5DM6F

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
144
structure length
144
Chain Sequence
MRRVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
total genus 13
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5dm6F02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5dm6F01
3I56I 2OTLI 3CCJI 4UY8I 3PIOF 4IO9F 3J7YJ 3I55I 2ZJRF 5GAGJ 2K3FA 5GAHJ 2ZJQF 1VQNI 5GADJ 3CCVI 1QA6A 3CJQB 2QEXI 4IOAF 4IOCF 2JQ7A 2QA4I 3CD6I 1VQ6I 3CJTB 1VQ4I 1VQKI 1Y39A 2NXNB 2E35A 3PIPF 3CCUI 1VQ7I 3G71I 1VQOI 1FOWA 5DM7F 3G6EI 3CJSB 2H8WA 2FOWA 3CCRI 1S72I 3CC7I 1VQ8I 3CC4I 1YJNI 1VQPI 3CCSI 3CCLI 4V19K 3G4SI 3CF5F 3CCQI 3J7ZI 3EGVB 3CC2I 1MMSA 1FOYA 5GAEJ 1YI2I 3CCEI 5JVGF 1VQLI 1YIJI 1WIBA 1YITI 1VQMI 2E36A 1VQ5I 5DM6F 1ACIA 3CCMI 1HC8A 1VQ9I 3CJRB 3CMAI 3DLLF 2E34A 2ZJPF 1FOXA 1YHQI 1YJ9I 3CMEI 2OTJI 1YJWI
chains in the Genus database with same CATH superfamily
3K4KA 5EZHA 5F0FA 1VFCA 4XL9A 5FD6A 2DOEA 3KPHA 2VC1A 3J7YJ 4L5EA 3K4LA 2WTEA 2W82A 3L09A 3WHCA 1OPCA 2KL4A 2F5DA 2P7CB 3F8NA 2V9KA 5FGMA 2K3FA 4N9IA 3J7AY 2VXZA 3ECOA 4A0XA 1ETYA 2ZFUA 3LSKA 2ECCA 4IQ4A 1ETOA 2FF4A 5GADJ 4Q48A 2HTJA 3W3CA 3F8MA 3LNQA 3QRFF 4BEHA 1LVKA 3BJOA 1ZGJA 3BG9A 1MBKA 2K9SA 1HBXG 1RPWA 1PUEE 2VI6A 2YU9J 3TDUC 5D5XB 2O9LA 3I4NJ 5HS7A 4FTHA 1KQ8A 1Q1VA 1K7AA 2XPUA 1X1BA 3ZMDA 4CYCB 2P5KA 3FXOA 1GT0C 1ODDA 3JCUC 3HBLA 4RB1A 1WSUA 3W2AA 2IS2A 2R7TA 1FWZA 3ZPLA 2VQCA 2RNGA 3S16J 3S8PA 3S1RJ 3RJPA 3CP8A 1N75A 4O5VA 1UHWA 1IN4A 3OYEA 2DK5A 3FXLA 1MGTA 3CC7I 4LIUA 3WODF 5IP7J 1QZYA 5IT3A 4ZTJA 1S9HA 3JSOA 4PK4A 2XAUA 1Z6RA 3VSKA 1IDZA 2JSCA 3ZP5A 2M1BA 4HSTA 4F91B 2ID3A 2NS8A 4V19K 2ZKZA 1PDNC 2XRNA 2NS7A 3WTWC 2CUJA 2XAHA 3FISA 4M71A 3DCFA 3BR3A 3PM1A 2MD0A 4UUSA 2ZNZA 5DDGA 3D5LA 1WI9A 1YYVA 4M73A 4A3GJ 4G6QA 2L01A 1J7KA 3ZN1A 3J7AO 4MEXF 2V9PA 1ZHFA 2LMDA 2OV7A 3BPVA 2R7RA 2K5CA 4G94A 1SMYF 4M72A 2DTZA 5HLIA 2ID6A 3DPUA 4S05A 1FBSA 4HAMA 2NVQJ 3MD2A 4BS9A 1WRJA 3FXMA 2ELHA 2XGXA 4ENJA 3G1OA 2EZHA 3SFIA 1W0UA 2EV6A 1BJZA 3REOA 3CCMI 2K7LA 1KZHA 2W48A 2ICWG 5DD8A 4HNUA 1YTYA 4HG2A 4X0GA 2M87A 3VPRA 4V2FA 3WG7H 2Z99A 2HXOA 2MD5A 4A69C 4RMNA 2BW3B 3FM3A 3U2RA 5E8IA 2HVSA 4PUSA 2JA5J 2N8GA 1ULYA 1IV6A 3H3UA 3HZJA 4BQNA 1SVLA 1F9NA 3KLOA 1UAAA 3OYDA 1TWCJ 3NWSA 2E5NA 4A3CJ 3K69A 3AFHA 1H0MA 2FX0A 3OYFA 1L0OC 4FISA 3IL2A 4ITVA 5FLVA 3SJMA 2X9DA 3HKZA 2L9NA 3LL7A 4NNJA 2W7NA 4AIKA 9ANTA 3GTLJ 3HIFA 2A6EF 3R4KA 2XF5A 3HSRA 3X2QH 2VC0A 2BVMA 4MQVA 1FY7A 5KK1A 2G7HA 2L7MP 2Y2ZA 4U0WA 5F6FA 1U78A 3QPLA 4EJVA 2E1MC 3GEZA 1S7AA 1YO5C 2X85A 5CVUA 3GFJA 1VQ6I 3PNVA 4ESJA 2RGVA 1MJ9A 4KYWA 4DYQA 3FKIJ 1B6AA 1WCMJ 3WU1B 2GWRA 3FF5A 3HGGA 4P5OA 5EZGA 1R36A 1MIJA 2WV0A 1VQ7I 3CMYA 2IJLA 2F5EA 4KUMA 4NC7A 5IPAA 1SD5A 2L7KA 4EM0B 2DK8A 3QOPA 2R7SA 2FA5A 4JBAA 3UR3C 2R92J 4XKCA 4CGZA 3KIOA 3IWFA 3WTXC 2NRAC 3HEFA 5IYBJ 3GTOJ 2MC4A 3V7CA 1ZLJA 3CZ6A 4PFPA 3OSFA 1YJNI 2ZFWA 4I99C 2A07F 1WQ2A 1G4DA 3I59A 1FYLA 1RETA 2VL8A 5B1AH 5ERIA 2W24A 1TT5B 3JRHA 1TQPA 4BDZA 3E3VA 5E3LA 2QF7A 1Y6IA 3H0DA 1G8XA 3FZVA 4CSWA 2MC3A 4I02A 4YIFA 2DFIA 2DMQA 4OAYA 3S3OA 1OCPA 1XG1A 1E3HA 1TWFJ 4RAZA 5E1XA 5J4YA 3P5JA 2COMA 1RI7A 1RR7A 4L5JA 1EKEA 3G3ZA 2Z33A 2VN2A 3FK6A 3MVPA 3S15J 5D5VB 4BHCA 4ESBA 1T39A 3ERMA 5HNFA 4HV6A 1NH3A 4L5IA 4A3EJ 3W2VA 4LB6B 2ZBKA 4B3AA 1DP7P 2O7OA 3WTYC 5FLMJ 3HOUJ 1FSHA 4CXFA 2LDUA 1G6NA 3ZXSA 1BI1A 2V1DA 5C4JJ 5DYMA 4KT5C 5GTIC 3BCAA 5D8KB 1B72B 2Q2EA 3BG5A 3K4JA 3K4NA 3M7GA 1JXSA 4F93B 1R1TA 3GTPJ 1XSDA 1V5EA 3UNGC 2KRCA 3T8RA 2CQKA 4CUGA 1FNNA 4G7OF 2R7VA 2DJIA 2Y9ZA 1TTYA 5JLXA 2Y9YA 1H89C 2ZNYA 1X4OA 3GMEA 4RAYA 4F7ZA 2V6EA 3RZDJ 3QP5A 4RS8A 2I8DA 2DYSH 3HB9A 5ICGA 4KMFA 3TBIA 2E2HJ 3ZMZA 3GCMA 2EJRA 2DMTA 2E7XA 3ABLH 4CO8A 2R5YA 1ZR4A 2KRFA 4ZJZA 4ZYAA 1KONA 3DKXA 2JZYA 4KT6A 4MHGA 1FJLA 4UB6C 1TW3A 3FXJA 1MH3A 2QUFA 3PNTA 5K7HA 1G2HA 1MBHA 5LHHA 1Y39A 5FKMA 4DOZA 4XSZF 2AHQA 4B3XA 2LKXA 1UCRA 3Q9VA 2GIZA 3F8BA 4EJOA 4ZTFA 2H1KA 3E6BA 2ME6A 3LQQA 1O3QA 3B02A 3BP8A 1VQOI 1WWXA 5FFZA 5BNGA 3S2HJ 1P7JA 4M3FA 1Z77A 3ABTA 2DCEA 2D45A 2QQ9A 1MMAA 4ENMA 1ZTRA 1JKQC 3ZMTA 1X2MA 2XRLA 1XB4A 5IYCJ 1D5VA 2PBIA 4V2GA 3H5RA 3QPSA 2V7FA 1TL8A 1A04A 2BXYA 1ZLKA 2BHYA 2E60A 1V5FA 3TW7A 3CCQI 4AIDA 4QWQA 3K70D 4Y13A 5EEAA 1FOYA 4M6YA 3ZQLA 2VKVA 4BE1A 2DO7A 3D0SA 1U5TB 2QBYA 1Y56A 1OYWA 5D8LB 3L2RA 1B8IA 3M8JA 1VQMI 4A3FJ 3HOWJ 1VF9A 1W1WE 4IHYA 1X1CA 1VQ5I 2R4GA 3FXQA 4A3JJ 2QCOA 3S1MJ 3OOUA 1P4WA 3HOVJ 4XN0A 1RC9A 1FBUA 2VT2A 2NNYA 3HUGB 1K61A 2DI3A 1SFUA 3ZQFA 2WWYA 3IH2A 4ZYGA 3COAC 2KDZA 5DCMB 4DBRA 4ZC3A 1H9TA 2AXTC 3IRQA 2BV6A 2W4SA 2JK3A 3SZGA 1GV2A 3NEUA 2MBFA 1JHHA 1IF1A 2H1LA 2JUCA 3BQYA 3HRSA 2L4AA 4ZZLA 4IO9F 1BW5A 4AIHA 1JTXA 4I09A 3WTUC 1ZAOA 1YLFA 3SEQA 1NG7A 2R7ZJ 3DTIA 2LF7A 4WXHA 5H20A 2G7UA 2XB5A 2V26A 4ZDLA 4BDYA 1XCVA 1FP2A 2JVHA 3Q5FA 4HQMA 2DA5A 2M8EA 3TGNA 4HW0A 4O3MA 1QQIA 2DFHA 5AIQA 3CJNA 4GO1A 3H36A 5HS8A 1LFPA 2V9VA 3JTHA 1HCRA 3J80Z 2K9MA 1VQKI 1K6YA 3ZMUA 4IXAA 2KZVA 2VUMJ 1ZH5A 5IOZA 2L4MA 1KU2A 4HV5A 2K9NA 2NOGA 1MSFC 5K1YA 3PUFA 4NQWA 3CUOA 3DP7A 4XN3A 2YPRA 4EM2A 3OS1A 1JJ6C 3T0YA 4P1WA 5KCMA 2OU2A 1HSJA 2X0LA 5E3MA 3R60A 3WE2A 2K85A 2WC2A 4DBQA 3S14J 1I39A 4ZYDA 2HQNA 1ETXA 3N4MA 4M3GA 3GO5A 2CO5A 3GTKJ 4PJMA 2HVRA 1AOYA 1QHGA 1KYZA 5DUIA 4RM3A 2Y31A 1WJ5A 3FBIB 4NBQA 1G3TA 4EJUA 1UFMA 3OYKA 2QZ8A 3M8FA 5IY5H 1ZG5A 5J4VA 2L3DA 1X3ZB 1E0EA 5L3GA 1ETQA 2VBWA 1KGSA 2WAQN 2X48A 3FK7A 5C3EJ 2B63J 1NTCA 4PGHA 3ECHA 3GVAA 1YW9A 4XM3A 4JYKA 1FTZA 3KP6A 2CQNA 4ENNA 3HOZJ 1QO0D 1VNDA 2D5VA 1EH7A 3BPXA 3ZN0A 3HYIA 4WXCA 2KLOA 1J0RA 2DTRA 2QQAA 4IRHA 2WAFA 3PNYA 4M3BA 4XLFA 4RB3C 1OMIA 5A2QZ 5M5WJ 3RQ4A 1LEBA 3R0AA 3DLLF 2HVQA 3NWTA 4AVPA 2LBFA 2H6BA 3WGGA 1CGPA 3DF8A 3PUBA 1OCRH 3PSIA 5HDGA 3AKZA 5EG0A 5BPIA 2HQAA 4FT8A 2KHMA 3MN2A 4IL6C 3CMEI 3V4GA 1I3QJ 2EBIA 3I64A 1SFOJ 3F21A 1LQ1A 4CA0A 1SVMA 1A35A 2FMYA 4LIVA 1XS9A 2MGQA 2QVOA 5GP9A 4AVZA 3M07A 4J01A 1JKOC 3ISPA 4I2OA 3HPHA 4S0HB 2FRHA 1C0WA 2ZCWA 1VI0A 4KN7X 1AA7A 4X1EA 3FDYA 3M1CA 3E1SA 4RB0A 2F5FA 4FETA 5H6QA 2ESNA 4LFUA 2DFEA 1BW6A 3KE2A 1TBXA 2EV0A 4XLCA 3WHBA 2Z1DA 5B1BH 2ECBA 3OIPA 2Y0SN 2XGDA 4E7HA 2E5ZA 3DU5A 2VBZA 3EDPA 3F6OA 1USSA 3OSGA 2XV4S 1U8RA 2BOLA 4D7NA 1R71A 1A5JA 2P6SA 5D5WB 2P81A 3C2BA 1KYWA 3HOTA 1R6RA 3JAMZ 2WBMA 1MH4A 1R5ID 3BR6A 4RGUA 2STWA 3Q0UA 2Q8KA 2VQGA 5CVIA 3RPUA 3HL2A 3LMMA 