5DM6F

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
144
structure length
144
Chain Sequence
MRRVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5dm6F02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5dm6F01
3J7ZI 2JQ7A 1YI2I 3I55I 1VQOI 1YJNI 2NXNB 2E35A 3CJRB 1FOXA 3DLLF 3CC2I 1S72I 1FOWA 3CF5F 3CCVI 1WIBA 5JVGF 3CMAI 2ZJRF 3CMEI 1Y39A 1YJWI 3G4SI 2E34A 1QA6A 1VQPI 2FOWA 2QA4I 3CCMI 3CCRI 2E36A 2H8WA 1VQ7I 1YITI 1HC8A 2QEXI 4V19K 5GAGJ 3CC7I 5GAHJ 1VQ9I 3CD6I 3G6EI 1VQMI 3PIPF 4UY8I 1VQ4I 1YHQI 2OTJI 2K3FA 4IOCF 3PIOF 1VQLI 3CCQI 2OTLI 4IOAF 5GAEJ 1VQKI 5DM7F 3G71I 1VQNI 1VQ5I 3CCSI 3CJTB 1VQ6I 1MMSA 1YJ9I 5DM6F 3EGVB 3CJQB 2ZJQF 4IO9F 3CJSB 3CC4I 5GADJ 3J7YJ 1VQ8I 1FOYA 2ZJPF 3CCUI 3CCLI 1ACIA 3I56I 1YIJI 3CCJI 3CCEI
chains in the Genus database with same CATH superfamily
1FTZA 3DPLC 2OPTA 3H36A 2P6TA 3U1DA 4BXXJ 4B4CA 4D7MA 3GX4X 3CO7C 4A2UA 1G3SA 2W00A 2XKOA 3HB9A 1BN5A 2X48A 3L09A 4YIIA 4X0GA 5LHHA 3F23A 4XK4A 1MMDA 2LKXA 1HW5A 1X2MA 2NXNB 4BY7J 2KZGA 1MH4A 3DLLF 2F48A 1F1ZA 3WTVC 1E0EA 1YLFA 3W6KB 3OYLA 4RMNA 1LFUP 2BE5F 3FXKA 2LYCA 2M9HA 2Z1DA 3S15J 1XGNA 1X3ZB 2V9PA 4PCQA 5ICCA 2HQAA 2DMUA 2TRTA 3BR0A 4MHGA 4HLXA 2E7WA 4HX4A 1Y8RB 3CMEI 2X51A 3BY6A 3HOXJ 2B63J 2DDBA 4AYBA 2ESNA 1OCZH 2JPCA 2JJ7A 5L3DA 1XN7A 5D5UB 3S93A 1ZR2A 4DZPA 2L9SA 4FX0A 3LSMA 5BPDA 1QU3A 4KIGA 1NK3P 3FXJA 5D5WB 1MD0A 2M7AA 4L5EA 3KLNA 4UUTA 5IYCJ 9ANTA 3PUBA 1FYLA 2BGCA 1VQMI 2LBFA 1S8NA 1O3RA 3HHHA 1F36A 4AYBN 2VT2A 5EEHA 1GVDA 1P4XA 3DP7A 4I6ZA 3KCCA 2XROA 3ZMTA 3BR2A 2QF7A 2AS5F 1XG1A 2IAIA 2CV0A 2QSFX 3OWTA 1O57A 1WQ2A 2L4AA 3QODA 1TNTA 1W0TA 1GLNA 2LKSA 3K4LA 3RI4A 3GZ6A 5IT9K 3LA7A 2CQKA 3ABMH 4PSXA 2M4KA 3RIRA 2RNJA 3O8GA 1HA8A 2DT5A 3WTSC 2KJCA 2BEOA 1G4DA 2CV1A 1F9NA 3C2BA 4XR6A 2HYFA 4S04A 3CCYA 1IUFA 2P8TA 2M5WA 5IP9J 4CA0A 3I59A 4JOMA 2EZIA 2HXIA 5J6XA 3OYMA 3MKYB 1VQ8I 2ME6A 3OOUA 4UUSB 3JRDA 4UV9A 2DQRA 2LY2A 3S2HJ 1FBUA 2MD5A 2FU4A 4B48A 4KFCA 3BDDA 2MYSA 4KICA 3K69A 1VQOI 3CO6C 3FXOA 2M7BA 2H27A 2BW3A 5KCMA 4HQEA 5TRDA 5IYDJ 3RQIA 2ISZA 3BG6A 3DTIA 4I99C 3SZTA 3ECOA 3OR1C 2BZTA 3H5NA 1V54H 2E2IJ 5HS9A 1SMYF 1JE8A 4WXDA 2PMZA 4MNUA 1T8IA 3AKZA 3W6VA 1WJ5A 2FA5A 3LSKA 2LREA 4MFEA 1ZYRF 4AC0A 5BOXA 3PSFA 1Y39A 1S7EA 3I5UA 3CDLA 2R5YA 2LVSA 4Y52J 2LOOA 1RKTA 3HZJA 1PUFA 1FIPA 4BH9A 3RJPA 4EJUA 2MW8A 2QA4I 2DOEA 3CCRI 2FX0A 1CF7B 4AM3A 2VBZA 5FD6A 3EUHC 4AIJA 3WU0A 4R1HA 2PMZN 3CUQC 4LLLA 5LEJA 1SFEA 2O8XA 4MLOA 1TW3A 2OV7A 2OZUA 2L7MP 2BHZA 4RB2C 2R7ZJ 2XF5A 5IYBJ 1A04A 1I27A 4J19A 5C4XJ 1JUSA 1SD7A 1SFOJ 3BTIA 3MWMA 4IHTA 2G7UA 1RRJA 3ZMDA 5CVUA 1U6GA 2K85A 5JLWA 2QCOA 5BS6A 1ONVA 2A05A 3VSLA 5CPRB 1FYKA 1Z7LA 1FSEA 3GTPJ 1Y6IA 2V1NA 2LFBA 2EWNA 3HG9A 5E3OA 1LFPA 2WV0A 4JBAA 5TGTA 1VQ5I 1Y0NA 1YIOA 4IL6C 5H20A 3Q5FA 2DPUA 4NB5A 1I39A 3BJOA 3FXMA 2DJIA 2HU9A 4YFKF 1ZGWA 4Y13A 1D5VA 2VN2A 2OF7A 4O3MA 2JTVA 2M1BA 2MD0A 3OYEA 4EM0B 4W1UA 4M3DA 1JXSA 2KFDA 1MMSA 3DEEA 5F0FA 1S6LA 5J47A 2ZJQF 3GYHX 3FXLA 2KMUA 4A5MA 2XGEA 3DFGA 4IX7A 2O7OA 3F3XA 5E79C 1FSHA 4NQWB 2AXTC 3PUFA 2EILH 4V2GA 5M5WJ 2CSOA 1IV8A 1S7OA 2N8GA 3F8BA 4HYEA 1TC3C 4P1WA 1OCRH 4GYGA 3I54A 1V5FA 2OBPA 1J0RA 3BCAA 4JK1X 1UAAA 1XSDA 2AHQA 1RESA 5K5RA 4CICA 1MMGA 2O03A 1MJBA 1FWZA 3HTSB 4WF2A 1Q1VA 2K9MA 4XL9A 3TP0A 1WGXA 5J8FA 2FOKA 3GMEA 4R8HA 4CCOA 1EF4A 4NDLA 2P6SA 4HSRA 2V9KA 2FE3A 4PJ0C 3RZDJ 2H1KA 3FIWA 3GTGJ 4W97A 5E3MA 3D1NI 5BQTA 1IRXA 3LSTA 1T33A 2K40A 2DK8A 4L9VA 1DGWY 2G0EA 5F04A 3A4CA 4ZYHA 2HOAA 3U1KA 2VUMJ 1KQ8A 2HQRA 3SDBA 4HF0A 5B66C 3L2QA 1I3QJ 1RR8C 2FSWA 4WXCA 1JI8A 2JUGA 4OAZA 3DEWA 1IN5A 1ETXA 1R49A 4RAGA 3JSPA 1HW2A 2K27A 2JA2A 4LJZF 3TO9A 1MZBA 1YRNA 3VPRA 1S5LC 4EEFG 1XMKA 4Y33A 2E71A 3MAJA 3B6CA 1YITI 1JJ6C 1FT9A 4P96A 1FX7A 1HF0A 2XAQA 3H92A 5GP9A 1W36D 2GXAA 2D1VA 3K1PA 3S3NA 1FC3A 2M34A 2H1LA 4XLHA 3HYIA 1QZYA 3GFLA 2RGVA 5L3CA 3D0SA 2VXDA 3EETA 1IGNA 3BT9A 4A3DJ 3RTRA 1AA7A 2KDZA 4G6DA 2MG4A 3G3ZA 5KAFC 4L5JA 2DW4A 2HEOA 1WJDA 3RKXA 3J81Z 3BC8A 3QQAA 4IVNA 3H9GA 4BXFA 1PYVA 2RQQA 2LK2A 3Q9VA 2HYJA 3PO2J 2A3SA 4B3XA 4ENMA 2RKHA 3CCSI 3GF2A 3QYFA 2VJIA 2HDCA 4PJJA 2EFWA 3LFKA 4ZZDA 4F91B 2MC4A 4M9XA 4I2OA 2VONA 2NS8A 3JRCA 5C3EJ 3ZQGA 2HZDA 2DFEA 4RGSA 2DOAA 2ADUA 2FUG2 5C44J 2V7FA 1SD4A 3T5XA 2F6CA 4DJAA 2UUZA 3VODA 1Z9CA 2DOFA 4BQQA 3HUGB 1OMIA 4G9YA 1RUNA 4HDVA 3HGGA 4XN0A 5ICFA 4QSHA 3AG2H 3NWTA 1KYZA 1ETYA 4LK1F 1IUYA 4CYCB 2ZJPF 3HBLA 3CESA 2X6YA 4XN3A 2GWRA 3SXYA 2MABA 2JSCA 3HSFA 2VBWA 2ZSIB 1XGSA 3K70C 3P5JA 1DQUA 1W5TA 4EATA 5B3SH 3Q0UA 2HKXA 1SFKA 4L18B 3WE2A 3GZ5A 3PQJA 3Q9SA 2VASA 4WXHA 1ZGJA 4PSWA 3HRUA 3ZQFA 4IHYA 2KT0A 2A5WA 4ABZA 4EJWA 1FPQA 1NK2P 4HX8A 2HVRA 3WE3A 3SDGA 3CC2I 2X1CA 1P4WA 2RREA 3LSRA 4U87A 4OU0A 2JT1A 1XB4A 4IRHA 5FKLA 4BE0A 3KZZA 1B4AA 1SVMA 2PQ8A 3WGGA 4Q48A 2LF7A 2VOOA 4CCMA 3HOYJ 2YU3A 4KYWA 2I10A 2UZKA 1RNLA 2ZJRF 3TW7A 1VQPI 1DP7P 1P92A 4IRIA 1TW2A 3VYUB 2HOTA 3CMMA 4JX4A 5K5QA 1Y1VJ 2Y31A 4EGZA 1ZAOA 3GO5A 3K9TA 1P7JA 3F6VA 3PQKA 2HOSA 3GFMA 5IOYA 4IQJA 3ISPA 4BS9A 1UFMA 2L7FP 5BMZA 3AL0C 3EUHA 4A12A 3K0LA 1VQ9I 3ZMUA 1GT0C 3CUQA 2GXGA 3F8MA 1BOAA 3HHGA 5ICGA 2Y0SA 2CUJA 2KISA 1Q1HA 4M3FA 3E7LA 4E4HA 3MKLA 3QYBA 1TT0A 1JHHA 4EJVA 3WTYC 3ERED 5L3EA 2BV6A 3FKIJ 5LHIA 2QKLB 2GBYA 3HPHA 2FMLA 4KDPA 2BHYA 3COAC 1R58A 2OAZA 1AKHA 1TLHB 5HNFA 2GZWA 4U7DA 2BXYA 1W7PA 3KP3A 5D6FA 4IPAA 1Y0UA 4JP0A 3G1OA 3PFIA 3N4MA 1R36A 3FM5A 2DXIA 3J80Z 1I50J 2L2OA 1J09A 2WY8Q 1UJ8A 4RLQA 2NNYA 2GM4A 1T38A 1EH8A 1ZARA 2CUFA 2FF4A 3IUOA 3OV8A 2DODA 4C9YA 1J75A 1HCRA 3HDDA 1SVOA 2FEZA 3CF2A 3OYBA 3P9CA 1BJAA 4N9HA 1ENHA 4KT6A 4KN7X 5EG0B 1YTYA 5DUIA 3ERMA 4PFOA 1WH7A 1IO2A 2R7DA 5E18F 4MFDA 3IV5A 2JRTA 4LMYA 1A6IA 2F5DA 3WTZA 4HF2A 4WK8F 3JR9A 1J5YA 4UVCA 1HW1A 3ABUA 3BOQA 3I56I 2FXAA 4HLYA 4JQFA 2VC0A 1I1SA 1E3PA 4MIMA 3GFIA 2A68F 2DA5A 3OMYA 3KYDB 4MTEA 4RGRA 1ETVA 1MNMC 4WX9A 3HKZA 3K4KA 1G59A 2KZVA 1PP8F 2CW7A 3WTWC 1VZ0A 2R7SA 2QWWA 2Z3YA 3WGIA 4G7OF 3TW6A 1XD7A 2ZMEB 4Z2YA 5K7ZA 1ZG1A 2RV8A 2HVSA 5L3BA 3BQYA 3LL7A 1K79A 2ECCA 4RAFA 3K4JA 3RCOA 1AWCA 2IS2A 3ESWB 2ZC2A 1R5ID 2VJJA 1AOYA 4A3IJ 3RPUD 4XKVA 1WPKA 2WAQA 4D1QA 1OCOH 4A3LJ 4G8XA 4BBRJ 4ZH4F 3CCMI 2KKOA 4XSZF 2HNHA 3BQZA 4ENJA 1I6XA 3LAJA 5DUKA 2DA3A 4Y15A 2HOEA 5LFAA 1IV6A 5DD8A 1V4RA 4IXAA 3J81K 1MBGA 5J1RA 3JTGA 1USSA 3BROA 1U2WA 4J00A 3FKJA 3G6EI 