1ONVA

Nmr structure of a complex containing the tfiif subunit rap74 and the rnap ii ctd phosphatase fcp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor IIF, alpha subunit
publication title NMR Structure of a Complex Containing the TFIIF Subunit RAP74 and the RNA polymerase II carboxyl-terminal domain phosphatase FCP1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1onvA00
1SD4A 4EJVA 3ZMUA 4JBAA 2XIGA 4EVIA 4HF2A 3I0TA 1IN8A 4GCVA 3QP5A 3NRVA 3QAHA 2OZUA 2IW5A 1XMAA 1P4AA 2WWYA 4G7HF 3F8FA 1IUYA 2XRNA 1PDNC 5F64A 1UFMA 4YFKF 2Q0OA 2OA4A 3GFJA 2VONA 1LDKB 1IN7A 5D8LB 2HGCA 2BBYA 3LA7A 2P6TA 4LLLA 1IXCA 4M6YA 2RKHA 2IA1A 5E1XA 2K7LA 3DEUA 4YFNF 4GGGA 3RYPA 5LRRA 1EH7A 4P5OA 1NHAA 4MTEA 1TQPA 2Y48A 1KQ8A 5D5WB 1ULYA 2PQ8A 5D6EA 5AIPA 2IT0A 2NRAC 4U7BA 2K4BA 3BJAA 3IKVA 3BWGA 2B0LA 1LEAA 3J80Z 2GZWA 1B4AA 1PP7U 2PG4A 4GO1A 2XVCA 3K9TA 4BHBA 4CO8A 2Y0MA 5K5RA 4L9JA 3ERED 1U2WA 2AS5F 3FZVA 4P96A 2ESHA 2P5KA 2FBIA 4P9UA 4CGZA 2L3DA 1YS6A 1E2XA 1T6SA 3NQOA 2NYXA 2PBIA 3WTZA 2HKXA 1ONVA 2GXGA 2K02A 1S7AA 2DBBA 2LNBA 3WE3A 1R00A 2V1XA 4M6XA 1X3UA 1WQ2A 4Q48A 2PMHA 1W7PA 3TDZC 3HOTA 4HA8A 3ABTA 4KIFA 4MNUA 2FNAA 3SQNA 2VBZA 1E17A 4IF4A 1U78A 4A5MA 1QNTA 4ZH4F 3P9KA 4BQAA 2H6CA 4UNOA 2CQKA 1S29A 3FF5A 2CW0F 3KP6A 1H0MA 3JAMK 5KVRA 3P7NA 3GF2A 4WXDA 4HOBA 3GW2A 1FYLA 3GEZA 3FHZA 1IRGA 4ENMA 4ZYEA 1BIBA 2RV8A 3BZ6A 1KU3A 1ZARA 1IN4A 1ZLKA 1F5TA 1FP2A 1TNTA 2ACJA 1ON1A 4HBLA 2GIVA 3V7CA 4RB1A 1ZG1A 2VT3A 4WXCA 4WXHA 5K1YA 4KYWA 2E1NA 3VOEA 5L3GA 4YFXF 1U5TC 5CLSA 1KU2A 1XGNA 3RKXA 5CVRA 1O7LA 1XGMA 2M1BA 4RGSA 5HOOA 2HZTA 2DT5A 3CTAA 2YPRA 3LAJA 2P6SA 1KQ0A 3WTSC 3W6KB 4YIIA 5KK1A 1BM9A 1I1GA 4LG0B 4KIBA 3COAC 1HW2A 2BGCA 4HZFA 2QLZA 2VN2A 3CDHA 1L0OC 3HSFA 3QOPA 3ULQB 2DI3A 4ESBA 3GO5A 1WWXA 3DF8A 4KDPA 2HQRA 2QQAA 4ZYHA 3HYIA 1OKRA 1YLFA 3M8EA 2KIMA 3FX3A 2XROA 4WX9A 1XDUA 4ON0A 3J81Z 5BQTA 2XAJA 3KLNA 5E8GA 1I6XA 1C0WA 2JRTA 2EV6A 1SMYF 3HOSA 3BJOA 5E18F 1STZA 1WKMA 5DD4A 2OBPA 2E1CA 3HHHA 3DFGA 2EFNA 1D8JA 3ELKA 4P9FA 1SFEA 3QPHA 2XV4S 2OAZA 3WGGA 3WTVC 2PMUA 3IC7A 1USSA 2IVMA 2LDUA 1SD6A 3LWFA 5ED4A 4O6JA 1UHWA 1Q1HA 1O3TA 5HS8A 1MDMB 5H20A 1IRFA 1HKQA 4AIHA 5JI6A 4FX0A 1KGSA 3TKYA 2XAGA 2HOEA 5DCMA 4LD5A 2YSRA 4KICA 4P55A 1OYWA 2H6BA 3IHUA 2F5EA 4L5IA 2D45A 1HW5A 3KCCA 2DK5A 3N4MA 1S8NA 4YIFA 1TQMA 3EETA 1G4DA 4JQFA 4XSZF 2RGVA 3HTUA 5LHIA 4Q5SF 1EV7A 3ECHA 2Z33A 3BPXA 1J9IA 4ZYGA 2ZCWA 4OOIA 3MZHA 2HFHA 2EV0A 5E17F 4XRFA 1MGTA 2A6HF 1XD7A 1BBYA 5JVTA 1G3YA 1KU7A 1FZPB 3GFIA 2XAFA 5FB2A 3TOAA 5A2QZ 3ISPA 3MCZA 2F5FA 4LG0A 3D0SA 3GVAA 3WU0A 5ICCA 1FBQA 3RPUA 3ZMVA 5DUKA 2BEOA 4MTDA 3QP6A 1HXDA 3CO6C 1PUEE 3ZMDA 5HVQC 1H9TA 3K0LA 5JR3A 5L3FA 3SXYA 3U1DA 3Q9SA 2O8XA 1GXQA 2DQLA 2F5DA 3FWEA 4HQMA 4ASNA 2O6GE 4IVNA 3FXUA 4MQ9F 5D6FA 2QBYA 1ZGAA 4IRHA 2VE9A 4HDVA 1FBUA 4RB3C 4HAMA 1MZBA 5FLXZ 5FD5A 4L9VA 3F22A 2FE3A 3DPTA 2VOOA 2KJBA 5H6RA 2Z9OA 4IHTA 5K5QA 2M45A 4KNYA 5H6QA 3KP3A 1MDMA 2PI0A 3GFLA 3W6JB 4PGGA 3BROA 4Y13A 3RPQA 1OR7A 4G8XA 5FGMA 2MBFA 4R1HA 4PGHA 5HS7A 1W7PB 3DQVC 3MZYA 2D1HA 4M73A 5LGUA 5FFXA 4MQVA 5IT9Z 4PCQA 1LDJA 2DFIA 5ILVA 3B02A 4LB5A 3GX4X 4U0YA 4OMZA 3IRQA 5L3EA 1RUOA 2ETHA 2VE8A 2WTEA 1ON2A 3SZPA 5EEHA 2IA2A 3JTHA 1FYMA 5TRDA 2YR2A 2QVOA 1YS7A 3SHFA 3RTRA 1MJBA 4L18B 4HX4A 3F8BA 2D1VA 4NB5A 1IN5A 2K86A 1J59A 1FP1D 3WTYC 2ZBKA 1YIOA 4O5VA 4TV7A 2DLLA 3LSTA 3LA3A 4HLYA 1FSEA 4A0ZA 1RZ4A 4G6QA 3VB2A 2KIFA 3V7RA 1FC3A 1MJAA 4IRGA 4UV8A 2DPUA 2QZ8A 2MC3A 3BP8A 3HTSB 2C6YA 2RDPA 2DPDA 2NNYA 3GXOA 5BMZA 4LB6B 3BPVA 3P9IA 3OOPA 4OIRF 5HDNA 4AIKA 4KMFA 3WGHA 1U8RA 1QZZA 3E97A 1TQIA 1A04A 3F8CA 1BC8C 5F6FA 3ABUA 1WSUA 3J80K 5EEGA 1O7FA 3Q9VA 3WODF 5LHGA 3D5LA 2BV6A 1MKMA 5E20A 1LB2A 3Q5FA 4Q4ZF 1BI3A 2H27A 4G6DA 2NNNA 5LGNA 5HDKA 5HLGA 1XSDA 1DDNA 4A6EA 1B1BA 2L01A 4CHUA 3E5XA 2DAOA 2ZXJA 1YO5C 4BHPA 2Q2EA 4XLNF 5JFRA 4FX4A 4LJZF 2HQNA 3RKYA 1LQ1A 3F72A 2R7DA 2M5WA 2GXBA 4EGZA 2FEZA 4LK0F 1MD0A 4BAYA 5CVJA 4GYIA 4I09A 2Y75A 3JTGA 2QYOA 5DCMB 3LFKA 3PFIA 3T1BA 5D5VB 1XCBA 4BHCA 3NEUA 2UXXA 2UXNA 4I0BA 2ISYA 5LEJA 3KP5A 5FD6A 2MLKA 2PN6A 2P5LC 4CICA 3ZMTA 3EYYA 4I98B 3IL2A 1DUXC 3WGIA 5FO5A 1HKTA 2M87A 3MWMA 3M8FA 2E7XA 2P5VA 2OQRA 2ZJ2A 3GWZA 2VT2A 1K6OA 3KP2A 2ESNA 2FMYA 3TQNA 5FFZA 2X0LA 2FQ3A 5K5OA 4NHJA 1XGOA 1HKSA 3DKWA 3F23A 3CO7C 3RYRA 3FXRA 2FSWA 2W84A 3FM3A 2FMLA 1ODDA 4RGUA 4I2OA 4CDGA 1F9NA 3M7GA 1YG2A 5DD8A 4RAZA 5HDGA 1R58A 2EA2A 2CSOA 4A2UA 2J5OA 5E8IA 2EV5A 2EFOA 3KP7A 3G3ZA 3ZN1A 4LGWA 4YG2F 2FOKA 1K7AA 1AOYA 1ZHFA 2KRFA 4IXAA 3J81K 1R1UA 4UUVA 3H92A 4MEYF 1I5ZA 4AIJA 1GHCA 1HSJA 2ZMEB 3ML6A 3JSPA 1K79A 2L02A 1YW7A 4KN4X 2CGPA 4EJTA 3V8LA 1JHHA 2P7VB 2QBYB 3R4KA 2DK8A 4NQWA 2FBKA 3L9FA 4CYDA 4KIGA 3T0YA 2NS0A 1ZGJA 6PAXA 4Q47A 2F5CA 3I59B 5ICEA 2E7WA 4ENKA 4KN7X 2LKPA 4RAYA 4AD9A 1RNLA 2A07F 3R0JA 3CJNA 1BI2A 3VODA 1REPC 1IF1A 5E1ZB 5ICFA 4CXFA 3TOBA 2Q8KA 4HF1A 3CUQA 1R5HA 2V79A 1Z6TA 1FX7A 4M71A 4G9YA 4D0PA 4AWXB 1RUNA 1P92A 3LQRA 1J7KA 3KZYA 1ZYRF 4N0BA 1Z05A 3WTWC 2HKOA 4IJAA 4KFCA 