1D8KA 2WY7Q 1EH8A 2KIUA 4XKVA 3NAUA 1MJAA 5AONA 2R0QC 1O7LA 4PDKA 1UG0A 2TRTA 5ICCA 4IHTA 3A03A 3BJAA 3E6DA 4BY1J 3MFKA 2DOFA 5F1JA 2VOPA 3BCBA 3OYJA 2OCCH 2LVSA 2PMHA 4BXUA 3RYRA 1OCCH 2MW8A 3FX3A 1IXRC 1RIOH 3CTAA 4AYBN 1YIJI 1IO2A 1R9TJ 2A05A 1UB9A 4OIRF 1APLC 3PL8A 4HF0A 2E36A 3TO6A 2B0LA 2GA2A 2IGMA 1Z7LA 3JRIA 3T1BA 1KU7A 3MKLA 5HOOA 1MKMA 3MMYB 4AUXA 2VQHA 3I4MJ 5K5RA 4M3DA 1JUPA 5EEGA 5J47A 2GXAA 4XLHA 4XKWA 3SEZA 1X58A 4RA2A 1RRJA 2M8GX 4ENKA 4I7HA 2DN0A 1OR7C 2CJJA 2O0YA 4YELA 5FROA 3SFZA 4HLYA 1VZ0A 2XSDC 1BR4A 1I1GA 3MKWB 2CV0A 3U9GA 2VKHA 4IHVA 4RGRA 4GFBA 1MDMA 1HKTA 1LDJA 4F52A 2EV5A 4JP0A 2BHZA 2DT5A 2XAFA 3M4OJ 4A3LJ 1HQCA 2Y69H 4BBSJ 3AG2H 4BEHB 2COBA 4NC6A 2PLYA 1HW5A 1MJBA 2PMUA 2A3SA 3NRVA 5E3OA 4G7ZF 4AM3A 5CQEA 2JA2A 4OU0A 4UB8C 3TOAA 5BQTA 4HDVA 4A12A 1O3TA 1TWHJ 1V5GA 2L9SA 3A2KA 4HBLA 1I6XA 5BS6A 3CF2A 1FX7A 5BPDA 4PJNA 3V8JA 2ESHA 4I76A 2DJNA 1T08B 2NVXJ 2EPFA 3LSTA 2HS5A 2GBYA 4QTRA 2HEOA 4A5MA 2IA1A 2ISYA 3DBRB 3KFWX 3CESA 2M4GA 3G71I 4C3HJ 1LPQA 4Y3OA 4MO7A 1S6LA 4BY7J 1RZ4A 1MZBA 1IUYA 1FMVA 4RGSA 1R23A 4XLPF 2FNPA 2F48A 4M9XA 1S72I 4IQJA 2NVUB 4JX4A 4MLOA 5IYDJ 3VYRB 3DKWA 1R22A 1WPKA 4UUSB 2OCEA 1OISA 2ZXIA 3CCLI 2NVTJ 2E2JJ 4LG0A 1SD7A 1ETWA 2FJ1A 3O6BB 1IXCA 5F1RA 3I5UA 2X1DA 4NC8A 5HLTA 3EETA 2IPQX 5HDNA 1H88C 5J6XA 3ZCOA 4MQ9F 2DOAA 4M9ZA 3FKJA 4LOCA 5GPCA 1F36A 1H8AC 1IRZA 2KISA 3G2BA 4N4NB 2FUG2 1D1BA 3KCCA 2Y48A 4DYCA 3TP0A 1LEAA 4P9UA 2XKOA 4R1HA 1IRXA 2HZDA 1QGPA 2IA2A 1ZARA 1TNTA 2G9WA 4N0BA 3CUQA 4LJZF 4CHUA 4A3KJ 2E1OA 2VONA 3L2UA 2GQQA 2Z9OA 1ITYA 1W4MA 3G1LA 1DUXC 3AL0C 3HTSB 1LJ9A 4WX9A 3CLOA 5LFAA 1ENHA 4OIQF 1D8JA 2EINH 2QQ8A 3U1DA 1OCZH 4HSRA 4CCJA 4UNOA 1FOXA 2KIQA 1KU9A 2K27A 3ZGKA 3DU6A 2BY3A 1ZG1A 1ZRFA 2AO9A 1XSXA 4JX5A 2OZ6A 2HOAA 3QWLA 4Z2YA 2OTJI 1MNMC 2BY1A 3WTZA 2EWNA 3I56I 4A2UA 2GLOA 4HX7A 1QZEA 2NNNA 1KQ0A 4NDLA 1UHSA 3I3LA 2R5ZA 1ON1A 1DP3A 3A01A 1IN6A 2ZXWH 4KICA 4Y17A 4QLCU 1G3SA 4FE7A 4MTDA 1OYYA 2XSJC 2YU3A 5HLHA 3DBLB 3VDXA 1JI8A 4M6XA 2UZKA 4KITB 2IGNA 2R7OA 4E7SA 4P96A 2V4JC 3GWZA 2V1UA 3JW4A 4PSWA 2KDOA 2HOSA 3GW2A 1A31A 1FC3A 3KP5A 2DA4A 1U6GA 4GYIA 1JUSA 3OWTA 3DFGA 1LVAA 1U2WA 3EUAA 1AU7A 4DQ2A 4PJJA 4RDUA 3H3ZA 4CYDA 3MWMA 3I59B 4IHWA 2MSYA 4L0ZB 2E1CA 2JPBA 1FLIA 4JK1X 3HPGA 4J00A 1IRGA 2VLAA 1JUMA 1VQ8I 4XQFA 2GXGA 3DXJF 2F6CA 2P6TA 4ZH4F 4ZYHA 3RPUD 3OIQA 2VT3A 2LFBA 3G73A 4OWRB 3S3MA 2JRMA 4EJTA 1SANA 3BG3A 2PQ8A 5DCFA 2IAIA 3ULQB 2GA1A 3A02A 2VBYA 2CH0A 1JGSA 4CZCA 2L9VA 5E18F 3ZQHA 2LOOA 4OMZA 3WU0A 3QU3A 3DQVC 4G6DA 3TO7A 4A3MJ 4O6JA 2X6YA 3I9V2 4HX8A 2CQ7A 2RDPA 4KIFA 1BI2A 3DTKA 2J5PA 3R0JA 3QQAA 3ML6A 4RBOA 3MCZA 4LLGF 4UV9A 1XD7A 3FHNA 1R49A 2DBBA 3IP4B 1ZN2A 3B73A 5FKKA 4CCLA 4KDPA 2QLZA 3TO9A 4MEYF 4HF2A 4XNFA 2ELKA 1RR8C 4HEA2 2R7FA 1Y8RB 3HSFA 2ME0A 1S7OA 3J80K 4H4KC 3DV8A 4DZJA 1VQ9I 3IHUA 1CF7A 3CLQA 2KMUA 1XCBA 4D5CA 3BC8A 2Q2EB 2ZJPF 4BHPA 3OYIA 1Z67A 2LTPA 1PUFA 1YHQI 2EIJH 2HDWA 5E8GA 1FP1D 3BR5A 4NHJA 2KJCA 5LGTA 3S1QJ 3C7JA 3DLAA 2VKDA 2QGUA 1WGXA 4CICA 2XVCA 4HOBA 3D5RC 1TWGJ 1P9QC 5L3CA 5M3FJ 3ZMVA 4BYYA 3Q0WA 2ZSHB 4UY8I 1WZ2A 4G12A 1XTAA 3IAS2 1Z0XA 3K6GA 1DPUA 3CDLA 4PGGA 3HJEA 4U0YA 2EZIA 2K4JA 2R5YB 2PMZN 4L9NA 3TP3A 3CO7C 2XGCA 1W36D 5D6EA 1IDYA 3ZOBA 4LK0F 4L9JA 2E1NA 4YFNF 2IXSA 2OA4A 4BQQA 2P8TA 1O57A 3OOPA 3BZKA 3WTTC 4FX4A 2Q1ZB 3CD6I 3Q9SA 4KNYA 2X51A 4B09A 4BGDA 4E70A 4IZZA 4ZDPA 2JUGA 1A6IA 2W00A 2DA7A 3PIPF 2FQ4A 1N77A 2DFFA 3KP7A 5KAIC 1OFCX 2HDDA 3OY9A 1KU3A 1OCOH 1GDTA 1FMWA 3F0CA 3RPQA 5JHUA 2L0KA 4LD5A 1HOMA 1ZYRF 2DT6A 4E7ZA 2CMPA 3CCRI 5A2QK 2QENA 2MABA 4XBFA 4C9YA 4A93J 1M1EB 5J8CA 2QKLB 1G59A 2MG4A 5IT9K 5LBQA 4P9FA 3SQNA 2IT0A 1SFXA 1ETVA 2DU9A 4E6KG 1FPQA 1UELB 1BOBA 1GV5A 1HKQA 3K1PA 2QBYB 3CC2I 2YUSA 2FNAA 1WJDA 5IOYA 1JT6A 2QSFX 3HOXJ 2RKHA 1B8IB 4ZYEA 3S1NJ 1E3PA 2ZO4A 3CCEI 2XHKA 5FKLA 5FD5A 1UMQA 3TMOA 1G3YA 4XORA 3A0HC 3L2QA 1K4SA 2TCTA 1DU0A 5E17F 4I0BA 3K9TA 4E7LA 5H2FC 1STZA 2BEOA 2EA2A 2K86A 3HG9A 4BJTA 4YFXF 1P92A 4XICA 3LAPA 4BACA 1T0FC 4OINF 3HKZN 3H92A 2PN6A 2EZLA 2HFHA 1OR7A 2KQRA 2KZGA 4PZJA 3HOSA 3W6JB 1SMTA 3OS0A 1W5TA 2VE9A 3A1YA 1HW2A 3P9IA 1NK3P 5CVRA 1OKRA 4XOTA 1FYMA 5J3LA 4DW6A 5GTHC 4JX6A 2P5VA 3JAMK 2V79A 1QVTA 3EUHC 5FKOA 1IJWC 2PJRA 1VTNC 3SXYA 1L3LA 3RKYA 2HTSA 4DJAA 3ZQQA 5CPRB 1Y1VJ 2ZJRF 3RIRA 5ED4A 3DEUA 4YIIA 3L2WA 2CW7A 3C2HA 3TDZC 1HDDC 3VEPA 2V1XA 3F72A 3Q0VA 1IG7A 5HLGA 3GZNB 2X6XA 5E20A 2XAJA 4X6AJ 1BM9A 3CJQB 4XLEA 1QA6A 5F08A 1R5GA 1YX3A 3IC7A 4BXFA 4IOCF 2JQ7A 1EH6A 2Z2SB 2FBHA 1AWCA 5GPAA 4QIWN 3RTRA 2BBYA 5F64A 1QHHD 4IEJA 1S3JA 1V54H 2UUZA 2M3AA 4BJ6C 5ICEA 1SAUA 2RQPA 4HZFA 2Y0SA 2NXNB 2E35A 1IW7F 1TLHB 3K2AA 3VYUB 1XX5A 1FSEA 2HQRA 5DV5A 3HM5A 2IRFG 1SD6A 5M3MJ 5L3DA 1GHCA 4FHTA 5DM7F 3H9GA 1DDNA 2EILH 2R7DA 2JJ7A 1GVJA 2FOWA 3MZ8A 2O3FA 4IX7A 4HNVA 2OBPA 2K4BA 3JRCA 1JHFA 3F22A 4M6VA 2VODA 3OYNA 1B1BA 4GXOA 1TW2A 2UV1A 2O8XA 3WGIA 1SFEA 2CW0F 2H94A 1S8NA 3S3NA 2OUMA 3DWLE 1OQYA 1PVEA 3FMQA 1B59A 2QSHX 2LY2A 1MMGA 5K5QA 1XN7A 5JVGF 1VQLI 5KAFC 3PQJA 4ETSA 2VOOA 2DQLA 5EGOA 4MNUA 4MFEA 3TOBA 4BJ5C 3C18A 3IUOA 3DPTA 3KZIC 2MLGA 3L7WA 3KX2A 3ZMSA 2H8RA 2HR3A 2H27A 2OC6A 2LBFB 2E19A 1WVRA 1YG2A 3TEDA 2J5OA 1Z91A 3F8CA 5EG0B 1MBGA 4WF2A 1SC7A 5C44J 3ZRGA 5K5OA 2QYOA 2PX9A 5LD2C 4Y15A 3O8HA 4TV7A 5EJCA 4HPQA 3OMYA 5CVJA 2OF7A 3BROA 2JA7J 3J81Z 1ZQ3P 1YQAA 5ILSA 2LY1A 4Q5SF 2XUBA 4KIGA 4XLAA 2WV1A 3FM5A 3P9CA 2CQQA 1QNTA 4Q4ZF 1WKMA 2KFDA 1T38A 5L3BA 1F4KA 3LOCA 4BXXJ 4Y4RA 2QQBA 4A3IJ 1WJEA 1X1AA 3GLXA 2AQFA 2ELJA 3MZYA 2DAOA 2EIMH 3HTUA 1OCTC 3L1PA 2DA2A 5LLQA 1QVUA 3VYSB 1F5TA 2NS0A 4N9HA 3ABMH 2LH9A 1WJFA 3K2ZA 3BJ6A 2QEXI 5LHIA 4N4OB 3V42A 1OLTA 2JN6A 3SDGA 1RESA 2DXIA 1YE9A 2FXAA 3DPLC 2RVCA 1E17A 4DNCA 1MBJA 5ICFA 3KETA 5EDNA 2VJ5A 3GXOA 2DA3A 1XC5A 3F23A 3GLLA 4HYEA 2L9RA 2ISZA 2H09A 3SZTA 2MH9A 2PI0A 1B9NA 4EATA 3C2GA 3FMRA 2AQEA 2DYRH 2I5UA 2PFBA 2EA4A 3BTIA 2VJ4A 4A0ZA 4HF1A 4II3A 2ZMEB 3HC7A 3H9QA 3CC4I 1RUOA 5J1RA 3ZR8X 1QZZA 3Q3SA 2EZKA 1WFXA 5K7FA 4EGYA 3RSNA 2UWMA 4BBRJ 1F43A 4OAZA 2O6GE 2I10A 1UZCA 2L7FP 3FXUA 2B9SA 1K78A 4DIQA 3W6KB 1G3WA 4YFKF 2K9QA 2P5LC 3F6VA 1NK2P 3BTCA 2CUEA 4ZDOA 2DW4A 1ERDA 1R5HA 2MA3A 4UV8A 1HF0A 3KP4A 2HGCA 4UVAA 2ADUA 3GTGJ 2HOTA 4LGWA 2K3PA 2GOMA 2RNJA 3IWZA 3RI4A 1TWAJ 2M4KA 3B6CA 2FQ3A 5FKNA 2JVGA 3FMSA 3I0TA 2WADA 1PP7U 