3GEZA

Crystal structure of the hypothetical egulator from sulfolobus tokodaii 7
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gezA00
3E6MA 2XIGA 3FX3A 3TDUC 1LEAA 4Q5SF 2K86A 1IN4A 2E1NA 3D5LA 2XAHA 4XLNF 4HV6A 1FBSA 1Z6RA 1HQCA 2HEOA 1QBJA 1I1SA 4BAYA 2YSRA 4G6QA 2Z99A 3ERED 3BJOA 5ED4A 3QP6A 1AOYA 4M9XA 1XGOA 5K1YA 2PBIA 3MEXA 2PMUA 1AWCA 1KU2A 4P9UA 1GVJA 5A2QZ 1XDUA 3WTTC 1K7AA 2IA1A 4WXDA 4KIBA 1O7LA 4IVNA 3DEUA 1RIOH 4G7ZF 3NQOA 2YX4A 2ZBKA 1O3TA 2O0YA 1T0FA 1T39A 2EA2A 2MLGA 2P5VA 4XBFA 3L7WA 3C7JA 1FSHA 1KQ8A 2A5YB 3GZ5A 3I58A 1CGPA 3ULQB 4L9TA 4RB0A 4OIRF 5IT9K 3K2ZA 3QAHA 1FP2A 3V8JA 3V4GA 1XN7A 5E8IA 4JBAA 2NAZA 4GXOA 4A2UA 4Y17A 1XGNA 3RPUA 4BHBA 5D6EA 1LDDA 4EJWA 4A0YA 4FX4A 2FMLA 2DTRA 3MCZA 2DQRA 1JE8A 2DPUA 3C3WA 5JR3A 1TQMA 2H27A 4L9JA 3KFWX 5CVUA 2XAFA 1T6SA 1R7JA 2QBYA 1JGSA 5L3DA 2HGCA 1D8JA 1ZRDA 5FB2A 3BROA 1T2KA 1LJ9A 2FNAA 2RVCA 4EM2A 1DP7P 1R23A 3FMSA 3HSEA 3M7GA 4HQMA 5L3FA 3EUHA 3S2WA 4LLNA 3TKYA 1KYWA 4M74A 4ESBA 1MZBA 2TDXA 4EQQA 3T0YA 4Y15A 2M30A 2L4AA 1ODDA 4EJVA 2A61A 2WC2A 5L3EA 2STWA 1W4MA 4CYDA 2E1CA 1W5TA 5HS8A 4LMYA 4WX9A 2FU4A 2JPBA 3HTSB 1IXCA 3GF2A 3LAPA 2O03A 1R22A 3N97A 3U2RA 1BN5A 3VFZA 1O57A 1SD6A 3TDZC 2A69F 5HLHA 4BYYA 3J80K 3DPTA 1IAWA 3HRTA 2Z33A 1MKMA 4KA4A 4KIFA 3QPHA 3LSTA 4ETSA 2A07F 5E17F 4O5VA 3RPQA 3KETA 5ILUA 2GAUA 2Z5UA 2QQ9A 1PDNC 2Q2EA 4G7OF 2IJLA 4BQAA 3I71A 4RS8A 1DPUA 2YPRA 3F6VA 3WE2A 2XV4S 1IUYA 4Q47A 2ZMEB 2M87A 4ZZDA 4RB3C 4RAYA 3BWGA 1LEBA 1SFEA 2CG4A 4HLYA 1TLHB 3O6BB 3HHHA 4LB5A 4A0ZA 4QWQA 3ZMVA 4RGXA 2PLYA 3GW2A 4AD9A 3Q9VA 2K4BA 2PG4A 3V8KA 3KP5A 5BS6A 3EYIA 5L3CA 1Z7UA 3QRFF 1ULYA 4PGGA 4IHSA 3W6KB 1R5GA 4OIOF 2VBWA 4KDPA 2PQ8A 2VOOA 2E7XA 2P7CB 1FX7A 4O6JA 1D5VA 2RV8A 2E7WA 1TQIA 4EJTA 4YFNF 1YO5C 1ZLJA 2FEZA 2ZJ2A 1KQ0A 2CW0F 1XSXA 2FQ3A 5LBQA 5LHGA 2QWWA 5F64A 3SZPA 5DUIA 3RYRA 2BBYA 1UFMA 4FX0A 3BPXA 2XUBA 3W6JB 4M6YA 2AS5F 4M9ZA 1XD7A 1BC7C 4KNYA 3F8NA 3M8FA 1HXDA 1OR7A 2QQBA 2FNPA 3F72A 1QGPA 5LLQA 4BNCA 2CWEA 1BM9A 2QZ8A 3TOAA 1GHCA 2XAGA 1SD7A 3TO7A 1R1VA 2YR2A 2QENA 3F23A 5JI6A 5LHHA 2C6YA 1OYIA 1MGTA 3BJ6A 2QLZA 5FLXK 3BDDA 2KIFA 2XKOA 3BPVA 2M5WA 4OMYA 1R58A 3V7RA 2JT1A 2DI3A 1DDNA 3FWEA 2K4JA 5E1XA 2DK5A 4MQ9F 3ECOA 3CDHA 1WWXA 2XRNA 4EJUA 5DYMA 4BHPA 3FXUA 2G7UA 1SAXA 1IRGA 1GXPA 1MJ9A 4Q4ZF 3KP7A 5TJJA 4XSXF 3RKWA 5FD6A 4L18B 2IA0A 3IWFA 3ELKA 2GA1A 1BJAA 2JTVA 1YLFA 1IN6A 2IVMA 3DKWA 5AIQA 5D4RA 4EMSA 2JZYA 2RNJA 4IRHA 4KN7X 3ZPLA 1O3QA 4XRFA 2XROA 4OU0A 2RDPA 1O7FA 2K02A 1S6LA 5DV5A 2G7HA 3FXQA 2LNBA 3RI4A 1YQAA 5JVTA 3PQKA 4WWCA 3R61A 2ISYA 1S3JA 4A5MA 4BXUA 2ZFWA 4OOIA 5D8KB 4UXNA 2OU2A 3J81K 4L9VA 1H0MA 2K7LA 2KJBA 4XSZF 1P4AA 1QNTA 3E6CC 4UV9A 1ZN2A 2PMHA 2V9VA 4EVIA 2ETHA 2IP2A 2XKPA 2UWMA 2PEXA 2W57A 2VBXA 1ZG3A 1OYYA 1B9MA 3E5QA 1TW2A 3IRQA 2DQLA 1SD5A 2D2WA 4PZJA 4KIGA 4GGGA 5FD5A 3MWMA 3AAFA 3JSPA 5K5QA 2VODA 2Q8KA 2A68F 2CYYA 4BH9A 1KU7A 2VXZA 4WCGA 4MEYF 3IWZA 4AIKA 3BP8A 1XCVA 1FP1D 4HX7A 4YG2F 1WI9A 4U0VA 4OIPF 1MJBA 6PAXA 4LG0A 2VT3A 2XAQA 2M1BA 1B4AA 1BI3A 4B8XA 4OIQF 3LQRA 4AVPA 1WKMA 3RIRA 2JPCA 3F22A 5K5RA 1RNLA 3KZYA 2DPDA 3GEZA 2FOKA 3B02A 1U3EM 1I27A 1K78A 4ENNA 1HKQA 1U6GA 4RB2C 1IW7F 2VE8A 1J59A 1W7PB 4HDUA 4CDGA 3WTXC 2DO7A 2OAZA 5CVJA 2O3FA 2A6HF 3DXJF 2L4MA 2X0LA 3HUGA 3OV8A 2QQAA 1ONVA 4K2EA 2DU9A 1OKRA 1WRJA 4M6XA 4KMUX 1YFHA 2IRFG 3HSRA 2EV0A 4IPAA 2V1UA 1G3WA 5CLSA 3VODA 1S29A 2HOEA 3CUQA 4G94A 3KEOA 3COAC 3I59A 3RYPA 3SXYA 3K1NA 3GVAA 3HYIA 4P5OA 1D8KA 5CVRA 1CF7B 2J5OA 1GXQA 1P92A 2RQPA 2Z9OA 1H9TA 3L09A 4N9HA 2W25A 2WWYA 3HRUA 2EWNA 3RTRA 2AXLA 5HLIA 3GXOA 4M72A 4UHTA 3GFIA 2MC3A 1XMAA 2LF7A 2NRAC 1MD0A 1BI1A 4WF2A 2HQRA 1O3SA 2EB7A 4I09A 3WE3A 2HR3A 2VC1A 2RN7A 2KKOA 5DEQA 4M9SA 1FT9A 3FM5A 4ENMA 2Z3YA 2EV5A 2VN2A 3SFZA 5LRSA 4A5NA 4MQVA 4HAMA 2IA2A 2VC0A 2FSWA 3R0JA 2W85A 1R36A 3EETA 1XDSA 3KLOA 4MTEA 4NB5A 2FMYA 2GZWA 2P6TA 1B1BA 1Z1DA 3SHFA 3LA3A 4TV7A 1FLIA 4ZH4F 5D5XB 3FM3A 1JHHA 3QPTA 5DCFA 4I98B 4NHJA 3LA2A 2D1VA 1TW3A 5F6FA 2F5EA 1ZAOA 1U5TA 1UHMA 5H20A 4KT5C 1ZG5A 3ZN0A 2YX7A 2COMA 1NHAA 2Y48A 2P4WA 5KVRA 4A0XA 3SZTA 1VTNC 4KN4X 2VBZA 4YFXF 3QU6A 3GYHX 2DK8A 4CZZA 1USTA 1EH6A 1S7AA 2EFPA 1U2WA 2UXNA 1Y0UA 2R7FA 3V8LA 2DLLA 1IN5A 1LB2A 1G3YA 1SFXA 2XVCA 3KP6A 3Q9SA 2GXGA 3G73A 1EH8A 4KICA 2A6EF 3HOTA 2BV6A 4UUVA 4HQEA 3WTVC 3WU0A 3EQLF 3H92A 3BJAA 1ZLKA 2EFNA 1LNWA 5BMZA 4L5JA 1JHFA 1F1ZA 4XLPF 3BOQA 2NYXA 3LWFA 3WG9A 3WODF 5LHIA 4PDKA 2H6CA 4IHTA 3JTHA 1XGMA 3K1PA 3T8TA 2L02A 3F8CA 2DT5A 3J7AO 5CYVA 4B09A 5A2QK 2D45A 2P5LC 5ILVA 1J2XA 2ZKZA 4ENKA 2HS5A 3D0SA 1YW9A 2OZ6A 1ZRCA 1V3FA 1B9NA 2KJCA 1SMYF 3GFMA 2RKHA 3F8FA 4Z2YA 3I0TA 3ZQ7A 1QZZA 1BI0A 2FE3A 3FHZA 4S04A 4HZFA 3L00A 3ZMSA 2YU3A 3Q5FA 1MDMA 1R5HA 1IN7A 2ZXJA 1XB4A 5E18F 2IPQX 1F4KA 3P7NA 3HHGA 3E3VA 4HF2A 1XSDA 3BY6A 5ICEA 1IF1A 1UHWA 3VB2A 3ZN1A 1SMTA 5AONA 5JHUA 5L3GA 5HVQC 1WQ2A 4HBLA 4O3MA 2PFBA 3LQQA 3M8EA 3KZZA 3IL2A 3ZP5A 3I54A 2LF8A 5J6XA 5FO5A 4LFUA 5E20A 1U78A 1HW5A 2EFOA 3JAMZ 3K9TA 4KUMA 1J75A 5LEKA 1BI2A 2XHKA 4EGYA 1S8NA 2ELHA 1HW1A 5E1WA 2A3SA 4U7DA 1P6RA 1LDJA 4UVAA 2ZNZA 2QM3A 4KFCA 1L3LA 2FBHA 5CVIA 3EYYA 4RB1A 3IKVA 1FNNA 2HQNA 2P8TA 3U9GA 3MZHA 1H9GA 2NNYA 1IXRC 3RKYA 2WV0A 2V6CA 2QBYB 1KU9A 2DBBA 1D3YA 2EV6A 4LLGF 4HX4A 4DNCA 4IRIA 2G9WA 2GQQA 3C1DA 4RGRA 3I53A 3KE2A 3F6OA 4S05A 1J7KA 1RI7A 3KP3A 1I5ZA 3K1MA 1IXSB 1HKTA 3ECHA 2ADUA 5F1RA 4MNUA 3F3XA 4P55A 3WTSC 2GA2A 4LD5A 4PCQA 4RGUA 1G3SA 2GIVA 1ZH5A 5D8LB 5AIPA 1XMKA 4ZYGA 5H6QA 3ML6A 4ESFA 3R60A 3LA7A 5LEJA 4G8XA 5ILSA 4EM0B 3N4MA 2P6SA 1WSUA 1OMIA 1Z91A 4GYIA 2ZO4A 5ERIA 2OZUA 2KRFA 1TNSA 4I7HA 1G3TA 3WTYC 2V79A 5JFRA 4H0EA 1KQ9A 3CJNA 5FGMA 2EA4A 3I5UA 3PFIA 5D6FA 1S7OA 3IHUA 4EM1A 4AIJA 3IC7A 1XGSA 3F21A 1TBXA 2D1HA 4UVCA 1RUNA 2Y0MA 1LQ1A 3ZMDA 4QLCU 1FYKA 2ZCWA 2CGPA 4A6DA 5CJ9A 1ZYRF 3FMQA 3JW4A 1ZG1A 4LGWA 3RKXA 3TO9A 2IW5A 4A12A 1L0OC 2J5PA 5ICCA 5BPDA 1ZHFA 3FXRA 3R6SA 1YTYA 1C0WA 5HS9A 4GO1A 1X3UA 2FF4A 1I1GA 4GCVA 3M1EA 1ZREA 3CO7C 3T5XA 2OQGA 2ZMEA 4IJAA 3GWZA 1EH7A 3KCCA 4U88A 4OINF 4UVBA 4HF1A 4G7HF 1ZGJA 2PI0A 4ON0A 4ZYHA 3JAMK 1XSVA 2HZTA 1TNTA 5D5UB 2ESHA 4ZZLA 3DP7A 2OQRA 1P4XA 2BEOA 4ZYDA 4N9IA 1IRFA 2R7DA 4MTDA 3MFKA 3TQNA 3GX4X 2KIUA 3GZ6A 3KLNA 5H6RA 3ZMZA 3WU1B 4MEXF 3HOSA 1FC3A 3WGGA 5HS7A 1YS7A 4IXAA 2V1DA 5HDNA 1QPMA 1EV7A 5DCMB 4HLXA 3K0LA 3CTAA 4FT8A 2HFHA 1XCBA 5D5VB 2KIMA 3R0AA 3TOBA 3L2CA 1ON1A 1FBQA 4Y13A 4DQ2A 2O6GE 2ACJA 4LK1F 1RZ4A 2O8XA 4CGZA 5DD8A 4CHUA 3T1BA 1B6AA 3G3ZA 4E70A 2EK5A 4FHTA 5EEGA 4BHCA 1IZ1A 1LVAA 5TRDA 4HV5A 4Q48A 2ESNA 1OYWA 2W84A 4CO8A 3T8RA 4UNOA 2XGXA 4G9YA 2GXBA 2W24A 5E1ZB 3U1DA 2HKOA 1UCRA 5FFXA 3JSOA 2HKXA 4HOBA 1FYMA 1QQIA 2EFWA 4U7BA 2VE9A 1K79A 5LGUA 2L3DA 1J9IA 4ASNA 2HTSA 1KYZA 5J8FA 2FA5A 5CVVA 1I6XA 3MAJA 4WXHA 1YS6A 3ZMTA 3DV8A 2RC4A 2ISZA 1PP8F 2Q0OA 1E17A 3F8MA 2DW4A 5KK1A 3E5UA 1HSTA 2F5CA 3REOA 3LAJA 3HRSA 1B59A 2HYGD 3P9IA 1YW8A 3TO6A 4R1HA 2STTA 4EGZA 3H3UA 1KU3A 1OPCA 3HIFA 2VONA 1J0RA 3DPLC 5FLXZ 1TQPA 1FZPB 1G4DA 4L5IA 1TTYA 3ISPA 2H09A 4RAZA 3V7SA 1FBUA 3SQNA 1V4RA 5IT3A 3HTUA 4F7ZA 2MD5A 2F5FA 2MLKA 1F5TA 3GO5A 4WXCA 4EJOA 1FSEA 1BIBA 3MQ0A 1JXSA 4N0BA 4KMFA 3DFGA 5DD4A 1P4WA 3DQVC 3GFLA 4U0WA 2MA3A 3QP5A 3RJPA 4KYWA 2M8EA 3E6BA 2LDUA 2O61A 4I01A 3IKTA 3VEPA 3KP2A 1YW7A 4I02A 1W5SA 4CXFA 2XASA 2R3SA 1ZGAA 5J8CA 3RDIA 4JQFA 2HTJA 2DAOA 4ZYEA 3HSFA 3K69A 1BC8C 4LG0B 1ZARA 2UXXA 2LKPA 1G6NA 3PQJA 2MBFA 4JK1X 4HA8A 4OMZA 1REPC 3I4PA 1SFUA 2XAJA 2BGCA 3WGIA 3J81Z 3DF8A 3WGHA 4ESJA 1K78B 5BOXA 4M71A 1YG2A 4AWXB 3WTWC 4YFKF 4LK0F 3GUDA 1U8RA 5L3BA 2VT2A 1KA8A 2BE5F 1FWZA 1DPRA 1BBYA 2H6BA 1YYVA 3E97A 1RUOA 1W7PA 1QZYA 1PP7U 2M45A 4P96A 1ON2A 4L0YB 3LFKA 5HOOA 4HYEA 1HW2A 2B0LA 3E6DA 4I0AA 4NQWA 1FOKA 5HDGA 5LGTA 5D5WB 2PJPA 3CUQB 4MHGA 3I59B 3R4KA 1STZA 1F9NA 5LGNA 5E8GA 2OD5A 5DCMA 4I2OA 3C18A 4PGHA 4ENJA 5ICFA 4YIIA 1P2FA 2VOPA 2Y75A 2LSOA 4LB6B 4IRGA 3B73A 1USSA 3GLXA 2GWRA 2OA4A 1R00A 2EJRA 1CF7A 1UB9A 3FZVA 2FBIA 4I0BA 2P5KA 2VBYA 3KEQA 5LRRA 1FPQA 1IN8A 2QVOA 3KP4A 1DUXC 2DFIA 5DDGA 4HW0A 1W7PD 2X4HA 2QUFA 1PUEE 1Q1HA 4U0YA 3WTUC 4D0PA 1E2XA 1KGSA 4AIHA 2IT0A 3CLOA 4HF0A 2BYVE 5K5OA 3L9FA 5IT9Z 3ZMUA 2RGVA 5ICGA 2MH2A 2F5DA 1A04A 1Z05A 1K6OA 2JRTA 3WTZA 1MJAA 1U5TB 1ZRFA 2MH9A 2FXAA 3NRVA 2H94A 3I64A 4L9NA 4G6DA 2EFQA 3QOPA 4LLLA 1BIAA 2CFXA 1LDKB 2HYFA 2CQKA 5BPIA 2WTEA 3ABUA 3M9AA 4HDVA 5FFZA 3CUQC 3NEUA 5DUKA 1T98A 1YIOA 3HRMA 4YIFA 2OBPA 3O2PE 1BOAA 3FMRA 3MZYA 3P9CA 2PN6A 2NS0A 3H3ZA 4UV8A 1HBXG 2L54A 4CICA 1FYLA 1R1TA 2K27A 4GYGA 3IRRA 3JTGA 1T38A 2HWVA 3V7CA 4HX8A 4P9FA 2P7VB 3F8BA 4M73A 2FRHA 2FBKA 5D4SA 5HLGA 3BZ6A 2F2EA 1FY7A 2V1XA 2QYOA 2ZNYA 3TGNA 3P9KA 2CO5A 2L01A 4MGRA 2JSCA 1Z9CA 4A6EA 3ROUA 4R79A 1SD4A 3OOPA 4R8HA 5BQTA 2CSOA 2NNNA 5HDKA 1R1UA 3ABTA 3QU3A 1O3RA 2HDCA 1QO0D 1Z6TA 3O3KA 3E5XA 4EV0A 4L0ZB 4IF4A 4WK8F 4RGSA 3J80Z 3CUOA 3GFJA 1HKSA 3CO6C 5EEHA 1J5YA 3FF5A 1MDMB 3EDPA 1U5TC 4LJZF 2UZKA 1HSJA 3VOEA
chains in the Genus database with same CATH superfamily
3A1YA 3K70C 3E6MA 2XIGA 4RAFA 3FX3A 3TDUC 4F92B 1LEAA 4Q5SF 1X3WB 2K86A 2LG4A 4MLOA 2CRGA 1IN4A 1XTAA 2E1NA 3D5LA 3G71I 2XAHA 4XLNF 3AG1H 1D1CA 1BA5A 4HV6A 4IOAF 2NVYJ 1B8IB 1FEXA 4JX5A 1FBSA 1Z6RA 1HQCA 2HEOA 1QBJA 3ASOH 2LBFB 2F4IA 1EA3A 2I8DA 2E2JJ 1I1SA 4BAYA 3FBIB 2YSRA 4G6QA 2Z99A 3SYTA 3ERED 1IC8A 2ZJPF 3GLLA 3AG4H 3BJOA 5ED4A 3QP6A 1AOYA 4M9XA 1XGOA 5K1YA 2PBIA 4ABZA 3MEXA 2PMUA 3TP3A 1AWCA 2CQ7A 1KU2A 4P9UA 1X2NA 1GVJA 5A2QZ 1XDUA 3WTTC 1K7AA 2QGUA 2IA1A 4WXDA 3SDGA 3CMAI 5JVGF 1R71A 4A3GJ 1MNDA 3EPZA 4KIBA 4GDFA 1O7LA 4IVNA 1W36C 3DEUA 5CQEA 1RIOH 2OJED 4G7ZF 3NQOA 2YX4A 2ZBKA 5TISC 2O0YA 1O3TA 1T0FA 1T39A 2DJIA 2EA2A 5EGOA 2HOTA 2MLGA 2P5VA 5JLWA 2ZSIB 4XBFA 3L7WA 4X6AJ 3C7JA 2V6EA 1FSHA 1KQ8A 2GOMA 2A5YB 3GZ5A 3KPHA 4BUPA 3I58A 4HNVA 1CGPA 2VQLA 3ULQB 4L9TA 4RB0A 4OIRF 5IT9K 3K2ZA 3QAHA 3DLAA 2EZHA 3Q3SA 1YX5A 1FP2A 1YE9A 3V8JA 3V4GA 2LP0A 1J09A 2DMUA 1XN7A 5E8IA 1Z7LA 3LSHA 1LPQA 4JBAA 5B1AH 1MBFA 3VYUB 1TWHJ 1JTYA 2NAZA 2YU9J 3I4NJ 3S3NA 4GXOA 4A2UA 4Y17A 1XGNA 1MBHA 3RPUA 4BHBA 2Y9YA 5D6EA 1LDDA 1VI0A 1X3ZB 3DKYA 2CQNA 4A0YA 4EJWA 2PMZN 4FX4A 2FMLA 2X1EA 2DTRA 3MCZA 2DQRA 3QPSA 1RC9A 4G12A 1JE8A 2DPUA 5K7ZA 3G2BA 5E3MA 3C3WA 3LSGA 5JR3A 1TQMA 2H27A 4HPQA 3CF5F 4DW6A 4L9JA 3KFWX 4ANJA 4IHWA 5CVUA 2XAFA 2LFBA 1T6SA 2LY2A 2JUGA 1R7JA 2QBYA 1WPKA 2VQHA 4NBQA 1JGSA 5L3DA 2HGCA 1D8JA 5C3EJ 2QF7A 5M3MJ 1ZRDA 5F1JA 1V54H 5FB2A 3BROA 1T2KA 1LJ9A 2LREA 3OL3A 4E7SA 2FNAA 2RVCA 4EM2A 4CCNA 1DP7P 3JRHA 3CDIA 4C2MJ 1B72B 1R23A 2OUMA 3FMSA 3NWTA 1DGWY 3HSEA 2DA5A 3M7GA 5B1BH 4HQMA 5L3FA 3A0BC 3EUHA 2KRHA 3S2WA 2MSYA 4LLNA 3TKYA 1KYWA 3IV5A 4M74A 5EZHA 4ESBA 1MZBA 2TDXA 3OYGA 1GVDA 1TT0A 4PFOA 4EQQA 3T0YA 4Y15A 5J40A 1G8XA 2M30A 3HOVJ 2L4AA 1ODDA 4EJVA 2A61A 1SFOJ 5DM6F 4G6TB 2WC2A 2X6XA 2KDOA 5L3EA 4YEJA 2STWA 1W4MA 2K85A 2M0MA 2BVMA 1QZEA 1SVOA 3RPUD 4CYDA 2E1CA 2VJ5A 4DZPA 1X2MA 2LRDA 2X9DA 1W5TA 5HS8A 1XPXA 5KHDA 2JJ7A 5HNHA 4BXXJ 4LMYA 3TMOA 5IOYA 4WX9A 2FU4A 2JPBA 4C9YA 3HTSB 1APLC 2Y0SA 1O4XA 1IXCA 3GF2A 3LAPA 2O03A 1R22A 3N97A 3U2RA 2F48A 2HI3A 3JCUC 1BN5A 3VFZA 2EINH 2Y69H 2LKXA 2KQRA 1O57A 1SD6A 1U9OA 1MW7A 4RM2A 2Q1ZB 2HNHA 3HPGA 2QEXI 3DU6A 3TDZC 2A69F 5HLHA 2IGMA 5FKOA 2DMTA 4BYYA 3J80K 4JX4A 1JUSA 3DPTA 1IAWA 3HRTA 3CC2I 4A93J 2Z33A 1MKMA 3I9V2 3OIOA 2JUCA 2R7UA 4KA4A 4KIFA 3QPHA 3LSTA 4B44A 4ETSA 2A07F 5E17F 1IGNA 2BXYA 2VQGA 1YX3A 4O5VA 3RPQA 3KETA 3OYDA 4IHVA 3L2QA 5ILUA 2GAUA 3G6EI 2Z5UA 3LNQA 