4KA4A 3R0AA 1R71A 3WHBA 4E7LA 2WAQN 3HIFA 2W25A 3DTKA 3BZKA 2ESHA 2BYVE 3UR3C 2XASA 1X1CA 5ED4A 4BYYA 3WODF 1LQ1A 5DD4A 1B59A 2ID3A 2ZXHA 2HDDA 2YS9A 1CGPA 4N4NB 3VYSB 2KJBA 4LG0A 3S1MJ 2K9SA 4P9UA 2MC3A 4J01A 3RPQA 4Y7NJ 2VQLA 3I4NJ 2HFHA 2DFHA 2X1EA 5DM7F 1D0YA 2F5EA 3FXRA 3T0YA 1VQNI 3BR3A 2FBIA 1I5ZA 1A36A 3M1CA 3OYAA 2LBFB 1XX5A 1TP4A 3FWEA 3KE2A 4AU7A 4X6AJ 2CMPA 3MZHA 4NC8A 3CDIA 1X1PA 2Y69H 4I76A 3CTAA 4M3EA 4U0VA 3VOEA 4ESFA 4G12A 2OA4A 3JRFA 3ZP5A 1LVKA 2DYRH 3EGVB 5LGTA 5EJCA 3CP8A 3OIOA 2DTRA 3ZCOA 2PX9A 4XLPF 1ETWA 3BPXA 4M9SA 3TQNA 5CVJA 4XLNF 3OYIA 1SD5A 2ZKZA 1HKQA 1VFCA 4XKWA 1MDMA 2HYGD 3C3WA 3M4OJ 2P7CB 1HKTA 1Y56A 1OYYA 3G73A 2HS5A 1WSUA 1JTYA 1I3AA 3GVAA 1YJNI 1W4MA 4E7IA 2RNGA 2Y2ZA 4DZJA 3S14J 3I59B 4FE7A 1YW9A 4C2MJ 4II3A 3H5RA 4L9TA 5F6FA 3E3VA 4L9NA 4NNJA 5H6RA 2KLOA 2DK5A 4CYDA 2XAJA 3ONQA 1WIBA 5EGOA 4AUXA 2RAEA 3EDPA 5FO5A 5CLSA 1WI3A 2M87A 2LLKA 2E7XA 1P7IA 2X9DA 3IRRA 3D5RC 1SEUA 1H0MA 4XRSG 3FF5A 4KNYA 1H8AC 5FKNA 2K86A 3H0GJ 3V8JA 2KIQA 2JPBA 1B9NA 2XGCA 4BJ6C 4IHVA 2BW3B 3K7AJ 1EJ9A 2OCCH 2OD5A 5GTHC 5HOOA 1QGPA 1KA8A 2M30A 2NYXA 3KEQA 2XKPA 3S8PA 4UVAA 3LNQA 3CD6I 4IEJA 1E17A 1H89C 4OIPF 4FT8A 3LAPA 3KLOA 2MH2A 4XORA 4A6EA 3DQVC 3V8KA 2NVYJ 1YHQI 1QVTA 1D0ZA 2E1NA 1MJAA 4NC7A 2ELJA 1D1CA 3J80K 2R7RA 2R5YB 2AO9A 2Y9YA 1R1UA 3HRMA 3HPGA 2MBFA 1PUFB 2HQ5A 3FXUA 2PLYA 1IN4A 5CVRA 3U2RA 1P6RA 1BW6A 2A6HF 2DJNA 2R7VA 1MSEC 1R1VA 4ZDPA 2XSJC 2GAUA 5ILSA 3G71I 3KYLA 2P7VB 3OYGA 1UHSA 3IL2A 4XONA 1ORKA 5HLIA 1AU7A 1NG7A 2HDWA 3E5QA 3AFHA 5BPIA 2GLOA 1HXDA 4FETA 1X1BA 1HOMA 3EYYA 3IKVA 4HX7A 1X3UA 5LLQA 5KHDA 2RVCA 2FQ4A 2P81A 3F9KA 1T0FA 3JRBA 2HXOA 3LSIA 3EUKL 1QZZA 3QPTA 2V1XA 3OYDA 5CQGA 2IBDA 3LQRA 2KL4A 1SFXA 4G6QA 5HLTA 3P9IA 2CFOA 4TV7A 5AIQA 2PBIA 2VE9A 3B02A 2VT3A 3DCFA 2VE8A 3CCLI 1MGTA 1R4NB 2D2WA 3R0JA 3W6JB 1O3TA 3GW2A 4JX5A 3TOBA 2L7KA 2DBBA 2KIUA 1AHDP 3OYJA 2RC4A 2OQGA 2DTZA 4PFPA 3ZQLA 3HRTA 5BNGA 2YX4A 1A35A 3S3MA 2VI6A 2HVQA 5JR3A 1LDJA 1F43A 2DLLA 1WI9A 4PGHA 1BI1A 4MQVA 4EJTA 1S72I 4FHTA 1KU9A 2IVMA 2OZ6A 2ZXIA 4DBQA 5LD2C 4YG2F 4A0XA 1WJBA 2ELKA 3FBNB 2Q2EA 3H3ZA 1B6AA 4D0PA 2BY2A 2FD5A 5HNHA 1UELB 1N77A 3K2ZA 2AQFA 3B6AA 1P2FA 3CLOA 2YR2A 4P9FA 2UWMA 4UV8A 4RS8A 3DLAA 1TNSA 5M3MJ 4IF4A 2KRCA 2UV1A 1OCTC 1DU6A 1GHCA 4IJAA 4MEYF 1JHFA 3OIPA 3I4PA 4DQ2A 3OYCA 3PIPF 2VKEA 2EV6A 2QSHX 4ANJA 2E5NA 3ABLH 1JKPC 2CYYA 3REOA 2WY7Q 5CKTA 3KPHA 3OL3A 3HOZJ 3O6BB 4Q4ZF 2LY1A 5CQEA 2WAEA 2KQRA 3MKWB 4EGYA 1YRNB 1BA5A 2EIKH 1KQ0A 1XDUA 3W2VA 4BDYA 1XGMA 3FDYA 5B1BH 2XPVA 4DYRA 2F5CA 1ZHFA 1K6YA 3V42A 2DDAA 2ZJ2A 2VPRA 2Z16A 2LTPA 1OKRA 3N05A 2VL8A 2IS1A 3E97A 3S2WA 4OIOF 4XLCA 1FNNA 2CUZA 2NS7A 3GTMJ 3BTCA 5E8GA 1IAWA 1G3WA 3RSNA 4OIQF 3ZQ7A 3H9JA 1FOKA 2WA0A 2XGDA 2CV2A 1OR7C 1TBXA 2BVLA 2ZXJA 3FMSA 2EH3A 3ZMVA 2DMPA 2O6GE 2H6CA 1UG2A 3QRFF 1J59A 1RUOA 1BIAA 4X1EA 2IXSA 4ZDOA 3U21A 1WVRA 4OIRF 3DWLE 1MBFA 5E1WA 2E1CA 1XS9A 1TWHJ 1FBSA 1U78A 4CXFA 3CCUI 3C18A 2Z9OA 2XF7A 4G7ZF 2O5RA 2CQQA 1GXQA 2ZSHB 5DCMA 2NOJB 2PN6A 2VC1A 1R5GA 2K7LA 2P5KA 1YE9A 4U0YA 2PEXA 2W4SA 5E8IA 2JA8J 1J9IA 1QZEA 1WJEA 4P55A 5KK1A 2NVTJ 5DV5A 4EM2A 4QWQA 3SJMA 3QOPA 4YIFA 4GFBA 3C2HA 1PDNC 2A6TA 1XMXA 2E35A 2K3PA 2IJLA 3E1SA 3LA2A 2DI3A 1GXPA 5IOZA 3R61A 1JGSA 3BG5A 5FGMA 4CGZA 3TO7A 2LF8A 2QQ9A 3IAM2 2EIJH 4BGDA 3CF5F 2QQBA 3GXOA 4I98B 2BY3A 1XSXA 2MLKA 4M71A 3KP6A 5GPAA 3CMYA 2E34A 2CJJA 3KIOA 2MSYA 1YYVA 2FOWA 4I09A 3OYFA 4HRIA 2BY1A 5E3NA 2QYOA 2R92J 4F3QA 1D8JA 4UHTA 2OJED 4YRVA 1E3OC 2W1OA 1ZTRA 3IKTA 2ZO4A 4V19K 4I0BA 5GAGJ 1RPWA 1DUXC 1XMAA 2STTA 3BG9A 1DU0A 2D1HA 2VQHA 3U9GA 1J7KA 1X19A 4QPQA 4A3CJ 2VKHA 4OAYA 1VQ4I 2ETHA 1ZREA 2E5ZA 2FNPA 3F22A 3BPVA 3MMYB 1X4OA 2K3FA 1U5TC 3ZQIA 3S16J 3P9KA 2OQRA 4A3EJ 5E3LA 1T6SA 4BHBA 4D9JA 4A3MJ 3CCQI 5EZHA 4IHSA 2A6EF 2EFNA 4Q47A 4A0ZA 2JUCA 1IXSB 4ZYEA 4NUBA 1ZR4A 4BHPA 1VQKI 2L4MA 2V79A 1ZG3A 2RQPA 1E3HA 3ZRGA 4RB3C 1O4XA 5JLXA 4CHUA 2W85A 3EQLF 4EM1A 3BCBA 3LFUA 3CUQB 2DFIA 1S9HA 1GV2A 1ON2A 1OYWA 3WTTC 1MSFC 1TQMA 2EZKA 1MH3A 2F4OB 4XOTA 1JKRC 2FNAA 2EA4A 2Z2SB 1IRZA 4LITA 1G2HA 3M8FA 4IZZA 3BP8A 3KP5A 2UXNA 2XUBA 3MZYA 3CJQB 4CCKA 2LY9A 4M3BA 4O5VA 2COBA 1T39A 1AKHB 2R7TA 1W7PB 3SZPA 4NBQA 3ZQCA 1V5GA 4I01A 4WCGA 2LP0A 1ZRFA 2CU7A 3KFWX 2B0LA 4S05A 1ACIA 1KGSA 3HTUA 4HW0A 1V55H 1SANA 3I64A 1NHAA 2WTEA 3SEQA 1N25A 1XCVA 2EBIA 3RKQA 3PNVA 3SHFA 3PNTA 1W5SA 2O8KA 3M07A 1HDPA 4H4KC 1OLTA 1ZK8A 1BR4A 5A2QZ 5FJ8J 2MFZA 5HDNA 1R22A 4B43A 1PUEE 1I1GA 2Y48A 2KPMA 2DMTA 3QU6A 5J1YA 4MEXF 4I02A 3QP6A 5D6EA 2CO5A 1BL0A 4Z6YA 4FCYA 2IA1A 2VQCA 2R7WA 1FY7A 4DOZA 4Y3OA 1BR2A 3E6DA 1H9GA 2NVQJ 3IRQA 3BJAA 4IRGA 4DIQA 3MFKA 3FHNA 5JVGF 5LRRA 4HNVA 2EV0A 2DQLA 5DTDA 1T98A 2ZCWA 2X6OA 3I71A 3FMRA 3JAMZ 2VLAA 3I4MJ 2DA2A 3O3KA 3E5UA 2AXLA 1DGRM 3TKYA 3K10A 4XOPA 4KUMA 3M9AA 5LRSA 5ILVA 2F4MB 1VTNC 3HGYA 4RAZA 4YFXF 1SD6A 5EZGA 1MW7A 2JK3A 4II2A 1D0XA 4RGUA 1BBYA 1FYMA 5GAHJ 2BOLA 3QPLA 3HC7A 4HV6A 1VI0A 4ASNA 1BOBA 2E1MC 3L00A 2L54A 2P4WA 5FLMJ 1QVUA 1K4SA 3GTLJ 5FLXZ 1OPCA 3ECHA 5LGNA 2ECBA 4PGGA 5FFXA 3V7RA 1QRYA 4DW6A 1LEAA 4GCVA 3WGHA 4B44A 4BU2A 4C30A 4D5CA 3MKZA 2DA6A 5GAEJ 1J2XA 3L2RA 4ZDLA 2EINH 1FP2A 1RZ4A 2F2EA 1IW7F 4A3FJ 1JT6A 1Z6RA 4MO7A 3E6MA 1IN7A 1Z05A 2LSOA 1ETOA 3K4MA 4ETSA 1D5YA 2F4IA 3Q0WA 2LRDA 3KZIC 3KEYA 1H88C 1SAUA 2JWTA 1B9MA 4HOBA 4LD5A 1LPQA 2FRHA 1WZ2A 5DM6F 2R5ZA 5IY5H 4ZYAA 1SVLA 1ZRCA 1V5EA 4RA2A 1OR7A 3PNYA 4LG0B 3FK6A 2EZLA 3CUOA 4LG3A 1LDKB 2L7ZA 3AG1H 3R60A 4HNUA 3HL2A 2EK5A 2O0YA 5JHUA 1G8XA 4BXUA 3H9QA 4B8XA 2IA2A 5FB2A 1YIJI 2XSDC 4B3AA 4C2UA 2GOXB 1EH7A 1TQPA 1MMAA 1U8BA 3TBIA 1YI2I 2XC7A 2VOPA 1R1TA 4XKCA 1KU2A 5AIPA 2CQ7A 1BI2A 4LIUA 1ON1A 2W7NA 2E60A 3K1NA 3H0DA 3A01A 2PMHA 1TZLA 4EQQA 2CGPA 1WRJA 1BM9A 1JKQC 4UNOA 1TWFJ 5F1RA 3OS0A 4Q5SF 3I9V2 2EFOA 4KT5C 1D1AA 4XBFA 3DPUA 5DS9A 3OYNA 1MDMB 2KRHA 2C6YA 3CMAI 2HTSA 4NC6A 1X2NA 4NHJA 1RKWA 4GGGA 4I0AA 4BKXA 4KIBA 1ULYA 2E2JJ 2BVMA 4LLNA 1ETKA 1UMQA 2V1UA 3EYIA 3BLYA 1YO5C 1X58A 2GIZA 2ZBKA 3DKWA 3BR5A 1HC8A 4XLAA 2QZ8A 3NARA 3GLLA 5TJJA 4LOCA 3CC7I 4ZYGA 1QNTA 1HKSA 3LSHA 1C0WA 2CS3A 2DCEA 5F27A 4KJZA 5EGOB 1UB9A 2XB5A 3T1BA 4XIDA 2IW5A 2EFPA 1UZCA 5AONA 3M8JA 1H9TA 2NVUB 3VYRB 2G9WA 4XSXF 4IOCF 4A3GJ 2X1DA 3JRAA 2V9VA 1JGGA 1WJAA 2PG4A 1U5TA 5JHFA 3LOCA 1BR1A 4GO1A 1JT0A 2KDOA 1WFXA 3RKYA 2OC6A 