2ECBA

The solution structure of the third homeobox domain of human zinc fingers and homeoboxes protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc fingers and homeoboxes protein 1
publication title The solution structure of the third homeobox domain of human Zinc fingers and homeoboxes protein
rcsb
source organism Homo sapiens
total genus 14
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ecbA01
1RKWA 3OSFA 4CYCB 2XRLA 4QIWN 2XB0X 1ETWA 5IYBJ 5IYDJ 2E19A 1F36A 3UKGA 4MO7A 1MBHA 2IBDA 5M5XJ 2ELKA 2H1KA 2DTZA 3S1MJ 4CYCA 3S17J 1XS9A 2LD5A 2K9SA 1POGA 3JRDA 5GPAA 3JRAA 2E1OA 5J3LA 1Y1WJ 2JMWA 5E3OA 4D5FA 1RPWA 2DMQA 3PM1A 1ZR4A 2X9DA 1BL0A 2YS9A 1A6IA 1MNMC 2DA7A 3HBLA 3QQAA 4A3KJ 1G2HA 2HOAA 3HOUJ 2QCOA 4Y52J 3LSGA 1ETKA 2IAIA 2EH3A 1MH4A 4D7NA 2COBA 3S2HJ 4G12A 4A93J 3OOUA 1HOMA 4C3IJ 1HCRA 2DN0A 3NAUA 2MSYA 1X2MA 5EEAA 3SJMA 2ECCA 2LK2A 2HDDA 1JUSA 1IGNA 3ZQGA 5K7HA 2FD5A 2DMTA 3HOZJ 4BBRJ 4EEFG 2M0CA 1P7JA 5M5WJ 3B6CA 1Q1VA 4BBSJ 1GV5A 2N8GA 4DYQA 2AO9A 1NK3P 3ZQHA 1RR7A 5J1RA 1U8BA 4DW6A 3PO2J 1MBKA 3B6AA 4V2FA 3HDDA 1T33A 2YUSA 5IOYA 2FQ4A 3SFIA 1D5YA 2XPUA 3GTGJ 1FTZA 1IC8A 1APLC 2VKVA 4M3GA 3JRBA 1MBJA 4MFDA 3BG5A 1WI3A 4UUSA 2EBIA 4I6ZA 3BTLA 4I76A 2HI3A 3VPRA 3BTCA 3H3VK 4FCYA 4W1UA 3WHBA 2VUMJ 2FX0A 1JUMA 2CJJA 3FKIJ 4A3DJ 3GTKJ 1S7EA 1TWAJ 2ME6A 3HOYJ 1WH7A 2LVSA 2B63J 2CUEA 1O4XA 5E3NA 1ZKGA 1IJWC 3RQIA 2CU7A 1XG1A 1AU7A 4A3GJ 5JLWA 1FEXA 2WAQN 1VI0A 2E2HJ 1TWHJ 4JYKA 4D5CA 5IP6A 3C2BA 1RKTA 3ZQLA 1JKRC 3K7AJ 2KT0A 2L7MP 5EG0B 2M9HA 2H8RA 1GUUA 4LOCA 1I6HJ 2PMZN 1Z0XA 3K2AA 2DMPA 2CQXA 1X2NA 2WV1A 4V2GA 2LY9A 5K7FA 1HDPA 1CQTA 5EG0A 1VFCA 4DZJA 4RBOA 2R0QC 1LE8B 1IDZA 1DU0A 2O8KA 1F43A 1WH5A 1I50J 2K40A 1BA5A 2M2EA 3IH4A 1ZK8A 4A3EJ 1IG7A 4M3BA 1SFOJ 2LR8A 3L1PA 2Y30A 2JK3A 5FKKA 2ID6A 5BNGA 1U78A 1LE8A 4DZPA 3FK7A 2XPVA 1H8AC 2DA1A 5EZHA 3HOWJ 2OF7A 3PO3J 1K83J 1TWCJ 4A3LJ 1OCTC 1A5JA 1QRYA 2DJNA 3A03A 3JRIA 4J19A 2NS7A 4JX5A 2LP0A 3A02A 3SDGA 1AKHB 1OFCX 1T56A 2O7OA 3LSJA 3HOXJ 3HGGA 3Q0UA 4IHYA 3FIWA 5M5YJ 1TWFJ 3MN2A 3MVPA 3HM5A 2X6OA 1JJ6C 3CQZJ 2LFBA 4BKXA 1AKHA 5HODA 3NARA 5FKLA 2HYJA 5IPAA 1R9TJ 1IUFA 3LOCA 3IH2A 3TW7A 1JUPA 3S1RJ 3MKLA 5J1UA 3M3YJ 3Q3SA 1LFBA 2LTPA 4A3MJ 5IP9J 3DEWA 2R93J 1ZQ3P 3HEFA 2W48A 1JGGA 1AHDP 5F08A 2EZHA 2TRTA 4UUTA 5E3LA 3D1NI 4A3JJ 4C3JJ 3BG9A 3HB9A 4BXXJ 3A01B 2EZKA 3GBGA 1JKPC 2NS8A 1E3OC 5C3EJ 1FJLA 3GTOJ 5FKNA 2FJ1A 3JRHA 3G1LA 3BR3A 2XSDC 4IHVA 1ORKA 2IEKA 4JP0A 2EZLA 3IH3A 1B72B 5GP9A 5F04A 3Q0WA 3BTJA 4FE4A 5FJ8J 2DA2A 2XGCA 5IOZA 2Y9YA 1SANA 2DMNA 5FLMJ 2AHQA 1UG2A 4A69C 1GV2A 1B72A 3CMYA 2DA3A 1LFUP 1XC5A 2X48A 1WCMJ 2JWTA 4A3CJ 2R5YB 1UHSA 1ZGWA 3I4MJ 4D7MA 4DYCA 3LSPA 2R92J 9ANTA 4B3AA 1PUFB 1QPIA 2CRGA 3RZDJ 5EYRA 1RETA 1IV6A 2DA5A 2O9LA 2R5YA 4B4CA 2MGQA 1ITYA 3F0CA 1B8IB 2QF7A 2Y9ZA 4JX4A 1PUFA 3FISA 2DMUA 3JREA 2R7ZJ 3FK6A 2VKEA 2Y31A 4XICA 3BTIA 3S1QJ 4MLOA 2HXIA 5M3FJ 5EDNA 3ZQIA 3BR2A 1P7IA 3O8GA 4XRMA 2JA6J 1Y1VJ 5FLVA 1WPKA 4W97A 5GPCA 4FISA 1X58A 1B8IA 1RESA 4ABZA 1GVDA 1Z77A 4AYBN 1NTCA 4M6VA 2LKXA 1ETOA 3TEDA 2E2IJ 5F1JA 1ETQA 2ID3A 1FIPA 1JTXA 3JR9A 5F0CA 3BT9A 3WHCA 3G1MA 4A3BJ 4HNVA 2XGEA 1JTYA 3GTQJ 3E7LA 5C4XJ 4IHXA 2WB1N 1DU6A 3G1OA 2L7FP 1EF4A 1OJLA 2VI6A 4IHWA 4S0HB 3HGYA 3S2DJ 1IDYA 2XPWA 1HF0A 2L0KA 1MBEA 5F27A 3ZOBA 4JX6A 2I10A 3W6VA 1JT6A 4QTRA 5JLXA 4DYRA 3CDLA 1H89C 5EF6A 3TP3A 3HKZN 3BR6A 4XIDA 5EZGA 4FTHA 2R5ZB 2DA4A 3BQZA 1ZR2A 1MH3A 4MIMA 1H88C 1GDTA 3OSGA 1MBGA 4GFBA 5M3MJ 4B1RA 5E3MA 1MSFC 4BY1J 1QVTA 4QSHA 2R5ZA 2NVXJ 1ZTRA 1JJ8C 2L9RA 2E2JJ 5EGOB 3TW6A 1QVUA 2EQRA 5IP7J 4C2MJ 2MW8A 2JA5J 1TC3C 4BY7J 2ZB9A 1ENHA 1U9NA 2JA7J 2JJ7A 3GTPJ 5F0HA 1ETVA 2P81A 2G0EA 1MBFA 5EGOA 2GLOA 2NVQJ 1MSEC 2MG4A 2CQQA 4NDLA 2Y2ZA 5C44J 1W0TA 3ZQFA 3HOVJ 4FE7A 1NK2P 4RDUA 1VNDA 1ETYA 5IYCJ 4Y7NJ 3RZOJ 3GTJJ 3A01A 1JT0A 2DA6A 1JKOC 2RAEA 1FTTA 2HQ5A 4UUSB 2HOSA 2OPTA 1TWGJ 4AUXA 2EZIA 3S14J 1VF9A 2K9QA 3GTMJ 4XK4A 2XB5A 5J1YA 3QPSA 2NVYJ 1IRZA 2CUFA 3BR1A 4A3IJ 3GTLJ 1GT0C 1JKQC 1K61A 3S15J 4M3FA 2M8GX 5DS9A 3IV5A 1W0UA 1YRNB 1BW5A 4IEJA 1BJZA 2L7ZA 1ETXA 1OCPA 3LNQA 1U9OA 5K7ZA 3LSRA 1HLVA 1BW6A 5C4JJ 5FKOA 2ME0A 2GBYA 3BG3A 1HDDC 2YU9J 2TCTA 4C3HJ 1YRNA 2M34A 5FKMA 3QPLA 3M4OJ 4XRSA 3BR5A 1UMQA 4XRSG 2NOGA 3H0GJ 2HXOA 5DTDA 3S1NJ 2Y0SN 3O8HA 2NVTJ 2GM4A 4A3FJ 4MFEA 2HOTA 4L5EA 4AC0A 4X6AJ 3DCFA 2JN6A 3CCYA 2XGDA 4M3DA 3JRCA 3BR0A 3S16J 3JRFA 4X1EA 3ZQCA 4M3EA 3TP0A 1FIAA 1I3QJ 2VPRA 2ECBA 2KDZA 2LLKA 3BQYA 2K9NA 2D5VA 2JA8J 3OIOA 3Q0VA 3JRGA 3I4NJ 1WGXA 3RKQA 5F0FA
chains in the Genus database with same CATH superfamily
3OYBA 4O5VA 2XRLA 4XLHA 1U3EM 1X3WB 2CH0A 4LFUA 3V7CA 3GFMA 3MKWB 1F36A 3UKGA 5DCFA 3CP2A 5E18F 1IW7F 2ZFUA 5GAGJ 4U87A 4LK1F 4IJAA 3DF8A 2GOMA 4CYCA 5JFRA 2V1XA 4LK0F 3CF5F 4IPAA 3GZNB 5GPAA 1V5GA 5FLXK 5IT3A 4EMSA 2JMWA 5E3OA 4XR6A 1QBJA 3S3OA 3KZZA 3PM1A 1ZR4A 3HC7A 5D6EA 2W25A 2FE3A 5DD8A 3OYNA 3HBLA 2QBYB 3I4PA 2I5UA 1W7PA 5CQEA 3HOUJ 1TP4A 3MEXA 2CFOA 2QCOA 4ZYEA 4KUMA 3FXKA 2HPIA 2IAIA 1SVLA 2PI0A 1G3YA 4II3A 5TISC 1ZREA 2Y48A 2COBA 3OOPA 3CO6C 4ESBA 3DLAA 1QGPA 2EFPA 1FP2A 2DN0A 2Z5UA 2PMHA 2X6YA 3TO9A 5AIPA 4BL0B 1JGSA 3SJMA 2LK2A 2GXAA 1IGNA 1KU2A 5L3EA 1BI1A 1IN5A 2FD5A 5CVJA 3J7ZI 4EEFG 2BGCA 3FBIB 2M0CA 3IP4B 2N8GA 3OWTA 1XX5A 5CVVA 3HPHA 1QA6A 1A31A 2M5WA 2XKPA 1MBKA 4A5MA 4WK8F 3PIPF 3B6AA 2E1NA 4IHTA 3CC4I 3KIOA 5DM6F 3HDDA 3QP5A 4P96A 3L9FA 1YW7A 1G3WA 2EFWA 2PBIA 1P92A 2VKVA 3M8FA 3TOBA 1R7JA 4G94A 4RGUA 3AG4H 1FWZA 2A5YB 4BEHA 1D3YA 3QAHA 3I71A 1WI3A 3HG9A 2DPUA 1J0RA 1EKEA 1D1AA 2JUCA 4I6ZA 4XONA 1MDMA 3F8NA 2HYFA 3BTCA 1CF7A 1GXQA 3TO7A 1D5VA 3R0JA 3WU1B 2VUMJ 3LA3A 1WFXA 3GTKJ 3W3CA 1IXRC 2LBFA 3FXQA 1WH7A 1O4XA 4I0AA 1FC3A 3GWZA 2XIGA 4PDKA 3EYYA 3RQIA 4ANJA 2JPBA 1O3SA 2OA4A 2EWNA 1VTNC 4A3GJ 3L7WA 4FASD 2JPCA 5J4VA 1S6LA 1FEXA 3OYDA 2WAQN 3K6GA 1R1TA 4JYKA 3UNGC 4D5CA 5IP6A 2KQRA 3N4MA 5H2FC 3F8CA 2JVGA 2CYYA 1X3UA 2P4WA 5EG0B 4HOBA 2H8RA 1GUUA 1JE8A 1UCRA 1BOAA 4PFPA 1EA3A 2MLKA 5K5RA 2CQXA 2VT2A 3M07A 4DNCA 5EJCA 1XSDA 2IXSA 3BWGA 3GXOA 3KFWX 2BEOA 2LY9A 5J4YA 1W36D 1BR4A 1MMDA 1Q1HA 1YS6A 1LPQA 1IO2A 1RRJA 1ZAOA 3ZMTA 4NQWA 3WU0A 2ZKZA 4PCQA 4DBQA 1IDZA 4U0YA 2ZXWH 1WHUA 1WH5A 2F5VA 4FHTA 1D0YA 2K40A 3COAC 3F23A 2GIVA 2M2EA 1FOYA 4A3EJ 3PNYA 5L3BA 4M3BA 2BHYA 4P55A 2A69F 2H8WA 2Y30A 2JK3A 5ED4A 3KYCB 4KN4X 3QYBA 3LQQA 1F9NA 4TV7A 3BZKA 3HUGB 3HOWJ 3PO3J 3ROUA 4BQOA 3HJEA 2R7RA 5KVRA 1HSJA 2ESNA 1XGOA 3A03A 3WGIA 4J19A 2NS7A 3CMEI 3QPTA 3GZ6A 2L9VA 2STTA 5FRMA 4ZC3A 3Q0UA 2A3SA 1X19A 3JAMZ 2RDPA 1EH8A 2UV1A 5M5YJ 3J81Z 2Q2EA 1R1VA 3MCZA 2F5DA 3K4MA 3PSIA 3LL7A 1AKHA 3OL4A 5FKLA 3I0TA 1V3FA 1Y0UA 3PNTA 1GVJA 3E0JB 1X4OA 4MTEA 5BS6A 3L09A 2VONA 3C18A 3IH2A 1YS7A 3TW7A 4O6JA 1VQ5I 1O57A 4E7KA 2LTPA 4A3MJ 4I09A 4AM3A 3DEWA 1P4WA 5E1ZB 5JR3A 1GLNA 2EZHA 4CDGA 4EJUA 2CUZA 4C9YA 3OY9A 1R5GA 3G3ZA 4PUSA 2VQGA 1WI9A 3CLQA 3D1NI 3ZMVA 1SFEA 1N78A 4XN3A 3SXYA 4YIFA 4A3JJ 2ACJA 3BCBA 4L9NA 1Z91A 2EA2A 3MZ8A 2EZKA 4FX0A 2E35A 3GBGA 4XMYA 1JKPC 2NS8A 4FQGA 2G7UA 5C3EJ 2L7KA 2MH2A 3GTOJ 3B02A 2J5PA 1R58A 4LB5A 1ULYA 1FX7A 5HS7A 4GXOA 3OYAA 3BR3A 1ORKA 2EILH 2K9MA 1HKTA 3P5JA 1Y0NA 4G6DA 3DTKA 1V54H 1QZEA 1B72B 1Z21A 1J5YA 3I9V2 5F04A 1UZCA 2XHKA 2YR2A 4LD5A 1VQOI 4PZJA 2DA2A 3HTSB 3E5UA 1YW9A 2XASA 2DMNA 1KU9A 4CCJA 5B66C 3RJPA 2E71A 3CMYA 1XC5A 2GWRA 2LMDA 2CQNA 4AYBA 3OYCA 3BJ6A 1UHSA 2ZFWA 1NHAA 2R92J 5TGTA 2LOOA 4C2UA 4DGWB 1QPIA 1XGMA 2OC6A 4BQQA 2Z16A 3CJTB 4BAYA 3OYHA 3BY6A 5EYRA 1ZYRF 3F6VA 1IV6A 1WJCA 1LQ1A 5B1BH 1ON1A 4B4CA 1B59A 2MGQA 3O2PE 5B5EC 3QPHA 4A6EA 2F5CA 4YFXF 3HTUA 4KMUX 2UXNA 2AXTC 3JREA 2XC7A 2R7ZJ 3I54A 2UWMA 2W82A 4PJNA 3BTIA 4M72A 3R6SA 2WTEA 1YX5A 5EDNA 1TLHB 3BR2A 5J47A 2JA6J 1Y1VJ 1XN7A 1W36C 3H5RA 3BG7A 3CZ6A 2XDVA 3J80K 1GVDA 4RS8A 2VC0A 1NTCA 1WKMA 4M6VA 2OD5A 2DDAA 1ETOA 2E2IJ 5F1JA 2XAGA 1ETQA 4HQMA 2L4AA 2ID3A 3H0DA 2HS5A 3FF5A 2FRHA 3BT9A 3WHCA 5JHFA 4A3BJ 2FA5A 2XGEA 5E17F 3CJNA 3K1NA 3CD6I 2HTSA 2P6SA 1Z7UA 2M4GA 2EFOA 4L0ZB 4HPQA 4XL9A 1QHGA 3FMSA 3O6BB 1I1GA 2P0WA 1IDYA 1IN6A 4R79A 2VT3A 4HX7A 1J2XA 2L0KA 1Y39A 2NAZA 4RM2A 5FD5A 3ZOBA 3KEYA 4CCNA 4QTRA 4BHCA 2BVLA 3T8TA 4P9UA 1XMKA 4DYRA 1A6QA 3I55I 3DPTA 2YSRA 1LDKB 5HS8A 4XIDA 2OZUA 3H35A 4Y13A 2LSOA 2P8TA 2E36A 2DA4A 3DTEA 1MH3A 4B09A 1V55H 2EINH 1H88C 1WJFA 2IA0A 1IN8A 1FOWA 4LJZF 5KAIC 3ZPLA 4F55A 4GFBA 2DYRH 3HHGA 4B1RA 5E3MA 4IZZA 4N9HA 3K10A 4A6DA 2R5ZA 2L9RA 2E2JJ 3ABMH 3CCQI 2W84A 1OCCH 2MW8A 2V9PA 3PQKA 3LAPA 2NOJB 4BY7J 1ENHA 5HDGA 2JA7J 1RR8C 4ESFA 5FRNA 2QWWA 4E7ZA 4L5JA 2F5FA 2YX4A 2XROA 4LIVA 2G0EA 1VQKI 1VQMI 