4XKWA 2QQ9A 1PDNC 2Q2EA 4G7OF 1E3PA 2IJLA 2OPTA 1TWFJ 3K6GA 4BQAA 3I71A 4RS8A 1YJNI 1IO2A 2XGEA 1DPUA 4C30A 2RAEA 3M4OJ 2YPRA 3K4JA 3F6VA 3WE2A 2XV4S 1IUYA 3OOUA 4Q47A 2ZMEB 1UG2A 1F36A 2M87A 3M1CA 3BCAA 2FJ1A 4ZZDA 2ZB9A 4RB3C 4RAYA 3BWGA 3W2VA 1R4NB 2H1LA 2X1CA 2L5QA 3J7ZI 1SFEA 2CG4A 4NC8A 1GDTA 4A3LJ 1LEBA 4BE1A 4HLYA 3CCVI 3RZDJ 1TLHB 3O6BB 3HHHA 4LB5A 4A0ZA 4QWQA 2EIMH 4BE2A 3NARA 5F0CA 2XF5A 3OR2C 3ZMVA 2CUJA 4RGXA 2PLYA 3GW2A 4AD9A 3PIPF 3Q9VA 1YOVB 2K4BA 2PG4A 3V8KA 1UAAA 2QQ8A 3KP5A 5BS6A 3CCQI 3EYIA 5L3CA 1S7EA 4UY8I 1Z7UA 2VKEA 3QRFF 3M8JA 4D9JA 2A05A 1ULYA 1JKOC 4PGGA 1K61A 4IHSA 1A5JA 3ABMH 3K10A 3W6KB 2DDBA 3PNTA 3HUGB 2XB0X 2IS1A 1R5GA 4M3EA 3KEYA 4D5CA 4J00A 4BEHB 4OIOF 3S1NJ 2IS4A 3ZOBA 2VBWA 1U9NA 3HGGA 1EKEA 4KDPA 2PQ8A 2VOOA 2E7XA 2P7CB 3BR0A 1FX7A 4O6JA 2HYJA 4DIQA 3ASNH 4XQFA 1D5VA 2RV8A 2E7WA 2EIKH 1TQIA 4EJTA 4D1QA 4YFNF 1YO5C 1ZLJA 1B8IA 3OS1A 1W0UA 2FEZA 2LBFA 2ZJ2A 3A01B 2VKVA 3DWLE 2CV2A 3RZOJ 1IDZA 1KQ0A 2CW0F 1XSXA 2FQ3A 5LBQA 3HKZN 5LHGA 1IG7A 1LUJB 2QWWA 5F64A 4QSHA 3FXMA 3SZPA 4CUGA 1ETKA 5DUIA 3K7AJ 3RYRA 2BBYA 2EBIA 1UFMA 4FX0A 4MO7A 3BPXA 2AQEA 2XUBA 3W6JB 1MSEC 2XC7A 4M6YA 2BOLA 4M9ZA 4PUSA 2AS5F 3OYCA 1XD7A 2WAQN 1BC7C 4KJZA 4YELA 4KNYA 2HDDA 3MKWB 3F8NA 5DM7F 2QKLB 3M8FA 1HXDA 1OR7A 2QQBA 1ETWA 2FNPA 3BR5A 3F72A 3GCMA 2XRLA 1QGPA 5LLQA 3J7YJ 3L2RA 4BNCA 1FOYA 1Z77A 3X2QH 2CWEA 3O8GA 1BM9A 2QZ8A 3TOAA 4BBSJ 1GHCA 4A69C 2QSHX 3TP0A 2XAGA 4FTHA 3AFHA 1SD7A 2R4GA 3TO7A 1R1VA 2EQRA 2YR2A 4UB6C 5B66C 2QENA 2K9QA 5JI6A 3F23A 5LHHA 2C6YA 1OYIA 3BLYA 1MGTA 2ZMEC 3BJ6A 4ZYAA 1HCRA 2W7NA 4A3FJ 2QLZA 5FLXK 1TT5B 4PJMA 3BTLA 2WV1A 3BDDA 2KIFA 2XKOA 1ETYA 2V4JC 3BPVA 2M5WA 2XPWA 4OMYA 1S5LC 4E4HA 2K9MA 1R58A 1MBEA 3V7RA 3GZNB 2JT1A 2DI3A 3H9QA 1Q1VA 2DA1A 4XONA 1DDNA 3FWEA 2K4JA 5F0FA 1GLNA 2DODA 4DGWB 1X1BA 5E1XA 4XRSA 2DK5A 2FQ4A 4MQ9F 3ECOA 3CDHA 4RDUA 5EYRA 2IEKA 1WWXA 2XRNA 4EJUA 3FHNA 5DYMA 3TW7A 4BHPA 4IZZA 2XAUA 3FXUA 2DTZA 4E7KA 3Q0VA 2G7UA 2JVGA 3ZQHA 1Z0XA 4FCYA 1T8IA 1SAXA 1GXPA 2HOSA 4IQJA 1IRGA 1BW6A 2JSPA 1MJ9A 4HNUA 4Q4ZF 3KP7A 4W1UA 5TJJA 2DXIA 3CCLI 4XSXF 3RKWA 5FKMA 1WJAA 1HDDC 5FD6A 3HOYJ 4L18B 2IA0A 2YUSA 3A0HC 3ELKA 3IWFA 5LFAA 1K6YA 5J4VA 5E3OA 3J7AY 2GA1A 1BJAA 2B63J 2JTVA 1YLFA 1IN6A 2IVMA 3DKWA 4GFBA 4UB8C 5FRMA 5AIQA 5D4RA 4EMSA 1AHDP 1Y8RB 3PFYA 2JZYA 4XRSG 4XM3A 2RNJA 2CW8A 2VASA 4IRHA 2DJNA 3H3VK 5CPRB 3E1SA 4KN7X 1A6IA 5C44J 1K4SA 3BT9A 1XS9A 1O3QA 4XRFA 3ZPLA 2XROA 3C2HA 1ACIA 2ZJQF 4OU0A 2RDPA 1NG6A 1O7FA 2K02A 4IQ4A 1G59A 1T08B 1S6LA 5GTHC 3GTMJ 1MNEA 5DV5A 2HOAA 3H5NA 3PNYA 2GBYA 2DN0A 1ETOA 1UG0A 2WB1N 4IHXA 1T0FC 2G7HA 2LNBA 3FXQA 1YQAA 3RI4A 2VL8A 5FROA 1JI8A 5EG0A 3OYNA 5JVTA 1ETVA 1QRYA 3PQKA 4WWCA 3R61A 2ISYA 2L9NA 2W82A 1S3JA 1V55H 2X48A 2R7VA 4A5MA 4B48A 3VDXA 2KP6A 3CDLA 3WHCA 1MBGA 3DKXA 4BXUA 2ZFWA 4OOIA 4ZDLA 5FRNA 2F4OB 3ZQLA 5CKTA 5H2FC 5D8KB 4UXNA 4F3QA 2OU2A 3BR3A 3HM5A 2HZDA 3J81K 4L9VA 4LITA 1H0MA 1GV5A 2Y30A 3QODA 1OCCH 5GPCA 1VZ0A 5IYDJ 2K7LA 2KJBA 4XSZF 3BQZA 1P4AA 1QNTA 2IGNA 3E6CC 1WJ5A 4UV9A 1ZN2A 2PMHA 4XN3A 4XOTA 2V9VA 4EVIA 2XF6A 2ETHA 2IP2A 2XKPA 2UWMA 1NH3A 2MC4A 5DTDA 2PEXA 2XDVA 2MFZA 2W57A 3PM1A 4KITB 2VBXA 4D5FA 1WH5A 1ZG3A 1OYYA 1B9MA 3E5QA 2E2IJ 1TW2A 3VWBA 1X58A 4XKVA 3S2HJ 4FE7A 4RAGA 3IRQA 2DQLA 2CQXA 2X6YA 1SD5A 3JR9A 2D2WA 4PZJA 2Z16A 2DMQA 2X85A 4KIGA 4GGGA 5FD5A 3MWMA 4AYBN 3JSPA 3AAFA 5K5QA 2VODA 2Q8KA 2LY1A 3K2AA 2A68F 1X4PA 3AL0B 1LFBA 2CYYA 4BH9A 3BZKA 4CCJA 4MIMA 1WGXA 1ETXA 1KU7A 2VXZA 4WCGA 1JT6A 3IWZA 4MEYF 4B3AA 4AIKA 4Y4RA 2BW3B 3BP8A 1XCVA 1FP1D 3FIWA 3ONQA 4HX7A 4YG2F 1WI9A 4U0VA 4OIPF 1MJBA 1Y56A 1XMXA 3S3MA 3OS2A 6PAXA 4LG0A 5CQGA 1QU3A 2VT3A 2XAQA 2M1BA 2YS9A 4M3DA 1OCZH 1B4AA 1BI3A 4B8XA 5K7HA 4OIQF 1SC7A 2IBDA 4BS9A 3LQRA 3MVPA 2XF7A 4AVPA 1WKMA 3RIRA 2JPCA 3F22A 5K5RA 1RNLA 3KZYA 2DPDA 2BY3A 1TWCJ 3BR6A 3GEZA 4B47A 2FOKA 3B02A 1U3EM 1I27A 3DU5A 1K78A 4ENNA 1HKQA 1N25A 1U6GA 1IW7F 2GIZA 3KIOA 4Y3OA 4RB2C 2GOXB 2VE8A 1JGGA 1J59A 4F55A 1W7PB 1HF0A 3K4BA 2F6CA 4HDUA 4CDGA 3WTXC 5B5EC 2DO7A 2K3FA 3TEDA 1Y1VJ 2LK2A 2OAZA 4Z6YA 2L0KA 1H88C 4NQWB 1NG7A 5CVJA 2O3FA 2DA2A 2A6HF 5EZGA 3DXJF 5J4YA 4ZJZA 1X19A 2L4MA 2X0LA 3HUGA 3OV8A 2QQAA 1ONVA 4K2EA 2DU9A 4I6ZA 1OKRA 1WRJA 4M6XA 4KMUX 4M3FA 2WA0A 4XICA 2DFFA 3CC4I 1YFHA 2IRFG 3HSRA 2EV0A 4BXFA 4IPAA 2V1UA 1G3WA 4PK4A 3BG3A 5CLSA 3VODA 1S29A 5EEAA 4QTRA 5EDNA 2HOEA 3V42A 3CUQA 2ME6A 4G94A 3KEOA 3A01A 3COAC 1R9TJ 4BJ6C 3I59A 2DOEA 3RYPA 3SXYA 1T33A 3K1NA 2CV1A 3GVAA 3GMEA 1NTCA 3HYIA 4ZTJA 1YJ9I 4P5OA 1D8KA 5IYBJ 1V5GA 2Y0SN 4M6VA 5CVRA 1CF7B 1XG1A 2J5OA 1GXQA 1P92A 2RQPA 3BZCA 2W1OA 1H9TA 2Z9OA 3L09A 2XSDC 4N9HA 2W25A 3FDYA 2WWYA 4BE0A 4XIDA 4N4OB 3IH2A 3HRUA 2EWNA 3RTRA 2AXLA 5F04A 5EF6A 1ZR2A 5HLIA 2M3AA 2V7FA 3GXOA 3HGYA 3HPHA 3HEFA 3BC8A 4M72A 4UUSB 3OIPA 4UHTA 2LOOA 3GFIA 3HOUJ 2MC3A 1T56A 1XMAA 1MIJA 2LF7A 1YRNA 2NRAC 4PSXA 1MD0A 1BI1A 2DOFA 3G1OA 4WF2A 4CH7A 2HQRA 1O3SA 1P7IA 2EB7A 4I09A 4DBQA 3WE3A 1HW2A 2HR3A 2VC1A 2RN7A 1N75A 2KKOA 3E0JB 4X1EA 5DEQA 3AL0C 5E3LA 4M9SA 2VUMJ 1FT9A 1D1AA 3CMEI 1QA6A 3FM5A 4ENMA 2Z3YA 2CS3A 2EV5A 2VN2A 3SFZA 4CCLA 2DA3A 5LRSA 4A5NA 1MNMC 4MQVA 2JK3A 4HAMA 1Y0NA 2IA2A 3OYIA 1JKQC 2VC0A 4YIRX 1LE8A 2FSWA 4F52A 2XSJC 3R0JA 4EATA 3CMYA 2W85A 1X1AA 3FKIJ 1R36A 4LIUA 2GXAA 3EETA 1XDSA 3KLOA 1VQ8I 1KONA 1UMQA 4MTEA 3QYEA 4NB5A 4NNJA 1LFPA 2FMYA 2GZWA 2P6TA 3HBLA 3PSIA 3UNGC 1B1BA 1Z1DA 3SHFA 1FMVA 1QHGA 3ZXSA 2IAIA 3LA3A 4TV7A 4YRVA 5J47A 2E19A 5IYCJ 3UKGA 3PO3J 1FLIA 4ZH4F 3ZQGA 5D5XB 3FM3A 3B6AA 1JHHA 1FOXA 3QPTA 5DCFA 2HQ5A 1VQNI 2CFOA 1YJWI 4OAZA 4I98B 2X1DA 2PJRB 4NHJA 1RETA 3LA2A 1RR8C 3GTPJ 3K4NA 4X0GA 2D1VA 2JA7J 4AU7A 3HG9A 3IP4B 1TW3A 2P0WA 5F6FA 2F5EA 3GTGJ 1ZAOA 2ICWG 1X1CA 3ZQIA 1U5TA 1UHMA 1MMDA 3KZIC 2JA2A 2NS8A 2DDAA 3MKLA 4CCOA 2NOGA 3BG7A 2KL4A 1I39A 5H20A 4KT5C 2E71A 1ZG5A 3SJMA 3ZN0A 2YX7A 2COMA 1NHAA 2Y48A 2P4WA 5KVRA 5F27A 4A0XA 3SZTA 1VTNC 1HLVA 4KN4X 2VBZA 2VJ4A 3I56I 2AO9A 3H0DA 3IAM2 3FXKA 4YFXF 2V26A 3QU6A 3KYLA 1X1DA 1SAUA 3GYHX 2R7WA 2DK8A 3L2VA 1FJLA 4OWRB 4CZZA 1OR7C 1X4OA 1F43A 2KHMA 1USTA 2VIXA 1EH6A 3IUOA 1S7AA 1AA7A 1U2WA 2EFPA 1Y0UA 2UXNA 2R7FA 3V8LA 4V2GA 3N05A 2DLLA 3KX2A 4OAYA 1IN5A 4XNFA 3BTIA 1U0JA 2LYCA 1LB2A 1G3YA 1QVUA 1SFXA 2XVCA 3KP6A 2GXGA 3Q9SA 1UHSA 2DYRH 3G73A 1SVLA 1WFXA 3PUFA 1EH8A 4KICA 2A6EF 3HOTA 2BV6A 4UUVA 2HVSA 4HQEA 2IS2A 3WTVC 3WU0A 2LY9A 3EQLF 3H92A 2O7OA 4A3MJ 3BJAA 1ZLKA 2V1NA 2EFNA 4CCKA 3D5SC 2KT0A 1LNWA 5BMZA 4L5JA 3M3YJ 2HVQA 1JHFA 1F1ZA 3ABKH 4XLPF 3BOQA 4XLCA 1FTTA 2NYXA 3LWFA 3WG9A 2DT7B 3WODF 5LHIA 1RESA 4PDKA 2H6CA 4A3JJ 3F0CA 2WY7Q 1AKHB 4IHTA 4RM3A 3JTHA 2NVTJ 1XGMA 2ZXHA 3K1PA 4LG3A 3BQYA 5KNLA 3T8TA 4FETA 2L02A 3F8CA 1A36A 3S14J 2M7AA 3QQAA 1IUFA 2DT5A 3K70D 3J7AO 3BTCA 5CYVA 4B09A 4C3IJ 1V5FA 5A2QK 2R5ZA 2D45A 1GV2A 2P5LC 1DU6A 5ILVA 1BR2A 2CU7A 1J2XA 5GP9A 2L9SA 1IDYA 2ZKZA 2X6OA 4E7HA 4ENKA 2HS5A 3D0SA 1YW9A 2OZ6A 3PUBA 1ZRCA 4XLAA 3IH4A 1V3FA 5M5WJ 1B9NA 2KJCA 1VFCA 1SMYF 3GFMA 2VXDA 2RKHA 1R5ID 2R5YB 1S9HA 3F8FA 3H9GA 3CESA 4IKFA 1UELB 4HNTA 3CCEI 2HQAA 4Z2YA 1SEUA 3I0TA 2W00A 4XMYA 2ZJRF 3ZQ7A 1QZZA 1BI0A 2FE3A 3FHZA 1GT0C 4S04A 4HZFA 3ZGKA 3L00A 3I4MJ 3ZMSA 4XN0A 2YU3A 1PUFA 3Q5FA 1Y1WJ 1MDMA 1W36D 1R5HA 1IN7A 2ZXJA 1XB4A 4B3XA 2CV0A 5E18F 2IPQX 1F4KA 2WBMA 2L9RA 3P7NA 3HHGA 2KPMA 4B43A 2DMPA 2L7ZA 3E3VA 5M5XJ 4HF2A 1XSDA 2A5WA 2E1MC 4HSRA 3BY6A 4W97A 5ICEA 1IF1A 1UHWA 3VB2A 2M34A 3ZN1A 1SMTA 5DS9A 1CQTA 2EZLA 1HA8A 5AONA 5JHUA 3K4KA 5L3GA 2EZIA 5HVQC 5JHFA 2E2HJ 3U21A 2JQ7A 1WI3A 2KMUA 4RLFA 2LR8A 1NK2P 1WQ2A 4HBLA 4P1WA 1BR1A 1MMGA 4O3MA 2PFBA 3LQQA 3M8EA 3KZZA 3QOEA 5EGOB 2VJIA 4LOCA 3IL2A 3ZP5A 3I54A 2LF8A 5J6XA 5FO5A 4LFUA 1Y39A 5E20A 1U78A 1HW5A 2EFOA 3BG6A 3JAMZ 3K9TA 3L2WA 2QSGX 3OR1C 4KUMA 5LEKA 2Y9ZA 1J75A 3QYBA 1BI2A 2XHKA 1ZKGA 4EGYA 3H36A 4II3A 4CCMA 1S8NA 2ELHA 3BG5A 1HW1A 1WZ2A 5E1WA 2ZFUA 2A3SA 2JVHA 1R4MB 4FQGA 4UUTA 4AIDA 1D0YA 2VI6A 4U7DA 1P6RA 2AHQA 1LDJA 3D1NI 4UVAA 3Q0WA 3JRIA 2VJJA 2ZNZA 4N4NB 1ENHA 1U8BA 2QM3A 4KFCA 3A4CA 1L3LA 3EUAA 1PVEA 2AQFA 2FBHA 2VKHA 5CVIA 3EYYA 3FKJA 4RB1A 2CQQA 4FE4A 4EEFG 2COBA 3IKVA 3MZ8A 1FNNA 2HQNA 2P8TA 3ZCOA 3U9GA 3MZHA 1H9GA 1Z3XA 4BGDA 2NNYA 5IP7J 1IXRC 1WCMJ 3RKYA 2WV0A 2V6CA 4M3BA 4Y52J 2QBYB 1KU9A 4BL0B 3LSRA 2E60A 2DBBA 1H8AC 3CC7I 4NUBA 3FK6A 1D3YA 2EV6A 4LLGF 4HX4A 4DNCA 4IRIA 2G9WA 2GQQA 1YITI 5FLVA 2VB6A 3C1DA 4CZCA 4BBRJ 1G2HA 4RGRA 3I53A 4BQQA 1WJFA 3KE2A 3F6OA 4S05A 3TW6A 2M8GX 1IRXA 1J7KA 1RI7A 3KP3A 1I5ZA 3K1MA 4QIWN 1IXSB 4IEJA 5K7FA 4DYQA 2KFDA 3SDBA 1HKTA 1VQ5I 3ECHA 2ADUA 5M3FJ 4M3GA 5F1RA 4MNUA 2DMNA 3F3XA 4P55A 3WTSC 1AU7A 2GA2A 4LD5A 4PCQA 3S1MJ 3SZGA 4RGUA 1G3SA 2GIVA 2CMPA 1B72A 4XKBA 3S3OA 1ZH5A 4V19K 2HDWA 5AIPA 5D8LB 4I99C 1XMKA 4ZYGA 5H6QA 1I3QJ 3D5RC 3ML6A 4ESFA 1I50J 3R60A 3C2BA 3LA7A 5LEJA 3DLLF 1VQMI 2OC6A 5IOZA 3HKZA 3NWSA 4G8XA 3OS0A 2DFEA 3B6CA 2PJRA 4XLEA 1WJDA 5ILSA 4EM0B 3PSFA 3N4MA 4DZJA 2P6SA 5FKKA 1D5YA 1WSUA 1OMIA 1Z91A 4GYIA 2ZO4A 2XPVA 5ERIA 4BQNA 2OZUA 4QPQA 1A35A 2KRFA 2JRMA 1TNSA 2CUEA 1TL8A 1TZLA 4I7HA 1G3TA 3WTYC 2V79A 5JFRA 4H0EA 1KQ9A 1XC5A 4BJTA 1WH7A 2IGOA 4XLHA 3CJNA 4BQOA 5FGMA 3A2KA 2EA4A 3I5UA 2LMDA 2LC2A 3HZJA 1HDPA 3PFIA 5KCMA 1M1EB 4A3BJ 5D6FA 1S7OA 3FK7A 3IHUA 4EM1A 3HC7A 3OSGA 4A3DJ 4AIJA 1OCTC 1DGRM 3IC7A 1XGSA 3F21A 2EIJH 3DTEA 1TBXA 2HXIA 2D1HA 3W2AA 3HJEA 4UVCA 2ZSHB 3MKZA 2BY0A 3HDDA 1RUNA 2Y0MA 3CD6I 1LQ1A 3ZMDA 1BR4A 4CA0A 4QLCU 3ERMA 2NVXJ 2Q2EB 1FYKA 3VYTB 2WAFA 2CUFA 2ZCWA 1D1BA 2CGPA 4A6DA 2QKMB 3AKZA 5CJ9A 1WVRA 1ZYRF 2ECCA 3FMQA 3JW4A 1ZG1A 3OYAA 5C4JJ 3G1MA 1Y8QB 4LGWA 4V2FA 3RKXA 3TO9A 2IW5A 4A12A 2MABA 2K9SA 2Y31A 1VNDA 1L0OC 2J5PA 3P5JA 5ICCA 1FIPA 3SEQA 5BPDA 1ZHFA 3FXRA 4BDZA 3R6SA 1YTYA 1C0WA 5HS9A 2TRTA 3G4SI 3CJTB 4GO1A 2HPIA 1X3UA 1FIAA 1JUPA 2FF4A 1Z3YA 2UUZA 3U1KA 1I1GA 4GCVA 3M1EA 3I3LA 4PJNA 1ZREA 4GRIA 5B3SH 3CO7C 1ITYA 2FOWA 5KAFC 2K5CA 3T5XA 2OQGA 2ZMEA 2DYSH 3EUHC 4IJAA 3GWZA 1EH7A 3KCCA 4J19A 2EPFA 4U88A 1EJ9A 1OCRH 4E7LA 1R6RA 3K4LA 4OINF 2DFHA 3A02A 2R7QA 4UVBA 2XGCA 4HF1A 3Q0UA 4G7HF 3CJRB 3O8HA 2P81A 3S1QJ 1ZGJA 2PI0A 3S17J 4ON0A 4ZYHA 3L2UA 2RREA 1VQOI 1IV8A 3JAMK 2NVUB 4ZC3A 4PJ0C 1XSVA 2HZTA 3PL8A 4PJJA 5FKLA 1TNTA 5D5UB 2ESHA 4ZZLA 3DP7A 2OQRA 2R7RA 1P4XA 1H89C 2BEOA 3RSNA 4ZYDA 4IL6C 2BZTA 1BOBA 2BHZA 2EH3A 2W4SA 4N9IA 2LKSA 3ZQCA 4MFEA 4XOPA 1IRFA 2LLKA 2R7DA 4MTDA 3MFKA 2WB1A 3TQNA 3GX4X 3CP8A 2KIUA 4DYRA 2OTJI 3GZ6A 3KLNA 5H6RA 3ZMZA 1VQ9I 1V5EA 3WU1B 4MEXF 3ZR8X 1RR7A 3HOSA 2RQQA 1FC3A 3KYCB 1RRJA 3WGGA 3BR1A 3ABLH 4BEHA 5HS7A 1MSFC 4Y7NJ 2BXZA 1E0EA 1YS7A 4IXAA 2V1DA 1VQ4I 5HDNA 1QPMA 1EV7A 5DCMB 4HLXA 3K0LA 3CTAA 3H0GJ 4FT8A 4BU2A 2OV7A 2I5UA 2HFHA 1P7JA 1XCBA 2KIMA 5GAEJ 5D5VB 3R0AA 3TOBA 1T95A 2XGDA 3CCRI 3L2CA 1ON1A 5IP9J 1FBQA 4Y13A 3S93A 4DQ2A 2O6GE 2NS7A 2GLOA 2ACJA 2BY1A 2E5ZA 4LK1F 1RZ4A 2O8XA 4CGZA 5DD8A 3UR3C 4CHUA 3T1BA 1B6AA 3PJRA 3G3ZA 4E70A 2EK5A 3F9KA 4FHTA 4H4KC 4JP0A 1N78A 5EEGA 3LOCA 5E79C 1ZK8A 2DA4A 3W2WA 4BHCA 1IZ1A 1LVAA 1Y6IA 4Y33A 5TRDA 4HV5A 1OISA 4Q48A 2ESNA 1OYWA 2RNGA 3VYRB 3IAS2 2KLOA 2W84A 3T8RA 2DCEA 4CO8A 1EF4A 1X1PA 1WHUA 2QA4I 4HG2A 2MD0A 4UNOA 2XGXA 2LVSA 3DTKA 4G9YA 2JMWA 2GXBA 2W24A 3VYSB 4AYBA 5E1ZB 4AC0A 3MD2A 3CP2A 5TGTA 4ZDOA 4XLFA 3U1DA 2HKOA 5IY5H 3CQZJ 4AVZA 1UCRA 1OJLA 3OYHA 2VLAA 1YHQI 3S32A 5FFXA 3JSOA 2HKXA 4HOBA 4XKCA 5M5YJ 5FKNA 1PYVA 3GTLJ 4PFPA 1FYMA 1QQIA 2M7BA 5GAHJ 2EFWA 4U7BA 5BNGA 2VPLA 3AG2H 2VE9A 1K79A 3ESWB 3OL4A 5LGUA 2L3DA 2V9PA 1J9IA 1RPWA 4ASNA 