2A5WA

Crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (dsrc) from archaeoglobus fulgidus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
114
Chain Sequence
PELEVKGKKLRLDEDGFLQDWEEWDEEVAEALAKDTRFSPQPIELTEEHWKIIRYLRDYFIKYGVAPPVRMLVKHCKKEVRPDCNLQYIYKLFPQGPAKDACRIAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sulfite reductase, desulfoviridin-type subunit gamma (dsvC)
publication title X-ray structure of the gamma-subunit of a dissimilatory sulfite reductase: Fixed and flexible C-terminal arms.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 36
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2a5wA02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 2a5wA01
2A5WA 1JI8A 3OR2C 2V4JC 2XSJC 1YX3A 1SAUA 3OR1C
chains in the Genus database with same CATH superfamily
2A6HF 1V4RA 5HNFA 3BDDA 3K70D 2KDZA 3LQQA 3RPUA 5EEGA 1MNEA 2CYYA 1W36D 2VT2A 3DPLC 2CGPA 3E6CC 2DJIA 3F3XA 5F1RA 4HX4A 3BG5A 2IGNA 3AG1H 5E1XA 4ESBA 4FETA 4ZYHA 2E1NA 2WAEA 3FKIJ 4A0ZA 2DOEA 3U1DA 4EQQA 3VPRA 2EJRA 1YW8A 4QSHA 4KISA 2Q2EB 2HZTA 2WAQN 3C3WA 1T0FA 3CUQC 5DEQA 2VPLA 4FISA 2R7TA 2LK2A 3S8PA 4F3QA 4CCNA 4Y33A 2JQ7A 2NVTJ 5CVUA 3EUHC 1PVEA 2D5VA 3ISPA 1D8JA 3WU0A 1YQAA 5FD5A 3U9GA 1YLFA 5K5QA 4YEJA 1G3SA 5GAGJ 2NNYA 4F91B 3F6OA 4NNJA 4NC7A 1JGSA 4UHTA 5K7FA 3KP7A 4PSXA 2TCTA 3WE2A 1YRNB 3U1KA 2VUMJ 4A12A 4UUSA 2LKXA 2GXGA 5HS8A 3GLXA 1R36A 2WV0A 2ZXHA 2EBIA 5LHIA 3CCSI 3TQNA 4E4HA 2IA1A 3F72A 3VYUB 2LY1A 2VE8A 3GEZA 3GTOJ 3HB9A 3OIQA 2WB1N 3FHNA 5LRSA 2O8XA 4S0HB 3ZMSA 1I3QJ 1BJZA 2CUEA 1FOYA 4FX4A 5JI6A 1K4SA 2V26A 5EJCA 2OTJI 2DA5A 2FA5A 2GA1A 1BI3A 3CMYA 2LFBA 2DMPA 1FTTA 4IEJA 4CZCA 4IKFA 1XC5A 5FLMJ 1W5SA 1T56A 1USSA 3REOA 2O8KA 4OIOF 4EATA 3A0HC 4F52A 4AUXA 3ZMVA 3SXYA 2V4JC 4DW6A 1TT0A 4M6YA 2DFFA 3BG6A 1MDMA 1T33A 2CG4A 3FXOA 3LSIA 3MEXA 3SFIA 5B3SH 2M7BA 4A93J 3I59A 1UJ8A 2FD5A 1AWCA 5E79C 2Q8KA 2XC7A 2QBYA 4B4CA 1ZR2A 1TP4A 1EV7A 1EJ9A 1ZAOA 5M3MJ 3SDGA 3ZQHA 3BR2A 4QPOA 3KETA 4U88A 3HGYA 3BG3A 1HA8A 3F22A 4RAFA 2DQLA 4D9JA 2QF7A 2C6YA 2KL4A 1QO0D 2XAJA 3P9IA 2D1HA 4F92B 5GAEJ 5K7HA 3ML6A 4BAYA 3BTIA 2LH9A 2W57A 4G7HF 1U78A 2V9VA 4HW0A 1LDJA 4BYYA 3DPUA 4UVAA 2W24A 1HLVA 1MMAA 3HXLA 2XRLA 1KYZA 1I3AA 1HW2A 1FMWA 1JT0A 1MSFC 3BR3A 2L2OA 4QIWN 1MMDA 1C0WA 1U5TB 1P4WA 2VJIA 4O6JA 1LFPA 3W6KB 4BJ5C 2I8DA 2VN2A 4YELA 1W7PB 3S3OA 4JBAA 4RLQA 3P7NA 3CZ6A 5LHHA 5FGMA 3ZCOA 2CUFA 1MZBA 3I3LA 2ZJRF 3TW6A 2LP0A 3RQ4A 3LAJA 2KIFA 2PMZN 4II2A 2QZ8A 3ASOH 4IHXA 5BOXA 2IGMA 2O5RA 2HFHA 2PX9A 2FJ1A 3ZMTA 4XIDA 3GZNB 1X3WB 4O5VA 1GXQA 5FRMA 2RNGA 3CC2I 1VQ5I 1LDKB 1SC7A 1DU0A 5FFXA 3G1MA 3K4JA 4M9SA 2M0MA 1K83J 2PQ8A 4XLAA 1BR2A 3DLAA 4FQGA 4BACA 4E7LA 3M1CA 5FKOA 3I54A 3RPQA 3OYHA 1XGNA 3BZCA 1R6RA 3DBHB 1ZH5A 3CLQA 3ECHA 3OIOA 4L5EA 1JKRC 5IP6A 1T98A 3IKVA 1AU7A 4M3DA 3BG7A 1IRZA 1ZLKA 2XV4S 5EGOB 2DA4A 2MD5A 4LLNA 1CQTA 3ECOA 3T5XA 4AIKA 4II3A 1YO5C 3K2AA 4LLGF 3HJEA 4XR6A 3R0AA 4DZJA 2K40A 1S29A 3NRVA 4NC6A 1JHHA 2IXSA 3KX2A 3PM1A 1R00A 2FMLA 2NS0A 2F6CA 1JUSA 5D8KB 4QPQA 3MVPA 2M8GX 3EDPA 2DK5A 4F7ZA 1JJ6C 4B3XA 1OCZH 5HLTA 1JI8A 3LSJA 2DTRA 3G6EI 1MJ9A 3FX3A 3BR5A 3TO7A 1EF4A 1TWGJ 3HTSB 4R1HA 2ZFWA 3PIOF 2RAEA 3F8BA 4Q48A 3PSIA 5KK1A 2O7OA 3CO6C 5FRNA 2ESNA 3CUOA 3WU1B 1E3PA 2KQRA 5DTDA 2R0QC 1POGA 2JUGA 3NEUA 1FYKA 2XDVA 3HHGA 3ABUA 3OS1A 2R7UA 1TT5B 4OWRB 2VKDA 2GZWA 2QGUA 1Z21A 1V5FA 1WQ2A 4KN7X 5EYRA 3CTAA 2HPIA 4WXHA 4G7OF 1XCBA 3CLOA 3DTEA 2JA5J 4XLHA 5E20A 1U5TA 2VONA 1U9OA 3F21A 1W7PA 3E1SA 3OY9A 3GF2A 1X3ZB 4S04A 5HDNA 4NHJA 4BQOA 2LMDA 3B6CA 2LKPA 3SFZA 2IGKA 2GLOA 4ABZA 1R4MB 2R92J 1I50J 3JR9A 4HF1A 1UZCA 2KJCA 2MSYA 4CA0A 2B7EA 3RKWA 2OQRA 1QHGA 1K78A 2CUZA 3HRTA 2VBZA 3CC7I 1YW9A 2DOFA 9ANTA 4EJUA 2MGQA 2ZNYA 3LL7A 3P9CA 1VQ6I 3L2WA 5KNLA 4AIHA 1STZA 2PMUA 1QQIA 3K0LA 3HPHA 4RB3C 5FD6A 3QOPA 2ZSHB 2HQRA 2HGCA 5L3DA 3S15J 3OOPA 4E70A 2EINH 4BUPA 2R4GA 1IXSB 4RA2A 2UZKA 4A0YA 5M3FJ 4LMYA 3BY6A 4GO1A 1LE8A 4IHTA 2XAQA 4NUBA 4UVCA 5BQTA 1P92A 3DBRB 2P0WA 4E7IA 4L9TA 3FZVA 4RM2A 2DMUA 3GTLJ 5HS7A 4N0BA 2LG4A 5EGOA 2EZHA 3C2HA 1HKSA 2GBYA 4M74A 3HKZN 4ZYAA 5C44J 2BXZA 1IRXA 1B9NA 1YYVA 3JRCA 4EJVA 3FM5A 1GT0C 2DDBA 2KRHA 5ICFA 4F93B 3I56I 3RZOJ 4DBQA 1AA7A 3BLYA 4P96A 5DCMA 3ULQB 4A3DJ 3BR6A 2EQRA 1IUFA 5F08A 2H6BA 1TWCJ 1HW1A 1JT6A 4AYBN 3QPSA 3DWLE 2OF7A 4L9JA 2PG4A 4PDKA 2IPQX 2DCEA 3DTKA 3L2QA 2OJED 4B47A 1QU3A 1J9IA 2F5FA 1XMKA 2P6TA 1TNSA 1ODDA 2OQGA 4IQ4A 5CPRB 2RGVA 1T39A 4I98B 3MKWB 1F36A 4J19A 1PUEE 2ELKA 1OJLA 3J7AO 2HQNA 2PMHA 2X4HA 2JN6A 1AHDP 3RQIA 1BC8C 1USTA 1TW3A 2ZCWA 4A6EA 2WWYA 2FSWA 3TW7A 1I1SA 3OOUA 1GV5A 4HX8A 4LK1F 1ZELA 1SANA 2HEOA 3ERED 1QA6A 2RQQA 1R22A 2IEKA 3FKJA 5E17F 3Q9SA 3LFKA 4I76A 4XN0A 3M07A 3DU5A 4ENKA 1ITYA 1R49A 2K02A 3DBLB 4Y17A 1HOMA 2X1CA 3TGNA 3ZN1A 2KIMA 3FK6A 2COMA 1H0MA 2UXXA 2BY2A 2P6SA 1JE8A 2DMTA 4BBSJ 2Z3YA 3D1NI 1QRYA 1IF1A 3J80K 2Z33A 2FXAA 1WJCA 4IL6C 3VOEA 1ETVA 2A3SA 3DLLF 5TRDA 2FBKA 4RGRA 5FFZA 5FKNA 5CKTA 1RKWA 4M3BA 4BHCA 3ONQA 4BGDA 2G9WA 3CJQB 3HM5A 3EYYA 2L02A 5F1JA 5K5OA 3JRFA 3HRMA 2HZDA 2E5ZA 1GVJA 2OC6A 1VQ8I 1VQLI 2ECBA 4LG3A 2ZJQF 3CJNA 3H3ZA 4X6AJ 1MJAA 4M6XA 4HQMA 3VSLA 2HDDA 2CWEA 2HI3A 3CCVI 2PBIA 5IYCJ 1HDPA 3RKYA 2X48A 2ISZA 3RZDJ 2F5CA 4D0PA 4PUSA 3H92A 3W3CA 2JT1A 3H9QA 5HS9A 2WY8Q 2R7XA 4A3LJ 2JUCA 5JFRA 4RGUA 3FMSA 3CP2A 2R7RA 4LITA 1BR4A 2KJBA 4ENNA 4OINF 2JJ7A 1QPIA 4BU2A 4MTEA 3G71I 1IW7F 1MH4A 4D5FA 2L9VA 3KLNA 2JK3A 4MFDA 2VKHA 4UUTA 3OWTA 3MKZA 3V7RA 2DT6A 4D5CA 4YG2F 1SFEA 4PFPA 5LEJA 1O4XA 1YS6A 4LFUA 3VYSB 1BA5A 2LBFB 5FB2A 1NK2P 4HF2A 1ZG3A 1ZARA 4V19K 1YOVB 4M3FA 3TL4X 1IRFA 5K1YA 2YU9J 2JA6J 2EWNA 1G2HA 1QZYA 2P5VA 5JVTA 2K3PA 4EEFG 1LB2A 1RZ4A 2EZLA 2RDPA 2E2JJ 4L9VA 3OYNA 2ETHA 3RPUD 1D1BA 3K10A 1YIOA 3ZQ7A 2JMWA 4BY1J 1S7OA 1P4XA 4DOZA 5M5XJ 1OISA 5HLGA 3M8FA 1Y0NA 3HYIA 3QOEA 5E18F 2HTJA 5HLIA 1KU7A 1JJ8C 4LIVA 4BDZA 1ZRDA 2Z5UA 4HOBA 3G3ZA 3CDHA 4KJZA 1TLHB 2PN6A 5F27A 2F5EA 4EJWA 4JK1X 4PJJA 3UNGC 2ZMEA 3S16J 1QZEA 3GMEA 3A01A 2OCCH 3BJ6A 3NARA 2DN0A 3V8LA 3HRSA 2JTVA 2DA3A 3CESA 2XUBA 3J81K 4BHPA 2DK8A 1O7LA 1IN5A 3QWLA 1T2KA 2OV7A 3IP4B 2V1XA 4MTDA 2VXDA 4A3EJ 2DA1A 2MLGA 3AG4H 2VQHA 3BP8A 3EUHA 2VQLA 4MIMA 3S1NJ 4A3GJ 4BH9A 3I58A 1VQOI 5CQGA 3HTUA 2V1UA 5E1ZB 1M1EB 3OR1C 1VF9A 3GX4X 3BR1A 3IAM2 3HUGB 1ZGWA 3MZHA 4KT6A 3Q0VA 4KYWA 2B63J 3L00A 2CJJA 5CJ9A 4FASD 1IGNA 3C2BA 2IVMA 2L9RA 1X1AA 4YIIA 4DQ2A 2RV8A 1REPC 1Y8RB 2QLZA 2K9MA 4CCMA 2IA0A 4FT8A 3LAPA 4YRVA 2XPVA 5DS9A 5A2QK 3E7LA 4CSWA 2KZVA 1X1PA 1XX5A 3R4KA 4YIRX 1IC8A 3BC8A 3V7SA 3Q3SA 2DODA 1XGOA 3ELKA 1WJ5A 2E2HJ 1XDUA 3JRBA 4FHTA 5CVJA 2X6WA 2QSGX 1D1CA 4RM3A 1SD7A 3CCUI 4IRHA 4ZZLA 3GFLA 5DYMA 1D5YA 4BJ6C 4RBOA 1IJWC 3AL0B 2L9NA 1O3TA 2Z1DA 4HNUA 3S17J 3WODF 5D4RA 2X0LA 3W2WA 4ASNA 1D0XA 2VBWA 1Z67A 2MFZA 3M8JA 5H20A 3MQ0A 2IA2A 2XGDA 3DKYA 2LF8A 1R9TJ 1Z77A 2XKPA 2WY7Q 2YUSA 4PCQA 1DUXC 4RB2C 2K9LA 2LC2A 4GCVA 1WRJA 3S3MA 3WTZA 5E3NA 2XAGA 4HLYA 5FLXK 2QEXI 3H0GJ 4OAZA 2DA7A 3TDZC 1MSEC 1SFUA 1TC3C 1MNDA 2V1DA 2ZXJA 1VQ9I 2JVHA 3E6BA 2P7VB 1OR7A 2DU9A 1ETQA 5KAIC 1D1AA 1F9NA 4AU7A 4CCJA 1WHUA 1Z1DA 1ZR4A 2X51A 1L0OC 4X0GA 3S14J 5C4JJ 3L2UA 1JKPC 5J4VA 3K4NA 5J1UA 2BOLA 3G1LA 3ZQQA 5B1AH 1YG2A 3RI4A 5J1RA 3KZYA 5EEHA 2K3FA 2Y9ZA 1SVLA 3O8GA 1ZKGA 4ANJA 1YFHA 5FKLA 2V7FA 4G6TB 3VFZA 4BDYA 2UWMA 1MMNA 1IAWA 3SEQA 2H94A 5EG0B 1W1WE 1U8RA 1LQ1A 2NVYJ 1XTAA 3ZQLA 1B9MA 