3K70D 3RYRA 3AG1H 3HOVJ 5K5QA 2P6TA 3FM3A 4BXUA 1VNDA 2HFHA 1ETYA 1N77A 4Y7NJ 1XCBA 3RZOJ 3BROA 1UHMA 2DA6A 3K1MA 1FTTA 3RYPA 2BOLA 2HQ5A 2WWYA 2OU2A 4WXCA 1I5ZA 4P5OA 3QWLA 4QPOA 3S14J 4MQVA 1VF9A 2K9QA 1FPQA 2RREA 4OWRB 3KYLA 5LGTA 5J8CA 3BR1A 4XRFA 1BI2A 2K3PA 1TT0A 3BJAA 4XKCA 3D5SC 1OYYA 4X0GA 3OS2A 3S15J 2M8GX 1JXSA 1YFHA 4EQQA 3FMQA 4EVIA 3H92A 1FMVA 1PP8F 1E3PA 2IGKA 3ERMA 3M1EA 1U9OA 2I8DA 2OQRA 1U5TA 2OBPA 5D4RA 5ICEA 2ME0A 3LFKA 2KJBA 3BG3A 3N05A 4XSXF 3V42A 3ONQA 4P9FA 4C3HJ 4OAZA 2OQGA 3OYKA 2VBZA 4GRIA 3QPLA 3M4OJ 2IS4A 1A35A 1ZLKA 3F3XA 1UMQA 3WTUC 4XRSG 1MMNA 1QZYA 4BHBA 4S04A 2D1HA 3V4GA 2OCEA 3O8HA 3MAJA 4ZDOA 2NVTJ 2IA2A 3I64A 4EV0A 1MKMA 5HLTA 3FZVA 3I59A 2JT1A 3RI4A 1FLIA 5J8FA 3Q9VA 2JN6A 2PQ8A 4M3DA 2XSJC 3JRCA 1LJ9A 3RQ4A 3S16J 3JRFA 4X1EA 3ZQCA 3BC8A 1ZRCA 2V1NA 1W5SA 4B44A 2ZXJA 2M3AA 2QUFA 4Y3OA 2VBYA 2EA4A 2JA8J 3I4NJ 3JRGA 4KT6A 2RVCA 3KETA 1RKWA 3CCJI 3LSKA 4LLNA 4U0WA 5CLSA 4LG0A 4UVAA 2L3DA 2ZC2A 1I6XA 3JSOA 3F72A 3Q5FA 1ONVA 5IYBJ 1SAXA 5IYDJ 2QEXI 4PGGA 4KMFA 3CF2A 4MO7A 5M5XJ 2IBDA 2STWA 1R22A 5E8IA 3U1DA 5DV5A 3MWMA 2DTZA 3S1MJ 3JW4A 2FOKA 4E7SA 3B73A 4XORA 1POGA 1E3HA 2LKPA 3G4SI 4A2UA 5J3LA 1SC7A 1Z05A 1W4MA 2F4MB 2HWVA 1SFKA 4PJ0C 2DMQA 4WXDA 3MZYA 1T38A 4I0BA 2X9DA 1BL0A 2DA7A 4XKBA 2DTRA 3K4NA 4EJOA 2EIJH 3NEUA 1WRJA 4A3KJ 1G2HA 2IA1A 4CZCA 3ZP5A 1ETKA 5GAEJ 1FT9A 2EH3A 4F92B 3E5QA 1S7OA 3BPVA 2DDBA 4G12A 1HW5A 1OPCA 1J75A 1E2XA 4A93J 2LDUA 3TKYA 4XKVA 2QBYA 1IXCA 1K7AA 1OR7C 2KZGA 3NAUA 2MSYA 3M8EA 4Y33A 2C6YA 3K4KA 2WAEA 4HAMA 1BR2A 2X1CA 1SD7A 2BYVE 2ECCA 1LDJA 4I7HA 4OIQF 1UELB 2FBIA 3HOZJ 1ZELA 1T0FC 5M5WJ 3KZYA 1Q1VA 4HDVA 4BBSJ 4NHJA 2XVCA 4DYQA 2AO9A 3K70C 1U8BA 5LD2C 1O7LA 1WQ2A 4Y15A 3HHHA 4CH7A 2FF4A 3NWTA 2YU3A 2YUSA 3FDYA 2FQ4A 4LIUA 3SFIA 1D5YA 2CGPA 2R7QA 1IC8A 2QQBA 2BBYA 4XOPA 3NWSA 2XV4S 5JVTA 3A2KA 4HNTA 1R36A 3QOEA 1MD0A 4M3GA 2HYGD 4WWCA 1B6AA 3JRBA 5FLXZ 1XSVA 1D0ZA 1MGTA 3OIPA 1MBJA 3E6CC 2UUZA 4XSZF 3QU6A 4FETA 3E1SA 5HDKA 3NQOA 3EUHC 1IRFA 4HDUA 2PMZA 3H3VK 2X6WA 3E6BA 3MQ0A 4W1UA 2FX0A 2CJJA 2IT0A 3G6EI 3R61A 1S7EA 4H0EA 1PUEE 4B43A 1X1BA 2GA2A 2LVSA 2PG4A 1G3TA 2XAQA 1KU7A 5E3NA 5KNLA 4JOMA 1X1AA 2R7UA 2NNNA 1LEBA 4QPQA 3VFZA 1UG0A 1WWXA 4KIGA 4ASNA 1R23A 2VXDA 5JLWA 2QM3A 2ELHA 1OR7A 1TWHJ 3TGNA 1B9NA 3LSTA 1F1ZA 1UHWA 2VKHA 4BACA 1H9GA 1CGPA 2MD0A 4HRIA 3K7AJ 3ZR8X 3QODA 1NG7A 1T0FA 2GXGA 2M9HA 2A07F 3W6KB 4LOCA 3TBIA 1Z0XA 2HZDA 2BVMA 3MZHA 3SZGA 1T2KA 3KYDB 2HTJA 2FBKA 2WV1A 1XDSA 4V2GA 1A04A 1P4AA 1TT5B 4Q5SF 1O3TA 1CQTA 2A61A 2QSGX 4IVNA 2PX9A 1ZRFA 2V9VA 5EG0A 4L9JA 1VFCA 2KRFA 4BGDA 1LE8B 4RLFA 3DBRB 2MH9A 4OMYA 2QSFX 1F43A 1KONA 2EJRA 1BA5A 3IH4A 3MMYB 4JBAA 3R4KA 4KITB 4M9XA 3U1KA 3CMMA 3L2QA 3EUHA 5ILVA 4UV8A 3Q9SA 2MABA 3KLNA 1ZRDA 2CV0A 3IRQA 5JHUA 4DZPA 3F21A 2BY1A 2XUBA 2DA1A 1X1CA 2EIMH 5EZHA 2V79A 4AIJA 2KHMA 3GF2A 4UVCA 4A3LJ 3DKXA 5CQGA 4XNFA 4YELA 2F5EA 4BQNA 5LGNA 3ECHA 3SDGA 5LRRA 1OFCX 5H6QA 3BCAA 3DTIA 2O7OA 2OZ6A 3HUGA 4E70A 3LA7A 4OAYA 4IHYA 3LSIA 4YIRX 3MN2A 1S3JA 2X6OA 3H9JA 3HRMA 4N4NB 3CQZJ 2LFBA 3RKXA 2IGOA 3DKYA 1SMTA 2CFXA 2P5KA 1XGNA 3NARA 5FO5A 3RDIA 1R9TJ 4DOZA 1OCRH 1X1DA 2BXYA 1IUFA 1Y8QB 3KX2A 1V5EA 2M0MA 1SD6A 2P5VA 3J7AO 5L3FA 4UUVA 5EEHA 4ZJZA 1MIJA 2M7BA 2R93J 3ZGKA 3HEFA 1JGGA 3SHFA 3HSEA 5F08A 2DXIA 2QQ8A 3K0LA 2YPRA 3WU2C 3VWBA 3IKTA 2GZWA 5IT9K 4UUTA 5E3LA 1S9HA 2LG4A 4KYWA 3HB9A 3ISPA 4UHTA 3A01B 3PQJA 4CHUA 1BI0A 1T8IA 3LWFA 4XOTA 1FJLA 4EATA 3IAS2 1VQ7I 4KNYA 1ZGAA 2ZMEB 3HYIA 5LHGA 3CCEI 2RKHA 4IQJA 3HOTA 5FKNA 1R4NB 3AL0C 3G1LA 2L4MA 2XSDC 4IHVA 1ZH5A 2NNYA 2E7WA 4JP0A 2EZLA 2XF7A 3IH3A 5HVQC 2ZJ2A 4MNUA 3PUBA 2H1LA 3DU6A 4YFNF 2XGCA 5DDGA 4M6XA 3T5XA 3KLOA 1HA8A 2IS2A 4HSRA 4IKFA 3C3WA 1B72A 2K86A 1LFUP 3K1PA 3CUQC 1P4XA 4G6TB 4BE1A 2JWTA 3PFIA 2R5YB 1ZGWA 3I4MJ 4D7MA 3FKJA 4KICA 2Y0MA 4B3AA 2VE9A 1PUFB 2UZKA 1MJ9A 4ZYGA 3RZDJ 1FSEA 1QNTA 2W4SA 2HR3A 4PJJA 3A0HC 4XN0A 2YX7A 2WB1A 2HVSA 3OYGA 2F2EA 1FBSA 2R7FA 3F0CA 1B8IB 1I1SA 2KMUA 2O5RA 1RC9A 2IGNA 2VQLA 1Y8RB 3DPLC 3HL2A 5ICFA 3EQLF 2BZTA 2RNJA 3S1QJ 2BHZA 1P7IA 4IO9F 3AAFA 4BH9A 1WPKA 3HKZA 1X58A 3SZTA 2DQLA 3KP5A 4AYBN 2KL4A 2L54A 2LKXA 3OYEA 4A0YA 2QQ9A 1DDNA 4OIOF 3TDZC 1FIPA 2P7VB 3JR9A 5F0CA 5F6FA 2GXBA 1JTYA 3V8JA 3GTQJ 1I27A 1E17A 3BZCA 4CCMA 1X4PA 2R7TA 2Y75A 1YJ9I 1DU6A 4KISA 2A5WA 4IHWA 1NH3A 1L3LA 1OISA 2DO7A 2HDWA 3CO7C 4JX6A 2I10A 3FHZA 1OYWA 5JLXA 3S2WA 1S7AA 1P2FA 2CS3A 3S3MA 5LEKA 3CDLA 4S05A 4A5NA 1OKRA 2VBWA 3GLXA 3C1DA 3TP3A 3BR6A 2BXZA 2DYSH 4G7ZF 2KRCA 4BDZA 2K4JA 2QKMB 3V8LA 4HV5A 1PVEA 3M7GA 4F91B 2DFIA 5D8KB 2ZCWA 1MBGA 3KP7A 5M3MJ 2IS6A 2ESHA 2QKLB 3L2CA 1RUNA 4BY1J 1XDUA 2R7WA 4ZH4F 4GYIA 3JSPA 3J80Z 1MJBA 2EV5A 4PSWA 1RNLA 2KIMA 3A4CA 2DOFA 2ZB9A 2V6CA 1YX3A 4HBLA 3MFKA 1G8XA 3DBLB 5BPIA 2JJ7A 4M9SA 5F0HA 1REPC 2NVQJ 4NDLA 2KISA 1VQ8I 1JHFA 2JRTA 2F6CA 2NXNB 3GO5A 3ZQFA 4FE7A 4CXFA 1W0TA 1E0EA 1R5HA 1PDNC 4QLCU 1XCVA 4KIBA 1JKOC 1K4SA 2FNAA 2RAEA 2OTLI 2DW4A 1SVMA 1DPUA 2DU9A 3L2RA 4CUGA 2KLOA 3KP6A 4AUXA 1TWGJ 3OYMA 2EZIA 3HRTA 3UR3C 3SYTA 3K4CA 2XB5A 5J1YA 3O3KA 4OU0A 5FFZA 2KPMA 3V7RA 2CUFA 2W1OA 2DT6A 2VKDA 5LEJA 2B9SA 4IHSA 4LG3A 2O6GE 1J59A 1KQ8A 4M3FA 1YRNB 4LB6B 1D1BA 4E7HA 1BIAA 1BJAA 2L7ZA 2D45A 2XAJA 4O3MA 4KIFA 3LNQA 3LSRA 1HLVA 3BOQA 4ZZDA 2EV6A 5K1YA 2P7CB 5L3DA 2DPDA 2QGUA 1ZARA 3FXRA 3RPUD 3ABTA 3BR5A 4GDFA 4ITVA 2NOGA 3H0GJ 3AL0B 2VC1A 3E5XA 1R71A 1XB4A 4YEJA 3TMOA 2GM4A 3DFGA 4ZTFA 2R7VA 1YQAA 3U9GA 4MFEA 4L5EA 2BY2A 2CQKA 3DCFA 4A0ZA 1T39A 3CCYA 3BR0A 3G71I 2K02A 3WTTC 2ECBA 5L3CA 2ZBKA 4L9TA 3CUQB 3U2RA 3BQYA 2D5VA 5KHDA 2WADA 2Z33A 1WGXA 4G7OF 3RKQA 3LQRA 4LGWA 3SZPA 1ZG1A 3IWFA 4BE2A 4ENNA 4OMZA 3OSFA 4QIWN 1FBQA 2XB0X 3IUOA 3BP8A 4MGRA 3LAJA 1ETWA 3S3NA 3F8MA 2E19A 2DODA 4HW0A 3VEPA 1HW1A 1MBHA 1MMAA 1PYVA 4A0XA 4I01A 2QSHX 4NC8A 2ELKA 2H1KA 4HA8A 1YW8A 3HOSA 4JQFA 2A6HF 2R3SA 2H6BA 4NC6A 3U21A 5J6XA 2A68F 3L2WA 1M1EB 2Q2EB 2TDXA 2ISYA 3JRAA 5HNFA 1Y1WJ 1R5ID 5A2QK 3VB2A 2E34A 2OV7A 1FYLA 3TL4X 2X4HA 3GX4X 5D5WB 4KA4A 2LF7A 2YS9A 4PJLA 3W6JB 2GIZA 2HNHA 1WZ2A 1U8RA 4RAFA 3QQAA 3CUOA 3DEEA 1L0OC 3FBNB 2PJRB 4Y52J 3LSGA 3KE2A 2DCEA 1HQCA 4XLPF 4D7NA 1Z3XA 2JSPA 2HKOA 1RIOH 3OOUA 1N75A 4ESJA 1HW2A 4NC7A 3DBHB 2OAZA 4C3IJ 2F48A 1HCRA 1T6SA 1X2MA 4HNUA 5LGUA 4XKWA 4RAZA 1G3SA 3P7NA 3DP7A 5ICGA 3ZN0A 2HDDA 2XRNA 2VPLA 3ZQGA 3VODA 5K7HA 2DMTA 2KP6A 3B6CA 1BBYA 3RSNA 1GV5A 1KQ0A 2RC4A 2JZYA 3VSKA 1NK3P 2JA2A 2B7EA 3ZQHA 5H6RA 1AWCA 2HU9A 3ABLH 3PO2J 1T33A 3GTGJ 3R0AA 2ISZA 2CW0F 1IRXA 4K2EA 4BJ5C 3LA2A 1N25A 1IAWA 2X1EA 1SMYF 5D8LB 2BY3A 5L3GA 3BG5A 4UUSA 3ECOA 3DPUA 4I76A 3VPRA 1GXPA 1DP7P 4BHPA 1QO0D 2WAFA 3WHBA 4F52A 1JUMA 4AU7A 5ILSA 4A3DJ 1LUJB 3HOYJ 1VQ4I 2WBMA 4D0PA 2CUEA 2ZJPF 1O3QA 1ZKGA 1IJWC 2FBHA 4CYDA 2CU7A 2HVQA 1STZA 1XG1A 3FXLA 1K78B 1Z7LA 3WODF 3OR1C 1VI0A 4KDPA 1RKTA 1JKRC 5BOXA 4AVPA 4ZYDA 4B8XA 4GGGA 3C2HA 3WG7H 3WTZA 2KT0A 4PK4A 5DUKA 4IXAA 3VYUB 5D4SA 1MMSA 2L2OA 3IAM2 3JTGA 1FBUA 1OLTA 3DWLE 1W7PD 2KIUA 2ZSIB 4N9IA 1Y56A 2PMZN 5JI6A 3E3VA 1X2NA 4BUPA 3HSRA 1KYWA 3KP3A 5K7FA 3QU3A 3VYRB 3C2GA 2HEOA 1FOXA 3DU5A 5FD6A 2DOAA 3L00A 3QYFA 3ZXSA 2R0QC 2DOEA 3VYTB 1GHCA 2WA0A 1DU0A 2O8KA 4P1WA 3DLLF 5FFXA 1I50J 2V1UA 4IOAF 1ZK8A 3LMMA 4RA2A 2QQAA 1IG7A 3FXJA 1ODDA 3ESWB 1SFOJ 3WGHA 5KAFC 1ZN2A 3L1PA 3V7SA 1Z1DA 5FKKA 2EPFA 5BNGA 3I56I 1LE8A 1FMWA 1H8AC 4FX4A 3C7JA 3H3ZA 1EJ9A 1K83J 1TWCJ 5LHIA 2A6TA 5DM7F 1OCTC 1A5JA 4BQAA 4R8HA 4BU2A 2DJNA 2MD5A 2AXLA 3JRIA 2LP0A 3A02A 3GVAA 3CCMI 4BNCA 2CSOA 2O3FA 1T56A 2DQRA 4ZTJA 3HOXJ 2KDOA 2MA3A 2ZMEC 3FIWA 1K4TA 2Z3YA 5GTIC 1WSUA 4L9VA 2PEXA 1KZHA 1R00A 3MVPA 3OYJA 1JJ6C 2RGVA 1DPRA 2G7HA 5HODA 1TZLA 4BXFA 2HYJA 3ZMSA 2ZNYA 3WTYC 1ZGJA 3LOCA 3IHUA 2NVUB 1UFMA 1JUPA 1IN4A 3MKLA 5J1UA 3M3YJ 3Q3SA 4D1QA 4G7HF 4WX9A 5K5OA 3GMEA 2IVMA 3WG9A 2FQ3A 1G59A 3KZIC 3N97A 3K2ZA 4M6YA 1KYZA 2W48A 5TRDA 1HBXG 1AHDP 4Q4ZF 3P9IA 3PFYA 5FB2A 3CLOA 4RAYA 1S29A 2TRTA 3OV8A 3S93A 1V5FA 3F22A 1T95A 4Z6YA 4RGRA 4C3JJ 4MTDA 4HQEA 2E1MB 3F6OA 1Y6IA 1E3OC 2V4JC 3I53A 4M71A 1TQPA 2ZSHB 3BDDA 1YJNI 3A1YA 2FJ1A 2MC4A 3QRFF 3FXOA 1DUXC 2IEKA 5BMZA 2Z99A 5GP9A 4HX4A 3F9KA 2ADUA 3W2WA 4ON0A 4PJMA 5FJ8J 2ELJA 2ZMEA 2K4BA 4IL6C 5JVGF 2Y9YA 1SANA 3IWZA 2H94A 5FLMJ 2AHQA 1UG2A 2VJ4A 2BY0A 2DA3A 1LVAA 1YHQI 3EETA 3I5UA 3SEQA 3OS1A 2X51A 4WCGA 1WCMJ 3ABKH 4A3CJ 2DFFA 4LLLA 4IOCF 3NRVA 1VQNI 4DYCA 3LSPA 3BPXA 2FU4A 3JCUC 1MNDA 2CRGA 1H9TA 4NUBA 4NB5A 4ENKA 3GW2A 5IT9Z 2HOEA 3REOA 3W2VA 1RETA 2WY7Q 2DA5A 4BDYA 1P6RA 2FUG2 2R5YA 5CKTA 1ITYA 2KIQA 4E7IA 2E5NA 2VE8A 4MQ9F 4MHGA 1FZPB 2DFEA 1FP1D 