3GEZA

Crystal structure of the hypothetical egulator from sulfolobus tokodaii 7
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gezA00
1EH8A 2HKOA 5DEQA 1BBYA 1B9MA 1XMAA 3T1BA 4RGXA 2K86A 1YTYA 4I98B 4EV0A 3M7GA 4B8XA 5DDGA 3TKYA 3WU0A 2Q2EA 1IAWA 4WXCA 2O03A 5CJ9A 2CGPA 2DFIA 4O6JA 3VOEA 1HW2A 4B09A 3KLOA 3L09A 1REPC 4MNUA 4I01A 2K4BA 2XAFA 4XSZF 2EWNA 1ZN2A 3N97A 3CUQA 3J81Z 1U3EM 3PQKA 1LEBA 1JHFA 1ON2A 2VE8A 4N9HA 1FT9A 2L01A 5F6FA 3GZ5A 4A2UA 2BGCA 2VN2A 2L02A 3H3ZA 2EV5A 1SMYF 2NS0A 1OR7A 2IA2A 3RKXA 4CYDA 1UFMA 2X0LA 1Z9CA 2ACJA 1IXRC 3F8FA 1VTNC 4YFXF 4WX9A 4KMUX 2H27A 4LFUA 5DCMB 3KP5A 3K69A 2KJBA 3P7NA 3BPXA 4CXFA 1IXCA 2K7LA 3WTZA 2OD5A 2QWWA 4WXDA 2EFOA 4OMZA 4GYGA 1SFXA 3GFJA 1IN6A 4LMYA 1GVJA 3VB2A 3HTSB 2MD5A 3TDZC 2AXLA 2R7DA 2YX7A 1TBXA 1G6NA 3ABTA 1W5TA 4WK8F 4MTDA 2QQAA 3LQQA 4UXNA 4M6XA 1ONVA 1OMIA 1F5TA 3FXQA 2A61A 1Z05A 2VBWA 5IT9K 2DQRA 2DAOA 4ENKA 2FMYA 1R1VA 4ON0A 5L3EA 5E8GA 1BJAA 3KZYA 3CLOA 1GXPA 4BHCA 4I2OA 1RZ4A 5EEHA 3HYIA 3OOPA 3I54A 4Q48A 3T5XA 3FMRA 5FD6A 2G9WA 2EFQA 1RIOH 5E20A 4EJVA 4NHJA 4QWQA 4YG2F 1WWXA 3E6CC 3ZQ7A 2MLKA 4ESJA 2VC1A 4BQAA 3MCZA 1S6LA 1YQAA 1FPQA 2XVCA 4KICA 3IKTA 3KP6A 3E5UA 1XGSA 4L9VA 1Y0UA 5E17F 2BV6A 5FLXK 3SHFA 3DP7A 4FHTA 2FXAA 3FWEA 1USTA 1J2XA 4WF2A 1TW3A 2XUBA 2RGVA 5L3BA 3JTGA 2D1VA 5L3GA 4BH9A 4KIGA 3JSOA 1YS7A 1ZG3A 3H3UA 4PZJA 4OU0A 1MD0A 1XN7A 4WCGA 3HSRA 4CGZA 1I27A 3KEQA 4A5NA 4L9TA 1B9NA 5TJJA 1IUYA 4R1HA 5CVRA 5DCMA 4L5JA 4KYWA 4WWCA 4HQMA 3J81K 4L9JA 4XSXF 3ZMSA 5BS6A 2E1CA 3L7WA 1R7JA 3MZYA 2DO7A 3REOA 4KIBA 4CHUA 3WTVC 1D8KA 3LWFA 1R36A 1L0OC 1P2FA 5KVRA 2KIMA 5DV5A 2LDUA 1GHCA 3L00A 2QQBA 2KIFA 1V3FA 3V4GA 3J7AO 1P6RA 5HS8A 4OIQF 4BAYA 1R5HA 4ZYHA 3GW2A 1KGSA 5FD5A 3LSTA 4PGHA 1J5YA 3KZZA 1YS6A 4I0BA 2Z99A 5J8CA 2RDPA 4AIKA 1ZGJA 3F6OA 1FNNA 3GWZA 1AWCA 1P92A 2O6GE 4RB3C 4JBAA 2W25A 2Y75A 2XROA 4CICA 2ZNYA 1IF1A 5K5OA 3GVAA 4UVCA 1V4RA 4UNOA 1YFHA 4S05A 1KYZA 3TO7A 3M1EA 2ISZA 1W5SA 2PMHA 4G6QA 3I53A 1LDKB 2A6EF 4R8HA 2QZ8A 3IWFA 1K78B 3WTWC 3EYYA 3IWZA 2HS5A 1HW1A 4UV8A 2GA1A 1S7AA 2ZBKA 1ZRDA 1YYVA 5LLQA 1BI0A 1FYMA 3JSPA 5DYMA 3CJNA 5TRDA 2QM3A 1XGMA 3F3XA 3LQRA 2DI3A 2XHKA 2CO5A 4G9YA 2FNAA 1WSUA 1G3TA 5ILVA 3U9GA 4KUMA 1J0RA 2IJLA 3IRQA 1K7AA 4Y17A 5FB2A 1ZHFA 5LHIA 2B0LA 2FBHA 3V8JA 4Q5SF 5L3DA 4EM2A 3V7CA 3ULQB 5FFZA 4G7OF 2XGXA 1RUNA 2M5WA 4HBLA 1J9IA 2YX4A 1LNWA 3BZ6A 2JSCA 2ZFWA 4A6EA 2ZJ2A 2YSRA 1XCVA 3NEUA 3N4MA 2JTVA 4HX8A 1FSEA 2EB7A 2O61A 3ZMTA 3OV8A 3WTSC 2DQLA 3KP3A 4PGGA 3I58A 2KIUA 5LEJA 3K1NA 2RC4A 5ED4A 3BDDA 1SAXA 5D5UB 3V8KA 3QU3A 4R79A 1JE8A 4NB5A 1K79A 1MGTA 3F8CA 5CVUA 3F8NA 1OYYA 3DF8A 2VBXA 1P4AA 3HHHA 5IT3A 4MQ9F 4RGSA 3CO7C 3C3WA 5LHGA 1FBSA 3ZMZA 2BE5F 4LK0F 2V1DA 3SQNA 1FLIA 1K78A 4MTEA 2IA1A 2YPRA 3V8LA 2JZYA 1W7PB 2QVOA 1F1ZA 2X4HA 5HVQC 2FSWA 4UV9A 2NNYA 1U5TB 3CTAA 3ZMUA 2PEXA 2FBIA 1TW2A 3EQLF 4GXOA 3D0SA 4RB1A 2MLGA 2CSOA 2XAQA 3QRFF 4M74A 3DV8A 1MZBA 3TQNA 5A2QZ 1CGPA 2W57A 1R1UA 4P55A 4BHPA 1JGSA 3EDPA 1H9GA 3SZPA 2XAJA 2PBIA 2VBZA 2WV0A 2XRNA 2G7UA 5H6RA 1XB4A 1XGNA 4O3MA 2DPUA 3ECOA 4OMYA 1QZYA 1TQIA 3BWGA 1STZA 3KP2A 2OQGA 3F23A 1TQMA 4M9XA 4KN4X 4MEYF 1U5TC 2XAHA 4M6YA 4EMSA 5HS7A 3ZMDA 2KKOA 5K5QA 3GFMA 4G8XA 1WI9A 2HKXA 2XASA 5HDKA 2CG4A 4L0ZB 1HW5A 3GX4X 2QBYB 2FMLA 2MC3A 3ZPLA 1I5ZA 2IPQX 1ZG5A 5D5VB 3GLXA 2WTEA 4HV5A 2EJRA 4UVAA 4KNYA 2K4JA 3F8BA 3LA7A 1U6GA 1ZRFA 4U0YA 1F9NA 3QPHA 1B1BA 1WKMA 1FBUA 1X3UA 3U1DA 4LLNA 2GIVA 5CYVA 5BPDA 3WGGA 2P6TA 4GCVA 1OYIA 3MQ0A 1AOYA 3JAMZ 5LEKA 4CDGA 1YW9A 2C6YA 5JFRA 4A12A 1LEAA 4ENJA 4NQWA 3HOTA 2H09A 3TDUC 1DPUA 4L0YB 4HX7A 1C0WA 3KETA 2VT3A 2R7FA 1T0FA 3ZP5A 3JW4A 4A5MA 1F4KA 1XSXA 4IF4A 2M45A 4Z2YA 4UVBA 3HHGA 1I1GA 4KIFA 3MWMA 1W7PA 5L3FA 2GXBA 3D5LA 5D5WB 2VXZA 2JPBA 3TOAA 3I59B 1U5TA 4M73A 1KU9A 4I7HA 2J5PA 1B6AA 3EYIA 1DP7P 1FBQA 4RGUA 4N9IA 2NRAC 3WTTC 2ZMEB 5D6EA 2V9VA 1IXSB 1SD6A 1SD7A 2OBPA 2OAZA 2IRFG 2IA0A 1D3YA 4JQFA 3FXRA 2CYYA 3DXJF 4GYIA 3E6MA 2K27A 4LG0B 5ICCA 2HQNA 4AD9A 5CLSA 3KCCA 1TTYA 1U8RA 2O3FA 3V7SA 2STWA 3I0TA 1IZ1A 2V1UA 1EV7A 3Q9SA 5JVTA 2IP2A 1A04A 3W6KB 1O3SA 2AS5F 5F1RA 4LLLA 5A2QK 2MH2A 1KQ0A 3P9CA 1O3QA 2Z33A 2UXNA 3R61A 1BM9A 3R0JA 1JHHA 3QP6A 1YW7A 2TDXA 5LGTA 5HS9A 2FQ3A 3E6BA 1TQPA 1Z7UA 2J5OA 3MAJA 5DUKA 2IW5A 1I6XA 2R3SA 3WE3A 3CO6C 4BYYA 3O2PE 4RAYA 3TO6A 2Z9OA 1ZLJA 1O57A 4HLYA 1ZRCA 3RYRA 3EUHA 4MHGA 1BI2A 1E17A 5E1XA 4FT8A 2KRFA 2V6CA 3LA2A 5D8KB 3IKVA 4KMFA 4I0AA 1D5VA 1KQ8A 4OIRF 2FA5A 1QZZA 2HYGD 5LRRA 3FHZA 1QQIA 1W4MA 2P7VB 5FFXA 3I59A 1QPMA 3IC7A 3MEXA 1R1TA 2WC2A 3T8TA 2FBKA 1Z1DA 4HX4A 2F5EA 2BEOA 2IT0A 3CUOA 2ZMEA 2E1NA 4XRFA 2EFWA 1EH7A 3JAMK 1BI1A 4RB2C 1MJ9A 3BJ6A 3V7RA 2V79A 2COMA 2VOPA 1HQCA 2E7WA 5DD8A 4IRHA 2IVMA 2PJPA 4LG0A 4EGZA 3ZN0A 3I71A 2CFXA 1HKQA 2DPDA 2QYOA 2ZKZA 2XKOA 2BBYA 2DTRA 4I02A 4L18B 3ZN1A 3K0LA 2D1HA 3HRMA 1G3WA 4MEXF 3SXYA 4LB5A 4ETSA 4LLGF 4LB6B 2ESHA 5H6QA 1DUXC 1LDDA 4HAMA 1RUOA 1Z91A 1IRFA 3ZMVA 1Z6TA 5BQTA 4F7ZA 3RIRA 4BXUA 4ZYGA 2FRHA 2ISYA 2GZWA 1NHAA 3QP5A 3FM3A 1OYWA 4IXAA 3PFIA 4M9SA 4HW0A 1IW7F 4MQVA 4OIOF 3C1DA 5J8FA 4K2EA 3F6VA 3PQJA 2G7HA 4YIFA 3F72A 1ZAOA 3B73A 5D6FA 4CZZA 1BIAA 4HDVA 1YG2A 2FNPA 2EFPA 2DK8A 3M8FA 4IHSA 3NRVA 4EVIA 3F21A 4Y13A 5LHHA 1QBJA 3M8EA 2L4AA 1I1SA 4HV6A 1LQ1A 3KE2A 2V1XA 4IHTA 2LNBA 5HLHA 5DUIA 4U88A 1B4AA 4A0YA 2NAZA 1KYWA 5BMZA 2Z5UA 3DPLC 5JI6A 1ON1A 3G73A 1W7PD 3RJPA 1LVAA 1IN4A 1OKRA 2M30A 2XIGA 2DBBA 3LA3A 3BOQA 3BJAA 2ZNZA 5AIPA 2NNNA 3RI4A 3HRSA 1HSJA 3ROUA 3L2CA 4FX4A 1OPCA 3GF2A 1BOAA 1XDUA 4IPAA 2W85A 4IRIA 3ML6A 3WTUC 4P5OA 2L3DA 3O3KA 2LF8A 4OOIA 1FOKA 4E70A 3M9AA 5BPIA 4A0XA 3RTRA 2GQQA 2PMUA 3WGIA 3ECHA 3WU1B 5ICFA 1QO0D 4ZH4F 1D8JA 3GFIA 2D45A 3P9IA 5CVJA 4CO8A 1O7FA 3FMQA 3Q5FA 4RS8A 1YLFA 5FGMA 3B02A 5HLGA 4DNCA 2W84A 4HZFA 1G3SA 3GYHX 3KLNA 1MKMA 1FYLA 2LF7A 3MFKA 4G6DA 4ZZDA 1LDJA 2OZ6A 1WRJA 3I4PA 2NYXA 3FMSA 4EJTA 2DLLA 4O5VA 4U0VA 2GXGA 2LKPA 2ETHA 3C18A 5HDGA 3QOPA 5DCFA 4HYEA 4PCQA 3RPQA 1QNTA 2O0YA 1IN8A 3WE2A 3R60A 1FY7A 2GAUA 4LD5A 1HXDA 3IRRA 2OU2A 2STTA 1ZYRF 2HR3A 1FP2A 1EH6A 4AWXB 3WTYC 2HOEA 3SZTA 2A07F 1S29A 3WTXC 2HTSA 2VC0A 1P4XA 2EA4A 2FF4A 1U78A 1J75A 4U7DA 1FZPB 1MDMB 1JXSA 2VODA 4EJOA 3HSEA 4PDKA 1HSTA 2UWMA 1PUEE 2HGCA 5E8IA 1HBXG 2HZTA 1SMTA 1BC8C 2VOOA 3TOBA 3E6DA 1LJ9A 2XV4S 4KT5C 4P9UA 3GFLA 2HEOA 2P4WA 3WODF 1O7LA 4EJWA 1SD5A 1RI7A 2UZKA 3BP8A 3WGHA 3J80Z 2Q0OA 3I64A 3FX3A 2MBFA 3E5XA 2L54A 3FXUA 1DDNA 5JHUA 4M71A 4D0PA 3C7JA 1RNLA 2VT2A 5J6XA 3RDIA 4KA4A 2F5FA 1DPRA 5ERIA 2QENA 3LAPA 2HFHA 1LB2A 4I09A 3KP7A 1KU7A 2Z3YA 2HWVA 4DQ2A 3GEZA 4YFNF 5CVIA 3IHUA 2P8TA 1S8NA 3FZVA 3DEUA 1O3TA 4HQEA 3U2RA 3E5QA 2ZCWA 1ULYA 5KK1A 2Y0MA 3COAC 5F64A 1T2KA 3KFWX 3EETA 3GUDA 4LJZF 2O8XA 3DKWA 3HTUA 1T38A 1O3RA 3T0YA 4YIIA 2RKHA 3GZ6A 1ODDA 5H20A 2YR2A 1KA8A 2KJCA 5AIQA 4U0WA 1USSA 4Q47A 1BC7C 2W24A 3MZHA 2FE3A 3L9FA 1SD4A 2H6CA 2CQKA 1FX7A 1MDMA 3DPTA 4M72A 4ENMA 2RN7A 2QBYA 5ILUA 4ZYEA 2QUFA 4EGYA 3TO9A 2MA3A 1ZLKA 4M9ZA 2F2EA 1BIBA 1CF7B 3KP4A 1R23A 2ESNA 4EJUA 3HIFA 2RQPA 2CWEA 3K1MA 1UCRA 1UB9A 3VODA 2RNJA 1FSHA 1T98A 1ZGAA 4KDPA 2XKPA 5LGNA 4ENNA 1UHWA 2D2WA 4OINF 3HOSA 2M1BA 4RGRA 1IN7A 3RYPA 1TNSA 3QAHA 1IN5A 3BROA 2Y48A 2M87A 3O6BB 2OA4A 2WWYA 2FEZA 5ILSA 4IVNA 1YIOA 1YW8A 5LGUA 1UHMA 1K6OA 1HKTA 2VBYA 4UHTA 4XLPF 1U2WA 3IL2A 3J80K 2ADUA 5D5XB 4MGRA 1XCBA 1H9TA 4XLNF 2RVCA 1MJAA 4HA8A 4A6DA 2A68F 1XGOA 5L3CA 3S2WA 4HLXA 3E3VA 4H0EA 1TLHB 4HDUA 3T8RA 2P5VA 3VFZA 5EEGA 3RKWA 3GXOA 3WG9A 1XSDA 5K1YA 5D8LB 2A3SA 1FC3A 1G4DA 2P5LC 3RKYA 3LAJA 4RB0A 5K5RA 3AAFA 3K9TA 4G7HF 1G3YA 4P96A 5AONA 5DD4A 3HSFA 2PQ8A 2JPCA 4N0BA 3LFKA 5FO5A 1MJBA 2OZUA 1CF7A 2PI0A 4HF2A 2H94A 2P5KA 4HF1A 2XAGA 4RAZA 1BN5A 1YO5C 2H6BA 5BOXA 3BJOA 2Q8KA 1S7OA 3ELKA 4L5IA 3K2ZA 1L3LA 2DK5A 1R5GA 1BI3A 1J59A 1E2XA 1GXQA 2F5CA 2PG4A 4L9NA 1S3JA 4Y15A 3FM5A 2P7CB 2HYFA 4EQQA 4AIHA 1XSVA 5ICGA 2HDCA 3TGNA 3RPUA 4HOBA 1PP7U 5LRSA 3VEPA 2JT1A 1H0MA 3R6SA 1ZH5A 2QQ9A 1XMKA 1ZREA 6PAXA 2HTJA 4P9FA 1FYKA 2E7XA 2A69F 3I5UA 2QLZA 2ELHA 1KU2A 4HF0A 1TNTA 4YFKF 1QGPA 3KEOA 2EV6A 5HDNA 2JRTA 4KFCA 2A6HF 2OQRA 2P6SA 3DFGA 4FX0A 2EK5A 5E18F 4EM0B 2M8EA 1XDSA 5E1ZB 2VONA 5E1WA 2EV0A 2FOKA 2HQRA 5JR3A 2L4MA 2DU9A 5D4RA 4GGGA 4UUVA 3JTHA 3W6JB 1P4WA 2PLYA 3R0AA 3R4KA 3CDHA 3H92A 1IRGA 3Q9VA 1KQ9A 1R22A 4EM1A 2K02A 2PN6A 1Z6RA 4QLCU 4ASNA 4WXHA 1R00A 5ICEA 1ZG1A 1PP8F 4ZZLA 4OIPF 4AVPA 3ABUA 4TV7A 3F8MA 3BY6A 4G94A 4AIJA 2DW4A 3HRTA 3CUQB 1ZARA 2ZO4A 1FWZA 4ESBA 2EFNA 4LK1F 4KN7X 1FP1D 2CW0F 4JK1X 4IRGA 4GO1A 4G7ZF 3QPTA 2A5YB 3E97A 4XBFA 1J7KA 4LGWA 3DQVC 4BHBA 3GO5A 2FU4A 5CVVA 4Q4ZF 2LSOA 4A0ZA 1SFUA 1KU3A 2YU3A 4BNCA 4IJAA 2GWRA 3ERED 5HOOA 2EA2A 1HKSA 4ZYDA 1T6SA 3K1PA 3NQOA 5IT9Z 5LBQA 1T39A 2ZXJA 4S04A 3QU6A 3F22A 3CUQC 2VE9A 2BYVE 2MH9A 4U7BA 3SFZA 2DT5A 1PDNC 3HUGA 2UXXA 1XD7A 1SFEA 1R58A 3P9KA 1WQ2A 3G3ZA 5HLIA 3BPVA 1Q1HA 3FF5A 3ISPA 1B59A 2RV8A 2PFBA 5D4SA 2F5DA 2GA2A 5FLXZ 3HRUA 4ESFA
chains in the Genus database with same CATH superfamily
1N75A 1EH8A 4X0GA 4C2UA 2HKOA 5DEQA 1BBYA 1B9MA 1VQ6I 1XMAA 3QYBA 4BGDA 3CMYA 3T1BA 5IP6A 4RGXA 2K86A 3J7ZI 2W7NA 2XAUA 1YTYA 1TT5B 2EPFA 4I98B 4EV0A 3M7GA 4B8XA 5DDGA 4CCLA 3TKYA 1JJ6C 3WU0A 4CYCB 3CQZJ 3HKZN 4M6VA 1D5YA 2Q2EA 2AHQA 4WXCA 1IAWA 2O03A 4XMYA 1OCTC 2X1DA 2HOTA 5CJ9A 3ZR8X 2V6EA 2CGPA 2DFIA 4HNUA 4O6JA 3VOEA 1HW2A 4B09A 3KLOA 3L09A 1U9OA 1XPXA 1QHHD 1REPC 1IRXA 2XF6A 1W0TA 4MNUA 4I01A 5IYDJ 2K4BA 4JYKA 2RREA 2VB6A 2XAFA 4XSZF 1GLNA 2E71A 2EWNA 3I9V2 3GTMJ 3S15J 3GTLJ 1D1CA 1ZN2A 3N97A 3IUOA 2LKSA 3K4NA 1D1AA 3CUQA 3J81Z 1U3EM 3PQKA 1LEBA 3I55I 1JHFA 1ON2A 3DKXA 3JRAA 2VE8A 1X4OA 1MSEC 4N9HA 5LD2C 1FT9A 2L01A 5F6FA 4XORA 3GZ5A 4A2UA 2X6OA 2BGCA 2VN2A 2LY9A 2L02A 3H3ZA 1IDZA 2EV5A 1UG2A 4XKVA 1SMYF 1DP3A 1XTAA 2LY1A 2NS0A 3LSIA 2GM4A 1LFBA 2O9LA 1OR7A 3TW6A 2IA2A 3RKXA 2H1KA 1VF9A 4CYDA 1UFMA 2X0LA 3OYIA 2M34A 1Z9CA 2ACJA 3LSJA 1QVTA 1IXRC 3BT9A 2V1NA 3F8FA 1VTNC 3JRDA 1VQ7I 5JLXA 4YFXF 3S2DJ 3MKZA 4WX9A 2CUEA 2CV0A 4AYBN 2EZLA 4KMUX 2VASA 2H27A 3OYEA 2BW3A 4LFUA 5DCMB 3KP5A 3BG7A 3K69A 2HVQA 2KJBA 3P7NA 3DKYA 3BPXA 4CXFA 3FBNB 1IXCA 1Y1WJ 3EPZA 3KYLA 3HOZJ 2NOGA 2K7LA 3WTZA 3SFIA 2BXYA 2OD5A 2QWWA 2ME0A 4WXDA 2ZJRF 2LMDA 3BTLA 2EFOA 4OMZA 4GYGA 1SFXA 3ZQHA 3GFJA 3G2BA 1IN6A 2B63J 4LMYA 1GVJA 3VB2A 2XPUA 3HTSB 3CC2I 2MD5A 2L5QA 4UUSA 3TDZC 3JRIA 3EUHC 2AXLA 2R7DA 4J01A 2DDAA 2YX7A 3VPRA 5B1BH 2LY2A 1TBXA 1PUFB 1G6NA 1K6YA 1W5TA 3ABTA 3U21A 4WK8F 4MTDA 2QQAA 3LQQA 4UXNA 2R7QA 4M6XA 1ONVA 2EQRA 1OMIA 4UY8I 2BY2A 1F5TA 3BG6A 3FXQA 3K2AA 2A61A 1Z05A 3GZNB 4YEJA 2VBWA 5IT9K 2DQRA 2DAOA 4ENKA 2RAEA 4DZPA 3TW7A 2FMYA 1R1VA 2IS6A 2V9KA 1YE9A 4ON0A 5L3EA 2P81A 4IOCF 3BR3A 5E8GA 2EBIA 2JWTA 1BJAA 3KZYA 3CLOA 1BR4A 1GXPA 1NH3A 4BHCA 3GTKJ 4HPQA 2Z2SB 3OIOA 4CYCA 1RZ4A 3HGGA 5EEHA 4I2OA 3HYIA 3OOPA 3I54A 4Q48A 3T5XA 4MO7A 4RMNA 1HCRA 3FMRA 3I4NJ 5FD6A 5HLTA 2G9WA 2EFQA 2ZMEC 5E20A 4EJVA 1RIOH 4NHJA 3PM1A 4QWQA 4YG2F 3GTQJ 1WWXA 4AM3A 3E6CC 3C2GA 3ZQ7A 4E6KG 2MLKA 4ESJA 2VC1A 4XLAA 3MCZA 1S6LA 4BQAA 3CDLA 1FJLA 2O8KA 1YQAA 2RQQA 1FPQA 2V7FA 2XVCA 2OJED 4KICA 4YIRX 3IKTA 1SVLA 1P9QC 3KP6A 1TWHJ 3E5UA 1XGSA 2Y0SA 2M7BA 4L9VA 1Y0UA 5E17F 2BV6A 4DYQA 5FLXK 1HLVA 3LSMA 2ZXHA 3SHFA 3DP7A 1MIJA 4X6AJ 4FHTA 4IQ4A 1JGGA 1SVMA 1W36D 2CUZA 2FXAA 3FWEA 2ELKA 4E7IA 1USTA 1J2XA 4WF2A 1TW3A 2XUBA 3K4BA 2RGVA 4E7JA 5L3BA 3JTGA 3H5RA 2D1VA 2PMZA 4NDLA 5L3GA 4BH9A 4KIGA 3JSOA 4ZDOA 1YS7A 3IH4A 4DBQA 1ZG3A 2KP6A 3H3UA 4PZJA 4OU0A 