2K5CA

Nmr structure for pf0385
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
MAKCPICGSPLKWEELIEEMLIIENFEEIVKDRERFLAQVEEFVFKCPVCGEEFYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords uncharacterized protein PF0385
publication title NMR structure of PF0385
rcsb
source organism Pyrococcus furiosus
total genus 7
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1220 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2k5cA00
2K5CA
chains in the Genus database with same CATH superfamily
1R5ID 5EF6A 4YG2F 3DWLE 3OY9A 2NVUB 3HRMA 3GVAA 1LNWA 2KT0A 3FWEA 1B59A 2LBFA 4HV6A 3TKYA 2VOOA 1FX7A 3K69A 3M7GA 5F1JA 3L7WA 5B66C 4LIUA 4C3IJ 2VJ5A 5DUKA 2VL8A 3H9JA 4E70A 3CC2I 4IRHA 4XSXF 1OCZH 2LY2A 3G2BA 5EGOB 4BJTA 1W7PB 5C4XJ 5D6FA 3LSRA 2XF6A 2PFBA 3F6OA 1FC3A 4D0PA 3BR3A 4X1EA 4AVPA 4BAYA 3OS2A 2TRTA 2UXNA 3JRDA 1YRNB 1QPMA 1IO2A 3QPHA 3JRCA 2CUFA 1MDMB 4YRVA 5HDGA 3BTCA 4BU2A 1UZCA 2YUSA 1R4MB 3QPTA 5KHDA 3PJRA 1WJFA 2K3FA 3W2VA 2ZBKA 1U5TC 1T6SA 4HA8A 2XF5A 2FQ3A 3GZ6A 4I6ZA 4ITVA 3C18A 4CYCA 2QQ9A 1J0RA 2IRFG 1OR7A 2A3SA 4JX6A 2CFOA 3TP3A 3K7AJ 4MGRA 4QTRA 1OCTC 2DT5A 3TGNA 2R7QA 1KZHA 2LNBA 4IEJA 1FPQA 3GTKJ 1QVTA 2HOSA 3MN2A 2J5PA 4GXOA 3O6BB 2KDOA 1WGXA 2EJRA 4ZYAA 2R3SA 1FLIA 3LAPA 4KIFA 1USSA 3TO9A 2KFDA 2ID3A 2VB6A 3IH2A 3DBLB 3MQ0A 4PJ0C 4ZZLA 2X0LA 2CYYA 4RLQA 3JRBA 3H0DA 2E36A 3HDDA 1E0EA 1PP8F 2RC4A 2E5NA 1NG6A 2EIJH 3CLOA 3JRFA 3HRTA 5BNGA 4BE1A 4KDPA 5BPIA 2HGCA 4XKVA 4J00A 1S7OA 4MTEA 1MBGA 1ORKA 2V1XA 5HODA 5D5XB 5E18F 1DP3A 4UUVA 1T8IA 2A61A 4I0AA 3K1MA 1JHHA 2DU9A 5D5VB 4S05A 3H1CA 4A3GJ 1BOAA 5DM6F 1WPKA 3I4PA 4UUSB 4WK8F 2XUBA 2PMUA 1GDTA 3FXRA 3Q0VA 4NUBA 2IA0A 2JTVA 4B47A 2R7WA 1T39A 1X3UA 2HS5A 3HHHA 4FE4A 2R7VA 4EV0A 2WAQA 5DEQA 4HDVA 1IN8A 3KZIC 2WAQN 4XLNF 2CUJA 1PP7U 2E1MC 3H0GJ 1JKPC 2OA4A 2X9DA 4GFBA 2LYCA 5LFAA 3HC7A 2V7FA 3RIRA 3H35A 4F7ZA 1E3OC 2ELKA 2QEXI 4CCKA 4AIJA 1H0MA 1FWZA 2XC7A 4Y17A 4RM2A 2CQXA 1H88C 3W6KB 1AKHA 2MG4A 3Q9VA 2YSRA 2GLOA 2KRFA 1Y1VJ 1Y56A 3IC7A 3F0CA 2L9NA 4UVAA 4XRFA 3LSGA 3O8HA 4YFKF 2OTLI 5IYBJ 4ZDLA 1IRGA 2Y75A 4Y7NJ 3EUHC 5EG0A 2A6HF 1FOYA 3BWGA 3A4CA 1FBUA 4NC8A 2MLKA 1A31A 2E1CA 2X4HA 3DTEA 4WXDA 2VQGA 3H3VK 1ETWA 4AIDA 2KZGA 2CUZA 2JA6J 1TNTA 5HS7A 3MZHA 2L2OA 3JTGA 2IEKA 4XRSG 4CCJA 2DK5A 4IO9F 5EEHA 2IJLA 5IY5H 1X3WB 1FIAA 1KGSA 3DPUA 1P9QC 1U0JA 3V7CA 1TT5B 2OPTA 4G6QA 3C7JA 3QQAA 1ZREA 4IRGA 4A5NA 1JGGA 4E7JA 4EJWA 3CCLI 2P5KA 1I27A 5EGOA 2D2WA 4P9FA 4ESJA 3JAMZ 3OYCA 1R4NB 2X6OA 3CDIA 4P96A 2NS8A 2VQLA 1N25A 4OIOF 4R8HA 2QQBA 5DCMB 1QGPA 3KETA 3WU1B 4EGZA 1HA8A 3K70C 3WTTC 4ZYHA 3IAM2 3JAMK 2R7OA 3BR0A 3SDGA 3TW7A 3TO7A 4UUTA 1J2XA 1XN7A 1GLNA 3GLXA 2EQRA 3KP7A 1L0OC 2DO7A 3GEZA 1BIBA 2VQHA 4RAGA 5EDNA 1B72B 4BHCA 4XNFA 1Z3YA 2KQRA 1FTZA 4NC7A 3GFLA 3DLAA 2DK8A 3F22A 1IRZA 2VKEA 2P6SA 1ZLJA 2W1OA 5EJCA 1W5TA 2BV6A 1VQ4I 3WTUC 5C4JJ 4C3JJ 4OINF 3UR3C 2O9LA 5JHFA 1Y0UA 1MJ9A 2IW5A 4HEA2 4LJZF 1ZGWA 1VQOI 4Y3OA 4BS9A 4QWQA 2XDVA 2XRNA 3LSJA 2QF7A 2H6CA 3ISPA 1MSFC 3E5QA 3GFJA 4I02A 4B3XA 1H9GA 1R1UA 3J80K 1OMIA 2HWVA 4M3DA 4CZCA 1W7PD 3HOSA 3BG7A 4OMZA 4IL6C 3F23A 3PSFA 3MKLA 3GX4X 2V9VA 3RKQA 4LG0A 1UELB 3E6BA 1MMAA 3CUOA 4HZFA 4XLCA 2ZB9A 2FBKA 2QWWA 3EQLF 1HCRA 4BHBA 2P0WA 1YE9A 3D1NI 2D5VA 2LVSA 4U88A 3ZQLA 3TMOA 3I64A 1GT0C 4O5VA 2M2EA 4MFDA 5E8GA 1QVUA 4PJNA 2OUMA 2BZTA 3MZYA 4CO8A 5LHIA 3IHUA 3QWLA 2DODA 2PI0A 4EJTA 2IS6A 5JVGF 3CUQC 1LE8B 1QA6A 1JKQC 3I54A 4NQWB 3S17J 3F8NA 1S9HA 2GIZA 3D5LA 4DNCA 4RBOA 1P4WA 4TV7A 1R58A 3HXLA 4WWCA 2CG4A 2XPUA 3S16J 2LKPA 2VE9A 2K5CA 2ISZA 3C2GA 1Q1HA 3CF5F 2FOWA 2FD5A 1B9MA 3EETA 2DI3A 4C2UA 1T95A 1QNTA 3A03A 3OSGA 4CZZA 2IGMA 4FISA 5J4VA 3QRFF 4UY8I 3LSKA 1XGOA 2XVCA 3MFKA 5HLGA 1P7IA 3DBHB 3NQOA 1X4OA 3X2QH 1B6AA 1S6LA 1SC7A 2H8WA 2UWMA 4A2UA 4XIDA 2PMZA 4HX4A 1BOBA 4XKBA 2QKLB 2PMZN 3LFUA 5K1YA 5D5UB 3CMAI 1W36C 5FGMA 2WC2A 2WAEA 2K9SA 1H9TA 1XX5A 2JVGA 3K4CA 3UNGC 1MMNA 2JMWA 3HUGA 1CQTA 1SFKA 4N4OB 1NH3A 4MFEA 1X1CA 1ZR4A 1T56A 5ICEA 4JP0A 2XSJC 5E3MA 1S3JA 1UFMA 3GBGA 4M6YA 2EZHA 3L2CA 4BEHB 2GWRA 2Y9YA 4I09A 1FSHA 4Y4RA 2LH9A 1OCPA 3FIWA 3NWSA 2VJIA 3EYIA 5GPAA 1WHUA 2ICWG 5AIPA 2ZNZA 2W82A 3ECOA 4DGWB 2GM4A 1EH7A 5KAIC 3GTPJ 2GAUA 1VQKI 3E7LA 3DU5A 4IHVA 3PNYA 3J81K 2KIFA 3FBIB 3OYKA 3T8RA 1S72I 1E3PA 4HLYA 2ZMEC 3ZOBA 1EJ9A 1R7JA 5DUIA 2LG4A 1V3FA 1U5TB 3I3LA 4EGYA 3R60A 1OLTA 2CH0A 3E1SA 1OJLA 3V8LA 1LVAA 2M45A 3NARA 1ZK8A 4A3EJ 1GXPA 3DKYA 4FHTA 5CQEA 4ESBA 3SEQA 4YFNF 5D8LB 1D1BA 1HQCA 3AG3H 3DU6A 3TW6A 2AO9A 4J19A 1BC7C 2EA2A 4HRIA 3Q5FA 4V19K 2V6CA 2EIMH 1PUFB 3LFKA 2WB1N 4EJUA 2LRDA 2DA3A 2A69F 4RS8A 1MBHA 2LD5A 1OQYA 3FXMA 3EDPA 3NWTA 3VWBA 2RAEA 5C44J 2HYJA 5F64A 2KHMA 2NYXA 1D5YA 3T8TA 3TQNA 4XK4A 2CUEA 1YW8A 2MD0A 3GWZA 3S1QJ 2HEOA 1XSVA 1HSTA 2P5VA 4LMYA 4KIGA 2EIKH 2HZTA 2AQEA 2J5OA 3JSOA 3TOBA 2AHQA 3Q0UA 1I3QJ 1MBKA 3CDLA 3R6SA 3VYRB 4FT8A 4RB2C 2VONA 3GF2A 5LGUA 4CH7A 2CS3A 2O0YA 4XKWA 3TDZC 4FE7A 1HW2A 1K79A 2R4GA 4CHUA 2R7FA 3EUKL 4L0ZB 1MMDA 1SFOJ 4G8XA 3GTJJ 4L9TA 3VDXA 4BE0A 2UZKA 3HRUA 2W85A 2KZVA 2ZJ2A 2VBZA 3KEQA 4XN0A 1MNEA 1HBXG 2H94A 2JUGA 5IP9J 3ZRGA 1ENHA 2JSPA 2WV1A 2F5VA 2XAJA 3HB9A 2Q2EA 1IW7F 4KITB 3J7AO 5F0HA 4DZPA 4Z6YA 2ZC2A 2FRHA 1SFUA 3BROA 2EILH 3F9KA 3WTYC 2Z33A 2RNJA 1NK3P 1AU7A 4HF2A 2F5FA 3TL4X 2CV2A 3DQVC 1XCVA 3LNQA 2JA7J 2KIMA 1SVOA 1FP2A 1UG2A 5DDGA 2MD5A 1TTYA 3QU6A 2HVSA 2ESHA 3JW4A 5ILSA 3M07A 4IKFA 2A6EF 2FJ1A 4F55A 3CESA 3SZPA 4HF1A 2BHZA 2OCCH 2Z1DA 2YPRA 3WU2C 5JLWA 3TDUC 3PIOF 2UV1A 2ZJQF 1TC3C 2NVYJ 1QZZA 1SVLA 2DBBA 2D1VA 1GVDA 1W4MA 1VQ6I 2OV7A 1LVKA 2HVQA 2M4GA 3ELKA 4ABZA 3TBIA 1XB4A 4RM3A 3ZMSA 2O6GE 3G6EI 2DA5A 4MO7A 4WCGA 3TEDA 3W6JB 3WGHA 2ZXHA 3COAC 4LD5A 4E7LA 4OIQF 3ZXSA 2FBHA 5DTDA 2F6CA 1X19A 2DMQA 1O3QA 5M5WJ 1JUPA 3K4BA 1R5GA 1WJAA 2DN0A 2MC4A 2FX0A 1K6YA 5BMZA 5J8FA 5HLHA 3OYGA 2P4WA 5LGNA 2X48A 4A5MA 3B73A 5KNLA 4C3HJ 4A3LJ 2Q1ZB 5FKMA 2VPRA 2OAZA 4RGRA 5FKNA 4PGGA 1YX5A 1ETXA 2RKHA 5HLTA 3PIPF 1BI1A 2XIGA 4G9YA 4HNUA 3IUOA 2M0MA 2F4IA 2MH2A 5KCMA 5M5XJ 3OWTA 2XF7A 3RYPA 3MD2A 2R5ZA 1JUSA 1Z05A 4U0VA 2EK5A 4H0EA 1QO0D 2M7AA 4FQGA 1Z7LA 2KJBA 1ZG1A 1IN5A 3F8CA 1K83J 4U0WA 2CQQA 3RDIA 1UHSA 1BJZA 2OCEA 3B6AA 2KKOA 1HDDC 4IHTA 6PAXA 3BTJA 1P7JA 1I1SA 3CJTB 3U1DA 2DMPA 3IV5A 1JUMA 1QU3A 5FO5A 2DJIA 3SJMA 5EEAA 2IGNA 3RPUD 4MTDA 5GAGJ 4UB6C 4I2OA 2CSOA 2V9PA 4K2EA 3LL7A 4NDLA 2H1LA 4RAYA 3PO2J 2LY9A 3U1KA 3OYMA 4LIVA 5FLXZ 1VQMI 1T38A 3F8FA 1HF0A 2DPUA 1JT6A 3KYCB 1QHHD 5GP9A 4M3EA 2HDDA 1I6XA 2EA4A 4BGDA 5BPDA 1IV8A 2JPCA 3HSEA 2COMA 1XMAA 2K86A 5FLXK 4GO1A 3KIOA 5DYMA 5LRRA 2RNGA 2FMYA 2DYRH 2BW3B 4EVIA 5H20A 3R0JA 1FBSA 2BY2A 2DA6A 2WAFA 4WXHA 2NOGA 3ZGKA 5D4RA 1EH6A 3OYFA 3OYJA 1R22A 2JT1A 1XDUA 1FOWA 1WRJA 1XMXA 2EZKA 3I53A 3NEUA 3V7SA 3JREA 4QIWN 1WKMA 1JJ6C 2EBIA 5HS8A 4UVBA 2FMLA 4JOMA 1IG7A 1SD6A 2ESNA 2WV0A 2X6YA 1A35A 1JHFA 1FZPB 2QQAA 3K4LA 2X1DA 1VQ5I 1HC8A 1I39A 2CV0A 2YS9A 3CUQB 2PJRA 2DT6A 1HW5A 2MA3A 4DQ2A 1G3SA 4XRMA 4J01A 4WF2A 4QPOA 2L9RA 3VYUB 4XKCA 2ISYA 1MZBA 3FK7A 2ZJRF 4LLNA 1MMGA 2V79A 3VSLA 2IBDA 4IHWA 1V4RA 3SYTA 5LBQA 3KE2A 3CCRI 5DS9A 1XTAA 4RA2A 3ZQIA 1IXRC 1I5ZA 1AA7A 2VBWA 4MQVA 2QENA 2QKMB 4Q47A 2D1HA 1SD5A 3CCVI 1O3TA 3A1YA 3L2WA 4NC6A 5F6FA 3S1RJ 1MNMC 1VQNI 2CJJA 3GZ5A 1MJBA 1AHDP 1J7KA 3DEUA 3S3MA 3HOWJ 2A6TA 4Y33A 3DP7A 1UJ8A 1Z3XA 3BJAA 3N05A 3Q0WA 