3K1NA 3FMRA 1P6RA 4O3MA 4RS8A 4ENNA 5J8FA 1GVJA 3V4GA 3MEXA 1FPQA 1W4MA 4KMUX 3U9GA 2O0YA 3HRUA 5A2QK 3O3KA 4ETSA 3F8NA 1B9NA 2XASA 1FYKA 3REOA 4PZJA 4I7HA 1JHFA 2JZYA 5D8KB 3BJ6A 4M9XA 2A61A 2FA5A 1G3TA 2MLGA 1W5SA 3HUGA 1XMKA 2EJRA 3BDDA 4BXUA 1YYVA 4U88A 4RGXA 2MH2A 2RQPA 1IW7F 3TGNA 4EJUA 4Y15A 2G7HA 3J7AO 3HSEA 4XSXF 2XKOA 1F4KA 2CYYA 5BPIA 2A6EF 3CLOA 3PQJA 1G6NA 2EFPA 1T39A 3FXQA 2ZMEA 4L0ZB 1RI7A 3WU1B 1YTYA 5LEKA 1Z91A 4EV0A 2PJPA 2KJCA 3L00A 2A69F 3HRSA 4A5NA 1R1TA 1R22A 5FLXK 3HRMA 3N97A 4G7OF 3GLXA 1DP7P 1SD5A 3GUDA 1DPRA 1HBXG 2IA0A 1FSHA 1SD7A 2D2WA 1TLHB 1FT9A 3I59A 3QPTA 3IRRA 1V3FA 4IPAA 3E6CC 3QU6A 4LFUA 5DV5A 2XGXA 2CG4A 2P7CB 5DDGA 4L9NA 3L7WA 2ADUA 4HX7A 3TO7A 4UHTA 1VTNC 5ICGA 3QU3A 1S6LA 1ZG3A 2QQ9A 5IT9K 2VOPA 5ILUA 5LHHA 2EFWA 1J0RA 5D4SA 3EQLF 1QGPA 2QM3A 3K69A 1W5TA 3M1EA 2COMA 2V9VA 4L5JA 1BIAA 4JK1X 4HF0A 4K2EA 2FRHA 2KKOA 5HS9A 1GXPA 5ILSA 5D4RA 1ZRCA 3WE2A 1LJ9A 3RIRA 2VBWA 4EM1A 3RKWA 4XLPF 3DP7A 1QO0D 3BY6A 2H09A 3FM5A 3T5XA 5LRSA 2RN7A 4EMSA 4XBFA 2W24A 3LQQA 1SAXA 1FLIA 3H3UA 2YU3A 2TDXA 1PP8F 4HW0A 5LBQA 3IKTA 1SMTA 5F1RA 4EJWA 4H0EA 1WRJA 4BYYA 5HLHA 3V7SA 5D5UB 2HR3A 4Z2YA 2CFXA 1O57A 3V8JA 4PDKA 2MD5A 4UVBA 1J5YA 2PLYA 3KFWX 4MHGA 2O3FA 1P2FA 2WC2A 1IXRC 3CUQC 3S2WA 4EM2A 1JE8A 1J75A 4ZZDA 5L3DA 2STWA 3I5UA 3V8KA 2HS5A 3C3WA 2VC0A 1V4RA 3DV8A 1QQIA 2L4MA 3R60A 1B6AA 2VBXA 4GXOA 3G73A 2HWVA 5L3BA 4A0YA 4HX8A 3T8RA 2XUBA 3R61A 4I0AA 2HEOA 2F2EA 4UV9A 4A0XA 3C7JA 2XAQA 4WK8F 2XAHA 2EFQA 1L3LA 3E3VA 2L4AA 4G94A 2ZO4A 1IZ1A 1YW8A 5DEQA 3WG9A 4AVPA 1FOKA 2L54A 2RC4A 3I58A 3F6VA 2HDCA 3JSOA 3LAPA 3IWFA 4B09A 5HLIA 3KETA 1ZH5A 3ECOA 3F6OA 4M72A 3BOQA 1HQCA 2JT1A 1USTA 2W85A 2H94A 4G7ZF 2JPCA 4N9HA 3O2PE 3E6BA 5BS6A 4KA4A 1ZG5A 1Z9CA 2V1DA 3ZN0A 4BH9A 2A5YB 1U6GA 2MH9A 5LGTA 2EA4A 3WTTC 4RGRA 1XDSA 4HV5A 4QWQA 1O3RA 1BC7C 3R0AA 1R5GA 1FBSA 2XHKA 2G7UA 1EH6A 2NAZA 1CF7B 4OIOF 1XB4A 3KEOA 3ZPLA 2AXLA 4R79A 2GQQA 1OPCA 4MEXF 2M30A 3CUQB 1ZRDA 4R8HA 1RIOH 5L3CA 4EM0B 4WF2A 5CVUA 5CVIA 4ESJA 2HYGD 1YW9A 4OIQF 5J8CA 4A12A 2V1UA 2R7FA 3GZ5A 5J6XA 2Z3YA 1UB9A 4I01A 2FNPA 2OU2A 2JSCA 2CO5A 1OYIA 5CVVA 1G3SA 2ZFWA 1B59A 1IXSB 3F21A 2FBHA 2W25A 2OZ6A 3FMSA 3CUOA 2LF7A 3JAMZ 1MJ9A 4U0WA 1P4WA 1P4XA 4EGYA 2FXAA 2M8EA 4M9ZA 4BNCA 1UCRA 1XGSA 4IHSA 1H9GA 2O03A 2UWMA 4LK1F 1FY7A 2ZKZA 3K1MA 5IT3A 3KE2A 2HTSA 4UVAA 2FU4A 4B8XA 2HTJA 1W7PD 3ZP5A 1UHMA 3T8TA 1BOAA 4HV6A 3AAFA 3H3ZA 5AIQA 3MAJA 2VODA 3C1DA 1YFHA 3SZTA 3GYHX 1LEBA 1DPUA 3K1PA 3K2ZA 1O3SA 1R1VA 1TW3A 5BOXA 4ZZLA 4LLNA 1KA8A 3E6DA 5D5XB 3F8MA 3TDUC 4HLXA 5TJJA 4I02A 4HYEA 2VXZA 2YX4A 1QBJA 1FWZA 1Y0UA 4CZZA 1K78B 2YX7A 1FNNA 4IRIA 4N9IA 2R3SA 3F3XA 4UVCA 1LDDA 2K4JA 1XN7A 1R7JA 3RDIA 2BE5F 1OYYA 1CF7A 2HYFA 3EDPA 2RNJA 4WWCA 4HDUA 4LMYA 4E70A 3KP4A 2ISZA 1XSXA 1T38A 1S3JA 1JXSA 4M74A 3FMQA 5AONA 1U3EM 2GAUA 1U5TB 3GFMA 3ZQ7A 3LA2A 2GA1A 2QWWA 3TO9A 1QPMA 1I1SA 3P9CA 1TTYA 2V6CA 2EB7A 1IAWA 3JW4A 1BI0A 4L9TA 2G9WA 3HSRA 2QENA 3L09A 5ERIA 3R6SA 1AWCA 1KQ9A 1HW1A 4LLGF 4S05A 2DU9A 1QZYA 4U7DA 3KEQA 5DUIA 3PQKA 1OMIA 2IJLA 4UXNA 2XKPA 3ROUA 3DPLC 3TO6A 1ZN2A 2Z99A 5BPDA 4EQQA 4ENJA 3C18A 1WI9A 3OV8A 3WTXC 2QQBA 1IN6A 2P4WA 3VEPA 2JPBA 2A3SA 4OU0A 5LLQA 1LNWA 3RI4A 1KYZA 2A68F 1T98A 1Z6RA 3O6BB 2VBYA 2DQRA 3QRFF 4ZYDA 1Z7UA 3E5QA 2J5PA 1S7OA 1YQAA 2BYVE 1ZAOA 2UZKA 4OINF 2K27A 2W57A 4HQEA 2OQGA 1G3WA 1D8KA 5JHUA 4RB2C 2X4HA 1F1ZA 1D3YA 3ZMSA 1ZRFA 1SFUA 5E1WA 4FT8A 4OMYA 4DNCA 4FHTA 3B73A 2STTA 2ELHA 1BJAA 1D5VA 3RJPA 1HSTA 3WTUC 2P8TA 2IP2A 3I71A 1TW2A 2MA3A 3L2CA 2FF4A 1CGPA 2EK5A 1LVAA 3I53A 1K78A 2ZNYA 1BI1A 1EH8A 2IPQX 4WCGA 3U2RA 2DTRA 5CJ9A 3KZZA 2PFBA 4RB0A 5DCFA 3I54A 1XSVA 3EUHA 2IRFG 3DXJF 4U0VA 2JTVA 4QLCU 3E5UA 1J2XA 1R36A 4KUMA 1I27A 4ESFA 4A6DA 1T2KA 3HRTA 3VFZA 1JGSA 2RVCA 1ZREA 3MQ0A 1R23A 3ZMZA 3MFKA 4EJOA 1U5TA 3HIFA 4KT5C 2EWNA 3HHGA 2VC1A 3I4PA 3KLOA 2Z5UA 2ZNZA 2O61A 1TBXA 1ZLJA 2LF8A 1Z1DA 5CYVA 2CWEA 1B9MA 2OD5A 2PEXA 4GYGA 3GZ6A 4F7ZA 2DW4A 1O3QA 1KYWA 1T0FA 4S04A 3E6MA 4MGRA 3EYIA 5DYMA 1TNSA 3M9AA 2WV0A 2LSOA 1BN5A 2KIUA 4Y17A 1KU9A 2QUFA 2GWRA 2DO7A 4DQ2A 1XCVA 4M9SA 4L0YB 1SFXA 3IWZA 2GA2A 3I64A 3SFZA 4OIPF
chains in the Genus database with same CATH superfamily
2O9LA 1SD4A 2KRHA 4EJVA 3ZMUA 2DJNA 4JBAA 3MKWB 2CUZA 2XIGA 1X58A 4EVIA 4HF2A 1QHGA 3LNQA 1TP4A 3I0TA 1IN8A 4IOAF 1VQOI 4GCVA 2NS7A 3E1SA 3HKZN 2ZXWH 3QP5A 3G1MA 1R5ID 3H35A 3NRVA 5GADJ 3A1YA 2X51A 2L9SA 3QAHA 2OZUA 3DWLE 2IW5A 1XMAA 1P4AA 3OR2C 2WWYA 1WZ2A 1MMNA 4G7HF 3F8FA 3HGYA 1DP3A 4M3GA 1IUYA 2XRNA 2XSJC 1V5GA 5F64A 1PDNC 1UFMA 4YFKF 2Q0OA 5FKLA 1R4MB 2OA4A 1HC8A 3GFJA 2VONA 2TRTA 1LDKB 1M1EB 1IN7A 5D8LB 3MN2A 1B8IB 2HGCA 4C3HJ 2BBYA 4UB6C 1Z3YA 3SYTA 3LA7A 2P6TA 2B63J 2CFOA 3FISA 4LLLA 1VZ0A 3H3VK 1IXCA 4M6YA 2RKHA 2IA1A 5E1XA 2LD5A 2K7LA 2W4SA 1YX3A 3DEUA 2CV0A 3CZ6A 1KONA 4YFNF 4A93J 4GGGA 5IPAA 3RYPA 3W2AA 1U0JA 5LRRA 3ZQCA 1EH7A 4P5OA 4BE1A 1NHAA 4MTEA 3PNTA 1TQPA 2Y48A 1KQ8A 4PK4A 4MFDA 5D5WB 1K6YA 1ULYA 2PQ8A 4XKVA 5D6EA 5AIPA 3G4SI 2IT0A 2NRAC 