3L1PA 2H1LA 1MD0A 1XN7A 4WCGA 4XL9A 3HSRA 4CGZA 2XSJC 1I27A 1ETYA 3GTGJ 3KEQA 4A5NA 2MC4A 4L9TA 5E3OA 2XPVA 4Y4RA 3VWBA 1B9NA 2L9SA 1GV2A 5TJJA 4D7MA 1ENHA 1IUYA 4R1HA 4HNVA 2JSPA 3HB9A 5CVRA 2CQXA 4HRIA 2NVTJ 5DCMA 1R49A 4L5JA 1T56A 4KYWA 5CQGA 4WWCA 1KZHA 4HQMA 3J81K 1K61A 1APLC 2XF5A 4I6ZA 2FQ4A 4BBRJ 2VQCA 3NARA 4L9JA 4LIUA 2DT6A 1I3AA 4XSXF 3X2QH 3ZMSA 5BS6A 3EUKL 1NK2P 2AQFA 2E1CA 4IHWA 3L7WA 4KT6A 1R7JA 3MZYA 1BL0A 2DO7A 3REOA 2KFDA 2L7ZA 4KIBA 4XLFA 4CHUA 3WTVC 2R7OA 4YELA 1D8KA 3LWFA 2V4JC 1SANA 1R36A 1VQMI 1MMGA 1L0OC 3ZQIA 1P2FA 2WY8Q 5KVRA 2KIMA 5DV5A 2LDUA 3PNVA 1GHCA 3PL8A 3L00A 5IY5H 2QQBA 4NNJA 3A0BC 4JX4A 2KIFA 4DBRA 1V3FA 2IGMA 3V4GA 2IGOA 3J7AO 1P6RA 1WGXA 1ZKGA 2DFEA 5HS8A 3HOVJ 1ORKA 3G1LA 2OTLI 4OIQF 3BLYA 1OFCX 4BAYA 4CUGA 1R5HA 4ZYHA 1MMDA 4M3GA 4BL0B 2A6TA 5FJ8J 3GW2A 4MFEA 4XLCA 1KGSA 5FD5A 3BG3A 3LSTA 4PGHA 1J5YA 3K10A 2E36A 3KZZA 1YS6A 1T33A 1M1EB 4I0BA 2Z99A 1WCMJ 3RSNA 5J8CA 4A3DJ 3K4LA 2YU9J 2RDPA 4AU7A 4AIKA 4RDUA 1ZGJA 4JP0A 3H0DA 3F6OA 2KDZA 1FNNA 2BHZA 3GWZA 3RZDJ 5M3FJ 3ERMA 1IDYA 1ZELA 3FXKA 5HNHA 4CCOA 1AWCA 1P92A 3BCAA 2BY3A 1FEXA 2O6GE 3PO2J 2JVHA 3M1CA 2K9NA 4JBAA 4AVZA 2W25A 2Y75A 4RB3C 3DU6A 4QIWN 2XROA 1MBJA 4CICA 2ZNYA 1SEUA 1IF1A 5K5OA 3BG9A 3GVAA 4LIVA 5EG0A 2LRDA 5M5WJ 1A5JA 4UVCA 3JREA 1V4RA 1ETXA 2HDWA 2HQ5A 2LLKA 3E0JB 1YFHA 4UNOA 4S05A 4ZTJA 1KYZA 1PYVA 3TO7A 2LC2A 1ITYA 5J4VA 5F27A 3M1EA 1W36C 2ISZA 1W5SA 2PMHA 4G6QA 1X2NA 3I53A 1LDKB 1YI2I 2A6EF 3FK6A 4R8HA 3GBGA 4F92B 2UUZA 2QZ8A 5KAIC 3IWFA 1K78B 3WTWC 3EYYA 3IWZA 1UZCA 2HS5A 1HW1A 4UV8A 2GA1A 1S7AA 2ZBKA 3DLLF 1ZRDA 1YYVA 3G1OA 5LLQA 4G6TB 1BI0A 3CMAI 3JSPA 1FYMA 1AKHB 5DYMA 2ID6A 2JMWA 3CJNA 2QM3A 5K7FA 5TRDA 2OPTA 1XGMA 3HPGA 3DEWA 4U87A 3F3XA 3SJMA 3LQRA 2DI3A 2XHKA 2KPMA 2CO5A 2O5RA 5C44J 4BXXJ 3VYRB 3GMEA 4G9YA 3L2VA 1WFXA 2K85A 2FNAA 5HODA 1WSUA 1G3TA 5ILVA 3U9GA 4KUMA 1J0RA 2IJLA 3IRQA 5IYBJ 3KZIC 5B5EC 1K7AA 4Y17A 1Z67A 5FB2A 1ZHFA 1YOVB 2QA4I 5LHIA 2M9HA 2B0LA 2FBHA 3V8JA 2NOJB 5M5YJ 1WJAA 2JQ7A 5L3DA 4C2TA 4Q5SF 4IKFA 1WJBA 1H88C 1OCRH 3HBLA 5EZHA 4EM2A 3V7CA 3ULQB 3O8GA 5FFZA 3TEDA 4G7OF 4D7NA 4B1RA 2XGXA 2BZTA 1ACIA 4FETA 2MSYA 1RUNA 2M5WA 5FKNA 4RLFA 3OYCA 4HBLA 3IP4B 1J9IA 3LSHA 4RAFA 2YX4A 1YIJI 1DU0A 3H5AA 1LNWA 2H8RA 3BZ6A 1EA3A 2FUG2 4GFBA 4KISA 1UG0A 2JSCA 2ZFWA 4A6EA 2ZJ2A 1GUUA 2YSRA 1XCVA 3NEUA 3OYKA 1ZGWA 3N4MA 3BR0A 2JTVA 4HX8A 2CW7A 4Z6YA 4B43A 1FSEA 3HG9A 4D1QA 2EB7A 2O61A 4PK4A 2IAIA 3ZMTA 3OV8A 3WTSC 4FASD 5F0FA 2DQLA 3CCSI 3KP3A 4XQFA 2P0WA 2L7KA 3CZ6A 4PGGA 3M3YJ 4II3A 1KONA 2LK2A 3TBIA 2JK3A 4X1EA 5GP9A 3I58A 4BXFA 2F6CA 2KIUA 4ANJA 3LNQA 5LEJA 2LREA 2VLAA 3K1NA 2RC4A 2XDVA 5ED4A 3BDDA 1SAXA 5D5UB 3V8KA 3OY9A 3DBLB 2XGEA 3QU3A 4R79A 1JE8A 1LPQA 3HDDA 4NB5A 1K79A 2R7XA 1MGTA 3F8CA 3A0HC 2I8DA 5CVUA 4B4CA 2E1MB 5J4YA 2HNHA 2F4IA 1D1BA 2XGCA 3F8NA 5GAGJ 1OYYA 5IYCJ 5M5XJ 2VJ4A 2VUMJ 4DYCA 1Z7LA 3DF8A 2VBXA 1SAUA 1P4AA 1R5ID 3HHHA 5IT3A 2AXTC 4NC8A 2TRTA 4PJ0C 2ICWG 4MQ9F 4RGSA 4ZDLA 5IP9J 2JN6A 3CO7C 3QPLA 2LH9A 3HM5A 3FXOA 3C3WA 2X6XA 5LHGA 5DM7F 3A01B 2R5YB 1ETKA 1FBSA 4Y33A 2BE5F 3CESA 4LK0F 3ZMZA 1IRZA 2JA2A 2V1DA 3SQNA 1FLIA 1K78A 4MTEA 2IA1A 3J7YJ 1LVKA 2YPRA 3V8LA 1WH5A 1N78A 2JZYA 5J47A 2LG4A 1YJWI 1W7PB 1FIPA 3CJTB 2QVOA 1ETOA 2VKEA 4XN3A 2Y2ZA 4F52A 1MNEA 1RR8C 2FD5A 1F1ZA 2X4HA 1ZK8A 3QOEA 4B48A 5HVQC 5LFAA 2HVSA 5IP7J 4Y3OA 4XLEA 1AKHA 2FSWA 1RR7A 5JVGF 4UV9A 4DZJA 3CC4I 4PFPA 2NNYA 1U5TB 3CCEI 1S5LC 1J09A 3CTAA 5GPAA 3ZMUA 5DM6F 2PEXA 1MH3A 2TCTA 3A03A 3C2HA 2FBIA 1TW2A 3ZXSA 3EQLF 2WAQA 4GXOA 3D0SA 4RB1A 2E1MC 2MLGA 2CSOA 5EJCA 2XAQA 1XX5A 2CS3A 3QRFF 4M74A 3DV8A 2W00A 1MZBA 1X3WB 3W6VA 3TQNA 1JI8A 5A2QZ 3PNTA 3S3OA 1CGPA 2W57A 1R1UA 2W48A 4P55A 4BHPA 3A02A 4BS9A 3PIOF 3M4OJ 1JGSA 2M3AA 2QKMB 3EDPA 5GPCA 1H9GA 2L7FP 3CF5F 3SZPA 1OJLA 1T0FC 2XAJA 2PBIA 2VBZA 2WV0A 2XRNA 1TWFJ 2G7UA 5H6RA 4RAGA 4QSHA 1JKRC 1XB4A 2M4GA 2L9VA 1XGNA 2BHYA 2CQNA 4BJ6C 3HOXJ 2JVGA 1Y39A 1X2MA 1BR1A 2LR8A 2K9SA 4O3MA 1D0XA 2DPUA 3G1MA 3ECOA 4OMYA 1N77A 3CCQI 1QZYA 1TQIA 3BWGA 1STZA 3KP2A 2OQGA 3F23A 4ABZA 1TQMA 4C9YA 4QTRA 4M9XA 4KN4X 4MEYF 1U5TC 2XAHA 4M6YA 3BZKA 4EMSA 2EIJH 3SEQA 1ETWA 4A3FJ 5HS7A 3ZMDA 2KKOA 5K5QA 3GFMA 1SFOJ 3D1NI 4G8XA 1WI9A 2RNGA 4XN0A 1R71A 2HKXA 2KMUA 2XASA 5HDKA 2CG4A 2MGQA 4L0ZB 1HW5A 3CC7I 2D5VA 3GX4X 2DMTA 2FMLA 2QBYB 1YX3A 1Y8RB 2MC3A 3HPHA 3ZPLA 1I5ZA 2IPQX 1ZG5A 5D5VB 4HSTA 3GLXA 2WTEA 4HV5A 2EJRA 2NS8A 1FOWA 4UVAA 1W0UA 1JTXA 4KNYA 4LG3A 2K4JA 2XC7A 3F8BA 1TP4A 4IL6C 2VQHA 3LA7A 1U6GA 5B1AH 1LE8B 1ZRFA 4U0YA 1GT0C 1TZLA 1F9NA 1G2HA 3QPHA 1B1BA 2CH0A 1WKMA 4I99C 2KLOA 1FBUA 1X3UA 3OS1A 3HXLA 3U1DA 1R4MB 3CCLI 4XLHA 1HDPA 1TL8A 3UKGA 2DOFA 3Q0VA 2GIVA 4LLNA 5CYVA 5BPDA 3WGGA 2P6TA 4GCVA 1OYIA 3MQ0A 1AOYA 2MD0A 3JAMZ 5LEKA 3P5JA 4CDGA 1YW9A 2C6YA 5JFRA 1HA8A 1RPWA 1POGA 4A12A 2ZSIB 1LEAA 1UMQA 4ENJA 4NQWA 3HOTA 1E3HA 2LTPA 2H09A 4XOTA 3TDUC 3TP3A 3FXLA 4L0YB 1DPUA 4HX7A 5J1RA 1C0WA 4QPOA 3NAUA 3S32A 3K4CA 2OCEA 3KETA 2VT3A 2R7FA 3FHNA 3J7AY 1T0FA 3ZP5A 3JW4A 4A5MA 3A01A 1XSXA 4IF4A 4BQOA 2R7WA 1F4KA 2M45A 4Z2YA 2DCEA 3OL4A 4UVBA 3HGYA 5FRMA 3HHGA 1Q1VA 1OISA 5H2FC 1I1GA 4KIFA 2B9SA 3MWMA 1W7PA 5FKLA 5L3FA 2GXBA 3D5LA 3RQIA 5D5WB 1QA6A 3A2KA 2VXZA 1S7EA 1DGWY 2QEXI 2JPBA 2DOAA 3TOAA 3I59B 1IC8A 1U5TA 4M73A 1KU9A 4I7HA 1RESA 2J5PA 1B6AA 3EYIA 1DP7P 1BW5A 5E3MA 1FBQA 4RA2A 4RGUA 4N9IA 2NRAC 1WZ2A 3WTTC 1YJ9I 2ZMEB 5D6EA 2V9VA 1IXSB 2JA5J 1SD6A 1SD7A 2F4MB 3Q3SA 3C2BA 2OBPA 3ASNH 3OSFA 2LD5A 3ZQLA 2OAZA 3OS0A 4A3IJ 2DYRH 2IRFG 1V55H 2IA0A 1D3YA 4JQFA 3H36A 4UB6C 3FXRA 2CYYA 3HZJA 1WH7A 3DXJF 3OMYA 4GYIA 1S72I 1U9NA 1GVDA 3RCOA 3E6MA 3I56I 2K27A 3QODA 2BVMA 2M0CA 2EINH 2ZC2A 4LG0B 2OTJI 2Q1ZB 1I50J 2OCCH 2ZJQF 5ICCA 2DA2A 2HI3A 4Y7NJ 2HQNA 4AD9A 5CLSA 3KCCA 1TTYA 2K9QA 2X1EA 5JLWA 1HF0A 2R7VA 1B8IB 1U8RA 2O3FA 2B7EA 3V7SA 1RETA 2STWA 3I0TA 1IZ1A 2V1UA 1EV7A 1MMSA 4FISA 5KAFC 1IUFA 3Q9SA 4E7KA 5JVTA 2IP2A 2CUJA 3ZQQA 1ZTRA 2QCOA 1YX5A 3G6EI 1A04A 3OR2C 4J00A 3AL0B 3W6KB 3QQAA 1O3SA 2AS5F 4IO9F 4JX6A 2ZSHB 2DDBA 5F1RA 2QQ8A 3KPHA 4LLLA 5A2QK 2ELJA 4XRSG 3ONQA 2MH2A 1KQ0A 3P9CA 1O3QA 2Z33A 4XK4A 2MG4A 3LSPA 3OYLA 2UXNA 3R61A 1BM9A 4DOZA 2K40A 1R4NB 3R0JA 1LE8A 3SYTA 1JHHA 3QP6A 1YW7A 2NVYJ 2TDXA 2W82A 4CA0A 5LGTA 5HS9A 2FQ3A 3ZQCA 3E6BA 1TQPA 4XOPA 1Z7UA 2J5OA 3MAJA 2KIQA 1PJRA 5DUKA 2IW5A 1I6XA 2VXDA 4NBQA 2R3SA 3WE3A 3CO6C 4BYYA 2E5ZA 4PJLA 3O2PE 4RAYA 3TO6A 2Z9OA 1ZLJA 2EH3A 1O57A 1Y56A 4HLYA 1MBHA 1A36A 1ZRCA 3DTKA 4XKCA 4BACA 3RYRA 3EUHA 4BKXA 4MHGA 1BI2A 1E17A 3AL0C 2HXIA 5E1XA 2HDDA 4PSXA 5CQEA 4NUBA 4FT8A 2KRFA 2JA6J 2V6CA 4C3JJ 3LA2A 5D8KB 3IKVA 4KMFA 4I0AA 4BJ5C 2GXAA 1IJWC 1D5VA 1FTTA 3FKIJ 1KQ8A 5B66C 2DT7B 4OIRF 2FA5A 1QZZA 1G8XA 2QKLB 2L0KA 1P7JA 2DN0A 2HOSA 4AC0A 2CU7A 2HYGD 2JA7J 5LRRA 4E7SA 3FHZA 1QQIA 1W4MA 2I5UA 2P7VB 3EUAA 4JOMA 2XRLA 5FFXA 4NC6A 3I59A 2V9PA 1QPMA 3IC7A 3KYCB 1R1TA 2WC2A 3MEXA 4PUSA 2FBKA 3K4MA 3T8TA 4XIDA 1Z1DA 3S2HJ 1WI3A 2R0QC 1BR2A 4HX4A 2F5EA 5KNLA 2Z1DA 5F0HA 2BEOA 4NC7A 2IT0A 2XSDC 3CUOA 2ZMEA 3L2QA 2E1NA 4XRFA 3S1RJ 2EFWA 1EH7A 3JAMK 4M3DA 1BI1A 2VL8A 4ITVA 2XF7A 1Z21A 1Y6IA 4RB2C 1N25A 1RC9A 4BDZA 1MJ9A 3BJ6A 1PUFA 3V7RA 3DEEA 2GOXB 4CCNA 3LSKA 2V79A 1Z3YA 2COMA 2FOWA 1HQCA 2E7WA 2IGKA 5DD8A 2VOPA 1IV6A 4IRHA 2IVMA 2PJPA 4RBOA 2X51A 3H9GA 4LG0A 2ZJPF 4EGZA 1NG7A 3ZN0A 1VNDA 2LKXA 2DMNA 5TISC 3I71A 2DA1A 2CFXA 1HKQA 2DPDA 4PJMA 3ZQFA 4BY7J 4IZZA 2EZIA 2GLOA 3UNGC 2QYOA 2ZKZA 1ETQA 1B8IA 2XKOA 2BBYA 2DTRA 4YRVA 4I02A 4L18B 1D0ZA 2E2JJ 4D9JA 3ZN1A 3K0LA 5C4JJ 2D1HA 1MBKA 4HG2A 2MW8A 3BTCA 3HRMA 2R5ZB 1K83J 1G3WA 4MEXF 3SXYA 4LB5A 1H8AC 3H35A 4ETSA 3FBIB 4LLGF 2WB1A 4FE4A 1OCZH 4LB6B 5H6QA 2H8WA 1LDDA 4OAZA 4HAMA 1DUXC 1RUOA 1Z91A 3CP2A 5CPRB 1IRFA 4P1WA 4BQNA 3ZMVA 1Z6TA 4XKBA 5BQTA 4F7ZA 4A3MJ 3RIRA 4CH7A 4BXUA 1WJCA 4ZYGA 2FRHA 1TWGJ 2ISYA 2GZWA 2KHMA 1NHAA 1OCPA 3BQYA 3QP5A 3DLAA 3FM3A 4IQJA 2R7ZJ 1OYWA 4IXAA 3K4JA 3PFIA 4M9SA 3HKZA 4F3QA 4B44A 4HW0A 3KYDB 3RZOJ 1IW7F 4MQVA 1HC8A 4II2A 3C1DA 3VSKA 3ZGKA 4K2EA 5J8FA 4E7LA 3OSGA 4OIOF 1AA7A 5KCMA 4M3FA 3F6VA 3E1SA 3CJRB 3PQJA 4EATA 2G7HA 2DA6A 4YIFA 3MKWB 2DA7A 2OUMA 4ZTFA 3F72A 1ZAOA 3KIOA 1MBFA 2E34A 3OYHA 3B73A 1WPKA 1X1CA 1VI0A 5D6FA 4CZZA 1BIAA 3BR1A 1JTYA 2DMPA 4HDVA 4IHVA 1YG2A 3CP8A 2FNPA 2EFPA 2DK8A 3M8FA 5EYRA 4A3EJ 4IHSA 3NRVA 4EVIA 3F21A 3H9JA 5E79C 4Y13A 5LHHA 1QBJA 1UJ8A 3M8EA 3K70C 2L4AA 1Y8QB 1I1SA 4HV6A 2OV7A 2ZFUA 3KE2A 1LQ1A 1HOMA 2E5NA 1VZ0A 3MKLA 2V1XA 3ASOH 4IHTA 2LNBA 4CCMA 5HLHA 5DUIA 4U88A 5IOYA 2JRMA 1B4AA 4MFDA 4A0YA 2NAZA 1KYWA 5BMZA 4A3KJ 2Z5UA 3DPLC 5JI6A 1T8IA 2NVXJ 1ON1A 3G73A 1W7PD 3CCJI 4CCKA 2LP0A 3RJPA 3WHBA 2A5WA 1LVAA 5K7HA 1IN4A 4AYBA 1OKRA 3ZQGA 2M30A 2XIGA 2DBBA 3LA3A 3BOQA 1V5FA 2VPRA 2ECBA 3BJAA 2ZNZA 5AIPA 1LFUP 2NNNA 3RI4A 5GADJ 3HRSA 1HSJA 3F9KA 3ROUA 3L2CA 1JKOC 2X1CA 4FX4A 2KL4A 1OPCA 1Y0NA 3GF2A 1JJ8C 1IGNA 4B47A 1MMNA 1FMVA 4W1UA 1BOAA 2R7RA 1XDUA 1ZQ3P 4RM3A 4IPAA 1VQ4I 2W85A 4IRIA 2GOMA 3QYFA 3ML6A 3WTUC 3M07A 1XC5A 4JX5A 4P5OA 3S3MA 2NVQJ 3SDGA 2L3DA 3O3KA 3CCRI 4QPQA 4DW6A 2KT0A 3W2VA 1X4PA 2PMZN 2LF8A 5EDNA 2Y69H 4OOIA 4BQQA 2BXZA 2LFBA 1UAAA 1FOKA 4E70A 3CJQB 3NWSA 3BC8A 3M9AA 5BPIA 2R5ZA 2F4OB 2R7SA 3F0CA 2UV1A 4A0XA 2KZGA 3RTRA 3ZCOA 4C3HJ 2Y30A 2GQQA 2PMUA 2WAEA 3WGIA 2F48A 2NXNB 3ECHA 3WU1B 5FRNA 5ICFA 2E1OA 1ETVA 1QO0D 4AUXA 4ZH4F 3PSIA 3JRHA 4A3BJ 1D8JA 3GFIA 1B72B 2E60A 2D45A 2K9LA 4N4NB 4XRMA 3P9IA 4UUTA 1MMAA 3MD2A 3L2WA 5CVJA 2A05A 9ANTA 3OYNA 4CO8A 2IS4A 1O7FA 2JUGA 2DTZA 3FMQA 3Q5FA 4RS8A 1YLFA 2VKDA 4B3AA 5FGMA 3B02A 2K5CA 3BG5A 3QPSA 5HLGA 3D5RC 3RKQA 4DNCA 3AG4H 1T08B 2W84A 2OF7A 4N4OB 1TT0A 5GTIC 2R92J 4HZFA 1TC3C 4XR6A 5F1JA 1G3SA 3GYHX 2EZHA 3B6AA 4OWRB 3KLNA 1MKMA 4ZJZA 1FYLA 2LF7A 3MFKA 4G6DA 4ZZDA 1LDJA 3FDYA 1JUSA 2IGNA 2WY7Q 2OZ6A 1WRJA 2HU9A 3I4PA 2NYXA 4F91B 3FMSA 4EJTA 2OC6A 3S1QJ 2DLLA 4O5VA 4U0VA 3PUBA 2GXGA 4W97A 2KZVA 3DCFA 2E2HJ 1X1BA 2LKPA 2ETHA 3C18A 5HDGA 2CQ7A 3QOPA 5DCFA 4OAYA 3TP0A 2FJ1A 4HYEA 4PCQA 3RPQA 1QNTA 2O0YA 1IN8A 1JKQC 3WE2A 3R60A 1FY7A 2GAUA 4LD5A 1HXDA 3TL4X 4F55A 3IRRA 2OU2A 2X48A 2VI6A 3DTEA 1OCCH 2LBFB 2FX0A 2STTA 1ZYRF 2HR3A 3S17J 1FP2A 4HEA2 1Z0XA 1VQ9I 1EH6A 3K4KA 3OIQA 1QVUA 4RM2A 4AWXB 3WTYC 2N8GA 2HOEA 3SZTA 2E35A 2A07F 3CMEI 3DU5A 3HOUJ 2M0MA 1S29A 2PJRB 3MVPA 3WTXC 4PJNA 2HTSA 2VC0A 1P4XA 4ZYAA 2DOEA 1W5CC 2EA4A 2FF4A 4U7DA 1U78A 1J75A 4KITB 4RLQA 2ECCA 3E7LA 1FZPB 1MDMB 1JXSA 1YITI 3QYEA 2VODA 4EJOA 2MABA 3HSEA 5E3NA 4PDKA 1HSTA 1TWAJ 2UWMA 2HVRA 3I3LA 1PUEE 2HGCA 3BTJA 3B6CA 2VQGA 5E8IA 2V26A 1HBXG 2HZTA 1SMTA 1BC8C 2VOOA 5GTHC 3W2AA 2M4KA 3TOBA 3E6DA 1LJ9A 2PX9A 4ZDPA 1WVRA 5FLVA 3HOWJ 2XV4S 4KT5C 4P9UA 3GFLA 4BDYA 2IS1A 2XPWA 2HEOA 1FTZA 3S16J 2P4WA 3CCUI 3WODF 3S93A 1O7LA 4DJAA 2CFOA 2Y31A 3W2WA 4EJWA 1SD5A 1RI7A 3H5NA 3BP8A 3WGHA 2UZKA 2HOAA 3J80Z 4A69C 2Q0OA 3H1CA 3JCUC 3I64A 1JT0A 2R93J 2DA4A 2W4SA 5E3LA 1VQOI 4BBSJ 3FX3A 2MBFA 3E5XA 2L54A 4D5CA 3FXUA 1DDNA 1DQUA 2BY1A 2YS9A 4LITA 3KEYA 3VSLA 5JHUA 2G0EA 4M71A 4D0PA 3MKYB 3FXJA 3C7JA 1RNLA 2VT2A 1B72A 1MBEA 2Y9YA 3A1YA 1I3QJ 1A6IA 1JUMA 5J6XA 4A3GJ 3DBHB 3RDIA 4KA4A 2F5FA 4MIMA 4HNTA 1F36A 3JRGA 1DPRA 3SEZA 5ERIA 2QENA 2R5YA 3LAPA 2BOLA 2HFHA 2HZDA 3QWLA 1LB2A 4I09A 3KP7A 1KU7A 1P7IA 2Z3YA 2HWVA 3AFHA 1E3OC 4DQ2A 3GEZA 1I39A 4YFNF 5CVIA 3IHUA 2P8TA 3V42A 1X58A 1S8NA 2AQEA 2HXOA 3FZVA 3DEUA 1O3TA 4HQEA 3U2RA 5GAEJ 3E5QA 1F43A 2ZCWA 4BEHB 4XM3A 3VDXA 1GV5A 1ULYA 2HYJA 3IV5A 5KK1A 2Y0MA 3ABLH 3COAC 5F64A 2DJIA 1OCOH 4E4HA 5K7ZA 3LSRA 