4IHYA 2B7EA 2IA2A 1FIPA 3A01B 2PN6A 1LQ1A 4L0YB 1YW9A 3O2PE 2PLYA 3S2DJ 2BY0A 2JJ7A 2LMDA 4XONA 1WVRA 2JVHA 4IQJA 3KP3A 4EJVA 2JZYA 2VI6A 2VJ4A 3CJNA 4A6DA 1W5CC 3D5RC 1HXDA 4A3CJ 5GTIC 3GUDA 2HPIA 4BUPA 2JA5J 1R00A 3F72A 1APLC 5H6RA 1MKMA 3AFHA 1G3YA 4DZJA 3S14J 3OL3A 3RKYA 1F1ZA 2ZMEB 3M8FA 4XBFA 3WTVC 1JTXA 3JR9A 1TW2A 3CJQB 4N9HA 5J1YA 3K4NA 2G7HA 5BQTA 3FXKA 3IKTA 5J40A 2FSWA 4NBQA 2MH9A 3HBLA 3F3XA 4F3QA 1X1PA 3BP8A 5CQGA 2DPDA 5K5OA 3K1NA 1B9NA 3EUAA 5AONA 1XC5A 2LP0A 2FE3A 2LTPA 1U9NA 3SHFA 1B1BA 2KPMA 2NVTJ 2F4OB 1QPIA 2HOTA 4EM0B 4M3BA 1GUUA 2L7MP 1V54H 4GYIA 2AQFA 3M8EA 4IJAA 1Z6TA 1VQ9I 1O7LA 3BTIA 5F08A 2HR3A 3H3UA 4PK4A 1IC8A 2K9NA 3H92A 3KLNA 2EINH 1X2NA 1Y1WJ 1X1AA 3DLLF 5KVRA 3AG1H 3W6VA 1NG7A 1XG1A 1OR7C 2XB0X 3RQ4A 3S2WA 3WG7H 4BACA 3F21A 3ML6A 3ZQ7A 4OOIA 1D8KA 2IA1A 1MMSA 4BL0B 1OCCH 3ZP5A 1LKXA 2QBYB 1P6RA 1ONVA 1KA8A 2KRHA 2Z3YA 3CDHA 3FHZA 2CGPA 1RESA 2XAHA 4PCQA 2RGVA 3BLYA 5LHGA 3K70D 3CCSI 4ENNA 5IT9Z 5E1XA 4L5IA 3BJ6A 2QZ8A 4PJJA 3H9GA 2V1DA 2LREA 3DBRB 5AIQA 3L9FA 2DOEA 3VSKA 4ZDOA 4JX5A 3U2RA 4UB8C 3L2QA 4P55A 4IHSA 4GRIA 2IS2A 3VFZA 1TBXA 1W7PA 3LWFA 1F9NA 3WHCA 1QQIA 5ICCA 1V5GA 1KU3A 3CP8A 5FRNA 2LR8A 4A3KJ 1MGTA 4LG3A 1BL0A 3SXYA 1IZ1A 3OOPA 3LA3A 4RMNA 2QYOA 1K78B 2GXBA 4A69C 1YRNA 3NRVA 3LQRA 3ONQA 3ASOH 2Y69H 3HKZA 2W4SA 1MDMA 2MBFA 4HLXA 3DF8A 1YLFA 3HKZN 1FOXA 4LITA 2K02A 5DD8A 4A3DJ 1SVMA 5D4SA 3VB2A 2VT3A 2XGXA 3BQYA 4XORA 5JI6A 2R5YB 5J1UA 4WX9A 2L5QA 3D5SC 3OMYA 4A0YA 2ZFUA 2Q0OA 2V6EA 4F91B 1ON2A 3M1EA 5KAFC 1L3LA 2GQQA 5CJ9A 3CD6I 2V9KA 1TP4A 1HKTA 2O5RA 3MKYB 1FY7A 5E79C 1HKSA 1ULYA 2CWEA 2M34A 3ESWB 4KJZA 1RR7A 2XPVA 3GLLA 3HGGA 4B09A 4FASD 3OOUA 2WY7Q 1TQIA 1R5HA 4OU0A 4ETSA 2E60A 2M3AA 5FKKA 3T1BA 3ZQGA 3H9QA 2DT7B 3HG9A 4Z2YA 2VOPA 2GOMA 1ZGAA 3RSNA 3L09A 2QGUA 4JYKA 2D45A 1R1TA 5L3CA 1ZRCA 3RKXA 2F4MB 1YJWI 3E5XA 1WI3A 4BJ5C 2EFOA 3CLQA 3DXJF 3G1MA 1HW1A 2MLGA 1Y6IA 1XGMA 2K9QA 1TWFJ 3IWFA 3CMMA 3K9TA 3AKZA 4XM3A 4DBRA 3RZOJ 4E4HA 1VQ8I 1WI9A 3K6GA 4PSXA 4DJAA 2BE5F 3R61A 1B4AA 4U87A 4ZH4F 3IP4B 3CCEI 3OYBA 1YIJI 4E6KG 4R79A 4R1HA 1YG2A 4B3AA 4UUSA 3I56I 2GXAA 1MW7A 2IT0A 4OIRF 1K6OA 2X1EA 2VBXA 3HSRA 1KQ8A 3WE3A 3WTSC 2WTEA 4L18B 3KPHA 2DMTA 4UHTA 3HTSB 3JRGA 4BY7J 1UHMA 4BXXJ 4LOCA 1S29A 1Z7UA 1GHCA 2GA1A 2DJNA 1KQ9A 1W36D 1CF7B 3I4MJ 2BVLA 3DTIA 3SFZA 4XLHA 1D8JA 4BY1J 3REOA 4II2A 4M73A 2DTZA 1G8XA 2RREA 4N0BA 4XN3A 4ZYDA 4DYCA 3HOUJ 4B8XA 1RZ4A 4AUXA 5FRMA 3S1MJ 4JK1X 1U3EM 3TP0A 3IWZA 4MLOA 1ZKGA 3EPZA 3QAHA 1Z67A 1RUOA 1FOKA 1IUYA 2DTRA 1ETYA 3OSFA 4P1WA 3CC7I 3GFMA 2ZXIA 2BVMA 2KL4A 3E97A 3NAUA 1IAWA 4XR6A 3GTQJ 2ELJA 4EEFG 1ITYA 4I0BA 2OZ6A 3ROUA 2L9SA 3PNVA 4A3MJ 1S5LC 1TL8A 2XPWA 5J8CA 2L54A 4RB0A 3T5XA 2QVOA 4HNTA 4XMYA 1ZR2A 3EYYA 2X6XA 2ZFWA 5DD4A 1DU0A 1TNSA 3BR5A 4DYQA 4O6JA 3BG5A 3I55I 1B8IB 1GV5A 2LDUA 2M5WA 1G3TA 5EEGA 5FKOA 4C2MJ 1X3ZB 2EB7A 2DOFA 3ZQFA 1MH3A 3O8GA 1WH5A 2L4MA 1XSXA 3HOYJ 2ZO4A 4RLFA 1RKWA 2XV4S 1XPXA 4KMUX 2RDPA 4GYGA 3GW2A 1WWXA 5K5QA 3S3OA 2P8TA 2X6WA 4ENKA 4W1UA 1EF4A 2BXYA 3HOZJ 1Y8QB 2L7KA 3ABTA 2K27A 5DCMA 1T0FA 3FF5A 3LA7A 2E2HJ 2HTSA 2CU7A 2VXDA 3PUFA 5EYRA 4E7ZA 5HDNA 2E34A 5IOZA 2HPMA 2QQ8A 1NTCA 1BIAA 4BQOA 1B72A 2M8EA 4M74A 1Y8RB 3AG4H 5A2QZ 2LKXA 1P4AA 3GMEA 1K4TA 3I59B 1FTTA 1GXQA 5JFRA 5H2FC 5E3OA 5B5EC 1UAAA 3E6DA 2IGKA 2OQRA 1PYVA 4CYDA 4G7OF 5IP7J 3LSTA 5M3FJ 5CLSA 2CW8A 3VPRA 4BNCA 4L5EA 4KYWA 2XASA 4ZJZA 3CCUI 3Q3SA 3GTMJ 5BS6A 2VKDA 3LSPA 4OAZA 2DMUA 1FBQA 4BBRJ 1XSDA 4A0ZA 2M4KA 2OJED 2RQPA 3OYIA 4JBAA 1KONA 1R1VA 2K4JA 5ICFA 3DTKA 1IGNA 2ZNYA 4RAFA 3FXOA 3W2AA 3V8JA 4HV5A 1RPWA 1W0UA 1HDPA 3BCAA 3CP2A 5ILVA 2HVRA 3M8JA 4HSRA 3LA2A 2IAIA 3J7AY 5ILUA 5FB2A 2ECCA 2HKXA 2FNPA 4LLGF 2DCEA 3PNTA 3H5AA 4ZC3A 1OPCA 1YJNI 4A3IJ 3I0TA 1IXSB 5JLXA 2DA7A 5F0FA 2PMHA 5TGTA 3ABLH 2XAQA 4P5OA 2G7UA 3BPVA 2VUMJ 5LHHA 1Z21A 2LBFB 1Y39A 2P7CB 3IH3A 2DQLA 3WTZA 3OS0A 2ME6A 3OYLA 1OYIA 2ZXJA 4BQQA 4CDGA 5FJ8J 4I76A 2B9SA 3OIOA 2IP2A 2HZDA 1XDSA 4OIPF 2QM3A 3FXLA 4B43A 3IRRA 3L2RA 4AM3A 5LD2C 1T98A 2L0KA 2HNHA 2K40A 1C0WA 2ZJPF 4U7DA 3WE2A 3JRAA 1LE8A 4NNJA 2E1MB 2HKOA 4NQWA 4ZDPA 2QCOA 1OISA 2I8DA 2WWYA 4XOTA 4HQMA 2A05A 2EFPA 1JXSA 3WU0A 4G7ZF 1SMYF 2MGQA 3QOPA 1MSEC 1A5JA 2GOXB 3MWMA 3FDYA 3HL2A 1R9TJ 3M4OJ 1CF7A 3V8KA 2JK3A 2RQQA 4Y15A 3ABUA 1A36A 3S2HJ 1T0FC 4QLCU 1TQPA 4L9JA 2A68F 1REPC 4V2FA 3ABMH 2QSFX 3HEFA 4PFPA 1P92A 4CYCB 3OYNA 1HLVA 1Y0NA 2BY3A 4D7MA 2Y2ZA 4KNYA 1KQ0A 3RTRA 3DCFA 2L02A 4LK1F 2EFQA 2MW8A 2PX9A 5CVUA 1PVEA 1XGSA 1IXCA 2HQNA 4GDFA 2O03A 4U0YA 1BI2A 1IUFA 1Z77A 2ZSHB 5LLQA 3PSIA 1GV2A 4GGGA 9ANTA 5E3NA 2PG4A 2FOKA 3WTXC 2JQ7A 3K4KA 3E3VA 3I58A 1Z0XA 4IZZA 1BBYA 4M6XA 1MBEA 1ZHFA 2VQCA 3KP2A 2E7WA 1DUXC 1SEUA 4HDUA 3V7RA 3P7NA 3OV8A 2QSGX 2IS4A 4BEHA 3PQKA 1DGWY 5J1RA 1DGRM 3MKWB 2EFWA 3ZN0A 3C2BA 4KN4X 1SAXA 4E7KA 3BG9A 4OAYA 4UVCA 1QBJA 3FMQA 2DA1A 2GA2A 4I7HA 4B48A 1WJDA 2E19A 1WSUA 1O3RA 1V55H 2H8RA 4CCNA 1V5EA 1J59A 4IOCF 2DOAA 4F92B 1J75A 2Y0SA 3DPTA 3H3ZA 3J7YJ 2LKSA 2XAUA 1U5TA 4RDUA 3GCMA 5GPCA 4JQFA 1CGPA 3H5NA 1X1DA 3KYDB 1RIOH 1YIOA 5IPAA 3CMEI 1VTNC 2PBIA 3F6VA 5J3LA 3K4MA 1YOVB 2QLZA 1UB9A 3G3ZA 4M9XA 5EZHA 2EH3A 5M3MJ 1S7AA 4KIBA 2HQAA 4HAMA 2EZIA 3GTOJ 4D5CA 1PUFA 2ECBA 4M6VA 1BC8C 1LUJB 5D6EA 5HLIA 2W84A 5JR3A 1K4SA 1ZARA 1P2FA 3WODF 2ELHA 2A5YB 3H36A 2X51A 4AC0A 4M3FA 4UV9A 3S15J 1ETKA 3RKWA 5JHUA 1EKEA 4D5FA 3HOXJ 4XLEA 3MCZA 4XLAA 1AKHB 4IX7A 2C6YA 2Z16A 1WJ5A 3HM5A 2UUZA 1BW5A 3GO5A 4HW0A 5TRDA 1STZA 4N9IA 1EA3A 3BZCA 4XOPA 1T2KA 3SEZA 5L3BA 3FMSA 4HYEA 5EG0B 3OL4A 3KX2A 1WH7A 2V1NA 3TO6A 1YITI 2LC2A 4PJMA 3ZN1A 2F2EA 3KP5A 3E5UA 3T0YA 1FP1D 3SFIA 2FUG2 3K1PA 4CGZA 3BZ6A 2M1BA 3RCOA 4G7HF 2EV0A 1U8RA 2CQKA 4XLFA 4AYBA 2OBPA 4CXFA 4AYBN 1W5SA 3SZTA 1T08B 1KU2A 4AIHA 1D0XA 4QPQA 3ZMUA 2E71A 4A0XA 5FLMJ 3RQIA 1R23A 1K7AA 3WGGA 1NHAA 1ZYRF 3CZ6A 4L5JA 4NB5A 4G6DA 3A0HC 4G94A 1XS9A 4IHXA 1VQLI 4EM2A 5E8IA 1KU7A 4MIMA 4LB5A 1UMQA 2O7OA 2ZXWH 1E2XA 4G12A 2VIXA 2DMNA 3OYAA 1PDNC 4B44A 3G71I 1O4XA 1WZ2A 3BT9A 1RKTA 4MEXF 3E0JB 2VC0A 3HGYA 3MAJA 3S32A 1DQUA 3G73A 1G59A 4HG2A 3DPLC 3FISA 5GTHC 2BXZA 2QSHX 4BXFA 1JE8A 2OZUA 5F27A 3ZMTA 2KMUA 3HOVJ 1DPUA 5FFZA 2CMPA 2W7NA 4UXNA 3HIFA 3IKVA 1Z6RA 2DDBA 2Y30A 4RGSA 2HFHA 3VOEA 3DFGA 1XCBA 2DW4A 2L01A 3ZQQA 4IRIA 1TWHJ 3CQZJ 1YQAA 3EUHA 3WG9A 2LF8A 1JKRC 4BE2A 4BKXA 5K7ZA 4S04A 1U2WA 4A3FJ 2PJPA 2KJCA 4CCOA 5L3EA 1VFCA 1F5TA 4MEYF 1R49A 4HSTA 1LDKB 2XSDC 4ZYEA 3V4GA 2BGCA 5J47A 4O3MA 1YFHA 3FMRA 4IF4A 1E3HA 4M9ZA 2Y48A 4LK0F 2DA2A 3S93A 3L2UA 3FM3A 3HZJA 1OCOH 2HOEA 3V42A 3ZMZA 2ID6A 2L7FP 1JT0A 2RVCA 3U21A 2BY1A 2FQ4A 4BQAA 1BI0A 5L3GA 2Z2SB 4EJOA 3CO7C 3BR2A 2YX4A 2W48A 4LG0B 3ZCOA 4DOZA 1HSJA 2R7XA 4E7HA 4II3A 4X6AJ 1OYYA 4BHPA 4P9UA 3A2KA 1FYLA 2R7TA 2BHYA 3BG3A 2DXIA 3ZMVA 1QRYA 1J09A 1Z1DA 4HOBA 2DFFA 2CW0F 3GTGJ 4Q48A 2B63J 1UCRA 1YW7A 2JSCA 3JRIA 2HYFA 1RETA 4M9SA 3HJEA 4UV8A 4ENMA 2AXLA 3CCQI 4Y13A 3AL0C 2KDZA 5HDKA 2IPQX 2CQ7A 2E2JJ 5LEKA 2HOAA 1JI8A 4QSHA 2HDCA 2NXNB 2V4JC 1WQ2A 2VKHA 4ANJA 5IT3A 3CCJI 1DP7P 1Q1VA 2NOJB 4LLLA 1F4KA 4HX8A 4B4CA 2HQRA 5E1ZB 1J9IA 1VNDA 2HYGD 1XD7A 5CVIA 1IF1A 2E5ZA 2V26A 5K5RA 4EMSA 5F04A 1D1AA 1ZTRA 5F0CA 1ZGJA 4BXUA 4YEJA 2JUCA 4W97A 2NVQJ 1QHGA 4I99C 4WXCA 3G4SI 1Z9CA 3VODA 5M5YJ 2OU2A 4BJ6C 4C2TA 3F8MA 2IVMA 1N78A 1ACIA 5F1RA 4FX4A 2R7SA 3ASNH 3K2ZA 3JTHA 3CO6C 4AD9A 