1ON1A 4PJMA 3CCRI 2M4KA 4A3CJ 3B02A 1TW2A 1IV8A 3JAMK 3OS0A 1O3QA 1GUUA 3GO5A 3Q5FA 5C3EJ 3WG9A 1VQ7I 2W4SA 1Y39A 4GRIA 3LNQA 3MFKA 2Y0MA 4EM2A 5LFAA 5CVVA 2HR3A 2XGEA 3BZ6A 1E2XA 1Z3XA 4G9YA 5KAFC 5GAHJ 2AO9A 2P5KA 2A07F 2EIMH 2FQ3A 4DGWB 1BIBA 4G94A 2KP6A 4HSRA 3M3YJ 2PI0A 5ILSA 1MNMC 2Z16A 4A2UA 2VQCA 3IV5A 2VXZA 3HC7A 3TOAA 3AFHA 2RC4A 3A2KA 1FOWA 4IHVA 3U2RA 4NC8A 5H6RA 2LYCA 5HLHA 2K7LA 2QYOA 3UR3C 4ESJA 1FJLA 3H5AA 4FX0A 1PUFB 4XORA 3KZZA 2MH2A 4ON0A 1IV6A 4OAYA 2XIGA 3ZGKA 1B72B 1SFKA 5ICEA 1KZHA 1VTNC 2VE9A 4C2MJ 2P7CB 4BEHB 3KYDB 3QAHA 2V6EA 1FZPB 1G4DA 4ENJA 2KPMA 3DTIA 3KYLA 1HBXG 1I1GA 2BVLA 1CGPA 1RC9A 1U8BA 1PP7U 4M3EA 1N75A 5LD2C 2M5WA 4KNYA 5D5XB 2F4OB 2ISYA 4P5OA 2LSOA 4MEXF 2QVOA 1R1UA 2XF5A 3DV8A 3QU6A 4AVPA 5CLSA 1DGRM 1EH8A 4M71A 3H36A 1SFOJ 2VQGA 2X1EA 3CDLA 3FMRA 2ICWG 2VC1A 5BMZA 3HHHA 4BHBA 3WHCA 2PJRB 4MGRA 4PGGA 4RB1A 5J6XA 4GYGA 5E8IA 4BXXJ 2XROA 3ERMA 5J4YA 2VBYA 3JW4A 3WGIA 2RQPA 5J8FA 4DNCA 4MEYF 1ONVA 1X1DA 3SHFA 3MMYB 1EA3A 4AD9A 5IT9K 4OIQF 3ROUA 3W2AA 4RB0A 1UHWA 3CCQI 3MD2A 2VBXA 1HCRA 1EH7A 2NVUB 1D0YA 2BE5F 4ZZDA 1WGXA 2L7ZA 1W7PD 3MZ8A 2Q2EA 2DJNA 2STTA 4B44A 3PUFA 4BY7J 1Z7UA 3VEPA 5JHFA 3SQNA 3DQVC 2QUFA 4HQEA 1FMVA 2YU3A 4NDLA 4D7NA 3I5UA 1YIJI 2EFNA 1I39A 1FPQA 1TQMA 2M0CA 3FXMA 4M9ZA 4R79A 4XRMA 3HSRA 1ZREA 1T0FC 1I6XA 1YW7A 2R7VA 3BPXA 4B3AA 1N25A 2XAUA 2VI6A 5JVGF 2X6XA 3K1NA 2FUG2 1S7AA 4KICA 1YRNA 2HVQA 2VPRA 1QPMA 2A68F 2BVMA 1HXDA 2EFWA 4ETSA 4KITB 4I6ZA 2Y48A 1S3JA 2JSPA 5KVRA 3OL4A 3ZMUA 5DUIA 3LSPA 1F43A 3E6MA 2W48A 1KU3A 4UXNA 3L9FA 3JREA 2DBBA 3FXLA 4IXAA 1IZ1A 1JTYA 4MQ9F 4ENMA 2FF4A 1O3RA 3W2VA 3TOBA 3JCUC 3GFJA 1FSEA 2NVXJ 2XVCA 5D4SA 4CYCB 3IHUA 4EGZA 1OQYA 1QVTA 1PYVA 2E1MC 3JTGA 1TTYA 3O2PE 4I0AA 5GTHC 1H9TA 2MD0A 3BJAA 1BM9A 2A05A 1RNLA 3IRRA 1SEUA 2WC2A 5H6QA 4BEHA 1MKMA 2HOAA 3PL8A 5AIQA 4G8XA 4PGHA 2R5YB 3JRAA 2TDXA 2LR8A 4M3GA 1X19A 3B73A 2QSFX 2L01A 1Y1WJ 2NOGA 1NG7A 5D5VB 4V2FA 4XLNF 3CCEI 1IN6A 3ZRGA 4XK4A 1VQPI 1S5LC 3EETA 3VB2A 3I71A 5ILUA 3QPLA 3BTLA 3HOWJ 4XRSA 1MBEA 4I7HA 2WTEA 1IO2A 2XGXA 4G6QA 2GQQA 3QYFA 1ZHFA 1XSDA 1LEAA 2IP2A 5K7ZA 3GTGJ 3RJPA 4IQJA 4A6DA 2OD5A 2DMQA 3K4LA 1Q1VA 1FY7A 1K7AA 5F0CA 4CCLA 2H8RA 2DW4A 2K9NA 1Z6RA 3BJOA 3K1MA 2LLKA 2K9QA 1MIJA 1RPWA 4UB8C 3LSGA 5DM6F 3OYLA 3BR0A 2HVSA 3OS2A 1UHSA 4R8HA 1E3HA 2CSOA 3K70C 2IT0A 5CYVA 4CH7A 2N8GA 2EV5A 1J59A 3F9KA 5LBQA 5JHUA 1W36C 4M73A 2GWRA 1W4MA 2R7SA 3IRQA 1ZRFA 2GAUA 3HGGA 1R5GA 2MLKA 3BG9A 4N4NB 3TBIA 3KP4A 4CICA 1SAXA 3WTSC 1SVOA 5L3CA 1YITI 4BXFA 3KYCB 3CCMI 3S1MJ 1SFXA 1GVDA 2L7MP 2Y69H 4JQFA 3S2WA 1R58A 4RAYA 1FWZA 1ZG5A 2HKOA 1MBKA 2OZ6A 1O3SA 3KCCA 4HPQA 2XRNA 1JHFA 3CCYA 4HZFA 2DXIA 2BW3B 3JSPA 1I27A 2KMUA 1GV2A 5EZGA 3F0CA 2X1DA 4LJZF 3U21A 3F8NA 1ETOA 1S6LA 5LGUA 1FYMA 2X6YA 4IX7A 2HDCA 2FRHA 2IS6A 2DQRA 3NWTA 4E7KA 5HDGA 2CW0F 1WJEA 3W6JB 2OUMA 5HDKA 4V2GA 2EV6A 2ZKZA 1B1BA 1SD4A 3NQOA 4N9IA 4F55A 1FBQA 2UXNA 3KEOA 4BE1A 3IWZA 4PSWA 2WV1A 3M7GA 4CYCA 2QM3A 5IP9J 3T8TA 2M2EA 3IC7A 2V1NA 4C9YA 3SJMA 1Z91A 1UCRA 2YS9A 4UB6C 3B6AA 1Z9CA 3N05A 3DCFA 3M4OJ 1Y0UA 3IWFA 5EF6A 1B8IB 2AXLA 2XF6A 5BPIA 1UHMA 3HPGA 2HKXA 4FE4A 4YFNF 5GTIC 3LWFA 4HNVA 5FKKA 4X1EA 3J81Z 3BROA 1RRJA 1GDTA 3ABTA 4MNUA 2R5YA 1T08B 3GZ6A 3H5RA 2WAFA 1H8AC 2I5UA 2H27A 2F4MB 1FX7A 1IRGA 2FOWA 4JX5A 1V5EA 4AC0A 1W5CC 2O0YA 3CQZJ 3MAJA 1BOBA 2DMNA 3CF5F 2L9SA 3HOXJ 2HXIA 4XKWA 4P55A 2K85A 1TZLA 2RKHA 2MABA 1KQ8A 3ZP5A 5D5WB 4HEA2 1VZ0A 3GLLA 2GOXB 3RCOA 1FTZA 1T38A 1FEXA 1LFUP 4KIGA 3JRGA 1WH5A 4I0BA 2PMZA 3BPVA 2K4BA 3I4PA 3R6SA 1K79A 1DDNA 2W82A 3QP6A 3K1PA 4HLXA 1H88C 3FF5A 2ZO4A 3CMAI 2NS7A 4I99C 3K7AJ 5A2QZ 5M5WJ 1B4AA 2M34A 3BCAA 5F0HA 4IO9F 3D5SC 1KA8A 2XHKA 5KHDA 2IW5A 1U9NA 3OSFA 1TWFJ 2FBIA 3K4BA 3N97A 3JSOA 1WFXA 1WH7A 3L09A 2LY2A 1UG0A 2P4WA 4XOPA 3S32A 1WVRA 2JPCA 3CUQB 3DEEA 1DP3A 1A35A 3V7CA 2IJLA 2Y0SA 4IOCF 3OYIA 1DU6A 4WCGA 4HV6A 1U5TC 3OYCA 2J5OA 3EPZA 2E35A 1S7EA 3FXJA 4DJAA 3L2CA 2EILH 2OAZA 2VJ4A 2FEZA 3ZMZA 4Y7NJ 2D45A 2K4JA 2BW3A 2M87A 2CW8A 3H1CA 1K6YA 4CDGA 2QWWA 2M4GA 1WWXA 1OCOH 1QVUA 2QKMB 3DFGA 5FLXZ 3HOYJ 3HRUA 4XICA 2ZC2A 1YJNI 5LRRA 3WTTC 5DD8A 5DM7F 1TL8A 1ZLJA 3BZKA 3P5JA 4UV9A 4S05A 2CQ7A 2BZTA 1FLIA 2XGCA 5DV5A 3PIPF 2Z99A 4RGXA 1X3UA 2H09A 2L7FP 2I10A 1YJWI 4RMNA 3H5NA 3TO9A 5H2FC 3IH4A 2CU7A 1IG7A 2PEXA 4XKVA 1X1BA 3CJRB 3L7WA 3O6BB 3WU2C 4XBFA 2Z9OA 4DZPA 3WG7H 3MZYA 2VOPA 3GVAA 3KP3A 2HQAA 4UUVA 1FP2A 4U7BA 2EFOA 1OCTC 1B8IA 4XLFA 4BQNA 1KU2A 4LB6B 3J7AY 3G2BA 2A6EF 2Z2SB 3SEZA 4BXUA 3JAMZ 4XQFA 4E7HA 1RKTA 3DEUA 2A5YB 3AAFA 1RI7A 5ICGA 4A5NA 4YFXF 5IPAA 2DA6A 4FCYA 1XD7A 3S3NA 3C2GA 2R7QA 4A3MJ 2ESHA 4BQAA 3E3VA 3RYPA 2IRFG 1Z7LA 2JSCA 4CGZA 2JA2A 2CS3A 4ZYGA 4E7SA 1VI0A 1RUOA 2L54A 1Z6TA 1V5GA 3PO3J 3EYIA 3LA2A 1XCVA 2IAIA 1UELB 2OZUA 5JR3A 1AKHB 1RESA 2EH3A 5TGTA 2P5LC 4XMYA 1O7FA 2YX7A 3HBLA 1PDNC 1IDYA 3Q9VA 2CUJA 1J75A 2EZIA 2FNAA 3PO2J 4KN4X 2OTLI 1ZYRF 1RR8C 3FXRA 2LF7A 2PLYA 1BR1A 4B09A 4GFBA 3HEFA 1VQ4I 2JVGA 4XLPF 4HRIA 4PFOA 3SDBA 4U0YA 2NXNB 3E5QA 3OSGA 3CO7C 2VKEA 5KCMA 3KPHA 4XKCA 5TJJA 1P4AA 2E36A 2GIZA 3HSEA 1N78A 4YIFA 4Y3OA 5E3MA 5M5YJ 3CUQA 4XONA 4ZDPA 1Y1VJ 1HF0A 3K2ZA 3LQRA 1YTYA 2VASA 3R61A 1B59A 3QRFF 1FNNA 1XS9A 2OPTA 3ABKH 5GADJ 2QSHX 3K69A 4EVIA 3HKZA 1H9GA 2HDWA 2DAOA 2HOEA 4L9NA 5E3OA 2ZXIA 1LEBA 3S93A 1QHHD 2GOMA 2LDUA 4PK4A 4HNTA 2XF7A 2YR2A 3AG3H 4LLLA 4ESFA 4IHSA 3S2HJ 3VYRB 1D0ZA 4UY8I 4ZYDA 1FOXA 2KKOA 1O57A 2ZJ2A 2G7HA 2Q1ZB 4KMFA 4OIPF 3G1OA 4MHGA 2B0LA 2WADA 4HV5A 3PQKA 5D6FA 4XOTA 4TV7A 1F1ZA 4IVNA 1YI2I 3OV8A 2OCEA 2HYJA 3HIFA 2KIQA 2XSJC 3ZXSA 5IT9Z 4A3IJ 3EQLF 5FLVA 1K6OA 2M45A 5FKMA 2DTZA 2EZKA 1KYWA 2XB5A 1G59A 2MH9A 3MWMA 4OMYA 4H0EA 1E0EA 1IXCA 1ON2A 2LNBA 3QPTA 3RYRA 1HDDC 1D8KA 2BY1A 3A1YA 3AG2H 2YSRA 2CV1A 3L2RA 2IS4A 3I4MJ 1H89C 2P8TA 1ZGJA 4CUGA 3I55I 2FU4A 4U0WA 3WE3A 4XRFA 2IBDA 4RAGA 1RETA 3ESWB 3MKLA 4KT5C 1LNWA 1J2XA 3OIPA 1LJ9A 5HVQC 2DFEA 2A69F 3ABLH 3WTVC 1VQNI 1TNTA 2NNNA 2KIUA 3LOCA 3IUOA 2LBFA 2XAHA 4HA8A 4RAZA 2EA2A 2JRMA 2BXYA 2F5DA 4G12A 1T95A 3JRHA 4E6KG 1Y8QB 5BS6A 1WJFA 4MLOA 1J5YA 2RN7A 4AM3A 1YE9A 1X4OA 2ZB9A 5F6FA 2HVRA 3QQAA 1ERDA 2M9HA 3HOSA 1R71A 2Y9YA 5J40A 3QP5A 1KQ9A 2RNJA 4XN3A 5FO5A 1AKHA 3PNVA 2R7FA 1G6NA 1U3EM 3BOQA 3SZTA 2DPDA 1A04A 1Y6IA 3PUBA 3FMQA 1NG6A 3DKXA 2JRTA 1SD6A 3R60A 4I02A 5D6EA 2ACJA 4I2OA 4IPAA 3KLOA 4UNOA 1J0RA 2ZSIB 4G7ZF 5IYDJ 1G3TA 2BBYA 2L3DA 2MBFA 1OLTA 3OYAA 1QZZA 2XB0X 3L1PA 4HG2A 1OYYA 2E19A 1F4KA 3ZR8X 1WPKA 3R0JA 5IP7J 2K5CA 1E3OC 4WWCA 1X2NA 4B43A 1VFCA 3GBGA 2ZMEC 2F4IA 4BKXA 5DDGA 4Y52J 2JWTA 2F48A 1FIPA 4RS8A 3O3KA 4E7JA 3M1EA 4KIFA 3KP6A 3ZQGA 4C3IJ 3I4NJ 2YX4A 2MYSA 4EM0B 2A6TA 4Q5SF 1YX3A 4Q47A 3HUGA 2UV1A 3KE2A 1NK3P 5DUKA 4C2UA 1P6RA 4WX9A 3HL2A 4BNCA 3CDIA 2CV0A 5JLXA 2GA2A 1Y56A 1MBFA 3GTPJ 2VOOA 2ID3A 3I0TA 1HW5A 1TQPA 2E5NA 4ITVA 1V55H 1ETWA 2MC3A 1Q1HA 4D1QA 4CYDA 5F0FA 2L4AA 1J7KA 3D5RC 4L5IA 4RLFA 3L2VA 5ERIA 1P7JA 1BI0A 2XSDC 4DBRA 3HOTA 2XAFA 1W0TA 4CXFA 3KP2A 2E71A 2O6GE 1KU9A 1WI9A 4NB5A 3LFUA 1IDZA 4UVBA 2K27A 2X9DA 2MG4A 1Z05A 3TEDA 2PJPA 2E7XA 5L3BA 2DFIA 2K86A 1P7IA 3CMEI 1RIOH 3G4SI 3BQYA 4HAMA 5CQEA 1OCRH 3N4MA 2HYFA 2ZNZA 2G7UA 3HSFA 5FROA 4A3BJ 3GUDA 1HSTA 4C3JJ 3H9GA 3OR2C 1T6SA 3KFWX 4BBRJ 3OYEA 1OYIA 3DU6A 1K4TA 2ELHA 2BHZA 3CD6I 1BJAA 4XLCA 2H1KA 3LSRA 2DT5A 3J7ZI 2W85A 4A3FJ 4LOCA 4PJNA 1OYWA 4RDUA 2EK5A 1P9QC 2V9KA 3GWZA 3TO6A 4KUMA 