1WVRA 1YYVA 2QF7A 1OYIA 4B48A 2Y9ZA 2DMUA 1PUFA 1SAUA 4ENJA 2E1CA 1UJ8A 1VQ6I 3GCMA 2B0LA 2Y31A 4XICA 1T98A 4MLOA 2Z1DA 3ZQIA 2DT5A 3VOEA 2CW7A 5FLVA 2A05A 1HC8A 2Q0OA 4W97A 1YE9A 2E60A 2ZXIA 2VODA 3GFJA 2QVOA 1B8IA 5E8GA 3CESA 2CWEA 1OQYA 2DK8A 3TEDA 2AQEA 3CJRB 1YIOA 2ICWG 2QA4I 4V19K 2KJCA 3HZJA 4HNVA 2DK5A 3QOPA 3W2AA 2NYXA 3E7LA 1HXDA 1S8NA 4IHXA 2WB1N 4U88A 3CJQB 3BG6A 4S0HB 3S2DJ 1MZBA 2MC3A 2BW3B 1HF0A 3TOAA 2LRDA 1QHHD 3FM5A 3SEZA 1TNSA 3W6VA 1I39A 4DIQA 2V6EA 2E5ZA 5EF6A 2GOXB 3HKZN 4I98B 4L18B 3PNVA 3L2UA 2W00A 4FTHA 2IS1A 4CCLA 1ZR2A 4AIHA 1I3AA 2VXZA 1GDTA 5GTHC 2CMPA 4R1HA 1QZZA 2LY1A 3OS0A 3PIOF 1MSFC 1TQIA 2H27A 2NVXJ 1ZTRA 4HX8A 5EGOB 2WV0A 4HZFA 2O0YA 2EQRA 5IP7J 4ZDLA 4C2MJ 2LKSA 2JA5J 3TO6A 3M8JA 1TC3C 5HNHA 1U9NA 4QWQA 2HGCA 4I99C 2QENA 4HF2A 3K4BA 4RM3A 3K4LA 3IL2A 1YIJI 2JSCA 3GTPJ 2XF6A 1ETVA 2V7FA 2VBXA 5TJJA 1D8JA 1MBFA 2FSWA 2A6EF 2HQRA 2GLOA 1MSEC 1Z67A 2CQQA 2MG4A 2P5LC 5EEGA 2Y2ZA 5C44J 2Z2SB 1NK2P 2VN2A 1BR1A 2COMA 2WC2A 4HF0A 4UB8C 4CZZA 1F4KA 1SD4A 2VJIA 4G8XA 1USSA 2KFDA 4J00A 3WE2A 5LHHA 2JQ7A 3GUDA 3KP4A 4HSTA 2Z9OA 4GCVA 5DCMB 2Y0SA 3CC2I 2UXXA 2LH9A 3GTMJ 4XK4A 2VLAA 2XF5A 2HDCA 3QPSA 4A3IJ 1Z6TA 3GTLJ 3K4JA 1GT0C 3H9GA 4ZDPA 4HLXA 2PMUA 4RGSA 1RZ4A 1K61A 3IV5A 4UNOA 1BW5A 4IEJA 2K5CA 1YTYA 3BJOA 1X3ZB 2O03A 2H6CA 1ACIA 5K7ZA 3CCVI 1BW6A 5C4JJ 4ZYAA 2MLGA 4HYEA 5FKOA 2GBYA 5IY5H 1HDDC 2E7XA 1K6OA 2YU9J 2VASA 1YITI 5DD4A 2FXAA 1HKSA 1YRNA 1SFUA 2M34A 2LC2A 5HLIA 1J09A 4XRSA 1XPXA 2NRAC 2HQNA 2ZJRF 1X1PA 4YRVA 3D0SA 2R7OA 2KKOA 4ZYHA 4B3XA 2HXOA 4H4KC 2M45A 5F1RA 1D1CA 4M9ZA 4Q47A 1DGRM 2HOTA 3GZ5A 3PL8A 2EFNA 4X6AJ 3AKZA 2XGDA 1G4DA 1OCOH 3KP2A 2VL8A 3TDUC 2GQQA 3ZN1A 3GFLA 1WJEA 1YG2A 5HLHA 3TP0A 4DJAA 1FIAA 2CQ7A 2KDZA 2X6XA 2Q8KA 2IW5A 3A0BC 4IF4A 5B3SH 2QZ8A 1U6GA 3Q0VA 3CC7I 3T0YA 5DUIA 4OIPF 3AG2H 5F0FA 1QPMA 3HRUA 4CYCB 1ZHFA 1H0MA 3H3UA 3CUQA 3RCOA 1B4AA 3ZQQA 5D5UB 5HS9A 2K3FA 1KU3A 2XKOA 1RI7A 4RB3C 4OOIA 4BYYA 1BM9A 5KCMA 1B1BA 2K9LA 3BZ6A 4Z2YA 1XS9A 3S17J 1FNNA 2LD5A 3FXUA 2K9SA 4UV9A 1W7PB 3JRDA 2EB7A 3JTHA 2E1OA 3AG3H 5H20A 4RB1A 3G73A 4PGHA 2IGMA 3OR2C 4LMYA 4D5FA 5LLQA 1RPWA 3EYIA 3SFZA 4E7JA 5B1AH 2V1DA 1LB2A 4AIKA 1O3RA 1A6IA 1MNMC 5ICCA 1D8KA 1WJBA 5DYMA 3T8RA 1IV8A 1VZ0A 2W24A 2HOAA 4EJTA 5CYVA 3D5LA 2VJ5A 1MH4A 1FSHA 2L9SA 2MYSA 3S2HJ 4F3QA 4C30A 1YJWI 1HOMA 2VIXA 3VDXA 4J01A 4EGZA 4M74A 2VQHA 3CCUI 3CCRI 5EEAA 1HSTA 3CCLI 2PJRA 4YG2F 1JUSA 1S5LC 1J9IA 2EV0A 2CV2A 1BN5A 1EH7A 1TW3A 4BBRJ 1P7JA 1TL8A 1DP3A 3H9QA 4II2A 1FY7A 3HIFA 5E20A 1AOYA 3H5NA 1RR7A 5J1RA 1BC8C 4DW6A 4B47A 4BEHB 1R6RA 4V2FA 2AS5F 3HXLA 5IOYA 3ABUA 1XSXA 2XPUA 4L0YB 1FTZA 2WAQA 3S32A 1MDMB 1CF7B 2W85A 5CVRA 2IRFG 1APLC 2PLYA 1ZG3A 2GA1A 4AIDA 4ENMA 4XM3A 5A2QZ 4MFDA 2K27A 2LBFB 4N4OB 3AFHA 1C0WA 2EBIA 2XGXA 2BE5F 3BTLA 3CTAA 2HI3A 2FMLA 3RTRA 2OTJI 3ZMDA 3MKYB 4FCYA 2QLZA 2DBBA 4IRGA 4BE0A 3FKIJ 5CJ9A 1VQ9I 1ERDA 1TWAJ 1EV7A 2ME6A 3CMAI 2VJJA 4HF1A 1Z3YA 2L02A 3ZMUA 3ZMZA 2B63J 3E6MA 2K85A 2JVHA 1IN7A 5J40A 2BV6A 1T08B 1AU7A 1S72I 4ETSA 3OYLA 2RQQA 4Y17A 1HKQA 4I2OA 3EDPA 2E2HJ 2OUMA 3RPQA 2CV1A 3C2BA 4PSXA 4I02A 3ZQLA 1MJAA 4BS9A 1D0XA 3JAMK 5D6FA 2M1BA 3KEQA 4RGXA 3ML6A 3J81K 1FOKA 3J7YJ 3WTXC 2L7MP 1K78A 4RAGA 3OYIA 4G6QA 5GADJ 4NQWB 3OL3A 3RKYA 5CVUA 1KGSA 1I6HJ 3K2AA 2DMPA 2LNBA 4A12A 1UB9A 2MFZA 5LBQA 1HDPA 1IRGA 3SDBA 4KFCA 4DZJA 4RBOA 5HDNA 2EK5A 3LSHA 1F5TA 3FXMA 4EM0B 1MNEA 2LREA 3DEUA 5GAHJ 1B9MA 2DAOA 3MKZA 4KN7X 5F64A 3M1CA 2LR8A 1IUYA 3ZCOA 2ID6A 1A36A 4XLCA 3HSFA 1U78A 3FK7A 2XPVA 1BOBA 2OF7A 2O8XA 4RLQA 3BLYA 2DI3A 4ZZLA 1IZ1A 3HPGA 4MEXF 3E97A 2LYCA 2V26A 1QRYA 5DEQA 4CGZA 3FWEA 3GLLA 3E6DA 3I3LA 2HVRA 2E1MC 3PSFA 2G9WA 1IF1A 4JX5A 4UY8I 1AKHB 2M30A 2KZVA 3LSJA 3HGGA 4OINF 2VB6A 1TWFJ 3HM5A 1XMAA 1WJAA 2HZTA 2RV8A 4BKXA 2CW8A 2FOWA 1YI2I 2DT7B 2R7SA 5IPAA 3V8KA 4M73A 3R60A 1PJRA 4IRHA 3S1RJ 1K6YA 2ETHA 5D5XB 3K9TA 1LFBA 4CCKA 5IP9J 1U5TC 4HV6A 3GFIA 4IQ4A 1ZQ3P 1K79A 1SFXA 1WJ5A 1J7KA 4HLYA 6PAXA 1ZG5A 1LNWA 1QU3A 5LRSA 3L2VA 1UAAA 5D5VB 1EH6A 1USTA 3BG9A 4BXXJ 3CDHA 4AD9A 4D9JA 2AQFA 3P9CA 1MW7A 1R4MB 2J5OA 3OIQA 2IPQX 4EM1A 1DQUA 1KQ9A 1Z9CA 1TW2A 3IRRA 3H1CA 4JK1X 3JRHA 5CVIA 1SEUA 1YLFA 2LY2A 4CSWA 3WTSC 3TQNA 2F4OB 3Q0WA 2L5QA 5KK1A 1JI8A 3BTJA 4FE4A 2M8EA 4F7ZA 5IOZA 4GO1A 2ZJQF 4XLAA 4KJZA 2PFBA 3WGGA 4E7LA 1VQLI 4A69C 2FNPA 1GV2A 2NS0A 2JUGA 3H5AA 2PN6A 2X48A 2OCCH 2VOPA 3QYEA 1FYMA 2D1VA 2HQAA 2K7LA 1TNTA 3DXJF 4UVBA 4C2TA 4XLFA 9ANTA 1KA8A 3HRSA 1V4RA 4CCOA 1XD7A 2ZXHA 5LFAA 2JTVA 3EPZA 2PJPA 4HEA2 3FHNA 2VQCA 3RKWA 4RB0A 2O9LA 2V9KA 2QYOA 2X1DA 3WTWC 1FYKA 2L01A 3CCSI 2CUJA 5HOOA 3LSMA 4JX4A 3FISA 3DKWA 4IX7A 3FK6A 2VKEA 1WJDA 1LFPA 1QQIA 2HXIA 1LEAA 5M3FJ 3H36A 2W7NA 4XRMA 3O8GA 3GYHX 5GPCA 3F8FA 4YFKF 2XAFA 4LITA 1DGWY 3ASOH 3G2BA 3PUFA 4FISA 5E1WA 1RESA 2IJLA 4ABZA 1ZLJA 1BI3A 1Z77A 4G9YA 4E6KG 1PP7U 1BIBA 3ELKA 3J7AY 3S8PA 4CO8A 3SQNA 2ZNZA 1Z6RA 3CP8A 3FX3A 1JTXA 3G1MA 4BJTA 3ZQ7A 5FGMA 3CDIA 5C4XJ 1O7FA 4U7DA 4KT5C 2X85A 3G1OA 2L7FP 1EF4A 1OJLA 2VI6A 4MEYF 2D2WA 2RQPA 3HGYA 3X2QH 2W57A 2GAUA 2XPWA 3KEOA 1MBEA 5F27A 1TTYA 1U0JA 4IRIA 3IC7A 1JT6A 3KCCA 3RPUA 3I58A 4AVZA 2LF8A 2KRHA 1H89C 4HG2A 2M7AA 3P9KA 4XBFA 5EZGA 4WF2A 2DLLA 3LFUA 5AIQA 4AWXB 2R5ZB 4RB2C 2Y69H 3BQZA 2BW3A 3RIRA 4MIMA 4NBQA 3WE3A 3OMYA 3D5RC 1W1WE 4EM2A 4PFOA 1SD5A 3OSGA 2FEZA 3EUAA 4YIIA 3K69A 1IXSB 1MMGA 4N0BA 1P9QC 3VSLA 1QVTA 1JHHA 4QSHA 5CPRB 2R7DA 3OYFA 3T1BA 1JJ8C 3TW6A 3M9AA 1QVUA 1NG6A 4E4HA 5BQTA 4EJWA 4XLNF 2FMYA 2R4GA 4OIRF 1XMXA 3QP6A 4NNJA 4CICA 5BPDA 1R1UA 2P81A 1R49A 4Y4RA 5EGOA 2RNGA 4RDUA 3DQVC 1LDDA 3F8BA 1BC7C 5IYCJ 4EGYA 4UXNA 2O61A 3GTJJ 2KIFA 3A01A 1JT0A 1XTAA 3GEZA 1XGSA 4WXHA 1TBXA 4UUSB 2HOSA 2EIKH 1OCZH 2CG4A 2OPTA 3VYSB 4FT8A 4RMNA 1U2WA 2JRMA 2H09A 1AA7A 1TQMA 2NVYJ 4U7BA 1IRZA 4U0VA 1U5TB 4DBRA 1ON2A 1W5CC 1JKQC 5E79C 2MBFA 4BJ6C 2ZO4A 5DS9A 3MD2A 5DCMA 1W0UA 4XLEA 2R7XA 5HLGA 1OMIA 1BJZA 5AONA 1LVKA 1ETXA 4Q48A 5ILUA 1RUOA 1OCPA 3PJRA 3KPHA 2DFHA 4UB6C 2Q1ZB 2CO5A 2TCTA 2WY8Q 2M4KA 3I59B 5FKMA 2DJIA 3ULQB 2XAHA 2M87A 4EJVA 4DQ2A 3ASNH 4LLGF 5DTDA 2L9NA 5ERIA 3DV8A 3S1NJ 2Y0SN 4CA0A 2IP2A 3ERED 5E1XA 1YO5C 4A3FJ 2F4IA 4F93B 2RN7A 1YOVB 4AC0A 1W5TA 2EFQA 3IKVA 3ZRGA 5FROA 2HPMA 4GYGA 1VQPI 3EUKL 2OJED 4L5IA 2X0LA 4LG0B 4M3EA 2XAUA 3FMRA 3WTVC 1I3QJ 2VPRA 1LKXA 1G6NA 2HKXA 2LLKA 1SVOA 4XQFA 2K9NA 3OIOA 2VOOA
chains in the Genus database with same CATH topology
1RKWA 3OSFA 4CYCB 2XRLA 4QIWN 2XB0X 1ETWA 5IYBJ 5IYDJ 2E19A 1F36A 3UKGA 4MO7A 1MBHA 2IBDA 5M5XJ 2ELKA 2H1KA 2DTZA 3S1MJ 4CYCA 3S17J 1XS9A 2LD5A 2K9SA 1POGA 3JRDA 5GPAA 3JRAA 2E1OA 5J3LA 1Y1WJ 2JMWA 5E3OA 4D5FA 1RPWA 2DMQA 3PM1A 1ZR4A 2X9DA 1BL0A 2YS9A 1A6IA 1MNMC 2DA7A 3HBLA 3QQAA 4A3KJ 1G2HA 2HOAA 3HOUJ 2QCOA 4Y52J 3LSGA 1ETKA 2IAIA 2EH3A 1MH4A 4D7NA 2COBA 3S2HJ 4G12A 4A93J 3OOUA 1HOMA 4C3IJ 1HCRA 2DN0A 3NAUA 2MSYA 1X2MA 5EEAA 3SJMA 2ECCA 2LK2A 2HDDA 1JUSA 1IGNA 3ZQGA 5K7HA 2FD5A 2DMTA 3HOZJ 4BBRJ 4EEFG 2M0CA 1P7JA 5M5WJ 3B6CA 1Q1VA 4BBSJ 1GV5A 2N8GA 4DYQA 2AO9A 1NK3P 3ZQHA 1RR7A 5J1RA 1U8BA 4DW6A 3PO2J 1MBKA 3B6AA 4V2FA 3HDDA 1T33A 2YUSA 5IOYA 2FQ4A 3SFIA 1D5YA 2XPUA 3GTGJ 1FTZA 1IC8A 1APLC 2VKVA 4M3GA 3JRBA 1MBJA 4MFDA 3BG5A 1WI3A 4UUSA 2EBIA 4I6ZA 3BTLA 4I76A 2HI3A 3VPRA 3BTCA 3H3VK 4FCYA 4W1UA 3WHBA 2VUMJ 2FX0A 1JUMA 2CJJA 3FKIJ 4A3DJ 3GTKJ 1S7EA 1TWAJ 2ME6A 3HOYJ 1WH7A 2LVSA 2B63J 2CUEA 1O4XA 5E3NA 1ZKGA 1IJWC 3RQIA 2CU7A 1XG1A 1AU7A 4A3GJ 5JLWA 1FEXA 2WAQN 1VI0A 2E2HJ 1TWHJ 4JYKA 4D5CA 5IP6A 3C2BA 1RKTA 3ZQLA 1JKRC 3K7AJ 2KT0A 2L7MP 5EG0B 2M9HA 2H8RA 1GUUA 4LOCA 1I6HJ 2PMZN 1Z0XA 3K2AA 2DMPA 2CQXA 1X2NA 2WV1A 4V2GA 2LY9A 5K7FA 1HDPA 1CQTA 5EG0A 1VFCA 4DZJA 4RBOA 2R0QC 1LE8B 1IDZA 1DU0A 2O8KA 1F43A 1WH5A 1I50J 2K40A 1BA5A 2M2EA 3IH4A 1ZK8A 4A3EJ 1IG7A 4M3BA 1SFOJ 2LR8A 3L1PA 2Y30A 2JK3A 5FKKA 2ID6A 5BNGA 1U78A 1LE8A 4DZPA 3FK7A 2XPVA 1H8AC 2DA1A 5EZHA 3HOWJ 2OF7A 3PO3J 1K83J 1TWCJ 4A3LJ 1OCTC 1A5JA 1QRYA 2DJNA 3A03A 3JRIA 4J19A 2NS7A 4JX5A 2LP0A 3A02A 3SDGA 1AKHB 1OFCX 1T56A 2O7OA 3LSJA 3HOXJ 3HGGA 3Q0UA 4IHYA 3FIWA 5M5YJ 1TWFJ 3MN2A 3MVPA 3HM5A 2X6OA 1JJ6C 3CQZJ 2LFBA 4BKXA 1AKHA 5HODA 3NARA 5FKLA 2HYJA 5IPAA 1R9TJ 1IUFA 3LOCA 3IH2A 3TW7A 1JUPA 3S1RJ 3MKLA 5J1UA 3M3YJ 3Q3SA 1LFBA 2LTPA 4A3MJ 5IP9J 3DEWA 2R93J 1ZQ3P 3HEFA 2W48A 1JGGA 1AHDP 5F08A 2EZHA 2TRTA 4UUTA 5E3LA 3D1NI 4A3JJ 4C3JJ 3BG9A 3HB9A 4BXXJ 3A01B 2EZKA 3GBGA 1JKPC 2NS8A 1E3OC 5C3EJ 1FJLA 3GTOJ 5FKNA 2FJ1A 3JRHA 3G1LA 3BR3A 2XSDC 4IHVA 1ORKA 2IEKA 4JP0A 2EZLA 3IH3A 1B72B 5GP9A 5F04A 3Q0WA 3BTJA 4FE4A 5FJ8J 2DA2A 2XGCA 5IOZA 2Y9YA 1SANA 2DMNA 5FLMJ 