3GEZA

Crystal structure of the hypothetical egulator from sulfolobus tokodaii 7
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gezA00
1DUXC 3HUGA 3L9FA 4RGSA 4I0BA 1I6XA 2D2WA 4KUMA 1BBYA 1G3YA 3HOSA 2GZWA 5FO5A 1FOKA 2M87A 2UXXA 5L3BA 4IVNA 3WGHA 4ETSA 1K6OA 2FSWA 5ICFA 3EDPA 2XAHA 3RKWA 5BOXA 1L3LA 4MTEA 2DLLA 4ZYDA 2W57A 3BZ6A 1LDKB 1XGOA 5JI6A 3T5XA 1ZG5A 3J80K 2O03A 1HKTA 3LQRA 3DP7A 2Z9OA 3G3ZA 4ZZLA 2MBFA 4UV8A 3IL2A 3I0TA 3NQOA 4CO8A 3CTAA 3K2ZA 3J81K 2L4AA 1MJAA 2DQRA 2M45A 5BMZA 4YFNF 4HQMA 1I5ZA 3I59B 2EA2A 2KIMA 2HYFA 2VC1A 2NNNA 4WXDA 1Q1HA 3I5UA 2DK5A 2PQ8A 1Z6RA 4HYEA 2MH9A 2K02A 1FYKA 1RNLA 2DPUA 4L9TA 2DQLA 5TJJA 3R0AA 1FYMA 5FLXZ 4RB3C 1QQIA 4M72A 1YW7A 2V1UA 1RZ4A 1HSJA 5LRRA 2FBHA 3BDDA 3BJOA 4GXOA 4QLCU 2MH2A 4Q48A 5LEJA 1G4DA 1FY7A 2ELHA 2W84A 4ON0A 4M6XA 5JVTA 4MEXF 2DI3A 1LEBA 1B4AA 1FBUA 3ZMDA 3WTTC 4KA4A 4HV5A 1HXDA 3LA2A 4M9XA 2VT3A 3GFLA 4MNUA 2V79A 3GWZA 3FHZA 4OIQF 2TDXA 3P9KA 2PJPA 4UV9A 5LBQA 5BPDA 1IAWA 1G3SA 3WTWC 1UHMA 4HQEA 1I27A 2V9VA 2Y48A 3JTHA 2DT5A 5LHGA 2A6EF 2KIUA 1I1GA 3GF2A 4F7ZA 1DDNA 5AIQA 5CVIA 1XGNA 3K1NA 5HS8A 1IXRC 4EQQA 2K4BA 1T0FA 2ZNYA 4HF1A 1GVJA 2CQKA 1P6RA 5CVRA 2EJRA 2ZMEB 4LK1F 3EYIA 1SD4A 1H9GA 3HSEA 1IXCA 5CYVA 2O0YA 4HX7A 1S8NA 3V4GA 2KIFA 1ZHFA 4EGYA 4ZYGA 2M8EA 3C1DA 2Z3YA 4R8HA 4ASNA 1B1BA 3MCZA 2H6CA 2V1DA 1XMAA 2CYYA 2C6YA 2ESNA 4LD5A 2WC2A 4KYWA 3B73A 2JRTA 1P4XA 2XASA 4GCVA 2CO5A 2IT0A 1Z05A 3DV8A 2BBYA 3AAFA 3KP7A 1CGPA 3HHHA 3SZTA 2ZKZA 2HOEA 2OZ6A 2P8TA 3DPTA 1QO0D 3RTRA 5BQTA 4L5IA 4RB1A 2PBIA 3KP2A 4XBFA 2PEXA 1O7LA 2XUBA 1E2XA 4U7DA 2HWVA 4G6QA 1BI0A 3LQQA 4Q47A 1FC3A 4WX9A 2XV4S 1SFXA 1YS7A 3N4MA 3MAJA 2RC4A 3WGGA 5DYMA 1G3WA 1R36A 4RB0A 3P9CA 1KQ0A 3IWFA 2FRHA 1SMYF 1MDMA 4HV6A 2NAZA 1TLHB 3IRRA 3ABUA 1K78A 3WTVC 1REPC 1BI3A 4XLPF 4U0YA 1ONVA 1LB2A 1FNNA 2HEOA 1ZRDA 1IN5A 5DCMB 2XHKA 3KP3A 5HLIA 3RKYA 2A68F 2ACJA 1V4RA 1YFHA 5L3GA 4R79A 2D45A 5AONA 1B59A 4A6EA 1R7JA 2AXLA 4OMYA 2XROA 1TTYA 1KQ9A 3KP4A 5CVVA 3ZN1A 2FE3A 3BPXA 3GYHX 4FX4A 1USSA 5D6FA 3GUDA 2A07F 1J59A 5FGMA 5H6RA 2IRFG 3RDIA 3TO9A 5E1XA 3RYPA 3KLNA 4M9SA 4R1HA 3FMQA 4CDGA 4B8XA 2P4WA 1NHAA 1Y0UA 4OIPF 3EUHA 2ISZA 4RAYA 1OYYA 3O3KA 5HOOA 4EM2A 1MD0A 1HKQA 1ZN2A 2HR3A 4WCGA 3H3UA 2CG4A 2FA5A 3VODA 4FT8A 4ESBA 1QBJA 2P7VB 3CUOA 5DD8A 2PLYA 3VFZA 5J8CA 5K1YA 1J0RA 2BEOA 5D8KB 2FQ3A 3JAMK 2VOOA 1T6SA 1R22A 3QP6A 5JHUA 1YLFA 1QPMA 2VT2A 1KU7A 4JBAA 2IA1A 3F3XA 2DFIA 3HYIA 5ED4A 3R4KA 4HLYA 2D1HA 1XDUA 1JGSA 4LLGF 3WGIA 3KEOA 2LF7A 2YSRA 5HDKA 3QPTA 2EFWA 3GVAA 1FLIA 4ESJA 3RYRA 4O5VA 1ZGJA 2W85A 4AWXB 1LNWA 1P2FA 1ZG1A 4I09A 2FXAA 4BHCA 1FZPB 1U5TC 1FP1D 1IN6A 4QWQA 4S04A 1E17A 1U5TA 1R00A 1SD7A 5HDGA 4LG0A 1WSUA 1Z1DA 5ICCA 3F8BA 4L18B 2LSOA 4PDKA 4KICA 4L0ZB 1HKSA 3EQLF 4ZYEA 2K86A 3W6KB 4YIIA 3E5UA 4AIJA 3QU3A 1ZLJA 2E1NA 3WTSC 4G94A 2F5EA 4L0YB 5DV5A 2ISYA 4LB6B 1DP7P 5E8GA 5FD5A 2KRFA 2XAGA 4M6YA 4B09A 4PCQA 2VE9A 2P6TA 3GFJA 2JZYA 3IHUA 2IA2A 3BJ6A 1ON1A 2QENA 4KNYA 4LB5A 2RN7A 4A0YA 3CJNA 1H0MA 4A0XA 3E5XA 2P6SA 1OYIA 4MGRA 4N9IA 3ZMSA 4JK1X 2EK5A 1IZ1A 1T98A 3CUQA 1S7AA 1PP7U 4HF0A 3ZMZA 3LA7A 3U9GA 1Z91A 2K4JA 2O3FA 1W5SA 2ZFWA 3I59A 2BYVE 2NS0A 5ILVA 1KU2A 1HQCA 5D5VB 1YW8A 4ENNA 4Z2YA 4I02A 1S3JA 1IXSB 2VBXA 1CF7B 2DO7A 4LMYA 3LSTA 2VXZA 1S7OA 1W4MA 1XCVA 2F5CA 5A2QK 3TO6A 5D4RA 3KCCA 1R58A 2ZJ2A 3GO5A 4L5JA 3ELKA 2IW5A 1FYLA 1QGPA 5FB2A 1SD5A 2O8XA 1QZZA 4HX4A 4IF4A 2QQ9A 1LVAA 2QBYB 4K2EA 4MQ9F 3TO7A 3K69A 2VONA 3I54A 1YO5C 1MZBA 3MWMA 2CWEA 1U78A 4LFUA 4GO1A 5IT9K 4EJTA 4P9FA 1UHWA 3S2WA 2YX4A 5ILSA 4LJZF 4U7BA 3QP5A 3ZPLA 3SXYA 3T8RA 1FPQA 1BC7C 3L2CA 3DF8A 2GA2A 4LGWA 1IRGA 1FBQA 1BM9A 1TQPA 3R60A 1FP2A 3U2RA 3HSFA 2JPCA 4BAYA 3F23A 2HTSA 3FWEA 2E1CA 2FMYA 4Q4ZF 2EB7A 1P4WA 2ZMEA 2QM3A 2M5WA 4CYDA 3DFGA 2KJCA 4G7HF 1R23A 2XAJA 2A6HF 2L54A 3E97A 2UZKA 1ZLKA 2VN2A 1O3SA 3J7AO 4RGRA 1YIOA 4IRGA 4YFKF 2OZUA 2EWNA 2E7XA 3LAPA 1ZREA 2XVCA 1KU9A 4I01A 2FNPA 1XSXA 2QZ8A 4NQWA 4EM1A 2EA4A 1JHHA 1J75A 3ISPA 3J80Z 3SHFA 1DPUA 2ZO4A 2LNBA 3WU0A 3DPLC 2IPQX 3Q5FA 1WI9A 3KP5A 1HW2A 2MC3A 2PMUA 3WE2A 2DTRA 3SQNA 4HAMA 3M1EA 5F6FA 4A12A 3GXOA 4UUVA 3FMRA 2W24A 3HRUA 3J81Z 4OU0A 5E17F 1OKRA 1S6LA 4ESFA 3KETA 1RIOH 1TBXA 5HS7A 1ULYA 1KU3A 2PFBA 2NYXA 4N0BA 4JQFA 1SAXA 4AD9A 1XSDA 1L0OC 1YS6A 3T1BA 5IT9Z 4G6DA 5ERIA 3VB2A 2XGXA 2FNAA 2H27A 3VEPA 5D5XB 2XRNA 2DPDA 4IPAA 4TV7A 5F1RA 2XKOA 1W7PD 4P5OA 3K1MA 2A69F 3TOBA 4CICA 2DK8A 3V8JA 1FT9A 2HDCA 2G7HA 5DCMA 3JSPA 2Z5UA 3F6VA 3DKWA 1EH7A 4A6DA 1J2XA 3K0LA 3ZMUA 3QPHA 1ZGAA 3GW2A 3HSRA 3O6BB 3D5LA 1UCRA 2YR2A 1D8JA 3FXUA 4P96A 4KFCA 5CJ9A 1O3TA 4HDUA 4GYGA 1D3YA 2UXNA 1TNTA 2RV8A 1STZA 3HTSB 1BOAA 3F8CA 3M8EA 3GZ5A 1TW3A 1A04A 3BY6A 2HQNA 3L00A 1HBXG 3FX3A 2L02A 2IVMA 4RS8A 1LQ1A 5HLHA 4U0VA 1OR7A 4NB5A 1ZRFA 3KLOA 3QU6A 4GYIA 5TRDA 4KMFA 2V1XA 3IKVA 3Q9SA 4AIKA 2MLGA 3KZZA 2UWMA 1YG2A 2OA4A 1GHCA 4KMUX 1T38A 2DAOA 3Q9VA 5JFRA 1ON2A 5DUIA 4OINF 3HRSA 2L3DA 1J7KA 2BE5F 2K27A 3R0JA 4NHJA 2F5DA 1XSVA 1O3QA 3DQVC 4RGUA 4CGZA 3GX4X 4IHTA 2J5OA 3TGNA 1ZG3A 1B9NA 1XD7A 3V7CA 4ENJA 4HBLA 1T39A 1K78B 3JTGA 2BGCA 2HS5A 1JHFA 1KA8A 2H94A 1G6NA 5L3FA 1RUOA 1ZH5A 4YFXF 2CSOA 2MA3A 3FZVA 1R5HA 4LLLA 2R7FA 3GFIA 5L3EA 1BIAA 4G8XA 3I71A 5AIPA 3C7JA 2VBYA 3DXJF 2X0LA 4I7HA 6PAXA 3GLXA 4ZH4F 2HKOA 2QQAA 2DW4A 4YIFA 4BYYA 1FSHA 1GXPA 2PMHA 2Y0MA 5HLGA 1DPRA 3BROA 1AWCA 3CLOA 3LFKA 5BPIA 4KDPA 2G7UA 1WKMA 2HYGD 3E6MA 1YYVA 2PN6A 3ZP5A 3PQJA 3F6OA 1R1VA 5LHIA 1BI1A 2COMA 2VE8A 3ZMTA 2WWYA 4EJVA 5KK1A 1S29A 4L9JA 2M30A 2FOKA 1UB9A 5D5UB 2PI0A 2HTJA 5CVJA 4EMSA 3KEQA 1SD6A 3DEUA 3LA3A 4A5MA 5KVRA 3N97A 3F8FA 2FMLA 3LWFA 1Z6TA 4EJOA 4HF2A 5JR3A 2ESHA 3K9TA 4O6JA 1G3TA 1QZYA 4CXFA 2A61A 4GGGA 5HVQC 5H6QA 3BJAA 2D1VA 1CF7A 1F4KA 5E20A 1IN4A 5LGNA 2IP2A 2HKXA 2XAQA 3E6CC 1UFMA 3RPUA 2RQPA 5LHHA 4UVAA 3E6BA 3WE3A 1IF1A 1H9TA 2VODA 1FWZA 1EH8A 5FFXA 2LKPA 5J8FA 5DUKA 1ZAOA 3ZMVA 3M8FA 1LJ9A 3T0YA 1XGSA 4FX0A 2A3SA 2ZBKA 1U3EM 2QBYA 2PG4A 3CUQC 3T8TA 3JAMZ 3RIRA 2O61A 4IRIA 1X3UA 5D5WB 3WTZA 3FM3A 2JTVA 3OOPA 3ERED 1XB4A 2JSCA 1K79A 1V3FA 3MZYA 2OD5A 3FXQA 1U5TB 4I2OA 3MQ0A 4LG0B 4KIGA 4IHSA 3M9AA 4I98B 2CGPA 2VC0A 4U0WA 3I4PA 5D4SA 1FX7A 2QVOA 1HW1A 2EV5A 1BI2A 2MLKA 4LK0F 2R3SA 1U8RA 3F22A 4L9VA 1FBSA 3E5QA 1W7PB 3CO7C 5IT3A 3HIFA 4WK8F 4HX8A 2V6CA 3I64A 1IW7F 5J6XA 1OPCA 3NRVA 2GQQA 1OYWA 1XCBA 3ECHA 2STWA 4Y17A 5E1ZB 4BHPA 3CUQB 3IKTA 1XMKA 2WV0A 4U88A 3WTYC 3FM5A 3B02A 3TDZC 3ZQ7A 2FEZA 3P9IA 2KKOA 2P7CB 4ZZDA 5CVUA 1F9NA 3O2PE 4I0AA 3EYYA 4XRFA 3JW4A 4DQ2A 5LGTA 4BNCA 5E8IA 2FBIA 4PZJA 1J9IA 5E1WA 2ZXJA 3MZHA 2CFXA 4HA8A 2F2EA 4G9YA 2F5FA 2DBBA 5HS9A 2P5KA 4EGZA 1D5VA 2HZTA 3CO6C 2B0LA 2HQRA 4YG2F 3R6SA 2QLZA 1O57A 3FMSA 2YX7A 3REOA 3RKXA 3C18A 1WQ2A 3IRQA 4WXHA 2GXGA 1JE8A 1F5TA 3KE2A 5HDNA 3R61A 1GXQA 1USTA 4XLNF 2NNYA 3MEXA 2O6GE 2XIGA 4A0ZA 4UNOA 1BIBA 3CDHA 3HHGA 1R1TA 2ADUA 4M74A 4AVPA 5A2QZ 1OMIA 2XKPA 3HTUA 1P4AA 5ICEA 1O3RA 5EEGA 4UHTA 3ULQB 3QRFF 2JT1A 1QNTA 3TKYA 2EFNA 1RUNA 2IA0A 3JSOA 4RB2C 1HW5A 5D6EA 4WF2A 1ODDA 4A5NA 2GIVA 4AIHA 5K5OA 3KFWX 4BQAA 3TQNA 3H92A 1U6GA 3QAHA 2K7LA 5K5QA 1RI7A 4M71A 5F64A 5L3DA 4HW0A 3HOTA 3K1PA 4P55A 4Y15A 5DEQA 2VBWA 1SFEA 5L3CA 1XDSA 2Q0OA 1K7AA 3RI4A 2Q2EA 2G9WA 2Q8KA 2Z33A 4EM0B 4KIFA 1R1UA 2X4HA 2YU3A 2GWRA 1IN7A 3FXRA 3SFZA 2Y75A 5DCFA 2OQRA 1ZARA 4UXNA 4EV0A 5FFZA 3TOAA 5LLQA 2OU2A 2YPRA 4PGGA 2DU9A 2HGCA 3W6JB 3OV8A 2LDUA 3HRMA 1XN7A 3KZYA 4BHBA 2LF8A 3G73A 4MEYF 4FHTA 2E7WA 3F8MA 2GAUA 2MD5A 3F8NA 2ZNZA 3IWZA 1U2WA 1XGMA 5ICGA 3ECOA 3D0SA 2FF4A 4MTDA 3V7SA 4EJWA 3I53A 5ILUA 1BJAA 2EFOA 1LDDA 5FD6A 4ENKA 1AOYA 2GXBA 2JPBA 4MHGA 4HZFA 5H20A 2RVCA 5K5RA 1WWXA 4XSXF 5DD4A 4UVBA 2STTA 3WODF 2P5LC 4KIBA 4KT5C 2RDPA 3GEZA 2QWWA 4HDVA 1TQMA 2BV6A 1TQIA 2IJLA 3M7GA 2P5VA 1D8KA 5D8LB 3WU1B 3BWGA 2GA1A 1SFUA 1EV7A 3MFKA 2L01A 3PFIA 1LEAA 4LLNA 2EFPA 3HRTA 4RGXA 1T2KA 2VBZA 3WTUC 4G7ZF 2WTEA 1F1ZA 3L09A 3V8LA 4EVIA 1KYWA 3F21A 1P92A 2H6BA 1BN5A 1WRJA 4EJUA 2A5YB 3PQKA 3QOPA 3GFMA 2VOPA 3BPVA 2EV6A 1MDMB 2KJBA 1SMTA 4M73A 2AS5F 4A2UA 2W25A 4MQVA 2XAFA 4RAZA 5EEHA 1ZRCA 3BOQA 3RJPA 4WWCA 1PDNC 1IRFA 3E3VA 3ML6A 3I58A 4L9NA 1IUYA 4Y13A 4OMZA 5DDGA 2EFQA 1FSEA 1J5YA 2OQGA 5E18F 3V8KA 4G7OF 3L7WA 2EV0A 1BC8C 4XSZF 2ZCWA 4H0EA 4Q5SF 3C3WA 1PUEE 1YTYA 4IJAA 4D0PA 3RPQA 4KN7X 1KGSA 1MJ9A 4UVCA 3F72A 3GZ6A 1I1SA 3ROUA 3U1DA 2RNJA 1B6AA 2RGVA 2QYOA 4WXCA 3LAJA 3WG9A 3KP6A 3NEUA 4BH9A 4ZYHA 1TW2A 2OBPA 4IRHA 1TNSA 1LDJA 1R5GA 2M1BA 3WTXC 1EH6A 1KYZA 3E6DA 4S05A 1VTNC 4CZZA 1C0WA 2L4MA 3BP8A 5BS6A 4OOIA 4HLXA 1Z7UA 3H3ZA 4N9HA 4CHUA 4IXAA 2CW0F 1Z9CA 2ETHA 1MKMA 1MGTA 3P7NA 4ENMA 4HOBA 3FF5A 4P9UA 4E70A 3ZN0A 5CLSA 1W7PA 5LRSA 1PP8F 3TDUC 1HSTA 3COAC 2Z99A 1IN8A 3IC7A 3V7RA 5LGUA 4O3MA 5FLXK 4OIOF 1MJBA 2H09A 2RKHA 2OAZA 2R7DA 4OIRF 1KQ8A 2NRAC 3ABTA 1YQAA 3VOEA 5LEKA 1O7FA 4KN4X 2J5PA 1B9MA 4BXUA 4DNCA 3SZPA 1W5TA 1YW9A 3EETA 4M9ZA 2FU4A 4PGHA 1JXSA 2HFHA 1ZYRF 2QUFA 2QQBA 2FBKA
chains in the Genus database with same CATH superfamily
4A3GJ 1B72A 4E7LA 1DUXC 3OYJA 3HUGA 1W36C 3L9FA 1Y1WJ 4RGSA 3PIPF 4RA2A 4I0BA 4RMNA 4DBRA 4KT6A 1I6XA 2D2WA 3D5RC 4KUMA 1BBYA 1G3YA 1R4NB 4BDZA 4RAGA 2QCOA 2K85A 2E1OA 3HOSA 3NWSA 1A35A 2GZWA 5FO5A 2E1MB 1FOKA 1DGWY 2M87A 2UXXA 3TL4X 3H9QA 1TWCJ 3LOCA 3KZIC 5L3BA 1D5YA 4LIUA 4IVNA 3WGHA 5HODA 4ETSA 2DJIA 1JKOC 2PX9A 2HZDA 2VJ5A 5HLTA 1K6OA 3BR1A 2HDDA 2AO9A 2FSWA 5ICFA 3EDPA 2XAHA 3RKWA 9ANTA 5BOXA 1L3LA 4MTEA 2DLLA 1SFOJ 2GLOA 4BL0B 2W57A 4ZYDA 2JJ7A 3BZ6A 5E3LA 3SFIA 1LDKB 1XGOA 4XN0A 5JI6A 1X58A 2DOFA 3T5XA 3S1RJ 1ZG5A 4YIRX 4IZZA 3J80K 1TWFJ 2O03A 3H35A 1HKTA 3LQRA 5IP6A 4LG3A 3DP7A 2Z9OA 3HGYA 2ZJRF 3G3ZA 1VQ4I 1ETQA 4ZZLA 2MBFA 1OLTA 1IUFA 1VZ0A 4UV8A 2A5WA 2NVXJ 3PUFA 1E3HA 3G4SI 3IL2A 3I0TA 3NQOA 4CO8A 3CTAA 3OYHA 3JRIA 3K2ZA 1MH4A 3J81K 2L4AA 1MJAA 4XORA 3H0DA 2BVMA 2DQRA 5B66C 1LVKA 2M45A 5BMZA 1TZLA 4YFNF 4HQMA 1MBFA 2BXZA 1I5ZA 3I59B 3O8GA 2EA2A 2KIMA 2HYFA 2VC1A 2NNNA 2B9SA 2XPUA 1AA7A 2CQNA 2QKLB 4WXDA 5E3MA 1Q1HA 3I5UA 2DK5A 2PQ8A 3N05A 1Z6RA 4HYEA 2MH9A 2K02A 4RLFA 1FYKA 1RNLA 2R7QA 3CJRB 2DPUA 4L9TA 1WJEA 2BW3B 3FBIB 5EDNA 2DQLA 5TJJA 4AYBA 3R0AA 4EATA 1FYMA 3FXJA 4OAYA 1MH3A 5FLXZ 3IP4B 2L7FP 3AG1H 2Y69H 4RB3C 1QQIA 4M72A 1YW7A 2V1UA 3CCEI 2B63J 1RZ4A 1B8IA 1HSJA 2E36A 5EG0A 3FISA 5LRRA 1V5FA 2FBHA 3BQYA 2CH0A 3BDDA 3BJOA 4GXOA 1VI0A 2XF6A 4QLCU 2MH2A 1VQPI 4X6AJ 4Q48A 5LEJA 1T8IA 1G4DA 1FY7A 1SANA 2ELHA 4D9JA 1TWAJ 1QRYA 2W84A 4ON0A 3LSJA 2LMDA 5J47A 4M6XA 4XKCA 2B7EA 2JA8J 3FXOA 2FOWA 5JVTA 2L9SA 4MEXF 2DI3A 2LK2A 1LEBA 1AU7A 2DMQA 1B4AA 1FBUA 1QVUA 2VKDA 2IXSA 3ZMDA 3WTTC 1AKHB 4KA4A 3OR1C 2KLOA 4HV5A 2DDAA 4PSXA 3CCYA 1V54H 1HXDA 4II2A 3LA2A 3ZQIA 2QEXI 4M9XA 3E0JB 2VT3A 3GFLA 4MNUA 4MIMA 2V79A 1X2MA 3GWZA 4Y3OA 2R5YA 3FHZA 4OIQF 2E19A 2TDXA 2KP6A 1D0XA 3P9KA 2PJPA 4UV9A 4CCLA 5LBQA 5BPDA 2LC2A 3OYDA 1IAWA 1G3SA 3WTWC 1UHMA 1UZCA 3W2VA 4HQEA 2DMTA 1I27A 1WH5A 3A03A 2V9VA 5GAGJ 4XLAA 2Y48A 1Y0NA 1H8AC 1OCPA 2LBFA 1DGRM 3JTHA 1YIJI 2VUMJ 4PJMA 4B4CA 2DT5A 4FASD 1GT0C 5LHGA 4DYRA 2A6EF 4I99C 2KIUA 3ZQGA 3JR9A 3GLLA 2WBMA 1NH3A 1XG1A 1I1GA 4E7SA 3GF2A 4F7ZA 1DDNA 2L0KA 2MYSA 5AIQA 3BZCA 5CVIA 1XGNA 4AUXA 3OYKA 4HRIA 3K1NA 5HS8A 1IXRC 4EQQA 3I9V2 4G12A 2K4BA 1T0FA 4IOCF 2PJRA 2ZNYA 4HF1A 3OSFA 1GVJA 1IGNA 1P6RA 2CQKA 1ZQ3P 1T56A 5CVRA 2EJRA 2ZMEB 1OCOH 3B6AA 4LK1F 3EYIA 4V2GA 3KEYA 3VSKA 1ETOA 3JCUC 4UB6C 3F9KA 1SD4A 5JHFA 1H9GA 2X1EA 1PUFB 3HSEA 2CV0A 1IXCA 4M3DA 5CYVA 2O0YA 3CC2I 2UV1A 3K70D 