4U7BA 2HQ5A 3NAUA 2K4BA 2QQ8A 3BJAA 1YOVB 3IKVA 3OYGA 5HODA 1UAAA 3BWGA 2LY2A 2B0LA 1LEAA 5F04A 2L7MP 3OIOA 1BR4A 3QODA 3J80Z 2GZWA 1B4AA 1PP7U 1VQ6I 2PG4A 4GO1A 5J1RA 3ZQFA 2XVCA 4YRVA 2K40A 3BR2A 3K9TA 2Y0MA 4BHBA 4CO8A 1HLVA 5K5RA 3M4OJ 4L9JA 3ERED 1U2WA 3SEQA 2AS5F 5JHFA 1YJ9I 3FZVA 4P96A 2ESHA 3OIQA 4A3KJ 2P5KA 2FBIA 4LIUA 3U1KA 4P9UA 1SAUA 2ZJPF 4CGZA 3L1PA 4XRMA 2L3DA 4DZJA 1YS6A 1QVTA 1E2XA 1T6SA 3NQOA 2NYXA 2OPTA 2PBIA 1VNDA 4E7ZA 4IHXA 3WTZA 4RBOA 2HKXA 1ONVA 1OCTC 2GXGA 2K02A 3BG7A 3FXJA 1S7AA 4CCKA 2KRCA 1ERDA 3BZCA 3LSKA 2DBBA 2LNBA 3ONQA 3WE3A 1R00A 2V1XA 3E0JB 4D5CA 2B9SA 1YIJI 5F0CA 4M6XA 1X3UA 3S93A 4RDUA 2R5YB 1WQ2A 3JRCA 4BS9A 4Q48A 2PMHA 3QOEA 3HGGA 2CMPA 1W7PA 2EPFA 2VIXA 5F0HA 3TDZC 3HOTA 4BDZA 4HA8A 4CA0A 4IQJA 3N05A 3ABTA 5M3FJ 2HU9A 4KIFA 4MNUA 2FNAA 3SQNA 3CDIA 2VBZA 4A3MJ 1E17A 1X1DA 4IF4A 3HOWJ 2JA2A 1U78A 5J3LA 4FE4A 4A5MA 1QNTA 4ZH4F 2M7AA 2TCTA 3P9KA 2H6CA 4BQAA 3AFHA 4UNOA 2CQKA 1S29A 1IDYA 3FF5A 2CW0F 3KP6A 1H0MA 2CRGA 5IP9J 2WADA 3JAMK 1DU6A 3SZGA 1JJ8C 4A3GJ 5KVRA 3P7NA 1E3PA 4XORA 3GF2A 1WGXA 4WXDA 3SDBA 4HOBA 3EUHC 3GW2A 1FYLA 2YUSA 5TISC 5F1JA 3GEZA 3FHZA 2ZJQF 1IRGA 1EA3A 2BXZA 4ZYEA 4ENMA 1BIBA 2RV8A 1WHUA 1X2MA 5EZGA 3J7YJ 4PJNA 3BZ6A 1KU3A 2QSGX 4LOCA 2VJ4A 1ZARA 1IN4A 3A4CA 1ZLKA 1F5TA 1FP2A 1TNTA 2E2JJ 1IGNA 2ACJA 1MMAA 1ON1A 4HBLA 2GIVA 3V7CA 1ETWA 2RQQA 5EZHA 4RB1A 1ZG1A 2VT3A 1AKHA 2X9DA 3RQIA 4WXCA 4WXHA 1N77A 2VXDA 5K1YA 4KYWA 3CF5F 4UB8C 2E1NA 3J7ZI 3VOEA 2QA4I 3S1RJ 2BXYA 4XLFA 4BUPA 3OYKA 1OJLA 5L3GA 1S9HA 4YFXF 4YEJA 1ZR2A 1ETVA 1U5TC 5CLSA 2HOTA 1T33A 1KU2A 1XGNA 1QHHD 3PUFA 2MGQA 3RKXA 4UY8I 5E79C 3OYEA 4BDYA 5CVRA 4Y7NJ 1O7LA 1XGMA 2M1BA 4RGSA 5HOOA 2V26A 4HG2A 2HZTA 2DT5A 2R7UA 2W82A 3CTAA 3KX2A 2YPRA 3LAJA 2P6SA 1KQ0A 3WTSC 4W1UA 1HA8A 3ZQIA 3W6KB 4YIIA 1RKWA 3PNVA 5KK1A 4ZTJA 1DQUA 4F92B 1PVEA 3IAM2 3QYFA 5CPRB 1SVLA 5JLWA 1J09A 2E1MC 1BM9A 1I1GA 4GDFA 4XKCA 2V4JC 4LG0B 3PUBA 1T0FC 4KIBA 3COAC 2M0CA 3CMEI 4C3JJ 1HW2A 2BGCA 1NG7A 1G59A 3C2GA 4CH7A 4HZFA 2JA5J 5J1YA 3CLQA 1MBFA 2QLZA 2VN2A 2L9VA 3CDHA 4NNJA 1L0OC 3HSFA 3QOPA 1ETYA 3ULQB 4J01A 3OYCA 2DI3A 4ESBA 3GO5A 4RAFA 1WWXA 4E6KG 3DF8A 4JP0A 4F91B 4KDPA 2HQRA 4B4CA 2QQAA 2VKDA 4ZYHA 4ANJA 3HYIA 1OKRA 1YLFA 3GMEA 2R7OA 3M07A 1ITYA 3M8EA 1YJNI 2N8GA 3OYHA 2KIMA 3FX3A 2VL8A 2XROA 1OCCH 4WX9A 1XDUA 4ON0A 4DBRA 3J81Z 2KLOA 5BQTA 2XAJA 3KLNA 5E8GA 1I6XA 2L9RA 1C0WA 2JRTA 3MZ8A 4MFEA 2EV6A 1SMYF 3HOSA 4DOZA 1LVKA 2EBIA 2VQCA 3BJOA 3ZQHA 5E18F 2MW8A 3QQAA 1ZKGA 4M3BA 1STZA 4OAZA 1WKMA 5FKMA 5DD4A 2OBPA 3J7AY 2E1CA 3HHHA 3DFGA 1Z77A 4PJJA 1FOYA 1WJEA 5DTDA 2EFNA 1D8JA 3ELKA 2KIQA 2XPWA 4PUSA 3FK7A 1UG2A 4P9FA 1SFEA 3QPHA 3CMMA 3HG9A 2XV4S 1E3OC 3JRDA 2OAZA 3WGGA 2JVHA 3OYIA 1N75A 3WTVC 2PMUA 2GM4A 1FJLA 3IC7A 4B48A 1F43A 1IO2A 1USSA 2IVMA 2LDUA 2VB6A 3LSIA 1SD6A 3LWFA 4OAYA 4DYCA 5ED4A 4O6JA 4B47A 1UHWA 1Q1HA 1Z67A 2K3PA 3OYMA 4XOPA 4HNTA 3MKYB 2AQFA 1O3TA 5HS8A 1MDMB 5H20A 5TGTA 3BG6A 1IRFA 3W3CA 2GOXB 3MMYB 1HKQA 4AIHA 2WY8Q 5JI6A 4EATA 4FX0A 1KGSA 2CQXA 3TKYA 2XAGA 2HOEA 4DBQA 3K70D 1NK3P 2XRLA 4UUSB 3HEFA 5DCMA 3H5RA 2EQRA 3BLYA 4LD5A 4PSWA 1VQ4I 3OYFA 2YSRA 4QIWN 3S32A 1VQ8I 5DM7F 4KICA 2K9SA 1ORKA 2VKHA 3CCMI 3HPHA 1A6IA 2NVTJ 4IHWA 3VYTB 2OTLI 3H0GJ 4P55A 1OYWA 2H6BA 3IHUA 2R7ZJ 1VQPI 4IO9F 2F5EA 4XKBA 4L5IA 4BJ6C 3A01B 3W2WA 2D45A 1HW5A 5IYDJ 3KCCA 2E1MB 2W7NA 4ZTFA 4CSWA 2DK5A 3N4MA 3CCRI 2WV1A 1S8NA 4YIFA 1TQMA 1TWHJ 3EETA 2E1OA 2DA6A 2DA4A 1G4DA 2LLKA 1XC5A 4JQFA 4XSZF 2RGVA 3HTUA 5LHIA 4Q5SF 1EV7A 3ECHA 2ID6A 2Z33A 3TP3A 2OUMA 3BPXA 4DYQA 1A6QA 1J9IA 2EIMH 2DYSH 5B1BH 4XLCA 4ZYGA 3K10A 3B6AA 4ABZA 2ZCWA 4OOIA 3MZHA 2HFHA 1MBKA 1TL8A 2EV0A 5E17F 4XRFA 1MGTA 2A6HF 1XD7A 1DGWY 1BBYA 5JVTA 1TC3C 5E3MA 2JA7J 1G3YA 2I8DA 2LC2A 1XMXA 2IGMA 2L7ZA 3QWLA 2BY2A 1KU7A 1Q1VA 1FZPB 3GFIA 2XGCA 2XAFA 4NBQA 1EKEA 2K9MA 4F52A 5FB2A 3TOAA 5A2QZ 3ZRGA 5EDNA 3ISPA 3MCZA 1X1BA 4Y52J 3D1NI 1WI3A 2R7SA 2DOFA 2DFHA 2CQQA 4XOTA 2AHQA 2F5FA 3LL7A 1WFXA 3CCQI 3EPZA 4M3FA 3CC2I 4LG0A 3VYSB 2VJ5A 3D0SA 4D7NA 5IYCJ 3GVAA 3WU0A 3FXMA 5ICCA 1FBQA 4N4NB 3RPUA 3ZMVA 1LE8A 5DUKA 2M34A 2BEOA 4MTDA 3QP6A 1HXDA 3CO6C 2X6XA 1PUEE 4PJLA 1ETOA 3ZMDA 1T8IA 5F0FA 3VYUB 4XLHA 4XLEA 4ITVA 4B3AA 5HVQC 1H9TA 1MNEA 3K0LA 2NS8A 5EJCA 5JR3A 5L3FA 3SXYA 3U1DA 3Q9SA 1P9QC 2O8XA 1GXQA 2DQLA 1GV2A 3ZXSA 2F5DA 3FWEA 2VJJA 4HQMA 4ASNA 3ZQQA 2O6GE 3NWSA 4HNVA 4IVNA 3FXUA 2FX0A 2DCEA 3TP0A 4CUGA 2GIZA 2E2IJ 4MQ9F 5D6FA 2QBYA 1ZGAA 2WAQA 1X2NA 3OIPA 1R9TJ 1JGGA 2MC4A 4IRHA 3KEYA 4C2TA 2IXSA 2VE9A 4HDVA 2LOOA 1FBUA 3C2BA 4RB3C 4HAMA 1MZBA 5FLXZ 3Q0WA 4GRIA 5FD5A 3FBIB 4V2FA 1SFOJ 4L9VA 3F22A 2FE3A 5EG0A 3DPTA 2VOOA 2KJBA 1W0TA 5H6RA 2Z9OA 4IHTA 5K5QA 3GTKJ 2M45A 4KNYA 2ZXHA 5H6QA 3KP3A 1MDMA 2QKMB 2X6WA 2DT6A 3CESA 4G6TB 4B3XA 4FASD 4NDLA 2PI0A 3GFLA 3W6JB 3H0DA 2R4GA 1Z7LA 4PGGA 3BROA 4Y13A 4PJMA 2IS4A 3RPQA 1OR7A 4G8XA 2DJIA 3OMYA 5FGMA 2MBFA 2D5VA 4R1HA 1X1AA 3RZOJ 4PGHA 3I4MJ 5HS7A 1W7PB 2Y0SA 4DGWB 3OSGA 3DQVC 3MZYA 2BY1A 2D1HA 4M73A 5LGUA 5FFXA 3A02A 3X2QH 