2A5WA

Crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (dsrc) from archaeoglobus fulgidus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
114
Chain Sequence
PELEVKGKKLRLDEDGFLQDWEEWDEEVAEALAKDTRFSPQPIELTEEHWKIIRYLRDYFIKYGVAPPVRMLVKHCKKEVRPDCNLQYIYKLFPQGPAKDACRIAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sulfite reductase, desulfoviridin-type subunit gamma (dsvC)
publication title X-ray structure of the gamma-subunit of a dissimilatory sulfite reductase: Fixed and flexible C-terminal arms.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 36
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2a5wA02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 2a5wA01
1JI8A 2V4JC 1SAUA 3OR1C 3OR2C 2XSJC 1YX3A 2A5WA
chains in the Genus database with same CATH superfamily
2JVHA 3H5RA 3JR9A 2D1HA 3K70D 4CCJA 5ILVA 3V4GA 3I55I 2ZJ2A 4LG0A 1T6SA 3ABTA 2WTEA 1FEXA 1DDNA 4IRHA 2HQNA 5DS9A 1SAXA 3DF8A 2EBIA 4F92B 2R7UA 5IT9K 4M3EA 1S7OA 2MBFA 4MFEA 2MH2A 3CCSI 1DP3A 2F5EA 1A6IA 1ONVA 4H4KC 4RB3C 5D6FA 1T39A 2VLAA 1GXPA 4BDZA 4BHBA 1KYZA 4B3AA 2E1MC 4UB8C 3L2VA 1O57A 3GYHX 4PZJA 3CCUI 2DFIA 3F8MA 2E19A 2LKXA 5LRRA 4MQ9F 3VODA 5HDGA 2O0YA 3M4OJ 5GPAA 2F5CA 4MEYF 4D7NA 4G6TB 4F7ZA 4EEFG 1TBXA 4HNVA 4A12A 2R7WA 3SYTA 5J1UA 2HWVA 2MLKA 4EGYA 1V5GA 4MTEA 4CCOA 3A01B 2P5VA 5DD4A 1SFOJ 3DTEA 2ID3A 1MKMA 1UFMA 1D3YA 2XGEA 3PFYA 4P9UA 3RCOA 2DT5A 3BR5A 1POGA 3E6MA 1W5SA 3RTRA 3BJOA 1T08B 4LJZF 2BEOA 4ZYDA 3W6KB 2J5OA 5HS9A 5EDNA 3L00A 1UHSA 4W97A 3TKYA 1GV2A 2F5DA 3GXOA 2MC4A 5DM7F 1KQ0A 2KZGA 1OQYA 2XDVA 1OKRA 4OU0A 2WBMA 2IS6A 4XN0A 3PNTA 2K27A 3S17J 2IBDA 2W7NA 1TWFJ 3N97A 1ZTRA 3JRCA 2IP2A 4RB0A 2DOAA 2NVYJ 2LF8A 5K7HA 2DMQA 4P9FA 4HF2A 1K6YA 4PFOA 2XF5A 2WAEA 3RKYA 1IG7A 1T95A 1ETWA 2FMLA 3KIOA 4AIHA 2ZJQF 1V4RA 4GCVA 3HOZJ 1ACIA 1Y56A 1U5TA 2FNPA 3LSIA 4XLNF 4B47A 1VQMI 3P5JA 1YE9A 2E2IJ 1P9QC 2CO5A 2LY1A 2G0EA 3VYUB 3ZMUA 1LUJB 3L1PA 1MZBA 3A1YA 4LLLA 3T8RA 4BU2A 3HL2A 5FJ8J 4CA0A 4UY8I 1H9GA 1I6HJ 3R4KA 2VE9A 4G9YA 1P92A 5IP9J 1D1BA 4IEJA 3TO6A 5EGOA 4I98B 3JRIA 3VSLA 3U9GA 4E7HA 2GA1A 5EEAA 4RA2A 3E3VA 5DCFA 3QOPA 3Q0WA 5LBQA 5FLVA 3J7ZI 3CF5F 3I59B 3SQNA 4RB1A 1J75A 4BDYA 3MKYB 3FX3A 3EYIA 5KK1A 2NVTJ 5DEQA 2IAIA 2B9SA 3HSFA 4E7SA 2LOOA 3TW7A 2NOGA 1XC5A 2L5QA 4WK8F 2VBXA 2L9NA 2HU9A 2CWEA 3DBHB 5E17F 3K4BA 1APLC 3I3LA 1R49A 2V79A 1ITYA 2LBFA 1VNDA 1GV5A 2V1NA 3EUAA 3HOSA 2A68F 5HNFA 2GM4A 2Y31A 1OCRH 1FSEA 2X1EA 3HBLA 1U9NA 3EUHC 3ZN1A 4YFXF 3DEWA 3CUQB 2HXOA 2F5FA 2XV4S 3JTHA 1P4AA 4L9JA 3RZOJ 3I53A 1JUSA 3WTYC 3HOWJ 4IHSA 2HOEA 1YRNB 2XGDA 4FQGA 4YG2F 4B44A 4CO8A 1K78A 3TEDA 2WY8Q 2GXBA 4V2FA 4U7BA 3J81K 2V9VA 2QM3A 1TLHB 1ETOA 1S9HA 2UXXA 2QCOA 2O7OA 1B4AA 1D5YA 1DU6A 2BW3A 1X1DA 2MG4A 3GTJJ 4C9YA 1T8IA 1YLFA 1JKOC 4OIQF 2O03A 1MW7A 4MEXF 2DAOA 5EZGA 1TWAJ 3R61A 5FD6A 3OYNA 2LSOA 2XSJC 1MBGA 1K7AA 4M9ZA 3DP7A 2HOAA 2A6EF 3IRRA 4PJLA 3BCAA 1XMXA 4EJOA 1ETQA 5E3OA 4ZC3A 3BZ6A 1ZK8A 4HQMA 3WTVC 4IRIA 1EH6A 4EGZA 3LSGA 1W36D 2KIUA 4L5IA 2AS5F 3HB9A 5J4YA 1W5CC 4OAZA 3PO2J 4HSTA 4KMUX 2JUGA 5DUKA 2FF4A 3KP3A 2AQEA 4HF0A 5IP7J 2H1KA 3CLQA 1HW2A 3ABLH 2W48A 3JCUC 4IXAA 1ZG3A 1YYVA 3KX2A 5K5RA 3NEUA 4XKWA 1TT0A 2WV1A 5FD5A 4HX4A 3FF5A 3G1LA 2IRFG 1OLTA 2F4OB 2E7WA 5EF6A 3GZ6A 4NC7A 1WWXA 3KE2A 2KRFA 3K4CA 4EATA 5FB2A 1IXCA 5FLMJ 4LK1F 3TDZC 1YW7A 5E1ZB 2BHYA 5FGMA 2NYXA 2UZKA 1VQPI 1W7PD 1A5JA 3F8BA 2HVQA 3C2HA 3A2KA 1QQIA 1LKXA 1O3QA 2KJCA 1BL0A 4MLOA 1YW9A 3EUHA 1YITI 2NVUB 3ECOA 1JKQC 1HLVA 1Z7UA 5TGTA 2PMUA 3QP5A 4JOMA 4N4OB 2L0KA 5D6EA 5LEKA 2H94A 3J80Z 1BW6A 4ZYAA 5AONA 2ZXIA 2X6YA 2OBPA 3ZMZA 1NG7A 3AG2H 2R5ZA 3I4PA 3CDLA 2DA4A 5KAIC 2XC7A 4WXDA 4F52A 1PYVA 1KU9A 2FD5A 3IC7A 3QU6A 1BR1A 3VPRA 2VJ4A 4PJNA 1NTCA 3CUQC 2KISA 4LLNA 4PDKA 4C2MJ 1DU0A 1U0JA 1G3WA 3RJPA 4N0BA 2TCTA 2CUEA 3KETA 1IJWC 5F27A 1BIAA 4QLCU 4DYQA 3IRQA 2PFBA 4E7KA 4PJJA 5F1JA 1O3RA 1FWZA 1FTZA 1ZGJA 4DZPA 1B1BA 2JMWA 1KQ8A 2H6CA 1V5FA 4HEA2 4XKVA 1HOMA 5TJJA 3WE3A 1XGNA 3HIFA 5B3SH 4OMZA 1YJNI 3BR3A 1QU3A 2AO9A 2DMTA 1YTYA 2L9RA 4JX4A 5IOYA 5JFRA 2CSOA 2EA4A 2JT1A 2KMUA 1Z91A 2HR3A 1G3YA 4HV6A 1ZQ3P 3W2WA 4HOBA 3D5LA 3F6OA 1B8IA 4KN7X 2FX0A 4P96A 3GFLA 3BTIA 3V42A 3IL2A 2VKHA 2OCCH 1MH3A 2IEKA 2IW5A 1SD7A 4CH7A 2VOOA 4IL6C 2O61A 1RESA 2VN2A 4R1HA 3NWTA 1E2XA 3HYIA 4Q5SF 2WB1A 1NK3P 1HCRA 2K3FA 1YO5C 1JXSA 2OQRA 1RUOA 4MO7A 1Z1DA 1RPWA 2M0CA 2NS7A 1F43A 2VT2A 1HKQA 1R00A 3GTOJ 3IP4B 2BOLA 2NS8A 4I76A 4A0XA 2KKOA 3KFWX 2Q2EB 5D4RA 2IS4A 4XOPA 3I59A 2DTRA 2MGQA 1W1WE 3H0GJ 3T5XA 2QENA 2BV6A 3A02A 3TL4X 3CD6I 1XPXA 2FA5A 3GEZA 3K70C 4A69C 1Z6TA 4D9JA 3CJNA 2K4JA 4HNTA 2OTJI 3LSKA 4BQOA 2BBYA 5CKTA 5D5VB 2FRHA 2W4SA 4KN4X 3KZYA 4CSWA 1R5GA 1SFUA 4KIBA 2Z3YA 4B43A 3BTLA 5EEHA 1PDNC 3FIWA 4CDGA 1ZRFA 4AIDA 4M6VA 3CUQA 2KFDA 3H35A 1GLNA 4KJZA 4RGXA 2GOMA 3CCQI 3OYHA 2LG4A 3FXOA 3MZHA 3IAM2 4PGHA 1YRNA 2K40A 1R6RA 1HXDA 2CQQA 2K9NA 2RN7A 3FK7A 4LMYA 3OYGA 2BY3A 4D7MA 1XSDA 4JQFA 4L0ZB 1Y1VJ 2CFOA 4FX0A 4A6EA 3AG4H 4BE2A 3IUOA 3SZGA 4HYEA 2YU9J 2EFWA 2DDAA 1FC3A 5B66C 1IRXA 2VKEA 1QHHD 3MVPA 2PJRB 1Y1WJ 3BCBA 4W1UA 1U78A 2PJPA 3FXMA 3TQNA 4ZZLA 1G4DA 3H92A 3GBGA 2K9QA 1FT9A 2XSDC 3LSTA 2L2OA 3V7RA 5LRSA 5M5XJ 5F6FA 1RUNA 3OY9A 2F5VA 3V8KA 4J01A 2JA2A 3CC7I 4KIFA 1QVUA 2QKLB 2VASA 4ZYGA 2LYCA 4DNCA 3S1MJ 2M8EA 1OYYA 2LRDA 4E7JA 3OIQA 5A2QZ 1X4PA 4M3DA 3C3WA 2X6OA 1H89C 3AAFA 2OTLI 4L5EA 5FLXZ 4EJUA 1ZLJA 3FISA 3QODA 4JX6A 3BR1A 1A6QA 1IO2A 1OCZH 2Y48A 3KLNA 4LOCA 1YX5A 1LDKB 4M6YA 3HUGB 1X3WB 2LY9A 2R7FA 3E5UA 3Q3SA 5J8CA 1YIOA 2ADUA 1J9IA 1TT5B 2CQKA 1O4XA 1QNTA 2WY7Q 2EB7A 1IV8A 3H36A 4CYDA 1VQ8I 2ZBKA 4EM0B 3CQZJ 1YIJI 1XMKA 3G6EI 4AD9A 3LA7A 2FJ1A 3DU5A 3REOA 3L2WA 1MDMA 2MA3A 3H5AA 4XK4A 4A3KJ 3H9QA 4NHJA 1GDTA 4F55A 1U5TB 4EJVA 1JTXA 3U2RA 5M3FJ 4A3JJ 3KEYA 3LOCA 1O3TA 3BG6A 3COAC 4E7IA 1W7PB 2JA8J 4V19K 3F8CA 1T98A 4HLXA 1FMVA 5J8FA 2KZVA 1LE8B 3SDGA 2BYVE 2QUFA 4GYIA 1IGNA 3WG9A 3DLLF 2Y9YA 2L4MA 1SD4A 4IVNA 1OJLA 2Y0SA 1DPUA 4DW6A 2EJRA 3OYFA 3WTXC 1JE8A 1SFKA 4XL9A 2DPUA 4RAYA 1TWCJ 2IGNA 1U8RA 3V7SA 5BQTA 4A3DJ 2X85A 2E36A 4BS9A 1JI8A 2M9HA 2N8GA 1LFBA 2E2HJ 2LLKA 3BPVA 1XSXA 3LA2A 3PQKA 2VT3A 2XAUA 1UMQA 2IA2A 2ZNYA 2A3SA 4RS8A 1H9TA 2O3FA 4KNYA 2L7MP 4BXFA 1FOYA 3HOTA 1SMTA 2JTVA 4WXCA 2WAQA 5KCMA 3K1PA 4J19A 4MGRA 4G7HF 2IT0A 5HLTA 1T33A 2JSPA 5L3DA 1X1AA 4HLYA 2DMUA 2UXNA 4RGUA 1BI2A 2RNJA 3I0TA 1FYLA 4JX5A 1D1AA 1JUMA 1I6XA 1KONA 2VJJA 1QGPA 2X4HA 5D4SA 4BBSJ 5LLQA 2GA2A 3S93A 4LITA 1IN6A 1GVJA 4XBFA 2OA4A 3Q0VA 2LMDA 2Z16A 1JTYA 5H2FC 4IKFA 4IRGA 2MD5A 3PO3J 4I0BA 4A93J 4KICA 5IYCJ 5IYDJ 1ETVA 1IN7A 1UJ8A 1D8KA 4A3BJ 3S1QJ 2JVGA 2QSGX 3FBIB 3HEFA 5FO5A 4RM3A 3TP3A 4D0PA 4PSWA 2WAFA 2ZNZA 4X1EA 3BY6A 1JJ6C 2HPIA 2ZFUA 2XB0X 2RGVA 3CESA 1WJAA 2CYYA 3ISPA 2AXLA 4NC8A 4UV8A 1BJZA 1G3SA 3NARA 4G8XA 1W36C 1FPQA 3CJRB 3K10A 1QVTA 3G1MA 2Q2EA 1GVDA 3V8LA 2E5NA 2V26A 2QF7A 2CQ7A 2W25A 2RVCA 1O7FA 3GW2A 3TDUC 5B5EC 1EF4A 2FOWA 2XVCA 3ZRGA 4JBAA 3LAJA 2Z99A 1PVEA 1Q1HA 2WB1N 5D5XB 2GWRA 4CCNA 2HZDA 3QPLA 4HPQA 3UKGA 1TL8A 4B8XA 4LIVA 3BROA 5EYRA 4DZJA 1QBJA 4S05A 1U5TC 4C2UA 1FOXA 1PP8F 1HSJA 4HX7A 4EQQA 2Y75A 3HSRA 2ZXJA 3HXLA 3O8GA 3VYTB 2EH3A 4OINF 4XICA 4FE4A 3FKIJ 3ERMA 4BQNA 2ELHA 4C30A 2FBHA 2NVQJ 3GTMJ 1DP7P 2M4KA 1FYMA 5FRNA 2OF7A 3ONQA 3B6CA 1WI3A 3G1OA 1Q1VA 1H0MA 2PJRA 4DIQA 3GO5A 1HF0A 4E4HA 2FQ4A 1D0YA 1E3OC 4Y7NJ 4RDUA 4XKBA 4AVPA 