3GTMJ 4U7DA 2CGPA 4BE2A 1W7PA 5HS9A 5J8FA 3FIWA 2EB7A 2F2EA 3RKXA 1YRNB 1MDMB 4UVCA 3V8KA 4E4HA 5F04A 1IGNA 2X6OA 3FXKA 3I4PA 1YS6A 1EF4A 2F4IA 4M74A 3VOEA 2A5YB 4IKFA 3E5UA 1BR1A 2OTLI 1JJ8C 4KMUX 3PJRA 5D4RA 2ZC2A 5J1YA 1X19A 2YSRA 3K10A 1T6SA 3M1EA 4EQQA 4F3QA 4GDFA 4UHTA 2DPUA 3ABUA 2WA0A 3IAM2 1BA5A 2VPLA 5FO5A 1ZREA 1R1UA 3S17J 1HKSA 4R8HA 3E5XA 2LK2A 4RLQA 1IAWA 2QWWA 3CCVI 1Z3YA 3K4MA 1Z7UA 5KHDA 1AKHA 2R7QA 3H9JA 3F8FA 4E7IA 1HW1A 1IRFA 4W1UA 3CMMA 1IV8A 3KEOA 1Z21A 5B5EC 2HKOA 3OYLA 3HDDA 4LMYA 3I71A 3L2VA 4W97A 5D4SA 4HQEA 1BC7C 3BZ6A 2JA8J 4GRIA 1LNWA 5LEJA 5TGTA 2WY8Q 1HSTA 2K02A 2GZWA 3LA3A 3G6EI 3PFYA 1YS7A 1SFKA 1ZG3A 3K1NA 4LG0B 2O03A 4DYRA 3JRAA 1DGRM 1FBQA 1R4NB 3E6MA 2LKPA 4XSXF 3GYHX 3F9KA 1EJ9A 4M3EA 1Z05A 2CRGA 3EQLF 1VQPI 3CCSI 2QM3A 2EFOA 3DTEA 4Y7NJ 2XPVA 5F0CA 2GIVA 2HOEA 2LF8A 3PFIA 3R6SA 3V7RA 6PAXA 2Q0OA 4F92B 1WJBA 2VASA 1I5ZA 2OPTA 3LA7A 3EGVB 3OL3A 3K4CA 1T95A 4XRSG 5FJ8J 2O5RA 3CUQB 2ZJ2A 3BZCA 4D1QA 1TC3C 4A6DA 3BTLA 1WI3A 1J2XA 1O7FA 1P2FA 2LR8A 4Q47A 4XRMA 1V55H 4RAFA 4WCGA 4G7HF 1B9MA 4AIJA 3ASNH 2EQRA 4LK1F 4RLFA 1TZLA 4FQGA 3T5XA 4D0PA 1D0ZA 2EK5A 2XAGA 3EYYA 2XASA 5EEHA 3EUHA 1IZ1A 2E34A 3GZ6A 3IRRA 3ESWB 4PJLA 5L3EA 1U5TC 4EEFG 1U3EM 1LE8A 3A4CA 3M8EA 2DT7B 3CCYA 4BQAA 4CZZA 2DDBA 4KJZA 2WB1N 2CUFA 2R5ZB 5AIPA 3VSLA 1PJRA 3A01B 2YS9A 1YFHA 4YIRX 3QYFA 1SEUA 3KZYA 3IH3A 2UXXA 4LITA 3RYPA 4BU2A 4IRGA 1XGNA 3HXLA 1XMKA 3HHHA 3RZOJ 1X1PA 1DQUA 1ORKA 2KIMA 2F4MB 1MD0A 2PMZA 4CH7A 2M30A 2IP2A 1ZELA 2EFPA 3KLNA 1VQNI 4XRFA 1BI3A 1Z3XA 2STTA 1QRYA 3IKVA 2A6TA 1REPC 4IPAA 3ELKA 2CV2A 3P9KA 4UUVA 2F5CA 4M9SA 4BHBA 1EV7A 3CP2A 1D5YA 1O3SA 3KEYA 4QPQA 4D9JA 1VQ4I 1I1SA 3SZPA 2VPRA 1V4RA 2JSPA 4MTEA 1WHUA 1PYVA 3GFIA 4LLNA 5CVVA 2IW5A 4OIPF 2VJJA 2BE5F 4KIBA 1K6OA 1R7JA 3BT9A 1JKPC 2DMNA 1HA8A 3ASOH 4I6ZA 4C2TA 4CYCA 3CJSB 4ON0A 4XLNF 3GZ5A 4JOMA 1QPMA 3N97A 1D0YA 3JRFA 2UXNA 3OIOA 3TL4X 3PQKA 2AXLA 3E97A 3CDHA 3MEXA 2LNBA 3K4BA 1XSVA 1H9GA 3FHZA 3BR2A 2NYXA 2BY2A 1ON2A 3WGHA 4GCVA 3WTSC 1Y0NA 4OIOF 3WE3A 1T98A 3CF5F 3E0JB 5E1ZB 3J7ZI 4XR6A 5GAEJ 4A6EA 3BWGA 2LY9A 4IJAA 2ZXJA 1Q1HA 3HRMA 1X3UA 4QSHA 3GFLA 3GUDA 4B47A 4CCOA 1ETKA 2A5WA 5DUKA 2CSOA 2LG4A 1SAXA 2G0EA 3LWFA 3EPZA 1F1ZA 3KYLA 1ZR2A 2HKXA 1E2XA 3C1DA 1FIAA 1JKRC 3QPHA 4L0YB 1CF7B 5DM6F 3SDBA 4RAGA 2HWVA 3HRTA 1PUFB 5CLSA 3M9AA 2QKMB 4HDUA 2NOJB 2EFNA 3CQZJ 4U0VA 2OAZA 3O2PE 3CMAI 3JRGA 1J59A 2HPMA 2A68F 2XAQA 5ILUA 2JMWA 3EYIA 4HRIA 4L9TA 4UUTA 1W7PD 1X4PA 2L2OA 1HLVA 4MFDA 5J40A 1JGGA 2AS5F 3W2WA 1LUJB 2V1NA 2YX4A 4MIMA 3E6CC 2PJPA 2LYCA 2BW3A 2BVLA 2LSOA 1V3FA 1T2KA 3KYCB 3I55I 3OS2A 1Y0UA 1PP8F 2HXIA 4D7MA 3NARA 5JVTA 3MKYB 3MQ0A 2P0WA 4I98B 1QU3A 4EM1A 2RC4A 1YW7A 5FLXZ 2KP6A 4BQOA 2MFZA 2MYSA 1BL0A 3WTVC 2CG4A 1HDPA 2Y75A 2QA4I 2X6WA 4BNCA 4B43A 1MSEC 2JRTA 2Y0MA 4BUPA 3BOQA 3LSRA 1D1AA 2M7BA 2GOXB 4G8XA 1XDSA 1YW8A 1TT0A 2YX7A 1W0TA 2HNHA 4G9YA 1P4XA 3QAHA 3D5SC 2K9LA 3L2CA 2X1CA 2ZMEC 3IKTA 2H8WA 2W84A 3SYTA 2YR2A 4P55A 3B6AA 1TQIA 2P7VB 2A61A 2X1EA 1B4AA 1Z1DA 1XPXA 3HSEA 5JLWA 1RUNA 2W57A 4DGWB 4MGRA 2HPIA 1U9NA 2BY0A 4C2MJ 2CUZA 3J81K 3AAFA 1O3RA 3FXRA 1MMDA 4AD9A 3JREA 3LSMA 3GTJJ 1J5YA 3N05A 2DA1A 1TP4A 2DODA 2M9HA 2MH2A 4GYGA 2HYJA 4F55A 4I0AA 4BL0B 2GM4A 1J75A 1YI2I 5H6RA 1GVDA 1GXQA 2OD5A 4IRIA 3BQZA 1U0JA 2LC2A 4A3DJ 3P7NA 4IF4A 4J19A 1HXDA 1XGMA 5HODA 3OYGA 1FIPA 4BH9A 1BJAA 1IC8A 5JFRA 1P7IA 3HRUA 1LB2A 3OYBA 4B48A 3KZZA 3U21A 4ABZA 2QSGX 3HGYA 3GBGA 3O3KA 1Y1WJ 3KEQA 3BTJA 2IS4A 3CJRB 1Y8QB 2TDXA 4CDGA 4BE0A 3R61A 1JTYA 1XGOA 4RB2C 2FE3A 2O8KA 3SHFA 3VFZA 1W36C 1BIAA 2PJRB 2CW8A 2LP0A 4B4CA 5BOXA 2W25A 2WAQA 4C30A 5CKTA 5LGNA 4XRSA 3ZQIA 2NVYJ 1BC8C 4C2UA 2Z3YA 2BXZA 3ZQGA 1FEXA 1JE8A 3MKZA 2ZSIB 3HHGA 2L7ZA 1B72A 1T8IA 1FZPB 2XROA 5D6FA 4NB5A 1D0XA 3DKYA 1YIOA 2IGOA 2GAUA 5GAGJ 2O61A 2HDCA 1SD4A 2M0CA 2IS1A 4I01A 4YG2F 1X3WB 1RKWA 2IGKA 4U87A 5LHGA 2CQXA 4JQFA 3K1MA 2GXBA 2M34A 2ACJA 2IVMA 3IV5A 5FB2A 5JR3A 2JWTA 3CJTB 2KT0A 5HNHA 2K40A 1POGA 3QYBA 4FASD 4BKXA 2BYVE 5LGUA 1R00A 3C3WA 1W5CC 3OYCA 2LKSA 2EFWA 2DMPA 2XGEA 3CDIA 3LSPA 2HU9A 3LSIA 1FOWA 2XC7A 3D1NI 3KYDB 1DGWY 1WJAA 5F0HA 2BZTA 3E7LA 4HNTA 4HA8A 5E3NA 5FRMA 4RM2A 1UG2A 3OYMA 4HLXA 3OR1C 2VE8A 4OOIA 4B8XA 3FWEA 3M3YJ 5TJJA 4CCNA 4NQWB 2WAEA 1QBJA 3VODA 3AL0B 1GLNA 1MNDA 3CUQC 3I54A 3K0LA 2DPDA 1NHAA 2E7WA 5EGOB 3TKYA 3H5NA 1R58A 1IN7A 1BBYA 4B44A 2KPMA 1FYKA 1FTTA 4UXNA 2NAZA 4C3JJ 3K70C 3W6VA 1P4AA 4ASNA 4DZPA 3LFKA 2JA6J 1S5LC 3WG9A 1N78A 1LFUP 2R7UA 2OZUA 2RREA 4L9VA 2KKOA 3JTGA 3L00A 2LD5A 1U5TA 1OJLA 3TQNA 2VIXA 2P4WA 1ACIA 3DEEA 2M0MA 2M45A 1T56A 5C4XJ 5J1UA 3T8TA 4WK8F 1MNEA 3HOYJ 1I27A 2CU7A 3IH4A 1RKTA 2F5VA 2E71A 4Y33A 1ZGAA 3BR0A 4G6TB 1ONVA 2XPWA 4YEJA 2HQ5A 3GX4X 3PO3J 5ILVA 4R79A 1D1CA 1P6RA 5LEKA 5TRDA 3HUGA 3MZHA 1DU6A 2RAEA 2IS6A 2FD5A 4EV0A 2L54A 3JSPA 4XIDA 4Y52J 5B3SH 5K7ZA 2A6HF 2W85A 5DCMA 4A0YA 4AYBA 2C6YA 1CQTA 1ZRDA 4IHXA 1EA3A 2W1OA 1BI0A 4YRVA 1DPRA 5E1WA 4CCKA 2LLKA 4B1RA 2R3SA 2R93J 5GAHJ 1O4XA 4FX0A 1U8BA 1XMXA 2ZJQF 5LRRA 1KQ9A 2E2IJ 4WWCA 4XK4A 2A69F 1A6QA 3ONQA 2VBXA 2EH3A 2OQGA 3S2DJ 2CYYA 3AG4H 4C3IJ 2VJIA 2CFOA 5DD4A 4IOAF 2DA6A 5B66C 2E1MB 1GUUA 2XDVA 4KN4X 1GXPA 1LDKB 2KRHA 2CV1A 3LA2A 3F3XA 4RGXA 3QU6A 3BG6A 4KA4A 3AG1H 3S32A 2XKPA 3VWBA 3H5AA 2VKEA 1D3YA 3LFUA 2VQLA 2X4HA 4Z6YA 3FBNB 1XGSA 4L18B 5JHFA 1IN5A 1X1DA 2DMUA 2DDAA 2CS3A 3RDIA 1TQMA 4XOPA 1XMAA 3PSFA 1K4TA 1I50J 4K2EA 5EF6A 4E7JA 1K78B 4U88A 3BDDA 2XB0X 2CWEA 2DLLA 3DBHB 3GTQJ 1KA8A 2XF7A 3UKGA 4IVNA 1WJCA 4XMYA 2JTVA 2PEXA 5KVRA 1BIBA 1AHDP 2CFXA 1MBEA 1UHMA 2H6CA 1TNSA 3VB2A 1R4MB 3RCOA 1I6HJ 5IT9Z 1UJ8A 3GF2A 3V8LA 3K7AJ 3NQOA 4AU7A 1ZKGA 2D1HA 2HYGD 5DEQA 4AWXB 1Z9CA 2FMLA 2ZXHA 3OR2C 1S7EA 1WIBA 1YITI 4BAYA 4QPOA 4A3BJ 3O8GA 3RKQA 1K83J 4EMSA 4IHSA 5F27A 4EGZA 1W7PB 3RKWA 3E5QA 2OJED 2Y30A 3ROUA 1HC8A 5HDKA 3EUKL 2FBKA 3S2WA 1WH5A 4PSXA 4A5NA 2DQRA 2EFQA 4KISA 3G1MA 5L3FA 3BG7A 1YJ9I 3H3VK 5JI6A 3KP3A 1IXSB 1I3AA 2EIKH 3U1KA 3BY6A 3MAJA 5CJ9A 3CCJI 2WB1A 2M7AA 3I58A 5HVQC 5DS9A 1RNLA 3LAJA 3PIOF 3RQIA 3BLYA 1ZK8A 2LREA 1S29A 1U9OA 4D5FA 1YX5A 1BR2A 2R7WA 1N25A 2IEKA 2VB6A 2RV8A 1IN8A 4UVBA 1AKHB 2MLKA 3ZQ7A 5D5UB 1MBFA 2JT1A 3WU2C 3OYAA 4LLLA 4NUBA 2VXDA 1A36A 5LRSA 2RN7A 3L9FA 4EJWA 2HYFA 2L5QA 4LB5A 1XDUA 3QODA 5FRNA 1K79A 4XKBA 2D2WA 4E7KA 3OL4A 4EVIA 3JRDA 2ZMEA 2HI3A 1J09A 1BOAA 1MMNA 4LG3A 2FEZA 2FBIA 3LQRA 3ABKH 3CCUI 3DEWA 2M2EA 2OQRA 5IP9J 2LRDA 5EYRA 1ZGWA 1J9IA 1FOKA 2FU4A 3PO2J 4XONA 4ZZDA 5DTDA 4H0EA 3OV8A 1LKXA 3QYEA 5KNLA 1OYIA 3GFMA 5TISC 2Z16A 2B7EA 2RQQA 1SVOA 2M5WA 1Z6TA 2PG4A 2ZB9A 4AC0A 1T33A 2L02A 3I53A 3ZQCA 1X2NA 5CYVA 1YOVB 2XF6A 2IA0A 4S04A 3G4SI 3KP2A 3QOEA 1NG6A 3LSHA 3H35A 3QP6A 1JT0A 4PFOA 3JR9A 1MMSA 4PCQA 1W5SA 3JRBA 3S93A 2IBDA 5BMZA 5IP6A 1MW7A 2HZTA 4ANJA 4WXDA 3H0GJ 3VYTB 4FCYA 2F4OB 1E3OC 4CCMA 4GGGA 3LSJA 5FLXK 2ETHA 1IUFA 5E79C 2FSWA 1YRNA 1USTA 3V7SA 2V6CA 2JPCA 2KIFA 3OYHA 4PJ0C 5CQGA 3QPTA 1LE8B 2R7XA 2XIGA 3AG3H 5FFXA 4U7BA 3ERED 4OMYA 5M5YJ 4KFCA 1LDDA 3BR1A 4ESFA 2Z5UA 4HX4A 2FOKA 3A0BC 3CO6C 4II2A 1ZRCA 3LSGA 2D1VA 2BGCA 1FT9A 1T0FA 1WH7A 2KJBA 3H1CA 1QPIA 1BN5A 4FE4A 3TW6A 1LFBA 1YJWI 1R1VA 5M5XJ