3PO3J 1T2KA 3ZOBA 3KFWX 3UR3C 2KRCA 3GTJJ 3EETA 3GUDA 3S1NJ 4LJZF 2O8XA 3HC7A 1W1WE 1X1DA 3M8JA 3DKWA 5FKOA 3HTUA 3IAM2 1T38A 3S8PA 1MSFC 1O3RA 3T0YA 2K9MA 4YIIA 2M7AA 2RKHA 3CMMA 3GZ6A 1K4TA 1ODDA 5H20A 1D0YA 3JR9A 3OWTA 2YR2A 3GCMA 2W1OA 1KA8A 5F0CA 2KJCA 4IX7A 5AIQA 4U0WA 3L2RA 2QSFX 2LBFA 1USSA 5EZGA 3AG3H 1VQPI 1FOYA 4Q47A 3H0GJ 1BC7C 3RPUD 3CDIA 3N05A 2W24A 1QRYA 4D5FA 3MZHA 3OS2A 2FE3A 1DU6A 4CSWA 2PJRA 1VQ5I 3L9FA 1G59A 5FROA 4XICA 4DGWB 1HDDC 1SD4A 2XB0X 2H6CA 2CQKA 3WHCA 1FX7A 3VYTB 3DPTA 1MDMA 4M72A 4ENMA 2HPIA 2F5VA 2RN7A 3OYBA 1FMWA 1R9TJ 3PSFA 2LVSA 2VKHA 2QBYA 2AO9A 3OL3A 5ILUA 1QZEA 5KHDA 3BR5A 1K4SA 4ZYEA 2QUFA 4PSWA 3TO9A 2MA3A 4EGYA 1ZLKA 4M9ZA 2MFZA 1Y1VJ 2F2EA 1BIBA 1ZR2A 1WHUA 1Z3XA 1CF7B 3HJEA 3PNYA 3MMYB 3BR2A 4FQGA 3KP4A 1BA5A 1R23A 2ESNA 2GBYA 5J1YA 3H3VK 4A3CJ 2CV2A 4EJUA 2X6YA 3HIFA 2RQPA 3HRUA 2CWEA 1JUPA 1UCRA 3K1MA 2VJ5A 1UB9A 3OYFA 3VODA 5EG0B 2RNJA 1UELB 4IHXA 5BNGA 1FSHA 4IHYA 1T98A 1ZGAA 2WAQN 2XKPA 4KDPA 5LGNA 1EF4A 2R7UA 1ZR4A 1VQLI 2EILH 2IBDA 4XONA 4ENNA 4FTHA 1UHWA 3LFUA 2D2WA 4OINF 3W3CA 3HOSA 2L9NA 4CZCA 3DWLE 2M1BA 2DA5A 4RGRA 2HPMA 1IN7A 2DFFA 3RYPA 1TNSA 3CCYA 3QAHA 1IN5A 1EJ9A 4XKWA 3JRBA 3BROA 2BVLA 2Y48A 2M87A 3O6BB 2OA4A 3PUFA 3S14J 3CCMI 1Z77A 2WWYA 3BR6A 4H4KC 2FEZA 3AKZA 1VFCA 2ZB9A 5ILSA 2QGUA 4IVNA 5CKTA 1YIOA 2MYSA 1YW8A 5LGUA 3VYUB 4BUPA 1UHMA 5J40A 1K6OA 1HKTA 1JT6A 2VBYA 4M3EA 4UHTA 3G4SI 3IAS2 1U2WA 4XLPF 3K70D 3IL2A 4BEHA 3OIPA 2LYCA 2DYSH 3J80K 4EEFG 2ADUA 5D5XB 4UB8C 2O7OA 4A93J 5C4XJ 1SFKA 1JKPC 1GDTA 4MGRA 1QHGA 2VIXA 2WV1A 1XCBA 2ZXWH 4L5EA 1H9TA 4XLNF 4ZC3A 5F08A 4S0HB 2RVCA 1MJAA 4A3JJ 4HA8A 1I6HJ 1V5GA 4A6DA 5EEAA 2A68F 2IS2A 2CV1A 1XGOA 3ABKH 4J19A 5L3CA 3S2WA 4XNFA 4HLXA 2DODA 3E3VA 4B3XA 2L2OA 4H0EA 4BE1A 1TLHB 4HDUA 3T8RA 2DA3A 2P5VA 3VFZA 5EGOB 3OYJA 4Y52J 3LMMA 5EEGA 3Q0UA 2R7TA 3RKWA 1VQKI 3GXOA 2YUSA 3WG9A 3DPUA 1XSDA 1CQTA 1FIAA 2VJIA 3Q0WA 5K1YA 4AIDA 1X1AA 2X9DA 5D8LB 2A3SA 2VPLA 5JHFA 1R6RA 1SVOA 2NVUB 1WJEA 3BZCA 1FC3A 1G4DA 2P5LC 3RKYA 3LAJA 1NTCA 4RB0A 5K5RA 3AAFA 1V54H 3SDBA 3TMOA 3WG7H 3K9TA 4G7HF 2I10A 2WADA 1G3YA 4P96A 2Y9ZA 5AONA 1RKTA 3ABMH 5DD4A 1BJZA 1XS9A 3HSFA 3PFYA 2PQ8A 2JPCA 2IXSA 4N0BA 1RRJA 5IOZA 1S9HA 2KQRA 3LFKA 5FO5A 3K6GA 1MJBA 2OZUA 3VYSB 3CD6I 3OYMA 1MNDA 1CF7A 1NK3P 2PI0A 3BQZA 4HF2A 4DYRA 3FXMA 2H94A 3H9QA 3I4MJ 3DBRB 2P5KA 4BY1J 4HF1A 2BY0A 2XAGA 5FKKA 4RAZA 3HOYJ 4C30A 1BN5A 4PJJA 1YO5C 2H6BA 3CCVI 5BOXA 3BJOA 4MLOA 2Q8KA 1OQYA 5M3MJ 1S7OA 1X19A 2K3FA 1VQ8I 1TWCJ 2JJ7A 1BW6A 2ME6A 4IEJA 1IV8A 2JA8J 3ELKA 4L5IA 3K2ZA 1L3LA 2DK5A 3OR1C 1R5GA 1BI3A 1J59A 1IO2A 1E2XA 1GXQA 2F5CA 2PG4A 4L9NA 1S3JA 4Y15A 3FM5A 2P7CB 1UHSA 2HYFA 2QF7A 1V5EA 4EQQA 4AIHA 1XSVA 5ICGA 3CLQA 5FKMA 1WJDA 2HDCA 3TGNA 2WA0A 2WAFA 1MNMC 3RPUA 3U1KA 4HOBA 4I76A 1PP7U 2DFHA 5LRSA 3VEPA 2JT1A 3MN2A 4C2MJ 1H0MA 3R6SA 3ZRGA 1ZH5A 2CRGA 2CJJA 2DMQA 2QQ9A 3GTOJ 1XMKA 3HUGB 1ZREA 6PAXA 1NG6A 1QPIA 2IEKA 2HTJA 2L7MP 4P9FA 1FYKA 3OYDA 2E7XA 3L2UA 4XRSA 2A69F 2M2EA 3I5UA 2QLZA 4CCJA 2ELHA 1A35A 3JRCA 1KU2A 4HF0A 2E19A 3FK7A 4V2GA 1YRNB 1TNTA 5DTDA 4YFKF 1QGPA 3KEOA 3GTPJ 5J1UA 2EV6A 3NWTA 3IH2A 5HDNA 2JRTA 3AG2H 4KFCA 2A6HF 3OOUA 2OQRA 4BU2A 2P6SA 3DFGA 3IH3A 5IPAA 2LOOA 2K3PA 5J3LA 1LKXA 4FX0A 3FISA 3FIWA 2EK5A 3MZ8A 5E18F 4EM0B 2M8EA 1XDSA 2Y0SN 5E1ZB 4HSRA 2NS7A 3BCBA 5EGOA 1SC7A 2VONA 5E1WA 2COBA 2EV0A 2VKVA 2X85A 2CW8A 2FOKA 2HQRA 5JR3A 2L4MA 1XMXA 3LL7A 2DU9A 5D4RA 1X1PA 1MBGA 3D5SC 4GGGA 2KRHA 2Q2EB 4DIQA 4UUVA 3JTHA 3W6JB 1P4WA 2PLYA 3R0AA 3R4KA 3CDHA 5DS9A 3HL2A 2VQLA 3H92A 1IRGA 3Q9VA 1KQ9A 1R22A 4EM1A 3S1MJ 2EIMH 2K02A 2PN6A 1Z6RA 1BOBA 4QLCU 2Z16A 4ASNA 3O8HA 4GDFA 2ZXIA 1E0EA 4WXHA 1R00A 3BTIA 4PFOA 5ICEA 3PIPF 3A4CA 1ZG1A 3PJRA 1PP8F 4ZZLA 4OIPF 4AVPA 1LFPA 3JRFA 2DXIA 1MH4A 1X3ZB 3ABUA 4TV7A 3F8MA 3BY6A 4G94A 3S3NA 2DW4A 4AIJA 1O4XA 3HRTA 3CUQB 2DJNA 4A3LJ 1WJFA 1ZARA 2ZO4A 1FWZA 4ESBA 1XG1A 1QU3A 2EFNA 4LK1F 1DGRM 1U0JA 3RQ4A 5EF6A 3FKJA 1FP1D 2EIKH 4KN7X 2CW0F 4JK1X 4IRGA 1ERDA 4GO1A 2VJJA 4G7ZF 3QPTA 2A5YB 2JUCA 3E97A 3OYAA 4XBFA 1IG7A 3AG1H 1YJNI 1J7KA 2GIZA 1A6QA 1FOXA 4LGWA 2X6WA 1AHDP 3DQVC 3K7AJ 4BHBA 3GO5A 2FU4A 5CVVA 2HQAA 4Q4ZF 1LUJB 2LSOA 3OYGA 4NQWB 4A0ZA 2EZKA 4FE7A 1SFUA 1KU3A 2YU3A 4BNCA 1YHQI 4IJAA 2XB5A 1EKEA 2GWRA 1PVEA 3ERED 5HOOA 2CUFA 2EA2A 1HKSA 1MW7A 4LOCA 1VQNI 5TGTA 4ZYDA 1T6SA 4BE2A 4E7HA 3K1PA 3NQOA 1A31A 5IT9Z 5LBQA 1T39A 2ZXJA 4S04A 2KDOA 3QU6A 1OLTA 3GLLA 4C3IJ 4F93B 2BW3B 1H89C 4GRIA 3F22A 3CUQC 3KX2A 2VE9A 3WU2C 5FLMJ 2BYVE 2QSGX 1E3PA 2MH9A 1AU7A 4U7BA 3CF2A 3SFZA 2DT5A 3G71I 1PDNC 2CMPA 3LOCA 2R4GA 3HUGA 4FCYA 2KISA 3ESWB 1RKWA 2UXXA 2E2IJ 1XD7A 1SFEA 1R58A 3P9KA 4BJTA 1WQ2A 2QSHX 3DTIA 2L9RA 5C3EJ 3G3ZA 2ID3A 5HLIA 3BPVA 1T95A 4V19K 1Q1HA 3FF5A 5B3SH 1OR7C 1WJ5A 2WBMA 3HEFA 3ISPA 4KJZA 2XGDA 4E7ZA 4UUSB 1YRNA 1B59A 2DMUA 2RV8A 2M8GX 4V2FA 4G12A 2PFBA 3LSGA 5D4SA 4IOAF 1U8BA 5GAHJ 3SZGA 2F5DA 2WB1N 2CQQA 4M3BA 2GA2A 5HNFA 4BE0A 5FLXZ 5F04A 2ESHA 4ESFA
chains in the Genus database with same CATH topology
1EH8A 2HKOA 5DEQA 1BBYA 1B9MA 1XMAA 3T1BA 4RGXA 2K86A 1YTYA 4I98B 4EV0A 3M7GA 4B8XA 5DDGA 3TKYA 3WU0A 2Q2EA 1IAWA 4WXCA 2O03A 5CJ9A 2CGPA 2DFIA 4O6JA 3VOEA 1HW2A 4B09A 3KLOA 3L09A 1REPC 4MNUA 4I01A 2K4BA 2XAFA 4XSZF 2EWNA 1ZN2A 3N97A 3CUQA 3J81Z 1U3EM 3PQKA 1LEBA 1JHFA 1ON2A 2VE8A 4N9HA 1FT9A 2L01A 5F6FA 3GZ5A 4A2UA 2BGCA 2VN2A 2L02A 3H3ZA 2EV5A 1SMYF 2NS0A 1OR7A 2IA2A 3RKXA 4CYDA 1UFMA 2X0LA 1Z9CA 2ACJA 1IXRC 3F8FA 1VTNC 4YFXF 4WX9A 4KMUX 2H27A 4LFUA 5DCMB 3KP5A 3K69A 2KJBA 3P7NA 3BPXA 4CXFA 1IXCA 2K7LA 3WTZA 2OD5A 2QWWA 4WXDA 2EFOA 4OMZA 4GYGA 1SFXA 3GFJA 1IN6A 4LMYA 1GVJA 3VB2A 3HTSB 2MD5A 3TDZC 2AXLA 2R7DA 2YX7A 1TBXA 1G6NA 3ABTA 1W5TA 4WK8F 4MTDA 2QQAA 3LQQA 4UXNA 4M6XA 1ONVA 1OMIA 1F5TA 3FXQA 2A61A 1Z05A 2VBWA 5IT9K 2DQRA 2DAOA 4ENKA 2FMYA 1R1VA 4ON0A 5L3EA 5E8GA 1BJAA 3KZYA 3CLOA 1GXPA 4BHCA 4I2OA 1RZ4A 5EEHA 3HYIA 3OOPA 3I54A 4Q48A 3T5XA 3FMRA 5FD6A 2G9WA 2EFQA 1RIOH 5E20A 4EJVA 4NHJA 4QWQA 4YG2F 1WWXA 3E6CC 3ZQ7A 2MLKA 4ESJA 2VC1A 4BQAA 3MCZA 1S6LA 1YQAA 1FPQA 2XVCA 4KICA 3IKTA 3KP6A 3E5UA 1XGSA 4L9VA 1Y0UA 5E17F 2BV6A 5FLXK 3SHFA 3DP7A 4FHTA 2FXAA 3FWEA 1USTA 1J2XA 4WF2A 1TW3A 2XUBA 2RGVA 5L3BA 3JTGA 2D1VA 5L3GA 4BH9A 4KIGA 3JSOA 1YS7A 1ZG3A 3H3UA 4PZJA 4OU0A 1MD0A 1XN7A 4WCGA 3HSRA 4CGZA 1I27A 3KEQA 4A5NA 4L9TA 1B9NA 5TJJA 1IUYA 4R1HA 5CVRA 5DCMA 4L5JA 4KYWA 4WWCA 4HQMA 3J81K 4L9JA 4XSXF 3ZMSA 5BS6A 2E1CA 3L7WA 1R7JA 3MZYA 2DO7A 3REOA 4KIBA 4CHUA 3WTVC 1D8KA 3LWFA 1R36A 1L0OC 1P2FA 5KVRA 2KIMA 5DV5A 2LDUA 1GHCA 3L00A 2QQBA 2KIFA 1V3FA 3V4GA 3J7AO 1P6RA 5HS8A 4OIQF 4BAYA 1R5HA 4ZYHA 3GW2A 1KGSA 5FD5A 3LSTA 4PGHA 1J5YA 3KZZA 1YS6A 4I0BA 2Z99A 5J8CA 2RDPA 4AIKA 1ZGJA 3F6OA 1FNNA 3GWZA 1AWCA 1P92A 2O6GE 4RB3C 4JBAA 2W25A 2Y75A 2XROA 4CICA 2ZNYA 1IF1A 5K5OA 3GVAA 4UVCA 1V4RA 4UNOA 1YFHA 4S05A 1KYZA 3TO7A 3M1EA 2ISZA 1W5SA 2PMHA 4G6QA 3I53A 1LDKB 2A6EF 4R8HA 2QZ8A 3IWFA 1K78B 3WTWC 3EYYA 3IWZA 2HS5A 1HW1A 4UV8A 2GA1A 1S7AA 2ZBKA 1ZRDA 1YYVA 5LLQA 1BI0A 1FYMA 3JSPA 5DYMA 3CJNA 5TRDA 2QM3A 1XGMA 3F3XA 3LQRA 2DI3A 2XHKA 2CO5A 4G9YA 2FNAA 1WSUA 1G3TA 5ILVA 3U9GA 4KUMA 1J0RA 2IJLA 3IRQA 1K7AA 4Y17A 5FB2A 1ZHFA 5LHIA 2B0LA 2FBHA 3V8JA 4Q5SF 5L3DA 4EM2A 3V7CA 3ULQB 5FFZA 4G7OF 2XGXA 1RUNA 2M5WA 4HBLA 1J9IA 2YX4A 1LNWA 3BZ6A 2JSCA 2ZFWA 4A6EA 2ZJ2A 2YSRA 1XCVA 3NEUA 3N4MA 2JTVA 4HX8A 1FSEA 2EB7A 2O61A 3ZMTA 3OV8A 3WTSC 2DQLA 3KP3A 4PGGA 3I58A 2KIUA 5LEJA 3K1NA 2RC4A 5ED4A 3BDDA 1SAXA 5D5UB 3V8KA 3QU3A 4R79A 1JE8A 4NB5A 1K79A 1MGTA 3F8CA 5CVUA 3F8NA 1OYYA 3DF8A 2VBXA 1P4AA 3HHHA 5IT3A 4MQ9F 4RGSA 3CO7C 3C3WA 5LHGA 1FBSA 3ZMZA 2BE5F 4LK0F 2V1DA 3SQNA 1FLIA 1K78A 4MTEA 2IA1A 2YPRA 3V8LA 2JZYA 1W7PB 2QVOA 1F1ZA 2X4HA 5HVQC 2FSWA 4UV9A 2NNYA 1U5TB 3CTAA 3ZMUA 2PEXA 2FBIA 1TW2A 3EQLF 4GXOA 3D0SA 4RB1A 2MLGA 2CSOA 2XAQA 3QRFF 4M74A 3DV8A 1MZBA 3TQNA 5A2QZ 1CGPA 2W57A 1R1UA 4P55A 4BHPA 1JGSA 3EDPA 1H9GA 3SZPA 2XAJA 2PBIA 2VBZA 2WV0A 2XRNA 2G7UA 5H6RA 1XB4A 1XGNA 4O3MA 2DPUA 3ECOA 4OMYA 1QZYA 1TQIA 3BWGA 1STZA 3KP2A 2OQGA 3F23A 1TQMA 4M9XA 4KN4X 4MEYF 1U5TC 2XAHA 4M6YA 4EMSA 5HS7A 3ZMDA 2KKOA 5K5QA 3GFMA 4G8XA 1WI9A 2HKXA 2XASA 5HDKA 2CG4A 4L0ZB 1HW5A 3GX4X 2QBYB 2FMLA 2MC3A 3ZPLA 1I5ZA 2IPQX 1ZG5A 5D5VB 3GLXA 2WTEA 4HV5A 2EJRA 4UVAA 4KNYA 2K4JA 3F8BA 3LA7A 1U6GA 1ZRFA 4U0YA 1F9NA 3QPHA 1B1BA 1WKMA 1FBUA 1X3UA 3U1DA 4LLNA 2GIVA 5CYVA 5BPDA 3WGGA 2P6TA 4GCVA 1OYIA 3MQ0A 1AOYA 3JAMZ 5LEKA 4CDGA 1YW9A 2C6YA 5JFRA 4A12A 1LEAA 4ENJA 4NQWA 3HOTA 2H09A 3TDUC 1DPUA 4L0YB 4HX7A 1C0WA 3KETA 2VT3A 2R7FA 1T0FA 3ZP5A 3JW4A 4A5MA 1F4KA 1XSXA 4IF4A 2M45A 4Z2YA 4UVBA 3HHGA 1I1GA 4KIFA 3MWMA 1W7PA 5L3FA 2GXBA 3D5LA 5D5WB 2VXZA 2JPBA 3TOAA 3I59B 1U5TA 4M73A 1KU9A 4I7HA 2J5PA 1B6AA 3EYIA 1DP7P 1FBQA 4RGUA 4N9IA 2NRAC 3WTTC 2ZMEB 5D6EA 2V9VA 1IXSB 1SD6A 1SD7A 2OBPA 2OAZA 2IRFG 2IA0A 1D3YA 4JQFA 3FXRA 2CYYA 3DXJF 4GYIA 3E6MA 2K27A 4LG0B 5ICCA 2HQNA 4AD9A 5CLSA 3KCCA 1TTYA 1U8RA 2O3FA 3V7SA 2STWA 3I0TA 1IZ1A 2V1UA 1EV7A 3Q9SA 5JVTA 2IP2A 1A04A 3W6KB 1O3SA 2AS5F 5F1RA 4LLLA 5A2QK 2MH2A 1KQ0A 3P9CA 1O3QA 2Z33A 2UXNA 3R61A 1BM9A 3R0JA 1JHHA 3QP6A 1YW7A 2TDXA 5LGTA 5HS9A 2FQ3A 3E6BA 1TQPA 1Z7UA 2J5OA 3MAJA 5DUKA 2IW5A 1I6XA 2R3SA 3WE3A 3CO6C 4BYYA 3O2PE 4RAYA 3TO6A 2Z9OA 1ZLJA 1O57A 4HLYA 1ZRCA 3RYRA 3EUHA 4MHGA 1BI2A 1E17A 5E1XA 4FT8A 2KRFA 2V6CA 3LA2A 5D8KB 3IKVA 4KMFA 4I0AA 1D5VA 1KQ8A 4OIRF 2FA5A 1QZZA 2HYGD 5LRRA 3FHZA 1QQIA 1W4MA 2P7VB 5FFXA 3I59A 1QPMA 3IC7A 3MEXA 1R1TA 2WC2A 3T8TA 2FBKA 1Z1DA 4HX4A 2F5EA 2BEOA 2IT0A 3CUOA 2ZMEA 2E1NA 4XRFA 2EFWA 1EH7A 3JAMK 1BI1A 4RB2C 1MJ9A 3BJ6A 3V7RA 2V79A 2COMA 2VOPA 1HQCA 2E7WA 5DD8A 4IRHA 2IVMA 2PJPA 4LG0A 4EGZA 3ZN0A 3I71A 2CFXA 1HKQA 2DPDA 2QYOA 2ZKZA 2XKOA 2BBYA 2DTRA 4I02A 4L18B 3ZN1A 3K0LA 2D1HA 3HRMA 1G3WA 4MEXF 3SXYA 4LB5A 4ETSA 4LLGF 4LB6B 2ESHA 5H6QA 1DUXC 1LDDA 4HAMA 1RUOA 1Z91A 1IRFA 3ZMVA 1Z6TA 5BQTA 4F7ZA 3RIRA 4BXUA 4ZYGA 2FRHA 2ISYA 2GZWA 1NHAA 3QP5A 3FM3A 1OYWA 4IXAA 3PFIA 4M9SA 4HW0A 1IW7F 4MQVA 4OIOF 3C1DA 5J8FA 4K2EA 3F6VA 3PQJA 2G7HA 4YIFA 3F72A 1ZAOA 3B73A 5D6FA 4CZZA 1BIAA 4HDVA 1YG2A 2FNPA 2EFPA 2DK8A 3M8FA 4IHSA 3NRVA 4EVIA 3F21A 4Y13A 5LHHA 1QBJA 3M8EA 2L4AA 1I1SA 4HV6A 1LQ1A 3KE2A 2V1XA 4IHTA 2LNBA 5HLHA 5DUIA 4U88A 1B4AA 4A0YA 2NAZA 1KYWA 5BMZA 2Z5UA 3DPLC 5JI6A 1ON1A 3G73A 1W7PD 3RJPA 1LVAA 1IN4A 1OKRA 2M30A 2XIGA 2DBBA 3LA3A 3BOQA 3BJAA 2ZNZA 5AIPA 2NNNA 3RI4A 3HRSA 1HSJA 3ROUA 3L2CA 4FX4A 1OPCA 3GF2A 1BOAA 1XDUA 4IPAA 2W85A 4IRIA 3ML6A 3WTUC 4P5OA 2L3DA 3O3KA 2LF8A 4OOIA 1FOKA 4E70A 3M9AA 5BPIA 4A0XA 3RTRA 2GQQA 2PMUA 3WGIA 3ECHA 3WU1B 5ICFA 1QO0D 4ZH4F 1D8JA 3GFIA 2D45A 3P9IA 5CVJA 4CO8A 1O7FA 3FMQA 3Q5FA 4RS8A 1YLFA 5FGMA 3B02A 5HLGA 4DNCA 2W84A 4HZFA 1G3SA 3GYHX 3KLNA 1MKMA 1FYLA 2LF7A 3MFKA 4G6DA 4ZZDA 1LDJA 2OZ6A 1WRJA 3I4PA 2NYXA 3FMSA 4EJTA 2DLLA 4O5VA 4U0VA 2GXGA 2LKPA 2ETHA 3C18A 5HDGA 3QOPA 5DCFA 4HYEA 4PCQA 3RPQA 1QNTA 2O0YA 1IN8A 3WE2A 3R60A 1FY7A 2GAUA 4LD5A 1HXDA 3IRRA 2OU2A 2STTA 1ZYRF 2HR3A 1FP2A 1EH6A 4AWXB 3WTYC 2HOEA 3SZTA 2A07F 1S29A 3WTXC 2HTSA 2VC0A 1P4XA 2EA4A 2FF4A 1U78A 1J75A 4U7DA 1FZPB 1MDMB 1JXSA 2VODA 4EJOA 3HSEA 4PDKA 1HSTA 2UWMA 1PUEE 2HGCA 5E8IA 1HBXG 2HZTA 1SMTA 1BC8C 2VOOA 3TOBA 3E6DA 1LJ9A 2XV4S 4KT5C 4P9UA 3GFLA 2HEOA 2P4WA 3WODF 1O7LA 4EJWA 1SD5A 1RI7A 2UZKA 3BP8A 3WGHA 3J80Z 2Q0OA 3I64A 3FX3A 2MBFA 3E5XA 2L54A 3FXUA 1DDNA 5JHUA 4M71A 4D0PA 3C7JA 1RNLA 2VT2A 5J6XA 3RDIA 4KA4A 2F5FA 1DPRA 5ERIA 2QENA 3LAPA 2HFHA 1LB2A 4I09A 3KP7A 1KU7A 2Z3YA 2HWVA 