4BY7J 5IPAA 1IV6A 2VKDA 1IJWC 3OYFA 2HTSA 1KYZA 2FA5A 5J8FA 5CVVA 1I6XA 2LH9A 2FD5A 2OCCH 3MAJA 1YS6A 4WXHA 4C3HJ 3ZMTA 3DV8A 1OLTA 2RC4A 2ISZA 1MH4A 1PP8F 2Q0OA 1WJBA 1E17A 3TBIA 4NC7A 5F0HA 3F8MA 2AXTC 5GTIC 2DW4A 3H5RA 5KK1A 2MG4A 3E5UA 1HSTA 2XB5A 2F5CA 3REOA 3LAJA 3DBLB 3HRSA 1B59A 2HYGD 3P9IA 5GPAA 1YW8A 4XR6A 3FISA 1E3HA 3TO6A 4R1HA 2STTA 1RKTA 4EGZA 1OFCX 1KZHA 3JRCA 1W0TA 3H3UA 3H5AA 2M4KA 3TL4X 1KU3A 3LSPA 3S16J 1OPCA 3HIFA 4A3EJ 4A3CJ 2VONA 3SEZA 1J0RA 2R7XA 3W3CA 2E1MB 3DPLC 2B7EA 5FLXZ 3WG7H 1TQPA 2M2EA 1VQ6I 1DQUA 3HB9A 1FZPB 1G4DA 4L5IA 2Y2ZA 5EG0B 3CCSI 4S0HB 3FXLA 4KT6A 1TTYA 2PX9A 1A6QA 3ISPA 5J1YA 2H09A 3AG3H 4PSWA 4RAZA 2H1KA 2W48A 3H35A 2KDZA 3V7SA 1FBUA 3SQNA 1V4RA 5IT3A 3HTUA 4F7ZA 2MD5A 4JYKA 2EZKA 3JRFA 2F5FA 2MLKA 3CJQB 5E3NA 1F5TA 2F5VA 2E34A 3GO5A 4WXCA 1BW5A 3OIQA 4EJOA 3DBRB 1OQYA 2BVLA 1FSEA 1BIBA 3MQ0A 5EJCA 1JXSA 3ZRGA 4N0BA 3WU2C 4KMFA 3DFGA 5DD4A 2PMZA 5GAGJ 1P4WA 3DQVC 3GFLA 1W1WE 2MA3A 4U0WA 3S2DJ 1DP3A 3QP5A 3W6VA 3RJPA 1E3OC 2TCTA 1JTXA 3JREA 4KYWA 2M8EA 2R7SA 1QHHD 3I55I 2O5RA 4XL9A 2ELJA 9ANTA 3E6BA 2M9HA 1ZGWA 3LSJA 2LDUA 3HOWJ 2O61A 4I01A 2MW8A 3VEPA 3IKTA 2CJJA 3KP2A 1YW7A 1ZTRA 4I02A 3WHBA 3BR2A 3ZQQA 2JA8J 3H1CA 4E7IA 2R7ZJ 5HODA 1W5SA 1N77A 4CXFA 3CLQA 3CCUI 4BACA 2XASA 2R3SA 1ZGAA 5J8CA 2ME0A 3RDIA 4JQFA 2HTJA 4I76A 4QPOA 4IOCF 1RKWA 2DA7A 2H8RA 3SFIA 3EUKL 2DT6A 4HEA2 2DAOA 3VPRA 3DEWA 4ZYEA 1K83J 2ID6A 1PJRA 3HSFA 3M07A 3K69A 1P9QC 3CCYA 1BC8C 2K9LA 1Z67A 4CYCB 2DA6A 4LG0B 4C2TA 3GTQJ 4BY1J 1ZARA 2UXXA 2IGKA 2LKPA 4DJAA 2F4MB 4AM3A 2OTLI 1G6NA 3PQJA 1MMAA 4U87A 2MBFA 4JK1X 4HA8A 4OMZA 5HNFA 3OYEA 2E1OA 3JRAA 3LL7A 1REPC 3I4PA 1SFUA 3CZ6A 2BW3A 2CH0A 1DU0A 4HRIA 2JA6J 3GTKJ 2XAJA 2BGCA 3WGIA 3J81Z 1YIJI 3DF8A 1OCPA 3WGHA 3CCMI 4E7JA 4ESJA 1K78B 5BOXA 1MBKA 2K3PA 1YG2A 4M71A 4AWXB 2KISA 4A3KJ 1XX5A 2E35A 3WTWC 1BL0A 3HXLA 4YFKF 3KYDB 4LK0F 3GUDA 1U8RA 3VSLA 5L3BA 3OY9A 2VT2A 3QYFA 1KA8A 3JRDA 1NK3P 4IO9F 4BJ5C 2L2OA 2BE5F 1FWZA 2V9KA 1DPRA 1Z21A 1BBYA 2H6BA 3OSFA 3OYMA 1YYVA 2HU9A 3E97A 3LSIA 1RUOA 1W7PA 4BDYA 3LSKA 1QZYA 1PP7U 2M45A 3CMMA 4P96A 1UZCA 4B4CA 2L7MP 4F91B 1ON2A 2K9NA 1JKRC 4L0YB 3LFKA 1I3AA 2ZXWH 4F93B 5HOOA 4HYEA 4J01A 4IX7A 2B0LA 1JUMA 3E6DA 4I0AA 2XPUA 3PNVA 4NQWA 2LD5A 1FOKA 5HDGA 5LGTA 5D5WB 2PJPA 3CUQB 3MN2A 4MHGA 3LFUA 1ZQ3P 4IHYA 1QVTA 3I59B 2NOJB 3R4KA 3OYKA 1STZA 1WJCA 2OCEA 3GBGA 1F9NA 4CSWA 4D7MA 5LGNA 5E8GA 1IRZA 2OD5A 5DCMA 4I2OA 3C18A 2L7FP 4PGHA 5ICFA 3RQ4A 4ENJA 1MBJA 2H8WA 4YIIA 5HLTA 1P2FA 2VOPA 2Y75A 3OYJA 4XK4A 2QSFX 3GTJJ 1VQ7I 1QPIA 2LSOA 1S72I 4LB6B 4IRGA 3B73A 1USSA 3GLXA 4MFDA 4II2A 2HXOA 2X51A 3BTJA 2GWRA 2OA4A 3FBNB 1SFKA 5FJ8J 1R00A 2EJRA 1CF7A 1UB9A 3FZVA 1HC8A 2FBIA 1YRNB 1FOWA 4I0BA 2P5KA 3DCFA 5F08A 4RMNA 2VBYA 3S8PA 2HVRA 3OMYA 2ELKA 3KEQA 5LRRA 2BHYA 1FPQA 1IN8A 2QVOA 4ZTFA 2MGQA 4UUSA 3KP4A 1DUXC 1ERDA 4RBOA 2JA5J 3E7LA 3FXOA 2DFIA 3A03A 5DDGA 3DTIA 2M0CA 1LE8B 4HW0A 1W7PD 2X4HA 3VSKA 1I6HJ 2ZC2A 3PO2J 1MMSA 2QUFA 1PUEE 1Q1HA 1TWAJ 3L1PA 3HL2A 4U0YA 3WTUC 1ZR4A 2O9LA 3S15J 3BG9A 4D0PA 1R49A 1E2XA 1KGSA 3OYLA 2GM4A 1LKXA 1JJ6C 4AIHA 2KZGA 2JWTA 2IT0A 1VQKI 3CLOA 2Z2SB 4RLQA 1FMWA 2UV1A 4HF0A 2BYVE 4KISA 3G1LA 5K5OA 4ITVA 3C2GA 3OYBA 3L9FA 5IT9Z 3ZMUA 2OF7A 1GUUA 2RGVA 2MH2A 5ICGA 4HSTA 2F5DA 1A04A 1Z05A 2KIQA 1K6OA 2JRTA 2CUZA 3WTZA 2Z1DA 1A31A 4AUXA 4DYCA 2G0EA 1MJAA 2FUG2 4E6KG 1SVMA 1U5TB 3LMMA 1ZRFA 1OCOH 2MH9A 2FXAA 3NRVA 2H94A 2JN6A 3I64A 4G6DA 4L9NA 2R0QC 2EFQA 3QOPA 2R93J 2N8GA 2L7KA 4LLLA 1BIAA 2CFXA 1YI2I 3JRGA 1LDKB 2HYFA 4E7ZA 2CW7A 5C4XJ 1TP4A 4C2UA 2VPRA 2CQKA 2VQCA 3K4MA 3QPLA 3FXJA 5BPIA 2E36A 5J1RA 2WTEA 3DEEA 3OWTA 4DBRA 3ABUA 5KAIC 3M9AA 4HDVA 4L5EA 5FFZA 3CUQC 2WAQA 3NEUA 5DUKA 4XORA 1T98A 1YIOA 2DOAA 3HRMA 2NVQJ 2E5NA 3HOZJ 4YIFA 4JX6A 3NAUA 2OBPA 3O2PE 3RCOA 3CF2A 2NXNB 2B9SA 1BOAA 3FMRA 3MZYA 4NDLA 3P9CA 2PN6A 5FLMJ 2NS0A 2ZXIA 3H3ZA 4UV8A 1HBXG 1VF9A 1ZELA 4FASD 2L54A 5J3LA 4CICA 1TWGJ 1FYLA 1R1TA 2K27A 4GYGA 2IXSA 3IRRA 3HOXJ 4A3IJ 1TC3C 4ZDPA 2KZVA 3JTGA 2I10A 2HPMA 1ORKA 2X6WA 2M4GA 3ZQFA 1T38A 2HWVA 2WY8Q 1D0ZA 3QWLA 4NC6A 3V7CA 1VQLI 1MMNA 4HX8A 3BCBA 4P9FA 2P7VB 3MKYB 1D0XA 3F8BA 3H9JA 4M73A 2IS6A 2O8KA 2FRHA 2FBKA 4JOMA 5D4SA 5HLGA 3BZ6A 1VQPI 4PJLA 3JRBA 2F2EA 3LSMA 5IP6A 2D5VA 1FY7A 2V1XA 1FTZA 2QYOA 2ZNYA 3RQIA 3CCJI 1HOMA 3TGNA 3P9KA 3PIOF 1JT0A 2R7OA 2ID3A 5GADJ 5J1UA 1JJ8C 4DOZA 1POGA 1JKPC 2CO5A 2R7TA 2WAEA 5JLXA 2L01A 4MGRA 3S1RJ 1WJEA 2JSCA 1Z9CA 4B1RA 4A6EA 4XRMA 1W5CC 3ROUA 4R79A 1SD4A 2QCOA 2FX0A 3OOPA 2R5ZB 4R8HA 5BQTA 2CSOA 4BKXA 2MYSA 2NNNA 2BY2A 5HDKA 4RA2A 2ECBA 1ETQA 1R1UA 3ABTA 1LVKA 3QU3A 4FISA 1O3RA 1AKHA 4C3JJ 3MMYB 2HDCA 1QO0D 2K40A 1Z6TA 2KRCA 3O3KA 1MH3A 3DBHB 2R92J 1BJZA 3E5XA 4EV0A 3K4CA 4L0ZB 2LTPA 4IF4A 4WK8F 3GTOJ 4RGSA 4D7NA 3RKQA 3J80Z 3CUOA 3GFJA 1HKSA 1UJ8A 3CO6C 1LFUP 1PUFB 1K4TA 5EEHA 2WADA 2EILH 1SANA 1J5YA 3FF5A 1MDMB 4LIVA 3DPUA 3EDPA 1U5TC 4CYCA 3IH3A 4LJZF 2L9VA 2UZKA 5LD2C 1HSJA 2A6TA 2R5YA 3VOEA
chains in the Genus database with same CATH topology
3E6MA 2XIGA 3FX3A 3TDUC 1LEAA 4Q5SF 2K86A 1IN4A 2E1NA 3D5LA 2XAHA 4XLNF 4HV6A 1FBSA 1Z6RA 1HQCA 2HEOA 1QBJA 1I1SA 4BAYA 2YSRA 4G6QA 2Z99A 3ERED 3BJOA 5ED4A 3QP6A 1AOYA 4M9XA 1XGOA 5K1YA 2PBIA 3MEXA 2PMUA 1AWCA 1KU2A 4P9UA 1GVJA 5A2QZ 1XDUA 3WTTC 1K7AA 2IA1A 4WXDA 4KIBA 1O7LA 4IVNA 3DEUA 1RIOH 4G7ZF 3NQOA 2YX4A 2ZBKA 1O3TA 2O0YA 1T0FA 1T39A 2EA2A 2MLGA 2P5VA 4XBFA 3L7WA 3C7JA 1FSHA 1KQ8A 2A5YB 3GZ5A 3I58A 1CGPA 3ULQB 4L9TA 4RB0A 4OIRF 5IT9K 3K2ZA 3QAHA 1FP2A 3V8JA 3V4GA 1XN7A 5E8IA 4JBAA 2NAZA 4GXOA 4A2UA 4Y17A 1XGNA 3RPUA 4BHBA 5D6EA 1LDDA 4EJWA 4A0YA 4FX4A 2FMLA 2DTRA 3MCZA 2DQRA 1JE8A 2DPUA 3C3WA 5JR3A 1TQMA 2H27A 4L9JA 3KFWX 5CVUA 2XAFA 1T6SA 1R7JA 2QBYA 1JGSA 5L3DA 2HGCA 1D8JA 1ZRDA 5FB2A 3BROA 1T2KA 1LJ9A 2FNAA 2RVCA 4EM2A 1DP7P 1R23A 3FMSA 3HSEA 3M7GA 4HQMA 5L3FA 3EUHA 3S2WA 4LLNA 3TKYA 1KYWA 4M74A 4ESBA 1MZBA 2TDXA 4EQQA 3T0YA 4Y15A 2M30A 2L4AA 1ODDA 4EJVA 2A61A 2WC2A 5L3EA 2STWA 1W4MA 4CYDA 2E1CA 1W5TA 5HS8A 4LMYA 4WX9A 2FU4A 2JPBA 3HTSB 1IXCA 3GF2A 3LAPA 2O03A 1R22A 3N97A 3U2RA 1BN5A 3VFZA 1O57A 1SD6A 3TDZC 2A69F 5HLHA 4BYYA 3J80K 3DPTA 1IAWA 3HRTA 2Z33A 1MKMA 4KA4A 4KIFA 3QPHA 3LSTA 4ETSA 2A07F 5E17F 4O5VA 3RPQA 3KETA 5ILUA 2GAUA 2Z5UA 2QQ9A 1PDNC 2Q2EA 4G7OF 2IJLA 4BQAA 3I71A 4RS8A 1DPUA 2YPRA 3F6VA 3WE2A 2XV4S 1IUYA 4Q47A 2ZMEB 2M87A 4ZZDA 4RB3C 4RAYA 3BWGA 1LEBA 1SFEA 2CG4A 4HLYA 1TLHB 3O6BB 3HHHA 4LB5A 4A0ZA 4QWQA 3ZMVA 4RGXA 2PLYA 3GW2A 4AD9A 3Q9VA 2K4BA 2PG4A 3V8KA 3KP5A 5BS6A 3EYIA 5L3CA 1Z7UA 3QRFF 1ULYA 4PGGA 4IHSA 3W6KB 1R5GA 4OIOF 2VBWA 4KDPA 2PQ8A 2VOOA 2E7XA 2P7CB 1FX7A 4O6JA 1D5VA 2RV8A 2E7WA 1TQIA 4EJTA 4YFNF 1YO5C 1ZLJA 2FEZA 2ZJ2A 1KQ0A 2CW0F 1XSXA 2FQ3A 5LBQA 5LHGA 2QWWA 5F64A 3SZPA 5DUIA 3RYRA 2BBYA 1UFMA 4FX0A 3BPXA 2XUBA 3W6JB 4M6YA 2AS5F 4M9ZA 1XD7A 1BC7C 4KNYA 3F8NA 3M8FA 1HXDA 1OR7A 2QQBA 2FNPA 3F72A 1QGPA 5LLQA 4BNCA 2CWEA 1BM9A 2QZ8A 3TOAA 1GHCA 2XAGA 1SD7A 3TO7A 1R1VA 2YR2A 2QENA 3F23A 5JI6A 5LHHA 2C6YA 1OYIA 1MGTA 3BJ6A 2QLZA 5FLXK 3BDDA 2KIFA 2XKOA 3BPVA 2M5WA 4OMYA 1R58A 3V7RA 2JT1A 2DI3A 1DDNA 3FWEA 2K4JA 5E1XA 2DK5A 4MQ9F 3ECOA 3CDHA 1WWXA 2XRNA 4EJUA 5DYMA 4BHPA 3FXUA 2G7UA 1SAXA 1IRGA 1GXPA 1MJ9A 4Q4ZF 3KP7A 5TJJA 4XSXF 3RKWA 5FD6A 4L18B 2IA0A 3IWFA 3ELKA 2GA1A 1BJAA 2JTVA 1YLFA 1IN6A 2IVMA 3DKWA 5AIQA 5D4RA 4EMSA 2JZYA 2RNJA 4IRHA 4KN7X 3ZPLA 1O3QA 4XRFA 2XROA 4OU0A 2RDPA 1O7FA 2K02A 1S6LA 5DV5A 2G7HA 3FXQA 2LNBA 3RI4A 1YQAA 5JVTA 3PQKA 4WWCA 3R61A 2ISYA 1S3JA 4A5MA 4BXUA 2ZFWA 4OOIA 5D8KB 4UXNA 2OU2A 3J81K 4L9VA 1H0MA 2K7LA 2KJBA 4XSZF 1P4AA 1QNTA 3E6CC 4UV9A 1ZN2A 2PMHA 2V9VA 4EVIA 2ETHA 2IP2A 2XKPA 2UWMA 2PEXA 2W57A 2VBXA 1ZG3A 1OYYA 1B9MA 3E5QA 1TW2A 3IRQA 2DQLA 1SD5A 2D2WA 4PZJA 4KIGA 4GGGA 5FD5A 3MWMA 3AAFA 3JSPA 5K5QA 2VODA 2Q8KA 2A68F 2CYYA 4BH9A 1KU7A 2VXZA 4WCGA 4MEYF 3IWZA 4AIKA 3BP8A 1XCVA 1FP1D 4HX7A 4YG2F 1WI9A 4U0VA 4OIPF 1MJBA 6PAXA 4LG0A 2VT3A 2XAQA 2M1BA 1B4AA 1BI3A 4B8XA 4OIQF 3LQRA 4AVPA 1WKMA 3RIRA 2JPCA 3F22A 5K5RA 1RNLA 3KZYA 2DPDA 3GEZA 2FOKA 3B02A 1U3EM 1I27A 1K78A 4ENNA 1HKQA 1U6GA 4RB2C 1IW7F 2VE8A 1J59A 1W7PB 4HDUA 4CDGA 3WTXC 2DO7A 2OAZA 5CVJA 2O3FA 2A6HF 3DXJF 2L4MA 2X0LA 3HUGA 3OV8A 2QQAA 1ONVA 4K2EA 2DU9A 1OKRA 1WRJA 4M6XA 4KMUX 1YFHA 2IRFG 3HSRA 2EV0A 4IPAA 2V1UA 1G3WA 5CLSA 3VODA 1S29A 2HOEA 3CUQA 4G94A 3KEOA 3COAC 3I59A 3RYPA 3SXYA 3K1NA 3GVAA 3HYIA 4P5OA 1D8KA 5CVRA 1CF7B 2J5OA 1GXQA 1P92A 2RQPA 2Z9OA 1H9TA 3L09A 4N9HA 2W25A 2WWYA 3HRUA 2EWNA 3RTRA 2AXLA 5HLIA 3GXOA 4M72A 4UHTA 3GFIA 2MC3A 1XMAA 2LF7A 2NRAC 1MD0A 1BI1A 4WF2A 2HQRA 1O3SA 2EB7A 4I09A 3WE3A 2HR3A 2VC1A 2RN7A 2KKOA 5DEQA 4M9SA 1FT9A 3FM5A 4ENMA 2Z3YA 2EV5A 2VN2A 3SFZA 5LRSA 4A5NA 4MQVA 4HAMA 2IA2A 2VC0A 2FSWA 3R0JA 2W85A 1R36A 3EETA 1XDSA 3KLOA 4MTEA 4NB5A 2FMYA 2GZWA 2P6TA 1B1BA 1Z1DA 3SHFA 3LA3A 4TV7A 1FLIA 4ZH4F 5D5XB 3FM3A 1JHHA 3QPTA 5DCFA 4I98B 4NHJA 3LA2A 2D1VA 1TW3A 5F6FA 2F5EA 1ZAOA 1U5TA 1UHMA 5H20A 4KT5C 1ZG5A 3ZN0A 2YX7A 2COMA 1NHAA 2Y48A 2P4WA 5KVRA 4A0XA 3SZTA 1VTNC 4KN4X 2VBZA 4YFXF 3QU6A 3GYHX 2DK8A 4CZZA 1USTA 1EH6A 1S7AA 2EFPA 1U2WA 2UXNA 1Y0UA 2R7FA 3V8LA 2DLLA 1IN5A 1LB2A 1G3YA 1SFXA 2XVCA 3KP6A 3Q9SA 2GXGA 3G73A 1EH8A 4KICA 2A6EF 3HOTA 2BV6A 4UUVA 4HQEA 3WTVC 3WU0A 3EQLF 3H92A 3BJAA 1ZLKA 2EFNA 1LNWA 5BMZA 4L5JA 1JHFA 1F1ZA 4XLPF 3BOQA 2NYXA 3LWFA 3WG9A 3WODF 5LHIA 4PDKA 2H6CA 4IHTA 3JTHA 1XGMA 3K1PA 3T8TA 2L02A 3F8CA 2DT5A 3J7AO 5CYVA 4B09A 5A2QK 2D45A 2P5LC 5ILVA 1J2XA 2ZKZA 4ENKA 2HS5A 3D0SA 1YW9A 2OZ6A 1ZRCA 1V3FA 1B9NA 2KJCA 1SMYF 3GFMA 2RKHA 3F8FA 4Z2YA 3I0TA 3ZQ7A 1QZZA 1BI0A 2FE3A 3FHZA 4S04A 4HZFA 3L00A 3ZMSA 2YU3A 3Q5FA 1MDMA 1R5HA 1IN7A 2ZXJA 1XB4A 5E18F 2IPQX 1F4KA 3P7NA 3HHGA 3E3VA 4HF2A 1XSDA 3BY6A 5ICEA 1IF1A 1UHWA 3VB2A 3ZN1A 1SMTA 5AONA 5JHUA 5L3GA 5HVQC 1WQ2A 4HBLA 4O3MA 2PFBA 3LQQA 3M8EA 3KZZA 3IL2A 3ZP5A 3I54A 2LF8A 5J6XA 5FO5A 4LFUA 5E20A 1U78A 1HW5A 2EFOA 3JAMZ 3K9TA 4KUMA 1J75A 5LEKA 1BI2A 2XHKA 4EGYA 1S8NA 2ELHA 1HW1A 5E1WA 2A3SA 4U7DA 1P6RA 1LDJA 4UVAA 2ZNZA 2QM3A 4KFCA 1L3LA 2FBHA 5CVIA 3EYYA 4RB1A 3IKVA 1FNNA 2HQNA 2P8TA 3U9GA 3MZHA 1H9GA 2NNYA 1IXRC 3RKYA 2WV0A 2V6CA 2QBYB 1KU9A 2DBBA 1D3YA 2EV6A 4LLGF 4HX4A 4DNCA 4IRIA 2G9WA 2GQQA 3C1DA 4RGRA 3I53A 3KE2A 3F6OA 4S05A 1J7KA 1RI7A 3KP3A 1I5ZA 3K1MA 1IXSB 1HKTA 3ECHA 2ADUA 5F1RA 4MNUA 3F3XA 4P55A 3WTSC 2GA2A 4LD5A 4PCQA 4RGUA 1G3SA 2GIVA 1ZH5A 5D8LB 5AIPA 1XMKA 4ZYGA 5H6QA 3ML6A 4ESFA 3R60A 3LA7A 5LEJA 4G8XA 5ILSA 4EM0B 3N4MA 2P6SA 1WSUA 1OMIA 1Z91A 4GYIA 2ZO4A 5ERIA 2OZUA 2KRFA 1TNSA 4I7HA 1G3TA 3WTYC 2V79A 5JFRA 4H0EA 1KQ9A 3CJNA 5FGMA 2EA4A 3I5UA 3PFIA 5D6FA 1S7OA 3IHUA 4EM1A 4AIJA 3IC7A 1XGSA 3F21A 1TBXA 2D1HA 4UVCA 1RUNA 2Y0MA 1LQ1A 3ZMDA 4QLCU 1FYKA 2ZCWA 2CGPA 4A6DA 5CJ9A 1ZYRF 3FMQA 3JW4A 1ZG1A 4LGWA 3RKXA 3TO9A 2IW5A 4A12A 1L0OC 2J5PA 5ICCA 5BPDA 1ZHFA 3FXRA 3R6SA 1YTYA 1C0WA 5HS9A 4GO1A 1X3UA 2FF4A 1I1GA 4GCVA 3M1EA 1ZREA 3CO7C 3T5XA 2OQGA 2ZMEA 4IJAA 3GWZA 1EH7A 3KCCA 4U88A 4OINF 4UVBA 4HF1A 4G7HF 1ZGJA 2PI0A 4ON0A 4ZYHA 3JAMK 1XSVA 2HZTA 1TNTA 5D5UB 2ESHA 4ZZLA 3DP7A 2OQRA 1P4XA 2BEOA 4ZYDA 4N9IA 1IRFA 2R7DA 4MTDA 3MFKA 3TQNA 3GX4X 2KIUA 3GZ6A 3KLNA 5H6RA 3ZMZA 3WU1B 4MEXF 3HOSA 1FC3A 3WGGA 5HS7A 1YS7A 4IXAA 2V1DA 5HDNA 1QPMA 1EV7A 5DCMB 4HLXA 3K0LA 3CTAA 4FT8A 2HFHA 1XCBA 5D5VB 2KIMA 3R0AA 3TOBA 3L2CA 1ON1A 1FBQA 4Y13A 4DQ2A 2O6GE 2ACJA 4LK1F 1RZ4A 2O8XA 4CGZA 5DD8A 4CHUA 3T1BA 1B6AA 3G3ZA 4E70A 2EK5A 4FHTA 5EEGA 4BHCA 1IZ1A 1LVAA 5TRDA 4HV5A 4Q48A 2ESNA 1OYWA 2W84A 4CO8A 