chains in the Genus database with same CATH topology
3I56I 2OTLI 3CCJI 4UY8I 3PIOF 4IO9F 3J7YJ 3I55I 2ZJRF 5GAGJ 2K3FA 5GAHJ 2ZJQF 1VQNI 5GADJ 3CCVI 1QA6A 3CJQB 2QEXI 4IOAF 4IOCF 2JQ7A 2QA4I 3CD6I 1VQ6I 3CJTB 1VQ4I 1VQKI 1Y39A 2NXNB 2E35A 3PIPF 3CCUI 1VQ7I 3G71I 1VQOI 1FOWA 5DM7F 3G6EI 3CJSB 2H8WA 2FOWA 3CCRI 1S72I 3CC7I 1VQ8I 3CC4I 1YJNI 1VQPI 3CCSI 3CCLI 4V19K 3G4SI 3CF5F 3CCQI 3J7ZI 3EGVB 3CC2I 1MMSA 1FOYA 5GAEJ 1YI2I 3CCEI 5JVGF 1VQLI 1YIJI 1WIBA 1YITI 1VQMI 2E36A 1VQ5I 5DM6F 1ACIA 3CCMI 1HC8A 1VQ9I 3CJRB 3CMAI 3DLLF 2E34A 2ZJPF 1FOXA 1YHQI 1YJ9I 3CMEI 2OTJI 1YJWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 I;  2OTL I;  3CCJ I;  4UY8 I;  3PIO F;  4IO9 F;  3J7Y J;  3I55 I;  2ZJR F;  5GAG J;  2K3F A;  5GAH J;  2ZJQ F;  1VQN I;  5GAD J;  3CCV I;  1QA6 A;  3CJQ B;  2QEX I;  4IOA F;  4IOC F;  2JQ7 A;  2QA4 I;  3CD6 I;  1VQ6 I;  3CJT B;  1VQ4 I;  1VQK I;  1Y39 A;  2NXN B;  2E35 A;  3PIP F;  3CCU I;  1VQ7 I;  3G71 I;  1VQO I;  1FOW A;  5DM7 F;  3G6E I;  3CJS B;  2H8W A;  2FOW A;  3CCR I;  1S72 I;  3CC7 I;  1VQ8 I;  3CC4 I;  1YJN I;  1VQP I;  3CCS I;  3CCL I;  4V19 K;  3G4S I;  3CF5 F;  3CCQ I;  3J7Z I;  3EGV B;  3CC2 I;  1MMS A;  1FOY A;  5GAE J;  1YI2 I;  3CCE I;  5JVG F;  1VQL I;  1YIJ I;  1WIB A;  1YIT I;  1VQM I;  2E36 A;  1VQ5 I;  5DM6 F;  1ACI A;  3CCM I;  1HC8 A;  1VQ9 I;  3CJR B;  3CMA I;  3DLL F;  2E34 A;  2ZJP F;  1FOX A;  1YHQ I;  1YJ9 I;  3CME I;  2OTJ I;  1YJW I; 
#chains in the Genus database with same CATH topology
 3K4K A;  5EZH A;  5F0F A;  1VFC A;  4XL9 A;  5FD6 A;  2DOE A;  3KPH A;  2VC1 A;  3J7Y J;  4L5E A;  3K4L A;  2WTE A;  2W82 A;  3L09 A;  3WHC A;  1OPC A;  2KL4 A;  2F5D A;  2P7C B;  3F8N A;  2V9K A;  5FGM A;  2K3F A;  4N9I A;  3J7A Y;  2VXZ A;  3ECO A;  4A0X A;  1ETY A;  2ZFU A;  3LSK A;  2ECC A;  4IQ4 A;  1ETO A;  2FF4 A;  5GAD J;  4Q48 A;  2HTJ A;  3W3C A;  3F8M A;  3LNQ A;  3QRF F;  4BEH A;  1LVK A;  3BJO A;  1ZGJ A;  3BG9 A;  1MBK A;  2K9S A;  1HBX G;  1RPW A;  1PUE E;  2VI6 A;  2YU9 J;  3TDU C;  5D5X B;  2O9L A;  3I4N J;  5HS7 A;  4FTH A;  1KQ8 A;  1Q1V A;  1K7A A;  2XPU A;  1X1B A;  3ZMD A;  4CYC B;  2P5K A;  3FXO A;  1GT0 C;  1ODD A;  3JCU C;  3HBL A;  4RB1 A;  1WSU A;  3W2A A;  2IS2 A;  2R7T A;  1FWZ A;  3ZPL A;  2VQC A;  2RNG A;  3S16 J;  3S8P A;  3S1R J;  3RJP A;  3CP8 A;  1N75 A;  4O5V A;  1UHW A;  1IN4 A;  3OYE A;  2DK5 A;  3FXL A;  1MGT A;  3CC7 I;  4LIU A;  3WOD F;  5IP7 J;  1QZY A;  5IT3 A;  4ZTJ A;  1S9H A;  3JSO A;  4PK4 A;  2XAU A;  1Z6R A;  3VSK A;  1IDZ A;  2JSC A;  3ZP5 A;  2M1B A;  4HST A;  4F91 B;  2ID3 A;  2NS8 A;  4V19 K;  2ZKZ A;  1PDN C;  2XRN A;  2NS7 A;  3WTW C;  2CUJ A;  2XAH A;  3FIS A;  4M71 A;  3DCF A;  3BR3 A;  3PM1 A;  2MD0 A;  4UUS A;  2ZNZ A;  5DDG A;  3D5L A;  1WI9 A;  1YYV A;  4M73 A;  4A3G J;  4G6Q A;  2L01 A;  1J7K A;  3ZN1 A;  3J7A O;  4MEX F;  2V9P A;  1ZHF A;  2LMD A;  2OV7 A;  3BPV A;  2R7R A;  2K5C A;  4G94 A;  1SMY F;  4M72 A;  2DTZ A;  5HLI A;  2ID6 A;  3DPU A;  4S05 A;  1FBS A;  4HAM A;  2NVQ J;  3MD2 A;  4BS9 A;  1WRJ A;  3FXM A;  2ELH A;  2XGX A;  4ENJ A;  3G1O A;  2EZH A;  3SFI A;  1W0U A;  2EV6 A;  1BJZ A;  3REO A;  3CCM I;  2K7L A;  1KZH A;  2W48 A;  2ICW G;  5DD8 A;  4HNU A;  1YTY A;  4HG2 A;  4X0G A;  2M87 A;  3VPR A;  4V2F A;  3WG7 H;  2Z99 A;  2HXO A;  2MD5 A;  4A69 C;  4RMN A;  2BW3 B;  3FM3 A;  3U2R A;  5E8I A;  2HVS A;  4PUS A;  2JA5 J;  2N8G A;  1ULY A;  1IV6 A;  3H3U A;  3HZJ A;  4BQN A;  1SVL A;  1F9N A;  3KLO A;  1UAA A;  3OYD A;  1TWC J;  3NWS A;  2E5N A;  4A3C J;  3K69 A;  3AFH A;  1H0M A;  2FX0 A;  3OYF A;  1L0O C;  4FIS A;  3IL2 A;  4ITV A;  5FLV A;  3SJM A;  2X9D A;  3HKZ A;  2L9N A;  3LL7 A;  4NNJ A;  2W7N A;  4AIK A;  9ANT A;  3GTL J;  3HIF A;  2A6E F;  3R4K A;  2XF5 A;  3HSR A;  3X2Q H;  2VC0 A;  2BVM A;  4MQV A;  1FY7 A;  5KK1 A;  2G7H A;  2L7M P;  2Y2Z A;  4U0W A;  5F6F A;  1U78 A;  3QPL A;  4EJV A;  2E1M C;  3GEZ A;  1S7A A;  1YO5 C;  2X85 A;  5CVU A;  3GFJ A;  1VQ6 I;  3PNV A;  4ESJ A;  2RGV A;  1MJ9 A;  4KYW A;  4DYQ A;  3FKI J;  1B6A A;  1WCM J;  3WU1 B;  2GWR A;  3FF5 A;  3HGG A;  4P5O A;  5EZG A;  1R36 A;  1MIJ A;  2WV0 A;  1VQ7 I;  3CMY A;  2IJL A;  2F5E A;  4KUM A;  4NC7 A;  5IPA A;  1SD5 A;  2L7K A;  4EM0 B;  2DK8 A;  3QOP A;  2R7S A;  2FA5 A;  4JBA A;  3UR3 C;  2R92 J;  4XKC A;  4CGZ A;  3KIO A;  3IWF A;  3WTX C;  2NRA C;  3HEF A;  5IYB J;  3GTO J;  2MC4 A;  3V7C A;  1ZLJ A;  3CZ6 A;  4PFP A;  3OSF A;  1YJN I;  2ZFW A;  4I99 C;  2A07 F;  1WQ2 A;  1G4D A;  3I59 A;  1FYL A;  1RET A;  2VL8 A;  5B1A H;  5ERI A;  2W24 A;  1TT5 B;  3JRH A;  1TQP A;  4BDZ A;  3E3V A;  5E3L A;  2QF7 A;  1Y6I A;  3H0D A;  1G8X A;  3FZV A;  4CSW A;  2MC3 A;  4I02 A;  4YIF A;  2DFI A;  2DMQ A;  4OAY A;  3S3O A;  1OCP A;  1XG1 A;  1E3H A;  1TWF J;  4RAZ A;  5E1X A;  5J4Y A;  3P5J A;  2COM A;  1RI7 A;  1RR7 A;  4L5J A;  1EKE A;  3G3Z A;  2Z33 A;  2VN2 A;  3FK6 A;  3MVP A;  3S15 J;  5D5V B;  4BHC A;  4ESB A;  1T39 A;  3ERM A;  5HNF A;  4HV6 A;  1NH3 A;  4L5I A;  4A3E J;  3W2V A;  4LB6 B;  2ZBK A;  4B3A A;  1DP7 P;  2O7O A;  3WTY C;  5FLM J;  3HOU J;  1FSH A;  4CXF A;  2LDU A;  1G6N A;  3ZXS A;  1BI1 A;  2V1D A;  5C4J J;  5DYM A;  4KT5 C;  5GTI C;  3BCA A;  5D8K B;  1B72 B;  2Q2E A;  3BG5 A;  3K4J A;  3K4N A;  3M7G A;  1JXS A;  4F93 B;  1R1T A;  3GTP J;  1XSD A;  1V5E A;  3UNG C;  2KRC A;  3T8R A;  2CQK A;  4CUG A;  1FNN A;  4G7O F;  2R7V A;  2DJI A;  2Y9Z A;  1TTY A;  5JLX