4DQ2A 3GEZA 4YFNF 5CVIA 3IHUA 2P8TA 1S8NA 3FZVA 3DEUA 1O3TA 4HQEA 3U2RA 3E5QA 2ZCWA 1ULYA 5KK1A 2Y0MA 3COAC 5F64A 1T2KA 3KFWX 3EETA 3GUDA 4LJZF 2O8XA 3DKWA 3HTUA 1T38A 1O3RA 3T0YA 4YIIA 2RKHA 3GZ6A 1ODDA 5H20A 2YR2A 1KA8A 2KJCA 5AIQA 4U0WA 1USSA 4Q47A 1BC7C 2W24A 3MZHA 2FE3A 3L9FA 1SD4A 2H6CA 2CQKA 1FX7A 1MDMA 3DPTA 4M72A 4ENMA 2RN7A 2QBYA 5ILUA 4ZYEA 2QUFA 4EGYA 3TO9A 2MA3A 1ZLKA 4M9ZA 2F2EA 1BIBA 1CF7B 3KP4A 1R23A 2ESNA 4EJUA 3HIFA 2RQPA 2CWEA 3K1MA 1UCRA 1UB9A 3VODA 2RNJA 1FSHA 1T98A 1ZGAA 4KDPA 2XKPA 5LGNA 4ENNA 1UHWA 2D2WA 4OINF 3HOSA 2M1BA 4RGRA 1IN7A 3RYPA 1TNSA 3QAHA 1IN5A 3BROA 2Y48A 2M87A 3O6BB 2OA4A 2WWYA 2FEZA 5ILSA 4IVNA 1YIOA 1YW8A 5LGUA 1UHMA 1K6OA 1HKTA 2VBYA 4UHTA 4XLPF 1U2WA 3IL2A 3J80K 2ADUA 5D5XB 4MGRA 1XCBA 1H9TA 4XLNF 2RVCA 1MJAA 4HA8A 4A6DA 2A68F 1XGOA 5L3CA 3S2WA 4HLXA 3E3VA 4H0EA 1TLHB 4HDUA 3T8RA 2P5VA 3VFZA 5EEGA 3RKWA 3GXOA 3WG9A 1XSDA 5K1YA 5D8LB 2A3SA 1FC3A 1G4DA 2P5LC 3RKYA 3LAJA 4RB0A 5K5RA 3AAFA 3K9TA 4G7HF 1G3YA 4P96A 5AONA 5DD4A 3HSFA 2PQ8A 2JPCA 4N0BA 3LFKA 5FO5A 1MJBA 2OZUA 1CF7A 2PI0A 4HF2A 2H94A 2P5KA 4HF1A 2XAGA 4RAZA 1BN5A 1YO5C 2H6BA 5BOXA 3BJOA 2Q8KA 1S7OA 3ELKA 4L5IA 3K2ZA 1L3LA 2DK5A 1R5GA 1BI3A 1J59A 1E2XA 1GXQA 2F5CA 2PG4A 4L9NA 1S3JA 4Y15A 3FM5A 2P7CB 2HYFA 4EQQA 4AIHA 1XSVA 5ICGA 2HDCA 3TGNA 3RPUA 4HOBA 1PP7U 5LRSA 3VEPA 2JT1A 1H0MA 3R6SA 1ZH5A 2QQ9A 1XMKA 1ZREA 6PAXA 2HTJA 4P9FA 1FYKA 2E7XA 2A69F 3I5UA 2QLZA 2ELHA 1KU2A 4HF0A 1TNTA 4YFKF 1QGPA 3KEOA 2EV6A 5HDNA 2JRTA 4KFCA 2A6HF 2OQRA 2P6SA 3DFGA 4FX0A 2EK5A 5E18F 4EM0B 2M8EA 1XDSA 5E1ZB 2VONA 5E1WA 2EV0A 2FOKA 2HQRA 5JR3A 2L4MA 2DU9A 5D4RA 4GGGA 4UUVA 3JTHA 3W6JB 1P4WA 2PLYA 3R0AA 3R4KA 3CDHA 3H92A 1IRGA 3Q9VA 1KQ9A 1R22A 4EM1A 2K02A 2PN6A 1Z6RA 4QLCU 4ASNA 4WXHA 1R00A 5ICEA 1ZG1A 1PP8F 4ZZLA 4OIPF 4AVPA 3ABUA 4TV7A 3F8MA 3BY6A 4G94A 4AIJA 2DW4A 3HRTA 3CUQB 1ZARA 2ZO4A 1FWZA 4ESBA 2EFNA 4LK1F 4KN7X 1FP1D 2CW0F 4JK1X 4IRGA 4GO1A 4G7ZF 3QPTA 2A5YB 3E97A 4XBFA 1J7KA 4LGWA 3DQVC 4BHBA 3GO5A 2FU4A 5CVVA 4Q4ZF 2LSOA 4A0ZA 1SFUA 1KU3A 2YU3A 4BNCA 4IJAA 2GWRA 3ERED 5HOOA 2EA2A 1HKSA 4ZYDA 1T6SA 3K1PA 3NQOA 5IT9Z 5LBQA 1T39A 2ZXJA 4S04A 3QU6A 3F22A 3CUQC 2VE9A 2BYVE 2MH9A 4U7BA 3SFZA 2DT5A 1PDNC 3HUGA 2UXXA 1XD7A 1SFEA 1R58A 3P9KA 1WQ2A 3G3ZA 5HLIA 3BPVA 1Q1HA 3FF5A 3ISPA 1B59A 2RV8A 2PFBA 5D4SA 2F5DA 2GA2A 5FLXZ 3HRUA 4ESFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH8 A;  2HKO A;  5DEQ A;  1BBY A;  1B9M A;  1XMA A;  3T1B A;  4RGX A;  2K86 A;  1YTY A;  4I98 B;  4EV0 A;  3M7G A;  4B8X A;  5DDG A;  3TKY A;  3WU0 A;  2Q2E A;  1IAW A;  4WXC A;  2O03 A;  5CJ9 A;  2CGP A;  2DFI A;  4O6J A;  3VOE A;  1HW2 A;  4B09 A;  3KLO A;  3L09 A;  1REP C;  4MNU A;  4I01 A;  2K4B A;  2XAF A;  4XSZ F;  2EWN A;  1ZN2 A;  3N97 A;  3CUQ A;  3J81 Z;  1U3E M;  3PQK A;  1LEB A;  1JHF A;  1ON2 A;  2VE8 A;  4N9H A;  1FT9 A;  2L01 A;  5F6F A;  3GZ5 A;  4A2U A;  2BGC A;  2VN2 A;  2L02 A;  3H3Z A;  2EV5 A;  1SMY F;  2NS0 A;  1OR7 A;  2IA2 A;  3RKX A;  4CYD A;  1UFM A;  2X0L A;  1Z9C A;  2ACJ A;  1IXR C;  3F8F A;  1VTN C;  4YFX F;  4WX9 A;  4KMU X;  2H27 A;  4LFU A;  5DCM B;  3KP5 A;  3K69 A;  2KJB A;  3P7N A;  3BPX A;  4CXF A;  1IXC A;  2K7L A;  3WTZ A;  2OD5 A;  2QWW A;  4WXD A;  2EFO A;  4OMZ A;  4GYG A;  1SFX A;  3GFJ A;  1IN6 A;  4LMY A;  1GVJ A;  3VB2 A;  3HTS B;  2MD5 A;  3TDZ C;  2AXL A;  2R7D A;  2YX7 A;  1TBX A;  1G6N A;  3ABT A;  1W5T A;  4WK8 F;  4MTD A;  2QQA A;  3LQQ A;  4UXN A;  4M6X A;  1ONV A;  1OMI A;  1F5T A;  3FXQ A;  2A61 A;  1Z05 A;  2VBW A;  5IT9 K;  2DQR A;  2DAO A;  4ENK A;  2FMY A;  1R1V A;  4ON0 A;  5L3E A;  5E8G A;  1BJA A;  3KZY A;  3CLO A;  1GXP A;  4BHC A;  4I2O A;  1RZ4 A;  5EEH A;  3HYI A;  3OOP A;  3I54 A;  4Q48 A;  3T5X A;  3FMR A;  5FD6 A;  2G9W A;  2EFQ A;  1RIO H;  5E20 A;  4EJV A;  4NHJ A;  4QWQ A;  4YG2 F;  1WWX A;  3E6C C;  3ZQ7 A;  2MLK A;  4ESJ A;  2VC1 A;  4BQA A;  3MCZ A;  1S6L A;  1YQA A;  1FPQ A;  2XVC A;  4KIC A;  3IKT A;  3KP6 A;  3E5U A;  1XGS A;  4L9V A;  1Y0U A;  5E17 F;  2BV6 A;  5FLX K;  3SHF A;  3DP7 A;  4FHT A;  2FXA A;  3FWE A;  1UST A;  1J2X A;  4WF2 A;  1TW3 A;  2XUB A;  2RGV A;  5L3B A;  3JTG A;  2D1V A;  5L3G A;  4BH9 A;  4KIG A;  3JSO A;  1YS7 A;  1ZG3 A;  3H3U A;  4PZJ A;  4OU0 A;  1MD0 A;  1XN7 A;  4WCG A;  3HSR A;  4CGZ A;  1I27 A;  3KEQ A;  4A5N A;  4L9T A;  1B9N A;  5TJJ A;  1IUY A;  4R1H A;  5CVR A;  5DCM A;  4L5J A;  4KYW A;  4WWC A;  4HQM A;  3J81 K;  4L9J A;  4XSX F;  3ZMS A;  5BS6 A;  2E1C A;  3L7W A;  1R7J A;  3MZY A;  2DO7 A;  3REO A;  4KIB A;  4CHU A;  3WTV C;  1D8K A;  3LWF A;  1R36 A;  1L0O C;  1P2F A;  5KVR A;  2KIM A;  5DV5 A;  2LDU A;  1GHC A;  3L00 A;  2QQB A;  2KIF A;  1V3F A;  3V4G A;  3J7A O;  1P6R A;  5HS8 A;  4OIQ F;  4BAY A;  1R5H A;  4ZYH A;  3GW2 A;  1KGS A;  5FD5 A;  3LST A;  4PGH A;  1J5Y A;  3KZZ A;  1YS6 A;  4I0B A;  2Z99 A;  5J8C A;  2RDP A;  4AIK A;  1ZGJ A;  3F6O A;  1FNN A;  3GWZ A;  1AWC A;  1P92 A;  2O6G E;  4RB3 C;  4JBA A;  2W25 A;  2Y75 A;  2XRO A;  4CIC A;  2ZNY A;  1IF1 A;  5K5O A;  3GVA A;  4UVC A;  1V4R A;  4UNO A;  1YFH A;  4S05 A;  1KYZ A;  3TO7 A;  3M1E A;  2ISZ A;  1W5S A;  2PMH A;  4G6Q A;  3I53 A;  1LDK B;  2A6E F;  4R8H A;  2QZ8 A;  3IWF A;  1K78 B;  3WTW C;  3EYY A;  3IWZ A;  2HS5 A;  1HW1 A;  4UV8 A;  2GA1 A;  1S7A A;  2ZBK A;  1ZRD A;  1YYV A;  5LLQ A;  1BI0 A;  1FYM A;  3JSP A;  5DYM A;  3CJN A;  5TRD A;  2QM3 A;  1XGM A;  3F3X A;  3LQR A;  2DI3 A;  2XHK A;  2CO5 A;  4G9Y A;  2FNA A;  1WSU A;  1G3T A;  5ILV A;  3U9G A;  4KUM A;  1J0R A;  2IJL A;  3IRQ A;  1K7A A;  4Y17 A;  5FB2 A;  1ZHF A;  5LHI A;  2B0L A;  2FBH A;  3V8J A;  4Q5S F;  5L3D A;  4EM2 A;  3V7C A;  3ULQ B;  5FFZ A;  4G7O F;  2XGX A;  1RUN A;  2M5W A;  4HBL A;  1J9I A;  2YX4 A;  1LNW A;  3BZ6 A;  2JSC A;  2ZFW A;  4A6E A;  2ZJ2 A;  2YSR A;  1XCV A;  3NEU A;  3N4M A;  2JTV A;  4HX8 A;  1FSE A;  2EB7 A;  2O61 A;  3ZMT A;  3OV8 A;  3WTS C;  2DQL A;  3KP3 A;  4PGG A;  3I58 A;  2KIU A;  5LEJ A;  3K1N A;  2RC4 A;  5ED4 A;  3BDD A;  1SAX A;  5D5U B;  3V8K A;  3QU3 A;  4R79 A;  1JE8 A;  4NB5 A;  1K79 A;  1MGT A;  3F8C A;  5CVU A;  3F8N A;  1OYY A;  3DF8 A;  2VBX A;  1P4A A;  3HHH A;  5IT3 A;  4MQ9 F;  4RGS A;  3CO7 C;  3C3W A;  5LHG A;  1FBS A;  3ZMZ A;  2BE5 F;  4LK0 F;  2V1D A;  3SQN A;  1FLI A;  1K78 A;  4MTE A;  2IA1 A;  2YPR A;  3V8L A;  2JZY A;  1W7P B;  2QVO A;  1F1Z A;  2X4H A;  5HVQ C;  2FSW A;  4UV9 A;  2NNY A;  1U5T B;  3CTA A;  3ZMU A;  2PEX A;  2FBI A;  1TW2 A;  3EQL F;  4GXO A;  3D0S A;  4RB1 A;  2MLG A;  2CSO A;  2XAQ A;  3QRF F;  4M74 A;  3DV8 A;  1MZB A;  3TQN A;  5A2Q Z;  1CGP A;  2W57 A;  1R1U A;  4P55 A;  4BHP A;  1JGS A;  3EDP A;  1H9G A;  3SZP A;  2XAJ A;  2PBI A;  2VBZ A;  2WV0 A;  2XRN A;  2G7U A;  5H6R A;  1XB4 A;  1XGN A;  4O3M A;  2DPU A;  3ECO A;  4OMY A;  1QZY A;  1TQI A;  3BWG A;  1STZ A;  3KP2 A;  2OQG A;  3F23 A;  1TQM A;  4M9X A;  4KN4 X;  4MEY F;  1U5T C;  2XAH A;  4M6Y A;  4EMS A;  5HS7 A;  3ZMD A;  2KKO A;  5K5Q A;  3GFM A;  4G8X A;  1WI9 A;  2HKX A;  2XAS A;  5HDK A;  2CG4 A;  4L0Z B;  1HW5 A;  3GX4 X;  2QBY B;  2FML A;  2MC3 A;  3ZPL A;  1I5Z A;  2IPQ X;  1ZG5 A;  5D5V B;  3GLX A;  2WTE A;  4HV5 A;  2EJR A;  4UVA A;  4KNY A;  2K4J A;  3F8B A;  3LA7 A;  1U6G A;  1ZRF A;  4U0Y A;  1F9N A;  3QPH A;  1B1B A;  1WKM A;  1FBU A;  1X3U A;  3U1D A;  4LLN A;  2GIV A;  5CYV A;  5BPD A;  3WGG A;  2P6T A;  4GCV A;  1OYI A;  3MQ0 A;  1AOY A;  3JAM Z;  5LEK A;  4CDG A;  1YW9 A;  2C6Y A;  5JFR A;  4A12 A;  1LEA A;  4ENJ A;  4NQW A;  3HOT A;  2H09 A;  3TDU C;  1DPU A;  4L0Y B;  4HX7 A;  1C0W A;  3KET A;  2VT3 A;  2R7F A;  1T0F A;  3ZP5 A;  3JW4 A;  4A5M A;  1F4K A;  1XSX A;  4IF4 A;  2M45 A;  4Z2Y A;  4UVB A;  3HHG A;  1I1G A;  4KIF A;  3MWM A;  1W7P A;  5L3F A;  2GXB A;  3D5L A;  5D5W B;  2VXZ A;  2JPB A;  3TOA A;  3I59 B;  1U5T A;  4M73 A;  1KU9 A;  4I7H A;  2J5P A;  1B6A A;  3EYI A;  1DP7 P;  1FBQ A;  4RGU A;  4N9I A;  2NRA C;  3WTT C;  2ZME B;  5D6E A;  2V9V A;  1IXS B;  1SD6 A;  1SD7 A;  2OBP A;  2OAZ A;  2IRF G;  2IA0 A;  1D3Y A;  4JQF A;  3FXR A;  2CYY A;  3DXJ F;  4GYI A;  3E6M A;  2K27 A;  4LG0 B;  5ICC A;  2HQN A;  4AD9 A;  5CLS A;  3KCC A;  1TTY A;  1U8R A;  2O3F A;  3V7S A;  2STW A;  3I0T A;  1IZ1 A;  2V1U A;  1EV7 A;  3Q9S A;  5JVT A;  2IP2 A;  1A04 A;  3W6K B;  1O3S A;  2AS5 F;  5F1R A;  4LLL A;  5A2Q K;  2MH2 A;  1KQ0 A;  3P9C A;  1O3Q A;  2Z33 A;  2UXN A;  3R61 A;  1BM9 A;  3R0J A;  1JHH A;  3QP6 A;  1YW7 A;  2TDX A;  5LGT A;  5HS9 A;  2FQ3 A;  3E6B A;  1TQP A;  1Z7U A;  2J5O A;  3MAJ A;  5DUK A;  2IW5 A;  1I6X A;  2R3S A;  3WE3 A;  3CO6 C;  4BYY A;  3O2P E;  4RAY A;  3TO6 A;  2Z9O A;  1ZLJ A;  1O57 A;  4HLY A;  1ZRC A;  3RYR A;  3EUH A;  4MHG A;  1BI2 A;  1E17 A;  5E1X A;  4FT8 A;  2KRF A;  2V6C A;  3LA2 A;  5D8K B;  3IKV A;  4KMF A;  4I0A A;  1D5V A;  1KQ8 A;  4OIR F;  2FA5 A;  1QZZ A;  2HYG D;  5LRR A;  3FHZ A;  1QQI A;  1W4M A;  2P7V B;  5FFX A;  3I59 A;  1QPM A;  3IC7 A;  3MEX A;  1R1T A;  2WC2 A;  3T8T A;  2FBK A;  1Z1D A;  4HX4 A;  2F5E A;  2BEO A;  2IT0 A;  3CUO A;  2ZME A;  2E1N A;  4XRF A;  2EFW A;  1EH7 A;  3JAM K;  1BI1 A;  4RB2 C;  1MJ9 A;  3BJ6 A;  3V7R A;  2V79 A;  2COM A;  2VOP A;  1HQC A;  2E7W A;  5DD8 A;  4IRH A;  2IVM A;  2PJP A;  4LG0 A;  4EGZ A;  3ZN0 A;  3I71 A;  2CFX A;  1HKQ A;  2DPD A;  2QYO A;  2ZKZ A;  2XKO A;  2BBY A;  2DTR A;  4I02 A;  4L18 B;  3ZN1 A;  3K0L A;  2D1H A;  3HRM A;  1G3W A;  4MEX F;  3SXY A;  4LB5 A;  4ETS A;  4LLG F;  4LB6 B;  2ESH A;  5H6Q A;  1DUX C;  1LDD A;  4HAM A;  1RUO A;  1Z91 A;  1IRF A;  3ZMV A;  1Z6T A;  5BQT A;  4F7Z A;  3RIR A;  4BXU A;  4ZYG A;  2FRH A;  2ISY A;  2GZW A;  1NHA A;  3QP5 A;  3FM3 A;  1OYW A;  4IXA A;  3PFI A;  4M9S A;  4HW0 A;  1IW7 F;  4MQV A;  4OIO F;  3C1D A;  5J8F A;  4K2E A;  3F6V A;  3PQJ A;  2G7H A;  4YIF A;  3F72 A;  1ZAO A;  3B73 A;  5D6F A;  4CZZ A;  1BIA A;  4HDV A;  1YG2 A;  2FNP A;  2EFP A;  2DK8 A;  3M8F A;  4IHS A;  3NRV A;  4EVI A;  3F21 A;  4Y13 A;  5LHH A;  1QBJ A;  3M8E A;  2L4A A;  1I1S A;  4HV6 A;  1LQ1 A;  3KE2 A;  2V1X A;  4IHT A;  2LNB A;  5HLH A;  5DUI A;  4U88 A;  1B4A A;  4A0Y A;  2NAZ A;  1KYW A;  5BMZ A;  2Z5U A;  3DPL C;  5JI6 A;  1ON1 A;  3G73 A;  1W7P D;  3RJP A;  1LVA A;  1IN4 A;  1OKR A;  2M30 A;  2XIG A;  2DBB A;  3LA3 A;  3BOQ A;  3BJA A;  2ZNZ A;  5AIP A;  2NNN A;  3RI4 A;  3HRS A;  1HSJ A;  3ROU A;  3L2C A;  4FX4 A;  1OPC A;  3GF2 A;  1BOA A;  1XDU A;  4IPA A;  2W85 A;  4IRI A;  3ML6 A;  3WTU C;  4P5O A;  2L3D A;  3O3K A;  2LF8 A;  4OOI A;  1FOK A;  4E70 A;  3M9A A;  5BPI A;  4A0X A;  3RTR A;  2GQQ A;  2PMU A;  3WGI A;  3ECH A;  3WU1 B;  5ICF A;  1QO0 D;  4ZH4 F;  1D8J A;  3GFI A;  2D45 A;  3P9I A;  5CVJ A;  4CO8 A;  1O7F A;  3FMQ A;  3Q5F A;  4RS8 A;  1YLF A;  5FGM A;  3B02 A;  5HLG A;  4DNC A;  2W84 A;  4HZF A;  1G3S A;  3GYH X;  3KLN A;  1MKM A;  1FYL A;  2LF7 A;  3MFK A;  4G6D A;  4ZZD A;  1LDJ A;  2OZ6 A;  1WRJ A;  3I4P A;  2NYX A;  3FMS A;  4EJT A;  2DLL A;  4O5V A;  4U0V A;  2GXG A;  2LKP A;  2ETH A;  3C18 A;  5HDG A;  3QOP A;  5DCF A;  4HYE A;  4PCQ A;  3RPQ A;  1QNT A;  2O0Y A;  1IN8 A;  3WE2 A;  3R60 A;  1FY7 A;  2GAU A;  4LD5 A;  1HXD A;  3IRR A;  2OU2 A;  2STT A;  1ZYR F;  2HR3 A;  1FP2 A;  1EH6 A;  4AWX B;  3WTY C;  2HOE A;  3SZT A;  2A07 F;  1S29 A;  3WTX C;  2HTS A;  2VC0 A;  1P4X A;  2EA4 A;  2FF4 A;  1U78 A;  1J75 A;  4U7D A;  1FZP B;  