2AHQA 1UG2A 4A69C 1GV2A 1B72A 3CMYA 2DA3A 1LFUP 1XC5A 2X48A 1WCMJ 2JWTA 4A3CJ 2R5YB 1UHSA 1ZGWA 3I4MJ 4D7MA 4DYCA 3LSPA 2R92J 9ANTA 4B3AA 1PUFB 1QPIA 2CRGA 3RZDJ 5EYRA 1RETA 1IV6A 2DA5A 2O9LA 2R5YA 4B4CA 2MGQA 1ITYA 3F0CA 1B8IB 2QF7A 2Y9ZA 4JX4A 1PUFA 3FISA 2DMUA 3JREA 2R7ZJ 3FK6A 2VKEA 2Y31A 4XICA 3BTIA 3S1QJ 4MLOA 2HXIA 5M3FJ 5EDNA 3ZQIA 3BR2A 1P7IA 3O8GA 4XRMA 2JA6J 1Y1VJ 5FLVA 1WPKA 4W97A 5GPCA 4FISA 1X58A 1B8IA 1RESA 4ABZA 1GVDA 1Z77A 4AYBN 1NTCA 4M6VA 2LKXA 1ETOA 3TEDA 2E2IJ 5F1JA 1ETQA 2ID3A 1FIPA 1JTXA 3JR9A 5F0CA 3BT9A 3WHCA 3G1MA 4A3BJ 4HNVA 2XGEA 1JTYA 3GTQJ 3E7LA 5C4XJ 4IHXA 2WB1N 1DU6A 3G1OA 2L7FP 1EF4A 1OJLA 2VI6A 4IHWA 4S0HB 3HGYA 3S2DJ 1IDYA 2XPWA 1HF0A 2L0KA 1MBEA 5F27A 3ZOBA 4JX6A 2I10A 3W6VA 1JT6A 4QTRA 5JLXA 4DYRA 3CDLA 1H89C 5EF6A 3TP3A 3HKZN 3BR6A 4XIDA 5EZGA 4FTHA 2R5ZB 2DA4A 3BQZA 1ZR2A 1MH3A 4MIMA 1H88C 1GDTA 3OSGA 1MBGA 4GFBA 5M3MJ 4B1RA 5E3MA 1MSFC 4BY1J 1QVTA 4QSHA 2R5ZA 2NVXJ 1ZTRA 1JJ8C 2L9RA 2E2JJ 5EGOB 3TW6A 1QVUA 2EQRA 5IP7J 4C2MJ 2MW8A 2JA5J 1TC3C 4BY7J 2ZB9A 1ENHA 1U9NA 2JA7J 2JJ7A 3GTPJ 5F0HA 1ETVA 2P81A 2G0EA 1MBFA 5EGOA 2GLOA 2NVQJ 1MSEC 2MG4A 2CQQA 4NDLA 2Y2ZA 5C44J 1W0TA 3ZQFA 3HOVJ 4FE7A 1NK2P 4RDUA 1VNDA 1ETYA 5IYCJ 4Y7NJ 3RZOJ 3GTJJ 3A01A 1JT0A 2DA6A 1JKOC 2RAEA 1FTTA 2HQ5A 4UUSB 2HOSA 2OPTA 1TWGJ 4AUXA 2EZIA 3S14J 1VF9A 2K9QA 3GTMJ 4XK4A 2XB5A 5J1YA 3QPSA 2NVYJ 1IRZA 2CUFA 3BR1A 4A3IJ 3GTLJ 1GT0C 1JKQC 1K61A 3S15J 4M3FA 2M8GX 5DS9A 3IV5A 1W0UA 1YRNB 1BW5A 4IEJA 1BJZA 2L7ZA 1ETXA 1OCPA 3LNQA 1U9OA 5K7ZA 3LSRA 1HLVA 1BW6A 5C4JJ 5FKOA 2ME0A 2GBYA 3BG3A 1HDDC 2YU9J 2TCTA 4C3HJ 1YRNA 2M34A 5FKMA 3QPLA 3M4OJ 4XRSA 3BR5A 1UMQA 4XRSG 2NOGA 3H0GJ 2HXOA 5DTDA 3S1NJ 2Y0SN 3O8HA 2NVTJ 2GM4A 4A3FJ 4MFEA 2HOTA 4L5EA 4AC0A 4X6AJ 3DCFA 2JN6A 3CCYA 2XGDA 4M3DA 3JRCA 3BR0A 3S16J 3JRFA 4X1EA 3ZQCA 4M3EA 3TP0A 1FIAA 1I3QJ 2VPRA 2ECBA 2KDZA 2LLKA 3BQYA 2K9NA 2D5VA 2JA8J 3OIOA 3Q0VA 3JRGA 3I4NJ 1WGXA 3RKQA 5F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKW A;  3OSF A;  4CYC B;  2XRL A;  4QIW N;  2XB0 X;  1ETW A;  5IYB J;  5IYD J;  2E19 A;  1F36 A;  3UKG A;  4MO7 A;  1MBH A;  2IBD A;  5M5X J;  2ELK A;  2H1K A;  2DTZ A;  3S1M J;  4CYC A;  3S17 J;  1XS9 A;  2LD5 A;  2K9S A;  1POG A;  3JRD A;  5GPA A;  3JRA A;  2E1O A;  5J3L A;  1Y1W J;  2JMW A;  5E3O A;  4D5F A;  1RPW A;  2DMQ A;  3PM1 A;  1ZR4 A;  2X9D A;  1BL0 A;  2YS9 A;  1A6I A;  1MNM C;  2DA7 A;  3HBL A;  3QQA A;  4A3K J;  1G2H A;  2HOA A;  3HOU J;  2QCO A;  4Y52 J;  3LSG A;  1ETK A;  2IAI A;  2EH3 A;  1MH4 A;  4D7N A;  2COB A;  3S2H J;  4G12 A;  4A93 J;  3OOU A;  1HOM A;  4C3I J;  1HCR A;  2DN0 A;  3NAU A;  2MSY A;  1X2M A;  5EEA A;  3SJM A;  2ECC A;  2LK2 A;  2HDD A;  1JUS A;  1IGN A;  3ZQG A;  5K7H A;  2FD5 A;  2DMT A;  3HOZ J;  4BBR J;  4EEF G;  2M0C A;  1P7J A;  5M5W J;  3B6C A;  1Q1V A;  4BBS J;  1GV5 A;  2N8G A;  4DYQ A;  2AO9 A;  1NK3 P;  3ZQH A;  1RR7 A;  5J1R A;  1U8B A;  4DW6 A;  3PO2 J;  1MBK A;  3B6A A;  4V2F A;  3HDD A;  1T33 A;  2YUS A;  5IOY A;  2FQ4 A;  3SFI A;  1D5Y A;  2XPU A;  3GTG J;  1FTZ A;  1IC8 A;  1APL C;  2VKV A;  4M3G A;  3JRB A;  1MBJ A;  4MFD A;  3BG5 A;  1WI3 A;  4UUS A;  2EBI A;  4I6Z A;  3BTL A;  4I76 A;  2HI3 A;  3VPR A;  3BTC A;  3H3V K;  4FCY A;  4W1U A;  3WHB A;  2VUM J;  2FX0 A;  1JUM A;  2CJJ A;  3FKI J;  4A3D J;  3GTK J;  1S7E A;  1TWA J;  2ME6 A;  3HOY J;  1WH7 A;  2LVS A;  2B63 J;  2CUE A;  1O4X A;  5E3N A;  1ZKG A;  1IJW C;  3RQI A;  2CU7 A;  1XG1 A;  1AU7 A;  4A3G J;  5JLW A;  1FEX A;  2WAQ N;  1VI0 A;  2E2H J;  1TWH J;  4JYK A;  4D5C A;  5IP6 A;  3C2B A;  1RKT A;  3ZQL A;  1JKR C;  3K7A J;  2KT0 A;  2L7M P;  5EG0 B;  2M9H A;  2H8R A;  1GUU A;  4LOC A;  1I6H J;  2PMZ N;  1Z0X A;  3K2A A;  2DMP A;  2CQX A;  1X2N A;  2WV1 A;  4V2G A;  2LY9 A;  5K7F A;  1HDP A;  1CQT A;  5EG0 A;  1VFC A;  4DZJ A;  4RBO A;  2R0Q C;  1LE8 B;  1IDZ A;  1DU0 A;  2O8K A;  1F43 A;  1WH5 A;  1I50 J;  2K40 A;  1BA5 A;  2M2E A;  3IH4 A;  1ZK8 A;  4A3E J;  1IG7 A;  4M3B A;  1SFO J;  2LR8 A;  3L1P A;  2Y30 A;  2JK3 A;  5FKK A;  2ID6 A;  5BNG A;  1U78 A;  1LE8 A;  4DZP A;  3FK7 A;  2XPV A;  1H8A C;  2DA1 A;  5EZH A;  3HOW J;  2OF7 A;  3PO3 J;  1K83 J;  1TWC J;  4A3L J;  1OCT C;  1A5J A;  1QRY A;  2DJN A;  3A03 A;  3JRI A;  4J19 A;  2NS7 A;  4JX5 A;  2LP0 A;  3A02 A;  3SDG A;  1AKH B;  1OFC X;  1T56 A;  2O7O A;  3LSJ A;  3HOX J;  3HGG A;  3Q0U A;  4IHY A;  3FIW A;  5M5Y J;  1TWF J;  3MN2 A;  3MVP A;  3HM5 A;  2X6O A;  1JJ6 C;  3CQZ J;  2LFB A;  4BKX A;  1AKH A;  5HOD A;  3NAR A;  5FKL A;  2HYJ A;  5IPA A;  1R9T J;  1IUF A;  3LOC A;  3IH2 A;  3TW7 A;  1JUP A;  3S1R J;  3MKL A;  5J1U A;  3M3Y J;  3Q3S A;  1LFB A;  2LTP A;  4A3M J;  5IP9 J;  3DEW A;  2R93 J;  1ZQ3 P;  3HEF A;  2W48 A;  1JGG A;  1AHD P;  5F08 A;  2EZH A;  2TRT A;  4UUT A;  5E3L A;  3D1N I;  4A3J J;  4C3J J;  3BG9 A;  3HB9 A;  4BXX J;  3A01 B;  2EZK A;  3GBG A;  1JKP C;  2NS8 A;  1E3O C;  5C3E J;  1FJL A;  3GTO J;  5FKN A;  2FJ1 A;  3JRH A;  3G1L A;  3BR3 A;  2XSD C;  4IHV A;  1ORK A;  2IEK A;  4JP0 A;  2EZL A;  3IH3 A;  1B72 B;  5GP9 A;  5F04 A;  3Q0W A;  3BTJ A;  4FE4 A;  5FJ8 J;  2DA2 A;  2XGC A;  5IOZ A;  2Y9Y A;  1SAN A;  2DMN A;  5FLM J;  2AHQ A;  1UG2 A;  4A69 C;  1GV2 A;  1B72 A;  3CMY A;  2DA3 A;  1LFU P;  1XC5 A;  2X48 A;  1WCM J;  2JWT A;  4A3C J;  2R5Y B;  1UHS A;  1ZGW A;  3I4M J;  4D7M A;  4DYC A;  3LSP A;  2R92 J;  9ANT A;  4B3A A;  1PUF B;  1QPI A;  2CRG A;  3RZD J;  5EYR A;  1RET A;  1IV6 A;  2DA5 A;  2O9L A;  2R5Y A;  4B4C A;  2MGQ A;  1ITY A;  3F0C A;  1B8I B;  2QF7 A;  2Y9Z A;  4JX4 A;  1PUF A;  3FIS A;  2DMU A;  3JRE A;  2R7Z J;  3FK6 A;  2VKE A;  2Y31 A;  4XIC A;  3BTI A;  3S1Q J;  4MLO A;  2HXI A;  5M3F J;  5EDN A;  3ZQI A;  3BR2 A;  1P7I A;  3O8G A;  4XRM A;  2JA6 J;  1Y1V J;  5FLV A;  1WPK A;  4W97 A;  5GPC A;  4FIS A;  1X58 A;  1B8I A;  1RES A;  4ABZ A;  1GVD A;  1Z77 A;  4AYB N;  1NTC A;  4M6V A;  2LKX A;  1ETO A;  3TED A;  2E2I J;  5F1J A;  1ETQ A;  2ID3 A;  1FIP A;  1JTX A;  3JR9 A;  5F0C A;  3BT9 A;  3WHC A;  3G1M A;  4A3B J;  4HNV A;  2XGE A;  1JTY A;  3GTQ J;  3E7L A;  5C4X J;  4IHX A;  2WB1 N;  1DU6 A;  3G1O A;  2L7F P;  1EF4 A;  1OJL A;  2VI6 A;  4IHW A;  4S0H B;  3HGY A;  3S2D J;  1IDY A;  2XPW A;  1HF0 A;  2L0K A;  1MBE A;  5F27 A;  3ZOB A;  4JX6 A;  2I10 A;  3W6V A;  1JT6 A;  4QTR A;  5JLX A;  4DYR A;  3CDL A;  1H89 C;  5EF6 A;  3TP3 A;  3HKZ N;  3BR6 A;  4XID A;  5EZG A;  4FTH A;  2R5Z B;  2DA4 A;  3BQZ A;  1ZR2 A;  1MH3 A;  4MIM A;  1H88 C;  1GDT A;  3OSG A;  1MBG A;  4GFB A;  5M3M J;  4B1R A;  5E3M A;  1MSF C;  4BY1 J;  1QVT A;  4QSH A;  2R5Z A;  2NVX J;  1ZTR A;  1JJ8 C;  2L9R A;  2E2J J;  5EGO B;  3TW6 A;  1QVU A;  2EQR A;  5IP7 J;  4C2M J;  2MW8 A;  2JA5 J;  1TC3 C;  4BY7 J;  2ZB9 A;  1ENH A;  1U9N A;  2JA7 J;  2JJ7 A;  3GTP J;  5F0H A;  1ETV A;  2P81 A;  2G0E A;  1MBF A;  5EGO A;  2GLO A;  2NVQ J;  1MSE C;  2MG4 A;  2CQQ A;  4NDL A;  2Y2Z A;  5C44 J;  1W0T A;  3ZQF A;  3HOV J;  4FE7 A;  1NK2 P;  4RDU A;  1VND A;  1ETY A;  5IYC J;  4Y7N J;  3RZO J;  3GTJ J;  3A01 A;  1JT0 A;  2DA6 A;  1JKO C;  2RAE A;  1FTT A;  2HQ5 A;  4UUS B;  2HOS A;  2OPT A;  1TWG J;  4AUX A;  2EZI A;  3S14 J;  1VF9 A;  2K9Q A;  3GTM J;  4XK4 A;  2XB5 A;  5J1Y A;  3QPS A;  2NVY J;  1IRZ A;  2CUF A;  3BR1 A;  4A3I J;  3GTL J;  1GT0 C;  1JKQ C;  1K61 A;  3S15 J;  4M3F A;  2M8G X;  5DS9 A;  3IV5 A;  1W0U A;  1YRN B;  1BW5 A;  4IEJ A;  1BJZ A;  2L7Z A;  1ETX A;  1OCP A;  3LNQ A;  1U9O A;  5K7Z A;  3LSR A;  1HLV A;  1BW6 A;  5C4J J;  5FKO A;  2ME0 A;  2GBY A;  3BG3 A;  1HDD C;  2YU9 J;  2TCT A;  4C3H J;  1YRN A;  2M34 A;  5FKM A;  3QPL A;  3M4O J;  4XRS A;  3BR5 A;  1UMQ A;  4XRS G;  2NOG A;  3H0G J;  2HXO A;  5DTD A;  3S1N J;  2Y0S N;  3O8H A;  2NVT J;  2GM4 A;  4A3F J;  4MFE A;  2HOT A;  4L5E A;  4AC0 A;  4X6A J;  3DCF A;  2JN6 A;  3CCY A;  2XGD A;  4M3D A;  3JRC A;  3BR0 A;  3S16 J;  3JRF A;  4X1E A;  3ZQC A;  4M3E A;  3TP0 A;  1FIA A;  1I3Q J;  2VPR A;  2ECB A;  2KDZ A;  2LLK A;  3BQY A;  2K9N A;  2D5V A;  2JA8 J;  3OIO A;  3Q0V A;  3JRG A;  3I4N J;  1WGX A;  3RKQ A;  5F0F A; 
#chains in the Genus database with same CATH topology