3T8RA 4UNOA 2XGXA 4G9YA 2GXBA 2W24A 5E1ZB 3U1DA 2HKOA 1UCRA 5FFXA 3JSOA 2HKXA 4HOBA 1FYMA 1QQIA 2EFWA 4U7BA 2VE9A 1K79A 5LGUA 2L3DA 1J9IA 4ASNA 2HTSA 1KYZA 5J8FA 2FA5A 5CVVA 1I6XA 3MAJA 4WXHA 1YS6A 3ZMTA 3DV8A 2RC4A 2ISZA 1PP8F 2Q0OA 1E17A 3F8MA 2DW4A 5KK1A 3E5UA 1HSTA 2F5CA 3REOA 3LAJA 3HRSA 1B59A 2HYGD 3P9IA 1YW8A 3TO6A 4R1HA 2STTA 4EGZA 3H3UA 1KU3A 1OPCA 3HIFA 2VONA 1J0RA 3DPLC 5FLXZ 1TQPA 1FZPB 1G4DA 4L5IA 1TTYA 3ISPA 2H09A 4RAZA 3V7SA 1FBUA 3SQNA 1V4RA 5IT3A 3HTUA 4F7ZA 2MD5A 2F5FA 2MLKA 1F5TA 3GO5A 4WXCA 4EJOA 1FSEA 1BIBA 3MQ0A 1JXSA 4N0BA 4KMFA 3DFGA 5DD4A 1P4WA 3DQVC 3GFLA 4U0WA 2MA3A 3QP5A 3RJPA 4KYWA 2M8EA 3E6BA 2LDUA 2O61A 4I01A 3IKTA 3VEPA 3KP2A 1YW7A 4I02A 1W5SA 4CXFA 2XASA 2R3SA 1ZGAA 5J8CA 3RDIA 4JQFA 2HTJA 2DAOA 4ZYEA 3HSFA 3K69A 1BC8C 4LG0B 1ZARA 2UXXA 2LKPA 1G6NA 3PQJA 2MBFA 4JK1X 4HA8A 4OMZA 1REPC 3I4PA 1SFUA 2XAJA 2BGCA 3WGIA 3J81Z 3DF8A 3WGHA 4ESJA 1K78B 5BOXA 4M71A 1YG2A 4AWXB 3WTWC 4YFKF 4LK0F 3GUDA 1U8RA 5L3BA 2VT2A 1KA8A 2BE5F 1FWZA 1DPRA 1BBYA 2H6BA 1YYVA 3E97A 1RUOA 1W7PA 1QZYA 1PP7U 2M45A 4P96A 1ON2A 4L0YB 3LFKA 5HOOA 4HYEA 1HW2A 2B0LA 3E6DA 4I0AA 4NQWA 1FOKA 5HDGA 5LGTA 5D5WB 2PJPA 3CUQB 4MHGA 3I59B 3R4KA 1STZA 1F9NA 5LGNA 5E8GA 2OD5A 5DCMA 4I2OA 3C18A 4PGHA 4ENJA 5ICFA 4YIIA 1P2FA 2VOPA 2Y75A 2LSOA 4LB6B 4IRGA 3B73A 1USSA 3GLXA 2GWRA 2OA4A 1R00A 2EJRA 1CF7A 1UB9A 3FZVA 2FBIA 4I0BA 2P5KA 2VBYA 3KEQA 5LRRA 1FPQA 1IN8A 2QVOA 3KP4A 1DUXC 2DFIA 5DDGA 4HW0A 1W7PD 2X4HA 2QUFA 1PUEE 1Q1HA 4U0YA 3WTUC 4D0PA 1E2XA 1KGSA 4AIHA 2IT0A 3CLOA 4HF0A 2BYVE 5K5OA 3L9FA 5IT9Z 3ZMUA 2RGVA 5ICGA 2MH2A 2F5DA 1A04A 1Z05A 1K6OA 2JRTA 3WTZA 1MJAA 1U5TB 1ZRFA 2MH9A 2FXAA 3NRVA 2H94A 3I64A 4L9NA 4G6DA 2EFQA 3QOPA 4LLLA 1BIAA 2CFXA 1LDKB 2HYFA 2CQKA 5BPIA 2WTEA 3ABUA 3M9AA 4HDVA 5FFZA 3CUQC 3NEUA 5DUKA 1T98A 1YIOA 3HRMA 4YIFA 2OBPA 3O2PE 1BOAA 3FMRA 3MZYA 3P9CA 2PN6A 2NS0A 3H3ZA 4UV8A 1HBXG 2L54A 4CICA 1FYLA 1R1TA 2K27A 4GYGA 3IRRA 3JTGA 1T38A 2HWVA 3V7CA 4HX8A 4P9FA 2P7VB 3F8BA 4M73A 2FRHA 2FBKA 5D4SA 5HLGA 3BZ6A 2F2EA 1FY7A 2V1XA 2QYOA 2ZNYA 3TGNA 3P9KA 2CO5A 2L01A 4MGRA 2JSCA 1Z9CA 4A6EA 3ROUA 4R79A 1SD4A 3OOPA 4R8HA 5BQTA 2CSOA 2NNNA 5HDKA 1R1UA 3ABTA 3QU3A 1O3RA 2HDCA 1QO0D 1Z6TA 3O3KA 3E5XA 4EV0A 4L0ZB 4IF4A 4WK8F 4RGSA 3J80Z 3CUOA 3GFJA 1HKSA 3CO6C 5EEHA 1J5YA 3FF5A 1MDMB 3EDPA 1U5TC 4LJZF 2UZKA 1HSJA 3VOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6M A;  2XIG A;  3FX3 A;  3TDU C;  1LEA A;  4Q5S F;  2K86 A;  1IN4 A;  2E1N A;  3D5L A;  2XAH A;  4XLN F;  4HV6 A;  1FBS A;  1Z6R A;  1HQC A;  2HEO A;  1QBJ A;  1I1S A;  4BAY A;  2YSR A;  4G6Q A;  2Z99 A;  3ERE D;  3BJO A;  5ED4 A;  3QP6 A;  1AOY A;  4M9X A;  1XGO A;  5K1Y A;  2PBI A;  3MEX A;  2PMU A;  1AWC A;  1KU2 A;  4P9U A;  1GVJ A;  5A2Q Z;  1XDU A;  3WTT C;  1K7A A;  2IA1 A;  4WXD A;  4KIB A;  1O7L A;  4IVN A;  3DEU A;  1RIO H;  4G7Z F;  3NQO A;  2YX4 A;  2ZBK A;  1O3T A;  2O0Y A;  1T0F A;  1T39 A;  2EA2 A;  2MLG A;  2P5V A;  4XBF A;  3L7W A;  3C7J A;  1FSH A;  1KQ8 A;  2A5Y B;  3GZ5 A;  3I58 A;  1CGP A;  3ULQ B;  4L9T A;  4RB0 A;  4OIR F;  5IT9 K;  3K2Z A;  3QAH A;  1FP2 A;  3V8J A;  3V4G A;  1XN7 A;  5E8I A;  4JBA A;  2NAZ A;  4GXO A;  4A2U A;  4Y17 A;  1XGN A;  3RPU A;  4BHB A;  5D6E A;  1LDD A;  4EJW A;  4A0Y A;  4FX4 A;  2FML A;  2DTR A;  3MCZ A;  2DQR A;  1JE8 A;  2DPU A;  3C3W A;  5JR3 A;  1TQM A;  2H27 A;  4L9J A;  3KFW X;  5CVU A;  2XAF A;  1T6S A;  1R7J A;  2QBY A;  1JGS A;  5L3D A;  2HGC A;  1D8J A;  1ZRD A;  5FB2 A;  3BRO A;  1T2K A;  1LJ9 A;  2FNA A;  2RVC A;  4EM2 A;  1DP7 P;  1R23 A;  3FMS A;  3HSE A;  3M7G A;  4HQM A;  5L3F A;  3EUH A;  3S2W A;  4LLN A;  3TKY A;  1KYW A;  4M74 A;  4ESB A;  1MZB A;  2TDX A;  4EQQ A;  3T0Y A;  4Y15 A;  2M30 A;  2L4A A;  1ODD A;  4EJV A;  2A61 A;  2WC2 A;  5L3E A;  2STW A;  1W4M A;  4CYD A;  2E1C A;  1W5T A;  5HS8 A;  4LMY A;  4WX9 A;  2FU4 A;  2JPB A;  3HTS B;  1IXC A;  3GF2 A;  3LAP A;  2O03 A;  1R22 A;  3N97 A;  3U2R A;  1BN5 A;  3VFZ A;  1O57 A;  1SD6 A;  3TDZ C;  2A69 F;  5HLH A;  4BYY A;  3J80 K;  3DPT A;  1IAW A;  3HRT A;  2Z33 A;  1MKM A;  4KA4 A;  4KIF A;  3QPH A;  3LST A;  4ETS A;  2A07 F;  5E17 F;  4O5V A;  3RPQ A;  3KET A;  5ILU A;  2GAU A;  2Z5U A;  2QQ9 A;  1PDN C;  2Q2E A;  4G7O F;  2IJL A;  4BQA A;  3I71 A;  4RS8 A;  1DPU A;  2YPR A;  3F6V A;  3WE2 A;  2XV4 S;  1IUY A;  4Q47 A;  2ZME B;  2M87 A;  4ZZD A;  4RB3 C;  4RAY A;  3BWG A;  1LEB A;  1SFE A;  2CG4 A;  4HLY A;  1TLH B;  3O6B B;  3HHH A;  4LB5 A;  4A0Z A;  4QWQ A;  3ZMV A;  4RGX A;  2PLY A;  3GW2 A;  4AD9 A;  3Q9V A;  2K4B A;  2PG4 A;  3V8K A;  3KP5 A;  5BS6 A;  3EYI A;  5L3C A;  1Z7U A;  3QRF F;  1ULY A;  4PGG A;  4IHS A;  3W6K B;  1R5G A;  4OIO F;  2VBW A;  4KDP A;  2PQ8 A;  2VOO A;  2E7X A;  2P7C B;  1FX7 A;  4O6J A;  1D5V A;  2RV8 A;  2E7W A;  1TQI A;  4EJT A;  4YFN F;  1YO5 C;  1ZLJ A;  2FEZ A;  2ZJ2 A;  1KQ0 A;  2CW0 F;  1XSX A;  2FQ3 A;  5LBQ A;  5LHG A;  2QWW A;  5F64 A;  3SZP A;  5DUI A;  3RYR A;  2BBY A;  1UFM A;  4FX0 A;  3BPX A;  2XUB A;  3W6J B;  4M6Y A;  2AS5 F;  4M9Z A;  1XD7 A;  1BC7 C;  4KNY A;  3F8N A;  3M8F A;  1HXD A;  1OR7 A;  2QQB A;  2FNP A;  3F72 A;  1QGP A;  5LLQ A;  4BNC A;  2CWE A;  1BM9 A;  2QZ8 A;  3TOA A;  1GHC A;  2XAG A;  1SD7 A;  3TO7 A;  1R1V A;  2YR2 A;  2QEN A;  3F23 A;  5JI6 A;  5LHH A;  2C6Y A;  1OYI A;  1MGT A;  3BJ6 A;  2QLZ A;  5FLX K;  3BDD A;  2KIF A;  2XKO A;  3BPV A;  2M5W A;  4OMY A;  1R58 A;  3V7R A;  2JT1 A;  2DI3 A;  1DDN A;  3FWE A;  2K4J A;  5E1X A;  2DK5 A;  4MQ9 F;  3ECO A;  3CDH A;  1WWX A;  2XRN A;  4EJU A;  5DYM A;  4BHP A;  3FXU A;  2G7U A;  1SAX A;  1IRG A;  1GXP A;  1MJ9 A;  4Q4Z F;  3KP7 A;  5TJJ A;  4XSX F;  3RKW A;  5FD6 A;  4L18 B;  2IA0 A;  3IWF A;  3ELK A;  2GA1 A;  1BJA A;  2JTV A;  1YLF A;  1IN6 A;  2IVM A;  3DKW A;  5AIQ A;  5D4R A;  4EMS A;  2JZY A;  2RNJ A;  4IRH A;  4KN7 X;  3ZPL A;  1O3Q A;  4XRF A;  2XRO A;  4OU0 A;  2RDP A;  1O7F A;  2K02 A;  1S6L A;  5DV5 A;  2G7H A;  3FXQ A;  2LNB A;  3RI4 A;  1YQA A;  5JVT A;  3PQK A;  4WWC A;  3R61 A;  2ISY A;  1S3J A;  4A5M A;  4BXU A;  2ZFW A;  4OOI A;  5D8K B;  4UXN A;  2OU2 A;  3J81 K;  4L9V A;  1H0M A;  2K7L A;  2KJB A;  4XSZ F;  1P4A A;  1QNT A;  3E6C C;  4UV9 A;  1ZN2 A;  2PMH A;  2V9V A;  4EVI A;  2ETH A;  2IP2 A;  2XKP A;  2UWM A;  2PEX A;  2W57 A;  2VBX A;  1ZG3 A;  1OYY A;  1B9M A;  3E5Q A;  1TW2 A;  3IRQ A;  2DQL A;  1SD5 A;  2D2W A;  4PZJ A;  4KIG A;  4GGG A;  5FD5 A;  3MWM A;  3AAF A;  3JSP A;  5K5Q A;  2VOD A;  2Q8K A;  2A68 F;  2CYY A;  4BH9 A;  1KU7 A;  2VXZ A;  4WCG A;  4MEY F;  3IWZ A;  4AIK A;  3BP8 A;  1XCV A;  1FP1 D;  4HX7 A;  4YG2 F;  1WI9 A;  4U0V A;  4OIP F;  1MJB A;  6PAX A;  4LG0 A;  2VT3 A;  2XAQ A;  2M1B A;  1B4A A;  1BI3 A;  4B8X A;  4OIQ F;  3LQR A;  4AVP A;  1WKM A;  3RIR A;  2JPC A;  3F22 A;  5K5R A;  1RNL A;  3KZY A;  2DPD A;  3GEZ A;  2FOK A;  3B02 A;  1U3E M;  1I27 A;  1K78 A;  4ENN A;  1HKQ A;  1U6G A;  4RB2 C;  1IW7 F;  2VE8 A;  1J59 A;  1W7P B;  4HDU A;  4CDG A;  3WTX C;  2DO7 A;  2OAZ A;  5CVJ A;  2O3F A;  2A6H F;  3DXJ F;  2L4M A;  2X0L A;  3HUG A;  3OV8 A;  2QQA A;  1ONV A;  4K2E A;  2DU9 A;  1OKR A;  1WRJ A;  4M6X A;  4KMU X;  1YFH A;  2IRF G;  3HSR A;  2EV0 A;  4IPA A;  2V1U A;  1G3W A;  5CLS A;  3VOD A;  1S29 A;  2HOE A;  3CUQ A;  4G94 A;  3KEO A;  3COA C;  3I59 A;  3RYP A;  3SXY A;  3K1N A;  3GVA A;  3HYI A;  4P5O A;  1D8K A;  5CVR A;  1CF7 B;  2J5O A;  1GXQ A;  1P92 A;  2RQP A;  2Z9O A;  1H9T A;  3L09 A;  4N9H A;  2W25 A;  2WWY A;  3HRU A;  2EWN A;  3RTR A;  2AXL A;  5HLI A;  3GXO A;  4M72 A;  4UHT A;  3GFI A;  2MC3 A;  1XMA A;  2LF7 A;  2NRA C;  1MD0 A;  1BI1 A;  4WF2 A;  2HQR A;  1O3S A;  2EB7 A;  4I09 A;  3WE3 A;  2HR3 A;  2VC1 A;  2RN7 A;  2KKO A;  5DEQ A;  4M9S A;  1FT9 A;  3FM5 A;  4ENM A;  2Z3Y A;  2EV5 A;  2VN2 A;  3SFZ A;  5LRS A;  4A5N A;  4MQV A;  4HAM A;  2IA2 A;  2VC0 A;  2FSW A;  3R0J A;  2W85 A;  1R36 A;  3EET A;  1XDS A;  3KLO A;  4MTE A;  4NB5 A;  2FMY A;  2GZW A;  2P6T A;  1B1B A;  1Z1D A;  3SHF A;  3LA3 A;  4TV7 A;  1FLI A;  4ZH4 F;  5D5X B;  3FM3 A;  1JHH A;  3QPT A;  5DCF A;  4I98 B;  4NHJ A;  3LA2 A;  2D1V A;  1TW3 A;  5F6F A;  2F5E A;  1ZAO A;  1U5T A;  1UHM A;  5H20 A;  4KT5 C;  1ZG5 A;  3ZN0 A;  2YX7 A;  2COM A;  1NHA A;  2Y48 A;  2P4W A;  5KVR A;  4A0X A;  3SZT A;  1VTN C;  4KN4 X;  2VBZ A;  4YFX F;  3QU6 A;  3GYH X;  2DK8 A;  4CZZ A;  1UST A;  1EH6 A;  1S7A A;  2EFP A;  1U2W A;  2UXN A;  1Y0U A;  2R7F A;  3V8L A;  2DLL A;  1IN5 A;  1LB2 A;  1G3Y A;  1SFX A;  2XVC A;  3KP6 A;  3Q9S A;  2GXG A;  3G73 A;  1EH8 A;  4KIC A;  2A6E F;  3HOT A;  2BV6 A;  4UUV A;  4HQE A;  3WTV C;  3WU0 A;  3EQL F;  3H92 A;  3BJA A;  1ZLK A;  2EFN A;  1LNW A;  5BMZ A;  4L5J A;  1JHF A;  1F1Z A;  4XLP F;  3BOQ A;  2NYX A;  3LWF A;  3WG9 A;  3WOD F;  5LHI A;  4PDK A;  2H6C A;  4IHT A;  3JTH A;  1XGM A;  3K1P A;  3T8T A;  2L02 A;  3F8C A;  2DT5 A;  3J7A O;  5CYV A;  4B09 A;  5A2Q K;  2D45 A;  2P5L C;  5ILV A;  1J2X A;  2ZKZ A;  4ENK A;  2HS5 A;  3D0S A;  1YW9 A;  2OZ6 A;  1ZRC A;  1V3F A;  1B9N A;  2KJC A;  1SMY F;  3GFM A;  2RKH A;  3F8F A;  4Z2Y A;  3I0T A;  3ZQ7 A;  1QZZ A;  1BI0 A;  2FE3 A;  3FHZ A;  4S04 A;  4HZF A;  3L00 A;  3ZMS A;  2YU3 A;  3Q5F A;  1MDM A;  1R5H A;  1IN7 A;  2ZXJ A;  1XB4 A;  5E18 F;  2IPQ X;  1F4K A;  3P7N A;  3HHG A;  3E3V A;  4HF2 A;  1XSD A;  3BY6 A;  5ICE A;  1IF1 A;  1UHW A;  3VB2 A;  3ZN1 A;  1SMT A;  5AON A;  5JHU A;  5L3G A;  5HVQ C;  1WQ2 A;  4HBL A;  4O3M A;  2PFB A;  3LQQ A;  3M8E A;  3KZZ A;  3IL2 A;  3ZP5 A;  3I54 A;  2LF8 A;  5J6X A;  5FO5 A;  4LFU A;  5E20 A;  1U78 A;  1HW5 A;  2EFO A;  3JAM Z;  3K9T A;  4KUM A;  1J75 A;  5LEK A;  1BI2 A;  2XHK A;  4EGY A;  1S8N A;  2ELH A;  1HW1 A;  5E1W A;  2A3S A;  4U7D A;  1P6R A;  1LDJ A;  4UVA A;  2ZNZ A;  2QM3 A;  4KFC A;  1L3L A;  2FBH A;  5CVI A;  3EYY A;  4RB1 A;  3IKV A;  1FNN A;  2HQN A;  2P8T A;  3U9G A;  3MZH A;  1H9G A;  2NNY A;  1IXR C;  3RKY A;  2WV0 A;  2V6C A;  2QBY B;  1KU9 A;  2DBB A;  1D3Y A;  2EV6 A;  4LLG F;  4HX4 A;  4DNC A;  4IRI A;  2G9W A;  2GQQ A;  3C1D A;  4RGR A;  3I53 A;  3KE2 A;  3F6O A;  4S05 A;  1J7K A;  1RI7 A;  3KP3 A;  1I5Z A;  3K1M A;  1IXS B;  1HKT A;  3ECH A;  2ADU A;  5F1R A;  4MNU A;  3F3X A;  4P55 A;  3WTS C;  2GA2 A;  4LD5 A;  4PCQ A;  4RGU A;  1G3S A;  2GIV A;  1ZH5 A;  5D8L B;  5AIP A;  1XMK A;  4ZYG A;  5H6Q A;  3ML6 A;  4ESF A;  3R60 A;  3LA7 A;  5LEJ A;  4G8X A;  5ILS A;  4EM0 B;  3N4M A;  2P6S A;  1WSU A;  1OMI A;  1Z91 A;  4GYI A;  2ZO4 A;  5ERI A;  2OZU A;  2KRF A;  1TNS A;  4I7H A;  1G3T A;  3WTY C;  2V79 A;  5JFR A;  4H0E A;  1KQ9 A;  3CJN A;  5FGM A;  2EA4 A;  3I5U A;  3PFI A;  5D6F A;  1S7O A;  3IHU A;  4EM1 A;  4AIJ A;  3IC7 A;  1XGS A;  3F21 A;  1TBX A;  2D1H A;  4UVC A;  1RUN A;  2Y0M A;  1LQ1 A;  3ZMD A;  4QLC U;  1FYK A;  2ZCW A;  2CGP A;  4A6D A;  5CJ9 A;  1ZYR F;  3FMQ A;  3JW4 A;  1ZG1 A;  4LGW A;  3RKX A;  3TO9 A;  2IW5 A;  4A12 A;  1L0O C;  2J5P A;  5ICC A;  5BPD A;  1ZHF A;  3FXR A;  3R6S A;  1YTY A;  1C0W A;  5HS9 A;  4GO1 A;  1X3U A;  2FF4 A;  1I1G A;  4GCV A;  3M1E A;  1ZRE A;  3CO7 C;  3T5X A;  2OQG A;  2ZME A;  4IJA A;  3GWZ A;  1EH7 A;  3KCC A;  4U88 A;  4OIN F;  4UVB A;  4HF1 A;  4G7H F;  1ZGJ A;  2PI0 A;  4ON0 A;  4ZYH A;  3JAM K;  1XSV A;  2HZT A;  1TNT A;  5D5U B;  2ESH A;  4ZZL A;  3DP7 A;  2OQR A;  1P4X A;  2BEO A;  4ZYD A;  4N9I A;  1IRF A;  