2G9WA 4HNVA 4BDYA 5HOOA 2L3DA 1POGA 4S0HB 2LFBA 1LB2A 3RZDJ 2GXGA 4GCVA 4MNUA 4FTHA 3PFIA 3VYSB 3KYLA 2ACJA 2BW3A 3OS1A 2K7LA 3LSMA 2MYSA 3C2HA 3S3NA 2BEOA 1DU6A 4BH9A 3SQNA 1MJAA 4MQ9F 1BW6A 2DAOA 1SANA 3OIPA 4KT5C 3I71A 2NNYA 1LPQA 4ZTJA 2F48A 4KN7X 4XLPF 1RNLA 1BR4A 2LOOA 3HUGB 1ZAOA 2MFZA 5IT9K 2YR2A 3ABKH 4A6EA 4I01A 4XSZF 1QZYA 1I6HJ 3LOCA 2O8KA 3W3CA 1SFXA 2RV8A 2F5EA 3CUQA 4M3GA 2ZCWA 1KU9A 2K3PA 2KLOA 3BR1A 4YFXF 2P5LC 5E1WA 1FMVA 5EZGA 4XICA 2XKPA 2VJJA 2IGOA 2Y31A 3GFIA 1FEXA 3WHBA 1UHWA 3FHNA 3HPGA 4YIIA 4LGWA 3D0SA 3GXOA 3RI4A 2EPFA 3IAS2 3DEEA 2XAFA 1ZG5A 3H5RA 5IP6A 1YS6A 4N4NB 5FD6A 1PUEE 3BJOA 4RGUA 2DFHA 2FA5A 2COBA 3M9AA 3ULQB 1ZRFA 4OWRB 1IRFA 4PZJA 3PO3J 1TWAJ 3PQJA 1ODDA 3E6CC 3BR6A 1MNDA 2CFXA 2WY8Q 1SD4A 3PFYA 4G6TB 2VXZA 5K7FA 1R71A 1I3AA 2E7XA 2A07F 3B6CA 3P9IA 3ZQCA 1RUNA 4AVZA 2E2IJ 3A01A 5HVQC 5CVRA 3J80Z 3AAFA 2RN7A 5E17F 2M9HA 1FT9A 3E6MA 3KP6A 2Q8KA 5GADJ 3OYHA 2QUFA 3IRQA 1YI2I 5DM7F 1EH8A 3L1PA 2JWTA 2L9VA 5FROA 2R7ZJ 2PQ8A 2O8XA 5D5WB 3Q9SA 1JTYA 2BOLA 2M87A 2AS5F 4RAZA 4ZTFA 3KZYA 3MZ8A 3IL2A 1D5VA 1X4PA 4Q5SF 3N4MA 2YX7A 1ETQA 3PL8A 2HU9A 2H27A 2STWA 3G1LA 2WADA 2VLAA 5HNHA 2EV5A 2ADUA 1ON1A 3GZNB 4HBLA 1VQPI 2L4AA 1RRJA 1LJ9A 2A5WA 1EV7A 2WA0A 1N75A 4PFOA 1LEBA 1I1GA 2KP6A 3K0LA 2NS7A 1BN5A 2ZMEA 2H09A 3CJRB 2JRTA 2X85A 2TCTA 5CPRB 3MKZA 5GAHJ 1DDNA 1IV6A 3QYEA 4RGXA 1S7EA 1A6QA 2P6TA 2Q2EB 2PEXA 1V5FA 5FD5A 2OQGA 2DA4A 4I98B 1TLHB 3P9KA 2M30A 2ME0A 1ZH5A 4V2GA 4ASNA 2LY1A 3ERED 4AIKA 1TWCJ 1O7FA 1X58A 5IYDJ 3K4JA 3KEOA 5LGTA 1LFUP 4KMFA 1ERDA 2K85A 2CW7A 4A3BJ 4FCYA 3FM5A 2Z9OA 3QP6A 2XHKA 1JJ8C 3BY6A 3MEXA 2XKOA 2O61A 3L2VA 4BBSJ 2BYVE 4XQFA 2GIVA 1MBJA 4HF0A 1FSEA 2FEZA 2H6BA 3BC8A 3CF2A 4LB6B 4CICA 4YIRX 3J7ZI 1ZELA 2QBYA 2HDWA 2M0CA 4KFCA 3FX3A 4NHJA 1ETVA 4RB3C 1RI7A 5E3LA 5BOXA 3L00A 2LLKA 2R7RA 1ZG3A 3HYIA 2R93J 3HTUA 3KCCA 3OYDA 1G6NA 3JCUC 3CCYA 1TWGJ 4XRSA 3A02A 5DV5A 3FZVA 1D1CA 2LF7A 2GBYA 5HS9A 4D7NA 3N97A 5J6XA 1ZLKA 1TT0A 2R0QC 1MD0A 2L7ZA 2X1CA 4C30A 2VKVA 3BPXA 2B0LA 2VE8A 3SZGA 5LRSA 1IN6A 3P9CA 4ZZDA 2K4BA 1SAUA 4RB1A 2ETHA 4F52A 1HKQA 4AU7A 2HTJA 4JX4A 1HOMA 3QYBA 4BDZA 1XGNA 1K78A 1FYMA 1FMWA 2VT2A 3J81Z 1FYKA 2M7BA 3UKGA 1IRXA 2E1OA 4KUMA 3PUBA 1D0YA 1IN4A 3M3YJ 5B1AH 1DPRA 1G2HA 2R7DA 4A12A 1GVJA 2HXOA 4ENJA 3CMYA 2DFIA 2VN2A 5DCFA 1ETOA 2R5ZB 1E17A 2R5YA 2MC3A 2FF4A 1SMTA 4HQEA 2XROA 2JPBA 1OFCX 5L3DA 3RYRA 2FU4A 4A3JJ 1KYZA 4ZYGA 3CCMI 1LDJA 2IXSA 3VYTB 4HX7A 2F5DA 3QPSA 2GZWA 3F8BA 4M71A 5A2QK 1LFBA 3WGIA 3O3KA 5CVVA 1A04A 3LMMA 4Q4ZF 2JA8J 1WFXA 2XGDA 4PJLA 4L9VA 3OYEA 3HOTA 4HPQA 1VQ7I 2FNAA 3BQZA 2KIQA 1TQMA 3BG6A 5JVTA 2KRCA 3QODA 4FX0A 2WB1A 3QOEA 5GAEJ 3HHGA 1X2MA 4FETA 1M1EB 3R4KA 1U8BA 1I50J 4E7SA 1J5YA 4PUSA 1TW3A 2DYSH 1F36A 3S1NJ 5TJJA 2E35A 4Y52J 1MBFA 2V1UA 5KK1A 1NK2P 3KP4A 3KLOA 3MVPA 4X0GA 2DFEA 2EZLA 3OIQA 1UG0A 4U7BA 4YELA 2HQ5A 2XB5A 1LFPA 3BTLA 3FK6A 4KA4A 4DYRA 4IOAF 2NRAC 3I4NJ 1R36A 2M8GX 1IDYA 2P81A 2LSOA 2KISA 1O3SA 2O3FA 3GYHX 2HXIA 1VI0A 5ERIA 4CA0A 2OTJI 2EFNA 3MMYB 1ZN2A 3AG2H 3AL0B 1U78A 4IVNA 2R92J 2UXXA 3JRHA 3LAJA 5ED4A 2G0EA 1FNNA 1Z91A 1BI3A 2W57A 3HPHA 2N8GA 4E7IA 2EWNA 1USTA 1TZLA 3QP5A 3ZQHA 2DLLA 3G1OA 2E1NA 2IS1A 4CSWA 1G4DA 2PJRB 2R7UA 1YJ9I 1A6IA 2NAZA 2VPLA 1SD7A 2VBYA 1O57A 4LFUA 3VEPA 4BYYA 5LEJA 1IN7A 1U9OA 2DQRA 1W1WE 1S8NA 4DBQA 2I10A 3FXQA 4UNOA 3B02A 1KYWA 2OC6A 1YYVA 5IOYA 4KT6A 1JKOC 3FXUA 2K9MA 3FXJA 3PM1A 4ON0A 1WJBA 4M72A 2LK2A 1OKRA 3DEWA 3K10A 3QPLA 2XRLA 3M1CA 3ERMA 4ESFA 3HSFA 1AOYA 2YU3A 3A0BC 4PGHA 3FBNB 3U9GA 1VZ0A 3OR1C 3RPUA 1LEAA 5J4YA 2VC1A 1YO5C 2W24A 2EV6A 4IQ4A 4D1QA 2XGEA 1IDZA 5K7HA 3ZMDA 4EM1A 2FBIA 5C3EJ 1X1BA 1AWCA 2Z99A 5H6QA 4EATA 2I5UA 3DV8A 3BOQA 1WJEA 5FKLA 1BM9A 1JGSA 2Y9ZA 2CV1A 2VODA 1PJRA 3TOAA 1OCRH 2CQNA 1B8IA 1U6GA 1MIJA 2OF7A 4KICA 3RPQA 2JN6A 2QA4I 4BQNA 3P5JA 1OYWA 1W0TA 1YX3A 3ECHA 4OMYA 1FJLA 2H1KA 1QZEA 2KIUA 4KISA 3W2WA 3C1DA 1D3YA 5CYVA 1D0ZA 4IPAA 2JA2A 2P7VB 5FFXA 1RR8C 1XMKA 3BCBA 3KFWX 3SDBA 4XL9A 2BBYA 2K9LA 3K2AA 3DKWA 3OR2C 1VF9A 4IXAA 4MHGA 1YHQI 5IYCJ 3BZKA 3GTLJ 3CTAA 3LSHA 5CKTA 3JSPA 4CUGA 1SFEA 4L9NA 3WTWC 1RC9A 2W25A 4A93J 1WJCA 4H4KC 2Y0SN 3KEYA 1H89C 3HRSA 3RJPA 4EQQA 1IJWC 1ZQ3P 2FXAA 3KZZA 3S8PA 5TISC 2NNNA 2HI3A 3R0AA 2ZSIB 3QU3A 5B3SH 3IH4A 3DKXA 2CRGA 1YS7A 3CC4I 2MSYA 1F43A 4CCMA 4B1RA 2W00A 3C3WA 3I59A 4C9YA 1BJAA 2STTA 4F93B 1T33A 3ZR8X 2MABA 3FKJA 1BR2A 1MH4A 2JRMA 4PSWA 2Y0MA 2WBMA 3QYFA 2ZKZA 5FLVA 4DIQA 5HNFA 1WCMJ 2AXTC 3LSIA 1N77A 1P4XA 2CO5A 5ICGA 2VASA 3BDDA 3I9V2 1LDDA 2Z5UA 1YTYA 2YU9J 3FKIJ 2F5CA 2NVXJ 2XAGA 1ZRDA 3ZPLA 2DDAA 2OD5A 1R6RA 2XGCA 1K61A 5D8KB 2TDXA 2NS0A 1G3WA 4YIFA 5L3FA 3I5UA 4D9JA 3LQQA 1BA5A 4DW6A 4AWXB 4PDKA 4CCLA 1BR1A 5B1BH 5E20A 1H8AC 5CVJA
chains in the Genus database with same CATH topology
2R7SA 3DWLE 4XN0A 1W36D 1MNEA 3OY9A 2BVLA 3DTIA 2JUGA 4XLHA 4BDYA 3ZRGA 5HOOA 2JSPA 4II2A 2F5VA 1G8XA 2RREA 4XN3A 4KITB 2LBFA 3VYSB 3KYLA 5FRMA 2BW3A 3OS1A 4LIUA 2VJ5A 2VL8A 3LSMA 3H9JA 4MLOA 2MYSA 3C2HA 3S3NA 3EPZA 3F9KA 3G2BA 2LY2A 3TL4X 2CV2A 3DQVC 4P1WA 4BJTA 3OIPA 2ZXIA 4ZTJA 2BVMA 2KL4A 2XF6A 2HVSA 1BR4A 2LOOA 3HUGB 2MFZA 4XR6A 2ELJA 3OS2A 4IKFA 4F55A 3CESA 2L9SA 3PNVA 2Z1DA 4YRVA 4HNTA 4XMYA 4BU2A 2UV1A 3W3CA 2X6XA 5KHDA 3PJRA 1WJFA 2OV7A 1LVKA 2HVQA 2M4GA 3W2VA 2K3PA 2KLOA 3TBIA 4RM3A 2XF5A 1FMVA 4ITVA 2VJJA 2IGOA 2ZXHA 4E7LA 3FHNA 4RLFA 3ZXSA 3HPGA 2CFOA 2F6CA 1X19A 3IAS2 3DEEA 3K4BA 2R7QA 3S3OA 2X6WA 3H5RA 4N4NB 1WJAA 2MC4A 1K6YA 2L7KA 3OYGA 2KDOA 5KNLA 4OWRB 4ZYAA 2VXDA 1MNDA 2WY8Q 3PFYA 2Q1ZB 2VB6A 4E7ZA 4G6TB 2VXZA 4RLQA 1YX5A 3H0DA 1E0EA 2E5NA 2HPMA 5HLTA 1NG6A 4BQOA 4HNUA 3IUOA 2M0MA 4AVZA 4BE1A 2F4IA 5KCMA 3OWTA 5HVQC 2XF7A 3MD2A 4XKVA 4J00A 3OYHA 1UAAA 2M7AA 1Z7LA 2IGKA 1DP3A 1PYVA 5FROA 2CW8A 2BOLA 4ZTFA 4ZJZA 1X4PA 2VKDA 3PL8A 4OAZA 2HU9A 1QU3A 2DJIA 2WADA 2IGNA 3RPUD 2VLAA 2M4KA 3OYIA 5HNHA 1KONA 4NUBA 3DTKA 4B47A 2R7WA 3W2AA 2R7VA 3LL7A 2A5WA 2WAQA 3BCAA 3CP2A 2WA0A 2HVRA 3M8JA 1N75A 4HSRA 4PFOA 3OYMA 4LIVA 2KP6A 3J7AY 2CUJA 3CJRB 1QHHD 2E1MC 2X85A 5CPRB 4ZC3A 2DCEA 3PNTA 3H5AA 3MKZA 4BGDA 2LYCA 5LFAA 3HC7A 2V7FA 3QYEA 3H35A 5TGTA 4P5OA 2Q2EB 4CCKA 2XC7A 1Z21A 2LBFB 4RM2A 3OS0A 2RNGA 3OYLA 1V5FA 2BW3B 4BQQA 1Y56A 2HZDA 2WAFA 2L9NA 4B43A 3L2RA 3LSGA 3ZGKA 5LD2C 2HNHA 3OYFA 4ZDLA 3OYJA 2LY1A 3K4JA 4NNJA 2E1MB 4ZDPA 3EUHC 1ERDA 2CW7A 2I8DA 4XOTA 3A4CA 4NC8A 4JOMA 2GOXB 3DTEA 3FDYA 2VQGA 2X6YA 3HL2A 3L2VA 2CUZA 4XQFA 3K4LA 2X1DA 2RQQA 2CV0A 2L2OA 2PJRA 4CCJA 2DT6A 3BC8A 3CF2A 4J01A 1T0FC 1ZELA 2HDWA 3DPUA 1P9QC 1U0JA 4QPOA 4PFPA 2R7RA 3OYNA 3VYUB 4XKCA 1MMGA 3VSLA 3OYDA 4E7JA 3SYTA 3RTRA 1D1CA 1TT0A 2X1CA 4C30A 3OYCA 2ZSHB 1AA7A 3PSIA 3SZGA 2QKMB 3K4KA 2VQLA 3A1YA 3L2WA 4IZZA 1SAUA 4F52A 2VQCA 4AU7A 1HA8A 3K70C 3QYBA 4BDZA 3IAM2 3S3MA 2R7OA 1FMWA 2A6TA 4Y33A 1GLNA 2M7BA 1IRXA 1Z3XA 3N05A 2IS4A 3PUBA 1D0YA 2VQHA 4BEHA 1DGWY 1Z3YA 1DGRM 2KQRA 4XNFA 3MKWB 4NC7A 3DLAA 2W1OA 4E7KA 4XONA 2JVHA 4OAYA 3UR3C 4IQJA 4B48A 1WJDA 5JHFA 4HEA2 4CCNA 1V5EA 4Y3OA 2IXSA 3VYTB 4BS9A 2XDVA 2DOAA 4F92B 2VJ4A 3D5RC 2Y0SA 3DPTA 4B3XA 3LMMA 2XAUA 4CZCA 2HPIA 4BUPA 3HOSA 4JQFA 3BG7A 1WFXA 4PJLA 3H5NA 3OYEA 1X1DA 3HOTA 4HPQA 3PSFA 3AFHA 1UELB 3BG6A 2KRCA 3K4MA 3QODA 2WB1A 3QOEA 1N78A 3OL3A 1MMAA 4FETA 2HQAA 4XLCA 4E7SA 4PUSA 3CJQB 3K4NA 2P0WA 1YE9A 2X51A 4X0GA 3TMOA 3OIQA 4XLEA 1UG0A 4F3QA 4XLAA 