4UB8C 2DMQA 5EF6A 1MKMA 4QPOA 3CJTB 5E1ZB 2VKVA 3S3OA 2R7QA 4CH7A 4CZCA 3HRSA 3HJEA 4OMYA 1EA3A 2XIGA 3EPZA 3ZPLA 2LC2A 1ZGAA 4BUPA 4BE1A 1ERDA 3PJRA 2DFFA 5E20A 2OUMA 2GA2A 1V3FA 1BI3A 4RDUA 1X1AA 4IHWA 1MBEA 2XAUA 5A2QK 3IH2A 4L9JA 3L9FA 2ISYA 3V7CA 3L2CA 1FOYA 3ASOH 3FXQA 1W36C 2BY0A 2O3FA 3O8HA 3ZMSA 1B8IA 3MCZA 1WWXA 2EB7A 3KETA 3K4NA 1KONA 3BJ6A 3VWBA 3I58A 1O3SA 1MJ9A 2JQ7A 4FISA 1OCPA 4BE2A 2H8RA 1Z91A 1A6QA 4QIWN 4HDUA 1LEBA 2QM3A 4DBRA 3DXJF 1W7PD 4BAYA 3JCUC 1YW7A 1LE8A 5ICEA 3WG7H 3JAMK 1Z3XA 5J4YA 3M3YJ 4E7JA 3ABKH 1K4TA 3ELKA 2VODA 2XVCA 3W3CA 2L9RA 3LSJA 2KRFA 5L3FA 2LD5A 3G2BA 1JUMA 1FLIA 2JRMA 2G7HA 4LFUA 6PAXA 5LBQA 2DMNA 2W24A 1RC9A 5DDGA 4CZZA 1S3JA 4DYCA 3HM5A 1HSTA 4BJTA 1GVJA 4CDGA 4F92B 4F52A 1FEXA 1ODDA 3KX2A 4XRSA 3DU6A 2IA0A 1F4KA 3OSFA 4D7NA 2XDVA 4I7HA 5FLXK 3Q0VA 2EJRA 2H8WA 5F0HA 1LB2A 1TT5B 3RYRA 5ILUA 1S29A 1W0UA 1L0OC 1ZELA 4UVBA 3JRGA 1IF1A 3LSPA 4BNCA 1VNDA 1U8RA 3BG3A 3HXLA 2IRFG 2O9LA 4DNCA 2Q2EB 3F6OA 3GLXA 3O2PE 4CCNA 3GTOJ 3FISA 3F8CA 3OYHA 2OTJI 4XRFA 1FJLA 2BXZA 1Z0XA 2H09A 4FASD 3S1QJ 2CQNA 1T08B 3BTJA 3ZGKA 1Y1WJ 3DKXA 4B1RA 3L2UA 4KN4X 5D4SA 2QGUA 2IP2A 5E1XA 4BEHA 2M8EA 4YELA 3VB2A 5LGUA 3W2AA 4BBSJ 1KYWA 2CH0A 3FK7A 2GA1A 1NG6A 1XC5A 5H2FC 3KP2A 2B9SA 2RN7A 4ENKA 2CW8A 2L9NA 1PVEA 2ZB9A 2PJRA 1Z21A 3CJNA 3HOUJ 1ZLKA 4UB6C 2M8GX 2VIXA 1OFCX 2F5VA 3H35A 3MD2A 4IO9F 1XCBA 4RBOA 4UXNA 1K78A 2YPRA 3K4CA 3DU5A 2Q0OA 1FP1D 5GADJ 4ZJZA 1B72A 4A93J 4KIFA 5EEGA 3HOSA 4K2EA 1EV7A 2LKPA 2NAZA 2IS4A 3OOPA 3ZOBA 2L0KA 2YSRA 3CCEI 1KQ9A 1U9OA 4IQ4A 4CCLA 3CLQA 3NQOA 3OSGA 2XAHA 3KEOA 4ZC3A 2YUSA 1LDDA 3BR6A 4XLFA 5J4VA 3SYTA 3LWFA 2X85A 1M1EB 5D4RA 1QQIA 4CSWA 5FLVA 1ZH5A 2QKMB 3ZN0A 3ZXSA 2EA2A 5M5YJ 2QBYA 1ZG5A 1N75A 1LFBA 1K6OA 3DTEA 4PK4A 3R4KA 2R93J 3H3VK 3IAS2 2M3AA 3JSOA 1UHMA 4EV0A 4AIKA 4S0HB 4BQOA 1YQAA 4N9IA 2WWYA 1O7LA 1SAXA 1OYIA 3B73A 1SMTA 5DCMB 3TEDA 3G4SI 3E5XA 2CG4A 1X1DA 2KP6A 4A6DA 4QTRA 5FRNA 5FKOA 1ZRDA 2DAOA 3WG9A 3PFYA 1R7JA 1BJZA 4G7HF 4M73A 3H1CA 2ME0A 4M74A 4M72A 4BY1J 2QQAA 2FBKA 3R6SA 4KMFA 1MIJA 3FZVA 3K70D 1X4PA 4M9ZA 3MN2A 4LIVA 4DGWB 5DCFA 1G6NA 1TWCJ 4EVIA 3QOEA 3IHUA 2R7OA 2L01A 2IGOA 3TOAA 3HSEA 1WHUA 5M5XJ 1VQLI 1BC7C 2JA6J 4PUSA 1YFHA 2JA5J 2PMUA 2I5UA 4ESJA 1R00A 4OWRB 3W2WA 4H0EA 2HGCA 2WB1A 2PFBA 2QSGX 4YIRX 2DPDA 3CDHA 1D8KA 3AG3H 4HZFA 2Y9ZA 2D5VA 1QHGA 1OCCH 2K9LA 4HF1A 3L2VA 2MLGA 2Y75A 4HEA2 3E6BA 2HPIA 4E7ZA 3FX3A 2XGXA 5F1JA 3ZQQA 1XPXA 1HDDC 4WWCA 1D3YA 3VEPA 1WKMA 3A1YA 2IEKA 5EDNA 1QBJA 1PJRA 5TISC 2TCTA 3L7WA 1JUPA 1RIOH 4A3BJ 2WB1N 2IPQX 2CRGA 2X6WA 1FMWA 3CC4I 3CZ6A 2VB6A 2EPFA 5K1YA 2K4BA 3GTQJ 3F8FA 2VPLA 1TQIA 1R4MB 1RI7A 2WADA 4M3GA 3DBHB 4AD9A 4HA8A 3CCJI 3N97A 2FBHA 4F7ZA 1IDYA 5D5VB 1F5TA 2QLZA 4U0WA 3TP3A 4RM3A 3BTLA 1BI0A 3QYEA 3IWZA 2V4JC 3OS2A 2CFXA 1T95A 3M1EA 3K6GA 3X2QH 3QP5A 2K02A 5J1UA 4BJ5C 2A69F 4IKFA 3OYKA 1TL8A 2K9NA 2IGMA 2VXZA 2VJ4A 4XLEA 4LLGF 3ZR8X 4AVPA 5H6QA 2STWA 3CP2A 5D8KB 5D8LB 1KU3A 1B1BA 3RKWA 5LEKA 3WTUC 4A69C 2HZTA 2MH9A 4XQFA 3CCVI 1QPIA 1IZ1A 3RZOJ 3LMMA 2LG4A 3DBRB 1YS6A 1MMNA 4FTHA 5M3FJ 4BACA 4LB6B 3WU1B 2GOMA 2E36A 2XHKA 4A5NA 4OOIA 2LMDA 3C2GA 2EV5A 2EQRA 5JVTA 2QEXI 2DO7A 2WAFA 5L3GA 4KITB 1K61A 2Y30A 1YS7A 3DF8A 1LKXA 1BW5A 4O6JA 4XM3A 1RETA 2Q8KA 3BZCA 1ZLJA 2Q1ZB 3PIOF 3BZ6A 3ASNH 3QWLA 5JI6A 1VF9A 4IOAF 1IRFA 5J8CA 1W5CC 5DYMA 4V2FA 1BC8C 1EKEA 3I53A 5FROA 1S7AA 4RLFA 2CQXA 3A0HC 1LVAA 4UUSA 3AAFA 1OISA 4L5IA 2DYSH 3FM3A 2CUEA 3T8TA 2XPWA 3GWZA 3OR2C 1IXCA 5K7FA 5CJ9A 3IH4A 3K1MA 2KIFA 3CQZJ 1CQTA 3FBIB 4A3JJ 2R7FA 4A0YA 4IHXA 1FIAA 4ENNA 4RB1A 3P7NA 3V7SA 3H3UA 3GTKJ 1IN6A 3S1NJ 4PJNA 4MTDA 4GXOA 5FRMA 3ROUA 3J7YJ 1I6HJ 4B47A 1Z3YA 3AG4H 5IT3A 2DA4A 2W82A 1G3TA 1P9QC 1IG7A 4PJLA 4HNTA 2R7UA 3S2DJ 1HQCA 2D45A 1T56A 1WJFA 4BDZA 1RR7A 2DA7A 4HAMA 1Z6TA 4XRMA 1IC8A 2R0QC 2JA7J 2JVGA 2KHMA 3A03A 4XKBA 2R5ZB 2I8DA 2JVHA 2VJ5A 4BL0B 1CF7A 2GIVA 1GV5A 1LJ9A 3GZNB 3WTXC 1HBXG 3J7AY 1UG0A 2ELHA 2ZNZA 4A3KJ 2NVXJ 5J3LA 1EH6A 3VSKA 1HLVA 1YX3A 2QVOA 4OINF 3FMQA 3PSIA 2Z99A 3G1LA 5ERIA 1Z1DA 1QA6A 3OY9A 2R7XA 3S32A 2XAFA 3TDZC 4ZZLA 4G6TB 5HLGA 3F0CA 3DKYA 3PL8A 2QUFA 1DPRA 3NEUA 4DYQA 1E2XA 1XGOA 1NH3A 3A01B 4HBLA 2VBYA 4XMYA 3V8LA 5FD5A 2PI0A 2FMYA 5IP6A 3LSGA 4GDFA 2QENA 1U0JA 2M4GA 2TDXA 4ZTJA 1REPC 1XDSA 4ON0A 2K4JA 2XF6A 1KU7A 3S17J 3C1DA 1WCMJ 1SFUA 2ACJA 5F08A 3LQQA 4M6XA 1DDNA 4E7HA 2WV1A 4XICA 1YOVB 3VFZA 2XRLA 1A5JA 3GCMA 2OTLI 3A2KA 5HS7A 5IP7J 2OU2A 2Z5UA 1NTCA 2L02A 4NQWA 3SFIA 2JSPA 4F93B 3S1RJ 3M8EA 3BG7A 1IRGA 2W57A 5FFZA 1G3YA 1OJLA 3A0BC 4U7BA 5F0CA 2DT7B 1X3WB 2JZYA 2XAGA 1A31A 4C2TA 2DN0A 2M45A 4FX4A 1VQ6I 4L0YB 1MNEA 3BWGA 5E17F 5HDGA 4YFNF 2Y0MA 4Y17A 1U5TB 2AQEA 4LB5A 3RQ4A 1MBHA 2ZMEC 3RDIA 4PDKA 3RPUA 4U88A 3CJSB 2KIMA 2JMWA 2GQQA 3EUAA 2M0MA 1PP7U 3JREA 4E7SA 2DU9A 1POGA 2B7EA 1USTA 3HOTA 2E19A 1UCRA 2EZHA 2A5YB 1WJCA 2JN6A 3LA3A 3J7ZI 2P0WA 3MEXA 5DEQA 1XTAA 2LNBA 4HPQA 1Z77A 2QQ8A 5KAIC 4E70A 3I55I 3I0TA 3TO6A 2EIMH 3HOVJ 2H6BA 4BQNA 1XSVA 3HOWJ 2V1DA 2O61A 2R3SA 5KVRA 1JKOC 1MBKA 4HQMA 2XB0X 1APLC 4ZTFA 4L0ZB 5JFRA 2NOGA 1B8IB 2A61A 2UXXA 1ZN2A 1R9TJ 5EYRA 1IJWC 5CYVA 2V6EA 1FZPB 3SQNA 5K5OA 3QPHA 5CVIA 5J40A 2J5OA 4RB0A 2ICWG 2GXBA 2Z33A 1GDTA 4OMZA 3BR1A 3QAHA 3D5LA 1LE8B 3FHZA 4ITVA 2HQNA 3GFJA 1JTXA 3TMOA 2Y0SN 2M2EA 4N0BA 2FQ3A 2NS0A 2VQGA 3C7JA 2P5VA 2DA1A 2HR3A 2L5QA 1MBJA 3F72A 1STZA 1FBQA 1T0FC 5HLHA 2OCEA 2ZNYA 3K4BA 1FTTA 3TL4X 3GBGA 1YW8A 4P5OA 4BQAA 4HV5A 1O7FA 1QHHD 4E7KA 5F64A 4KMUX 5C4JJ 3GEZA 3E6CC 5CVVA 2YX7A 2CW0F 3HUGA 4YEJA 3JRIA 3KYCB 1N78A 1IXRC 4N4OB 2IGKA 3KZYA 1ZKGA 3DEUA 3SEZA 1R5HA 4CYCA 3ZN1A 4LK0F 2WBMA 2L3DA 1O3QA 3L1PA 3V4GA 4KISA 4RAYA 1DPUA 3IH3A 2ZFWA 5K7HA 3ULQB 1GUUA 2E1MB 2RDPA 5GPCA 1WH5A 4Y4RA 5HVQC 2X0LA 1YX5A 1MNDA 1IN8A 5IT9Z 5D5XB 2E1OA 2VBXA 2K5CA 5FKKA 3WU2C 4EMSA 3IC7A 3TDUC 3Q3SA 3SZGA 2CWEA 3F8NA 4BEHB 2E2HJ 4HSTA 4E6KG 5EEAA 4MQ9F 2F5FA 2L9VA 3MZ8A 1Z7UA 2VKDA 4AVZA 1DP3A 2EFQA 2PJRB 2ZXWH 1HSJA 2IT0A 4C3JJ 3AL0B 3DPTA 3VYTB 4RGXA 5LHGA 3HKZN 3KP4A 2J5PA 3UKGA 2YU9J 4QLCU 3JTHA 1KZHA 3JW4A 3F21A 1TTYA 1ITYA 3G1MA 4LGWA 2DT6A 4CUGA 3WHCA 1K78B 3CJRB 4CCJA 2V26A 1FOXA 1P4AA 2MGQA 5FKMA 1T2KA 1B72B 2LH9A 1QPMA 1FOWA 2IS6A 1OQYA 2BBYA 2H94A 2K9QA 3TGNA 3GUDA 3I3LA 3OIQA 3H5AA 4G94A 4HG2A 1R23A 1U3EM 4FE4A 1TWGJ 1LNWA 4AIDA 3JRHA 2WC2A 3RYPA 4PJMA 1R6RA 3HSRA 1YJWI 4ZYDA 3ML6A 2V6CA 2XV4S 3ABTA 4RM2A 2HPMA 2IGNA 3NWSA 1JJ8C 4PZJA 3VDXA 4BHCA 4M6YA 5GTIC 5KNLA 3ZQHA 2XRNA 1VQ7I 3MVPA 2QBYB 3D5SC 3HEFA 3DBLB 3IWFA 1ETQA 3NRVA 1TWAJ 1YG2A 5HS8A 3K2AA 2A07F 4UY8I 1UHWA 2R4GA 4FQGA 3MQ0A 2ZFUA 1K7AA 1Y8QB 1BIBA 4AIHA 1SC7A 3GTJJ 3E0JB 2ID6A 2HKOA 2W84A 3PM1A 2M0CA 5HDKA 3L2WA 5B1AH 4UUVA 1ZQ3P 4ESBA 3M7GA 3DV8A 3KP7A 2NRAC 2LDUA 2W48A 5EG0A 1D1BA 1QO0D 4AWXB 3ZMZA 2FJ1A 4D5FA 2HTJA 4R79A 1LUJB 4F55A 3QU3A 2XPUA 4GRIA 1W1WE 4JYKA 2X6XA 4GYIA 4JX6A 3IP4B 1L3LA 3J7AO 3T8RA 3PO3J 2HI3A 2HWVA 4MGRA 1K83J 1U9NA 2X4HA 4B09A 3NAUA 1Z67A 3UNGC 1YJ9I 4C3HJ 2P5LC 3SFZA 2PJPA 4XNFA 5HODA 3OL4A 2LR8A 4EJOA 4C3IJ 3A02A 2ZMEA 3QPSA 5B5EC 4CO8A 1IDZA 4M6VA 2MA3A 1FMVA 3OS1A 5IPAA 2NNNA 2COMA