4MQVA 4F55A 3SDGA 4HRIA 5IT9Z 4PCQA 3VYRB 3V42A 1ZGWA 1LDJA 3OYNA 2DFIA 5CQGA 5ILVA 3B02A 2E35A 4LB5A 2HI3A 3GX4X 1IDZA 4U0YA 4OMZA 3IRQA 2XGDA 1JUSA 4JX6A 5L3EA 1RUOA 4J19A 2ETHA 2VE8A 2WTEA 4BE2A 5M5XJ 1ON2A 1K4SA 2OC6A 2VKVA 3SZPA 5EEHA 2IA2A 5E3OA 1YX5A 3JTHA 2VPRA 4N4OB 1FYMA 1VQ9I 3BR3A 5TRDA 2YR2A 2FUG2 2WBMA 5J4VA 2LREA 2QVOA 1YS7A 1Y0NA 2DA1A 3SHFA 3RTRA 4IHVA 1MJBA 4L18B 1WJBA 2BOLA 1FIAA 4HX4A 3CCJI 3MKZA 3F8BA 2D1VA 4NB5A 1IN5A 2K86A 1J59A 2ELKA 2O5RA 1FP1D 3Q3SA 3WTYC 2ZBKA 4BY7J 1AKHB 5LD2C 1VQ5I 2O7OA 2UV1A 1YIOA 2LFBA 1U8BA 4P1WA 4O5VA 4BL0B 4TV7A 2DLLA 3LSTA 3LA3A 4HLYA 2DA7A 2ZSIB 1FSEA 2X1EA 4A0ZA 1RZ4A 5GAHJ 4G6QA 3QYBA 3TL4X 3VB2A 2KIFA 3V7RA 3GTMJ 1FC3A 3BTLA 1MJAA 4A3DJ 3BCAA 2FOWA 4D1QA 4IRGA 1BA5A 5GAGJ 4UV8A 2R7RA 1W5CC 2DPUA 2QZ8A 2DFEA 3HPGA 2Z1DA 2IBDA 2R92J 3ERMA 2MC3A 2CS3A 3BP8A 5KAIC 2DA2A 2IS6A 3HTSB 3DKYA 3DBLB 2C6YA 2RDPA 2DPDA 2Y30A 3BR1A 2NNYA 3GXOA 3RSNA 3BTIA 1A36A 5BMZA 3HOYJ 4A3LJ 1S72I 1TZLA 4E7HA 2CW7A 2VLAA 4ZC3A 9ANTA 4LB6B 3BPVA 3DPUA 1F36A 3P9IA 1DU0A 3OOPA 1N78A 2JMWA 4OIRF 3DKXA 1Y8QB 5HDNA 2FJ1A 4AIKA 4KMFA 3WGHA 1U8RA 1QZZA 1SVOA 1TQIA 2W1OA 1A04A 3E97A 3F8CA 1NH3A 4ZJZA 1BC8C 4C9YA 2EZIA 5F6FA 4V2GA 3ABUA 1WSUA 3J80K 4XQFA 5EEGA 3S3NA 1Y6IA 3KYLA 2L0KA 3S8PA 1JI8A 2XF5A 2ZC2A 2MSYA 3MD2A 1O7FA 3BR5A 4IEJA 3BT9A 3Q9VA 3WODF 5LHGA 3OYAA 3S2HJ 3D5LA 2A05A 2BV6A 2OCEA 1MKMA 1H88C 2L2OA 3BR6A 3FXLA 5E20A 5DS9A 3Q5FA 1LB2A 2YS9A 4Q4ZF 1BI3A 2H27A 4G6DA 3GTPJ 5GPCA 3WG7H 1QZEA 2NNNA 2L7KA 3BTJA 1V55H 5LGNA 5HDKA 4BE0A 5HLGA 3UNGC 1XSDA 1DDNA 4A6EA 4I99C 1ZK8A 3O8GA 1H89C 2PJRB 1B1BA 2L01A 4CHUA 1UELB 3E5XA 2HXOA 2Q1ZB 2Y31A 2JQ7A 2DAOA 1Y39A 1GV5A 4FE7A 2ZXJA 1LKXA 3GBGA 2HVQA 1YO5C 2IGKA 4BHPA 2NVXJ 2R7WA 5DM6F 2Q2EA 3CCUI 3QPLA 4XLNF 5JFRA 4FX4A 2KP6A 4LIVA 4LJZF 2HQNA 2CQNA 4B1RA 2ME0A 3DLAA 1GVDA 2LMDA 3RKYA 4DIQA 2DA5A 3IV5A 3AG3H 3HOXJ 4X1EA 2HVRA 1LQ1A 4RLFA 3F72A 3RCOA 2R7DA 3GTQJ 2M5WA 2GXBA 4EGZA 1XX5A 2FEZA 1YHQI 4LK0F 1MD0A 2R7VA 4BAYA 5CVJA 4GYIA 4I09A 2JRMA 4XICA 2Y75A 3U21A 3JTGA 5M5WJ 2QYOA 3ESWB 4OWRB 1W36D 5DCMB 3LFKA 3RQ4A 3DEEA 1RR8C 3PFIA 3PIPF 2WAQN 3T1BA 5D5VB 2EIKH 2BVMA 2KFDA 1XCBA 5GTHC 3FIWA 4BHCA 3NEUA 2UXXA 3CMAI 2UXNA 2OTJI 1MSFC 4FTHA 4I0BA 2ISYA 5LEJA 3KP5A 5FD6A 1GT0C 1NG6A 2MLKA 4E7IA 3G6EI 2PN6A 2P5LC 2EZHA 4CICA 1IUFA 3ZMTA 3EYYA 4C2MJ 4I98B 1ETXA 3IL2A 1DUXC 2BVLA 3WGIA 4I76A 1JKQC 2E36A 5C4JJ 3UR3C 5FO5A 3ZCOA 1HKTA 1P7JA 2IGOA 2M87A 1SANA 3MWMA 3M8FA 2E7XA 2ECCA 4L5EA 1IRZA 2P5VA 2OQRA 2ZJ2A 3BZKA 3GWZA 3K4NA 2MG4A 2COBA 2VT2A 4J00A 1K6OA 3HDDA 3TW7A 2Y0SN 3OL3A 3KP2A 2QEXI 1OR7C 2ESNA 2FMYA 3TQNA 5FFZA 5IY5H 2CUJA 2X0LA 3FKJA 1QVUA 2FQ3A 3GTOJ 5K5OA 1FMWA 4NHJA 1XGOA 1HKSA 2F4MB 3DKWA 3D5SC 3OS2A 1YJWI 3IUOA 3F23A 3AG2H 3CO7C 1YITI 2NVQJ 3RYRA 1D5YA 2K9QA 3CD6I 1U9NA 3FXRA 1ENHA 2V9KA 3K4BA 2H8RA 3S17J 3AG4H 2FSWA 2X1DA 2W84A 2K3FA 3FM3A 4ZYAA 1A5JA 2FMLA 1ODDA 1SC7A 4RGUA 1PJRA 1X3ZB 4I2OA 4CDGA 1F9NA 3M7GA 1YG2A 5IYBJ 4AYBA 5DD8A 4RAZA 5HDGA 1R58A 2F4IA 2IS1A 2EA2A 2CSOA 4A2UA 2J5OA 5E8IA 3S1MJ 3LSJA 2EV5A 2EFOA 4HEA2 2KISA 3ASOH 3KP7A 1LE8B 3G3ZA 3ZN1A 4OIPF 4LGWA 4YG2F 3S15J 2FOKA 1UZCA 3GTJJ 1K7AA 2UUZA 1AOYA 1ZHFA 2CUFA 2XSDC 2ZXIA 1Y1VJ 2KRFA 4IXAA 4LG3A 5IOYA 1Y1WJ 1FOXA 4BEHA 3DBRB 3J81K 5IP6A 1R1UA 4UUVA 1LFBA 2EILH 2ZSHB 3H92A 4QSHA 3H5NA 4MEYF 2ELJA 1I5ZA 3PL8A 5CQEA 4AIJA 1GHCA 1AA7A 1K61A 1HSJA 4BJTA 2ZMEB 3ML6A 2VJIA 3JSPA 3S2DJ 2CV1A 1LUJB 1K79A 2L02A 1YW7A 4D7MA 3OSFA 4KN4X 1TT0A 1OCOH 2K85A 3OYLA 3OR1C 2CGPA 4EJTA 1RESA 3DTKA 3V8LA 3KPHA 5M3MJ 1JT6A 3PSFA 1JHHA 2P7VB 4A3CJ 3CC7I 2VKEA 4A3IJ 5K7FA 2QBYB 4B43A 2PJRA 2M8GX 3R4KA 4AC0A 3DEWA 4NC6A 2DK8A 4NQWA 2FBKA 1HDPA 3L9FA 4CYDA 4KIGA 1I39A 3MKLA 3T0YA 4B44A 3CCYA 4XM3A 2NS0A 4E7JA 1ZGJA 6PAXA 2LG4A 2AQEA 4Q47A 2F5CA 4W97A 3I59B 1WJCA 5ICEA 5FJ8J 2KQRA 5EG0B 4JOMA 2F6CA 1IRXA 2CW8A 2E7WA 3CJTB 2XF7A 4ENKA 4KN7X 5FLVA 4Y3OA 2LKPA 4XNFA 3OS1A 4RAYA 4AD9A 3G1LA 1RNLA 2GXAA 2A07F 3R0JA 3CJNA 5FRMA 1BI2A 3VODA 3EUKL 1Z0XA 4DJAA 1IF1A 1REPC 1VQLI 5E1ZB 2G0EA 5ICFA 4CXFA 3TOBA 2M9HA 2CQ7A 3VSLA 2Q8KA 1YRNB 4HF1A 3CUQA 1R5HA 2V79A 1Z6TA 1FX7A 4M71A 4G9YA 4D0PA 4AWXB 1RUNA 3DU5A 2Z16A 1P92A 2ECBA 2L5QA 3LQRA 3OOUA 5B5EC 4KISA 1J7KA 2IAIA 3KZYA 3CJQB 1ZYRF 4E4HA 1MNMC 1FTTA 4N0BA 1Z05A 3WTWC 2HKOA 4IJAA 4KFCA 3K1NA 4D9JA 1EJ9A 1Z21A 3FMRA 3OY9A 1P6RA 4A3FJ 5GTIC 2ZFUA 1K83J 2XDVA 1AU7A 2WB1A 4PFPA 4O3MA 2JN6A 4RS8A 4ENNA 5J8FA 2LRDA 1GVJA 2MFZA 4A3EJ 1OCZH 3V4GA 2VPLA 2NOJB 3MEXA 2F48A 1FPQA 1W4MA 4EEFG 2R7TA 4KMUX 3U9GA 2NXNB 4NC8A 4BJ5C 2O0YA 3HRUA 2ICWG 2XPUA 5A2QK 3O3KA 1ZR4A 3A0BC 3DTEA 4ETSA 3F8NA 1B9NA 2XASA 4M6VA 1FYKA 3M3YJ 3REOA 4PZJA 4XONA 4I7HA 1CQTA 3FXOA 4RM2A 4U87A 2M4KA 4RMNA 1JHFA 2JZYA 5D8KB 3BJ6A 4M9XA 3G2BA 2A61A 2FA5A 1G3TA 3UKGA 3HB9A 4M3EA 2EINH 1S5LC 2MLGA 1MSEC 2ID3A 1W5SA 3HUGA 5B3SH 3CCEI 1XMKA 2EJRA 3BDDA 3H9QA 4BXUA 5KNLA 3IH2A 1YYVA 4U88A 2HPIA 2OF7A 1X4PA 2AXTC 2HDWA 4XL9A 1V54H 2XAUA 1VQKI 3IP4B 4MO7A 2GLOA 4RGXA 2MH2A 3H36A 4BXXJ 5C4XJ 2RQPA 