1VQ8I 2OV7A 4HX7A 1S8NA 3H5AA 2K9MA 3V4GA 2KIFA 2QSGX 1ZHFA 4HNVA 4EGYA 5KAIC 4ZYGA 2M8EA 3C1DA 2CUFA 3MKYB 1U8BA 3Q0WA 2Z3YA 4R8HA 4ASNA 1B1BA 2D5VA 3RPUD 3MCZA 3OYFA 1Y8QB 2H6CA 2JUGA 2V1DA 3CMEI 2IS4A 3DEWA 3D1NI 2HVRA 4UUSB 1XMAA 2CYYA 4NC7A 4BU2A 4GDFA 2C6YA 2ESNA 4XKVA 3S3MA 4XKWA 1E3PA 1MBJA 2WC2A 4LD5A 3B73A 2JRTA 4KYWA 3X2QH 4QPQA 5EYRA 1MBKA 1P4XA 1XS9A 2XASA 3L2RA 3CCUI 4GCVA 1QZEA 2CO5A 2IT0A 1I39A 1Z05A 3DV8A 2BBYA 2L7ZA 3KP7A 3AAFA 2Y30A 3G2BA 2VQCA 1CGPA 2IS2A 2I5UA 3HHHA 3WHBA 4PK4A 4AU7A 3QYFA 3SZTA 2ZKZA 2HOEA 2OZ6A 4BE1A 3SZGA 1DQUA 2P8TA 3DPTA 1QO0D 4JX4A 3RTRA 2L2OA 5BQTA 2WADA 4L5IA 1R5ID 5F27A 4RB1A 3W6VA 2PBIA 3KP2A 4XBFA 1EJ9A 4PUSA 2EZIA 2Z16A 2PEXA 4JX6A 1O7LA 2XUBA 3H5RA 1E2XA 2DT7B 2EILH 4A3BJ 4U7DA 2HWVA 2L5QA 4G6QA 1BI0A 3LQQA 2M3AA 1FC3A 4Q47A 4WX9A 3S1QJ 2QGUA 3BR0A 2XV4S 5GPAA 1MNEA 2OJED 1SFXA 1YS7A 3N4MA 1U0JA 3CMAI 3MAJA 2RC4A 3WGGA 5DYMA 1OCCH 5FJ8J 2KZGA 1W36D 1G3WA 1R36A 4RB0A 4BS9A 2VJIA 4RM2A 1G2HA 2F4OB 3P9CA 4RLQA 3BR6A 1KQ0A 4XLFA 1CQTA 3IWFA 2FRHA 1SMYF 1MDMA 4HV6A 2NAZA 4XL9A 1TLHB 4ZDOA 2Q2EB 3IRRA 1LKXA 3M3YJ 3ABUA 1ERDA 2COBA 1K78A 1J09A 3WTVC 3S93A 1REPC 1BI3A 4XLPF 2VKHA 4U0YA 4XLCA 1R9TJ 1D1AA 2K40A 3WU2C 2DTZA 5IPAA 1ONVA 1LB2A 3FKIJ 1FNNA 5FKNA 2HEOA 1ZRDA 4IO9F 2KDOA 1IN5A 3H9JA 3S16J 1D1CA 5DCMB 3GBGA 2XHKA 3KP3A 5HLIA 3RKYA 4CA0A 2HXIA 1YRNA 4L5EA 2A68F 2ACJA 1V4RA 2R5ZB 1YFHA 1GLNA 1MBGA 1BA5A 5L3GA 3IV5A 3S14J 4R79A 2D45A 5AONA 1B59A 2EIKH 2AHQA 4M3EA 3PNVA 4A6EA 3CMMA 3A2KA 2XPVA 4PJLA 5IYBJ 1R7JA 3ZXSA 3UKGA 5F0CA 3OYGA 1WJ5A 2AXLA 4OMYA 3SJMA 5B5EC 4AYBN 1LE8B 2XROA 2DFFA 3B6CA 1I3QJ 2IEKA 1TTYA 1KQ9A 4DBQA 1WJFA 1HLVA 1YE9A 4BY1J 3ZQQA 2F4IA 3KP4A 1SVLA 3AL0C 5CVVA 2GOXB 3ZN1A 2FE3A 3BPXA 3GYHX 4FX4A 1USSA 1MW7A 3GUDA 5D6FA 2OTLI 1WZ2A 3IAM2 1LUJB 2E5ZA 2GBYA 2M7AA 2VJ4A 1J59A 2A07F 3L2WA 3HXLA 5FGMA 1K6YA 3CC4I 1OFCX 2VJJA 2EZLA 3DBLB 5H6RA 1W0TA 1ZGWA 1K83J 2G0EA 3FKJA 3LL7A 2V26A 2GXAA 2IRFG 3RDIA 3TO9A 3BZKA 5E1XA 3RYPA 1K4SA 4PFPA 3KLNA 5CPRB 3SYTA 4M9SA 3G6EI 4CYCA 4R1HA 3OIPA 3FMQA 3TP0A 2JA5J 4CDGA 3OYAA 4B8XA 1FMVA 2P4WA 2W4SA 1NHAA 1Y0UA 4OIPF 3EUHA 2LOOA 2ISZA 4RAYA 1OYYA 3DU6A 3K7AJ 4FQGA 1VF9A 2XB5A 1APLC 2FQ4A 2L9VA 3O3KA 5HOOA 4EM2A 1MD0A 4BQNA 1FIAA 4HEA2 1HKQA 5GAEJ 1ZN2A 5JVGF 2HR3A 4WCGA 3H3UA 1X1AA 2CG4A 2FA5A 3GCMA 3JRBA 5EZGA 1BR4A 4W1UA 3S3NA 3VODA 4A3LJ 3A01B 3DEEA 2E71A 1GV5A 1I50J 4FT8A 3BTJA 5F0FA 4ESBA 1QBJA 2P7VB 3CUOA 5DD8A 3W3CA 2PLYA 3VFZA 4F3QA 5J8CA 1DP3A 2CMPA 4HSTA 5K1YA 1J0RA 4OWRB 2BEOA 4XLEA 5D8KB 2FQ3A 3JAMK 4CCKA 2VOOA 5J3LA 2O9LA 1T6SA 4DZPA 1R22A 2UUZA 3QP6A 5JHUA 3A02A 2EBIA 1YLFA 3FDYA 1K4TA 1NTCA 1FTTA 1QPMA 2XRLA 2VT2A 1KU7A 3HOZJ 4JBAA 2IA1A 2XGEA 3F3XA 3G1LA 2ZFUA 3O8HA 5DTDA 3HOWJ 2DFIA 3HYIA 5ED4A 1HC8A 3R4KA 4IL6C 2R7TA 3PNYA 4C2UA 4HLYA 2D1HA 1XDUA 2DA5A 3G1OA 2F48A 4Y4RA 1JGSA 4LLGF 2BXYA 3WGIA 5J4YA 3KEOA 2LF7A 2YSRA 1DU0A 2EINH 1X1CA 5HDKA 3HOUJ 2JVHA 3QPTA 2EFWA 3DPUA 3GVAA 1FLIA 1VQKI 4ESJA 3RYRA 4O5VA 4A3CJ 1RESA 1ZGJA 2W85A 3HB9A 4AWXB 2P0WA 4CUGA 1LNWA 1P2FA 5B3SH 5IYCJ 1ZG1A 1FTZA 3GMEA 4I09A 1UAAA 3KYDB 2FXAA 3M1CA 4BHCA 1X1BA 3I3LA 1FZPB 1U5TC 1FP1D 2CRGA 2YUSA 1IN6A 2BZTA 4QWQA 4S04A 1E17A 1U5TA 1R00A 1SD7A 5HDGA 3PIOF 4LG0A 1HDPA 1WSUA 1Z1DA 5GAHJ 5ICCA 4ZC3A 2E34A 3F8BA 4L18B 3I56I 4X1EA 2LSOA 1WJBA 4KICA 1QHGA 4PDKA 1HKSA 4RDUA 4L0ZB 1ETYA 1U9NA 3EQLF 4ZYEA 2K86A 2Y2ZA 3VWBA 3W6KB 3H1CA 4YIIA 3H0GJ 2JMWA 3E5UA 4F92B 4AIJA 2EIJH 1GVDA 4IKFA 3GTMJ 3QU3A 2ZB9A 1IV8A 1BW6A 3M4OJ 1V5GA 1XX5A 1ZLJA 2RNGA 2E1NA 3RQ4A 2XDVA 3BG3A 3WTSC 4G94A 2F5EA 2WAEA 4OAZA 4RAFA 4L0YB 5DV5A 1YI2I 1GV2A 2ISYA 4B3AA 3AG3H 2VQLA 4LB6B 1DP7P 2ELJA 5E8GA 3Q0UA 1ITYA 3C2BA 1LFPA 1KZHA 2VI6A 3ZR8X 1N78A 1MBHA 5FD5A 2KRFA 1I3AA 3LNQA 2XAGA 4M6YA 4B09A 4PCQA 3PO3J 2VE9A 2P6TA 2JA6J 3GFJA 2JZYA 4C3JJ 1UELB 3IHUA 2R7ZJ 4PJJA 3IH2A 3CCMI 2IA2A 2V9KA 3L2VA 4ITVA 3BJ6A 3BCBA 1ON1A 3FK6A 2H1LA 2QENA 4KNYA 4LB5A 3ESWB 1A6QA 1RRJA 2RN7A 4A0YA 3CJNA 4NNJA 5J40A 1H0MA 4A0XA 2CUJA 2JRMA 3E5XA 2VL8A 4X0GA 3DBRB 2P6SA 1OYIA 4GFBA 3J7YJ 4MGRA 4N9IA 3ZMSA 1BJZA 4BDYA 4D7MA 4JK1X 2EK5A 3LSKA 3VYUB 1IZ1A 1T98A 1G59A 2NS7A 3CUQA 1S7AA 2XC7A 1PP7U 4FISA 1XPXA 4HF0A 3ZMZA 1VQ9I 3LA7A 3U9GA 1Z91A 2K4JA 4YRVA 2R7VA 2O3FA 3S17J 1W5SA 2ZFWA 3I59A 4BEHB 2HVSA 2BYVE 2NS0A 3V42A 5ILVA 4XICA 4ZTJA 1KU2A 1HQCA 1JUPA 1TWHJ 3OYCA 3BLYA 5D5VB 1YW8A 3BTLA 4ENNA 4Z2YA 4I02A 1S3JA 1IXSB 1UHSA 2VBXA 1CF7B 2DO7A 2R7WA 1R49A 3J7ZI 4LMYA 2R93J 1WH7A 3LSTA 2VXZA 1S7OA 4A3FJ 3IH3A 3CD6I 1W4MA 2HPIA 4FE4A 1XCVA 2F5CA 5A2QK 4UUTA 3TO6A 5D4RA 3MKZA 1HOMA 1D0YA 3KCCA 1R58A 1W5CC 2QSHX 2ZJ2A 3GO5A 3NWTA 4L5JA 3CDLA 3S15J 4D1QA 3K4JA 3OMYA 3ELKA 2IW5A 1FYLA 1QGPA 2EZKA 4XRSA 1YHQI 4MFDA 5FB2A 3TP3A 2R92J 1SD5A 2O8XA 3IH4A 3S8PA 1QZZA 4HX4A 4IF4A 2QQ9A 1LVAA 2QBYB 4N4OB 4K2EA 2KPMA 1JUSA 4AIDA 4MQ9F 3K69A 3TO7A 1WPKA 2VONA 2YS9A 3I54A 1Z3XA 4CH7A 2KISA 4NC6A 1YO5C 4UY8I 4JX5A 2CW8A 4BBRJ 1NK3P 2R0QC 1MZBA 1VQOI 5K7ZA 3MWMA 1ZR2A 2CWEA 1U78A 2ZJPF 3HUGB 4LFUA 4IQJA 4C2TA 4J19A 4GO1A 3JRCA 2ZJQF 1NG6A 3LSHA 1IJWC 5IT9K 3K10A 3SEQA 2NOJB 2LR8A 2AQFA 4EJTA 4P9FA 1UHWA 3S2WA 1IDZA 2YX4A 5ILSA 4ABZA 5GTHC 4LJZF 4U7BA 3QP5A 4A3MJ 1X3ZB 3ZPLA 4C3HJ 3SXYA 4A3EJ 3T8RA 2X6XA 1FPQA 5E79C 1BC7C 1JI8A 3TW7A 3L2CA 3E7LA 1X1DA 3DF8A 1R4MB 4ZJZA 4PFOA 4ZDLA 2GA2A 4LGWA 1IRGA 1FBQA 1BM9A 4A3IJ 1TQPA 3DBHB 3R60A 1FP2A 1GDTA 3U2RA 3HSFA 3K2AA 2JPCA 4BAYA 5CQGA 3F23A 3HGGA 2O8KA 5FLVA 1QU3A 2HTSA 3FWEA 2E1CA 1MIJA 2OF7A 3L2UA 3HJEA 1JJ6C 2Z2SB 2FMYA 1P9QC 4DIQA 4Q4ZF 2L9NA 2EB7A 2TRTA 1P4WA 2W7NA 2ZMEA 3CMYA 1SC7A 1P7IA 2NVYJ 2M5WA 2QM3A 3DFGA 4M3BA 4CYDA 2KJCA 2E2JJ 1WFXA 5FKMA 1PUFA 4II3A 5E3NA 4G7HF 4J00A 1R23A 1JTXA 2XAJA 2A6HF 2L54A 3E97A 2UZKA 1ZLKA 3HKZN 3BTIA 2VN2A 2ID6A 1POGA 1O3SA 3J7AO 4RGRA 3U1KA 3S3OA 2DA2A 3HDDA 1YIOA 3K4LA 4IRGA 3ZCOA 3L2QA 1MBEA 2DMPA 4YFKF 2OZUA 2EWNA 2XGCA 2E7XA 2L7MP 3LAPA 1ZREA 2XVCA 3PSIA 1KU9A 4I01A 2FNPA 1Y6IA 1XSXA 1Z21A 2QZ8A 1YJWI 4NQWA 4DZJA 4EM1A 5GPCA 5FLMJ 2DT6A 2WAQA 2EA4A 2K9LA 2E5NA 3F0CA 3JRGA 1JKPC 1JHHA 1J75A 3ISPA 3J80Z 3SHFA 1DPUA 2ZO4A 1HA8A 2HNHA 2LNBA 1JKQC 3WU0A 2R7SA 3VYRB 3DPLC 1WJAA 1TWGJ 2IPQX 1N77A 3Q5FA 2LREA 1WI9A 3CLQA 3KP5A 1HW2A 2MC3A 2PMUA 3WE2A 4CCJA 2DTRA 1T0FC 4D5CA 3SQNA 1GUUA 1B8IB 1RR8C 4HAMA 3M1EA 5F6FA 4A12A 3GXOA 1OISA 5EG0B 4UUVA 2FUG2 2Y0SA 2F4MB 2FX0A 2W24A 3FMRA 3HRUA 3J81Z 2WY8Q 2MABA 3ZQLA 4OU0A 5E17F 1OKRA 4MO7A 1S6LA 4ESFA 3KETA 1RIOH 5C3EJ 4KJZA 2HQAA 3FK7A 1TBXA 2QA4I 5HS7A 1ULYA 2K9SA 1KU3A 2PFBA 3KYCB 2NYXA 4N0BA 4JQFA 1SAXA 4YELA 4AD9A 1XSDA 4XOPA 1UG2A 1L0OC 3I4MJ 1UJ8A 2X1DA 1YS6A 3T1BA 5IT9Z 1HCRA 4G6DA 5ERIA 3VB2A 2XGXA 2FNAA 5CKTA 2H27A 3VEPA 5D5XB 2XRNA 2DPDA 4E7HA 4IPAA 4F52A 4TV7A 5F1RA 2XKOA 4XONA 1W7PD 2R5YB 1HF0A 4P5OA 3K1MA 2A69F 3TOBA 1S72I 2LG4A 4M3FA 2DK8A 2DOEA 4CICA 2DA3A 5IOZA 3V8JA 2LH9A 1FT9A 2HDCA 2LFBA 2O7OA 2G7HA 5DCMA 2LKXA 3JSPA 1R71A 2KMUA 4U87A 2Z5UA 3F6VA 4Y7NJ 1T95A 3DKWA 1EH7A 4A6DA 1MMNA 4CCMA 1J2XA 5J1RA 2BHYA 2M9HA 5TGTA 3K0LA 3DKYA 3ZQFA 3ZMUA 5JLWA 3HM5A 3QPHA 1ZGAA 5H2FC 2LBFB 1IG7A 3GW2A 3HSRA 3MZ8A 4D5FA 1ETWA 3O6BB 1X1PA 1Y8RB 3D5LA 1UCRA 3H5NA 2YR2A 1D8JA 3FXUA 3CESA 4P96A 2E60A 4KFCA 2R7UA 1LE8A 5CJ9A 4AVZA 1E0EA 4DGWB 1O3TA 2M0MA 2ZXHA 2CQXA 1UG0A 4AC0A 4HDUA 1BR1A 5C4XJ 2X6WA 3DKXA 3PO2J 2M8GX 2IGNA 4GYGA 5KNLA 1FMWA 2MD0A 1D3YA 2UXNA 1FOXA 4QSHA 1TNTA 3DTIA 2RV8A 3HL2A 4GRIA 3HBLA 3CQZJ 2IS1A 1STZA 1Y56A 3ZGKA 2A6TA 3EUAA 3QODA 1ACIA 3HTSB 1MMSA 2JA7J 1BOAA 3F8CA 3M8EA 3OWTA 2ME0A 2VQHA 3GZ5A 2WAFA 1TW3A 3HOYJ 3C2HA 1A04A 3CJQB 3BY6A 2HQNA 3L00A 4QTRA 2XPWA 1HBXG 3FX3A 2L02A 2IVMA 3JREA 4RS8A 1FOWA 2IGKA 1LQ1A 4C9YA 3RQIA 2H8RA 4XN3A 5HLHA 2HOAA 4U0VA 5LD2C 1SEUA 1OR7A 2JSPA 4NB5A 1ZRFA 3KLOA 2CW7A 3RZDJ 1VNDA 2LLKA 3QU6A 4GYIA 3SDBA 4E7IA 2JQ7A 5TRDA 4Y52J 1WJDA 3AKZA 2V1XA 4KMFA 2MSYA 3IKVA 1R6RA 1JT6A 1RR7A 2ECCA 2X9DA 3KYLA 3Q9SA 3JRDA 2YU9J 4G6TB 3OSGA 1MSEC 4AIKA 1QHHD 5KHDA 5M5WJ 1D1BA 2NVUB 2MLGA 3KZZA 2M4GA 2UWMA 3KX2A 1YG2A 2OA4A 3S1NJ 1GHCA 3D5SC 3KPHA 4XLHA 4KMUX 1T38A 4AM3A 2DAOA 4XIDA 3Q9VA 5JFRA 5J4VA 1ZK8A 1ON2A 4LOCA 3PNTA 2F6CA 5DUIA 4OINF 3HRSA 2L3DA 1J7KA 2BE5F 3GTKJ 2K27A 3J7AY 3R0JA 4NHJA 2F5DA 2OPTA 1XSVA 3WHCA 1O3QA 2M4KA 3DQVC 2VPRA 5F04A 4RGUA 4CGZA 2ZXIA 4ZTFA 3JRAA 3GX4X 4IHTA 4BUPA 2J5OA 3TGNA 1IDYA 2KL4A 3AFHA 1ZG3A 4XRMA 3EUHC 5FROA 1B9NA 5DM6F 1BW5A 2DCEA 1XD7A 3ZQCA 1RKWA 3V7CA 2EH3A 1VQLI 4JOMA 4ENJA 2FD5A 1ZR4A 1G8XA 3QYBA 4HBLA 4PJ0C 3CCVI 1T39A 2OC6A 2HOTA 2CU7A 4FCYA 1K78B 3JTGA 5DS9A 4E6KG 4MFEA 2BGCA 4M3GA 2HS5A 5M5XJ 1JHFA 1KA8A 2H94A 1G6NA 3DTEA 5L3FA 1RUOA 2GIZA 4W97A 1ZH5A 4YFXF 2CSOA 2MA3A 3FZVA 1R5HA 3HPHA 4LLLA 2R7FA 2IBDA 3GFIA 5L3EA 3DLLF 1A6IA 4ZDPA 1ENHA 4IHWA 4HSRA 1BIAA 4G8XA 4BE2A 3I71A 5AIPA 3C7JA 3LSRA 2VBYA 1FEXA 1XC5A 2WAQN 2DA4A 3DXJF 2PMZA 2X0LA 4I7HA 3OYLA 6PAXA 1V5EA 3GLXA 4ZH4F 3S1MJ 2HKOA 2QQAA 2DW4A 4YIFA 2V7FA 2H8WA 2ICWG 4BYYA 1FSHA 1GXPA 2PMHA 2Y0MA 5HLGA 1DPRA 2X51A 2LVSA 3BROA 3A4CA 2ECBA 1AWCA 3BG7A 3AL0B 3CLOA 3LFKA 5BPIA 4KDPA 4FTHA 2G7UA 1WKMA 2X1CA 1PJRA 2HYGD 3S32A 3RSNA 3E6MA 1YYVA 2P81A 2PN6A 3ZP5A 3PQJA 2LRDA 2HI3A 1JTYA 3F6OA 1R1VA 5LHIA 4IQ4A 1BI1A 2COMA 3OYNA 2VE8A 3MVPA 3ZMTA 3BCAA 5EGOA 2WWYA 4EJVA 1OQYA 4CYCB 3QQAA 5KK1A 1S29A 4L9JA 2M30A 1T33A 1EA3A 4YEJA 3OS1A 3VDXA 2FOKA 1UB9A 4KISA 2JN6A 2E2IJ 2K3PA 4BKXA 5D5UB 1FJLA 2PI0A 2MC4A 2DDBA 4RBOA 3OYBA 2HTJA 3A0BC 2R4GA 3SDGA 5K7HA 5CVJA 1ETVA 4EMSA 2M0CA 3KEQA 1SD6A 2W00A 3DEUA 2Q1ZB 2LP0A 3LA3A 4A5MA 2QQ8A 5KVRA 3N97A 2I8DA 3F8FA 4XKBA 4Z6YA 2FMLA 3LWFA 1Z6TA 4V19K 3DLAA 4EJOA 2E1MC 2R7RA 4BQQA 4HF2A 5JR3A 2ESHA 3K9TA 4KITB 4BJ5C 1MMGA 4O6JA 5IOYA 1G3TA 3CP8A 1QZYA 4CXFA 3PL8A 2A61A 4GGGA 2OUMA 2QKMB 1VFCA 2EPFA 3HC7A 5HVQC 5H6QA 1A36A 4BGDA 2VXDA 3BJAA 2D1VA 1CF7A 1F4KA 2XSJC 5E20A 1ZKGA 1IN4A 1LFBA 5LGNA 2IP2A 2HKXA 2XAQA 3UR3C 3E6CC 1UFMA 3RPUA 3M07A 2RQPA 5LHHA 4BACA 4UVAA 3E6BA 3WE3A 1IF1A 1H9TA 3VPRA 2VODA 2DA7A 2CQQA 1FWZA 3FHNA 1EH8A 5J1UA 2IS6A 5FFXA 2LKPA 4HG2A 1A31A 5J8FA 5DUKA 1ZAOA 1O4XA 4CSWA 2QSFX 3GTOJ 2E35A 1FIPA 2BY2A 3ZMVA 2E2HJ 3M8FA 3DCFA 1LJ9A 4DYQA 4E4HA 1PYVA 3T0YA 1Z3YA 2ME6A 1XGSA 4FX0A 4DW6A 2A3SA 2ZBKA 5IY5H 1U3EM 2QBYA 2PG4A 3CUQC 4XMYA 3T8TA 3JAMZ 3RIRA 4BXFA 2O61A 4IRIA 1X3UA 5D5WB 4UB8C 1IV6A 3OYEA 3WTZA 3FM3A 2EQRA 5IP7J 2JTVA 3OOPA 3ERED 1XB4A 2JSCA 1K79A 3CF5F 1V3FA 2CS3A 3MZYA 4QPOA 2OD5A 5HNFA 4XQFA 3FXQA 1U5TB 4I2OA 3MQ0A 4LG0B 1EKEA 4KIGA 4DJAA 2KZVA 4IHSA 1Y1VJ 3K4MA 3M9AA 4I98B 2CGPA 2K3FA 4D7NA 4JP0A 2VC0A 4U0WA 1TT0A 3I4PA 3OYIA 2BW3A 1I6HJ 3GZNB 5D4SA 1WVRA 2V1NA 3EPZA 3S2DJ 1FX7A 1RETA 2QVOA 1HW1A 2EV5A 1BI2A 2K9QA 3PFYA 2MLKA 4PJNA 4LK0F 2R3SA 3BT9A 1U8RA 3F22A 4L9VA 2DODA 1N75A 1FBSA 3E5QA 1W7PB 1MMDA 3CO7C 3GTQJ 5IT3A 5FRNA 3HIFA 3JRFA 4WK8F 2O5RA 1XTAA 3K4CA 3JRHA 2HU9A 4HX8A 3BR2A 3C2GA 4A3KJ 3HPGA 5DM7F 2V6CA 4IHVA 3OYMA 3I64A 3G71I 1Z77A 2W48A 2M7BA 5M3MJ 2ID3A 1IW7F 1AKHA 5J6XA 1OPCA 3NRVA 2CUZA 4XNFA 2BOLA 2GQQA 2VIXA 1OYWA 2XB0X 2DA1A 1XCBA 1QVTA 5J1YA 2WA0A 3ECHA 1ZTRA 2JUCA 4C3IJ 1B72B 2STWA 4Y17A 2ZSHB 1Y39A 4A3DJ 2EIMH 5E1ZB 4BHPA 2VQGA 3CUQB 3IKTA 1TL8A 2I10A 1XMKA 2WV0A 1UMQA 5EJCA 1YX3A 4U88A 3WTYC 5K7FA 3RKQA 2R7OA 2CV1A 3FM5A 3B02A 3TDZC 4I6ZA 2ZXWH 4M6VA 3ZQ7A 2KQRA 3TBIA 1Z0XA 2FEZA 2RQQA 3LSIA 1YOVB 2KKOA 3P9IA 4E7ZA 2P7CB 4ZZDA 2R7XA 2JA2A 5CVUA 3MKWB 1F9NA 3O2PE 4NDLA 1XMXA 4I0AA 3EYYA 1MMAA 1IO2A 3JW4A 4XRFA 4DQ2A 1F36A 5LGTA 4BNCA 5E8IA 2FBIA 4PZJA 1F43A 2CFOA 1J9IA 5E1WA 