5FO5A

Structure of the dna-binding domain of escherichia coli methionine biosynthesis regulator metr
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
MIEVKHLKTLQALRNCGSLAAAAATLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTPQGEILLQLANQVLPQISQALQACNEPQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-TYPE TRANSCRIPTIONAL REGULATOR METR
publication title Structural Basis for DNA Recognition by the Transcription Regulator Metr.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5fo5A00
2R7DA 5LGNA 1P6RA 3IRQA 2E7WA 4WWCA 2FRHA 3HIFA 3JTHA 4M6XA 2A5YB 2V1UA 2QYOA 1J75A 3WG9A 5A2QZ 1K7AA 4I0AA 4Q48A 2GA2A 1FLIA 3TO6A 3JSPA 3IL2A 3MWMA 2JZYA 4EM1A 4Y13A 2OU2A 2OBPA 2STWA 3EQLF 2Y75A 2LF8A 3KZYA 3CDHA 4S04A 2HEOA 2PG4A 4XRFA 1HKTA 4CZZA 3CUQB 3E5UA 1FYLA 2W24A 1R58A 1J0RA 2HQNA 3ISPA 4IF4A 5FFXA 3VB2A 4YIFA 3F6VA 4Q47A 1ZGJA 3QOPA 3HTSB 2DFIA 4G8XA 4CICA 1LDJA 2FOKA 5JVTA 3FXUA 1I6XA 1T2KA 2Q2EA 2CWEA 3ZMSA 4BXUA 3V8LA 4UVAA 2GA1A 1KU3A 5LRRA 1YS6A 5DYMA 1BN5A 1R00A 2RVCA 5DD4A 2QQ9A 2Y0MA 3IC7A 3J81Z 3BJ6A 2H94A 2EJRA 2D1VA 1OYIA 4FT8A 1DPRA 3QP6A 1QNTA 4RB3C 4HDUA 1PDNC 2A68F 2MLKA 3R4KA 3EUHA 3HRSA 4JK1X 3HRUA 5BS6A 5CVIA 1FBQA 4AWXB 3JTGA 3E5QA 5D8LB 1Q1HA 3ZPLA 5EEHA 2ZNZA 1ZRFA 5HLGA 2W25A 4LK0F 4M74A 1BI3A 2HOEA 4IRIA 2LDUA 1K78B 4RB1A 1WWXA 1F4KA 2V9VA 1NHAA 3FXRA 2FMLA 1IRGA 5AIQA 4A6EA 4KMFA 2ISZA 4BH9A 4RB0A 1DDNA 2O8XA 4YFNF 3H3UA 2F5CA 4IPAA 1B9MA 2DQRA 2Z9OA 1S7AA 1BOAA 3KP7A 1Z05A 1U5TB 1CGPA 3V7SA 1J5YA 4QLCU 2ZCWA 2M5WA 4IRHA 2K86A 4WXDA 4IRGA 1U3EM 2EFOA 3F21A 1FYKA 3RTRA 4L9JA 3DEUA 1R23A 1ZLKA 5HVQC 2EK5A 3WTXC 2JT1A 4HLXA 2WV0A 5HS9A 1FOKA 3FF5A 1UFMA 1ON1A 5LGUA 2V6CA 3FXQA 4HDVA 5D5VB 4HV6A 4L0YB 3GFLA 2LNBA 3BROA 1RNLA 4HF2A 1MKMA 4L9NA 1R36A 2DQLA 2P6SA 3IWFA 2ETHA 4S05A 1D5VA 1T6SA 1PP8F 3CO6C 4YFKF 4QWQA 2XV4S 4N9IA 1KGSA 3E3VA 3ZMUA 3TQNA 1R1VA 5L3EA 2Q0OA 1FZPB 4ZYHA 5HS7A 3K9TA 3HSEA 1F1ZA 2FBHA 4RB2C 2ESNA 2LKPA 4EM2A 1FX7A 3LQRA 4LD5A 4PDKA 2JRTA 5ERIA 4PGGA 2Z99A 3U1DA 1EV7A 1HW1A 4E70A 1K78A 1U8RA 3BDDA 2BGCA 3HOSA 3EETA 3J7AO 2D45A 2HTJA 2XKPA 3RPUA 2K02A 3K69A 1XGSA 2FBIA 4P9FA 4EGYA 2ZXJA 1IAWA 1KU2A 2ZMEB 1LDDA 5D6EA 1XMAA 3J80K 2YX4A 5CVRA 3KP2A 1FSHA 2HWVA 1B6AA 4WXHA 1SFUA 1OYWA 2R7FA 4M9ZA 5F1RA 4M6YA 2RGVA 2EV5A 2FQ3A 1G3YA 1AOYA 1U5TA 2MH9A 2WWYA 4KA4A 4I2OA 4M72A 4LB5A 1MZBA 3KP3A 2IA2A 2O3FA 2CGPA 3E6MA 4L9VA 4EGZA 1STZA 2VONA 5FD6A 2V1DA 1FBSA 1JHFA 1H0MA 4EJOA 1YIOA 4HYEA 3RJPA 3R0AA 4L9TA 5HOOA 3PQKA 3FMRA 2VT2A 2VOOA 1XCVA 3JAMZ 2LSOA 4I09A 2HYGD 1B59A 2K7LA 1WKMA 1R1UA 3K2ZA 2F2EA 3V4GA 2NYXA 4D0PA 1AWCA 4IHTA 3S2WA 5IT9Z 1YG2A 4IXAA 3M8EA 1O7LA 5CVVA 3KCCA 3M1EA 1FPQA 2IVMA 1O57A 3SZPA 3KLNA 3ML6A 1KYWA 1HBXG 4L0ZB 5BPDA 5FB2A 1O3SA 4EV0A 4KIBA 1KQ8A 3KE2A 3R61A 2FMYA 2KIMA 2WC2A 1L0OC 4P55A 2PMHA 4ESJA 3VEPA 4LGWA 1OKRA 4YFXF 2JSCA 4UXNA 4RAZA 2QLZA 3JSOA 3N97A 2DPUA 1XGMA 2A6HF 1TBXA 4OMYA 1ZG3A 2QWWA 2EA2A 3DPTA 2CW0F 3HUGA 4GYGA 3GZ6A 1XMKA 3F22A 4M9XA 1IF1A 3IHUA 3TGNA 2XKOA 1UHWA 1HQCA 5H6RA 5ILSA 4HX4A 1KA8A 2P6TA 2H6CA 3HHGA 2CG4A 4N0BA 3IWZA 1W7PA 2VN2A 2XRNA 3WE2A 2LF7A 1YYVA 2W85A 2V79A 1LB2A 1G4DA 3GYHX 4ENMA 4KFCA 4EJVA 2EWNA 3R6SA 2HYFA 5D4SA 2ZNYA 4L5JA 1RI7A 4U0VA 2XAJA 1D8KA 4A5NA 4OMZA 2HDCA 1BIBA 4O3MA 3LA2A 2ZJ2A 2GAUA 3LWFA 3EDPA 4G9YA 4HF0A 3MZYA 2EFQA 2DLLA 1KYZA 2ZO4A 2MBFA 1O3TA 1IW7F 4WK8F 1XN7A 3BPVA 2L4AA 4UVCA 1FT9A 1T98A 3NEUA 1HSJA 1LNWA 1QO0D 4U0WA 3FX3A 3GUDA 5LEKA 4HBLA 2CQKA 1YQAA 2AS5F 3KETA 2ESHA 3LA3A 3ELKA 3F6OA 3OOPA 1R5GA 1ZN2A 3TKYA 4LFUA 1ZARA 2ELHA 2O6GE 2PMUA 3MQ0A 1SD5A 4LB6B 2PN6A 2E1NA 2XGXA 2IPQX 3VODA 4A2UA 2OQGA 2R3SA 3AAFA 1Z91A 2COMA 4UNOA 2RV8A 1ZLJA 2FU4A 4LMYA 2K4JA 3NRVA 2G7HA 3F8CA 4PCQA 5CVJA 1J9IA 1J59A 2V1XA 1ZG5A 4RS8A 1XSXA 1P4AA 2OQRA 3CTAA 5D5XB 4MEYF 1JE8A 1SD7A 4LJZF 2VBWA 4ENJA 1FP1D 3WTVC 2OD5A 5JR3A 3K0LA 4KICA 1MJ9A 2UXNA 5H6QA 1T39A 3TDZC 5FD5A 5A2QK 3O3KA 1TLHB 4U88A 4G7HF 2GXGA 4UHTA 3RIRA 3KFWX 1MD0A 4GYIA 4ZZDA 2M8EA 2H27A 4PZJA 5HDGA 2C6YA 1G3TA 3I59B 1IXCA 4GXOA 1Z6TA 3FM5A 1ULYA 1OMIA 2X4HA 3LQQA 3SFZA 4UV8A 3RDIA 1SD6A 2O03A 2XVCA 4KT5C 1YLFA 1P4XA 5FFZA 4ZYGA 3D5LA 5LBQA 2RDPA 1UB9A 2MD5A 3R0JA 3FZVA 4RGRA 2GQQA 5J8FA 1FSEA 1IN4A 1E2XA 3WGIA 1YW7A 4A6DA 2NRAC 3QU6A 4U7BA 3RKWA 5LEJA 2EFWA 2J5PA 4A0XA 3IRRA 4KUMA 4ON0A 1S6LA 1QZYA 4HF1A 3DPLC 2VBXA 3WODF 3J81K 3ECOA 4LG0B 1P92A 1LJ9A 2RN7A 4CGZA 3I4PA 5HS8A 1ON2A 4OOIA 2Q8KA 4ESFA 4Y15A 5K5OA 1YO5C 1H9TA 4JBAA 5DCMB 2UZKA 2Y48A 4WXCA 4NQWA 1EH7A 4P9UA 3I5UA 5EEGA 3U9GA 5LRSA 3V7CA 1S8NA 2XAHA 3L9FA 4H0EA 3P9IA 2MLGA 3CUQC 3IKTA 1RUOA 1R7JA 3LAPA 3BY6A 1REPC 2UXXA 4M9SA 3GF2A 2VE9A 3WTYC 3BJOA 1XDSA 2KRFA 4RAYA 2PI0A 1IN7A 2EB7A 1ZG1A 1W4MA 4HQMA 2FNAA 4CYDA 4OU0A 4A0ZA 1TTYA 2YPRA 1Z1DA 2NNYA 2YX7A 2VODA 3PQJA 3KEQA 3WGGA 1MJAA 4G6DA 1HW2A 4KNYA 5DDGA 1BI0A 1UHMA 4KMUX 5FLXZ 4WF2A 3N4MA 1KQ0A 3ROUA 5CYVA 2P4WA 2WTEA 4I7HA 2DK5A 3I59A 3FWEA 4U7DA 1S7OA 4DQ2A 1ZRCA 4OINF 3QAHA 1GXPA 4EVIA 3SXYA 2ISYA 3FHZA 1W7PB 4IJAA 3CLOA 2E1CA 4AD9A 4ZZLA 2A69F 3EYIA 2FNPA 4I98B 5J6XA 1OPCA 5L3BA 1FWZA 1TW3A 3KP6A 2NNNA 1LVAA 3SZTA 4TV7A 5TRDA 3H92A 2H09A 4LG0A 3I0TA 1BC8C 1F9NA 4OIRF 5D8KB 4NHJA 4LK1F 1YTYA 5TJJA 1X3UA 1TW2A 3L09A 1P4WA 4GO1A 4A5MA 1VTNC 5DCMA 4I02A 1J2XA 4AIJA 2J5OA 2QQAA 4MEXF 5CJ9A 5BQTA 2MC3A 1HKQA 1W7PD 3F8NA 5CVUA 3LAJA 3BWGA 3FMSA 2GIVA 4Z2YA 2FE3A 3ZMDA 1LEAA 3E6DA 3R60A 1ZREA 2GXBA 1KQ9A 4KYWA 1FBUA 2M45A 1B9NA 2HS5A 3IKVA 3DKWA 3DP7A 1JXSA 4ZYEA 3E5XA 3K1NA 4OIOF 3RYRA 1HKSA 5HLIA 4P5OA 3ZP5A 5FLXK 2L3DA 3WTSC 4CHUA 1P2FA 1IXRC 3QPHA 5D5UB 2EA4A 2OZUA 4HA8A 2W84A 4HX7A 2XROA 4ETSA 2NS0A 4LLGF 3WU0A 4Q5SF 4ESBA 4F7ZA 3RKXA 2BV6A 1MGTA 4BHBA 2ZFWA 2A61A 2VT3A 3GFMA 1XCBA 1ZRDA 3WU1B 3ZMTA 5DEQA 5FGMA 1SMTA 4XLNF 5DUKA 4L18B 3SQNA 3RI4A 1TQPA 1ZYRF 2IA0A 2MA3A 3P9KA 3GXOA 3KLOA 4KDPA 1LDKB 1R5HA 2QBYB 5DUIA 1USTA 2AXLA 2PFBA 5D5WB 5E1XA 2BYVE 1MJBA 1ZGAA 1RIOH 2DAOA 4FHTA 5L3DA 2IP2A 3WTWC 2TDXA 3JAMK 1DUXC 2JTVA 2PLYA 1IRFA 1Z6RA 2DI3A 4BHPA 3BJAA 2HQRA 4OIPF 4UUVA 2E7XA 2M87A 2GZWA 3ECHA 5IT9K 3GW2A 2PJPA 4LLNA 1FNNA 4MNUA 1D3YA 2P5LC 2VBZA 3GWZA 1T0FA 3HSFA 3BPXA 4RGXA 2FBKA 3WTTC 2L4MA 4BYYA 4U0YA 1YW8A 1XDUA 2P7VB 1FP2A 1I27A 5BOXA 3HYIA 1FY7A 2P7CB 1LEBA 3FMQA 4HW0A 1BI1A 1B1BA 2XAQA 1TNTA 4KIGA 3BZ6A 5FO5A 3V7RA 1ZHFA 1LQ1A 1HSTA 1V3FA 4M73A 2HKXA 4AVPA 1KU9A 2RNJA 3T0YA 1SFEA 4ZH4F 3ZN0A 2RC4A 1YW9A 1UCRA 3M9AA 2A07F 2STTA 1QQIA 1F5TA 2VBYA 4HQEA 2BEOA 5L3FA 3Q9SA 1L3LA 1QPMA 4KIFA 3WTUC 2P5KA 2XAGA 3HRMA 4R79A 4XBFA 3K1PA 3KP5A 3BP8A 2FSWA 4EM0B 2QM3A 1W5SA 4GCVA 2NAZA 1U2WA 4KN7X 4KN4X 2O0YA 5J8CA 2QQBA 2L01A 3LA7A 4P96A 3CO7C 1BC7C 4XLPF 2K4BA 2EV0A 1WQ2A 5ICCA 4CDGA 3B73A 1USSA 3C18A 4GGGA 1T38A 3HSRA 2ZBKA 4WX9A 2MH2A 5K5RA 1GXQA 2RKHA 6PAXA 3CUOA 2GWRA 2BBYA 3H3ZA 4LLLA 4A12A 2QBYA 2HZTA 1IUYA 4PGHA 3QP5A 1SAXA 4I0BA 1GHCA 1D8JA 4O5VA 2CO5A 1DPUA 3W6KB 1O3RA 3I54A 3GVAA 5ILUA 5ILVA 2G7UA 5L3CA 5BPIA 4EQQA 1HXDA 4UV9A 3DV8A 2HFHA 1J7KA 1OR7A 5LHHA 1K79A 5HLHA 3V8JA 1CF7B 4UVBA 4NB5A 2DTRA 3KEOA 2YR2A 3HHHA 3GO5A 3E97A 4N9HA 3ZMZA 4ZYDA 4JQFA 1JGSA 1G6NA 4R8HA 2KIUA 2CFXA 5ED4A 3Q5FA 4BNCA 2HTSA 1RUNA 1E17A 1XB4A 5E1ZB 1TNSA 1PUEE 1W5TA 3JW4A 2L54A 3Q9VA 1I5ZA 5L3GA 3C7JA 4G94A 4EJTA 2XUBA 1ZH5A 4ENNA 1IXSB 5KVRA 5E18F 4YG2F 1H9GA 1GVJA 2FXAA 3DXJF 5E17F 3GFJA 3QU3A 1O7FA 1IN8A 1PP7U 5HDNA 5DCFA 2PQ8A 3B02A 5F6FA 3CUQA 4RGUA 3TO9A 2IRFG 3O6BB 4WCGA 2QVOA 5DD8A 3T8TA 4BHCA 3J80Z 5LLQA 3D0SA 3WTZA 2HR3A 2EFPA 3KZZA 3M7GA 2JPCA 4G7OF 3WE3A 1WSUA 1SD4A 2DO7A 3P9CA 3RPQA 1Z7UA 2XAFA 4CXFA 4FX0A 3G3ZA 5IT3A 1RZ4A 4HLYA 2F5DA 3G73A 3F3XA 2ACJA 3L2CA 1QZZA 2QENA 1ZAOA 4MGRA 1XSVA 2FA5A 1EH6A 2VC1A 3T1BA 5CLSA 5JFRA 3ABUA 4R1HA 2XHKA 1WRJA 2QZ8A 4A0YA 2VXZA 1TQIA 3C3WA 5H20A 1YS7A 3O2PE 3KP4A 2H6BA 1Z9CA 4I01A 2BE5F 3QPTA 3C1DA 1EH8A 3LSTA 5ICGA 4Q4ZF 2DBBA 5K1YA 1ONVA 2DK8A 1MDMB 1TQMA 3L7WA 4XSZF 3NQOA 1IN6A 3LFKA 1BJAA 2X0LA 1U6GA 3COAC 3DQVC 2G9WA 1G3SA 2VC0A 4EMSA 2OAZA 2DW4A 3GX4X 3CJNA 2KKOA 4M71A 2OA4A 2EV6A 3TOBA 2W57A 2IT0A 3F23A 2FF4A 2VOPA 2M1BA 2P8TA 3HOTA 3ABTA 2CYYA 1FYMA 3ULQB 1CF7A 4L5IA 4G6QA 2IW5A 3REOA 1BI2A 1IN5A 4AIHA 4HOBA 3VFZA 4HZFA 3BOQA 1U78A 3TO7A 3F8MA 5LHGA 2PBIA 1ODDA 5BMZA 3E6CC 3I71A 1YFHA 2A6EF 2A3SA 3T8RA 4ASNA 5JHUA 3L00A 3MEXA 1SMYF 2P5VA 3GLXA 2CSOA 1XGOA 5DV5A 1BBYA 2D1HA 3QRFF 1R1TA 2JPBA 3HRTA 1O3QA 1S29A 3P7NA 3I58A 4HAMA 3T5XA 4EJWA 2DU9A 4HV5A 4O6JA 1K6OA 3M8FA 1XD7A 5JI6A 2VE8A 2F5EA 3F8FA 5KK1A 1HW5A 4BAYA 3DF8A 2L02A 2K27A 2Z5UA 1I1SA 1XGNA 2PEXA 3I53A 1U5TC 5AONA 5E20A 2XASA 3RKYA 1C0WA 1BIAA 4OIQF 3I64A 3MZHA 1OYYA 1Y0UA 2M30A 3DFGA 3E6BA 1R22A 5LHIA 4MHGA 1G3WA 2IA1A 1QBJA 1KU7A 5ICEA 4HX8A 1MDMA 3F72A 2ZKZA 1DP7P 1XSDA 3GZ5A 3TOAA 3PFIA 3K1MA 4DNCA 3GFIA 4B8XA 5D4RA 2DT5A 3WGHA 2DPDA 3ZN1A 2YSRA 3ZQ7A 2QUFA 2YU3A 1BM9A 4B09A 3EYYA 3MFKA 3ERED 2RQPA 4K2EA 2UWMA 5E8IA 3U2RA 3GEZA 4MQ9F 3MCZA 4XSXF 5E8GA 2O61A 5LGTA 2KJCA 4IVNA 2B0LA 4EJUA 2F5FA 4MTDA 3HTUA 4MQVA 2XIGA 2HKOA 2EFNA 1FC3A 1SFXA 5HDKA 1I1GA 3TDUC 4CO8A 4FX4A 3VOEA 1V4RA 1IZ1A 2ADUA 3V8KA 3SHFA 5AIPA 3RYPA 3W6JB 3ZMVA 1B4AA 5F64A 3FM3A 5D6FA 5E1WA 2ZMEA 5ICFA 2FEZA 4IHSA 1S3JA 4G7ZF 5K5QA 2KJBA 2OZ6A 4AIKA 1JHHA 4ENKA 4RGSA 3OV8A 2Z33A 2KIFA 1A04A 2Z3YA 4BQAA 3F8BA 3MAJA 1WI9A 2IJLA 4MTEA 2D2WA 1QGPA 2HGCA 4Y17A 4YIIA
chains in the Genus database with same CATH superfamily
2R7DA 3MKYB 1WVRA 1P6RA 4XORA 3MD2A 5LGNA 2DDBA 3IRQA 2E7WA 2NVYJ 2FRHA 4WWCA 4DGWB 2M0CA 4D9JA 3PNVA 3DEWA 2R5ZB 4PJ0C 3HIFA 3JTHA 4M6XA 2V1NA 2R0QC 2A5YB 5F0HA 2V1UA 2QYOA 3IP4B 3GBGA 1J75A 3WG9A 5A2QZ 1K7AA 4I0AA 4Q48A 3FBNB 3S1MJ 2GA2A 1FLIA 3TO6A 3JSPA 3IL2A 2D5VA 3MWMA 2JZYA 4EM1A 2KIQA 1UZCA 4Y13A 2OU2A 4FTHA 3M8JA 1FMVA 1IC8A 2HOSA 2Q1ZB 1H88C 2OBPA 3C2BA 3OS0A 2EIMH 4QTRA 2STWA 3EQLF 2Y75A 2LF8A 3KZYA 2LMDA 3CDHA 4M3DA 4S04A 2HEOA 4QPOA 2PG4A 4XRFA 1ZKGA 1X2NA 4CZZA 1HKTA 1GVDA 2WV1A 3HKZA 3CUQB 3SFIA 5C3EJ 3E5UA 1FYLA 2W24A 1R58A 1J0RA 2HQNA 1DGRM 3ISPA 4IF4A 2HOAA 3LSMA 5FFXA 3FDYA 3VB2A 1D5YA 1U9NA 4YIFA 3F6VA 4Q47A 1ZGJA 3QOPA 5M3MJ 1T0FC 3OYFA 3GTQJ 3HTSB 2Y0SA 2EZKA 3O8HA 2DFIA 4G8XA 4CICA 1RETA 1LDJA 2FOKA 3BR1A 2PJRB 4BU2A 4Y4RA 2ME0A 5JVTA 3FXUA 1I6XA 3ABMH 1T2KA 1I3AA 2Q2EA 2CWEA 5GPAA 3I56I 1NH3A 3ZMSA 4BXUA 5C44J 5GAHJ 1T56A 3V8LA 1SC7A 4UVAA 2GA1A 1KU3A 3OYEA 5LRRA 1YS6A 5DYMA 1BN5A 1R00A 2VL8A 4DBRA 2RVCA 3P5JA 2V4JC 1MSEC 1FMWA 5DD4A 3K6GA 2QQ9A 2F4MB 2Y0MA 3IC7A 4DBQA 1X4PA 3A0HC 3PIOF 3J81Z 1T33A 3LSIA 1SAUA 4HNVA 3BJ6A 4HPQA 4XRMA 2H94A 4V19K 2EJRA 2MGQA 3ZQHA 2D1VA 4BBRJ 1WJDA 1X1CA 2FD5A 5B66C 1V54H 1OYIA 3CCYA 4FT8A 4XMYA 3HB9A 2CQ7A 1DPRA 3QP6A 1V5GA 3S3MA 1ZR4A 2HOTA 1QNTA 3OIQA 4BY7J 4RB3C 2Z1DA 3OYMA 4HDUA 3AG2H 4RAFA 3DTEA 1PDNC 2A68F 3PM1A 2MLKA 3A02A 3R4KA 1O4XA 1K83J 2QF7A 3EUHA 3HRSA 2OC6A 3OL4A 2NOGA 4IHYA 1ACIA 4JK1X 4XK4A 3HRUA 5BS6A 2LLKA 5CVIA 2EPFA 3CQZJ 3QQAA 4MFEA 4FE7A 1FBQA 4ZTJA 1GLNA 2IS1A 1A6QA 4AWXB 3JTGA 3HKZN 2X6WA 3E5QA 5D8LB 3GTGJ 1Q1HA 1RRJA 3ZPLA 5EEHA 2ZNZA 4A3CJ 3UR3C 3LSRA 1ZRFA 5HLGA 2W25A 4LK0F 2DN0A 1SFKA 2VKDA 3BG6A 4M74A 1BI3A 2HOEA 4IRIA 3HDDA 4XQFA 1K61A 2LDUA 2L9NA 4PJJA 3G6EI 1V5FA 1K78B 4RB1A 1WWXA 2XDVA 4RDUA 1F4KA 1T95A 3H3VK 5IOZA 3BG3A 2V9VA 5IP6A 1Z21A 1NHAA 3BG9A 2L7KA 1ETXA 3LSKA 3MMYB 3FXRA 2FMLA 1IRGA 5AIQA 3DU6A 4A6EA 3HBLA 1WJFA 4KMFA 3J7AY 2ISZA 4BH9A 2R5ZA 4RB0A 1DDNA 2O8XA 3OY9A 4YFNF 2NS7A 2M2EA 5F0FA 3H3UA 3S17J 2E5NA 4XOPA 3CCMI 2F5CA 4IPAA 3LSHA 1B9MA 2NVQJ 2XSDC 2DQRA 2Z9OA 1S7AA 1BOAA 3KP7A 5E79C 1Z05A 1U5TB 