chains in the Genus database with same CATH topology
3J7ZI 2JQ7A 1YI2I 3I55I 1VQOI 1YJNI 2NXNB 2E35A 3CJRB 1FOXA 3DLLF 3CC2I 1S72I 1FOWA 3CF5F 3CCVI 1WIBA 5JVGF 3CMAI 2ZJRF 3CMEI 1Y39A 1YJWI 3G4SI 2E34A 1QA6A 1VQPI 2FOWA 2QA4I 3CCMI 3CCRI 2E36A 2H8WA 1VQ7I 1YITI 1HC8A 2QEXI 4V19K 5GAGJ 3CC7I 5GAHJ 1VQ9I 3CD6I 3G6EI 1VQMI 3PIPF 4UY8I 1VQ4I 1YHQI 2OTJI 2K3FA 4IOCF 3PIOF 1VQLI 3CCQI 2OTLI 4IOAF 5GAEJ 1VQKI 5DM7F 3G71I 1VQNI 1VQ5I 3CCSI 3CJTB 1VQ6I 1MMSA 1YJ9I 5DM6F 3EGVB 3CJQB 2ZJQF 4IO9F 3CJSB 3CC4I 5GADJ 3J7YJ 1VQ8I 1FOYA 2ZJPF 3CCUI 3CCLI 1ACIA 3I56I 1YIJI 3CCJI 3CCEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z I;  2JQ7 A;  1YI2 I;  3I55 I;  1VQO I;  1YJN I;  2NXN B;  2E35 A;  3CJR B;  1FOX A;  3DLL F;  3CC2 I;  1S72 I;  1FOW A;  3CF5 F;  3CCV I;  1WIB A;  5JVG F;  3CMA I;  2ZJR F;  3CME I;  1Y39 A;  1YJW I;  3G4S I;  2E34 A;  1QA6 A;  1VQP I;  2FOW A;  2QA4 I;  3CCM I;  3CCR I;  2E36 A;  2H8W A;  1VQ7 I;  1YIT I;  1HC8 A;  2QEX I;  4V19 K;  5GAG J;  3CC7 I;  5GAH J;  1VQ9 I;  3CD6 I;  3G6E I;  1VQM I;  3PIP F;  4UY8 I;  1VQ4 I;  1YHQ I;  2OTJ I;  2K3F A;  4IOC F;  3PIO F;  1VQL I;  3CCQ I;  2OTL I;  4IOA F;  5GAE J;  1VQK I;  5DM7 F;  3G71 I;  1VQN I;  1VQ5 I;  3CCS I;  3CJT B;  1VQ6 I;  1MMS A;  1YJ9 I;  5DM6 F;  3EGV B;  3CJQ B;  2ZJQ F;  4IO9 F;  3CJS B;  3CC4 I;  5GAD J;  3J7Y J;  1VQ8 I;  1FOY A;  2ZJP F;  3CCU I;  3CCL I;  1ACI A;  3I56 I;  1YIJ I;  3CCJ I;  3CCE I; 
#chains in the Genus database with same CATH topology
 1FTZ A;  3DPL C;  2OPT A;  3H36 A;  2P6T A;  3U1D A;  4BXX J;  4B4C A;  4D7M A;  3GX4 X;  3CO7 C;  4A2U A;  1G3S A;  2W00 A;  2XKO A;  3HB9 A;  1BN5 A;  2X48 A;  3L09 A;  4YII A;  4X0G A;  5LHH A;  3F23 A;  4XK4 A;  1MMD A;  2LKX A;  1HW5 A;  1X2M A;  2NXN B;  4BY7 J;  2KZG A;  1MH4 A;  3DLL F;  2F48 A;  1F1Z A;  3WTV C;  1E0E A;  1YLF A;  3W6K B;  3OYL A;  4RMN A;  1LFU P;  2BE5 F;  3FXK A;  2LYC A;  2M9H A;  2Z1D A;  3S15 J;  1XGN A;  1X3Z B;  2V9P A;  4PCQ A;  5ICC A;  2HQA A;  2DMU A;  2TRT A;  3BR0 A;  4MHG A;  4HLX A;  2E7W A;  4HX4 A;  1Y8R B;  3CME I;  2X51 A;  3BY6 A;  3HOX J;  2B63 J;  2DDB A;  4AYB A;  2ESN A;  1OCZ H;  2JPC A;  2JJ7 A;  5L3D A;  1XN7 A;  5D5U B;  3S93 A;  1ZR2 A;  4DZP A;  2L9S A;  4FX0 A;  3LSM A;  5BPD A;  1QU3 A;  4KIG A;  1NK3 P;  3FXJ A;  5D5W B;  1MD0 A;  2M7A A;  4L5E A;  3KLN A;  4UUT A;  5IYC J;  9ANT A;  3PUB A;  1FYL A;  2BGC A;  1VQM I;  2LBF A;  1S8N A;  1O3R A;  3HHH A;  1F36 A;  4AYB N;  2VT2 A;  5EEH A;  1GVD A;  1P4X A;  3DP7 A;  4I6Z A;  3KCC A;  2XRO A;  3ZMT A;  3BR2 A;  2QF7 A;  2AS5 F;  1XG1 A;  2IAI A;  2CV0 A;  2QSF X;  3OWT A;  1O57 A;  1WQ2 A;  2L4A A;  3QOD A;  1TNT A;  1W0T A;  1GLN A;  2LKS A;  3K4L A;  3RI4 A;  3GZ6 A;  5IT9 K;  3LA7 A;  2CQK A;  3ABM H;  4PSX A;  2M4K A;  3RIR A;  2RNJ A;  3O8G A;  1HA8 A;  2DT5 A;  3WTS C;  2KJC A;  2BEO A;  1G4D A;  2CV1 A;  1F9N A;  3C2B A;  4XR6 A;  2HYF A;  4S04 A;  3CCY A;  1IUF A;  2P8T A;  2M5W A;  5IP9 J;  4CA0 A;  3I59 A;  4JOM A;  2EZI A;  2HXI A;  5J6X A;  3OYM A;  3MKY B;  1VQ8 I;  2ME6 A;  3OOU A;  4UUS B;  3JRD A;  4UV9 A;  2DQR A;  2LY2 A;  3S2H J;  1FBU A;  2MD5 A;  2FU4 A;  4B48 A;  4KFC A;  3BDD A;  2MYS A;  4KIC A;  3K69 A;  1VQO I;  3CO6 C;  3FXO A;  2M7B A;  2H27 A;  2BW3 A;  5KCM A;  4HQE A;  5TRD A;  5IYD J;  3RQI A;  2ISZ A;  3BG6 A;  3DTI A;  4I99 C;  3SZT A;  3ECO A;  3OR1 C;  2BZT A;  3H5N A;  1V54 H;  2E2I J;  5HS9 A;  1SMY F;  1JE8 A;  4WXD A;  2PMZ A;  4MNU A;  1T8I A;  3AKZ A;  3W6V A;  1WJ5 A;  2FA5 A;  3LSK A;  2LRE A;  4MFE A;  1ZYR F;  4AC0 A;  5BOX A;  3PSF A;  1Y39 A;  1S7E A;  3I5U A;  3CDL A;  2R5Y A;  2LVS A;  4Y52 J;  2LOO A;  1RKT A;  3HZJ A;  1PUF A;  1FIP A;  4BH9 A;  3RJP A;  4EJU A;  2MW8 A;  2QA4 I;  2DOE A;  3CCR I;  2FX0 A;  1CF7 B;  4AM3 A;  2VBZ A;  5FD6 A;  3EUH C;  4AIJ A;  3WU0 A;  4R1H A;  2PMZ N;  3CUQ C;  4LLL A;  5LEJ A;  1SFE A;  2O8X A;  4MLO A;  1TW3 A;  2OV7 A;  2OZU A;  2L7M P;  2BHZ A;  4RB2 C;  2R7Z J;  2XF5 A;  5IYB J;  1A04 A;  1I27 A;  4J19 A;  5C4X J;  1JUS A;  1SD7 A;  1SFO J;  3BTI A;  3MWM A;  4IHT A;  2G7U A;  1RRJ A;  3ZMD A;  5CVU A;  1U6G A;  2K85 A;  5JLW A;  2QCO A;  5BS6 A;  1ONV A;  2A05 A;  3VSL A;  5CPR B;  1FYK A;  1Z7L A;  1FSE A;  3GTP J;  1Y6I A;  2V1N A;  2LFB A;  2EWN A;  3HG9 A;  5E3O A;  1LFP A;  2WV0 A;  4JBA A;  5TGT A;  1VQ5 I;  1Y0N A;  1YIO A;  4IL6 C;  5H20 A;  3Q5F A;  2DPU A;  4NB5 A;  1I39 A;  3BJO A;  3FXM A;  2DJI A;  2HU9 A;  4YFK F;  1ZGW A;  4Y13 A;  1D5V A;  2VN2 A;  2OF7 A;  4O3M A;  2JTV A;  2M1B A;  2MD0 A;  3OYE A;  4EM0 B;  4W1U A;  4M3D A;  1JXS A;  2KFD A;  1MMS A;  3DEE A;  5F0F A;  1S6L A;  5J47 A;  2ZJQ F;  3GYH X;  3FXL A;  2KMU A;  4A5M A;  2XGE A;  3DFG A;  4IX7 A;  2O7O A;  3F3X A;  5E79 C;  1FSH A;  4NQW B;  2AXT C;  3PUF A;  2EIL H;  4V2G A;  5M5W J;  2CSO A;  1IV8 A;  1S7O A;  2N8G A;  3F8B A;  4HYE A;  1TC3 C;  4P1W A;  1OCR H;  4GYG A;  3I54 A;  1V5F A;  2OBP A;  1J0R A;  3BCA A;  4JK1 X;  1UAA A;  1XSD A;  2AHQ A;  1RES A;  5K5R A;  4CIC A;  1MMG A;  2O03 A;  1MJB A;  1FWZ A;  3HTS B;  4WF2 A;  1Q1V A;  2K9M A;  4XL9 A;  3TP0 A;  1WGX A;  5J8F A;  2FOK A;  3GME A;  4R8H A;  4CCO A;  1EF4 A;  4NDL A;  2P6S A;  4HSR A;  2V9K A;  2FE3 A;  4PJ0 C;  3RZD J;  2H1K A;  3FIW A;  3GTG J;  4W97 A;  5E3M A;  3D1N I;  5BQT A;  1IRX A;  3LST A;  1T33 A;  2K40 A;  2DK8 A;  4L9V A;  1DGW Y;  2G0E A;  5F04 A;  3A4C A;  4ZYH A;  2HOA A;  3U1K A;  2VUM J;  1KQ8 