4IX7A 4U7BA 4YELA 1LFPA 4PJNA 2OUMA 2Z16A 5CQGA 1WJ5A 2UUZA 3EUAA 2IS6A 2KPMA 1EA3A 4XOPA 4NQWB 3SEZA 1S9HA 3D5LA 2AQFA 4CA0A 3MMYB 3OL4A 3KX2A 2V1NA 3AL0B 3HXLA 2LC2A 4PJMA 4PK4A 1X1AA 2FUG2 1NG7A 1OR7C 2K5CA 3HPHA 3RCOA 3RQ4A 4E7IA 1TZLA 4BACA 3C2GA 4XLFA 4AYBA 2IS1A 4CSWA 4BL0B 2PJRB 4C2UA 2R7UA 1T95A 1LKXA 2VPLA 2IGMA 1D0XA 4QPQA 2KRHA 3LSKA 3BLYA 4DBQA 3K70D 3CZ6A 1X4OA 4PJJA 3H9GA 2OC6A 2LREA 2UWMA 3OYAA 4KT6A 2PMZA 3VSKA 2VIXA 4ZDOA 2K9MA 1BOBA 1WJBA 4B44A 4XKBA 3L2QA 2QKLB 3K10A 3LFUA 4GRIA 2IS2A 3M1CA 1W36C 2WAEA 3E0JB 1V5GA 3S32A 1DQUA 1G59A 3CP8A 2JVGA 3FBNB 3DPLC 3K4CA 4HG2A 1VZ0A 3OR1C 5FRNA 3UNGC 1MMNA 1SFKA 4N4OB 4LG3A 4BXFA 1X1CA 2KMUA 4IQ4A 4D1QA 4RMNA 2CMPA 2W7NA 1X1BA 2XSJC 3ONQA 3GBGA 3HKZA 2W4SA 4EATA 2CV1A 1WJEA 4BEHB 3ZQQA 4LITA 1PJRA 4Y4RA 2LH9A 3NWSA 2VJIA 2W82A 4XORA 4DGWB 2L5QA 3D5SC 3OMYA 4BE2A 2ZFUA 4BQNA 2V6EA 4F91B 4CCOA 1YX3A 2V9KA 4HSTA 4KISA 3DU5A 1LDKB 3W2WA 2O5RA 3MKYB 1D0ZA 3PNYA 2JA2A 3FBIB 3OYKA 3BCBA 3SDBA 4XL9A 2K9LA 4KJZA 4FASD 3OR2C 3OOUA 2WY7Q 3S93A 3L2UA 2E60A 2LG4A 2M3AA 3V42A 3I3LA 3H9QA 3LSHA 5CKTA 1OLTA 2CH0A 3E1SA 2DT7B 3HG9A 4CUGA 3U21A 2GOMA 2Z2SB 1WJCA 3DKYA 4H4KC 5CQEA 3KEYA 3RSNA 3ZCOA 4DOZA 3S8PA 3SEQA 2R7XA 1D1BA 3DU6A 4E7HA 2ZSIB 4II3A 4HRIA 3A2KA 3DKXA 2R7TA 2DXIA 1J09A 4BJ5C 4CCMA 2W00A 1Y6IA 4C9YA 2LRDA 3CMMA 4F93B 3ZR8X 2MABA 3FKJA 1BR2A 4PSWA 3AKZA 4XM3A 3NWTA 4DBRA 3VWBA 3AL0C 2WBMA 3QYFA 4E4HA 2KHMA 3K6GA 4PSXA 4DJAA 4DIQA 1JI8A 5HNFA 4U87A 3LSIA 1N77A 3IP4B 2V4JC 3OYBA 2VKHA 4ANJA 2MD0A 4E6KG 4R79A 2VASA 2NOJB 3I9V2 2AQEA 1MW7A 2X1EA 1R6RA 2E5ZA 3VYRB 2V26A 4CH7A 2CS3A 1D1AA 4XKWA 4YEJA 4D9JA 2R4GA 3EUKL 1QHGA 1MMDA 4CCLA 3VDXA 4BE0A 4BJ6C 1BR1A 4C2TA 2KZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5C A; 
#chains in the Genus database with same CATH topology
 1R5I D;  5EF6 A;  4YG2 F;  3DWL E;  3OY9 A;  2NVU B;  3HRM A;  3GVA A;  1LNW A;  2KT0 A;  3FWE A;  1B59 A;  2LBF A;  4HV6 A;  3TKY A;  2VOO A;  1FX7 A;  3K69 A;  3M7G A;  5F1J A;  3L7W A;  5B66 C;  4LIU A;  4C3I J;  2VJ5 A;  5DUK A;  2VL8 A;  3H9J A;  4E70 A;  3CC2 I;  4IRH A;  4XSX F;  1OCZ H;  2LY2 A;  3G2B A;  5EGO B;  4BJT A;  1W7P B;  5C4X J;  5D6F A;  3LSR A;  2XF6 A;  2PFB A;  3F6O A;  1FC3 A;  4D0P A;  3BR3 A;  4X1E A;  4AVP A;  4BAY A;  3OS2 A;  2TRT A;  2UXN A;  3JRD A;  1YRN B;  1QPM A;  1IO2 A;  3QPH A;  3JRC A;  2CUF A;  1MDM B;  4YRV A;  5HDG A;  3BTC A;  4BU2 A;  1UZC A;  2YUS A;  1R4M B;  3QPT A;  5KHD A;  3PJR A;  1WJF A;  2K3F A;  3W2V A;  2ZBK A;  1U5T C;  1T6S A;  4HA8 A;  2XF5 A;  2FQ3 A;  3GZ6 A;  4I6Z A;  4ITV A;  3C18 A;  4CYC A;  2QQ9 A;  1J0R A;  2IRF G;  1OR7 A;  2A3S A;  4JX6 A;  2CFO A;  3TP3 A;  3K7A J;  4MGR A;  4QTR A;  1OCT C;  2DT5 A;  3TGN A;  2R7Q A;  1KZH A;  2LNB A;  4IEJ A;  1FPQ A;  3GTK J;  1QVT A;  2HOS A;  3MN2 A;  2J5P A;  4GXO A;  3O6B B;  2KDO A;  1WGX A;  2EJR A;  4ZYA A;  2R3S A;  1FLI A;  3LAP A;  4KIF A;  1USS A;  3TO9 A;  2KFD A;  2ID3 A;  2VB6 A;  3IH2 A;  3DBL B;  3MQ0 A;  4PJ0 C;  4ZZL A;  2X0L A;  2CYY A;  4RLQ A;  3JRB A;  3H0D A;  2E36 A;  3HDD A;  1E0E A;  1PP8 F;  2RC4 A;  2E5N A;  1NG6 A;  2EIJ H;  3CLO A;  3JRF A;  3HRT A;  5BNG A;  4BE1 A;  4KDP A;  5BPI A;  2HGC A;  4XKV A;  4J00 A;  1S7O A;  4MTE A;  1MBG A;  1ORK A;  2V1X A;  5HOD A;  5D5X B;  5E18 F;  1DP3 A;  4UUV A;  1T8I A;  2A61 A;  4I0A A;  3K1M A;  1JHH A;  2DU9 A;  5D5V B;  4S05 A;  3H1C A;  4A3G J;  1BOA A;  5DM6 F;  1WPK A;  3I4P A;  4UUS B;  4WK8 F;  2XUB A;  2PMU A;  1GDT A;  3FXR A;  3Q0V A;  4NUB A;  2IA0 A;  2JTV A;  4B47 A;  2R7W A;  1T39 A;  1X3U A;  2HS5 A;  3HHH A;  4FE4 A;  2R7V A;  4EV0 A;  2WAQ A;  5DEQ A;  4HDV A;  1IN8 A;  3KZI C;  2WAQ N;  4XLN F;  2CUJ A;  1PP7 U;  2E1M C;  3H0G J;  1JKP C;  2OA4 A;  2X9D A;  4GFB A;  2LYC A;  5LFA A;  3HC7 A;  2V7F A;  3RIR A;  3H35 A;  4F7Z A;  1E3O C;  2ELK A;  2QEX I;  4CCK A;  4AIJ A;  1H0M A;  1FWZ A;  2XC7 A;  4Y17 A;  4RM2 A;  2CQX A;  1H88 C;  3W6K B;  1AKH A;  2MG4 A;  3Q9V A;  2YSR A;  2GLO A;  2KRF A;  1Y1V J;  1Y56 A;  3IC7 A;  3F0C A;  2L9N A;  4UVA A;  4XRF A;  3LSG A;  3O8H A;  4YFK F;  2OTL I;  5IYB J;  4ZDL A;  1IRG A;  2Y75 A;  4Y7N J;  3EUH C;  5EG0 A;  2A6H F;  1FOY A;  3BWG A;  3A4C A;  1FBU A;  4NC8 A;  2MLK A;  1A31 A;  2E1C A;  2X4H A;  3DTE A;  4WXD A;  2VQG A;  3H3V K;  1ETW A;  4AID A;  2KZG A;  2CUZ A;  2JA6 J;  1TNT A;  5HS7 A;  3MZH A;  2L2O A;  3JTG A;  2IEK A;  4XRS G;  4CCJ A;  2DK5 A;  4IO9 F;  5EEH A;  2IJL A;  5IY5 H;  1X3W B;  1FIA A;  1KGS A;  3DPU A;  1P9Q C;  1U0J A;  3V7C A;  1TT5 B;  2OPT A;  4G6Q A;  3C7J A;  3QQA A;  1ZRE A;  4IRG A;  4A5N A;  1JGG A;  4E7J A;  4EJW A;  3CCL I;  2P5K A;  1I27 A;  5EGO A;  2D2W A;  4P9F A;  4ESJ A;  3JAM Z;  3OYC A;  1R4N B;  2X6O A;  3CDI A;  4P96 A;  2NS8 A;  2VQL A;  1N25 A;  4OIO F;  4R8H A;  2QQB A;  5DCM B;  1QGP A;  3KET A;  3WU1 B;  4EGZ A;  1HA8 A;  3K70 C;  3WTT C;  4ZYH A;  3IAM 2;  3JAM K;  2R7O A;  3BR0 A;  3SDG A;  3TW7 A;  3TO7 A;  4UUT A;  1J2X A;  1XN7 A;  1GLN A;  3GLX A;  2EQR A;  3KP7 A;  1L0O C;  2DO7 A;  3GEZ A;  1BIB A;  2VQH A;  4RAG A;  5EDN A;  1B72 B;  4BHC A;  4XNF A;  1Z3Y A;  2KQR A;  1FTZ A;  4NC7 A;  3GFL A;  3DLA A;  2DK8 A;  3F22 A;  1IRZ A;  2VKE A;  2P6S A;  1ZLJ A;  2W1O A;  5EJC A;  1W5T A;  2BV6 A;  1VQ4 I;  3WTU C;  5C4J J;  4C3J J;  4OIN F;  3UR3 C;  2O9L A;  5JHF A;  1Y0U A;  1MJ9 A;  2IW5 A;  4HEA 2;  4LJZ F;  1ZGW A;  1VQO I;  4Y3O A;  4BS9 A;  4QWQ A;  2XDV A;  2XRN A;  3LSJ A;  2QF7 A;  2H6C A;  3ISP A;  1MSF C;  3E5Q A;  3GFJ A;  4I02 A;  4B3X A;  1H9G A;  1R1U A;  3J80 K;  1OMI A;  2HWV A;  4M3D A;  4CZC A;  1W7P D;  3HOS A;  3BG7 A;  4OMZ A;  4IL6 C;  3F23 A;  3PSF A;  3MKL A;  3GX4 X;  2V9V A;  3RKQ A;  4LG0 A;  1UEL B;  3E6B A;  1MMA A;  3CUO A;  4HZF A;  4XLC A;  2ZB9 A;  2FBK A;  2QWW A;  3EQL F;  1HCR A;  4BHB A;  2P0W A;  1YE9 A;  3D1N I;  2D5V A;  2LVS A;  4U88 A;  3ZQL A;  3TMO A;  3I64 A;  1GT0 C;  4O5V A;  2M2E A;  4MFD A;  5E8G A;  1QVU A;  4PJN A;  2OUM A;  2BZT A;  3MZY A;  4CO8 A;  5LHI A;  3IHU A;  3QWL A;  2DOD A;  2PI0 A;  4EJT A;  2IS6 A;  5JVG F;  3CUQ C;  1LE8 B;  1QA6 A;  1JKQ C;  3I54 A;  4NQW B;  3S17 J;  3F8N A;  1S9H A;  2GIZ A;  3D5L A;  4DNC A;  4RBO A;  1P4W A;  4TV7 A;  1R58 A;  3HXL A;  4WWC A;  2CG4 A;  2XPU A;  3S16 J;  2LKP A;  2VE9 A;  2K5C A;  2ISZ A;  3C2G A;  1Q1H A;  3CF5 F;  2FOW A;  2FD5 A;  1B9M A;  3EET A;  2DI3 A;  4C2U A;  1T95 A;  1QNT A;  3A03 A;  3OSG A;  4CZZ A;  2IGM A;  4FIS A;  5J4V A;  3QRF F;  4UY8 I;  3LSK A;  1XGO A;  2XVC A;  3MFK A;  5HLG A;  1P7I A;  3DBH B;  3NQO A;  1X4O A;  3X2Q H;  1B6A A;  1S6L A;  1SC7 A;  2H8W A;  2UWM A;  4A2U A;  4XID A;  2PMZ A;  4HX4 A;  1BOB A;  4XKB A;  2QKL B;  2PMZ N;  3LFU A;  5K1Y A;  5D5U B;  3CMA I;  1W36 C;  5FGM A;  2WC2 A;  2WAE A;  2K9S A;  1H9T A;  1XX5 A;  2JVG A;  3K4C A;  3UNG C;  1MMN A;  2JMW A;  3HUG A;  1CQT A;  1SFK A;  4N4O B;  1NH3 A;  4MFE A;  1X1C A;  1ZR4 A;  1T56 A;  5ICE A;  4JP0 A;  2XSJ C;  5E3M A;  1S3J A;  1UFM A;  3GBG A;  4M6Y A;  2EZH A;  3L2C A;  4BEH B;  2GWR A;  2Y9Y A;  4I09 A;  1FSH A;  4Y4R A;  2LH9 A;  1OCP A;  3FIW A;  3NWS A;  2VJI A;  3EYI A;  5GPA A;  1WHU A;  2ICW G;  5AIP A;  2ZNZ A;  2W82 A;  3ECO A;  4DGW B;  2GM4 A;  