1IW7F 2RREA 3TGNA 4EJUA 4Y15A 2G7HA 2P0WA 4YELA 3J7AO 3HSEA 4NC7A 4XSXF 4FQGA 1TWGJ 2W48A 2XKOA 3BC8A 1H8AC 1F4KA 2X85A 1BOBA 5J4YA 2KDZA 2CYYA 5BPIA 1O4XA 2HVSA 2A6EF 3CLOA 3PQJA 1G6NA 3TMOA 2EFPA 3FXKA 1T39A 2NVYJ 2VUMJ 3FXQA 2A5WA 2ZMEA 4L0ZB 1RI7A 4CCJA 3WU1B 2B7EA 1OFCX 3B6CA 1YTYA 5LEKA 4II2A 1Z91A 2R7QA 1QA6A 4EV0A 2PJPA 2KJCA 3FKIJ 3L00A 4RM3A 1N25A 2A69F 3HRSA 1V5FA 5KCMA 4UUTA 4A5NA 1R1TA 2HQAA 4X0GA 1R22A 3H9JA 4FISA 5FLXK 3HRMA 2M7BA 3N97A 4G7OF 3GLXA 1BL0A 1DP7P 1SD5A 2CJJA 2V9PA 4QPOA 3JRIA 3GUDA 3K2AA 1DPRA 3IH4A 1HBXG 3W6VA 1TWAJ 2IA0A 5EGOA 1FSHA 4IKFA 1SD7A 4QPQA 2K9NA 2D2WA 1TLHB 1FT9A 1VF9A 3I59A 2MYSA 3QPTA 3TEDA 5E3LA 3IRRA 2BW3B 1V3FA 4IPAA 3I55I 3E6CC 4AM3A 3QU6A 4LFUA 3F9KA 4AYBN 2DMNA 1W1WE 3QPSA 5DV5A 1GDTA 2XGXA 4CZCA 3FHNA 2CG4A 3KIOA 2P7CB 5DDGA 1HOMA 4L9NA 3L7WA 2ADUA 4HX7A 3K4LA 3TO7A 4UHTA 2E19A 3K70C 1VTNC 5ICGA 1GLNA 4HNUA 3SEZA 1FEXA 3QU3A 2DN0A 2Q2EB 2QF7A 1IV6A 1S6LA 1ZG3A 2EZKA 2QQ9A 5IT9K 2NVUB 1WVRA 2VOPA 5K7ZA 3VPRA 1YRNA 5ILUA 5GPAA 5LHHA 4S0HB 2EFWA 1J0RA 3PO3J 5D4SA 3EQLF 5EYRA 2ME6A 1QGPA 2QM3A 2MD0A 2OJED 4QTRA 1FTZA 4IQ4A 3K69A 1W5TA 3M1EA 1RETA 2COMA 1OLTA 2V9VA 2V1NA 4L5JA 1BIAA 2BZTA 4JK1X 4A3JJ 4HF0A 3ABMH 1ZTRA 4K2EA 1X3WB 2FRHA 2KKOA 5FROA 5HS9A 1GXPA 5ILSA 5D4RA 5KAFC 1ZRCA 3WE2A 1LJ9A 3O8HA 3RIRA 5IOZA 2VBWA 4EM1A 3CC4I 1OISA 3RKWA 4XLPF 1ZQ3P 4XN3A 1G2HA 3DP7A 1QO0D 3BY6A 2Y9YA 2H09A 3FM5A 3L2QA 3T5XA 5LRSA 2M4GA 1Y56A 2RN7A 4EMSA 3A03A 4XBFA 4ZDOA 3NWTA 4Y33A 2W24A 3C2HA 2LK2A 3LQQA 1WJFA 1SAXA 1FLIA 3BTCA 1ETQA 3H3UA 2LR8A 3G1OA 2YU3A 2TDXA 4XRSA 1PP8F 1NK2P 4HW0A 5LBQA 3WHBA 3IKTA 1SMTA 5F1RA 4EJWA 4H0EA 1WRJA 3JREA 4BYYA 4KJZA 5HLHA 3V7SA 5D5UB 2BY3A 2HR3A 2Y2ZA 1FOWA 3CQZJ 5BNGA 3I3LA 4Z2YA 3BG5A 2CFXA 1O57A 3LSMA 3F0CA 3V8JA 1IC8A 4PDKA 2MD5A 4UVBA 3LSRA 1J5YA 2PLYA 4IX7A 3KFWX 2CH0A 2ZB9A 4MHGA 2O3FA 3HOZJ 4A69C 4CYCB 1P2FA 4IOCF 1BW6A 2WC2A 1IXRC 3CUQC 3S2WA 4EM2A 1JE8A 1J75A 4ZZDA 3ZGKA 5L3DA 2STWA 1V5EA 3I5UA 3V8KA 2PMZA 2HS5A 3FBNB 1SVMA 5J40A 3C3WA 2DMQA 2KZGA 4DW6A 2VC0A 2DDAA 2F5VA 1V4RA 5HNFA 3DV8A 1QQIA 2L4MA 3R60A 1B6AA 2VBXA 4GXOA 5EF6A 3G73A 2HWVA 5L3BA 4A0YA 2YU9J 3K4KA 4HX8A 2WB1N 1Y8RB 3T8RA 2XUBA 3R61A 1JT0A 4I0AA 3KZIC 4XLAA 2HEOA 1I3QJ 2F2EA 4UV9A 4A0XA 3C7JA 2XAQA 4WK8F 2P81A 3K6GA 3ZQGA 1JKPC 2XAHA 5JLXA 2EFQA 1QU3A 3PFYA 3HJEA 5LFAA 1L3LA 3E3VA 3QYEA 2L4AA 4G94A 1JUPA 2F4OB 3HL2A 2ZO4A 3OYDA 2I5UA 1IZ1A 1YW8A 3W2VA 5DEQA 1FIPA 3WG9A 4AVPA 2DXIA 1FOKA 2L54A 4BQOA 2RC4A 3I58A 1MIJA 3F6VA 4BEHB 5IP7J 2HDCA 4CCOA 3Q0UA 1PYVA 2KMUA 3JSOA 3LAPA 3IWFA 3ZOBA 4B09A 3CF2A 3Q0VA 2KPMA 5HLIA 1POGA 3FK6A 1VQMI 1MW7A 4A3BJ 4XMYA 2JUGA 3KETA 1ZH5A 3ECOA 3F6OA 4M72A 4F93B 3BOQA 3M8JA 1HQCA 1R6RA 2JT1A 1USTA 3HC7A 4ZDLA 2W85A 2H94A 2K5CA 4G7ZF 2BW3A 2JPCA 4N9HA 3O2PE 1R71A 2VQHA 4NQWB 3S3MA 2HNHA 3E6BA 5BS6A 1KZHA 4KA4A 1ZG5A 3BQYA 1Z9CA 2KL4A 5JVGF 4RAGA 2V1DA 3ZN0A 4BH9A 3GCMA 2A5YB 1U6GA 4XK4A 2MABA 2MH9A 1PUFB 5LGTA 3VWBA 3VSKA 3KYCB 2CV2A 1NTCA 2L7FP 2EA4A 3WTTC 2HYJA 2Y69H 4RGRA 2IEKA 4BKXA 1XDSA 4HV5A 4QWQA 1O3RA 1BC7C 3R0AA 3OYBA 1R5GA 1JTYA 1FBSA 4AIDA 2XHKA 2G7UA 1EH6A 2EZLA 2NAZA 1CF7B 4OIOF 1XB4A 3KEOA 4AUXA 3A0HC 2ZJRF 4IZZA 2AXLA 1WCMJ 3ZPLA 4R79A 2GQQA 4HSRA 5GP9A 1OPCA 3SFIA 2M30A 4MEXF 5FLMJ 2ZMEC 1X1PA 2R93J 2M0MA 3CUQB 1ZRDA 4R8HA 2W00A 1RIOH 5L3CA 4EM0B 4WF2A 5CVUA 3JRBA 1I50J 3IH3A 5CVIA 4ESJA 2HYGD 1YW9A 4OIQF 2X6YA 5J8CA 4A12A 2V1UA 2R7FA 1D1CA 2E71A 2R0QC 3GZ5A 5J6XA 2Z3YA 1UB9A 4I01A 4CCMA 1JJ6C 4FETA 5CKTA 2FNPA 1WH5A 2OU2A 3BG9A 2JSCA 2CO5A 3CP8A 2DOEA 1OYIA 5CVVA 1G3SA 3LSHA 2ZFWA 3M1CA 1TWFJ 1B59A 3BQZA 1IXSB 1A35A 1TWCJ 1IJWC 3F21A 2XB5A 2HZDA 2FBHA 2W25A 2OZ6A 1D0YA 2O8KA 3FMSA 3CUOA 2LF7A 4GFBA 1LFPA 1MMSA 3JAMZ 3FDYA 1MJ9A 3LSPA 3DTIA 2KZVA 4U0WA 1P4WA 4D5FA 3S1NJ 3S3OA 1X4OA 3GZNB 5HLTA 1P4XA 4CYCA 4EGYA 2FXAA 3CCSI 2M8EA 2GOMA 1R49A 2DTZA 3AL0C 3K7AJ 1WJDA 3K4MA 2DA3A 4M9ZA 2HOAA 2XPVA 4BNCA 1UCRA 5B66C 1IV8A 1XGSA 3VDXA 3HOVJ 4IHSA 3IAS2 3JRAA 2Y9ZA 1WPKA 4E7SA 1H9GA 4BQQA 1VI0A 2O03A 2UWMA 2LH9A 4LK1F 1FY7A 4G12A 3HUGB 4RA2A 2ZKZA 3K1MA 1UJ8A 3ABLH 1VQNI 1XS9A 1K4TA 3A2KA 5IT3A 3KE2A 2HTSA 3H5AA 1JKOC 2OCCH 1GUUA 2DFFA 4XIDA 1HCRA 2H1LA 4HSTA 4UVAA 2FU4A 4B8XA 2HTJA 1W7PD 3ZP5A 1B8IA 3GTGJ 1XG1A 1UHMA 3T8TA 1BOAA 4HV6A 3AAFA 3H3ZA 1IG7A 5AIQA 3MAJA 2A6TA 2VODA 1BR2A 3C1DA 1YFHA 3SZTA 2HDDA 3TBIA 1D1AA 3BCBA 3GYHX 5FRNA 4MLOA 1LEBA 4Y4RA 3KYDB 2JSPA 1DPUA 2JJ7A 3K1PA 1SFKA 2H1KA 3P5JA 4NUBA 3K2ZA 1O3SA 1JTXA 3K4CA 1R1VA 1TW3A 4PFOA 5BOXA 4ZZLA 4LLNA 1KA8A 3E6DA 3L2UA 5D5XB 1E3HA 4MIMA 1SEUA 3F8MA 1X1CA 2LY9A 3TDUC 5HNHA 2LYCA 4HLXA 4PJ0C 4I02A 5TJJA 3EUAA 1OCPA 4HYEA 2HOSA 4DZPA 3G71I 2DOAA 2VXZA 3L2VA 1AHDP 2PMZN 1R4NB 2YX4A 3JRGA 3L2RA 1QBJA 2LTPA 1FWZA 1MBJA 3TW6A 1LPQA 1Y0UA 5EGOB 4V19K 4CZZA 2WAEA 2IGNA 1T56A 2V7FA 2R5ZB 1K78B 1PUFA 4BU2A 2YX7A 1FNNA 4FCYA 4IRIA 4N9IA 2R3SA 3S14J 2NOGA 3F3XA 3HXLA 4UVCA 4YIRX 2X1CA 1LDDA 2K4JA 2LP0A 1XN7A 1P7IA 1R7JA 3RDIA 2BE5F 1MBHA 1OYYA 1UMQA 1OCRH 1CF7A 1W36C 2DMUA 