2ZXJA 3K4KA 3MZHA 1PVEA 2F5VA 2PMZN 3HEFA 2CFXA 5FKKA 4HA8A 2F2EA 4G9YA 2F5FA 2DBBA 5HS9A 2P5KA 4EGZA 5EZHA 1D5VA 2HZTA 1RKTA 3CO6C 1D0ZA 2ZMEC 2B0LA 2HQRA 4YG2F 4C2MJ 3R6SA 2QLZA 5LFAA 1O57A 3FMSA 3OIOA 2YX7A 3DWLE 2DMUA 3REOA 3RKXA 3C18A 2KRHA 1WQ2A 1OJLA 3IRQA 4IEJA 2EZHA 2BY1A 3QPLA 2DFHA 2GXGA 2HQ5A 3CJTB 4WXHA 4E7JA 1JE8A 1F5TA 3KE2A 5HDNA 3R61A 1GXQA 1USTA 3Q3SA 1NK2P 3M8JA 3PUBA 4XLNF 2NNYA 3MEXA 2M34A 3TMOA 4BQOA 3OS0A 2O6GE 3WG7H 1N25A 2VLAA 2XIGA 2IAIA 4FE7A 4V2FA 4A0ZA 4UNOA 2NS8A 3DU5A 1BIBA 3L1PA 3CDHA 1X2NA 3HHGA 5KAFC 1R1TA 3QYEA 1DU6A 2ADUA 2XAUA 4UUSA 1M1EB 1X4OA 2GM4A 4M74A 4AVPA 5A2QZ 1OMIA 2XKPA 3HTUA 3ABMH 1P4AA 5ICEA 3CP2A 3CCQI 1O3RA 4BXXJ 5EEGA 3K6GA 2K9NA 4UHTA 2N8GA 4F93B 3ULQB 1WGXA 2WB1A 2JT1A 3QRFF 2DA6A 1H88C 1QNTA 3TKYA 1W0UA 3OIQA 1BR2A 2DOAA 1JT0A 2EFNA 1RUNA 2IA0A 4CCNA 3JSOA 2CQ7A 4RB2C 4BJ6C 1HW5A 5D6EA 4WF2A 3H9GA 3OR2C 1ODDA 4A5NA 2GIVA 4AIHA 5EF6A 5K5OA 3KFWX 3CC7I 4BQAA 3TQNA 3VYSB 3H92A 1U6GA 3QAHA 2K7LA 4CZCA 2CJJA 3OY9A 5K5QA 1RI7A 4M71A 2RAEA 5F64A 5L3DA 3CCJI 4BBSJ 3OS2A 4HW0A 2OTJI 3HOTA 3H36A 3K1PA 2X6OA 2VKEA 4P55A 5HNHA 4E7KA 1QA6A 4Y15A 5DEQA 2VBWA 1SFEA 2JK3A 5L3CA 2MGQA 3A0HC 2V4JC 1X3WB 1XDSA 2Q0OA 1K7AA 2ZSIB 1YITI 5F0HA 1H89C 4HNUA 1LFUP 3BG6A 3NAUA 3QPSA 3RI4A 1YX5A 3ABLH 1WJCA 3FXLA 2XGDA 3K4BA 2Q2EA 2G9WA 2Q8KA 2Z33A 2ELKA 1TT5B 2IGOA 4EM0B 1TC3C 3BC8A 1VQ7I 3TEDA 2KRCA 4KIFA 4B44A 2NVTJ 2GOMA 4IOAF 1R1UA 2X4HA 2YU3A 2GWRA 5F08A 2CV2A 1IN7A 2L7KA 3FXRA 1WI3A 3MN2A 4A93J 3SFZA 4LIVA 4IHXA 2Y75A 3CCSI 5DCFA 2OQRA 1ZARA 4UXNA 4EV0A 5FFZA 3TOAA 4NQWB 5LLQA 3VYTB 2OU2A 2V6EA 2YPRA 4PGGA 2DU9A 2R5ZA 3LSGA 3GTLJ 4EEFG 2HGCA 2WV1A 3W6JB 3W2AA 1OCRH 3OV8A 4BE0A 2LDUA 3HRMA 1XN7A 3KZYA 4BHBA 1A5JA 2LF8A 3G73A 4IHYA 4A3JJ 3EUKL 4MEYF 4FHTA 2E7WA 3E1SA 3LMMA 3F8MA 2GAUA 2MD5A 1SAUA 3F8NA 4B47A 4DYCA 2ZNZA 1VQMI 1T08B 3IWZA 1U2WA 1XGMA 5ICGA 2DFEA 3ECOA 3D0SA 5TISC 3IUOA 4IX7A 1S9HA 2FF4A 1RPWA 1SFKA 4MTDA 3IAS2 2LY2A 2AQEA 3V7SA 4F55A 4EJWA 3I53A 4F91B 5ILUA 1BOBA 2X48A 1BJAA 1EF4A 2EFOA 1LDDA 5FD6A 2PJRB 4ENKA 3A1YA 1AOYA 4S0HB 2GXBA 3P5JA 2WY7Q 2JPBA 4MHGA 3RCOA 3TW6A 4HZFA 5H20A 3LSPA 2HOSA 2RVCA 2TCTA 4NC8A 3HOXJ 1LPQA 5K5RA 1WWXA 2H1KA 3AG4H 4XOTA 5E3OA 3CCLI 4XSXF 5DD4A 4UVBA 2STTA 3WODF 5M5YJ 2P5LC 1S7EA 4KIBA 4KT5C 2RDPA 2MFZA 3GEZA 1TP4A 2KIQA 3I4NJ 4B3XA 3ONQA 1OR7C 2QWWA 4LITA 5KCMA 2BVLA 4HDVA 4BY7J 1TQMA 4HNTA 2BV6A 1TQIA 3DTKA 2K5CA 5BNGA 2IJLA 2HYJA 3M7GA 2P5VA 1D8KA 3BR5A 3MKLA 5D8LB 3WU1B 3BWGA 2A05A 1S5LC 3K4NA 2GA1A 3CDIA 4I76A 3FXMA 1SFUA 2VB6A 1EV7A 3MFKA 1V55H 2LYCA 3A01A 3HZJA 2L01A 3PFIA 4XK4A 2V9PA 1LEAA 3ZQHA 1X4PA 4LLNA 2EFPA 3HRTA 4RGXA 1T2KA 2VBZA 4XR6A 3WTUC 2DN0A 2WTEA 4G7ZF 2Y9ZA 2NVQJ 1QPIA 1F1ZA 2FJ1A 5FKLA 3L09A 4JYKA 3V8LA 1AHDP 3VSLA 3FBNB 3OL3A 4EVIA 1ETXA 5GTIC 4NBQA 2LKSA 3UNGC 1ETKA 4B1RA 1WCMJ 1NG7A 1KYWA 1Z7LA 2VASA 3F21A 2VKVA 2NOGA 1P92A 1Q1VA 2H6BA 1JKRC 1BN5A 4MLOA 1WRJA 4EJUA 2A5YB 3PQKA 5F1JA 3QOPA 3GFMA 2VOPA 2HVQA 3BPVA 5CQEA 4Y33A 1W1WE 3CF2A 2DXIA 2EV6A 1HDDC 1MDMB 2KJBA 2Y9YA 1SMTA 5M3FJ 4M73A 2DJNA 2AS5F 4A2UA 2W25A 5FRMA 4MQVA 2XAFA 3GTGJ 3BG5A 2XSDC 4RAZA 1RC9A 2KT0A 1P7JA 5EEHA 1IRZA 2OCEA 1ZRCA 1MNDA 2QF7A 3BOQA 3RJPA 3NARA 4WWCA 3U21A 1IC8A 1PDNC 1IRFA 2LY1A 4FETA 3E3VA 3FIWA 1YRNB 2BHZA 3ML6A 2LD5A 3I58A 4L9NA 3LFUA 3GTJJ 3BG9A 1IUYA 1X19A 4Y13A 4OMZA 5DDGA 1VQNI 2JWTA 2EFQA 2ZC2A 1FSEA 5C44J 4RM3A 4N4NB 1OCZH 1J5YA 2OQGA 5E18F 2JVGA 3V8KA 4G7OF 3L7WA 1SVOA 3ZRGA 1KONA 2EV0A 2HDWA 1BC8C 5GP9A 4XSZF 2WB1N 2ZCWA 5FKOA 3I55I 5B1BH 4H0EA 4H4KC 3LSMA 2KDZA 4DOZA 2Y31A 4Q5SF 1IRXA 4B48A 3C3WA 1YJ9I 1PUEE 4HPQA 2OCCH 3KIOA 1YTYA 4IJAA 3PJRA 4D0PA 4C30A 3RPQA 2M2EA 4A69C 4KN7X 2Y0SN 1E3OC 1VQ5I 3H3VK 5JLXA 1KGSA 1MJ9A 4UVCA 3F72A 3GZ6A 1I1SA 3ROUA 3PM1A 3U1DA 2RNJA 1B6AA 1Z67A 3HG9A 2RGVA 3FXKA 2MG4A 1YJNI 3BQZA 2W1OA 2QYOA 2NXNB 4WXCA 3BTCA 2BY0A 3QWLA 3ABKH 3LAJA 3WG9A 3KP6A 1VQ6I 3NEUA 3BR3A 4BH9A 4ZYHA 2X85A 1TW2A 3GTPJ 2OBPA 3Q0VA 1TNSA 4IRHA 5GADJ 1SVMA 1LDJA 3AG2H 2XF7A 4PSWA 4ANJA 4B43A 1WHUA 1R5GA 2M1BA 3ZOBA 3CCRI 3HKZA 3WTXC 2XF5A 1EH6A 1KYZA 3E6DA 4S05A 1VTNC 4CZZA 1C0WA 2L4MA 3BP8A 5C4JJ 3S2HJ 3OL4A 5BS6A 1FOYA 4OOIA 2LY9A 3PSFA 2Z1DA 4HLXA 4BEHA 1Z7UA 4ZYAA 3H3ZA 4XRSG 2X6YA 3K70C 1K61A 3MD2A 2RREA 4N9HA 4CCOA 1OCTC 4J01A 3ERMA 2MW8A 4NUBA 5IYDJ 4CHUA 3CZ6A 4IXAA 5EEAA 1JGGA 3QOEA 2CW0F 3SEZA 1Z9CA 2ETHA 1MKMA 1ORKA 1MGTA 3OOUA 4P1WA 2KFDA 4QIWN 3P7NA 4ENMA 1JJ8C 2W82A 3W2WA 4HOBA 3ASNH 3FF5A 4P9UA 1MNMC 4E70A 2L9RA 1BL0A 3ZN0A 5IP9J 5CLSA 2VPLA 1W7PA 3MMYB 2DYRH 2HXOA 5LRSA 1PP8F 3TDUC 1HSTA 1ZELA 4BJTA 3COAC 2DYSH 2Z99A 1IN8A 3IC7A 3V7RA 5LGUA 4O3MA 1U9OA 5FLXK 4OIOF 3RZOJ 2CUEA 3G1MA 1MJBA 3HOVJ 2H09A 1MSFC 2RKHA 2OAZA 2R7DA 2LTPA 4OIRF 5EGOB 1KQ8A 2NRAC 3ABTA 1YQAA 3VOEA 5LEKA 5B1AH 1O7FA 2AXTC 4KN4X 2J5PA 1B9MA 4BXUA 4DNCA 2BY3A 1W5TA 3SZPA 2IGMA 1YW9A 2KHMA 3ASOH 3EETA 4M9ZA 2FU4A 2HPMA 4PGHA 1JXSA 1JUMA 2HFHA 1ZYRF 2QUFA 2DMNA 2QQBA 4XM3A 2FBKA
chains in the Genus database with same CATH topology
1DUXC 3HUGA 3L9FA 4RGSA 4I0BA 1I6XA 2D2WA 4KUMA 1BBYA 1G3YA 3HOSA 2GZWA 5FO5A 1FOKA 2M87A 2UXXA 5L3BA 4IVNA 3WGHA 4ETSA 1K6OA 2FSWA 5ICFA 3EDPA 2XAHA 3RKWA 5BOXA 1L3LA 4MTEA 2DLLA 4ZYDA 2W57A 3BZ6A 1LDKB 1XGOA 5JI6A 3T5XA 1ZG5A 3J80K 2O03A 1HKTA 3LQRA 3DP7A 2Z9OA 3G3ZA 4ZZLA 2MBFA 4UV8A 3IL2A 3I0TA 3NQOA 4CO8A 3CTAA 3K2ZA 3J81K 2L4AA 1MJAA 2DQRA 2M45A 5BMZA 4YFNF 4HQMA 1I5ZA 3I59B 2EA2A 2KIMA 2HYFA 2VC1A 2NNNA 4WXDA 1Q1HA 3I5UA 2DK5A 2PQ8A 1Z6RA 4HYEA 2MH9A 2K02A 1FYKA 1RNLA 2DPUA 4L9TA 2DQLA 5TJJA 3R0AA 1FYMA 5FLXZ 4RB3C 1QQIA 4M72A 1YW7A 2V1UA 1RZ4A 1HSJA 5LRRA 2FBHA 3BDDA 3BJOA 4GXOA 4QLCU 2MH2A 4Q48A 5LEJA 1G4DA 1FY7A 2ELHA 2W84A 4ON0A 4M6XA 5JVTA 4MEXF 2DI3A 1LEBA 1B4AA 1FBUA 3ZMDA 3WTTC 4KA4A 4HV5A 1HXDA 3LA2A 4M9XA 2VT3A 3GFLA 4MNUA 2V79A 3GWZA 3FHZA 4OIQF 2TDXA 3P9KA 2PJPA 4UV9A 5LBQA 5BPDA 1IAWA 1G3SA 3WTWC 1UHMA 4HQEA 1I27A 2V9VA 2Y48A 3JTHA 2DT5A 5LHGA 2A6EF 2KIUA 1I1GA 3GF2A 4F7ZA 1DDNA 5AIQA 5CVIA 1XGNA 3K1NA 5HS8A 1IXRC 4EQQA 2K4BA 1T0FA 2ZNYA 4HF1A 1GVJA 2CQKA 1P6RA 5CVRA 2EJRA 2ZMEB 4LK1F 3EYIA 1SD4A 1H9GA 3HSEA 1IXCA 5CYVA 2O0YA 4HX7A 1S8NA 3V4GA 2KIFA 1ZHFA 4EGYA 4ZYGA 2M8EA 3C1DA 2Z3YA 4R8HA 4ASNA 1B1BA 3MCZA 2H6CA 2V1DA 1XMAA 2CYYA 2C6YA 2ESNA 4LD5A 2WC2A 4KYWA 3B73A 2JRTA 1P4XA 2XASA 4GCVA 2CO5A 2IT0A 1Z05A 3DV8A 2BBYA 3AAFA 3KP7A 1CGPA 3HHHA 3SZTA 2ZKZA 2HOEA 2OZ6A 2P8TA 3DPTA 1QO0D 3RTRA 5BQTA 4L5IA 4RB1A 2PBIA 3KP2A 4XBFA 2PEXA 1O7LA 2XUBA 1E2XA 4U7DA 2HWVA 4G6QA 1BI0A 3LQQA 4Q47A 1FC3A 4WX9A 2XV4S 1SFXA 1YS7A 3N4MA 3MAJA 2RC4A 3WGGA 5DYMA 1G3WA 1R36A 4RB0A 3P9CA 1KQ0A 3IWFA 2FRHA 1SMYF 1MDMA 4HV6A 2NAZA 1TLHB 3IRRA 3ABUA 1K78A 3WTVC 1REPC 1BI3A 4XLPF 4U0YA 1ONVA 1LB2A 1FNNA 2HEOA 1ZRDA 1IN5A 5DCMB 2XHKA 3KP3A 5HLIA 3RKYA 2A68F 2ACJA 1V4RA 1YFHA 5L3GA 4R79A 2D45A 5AONA 1B59A 4A6EA 1R7JA 2AXLA 4OMYA 2XROA 1TTYA 1KQ9A 3KP4A 5CVVA 3ZN1A 2FE3A 3BPXA 3GYHX 4FX4A 1USSA 5D6FA 3GUDA 2A07F 1J59A 5FGMA 5H6RA 2IRFG 3RDIA 3TO9A 5E1XA 3RYPA 3KLNA 4M9SA 4R1HA 3FMQA 4CDGA 4B8XA 2P4WA 1NHAA 1Y0UA 4OIPF 3EUHA 2ISZA 4RAYA 1OYYA 3O3KA 5HOOA 4EM2A 1MD0A 1HKQA 1ZN2A 2HR3A 4WCGA 3H3UA 2CG4A 2FA5A 3VODA 4FT8A 4ESBA 1QBJA 2P7VB 3CUOA 5DD8A 2PLYA 3VFZA 5J8CA 5K1YA 1J0RA 2BEOA 5D8KB 2FQ3A 3JAMK 2VOOA 1T6SA 1R22A 3QP6A 5JHUA 1YLFA 1QPMA 2VT2A 1KU7A 4JBAA 2IA1A 3F3XA 2DFIA 3HYIA 5ED4A 3R4KA 4HLYA 2D1HA 1XDUA 1JGSA 4LLGF 3WGIA 3KEOA 2LF7A 2YSRA 5HDKA 3QPTA 2EFWA 3GVAA 1FLIA 4ESJA 3RYRA 4O5VA 1ZGJA 2W85A 4AWXB 1LNWA 1P2FA 1ZG1A 4I09A 2FXAA 4BHCA 1FZPB 1U5TC 1FP1D 1IN6A 4QWQA 4S04A 1E17A 1U5TA 1R00A 1SD7A 5HDGA 4LG0A 1WSUA 1Z1DA 5ICCA 3F8BA 4L18B 2LSOA 4PDKA 4KICA 4L0ZB 1HKSA 3EQLF 4ZYEA 2K86A 3W6KB 4YIIA 3E5UA 4AIJA 3QU3A 1ZLJA 2E1NA 3WTSC 4G94A 2F5EA 4L0YB 5DV5A 2ISYA 4LB6B 1DP7P 5E8GA 5FD5A 2KRFA 2XAGA 4M6YA 4B09A 4PCQA 2VE9A 2P6TA 3GFJA 2JZYA 3IHUA 2IA2A 3BJ6A 1ON1A 2QENA 4KNYA 4LB5A 2RN7A 4A0YA 3CJNA 1H0MA 4A0XA 3E5XA 2P6SA 1OYIA 4MGRA 4N9IA 3ZMSA 4JK1X 2EK5A 1IZ1A 1T98A 3CUQA 1S7AA 1PP7U 4HF0A 3ZMZA 3LA7A 3U9GA 1Z91A 2K4JA 2O3FA 1W5SA 2ZFWA 3I59A 2BYVE 2NS0A 5ILVA 1KU2A 1HQCA 5D5VB 1YW8A 4ENNA 4Z2YA 4I02A 1S3JA 1IXSB 2VBXA 1CF7B 2DO7A 4LMYA 3LSTA 2VXZA 1S7OA 1W4MA 1XCVA 2F5CA 5A2QK 3TO6A 5D4RA 3KCCA 1R58A 2ZJ2A 3GO5A 4L5JA 3ELKA 2IW5A 1FYLA 1QGPA 5FB2A 1SD5A 2O8XA 1QZZA 4HX4A 4IF4A 2QQ9A 1LVAA 2QBYB 4K2EA 4MQ9F 3TO7A 3K69A 2VONA 3I54A 1YO5C 1MZBA 3MWMA 2CWEA 1U78A 4LFUA 4GO1A 5IT9K 4EJTA 4P9FA 1UHWA 3S2WA 2YX4A 5ILSA 4LJZF 4U7BA 3QP5A 3ZPLA 3SXYA 3T8RA 1FPQA 1BC7C 3L2CA 3DF8A 2GA2A 4LGWA 1IRGA 1FBQA 1BM9A 1TQPA 3R60A 1FP2A 3U2RA 3HSFA 2JPCA 4BAYA 3F23A 2HTSA 3FWEA 2E1CA 2FMYA 4Q4ZF 2EB7A 1P4WA 2ZMEA 2QM3A 2M5WA 4CYDA 3DFGA 2KJCA 4G7HF 1R23A 2XAJA 2A6HF 2L54A 3E97A 2UZKA 1ZLKA 2VN2A 1O3SA 3J7AO 4RGRA 1YIOA 4IRGA 4YFKF 2OZUA 2EWNA 2E7XA 3LAPA 1ZREA 2XVCA 1KU9A 4I01A 2FNPA 1XSXA 2QZ8A 4NQWA 4EM1A 2EA4A 1JHHA 1J75A 3ISPA 3J80Z 3SHFA 1DPUA 2ZO4A 2LNBA 3WU0A 3DPLC 2IPQX 3Q5FA 1WI9A 3KP5A 1HW2A 2MC3A 2PMUA 3WE2A 2DTRA 3SQNA 4HAMA 3M1EA 5F6FA 4A12A 3GXOA 4UUVA 3FMRA 2W24A 3HRUA 3J81Z 4OU0A 5E17F 1OKRA 1S6LA 4ESFA 3KETA 1RIOH 1TBXA 5HS7A 1ULYA 1KU3A 2PFBA 2NYXA 4N0BA 4JQFA 1SAXA 4AD9A 1XSDA 1L0OC 1YS6A 3T1BA 5IT9Z 4G6DA 5ERIA 3VB2A 2XGXA 2FNAA 2H27A 3VEPA 5D5XB 2XRNA 2DPDA 4IPAA 4TV7A 5F1RA 2XKOA 1W7PD 4P5OA 3K1MA 2A69F 3TOBA 4CICA 2DK8A 3V8JA 1FT9A 2HDCA 2G7HA 5DCMA 3JSPA 2Z5UA 3F6VA 3DKWA 1EH7A 4A6DA 1J2XA 3K0LA 3ZMUA 3QPHA 1ZGAA 3GW2A 3HSRA 3O6BB 3D5LA 1UCRA 2YR2A 1D8JA 3FXUA 4P96A 4KFCA 5CJ9A 1O3TA 4HDUA 4GYGA 1D3YA 2UXNA 1TNTA 2RV8A 1STZA 3HTSB 1BOAA 3F8CA 3M8EA 3GZ5A 1TW3A 1A04A 3BY6A 2HQNA 3L00A 1HBXG 3FX3A 2L02A 2IVMA 4RS8A 1LQ1A 5HLHA 4U0VA 1OR7A 4NB5A 1ZRFA 3KLOA 3QU6A 4GYIA 5TRDA 4KMFA 2V1XA 3IKVA 3Q9SA 4AIKA 2MLGA 3KZZA 2UWMA 1YG2A 2OA4A 1GHCA 4KMUX 1T38A 2DAOA 3Q9VA 5JFRA 1ON2A 5DUIA 4OINF 3HRSA 2L3DA 1J7KA 2BE5F 2K27A 3R0JA 4NHJA 2F5DA 1XSVA 1O3QA 3DQVC 4RGUA 4CGZA 3GX4X 4IHTA 2J5OA 3TGNA 1ZG3A 1B9NA 1XD7A 3V7CA 4ENJA 4HBLA 1T39A 1K78B 3JTGA 2BGCA 2HS5A 1JHFA 1KA8A 2H94A 1G6NA 5L3FA 1RUOA 1ZH5A 4YFXF 2CSOA 2MA3A 3FZVA 1R5HA 4LLLA 2R7FA 3GFIA 5L3EA 1BIAA 4G8XA 3I71A 5AIPA 3C7JA 2VBYA 3DXJF 2X0LA 4I7HA 6PAXA 3GLXA 4ZH4F 2HKOA 2QQAA 2DW4A 4YIFA 4BYYA 1FSHA 1GXPA 2PMHA 2Y0MA 5HLGA 1DPRA 3BROA 1AWCA 3CLOA 3LFKA 5BPIA 4KDPA 2G7UA 1WKMA 2HYGD 3E6MA 1YYVA 2PN6A 3ZP5A 3PQJA 3F6OA 1R1VA 5LHIA 1BI1A 2COMA 2VE8A 3ZMTA 2WWYA 4EJVA 5KK1A 1S29A 4L9JA 2M30A 2FOKA 1UB9A 5D5UB 2PI0A 2HTJA 5CVJA 4EMSA 3KEQA 1SD6A 3DEUA 3LA3A 4A5MA 5KVRA 3N97A 3F8FA 2FMLA 3LWFA 1Z6TA 4EJOA 4HF2A 5JR3A 2ESHA 3K9TA 4O6JA 1G3TA 1QZYA 4CXFA 2A61A 4GGGA 5HVQC 5H6QA 3BJAA 2D1VA 1CF7A 1F4KA 5E20A 1IN4A 5LGNA 2IP2A 2HKXA 2XAQA 3E6CC 1UFMA 3RPUA 2RQPA 5LHHA 4UVAA 3E6BA 3WE3A 1IF1A 1H9TA 2VODA 1FWZA 1EH8A 5FFXA 2LKPA 5J8FA 5DUKA 1ZAOA 3ZMVA 3M8FA 1LJ9A 3T0YA 1XGSA 4FX0A 2A3SA 2ZBKA 1U3EM 2QBYA 2PG4A 3CUQC 3T8TA 3JAMZ 3RIRA 2O61A 4IRIA 1X3UA 5D5WB 3WTZA 3FM3A 2JTVA 3OOPA 3ERED 1XB4A 2JSCA 1K79A 1V3FA 3MZYA 2OD5A 3FXQA 1U5TB 4I2OA 3MQ0A 4LG0B 4KIGA 4IHSA 3M9AA 4I98B 2CGPA 2VC0A 4U0WA 3I4PA 5D4SA 1FX7A 2QVOA 1HW1A 2EV5A 1BI2A 2MLKA 4LK0F 2R3SA 1U8RA 3F22A 4L9VA 1FBSA 3E5QA 1W7PB 3CO7C 5IT3A 3HIFA 4WK8F 4HX8A 2V6CA 3I64A 1IW7F 5J6XA 1OPCA 3NRVA 2GQQA 1OYWA 1XCBA 3ECHA 2STWA 4Y17A 5E1ZB 4BHPA 3CUQB 3IKTA 1XMKA 2WV0A 4U88A 3WTYC 3FM5A 3B02A 3TDZC 3ZQ7A 2FEZA 3P9IA 2KKOA 2P7CB 4ZZDA 5CVUA 1F9NA 3O2PE 4I0AA 3EYYA 4XRFA 3JW4A 4DQ2A 5LGTA 4BNCA 5E8IA 2FBIA 4PZJA 1J9IA 5E1WA 