3I4NJ 3FKJA 5E79C 4KA4A 1K6OA 2QQ8A 1EH8A 3PNVA 3A0HC 1UG0A 2E34A 3CO6C 1WH7A 2R5ZB 1JKRC 1RC9A 3LWFA 5EJCA 2VJIA 2JSCA 3RKQA 4FETA 1YJ9I 3WG7H 1G8XA 2XAJA 4QWQA 3LSPA 3CCJI 1BC8C 1E17A 3KYDB 5K1YA 3K69A 3ZN0A 3S15J 1LJ9A 3GTGJ 3HPGA 1YS6A 3BZCA 3QYBA 4N4NB 1BI3A 2K3PA 3F3XA 5L3FA 1TC3C 1F4KA 2ETHA 2CG4A 3HUGA 4LLGF 3V7CA 1SAUA 2DYSH 4Z2YA 1OCOH 2EILH 2KP6A 4HQEA 4OIOF 3CCVI 3M8FA 1VF9A 3H1CA 3ZMVA 1BA5A 3I58A 5CVIA 5J1RA 3OS0A 2JPBA 2HQ5A 2JQ7A 3ZQHA 1Z7LA 3P9KA 2GXAA 2JPCA 2JA5J 5BMZA 1C0WA 1JT0A 2F4MB 4U0VA 1FMWA 2MSYA 4RAZA 5E3MA 1R1TA 1B8IB 4A0ZA 2PMZA 4O3MA 1R23A 3P7NA 3MCZA 5BNGA 2KLOA 3G4SI 1FJLA 3S3OA 5H6RA 4RMNA 5HNHA 4X0GA 4S0HB 4WX9A 5L3EA 1IRZA 2HTJA 3JW4A 1OCPA 3IWFA 2EFOA 1R1UA 1W7PA 3VSKA 1X2MA 2DQLA 2AXTC 1SD6A 3H3UA 4U88A 1U2WA 1KQ9A 2OZUA 4ON0A 2DOFA 1LE8A 4DYRA 3OYEA 4WXHA 2R7DA 1YW8A 2L7ZA 1DUXC 4RLFA 5ICCA 1TW2A 3CCEI 1SVOA 3KEOA 3PUFA 1HBXG 1VTNC 1WJDA 1T56A 2HFHA 2KL4A 4ZZDA 1VQOI 4MNUA 5CVJA 1ZHFA 3BJAA 5J6XA 3RSNA 1OPCA 3NRVA 1S5LC 3Q9SA 1IAWA 1IF1A 1VQ6I 5F0FA 2KRHA 1EA3A 5H20A 3ZXSA 5EZHA 3CP8A 5ICEA 1N77A 3R0AA 2M87A 2HS5A 2CUJA 2OD5A 4OIPF 3PL8A 2WA0A 2DK5A 4FISA 2COBA 2R7RA 2OAZA 4BHCA 2Q0OA 2I10A 3MMYB 3WU0A 3GMEA 1FZPB 1G2HA 1E3PA 1SFXA 4HAMA 3DLAA 1FIPA 4ENNA 1MBFA 4YFNF 5FROA 3D5RC 2KRCA 4KISA 2H8RA 4RGSA 1MJBA 2UWMA 2Y0SN 3FM3A 1I50J 1QZYA 1PUEE 1OCCH 2ZB9A 1MMGA 1IN4A 1I3AA 4PJ0C 1BJAA 3D0SA 5IYBJ 4DBRA 1CGPA 4I99C 3PFIA 3RKWA 5M3MJ 5C44J 1BR4A 3ML6A 3LSHA 4ENJA 1WRJA 4G94A 3OYMA 4IOAF 4IO9F 1Z3YA 5DCMB 3HHGA 4RBOA 1FOKA 1ETKA 5AIPA 3J80K 1IN5A 2DI3A 1B72B 2L9SA 3K9TA 1R1VA 2XGXA 2WAQN 1MBJA 2HDCA 1B9NA 2XB5A 3EPZA 3G2BA 3W6VA 4LD5A 4NC6A 4BUPA 1N75A 1TNTA 3JRHA 3IV5A 2QQ9A 2ZXHA 3DXJF 4XLHA 3QOEA 5KNLA 5FKLA 1XD7A 1PUFB 3BG9A 2PMHA 2KPMA 3DPLC 3OIPA 5FFXA 1BC7C 4ZJZA 5JI6A 5F0CA 2PG4A 2DMNA 4LB5A 3SDBA 5E18F 1S7AA 5E1WA 2EZLA 2KHMA 2RREA 3RYRA 1LPQA 3ECHA 3MFKA 2GBYA 5C4XJ 2V9KA 1IUYA 1Y8RB 2ZSIB 2P81A 3FXUA 3IAS2 2W85A 4UHTA 2HNHA 3OYIA 1MBHA 4GFBA 2X6WA 1SANA 2E1NA 3HHHA 2LDUA 1VQLI 2QSFX 5D5UB 2P6SA 2FSWA 5JVGF 3BTJA 1MNEA 1MDMB 5E1XA 4AYBA 2ELJA 4AIJA 2XIGA 2JWTA 2E5ZA 2E7XA 2EWNA 3ZQGA 4XIDA 3ABKH 4CCKA 2VIXA 3L7WA 1W5TA 3LSMA 5E8GA 1OCTC 3L09A 1UHMA 3NQOA 4E70A 3SXYA 3U1DA 3F8FA 4RM2A 5IPAA 4BE1A 2EQRA 2R7OA 3GFIA 2EFNA 2NVXJ 2ECCA 1WPKA 2STTA 4EJTA 5E8IA 1VQNI 1HQCA 2KIMA 5DUIA 1VQ9I 2XHKA 1IXRC 4I7HA 5D8LB 2Z1DA 1UG2A 3J7AY 2VOPA 2ELKA 1D5VA 5JHFA 1RKWA 1STZA 1WJCA 5GPCA 1QZZA 4A3MJ 5JLWA 2FU4A 1TWGJ 3F9KA 4NQWA 3H5NA 2CW0F 1WVRA 2DA6A 1ZREA 1ZELA 2LR8A 3ASNH 3GZNB 1FYKA 3LQRA 1FNNA 4XLEA 1XN7A 2BY2A 4ZYEA 4KITB 4BJTA 1LQ1A 4YIIA 3ZQIA 2XRLA 3OR2C 2DCEA 2ZMEB 2JA6J 1V5EA 2P7CB 5CVRA 3MEXA 4CGZA 3GTLJ 2ESNA 3G3ZA 3H3VK 3LAPA 3TOAA 2XRNA 2K9SA 4S04A 1WH5A 5LHHA 4XOTA 4ESBA 3X2QH 1Z77A 2W00A 2CJJA 2VQHA 3OYJA 3SZPA 2P4WA 2VBZA 1AHDP 3KP7A 4AU7A 4QIWN 1OYWA 2FOKA 3BP8A 4XN3A 3WGHA 4CZZA 2Z2SB 4Q48A 1ZGWA 4ESJA 2EK5A 2G9WA 1UHWA 4M6XA 4DOZA 1EV7A 2X1CA 3DTIA 2HZTA 3QWLA 3OYBA 4YEJA 3DPUA 1G3TA 4CCMA 1OR7C 2P7VB 4MTDA 1I27A 1TZLA 4BY7J 3LSJA 3HTSB 3OL4A 3LMMA 3JREA 4EMSA 1TW3A 4BHPA 5A2QK 4J00A 2LC2A 2ECBA 1VFCA 1R4NB 3FBNB 3PSIA 5DYMA 5FLXK 2QBYB 4KT5C 2IPQX 3IH3A 3HG9A 3RPUA 3KP2A 4LIUA 1SVLA 4BNCA 3GVAA 5JHUA 1HKSA 2DTZA 1P4WA 2P5KA 4A2UA 5IY5H 2MC3A 2D1VA 3WTUC 4UVCA 4IHVA 2DA2A 2E35A 3C1DA 2JZYA 3L9FA 3EQLF 2HDDA 1CQTA 2X6XA 3PNYA 3FWEA 1BI0A 2COMA 3ASOH 2R7QA 1LFUP 1JGGA 1XDUA 4DBQA 1HSTA 2DPDA 3W6JB 2R7SA 4HW0A 2OC6A 3DQVC 2V6CA 4F3QA 3K1MA 5CVVA 1MSFC 3DKXA 4AUXA 4II2A 1QPMA 2XASA 4NNJA 3I54A 2K86A 2LKSA 3ELKA 2OZ6A 2HOTA 2CGPA 3WE2A 2M2EA 1FLIA 2A6HF 3EDPA 3O8HA 3ZOBA 5DCMA 2UUZA 3O2PE 1WJ5A 3VFZA 3M1CA 2BHZA 4HF1A 2OUMA 2CFXA 1NK2P 4CUGA 2DT6A 3HOXJ 3BZKA 2B7EA 1B72A 1VQ5I 3WGIA 4UUTA 2L3DA 5J4VA 1G59A 1DPRA 3BWGA 3WODF 1FTTA 3K4NA 1TTYA 2W24A 3DKYA 1J7KA 3ZQCA 1PUFA 1M1EB 2K4BA 4DYCA 4G6DA 4P5OA 5LGUA 2KDZA 1E0EA 2LTPA 2VXZA 2PI0A 1R22A 1B59A 4JYKA 2ME6A 1QHGA 3KZIC 2ZJPF 2ZMEC 4QPQA 3RKXA 3F8NA 4ZTFA 2DA7A 3VEPA 2CQXA 4AIKA 2R7XA 2LK2A 3BQYA 3SFIA 2FXAA 3BG3A 4ITVA 4HDUA 2DOEA 2GIVA 1EKEA 3J7YJ 4WF2A 2HOSA 1X1CA 2FE3A 4KFCA 2MH9A 4BEHB 3WTWC 1EH7A 4CYCB 1MNMC 2F6CA 1Z3XA 1OR7A 4A0YA 3E97A 5IOZA 1X2NA 2JUCA 1RNLA 2KJBA 3OSFA 5LGTA 3GTQJ 3GLLA 4LFUA 1MIJA 1AKHB 3L2QA 4U87A 3R0JA 3OYKA 3A4CA 3AG1H 1R5ID 2W82A 5HLIA 2RV8A 3S32A 5F08A 1F5TA 2W1OA 3KYCB 4XQFA 2H27A 1BR2A 1BOBA 1RZ4A 1OISA 1JKPC 2DN0A 3SFZA 2R7VA 1WJFA 3MKZA 3S2HJ 3P9CA 2K9MA 4GYGA 4XSXF 2P8TA 3WGGA 3OYCA 3HOYJ 4M3GA 3ZQ7A 5BPDA 3HM5A 1ZLKA 4UNOA 2VQCA 1BIBA 4U7DA 3QRFF 2XPVA 3DBLB 2QKMB 3ZMTA 2RQQA 2Y30A 5DTDA 2QZ8A 2EV0A 1SFEA 3IKVA 3DBRB 4HV5A 2ZJRF 4EVIA 4KT6A 1AU7A 5F64A 4A3EJ 2M45A 3TO7A 2CW8A 4CXFA 2A05A 1Z0XA 4A6DA 2PEXA 4U0YA 1XB4A 3TBIA 4BXXJ 3RPUD 1LDDA 2FMYA 4C2TA 4MIMA 4HA8A 2O9LA 1UZCA 2QQBA 2NS0A 1P7JA 4AYBN 2H1LA 5M5YJ 3ZP5A 1TQIA 3CZ6A 3CCLI 4WWCA 3WHBA 5ILSA 1VQ7I 2Z9OA 3HSEA 5D5WB 2HPMA 3PJRA 3LNQA 1XGOA 1D0ZA 3QU3A 4ETSA 5FKKA 3KEQA 4O6JA 3QPSA 5FRMA 1L3LA 2DT7B 1J59A 3H9JA 1R4MB 2Q1ZB 3HKZA 2ZMEA 2P6TA 2LREA 3E0JB 1LB2A 3OMYA 1R36A 2A5WA 4BBRJ 2DO7A 4A5NA 1ZARA 2VJ5A 1RRJA 3VDXA 1UELB 3CLOA 1AA7A 3BR2A 1RIOH 1T2KA 2NOJB 2L4AA 1S7EA 3GF2A 4O5VA 3DWLE 3K4MA 4XMYA 3CO7C 1HDDC 1GUUA 3CDIA 2OPTA 4ENMA 4ABZA 2P0WA 1VI0A 3BC8A 3JRGA 1MH4A 1WQ2A 2V9PA 4N9HA 1MSEC 1HW1A 1B9MA 1TQMA 3M07A 3QYFA 5JR3A 2YX7A 3CCYA 4G7OF 4M72A 3S3NA 1FIAA 5C3EJ 1IRGA 3ZQLA 1BOAA 2HKXA 2Y69H 2Y0MA 3GTPJ 1YG2A 3WTSC 2X51A 1F1ZA 4KMFA 3N05A 1ZRDA 1BI1A 2K5CA 3FZVA 5ILUA 3K2AA 5K7ZA 2QBYA 2ZKZA 2R7ZJ 1YJWI 2GIZA 2XPUA 3CF2A 3F6VA 1KU2A 1ZN2A 2F48A 4HNUA 5CJ9A 4XNFA 5H6QA 1YHQI 4JK1X 3I56I 3GLXA 5L3CA 3NWSA 1SVMA 4ZDLA 2OU2A 4IX7A 1Z05A 3UR3C 2E1CA 2IS1A 3CC2I 5BOXA 2DBBA 3Q9VA 2Y2ZA 2VPRA 4Y13A 1XG1A 1B6AA 3M9AA 1IW7F 2RKHA 3BG5A 2GAUA 1R71A 4Y3OA 3WTZA 2ACJA 2I5UA 2NAZA 4PSXA 4Y33A 2TRTA 1XX5A 2EZKA 2YSRA 1YFHA 3OSGA 2ISYA 2HGCA 3C18A 1LEAA 3FK6A 3I71A 3S2WA 1A31A 4BE0A 2XGCA 1I3QJ 5HLGA 3O3KA 4IF4A 4XLPF 3EETA 3CC4I 3ZPLA 3K2ZA 2XAFA 3HC7A 1LVKA 3OWTA 4HDVA 1XDSA 4IHWA 2Z5UA 5TRDA 3HOUJ 5HODA 3E6BA 4LGWA 1WGXA 4I6ZA 2EZHA 4HX8A 4DGWB 4KUMA 5GADJ 1XSVA 2V6EA 3IWZA 4L9VA 4GXOA 3B6AA 1J0RA 2XAQA 1D1CA 1RR7A 2EFPA 3LFUA 3T0YA 1Y0UA 2X48A 3I5UA 4I09A 1SD5A 4XSZF 4L0YB 1WI9A 2D5VA 4Q47A 5AIQA 3RDIA 2AHQA 3BQZA 4B1RA 3JAMZ 3JSOA 4IHTA 3MAJA 4LB6B 1V3FA 3HPHA 4GDFA 2VONA 2YR2A 4BEHA 4NQWB 4CYCA 3AL0B 2VKDA 4BYYA 1R7JA 4UUVA 5DM6F 4ESFA 5LFAA 2HDWA 2MW8A 3FMRA 2I8DA 2LY2A 1J5YA 2QYOA 5CVUA 1ORKA 1IV6A 4L9TA 1YOVB 3HGGA 4RAFA 1AKHA 1QPIA 5BS6A 3M1EA 1K83J 2ESHA 3RQIA 2MFZA 1X58A 4NDLA 4QPOA 3JRDA 4L18B 1A04A 2GXGA 2JJ7A 4KYWA 5EG0B 4PUSA 2R0QC 2VC1A 4YIRX 4WCGA 3IKTA 3W3CA 1JHFA 3LFKA 5IT3A 1WZ2A 3GTKJ 3S16J 3HTUA 3DTKA 4AWXB 1MNDA 1Y6IA 3KCCA 5LGNA 3K4JA 4QSHA 1A36A 2K7LA 2BGCA 5E3LA 2M3AA 2CV1A 3TW6A 2LD5A 1E3HA 3PUBA 4ZTJA 1D8JA 2DLLA 5HS7A 2CUFA 3VWBA 1J09A 4BACA 4UUSB 5LD2C 1CF7B 3DFGA 4IOCF 1FOWA 5IT9Z 2DA3A 4II3A 1UCRA 1RETA 2HTSA 4KDPA 4E7LA 3EYYA 5TISC 4I02A 2X1DA 5LHIA 4M9SA 1ON2A 3MZ8A 4FASD 2PN6A 2ISZA 4DQ2A 1FSHA 2IVMA 1FP2A 1G6NA 1WSUA 4CCLA 1JGSA 2GLOA 1MGTA 4HBLA 3B02A 4BKXA 2R92J 3ZMSA 3CDHA 1IDYA 4A3CJ 1SC7A 2DJNA 4YFKF 1UB9A 2EA2A 2CU7A 3E5QA 2M5WA 3OYAA 2R93J 5HVQC 4AM3A 4XRMA 2XAHA 4C3IJ 1WFXA 2PLYA 2DMPA 1XCBA 3RPQA 2OCEA 1ZAOA 2EV6A 2M7AA 5KVRA 2L02A 3FXKA 3QP6A 3TO9A 2FBIA 2NXNB 3DCFA 4JP0A 1XGSA 1IDZA 1ZH5A 5CQEA 