4KA4A 3FDYA 3D5LA 1NTCA 2ECCA 1OR7C 2MA3A 3I64A 5BPDA 1OKRA 1XMXA 2A61A 2EA4A 4HX7A 2CO5A 4OU0A 2HYGD 2AXTC 1FBSA 2GIVA 5EG0A 2JA8J 3IH2A 1UG2A 4DYQA 3CP8A 2LOOA 3CCLI 2QA4I 2PFBA 3ZOBA 3T1BA 3DKWA 2QQ9A 4C3HJ 3NAUA 2K9SA 1JXSA 2OU2A 2KDOA 1BI2A 2O9LA 2HWVA 2R5ZB 3F6VA 1JKOC 4GXOA 2VL8A 2R3SA 1TQIA 3S1QJ 2ID6A 5AIPA 3ZQIA 2HOSA 4L5JA 5AONA 2P81A 4XRSG 2NYXA 1WJAA 4WF2A 1MH3A 1Z0XA 2V9PA 3IH3A 4W97A 3C18A 1K78B 3DEWA 4B8XA 2CQNA 2W84A 2CW7A 3RSNA 4KMUX 2QCOA 1MW7A 1A31A 4IRGA 1R23A 2DT7B 3WGGA 3RKQA 1SMTA 1XB4A 5FJ8J 1VQMI 2KZGA 1WSUA 5JLWA 2QQAA 3OL3A 1ZGAA 5B66C 2M3AA 1PUFA 4JOMA 5B5EC 3S1RJ 2HTSA 4HYEA 2AQFA 1DP7P 2DLLA 2H6CA 1MMGA 2ME0A 4B48A 2E7WA 4AVZA 5IY5H 1XGMA 4DIQA 1B72A 1LE8B 2DI3A 3C1DA 2ZXWH 1A5JA 3DPTA 1ZTRA 1MBJA 2KFDA 5HODA 2Y0SN 3I53A 3KEQA 3VODA 3J80Z 4CO8A 3E5UA 4UV8A 6PAXA 2L5QA 4ZDOA 3FBIB 5GPAA 1U6GA 1A6QA 5C4XJ 3FXUA 2DOAA 3PNTA 2BYVE 4B1RA 2B9SA 2CQXA 1LVAA 1YX5A 3CF2A 1T8IA 4A69C 1KGSA 2JPBA 3OYFA 1NH3A 3ZQCA 4A0XA 2QENA 1IXRC 3F8CA 3GYHX 4Z2YA 5DCMB 2VJ5A 5IOYA 3G73A 2WAQA 4OOIA 1R5HA 4JYKA 3AL0C 4PJLA 3K4KA 4HBLA 2A5WA 1BOAA 2D2WA 2FX0A 1CF7B 2PJRA 3KIOA 3WHBA 1B6AA 3CJTB 3V4GA 3DF8A 1BBYA 1G3WA 2DYSH 4MQVA 4L0ZB 2M7AA 3RDIA 3F23A 4A3KJ 2VJJA 5F64A 1FT9A 4Y4RA 3LSMA 2XASA 1MGTA 4AWXB 2BGCA 1AOYA 3HDDA 4BL0B 4JX4A 3CC4I 1MJBA 4IOAF 4LB5A 2IS2A 2L0KA 2RREA 3WTWC 4P1WA 3QPHA 3HZJA 3V8JA 1BI1A 3FWEA 4WXDA 3RKXA 1X4PA 2E34A 3OYJA 5ILVA 1BW5A 3AKZA 2WB1A 3MN2A 4PZJA 3PJRA 2AQEA 2D1VA 1HKTA 1S8NA 1JGGA 4XKBA 2YPRA 3PNYA 1UMQA 1JTXA 3FXQA 2F2EA 3J7YJ 3JRDA 2R5ZA 1ETKA 4J00A 1ZG1A 1TWHJ 2FE3A 2FNPA 3WTYC 2AS5F 1UFMA 4GDFA 1X1CA 2BY0A 1LPQA 5B1BH 3Q0WA 2EFQA 4DYCA 2DA2A 3D0SA 3KZIC 1FC3A 3BTJA 1Z3YA 2L7KA 3E6DA 3JTHA 2VLAA 1MMSA 3F8MA 4U0VA 1WI3A 1XDSA 2VODA 1UB9A 2STWA 3HOUJ 1ZK8A 2GXAA 1JUMA 3M8EA 5L3GA 2DFHA 3FK7A 2Y2ZA 4QWQA 5LGTA 1D5VA 2HU9A 4HDVA 4MFEA 3I9V2 1RR7A 1K61A 4JX6A 3V42A 1BW6A 1R4NB 1IN4A 5CVIA 3OYGA 3PQJA 4BJTA 2VIXA 4HDUA 1QBJA 3H0DA 1UAAA 3FM3A 2DO7A 2DDAA 4EM1A 1ZRCA 2X85A 3QU3A 2IGOA 5EZHA 4NQWB 1SVMA 3GFMA 2CQKA 3ZPLA 2LRDA 1VQKI 4KDPA 2R7ZJ 2W7NA 4XSXF 5LGNA 1EKEA 1LKXA 2JA7J 5J3LA 1FIAA 1J09A 4EGYA 4HSTA 2R7WA 2CQQA 2ZBKA 1XSVA 2NOJB 3K4CA 2FBHA 3LMMA 3NWSA 3RTRA 2H1LA 4H4KC 1XPXA 3VSKA 4BS9A 2E1OA 1HQCA 3DXJF 5ED4A 1CF7A 4Q4ZF 4GGGA 1KONA 3A03A 2KLOA 4JP0A 2XPWA 2BEOA 1I5ZA 1V54H 2EIKH 1XG1A 3LSHA 1YJ9I 1YHQI 5DD4A 5L3FA 1OMIA 3A02A 4E7ZA 4LIUA 1IN8A 4ZYEA 3WTUC 4BE0A 4ZTJA 3W6VA 3WTXC 2BV6A 2Q0OA 4XL9A 1LDDA 2R7DA 4U7DA 4LG0B 3PFIA 4MO7A 4I01A 2R93J 1MD0A 2CFXA 1ZQ3P 3K4MA 3FBNB 3VYTB 1DQUA 3ZN0A 1S72I 2M8EA 2HPMA 4OIRF 3RIRA 1WKMA 4G6DA 4Y13A 1X58A 5J8CA 1PP8F 4K2EA 3HOVJ 3ABMH 2TRTA 1LVKA 3TP0A 3ZMDA 2RVCA 4N4OB 1F5TA 4WXCA 4AIDA 5LHGA 1XN7A 3CCJI 2ZMEB 2OA4A 1DPRA 2GXBA 2HQ5A 3A01B 1DGWY 4KIBA 1P2FA 1WZ2A 3BCBA 2H8WA 2WA0A 4M6VA 1R7JA 3GTJJ 1YS7A 4IF4A 4CCOA 4C2TA 3LA3A 4XSZF 3HOZJ 2R7OA 1G8XA 4J01A 1U0JA 3SYTA 3GTKJ 2E2IJ 2EPFA 2IS1A 1BN5A 4CZZA 1N77A 3MCZA 2V6CA 3FHZA 1I6HJ 2O03A 1GHCA 4M72A 3MKYB 2FQ4A 3OYBA 4A3JJ 2BY3A 3QYEA 5D5UB 3O8HA 2O3FA 2GM4A 2QQBA 3GZ5A 1IUYA 4ZJZA 1WJDA 3TKYA 3GTQJ 1V3FA 1TBXA 2LKSA 3A0BC 1JUPA 3PSFA 1BC7C 2CRGA 5GP9A 1R1TA 2UUZA 2W1OA 3GW2A 2XKOA 3CMMA 3EUAA 2E1CA 1XSXA 3T0YA 1LFBA 3OMYA 2EB7A 4IJAA 3OYDA 4NQWA 3E5XA 4XNFA 2J5PA 2LVSA 3ASNH 2ZJPF 5CVRA 3E97A 3WGHA 4EV0A 1KQ0A 3E0JB 3GXOA 1FOKA 1SD5A 4L0YB 2NVQJ 3H3VK 1WJBA 4O3MA 3P9KA 3SZGA 2KHMA 1W5TA 3BWGA 2V79A 5IYBJ 3BTCA 2O61A 1GLNA 3FXKA 4ZH4F 4FE7A 1XGSA 4WK8F 2NRAC 4I09A 5IOZA 5EEAA 3SZPA 2ME6A 2X6OA 3QODA 2JZYA 5E1WA 5TISC 1W0UA 3QYBA 2XPUA 2BHYA 1ETYA 4XLEA 4L18B 3H35A 3LSTA 4ZTFA 4GYIA 2QQ8A 2ZFUA 1OCPA 3VDXA 2L4MA 1MBGA 2ELJA 3BT9A 3IL2A 1A6IA 1JKQC 1X2MA 4HF0A 2VT3A 3FISA 3KEYA 2QKLB 5E8GA 4IRIA 2LTPA 4IHYA 1FYLA 2COBA 1S9HA 3HG9A 2W25A 5L3EA 3H3UA 3TDUC 4LD5A 3T8RA 3FIWA 1BL0A 4LG0A 4P9UA 4RGSA 3X2QH 4Z6YA 5HOOA 3M9AA 1XMAA 1QNTA 1R1VA 5K5RA 4ZC3A 5EDNA 4KFCA 1HC8A 2F5VA 2NAZA 2CFOA 5HNHA 3GFIA 3C7JA 5J47A 4IHWA 4M9XA 2LREA 3K9TA 4LGWA 2AHQA 1HSJA 2M30A 4XM3A 3KP5A 3S2DJ 2W00A 3TMOA 1OCCH 1BIAA 3BQZA 2NS8A 1OPCA 1ENHA 5IT3A 3TP3A 4QTRA 4YFKF 2ADUA 2CV2A 4W1UA 4EJTA 1FP1D 1ACIA 3K6GA 3ZQFA 4IZZA 1SMYF 1HKQA 1IN7A 3H9JA 1L3LA 4C30A 3Q0UA 4U87A 1R5ID 4AYBA 4CCKA 4D7MA 1OFCX 1ORKA 3EUKL 1U2WA 4BE2A 3UKGA 3DP7A 4UUSB 1A36A 2LY9A 1RUNA 3V8KA 1FBUA 5LEKA 2M1BA 2MW8A 1MBHA 2E1MB 1NHAA 2VB6A 1PJRA 4OMZA 5E3LA 4N9HA 1D3YA 2HS5A 4EJOA 4PJ0C 2LD5A 3IAS2 2CMPA 4EMSA 2KT0A 5ICCA 3OYKA 2HOTA 1QGPA 1LUJB 2CH0A 3PFYA 5J1YA 3VWBA 3LSKA 1G3YA 1SAUA 1EH6A 2FMYA 2VKVA 1ZN2A 5D8LB 1APLC 1FSHA 2EV0A 1TWAJ 5LLQA 4NBQA 2VC0A 4QLCU 2G0EA 2FOKA 2Y75A 1ULYA 2MC4A 3F8FA 2OBPA 4Y15A 1GXPA 2KRFA 2Y30A 5DCFA 3A4CA 1MDMB 4A5MA 1WCMJ 4ZDLA 5F04A 4BQQA 3LA7A 4AIJA 4P9FA 1VNDA 2KRCA 3I59B 5BNGA 2QBYB 1E17A 2HNHA 2EFPA 5GPCA 2DYRH 3OYMA 4CHUA 1DPUA 4DYRA 4LK0F 2E60A 2Y31A 1ETXA 2EIJH 2KISA 3GCMA 3GTMJ 3COAC 3IKTA 4FTHA 2DPUA 2HXOA 2WBMA 3JRIA
chains in the Genus database with same CATH topology
4BU2A 5HNFA 4F55A 3K70D 2VL8A 3MKZA 2VKHA 3OWTA 1MNEA 4BE1A 1W36D 4PSWA 2DT6A 3DPLC 4PFPA 3VYSB 2V1NA 1WJAA 4C9YA 2DJIA 2LBFB 2CW7A 3RSNA 3N05A 3TL4X 2IGNA 1MW7A 2XF6A 4FETA 3HPGA 2DT7B 2WAEA 2K3PA 3OYNA 3H5RA 2WAFA 3RPUD 4KISA 1D1BA 3OL3A 3K10A 2Q2EB 1V5EA 2M3AA 4DOZA 2VPLA 4JOMA 2R7TA 2AQFA 1BOBA 3QOEA 3S8PA 4F3QA 2L9SA 4CCNA 4LIVA 4XKWA 4BDZA 4Y33A 1MMGA 1TZLA 3EUHC 2MABA 4B48A 4AVZA 4DIQA 4KJZA 3DPTA 4HEA2 1VZ0A 4YEJA 2GOXB 3RCOA 4PJJA 3UNGC 4F91B 2L5QA 4NC7A 4NNJA 4ZDOA 3FBIB 4PSXA 2PMZA 2DOAA 3PNTA 1YX5A 3CF2A 3CESA 2W82A 2ZXHA 4E4HA 3VYUB 3OYFA 2OV7A 3IP4B 2LY1A 2VXDA 3BCAA 3D5SC 2VQHA 3OIQA 2VQLA 3FHNA 2VJ5A 5KHDA 2WAQA 3K4BA 5CQGA 3AL0C 1WFXA 4PJLA 3OR1C 3K4KA 2LY2A 2A5WA 1UG0A 2V26A 2PJRA 3IAM2 3HUGB 4KT6A 4XOPA 3S32A 1DP3A 3DEEA 4CZCA 2M7AA 4IKFA 2Y0SA 3OYIA 2VJJA 4FASD 4Y4RA 3LSMA 3OYCA 3EPZA 4EATA 1X1AA 4DJAA 4F52A 4BL0B 2V4JC 2VJ4A 1TT0A 2IS2A 3BG6A 2RREA 2K9MA 4P1WA 4CCMA 2BW3A 3LSIA 2CW8A 4YRVA 1K6YA 2M7BA 4CSWA 2KZVA 2M4GA 3BC8A 2QKMB 1X4PA 3OYJA 2XC7A 3AKZA 2WB1A 3PJRA 1WJ5A 2AQEA 4QPOA 4XKBA 2X6WA 1D1CA 3PNYA 4RM3A 1HA8A 4BJ6C 4D9JA 4J00A 2KL4A 3AL0B 2L9NA 4F92B 2Z1DA 4HNUA 4RMNA 3H5NA 2LH9A 3W2WA 1X1CA 1D0XA 3DPUA 4XKVA 1X1BA 2MFZA 1MMAA 3CJRB 3HXLA 3M8JA 1FMWA 3DKYA 2L2OA 1MMDA 2HQAA 4U7BA 2VJIA 2WY7Q 1LFPA 4XLFA 4BQNA 2K9LA 2LC2A 3S3MA 4BJ5C 2I8DA 4YELA 3J7AY 3G2BA 1Z3YA 2Z2SB 3S3OA 4OAZA 3SEZA 2L7KA 4RLQA 2VLAA 1MNDA 4XQFA 2JVHA 3CZ6A 4E7HA 3ZCOA 1D1AA 4AU7A 4CCJA 2HU9A 3I3LA 3I9V2 3RQ4A 3S3NA 3C2GA 2X51A 2R7QA 4II2A 3V42A 4X0GA 3OYGA 3L2UA 4BJTA 2IGMA 2VIXA 3K4NA 1Z7LA 2BOLA 2O5RA 3H0DA 1UAAA 3ZQQA 2JA2A 5FRMA 2CS3A 2X85A 2RNGA 2IGOA 4E7SA 4ANJA 1LDKB 4NQWB 2V7FA 4G6TB 4BDYA 2UWMA 1MMNA 1V5GA 3K4JA 3SEQA 2M0MA 4XLAA 2LRDA 1UELB 1BR2A 3DLAA 2W7NA 4BACA 4E7LA 5TGTA 3M1CA 4XMYA 4PJMA 1LKXA 2M4KA 3OYHA 1R6RA 1J09A 2CUJA 4HSTA 2R7WA 3OS0A 2NOJB 2W4SA 3K4CA 3LMMA 1BR1A 3NWSA 4GRIA 3RTRA 3BG7A 2JVGA 4H4KC 5LFAA 4HRIA 4PFOA 3SDBA 3VSKA 1Z3XA 4BS9A 5KCMA 4XKCA 1KONA 4II3A 2KLOA 4DGWB 1N78A 2KP6A 4HSRA 4Y3OA 4XONA 4ZDPA 4XR6A 3LSHA 2VASA 2Z16A 2VQCA 2VXZA 2IXSA 3KX2A 3HC7A 4LIUA 4E7ZA 3AFHA 4ZTJA 4BE0A 2F6CA 3A2KA 4XL9A 4QPQA 4NC8A 4B3XA 2LYCA 3HKZA 2HDWA 5HLTA 3UR3C 1JI8A 2ZXIA 3H5AA 3K4MA 3FBNB 3VYTB 1DQUA 4XORA 3S93A 1QHHD 2GOMA 4PK4A 4HNTA 2HPMA 2XF7A 4OAYA 3VYRB 1D0ZA 3ZGKA 3PSIA 1LVKA 1SFKA 4N4OB 2Q1ZB 4BEHB 