3PIOF 2HYFA 3EDPA 1MH3A 2RNJA 5F27A 4H4KC 4WWCA 3H1CA 3ZQLA 4HDUA 2KDOA 4LMYA 2RAEA 2QSFX 2LVSA 4E70A 2R5YA 3AL0B 1JKRC 3KP4A 2ISZA 1XSXA 3LMMA 1T38A 1S3JA 1JXSA 4E7KA 4M74A 3FMQA 5AONA 3CCVI 1U3EM 2LBFB 2GAUA 1U5TB 3GFMA 3JRHA 3I4NJ 2CUEA 3ZR8X 1OQYA 3LA2A 3ZQ7A 2GA1A 2QWWA 3TO9A 5FKOA 2LY1A 1QPMA 1I1SA 4KT6A 3OS0A 3RKQA 1DGRM 2XGEA 4HPQA 2XB0X 3P9CA 2E5ZA 3HKZA 1TTYA 2V6CA 2FD5A 2LKSA 3L2WA 2EB7A 1IAWA 3JW4A 1YI2I 1BI0A 4L9TA 4BGDA 2G9WA 3S16J 4DYRA 4Z6YA 3HSRA 2QENA 3L09A 5ERIA 4CCLA 5J1UA 3R6SA 1KQ9A 1AWCA 4F3QA 1HW1A 4LLGF 1TT5B 5F08A 3JRFA 2JA6J 4S05A 2DU9A 4IL6C 1QZYA 4U7DA 3S1QJ 3KEQA 2DODA 5DUIA 1ACIA 4M3DA 4BACA 3PQKA 5FKKA 1OMIA 1WH7A 2IJLA 4UXNA 2XKPA 3ROUA 3PSIA 4II3A 3CJRB 3DPLC 2M3AA 3TO6A 1ZN2A 2Z99A 5BPDA 2K9LA 4EQQA 4ENJA 3C18A 1WI9A 3OV8A 3WTXC 2QQBA 2BHYA 1WJ5A 1IN6A 2P4WA 3VEPA 1D0XA 2JPBA 1RR7A 1B72B 3H9GA 2A3SA 4OU0A 5LLQA 1MBEA 1LNWA 2DT7B 2E60A 1WJAA 3RI4A 1KYZA 2A68F 3MVPA 1G8XA 1T98A 1Z6RA 3O6BB 1D0ZA 2VBYA 2DQRA 5E3NA 4JX5A 4XKWA 4JYKA 4KITB 4E7LA 3QRFF 3BR0A 2AO9A 3CCLI 4ZYDA 2HXIA 2QGUA 5C3EJ 3I56I 1Z7UA 3E5QA 2DYRH 2J5PA 2QKLB 1S7OA 1YQAA 2BYVE 1ZAOA 2E2HJ 2UZKA 3ASNH 5C44J 4OINF 3OWTA 2K27A 2W57A 2KT0A 1W0UA 2JA8J 2QSHX 1RKTA 1XTAA 1T08B 4HQEA 4BQNA 2OQGA 2EH3A 1ETKA 1G3WA 1D8KA 4RLQA 5JHUA 5K7HA 4RB2C 2X4HA 1F1ZA 3DCFA 3HBLA 1D3YA 3ZMSA 2V6EA 3PM1A 1ZRFA 1SFUA 5E1WA 4IHYA 3WHCA 4FT8A 1UHSA 1MBGA 3GLLA 1UG0A 3I9V2 4OMYA 4DNCA 4FHTA 2XF6A 2JWTA 4BXFA 1I3AA 3B73A 2STTA 1X19A 2Z2SB 1MMDA 2ELHA 3JR9A 1BJAA 2E5NA 1D5VA 3RJPA 1HSTA 2P8TA 2IP2A 4PSXA 3WTUC 3I71A 1TW2A 3AKZA 3HZJA 4C3IJ 2JUCA 3DU6A 2MA3A 4BBSJ 3L2CA 2FF4A 3K4JA 5M5YJ 2KHMA 1CGPA 2EK5A 3JCUC 3LFUA 3DLLF 1LVAA 3PO2J 3I53A 2WAFA 4AU7A 3AG1H 3DBHB 2ZNYA 2R5ZA 1K78A 1BI1A 1VQ7I 1EH8A 2IPQX 4WCGA 2DMTA 3U2RA 2DTRA 5CJ9A 1T95A 3KZZA 2PFBA 4RB0A 3HOUJ 4LITA 1QRYA 5DCFA 2VQLA 2WA0A 3I54A 5H2FC 2L9NA 1XSVA 3EUHA 4XRSG 2IRFG 3DXJF 4U0VA 2JTVA 4CCNA 3ABKH 2PX9A 2BHZA 3E5UA 1J2XA 4QLCU 1R36A 4KUMA 1I27A 4ESFA 1YE9A 2VASA 4A6DA 2XC7A 3HRTA 1MH4A 3VFZA 1T2KA 1JGSA 4BY1J 1E0EA 2RVCA 2WY7Q 3PNYA 3LSGA 2BY0A 1ZREA 5B1AH 4XR6A 2DMPA 3MQ0A 2CU7A 1R23A 3NARA 1HF0A 3D5RC 3LOCA 5KHDA 3PJRA 3ZMZA 3MFKA 1VFCA 4EJOA 2LBFA 1U5TA 2I10A 3HIFA 2HPMA 2RNGA 4KT5C 1QPIA 2VI6A 1MNDA 2EWNA 3HHGA 1BW5A 2VC1A 5FKNA 3I4PA 4UUSA 2GBYA 3KLOA 2Z5UA 2ZNZA 3E7LA 2O61A 1XPXA 4BBRJ 3CMYA 1MMGA 2EIJH 2JVGA 1TBXA 1ZLJA 3GTLJ 3RPUD 2FQ4A 3HM5A 1FMVA 1RRJA 3OL4A 1BR1A 2QCOA 1ZELA 2DDBA 2LF8A 5EEAA 1Z1DA 5J47A 1RPWA 5CYVA 2CWEA 4ZDPA 1B9MA 2OD5A 2PEXA 4GYGA 1HDDC 3GZ6A 3WU2C 3A01A 4F7ZA 1JUMA 2DW4A 4AVZA 2LKXA 1S7EA 5GAEJ 1A31A 1EF4A 1BJZA 4C30A 3OYJA 1O3QA 1KYWA 1T0FA 2X48A 4S04A 2M2EA 3E6MA 4MGRA 3EYIA 5DYMA 1TNSA 3M9AA 2WV0A 2LSOA 1BN5A 1D1BA 2JK3A 2KIUA 2R7XA 4Y17A 3RZDJ 1KU9A 2QUFA 2OV7A 2GWRA 4C2UA 1RC9A 2DO7A 4DQ2A 1B72A 1LFUP 1Z3XA 2H8WA 1APLC 4I6ZA 2X6OA 3CDLA 2IS2A 1XCVA 2E34A 3BG3A 3SJMA 4X6AJ 4M9SA 4XN0A 4L0YB 3CP2A 1SFXA 3IWZA 2GA2A 2VQGA 3I64A 4JX4A 3SFZA 1I6HJ 1U9OA
chains in the Genus database with same CATH topology
1SD4A 4EJVA 3ZMUA 4JBAA 2XIGA 4EVIA 4HF2A 3I0TA 1IN8A 4GCVA 3QP5A 3NRVA 3QAHA 2OZUA 2IW5A 1XMAA 1P4AA 2WWYA 4G7HF 3F8FA 1IUYA 2XRNA 1PDNC 5F64A 1UFMA 4YFKF 2Q0OA 2OA4A 3GFJA 2VONA 1LDKB 1IN7A 5D8LB 2HGCA 2BBYA 3LA7A 2P6TA 4LLLA 1IXCA 4M6YA 2RKHA 2IA1A 5E1XA 2K7LA 3DEUA 4YFNF 4GGGA 3RYPA 5LRRA 1EH7A 4P5OA 1NHAA 4MTEA 1TQPA 2Y48A 1KQ8A 5D5WB 1ULYA 2PQ8A 5D6EA 5AIPA 2IT0A 2NRAC 4U7BA 2K4BA 3BJAA 3IKVA 3BWGA 2B0LA 1LEAA 3J80Z 2GZWA 1B4AA 1PP7U 2PG4A 4GO1A 2XVCA 3K9TA 4BHBA 4CO8A 2Y0MA 5K5RA 4L9JA 3ERED 1U2WA 2AS5F 3FZVA 4P96A 2ESHA 2P5KA 2FBIA 4P9UA 4CGZA 2L3DA 1YS6A 1E2XA 1T6SA 3NQOA 2NYXA 2PBIA 3WTZA 2HKXA 1ONVA 2GXGA 2K02A 1S7AA 2DBBA 2LNBA 3WE3A 1R00A 2V1XA 4M6XA 1X3UA 1WQ2A 4Q48A 2PMHA 1W7PA 3TDZC 3HOTA 4HA8A 3ABTA 4KIFA 4MNUA 2FNAA 3SQNA 2VBZA 1E17A 4IF4A 1U78A 4A5MA 1QNTA 4ZH4F 3P9KA 4BQAA 2H6CA 4UNOA 2CQKA 1S29A 3FF5A 2CW0F 3KP6A 1H0MA 3JAMK 5KVRA 3P7NA 3GF2A 4WXDA 4HOBA 3GW2A 1FYLA 3GEZA 3FHZA 1IRGA 4ENMA 4ZYEA 1BIBA 2RV8A 3BZ6A 1KU3A 1ZARA 1IN4A 1ZLKA 1F5TA 1FP2A 1TNTA 2ACJA 1ON1A 4HBLA 2GIVA 3V7CA 4RB1A 1ZG1A 2VT3A 4WXCA 4WXHA 5K1YA 4KYWA 2E1NA 3VOEA 5L3GA 4YFXF 1U5TC 5CLSA 1KU2A 1XGNA 3RKXA 5CVRA 1O7LA 1XGMA 2M1BA 4RGSA 5HOOA 2HZTA 2DT5A 3CTAA 2YPRA 3LAJA 2P6SA 1KQ0A 3WTSC 3W6KB 4YIIA 5KK1A 1BM9A 1I1GA 4LG0B 4KIBA 3COAC 1HW2A 2BGCA 4HZFA 2QLZA 2VN2A 3CDHA 1L0OC 3HSFA 3QOPA 3ULQB 2DI3A 4ESBA 3GO5A 1WWXA 3DF8A 4KDPA 2HQRA 2QQAA 4ZYHA 3HYIA 1OKRA 1YLFA 3M8EA 2KIMA 3FX3A 2XROA 4WX9A 1XDUA 4ON0A 3J81Z 5BQTA 2XAJA 3KLNA 5E8GA 1I6XA 1C0WA 2JRTA 2EV6A 1SMYF 3HOSA 3BJOA 5E18F 1STZA 1WKMA 5DD4A 2OBPA 2E1CA 3HHHA 3DFGA 2EFNA 1D8JA 3ELKA 4P9FA 1SFEA 3QPHA 2XV4S 2OAZA 3WGGA 3WTVC 2PMUA 3IC7A 1USSA 2IVMA 2LDUA 1SD6A 3LWFA 5ED4A 4O6JA 1UHWA 1Q1HA 1O3TA 5HS8A 1MDMB 5H20A 1IRFA 1HKQA 4AIHA 5JI6A 4FX0A 1KGSA 3TKYA 2XAGA 2HOEA 5DCMA 4LD5A 2YSRA 4KICA 4P55A 1OYWA 2H6BA 3IHUA 2F5EA 4L5IA 2D45A 1HW5A 3KCCA 2DK5A 3N4MA 1S8NA 4YIFA 1TQMA 3EETA 1G4DA 4JQFA 4XSZF 