1MDM B;  1JXS A;  2VOD A;  4EJO A;  3HSE A;  4PDK A;  1HST A;  2UWM A;  1PUE E;  2HGC A;  5E8I A;  1HBX G;  2HZT A;  1SMT A;  1BC8 C;  2VOO A;  3TOB A;  3E6D A;  1LJ9 A;  2XV4 S;  4KT5 C;  4P9U A;  3GFL A;  2HEO A;  2P4W A;  3WOD F;  1O7L A;  4EJW A;  1SD5 A;  1RI7 A;  2UZK A;  3BP8 A;  3WGH A;  3J80 Z;  2Q0O A;  3I64 A;  3FX3 A;  2MBF A;  3E5X A;  2L54 A;  3FXU A;  1DDN A;  5JHU A;  4M71 A;  4D0P A;  3C7J A;  1RNL A;  2VT2 A;  5J6X A;  3RDI A;  4KA4 A;  2F5F A;  1DPR A;  5ERI A;  2QEN A;  3LAP A;  2HFH A;  1LB2 A;  4I09 A;  3KP7 A;  1KU7 A;  2Z3Y A;  2HWV A;  4DQ2 A;  3GEZ A;  4YFN F;  5CVI A;  3IHU A;  2P8T A;  1S8N A;  3FZV A;  3DEU A;  1O3T A;  4HQE A;  3U2R A;  3E5Q A;  2ZCW A;  1ULY A;  5KK1 A;  2Y0M A;  3COA C;  5F64 A;  1T2K A;  3KFW X;  3EET A;  3GUD A;  4LJZ F;  2O8X A;  3DKW A;  3HTU A;  1T38 A;  1O3R A;  3T0Y A;  4YII A;  2RKH A;  3GZ6 A;  1ODD A;  5H20 A;  2YR2 A;  1KA8 A;  2KJC A;  5AIQ A;  4U0W A;  1USS A;  4Q47 A;  1BC7 C;  2W24 A;  3MZH A;  2FE3 A;  3L9F A;  1SD4 A;  2H6C A;  2CQK A;  1FX7 A;  1MDM A;  3DPT A;  4M72 A;  4ENM A;  2RN7 A;  2QBY A;  5ILU A;  4ZYE A;  2QUF A;  4EGY A;  3TO9 A;  2MA3 A;  1ZLK A;  4M9Z A;  2F2E A;  1BIB A;  1CF7 B;  3KP4 A;  1R23 A;  2ESN A;  4EJU A;  3HIF A;  2RQP A;  2CWE A;  3K1M A;  1UCR A;  1UB9 A;  3VOD A;  2RNJ A;  1FSH A;  1T98 A;  1ZGA A;  4KDP A;  2XKP A;  5LGN A;  4ENN A;  1UHW A;  2D2W A;  4OIN F;  3HOS A;  2M1B A;  4RGR A;  1IN7 A;  3RYP A;  1TNS A;  3QAH A;  1IN5 A;  3BRO A;  2Y48 A;  2M87 A;  3O6B B;  2OA4 A;  2WWY A;  2FEZ A;  5ILS A;  4IVN A;  1YIO A;  1YW8 A;  5LGU A;  1UHM A;  1K6O A;  1HKT A;  2VBY A;  4UHT A;  4XLP F;  1U2W A;  3IL2 A;  3J80 K;  2ADU A;  5D5X B;  4MGR A;  1XCB A;  1H9T A;  4XLN F;  2RVC A;  1MJA A;  4HA8 A;  4A6D A;  2A68 F;  1XGO A;  5L3C A;  3S2W A;  4HLX A;  3E3V A;  4H0E A;  1TLH B;  4HDU A;  3T8R A;  2P5V A;  3VFZ A;  5EEG A;  3RKW A;  3GXO A;  3WG9 A;  1XSD A;  5K1Y A;  5D8L B;  2A3S A;  1FC3 A;  1G4D A;  2P5L C;  3RKY A;  3LAJ A;  4RB0 A;  5K5R A;  3AAF A;  3K9T A;  4G7H F;  1G3Y A;  4P96 A;  5AON A;  5DD4 A;  3HSF A;  2PQ8 A;  2JPC A;  4N0B A;  3LFK A;  5FO5 A;  1MJB A;  2OZU A;  1CF7 A;  2PI0 A;  4HF2 A;  2H94 A;  2P5K A;  4HF1 A;  2XAG A;  4RAZ A;  1BN5 A;  1YO5 C;  2H6B A;  5BOX A;  3BJO A;  2Q8K A;  1S7O A;  3ELK A;  4L5I A;  3K2Z A;  1L3L A;  2DK5 A;  1R5G A;  1BI3 A;  1J59 A;  1E2X A;  1GXQ A;  2F5C A;  2PG4 A;  4L9N A;  1S3J A;  4Y15 A;  3FM5 A;  2P7C B;  2HYF A;  4EQQ A;  4AIH A;  1XSV A;  5ICG A;  2HDC A;  3TGN A;  3RPU A;  4HOB A;  1PP7 U;  5LRS A;  3VEP A;  2JT1 A;  1H0M A;  3R6S A;  1ZH5 A;  2QQ9 A;  1XMK A;  1ZRE A;  6PAX A;  2HTJ A;  4P9F A;  1FYK A;  2E7X A;  2A69 F;  3I5U A;  2QLZ A;  2ELH A;  1KU2 A;  4HF0 A;  1TNT A;  4YFK F;  1QGP A;  3KEO A;  2EV6 A;  5HDN A;  2JRT A;  4KFC A;  2A6H F;  2OQR A;  2P6S A;  3DFG A;  4FX0 A;  2EK5 A;  5E18 F;  4EM0 B;  2M8E A;  1XDS A;  5E1Z B;  2VON A;  5E1W A;  2EV0 A;  2FOK A;  2HQR A;  5JR3 A;  2L4M A;  2DU9 A;  5D4R A;  4GGG A;  4UUV A;  3JTH A;  3W6J B;  1P4W A;  2PLY A;  3R0A A;  3R4K A;  3CDH A;  3H92 A;  1IRG A;  3Q9V A;  1KQ9 A;  1R22 A;  4EM1 A;  2K02 A;  2PN6 A;  1Z6R A;  4QLC U;  4ASN A;  4WXH A;  1R00 A;  5ICE A;  1ZG1 A;  1PP8 F;  4ZZL A;  4OIP F;  4AVP A;  3ABU A;  4TV7 A;  3F8M A;  3BY6 A;  4G94 A;  4AIJ A;  2DW4 A;  3HRT A;  3CUQ B;  1ZAR A;  2ZO4 A;  1FWZ A;  4ESB A;  2EFN A;  4LK1 F;  4KN7 X;  1FP1 D;  2CW0 F;  4JK1 X;  4IRG A;  4GO1 A;  4G7Z F;  3QPT A;  2A5Y B;  3E97 A;  4XBF A;  1J7K A;  4LGW A;  3DQV C;  4BHB A;  3GO5 A;  2FU4 A;  5CVV A;  4Q4Z F;  2LSO A;  4A0Z A;  1SFU A;  1KU3 A;  2YU3 A;  4BNC A;  4IJA A;  2GWR A;  3ERE D;  5HOO A;  2EA2 A;  1HKS A;  4ZYD A;  1T6S A;  3K1P A;  3NQO A;  5IT9 Z;  5LBQ A;  1T39 A;  2ZXJ A;  4S04 A;  3QU6 A;  3F22 A;  3CUQ C;  2VE9 A;  2BYV E;  2MH9 A;  4U7B A;  3SFZ A;  2DT5 A;  1PDN C;  3HUG A;  2UXX A;  1XD7 A;  1SFE A;  1R58 A;  3P9K A;  1WQ2 A;  3G3Z A;  5HLI A;  3BPV A;  1Q1H A;  3FF5 A;  3ISP A;  1B59 A;  2RV8 A;  2PFB A;  5D4S A;  2F5D A;  2GA2 A;  5FLX Z;  3HRU A;  4ESF A; 
#chains in the Genus database with same CATH topology
 1N75 A;  1EH8 A;  4X0G A;  4C2U A;  2HKO A;  5DEQ A;  1BBY A;  1B9M A;  1VQ6 I;  1XMA A;  3QYB A;  4BGD A;  3CMY A;  3T1B A;  5IP6 A;  4RGX A;  2K86 A;  3J7Z I;  2W7N A;  2XAU A;  1YTY A;  1TT5 B;  2EPF A;  4I98 B;  4EV0 A;  3M7G A;  4B8X A;  5DDG A;  4CCL A;  3TKY A;  1JJ6 C;  3WU0 A;  4CYC B;  3CQZ J;  3HKZ N;  4M6V A;  1D5Y A;  2Q2E A;  2AHQ A;  4WXC A;  1IAW A;  2O03 A;  4XMY A;  1OCT C;  2X1D A;  2HOT A;  5CJ9 A;  3ZR8 X;  2V6E A;  2CGP A;  2DFI A;  4HNU A;  4O6J A;  3VOE A;  1HW2 A;  4B09 A;  3KLO A;  3L09 A;  1U9O A;  1XPX A;  1QHH D;  1REP C;  1IRX A;  2XF6 A;  1W0T A;  4MNU A;  4I01 A;  5IYD J;  2K4B A;  4JYK A;  2RRE A;  2VB6 A;  2XAF A;  4XSZ F;  1GLN A;  2E71 A;  2EWN A;  3I9V 2;  3GTM J;  3S15 J;  3GTL J;  1D1C A;  1ZN2 A;  3N97 A;  3IUO A;  2LKS A;  3K4N A;  1D1A A;  3CUQ A;  3J81 Z;  1U3E M;  3PQK A;  1LEB A;  3I55 I;  1JHF A;  1ON2 A;  3DKX A;  3JRA A;  2VE8 A;  1X4O A;  1MSE C;  4N9H A;  5LD2 C;  1FT9 A;  2L01 A;  5F6F A;  4XOR A;  3GZ5 A;  4A2U A;  2X6O A;  2BGC A;  2VN2 A;  2LY9 A;  2L02 A;  3H3Z A;  1IDZ A;  2EV5 A;  1UG2 A;  4XKV A;  1SMY F;  1DP3 A;  1XTA A;  2LY1 A;  2NS0 A;  3LSI A;  2GM4 A;  1LFB A;  2O9L A;  1OR7 A;  3TW6 A;  2IA2 A;  3RKX A;  2H1K A;  1VF9 A;  4CYD A;  1UFM A;  2X0L A;  3OYI A;  2M34 A;  1Z9C A;  2ACJ A;  3LSJ A;  1QVT A;  1IXR C;  3BT9 A;  2V1N A;  3F8F A;  1VTN C;  3JRD A;  1VQ7 I;  5JLX A;  4YFX F;  3S2D J;  3MKZ A;  4WX9 A;  2CUE A;  2CV0 A;  4AYB N;  2EZL A;  4KMU X;  2VAS A;  2H27 A;  3OYE A;  2BW3 A;  4LFU A;  5DCM B;  3KP5 A;  3BG7 A;  3K69 A;  2HVQ A;  2KJB A;  3P7N A;  3DKY A;  3BPX A;  4CXF A;  3FBN B;  1IXC A;  1Y1W J;  3EPZ A;  3KYL A;  3HOZ J;  2NOG A;  2K7L A;  3WTZ A;  3SFI A;  2BXY A;  2OD5 A;  2QWW A;  2ME0 A;  4WXD A;  2ZJR F;  2LMD A;  3BTL A;  2EFO A;  4OMZ A;  4GYG A;  1SFX A;  3ZQH A;  3GFJ A;  3G2B A;  1IN6 A;  2B63 J;  4LMY A;  1GVJ A;  3VB2 A;  2XPU A;  3HTS B;  3CC2 I;  2MD5 A;  2L5Q A;  4UUS A;  3TDZ C;  3JRI A;  3EUH C;  2AXL A;  2R7D A;  4J01 A;  2DDA A;  2YX7 A;  3VPR A;  5B1B H;  2LY2 A;  1TBX A;  1PUF B;  1G6N A;  1K6Y A;  1W5T A;  3ABT A;  3U21 A;  4WK8 F;  4MTD A;  2QQA A;  3LQQ A;  4UXN A;  2R7Q A;  4M6X A;  1ONV A;  2EQR A;  1OMI A;  4UY8 I;  2BY2 A;  1F5T A;  3BG6 A;  3FXQ A;  3K2A A;  2A61 A;  1Z05 A;  3GZN B;  4YEJ A;  2VBW A;  5IT9 K;  2DQR A;  2DAO A;  4ENK A;  2RAE A;  4DZP A;  3TW7 A;  2FMY A;  1R1V A;  2IS6 A;  2V9K A;  1YE9 A;  4ON0 A;  5L3E A;  2P81 A;  4IOC F;  3BR3 A;  5E8G A;  2EBI A;  2JWT A;  1BJA A;  3KZY A;  3CLO A;  1BR4 A;  1GXP A;  1NH3 A;  4BHC A;  3GTK J;  4HPQ A;  2Z2S B;  3OIO A;  4CYC A;  1RZ4 A;  3HGG A;  5EEH A;  4I2O A;  3HYI A;  3OOP A;  3I54 A;  4Q48 A;  3T5X A;  4MO7 A;  4RMN A;  1HCR A;  3FMR A;  3I4N J;  5FD6 A;  5HLT A;  2G9W A;  2EFQ A;  2ZME C;  5E20 A;  4EJV A;  1RIO H;  4NHJ A;  3PM1 A;  4QWQ A;  4YG2 F;  3GTQ J;  1WWX A;  4AM3 A;  3E6C C;  3C2G A;  3ZQ7 A;  4E6K G;  2MLK A;  4ESJ A;  2VC1 A;  4XLA A;  3MCZ A;  1S6L A;  4BQA A;  3CDL A;  1FJL A;  2O8K A;  1YQA A;  2RQQ A;  1FPQ A;  2V7F A;  2XVC A;  2OJE D;  4KIC A;  4YIR X;  3IKT A;  1SVL A;  1P9Q C;  3KP6 A;  1TWH J;  3E5U A;  1XGS A;  2Y0S A;  2M7B A;  4L9V A;  1Y0U A;  5E17 F;  2BV6 A;  4DYQ A;  5FLX K;  1HLV A;  3LSM A;  2ZXH A;  3SHF A;  3DP7 A;  1MIJ A;  4X6A J;  4FHT A;  4IQ4 A;  1JGG A;  1SVM A;  1W36 D;  2CUZ A;  2FXA A;  3FWE A;  2ELK A;  4E7I A;  1UST A;  1J2X A;  4WF2 A;  1TW3 A;  2XUB A;  3K4B A;  2RGV A;  4E7J A;  5L3B A;  3JTG A;  3H5R A;  2D1V A;  2PMZ A;  4NDL A;  5L3G A;  4BH9 A;  4KIG A;  3JSO A;  4ZDO A;  1YS7 A;  3IH4 A;  4DBQ A;  1ZG3 A;  2KP6 A;  3H3U A;  4PZJ A;  4OU0 A;  3L1P A;  2H1L A;  1MD0 A;  1XN7 A;  4WCG A;  4XL9 A;  3HSR A;  4CGZ A;  2XSJ C;  1I27 A;  1ETY A;  3GTG J;  3KEQ A;  4A5N A;  2MC4 A;  4L9T A;  5E3O A;  2XPV A;  4Y4R A;  3VWB A;  1B9N A;  2L9S A;  1GV2 A;  5TJJ A;  4D7M A;  1ENH A;  1IUY A;  4R1H A;  4HNV A;  2JSP A;  3HB9 A;  5CVR A;  2CQX A;  4HRI A;  2NVT J;  5DCM A;  1R49 A;  4L5J A;  1T56 A;  4KYW A;  5CQG A;  4WWC A;  1KZH A;  4HQM A;  3J81 K;  1K61 A;  1APL C;  2XF5 A;  4I6Z A;  2FQ4 A;  4BBR J;  2VQC A;  3NAR A;  4L9J A;  4LIU A;  2DT6 A;  1I3A A;  4XSX F;  3X2Q H;  3ZMS A;  5BS6 A;  3EUK L;  1NK2 P;  2AQF A;  2E1C A;  4IHW A;  3L7W A;  4KT6 A;  1R7J A;  3MZY A;  1BL0 A;  2DO7 A;  3REO A;  2KFD A;  2L7Z A;  4KIB A;  4XLF A;  4CHU A;  3WTV C;  2R7O A;  4YEL A;  1D8K A;  3LWF A;  2V4J C;  1SAN A;  1R36 A;  1VQM I;  1MMG A;  1L0O C;  3ZQI A;  1P2F A;  2WY8 Q;  5KVR A;  2KIM A;  5DV5 A;  2LDU A;  3PNV A;  1GHC A;  3PL8 A;  3L00 A;  5IY5 H;  2QQB A;  4NNJ A;  3A0B C;  4JX4 A;  2KIF A;  4DBR A;  1V3F A;  2IGM A;  3V4G A;  2IGO A;  3J7A O;  1P6R A;  1WGX A;  1ZKG A;  2DFE A;  5HS8 A;  3HOV J;  1ORK A;  3G1L A;  2OTL I;  4OIQ F;  3BLY A;  1OFC X;  4BAY A;  4CUG A;  1R5H A;  4ZYH A;  1MMD A;  4M3G A;  4BL0 B;  2A6T A;  5FJ8 J;  3GW2 A;  4MFE A;  4XLC A;  1KGS A;  5FD5 A;  3BG3 A;  3LST A;  4PGH A;  1J5Y A;  3K10 A;  2E36 A;  3KZZ A;  1YS6 A;  1T33 A;  1M1E B;  4I0B A;  2Z99 A;  1WCM J;  3RSN A;  5J8C A;  4A3D J;  3K4L A;  2YU9 J;  2RDP A;  4AU7 A;  4AIK A;  4RDU A;  1ZGJ A;  4JP0 A;  3H0D A;  3F6O A;  2KDZ A;  1FNN A;  2BHZ A;  3GWZ A;  3RZD J;  5M3F J;  3ERM A;  1IDY A;  1ZEL A;  3FXK A;  5HNH A;  4CCO A;  1AWC A;  1P92 A;  3BCA A;  2BY3 A;  1FEX A;  2O6G E;  3PO2 J;  2JVH A;  3M1C A;  2K9N A;  4JBA A;  4AVZ A;  2W25 A;  2Y75 A;  4RB3 C;  3DU6 A;  4QIW N;  2XRO A;  1MBJ A;  4CIC A;  2ZNY A;  1SEU A;  1IF1 A;  5K5O A;  3BG9 A;  3GVA A;  4LIV A;  5EG0 A;  2LRD A;  5M5W J;  1A5J A;  4UVC A;  3JRE A;  1V4R A;  1ETX A;  2HDW A;  2HQ5 A;  2LLK A;  3E0J B;  1YFH A;  4UNO A;  4S05 A;  4ZTJ A;  1KYZ A;  1PYV A;  3TO7 A;  2LC2 A;  1ITY A;  5J4V A;  5F27 A;  3M1E A;  1W36 C;  2ISZ A;  1W5S A;  2PMH A;  4G6Q A;  1X2N A;  3I53 A;  1LDK B;  1YI2 I;  2A6E F;  3FK6 A;  4R8H A;  3GBG A;  4F92 B;  2UUZ A;  2QZ8 A;  5KAI C;  3IWF A;  1K78 B;  3WTW C;  3EYY A;  3IWZ A;  1UZC A;  2HS5 A;  1HW1 A;  4UV8 A;  2GA1 A;  1S7A A;  2ZBK A;  3DLL F;  1ZRD A;  1YYV A;  3G1O A;  5LLQ A;  4G6T B;  1BI0 A;  3CMA I;  3JSP A;  1FYM A;  1AKH B;  5DYM A;  2ID6 A;  2JMW A;  3CJN A;  2QM3 A;  5K7F A;  5TRD A;  2OPT A;  1XGM A;  3HPG A;  3DEW A;  4U87 A;  3F3X A;  3SJM A;  3LQR A;  2DI3 A;  2XHK A;  2KPM A;  2CO5 A;  2O5R A;  5C44 J;  4BXX J;  3VYR B;  3GME A;  4G9Y A;  3L2V A;  1WFX A;  2K85 A;  2FNA A;  5HOD A;  1WSU A;  1G3T A;  5ILV A;  3U9G A;  4KUM A;  1J0R A;  2IJL A;  3IRQ A;  5IYB J;  3KZI C;  5B5E C;  1K7A A;  4Y17 A;  1Z67 A;  5FB2 A;  1ZHF A;  1YOV B;  2QA4 I;  5LHI A;  2M9H A;  2B0L A;  2FBH A;  3V8J A;  2NOJ B;  5M5Y J;  1WJA A;  2JQ7 A;  5L3D A;  4C2T A;  4Q5S F;  4IKF A;  1WJB A;  1H88 C;  1OCR H;  3HBL A;  5EZH A;  4EM2 A;  3V7C A;  3ULQ B;  3O8G A;  5FFZ A;  3TED A;  4G7O F;  4D7N A;  4B1R A;  2XGX A;  2BZT A;  1ACI A;  4FET A;  2MSY A;  1RUN A;  2M5W A;  5FKN A;  4RLF A;  3OYC A;  4HBL A;  3IP4 B;  1J9I A;  3LSH A;  4RAF A;  2YX4 A;  1YIJ I;  1DU0 A;  3H5A A;  1LNW A;  2H8R A;  3BZ6 A;  1EA3 A;  2FUG 2;  4GFB A;  4KIS A;  1UG0 A;  2JSC A;  2ZFW A;  4A6E A;  2ZJ2 A;  1GUU A;  2YSR A;  1XCV A;  3NEU A;  3OYK A;  1ZGW A;  