2WADA 2V6EA 5FRNA 4XOTA 2KPMA 2KQRA 3DTIA 3KYLA 2BVLA 1DGWY 2JUGA 3BCBA 2XDVA 2XSJC 3ZXSA 1N75A 5LD2C 2WA0A 1G59A 3OS1A 2R7UA 4OWRB 2VKDA 4CCOA 4C2TA 1E0EA 1Z21A 1V5FA 2R7OA 4P5OA 1G8XA 3A1YA 4J01A 1U0JA 2CV1A 3SYTA 2XF5A 3L2RA 2IS4A 2IS1A 2HPIA 1DGRM 4CUGA 1N77A 3DTEA 2VQGA 2X1EA 4XLHA 3MKYB 3OYBA 2PJRB 3E1SA 3QYEA 3OY9A 3OIPA 5HVQC 4BQOA 2IGKA 4ZJZA 1WJDA 4CA0A 3IUOA 1X1DA 2LBFA 1QHGA 3MMYB 1EA3A 1T95A 3PSFA 4E6KG 2CUZA 1WJFA 4MLOA 3W2AA 1YE9A 1X4OA 3MD2A 2UUZA 2W1OA 3LL7A 2HVRA 1D0YA 3CMMA 3EUAA 3L2WA 1ERDA 5KNLA 3HOSA 3OMYA 3OYDA 3HPHA 4XNFA 4B44A 4XN3A 3E0JB 2ZSHB 3PNVA 5JHFA 1WJBA 3DQVC 3SZGA 1FMVA 4BUPA 2KHMA 2R4GA 1Y6IA 1GLNA 3PUBA 1NG6A 3DKXA 4NUBA 4R79A 2ZSIB 1T0FC 2R7VA 3QODA 2P0WA 3QYBA 4E7IA 1OLTA 2XAUA 4RM2A 3OYAA 4XLEA 3H35A 2LG4A 4HG2A 2X6XA 4ZTFA 2FUG2 3C2HA 3ZR8X 2HVQA 2ZFUA 4ZYAA 3VDXA 1IRXA 2BVMA 2K5CA 2ELJA 4KITB 4B43A 2JSPA 3OL4A 3KEYA 2QKLB 2KRHA 3GBGA 4F93B 2F4IA 3HG9A 1S9HA 4DBQA 1AA7A 3W2VA 3BLYA 5HOOA 4E7JA 4ZC3A 2MYSA 2A6TA 1YX3A 1PYVA 2E1MC 2F5VA 2UV1A 3DWLE 2CFOA 5HNHA 2MD0A 2LREA 2DCEA 3DTKA 3L2QA 4C2UA 1QU3A 4B47A 3HL2A 4XM3A 4IQ4A 5CPRB 2CV0A 4BEHA 3PL8A 1Y56A 3MKWB 2W00A 1X19A 3TMOA 1NG7A 2E5NA 4ITVA 3ZRGA 3OOUA 4D1QA 1ZELA 2CV2A 3K6GA 3QYFA 2RQQA 3D5RC 3FKJA 4RLFA 4IZZA 3L2VA 4XN0A 4IQJA 4DBRA 3HOTA 3H9JA 3DU5A 4C30A 4U87A 3K4LA 4AYBA 4CCKA 4CCLA 3LFUA 2X1CA 3EUKL 4BE2A 3LSGA 2E1MB 2VB6A 3OYLA 1PJRA 2HVSA 3OS2A 1WJCA 5CQEA 3IAS2 2CMPA 3K70C 5CKTA 4CH7A 3OYKA 5FROA 3F9KA 1W36C 3ONQA 2CH0A 3PFYA 2R7SA 4BGDA 3VWBA 3LSKA 1SAUA 3CJQB 3H9GA 3OR2C 4N4NB 3TBIA 3OYEA 3DU6A 4BXFA 4XLCA 2HZDA 2E5ZA 4JQFA 2OC6A 2MC4A 4LG3A 4PJNA 3VSLA 1P9QC 2V9KA 4HPQA 2DXIA 3A4CA 3FDYA 2BW3B 3D5LA 4ZDLA 4BQQA 1OR7C 2KMUA 2KRCA 4PUSA 2X1DA 3W3CA 3U21A 3H9QA 2HNHA 2WY8Q 2R7XA 3OYMA 3CP8A 2X6YA 2E60A 4IX7A 2LOOA 2IS6A 3NWTA 3CP2A 2R7RA 2WBMA 4LITA 1WJEA 1BR4A 4E7KA 2OUMA 2KDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5W A;  1JI8 A;  3OR2 C;  2V4J C;  2XSJ C;  1YX3 A;  1SAU A;  3OR1 C; 
#chains in the Genus database with same CATH topology
 2A6H F;  1V4R A;  5HNF A;  3BDD A;  3K70 D;  2KDZ A;  3LQQ A;  3RPU A;  5EEG A;  1MNE A;  2CYY A;  1W36 D;  2VT2 A;  3DPL C;  2CGP A;  3E6C C;  2DJI A;  3F3X A;  5F1R A;  4HX4 A;  3BG5 A;  2IGN A;  3AG1 H;  5E1X A;  4ESB A;  4FET A;  4ZYH A;  2E1N A;  2WAE A;  3FKI J;  4A0Z A;  2DOE A;  3U1D A;  4EQQ A;  3VPR A;  2EJR A;  1YW8 A;  4QSH A;  4KIS A;  2Q2E B;  2HZT A;  2WAQ N;  3C3W A;  1T0F A;  3CUQ C;  5DEQ A;  2VPL A;  4FIS A;  2R7T A;  2LK2 A;  3S8P A;  4F3Q A;  4CCN A;  4Y33 A;  2JQ7 A;  2NVT J;  5CVU A;  3EUH C;  1PVE A;  2D5V A;  3ISP A;  1D8J A;  3WU0 A;  1YQA A;  5FD5 A;  3U9G A;  1YLF A;  5K5Q A;  4YEJ A;  1G3S A;  5GAG J;  2NNY A;  4F91 B;  3F6O A;  4NNJ A;  4NC7 A;  1JGS A;  4UHT A;  5K7F A;  3KP7 A;  4PSX A;  2TCT A;  3WE2 A;  1YRN B;  3U1K A;  2VUM J;  4A12 A;  4UUS A;  2LKX A;  2GXG A;  5HS8 A;  3GLX A;  1R36 A;  2WV0 A;  2ZXH A;  2EBI A;  5LHI A;  3CCS I;  3TQN A;  4E4H A;  2IA1 A;  3F72 A;  3VYU B;  2LY1 A;  2VE8 A;  3GEZ A;  3GTO J;  3HB9 A;  3OIQ A;  2WB1 N;  3FHN A;  5LRS A;  2O8X A;  4S0H B;  3ZMS A;  1I3Q J;  1BJZ A;  2CUE A;  1FOY A;  4FX4 A;  5JI6 A;  1K4S A;  2V26 A;  5EJC A;  2OTJ I;  2DA5 A;  2FA5 A;  2GA1 A;  1BI3 A;  3CMY A;  2LFB A;  2DMP A;  1FTT A;  4IEJ A;  4CZC A;  4IKF A;  1XC5 A;  5FLM J;  1W5S A;  1T56 A;  1USS A;  3REO A;  2O8K A;  4OIO F;  4EAT A;  3A0H C;  4F52 A;  4AUX A;  3ZMV A;  3SXY A;  2V4J C;  4DW6 A;  1TT0 A;  4M6Y A;  2DFF A;  3BG6 A;  1MDM A;  1T33 A;  2CG4 A;  3FXO A;  3LSI A;  3MEX A;  3SFI A;  5B3S H;  2M7B A;  4A93 J;  3I59 A;  1UJ8 A;  2FD5 A;  1AWC A;  5E79 C;  2Q8K A;  2XC7 A;  2QBY A;  4B4C A;  1ZR2 A;  1TP4 A;  1EV7 A;  1EJ9 A;  1ZAO A;  5M3M J;  3SDG A;  3ZQH A;  3BR2 A;  4QPO A;  3KET A;  4U88 A;  3HGY A;  3BG3 A;  1HA8 A;  3F22 A;  4RAF A;  2DQL A;  4D9J A;  2QF7 A;  2C6Y A;  2KL4 A;  1QO0 D;  2XAJ A;  3P9I A;  2D1H A;  4F92 B;  5GAE J;  5K7H A;  3ML6 A;  4BAY A;  3BTI A;  2LH9 A;  2W57 A;  4G7H F;  1U78 A;  2V9V A;  4HW0 A;  1LDJ A;  4BYY A;  3DPU A;  4UVA A;  2W24 A;  1HLV A;  1MMA A;  3HXL A;  2XRL A;  1KYZ A;  1I3A A;  1HW2 A;  1FMW A;  1JT0 A;  1MSF C;  3BR3 A;  2L2O A;  4QIW N;  1MMD A;  1C0W A;  1U5T B;  1P4W A;  2VJI A;  4O6J A;  1LFP A;  3W6K B;  4BJ5 C;  2I8D A;  2VN2 A;  4YEL A;  1W7P B;  3S3O A;  4JBA A;  4RLQ A;  3P7N A;  3CZ6 A;  5LHH A;  5FGM A;  3ZCO A;  2CUF A;  1MZB A;  3I3L A;  2ZJR F;  3TW6 A;  2LP0 A;  3RQ4 A;  3LAJ A;  2KIF A;  2PMZ N;  4II2 A;  2QZ8 A;  3ASO H;  4IHX A;  5BOX A;  2IGM A;  2O5R A;  2HFH A;  2PX9 A;  2FJ1 A;  3ZMT A;  4XID A;  3GZN B;  1X3W B;  4O5V A;  1GXQ A;  5FRM A;  2RNG A;  3CC2 I;  1VQ5 I;  1LDK B;  1SC7 A;  1DU0 A;  5FFX A;  3G1M A;  3K4J A;  4M9S A;  2M0M A;  1K83 J;  2PQ8 A;  4XLA A;  1BR2 A;  3DLA A;  4FQG A;  4BAC A;  4E7L A;  3M1C A;  5FKO A;  3I54 A;  3RPQ A;  3OYH A;  1XGN A;  3BZC A;  1R6R A;  3DBH B;  1ZH5 A;  3CLQ A;  3ECH A;  3OIO A;  4L5E A;  1JKR C;  5IP6 A;  1T98 A;  3IKV A;  1AU7 A;  4M3D A;  3BG7 A;  1IRZ A;  1ZLK A;  2XV4 S;  5EGO B;  2DA4 A;  2MD5 A;  4LLN A;  1CQT A;  3ECO A;  3T5X A;  4AIK A;  4II3 A;  1YO5 C;  3K2A A;  4LLG F;  3HJE A;  4XR6 A;  3R0A A;  4DZJ A;  2K40 A;  1S29 A;  3NRV A;  4NC6 A;  1JHH A;  2IXS A;  3KX2 A;  3PM1 A;  1R00 A;  2FML A;  2NS0 A;  2F6C A;  1JUS A;  5D8K B;  4QPQ A;  3MVP A;  2M8G X;  3EDP A;  2DK5 A;  4F7Z A;  1JJ6 C;  4B3X A;  1OCZ H;  5HLT A;  1JI8 A;  3LSJ A;  2DTR A;  3G6E I;  1MJ9 A;  3FX3 A;  3BR5 A;  3TO7 A;  1EF4 A;  1TWG J;  3HTS B;  4R1H A;  2ZFW A;  3PIO F;  2RAE A;  3F8B A;  4Q48 A;  3PSI A;  5KK1 A;  2O7O A;  3CO6 C;  5FRN A;  2ESN A;  3CUO A;  3WU1 B;  1E3P A;  2KQR A;  5DTD A;  2R0Q C;  1POG A;  2JUG A;  3NEU A;  1FYK A;  2XDV A;  3HHG A;  3ABU A;  3OS1 A;  2R7U A;  1TT5 B;  4OWR B;  2VKD A;  2GZW A;  2QGU A;  1Z21 A;  1V5F A;  1WQ2 A;  4KN7 X;  5EYR A;  3CTA A;  2HPI A;  4WXH A;  4G7O F;  1XCB A;  3CLO A;  3DTE A;  2JA5 J;  4XLH A;  5E20 A;  1U5T A;  2VON A;  1U9O A;  3F21 A;  1W7P A;  3E1S A;  3OY9 A;  3GF2 A;  1X3Z B;  4S04 A;  5HDN A;  4NHJ A;  4BQO A;  2LMD A;  3B6C A;  2LKP A;  3SFZ A;  2IGK A;  2GLO A;  4ABZ A;  1R4M B;  2R92 J;  1I50 J;  3JR9 A;  4HF1 A;  1UZC A;  2KJC A;  2MSY A;  4CA0 A;  2B7E A;  3RKW A;  2OQR A;  1QHG A;  1K78 A;  2CUZ A;  3HRT A;  2VBZ A;  3CC7 I;  1YW9 A;  2DOF A;  9ANT A;  4EJU A;  2MGQ A;  2ZNY A;  3LL7 A;  3P9C A;  1VQ6 I;  3L2W A;  5KNL A;  4AIH A;  1STZ A;  2PMU A;  1QQI A;  3K0L A;  3HPH A;  4RB3 C;  5FD6 A;  3QOP A;  2ZSH B;  2HQR A;  2HGC A;  5L3D A;  3S15 J;  3OOP A;  4E70 A;  2EIN H;  4BUP A;  2R4G A;  1IXS B;  4RA2 A;  2UZK A;  4A0Y A;  5M3F J;  4LMY A;  3BY6 A;  4GO1 A;  1LE8 A;  4IHT A;  2XAQ A;  4NUB A;  4UVC A;  5BQT A;  1P92 A;  3DBR B;  2P0W A;  4E7I A;  4L9T A;  3FZV A;  4RM2 A;  2DMU A;  3GTL J;  5HS7 A;  4N0B A;  2LG4 A;  5EGO A;  2EZH A;  3C2H A;  1HKS A;  2GBY A;  4M74 A;  3HKZ N;  4ZYA A;  5C44 J;  2BXZ A;  1IRX A;  1B9N A;  1YYV A;  3JRC A;  4EJV A;  3FM5 A;  1GT0 C;  2DDB A;  2KRH A;  5ICF A;  4F93 B;  3I56 I;  3RZO J;  4DBQ A;  1AA7 A;  3BLY A;  4P96 A;  5DCM A;  3ULQ B;  4A3D J;  3BR6 A;  2EQR A;  1IUF A;  5F08 A;  2H6B A;  1TWC J;  1HW1 A;  1JT6 A;  4AYB N;  3QPS A;  3DWL E;  2OF7 A;  4L9J A;  2PG4 A;  4PDK A;  2IPQ X;  2DCE A;  3DTK A;  3L2Q A;  2OJE