A;  2Y9Y A;  1H89 C;  2ZNY A;  1X4O A;  3GME A;  4RAY A;  4F7Z A;  2V6E A;  3RZD J;  3QP5 A;  4RS8 A;  2I8D A;  2DYS H;  3HB9 A;  5ICG A;  4KMF A;  3TBI A;  2E2H J;  3ZMZ A;  3GCM A;  2EJR A;  2DMT A;  2E7X A;  3ABL H;  4CO8 A;  2R5Y A;  1ZR4 A;  2KRF A;  4ZJZ A;  4ZYA A;  1KON A;  3DKX A;  2JZY A;  4KT6 A;  4MHG A;  1FJL A;  4UB6 C;  1TW3 A;  3FXJ A;  1MH3 A;  2QUF A;  3PNT A;  5K7H A;  1G2H A;  1MBH A;  5LHH A;  1Y39 A;  5FKM A;  4DOZ A;  4XSZ F;  2AHQ A;  4B3X A;  2LKX A;  1UCR A;  3Q9V A;  2GIZ A;  3F8B A;  4EJO A;  4ZTF A;  2H1K A;  3E6B A;  2ME6 A;  3LQQ A;  1O3Q A;  3B02 A;  3BP8 A;  1VQO I;  1WWX A;  5FFZ A;  5BNG A;  3S2H J;  1P7J A;  4M3F A;  1Z77 A;  3ABT A;  2DCE A;  2D45 A;  2QQ9 A;  1MMA A;  4ENM A;  1ZTR A;  1JKQ C;  3ZMT A;  1X2M A;  2XRL A;  1XB4 A;  5IYC J;  1D5V A;  2PBI A;  4V2G A;  3H5R A;  3QPS A;  2V7F A;  1TL8 A;  1A04 A;  2BXY A;  1ZLK A;  2BHY A;  2E60 A;  1V5F A;  3TW7 A;  3CCQ I;  4AID A;  4QWQ A;  3K70 D;  4Y13 A;  5EEA A;  1FOY A;  4M6Y A;  3ZQL A;  2VKV A;  4BE1 A;  2DO7 A;  3D0S A;  1U5T B;  2QBY A;  1Y56 A;  1OYW A;  5D8L B;  3L2R A;  1B8I A;  3M8J A;  1VQM I;  4A3F J;  3HOW J;  1VF9 A;  1W1W E;  4IHY A;  1X1C A;  1VQ5 I;  2R4G A;  3FXQ A;  4A3J J;  2QCO A;  3S1M J;  3OOU A;  1P4W A;  3HOV J;  4XN0 A;  1RC9 A;  1FBU A;  2VT2 A;  2NNY A;  3HUG B;  1K61 A;  2DI3 A;  1SFU A;  3ZQF A;  2WWY A;  3IH2 A;  4ZYG A;  3COA C;  2KDZ A;  5DCM B;  4DBR A;  4ZC3 A;  1H9T A;  2AXT C;  3IRQ A;  2BV6 A;  2W4S A;  2JK3 A;  3SZG A;  1GV2 A;  3NEU A;  2MBF A;  1JHH A;  1IF1 A;  2H1L A;  2JUC A;  3BQY A;  3HRS A;  2L4A A;  4ZZL A;  4IO9 F;  1BW5 A;  4AIH A;  1JTX A;  4I09 A;  3WTU C;  1ZAO A;  1YLF A;  3SEQ A;  1NG7 A;  2R7Z J;  3DTI A;  2LF7 A;  4WXH A;  5H20 A;  2G7U A;  2XB5 A;  2V26 A;  4ZDL A;  4BDY A;  1XCV A;  1FP2 A;  2JVH A;  3Q5F A;  4HQM A;  2DA5 A;  2M8E A;  3TGN A;  4HW0 A;  4O3M A;  1QQI A;  2DFH A;  5AIQ A;  3CJN A;  4GO1 A;  3H36 A;  5HS8 A;  1LFP A;  2V9V A;  3JTH A;  1HCR A;  3J80 Z;  2K9M A;  1VQK I;  1K6Y A;  3ZMU A;  4IXA A;  2KZV A;  2VUM J;  1ZH5 A;  5IOZ A;  2L4M A;  1KU2 A;  4HV5 A;  2K9N A;  2NOG A;  1MSF C;  5K1Y A;  3PUF A;  4NQW A;  3CUO A;  3DP7 A;  4XN3 A;  2YPR A;  4EM2 A;  3OS1 A;  1JJ6 C;  3T0Y A;  4P1W A;  5KCM A;  2OU2 A;  1HSJ A;  2X0L A;  5E3M A;  3R60 A;  3WE2 A;  2K85 A;  2WC2 A;  4DBQ A;  3S14 J;  1I39 A;  4ZYD A;  2HQN A;  1ETX A;  3N4M A;  4M3G A;  3GO5 A;  2CO5 A;  3GTK J;  4PJM A;  2HVR A;  1AOY A;  1QHG A;  1KYZ A;  5DUI A;  4RM3 A;  2Y31 A;  1WJ5 A;  3FBI B;  4NBQ A;  1G3T A;  4EJU A;  1UFM A;  3OYK A;  2QZ8 A;  3M8F A;  5IY5 H;  1ZG5 A;  5J4V A;  2L3D A;  1X3Z B;  1E0E A;  5L3G A;  1ETQ A;  2VBW A;  1KGS A;  2WAQ N;  2X48 A;  3FK7 A;  5C3E J;  2B63 J;  1NTC A;  4PGH A;  3ECH A;  3GVA A;  1YW9 A;  4XM3 A;  4JYK A;  1FTZ A;  3KP6 A;  2CQN A;  4ENN A;  3HOZ J;  1QO0 D;  1VND A;  2D5V A;  1EH7 A;  3BPX A;  3ZN0 A;  3HYI A;  4WXC A;  2KLO A;  1J0R A;  2DTR A;  2QQA A;  4IRH A;  2WAF A;  3PNY A;  4M3B A;  4XLF A;  4RB3 C;  1OMI A;  5A2Q Z;  5M5W J;  3RQ4 A;  1LEB A;  3R0A A;  3DLL F;  2HVQ A;  3NWT A;  4AVP A;  2LBF A;  2H6B A;  3WGG A;  1CGP A;  3DF8 A;  3PUB A;  1OCR H;  3PSI A;  5HDG A;  3AKZ A;  5EG0 A;  5BPI A;  2HQA A;  4FT8 A;  2KHM A;  3MN2 A;  4IL6 C;  3CME I;  3V4G A;  1I3Q J;  2EBI A;  3I64 A;  1SFO J;  3F21 A;  1LQ1 A;  4CA0 A;  1SVM A;  1A35 A;  2FMY A;  4LIV A;  1XS9 A;  2MGQ A;  2QVO A;  5GP9 A;  4AVZ A;  3M07 A;  4J01 A;  1JKO C;  3ISP A;  4I2O A;  3HPH A;  4S0H B;  2FRH A;  1C0W A;  2ZCW A;  1VI0 A;  4KN7 X;  1AA7 A;  4X1E A;  3FDY A;  3M1C A;  3E1S A;  4RB0 A;  2F5F A;  4FET A;  5H6Q A;  2ESN A;  4LFU A;  2DFE A;  1BW6 A;  3KE2 A;  1TBX A;  2EV0 A;  4XLC A;  3WHB A;  2Z1D A;  5B1B H;  2ECB A;  3OIP A;  2Y0S N;  2XGD A;  4E7H A;  2E5Z A;  3DU5 A;  2VBZ A;  3EDP A;  3F6O A;  1USS A;  3OSG A;  2XV4 S;  1U8R A;  2BOL A;  4D7N A;  1R71 A;  1A5J A;  2P6S A;  5D5W B;  2P81 A;  3C2B A;  1KYW A;  3HOT A;  1R6R A;  3JAM Z;  2WBM A;  1MH4 A;  1R5I D;  3BR6 A;  4RGU A;  2STW A;  3Q0U A;  2Q8K A;  2VQG A;  5CVI A;  3RPU A;  3HL2 A;  3LMM A;  1D8K A;  2WY7 Q;  1EH8 A;  2KIU A;  4XKV A;  3NAU A;  1MJA A;  5AON A;  2R0Q C;  1O7L A;  4PDK A;  1UG0 A;  2TRT A;  5ICC A;  4IHT A;  3A03 A;  3BJA A;  3E6D A;  4BY1 J;  3MFK A;  2DOF A;  5F1J A;  2VOP A;  3BCB A;  3OYJ A;  2OCC H;  2LVS A;  2PMH A;  4BXU A;  3RYR A;  1OCC H;  2MW8 A;  3FX3 A;  1IXR C;  1RIO H;  3CTA A;  4AYB N;  1YIJ I;  1IO2 A;  1R9T J;  2A05 A;  1UB9 A;  4OIR F;  1APL C;  3PL8 A;  4HF0 A;  2E36 A;  3TO6 A;  2B0L A;  2GA2 A;  2IGM A;  1Z7L A;  3JRI A;  3T1B A;  1KU7 A;  3MKL A;  5HOO A;  1MKM A;  3MMY B;  4AUX A;  2VQH A;  3I4M J;  5K5R A;  4M3D A;  1JUP A;  5EEG A;  5J47 A;  2GXA A;  4XLH A;  4XKW A;  3SEZ A;  1X58 A;  4RA2 A;  1RRJ A;  2M8G X;  4ENK A;  4I7H A;  2DN0 A;  1OR7 C;  2CJJ A;  2O0Y A;  4YEL A;  5FRO A;  3SFZ A;  4HLY A;  1VZ0 A;  2XSD C;  1BR4 A;  1I1G A;  3MKW B;  2CV0 A;  3U9G A;  2VKH A;  4IHV A;  4RGR A;  4GFB A;  1MDM A;  1HKT A;  1LDJ A;  4F52 A;  2EV5 A;  4JP0 A;  2BHZ A;  2DT5 A;  2XAF A;  3M4O J;  4A3L J;  1HQC A;  2Y69 H;  4BBS J;  3AG2 H;  4BEH B;  2COB A;  4NC6 A;  2PLY A;  1HW5 A;  1MJB A;  2PMU A;  2A3S A;  3NRV A;  5E3O A;  4G7Z F;  4AM3 A;  5CQE A;  2JA2 A;  4OU0 A;  4UB8 C;  3TOA A;  5BQT A;  4HDV A;  4A12 A;  1O3T A;  1TWH J;  1V5G A;  2L9S A;  3A2K A;  4HBL A;  1I6X A;  5BS6 A;  3CF2 A;  1FX7 A;  5BPD A;  4PJN A;  3V8J A;  2ESH A;  4I76 A;  2DJN A;  1T08 B;  2NVX J;  2EPF A;  3LST A;  2HS5 A;  2GBY A;  4QTR A;  2HEO A;  4A5M A;  2IA1 A;  2ISY A;  3DBR B;  3KFW X;  3CES A;  2M4G A;  3G71 I;  4C3H J;  1LPQ A;  4Y3O A;  4MO7 A;  1S6L A;  4BY7 J;  1RZ4 A;  1MZB A;  1IUY A;  1FMV A;  4RGS A;  1R23 A;  4XLP F;  2FNP A;  2F48 A;  4M9X A;  1S72 I;  4IQJ A;  2NVU B;  4JX4 A;  4MLO A;  5IYD J;  3VYR B;  3DKW A;  1R22 A;  1WPK A;  4UUS B;  2OCE A;  1OIS A;  2ZXI A;  3CCL I;  2NVT J;  2E2J J;  4LG0 A;  1SD7 A;  1ETW A;  2FJ1 A;  3O6B B;  1IXC A;  5F1R A;  3I5U A;  2X1D A;  4NC8 A;  5HLT A;  3EET A;  2IPQ X;  5HDN A;  1H88 C;  5J6X A;  3ZCO A;  4MQ9 F;  2DOA A;  4M9Z A;  3FKJ A;  4LOC A;  5GPC A;  1F36 A;  1H8A C;  1IRZ A;  2KIS A;  3G2B A;  4N4N B;  2FUG 2;  1D1B A;  3KCC A;  2Y48 A;  4DYC A;  3TP0 A;  