4I01A 1X3UA 2RQPA 3SEQA 1PJRA 4M3BA 5L3GA 2PX9A 5HLHA 5J1YA 3OYDA 1P7IA 1KU7A 2EINH 4Y4RA 3KP6A 4NUBA 4ENKA 4BGDA 2QVOA 3KP5A 4MFDA 3CJTB 1IZ1A 1AOYA 2KIFA 5CPRB 5LHGA 3PM1A 2H8WA 3JSPA 5ICFA 4DJAA 1ZR2A 6PAXA 3KYLA 2VE8A 2XAGA 3R60A 2HQAA 2EIKH 2OQGA 2HYFA 3C7JA 4EM1A 2IS2A 3L2UA 2R5YB 4PK4A 2FUG2 3HKZN 3TOBA 3QPTA 3AL0C 2R7TA 4HZFA 1K61A 1ZRCA 3WTTC 2IGOA 3IHUA 4I0AA 3OS1A 3E7LA 1PP7U 3CUOA 3S2DJ 4TV7A 3MD2A 1NG6A 3HRUA 2HVRA 3GWZA 5E3NA 3FXJA 2GZWA 2BXYA 3K4LA 1TQPA 3A0BC 1FX7A 3R6SA 4X6AJ 1JJ8C 1Y39A 1R9TJ 2H09A 4H0EA 2E60A 1NHAA 4FT8A 4RGRA 1ETXA 4XM3A 3V8JA 4BXUA 2DODA 1KYWA 3FMSA 3QYEA 4V2GA 4Q4ZF 3D1NI 4G7ZF 1FBUA 3F0CA 1O7LA 1S8NA 3HOVJ 2XKOA 4FE7A 2G7HA 1RR8C 2UV1A 2W84A 5CYVA 1KZHA 3RQ4A 1FBQA 2B63J 1Y0NA 5FKNA 1ENHA 1D0XA 2FNAA 2H6BA 3OL3A 2TDXA 2QGUA 2LVSA 2WC2A 3ERED 1W0TA 1X3ZB 2XKPA 3CTAA 3HRSA 1MBKA 3JRFA 4D1QA 2ZO4A 3F23A 5FKMA 2LF7A 4GGGA 3S14J 3MKWB 2BY0A 3OOPA 2LKPA 1BN5A 3ABUA 2EZIA 5F04A 5FKOA 4D5CA 3JTGA 2GOXB 1KA8A 2EIJH 4NB5A 1LDJA 1F36A 2DA5A 1MBEA 4BJ6C 1IC8A 4XR6A 1JT6A 2L9VA 3IH2A 3N4MA 4CHUA 2MABA 2YS9A 2K85A 2XPWA 4BL0B 1GT0C 1I1SA 3VYSB 3BJ6A 3WU1B 2V1UA 1OFCX 4R8HA 3ABMH 5GAEJ 5K5QA 4ANJA 2V1XA 3D5SC 2F2EA 2YU3A 3U21A 1LVAA 2B0LA 2DJIA 4G12A 4P55A 2R4GA 5HS8A 3J81Z 2A61A 3W2AA 1X1PA 1Z21A 2Q8KA 3BDDA 2IXSA 2BVLA 4Y15A 2ZXWH 3KZZA 2CV2A 3I4MJ 1U8BA 5GTIC 1R58A 2OV7A 4HG2A 5K7FA 2HEOA 3M3YJ 1USSA 2VBYA 3BT9A 1A35A 2VQGA 2CS3A 2A5YB 1IUFA 3I64A 1V54H 2XROA 3A01A 3CMAI 2CW7A 1XCVA 5K5OA 3OS2A 1GHCA 4BAYA 1SEUA 3IH4A 4EV0A 4UV9A 3FHZA 5EG0A 3NAUA 4M74A 2VB6A 4B3XA 3I9V2 2HI3A 2W57A 2YX4A 2HQRA 3CMYA 2RAEA 2LH9A 3FXRA 1I39A 2FEZA 3S1RJ 5GAGJ 1KGSA 5BPIA 1EJ9A 2KIQA 3G71I 4GRIA 3CMMA 4IJAA 4Z6YA 1H88C 4IPAA 1VQ4I 3AG3H 4UB6C 2LP0A 4U0WA 4M9XA 1WCMJ 2VL8A 1WKMA 4ZH4F 2QEXI 1UAAA 5D8KB 2VKVA 1T0FC 1S72I 3EUKL 1L0OC 5KAFC 3HDDA 4UUSA 1IRFA 1MD0A 2YPRA 1CF7A 3G73A 2A6TA 1ETYA 4B4CA 1H8AC 3ULQB 1XMAA 1ODDA 4OOIA 4E6KG 4A3GJ 5HDKA 1XGMA 2ZC2A 2D45A 3VYRB 5ERIA 3SEZA 1HDPA 3ESWB 1DGRM 1ZR4A 1P6RA 3CP2A 2HVSA 3H9GA 2L54A 4P1WA 2IA1A 2R3SA 2DK8A 2VQLA 2A07F 2PMZN 3MN2A 4HSRA 1ZG5A 2RDPA 1U9OA 2CRGA 4L9NA 3E5XA 4IQJA 2EIMH 2E71A 1XTAA 2XF7A 4YRVA 3SJMA 2D2WA 2ICWG 1QO0D 3OV8A 4IZZA 2KT0A 2DFHA 3TP0A 4OMYA 2DFEA 5E20A 3F22A 1F9NA 4RAGA 3LQQA 1ULYA 4PJMA 9ANTA 4IQ4A 1BM9A 5DD8A 3C2GA 3DKWA 1TNSA 2ID6A 2IA0A 2O8XA 1U6GA 3F72A 3S1NJ 3HJEA 4M71A 4ZYHA 3Q5FA 5JVTA 4ZDOA 2DU9A 2VI6A 3H0DA 2JRMA 4EJWA 1WHUA 2V4JC 3Q0UA 4KIGA 3MZYA 4BQAA 3HRTA 2MYSA 3KLOA 3P9IA 2ZFWA 1GXQA 3GZ5A 1OYIA 5C4JJ 1Z67A 3GFMA 4LG3A 1FBSA 1ON1A 1KU3A 3E6DA 2J5PA 2K02A 4XLAA 2RNGA 3GX4X 2VODA 1N78A 3FDYA 1S29A 2BXZA 4PCQA 4E7ZA 2ZSHB 3OYLA 3L2RA 3OIOA 3GCMA 4XORA 3FHNA 4OIRF 3BPXA 3B73A 3QPHA 1X1BA 5KHDA 1REPC 4IHXA 4LG0B 3HRMA 3ZQFA 1JUPA 5B1AH 5EEGA 1X4OA 3SHFA 3PIPF 2R5YA 3K7AJ 1XS9A 3BG7A 3K1NA 3T8TA 1K4SA 2A69F 2M34A 1DQUA 2WV0A 4Y17A 3LSRA 3S3MA 3FMQA 3ROUA 1P2FA 2PQ8A 3HZJA 3SZTA 4RLQA 4OAYA 2KDOA 4XONA 2QA4I 1J2XA 2M4GA 2WADA 4YIFA 1LEBA 1T0FA 3WHCA 3RI4A 5B1BH 1WJBA 2CQNA 3WU2C 3BR6A 4D5FA 2OJED 2JK3A 1USTA 2Z33A 3QAHA 2KQRA 1QZEA 2C6YA 2V7FA 2DDBA 3CJQB 1JHHA 5M5WJ 3MKLA 3QQAA 1N25A 4F91B 4BQQA 4BH9A 1YQAA 2IJLA 1P4XA 4R79A 3S8PA 2CMPA 4M3FA 3J7AO 4CICA 1MMAA 1WJEA 4MHGA 1R5HA 4A3FJ 3O6BB 1MMNA 4FCYA 3A03A 4LK0F 2IGMA 3W2VA 1IXSB 4A5MA 5F0HA 4A3LJ 2VXDA 2DA1A 2DXIA 3E6CC 2DFFA 1BBYA 4UVAA 4UXNA 2WWYA 2GQQA 2MD0A 3GUDA 2HYJA 4L5JA 2O8KA 1QRYA 2M30A 2M0MA 3FXQA 3LL7A 2BY1A 4GO1A 2O6GE 2FQ3A 3BOQA 4G6QA 1FY7A 1ZGAA 2ZCWA 3H3ZA 4XLFA 3L2CA 3RIRA 4C3JJ 3HGYA 2YUSA 5CLSA 4AC0A 1VZ0A 1W0UA 3DEUA 3ZR8X 2AQFA 3MQ0A 5L3BA 2E2JJ 2MLGA 2E1OA 5IP6A 4C3HJ 2QWWA 1HW5A 5F1RA 2L01A 5GP9A 2QQAA 3E1SA 3PIOF 3VB2A 4N9IA 4B09A 3FXLA 3MWMA 1I1GA 2VUMJ 4ZDPA 4B48A 3ZGKA 5ED4A 4IHYA 5J3LA 2K9LA 2X9DA 4XRSA 4HRIA 1X19A 1SMYF 1ERDA 4QTRA 2F4IA 1I5ZA 5EGOB 2M8GX 5CQGA 4BY1J 3CMEI 3GFJA 1S6LA 2CV0A 2VC0A 4XRFA 3CCRI 1S3JA 4YELA 2E1MB 2QSHX 2NNNA 3DEEA 3M8JA 4FHTA 1MJAA 4ASNA 2V1DA 1LFPA 4PFPA 3TMOA 5DV5A 3K6GA 1YX3A 1RKTA 3CCMI 4XRSG 4F93B 3M8EA 3VOEA 2VBWA 1MJ9A 2X0LA 5GTHC 3JRBA 4K2EA 3PQJA 2LBFB 3DV8A 3U1KA 5LEJA 1HA8A 3RZDJ 2CH0A 1Z6RA 1DGWY 2JRTA 3K0LA 5J40A 4FTHA 2DQRA 3C2BA 1ZG1A 2DW4A 1ZYRF 5HOOA 3OR1C 1IN8A 1MMDA 3TGNA 4MQVA 4CZCA 2BZTA 2VPLA 2EFQA 2Y9ZA 1Z9CA 3OOUA 2CUZA 2FBKA 4FX4A 1K79A 4Y52J 2L7KA 2HYGD 5HDNA 3M7GA 1U3EM 5ICGA 3DU6A 3KPHA 1VQKI 3AKZA 3T1BA 4XKCA 2HXIA 1T38A 1K78B 1K4TA 4RB2C 2EPFA 1QA6A 1YI2I 3UNGC 3ZQQA 1FP1D 4PGGA 3AFHA 2BVMA 2EV5A 3JAMK 4A3IJ 3PSFA 5DDGA 5FFZA 2PBIA 1BW5A 5J47A 2HKOA 4NBQA 5JLXA 1NH3A 2BW3B 2BE5F 2XF6A 2NRAC 3BTCA 3DPTA 4EM2A 3ZCOA 1ZKGA 4M73A 3F21A 1HKTA 4UVBA 1HC8A 2M7BA 2ME0A 2JN6A 2JA7J 1W4MA 5GAHJ 4XLCA 4OWRB 2LFBA 1AWCA 1LNWA 2QLZA 1YS7A 2G7UA 2LNBA 3JRAA 4AVZA 3K4KA 1OMIA 1V55H 3FM5A 3RYPA 3LA3A 1RI7A 4I2OA 2DYRH 2IGKA 2M1BA 1Y8QB 2P5LC 3KP4A 1MMSA 1TWHJ 2XUBA 2NNYA 4BJ5C 3ZMDA 2RC4A 2STWA 1TP4A 1O3SA 2L7FP 2O5RA 3BLYA 3BR0A
chains in the Genus database with same CATH topology
2JVHA 3H5RA 3SEQA 1PJRA 1V5EA 3OYDA 3K70D 2WY7Q 4CCJA 4Y4RA 4NUBA 4BGDA 4XOTA 4F92B 2R7UA 3DU5A 5CPRB 2W00A 3L2WA 3H5AA 2VQHA 3OYJA 4DJAA 3H9QA 3KYLA 4AU7A 1DP3A 2HQAA 4XN3A 4F55A 2IS2A 3L2UA 4PK4A 2FUG2 2Z2SB 4H4KC 3KEYA 3AL0C 2VLAA 3BG6A 2R7TA 4DOZA 4BDZA 4E7IA 2IGOA 2X1CA 3DTIA 3OS1A 2E1MC 3L2VA 3OYBA 3MD2A 1NG6A 3DPUA 4YEJA 4CCMA 1FMVA 1OR7C 2KZVA 2HVRA 1TZLA 3K4LA 3OL4A 3LMMA 2Y0SA 4G6TB 3OYFA 1SFKA 4J00A 2LC2A 2E60A 4XL9A 4XM3A 3FBNB 3PSIA 3SYTA 2R7WA 2IGNA 3QYEA 3HG9A 2X85A 4LIUA 4BS9A 1V5GA 1JI8A 4CCOA 2UV1A 3DTEA 3RQ4A 2XAUA 3PFYA 2X6XA 3PNYA 3RCOA 1D0XA 2R7QA 3RTRA 4BXFA 3HOTA 4DBQA 2WAQA 3OL3A 5KCMA 2R7SA 2OC6A 3DQVC 4F3QA 5HLTA 2JSPA 1X1AA 2MC4A 3DKXA 4II2A 4NNJA 4D1QA 2XDVA 2WBMA 2IS6A 4XN0A 3PNTA 1D1AA 1KONA 3MKWB 2VJJA 2W7NA 3S93A 4LITA 2DOAA 2UUZA 1K6YA 1WJ5A 2GOXB 2XF5A 2WAEA 3M1CA 4PFOA 1T95A 2OUMA 4CUGA 4BJ6C 2DT6A 2Z16A 4IKFA 4XR6A 1G59A 2MABA 1Y56A 3LSIA 4BL0B 2JVGA 3VYSB 4B47A 3FBIB 4RM3A 1YE9A 1P9QC 4PSWA 2WAFA 2LY1A 2HPIA 2ZFUA 3VYUB 4ANJA 3K4NA 3DKYA 3D5SC 3U21A 3A1YA 3CESA 2DJIA 1WJAA 4BU2A 3HL2A 2R4GA 4CA0A 4P5OA 1E0EA 4NC8A 3W2AA 1Z21A 2VXZA 2IXSA 1W36C 2BVLA 1D1BA 1QHGA 3CJRB 3K10A 2CV2A 4QPQA 4ZTFA 3VSLA 2R7XA 2E5NA 2V26A 4E7HA 2OV7A 4HG2A 4ITVA 1X1CA 2VQGA 4BEHB 4BDYA 2CS3A 3MKYB 2F6CA 1Z3XA 3ZRGA 2CW7A 3OS2A 4E7SA 2LOOA 4CCNA 2HZDA 2L5QA 4HPQA 2L9NA 4LIVA 3L2QA 4U87A 2HU9A 4C2UA 2VB6A 4B3XA 3A4CA 3I9V2 3OYKA 2W82A 3K4BA 3I3LA 3S32A 2LH9A 2LBFA 3EUAA 2V1NA 3HOSA 2W1OA 4XQFA 3HXLA 1BR2A 1BOBA 3VYTB 5HNFA 2X1EA 3CMMA 4GRIA 3EUHC 2R7VA 1WJFA 3MKZA 2K9MA 4BQNA 2VL8A 1UAAA 4C30A 1T0FC 2M4KA 3EUKL 5FRNA 3ONQA 2VQCA 2QKMB 4B44A 2RQQA 2PJRA 2A6TA 4DIQA 2WY8Q 4E4HA 4U7BA 1D0YA 4KT6A 4XKBA 1S9HA 2CW8A 4E6KG 3FKJA 3VYRB 3SEZA 1DGRM 3CP2A 2HVSA 3H9GA 4P1WA 2BW3A 1X1DA 3PNVA 3TBIA 1UG0A 2VQLA 4C9YA 3RPUD 4HSRA 1MW7A 2VJIA 4C2TA 4IQJA 2XF7A 4YRVA 4FETA 4IZZA 1G8XA 3OYNA 2XSJC 3CZ6A 4PJMA 3HPGA 4IQ4A 4PJLA 3BCAA 3QYBA 4N4NB 2HPMA 3PJRA 1D0ZA 3C2GA 4ZC3A 2K3PA 3LSGA 1W36D 5FRMA 4ZDOA 3H0DA 4OAZA 2DT7B 3H9JA 4HSTA 2Q1ZB 3HKZA 2V4JC 1SAUA 2JUGA 2LREA 3E0JB 2KP6A 3OMYA 2MYSA 2AQEA 2A5WA 3OS0A 3KX2A 4LG3A 2VJ5A 4XKWA 4XLAA 1TT0A 3VDXA 1UELB 2RNGA 1Z7LA 1AA7A 1N78A 3FDYA 4E7ZA 2ZSHB 2NOJB 3OYLA 1FMWA 1OLTA 3L2RA 4XORA 3FHNA 5KHDA 1X1BA 3DWLE 3K4MA 4NC7A 2PMZA 4XMYA 2KLOA 1X4OA 3K4CA 4EATA 3S3OA 4RMNA 2P0WA 5HNHA 4X0GA 