1CGPA 1SVOA 1LFPA 3V7SA 2PMZA 4DZPA 2WAFA 1R71A 4AYBA 3QPSA 2P81A 2DJIA 3QPLA 4XIDA 1J5YA 4QLCU 3OYIA 1CQTA 2ZCWA 2M5WA 4IRHA 3U21A 2K86A 3VPRA 3DBHB 2VPLA 4WXDA 5KAIC 4IRGA 1U3EM 1QVUA 1KZHA 2W1OA 2LD5A 1UMQA 2EFOA 3F21A 1ETVA 3PO3J 1FYKA 3RTRA 2EH3A 4L9JA 3DEUA 3DU5A 1R23A 2L7ZA 5F08A 1ZLKA 2ID6A 5HVQC 4RMNA 1MMSA 2EK5A 1VQ5I 1QA6A 4XICA 3HJEA 3WTXC 2JT1A 4HLXA 2WV0A 4XLHA 5HS9A 1FOKA 4YIRX 5TISC 3FF5A 1UHSA 3RPUD 1TL8A 2PJRA 1UFMA 1ON1A 2VPRA 3GCMA 2V6CA 5LGUA 3FXQA 3LNQA 1D1BA 4HV6A 1FOYA 5D5VB 4HDVA 4L0YB 4BUPA 3GFLA 3S8PA 2LNBA 3BROA 2ZXIA 1IV6A 1RNLA 1G59A 4A3KJ 4HF2A 1FOWA 3BTIA 2IS6A 5IYDJ 1MKMA 4FASD 2DJNA 3OS2A 5IYCJ 1ETKA 3HXLA 1DGWY 3K2AA 1WJ5A 3CCUI 4L9NA 1R36A 1NK3P 2CW8A 4GRIA 2LY2A 2DQLA 3A4CA 2X6YA 2L9RA 3BTJA 4XN0A 2P6SA 2JQ7A 2KFDA 3IWFA 4ITVA 1VQNI 4N4OB 4IHXA 1FEXA 2ETHA 4S05A 1D5VA 1T6SA 1PP8F 4GFBA 1TWAJ 3CO6C 4YFKF 4QWQA 2XV4S 2CQXA 4N9IA 2BY3A 1KGSA 2HVRA 2LC2A 1Y1WJ 4PJMA 5IP7J 3E3VA 2XF5A 3ZMUA 1WFXA 3TQNA 1OJLA 1R1VA 5L3EA 4XOTA 2Q0OA 2WY7Q 5IYBJ 1FZPB 4ZYHA 4C3IJ 5HS7A 1TP4A 3K9TA 3HSEA 3VWBA 2N8GA 1F1ZA 2FBHA 4AYBN 4C30A 4RB2C 2K85A 1J09A 2ESNA 5HODA 1MBHA 2JN6A 2LKPA 1X19A 4EM2A 2DOFA 1FX7A 2IGMA 4JX6A 3LQRA 4LD5A 3Q0UA 4PDKA 2QCOA 2DOEA 2JRTA 5ERIA 4PGGA 2Z99A 2F48A 1P7IA 1EV7A 1HW1A 3H5AA 3U1DA 4E70A 1K78A 1U8RA 2KLOA 3BDDA 2BGCA 4IZZA 3HOSA 1GV2A 3EETA 2QSHX 3J7AO 4CYCB 2D45A 2HTJA 3IH4A 2XKPA 3RPUA 1ZTRA 2K02A 3QWLA 1Q1VA 2NVUB 3K69A 3S32A 1XGSA 2FBIA 3KYDB 4P9FA 3HOZJ 1QVTA 4EGYA 2ZXJA 1IAWA 1W1WE 2K40A 2OPTA 1KU2A 5LFAA 2ZMEB 2AQFA 1LDDA 3PUBA 1QZEA 4RAGA 1KONA 5D6EA 2LVSA 4BS9A 1XMAA 3J80K 2YX4A 2LKXA 5CVRA 2YUSA 3KP2A 1FSHA 2HWVA 3OYJA 1B6AA 4WXHA 4ZTFA 1SFUA 1WJAA 1OYWA 2R7FA 4M9ZA 5F1RA 2Y30A 4M6YA 2RGVA 2BW3B 4IHVA 2EV5A 1MH4A 1MW7A 1JKRC 2FQ3A 1IUFA 1G3YA 1AOYA 1U5TA 2MH9A 1R5ID 3NWSA 2WWYA 4KA4A 4I2OA 4M72A 4LB5A 1W36C 1MZBA 1X1PA 2IA2A 3KP3A 1E3OC 2O3FA 2E5ZA 3RKQA 2CGPA 1A5JA 3E6MA 2QSFX 2RNGA 4L9VA 4EGZA 1STZA 1WJEA 2IS4A 1QHGA 5FD6A 2VONA 2V1DA 3LFUA 3SYTA 3HOWJ 4HEA2 1OCZH 1FBSA 1JHFA 1H0MA 4HNUA 2E35A 3I9V2 4EJOA 1YIOA 3PFYA 4HYEA 1N75A 2BY0A 3RJPA 1IGNA 3KYCB 2XC7A 2ZFUA 3R0AA 2IS2A 3RQIA 4L9TA 5HOOA 4RBOA 3PQKA 3FMRA 3CMYA 2VT2A 2VOOA 1XCVA 1MMGA 2COBA 2M7AA 5K7ZA 5GAEJ 1P7JA 3JAMZ 2LSOA 4I09A 2ELKA 2HYGD 5J1YA 3QYEA 1B59A 2K7LA 1WKMA 1Y1VJ 1R1UA 3K2ZA 2F2EA 1QPIA 3V4GA 4D7MA 4PUSA 2NYXA 4XN3A 5EDNA 4D0PA 1AWCA 4ZJZA 2KRHA 1MSFC 1YOVB 2KQRA 3S2WA 4IHTA 5IT9Z 1YG2A 4IXAA 3BCAA 3M8EA 4X6AJ 2CMPA 3PSFA 1O7LA 5CVVA 3KCCA 3M1EA 4OWRB 1FPQA 2KMUA 3NWTA 3VYUB 3CCVI 2W00A 2VLAA 4CCKA 2JVHA 1DU6A 2IVMA 3SDGA 1O57A 3SZPA 3KLNA 3PL8A 2EINH 3ML6A 1KYWA 5J4VA 2E60A 3K70D 1WGXA 1HBXG 4L0ZB 3CCSI 5BPDA 5FB2A 1O3SA 3TW7A 4EV0A 2K3PA 3WHCA 3OYBA 3GMEA 3TP3A 1MBGA 4PSXA 4KIBA 1KQ8A 3KE2A 3R61A 2F5VA 3LSJA 2FMYA 2KIMA 3BCBA 1SFOJ 2WC2A 1L0OC 4P55A 4A93J 2PMHA 4ESJA 2WB1A 2LG4A 3VEPA 1HDPA 1OCOH 4LGWA 1OKRA 4YFXF 2VKVA 4F52A 2JSCA 4CUGA 3BQZA 2JSPA 4BBSJ 4UXNA 4RAZA 3WHBA 2QLZA 4RLQA 2L7MP 3JSOA 3CMAI 3N97A 2DPUA 5J47A 1XGMA 3IAS2 2A6HF 3ZOBA 1TBXA 2IGNA 4OMYA 1ZG3A 4II2A 4BE1A 2QWWA 2EA2A 1JT6A 3DPTA 1IJWC 4NNJA 1JT0A 2CW0F 3HUGA 1E3HA 4NC7A 4GYGA 3GZ6A 2P0WA 4CYCA 1XMKA 3CJQB 3F22A 4M9XA 1IF1A 3IHUA 3TGNA 4XL9A 3E1SA 5GTIC 5JHFA 2JA2A 5FKOA 4RA2A 2XKOA 4ZDPA 2DMPA 1UHWA 4BDYA 4YELA 2R4GA 1VF9A 3AL0C 2X1EA 1HQCA 5M5XJ 5H6RA 5ILSA 4HX4A 1KA8A 2P6TA 4XLEA 5EZHA 5KCMA 2KPMA 3OYDA 3GTKJ 2H6CA 3HHGA 3OS1A 3HEFA 2CG4A 2H1KA 4N0BA 3IWZA 1W7PA 3K4BA 2HPIA 4F3QA 2GXAA 2VN2A 2BW3A 2XRNA 3WE2A 2LF7A 1YYVA 1TWGJ 4KISA 2W85A 2V79A 1LB2A 2WAQN 3DKXA 1G4DA 3GYHX 4ENMA 4KFCA 2E19A 4EJVA 2EWNA 5IY5H 3SZGA 2M8GX 3R6SA 1FJLA 2W82A 4I99C 2HYFA 5D4SA 2ZNYA 4MLOA 1RR7A 4FCYA 4E7ZA 4L5JA 1RI7A 4U0VA 2XAJA 4UUSB 1D8KA 4A5NA 4IO9F 4E7JA 2DMNA 4C2TA 4OMZA 1UG2A 4ANJA 3VSLA 3ZQGA 5H2FC 2HDCA 3HC7A 1BIBA 2VQCA 4O3MA 3LA2A 5DS9A 3AFHA 2MABA 2WB1N 1GUUA 1NG7A 2ZJ2A 2GAUA 3LWFA 3EDPA 4G9YA 3JRHA 2RAEA 4HF0A 1ORKA 4PFPA 4BJ6C 3MZYA 5CQEA 2ZJRF 2EFQA 1IRZA 2CUJA 3K4MA 2DLLA 1VQKI 1ZQ3P 1KYZA 1D0ZA 2ZO4A 1JJ8C 2MBFA 1O3TA 3TEDA 1IW7F 4WK8F 4A3GJ 1XN7A 3BPVA 2L4AA 4UVCA 1BR1A 1MNDA 1JUSA 2V7FA 1FT9A 1N78A 1T98A 3BR0A 3W3CA 3NEUA 1HSJA 3VDXA 1LNWA 1QO0D 4U0WA 4Y3OA 1D0XA 4E7LA 2NS8A 3FX3A 2HVSA 3GUDA 3IH3A 4W1UA 2HDWA 5LEKA 1E0EA 4HBLA 2CQKA 3KIOA 2R7QA 2DODA 1YQAA 2MD0A 3FISA 4M6VA 3CC4I 4ZYAA 2AS5F 3KETA 4E7SA 1IO2A 2ESHA 3LA3A 4LIVA 2V9PA 3CCQI 3ELKA 3DWLE 1VNDA 1YRNA 3F6OA 3OOPA 1R5GA 2WY8Q 1ZN2A 4BL0B 3TKYA 3OSFA 2E71A 4LFUA 1ZARA 2ELHA 3ZQCA 2OTJI 2O6GE 3G71I 3J7YJ 3MZ8A 2PMUA 1QHHD 4XKWA 5C4JJ 2CFOA 3MQ0A 1SD5A 4LB6B 2PN6A 2E1NA 2XGXA 2IPQX 4XNFA 3VODA 3I55I 3HPGA 4A2UA 2OQGA 5EG0B 1D0YA 2R3SA 3G1MA 1Z91A 5TGTA 2COMA 3AAFA 4UNOA 3H0GJ 2RV8A 2R7OA 2EBIA 3OMYA 1T08B 3G2BA 4C2MJ 2ZSHB 2AQEA 1ZLJA 1D1CA 4B47A 2FU4A 4LMYA 3AG3H 3G1OA 2AXTC 2K4JA 3GTJJ 2CJJA 4FE4A 3NRVA 2G7HA 2V26A 3F8CA 4PCQA 4G12A 5CVJA 1J9IA 1J59A 2V1XA 1ZG5A 3F9KA 3WG7H 4RS8A 1XSXA 1P4AA 5J40A 2IGOA 2X1DA 2MSYA 1WH7A 4N4NB 2OQRA 3CTAA 5D5XB 2HNHA 4MEYF 2KISA 1JE8A 3IH2A 1SD7A 4LJZF 2VBWA 1NG6A 1FP1D 3BG5A 3FKIJ 5E3MA 2ZJQF 4ENJA 4BACA 3WTVC 3OYLA 4C3JJ 1VQ6I 2OD5A 2LOOA 5JR3A 2XPVA 3K0LA 3LL7A 4KICA 3L2VA 1MJ9A 2UXNA 5H6QA 3F0CA 1T39A 4PSWA 3Q0WA 5FD5A 3TDZC 2GLOA 2HDDA 3GZNB 5A2QK 3CP2A 3O3KA 1TLHB 4BE0A 4U88A 4G7HF 2GXGA 3OYCA 1P9QC 4UHTA 2JUGA 3RIRA 2NXNB 1YJ9I 3KFWX 1MD0A 2VJ4A 4GYIA 4UUSA 3O8GA 4ZZDA 2M8EA 2Y0SN 2H27A 4PZJA 2HU9A 5HDGA 2C6YA 3MVPA 4X0GA 1G3TA 3KYLA 1RPWA 3I59B 4D1QA 1IXCA 2Y31A 4GXOA 1Z6TA 3BZKA 4AUXA 1POGA 3FM5A 2K3FA 4JP0A 2FUG2 1LE8A 2NVXJ 3BT9A 1ULYA 1OMIA 2HXIA 2DA6A 2X4HA 5IPAA 1BJZA 2CV1A 1HDDC 3LQQA 1JKQC 3SFZA 4UV8A 3RDIA 2OTLI 1SD6A 1LUJB 2O03A 2XVCA 4ABZA 1R6RA 4KT5C 1YLFA 1P4XA 1XC5A 1Y8RB 3EUHC 5FFZA 1HLVA 2B63J 4ZYGA 3D5LA 5LBQA 2RDPA 1UB9A 3JRAA 2MD5A 3VYSB 2DTZA 2KRCA 3FZVA 3R0JA 4RGRA 2EZLA 2GQQA 5IP9J 5J8FA 1FSEA 2Z16A 2DA4A 1OR7C 1IN4A 1E2XA 3WGIA 1YW7A 4A6DA 2FX0A 2H1LA 4BEHB 2NRAC 1VZ0A 3QU6A 3S14J 4U7BA 3RKWA 5LEJA 3IAM2 2EFWA 2HYJA 2J5PA 3FK7A 2CRGA 4A0XA 1ZR2A 3IRRA 4KUMA 4ON0A 1RKWA 1S6LA 4DYCA 1QZYA 4HF1A 3DPLC 2LTPA 2VBXA 3CMMA 2MG4A 3WODF 2E2JJ 3J81K 3ECOA 4LG0B 3KZIC 1P92A 1LJ9A 2RN7A 2UUZA 2DCEA 1A36A 4EATA 4CGZA 2VQGA 3TBIA 4PFOA 3I4PA 5HS8A 1ON2A 3BZCA 4OOIA 2Q8KA 5EF6A 1N77A 2CUEA 2OJED 1T8IA 4D5CA 4ESFA 4Y15A 2CQQA 4D5FA 5EG0A 5F0CA 3OL3A 1IDZA 3A1YA 5K5OA 2I8DA 2VKEA 1YO5C 1H9TA 4JBAA 4M3BA 5DCMB 2UZKA 5IOYA 2Y48A 4BGDA 3DLLF 4WXCA 4NQWA 3B6CA 2DMQA 2W48A 5F04A 3L2WA 3KPHA 1EH7A 5GAGJ 4P9UA 4IEJA 1X1BA 4E7HA 2GM4A 3I5UA 4M3EA 2QGUA 2VKHA 1B72A 3S1QJ 5EEGA 3U9GA 5LRSA 4JYKA 4XRSG 3V7CA 4FETA 3L2QA 1S8NA 2JWTA 2XAHA 1TC3C 3L9FA 2X85A 4H0EA 3P9IA 4LG3A 2MLGA 3CUQC 4CH7A 3IKTA 1RUOA 2UWMA 1R7JA 3IV5A 4U87A 2W4SA 5EYRA 1I50J 2IAIA 2FOWA 3BY6A 3LAPA 1REPC 3GTOJ 2M3AA 2UXXA 1XMXA 4IL6C 1XG1A 4M9SA 3GF2A 3CC2I 2R7SA 2BHYA 2VE9A 3WTYC 2DFEA 3AL0B 1TWHJ 3BJOA 1XDSA 2KRFA 4RAYA 2PMZN 3OYAA 2PI0A 1X3ZB 5B1AH 1IN7A 2EB7A 1ZG1A 3L2RA 1W4MA 3BQYA 2X6OA 4BJ5C 4HQMA 2FNAA 1Y6IA 4CYDA 1N25A 4OU0A 4A0ZA 1TTYA 1BR4A 4QPQA 2YPRA 1Z1DA 2NNYA 2KDOA 2YX7A 2VODA 3PQJA 1MBKA 1I39A 2VASA 3KEQA 3WGGA 4CCJA 5HNHA 4NDLA 1MJAA 4G6DA 4P1WA 1HW2A 1HC8A 1DQUA 3HUGB 1YHQI 4KNYA 3M4OJ 3CD6I 5DDGA 3AG1H 4IHWA 1BI0A 1UHMA 3BR3A 3K10A 4KMUX 4UUTA 4CA0A 3A01A 3HL2A 5FLXZ 4WF2A 1MIJA 2XAUA 1GT0C 3N4MA 1KQ0A 1RKTA 2WA0A 1BW6A 2BVMA 3ROUA 5CYVA 3H5RA 3VSKA 4DYQA 2P4WA 2WTEA 4I7HA 4IOAF 2WADA 2DK5A 3I59A 1IG7A 2E1MC 3FWEA 3X2QH 1M1EB 4U7DA 1S7OA 4DQ2A 1ZRCA 5E3LA 1IRXA 3QAHA 4OINF 1GXPA 1X4OA 3W2WA 4E6KG 4D7NA 1HOMA 2DXIA 1XPXA 3B6AA 1MMDA 2MW8A 4EVIA 3RCOA 3SXYA 2ISYA 3UNGC 5DM7F 3FHZA 4BQOA 4JX5A 1W7PB 4IJAA 3ZQLA 2ID3A 3CLOA 3PNTA 2CS3A 2JA5J 1WPKA 4CCMA 2L9VA 1LFUP 1Z77A 1YJNI 2DA7A 1U8BA 4NBQA 2E1CA 4AD9A 2VB6A 1R4NB 2TCTA 1TWCJ 1Z3XA 4ZZLA 2A69F 1IV8A 2VXDA 3EYIA 2OUMA 2FNPA 3CCJI 4LOCA 4I98B 3DBLB 4OAZA 4A69C 2ZJPF 1D1AA 3FHNA 5J6XA 1OPCA 5L3BA 3OR1C 5FLMJ 1FWZA 4BEHA 1TW3A 3KP6A 2NNNA 5FKNA 2XB0X 1LVAA 2XF7A 3H35A 3SZTA 4TV7A 1UAAA 2A5WA 5TRDA 2HQAA 1A6IA 5FRMA 3H92A 2H09A 2QQ8A 3M1CA 4NUBA 2JA8J 4LG0A 3S15J 2HVQA 3L2UA 3I0TA 3BTCA 1BC8C 4XONA 4S0HB 2QA4I 1F9NA 4OIRF 2XPUA 4RM2A 5D8KB 4CSWA 4NHJA 3DLAA 4C2UA 4LK1F 4XKBA 2HQ5A 1JTYA 4JX4A 4UY8I 1YTYA 1EF4A 3OIOA 3SEZA 5TJJA 1X3UA 1YI2I 1YITI 2PX9A 1TW2A 3L09A 1P4WA 5DM6F 1U9OA 4GO1A 4A5MA 1VTNC 2G0EA 1R4MB 3NAUA 5DCMA 4I02A 1J2XA 3FXLA 3ZQQA 2K5CA 4AIJA 2J5OA 2QQAA 4MEXF 5CJ9A 5BQTA 2MC3A 1X3WB 1HKQA 1W7PD 3OYGA 3F8NA 4XKCA 4IOCF 5CVUA 3LAJA 2BVLA 3BWGA 3FMSA 2GIVA 4Y52J 4Z2YA 2FE3A 2UV1A 3ZMDA 1LEAA 3E6DA 2RQQA 1K6YA 2EIKH 2IXSA 2LRDA 3R60A 5GP9A 1ZREA 2GXBA 1KQ9A 1YRNB 2LBFB 1YIJI 2A6TA 4KYWA 1FBUA 2M45A 1B9NA 1VFCA 1MH3A 2HS5A 3IKVA 3DKWA 3DP7A 2V6EA 3ASOH 2E1OA 1JXSA 4H4KC 4ZYEA 1HA8A 3E5XA 3K1NA 4OIOF 3RYRA 5FRNA 3CESA 3AG4H 2Y69H 1HKSA 2L5QA 5HLTA 5HLIA 1VQ8I 3M3YJ 4P5OA 3ZP5A 5FLXK 2KZVA 2L3DA 2R92J 2ECCA 1JTXA 2KZGA 3WTSC 4CHUA 1P2FA 1IXRC 3NARA 3QPHA 5D5UB 2EA4A 2OZUA 4HA8A 2W84A 4HX7A 3JREA 4CZCA 2XROA 3BR5A 4F55A 4ETSA 2NS0A 4LLGF 3H5NA 3WU0A 3KX2A 4Q5SF 1AU7A 2IEKA 2X1CA 4ESBA 4F7ZA 3RKXA 4Z6YA 1OCRH 2BV6A 1FTTA 2CH0A 1MGTA 1JI8A 4BHBA 2ZFWA 2A61A 3VYTB 4DW6A 2VT3A 3GFMA 4KJZA 1XCBA 1ZRDA 3GLLA 2FQ4A 3E0JB 1X1DA 2M34A 3WU1B 2V9KA 3ZMTA 5DEQA 5FGMA 1OQYA 1SMTA 1PVEA 4XLNF 2M4GA 1ZELA 5DUKA 1WCMJ 3KEYA 1FOXA 1BW5A 2K9QA 2X51A 3OSGA 5J4YA 4BJTA 4L18B 3SQNA 2LKSA 2VIXA 3H9JA 4BE2A 3RI4A 1TQPA 4GDFA 1XTAA 5FKLA 3S2DJ 1ZYRF 1DU0A 2WBMA 2IA0A 3QYFA 1PUFB 2KT0A 2MA3A 3P9KA 3ZXSA 1RR8C 1F36A 3GXOA 3K4CA 4FQGA 3D1NI 3KLOA 5GPCA 4KDPA 1LDKB 1R5HA 2QBYB 3ZQFA 4E4HA 5DUIA 3CZ6A 2CU7A 4PJLA 1USTA 1MMNA 2AXLA 5GTHC 2PFBA 2R93J 1B8IB 5D5WB 5FLVA 5E1XA 2BYVE 3BG7A 1MJBA 3S1NJ 1ZGAA 4YRVA 1Y39A 1RIOH 2DAOA 1S5LC 2XGEA 2IP2A 4FHTA 2TDXA 5L3DA 3JAMK 3WTWC 3OYNA 3JRCA 1JKPC 1Y0NA 1DUXC 2JTVA 2E34A 2PLYA 4XR6A 1IDYA 2GOMA 2DMUA 3A0BC 1IRFA 1Z6RA 1A35A 2M0MA 4A3BJ 2R7UA 2DI3A 4BHPA 3BJAA 3K4KA 2HQRA 2EIJH 9ANTA 2ICWG 3PSIA 4OIPF 2MYSA 2XRLA 4UUVA 3OOUA 2E7XA 2M87A 2GZWA 3ECHA 1EJ9A 5IT9K 1MMAA 2ELJA 3GW2A 1X58A 3H36A 4NC8A 2PJPA 4AVZA 3AKZA 3QOEA 4LLNA 1FNNA 1X1AA 3BR2A 4MNUA 5J1RA 1D3YA 2P5LC 2VBZA 3HOXJ 1OISA 2R7RA 3GWZA 3HOYJ 4NC6A 1LE8B 1T0FA 4ZC3A 4HNTA 3HSFA 3BPXA 4RGXA 2FJ1A 2FBKA 3WTTC 1VQLI 4BXXJ 5LD2C 4KITB 3JCUC 3MN2A 2L4MA 4BYYA 3HZJA 1RESA 4U0YA 1YW8A 1XDUA 2A05A 3SEQA 2P7VB 1FP2A 2AO9A 2ZMEC 1S72I 1I27A 5BOXA 3HYIA 4JOMA 4E7IA 5FJ8J 1FY7A 2JMWA 2R7TA 4HSTA 3C2GA 2P7CB 4PK4A 3H0DA 1LEBA 3FMQA 4HW0A 1BI1A 1B1BA 2XGCA 1R49A 4AU7A 3DPUA 2XAQA 1TNTA 5F27A 1APLC 4KIGA 4BXFA 2K9NA 4X1EA 1XS9A 3BZ6A 1G2HA 2DA2A 5FO5A 3V7RA 1ZHFA 1LQ1A 3DCFA 4IX7A 3K70C 3HGGA 3H1CA 5GADJ 1HSTA 1V3FA 4M73A 2HKXA 2LBFA 3FIWA 4J19A 2CV2A 4AVPA 4F93B 1KU9A 1PYVA 2RNJA 4A3MJ 3Q3SA 1SFEA 2DDAA 4G6TB 3T0YA 4ZH4F 3LOCA 3HGYA 3ZN0A 3G1LA 2RC4A 3TW6A 4F92B 1W0UA 1YW9A 1AHDP 3PUFA 3CJRB 1UCRA 3HOVJ 3M9AA 2A07F 5B5EC 1TZLA 2STTA 2MFZA 1QQIA 4Y7NJ 1F5TA 2VBYA 3D5SC 4HQEA 2BEOA 5L3FA 1S9HA 1F43A 3IUOA 3Q9SA 5FROA 1L3LA 3JRIA 3PO2J 1QPMA 4KIFA 4B44A 2O5RA 4YEJA 3ZQIA 3HPHA 2P5KA 2XAGA 1OLTA 3WTUC 3HRMA 4R79A 4NQWB 2K9LA 4XBFA 3K1PA 3KP5A 2DFFA 2HXOA 3BP8A 4BQNA 4C9YA 2FSWA 2LR8A 2QM3A 4EM0B 1W5SA 2I5UA 4GCVA 2NAZA 1B72B 1U2WA 4KN7X 4KN4X 2O0YA 2XGDA 5J8CA 2O9LA 4B4CA 2ZC2A 2YU9J 3CJTB 4ZDOA 1Z7LA 2QQBA 5J1UA 2L01A 3LA7A 4P96A 3CO7C 1BC7C 3ASNH 2KHMA 2NOJB 5JVGF 1PJRA 1G8XA 2Y9ZA 4XLPF 2K4BA 1OFCX 3BC8A 2EV0A 1WQ2A 2M7BA 3LMMA 5ICCA 1ITYA 4CDGA 3B73A 3DKYA 1USSA 1PUFA 3C18A 2M9HA 