1EH7 A;  5KAI C;  3GTP J;  2GAU A;  1VQK I;  3E7L A;  3DU5 A;  4IHV A;  3PNY A;  3J81 K;  2KIF A;  3FBI B;  3OYK A;  3T8R A;  1S72 I;  1E3P A;  4HLY A;  2ZME C;  3ZOB A;  1EJ9 A;  1R7J A;  5DUI A;  2LG4 A;  1V3F A;  1U5T B;  3I3L A;  4EGY A;  3R60 A;  1OLT A;  2CH0 A;  3E1S A;  1OJL A;  3V8L A;  1LVA A;  2M45 A;  3NAR A;  1ZK8 A;  4A3E J;  1GXP A;  3DKY A;  4FHT A;  5CQE A;  4ESB A;  3SEQ A;  4YFN F;  5D8L B;  1D1B A;  1HQC A;  3AG3 H;  3DU6 A;  3TW6 A;  2AO9 A;  4J19 A;  1BC7 C;  2EA2 A;  4HRI A;  3Q5F A;  4V19 K;  2V6C A;  2EIM H;  1PUF B;  3LFK A;  2WB1 N;  4EJU A;  2LRD A;  2DA3 A;  2A69 F;  4RS8 A;  1MBH A;  2LD5 A;  1OQY A;  3FXM A;  3EDP A;  3NWT A;  3VWB A;  2RAE A;  5C44 J;  2HYJ A;  5F64 A;  2KHM A;  2NYX A;  1D5Y A;  3T8T A;  3TQN A;  4XK4 A;  2CUE A;  1YW8 A;  2MD0 A;  3GWZ A;  3S1Q J;  2HEO A;  1XSV A;  1HST A;  2P5V A;  4LMY A;  4KIG A;  2EIK H;  2HZT A;  2AQE A;  2J5O A;  3JSO A;  3TOB A;  2AHQ A;  3Q0U A;  1I3Q J;  1MBK A;  3CDL A;  3R6S A;  3VYR B;  4FT8 A;  4RB2 C;  2VON A;  3GF2 A;  5LGU A;  4CH7 A;  2CS3 A;  2O0Y A;  4XKW A;  3TDZ C;  4FE7 A;  1HW2 A;  1K79 A;  2R4G A;  4CHU A;  2R7F A;  3EUK L;  4L0Z B;  1MMD A;  1SFO J;  4G8X A;  3GTJ J;  4L9T A;  3VDX A;  4BE0 A;  2UZK A;  3HRU A;  2W85 A;  2KZV A;  2ZJ2 A;  2VBZ A;  3KEQ A;  4XN0 A;  1MNE A;  1HBX G;  2H94 A;  2JUG A;  5IP9 J;  3ZRG A;  1ENH A;  2JSP A;  2WV1 A;  2F5V A;  2XAJ A;  3HB9 A;  2Q2E A;  1IW7 F;  4KIT B;  3J7A O;  5F0H A;  4DZP A;  4Z6Y A;  2ZC2 A;  2FRH A;  1SFU A;  3BRO A;  2EIL H;  3F9K A;  3WTY C;  2Z33 A;  2RNJ A;  1NK3 P;  1AU7 A;  4HF2 A;  2F5F A;  3TL4 X;  2CV2 A;  3DQV C;  1XCV A;  3LNQ A;  2JA7 J;  2KIM A;  1SVO A;  1FP2 A;  1UG2 A;  5DDG A;  2MD5 A;  1TTY A;  3QU6 A;  2HVS A;  2ESH A;  3JW4 A;  5ILS A;  3M07 A;  4IKF A;  2A6E F;  2FJ1 A;  4F55 A;  3CES A;  3SZP A;  4HF1 A;  2BHZ A;  2OCC H;  2Z1D A;  2YPR A;  3WU2 C;  5JLW A;  3TDU C;  3PIO F;  2UV1 A;  2ZJQ F;  1TC3 C;  2NVY J;  1QZZ A;  1SVL A;  2DBB A;  2D1V A;  1GVD A;  1W4M A;  1VQ6 I;  2OV7 A;  1LVK A;  2HVQ A;  2M4G A;  3ELK A;  4ABZ A;  3TBI A;  1XB4 A;  4RM3 A;  3ZMS A;  2O6G E;  3G6E I;  2DA5 A;  4MO7 A;  4WCG A;  3TED A;  3W6J B;  3WGH A;  2ZXH A;  3COA C;  4LD5 A;  4E7L A;  4OIQ F;  3ZXS A;  2FBH A;  5DTD A;  2F6C A;  1X19 A;  2DMQ A;  1O3Q A;  5M5W J;  1JUP A;  3K4B A;  1R5G A;  1WJA A;  2DN0 A;  2MC4 A;  2FX0 A;  1K6Y A;  5BMZ A;  5J8F A;  5HLH A;  3OYG A;  2P4W A;  5LGN A;  2X48 A;  4A5M A;  3B73 A;  5KNL A;  4C3H J;  4A3L J;  2Q1Z B;  5FKM A;  2VPR A;  2OAZ A;  4RGR A;  5FKN A;  4PGG A;  1YX5 A;  1ETX A;  2RKH A;  5HLT A;  3PIP F;  1BI1 A;  2XIG A;  4G9Y A;  4HNU A;  3IUO A;  2M0M A;  2F4I A;  2MH2 A;  5KCM A;  5M5X J;  3OWT A;  2XF7 A;  3RYP A;  3MD2 A;  2R5Z A;  1JUS A;  1Z05 A;  4U0V A;  2EK5 A;  4H0E A;  1QO0 D;  2M7A A;  4FQG A;  1Z7L A;  2KJB A;  1ZG1 A;  1IN5 A;  3F8C A;  1K83 J;  4U0W A;  2CQQ A;  3RDI A;  1UHS A;  1BJZ A;  2OCE A;  3B6A A;  2KKO A;  1HDD C;  4IHT A;  6PAX A;  3BTJ A;  1P7J A;  1I1S A;  3CJT B;  3U1D A;  2DMP A;  3IV5 A;  1JUM A;  1QU3 A;  5FO5 A;  2DJI A;  3SJM A;  5EEA A;  2IGN A;  3RPU D;  4MTD A;  5GAG J;  4UB6 C;  4I2O A;  2CSO A;  2V9P A;  4K2E A;  3LL7 A;  4NDL A;  2H1L A;  4RAY A;  3PO2 J;  2LY9 A;  3U1K A;  3OYM A;  4LIV A;  5FLX Z;  1VQM I;  1T38 A;  3F8F A;  1HF0 A;  2DPU A;  1JT6 A;  3KYC B;  1QHH D;  5GP9 A;  4M3E A;  2HDD A;  1I6X A;  2EA4 A;  4BGD A;  5BPD A;  1IV8 A;  2JPC A;  3HSE A;  2COM A;  1XMA A;  2K86 A;  5FLX K;  4GO1 A;  3KIO A;  5DYM A;  5LRR A;  2RNG A;  2FMY A;  2DYR H;  2BW3 B;  4EVI A;  5H20 A;  3R0J A;  1FBS A;  2BY2 A;  2DA6 A;  2WAF A;  4WXH A;  2NOG A;  3ZGK A;  5D4R A;  1EH6 A;  3OYF A;  3OYJ A;  1R22 A;  2JT1 A;  1XDU A;  1FOW A;  1WRJ A;  1XMX A;  2EZK A;  3I53 A;  3NEU A;  3V7S A;  3JRE A;  4QIW N;  1WKM A;  1JJ6 C;  2EBI A;  5HS8 A;  4UVB A;  2FML A;  4JOM A;  1IG7 A;  1SD6 A;  2ESN A;  2WV0 A;  2X6Y A;  1A35 A;  1JHF A;  1FZP B;  2QQA A;  3K4L A;  2X1D A;  1VQ5 I;  1HC8 A;  1I39 A;  2CV0 A;  2YS9 A;  3CUQ B;  2PJR A;  2DT6 A;  1HW5 A;  2MA3 A;  4DQ2 A;  1G3S A;  4XRM A;  4J01 A;  4WF2 A;  4QPO A;  2L9R A;  3VYU B;  4XKC A;  2ISY A;  1MZB A;  3FK7 A;  2ZJR F;  4LLN A;  1MMG A;  2V79 A;  3VSL A;  2IBD A;  4IHW A;  1V4R A;  3SYT A;  5LBQ A;  3KE2 A;  3CCR I;  5DS9 A;  1XTA A;  4RA2 A;  3ZQI A;  1IXR C;  1I5Z A;  1AA7 A;  2VBW A;  4MQV A;  2QEN A;  2QKM B;  4Q47 A;  2D1H A;  1SD5 A;  3CCV I;  1O3T A;  3A1Y A;  3L2W A;  4NC6 A;  5F6F A;  3S1R J;  1MNM C;  1VQN I;  2CJJ A;  3GZ5 A;  1MJB A;  1AHD P;  1J7K A;  3DEU A;  3S3M A;  3HOW J;  2A6T A;  4Y33 A;  3DP7 A;  1UJ8 A;  1Z3X A;  3BJA A;  3N05 A;  3Q0W A;  4IHY A;  2B7E A;  2IA2 A;  1FIP A;  3A01 B;  2PN6 A;  1LQ1 A;  4L0Y B;  1YW9 A;  3O2P E;  2PLY A;  3S2D J;  2BY0 A;  2JJ7 A;  2LMD A;  4XON A;  1WVR A;  2JVH A;  4IQJ A;  3KP3 A;  4EJV A;  2JZY A;  2VI6 A;  2VJ4 A;  3CJN A;  4A6D A;  1W5C C;  3D5R C;  1HXD A;  4A3C J;  5GTI C;  3GUD A;  2HPI A;  4BUP A;  2JA5 J;  1R00 A;  3F72 A;  1APL C;  5H6R A;  1MKM A;  3AFH A;  1G3Y A;  4DZJ A;  3S14 J;  3OL3 A;  3RKY A;  1F1Z A;  2ZME B;  3M8F A;  4XBF A;  3WTV C;  1JTX A;  3JR9 A;  1TW2 A;  3CJQ B;  4N9H A;  5J1Y A;  3K4N A;  2G7H A;  5BQT A;  3FXK A;  3IKT A;  5J40 A;  2FSW A;  4NBQ A;  2MH9 A;  3HBL A;  3F3X A;  4F3Q A;  1X1P A;  3BP8 A;  5CQG A;  2DPD A;  5K5O A;  3K1N A;  1B9N A;  3EUA A;  5AON A;  1XC5 A;  2LP0 A;  2FE3 A;  2LTP A;  1U9N A;  3SHF A;  1B1B A;  2KPM A;  2NVT J;  2F4O B;  1QPI A;  2HOT A;  4EM0 B;  4M3B A;  1GUU A;  2L7M P;  1V54 H;  4GYI A;  2AQF A;  3M8E A;  4IJA A;  1Z6T A;  1VQ9 I;  1O7L A;  3BTI A;  5F08 A;  2HR3 A;  3H3U A;  4PK4 A;  1IC8 A;  2K9N A;  3H92 A;  3KLN A;  2EIN H;  1X2N A;  1Y1W J;  1X1A A;  3DLL F;  5KVR A;  3AG1 H;  3W6V A;  1NG7 A;  1XG1 A;  1OR7 C;  2XB0 X;  3RQ4 A;  3S2W A;  3WG7 H;  4BAC A;  3F21 A;  3ML6 A;  3ZQ7 A;  4OOI A;  1D8K A;  2IA1 A;  1MMS A;  4BL0 B;  1OCC H;  3ZP5 A;  1LKX A;  2QBY B;  1P6R A;  1ONV A;  1KA8 A;  2KRH A;  2Z3Y A;  3CDH A;  3FHZ A;  2CGP A;  1RES A;  2XAH A;  4PCQ A;  2RGV A;  3BLY A;  5LHG A;  3K70 D;  3CCS I;  4ENN A;  5IT9 Z;  5E1X A;  4L5I A;  3BJ6 A;  2QZ8 A;  4PJJ A;  3H9G A;  2V1D A;  2LRE A;  3DBR B;  5AIQ A;  3L9F A;  2DOE A;  3VSK A;  4ZDO A;  4JX5 A;  3U2R A;  4UB8 C;  3L2Q A;  4P55 A;  4IHS A;  4GRI A;  2IS2 A;  3VFZ A;  1TBX A;  1W7P A;  3LWF A;  1F9N A;  3WHC A;  1QQI A;  5ICC A;  1V5G A;  1KU3 A;  3CP8 A;  5FRN A;  2LR8 A;  4A3K J;  1MGT A;  4LG3 A;  1BL0 A;  3SXY A;  1IZ1 A;  3OOP A;  3LA3 A;  4RMN A;  2QYO A;  1K78 B;  2GXB A;  4A69 C;  1YRN A;  3NRV A;  3LQR A;  3ONQ A;  3ASO H;  2Y69 H;  3HKZ A;  2W4S A;  1MDM A;  2MBF A;  4HLX A;  3DF8 A;  1YLF A;  3HKZ N;  1FOX A;  4LIT A;  2K02 A;  5DD8 A;  4A3D J;  1SVM A;  5D4S A;  3VB2 A;  2VT3 A;  2XGX A;  3BQY A;  4XOR A;  5JI6 A;  2R5Y B;  5J1U A;  4WX9 A;  2L5Q A;  3D5S C;  3OMY A;  4A0Y A;  2ZFU A;  2Q0O A;  2V6E A;  4F91 B;  1ON2 A;  3M1E A;  5KAF C;  1L3L A;  2GQQ A;  5CJ9 A;  3CD6 I;  2V9K A;  1TP4 A;  1HKT A;  2O5R A;  3MKY B;  1FY7 A;  5E79 C;  1HKS A;  1ULY A;  2CWE A;  2M34 A;  3ESW B;  4KJZ A;  1RR7 A;  2XPV A;  3GLL A;  3HGG A;  4B09 A;  4FAS D;  3OOU A;  2WY7 Q;  1TQI A;  1R5H A;  4OU0 A;  4ETS A;  2E60 A;  2M3A A;  5FKK A;  3T1B