A;  2HQR A;  3SDB A;  4HF0 A;  5B66 C;  3L2Q A;  1I3Q J;  1RR8 C;  2FSW A;  4WXC A;  1JI8 A;  2JUG A;  4OAZ A;  3DEW A;  1IN5 A;  1ETX A;  1R49 A;  4RAG A;  3JSP A;  1HW2 A;  2K27 A;  2JA2 A;  4LJZ F;  3TO9 A;  1MZB A;  1YRN A;  3VPR A;  1S5L C;  4EEF G;  1XMK A;  4Y33 A;  2E71 A;  3MAJ A;  3B6C A;  1YIT I;  1JJ6 C;  1FT9 A;  4P96 A;  1FX7 A;  1HF0 A;  2XAQ A;  3H92 A;  5GP9 A;  1W36 D;  2GXA A;  2D1V A;  3K1P A;  3S3N A;  1FC3 A;  2M34 A;  2H1L A;  4XLH A;  3HYI A;  1QZY A;  3GFL A;  2RGV A;  5L3C A;  3D0S A;  2VXD A;  3EET A;  1IGN A;  3BT9 A;  4A3D J;  3RTR A;  1AA7 A;  2KDZ A;  4G6D A;  2MG4 A;  3G3Z A;  5KAF C;  4L5J A;  2DW4 A;  2HEO A;  1WJD A;  3RKX A;  3J81 Z;  3BC8 A;  3QQA A;  4IVN A;  3H9G A;  4BXF A;  1PYV A;  2RQQ A;  2LK2 A;  3Q9V A;  2HYJ A;  3PO2 J;  2A3S A;  4B3X A;  4ENM A;  2RKH A;  3CCS I;  3GF2 A;  3QYF A;  2VJI A;  2HDC A;  4PJJ A;  2EFW A;  3LFK A;  4ZZD A;  4F91 B;  2MC4 A;  4M9X A;  4I2O A;  2VON A;  2NS8 A;  3JRC A;  5C3E J;  3ZQG A;  2HZD A;  2DFE A;  4RGS A;  2DOA A;  2ADU A;  2FUG 2;  5C44 J;  2V7F A;  1SD4 A;  3T5X A;  2F6C A;  4DJA A;  2UUZ A;  3VOD A;  1Z9C A;  2DOF A;  4BQQ A;  3HUG B;  1OMI A;  4G9Y A;  1RUN A;  4HDV A;  3HGG A;  4XN0 A;  5ICF A;  4QSH A;  3AG2 H;  3NWT A;  1KYZ A;  1ETY A;  4LK1 F;  1IUY A;  4CYC B;  2ZJP F;  3HBL A;  3CES A;  2X6Y A;  4XN3 A;  2GWR A;  3SXY A;  2MAB A;  2JSC A;  3HSF A;  2VBW A;  2ZSI B;  1XGS A;  3K70 C;  3P5J A;  1DQU A;  1W5T A;  4EAT A;  5B3S H;  3Q0U A;  2HKX A;  1SFK A;  4L18 B;  3WE2 A;  3GZ5 A;  3PQJ A;  3Q9S A;  2VAS A;  4WXH A;  1ZGJ A;  4PSW A;  3HRU A;  3ZQF A;  4IHY A;  2KT0 A;  2A5W A;  4ABZ A;  4EJW A;  1FPQ A;  1NK2 P;  4HX8 A;  2HVR A;  3WE3 A;  3SDG A;  3CC2 I;  2X1C A;  1P4W A;  2RRE A;  3LSR A;  4U87 A;  4OU0 A;  2JT1 A;  1XB4 A;  4IRH A;  5FKL A;  4BE0 A;  3KZZ A;  1B4A A;  1SVM A;  2PQ8 A;  3WGG A;  4Q48 A;  2LF7 A;  2VOO A;  4CCM A;  3HOY J;  2YU3 A;  4KYW A;  2I10 A;  2UZK A;  1RNL A;  2ZJR F;  3TW7 A;  1VQP I;  1DP7 P;  1P92 A;  4IRI A;  1TW2 A;  3VYU B;  2HOT A;  3CMM A;  4JX4 A;  5K5Q A;  1Y1V J;  2Y31 A;  4EGZ A;  1ZAO A;  3GO5 A;  3K9T A;  1P7J A;  3F6V A;  3PQK A;  2HOS A;  3GFM A;  5IOY A;  4IQJ A;  3ISP A;  4BS9 A;  1UFM A;  2L7F P;  5BMZ A;  3AL0 C;  3EUH A;  4A12 A;  3K0L A;  1VQ9 I;  3ZMU A;  1GT0 C;  3CUQ A;  2GXG A;  3F8M A;  1BOA A;  3HHG A;  5ICG A;  2Y0S A;  2CUJ A;  2KIS A;  1Q1H A;  4M3F A;  3E7L A;  4E4H A;  3MKL A;  3QYB A;  1TT0 A;  1JHH A;  4EJV A;  3WTY C;  3ERE D;  5L3E A;  2BV6 A;  3FKI J;  5LHI A;  2QKL B;  2GBY A;  3HPH A;  2FML A;  4KDP A;  2BHY A;  3COA C;  1R58 A;  2OAZ A;  1AKH A;  1TLH B;  5HNF A;  2GZW A;  4U7D A;  2BXY A;  1W7P A;  3KP3 A;  5D6F A;  4IPA A;  1Y0U A;  4JP0 A;  3G1O A;  3PFI A;  3N4M A;  1R36 A;  3FM5 A;  2DXI A;  3J80 Z;  1I50 J;  2L2O A;  1J09 A;  2WY8 Q;  1UJ8 A;  4RLQ A;  2NNY A;  2GM4 A;  1T38 A;  1EH8 A;  1ZAR A;  2CUF A;  2FF4 A;  3IUO A;  3OV8 A;  2DOD A;  4C9Y A;  1J75 A;  1HCR A;  3HDD A;  1SVO A;  2FEZ A;  3CF2 A;  3OYB A;  3P9C A;  1BJA A;  4N9H A;  1ENH A;  4KT6 A;  4KN7 X;  5EG0 B;  1YTY A;  5DUI A;  3ERM A;  4PFO A;  1WH7 A;  1IO2 A;  2R7D A;  5E18 F;  4MFD A;  3IV5 A;  2JRT A;  4LMY A;  1A6I A;  2F5D A;  3WTZ A;  4HF2 A;  4WK8 F;  3JR9 A;  1J5Y A;  4UVC A;  1HW1 A;  3ABU A;  3BOQ A;  3I56 I;  2FXA A;  4HLY A;  4JQF A;  2VC0 A;  1I1S A;  1E3P A;  4MIM A;  3GFI A;  2A68 F;  2DA5 A;  3OMY A;  3KYD B;  4MTE A;  4RGR A;  1ETV A;  1MNM C;  4WX9 A;  3HKZ A;  3K4K A;  1G59 A;  2KZV A;  1PP8 F;  2CW7 A;  3WTW C;  1VZ0 A;  2R7S A;  2QWW A;  2Z3Y A;  3WGI A;  4G7O F;  3TW6 A;  1XD7 A;  2ZME B;  4Z2Y A;  5K7Z A;  1ZG1 A;  2RV8 A;  2HVS A;  5L3B A;  3BQY A;  3LL7 A;  1K79 A;  2ECC A;  4RAF A;  3K4J A;  3RCO A;  1AWC A;  2IS2 A;  3ESW B;  2ZC2 A;  1R5I D;  2VJJ A;  1AOY A;  4A3I J;  3RPU D;  4XKV A;  1WPK A;  2WAQ A;  4D1Q A;  1OCO H;  4A3L J;  4G8X A;  4BBR J;  4ZH4 F;  3CCM I;  2KKO A;  4XSZ F;  2HNH A;  3BQZ A;  4ENJ A;  1I6X A;  3LAJ A;  5DUK A;  2DA3 A;  4Y15 A;  2HOE A;  5LFA A;  1IV6 A;  5DD8 A;  1V4R A;  4IXA A;  3J81 K;  1MBG A;  5J1R A;  3JTG A;  1USS A;  3BRO A;  1U2W A;  4J00 A;  3FKJ A;  3G6E I;  4KA4 A;  3R0A A;  1R71 A;  3WHB A;  4E7L A;  2WAQ N;  3HIF A;  2W25 A;  3DTK A;  3BZK A;  2ESH A;  2BYV E;  3UR3 C;  2XAS A;  1X1C A;  5ED4 A;  4BYY A;  3WOD F;  1LQ1 A;  5DD4 A;  1B59 A;  2ID3 A;  2ZXH A;  2HDD A;  2YS9 A;  1CGP A;  4N4N B;  3VYS B;  2KJB A;  4LG0 A;  3S1M J;  2K9S A;  4P9U A;  2MC3 A;  4J01 A;  3RPQ A;  4Y7N J;  2VQL A;  3I4N J;  2HFH A;  2DFH A;  2X1E A;  5DM7 F;  1D0Y A;  2F5E A;  3FXR A;  3T0Y A;  1VQN I;  3BR3 A;  2FBI A;  1I5Z A;  1A36 A;  3M1C A;  3OYA A;  2LBF B;  1XX5 A;  1TP4 A;  3FWE A;  3KE2 A;  4AU7 A;  4X6A J;  2CMP A;  3MZH A;  4NC8 A;  3CDI A;  1X1P A;  2Y69 H;  4I76 A;  3CTA A;  4M3E A;  4U0V A;  3VOE A;  4ESF A;  4G12 A;  2OA4 A;  3JRF A;  3ZP5 A;  1LVK A;  2DYR H;  3EGV B;  5LGT A;  5EJC A;  3CP8 A;  3OIO A;  2DTR A;  3ZCO A;  2PX9 A;  4XLP F;  1ETW A;  3BPX A;  4M9S A;  3TQN A;  5CVJ A;  4XLN F;  3OYI A;  1SD5 A;  2ZKZ A;  1HKQ A;  1VFC A;  4XKW A;  1MDM A;  2HYG D;  3C3W A;  3M4O J;  2P7C B;  1HKT A;  1Y56 A;  1OYY A;  3G73 A;  2HS5 A;  1WSU A;  1JTY A;  1I3A A;  3GVA A;  1YJN I;  1W4M A;  4E7I A;  2RNG A;  2Y2Z A;  4DZJ A;  3S14 J;  3I59 B;  4FE7 A;  1YW9 A;  4C2M J;  4II3 A;  3H5R A;  4L9T A;  5F6F A;  3E3V A;  4L9N A;  4NNJ A;  5H6R A;  2KLO A;  2DK5 A;  4CYD A;  2XAJ A;  3ONQ A;  1WIB A;  5EGO A;  4AUX A;  2RAE A;  3EDP A;  5FO5 A;  5CLS A;  1WI3 A;  2M87 A;  2LLK A;  2E7X A;  1P7I A;  2X9D A;  3IRR A;  3D5R C;  1SEU A;  1H0M A;  4XRS G;  3FF5 A;  4KNY A;  1H8A C;  5FKN A;  2K86 A;  3H0G J;  3V8J A;  2KIQ A;  2JPB A;  1B9N A;  2XGC A;  4BJ6 C;  4IHV A;  2BW3 B;  3K7A J;  1EJ9 A;  2OCC H;  2OD5 A;  5GTH C;  5HOO A;  1QGP A;  1KA8 A;  2M30 A;  2NYX A;  3KEQ A;  2XKP A;  3S8P A;  4UVA A;  3LNQ A;  3CD6 I;  4IEJ A;  1E17 A;  1H89 C;  4OIP F;  4FT8 A;  3LAP A;  3KLO A;  2MH2 A;  4XOR A;  4A6E A;  3DQV C;  3V8K A;  2NVY J;  1YHQ I;  1QVT A;  1D0Z A;  2E1N A;  1MJA A;  4NC7 A;  2ELJ A;  1D1C A;  3J80 K;  2R7R A;  2R5Y B;  2AO9 A;  2Y9Y A;  1R1U A;  3HRM A;  3HPG A;  2MBF A;  1PUF B;  2HQ5 A;  3FXU A;  2PLY A;  1IN4 A;  5CVR A;  3U2R A;  1P6R A;  