3BC8A 3BG7A 2HVQA 3C2HA 3A2KA 1DQUA 1LKXA 3VSKA 3S3MA 3QYFA 4MLOA 3S3NA 5TGTA 4RLQA 4OAYA 4N4OB 4JOMA 3OYEA 2KDOA 4XONA 4RLFA 2M4GA 2WADA 4ZYAA 2X51A 2ZXIA 2X6YA 3N05A 1NG7A 1WJDA 2K5CA 2KL4A 1WJBA 3RSNA 2KQRA 2KRHA 2XC7A 4F52A 1EA3A 2V7FA 3ZXSA 3CF2A 1PYVA 3CJQB 3CP8A 1N77A 1BR1A 4F91B 2CUJA 2VJ4A 4PJNA 4BQQA 4HNUA 3PL8A 2WA0A 4XNFA 1U0JA 4R79A 3S8PA 2CMPA 1MMAA 2R7RA 1WJEA 3NWSA 4IX7A 4ZDLA 1MMNA 3MMYB 4PJJA 4E7KA 3UR3C 2IS1A 2IGMA 3W2VA 2VXDA 3DLAA 2DXIA 1V5FA 4HEA2 4XKVA 5FROA 3D5RC 2KRCA 4KISA 2MD0A 2UWMA 1QU3A 4Y3OA 4PSXA 4Y33A 1MMGA 2M0MA 4DBRA 2KMUA 3LL7A 1BR4A 3LSHA 3W2WA 3D5LA 3OYMA 4BE0A 4XLFA 1Z3YA 3V42A 2VKHA 1VZ0A 3ZR8X 2AQFA 3HC7A 1LVKA 3OWTA 4CH7A 2L9SA 3NWTA 2WB1A 3EPZA 3G2BA 4DGWB 3E1SA 2V6EA 4BUPA 1N75A 2ZXHA 4XLHA 3QOEA 5KNLA 3LFUA 1D1CA 4ZDPA 4B48A 3ZGKA 2K9LA 2KPMA 4HRIA 3DPLC 3OIPA 3IP4B 2BOLA 1X19A 4ZJZA 1ERDA 2F4IA 2Q2EB 2IS4A 3HPHA 5CQGA 4XOPA 3SDBA 4BEHA 4NQWB 3AL0B 2VKDA 2KHMA 2CV0A 2RREA 3TL4X 5LFAA 2HDWA 4YELA 2E1MB 2I8DA 2LY2A 4D9JA 3K70C 2V9KA 3DEEA 3M8JA 4HNTA 2ZSIB 3LSKA 4BQOA 5CKTA 3IAS2 2W4SA 1LFPA 4PFPA 3TMOA 2MFZA 3K6GA 1YX3A 4CSWA 4QPOA 2HNHA 4F93B 3OYIA 4B43A 4PUSA 2X6WA 3W3CA 2LBFB 1HA8A 3H35A 1GLNA 4KJZA 3DTKA 2GOMA 1MNDA 1Y6IA 2CH0A 1DGWY 3OYHA 3K4JA 2LG4A 3IAM2 5HOOA 3OR1C 1MNEA 2CV1A 1MMDA 2M3AA 4CZCA 2VPLA 1R6RA 4AYBA 2ELJA 3OYGA 3PUBA 4ZTJA 3OOUA 2CUZA 4JQFA 2CFOA 2E5ZA 2L7KA 3VWBA 1J09A 4BE2A 4BACA 3IUOA 3SZGA 4CCKA 3DU6A 2VIXA 5LD2C 3LSMA 3AKZA 4XKCA 1IRXA 1QHHD 2PJRB 4II3A 4RM2A 4BE1A 3BCBA 4E7LA 2R7OA 2X1DA 3UNGC 3ZQQA 3AFHA 2BVMA 3PSFA 4FASD 3GBGA 2BW3B 2XF6A 2L2OA 3DPTA 2Z1DA 3J7AY 3OY9A 2F5VA 3ZCOA 4CCLA 4J01A 2JA2A 5JHFA 1WJCA 2M7BA 2QKLB 2VASA 2LYCA 4XLCA 4OWRB 2LRDA 4E7JA 3OIQA 3F9KA 3H5NA 4AVZA 3K4KA 3OYAA 1X4PA 5HVQC 2IGKA 1ZELA 3QODA 1WFXA 4XLEA 4KITB 4BJ5C 4BJTA 2M7AA 1YX5A 1LDKB 3HUGB 3OR2C 2O5RA 2DCEA 5CQEA 3BLYA 3OYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI8 A;  2V4J C;  1SAU A;  3OR1 C;  3OR2 C;  2XSJ C;  1YX3 A;  2A5W A; 
#chains in the Genus database with same CATH topology
 2JVH A;  3H5R A;  3JR9 A;  2D1H A;  3K70 D;  4CCJ A;  5ILV A;  3V4G A;  3I55 I;  2ZJ2 A;  4LG0 A;  1T6S A;  3ABT A;  2WTE A;  1FEX A;  1DDN A;  4IRH A;  2HQN A;  5DS9 A;  1SAX A;  3DF8 A;  2EBI A;  4F92 B;  2R7U A;  5IT9 K;  4M3E A;  1S7O A;  2MBF A;  4MFE A;  2MH2 A;  3CCS I;  1DP3 A;  2F5E A;  1A6I A;  1ONV A;  4H4K C;  4RB3 C;  5D6F A;  1T39 A;  2VLA A;  1GXP A;  4BDZ A;  4BHB A;  1KYZ A;  4B3A A;  2E1M C;  4UB8 C;  3L2V A;  1O57 A;  3GYH X;  4PZJ A;  3CCU I;  2DFI A;  3F8M A;  2E19 A;  2LKX A;  5LRR A;  4MQ9 F;  3VOD A;  5HDG A;  2O0Y A;  3M4O J;  5GPA A;  2F5C A;  4MEY F;  4D7N A;  4G6T B;  4F7Z A;  4EEF G;  1TBX A;  4HNV A;  4A12 A;  2R7W A;  3SYT A;  5J1U A;  2HWV A;  2MLK A;  4EGY A;  1V5G A;  4MTE A;  4CCO A;  3A01 B;  2P5V A;  5DD4 A;  1SFO J;  3DTE A;  2ID3 A;  1MKM A;  1UFM A;  1D3Y A;  2XGE A;  3PFY A;  4P9U A;  3RCO A;  2DT5 A;  3BR5 A;  1POG A;  3E6M A;  1W5S A;  3RTR A;  3BJO A;  1T08 B;  4LJZ F;  2BEO A;  4ZYD A;  3W6K B;  2J5O A;  5HS9 A;  5EDN A;  3L00 A;  1UHS A;  4W97 A;  3TKY A;  1GV2 A;  2F5D A;  3GXO A;  2MC4 A;  5DM7 F;  1KQ0 A;  2KZG A;  1OQY A;  2XDV A;  1OKR A;  4OU0 A;  2WBM A;  2IS6 A;  4XN0 A;  3PNT A;  2K27 A;  3S17 J;  2IBD A;  2W7N A;  1TWF J;  3N97 A;  1ZTR A;  3JRC A;  2IP2 A;  4RB0 A;  2DOA A;  2NVY J;  2LF8 A;  5K7H A;  2DMQ A;  4P9F A;  4HF2 A;  1K6Y A;  4PFO A;  2XF5 A;  2WAE A;  3RKY A;  1IG7 A;  1T95 A;  1ETW A;  2FML A;  3KIO A;  4AIH A;  2ZJQ F;  1V4R A;  4GCV A;  3HOZ J;  1ACI A;  1Y56 A;  1U5T A;  2FNP A;  3LSI A;  4XLN F;  4B47 A;  1VQM I;  3P5J A;  1YE9 A;  2E2I J;  1P9Q C;  2CO5 A;  2LY1 A;  2G0E A;  3VYU B;  3ZMU A;  1LUJ B;  3L1P A;  1MZB A;  3A1Y A;  4LLL A;  3T8R A;  4BU2 A;  3HL2 A;  5FJ8 J;  4CA0 A;  4UY8 I;  1H9G A;  1I6H J;  3R4K A;  2VE9 A;  4G9Y A;  1P92 A;  5IP9 J;  1D1B A;  4IEJ A;  3TO6 A;  5EGO A;  4I98 B;  3JRI A;  3VSL A;  3U9G A;  4E7H A;  2GA1 A;  5EEA A;  4RA2 A;  3E3V A;  5DCF A;  3QOP A;  3Q0W A;  5LBQ A;  5FLV A;  3J7Z I;  3CF5 F;  3I59 B;  3SQN A;  4RB1 A;  1J75 A;  4BDY A;  3MKY B;  3FX3 A;  3EYI A;  5KK1 A;  2NVT J;  5DEQ A;  2IAI A;  2B9S A;  3HSF A;  4E7S A;  2LOO A;  3TW7 A;  2NOG A;  1XC5 A;  2L5Q A;  4WK8 F;  2VBX A;  2L9N A;  2HU9 A;  2CWE A;  3DBH B;  5E17 F;  3K4B A;  1APL C;  3I3L A;  1R49 A;  2V79 A;  1ITY A;  2LBF A;  1VND A;  1GV5 A;  2V1N A;  3EUA A;  3HOS A;  2A68 F;  5HNF A;  2GM4 A;  2Y31 A;  1OCR H;  1FSE A;  2X1E A;  3HBL A;  1U9N A;  3EUH C;  3ZN1 A;  4YFX F;  3DEW A;  3CUQ B;  2HXO A;  2F5F A;  2XV4 S;  3JTH A;  1P4A A;  4L9J A;  3RZO J;  3I53 A;  1JUS A;  3WTY C;  3HOW J;  4IHS A;  2HOE A;  1YRN B;  2XGD A;  4FQG A;  4YG2 F;  4B44 A;  4CO8 A;  1K78 A;  3TED A;  2WY8 Q;  2GXB A;  4V2F A;  4U7B A;  3J81 K;  2V9V A;  2QM3 A;  1TLH B;  1ETO A;  1S9H A;  2UXX A;  2QCO A;  2O7O A;  1B4A A;  1D5Y A;  1DU6 A;  2BW3 A;  1X1D A;  2MG4 A;  3GTJ J;  4C9Y A;  1T8I A;  1YLF A;  1JKO C;  4OIQ F;  2O03 A;  1MW7 A;  4MEX F;  2DAO A;  5EZG A;  1TWA J;  3R61 A;  5FD6 A;  3OYN A;  2LSO A;  2XSJ C;  1MBG A;  1K7A A;  4M9Z A;  3DP7 A;  2HOA A;  2A6E F;  3IRR A;  4PJL A;  3BCA A;  1XMX A;  4EJO A;  1ETQ A;  5E3O A;  4ZC3 A;  3BZ6 A;  1ZK8 A;  4HQM A;  3WTV C;  4IRI A;  1EH6 A;  4EGZ A;  3LSG A;  1W36 D;  2KIU A;  4L5I A;  2AS5 F;  3HB9 A;  5J4Y A;  1W5C C;  4OAZ A;  3PO2 J;  4HST A;  4KMU X;  2JUG A;  5DUK A;  2FF4 A;  3KP3 A;  2AQE A;  4HF0 A;  5IP7 J;  2H1K A;  3CLQ A;  1HW2 A;  3ABL H;  2W48 A;  3JCU C;  4IXA A;  1ZG3 A;  1YYV A;  3KX2 A;  5K5R A;  3NEU A;  4XKW A;  1TT0 A;  2WV1 A;  5FD5 A;  4HX4 A;  3FF5 A;  3G1L A;  2IRF G;  1OLT A;  2F4O B;  2E7W A;  5EF6 A;  3GZ6 A;  4NC7 A;  1WWX A;  3KE2 A;  2KRF A;  3K4C A;  4EAT A;  5FB2 A;  1IXC A;  5FLM J;  4LK1 F;  3TDZ C;  1YW7 A;  5E1Z B;  2BHY A;  5FGM A;  2NYX A;  2UZK A;  1VQP I;  1W7P D;  1A5J A;  3F8B A;  2HVQ A;  3C2H A;  3A2K A;  1QQI A;  1LKX A;  1O3Q A;  2KJC A;  1BL0 A;  4MLO A;  1YW9 A;  3EUH A;  1YIT I;  2NVU B;  3ECO A;  1JKQ C;  1HLV A;  1Z7U A;  5TGT A;  2PMU A;  3QP5 A;  4JOM A;  4N4O B;  2L0K A;  5D6E A;  5LEK A;  2H94 A;  3J80 Z;  1BW6 A;  4ZYA A;  5AON A;  2ZXI A;  2X6Y A;  2OBP A;  3ZMZ A;  1NG7 A;  3AG2 H;  2R5Z A;  3I4P A;  3CDL A;  2DA4 A;  5KAI C;  2XC7 A;  4WXD A;  4F52 A;  1PYV A;  1KU9 A;  2FD5 A;  3IC7 A;  3QU6 A;  1BR1 A;  3VPR A;  2VJ4 A;  4PJN A;  1NTC A;  3CUQ C;  2KIS A;  4LLN A;  4PDK A;  4C2M J;  1DU0 A;  1U0J A;  1G3W A;  3RJP A;  4N0B A;  2TCT A;  2CUE A;  3KET A;  1IJW C;  5F27 A;  1BIA A;  4QLC U;  4DYQ A;  3IRQ A;  2PFB A;  4E7K A;  4PJJ A;  5F1J A;  1O3R A;  1FWZ A;  1FTZ A;  1ZGJ A;  4DZP A;  1B1B A;  2JMW A;  1KQ8 A;  2H6C A;  1V5F A;  4HEA 2;  4XKV A;  1HOM A;  5TJJ A;  3WE3 A;  1XGN A;  3HIF A;  5B3S H;  4OMZ A;  1YJN I;  3BR3 A;  1QU3 A;  2AO9 A;  2DMT A;  1YTY A;  2L9R A;  4JX4 A;  5IOY A;  5JFR A;  2CSO A;  2EA4 A;  2JT1 A;  2KMU A;  1Z91 A;  2HR3 A;  1G3Y A;  4HV6 A;  1ZQ3 P;  3W2W A;  4HOB A;  3D5L A;  3F6O A;  1B8I A;  4KN7 X;  2FX0 A;  4P96 A;  3GFL A;  3BTI A;  3V42 A;  3IL2 A;  2VKH A;  2OCC H;  1MH3 A;  2IEK A;  2IW5 A;  1SD7 A;  4CH7 A;  2VOO A;  4IL6 C;  2O61 A;  1RES A;  2VN2 A;  4R1H A;  3NWT A;  1E2X A;  3HYI A;  4Q5S F;  2WB1 A;  1NK3 P;  1HCR A;  2K3F A;  1YO5 C;  1JXS A;  2OQR A;  1RUO A;  4MO7 