4MIMA 4GGGA 3MKZA 1SEUA 2E1MB 4RLFA 1T38A 3S3NA 3HSRA 1SANA 2ZBKA 4WX9A 2MH2A 5K5RA 1GXQA 2RKHA 6PAXA 3CUOA 2GWRA 2BBYA 3H3ZA 4LLLA 4A12A 1JUPA 2QBYA 2HZTA 2E2HJ 1IUYA 4PGHA 3QP5A 1SAXA 4I0BA 1B8IA 1GHCA 1D8JA 1DP3A 2AHQA 2EZIA 3PJRA 3H9QA 1Z67A 1XX5A 2JRMA 5J3LA 5M5WJ 3OWTA 1W0TA 2CV0A 1WZ2A 1Z0XA 1X2MA 2ZXHA 4O5VA 2CO5A 2ZB9A 3I4MJ 1DPUA 2LY9A 3W6KB 1O3RA 3I54A 3GVAA 3FBIB 5ILUA 1FTZA 5JLWA 5ILVA 2G7UA 5L3CA 3K4NA 5BPIA 4EQQA 1HXDA 2VUMJ 2DT7B 4UV9A 3DV8A 2HFHA 5CKTA 1J7KA 1OR7A 5LHHA 3A01B 1K79A 3ZRGA 3V8JA 5HLHA 1CF7B 2ME6A 4DIQA 4PJNA 4UVBA 1HCRA 4HRIA 4NB5A 4B1RA 1OCPA 2DTRA 3KEOA 2YR2A 3HHHA 3JRFA 3GO5A 2O8KA 3E97A 4N9HA 1LKXA 3ZMZA 4AM3A 4ZYDA 4JQFA 4XRSA 1JGSA 1G6NA 1BL0A 4R8HA 2JUCA 2KIUA 2CFXA 5ED4A 4V2FA 3Q5FA 4BNCA 1MNEA 1OCTC 4A3LJ 2HTSA 2ZXWH 1RUNA 3S93A 1E17A 4W97A 1XB4A 5E1ZB 1FIPA 2L2OA 1TNSA 2NVTJ 1LFBA 1PUEE 1EA3A 5DTDA 5EZGA 1W5TA 3BTLA 3JW4A 5EGOB 5C4XJ 2HZDA 4BKXA 2L54A 3TP0A 3SJMA 4A3FJ 3Q9VA 3CDIA 3TMOA 3DBRB 3K4JA 1I5ZA 5L3GA 1K4SA 5B3SH 3C7JA 2KDZA 4G94A 4EJTA 2XUBA 1ZH5A 2XPWA 1IXSB 4ENNA 2W7NA 5KVRA 4MO7A 4YG2F 5E18F 1R9TJ 3ERMA 3OYHA 3K4LA 1H9GA 1GVJA 1MNMC 2FXAA 3DXJF 5E17F 3GFJA 2XSJC 2EZHA 3QU3A 3EUKL 1O7FA 4A3JJ 3SDBA 1IN8A 2LH9A 2QEXI 1MBJA 5HDNA 1PP7U 5DCFA 2PQ8A 1W36D 1BOBA 3B02A 5F6FA 1ERDA 3CUQA 3I4NJ 2L9SA 4RGUA 2DT6A 3TO9A 1VQ4I 2IRFG 3K7AJ 3O6BB 4WCGA 1YX5A 2QVOA 5DD8A 3T8TA 4BHCA 2K9MA 3J80Z 2CUFA 3A2KA 3D0SA 5LLQA 3V42A 3WTZA 2HR3A 2EFPA 2LK2A 3LSGA 3ONQA 3KZZA 3M7GA 4DOZA 1HF0A 4MFDA 2JPCA 4G7OF 3WE3A 5K7HA 2VI6A 1WSUA 1SD4A 2DO7A 3P9CA 2K9SA 3MKWB 3RPQA 1Z7UA 2XAFA 4CXFA 2BHZA 3H9GA 4FX0A 3G3ZA 3J7ZI 5IT3A 1RZ4A 4HLYA 2F5DA 1WJCA 5KHDA 3G73A 2DA3A 3F3XA 2ACJA 3L2CA 1QZZA 2QENA 1ZAOA 4MGRA 4QIWN 1XSVA 1Z3YA 2FA5A 4IKFA 1EH6A 2VC1A 3RZOJ 3T1BA 5BNGA 3ZGKA 2H8RA 5CLSA 5JFRA 3ABUA 3DTIA 4R1HA 1AKHB 2XHKA 1LVKA 1WI3A 1WRJA 2LFBA 2QZ8A 4A0YA 2VXZA 1TQIA 3C3WA 1Y56A 1YS7A 3CLQA 5H20A 4IQJA 3O2PE 3KP4A 2H6BA 5E3NA 1Z9CA 4I01A 2BE5F 3QPTA 3M07A 3C1DA 1EH8A 2VQHA 4CCOA 3LSTA 5ICGA 2JA6J 4F91B 4Q4ZF 3EUAA 5B1BH 1V5EA 2DBBA 4BQQA 4UB8C 5K1YA 1ONVA 2DK8A 2R7VA 1MDMB 5FKKA 1TQMA 3L7WA 2EQRA 4XSZF 2JVGA 3NQOA 1IN6A 1FIAA 1BJAA 2KP6A 3LFKA 3S16J 1WHUA 2BZTA 2JK3A 4A3DJ 5FKMA 2H8WA 2X0LA 1U6GA 3COAC 2BY2A 3DQVC 2G9WA 1G3SA 2VC0A 4EMSA 2OAZA 2F4OB 3GTLJ 2DW4A 1VQ7I 1V55H 4LIUA 3GX4X 2BY1A 2X48A 4DZJA 1VQOI 3JRBA 4E7KA 4I6ZA 3CJNA 2KKOA 1UG0A 4M71A 2OA4A 2EV6A 2YS9A 5CPRB 3TOBA 2W57A 2IT0A 2X9DA 4A3EJ 3FXJA 3I3LA 3ZR8X 3F23A 2JA7J 2FF4A 2VOPA 1ENHA 1MBFA 2M1BA 2EILH 4M3GA 3S1RJ 2P8TA 3HOTA 4XLFA 2WAEA 3ABTA 2CYYA 1FYMA 3ULQB 1CF7A 4L5IA 1NK2P 4G6QA 5M5YJ 2R7XA 2IW5A 2RREA 3REOA 1VQMI 3GTPJ 1BI2A 2QSGX 2B7EA 1U0JA 2ZSIB 1IN5A 4I76A 4AIHA 2Y2ZA 3N05A 1ETYA 4HOBA 3EPZA 3CF5F 3VFZA 4HZFA 3BOQA 4XLAA 1U78A 2X6XA 3TO7A 3F8MA 3CCEI 2BXYA 4M3FA 4AC0A 5LHGA 2PBIA 3TL4X 1VQ9I 5EGOA 5E3OA 2R7ZJ 1ODDA 4ZDLA 5BMZA 3E6CC 1EKEA 3I71A 1YFHA 1ZGWA 3RZDJ 3G4SI 2A6EF 2A3SA 3FXMA 3T8RA 3CCRI 4ASNA 3CMEI 5JHUA 4DYRA 3L00A 1UELB 5M3FJ 3MEXA 2DMTA 4A3IJ 1SMYF 1SVMA 1TWFJ 5HNFA 2CUZA 2P5VA 2CSOA 3GLXA 3GTMJ 3CF2A 2MC4A 3ABLH 1ETQA 2OF7A 4CCNA 2DA1A 1H8AC 2VJJA 1XGOA 2GOXB 4B3XA 5DV5A 3JR9A 1BBYA 2D1HA 2R5YB 3QRFF 2L7FP 2VJIA 1R1TA 2JPBA 3HRTA 2BOLA 3BLYA 1NTCA 4DJAA 4BY1J 2DFHA 2E2IJ 1O3QA 3L1PA 2DYSH 1GDTA 1S29A 3P7NA 1UJ8A 4RM3A 1WJBA 3FK6A 3I58A 4HAMA 3JRGA 3T5XA 4EJWA 2XB5A 1QRYA 2DU9A 4II3A 4HV5A 4O6JA 1SVLA 1K6OA 3Q0VA 3M8FA 1QU3A 2KL4A 1XD7A 1BA5A 2GBYA 5JI6A 2VE8A 2OCCH 2F5EA 2Z2SB 3F8FA 5KK1A 3WU2C 2HI3A 4BDZA 1HW5A 4BAYA 2I10A 3C2HA 2TRTA 4XLCA 3DF8A 3DEEA 2L02A 3OYKA 1W5CC 2K27A 2Z5UA 4HG2A 1I1SA 1XGNA 2PEXA 3I53A 3OIPA 3A03A 1U5TC 5AONA 5E20A 2XASA 3CP8A 2F4IA 3RQ4A 3RKYA 1AKHA 1C0WA 1I6HJ 1BIAA 4OIQF 3I64A 3S3OA 3MZHA 1OYYA 3RSNA 3CCLI 1Y0UA 4FISA 1RC9A 2M4KA 1AA7A 5CQGA 2M30A 1Y8QB 3OR2C 1TT0A 1VI0A 3DFGA 3E6BA 1R22A 1JKOC 1ETOA 3PNYA 5LHIA 2WAQA 4MHGA 1G3WA 2IA1A 1QBJA 1KU7A 5ICEA 1ZK8A 4HX8A 1MDMA 3F72A 1JGGA 1JUMA 3JRDA 2ZKZA 1DP7P 2GIZA 1XSDA 3GZ5A 3HM5A 3TOAA 3PFIA 3K1MA 4DNCA 3LSPA 3GFIA 3ABKH 4B8XA 5D4RA 5KNLA 2DT5A 3WGHA 2DPDA 3ZN1A 4QSHA 4B48A 5JLXA 2YSRA 2HPMA 3S2HJ 3ZQ7A 2QUFA 3ZCOA 5KAFC 4IQ4A 2YU3A 1S7EA 1BM9A 4B09A 2DOAA 3PIPF 3EYYA 4HSRA 2Y9YA 3MFKA 3ERED 3CC7I 4L5EA 5EEAA 2CW7A 2RQPA 2Q2EB 4K2EA 3W2VA 2LY1A 4B3AA 4KT6A 4UB6C 3U2RA 3GEZA 4Y33A 5E8IA 4CCLA 4MQ9F 3MCZA 1YJWI 1VQPI 4XSXF 5E8GA 3ESWB 4AIDA 1TT5B 3FXOA 4J00A 5EJCA 4B43A 2O61A 4V2GA 2QKLB 2VQLA 4J01A 5K7FA 5LGTA 2KJCA 2LYCA 2IGKA 4IVNA 2VJ5A 3W6VA 1WH5A 3VYRB 2B0LA 4EJUA 3CDLA 2F5FA 4MTDA 3HTUA 4MQVA 2XIGA 2HKOA 2EFNA 1FC3A 1SFXA 5HDKA 1I1GA 3TDUC 4CO8A 4FX4A 1JJ6C 3VOEA 1MBEA 1V4RA 4XM3A 1IZ1A 1I3QJ 2ADUA 3V8KA 3SHFA 5AIPA 1YE9A 3RYPA 3W6JB 3ZMVA 2QKMB 3DTKA 1B4AA 5F64A 2L0KA 2JJ7A 3FM3A 5D6FA 2LP0A 3FKJA 5E1WA 3D5RC 2ZMEA 2ECBA 3FXKA 3HG9A 2B9SA 5ICFA 2FEZA 4IHSA 1S3JA 2DYRH 2LREA 2O7OA 4G7ZF 5K5QA 2KJBA 1OCCH 2OZ6A 3U1KA 4AIKA 3HOUJ 1JHHA 2IBDA 3E7LA 4ENKA 4RGSA 3OV8A 2Z33A 2DA5A 2OV7A 4OAYA 1H89C 2KIFA 1A04A 2E36A 2BXZA 2Z3YA 1BR2A 4BQAA 1YX3A 1K4TA 3F8BA 3MAJA 1WI9A 3QODA 3W2AA 1E3PA 2IJLA 2CQNA 2OCEA 3BR6A 2R5YA 3QYBA 4MTEA 2D2WA 1QGPA 2F6CA 3UKGA 4LITA 2R7WA 2HGCA 4XKVA 2XF6A 1ETWA 4Y17A 1A31A 4YIIA 5F1JA 3MKLA 4EEFG 1GV5A 1LPQA 4C3HJ
chains in the Genus database with same CATH topology
2R7DA 5LGNA 1P6RA 3IRQA 2E7WA 4WWCA 2FRHA 3HIFA 3JTHA 4M6XA 2A5YB 2V1UA 2QYOA 1J75A 3WG9A 5A2QZ 1K7AA 4I0AA 4Q48A 2GA2A 1FLIA 3TO6A 3JSPA 3IL2A 3MWMA 2JZYA 4EM1A 4Y13A 2OU2A 2OBPA 2STWA 3EQLF 2Y75A 2LF8A 3KZYA 3CDHA 4S04A 2HEOA 2PG4A 4XRFA 1HKTA 4CZZA 3CUQB 3E5UA 1FYLA 2W24A 1R58A 1J0RA 2HQNA 3ISPA 4IF4A 5FFXA 3VB2A 4YIFA 3F6VA 4Q47A 1ZGJA 3QOPA 3HTSB 2DFIA 4G8XA 4CICA 1LDJA 2FOKA 5JVTA 3FXUA 1I6XA 1T2KA 2Q2EA 2CWEA 3ZMSA 4BXUA 3V8LA 4UVAA 2GA1A 1KU3A 5LRRA 1YS6A 5DYMA 1BN5A 1R00A 2RVCA 5DD4A 2QQ9A 2Y0MA 3IC7A 3J81Z 3BJ6A 2H94A 2EJRA 2D1VA 1OYIA 4FT8A 1DPRA 3QP6A 1QNTA 4RB3C 4HDUA 1PDNC 2A68F 2MLKA 3R4KA 3EUHA 3HRSA 4JK1X 3HRUA 5BS6A 5CVIA 1FBQA 4AWXB 3JTGA 3E5QA 5D8LB 1Q1HA 3ZPLA 5EEHA 2ZNZA 1ZRFA 5HLGA 2W25A 4LK0F 4M74A 1BI3A 2HOEA 4IRIA 2LDUA 1K78B 4RB1A 1WWXA 1F4KA 2V9VA 1NHAA 3FXRA 2FMLA 1IRGA 5AIQA 4A6EA 4KMFA 2ISZA 4BH9A 4RB0A 1DDNA 2O8XA 4YFNF 3H3UA 2F5CA 4IPAA 1B9MA 2DQRA 2Z9OA 1S7AA 1BOAA 3KP7A 1Z05A 1U5TB 1CGPA 3V7SA 1J5YA 4QLCU 2ZCWA 2M5WA 4IRHA 2K86A 4WXDA 4IRGA 1U3EM 2EFOA 3F21A 1FYKA 3RTRA 4L9JA 3DEUA 1R23A 1ZLKA 5HVQC 2EK5A 3WTXC 2JT1A 4HLXA 2WV0A 5HS9A 1FOKA 3FF5A 1UFMA 1ON1A 5LGUA 2V6CA 3FXQA 4HDVA 5D5VB 4HV6A 4L0YB 3GFLA 2LNBA 3BROA 1RNLA 4HF2A 1MKMA 4L9NA 1R36A 2DQLA 2P6SA 3IWFA 2ETHA 4S05A 1D5VA 1T6SA 1PP8F 3CO6C 4YFKF 4QWQA 2XV4S 4N9IA 1KGSA 3E3VA 3ZMUA 3TQNA 1R1VA 5L3EA 2Q0OA 1FZPB 4ZYHA 5HS7A 3K9TA 3HSEA 1F1ZA 2FBHA 4RB2C 2ESNA 2LKPA 4EM2A 1FX7A 3LQRA 4LD5A 4PDKA 2JRTA 5ERIA 4PGGA 2Z99A 3U1DA 1EV7A 1HW1A 4E70A 1K78A 1U8RA 3BDDA 2BGCA 3HOSA 3EETA 3J7AO 2D45A 2HTJA 2XKPA 3RPUA 2K02A 3K69A 1XGSA 2FBIA 4P9FA 4EGYA 2ZXJA 1IAWA 1KU2A 2ZMEB 1LDDA 5D6EA 1XMAA 3J80K 2YX4A 5CVRA 3KP2A 1FSHA 2HWVA 1B6AA 4WXHA 1SFUA 1OYWA 2R7FA 4M9ZA 5F1RA 4M6YA 2RGVA 2EV5A 2FQ3A 1G3YA 1AOYA 1U5TA 2MH9A 2WWYA 4KA4A 4I2OA 4M72A 4LB5A 1MZBA 3KP3A 2IA2A 2O3FA 2CGPA 3E6MA 4L9VA 4EGZA 1STZA 2VONA 5FD6A 2V1DA 1FBSA 1JHFA 1H0MA 4EJOA 1YIOA 4HYEA 3RJPA 3R0AA 4L9TA 5HOOA 3PQKA 3FMRA 2VT2A 2VOOA 1XCVA 3JAMZ 2LSOA 4I09A 2HYGD 1B59A 2K7LA 1WKMA 1R1UA 3K2ZA 2F2EA 3V4GA 2NYXA 4D0PA 1AWCA 4IHTA 3S2WA 5IT9Z 1YG2A 4IXAA 3M8EA 1O7LA 5CVVA 3KCCA 3M1EA 1FPQA 2IVMA 1O57A 3SZPA 3KLNA 3ML6A 1KYWA 1HBXG 4L0ZB 5BPDA 5FB2A 1O3SA 4EV0A 4KIBA 1KQ8A 3KE2A 3R61A 2FMYA 2KIMA 2WC2A 1L0OC 4P55A 2PMHA 4ESJA 3VEPA 4LGWA 1OKRA 4YFXF 2JSCA 4UXNA 4RAZA 2QLZA 3JSOA 3N97A 2DPUA 1XGMA 2A6HF 1TBXA 4OMYA 1ZG3A 2QWWA 2EA2A 3DPTA 2CW0F 3HUGA 4GYGA 3GZ6A 1XMKA 3F22A 4M9XA 1IF1A 3IHUA 3TGNA 2XKOA 1UHWA 1HQCA 5H6RA 5ILSA 4HX4A 1KA8A 2P6TA 2H6CA 3HHGA 2CG4A 4N0BA 3IWZA 1W7PA 2VN2A 2XRNA 3WE2A 2LF7A 1YYVA 2W85A 2V79A 1LB2A 1G4DA 3GYHX 4ENMA 4KFCA 4EJVA 2EWNA 3R6SA 2HYFA 5D4SA 2ZNYA 4L5JA 1RI7A 4U0VA 2XAJA 1D8KA 4A5NA 4OMZA 2HDCA 1BIBA 4O3MA 3LA2A 2ZJ2A 2GAUA 3LWFA 3EDPA 4G9YA 4HF0A 3MZYA 2EFQA 2DLLA 1KYZA 2ZO4A 2MBFA 1O3TA 1IW7F 4WK8F 1XN7A 3BPVA 2L4AA 4UVCA 1FT9A 1T98A 3NEUA 1HSJA 1LNWA 1QO0D 4U0WA 3FX3A 3GUDA 5LEKA 4HBLA 2CQKA 1YQAA 2AS5F 3KETA 2ESHA 3LA3A 3ELKA 3F6OA 3OOPA 1R5GA 1ZN2A 3TKYA 4LFUA 1ZARA 2ELHA 2O6GE 2PMUA 3MQ0A 1SD5A 4LB6B 2PN6A 2E1NA 2XGXA 2IPQX 3VODA 4A2UA 2OQGA 2R3SA 3AAFA 1Z91A 2COMA 4UNOA 2RV8A 1ZLJA 2FU4A 4LMYA 2K4JA 3NRVA 2G7HA 3F8CA 4PCQA 5CVJA 1J9IA 1J59A 2V1XA 1ZG5A 4RS8A 1XSXA 1P4AA 2OQRA 3CTAA 5D5XB 4MEYF 1JE8A 1SD7A 4LJZF 2VBWA 4ENJA 1FP1D 3WTVC 2OD5A 5JR3A 3K0LA 4KICA 1MJ9A 2UXNA 5H6QA 1T39A 3TDZC 5FD5A 5A2QK 3O3KA 1TLHB 4U88A 4G7HF 2GXGA 4UHTA 3RIRA 3KFWX 1MD0A 4GYIA 4ZZDA 2M8EA 2H27A 4PZJA 5HDGA 2C6YA 1G3TA 3I59B 1IXCA 4GXOA 1Z6TA 3FM5A 1ULYA 1OMIA 2X4HA 3LQQA 3SFZA 4UV8A 3RDIA 1SD6A 2O03A 2XVCA 4KT5C 1YLFA 1P4XA 5FFZA 4ZYGA 3D5LA 5LBQA 2RDPA 1UB9A 2MD5A 3R0JA 3FZVA 4RGRA 2GQQA 5J8FA 1FSEA 1IN4A 1E2XA 3WGIA 1YW7A 4A6DA 2NRAC 3QU6A 4U7BA 3RKWA 5LEJA 2EFWA 2J5PA 4A0XA 3IRRA 4KUMA 4ON0A 1S6LA 1QZYA 4HF1A 3DPLC 2VBXA 3WODF 3J81K 3ECOA 4LG0B 1P92A 1LJ9A 2RN7A 4CGZA 3I4PA 5HS8A 1ON2A 4OOIA 2Q8KA 4ESFA 4Y15A 5K5OA 1YO5C 1H9TA 4JBAA 5DCMB 2UZKA 2Y48A 4WXCA 4NQWA 1EH7A 4P9UA 3I5UA 5EEGA 3U9GA 5LRSA 3V7CA 1S8NA 2XAHA 3L9FA 4H0EA 3P9IA 2MLGA 3CUQC 3IKTA 1RUOA 1R7JA 3LAPA 3BY6A 1REPC 2UXXA 4M9SA 3GF2A 2VE9A 3WTYC 3BJOA 1XDSA 2KRFA 4RAYA 2PI0A 1IN7A 2EB7A 1ZG1A 1W4MA 4HQMA 2FNAA 4CYDA 4OU0A 4A0ZA 1TTYA 2YPRA 1Z1DA 2NNYA 2YX7A 2VODA 3PQJA 3KEQA 3WGGA 1MJAA 4G6DA 1HW2A 4KNYA 5DDGA 1BI0A 1UHMA 4KMUX 5FLXZ 4WF2A 3N4MA 1KQ0A 3ROUA 5CYVA 2P4WA 2WTEA 4I7HA 2DK5A 3I59A 3FWEA 4U7DA 1S7OA 4DQ2A 1ZRCA 4OINF 3QAHA 1GXPA 4EVIA 3SXYA 2ISYA 3FHZA 1W7PB 4IJAA 3CLOA 2E1CA 4AD9A 4ZZLA 2A69F 3EYIA 2FNPA 4I98B 5J6XA 1OPCA 5L3BA 1FWZA 1TW3A 3KP6A 2NNNA 1LVAA 3SZTA 4TV7A 5TRDA 3H92A 2H09A 4LG0A 3I0TA 1BC8C 1F9NA 4OIRF 5D8KB 4NHJA 4LK1F 1YTYA 5TJJA 1X3UA 1TW2A 3L09A 1P4WA 4GO1A 4A5MA 1VTNC 5DCMA 4I02A 1J2XA 4AIJA 2J5OA 2QQAA 4MEXF 5CJ9A 5BQTA 2MC3A 1HKQA 1W7PD 3F8NA 5CVUA 3LAJA 3BWGA 3FMSA 2GIVA 4Z2YA 2FE3A 3ZMDA 1LEAA 3E6DA 3R60A 1ZREA 2GXBA 1KQ9A 4KYWA 1FBUA 2M45A 1B9NA 2HS5A 3IKVA 3DKWA 3DP7A 1JXSA 4ZYEA 3E5XA 3K1NA 4OIOF 3RYRA 1HKSA 5HLIA 4P5OA 3ZP5A 5FLXK 2L3DA 3WTSC 4CHUA 1P2FA 1IXRC 3QPHA 5D5UB 2EA4A 2OZUA 4HA8A 2W84A 4HX7A 2XROA 4ETSA 2NS0A 4LLGF 3WU0A 4Q5SF 4ESBA 4F7ZA 3RKXA 2BV6A 1MGTA 4BHBA 2ZFWA 2A61A 2VT3A 3GFMA 1XCBA 1ZRDA 3WU1B 3ZMTA 5DEQA 5FGMA 1SMTA 4XLNF 5DUKA 4L18B 3SQNA 3RI4A 1TQPA 1ZYRF 2IA0A 2MA3A 3P9KA 3GXOA 3KLOA 4KDPA 1LDKB 1R5HA 2QBYB 5DUIA 1USTA 2AXLA 2PFBA 5D5WB 5E1XA 2BYVE 1MJBA 1ZGAA 1RIOH 2DAOA 4FHTA 5L3DA 2IP2A 3WTWC 2TDXA 3JAMK 1DUXC 2JTVA 2PLYA 1IRFA 1Z6RA 2DI3A 4BHPA 3BJAA 2HQRA 4OIPF 4UUVA 2E7XA 2M87A 2GZWA 3ECHA 5IT9K 3GW2A 2PJPA 4LLNA 1FNNA 4MNUA 1D3YA 2P5LC 2VBZA 3GWZA 1T0FA 3HSFA 3BPXA 4RGXA 2FBKA 3WTTC 2L4MA 4BYYA 4U0YA 1YW8A 1XDUA 2P7VB 1FP2A 1I27A 5BOXA 3HYIA 1FY7A 2P7CB 1LEBA 3FMQA 4HW0A 1BI1A 1B1BA 2XAQA 1TNTA 4KIGA 3BZ6A 5FO5A 3V7RA 1ZHFA 1LQ1A 1HSTA 1V3FA 4M73A 2HKXA 4AVPA 1KU9A 2RNJA 3T0YA 1SFEA 4ZH4F 3ZN0A 2RC4A 1YW9A 1UCRA 3M9AA 2A07F 2STTA 1QQIA 1F5TA 2VBYA 4HQEA 2BEOA 5L3FA 3Q9SA 1L3LA 1QPMA 4KIFA 3WTUC 2P5KA 2XAGA 3HRMA 4R79A 4XBFA 3K1PA 3KP5A 3BP8A 2FSWA 4EM0B 2QM3A 1W5SA 4GCVA 2NAZA 1U2WA 4KN7X 4KN4X 2O0YA 5J8CA 2QQBA 2L01A 3LA7A 4P96A 3CO7C 1BC7C 4XLPF 2K4BA 2EV0A 1WQ2A 5ICCA 4CDGA 3B73A 1USSA 3C18A 