2R7D A;  4MTD A;  3MFK A;  3TQN A;  3GX4 X;  2KIU A;  3GZ6 A;  3KLN A;  5H6R A;  3ZMZ A;  3WU1 B;  4MEX F;  3HOS A;  1FC3 A;  3WGG A;  5HS7 A;  1YS7 A;  4IXA A;  2V1D A;  5HDN A;  1QPM A;  1EV7 A;  5DCM B;  4HLX A;  3K0L A;  3CTA A;  4FT8 A;  2HFH A;  1XCB A;  5D5V B;  2KIM A;  3R0A A;  3TOB A;  3L2C A;  1ON1 A;  1FBQ A;  4Y13 A;  4DQ2 A;  2O6G E;  2ACJ A;  4LK1 F;  1RZ4 A;  2O8X A;  4CGZ A;  5DD8 A;  4CHU A;  3T1B A;  1B6A A;  3G3Z A;  4E70 A;  2EK5 A;  4FHT A;  5EEG A;  4BHC A;  1IZ1 A;  1LVA A;  5TRD A;  4HV5 A;  4Q48 A;  2ESN A;  1OYW A;  2W84 A;  4CO8 A;  3T8R A;  4UNO A;  2XGX A;  4G9Y A;  2GXB A;  2W24 A;  5E1Z B;  3U1D A;  2HKO A;  1UCR A;  5FFX A;  3JSO A;  2HKX A;  4HOB A;  1FYM A;  1QQI A;  2EFW A;  4U7B A;  2VE9 A;  1K79 A;  5LGU A;  2L3D A;  1J9I A;  4ASN A;  2HTS A;  1KYZ A;  5J8F A;  2FA5 A;  5CVV A;  1I6X A;  3MAJ A;  4WXH A;  1YS6 A;  3ZMT A;  3DV8 A;  2RC4 A;  2ISZ A;  1PP8 F;  2Q0O A;  1E17 A;  3F8M A;  2DW4 A;  5KK1 A;  3E5U A;  1HST A;  2F5C A;  3REO A;  3LAJ A;  3HRS A;  1B59 A;  2HYG D;  3P9I A;  1YW8 A;  3TO6 A;  4R1H A;  2STT A;  4EGZ A;  3H3U A;  1KU3 A;  1OPC A;  3HIF A;  2VON A;  1J0R A;  3DPL C;  5FLX Z;  1TQP A;  1FZP B;  1G4D A;  4L5I A;  1TTY A;  3ISP A;  2H09 A;  4RAZ A;  3V7S A;  1FBU A;  3SQN A;  1V4R A;  5IT3 A;  3HTU A;  4F7Z A;  2MD5 A;  2F5F A;  2MLK A;  1F5T A;  3GO5 A;  4WXC A;  4EJO A;  1FSE A;  1BIB A;  3MQ0 A;  1JXS A;  4N0B A;  4KMF A;  3DFG A;  5DD4 A;  1P4W A;  3DQV C;  3GFL A;  4U0W A;  2MA3 A;  3QP5 A;  3RJP A;  4KYW A;  2M8E A;  3E6B A;  2LDU A;  2O61 A;  4I01 A;  3IKT A;  3VEP A;  3KP2 A;  1YW7 A;  4I02 A;  1W5S A;  4CXF A;  2XAS A;  2R3S A;  1ZGA A;  5J8C A;  3RDI A;  4JQF A;  2HTJ A;  2DAO A;  4ZYE A;  3HSF A;  3K69 A;  1BC8 C;  4LG0 B;  1ZAR A;  2UXX A;  2LKP A;  1G6N A;  3PQJ A;  2MBF A;  4JK1 X;  4HA8 A;  4OMZ A;  1REP C;  3I4P A;  1SFU A;  2XAJ A;  2BGC A;  3WGI A;  3J81 Z;  3DF8 A;  3WGH A;  4ESJ A;  1K78 B;  5BOX A;  4M71 A;  1YG2 A;  4AWX B;  3WTW C;  4YFK F;  4LK0 F;  3GUD A;  1U8R A;  5L3B A;  2VT2 A;  1KA8 A;  2BE5 F;  1FWZ A;  1DPR A;  1BBY A;  2H6B A;  1YYV A;  3E97 A;  1RUO A;  1W7P A;  1QZY A;  1PP7 U;  2M45 A;  4P96 A;  1ON2 A;  4L0Y B;  3LFK A;  5HOO A;  4HYE A;  1HW2 A;  2B0L A;  3E6D A;  4I0A A;  4NQW A;  1FOK A;  5HDG A;  5LGT A;  5D5W B;  2PJP A;  3CUQ B;  4MHG A;  3I59 B;  3R4K A;  1STZ A;  1F9N A;  5LGN A;  5E8G A;  2OD5 A;  5DCM A;  4I2O A;  3C18 A;  4PGH A;  4ENJ A;  5ICF A;  4YII A;  1P2F A;  2VOP A;  2Y75 A;  2LSO A;  4LB6 B;  4IRG A;  3B73 A;  1USS A;  3GLX A;  2GWR A;  2OA4 A;  1R00 A;  2EJR A;  1CF7 A;  1UB9 A;  3FZV A;  2FBI A;  4I0B A;  2P5K A;  2VBY A;  3KEQ A;  5LRR A;  1FPQ A;  1IN8 A;  2QVO A;  3KP4 A;  1DUX C;  2DFI A;  5DDG A;  4HW0 A;  1W7P D;  2X4H A;  2QUF A;  1PUE E;  1Q1H A;  4U0Y A;  3WTU C;  4D0P A;  1E2X A;  1KGS A;  4AIH A;  2IT0 A;  3CLO A;  4HF0 A;  2BYV E;  5K5O A;  3L9F A;  5IT9 Z;  3ZMU A;  2RGV A;  5ICG A;  2MH2 A;  2F5D A;  1A04 A;  1Z05 A;  1K6O A;  2JRT A;  3WTZ A;  1MJA A;  1U5T B;  1ZRF A;  2MH9 A;  2FXA A;  3NRV A;  2H94 A;  3I64 A;  4L9N A;  4G6D A;  2EFQ A;  3QOP A;  4LLL A;  1BIA A;  2CFX A;  1LDK B;  2HYF A;  2CQK A;  5BPI A;  2WTE A;  3ABU A;  3M9A A;  4HDV A;  5FFZ A;  3CUQ C;  3NEU A;  5DUK A;  1T98 A;  1YIO A;  3HRM A;  4YIF A;  2OBP A;  3O2P E;  1BOA A;  3FMR A;  3MZY A;  3P9C A;  2PN6 A;  2NS0 A;  3H3Z A;  4UV8 A;  1HBX G;  2L54 A;  4CIC A;  1FYL A;  1R1T A;  2K27 A;  4GYG A;  3IRR A;  3JTG A;  1T38 A;  2HWV A;  3V7C A;  4HX8 A;  4P9F A;  2P7V B;  3F8B A;  4M73 A;  2FRH A;  2FBK A;  5D4S A;  5HLG A;  3BZ6 A;  2F2E A;  1FY7 A;  2V1X A;  2QYO A;  2ZNY A;  3TGN A;  3P9K A;  2CO5 A;  2L01 A;  4MGR A;  2JSC A;  1Z9C A;  4A6E A;  3ROU A;  4R79 A;  1SD4 A;  3OOP A;  4R8H A;  5BQT A;  2CSO A;  2NNN A;  5HDK A;  1R1U A;  3ABT A;  3QU3 A;  1O3R A;  2HDC A;  1QO0 D;  1Z6T A;  3O3K A;  3E5X A;  4EV0 A;  4L0Z B;  4IF4 A;  4WK8 F;  4RGS A;  3J80 Z;  3CUO A;  3GFJ A;  1HKS A;  3CO6 C;  5EEH A;  1J5Y A;  3FF5 A;  1MDM B;  3EDP A;  1U5T C;  4LJZ F;  2UZK A;  1HSJ A;  3VOE A; 
#chains in the Genus database with same CATH topology
 3A1Y A;  3K70 C;  3E6M A;  2XIG A;  4RAF A;  3FX3 A;  3TDU C;  4F92 B;  1LEA A;  4Q5S F;  1X3W B;  2K86 A;  2LG4 A;  4MLO A;  2CRG A;  1IN4 A;  1XTA A;  2E1N A;  3D5L A;  3G71 I;  2XAH A;  4XLN F;  3AG1 H;  1D1C A;  1BA5 A;  4HV6 A;  4IOA F;  2NVY J;  1B8I B;  1FEX A;  4JX5 A;  1FBS A;  1Z6R A;  1HQC A;  2HEO A;  1QBJ A;  3ASO H;  2LBF B;  2F4I A;  1EA3 A;  2I8D A;  2E2J J;  1I1S A;  4BAY A;  3FBI B;  2YSR A;  4G6Q A;  2Z99 A;  3SYT A;  3ERE D;  1IC8 A;  2ZJP F;  3GLL A;  3AG4 H;  3BJO A;  5ED4 A;  3QP6 A;  1AOY A;  4M9X A;  1XGO A;  5K1Y A;  2PBI A;  4ABZ A;  3MEX A;  2PMU A;  3TP3 A;  1AWC A;  2CQ7 A;  1KU2 A;  4P9U A;  1X2N A;  1GVJ A;  5A2Q Z;  1XDU A;  3WTT C;  1K7A A;  2QGU A;  2IA1 A;  4WXD A;  3SDG A;  3CMA I;  5JVG F;  1R71 A;  4A3G J;  1MND A;  3EPZ A;  4KIB A;  4GDF A;  1O7L A;  4IVN A;  1W36 C;  3DEU A;  5CQE A;  1RIO H;  2OJE D;  4G7Z F;  3NQO A;  2YX4 A;  2ZBK A;  5TIS C;  2O0Y A;  1O3T A;  1T0F A;  1T39 A;  2DJI A;  2EA2 A;  5EGO A;  2HOT A;  2MLG A;  2P5V A;  5JLW A;  2ZSI B;  4XBF A;  3L7W A;  4X6A J;  3C7J A;  2V6E A;  1FSH A;  1KQ8 A;  2GOM A;  2A5Y B;  3GZ5 A;  3KPH A;  4BUP A;  3I58 A;  4HNV A;  1CGP A;  2VQL A;  3ULQ B;  4L9T A;  4RB0 A;  4OIR F;  5IT9 K;  3K2Z A;  3QAH A;  3DLA A;  2EZH A;  3Q3S A;  1YX5 A;  1FP2 A;  1YE9 A;  3V8J A;  3V4G A;  2LP0 A;  1J09 A;  2DMU A;  1XN7 A;  5E8I A;  1Z7L A;  3LSH A;  1LPQ A;  4JBA A;  5B1A H;  1MBF A;  3VYU B;  1TWH J;  1JTY A;  2NAZ A;  2YU9 J;  3I4N J;  3S3N A;  4GXO A;  4A2U A;  4Y17 A;  1XGN A;  1MBH A;  3RPU A;  4BHB A;  2Y9Y A;  5D6E A;  1LDD A;  1VI0 A;  1X3Z B;  3DKY A;  2CQN A;  4A0Y A;  4EJW A;  2PMZ N;  4FX4 A;  2FML A;  2X1E A;  2DTR A;  3MCZ A;  2DQR A;  3QPS A;  1RC9 A;  4G12 A;  1JE8 A;  2DPU A;  5K7Z A;  3G2B A;  5E3M A;  3C3W A;  3LSG A;  5JR3 A;  1TQM A;  2H27 A;  4HPQ A;  3CF5 F;  4DW6 A;  4L9J A;  3KFW X;  4ANJ A;  4IHW A;  5CVU A;  2XAF A;  2LFB A;  1T6S A;  2LY2 A;  2JUG A;  1R7J A;  2QBY A;  1WPK A;  2VQH A;  4NBQ A;  1JGS A;  5L3D A;  2HGC A;  1D8J A;  5C3E J;  2QF7 A;  5M3M J;  1ZRD A;  5F1J A;  1V54 H;  5FB2 A;  3BRO A;  1T2K A;  1LJ9 A;  2LRE A;  3OL3 A;  4E7S A;  2FNA A;  2RVC A;  4EM2 A;  4CCN A;  1DP7 P;  3JRH A;  3CDI A;  4C2M J;  1B72 B;  1R23 A;  2OUM A;  3FMS A;  3NWT A;  1DGW Y;  3HSE A;  2DA5 A;  3M7G A;  5B1B H;  4HQM A;  5L3F A;  3A0B C;  3EUH A;  2KRH A;  3S2W A;  2MSY A;  4LLN A;  3TKY A;  1KYW A;  3IV5 A;  4M74 A;  5EZH A;  4ESB A;  1MZB A;  2TDX A;  3OYG A;  1GVD A;  1TT0 A;  4PFO A;  4EQQ A;  3T0Y A;  4Y15 A;  5J40 A;  1G8X A;  2M30 A;  3HOV J;  2L4A A;  1ODD A;  4EJV A;  2A61 A;  1SFO J;  5DM6 F;  4G6T B;  2WC2 A;  2X6X A;  2KDO A;  5L3E A;  4YEJ A;  2STW A;  1W4M A;  2K85 A;  2M0M A;  2BVM A;  1QZE A;  1SVO A;  3RPU D;  4CYD A;  2E1C A;  2VJ5 A;  4DZP A;  1X2M A;  2LRD A;  2X9D A;  1W5T A;  5HS8 A;  1XPX A;  5KHD A;  2JJ7 A;  5HNH A;  4BXX J;  4LMY A;  3TMO A;  5IOY A;  4WX9 A;  2FU4 A;  2JPB A;  4C9Y A;  3HTS B;  1APL C;  2Y0S A;  1O4X A;  1IXC A;  3GF2 A;  3LAP A;  2O03 A;  1R22 A;  3N97 A;  3U2R A;  2F48 A;  2HI3 A;  3JCU C;  1BN5 A;  3VFZ A;  2EIN H;  2Y69 H;  2LKX A;  2KQR A;  1O57 A;  1SD6 A;  1U9O A;  1MW7 A;  4RM2 A;  2Q1Z B;  2HNH A;  3HPG A;  2QEX I;  3DU6 A;  3TDZ C;  2A69 F;  5HLH A;  2IGM A;  5FKO A;  2DMT A;  4BYY A;  3J80 K;  4JX4 A;  1JUS A;  3DPT A;  1IAW A;  3HRT A;  3CC2 I;  4A93 J;  2Z33 A;  1MKM A;  3I9V 2;  3OIO A;  2JUC A;  2R7U A;  4KA4 A;  4KIF A;  3QPH A;  3LST A;  4B44 A;  4ETS A;  2A07 F;  5E17 F;  1IGN A;  2BXY A;  2VQG A;  1YX3 A;  4O5V A;  3RPQ A;  3KET A;  3OYD A;  4IHV A;  3L2Q A;  5ILU A;  2GAU A;  3G6E I;  2Z5U A;  3LNQ A;  4XKW A;  2QQ9 A;  1PDN C;  2Q2E A;  4G7O F;  1E3P A;  2IJL A;  2OPT A;  1TWF J;  3K6G A;  4BQA A;  3I71 A;  4RS8 A;  1YJN I;  1IO2 A;  2XGE A;  1DPU A;  4C30 A;  2RAE A;  3M4O J;  2YPR A;  3K4J A;  3F6V A;  3WE2 A;  2XV4 S;  1IUY A;  3OOU A;  4Q47 A;  2ZME B;  1UG2 A;  1F36 A;  2M87 A;  3M1C A;  3BCA A;  2FJ1 A;  4ZZD A;  2ZB9 A;  4RB3 C;  4RAY A;  3BWG A;  3W2V A;  1R4N B;  2H1L A;  2X1C A;  2L5Q A;  3J7Z I;  1SFE A;  2CG4 A;  4NC8 A;  1GDT A;  4A3L J;  1LEB A;  4BE1 A;  4HLY A;  3CCV I;  3RZD J;  1TLH B;  3O6B B;  3HHH A;  4LB5 A;  4A0Z A;  4QWQ A;  2EIM H;  4BE2 A;  3NAR A;  5F0C A;  2XF5 A;  3OR2 C;  3ZMV A;  2CUJ A;  4RGX A;  2PLY A;  3GW2 A;  4AD9 A;  3PIP F;  3Q9V A;  1YOV B;  2K4B A;  2PG4 A;  3V8K A;  1UAA A;  2QQ8 A;  3KP5 A;  5BS6 A;  3CCQ I;  3EYI A;  5L3C A;  1S7E A;  4UY8 I;  1Z7U A;  2VKE A;  3QRF F;  3M8J A;  4D9J A;  2A05 A;  1ULY A;  1JKO C;  4PGG A;  1K61 A;  4IHS A;  1A5J A;  3ABM H;  3K10 A;  3W6K B;  2DDB A;  3PNT A;  3HUG B;  2XB0 X;  2IS1 A;  1R5G A;  4M3E A;  3KEY A;  4D5C A;  4J00 A;  4BEH B;  4OIO F;  3S1N J;  2IS4 A;  3ZOB A;  2VBW A;  1U9N A;  3HGG A;  1EKE A;  4KDP A;  2PQ8 A;  2VOO A;  2E7X A;  2P7C B;  3BR0 A;  1FX7 A;  4O6J A;  2HYJ A;  4DIQ A;  3ASN H;  4XQF A;  1D5V A;  2RV8 A;  2E7W A;  2EIK H;  1TQI A;  4EJT A;  4D1Q A;  4YFN F;  1YO5 C;  1ZLJ A;  1B8I A;  3OS1 A;  1W0U A;  2FEZ A;  2LBF A;  2ZJ2 A;  3A01 B;  2VKV A;  3DWL E;  2CV2 A;  3RZO J;  1IDZ A;  1KQ0 A;  2CW0 F;  1XSX A;  2FQ3 A;  5LBQ A;  3HKZ N;  5LHG A;  1IG7 A;  1LUJ B;  2QWW A;  5F64 A;  4QSH A;  3FXM A;  3SZP A;  4CUG A;  1ETK A;  5DUI A;  3K7A J;  3RYR A;  2BBY A;  2EBI A;  1UFM A;  4FX0 A;  4MO7 A;  3BPX A;  2AQE A;  2XUB A;  3W6J B;  1MSE C;  2XC7 A;  4M6Y A;  2BOL A;  4M9Z A;  4PUS A;  2AS5 F;  3OYC A;  1XD7 A;  2WAQ N;  1BC7 C;  4KJZ A;  4YEL A;  4KNY A;  2HDD A;  3MKW B;  3F8N A;  5DM7 F;  2QKL B;  3M8F A;  1HXD A;  1OR7 A;  2QQB A;  1ETW A;  2FNP A;  3BR5 A;  3F72 A;  3GCM A;  2XRL A;  1QGP A;  5LLQ A;  3J7Y J;  3L2R A;  4BNC A;  1FOY A;  1Z77 A;  3X2Q H;  2CWE A;  3O8G A;  1BM9 A;  2QZ8 A;  3TOA A;  4BBS J;  1GHC A;  4A69 C;  2QSH X;  3TP0 A;  2XAG A;  4FTH A;  3AFH A;  1SD7 A;  2R4G A;  3TO7 A;  1R1V A;  2EQR A;  2YR2 A;  4UB6 C;  5B66 C;  2QEN A;  2K9Q A;  5JI6 A;  3F23 A;  5LHH A;  2C6Y A;  1OYI A;  3BLY A;  1MGT A;  2ZME C;  3BJ6 A;  4ZYA A;  1HCR A;  2W7N A;  4A3F J;  2QLZ A;  5FLX K;  1TT5 B;  4PJM A;  3BTL A;  2WV1 A;  3BDD A;  2KIF A;  2XKO A;  1ETY A;  2V4J C;  3BPV A;  2M5W A;  2XPW A;  4OMY A;  1S5L C;  4E4H A;  2K9M A;  1R58 A;  1MBE A;  3V7R A;  3GZN B;  2JT1 A;  2DI3 A;  3H9Q A;  1Q1V A;  2DA1 A;  4XON A;  1DDN A;  3FWE A;  2K4J A;  5F0F A;  1GLN A;  2DOD A;  4DGW B;  1X1B A;  5E1X A;  4XRS A;  2DK5 A;  2FQ4 A;  4MQ9 F;  3ECO A;  3CDH A;  4RDU A;  5EYR A;  2IEK A;  1WWX A;  2XRN A;  4EJU A;  3FHN A;  5DYM A;  3TW7 A;  4BHP A;  4IZZ A;  2XAU A;  3FXU A;  2DTZ A;  4E7K A;  3Q0V A;  2G7U A;  2JVG A;  3ZQH A;  1Z0X A;  4FCY A;  1T8I A;  1SAX A;  1GXP A;  2HOS A;  4IQJ A;  1IRG A;  1BW6 A;  2JSP A;  1MJ9 A;  4HNU A;  4Q4Z F;  3KP7 A;  4W1U A;  5TJJ A;  2DXI A;  3CCL I;  4XSX F;  3RKW A;  5FKM A;  1WJA A;  1HDD C;  5FD6 A;  3HOY J;  4L18 B;  2IA0 A;  2YUS A;  3A0H C;  3ELK A;  3IWF A;  5LFA A;  1K6Y A;  5J4V A;  5E3O A;  3J7A Y;  2GA1 A;  1BJA A;  2B63 J;  2JTV A;  1YLF A;  1IN6 A;  2IVM A;  3DKW A;  4GFB A;  4UB8 C;  5FRM A;  5AIQ A;  5D4R A;  4EMS A;  1AHD P;  1Y8R B;  3PFY A;  2JZY A;  4XRS G;  4XM3 A;  2RNJ A;  2CW8 A;  2VAS A;  