1LEA A;  4P9U A;  2XKO A;  4R1H A;  1IRX A;  2HZD A;  1QGP A;  2IA2 A;  1ZAR A;  1TNT A;  2G9W A;  4N0B A;  3CUQ A;  4LJZ F;  4CHU A;  4A3K J;  2E1O A;  2VON A;  3L2U A;  2GQQ A;  2Z9O A;  1ITY A;  1W4M A;  3G1L A;  1DUX C;  3AL0 C;  3HTS B;  1LJ9 A;  4WX9 A;  3CLO A;  5LFA A;  1ENH A;  4OIQ F;  1D8J A;  2EIN H;  2QQ8 A;  3U1D A;  1OCZ H;  4HSR A;  4CCJ A;  4UNO A;  1FOX A;  2KIQ A;  1KU9 A;  2K27 A;  3ZGK A;  3DU6 A;  2BY3 A;  1ZG1 A;  1ZRF A;  2AO9 A;  1XSX A;  4JX5 A;  2OZ6 A;  2HOA A;  3QWL A;  4Z2Y A;  2OTJ I;  1MNM C;  2BY1 A;  3WTZ A;  2EWN A;  3I56 I;  4A2U A;  2GLO A;  4HX7 A;  1QZE A;  2NNN A;  1KQ0 A;  4NDL A;  1UHS A;  3I3L A;  2R5Z A;  1ON1 A;  1DP3 A;  3A01 A;  1IN6 A;  2ZXW H;  4KIC A;  4Y17 A;  4QLC U;  1G3S A;  4FE7 A;  4MTD A;  1OYY A;  2XSJ C;  2YU3 A;  5HLH A;  3DBL B;  3VDX A;  1JI8 A;  4M6X A;  2UZK A;  4KIT B;  2IGN A;  2R7O A;  4E7S A;  4P96 A;  2V4J C;  3GWZ A;  2V1U A;  3JW4 A;  4PSW A;  2KDO A;  2HOS A;  3GW2 A;  1A31 A;  1FC3 A;  3KP5 A;  2DA4 A;  1U6G A;  4GYI A;  1JUS A;  3OWT A;  3DFG A;  1LVA A;  1U2W A;  3EUA A;  1AU7 A;  4DQ2 A;  4PJJ A;  4RDU A;  3H3Z A;  4CYD A;  3MWM A;  3I59 B;  4IHW A;  2MSY A;  4L0Z B;  2E1C A;  2JPB A;  1FLI A;  4JK1 X;  3HPG A;  4J00 A;  1IRG A;  2VLA A;  1JUM A;  1VQ8 I;  4XQF A;  2GXG A;  3DXJ F;  2F6C A;  2P6T A;  4ZH4 F;  4ZYH A;  3RPU D;  3OIQ A;  2VT3 A;  2LFB A;  3G73 A;  4OWR B;  3S3M A;  2JRM A;  4EJT A;  1SAN A;  3BG3 A;  2PQ8 A;  5DCF A;  2IAI A;  3ULQ B;  2GA1 A;  3A02 A;  2VBY A;  2CH0 A;  1JGS A;  4CZC A;  2L9V A;  5E18 F;  3ZQH A;  2LOO A;  4OMZ A;  3WU0 A;  3QU3 A;  3DQV C;  4G6D A;  3TO7 A;  4A3M J;  4O6J A;  2X6Y A;  3I9V 2;  4HX8 A;  2CQ7 A;  2RDP A;  4KIF A;  1BI2 A;  3DTK A;  2J5P A;  3R0J A;  3QQA A;  3ML6 A;  4RBO A;  3MCZ A;  4LLG F;  4UV9 A;  1XD7 A;  3FHN A;  1R49 A;  2DBB A;  3IP4 B;  1ZN2 A;  3B73 A;  5FKK A;  4CCL A;  4KDP A;  2QLZ A;  3TO9 A;  4MEY F;  4HF2 A;  4XNF A;  2ELK A;  1RR8 C;  4HEA 2;  2R7F A;  1Y8R B;  3HSF A;  2ME0 A;  1S7O A;  3J80 K;  4H4K C;  3DV8 A;  4DZJ A;  1VQ9 I;  3IHU A;  1CF7 A;  3CLQ A;  2KMU A;  1XCB A;  4D5C A;  3BC8 A;  2Q2E B;  2ZJP F;  4BHP A;  3OYI A;  1Z67 A;  2LTP A;  1PUF A;  1YHQ I;  2EIJ H;  2HDW A;  5E8G A;  1FP1 D;  3BR5 A;  4NHJ A;  2KJC A;  5LGT A;  3S1Q J;  3C7J A;  3DLA A;  2VKD A;  2QGU A;  1WGX A;  4CIC A;  2XVC A;  4HOB A;  3D5R C;  1TWG J;  1P9Q C;  5L3C A;  5M3F J;  3ZMV A;  4BYY A;  3Q0W A;  2ZSH B;  4UY8 I;  1WZ2 A;  4G12 A;  1XTA A;  3IAS 2;  1Z0X A;  3K6G A;  1DPU A;  3CDL A;  4PGG A;  3HJE A;  4U0Y A;  2EZI A;  2K4J A;  2R5Y B;  2PMZ N;  4L9N A;  3TP3 A;  3CO7 C;  2XGC A;  1W36 D;  5D6E A;  1IDY A;  3ZOB A;  4LK0 F;  4L9J A;  2E1N A;  4YFN F;  2IXS A;  2OA4 A;  4BQQ A;  2P8T A;  1O57 A;  3OOP A;  3BZK A;  3WTT C;  4FX4 A;  2Q1Z B;  3CD6 I;  3Q9S A;  4KNY A;  2X51 A;  4B09 A;  4BGD A;  4E70 A;  4IZZ A;  4ZDP A;  2JUG A;  1A6I A;  2W00 A;  2DA7 A;  3PIP F;  2FQ4 A;  1N77 A;  2DFF A;  3KP7 A;  5KAI C;  1OFC X;  2HDD A;  3OY9 A;  1KU3 A;  1OCO H;  1GDT A;  1FMW A;  3F0C A;  3RPQ A;  5JHU A;  2L0K A;  4LD5 A;  1HOM A;  1ZYR F;  2DT6 A;  4E7Z A;  2CMP A;  3CCR I;  5A2Q K;  2QEN A;  2MAB A;  4XBF A;  4C9Y A;  4A93 J;  1M1E B;  5J8C A;  2QKL B;  1G59 A;  2MG4 A;  5IT9 K;  5LBQ A;  4P9F A;  3SQN A;  2IT0 A;  1SFX A;  1ETV A;  2DU9 A;  4E6K G;  1FPQ A;  1UEL B;  1BOB A;  1GV5 A;  1HKQ A;  3K1P A;  2QBY B;  3CC2 I;  2YUS A;  2FNA A;  1WJD A;  5IOY A;  1JT6 A;  2QSF X;  3HOX J;  2RKH A;  1B8I B;  4ZYE A;  3S1N J;  1E3P A;  2ZO4 A;  3CCE I;  2XHK A;  5FKL A;  5FD5 A;  1UMQ A;  3TMO A;  1G3Y A;  4XOR A;  3A0H C;  3L2Q A;  1K4S A;  2TCT A;  1DU0 A;  5E17 F;  4I0B A;  3K9T A;  4E7L A;  5H2F C;  1STZ A;  2BEO A;  2EA2 A;  2K86 A;  3HG9 A;  4BJT A;  4YFX F;  1P92 A;  4XIC A;  3LAP A;  4BAC A;  1T0F C;  4OIN F;  3HKZ N;  3H92 A;  2PN6 A;  2EZL A;  2HFH A;  1OR7 A;  2KQR A;  2KZG A;  4PZJ A;  3HOS A;  3W6J B;  1SMT A;  3OS0 A;  1W5T A;  2VE9 A;  3A1Y A;  1HW2 A;  3P9I A;  1NK3 P;  5CVR A;  1OKR A;  4XOT A;  1FYM A;  5J3L A;  4DW6 A;  5GTH C;  4JX6 A;  2P5V A;  3JAM K;  2V79 A;  1QVT A;  3EUH C;  5FKO A;  1IJW C;  2PJR A;  1VTN C;  3SXY A;  1L3L A;  3RKY A;  2HTS A;  4DJA A;  3ZQQ A;  5CPR B;  1Y1V J;  2ZJR F;  3RIR A;  5ED4 A;  3DEU A;  4YII A;  3L2W A;  2CW7 A;  3C2H A;  3TDZ C;  1HDD C;  3VEP A;  2V1X A;  3F72 A;  3Q0V A;  1IG7 A;  5HLG A;  3GZN B;  2X6X A;  5E20 A;  2XAJ A;  4X6A J;  1BM9 A;  3CJQ B;  4XLE A;  1QA6 A;  5F08 A;  1R5G A;  1YX3 A;  3IC7 A;  4BXF A;  4IOC F;  2JQ7 A;  1EH6 A;  2Z2S B;  2FBH A;  1AWC A;  5GPA A;  4QIW N;  3RTR A;  2BBY A;  5F64 A;  1QHH D;  4IEJ A;  1S3J A;  1V54 H;  2UUZ A;  2M3A A;  4BJ6 C;  5ICE A;  1SAU A;  2RQP A;  4HZF A;  2Y0S A;  2NXN B;  2E35 A;  1IW7 F;  1TLH B;  3K2A A;  3VYU B;  1XX5 A;  1FSE A;  2HQR A;  5DV5 A;  3HM5 A;  2IRF G;  1SD6 A;  5M3M J;  5L3D A;  1GHC A;  4FHT A;  5DM7 F;  3H9G A;  1DDN A;  2EIL H;  2R7D A;  2JJ7 A;  1GVJ A;  2FOW A;  3MZ8 A;  2O3F A;  4IX7 A;  4HNV A;  2OBP A;  2K4B A;  3JRC A;  1JHF A;  3F22 A;  4M6V A;  2VOD A;  3OYN A;  1B1B A;  4GXO A;  1TW2 A;  2UV1 A;  2O8X A;  3WGI A;  1SFE A;  2CW0 F;  2H94 A;  1S8N A;  3S3N A;  2OUM A;  3DWL E;  1OQY A;  1PVE A;  3FMQ A;  1B59 A;  2QSH X;  2LY2 A;  1MMG A;  5K5Q A;  1XN7 A;  5JVG F;  1VQL I;  5KAF C;  3PQJ A;  4ETS A;  2VOO A;  2DQL A;  5EGO A;  4MNU A;  4MFE A;  3TOB A;  4BJ5 C;  3C18 A;  3IUO A;  3DPT A;  3KZI C;  2MLG A;  3L7W A;  3KX2 A;  3ZMS A;  2H8R A;  2HR3 A;  2H27 A;  2OC6 A;  2LBF B;  2E19 A;  1WVR A;  1YG2 A;  3TED A;  2J5O A;  1Z91 A;  3F8C A;  5EG0 B;  1MBG A;  4WF2 A;  1SC7 A;  5C44 J;  3ZRG A;  5K5O A;  2QYO A;  2PX9 A;  5LD2 C;  4Y15 A;  3O8H A;  4TV7 A;  5EJC A;  4HPQ A;  3OMY A;  5CVJ A;  2OF7 A;  3BRO A;  2JA7 J;  3J81 Z;  1ZQ3 P;  1YQA A;  5ILS A;  2LY1 A;  4Q5S F;  2XUB A;  4KIG A;  4XLA A;  2WV1 A;  3FM5 A;  3P9C A;  2CQQ A;  1QNT A;  4Q4Z F;  1WKM A;  2KFD A;  1T38 A;  5L3B A;  1F4K A;  3LOC A;  4BXX J;  4Y4R A;  2QQB A;  4A3I J;  1WJE A;  1X1A A;  3GLX A;  2AQF A;  2ELJ A;  3MZY A;  2DAO A;  2EIM H;  3HTU A;  1OCT C;  3L1P A;  2DA2 A;  5LLQ A;  1QVU A;  3VYS B;  1F5T A;  2NS0 A;  4N9H A;  3ABM H;  2LH9 A;  1WJF A;  3K2Z A;  3BJ6 A;  2QEX I;  5LHI A;  4N4O B;  3V42 A;  1OLT A;  