4GGGA 1T38A 3HSRA 2ZBKA 4WX9A 2MH2A 5K5RA 1GXQA 2RKHA 6PAXA 3CUOA 2GWRA 2BBYA 3H3ZA 4LLLA 4A12A 2QBYA 2HZTA 1IUYA 4PGHA 3QP5A 1SAXA 4I0BA 1GHCA 1D8JA 4O5VA 2CO5A 1DPUA 3W6KB 1O3RA 3I54A 3GVAA 5ILUA 5ILVA 2G7UA 5L3CA 5BPIA 4EQQA 1HXDA 4UV9A 3DV8A 2HFHA 1J7KA 1OR7A 5LHHA 1K79A 5HLHA 3V8JA 1CF7B 4UVBA 4NB5A 2DTRA 3KEOA 2YR2A 3HHHA 3GO5A 3E97A 4N9HA 3ZMZA 4ZYDA 4JQFA 1JGSA 1G6NA 4R8HA 2KIUA 2CFXA 5ED4A 3Q5FA 4BNCA 2HTSA 1RUNA 1E17A 1XB4A 5E1ZB 1TNSA 1PUEE 1W5TA 3JW4A 2L54A 3Q9VA 1I5ZA 5L3GA 3C7JA 4G94A 4EJTA 2XUBA 1ZH5A 4ENNA 1IXSB 5KVRA 5E18F 4YG2F 1H9GA 1GVJA 2FXAA 3DXJF 5E17F 3GFJA 3QU3A 1O7FA 1IN8A 1PP7U 5HDNA 5DCFA 2PQ8A 3B02A 5F6FA 3CUQA 4RGUA 3TO9A 2IRFG 3O6BB 4WCGA 2QVOA 5DD8A 3T8TA 4BHCA 3J80Z 5LLQA 3D0SA 3WTZA 2HR3A 2EFPA 3KZZA 3M7GA 2JPCA 4G7OF 3WE3A 1WSUA 1SD4A 2DO7A 3P9CA 3RPQA 1Z7UA 2XAFA 4CXFA 4FX0A 3G3ZA 5IT3A 1RZ4A 4HLYA 2F5DA 3G73A 3F3XA 2ACJA 3L2CA 1QZZA 2QENA 1ZAOA 4MGRA 1XSVA 2FA5A 1EH6A 2VC1A 3T1BA 5CLSA 5JFRA 3ABUA 4R1HA 2XHKA 1WRJA 2QZ8A 4A0YA 2VXZA 1TQIA 3C3WA 5H20A 1YS7A 3O2PE 3KP4A 2H6BA 1Z9CA 4I01A 2BE5F 3QPTA 3C1DA 1EH8A 3LSTA 5ICGA 4Q4ZF 2DBBA 5K1YA 1ONVA 2DK8A 1MDMB 1TQMA 3L7WA 4XSZF 3NQOA 1IN6A 3LFKA 1BJAA 2X0LA 1U6GA 3COAC 3DQVC 2G9WA 1G3SA 2VC0A 4EMSA 2OAZA 2DW4A 3GX4X 3CJNA 2KKOA 4M71A 2OA4A 2EV6A 3TOBA 2W57A 2IT0A 3F23A 2FF4A 2VOPA 2M1BA 2P8TA 3HOTA 3ABTA 2CYYA 1FYMA 3ULQB 1CF7A 4L5IA 4G6QA 2IW5A 3REOA 1BI2A 1IN5A 4AIHA 4HOBA 3VFZA 4HZFA 3BOQA 1U78A 3TO7A 3F8MA 5LHGA 2PBIA 1ODDA 5BMZA 3E6CC 3I71A 1YFHA 2A6EF 2A3SA 3T8RA 4ASNA 5JHUA 3L00A 3MEXA 1SMYF 2P5VA 3GLXA 2CSOA 1XGOA 5DV5A 1BBYA 2D1HA 3QRFF 1R1TA 2JPBA 3HRTA 1O3QA 1S29A 3P7NA 3I58A 4HAMA 3T5XA 4EJWA 2DU9A 4HV5A 4O6JA 1K6OA 3M8FA 1XD7A 5JI6A 2VE8A 2F5EA 3F8FA 5KK1A 1HW5A 4BAYA 3DF8A 2L02A 2K27A 2Z5UA 1I1SA 1XGNA 2PEXA 3I53A 1U5TC 5AONA 5E20A 2XASA 3RKYA 1C0WA 1BIAA 4OIQF 3I64A 3MZHA 1OYYA 1Y0UA 2M30A 3DFGA 3E6BA 1R22A 5LHIA 4MHGA 1G3WA 2IA1A 1QBJA 1KU7A 5ICEA 4HX8A 1MDMA 3F72A 2ZKZA 1DP7P 1XSDA 3GZ5A 3TOAA 3PFIA 3K1MA 4DNCA 3GFIA 4B8XA 5D4RA 2DT5A 3WGHA 2DPDA 3ZN1A 2YSRA 3ZQ7A 2QUFA 2YU3A 1BM9A 4B09A 3EYYA 3MFKA 3ERED 2RQPA 4K2EA 2UWMA 5E8IA 3U2RA 3GEZA 4MQ9F 3MCZA 4XSXF 5E8GA 2O61A 5LGTA 2KJCA 4IVNA 2B0LA 4EJUA 2F5FA 4MTDA 3HTUA 4MQVA 2XIGA 2HKOA 2EFNA 1FC3A 1SFXA 5HDKA 1I1GA 3TDUC 4CO8A 4FX4A 3VOEA 1V4RA 1IZ1A 2ADUA 3V8KA 3SHFA 5AIPA 3RYPA 3W6JB 3ZMVA 1B4AA 5F64A 3FM3A 5D6FA 5E1WA 2ZMEA 5ICFA 2FEZA 4IHSA 1S3JA 4G7ZF 5K5QA 2KJBA 2OZ6A 4AIKA 1JHHA 4ENKA 4RGSA 3OV8A 2Z33A 2KIFA 1A04A 2Z3YA 4BQAA 3F8BA 3MAJA 1WI9A 2IJLA 4MTEA 2D2WA 1QGPA 2HGCA 4Y17A 4YIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  5LGN A;  1P6R A;  3IRQ A;  2E7W A;  4WWC A;  2FRH A;  3HIF A;  3JTH A;  4M6X A;  2A5Y B;  2V1U A;  2QYO A;  1J75 A;  3WG9 A;  5A2Q Z;  1K7A A;  4I0A A;  4Q48 A;  2GA2 A;  1FLI A;  3TO6 A;  3JSP A;  3IL2 A;  3MWM A;  2JZY A;  4EM1 A;  4Y13 A;  2OU2 A;  2OBP A;  2STW A;  3EQL F;  2Y75 A;  2LF8 A;  3KZY A;  3CDH A;  4S04 A;  2HEO A;  2PG4 A;  4XRF A;  1HKT A;  4CZZ A;  3CUQ B;  3E5U A;  1FYL A;  2W24 A;  1R58 A;  1J0R A;  2HQN A;  3ISP A;  4IF4 A;  5FFX A;  3VB2 A;  4YIF A;  3F6V A;  4Q47 A;  1ZGJ A;  3QOP A;  3HTS B;  2DFI A;  4G8X A;  4CIC A;  1LDJ A;  2FOK A;  5JVT A;  3FXU A;  1I6X A;  1T2K A;  2Q2E A;  2CWE A;  3ZMS A;  4BXU A;  3V8L A;  4UVA A;  2GA1 A;  1KU3 A;  5LRR A;  1YS6 A;  5DYM A;  1BN5 A;  1R00 A;  2RVC A;  5DD4 A;  2QQ9 A;  2Y0M A;  3IC7 A;  3J81 Z;  3BJ6 A;  2H94 A;  2EJR A;  2D1V A;  1OYI A;  4FT8 A;  1DPR A;  3QP6 A;  1QNT A;  4RB3 C;  4HDU A;  1PDN C;  2A68 F;  2MLK A;  3R4K A;  3EUH A;  3HRS A;  4JK1 X;  3HRU A;  5BS6 A;  5CVI A;  1FBQ A;  4AWX B;  3JTG A;  3E5Q A;  5D8L B;  1Q1H A;  3ZPL A;  5EEH A;  2ZNZ A;  1ZRF A;  5HLG A;  2W25 A;  4LK0 F;  4M74 A;  1BI3 A;  2HOE A;  4IRI A;  2LDU A;  1K78 B;  4RB1 A;  1WWX A;  1F4K A;  2V9V A;  1NHA A;  3FXR A;  2FML A;  1IRG A;  5AIQ A;  4A6E A;  4KMF A;  2ISZ A;  4BH9 A;  4RB0 A;  1DDN A;  2O8X A;  4YFN F;  3H3U A;  2F5C A;  4IPA A;  1B9M A;  2DQR A;  2Z9O A;  1S7A A;  1BOA A;  3KP7 A;  1Z05 A;  1U5T B;  1CGP A;  3V7S A;  1J5Y A;  4QLC U;  2ZCW A;  2M5W A;  4IRH A;  2K86 A;  4WXD A;  4IRG A;  1U3E M;  2EFO A;  3F21 A;  1FYK A;  3RTR A;  4L9J A;  3DEU A;  1R23 A;  1ZLK A;  5HVQ C;  2EK5 A;  3WTX C;  2JT1 A;  4HLX A;  2WV0 A;  5HS9 A;  1FOK A;  3FF5 A;  1UFM A;  1ON1 A;  5LGU A;  2V6C A;  3FXQ A;  4HDV A;  5D5V B;  4HV6 A;  4L0Y B;  3GFL A;  2LNB A;  3BRO A;  1RNL A;  4HF2 A;  1MKM A;  4L9N A;  1R36 A;  2DQL A;  2P6S A;  3IWF A;  2ETH A;  4S05 A;  1D5V A;  1T6S A;  1PP8 F;  3CO6 C;  4YFK F;  4QWQ A;  2XV4 S;  4N9I A;  1KGS A;  3E3V A;  3ZMU A;  3TQN A;  1R1V A;  5L3E A;  2Q0O A;  1FZP B;  4ZYH A;  5HS7 A;  3K9T A;  3HSE A;  1F1Z A;  2FBH A;  4RB2 C;  2ESN A;  2LKP A;  4EM2 A;  1FX7 A;  3LQR A;  4LD5 A;  4PDK A;  2JRT A;  5ERI A;  4PGG A;  2Z99 A;  3U1D A;  1EV7 A;  1HW1 A;  4E70 A;  1K78 A;  1U8R A;  3BDD A;  2BGC A;  3HOS A;  3EET A;  3J7A O;  2D45 A;  2HTJ A;  2XKP A;  3RPU A;  2K02 A;  3K69 A;  1XGS A;  2FBI A;  4P9F A;  4EGY A;  2ZXJ A;  1IAW A;  1KU2 A;  2ZME B;  1LDD A;  5D6E A;  1XMA A;  3J80 K;  2YX4 A;  5CVR A;  3KP2 A;  1FSH A;  2HWV A;  1B6A A;  4WXH A;  1SFU A;  1OYW A;  2R7F A;  4M9Z A;  5F1R A;  4M6Y A;  2RGV A;  2EV5 A;  2FQ3 A;  1G3Y A;  1AOY A;  1U5T A;  2MH9 A;  2WWY A;  4KA4 A;  4I2O A;  4M72 A;  4LB5 A;  1MZB A;  3KP3 A;  2IA2 A;  2O3F A;  2CGP A;  3E6M A;  4L9V A;  4EGZ A;  1STZ A;  2VON A;  5FD6 A;  2V1D A;  1FBS A;  1JHF A;  1H0M A;  4EJO A;  1YIO A;  4HYE A;  3RJP A;  3R0A A;  4L9T A;  5HOO A;  3PQK A;  3FMR A;  2VT2 A;  2VOO A;  1XCV A;  3JAM Z;  2LSO A;  4I09 A;  2HYG D;  1B59 A;  2K7L A;  1WKM A;  1R1U A;  3K2Z A;  2F2E A;  3V4G A;  2NYX A;  4D0P A;  1AWC A;  4IHT A;  3S2W A;  5IT9 Z;  1YG2 A;  4IXA A;  3M8E A;  1O7L A;  5CVV A;  3KCC A;  3M1E A;  1FPQ A;  2IVM A;  1O57 A;  3SZP A;  3KLN A;  3ML6 A;  1KYW A;  1HBX G;  4L0Z B;  5BPD A;  5FB2 A;  1O3S A;  4EV0 A;  4KIB A;  1KQ8 A;  3KE2 A;  3R61 A;  2FMY A;  2KIM A;  2WC2 A;  1L0O C;  4P55 A;  2PMH A;  4ESJ A;  3VEP A;  4LGW A;  1OKR A;  4YFX F;  2JSC A;  4UXN A;  4RAZ A;  2QLZ A;  3JSO A;  3N97 A;  2DPU A;  1XGM A;  2A6H F;  1TBX A;  4OMY A;  1ZG3 A;  2QWW A;  2EA2 A;  3DPT A;  2CW0 F;  3HUG A;  4GYG A;  3GZ6 A;  1XMK A;  3F22 A;  4M9X A;  1IF1 A;  3IHU A;  3TGN A;  2XKO A;  1UHW A;  1HQC A;  5H6R A;  5ILS A;  4HX4 A;  1KA8 A;  2P6T A;  2H6C A;  3HHG A;  2CG4 A;  4N0B A;  3IWZ A;  1W7P A;  2VN2 A;  2XRN A;  3WE2 A;  2LF7 A;  1YYV A;  2W85 A;  2V79 A;  1LB2 A;  1G4D A;  3GYH X;  4ENM A;  4KFC A;  4EJV A;  2EWN A;  3R6S A;  2HYF A;  5D4S A;  2ZNY A;  4L5J A;  1RI7 A;  4U0V A;  2XAJ A;  1D8K A;  4A5N A;  4OMZ A;  2HDC A;  1BIB A;  4O3M A;  3LA2 A;  2ZJ2 A;  2GAU A;  3LWF A;  3EDP A;  4G9Y A;  4HF0 A;  3MZY A;  2EFQ A;  2DLL A;  1KYZ A;  2ZO4 A;  2MBF A;  1O3T A;  1IW7 F;  4WK8 F;  1XN7 A;  3BPV A;  2L4A A;  4UVC A;  1FT9 A;  1T98 A;  3NEU A;  1HSJ A;  1LNW A;  1QO0 D;  4U0W A;  3FX3 A;  3GUD A;  5LEK A;  4HBL A;  2CQK A;  1YQA A;  2AS5 F;  3KET A;  2ESH A;  3LA3 A;  3ELK A;  3F6O A;  3OOP A;  1R5G A;  1ZN2 A;  3TKY A;  4LFU A;  1ZAR A;  2ELH A;  2O6G E;  2PMU A;  3MQ0 A;  1SD5 A;  4LB6 B;  2PN6 A;  2E1N A;  2XGX A;  2IPQ X;  3VOD A;  4A2U A;  2OQG A;  2R3S A;  3AAF A;  1Z91 A;  2COM A;  4UNO A;  2RV8 A;  1ZLJ A;  2FU4 A;  4LMY A;  2K4J A;  3NRV A;  2G7H A;  3F8C A;  4PCQ A;  5CVJ A;  1J9I A;  1J59 A;  2V1X A;  1ZG5 A;  4RS8 A;  1XSX A;  1P4A A;  2OQR A;  3CTA A;  5D5X B;  4MEY F;  1JE8 A;  1SD7 A;  4LJZ F;  2VBW A;  4ENJ A;  1FP1 D;  3WTV C;  2OD5 A;  5JR3 A;  3K0L A;  4KIC A;  1MJ9 A;  2UXN A;  5H6Q A;  1T39 A;  3TDZ C;  5FD5 A;  5A2Q K;  3O3K A;  1TLH B;  4U88 A;  4G7H F;  2GXG A;  4UHT A;  3RIR A;  3KFW X;  1MD0 A;  4GYI A;  4ZZD A;  2M8E A;  2H27 A;  4PZJ A;  5HDG A;  2C6Y A;  1G3T A;  3I59 B;  1IXC A;  4GXO A;  1Z6T A;  3FM5 A;  1ULY A;  1OMI A;  2X4H A;  3LQQ A;  3SFZ A;  4UV8 A;  3RDI A;  1SD6 A;  2O03 A;  2XVC A;  4KT5 C;  1YLF A;  1P4X A;  5FFZ A;  4ZYG A;  3D5L A;  5LBQ A;  2RDP A;  1UB9 A;  2MD5 A;  3R0J A;  3FZV A;  4RGR A;  2GQQ A;  5J8F A;  1FSE A;  1IN4 A;  1E2X A;  3WGI A;  1YW7 A;  4A6D A;  2NRA C;  3QU6 A;  4U7B A;  3RKW A;  5LEJ A;  2EFW A;  2J5P A;  4A0X A;  3IRR A;  4KUM A;  4ON0 A;  1S6L A;  1QZY A;  4HF1 A;  3DPL C;  2VBX A;  3WOD F;  3J81 K;  3ECO A;  4LG0 B;  1P92 A;  1LJ9 A;  2RN7 A;  4CGZ A;  3I4P A;  5HS8 A;  1ON2 A;  4OOI A;  2Q8K A;  4ESF A;  4Y15 A;  5K5O A;  1YO5 C;  1H9T A;  4JBA A;  5DCM B;  2UZK A;  2Y48 A;  4WXC A;  4NQW A;  1EH7 A;  4P9U A;  3I5U A;  5EEG A;  3U9G A;  5LRS A;  3V7C A;  1S8N A;  2XAH A;  3L9F A;  4H0E A;  3P9I A;  2MLG A;  3CUQ C;  3IKT A;  1RUO A;  1R7J A;  3LAP A;  3BY6 A;  1REP C;  2UXX A;  4M9S A;  3GF2 A;  2VE9 A;  3WTY C;  3BJO A;  1XDS A;  2KRF A;  4RAY A;  2PI0 A;  1IN7 A;  2EB7 A;  1ZG1 A;  1W4M A;  4HQM A;  2FNA A;  4CYD A;  4OU0 A;  4A0Z A;  1TTY A;  2YPR A;  1Z1D A;  2NNY A;  2YX7 A;  2VOD A;  3PQJ A;  3KEQ A;  3WGG A;  1MJA A;  4G6D A;  1HW2 A;  4KNY A;  5DDG A;  1BI0 A;  1UHM A;  4KMU X;  5FLX Z;  4WF2 A;  3N4M A;  1KQ0 A;  3ROU A;  5CYV A;  2P4W A;  2WTE A;  4I7H A;  2DK5 A;  3I59 A;  3FWE A;  4U7D A;  1S7O A;  4DQ2 A;  1ZRC A;  4OIN F;  3QAH A;  1GXP A;  4EVI A;  3SXY A;  2ISY A;  3FHZ A;  1W7P B;  4IJA A;  3CLO A;  2E1C A;  4AD9 A;  4ZZL A;  2A69 F;  3EYI A;  2FNP A;  4I98 B;  5J6X A;  1OPC A;  5L3B A;  1FWZ A;  1TW3 A;  3KP6 A;  2NNN A;  1LVA A;  3SZT A;  4TV7 A;  5TRD A;  3H92 A;  2H09 A;  4LG0 A;  3I0T A;  1BC8 C;  1F9N A;  4OIR F;  5D8K B;  4NHJ A;  4LK1 F;  1YTY A;  5TJJ A;  1X3U A;  1TW2 A;  3L09 A;  1P4W A;  4GO1 A;  4A5M A;  1VTN C;  5DCM A;  4I02 A;  1J2X A;  4AIJ A;  2J5O A;  2QQA A;  4MEX F;  5CJ9 A;  5BQT A;  2MC3 A;  1HKQ A;  1W7P D;  3F8N A;  5CVU A;  3LAJ A;  3BWG A;  3FMS A;  2GIV A;  4Z2Y A;  2FE3 A;  3ZMD A;  1LEA A;  3E6D A;  3R60 A;  1ZRE A;  2GXB A;  1KQ9 A;  4KYW A;  1FBU A;  2M45 A;  1B9N A;  2HS5 A;  3IKV A;  3DKW A;  3DP7 A;  1JXS A;  4ZYE A;  3E5X A;  3K1N A;  4OIO F;  3RYR A;  1HKS A;  5HLI A;  4P5O A;  3ZP5 A;  5FLX K;  2L3D A;  3WTS C;  4CHU A;  1P2F A;  1IXR C;  3QPH A;  5D5U B;  2EA4 A;  2OZU A;  4HA8 A;  2W84 A;  4HX7 A;  2XRO A;  4ETS A;  2NS0 A;  4LLG F;  3WU0 A;  4Q5S F;  4ESB A;  4F7Z A;  3RKX A;  2BV6 A;  1MGT A;  4BHB A;  2ZFW A;  2A61 A;  2VT3 A;  3GFM A;  1XCB A;  1ZRD A;  3WU1 B;  3ZMT A;  5DEQ A;  5FGM A;  1SMT A;  4XLN F;  5DUK A;  4L18 B;  3SQN A;  3RI4 A;  1TQP A;  1ZYR F;  2IA0 A;  2MA3 A;  3P9K A;  3GXO A;  3KLO A;  4KDP A;  1LDK B;  1R5H A;  2QBY B;  5DUI A;  1UST A;  2AXL A;  2PFB A;  5D5W B;  5E1X A;  2BYV E;  1MJB A;  1ZGA A;  1RIO H;  2DAO A;  4FHT A;  5L3D A;  2IP2 A;  3WTW C;  2TDX A;  3JAM K;  1DUX C;  2JTV A;  2PLY A;  1IRF A;  1Z6R A;  2DI3 A;  4BHP A;  3BJA A;  2HQR A;  4OIP F;  4UUV A;  2E7X A;  2M87 A;  2GZW A;  3ECH A;  5IT9 K;  3GW2 A;  2PJP A;  4LLN A;  1FNN A;  4MNU A;  1D3Y A;  2P5L C;  2VBZ A;  3GWZ A;  1T0F A;  3HSF A;  3BPX A;  4RGX A;  2FBK A;  3WTT C;  2L4M A;  4BYY A;  4U0Y A;  1YW8 A;  1XDU A;  2P7V B;  1FP2 A;  1I27 A;  5BOX A;  3HYI A;  1FY7 A;  2P7C B;  1LEB A;  3FMQ A;  4HW0 A;  1BI1 A;  1B1B A;  2XAQ A;  1TNT A;  4KIG A;  3BZ6 A;  5FO5 A;  3V7R A;  1ZHF A;  1LQ1 A;  1HST A;  1V3F A;  4M73 A;  2HKX A;  4AVP A;  1KU9 A;  2RNJ A;  3T0Y A;  1SFE A;  4ZH4 F;  3ZN0 A;  2RC4 A;  1YW9 A;  1UCR A;  3M9A A;  2A07 F;  2STT A;  