2A5WA

Crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (dsrc) from archaeoglobus fulgidus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
114
Chain Sequence
PELEVKGKKLRLDEDGFLQDWEEWDEEVAEALAKDTRFSPQPIELTEEHWKIIRYLRDYFIKYGVAPPVRMLVKHCKKEVRPDCNLQYIYKLFPQGPAKDACRIAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords sulfite reductase, desulfoviridin-type subunit gamma (dsvC)
publication title X-ray structure of the gamma-subunit of a dissimilatory sulfite reductase: Fixed and flexible C-terminal arms.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 36
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2a5wA02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 2a5wA01
3OR1C 1SAUA 1JI8A 3OR2C 2XSJC 2A5WA 1YX3A 2V4JC
chains in the Genus database with same CATH superfamily
4HW0A 4MNUA 2HI3A 3TQNA 2NYXA 4E7SA 4QWQA 2O3FA 2YR2A 3GTJJ 4G7OF 1IUFA 1VZ0A 4Y15A 5ILUA 3GZ6A 1U8RA 5J4YA 1X19A 5EGOA 4Y52J 3LSRA 4P9FA 2CUFA 2QLZA 4XLAA 3SZTA 1EH8A 3ESWB 2XSDC 3FX3A 3GF2A 2WY8Q 1HCRA 1IW7F 1WI9A 2E34A 1GXPA 2VE9A 3KLNA 2IGOA 3FM3A 2ZNYA 1A6IA 3KEQA 3WTYC 1DPRA 3LSJA 2BXYA 3DKXA 5M5XJ 1K4SA 2EIJH 1CF7A 4MTEA 1IN4A 3J80K 4LLGF 2L02A 1D3YA 2VC0A 1IXSB 3H3VK 5EZGA 5B66C 3Q9VA 5BQTA 3N05A 1S29A 1DUXC 4DGWB 1STZA 4QPOA 3L7WA 5L3EA 2QENA 2ZSHB 5ICGA 4BHBA 5ICCA 2L7KA 5ICEA 1VF9A 3HUGA 3KE2A 2ZXHA 3BR5A 4A2UA 1SMYF 2R7WA 1U8BA 1MKMA 4A12A 3BZ6A 1TT0A 2O7OA 3KFWX 1Z91A 4F52A 5DD8A 2HFHA 2AS5F 2EILH 1FJLA 2HDCA 3FMQA 2L5QA 2VKVA 1HC8A 2Y2ZA 3GBGA 1X1BA 5D4RA 1PUEE 3ZRGA 4HRIA 1TQMA 5EF6A 4DOZA 2VPRA 3GTLJ 3RZDJ 1FOKA 5LFAA 3S1NJ 4AM3A 3I4MJ 2Z16A 3KP3A 2KIUA 3KZZA 2V9KA 3I56I 3HGYA 1X2MA 2R92J 1JUMA 2CO5A 2QF7A 2P81A 3M1CA 3H0DA 1J2XA 1V55H 1IRFA 3CCJI 4ZYDA 3K70C 3FIWA 3LA7A 1IO2A 1B1BA 4IJAA 1LVAA 3FXUA 1LEAA 3U1KA 1R6RA 4A0YA 5FB2A 4BAYA 3ERMA 3CCQI 1ZGAA 2QQ8A 3HYIA 1KQ9A 5FKOA 5HDNA 2FUG2 1ZG3A 4CO8A 3H3ZA 3OOUA 2IA1A 3OIPA 1X4PA 4M3FA 4NC8A 2P6SA 3A4CA 1X4OA 3KEOA 1UG0A 4RAGA 3L09A 2O9LA 5KHDA 2M9HA 3A0BC 2QKLB 3DTEA 2VBXA 1CGPA 2MD5A 5LGUA 3HOTA 5E18F 3CMEI 5DD4A 1T2KA 1ON2A 1JKOC 3GTGJ 3SEZA 2K02A 3S2HJ 1TT5B 1ZLJA 1IRXA 1FIPA 4CDGA 4J19A 1K79A 4BXXJ 2W00A 5J1UA 4KA4A 1YW9A 2GBYA 3AG2H 4BEHA 1MGTA 3QPHA 4KIGA 4ESJA 2PBIA 2X6OA 1T08B 2NS0A 2EV5A 1GLNA 1K6YA 2JA7J 3AL0B 5E79C 4D7MA 5DEQA 1XCVA 2R7DA 3G1LA 1R5HA 2MC3A 2A07F 4MEYF 1JHHA 3B6AA 2ECBA 3EPZA 5HLGA 1TQPA 2K4BA 5BOXA 1U3EM 2OTJI 5KK1A 3FKIJ 5E1WA 2IT0A 3U21A 1W0TA 3BTLA 3G3ZA 2FF4A 3BG5A 3U2RA 5IP6A 4ZYEA 1FBSA 2WAEA 2X1CA 1SEUA 3TO6A 1WHUA 3BR0A 1Q1HA 2FU4A 3LQRA 1EF4A 3FKJA 3HKZA 2AO9A 3S16J 2YX7A 3QYEA 5HNHA 5AIPA 4BE2A 3WU2C 3NRVA 3UNGC 3CDLA 2V7FA 5LBQA 2P4WA 3WTSC 4Y7NJ 4BE0A 3CQZJ 2MC4A 2F6CA 2DA4A 4D5CA 1R1UA 3PO2J 3OS2A 2IJLA 1F1ZA 2IGNA 2EPFA 2K7LA 3QQAA 2E36A 3K1NA 3O2PE 2KQRA 1QHHD 2GXAA 2FX0A 2EA2A 2QQ9A 4B8XA 2NOJB 3F21A 2IGKA 1IUYA 1F5TA 3S17J 4PJMA 1ZAOA 4F92B 2HQNA 3Q0UA 2R7OA 1YJNI 1BW5A 1Z21A 1EH6A 3ABMH 4HQMA 4I2OA 5IY5H 3HKZN 2WADA 2XGCA 2CUEA 3W2VA 4P55A 1ZK8A 1H9GA 5CPRB 1IAWA 1RI7A 2CQKA 1B8IA 1TW2A 4BXUA 1MH3A 2EK5A 4RBOA 2H6BA 4U0VA 4IEJA 4IO9F 1UB9A 3DEWA 3IAM2 2RREA 4RLFA 3SZGA 1MW7A 1DU0A 2ADUA 4AC0A 2XF7A 3ZN0A 1FYLA 4HDVA 3G1MA 3RKWA 3IKTA 1KONA 4HF1A 2QYOA 5IT9Z 2BVMA 2A6HF 3OV8A 5J8CA 4RGUA 4GYIA 5ED4A 2HPIA 1VQNI 2DO7A 2P5KA 4R79A 1FBUA 4U0YA 1YFHA 3QWLA 4HLXA 1SFOJ 2EQRA 1OCPA 1HKSA 4P1WA 2YU3A 2YUSA 3HGGA 3IWZA 1G4DA 5BPDA 3GFLA 2IS6A 4GGGA 4A3MJ 1O4XA 3HOWJ 5DYMA 1P4AA 1PYVA 3ASNH 2QVOA 2FQ3A 4NB5A 3TP3A 4M3BA 1DP7P 2O6GE 1TTYA 5A2QZ 2AQEA 1VQPI 2ISZA 4AIHA 4NQWA 1FP2A 2EH3A 5B1BH 4Y4RA 1R4NB 4E4HA 1KU3A 3T5XA 2V1XA 4ENMA 4AD9A 3MVPA 2IEKA 2LKPA 2XSJC 2LBFB 3AL0C 2K9QA 4BQQA 5GADJ 1Z0XA 2BE5F 3GZ5A 2BYVE 4A6DA 4QTRA 2K86A 4M3EA 1S72I 2KPMA 2HOSA 5ERIA 2GXGA 5E8GA 1Y56A 2LSOA 3QP5A 3QOEA 2RDPA 3BZCA 3LL7A 4ZH4F 1ONVA 2HQAA 2E1NA 2VASA 4M9ZA 3SQNA 4QLCU 5BPIA 2JVGA 5HDKA 4C3IJ 3CUOA 3GFMA 3VOEA 4LIUA 1TC3C 1YO5C 4XLFA 1WQ2A 4L18B 4B48A 3KETA 1OFCX 4CYCB 1IRZA 2A5YB 5LGTA 1H0MA 3GCMA 5GTIC 2K3PA 2GOMA 3AFHA 2KHMA 3CZ6A 4AYBA 4BACA 2D45A 1IXCA 2LR8A 3H1CA 4HZFA 1PP8F 4EM1A 5JHFA 1OCTC 2GA1A 1YW8A 1HQCA 1HW2A 1W7PB 3GVAA 4PGGA 4UY8I 3P9KA 1E17A 3JTHA 2OD5A 2XPVA 5KVRA 2W4SA 3PFIA 3JRGA 4PGHA 2DJIA 4KT5C 1I1SA 1IN6A 2KIQA 1ZG1A 1I3AA 2EFNA 2ZC2A 4IXAA 3RJPA 3R61A 2ZNZA 4UXNA 1ZR2A 2P5VA 2OTLI 2K9LA 4A5MA 4CH7A 1S7AA 3H5RA 3SFIA 1A36A 3VYUB 3DP7A 5EG0B 2JTVA 5C4XJ 1QU3A 3K6GA 4C3JJ 3QPTA 5LHGA 2DOFA 2HXIA 2LF8A 3HG9A 1AWCA 5EEGA 1QZEA 1OPCA 4AYBN 4E7HA 1U2WA 4ENNA 5FLMJ 2ZJ2A 3KP6A 4F7ZA 3LA2A 1QPMA 3H9GA 3I59A 2DDBA 3BR2A 4PSXA 4BHCA 5JLWA 4XICA 2XIGA 4XLPF 2E2IJ 2XV4S 4A3JJ 1NG6A 3HTSB 2M87A 3DFGA 1SMTA 4P9UA 3CD6I 2X6XA 1E3HA 5DS9A 1ETYA 2R5YA 1PP7U 2CV2A 4OMZA 3KPHA 4O5VA 4G9YA 2NVUB 2JJ7A 2OCCH 4OIQF 1Z7LA 3L2QA 4GXOA 1JGSA 5EEHA 2CU7A 1XG1A 1VQMI 1LFUP 1G3YA 3EYIA 4WXCA 3DEUA 2HVQA 2M5WA 2VXZA 4KDPA 5CQEA 3X2QH 5CKTA 4U0WA 3VWBA 4UVAA 2JMWA 1Z6TA 1A6QA 1GV2A 1Z05A 2P6TA 3GWZA 1QO0D 4OIRF 2DCEA 3UR3C 2F5DA 5C44J 3DLLF 2HPMA 3OL4A 4DYQA 1P92A 3HHHA 1FMWA 5K7HA 5J1RA 3HOUJ 2G9WA 3CCYA 1MBJA 2NS8A 3HJEA 3M8EA 4HF0A 2N8GA 2R0QC 1AHDP 3JRFA 5B1AH 3E3VA 2QM3A 2P5LC 4ESBA 2RQPA 1NK2P 3FXKA 4EGZA 4JOMA 1BOAA 4CCMA 4KISA 3GTPJ 1U9NA 3L1PA 3BJOA 1SAUA 4FX0A 5B5EC 2L9NA 5TISC 2WB1A 1IRGA 4GRIA 3CCUI 1AU7A 1K6OA 3C2HA 2DQRA 2NRAC 1TWCJ 1WKMA 5GAEJ 3MKYB 1Z77A 5FROA 1WH7A 1XC5A 1A5JA 4CHUA 2DFEA 4JYKA 1RKTA 5KCMA 1M1EB 3VSLA 1GVDA 2K3FA 4ABZA 3K70D 2BHZA 2JPCA 4XKWA 2JWTA 1OCOH 3HZJA 2R7FA 4R8HA 1XS9A 2NVQJ 3HOVJ 2X9DA 3IKVA 1XGMA 1K61A 2UXXA 2L3DA 3M8JA 2CJJA 2Q1ZB 2NOGA 3CCRI 4LITA 4LB6B 1W36D 3B73A 2EZIA 2LMDA 1G3SA 2K4JA 3E1SA 2Z9OA 1UHMA 3ECHA 2XGEA 4YELA 3KP4A 3O6BB 2WAFA 1D0XA 2EV0A 3IC7A 2X48A 4YG2F 3J81Z 1TWFJ 5IPAA 4RS8A 2P7CB 2ZBKA 2K5CA 2WB1N 1FC3A 2ZSIB 3GYHX 2DT6A 5LGNA 4S05A 3ZQLA 3OYCA 3C2BA 1WI3A 3S14J 5F04A 3V4GA 1S6LA 1T8IA 4DNCA 5JHUA 1JUSA 2FJ1A 3ASOH 1OYWA 1HOMA 1BR1A 3VFZA 2X4HA 3LWFA 3S3OA 2CQ7A 2LRDA 5FLVA 3IRQA 2CW7A 3E6MA 2VC1A 2ZJRF 3E6CC 1R5GA 1JT6A 1POGA 2MSYA 3H35A 5EJCA 3J7AO 4O3MA 2GZWA 4CZCA 1Z9CA 1PUFA 2F5EA 5D8LB 3TW6A 2DW4A 3GXOA 2DA1A 5FO5A 2KZVA 4M6XA 4LJZF 1JKRC 1MZBA 5FKLA 1F36A 4B3XA 4I6ZA 4RB3C 2B0LA 1X1PA 3D1NI 3GTKJ 4XR6A 3LA3A 5IOZA 2HZTA 3A02A 3BPVA 4X6AJ 2I5UA 4HNUA 3OY9A 1H88C 2LFBA 4HG2A 3PQJA 3DQVC 2DMUA 1H9TA 2DFFA 4UUSA 1IDZA 1T0FA 3CJQB 1IZ1A 3IHUA 3ZMZA 1FEXA 5J3LA 2IXSA 3OYGA 4CICA 5IOYA 3LOCA 1CQTA 4HNTA 1FX7A 4IRIA 3ERED 3M3YJ 4E6KG 3GTMJ 4FX4A 1YS7A 1LPQA 1KU7A 1ZRFA 1IN5A 3T8RA 3DKWA 1WSUA 3F0CA 2L01A 4CCKA 1K78B 2JPBA 2XAGA 1O3QA 3E6BA 2H6CA 2DU9A 4EVIA 5DUIA 4YFNF 1BIBA 4UNOA 5C3EJ 1ZN2A 4Z6YA 4JBAA 2DT5A 1SAXA 4EM2A 2OC6A 2EIKH 2DLLA 1BN5A 3ZQFA 2PX9A 3ZCOA 1U0JA 2WAQA 3OYAA 5ICFA 3O8GA 1YX3A 1TQIA 3K0LA 2R93J 1ZGWA 3VODA 2PMUA 3FF5A 3S1MJ 2BOLA 2QEXI 1NK3P 5AIQA 3F6OA 2VODA 3CF5F 1MDMA 3DPLC 1S7EA 4A3BJ 4DYRA 4D1QA 2MD0A 4A3LJ 5EEAA 1WCMJ 4ETSA 1QGPA 3OYDA 1OQYA 4HBLA 4A3CJ 4RAYA 5FLXZ 1J0RA 4J01A 4AIKA 2CYYA 3I3LA 1XN7A 3MKWB 4I0AA 4K2EA 3KZIC 4Q4ZF 1JTXA 1OYIA 3AKZA 3DLAA 4FE7A 2B7EA 4L5JA 2W82A 4KITB 1ZR4A 1Y39A 5J47A 3HOSA 1Z3XA 3F8NA 4CYCA 2DYSH 5M3FJ 3C1DA 1O3RA 1GVJA 1WPKA 3IP4B 1WJEA 2RN7A 3OYLA 3JREA 1PJRA 5HOOA 1FTZA 2DOAA 3JTGA 5GAHJ 4V2FA 1U5TB 3VB2A 2XHKA 4EQQA 2PEXA 1S8NA 1X1CA 4O6JA 1XTAA 2YU9J 2VE8A 3WTWC 1GDTA 9ANTA 5LHIA 5ILVA 2JSCA 4CYDA 4BGDA 3ABKH 3WTXC 2BBYA 