2ZXJA 3MZHA 2CFXA 4HA8A 2F2EA 4G9YA 2F5FA 2DBBA 5HS9A 2P5KA 4EGZA 1D5VA 2HZTA 3CO6C 2B0LA 2HQRA 4YG2F 3R6SA 2QLZA 1O57A 3FMSA 2YX7A 3REOA 3RKXA 3C18A 1WQ2A 3IRQA 4WXHA 2GXGA 1JE8A 1F5TA 3KE2A 5HDNA 3R61A 1GXQA 1USTA 4XLNF 2NNYA 3MEXA 2O6GE 2XIGA 4A0ZA 4UNOA 1BIBA 3CDHA 3HHGA 1R1TA 2ADUA 4M74A 4AVPA 5A2QZ 1OMIA 2XKPA 3HTUA 1P4AA 5ICEA 1O3RA 5EEGA 4UHTA 3ULQB 3QRFF 2JT1A 1QNTA 3TKYA 2EFNA 1RUNA 2IA0A 3JSOA 4RB2C 1HW5A 5D6EA 4WF2A 1ODDA 4A5NA 2GIVA 4AIHA 5K5OA 3KFWX 4BQAA 3TQNA 3H92A 1U6GA 3QAHA 2K7LA 5K5QA 1RI7A 4M71A 5F64A 5L3DA 4HW0A 3HOTA 3K1PA 4P55A 4Y15A 5DEQA 2VBWA 1SFEA 5L3CA 1XDSA 2Q0OA 1K7AA 3RI4A 2Q2EA 2G9WA 2Q8KA 2Z33A 4EM0B 4KIFA 1R1UA 2X4HA 2YU3A 2GWRA 1IN7A 3FXRA 3SFZA 2Y75A 5DCFA 2OQRA 1ZARA 4UXNA 4EV0A 5FFZA 3TOAA 5LLQA 2OU2A 2YPRA 4PGGA 2DU9A 2HGCA 3W6JB 3OV8A 2LDUA 3HRMA 1XN7A 3KZYA 4BHBA 2LF8A 3G73A 4MEYF 4FHTA 2E7WA 3F8MA 2GAUA 2MD5A 3F8NA 2ZNZA 3IWZA 1U2WA 1XGMA 5ICGA 3ECOA 3D0SA 2FF4A 4MTDA 3V7SA 4EJWA 3I53A 5ILUA 1BJAA 2EFOA 1LDDA 5FD6A 4ENKA 1AOYA 2GXBA 2JPBA 4MHGA 4HZFA 5H20A 2RVCA 5K5RA 1WWXA 4XSXF 5DD4A 4UVBA 2STTA 3WODF 2P5LC 4KIBA 4KT5C 2RDPA 3GEZA 2QWWA 4HDVA 1TQMA 2BV6A 1TQIA 2IJLA 3M7GA 2P5VA 1D8KA 5D8LB 3WU1B 3BWGA 2GA1A 1SFUA 1EV7A 3MFKA 2L01A 3PFIA 1LEAA 4LLNA 2EFPA 3HRTA 4RGXA 1T2KA 2VBZA 3WTUC 4G7ZF 2WTEA 1F1ZA 3L09A 3V8LA 4EVIA 1KYWA 3F21A 1P92A 2H6BA 1BN5A 1WRJA 4EJUA 2A5YB 3PQKA 3QOPA 3GFMA 2VOPA 3BPVA 2EV6A 1MDMB 2KJBA 1SMTA 4M73A 2AS5F 4A2UA 2W25A 4MQVA 2XAFA 4RAZA 5EEHA 1ZRCA 3BOQA 3RJPA 4WWCA 1PDNC 1IRFA 3E3VA 3ML6A 3I58A 4L9NA 1IUYA 4Y13A 4OMZA 5DDGA 2EFQA 1FSEA 1J5YA 2OQGA 5E18F 3V8KA 4G7OF 3L7WA 2EV0A 1BC8C 4XSZF 2ZCWA 4H0EA 4Q5SF 3C3WA 1PUEE 1YTYA 4IJAA 4D0PA 3RPQA 4KN7X 1KGSA 1MJ9A 4UVCA 3F72A 3GZ6A 1I1SA 3ROUA 3U1DA 2RNJA 1B6AA 2RGVA 2QYOA 4WXCA 3LAJA 3WG9A 3KP6A 3NEUA 4BH9A 4ZYHA 1TW2A 2OBPA 4IRHA 1TNSA 1LDJA 1R5GA 2M1BA 3WTXC 1EH6A 1KYZA 3E6DA 4S05A 1VTNC 4CZZA 1C0WA 2L4MA 3BP8A 5BS6A 4OOIA 4HLXA 1Z7UA 3H3ZA 4N9HA 4CHUA 4IXAA 2CW0F 1Z9CA 2ETHA 1MKMA 1MGTA 3P7NA 4ENMA 4HOBA 3FF5A 4P9UA 4E70A 3ZN0A 5CLSA 1W7PA 5LRSA 1PP8F 3TDUC 1HSTA 3COAC 2Z99A 1IN8A 3IC7A 3V7RA 5LGUA 4O3MA 5FLXK 4OIOF 1MJBA 2H09A 2RKHA 2OAZA 2R7DA 4OIRF 1KQ8A 2NRAC 3ABTA 1YQAA 3VOEA 5LEKA 1O7FA 4KN4X 2J5PA 1B9MA 4BXUA 4DNCA 3SZPA 1W5TA 1YW9A 3EETA 4M9ZA 2FU4A 4PGHA 1JXSA 2HFHA 1ZYRF 2QUFA 2QQBA 2FBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DUX C;  3HUG A;  3L9F A;  4RGS A;  4I0B A;  1I6X A;  2D2W A;  4KUM A;  1BBY A;  1G3Y A;  3HOS A;  2GZW A;  5FO5 A;  1FOK A;  2M87 A;  2UXX A;  5L3B A;  4IVN A;  3WGH A;  4ETS A;  1K6O A;  2FSW A;  5ICF A;  3EDP A;  2XAH A;  3RKW A;  5BOX A;  1L3L A;  4MTE A;  2DLL A;  4ZYD A;  2W57 A;  3BZ6 A;  1LDK B;  1XGO A;  5JI6 A;  3T5X A;  1ZG5 A;  3J80 K;  2O03 A;  1HKT A;  3LQR A;  3DP7 A;  2Z9O A;  3G3Z A;  4ZZL A;  2MBF A;  4UV8 A;  3IL2 A;  3I0T A;  3NQO A;  4CO8 A;  3CTA A;  3K2Z A;  3J81 K;  2L4A A;  1MJA A;  2DQR A;  2M45 A;  5BMZ A;  4YFN F;  4HQM A;  1I5Z A;  3I59 B;  2EA2 A;  2KIM A;  2HYF A;  2VC1 A;  2NNN A;  4WXD A;  1Q1H A;  3I5U A;  2DK5 A;  2PQ8 A;  1Z6R A;  4HYE A;  2MH9 A;  2K02 A;  1FYK A;  1RNL A;  2DPU A;  4L9T A;  2DQL A;  5TJJ A;  3R0A A;  1FYM A;  5FLX Z;  4RB3 C;  1QQI A;  4M72 A;  1YW7 A;  2V1U A;  1RZ4 A;  1HSJ A;  5LRR A;  2FBH A;  3BDD A;  3BJO A;  4GXO A;  4QLC U;  2MH2 A;  4Q48 A;  5LEJ A;  1G4D A;  1FY7 A;  2ELH A;  2W84 A;  4ON0 A;  4M6X A;  5JVT A;  4MEX F;  2DI3 A;  1LEB A;  1B4A A;  1FBU A;  3ZMD A;  3WTT C;  4KA4 A;  4HV5 A;  1HXD A;  3LA2 A;  4M9X A;  2VT3 A;  3GFL A;  4MNU A;  2V79 A;  3GWZ A;  3FHZ A;  4OIQ F;  2TDX A;  3P9K A;  2PJP A;  4UV9 A;  5LBQ A;  5BPD A;  1IAW A;  1G3S A;  3WTW C;  1UHM A;  4HQE A;  1I27 A;  2V9V A;  2Y48 A;  3JTH A;  2DT5 A;  5LHG A;  2A6E F;  2KIU A;  1I1G A;  3GF2 A;  4F7Z A;  1DDN A;  5AIQ A;  5CVI A;  1XGN A;  3K1N A;  5HS8 A;  1IXR C;  4EQQ A;  2K4B A;  1T0F A;  2ZNY A;  4HF1 A;  1GVJ A;  2CQK A;  1P6R A;  5CVR A;  2EJR A;  2ZME B;  4LK1 F;  3EYI A;  1SD4 A;  1H9G A;  3HSE A;  1IXC A;  5CYV A;  2O0Y A;  4HX7 A;  1S8N A;  3V4G A;  2KIF A;  1ZHF A;  4EGY A;  4ZYG A;  2M8E A;  3C1D A;  2Z3Y A;  4R8H A;  4ASN A;  1B1B A;  3MCZ A;  2H6C A;  2V1D A;  1XMA A;  2CYY A;  2C6Y A;  2ESN A;  4LD5 A;  2WC2 A;  4KYW A;  3B73 A;  2JRT A;  1P4X A;  2XAS A;  4GCV A;  2CO5 A;  2IT0 A;  1Z05 A;  3DV8 A;  2BBY A;  3AAF A;  3KP7 A;  1CGP A;  3HHH A;  3SZT A;  2ZKZ A;  2HOE A;  2OZ6 A;  2P8T A;  3DPT A;  1QO0 D;  3RTR A;  5BQT A;  4L5I A;  4RB1 A;  2PBI A;  3KP2 A;  4XBF A;  2PEX A;  1O7L A;  2XUB A;  1E2X A;  4U7D A;  2HWV A;  4G6Q A;  1BI0 A;  3LQQ A;  4Q47 A;  1FC3 A;  4WX9 A;  2XV4 S;  1SFX A;  1YS7 A;  3N4M A;  3MAJ A;  2RC4 A;  3WGG A;  5DYM A;  1G3W A;  1R36 A;  4RB0 A;  3P9C A;  1KQ0 A;  3IWF A;  2FRH A;  1SMY F;  1MDM A;  4HV6 A;  2NAZ A;  1TLH B;  3IRR A;  3ABU A;  1K78 A;  3WTV C;  1REP C;  1BI3 A;  4XLP F;  4U0Y A;  1ONV A;  1LB2 A;  1FNN A;  2HEO A;  1ZRD A;  1IN5 A;  5DCM B;  2XHK A;  3KP3 A;  5HLI A;  3RKY A;  2A68 F;  2ACJ A;  1V4R A;  1YFH A;  5L3G A;  4R79 A;  2D45 A;  5AON A;  1B59 A;  4A6E A;  1R7J A;  2AXL A;  4OMY A;  2XRO A;  1TTY A;  1KQ9 A;  3KP4 A;  5CVV A;  3ZN1 A;  2FE3 A;  3BPX A;  3GYH X;  4FX4 A;  1USS A;  5D6F A;  3GUD A;  2A07 F;  1J59 A;  5FGM A;  5H6R A;  2IRF G;  3RDI A;  3TO9 A;  5E1X A;  3RYP A;  3KLN A;  4M9S A;  4R1H A;  3FMQ A;  4CDG A;  4B8X A;  2P4W A;  1NHA A;  1Y0U A;  4OIP F;  3EUH A;  2ISZ A;  4RAY A;  1OYY A;  3O3K A;  5HOO A;  4EM2 A;  1MD0 A;  1HKQ A;  1ZN2 A;  2HR3 A;  4WCG A;  3H3U A;  2CG4 A;  2FA5 A;  3VOD A;  4FT8 A;  4ESB A;  1QBJ A;  2P7V B;  3CUO A;  5DD8 A;  2PLY A;  3VFZ A;  5J8C A;  5K1Y A;  1J0R A;  2BEO A;  5D8K B;  2FQ3 A;  3JAM K;  2VOO A;  1T6S A;  1R22 A;  3QP6 A;  5JHU A;  1YLF A;  1QPM A;  2VT2 A;  1KU7 A;  4JBA A;  2IA1 A;  3F3X A;  2DFI A;  3HYI A;  5ED4 A;  3R4K A;  4HLY A;  2D1H A;  1XDU A;  1JGS A;  4LLG F;  3WGI A;  3KEO A;  2LF7 A;  2YSR A;  5HDK A;  3QPT A;  2EFW A;  3GVA A;  1FLI A;  4ESJ A;  3RYR A;  4O5V A;  1ZGJ A;  2W85 A;  4AWX B;  1LNW A;  1P2F A;  1ZG1 A;  4I09 A;  2FXA A;  4BHC A;  1FZP B;  1U5T C;  1FP1 D;  1IN6 A;  4QWQ A;  4S04 A;  1E17 A;  1U5T A;  1R00 A;  1SD7 A;  5HDG A;  4LG0 A;  1WSU A;  1Z1D A;  5ICC A;  3F8B A;  4L18 B;  2LSO A;  4PDK A;  4KIC A;  4L0Z B;  1HKS A;  3EQL F;  4ZYE A;  2K86 A;  3W6K B;  4YII A;  3E5U A;  4AIJ A;  3QU3 A;  1ZLJ A;  2E1N A;  3WTS C;  4G94 A;  2F5E A;  4L0Y B;  5DV5 A;  2ISY A;  4LB6 B;  1DP7 P;  5E8G A;  5FD5 A;  2KRF A;  2XAG A;  4M6Y A;  4B09 A;  4PCQ A;  2VE9 A;  2P6T A;  3GFJ A;  2JZY A;  3IHU A;  2IA2 A;  3BJ6 A;  1ON1 A;  2QEN A;  4KNY A;  4LB5 A;  2RN7 A;  4A0Y A;  3CJN A;  1H0M A;  4A0X A;  3E5X A;  2P6S A;  1OYI A;  4MGR A;  4N9I A;  3ZMS A;  4JK1 X;  2EK5 A;  1IZ1 A;  1T98 A;  3CUQ A;  1S7A A;  1PP7 U;  4HF0 A;  3ZMZ A;  3LA7 A;  3U9G A;  1Z91 A;  2K4J A;  2O3F A;  1W5S A;  2ZFW A;  3I59 A;  2BYV E;  2NS0 A;  5ILV A;  1KU2 A;  1HQC A;  5D5V B;  1YW8 A;  4ENN A;  4Z2Y A;  4I02 A;  1S3J A;  1IXS B;  2VBX A;  1CF7 B;  2DO7 A;  4LMY A;  3LST A;  2VXZ A;  1S7O A;  1W4M A;  1XCV A;  2F5C A;  5A2Q K;  3TO6 A;  5D4R A;  3KCC A;  1R58 A;  2ZJ2 A;  3GO5 A;  4L5J A;  3ELK A;  2IW5 A;  1FYL A;  1QGP A;  5FB2 A;  1SD5 A;  2O8X A;  1QZZ A;  4HX4 A;  4IF4 A;  2QQ9 A;  1LVA A;  2QBY B;  4K2E A;  4MQ9 F;  3TO7 A;  3K69 A;  2VON A;  3I54 A;  1YO5 C;  1MZB A;  3MWM A;  2CWE A;  1U78 A;  4LFU A;  4GO1 A;  5IT9 K;  4EJT A;  4P9F A;  1UHW A;  3S2W A;  2YX4 A;  5ILS A;  4LJZ F;  4U7B A;  3QP5 A;  3ZPL A;  3SXY A;  3T8R A;  1FPQ A;  1BC7 C;  3L2C A;  3DF8 A;  2GA2 A;  4LGW A;  1IRG A;  1FBQ A;  1BM9 A;  1TQP A;  3R60 A;  1FP2 A;  3U2R A;  3HSF A;  2JPC A;  4BAY A;  3F23 A;  2HTS A;  3FWE A;  2E1C A;  2FMY A;  4Q4Z F;  2EB7 A;  1P4W A;  2ZME A;  2QM3 A;  2M5W A;  4CYD A;  3DFG A;  2KJC A;  4G7H F;  1R23 A;  2XAJ A;  2A6H F;  2L54 A;  3E97 A;  2UZK A;  1ZLK A;  2VN2 A;  1O3S A;  3J7A O;  4RGR A;  1YIO A;  4IRG A;  4YFK F;  2OZU A;  2EWN A;  2E7X A;  3LAP A;  1ZRE A;  2XVC A;  1KU9 A;  4I01 A;  2FNP A;  1XSX A;  2QZ8 A;  4NQW A;  4EM1 A;  2EA4 A;  1JHH A;  1J75 A;  3ISP A;  3J80 Z;  3SHF A;  1DPU A;  2ZO4 A;  2LNB A;  3WU0 A;  3DPL C;  2IPQ X;  3Q5F A;  1WI9 A;  3KP5 A;  1HW2 A;  2MC3 A;  2PMU A;  3WE2 A;  2DTR A;  3SQN A;  4HAM A;  3M1E A;  5F6F A;  4A12 A;  3GXO A;  4UUV A;  3FMR A;  2W24 A;  3HRU A;  3J81 Z;  4OU0 A;  5E17 F;  1OKR A;  1S6L A;  4ESF A;  3KET A;  1RIO H;  1TBX A;  5HS7 A;  1ULY A;  1KU3 A;  2PFB A;  2NYX A;  4N0B A;  4JQF A;  1SAX A;  4AD9 A;  1XSD A;  1L0O C;  1YS6 A;  3T1B A;  5IT9 Z;  4G6D A;  5ERI A;  3VB2 A;  2XGX A;  2FNA A;  2H27 A;  3VEP A;  5D5X B;  2XRN A;  2DPD A;  4IPA A;  4TV7 A;  5F1R A;  2XKO A;  1W7P D;  4P5O A;  3K1M A;  2A69 F;  3TOB A;  4CIC A;  2DK8 A;  3V8J A;  1FT9 A;  2HDC A;  2G7H A;  5DCM A;  3JSP A;  2Z5U A;  3F6V A;  3DKW A;  1EH7 A;  4A6D A;  1J2X A;  3K0L A;  3ZMU A;  3QPH A;  1ZGA A;  3GW2 A;  3HSR A;  3O6B B;  3D5L A;  1UCR A;  2YR2 A;  1D8J A;  3FXU A;  4P96 A;  4KFC A;  5CJ9 A;  1O3T A;  4HDU A;  4GYG A;  1D3Y A;  2UXN A;  1TNT A;  2RV8 A;  1STZ A;  3HTS B;  1BOA A;  3F8C A;  3M8E A;  3GZ5 A;  1TW3 A;  1A04 A;  3BY6 A;  2HQN A;  3L00 A;  1HBX G;  3FX3 A;  2L02 A;  2IVM A;  4RS8 A;  1LQ1 A;  5HLH A;  4U0V A;  1OR7 A;  4NB5 A;  1ZRF A;  3KLO A;  3QU6 A;  4GYI A;  5TRD A;  4KMF A;  2V1X A;  3IKV A;  3Q9S A;  4AIK A;  2MLG A;  3KZZ A;  2UWM A;  1YG2 A;  2OA4 A;  1GHC A;  4KMU X;  1T38 A;  2DAO A;  3Q9V A;  5JFR A;  1ON2 A;  5DUI A;  4OIN F;  3HRS A;  2L3D A;  1J7K A;  2BE5 F;  2K27 A;  3R0J A;  4NHJ A;  2F5D A;  1XSV A;  1O3Q A;  3DQV C;  4RGU A;  4CGZ A;  3GX4 X;  4IHT A;  2J5O A;  3TGN A;  1ZG3 A;  1B9N A;  1XD7 A;  3V7C A;  4ENJ A;  4HBL A;  1T39 A;  1K78 B;  3JTG A;  2BGC A;  2HS5 A;  1JHF A;  1KA8 A;  2H94 A;  1G6N A;  5L3F A;  1RUO A;  1ZH5 A;  4YFX F;  2CSO A;  2MA3 A;  3FZV A;  1R5H A;  4LLL A;  2R7F A;  3GFI A;  5L3E A;  1BIA A;  4G8X A;  3I71 A;  5AIP A;  3C7J A;  2VBY A;  3DXJ F;  2X0L A;  4I7H A;  6PAX A;  3GLX A;  4ZH4 F;  2HKO A;  2QQA A;  2DW4 A;  4YIF A;  4BYY A;  1FSH A;  1GXP A;  2PMH A;  2Y0M A;  5HLG A;  1DPR A;  3BRO A;  1AWC A;  3CLO A;  3LFK A;  5BPI A;  4KDP A;  2G7U A;  1WKM A;  2HYG D;  3E6M A;  1YYV A;  2PN6 A;  3ZP5 A;  3PQJ A;  3F6O A;  1R1V A;  5LHI A;  1BI1 A;  2COM A;  2VE8 A;  3ZMT A;  2WWY A;  4EJV A;  5KK1 A;  1S29 A;  4L9J A;  2M30 A;  2FOK A;  1UB9 A;  5D5U B;  2PI0 A;  2HTJ A;  5CVJ A;  4EMS A;  3KEQ A;  1SD6 A;  3DEU A;  3LA3 A;  4A5M A;  5KVR A;  3N97 A;  3F8F A;  2FML A;  3LWF A;  1Z6T A;  4EJO A;  4HF2 A;  5JR3 A;  2ESH A;  3K9T A;  4O6J A;  1G3T A;  1QZY A;  4CXF A;  2A61 A;  4GGG A;  5HVQ C;  5H6Q A;  3BJA A;  2D1V A;  1CF7 A;  1F4K A;  5E20 A;  1IN4 A;  5LGN A;  2IP2 A;  2HKX A;  2XAQ A;  3E6C C;  1UFM A;  3RPU A;  2RQP A;  5LHH A;  4UVA A;  3E6B A;  3WE3 A;  1IF1 A;  1H9T A;  2VOD A;  1FWZ A;  1EH8 A;  5FFX A;  2LKP A;  5J8F A;  5DUK A;  1ZAO A;  3ZMV A;  3M8F A;  1LJ9 A;  3T0Y A;  1XGS A;  4FX0 A;  2A3S A;  2ZBK A;  1U3E M;  2QBY A;  2PG4 A;  3CUQ C;  3T8T A;  3JAM Z;  3RIR A;  2O61 A;  4IRI A;  1X3U A;  5D5W B;  3WTZ A;  3FM3 A;  2JTV A;  3OOP A;  3ERE D;  1XB4 A;  2JSC A;  1K79 A;  1V3F A;  3MZY A;  2OD5 A;  3FXQ A;  1U5T B;  4I2O A;  3MQ0 A;  4LG0 B;  4KIG A;  4IHS A;  3M9A A;  4I98 B;  2CGP A;  2VC0 A;  4U0W A;  3I4P A;  5D4S A;  