4IRH A;  2DJN A;  3H3V K;  5CPR B;  3E1S A;  4KN7 X;  1A6I A;  5C44 J;  1K4S A;  3BT9 A;  1XS9 A;  1O3Q A;  4XRF A;  3ZPL A;  2XRO A;  3C2H A;  1ACI A;  2ZJQ F;  4OU0 A;  2RDP A;  1NG6 A;  1O7F A;  2K02 A;  4IQ4 A;  1G59 A;  1T08 B;  1S6L A;  5GTH C;  3GTM J;  1MNE A;  5DV5 A;  2HOA A;  3H5N A;  3PNY A;  2GBY A;  2DN0 A;  1ETO A;  1UG0 A;  2WB1 N;  4IHX A;  1T0F C;  2G7H A;  2LNB A;  3FXQ A;  1YQA A;  3RI4 A;  2VL8 A;  5FRO A;  1JI8 A;  5EG0 A;  3OYN A;  5JVT A;  1ETV A;  1QRY A;  3PQK A;  4WWC A;  3R61 A;  2ISY A;  2L9N A;  2W82 A;  1S3J A;  1V55 H;  2X48 A;  2R7V A;  4A5M A;  4B48 A;  3VDX A;  2KP6 A;  3CDL A;  3WHC A;  1MBG A;  3DKX A;  4BXU A;  2ZFW A;  4OOI A;  4ZDL A;  5FRN A;  2F4O B;  3ZQL A;  5CKT A;  5H2F C;  5D8K B;  4UXN A;  4F3Q A;  2OU2 A;  3BR3 A;  3HM5 A;  2HZD A;  3J81 K;  4L9V A;  4LIT A;  1H0M A;  1GV5 A;  2Y30 A;  3QOD A;  1OCC H;  5GPC A;  1VZ0 A;  5IYD J;  2K7L A;  2KJB A;  4XSZ F;  3BQZ A;  1P4A A;  1QNT A;  2IGN A;  3E6C C;  1WJ5 A;  4UV9 A;  1ZN2 A;  2PMH A;  4XN3 A;  4XOT A;  2V9V A;  4EVI A;  2XF6 A;  2ETH A;  2IP2 A;  2XKP A;  2UWM A;  1NH3 A;  2MC4 A;  5DTD A;  2PEX A;  2XDV A;  2MFZ A;  2W57 A;  3PM1 A;  4KIT B;  2VBX A;  4D5F A;  1WH5 A;  1ZG3 A;  1OYY A;  1B9M A;  3E5Q A;  2E2I J;  1TW2 A;  3VWB A;  1X58 A;  4XKV A;  3S2H J;  4FE7 A;  4RAG A;  3IRQ A;  2DQL A;  2CQX A;  2X6Y A;  1SD5 A;  3JR9 A;  2D2W A;  4PZJ A;  2Z16 A;  2DMQ A;  2X85 A;  4KIG A;  4GGG A;  5FD5 A;  3MWM A;  4AYB N;  3JSP A;  3AAF A;  5K5Q A;  2VOD A;  2Q8K A;  2LY1 A;  3K2A A;  2A68 F;  1X4P A;  3AL0 B;  1LFB A;  2CYY A;  4BH9 A;  3BZK A;  4CCJ A;  4MIM A;  1WGX A;  1ETX A;  1KU7 A;  2VXZ A;  4WCG A;  1JT6 A;  3IWZ A;  4MEY F;  4B3A A;  4AIK A;  4Y4R A;  2BW3 B;  3BP8 A;  1XCV A;  1FP1 D;  3FIW A;  3ONQ A;  4HX7 A;  4YG2 F;  1WI9 A;  4U0V A;  4OIP F;  1MJB A;  1Y56 A;  1XMX A;  3S3M A;  3OS2 A;  6PAX A;  4LG0 A;  5CQG A;  1QU3 A;  2VT3 A;  2XAQ A;  2M1B A;  2YS9 A;  4M3D A;  1OCZ H;  1B4A A;  1BI3 A;  4B8X A;  5K7H A;  4OIQ F;  1SC7 A;  2IBD A;  4BS9 A;  3LQR A;  3MVP A;  2XF7 A;  4AVP A;  1WKM A;  3RIR A;  2JPC A;  3F22 A;  5K5R A;  1RNL A;  3KZY A;  2DPD A;  2BY3 A;  1TWC J;  3BR6 A;  3GEZ A;  4B47 A;  2FOK A;  3B02 A;  1U3E M;  1I27 A;  3DU5 A;  1K78 A;  4ENN A;  1HKQ A;  1N25 A;  1U6G A;  1IW7 F;  2GIZ A;  3KIO A;  4Y3O A;  4RB2 C;  2GOX B;  2VE8 A;  1JGG A;  1J59 A;  4F55 A;  1W7P B;  1HF0 A;  3K4B A;  2F6C A;  4HDU A;  4CDG A;  3WTX C;  5B5E C;  2DO7 A;  2K3F A;  3TED A;  1Y1V J;  2LK2 A;  2OAZ A;  4Z6Y A;  2L0K A;  1H88 C;  4NQW B;  1NG7 A;  5CVJ A;  2O3F A;  2DA2 A;  2A6H F;  5EZG A;  3DXJ F;  5J4Y A;  4ZJZ A;  1X19 A;  2L4M A;  2X0L A;  3HUG A;  3OV8 A;  2QQA A;  1ONV A;  4K2E A;  2DU9 A;  4I6Z A;  1OKR A;  1WRJ A;  4M6X A;  4KMU X;  4M3F A;  2WA0 A;  4XIC A;  2DFF A;  3CC4 I;  1YFH A;  2IRF G;  3HSR A;  2EV0 A;  4BXF A;  4IPA A;  2V1U A;  1G3W A;  4PK4 A;  3BG3 A;  5CLS A;  3VOD A;  1S29 A;  5EEA A;  4QTR A;  5EDN A;  2HOE A;  3V42 A;  3CUQ A;  2ME6 A;  4G94 A;  3KEO A;  3A01 A;  3COA C;  1R9T J;  4BJ6 C;  3I59 A;  2DOE A;  3RYP A;  3SXY A;  1T33 A;  3K1N A;  2CV1 A;  3GVA A;  3GME A;  1NTC A;  3HYI A;  4ZTJ A;  1YJ9 I;  4P5O A;  1D8K A;  5IYB J;  1V5G A;  2Y0S N;  4M6V A;  5CVR A;  1CF7 B;  1XG1 A;  2J5O A;  1GXQ A;  1P92 A;  2RQP A;  3BZC A;  2W1O A;  1H9T A;  2Z9O A;  3L09 A;  2XSD C;  4N9H A;  2W25 A;  3FDY A;  2WWY A;  4BE0 A;  4XID A;  4N4O B;  3IH2 A;  3HRU A;  2EWN A;  3RTR A;  2AXL A;  5F04 A;  5EF6 A;  1ZR2 A;  5HLI A;  2M3A A;  2V7F A;  3GXO A;  3HGY A;  3HPH A;  3HEF A;  3BC8 A;  4M72 A;  4UUS B;  3OIP A;  4UHT A;  2LOO A;  3GFI A;  3HOU J;  2MC3 A;  1T56 A;  1XMA A;  1MIJ A;  2LF7 A;  1YRN A;  2NRA C;  4PSX A;  1MD0 A;  1BI1 A;  2DOF A;  3G1O A;  4WF2 A;  4CH7 A;  2HQR A;  1O3S A;  1P7I A;  2EB7 A;  4I09 A;  4DBQ A;  3WE3 A;  1HW2 A;  2HR3 A;  2VC1 A;  2RN7 A;  1N75 A;  2KKO A;  3E0J B;  4X1E A;  5DEQ A;  3AL0 C;  5E3L A;  4M9S A;  2VUM J;  1FT9 A;  1D1A A;  3CME I;  1QA6 A;  3FM5 A;  4ENM A;  2Z3Y A;  2CS3 A;  2EV5 A;  2VN2 A;  3SFZ A;  4CCL A;  2DA3 A;  5LRS A;  4A5N A;  1MNM C;  4MQV A;  2JK3 A;  4HAM A;  1Y0N A;  2IA2 A;  3OYI A;  1JKQ C;  2VC0 A;  4YIR X;  1LE8 A;  2FSW A;  4F52 A;  2XSJ C;  3R0J A;  4EAT A;  3CMY A;  2W85 A;  1X1A A;  3FKI J;  1R36 A;  4LIU A;  2GXA A;  3EET A;  1XDS A;  3KLO A;  1VQ8 I;  1KON A;  1UMQ A;  4MTE A;  3QYE A;  4NB5 A;  4NNJ A;  1LFP A;  2FMY A;  2GZW A;  2P6T A;  3HBL A;  3PSI A;  3UNG C;  1B1B A;  1Z1D A;  3SHF A;  1FMV A;  1QHG A;  3ZXS A;  2IAI A;  3LA3 A;  4TV7 A;  4YRV A;  5J47 A;  2E19 A;  5IYC J;  3UKG A;  3PO3 J;  1FLI A;  4ZH4 F;  3ZQG A;  5D5X B;  3FM3 A;  3B6A A;  1JHH A;  1FOX A;  3QPT A;  5DCF A;  2HQ5 A;  1VQN I;  2CFO A;  1YJW I;  4OAZ A;  4I98 B;  2X1D A;  2PJR B;  4NHJ A;  1RET A;  3LA2 A;  1RR8 C;  3GTP J;  3K4N A;  4X0G A;  2D1V A;  2JA7 J;  4AU7 A;  3HG9 A;  3IP4 B;  1TW3 A;  2P0W A;  5F6F A;  2F5E A;  3GTG J;  1ZAO A;  2ICW G;  1X1C A;  3ZQI A;  1U5T A;  1UHM A;  1MMD A;  3KZI C;  2JA2 A;  2NS8 A;  2DDA A;  3MKL A;  4CCO A;  2NOG A;  3BG7 A;  2KL4 A;  1I39 A;  5H20 A;  4KT5 C;  2E71 A;  1ZG5 A;  3SJM A;  3ZN0 A;  2YX7 A;  2COM A;  1NHA A;  2Y48 A;  2P4W A;  5KVR A;  5F27 A;  4A0X A;  3SZT A;  1VTN C;  1HLV A;  4KN4 X;  2VBZ A;  2VJ4 A;  3I56 I;  2AO9 A;  3H0D A;  3IAM 2;  3FXK A;  4YFX F;  2V26 A;  3QU6 A;  3KYL A;  1X1D A;  1SAU A;  3GYH X;  2R7W A;  2DK8 A;  3L2V A;  1FJL A;  4OWR B;  4CZZ A;  1OR7 C;  1X4O A;  1F43 A;  2KHM A;  1UST A;  2VIX A;  1EH6 A;  3IUO A;  1S7A A;  1AA7 A;  1U2W A;  2EFP A;  1Y0U A;  2UXN A;  2R7F A;  3V8L A;  4V2G A;  3N05 A;  2DLL A;  3KX2 A;  4OAY A;  1IN5 A;  4XNF A;  3BTI A;  1U0J A;  2LYC A;  1LB2 A;  1G3Y A;  1QVU A;  1SFX A;  2XVC A;  3KP6 A;  2GXG A;  3Q9S A;  1UHS A;  2DYR H;  3G73 A;  1SVL A;  1WFX A;  3PUF A;  1EH8 A;  4KIC A;  2A6E F;  3HOT A;  2BV6 A;  4UUV A;  2HVS A;  4HQE A;  2IS2 A;  3WTV C;  3WU0 A;  2LY9 A;  3EQL F;  3H92 A;  2O7O A;  4A3M J;  3BJA A;  1ZLK A;  2V1N A;  2EFN A;  4CCK A;  3D5S C;  2KT0 A;  1LNW A;  5BMZ A;  4L5J A;  3M3Y J;  2HVQ A;  1JHF A;  1F1Z A;  3ABK H;  4XLP F;  3BOQ A;  4XLC A;  1FTT A;  2NYX A;  3LWF A;  3WG9 A;  2DT7 B;  3WOD F;  5LHI A;  1RES A;  4PDK A;  2H6C A;  4A3J J;  3F0C A;  2WY7 Q;  1AKH B;  4IHT A;  4RM3 A;  3JTH A;  2NVT J;  1XGM A;  2ZXH A;  3K1P A;  4LG3 A;  3BQY A;  5KNL A;  3T8T A;  4FET A;  2L02 A;  3F8C A;  1A36 A;  3S14 J;  2M7A A;  3QQA A;  1IUF A;  2DT5 A;  3K70 D;  3J7A O;  3BTC A;  5CYV A;  4B09 A;  4C3I J;  1V5F A;  5A2Q K;  2R5Z A;  2D45 A;  1GV2 A;  2P5L C;  1DU6 A;  5ILV A;  1BR2 A;  2CU7 A;  1J2X A;  5GP9 A;  2L9S A;  1IDY A;  2ZKZ A;  2X6O A;  4E7H A;  4ENK A;  2HS5 A;  3D0S A;  1YW9 A;  2OZ6 A;  3PUB A;  1ZRC A;  4XLA A;  3IH4 A;  1V3F A;  5M5W J;  1B9N A;  2KJC A;  1VFC A;  1SMY F;  3GFM A;  2VXD A;  2RKH A;  1R5I D;  2R5Y B;  1S9H A;  3F8F A;  3H9G A;  3CES A;  4IKF A;  1UEL B;  4HNT A;  3CCE I;  2HQA A;  4Z2Y A;  1SEU A;  3I0T A;  2W00 A;  4XMY A;  2ZJR F;  3ZQ7 A;  1QZZ A;  1BI0 A;  2FE3 A;  3FHZ A;  1GT0 C;  4S04 A;  4HZF A;  3ZGK A;  3L00 A;  3I4M J;  3ZMS A;  4XN0 A;  2YU3 A;  1PUF A;  3Q5F A;  1Y1W J;  1MDM A;  1W36 D;  1R5H A;  1IN7 A;  2ZXJ A;  1XB4 A;  4B3X A;  2CV0 A;  5E18 F;  2IPQ X;  1F4K A;  2WBM A;  2L9R A;  3P7N A;  3HHG A;  2KPM A;  4B43 A;  2DMP A;  2L7Z A;  3E3V A;  5M5X J;  4HF2 A;  1XSD A;  2A5W A;  2E1M C;  4HSR A;  3BY6 A;  4W97 A;  5ICE A;  1IF1 A;  1UHW A;  3VB2 A;  2M34 A;  3ZN1 A;  1SMT A;  5DS9 A;  1CQT A;  2EZL A;  1HA8 A;  5AON A;  5JHU A;  3K4K A;  5L3G A;  2EZI A;  5HVQ C;  5JHF A;  2E2H J;  3U21 A;  2JQ7 A;  1WI3 A;  2KMU A;  4RLF A;  2LR8 A;  1NK2 P;  1WQ2 A;  4HBL A;  4P1W A;  1BR1 A;  1MMG A;  4O3M A;  2PFB A;  3LQQ A;  3M8E A;  3KZZ A;  3QOE A;  5EGO B;  2VJI A;  4LOC A;  3IL2 A;  3ZP5 A;  3I54 A;  2LF8 A;  5J6X A;  5FO5 A;  4LFU A;  1Y39 A;  5E20 A;  1U78 A;  1HW5 A;  2EFO A;  3BG6 A;  3JAM Z;  3K9T A;  3L2W A;  2QSG X;  3OR1 C;  4KUM A;  5LEK A;  2Y9Z A;  1J75 A;  3QYB A;  1BI2 A;  2XHK A;  1ZKG A;  4EGY A;  3H36 A;  4II3 A;  4CCM A;  1S8N A;  2ELH A;  3BG5 A;  1HW1 A;  1WZ2 A;  5E1W A;  2ZFU A;  2A3S A;  2JVH A;  1R4M B;  4FQG A;  4UUT A;  4AID A;  1D0Y A;  2VI6 A;  4U7D A;  1P6R A;  2AHQ A;  1LDJ A;  3D1N I;  4UVA A;  3Q0W A;  3JRI A;  2VJJ A;  2ZNZ A;  4N4N B;  1ENH A;  1U8B A;  2QM3 A;  4KFC A;  3A4C A;  1L3L A;  3EUA A;  1PVE A;  2AQF A;  2FBH A;  2VKH A;  5CVI A;  3EYY A;  3FKJ A;  4RB1 A;  2CQQ A;  4FE4 A;  4EEF G;  2COB A;  3IKV A;  3MZ8 A;  1FNN A;  2HQN A;  2P8T A;  3ZCO A;  3U9G A;  3MZH A;  1H9G A;  1Z3X A;  4BGD A;  2NNY A;  5IP7 J;  1IXR C;  1WCM J;  3RKY A;  2WV0 A;  2V6C A;  4M3B A;  4Y52 J;  2QBY B;  1KU9 A;  4BL0 B;  3LSR A;  2E60 A;  2DBB A;  1H8A C;  3CC7 I;  4NUB A;  3FK6 A;  1D3Y A;  2EV6 A;  4LLG F;  4HX4 A;  4DNC A;  4IRI A;  2G9W A;  2GQQ A;  1YIT I;  5FLV A;  2VB6 A;  3C1D A;  4CZC A;  4BBR J;  1G2H A;  4RGR A;  3I53 A;  4BQQ A;  1WJF A;  3KE2 A;  3F6O A;  4S05 A;  3TW6 A;  2M8G X;  1IRX A;  1J7K A;  1RI7 A;  3KP3 A;  1I5Z A;  3K1M A;  4QIW N;  1IXS B;  4IEJ A;  5K7F A;  4DYQ A;  2KFD A;  3SDB A;  1HKT A;  1VQ5 I;  3ECH A;  2ADU A;  5M3F J;  4M3G A;  5F1R A;  4MNU A;  2DMN A;  3F3X A;  4P55 A;  3WTS C;  1AU7 A;  2GA2 A;  4LD5 A;  4PCQ A;  3S1M J;  3SZG A;  4RGU A;  1G3S A;  2GIV A;  2CMP A;  1B72 A;  4XKB A;  3S3O A;  1ZH5 A;  4V19 K;  2HDW A;  5AIP A;  5D8L B;  4I99 C;  1XMK A;  4ZYG A;  5H6Q A;  1I3Q J;  3D5R C;  3ML6 A;  4ESF A;  1I50 J;  3R60 A;  3C2B A;  3LA7 A;  5LEJ A;  3DLL F;  1VQM I;  2OC6 A;  5IOZ A;  3HKZ A;  3NWS A;  4G8X A;  3OS0 A;  2DFE A;  3B6C A;  2PJR A;  4XLE A;  1WJD A;  5ILS A;  4EM0 B;  3PSF A;  3N4M A;  4DZJ A;  2P6S A;  5FKK A;  1D5Y A;  1WSU A;  1OMI A;  1Z91 A;  4GYI A;  2ZO4 A;  2XPV A;  5ERI A;  4BQN A;  2OZU A;  4QPQ A;  1A35 A;  2KRF A;  2JRM A;  1TNS A;  2CUE A;  1TL8 A;  1TZL A;  4I7H A;  1G3T A;  3WTY C;  2V79 A;  5JFR A;  4H0E A;  1KQ9 A;  1XC5 A;  4BJT A;  1WH7 A;  2IGO A;  4XLH A;  3CJN A;  4BQO A;  5FGM A;  3A2K A;  2EA4 A;  3I5U A;  2LMD A;  2LC2 A;  3HZJ A;  1HDP A;  3PFI A;  5KCM A;  1M1E B;  4A3B J;  5D6F A;  1S7O A;  3FK7 A;  3IHU A;  4EM1 A;  3HC7 A;  3OSG A;  4A3D J;  4AIJ A;  1OCT C;  1DGR M;  3IC7 A;  1XGS A;  3F21 A;  2EIJ H;  3DTE A;  1TBX A;  2HXI A;  2D1H A;  3W2A A;  3HJE A;  4UVC A;  2ZSH B;  3MKZ A;  2BY0 A;  3HDD A;  1RUN A;  2Y0M A;  3CD6 I;  1LQ1 A;  3ZMD A;  1BR4 A;  4CA0 A;  4QLC U;  3ERM A;  2NVX J;  2Q2E B;  1FYK A;  3VYT B;  2WAF A;  2CUF A;  2ZCW A;  1D1B A;  2CGP A;  4A6D A;  2QKM B;  3AKZ A;  5CJ9 A;  1WVR A;  1ZYR F;  2ECC A;  3FMQ A;  3JW4 A;  1ZG1 A;  3OYA A;  5C4J J;  3G1M A;  1Y8Q B;  4LGW A;  4V2F A;  3RKX A;  3TO9 A;  2IW5 A;  4A12 A;  2MAB A;  2K9S A;  2Y31 A;  1VND A;  1L0O C;  2J5P A;  3P5J A;  5ICC A;  1FIP A;  3SEQ A;  5BPD A;  1ZHF A;  3FXR A;  4BDZ A;  3R6S A;  1YTY A;  1C0W A;  5HS9 A;  2TRT A;  3G4S I;  3CJT B;  4GO1 A;  2HPI A;  1X3U A;  1FIA A;  1JUP A;  2FF4 A;  1Z3Y A;  2UUZ A;  3U1K A;  1I1G A;  4GCV A;  3M1E A;  3I3L A;  4PJN A;  1ZRE A;  4GRI A;  5B3S H;  3CO7 C;  1ITY A;  2FOW A;  5KAF C;  2K5C A;  3T5X A;  2OQG A;  2ZME A;  2DYS H;  3EUH C;  4IJA A;  3GWZ A;  1EH7 A;  3KCC A;  4J19 A;  2EPF A;  4U88 A;  1EJ9 A;  1OCR H;  4E7L A;  1R6R A;  3K4L A;  4OIN F;  2DFH A;  3A02 A;  2R7Q A;  4UVB A;  2XGC A;  4HF1 