3N4M A;  3BR0 A;  2JTV A;  4HX8 A;  2CW7 A;  4Z6Y A;  4B43 A;  1FSE A;  3HG9 A;  4D1Q A;  2EB7 A;  2O61 A;  4PK4 A;  2IAI A;  3ZMT A;  3OV8 A;  3WTS C;  4FAS D;  5F0F A;  2DQL A;  3CCS I;  3KP3 A;  4XQF A;  2P0W A;  2L7K A;  3CZ6 A;  4PGG A;  3M3Y J;  4II3 A;  1KON A;  2LK2 A;  3TBI A;  2JK3 A;  4X1E A;  5GP9 A;  3I58 A;  4BXF A;  2F6C A;  2KIU A;  4ANJ A;  3LNQ A;  5LEJ A;  2LRE A;  2VLA A;  3K1N A;  2RC4 A;  2XDV A;  5ED4 A;  3BDD A;  1SAX A;  5D5U B;  3V8K A;  3OY9 A;  3DBL B;  2XGE A;  3QU3 A;  4R79 A;  1JE8 A;  1LPQ A;  3HDD A;  4NB5 A;  1K79 A;  2R7X A;  1MGT A;  3F8C A;  3A0H C;  2I8D A;  5CVU A;  4B4C A;  2E1M B;  5J4Y A;  2HNH A;  2F4I A;  1D1B A;  2XGC A;  3F8N A;  5GAG J;  1OYY A;  5IYC J;  5M5X J;  2VJ4 A;  2VUM J;  4DYC A;  1Z7L A;  3DF8 A;  2VBX A;  1SAU A;  1P4A A;  1R5I D;  3HHH A;  5IT3 A;  2AXT C;  4NC8 A;  2TRT A;  4PJ0 C;  2ICW G;  4MQ9 F;  4RGS A;  4ZDL A;  5IP9 J;  2JN6 A;  3CO7 C;  3QPL A;  2LH9 A;  3HM5 A;  3FXO A;  3C3W A;  2X6X A;  5LHG A;  5DM7 F;  3A01 B;  2R5Y B;  1ETK A;  1FBS A;  4Y33 A;  2BE5 F;  3CES A;  4LK0 F;  3ZMZ A;  1IRZ A;  2JA2 A;  2V1D A;  3SQN A;  1FLI A;  1K78 A;  4MTE A;  2IA1 A;  3J7Y J;  1LVK A;  2YPR A;  3V8L A;  1WH5 A;  1N78 A;  2JZY A;  5J47 A;  2LG4 A;  1YJW I;  1W7P B;  1FIP A;  3CJT B;  2QVO A;  1ETO A;  2VKE A;  4XN3 A;  2Y2Z A;  4F52 A;  1MNE A;  1RR8 C;  2FD5 A;  1F1Z A;  2X4H A;  1ZK8 A;  3QOE A;  4B48 A;  5HVQ C;  5LFA A;  2HVS A;  5IP7 J;  4Y3O A;  4XLE A;  1AKH A;  2FSW A;  1RR7 A;  5JVG F;  4UV9 A;  4DZJ A;  3CC4 I;  4PFP A;  2NNY A;  1U5T B;  3CCE I;  1S5L C;  1J09 A;  3CTA A;  5GPA A;  3ZMU A;  5DM6 F;  2PEX A;  1MH3 A;  2TCT A;  3A03 A;  3C2H A;  2FBI A;  1TW2 A;  3ZXS A;  3EQL F;  2WAQ A;  4GXO A;  3D0S A;  4RB1 A;  2E1M C;  2MLG A;  2CSO A;  5EJC A;  2XAQ A;  1XX5 A;  2CS3 A;  3QRF F;  4M74 A;  3DV8 A;  2W00 A;  1MZB A;  1X3W B;  3W6V A;  3TQN A;  1JI8 A;  5A2Q Z;  3PNT A;  3S3O A;  1CGP A;  2W57 A;  1R1U A;  2W48 A;  4P55 A;  4BHP A;  3A02 A;  4BS9 A;  3PIO F;  3M4O J;  1JGS A;  2M3A A;  2QKM B;  3EDP A;  5GPC A;  1H9G A;  2L7F P;  3CF5 F;  3SZP A;  1OJL A;  1T0F C;  2XAJ A;  2PBI A;  2VBZ A;  2WV0 A;  2XRN A;  1TWF J;  2G7U A;  5H6R A;  4RAG A;  4QSH A;  1JKR C;  1XB4 A;  2M4G A;  2L9V A;  1XGN A;  2BHY A;  2CQN A;  4BJ6 C;  3HOX J;  2JVG A;  1Y39 A;  1X2M A;  1BR1 A;  2LR8 A;  2K9S A;  4O3M A;  1D0X A;  2DPU A;  3G1M A;  3ECO A;  4OMY A;  1N77 A;  3CCQ I;  1QZY A;  1TQI A;  3BWG A;  1STZ A;  3KP2 A;  2OQG A;  3F23 A;  4ABZ A;  1TQM A;  4C9Y A;  4QTR A;  4M9X A;  4KN4 X;  4MEY F;  1U5T C;  2XAH A;  4M6Y A;  3BZK A;  4EMS A;  2EIJ H;  3SEQ A;  1ETW A;  4A3F J;  5HS7 A;  3ZMD A;  2KKO A;  5K5Q A;  3GFM A;  1SFO J;  3D1N I;  4G8X A;  1WI9 A;  2RNG A;  4XN0 A;  1R71 A;  2HKX A;  2KMU A;  2XAS A;  5HDK A;  2CG4 A;  2MGQ A;  4L0Z B;  1HW5 A;  3CC7 I;  2D5V A;  3GX4 X;  2DMT A;  2FML A;  2QBY B;  1YX3 A;  1Y8R B;  2MC3 A;  3HPH A;  3ZPL A;  1I5Z A;  2IPQ X;  1ZG5 A;  5D5V B;  4HST A;  3GLX A;  2WTE A;  4HV5 A;  2EJR A;  2NS8 A;  1FOW A;  4UVA A;  1W0U A;  1JTX A;  4KNY A;  4LG3 A;  2K4J A;  2XC7 A;  3F8B A;  1TP4 A;  4IL6 C;  2VQH A;  3LA7 A;  1U6G A;  5B1A H;  1LE8 B;  1ZRF A;  4U0Y A;  1GT0 C;  1TZL A;  1F9N A;  1G2H A;  3QPH A;  1B1B A;  2CH0 A;  1WKM A;  4I99 C;  2KLO A;  1FBU A;  1X3U A;  3OS1 A;  3HXL A;  3U1D A;  1R4M B;  3CCL I;  4XLH A;  1HDP A;  1TL8 A;  3UKG A;  2DOF A;  3Q0V A;  2GIV A;  4LLN A;  5CYV A;  5BPD A;  3WGG A;  2P6T A;  4GCV A;  1OYI A;  3MQ0 A;  1AOY A;  2MD0 A;  3JAM Z;  5LEK A;  3P5J A;  4CDG A;  1YW9 A;  2C6Y A;  5JFR A;  1HA8 A;  1RPW A;  1POG A;  4A12 A;  2ZSI B;  1LEA A;  1UMQ A;  4ENJ A;  4NQW A;  3HOT A;  1E3H A;  2LTP A;  2H09 A;  4XOT A;  3TDU C;  3TP3 A;  3FXL A;  4L0Y B;  1DPU A;  4HX7 A;  5J1R A;  1C0W A;  4QPO A;  3NAU A;  3S32 A;  3K4C A;  2OCE A;  3KET A;  2VT3 A;  2R7F A;  3FHN A;  3J7A Y;  1T0F A;  3ZP5 A;  3JW4 A;  4A5M A;  3A01 A;  1XSX A;  4IF4 A;  4BQO A;  2R7W A;  1F4K A;  2M45 A;  4Z2Y A;  2DCE A;  3OL4 A;  4UVB A;  3HGY A;  5FRM A;  3HHG A;  1Q1V A;  1OIS A;  5H2F C;  1I1G A;  4KIF A;  2B9S A;  3MWM A;  1W7P A;  5FKL A;  5L3F A;  2GXB A;  3D5L A;  3RQI A;  5D5W B;  1QA6 A;  3A2K A;  2VXZ A;  1S7E A;  1DGW Y;  2QEX I;  2JPB A;  2DOA A;  3TOA A;  3I59 B;  1IC8 A;  1U5T A;  4M73 A;  1KU9 A;  4I7H A;  1RES A;  2J5P A;  1B6A A;  3EYI A;  1DP7 P;  1BW5 A;  5E3M A;  1FBQ A;  4RA2 A;  4RGU A;  4N9I A;  2NRA C;  1WZ2 A;  3WTT C;  1YJ9 I;  2ZME B;  5D6E A;  2V9V A;  1IXS B;  2JA5 J;  1SD6 A;  1SD7 A;  2F4M B;  3Q3S A;  3C2B A;  2OBP A;  3ASN H;  3OSF A;  2LD5 A;  3ZQL A;  2OAZ A;  3OS0 A;  4A3I J;  2DYR H;  2IRF G;  1V55 H;  2IA0 A;  1D3Y A;  4JQF A;  3H36 A;  4UB6 C;  3FXR A;  2CYY A;  3HZJ A;  1WH7 A;  3DXJ F;  3OMY A;  4GYI A;  1S72 I;  1U9N A;  1GVD A;  3RCO A;  3E6M A;  3I56 I;  2K27 A;  3QOD A;  2BVM A;  2M0C A;  2EIN H;  2ZC2 A;  4LG0 B;  2OTJ I;  2Q1Z B;  1I50 J;  2OCC H;  2ZJQ F;  5ICC A;  2DA2 A;  2HI3 A;  4Y7N J;  2HQN A;  4AD9 A;  5CLS A;  3KCC A;  1TTY A;  2K9Q A;  2X1E A;  5JLW A;  1HF0 A;  2R7V A;  1B8I B;  1U8R A;  2O3F A;  2B7E A;  3V7S A;  1RET A;  2STW A;  3I0T A;  1IZ1 A;  2V1U A;  1EV7 A;  1MMS A;  4FIS A;  5KAF C;  1IUF A;  3Q9S A;  4E7K A;  5JVT A;  2IP2 A;  2CUJ A;  3ZQQ A;  1ZTR A;  2QCO A;  1YX5 A;  3G6E I;  1A04 A;  3OR2 C;  4J00 A;  3AL0 B;  3W6K B;  3QQA A;  1O3S A;  2AS5 F;  4IO9 F;  4JX6 A;  2ZSH B;  2DDB A;  5F1R A;  2QQ8 A;  3KPH A;  4LLL A;  5A2Q K;  2ELJ A;  4XRS G;  3ONQ A;  2MH2 A;  1KQ0 A;  3P9C A;  1O3Q A;  2Z33 A;  4XK4 A;  2MG4 A;  3LSP A;  3OYL A;  2UXN A;  3R61 A;  1BM9 A;  4DOZ A;  2K40 A;  1R4N B;  3R0J A;  1LE8 A;  3SYT A;  1JHH A;  3QP6 A;  1YW7 A;  2NVY J;  2TDX A;  2W82 A;  4CA0 A;  5LGT A;  5HS9 A;  2FQ3 A;  3ZQC A;  3E6B A;  1TQP A;  4XOP A;  1Z7U A;  2J5O A;  3MAJ A;  2KIQ A;  1PJR A;  5DUK A;  2IW5 A;  1I6X A;  2VXD A;  4NBQ A;  2R3S A;  3WE3 A;  3CO6 C;  4BYY A;  2E5Z A;  4PJL A;  3O2P E;  4RAY A;  3TO6 A;  2Z9O A;  1ZLJ A;  2EH3 A;  1O57 A;  1Y56 A;  4HLY A;  1MBH A;  1A36 A;  1ZRC A;  3DTK A;  4XKC A;  4BAC A;  3RYR A;  3EUH A;  4BKX A;  4MHG A;  1BI2 A;  1E17 A;  3AL0 C;  2HXI A;  5E1X A;  2HDD A;  4PSX A;  5CQE A;  4NUB A;  4FT8 A;  2KRF A;  2JA6 J;  2V6C A;  4C3J J;  3LA2 A;  5D8K B;  3IKV A;  4KMF A;  4I0A A;  4BJ5 C;  2GXA A;  1IJW C;  1D5V A;  1FTT A;  3FKI J;  1KQ8 A;  5B66 C;  2DT7 B;  4OIR F;  2FA5 A;  1QZZ A;  1G8X A;  2QKL B;  2L0K A;  1P7J A;  2DN0 A;  2HOS A;  4AC0 A;  2CU7 A;  2HYG D;  2JA7 J;  5LRR A;  4E7S A;  3FHZ A;  1QQI A;  1W4M A;  2I5U A;  2P7V B;  3EUA A;  4JOM A;  2XRL A;  5FFX A;  4NC6 A;  3I59 A;  2V9P A;  1QPM A;  3IC7 A;  3KYC B;  1R1T A;  2WC2 A;  3MEX A;  4PUS A;  2FBK A;  3K4M A;  3T8T A;  4XID A;  1Z1D A;  3S2H J;  1WI3 A;  2R0Q C;  1BR2 A;  4HX4 A;  2F5E A;  5KNL A;  2Z1D A;  5F0H A;  2BEO A;  4NC7 A;  2IT0 A;  2XSD C;  3CUO A;  2ZME A;  3L2Q A;  2E1N A;  4XRF A;  3S1R J;  2EFW A;  1EH7 A;  3JAM K;  4M3D A;  1BI1 A;  2VL8 A;  4ITV A;  2XF7 A;  1Z21 A;  1Y6I A;  4RB2 C;  1N25 A;  1RC9 A;  4BDZ A;  1MJ9 A;  3BJ6 A;  1PUF A;  3V7R A;  3DEE A;  2GOX B;  4CCN A;  3LSK A;  2V79 A;  1Z3Y A;  2COM A;  2FOW A;  1HQC A;  2E7W A;  2IGK A;  5DD8 A;  2VOP A;  1IV6 A;  4IRH A;  2IVM A;  2PJP A;  4RBO A;  2X51 A;  3H9G A;  4LG0 A;  2ZJP F;  4EGZ A;  1NG7 A;  3ZN0 A;  1VND A;  2LKX A;  2DMN A;  5TIS C;  3I71 A;  2DA1 A;  2CFX A;  1HKQ A;  2DPD A;  4PJM A;  3ZQF A;  4BY7 J;  4IZZ A;  2EZI A;  2GLO A;  3UNG C;  2QYO A;  2ZKZ A;  1ETQ A;  1B8I A;  2XKO A;  2BBY A;  2DTR A;  4YRV A;  4I02 A;  4L18 B;  1D0Z A;  2E2J J;  4D9J A;  3ZN1 A;  3K0L A;  5C4J J;  2D1H A;  1MBK A;  4HG2 A;  2MW8 A;  3BTC A;  3HRM A;  2R5Z B;  1K83 J;  1G3W A;  4MEX F;  3SXY A;  4LB5 A;  1H8A C;  3H35 A;  4ETS A;  3FBI B;  4LLG F;  2WB1 A;  4FE4 A;  1OCZ H;  4LB6 B;  5H6Q A;  2H8W A;  1LDD A;  4OAZ A;  4HAM A;  1DUX C;  1RUO A;  1Z91 A;  3CP2 A;  5CPR B;  1IRF A;  4P1W A;  4BQN A;  3ZMV A;  1Z6T A;  4XKB A;  5BQT A;  4F7Z A;  4A3M J;  3RIR A;  4CH7 A;  4BXU A;  1WJC A;  4ZYG A;  2FRH A;  1TWG J;  2ISY A;  2GZW A;  2KHM A;  1NHA A;  1OCP A;  3BQY A;  3QP5 A;  3DLA A;  3FM3 A;  4IQJ A;  2R7Z J;  1OYW A;  4IXA A;  3K4J A;  3PFI A;  4M9S A;  3HKZ A;  4F3Q A;  4B44 A;  4HW0 A;  3KYD B;  3RZO J;  1IW7 F;  4MQV A;  1HC8 A;  4II2 A;  3C1D A;  3VSK A;  3ZGK A;  4K2E A;  5J8F A;  4E7L A;  3OSG A;  4OIO F;  1AA7 A;  5KCM A;  4M3F A;  3F6V A;  3E1S A;  3CJR B;  3PQJ A;  4EAT A;  2G7H A;  2DA6 A;  4YIF A;  3MKW B;  2DA7 A;  2OUM A;  4ZTF A;  3F72 A;  1ZAO A;  3KIO A;  1MBF A;  2E34 A;  3OYH A;  3B73 A;  1WPK A;  1X1C A;  1VI0 A;  5D6F A;  4CZZ A;  1BIA A;  3BR1 A;  1JTY A;  2DMP A;  4HDV A;  4IHV A;  1YG2 A;  3CP8 A;  2FNP A;  2EFP A;  2DK8 A;  3M8F A;  5EYR A;  4A3E J;  4IHS A;  3NRV A;  4EVI A;  3F21 A;  3H9J A;  5E79 C;  4Y13 A;  5LHH A;  1QBJ A;  1UJ8 A;  3M8E A;  3K70 C;  2L4A A;  1Y8Q B;  1I1S A;  4HV6 A;  2OV7 A;  2ZFU A;  3KE2 A;  1LQ1 A;  1HOM A;  2E5N A;  1VZ0 A;  3MKL A;  2V1X A;  3ASO H;  4IHT A;  2LNB A;  4CCM A;  5HLH A;  5DUI A;  4U88 A;  5IOY A;  2JRM A;  1B4A A;  4MFD A;  4A0Y A;  2NAZ A;  1KYW A;  5BMZ A;  4A3K J;  2Z5U A;  3DPL C;  5JI6 A;  1T8I A;  2NVX J;  1ON1 A;  3G73 A;  1W7P D;  3CCJ I;  4CCK A;  2LP0 A;  3RJP A;  3WHB A;  2A5W A;  1LVA A;  5K7H A;  1IN4 A;  4AYB A;  1OKR A;  3ZQG A;  2M30 A;  2XIG A;  2DBB A;  3LA3 A;  3BOQ A;  1V5F A;  2VPR A;  2ECB A;  3BJA A;  2ZNZ A;  5AIP A;  1LFU P;  2NNN A;  3RI4 A;  5GAD J;  3HRS A;  1HSJ A;  3F9K A;  3ROU A;  3L2C A;  1JKO C;  2X1C A;  4FX4 A;  2KL4 A;  1OPC A;  1Y0N A;  3GF2 A;  1JJ8 C;  1IGN A;  4B47 A;  1MMN A;  1FMV A;  4W1U A;  1BOA A;  2R7R A;  1XDU A;  1ZQ3 P;  4RM3 A;  4IPA A;  1VQ4 I;  2W85 A;  4IRI A;  2GOM A;  3QYF A;  3ML6 A;  3WTU C;  3M07 A;  1XC5 A;  4JX5 A;  4P5O A;  3S3M A;  2NVQ J;  3SDG A;  2L3D A;  3O3K A;  3CCR I;  4QPQ A;  4DW6 A;  2KT0 A;  3W2V A;  1X4P A;  2PMZ N;  2LF8 A;  5EDN A;  2Y69 H;  4OOI A;  4BQQ A;  2BXZ A;  2LFB A;  1UAA A;  1FOK A;  4E70 A;  3CJQ B;  3NWS A;  3BC8 A;  3M9A A;  5BPI A;  2R5Z A;  2F4O B;  2R7S A;  3F0C A;  2UV1 A;  4A0X A;  2KZG A;  3RTR A;  3ZCO A;  4C3H J;  2Y30 A;  2GQQ A;  2PMU A;  2WAE A;  3WGI A;  2F48 A;  2NXN B;  3ECH A;  3WU1 B;  5FRN A;  5ICF A;  2E1O A;  1ETV A;  1QO0 D;  4AUX A;  4ZH4 F;  3PSI A;  3JRH A;  4A3B J;  1D8J A;  3GFI A;  1B72 B;  2E60 A;  2D45 A;  2K9L A;  4N4N B;  4XRM A;  3P9I A;  4UUT A;  1MMA A;  3MD2 A;  3L2W A;  5CVJ A;  2A05 A;  9ANT A;  3OYN A;  4CO8 A;  2IS4 A;  1O7F A;  2JUG A;  2DTZ A;  3FMQ A;  3Q5F A;  4RS8 A;  1YLF A;  2VKD A;  4B3A A;  5FGM A;  3B02 A;  2K5C A;  3BG5 A;  3QPS A;  5HLG A;  3D5R C;  3RKQ A;  4DNC A;  3AG4 H;  1T08 B;  2W84 A;  2OF7 A;  4N4O B;  1TT0 A;  5GTI C;  2R92 J;  4HZF A;  1TC3 C;  4XR6 A;  5F1J A;  1G3S A;  3GYH X;  2EZH A;  3B6A A;  4OWR B;  3KLN A;  1MKM A;  4ZJZ A;  1FYL A;  2LF7 A;  3MFK A;  4G6D A;  4ZZD A;  1LDJ A;  3FDY A;  1JUS A;  2IGN A;  2WY7 Q;  2OZ6 A;  1WRJ A;  2HU9 A;  3I4P A;  2NYX A;  4F91 B;  3FMS A;  4EJT A;  2OC6 A;  3S1Q J;  2DLL A;  4O5V A;  4U0V A;  3PUB A;  2GXG A;  4W97 A;  2KZV A;  3DCF A;  2E2H J;  1X1B A;  2LKP A;  2ETH A;  3C18 A;  5HDG A;  2CQ7 A;  3QOP A;  5DCF A;  4OAY A;  3TP0 A;  2FJ1 A;  4HYE A;  4PCQ A;  3RPQ A;  1QNT A;  2O0Y A;  1IN8 A;  1JKQ C;  3WE2 A;  3R60 A;  1FY7 A;  2GAU A;  4LD5 A;  1HXD