 3OYB A;  4O5V A;  2XRL A;  4XLH A;  1U3E M;  1X3W B;  2CH0 A;  4LFU A;  3V7C A;  3GFM A;  3MKW B;  1F36 A;  3UKG A;  5DCF A;  3CP2 A;  5E18 F;  1IW7 F;  2ZFU A;  5GAG J;  4U87 A;  4LK1 F;  4IJA A;  3DF8 A;  2GOM A;  4CYC A;  5JFR A;  2V1X A;  4LK0 F;  3CF5 F;  4IPA A;  3GZN B;  5GPA A;  1V5G A;  5FLX K;  5IT3 A;  4EMS A;  2JMW A;  5E3O A;  4XR6 A;  1QBJ A;  3S3O A;  3KZZ A;  3PM1 A;  1ZR4 A;  3HC7 A;  5D6E A;  2W25 A;  2FE3 A;  5DD8 A;  3OYN A;  3HBL A;  2QBY B;  3I4P A;  2I5U A;  1W7P A;  5CQE A;  3HOU J;  1TP4 A;  3MEX A;  2CFO A;  2QCO A;  4ZYE A;  4KUM A;  3FXK A;  2HPI A;  2IAI A;  1SVL A;  2PI0 A;  1G3Y A;  4II3 A;  5TIS C;  1ZRE A;  2Y48 A;  2COB A;  3OOP A;  3CO6 C;  4ESB A;  3DLA A;  1QGP A;  2EFP A;  1FP2 A;  2DN0 A;  2Z5U A;  2PMH A;  2X6Y A;  3TO9 A;  5AIP A;  4BL0 B;  1JGS A;  3SJM A;  2LK2 A;  2GXA A;  1IGN A;  1KU2 A;  5L3E A;  1BI1 A;  1IN5 A;  2FD5 A;  5CVJ A;  3J7Z I;  4EEF G;  2BGC A;  3FBI B;  2M0C A;  3IP4 B;  2N8G A;  3OWT A;  1XX5 A;  5CVV A;  3HPH A;  1QA6 A;  1A31 A;  2M5W A;  2XKP A;  1MBK A;  4A5M A;  4WK8 F;  3PIP F;  3B6A A;  2E1N A;  4IHT A;  3CC4 I;  3KIO A;  5DM6 F;  3HDD A;  3QP5 A;  4P96 A;  3L9F A;  1YW7 A;  1G3W A;  2EFW A;  2PBI A;  1P92 A;  2VKV A;  3M8F A;  3TOB A;  1R7J A;  4G94 A;  4RGU A;  3AG4 H;  1FWZ A;  2A5Y B;  4BEH A;  1D3Y A;  3QAH A;  3I71 A;  1WI3 A;  3HG9 A;  2DPU A;  1J0R A;  1EKE A;  1D1A A;  2JUC A;  4I6Z A;  4XON A;  1MDM A;  3F8N A;  2HYF A;  3BTC A;  1CF7 A;  1GXQ A;  3TO7 A;  1D5V A;  3R0J A;  3WU1 B;  2VUM J;  3LA3 A;  1WFX A;  3GTK J;  3W3C A;  1IXR C;  2LBF A;  3FXQ A;  1WH7 A;  1O4X A;  4I0A A;  1FC3 A;  3GWZ A;  2XIG A;  4PDK A;  3EYY A;  3RQI A;  4ANJ A;  2JPB A;  1O3S A;  2OA4 A;  2EWN A;  1VTN C;  4A3G J;  3L7W A;  4FAS D;  2JPC A;  5J4V A;  1S6L A;  1FEX A;  3OYD A;  2WAQ N;  3K6G A;  1R1T A;  4JYK A;  3UNG C;  4D5C A;  5IP6 A;  2KQR A;  3N4M A;  5H2F C;  3F8C A;  2JVG A;  2CYY A;  1X3U A;  2P4W A;  5EG0 B;  4HOB A;  2H8R A;  1GUU A;  1JE8 A;  1UCR A;  1BOA A;  4PFP A;  1EA3 A;  2MLK A;  5K5R A;  2CQX A;  2VT2 A;  3M07 A;  4DNC A;  5EJC A;  1XSD A;  2IXS A;  3BWG A;  3GXO A;  3KFW X;  2BEO A;  2LY9 A;  5J4Y A;  1W36 D;  1BR4 A;  1MMD A;  1Q1H A;  1YS6 A;  1LPQ A;  1IO2 A;  1RRJ A;  1ZAO A;  3ZMT A;  4NQW A;  3WU0 A;  2ZKZ A;  4PCQ A;  4DBQ A;  1IDZ A;  4U0Y A;  2ZXW H;  1WHU A;  1WH5 A;  2F5V A;  4FHT A;  1D0Y A;  2K40 A;  3COA C;  3F23 A;  2GIV A;  2M2E A;  1FOY A;  4A3E J;  3PNY A;  5L3B A;  4M3B A;  2BHY A;  4P55 A;  2A69 F;  2H8W A;  2Y30 A;  2JK3 A;  5ED4 A;  3KYC B;  4KN4 X;  3QYB A;  3LQQ A;  1F9N A;  4TV7 A;  3BZK A;  3HUG B;  3HOW J;  3PO3 J;  3ROU A;  4BQO A;  3HJE A;  2R7R A;  5KVR A;  1HSJ A;  2ESN A;  1XGO A;  3A03 A;  3WGI A;  4J19 A;  2NS7 A;  3CME I;  3QPT A;  3GZ6 A;  2L9V A;  2STT A;  5FRM A;  4ZC3 A;  3Q0U A;  2A3S A;  1X19 A;  3JAM Z;  2RDP A;  1EH8 A;  2UV1 A;  5M5Y J;  3J81 Z;  2Q2E A;  1R1V A;  3MCZ A;  2F5D A;  3K4M A;  3PSI A;  3LL7 A;  1AKH A;  3OL4 A;  5FKL A;  3I0T A;  1V3F A;  1Y0U A;  3PNT A;  1GVJ A;  3E0J B;  1X4O A;  4MTE A;  5BS6 A;  3L09 A;  2VON A;  3C18 A;  3IH2 A;  1YS7 A;  3TW7 A;  4O6J A;  1VQ5 I;  1O57 A;  4E7K A;  2LTP A;  4A3M J;  4I09 A;  4AM3 A;  3DEW A;  1P4W A;  5E1Z B;  5JR3 A;  1GLN A;  2EZH A;  4CDG A;  4EJU A;  2CUZ A;  4C9Y A;  3OY9 A;  1R5G A;  3G3Z A;  4PUS A;  2VQG A;  1WI9 A;  3CLQ A;  3D1N I;  3ZMV A;  1SFE A;  1N78 A;  4XN3 A;  3SXY A;  4YIF A;  4A3J J;  2ACJ A;  3BCB A;  4L9N A;  1Z91 A;  2EA2 A;  3MZ8 A;  2EZK A;  4FX0 A;  2E35 A;  3GBG A;  4XMY A;  1JKP C;  2NS8 A;  4FQG A;  2G7U A;  5C3E J;  2L7K A;  2MH2 A;  3GTO J;  3B02 A;  2J5P A;  1R58 A;  4LB5 A;  1ULY A;  1FX7 A;  5HS7 A;  4GXO A;  3OYA A;  3BR3 A;  1ORK A;  2EIL H;  2K9M A;  1HKT A;  3P5J A;  1Y0N A;  4G6D A;  3DTK A;  1V54 H;  1QZE A;  1B72 B;  1Z21 A;  1J5Y A;  3I9V 2;  5F04 A;  1UZC A;  2XHK A;  2YR2 A;  4LD5 A;  1VQO I;  4PZJ A;  2DA2 A;  3HTS B;  3E5U A;  1YW9 A;  2XAS A;  2DMN A;  1KU9 A;  4CCJ A;  5B66 C;  3RJP A;  2E71 A;  3CMY A;  1XC5 A;  2GWR A;  2LMD A;  2CQN A;  4AYB A;  3OYC A;  3BJ6 A;  1UHS A;  2ZFW A;  1NHA A;  2R92 J;  5TGT A;  2LOO A;  4C2U A;  4DGW B;  1QPI A;  1XGM A;  2OC6 A;  4BQQ A;  2Z16 A;  3CJT B;  4BAY A;  3OYH A;  3BY6 A;  5EYR A;  1ZYR F;  3F6V A;  1IV6 A;  1WJC A;  1LQ1 A;  5B1B H;  1ON1 A;  4B4C A;  1B59 A;  2MGQ A;  3O2P E;  5B5E C;  3QPH A;  4A6E A;  2F5C A;  4YFX F;  3HTU A;  4KMU X;  2UXN A;  2AXT C;  3JRE A;  2XC7 A;  2R7Z J;  3I54 A;  2UWM A;  2W82 A;  4PJN A;  3BTI A;  4M72 A;  3R6S A;  2WTE A;  1YX5 A;  5EDN A;  1TLH B;  3BR2 A;  5J47 A;  2JA6 J;  1Y1V J;  1XN7 A;  1W36 C;  3H5R A;  3BG7 A;  3CZ6 A;  2XDV A;  3J80 K;  1GVD A;  4RS8 A;  2VC0 A;  1NTC A;  1WKM A;  4M6V A;  2OD5 A;  2DDA A;  1ETO A;  2E2I J;  5F1J A;  2XAG A;  1ETQ A;  4HQM A;  2L4A A;  2ID3 A;  3H0D A;  2HS5 A;  3FF5 A;  2FRH A;  3BT9 A;  3WHC A;  5JHF A;  4A3B J;  2FA5 A;  2XGE A;  5E17 F;  3CJN A;  3K1N A;  3CD6 I;  2HTS A;  2P6S A;  1Z7U A;  2M4G A;  2EFO A;  4L0Z B;  4HPQ A;  4XL9 A;  1QHG A;  3FMS A;  3O6B B;  1I1G A;  2P0W A;  1IDY A;  1IN6 A;  4R79 A;  2VT3 A;  4HX7 A;  1J2X A;  2L0K A;  1Y39 A;  2NAZ A;  4RM2 A;  5FD5 A;  3ZOB A;  3KEY A;  4CCN A;  4QTR A;  4BHC A;  2BVL A;  3T8T A;  4P9U A;  1XMK A;  4DYR A;  1A6Q A;  3I55 I;  3DPT A;  2YSR A;  1LDK B;  5HS8 A;  4XID A;  2OZU A;  3H35 A;  4Y13 A;  2LSO A;  2P8T A;  2E36 A;  2DA4 A;  3DTE A;  1MH3 A;  4B09 A;  1V55 H;  2EIN H;  1H88 C;  1WJF A;  2IA0 A;  1IN8 A;  1FOW A;  4LJZ F;  5KAI C;  3ZPL A;  4F55 A;  4GFB A;  2DYR H;  3HHG A;  4B1R A;  5E3M A;  4IZZ A;  4N9H A;  3K10 A;  4A6D A;  2R5Z A;  2L9R A;  2E2J J;  3ABM H;  3CCQ I;  2W84 A;  1OCC H;  2MW8 A;  2V9P A;  3PQK A;  3LAP A;  2NOJ B;  4BY7 J;  1ENH A;  5HDG A;  2JA7 J;  1RR8 C;  4ESF A;  5FRN A;  2QWW A;  4E7Z A;  4L5J A;  2F5F A;  2YX4 A;  2XRO A;  4LIV A;  2G0E A;  1VQK I;  1VQM I;  3K70 D;  3RYR A;  3AG1 H;  3HOV J;  5K5Q A;  2P6T A;  3FM3 A;  4BXU A;  1VND A;  2HFH A;  1ETY A;  1N77 A;  4Y7N J;  1XCB A;  3RZO J;  3BRO A;  1UHM A;  2DA6 A;  3K1M A;  1FTT A;  3RYP A;  2BOL A;  2HQ5 A;  2WWY A;  2OU2 A;  4WXC A;  1I5Z A;  4P5O A;  3QWL A;  4QPO A;  3S14 J;  4MQV A;  1VF9 A;  2K9Q A;  1FPQ A;  2RRE A;  4OWR B;  3KYL A;  5LGT A;  5J8C A;  3BR1 A;  4XRF A;  1BI2 A;  2K3P A;  1TT0 A;  3BJA A;  4XKC A;  3D5S C;  1OYY A;  4X0G A;  3OS2 A;  3S15 J;  2M8G X;  1JXS A;  1YFH A;  4EQQ A;  3FMQ A;  4EVI A;  3H92 A;  1FMV A;  1PP8 F;  1E3P A;  2IGK A;  3ERM A;  3M1E A;  1U9O A;  2I8D A;  2OQR A;  1U5T A;  2OBP A;  5D4R A;  5ICE A;  2ME0 A;  3LFK A;  2KJB A;  3BG3 A;  3N05 A;  4XSX F;  3V42 A;  3ONQ A;  4P9F A;  4C3H J;  4OAZ A;  2OQG A;  3OYK A;  2VBZ A;  4GRI A;  3QPL A;  3M4O J;  2IS4 A;  1A35 A;  1ZLK A;  3F3X A;  1UMQ A;  3WTU C;  4XRS G;  1MMN A;  1QZY A;  4BHB A;  4S04 A;  2D1H A;  3V4G A;  2OCE A;  3O8H A;  3MAJ A;  4ZDO A;  2NVT J;  2IA2 A;  3I64 A;  4EV0 A;  1MKM A;  5HLT A;  3FZV A;  3I59 A;  2JT1 A;  3RI4 A;  1FLI A;  5J8F A;  3Q9V A;  2JN6 A;  2PQ8 A;  4M3D A;  2XSJ C;  3JRC A;  1LJ9 A;  3RQ4 A;  3S16 J;  3JRF A;  4X1E A;  3ZQC A;  3BC8 A;  1ZRC A;  2V1N A;  1W5S A;  4B44 A;  2ZXJ A;  2M3A A;  2QUF A;  4Y3O A;  2VBY A;  2EA4 A;  2JA8 J;  3I4N J;  3JRG A;  4KT6 A;  2RVC A;  3KET A;  1RKW A;  3CCJ I;  3LSK A;  4LLN A;  4U0W A;  5CLS A;  4LG0 A;  4UVA A;  2L3D A;  2ZC2 A;  1I6X A;  3JSO A;  3F72 A;  3Q5F A;  1ONV A;  5IYB J;  1SAX A;  5IYD J;  2QEX I;  4PGG A;  4KMF A;  3CF2 A;  4MO7 A;  5M5X J;  2IBD A;  2STW A;  1R22 A;  5E8I A;  3U1D A;  5DV5 A;  3MWM A;  2DTZ A;  3S1M J;  3JW4 A;  2FOK A;  4E7S A;  3B73 A;  4XOR A;  1POG A;  1E3H A;  2LKP A;  3G4S I;  4A2U A;  5J3L A;  1SC7 A;  1Z05 A;  1W4M A;  2F4M B;  2HWV A;  1SFK A;  4PJ0 C;  2DMQ A;  4WXD A;  3MZY A;  1T38 A;  4I0B A;  2X9D A;  1BL0 A;  2DA7 A;  4XKB A;  2DTR A;  3K4N A;  4EJO A;  2EIJ H;  3NEU A;  1WRJ A;  4A3K J;  1G2H A;  2IA1 A;  4CZC A;  3ZP5 A;  1ETK A;  5GAE J;  1FT9 A;  2EH3 A;  4F92 B;  3E5Q A;  1S7O A;  3BPV A;  2DDB A;  4G12 A;  1HW5 A;  1OPC A;  1J75 A;  1E2X A;  4A93 J;  2LDU A;  3TKY A;  4XKV A;  2QBY A;  1IXC A;  1K7A A;  1OR7 C;  2KZG A;  3NAU A;  2MSY A;  3M8E A;  4Y33 A;  2C6Y A;  3K4K A;  2WAE A;  4HAM A;  1BR2 A;  2X1C A;  1SD7 A;  2BYV E;  2ECC A;  1LDJ A;  4I7H A;  4OIQ F;  1UEL B;  2FBI A;  3HOZ J;  1ZEL A;  1T0F C;  5M5W J;  3KZY A;  1Q1V A;  4HDV A;  4BBS J;  4NHJ A;  2XVC A;  4DYQ A;  2AO9 A;  3K70 C;  1U8B A;  5LD2 C;  1O7L A;  1WQ2 A;  4Y15 A;  3HHH A;  4CH7 A;  2FF4 A;  3NWT A;  2YU3 A;  2YUS A;  3FDY A;  2FQ4 A;  4LIU A;  3SFI A;  1D5Y A;  2CGP A;  2R7Q A;  1IC8 A;  2QQB A;  2BBY A;  4XOP A;  3NWS A;  2XV4 S;  5JVT A;  3A2K A;  4HNT A;  1R36 A;  3QOE A;  1MD0 A;  4M3G A;  2HYG D;  4WWC A;  1B6A A;  3JRB A;  5FLX Z;  1XSV A;  1D0Z A;  1MGT A;  3OIP A;  1MBJ A;  3E6C