1FX7 A;  2QVO A;  1HW1 A;  2EV5 A;  1BI2 A;  2MLK A;  4LK0 F;  2R3S A;  1U8R A;  3F22 A;  4L9V A;  1FBS A;  3E5Q A;  1W7P B;  3CO7 C;  5IT3 A;  3HIF A;  4WK8 F;  4HX8 A;  2V6C A;  3I64 A;  1IW7 F;  5J6X A;  1OPC A;  3NRV A;  2GQQ A;  1OYW A;  1XCB A;  3ECH A;  2STW A;  4Y17 A;  5E1Z B;  4BHP A;  3CUQ B;  3IKT A;  1XMK A;  2WV0 A;  4U88 A;  3WTY C;  3FM5 A;  3B02 A;  3TDZ C;  3ZQ7 A;  2FEZ A;  3P9I A;  2KKO A;  2P7C B;  4ZZD A;  5CVU A;  1F9N A;  3O2P E;  4I0A A;  3EYY A;  4XRF A;  3JW4 A;  4DQ2 A;  5LGT A;  4BNC A;  5E8I A;  2FBI A;  4PZJ A;  1J9I A;  5E1W A;  2ZXJ A;  3MZH A;  2CFX A;  4HA8 A;  2F2E A;  4G9Y A;  2F5F A;  2DBB A;  5HS9 A;  2P5K A;  4EGZ A;  1D5V A;  2HZT A;  3CO6 C;  2B0L A;  2HQR A;  4YG2 F;  3R6S A;  2QLZ A;  1O57 A;  3FMS A;  2YX7 A;  3REO A;  3RKX A;  3C18 A;  1WQ2 A;  3IRQ A;  4WXH A;  2GXG A;  1JE8 A;  1F5T A;  3KE2 A;  5HDN A;  3R61 A;  1GXQ A;  1UST A;  4XLN F;  2NNY A;  3MEX A;  2O6G E;  2XIG A;  4A0Z A;  4UNO A;  1BIB A;  3CDH A;  3HHG A;  1R1T A;  2ADU A;  4M74 A;  4AVP A;  5A2Q Z;  1OMI A;  2XKP A;  3HTU A;  1P4A A;  5ICE A;  1O3R A;  5EEG A;  4UHT A;  3ULQ B;  3QRF F;  2JT1 A;  1QNT A;  3TKY A;  2EFN A;  1RUN A;  2IA0 A;  3JSO A;  4RB2 C;  1HW5 A;  5D6E A;  4WF2 A;  1ODD A;  4A5N A;  2GIV A;  4AIH A;  5K5O A;  3KFW X;  4BQA A;  3TQN A;  3H92 A;  1U6G A;  3QAH A;  2K7L A;  5K5Q A;  1RI7 A;  4M71 A;  5F64 A;  5L3D A;  4HW0 A;  3HOT A;  3K1P A;  4P55 A;  4Y15 A;  5DEQ A;  2VBW A;  1SFE A;  5L3C A;  1XDS A;  2Q0O A;  1K7A A;  3RI4 A;  2Q2E A;  2G9W A;  2Q8K A;  2Z33 A;  4EM0 B;  4KIF A;  1R1U A;  2X4H A;  2YU3 A;  2GWR A;  1IN7 A;  3FXR A;  3SFZ A;  2Y75 A;  5DCF A;  2OQR A;  1ZAR A;  4UXN A;  4EV0 A;  5FFZ A;  3TOA A;  5LLQ A;  2OU2 A;  2YPR A;  4PGG A;  2DU9 A;  2HGC A;  3W6J B;  3OV8 A;  2LDU A;  3HRM A;  1XN7 A;  3KZY A;  4BHB A;  2LF8 A;  3G73 A;  4MEY F;  4FHT A;  2E7W A;  3F8M A;  2GAU A;  2MD5 A;  3F8N A;  2ZNZ A;  3IWZ A;  1U2W A;  1XGM A;  5ICG A;  3ECO A;  3D0S A;  2FF4 A;  4MTD A;  3V7S A;  4EJW A;  3I53 A;  5ILU A;  1BJA A;  2EFO A;  1LDD A;  5FD6 A;  4ENK A;  1AOY A;  2GXB A;  2JPB A;  4MHG A;  4HZF A;  5H20 A;  2RVC A;  5K5R A;  1WWX A;  4XSX F;  5DD4 A;  4UVB A;  2STT A;  3WOD F;  2P5L C;  4KIB A;  4KT5 C;  2RDP A;  3GEZ A;  2QWW A;  4HDV A;  1TQM A;  2BV6 A;  1TQI A;  2IJL A;  3M7G A;  2P5V A;  1D8K A;  5D8L B;  3WU1 B;  3BWG A;  2GA1 A;  1SFU A;  1EV7 A;  3MFK A;  2L01 A;  3PFI A;  1LEA A;  4LLN A;  2EFP A;  3HRT A;  4RGX A;  1T2K A;  2VBZ A;  3WTU C;  4G7Z F;  2WTE A;  1F1Z A;  3L09 A;  3V8L A;  4EVI A;  1KYW A;  3F21 A;  1P92 A;  2H6B A;  1BN5 A;  1WRJ A;  4EJU A;  2A5Y B;  3PQK A;  3QOP A;  3GFM A;  2VOP A;  3BPV A;  2EV6 A;  1MDM B;  2KJB A;  1SMT A;  4M73 A;  2AS5 F;  4A2U A;  2W25 A;  4MQV A;  2XAF A;  4RAZ A;  5EEH A;  1ZRC A;  3BOQ A;  3RJP A;  4WWC A;  1PDN C;  1IRF A;  3E3V A;  3ML6 A;  3I58 A;  4L9N A;  1IUY A;  4Y13 A;  4OMZ A;  5DDG A;  2EFQ A;  1FSE A;  1J5Y A;  2OQG A;  5E18 F;  3V8K A;  4G7O F;  3L7W A;  2EV0 A;  1BC8 C;  4XSZ F;  2ZCW A;  4H0E A;  4Q5S F;  3C3W A;  1PUE E;  1YTY A;  4IJA A;  4D0P A;  3RPQ A;  4KN7 X;  1KGS A;  1MJ9 A;  4UVC A;  3F72 A;  3GZ6 A;  1I1S A;  3ROU A;  3U1D A;  2RNJ A;  1B6A A;  2RGV A;  2QYO A;  4WXC A;  3LAJ A;  3WG9 A;  3KP6 A;  3NEU A;  4BH9 A;  4ZYH A;  1TW2 A;  2OBP A;  4IRH A;  1TNS A;  1LDJ A;  1R5G A;  2M1B A;  3WTX C;  1EH6 A;  1KYZ A;  3E6D A;  4S05 A;  1VTN C;  4CZZ A;  1C0W A;  2L4M A;  3BP8 A;  5BS6 A;  4OOI A;  4HLX A;  1Z7U A;  3H3Z A;  4N9H A;  4CHU A;  4IXA A;  2CW0 F;  1Z9C A;  2ETH A;  1MKM A;  1MGT A;  3P7N A;  4ENM A;  4HOB A;  3FF5 A;  4P9U A;  4E70 A;  3ZN0 A;  5CLS A;  1W7P A;  5LRS A;  1PP8 F;  3TDU C;  1HST A;  3COA C;  2Z99 A;  1IN8 A;  3IC7 A;  3V7R A;  5LGU A;  4O3M A;  5FLX K;  4OIO F;  1MJB A;  2H09 A;  2RKH A;  2OAZ A;  2R7D A;  4OIR F;  1KQ8 A;  2NRA C;  3ABT A;  1YQA A;  3VOE A;  5LEK A;  1O7F A;  4KN4 X;  2J5P A;  1B9M A;  4BXU A;  4DNC A;  3SZP A;  1W5T A;  1YW9 A;  3EET A;  4M9Z A;  2FU4 A;  4PGH A;  1JXS A;  2HFH A;  1ZYR F;  2QUF A;  2QQB A;  2FBK A; 
#chains in the Genus database with same CATH topology
 4A3G J;  1B72 A;  4E7L A;  1DUX C;  3OYJ A;  3HUG A;  1W36 C;  3L9F A;  1Y1W J;  4RGS A;  3PIP F;  4RA2 A;  4I0B A;  4RMN A;  4DBR A;  4KT6 A;  1I6X A;  2D2W A;  3D5R C;  4KUM A;  1BBY A;  1G3Y A;  1R4N B;  4BDZ A;  4RAG A;  2QCO A;  2K85 A;  2E1O A;  3HOS A;  3NWS A;  1A35 A;  2GZW A;  5FO5 A;  2E1M B;  1FOK A;  1DGW Y;  2M87 A;  2UXX A;  3TL4 X;  3H9Q A;  1TWC J;  3LOC A;  3KZI C;  5L3B A;  1D5Y A;  4LIU A;  4IVN A;  3WGH A;  5HOD A;  4ETS A;  2DJI A;  1JKO C;  2PX9 A;  2HZD A;  2VJ5 A;  5HLT A;  1K6O A;  3BR1 A;  2HDD A;  2AO9 A;  2FSW A;  5ICF A;  3EDP A;  2XAH A;  3RKW A;  9ANT A;  5BOX A;  1L3L A;  4MTE A;  2DLL A;  1SFO J;  2GLO A;  4BL0 B;  2W57 A;  4ZYD A;  2JJ7 A;  3BZ6 A;  5E3L A;  3SFI A;  1LDK B;  1XGO A;  4XN0 A;  5JI6 A;  1X58 A;  2DOF A;  3T5X A;  3S1R J;  1ZG5 A;  4YIR X;  4IZZ A;  3J80 K;  1TWF J;  2O03 A;  3H35 A;  1HKT A;  3LQR A;  5IP6 A;  4LG3 A;  3DP7 A;  2Z9O A;  3HGY A;  2ZJR F;  3G3Z A;  1VQ4 I;  1ETQ A;  4ZZL A;  2MBF A;  1OLT A;  1IUF A;  1VZ0 A;  4UV8 A;  2A5W A;  2NVX J;  3PUF A;  1E3H A;  3G4S I;  3IL2 A;  3I0T A;  3NQO A;  4CO8 A;  3CTA A;  3OYH A;  3JRI A;  3K2Z A;  1MH4 A;  3J81 K;  2L4A A;  1MJA A;  4XOR A;  3H0D A;  2BVM A;  2DQR A;  5B66 C;  1LVK A;  2M45 A;  5BMZ A;  1TZL A;  4YFN F;  4HQM A;  1MBF A;  2BXZ A;  1I5Z A;  3I59 B;  3O8G A;  2EA2 A;  2KIM A;  2HYF A;  2VC1 A;  2NNN A;  2B9S A;  2XPU A;  1AA7 A;  2CQN A;  2QKL B;  4WXD A;  5E3M A;  1Q1H A;  3I5U A;  2DK5 A;  2PQ8 A;  3N05 A;  1Z6R A;  4HYE A;  2MH9 A;  2K02 A;  4RLF A;  1FYK A;  1RNL A;  2R7Q A;  3CJR B;  2DPU A;  4L9T A;  1WJE A;  2BW3 B;  3FBI B;  5EDN A;  2DQL A;  5TJJ A;  4AYB A;  3R0A A;  4EAT A;  1FYM A;  3FXJ A;  4OAY A;  1MH3 A;  5FLX Z;  3IP4 B;  2L7F P;  3AG1 H;  2Y69 H;  4RB3 C;  1QQI A;  4M72 A;  1YW7 A;  2V1U A;  3CCE I;  2B63 J;  1RZ4 A;  1B8I A;  1HSJ A;  2E36 A;  5EG0 A;  3FIS A;  5LRR A;  1V5F A;  2FBH A;  3BQY A;  2CH0 A;  3BDD A;  3BJO A;  4GXO A;  1VI0 A;  2XF6 A;  4QLC U;  2MH2 A;  1VQP I;  4X6A J;  4Q48 A;  5LEJ A;  1T8I A;  1G4D A;  1FY7 A;  1SAN A;  2ELH A;  4D9J A;  1TWA J;  1QRY A;  2W84 A;  4ON0 A;  3LSJ A;  2LMD A;  5J47 A;  4M6X A;  4XKC A;  2B7E A;  2JA8 J;  3FXO A;  2FOW A;  5JVT A;  2L9S A;  4MEX F;  2DI3 A;  2LK2 A;  1LEB A;  1AU7 A;  2DMQ A;  1B4A A;  1FBU A;  1QVU A;  2VKD A;  2IXS A;  3ZMD A;  3WTT C;  1AKH B;  4KA4 A;  3OR1 C;  2KLO A;  4HV5 A;  2DDA A;  4PSX A;  3CCY A;  1V54 H;  1HXD A;  4II2 A;  3LA2 A;  3ZQI A;  2QEX I;  4M9X A;  3E0J B;  2VT3 A;  3GFL A;  4MNU A;  4MIM A;  2V79 A;  1X2M A;  3GWZ A;  4Y3O A;  2R5Y A;  3FHZ A;  4OIQ F;  2E19 A;  2TDX A;  2KP6 A;  1D0X A;  3P9K A;  2PJP A;  4UV9 A;  4CCL A;  5LBQ A;  5BPD A;  2LC2 A;  3OYD A;  1IAW A;  1G3S A;  3WTW C;  1UHM A;  1UZC A;  3W2V A;  4HQE A;  2DMT A;  1I27 A;  1WH5 A;  3A03 A;  2V9V A;  5GAG J;  4XLA A;  2Y48 A;  1Y0N A;  1H8A C;  1OCP A;  2LBF A;  1DGR M;  3JTH A;  1YIJ I;  2VUM J;  4PJM A;  4B4C A;  2DT5 A;  4FAS D;  1GT0 C;  5LHG A;  4DYR A;  2A6E F;  4I99 C;  2KIU A;  3ZQG A;  3JR9 A;  3GLL A;  2WBM A;  1NH3 A;  1XG1 A;  1I1G A;  4E7S A;  3GF2 A;  4F7Z A;  1DDN A;  2L0K A;  2MYS A;  5AIQ A;  3BZC A;  5CVI A;  1XGN A;  4AUX A;  3OYK A;  4HRI A;  3K1N A;  5HS8 A;  1IXR C;  4EQQ A;  3I9V 2;  4G12 A;  2K4B A;  1T0F A;  4IOC F;  2PJR A;  2ZNY A;  4HF1 A;  3OSF A;  1GVJ A;  1IGN A;  1P6R A;  2CQK A;  1ZQ3 P;  1T56 A;  5CVR A;  2EJR A;  2ZME B;  1OCO H;  3B6A A;  4LK1 F;  3EYI A;  4V2G A;  3KEY A;  3VSK A;  1ETO A;  3JCU C;  4UB6 C;  3F9K A;  1SD4 A;  5JHF A;  1H9G A;  2X1E A;  1PUF B;  3HSE A;  2CV0 A;  1IXC A;  4M3D A;  5CYV A;  2O0Y A;  3CC2 I;  2UV1 A;  3K70 D;  1VQ8 I;  2OV7 A;  4HX7 A;  1S8N A;  3H5A A;  2K9M A;  3V4G A;  2KIF A;  2QSG X;  1ZHF A;  4HNV A;  4EGY A;  5KAI C;  4ZYG A;  2M8E A;  3C1D A;  2CUF A;  3MKY B;  1U8B A;  3Q0W A;  2Z3Y A;  4R8H A;  4ASN A;  1B1B A;  2D5V A;  3RPU D;  3MCZ A;  3OYF A;  1Y8Q B;  2H6C A;  2JUG A;  2V1D A;  3CME I;  2IS4 A;  3DEW A;  3D1N I;  2HVR A;  4UUS B;  1XMA A;  2CYY A;  4NC7 A;  4BU2 A;  4GDF A;  2C6Y A;  2ESN A;  4XKV A;  3S3M A;  4XKW A;  1E3P A;  1MBJ A;  2WC2 A;  4LD5 A;  3B73 A;  2JRT A;  4KYW A;  3X2Q H;  4QPQ A;  5EYR A;  1MBK A;  1P4X A;  1XS9 A;  2XAS A;  3L2R A;  3CCU I;  4GCV A;  1QZE A;  2CO5 A;  2IT0 A;  1I39 A;  1Z05 A;  3DV8 A;  2BBY A;  2L7Z A;  3KP7 A;  3AAF A;  2Y30 A;  3G2B A;  2VQC A;  1CGP A;  2IS2 A;  2I5U A;  3HHH A;  3WHB A;  4PK4 A;  4AU7 A;  3QYF A;  3SZT A;  2ZKZ A;  2HOE A;  2OZ6 A;  4BE1 A;  3SZG A;  1DQU A;  2P8T A;  3DPT A;  1QO0 D;  4JX4 A;  3RTR A;  2L2O A;  5BQT A;  2WAD A;  4L5I A;  1R5I D;  5F27 A;  4RB1 A;  3W6V A;  2PBI A;  3KP2 A;  4XBF A;  1EJ9 A;  4PUS A;  2EZI A;  2Z16 A;  2PEX A;  4JX6 A;  1O7L A;  2XUB A;  3H5R A;  1E2X A;  2DT7 B;  2EIL H;  4A3B J;  4U7D A;  2HWV A;  2L5Q A;  4G6Q A;  1BI0 A;  3LQQ A;  2M3A A;  1FC3 A;  4Q47 A;  4WX9 A;  3S1Q J;  2QGU A;  3BR0 A;  2XV4 S;  5GPA A;  1MNE A;  2OJE D;  1SFX A;  1YS7 A;  3N4M A;  1U0J A;  3CMA I;  3MAJ A;  2RC4 A;  3WGG A;  5DYM A;  1OCC H;  5FJ8 J;  2KZG A;  1W36 D;  1G3W A;  1R36 A;  4RB0 A;  4BS9 A;  2VJI A;  4RM2 A;  1G2H A;  2F4O B;  3P9C A;  4RLQ A;  3BR6 A;  1KQ0 A;  4XLF A;  1CQT A;  3IWF A;  2FRH A;  1SMY F;  1MDM A;  4HV6 A;  2NAZ A;  4XL9 A;  1TLH B;  4ZDO A;  2Q2E B;  3IRR A;  1LKX A;  3M3Y J;  3ABU A;  1ERD A;  2COB A;  1K78 A;  1J09 A;  3WTV C;  3S93 A;  1REP C;  1BI3 A;  4XLP F;  2VKH A;  4U0Y A;  4XLC A;  1R9T J;  1D1A A;  2K40 A;  3WU2 C;  2DTZ A;  5IPA A;  1ONV A;  1LB2 A;  3FKI J;  1FNN A;  5FKN A;  2HEO A;  1ZRD A;  4IO9 F;  2KDO A;  1IN5 A;  3H9J A;  3S16 J;  1D1C A;  5DCM B;  3GBG A;  2XHK A;  3KP3 A;  5HLI A;  3RKY A;  4CA0 A;  2HXI A;  1YRN A;  4L5E A;  2A68 F;  2ACJ A;  1V4R A;  2R5Z B;  1YFH A;  1GLN A;  1MBG A;  1BA5 A;  5L3G A;  3IV5 A;  3S14 J;  4R79 A;  2D45 A;  5AON A;  1B59 A;  2EIK H;  2AHQ A;  4M3E A;  3PNV A;  4A6E A;  3CMM A;  3A2K A;  2XPV A;  4PJL A;  5IYB J;  1R7J A;  3ZXS A;  3UKG A;  5F0C A;  3OYG A;  1WJ5 A;  2AXL A;  4OMY A;  3SJM A;  5B5E C;  4AYB N;  1LE8 B;  2XRO A;  2DFF A;  3B6C A;  1I3Q J;  2IEK A;  1TTY A;  1KQ9 A;  4DBQ A;  1WJF A;  1HLV A;  1YE9 A;  4BY1 J;  3ZQQ A;  2F4I A;  3KP4 A;  1SVL A;  3AL0 C;  5CVV A;  2GOX B;  3ZN1 A;  2FE3 A;  3BPX A;  3GYH X;  4FX4 A;  1USS A;  1MW7 A;  3GUD A;  5D6F A;  2OTL I;  1WZ2 A;  3IAM 2;  1LUJ B;  2E5Z A;  2GBY A;  2M7A A;  2VJ4 A;  1J59 A;  2A07 F;  3L2W A;  3HXL A;  5FGM A;  1K6Y A;  3CC4 I;  1OFC X;  2VJJ A;  2EZL A;  3DBL B;  5H6R A;  1W0T A;  1ZGW A;  1K83 J;  2G0E A;  3FKJ A;  3LL7 A;  2V26 A;  2GXA A;  2IRF G;  3RDI A;  3TO9 A;  3BZK A;  5E1X A;  3RYP A;  1K4S A;  4PFP A;  3KLN A;  5CPR B;  3SYT A;  4M9S A;  3G6E I;  4CYC A;  4R1H A;  3OIP A;  3FMQ A;  3TP0 A;  2JA5 J;  4CDG A;  3OYA A;  4B8X A;  1FMV A;  2P4W A;  2W4S A;  1NHA A;  1Y0U A;  4OIP F;  3EUH A;  2LOO A;  2ISZ A;  4RAY A;  1OYY A;  3DU6 A;  3K7A J;  4FQG A;  1VF9 A;  2XB5 A;  1APL C;  2FQ4 A;  2L9V A;  3O3K A;  5HOO A;  4EM2 A;  1MD0 A;  4BQN A;  1FIA A;  4HEA 2;  1HKQ A;  5GAE J;  1ZN2 A;  5JVG F;  2HR3 A;  4WCG A;  3H3U A;  1X1A A;  2CG4 A;  2FA5 A;  3GCM A;  3JRB A;  5EZG A;  1BR4 A;  4W1U A;  3S3N A;  3VOD A;  