A;  3TL4 X;  4F55 A;  3IRR A;  2OU2 A;  2X48 A;  2VI6 A;  3DTE A;  1OCC H;  2LBF B;  2FX0 A;  2STT A;  1ZYR F;  2HR3 A;  3S17 J;  1FP2 A;  4HEA 2;  1Z0X A;  1VQ9 I;  1EH6 A;  3K4K A;  3OIQ A;  1QVU A;  4RM2 A;  4AWX B;  3WTY C;  2N8G A;  2HOE A;  3SZT A;  2E35 A;  2A07 F;  3CME I;  3DU5 A;  3HOU J;  2M0M A;  1S29 A;  2PJR B;  3MVP A;  3WTX C;  4PJN A;  2HTS A;  2VC0 A;  1P4X A;  4ZYA A;  2DOE A;  1W5C C;  2EA4 A;  2FF4 A;  4U7D A;  1U78 A;  1J75 A;  4KIT B;  4RLQ A;  2ECC A;  3E7L A;  1FZP B;  1MDM B;  1JXS A;  1YIT I;  3QYE A;  2VOD A;  4EJO A;  2MAB A;  3HSE A;  5E3N A;  4PDK A;  1HST A;  1TWA J;  2UWM A;  2HVR A;  3I3L A;  1PUE E;  2HGC A;  3BTJ A;  3B6C A;  2VQG A;  5E8I A;  2V26 A;  1HBX G;  2HZT A;  1SMT A;  1BC8 C;  2VOO A;  5GTH C;  3W2A A;  2M4K A;  3TOB A;  3E6D A;  1LJ9 A;  2PX9 A;  4ZDP A;  1WVR A;  5FLV A;  3HOW J;  2XV4 S;  4KT5 C;  4P9U A;  3GFL A;  4BDY A;  2IS1 A;  2XPW A;  2HEO A;  1FTZ A;  3S16 J;  2P4W A;  3CCU I;  3WOD F;  3S93 A;  1O7L A;  4DJA A;  2CFO A;  2Y31 A;  3W2W A;  4EJW A;  1SD5 A;  1RI7 A;  3H5N A;  3BP8 A;  3WGH A;  2UZK A;  2HOA A;  3J80 Z;  4A69 C;  2Q0O A;  3H1C A;  3JCU C;  3I64 A;  1JT0 A;  2R93 J;  2DA4 A;  2W4S A;  5E3L A;  1VQO I;  4BBS J;  3FX3 A;  2MBF A;  3E5X A;  2L54 A;  4D5C A;  3FXU A;  1DDN A;  1DQU A;  2BY1 A;  2YS9 A;  4LIT A;  3KEY A;  3VSL A;  5JHU A;  2G0E A;  4M71 A;  4D0P A;  3MKY B;  3FXJ A;  3C7J A;  1RNL A;  2VT2 A;  1B72 A;  1MBE A;  2Y9Y A;  3A1Y A;  1I3Q J;  1A6I A;  1JUM A;  5J6X A;  4A3G J;  3DBH B;  3RDI A;  4KA4 A;  2F5F A;  4MIM A;  4HNT A;  1F36 A;  3JRG A;  1DPR A;  3SEZ A;  5ERI A;  2QEN A;  2R5Y A;  3LAP A;  2BOL A;  2HFH A;  2HZD A;  3QWL A;  1LB2 A;  4I09 A;  3KP7 A;  1KU7 A;  1P7I A;  2Z3Y A;  2HWV A;  3AFH A;  1E3O C;  4DQ2 A;  3GEZ A;  1I39 A;  4YFN F;  5CVI A;  3IHU A;  2P8T A;  3V42 A;  1X58 A;  1S8N A;  2AQE A;  2HXO A;  3FZV A;  3DEU A;  1O3T A;  4HQE A;  3U2R A;  5GAE J;  3E5Q A;  1F43 A;  2ZCW A;  4BEH B;  4XM3 A;  3VDX A;  1GV5 A;  1ULY A;  2HYJ A;  3IV5 A;  5KK1 A;  2Y0M A;  3ABL H;  3COA C;  5F64 A;  2DJI A;  1OCO H;  4E4H A;  5K7Z A;  3LSR A;  3PO3 J;  1T2K A;  3ZOB A;  3KFW X;  3UR3 C;  2KRC A;  3GTJ J;  3EET A;  3GUD A;  3S1N J;  4LJZ F;  2O8X A;  3HC7 A;  1W1W E;  1X1D A;  3M8J A;  3DKW A;  5FKO A;  3HTU A;  3IAM 2;  1T38 A;  3S8P A;  1MSF C;  1O3R A;  3T0Y A;  2K9M A;  4YII A;  2M7A A;  2RKH A;  3CMM A;  3GZ6 A;  1K4T A;  1ODD A;  5H20 A;  1D0Y A;  3JR9 A;  3OWT A;  2YR2 A;  3GCM A;  2W1O A;  1KA8 A;  5F0C A;  2KJC A;  4IX7 A;  5AIQ A;  4U0W A;  3L2R A;  2QSF X;  2LBF A;  1USS A;  5EZG A;  3AG3 H;  1VQP I;  1FOY A;  4Q47 A;  3H0G J;  1BC7 C;  3RPU D;  3CDI A;  3N05 A;  2W24 A;  1QRY A;  4D5F A;  3MZH A;  3OS2 A;  2FE3 A;  1DU6 A;  4CSW A;  2PJR A;  1VQ5 I;  3L9F A;  1G59 A;  5FRO A;  4XIC A;  4DGW B;  1HDD C;  1SD4 A;  2XB0 X;  2H6C A;  2CQK A;  3WHC A;  1FX7 A;  3VYT B;  3DPT A;  1MDM A;  4M72 A;  4ENM A;  2HPI A;  2F5V A;  2RN7 A;  3OYB A;  1FMW A;  1R9T J;  3PSF A;  2LVS A;  2VKH A;  2QBY A;  2AO9 A;  3OL3 A;  5ILU A;  1QZE A;  5KHD A;  3BR5 A;  1K4S A;  4ZYE A;  2QUF A;  4PSW A;  3TO9 A;  2MA3 A;  4EGY A;  1ZLK A;  4M9Z A;  2MFZ A;  1Y1V J;  2F2E A;  1BIB A;  1ZR2 A;  1WHU A;  1Z3X A;  1CF7 B;  3HJE A;  3PNY A;  3MMY B;  3BR2 A;  4FQG A;  3KP4 A;  1BA5 A;  1R23 A;  2ESN A;  2GBY A;  5J1Y A;  3H3V K;  4A3C J;  2CV2 A;  4EJU A;  2X6Y A;  3HIF A;  2RQP A;  3HRU A;  2CWE A;  1JUP A;  1UCR A;  3K1M A;  2VJ5 A;  1UB9 A;  3OYF A;  3VOD A;  5EG0 B;  2RNJ A;  1UEL B;  4IHX A;  5BNG A;  1FSH A;  4IHY A;  1T98 A;  1ZGA A;  2WAQ N;  2XKP A;  4KDP A;  5LGN A;  1EF4 A;  2R7U A;  1ZR4 A;  1VQL I;  2EIL H;  2IBD A;  4XON A;  4ENN A;  4FTH A;  1UHW A;  3LFU A;  2D2W A;  4OIN F;  3W3C A;  3HOS A;  2L9N A;  4CZC A;  3DWL E;  2M1B A;  2DA5 A;  4RGR A;  2HPM A;  1IN7 A;  2DFF A;  3RYP A;  1TNS A;  3CCY A;  3QAH A;  1IN5 A;  1EJ9 A;  4XKW A;  3JRB A;  3BRO A;  2BVL A;  2Y48 A;  2M87 A;  3O6B B;  2OA4 A;  3PUF A;  3S14 J;  3CCM I;  1Z77 A;  2WWY A;  3BR6 A;  4H4K C;  2FEZ A;  3AKZ A;  1VFC A;  2ZB9 A;  5ILS A;  2QGU A;  4IVN A;  5CKT A;  1YIO A;  2MYS A;  1YW8 A;  5LGU A;  3VYU B;  4BUP A;  1UHM A;  5J40 A;  1K6O A;  1HKT A;  1JT6 A;  2VBY A;  4M3E A;  4UHT A;  3G4S I;  3IAS 2;  1U2W A;  4XLP F;  3K70 D;  3IL2 A;  4BEH A;  3OIP A;  2LYC A;  2DYS H;  3J80 K;  4EEF G;  2ADU A;  5D5X B;  4UB8 C;  2O7O A;  4A93 J;  5C4X J;  1SFK A;  1JKP C;  1GDT A;  4MGR A;  1QHG A;  2VIX A;  2WV1 A;  1XCB A;  2ZXW H;  4L5E A;  1H9T A;  4XLN F;  4ZC3 A;  5F08 A;  4S0H B;  2RVC A;  1MJA A;  4A3J J;  4HA8 A;  1I6H J;  1V5G A;  4A6D A;  5EEA A;  2A68 F;  2IS2 A;  2CV1 A;  1XGO A;  3ABK H;  4J19 A;  5L3C A;  3S2W A;  4XNF A;  4HLX A;  2DOD A;  3E3V A;  4B3X A;  2L2O A;  4H0E A;  4BE1 A;  1TLH B;  4HDU A;  3T8R A;  2DA3 A;  2P5V A;  3VFZ A;  5EGO B;  3OYJ A;  4Y52 J;  3LMM A;  5EEG A;  3Q0U A;  2R7T A;  3RKW A;  1VQK I;  3GXO A;  2YUS A;  3WG9 A;  3DPU A;  1XSD A;  1CQT A;  1FIA A;  2VJI A;  3Q0W A;  5K1Y A;  4AID A;  1X1A A;  2X9D A;  5D8L B;  2A3S A;  2VPL A;  5JHF A;  1R6R A;  1SVO A;  2NVU B;  1WJE A;  3BZC A;  1FC3 A;  1G4D A;  2P5L C;  3RKY A;  3LAJ A;  1NTC A;  4RB0 A;  5K5R A;  3AAF A;  1V54 H;  3SDB A;  3TMO A;  3WG7 H;  3K9T A;  4G7H F;  2I10 A;  2WAD A;  1G3Y A;  4P96 A;  2Y9Z A;  5AON A;  1RKT A;  3ABM H;  5DD4 A;  1BJZ A;  1XS9 A;  3HSF A;  3PFY A;  2PQ8 A;  2JPC A;  2IXS A;  4N0B A;  1RRJ A;  5IOZ A;  1S9H A;  2KQR A;  3LFK A;  5FO5 A;  3K6G A;  1MJB A;  2OZU A;  3VYS B;  3CD6 I;  3OYM A;  1MND A;  1CF7 A;  1NK3 P;  2PI0 A;  3BQZ A;  4HF2 A;  4DYR A;  3FXM A;  2H94 A;  3H9Q A;  3I4M J;  3DBR B;  2P5K A;  4BY1 J;  4HF1 A;  2BY0 A;  2XAG A;  5FKK A;  4RAZ A;  3HOY J;  4C30 A;  1BN5 A;  4PJJ A;  1YO5 C;  2H6B A;  3CCV I;  5BOX A;  3BJO A;  4MLO A;  2Q8K A;  1OQY A;  5M3M J;  1S7O A;  1X19 A;  2K3F A;  1VQ8 I;  1TWC J;  2JJ7 A;  1BW6 A;  2ME6 A;  4IEJ A;  1IV8 A;  2JA8 J;  3ELK A;  4L5I A;  3K2Z A;  1L3L A;  2DK5 A;  3OR1 C;  1R5G A;  1BI3 A;  1J59 A;  1IO2 A;  1E2X A;  1GXQ A;  2F5C A;  2PG4 A;  4L9N A;  1S3J A;  4Y15 A;  3FM5 A;  2P7C B;  1UHS A;  2HYF A;  2QF7 A;  1V5E A;  4EQQ A;  4AIH A;  1XSV A;  5ICG A;  3CLQ A;  5FKM A;  1WJD A;  2HDC A;  3TGN A;  2WA0 A;  2WAF A;  1MNM C;  3RPU A;  3U1K A;  4HOB A;  4I76 A;  1PP7 U;  2DFH A;  5LRS A;  3VEP A;  2JT1 A;  3MN2 A;  4C2M J;  1H0M A;  3R6S A;  3ZRG A;  1ZH5 A;  2CRG A;  2CJJ A;  2DMQ A;  2QQ9 A;  3GTO J;  1XMK A;  3HUG B;  1ZRE A;  6PAX A;  1NG6 A;  1QPI A;  2IEK A;  2HTJ A;  2L7M P;  4P9F A;  1FYK A;  3OYD A;  2E7X A;  3L2U A;  4XRS A;  2A69 F;  2M2E A;  3I5U A;  2QLZ A;  4CCJ A;  2ELH A;  1A35 A;  3JRC A;  1KU2 A;  4HF0 A;  2E19 A;  3FK7 A;  4V2G A;  1YRN B;  1TNT A;  5DTD A;  4YFK F;  1QGP A;  3KEO A;  3GTP J;  5J1U A;  2EV6 A;  3NWT A;  3IH2 A;  5HDN A;  2JRT A;  3AG2 H;  4KFC A;  2A6H F;  3OOU A;  2OQR A;  4BU2 A;  2P6S A;  3DFG A;  3IH3 A;  5IPA A;  2LOO A;  2K3P A;  5J3L A;  1LKX A;  4FX0 A;  3FIS A;  3FIW A;  2EK5 A;  3MZ8 A;  5E18 F;  4EM0 B;  2M8E A;  1XDS A;  2Y0S N;  5E1Z B;  4HSR A;  2NS7 A;  3BCB A;  5EGO A;  1SC7 A;  2VON A;  5E1W A;  2COB A;  2EV0 A;  2VKV A;  2X85 A;  2CW8 A;  2FOK A;  2HQR A;  5JR3 A;  2L4M A;  1XMX A;  3LL7 A;  2DU9 A;  5D4R A;  1X1P A;  1MBG A;  3D5S C;  4GGG A;  2KRH A;  2Q2E B;  4DIQ A;  4UUV A;  3JTH A;  3W6J B;  1P4W A;  2PLY A;  3R0A A;  3R4K A;  3CDH A;  5DS9 A;  3HL2 A;  2VQL A;  3H92 A;  1IRG A;  3Q9V A;  1KQ9 A;  1R22 A;  4EM1 A;  3S1M J;  2EIM H;  2K02 A;  2PN6 A;  1Z6R A;  1BOB A;  4QLC U;  2Z16 A;  4ASN A;  3O8H A;  4GDF A;  2ZXI A;  1E0E A;  4WXH A;  1R00 A;  3BTI A;  4PFO A;  5ICE A;  3PIP F;  3A4C A;  1ZG1 A;  3PJR A;  1PP8 F;  4ZZL A;  4OIP F;  4AVP A;  1LFP A;  3JRF A;  2DXI A;  1MH4 A;  1X3Z B;  3ABU A;  4TV7 A;  3F8M A;  3BY6 A;  4G94 A;  3S3N A;  2DW4 A;  4AIJ A;  1O4X A;  3HRT A;  3CUQ B;  2DJN A;  4A3L J;  1WJF A;  1ZAR A;  2ZO4 A;  1FWZ A;  4ESB A;  1XG1 A;  1QU3 A;  2EFN A;  4LK1 F;  1DGR M;  1U0J A;  3RQ4 A;  5EF6 A;  3FKJ A;  1FP1 D;  2EIK H;  4KN7 X;  2CW0 F;  4JK1 X;  4IRG A;  1ERD A;  4GO1 A;  2VJJ A;  4G7Z F;  3QPT A;  2A5Y B;  2JUC A;  3E97 A;  3OYA A;  4XBF A;  1IG7 A;  3AG1 H;  1YJN I;  1J7K A;  2GIZ A;  1A6Q A;  1FOX A;  4LGW A;  2X6W A;  1AHD P;  3DQV C;  3K7A J;  4BHB A;  3GO5 A;  2FU4 A;  5CVV A;  2HQA A;  4Q4Z F;  1LUJ B;  2LSO A;  3OYG A;  4NQW B;  4A0Z A;  2EZK A;  4FE7 A;  1SFU A;  1KU3 A;  2YU3 A;  4BNC A;  1YHQ I;  4IJA A;  2XB5 A;  1EKE A;  2GWR A;  1PVE A;  3ERE D;  5HOO A;  2CUF A;  2EA2 A;  1HKS A;  1MW7 A;  4LOC A;  1VQN I;  5TGT A;  4ZYD A;  1T6S A;  4BE2 A;  4E7H A;  3K1P A;  3NQO A;  1A31 A;  5IT9 Z;  5LBQ A;  1T39 A;  2ZXJ A;  4S04 A;  2KDO A;  3QU6 A;  1OLT A;  3GLL A;  4C3I J;  4F93 B;  2BW3 B;  1H89 C;  4GRI A;  3F22 A;  3CUQ C;  3KX2 A;  2VE9 A;  3WU2 C;  5FLM J;  2BYV E;  2QSG X;  1E3P A;  2MH9 A;  1AU7 A;  4U7B A;  3CF2 A;  3SFZ A;  2DT5 A;  3G71 I;  1PDN C;  2CMP A;  3LOC A;  2R4G A;  3HUG A;  4FCY A;  2KIS A;  3ESW B;  1RKW A;  2UXX A;  2E2I J;  1XD7 A;  1SFE A;  1R58 A;  3P9K A;  4BJT A;  1WQ2 A;  2QSH X;  3DTI A;  2L9R A;  5C3E J;  3G3Z A;  2ID3 A;  5HLI A;  3BPV A;  1T95 A;  4V19 K;  1Q1H A;  3FF5 A;  5B3S H;  1OR7 C;  1WJ5 A;  2WBM A;  3HEF A;  3ISP A;  4KJZ A;  2XGD A;  4E7Z A;  4UUS B;  1YRN A;  1B59 A;  2DMU A;  2RV8 A;  2M8G X;  4V2F A;  4G12 A;  2PFB A;  3LSG A;  5D4S A;  4IOA F;  1U8B A;  5GAH J;  3SZG A;  2F5D A;  2WB1 N;  2CQQ A;  4M3B A;  2GA2 A;  5HNF A;  4BE0 A;  5FLX Z;  5F04 A;  2ESH A;  4ESF A; 
#chains in the Genus database with same CATH homology
 1EH8 A;  2HKO A;  5DEQ A;  1BBY A;  1B9M A;  1XMA A;  3T1B A;  4RGX A;  2K86 A;  1YTY A;  4I98 B;  4EV0 A;  3M7G A;  4B8X A;  5DDG A;  3TKY A;  3WU0 A;  2Q2E A;  1IAW A;  4WXC A;  2O03 A;  5CJ9 A;  2CGP A;  2DFI A;  4O6J A;  3VOE A;  1HW2 A;  4B09 A;  3KLO A;  3L09 A;  1REP C;  4MNU A;  4I01 A;  2K4B A;  2XAF A;  4XSZ F;  2EWN A;  1ZN2 A;  3N97 A;  3CUQ A;  3J81 Z;  1U3E M;  3PQK A;  1LEB A;  1JHF A;  1ON2 A;  2VE8 A;  4N9H A;  1FT9 A;  2L01 A;  5F6F A;  3GZ5 A;  4A2U A;  2BGC A;  2VN2 A;  2L02 A;  3H3Z A;  2EV5 A;  1SMY F;  2NS0 A;  1OR7 A;  2IA2 A;  3RKX A;  4CYD A;  1UFM A;  2X0L A;  1Z9C A;  2ACJ A;  1IXR C;  3F8F A;  1VTN C;  4YFX F;  4WX9 A;  4KMU X;  2H27 A;  4LFU A;  5DCM B;  3KP5 A;  3K69 A;  2KJB A;  3P7N A;  3BPX A;  4CXF A;  1IXC A;  2K7L A;  3WTZ A;  2OD5 A;  2QWW A;  4WXD A;  2EFO A;  4OMZ A;  4GYG A;  1SFX A;  3GFJ A;  1IN6 A;  4LMY A;  1GVJ A;  3VB2 A;  3HTS B;  2MD5 A;  3TDZ C;  2AXL A;  2R7D A;  2YX7 A;  1TBX A;  1G6N A;  3ABT A;  1W5T A;  4WK8 F;  4MTD A;  2QQA A;  3LQQ A;  4UXN A;  4M6X A;  1ONV A;  1OMI A;  1F5T A;  3FXQ A;  2A61 A;  1Z05 A;  2VBW A;  5IT9 K;  2DQR A;  2DAO A;  4ENK A;  2FMY A;  1R1V A;  4ON0 A;  5L3E A;  5E8G A;  1BJA A;  3KZY A;  3CLO A;  1GXP A;  4BHC A;  4I2O A;  1RZ4 A;  5EEH A;  3HYI A;  3OOP A;  3I54 A;  4Q48 A;  3T5X A;  3FMR A;  5FD6 A;  2G9W A;  2EFQ A;  1RIO H;  5E20 A;  4EJV A;  4NHJ A;  4QWQ A;  4YG2 F;  1WWX A;  3E6C C;  3ZQ7 A;  2MLK A;  4ESJ A;  2VC1 A;  4BQA A;  3MCZ A;  1S6L A;  1YQA A;  1FPQ A;  2XVC A;  4KIC A;  3IKT A;  3KP6 A;  3E5U A;  1XGS A;  4L9V A;  1Y0U A;  5E17 F;  2BV6 A;  5FLX K;  3SHF A;  3DP7 A;  4FHT A;  2FXA A;  3FWE A;  1UST A;  1J2X A;  4WF2 A;  1TW3 A;  2XUB A;  2RGV A;  5L3B A;  3JTG A;  2D1V