1QQI A;  1F5T A;  2VBY A;  4HQE A;  2BEO A;  5L3F A;  3Q9S A;  1L3L A;  1QPM A;  4KIF A;  3WTU C;  2P5K A;  2XAG A;  3HRM A;  4R79 A;  4XBF A;  3K1P A;  3KP5 A;  3BP8 A;  2FSW A;  4EM0 B;  2QM3 A;  1W5S A;  4GCV A;  2NAZ A;  1U2W A;  4KN7 X;  4KN4 X;  2O0Y A;  5J8C A;  2QQB A;  2L01 A;  3LA7 A;  4P96 A;  3CO7 C;  1BC7 C;  4XLP F;  2K4B A;  2EV0 A;  1WQ2 A;  5ICC A;  4CDG A;  3B73 A;  1USS A;  3C18 A;  4GGG A;  1T38 A;  3HSR A;  2ZBK A;  4WX9 A;  2MH2 A;  5K5R A;  1GXQ A;  2RKH A;  6PAX A;  3CUO A;  2GWR A;  2BBY A;  3H3Z A;  4LLL A;  4A12 A;  2QBY A;  2HZT A;  1IUY A;  4PGH A;  3QP5 A;  1SAX A;  4I0B A;  1GHC A;  1D8J A;  4O5V A;  2CO5 A;  1DPU A;  3W6K B;  1O3R A;  3I54 A;  3GVA A;  5ILU A;  5ILV A;  2G7U A;  5L3C A;  5BPI A;  4EQQ A;  1HXD A;  4UV9 A;  3DV8 A;  2HFH A;  1J7K A;  1OR7 A;  5LHH A;  1K79 A;  5HLH A;  3V8J A;  1CF7 B;  4UVB A;  4NB5 A;  2DTR A;  3KEO A;  2YR2 A;  3HHH A;  3GO5 A;  3E97 A;  4N9H A;  3ZMZ A;  4ZYD A;  4JQF A;  1JGS A;  1G6N A;  4R8H A;  2KIU A;  2CFX A;  5ED4 A;  3Q5F A;  4BNC A;  2HTS A;  1RUN A;  1E17 A;  1XB4 A;  5E1Z B;  1TNS A;  1PUE E;  1W5T A;  3JW4 A;  2L54 A;  3Q9V A;  1I5Z A;  5L3G A;  3C7J A;  4G94 A;  4EJT A;  2XUB A;  1ZH5 A;  4ENN A;  1IXS B;  5KVR A;  5E18 F;  4YG2 F;  1H9G A;  1GVJ A;  2FXA A;  3DXJ F;  5E17 F;  3GFJ A;  3QU3 A;  1O7F A;  1IN8 A;  1PP7 U;  5HDN A;  5DCF A;  2PQ8 A;  3B02 A;  5F6F A;  3CUQ A;  4RGU A;  3TO9 A;  2IRF G;  3O6B B;  4WCG A;  2QVO A;  5DD8 A;  3T8T A;  4BHC A;  3J80 Z;  5LLQ A;  3D0S A;  3WTZ A;  2HR3 A;  2EFP A;  3KZZ A;  3M7G A;  2JPC A;  4G7O F;  3WE3 A;  1WSU A;  1SD4 A;  2DO7 A;  3P9C A;  3RPQ A;  1Z7U A;  2XAF A;  4CXF A;  4FX0 A;  3G3Z A;  5IT3 A;  1RZ4 A;  4HLY A;  2F5D A;  3G73 A;  3F3X A;  2ACJ A;  3L2C A;  1QZZ A;  2QEN A;  1ZAO A;  4MGR A;  1XSV A;  2FA5 A;  1EH6 A;  2VC1 A;  3T1B A;  5CLS A;  5JFR A;  3ABU A;  4R1H A;  2XHK A;  1WRJ A;  2QZ8 A;  4A0Y A;  2VXZ A;  1TQI A;  3C3W A;  5H20 A;  1YS7 A;  3O2P E;  3KP4 A;  2H6B A;  1Z9C A;  4I01 A;  2BE5 F;  3QPT A;  3C1D A;  1EH8 A;  3LST A;  5ICG A;  4Q4Z F;  2DBB A;  5K1Y A;  1ONV A;  2DK8 A;  1MDM B;  1TQM A;  3L7W A;  4XSZ F;  3NQO A;  1IN6 A;  3LFK A;  1BJA A;  2X0L A;  1U6G A;  3COA C;  3DQV C;  2G9W A;  1G3S A;  2VC0 A;  4EMS A;  2OAZ A;  2DW4 A;  3GX4 X;  3CJN A;  2KKO A;  4M71 A;  2OA4 A;  2EV6 A;  3TOB A;  2W57 A;  2IT0 A;  3F23 A;  2FF4 A;  2VOP A;  2M1B A;  2P8T A;  3HOT A;  3ABT A;  2CYY A;  1FYM A;  3ULQ B;  1CF7 A;  4L5I A;  4G6Q A;  2IW5 A;  3REO A;  1BI2 A;  1IN5 A;  4AIH A;  4HOB A;  3VFZ A;  4HZF A;  3BOQ A;  1U78 A;  3TO7 A;  3F8M A;  5LHG A;  2PBI A;  1ODD A;  5BMZ A;  3E6C C;  3I71 A;  1YFH A;  2A6E F;  2A3S A;  3T8R A;  4ASN A;  5JHU A;  3L00 A;  3MEX A;  1SMY F;  2P5V A;  3GLX A;  2CSO A;  1XGO A;  5DV5 A;  1BBY A;  2D1H A;  3QRF F;  1R1T A;  2JPB A;  3HRT A;  1O3Q A;  1S29 A;  3P7N A;  3I58 A;  4HAM A;  3T5X A;  4EJW A;  2DU9 A;  4HV5 A;  4O6J A;  1K6O A;  3M8F A;  1XD7 A;  5JI6 A;  2VE8 A;  2F5E A;  3F8F A;  5KK1 A;  1HW5 A;  4BAY A;  3DF8 A;  2L02 A;  2K27 A;  2Z5U A;  1I1S A;  1XGN A;  2PEX A;  3I53 A;  1U5T C;  5AON A;  5E20 A;  2XAS A;  3RKY A;  1C0W A;  1BIA A;  4OIQ F;  3I64 A;  3MZH A;  1OYY A;  1Y0U A;  2M30 A;  3DFG A;  3E6B A;  1R22 A;  5LHI A;  4MHG A;  1G3W A;  2IA1 A;  1QBJ A;  1KU7 A;  5ICE A;  4HX8 A;  1MDM A;  3F72 A;  2ZKZ A;  1DP7 P;  1XSD A;  3GZ5 A;  3TOA A;  3PFI A;  3K1M A;  4DNC A;  3GFI A;  4B8X A;  5D4R A;  2DT5 A;  3WGH A;  2DPD A;  3ZN1 A;  2YSR A;  3ZQ7 A;  2QUF A;  2YU3 A;  1BM9 A;  4B09 A;  3EYY A;  3MFK A;  3ERE D;  2RQP A;  4K2E A;  2UWM A;  5E8I A;  3U2R A;  3GEZ A;  4MQ9 F;  3MCZ A;  4XSX F;  5E8G A;  2O61 A;  5LGT A;  2KJC A;  4IVN A;  2B0L A;  4EJU A;  2F5F A;  4MTD A;  3HTU A;  4MQV A;  2XIG A;  2HKO A;  2EFN A;  1FC3 A;  1SFX A;  5HDK A;  1I1G A;  3TDU C;  4CO8 A;  4FX4 A;  3VOE A;  1V4R A;  1IZ1 A;  2ADU A;  3V8K A;  3SHF A;  5AIP A;  3RYP A;  3W6J B;  3ZMV A;  1B4A A;  5F64 A;  3FM3 A;  5D6F A;  5E1W A;  2ZME A;  5ICF A;  2FEZ A;  4IHS A;  1S3J A;  4G7Z F;  5K5Q A;  2KJB A;  2OZ6 A;  4AIK A;  1JHH A;  4ENK A;  4RGS A;  3OV8 A;  2Z33 A;  2KIF A;  1A04 A;  2Z3Y A;  4BQA A;  3F8B A;  3MAJ A;  1WI9 A;  2IJL A;  4MTE A;  2D2W A;  1QGP A;  2HGC A;  4Y17 A;  4YII A; 
#chains in the Genus database with same CATH topology
 2R7D A;  3MKY B;  1WVR A;  1P6R A;  4XOR A;  3MD2 A;  5LGN A;  2DDB A;  3IRQ A;  2E7W A;  2NVY J;  2FRH A;  4WWC A;  4DGW B;  2M0C A;  4D9J A;  3PNV A;  3DEW A;  2R5Z B;  4PJ0 C;  3HIF A;  3JTH A;  4M6X A;  2V1N A;  2R0Q C;  2A5Y B;  5F0H A;  2V1U A;  2QYO A;  3IP4 B;  3GBG A;  1J75 A;  3WG9 A;  5A2Q Z;  1K7A A;  4I0A A;  4Q48 A;  3FBN B;  3S1M J;  2GA2 A;  1FLI A;  3TO6 A;  3JSP A;  3IL2 A;  2D5V A;  3MWM A;  2JZY A;  4EM1 A;  2KIQ A;  1UZC A;  4Y13 A;  2OU2 A;  4FTH A;  3M8J A;  1FMV A;  1IC8 A;  2HOS A;  2Q1Z B;  1H88 C;  2OBP A;  3C2B A;  3OS0 A;  2EIM H;  4QTR A;  2STW A;  3EQL F;  2Y75 A;  2LF8 A;  3KZY A;  2LMD A;  3CDH A;  4M3D A;  4S04 A;  2HEO A;  4QPO A;  2PG4 A;  4XRF A;  1ZKG A;  1X2N A;  4CZZ A;  1HKT A;  1GVD A;  2WV1 A;  3HKZ A;  3CUQ B;  3SFI A;  5C3E J;  3E5U A;  1FYL A;  2W24 A;  1R58 A;  1J0R A;  2HQN A;  1DGR M;  3ISP A;  4IF4 A;  2HOA A;  3LSM A;  5FFX A;  3FDY A;  3VB2 A;  1D5Y A;  1U9N A;  4YIF A;  3F6V A;  4Q47 A;  1ZGJ A;  3QOP A;  5M3M J;  1T0F C;  3OYF A;  3GTQ J;  3HTS B;  2Y0S A;  2EZK A;  3O8H A;  2DFI A;  4G8X A;  4CIC A;  1RET A;  1LDJ A;  2FOK A;  3BR1 A;  2PJR B;  4BU2 A;  4Y4R A;  2ME0 A;  5JVT A;  3FXU A;  1I6X A;  3ABM H;  1T2K A;  1I3A A;  2Q2E A;  2CWE A;  5GPA A;  3I56 I;  1NH3 A;  3ZMS A;  4BXU A;  5C44 J;  5GAH J;  1T56 A;  3V8L A;  1SC7 A;  4UVA A;  2GA1 A;  1KU3 A;  3OYE A;  5LRR A;  1YS6 A;  5DYM A;  1BN5 A;  1R00 A;  2VL8 A;  4DBR A;  2RVC A;  3P5J A;  2V4J C;  1MSE C;  1FMW A;  5DD4 A;  3K6G A;  2QQ9 A;  2F4M B;  2Y0M A;  3IC7 A;  4DBQ A;  1X4P A;  3A0H C;  3PIO F;  3J81 Z;  1T33 A;  3LSI A;  1SAU A;  4HNV A;  3BJ6 A;  4HPQ A;  4XRM A;  2H94 A;  4V19 K;  2EJR A;  2MGQ A;  3ZQH A;  2D1V A;  4BBR J;  1WJD A;  1X1C A;  2FD5 A;  5B66 C;  1V54 H;  1OYI A;  3CCY A;  4FT8 A;  4XMY A;  3HB9 A;  2CQ7 A;  1DPR A;  3QP6 A;  1V5G A;  3S3M A;  1ZR4 A;  2HOT A;  1QNT A;  3OIQ A;  4BY7 J;  4RB3 C;  2Z1D A;  3OYM A;  4HDU A;  3AG2 H;  4RAF A;  3DTE A;  1PDN C;  2A68 F;  3PM1 A;  2MLK A;  3A02 A;  3R4K A;  1O4X A;  1K83 J;  2QF7 A;  3EUH A;  3HRS A;  2OC6 A;  3OL4 A;  2NOG A;  4IHY A;  1ACI A;  4JK1 X;  4XK4 A;  3HRU A;  5BS6 A;  2LLK A;  5CVI A;  2EPF A;  3CQZ J;  3QQA A;  4MFE A;  4FE7 A;  1FBQ A;  4ZTJ A;  1GLN A;  2IS1 A;  1A6Q A;  4AWX B;  3JTG A;  3HKZ N;  2X6W A;  3E5Q A;  5D8L B;  3GTG J;  1Q1H A;  1RRJ A;  3ZPL A;  5EEH A;  2ZNZ A;  4A3C J;  3UR3 C;  3LSR A;  1ZRF A;  5HLG A;  2W25 A;  4LK0 F;  2DN0 A;  1SFK A;  2VKD A;  3BG6 A;  4M74 A;  1BI3 A;  2HOE A;  4IRI A;  3HDD A;  4XQF A;  1K61 A;  2LDU A;  2L9N A;  4PJJ A;  3G6E I;  1V5F A;  1K78 B;  4RB1 A;  1WWX A;  2XDV A;  4RDU A;  1F4K A;  1T95 A;  3H3V K;  5IOZ A;  3BG3 A;  2V9V A;  5IP6 A;  1Z21 A;  1NHA A;  3BG9 A;  2L7K A;  1ETX A;  3LSK A;  3MMY B;  3FXR A;  2FML A;  1IRG A;  5AIQ A;  3DU6 A;  4A6E A;  3HBL A;  1WJF A;  4KMF A;  3J7A Y;  2ISZ A;  4BH9 A;  2R5Z A;  4RB0 A;  1DDN A;  2O8X A;  3OY9 A;  4YFN F;  2NS7 A;  2M2E A;  5F0F A;  3H3U A;  3S17 J;  2E5N A;  4XOP A;  3CCM I;  2F5C A;  4IPA A;  3LSH A;  1B9M A;  2NVQ J;  2XSD C;  2DQR A;  2Z9O A;  1S7A A;  1BOA A;  3KP7 A;  5E79 C;  1Z05 A;  1U5T B;  1CGP A;  1SVO A;  1LFP A;  3V7S A;  2PMZ A;  4DZP A;  2WAF A;  1R71 A;  4AYB A;  3QPS A;  2P81 A;  2DJI A;  3QPL A;  4XID A;  1J5Y A;  4QLC U;  3OYI A;  1CQT A;  2ZCW A;  2M5W A;  4IRH A;  3U21 A;  2K86 A;  3VPR A;  3DBH B;  2VPL A;  4WXD A;  5KAI C;  4IRG A;  1U3E M;  1QVU A;  1KZH A;  2W1O A;  2LD5 A;  1UMQ A;  2EFO A;  3F21 A;  1ETV A;  3PO3 J;  1FYK A;  3RTR A;  2EH3 A;  4L9J A;  3DEU A;  3DU5 A;  1R23 A;  2L7Z A;  5F08 A;  1ZLK A;  2ID6 A;  5HVQ C;  4RMN A;  1MMS A;  2EK5 A;  1VQ5 I;  1QA6 A;  4XIC A;  3HJE A;  3WTX C;  2JT1 A;  4HLX A;  2WV0 A;  4XLH A;  5HS9 A;  1FOK A;  4YIR X;  5TIS C;  3FF5 A;  1UHS A;  3RPU D;  1TL8 A;  2PJR A;  1UFM A;  1ON1 A;  2VPR A;  3GCM A;  2V6C A;  5LGU A;  3FXQ A;  3LNQ A;  1D1B A;  4HV6 A;  1FOY A;  5D5V B;  4HDV A;  4L0Y B;  4BUP A;  3GFL A;  3S8P A;  2LNB A;  3BRO A;  2ZXI A;  1IV6 A;  1RNL A;  1G59 A;  4A3K J;  4HF2 A;  1FOW A;  3BTI A;  2IS6 A;  5IYD J;  1MKM A;  4FAS D;  2DJN A;  3OS2 A;  5IYC J;  1ETK A;  3HXL A;  1DGW Y;  3K2A A;  1WJ5 A;  3CCU I;  4L9N A;  1R36 A;  1NK3 P;  2CW8 A;  4GRI A;  2LY2 A;  2DQL A;  3A4C A;  2X6Y A;  2L9R A;  3BTJ A;  4XN0 A;  2P6S A;  2JQ7 A;  2KFD A;  3IWF A;  4ITV A;  1VQN I;  4N4O B;  4IHX A;  1FEX A;  2ETH A;  4S05 A;  1D5V A;  1T6S A;  1PP8 F;  4GFB A;  1TWA J;  3CO6 C;  4YFK F;  4QWQ A;  2XV4 S;  2CQX A;  4N9I A;  2BY3 A;  1KGS A;  2HVR A;  2LC2 A;  1Y1W J;  4PJM A;  5IP7 J;  3E3V A;  2XF5 A;  3ZMU A;  1WFX A;  3TQN A;  1OJL A;  1R1V A;  5L3E A;  4XOT A;  2Q0O A;  2WY7 Q;  5IYB J;  1FZP B;  4ZYH A;  4C3I J;  5HS7 A;  1TP4 A;  3K9T A;  3HSE A;  3VWB A;  2N8G A;  1F1Z A;  2FBH A;  4AYB N;  4C30 A;  4RB2 C;  2K85 A;  1J09 A;  2ESN A;  5HOD A;  1MBH A;  2JN6 A;  2LKP A;  1X19 A;  4EM2 A;  2DOF A;  1FX7 A;  2IGM A;  4JX6 A;  3LQR A;  4LD5 A;  3Q0U A;  4PDK A;  2QCO A;  2DOE A;  2JRT A;  5ERI A;  4PGG A;  2Z99 A;  2F48 A;  1P7I A;  1EV7 A;  1HW1 A;  3H5A A;  3U1D A;  4E70 A;  1K78 A;  1U8R A;  2KLO A;  3BDD A;  2BGC A;  4IZZ A;  3HOS A;  1GV2 A;  3EET A;  2QSH X;  3J7A O;  4CYC B;  2D45 A;  2HTJ A;  3IH4 A;  2XKP A;  3RPU A;  1ZTR A;  2K02 A;  3QWL A;  1Q1V A;  2NVU B;  3K69 A;  3S32 A;  1XGS A;  2FBI A;  3KYD B;  4P9F A;  3HOZ J;  1QVT A;  4EGY A;  2ZXJ A;  1IAW A;  1W1W E;  2K40 A;  2OPT A;  1KU2 A;  5LFA A;  2ZME B;  2AQF A;  1LDD A;  3PUB A;  1QZE A;  4RAG A;  1KON A;  5D6E A;  2LVS A;  4BS9 A;  1XMA A;  3J80 K;  2YX4 A;  2LKX A;  5CVR A;  2YUS A;  3KP2 A;  1FSH A;  2HWV A;  3OYJ A;  1B6A A;  4WXH A;  4ZTF A;  1SFU A;  1WJA A;  1OYW A;  2R7F A;  4M9Z A;  5F1R A;  2Y30 A;  4M6Y A;  2RGV A;  2BW3 B;  4IHV A;  2EV5 A;  1MH4 A;  1MW7 A;  1JKR C;  2FQ3 A;  1IUF A;  1G3Y A;  1AOY A;  1U5T A;  2MH9 A;  1R5I D;  3NWS A;  2WWY A;  4KA4 A;  4I2O A;  4M72 A;  4LB5 A;  1W36 C;  1MZB A;  1X1P A;  2IA2 A;  3KP3 A;  1E3O C;  2O3F A;  2E5Z A;  3RKQ A;  2CGP A;  1A5J A;  3E6M A;  2QSF X;  2RNG A;  4L9V A;  4EGZ A;  1STZ A;  1WJE A;  2IS4 A;  1QHG A;  5FD6 A;  2VON A;  2V1D A;  3LFU A;  3SYT A;  3HOW J;  4HEA 2;  1OCZ H;  1FBS A;  1JHF A;  1H0M A;  4HNU A;  2E35 A;  3I9V 2;  4EJO A;  1YIO A;  3PFY A;  4HYE A;  1N75 A;  2BY0 A;  3RJP A;  1IGN A;  3KYC B;  2XC7 A;  2ZFU A;  3R0A A;  2IS2 A;  3RQI A;  4L9T A;  5HOO A;  4RBO A;  3PQK A;  3FMR A;  3CMY A;  2VT2 A;  2VOO A;  1XCV A;  1MMG A;  2COB A;  2M7A A;  5K7Z A;  5GAE J;  1P7J A;  3JAM Z;  2LSO A;  4I09 A;  2ELK A;  2HYG D;  5J1Y A;  3QYE A;  1B59 A;  2K7L A;  1WKM A;  1Y1V J;  1R1U A;  3K2Z A;  2F2E A;  1QPI A;  3V4G A;  4D7M A;  4PUS A;  2NYX A;  4XN3 A;  5EDN A;  4D0P A;  1AWC A;  4ZJZ A;  2KRH A;  1MSF C;  1YOV B;  2KQR A;  3S2W A;  4IHT A;  5IT9 Z;  1YG2 A;  4IXA A;  3BCA A;  3M8E A;  4X6A J;  2CMP A;  3PSF A;  1O7L A;  5CVV A;  3KCC A;  3M1E A;  4OWR B;  1FPQ A;  2KMU A;  3NWT A;  3VYU B;  3CCV I;  2W00 A;  2VLA A;  4CCK A;  2JVH A;  1DU6 A;  2IVM A;  3SDG A;  1O57 A;  