1BW6 A;  2A6H F;  2DJN A;  2R7V A;  1MSE C;  1R1V A;  4ZDP A;  2XSJ C;  2GAU A;  5ILS A;  3G71 I;  3KYL A;  2P7V B;  3OYG A;  1UHS A;  3IL2 A;  4XON A;  1ORK A;  5HLI A;  1AU7 A;  1NG7 A;  2HDW A;  3E5Q A;  3AFH A;  5BPI A;  2GLO A;  1HXD A;  4FET A;  1X1B A;  1HOM A;  3EYY A;  3IKV A;  4HX7 A;  1X3U A;  5LLQ A;  5KHD A;  2RVC A;  2FQ4 A;  2P81 A;  3F9K A;  1T0F A;  3JRB A;  2HXO A;  3LSI A;  3EUK L;  1QZZ A;  3QPT A;  2V1X A;  3OYD A;  5CQG A;  2IBD A;  3LQR A;  2KL4 A;  1SFX A;  4G6Q A;  5HLT A;  3P9I A;  2CFO A;  4TV7 A;  5AIQ A;  2PBI A;  2VE9 A;  3B02 A;  2VT3 A;  3DCF A;  2VE8 A;  3CCL I;  1MGT A;  1R4N B;  2D2W A;  3R0J A;  3W6J B;  1O3T A;  3GW2 A;  4JX5 A;  3TOB A;  2L7K A;  2DBB A;  2KIU A;  1AHD P;  3OYJ A;  2RC4 A;  2OQG A;  2DTZ A;  4PFP A;  3ZQL A;  3HRT A;  5BNG A;  2YX4 A;  1A35 A;  3S3M A;  2VI6 A;  2HVQ A;  5JR3 A;  1LDJ A;  1F43 A;  2DLL A;  1WI9 A;  4PGH A;  1BI1 A;  4MQV A;  4EJT A;  1S72 I;  4FHT A;  1KU9 A;  2IVM A;  2OZ6 A;  2ZXI A;  4DBQ A;  5LD2 C;  4YG2 F;  4A0X A;  1WJB A;  2ELK A;  3FBN B;  2Q2E A;  3H3Z A;  1B6A A;  4D0P A;  2BY2 A;  2FD5 A;  5HNH A;  1UEL B;  1N77 A;  3K2Z A;  2AQF A;  3B6A A;  1P2F A;  3CLO A;  2YR2 A;  4P9F A;  2UWM A;  4UV8 A;  4RS8 A;  3DLA A;  1TNS A;  5M3M J;  4IF4 A;  2KRC A;  2UV1 A;  1OCT C;  1DU6 A;  1GHC A;  4IJA A;  4MEY F;  1JHF A;  3OIP A;  3I4P A;  4DQ2 A;  3OYC A;  3PIP F;  2VKE A;  2EV6 A;  2QSH X;  4ANJ A;  2E5N A;  3ABL H;  1JKP C;  2CYY A;  3REO A;  2WY7 Q;  5CKT A;  3KPH A;  3OL3 A;  3HOZ J;  3O6B B;  4Q4Z F;  2LY1 A;  5CQE A;  2WAE A;  2KQR A;  3MKW B;  4EGY A;  1YRN B;  1BA5 A;  2EIK H;  1KQ0 A;  1XDU A;  3W2V A;  4BDY A;  1XGM A;  3FDY A;  5B1B H;  2XPV A;  4DYR A;  2F5C A;  1ZHF A;  1K6Y A;  3V42 A;  2DDA A;  2ZJ2 A;  2VPR A;  2Z16 A;  2LTP A;  1OKR A;  3N05 A;  2VL8 A;  2IS1 A;  3E97 A;  3S2W A;  4OIO F;  4XLC A;  1FNN A;  2CUZ A;  2NS7 A;  3GTM J;  3BTC A;  5E8G A;  1IAW A;  1G3W A;  3RSN A;  4OIQ F;  3ZQ7 A;  3H9J A;  1FOK A;  2WA0 A;  2XGD A;  2CV2 A;  1OR7 C;  1TBX A;  2BVL A;  2ZXJ A;  3FMS A;  2EH3 A;  3ZMV A;  2DMP A;  2O6G E;  2H6C A;  1UG2 A;  3QRF F;  1J59 A;  1RUO A;  1BIA A;  4X1E A;  2IXS A;  4ZDO A;  3U21 A;  1WVR A;  4OIR F;  3DWL E;  1MBF A;  5E1W A;  2E1C A;  1XS9 A;  1TWH J;  1FBS A;  1U78 A;  4CXF A;  3CCU I;  3C18 A;  2Z9O A;  2XF7 A;  4G7Z F;  2O5R A;  2CQQ A;  1GXQ A;  2ZSH B;  5DCM A;  2NOJ B;  2PN6 A;  2VC1 A;  1R5G A;  2K7L A;  2P5K A;  1YE9 A;  4U0Y A;  2PEX A;  2W4S A;  5E8I A;  2JA8 J;  1J9I A;  1QZE A;  1WJE A;  4P55 A;  5KK1 A;  2NVT J;  5DV5 A;  4EM2 A;  4QWQ A;  3SJM A;  3QOP A;  4YIF A;  4GFB A;  3C2H A;  1PDN C;  2A6T A;  1XMX A;  2E35 A;  2K3P A;  2IJL A;  3E1S A;  3LA2 A;  2DI3 A;  1GXP A;  5IOZ A;  3R61 A;  1JGS A;  3BG5 A;  5FGM A;  4CGZ A;  3TO7 A;  2LF8 A;  2QQ9 A;  3IAM 2;  2EIJ H;  4BGD A;  3CF5 F;  2QQB A;  3GXO A;  4I98 B;  2BY3 A;  1XSX A;  2MLK A;  4M71 A;  3KP6 A;  5GPA A;  3CMY A;  2E34 A;  2CJJ A;  3KIO A;  2MSY A;  1YYV A;  2FOW A;  4I09 A;  3OYF A;  4HRI A;  2BY1 A;  5E3N A;  2QYO A;  2R92 J;  4F3Q A;  1D8J A;  4UHT A;  2OJE D;  4YRV A;  1E3O C;  2W1O A;  1ZTR A;  3IKT A;  2ZO4 A;  4V19 K;  4I0B A;  5GAG J;  1RPW A;  1DUX C;  1XMA A;  2STT A;  3BG9 A;  1DU0 A;  2D1H A;  2VQH A;  3U9G A;  1J7K A;  1X19 A;  4QPQ A;  4A3C J;  2VKH A;  4OAY A;  1VQ4 I;  2ETH A;  1ZRE A;  2E5Z A;  2FNP A;  3F22 A;  3BPV A;  3MMY B;  1X4O A;  2K3F A;  1U5T C;  3ZQI A;  3S16 J;  3P9K A;  2OQR A;  4A3E J;  5E3L A;  1T6S A;  4BHB A;  4D9J A;  4A3M J;  3CCQ I;  5EZH A;  4IHS A;  2A6E F;  2EFN A;  4Q47 A;  4A0Z A;  2JUC A;  1IXS B;  4ZYE A;  4NUB A;  1ZR4 A;  4BHP A;  1VQK I;  2L4M A;  2V79 A;  1ZG3 A;  2RQP A;  1E3H A;  3ZRG A;  4RB3 C;  1O4X A;  5JLX A;  4CHU A;  2W85 A;  3EQL F;  4EM1 A;  3BCB A;  3LFU A;  3CUQ B;  2DFI A;  1S9H A;  1GV2 A;  1ON2 A;  1OYW A;  3WTT C;  1MSF C;  1TQM A;  2EZK A;  1MH3 A;  2F4O B;  4XOT A;  1JKR C;  2FNA A;  2EA4 A;  2Z2S B;  1IRZ A;  4LIT A;  1G2H A;  3M8F A;  4IZZ A;  3BP8 A;  3KP5 A;  2UXN A;  2XUB A;  3MZY A;  3CJQ B;  4CCK A;  2LY9 A;  4M3B A;  4O5V A;  2COB A;  1T39 A;  1AKH B;  2R7T A;  1W7P B;  3SZP A;  4NBQ A;  3ZQC A;  1V5G A;  4I01 A;  4WCG A;  2LP0 A;  1ZRF A;  2CU7 A;  3KFW X;  2B0L A;  4S05 A;  1ACI A;  1KGS A;  3HTU A;  4HW0 A;  1V55 H;  1SAN A;  3I64 A;  1NHA A;  2WTE A;  3SEQ A;  1N25 A;  1XCV A;  2EBI A;  3RKQ A;  3PNV A;  3SHF A;  3PNT A;  1W5S A;  2O8K A;  3M07 A;  1HDP A;  4H4K C;  1OLT A;  1ZK8 A;  1BR4 A;  5A2Q Z;  5FJ8 J;  2MFZ A;  5HDN A;  1R22 A;  4B43 A;  1PUE E;  1I1G A;  2Y48 A;  2KPM A;  2DMT A;  3QU6 A;  5J1Y A;  4MEX F;  4I02 A;  3QP6 A;  5D6E A;  2CO5 A;  1BL0 A;  4Z6Y A;  4FCY A;  2IA1 A;  2VQC A;  2R7W A;  1FY7 A;  4DOZ A;  4Y3O A;  1BR2 A;  3E6D A;  1H9G A;  2NVQ J;  3IRQ A;  3BJA A;  4IRG A;  4DIQ A;  3MFK A;  3FHN A;  5JVG F;  5LRR A;  4HNV A;  2EV0 A;  2DQL A;  5DTD A;  1T98 A;  2ZCW A;  2X6O A;  3I71 A;  3FMR A;  3JAM Z;  2VLA A;  3I4M J;  2DA2 A;  3O3K A;  3E5U A;  2AXL A;  1DGR M;  3TKY A;  3K10 A;  4XOP A;  4KUM A;  3M9A A;  5LRS A;  5ILV A;  2F4M B;  1VTN C;  3HGY A;  4RAZ A;  4YFX F;  1SD6 A;  5EZG A;  1MW7 A;  2JK3 A;  4II2 A;  1D0X A;  4RGU A;  1BBY A;  1FYM A;  5GAH J;  2BOL A;  3QPL A;  3HC7 A;  4HV6 A;  1VI0 A;  4ASN A;  1BOB A;  2E1M C;  3L00 A;  2L54 A;  2P4W A;  5FLM J;  1QVU A;  1K4S A;  3GTL J;  5FLX Z;  1OPC A;  3ECH A;  5LGN A;  2ECB A;  4PGG A;  5FFX A;  3V7R A;  1QRY A;  4DW6 A;  1LEA A;  4GCV A;  3WGH A;  4B44 A;  4BU2 A;  4C30 A;  4D5C A;  3MKZ A;  2DA6 A;  5GAE J;  1J2X A;  3L2R A;  4ZDL A;  2EIN H;  1FP2 A;  1RZ4 A;  2F2E A;  1IW7 F;  4A3F J;  1JT6 A;  1Z6R A;  4MO7 A;  3E6M A;  1IN7 A;  1Z05 A;  2LSO A;  1ETO A;  3K4M A;  4ETS A;  1D5Y A;  2F4I A;  3Q0W A;  2LRD A;  3KZI C;  3KEY A;  1H88 C;  1SAU A;  2JWT A;  1B9M A;  4HOB A;  4LD5 A;  1LPQ A;  2FRH A;  1WZ2 A;  5DM6 F;  2R5Z A;  5IY5 H;  4ZYA A;  1SVL A;  1ZRC A;  1V5E A;  4RA2 A;  1OR7 A;  3PNY A;  4LG0 B;  3FK6 A;  2EZL A;  3CUO A;  4LG3 A;  1LDK B;  2L7Z A;  3AG1 H;  3R60 A;  4HNU A;  3HL2 A;  2EK5 A;  2O0Y A;  5JHU A;  1G8X A;  4BXU A;  3H9Q A;  4B8X A;  2IA2 A;  5FB2 A;  1YIJ I;  2XSD C;  4B3A A;  4C2U A;  2GOX B;  1EH7 A;  1TQP A;  1MMA A;  1U8B A;  3TBI A;  1YI2 I;  2XC7 A;  