2JN6 A;  3SDG A;  1RES A;  2DXI A;  1YE9 A;  2FXA A;  3DPL C;  2RVC A;  1E17 A;  4DNC A;  1MBJ A;  5ICF A;  3KET A;  5EDN A;  2VJ5 A;  3GXO A;  2DA3 A;  1XC5 A;  3F23 A;  3GLL A;  4HYE A;  2L9R A;  2ISZ A;  2H09 A;  3SZT A;  2MH9 A;  2PI0 A;  1B9N A;  4EAT A;  3C2G A;  3FMR A;  2AQE A;  2DYR H;  2I5U A;  2PFB A;  2EA4 A;  3BTI A;  2VJ4 A;  4A0Z A;  4HF1 A;  4II3 A;  2ZME B;  3HC7 A;  3H9Q A;  3CC4 I;  1RUO A;  5J1R A;  3ZR8 X;  1QZZ A;  3Q3S A;  2EZK A;  1WFX A;  5K7F A;  4EGY A;  3RSN A;  2UWM A;  4BBR J;  1F43 A;  4OAZ A;  2O6G E;  2I10 A;  1UZC A;  2L7F P;  3FXU A;  2B9S A;  1K78 A;  4DIQ A;  3W6K B;  1G3W A;  4YFK F;  2K9Q A;  2P5L C;  3F6V A;  1NK2 P;  3BTC A;  2CUE A;  4ZDO A;  2DW4 A;  1ERD A;  1R5H A;  2MA3 A;  4UV8 A;  1HF0 A;  3KP4 A;  2HGC A;  4UVA A;  2ADU A;  3GTG J;  2HOT A;  4LGW A;  2K3P A;  2GOM A;  2RNJ A;  3IWZ A;  3RI4 A;  1TWA J;  2M4K A;  3B6C A;  2FQ3 A;  5FKN A;  2JVG A;  3FMS A;  3I0T A;  2WAD A;  1PP7 U;  3GTM J;  4U7D A;  2CGP A;  4BE2 A;  1W7P A;  5HS9 A;  5J8F A;  3FIW A;  2EB7 A;  2F2E A;  3RKX A;  1YRN B;  1MDM B;  4UVC A;  3V8K A;  4E4H A;  5F04 A;  1IGN A;  2X6O A;  3FXK A;  3I4P A;  1YS6 A;  1EF4 A;  2F4I A;  4M74 A;  3VOE A;  2A5Y B;  4IKF A;  3E5U A;  1BR1 A;  2OTL I;  1JJ8 C;  4KMU X;  3PJR A;  5D4R A;  2ZC2 A;  5J1Y A;  1X19 A;  2YSR A;  3K10 A;  1T6S A;  3M1E A;  4EQQ A;  4F3Q A;  4GDF A;  4UHT A;  2DPU A;  3ABU A;  2WA0 A;  3IAM 2;  1BA5 A;  2VPL A;  5FO5 A;  1ZRE A;  1R1U A;  3S17 J;  1HKS A;  4R8H A;  3E5X A;  2LK2 A;  4RLQ A;  1IAW A;  2QWW A;  3CCV I;  1Z3Y A;  3K4M A;  1Z7U A;  5KHD A;  1AKH A;  2R7Q A;  3H9J A;  3F8F A;  4E7I A;  1HW1 A;  1IRF A;  4W1U A;  3CMM A;  1IV8 A;  3KEO A;  1Z21 A;  5B5E C;  2HKO A;  3OYL A;  3HDD A;  4LMY A;  3I71 A;  3L2V A;  4W97 A;  5D4S A;  4HQE A;  1BC7 C;  3BZ6 A;  2JA8 J;  4GRI A;  1LNW A;  5LEJ A;  5TGT A;  2WY8 Q;  1HST A;  2K02 A;  2GZW A;  3LA3 A;  3G6E I;  3PFY A;  1YS7 A;  1SFK A;  1ZG3 A;  3K1N A;  4LG0 B;  2O03 A;  4DYR A;  3JRA A;  1DGR M;  1FBQ A;  1R4N B;  3E6M A;  2LKP A;  4XSX F;  3GYH X;  3F9K A;  1EJ9 A;  4M3E A;  1Z05 A;  2CRG A;  3EQL F;  1VQP I;  3CCS I;  2QM3 A;  2EFO A;  3DTE A;  4Y7N J;  2XPV A;  5F0C A;  2GIV A;  2HOE A;  2LF8 A;  3PFI A;  3R6S A;  3V7R A;  6PAX A;  2Q0O A;  4F92 B;  1WJB A;  2VAS A;  1I5Z A;  2OPT A;  3LA7 A;  3EGV B;  3OL3 A;  3K4C A;  1T95 A;  4XRS G;  5FJ8 J;  2O5R A;  3CUQ B;  2ZJ2 A;  3BZC A;  4D1Q A;  1TC3 C;  4A6D A;  3BTL A;  1WI3 A;  1J2X A;  1O7F A;  1P2F A;  2LR8 A;  4Q47 A;  4XRM A;  1V55 H;  4RAF A;  4WCG A;  4G7H F;  1B9M A;  4AIJ A;  3ASN H;  2EQR A;  4LK1 F;  4RLF A;  1TZL A;  4FQG A;  3T5X A;  4D0P A;  1D0Z A;  2EK5 A;  2XAG A;  3EYY A;  2XAS A;  5EEH A;  3EUH A;  1IZ1 A;  2E34 A;  3GZ6 A;  3IRR A;  3ESW B;  4PJL A;  5L3E A;  1U5T C;  4EEF G;  1U3E M;  1LE8 A;  3A4C A;  3M8E A;  2DT7 B;  3CCY A;  4BQA A;  4CZZ A;  2DDB A;  4KJZ A;  2WB1 N;  2CUF A;  2R5Z B;  5AIP A;  3VSL A;  1PJR A;  3A01 B;  2YS9 A;  1YFH A;  4YIR X;  3QYF A;  1SEU A;  3KZY A;  3IH3 A;  2UXX A;  4LIT A;  3RYP A;  4BU2 A;  4IRG A;  1XGN A;  3HXL A;  1XMK A;  3HHH A;  3RZO J;  1X1P A;  1DQU A;  1ORK A;  2KIM A;  2F4M B;  1MD0 A;  2PMZ A;  4CH7 A;  2M30 A;  2IP2 A;  1ZEL A;  2EFP A;  3KLN A;  1VQN I;  4XRF A;  1BI3 A;  1Z3X A;  2STT A;  1QRY A;  3IKV A;  2A6T A;  1REP C;  4IPA A;  3ELK A;  2CV2 A;  3P9K A;  4UUV A;  2F5C A;  4M9S A;  4BHB A;  1EV7 A;  3CP2 A;  1D5Y A;  1O3S A;  3KEY A;  4QPQ A;  4D9J A;  1VQ4 I;  1I1S A;  3SZP A;  2VPR A;  1V4R A;  2JSP A;  4MTE A;  1WHU A;  1PYV A;  3GFI A;  4LLN A;  5CVV A;  2IW5 A;  4OIP F;  2VJJ A;  2BE5 F;  4KIB A;  1K6O A;  1R7J A;  3BT9 A;  1JKP C;  2DMN A;  1HA8 A;  3ASO H;  4I6Z A;  4C2T A;  4CYC A;  3CJS B;  4ON0 A;  4XLN F;  3GZ5 A;  4JOM A;  1QPM A;  3N97 A;  1D0Y A;  3JRF A;  2UXN A;  3OIO A;  3TL4 X;  3PQK A;  2AXL A;  3E97 A;  3CDH A;  3MEX A;  2LNB A;  3K4B A;  1XSV A;  1H9G A;  3FHZ A;  3BR2 A;  2NYX A;  2BY2 A;  1ON2 A;  3WGH A;  4GCV A;  3WTS C;  1Y0N A;  4OIO F;  3WE3 A;  1T98 A;  3CF5 F;  3E0J B;  5E1Z B;  3J7Z I;  4XR6 A;  5GAE J;  4A6E A;  3BWG A;  2LY9 A;  4IJA A;  2ZXJ A;  1Q1H A;  3HRM A;  1X3U A;  4QSH A;  3GFL A;  3GUD A;  4B47 A;  4CCO A;  1ETK A;  2A5W A;  5DUK A;  2CSO A;  2LG4 A;  1SAX A;  2G0E A;  3LWF A;  3EPZ A;  1F1Z A;  3KYL A;  1ZR2 A;  2HKX A;  1E2X A;  3C1D A;  1FIA A;  1JKR C;  3QPH A;  4L0Y B;  1CF7 B;  5DM6 F;  3SDB A;  4RAG A;  2HWV A;  3HRT A;  1PUF B;  5CLS A;  3M9A A;  2QKM B;  4HDU A;  2NOJ B;  2EFN A;  3CQZ J;  4U0V A;  2OAZ A;  3O2P E;  3CMA I;  3JRG A;  1J59 A;  2HPM A;  2A68 F;  2XAQ A;  5ILU A;  2JMW A;  3EYI A;  4HRI A;  4L9T A;  4UUT A;  1W7P D;  1X4P A;  2L2O A;  1HLV A;  4MFD A;  5J40 A;  1JGG A;  2AS5 F;  3W2W A;  1LUJ B;  2V1N A;  2YX4 A;  4MIM A;  3E6C C;  2PJP A;  2LYC A;  2BW3 A;  2BVL A;  2LSO A;  1V3F A;  1T2K A;  3KYC B;  3I55 I;  3OS2 A;  1Y0U A;  1PP8 F;  2HXI A;  4D7M A;  3NAR A;  5JVT A;  3MKY B;  3MQ0 A;  2P0W A;  4I98 B;  1QU3 A;  4EM1 A;  2RC4 A;  1YW7 A;  5FLX Z;  2KP6 A;  4BQO A;  2MFZ A;  2MYS A;  1BL0 A;  3WTV C;  2CG4 A;  1HDP A;  2Y75 A;  2QA4 I;  2X6W A;  4BNC A;  4B43 A;  1MSE C;  2JRT A;  2Y0M A;  4BUP A;  3BOQ A;  3LSR A;  1D1A A;  2M7B A;  2GOX B;  4G8X A;  1XDS A;  1YW8 A;  1TT0 A;  2YX7 A;  1W0T A;  2HNH A;  4G9Y A;  1P4X A;  3QAH A;  3D5S C;  2K9L A;  3L2C A;  2X1C A;  2ZME C;  3IKT A;  2H8W A;  2W84 A;  3SYT A;  2YR2 A;  4P55 A;  3B6A A;  1TQI A;  2P7V B;  2A61 A;  2X1E A;  1B4A A;  1Z1D A;  1XPX A;  3HSE A;  5JLW A;  1RUN A;  2W57 A;  4DGW B;  4MGR A;  2HPI A;  1U9N A;  2BY0 A;  4C2M J;  2CUZ A;  3J81 K;  3AAF A;  1O3R A;  3FXR A;  1MMD A;  4AD9 A;  3JRE A;  3LSM A;  3GTJ J;  1J5Y A;  3N05 A;  2DA1 A;  1TP4 A;  2DOD A;  2M9H A;  2MH2 A;  4GYG A;  2HYJ A;  4F55 A;  4I0A A;  4BL0 B;  2GM4 A;  1J75 A;  1YI2 I;  5H6R A;  1GVD A;  1GXQ A;  2OD5 A;  4IRI A;  3BQZ A;  1U0J A;  2LC2 A;  4A3D J;  3P7N A;  4IF4 A;  4J19 A;  1HXD A;  1XGM A;  5HOD A;  3OYG A;  1FIP A;  4BH9 A;  1BJA A;  1IC8 A;  5JFR A;  1P7I A;  3HRU A;  1LB2 A;  3OYB A;  4B48 A;  3KZZ A;  3U21 A;  4ABZ A;  2QSG X;  3HGY A;  3GBG A;  3O3K A;  1Y1W J;  3KEQ A;  3BTJ A;  2IS4 A;  3CJR B;  1Y8Q B;  2TDX A;  4CDG A;  4BE0 A;  3R61 A;  1JTY A;  1XGO A;  4RB2 C;  2FE3 