3SZP A;  3KLN A;  3PL8 A;  2EIN H;  3ML6 A;  1KYW A;  5J4V A;  2E60 A;  3K70 D;  1WGX A;  1HBX G;  4L0Z B;  3CCS I;  5BPD A;  5FB2 A;  1O3S A;  3TW7 A;  4EV0 A;  2K3P A;  3WHC A;  3OYB A;  3GME A;  3TP3 A;  1MBG A;  4PSX A;  4KIB A;  1KQ8 A;  3KE2 A;  3R61 A;  2F5V A;  3LSJ A;  2FMY A;  2KIM A;  3BCB A;  1SFO J;  2WC2 A;  1L0O C;  4P55 A;  4A93 J;  2PMH A;  4ESJ A;  2WB1 A;  2LG4 A;  3VEP A;  1HDP A;  1OCO H;  4LGW A;  1OKR A;  4YFX F;  2VKV A;  4F52 A;  2JSC A;  4CUG A;  3BQZ A;  2JSP A;  4BBS J;  4UXN A;  4RAZ A;  3WHB A;  2QLZ A;  4RLQ A;  2L7M P;  3JSO A;  3CMA I;  3N97 A;  2DPU A;  5J47 A;  1XGM A;  3IAS 2;  2A6H F;  3ZOB A;  1TBX A;  2IGN A;  4OMY A;  1ZG3 A;  4II2 A;  4BE1 A;  2QWW A;  2EA2 A;  1JT6 A;  3DPT A;  1IJW C;  4NNJ A;  1JT0 A;  2CW0 F;  3HUG A;  1E3H A;  4NC7 A;  4GYG A;  3GZ6 A;  2P0W A;  4CYC A;  1XMK A;  3CJQ B;  3F22 A;  4M9X A;  1IF1 A;  3IHU A;  3TGN A;  4XL9 A;  3E1S A;  5GTI C;  5JHF A;  2JA2 A;  5FKO A;  4RA2 A;  2XKO A;  4ZDP A;  2DMP A;  1UHW A;  4BDY A;  4YEL A;  2R4G A;  1VF9 A;  3AL0 C;  2X1E A;  1HQC A;  5M5X J;  5H6R A;  5ILS A;  4HX4 A;  1KA8 A;  2P6T A;  4XLE A;  5EZH A;  5KCM A;  2KPM A;  3OYD A;  3GTK J;  2H6C A;  3HHG A;  3OS1 A;  3HEF A;  2CG4 A;  2H1K A;  4N0B A;  3IWZ A;  1W7P A;  3K4B A;  2HPI A;  4F3Q A;  2GXA A;  2VN2 A;  2BW3 A;  2XRN A;  3WE2 A;  2LF7 A;  1YYV A;  1TWG J;  4KIS A;  2W85 A;  2V79 A;  1LB2 A;  2WAQ N;  3DKX A;  1G4D A;  3GYH X;  4ENM A;  4KFC A;  2E19 A;  4EJV A;  2EWN A;  5IY5 H;  3SZG A;  2M8G X;  3R6S A;  1FJL A;  2W82 A;  4I99 C;  2HYF A;  5D4S A;  2ZNY A;  4MLO A;  1RR7 A;  4FCY A;  4E7Z A;  4L5J A;  1RI7 A;  4U0V A;  2XAJ A;  4UUS B;  1D8K A;  4A5N A;  4IO9 F;  4E7J A;  2DMN A;  4C2T A;  4OMZ A;  1UG2 A;  4ANJ A;  3VSL A;  3ZQG A;  5H2F C;  2HDC A;  3HC7 A;  1BIB A;  2VQC A;  4O3M A;  3LA2 A;  5DS9 A;  3AFH A;  2MAB A;  2WB1 N;  1GUU A;  1NG7 A;  2ZJ2 A;  2GAU A;  3LWF A;  3EDP A;  4G9Y A;  3JRH A;  2RAE A;  4HF0 A;  1ORK A;  4PFP A;  4BJ6 C;  3MZY A;  5CQE A;  2ZJR F;  2EFQ A;  1IRZ A;  2CUJ A;  3K4M A;  2DLL A;  1VQK I;  1ZQ3 P;  1KYZ A;  1D0Z A;  2ZO4 A;  1JJ8 C;  2MBF A;  1O3T A;  3TED A;  1IW7 F;  4WK8 F;  4A3G J;  1XN7 A;  3BPV A;  2L4A A;  4UVC A;  1BR1 A;  1MND A;  1JUS A;  2V7F A;  1FT9 A;  1N78 A;  1T98 A;  3BR0 A;  3W3C A;  3NEU A;  1HSJ A;  3VDX A;  1LNW A;  1QO0 D;  4U0W A;  4Y3O A;  1D0X A;  4E7L A;  2NS8 A;  3FX3 A;  2HVS A;  3GUD A;  3IH3 A;  4W1U A;  2HDW A;  5LEK A;  1E0E A;  4HBL A;  2CQK A;  3KIO A;  2R7Q A;  2DOD A;  1YQA A;  2MD0 A;  3FIS A;  4M6V A;  3CC4 I;  4ZYA A;  2AS5 F;  3KET A;  4E7S A;  1IO2 A;  2ESH A;  3LA3 A;  4LIV A;  2V9P A;  3CCQ I;  3ELK A;  3DWL E;  1VND A;  1YRN A;  3F6O A;  3OOP A;  1R5G A;  2WY8 Q;  1ZN2 A;  4BL0 B;  3TKY A;  3OSF A;  2E71 A;  4LFU A;  1ZAR A;  2ELH A;  3ZQC A;  2OTJ I;  2O6G E;  3G71 I;  3J7Y J;  3MZ8 A;  2PMU A;  1QHH D;  4XKW A;  5C4J J;  2CFO A;  3MQ0 A;  1SD5 A;  4LB6 B;  2PN6 A;  2E1N A;  2XGX A;  2IPQ X;  4XNF A;  3VOD A;  3I55 I;  3HPG A;  4A2U A;  2OQG A;  5EG0 B;  1D0Y A;  2R3S A;  3G1M A;  1Z91 A;  5TGT A;  2COM A;  3AAF A;  4UNO A;  3H0G J;  2RV8 A;  2R7O A;  2EBI A;  3OMY A;  1T08 B;  3G2B A;  4C2M J;  2ZSH B;  2AQE A;  1ZLJ A;  1D1C A;  4B47 A;  2FU4 A;  4LMY A;  3AG3 H;  3G1O A;  2AXT C;  2K4J A;  3GTJ J;  2CJJ A;  4FE4 A;  3NRV A;  2G7H A;  2V26 A;  3F8C A;  4PCQ A;  4G12 A;  5CVJ A;  1J9I A;  1J59 A;  2V1X A;  1ZG5 A;  3F9K A;  3WG7 H;  4RS8 A;  1XSX A;  1P4A A;  5J40 A;  2IGO A;  2X1D A;  2MSY A;  1WH7 A;  4N4N B;  2OQR A;  3CTA A;  5D5X B;  2HNH A;  4MEY F;  2KIS A;  1JE8 A;  3IH2 A;  1SD7 A;  4LJZ F;  2VBW A;  1NG6 A;  1FP1 D;  3BG5 A;  3FKI J;  5E3M A;  2ZJQ F;  4ENJ A;  4BAC A;  3WTV C;  3OYL A;  4C3J J;  1VQ6 I;  2OD5 A;  2LOO A;  5JR3 A;  2XPV A;  3K0L A;  3LL7 A;  4KIC A;  3L2V A;  1MJ9 A;  2UXN A;  5H6Q A;  3F0C A;  1T39 A;  4PSW A;  3Q0W A;  5FD5 A;  3TDZ C;  2GLO A;  2HDD A;  3GZN B;  5A2Q K;  3CP2 A;  3O3K A;  1TLH B;  4BE0 A;  4U88 A;  4G7H F;  2GXG A;  3OYC A;  1P9Q C;  4UHT A;  2JUG A;  3RIR A;  2NXN B;  1YJ9 I;  3KFW X;  1MD0 A;  2VJ4 A;  4GYI A;  4UUS A;  3O8G A;  4ZZD A;  2M8E A;  2Y0S N;  2H27 A;  4PZJ A;  2HU9 A;  5HDG A;  2C6Y A;  3MVP A;  4X0G A;  1G3T A;  3KYL A;  1RPW A;  3I59 B;  4D1Q A;  1IXC A;  2Y31 A;  4GXO A;  1Z6T A;  3BZK A;  4AUX A;  1POG A;  3FM5 A;  2K3F A;  4JP0 A;  2FUG 2;  1LE8 A;  2NVX J;  3BT9 A;  1ULY A;  1OMI A;  2HXI A;  2DA6 A;  2X4H A;  5IPA A;  1BJZ A;  2CV1 A;  1HDD C;  3LQQ A;  1JKQ C;  3SFZ A;  4UV8 A;  3RDI A;  2OTL I;  1SD6 A;  1LUJ B;  2O03 A;  2XVC A;  4ABZ A;  1R6R A;  4KT5 C;  1YLF A;  1P4X A;  1XC5 A;  1Y8R B;  3EUH C;  5FFZ A;  1HLV A;  2B63 J;  4ZYG A;  3D5L A;  5LBQ A;  2RDP A;  1UB9 A;  3JRA A;  2MD5 A;  3VYS B;  2DTZ A;  2KRC A;  3FZV A;  3R0J A;  4RGR A;  2EZL A;  2GQQ A;  5IP9 J;  5J8F A;  1FSE A;  2Z16 A;  2DA4 A;  1OR7 C;  1IN4 A;  1E2X A;  3WGI A;  1YW7 A;  4A6D A;  2FX0 A;  2H1L A;  4BEH B;  2NRA C;  1VZ0 A;  3QU6 A;  3S14 J;  4U7B A;  3RKW A;  5LEJ A;  3IAM 2;  2EFW A;  2HYJ A;  2J5P A;  3FK7 A;  2CRG A;  4A0X A;  1ZR2 A;  3IRR A;  4KUM A;  4ON0 A;  1RKW A;  1S6L A;  4DYC A;  1QZY A;  4HF1 A;  3DPL C;  2LTP A;  2VBX A;  3CMM A;  2MG4 A;  3WOD F;  2E2J J;  3J81 K;  3ECO A;  4LG0 B;  3KZI C;  1P92 A;  1LJ9 A;  2RN7 A;  2UUZ A;  2DCE A;  1A36 A;  4EAT A;  4CGZ A;  2VQG A;  3TBI A;  4PFO A;  3I4P A;  5HS8 A;  1ON2 A;  3BZC A;  4OOI A;  2Q8K A;  5EF6 A;  1N77 A;  2CUE A;  2OJE D;  1T8I A;  4D5C A;  4ESF A;  4Y15 A;  2CQQ A;  4D5F A;  5EG0 A;  5F0C A;  3OL3 A;  1IDZ A;  3A1Y A;  5K5O A;  2I8D A;  2VKE A;  1YO5 C;  1H9T A;  4JBA A;  4M3B A;  5DCM B;  2UZK A;  5IOY A;  2Y48 A;  4BGD A;  3DLL F;  4WXC A;  4NQW A;  3B6C A;  2DMQ A;  2W48 A;  5F04 A;  3L2W A;  3KPH A;  1EH7 A;  5GAG J;  4P9U A;  4IEJ A;  1X1B A;  4E7H A;  2GM4 A;  3I5U A;  4M3E A;  2QGU A;  2VKH A;  1B72 A;  3S1Q J;  5EEG A;  3U9G A;  5LRS A;  4JYK A;  4XRS G;  3V7C A;  4FET A;  3L2Q A;  1S8N A;  2JWT A;  2XAH A;  1TC3 C;  3L9F A;  2X85 A;  4H0E A;  3P9I A;  4LG3 A;  2MLG A;  3CUQ C;  4CH7 A;  3IKT A;  1RUO A;  2UWM A;  1R7J A;  3IV5 A;  4U87 A;  2W4S A;  5EYR A;  1I50 J;  2IAI A;  2FOW A;  3BY6 A;  3LAP A;  1REP C;  3GTO J;  2M3A A;  2UXX A;  1XMX A;  4IL6 C;  1XG1 A;  4M9S A;  3GF2 A;  3CC2 I;  2R7S A;  2BHY A;  2VE9 A;  3WTY C;  2DFE A;  3AL0 B;  1TWH J;  3BJO A;  1XDS A;  2KRF A;  4RAY A;  2PMZ N;  3OYA A;  2PI0 A;  1X3Z B;  5B1A H;  1IN7 A;  2EB7 A;  1ZG1 A;  3L2R A;  1W4M A;  3BQY A;  2X6O A;  4BJ5 C;  4HQM A;  2FNA A;  1Y6I A;  4CYD A;  1N25 A;  4OU0 A;  4A0Z A;  1TTY A;  1BR4 A;  4QPQ A;  2YPR A;  1Z1D A;  2NNY A;  2KDO A;  2YX7 A;  2VOD A;  3PQJ A;  1MBK A;  1I39 A;  2VAS A;  3KEQ A;  3WGG A;  4CCJ A;  5HNH A;  4NDL A;  1MJA A;  4G6D A;  4P1W A;  1HW2 A;  1HC8 A;  1DQU A;  3HUG B;  1YHQ I;  4KNY A;  3M4O J;  3CD6 I;  5DDG A;  3AG1 H;  4IHW A;  1BI0 A;  1UHM A;  3BR3 A;  3K10 A;  4KMU X;  4UUT A;  4CA0 A;  3A01 A;  3HL2 A;  5FLX Z;  4WF2 A;  1MIJ A;  2XAU A;  1GT0 C;  3N4M A;  1KQ0 A;  1RKT A;  2WA0 A;  1BW6 A;  2BVM A;  3ROU A;  5CYV A;  3H5R A;  3VSK A;  4DYQ A;  2P4W A;  2WTE A;  4I7H A;  4IOA F;  2WAD A;  2DK5 A;  3I59 A;  1IG7 A;  2E1M C;  3FWE A;  3X2Q H;  1M1E B;  4U7D A;  1S7O A;  4DQ2 A;  1ZRC A;  5E3L A;  1IRX A;  3QAH A;  4OIN F;  1GXP A;  1X4O A;  3W2W A;  4E6K G;  4D7N A;  1HOM A;  2DXI A;  1XPX A;  3B6A A;  1MMD A;  2MW8 A;  4EVI A;  3RCO A;  3SXY A;  2ISY A;  3UNG C;  5DM7 F;  3FHZ A;  4BQO A;  4JX5 A;  1W7P B;  4IJA A;  3ZQL A;  2ID3 A;  3CLO A;  3PNT A;  2CS3 A;  2JA5 J;  1WPK A;  4CCM A;  2L9V A;  1LFU P;  1Z77 A;  1YJN I;  2DA7 A;  1U8B A;  4NBQ A;  2E1C A;  4AD9 A;  2VB6 A;  1R4N B;  2TCT A;  1TWC J;  1Z3X A;  4ZZL A;  2A69 F;  1IV8 A;  2VXD A;  3EYI A;  2OUM A;  2FNP A;  3CCJ I;  4LOC A;  4I98 B;  3DBL B;  4OAZ A;  4A69 C;  2ZJP F;  1D1A A;  3FHN A;  5J6X A;  1OPC A;  5L3B A;  3OR1 C;  5FLM J;  1FWZ A;  4BEH A;  1TW3 A;  3KP6 A;  2NNN A;  5FKN A;  2XB0 X;  1LVA A;  2XF7 A;  3H35 A;  3SZT A;  4TV7 A;  1UAA A;  2A5W A;  5TRD A;  2HQA A;  1A6I A;  5FRM A;  3H92 A;  2H09 A;  2QQ8 A;  3M1C A;  4NUB A;  2JA8 J;  4LG0 A;  3S15 J;  2HVQ A;  3L2U A;  3I0T A;  3BTC A;  1BC8 C;  4XON A;  4S0H B;  2QA4 I;  1F9N A;  4OIR F;  2XPU A;  4RM2 A;  5D8K B;  4CSW A;  4NHJ A;  3DLA A;  4C2U A;  4LK1 F;  4XKB A;  2HQ5 A;  1JTY A;  4JX4 A;  4UY8 I;  1YTY A;  1EF4 A;  3OIO A;  3SEZ A;  5TJJ A;  1X3U A;  1YI2 I;  1YIT I;  2PX9 A;  1TW2 A;  3L09 A;  1P4W A;  5DM6 F;  1U9O A;  4GO1 A;  4A5M A;  1VTN C;  2G0E A;  1R4M B;  3NAU A;  5DCM A;  4I02 A;  1J2X A;  3FXL A;  3ZQQ A;  2K5C A;  4AIJ A;  2J5O A;  2QQA A;  4MEX F;  5CJ9 A;  5BQT A;  2MC3 A;  1X3W B;  1HKQ A;  1W7P D;  3OYG A;  3F8N A;  4XKC A;  4IOC F;  5CVU A;  3LAJ A;  2BVL A;  3BWG A;  3FMS A;  2GIV A;  4Y52 J;  4Z2Y A;  2FE3 A;  2UV1 A;  3ZMD A;  1LEA A;  3E6D A;  2RQQ A;  1K6Y A;  2EIK H;  2IXS A;  2LRD A;  3R60 A;  5GP9 A;  1ZRE A;  2GXB A;  1KQ9 A;  1YRN B;  2LBF B;  1YIJ I;  2A6T A;  4KYW A;  1FBU A;  2M45 A;  1B9N A;  1VFC A;  1MH3 A;  2HS5 A;  3IKV A;  3DKW A;  3DP7 A;  2V6E A;  3ASO H;  2E1O A;  1JXS A;  4H4K C;  4ZYE A;  1HA8 A;  3E5X A;  3K1N A;  4OIO F;  3RYR A;  5FRN A;  3CES A;  3AG4 H;  2Y69 H;  1HKS A;  2L5Q A;  5HLT A;  5HLI A;  1VQ8 I;  3M3Y J;  4P5O A;  3ZP5 A;  5FLX K;  2KZV A;  2L3D A;  2R92 J;  2ECC A;  1JTX A;  2KZG A;  3WTS C;  4CHU A;  1P2F A;  1IXR C;  3NAR A;  3QPH A;  5D5U B;  2EA4 A;  2OZU A;  4HA8 A;  2W84 A;  4HX7 A;  3JRE A;  4CZC A;  2XRO A;  3BR5 A;  4F55 A;  4ETS A;  2NS0 A;  4LLG F;  3H5N A;  3WU0 A;  3KX2 A;  4Q5S F;  1AU7 A;  2IEK A;  2X1C A;  4ESB A;  4F7Z A;  3RKX A;  4Z6Y A;  1OCR H;  2BV6 A;  1FTT A;  2CH0 A;  1MGT A;  1JI8 A;  4BHB A;  2ZFW A;  2A61 A;  3VYT B;  4DW6 A;  2VT3 A;  3GFM A;  4KJZ A;  1XCB A;  1ZRD A;  3GLL A;  2FQ4 A;  3E0J B;  1X1D A;  2M34 A;  3WU1 B;  2V9K A;  3ZMT A;  5DEQ A;  5FGM A;  1OQY A;  1SMT A;  1PVE A;  4XLN F;  2M4G A;  1ZEL A;  5DUK A;  1WCM J;  3KEY A;  1FOX A;  1BW5 A;  2K9Q A;  2X51 A;  3OSG A;  5J4Y A;  4BJT A;  4L18 B;  3SQN A;  2LKS A;  2VIX A;  3H9J A;  4BE2 A;  3RI4 A;  1TQP A;  4GDF A;  1XTA A;  5FKL A;  3S2D J;  1ZYR F;  1DU0 A;  2WBM A;  2IA0 A;  3QYF A;  1PUF B;  2KT0 A;  2MA3 A;  3P9K A;  3ZXS A;  1RR8 C;  1F36 A;  3GXO A;  3K4C A;  4FQG A;  3D1N I;  3KLO A;  5GPC A;  4KDP A;  1LDK B;  1R5H A;  2QBY B;  3ZQF A;  4E4H A;  5DUI A;  3CZ6 A;  2CU7 A;  4PJL A;  1UST A;  1MMN A;  2AXL A;  5GTH C;  2PFB A;  2R93 J;  1B8I B;  5D5W B;  5FLV A;  5E1X A;  2BYV E;  3BG7 A;  1MJB A;  3S1N J;  1ZGA A;  4YRV A;  1Y39 A;  1RIO H;  2DAO A;  1S5L C;  2XGE A;  2IP2 A;  4FHT A;  2TDX A;  5L3D A;  3JAM K;  3WTW C;  3OYN A;  3JRC A;  1JKP C;  1Y0N A;  1DUX C;  2JTV A;  2E34 A;  2PLY A;  4XR6 A;  1IDY A;  2GOM A;  2DMU A;  3A0B C;  1IRF A;  1Z6R A;  1A35 A;  2M0M A;  4A3B J;  2R7U A;  2DI3 A;  4BHP A;  3BJA A;  3K4K A;  2HQR A;  2EIJ H;  9ANT A;  2ICW G;  3PSI A;  4OIP F;  2MYS A;  2XRL A;  4UUV A;  3OOU A;  2E7X A;  2M87 A;  2GZW A;  3ECH A;  1EJ9 A;  5IT9 K;  1MMA A;  2ELJ A;  3GW2 A;  1X58 A;  3H36 A;  4NC8 A;  2PJP A;  4AVZ A;  3AKZ A;  3QOE A;  4LLN A;  1FNN A;  1X1A A;  3BR2 A;  4MNU A;  5J1R A;  1D3Y A;  2P5L C;  2VBZ A;  3HOX J;  1OIS A;  2R7R A;  3GWZ A;  3HOY J;  4NC6 A;  1LE8 B;  1T0F A;  4ZC3 A;  4HNT A;  3HSF A;  3BPX A;  4RGX A;  2FJ1 A;  2FBK A;  3WTT C;  1VQL I;  4BXX J;  5LD2 C;  4KIT