4A3L J;  3A01 B;  3DEE A;  2E71 A;  1GV5 A;  1I50 J;  4FT8 A;  3BTJ A;  5F0F A;  4ESB A;  1QBJ A;  2P7V B;  3CUO A;  5DD8 A;  3W3C A;  2PLY A;  3VFZ A;  4F3Q A;  5J8C A;  1DP3 A;  2CMP A;  4HST A;  5K1Y A;  1J0R A;  4OWR B;  2BEO A;  4XLE A;  5D8K B;  2FQ3 A;  3JAM K;  4CCK A;  2VOO A;  5J3L A;  2O9L A;  1T6S A;  4DZP A;  1R22 A;  2UUZ A;  3QP6 A;  5JHU A;  3A02 A;  2EBI A;  1YLF A;  3FDY A;  1K4T A;  1NTC A;  1FTT A;  1QPM A;  2XRL A;  2VT2 A;  1KU7 A;  3HOZ J;  4JBA A;  2IA1 A;  2XGE A;  3F3X A;  3G1L A;  2ZFU A;  3O8H A;  5DTD A;  3HOW J;  2DFI A;  3HYI A;  5ED4 A;  1HC8 A;  3R4K A;  4IL6 C;  2R7T A;  3PNY A;  4C2U A;  4HLY A;  2D1H A;  1XDU A;  2DA5 A;  3G1O A;  2F48 A;  4Y4R A;  1JGS A;  4LLG F;  2BXY A;  3WGI A;  5J4Y A;  3KEO A;  2LF7 A;  2YSR A;  1DU0 A;  2EIN H;  1X1C A;  5HDK A;  3HOU J;  2JVH A;  3QPT A;  2EFW A;  3DPU A;  3GVA A;  1FLI A;  1VQK I;  4ESJ A;  3RYR A;  4O5V A;  4A3C J;  1RES A;  1ZGJ A;  2W85 A;  3HB9 A;  4AWX B;  2P0W A;  4CUG A;  1LNW A;  1P2F A;  5B3S H;  5IYC J;  1ZG1 A;  1FTZ A;  3GME A;  4I09 A;  1UAA A;  3KYD B;  2FXA A;  3M1C A;  4BHC A;  1X1B A;  3I3L A;  1FZP B;  1U5T C;  1FP1 D;  2CRG A;  2YUS A;  1IN6 A;  2BZT A;  4QWQ A;  4S04 A;  1E17 A;  1U5T A;  1R00 A;  1SD7 A;  5HDG A;  3PIO F;  4LG0 A;  1HDP A;  1WSU A;  1Z1D A;  5GAH J;  5ICC A;  4ZC3 A;  2E34 A;  3F8B A;  4L18 B;  3I56 I;  4X1E A;  2LSO A;  1WJB A;  4KIC A;  1QHG A;  4PDK A;  1HKS A;  4RDU A;  4L0Z B;  1ETY A;  1U9N A;  3EQL F;  4ZYE A;  2K86 A;  2Y2Z A;  3VWB A;  3W6K B;  3H1C A;  4YII A;  3H0G J;  2JMW A;  3E5U A;  4F92 B;  4AIJ A;  2EIJ H;  1GVD A;  4IKF A;  3GTM J;  3QU3 A;  2ZB9 A;  1IV8 A;  1BW6 A;  3M4O J;  1V5G A;  1XX5 A;  1ZLJ A;  2RNG A;  2E1N A;  3RQ4 A;  2XDV A;  3BG3 A;  3WTS C;  4G94 A;  2F5E A;  2WAE A;  4OAZ A;  4RAF A;  4L0Y B;  5DV5 A;  1YI2 I;  1GV2 A;  2ISY A;  4B3A A;  3AG3 H;  2VQL A;  4LB6 B;  1DP7 P;  2ELJ A;  5E8G A;  3Q0U A;  1ITY A;  3C2B A;  1LFP A;  1KZH A;  2VI6 A;  3ZR8 X;  1N78 A;  1MBH A;  5FD5 A;  2KRF A;  1I3A A;  3LNQ A;  2XAG A;  4M6Y A;  4B09 A;  4PCQ A;  3PO3 J;  2VE9 A;  2P6T A;  2JA6 J;  3GFJ A;  2JZY A;  4C3J J;  1UEL B;  3IHU A;  2R7Z J;  4PJJ A;  3IH2 A;  3CCM I;  2IA2 A;  2V9K A;  3L2V A;  4ITV A;  3BJ6 A;  3BCB A;  1ON1 A;  3FK6 A;  2H1L A;  2QEN A;  4KNY A;  4LB5 A;  3ESW B;  1A6Q A;  1RRJ A;  2RN7 A;  4A0Y A;  3CJN A;  4NNJ A;  5J40 A;  1H0M A;  4A0X A;  2CUJ A;  2JRM A;  3E5X A;  2VL8 A;  4X0G A;  3DBR B;  2P6S A;  1OYI A;  4GFB A;  3J7Y J;  4MGR A;  4N9I A;  3ZMS A;  1BJZ A;  4BDY A;  4D7M A;  4JK1 X;  2EK5 A;  3LSK A;  3VYU B;  1IZ1 A;  1T98 A;  1G59 A;  2NS7 A;  3CUQ A;  1S7A A;  2XC7 A;  1PP7 U;  4FIS A;  1XPX A;  4HF0 A;  3ZMZ A;  1VQ9 I;  3LA7 A;  3U9G A;  1Z91 A;  2K4J A;  4YRV A;  2R7V A;  2O3F A;  3S17 J;  1W5S A;  2ZFW A;  3I59 A;  4BEH B;  2HVS A;  2BYV E;  2NS0 A;  3V42 A;  5ILV A;  4XIC A;  4ZTJ A;  1KU2 A;  1HQC A;  1JUP A;  1TWH J;  3OYC A;  3BLY A;  5D5V B;  1YW8 A;  3BTL A;  4ENN A;  4Z2Y A;  4I02 A;  1S3J A;  1IXS B;  1UHS A;  2VBX A;  1CF7 B;  2DO7 A;  2R7W A;  1R49 A;  3J7Z I;  4LMY A;  2R93 J;  1WH7 A;  3LST A;  2VXZ A;  1S7O A;  4A3F J;  3IH3 A;  3CD6 I;  1W4M A;  2HPI A;  4FE4 A;  1XCV A;  2F5C A;  5A2Q K;  4UUT A;  3TO6 A;  5D4R A;  3MKZ A;  1HOM A;  1D0Y A;  3KCC A;  1R58 A;  1W5C C;  2QSH X;  2ZJ2 A;  3GO5 A;  3NWT A;  4L5J A;  3CDL A;  3S15 J;  4D1Q A;  3K4J A;  3OMY A;  3ELK A;  2IW5 A;  1FYL A;  1QGP A;  2EZK A;  4XRS A;  1YHQ I;  4MFD A;  5FB2 A;  3TP3 A;  2R92 J;  1SD5 A;  2O8X A;  3IH4 A;  3S8P A;  1QZZ A;  4HX4 A;  4IF4 A;  2QQ9 A;  1LVA A;  2QBY B;  4N4O B;  4K2E A;  2KPM A;  1JUS A;  4AID A;  4MQ9 F;  3K69 A;  3TO7 A;  1WPK A;  2VON A;  2YS9 A;  3I54 A;  1Z3X A;  4CH7 A;  2KIS A;  4NC6 A;  1YO5 C;  4UY8 I;  4JX5 A;  2CW8 A;  4BBR J;  1NK3 P;  2R0Q C;  1MZB A;  1VQO I;  5K7Z A;  3MWM A;  1ZR2 A;  2CWE A;  1U78 A;  2ZJP F;  3HUG B;  4LFU A;  4IQJ A;  4C2T A;  4J19 A;  4GO1 A;  3JRC A;  2ZJQ F;  1NG6 A;  3LSH A;  1IJW C;  5IT9 K;  3K10 A;  3SEQ A;  2NOJ B;  2LR8 A;  2AQF A;  4EJT A;  4P9F A;  1UHW A;  3S2W A;  1IDZ A;  2YX4 A;  5ILS A;  4ABZ A;  5GTH C;  4LJZ F;  4U7B A;  3QP5 A;  4A3M J;  1X3Z B;  3ZPL A;  4C3H J;  3SXY A;  4A3E J;  3T8R A;  2X6X A;  1FPQ A;  5E79 C;  1BC7 C;  1JI8 A;  3TW7 A;  3L2C A;  3E7L A;  1X1D A;  3DF8 A;  1R4M B;  4ZJZ A;  4PFO A;  4ZDL A;  2GA2 A;  4LGW A;  1IRG A;  1FBQ A;  1BM9 A;  4A3I J;  1TQP A;  3DBH B;  3R60 A;  1FP2 A;  1GDT A;  3U2R A;  3HSF A;  3K2A A;  2JPC A;  4BAY A;  5CQG A;  3F23 A;  3HGG A;  2O8K A;  5FLV A;  1QU3 A;  2HTS A;  3FWE A;  2E1C A;  1MIJ A;  2OF7 A;  3L2U A;  3HJE A;  1JJ6 C;  2Z2S B;  2FMY A;  1P9Q C;  4DIQ A;  4Q4Z F;  2L9N A;  2EB7 A;  2TRT A;  1P4W A;  2W7N A;  2ZME A;  3CMY A;  1SC7 A;  1P7I A;  2NVY J;  2M5W A;  2QM3 A;  3DFG A;  4M3B A;  4CYD A;  2KJC A;  2E2J J;  1WFX A;  5FKM A;  1PUF A;  4II3 A;  5E3N A;  4G7H F;  4J00 A;  1R23 A;  1JTX A;  2XAJ A;  2A6H F;  2L54 A;  3E97 A;  2UZK A;  1ZLK A;  3HKZ N;  3BTI A;  2VN2 A;  2ID6 A;  1POG A;  1O3S A;  3J7A O;  4RGR A;  3U1K A;  3S3O A;  2DA2 A;  3HDD A;  1YIO A;  3K4L A;  4IRG A;  3ZCO A;  3L2Q A;  1MBE A;  2DMP A;  4YFK F;  2OZU A;  2EWN A;  2XGC A;  2E7X A;  2L7M P;  3LAP A;  1ZRE A;  2XVC A;  3PSI A;  1KU9 A;  4I01 A;  2FNP A;  1Y6I A;  1XSX A;  1Z21 A;  2QZ8 A;  1YJW I;  4NQW A;  4DZJ A;  4EM1 A;  5GPC A;  5FLM J;  2DT6 A;  2WAQ A;  2EA4 A;  2K9L A;  2E5N A;  3F0C A;  3JRG A;  1JKP C;  1JHH A;  1J75 A;  3ISP A;  3J80 Z;  3SHF A;  1DPU A;  2ZO4 A;  1HA8 A;  2HNH A;  2LNB A;  1JKQ C;  3WU0 A;  2R7S A;  3VYR B;  3DPL C;  1WJA A;  1TWG J;  2IPQ X;  1N77 A;  3Q5F A;  2LRE A;  1WI9 A;  3CLQ A;  3KP5 A;  1HW2 A;  2MC3 A;  2PMU A;  3WE2 A;  4CCJ A;  2DTR A;  1T0F C;  4D5C A;  3SQN A;  1GUU A;  1B8I B;  1RR8 C;  4HAM A;  3M1E A;  5F6F A;  4A12 A;  3GXO A;  1OIS A;  5EG0 B;  4UUV A;  2FUG 2;  2Y0S A;  2F4M B;  2FX0 A;  2W24 A;  3FMR A;  3HRU A;  3J81 Z;  2WY8 Q;  2MAB A;  3ZQL A;  4OU0 A;  5E17 F;  1OKR A;  4MO7 A;  1S6L A;  4ESF A;  3KET A;  1RIO H;  5C3E J;  4KJZ A;  2HQA A;  3FK7 A;  1TBX A;  2QA4 I;  5HS7 A;  1ULY A;  2K9S A;  1KU3 A;  2PFB A;  3KYC B;  2NYX A;  4N0B A;  4JQF A;  1SAX A;  4YEL A;  4AD9 A;  1XSD A;  4XOP A;  1UG2 A;  1L0O C;  3I4M J;  1UJ8 A;  2X1D A;  1YS6 A;  3T1B A;  5IT9 Z;  1HCR A;  4G6D A;  5ERI A;  3VB2 A;  2XGX A;  2FNA A;  5CKT A;  2H27 A;  3VEP A;  5D5X B;  2XRN A;  2DPD A;  4E7H A;  4IPA A;  4F52 A;  4TV7 A;  5F1R A;  2XKO A;  4XON A;  1W7P D;  2R5Y B;  1HF0 A;  4P5O A;  3K1M A;  2A69 F;  3TOB A;  1S72 I;  2LG4 A;  4M3F A;  2DK8 A;  2DOE A;  4CIC A;  2DA3 A;  5IOZ A;  3V8J A;  2LH9 A;  1FT9 A;  2HDC A;  2LFB A;  2O7O A;  2G7H A;  5DCM A;  2LKX A;  3JSP A;  1R71 A;  2KMU A;  4U87 A;  2Z5U A;  3F6V A;  4Y7N J;  1T95 A;  3DKW A;  1EH7 A;  4A6D A;  1MMN A;  4CCM A;  1J2X A;  5J1R A;  2BHY A;  2M9H A;  5TGT A;  3K0L A;  3DKY A;  3ZQF A;  3ZMU A;  5JLW A;  3HM5 A;  3QPH A;  1ZGA A;  5H2F C;  2LBF B;  1IG7 A;  3GW2 A;  3HSR A;  3MZ8 A;  4D5F A;  1ETW A;  3O6B B;  1X1P A;  1Y8R B;  3D5L A;  1UCR A;  3H5N A;  2YR2 A;  1D8J A;  3FXU A;  3CES A;  4P96 A;  2E60 A;  4KFC A;  2R7U A;  1LE8 A;  5CJ9 A;  4AVZ A;  1E0E A;  4DGW B;  1O3T A;  2M0M A;  2ZXH A;  2CQX A;  1UG0 A;  4AC0 A;  4HDU A;  1BR1 A;  5C4X J;  2X6W A;  3DKX A;  3PO2 J;  2M8G X;  2IGN A;  4GYG A;  5KNL A;  1FMW A;  2MD0 A;  1D3Y A;  2UXN A;  1FOX A;  4QSH A;  1TNT A;  3DTI A;  2RV8 A;  3HL2 A;  4GRI A;  3HBL A;  3CQZ J;  2IS1 A;  1STZ A;  1Y56 A;  3ZGK A;  2A6T A;  3EUA A;  3QOD A;  1ACI A;  3HTS B;  1MMS A;  2JA7 J;  1BOA A;  3F8C A;  3M8E A;  3OWT A;  2ME0 A;  2VQH A;  3GZ5 A;  2WAF A;  1TW3 A;  3HOY J;  3C2H A;  1A04 A;  3CJQ B;  3BY6 A;  2HQN A;  3L00 A;  4QTR A;  2XPW A;  1HBX G;  3FX3 A;  2L02 A;  2IVM A;  3JRE A;  4RS8 A;  1FOW A;  2IGK A;  1LQ1 A;  4C9Y A;  3RQI A;  2H8R A;  4XN3 A;  5HLH A;  2HOA A;  4U0V A;  5LD2 C;  1SEU A;  1OR7 A;  2JSP A;  4NB5 A;  1ZRF A;  3KLO A;  2CW7 A;  3RZD J;  1VND A;  2LLK A;  3QU6 A;  4GYI A;  3SDB A;  4E7I A;  2JQ7 A;  5TRD A;  4Y52 J;  1WJD A;  3AKZ A;  2V1X A;  4KMF A;  2MSY A;  3IKV A;  1R6R A;  1JT6 A;  1RR7 A;  2ECC A;  2X9D A;  3KYL A;  3Q9S A;  3JRD A;  2YU9 J;  4G6T B;  3OSG A;  1MSE C;  4AIK A;  1QHH D;  5KHD A;  5M5W J;  1D1B A;  2NVU B;  2MLG A;  3KZZ A;  2M4G A;  2UWM A;  3KX2 A;  1YG2 A;  2OA4 A;  3S1N J;  1GHC A;  3D5S C;  3KPH A;  4XLH A;  4KMU X;  1T38 A;  4AM3 A;  2DAO A;  4XID A;  3Q9V A;  5JFR A;  5J4V A;  1ZK8 A;  1ON2 A;  4LOC A;  3PNT A;  2F6C A;  5DUI A;  4OIN F;  3HRS A;  2L3D A;  1J7K A;  2BE5 F;  3GTK J;  2K27 A;  3J7A Y;  3R0J A;  4NHJ A;  2F5D A;  2OPT A;  1XSV A;  3WHC A;  1O3Q A;  2M4K A;  3DQV C;  2VPR A;  5F04 A;  4RGU A;  4CGZ A;  2ZXI A;  4ZTF A;  3JRA A;  3GX4 X;  4IHT A;  4BUP A;  2J5O A;  3TGN A;  1IDY A;  2KL4 A;  3AFH A;  1ZG3 A;  4XRM A;  3EUH C;  5FRO A;  1B9N A;  5DM6 F;  1BW5 A;  2DCE A;  1XD7 A;  3ZQC A;  1RKW A;  3V7C A;  2EH3 A;  1VQL I;  4JOM A;  4ENJ A;  2FD5 A;  1ZR4 A;  1G8X A;  3QYB A;  4HBL A;  4PJ0 C;  3CCV I;  1T39 A;  2OC6 A;  2HOT A;  2CU7 A;  4FCY A;  1K78 B;  3JTG A;  5DS9 A;  4E6K G;  4MFE A;  2BGC A;  4M3G A;  2HS5 A;  5M5X J;  1JHF A;  1KA8 A;  2H94 A;  1G6N A;  3DTE A;  5L3F A;  1RUO A;  2GIZ A;  4W97 A;  1ZH5 A;  4YFX F;  2CSO A;  2MA3 A;  3FZV A;  1R5H A;  3HPH A;  4LLL A;  2R7F A;  2IBD A;  3GFI A;  5L3E A;  3DLL F;  1A6I A;  4ZDP A;  1ENH A;  4IHW A;  4HSR A;  1BIA A;  4G8X A;  4BE2 A;  3I71 A;  5AIP A;  3C7J A;  3LSR A;  2VBY A;  1FEX A;  1XC5 A;  2WAQ N;  2DA4 A;  3DXJ F;  2PMZ A;  2X0L A;  4I7H A;  3OYL A;  6PAX A;  1V5E A;  3GLX A;  4ZH4 F;  3S1M J;  2HKO A;  2QQA A;  2DW4 A;  4YIF A;  2V7F A;  2H8W A;  2ICW G;  4BYY A;  1FSH A;  1GXP A;  2PMH A;  2Y0M A;  5HLG A;  1DPR A;  2X51 A;  2LVS A;  3BRO A;  3A4C A;  2ECB A;  1AWC A;  3BG7 A;  3AL0 B;  3CLO A;  3LFK A;  5BPI A;  4KDP A;  4FTH A;  2G7U A;  1WKM A;  2X1C A;  1PJR A;  2HYG D;  3S32 A;  3RSN A;  3E6M A;  1YYV A;  2P81 A;  2PN6 A;  3ZP5 A;  3PQJ A;  2LRD A;  2HI3 A;  1JTY A;  3F6O A;  1R1V A;  5LHI A;  4IQ4 A;  1BI1 A;  2COM A;  3OYN A;  2VE8 A;  3MVP A;  3ZMT A;  3BCA A;  5EGO A;  2WWY A;  4EJV A;  1OQY A;  4CYC B;  3QQA A;  5KK1 A;  1S29 A;  4L9J A;  2M30 A;  1T33 A;  1EA3 A;  4YEJ A;  3OS1 A;  3VDX A;  2FOK A;  1UB9 A;  4KIS A;  2JN6 A;  2E2I J;  2K3P A;  4BKX A;  5D5U B;  1FJL A;  2PI0 A;  2MC4 A;  2DDB A;  4RBO A;  3OYB A;  2HTJ A;  3A0B C;  2R4G A;  3SDG A;  5K7H A;  5CVJ A;  1ETV A;  4EMS A;  2M0C A;  3KEQ A;  1SD6 A;  2W00 A;  3DEU A;  2Q1Z B;  2LP0 A;  3LA3 A;  4A5M A;  2QQ8 A;  5KVR A;  3N97 A;  2I8D A;  3F8F A;  4XKB A;  4Z6Y A;  2FML A;  3LWF A;  1Z6T A;  4V19 K;  3DLA A;  4EJO A;  2E1M C;  2R7R A;  4BQQ A;  4HF2 A;  5JR3 A;  2ESH A;  3K9T A;  4KIT B;  4BJ5 C;  1MMG A;  4O6J A;  5IOY A;  1G3T A;  3CP8 A;  1QZY A;  4CXF A;  3PL8 A;  2A61 A;  4GGG A;  2OUM A;  2QKM B;  1VFC A;  2EPF A;  3HC7 A;  5HVQ C;  5H6Q A;  1A36 A;  4BGD A;  2VXD A;  3BJA A;  2D1V A;  1CF7 A;  1F4K A;  2XSJ C;  5E20 A;  1ZKG A;  1IN4 A;  1LFB A;  5LGN A;  2IP2 A;  2HKX A;  2XAQ A;  3UR3 C;  3E6C C;  1UFM A;  3RPU A;  3M07 A;  2RQP A;  5LHH A;  4BAC A;  4UVA A;  3E6B A;  3WE3 A;  1IF1 A;  1H9T A;  3VPR A;  2VOD A;  2DA7 A;  2CQQ A;  1FWZ A;  3FHN A;  1EH8 A;  5J1U A;  2IS6 A;  5FFX A;  2LKP A;  4HG2 A;  1A31 A;  5J8F A;  5DUK A;  1ZAO