A;  3Q0U A;  4G7H F;  3CJR B;  3O8H A;  2P81 A;  3S1Q J;  1ZGJ A;  2PI0 A;  3S17 J;  4ON0 A;  4ZYH A;  3L2U A;  2RRE A;  1VQO I;  1IV8 A;  3JAM K;  2NVU B;  4ZC3 A;  4PJ0 C;  1XSV A;  2HZT A;  3PL8 A;  4PJJ A;  5FKL A;  1TNT A;  5D5U B;  2ESH A;  4ZZL A;  3DP7 A;  2OQR A;  2R7R A;  1P4X A;  1H89 C;  2BEO A;  3RSN A;  4ZYD A;  4IL6 C;  2BZT A;  1BOB A;  2BHZ A;  2EH3 A;  2W4S A;  4N9I A;  2LKS A;  3ZQC A;  4MFE A;  4XOP A;  1IRF A;  2LLK A;  2R7D A;  4MTD A;  3MFK A;  2WB1 A;  3TQN A;  3GX4 X;  3CP8 A;  2KIU A;  4DYR A;  2OTJ I;  3GZ6 A;  3KLN A;  5H6R A;  3ZMZ A;  1VQ9 I;  1V5E A;  3WU1 B;  4MEX F;  3ZR8 X;  1RR7 A;  3HOS A;  2RQQ A;  1FC3 A;  3KYC B;  1RRJ A;  3WGG A;  3BR1 A;  3ABL H;  4BEH A;  5HS7 A;  1MSF C;  4Y7N J;  2BXZ A;  1E0E A;  1YS7 A;  4IXA A;  2V1D A;  1VQ4 I;  5HDN A;  1QPM A;  1EV7 A;  5DCM B;  4HLX A;  3K0L A;  3CTA A;  3H0G J;  4FT8 A;  4BU2 A;  2OV7 A;  2I5U A;  2HFH A;  1P7J A;  1XCB A;  2KIM A;  5GAE J;  5D5V B;  3R0A A;  3TOB A;  1T95 A;  2XGD A;  3CCR I;  3L2C A;  1ON1 A;  5IP9 J;  1FBQ A;  4Y13 A;  3S93 A;  4DQ2 A;  2O6G E;  2NS7 A;  2GLO A;  2ACJ A;  2BY1 A;  2E5Z A;  4LK1 F;  1RZ4 A;  2O8X A;  4CGZ A;  5DD8 A;  3UR3 C;  4CHU A;  3T1B A;  1B6A A;  3PJR A;  3G3Z A;  4E70 A;  2EK5 A;  3F9K A;  4FHT A;  4H4K C;  4JP0 A;  1N78 A;  5EEG A;  3LOC A;  5E79 C;  1ZK8 A;  2DA4 A;  3W2W A;  4BHC A;  1IZ1 A;  1LVA A;  1Y6I A;  4Y33 A;  5TRD A;  4HV5 A;  1OIS A;  4Q48 A;  2ESN A;  1OYW A;  2RNG A;  3VYR B;  3IAS 2;  2KLO A;  2W84 A;  3T8R A;  2DCE A;  4CO8 A;  1EF4 A;  1X1P A;  1WHU A;  2QA4 I;  4HG2 A;  2MD0 A;  4UNO A;  2XGX A;  2LVS A;  3DTK A;  4G9Y A;  2JMW A;  2GXB A;  2W24 A;  3VYS B;  4AYB A;  5E1Z B;  4AC0 A;  3MD2 A;  3CP2 A;  5TGT A;  4ZDO A;  4XLF A;  3U1D A;  2HKO A;  5IY5 H;  3CQZ J;  4AVZ A;  1UCR A;  1OJL A;  3OYH A;  2VLA A;  1YHQ I;  3S32 A;  5FFX A;  3JSO A;  2HKX A;  4HOB A;  4XKC A;  5M5Y J;  5FKN A;  1PYV A;  3GTL J;  4PFP A;  1FYM A;  1QQI A;  2M7B A;  5GAH J;  2EFW A;  4U7B A;  5BNG A;  2VPL A;  3AG2 H;  2VE9 A;  1K79 A;  3ESW B;  3OL4 A;  5LGU A;  2L3D A;  2V9P A;  1J9I A;  1RPW A;  4ASN A;  4BY7 J;  5IPA A;  1IV6 A;  2VKD A;  1IJW C;  3OYF A;  2HTS A;  1KYZ A;  2FA5 A;  5J8F A;  5CVV A;  1I6X A;  2LH9 A;  2FD5 A;  2OCC H;  3MAJ A;  1YS6 A;  4WXH A;  4C3H J;  3ZMT A;  3DV8 A;  1OLT A;  2RC4 A;  2ISZ A;  1MH4 A;  1PP8 F;  2Q0O A;  1WJB A;  1E17 A;  3TBI A;  4NC7 A;  5F0H A;  3F8M A;  2AXT C;  5GTI C;  2DW4 A;  3H5R A;  5KK1 A;  2MG4 A;  3E5U A;  1HST A;  2XB5 A;  2F5C A;  3REO A;  3LAJ A;  3DBL B;  3HRS A;  1B59 A;  2HYG D;  3P9I A;  5GPA A;  1YW8 A;  4XR6 A;  3FIS A;  1E3H A;  3TO6 A;  4R1H A;  2STT A;  1RKT A;  4EGZ A;  1OFC X;  1KZH A;  3JRC A;  1W0T A;  3H3U A;  3H5A A;  2M4K A;  3TL4 X;  1KU3 A;  3LSP A;  3S16 J;  1OPC A;  3HIF A;  4A3E J;  4A3C J;  2VON A;  3SEZ A;  1J0R A;  2R7X A;  3W3C A;  2E1M B;  3DPL C;  2B7E A;  5FLX Z;  3WG7 H;  1TQP A;  2M2E A;  1VQ6 I;  1DQU A;  3HB9 A;  1FZP B;  1G4D A;  4L5I A;  2Y2Z A;  5EG0 B;  3CCS I;  4S0H B;  3FXL A;  4KT6 A;  1TTY A;  2PX9 A;  1A6Q A;  3ISP A;  5J1Y A;  2H09 A;  3AG3 H;  4PSW A;  4RAZ A;  2H1K A;  2W48 A;  3H35 A;  2KDZ A;  3V7S A;  1FBU A;  3SQN A;  1V4R A;  5IT3 A;  3HTU A;  4F7Z A;  2MD5 A;  4JYK A;  2EZK A;  3JRF A;  2F5F A;  2MLK A;  3CJQ B;  5E3N A;  1F5T A;  2F5V A;  2E34 A;  3GO5 A;  4WXC A;  1BW5 A;  3OIQ A;  4EJO A;  3DBR B;  1OQY A;  2BVL A;  1FSE A;  1BIB A;  3MQ0 A;  5EJC A;  1JXS A;  3ZRG A;  4N0B A;  3WU2 C;  4KMF A;  3DFG A;  5DD4 A;  2PMZ A;  5GAG J;  1P4W A;  3DQV C;  3GFL A;  1W1W E;  2MA3 A;  4U0W A;  3S2D J;  1DP3 A;  3QP5 A;  3W6V A;  3RJP A;  1E3O C;  2TCT A;  1JTX A;  3JRE A;  4KYW A;  2M8E A;  2R7S A;  1QHH D;  3I55 I;  2O5R A;  4XL9 A;  2ELJ A;  9ANT A;  3E6B A;  2M9H A;  1ZGW A;  3LSJ A;  2LDU A;  3HOW J;  2O61 A;  4I01 A;  2MW8 A;  3VEP A;  3IKT A;  2CJJ A;  3KP2 A;  1YW7 A;  1ZTR A;  4I02 A;  3WHB A;  3BR2 A;  3ZQQ A;  2JA8 J;  3H1C A;  4E7I A;  2R7Z J;  5HOD A;  1W5S A;  1N77 A;  4CXF A;  3CLQ A;  3CCU I;  4BAC A;  2XAS A;  2R3S A;  1ZGA A;  5J8C A;  2ME0 A;  3RDI A;  4JQF A;  2HTJ A;  4I76 A;  4QPO A;  4IOC F;  1RKW A;  2DA7 A;  2H8R A;  3SFI A;  3EUK L;  2DT6 A;  4HEA 2;  2DAO A;  3VPR A;  3DEW A;  4ZYE A;  1K83 J;  2ID6 A;  1PJR A;  3HSF A;  3M07 A;  3K69 A;  1P9Q C;  3CCY A;  1BC8 C;  2K9L A;  1Z67 A;  4CYC B;  2DA6 A;  4LG0 B;  4C2T A;  3GTQ J;  4BY1 J;  1ZAR A;  2UXX A;  2IGK A;  2LKP A;  4DJA A;  2F4M B;  4AM3 A;  2OTL I;  1G6N A;  3PQJ A;  1MMA A;  4U87 A;  2MBF A;  4JK1 X;  4HA8 A;  4OMZ A;  5HNF A;  3OYE A;  2E1O A;  3JRA A;  3LL7 A;  1REP C;  3I4P A;  1SFU A;  3CZ6 A;  2BW3 A;  2CH0 A;  1DU0 A;  4HRI A;  2JA6 J;  3GTK J;  2XAJ A;  2BGC A;  3WGI A;  3J81 Z;  1YIJ I;  3DF8 A;  1OCP A;  3WGH A;  3CCM I;  4E7J A;  4ESJ A;  1K78 B;  5BOX A;  1MBK A;  2K3P A;  1YG2 A;  4M71 A;  4AWX B;  2KIS A;  4A3K J;  1XX5 A;  2E35 A;  3WTW C;  1BL0 A;  3HXL A;  4YFK F;  3KYD B;  4LK0 F;  3GUD A;  1U8R A;  3VSL A;  5L3B A;  3OY9 A;  2VT2 A;  3QYF A;  1KA8 A;  3JRD A;  1NK3 P;  4IO9 F;  4BJ5 C;  2L2O A;  2BE5 F;  1FWZ A;  2V9K A;  1DPR A;  1Z21 A;  1BBY A;  2H6B A;  3OSF A;  3OYM A;  1YYV A;  2HU9 A;  3E97 A;  3LSI A;  1RUO A;  1W7P A;  4BDY A;  3LSK A;  1QZY A;  1PP7 U;  2M45 A;  3CMM A;  4P96 A;  1UZC A;  4B4C A;  2L7M P;  4F91 B;  1ON2 A;  2K9N A;  1JKR C;  4L0Y B;  3LFK A;  1I3A A;  2ZXW H;  4F93 B;  5HOO A;  4HYE A;  4J01 A;  4IX7 A;  2B0L A;  1JUM A;  3E6D A;  4I0A A;  2XPU A;  3PNV A;  4NQW A;  2LD5 A;  1FOK A;  5HDG A;  5LGT A;  5D5W B;  2PJP A;  3CUQ B;  3MN2 A;  4MHG A;  3LFU A;  1ZQ3 P;  4IHY A;  1QVT A;  3I59 B;  2NOJ B;  3R4K A;  3OYK A;  1STZ A;  1WJC A;  2OCE A;  3GBG A;  1F9N A;  4CSW A;  4D7M A;  5LGN A;  5E8G A;  1IRZ A;  2OD5 A;  5DCM A;  4I2O A;  3C18 A;  2L7F P;  4PGH A;  5ICF A;  3RQ4 A;  4ENJ A;  1MBJ A;  2H8W A;  4YII A;  5HLT A;  1P2F A;  2VOP A;  2Y75 A;  3OYJ A;  4XK4 A;  2QSF X;  3GTJ J;  1VQ7 I;  1QPI A;  2LSO A;  1S72 I;  4LB6 B;  4IRG A;  3B73 A;  1USS A;  3GLX A;  4MFD A;  4II2 A;  2HXO A;  2X51 A;  3BTJ A;  2GWR A;  2OA4 A;  3FBN B;  1SFK A;  5FJ8 J;  1R00 A;  2EJR A;  1CF7 A;  1UB9 A;  3FZV A;  1HC8 A;  2FBI A;  1YRN B;  1FOW A;  4I0B A;  2P5K A;  3DCF A;  5F08 A;  4RMN A;  2VBY A;  3S8P A;  2HVR A;  3OMY A;  2ELK A;  3KEQ A;  5LRR A;  2BHY A;  1FPQ A;  1IN8 A;  2QVO A;  4ZTF A;  2MGQ A;  4UUS A;  3KP4 A;  1DUX C;  1ERD A;  4RBO A;  2JA5 J;  3E7L A;  3FXO A;  2DFI A;  3A03 A;  5DDG A;  3DTI A;  2M0C A;  1LE8 B;  4HW0 A;  1W7P D;  2X4H A;  3VSK A;  1I6H J;  2ZC2 A;  3PO2 J;  1MMS A;  2QUF A;  1PUE E;  1Q1H A;  1TWA J;  3L1P A;  3HL2 A;  4U0Y A;  3WTU C;  1ZR4 A;  2O9L A;  3S15 J;  3BG9 A;  4D0P A;  1R49 A;  1E2X A;  1KGS A;  3OYL A;  2GM4 A;  1LKX A;  1JJ6 C;  4AIH A;  2KZG A;  2JWT A;  2IT0 A;  1VQK I;  3CLO A;  2Z2S B;  4RLQ A;  1FMW A;  2UV1 A;  4HF0 A;  2BYV E;  4KIS A;  3G1L A;  5K5O A;  4ITV A;  3C2G A;  3OYB A;  3L9F A;  5IT9 Z;  3ZMU A;  2OF7 A;  1GUU A;  2RGV A;  2MH2 A;  5ICG A;  4HST A;  2F5D A;  1A04 A;  1Z05 A;  2KIQ A;  1K6O A;  2JRT A;  2CUZ A;  3WTZ A;  2Z1D A;  1A31 A;  4AUX A;  4DYC A;  2G0E A;  1MJA A;  2FUG 2;  4E6K G;  1SVM A;  1U5T B;  3LMM A;  1ZRF A;  1OCO H;  2MH9 A;  2FXA A;  3NRV A;  2H94 A;  2JN6 A;  3I64 A;  4G6D A;  4L9N A;  2R0Q C;  2EFQ A;  3QOP A;  2R93 J;  2N8G A;  2L7K A;  4LLL A;  1BIA A;  2CFX A;  1YI2 I;  3JRG A;  1LDK B;  2HYF A;  4E7Z A;  2CW7 A;  5C4X J;  1TP4 A;  4C2U A;  2VPR A;  2CQK A;  2VQC A;  3K4M A;  3QPL A;  3FXJ A;  5BPI A;  2E36 A;  5J1R A;  2WTE A;  3DEE A;  3OWT A;  4DBR A;  3ABU A;  5KAI C;  3M9A A;  4HDV A;  4L5E A;  5FFZ A;  3CUQ C;  2WAQ A;  3NEU A;  5DUK A;  4XOR A;  1T98 A;  1YIO A;  2DOA A;  3HRM A;  2NVQ J;  2E5N A;  3HOZ J;  4YIF A;  4JX6 A;  3NAU A;  2OBP A;  3O2P E;  3RCO A;  3CF2 A;  2NXN B;  2B9S A;  1BOA A;  3FMR A;  3MZY A;  4NDL A;  3P9C A;  2PN6 A;  5FLM J;  2NS0 A;  2ZXI A;  3H3Z A;  4UV8 A;  1HBX G;  1VF9 A;  1ZEL A;  4FAS D;  2L54 A;  5J3L A;  4CIC A;  1TWG J;  1FYL A;  1R1T A;  2K27 A;  4GYG A;  2IXS A;  3IRR A;  3HOX J;  4A3I J;  1TC3 C;  4ZDP A;  2KZV A;  3JTG A;  2I10 A;  2HPM A;  1ORK A;  2X6W A;  2M4G A;  3ZQF A;  1T38 A;  2HWV A;  2WY8 Q;  1D0Z A;  3QWL A;  4NC6 A;  3V7C A;  1VQL I;  1MMN A;  4HX8 A;  3BCB A;  4P9F A;  2P7V B;  3MKY B;  1D0X A;  3F8B A;  3H9J A;  4M73 A;  2IS6 A;  2O8K A;  2FRH A;  2FBK A;  4JOM A;  5D4S A;  5HLG A;  3BZ6 A;  1VQP I;  4PJL A;  3JRB A;  2F2E A;  3LSM A;  5IP6 A;  2D5V A;  1FY7 A;  2V1X A;  1FTZ A;  2QYO A;  2ZNY A;  3RQI A;  3CCJ I;  1HOM A;  3TGN A;  3P9K A;  3PIO F;  1JT0 A;  2R7O A;  2ID3 A;  5GAD J;  5J1U A;  1JJ8 C;  4DOZ A;  1POG A;  1JKP C;  2CO5 A;  2R7T A;  2WAE A;  5JLX A;  2L01 A;  4MGR A;  3S1R J;  1WJE A;  2JSC A;  1Z9C A;  4B1R A;  4A6E A;  4XRM A;  1W5C C;  3ROU A;  4R79 A;  1SD4 A;  2QCO A;  2FX0 A;  3OOP A;  2R5Z B;  4R8H A;  5BQT A;  2CSO A;  4BKX A;  2MYS A;  2NNN A;  2BY2 A;  5HDK A;  4RA2 A;  2ECB A;  1ETQ A;  1R1U A;  3ABT A;  1LVK A;  3QU3 A;  4FIS A;  1O3R A;  1AKH A;  4C3J J;  3MMY B;  2HDC A;  1QO0 D;  2K40 A;  1Z6T A;  2KRC A;  3O3K A;  1MH3 A;  3DBH B;  2R92 J;  1BJZ A;  3E5X A;  4EV0 A;  3K4C A;  4L0Z B;  2LTP A;  4IF4 A;  4WK8 F;  3GTO J;  4RGS A;  4D7N A;  3RKQ A;  3J80 Z;  3CUO A;  3GFJ A;  1HKS A;  1UJ8 A;  3CO6 C;  1LFU P;  1PUF B;  1K4T A;  5EEH A;  2WAD A;  2EIL H;  1SAN A;  1J5Y A;  3FF5 A;  1MDM B;  4LIV A;  3DPU A;  3EDP A;  1U5T C;  4CYC A;  3IH3 A;  4LJZ F;  2L9V A;  2UZK A;  5LD2 C;  1HSJ A;  2A6T A;  2R5Y A;  3VOE A; 
#chains in the Genus database with same CATH homology
 3E6M A;  2XIG A;  3FX3 A;  3TDU C;  1LEA A;  4Q5S F;  2K86 A;  1IN4 A;  2E1N A;  3D5L A;  2XAH A;  4XLN F;  4HV6 A;  1FBS A;  1Z6R A;  1HQC A;  2HEO A;  1QBJ A;  1I1S A;  4BAY A;  2YSR A;  4G6Q A;  2Z99 A;  3ERE D;  3BJO A;  5ED4 A;  3QP6 A;  1AOY A;  4M9X A;  1XGO A;  5K1Y A;  2PBI A;  3MEX A;  2PMU A;  1AWC A;  1KU2 A;  4P9U A;  1GVJ A;  5A2Q Z;  1XDU A;  3WTT C;  1K7A A;  2IA1 A;  4WXD A;  4KIB A;  1O7L A;  4IVN A;  3DEU A;  1RIO H;  4G7Z F;  3NQO A;  2YX4 A;  2ZBK A;  1O3T A;  2O0Y A;  1T0F A;  1T39 A;  2EA2 A;  2MLG A;  2P5V A;  4XBF A;  3L7W A;  3C7J A;  1FSH A;  1KQ8 A;  2A5Y B;  3GZ5 A;  3I58 A;  1CGP A;  3ULQ B;  4L9T A;  4RB0 A;  4OIR F;  5IT9 K;  3K2Z A;  3QAH A;  1FP2 A;  3V8J A;  3V4G A;  1XN7 A;  5E8I A;  4JBA A;  2NAZ A;  4GXO A;  4A2U A;  4Y17 A;  1XGN A;  3RPU A;  4BHB A;  5D6E A;  1LDD A;  4EJW A;  4A0Y A;  4FX4 A;  2FML A;  2DTR A;  3MCZ A;  2DQR A;  1JE8 A;  2DPU A;  3C3W A;  5JR3 A;  1TQM A;  2H27 A;  4L9J A;  3KFW X;  5CVU A;  2XAF A;  1T6S A;  1R7J A;  2QBY A;  1JGS A;  5L3D A;  2HGC A;  1D8J A;  1ZRD A;  5FB2 A;  3BRO A;  1T2K A;  1LJ9 A;  2FNA A;  2RVC A;  4EM2 A;  1DP7 P;  1R23 A;  3FMS A;  3HSE A;  3M7G A;  4HQM A;  5L3F A;  3EUH A;  3S2W A;  4LLN A;  3TKY A;  1KYW A;  4M74 A;  4ESB A;  1MZB A;  2TDX A;  4EQQ A;  3T0Y A;  4Y15 A;  2M30 A;  2L4A A;  1ODD A;  4EJV A;  2A61 A;  2WC2 A;  5L3E A;  2STW A;  1W4M A;  4CYD A;  2E1C A;  1W5T A;  5HS8 A;  4LMY A;  4WX9 A;  2FU4 A;  2JPB A;  3HTS B;  1IXC A;  3GF2 A;  3LAP A;  2O03 A;  1R22 A;  3N97 A;  3U2R A;  1BN5 A;  3VFZ A;  1O57 A;  1SD6 A;  3TDZ C;  2A69 F;  5HLH A;  4BYY A;  3J80 K;  3DPT A;  1IAW A;  3HRT A;  2Z33 A;  1MKM A;  4KA4 A;  4KIF A;  3QPH A;  3LST A;  4ETS A;  2A07 F;  5E17 F;  4O5V