A;  3ZQG A;  3H9Q A;  2DT7 B;  3HG9 A;  4Z2Y A;  2VOP A;  2GOM A;  1ZGA A;  3RSN A;  3L09 A;  2QGU A;  4JYK A;  2D45 A;  1R1T A;  5L3C A;  1ZRC A;  3RKX A;  2F4M B;  1YJW I;  3E5X A;  1WI3 A;  4BJ5 C;  2EFO A;  3CLQ A;  3DXJ F;  3G1M A;  1HW1 A;  2MLG A;  1Y6I A;  1XGM A;  2K9Q A;  1TWF J;  3IWF A;  3CMM A;  3K9T A;  3AKZ A;  4XM3 A;  4DBR A;  3RZO J;  4E4H A;  1VQ8 I;  1WI9 A;  3K6G A;  4PSX A;  4DJA A;  2BE5 F;  3R61 A;  1B4A A;  4U87 A;  4ZH4 F;  3IP4 B;  3CCE I;  3OYB A;  1YIJ I;  4E6K G;  4R79 A;  4R1H A;  1YG2 A;  4B3A A;  4UUS A;  3I56 I;  2GXA A;  1MW7 A;  2IT0 A;  4OIR F;  1K6O A;  2X1E A;  2VBX A;  3HSR A;  1KQ8 A;  3WE3 A;  3WTS C;  2WTE A;  4L18 B;  3KPH A;  2DMT A;  4UHT A;  3HTS B;  3JRG A;  4BY7 J;  1UHM A;  4BXX J;  4LOC A;  1S29 A;  1Z7U A;  1GHC A;  2GA1 A;  2DJN A;  1KQ9 A;  1W36 D;  1CF7 B;  3I4M J;  2BVL A;  3DTI A;  3SFZ A;  4XLH A;  1D8J A;  4BY1 J;  3REO A;  4II2 A;  4M73 A;  2DTZ A;  1G8X A;  2RRE A;  4N0B A;  4XN3 A;  4ZYD A;  4DYC A;  3HOU J;  4B8X A;  1RZ4 A;  4AUX A;  5FRM A;  3S1M J;  4JK1 X;  1U3E M;  3TP0 A;  3IWZ A;  4MLO A;  1ZKG A;  3EPZ A;  3QAH A;  1Z67 A;  1RUO A;  1FOK A;  1IUY A;  2DTR A;  1ETY A;  3OSF A;  4P1W A;  3CC7 I;  3GFM A;  2ZXI A;  2BVM A;  2KL4 A;  3E97 A;  3NAU A;  1IAW A;  4XR6 A;  3GTQ J;  2ELJ A;  4EEF G;  1ITY A;  4I0B A;  2OZ6 A;  3ROU A;  2L9S A;  3PNV A;  4A3M J;  1S5L C;  1TL8 A;  2XPW A;  5J8C A;  2L54 A;  4RB0 A;  3T5X A;  2QVO A;  4HNT A;  4XMY A;  1ZR2 A;  3EYY A;  2X6X A;  2ZFW A;  5DD4 A;  1DU0 A;  1TNS A;  3BR5 A;  4DYQ A;  4O6J A;  3BG5 A;  3I55 I;  1B8I B;  1GV5 A;  2LDU A;  2M5W A;  1G3T A;  5EEG A;  5FKO A;  4C2M J;  1X3Z B;  2EB7 A;  2DOF A;  3ZQF A;  1MH3 A;  3O8G A;  1WH5 A;  2L4M A;  1XSX A;  3HOY J;  2ZO4 A;  4RLF A;  1RKW A;  2XV4 S;  1XPX A;  4KMU X;  2RDP A;  4GYG A;  3GW2 A;  1WWX A;  5K5Q A;  3S3O A;  2P8T A;  2X6W A;  4ENK A;  4W1U A;  1EF4 A;  2BXY A;  3HOZ J;  1Y8Q B;  2L7K A;  3ABT A;  2K27 A;  5DCM A;  1T0F A;  3FF5 A;  3LA7 A;  2E2H J;  2HTS A;  2CU7 A;  2VXD A;  3PUF A;  5EYR A;  4E7Z A;  5HDN A;  2E34 A;  5IOZ A;  2HPM A;  2QQ8 A;  1NTC A;  1BIA A;  4BQO A;  1B72 A;  2M8E A;  4M74 A;  1Y8R B;  3AG4 H;  5A2Q Z;  2LKX A;  1P4A A;  3GME A;  1K4T A;  3I59 B;  1FTT A;  1GXQ A;  5JFR A;  5H2F C;  5E3O A;  5B5E C;  1UAA A;  3E6D A;  2IGK A;  2OQR A;  1PYV A;  4CYD A;  4G7O F;  5IP7 J;  3LST A;  5M3F J;  5CLS A;  2CW8 A;  3VPR A;  4BNC A;  4L5E A;  4KYW A;  2XAS A;  4ZJZ A;  3CCU I;  3Q3S A;  3GTM J;  5BS6 A;  2VKD A;  3LSP A;  4OAZ A;  2DMU A;  1FBQ A;  4BBR J;  1XSD A;  4A0Z A;  2M4K A;  2OJE D;  2RQP A;  3OYI A;  4JBA A;  1KON A;  1R1V A;  2K4J A;  5ICF A;  3DTK A;  1IGN A;  2ZNY A;  4RAF A;  3FXO A;  3W2A A;  3V8J A;  4HV5 A;  1RPW A;  1W0U A;  1HDP A;  3BCA A;  3CP2 A;  5ILV A;  2HVR A;  3M8J A;  4HSR A;  3LA2 A;  2IAI A;  3J7A Y;  5ILU A;  5FB2 A;  2ECC A;  2HKX A;  2FNP A;  4LLG F;  2DCE A;  3PNT A;  3H5A A;  4ZC3 A;  1OPC A;  1YJN I;  4A3I J;  3I0T A;  1IXS B;  5JLX A;  2DA7 A;  5F0F A;  2PMH A;  5TGT A;  3ABL H;  2XAQ A;  4P5O A;  2G7U A;  3BPV A;  2VUM J;  5LHH A;  1Z21 A;  2LBF B;  1Y39 A;  2P7C B;  3IH3 A;  2DQL A;  3WTZ A;  3OS0 A;  2ME6 A;  3OYL A;  1OYI A;  2ZXJ A;  4BQQ A;  4CDG A;  5FJ8 J;  4I76 A;  2B9S A;  3OIO A;  2IP2 A;  2HZD A;  1XDS A;  4OIP F;  2QM3 A;  3FXL A;  4B43 A;  3IRR A;  3L2R A;  4AM3 A;  5LD2 C;  1T98 A;  2L0K A;  2HNH A;  2K40 A;  1C0W A;  2ZJP F;  4U7D A;  3WE2 A;  3JRA A;  1LE8 A;  4NNJ A;  2E1M B;  2HKO A;  4NQW A;  4ZDP A;  2QCO A;  1OIS A;  2I8D A;  2WWY A;  4XOT A;  4HQM A;  2A05 A;  2EFP A;  1JXS A;  3WU0 A;  4G7Z F;  1SMY F;  2MGQ A;  3QOP A;  1MSE C;  1A5J A;  2GOX B;  3MWM A;  3FDY A;  3HL2 A;  1R9T J;  3M4O J;  1CF7 A;  3V8K A;  2JK3 A;  2RQQ A;  4Y15 A;  3ABU A;  1A36 A;  3S2H J;  1T0F C;  4QLC U;  1TQP A;  4L9J A;  2A68 F;  1REP C;  4V2F A;  3ABM H;  2QSF X;  3HEF A;  4PFP A;  1P92 A;  4CYC B;  3OYN A;  1HLV A;  1Y0N A;  2BY3 A;  4D7M A;  2Y2Z A;  4KNY A;  1KQ0 A;  3RTR A;  3DCF A;  2L02 A;  4LK1 F;  2EFQ A;  2MW8 A;  2PX9 A;  5CVU A;  1PVE A;  1XGS A;  1IXC A;  2HQN A;  4GDF A;  2O03 A;  4U0Y A;  1BI2 A;  1IUF A;  1Z77 A;  2ZSH B;  5LLQ A;  3PSI A;  1GV2 A;  4GGG A;  9ANT A;  5E3N A;  2PG4 A;  2FOK A;  3WTX C;  2JQ7 A;  3K4K A;  3E3V A;  3I58 A;  1Z0X A;  4IZZ A;  1BBY A;  4M6X A;  1MBE A;  1ZHF A;  2VQC A;  3KP2 A;  2E7W A;  1DUX C;  1SEU A;  4HDU A;  3V7R A;  3P7N A;  3OV8 A;  2QSG X;  2IS4 A;  4BEH A;  3PQK A;  1DGW Y;  5J1R A;  1DGR M;  3MKW B;  2EFW A;  3ZN0 A;  3C2B A;  4KN4 X;  1SAX A;  4E7K A;  3BG9 A;  4OAY A;  4UVC A;  1QBJ A;  3FMQ A;  2DA1 A;  2GA2 A;  4I7H A;  4B48 A;  1WJD A;  2E19 A;  1WSU A;  1O3R A;  1V55 H;  2H8R A;  4CCN A;  1V5E A;  1J59 A;  4IOC F;  2DOA A;  4F92 B;  1J75 A;  2Y0S A;  3DPT A;  3H3Z A;  3J7Y J;  2LKS A;  2XAU A;  1U5T A;  4RDU A;  3GCM A;  5GPC A;  4JQF A;  1CGP A;  3H5N A;  1X1D A;  3KYD B;  1RIO H;  1YIO A;  5IPA A;  3CME I;  1VTN C;  2PBI A;  3F6V A;  5J3L A;  3K4M A;  1YOV B;  2QLZ A;  1UB9 A;  3G3Z A;  4M9X A;  5EZH A;  2EH3 A;  5M3M J;  1S7A A;  4KIB A;  2HQA A;  4HAM A;  2EZI A;  3GTO J;  4D5C A;  1PUF A;  2ECB A;  4M6V A;  1BC8 C;  1LUJ B;  5D6E A;  5HLI A;  2W84 A;  5JR3 A;  1K4S A;  1ZAR A;  1P2F A;  3WOD F;  2ELH A;  2A5Y B;  3H36 A;  2X51 A;  4AC0 A;  4M3F A;  4UV9 A;  3S15 J;  1ETK A;  3RKW A;  5JHU A;  1EKE A;  4D5F A;  3HOX J;  4XLE A;  3MCZ A;  4XLA A;  1AKH B;  4IX7 A;  2C6Y A;  2Z16 A;  1WJ5 A;  3HM5 A;  2UUZ A;  1BW5 A;  3GO5 A;  4HW0 A;  5TRD A;  1STZ A;  4N9I A;  1EA3 A;  3BZC A;  4XOP A;  1T2K A;  3SEZ A;  5L3B A;  3FMS A;  4HYE A;  5EG0 B;  3OL4 A;  3KX2 A;  1WH7 A;  2V1N A;  3TO6 A;  1YIT I;  2LC2 A;  4PJM A;  3ZN1 A;  2F2E A;  3KP5 A;  3E5U A;  3T0Y A;  1FP1 D;  3SFI A;  2FUG 2;  3K1P A;  4CGZ A;  3BZ6 A;  2M1B A;  3RCO A;  4G7H F;  2EV0 A;  1U8R A;  2CQK A;  4XLF A;  4AYB A;  2OBP A;  4CXF A;  4AYB N;  1W5S A;  3SZT A;  1T08 B;  1KU2 A;  4AIH A;  1D0X A;  4QPQ A;  3ZMU A;  2E71 A;  4A0X A;  5FLM J;  3RQI A;  1R23 A;  1K7A A;  3WGG A;  1NHA A;  1ZYR F;  3CZ6 A;  4L5J A;  4NB5 A;  4G6D A;  3A0H C;  4G94 A;  1XS9 A;  4IHX A;  1VQL I;  4EM2 A;  5E8I A;  1KU7 A;  4MIM A;  4LB5 A;  1UMQ A;  2O7O A;  2ZXW H;  1E2X A;  4G12 A;  2VIX A;  2DMN A;  3OYA A;  1PDN C;  4B44 A;  3G71 I;  1O4X A;  1WZ2 A;  3BT9 A;  1RKT A;  4MEX F;  3E0J B;  2VC0 A;  3HGY A;  3MAJ A;  3S32 A;  1DQU A;  3G73 A;  1G59 A;  4HG2 A;  3DPL C;  3FIS A;  5GTH C;  2BXZ A;  2QSH X;  4BXF A;  1JE8 A;  2OZU A;  5F27 A;  3ZMT A;  2KMU A;  3HOV J;  1DPU A;  5FFZ A;  2CMP A;  2W7N A;  4UXN A;  3HIF A;  3IKV A;  1Z6R A;  2DDB A;  2Y30 A;  4RGS A;  2HFH A;  3VOE A;  3DFG A;  1XCB A;  2DW4 A;  2L01 A;  3ZQQ A;  4IRI A;  1TWH J;  3CQZ J;  1YQA A;  3EUH A;  3WG9 A;  2LF8 A;  1JKR C;  4BE2 A;  4BKX A;  5K7Z A;  4S04 A;  1U2W A;  4A3F J;  2PJP A;  2KJC A;  4CCO A;  5L3E A;  1VFC A;  1F5T A;  4MEY F;  1R49 A;  4HST A;  1LDK B;  2XSD C;  4ZYE A;  3V4G A;  2BGC A;  5J47 A;  4O3M A;  1YFH A;  3FMR A;  4IF4 A;  1E3H A;  4M9Z A;  2Y48 A;  4LK0 F;  2DA2 A;  3S93 A;  3L2U A;  3FM3 A;  3HZJ A;  1OCO H;  2HOE A;  3V42 A;  3ZMZ A;  2ID6 A;  2L7F P;  1JT0 A;  2RVC A;  3U21 A;  2BY1 A;  2FQ4 A;  4BQA A;  1BI0 A;  5L3G A;  2Z2S B;  4EJO A;  3CO7 C;  3BR2 A;  