B;  3JCU C;  3MN2 A;  2L4M A;  4BYY A;  3HZJ A;  1RES A;  4U0Y A;  1YW8 A;  1XDU A;  2A05 A;  3SEQ A;  2P7V B;  1FP2 A;  2AO9 A;  2ZME C;  1S72 I;  1I27 A;  5BOX A;  3HYI A;  4JOM A;  4E7I A;  5FJ8 J;  1FY7 A;  2JMW A;  2R7T A;  4HST A;  3C2G A;  2P7C B;  4PK4 A;  3H0D A;  1LEB A;  3FMQ A;  4HW0 A;  1BI1 A;  1B1B A;  2XGC A;  1R49 A;  4AU7 A;  3DPU A;  2XAQ A;  1TNT A;  5F27 A;  1APL C;  4KIG A;  4BXF A;  2K9N A;  4X1E A;  1XS9 A;  3BZ6 A;  1G2H A;  2DA2 A;  5FO5 A;  3V7R A;  1ZHF A;  1LQ1 A;  3DCF A;  4IX7 A;  3K70 C;  3HGG A;  3H1C A;  5GAD J;  1HST A;  1V3F A;  4M73 A;  2HKX A;  2LBF A;  3FIW A;  4J19 A;  2CV2 A;  4AVP A;  4F93 B;  1KU9 A;  1PYV A;  2RNJ A;  4A3M J;  3Q3S A;  1SFE A;  2DDA A;  4G6T B;  3T0Y A;  4ZH4 F;  3LOC A;  3HGY A;  3ZN0 A;  3G1L A;  2RC4 A;  3TW6 A;  4F92 B;  1W0U A;  1YW9 A;  1AHD P;  3PUF A;  3CJR B;  1UCR A;  3HOV J;  3M9A A;  2A07 F;  5B5E C;  1TZL A;  2STT A;  2MFZ A;  1QQI A;  4Y7N J;  1F5T A;  2VBY A;  3D5S C;  4HQE A;  2BEO A;  5L3F A;  1S9H A;  1F43 A;  3IUO A;  3Q9S A;  5FRO A;  1L3L A;  3JRI A;  3PO2 J;  1QPM A;  4KIF A;  4B44 A;  2O5R A;  4YEJ A;  3ZQI A;  3HPH A;  2P5K A;  2XAG A;  1OLT A;  3WTU C;  3HRM A;  4R79 A;  4NQW B;  2K9L A;  4XBF A;  3K1P A;  3KP5 A;  2DFF A;  2HXO A;  3BP8 A;  4BQN A;  4C9Y A;  2FSW A;  2LR8 A;  2QM3 A;  4EM0 B;  1W5S A;  2I5U A;  4GCV A;  2NAZ A;  1B72 B;  1U2W A;  4KN7 X;  4KN4 X;  2O0Y A;  2XGD A;  5J8C A;  2O9L A;  4B4C A;  2ZC2 A;  2YU9 J;  3CJT B;  4ZDO A;  1Z7L A;  2QQB A;  5J1U A;  2L01 A;  3LA7 A;  4P96 A;  3CO7 C;  1BC7 C;  3ASN H;  2KHM A;  2NOJ B;  5JVG F;  1PJR A;  1G8X A;  2Y9Z A;  4XLP F;  2K4B A;  1OFC X;  3BC8 A;  2EV0 A;  1WQ2 A;  2M7B A;  3LMM A;  5ICC A;  1ITY A;  4CDG A;  3B73 A;  3DKY A;  1USS A;  1PUF A;  3C18 A;  2M9H A;  4MIM A;  4GGG A;  3MKZ A;  1SEU A;  2E1M B;  4RLF A;  1T38 A;  3S3N A;  3HSR A;  1SAN A;  2ZBK A;  4WX9 A;  2MH2 A;  5K5R A;  1GXQ A;  2RKH A;  6PAX A;  3CUO A;  2GWR A;  2BBY A;  3H3Z A;  4LLL A;  4A12 A;  1JUP A;  2QBY A;  2HZT A;  2E2H J;  1IUY A;  4PGH A;  3QP5 A;  1SAX A;  4I0B A;  1B8I A;  1GHC A;  1D8J A;  1DP3 A;  2AHQ A;  2EZI A;  3PJR A;  3H9Q A;  1Z67 A;  1XX5 A;  2JRM A;  5J3L A;  5M5W J;  3OWT A;  1W0T A;  2CV0 A;  1WZ2 A;  1Z0X A;  1X2M A;  2ZXH A;  4O5V A;  2CO5 A;  2ZB9 A;  3I4M J;  1DPU A;  2LY9 A;  3W6K B;  1O3R A;  3I54 A;  3GVA A;  3FBI B;  5ILU A;  1FTZ A;  5JLW A;  5ILV A;  2G7U A;  5L3C A;  3K4N A;  5BPI A;  4EQQ A;  1HXD A;  2VUM J;  2DT7 B;  4UV9 A;  3DV8 A;  2HFH A;  5CKT A;  1J7K A;  1OR7 A;  5LHH A;  3A01 B;  1K79 A;  3ZRG A;  3V8J A;  5HLH A;  1CF7 B;  2ME6 A;  4DIQ A;  4PJN A;  4UVB A;  1HCR A;  4HRI A;  4NB5 A;  4B1R A;  1OCP A;  2DTR A;  3KEO A;  2YR2 A;  3HHH A;  3JRF A;  3GO5 A;  2O8K A;  3E97 A;  4N9H A;  1LKX A;  3ZMZ A;  4AM3 A;  4ZYD A;  4JQF A;  4XRS A;  1JGS A;  1G6N A;  1BL0 A;  4R8H A;  2JUC A;  2KIU A;  2CFX A;  5ED4 A;  4V2F A;  3Q5F A;  4BNC A;  1MNE A;  1OCT C;  4A3L J;  2HTS A;  2ZXW H;  1RUN A;  3S93 A;  1E17 A;  4W97 A;  1XB4 A;  5E1Z B;  1FIP A;  2L2O A;  1TNS A;  2NVT J;  1LFB A;  1PUE E;  1EA3 A;  5DTD A;  5EZG A;  1W5T A;  3BTL A;  3JW4 A;  5EGO B;  5C4X J;  2HZD A;  4BKX A;  2L54 A;  3TP0 A;  3SJM A;  4A3F J;  3Q9V A;  3CDI A;  3TMO A;  3DBR B;  3K4J A;  1I5Z A;  5L3G A;  1K4S A;  5B3S H;  3C7J A;  2KDZ A;  4G94 A;  4EJT A;  2XUB A;  1ZH5 A;  2XPW A;  1IXS B;  4ENN A;  2W7N A;  5KVR A;  4MO7 A;  4YG2 F;  5E18 F;  1R9T J;  3ERM A;  3OYH A;  3K4L A;  1H9G A;  1GVJ A;  1MNM C;  2FXA A;  3DXJ F;  5E17 F;  3GFJ A;  2XSJ C;  2EZH A;  3QU3 A;  3EUK L;  1O7F A;  4A3J J;  3SDB A;  1IN8 A;  2LH9 A;  2QEX I;  1MBJ A;  5HDN A;  1PP7 U;  5DCF A;  2PQ8 A;  1W36 D;  1BOB A;  3B02 A;  5F6F A;  1ERD A;  3CUQ A;  3I4N J;  2L9S A;  4RGU A;  2DT6 A;  3TO9 A;  1VQ4 I;  2IRF G;  3K7A J;  3O6B B;  4WCG A;  1YX5 A;  2QVO A;  5DD8 A;  3T8T A;  4BHC A;  2K9M A;  3J80 Z;  2CUF A;  3A2K A;  3D0S A;  5LLQ A;  3V42 A;  3WTZ A;  2HR3 A;  2EFP A;  2LK2 A;  3LSG A;  3ONQ A;  3KZZ A;  3M7G A;  4DOZ A;  1HF0 A;  4MFD A;  2JPC A;  4G7O F;  3WE3 A;  5K7H A;  2VI6 A;  1WSU A;  1SD4 A;  2DO7 A;  3P9C A;  2K9S A;  3MKW B;  3RPQ A;  1Z7U A;  2XAF A;  4CXF A;  2BHZ A;  3H9G A;  4FX0 A;  3G3Z A;  3J7Z I;  5IT3 A;  1RZ4 A;  4HLY A;  2F5D A;  1WJC A;  5KHD A;  3G73 A;  2DA3 A;  3F3X A;  2ACJ A;  3L2C A;  1QZZ A;  2QEN A;  1ZAO A;  4MGR A;  4QIW N;  1XSV A;  1Z3Y A;  2FA5 A;  4IKF A;  1EH6 A;  2VC1 A;  3RZO J;  3T1B A;  5BNG A;  3ZGK A;  2H8R A;  5CLS A;  5JFR A;  3ABU A;  3DTI A;  4R1H A;  1AKH B;  2XHK A;  1LVK A;  1WI3 A;  1WRJ A;  2LFB A;  2QZ8 A;  4A0Y A;  2VXZ A;  1TQI A;  3C3W A;  1Y56 A;  1YS7 A;  3CLQ A;  5H20 A;  4IQJ A;  3O2P E;  3KP4 A;  2H6B A;  5E3N A;  1Z9C A;  4I01 A;  2BE5 F;  3QPT A;  3M07 A;  3C1D A;  1EH8 A;  2VQH A;  4CCO A;  3LST A;  5ICG A;  2JA6 J;  4F91 B;  4Q4Z F;  3EUA A;  5B1B H;  1V5E A;  2DBB A;  4BQQ A;  4UB8 C;  5K1Y A;  1ONV A;  2DK8 A;  2R7V A;  1MDM B;  5FKK A;  1TQM A;  3L7W A;  2EQR A;  4XSZ F;  2JVG A;  3NQO A;  1IN6 A;  1FIA A;  1BJA A;  2KP6 A;  3LFK A;  3S16 J;  1WHU A;  2BZT A;  2JK3 A;  4A3D J;  5FKM A;  2H8W A;  2X0L A;  1U6G A;  3COA C;  2BY2 A;  3DQV C;  2G9W A;  1G3S A;  2VC0 A;  4EMS A;  2OAZ A;  2F4O B;  3GTL J;  2DW4 A;  1VQ7 I;  1V55 H;  4LIU A;  3GX4 X;  2BY1 A;  2X48 A;  4DZJ A;  1VQO I;  3JRB A;  4E7K A;  4I6Z A;  3CJN A;  2KKO A;  1UG0 A;  4M71 A;  2OA4 A;  2EV6 A;  2YS9 A;  5CPR B;  3TOB A;  2W57 A;  2IT0 A;  2X9D A;  4A3E J;  3FXJ A;  3I3L A;  3ZR8 X;  3F23 A;  2JA7 J;  2FF4 A;  2VOP A;  1ENH A;  1MBF A;  2M1B A;  2EIL H;  4M3G A;  3S1R J;  2P8T A;  3HOT A;  4XLF A;  2WAE A;  3ABT A;  2CYY A;  1FYM A;  3ULQ B;  1CF7 A;  4L5I A;  1NK2 P;  4G6Q A;  5M5Y J;  2R7X A;  2IW5 A;  2RRE A;  3REO A;  1VQM I;  3GTP J;  1BI2 A;  2QSG X;  2B7E A;  1U0J A;  2ZSI B;  1IN5 A;  4I76 A;  4AIH A;  2Y2Z A;  3N05 A;  1ETY A;  4HOB A;  3EPZ A;  3CF5 F;  3VFZ A;  4HZF A;  3BOQ A;  4XLA A;  1U78 A;  2X6X A;  3TO7 A;  3F8M A;  3CCE I;  2BXY A;  4M3F A;  4AC0 A;  5LHG A;  2PBI A;  3TL4 X;  1VQ9 I;  5EGO A;  5E3O A;  2R7Z J;  1ODD A;  4ZDL A;  5BMZ A;  3E6C C;  1EKE A;  3I71 A;  1YFH A;  1ZGW A;  3RZD J;  3G4S I;  2A6E F;  2A3S A;  3FXM A;  3T8R A;  3CCR I;  4ASN A;  3CME I;  5JHU A;  4DYR A;  3L00 A;  1UEL B;  5M3F J;  3MEX A;  2DMT A;  4A3I J;  1SMY F;  1SVM A;  1TWF J;  5HNF A;  2CUZ A;  2P5V A;  2CSO A;  3GLX A;  3GTM J;  3CF2 A;  2MC4 A;  3ABL H;  1ETQ A;  2OF7 A;  4CCN A;  2DA1 A;  1H8A C;  2VJJ A;  1XGO A;  2GOX B;  4B3X A;  5DV5 A;  3JR9 A;  1BBY A;  2D1H A;  2R5Y B;  3QRF F;  2L7F P;  2VJI A;  1R1T A;  2JPB A;  3HRT A;  2BOL A;  3BLY A;  1NTC A;  4DJA A;  4BY1 J;  2DFH A;  2E2I J;  1O3Q A;  3L1P A;  2DYS H;  1GDT A;  1S29 A;  3P7N A;  1UJ8 A;  4RM3 A;  1WJB A;  3FK6 A;  3I58 A;  4HAM A;  3JRG A;  3T5X A;  4EJW A;  2XB5 A;  1QRY A;  2DU9 A;  4II3 A;  4HV5 A;  4O6J A;  1SVL A;  1K6O A;  3Q0V A;  3M8F A;  1QU3 A;  2KL4 A;  1XD7 A;  1BA5 A;  2GBY A;  5JI6 A;  2VE8 A;  2OCC H;  2F5E A;  2Z2S B;  3F8F A;  5KK1 A;  3WU2 C;  2HI3 A;  4BDZ A;  1HW5 A;  4BAY A;  2I10 A;  3C2H A;  2TRT A;  4XLC A;  3DF8 A;  3DEE A;  2L02 A;  3OYK A;  1W5C C;  2K27 A;  2Z5U A;  4HG2 A;  1I1S A;  1XGN A;  2PEX A;  3I53 A;  3OIP A;  3A03 A;  1U5T C;  5AON A;  5E20 A;  2XAS A;  3CP8 A;  2F4I A;  3RQ4 A;  3RKY A;  1AKH A;  1C0W A;  1I6H J;  1BIA A;  4OIQ F;  3I64 A;  3S3O A;  3MZH A;  1OYY A;  3RSN A;  3CCL I;  1Y0U A;  4FIS A;  1RC9 A;  2M4K A;  1AA7 A;  5CQG A;  2M30 A;  1Y8Q B;  3OR2 C;  1TT0 A;  1VI0 A;  3DFG A;  3E6B A;  1R22 A;  1JKO C;  1ETO A;  3PNY A;  5LHI A;  2WAQ A;  4MHG A;  1G3W A;  2IA1 A;  1QBJ A;  1KU7 A;  5ICE A;  1ZK8 A;  4HX8 A;  1MDM A;  3F72 A;  1JGG A;  1JUM A;  3JRD A;  2ZKZ A;  1DP7 P;  2GIZ A;  1XSD A;  3GZ5 A;  3HM5 A;  3TOA A;  3PFI A;  3K1M A;  4DNC A;  3LSP A;  3GFI A;  3ABK H;  4B8X A;  5D4R A;  5KNL A;  2DT5 A;  3WGH A;  2DPD A;  3ZN1 A;  4QSH A;  4B48 A;  5JLX A;  2YSR A;  2HPM A;  3S2H J;  3ZQ7 A;  2QUF A;  3ZCO A;  5KAF C;  4IQ4 A;  2YU3 A;  1S7E A;  1BM9 A;  4B09 A;  2DOA A;  3PIP F;  3EYY A;  4HSR A;  2Y9Y A;  3MFK A;  3ERE D;  3CC7 I;  4L5E A;  5EEA A;  2CW7 A;  2RQP A;  2Q2E B;  4K2E A;  3W2V A;  2LY1 A;  4B3A A;  4KT6 A;  4UB6 C;  3U2R A;  3GEZ A;  4Y33 A;  5E8I A;  4CCL A;  4MQ9 F;  3MCZ A;  1YJW I;  1VQP I;  4XSX F;  5E8G A;  3ESW B;  4AID A;  1TT5 B;  3FXO A;  4J00 A;  5EJC A;  4B43 A;  2O61 A;  4V2G A;  2QKL B;  2VQL A;  4J01 A;  5K7F A;  5LGT A;  2KJC A;  2LYC A;  2IGK A;  4IVN A;  2VJ5 A;  3W6V A;  1WH5 A;  3VYR B;  2B0L A;  4EJU A;  3CDL A;  2F5F A;  4MTD A;  3HTU A;  4MQV A;  2XIG A;  2HKO A;  2EFN A;  1FC3 A;  1SFX A;  5HDK A;  1I1G A;  3TDU C;  4CO8 A;  4FX4 A;  1JJ6 C;  3VOE A;  1MBE A;  1V4R A;  4XM3 A;  1IZ1 A;  1I3Q J;  2ADU A;  3V8K A;  3SHF A;  5AIP A;  1YE9 A;  3RYP A;  3W6J B;  3ZMV A;  2QKM B;  3DTK A;  1B4A A;  5F64 A;  2L0K A;  2JJ7 A;  3FM3 A;  5D6F A;  2LP0 A;  3FKJ A;  5E1W A;  3D5R C;  2ZME A;  2ECB A;  3FXK A;  3HG9 A;  2B9S A;  5ICF A;  2FEZ A;  4IHS A;  1S3J A;  2DYR H;  2LRE A;  2O7O A;  4G7Z F;  5K5Q A;  2KJB A;  1OCC H;  2OZ6 A;  3U1K A;  4AIK A;  3HOU J;  1JHH A;  2IBD A;  3E7L A;  4ENK A;  4RGS A;  3OV8 A;  2Z33 A;  2DA5 A;  2OV7 A;  4OAY A;  1H89 C;  2KIF A;  1A04 A;  2E36 A;  2BXZ A;  2Z3Y A;  1BR2 A;  4BQA A;  1YX3 A;  1K4T A;  3F8B A;  3MAJ A;  1WI9 A;  3QOD A;  3W2A A;  1E3P A;  2IJL A;  2CQN A;  2OCE A;  3BR6 A;  2R5Y A;  3QYB A;  4MTE A;  2D2W A;  1QGP A;  2F6C A;  3UKG A;  4LIT A;  2R7W A;  2HGC A;  4XKV A;  2XF6 A;  1ETW A;  4Y17 A;  1A31 A;  4YII A;  5F1J A;  3MKL A;  4EEF G;  1GV5 A;  1LPQ A;  4C3H J; 
#chains in the Genus database with same CATH homology
 2R7D A;  5LGN A;  1P6R A;  3IRQ A;  2E7W A;  4WWC A;  2FRH A;  3HIF A;  3JTH A;  4M6X A;  2A5Y B;  2V1U A;  2QYO A;  1J75 A;  3WG9 A;  5A2Q Z;  1K7A A;  4I0A A;  4Q48 A;  2GA2 A;  1FLI A;  3TO6 A;  3JSP A;  3IL2 A;  3MWM A;  2JZY A;  4EM1 A;  4Y13 A;  2OU2 A;  2OBP A;  2STW A;  3EQL F;  2Y75 A;  2LF8 A;  3KZY A;  3CDH A;  4S04 A;  2HEO A;  2PG4 A;  4XRF A;  1HKT A;  4CZZ A;  3CUQ B;  3E5U A;  1FYL A;  2W24 A;  1R58 A;  1J0R A;  2HQN A;  3ISP A;  4IF4 A;  5FFX A;  3VB2 A;  4YIF A;  3F6V A;  4Q47 A;  1ZGJ A;  3QOP A;  3HTS B;  2DFI A;  4G8X A;  4CIC A;  1LDJ A;  2FOK A;  5JVT A;  3FXU A;  1I6X A;  1T2K A;  2Q2E A;  2CWE A;  3ZMS A;  4BXU A;  3V8L A;  4UVA A;  2GA1 A;  1KU3 A;  5LRR A;  1YS6 A;  5DYM A;  1BN5 A;  1R00 A;  2RVC A;  5DD4 A;  2QQ9 A;  2Y0M A;  3IC7 A;  3J81 Z;  3BJ6 A;  2H94 A;  2EJR A;  2D1V A;  1OYI A;  4FT8 A;  1DPR A;  3QP6 A;  1QNT A;  4RB3 C;  4HDU A;  1PDN C;  2A68 F;  2MLK A;  3R4K A;  3EUH A;  3HRS A;  4JK1 X;  3HRU A;  5BS6 A;  5CVI A;  1FBQ A;  4AWX B;  3JTG A;  3E5Q A;  5D8L B;  1Q1H A;  3ZPL A;  5EEH A;  2ZNZ A;  1ZRF A;  5HLG A;  2W25 A;  4LK0 F;  4M74 A;  1BI3 A;  2HOE A;  4IRI A;  2LDU A;  1K78 B;  4RB1 A;  1WWX A;  1F4K A;  2V9V A;  1NHA A;  3FXR A;  2FML A;  1IRG A;  5AIQ A;  4A6E A;  4KMF A;  2ISZ A;  4BH9 A;  4RB0 A;  1DDN A;  2O8X A;  4YFN F;  3H3U A;  2F5C A;  4IPA A;  1B9M A;  2DQR A;  2Z9O A;  1S7A A;  1BOA A;  3KP7 A;  1Z05 A;  1U5T B;  1CGP A;  3V7S A;  1J5Y A;  4QLC U;  2ZCW A;  2M5W A;  4IRH A;  2K86 A;  4WXD A;  4IRG A;  1U3E M;  2EFO A;  3F21 A;  1FYK A;  3RTR A;  4L9J A;  3DEU A;  1R23 A;  1ZLK A;  5HVQ C;  2EK5 A;  3WTX C;  2JT1 A;  4HLX A;  2WV0 A;  5HS9 A;  1FOK A;  3FF5 A;  1UFM