2KDOA 2A69F 2QCOA 4AVZA 5J1YA 3I64A 3SDGA 4XKCA 3DWLE 5EG0A 4LFUA 2XAUA 4BJ6C 1Y6IA 3SDBA 1LDKB 3HSFA 1S7OA 2BZTA 1T98A 2HKOA 4IHYA 1DP3A 2P8TA 3FXJA 3KLOA 4BYYA 5L3FA 2QSHX 2BY0A 3HIFA 1QRYA 2Q0OA 2OCEA 4L9NA 2FQ4A 1BM9A 2V4JC 3FM5A 3FXOA 4XSXF 2CQNA 3Q5FA 3FHZA 4XRSA 2E7WA 4S04A 2H94A 3S32A 1SFEA 4CCNA 4V2GA 2VJIA 3KCCA 2CMPA 2IS1A 3RZOJ 3JRCA 3EUHC 2E5ZA 2FSWA 3Q0WA 2L9SA 2G7UA 3IL2A 1R5ID 1U78A 3VEPA 1R4MB 4LK1F 2HU9A 4WXDA 2M45A 3HPGA 3RQ4A 2WA0A 4KUMA 1ODDA 3AG3H 1ZRDA 1UAAA 1QNTA 2IVMA 3GTQJ 3K1PA 1YIJI 2R7XA 5JVTA 1W5SA 3TP0A 1BW6A 3PNVA 3V8LA 4G94A 4TV7A 5F1JA 4Z2YA 1XX5A 4IPAA 1XCBA 2M7BA 3WTVC 3WU1B 1OCRH 2QGUA 3B02A 4M72A 2L9RA 3ULQB 1R9TJ 4G7HF 2KP6A 3A01B 5JI6A 1B4AA 3H5NA 1B72B 2A3SA 5JLXA 4WCGA 1X3WB 2IS2A 1VI0A 1Z3YA 5C4JJ 4BQAA 2XGDA 3GLXA 4E7ZA 1YTYA 2ZXIA 4BDYA 1JKPC 1KU2A 2Q2EA 3FBIB 4PZJA 4IF4A 2E2HJ 3DBHB 4KMFA 1W36C 3I4NJ 3C7JA 2A61A 2ESNA 1R49A 3ZQHA 2LP0A 4YIFA 3MCZA 2M1BA 5FKNA 3E5QA 5HODA 1TZLA 2R7SA 4AIJA 1TW3A 1HDPA 4HSTA 5EDNA 4M3GA 4KN4X 4MFDA 4DZJA 5LHHA 4E7KA 5E1ZB 2E60A 3G71I 3GMEA 2KL4A 4U88A 4PFPA 3JAMK 3S15J 2ZXWH 3I58A 1JKQC 4XMYA 3ZMDA 2EZKA 4XN3A 5HDGA 2JQ7A 2DA2A 1LKXA 3BR6A 3TKYA 3DU6A 3WTTC 3P5JA 4C30A 2QKMB 2QWWA 4ENJA 1U5TC 2VT3A 4F3QA 4G12A 2DA6A 2Q8KA 3WTUC 3IRRA 4RB1A 1ERDA 1O57A 1MNDA 2OAZA 2VOOA 2HYFA 2IAIA 3PIOF 3QU6A 1LNWA 3GZNB 5IYCJ 3ZMVA 3CCSI 5F0HA 1HBXG 3OIOA 4YFKF 4IRHA 2LREA 1TNSA 3NAUA 4MLOA 3CJTB 2PJPA 1J09A 3BPXA 1TLHB 5IT9K 4UV9A 1OYYA 2AQFA 2F5VA 4ZC3A 4BXFA 1WJDA 3HPHA 1XGNA 1ZHFA 3FMSA 2GA2A 1JE8A 2LC2A 3G4SI 2BW3B 4XBFA 4ESFA 2Y30A 4RB2C 3J80Z 3ROUA 4B3AA 1SVOA 2ZKZA 3EYYA 1ETVA 3OR1C 1J9IA 1UFMA 2FBKA 3KX2A 2DT7B 1KYWA 3U1DA 2L0KA 2FMLA 1JT0A 2WV1A 5JR3A 2LG4A 4PSWA 3BZKA 5A2QK 5CYVA 5AONA 1EKEA 4XM3A 4MQVA 1ZH5A 4OU0A 1W0UA 3RPUD 2ELKA 5L3BA 2KDZA 3OR2C 2FD5A 1ZREA 4RDUA 1XGSA 1MMGA 2COMA 2L7MP 3OYEA 3MKLA 1YI2I 2Y9ZA 2RNGA 2IW5A 1W7PD 1W1WE 4GYGA 2E2JJ 4MIMA 2R7QA 2CQQA 1WJ5A 2K85A 1QZYA 3Q0VA 1B9MA 3EUHA 3LNQA 3JCUC 4BS9A 2CWEA 1V54H 4B44A 3BDDA 3JW4A 3RTRA 3ZMSA 3MN2A 3WG7H 3E0JB 3F9KA 1XMKA 2UZKA 2IA2A 3O3KA 3FXRA 1K78A 5J40A 3HDDA 1WFXA 1OCCH 2P0WA 2DYRH 3R60A 2FXAA 1F43A 3V42A 2X51A 4U7BA 4FETA 4AUXA 4G8XA 2WBMA 2MLKA 4ZYHA 3V8JA 3HXLA 1FTTA 4A0ZA 4HOBA 2XC7A 5B3SH 3IH4A 3ZQIA 1Y0UA 1SD5A 4IL6C 4LLLA 2FRHA 1UCRA 5IT3A 1VQ5I 1E3PA 2FMYA 1N75A 3OOPA 2ZJPF 5K5OA 2PJRB 4BHPA 2VLAA 4DJAA 2R5ZA 4E7JA 1OJLA 4Y3OA 4XLNF 5BMZA 1U6GA 1MBFA 5L3DA 1SD7A 2V1NA 3CJNA 1D0YA 1Z1DA 4EV0A 1MBEA 2VQLA 3DTKA 3RKQA 4DW6A 3G1OA 1FYMA 1X3ZB 2CW0F 5J4VA 3Q9SA 5FD6A 4KFCA 2QBYB 4YIRX 4PFOA 2OU2A 1XMAA 2ETHA 1REPC 4JP0A 3I54A 5D5XB 3OS1A 3CO7C 2O5RA 3OWTA 3PM1A 2TRTA 5CJ9A 3GO5A 3RPQA 3K10A 1U5TA 3MEXA 3DXJF 2X6YA 1EA3A 4RGXA 1HSJA 2YX4A 2LVSA 3V7SA 2XDVA 4BDZA 2RKHA 3KYCB 1VNDA 4IRGA 3OYHA 1AOYA 1GUUA 2ZO4A 1N77A 1AKHB 1D1BA 3RYRA 3GW2A 4WWCA 2EV6A 1VTNC 2XAQA 1VQ8I 1VQ4I 3B6CA 5KAFC 4DYCA 2L54A 5K7FA 2R7UA 3KP7A 3RYPA 5GAGJ 3LAPA 1QVUA 2EFQA 3AG1H 2Z5UA 3BQZA 4UB8C 1RRJA 2QZ8A 2GWRA 2H8RA 4XNFA 4A3EJ 2O03A 5CVIA 2VJ4A 5J8FA 3HSEA 5EZHA 1XSDA 1VQ6I 4PJ0C 2XROA 1P6RA 3I55I 1RIOH 2EFOA 3ZQGA 1FIAA 1XSVA 3HB9A 4HPQA 1WJCA 2KIMA 2NNNA 1XB4A 3F3XA 1FSEA 2KRCA 4IOAF 4FASD 1KGSA 2XB0X 1YLFA 5HNFA 4A3KJ 1D8JA 4IOCF 1YQAA 3DPTA 5CVRA 4RAFA 1L0OC 3JRIA 2HVRA 1R00A 3E97A 4W97A 1YX5A 3OYNA 2GQQA 1EV7A 1KYZA 3DBRB 2E1OA 5LD2C 1FZPB 5IP9J 2KRFA 2OPTA 2E35A 2BGCA 3PUFA 2BY3A 2LD5A 3W6KB 2BV6A 5DCMB 2ISYA 1DGWY 2MABA 1UJ8A 2M7AA 3M4OJ 4Y17A 3T8TA 2IA0A 2OBPA 3TOBA 5LEJA 3V8KA 4A0XA 4OMYA 3L00A 1ULYA 3CMYA 4KJZA 3DTIA 2CH0A 2HGCA 1B72A 2HOTA 1TP4A 4BKXA 2DK5A 5E17F 3KP5A 2FBIA 3JR9A 1Y8QB 4C3HJ 3VSKA 1T38A 2M4KA 4E7LA 2VKEA 2KLOA 2E1CA 5M5WJ 4F93B 3CESA 2L4AA 3MAJA 3BC8A 3ZOBA 2OZ6A 3PIPF 5TRDA 1V5EA 5K1YA 1NTCA 2DTZA 2W84A 5HLIA 2JRMA 2E5NA 4P5OA 5ILSA 2ID3A 4M6VA 1MBKA 2JN6A 5BS6A 2V79A 3FXQA 1WWXA 1N78A 2V26A 3OL3A 3R4KA 2VN2A 1Z6RA 3W3CA 1I6XA 1QZZA 4KN7X 3NWSA 4B4CA 1HW5A 1ZRCA 2M4GA 2IP2A 3JSPA 2LY9A 1WJFA 2VPLA 2GAUA 4V19K 4FE4A 3FBNB 3ZXSA 1JJ6C 2WC2A 1YJWI 4EJTA 3SJMA 3OIQA 4II2A 5CLSA 3DPUA 2EZLA 1MD0A 3G73A 2Y75A 3F8CA 4I02A 1XDSA 3CO6C 2XGXA 3PNYA 4HQEA 2HYJA 2DMTA 2X1EA 4LB5A 4ANJA 2KJCA 2G7HA 2W25A 3FDYA 4IX7A 1YITI 1FOWA 3SFZA 2DA5A 4D7NA 3QU3A 5BNGA 1ITYA 3L2UA 2ESHA 3ZQQA 5D5WB 3M8FA 1YOVB 3WU0A 2ACJA 2BW3A 3D5RC 2QA4I 2LDUA 2WWYA 2IRFG 1G59A 4A3GJ 4JX5A 3BJAA 3R6SA 3CP8A 3R0AA 1H89C 3ZR8X 4ZDOA 2UXNA 5HS7A 3WGIA 4RAZA 4PJLA 3QPLA 2DK8A 4M9XA 4I98B 2HQRA 3K4KA 4FISA 3RCOA 2Y48A 4XL9A 2HS5A 4MEXF 4XK4A 2KJBA 2ME0A 4EJUA 4IHSA 4IHWA 2V6EA 3WE2A 2OF7A 1YRNB 2D5VA 2TCTA 4UHTA 3W6JB 3JRHA 3HM5A 2A68F 1WZ2A 1IDYA 4OINF 4HV6A 1BJAA 3OSGA 5FLXK 3HOYJ 3K69A 1XSXA 2H09A 2W48A 2G0EA 3CDHA 1DQUA 2EFPA 1R36A 3FXLA 3ZQCA 1BC8C 4FHTA 2XB5A 4OOIA 4CA0A 4E7IA 4BEHB 5F1RA 3I9V2 4NDLA 4I76A 5F0FA 4BJTA 1RPWA 2FE3A 4RMNA 2VONA 2PG4A 2HOEA 4M3DA 2UV1A 2BY2A 3F8MA 4XKBA 4IVNA 3CC2I 1GHCA 3A2KA 4GCVA 1JUPA 3CDIA 1VQ7I 4XONA 1HXDA 1ETXA 4D5FA 2FOWA 1S3JA 2CFXA 4DBRA 2J5PA 2EZHA 2F4MB 3CCLI 1Y8RB 5LRRA 2R4GA 4YRVA 2XPUA 3NWTA 4BUPA 2PJRA 2E19A 3SZPA 3FISA 4CCLA 2TDXA 4MHGA 2STWA 2WTEA 5CQGA 5FD5A 1B9NA 4G7ZF 4DZPA 3TOAA 1VQKI 2F48A 3L2RA 2KMUA 3CCMI 1BI3A 1TWHJ 3KYDB 1O7LA 3K2ZA 3SXYA 3KYLA 1BI1A 2FEZA 3L2VA 2STTA 3TO9A 4QSHA 2MBFA 3LSHA 3K1MA 2ZMEB 4XRSG 1IJWC 4I09A 1G2HA 2A6EF 3WODF 5FKKA 2Y9YA 2PI0A 4DBQA 1T95A 4HLYA 1SC7A 2JUCA 1RNLA 4HV5A 5LLQA 3ISPA 3JRDA 1I6HJ 5TJJA 3MFKA 3R0JA 2M3AA 4F91B 3LSGA 4B1RA 2VQGA 1YHQI 4LK0F 4OAYA 2NVYJ 4AIDA 3OSFA 1BL0A 2QQAA 2DJNA 3FXMA 1RUNA 3VYRB 4XLEA 2VT2A 4L5EA 2LBFA 2R7RA 2KZGA 1B8IB 1V5GA 1GXQA 3CUQB 2JZYA 3S1RJ 1AKHA 3C2GA 3DKYA 1MMAA 3NEUA 3ABUA 1XD7A 2LYCA 1OR7C 3VPRA 2MH2A 4WK8F 3TGNA 3OYJA 5F08A 3LFKA 3RPUA 2MFZA 1IG7A 1MIJA 4KIBA 2OUMA 2DTRA 2A05A 3HOZJ 3G2BA 5E20A 5CVUA 5D8KB 3PSFA 4XOPA 4ENKA 1BA5A 1ZYRF 4UV8A 3BLYA 5D6FA 1ACIA 1KA8A 2DA3A 1W7PA 5F64A 2JRTA 4BBSJ 4AVPA 4Q47A 1RZ4A 2WV0A 3OYMA 1T39A 1LQ1A 2CS3A 4I0BA 2MH9A 3TO7A 3S3NA 2CV0A 2HKXA 3I71A 1ZLKA 4CGZA 3W2AA 1FPQA 2PMHA 2DMQA 3ML6A 5DUKA 2PMZA 3PFYA 3TEDA 3M07A 1X1DA 3E6DA 4PJJA 3DF8A 3K4MA 4ZDLA 1LFPA 4U7DA 1LJ9A 1OLTA 3LQQA 5H6QA 3IH3A 4KMUX 4A6EA 5F0CA 2L4MA 4NNJA 2K9MA 2VL8A 5F6FA 4XLCA 4ZYAA 1R23A 4A5NA 3BWGA 1IC8A 2VBYA 2CFOA 4IQ4A 3BCBA 5IYBJ 3S3MA 1E3OC 2RNJA 5DM7F 2ZFUA 1DPUA 4YIIA 4L9VA 2A5WA 1R58A 4ZDPA 4AWXB 2DMPA 3H36A 4EMSA 1XDUA 2DBBA 4FCYA 1MJBA 3RKXA 2OQRA 3RDIA 1HKQA 4BY1J 3G6EI 2O8KA 2V9PA 3BG3A 4B43A 1XPXA 2V1DA 3IUOA 3IWFA 4XIDA 4FTHA 5GTHC 2PMZN 4UUVA 2LF7A 1I5ZA 2M30A 2MLGA 1CF7B 1R7JA 3BOQA 1MSFC 3LSKA 4YFXF 1P4XA 3NARA 3HHGA 1B59A 3F6VA 1SVMA 1V4RA 2XUBA 5DV5A 2DN0A 2L2OA 2VKDA 2ME6A 4MTDA 2QUFA 1APLC 3CCEI 3HRUA 4LG0B 4M74A 4MO7A 2YS9A 1LFBA 1RC9A 3BCAA 2ZMEC 3CMMA 3FMRA 3MKZA 3MQ0A 4MQ9F 3IAS2 1B6AA 1H8AC 1I27A 2NVXJ 3RKYA 3ELKA 3K4BA 4L9TA 3S1QJ 2JT1A 1XGOA 5GPAA 3S93A 1IF1A 2M8GX 3J7ZI 1U9OA 2H1KA 1W4MA 2R7TA 3T0YA 4F55A 1J7KA 3RQIA 5JFRA 1MSEC 4BNCA 2FBHA 4XRFA 1USTA 1WGXA 4BE1A 1G3TA 2JVHA 2WY7Q 3T1BA 4HDUA 3EDPA 1L3LA 1E2XA 2CV1A 3H5AA 2H8WA 3BJ6A 4RLQA 4HSRA 3REOA 1K83J 3AG4H 1SD4A 1V5FA 3OYIA 3I59B 4X1EA 3CUQC 2M0MA 3CMAI 2HXOA 2MG4A 3CC4I 2XAFA 1RR7A 2IPQX 1KU9A 2W57A 5DM6F 3H9JA 3DU5A 4A69C 4PUSA 2R5YB 2QSGX 4RA2A 2HYGD 2R3SA 1QQIA 4CSWA 2RC4A 1UG2A 1Z67A 3S2WA 2NXNB 1OR7A 1J59A 5D6EA 1YYVA 1LB2A 3GLLA 2HDDA 1F9NA 1AA7A 4EEFG 2HOAA 3KZYA 3UKGA 2B9SA 