2RGVA 3HTUA 5LHIA 4Q5SF 1EV7A 3ECHA 2Z33A 3BPXA 1J9IA 4ZYGA 2ZCWA 4OOIA 3MZHA 2HFHA 2EV0A 5E17F 4XRFA 1MGTA 2A6HF 1XD7A 1BBYA 5JVTA 1G3YA 1KU7A 1FZPB 3GFIA 2XAFA 5FB2A 3TOAA 5A2QZ 3ISPA 3MCZA 2F5FA 4LG0A 3D0SA 3GVAA 3WU0A 5ICCA 1FBQA 3RPUA 3ZMVA 5DUKA 2BEOA 4MTDA 3QP6A 1HXDA 3CO6C 1PUEE 3ZMDA 5HVQC 1H9TA 3K0LA 5JR3A 5L3FA 3SXYA 3U1DA 3Q9SA 2O8XA 1GXQA 2DQLA 2F5DA 3FWEA 4HQMA 4ASNA 2O6GE 4IVNA 3FXUA 4MQ9F 5D6FA 2QBYA 1ZGAA 4IRHA 2VE9A 4HDVA 1FBUA 4RB3C 4HAMA 1MZBA 5FLXZ 5FD5A 4L9VA 3F22A 2FE3A 3DPTA 2VOOA 2KJBA 5H6RA 2Z9OA 4IHTA 5K5QA 2M45A 4KNYA 5H6QA 3KP3A 1MDMA 2PI0A 3GFLA 3W6JB 4PGGA 3BROA 4Y13A 3RPQA 1OR7A 4G8XA 5FGMA 2MBFA 4R1HA 4PGHA 5HS7A 1W7PB 3DQVC 3MZYA 2D1HA 4M73A 5LGUA 5FFXA 4MQVA 5IT9Z 4PCQA 1LDJA 2DFIA 5ILVA 3B02A 4LB5A 3GX4X 4U0YA 4OMZA 3IRQA 5L3EA 1RUOA 2ETHA 2VE8A 2WTEA 1ON2A 3SZPA 5EEHA 2IA2A 3JTHA 1FYMA 5TRDA 2YR2A 2QVOA 1YS7A 3SHFA 3RTRA 1MJBA 4L18B 4HX4A 3F8BA 2D1VA 4NB5A 1IN5A 2K86A 1J59A 1FP1D 3WTYC 2ZBKA 1YIOA 4O5VA 4TV7A 2DLLA 3LSTA 3LA3A 4HLYA 1FSEA 4A0ZA 1RZ4A 4G6QA 3VB2A 2KIFA 3V7RA 1FC3A 1MJAA 4IRGA 4UV8A 2DPUA 2QZ8A 2MC3A 3BP8A 3HTSB 2C6YA 2RDPA 2DPDA 2NNYA 3GXOA 5BMZA 4LB6B 3BPVA 3P9IA 3OOPA 4OIRF 5HDNA 4AIKA 4KMFA 3WGHA 1U8RA 1QZZA 3E97A 1TQIA 1A04A 3F8CA 1BC8C 5F6FA 3ABUA 1WSUA 3J80K 5EEGA 1O7FA 3Q9VA 3WODF 5LHGA 3D5LA 2BV6A 1MKMA 5E20A 1LB2A 3Q5FA 4Q4ZF 1BI3A 2H27A 4G6DA 2NNNA 5LGNA 5HDKA 5HLGA 1XSDA 1DDNA 4A6EA 1B1BA 2L01A 4CHUA 3E5XA 2DAOA 2ZXJA 1YO5C 4BHPA 2Q2EA 4XLNF 5JFRA 4FX4A 4LJZF 2HQNA 3RKYA 1LQ1A 3F72A 2R7DA 2M5WA 2GXBA 4EGZA 2FEZA 4LK0F 1MD0A 4BAYA 5CVJA 4GYIA 4I09A 2Y75A 3JTGA 2QYOA 5DCMB 3LFKA 3PFIA 3T1BA 5D5VB 1XCBA 4BHCA 3NEUA 2UXXA 2UXNA 4I0BA 2ISYA 5LEJA 3KP5A 5FD6A 2MLKA 2PN6A 2P5LC 4CICA 3ZMTA 3EYYA 4I98B 3IL2A 1DUXC 3WGIA 5FO5A 1HKTA 2M87A 3MWMA 3M8FA 2E7XA 2P5VA 2OQRA 2ZJ2A 3GWZA 2VT2A 1K6OA 3KP2A 2ESNA 2FMYA 3TQNA 5FFZA 2X0LA 2FQ3A 5K5OA 4NHJA 1XGOA 1HKSA 3DKWA 3F23A 3CO7C 3RYRA 3FXRA 2FSWA 2W84A 3FM3A 2FMLA 1ODDA 4RGUA 4I2OA 4CDGA 1F9NA 3M7GA 1YG2A 5DD8A 4RAZA 5HDGA 1R58A 2EA2A 2CSOA 4A2UA 2J5OA 5E8IA 2EV5A 2EFOA 3KP7A 3G3ZA 3ZN1A 4LGWA 4YG2F 2FOKA 1K7AA 1AOYA 1ZHFA 2KRFA 4IXAA 3J81K 1R1UA 4UUVA 3H92A 4MEYF 1I5ZA 4AIJA 1GHCA 1HSJA 2ZMEB 3ML6A 3JSPA 1K79A 2L02A 1YW7A 4KN4X 2CGPA 4EJTA 3V8LA 1JHHA 2P7VB 2QBYB 3R4KA 2DK8A 4NQWA 2FBKA 3L9FA 4CYDA 4KIGA 3T0YA 2NS0A 1ZGJA 6PAXA 4Q47A 2F5CA 3I59B 5ICEA 2E7WA 4ENKA 4KN7X 2LKPA 4RAYA 4AD9A 1RNLA 2A07F 3R0JA 3CJNA 1BI2A 3VODA 1REPC 1IF1A 5E1ZB 5ICFA 4CXFA 3TOBA 2Q8KA 4HF1A 3CUQA 1R5HA 2V79A 1Z6TA 1FX7A 4M71A 4G9YA 4D0PA 4AWXB 1RUNA 1P92A 3LQRA 1J7KA 3KZYA 1ZYRF 4N0BA 1Z05A 3WTWC 2HKOA 4IJAA 4KFCA 3K1NA 3FMRA 1P6RA 4O3MA 4RS8A 4ENNA 5J8FA 1GVJA 3V4GA 3MEXA 1FPQA 1W4MA 4KMUX 3U9GA 2O0YA 3HRUA 5A2QK 3O3KA 4ETSA 3F8NA 1B9NA 2XASA 1FYKA 3REOA 4PZJA 4I7HA 1JHFA 2JZYA 5D8KB 3BJ6A 4M9XA 2A61A 2FA5A 1G3TA 2MLGA 1W5SA 3HUGA 1XMKA 2EJRA 3BDDA 4BXUA 1YYVA 4U88A 4RGXA 2MH2A 2RQPA 1IW7F 3TGNA 4EJUA 4Y15A 2G7HA 3J7AO 3HSEA 4XSXF 2XKOA 1F4KA 2CYYA 5BPIA 2A6EF 3CLOA 3PQJA 1G6NA 2EFPA 1T39A 3FXQA 2ZMEA 4L0ZB 1RI7A 3WU1B 1YTYA 5LEKA 1Z91A 4EV0A 2PJPA 2KJCA 3L00A 2A69F 3HRSA 4A5NA 1R1TA 1R22A 5FLXK 3HRMA 3N97A 4G7OF 3GLXA 1DP7P 1SD5A 3GUDA 1DPRA 1HBXG 2IA0A 1FSHA 1SD7A 2D2WA 1TLHB 1FT9A 3I59A 3QPTA 3IRRA 1V3FA 4IPAA 3E6CC 3QU6A 4LFUA 5DV5A 2XGXA 2CG4A 2P7CB 5DDGA 4L9NA 3L7WA 2ADUA 4HX7A 3TO7A 4UHTA 1VTNC 5ICGA 3QU3A 1S6LA 1ZG3A 2QQ9A 5IT9K 2VOPA 5ILUA 5LHHA 2EFWA 1J0RA 5D4SA 3EQLF 1QGPA 2QM3A 3K69A 1W5TA 3M1EA 2COMA 2V9VA 4L5JA 1BIAA 4JK1X 4HF0A 4K2EA 2FRHA 2KKOA 5HS9A 1GXPA 5ILSA 5D4RA 1ZRCA 3WE2A 1LJ9A 3RIRA 2VBWA 4EM1A 3RKWA 4XLPF 3DP7A 1QO0D 3BY6A 2H09A 3FM5A 3T5XA 5LRSA 2RN7A 4EMSA 4XBFA 2W24A 3LQQA 1SAXA 1FLIA 3H3UA 2YU3A 2TDXA 1PP8F 4HW0A 5LBQA 3IKTA 1SMTA 5F1RA 4EJWA 4H0EA 1WRJA 4BYYA 5HLHA 3V7SA 5D5UB 2HR3A 4Z2YA 2CFXA 1O57A 3V8JA 4PDKA 2MD5A 4UVBA 1J5YA 2PLYA 3KFWX 4MHGA 2O3FA 1P2FA 2WC2A 1IXRC 3CUQC 3S2WA 4EM2A 1JE8A 1J75A 4ZZDA 5L3DA 2STWA 3I5UA 3V8KA 2HS5A 3C3WA 2VC0A 1V4RA 3DV8A 1QQIA 2L4MA 3R60A 1B6AA 2VBXA 4GXOA 3G73A 2HWVA 5L3BA 4A0YA 4HX8A 3T8RA 2XUBA 3R61A 4I0AA 2HEOA 2F2EA 4UV9A 4A0XA 3C7JA 2XAQA 4WK8F 2XAHA 2EFQA 1L3LA 3E3VA 2L4AA 4G94A 2ZO4A 1IZ1A 1YW8A 5DEQA 3WG9A 4AVPA 1FOKA 2L54A 2RC4A 3I58A 3F6VA 2HDCA 3JSOA 3LAPA 3IWFA 4B09A 5HLIA 3KETA 1ZH5A 3ECOA 3F6OA 4M72A 3BOQA 1HQCA 2JT1A 1USTA 2W85A 2H94A 4G7ZF 2JPCA 4N9HA 3O2PE 3E6BA 5BS6A 4KA4A 1ZG5A 1Z9CA 2V1DA 3ZN0A 4BH9A 2A5YB 1U6GA 2MH9A 5LGTA 2EA4A 3WTTC 4RGRA 1XDSA 4HV5A 4QWQA 1O3RA 1BC7C 3R0AA 1R5GA 1FBSA 2XHKA 2G7UA 1EH6A 2NAZA 1CF7B 4OIOF 1XB4A 3KEOA 3ZPLA 2AXLA 4R79A 2GQQA 1OPCA 4MEXF 2M30A 3CUQB 1ZRDA 4R8HA 1RIOH 5L3CA 4EM0B 4WF2A 5CVUA 5CVIA 4ESJA 2HYGD 1YW9A 4OIQF 5J8CA 4A12A 2V1UA 2R7FA 3GZ5A 5J6XA 2Z3YA 1UB9A 4I01A 2FNPA 2OU2A 2JSCA 2CO5A 1OYIA 5CVVA 1G3SA 2ZFWA 1B59A 1IXSB 3F21A 2FBHA 2W25A 2OZ6A 3FMSA 3CUOA 2LF7A 3JAMZ 1MJ9A 4U0WA 1P4WA 1P4XA 4EGYA 2FXAA 2M8EA 4M9ZA 4BNCA 1UCRA 1XGSA 4IHSA 1H9GA 2O03A 2UWMA 4LK1F 1FY7A 2ZKZA 3K1MA 5IT3A 3KE2A 2HTSA 4UVAA 