2YX4 A;  2W48 A;  4LG0 B;  3ZCO A;  4DOZ A;  1HSJ A;  2R7X A;  4E7H A;  4II3 A;  4X6A J;  1OYY A;  4BHP A;  4P9U A;  3A2K A;  1FYL A;  2R7T A;  2BHY A;  3BG3 A;  2DXI A;  3ZMV A;  1QRY A;  1J09 A;  1Z1D A;  4HOB A;  2DFF A;  2CW0 F;  3GTG J;  4Q48 A;  2B63 J;  1UCR A;  1YW7 A;  2JSC A;  3JRI A;  2HYF A;  1RET A;  4M9S A;  3HJE A;  4UV8 A;  4ENM A;  2AXL A;  3CCQ I;  4Y13 A;  3AL0 C;  2KDZ A;  5HDK A;  2IPQ X;  2CQ7 A;  2E2J J;  5LEK A;  2HOA A;  1JI8 A;  4QSH A;  2HDC A;  2NXN B;  2V4J C;  1WQ2 A;  2VKH A;  4ANJ A;  5IT3 A;  3CCJ I;  1DP7 P;  1Q1V A;  2NOJ B;  4LLL A;  1F4K A;  4HX8 A;  4B4C A;  2HQR A;  5E1Z B;  1J9I A;  1VND A;  2HYG D;  1XD7 A;  5CVI A;  1IF1 A;  2E5Z A;  2V26 A;  5K5R A;  4EMS A;  5F04 A;  1D1A A;  1ZTR A;  5F0C A;  1ZGJ A;  4BXU A;  4YEJ A;  2JUC A;  4W97 A;  2NVQ J;  1QHG A;  4I99 C;  4WXC A;  3G4S I;  1Z9C A;  3VOD A;  5M5Y J;  2OU2 A;  4BJ6 C;  4C2T A;  3F8M A;  2IVM A;  1N78 A;  1ACI A;  5F1R A;  4FX4 A;  2R7S A;  3ASN H;  3K2Z A;  3JTH A;  3CO6 C;  4AD9 A;  2G9W A;  4HNV A;  4BDY A;  5HOO A;  2L3D A;  1POG A;  4S0H B;  2LFB A;  1LB2 A;  3RZD J;  2GXG A;  4GCV A;  4MNU A;  4FTH A;  3PFI A;  3VYS B;  3KYL A;  2ACJ A;  2BW3 A;  3OS1 A;  2K7L A;  3LSM A;  2MYS A;  3C2H A;  3S3N A;  2BEO A;  1DU6 A;  4BH9 A;  3SQN A;  1MJA A;  4MQ9 F;  1BW6 A;  2DAO A;  1SAN A;  3OIP A;  4KT5 C;  3I71 A;  2NNY A;  1LPQ A;  4ZTJ A;  2F48 A;  4KN7 X;  4XLP F;  1RNL A;  1BR4 A;  2LOO A;  3HUG B;  1ZAO A;  2MFZ A;  5IT9 K;  2YR2 A;  3ABK H;  4A6E A;  4I01 A;  4XSZ F;  1QZY A;  1I6H J;  3LOC A;  2O8K A;  3W3C A;  1SFX A;  2RV8 A;  2F5E A;  3CUQ A;  4M3G A;  2ZCW A;  1KU9 A;  2K3P A;  2KLO A;  3BR1 A;  4YFX F;  2P5L C;  5E1W A;  1FMV A;  5EZG A;  4XIC A;  2XKP A;  2VJJ A;  2IGO A;  2Y31 A;  3GFI A;  1FEX A;  3WHB A;  1UHW A;  3FHN A;  3HPG A;  4YII A;  4LGW A;  3D0S A;  3GXO A;  3RI4 A;  2EPF A;  3IAS 2;  3DEE A;  2XAF A;  1ZG5 A;  3H5R A;  5IP6 A;  1YS6 A;  4N4N B;  5FD6 A;  1PUE E;  3BJO A;  4RGU A;  2DFH A;  2FA5 A;  2COB A;  3M9A A;  3ULQ B;  1ZRF A;  4OWR B;  1IRF A;  4PZJ A;  3PO3 J;  1TWA J;  3PQJ A;  1ODD A;  3E6C C;  3BR6 A;  1MND A;  2CFX A;  2WY8 Q;  1SD4 A;  3PFY A;  4G6T B;  2VXZ A;  5K7F A;  1R71 A;  1I3A A;  2E7X A;  2A07 F;  3B6C A;  3P9I A;  3ZQC A;  1RUN A;  4AVZ A;  2E2I J;  3A01 A;  5HVQ C;  5CVR A;  3J80 Z;  3AAF A;  2RN7 A;  5E17 F;  2M9H A;  1FT9 A;  3E6M A;  3KP6 A;  2Q8K A;  5GAD J;  3OYH A;  2QUF A;  3IRQ A;  1YI2 I;  5DM7 F;  1EH8 A;  3L1P A;  2JWT A;  2L9V A;  5FRO A;  2R7Z J;  2PQ8 A;  2O8X A;  5D5W B;  3Q9S A;  1JTY A;  2BOL A;  2M87 A;  2AS5 F;  4RAZ A;  4ZTF A;  3KZY A;  3MZ8 A;  3IL2 A;  1D5V A;  1X4P A;  4Q5S F;  3N4M A;  2YX7 A;  1ETQ A;  3PL8 A;  2HU9 A;  2H27 A;  2STW A;  3G1L A;  2WAD A;  2VLA A;  5HNH A;  2EV5 A;  2ADU A;  1ON1 A;  3GZN B;  4HBL A;  1VQP I;  2L4A A;  1RRJ A;  1LJ9 A;  2A5W A;  1EV7 A;  2WA0 A;  1N75 A;  4PFO A;  1LEB A;  1I1G A;  2KP6 A;  3K0L A;  2NS7 A;  1BN5 A;  2ZME A;  2H09 A;  3CJR B;  2JRT A;  2X85 A;  2TCT A;  5CPR B;  3MKZ A;  5GAH J;  1DDN A;  1IV6 A;  3QYE A;  4RGX A;  1S7E A;  1A6Q A;  2P6T A;  2Q2E B;  2PEX A;  1V5F A;  5FD5 A;  2OQG A;  2DA4 A;  4I98 B;  1TLH B;  3P9K A;  2M30 A;  2ME0 A;  1ZH5 A;  4V2G A;  4ASN A;  2LY1 A;  3ERE D;  4AIK A;  1TWC J;  1O7F A;  1X58 A;  5IYD J;  3K4J A;  3KEO A;  5LGT A;  1LFU P;  4KMF A;  1ERD A;  2K85 A;  2CW7 A;  4A3B J;  4FCY A;  3FM5 A;  2Z9O A;  3QP6 A;  2XHK A;  1JJ8 C;  3BY6 A;  3MEX A;  2XKO A;  2O61 A;  3L2V A;  4BBS J;  2BYV E;  4XQF A;  2GIV A;  1MBJ A;  4HF0 A;  1FSE A;  2FEZ A;  2H6B A;  3BC8 A;  3CF2 A;  4LB6 B;  4CIC A;  4YIR X;  3J7Z I;  1ZEL A;  2QBY A;  2HDW A;  2M0C A;  4KFC A;  3FX3 A;  4NHJ A;  1ETV A;  4RB3 C;  1RI7 A;  5E3L A;  5BOX A;  3L00 A;  2LLK A;  2R7R A;  1ZG3 A;  3HYI A;  2R93 J;  3HTU A;  3KCC A;  3OYD A;  1G6N A;  3JCU C;  3CCY A;  1TWG J;  4XRS A;  3A02 A;  5DV5 A;  3FZV A;  1D1C A;  2LF7 A;  2GBY A;  5HS9 A;  4D7N A;  3N97 A;  5J6X A;  1ZLK A;  1TT0 A;  2R0Q C;  1MD0 A;  2L7Z A;  2X1C A;  4C30 A;  2VKV A;  3BPX A;  2B0L A;  2VE8 A;  3SZG A;  5LRS A;  1IN6 A;  3P9C A;  4ZZD A;  2K4B A;  1SAU A;  4RB1 A;  2ETH A;  4F52 A;  1HKQ A;  4AU7 A;  2HTJ A;  4JX4 A;  1HOM A;  3QYB A;  4BDZ A;  1XGN A;  1K78 A;  1FYM A;  1FMW A;  2VT2 A;  3J81 Z;  1FYK A;  2M7B A;  3UKG A;  1IRX A;  2E1O A;  4KUM A;  3PUB A;  1D0Y A;  1IN4 A;  3M3Y J;  5B1A H;  1DPR A;  1G2H A;  2R7D A;  4A12 A;  1GVJ A;  2HXO A;  4ENJ A;  3CMY A;  2DFI A;  2VN2 A;  5DCF A;  1ETO A;  2R5Z B;  1E17 A;  2R5Y A;  2MC3 A;  2FF4 A;  1SMT A;  4HQE A;  2XRO A;  2JPB A;  1OFC X;  5L3D A;  3RYR A;  2FU4 A;  4A3J J;  1KYZ A;  4ZYG A;  3CCM I;  1LDJ A;  2IXS A;  3VYT B;  4HX7 A;  2F5D A;  3QPS A;  2GZW A;  3F8B A;  4M71 A;  5A2Q K;  1LFB A;  3WGI A;  3O3K A;  5CVV A;  1A04 A;  3LMM A;  4Q4Z F;  2JA8 J;  1WFX A;  2XGD A;  4PJL A;  4L9V A;  3OYE A;  3HOT A;  4HPQ A;  1VQ7 I;  2FNA A;  3BQZ A;  2KIQ A;  1TQM A;  3BG6 A;  5JVT A;  2KRC A;  3QOD A;  4FX0 A;  2WB1 A;  3QOE A;  5GAE J;  3HHG A;  1X2M A;  4FET A;  1M1E B;  3R4K A;  1U8B A;  1I50 J;  4E7S A;  1J5Y A;  4PUS A;  1TW3 A;  2DYS H;  1F36 A;  3S1N J;  5TJJ A;  2E35 A;  4Y52 J;  1MBF A;  2V1U A;  5KK1 A;  1NK2 P;  3KP4 A;  3KLO A;  3MVP A;  4X0G A;  2DFE A;  2EZL A;  3OIQ A;  1UG0 A;  4U7B A;  4YEL A;  2HQ5 A;  2XB5 A;  1LFP A;  3BTL A;  3FK6 A;  4KA4 A;  4DYR A;  4IOA F;  2NRA C;  3I4N J;  1R36 A;  2M8G X;  1IDY A;  2P81 A;  2LSO A;  2KIS A;  1O3S A;  2O3F A;  3GYH X;  2HXI A;  1VI0 A;  5ERI A;  4CA0 A;  2OTJ I;  2EFN A;  3MMY B;  1ZN2 A;  3AG2 H;  3AL0 B;  1U78 A;  4IVN A;  2R92 J;  2UXX A;  3JRH A;  3LAJ A;  5ED4 A;  2G0E A;  1FNN A;  1Z91 A;  1BI3 A;  2W57 A;  3HPH A;  2N8G A;  4E7I A;  2EWN A;  1UST A;  1TZL A;  3QP5 A;  3ZQH A;  2DLL A;  3G1O A;  2E1N A;  2IS1 A;  4CSW A;  1G4D A;  2PJR B;  2R7U A;  1YJ9 I;  1A6I A;  2NAZ A;  2VPL A;  1SD7 A;  2VBY A;  1O57 A;  4LFU A;  3VEP A;  4BYY A;  5LEJ A;  1IN7 A;  1U9O A;  2DQR A;  1W1W E;  1S8N A;  4DBQ A;  2I10 A;  3FXQ A;  4UNO A;  3B02 A;  1KYW A;  2OC6 A;  1YYV A;  5IOY A;  4KT6 A;  1JKO C;  3FXU A;  2K9M A;  3FXJ A;  3PM1 A;  4ON0 A;  1WJB A;  4M72 A;  2LK2 A;  1OKR A;  3DEW A;  3K10 A;  3QPL A;  2XRL A;  3M1C A;  3ERM A;  4ESF A;  3HSF A;  1AOY A;  2YU3 A;  3A0B C;  4PGH A;  3FBN B;  3U9G A;  1VZ0 A;  3OR1 C;  3RPU A;  1LEA A;  5J4Y A;  2VC1 A;  1YO5 C;  2W24 A;  2EV6 A;  4IQ4 A;  4D1Q A;  2XGE A;  1IDZ A;  5K7H A;  3ZMD A;  4EM1 A;  2FBI A;  5C3E J;  1X1B A;  1AWC A;  2Z99 A;  5H6Q A;  4EAT A;  2I5U A;  3DV8 A;  3BOQ A;  1WJE A;  5FKL A;  1BM9 A;  1JGS A;  2Y9Z A;  2CV1 A;  2VOD A;  1PJR A;  3TOA A;  1OCR H;  2CQN A;  1B8I A;  1U6G A;  1MIJ A;  2OF7 A;  4KIC A;  3RPQ A;  2JN6 A;  2QA4 I;  4BQN A;  3P5J A;  1OYW A;  1W0T A;  1YX3 A;  3ECH A;  4OMY A;  1FJL A;  2H1K A;  1QZE A;  2KIU A;  4KIS A;  3W2W A;  3C1D A;  1D3Y A;  5CYV A;  1D0Z A;  4IPA A;  2JA2 A;  2P7V B;  5FFX A;  1RR8 C;  1XMK A;  3BCB A;  3KFW X;  3SDB A;  4XL9 A;  2BBY A;  2K9L A;  3K2A A;  3DKW A;  3OR2 C;  1VF9 A;  4IXA A;  4MHG A;  1YHQ I;  5IYC J;  3BZK A;  3GTL J;  3CTA A;  3LSH A;  5CKT A;  3JSP A;  4CUG A;  1SFE A;  4L9N A;  3WTW C;  1RC9 A;  2W25 A;  4A93 J;  1WJC A;  4H4K C;  2Y0S N;  3KEY A;  1H89 C;  3HRS A;  3RJP A;  4EQQ A;  1IJW C;  1ZQ3 P;  2FXA A;  3KZZ A;  3S8P A;  5TIS C;  2NNN A;  2HI3 A;  3R0A A;  2ZSI B;  3QU3 A;  5B3S H;  3IH4 A;  3DKX A;  2CRG A;  1YS7 A;  3CC4 I;  2MSY A;  1F43 A;  4CCM A;  4B1R A;  2W00 A;  3C3W A;  3I59 A;  4C9Y A;  1BJA A;  2STT A;  4F93 B;  1T33 A;  3ZR8 X;  2MAB A;  3FKJ A;  1BR2 A;  1MH4 A;  2JRM A;  4PSW A;  2Y0M A;  2WBM A;  3QYF A;  2ZKZ A;  5FLV A;  4DIQ A;  5HNF A;  1WCM J;  2AXT C;  3LSI A;  1N77 A;  1P4X A;  2CO5 A;  5ICG A;  2VAS A;  3BDD A;  3I9V 2;  1LDD A;  2Z5U A;  1YTY A;  2YU9 J;  3FKI J;  2F5C A;  2NVX J;  2XAG A;  1ZRD A;  3ZPL A;  2DDA A;  2OD5 A;  1R6R A;  2XGC A;  1K61 A;  5D8K B;  2TDX A;  2NS0 A;  1G3W A;  4YIF A;  5L3F A;  3I5U A;  4D9J A;  3LQQ A;  1BA5 A;  4DW6 A;  4AWX B;  4PDK A;  4CCL A;  1BR1 A;  5B1B H;  5E20 A;  1H8A C;  5CVJ A; 