6PAXA 2LTPA 3BTJA 4UB6C 4I99C 4BY7J 1ETOA 1P2FA 1RKWA 2Y31A 1A04A 5TGTA 3I0TA 2YSRA 2RV8A 2YPRA 3M7GA 3MZ8A 2CG4A 1LUJB 2M8EA 4KYWA 1YRNA 5HVQC 2VI6A 4XORA 2HQ5A 2IGMA 2HWVA 2K9NA 3F8FA 3CF2A 3BR3A 4M71A 1FOYA 2D1VA 1SD6A 3CTAA 5CVJA 1G6NA 2DQLA 3V7RA 3TBIA 2W7NA 1XMXA 1DDNA 4ZTJA 2NNYA 4A3FJ 3PL8A 3P7NA 4RM2A 3L2WA 3PUBA 2R7VA 3TW7A 1UHSA 4A3IJ 3HL2A 2EBIA 2DAOA 2CRGA 2VBZA 1LEBA 4ON0A 1IXRC 5KAIC 1VQOI 1DU6A 4ZJZA 1WVRA 5E3LA 2DFHA 1UELB 2Z33A 4HX7A 4HF2A 2I8DA 3K9TA 4EGYA 3WHCA 2DPUA 2KT0A 3TDZC 1FLIA 1LDDA 5D5VB 2J5OA 3CLOA 3HTUA 3S8PA 1SFKA 2VUMJ 4CUGA 1C0WA 3ECOA 2ZXJA 2I10A 1D0ZA 2HZDA 3BG6A 3GFJA 1QBJA 1RESA 5DCFA 2Z1DA 2D1HA 1KQ0A 2HDWA 1D1CA 2DFIA 3K4CA 3MMYB 3O8HA 3K7AJ 1I1GA 2LKSA 1IN7A 1TWAJ 1KZHA 1Y0NA 4BH9A 2EIMH 2LLKA 4MGRA 3EETA 3KP2A 2OZUA 3ZMTA 3FK7A 2HR3A 4OIPF 5HLHA 3N97A 3H9QA 1O3SA 2DDAA 5L3CA 1OISA 1FP1D 1RETA 2OJED 2ZMEA 3TL4X 2P7VB 2BVLA 1E0EA 4G6DA 2W85A 1JGGA 4KIFA 2ICWG 1SVLA 4I01A 3BROA 2L7ZA 4AU7A 5JVGF 3U9GA 1LE8B 3NQOA 1HF0A 1PUFB 2VJJA 1PDNC 2DMNA 2E1MB 1X2NA 1A31A 4U87A 1WJAA 4Q48A 1R22A 2A6TA 3L9FA 3SYTA 5J6XA 3VYSB 3TMOA 2V1UA 2JA5J 3JAMZ 2W24A 1UZCA 3EUAA 2XASA 3RSNA 1LDJA 2XKOA 5FJ8J 3CUQA 3IH2A 4Y33A 4NC7A 5K5QA 4OWRB 4X0GA 1T6SA 5CVVA 1V3FA 3WTZA 1QA6A 2PLYA 2E7XA 1MH4A 4ASNA 1NH3A 4UUSB 2RQQA 1X1AA 4Y13A 2LK2A 4XLHA 3LFUA 2GIZA 3BQYA 4QPQA 1HDDC 4C2TA 2IBDA 2MYSA 3ZN1A 2AHQA 2JA2A 3OMYA 2Z2SB 1FMVA 4RB0A 4GO1A 2HEOA 2O0YA 4PK4A 4HYEA 1TNTA 4C2MJ 2FA5A 4PCQA 2O61A 2DOEA 3W2WA 2JK3A 3ZGKA 1P4WA 2GM4A 3FK6A 4JX4A 1T56A 4RGRA 1ZARA 4XSZF 2X85A 4ITVA 1S9HA 3VDXA 1D5YA 4XRMA 4WX9A 3OYBA 3JRBA 3W6VA 3SHFA 3D5SC 1D1AA 1OKRA 3Q3SA 2GXBA 3C18A 4ZYGA 2NVTJ 4UVCA 2BXZA 1YE9A 2X1DA 5H2FC 1YIOA 2DODA 2NS7A 1MDMB 4LD5A 4LLNA 4QIWN 2CUZA 3P9CA 2KISA 2ID6A 2DPDA 2ZJQF 5E1XA 1G8XA 2EB7A 1ZELA 4BU2A 3PQKA 2Z99A 3ZMUA 2RGVA 2LY1A 2LOOA 2ELHA 4MFEA 1SFUA 3RIRA 3D5LA 3EQLF 4II3A 4N9HA 1J5YA 4HX4A 4J00A 2VXDA 4G6QA 2JSPA 3J7YJ 1Y1WJ 1USSA 5HS8A 2CGPA 2BHYA 1JI8A 2IS4A 5GPCA 4NC6A 5FRNA 1YW7A 2JA6J 3M1EA 5HLTA 4L0ZB 4ZZLA 2W1OA 3ABLH 4Q5SF 4IQJA 1JHFA 5D5UB 3V7CA 4HAMA 4NBQA 2VIXA 3A03A 4LG0A 4S0HB 1IGNA 1FBQA 2OV7A 4H0EA 3F8BA 1QHGA 4EM0B 5DDGA 1NG7A 1RUOA 1T33A 2HNHA 4ZZDA 5M5YJ 2VB6A 2XRNA 4EJVA 1ZGJA 2GOXB 1MNMC 5EGOB 3J81K 3ZP5A 1ETKA 5K5RA 3A01A 3QOPA 1BOBA 2B63J 2E1MC 4M73A 3BG7A 3MWMA 1O7FA 2KFDA 1I50J 2LKXA 2V6CA 1P7IA 3BR1A 1X58A 4XQFA 1W5CC 2RVCA 2BEOA 1FY7A 1P9QC 4WF2A 3CLQA 4CCJA 2MGQA 1K4TA 1ZKGA 2ZB9A 4L9JA 2KIFA 4KICA 2ELJA 1DGRM 3GX4X 1IV8A 3J7AY 3H3UA 1D8KA 1ORKA 3I5UA 4C2UA 3HRMA 1T0FC 2Y0MA 3MZHA 1BC7C 3PSIA 3WGHA 5IP7J 1JJ8C 3GTOJ 3D0SA 4FQGA 4P96A 3E7LA 4IHVA 1BIAA 2RAEA 3VYTB 1BBYA 2AXTC 5KNLA 2VKHA 1FYKA 3M9AA 2HTSA 3LSTA 1VFCA 2FOKA 1HLVA 3HUGB 2F5FA 3QYFA 3QPSA 1Z7UA 3HC7A 1G3WA 1P7JA 1GV5A 4CXFA 2HTJA 1BR4A 5H6RA 4L0YB 2C6YA 4JX6A 2XF5A 2ZFWA 1SANA 3N4MA 2DXIA 2OA4A 4EJOA 3DCFA 4BL0B 2GLOA 2JUGA 1UMQA 2ZCWA 4XOTA 3I4PA 2NAZA 2K27A 3JSOA 2V9VA 2LY2A 5EYRA 3ABTA 1NHAA 1R1TA 2FNAA 2CUJA 2VQCA 1KQ8A 4N0BA 2XPWA 2X0LA 2D2WA 3QRFF 2MW8A 1QPIA 2R7ZJ 1MMSA 2Q2EB 1MJAA 2Y69H 3BY6A 3WGGA 2M0CA 3ONQA 5E3MA 2FNPA 3RI4A 1HKTA 1YS6A 1BR2A 2MA3A 3OS0A 1ON1A 3WG9A 3ZQ7A 4BQOA 1TWGJ 1YJ9I 1WRJA 4LGWA 4XKVA 4ZTFA 4DQ2A 3OYFA 4L5IA 1BI2A 1EH7A 1I39A 1MMDA 3HSRA 3MD2A 5H20A 5E8IA 5FFZA 3BTIA 1HA8A 2XVCA 3JRAA 1EJ9A 4C9YA 1YG2A 4B09A 3TDUC 4D0PA 1MBHA 1IN8A 5FGMA 4PJNA 1QVTA 3BG9A 4H4KC 2E71A 2XAHA 3ZPLA 3COAC 4RGSA 5E3NA 2UUZA 5FKMA 4HNVA 1MJ9A 1ZG5A 2XAJA 3LMMA 1GT0C 5GP9A 3WE3A 2KRHA 3CP2A 2VOPA 1BI0A 4UUTA 2VQHA 4NHJA 2XKPA 2QQBA 1W5TA 1O3TA 3SEQA 1Q1VA 2AXLA 4OAZA 3DBLB 3L2CA 4FT8A 4A93J 3MZYA 2XRLA 4LMYA 3AAFA 3GUDA 3CC7I 4N4NB 1LE8A 3KIOA 1S5LC 2Y0SA 5LEKA 1FSHA 4B47A 4GFBA 2COBA 4KNYA 2EA4A 2VJ5A 3HBLA 1N25A 1UHWA 2M2EA 2K9SA 1ZTRA 1JXSA 5DTDA 3HEFA 4A3DJ 1I3QJ 1WH5A 4HX8A 4EATA 4N9IA 3LSIA 5F27A 3GEZA 2ECCA 1Y1VJ 3FWEA 3PNTA 3QYBA 5D4SA 2L7FP 3DEEA 5E3OA 4LG3A 2QBYA 4IKFA 3C3WA 4IZZA 2DA7A 1R71A 2VBWA 3HRSA 1D5VA 1IV6A 4JK1X 4LOCA 4GDFA 3K2AA 2Y0SN 1SFXA 1RR8C 2CW8A 4PDKA 4CZZA 3QP6A 3IV5A 2F4IA 1VQ9I 5K7ZA 3GFIA 2K40A 3LSPA 2H27A 4RM3A 1K7AA 1MMNA 4M6YA 1HSTA 3K4JA 3BTCA 1ETQA 2L9VA 4KT6A 4UVBA 4IHTA 2LH9A 3S2DJ 1MBGA 2KKOA 4N4OB 3K4NA 1PVEA 4HEA2 1A35A 1ENHA 1LVKA 2X6WA 2EINH 3LSMA 1F4KA 3A0HC 2XF6A 3FZVA 2JA8J 3BT9A 3OYKA 3PJRA 4BJ5C 4WXHA 1R1VA 4NUBA 3CJRB 4G6TB 1FNNA 3KEYA 3LAJA 3I53A 3F72A 4YEJA 1VQLI 3BP8A 1X3UA 3HRTA 4EJWA 3DV8A 4W1UA 1J75A 4XN0A 3WHBA 2CQXA 2O8XA 3E5XA 4JQFA 3QAHA 1BJZA 2R5ZB 5LRSA 2EJRA 1WJBA 4D9JA 2PQ8A 2LNBA 1FT9A 1FWZA 3F23A 2CSOA 2F4OB 5FFXA 4HA8A 3P9IA 3HOXJ 1ETWA 3QODA 4CCOA 1JTYA 2BY1A 4BBRJ 1MNEA 3H0GJ 1OCZH 2UWMA 4R1HA 2DI3A 4IHXA 1ZQ3P 2WAQN 3EUKL 4I7HA 5FRMA 2PN6A 1OMIA 2Z3YA 3E5UA 2H1LA 3K4LA 5M3MJ 1TBXA 1HW1A 2M34A 4M9SA 4BQNA 5L3GA 4NQWB 4LIVA 4DIQA 5HS9A 1TL8A 3CCVI 2F2EA 4OIOF 2EWNA 3A1YA 3FHNA 2QSFX 3F22A 3H92A 2EFWA 4E70A 5IYDJ 3PO3J 2GIVA 1FOXA 2HVSA 2F5CA 5DCMA 2OQGA 2PFBA
chains in the Genus database with same CATH topology
1WJCA 2I8DA 4E7SA 2KRCA 1VZ0A 4FASD 1X19A 1BR1A 1SFKA 3S8PA 5HNFA 3DPTA 4CUGA 4XLAA 3S3OA 2LRDA 2HVRA 1D0ZA 2CW7A 2HZDA 3BG6A 1YX5A 3OYNA 2WY8Q 3H35A 4CZCA 2IGOA 2Z1DA 5LD2C 2HDWA 1D1CA 2KZVA 3K4CA 3MMYB 3DKXA 1DGWY 2MABA 4B3XA 2M7AA 3H9QA 4XR6A 4HNUA 3OY9A 4HG2A 3TL4X 2BVLA 3N05A 1E0EA 3DQVC 4DGWB 4KJZA 4QPOA 3DTIA 2CH0A 2ZSHB 3CJQB 4AU7A 2IXSA 2L7KA 3OYGA 3VSKA 2M4KA 2ZXHA 2VJJA 4E7LA 4HNTA 2R7WA 2E1MB 2KLOA 4F93B 3CESA 4U87A 1TT0A 1WJAA 4E6KG 3BC8A 4F52A 1V5EA 2A6TA 3SYTA 3VYSB 3TMOA 4CCKA 2L5QA 3GBGA 1X1BA 4HRIA 3ZRGA 3EUAA 2E5NA 3RSNA 4P5OA 4DOZA 4Y33A 4NC7A 5LFAA 4OWRB 4X0GA 2Z16A 1N78A 2OC6A 2V26A 2V9KA 3OL3A 3W3CA 2RQQA 3M1CA 1X1AA 3H0DA 3NWSA 3ZCOA 1U0JA 4XLHA 2WAQA 3OYAA 3K70C 2M4GA 3LFUA 1YX3A 4QPQA 1WJFA 4C2TA 2MYSA 2VPLA 2JA2A 1R6RA 3OMYA 2Z2SB 3FBNB 3ZXSA 1FMVA 2BOLA 3OIQA 4II2A 3DPLC 3DPUA 4PK4A 2FUG2 3W2WA 4D1QA 2MD0A 3PNYA 3ZGKA 2X1EA 3OOUA 3OIPA 4ANJA 1X4PA 3OYDA 4NC8A 3A4CA 1X4OA 4J01A 1UG0A 2X85A 3I3LA 3MKWB 3FDYA 4IX7A 4ITVA 3AKZA 1S9HA 3VDXA 3DLAA 3OYBA 5KHDA 3DTEA 3D5SC 2QKLB 1D1AA 3ZQQA 3L2UA 2W82A 4KITB 3HOSA 2BW3A 3D5RC 1YE9A 1Z3XA 2X1DA 3HOTA 1G59A 3CP8A 3SEZA 3ZR8X 3IP4B 1WJEA 3OYLA 4ZDOA 1IRXA 1PJRA 5HOOA 4PJLA 2DOAA 2W00A 3K4KA 3RCOA 2CUZA 4XL9A 4BEHA 1X1CA 2V6EA 1K6YA 1GLNA 4BGDA 3AL0B 1G8XA 1ZELA 4BU2A 2KDOA 3EPZA 2LY1A 2LOOA 4AVZA 3D5LA 4II3A 3U21A 4J00A 4XKCA 2VXDA 3DWLE 2JSPA 2XAUA 4BJ6C 1JI8A 1DQUA 2IS4A 5FRNA 1Y6IA 2WAEA 3SDBA 1LDKB 2X1CA 5HLTA 2W1OA 3FKJA 3HKZA 4CA0A 1DP3A 4IQJA 4E7IA 4BEHB 3I9V2 3QYEA 2VIXA 4BJTA 5HNHA 2V4JC 2OV7A 4RMNA 4BE2A 1QHGA 2UV1A 1NG7A 3UNGC 2V7FA 3S32A 4XKBA 4CCNA 2HNHA 3A2KA 2VB6A 4BE0A 2VJIA 2GOXB 2CMPA 2IS1A 2MC4A 2F6CA 4XONA 3EUHC 2E5ZA 4DBRA 3OS2A 1BOBA 2L9SA 2E1MC 2IGNA 3BG7A 2KQRA 1QHHD 2HU9A 4YRVA 2R4GA 3HPGA 2NOJB 3RQ4A 2IGKA 2WA0A 4XQFA 3NWTA 1UAAA 4PJMA 4F92B 4BUPA 2PJRA 1P9QC 4CCLA 2R7OA 5CQGA 2R7XA 4CCJA 1Z21A 3PNVA 2WADA 3L2RA 2KMUA 2ELJA 1DGRM 3W2VA 3J7AY 2M7BA 5CPRB 3KYLA 3L2VA 4C2UA 3LSHA 1T0FC 3PSIA 2KP6A 3H5NA 3IAM2 3VYTB 2RREA 4RLFA 2VKHA 3SZGA 5KNLA 4DBQA 1MW7A 1T95A 2IS2A 1Z3YA 2XF7A 3HUGB 3QYFA 4E7ZA 2ZXIA 3HC7A 4BDYA 2M3AA 4F91B 3LSGA 2VQGA 1KONA 1BR4A 2BVMA 3FBIB 4OAYA 1W36C 2HPIA 2XF5A 3VYRB 4XLEA 4R79A 2DXIA 2LBFA 2R7RA 4BL0B 2JUGA 1V5GA 1TZLA 4XOTA 2R7SA 4P1WA 4HSTA 2LY2A 3C2GA 3DKYA 1MMAA 4E7KA 2E60A 2LYCA 1OR7C 2IS6A 2KL4A 4PFPA 2CUJA 