2VOP A;  1R1T A;  4XKC A;  1KU2 A;  5AIP A;  2CQ7 A;  1BI2 A;  4LIU A;  1ON1 A;  2W7N A;  2E60 A;  3K1N A;  3H0D A;  3A01 A;  2PMH A;  1TZL A;  4EQQ A;  2CGP A;  1WRJ A;  1BM9 A;  1JKQ C;  4UNO A;  1TWF J;  5F1R A;  3OS0 A;  4Q5S F;  3I9V 2;  2EFO A;  4KT5 C;  1D1A A;  4XBF A;  3DPU A;  5DS9 A;  3OYN A;  1MDM B;  2KRH A;  2C6Y A;  3CMA I;  2HTS A;  4NC6 A;  1X2N A;  4NHJ A;  1RKW A;  4GGG A;  4I0A A;  4BKX A;  4KIB A;  1ULY A;  2E2J J;  2BVM A;  4LLN A;  1ETK A;  1UMQ A;  2V1U A;  3EYI A;  3BLY A;  1YO5 C;  1X58 A;  2GIZ A;  2ZBK A;  3DKW A;  3BR5 A;  1HC8 A;  4XLA A;  2QZ8 A;  3NAR A;  3GLL A;  5TJJ A;  4LOC A;  3CC7 I;  4ZYG A;  1QNT A;  1HKS A;  3LSH A;  1C0W A;  2CS3 A;  2DCE A;  5F27 A;  4KJZ A;  5EGO B;  1UB9 A;  2XB5 A;  3T1B A;  4XID A;  2IW5 A;  2EFP A;  1UZC A;  5AON A;  3M8J A;  1H9T A;  2NVU B;  3VYR B;  2G9W A;  4XSX F;  4IOC F;  4A3G J;  2X1D A;  3JRA A;  2V9V A;  1JGG A;  1WJA A;  2PG4 A;  1U5T A;  5JHF A;  3LOC A;  1BR1 A;  4GO1 A;  1JT0 A;  2KDO A;  1WFX A;  3RKY A;  2OC6 A;  4UB8 C;  2DMQ A;  5EF6 A;  1MKM A;  4QPO A;  3CJT B;  5E1Z B;  2VKV A;  3S3O A;  2R7Q A;  4CH7 A;  4CZC A;  3HRS A;  3HJE A;  4OMY A;  1EA3 A;  2XIG A;  3EPZ A;  3ZPL A;  2LC2 A;  1ZGA A;  4BUP A;  4BE1 A;  1ERD A;  3PJR A;  2DFF A;  5E20 A;  2OUM A;  2GA2 A;  1V3F A;  1BI3 A;  4RDU A;  1X1A A;  4IHW A;  1MBE A;  2XAU A;  5A2Q K;  3IH2 A;  4L9J A;  3L9F A;  2ISY A;  3V7C A;  3L2C A;  1FOY A;  3ASO H;  3FXQ A;  1W36 C;  2BY0 A;  2O3F A;  3O8H A;  3ZMS A;  1B8I A;  3MCZ A;  1WWX A;  2EB7 A;  3KET A;  3K4N A;  1KON A;  3BJ6 A;  3VWB A;  3I58 A;  1O3S A;  1MJ9 A;  2JQ7 A;  4FIS A;  1OCP A;  4BE2 A;  2H8R A;  1Z91 A;  1A6Q A;  4QIW N;  4HDU A;  1LEB A;  2QM3 A;  4DBR A;  3DXJ F;  1W7P D;  4BAY A;  3JCU C;  1YW7 A;  1LE8 A;  5ICE A;  3WG7 H;  3JAM K;  1Z3X A;  5J4Y A;  3M3Y J;  4E7J A;  3ABK H;  1K4T A;  3ELK A;  2VOD A;  2XVC A;  3W3C A;  2L9R A;  3LSJ A;  2KRF A;  5L3F A;  2LD5 A;  3G2B A;  1JUM A;  1FLI A;  2JRM A;  2G7H A;  4LFU A;  6PAX A;  5LBQ A;  2DMN A;  2W24 A;  1RC9 A;  5DDG A;  4CZZ A;  1S3J A;  4DYC A;  3HM5 A;  1HST A;  4BJT A;  1GVJ A;  4CDG A;  4F92 B;  4F52 A;  1FEX A;  1ODD A;  3KX2 A;  4XRS A;  3DU6 A;  2IA0 A;  1F4K A;  3OSF A;  4D7N A;  2XDV A;  4I7H A;  5FLX K;  3Q0V A;  2EJR A;  2H8W A;  5F0H A;  1LB2 A;  1TT5 B;  3RYR A;  5ILU A;  1S29 A;  1W0U A;  1L0O C;  1ZEL A;  4UVB A;  3JRG A;  1IF1 A;  3LSP A;  4BNC A;  1VND A;  1U8R A;  3BG3 A;  3HXL A;  2IRF G;  2O9L A;  4DNC A;  2Q2E B;  3F6O A;  3GLX A;  3O2P E;  4CCN A;  3GTO J;  3FIS A;  3F8C A;  3OYH A;  2OTJ I;  4XRF A;  1FJL A;  2BXZ A;  1Z0X A;  2H09 A;  4FAS D;  3S1Q J;  2CQN A;  1T08 B;  3BTJ A;  3ZGK A;  1Y1W J;  3DKX A;  4B1R A;  3L2U A;  4KN4 X;  5D4S A;  2QGU A;  2IP2 A;  5E1X A;  4BEH A;  2M8E A;  4YEL A;  3VB2 A;  5LGU A;  3W2A A;  4BBS J;  1KYW A;  2CH0 A;  3FK7 A;  2GA1 A;  1NG6 A;  1XC5 A;  5H2F C;  3KP2 A;  2B9S A;  2RN7 A;  4ENK A;  2CW8 A;  2L9N A;  1PVE A;  2ZB9 A;  2PJR A;  1Z21 A;  3CJN A;  3HOU J;  1ZLK A;  4UB6 C;  2M8G X;  2VIX A;  1OFC X;  2F5V A;  3H35 A;  3MD2 A;  4IO9 F;  1XCB A;  4RBO A;  4UXN A;  1K78 A;  2YPR A;  3K4C A;  3DU5 A;  2Q0O A;  1FP1 D;  5GAD J;  4ZJZ A;  1B72 A;  4A93 J;  4KIF A;  5EEG A;  3HOS A;  4K2E A;  1EV7 A;  2LKP A;  2NAZ A;  2IS4 A;  3OOP A;  3ZOB A;  2L0K A;  2YSR A;  3CCE I;  1KQ9 A;  1U9O A;  4IQ4 A;  4CCL A;  3CLQ A;  3NQO A;  3OSG A;  2XAH A;  3KEO A;  4ZC3 A;  2YUS A;  1LDD A;  3BR6 A;  4XLF A;  5J4V A;  3SYT A;  3LWF A;  2X85 A;  1M1E B;  5D4R A;  1QQI A;  4CSW A;  5FLV A;  1ZH5 A;  2QKM B;  3ZN0 A;  3ZXS A;  2EA2 A;  5M5Y J;  2QBY A;  1ZG5 A;  1N75 A;  1LFB A;  1K6O A;  3DTE A;  4PK4 A;  3R4K A;  2R93 J;  3H3V K;  3IAS 2;  2M3A A;  3JSO A;  1UHM A;  4EV0 A;  4AIK A;  4S0H B;  4BQO A;  1YQA A;  4N9I A;  2WWY A;  1O7L A;  1SAX A;  1OYI A;  3B73 A;  1SMT A;  5DCM B;  3TED A;  3G4S I;  3E5X A;  2CG4 A;  1X1D A;  2KP6 A;  4A6D A;  4QTR A;  5FRN A;  5FKO A;  1ZRD A;  2DAO A;  3WG9 A;  3PFY A;  1R7J A;  1BJZ A;  4G7H F;  4M73 A;  3H1C A;  2ME0 A;  4M74 A;  4M72 A;  4BY1 J;  2QQA A;  2FBK A;  3R6S A;  4KMF A;  1MIJ A;  3FZV A;  3K70 D;  1X4P A;  4M9Z A;  3MN2 A;  4LIV A;  4DGW B;  5DCF A;  1G6N A;  1TWC J;  4EVI A;  3QOE A;  3IHU A;  2R7O A;  2L01 A;  2IGO A;  3TOA A;  3HSE A;  1WHU A;  5M5X J;  1VQL I;  1BC7 C;  2JA6 J;  4PUS A;  1YFH A;  2JA5 J;  2PMU A;  2I5U A;  4ESJ A;  1R00 A;  4OWR B;  3W2W A;  4H0E A;  2HGC A;  2WB1 A;  2PFB A;  2QSG X;  4YIR X;  2DPD A;  3CDH A;  1D8K A;  3AG3 H;  4HZF A;  2Y9Z A;  2D5V A;  1QHG A;  1OCC H;  2K9L A;  4HF1 A;  3L2V A;  2MLG A;  2Y75 A;  4HEA 2;  3E6B A;  2HPI A;  4E7Z A;  3FX3 A;  2XGX A;  5F1J A;  3ZQQ A;  1XPX A;  1HDD C;  4WWC A;  1D3Y A;  3VEP A;  1WKM A;  3A1Y A;  2IEK A;  5EDN A;  1QBJ A;  1PJR A;  5TIS C;  2TCT A;  3L7W A;  1JUP A;  1RIO H;  4A3B J;  2WB1 N;  2IPQ X;  2CRG A;  2X6W A;  1FMW A;  3CC4 I;  3CZ6 A;  2VB6 A;  2EPF A;  5K1Y A;  2K4B A;  3GTQ J;  3F8F A;  2VPL A;  1TQI A;  1R4M B;  1RI7 A;  2WAD A;  4M3G A;  3DBH B;  4AD9 A;  4HA8 A;  3CCJ I;  3N97 A;  2FBH A;  4F7Z A;  1IDY A;  5D5V B;  1F5T A;  2QLZ A;  4U0W A;  3TP3 A;  4RM3 A;  3BTL A;  1BI0 A;  3QYE A;  3IWZ A;  2V4J C;  3OS2 A;  2CFX A;  1T95 A;  3M1E A;  3K6G A;  3X2Q H;  3QP5 A;  2K02 A;  5J1U A;  4BJ5 C;  2A69 F;  4IKF A;  3OYK A;  1TL8 A;  2K9N A;  2IGM A;  2VXZ A;  2VJ4 A;  4XLE A;  4LLG F;  3ZR8 X;  4AVP A;  5H6Q A;  2STW A;  3CP2 A;  5D8K B;  5D8L B;  1KU3 A;  1B1B A;  3RKW A;  5LEK A;  3WTU C;  4A69 C;  2HZT A;  2MH9 A;  4XQF A;  3CCV I;  1QPI A;  1IZ1 A;  3RZO J;  3LMM A;  2LG4 A;  3DBR B;  1YS6 A;  1MMN A;  4FTH A;  5M3F J;  4BAC A;  4LB6 B;  3WU1 B;  2GOM A;  2E36 A;  2XHK A;  4A5N A;  4OOI A;  2LMD A;  3C2G A;  2EV5 A;  2EQR A;  5JVT A;  2QEX I;  2DO7 A;  2WAF A;  5L3G A;  4KIT B;  1K61 A;  2Y30 A;  1YS7 A;  3DF8 A;  1LKX A;  1BW5 A;  4O6J A;  4XM3 A;  1RET A;  2Q8K A;  3BZC A;  1ZLJ A;  2Q1Z B;  3PIO F;  3BZ6 A;  3ASN H;  3QWL A;  5JI6 A;  1VF9 A;  4IOA F;  1IRF A;  5J8C A;  1W5C C;  5DYM A;  4V2F A;  1BC8 C;  1EKE A;  3I53 A;  5FRO A;  1S7A A;  4RLF A;  2CQX A;  3A0H C;  1LVA A;  4UUS A;  3AAF A;  1OIS A;  4L5I A;  2DYS H;  3FM3 A;  2CUE A;  3T8T A;  2XPW A;  3GWZ A;  3OR2 C;  1IXC A;  5K7F A;  5CJ9 