A;  1Z1D A;  1RPW A;  2M0C A;  2NS7 A;  1F43 A;  2VT2 A;  1HKQ A;  1R00 A;  3GTO J;  3IP4 B;  2BOL A;  2NS8 A;  4I76 A;  4A0X A;  2KKO A;  3KFW X;  2Q2E B;  5D4R A;  2IS4 A;  4XOP A;  3I59 A;  2DTR A;  2MGQ A;  1W1W E;  3H0G J;  3T5X A;  2QEN A;  2BV6 A;  3A02 A;  3TL4 X;  3CD6 I;  1XPX A;  2FA5 A;  3GEZ A;  3K70 C;  4A69 C;  1Z6T A;  4D9J A;  3CJN A;  2K4J A;  4HNT A;  2OTJ I;  3LSK A;  4BQO A;  2BBY A;  5CKT A;  5D5V B;  2FRH A;  2W4S A;  4KN4 X;  3KZY A;  4CSW A;  1R5G A;  1SFU A;  4KIB A;  2Z3Y A;  4B43 A;  3BTL A;  5EEH A;  1PDN C;  3FIW A;  4CDG A;  1ZRF A;  4AID A;  4M6V A;  3CUQ A;  2KFD A;  3H35 A;  1GLN A;  4KJZ A;  4RGX A;  2GOM A;  3CCQ I;  3OYH A;  2LG4 A;  3FXO A;  3MZH A;  3IAM 2;  4PGH A;  1YRN A;  2K40 A;  1R6R A;  1HXD A;  2CQQ A;  2K9N A;  2RN7 A;  3FK7 A;  4LMY A;  3OYG A;  2BY3 A;  4D7M A;  1XSD A;  4JQF A;  4L0Z B;  1Y1V J;  2CFO A;  4FX0 A;  4A6E A;  3AG4 H;  4BE2 A;  3IUO A;  3SZG A;  4HYE A;  2YU9 J;  2EFW A;  2DDA A;  1FC3 A;  5B66 C;  1IRX A;  2VKE A;  1QHH D;  3MVP A;  2PJR B;  1Y1W J;  3BCB A;  4W1U A;  1U78 A;  2PJP A;  3FXM A;  3TQN A;  4ZZL A;  1G4D A;  3H92 A;  3GBG A;  2K9Q A;  1FT9 A;  2XSD C;  3LST A;  2L2O A;  3V7R A;  5LRS A;  5M5X J;  5F6F A;  1RUN A;  3OY9 A;  2F5V A;  3V8K A;  4J01 A;  2JA2 A;  3CC7 I;  4KIF A;  1QVU A;  2QKL B;  2VAS A;  4ZYG A;  2LYC A;  4DNC A;  3S1M J;  2M8E A;  1OYY A;  2LRD A;  4E7J A;  3OIQ A;  5A2Q Z;  1X4P A;  4M3D A;  3C3W A;  2X6O A;  1H89 C;  3AAF A;  2OTL I;  4L5E A;  5FLX Z;  4EJU A;  1ZLJ A;  3FIS A;  3QOD A;  4JX6 A;  3BR1 A;  1A6Q A;  1IO2 A;  1OCZ H;  2Y48 A;  3KLN A;  4LOC A;  1YX5 A;  1LDK B;  4M6Y A;  3HUG B;  1X3W B;  2LY9 A;  2R7F A;  3E5U A;  3Q3S A;  5J8C A;  1YIO A;  2ADU A;  1J9I A;  1TT5 B;  2CQK A;  1O4X A;  1QNT A;  2WY7 Q;  2EB7 A;  1IV8 A;  3H36 A;  4CYD A;  1VQ8 I;  2ZBK A;  4EM0 B;  3CQZ J;  1YIJ I;  1XMK A;  3G6E I;  4AD9 A;  3LA7 A;  2FJ1 A;  3DU5 A;  3REO A;  3L2W A;  1MDM A;  2MA3 A;  3H5A A;  4XK4 A;  4A3K J;  3H9Q A;  4NHJ A;  1GDT A;  4F55 A;  1U5T B;  4EJV A;  1JTX A;  3U2R A;  5M3F J;  4A3J J;  3KEY A;  3LOC A;  1O3T A;  3BG6 A;  3COA C;  4E7I A;  1W7P B;  2JA8 J;  4V19 K;  3F8C A;  1T98 A;  4HLX A;  1FMV A;  5J8F A;  2KZV A;  1LE8 B;  3SDG A;  2BYV E;  2QUF A;  4GYI A;  1IGN A;  3WG9 A;  3DLL F;  2Y9Y A;  2L4M A;  1SD4 A;  4IVN A;  1OJL A;  2Y0S A;  1DPU A;  4DW6 A;  2EJR A;  3OYF A;  3WTX C;  1JE8 A;  1SFK A;  4XL9 A;  2DPU A;  4RAY A;  1TWC J;  2IGN A;  1U8R A;  3V7S A;  5BQT A;  4A3D J;  2X85 A;  2E36 A;  4BS9 A;  1JI8 A;  2M9H A;  2N8G A;  1LFB A;  2E2H J;  2LLK A;  3BPV A;  1XSX A;  3LA2 A;  3PQK A;  2VT3 A;  2XAU A;  1UMQ A;  2IA2 A;  2ZNY A;  2A3S A;  4RS8 A;  1H9T A;  2O3F A;  4KNY A;  2L7M P;  4BXF A;  1FOY A;  3HOT A;  1SMT A;  2JTV A;  4WXC A;  2WAQ A;  5KCM A;  3K1P A;  4J19 A;  4MGR A;  4G7H F;  2IT0 A;  5HLT A;  1T33 A;  2JSP A;  5L3D A;  1X1A A;  4HLY A;  2DMU A;  2UXN A;  4RGU A;  1BI2 A;  2RNJ A;  3I0T A;  1FYL A;  4JX5 A;  1D1A A;  1JUM A;  1I6X A;  1KON A;  2VJJ A;  1QGP A;  2X4H A;  5D4S A;  4BBS J;  5LLQ A;  2GA2 A;  3S93 A;  4LIT A;  1IN6 A;  1GVJ A;  4XBF A;  2OA4 A;  3Q0V A;  2LMD A;  2Z16 A;  1JTY A;  5H2F C;  4IKF A;  4IRG A;  2MD5 A;  3PO3 J;  4I0B A;  4A93 J;  4KIC A;  5IYC J;  5IYD J;  1ETV A;  1IN7 A;  1UJ8 A;  1D8K A;  4A3B J;  3S1Q J;  2JVG A;  2QSG X;  3FBI B;  3HEF A;  5FO5 A;  4RM3 A;  3TP3 A;  4D0P A;  4PSW A;  2WAF A;  2ZNZ A;  4X1E A;  3BY6 A;  1JJ6 C;  2HPI A;  2ZFU A;  2XB0 X;  2RGV A;  3CES A;  1WJA A;  2CYY A;  3ISP A;  2AXL A;  4NC8 A;  4UV8 A;  1BJZ A;  1G3S A;  3NAR A;  4G8X A;  1W36 C;  1FPQ A;  3CJR B;  3K10 A;  1QVT A;  3G1M A;  2Q2E A;  1GVD A;  3V8L A;  2E5N A;  2V26 A;  2QF7 A;  2CQ7 A;  2W25 A;  2RVC A;  1O7F A;  3GW2 A;  3TDU C;  5B5E C;  1EF4 A;  2FOW A;  2XVC A;  3ZRG A;  4JBA A;  3LAJ A;  2Z99 A;  1PVE A;  1Q1H A;  2WB1 N;  5D5X B;  2GWR A;  4CCN A;  2HZD A;  3QPL A;  4HPQ A;  3UKG A;  1TL8 A;  4B8X A;  4LIV A;  3BRO A;  5EYR A;  4DZJ A;  1QBJ A;  4S05 A;  1U5T C;  4C2U A;  1FOX A;  1PP8 F;  1HSJ A;  4HX7 A;  4EQQ A;  2Y75 A;  3HSR A;  2ZXJ A;  3HXL A;  3O8G A;  3VYT B;  2EH3 A;  4OIN F;  4XIC A;  4FE4 A;  3FKI J;  3ERM A;  4BQN A;  2ELH A;  4C30 A;  2FBH A;  2NVQ J;  3GTM J;  1DP7 P;  2M4K A;  1FYM A;  5FRN A;  2OF7 A;  3ONQ A;  3B6C A;  1WI3 A;  3G1O A;  1Q1V A;  1H0M A;  2PJR A;  4DIQ A;  3GO5 A;  1HF0 A;  4E4H A;  2FQ4 A;  1D0Y A;  1E3O C;  4Y7N J;  4RDU A;  4XKB A;  4AVP A;  3I4N J;  3FKJ A;  5E79 C;  4KA4 A;  1K6O A;  2QQ8 A;  1EH8 A;  3PNV A;  3A0H C;  1UG0 A;  2E34 A;  3CO6 C;  1WH7 A;  2R5Z B;  1JKR C;  1RC9 A;  3LWF A;  5EJC A;  2VJI A;  2JSC A;  3RKQ A;  4FET A;  1YJ9 I;  3WG7 H;  1G8X A;  2XAJ A;  4QWQ A;  3LSP A;  3CCJ I;  1BC8 C;  1E17 A;  3KYD B;  5K1Y A;  3K69 A;  3ZN0 A;  3S15 J;  1LJ9 A;  3GTG J;  3HPG A;  1YS6 A;  3BZC A;  3QYB A;  4N4N B;  1BI3 A;  2K3P A;  3F3X A;  5L3F A;  1TC3 C;  1F4K A;  2ETH A;  2CG4 A;  3HUG A;  4LLG F;  3V7C A;  1SAU A;  2DYS H;  4Z2Y A;  1OCO H;  2EIL H;  2KP6 A;  4HQE A;  4OIO F;  3CCV I;  3M8F A;  1VF9 A;  3H1C A;  3ZMV A;  1BA5 A;  3I58 A;  5CVI A;  5J1R A;  3OS0 A;  2JPB A;  2HQ5 A;  2JQ7 A;  3ZQH A;  1Z7L A;  3P9K A;  2GXA A;  2JPC A;  2JA5 J;  5BMZ A;  1C0W A;  1JT0 A;  2F4M B;  4U0V A;  1FMW A;  2MSY A;  4RAZ A;  5E3M A;  1R1T A;  1B8I B;  4A0Z A;  2PMZ A;  4O3M A;  1R23 A;  3P7N A;  3MCZ A;  5BNG A;  2KLO A;  3G4S I;  1FJL A;  3S3O A;  5H6R A;  4RMN A;  5HNH A;  4X0G A;  4S0H B;  4WX9 A;  5L3E A;  1IRZ A;  2HTJ A;  3JW4 A;  1OCP A;  3IWF A;  2EFO A;  1R1U A;  1W7P A;  3VSK A;  1X2M A;  2DQL A;  2AXT C;  1SD6 A;  3H3U A;  4U88 A;  1U2W A;  1KQ9 A;  2OZU A;  4ON0 A;  2DOF A;  1LE8 A;  4DYR A;  3OYE A;  4WXH A;  2R7D A;  1YW8 A;  2L7Z A;  1DUX C;  4RLF A;  5ICC A;  1TW2 A;  3CCE I;  1SVO A;  3KEO A;  3PUF A;  1HBX G;  1VTN C;  1WJD A;  1T56 A;  2HFH A;  2KL4 A;  4ZZD A;  1VQO I;  4MNU A;  5CVJ A;  1ZHF A;  3BJA A;  5J6X A;  3RSN A;  1OPC A;  3NRV A;  1S5L C;  3Q9S A;  1IAW A;  1IF1 A;  1VQ6 I;  5F0F A;  2KRH A;  1EA3 A;  5H20 A;  3ZXS A;  5EZH A;  3CP8 A;  5ICE A;  1N77 A;  3R0A A;  2M87 A;  2HS5 A;  2CUJ A;  2OD5 A;  4OIP F;  3PL8 A;  2WA0 A;  2DK5 A;  4FIS A;  2COB A;  2R7R A;  2OAZ A;  4BHC A;  2Q0O A;  2I10 A;  3MMY B;  3WU0 A;  3GME A;  1FZP B;  1G2H A;  1E3P A;  1SFX A;  4HAM A;  3DLA A;  1FIP A;  4ENN A;  1MBF A;  4YFN F;  5FRO A;  3D5R C;  2KRC A;  4KIS A;  2H8R A;  4RGS A;  1MJB A;  2UWM A;  2Y0S N;  3FM3 A;  1I50 J;  1QZY A;  1PUE E;  1OCC H;  2ZB9 A;  1MMG A;  1IN4 A;  1I3A A;  4PJ0 C;  1BJA A;  3D0S A;  5IYB J;  4DBR A;  1CGP A;  4I99 C;  3PFI A;  3RKW A;  5M3M J;  5C44 J;  1BR4 A;  3ML6 A;  3LSH A;  4ENJ A;  1WRJ A;  4G94 A;  3OYM A;  4IOA F;  4IO9 F;  1Z3Y A;  5DCM B;  3HHG A;  4RBO A;  1FOK A;  1ETK A;  5AIP A;  3J80 K;  1IN5 A;  2DI3 A;  1B72 B;  2L9S A;  3K9T A;  1R1V A;  2XGX A;  2WAQ N;  1MBJ A;  2HDC A;  1B9N A;  2XB5 A;  3EPZ A;  3G2B A;  3W6V A;  4LD5 A;  4NC6 A;  4BUP A;  1N75 A;  1TNT A;  3JRH A;  3IV5 A;  2QQ9 A;  2ZXH A;  3DXJ F;  4XLH A;  3QOE A;  5KNL A;  5FKL A;  1XD7 A;  1PUF B;  3BG9 A;  2PMH A;  2KPM A;  3DPL C;  3OIP A;  5FFX A;  1BC7 C;  4ZJZ A;  5JI6 A;  5F0C A;  2PG4 A;  2DMN A;  4LB5 A;  3SDB A;  5E18 F;  1S7A A;  5E1W A;  2EZL A;  2KHM A;  2RRE A;  3RYR A;  1LPQ A;  3ECH A;  3MFK A;  