A;  3RPQ A;  3KET A;  5ILU A;  2GAU A;  2Z5U A;  2QQ9 A;  1PDN C;  2Q2E A;  4G7O F;  2IJL A;  4BQA A;  3I71 A;  4RS8 A;  1DPU A;  2YPR A;  3F6V A;  3WE2 A;  2XV4 S;  1IUY A;  4Q47 A;  2ZME B;  2M87 A;  4ZZD A;  4RB3 C;  4RAY A;  3BWG A;  1LEB A;  1SFE A;  2CG4 A;  4HLY A;  1TLH B;  3O6B B;  3HHH A;  4LB5 A;  4A0Z A;  4QWQ A;  3ZMV A;  4RGX A;  2PLY A;  3GW2 A;  4AD9 A;  3Q9V A;  2K4B A;  2PG4 A;  3V8K A;  3KP5 A;  5BS6 A;  3EYI A;  5L3C A;  1Z7U A;  3QRF F;  1ULY A;  4PGG A;  4IHS A;  3W6K B;  1R5G A;  4OIO F;  2VBW A;  4KDP A;  2PQ8 A;  2VOO A;  2E7X A;  2P7C B;  1FX7 A;  4O6J A;  1D5V A;  2RV8 A;  2E7W A;  1TQI A;  4EJT A;  4YFN F;  1YO5 C;  1ZLJ A;  2FEZ A;  2ZJ2 A;  1KQ0 A;  2CW0 F;  1XSX A;  2FQ3 A;  5LBQ A;  5LHG A;  2QWW A;  5F64 A;  3SZP A;  5DUI A;  3RYR A;  2BBY A;  1UFM A;  4FX0 A;  3BPX A;  2XUB A;  3W6J B;  4M6Y A;  2AS5 F;  4M9Z A;  1XD7 A;  1BC7 C;  4KNY A;  3F8N A;  3M8F A;  1HXD A;  1OR7 A;  2QQB A;  2FNP A;  3F72 A;  1QGP A;  5LLQ A;  4BNC A;  2CWE A;  1BM9 A;  2QZ8 A;  3TOA A;  1GHC A;  2XAG A;  1SD7 A;  3TO7 A;  1R1V A;  2YR2 A;  2QEN A;  3F23 A;  5JI6 A;  5LHH A;  2C6Y A;  1OYI A;  1MGT A;  3BJ6 A;  2QLZ A;  5FLX K;  3BDD A;  2KIF A;  2XKO A;  3BPV A;  2M5W A;  4OMY A;  1R58 A;  3V7R A;  2JT1 A;  2DI3 A;  1DDN A;  3FWE A;  2K4J A;  5E1X A;  2DK5 A;  4MQ9 F;  3ECO A;  3CDH A;  1WWX A;  2XRN A;  4EJU A;  5DYM A;  4BHP A;  3FXU A;  2G7U A;  1SAX A;  1IRG A;  1GXP A;  1MJ9 A;  4Q4Z F;  3KP7 A;  5TJJ A;  4XSX F;  3RKW A;  5FD6 A;  4L18 B;  2IA0 A;  3IWF A;  3ELK A;  2GA1 A;  1BJA A;  2JTV A;  1YLF A;  1IN6 A;  2IVM A;  3DKW A;  5AIQ A;  5D4R A;  4EMS A;  2JZY A;  2RNJ A;  4IRH A;  4KN7 X;  3ZPL A;  1O3Q A;  4XRF A;  2XRO A;  4OU0 A;  2RDP A;  1O7F A;  2K02 A;  1S6L A;  5DV5 A;  2G7H A;  3FXQ A;  2LNB A;  3RI4 A;  1YQA A;  5JVT A;  3PQK A;  4WWC A;  3R61 A;  2ISY A;  1S3J A;  4A5M A;  4BXU A;  2ZFW A;  4OOI A;  5D8K B;  4UXN A;  2OU2 A;  3J81 K;  4L9V A;  1H0M A;  2K7L A;  2KJB A;  4XSZ F;  1P4A A;  1QNT A;  3E6C C;  4UV9 A;  1ZN2 A;  2PMH A;  2V9V A;  4EVI A;  2ETH A;  2IP2 A;  2XKP A;  2UWM A;  2PEX A;  2W57 A;  2VBX A;  1ZG3 A;  1OYY A;  1B9M A;  3E5Q A;  1TW2 A;  3IRQ A;  2DQL A;  1SD5 A;  2D2W A;  4PZJ A;  4KIG A;  4GGG A;  5FD5 A;  3MWM A;  3AAF A;  3JSP A;  5K5Q A;  2VOD A;  2Q8K A;  2A68 F;  2CYY A;  4BH9 A;  1KU7 A;  2VXZ A;  4WCG A;  4MEY F;  3IWZ A;  4AIK A;  3BP8 A;  1XCV A;  1FP1 D;  4HX7 A;  4YG2 F;  1WI9 A;  4U0V A;  4OIP F;  1MJB A;  6PAX A;  4LG0 A;  2VT3 A;  2XAQ A;  2M1B A;  1B4A A;  1BI3 A;  4B8X A;  4OIQ F;  3LQR A;  4AVP A;  1WKM A;  3RIR A;  2JPC A;  3F22 A;  5K5R A;  1RNL A;  3KZY A;  2DPD A;  3GEZ A;  2FOK A;  3B02 A;  1U3E M;  1I27 A;  1K78 A;  4ENN A;  1HKQ A;  1U6G A;  4RB2 C;  1IW7 F;  2VE8 A;  1J59 A;  1W7P B;  4HDU A;  4CDG A;  3WTX C;  2DO7 A;  2OAZ A;  5CVJ A;  2O3F A;  2A6H F;  3DXJ F;  2L4M A;  2X0L A;  3HUG A;  3OV8 A;  2QQA A;  1ONV A;  4K2E A;  2DU9 A;  1OKR A;  1WRJ A;  4M6X A;  4KMU X;  1YFH A;  2IRF G;  3HSR A;  2EV0 A;  4IPA A;  2V1U A;  1G3W A;  5CLS A;  3VOD A;  1S29 A;  2HOE A;  3CUQ A;  4G94 A;  3KEO A;  3COA C;  3I59 A;  3RYP A;  3SXY A;  3K1N A;  3GVA A;  3HYI A;  4P5O A;  1D8K A;  5CVR A;  1CF7 B;  2J5O A;  1GXQ A;  1P92 A;  2RQP A;  2Z9O A;  1H9T A;  3L09 A;  4N9H A;  2W25 A;  2WWY A;  3HRU A;  2EWN A;  3RTR A;  2AXL A;  5HLI A;  3GXO A;  4M72 A;  4UHT A;  3GFI A;  2MC3 A;  1XMA A;  2LF7 A;  2NRA C;  1MD0 A;  1BI1 A;  4WF2 A;  2HQR A;  1O3S A;  2EB7 A;  4I09 A;  3WE3 A;  2HR3 A;  2VC1 A;  2RN7 A;  2KKO A;  5DEQ A;  4M9S A;  1FT9 A;  3FM5 A;  4ENM A;  2Z3Y A;  2EV5 A;  2VN2 A;  3SFZ A;  5LRS A;  4A5N A;  4MQV A;  4HAM A;  2IA2 A;  2VC0 A;  2FSW A;  3R0J A;  2W85 A;  1R36 A;  3EET A;  1XDS A;  3KLO A;  4MTE A;  4NB5 A;  2FMY A;  2GZW A;  2P6T A;  1B1B A;  1Z1D A;  3SHF A;  3LA3 A;  4TV7 A;  1FLI A;  4ZH4 F;  5D5X B;  3FM3 A;  1JHH A;  3QPT A;  5DCF A;  4I98 B;  4NHJ A;  3LA2 A;  2D1V A;  1TW3 A;  5F6F A;  2F5E A;  1ZAO A;  1U5T A;  1UHM A;  5H20 A;  4KT5 C;  1ZG5 A;  3ZN0 A;  2YX7 A;  2COM A;  1NHA A;  2Y48 A;  2P4W A;  5KVR A;  4A0X A;  3SZT A;  1VTN C;  4KN4 X;  2VBZ A;  4YFX F;  3QU6 A;  3GYH X;  2DK8 A;  4CZZ A;  1UST A;  1EH6 A;  1S7A A;  2EFP A;  1U2W A;  2UXN A;  1Y0U A;  2R7F A;  3V8L A;  2DLL A;  1IN5 A;  1LB2 A;  1G3Y A;  1SFX A;  2XVC A;  3KP6 A;  3Q9S A;  2GXG A;  3G73 A;  1EH8 A;  4KIC A;  2A6E F;  3HOT A;  2BV6 A;  4UUV A;  4HQE A;  3WTV C;  3WU0 A;  3EQL F;  3H92 A;  3BJA A;  1ZLK A;  2EFN A;  1LNW A;  5BMZ A;  4L5J A;  1JHF A;  1F1Z A;  4XLP F;  3BOQ A;  2NYX A;  3LWF A;  3WG9 A;  3WOD F;  5LHI A;  4PDK A;  2H6C A;  4IHT A;  3JTH A;  1XGM A;  3K1P A;  3T8T A;  2L02 A;  3F8C A;  2DT5 A;  3J7A O;  5CYV A;  4B09 A;  5A2Q K;  2D45 A;  2P5L C;  5ILV A;  1J2X A;  2ZKZ A;  4ENK A;  2HS5 A;  3D0S A;  1YW9 A;  2OZ6 A;  1ZRC A;  1V3F A;  1B9N A;  2KJC A;  1SMY F;  3GFM A;  2RKH A;  3F8F A;  4Z2Y A;  3I0T A;  3ZQ7 A;  1QZZ A;  1BI0 A;  2FE3 A;  3FHZ A;  4S04 A;  4HZF A;  3L00 A;  3ZMS A;  2YU3 A;  3Q5F A;  1MDM A;  1R5H A;  1IN7 A;  2ZXJ A;  1XB4 A;  5E18 F;  2IPQ X;  1F4K A;  3P7N A;  3HHG A;  3E3V A;  4HF2 A;  1XSD A;  3BY6 A;  5ICE A;  1IF1 A;  1UHW A;  3VB2 A;  3ZN1 A;  1SMT A;  5AON A;  5JHU A;  5L3G A;  5HVQ C;  1WQ2 A;  4HBL A;  4O3M A;  2PFB A;  3LQQ A;  3M8E A;  3KZZ A;  3IL2 A;  3ZP5 A;  3I54 A;  2LF8 A;  5J6X A;  5FO5 A;  4LFU A;  5E20 A;  1U78 A;  1HW5 A;  2EFO A;  3JAM Z;  3K9T A;  4KUM A;  1J75 A;  5LEK A;  1BI2 A;  2XHK A;  4EGY A;  1S8N A;  2ELH A;  1HW1 A;  5E1W A;  2A3S A;  4U7D A;  1P6R A;  1LDJ A;  4UVA A;  2ZNZ A;  2QM3 A;  4KFC A;  1L3L A;  2FBH A;  5CVI A;  3EYY A;  4RB1 A;  3IKV A;  1FNN A;  2HQN A;  2P8T A;  3U9G A;  3MZH A;  1H9G A;  2NNY A;  1IXR C;  3RKY A;  2WV0 A;  2V6C A;  2QBY B;  1KU9 A;  2DBB A;  1D3Y A;  2EV6 A;  4LLG F;  4HX4 A;  4DNC A;  4IRI A;  2G9W A;  2GQQ A;  3C1D A;  4RGR A;  3I53 A;  3KE2 A;  3F6O A;  4S05 A;  1J7K A;  1RI7 A;  3KP3 A;  1I5Z A;  3K1M A;  1IXS B;  1HKT A;  3ECH A;  2ADU A;  5F1R A;  4MNU A;  3F3X A;  4P55 A;  3WTS C;  2GA2 A;  4LD5 A;  4PCQ A;  4RGU A;  1G3S A;  2GIV A;  1ZH5 A;  5D8L B;  5AIP A;  1XMK A;  4ZYG A;  5H6Q A;  3ML6 A;  4ESF A;  3R60 A;  3LA7 A;  5LEJ A;  4G8X A;  5ILS A;  4EM0 B;  3N4M A;  2P6S A;  1WSU A;  1OMI A;  1Z91 A;  4GYI A;  2ZO4 A;  5ERI A;  2OZU A;  2KRF A;  1TNS A;  4I7H A;  1G3T A;  3WTY C;  2V79 A;  5JFR A;  4H0E A;  1KQ9 A;  3CJN A;  5FGM A;  2EA4 A;  3I5U A;  3PFI A;  5D6F A;  1S7O A;  3IHU A;  4EM1 A;  4AIJ A;  3IC7 A;  1XGS A;  3F21 A;  1TBX A;  2D1H A;  4UVC A;  1RUN A;  2Y0M A;  1LQ1 A;  3ZMD A;  4QLC U;  1FYK A;  2ZCW A;  2CGP A;  4A6D A;  5CJ9 A;  1ZYR F;  3FMQ A;  3JW4 A;  1ZG1 A;  4LGW A;  3RKX A;  3TO9 A;  2IW5 A;  4A12 A;  1L0O C;  2J5P A;  5ICC A;  5BPD A;  1ZHF A;  3FXR A;  3R6S A;  1YTY A;  1C0W A;  5HS9 A;  4GO1 A;  1X3U A;  2FF4 A;  1I1G A;  4GCV A;  3M1E A;  1ZRE A;  3CO7 C;  3T5X A;  2OQG A;  2ZME A;  4IJA A;  3GWZ A;  1EH7 A;  3KCC A;  4U88 A;  4OIN F;  4UVB A;  4HF1 A;  4G7H F;  1ZGJ A;  2PI0 A;  4ON0 A;  4ZYH A;  3JAM K;  1XSV A;  2HZT A;  1TNT A;  5D5U B;  2ESH A;  4ZZL A;  3DP7 A;  2OQR A;  1P4X A;  2BEO A;  4ZYD A;  4N9I A;  1IRF A;  2R7D A;  4MTD A;  3MFK A;  3TQN A;  3GX4 X;  2KIU A;  3GZ6 A;  3KLN A;  5H6R A;  3ZMZ A;  3WU1 B;  4MEX F;  3HOS A;  1FC3 A;  3WGG A;  5HS7 A;  1YS7 A;  4IXA A;  2V1D A;  5HDN A;  1QPM A;  1EV7 A;  5DCM B;  4HLX A;  3K0L A;  3CTA A;  4FT8 A;  2HFH A;  1XCB A;  5D5V B;  2KIM A;  3R0A A;  3TOB A;  3L2C A;  1ON1 A;  1FBQ A;  4Y13 A;  4DQ2 A;  2O6G E;  2ACJ A;  4LK1 F;  1RZ4 A;  2O8X A;  4CGZ A;  5DD8 A;  4CHU A;  3T1B A;  1B6A A;  3G3Z A;  4E70 A;  2EK5 A;  4FHT A;  5EEG A;  4BHC A;  1IZ1 A;  1LVA A;  5TRD A;  4HV5 A;  4Q48 A;  2ESN A;  1OYW A;  2W84 A;  4CO8 A;  3T8R A;  4UNO A;  2XGX A;  4G9Y A;  2GXB A;  2W24 A;  5E1Z B;  3U1D A;  2HKO A;  1UCR A;  5FFX A;  3JSO A;  2HKX A;  4HOB A;  1FYM A;  1QQI A;  2EFW A;  4U7B A;  2VE9 A;  1K79 A;  5LGU A;  2L3D A;  1J9I A;  4ASN A;  2HTS A;  1KYZ A;  5J8F A;  2FA5 A;  5CVV A;  1I6X A;  3MAJ A;  4WXH A;  1YS6 A;  3ZMT A;  3DV8 A;  2RC4 A;  2ISZ A;  1PP8 F;  2Q0O A;  1E17 A;  3F8M A;  2DW4 A;  5KK1 A;  3E5U A;  1HST A;  2F5C A;  3REO A;  3LAJ A;  3HRS A;  1B59 A;  2HYG D;  3P9I A;  1YW8 A;  3TO6 A;  4R1H A;  2STT A;  4EGZ A;  3H3U A;  1KU3 A;  1OPC A;  3HIF A;  2VON A;  1J0R A;  3DPL C;  5FLX Z;  1TQP A;  1FZP B;  1G4D A;  4L5I A;  1TTY A;  3ISP A;  2H09 A;  4RAZ A;  3V7S A;  1FBU A;  3SQN A;  1V4R A;  5IT3 A;  3HTU A;  4F7Z A;  2MD5 A;  2F5F A;  2MLK A;  1F5T A;  3GO5 A;  4WXC A;  4EJO A;  1FSE A;  1BIB A;  3MQ0 A;  1JXS A;  4N0B A;  4KMF A;  3DFG A;  5DD4 A;  1P4W A;  3DQV C;  3GFL A;  4U0W A;  2MA3 A;  3QP5 A;  3RJP A;  4KYW A;  2M8E A;  3E6B A;  2LDU A;  2O61 A;  4I01 A;  3IKT A;  3VEP A;  3KP2 A;  1YW7 A;  4I02 A;  1W5S A;  4CXF A;  2XAS A;  2R3S A;  1ZGA A;  5J8C A;  3RDI A;  4JQF A;  2HTJ A;  2DAO A;  4ZYE A;  3HSF A;  3K69 A;  1BC8 C;  4LG0 B;  1ZAR A;  2UXX A;  2LKP A;  1G6N A;  3PQJ A;  2MBF A;  4JK1 X;  4HA8 A;  4OMZ A;  1REP C;  3I4P A;  1SFU A;  2XAJ A;  2BGC A;  3WGI A;  3J81 Z;  3DF8 A;  3WGH A;  4ESJ A;  1K78 B;  5BOX A;  4M71 A;  1YG2 A;  4AWX B;  3WTW C;  4YFK F;  4LK0 F;  3GUD A;  1U8R A;  5L3B A;  2VT2 A;  1KA8 A;  2BE5 F;  1FWZ A;  1DPR A;  1BBY A;  2H6B A;  1YYV A;  3E97 A;  1RUO A;  1W7P A;  1QZY A;  1PP7 U;  2M45 A;  4P96 A;  1ON2 A;  4L0Y B;  3LFK A;  5HOO A;  4HYE A;  1HW2 A;  2B0L A;  3E6D A;  4I0A A;  4NQW A;  1FOK A;  5HDG A;  5LGT A;  5D5W B;  2PJP A;  3CUQ B;  4MHG A;  3I59 B;  3R4K A;  1STZ A;  1F9N A;  5LGN A;  5E8G A;  2OD5 A;  5DCM A;  4I2O A;  3C18 A;  4PGH A;  4ENJ A;  5ICF A;  4YII A;  1P2F A;  2VOP A;  2Y75 A;  2LSO A;  4LB6 B;  4IRG A;  3B73 A;  1USS A;  3GLX A;  2GWR A;  2OA4 A;  1R00 A;  2EJR A;  1CF7 A;  1UB9 A;  3FZV A;  2FBI A;  4I0B A;  2P5K A;  2VBY A;  3KEQ A;  5LRR A;  1FPQ A;  1IN8 A;  2QVO A;  3KP4 A;  1DUX C;  2DFI A;  5DDG A;  4HW0 A;  1W7P D;  2X4H A;  2QUF A;  1PUE E;  1Q1H A;  4U0Y A;  3WTU C;  4D0P A;  1E2X A;  1KGS A;  4AIH A;  2IT0 A;  3CLO A;  4HF0 A;  2BYV E;  5K5O A;  3L9F A;  5IT9 Z;  3ZMU A;  2RGV A;  5ICG A;  2MH2 A;  2F5D A;  1A04 A;  1Z05 A;  1K6O A;  2JRT A;  3WTZ A;  1MJA A;  1U5T B;  1ZRF A;  2MH9 A;  2FXA A;  3NRV A;  2H94 A;  3I64 A;  4L9N A;  4G6D A;  2EFQ A;  3QOP A;  4LLL A;  1BIA A;  2CFX A;  1LDK B;  2HYF A;  2CQK A;  5BPI A;  2WTE A;  3ABU A;  3M9A A;  4HDV A;  5FFZ A;  3CUQ C;  3NEU A;  5DUK A;  1T98 A;  1YIO A;  3HRM A;  4YIF A;  2OBP A;  3O2P E;  1BOA A;  3FMR A;  3MZY A;  3P9C A;  2PN6 A;  2NS0 A;  3H3Z A;  4UV8 A;  1HBX G;  2L54 A;  4CIC A;  1FYL A;  1R1T A;  2K27 A;  4GYG A;  3IRR A;  3JTG A;  1T38 A;  2HWV A;  3V7C A;  4HX8 A;  4P9F A;  2P7V B;  3F8B A;  4M73 A;  2FRH A;  2FBK A;  5D4S A;  5HLG A;  3BZ6 A;  2F2E A;  1FY7 A;  2V1X A;  2QYO A;  2ZNY A;  3TGN A;  3P9K A;  2CO5 A;  2L01 A;  4MGR A;  2JSC A;  1Z9C A;  4A6E A;  3ROU A;  4R79 A;  1SD4 A;  3OOP A;  4R8H A;  5BQT A;  2CSO A;  2NNN A;  5HDK A;  1R1U A;  3ABT A;  3QU3 A;  1O3R A;  2HDC A;  1QO0 D;  1Z6T A;  3O3K A;  3E5X A;  4EV0 A;  4L0Z B;  4IF4 A;  4WK8 F;  4RGS A;  3J80 Z;  3CUO A;  3GFJ A;  1HKS A;  3CO6 C;  5EEH A;  1J5Y A;  3FF5 A;  1MDM B;  3EDP A;  1U5T C;  4LJZ F;  2UZK A;  1HSJ A;  3VOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...