C;  2UUZ A;  4XSZ F;  3QU6 A;  4FET A;  3E1S A;  5HDK A;  3NQO A;  3EUH C;  1IRF A;  4HDU A;  2PMZ A;  3H3V K;  2X6W A;  3E6B A;  3MQ0 A;  4W1U A;  2FX0 A;  2CJJ A;  2IT0 A;  3G6E I;  3R61 A;  1S7E A;  4H0E A;  1PUE E;  4B43 A;  1X1B A;  2GA2 A;  2LVS A;  2PG4 A;  1G3T A;  2XAQ A;  1KU7 A;  5E3N A;  5KNL A;  4JOM A;  1X1A A;  2R7U A;  2NNN A;  1LEB A;  4QPQ A;  3VFZ A;  1UG0 A;  1WWX A;  4KIG A;  4ASN A;  1R23 A;  2VXD A;  5JLW A;  2QM3 A;  2ELH A;  1OR7 A;  1TWH J;  3TGN A;  1B9N A;  3LST A;  1F1Z A;  1UHW A;  2VKH A;  4BAC A;  1H9G A;  1CGP A;  2MD0 A;  4HRI A;  3K7A J;  3ZR8 X;  3QOD A;  1NG7 A;  1T0F A;  2GXG A;  2M9H A;  2A07 F;  3W6K B;  4LOC A;  3TBI A;  1Z0X A;  2HZD A;  2BVM A;  3MZH A;  3SZG A;  1T2K A;  3KYD B;  2HTJ A;  2FBK A;  2WV1 A;  1XDS A;  4V2G A;  1A04 A;  1P4A A;  1TT5 B;  4Q5S F;  1O3T A;  1CQT A;  2A61 A;  2QSG X;  4IVN A;  2PX9 A;  1ZRF A;  2V9V A;  5EG0 A;  4L9J A;  1VFC A;  2KRF A;  4BGD A;  1LE8 B;  4RLF A;  3DBR B;  2MH9 A;  4OMY A;  2QSF X;  1F43 A;  1KON A;  2EJR A;  1BA5 A;  3IH4 A;  3MMY B;  4JBA A;  3R4K A;  4KIT B;  4M9X A;  3U1K A;  3CMM A;  3L2Q A;  3EUH A;  5ILV A;  4UV8 A;  3Q9S A;  2MAB A;  3KLN A;  1ZRD A;  2CV0 A;  3IRQ A;  5JHU A;  4DZP A;  3F21 A;  2BY1 A;  2XUB A;  2DA1 A;  1X1C A;  2EIM H;  5EZH A;  2V79 A;  4AIJ A;  2KHM A;  3GF2 A;  4UVC A;  4A3L J;  3DKX A;  5CQG A;  4XNF A;  4YEL A;  2F5E A;  4BQN A;  5LGN A;  3ECH A;  3SDG A;  5LRR A;  1OFC X;  5H6Q A;  3BCA A;  3DTI A;  2O7O A;  2OZ6 A;  3HUG A;  4E70 A;  3LA7 A;  4OAY A;  4IHY A;  3LSI A;  4YIR X;  3MN2 A;  1S3J A;  2X6O A;  3H9J A;  3HRM A;  4N4N B;  3CQZ J;  2LFB A;  3RKX A;  2IGO A;  3DKY A;  1SMT A;  2CFX A;  2P5K A;  1XGN A;  3NAR A;  5FO5 A;  3RDI A;  1R9T J;  4DOZ A;  1OCR H;  1X1D A;  2BXY A;  1IUF A;  1Y8Q B;  3KX2 A;  1V5E A;  2M0M A;  1SD6 A;  2P5V A;  3J7A O;  5L3F A;  4UUV A;  5EEH A;  4ZJZ A;  1MIJ A;  2M7B A;  2R93 J;  3ZGK A;  3HEF A;  1JGG A;  3SHF A;  3HSE A;  5F08 A;  2DXI A;  2QQ8 A;  3K0L A;  2YPR A;  3WU2 C;  3VWB A;  3IKT A;  2GZW A;  5IT9 K;  4UUT A;  5E3L A;  1S9H A;  2LG4 A;  4KYW A;  3HB9 A;  3ISP A;  4UHT A;  3A01 B;  3PQJ A;  4CHU A;  1BI0 A;  1T8I A;  3LWF A;  4XOT A;  1FJL A;  4EAT A;  3IAS 2;  1VQ7 I;  4KNY A;  1ZGA A;  2ZME B;  3HYI A;  5LHG A;  3CCE I;  2RKH A;  4IQJ A;  3HOT A;  5FKN A;  1R4N B;  3AL0 C;  3G1L A;  2L4M A;  2XSD C;  4IHV A;  1ZH5 A;  2NNY A;  2E7W A;  4JP0 A;  2EZL A;  2XF7 A;  3IH3 A;  5HVQ C;  2ZJ2 A;  4MNU A;  3PUB A;  2H1L A;  3DU6 A;  4YFN F;  2XGC A;  5DDG A;  4M6X A;  3T5X A;  3KLO A;  1HA8 A;  2IS2 A;  4HSR A;  4IKF A;  3C3W A;  1B72 A;  2K86 A;  1LFU P;  3K1P A;  3CUQ C;  1P4X A;  4G6T B;  4BE1 A;  2JWT A;  3PFI A;  2R5Y B;  1ZGW A;  3I4M J;  4D7M A;  3FKJ A;  4KIC A;  2Y0M A;  4B3A A;  2VE9 A;  1PUF B;  2UZK A;  1MJ9 A;  4ZYG A;  3RZD J;  1FSE A;  1QNT A;  2W4S A;  2HR3 A;  4PJJ A;  3A0H C;  4XN0 A;  2YX7 A;  2WB1 A;  2HVS A;  3OYG A;  2F2E A;  1FBS A;  2R7F A;  3F0C A;  1B8I B;  1I1S A;  2KMU A;  2O5R A;  1RC9 A;  2IGN A;  2VQL A;  1Y8R B;  3DPL C;  3HL2 A;  5ICF A;  3EQL F;  2BZT A;  2RNJ A;  3S1Q J;  2BHZ A;  1P7I A;  4IO9 F;  3AAF A;  4BH9 A;  1WPK A;  3HKZ A;  1X58 A;  3SZT A;  2DQL A;  3KP5 A;  4AYB N;  2KL4 A;  2L54 A;  2LKX A;  3OYE A;  4A0Y A;  2QQ9 A;  1DDN A;  4OIO F;  3TDZ C;  1FIP A;  2P7V B;  3JR9 A;  5F0C A;  5F6F A;  2GXB A;  1JTY A;  3V8J A;  3GTQ J;  1I27 A;  1E17 A;  3BZC A;  4CCM A;  1X4P A;  2R7T A;  2Y75 A;  1YJ9 I;  1DU6 A;  4KIS A;  2A5W A;  4IHW A;  1NH3 A;  1L3L A;  1OIS A;  2DO7 A;  2HDW A;  3CO7 C;  4JX6 A;  2I10 A;  3FHZ A;  1OYW A;  5JLX A;  3S2W A;  1S7A A;  1P2F A;  2CS3 A;  3S3M A;  5LEK A;  3CDL A;  4S05 A;  4A5N A;  1OKR A;  2VBW A;  3GLX A;  3C1D A;  3TP3 A;  3BR6 A;  2BXZ A;  2DYS H;  4G7Z F;  2KRC A;  4BDZ A;  2K4J A;  2QKM B;  3V8L A;  4HV5 A;  1PVE A;  3M7G A;  4F91 B;  2DFI A;  5D8K B;  2ZCW A;  1MBG A;  3KP7 A;  5M3M J;  2IS6 A;  2ESH A;  2QKL B;  3L2C A;  1RUN A;  4BY1 J;  1XDU A;  2R7W A;  4ZH4 F;  4GYI A;  3JSP A;  3J80 Z;  1MJB A;  2EV5 A;  4PSW A;  1RNL A;  2KIM A;  3A4C A;  2DOF A;  2ZB9 A;  2V6C A;  1YX3 A;  4HBL A;  3MFK A;  1G8X A;  3DBL B;  5BPI A;  2JJ7 A;  4M9S A;  5F0H A;  1REP C;  2NVQ J;  4NDL A;  2KIS A;  1VQ8 I;  1JHF A;  2JRT A;  2F6C A;  2NXN B;  3GO5 A;  3ZQF A;  4FE7 A;  4CXF A;  1W0T A;  1E0E A;  1R5H A;  1PDN C;  4QLC U;  1XCV A;  4KIB A;  1JKO C;  1K4S A;  2FNA A;  2RAE A;  2OTL I;  2DW4 A;  1SVM A;  1DPU A;  2DU9 A;  3L2R A;  4CUG A;  2KLO A;  3KP6 A;  4AUX A;  1TWG J;  3OYM A;  2EZI A;  3HRT A;  3UR3 C;  3SYT A;  3K4C A;  2XB5 A;  5J1Y A;  3O3K A;  4OU0 A;  5FFZ A;  2KPM A;  3V7R A;  2CUF A;  2W1O A;  2DT6 A;  2VKD A;  5LEJ A;  2B9S A;  4IHS A;  4LG3 A;  2O6G E;  1J59 A;  1KQ8 A;  4M3F A;  1YRN B;  4LB6 B;  1D1B A;  4E7H A;  1BIA A;  1BJA A;  2L7Z A;  2D45 A;  2XAJ A;  4O3M A;  4KIF A;  3LNQ A;  3LSR A;  1HLV A;  3BOQ A;  4ZZD A;  2EV6 A;  5K1Y A;  2P7C B;  5L3D A;  2DPD A;  2QGU A;  1ZAR A;  3FXR A;  3RPU D;  3ABT A;  3BR5 A;  4GDF A;  4ITV A;  2NOG A;  3H0G J;  3AL0 B;  2VC1 A;  3E5X A;  1R71 A;  1XB4 A;  4YEJ A;  3TMO A;  2GM4 A;  3DFG A;  4ZTF A;  2R7V A;  1YQA A;  3U9G A;  4MFE A;  4L5E A;  2BY2 A;  2CQK A;  3DCF A;  4A0Z A;  1T39 A;  3CCY A;  3BR0 A;  3G71 I;  2K02 A;  3WTT C;  2ECB A;  5L3C A;  2ZBK A;  4L9T A;  3CUQ B;  3U2R A;  3BQY A;  2D5V A;  5KHD A;  2WAD A;  2Z33 A;  1WGX A;  4G7O F;  3RKQ A;  3LQR A;  4LGW A;  3SZP A;  1ZG1 A;  3IWF A;  4BE2 A;  4ENN A;  4OMZ A;  3OSF A;  4QIW N;  1FBQ A;  2XB0 X;  3IUO A;  3BP8 A;  4MGR A;  3LAJ A;  1ETW A;  3S3N A;  3F8M A;  2E19 A;  2DOD A;  4HW0 A;  3VEP A;  1HW1 A;  1MBH A;  1MMA A;  1PYV A;  4A0X A;  4I01 A;  2QSH X;  4NC8 A;  2ELK A;  2H1K A;  4HA8 A;  1YW8 A;  3HOS A;  4JQF A;  2A6H F;  2R3S A;  2H6B A;  4NC6 A;  3U21 A;  5J6X A;  2A68 F;  3L2W A;  1M1E B;  2Q2E B;  2TDX A;  2ISY A;  3JRA A;  5HNF A;  1Y1W J;  1R5I D;  5A2Q K;  3VB2 A;  2E34 A;  2OV7 A;  1FYL A;  3TL4 X;  2X4H A;  3GX4 X;  5D5W B;  4KA4 A;  2LF7 A;  2YS9 A;  4PJL A;  3W6J B;  2GIZ A;  2HNH A;  1WZ2 A;  1U8R A;  4RAF A;  3QQA A;  3CUO A;  3DEE A;  1L0O C;  3FBN B;  2PJR B;  4Y52 J;  3LSG A;  3KE2 A;  2DCE A;  1HQC A;  4XLP F;  4D7N A;  1Z3X A;  2JSP A;  2HKO A;  1RIO H;  3OOU A;  1N75 A;  4ESJ A;  1HW2 A;  4NC7 A;  3DBH B;  2OAZ A;  4C3I J;  2F48 A;  1HCR A;  1T6S A;  1X2M A;  4HNU A;  5LGU A;  4XKW A;  4RAZ A;  1G3S A;  3P7N A;  3DP7 A;  5ICG A;  3ZN0 A;  2HDD A;  2XRN A;  2VPL A;  3ZQG A;  3VOD A;  5K7H A;  2DMT A;  2KP6 A;  3B6C A;  1BBY A;  3RSN A;  1GV5 A;  1KQ0 A;  2RC4 A;  2JZY A;  3VSK A;  1NK3 P;  2JA2 A;  2B7E A;  3ZQH A;  5H6R A;  1AWC A;  2HU9 A;  3ABL H;  3PO2 J;  1T33 A;  3GTG J;  3R0A A;  2ISZ A;  2CW0 F;  1IRX A;  4K2E A;  4BJ5 C;  3LA2 A;  1N25 A;  1IAW A;  2X1E A;  1SMY F;  5D8L B;  2BY3 A;  5L3G A;  3BG5 A;  4UUS A;  3ECO A;  3DPU A;  4I76 A;  3VPR A;  1GXP A;  1DP7 P;  4BHP A;  1QO0 D;  2WAF A;  3WHB A;  4F52 A;  1JUM A;  4AU7 A;  5ILS A;  4A3D J;  1LUJ B;  3HOY J;  1VQ4 I;  2WBM A;  4D0P A;  2CUE A;  2ZJP F;  1O3Q A;  1ZKG A;  1IJW C;  2FBH A;  4CYD A;  2CU7 A;  2HVQ A;  1STZ A;  1XG1 A;  3FXL A;  1K78 B;  1Z7L A;  3WOD F;  3OR1 C;  1VI0 A;  4KDP A;  1RKT A;  1JKR C;  5BOX A;  4AVP A;  4ZYD A;  4B8X A;  4GGG A;  3C2H A;  3WG7 H;  3WTZ A;  2KT0 A;  4PK4 A;  5DUK A;  4IXA A;  3VYU B;  5D4S A;  1MMS A;  2L2O A;  3IAM 2;  3JTG A;  1FBU A;  1OLT A;  3DWL E;  1W7P D;  2KIU A;  2ZSI B;  4N9I A;  1Y56 A;  2PMZ N;  5JI6 A;  3E3V A;  1X2N A;  4BUP A;  3HSR A;  1KYW A;  3KP3 A;  5K7F A;  3QU3 A;  3VYR B;  3C2G A;  2HEO A;  1FOX A;  3DU5 A;  5FD6 A;  2DOA A;  3L00 A;  3QYF A;  3ZXS A;  2R0Q C;  2DOE A;  3VYT B;  1GHC A;  2WA0 A;  1DU0 A;  2O8K A;  4P1W A;  3DLL F;  5FFX A;  1I50 J;  2V1U A;  4IOA F;  1ZK8 A;  3LMM A;  4RA2 A;  2QQA A;  1IG7 A;  3FXJ A;  1ODD A;  3ESW B;  1SFO J;  3WGH A;  5KAF C;  1ZN2 A;  3L1P A;  3V7S A;  1Z1D A;  5FKK A;  2EPF A;  5BNG A;  3I56 I;  1LE8 A;  1FMW A;  1H8A C;  4FX4 A;  3C7J A;  3H3Z A;  1EJ9 A;  1K83 J;  1TWC J;  5LHI A;  2A6T A;  5DM7 F;  1OCT C;  1A5J A;  4BQA A;  4R8H A;  4BU2 A;  2DJN A;  2MD5 A;  2AXL A;  3JRI A;  2LP0 A;  3A02 A;  3GVA A;  3CCM I;  4BNC A;  2CSO A;  2O3F A;  1T56 A;  2DQR A;  4ZTJ A;  3HOX J;  2KDO A;  2MA3 A;  2ZME C;  3FIW A;  1K4T A;  2Z3Y A;  5GTI C;  1WSU A;  4L9V A;  2PEX A;  1KZH A;  1R00 A;  3MVP A;  3OYJ A;  1JJ6 C;  2RGV A;  1DPR A;  2G7H A;  5HOD A;  1TZL A;  4BXF A;  2HYJ A;  3ZMS A;  2ZNY A;  3WTY