2GBY A;  5C4X J;  2V9K A;  1IUY A;  1Y8R B;  2ZSI B;  2P81 A;  3FXU A;  3IAS 2;  2W85 A;  4UHT A;  2HNH A;  3OYI A;  1MBH A;  4GFB A;  2X6W A;  1SAN A;  2E1N A;  3HHH A;  2LDU A;  1VQL I;  2QSF X;  5D5U B;  2P6S A;  2FSW A;  5JVG F;  3BTJ A;  1MNE A;  1MDM B;  5E1X A;  4AYB A;  2ELJ A;  4AIJ A;  2XIG A;  2JWT A;  2E5Z A;  2E7X A;  2EWN A;  3ZQG A;  4XID A;  3ABK H;  4CCK A;  2VIX A;  3L7W A;  1W5T A;  3LSM A;  5E8G A;  1OCT C;  3L09 A;  1UHM A;  3NQO A;  4E70 A;  3SXY A;  3U1D A;  3F8F A;  4RM2 A;  5IPA A;  4BE1 A;  2EQR A;  2R7O A;  3GFI A;  2EFN A;  2NVX J;  2ECC A;  1WPK A;  2STT A;  4EJT A;  5E8I A;  1VQN I;  1HQC A;  2KIM A;  5DUI A;  1VQ9 I;  2XHK A;  1IXR C;  4I7H A;  5D8L B;  2Z1D A;  1UG2 A;  3J7A Y;  2VOP A;  2ELK A;  1D5V A;  5JHF A;  1RKW A;  1STZ A;  1WJC A;  5GPC A;  1QZZ A;  4A3M J;  5JLW A;  2FU4 A;  1TWG J;  3F9K A;  4NQW A;  3H5N A;  2CW0 F;  1WVR A;  2DA6 A;  1ZRE A;  1ZEL A;  2LR8 A;  3ASN H;  3GZN B;  1FYK A;  3LQR A;  1FNN A;  4XLE A;  1XN7 A;  2BY2 A;  4ZYE A;  4KIT B;  4BJT A;  1LQ1 A;  4YII A;  3ZQI A;  2XRL A;  3OR2 C;  2DCE A;  2ZME B;  2JA6 J;  1V5E A;  2P7C B;  5CVR A;  3MEX A;  4CGZ A;  3GTL J;  2ESN A;  3G3Z A;  3H3V K;  3LAP A;  3TOA A;  2XRN A;  2K9S A;  4S04 A;  1WH5 A;  5LHH A;  4XOT A;  4ESB A;  3X2Q H;  1Z77 A;  2W00 A;  2CJJ A;  2VQH A;  3OYJ A;  3SZP A;  2P4W A;  2VBZ A;  1AHD P;  3KP7 A;  4AU7 A;  4QIW N;  1OYW A;  2FOK A;  3BP8 A;  4XN3 A;  3WGH A;  4CZZ A;  2Z2S B;  4Q48 A;  1ZGW A;  4ESJ A;  2EK5 A;  2G9W A;  1UHW A;  4M6X A;  4DOZ A;  1EV7 A;  2X1C A;  3DTI A;  2HZT A;  3QWL A;  3OYB A;  4YEJ A;  3DPU A;  1G3T A;  4CCM A;  1OR7 C;  2P7V B;  4MTD A;  1I27 A;  1TZL A;  4BY7 J;  3LSJ A;  3HTS B;  3OL4 A;  3LMM A;  3JRE A;  4EMS A;  1TW3 A;  4BHP A;  5A2Q K;  4J00 A;  2LC2 A;  2ECB A;  1VFC A;  1R4N B;  3FBN B;  3PSI A;  5DYM A;  5FLX K;  2QBY B;  4KT5 C;  2IPQ X;  3IH3 A;  3HG9 A;  3RPU A;  3KP2 A;  4LIU A;  1SVL A;  4BNC A;  3GVA A;  5JHU A;  1HKS A;  2DTZ A;  1P4W A;  2P5K A;  4A2U A;  5IY5 H;  2MC3 A;  2D1V A;  3WTU C;  4UVC A;  4IHV A;  2DA2 A;  2E35 A;  3C1D A;  2JZY A;  3L9F A;  3EQL F;  2HDD A;  1CQT A;  2X6X A;  3PNY A;  3FWE A;  1BI0 A;  2COM A;  3ASO H;  2R7Q A;  1LFU P;  1JGG A;  1XDU A;  4DBQ A;  1HST A;  2DPD A;  3W6J B;  2R7S A;  4HW0 A;  2OC6 A;  3DQV C;  2V6C A;  4F3Q A;  3K1M A;  5CVV A;  1MSF C;  3DKX A;  4AUX A;  4II2 A;  1QPM A;  2XAS A;  4NNJ A;  3I54 A;  2K86 A;  2LKS A;  3ELK A;  2OZ6 A;  2HOT A;  2CGP A;  3WE2 A;  2M2E A;  1FLI A;  2A6H F;  3EDP A;  3O8H A;  3ZOB A;  5DCM A;  2UUZ A;  3O2P E;  1WJ5 A;  3VFZ A;  3M1C A;  2BHZ A;  4HF1 A;  2OUM A;  2CFX A;  1NK2 P;  4CUG A;  2DT6 A;  3HOX J;  3BZK A;  2B7E A;  1B72 A;  1VQ5 I;  3WGI A;  4UUT A;  2L3D A;  5J4V A;  1G59 A;  1DPR A;  3BWG A;  3WOD F;  1FTT A;  3K4N A;  1TTY A;  2W24 A;  3DKY A;  1J7K A;  3ZQC A;  1PUF A;  1M1E B;  2K4B A;  4DYC A;  4G6D A;  4P5O A;  5LGU A;  2KDZ A;  1E0E A;  2LTP A;  2VXZ A;  2PI0 A;  1R22 A;  1B59 A;  4JYK A;  2ME6 A;  1QHG A;  3KZI C;  2ZJP F;  2ZME C;  4QPQ A;  3RKX A;  3F8N A;  4ZTF A;  2DA7 A;  3VEP A;  2CQX A;  4AIK A;  2R7X A;  2LK2 A;  3BQY A;  3SFI A;  2FXA A;  3BG3 A;  4ITV A;  4HDU A;  2DOE A;  2GIV A;  1EKE A;  3J7Y J;  4WF2 A;  2HOS A;  1X1C A;  2FE3 A;  4KFC A;  2MH9 A;  4BEH B;  3WTW C;  1EH7 A;  4CYC B;  1MNM C;  2F6C A;  1Z3X A;  1OR7 A;  4A0Y A;  3E97 A;  5IOZ A;  1X2N A;  2JUC A;  1RNL A;  2KJB A;  3OSF A;  5LGT A;  3GTQ J;  3GLL A;  4LFU A;  1MIJ A;  1AKH B;  3L2Q A;  4U87 A;  3R0J A;  3OYK A;  3A4C A;  3AG1 H;  1R5I D;  2W82 A;  5HLI A;  2RV8 A;  3S32 A;  5F08 A;  1F5T A;  2W1O A;  3KYC B;  4XQF A;  2H27 A;  1BR2 A;  1BOB A;  1RZ4 A;  1OIS A;  1JKP C;  2DN0 A;  3SFZ A;  2R7V A;  1WJF A;  3MKZ A;  3S2H J;  3P9C A;  2K9M A;  4GYG A;  4XSX F;  2P8T A;  3WGG A;  3OYC A;  3HOY J;  4M3G A;  3ZQ7 A;  5BPD A;  3HM5 A;  1ZLK A;  4UNO A;  2VQC A;  1BIB A;  4U7D A;  3QRF F;  2XPV A;  3DBL B;  2QKM B;  3ZMT A;  2RQQ A;  2Y30 A;  5DTD A;  2QZ8 A;  2EV0 A;  1SFE A;  3IKV A;  3DBR B;  4HV5 A;  2ZJR F;  4EVI A;  4KT6 A;  1AU7 A;  5F64 A;  4A3E J;  2M45 A;  3TO7 A;  2CW8 A;  4CXF A;  2A05 A;  1Z0X A;  4A6D A;  2PEX A;  4U0Y A;  1XB4 A;  3TBI A;  4BXX J;  3RPU D;  1LDD A;  2FMY A;  4C2T A;  4MIM A;  4HA8 A;  2O9L A;  1UZC A;  2QQB A;  2NS0 A;  1P7J A;  4AYB N;  2H1L A;  5M5Y J;  3ZP5 A;  1TQI A;  3CZ6 A;  3CCL I;  4WWC A;  3WHB A;  5ILS A;  1VQ7 I;  2Z9O A;  3HSE A;  5D5W B;  2HPM A;  3PJR A;  3LNQ A;  1XGO A;  1D0Z A;  3QU3 A;  4ETS A;  5FKK A;  3KEQ A;  4O6J A;  3QPS A;  5FRM A;  1L3L A;  2DT7 B;  1J59 A;  3H9J A;  1R4M B;  2Q1Z B;  3HKZ A;  2ZME A;  2P6T A;  2LRE A;  3E0J B;  1LB2 A;  3OMY A;  1R36 A;  2A5W A;  4BBR J;  2DO7 A;  4A5N A;  1ZAR A;  2VJ5 A;  1RRJ A;  3VDX A;  1UEL B;  3CLO A;  1AA7 A;  3BR2 A;  1RIO H;  1T2K A;  2NOJ B;  2L4A A;  1S7E A;  3GF2 A;  4O5V A;  3DWL E;  3K4M A;  4XMY A;  3CO7 C;  1HDD C;  1GUU A;  3CDI A;  2OPT A;  4ENM A;  4ABZ A;  2P0W A;  1VI0 A;  3BC8 A;  3JRG A;  1MH4 A;  1WQ2 A;  2V9P A;  4N9H A;  1MSE C;  1HW1 A;  1B9M A;  1TQM A;  3M07 A;  3QYF A;  5JR3 A;  2YX7 A;  3CCY A;  4G7O F;  4M72 A;  3S3N A;  1FIA A;  5C3E J;  1IRG A;  3ZQL A;  1BOA A;  2HKX A;  2Y69 H;  2Y0M A;  3GTP J;  1YG2 A;  3WTS C;  2X51 A;  1F1Z A;  4KMF A;  3N05 A;  1ZRD A;  1BI1 A;  2K5C A;  3FZV A;  5ILU A;  3K2A A;  5K7Z A;  2QBY A;  2ZKZ A;  2R7Z J;  1YJW I;  2GIZ A;  2XPU A;  3CF2 A;  3F6V A;  1KU2 A;  1ZN2 A;  2F48 A;  4HNU A;  5CJ9 A;  4XNF A;  5H6Q A;  1YHQ I;  4JK1 X;  3I56 I;  3GLX A;  5L3C A;  3NWS A;  1SVM A;  4ZDL A;  2OU2 A;  4IX7 A;  1Z05 A;  3UR3 C;  2E1C A;  2IS1 A;  3CC2 I;  5BOX A;  2DBB A;  3Q9V A;  2Y2Z A;  2VPR A;  4Y13 A;  1XG1 A;  1B6A A;  3M9A A;  1IW7 F;  2RKH A;  3BG5 A;  2GAU A;  1R71 A;  4Y3O A;  3WTZ A;  2ACJ A;  2I5U A;  2NAZ A;  4PSX A;  4Y33 A;  2TRT A;  1XX5 A;  2EZK A;  2YSR A;  1YFH A;  3OSG A;  2ISY A;  2HGC A;  3C18 A;  1LEA A;  3FK6 A;  3I71 A;  3S2W A;  1A31 A;  4BE0 A;  2XGC A;  1I3Q J;  5HLG A;  3O3K A;  4IF4 A;  4XLP F;  3EET A;  3CC4 I;  3ZPL A;  3K2Z A;  2XAF A;  3HC7 A;  1LVK A;  3OWT A;  4HDV A;  1XDS A;  4IHW A;  2Z5U A;  5TRD A;  3HOU J;  5HOD A;  3E6B A;  4LGW A;  1WGX A;  4I6Z A;  2EZH A;  4HX8 A;  4DGW B;  4KUM A;  5GAD J;  1XSV A;  2V6E A;  3IWZ A;  4L9V A;  4GXO A;  3B6A A;  1J0R A;  2XAQ A;  1D1C A;  1RR7 A;  2EFP A;  3LFU A;  3T0Y A;  1Y0U A;  2X48 A;  3I5U A;  4I09 A;  1SD5 A;  4XSZ F;  4L0Y B;  1WI9 A;  2D5V A;  4Q47 A;  5AIQ A;  3RDI A;  2AHQ A;  3BQZ A;  4B1R A;  3JAM Z;  3JSO A;  4IHT A;  3MAJ A;  4LB6 B;  1V3F A;  3HPH A;  4GDF A;  2VON A;  2YR2 A;  4BEH A;  4NQW B;  4CYC A;  3AL0 B;  2VKD A;  4BYY A;  1R7J A;  4UUV A;  5DM6 F;  4ESF A;  5LFA A;  2HDW A;  2MW8 A;  3FMR A;  2I8D A;  2LY2 A;  1J5Y A;  2QYO A;  5CVU A;  1ORK A;  1IV6 A;  4L9T A;  1YOV B;  3HGG A;  4RAF A;  1AKH A;  1QPI A;  5BS6 A;  3M1E A;  1K83 J;  2ESH A;  3RQI A;  2MFZ A;  1X58 A;  4NDL A;  4QPO A;  3JRD A;  4L18 B;  1A04 A;  2GXG A;  2JJ7 A;  4KYW A;  5EG0 B;  4PUS A;  2R0Q C;  2VC1 A;  4YIR X;  4WCG A;  3IKT A;  3W3C A;  1JHF A;  3LFK A;  5IT3 A;  1WZ2 A;  3GTK J;  3S16 J;  3HTU A;  3DTK A;  4AWX B;  1MND A;  1Y6I A;  3KCC A;  5LGN A;  3K4J A;  4QSH A;  1A36 A;  2K7L A;  2BGC A;  5E3L A;  2M3A A;  2CV1 A;  3TW6 A;  2LD5 A;  1E3H A;  3PUB A;  4ZTJ A;  1D8J A;  2DLL A;  5HS7 A;  2CUF A;  3VWB A;  1J09 A;  4BAC A;  4UUS B;  5LD2 C;  1CF7 B;  3DFG A;  4IOC F;  1FOW A;  5IT9 Z;  2DA3 A;  4II3 A;  1UCR A;  1RET A;  2HTS A;  4KDP A;  4E7L A;  3EYY A;  5TIS C;  4I02 A;  2X1D A;  5LHI A;  4M9S A;  1ON2 A;  3MZ8 A;  4FAS D;  2PN6 A;  2ISZ A;  4DQ2 A;  1FSH A;  2IVM A;  1FP2 A;  1G6N A;  1WSU A;  4CCL A;  1JGS A;  2GLO A;  1MGT A;  4HBL A;  3B02 A;  4BKX A;  2R92 J;  3ZMS A;  3CDH A;  1IDY A;  4A3C J;  1SC7 A;  2DJN A;  4YFK F;  1UB9 A;  2EA2 A;  2CU7 A;  3E5Q A;  2M5W A;  3OYA A;  2R93 J;  5HVQ C;  4AM3 A;  4XRM A;  2XAH A;  4C3I J;  1WFX A;  2PLY A;  2DMP A;  1XCB A;  3RPQ A;  2OCE A;  1ZAO A;  2EV6 A;  2M7A A;  5KVR A;  2L02 A;  3FXK A;  3QP6 A;  3TO9 A;  2FBI A;  2NXN B;  3DCF A;  4JP0 A;  1XGS A;  1IDZ A;  1ZH5 A;  5CQE A;  4I01 A;  1X3U A;  2RQP A;  3SEQ A;  1PJR A;  4M3B A;  5L3G A;  2PX9 A;  5HLH A;  5J1Y A;  3OYD A;  1P7I A;  1KU7 A;  2EIN H;  4Y4R A;  3KP6 A;  4NUB A;  4ENK A;  4BGD A;  2QVO A;  3KP5 A;  4MFD A;  3CJT B;  1IZ1 A;  1AOY A;  2KIF A;  5CPR B;  5LHG A;  3PM1 A;  2H8W A;  3JSP A;  5ICF A;  4DJA A;  1ZR2 A;  6PAX A;  3KYL A;  2VE8 A;  2XAG A;  3R60 A;  2HQA A;  2EIK H;  2OQG A;  2HYF A;  3C7J A;  4EM1 A;  2IS2 A;  3L2U A;  2R5Y B;  4PK4 A;  2FUG 2;  3HKZ N;  3TOB A;  3QPT A;  3AL0 C;  2R7T A;  4HZF A;  1K61 A;  1ZRC A;  3WTT C;  2IGO A;  3IHU A;  4I0A A;  3OS1 A;  3E7L A;  1PP7 U;  3CUO A;  3S2D J;  4TV7 A;  3MD2 A;  1NG6 A;  3HRU A;  2HVR A;  3GWZ A;  5E3N A;  3FXJ A;  2GZW A;  2BXY A;  3K4L A;  1TQP A;  3A0B C;  1FX7 A;  3R6S A;  4X6A J;  1JJ8 C;  1Y39 A;  1R9T J;  2H09 A;  4H0E A;  2E60 A;  1NHA A;  4FT8 A;  4RGR A;  1ETX A;  4XM3 A;  3V8J A;  4BXU A;  2DOD A;  1KYW A;  3FMS A;  3QYE A;  4V2G A;  4Q4Z F;  3D1N I;  4G7Z F;  1FBU A;  3F0C A;  1O7L A;  1S8N A;  3HOV J;  2XKO A;  4FE7 A;  2G7H A;  1RR8 C;  2UV1 A;  2W84 A;  5CYV A;  1KZH A;  3RQ4 A;  1FBQ A;  2B63 J;  1Y0N A;  5FKN A;  1ENH A;  1D0X A;  2FNA A;  2H6B A;  3OL3 A;  2TDX A;  2QGU A;  2LVS A;  2WC2 A;  3ERE D;  1W0T A;  1X3Z B;  2XKP A;  3CTA A;  3HRS A;  1MBK A;  3JRF A;  4D1Q A;  2ZO4 A;  3F23 A;  5FKM A;  2LF7 A;  4GGG A;  3S14 J;  3MKW B;  2BY0 A;  3OOP A;  2LKP A;  1BN5 A;  3ABU A;  2EZI A;  5F04 A;  5FKO A;  4D5C A;  3JTG A;  2GOX B;  1KA8 A;  2EIJ H;  4NB5 A;  1LDJ A;  1F36 A;  2DA5 A;  1MBE A;  4BJ6 C;  1IC8 A;  4XR6 A;  1JT6 A;  2L9V A;  3IH2 A;  3N4M A;  4CHU A;  2MAB A;  2YS9 A;  2K85 A;  2XPW A;  4BL0 B;  1GT0 C;  1I1S A;  3VYS B;  3BJ6 A;  3WU1 B;  2V1U A;  1OFC X;  4R8H A;  3ABM H;  5GAE J;  5K5Q A;  4ANJ A;  2V1X A;  3D5S C;  2F2E A;  2YU3 A;  3U21 A;  1LVA A;  2B0L A;  2DJI A;  4G12 A;  4P55 A;  2R4G A;  5HS8 A;  3J81 Z;  2A61 A;  3W2A A;  1X1P A;  1Z21 A;  2Q8K A;  3BDD A;  2IXS A;  2BVL A;  4Y15 A;  2ZXW H;  3KZZ A;  2CV2 A;  3I4M J;  1U8B A;  5GTI C;  1R58 A;  2OV7 A;  4HG2 A;  5K7F A;  2HEO A;  3M3Y J;  1USS A;  2VBY A;  3BT9 A;  1A35 A;  2VQG A;  2CS3 A;  2A5Y B;  1IUF A;  3I64 A;  1V54 H;  2XRO A;  3A01 A;  3CMA I;  2CW7 A;  1XCV A;  5K5O A;  3OS2 A;  1GHC A;  4BAY A;  1SEU A;  3IH4 A;  4EV0 A;  4UV9 A;  3FHZ A;  5EG0 A;  3NAU A;  4M74 A;  2VB6 A;  4B3X A;  3I9V 2;  2HI3 A;  2W57 A;  2YX4 A;  2HQR A;  3CMY A;  2RAE A;  2LH9 A;  3FXR A;  1I39 A;  2FEZ A;  3S1R J;  5GAG J;  1KGS A;  5BPI A;  1EJ9 A;  2KIQ A;  3G71 I;  4GRI A;  3CMM A;  4IJA A;  4Z6Y A;  1H88 C;  4IPA A;  1VQ4 I;  3AG3 H;  4UB6 C;  2LP0 A;  4U0W A;  4M9X A;  1WCM J;  2VL8 A;  1WKM A;  4ZH4 F;  2QEX I;  1UAA A;  5D8K B;  2VKV A;  1T0F C;  1S72 I;  3EUK L;  1L0O C;  5KAF C;  3HDD A;  4UUS A;  1IRF A;  1MD0 A;  2YPR A;  1CF7 A;  3G73 A;  2A6T A;  1ETY A;  4B4C A;  1H8A C;  3ULQ B;  1XMA A;  1ODD A;  4OOI A;  4E6K G;  4A3G J;  5HDK A;  1XGM A;  2ZC2 A;  2D45 A;  3VYR B;  5ERI A;  3SEZ A;  1HDP A;  3ESW B;  1DGR M;  1ZR4 A;  1P6R A;  3CP2 A;  2HVS A;  3H9G A;  2L54 A;  4P1W A;  2IA1 A;  2R3S A;  2DK8 A;  2VQL A;  2A07 F;  2PMZ N;  3MN2 A;  4HSR A;  1ZG5 A;  2RDP A;  1U9O A;  2CRG A;  4L9N A;  3E5X A;  4IQJ A;  2EIM H;  2E71 A;  1XTA A;  2XF7 A;  4YRV A;  3SJM A;  2D2W A;  2ICW G;  1QO0 D;  3OV8 A;  4IZZ A;  2KT0 A;  2DFH A;  3TP0 A;  4OMY A;  2DFE A;  5E20 A;  3F22 A;  1F9N A;  4RAG A;  3LQQ A;  1ULY A;  4PJM A;  9ANT A;  4IQ4 A;  1BM9 A;  5DD8 A;  3C2G A;  3DKW A;  1TNS A;  2ID6 A;  2IA0 A;  2O8X A;  1U6G A;  3F72 A;  3S1N J;  3HJE A;  4M71 A;  4ZYH A;  3Q5F A;  5JVT A;  4ZDO A;  2DU9 A;  2VI6 A;  3H0D A;  2JRM A;  4EJW A;  1WHU A;  2V4J C;  3Q0U A;  4KIG A;  3MZY A;  4BQA A;  3HRT A;  2MYS A;  3KLO A;  3P9I A;  2ZFW A;  1GXQ A;  3GZ5 A;  1OYI A;  5C4J J;  1Z67 A;  3GFM A;  4LG3 A;  1FBS A;  1ON1 A;  1KU3 A;  3E6D A;  2J5P A;  2K02 A;  4XLA A;  2RNG A;  3GX4 X;  2VOD A;  1N78 A;  3FDY A;  1S29 A;  2BXZ A;  4PCQ A;  4E7Z A;  2ZSH B;  3OYL A;  3L2R A;  3OIO A;  3GCM A;  4XOR A;  3FHN A;  4OIR F;  3BPX A;  3B73 A;  3QPH A;  1X1B A;  5KHD A;  1REP C;  4IHX A;  4LG0 B;  3HRM A;  3ZQF A;  1JUP A;  5B1A H;  5EEG A;  1X4O A;  3SHF A;  3PIP F;  2R5Y A;  3K7A J;  1XS9 A;  3BG7 A;  3K1N A;  3T8T A;  1K4S A;  2A69 F;  2M34 A;  1DQU A;  2WV0 A;  4Y17 A;  3LSR A;  3S3M A;  3FMQ A;  3ROU A;  1P2F A;  2PQ8 A;  3HZJ A;  3SZT A;  4RLQ A;  4OAY A;  2KDO A;  4XON A;  2QA4 I;  1J2X A;  2M4G A;  2WAD A;  4YIF A;  1LEB A;  1T0F A;  3WHC A;  3RI4 A;  5B1B H;  1WJB A;  2CQN A;  3WU2 C;  3BR6 A;  4D5F A;  2OJE D;  2JK3 A;  1UST A;  2Z33 A;  3QAH A;  2KQR A;  1QZE A;  2C6Y A;  2V7F A;  2DDB A;  3CJQ B;  1JHH A;  5M5W J;  3MKL A;  3QQA A;  1N25 A;  4F91 B;  4BQQ A;  4BH9 A;  1YQA A;  2IJL A;  1P4X A;  4R79 A;  3S8P A;  2CMP A;  4M3F A;  3J7A O;  4CIC A;  1MMA A;  1WJE A;  4MHG A;  1R5H A;  4A3F J;  3O6B B;  1MMN A;  4FCY A;  3A03 A;  4LK0 F;  2IGM A;  3W2V A;  1IXS B;  4A5M A;  5F0H A;  4A3L J;  2VXD A;  2DA1 A;  2DXI A;  3E6C C;  2DFF A;  1BBY A;  4UVA A;  4UXN A;  2WWY A;  2GQQ A;  2MD0 A;  3GUD A;  2HYJ A;  4L5J A;  2O8K A;  1QRY A;  2M30 A;  2M0M A;  3FXQ A;  3LL7 A;  2BY1 A;  4GO1 A;  2O6G E;  2FQ3 A;  3BOQ A;  4G6Q A;  1FY7 A;  1ZGA A;  2ZCW A;  3H3Z A;  4XLF A;  3L2C A;  3RIR A;  4C3J J;  3HGY A;  2YUS A;  5CLS A;  4AC0 A;  1VZ0 A;  1W0U A;  3DEU A;  3ZR8 X;  2AQF A;  3MQ0 A;  5L3B A;  2E2J J;  2MLG A;  2E1O A;  5IP6 A;  4C3H J;  2QWW A;  1HW5 A;  5F1R A;  2L01 A;  5GP9 A;  2QQA A;  3E1S A;  3PIO F;  3VB2 A;  4N9I A;  4B09 A;  3FXL A;  3MWM A;  1I1G A;  2VUM J;  4ZDP A;  4B48 A;  3ZGK A;  5ED4 A;  4IHY A;  5J3L A;  2K9L A;  2X9D A;  4XRS A;  4HRI A;  1X19 A;  1SMY F;  1ERD A;  4QTR A;  2F4I A;  1I5Z A;  5EGO B;  2M8G X;  5CQG A;  4BY1 J;  3CME I;  3GFJ A;  1S6L A;  2CV0 A;  2VC0 A;  4XRF A;  3CCR I;  1S3J A;  4YEL A;  2E1M B;  2QSH X;  2NNN A;  3DEE A;  3M8J A;  4FHT A;  1MJA A;  4ASN A;  2V1D A;  1LFP A;  4PFP A;  3TMO A;  5DV5 A;  3K6G A;  1YX3 A;  1RKT A;  3CCM I;  4XRS G;  4F93 B;  3M8E A;  3VOE A;  2VBW A;  1MJ9 A;  2X0L A;  5GTH C;  3JRB A;  4K2E A;  3PQJ A;  2LBF B;  3DV8 A;  3U1K A;  5LEJ A;  1HA8 A;  3RZD J;  2CH0 A;  1Z6R A;  1DGW Y;  2JRT A;  3K0L A;  5J40 A;  4FTH A;  2DQR A;  3C2B A;  1ZG1 A;  2DW4 A;  1ZYR F;  5HOO A;  3OR1 C;  1IN8 A;  1MMD A;  3TGN A;  4MQV A;  4CZC A;  2BZT A;  2VPL A;  2EFQ A;  2Y9Z A;  1Z9C A;  3OOU A;  2CUZ A;  2FBK A;  4FX4 A;  1K79 A;  4Y52 J;  2L7K A;  2HYG D;  5HDN A;  3M7G A;  1U3E M;  5ICG A;  3DU6 A;  3KPH A;  1VQK I;  3AKZ A;  3T1B A;  4XKC A;  2HXI A;  1T38 A;  1K78 B;  1K4T A;  4RB2 C;  2EPF A;  1QA6 A;  1YI2 I;  3UNG C;  3ZQQ A;  1FP1 D;  4PGG A;  3AFH A;  2BVM A;  2EV5 A;  3JAM K;  4A3I J;  3PSF A;  5DDG A;  5FFZ A;  2PBI A;  1BW5 A;  5J47 A;  2HKO A;  4NBQ A;  5JLX A;  1NH3 A;  2BW3 B;  2BE5 F;  2XF6 A;  2NRA C;  3BTC A;  3DPT A;  4EM2 A;  3ZCO A;  1ZKG A;  4M73 A;  3F21 A;  1HKT A;  4UVB A;  1HC8 A;  2M7B A;  2ME0 A;  2JN6 A;  2JA7 J;  1W4M A;  5GAH J;  4XLC A;  4OWR B;  2LFB A;  1AWC A;  1LNW A;  2QLZ A;  1YS7 A;  2G7U A;  2LNB A;  3JRA A;  4AVZ A;  3K4K A;  1OMI A;  1V55 H;  3FM5 A;  3RYP A;  3LA3 A;  1RI7 A;  4I2O A;  2DYR H;  2IGK A;  2M1B A;  1Y8Q B;  2P5L C;  3KP4 A;  1MMS A;  1TWH J;  2XUB A;  2NNY A;  4BJ5 C;  3ZMD A;  2RC4 A;  2STW A;  1TP4 A;  1O3S A;  2L7F P;  2O5R A;  3BLY A;  3BR0 A; 