#chains in the Genus database with same CATH homology
 2R7S A;  3DWL E;  4XN0 A;  1W36 D;  1MNE A;  3OY9 A;  2BVL A;  3DTI A;  2JUG A;  4XLH A;  4BDY A;  3ZRG A;  5HOO A;  2JSP A;  4II2 A;  2F5V A;  1G8X A;  2RRE A;  4XN3 A;  4KIT B;  2LBF A;  3VYS B;  3KYL A;  5FRM A;  2BW3 A;  3OS1 A;  4LIU A;  2VJ5 A;  2VL8 A;  3LSM A;  3H9J A;  4MLO A;  2MYS A;  3C2H A;  3S3N A;  3EPZ A;  3F9K A;  3G2B A;  2LY2 A;  3TL4 X;  2CV2 A;  3DQV C;  4P1W A;  4BJT A;  3OIP A;  2ZXI A;  4ZTJ A;  2BVM A;  2KL4 A;  2XF6 A;  2HVS A;  1BR4 A;  2LOO A;  3HUG B;  2MFZ A;  4XR6 A;  2ELJ A;  3OS2 A;  4IKF A;  4F55 A;  3CES A;  2L9S A;  3PNV A;  2Z1D A;  4YRV A;  4HNT A;  4XMY A;  4BU2 A;  2UV1 A;  3W3C A;  2X6X A;  5KHD A;  3PJR A;  1WJF A;  2OV7 A;  1LVK A;  2HVQ A;  2M4G A;  3W2V A;  2K3P A;  2KLO A;  3TBI A;  4RM3 A;  2XF5 A;  1FMV A;  4ITV A;  2VJJ A;  2IGO A;  2ZXH A;  4E7L A;  3FHN A;  4RLF A;  3ZXS A;  3HPG A;  2CFO A;  2F6C A;  1X19 A;  3IAS 2;  3DEE A;  3K4B A;  2R7Q A;  3S3O A;  2X6W A;  3H5R A;  4N4N B;  1WJA A;  2MC4 A;  1K6Y A;  2L7K A;  3OYG A;  2KDO A;  5KNL A;  4OWR B;  4ZYA A;  2VXD A;  1MND A;  2WY8 Q;  3PFY A;  2Q1Z B;  2VB6 A;  4E7Z A;  4G6T B;  2VXZ A;  4RLQ A;  1YX5 A;  3H0D A;  1E0E A;  2E5N A;  2HPM A;  5HLT A;  1NG6 A;  4BQO A;  4HNU A;  3IUO A;  2M0M A;  4AVZ A;  4BE1 A;  2F4I A;  5KCM A;  3OWT A;  5HVQ C;  2XF7 A;  3MD2 A;  4XKV A;  4J00 A;  3OYH A;  1UAA A;  2M7A A;  1Z7L A;  2IGK A;  1DP3 A;  1PYV A;  5FRO A;  2CW8 A;  2BOL A;  4ZTF A;  4ZJZ A;  1X4P A;  2VKD A;  3PL8 A;  4OAZ A;  2HU9 A;  1QU3 A;  2DJI A;  2WAD A;  2IGN A;  3RPU D;  2VLA A;  2M4K A;  3OYI A;  5HNH A;  1KON A;  4NUB A;  3DTK A;  4B47 A;  2R7W A;  3W2A A;  2R7V A;  3LL7 A;  2A5W A;  2WAQ A;  3BCA A;  3CP2 A;  2WA0 A;  2HVR A;  3M8J A;  1N75 A;  4HSR A;  4PFO A;  3OYM A;  4LIV A;  2KP6 A;  3J7A Y;  2CUJ A;  3CJR B;  1QHH D;  2E1M C;  2X85 A;  5CPR B;  4ZC3 A;  2DCE A;  3PNT A;  3H5A A;  3MKZ A;  4BGD A;  2LYC A;  5LFA A;  3HC7 A;  2V7F A;  3QYE A;  3H35 A;  5TGT A;  4P5O A;  2Q2E B;  4CCK A;  2XC7 A;  1Z21 A;  2LBF B;  4RM2 A;  3OS0 A;  2RNG A;  3OYL A;  1V5F A;  2BW3 B;  4BQQ A;  1Y56 A;  2HZD A;  2WAF A;  2L9N A;  4B43 A;  3L2R A;  3LSG A;  3ZGK A;  5LD2 C;  2HNH A;  3OYF A;  4ZDL A;  3OYJ A;  2LY1 A;  3K4J A;  4NNJ A;  2E1M B;  4ZDP A;  3EUH C;  1ERD A;  2CW7 A;  2I8D A;  4XOT A;  3A4C A;  4NC8 A;  4JOM A;  2GOX B;  3DTE A;  3FDY A;  2VQG A;  2X6Y A;  3HL2 A;  3L2V A;  2CUZ A;  4XQF A;  3K4L A;  2X1D A;  2RQQ A;  2CV0 A;  2L2O A;  2PJR A;  4CCJ A;  2DT6 A;  3BC8 A;  3CF2 A;  4J01 A;  1T0F C;  1ZEL A;  2HDW A;  3DPU A;  1P9Q C;  1U0J A;  4QPO A;  4PFP A;  2R7R A;  3OYN A;  3VYU B;  4XKC A;  1MMG A;  3VSL A;  3OYD A;  4E7J A;  3SYT A;  3RTR A;  1D1C A;  1TT0 A;  2X1C A;  4C30 A;  3OYC A;  2ZSH B;  1AA7 A;  3PSI A;  3SZG A;  2QKM B;  3K4K A;  2VQL A;  3A1Y A;  3L2W A;  4IZZ A;  1SAU A;  4F52 A;  2VQC A;  4AU7 A;  1HA8 A;  3K70 C;  3QYB A;  4BDZ A;  3IAM 2;  3S3M A;  2R7O A;  1FMW A;  2A6T A;  4Y33 A;  1GLN A;  2M7B A;  1IRX A;  1Z3X A;  3N05 A;  2IS4 A;  3PUB A;  1D0Y A;  2VQH A;  4BEH A;  1DGW Y;  1Z3Y A;  1DGR M;  2KQR A;  4XNF A;  3MKW B;  4NC7 A;  3DLA A;  2W1O A;  4E7K A;  4XON A;  2JVH A;  4OAY A;  3UR3 C;  4IQJ A;  4B48 A;  1WJD A;  5JHF A;  4HEA 2;  4CCN A;  1V5E A;  4Y3O A;  2IXS A;  3VYT B;  4BS9 A;  2XDV A;  2DOA A;  4F92 B;  2VJ4 A;  3D5R C;  2Y0S A;  3DPT A;  4B3X A;  3LMM A;  2XAU A;  4CZC A;  2HPI A;  4BUP A;  3HOS A;  4JQF A;  3BG7 A;  1WFX A;  4PJL A;  3H5N A;  3OYE A;  1X1D A;  3HOT A;  4HPQ A;  3PSF A;  3AFH A;  1UEL B;  3BG6 A;  2KRC A;  3K4M A;  3QOD A;  2WB1 A;  3QOE A;  1N78 A;  3OL3 A;  1MMA A;  4FET A;  2HQA A;  4XLC A;  4E7S A;  4PUS A;  3CJQ B;  3K4N A;  2P0W A;  1YE9 A;  2X51 A;  4X0G A;  3TMO A;  3OIQ A;  4XLE A;  1UG0 A;  4F3Q A;  4XLA A;  4IX7 A;  4U7B A;  4YEL A;  1LFP A;  4PJN A;  2OUM A;  2Z16 A;  5CQG A;  1WJ5 A;  2UUZ A;  3EUA A;  2IS6 A;  2KPM A;  1EA3 A;  4XOP A;  4NQW B;  3SEZ A;  1S9H A;  3D5L A;  2AQF A;  4CA0 A;  3MMY B;  3OL4 A;  3KX2 A;  2V1N A;  3AL0 B;  3HXL A;  2LC2 A;  4PJM A;  4PK4 A;  1X1A A;  2FUG 2;  1NG7 A;  1OR7 C;  2K5C A;  3HPH A;  3RCO A;  3RQ4 A;  4E7I A;  1TZL A;  4BAC A;  3C2G A;  4XLF A;  4AYB A;  2IS1 A;  4CSW A;  4BL0 B;  2PJR B;  4C2U A;  2R7U A;  1T95 A;  1LKX A;  2VPL A;  2IGM A;  1D0X A;  4QPQ A;  2KRH A;  3LSK A;  3BLY A;  4DBQ A;  3K70 D;  3CZ6 A;  1X4O A;  4PJJ A;  3H9G A;  2OC6 A;  2LRE A;  2UWM A;  3OYA A;  4KT6 A;  2PMZ A;  3VSK A;  2VIX A;  4ZDO A;  2K9M A;  1BOB A;  1WJB A;  4B44 A;  4XKB A;  3L2Q A;  2QKL B;  3K10 A;  3LFU A;  4GRI A;  2IS2 A;  3M1C A;  1W36 C;  2WAE A;  3E0J B;  1V5G A;  3S32 A;  1DQU A;  1G59 A;  3CP8 A;  2JVG A;  3FBN B;  3DPL C;  3K4C A;  4HG2 A;  1VZ0 A;  3OR1 C;  5FRN A;  3UNG C;  1MMN A;  1SFK A;  4N4O B;  4LG3 A;  4BXF A;  1X1C A;  2KMU A;  4IQ4 A;  4D1Q A;  4RMN A;  2CMP A;  2W7N A;  1X1B A;  2XSJ C;  3ONQ A;  3GBG A;  3HKZ A;  2W4S A;  4EAT A;  2CV1 A;  1WJE A;  4BEH B;  3ZQQ A;  4LIT A;  1PJR A;  4Y4R A;  2LH9 A;  3NWS A;  2VJI A;  2W82 A;  4XOR A;  4DGW B;  2L5Q A;  3D5S C;  3OMY A;  4BE2 A;  2ZFU A;  4BQN A;  2V6E A;  4F91 B;  4CCO A;  1YX3 A;  2V9K A;  4HST A;  4KIS A;  3DU5 A;  1LDK B;  3W2W A;  2O5R A;  3MKY B;  1D0Z A;  3PNY A;  2JA2 A;  3FBI B;  3OYK A;  3BCB A;  3SDB A;  4XL9 A;  2K9L A;  4KJZ A;  4FAS D;  3OR2 C;  3OOU A;  2WY7 Q;  3S93 A;  3L2U A;  2E60 A;  2LG4 A;  2M3A A;  3V42 A;  3I3L A;  3H9Q A;  3LSH A;  5CKT A;  1OLT A;  2CH0 A;  3E1S A;  2DT7 B;  3HG9 A;  4CUG A;  3U21 A;  2GOM A;  2Z2S B;  1WJC A;  3DKY A;  4H4K C;  5CQE A;  3KEY A;  3RSN A;  3ZCO A;  4DOZ A;  3S8P A;  3SEQ A;  2R7X A;  1D1B A;  3DU6 A;  4E7H A;  2ZSI B;  4II3 A;  4HRI A;  3A2K A;  3DKX A;  2R7T A;  2DXI A;  1J09 A;  4BJ5 C;  4CCM A;  2W00 A;  1Y6I A;  4C9Y A;  2LRD A;  3CMM A;  4F93 B;  3ZR8 X;  2MAB A;  3FKJ A;  1BR2 A;  4PSW A;  3AKZ A;  4XM3 A;  3NWT A;  4DBR A;  3VWB A;  3AL0 C;  2WBM A;  3QYF A;  4E4H A;  2KHM A;  3K6G A;  4PSX A;  4DJA A;  4DIQ A;  1JI8 A;  5HNF A;  4U87 A;  3LSI A;  1N77 A;  3IP4 B;  2V4J C;  3OYB A;  2VKH A;  4ANJ A;  2MD0 A;  4E6K G;  4R79 A;  2VAS A;  2NOJ B;  3I9V 2;  2AQE A;  1MW7 A;  2X1E A;  1R6R A;  2E5Z A;  3VYR B;  2V26 A;  4CH7 A;  2CS3 A;  1D1A A;  4XKW A;  4YEJ A;  4D9J A;  2R4G A;  3EUK L;  1QHG A;  1MMD A;  4CCL A;  3VDX A;  4BE0 A;  4BJ6 C;  1BR1 A;  4C2T A;  2KZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...