A;  5L3G A;  4BH9 A;  4KIG A;  3JSO A;  1YS7 A;  1ZG3 A;  3H3U A;  4PZJ A;  4OU0 A;  1MD0 A;  1XN7 A;  4WCG A;  3HSR A;  4CGZ A;  1I27 A;  3KEQ A;  4A5N A;  4L9T A;  1B9N A;  5TJJ A;  1IUY A;  4R1H A;  5CVR A;  5DCM A;  4L5J A;  4KYW A;  4WWC A;  4HQM A;  3J81 K;  4L9J A;  4XSX F;  3ZMS A;  5BS6 A;  2E1C A;  3L7W A;  1R7J A;  3MZY A;  2DO7 A;  3REO A;  4KIB A;  4CHU A;  3WTV C;  1D8K A;  3LWF A;  1R36 A;  1L0O C;  1P2F A;  5KVR A;  2KIM A;  5DV5 A;  2LDU A;  1GHC A;  3L00 A;  2QQB A;  2KIF A;  1V3F A;  3V4G A;  3J7A O;  1P6R A;  5HS8 A;  4OIQ F;  4BAY A;  1R5H A;  4ZYH A;  3GW2 A;  1KGS A;  5FD5 A;  3LST A;  4PGH A;  1J5Y A;  3KZZ A;  1YS6 A;  4I0B A;  2Z99 A;  5J8C A;  2RDP A;  4AIK A;  1ZGJ A;  3F6O A;  1FNN A;  3GWZ A;  1AWC A;  1P92 A;  2O6G E;  4RB3 C;  4JBA A;  2W25 A;  2Y75 A;  2XRO A;  4CIC A;  2ZNY A;  1IF1 A;  5K5O A;  3GVA A;  4UVC A;  1V4R A;  4UNO A;  1YFH A;  4S05 A;  1KYZ A;  3TO7 A;  3M1E A;  2ISZ A;  1W5S A;  2PMH A;  4G6Q A;  3I53 A;  1LDK B;  2A6E F;  4R8H A;  2QZ8 A;  3IWF A;  1K78 B;  3WTW C;  3EYY A;  3IWZ A;  2HS5 A;  1HW1 A;  4UV8 A;  2GA1 A;  1S7A A;  2ZBK A;  1ZRD A;  1YYV A;  5LLQ A;  1BI0 A;  1FYM A;  3JSP A;  5DYM A;  3CJN A;  5TRD A;  2QM3 A;  1XGM A;  3F3X A;  3LQR A;  2DI3 A;  2XHK A;  2CO5 A;  4G9Y A;  2FNA A;  1WSU A;  1G3T A;  5ILV A;  3U9G A;  4KUM A;  1J0R A;  2IJL A;  3IRQ A;  1K7A A;  4Y17 A;  5FB2 A;  1ZHF A;  5LHI A;  2B0L A;  2FBH A;  3V8J A;  4Q5S F;  5L3D A;  4EM2 A;  3V7C A;  3ULQ B;  5FFZ A;  4G7O F;  2XGX A;  1RUN A;  2M5W A;  4HBL A;  1J9I A;  2YX4 A;  1LNW A;  3BZ6 A;  2JSC A;  2ZFW A;  4A6E A;  2ZJ2 A;  2YSR A;  1XCV A;  3NEU A;  3N4M A;  2JTV A;  4HX8 A;  1FSE A;  2EB7 A;  2O61 A;  3ZMT A;  3OV8 A;  3WTS C;  2DQL A;  3KP3 A;  4PGG A;  3I58 A;  2KIU A;  5LEJ A;  3K1N A;  2RC4 A;  5ED4 A;  3BDD A;  1SAX A;  5D5U B;  3V8K A;  3QU3 A;  4R79 A;  1JE8 A;  4NB5 A;  1K79 A;  1MGT A;  3F8C A;  5CVU A;  3F8N A;  1OYY A;  3DF8 A;  2VBX A;  1P4A A;  3HHH A;  5IT3 A;  4MQ9 F;  4RGS A;  3CO7 C;  3C3W A;  5LHG A;  1FBS A;  3ZMZ A;  2BE5 F;  4LK0 F;  2V1D A;  3SQN A;  1FLI A;  1K78 A;  4MTE A;  2IA1 A;  2YPR A;  3V8L A;  2JZY A;  1W7P B;  2QVO A;  1F1Z A;  2X4H A;  5HVQ C;  2FSW A;  4UV9 A;  2NNY A;  1U5T B;  3CTA A;  3ZMU A;  2PEX A;  2FBI A;  1TW2 A;  3EQL F;  4GXO A;  3D0S A;  4RB1 A;  2MLG A;  2CSO A;  2XAQ A;  3QRF F;  4M74 A;  3DV8 A;  1MZB A;  3TQN A;  5A2Q Z;  1CGP A;  2W57 A;  1R1U A;  4P55 A;  4BHP A;  1JGS A;  3EDP A;  1H9G A;  3SZP A;  2XAJ A;  2PBI A;  2VBZ A;  2WV0 A;  2XRN A;  2G7U A;  5H6R A;  1XB4 A;  1XGN A;  4O3M A;  2DPU A;  3ECO A;  4OMY A;  1QZY A;  1TQI A;  3BWG A;  1STZ A;  3KP2 A;  2OQG A;  3F23 A;  1TQM A;  4M9X A;  4KN4 X;  4MEY F;  1U5T C;  2XAH A;  4M6Y A;  4EMS A;  5HS7 A;  3ZMD A;  2KKO A;  5K5Q A;  3GFM A;  4G8X A;  1WI9 A;  2HKX A;  2XAS A;  5HDK A;  2CG4 A;  4L0Z B;  1HW5 A;  3GX4 X;  2QBY B;  2FML A;  2MC3 A;  3ZPL A;  1I5Z A;  2IPQ X;  1ZG5 A;  5D5V B;  3GLX A;  2WTE A;  4HV5 A;  2EJR A;  4UVA A;  4KNY A;  2K4J A;  3F8B A;  3LA7 A;  1U6G A;  1ZRF A;  4U0Y A;  1F9N A;  3QPH A;  1B1B A;  1WKM A;  1FBU A;  1X3U A;  3U1D A;  4LLN A;  2GIV A;  5CYV A;  5BPD A;  3WGG A;  2P6T A;  4GCV A;  1OYI A;  3MQ0 A;  1AOY A;  3JAM Z;  5LEK A;  4CDG A;  1YW9 A;  2C6Y A;  5JFR A;  4A12 A;  1LEA A;  4ENJ A;  4NQW A;  3HOT A;  2H09 A;  3TDU C;  1DPU A;  4L0Y B;  4HX7 A;  1C0W A;  3KET A;  2VT3 A;  2R7F A;  1T0F A;  3ZP5 A;  3JW4 A;  4A5M A;  1F4K A;  1XSX A;  4IF4 A;  2M45 A;  4Z2Y A;  4UVB A;  3HHG A;  1I1G A;  4KIF A;  3MWM A;  1W7P A;  5L3F A;  2GXB A;  3D5L A;  5D5W B;  2VXZ A;  2JPB A;  3TOA A;  3I59 B;  1U5T A;  4M73 A;  1KU9 A;  4I7H A;  2J5P A;  1B6A A;  3EYI A;  1DP7 P;  1FBQ A;  4RGU A;  4N9I A;  2NRA C;  3WTT C;  2ZME B;  5D6E A;  2V9V A;  1IXS B;  1SD6 A;  1SD7 A;  2OBP A;  2OAZ A;  2IRF G;  2IA0 A;  1D3Y A;  4JQF A;  3FXR A;  2CYY A;  3DXJ F;  4GYI A;  3E6M A;  2K27 A;  4LG0 B;  5ICC A;  2HQN A;  4AD9 A;  5CLS A;  3KCC A;  1TTY A;  1U8R A;  2O3F A;  3V7S A;  2STW A;  3I0T A;  1IZ1 A;  2V1U A;  1EV7 A;  3Q9S A;  5JVT A;  2IP2 A;  1A04 A;  3W6K B;  1O3S A;  2AS5 F;  5F1R A;  4LLL A;  5A2Q K;  2MH2 A;  1KQ0 A;  3P9C A;  1O3Q A;  2Z33 A;  2UXN A;  3R61 A;  1BM9 A;  3R0J A;  1JHH A;  3QP6 A;  1YW7 A;  2TDX A;  5LGT A;  5HS9 A;  2FQ3 A;  3E6B A;  1TQP A;  1Z7U A;  2J5O A;  3MAJ A;  5DUK A;  2IW5 A;  1I6X A;  2R3S A;  3WE3 A;  3CO6 C;  4BYY A;  3O2P E;  4RAY A;  3TO6 A;  2Z9O A;  1ZLJ A;  1O57 A;  4HLY A;  1ZRC A;  3RYR A;  3EUH A;  4MHG A;  1BI2 A;  1E17 A;  5E1X A;  4FT8 A;  2KRF A;  2V6C A;  3LA2 A;  5D8K B;  3IKV A;  4KMF A;  4I0A A;  1D5V A;  1KQ8 A;  4OIR F;  2FA5 A;  1QZZ A;  2HYG D;  5LRR A;  3FHZ A;  1QQI A;  1W4M A;  2P7V B;  5FFX A;  3I59 A;  1QPM A;  3IC7 A;  3MEX A;  1R1T A;  2WC2 A;  3T8T A;  2FBK A;  1Z1D A;  4HX4 A;  2F5E A;  2BEO A;  2IT0 A;  3CUO A;  2ZME A;  2E1N A;  4XRF A;  2EFW A;  1EH7 A;  3JAM K;  1BI1 A;  4RB2 C;  1MJ9 A;  3BJ6 A;  3V7R A;  2V79 A;  2COM A;  2VOP A;  1HQC A;  2E7W A;  5DD8 A;  4IRH A;  2IVM A;  2PJP A;  4LG0 A;  4EGZ A;  3ZN0 A;  3I71 A;  2CFX A;  1HKQ A;  2DPD A;  2QYO A;  2ZKZ A;  2XKO A;  2BBY A;  2DTR A;  4I02 A;  4L18 B;  3ZN1 A;  3K0L A;  2D1H A;  3HRM A;  1G3W A;  4MEX F;  3SXY A;  4LB5 A;  4ETS A;  4LLG F;  4LB6 B;  2ESH A;  5H6Q A;  1DUX C;  1LDD A;  4HAM A;  1RUO A;  1Z91 A;  1IRF A;  3ZMV A;  1Z6T A;  5BQT A;  4F7Z A;  3RIR A;  4BXU A;  4ZYG A;  2FRH A;  2ISY A;  2GZW A;  1NHA A;  3QP5 A;  3FM3 A;  1OYW A;  4IXA A;  3PFI A;  4M9S A;  4HW0 A;  1IW7 F;  4MQV A;  4OIO F;  3C1D A;  5J8F A;  4K2E A;  3F6V A;  3PQJ A;  2G7H A;  4YIF A;  3F72 A;  1ZAO A;  3B73 A;  5D6F A;  4CZZ A;  1BIA A;  4HDV A;  1YG2 A;  2FNP A;  2EFP A;  2DK8 A;  3M8F A;  4IHS A;  3NRV A;  4EVI A;  3F21 A;  4Y13 A;  5LHH A;  1QBJ A;  3M8E A;  2L4A A;  1I1S A;  4HV6 A;  1LQ1 A;  3KE2 A;  2V1X A;  4IHT A;  2LNB A;  5HLH A;  5DUI A;  4U88 A;  1B4A A;  4A0Y A;  2NAZ A;  1KYW A;  5BMZ A;  2Z5U A;  3DPL C;  5JI6 A;  1ON1 A;  3G73 A;  1W7P D;  3RJP A;  1LVA A;  1IN4 A;  1OKR A;  2M30 A;  2XIG A;  2DBB A;  3LA3 A;  3BOQ A;  3BJA A;  2ZNZ A;  5AIP A;  2NNN A;  3RI4 A;  3HRS A;  1HSJ A;  3ROU A;  3L2C A;  4FX4 A;  1OPC A;  3GF2 A;  1BOA A;  1XDU A;  4IPA A;  2W85 A;  4IRI A;  3ML6 A;  3WTU C;  4P5O A;  2L3D A;  3O3K A;  2LF8 A;  4OOI A;  1FOK A;  4E70 A;  3M9A A;  5BPI A;  4A0X A;  3RTR A;  2GQQ A;  2PMU A;  3WGI A;  3ECH A;  3WU1 B;  5ICF A;  1QO0 D;  4ZH4 F;  1D8J A;  3GFI A;  2D45 A;  3P9I A;  5CVJ A;  4CO8 A;  1O7F A;  3FMQ A;  3Q5F A;  4RS8 A;  1YLF A;  5FGM A;  3B02 A;  5HLG A;  4DNC A;  2W84 A;  4HZF A;  1G3S A;  3GYH X;  3KLN A;  1MKM A;  1FYL A;  2LF7 A;  3MFK A;  4G6D A;  4ZZD A;  1LDJ A;  2OZ6 A;  1WRJ A;  3I4P A;  2NYX A;  3FMS A;  4EJT A;  2DLL A;  4O5V A;  4U0V A;  2GXG A;  2LKP A;  2ETH A;  3C18 A;  5HDG A;  3QOP A;  5DCF A;  4HYE A;  4PCQ A;  3RPQ A;  1QNT A;  2O0Y A;  1IN8 A;  3WE2 A;  3R60 A;  1FY7 A;  2GAU A;  4LD5 A;  1HXD A;  3IRR A;  2OU2 A;  2STT A;  1ZYR F;  2HR3 A;  1FP2 A;  1EH6 A;  4AWX B;  3WTY C;  2HOE A;  3SZT A;  2A07 F;  1S29 A;  3WTX C;  2HTS A;  2VC0 A;  1P4X A;  2EA4 A;  2FF4 A;  1U78 A;  1J75 A;  4U7D A;  1FZP B;  1MDM B;  1JXS A;  2VOD A;  4EJO A;  3HSE A;  4PDK A;  1HST A;  2UWM A;  1PUE E;  2HGC A;  5E8I A;  1HBX G;  2HZT A;  1SMT A;  1BC8 C;  2VOO A;  3TOB A;  3E6D A;  1LJ9 A;  2XV4 S;  4KT5 C;  4P9U A;  3GFL A;  2HEO A;  2P4W A;  3WOD F;  1O7L A;  4EJW A;  1SD5 A;  1RI7 A;  2UZK A;  3BP8 A;  3WGH A;  3J80 Z;  2Q0O A;  3I64 A;  3FX3 A;  2MBF A;  3E5X A;  2L54 A;  3FXU A;  1DDN A;  5JHU A;  4M71 A;  4D0P A;  3C7J A;  1RNL A;  2VT2 A;  5J6X A;  3RDI A;  4KA4 A;  2F5F A;  1DPR A;  5ERI A;  2QEN A;  3LAP A;  2HFH A;  1LB2 A;  4I09 A;  3KP7 A;  1KU7 A;  2Z3Y A;  2HWV A;  4DQ2 A;  3GEZ A;  4YFN F;  5CVI A;  3IHU A;  2P8T A;  1S8N A;  3FZV A;  3DEU A;  1O3T A;  4HQE A;  3U2R A;  3E5Q A;  2ZCW A;  1ULY A;  5KK1 A;  2Y0M A;  3COA C;  5F64 A;  1T2K A;  3KFW X;  3EET A;  3GUD A;  4LJZ F;  2O8X A;  3DKW A;  3HTU A;  1T38 A;  1O3R A;  3T0Y A;  4YII A;  2RKH A;  3GZ6 A;  1ODD A;  5H20 A;  2YR2 A;  1KA8 A;  2KJC A;  5AIQ A;  4U0W A;  1USS A;  4Q47 A;  1BC7 C;  2W24 A;  3MZH A;  2FE3 A;  3L9F A;  1SD4 A;  2H6C A;  2CQK A;  1FX7 A;  1MDM A;  3DPT A;  4M72 A;  4ENM A;  2RN7 A;  2QBY A;  5ILU A;  4ZYE A;  2QUF A;  4EGY A;  3TO9 A;  2MA3 A;  1ZLK A;  4M9Z A;  2F2E A;  1BIB A;  1CF7 B;  3KP4 A;  1R23 A;  2ESN A;  4EJU A;  3HIF A;  2RQP A;  2CWE A;  3K1M A;  1UCR A;  1UB9 A;  3VOD A;  2RNJ A;  1FSH A;  1T98 A;  1ZGA A;  4KDP A;  2XKP A;  5LGN A;  4ENN A;  1UHW A;  2D2W A;  4OIN F;  3HOS A;  2M1B A;  4RGR A;  1IN7 A;  3RYP A;  1TNS A;  3QAH A;  1IN5 A;  3BRO A;  2Y48 A;  2M87 A;  3O6B B;  2OA4 A;  2WWY A;  2FEZ A;  5ILS A;  4IVN A;  1YIO A;  1YW8 A;  5LGU A;  1UHM A;  1K6O A;  1HKT A;  2VBY A;  4UHT A;  4XLP F;  1U2W A;  3IL2 A;  3J80 K;  2ADU A;  5D5X B;  4MGR A;  1XCB A;  1H9T A;  4XLN F;  2RVC A;  1MJA A;  4HA8 A;  4A6D A;  2A68 F;  1XGO A;  5L3C A;  3S2W A;  4HLX A;  3E3V A;  4H0E A;  1TLH B;  4HDU A;  3T8R A;  2P5V A;  3VFZ A;  5EEG A;  3RKW A;  3GXO A;  3WG9 A;  1XSD A;  5K1Y A;  5D8L B;  2A3S A;  1FC3 A;  1G4D A;  2P5L C;  3RKY A;  3LAJ A;  4RB0 A;  5K5R A;  3AAF A;  3K9T A;  4G7H F;  1G3Y A;  4P96 A;  5AON A;  5DD4 A;  3HSF A;  2PQ8 A;  2JPC A;  4N0B A;  3LFK A;  5FO5 A;  1MJB A;  2OZU A;  1CF7 A;  2PI0 A;  4HF2 A;  2H94 A;  2P5K A;  4HF1 A;  2XAG A;  4RAZ A;  1BN5 A;  1YO5 C;  2H6B A;  5BOX A;  3BJO A;  2Q8K A;  1S7O A;  3ELK A;  4L5I A;  3K2Z A;  1L3L A;  2DK5 A;  1R5G A;  1BI3 A;  1J59 A;  1E2X A;  1GXQ A;  2F5C A;  2PG4 A;  4L9N A;  1S3J A;  4Y15 A;  3FM5 A;  2P7C B;  2HYF A;  4EQQ A;  4AIH A;  1XSV A;  5ICG A;  2HDC A;  3TGN A;  3RPU A;  4HOB A;  1PP7 U;  5LRS A;  3VEP A;  2JT1 A;  1H0M A;  3R6S A;  1ZH5 A;  2QQ9 A;  1XMK A;  1ZRE A;  6PAX A;  2HTJ A;  4P9F A;  1FYK A;  2E7X A;  2A69 F;  3I5U A;  2QLZ A;  2ELH A;  1KU2 A;  4HF0 A;  1TNT A;  4YFK F;  1QGP A;  3KEO A;  2EV6 A;  5HDN A;  2JRT A;  4KFC A;  2A6H F;  2OQR A;  2P6S A;  3DFG A;  4FX0 A;  2EK5 A;  5E18 F;  4EM0 B;  2M8E A;  1XDS A;  5E1Z B;  2VON A;  5E1W A;  2EV0 A;  2FOK A;  2HQR A;  5JR3 A;  2L4M A;  2DU9 A;  5D4R A;  4GGG A;  4UUV A;  3JTH A;  3W6J B;  1P4W A;  2PLY A;  3R0A A;  3R4K A;  3CDH A;  3H92 A;  1IRG A;  3Q9V A;  1KQ9 A;  1R22 A;  4EM1 A;  2K02 A;  2PN6 A;  1Z6R A;  4QLC U;  4ASN A;  4WXH A;  1R00 A;  5ICE A;  1ZG1 A;  1PP8 F;  4ZZL A;  4OIP F;  4AVP A;  3ABU A;  4TV7 A;  3F8M A;  3BY6 A;  4G94 A;  4AIJ A;  2DW4 A;  3HRT A;  3CUQ B;  1ZAR A;  2ZO4 A;  1FWZ A;  4ESB A;  2EFN A;  4LK1 F;  4KN7 X;  1FP1 D;  2CW0 F;  4JK1 X;  4IRG A;  4GO1 A;  4G7Z F;  3QPT A;  2A5Y B;  3E97 A;  4XBF A;  1J7K A;  4LGW A;  3DQV C;  4BHB A;  3GO5 A;  2FU4 A;  5CVV A;  4Q4Z F;  2LSO A;  4A0Z A;  1SFU A;  1KU3 A;  2YU3 A;  4BNC A;  4IJA A;  2GWR A;  3ERE D;  5HOO A;  2EA2 A;  1HKS A;  4ZYD A;  1T6S A;  3K1P A;  3NQO A;  5IT9 Z;  5LBQ A;  1T39 A;  2ZXJ A;  4S04 A;  3QU6 A;  3F22 A;  3CUQ C;  2VE9 A;  2BYV E;  2MH9 A;  4U7B A;  3SFZ A;  2DT5 A;  1PDN C;  3HUG A;  2UXX A;  1XD7 A;  1SFE A;  1R58 A;  3P9K A;  1WQ2 A;  3G3Z A;  5HLI A;  3BPV A;  1Q1H A;  3FF5 A;  3ISP A;  1B59 A;  2RV8 A;  2PFB A;  5D4S A;  2F5D A;  2GA2 A;  5FLX Z;  3HRU A;  4ESF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...