A;  1O4X A;  4CSW A;  2QSF X;  3GTO J;  2E35 A;  1FIP A;  2BY2 A;  3ZMV A;  2E2H J;  3M8F A;  3DCF A;  1LJ9 A;  4DYQ A;  4E4H A;  1PYV A;  3T0Y A;  1Z3Y A;  2ME6 A;  1XGS A;  4FX0 A;  4DW6 A;  2A3S A;  2ZBK A;  5IY5 H;  1U3E M;  2QBY A;  2PG4 A;  3CUQ C;  4XMY A;  3T8T A;  3JAM Z;  3RIR A;  4BXF A;  2O61 A;  4IRI A;  1X3U A;  5D5W B;  4UB8 C;  1IV6 A;  3OYE A;  3WTZ A;  3FM3 A;  2EQR A;  5IP7 J;  2JTV A;  3OOP A;  3ERE D;  1XB4 A;  2JSC A;  1K79 A;  3CF5 F;  1V3F A;  2CS3 A;  3MZY A;  4QPO A;  2OD5 A;  5HNF A;  4XQF A;  3FXQ A;  1U5T B;  4I2O A;  3MQ0 A;  4LG0 B;  1EKE A;  4KIG A;  4DJA A;  2KZV A;  4IHS A;  1Y1V J;  3K4M A;  3M9A A;  4I98 B;  2CGP A;  2K3F A;  4D7N A;  4JP0 A;  2VC0 A;  4U0W A;  1TT0 A;  3I4P A;  3OYI A;  2BW3 A;  1I6H J;  3GZN B;  5D4S A;  1WVR A;  2V1N A;  3EPZ A;  3S2D J;  1FX7 A;  1RET A;  2QVO A;  1HW1 A;  2EV5 A;  1BI2 A;  2K9Q A;  3PFY A;  2MLK A;  4PJN A;  4LK0 F;  2R3S A;  3BT9 A;  1U8R A;  3F22 A;  4L9V A;  2DOD A;  1N75 A;  1FBS A;  3E5Q A;  1W7P B;  1MMD A;  3CO7 C;  3GTQ J;  5IT3 A;  5FRN A;  3HIF A;  3JRF A;  4WK8 F;  2O5R A;  1XTA A;  3K4C A;  3JRH A;  2HU9 A;  4HX8 A;  3BR2 A;  3C2G A;  4A3K J;  3HPG A;  5DM7 F;  2V6C A;  4IHV A;  3OYM A;  3I64 A;  3G71 I;  1Z77 A;  2W48 A;  2M7B A;  5M3M J;  2ID3 A;  1IW7 F;  1AKH A;  5J6X A;  1OPC A;  3NRV A;  2CUZ A;  4XNF A;  2BOL A;  2GQQ A;  2VIX A;  1OYW A;  2XB0 X;  2DA1 A;  1XCB A;  1QVT A;  5J1Y A;  2WA0 A;  3ECH A;  1ZTR A;  2JUC A;  4C3I J;  1B72 B;  2STW A;  4Y17 A;  2ZSH B;  1Y39 A;  4A3D J;  2EIM H;  5E1Z B;  4BHP A;  2VQG A;  3CUQ B;  3IKT A;  1TL8 A;  2I10 A;  1XMK A;  2WV0 A;  1UMQ A;  5EJC A;  1YX3 A;  4U88 A;  3WTY C;  5K7F A;  3RKQ A;  2R7O A;  2CV1 A;  3FM5 A;  3B02 A;  3TDZ C;  4I6Z A;  2ZXW H;  4M6V A;  3ZQ7 A;  2KQR A;  3TBI A;  1Z0X A;  2FEZ A;  2RQQ A;  3LSI A;  1YOV B;  2KKO A;  3P9I A;  4E7Z A;  2P7C B;  4ZZD A;  2R7X A;  2JA2 A;  5CVU A;  3MKW B;  1F9N A;  3O2P E;  4NDL A;  1XMX A;  4I0A A;  3EYY A;  1MMA A;  1IO2 A;  3JW4 A;  4XRF A;  4DQ2 A;  1F36 A;  5LGT A;  4BNC A;  5E8I A;  2FBI A;  4PZJ A;  1F43 A;  2CFO A;  1J9I A;  5E1W A;  2ZXJ A;  3K4K A;  3MZH A;  1PVE A;  2F5V A;  2PMZ N;  3HEF A;  2CFX A;  5FKK A;  4HA8 A;  2F2E A;  4G9Y A;  2F5F A;  2DBB A;  5HS9 A;  2P5K A;  4EGZ A;  5EZH A;  1D5V A;  2HZT A;  1RKT A;  3CO6 C;  1D0Z A;  2ZME C;  2B0L A;  2HQR A;  4YG2 F;  4C2M J;  3R6S A;  2QLZ A;  5LFA A;  1O57 A;  3FMS A;  3OIO A;  2YX7 A;  3DWL E;  2DMU A;  3REO A;  3RKX A;  3C18 A;  2KRH A;  1WQ2 A;  1OJL A;  3IRQ A;  4IEJ A;  2EZH A;  2BY1 A;  3QPL A;  2DFH A;  2GXG A;  2HQ5 A;  3CJT B;  4WXH A;  4E7J A;  1JE8 A;  1F5T A;  3KE2 A;  5HDN A;  3R61 A;  1GXQ A;  1UST A;  3Q3S A;  1NK2 P;  3M8J A;  3PUB A;  4XLN F;  2NNY A;  3MEX A;  2M34 A;  3TMO A;  4BQO A;  3OS0 A;  2O6G E;  3WG7 H;  1N25 A;  2VLA A;  2XIG A;  2IAI A;  4FE7 A;  4V2F A;  4A0Z A;  4UNO A;  2NS8 A;  3DU5 A;  1BIB A;  3L1P A;  3CDH A;  1X2N A;  3HHG A;  5KAF C;  1R1T A;  3QYE A;  1DU6 A;  2ADU A;  2XAU A;  4UUS A;  1M1E B;  1X4O A;  2GM4 A;  4M74 A;  4AVP A;  5A2Q Z;  1OMI A;  2XKP A;  3HTU A;  3ABM H;  1P4A A;  5ICE A;  3CP2 A;  3CCQ I;  1O3R A;  4BXX J;  5EEG A;  3K6G A;  2K9N A;  4UHT A;  2N8G A;  4F93 B;  3ULQ B;  1WGX A;  2WB1 A;  2JT1 A;  3QRF F;  2DA6 A;  1H88 C;  1QNT A;  3TKY A;  1W0U A;  3OIQ A;  1BR2 A;  2DOA A;  1JT0 A;  2EFN A;  1RUN A;  2IA0 A;  4CCN A;  3JSO A;  2CQ7 A;  4RB2 C;  4BJ6 C;  1HW5 A;  5D6E A;  4WF2 A;  3H9G A;  3OR2 C;  1ODD A;  4A5N A;  2GIV A;  4AIH A;  5EF6 A;  5K5O A;  3KFW X;  3CC7 I;  4BQA A;  3TQN A;  3VYS B;  3H92 A;  1U6G A;  3QAH A;  2K7L A;  4CZC A;  2CJJ A;  3OY9 A;  5K5Q A;  1RI7 A;  4M71 A;  2RAE A;  5F64 A;  5L3D A;  3CCJ I;  4BBS J;  3OS2 A;  4HW0 A;  2OTJ I;  3HOT A;  3H36 A;  3K1P A;  2X6O A;  2VKE A;  4P55 A;  5HNH A;  4E7K A;  1QA6 A;  4Y15 A;  5DEQ A;  2VBW A;  1SFE A;  2JK3 A;  5L3C A;  2MGQ A;  3A0H C;  2V4J C;  1X3W B;  1XDS A;  2Q0O A;  1K7A A;  2ZSI B;  1YIT I;  5F0H A;  1H89 C;  4HNU A;  1LFU P;  3BG6 A;  3NAU A;  3QPS A;  3RI4 A;  1YX5 A;  3ABL H;  1WJC A;  3FXL A;  2XGD A;  3K4B A;  2Q2E A;  2G9W A;  2Q8K A;  2Z33 A;  2ELK A;  1TT5 B;  2IGO A;  4EM0 B;  1TC3 C;  3BC8 A;  1VQ7 I;  3TED A;  2KRC A;  4KIF A;  4B44 A;  2NVT J;  2GOM A;  4IOA F;  1R1U A;  2X4H A;  2YU3 A;  2GWR A;  5F08 A;  2CV2 A;  1IN7 A;  2L7K A;  3FXR A;  1WI3 A;  3MN2 A;  4A93 J;  3SFZ A;  4LIV A;  4IHX A;  2Y75 A;  3CCS I;  5DCF A;  2OQR A;  1ZAR A;  4UXN A;  4EV0 A;  5FFZ A;  3TOA A;  4NQW B;  5LLQ A;  3VYT B;  2OU2 A;  2V6E A;  2YPR A;  4PGG A;  2DU9 A;  2R5Z A;  3LSG A;  3GTL J;  4EEF G;  2HGC A;  2WV1 A;  3W6J B;  3W2A A;  1OCR H;  3OV8 A;  4BE0 A;  2LDU A;  3HRM A;  1XN7 A;  3KZY A;  4BHB A;  1A5J A;  2LF8 A;  3G73 A;  4IHY A;  4A3J J;  3EUK L;  4MEY F;  4FHT A;  2E7W A;  3E1S A;  3LMM A;  3F8M A;  2GAU A;  2MD5 A;  1SAU A;  3F8N A;  4B47 A;  4DYC A;  2ZNZ A;  1VQM I;  1T08 B;  3IWZ A;  1U2W A;  1XGM A;  5ICG A;  2DFE A;  3ECO A;  3D0S A;  5TIS C;  3IUO A;  4IX7 A;  1S9H A;  2FF4 A;  1RPW A;  1SFK A;  4MTD A;  3IAS 2;  2LY2 A;  2AQE A;  3V7S A;  4F55 A;  4EJW A;  3I53 A;  4F91 B;  5ILU A;  1BOB A;  2X48 A;  1BJA A;  1EF4 A;  2EFO A;  1LDD A;  5FD6 A;  2PJR B;  4ENK A;  3A1Y A;  1AOY A;  4S0H B;  2GXB A;  3P5J A;  2WY7 Q;  2JPB A;  4MHG A;  3RCO A;  3TW6 A;  4HZF A;  5H20 A;  3LSP A;  2HOS A;  2RVC A;  2TCT A;  4NC8 A;  3HOX J;  1LPQ A;  5K5R A;  1WWX A;  2H1K A;  3AG4 H;  4XOT A;  5E3O A;  3CCL I;  4XSX F;  5DD4 A;  4UVB A;  2STT A;  3WOD F;  5M5Y J;  2P5L C;  1S7E A;  4KIB A;  4KT5 C;  2RDP A;  2MFZ A;  3GEZ A;  1TP4 A;  2KIQ A;  3I4N J;  4B3X A;  3ONQ A;  1OR7 C;  2QWW A;  4LIT A;  5KCM A;  2BVL A;  4HDV A;  4BY7 J;  1TQM A;  4HNT A;  2BV6 A;  1TQI A;  3DTK A;  2K5C A;  5BNG A;  2IJL A;  2HYJ A;  3M7G A;  2P5V A;  1D8K A;  3BR5 A;  3MKL A;  5D8L B;  3WU1 B;  3BWG A;  2A05 A;  1S5L C;  3K4N A;  2GA1 A;  3CDI A;  4I76 A;  3FXM A;  1SFU A;  2VB6 A;  1EV7 A;  3MFK A;  1V55 H;  2LYC A;  3A01 A;  3HZJ A;  2L01 A;  3PFI A;  4XK4 A;  2V9P A;  1LEA A;  3ZQH A;  1X4P A;  4LLN A;  2EFP A;  3HRT A;  4RGX A;  1T2K A;  2VBZ A;  4XR6 A;  3WTU C;  2DN0 A;  2WTE A;  4G7Z F;  2Y9Z A;  2NVQ J;  1QPI A;  1F1Z A;  2FJ1 A;  5FKL A;  3L09 A;  4JYK A;  3V8L A;  1AHD P;  3VSL A;  3FBN B;  3OL3 A;  4EVI A;  1ETX A;  5GTI C;  4NBQ A;  2LKS A;  3UNG C;  1ETK A;  4B1R A;  1WCM J;  1NG7 A;  1KYW A;  1Z7L A;  2VAS A;  3F21 A;  2VKV A;  2NOG A;  1P92 A;  1Q1V A;  2H6B A;  1JKR C;  1BN5 A;  4MLO A;  1WRJ A;  4EJU A;  2A5Y B;  3PQK A;  5F1J A;  3QOP A;  3GFM A;  2VOP A;  2HVQ A;  3BPV A;  5CQE A;  4Y33 A;  1W1W E;  3CF2 A;  2DXI A;  2EV6 A;  1HDD C;  1MDM B;  2KJB A;  2Y9Y A;  1SMT A;  5M3F J;  4M73 A;  2DJN A;  2AS5 F;  4A2U A;  2W25 A;  5FRM A;  4MQV A;  2XAF A;  3GTG J;  3BG5 A;  2XSD C;  4RAZ A;  1RC9 A;  2KT0 A;  1P7J A;  5EEH A;  1IRZ A;  2OCE A;  1ZRC A;  1MND A;  2QF7 A;  3BOQ A;  3RJP A;  3NAR A;  4WWC A;  3U21 A;  1IC8 A;  1PDN C;  1IRF A;  2LY1 A;  4FET A;  3E3V A;  3FIW A;  1YRN B;  2BHZ A;  3ML6 A;  2LD5 A;  3I58 A;  4L9N A;  3LFU A;  3GTJ J;  3BG9 A;  1IUY A;  1X19 A;  4Y13 A;  4OMZ A;  5DDG A;  1VQN I;  2JWT A;  2EFQ A;  2ZC2 A;  1FSE A;  5C44 J;  4RM3 A;  4N4N B;  1OCZ H;  1J5Y A;  2OQG A;  5E18 F;  2JVG A;  3V8K A;  4G7O F;  3L7W A;  1SVO A;  3ZRG A;  1KON A;  2EV0 A;  2HDW A;  1BC8 C;  5GP9 A;  4XSZ F;  2WB1 N;  2ZCW A;  5FKO A;  3I55 I;  5B1B H;  4H0E A;  4H4K C;  3LSM A;  2KDZ A;  4DOZ A;  2Y31 A;  4Q5S F;  1IRX A;  4B48 A;  3C3W A;  1YJ9 I;  1PUE E;  4HPQ A;  2OCC H;  3KIO A;  1YTY A;  4IJA A;  3PJR A;  4D0P A;  4C30 A;  3RPQ A;  2M2E A;  4A69 C;  4KN7 X;  2Y0S N;  1E3O C;  1VQ5 I;  3H3V K;  5JLX A;  1KGS A;  1MJ9 A;  4UVC A;  3F72 A;  3GZ6 A;  1I1S A;  3ROU A;  3PM1 A;  3U1D A;  2RNJ A;  1B6A A;  1Z67 A;  3HG9 A;  2RGV A;  3FXK A;  2MG4 A;  1YJN I;  3BQZ A;  2W1O A;  2QYO A;  2NXN B;  4WXC A;  3BTC A;  2BY0 A;  3QWL A;  3ABK H;  3LAJ A;  3WG9 A;  3KP6 A;  1VQ6 I;  3NEU A;  3BR3 A;  4BH9 A;  4ZYH A;  2X85 A;  1TW2 A;  3GTP J;  2OBP A;  3Q0V A;  1TNS A;  4IRH A;  5GAD J;  1SVM A;  1LDJ A;  3AG2 H;  2XF7 A;  4PSW A;  4ANJ A;  4B43 A;  1WHU A;  1R5G A;  2M1B A;  3ZOB A;  3CCR I;  3HKZ A;  3WTX C;  2XF5 A;  1EH6 A;  1KYZ A;  3E6D A;  4S05 A;  1VTN C;  4CZZ A;  1C0W A;  2L4M A;  3BP8 A;  5C4J J;  3S2H J;  3OL4 A;  5BS6 A;  1FOY A;  4OOI A;  2LY9 A;  3PSF A;  2Z1D A;  4HLX A;  4BEH A;  1Z7U A;  4ZYA A;  3H3Z A;  4XRS G;  2X6Y A;  3K70 C;  1K61 A;  3MD2 A;  2RRE A;  4N9H A;  4CCO A;  1OCT C;  4J01 A;  3ERM A;  2MW8 A;  4NUB A;  5IYD J;  4CHU A;  3CZ6 A;  4IXA A;  5EEA A;  1JGG A;  3QOE A;  2CW0 F;  3SEZ A;  1Z9C A;  2ETH A;  1MKM A;  1ORK A;  1MGT A;  3OOU A;  4P1W A;  2KFD A;  4QIW N;  3P7N A;  4ENM A;  1JJ8 C;  2W82 A;  3W2W A;  4HOB A;  3ASN H;  3FF5 A;  4P9U A;  1MNM C;  4E70 A;  2L9R A;  1BL0 A;  3ZN0 A;  5IP9 J;  5CLS A;  2VPL A;  1W7P A;  3MMY B;  2DYR H;  2HXO A;  5LRS A;  1PP8 F;  3TDU C;  1HST A;  1ZEL A;  4BJT A;  3COA C;  2DYS H;  2Z99 A;  1IN8 A;  3IC7 A;  3V7R A;  5LGU A;  4O3M A;  1U9O A;  5FLX K;  4OIO F;  3RZO J;  2CUE A;  3G1M A;  1MJB A;  3HOV J;  2H09 A;  1MSF C;  2RKH A;  2OAZ A;  2R7D A;  2LTP A;  4OIR F;  5EGO B;  1KQ8 A;  2NRA C;  3ABT A;  1YQA A;  3VOE A;  5LEK A;  5B1A H;  1O7F A;  2AXT C;  4KN4 X;  2J5P A;  1B9M A;  4BXU A;  4DNC A;  2BY3 A;  1W5T A;  3SZP A;  2IGM A;  1YW9 A;  2KHM A;  3ASO H;  3EET A;  4M9Z A;  2FU4 A;  2HPM A;  4PGH A;  1JXS A;  1JUM A;  2HFH A;  1ZYR F;  2QUF A;  2DMN A;  2QQB A;  4XM3 A;  2FBK A; 
#chains in the Genus database with same CATH homology
 1DUX C;  3HUG A;  3L9F A;  4RGS A;  4I0B A;  1I6X A;  2D2W A;  4KUM A;  1BBY A;  1G3Y A;  3HOS A;  2GZW A;  5FO5 A;  1FOK A;  2M87 A;  2UXX A;  5L3B A;  4IVN A;  3WGH A;  4ETS A;  1K6O A;  2FSW A;  5ICF A;  3EDP A;  2XAH A;  3RKW A;  5BOX A;  1L3L A;  4MTE A;  2DLL A;  4ZYD A;  2W57 A;  3BZ6 A;  1LDK B;  1XGO A;  5JI6 A;  3T5X A;  1ZG5 A;  3J80 K;  2O03 A;  1HKT A;  3LQR A;  3DP7 A;  2Z9O A;  3G3Z A;  4ZZL A;  2MBF A;  4UV8 A;  3IL2 A;  3I0T A;  3NQO A;  4CO8 A;  3CTA A;  3K2Z A;  3J81 K;  2L4A A;  1MJA A;  2DQR A;  2M45 A;  5BMZ A;  4YFN F;  4HQM A;  1I5Z A;  3I59 B;  2EA2 A;  2KIM A;  2HYF A;  2VC1 A;  2NNN A;  4WXD A;  1Q1H A;  3I5U A;  2DK5 A;  2PQ8 A;  1Z6R A;  4HYE A;  2MH9 A;  2K02 A;  1FYK A;  1RNL A;  2DPU A;  4L9T A;  2DQL A;  5TJJ A;  3R0A A;  1FYM A;  5FLX Z;  4RB3 C;  1QQI A;  4M72 A;  1YW7 A;  2V1U A;  1RZ4 A;  1HSJ A;  5LRR A;  2FBH A;  3BDD A;  3BJO A;  4GXO A;  4QLC U;  2MH2 A;  4Q48 A;  5LEJ A;  1G4D A;  1FY7 A;  2ELH A;  2W84 A;  4ON0 A;  4M6X A;  5JVT A;  4MEX F;  2DI3 A;  1LEB A;  1B4A A;  1FBU A;  3ZMD A;  3WTT C;  4KA4 A;  4HV5 A;  1HXD A;  3LA2 A;  4M9X A;  2VT3 A;  3GFL A;  4MNU A;  2V79 A;  3GWZ A;  3FHZ A;  4OIQ F;  2TDX A;  3P9K A;  2PJP A;  4UV9 A;  5LBQ A;  5BPD A;  1IAW A;  1G3S A;  3WTW C;  1UHM A;  4HQE A;  1I27 A;  2V9V A;  2Y48 A;  3JTH A;  2DT5 A;  5LHG A;  2A6E F;  2KIU A;  1I1G A;  3GF2 A;  4F7Z A;  1DDN A;  5AIQ A;  5CVI A;  1XGN A;  3K1N A;  5HS8 A;  1IXR C;  4EQQ A;  2K4B A;  1T0F A;  2ZNY A;  4HF1 A;  1GVJ A;  2CQK A;  1P6R A;  5CVR A;  2EJR A;  2ZME B;  4LK1 F;  3EYI A;  1SD4 A;  1H9G A;  3HSE A;  1IXC A;  5CYV A;  2O0Y A;  4HX7 A;  1S8N A;  3V4G A;  2KIF A;  1ZHF A;  4EGY A;  4ZYG A;  2M8E A;  3C1D A;  2Z3Y A;  4R8H A;  4ASN