#chains in the Genus database with same CATH homology
 2JVH A;  3H5R A;  3SEQ A;  1PJR A;  1V5E A;  3OYD A;  3K70 D;  2WY7 Q;  4CCJ A;  4Y4R A;  4NUB A;  4BGD A;  4XOT A;  4F92 B;  2R7U A;  3DU5 A;  5CPR B;  2W00 A;  3L2W A;  3H5A A;  2VQH A;  3OYJ A;  4DJA A;  3H9Q A;  3KYL A;  4AU7 A;  1DP3 A;  2HQA A;  4XN3 A;  4F55 A;  2IS2 A;  3L2U A;  4PK4 A;  2FUG 2;  2Z2S B;  4H4K C;  3KEY A;  3AL0 C;  2VLA A;  3BG6 A;  2R7T A;  4DOZ A;  4BDZ A;  4E7I A;  2IGO A;  2X1C A;  3DTI A;  3OS1 A;  2E1M C;  3L2V A;  3OYB A;  3MD2 A;  1NG6 A;  3DPU A;  4YEJ A;  4CCM A;  1FMV A;  1OR7 C;  2KZV A;  2HVR A;  1TZL A;  3K4L A;  3OL4 A;  3LMM A;  2Y0S A;  4G6T B;  3OYF A;  1SFK A;  4J00 A;  2LC2 A;  2E60 A;  4XL9 A;  4XM3 A;  3FBN B;  3PSI A;  3SYT A;  2R7W A;  2IGN A;  3QYE A;  3HG9 A;  2X85 A;  4LIU A;  4BS9 A;  1V5G A;  1JI8 A;  4CCO A;  2UV1 A;  3DTE A;  3RQ4 A;  2XAU A;  3PFY A;  2X6X A;  3PNY A;  3RCO A;  1D0X A;  2R7Q A;  3RTR A;  4BXF A;  3HOT A;  4DBQ A;  2WAQ A;  3OL3 A;  5KCM A;  2R7S A;  2OC6 A;  3DQV C;  4F3Q A;  5HLT A;  2JSP A;  1X1A A;  2MC4 A;  3DKX A;  4II2 A;  4NNJ A;  4D1Q A;  2XDV A;  2WBM A;  2IS6 A;  4XN0 A;  3PNT A;  1D1A A;  1KON A;  3MKW B;  2VJJ A;  2W7N A;  3S93 A;  4LIT A;  2DOA A;  2UUZ A;  1K6Y A;  1WJ5 A;  2GOX B;  2XF5 A;  2WAE A;  3M1C A;  4PFO A;  1T95 A;  2OUM A;  4CUG A;  4BJ6 C;  2DT6 A;  2Z16 A;  4IKF A;  4XR6 A;  1G59 A;  2MAB A;  1Y56 A;  3LSI A;  4BL0 B;  2JVG A;  3VYS B;  4B47 A;  3FBI B;  4RM3 A;  1YE9 A;  1P9Q C;  4PSW A;  2WAF A;  2LY1 A;  2HPI A;  2ZFU A;  3VYU B;  4ANJ A;  3K4N A;  3DKY A;  3D5S C;  3U21 A;  3A1Y A;  3CES A;  2DJI A;  1WJA A;  4BU2 A;  3HL2 A;  2R4G A;  4CA0 A;  4P5O A;  1E0E A;  4NC8 A;  3W2A A;  1Z21 A;  2VXZ A;  2IXS A;  1W36 C;  2BVL A;  1D1B A;  1QHG A;  3CJR B;  3K10 A;  2CV2 A;  4QPQ A;  4ZTF A;  3VSL A;  2R7X A;  2E5N A;  2V26 A;  4E7H A;  2OV7 A;  4HG2 A;  4ITV A;  1X1C A;  2VQG A;  4BEH B;  4BDY A;  2CS3 A;  3MKY B;  2F6C A;  1Z3X A;  3ZRG A;  2CW7 A;  3OS2 A;  4E7S A;  2LOO A;  4CCN A;  2HZD A;  2L5Q A;  4HPQ A;  2L9N A;  4LIV A;  3L2Q A;  4U87 A;  2HU9 A;  4C2U A;  2VB6 A;  4B3X A;  3A4C A;  3I9V 2;  3OYK A;  2W82 A;  3K4B A;  3I3L A;  3S32 A;  2LH9 A;  2LBF A;  3EUA A;  2V1N A;  3HOS A;  2W1O A;  4XQF A;  3HXL A;  1BR2 A;  1BOB A;  3VYT B;  5HNF A;  2X1E A;  3CMM A;  4GRI A;  3EUH C;  2R7V A;  1WJF A;  3MKZ A;  2K9M A;  4BQN A;  2VL8 A;  1UAA A;  4C30 A;  1T0F C;  2M4K A;  3EUK L;  5FRN A;  3ONQ A;  2VQC A;  2QKM B;  4B44 A;  2RQQ A;  2PJR A;  2A6T A;  4DIQ A;  2WY8 Q;  4E4H A;  4U7B A;  1D0Y A;  4KT6 A;  4XKB A;  1S9H A;  2CW8 A;  4E6K G;  3FKJ A;  3VYR B;  3SEZ A;  1DGR M;  3CP2 A;  2HVS A;  3H9G A;  4P1W A;  2BW3 A;  1X1D A;  3PNV A;  3TBI A;  1UG0 A;  2VQL A;  4C9Y A;  3RPU D;  4HSR A;  1MW7 A;  2VJI A;  4C2T A;  4IQJ A;  2XF7 A;  4YRV A;  4FET A;  4IZZ A;  1G8X A;  3OYN A;  2XSJ C;  3CZ6 A;  4PJM A;  3HPG A;  4IQ4 A;  4PJL A;  3BCA A;  3QYB A;  4N4N B;  2HPM A;  3PJR A;  1D0Z A;  3C2G A;  4ZC3 A;  2K3P A;  3LSG A;  1W36 D;  5FRM A;  4ZDO A;  3H0D A;  4OAZ A;  2DT7 B;  3H9J A;  4HST A;  2Q1Z B;  3HKZ A;  2V4J C;  1SAU A;  2JUG A;  2LRE A;  3E0J B;  2KP6 A;  3OMY A;  2MYS A;  2AQE A;  2A5W A;  3OS0 A;  3KX2 A;  4LG3 A;  2VJ5 A;  4XKW A;  4XLA A;  1TT0 A;  3VDX A;  1UEL B;  2RNG A;  1Z7L A;  1AA7 A;  1N78 A;  3FDY A;  4E7Z A;  2ZSH B;  2NOJ B;  3OYL A;  1FMW A;  1OLT A;  3L2R A;  4XOR A;  3FHN A;  5KHD A;  1X1B A;  3DWL E;  3K4M A;  4NC7 A;  2PMZ A;  4XMY A;  2KLO A;  1X4O A;  3K4C A;  4EAT A;  3S3O A;  4RMN A;  2P0W A;  5HNH A;  4X0G A;  3BC8 A;  3BG7 A;  2HVQ A;  3C2H A;  3A2K A;  1DQU A;  1LKX A;  3VSK A;  3S3M A;  3QYF A;  4MLO A;  3S3N A;  5TGT A;  4RLQ A;  4OAY A;  4N4O B;  4JOM A;  3OYE A;  2KDO A;  4XON A;  4RLF A;  2M4G A;  2WAD A;  4ZYA A;  2X51 A;  2ZXI A;  2X6Y A;  3N05 A;  1NG7 A;  1WJD A;  2K5C A;  2KL4 A;  1WJB A;  3RSN A;  2KQR A;  2KRH A;  2XC7 A;  4F52 A;  1EA3 A;  2V7F A;  3ZXS A;  3CF2 A;  1PYV A;  3CJQ B;  3CP8 A;  1N77 A;  1BR1 A;  4F91 B;  2CUJ A;  2VJ4 A;  4PJN A;  4BQQ A;  4HNU A;  3PL8 A;  2WA0 A;  4XNF A;  1U0J A;  4R79 A;  3S8P A;  2CMP A;  1MMA A;  2R7R A;  1WJE A;  3NWS A;  4IX7 A;  4ZDL A;  1MMN A;  3MMY B;  4PJJ A;  4E7K A;  3UR3 C;  2IS1 A;  2IGM A;  3W2V A;  2VXD A;  3DLA A;  2DXI A;  1V5F A;  4HEA 2;  4XKV A;  5FRO A;  3D5R C;  2KRC A;  4KIS A;  2MD0 A;  2UWM A;  1QU3 A;  4Y3O A;  4PSX A;  4Y33 A;  1MMG A;  2M0M A;  4DBR A;  2KMU A;  3LL7 A;  1BR4 A;  3LSH A;  3W2W A;  3D5L A;  3OYM A;  4BE0 A;  4XLF A;  1Z3Y A;  3V42 A;  2VKH A;  1VZ0 A;  3ZR8 X;  2AQF A;  3HC7 A;  1LVK A;  3OWT A;  4CH7 A;  2L9S A;  3NWT A;  2WB1 A;  3EPZ A;  3G2B A;  4DGW B;  3E1S A;  2V6E A;  4BUP A;  1N75 A;  2ZXH A;  4XLH A;  3QOE A;  5KNL A;  3LFU A;  1D1C A;  4ZDP A;  4B48 A;  3ZGK A;  2K9L A;  2KPM A;  4HRI A;  3DPL C;  3OIP A;  3IP4 B;  2BOL A;  1X19 A;  4ZJZ A;  1ERD A;  2F4I A;  2Q2E B;  2IS4 A;  3HPH A;  5CQG A;  4XOP A;  3SDB A;  4BEH A;  4NQW B;  3AL0 B;  2VKD A;  2KHM A;  2CV0 A;  2RRE A;  3TL4 X;  5LFA A;  2HDW A;  4YEL A;  2E1M B;  2I8D A;  2LY2 A;  4D9J A;  3K70 C;  2V9K A;  3DEE A;  3M8J A;  4HNT A;  2ZSI B;  3LSK A;  4BQO A;  5CKT A;  3IAS 2;  2W4S A;  1LFP A;  4PFP A;  3TMO A;  2MFZ A;  3K6G A;  1YX3 A;  4CSW A;  4QPO A;  2HNH A;  4F93 B;  3OYI A;  4B43 A;  4PUS A;  2X6W A;  3W3C A;  2LBF B;  1HA8 A;  3H35 A;  1GLN A;  4KJZ A;  3DTK A;  2GOM A;  1MND A;  1Y6I A;  2CH0 A;  1DGW Y;  3OYH A;  3K4J A;  2LG4 A;  3IAM 2;  5HOO A;  3OR1 C;  1MNE A;  2CV1 A;  1MMD A;  2M3A A;  4CZC A;  2VPL A;  1R6R A;  4AYB A;  2ELJ A;  3OYG A;  3PUB A;  4ZTJ A;  3OOU A;  2CUZ A;  4JQF A;  2CFO A;  2E5Z A;  2L7K A;  3VWB A;  1J09 A;  4BE2 A;  4BAC A;  3IUO A;  3SZG A;  4CCK A;  3DU6 A;  2VIX A;  5LD2 C;  3LSM A;  3AKZ A;  4XKC A;  1IRX A;  1QHH D;  2PJR B;  4II3 A;  4RM2 A;  4BE1 A;  3BCB A;  4E7L A;  2R7O A;  2X1D A;  3UNG C;  3ZQQ A;  3AFH A;  2BVM A;  3PSF A;  4FAS D;  3GBG A;  2BW3 B;  2XF6 A;  2L2O A;  3DPT A;  2Z1D A;  3J7A Y;  3OY9 A;  2F5V A;  3ZCO A;  4CCL A;  4J01 A;  2JA2 A;  5JHF A;  1WJC A;  2M7B A;  2QKL B;  2VAS A;  2LYC A;  4XLC A;  4OWR B;  2LRD A;  4E7J A;  3OIQ A;  3F9K A;  3H5N A;  4AVZ A;  3K4K A;  3OYA A;  1X4P A;  5HVQ C;  2IGK A;  1ZEL A;  3QOD A;  1WFX A;  4XLE A;  4KIT B;  4BJ5 C;  4BJT A;  2M7A A;  1YX5 A;  1LDK B;  3HUG B;  3OR2 C;  2O5R A;  2DCE A;  5CQE A;  3BLY A;  3OYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...