2VQCA 4XMYA 3OYJA 1PYVA 4XN3A 1LKXA 2AQEA 2MFZA 3DU6A 4C30A 2QKMB 2Q2EB 4F3QA 2OUMA 4Y4RA 3G2BA 3PSFA 4XOPA 4E4HA 1ERDA 3ONQA 1MNDA 3BLYA 2XSJC 2LBFB 1BR2A 3AL0C 4BQQA 3OS0A 4BQOA 2LREA 4MLOA 2KPMA 4XKVA 1J09A 3OYMA 1Y56A 3QOEA 4ZTFA 2CS3A 3OYFA 2AQFA 3LL7A 3S3NA 2F5VA 4ZC3A 2CV0A 2HQAA 2VASA 3MD2A 1MMDA 2JVGA 1WJDA 4BXFA 3W2AA 3HPHA 2LC2A 4LIUA 2PMZA 1HA8A 3PFYA 4XLFA 2BW3B 4C9YA 1X1DA 4B48A 4PJJA 3K4MA 4ZDLA 1LFPA 4PJNA 4H4KC 1OLTA 2K3PA 2GOMA 3AFHA 2KHMA 3CZ6A 3OR1C 4AYBA 4BACA 4NNJA 2K9MA 3KX2A 2DT7B 2VL8A 5JHFA 2UUZA 4ZYAA 4XLCA 2LG4A 2CFOA 4PSWA 3LMMA 4IQ4A 3BCBA 3S3MA 2KRHA 4XM3A 3CP2A 2ZFUA 3RPUD 2W4SA 3OR2C 2VQHA 2DJIA 3SEQA 2A5WA 4ZDPA 1MMGA 4OAZA 3OYEA 2K9LA 4CH7A 2RNGA 4B43A 4N4NB 3H5RA 2R7QA 3IUOA 1WJ5A 2Y0SA 3VYUB 1QU3A 4BS9A 3LSKA 3K6GA 4B47A 4B44A 3RTRA 3HG9A 3E0JB 3F9KA 2VJ5A 4E7HA 2VKDA 2L2OA 1WFXA 3H9GA 3BCAA 4PSXA 2P0WA 3CMMA 4EATA 3MKZA 3V42A 1NG6A 2X51A 3IAS2 3LSIA 4U7BA 4FETA 2WBMA 2X6XA 3K4BA 3HXLA 2CV2A 3PNTA 3QYBA 3S93A 2XC7A 3DEEA 4LG3A 4IKFA 1Z7LA 3L2QA 4IZZA 2R7TA 4F55A 2HVQA 2VXZA 1N75A 2CW8A 4BE1A 5CQEA 2F4IA 2JVHA 5CKTA 2WY7Q 2PJRB 3VWBA 2CV1A 2VLAA 3H5AA 4DJAA 4RM3A 4RLQA 1MMNA 4HSRA 1V5FA 3K4JA 3OYIA 4E7JA 4Y3OA 2DCEA 3UR3C 4KT6A 2HPMA 2LH9A 3OL4A 2M0MA 4N4OB 3K4NA 4HEA2 2V1NA 1D0YA 1FMWA 2VQLA 3DTKA 3H9JA 3DU5A 1LVKA 2X6WA 3LSMA 4PUSA 2XF6A 3OYKA 3PJRA 4CSWA 4BJ5C 4NUBA 3CJRB 4G6TB 4PFOA 3KEYA 3OS1A 4YEJA 4JOMA 2O5RA 3OWTA 1AA7A 4CCMA 4KISA 4XN0A 1SAUA 4JQFA 2L9NA 2WB1A 3K10A 1WJBA 4D9JA 2X6YA 4GRIA 1EA3A 3C2HA 5TGTA 3MKYB 2XDVA 4BDZA 5FROA 5HVQC 3OYHA 5KCMA 3QODA 4XORA 4CCOA 3VSLA 2IGMA 1N77A 1D1BA 3K70D 3CF2A 4XKWA 1MNEA 2UWMA 3TBIA 2W7NA 3M8JA 3EUKL 4ZTJA 2Q1ZB 3PL8A 5FRMA 4LITA 2R7UA 4RM2A 3L2WA 1W36D 3PUBA 2R7VA 3K4LA 3HL2A 4BQNA 4NQWB 3E1SA 4YELA 4LIVA 4XNFA 4DIQA 2WAFA 1D0XA 3A1YA 3FHNA 2VJ4A 2K5CA 2ZSIB 2DT6A 3OYCA 2HVSA 4ZJZA 1UELB 4HPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR1 C;  1SAU A;  1JI8 A;  3OR2 C;  2XSJ C;  2A5W A;  1YX3 A;  2V4J C; 
#chains in the Genus database with same CATH topology
 4HW0 A;  4MNU A;  2HI3 A;  3TQN A;  2NYX A;  4E7S A;  4QWQ A;  2O3F A;  2YR2 A;  3GTJ J;  4G7O F;  1IUF A;  1VZ0 A;  4Y15 A;  5ILU A;  3GZ6 A;  1U8R A;  5J4Y A;  1X19 A;  5EGO A;  4Y52 J;  3LSR A;  4P9F A;  2CUF A;  2QLZ A;  4XLA A;  3SZT A;  1EH8 A;  3ESW B;  2XSD C;  3FX3 A;  3GF2 A;  2WY8 Q;  1HCR A;  1IW7 F;  1WI9 A;  2E34 A;  1GXP A;  2VE9 A;  3KLN A;  2IGO A;  3FM3 A;  2ZNY A;  1A6I A;  3KEQ A;  3WTY C;  1DPR A;  3LSJ A;  2BXY A;  3DKX A;  5M5X J;  1K4S A;  2EIJ H;  1CF7 A;  4MTE A;  1IN4 A;  3J80 K;  4LLG F;  2L02 A;  1D3Y A;  2VC0 A;  1IXS B;  3H3V K;  5EZG A;  5B66 C;  3Q9V A;  5BQT A;  3N05 A;  1S29 A;  1DUX C;  4DGW B;  1STZ A;  4QPO A;  3L7W A;  5L3E A;  2QEN A;  2ZSH B;  5ICG A;  4BHB A;  5ICC A;  2L7K A;  5ICE A;  1VF9 A;  3HUG A;  3KE2 A;  2ZXH A;  3BR5 A;  4A2U A;  1SMY F;  2R7W A;  1U8B A;  1MKM A;  4A12 A;  3BZ6 A;  1TT0 A;  2O7O A;  3KFW X;  1Z91 A;  4F52 A;  5DD8 A;  2HFH A;  2AS5 F;  2EIL H;  1FJL A;  2HDC A;  3FMQ A;  2L5Q A;  2VKV A;  1HC8 A;  2Y2Z A;  3GBG A;  1X1B A;  5D4R A;  1PUE E;  3ZRG A;  4HRI A;  1TQM A;  5EF6 A;  4DOZ A;  2VPR A;  3GTL J;  3RZD J;  1FOK A;  5LFA A;  3S1N J;  4AM3 A;  3I4M J;  2Z16 A;  3KP3 A;  2KIU A;  3KZZ A;  2V9K A;  3I56 I;  3HGY A;  1X2M A;  2R92 J;  1JUM A;  2CO5 A;  2QF7 A;  2P81 A;  3M1C A;  3H0D A;  1J2X A;  1V55 H;  1IRF A;  3CCJ I;  4ZYD A;  3K70 C;  3FIW A;  3LA7 A;  1IO2 A;  1B1B A;  4IJA A;  1LVA A;  3FXU A;  1LEA A;  3U1K A;  1R6R A;  4A0Y A;  5FB2 A;  4BAY A;  3ERM A;  3CCQ I;  1ZGA A;  2QQ8 A;  3HYI A;  1KQ9 A;  5FKO A;  5HDN A;  2FUG 2;  1ZG3 A;  4CO8 A;  3H3Z A;  3OOU A;  2IA1 A;  3OIP A;  1X4P A;  4M3F A;  4NC8 A;  2P6S A;  3A4C A;  1X4O A;  3KEO A;  1UG0 A;  4RAG A;  3L09 A;  2O9L A;  5KHD A;  2M9H A;  3A0B C;  2QKL B;  3DTE A;  2VBX A;  1CGP A;  2MD5 A;  5LGU A;  3HOT A;  5E18 F;  3CME I;  5DD4 A;  1T2K A;  1ON2 A;  1JKO C;  3GTG J;  3SEZ A;  2K02 A;  3S2H J;  1TT5 B;  1ZLJ A;  1IRX A;  1FIP A;  4CDG A;  4J19 A;  1K79 A;  4BXX J;  2W00 A;  5J1U A;  4KA4 A;  1YW9 A;  2GBY A;  3AG2 H;  4BEH A;  1MGT A;  3QPH A;  4KIG A;  4ESJ A;  2PBI A;  2X6O A;  1T08 B;  2NS0 A;  2EV5 A;  1GLN A;  1K6Y A;  2JA7 J;  3AL0 B;  5E79 C;  4D7M A;  5DEQ A;  1XCV A;  2R7D A;  3G1L A;  1R5H A;  2MC3 A;  2A07 F;  4MEY F;  1JHH A;  3B6A A;  2ECB A;  3EPZ A;  5HLG A;  1TQP A;  2K4B A;  5BOX A;  1U3E M;  2OTJ I;  5KK1 A;  3FKI J;  5E1W A;  2IT0 A;  3U21 A;  1W0T A;  3BTL A;  3G3Z A;  2FF4 A;  3BG5 A;  3U2R A;  5IP6 A;  4ZYE A;  1FBS A;  2WAE A;  2X1C A;  1SEU A;  3TO6 A;  1WHU A;  3BR0 A;  1Q1H A;  2FU4 A;  3LQR A;  1EF4 A;  3FKJ A;  3HKZ A;  2AO9 A;  3S16 J;  2YX7 A;  3QYE A;  5HNH A;  5AIP A;  4BE2 A;  3WU2 C;  3NRV A;  3UNG C;  3CDL A;  2V7F A;  5LBQ A;  2P4W A;  3WTS C;  4Y7N J;  4BE0 A;  3CQZ J;  2MC4 A;  2F6C A;  2DA4 A;  4D5C A;  1R1U A;  3PO2 J;  3OS2 A;  2IJL A;  1F1Z A;  2IGN A;  2EPF A;  2K7L A;  3QQA A;  2E36 A;  3K1N A;  3O2P E;  2KQR A;  1QHH D;  2GXA A;  2FX0 A;  2EA2 A;  2QQ9 A;  4B8X A;  2NOJ B;  3F21 A;  2IGK A;  1IUY A;  1F5T A;  3S17 J;  4PJM A;  1ZAO A;  4F92 B;  2HQN A;  3Q0U A;  2R7O A;  1YJN I;  1BW5 A;  1Z21 A;  1EH6 A;  3ABM H;  4HQM A;  4I2O A;  5IY5 H;  3HKZ N;  2WAD A;  2XGC A;  2CUE A;  3W2V A;  4P55 A;  1ZK8 A;  1H9G A;  5CPR B;  1IAW A;  1RI7 A;  2CQK A;  1B8I A;  1TW2 A;  4BXU A;  1MH3 A;  2EK5 A;  4RBO A;  2H6B A;  4U0V A;  4IEJ A;  4IO9 F;  1UB9 A;  3DEW A;  3IAM 2;  2RRE A;  4RLF A;  3SZG A;  1MW7 A;  1DU0 A;  2ADU A;  4AC0 A;  2XF7 A;  3ZN0 A;  1FYL A;  4HDV A;  3G1M A;  3RKW A;  3IKT A;  1KON A;  4HF1 A;  2QYO A;  5IT9 Z;  2BVM A;  2A6H F;  3OV8 A;  5J8C A;  4RGU A;  4GYI A;  5ED4 A;  2HPI A;  1VQN I;  2DO7 A;  2P5K A;  4R79 A;  1FBU A;  4U0Y A;  1YFH A;  3QWL A;  4HLX A;  1SFO J;  2EQR A;  1OCP A;  1HKS A;  4P1W A;  2YU3 A;  2YUS A;  3HGG A;  3IWZ A;  1G4D A;  5BPD A;  3GFL A;  2IS6 A;  4GGG A;  4A3M J;  1O4X A;  3HOW J;  5DYM A;  1P4A A;  1PYV A;  3ASN H;  2QVO A;  2FQ3 A;  4NB5 A;  3TP3 A;  4M3B A;  1DP7 P;  2O6G E;  1TTY A;  5A2Q Z;  2AQE A;  1VQP I;  2ISZ A;  4AIH A;  4NQW A;  1FP2 A;  2EH3 A;  5B1B H;  4Y4R A;  1R4N B;  4E4H A;  1KU3 A;  3T5X A;  2V1X A;  4ENM A;  4AD9 A;  3MVP A;  2IEK A;  2LKP A;  2XSJ C;  2LBF B;  3AL0 C;  2K9Q A;  4BQQ A;  5GAD J;  1Z0X A;  2BE5 F;  3GZ5 A;  2BYV E;  4A6D A;  4QTR A;  2K86 A;  4M3E A;  1S72 I;  2KPM A;  2HOS A;  5ERI A;  2GXG A;  5E8G A;  1Y56 A;  2LSO A;  3QP5 A;  3QOE A;  2RDP A;  3BZC A;  3LL7 A;  4ZH4 F;  1ONV A;  2HQA A;  2E1N A;  2VAS A;  4M9Z A;  3SQN A;  4QLC U;  5BPI A;  2JVG A;  5HDK A;  4C3I J;  3CUO A;  3GFM A;  3VOE A;  4LIU A;  1TC3 C;  1YO5 C;  4XLF A;  1WQ2 A;  4L18 B;  4B48 A;  3KET A;  1OFC X;  4CYC B;  1IRZ A;  2A5Y B;  5LGT A;  1H0M A;  3GCM A;  5GTI C;  2K3P A;  2GOM A;  3AFH A;  2KHM A;  3CZ6 A;  4AYB A;  4BAC A;  2D45 A;  1IXC A;  2LR8 A;  3H1C A;  4HZF A;  1PP8 F;  4EM1 A;  5JHF A;  1OCT C;  2GA1 A;  1YW8 A;  1HQC A;  1HW2 A;  1W7P B;  3GVA A;  4PGG A;  4UY8 I;  3P9K A;  1E17 A;  3JTH A;  2OD5 A;  2XPV A;  5KVR A;  2W4S A;  3PFI A;  3JRG A;  4PGH A;  2DJI A;  4KT5 C;  1I1S A;  1IN6 A;  2KIQ A;  1ZG1 A;  1I3A A;  2EFN A;  2ZC2 A;  4IXA A;  3RJP A;  3R61 A;  2ZNZ A;  4UXN A;  1ZR2 A;  2P5V A;  2OTL I;  2K9L A;  4A5M A;  4CH7 A;  1S7A