D;  4B47 A;  1QU3 A;  1J9I A;  2F5F A;  1XMK A;  2P6T A;  1TNS A;  1ODD A;  2OQG A;  4IQ4 A;  5CPR B;  2RGV A;  1T39 A;  4I98 B;  3MKW B;  1F36 A;  4J19 A;  1PUE E;  2ELK A;  1OJL A;  3J7A O;  2HQN A;  2PMH A;  2X4H A;  2JN6 A;  1AHD P;  3RQI A;  1BC8 C;  1UST A;  1TW3 A;  2ZCW A;  4A6E A;  2WWY A;  2FSW A;  3TW7 A;  1I1S A;  3OOU A;  1GV5 A;  4HX8 A;  4LK1 F;  1ZEL A;  1SAN A;  2HEO A;  3ERE D;  1QA6 A;  2RQQ A;  1R22 A;  2IEK A;  3FKJ A;  5E17 F;  3Q9S A;  3LFK A;  4I76 A;  4XN0 A;  3M07 A;  3DU5 A;  4ENK A;  1ITY A;  1R49 A;  2K02 A;  3DBL B;  4Y17 A;  1HOM A;  2X1C A;  3TGN A;  3ZN1 A;  2KIM A;  3FK6 A;  2COM A;  1H0M A;  2UXX A;  2BY2 A;  2P6S A;  1JE8 A;  2DMT A;  4BBS J;  2Z3Y A;  3D1N I;  1QRY A;  1IF1 A;  3J80 K;  2Z33 A;  2FXA A;  1WJC A;  4IL6 C;  3VOE A;  1ETV A;  2A3S A;  3DLL F;  5TRD A;  2FBK A;  4RGR A;  5FFZ A;  5FKN A;  5CKT A;  1RKW A;  4M3B A;  4BHC A;  3ONQ A;  4BGD A;  2G9W A;  3CJQ B;  3HM5 A;  3EYY A;  2L02 A;  5F1J A;  5K5O A;  3JRF A;  3HRM A;  2HZD A;  2E5Z A;  1GVJ A;  2OC6 A;  1VQ8 I;  1VQL I;  2ECB A;  4LG3 A;  2ZJQ F;  3CJN A;  3H3Z A;  4X6A J;  1MJA A;  4M6X A;  4HQM A;  3VSL A;  2HDD A;  2CWE A;  2HI3 A;  3CCV I;  2PBI A;  5IYC J;  1HDP A;  3RKY A;  2X48 A;  2ISZ A;  3RZD J;  2F5C A;  4D0P A;  4PUS A;  3H92 A;  3W3C A;  2JT1 A;  3H9Q A;  5HS9 A;  2WY8 Q;  2R7X A;  4A3L J;  2JUC A;  5JFR A;  4RGU A;  3FMS A;  3CP2 A;  2R7R A;  4LIT A;  1BR4 A;  2KJB A;  4ENN A;  4OIN F;  2JJ7 A;  1QPI A;  4BU2 A;  4MTE A;  3G71 I;  1IW7 F;  1MH4 A;  4D5F A;  2L9V A;  3KLN A;  2JK3 A;  4MFD A;  2VKH A;  4UUT A;  3OWT A;  3MKZ A;  3V7R A;  2DT6 A;  4D5C A;  4YG2 F;  1SFE A;  4PFP A;  5LEJ A;  1O4X A;  1YS6 A;  4LFU A;  3VYS B;  1BA5 A;  2LBF B;  5FB2 A;  1NK2 P;  4HF2 A;  1ZG3 A;  1ZAR A;  4V19 K;  1YOV B;  4M3F A;  3TL4 X;  1IRF A;  5K1Y A;  2YU9 J;  2JA6 J;  2EWN A;  1G2H A;  1QZY A;  2P5V A;  5JVT A;  2K3P A;  4EEF G;  1LB2 A;  1RZ4 A;  2EZL A;  2RDP A;  2E2J J;  4L9V A;  3OYN A;  2ETH A;  3RPU D;  1D1B A;  3K10 A;  1YIO A;  3ZQ7 A;  2JMW A;  4BY1 J;  1S7O A;  1P4X A;  4DOZ A;  5M5X J;  1OIS A;  5HLG A;  3M8F A;  1Y0N A;  3HYI A;  3QOE A;  5E18 F;  2HTJ A;  5HLI A;  1KU7 A;  1JJ8 C;  4LIV A;  4BDZ A;  1ZRD A;  2Z5U A;  4HOB A;  3G3Z A;  3CDH A;  4KJZ A;  1TLH B;  2PN6 A;  5F27 A;  2F5E A;  4EJW A;  4JK1 X;  4PJJ A;  3UNG C;  2ZME A;  3S16 J;  1QZE A;  3GME A;  3A01 A;  2OCC H;  3BJ6 A;  3NAR A;  2DN0 A;  3V8L A;  3HRS A;  2JTV A;  2DA3 A;  3CES A;  2XUB A;  3J81 K;  4BHP A;  2DK8 A;  1O7L A;  1IN5 A;  3QWL A;  1T2K A;  2OV7 A;  3IP4 B;  2V1X A;  4MTD A;  2VXD A;  4A3E J;  2DA1 A;  2MLG A;  3AG4 H;  2VQH A;  3BP8 A;  3EUH A;  2VQL A;  4MIM A;  3S1N J;  4A3G J;  4BH9 A;  3I58 A;  1VQO I;  5CQG A;  3HTU A;  2V1U A;  5E1Z B;  1M1E B;  3OR1 C;  1VF9 A;  3GX4 X;  3BR1 A;  3IAM 2;  3HUG B;  1ZGW A;  3MZH A;  4KT6 A;  3Q0V A;  4KYW A;  2B63 J;  3L00 A;  2CJJ A;  5CJ9 A;  4FAS D;  1IGN A;  3C2B A;  2IVM A;  2L9R A;  1X1A A;  4YII A;  4DQ2 A;  2RV8 A;  1REP C;  1Y8R B;  2QLZ A;  2K9M A;  4CCM A;  2IA0 A;  4FT8 A;  3LAP A;  4YRV A;  2XPV A;  5DS9 A;  5A2Q K;  3E7L A;  4CSW A;  2KZV A;  1X1P A;  1XX5 A;  3R4K A;  4YIR X;  1IC8 A;  3BC8 A;  3V7S A;  3Q3S A;  2DOD A;  1XGO A;  3ELK A;  1WJ5 A;  2E2H J;  1XDU A;  3JRB A;  4FHT A;  5CVJ A;  2X6W A;  2QSG X;  1D1C A;  4RM3 A;  1SD7 A;  3CCU I;  4IRH A;  4ZZL A;  3GFL A;  5DYM A;  1D5Y A;  4BJ6 C;  4RBO A;  1IJW C;  3AL0 B;  2L9N A;  1O3T A;  2Z1D A;  4HNU A;  3S17 J;  3WOD F;  5D4R A;  2X0L A;  3W2W A;  4ASN A;  1D0X A;  2VBW A;  1Z67 A;  2MFZ A;  3M8J A;  5H20 A;  3MQ0 A;  2IA2 A;  2XGD A;  3DKY A;  2LF8 A;  1R9T J;  1Z77 A;  2XKP A;  2WY7 Q;  2YUS A;  4PCQ A;  1DUX C;  4RB2 C;  2K9L A;  2LC2 A;  4GCV A;  1WRJ A;  3S3M A;  3WTZ A;  5E3N A;  2XAG A;  4HLY A;  5FLX K;  2QEX I;  3H0G J;  4OAZ A;  2DA7 A;  3TDZ C;  1MSE C;  1SFU A;  1TC3 C;  1MND A;  2V1D A;  2ZXJ A;  1VQ9 I;  2JVH A;  3E6B A;  2P7V B;  1OR7 A;  2DU9 A;  1ETQ A;  5KAI C;  1D1A A;  1F9N A;  4AU7 A;  4CCJ A;  1WHU A;  1Z1D A;  1ZR4 A;  2X51 A;  1L0O C;  4X0G A;  3S14 J;  5C4J J;  3L2U A;  1JKP C;  5J4V A;  3K4N A;  5J1U A;  2BOL A;  3G1L A;  3ZQQ A;  5B1A H;  1YG2 A;  3RI4 A;  5J1R A;  3KZY A;  5EEH A;  2K3F A;  2Y9Z A;  1SVL A;  3O8G A;  1ZKG A;  4ANJ A;  1YFH A;  5FKL A;  2V7F A;  4G6T B;  3VFZ A;  4BDY A;  2UWM A;  1MMN A;  1IAW A;  3SEQ A;  2H94 A;  5EG0 B;  1W1W E;  1U8R A;  1LQ1 A;  2NVY J;  1XTA A;  3ZQL A;  1B9M A;  1ON1 A;  4PJM A;  3CCR I;  2M4K A;  4A3C J;  3B02 A;  1TW2 A;  1IV8 A;  3JAM K;  3OS0 A;  1O3Q A;  1GUU A;  3GO5 A;  3Q5F A;  5C3E J;  3WG9 A;  1VQ7 I;  2W4S A;  1Y39 A;  4GRI A;  3LNQ A;  3MFK A;  2Y0M A;  4EM2 A;  5LFA A;  5CVV A;  2HR3 A;  2XGE A;  3BZ6 A;  1E2X A;  1Z3X A;  4G9Y A;  5KAF C;  5GAH J;  2AO9 A;  2P5K A;  2A07 F;  2EIM H;  2FQ3 A;  4DGW B;  1BIB A;  4G94 A;  2KP6 A;  4HSR A;  3M3Y J;  2PI0 A;  5ILS A;  1MNM C;  2Z16 A;  4A2U A;  2VQC A;  3IV5 A;  2VXZ A;  3HC7 A;  3TOA A;  3AFH A;  2RC4 A;  3A2K A;  1FOW A;  4IHV A;  3U2R A;  4NC8 A;  5H6R A;  2LYC A;  5HLH A;  2K7L A;  2QYO A;  3UR3 C;  4ESJ A;  1FJL A;  3H5A A;  4FX0 A;  1PUF B;  4XOR A;  3KZZ A;  2MH2 A;  4ON0 A;  1IV6 A;  4OAY A;  2XIG A;  3ZGK A;  1B72 B;  1SFK A;  5ICE A;  1KZH A;  1VTN C;  2VE9 A;  4C2M J;  2P7C B;  4BEH B;  3KYD B;  3QAH A;  2V6E A;  1FZP B;  1G4D A;  4ENJ A;  2KPM A;  3DTI A;  3KYL A;  1HBX G;  1I1G A;  2BVL A;  1CGP A;  1RC9 A;  1U8B A;  1PP7 U;  4M3E A;  1N75 A;  5LD2 C;  2M5W A;  4KNY A;  5D5X B;  2F4O B;  2ISY A;  4P5O A;  2LSO A;  4MEX F;  2QVO A;  1R1U A;  2XF5 A;  3DV8 A;  3QU6 A;  4AVP A;  5CLS A;  1DGR M;  1EH8 A;  4M71 A;  3H36 A;  1SFO J;  2VQG A;  2X1E A;  3CDL A;  3FMR A;  2ICW G;  2VC1 A;  5BMZ A;  3HHH A;  4BHB A;  3WHC A;  2PJR B;  4MGR A;  4PGG A;  4RB1 A;  5J6X A;  4GYG A;  5E8I A;  4BXX J;  2XRO A;  3ERM A;  5J4Y A;  2VBY A;  3JW4 A;  3WGI A;  2RQP A;  5J8F A;  4DNC A;  4MEY F;  1ONV A;  1X1D A;  3SHF A;  3MMY B;  1EA3 A;  4AD9 A;  5IT9 K;  4OIQ F;  3ROU A;  3W2A A;  4RB0 A;  1UHW A;  3CCQ I;  3MD2 A;  2VBX A;  1HCR A;  1EH7 A;  2NVU B;  1D0Y A;  2BE5 F;  4ZZD A;  1WGX A;  2L7Z A;  1W7P D;  3MZ8 A;  2Q2E A;  2DJN A;  2STT A;  4B44 A;  3PUF A;  4BY7 J;  1Z7U A;  3VEP A;  5JHF A;  3SQN A;  3DQV C;  2QUF A;  4HQE A;  1FMV A;  2YU3 A;  4NDL A;  4D7N A;  3I5U A;  1YIJ I;  2EFN A;  1I39 A;  1FPQ A;  1TQM A;  2M0C A;  3FXM A;  4M9Z A;  4R79 A;  4XRM A;  3HSR A;  1ZRE A;  1T0F C;  1I6X A;  1YW7 A;  2R7V A;  3BPX A;  4B3A A;  1N25 A;  2XAU A;  2VI6 A;  5JVG F;  2X6X A;  3K1N A;  2FUG 2;  1S7A A;  4KIC A;  1YRN A;  2HVQ A;  2VPR A;  1QPM A;  2A68 F;  2BVM A;  1HXD A;  2EFW A;  4ETS A;  4KIT B;  4I6Z A;  2Y48 A;  1S3J A;  2JSP A;  5KVR A;  3OL4 A;  3ZMU A;  5DUI A;  3LSP A;  1F43 A;  3E6M A;  2W48 A;  1KU3 A;  4UXN A;  3L9F A;  3JRE A;  2DBB A;  3FXL A;  4IXA A;  1IZ1 A;  1JTY A;  4MQ9 F;  4ENM A;  2FF4 A;  1O3R A;  3W2V A;  3TOB A;  3JCU C;  3GFJ A;  1FSE A;  2NVX J;  2XVC A;  5D4S A;  4CYC B;  3IHU A;  4EGZ A;  1OQY A;  1QVT A;  1PYV A;  2E1M C;  3JTG A;  1TTY A;  3O2P E;  4I0A A;  5GTH C;  1H9T A;  2MD0 A;  3BJA A;  1BM9 A;  2A05 A;  1RNL A;  3IRR A;  1SEU A;  2WC2 A;  5H6Q A;  4BEH A;  1MKM A;  2HOA A;  3PL8 A;  5AIQ A;  4G8X A;  4PGH A;  2R5Y B;  3JRA A;  2TDX A;  2LR8 A;  4M3G A;  1X19 A;  