A;  1B1B A;  3MCZ A;  2H6C A;  2V1D A;  1XMA A;  2CYY A;  2C6Y A;  2ESN A;  4LD5 A;  2WC2 A;  4KYW A;  3B73 A;  2JRT A;  1P4X A;  2XAS A;  4GCV A;  2CO5 A;  2IT0 A;  1Z05 A;  3DV8 A;  2BBY A;  3AAF A;  3KP7 A;  1CGP A;  3HHH A;  3SZT A;  2ZKZ A;  2HOE A;  2OZ6 A;  2P8T A;  3DPT A;  1QO0 D;  3RTR A;  5BQT A;  4L5I A;  4RB1 A;  2PBI A;  3KP2 A;  4XBF A;  2PEX A;  1O7L A;  2XUB A;  1E2X A;  4U7D A;  2HWV A;  4G6Q A;  1BI0 A;  3LQQ A;  4Q47 A;  1FC3 A;  4WX9 A;  2XV4 S;  1SFX A;  1YS7 A;  3N4M A;  3MAJ A;  2RC4 A;  3WGG A;  5DYM A;  1G3W A;  1R36 A;  4RB0 A;  3P9C A;  1KQ0 A;  3IWF A;  2FRH A;  1SMY F;  1MDM A;  4HV6 A;  2NAZ A;  1TLH B;  3IRR A;  3ABU A;  1K78 A;  3WTV C;  1REP C;  1BI3 A;  4XLP F;  4U0Y A;  1ONV A;  1LB2 A;  1FNN A;  2HEO A;  1ZRD A;  1IN5 A;  5DCM B;  2XHK A;  3KP3 A;  5HLI A;  3RKY A;  2A68 F;  2ACJ A;  1V4R A;  1YFH A;  5L3G A;  4R79 A;  2D45 A;  5AON A;  1B59 A;  4A6E A;  1R7J A;  2AXL A;  4OMY A;  2XRO A;  1TTY A;  1KQ9 A;  3KP4 A;  5CVV A;  3ZN1 A;  2FE3 A;  3BPX A;  3GYH X;  4FX4 A;  1USS A;  5D6F A;  3GUD A;  2A07 F;  1J59 A;  5FGM A;  5H6R A;  2IRF G;  3RDI A;  3TO9 A;  5E1X A;  3RYP A;  3KLN A;  4M9S A;  4R1H A;  3FMQ A;  4CDG A;  4B8X A;  2P4W A;  1NHA A;  1Y0U A;  4OIP F;  3EUH A;  2ISZ A;  4RAY A;  1OYY A;  3O3K A;  5HOO A;  4EM2 A;  1MD0 A;  1HKQ A;  1ZN2 A;  2HR3 A;  4WCG A;  3H3U A;  2CG4 A;  2FA5 A;  3VOD A;  4FT8 A;  4ESB A;  1QBJ A;  2P7V B;  3CUO A;  5DD8 A;  2PLY A;  3VFZ A;  5J8C A;  5K1Y A;  1J0R A;  2BEO A;  5D8K B;  2FQ3 A;  3JAM K;  2VOO A;  1T6S A;  1R22 A;  3QP6 A;  5JHU A;  1YLF A;  1QPM A;  2VT2 A;  1KU7 A;  4JBA A;  2IA1 A;  3F3X A;  2DFI A;  3HYI A;  5ED4 A;  3R4K A;  4HLY A;  2D1H A;  1XDU A;  1JGS A;  4LLG F;  3WGI A;  3KEO A;  2LF7 A;  2YSR A;  5HDK A;  3QPT A;  2EFW A;  3GVA A;  1FLI A;  4ESJ A;  3RYR A;  4O5V A;  1ZGJ A;  2W85 A;  4AWX B;  1LNW A;  1P2F A;  1ZG1 A;  4I09 A;  2FXA A;  4BHC A;  1FZP B;  1U5T C;  1FP1 D;  1IN6 A;  4QWQ A;  4S04 A;  1E17 A;  1U5T A;  1R00 A;  1SD7 A;  5HDG A;  4LG0 A;  1WSU A;  1Z1D A;  5ICC A;  3F8B A;  4L18 B;  2LSO A;  4PDK A;  4KIC A;  4L0Z B;  1HKS A;  3EQL F;  4ZYE A;  2K86 A;  3W6K B;  4YII A;  3E5U A;  4AIJ A;  3QU3 A;  1ZLJ A;  2E1N A;  3WTS C;  4G94 A;  2F5E A;  4L0Y B;  5DV5 A;  2ISY A;  4LB6 B;  1DP7 P;  5E8G A;  5FD5 A;  2KRF A;  2XAG A;  4M6Y A;  4B09 A;  4PCQ A;  2VE9 A;  2P6T A;  3GFJ A;  2JZY A;  3IHU A;  2IA2 A;  3BJ6 A;  1ON1 A;  2QEN A;  4KNY A;  4LB5 A;  2RN7 A;  4A0Y A;  3CJN A;  1H0M A;  4A0X A;  3E5X A;  2P6S A;  1OYI A;  4MGR A;  4N9I A;  3ZMS A;  4JK1 X;  2EK5 A;  1IZ1 A;  1T98 A;  3CUQ A;  1S7A A;  1PP7 U;  4HF0 A;  3ZMZ A;  3LA7 A;  3U9G A;  1Z91 A;  2K4J A;  2O3F A;  1W5S A;  2ZFW A;  3I59 A;  2BYV E;  2NS0 A;  5ILV A;  1KU2 A;  1HQC A;  5D5V B;  1YW8 A;  4ENN A;  4Z2Y A;  4I02 A;  1S3J A;  1IXS B;  2VBX A;  1CF7 B;  2DO7 A;  4LMY A;  3LST A;  2VXZ A;  1S7O A;  1W4M A;  1XCV A;  2F5C A;  5A2Q K;  3TO6 A;  5D4R A;  3KCC A;  1R58 A;  2ZJ2 A;  3GO5 A;  4L5J A;  3ELK A;  2IW5 A;  1FYL A;  1QGP A;  5FB2 A;  1SD5 A;  2O8X A;  1QZZ A;  4HX4 A;  4IF4 A;  2QQ9 A;  1LVA A;  2QBY B;  4K2E A;  4MQ9 F;  3TO7 A;  3K69 A;  2VON A;  3I54 A;  1YO5 C;  1MZB A;  3MWM A;  2CWE A;  1U78 A;  4LFU A;  4GO1 A;  5IT9 K;  4EJT A;  4P9F A;  1UHW A;  3S2W A;  2YX4 A;  5ILS A;  4LJZ F;  4U7B A;  3QP5 A;  3ZPL A;  3SXY A;  3T8R A;  1FPQ A;  1BC7 C;  3L2C A;  3DF8 A;  2GA2 A;  4LGW A;  1IRG A;  1FBQ A;  1BM9 A;  1TQP A;  3R60 A;  1FP2 A;  3U2R A;  3HSF A;  2JPC A;  4BAY A;  3F23 A;  2HTS A;  3FWE A;  2E1C A;  2FMY A;  4Q4Z F;  2EB7 A;  1P4W A;  2ZME A;  2QM3 A;  2M5W A;  4CYD A;  3DFG A;  2KJC A;  4G7H F;  1R23 A;  2XAJ A;  2A6H F;  2L54 A;  3E97 A;  2UZK A;  1ZLK A;  2VN2 A;  1O3S A;  3J7A O;  4RGR A;  1YIO A;  4IRG A;  4YFK F;  2OZU A;  2EWN A;  2E7X A;  3LAP A;  1ZRE A;  2XVC A;  1KU9 A;  4I01 A;  2FNP A;  1XSX A;  2QZ8 A;  4NQW A;  4EM1 A;  2EA4 A;  1JHH A;  1J75 A;  3ISP A;  3J80 Z;  3SHF A;  1DPU A;  2ZO4 A;  2LNB A;  3WU0 A;  3DPL C;  2IPQ X;  3Q5F A;  1WI9 A;  3KP5 A;  1HW2 A;  2MC3 A;  2PMU A;  3WE2 A;  2DTR A;  3SQN A;  4HAM A;  3M1E A;  5F6F A;  4A12 A;  3GXO A;  4UUV A;  3FMR A;  2W24 A;  3HRU A;  3J81 Z;  4OU0 A;  5E17 F;  1OKR A;  1S6L A;  4ESF A;  3KET A;  1RIO H;  1TBX A;  5HS7 A;  1ULY A;  1KU3 A;  2PFB A;  2NYX A;  4N0B A;  4JQF A;  1SAX A;  4AD9 A;  1XSD A;  1L0O C;  1YS6 A;  3T1B A;  5IT9 Z;  4G6D A;  5ERI A;  3VB2 A;  2XGX A;  2FNA A;  2H27 A;  3VEP A;  5D5X B;  2XRN A;  2DPD A;  4IPA A;  4TV7 A;  5F1R A;  2XKO A;  1W7P D;  4P5O A;  3K1M A;  2A69 F;  3TOB A;  4CIC A;  2DK8 A;  3V8J A;  1FT9 A;  2HDC A;  2G7H A;  5DCM A;  3JSP A;  2Z5U A;  3F6V A;  3DKW A;  1EH7 A;  4A6D A;  1J2X A;  3K0L A;  3ZMU A;  3QPH A;  1ZGA A;  3GW2 A;  3HSR A;  3O6B B;  3D5L A;  1UCR A;  2YR2 A;  1D8J A;  3FXU A;  4P96 A;  4KFC A;  5CJ9 A;  1O3T A;  4HDU A;  4GYG A;  1D3Y A;  2UXN A;  1TNT A;  2RV8 A;  1STZ A;  3HTS B;  1BOA A;  3F8C A;  3M8E A;  3GZ5 A;  1TW3 A;  1A04 A;  3BY6 A;  2HQN A;  3L00 A;  1HBX G;  3FX3 A;  2L02 A;  2IVM A;  4RS8 A;  1LQ1 A;  5HLH A;  4U0V A;  1OR7 A;  4NB5 A;  1ZRF A;  3KLO A;  3QU6 A;  4GYI A;  5TRD A;  4KMF A;  2V1X A;  3IKV A;  3Q9S A;  4AIK A;  2MLG A;  3KZZ A;  2UWM A;  1YG2 A;  2OA4 A;  1GHC A;  4KMU X;  1T38 A;  2DAO A;  3Q9V A;  5JFR A;  1ON2 A;  5DUI A;  4OIN F;  3HRS A;  2L3D A;  1J7K A;  2BE5 F;  2K27 A;  3R0J A;  4NHJ A;  2F5D A;  1XSV A;  1O3Q A;  3DQV C;  4RGU A;  4CGZ A;  3GX4 X;  4IHT A;  2J5O A;  3TGN A;  1ZG3 A;  1B9N A;  1XD7 A;  3V7C A;  4ENJ A;  4HBL A;  1T39 A;  1K78 B;  3JTG A;  2BGC A;  2HS5 A;  1JHF A;  1KA8 A;  2H94 A;  1G6N A;  5L3F A;  1RUO A;  1ZH5 A;  4YFX F;  2CSO A;  2MA3 A;  3FZV A;  1R5H A;  4LLL A;  2R7F A;  3GFI A;  5L3E A;  1BIA A;  4G8X A;  3I71 A;  5AIP A;  3C7J A;  2VBY A;  3DXJ F;  2X0L A;  4I7H A;  6PAX A;  3GLX A;  4ZH4 F;  2HKO A;  2QQA A;  2DW4 A;  4YIF A;  4BYY A;  1FSH A;  1GXP A;  2PMH A;  2Y0M A;  5HLG A;  1DPR A;  3BRO A;  1AWC A;  3CLO A;  3LFK A;  5BPI A;  4KDP A;  2G7U A;  1WKM A;  2HYG D;  3E6M A;  1YYV A;  2PN6 A;  3ZP5 A;  3PQJ A;  3F6O A;  1R1V A;  5LHI A;  1BI1 A;  2COM A;  2VE8 A;  3ZMT A;  2WWY A;  4EJV A;  5KK1 A;  1S29 A;  4L9J A;  2M30 A;  2FOK A;  1UB9 A;  5D5U B;  2PI0 A;  2HTJ A;  5CVJ A;  4EMS A;  3KEQ A;  1SD6 A;  3DEU A;  3LA3 A;  4A5M A;  5KVR A;  3N97 A;  3F8F A;  2FML A;  3LWF A;  1Z6T A;  4EJO A;  4HF2 A;  5JR3 A;  2ESH A;  3K9T A;  4O6J A;  1G3T A;  1QZY A;  4CXF A;  2A61 A;  4GGG A;  5HVQ C;  5H6Q A;  3BJA A;  2D1V A;  1CF7 A;  1F4K A;  5E20 A;  1IN4 A;  5LGN A;  2IP2 A;  2HKX A;  2XAQ A;  3E6C C;  1UFM A;  3RPU A;  2RQP A;  5LHH A;  4UVA A;  3E6B A;  3WE3 A;  1IF1 A;  1H9T A;  2VOD A;  1FWZ A;  1EH8 A;  5FFX A;  2LKP A;  5J8F A;  5DUK A;  1ZAO A;  3ZMV A;  3M8F A;  1LJ9 A;  3T0Y A;  1XGS A;  4FX0 A;  2A3S A;  2ZBK A;  1U3E M;  2QBY A;  2PG4 A;  3CUQ C;  3T8T A;  3JAM Z;  3RIR A;  2O61 A;  4IRI A;  1X3U A;  5D5W B;  3WTZ A;  3FM3 A;  2JTV A;  3OOP A;  3ERE D;  1XB4 A;  2JSC A;  1K79 A;  1V3F A;  3MZY A;  2OD5 A;  3FXQ A;  1U5T B;  4I2O A;  3MQ0 A;  4LG0 B;  4KIG A;  4IHS A;  3M9A A;  4I98 B;  2CGP A;  2VC0 A;  4U0W A;  3I4P A;  5D4S A;  1FX7 A;  2QVO A;  1HW1 A;  2EV5 A;  1BI2 A;  2MLK A;  4LK0 F;  2R3S A;  1U8R A;  3F22 A;  4L9V A;  1FBS A;  3E5Q A;  1W7P B;  3CO7 C;  5IT3 A;  3HIF A;  4WK8 F;  4HX8 A;  2V6C A;  3I64 A;  1IW7 F;  5J6X A;  1OPC A;  3NRV A;  2GQQ A;  1OYW A;  1XCB A;  3ECH A;  2STW A;  4Y17 A;  5E1Z B;  4BHP A;  3CUQ B;  3IKT A;  1XMK A;  2WV0 A;  4U88 A;  3WTY C;  3FM5 A;  3B02 A;  3TDZ C;  3ZQ7 A;  2FEZ A;  3P9I A;  2KKO A;  2P7C B;  4ZZD A;  5CVU A;  1F9N A;  3O2P E;  4I0A A;  3EYY A;  4XRF A;  3JW4 A;  4DQ2 A;  5LGT A;  4BNC A;  5E8I A;  2FBI A;  4PZJ A;  1J9I A;  5E1W A;  2ZXJ A;  3MZH A;  2CFX A;  4HA8 A;  2F2E A;  4G9Y A;  2F5F A;  2DBB A;  5HS9 A;  2P5K A;  4EGZ A;  1D5V A;  2HZT A;  3CO6 C;  2B0L A;  2HQR A;  4YG2 F;  3R6S A;  2QLZ A;  1O57 A;  3FMS A;  2YX7 A;  3REO A;  3RKX A;  3C18 A;  1WQ2 A;  3IRQ A;  4WXH A;  2GXG A;  1JE8 A;  1F5T A;  3KE2 A;  5HDN A;  3R61 A;  1GXQ A;  1UST A;  4XLN F;  2NNY A;  3MEX A;  2O6G E;  2XIG A;  4A0Z A;  4UNO A;  1BIB A;  3CDH A;  3HHG A;  1R1T A;  2ADU A;  4M74 A;  4AVP A;  5A2Q Z;  1OMI A;  2XKP A;  3HTU A;  1P4A A;  5ICE A;  1O3R A;  5EEG A;  4UHT A;  3ULQ B;  3QRF F;  2JT1 A;  1QNT A;  3TKY A;  2EFN A;  1RUN A;  2IA0 A;  3JSO A;  4RB2 C;  1HW5 A;  5D6E A;  4WF2 A;  1ODD A;  4A5N A;  2GIV A;  4AIH A;  5K5O A;  3KFW X;  4BQA A;  3TQN A;  3H92 A;  1U6G A;  3QAH A;  2K7L A;  5K5Q A;  1RI7 A;  4M71 A;  5F64 A;  5L3D A;  4HW0 A;  3HOT A;  3K1P A;  4P55 A;  4Y15 A;  5DEQ A;  2VBW A;  1SFE A;  5L3C A;  1XDS A;  2Q0O A;  1K7A A;  3RI4 A;  2Q2E A;  2G9W A;  2Q8K A;  2Z33 A;  4EM0 B;  4KIF A;  1R1U A;  2X4H A;  2YU3 A;  2GWR A;  1IN7 A;  3FXR A;  3SFZ A;  2Y75 A;  5DCF A;  2OQR A;  1ZAR A;  4UXN A;  4EV0 A;  5FFZ A;  3TOA A;  5LLQ A;  2OU2 A;  2YPR A;  4PGG A;  2DU9 A;  2HGC A;  3W6J B;  3OV8 A;  2LDU A;  3HRM A;  1XN7 A;  3KZY A;  4BHB A;  2LF8 A;  3G73 A;  4MEY F;  4FHT A;  2E7W A;  3F8M A;  2GAU A;  2MD5 A;  3F8N A;  2ZNZ A;  3IWZ A;  1U2W A;  1XGM A;  5ICG A;  3ECO A;  3D0S A;  2FF4 A;  4MTD A;  3V7S A;  4EJW A;  3I53 A;  5ILU A;  1BJA A;  2EFO A;  1LDD A;  5FD6 A;  4ENK A;  1AOY A;  2GXB A;  2JPB A;  4MHG A;  4HZF A;  5H20 A;  2RVC A;  5K5R A;  1WWX A;  4XSX F;  5DD4 A;  4UVB A;  2STT A;  3WOD F;  2P5L C;  4KIB A;  4KT5 C;  2RDP A;  3GEZ A;  2QWW A;  4HDV A;  1TQM A;  2BV6 A;  1TQI A;  2IJL A;  3M7G A;  2P5V A;  1D8K A;  5D8L B;  3WU1 B;  3BWG A;  2GA1 A;  1SFU A;  1EV7 A;  3MFK A;  2L01 A;  3PFI A;  1LEA A;  4LLN A;  2EFP A;  3HRT A;  4RGX A;  1T2K A;  2VBZ A;  3WTU C;  4G7Z F;  2WTE A;  1F1Z A;  3L09 A;  3V8L A;  4EVI A;  1KYW A;  3F21 A;  1P92 A;  2H6B A;  1BN5 A;  1WRJ A;  4EJU A;  2A5Y B;  3PQK A;  3QOP A;  3GFM A;  2VOP A;  3BPV A;  2EV6 A;  1MDM B;  2KJB A;  1SMT A;  4M73 A;  2AS5 F;  4A2U A;  2W25 A;  4MQV A;  2XAF A;  4RAZ A;  5EEH A;  1ZRC A;  3BOQ A;  3RJP A;  4WWC A;  1PDN C;  1IRF A;  3E3V A;  3ML6 A;  3I58 A;  4L9N A;  1IUY A;  4Y13 A;  4OMZ A;  5DDG A;  2EFQ A;  1FSE A;  1J5Y A;  2OQG A;  5E18 F;  3V8K A;  4G7O F;  3L7W A;  2EV0 A;  1BC8 C;  4XSZ F;  2ZCW A;  4H0E A;  4Q5S F;  3C3W A;  1PUE E;  1YTY A;  4IJA A;  4D0P A;  3RPQ A;  4KN7 X;  1KGS A;  1MJ9 A;  4UVC A;  3F72 A;  3GZ6 A;  1I1S A;  3ROU A;  3U1D A;  2RNJ A;  1B6A A;  2RGV A;  2QYO A;  4WXC A;  3LAJ A;  3WG9 A;  3KP6 A;  3NEU A;  4BH9 A;  4ZYH A;  1TW2 A;  2OBP A;  4IRH A;  1TNS A;  1LDJ A;  1R5G A;  2M1B A;  3WTX C;  1EH6 A;  1KYZ A;  3E6D A;  4S05 A;  1VTN C;  4CZZ A;  1C0W A;  2L4M A;  3BP8 A;  5BS6 A;  4OOI A;  4HLX A;  1Z7U A;  3H3Z A;  4N9H A;  4CHU A;  4IXA A;  2CW0 F;  1Z9C A;  2ETH A;  1MKM A;  1MGT A;  3P7N A;  4ENM A;  4HOB A;  3FF5 A;  4P9U A;  4E70 A;  3ZN0 A;  5CLS A;  1W7P A;  5LRS A;  1PP8 F;  3TDU C;  1HST A;  3COA C;  2Z99 A;  1IN8 A;  3IC7 A;  3V7R A;  5LGU A;  4O3M A;  5FLX K;  4OIO F;  1MJB A;  2H09 A;  2RKH A;  2OAZ A;  2R7D A;  4OIR F;  1KQ8 A;  2NRA C;  3ABT A;  1YQA A;  3VOE A;  5LEK A;  1O7F A;  4KN4 X;  2J5P A;  1B9M A;  4BXU A;  4DNC A;  3SZP A;  1W5T A;  1YW9 A;  3EET A;  4M9Z A;  2FU4 A;  4PGH A;  1JXS A;  2HFH A;  1ZYR F;  2QUF A;  2QQB A;  2FBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...