A;  3H5R A;  3SFI A;  1A36 A;  3VYU B;  3DP7 A;  5EG0 B;  2JTV A;  5C4X J;  1QU3 A;  3K6G A;  4C3J J;  3QPT A;  5LHG A;  2DOF A;  2HXI A;  2LF8 A;  3HG9 A;  1AWC A;  5EEG A;  1QZE A;  1OPC A;  4AYB N;  4E7H A;  1U2W A;  4ENN A;  5FLM J;  2ZJ2 A;  3KP6 A;  4F7Z A;  3LA2 A;  1QPM A;  3H9G A;  3I59 A;  2DDB A;  3BR2 A;  4PSX A;  4BHC A;  5JLW A;  4XIC A;  2XIG A;  4XLP F;  2E2I J;  2XV4 S;  4A3J J;  1NG6 A;  3HTS B;  2M87 A;  3DFG A;  1SMT A;  4P9U A;  3CD6 I;  2X6X A;  1E3H A;  5DS9 A;  1ETY A;  2R5Y A;  1PP7 U;  2CV2 A;  4OMZ A;  3KPH A;  4O5V A;  4G9Y A;  2NVU B;  2JJ7 A;  2OCC H;  4OIQ F;  1Z7L A;  3L2Q A;  4GXO A;  1JGS A;  5EEH A;  2CU7 A;  1XG1 A;  1VQM I;  1LFU P;  1G3Y A;  3EYI A;  4WXC A;  3DEU A;  2HVQ A;  2M5W A;  2VXZ A;  4KDP A;  5CQE A;  3X2Q H;  5CKT A;  4U0W A;  3VWB A;  4UVA A;  2JMW A;  1Z6T A;  1A6Q A;  1GV2 A;  1Z05 A;  2P6T A;  3GWZ A;  1QO0 D;  4OIR F;  2DCE A;  3UR3 C;  2F5D A;  5C44 J;  3DLL F;  2HPM A;  3OL4 A;  4DYQ A;  1P92 A;  3HHH A;  1FMW A;  5K7H A;  5J1R A;  3HOU J;  2G9W A;  3CCY A;  1MBJ A;  2NS8 A;  3HJE A;  3M8E A;  4HF0 A;  2N8G A;  2R0Q C;  1AHD P;  3JRF A;  5B1A H;  3E3V A;  2QM3 A;  2P5L C;  4ESB A;  2RQP A;  1NK2 P;  3FXK A;  4EGZ A;  4JOM A;  1BOA A;  4CCM A;  4KIS A;  3GTP J;  1U9N A;  3L1P A;  3BJO A;  1SAU A;  4FX0 A;  5B5E C;  2L9N A;  5TIS C;  2WB1 A;  1IRG A;  4GRI A;  3CCU I;  1AU7 A;  1K6O A;  3C2H A;  2DQR A;  2NRA C;  1TWC J;  1WKM A;  5GAE J;  3MKY B;  1Z77 A;  5FRO A;  1WH7 A;  1XC5 A;  1A5J A;  4CHU A;  2DFE A;  4JYK A;  1RKT A;  5KCM A;  1M1E B;  3VSL A;  1GVD A;  2K3F A;  4ABZ A;  3K70 D;  2BHZ A;  2JPC A;  4XKW A;  2JWT A;  1OCO H;  3HZJ A;  2R7F A;  4R8H A;  1XS9 A;  2NVQ J;  3HOV J;  2X9D A;  3IKV A;  1XGM A;  1K61 A;  2UXX A;  2L3D A;  3M8J A;  2CJJ A;  2Q1Z B;  2NOG A;  3CCR I;  4LIT A;  4LB6 B;  1W36 D;  3B73 A;  2EZI A;  2LMD A;  1G3S A;  2K4J A;  3E1S A;  2Z9O A;  1UHM A;  3ECH A;  2XGE A;  4YEL A;  3KP4 A;  3O6B B;  2WAF A;  1D0X A;  2EV0 A;  3IC7 A;  2X48 A;  4YG2 F;  3J81 Z;  1TWF J;  5IPA A;  4RS8 A;  2P7C B;  2ZBK A;  2K5C A;  2WB1 N;  1FC3 A;  2ZSI B;  3GYH X;  2DT6 A;  5LGN A;  4S05 A;  3ZQL A;  3OYC A;  3C2B A;  1WI3 A;  3S14 J;  5F04 A;  3V4G A;  1S6L A;  1T8I A;  4DNC A;  5JHU A;  1JUS A;  2FJ1 A;  3ASO H;  1OYW A;  1HOM A;  1BR1 A;  3VFZ A;  2X4H A;  3LWF A;  3S3O A;  2CQ7 A;  2LRD A;  5FLV A;  3IRQ A;  2CW7 A;  3E6M A;  2VC1 A;  2ZJR F;  3E6C C;  1R5G A;  1JT6 A;  1POG A;  2MSY A;  3H35 A;  5EJC A;  3J7A O;  4O3M A;  2GZW A;  4CZC A;  1Z9C A;  1PUF A;  2F5E A;  5D8L B;  3TW6 A;  2DW4 A;  3GXO A;  2DA1 A;  5FO5 A;  2KZV A;  4M6X A;  4LJZ F;  1JKR C;  1MZB A;  5FKL A;  1F36 A;  4B3X A;  4I6Z A;  4RB3 C;  2B0L A;  1X1P A;  3D1N I;  3GTK J;  4XR6 A;  3LA3 A;  5IOZ A;  2HZT A;  3A02 A;  3BPV A;  4X6A J;  2I5U A;  4HNU A;  3OY9 A;  1H88 C;  2LFB A;  4HG2 A;  3PQJ A;  3DQV C;  2DMU A;  1H9T A;  2DFF A;  4UUS A;  1IDZ A;  1T0F A;  3CJQ B;  1IZ1 A;  3IHU A;  3ZMZ A;  1FEX A;  5J3L A;  2IXS A;  3OYG A;  4CIC A;  5IOY A;  3LOC A;  1CQT A;  4HNT A;  1FX7 A;  4IRI A;  3ERE D;  3M3Y J;  4E6K G;  3GTM J;  4FX4 A;  1YS7 A;  1LPQ A;  1KU7 A;  1ZRF A;  1IN5 A;  3T8R A;  3DKW A;  1WSU A;  3F0C A;  2L01 A;  4CCK A;  1K78 B;  2JPB A;  2XAG A;  1O3Q A;  3E6B A;  2H6C A;  2DU9 A;  4EVI A;  5DUI A;  4YFN F;  1BIB A;  4UNO A;  5C3E J;  1ZN2 A;  4Z6Y A;  4JBA A;  2DT5 A;  1SAX A;  4EM2 A;  2OC6 A;  2EIK H;  2DLL A;  1BN5 A;  3ZQF A;  2PX9 A;  3ZCO A;  1U0J A;  2WAQ A;  3OYA A;  5ICF A;  3O8G A;  1YX3 A;  1TQI A;  3K0L A;  2R93 J;  1ZGW A;  3VOD A;  2PMU A;  3FF5 A;  3S1M J;  2BOL A;  2QEX I;  1NK3 P;  5AIQ A;  3F6O A;  2VOD A;  3CF5 F;  1MDM A;  3DPL C;  1S7E A;  4A3B J;  4DYR A;  4D1Q A;  2MD0 A;  4A3L J;  5EEA A;  1WCM J;  4ETS A;  1QGP A;  3OYD A;  1OQY A;  4HBL A;  4A3C J;  4RAY A;  5FLX Z;  1J0R A;  4J01 A;  4AIK A;  2CYY A;  3I3L A;  1XN7 A;  3MKW B;  4I0A A;  4K2E A;  3KZI C;  4Q4Z F;  1JTX A;  1OYI A;  3AKZ A;  3DLA A;  4FE7 A;  2B7E A;  4L5J A;  2W82 A;  4KIT B;  1ZR4 A;  1Y39 A;  5J47 A;  3HOS A;  1Z3X A;  3F8N A;  4CYC A;  2DYS H;  5M3F J;  3C1D A;  1O3R A;  1GVJ A;  1WPK A;  3IP4 B;  1WJE A;  2RN7 A;  3OYL A;  3JRE A;  1PJR A;  5HOO A;  1FTZ A;  2DOA A;  3JTG A;  5GAH J;  4V2F A;  1U5T B;  3VB2 A;  2XHK A;  4EQQ A;  2PEX A;  1S8N A;  1X1C A;  4O6J A;  1XTA A;  2YU9 J;  2VE8 A;  3WTW C;  1GDT A;  9ANT A;  5LHI A;  5ILV A;  2JSC A;  4CYD A;  4BGD A;  3ABK H;  3WTX C;  2BBY A;  2KDO A;  2A69 F;  2QCO A;  4AVZ A;  5J1Y A;  3I64 A;  3SDG A;  4XKC A;  3DWL E;  5EG0 A;  4LFU A;  2XAU A;  4BJ6 C;  1Y6I A;  3SDB A;  1LDK B;  3HSF A;  1S7O A;  2BZT A;  1T98 A;  2HKO A;  4IHY A;  1DP3 A;  2P8T A;  3FXJ A;  3KLO A;  4BYY A;  5L3F A;  2QSH X;  2BY0 A;  3HIF A;  1QRY A;  2Q0O A;  2OCE A;  4L9N A;  2FQ4 A;  1BM9 A;  2V4J C;  3FM5 A;  3FXO A;  4XSX F;  2CQN A;  3Q5F A;  3FHZ A;  4XRS A;  2E7W A;  4S04 A;  2H94 A;  3S32 A;  1SFE A;  4CCN A;  4V2G A;  2VJI A;  3KCC A;  2CMP A;  2IS1 A;  3RZO J;  3JRC A;  3EUH C;  2E5Z A;  2FSW A;  3Q0W A;  2L9S A;  2G7U A;  3IL2 A;  1R5I D;  1U78 A;  3VEP A;  1R4M B;  4LK1 F;  2HU9 A;  4WXD A;  2M45 A;  3HPG A;  3RQ4 A;  2WA0 A;  4KUM A;  1ODD A;  3AG3 H;  1ZRD A;  1UAA A;  1QNT A;  2IVM A;  3GTQ J;  3K1P A;  1YIJ I;  2R7X A;  5JVT A;  1W5S A;  3TP0 A;  1BW6 A;  3PNV A;  3V8L A;  4G94 A;  4TV7 A;  5F1J A;  4Z2Y A;  1XX5 A;  4IPA A;  1XCB A;  2M7B A;  3WTV C;  3WU1 B;  1OCR H;  2QGU A;  3B02 A;  4M72 A;  2L9R A;  3ULQ B;  1R9T J;  4G7H F;  2KP6 A;  3A01 B;  5JI6 A;  1B4A A;  3H5N A;  1B72 B;  2A3S A;  5JLX A;  4WCG A;  1X3W B;  2IS2 A;  1VI0 A;  1Z3Y A;  5C4J J;  4BQA A;  2XGD A;  3GLX A;  4E7Z A;  1YTY A;  2ZXI A;  4BDY A;  1JKP C;  1KU2 A;  2Q2E A;  3FBI B;  4PZJ A;  4IF4 A;  2E2H J;  3DBH B;  4KMF A;  1W36 C;  3I4N J;  3C7J A;  2A61 A;  2ESN A;  1R49 A;  3ZQH A;  2LP0 A;  4YIF A;  3MCZ A;  2M1B A;  5FKN A;  3E5Q A;  5HOD A;  1TZL A;  2R7S A;  4AIJ A;  1TW3 A;  1HDP A;  4HST A;  5EDN A;  4M3G A;  4KN4 X;  4MFD A;  4DZJ A;  5LHH A;  4E7K A;  5E1Z B;  2E60 A;  3G71 I;  3GME A;  2KL4 A;  4U88 A;  4PFP A;  3JAM K;  3S15 J;  2ZXW H;  3I58 A;  1JKQ C;  4XMY A;  3ZMD A;  2EZK A;  4XN3 A;  5HDG A;  2JQ7 A;  2DA2 A;  1LKX A;  3BR6 A;  3TKY A;  3DU6 A;  3WTT C;  3P5J A;  4C30 A;  2QKM B;  2QWW A;  4ENJ A;  1U5T C;  2VT3 A;  4F3Q A;  4G12 A;  2DA6 A;  2Q8K A;  3WTU C;  3IRR A;  4RB1 A;  1ERD A;  1O57 A;  1MND A;  2OAZ A;  2VOO A;  2HYF A;  2IAI A;  3PIO F;  3QU6 A;  1LNW A;  3GZN B;  5IYC J;  3ZMV A;  3CCS I;  5F0H A;  1HBX G;  3OIO A;  4YFK F;  4IRH A;  2LRE A;  1TNS A;  3NAU A;  4MLO A;  3CJT B;  2PJP A;  1J09 A;  3BPX A;  1TLH B;  5IT9 K;  4UV9 A;  1OYY A;  2AQF A;  2F5V A;  4ZC3 A;  4BXF A;  1WJD A;  3HPH A;  1XGN A;  1ZHF A;  3FMS A;  2GA2 A;  1JE8 A;  2LC2 A;  3G4S I;  2BW3 B;  4XBF A;  4ESF A;  2Y30 A;  4RB2 C;  3J80 Z;  3ROU A;  4B3A A;  1SVO A;  2ZKZ A;  3EYY A;  1ETV A;  3OR1 C;  1J9I A;  1UFM A;  2FBK A;  3KX2 A;  2DT7 B;  1KYW A;  3U1D A;  2L0K A;  2FML A;  1JT0 A;  2WV1 A;  5JR3 A;  2LG4 A;  4PSW A;  3BZK A;  5A2Q K;  5CYV A;  5AON A;  1EKE A;  4XM3 A;  4MQV A;  1ZH5 A;  4OU0 A;  1W0U A;  3RPU D;  2ELK A;  5L3B A;  2KDZ A;  3OR2 C;  2FD5 A;  1ZRE A;  4RDU A;  1XGS A;  1MMG A;  2COM A;  2L7M P;  3OYE A;  3MKL A;  1YI2 I;  2Y9Z A;  2RNG A;  2IW5 