3B73 A;  2QSF X;  2L01 A;  1Y1W J;  2NOG A;  1NG7 A;  5D5V B;  4V2F A;  4XLN F;  3CCE I;  1IN6 A;  3ZRG A;  4XK4 A;  1VQP I;  1S5L C;  3EET A;  3VB2 A;  3I71 A;  5ILU A;  3QPL A;  3BTL A;  3HOW J;  4XRS A;  1MBE A;  4I7H A;  2WTE A;  1IO2 A;  2XGX A;  4G6Q A;  2GQQ A;  3QYF A;  1ZHF A;  1XSD A;  1LEA A;  2IP2 A;  5K7Z A;  3GTG J;  3RJP A;  4IQJ A;  4A6D A;  2OD5 A;  2DMQ A;  3K4L A;  1Q1V A;  1FY7 A;  1K7A A;  5F0C A;  4CCL A;  2H8R A;  2DW4 A;  2K9N A;  1Z6R A;  3BJO A;  3K1M A;  2LLK A;  2K9Q A;  1MIJ A;  1RPW A;  4UB8 C;  3LSG A;  5DM6 F;  3OYL A;  3BR0 A;  2HVS A;  3OS2 A;  1UHS A;  4R8H A;  1E3H A;  2CSO A;  3K70 C;  2IT0 A;  5CYV A;  4CH7 A;  2N8G A;  2EV5 A;  1J59 A;  3F9K A;  5LBQ A;  5JHU A;  1W36 C;  4M73 A;  2GWR A;  1W4M A;  2R7S A;  3IRQ A;  1ZRF A;  2GAU A;  3HGG A;  1R5G A;  2MLK A;  3BG9 A;  4N4N B;  3TBI A;  3KP4 A;  4CIC A;  1SAX A;  3WTS C;  1SVO A;  5L3C A;  1YIT I;  4BXF A;  3KYC B;  3CCM I;  3S1M J;  1SFX A;  1GVD A;  2L7M P;  2Y69 H;  4JQF A;  3S2W A;  1R58 A;  4RAY A;  1FWZ A;  1ZG5 A;  2HKO A;  1MBK A;  2OZ6 A;  1O3S A;  3KCC A;  4HPQ A;  2XRN A;  1JHF A;  3CCY A;  4HZF A;  2DXI A;  2BW3 B;  3JSP A;  1I27 A;  2KMU A;  1GV2 A;  5EZG A;  3F0C A;  2X1D A;  4LJZ F;  3U21 A;  3F8N A;  1ETO A;  1S6L A;  5LGU A;  1FYM A;  2X6Y A;  4IX7 A;  2HDC A;  2FRH A;  2IS6 A;  2DQR A;  3NWT A;  4E7K A;  5HDG A;  2CW0 F;  1WJE A;  3W6J B;  2OUM A;  5HDK A;  4V2G A;  2EV6 A;  2ZKZ A;  1B1B A;  1SD4 A;  3NQO A;  4N9I A;  4F55 A;  1FBQ A;  2UXN A;  3KEO A;  4BE1 A;  3IWZ A;  4PSW A;  2WV1 A;  3M7G A;  4CYC A;  2QM3 A;  5IP9 J;  3T8T A;  2M2E A;  3IC7 A;  2V1N A;  4C9Y A;  3SJM A;  1Z91 A;  1UCR A;  2YS9 A;  4UB6 C;  3B6A A;  1Z9C A;  3N05 A;  3DCF A;  3M4O J;  1Y0U A;  3IWF A;  5EF6 A;  1B8I B;  2AXL A;  2XF6 A;  5BPI A;  1UHM A;  3HPG A;  2HKX A;  4FE4 A;  4YFN F;  5GTI C;  3LWF A;  4HNV A;  5FKK A;  4X1E A;  3J81 Z;  3BRO A;  1RRJ A;  1GDT A;  3ABT A;  4MNU A;  2R5Y A;  1T08 B;  3GZ6 A;  3H5R A;  2WAF A;  1H8A C;  2I5U A;  2H27 A;  2F4M B;  1FX7 A;  1IRG A;  2FOW A;  4JX5 A;  1V5E A;  4AC0 A;  1W5C C;  2O0Y A;  3CQZ J;  3MAJ A;  1BOB A;  2DMN A;  3CF5 F;  2L9S A;  3HOX J;  2HXI A;  4XKW A;  4P55 A;  2K85 A;  1TZL A;  2RKH A;  2MAB A;  1KQ8 A;  3ZP5 A;  5D5W B;  4HEA 2;  1VZ0 A;  3GLL A;  2GOX B;  3RCO A;  1FTZ A;  1T38 A;  1FEX A;  1LFU P;  4KIG A;  3JRG A;  1WH5 A;  4I0B A;  2PMZ A;  3BPV A;  2K4B A;  3I4P A;  3R6S A;  1K79 A;  1DDN A;  2W82 A;  3QP6 A;  3K1P A;  4HLX A;  1H88 C;  3FF5 A;  2ZO4 A;  3CMA I;  2NS7 A;  4I99 C;  3K7A J;  5A2Q Z;  5M5W J;  1B4A A;  2M34 A;  3BCA A;  5F0H A;  4IO9 F;  3D5S C;  1KA8 A;  2XHK A;  5KHD A;  2IW5 A;  1U9N A;  3OSF A;  1TWF J;  2FBI A;  3K4B A;  3N97 A;  3JSO A;  1WFX A;  1WH7 A;  3L09 A;  2LY2 A;  1UG0 A;  2P4W A;  4XOP A;  3S32 A;  1WVR A;  2JPC A;  3CUQ B;  3DEE A;  1DP3 A;  1A35 A;  3V7C A;  2IJL A;  2Y0S A;  4IOC F;  3OYI A;  1DU6 A;  4WCG A;  4HV6 A;  1U5T C;  3OYC A;  2J5O A;  3EPZ A;  2E35 A;  1S7E A;  3FXJ A;  4DJA A;  3L2C A;  2EIL H;  2OAZ A;  2VJ4 A;  2FEZ A;  3ZMZ A;  4Y7N J;  2D45 A;  2K4J A;  2BW3 A;  2M87 A;  2CW8 A;  3H1C A;  1K6Y A;  4CDG A;  2QWW A;  2M4G A;  1WWX A;  1OCO H;  1QVU A;  2QKM B;  3DFG A;  5FLX Z;  3HOY J;  3HRU A;  4XIC A;  2ZC2 A;  1YJN I;  5LRR A;  3WTT C;  5DD8 A;  5DM7 F;  1TL8 A;  1ZLJ A;  3BZK A;  3P5J A;  4UV9 A;  4S05 A;  2CQ7 A;  2BZT A;  1FLI A;  2XGC A;  5DV5 A;  3PIP F;  2Z99 A;  4RGX A;  1X3U A;  2H09 A;  2L7F P;  2I10 A;  1YJW I;  4RMN A;  3H5N A;  3TO9 A;  5H2F C;  3IH4 A;  2CU7 A;  1IG7 A;  2PEX A;  4XKV A;  1X1B A;  3CJR B;  3L7W A;  3O6B B;  3WU2 C;  4XBF A;  2Z9O A;  4DZP A;  3WG7 H;  3MZY A;  2VOP A;  3GVA A;  3KP3 A;  2HQA A;  4UUV A;  1FP2 A;  4U7B A;  2EFO A;  1OCT C;  1B8I A;  4XLF A;  4BQN A;  1KU2 A;  4LB6 B;  3J7A Y;  3G2B A;  2A6E F;  2Z2S B;  3SEZ A;  4BXU A;  3JAM Z;  4XQF A;  4E7H A;  1RKT A;  3DEU A;  2A5Y B;  3AAF A;  1RI7 A;  5ICG A;  4A5N A;  4YFX F;  5IPA A;  2DA6 A;  4FCY A;  1XD7 A;  3S3N A;  3C2G A;  2R7Q A;  4A3M J;  2ESH A;  4BQA A;  3E3V A;  3RYP A;  2IRF G;  1Z7L A;  2JSC A;  4CGZ A;  2JA2 A;  2CS3 A;  4ZYG A;  4E7S A;  1VI0 A;  1RUO A;  2L54 A;  1Z6T A;  1V5G A;  3PO3 J;  3EYI A;  3LA2 A;  1XCV A;  2IAI A;  1UEL B;  2OZU A;  5JR3 A;  1AKH B;  1RES A;  2EH3 A;  5TGT A;  2P5L C;  4XMY A;  1O7F A;  2YX7 A;  3HBL A;  1PDN C;  1IDY A;  3Q9V A;  2CUJ A;  1J75 A;  2EZI A;  2FNA A;  3PO2 J;  4KN4 X;  2OTL I;  1ZYR F;  1RR8 C;  3FXR A;  2LF7 A;  2PLY A;  1BR1 A;  4B09 A;  4GFB A;  3HEF A;  1VQ4 I;  2JVG A;  4XLP F;  4HRI A;  4PFO A;  3SDB A;  4U0Y A;  2NXN B;  3E5Q A;  3OSG A;  3CO7 C;  2VKE A;  5KCM A;  3KPH A;  4XKC A;  5TJJ A;  1P4A A;  2E36 A;  2GIZ A;  3HSE A;  1N78 A;  4YIF A;  4Y3O A;  5E3M A;  5M5Y J;  3CUQ A;  4XON A;  4ZDP A;  1Y1V J;  1HF0 A;  3K2Z A;  3LQR A;  1YTY A;  2VAS A;  3R61 A;  1B59 A;  3QRF F;  1FNN A;  1XS9 A;  2OPT A;  3ABK H;  5GAD J;  2QSH X;  3K69 A;  4EVI A;  3HKZ A;  1H9G A;  2HDW A;  2DAO A;  2HOE A;  4L9N A;  5E3O A;  2ZXI A;  1LEB A;  3S93 A;  1QHH D;  2GOM A;  2LDU A;  4PK4 A;  4HNT A;  2XF7 A;  2YR2 A;  3AG3 H;  4LLL A;  4ESF A;  4IHS A;  3S2H J;  3VYR B;  1D0Z A;  4UY8 I;  4ZYD A;  1FOX A;  2KKO A;  1O57 A;  2ZJ2 A;  2G7H A;  2Q1Z B;  4KMF A;  4OIP F;  3G1O A;  4MHG A;  2B0L A;  2WAD A;  4HV5 A;  3PQK A;  5D6F A;  4XOT A;  4TV7 A;  1F1Z A;  4IVN A;  1YI2 I;  3OV8 A;  2OCE A;  2HYJ A;  3HIF A;  2KIQ A;  2XSJ C;  3ZXS A;  5IT9 Z;  4A3I J;  3EQL F;  5FLV A;  1K6O A;  2M45 A;  5FKM A;  2DTZ A;  2EZK A;  1KYW A;  2XB5 A;  1G59 A;  2MH9 A;  3MWM A;  4OMY A;  4H0E A;  1E0E A;  1IXC A;  1ON2 A;  2LNB A;  3QPT A;  3RYR A;  1HDD C;  1D8K A;  2BY1 A;  3A1Y A;  3AG2 H;  2YSR A;  2CV1 A;  3L2R A;  2IS4 A;  3I4M J;  1H89 C;  2P8T A;  1ZGJ A;  4CUG A;  3I55 I;  2FU4 A;  4U0W A;  3WE3 A;  4XRF A;  2IBD A;  4RAG A;  1RET A;  3ESW B;  3MKL A;  4KT5 C;  1LNW A;  1J2X A;  3OIP A;  1LJ9 A;  5HVQ C;  2DFE A;  2A69 F;  3ABL H;  3WTV C;  1VQN I;  1TNT A;  2NNN A;  2KIU A;  3LOC A;  3IUO A;  2LBF A;  2XAH A;  4HA8 A;  4RAZ A;  2EA2 A;  2JRM A;  2BXY A;  2F5D A;  4G12 A;  1T95 A;  3JRH A;  4E6K G;  1Y8Q B;  5BS6 A;  1WJF A;  4MLO A;  1J5Y A;  2RN7 A;  4AM3 A;  1YE9 A;  1X4O A;  2ZB9 A;  5F6F A;  2HVR A;  3QQA A;  1ERD A;  2M9H A;  3HOS A;  1R71 A;  2Y9Y A;  5J40 A;  3QP5 A;  1KQ9 A;  2RNJ A;  4XN3 A;  5FO5 A;  1AKH A;  3PNV A;  2R7F A;  1G6N A;  1U3E M;  3BOQ A;  3SZT A;  2DPD A;  1A04 A;  1Y6I A;  3PUB A;  3FMQ A;  1NG6 A;  3DKX A;  2JRT A;  1SD6 A;  3R60 A;  4I02 A;  5D6E A;  2ACJ A;  4I2O A;  4IPA A;  3KLO A;  4UNO A;  1J0R A;  2ZSI B;  4G7Z F;  5IYD J;  1G3T A;  2BBY A;  2L3D A;  2MBF A;  1OLT A;  3OYA A;  1QZZ A;  2XB0 X;  3L1P A;  4HG2 A;  1OYY A;  2E19 A;  1F4K A;  3ZR8 X;  1WPK A;  3R0J A;  5IP7 J;  2K5C A;  1E3O C;  4WWC A;  1X2N A;  4B43 A;  1VFC A;  3GBG A;  2ZME C;  2F4I A;  4BKX A;  5DDG A;  4Y52 J;  2JWT A;  2F48 A;  1FIP A;  4RS8 A;  3O3K A;  4E7J A;  3M1E A;  4KIF A;  3KP6 A;  3ZQG A;  4C3I J;  3I4N J;  2YX4 A;  2MYS A;  4EM0 B;  2A6T A;  4Q5S F;  1YX3 A;  4Q47 A;  3HUG A;  2UV1 A;  3KE2 A;  1NK3 P;  5DUK A;  4C2U A;  1P6R A;  4WX9 A;  3HL2 A;  4BNC A;  3CDI A;  2CV0 A;  5JLX A;  2GA2 A;  1Y56 A;  1MBF A;  3GTP J;  2VOO A;  2ID3 A;  3I0T A;  1HW5 A;  1TQP A;  2E5N A;  4ITV A;  1V55 H;  