A;  2O8K A;  3SHF A;  3VFZ A;  1W36 C;  1BIA A;  2PJR B;  2CW8 A;  2LP0 A;  4B4C A;  5BOX A;  2W25 A;  2WAQ A;  4C30 A;  5CKT A;  5LGN A;  4XRS A;  3ZQI A;  2NVY J;  1BC8 C;  4C2U A;  2Z3Y A;  2BXZ A;  3ZQG A;  1FEX A;  1JE8 A;  3MKZ A;  2ZSI B;  3HHG A;  2L7Z A;  1B72 A;  1T8I A;  1FZP B;  2XRO A;  5D6F A;  4NB5 A;  1D0X A;  3DKY A;  1YIO A;  2IGO A;  2GAU A;  5GAG J;  2O61 A;  2HDC A;  1SD4 A;  2M0C A;  2IS1 A;  4I01 A;  4YG2 F;  1X3W B;  1RKW A;  2IGK A;  4U87 A;  5LHG A;  2CQX A;  4JQF A;  3K1M A;  2GXB A;  2M34 A;  2ACJ A;  2IVM A;  3IV5 A;  5FB2 A;  5JR3 A;  2JWT A;  3CJT B;  2KT0 A;  5HNH A;  2K40 A;  1POG A;  3QYB A;  4FAS D;  4BKX A;  2BYV E;  5LGU A;  1R00 A;  3C3W A;  1W5C C;  3OYC A;  2LKS A;  2EFW A;  2DMP A;  2XGE A;  3CDI A;  3LSP A;  2HU9 A;  3LSI A;  1FOW A;  2XC7 A;  3D1N I;  3KYD B;  1DGW Y;  1WJA A;  5F0H A;  2BZT A;  3E7L A;  4HNT A;  4HA8 A;  5E3N A;  5FRM A;  4RM2 A;  1UG2 A;  3OYM A;  4HLX A;  3OR1 C;  2VE8 A;  4OOI A;  4B8X A;  3FWE A;  3M3Y J;  5TJJ A;  4CCN A;  4NQW B;  2WAE A;  1QBJ A;  3VOD A;  3AL0 B;  1GLN A;  1MND A;  3CUQ C;  3I54 A;  3K0L A;  2DPD A;  1NHA A;  2E7W A;  5EGO B;  3TKY A;  3H5N A;  1R58 A;  1IN7 A;  1BBY A;  4B44 A;  2KPM A;  1FYK A;  1FTT A;  4UXN A;  2NAZ A;  4C3J J;  3K70 C;  3W6V A;  1P4A A;  4ASN A;  4DZP A;  3LFK A;  2JA6 J;  1S5L C;  3WG9 A;  1N78 A;  1LFU P;  2R7U A;  2OZU A;  2RRE A;  4L9V A;  2KKO A;  3JTG A;  3L00 A;  2LD5 A;  1U5T A;  1OJL A;  3TQN A;  2VIX A;  2P4W A;  1ACI A;  3DEE A;  2M0M A;  2M45 A;  1T56 A;  5C4X J;  5J1U A;  3T8T A;  4WK8 F;  1MNE A;  3HOY J;  1I27 A;  2CU7 A;  3IH4 A;  1RKT A;  2F5V A;  2E71 A;  4Y33 A;  1ZGA A;  3BR0 A;  4G6T B;  1ONV A;  2XPW A;  4YEJ A;  2HQ5 A;  3GX4 X;  3PO3 J;  5ILV A;  4R79 A;  1D1C A;  1P6R A;  5LEK A;  5TRD A;  3HUG A;  3MZH A;  1DU6 A;  2RAE A;  2IS6 A;  2FD5 A;  4EV0 A;  2L54 A;  3JSP A;  4XID A;  4Y52 J;  5B3S H;  5K7Z A;  2A6H F;  2W85 A;  5DCM A;  4A0Y A;  4AYB A;  2C6Y A;  1CQT A;  1ZRD A;  4IHX A;  1EA3 A;  2W1O A;  1BI0 A;  4YRV A;  1DPR A;  5E1W A;  4CCK A;  2LLK A;  4B1R A;  2R3S A;  2R93 J;  5GAH J;  1O4X A;  4FX0 A;  1U8B A;  1XMX A;  2ZJQ F;  5LRR A;  1KQ9 A;  2E2I J;  4WWC A;  4XK4 A;  2A69 F;  1A6Q A;  3ONQ A;  2VBX A;  2EH3 A;  2OQG A;  3S2D J;  2CYY A;  3AG4 H;  4C3I J;  2VJI A;  2CFO A;  5DD4 A;  4IOA F;  2DA6 A;  5B66 C;  2E1M B;  1GUU A;  2XDV A;  4KN4 X;  1GXP A;  1LDK B;  2KRH A;  2CV1 A;  3LA2 A;  3F3X A;  4RGX A;  3QU6 A;  3BG6 A;  4KA4 A;  3AG1 H;  3S32 A;  2XKP A;  3VWB A;  3H5A A;  2VKE A;  1D3Y A;  3LFU A;  2VQL A;  2X4H A;  4Z6Y A;  3FBN B;  1XGS A;  4L18 B;  5JHF A;  1IN5 A;  1X1D A;  2DMU A;  2DDA A;  2CS3 A;  3RDI A;  1TQM A;  4XOP A;  1XMA A;  3PSF A;  1K4T A;  1I50 J;  4K2E A;  5EF6 A;  4E7J A;  1K78 B;  4U88 A;  3BDD A;  2XB0 X;  2CWE A;  2DLL A;  3DBH B;  3GTQ J;  1KA8 A;  2XF7 A;  3UKG A;  4IVN A;  1WJC A;  4XMY A;  2JTV A;  2PEX A;  5KVR A;  1BIB A;  1AHD P;  2CFX A;  1MBE A;  1UHM A;  2H6C A;  1TNS A;  3VB2 A;  1R4M B;  3RCO A;  1I6H J;  5IT9 Z;  1UJ8 A;  3GF2 A;  3V8L A;  3K7A J;  3NQO A;  4AU7 A;  1ZKG A;  2D1H A;  2HYG D;  5DEQ A;  4AWX B;  1Z9C A;  2FML A;  2ZXH A;  3OR2 C;  1S7E A;  1WIB A;  1YIT I;  4BAY A;  4QPO A;  4A3B J;  3O8G A;  3RKQ A;  1K83 J;  4EMS A;  4IHS A;  5F27 A;  4EGZ A;  1W7P B;  3RKW A;  3E5Q A;  2OJE D;  2Y30 A;  3ROU A;  1HC8 A;  5HDK A;  3EUK L;  2FBK A;  3S2W A;  1WH5 A;  4PSX A;  4A5N A;  2DQR A;  2EFQ A;  4KIS A;  3G1M A;  5L3F A;  3BG7 A;  1YJ9 I;  3H3V K;  5JI6 A;  3KP3 A;  1IXS B;  1I3A A;  2EIK H;  3U1K A;  3BY6 A;  3MAJ A;  5CJ9 A;  3CCJ I;  2WB1 A;  2M7A A;  3I58 A;  5HVQ C;  5DS9 A;  1RNL A;  3LAJ A;  3PIO F;  3RQI A;  3BLY A;  1ZK8 A;  2LRE A;  1S29 A;  1U9O A;  4D5F A;  1YX5 A;  1BR2 A;  2R7W A;  1N25 A;  2IEK A;  2VB6 A;  2RV8 A;  1IN8 A;  4UVB A;  1AKH B;  2MLK A;  3ZQ7 A;  5D5U B;  1MBF A;  2JT1 A;  3WU2 C;  3OYA A;  4LLL A;  4NUB A;  2VXD A;  1A36 A;  5LRS A;  2RN7 A;  3L9F A;  4EJW A;  2HYF A;  2L5Q A;  4LB5 A;  1XDU A;  3QOD A;  5FRN A;  1K79 A;  4XKB A;  2D2W A;  4E7K A;  3OL4 A;  4EVI A;  3JRD A;  2ZME A;  2HI3 A;  1J09 A;  1BOA A;  1MMN A;  4LG3 A;  2FEZ A;  2FBI A;  3LQR A;  3ABK H;  3CCU I;  3DEW A;  2M2E A;  2OQR A;  5IP9 J;  2LRD A;  5EYR A;  1ZGW A;  1J9I A;  1FOK A;  2FU4 A;  3PO2 J;  4XON A;  4ZZD A;  5DTD A;  4H0E A;  3OV8 A;  1LKX A;  3QYE A;  5KNL A;  1OYI A;  3GFM A;  5TIS C;  2Z16 A;  2B7E A;  2RQQ A;  1SVO A;  2M5W A;  1Z6T A;  2PG4 A;  2ZB9 A;  4AC0 A;  1T33 A;  2L02 A;  3I53 A;  3ZQC A;  1X2N A;  5CYV A;  1YOV B;  2XF6 A;  2IA0 A;  4S04 A;  3G4S I;  3KP2 A;  3QOE A;  1NG6 A;  3LSH A;  3H35 A;  3QP6 A;  1JT0 A;  4PFO A;  3JR9 A;  1MMS A;  4PCQ A;  1W5S A;  3JRB A;  3S93 A;  2IBD A;  5BMZ A;  5IP6 A;  1MW7 A;  2HZT A;  4ANJ A;  4WXD A;  3H0G J;  3VYT B;  4FCY A;  2F4O B;  1E3O C;  4CCM A;  4GGG A;  3LSJ A;  5FLX K;  2ETH A;  1IUF A;  5E79 C;  2FSW A;  1YRN A;  1UST A;  3V7S A;  2V6C A;  2JPC A;  2KIF A;  3OYH A;  4PJ0 C;  5CQG A;  3QPT A;  1LE8 B;  2R7X A;  2XIG A;  3AG3 H;  5FFX A;  4U7B A;  3ERE D;  4OMY A;  5M5Y J;  4KFC A;  1LDD A;  3BR1 A;  4ESF A;  2Z5U A;  4HX4 A;  2FOK A;  3A0B C;  3CO6 C;  4II2 A;  1ZRC A;  3LSG A;  2D1V A;  2BGC A;  1FT9 A;  1T0F A;  1WH7 A;  2KJB A;  3H1C A;  1QPI A;  1BN5 A;  4FE4 A;  3TW6 A;  1LFB A;  1YJW I;  1R1V A;  5M5X J; 
#chains in the Genus database with same CATH homology
 3I56 I;  2OTL I;  3CCJ I;  4UY8 I;  3PIO F;  4IO9 F;  3J7Y J;  3I55 I;  2ZJR F;  5GAG J;  2K3F A;  5GAH J;  2ZJQ F;  1VQN I;  5GAD J;  3CCV I;  1QA6 A;  3CJQ B;  2QEX I;  4IOA F;  4IOC F;  2JQ7 A;  2QA4 I;  3CD6 I;  1VQ6 I;  3CJT B;  1VQ4 I;  1VQK I;  1Y39 A;  2NXN B;  2E35 A;  3PIP F;  3CCU I;  1VQ7 I;  3G71 I;  1VQO I;  1FOW A;  5DM7 F;  3G6E I;  3CJS B;  2H8W A;  2FOW A;  3CCR I;  1S72 I;  3CC7 I;  1VQ8 I;  3CC4 I;  1YJN I;  1VQP I;  3CCS I;  3CCL I;  4V19 K;  3G4S I;  3CF5 F;  3CCQ I;  3J7Z I;  3EGV B;  3CC2 I;  1MMS A;  1FOY A;  5GAE J;  1YI2 I;  3CCE I;  5JVG F;  1VQL I;  1YIJ I;  1WIB A;  1YIT I;  1VQM I;  2E36 A;  1VQ5 I;  5DM6 F;  1ACI A;  3CCM I;  1HC8 A;  1VQ9 I;  3CJR B;  3CMA I;  3DLL F;  2E34 A;  2ZJP F;  1FOX A;  1YHQ I;  1YJ9 I;  3CME I;  2OTJ I;  1YJW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...