A;  1W7P D;  1W1W E;  4GYG A;  2E2J J;  4MIM A;  2R7Q A;  2CQQ A;  1WJ5 A;  2K85 A;  1QZY A;  3Q0V A;  1B9M A;  3EUH A;  3LNQ A;  3JCU C;  4BS9 A;  2CWE A;  1V54 H;  4B44 A;  3BDD A;  3JW4 A;  3RTR A;  3ZMS A;  3MN2 A;  3WG7 H;  3E0J B;  3F9K A;  1XMK A;  2UZK A;  2IA2 A;  3O3K A;  3FXR A;  1K78 A;  5J40 A;  3HDD A;  1WFX A;  1OCC H;  2P0W A;  2DYR H;  3R60 A;  2FXA A;  1F43 A;  3V42 A;  2X51 A;  4U7B A;  4FET A;  4AUX A;  4G8X A;  2WBM A;  2MLK A;  4ZYH A;  3V8J A;  3HXL A;  1FTT A;  4A0Z A;  4HOB A;  2XC7 A;  5B3S H;  3IH4 A;  3ZQI A;  1Y0U A;  1SD5 A;  4IL6 C;  4LLL A;  2FRH A;  1UCR A;  5IT3 A;  1VQ5 I;  1E3P A;  2FMY A;  1N75 A;  3OOP A;  2ZJP F;  5K5O A;  2PJR B;  4BHP A;  2VLA A;  4DJA A;  2R5Z A;  4E7J A;  1OJL A;  4Y3O A;  4XLN F;  5BMZ A;  1U6G A;  1MBF A;  5L3D A;  1SD7 A;  2V1N A;  3CJN A;  1D0Y A;  1Z1D A;  4EV0 A;  1MBE A;  2VQL A;  3DTK A;  3RKQ A;  4DW6 A;  3G1O A;  1FYM A;  1X3Z B;  2CW0 F;  5J4V A;  3Q9S A;  5FD6 A;  4KFC A;  2QBY B;  4YIR X;  4PFO A;  2OU2 A;  1XMA A;  2ETH A;  1REP C;  4JP0 A;  3I54 A;  5D5X B;  3OS1 A;  3CO7 C;  2O5R A;  3OWT A;  3PM1 A;  2TRT A;  5CJ9 A;  3GO5 A;  3RPQ A;  3K10 A;  1U5T A;  3MEX A;  3DXJ F;  2X6Y A;  1EA3 A;  4RGX A;  1HSJ A;  2YX4 A;  2LVS A;  3V7S A;  2XDV A;  4BDZ A;  2RKH A;  3KYC B;  1VND A;  4IRG A;  3OYH A;  1AOY A;  1GUU A;  2ZO4 A;  1N77 A;  1AKH B;  1D1B A;  3RYR A;  3GW2 A;  4WWC A;  2EV6 A;  1VTN C;  2XAQ A;  1VQ8 I;  1VQ4 I;  3B6C A;  5KAF C;  4DYC A;  2L54 A;  5K7F A;  2R7U A;  3KP7 A;  3RYP A;  5GAG J;  3LAP A;  1QVU A;  2EFQ A;  3AG1 H;  2Z5U A;  3BQZ A;  4UB8 C;  1RRJ A;  2QZ8 A;  2GWR A;  2H8R A;  4XNF A;  4A3E J;  2O03 A;  5CVI A;  2VJ4 A;  5J8F A;  3HSE A;  5EZH A;  1XSD A;  1VQ6 I;  4PJ0 C;  2XRO A;  1P6R A;  3I55 I;  1RIO H;  2EFO A;  3ZQG A;  1FIA A;  1XSV A;  3HB9 A;  4HPQ A;  1WJC A;  2KIM A;  2NNN A;  1XB4 A;  3F3X A;  1FSE A;  2KRC A;  4IOA F;  4FAS D;  1KGS A;  2XB0 X;  1YLF A;  5HNF A;  4A3K J;  1D8J A;  4IOC F;  1YQA A;  3DPT A;  5CVR A;  4RAF A;  1L0O C;  3JRI A;  2HVR A;  1R00 A;  3E97 A;  4W97 A;  1YX5 A;  3OYN A;  2GQQ A;  1EV7 A;  1KYZ A;  3DBR B;  2E1O A;  5LD2 C;  1FZP B;  5IP9 J;  2KRF A;  2OPT A;  2E35 A;  2BGC A;  3PUF A;  2BY3 A;  2LD5 A;  3W6K B;  2BV6 A;  5DCM B;  2ISY A;  1DGW Y;  2MAB A;  1UJ8 A;  2M7A A;  3M4O J;  4Y17 A;  3T8T A;  2IA0 A;  2OBP A;  3TOB A;  5LEJ A;  3V8K A;  4A0X A;  4OMY A;  3L00 A;  1ULY A;  3CMY A;  4KJZ A;  3DTI A;  2CH0 A;  2HGC A;  1B72 A;  2HOT A;  1TP4 A;  4BKX A;  2DK5 A;  5E17 F;  3KP5 A;  2FBI A;  3JR9 A;  1Y8Q B;  4C3H J;  3VSK A;  1T38 A;  2M4K A;  4E7L A;  2VKE A;  2KLO A;  2E1C A;  5M5W J;  4F93 B;  3CES A;  2L4A A;  3MAJ A;  3BC8 A;  3ZOB A;  2OZ6 A;  3PIP F;  5TRD A;  1V5E A;  5K1Y A;  1NTC A;  2DTZ A;  2W84 A;  5HLI A;  2JRM A;  2E5N A;  4P5O A;  5ILS A;  2ID3 A;  4M6V A;  1MBK A;  2JN6 A;  5BS6 A;  2V79 A;  3FXQ A;  1WWX A;  1N78 A;  2V26 A;  3OL3 A;  3R4K A;  2VN2 A;  1Z6R A;  3W3C A;  1I6X A;  1QZZ A;  4KN7 X;  3NWS A;  4B4C A;  1HW5 A;  1ZRC A;  2M4G A;  2IP2 A;  3JSP A;  2LY9 A;  1WJF A;  2VPL A;  2GAU A;  4V19 K;  4FE4 A;  3FBN B;  3ZXS A;  1JJ6 C;  2WC2 A;  1YJW I;  4EJT A;  3SJM A;  3OIQ A;  4II2 A;  5CLS A;  3DPU A;  2EZL A;  1MD0 A;  3G73 A;  2Y75 A;  3F8C A;  4I02 A;  1XDS A;  3CO6 C;  2XGX A;  3PNY A;  4HQE A;  2HYJ A;  2DMT A;  2X1E A;  4LB5 A;  4ANJ A;  2KJC A;  2G7H A;  2W25 A;  3FDY A;  4IX7 A;  1YIT I;  1FOW A;  3SFZ A;  2DA5 A;  4D7N A;  3QU3 A;  5BNG A;  1ITY A;  3L2U A;  2ESH A;  3ZQQ A;  5D5W B;  3M8F A;  1YOV B;  3WU0 A;  2ACJ A;  2BW3 A;  3D5R C;  2QA4 I;  2LDU A;  2WWY A;  2IRF G;  1G59 A;  4A3G J;  4JX5 A;  3BJA A;  3R6S A;  3CP8 A;  3R0A A;  1H89 C;  3ZR8 X;  4ZDO A;  2UXN A;  5HS7 A;  3WGI A;  4RAZ A;  4PJL A;  3QPL A;  2DK8 A;  4M9X A;  4I98 B;  2HQR A;  3K4K A;  4FIS A;  3RCO A;  2Y48 A;  4XL9 A;  2HS5 A;  4MEX F;  4XK4 A;  2KJB A;  2ME0 A;  4EJU A;  4IHS A;  4IHW A;  2V6E A;  3WE2 A;  2OF7 A;  1YRN B;  2D5V A;  2TCT A;  4UHT A;  3W6J B;  3JRH A;  3HM5 A;  2A68 F;  1WZ2 A;  1IDY A;  4OIN F;  4HV6 A;  1BJA A;  3OSG A;  5FLX K;  3HOY J;  3K69 A;  1XSX A;  2H09 A;  2W48 A;  2G0E A;  3CDH A;  1DQU A;  2EFP A;  1R36 A;  3FXL A;  3ZQC A;  1BC8 C;  4FHT A;  2XB5 A;  4OOI A;  4CA0 A;  4E7I A;  4BEH B;  5F1R A;  3I9V 2;  4NDL A;  4I76 A;  5F0F A;  4BJT A;  1RPW A;  2FE3 A;  4RMN A;  2VON A;  2PG4 A;  2HOE A;  4M3D A;  2UV1 A;  2BY2 A;  3F8M A;  4XKB A;  4IVN A;  3CC2 I;  1GHC A;  3A2K A;  4GCV A;  1JUP A;  3CDI A;  1VQ7 I;  4XON A;  1HXD A;  1ETX A;  4D5F A;  2FOW A;  1S3J A;  2CFX A;  4DBR A;  2J5P A;  2EZH A;  2F4M B;  3CCL I;  1Y8R B;  5LRR A;  2R4G A;  4YRV A;  2XPU A;  3NWT A;  4BUP A;  2PJR A;  2E19 A;  3SZP A;  3FIS A;  4CCL A;  2TDX A;  4MHG A;  2STW A;  2WTE A;  5CQG A;  5FD5 A;  1B9N A;  4G7Z F;  4DZP A;  3TOA A;  1VQK I;  2F48 A;  3L2R A;  2KMU A;  3CCM I;  1BI3 A;  1TWH J;  3KYD B;  1O7L A;  3K2Z A;  3SXY A;  3KYL A;  1BI1 A;  2FEZ A;  3L2V A;  2STT A;  3TO9 A;  4QSH A;  2MBF A;  3LSH A;  3K1M A;  2ZME B;  4XRS G;  1IJW C;  4I09 A;  1G2H A;  2A6E F;  3WOD F;  5FKK A;  2Y9Y A;  2PI0 A;  4DBQ A;  1T95 A;  4HLY A;  1SC7 A;  2JUC A;  1RNL A;  4HV5 A;  5LLQ A;  3ISP A;  3JRD A;  1I6H J;  5TJJ A;  3MFK A;  3R0J A;  2M3A A;  4F91 B;  3LSG A;  4B1R A;  2VQG A;  1YHQ I;  4LK0 F;  4OAY A;  2NVY J;  4AID A;  3OSF A;  1BL0 A;  2QQA A;  2DJN A;  3FXM A;  1RUN A;  3VYR B;  4XLE A;  2VT2 A;  4L5E A;  2LBF A;  2R7R A;  2KZG A;  1B8I B;  1V5G A;  1GXQ A;  3CUQ B;  2JZY A;  3S1R J;  1AKH A;  3C2G A;  3DKY A;  1MMA A;  3NEU A;  3ABU A;  1XD7 A;  2LYC A;  1OR7 C;  3VPR A;  2MH2 A;  4WK8 F;  3TGN A;  3OYJ A;  5F08 A;  3LFK A;  3RPU A;  2MFZ A;  1IG7 A;  1MIJ A;  4KIB A;  2OUM A;  2DTR A;  2A05 A;  3HOZ J;  3G2B A;  5E20 A;  5CVU A;  5D8K B;  3PSF A;  4XOP A;  4ENK A;  1BA5 A;  1ZYR F;  4UV8 A;  3BLY A;  5D6F A;  1ACI A;  1KA8 A;  2DA3 A;  1W7P A;  5F64 A;  2JRT A;  4BBS J;  4AVP A;  4Q47 A;  1RZ4 A;  2WV0 A;  3OYM A;  1T39 A;  1LQ1 A;  2CS3 A;  4I0B A;  2MH9 A;  3TO7 A;  3S3N A;  2CV0 A;  2HKX A;  3I71 A;  1ZLK A;  4CGZ A;  3W2A A;  1FPQ A;  2PMH A;  2DMQ A;  3ML6 A;  5DUK A;  2PMZ A;  3PFY A;  3TED A;  3M07 A;  1X1D A;  3E6D A;  4PJJ A;  3DF8 A;  3K4M A;  4ZDL A;  1LFP A;  4U7D A;  1LJ9 A;  1OLT A;  3LQQ A;  5H6Q A;  3IH3 A;  4KMU X;  4A6E A;  5F0C A;  2L4M A;  4NNJ A;  2K9M A;  2VL8 A;  5F6F A;  4XLC A;  4ZYA A;  1R23 A;  4A5N A;  3BWG A;  1IC8 A;  2VBY A;  2CFO A;  4IQ4 A;  3BCB A;  5IYB J;  3S3M A;  1E3O C;  2RNJ A;  5DM7 F;  2ZFU A;  1DPU A;  4YII A;  4L9V A;  2A5W A;  1R58 A;  4ZDP A;  4AWX B;  2DMP A;  3H36 A;  4EMS A;  1XDU A;  2DBB A;  4FCY A;  1MJB A;  3RKX A;  2OQR A;  3RDI A;  1HKQ A;  4BY1 J;  3G6E I;  2O8K A;  2V9P A;  3BG3 A;  4B43 A;  1XPX A;  2V1D A;  3IUO A;  3IWF A;  4XID A;  4FTH A;  5GTH C;  2PMZ N;  4UUV A;  2LF7 A;  1I5Z A;  2M30 A;  2MLG A;  1CF7 B;  1R7J A;  3BOQ A;  1MSF C;  3LSK A;  4YFX F;  1P4X A;  3NAR A;  3HHG A;  1B59 A;  3F6V A;  1SVM A;  1V4R A;  2XUB A;  5DV5 A;  2DN0 A;  2L2O A;  2VKD A;  2ME6 A;  4MTD A;  2QUF A;  1APL C;  3CCE I;  3HRU A;  4LG0 B;  4M74 A;  4MO7 A;  2YS9 A;  1LFB A;  1RC9 A;  3BCA A;  2ZME C;  3CMM A;  3FMR A;  3MKZ A;  3MQ0 A;  4MQ9 F;  3IAS 2;  1B6A A;  1H8A C;  1I27 A;  2NVX J;  3RKY A;  3ELK A;  3K4B A;  4L9T A;  3S1Q J;  