A;  3IH4 A;  3K1M A;  2KIF A;  3CQZ J;  1CQT A;  3FBI B;  4A3J J;  2R7F A;  4A0Y A;  4IHX A;  1FIA A;  4ENN A;  4RB1 A;  3P7N A;  3V7S A;  3H3U A;  3GTK J;  1IN6 A;  3S1N J;  4PJN A;  4MTD A;  4GXO A;  5FRM A;  3ROU A;  3J7Y J;  1I6H J;  4B47 A;  1Z3Y A;  3AG4 H;  5IT3 A;  2DA4 A;  2W82 A;  1G3T A;  1P9Q C;  1IG7 A;  4PJL A;  4HNT A;  2R7U A;  3S2D J;  1HQC A;  2D45 A;  1T56 A;  1WJF A;  4BDZ A;  1RR7 A;  2DA7 A;  4HAM A;  1Z6T A;  4XRM A;  1IC8 A;  2R0Q C;  2JA7 J;  2JVG A;  2KHM A;  3A03 A;  4XKB A;  2R5Z B;  2I8D A;  2JVH A;  2VJ5 A;  4BL0 B;  1CF7 A;  2GIV A;  1GV5 A;  1LJ9 A;  3GZN B;  3WTX C;  1HBX G;  3J7A Y;  1UG0 A;  2ELH A;  2ZNZ A;  4A3K J;  2NVX J;  5J3L A;  1EH6 A;  3VSK A;  1HLV A;  1YX3 A;  2QVO A;  4OIN F;  3FMQ A;  3PSI A;  2Z99 A;  3G1L A;  5ERI A;  1Z1D A;  1QA6 A;  3OY9 A;  2R7X A;  3S32 A;  2XAF A;  3TDZ C;  4ZZL A;  4G6T B;  5HLG A;  3F0C A;  3DKY A;  3PL8 A;  2QUF A;  1DPR A;  3NEU A;  4DYQ A;  1E2X A;  1XGO A;  1NH3 A;  3A01 B;  4HBL A;  2VBY A;  4XMY A;  3V8L A;  5FD5 A;  2PI0 A;  2FMY A;  5IP6 A;  3LSG A;  4GDF A;  2QEN A;  1U0J A;  2M4G A;  2TDX A;  4ZTJ A;  1REP C;  1XDS A;  4ON0 A;  2K4J A;  2XF6 A;  1KU7 A;  3S17 J;  3C1D A;  1WCM J;  1SFU A;  2ACJ A;  5F08 A;  3LQQ A;  4M6X A;  1DDN A;  4E7H A;  2WV1 A;  4XIC A;  1YOV B;  3VFZ A;  2XRL A;  1A5J A;  3GCM A;  2OTL I;  3A2K A;  5HS7 A;  5IP7 J;  2OU2 A;  2Z5U A;  1NTC A;  2L02 A;  4NQW A;  3SFI A;  2JSP A;  4F93 B;  3S1R J;  3M8E A;  3BG7 A;  1IRG A;  2W57 A;  5FFZ A;  1G3Y A;  1OJL A;  3A0B C;  4U7B A;  5F0C A;  2DT7 B;  1X3W B;  2JZY A;  2XAG A;  1A31 A;  4C2T A;  2DN0 A;  2M45 A;  4FX4 A;  1VQ6 I;  4L0Y B;  1MNE A;  3BWG A;  5E17 F;  5HDG A;  4YFN F;  2Y0M A;  4Y17 A;  1U5T B;  2AQE A;  4LB5 A;  3RQ4 A;  1MBH A;  2ZME C;  3RDI A;  4PDK A;  3RPU A;  4U88 A;  3CJS B;  2KIM A;  2JMW A;  2GQQ A;  3EUA A;  2M0M A;  1PP7 U;  3JRE A;  4E7S A;  2DU9 A;  1POG A;  2B7E A;  1UST A;  3HOT A;  2E19 A;  1UCR A;  2EZH A;  2A5Y B;  1WJC A;  2JN6 A;  3LA3 A;  3J7Z I;  2P0W A;  3MEX A;  5DEQ A;  1XTA A;  2LNB A;  4HPQ A;  1Z77 A;  2QQ8 A;  5KAI C;  4E70 A;  3I55 I;  3I0T A;  3TO6 A;  2EIM H;  3HOV J;  2H6B A;  4BQN A;  1XSV A;  3HOW J;  2V1D A;  2O61 A;  2R3S A;  5KVR A;  1JKO C;  1MBK A;  4HQM A;  2XB0 X;  1APL C;  4ZTF A;  4L0Z B;  5JFR A;  2NOG A;  1B8I B;  2A61 A;  2UXX A;  1ZN2 A;  1R9T J;  5EYR A;  1IJW C;  5CYV A;  2V6E A;  1FZP B;  3SQN A;  5K5O A;  3QPH A;  5CVI A;  5J40 A;  2J5O A;  4RB0 A;  2ICW G;  2GXB A;  2Z33 A;  1GDT A;  4OMZ A;  3BR1 A;  3QAH A;  3D5L A;  1LE8 B;  3FHZ A;  4ITV A;  2HQN A;  3GFJ A;  1JTX A;  3TMO A;  2Y0S N;  2M2E A;  4N0B A;  2FQ3 A;  2NS0 A;  2VQG A;  3C7J A;  2P5V A;  2DA1 A;  2HR3 A;  2L5Q A;  1MBJ A;  3F72 A;  1STZ A;  1FBQ A;  1T0F C;  5HLH A;  2OCE A;  2ZNY A;  3K4B A;  1FTT A;  3TL4 X;  3GBG A;  1YW8 A;  4P5O A;  4BQA A;  4HV5 A;  1O7F A;  1QHH D;  4E7K A;  5F64 A;  4KMU X;  5C4J J;  3GEZ A;  3E6C C;  5CVV A;  2YX7 A;  2CW0 F;  3HUG A;  4YEJ A;  3JRI A;  3KYC B;  1N78 A;  1IXR C;  4N4O B;  2IGK A;  3KZY A;  1ZKG A;  3DEU A;  3SEZ A;  1R5H A;  4CYC A;  3ZN1 A;  4LK0 F;  2WBM A;  2L3D A;  1O3Q A;  3L1P A;  3V4G A;  4KIS A;  4RAY A;  1DPU A;  3IH3 A;  2ZFW A;  5K7H A;  3ULQ B;  1GUU A;  2E1M B;  2RDP A;  5GPC A;  1WH5 A;  4Y4R A;  5HVQ C;  2X0L A;  1YX5 A;  1MND A;  1IN8 A;  5IT9 Z;  5D5X B;  2E1O A;  2VBX A;  2K5C A;  5FKK A;  3WU2 C;  4EMS A;  3IC7 A;  3TDU C;  3Q3S A;  3SZG A;  2CWE A;  3F8N A;  4BEH B;  2E2H J;  4HST A;  4E6K G;  5EEA A;  4MQ9 F;  2F5F A;  2L9V A;  3MZ8 A;  1Z7U A;  2VKD A;  4AVZ A;  1DP3 A;  2EFQ A;  2PJR B;  2ZXW H;  1HSJ A;  2IT0 A;  4C3J J;  3AL0 B;  3DPT A;  3VYT B;  4RGX A;  5LHG A;  3HKZ N;  3KP4 A;  2J5P A;  3UKG A;  2YU9 J;  4QLC U;  3JTH A;  1KZH A;  3JW4 A;  3F21 A;  1TTY A;  1ITY A;  3G1M A;  4LGW A;  2DT6 A;  4CUG A;  3WHC A;  1K78 B;  3CJR B;  4CCJ A;  2V26 A;  1FOX A;  1P4A A;  2MGQ A;  5FKM A;  1T2K A;  1B72 B;  2LH9 A;  1QPM A;  1FOW A;  2IS6 A;  1OQY A;  2BBY A;  2H94 A;  2K9Q A;  3TGN A;  3GUD A;  3I3L A;  3OIQ A;  3H5A A;  4G94 A;  4HG2 A;  1R23 A;  1U3E M;  4FE4 A;  1TWG J;  1LNW A;  4AID A;  3JRH A;  2WC2 A;  3RYP A;  4PJM A;  1R6R A;  3HSR A;  1YJW I;  4ZYD A;  3ML6 A;  2V6C A;  2XV4 S;  3ABT A;  4RM2 A;  2HPM A;  2IGN A;  3NWS A;  1JJ8 C;  4PZJ A;  3VDX A;  4BHC A;  4M6Y A;  5GTI C;  5KNL A;  3ZQH A;  2XRN A;  1VQ7 I;  3MVP A;  2QBY B;  3D5S C;  3HEF A;  3DBL B;  3IWF A;  1ETQ A;  3NRV A;  1TWA J;  1YG2 A;  5HS8 A;  3K2A A;  2A07 F;  4UY8 I;  1UHW A;  2R4G A;  4FQG A;  3MQ0 A;  2ZFU A;  1K7A A;  1Y8Q B;  1BIB A;  4AIH A;  1SC7 A;  3GTJ J;  3E0J B;  2ID6 A;  2HKO A;  2W84 A;  3PM1 A;  2M0C A;  5HDK A;  3L2W A;  5B1A H;  4UUV A;  1ZQ3 P;  4ESB A;  3M7G A;  3DV8 A;  3KP7 A;  2NRA C;  2LDU A;  2W48 A;  5EG0 A;  1D1B A;  1QO0 D;  4AWX B;  3ZMZ A;  2FJ1 A;  4D5F A;  2HTJ A;  4R79 A;  1LUJ B;  4F55 A;  3QU3 A;  2XPU A;  4GRI A;  1W1W E;  4JYK A;  2X6X A;  4GYI A;  4JX6 A;  3IP4 B;  1L3L A;  3J7A O;  3T8R A;  3PO3 J;  2HI3 A;  2HWV A;  4MGR A;  1K83 J;  1U9N A;  2X4H A;  4B09 A;  3NAU A;  1Z67 A;  3UNG C;  1YJ9 I;  4C3H J;  2P5L C;  3SFZ A;  2PJP A;  4XNF A;  5HOD A;  3OL4 A;  2LR8 A;  4EJO A;  4C3I J;  3A02 A;  2ZME A;  3QPS A;  5B5E C;  4CO8 A;  1IDZ A;  4M6V A;  2MA3 A;  1FMV A;  3OS1 A;  5IPA A;  2NNN A;  2COM A; 
#chains in the Genus database with same CATH homology
 3J7Z I;  2JQ7 A;  1YI2 I;  3I55 I;  1VQO I;  1YJN I;  2NXN B;  2E35 A;  3CJR B;  1FOX A;  3DLL F;  3CC2 I;  1S72 I;  1FOW A;  3CF5 F;  3CCV I;  1WIB A;  5JVG F;  3CMA I;  2ZJR F;  3CME I;  1Y39 A;  1YJW I;  3G4S I;  2E34 A;  1QA6 A;  1VQP I;  2FOW A;  2QA4 I;  3CCM I;  3CCR I;  2E36 A;  2H8W A;  1VQ7 I;  1YIT I;  1HC8 A;  2QEX I;  4V19 K;  5GAG J;  3CC7 I;  5GAH J;  1VQ9 I;  3CD6 I;  3G6E I;  1VQM I;  3PIP F;  4UY8 I;  1VQ4 I;  1YHQ I;  2OTJ I;  2K3F A;  4IOC F;  3PIO F;  1VQL I;  3CCQ I;  2OTL I;  4IOA F;  5GAE J;  1VQK I;  5DM7 F;  3G71 I;  1VQN I;  1VQ5 I;  3CCS I;  3CJT B;  1VQ6 I;  1MMS A;  1YJ9 I;  5DM6 F;  3EGV B;  3CJQ B;  2ZJQ F;  4IO9 F;  3CJS B;  3CC4 I;  5GAD J;  3J7Y J;  1VQ8 I;  1FOY A;  2ZJP F;  3CCU I;  3CCL I;  1ACI A;  3I56 I;  1YIJ I;  3CCJ I;  3CCE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...