1ETW A;  2MC3 A;  1Q1H A;  4D1Q A;  4CYD A;  5F0F A;  2L4A A;  1J7K A;  3D5R C;  4L5I A;  4RLF A;  3L2V A;  5ERI A;  1P7J A;  1BI0 A;  2XSD C;  4DBR A;  3HOT A;  2XAF A;  1W0T A;  4CXF A;  3KP2 A;  2E71 A;  2O6G E;  1KU9 A;  1WI9 A;  4NB5 A;  3LFU A;  1IDZ A;  4UVB A;  2K27 A;  2X9D A;  2MG4 A;  1Z05 A;  3TED A;  2PJP A;  2E7X A;  5L3B A;  2DFI A;  2K86 A;  1P7I A;  3CME I;  1RIO H;  3G4S I;  3BQY A;  4HAM A;  5CQE A;  1OCR H;  3N4M A;  2HYF A;  2ZNZ A;  2G7U A;  3HSF A;  5FRO A;  4A3B J;  3GUD A;  1HST A;  4C3J J;  3H9G A;  3OR2 C;  1T6S A;  3KFW X;  4BBR J;  3OYE A;  1OYI A;  3DU6 A;  1K4T A;  2ELH A;  2BHZ A;  3CD6 I;  1BJA A;  4XLC A;  2H1K A;  3LSR A;  2DT5 A;  3J7Z I;  2W85 A;  4A3F J;  4LOC A;  4PJN A;  1OYW A;  4RDU A;  2EK5 A;  1P9Q C;  2V9K A;  3GWZ A;  3TO6 A;  4KUM A;  4KA4 A;  3FDY A;  3D5L A;  1NTC A;  2ECC A;  1OR7 C;  2MA3 A;  3I64 A;  5BPD A;  1OKR A;  1XMX A;  2A61 A;  2EA4 A;  4HX7 A;  2CO5 A;  4OU0 A;  2HYG D;  2AXT C;  1FBS A;  2GIV A;  5EG0 A;  2JA8 J;  3IH2 A;  1UG2 A;  4DYQ A;  3CP8 A;  2LOO A;  3CCL I;  2QA4 I;  2PFB A;  3ZOB A;  3T1B A;  3DKW A;  2QQ9 A;  4C3H J;  3NAU A;  2K9S A;  1JXS A;  2OU2 A;  2KDO A;  1BI2 A;  2O9L A;  2HWV A;  2R5Z B;  3F6V A;  1JKO C;  4GXO A;  2VL8 A;  2R3S A;  1TQI A;  3S1Q J;  2ID6 A;  5AIP A;  3ZQI A;  2HOS A;  4L5J A;  5AON A;  2P81 A;  4XRS G;  2NYX A;  1WJA A;  4WF2 A;  1MH3 A;  1Z0X A;  2V9P A;  3IH3 A;  4W97 A;  3C18 A;  1K78 B;  3DEW A;  4B8X A;  2CQN A;  2W84 A;  2CW7 A;  3RSN A;  4KMU X;  2QCO A;  1MW7 A;  1A31 A;  4IRG A;  1R23 A;  2DT7 B;  3WGG A;  3RKQ A;  1SMT A;  1XB4 A;  5FJ8 J;  1VQM I;  2KZG A;  1WSU A;  5JLW A;  2QQA A;  3OL3 A;  1ZGA A;  5B66 C;  2M3A A;  1PUF A;  4JOM A;  5B5E C;  3S1R J;  2HTS A;  4HYE A;  2AQF A;  1DP7 P;  2DLL A;  2H6C A;  1MMG A;  2ME0 A;  4B48 A;  2E7W A;  4AVZ A;  5IY5 H;  1XGM A;  4DIQ A;  1B72 A;  1LE8 B;  2DI3 A;  3C1D A;  2ZXW H;  1A5J A;  3DPT A;  1ZTR A;  1MBJ A;  2KFD A;  5HOD A;  2Y0S N;  3I53 A;  3KEQ A;  3VOD A;  3J80 Z;  4CO8 A;  3E5U A;  4UV8 A;  6PAX A;  2L5Q A;  4ZDO A;  3FBI B;  5GPA A;  1U6G A;  1A6Q A;  5C4X J;  3FXU A;  2DOA A;  3PNT A;  2BYV E;  4B1R A;  2B9S A;  2CQX A;  1LVA A;  1YX5 A;  3CF2 A;  1T8I A;  4A69 C;  1KGS A;  2JPB A;  3OYF A;  1NH3 A;  3ZQC A;  4A0X A;  2QEN A;  1IXR C;  3F8C A;  3GYH X;  4Z2Y A;  5DCM B;  2VJ5 A;  5IOY A;  3G73 A;  2WAQ A;  4OOI A;  1R5H A;  4JYK A;  3AL0 C;  4PJL A;  3K4K A;  4HBL A;  2A5W A;  1BOA A;  2D2W A;  2FX0 A;  1CF7 B;  2PJR A;  3KIO A;  3WHB A;  1B6A A;  3CJT B;  3V4G A;  3DF8 A;  1BBY A;  1G3W A;  2DYS H;  4MQV A;  4L0Z B;  2M7A A;  3RDI A;  3F23 A;  4A3K J;  2VJJ A;  5F64 A;  1FT9 A;  4Y4R A;  3LSM A;  2XAS A;  1MGT A;  4AWX B;  2BGC A;  1AOY A;  3HDD A;  4BL0 B;  4JX4 A;  3CC4 I;  1MJB A;  4IOA F;  4LB5 A;  2IS2 A;  2L0K A;  2RRE A;  3WTW C;  4P1W A;  3QPH A;  3HZJ A;  3V8J A;  1BI1 A;  3FWE A;  4WXD A;  3RKX A;  1X4P A;  2E34 A;  3OYJ A;  5ILV A;  1BW5 A;  3AKZ A;  2WB1 A;  3MN2 A;  4PZJ A;  3PJR A;  2AQE A;  2D1V A;  1HKT A;  1S8N A;  1JGG A;  4XKB A;  2YPR A;  3PNY A;  1UMQ A;  1JTX A;  3FXQ A;  2F2E A;  3J7Y J;  3JRD A;  2R5Z A;  1ETK A;  4J00 A;  1ZG1 A;  1TWH J;  2FE3 A;  2FNP A;  3WTY C;  2AS5 F;  1UFM A;  4GDF A;  1X1C A;  2BY0 A;  1LPQ A;  5B1B H;  3Q0W A;  2EFQ A;  4DYC A;  2DA2 A;  3D0S A;  3KZI C;  1FC3 A;  3BTJ A;  1Z3Y A;  2L7K A;  3E6D A;  3JTH A;  2VLA A;  1MMS A;  3F8M A;  4U0V A;  1WI3 A;  1XDS A;  2VOD A;  1UB9 A;  2STW A;  3HOU J;  1ZK8 A;  2GXA A;  1JUM A;  3M8E A;  5L3G A;  2DFH A;  3FK7 A;  2Y2Z A;  4QWQ A;  5LGT A;  1D5V A;  2HU9 A;  4HDV A;  4MFE A;  3I9V 2;  1RR7 A;  1K61 A;  4JX6 A;  3V42 A;  1BW6 A;  1R4N B;  1IN4 A;  5CVI A;  3OYG A;  3PQJ A;  4BJT A;  2VIX A;  4HDU A;  1QBJ A;  3H0D A;  1UAA A;  3FM3 A;  2DO7 A;  2DDA A;  4EM1 A;  1ZRC A;  2X85 A;  3QU3 A;  2IGO A;  5EZH A;  4NQW B;  1SVM A;  3GFM A;  2CQK A;  3ZPL A;  2LRD A;  1VQK I;  4KDP A;  2R7Z J;  2W7N A;  4XSX F;  5LGN A;  1EKE A;  1LKX A;  2JA7 J;  5J3L A;  1FIA A;  1J09 A;  4EGY A;  4HST A;  2R7W A;  2CQQ A;  2ZBK A;  1XSV A;  2NOJ B;  3K4C A;  2FBH A;  3LMM A;  3NWS A;  3RTR A;  2H1L A;  4H4K C;  1XPX A;  3VSK A;  4BS9 A;  2E1O A;  1HQC A;  3DXJ F;  5ED4 A;  1CF7 A;  4Q4Z F;  4GGG A;  1KON A;  3A03 A;  2KLO A;  4JP0 A;  2XPW A;  2BEO A;  1I5Z A;  1V54 H;  2EIK H;  1XG1 A;  3LSH A;  1YJ9 I;  1YHQ I;  5DD4 A;  5L3F A;  1OMI A;  3A02 A;  4E7Z A;  4LIU A;  1IN8 A;  4ZYE A;  3WTU C;  4BE0 A;  4ZTJ A;  3W6V A;  3WTX C;  2BV6 A;  2Q0O A;  4XL9 A;  1LDD A;  2R7D A;  4U7D A;  4LG0 B;  3PFI A;  4MO7 A;  4I01 A;  2R93 J;  1MD0 A;  2CFX A;  1ZQ3 P;  3K4M A;  3FBN B;  3VYT B;  1DQU A;  3ZN0 A;  1S72 I;  2M8E A;  2HPM A;  4OIR F;  3RIR A;  1WKM A;  4G6D A;  4Y13 A;  1X58 A;  5J8C A;  1PP8 F;  4K2E A;  3HOV J;  3ABM H;  2TRT A;  1LVK A;  3TP0 A;  3ZMD A;  2RVC A;  4N4O B;  1F5T A;  4WXC A;  4AID A;  5LHG A;  1XN7 A;  3CCJ I;  2ZME B;  2OA4 A;  1DPR A;  2GXB A;  2HQ5 A;  3A01 B;  1DGW Y;  4KIB A;  1P2F A;  1WZ2 A;  3BCB A;  2H8W A;  2WA0 A;  4M6V A;  1R7J A;  3GTJ J;  1YS7 A;  4IF4 A;  4CCO A;  4C2T A;  3LA3 A;  4XSZ F;  3HOZ J;  2R7O A;  1G8X A;  4J01 A;  1U0J A;  3SYT A;  3GTK J;  2E2I J;  2EPF A;  2IS1 A;  1BN5 A;  4CZZ A;  1N77 A;  3MCZ A;  2V6C A;  3FHZ A;  1I6H J;  2O03 A;  1GHC A;  4M72 A;  3MKY B;  2FQ4 A;  3OYB A;  4A3J J;  2BY3 A;  3QYE A;  5D5U B;  3O8H A;  2O3F A;  2GM4 A;  2QQB A;  3GZ5 A;  1IUY A;  4ZJZ A;  1WJD A;  3TKY A;  3GTQ J;  1V3F A;  1TBX A;  2LKS A;  3A0B C;  1JUP A;  3PSF A;  1BC7 C;  2CRG A;  5GP9 A;  1R1T A;  2UUZ A;  2W1O A;  3GW2 A;  2XKO A;  3CMM A;  3EUA A;  2E1C A;  1XSX A;  3T0Y A;  1LFB A;  3OMY A;  2EB7 A;  4IJA A;  3OYD A;  4NQW A;  3E5X A;  4XNF A;  2J5P A;  2LVS A;  3ASN H;  2ZJP F;  5CVR A;  3E97 A;  3WGH A;  4EV0 A;  1KQ0 A;  3E0J B;  3GXO A;  1FOK A;  1SD5 A;  4L0Y B;  2NVQ J;  3H3V K;  1WJB A;  4O3M A;  3P9K A;  3SZG A;  2KHM A;  1W5T A;  3BWG A;  2V79 A;  5IYB J;  3BTC A;  2O61 A;  1GLN A;  3FXK A;  4ZH4 F;  4FE7 A;  1XGS A;  4WK8 F;  2NRA C;  4I09 A;  5IOZ A;  5EEA A;  3SZP A;  2ME6 A;  2X6O A;  3QOD A;  2JZY A;  5E1W A;  5TIS C;  1W0U A;  3QYB A;  2XPU A;  2BHY A;  1ETY A;  4XLE A;  4L18 B;  3H35 A;  3LST A;  4ZTF A;  4GYI A;  2QQ8 A;  2ZFU A;  1OCP A;  3VDX A;  2L4M A;  1MBG A;  2ELJ A;  3BT9 A;  3IL2 A;  1A6I A;  1JKQ C;  1X2M A;  4HF0 A;  2VT3 A;  3FIS A;  3KEY A;  2QKL B;  5E8G A;  4IRI A;  2LTP A;  4IHY A;  1FYL A;  2COB A;  1S9H A;  3HG9 A;  2W25 A;  5L3E A;  3H3U A;  3TDU C;  4LD5 A;  3T8R A;  3FIW A;  1BL0 A;  4LG0 A;  4P9U A;  4RGS A;  3X2Q H;  4Z6Y A;  5HOO A;  3M9A A;  1XMA A;  1QNT A;  1R1V A;  5K5R A;  4ZC3 A;  5EDN A;  4KFC A;  1HC8 A;  2F5V A;  2NAZ A;  2CFO A;  5HNH A;  3GFI A;  3C7J A;  5J47 A;  4IHW A;  4M9X A;  2LRE A;  3K9T A;  4LGW A;  2AHQ A;  1HSJ A;  2M30 A;  4XM3 A;  3KP5 A;  3S2D J;  2W00 A;  3TMO A;  1OCC H;  1BIA A;  3BQZ A;  2NS8 A;  1OPC A;  1ENH A;  5IT3 A;  3TP3 A;  4QTR A;  4YFK F;  2ADU A;  2CV2 A;  4W1U A;  4EJT A;  1FP1 D;  1ACI A;  3K6G A;  3ZQF A;  4IZZ A;  1SMY F;  1HKQ A;  1IN7 A;  3H9J A;  1L3L A;  4C30 A;  3Q0U A;  4U87 A;  1R5I D;  4AYB A;  4CCK A;  4D7M A;  1OFC X;  1ORK A;  3EUK L;  1U2W A;  4BE2 A;  3UKG A;  3DP7 A;  4UUS B;  1A36 A;  2LY9 A;  1RUN A;  3V8K A;  1FBU A;  5LEK A;  2M1B A;  2MW8 A;  1MBH A;  2E1M B;  1NHA A;  2VB6 A;  1PJR A;  4OMZ A;  5E3L A;  4N9H A;  1D3Y A;  2HS5 A;  4EJO A;  4PJ0 C;  2LD5 A;  3IAS 2;  2CMP A;  4EMS A;  2KT0 A;  5ICC A;  3OYK A;  2HOT A;  1QGP A;  1LUJ B;  2CH0 A;  3PFY A;  5J1Y A;  3VWB A;  3LSK A;  1G3Y A;  1SAU A;  1EH6 A;  2FMY A;  2VKV A;  1ZN2 A;  5D8L B;  1APL C;  1FSH A;  2EV0 A;  1TWA J;  5LLQ A;  4NBQ A;  2VC0 A;  4QLC U;  2G0E A;  2FOK A;  2Y75 A;  1ULY A;  2MC4 A;  3F8F A;  2OBP A;  4Y15 A;  1GXP A;  2KRF A;  2Y30 A;  5DCF A;  3A4C A;  1MDM B;  4A5M A;  1WCM J;  4ZDL A;  5F04 A;  4BQQ A;  3LA7 A;  4AIJ A;  4P9F A;  1VND A;  2KRC A;  3I59 B;  5BNG A;  2QBY B;  1E17 A;  2HNH A;  2EFP A;  5GPC A;  2DYR H;  3OYM A;  4CHU A;  1DPU A;  4DYR A;  4LK0 F;  2E60 A;  2Y31 A;  1ETX A;  2EIJ H;  2KIS A;  3GCM A;  3GTM J;  3COA C;  3IKT A;  4FTH A;  2DPU A;  2HXO A;  2WBM A;  3JRI A; 