2JT1 A;  1XGO A;  5GPA A;  3S93 A;  1IF1 A;  2M8G X;  3J7Z I;  1U9O A;  2H1K A;  1W4M A;  2R7T A;  3T0Y A;  4F55 A;  1J7K A;  3RQI A;  5JFR A;  1MSE C;  4BNC A;  2FBH A;  4XRF A;  1UST A;  1WGX A;  4BE1 A;  1G3T A;  2JVH A;  2WY7 Q;  3T1B A;  4HDU A;  3EDP A;  1L3L A;  1E2X A;  2CV1 A;  3H5A A;  2H8W A;  3BJ6 A;  4RLQ A;  4HSR A;  3REO A;  1K83 J;  3AG4 H;  1SD4 A;  1V5F A;  3OYI A;  3I59 B;  4X1E A;  3CUQ C;  2M0M A;  3CMA I;  2HXO A;  2MG4 A;  3CC4 I;  2XAF A;  1RR7 A;  2IPQ X;  1KU9 A;  2W57 A;  5DM6 F;  3H9J A;  3DU5 A;  4A69 C;  4PUS A;  2R5Y B;  2QSG X;  4RA2 A;  2HYG D;  2R3S A;  1QQI A;  4CSW A;  2RC4 A;  1UG2 A;  1Z67 A;  3S2W A;  2NXN B;  1OR7 A;  1J59 A;  5D6E A;  1YYV A;  1LB2 A;  3GLL A;  2HDD A;  1F9N A;  1AA7 A;  4EEF G;  2HOA A;  3KZY A;  3UKG A;  2B9S A;  6PAX A;  2LTP A;  3BTJ A;  4UB6 C;  4I99 C;  4BY7 J;  1ETO A;  1P2F A;  1RKW A;  2Y31 A;  1A04 A;  5TGT A;  3I0T A;  2YSR A;  2RV8 A;  2YPR A;  3M7G A;  3MZ8 A;  2CG4 A;  1LUJ B;  2M8E A;  4KYW A;  1YRN A;  5HVQ C;  2VI6 A;  4XOR A;  2HQ5 A;  2IGM A;  2HWV A;  2K9N A;  3F8F A;  3CF2 A;  3BR3 A;  4M71 A;  1FOY A;  2D1V A;  1SD6 A;  3CTA A;  5CVJ A;  1G6N A;  2DQL A;  3V7R A;  3TBI A;  2W7N A;  1XMX A;  1DDN A;  4ZTJ A;  2NNY A;  4A3F J;  3PL8 A;  3P7N A;  4RM2 A;  3L2W A;  3PUB A;  2R7V A;  3TW7 A;  1UHS A;  4A3I J;  3HL2 A;  2EBI A;  2DAO A;  2CRG A;  2VBZ A;  1LEB A;  4ON0 A;  1IXR C;  5KAI C;  1VQO I;  1DU6 A;  4ZJZ A;  1WVR A;  5E3L A;  2DFH A;  1UEL B;  2Z33 A;  4HX7 A;  4HF2 A;  2I8D A;  3K9T A;  4EGY A;  3WHC A;  2DPU A;  2KT0 A;  3TDZ C;  1FLI A;  1LDD A;  5D5V B;  2J5O A;  3CLO A;  3HTU A;  3S8P A;  1SFK A;  2VUM J;  4CUG A;  1C0W A;  3ECO A;  2ZXJ A;  2I10 A;  1D0Z A;  2HZD A;  3BG6 A;  3GFJ A;  1QBJ A;  1RES A;  5DCF A;  2Z1D A;  2D1H A;  1KQ0 A;  2HDW A;  1D1C A;  2DFI A;  3K4C A;  3MMY B;  3O8H A;  3K7A J;  1I1G A;  2LKS A;  1IN7 A;  1TWA J;  1KZH A;  1Y0N A;  4BH9 A;  2EIM H;  2LLK A;  4MGR A;  3EET A;  3KP2 A;  2OZU A;  3ZMT A;  3FK7 A;  2HR3 A;  4OIP F;  5HLH A;  3N97 A;  3H9Q A;  1O3S A;  2DDA A;  5L3C A;  1OIS A;  1FP1 D;  1RET A;  2OJE D;  2ZME A;  3TL4 X;  2P7V B;  2BVL A;  1E0E A;  4G6D A;  2W85 A;  1JGG A;  4KIF A;  2ICW G;  1SVL A;  4I01 A;  3BRO A;  2L7Z A;  4AU7 A;  5JVG F;  3U9G A;  1LE8 B;  3NQO A;  1HF0 A;  1PUF B;  2VJJ A;  1PDN C;  2DMN A;  2E1M B;  1X2N A;  1A31 A;  4U87 A;  1WJA A;  4Q48 A;  1R22 A;  2A6T A;  3L9F A;  3SYT A;  5J6X A;  3VYS B;  3TMO A;  2V1U A;  2JA5 J;  3JAM Z;  2W24 A;  1UZC A;  3EUA A;  2XAS A;  3RSN A;  1LDJ A;  2XKO A;  5FJ8 J;  3CUQ A;  3IH2 A;  4Y33 A;  4NC7 A;  5K5Q A;  4OWR B;  4X0G A;  1T6S A;  5CVV A;  1V3F A;  3WTZ A;  1QA6 A;  2PLY A;  2E7X A;  1MH4 A;  4ASN A;  1NH3 A;  4UUS B;  2RQQ A;  1X1A A;  4Y13 A;  2LK2 A;  4XLH A;  3LFU A;  2GIZ A;  3BQY A;  4QPQ A;  1HDD C;  4C2T A;  2IBD A;  2MYS A;  3ZN1 A;  2AHQ A;  2JA2 A;  3OMY A;  2Z2S B;  1FMV A;  4RB0 A;  4GO1 A;  2HEO A;  2O0Y A;  4PK4 A;  4HYE A;  1TNT A;  4C2M J;  2FA5 A;  4PCQ A;  2O61 A;  2DOE A;  3W2W A;  2JK3 A;  3ZGK A;  1P4W A;  2GM4 A;  3FK6 A;  4JX4 A;  1T56 A;  4RGR A;  1ZAR A;  4XSZ F;  2X85 A;  4ITV A;  1S9H A;  3VDX A;  1D5Y A;  4XRM A;  4WX9 A;  3OYB A;  3JRB A;  3W6V A;  3SHF A;  3D5S C;  1D1A A;  1OKR A;  3Q3S A;  2GXB A;  3C18 A;  4ZYG A;  2NVT J;  4UVC A;  2BXZ A;  1YE9 A;  2X1D A;  5H2F C;  1YIO A;  2DOD A;  2NS7 A;  1MDM B;  4LD5 A;  4LLN A;  4QIW N;  2CUZ A;  3P9C A;  2KIS A;  2ID6 A;  2DPD A;  2ZJQ F;  5E1X A;  1G8X A;  2EB7 A;  1ZEL A;  4BU2 A;  3PQK A;  2Z99 A;  3ZMU A;  2RGV A;  2LY1 A;  2LOO A;  2ELH A;  4MFE A;  1SFU A;  3RIR A;  3D5L A;  3EQL F;  4II3 A;  4N9H A;  1J5Y A;  4HX4 A;  4J00 A;  2VXD A;  4G6Q A;  2JSP A;  3J7Y J;  1Y1W J;  1USS A;  5HS8 A;  2CGP A;  2BHY A;  1JI8 A;  2IS4 A;  5GPC A;  4NC6 A;  5FRN A;  1YW7 A;  2JA6 J;  3M1E A;  5HLT A;  4L0Z B;  4ZZL A;  2W1O A;  3ABL H;  4Q5S F;  4IQJ A;  1JHF A;  5D5U B;  3V7C A;  4HAM A;  4NBQ A;  2VIX A;  3A03 A;  4LG0 A;  4S0H B;  1IGN A;  1FBQ A;  2OV7 A;  4H0E A;  3F8B A;  1QHG A;  4EM0 B;  5DDG A;  1NG7 A;  1RUO A;  1T33 A;  2HNH A;  4ZZD A;  5M5Y J;  2VB6 A;  2XRN A;  4EJV A;  1ZGJ A;  2GOX B;  1MNM C;  5EGO B;  3J81 K;  3ZP5 A;  1ETK A;  5K5R A;  3A01 A;  3QOP A;  1BOB A;  2B63 J;  2E1M C;  4M73 A;  3BG7 A;  3MWM A;  1O7F A;  2KFD A;  1I50 J;  2LKX A;  2V6C A;  1P7I A;  3BR1 A;  1X58 A;  4XQF A;  1W5C C;  2RVC A;  2BEO A;  1FY7 A;  1P9Q C;  4WF2 A;  3CLQ A;  4CCJ A;  2MGQ A;  1K4T A;  1ZKG A;  2ZB9 A;  4L9J A;  2KIF A;  4KIC A;  2ELJ A;  1DGR M;  3GX4 X;  1IV8 A;  3J7A Y;  3H3U A;  1D8K A;  1ORK A;  3I5U A;  4C2U A;  3HRM A;  1T0F C;  2Y0M A;  3MZH A;  1BC7 C;  3PSI A;  3WGH A;  5IP7 J;  1JJ8 C;  3GTO J;  3D0S A;  4FQG A;  4P96 A;  3E7L A;  4IHV A;  1BIA A;  2RAE A;  3VYT B;  1BBY A;  2AXT C;  5KNL A;  2VKH A;  1FYK A;  3M9A A;  2HTS A;  3LST A;  1VFC A;  2FOK A;  1HLV A;  3HUG B;  2F5F A;  3QYF A;  3QPS A;  1Z7U A;  3HC7 A;  1G3W A;  1P7J A;  1GV5 A;  4CXF A;  2HTJ A;  1BR4 A;  5H6R A;  4L0Y B;  2C6Y A;  4JX6 A;  2XF5 A;  2ZFW A;  1SAN A;  3N4M A;  2DXI A;  2OA4 A;  4EJO A;  3DCF A;  4BL0 B;  2GLO A;  2JUG A;  1UMQ A;  2ZCW A;  4XOT A;  3I4P A;  2NAZ A;  2K27 A;  3JSO A;  2V9V A;  2LY2 A;  5EYR A;  3ABT A;  1NHA A;  1R1T A;  2FNA A;  2CUJ A;  2VQC A;  1KQ8 A;  4N0B A;  2XPW A;  2X0L A;  2D2W A;  3QRF F;  2MW8 A;  1QPI A;  2R7Z J;  1MMS A;  2Q2E B;  1MJA A;  2Y69 H;  3BY6 A;  3WGG A;  2M0C A;  3ONQ A;  5E3M A;  2FNP A;  3RI4 A;  1HKT A;  1YS6 A;  1BR2 A;  2MA3 A;  3OS0 A;  1ON1 A;  3WG9 A;  3ZQ7 A;  4BQO A;  1TWG J;  1YJ9 I;  1WRJ A;  4LGW A;  4XKV A;  4ZTF A;  4DQ2 A;  3OYF A;  4L5I A;  1BI2 A;  1EH7 A;  1I39 A;  1MMD A;  3HSR A;  3MD2 A;  5H20 A;  5E8I A;  5FFZ A;  3BTI A;  1HA8 A;  2XVC A;  3JRA A;  1EJ9 A;  4C9Y A;  1YG2 A;  4B09 A;  3TDU C;  4D0P A;  1MBH A;  1IN8 A;  5FGM A;  4PJN A;  1QVT A;  3BG9 A;  4H4K C;  2E71 A;  2XAH A;  3ZPL A;  3COA C;  4RGS A;  5E3N A;  2UUZ A;  5FKM A;  4HNV A;  1MJ9 A;  1ZG5 A;  2XAJ A;  3LMM A;  1GT0 C;  5GP9 A;  3WE3 A;  2KRH A;  3CP2 A;  2VOP A;  1BI0 A;  4UUT A;  2VQH A;  4NHJ A;  2XKP A;  2QQB A;  1W5T A;  1O3T A;  3SEQ A;  1Q1V A;  2AXL A;  4OAZ A;  3DBL B;  3L2C A;  4FT8 A;  4A93 J;  3MZY A;  2XRL A;  4LMY A;  3AAF A;  3GUD A;  3CC7 I;  4N4N B;  1LE8 A;  3KIO A;  1S5L C;  2Y0S A;  5LEK A;  1FSH A;  4B47 A;  4GFB A;  2COB A;  4KNY A;  2EA4 A;  2VJ5 A;  3HBL A;  1N25 A;  1UHW A;  2M2E A;  2K9S A;  1ZTR A;  1JXS A;  5DTD A;  3HEF A;  4A3D J;  1I3Q J;  1WH5 A;  4HX8 A;  4EAT A;  4N9I A;  3LSI A;  5F27 A;  3GEZ A;  2ECC A;  1Y1V J;  3FWE A;  3PNT A;  3QYB A;  5D4S A;  2L7F P;  3DEE A;  5E3O A;  4LG3 A;  2QBY A;  4IKF A;  3C3W A;  4IZZ A;  2DA7 A;  1R71 A;  2VBW A;  3HRS A;  1D5V A;  1IV6 A;  4JK1 X;  4LOC A;  4GDF A;  3K2A A;  2Y0S N;  1SFX A;  1RR8 C;  2CW8 A;  4PDK A;  4CZZ A;  3QP6 A;  3IV5 A;  2F4I A;  1VQ9 I;  5K7Z A;  3GFI A;  2K40 A;  3LSP A;  2H27 A;  4RM3 A;  1K7A A;  1MMN A;  4M6Y A;  1HST A;  3K4J A;  3BTC A;  1ETQ A;  2L9V A;  4KT6 A;  4UVB A;  4IHT A;  2LH9 A;  3S2D J;  1MBG A;  2KKO A;  4N4O B;  3K4N A;  1PVE A;  4HEA 2;  1A35 A;  1ENH A;  1LVK A;  2X6W A;  2EIN H;  3LSM A;  1F4K A;  3A0H C;  2XF6 A;  3FZV A;  2JA8 J;  3BT9 A;  3OYK A;  3PJR A;  4BJ5 C;  4WXH A;  1R1V A;  4NUB A;  3CJR B;  4G6T B;  1FNN A;  3KEY A;  3LAJ A;  3I53 A;  3F72 A;  4YEJ A;  1VQL I;  3BP8 A;  1X3U A;  3HRT A;  4EJW A;  3DV8 A;  4W1U A;  1J75 A;  4XN0 A;  3WHB A;  2CQX A;  2O8X A;  3E5X A;  4JQF A;  3QAH A;  1BJZ A;  2R5Z B;  5LRS A;  2EJR A;  1WJB A;  4D9J A;  2PQ8 A;  2LNB A;  1FT9 A;  1FWZ A;  3F23 A;  2CSO A;  2F4O B;  5FFX A;  4HA8 A;  3P9I A;  3HOX J;  1ETW A;  3QOD A;  4CCO A;  1JTY A;  2BY1 A;  4BBR J;  1MNE A;  3H0G J;  1OCZ H;  2UWM A;  4R1H A;  2DI3 A;  4IHX A;  1ZQ3 P;  2WAQ N;  3EUK L;  4I7H A;  5FRM A;  2PN6 A;  1OMI A;  2Z3Y A;  3E5U A;  2H1L A;  3K4L A;  5M3M J;  1TBX A;  1HW1 A;  2M34 A;  4M9S A;  4BQN A;  5L3G A;  4NQW B;  4LIV A;  4DIQ A;  5HS9 A;  1TL8 A;  3CCV I;  2F2E A;  4OIO F;  2EWN A;  3A1Y A;  3FHN A;  2QSF X;  3F22 A;  3H92 A;  2EFW A;  4E70 A;  5IYD J;  3PO3 J;  2GIV A;  1FOX A;  2HVS A;  2F5C A;  5DCM A;  2OQG A;  2PFB A; 