A;  1ON1 A;  5LGU A;  2V6C A;  3FXQ A;  4HDV A;  5D5V B;  4HV6 A;  4L0Y B;  3GFL A;  2LNB A;  3BRO A;  1RNL A;  4HF2 A;  1MKM A;  4L9N A;  1R36 A;  2DQL A;  2P6S A;  3IWF A;  2ETH A;  4S05 A;  1D5V A;  1T6S A;  1PP8 F;  3CO6 C;  4YFK F;  4QWQ A;  2XV4 S;  4N9I A;  1KGS A;  3E3V A;  3ZMU A;  3TQN A;  1R1V A;  5L3E A;  2Q0O A;  1FZP B;  4ZYH A;  5HS7 A;  3K9T A;  3HSE A;  1F1Z A;  2FBH A;  4RB2 C;  2ESN A;  2LKP A;  4EM2 A;  1FX7 A;  3LQR A;  4LD5 A;  4PDK A;  2JRT A;  5ERI A;  4PGG A;  2Z99 A;  3U1D A;  1EV7 A;  1HW1 A;  4E70 A;  1K78 A;  1U8R A;  3BDD A;  2BGC A;  3HOS A;  3EET A;  3J7A O;  2D45 A;  2HTJ A;  2XKP A;  3RPU A;  2K02 A;  3K69 A;  1XGS A;  2FBI A;  4P9F A;  4EGY A;  2ZXJ A;  1IAW A;  1KU2 A;  2ZME B;  1LDD A;  5D6E A;  1XMA A;  3J80 K;  2YX4 A;  5CVR A;  3KP2 A;  1FSH A;  2HWV A;  1B6A A;  4WXH A;  1SFU A;  1OYW A;  2R7F A;  4M9Z A;  5F1R A;  4M6Y A;  2RGV A;  2EV5 A;  2FQ3 A;  1G3Y A;  1AOY A;  1U5T A;  2MH9 A;  2WWY A;  4KA4 A;  4I2O A;  4M72 A;  4LB5 A;  1MZB A;  3KP3 A;  2IA2 A;  2O3F A;  2CGP A;  3E6M A;  4L9V A;  4EGZ A;  1STZ A;  2VON A;  5FD6 A;  2V1D A;  1FBS A;  1JHF A;  1H0M A;  4EJO A;  1YIO A;  4HYE A;  3RJP A;  3R0A A;  4L9T A;  5HOO A;  3PQK A;  3FMR A;  2VT2 A;  2VOO A;  1XCV A;  3JAM Z;  2LSO A;  4I09 A;  2HYG D;  1B59 A;  2K7L A;  1WKM A;  1R1U A;  3K2Z A;  2F2E A;  3V4G A;  2NYX A;  4D0P A;  1AWC A;  4IHT A;  3S2W A;  5IT9 Z;  1YG2 A;  4IXA A;  3M8E A;  1O7L A;  5CVV A;  3KCC A;  3M1E A;  1FPQ A;  2IVM A;  1O57 A;  3SZP A;  3KLN A;  3ML6 A;  1KYW A;  1HBX G;  4L0Z B;  5BPD A;  5FB2 A;  1O3S A;  4EV0 A;  4KIB A;  1KQ8 A;  3KE2 A;  3R61 A;  2FMY A;  2KIM A;  2WC2 A;  1L0O C;  4P55 A;  2PMH A;  4ESJ A;  3VEP A;  4LGW A;  1OKR A;  4YFX F;  2JSC A;  4UXN A;  4RAZ A;  2QLZ A;  3JSO A;  3N97 A;  2DPU A;  1XGM A;  2A6H F;  1TBX A;  4OMY A;  1ZG3 A;  2QWW A;  2EA2 A;  3DPT A;  2CW0 F;  3HUG A;  4GYG A;  3GZ6 A;  1XMK A;  3F22 A;  4M9X A;  1IF1 A;  3IHU A;  3TGN A;  2XKO A;  1UHW A;  1HQC A;  5H6R A;  5ILS A;  4HX4 A;  1KA8 A;  2P6T A;  2H6C A;  3HHG A;  2CG4 A;  4N0B A;  3IWZ A;  1W7P A;  2VN2 A;  2XRN A;  3WE2 A;  2LF7 A;  1YYV A;  2W85 A;  2V79 A;  1LB2 A;  1G4D A;  3GYH X;  4ENM A;  4KFC A;  4EJV A;  2EWN A;  3R6S A;  2HYF A;  5D4S A;  2ZNY A;  4L5J A;  1RI7 A;  4U0V A;  2XAJ A;  1D8K A;  4A5N A;  4OMZ A;  2HDC A;  1BIB A;  4O3M A;  3LA2 A;  2ZJ2 A;  2GAU A;  3LWF A;  3EDP A;  4G9Y A;  4HF0 A;  3MZY A;  2EFQ A;  2DLL A;  1KYZ A;  2ZO4 A;  2MBF A;  1O3T A;  1IW7 F;  4WK8 F;  1XN7 A;  3BPV A;  2L4A A;  4UVC A;  1FT9 A;  1T98 A;  3NEU A;  1HSJ A;  1LNW A;  1QO0 D;  4U0W A;  3FX3 A;  3GUD A;  5LEK A;  4HBL A;  2CQK A;  1YQA A;  2AS5 F;  3KET A;  2ESH A;  3LA3 A;  3ELK A;  3F6O A;  3OOP A;  1R5G A;  1ZN2 A;  3TKY A;  4LFU A;  1ZAR A;  2ELH A;  2O6G E;  2PMU A;  3MQ0 A;  1SD5 A;  4LB6 B;  2PN6 A;  2E1N A;  2XGX A;  2IPQ X;  3VOD A;  4A2U A;  2OQG A;  2R3S A;  3AAF A;  1Z91 A;  2COM A;  4UNO A;  2RV8 A;  1ZLJ A;  2FU4 A;  4LMY A;  2K4J A;  3NRV A;  2G7H A;  3F8C A;  4PCQ A;  5CVJ A;  1J9I A;  1J59 A;  2V1X A;  1ZG5 A;  4RS8 A;  1XSX A;  1P4A A;  2OQR A;  3CTA A;  5D5X B;  4MEY F;  1JE8 A;  1SD7 A;  4LJZ F;  2VBW A;  4ENJ A;  1FP1 D;  3WTV C;  2OD5 A;  5JR3 A;  3K0L A;  4KIC A;  1MJ9 A;  2UXN A;  5H6Q A;  1T39 A;  3TDZ C;  5FD5 A;  5A2Q K;  3O3K A;  1TLH B;  4U88 A;  4G7H F;  2GXG A;  4UHT A;  3RIR A;  3KFW X;  1MD0 A;  4GYI A;  4ZZD A;  2M8E A;  2H27 A;  4PZJ A;  5HDG A;  2C6Y A;  1G3T A;  3I59 B;  1IXC A;  4GXO A;  1Z6T A;  3FM5 A;  1ULY A;  1OMI A;  2X4H A;  3LQQ A;  3SFZ A;  4UV8 A;  3RDI A;  1SD6 A;  2O03 A;  2XVC A;  4KT5 C;  1YLF A;  1P4X A;  5FFZ A;  4ZYG A;  3D5L A;  5LBQ A;  2RDP A;  1UB9 A;  2MD5 A;  3R0J A;  3FZV A;  4RGR A;  2GQQ A;  5J8F A;  1FSE A;  1IN4 A;  1E2X A;  3WGI A;  1YW7 A;  4A6D A;  2NRA C;  3QU6 A;  4U7B A;  3RKW A;  5LEJ A;  2EFW A;  2J5P A;  4A0X A;  3IRR A;  4KUM A;  4ON0 A;  1S6L A;  1QZY A;  4HF1 A;  3DPL C;  2VBX A;  3WOD F;  3J81 K;  3ECO A;  4LG0 B;  1P92 A;  1LJ9 A;  2RN7 A;  4CGZ A;  3I4P A;  5HS8 A;  1ON2 A;  4OOI A;  2Q8K A;  4ESF A;  4Y15 A;  5K5O A;  1YO5 C;  1H9T A;  4JBA A;  5DCM B;  2UZK A;  2Y48 A;  4WXC A;  4NQW A;  1EH7 A;  4P9U A;  3I5U A;  5EEG A;  3U9G A;  5LRS A;  3V7C A;  1S8N A;  2XAH A;  3L9F A;  4H0E A;  3P9I A;  2MLG A;  3CUQ C;  3IKT A;  1RUO A;  1R7J A;  3LAP A;  3BY6 A;  1REP C;  2UXX A;  4M9S A;  3GF2 A;  2VE9 A;  3WTY C;  3BJO A;  1XDS A;  2KRF A;  4RAY A;  2PI0 A;  1IN7 A;  2EB7 A;  1ZG1 A;  1W4M A;  4HQM A;  2FNA A;  4CYD A;  4OU0 A;  4A0Z A;  1TTY A;  2YPR A;  1Z1D A;  2NNY A;  2YX7 A;  2VOD A;  3PQJ A;  3KEQ A;  3WGG A;  1MJA A;  4G6D A;  1HW2 A;  4KNY A;  5DDG A;  1BI0 A;  1UHM A;  4KMU X;  5FLX Z;  4WF2 A;  3N4M A;  1KQ0 A;  3ROU A;  5CYV A;  2P4W A;  2WTE A;  4I7H A;  2DK5 A;  3I59 A;  3FWE A;  4U7D A;  1S7O A;  4DQ2 A;  1ZRC A;  4OIN F;  3QAH A;  1GXP A;  4EVI A;  3SXY A;  2ISY A;  3FHZ A;  1W7P B;  4IJA A;  3CLO A;  2E1C A;  4AD9 A;  4ZZL A;  2A69 F;  3EYI A;  2FNP A;  4I98 B;  5J6X A;  1OPC A;  5L3B A;  1FWZ A;  1TW3 A;  3KP6 A;  2NNN A;  1LVA A;  3SZT A;  4TV7 A;  5TRD A;  3H92 A;  2H09 A;  4LG0 A;  3I0T A;  1BC8 C;  1F9N A;  4OIR F;  5D8K B;  4NHJ A;  4LK1 F;  1YTY A;  5TJJ A;  1X3U A;  1TW2 A;  3L09 A;  1P4W A;  4GO1 A;  4A5M A;  1VTN C;  5DCM A;  4I02 A;  1J2X A;  4AIJ A;  2J5O A;  2QQA A;  4MEX F;  5CJ9 A;  5BQT A;  2MC3 A;  1HKQ A;  1W7P D;  3F8N A;  5CVU A;  3LAJ A;  3BWG A;  3FMS A;  2GIV A;  4Z2Y A;  2FE3 A;  3ZMD A;  1LEA A;  3E6D A;  3R60 A;  1ZRE A;  2GXB A;  1KQ9 A;  4KYW A;  1FBU A;  2M45 A;  1B9N A;  2HS5 A;  3IKV A;  3DKW A;  3DP7 A;  1JXS A;  4ZYE A;  3E5X A;  3K1N A;  4OIO F;  3RYR A;  1HKS A;  5HLI A;  4P5O A;  3ZP5 A;  5FLX K;  2L3D A;  3WTS C;  4CHU A;  1P2F A;  1IXR C;  3QPH A;  5D5U B;  2EA4 A;  2OZU A;  4HA8 A;  2W84 A;  4HX7 A;  2XRO A;  4ETS A;  2NS0 A;  4LLG F;  3WU0 A;  4Q5S F;  4ESB A;  4F7Z A;  3RKX A;  2BV6 A;  1MGT A;  4BHB A;  2ZFW A;  2A61 A;  2VT3 A;  3GFM A;  1XCB A;  1ZRD A;  3WU1 B;  3ZMT A;  5DEQ A;  5FGM A;  1SMT A;  4XLN F;  5DUK A;  4L18 B;  3SQN A;  3RI4 A;  1TQP A;  1ZYR F;  2IA0 A;  2MA3 A;  3P9K A;  3GXO A;  3KLO A;  4KDP A;  1LDK B;  1R5H A;  2QBY B;  5DUI A;  1UST A;  2AXL A;  2PFB A;  5D5W B;  5E1X A;  2BYV E;  1MJB A;  1ZGA A;  1RIO H;  2DAO A;  4FHT A;  5L3D A;  2IP2 A;  3WTW C;  2TDX A;  3JAM K;  1DUX C;  2JTV A;  2PLY A;  1IRF A;  1Z6R A;  2DI3 A;  4BHP A;  3BJA A;  2HQR A;  4OIP F;  4UUV A;  2E7X A;  2M87 A;  2GZW A;  3ECH A;  5IT9 K;  3GW2 A;  2PJP A;  4LLN A;  1FNN A;  4MNU A;  1D3Y A;  2P5L C;  2VBZ A;  3GWZ A;  1T0F A;  3HSF A;  3BPX A;  4RGX A;  2FBK A;  3WTT C;  2L4M A;  4BYY A;  4U0Y A;  1YW8 A;  1XDU A;  2P7V B;  1FP2 A;  1I27 A;  5BOX A;  3HYI A;  1FY7 A;  2P7C B;  1LEB A;  3FMQ A;  4HW0 A;  1BI1 A;  1B1B A;  2XAQ A;  1TNT A;  4KIG A;  3BZ6 A;  5FO5 A;  3V7R A;  1ZHF A;  1LQ1 A;  1HST A;  1V3F A;  4M73 A;  2HKX A;  4AVP A;  1KU9 A;  2RNJ A;  3T0Y A;  1SFE A;  4ZH4 F;  3ZN0 A;  2RC4 A;  1YW9 A;  1UCR A;  3M9A A;  2A07 F;  2STT A;  1QQI A;  1F5T A;  2VBY A;  4HQE A;  2BEO A;  5L3F A;  3Q9S A;  1L3L A;  1QPM A;  4KIF A;  3WTU C;  2P5K A;  2XAG A;  3HRM A;  4R79 A;  4XBF A;  3K1P A;  3KP5 A;  3BP8 A;  2FSW A;  4EM0 B;  2QM3 A;  1W5S A;  4GCV A;  2NAZ A;  1U2W A;  4KN7 X;  4KN4 X;  2O0Y A;  5J8C A;  2QQB A;  2L01 A;  3LA7 A;  4P96 A;  3CO7 C;  1BC7 C;  4XLP F;  2K4B A;  2EV0 A;  1WQ2 A;  5ICC A;  4CDG A;  3B73 A;  1USS A;  3C18 A;  4GGG A;  1T38 A;  3HSR A;  2ZBK A;  4WX9 A;  2MH2 A;  5K5R A;  1GXQ A;  2RKH A;  6PAX A;  3CUO A;  2GWR A;  2BBY A;  3H3Z A;  4LLL A;  4A12 A;  2QBY A;  2HZT A;  1IUY A;  4PGH A;  3QP5 A;  1SAX A;  4I0B A;  1GHC A;  1D8J A;  4O5V A;  2CO5 A;  1DPU A;  3W6K B;  1O3R A;  3I54 A;  3GVA A;  5ILU A;  5ILV A;  2G7U A;  5L3C A;  5BPI A;  4EQQ A;  1HXD A;  4UV9 A;  3DV8 A;  2HFH A;  1J7K A;  1OR7 A;  5LHH A;  1K79 A;  5HLH A;  3V8J A;  1CF7 B;  4UVB A;  4NB5 A;  2DTR A;  3KEO A;  2YR2 A;  3HHH A;  3GO5 A;  3E97 A;  4N9H A;  3ZMZ A;  4ZYD A;  4JQF A;  1JGS A;  1G6N A;  4R8H A;  2KIU A;  2CFX A;  5ED4 A;  3Q5F A;  4BNC A;  2HTS A;  1RUN A;  1E17 A;  1XB4 A;  5E1Z B;  1TNS A;  1PUE E;  1W5T A;  3JW4 A;  2L54 A;  3Q9V A;  1I5Z A;  5L3G A;  3C7J A;  4G94 A;  4EJT A;  2XUB A;  1ZH5 A;  4ENN A;  1IXS B;  5KVR A;  5E18 F;  4YG2 F;  1H9G A;  1GVJ A;  2FXA A;  3DXJ F;  5E17 F;  3GFJ A;  3QU3 A;  1O7F A;  1IN8 A;  1PP7 U;  5HDN A;  5DCF A;  2PQ8 A;  3B02 A;  5F6F A;  3CUQ A;  4RGU A;  3TO9 A;  2IRF G;  3O6B B;  4WCG A;  2QVO A;  5DD8 A;  3T8T A;  4BHC A;  3J80 Z;  5LLQ A;  3D0S A;  3WTZ A;  2HR3 A;  2EFP A;  3KZZ A;  3M7G A;  2JPC A;  4G7O F;  3WE3 A;  1WSU A;  1SD4 A;  2DO7 A;  3P9C A;  3RPQ A;  1Z7U A;  2XAF A;  4CXF A;  4FX0 A;  3G3Z A;  5IT3 A;  1RZ4 A;  4HLY A;  2F5D A;  3G73 A;  3F3X A;  2ACJ A;  3L2C A;  1QZZ A;  2QEN A;  1ZAO A;  4MGR A;  1XSV A;  2FA5 A;  1EH6 A;  2VC1 A;  3T1B A;  5CLS A;  5JFR A;  3ABU A;  4R1H A;  2XHK A;  1WRJ A;  2QZ8 A;  4A0Y A;  2VXZ A;  1TQI A;  3C3W A;  5H20 A;  1YS7 A;  3O2P E;  3KP4 A;  2H6B A;  1Z9C A;  4I01 A;  2BE5 F;  3QPT A;  3C1D A;  1EH8 A;  3LST A;  5ICG A;  4Q4Z F;  2DBB A;  5K1Y A;  1ONV A;  2DK8 A;  1MDM B;  1TQM A;  3L7W A;  4XSZ F;  3NQO A;  1IN6 A;  3LFK A;  1BJA A;  2X0L A;  1U6G A;  3COA C;  3DQV C;  2G9W A;  1G3S A;  2VC0 A;  4EMS A;  2OAZ A;  2DW4 A;  3GX4 X;  3CJN A;  2KKO A;  4M71 A;  2OA4 A;  2EV6 A;  3TOB A;  2W57 A;  2IT0 A;  3F23 A;  2FF4 A;  2VOP A;  2M1B A;  2P8T A;  3HOT A;  3ABT A;  2CYY A;  1FYM A;  3ULQ B;  1CF7 A;  4L5I A;  4G6Q A;  2IW5 A;  3REO A;  1BI2 A;  1IN5 A;  4AIH A;  4HOB A;  3VFZ A;  4HZF A;  3BOQ A;  1U78 A;  3TO7 A;  3F8M A;  5LHG A;  2PBI A;  1ODD A;  5BMZ A;  3E6C C;  3I71 A;  1YFH A;  2A6E F;  2A3S A;  3T8R A;  4ASN A;  5JHU A;  3L00 A;  3MEX A;  1SMY F;  2P5V A;  3GLX A;  2CSO A;  1XGO A;  5DV5 A;  1BBY A;  2D1H A;  3QRF F;  1R1T A;  2JPB A;  3HRT A;  1O3Q A;  1S29 A;  3P7N A;  3I58 A;  4HAM A;  3T5X A;  4EJW A;  2DU9 A;  4HV5 A;  4O6J A;  1K6O A;  3M8F A;  1XD7 A;  5JI6 A;  2VE8 A;  2F5E A;  3F8F A;  5KK1 A;  1HW5 A;  4BAY A;  3DF8 A;  2L02 A;  2K27 A;  2Z5U A;  1I1S A;  1XGN A;  2PEX A;  3I53 A;  1U5T C;  5AON A;  5E20 A;  2XAS A;  3RKY A;  1C0W A;  1BIA A;  4OIQ F;  3I64 A;  3MZH A;  1OYY A;  1Y0U A;  2M30 A;  3DFG A;  3E6B A;  1R22 A;  5LHI A;  4MHG A;  1G3W A;  2IA1 A;  1QBJ A;  1KU7 A;  5ICE A;  4HX8 A;  1MDM A;  3F72 A;  2ZKZ A;  1DP7 P;  1XSD A;  3GZ5 A;  3TOA A;  3PFI A;  3K1M A;  4DNC A;  3GFI A;  4B8X A;  5D4R A;  2DT5 A;  3WGH A;  2DPD A;  3ZN1 A;  2YSR A;  3ZQ7 A;  2QUF A;  2YU3 A;  1BM9 A;  4B09 A;  3EYY A;  3MFK A;  3ERE D;  2RQP A;  4K2E A;  2UWM A;  5E8I A;  3U2R A;  3GEZ A;  4MQ9 F;  3MCZ A;  4XSX F;  5E8G A;  2O61 A;  5LGT A;  2KJC A;  4IVN A;  2B0L A;  4EJU A;  2F5F A;  4MTD A;  3HTU A;  4MQV A;  2XIG A;  2HKO A;  2EFN A;  1FC3 A;  1SFX A;  5HDK A;  1I1G A;  3TDU C;  4CO8 A;  4FX4 A;  3VOE A;  1V4R A;  1IZ1 A;  2ADU A;  3V8K A;  3SHF A;  5AIP A;  3RYP A;  3W6J B;  3ZMV A;  1B4A A;  5F64 A;  3FM3 A;  5D6F A;  5E1W A;  2ZME A;  5ICF A;  2FEZ A;  4IHS A;  1S3J A;  4G7Z F;  5K5Q A;  2KJB A;  2OZ6 A;  4AIK A;  1JHH A;  4ENK A;  4RGS A;  3OV8 A;  2Z33 A;  2KIF A;  1A04 A;  2Z3Y A;  4BQA A;  3F8B A;  3MAJ A;  1WI9 A;  2IJL A;  4MTE A;  2D2W A;  1QGP A;  2HGC A;  4Y17 A;  4YII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...