#chains in the Genus database with same CATH homology
 4BU2 A;  5HNF A;  4F55 A;  3K70 D;  2VL8 A;  3MKZ A;  2VKH A;  3OWT A;  1MNE A;  4BE1 A;  1W36 D;  4PSW A;  2DT6 A;  3DPL C;  4PFP A;  3VYS B;  2V1N A;  1WJA A;  4C9Y A;  2DJI A;  2LBF B;  2CW7 A;  3RSN A;  3N05 A;  3TL4 X;  2IGN A;  1MW7 A;  2XF6 A;  4FET A;  3HPG A;  2DT7 B;  2WAE A;  2K3P A;  3OYN A;  3H5R A;  2WAF A;  3RPU D;  4KIS A;  1D1B A;  3OL3 A;  3K10 A;  2Q2E B;  1V5E A;  2M3A A;  4DOZ A;  2VPL A;  4JOM A;  2R7T A;  2AQF A;  1BOB A;  3QOE A;  3S8P A;  4F3Q A;  2L9S A;  4CCN A;  4LIV A;  4XKW A;  4BDZ A;  4Y33 A;  1MMG A;  1TZL A;  3EUH C;  2MAB A;  4B48 A;  4AVZ A;  4DIQ A;  4KJZ A;  3DPT A;  4HEA 2;  1VZ0 A;  4YEJ A;  2GOX B;  3RCO A;  4PJJ A;  3UNG C;  4F91 B;  2L5Q A;  4NC7 A;  4NNJ A;  4ZDO A;  3FBI B;  4PSX A;  2PMZ A;  2DOA A;  3PNT A;  1YX5 A;  3CF2 A;  3CES A;  2W82 A;  2ZXH A;  4E4H A;  3VYU B;  3OYF A;  2OV7 A;  3IP4 B;  2LY1 A;  2VXD A;  3BCA A;  3D5S C;  2VQH A;  3OIQ A;  2VQL A;  3FHN A;  2VJ5 A;  5KHD A;  2WAQ A;  3K4B A;  5CQG A;  3AL0 C;  1WFX A;  4PJL A;  3OR1 C;  3K4K A;  2LY2 A;  2A5W A;  1UG0 A;  2V26 A;  2PJR A;  3IAM 2;  3HUG B;  4KT6 A;  4XOP A;  3S32 A;  1DP3 A;  3DEE A;  4CZC A;  2M7A A;  4IKF A;  2Y0S A;  3OYI A;  2VJJ A;  4FAS D;  4Y4R A;  3LSM A;  3OYC A;  3EPZ A;  4EAT A;  1X1A A;  4DJA A;  4F52 A;  4BL0 B;  2V4J C;  2VJ4 A;  1TT0 A;  2IS2 A;  3BG6 A;  2RRE A;  2K9M A;  4P1W A;  4CCM A;  2BW3 A;  3LSI A;  2CW8 A;  4YRV A;  1K6Y A;  2M7B A;  4CSW A;  2KZV A;  2M4G A;  3BC8 A;  2QKM B;  1X4P A;  3OYJ A;  2XC7 A;  3AKZ A;  2WB1 A;  3PJR A;  1WJ5 A;  2AQE A;  4QPO A;  4XKB A;  2X6W A;  1D1C A;  3PNY A;  4RM3 A;  1HA8 A;  4BJ6 C;  4D9J A;  4J00 A;  2KL4 A;  3AL0 B;  2L9N A;  4F92 B;  2Z1D A;  4HNU A;  4RMN A;  3H5N A;  2LH9 A;  3W2W A;  1X1C A;  1D0X A;  3DPU A;  4XKV A;  1X1B A;  2MFZ A;  1MMA A;  3CJR B;  3HXL A;  3M8J A;  1FMW A;  3DKY A;  2L2O A;  1MMD A;  2HQA A;  4U7B A;  2VJI A;  2WY7 Q;  1LFP A;  4XLF A;  4BQN A;  2K9L A;  2LC2 A;  3S3M A;  4BJ5 C;  2I8D A;  4YEL A;  3J7A Y;  3G2B A;  1Z3Y A;  2Z2S B;  3S3O A;  4OAZ A;  3SEZ A;  2L7K A;  4RLQ A;  2VLA A;  1MND A;  4XQF A;  2JVH A;  3CZ6 A;  4E7H A;  3ZCO A;  1D1A A;  4AU7 A;  4CCJ A;  2HU9 A;  3I3L A;  3I9V 2;  3RQ4 A;  3S3N A;  3C2G A;  2X51 A;  2R7Q A;  4II2 A;  3V42 A;  4X0G A;  3OYG A;  3L2U A;  4BJT A;  2IGM A;  2VIX A;  3K4N A;  1Z7L A;  2BOL A;  2O5R A;  3H0D A;  1UAA A;  3ZQQ A;  2JA2 A;  5FRM A;  2CS3 A;  2X85 A;  2RNG A;  2IGO A;  4E7S A;  4ANJ A;  1LDK B;  4NQW B;  2V7F A;  4G6T B;  4BDY A;  2UWM A;  1MMN A;  1V5G A;  3K4J A;  3SEQ A;  2M0M A;  4XLA A;  2LRD A;  1UEL B;  1BR2 A;  3DLA A;  2W7N A;  4BAC A;  4E7L A;  5TGT A;  3M1C A;  4XMY A;  4PJM A;  1LKX A;  2M4K A;  3OYH A;  1R6R A;  1J09 A;  2CUJ A;  4HST A;  2R7W A;  3OS0 A;  2NOJ B;  2W4S A;  3K4C A;  3LMM A;  1BR1 A;  3NWS A;  4GRI A;  3RTR A;  3BG7 A;  2JVG A;  4H4K C;  5LFA A;  4HRI A;  4PFO A;  3SDB A;  3VSK A;  1Z3X A;  4BS9 A;  5KCM A;  4XKC A;  1KON A;  4II3 A;  2KLO A;  4DGW B;  1N78 A;  2KP6 A;  4HSR A;  4Y3O A;  4XON A;  4ZDP A;  4XR6 A;  3LSH A;  2VAS A;  2Z16 A;  2VQC A;  2VXZ A;  2IXS A;  3KX2 A;  3HC7 A;  4LIU A;  4E7Z A;  3AFH A;  4ZTJ A;  4BE0 A;  2F6C A;  3A2K A;  4XL9 A;  4QPQ A;  4NC8 A;  4B3X A;  2LYC A;  3HKZ A;  2HDW A;  5HLT A;  3UR3 C;  1JI8 A;  2ZXI A;  3H5A A;  3K4M A;  3FBN B;  3VYT B;  1DQU A;  4XOR A;  3S93 A;  1QHH D;  2GOM A;  4PK4 A;  4HNT A;  2HPM A;  2XF7 A;  4OAY A;  3VYR B;  1D0Z A;  3ZGK A;  3PSI A;  1LVK A;  1SFK A;  4N4O B;  2Q1Z B;  4BEH B;  2WAD A;  2V6E A;  5FRN A;  4XOT A;  2KPM A;  2KQR A;  3DTI A;  3KYL A;  2BVL A;  1DGW Y;  2JUG A;  3BCB A;  2XDV A;  2XSJ C;  3ZXS A;  1N75 A;  5LD2 C;  2WA0 A;  1G59 A;  3OS1 A;  2R7U A;  4OWR B;  2VKD A;  4CCO A;  4C2T A;  1E0E A;  1Z21 A;  1V5F A;  2R7O A;  4P5O A;  1G8X A;  3A1Y A;  4J01 A;  1U0J A;  2CV1 A;  3SYT A;  2XF5 A;  3L2R A;  2IS4 A;  2IS1 A;  2HPI A;  1DGR M;  4CUG A;  1N77 A;  3DTE A;  2VQG A;  2X1E A;  4XLH A;  3MKY B;  3OYB A;  2PJR B;  3E1S A;  3QYE A;  3OY9 A;  3OIP A;  5HVQ C;  4BQO A;  2IGK A;  4ZJZ A;  1WJD A;  4CA0 A;  3IUO A;  1X1D A;  2LBF A;  1QHG A;  3MMY B;  1EA3 A;  1T95 A;  3PSF A;  4E6K G;  2CUZ A;  1WJF A;  4MLO A;  3W2A A;  1YE9 A;  1X4O A;  3MD2 A;  2UUZ A;  2W1O A;  3LL7 A;  2HVR A;  1D0Y A;  3CMM A;  3EUA A;  3L2W A;  1ERD A;  5KNL A;  3HOS A;  3OMY A;  3OYD A;  3HPH A;  4XNF A;  4B44 A;  4XN3 A;  3E0J B;  2ZSH B;  3PNV A;  5JHF A;  1WJB A;  3DQV C;  3SZG A;  1FMV A;  4BUP A;  2KHM A;  2R4G A;  1Y6I A;  1GLN A;  3PUB A;  1NG6 A;  3DKX A;  4NUB A;  4R79 A;  2ZSI B;  1T0F C;  2R7V A;  3QOD A;  2P0W A;  3QYB A;  4E7I A;  1OLT A;  2XAU A;  4RM2 A;  3OYA A;  4XLE A;  3H35 A;  2LG4 A;  4HG2 A;  2X6X A;  4ZTF A;  2FUG 2;  3C2H A;  3ZR8 X;  2HVQ A;  2ZFU A;  4ZYA A;  3VDX A;  1IRX A;  2BVM A;  2K5C A;  2ELJ A;  4KIT B;  4B43 A;  2JSP A;  3OL4 A;  3KEY A;  2QKL B;  2KRH A;  3GBG A;  4F93 B;  2F4I A;  3HG9 A;  1S9H A;  4DBQ A;  1AA7 A;  3W2V A;  3BLY A;  5HOO A;  4E7J A;  4ZC3 A;  2MYS A;  2A6T A;  1YX3 A;  1PYV A;  2E1M C;  2F5V A;  2UV1 A;  3DWL E;  2CFO A;  5HNH A;  2MD0 A;  2LRE A;  2DCE A;  3DTK A;  3L2Q A;  4C2U A;  1QU3 A;  4B47 A;  3HL2 A;  4XM3 A;  4IQ4 A;  5CPR B;  2CV0 A;  4BEH A;  3PL8 A;  1Y56 A;  3MKW B;  2W00 A;  1X19 A;  3TMO A;  1NG7 A;  2E5N A;  4ITV A;  3ZRG A;  3OOU A;  4D1Q A;  1ZEL A;  2CV2 A;  3K6G A;  3QYF A;  2RQQ A;  3D5R C;  3FKJ A;  4RLF A;  4IZZ A;  3L2V A;  4XN0 A;  4IQJ A;  4DBR A;  3HOT A;  3H9J A;  3DU5 A;  4C30 A;  4U87 A;  3K4L A;  4AYB A;  4CCK A;  4CCL A;  3LFU A;  2X1C A;  3EUK L;  4BE2 A;  3LSG A;  2E1M B;  2VB6 A;  3OYL A;  1PJR A;  2HVS A;  3OS2 A;  1WJC A;  5CQE A;  3IAS 2;  2CMP A;  3K70 C;  5CKT A;  4CH7 A;  3OYK A;  5FRO A;  3F9K A;  1W36 C;  3ONQ A;  2CH0 A;  3PFY A;  2R7S A;  4BGD A;  3VWB A;  3LSK A;  1SAU A;  3CJQ B;  3H9G A;  3OR2 C;  4N4N B;  3TBI A;  3OYE A;  3DU6 A;  4BXF A;  4XLC A;  2HZD A;  2E5Z A;  4JQF A;  2OC6 A;  2MC4 A;  4LG3 A;  4PJN A;  3VSL A;  1P9Q C;  2V9K A;  4HPQ A;  2DXI A;  3A4C A;  3FDY A;  2BW3 B;  3D5L A;  4ZDL A;  4BQQ A;  1OR7 C;  2KMU A;  2KRC A;  4PUS A;  2X1D A;  3W3C A;  3U21 A;  3H9Q A;  2HNH A;  2WY8 Q;  2R7X A;  3OYM A;  3CP8 A;  2X6Y A;  2E60 A;  4IX7 A;  2LOO A;  2IS6 A;  3NWT A;  3CP2 A;  2R7R A;  2WBM A;  4LIT A;  1WJE A;  1BR4 A;  4E7K A;  2OUM A;  2KDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...