#chains in the Genus database with same CATH homology
 1WJC A;  2I8D A;  4E7S A;  2KRC A;  1VZ0 A;  4FAS D;  1X19 A;  1BR1 A;  1SFK A;  3S8P A;  5HNF A;  3DPT A;  4CUG A;  4XLA A;  3S3O A;  2LRD A;  2HVR A;  1D0Z A;  2CW7 A;  2HZD A;  3BG6 A;  1YX5 A;  3OYN A;  2WY8 Q;  3H35 A;  4CZC A;  2IGO A;  2Z1D A;  5LD2 C;  2HDW A;  1D1C A;  2KZV A;  3K4C A;  3MMY B;  3DKX A;  1DGW Y;  2MAB A;  4B3X A;  2M7A A;  3H9Q A;  4XR6 A;  4HNU A;  3OY9 A;  4HG2 A;  3TL4 X;  2BVL A;  3N05 A;  1E0E A;  3DQV C;  4DGW B;  4KJZ A;  4QPO A;  3DTI A;  2CH0 A;  2ZSH B;  3CJQ B;  4AU7 A;  2IXS A;  2L7K A;  3OYG A;  3VSK A;  2M4K A;  2ZXH A;  2VJJ A;  4E7L A;  4HNT A;  2R7W A;  2E1M B;  2KLO A;  4F93 B;  3CES A;  4U87 A;  1TT0 A;  1WJA A;  4E6K G;  3BC8 A;  4F52 A;  1V5E A;  2A6T A;  3SYT A;  3VYS B;  3TMO A;  4CCK A;  2L5Q A;  3GBG A;  1X1B A;  4HRI A;  3ZRG A;  3EUA A;  2E5N A;  3RSN A;  4P5O A;  4DOZ A;  4Y33 A;  4NC7 A;  5LFA A;  4OWR B;  4X0G A;  2Z16 A;  1N78 A;  2OC6 A;  2V26 A;  2V9K A;  3OL3 A;  3W3C A;  2RQQ A;  3M1C A;  1X1A A;  3H0D A;  3NWS A;  3ZCO A;  1U0J A;  4XLH A;  2WAQ A;  3OYA A;  3K70 C;  2M4G A;  3LFU A;  1YX3 A;  4QPQ A;  1WJF A;  4C2T A;  2MYS A;  2VPL A;  2JA2 A;  1R6R A;  3OMY A;  2Z2S B;  3FBN B;  3ZXS A;  1FMV A;  2BOL A;  3OIQ A;  4II2 A;  3DPL C;  3DPU A;  4PK4 A;  2FUG 2;  3W2W A;  4D1Q A;  2MD0 A;  3PNY A;  3ZGK A;  2X1E A;  3OOU A;  3OIP A;  4ANJ A;  1X4P A;  3OYD A;  4NC8 A;  3A4C A;  1X4O A;  4J01 A;  1UG0 A;  2X85 A;  3I3L A;  3MKW B;  3FDY A;  4IX7 A;  4ITV A;  3AKZ A;  1S9H A;  3VDX A;  3DLA A;  3OYB A;  5KHD A;  3DTE A;  3D5S C;  2QKL B;  1D1A A;  3ZQQ A;  3L2U A;  2W82 A;  4KIT B;  3HOS A;  2BW3 A;  3D5R C;  1YE9 A;  1Z3X A;  2X1D A;  3HOT A;  1G59 A;  3CP8 A;  3SEZ A;  3ZR8 X;  3IP4 B;  1WJE A;  3OYL A;  4ZDO A;  1IRX A;  1PJR A;  5HOO A;  4PJL A;  2DOA A;  2W00 A;  3K4K A;  3RCO A;  2CUZ A;  4XL9 A;  4BEH A;  1X1C A;  2V6E A;  1K6Y A;  1GLN A;  4BGD A;  3AL0 B;  1G8X A;  1ZEL A;  4BU2 A;  2KDO A;  3EPZ A;  2LY1 A;  2LOO A;  4AVZ A;  3D5L A;  4II3 A;  3U21 A;  4J00 A;  4XKC A;  2VXD A;  3DWL E;  2JSP A;  2XAU A;  4BJ6 C;  1JI8 A;  1DQU A;  2IS4 A;  5FRN A;  1Y6I A;  2WAE A;  3SDB A;  1LDK B;  2X1C A;  5HLT A;  2W1O A;  3FKJ A;  3HKZ A;  4CA0 A;  1DP3 A;  4IQJ A;  4E7I A;  4BEH B;  3I9V 2;  3QYE A;  2VIX A;  4BJT A;  5HNH A;  2V4J C;  2OV7 A;  4RMN A;  4BE2 A;  1QHG A;  2UV1 A;  1NG7 A;  3UNG C;  2V7F A;  3S32 A;  4XKB A;  4CCN A;  2HNH A;  3A2K A;  2VB6 A;  4BE0 A;  2VJI A;  2GOX B;  2CMP A;  2IS1 A;  2MC4 A;  2F6C A;  4XON A;  3EUH C;  2E5Z A;  4DBR A;  3OS2 A;  1BOB A;  2L9S A;  2E1M C;  2IGN A;  3BG7 A;  2KQR A;  1QHH D;  2HU9 A;  4YRV A;  2R4G A;  3HPG A;  2NOJ B;  3RQ4 A;  2IGK A;  2WA0 A;  4XQF A;  3NWT A;  1UAA A;  4PJM A;  4F92 B;  4BUP A;  2PJR A;  1P9Q C;  4CCL A;  2R7O A;  5CQG A;  2R7X A;  4CCJ A;  1Z21 A;  3PNV A;  2WAD A;  3L2R A;  2KMU A;  2ELJ A;  1DGR M;  3W2V A;  3J7A Y;  2M7B A;  5CPR B;  3KYL A;  3L2V A;  4C2U A;  3LSH A;  1T0F C;  3PSI A;  2KP6 A;  3H5N A;  3IAM 2;  3VYT B;  2RRE A;  4RLF A;  2VKH A;  3SZG A;  5KNL A;  4DBQ A;  1MW7 A;  1T95 A;  2IS2 A;  1Z3Y A;  2XF7 A;  3HUG B;  3QYF A;  4E7Z A;  2ZXI A;  3HC7 A;  4BDY A;  2M3A A;  4F91 B;  3LSG A;  2VQG A;  1KON A;  1BR4 A;  2BVM A;  3FBI B;  4OAY A;  1W36 C;  2HPI A;  2XF5 A;  3VYR B;  4XLE A;  4R79 A;  2DXI A;  2LBF A;  2R7R A;  4BL0 B;  2JUG A;  1V5G A;  1TZL A;  4XOT A;  2R7S A;  4P1W A;  4HST A;  2LY2 A;  3C2G A;  3DKY A;  1MMA A;  4E7K A;  2E60 A;  2LYC A;  1OR7 C;  2IS6 A;  2KL4 A;  4PFP A;  2CUJ A;  2VQC A;  4XMY A;  3OYJ A;  1PYV A;  4XN3 A;  1LKX A;  2AQE A;  2MFZ A;  3DU6 A;  4C30 A;  2QKM B;  2Q2E B;  4F3Q A;  2OUM A;  4Y4R A;  3G2B A;  3PSF A;  4XOP A;  4E4H A;  1ERD A;  3ONQ A;  1MND A;  3BLY A;  2XSJ C;  2LBF B;  1BR2 A;  3AL0 C;  4BQQ A;  3OS0 A;  4BQO A;  2LRE A;  4MLO A;  2KPM A;  4XKV A;  1J09 A;  3OYM A;  1Y56 A;  3QOE A;  4ZTF A;  2CS3 A;  3OYF A;  2AQF A;  3LL7 A;  3S3N A;  2F5V A;  4ZC3 A;  2CV0 A;  2HQA A;  2VAS A;  3MD2 A;  1MMD A;  2JVG A;  1WJD A;  4BXF A;  3W2A A;  3HPH A;  2LC2 A;  4LIU A;  2PMZ A;  1HA8 A;  3PFY A;  4XLF A;  2BW3 B;  4C9Y A;  1X1D A;  4B48 A;  4PJJ A;  3K4M A;  4ZDL A;  1LFP A;  4PJN A;  4H4K C;  1OLT A;  2K3P A;  2GOM A;  3AFH A;  2KHM A;  3CZ6 A;  3OR1 C;  4AYB A;  4BAC A;  4NNJ A;  2K9M A;  3KX2 A;  2DT7 B;  2VL8 A;  5JHF A;  2UUZ A;  4ZYA A;  4XLC A;  2LG4 A;  2CFO A;  4PSW A;  3LMM A;  4IQ4 A;  3BCB A;  3S3M A;  2KRH A;  4XM3 A;  3CP2 A;  2ZFU A;  3RPU D;  2W4S A;  3OR2 C;  2VQH A;  2DJI A;  3SEQ A;  2A5W A;  4ZDP A;  1MMG A;  4OAZ A;  3OYE A;  2K9L A;  4CH7 A;  2RNG A;  4B43 A;  4N4N B;  3H5R A;  2R7Q A;  3IUO A;  1WJ5 A;  2Y0S A;  3VYU B;  1QU3 A;  4BS9 A;  3LSK A;  3K6G A;  4B47 A;  4B44 A;  3RTR A;  3HG9 A;  3E0J B;  3F9K A;  2VJ5 A;  4E7H A;  2VKD A;  2L2O A;  1WFX A;  3H9G A;  3BCA A;  4PSX A;  2P0W A;  3CMM A;  4EAT A;  3MKZ A;  3V42 A;  1NG6 A;  2X51 A;  3IAS 2;  3LSI A;  4U7B A;  4FET A;  2WBM A;  2X6X A;  3K4B A;  3HXL A;  2CV2 A;  3PNT A;  3QYB A;  3S93 A;  2XC7 A;  3DEE A;  4LG3 A;  4IKF A;  1Z7L A;  3L2Q A;  4IZZ A;  2R7T A;  4F55 A;  2HVQ A;  2VXZ A;  1N75 A;  2CW8 A;  4BE1 A;  5CQE A;  2F4I A;  2JVH A;  5CKT A;  2WY7 Q;  2PJR B;  3VWB A;  2CV1 A;  2VLA A;  3H5A A;  4DJA A;  4RM3 A;  4RLQ A;  1MMN A;  4HSR A;  1V5F A;  3K4J A;  3OYI A;  4E7J A;  4Y3O A;  2DCE A;  3UR3 C;  4KT6 A;  2HPM A;  2LH9 A;  3OL4 A;  2M0M A;  4N4O B;  3K4N A;  4HEA 2;  2V1N A;  1D0Y A;  1FMW A;  2VQL A;  3DTK A;  3H9J A;  3DU5 A;  1LVK A;  2X6W A;  3LSM A;  4PUS A;  2XF6 A;  3OYK A;  3PJR A;  4CSW A;  4BJ5 C;  4NUB A;  3CJR B;  4G6T B;  4PFO A;  3KEY A;  3OS1 A;  4YEJ A;  4JOM A;  2O5R A;  3OWT A;  1AA7 A;  4CCM A;  4KIS A;  4XN0 A;  1SAU A;  4JQF A;  2L9N A;  2WB1 A;  3K10 A;  1WJB A;  4D9J A;  2X6Y A;  4GRI A;  1EA3 A;  3C2H A;  5TGT A;  3MKY B;  2XDV A;  4BDZ A;  5FRO A;  5HVQ C;  3OYH A;  5KCM A;  3QOD A;  4XOR A;  4CCO A;  3VSL A;  2IGM A;  1N77 A;  1D1B A;  3K70 D;  3CF2 A;  4XKW A;  1MNE A;  2UWM A;  3TBI A;  2W7N A;  3M8J A;  3EUK L;  4ZTJ A;  2Q1Z B;  3PL8 A;  5FRM A;  4LIT A;  2R7U A;  4RM2 A;  3L2W A;  1W36 D;  3PUB A;  2R7V A;  3K4L A;  3HL2 A;  4BQN A;  4NQW B;  3E1S A;  4YEL A;  4LIV A;  4XNF A;  4DIQ A;  2WAF A;  1D0X A;  3A1Y A;  3FHN A;  2VJ4 A;  2K5C A;  2ZSI B;  2DT6 A;  3OYC A;  2HVS A;  4ZJZ A;  1UEL B;  4HPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...