C;  1ZGJ A;  3LOC A;  3IHU A;  2NVU B;  1UFM A;  1JUP A;  1IN4 A;  3MKL A;  5J1U A;  3M3Y J;  3Q3S A;  4D1Q A;  4G7H F;  4WX9 A;  5K5O A;  3GME A;  2IVM A;  3WG9 A;  2FQ3 A;  1G59 A;  3KZI C;  3N97 A;  3K2Z A;  4M6Y A;  1KYZ A;  2W48 A;  5TRD A;  1HBX G;  1AHD P;  4Q4Z F;  3P9I A;  3PFY A;  5FB2 A;  3CLO A;  4RAY A;  1S29 A;  2TRT A;  3OV8 A;  3S93 A;  1V5F A;  3F22 A;  1T95 A;  4Z6Y A;  4RGR A;  4C3J J;  4MTD A;  4HQE A;  2E1M B;  3F6O A;  1Y6I A;  1E3O C;  2V4J C;  3I53 A;  4M71 A;  1TQP A;  2ZSH B;  3BDD A;  1YJN I;  3A1Y A;  2FJ1 A;  2MC4 A;  3QRF F;  3FXO A;  1DUX C;  2IEK A;  5BMZ A;  2Z99 A;  5GP9 A;  4HX4 A;  3F9K A;  2ADU A;  3W2W A;  4ON0 A;  4PJM A;  5FJ8 J;  2ELJ A;  2ZME A;  2K4B A;  4IL6 C;  5JVG F;  2Y9Y A;  1SAN A;  3IWZ A;  2H94 A;  5FLM J;  2AHQ A;  1UG2 A;  2VJ4 A;  2BY0 A;  2DA3 A;  1LVA A;  1YHQ I;  3EET A;  3I5U A;  3SEQ A;  3OS1 A;  2X51 A;  4WCG A;  1WCM J;  3ABK H;  4A3C J;  2DFF A;  4LLL A;  4IOC F;  3NRV A;  1VQN I;  4DYC A;  3LSP A;  3BPX A;  2FU4 A;  3JCU C;  1MND A;  2CRG A;  1H9T A;  4NUB A;  4NB5 A;  4ENK A;  3GW2 A;  5IT9 Z;  2HOE A;  3REO A;  3W2V A;  1RET A;  2WY7 Q;  2DA5 A;  4BDY A;  1P6R A;  2FUG 2;  2R5Y A;  5CKT A;  1ITY A;  2KIQ A;  4E7I A;  2E5N A;  2VE8 A;  4MQ9 F;  4MHG A;  1FZP B;  2DFE A;  1FP1 D;  1WVR A;  1YYV A;  2QF7 A;  1OYI A;  4B48 A;  2Y9Z A;  2DMU A;  1PUF A;  1SAU A;  4ENJ A;  2E1C A;  1UJ8 A;  1VQ6 I;  3GCM A;  2B0L A;  2Y31 A;  4XIC A;  1T98 A;  4MLO A;  2Z1D A;  3ZQI A;  2DT5 A;  3VOE A;  2CW7 A;  5FLV A;  2A05 A;  1HC8 A;  2Q0O A;  4W97 A;  1YE9 A;  2E60 A;  2ZXI A;  2VOD A;  3GFJ A;  2QVO A;  1B8I A;  5E8G A;  3CES A;  2CWE A;  1OQY A;  2DK8 A;  3TED A;  2AQE A;  3CJR B;  1YIO A;  2ICW G;  2QA4 I;  4V19 K;  2KJC A;  3HZJ A;  4HNV A;  2DK5 A;  3QOP A;  3W2A A;  2NYX A;  3E7L A;  1HXD A;  1S8N A;  4IHX A;  2WB1 N;  4U88 A;  3CJQ B;  3BG6 A;  4S0H B;  3S2D J;  1MZB A;  2MC3 A;  2BW3 B;  1HF0 A;  3TOA A;  2LRD A;  1QHH D;  3FM5 A;  3SEZ A;  1TNS A;  3W6V A;  1I39 A;  4DIQ A;  2V6E A;  2E5Z A;  5EF6 A;  2GOX B;  3HKZ N;  4I98 B;  4L18 B;  3PNV A;  3L2U A;  2W00 A;  4FTH A;  2IS1 A;  4CCL A;  1ZR2 A;  4AIH A;  1I3A A;  2VXZ A;  1GDT A;  5GTH C;  2CMP A;  4R1H A;  1QZZ A;  2LY1 A;  3OS0 A;  3PIO F;  1MSF C;  1TQI A;  2H27 A;  2NVX J;  1ZTR A;  4HX8 A;  5EGO B;  2WV0 A;  4HZF A;  2O0Y A;  2EQR A;  5IP7 J;  4ZDL A;  4C2M J;  2LKS A;  2JA5 J;  3TO6 A;  3M8J A;  1TC3 C;  5HNH A;  1U9N A;  4QWQ A;  2HGC A;  4I99 C;  2QEN A;  4HF2 A;  3K4B A;  4RM3 A;  3K4L A;  3IL2 A;  1YIJ I;  2JSC A;  3GTP J;  2XF6 A;  1ETV A;  2V7F A;  2VBX A;  5TJJ A;  1D8J A;  1MBF A;  2FSW A;  2A6E F;  2HQR A;  2GLO A;  1MSE C;  1Z67 A;  2CQQ A;  2MG4 A;  2P5L C;  5EEG A;  2Y2Z A;  5C44 J;  2Z2S B;  1NK2 P;  2VN2 A;  1BR1 A;  2COM A;  2WC2 A;  4HF0 A;  4UB8 C;  4CZZ A;  1F4K A;  1SD4 A;  2VJI A;  4G8X A;  1USS A;  2KFD A;  4J00 A;  3WE2 A;  5LHH A;  2JQ7 A;  3GUD A;  3KP4 A;  4HST A;  2Z9O A;  4GCV A;  5DCM B;  2Y0S A;  3CC2 I;  2UXX A;  2LH9 A;  3GTM J;  4XK4 A;  2VLA A;  2XF5 A;  2HDC A;  3QPS A;  4A3I J;  1Z6T A;  3GTL J;  3K4J A;  1GT0 C;  3H9G A;  4ZDP A;  4HLX A;  2PMU A;  4RGS A;  1RZ4 A;  1K61 A;  3IV5 A;  4UNO A;  1BW5 A;  4IEJ A;  2K5C A;  1YTY A;  3BJO A;  1X3Z B;  2O03 A;  2H6C A;  1ACI A;  5K7Z A;  3CCV I;  1BW6 A;  5C4J J;  4ZYA A;  2MLG A;  4HYE A;  5FKO A;  2GBY A;  5IY5 H;  1HDD C;  2E7X A;  1K6O A;  2YU9 J;  2VAS A;  1YIT I;  5DD4 A;  2FXA A;  1HKS A;  1YRN A;  1SFU A;  2M34 A;  2LC2 A;  5HLI A;  1J09 A;  4XRS A;  1XPX A;  2NRA C;  2HQN A;  2ZJR F;  1X1P A;  4YRV A;  3D0S A;  2R7O A;  2KKO A;  4ZYH A;  4B3X A;  2HXO A;  4H4K C;  2M45 A;  5F1R A;  1D1C A;  4M9Z A;  4Q47 A;  1DGR M;  2HOT A;  3GZ5 A;  3PL8 A;  2EFN A;  4X6A J;  3AKZ A;  2XGD A;  1G4D A;  1OCO H;  3KP2 A;  2VL8 A;  3TDU C;  2GQQ A;  3ZN1 A;  3GFL A;  1WJE A;  1YG2 A;  5HLH A;  3TP0 A;  4DJA A;  1FIA A;  2CQ7 A;  2KDZ A;  2X6X A;  2Q8K A;  2IW5 A;  3A0B C;  4IF4 A;  5B3S H;  2QZ8 A;  1U6G A;  3Q0V A;  3CC7 I;  3T0Y A;  5DUI A;  4OIP F;  3AG2 H;  5F0F A;  1QPM A;  3HRU A;  4CYC B;  1ZHF A;  1H0M A;  3H3U A;  3CUQ A;  3RCO A;  1B4A A;  3ZQQ A;  5D5U B;  5HS9 A;  2K3F A;  1KU3 A;  2XKO A;  1RI7 A;  4RB3 C;  4OOI A;  4BYY A;  1BM9 A;  5KCM A;  1B1B A;  2K9L A;  3BZ6 A;  4Z2Y A;  1XS9 A;  3S17 J;  1FNN A;  2LD5 A;  3FXU A;  2K9S A;  4UV9 A;  1W7P B;  3JRD A;  2EB7 A;  3JTH A;  2E1O A;  3AG3 H;  5H20 A;  4RB1 A;  3G73 A;  4PGH A;  2IGM A;  3OR2 C;  4LMY A;  4D5F A;  5LLQ A;  1RPW A;  3EYI A;  3SFZ A;  4E7J A;  5B1A H;  2V1D A;  1LB2 A;  4AIK A;  1O3R A;  1A6I A;  1MNM C;  5ICC A;  1D8K A;  1WJB A;  5DYM A;  3T8R A;  1IV8 A;  1VZ0 A;  2W24 A;  2HOA A;  4EJT A;  5CYV A;  3D5L A;  2VJ5 A;  1MH4 A;  1FSH A;  2L9S A;  2MYS A;  3S2H J;  4F3Q A;  4C30 A;  1YJW I;  1HOM A;  2VIX A;  3VDX A;  4J01 A;  4EGZ A;  4M74 A;  2VQH A;  3CCU I;  3CCR I;  5EEA A;  1HST A;  3CCL I;  2PJR A;  4YG2 F;  1JUS A;  1S5L C;  1J9I A;  2EV0 A;  2CV2 A;  1BN5 A;  1EH7 A;  1TW3 A;  4BBR J;  1P7J A;  1TL8 A;  1DP3 A;  3H9Q A;  4II2 A;  1FY7 A;  3HIF A;  5E20 A;  1AOY A;  3H5N A;  1RR7 A;  5J1R A;  1BC8 C;  4DW6 A;  4B47 A;  4BEH B;  1R6R A;  4V2F A;  2AS5 F;  3HXL A;  5IOY A;  3ABU A;  1XSX A;  2XPU A;  4L0Y B;  1FTZ A;  2WAQ A;  3S32 A;  1MDM B;  1CF7 B;  2W85 A;  5CVR A;  2IRF G;  1APL C;  2PLY A;  1ZG3 A;  2GA1 A;  4AID A;  4ENM A;  4XM3 A;  5A2Q Z;  4MFD A;  2K27 A;  2LBF B;  4N4O B;  3AFH A;  1C0W A;  2EBI A;  2XGX A;  2BE5 F;  3BTL A;  3CTA A;  2HI3 A;  2FML A;  3RTR A;  2OTJ I;  3ZMD A;  3MKY B;  4FCY A;  2QLZ A;  2DBB A;  4IRG A;  4BE0 A;  3FKI J;  5CJ9 A;  1VQ9 I;  1ERD A;  1TWA J;  1EV7 A;  2ME6 A;  3CMA I;  2VJJ A;  4HF1 A;  1Z3Y A;  2L02 A;  3ZMU A;  3ZMZ A;  2B63 J;  3E6M A;  2K85 A;  2JVH A;  1IN7 A;  5J40 A;  2BV6 A;  1T08 B;  1AU7 A;  1S72 I;  4ETS A;  3OYL A;  2RQQ A;  4Y17 A;  1HKQ A;  4I2O A;  3EDP A;  2E2H J;  2OUM A;  3RPQ A;  2CV1 A;  3C2B A;  4PSX A;  4I02 A;  3ZQL A;  1MJA A;  4BS9 A;  1D0X A;  3JAM K;  5D6F A;  2M1B A;  3KEQ A;  4RGX A;  3ML6 A;  3J81 K;  1FOK A;  3J7Y J;  3WTX C;  2L7M P;  1K78 A;  4RAG A;  3OYI A;  4G6Q A;  5GAD J;  4NQW B;  3OL3 A;  3RKY A;  5CVU A;  1KGS A;  1I6H J;  3K2A A;  2DMP A;  2LNB A;  4A12 A;  1UB9 A;  2MFZ A;  5LBQ A;  1HDP A;  1IRG A;  3SDB A;  4KFC A;  4DZJ A;  4RBO A;  5HDN A;  2EK5 A;  3LSH A;  1F5T A;  3FXM A;  4EM0 B;  1MNE A;  2LRE A;  3DEU A;  5GAH J;  1B9M A;  2DAO A;  3MKZ A;  4KN7 X;  5F64 A;  3M1C A;  2LR8 A;  1IUY A;  3ZCO A;  2ID6 A;  1A36 A;  4XLC A;  3HSF A;  1U78 A;  3FK7 A;  2XPV A;  1BOB A;  2OF7 A;  2O8X A;  4RLQ A;  3BLY A;  2DI3 A;  4ZZL A;  1IZ1 A;  3HPG A;  4MEX F;  3E97 A;  2LYC A;  2V26 A;  1QRY A;  5DEQ A;  4CGZ A;  3FWE A;  3GLL A;  3E6D A;  3I3L A;  2HVR A;  2E1M C;  3PSF A;  2G9W A;  1IF1 A;  4JX5 A;  4UY8 I;  1AKH B;  2M30 A;  2KZV A;  3LSJ A;  3HGG A;  4OIN F;  2VB6 A;  1TWF J;  3HM5 A;  1XMA A;  1WJA A;  2HZT A;  2RV8 A;  4BKX A;  2CW8 A;  2FOW A;  1YI2 I;  2DT7 B;  2R7S A;  5IPA A;  3V8K A;  4M73 A;  3R60 A;  1PJR A;  4IRH A;  3S1R J;  1K6Y A;  2ETH A;  5D5X B;  3K9T A;  1LFB A;  4CCK A;  5IP9 J;  1U5T C;  4HV6 A;  3GFI A;  4IQ4 A;  1ZQ3 P;  1K79 A;  1SFX A;  1WJ5 A;  1J7K A;  4HLY A;  6PAX A;  1ZG5 A;  1LNW A;  1QU3 A;  5LRS A;  3L2V A;  1UAA A;  5D5V B;  1EH6 A;  1UST A;  3BG9 A;  4BXX J;  3CDH A;  4AD9 A;  4D9J A;  2AQF A;  3P9C A;  1MW7 A;  1R4M B;  2J5O A;  3OIQ A;  2IPQ X;  4EM1 A;  1DQU A;  1KQ9 A;  1Z9C A;  1TW2 A;  3IRR A;  3H1C A;  4JK1 X;  3JRH A;  5CVI A;  1SEU A;  1YLF A;  2LY2 A;  4CSW A;  3WTS C;  3TQN A;  2F4O B;  3Q0W A;  2L5Q A;  5KK1 A;  1JI8 A;  3BTJ A;  4FE4 A;  2M8E A;  4F7Z A;  5IOZ A;  4GO1 A;  2ZJQ F;  4XLA A;  4KJZ A;  2PFB A;  3WGG A;  4E7L A;  1VQL I;  4A69 C;  2FNP A;  1GV2 A;  2NS0 A;  2JUG A;  3H5A A;  2PN6 A;  2X48 A;  2OCC H;  2VOP A;  3QYE A;  1FYM A;  2D1V A;  2HQA A;  2K7L A;  1TNT A;  3DXJ F;  4UVB A;  4C2T A;  4XLF A;  9ANT A;  1KA8 A;  3HRS A;  1V4R A;  4CCO A;  1XD7 A;  2ZXH A;  5LFA A;  2JTV A;  3EPZ A;  2PJP A;  4HEA 2;  3FHN A;  2VQC A;  3RKW A;  4RB0 A;  2O9L A;  2V9K A;  2QYO A;  2X1D A;  3WTW C;  1FYK A;  2L01 A;  3CCS I;  2CUJ A;  5HOO A;  3LSM A;  4JX4 A;  3FIS A;  3DKW A;  4IX7 A;  3FK6 A;  2VKE A;  1WJD A;  1LFP A;  1QQI A;  2HXI A;  1LEA A;  5M3F J;  3H36 A;  2W7N A;  4XRM A;  3O8G A;  3GYH X;  5GPC A;  3F8F A;  4YFK F;  2XAF A;  4LIT A;  1DGW Y;  3ASO H;  3G2B A;  3PUF A;  4FIS A;  5E1W A;  1RES A;  2IJL A;  4ABZ A;  1ZLJ A;  1BI3 A;  1Z77 A;  4G9Y A;  4E6K G;  1PP7 U;  1BIB A;  3ELK A;  3J7A Y;  3S8P A;  4CO8 A;  3SQN A;  2ZNZ A;  1Z6R A;  3CP8 A;  3FX3 A;  1JTX A;  3G1M A;  4BJT A;  3ZQ7 A;  5FGM A;  3CDI A;  5C4X J;  1O7F A;  4U7D A;  4KT5 C;  2X85 A;  3G1O A;  2L7F P;  1EF4 A;  1OJL A;  2VI6 A;  4MEY F;  2D2W A;  2RQP A;  3HGY A;  3X2Q H;  2W57 A;  2GAU A;  2XPW A;  3KEO A;  1MBE A;  5F27 A;  1TTY A;  1U0J A;  4IRI A;  3IC7 A;  1JT6 A;  3KCC A;  3RPU A;  3I58 A;  4AVZ A;  2LF8 A;  2KRH A;  1H89 C;  4HG2 A;  2M7A A;  3P9K A;  4XBF A;  5EZG A;  4WF2 A;  2DLL A;  3LFU A;  5AIQ A;  4AWX B;  2R5Z B;  4RB2 C;  2Y69 H;  3BQZ A;  2BW3 A;  3RIR A;  4MIM A;  4NBQ A;  3WE3 A;  3OMY A;  3D5R C;  1W1W E;  4EM2 A;  4PFO A;  1SD5 A;  3OSG A;  2FEZ A;  3EUA A;  4YII A;  3K69 A;  1IXS B;  1MMG A;  4N0B A;  1P9Q C;  3VSL A;  1QVT A;  1JHH A;  4QSH A;  5CPR B;  2R7D A;  3OYF A;  3T1B A;  1JJ8 C;  3TW6 A;  3M9A A;  1QVU A;  1NG6 A;  4E4H A;  5BQT A;  4EJW A;  4XLN F;  2FMY A;  2R4G A;  4OIR F;  1XMX A;  3QP6 A;  4NNJ A;  4CIC A;  5BPD A;  1R1U A;  2P81 A;  1R49 A;  4Y4R A;  5EGO A;  2RNG A;  4RDU A;  3DQV C;  1LDD A;  3F8B A;  1BC7 C;  5IYC J;  4EGY A;  4UXN A;  2O61 A;  3GTJ J;  2KIF A;  3A01 A;  1JT0 A;  1XTA A;  3GEZ A;  1XGS A;  4WXH A;  1TBX A;  4UUS B;  2HOS A;  2EIK H;  1OCZ H;  2CG4 A;  2OPT A;  3VYS B;  4FT8 A;  4RMN A;  1U2W A;  2JRM A;  2H09 A;  1AA7 A;  1TQM A;  2NVY J;  4U7B A;  1IRZ A;  4U0V A;  1U5T B;  4DBR A;  1ON2 A;  1W5C C;  1JKQ C;  5E79 C;  2MBF A;  4BJ6 C;  2ZO4 A;  5DS9 A;  3MD2 A;  5DCM A;  1W0U A;  4XLE A;  2R7X A;  5HLG A;  1OMI A;  1BJZ A;  5AON A;  1LVK A;  1ETX A;  4Q48 A;  5ILU A;  1RUO A;  1OCP A;  3PJR A;  3KPH A;  2DFH A;  4UB6 C;  2Q1Z B;  2CO5 A;  2TCT A;  2WY8 Q;  2M4K A;  3I59 B;  5FKM A;  2DJI A;  3ULQ B;  2XAH A;  2M87 A;  4EJV A;  4DQ2 A;  3ASN H;  4LLG F;  5DTD A;  2L9N A;  5ERI A;  3DV8 A;  3S1N J;  2Y0S N;  4CA0 A;  2IP2 A;  3ERE D;  5E1X A;  1YO5 C;  4A3F J;  2F4I A;  4F93 B;  2RN7 A;  1YOV B;  4AC0 A;  1W5T A;  2EFQ A;  3IKV A;  3ZRG A;  5FRO A;  2HPM A;  4GYG A;  1VQP I;  3EUK L;  2OJE D;  4L5I A;  2X0L A;  4LG0 B;  4M3E A;  2XAU A;  3FMR A;  3WTV C;  1I3Q J;  2VPR A;  1LKX A;  1G6N A;  2HKX A;  2LLK A;  1SVO A;  4XQF A;  2K9N A;  3OIO A;  2VOO A; 
#chains in the Genus database with same CATH homology
 1RKW A;  3OSF A;  4CYC B;  2XRL A;  4QIW N;  2XB0 X;  1ETW A;  5IYB J;  5IYD J;  2E19 A;  1F36 A;  3UKG A;  4MO7 A;  1MBH A;  2IBD A;  5M5X J;  2ELK A;  2H1K A;  2DTZ A;  3S1M J;  4CYC A;  3S17 J;  1XS9 A;  2LD5 A;  2K9S A;  1POG A;  3JRD A;  5GPA A;  3JRA A;  2E1O A;  5J3L A;  1Y1W J;  2JMW A;  5E3O A;  4D5F A;  1RPW A;  2DMQ A;  3PM1 A;  1ZR4 A;  2X9D A;  1BL0 A;  2YS9 A;  1A6I A;  1MNM C;  2DA7 A;  3HBL A;  3QQA A;  4A3K J;  1G2H A;  2HOA A;  3HOU J;  2QCO A;  4Y52 J;  3LSG A;  1ETK A;  2IAI A;  2EH3 A;  1MH4 A;  4D7N A;  2COB A;  3S2H J;  4G12 A;  4A93 J;  3OOU A;  1HOM A;  4C3I J;  1HCR A;  2DN0 A;  3NAU A;  2MSY A;  1X2M A;  5EEA A;  3SJM A;  2ECC A;  2LK2 A;  2HDD A;  1JUS A;  1IGN A;  3ZQG A;  5K7H A;  2FD5 A;  2DMT A;  3HOZ J;  4BBR J;  4EEF G;  2M0C A;  1P7J A;  5M5W J;  3B6C A;  1Q1V A;  4BBS J;  1GV5 A;  2N8G A;  4DYQ A;  2AO9 A;  1NK3 P;  3ZQH A;  1RR7 A;  5J1R A;  1U8B A;  4DW6 A;  3PO2 J;  1MBK A;  3B6A A;  4V2F A;  3HDD A;  1T33 A;  2YUS A;  5IOY A;  2FQ4 A;  3SFI A;  1D5Y A;  2XPU A;  3GTG J;  1FTZ A;  1IC8 A;  1APL C;  2VKV A;  4M3G A;  3JRB A;  1MBJ A;  4MFD A;  3BG5 A;  1WI3 A;  4UUS A;  2EBI A;  4I6Z A;  3BTL A;  4I76 A;  2HI3 A;  3VPR A;  3BTC A;  3H3V K;  4FCY A;  4W1U A;  3WHB A;  2VUM J;  2FX0 A;  1JUM A;  2CJJ A;  3FKI J;  4A3D J;  3GTK J;  1S7E A;  1TWA J;  2ME6 A;  3HOY J;  1WH7 A;  2LVS A;  2B63 J;  2CUE A;  1O4X A;  5E3N A;  1ZKG A;  1IJW C;  3RQI A;  2CU7 A;  1XG1 A;  1AU7 A;  4A3G J;  5JLW A;  1FEX A;  2WAQ N;  1VI0 A;  2E2H J;  1TWH J;  4JYK A;  4D5C A;  5IP6 A;  3C2B A;  1RKT A;  3ZQL A;  1JKR C;  3K7A J;  2KT0 A;  2L7M P;  5EG0 B;  2M9H A;  2H8R A;  1GUU A;  4LOC A;  1I6H J;  2PMZ N;  1Z0X A;  3K2A A;  2DMP A;  2CQX A;  1X2N A;  2WV1 A;  4V2G A;  2LY9 A;  5K7F A;  1HDP A;  1CQT A;  5EG0 A;  1VFC A;  4DZJ A;  4RBO A;  2R0Q C;  1LE8 B;  1IDZ A;  1DU0 A;  2O8K A;  1F43 A;  1WH5 A;  1I50 J;  2K40 A;  1BA5 A;  2M2E A;  3IH4 A;  1ZK8 A;  4A3E J;  1IG7 A;  4M3B A;  1SFO J;  2LR8 A;  3L1P A;  2Y30 A;  2JK3 A;  5FKK A;  2ID6 A;  5BNG A;  1U78 A;  1LE8 A;  4DZP A;  3FK7 A;  2XPV A;  1H8A C;  2DA1 A;  5EZH A;  3HOW J;  2OF7 A;  3PO3 J;  1K83 J;  1TWC J;  4A3L J;  1OCT C;  1A5J A;  1QRY A;  2DJN A;  3A03 A;  3JRI A;  4J19 A;  2NS7 A;  4JX5 A;  2LP0 A;  3A02 A;  3SDG A;  1AKH B;  1OFC X;  1T56 A;  2O7O A;  3LSJ A;  3HOX J;  3HGG A;  3Q0U A;  4IHY A;  3FIW A;  5M5Y J;  1TWF J;  3MN2 A;  3MVP A;  3HM5 A;  2X6O A;  1JJ6 C;  3CQZ J;  2LFB A;  4BKX A;  1AKH A;  5HOD A;  3NAR A;  5FKL A;  2HYJ A;  5IPA A;  1R9T J;  1IUF A;  3LOC A;  3IH2 A;  3TW7 A;  1JUP A;  3S1R J;  3MKL A;  5J1U A;  3M3Y J;  3Q3S A;  1LFB A;  2LTP A;  4A3M J;  5IP9 J;  3DEW A;  2R93 J;  1ZQ3 P;  3HEF A;  2W48 A;  1JGG A;  1AHD P;  5F08 A;  2EZH A;  2TRT A;  4UUT A;  5E3L A;  3D1N I;  4A3J J;  4C3J J;  3BG9 A;  3HB9 A;  4BXX J;  3A01 B;  2EZK A;  3GBG A;  1JKP C;  2NS8 A;  1E3O C;  5C3E J;  1FJL A;  3GTO J;  5FKN A;  2FJ1 A;  3JRH A;  3G1L A;  3BR3 A;  2XSD C;  4IHV A;  1ORK A;  2IEK A;  4JP0 A;  2EZL A;  3IH3 A;  1B72 B;  5GP9 A;  5F04 A;  3Q0W A;  3BTJ A;  4FE4 A;  5FJ8 J;  2DA2 A;  2XGC A;  5IOZ A;  2Y9Y A;  1SAN A;  2DMN A;  5FLM J;  2AHQ A;  1UG2 A;  4A69 C;  1GV2 A;  1B72 A;  3CMY A;  2DA3 A;  1LFU P;  1XC5 A;  2X48 A;  1WCM J;  2JWT A;  4A3C J;  2R5Y B;  1UHS A;  1ZGW A;  3I4M J;  4D7M A;  4DYC A;  3LSP A;  2R92 J;  9ANT A;  4B3A A;  1PUF B;  1QPI A;  2CRG A;  3RZD J;  5EYR A;  1RET A;  1IV6 A;  2DA5 A;  2O9L A;  2R5Y A;  4B4C A;  2MGQ A;  1ITY A;  3F0C A;  1B8I B;  2QF7 A;  2Y9Z A;  4JX4 A;  1PUF A;  3FIS A;  2DMU A;  3JRE A;  2R7Z J;  3FK6 A;  2VKE A;  2Y31 A;  4XIC A;  3BTI A;  3S1Q J;  4MLO A;  2HXI A;  5M3F J;  5EDN A;  3ZQI A;  3BR2 A;  1P7I A;  3O8G A;  4XRM A;  2JA6 J;  1Y1V J;  5FLV A;  1WPK A;  4W97 A;  5GPC A;  4FIS A;  1X58 A;  1B8I A;  1RES A;  4ABZ A;  1GVD A;  1Z77 A;  4AYB N;  1NTC A;  4M6V A;  2LKX A;  1ETO A;  3TED A;  2E2I J;  5F1J A;  1ETQ A;  2ID3 A;  1FIP A;  1JTX A;  3JR9 A;  5F0C A;  3BT9 A;  3WHC A;  3G1M A;  4A3B J;  4HNV A;  2XGE A;  1JTY A;  3GTQ J;  3E7L A;  5C4X J;  4IHX A;  2WB1 N;  1DU6 A;  3G1O A;  2L7F P;  1EF4 A;  1OJL A;  2VI6 A;  4IHW A;  4S0H B;  3HGY A;  3S2D J;  1IDY A;  2XPW A;  1HF0 A;  2L0K A;  1MBE A;  5F27 A;  3ZOB A;  4JX6 A;  2I10 A;  3W6V A;  1JT6 A;  4QTR A;  5JLX A;  4DYR A;  3CDL A;  1H89 C;  5EF6 A;  3TP3 A;  3HKZ N;  3BR6 A;  4XID A;  5EZG A;  4FTH A;  2R5Z B;  2DA4 A;  3BQZ A;  1ZR2 A;  1MH3 A;  4MIM A;  1H88 C;  1GDT A;  3OSG A;  1MBG A;  4GFB A;  5M3M J;  4B1R A;  5E3M A;  1MSF C;  4BY1 J;  1QVT A;  4QSH A;  2R5Z A;  2NVX J;  1ZTR A;  1JJ8 C;  2L9R A;  2E2J J;  5EGO B;  3TW6 A;  1QVU A;  2EQR A;  5IP7 J;  4C2M J;  2MW8 A;  2JA5 J;  1TC3 C;  4BY7 J;  2ZB9 A;  1ENH A;  1U9N A;  2JA7 J;  2JJ7 A;  3GTP J;  5F0H A;  1ETV A;  2P81 A;  2G0E A;  1MBF A;  5EGO A;  2GLO A;  2NVQ J;  1MSE C;  2MG4 A;  2CQQ A;  4NDL A;  2Y2Z A;  5C44 J;  1W0T A;  3ZQF A;  3HOV J;  4FE7 A;  1NK2 P;  4RDU A;  1VND A;  1ETY A;  5IYC J;  4Y7N J;  3RZO J;  3GTJ J;  3A01 A;  1JT0 A;  2DA6 A;  1JKO C;  2RAE A;  1FTT A;  2HQ5 A;  4UUS B;  2HOS A;  2OPT A;  1TWG J;  4AUX A;  2EZI A;  3S14 J;  1VF9 A;  2K9Q A;  3GTM J;  4XK4 A;  2XB5 A;  5J1Y A;  3QPS A;  2NVY J;  1IRZ A;  2CUF A;  3BR1 A;  4A3I J;  3GTL J;  1GT0 C;  1JKQ C;  1K61 A;  3S15 J;  4M3F A;  2M8G X;  5DS9 A;  3IV5 A;  1W0U A;  1YRN B;  1BW5 A;  4IEJ A;  1BJZ A;  2L7Z A;  1ETX A;  1OCP A;  3LNQ A;  1U9O A;  5K7Z A;  3LSR A;  1HLV A;  1BW6 A;  5C4J J;  5FKO A;  2ME0 A;  2GBY A;  3BG3 A;  1HDD C;  2YU9 J;  2TCT A;  4C3H J;  1YRN A;  2M34 A;  5FKM A;  3QPL A;  3M4O J;  4XRS A;  3BR5 A;  1UMQ A;  4XRS G;  2NOG A;  3H0G J;  2HXO A;  5DTD A;  3S1N J;  2Y0S N;  3O8H A;  2NVT J;  2GM4 A;  4A3F J;  4MFE A;  2HOT A;  4L5E A;  4AC0 A;  4X6A J;  3DCF A;  2JN6 A;  3CCY A;  2XGD A;  4M3D A;  3JRC A;  3BR0 A;  3S16 J;  3JRF A;  4X1E A;  3ZQC A;  4M3E A;  3TP0 A;  1FIA A;  1I3Q J;  2VPR A;  2ECB A;  2KDZ A;  2LLK A;  3BQY A;  2K9N A;  2D5V A;  2JA8 J;  3OIO A;  3Q0V A;  3JRG A;  3I4N J;  1WGX A;  3RKQ A;  5F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...