2FU4A 4B8XA 2HTJA 1W7PD 3ZP5A 1UHMA 3T8TA 1BOAA 4HV6A 3AAFA 3H3ZA 5AIQA 3MAJA 2VODA 3C1DA 1YFHA 3SZTA 3GYHX 1LEBA 1DPUA 3K1PA 3K2ZA 1O3SA 1R1VA 1TW3A 5BOXA 4ZZLA 4LLNA 1KA8A 3E6DA 5D5XB 3F8MA 3TDUC 4HLXA 5TJJA 4I02A 4HYEA 2VXZA 2YX4A 1QBJA 1FWZA 1Y0UA 4CZZA 1K78B 2YX7A 1FNNA 4IRIA 4N9IA 2R3SA 3F3XA 4UVCA 1LDDA 2K4JA 1XN7A 1R7JA 3RDIA 2BE5F 1OYYA 1CF7A 2HYFA 3EDPA 2RNJA 4WWCA 4HDUA 4LMYA 4E70A 3KP4A 2ISZA 1XSXA 1T38A 1S3JA 1JXSA 4M74A 3FMQA 5AONA 1U3EM 2GAUA 1U5TB 3GFMA 3ZQ7A 3LA2A 2GA1A 2QWWA 3TO9A 1QPMA 1I1SA 3P9CA 1TTYA 2V6CA 2EB7A 1IAWA 3JW4A 1BI0A 4L9TA 2G9WA 3HSRA 2QENA 3L09A 5ERIA 3R6SA 1AWCA 1KQ9A 1HW1A 4LLGF 4S05A 2DU9A 1QZYA 4U7DA 3KEQA 5DUIA 3PQKA 1OMIA 2IJLA 4UXNA 2XKPA 3ROUA 3DPLC 3TO6A 1ZN2A 2Z99A 5BPDA 4EQQA 4ENJA 3C18A 1WI9A 3OV8A 3WTXC 2QQBA 1IN6A 2P4WA 3VEPA 2JPBA 2A3SA 4OU0A 5LLQA 1LNWA 3RI4A 1KYZA 2A68F 1T98A 1Z6RA 3O6BB 2VBYA 2DQRA 3QRFF 4ZYDA 1Z7UA 3E5QA 2J5PA 1S7OA 1YQAA 2BYVE 1ZAOA 2UZKA 4OINF 2K27A 2W57A 4HQEA 2OQGA 1G3WA 1D8KA 5JHUA 4RB2C 2X4HA 1F1ZA 1D3YA 3ZMSA 1ZRFA 1SFUA 5E1WA 4FT8A 4OMYA 4DNCA 4FHTA 3B73A 2STTA 2ELHA 1BJAA 1D5VA 3RJPA 1HSTA 3WTUC 2P8TA 2IP2A 3I71A 1TW2A 2MA3A 3L2CA 2FF4A 1CGPA 2EK5A 1LVAA 3I53A 1K78A 2ZNYA 1BI1A 1EH8A 2IPQX 4WCGA 3U2RA 2DTRA 5CJ9A 3KZZA 2PFBA 4RB0A 5DCFA 3I54A 1XSVA 3EUHA 2IRFG 3DXJF 4U0VA 2JTVA 4QLCU 3E5UA 1J2XA 1R36A 4KUMA 1I27A 4ESFA 4A6DA 1T2KA 3HRTA 3VFZA 1JGSA 2RVCA 1ZREA 3MQ0A 1R23A 3ZMZA 3MFKA 4EJOA 1U5TA 3HIFA 4KT5C 2EWNA 3HHGA 2VC1A 3I4PA 3KLOA 2Z5UA 2ZNZA 2O61A 1TBXA 1ZLJA 2LF8A 1Z1DA 5CYVA 2CWEA 1B9MA 2OD5A 2PEXA 4GYGA 3GZ6A 4F7ZA 2DW4A 1O3QA 1KYWA 1T0FA 4S04A 3E6MA 4MGRA 3EYIA 5DYMA 1TNSA 3M9AA 2WV0A 2LSOA 1BN5A 2KIUA 4Y17A 1KU9A 2QUFA 2GWRA 2DO7A 4DQ2A 1XCVA 4M9SA 4L0YB 1SFXA 3IWZA 2GA2A 3I64A 3SFZA 4OIPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD4 A;  4EJV A;  3ZMU A;  4JBA A;  2XIG A;  4EVI A;  4HF2 A;  3I0T A;  1IN8 A;  4GCV A;  3QP5 A;  3NRV A;  3QAH A;  2OZU A;  2IW5 A;  1XMA A;  1P4A A;  2WWY A;  4G7H F;  3F8F A;  1IUY A;  2XRN A;  1PDN C;  5F64 A;  1UFM A;  4YFK F;  2Q0O A;  2OA4 A;  3GFJ A;  2VON A;  1LDK B;  1IN7 A;  5D8L B;  2HGC A;  2BBY A;  3LA7 A;  2P6T A;  4LLL A;  1IXC A;  4M6Y A;  2RKH A;  2IA1 A;  5E1X A;  2K7L A;  3DEU A;  4YFN F;  4GGG A;  3RYP A;  5LRR A;  1EH7 A;  4P5O A;  1NHA A;  4MTE A;  1TQP A;  2Y48 A;  1KQ8 A;  5D5W B;  1ULY A;  2PQ8 A;  5D6E A;  5AIP A;  2IT0 A;  2NRA C;  4U7B A;  2K4B A;  3BJA A;  3IKV A;  3BWG A;  2B0L A;  1LEA A;  3J80 Z;  2GZW A;  1B4A A;  1PP7 U;  2PG4 A;  4GO1 A;  2XVC A;  3K9T A;  4BHB A;  4CO8 A;  2Y0M A;  5K5R A;  4L9J A;  3ERE D;  1U2W A;  2AS5 F;  3FZV A;  4P96 A;  2ESH A;  2P5K A;  2FBI A;  4P9U A;  4CGZ A;  2L3D A;  1YS6 A;  1E2X A;  1T6S A;  3NQO A;  2NYX A;  2PBI A;  3WTZ A;  2HKX A;  1ONV A;  2GXG A;  2K02 A;  1S7A A;  2DBB A;  2LNB A;  3WE3 A;  1R00 A;  2V1X A;  4M6X A;  1X3U A;  1WQ2 A;  4Q48 A;  2PMH A;  1W7P A;  3TDZ C;  3HOT A;  4HA8 A;  3ABT A;  4KIF A;  4MNU A;  2FNA A;  3SQN A;  2VBZ A;  1E17 A;  4IF4 A;  1U78 A;  4A5M A;  1QNT A;  4ZH4 F;  3P9K A;  4BQA A;  2H6C A;  4UNO A;  2CQK A;  1S29 A;  3FF5 A;  2CW0 F;  3KP6 A;  1H0M A;  3JAM K;  5KVR A;  3P7N A;  3GF2 A;  4WXD A;  4HOB A;  3GW2 A;  1FYL A;  3GEZ A;  3FHZ A;  1IRG A;  4ENM A;  4ZYE A;  1BIB A;  2RV8 A;  3BZ6 A;  1KU3 A;  1ZAR A;  1IN4 A;  1ZLK A;  1F5T A;  1FP2 A;  1TNT A;  2ACJ A;  1ON1 A;  4HBL A;  2GIV A;  3V7C A;  4RB1 A;  1ZG1 A;  2VT3 A;  4WXC A;  4WXH A;  5K1Y A;  4KYW A;  2E1N A;  3VOE A;  5L3G A;  4YFX F;  1U5T C;  5CLS A;  1KU2 A;  1XGN A;  3RKX A;  5CVR A;  1O7L A;  1XGM A;  2M1B A;  4RGS A;  5HOO A;  2HZT A;  2DT5 A;  3CTA A;  2YPR A;  3LAJ A;  2P6S A;  1KQ0 A;  3WTS C;  3W6K B;  4YII A;  5KK1 A;  1BM9 A;  1I1G A;  4LG0 B;  4KIB A;  3COA C;  1HW2 A;  2BGC A;  4HZF A;  2QLZ A;  2VN2 A;  3CDH A;  1L0O C;  3HSF A;  3QOP A;  3ULQ B;  2DI3 A;  4ESB A;  3GO5 A;  1WWX A;  3DF8 A;  4KDP A;  2HQR A;  2QQA A;  4ZYH A;  3HYI A;  1OKR A;  1YLF A;  3M8E A;  2KIM A;  3FX3 A;  2XRO A;  4WX9 A;  1XDU A;  4ON0 A;  3J81 Z;  5BQT A;  2XAJ A;  3KLN A;  5E8G A;  1I6X A;  1C0W A;  2JRT A;  2EV6 A;  1SMY F;  3HOS A;  3BJO A;  5E18 F;  1STZ A;  1WKM A;  5DD4 A;  2OBP A;  2E1C A;  3HHH A;  3DFG A;  2EFN A;  1D8J A;  3ELK A;  4P9F A;  1SFE A;  3QPH A;  2XV4 S;  2OAZ A;  3WGG A;  3WTV C;  2PMU A;  3IC7 A;  1USS A;  2IVM A;  2LDU A;  1SD6 A;  3LWF A;  5ED4 A;  4O6J A;  1UHW A;  1Q1H A;  1O3T A;  5HS8 A;  1MDM B;  5H20 A;  1IRF A;  1HKQ A;  4AIH A;  5JI6 A;  4FX0 A;  1KGS A;  3TKY A;  2XAG A;  2HOE A;  5DCM A;  4LD5 A;  2YSR A;  4KIC A;  4P55 A;  1OYW A;  2H6B A;  3IHU A;  2F5E A;  4L5I A;  2D45 A;  1HW5 A;  3KCC A;  2DK5 A;  3N4M A;  1S8N A;  4YIF A;  1TQM A;  3EET A;  1G4D A;  4JQF A;  4XSZ F;  2RGV A;  3HTU A;  5LHI A;  4Q5S F;  1EV7 A;  3ECH A;  2Z33 A;  3BPX A;  1J9I A;  4ZYG A;  2ZCW A;  4OOI A;  3MZH A;  2HFH A;  2EV0 A;  5E17 F;  4XRF A;  1MGT A;  2A6H F;  1XD7 A;  1BBY A;  5JVT A;  1G3Y A;  1KU7 A;  1FZP B;  3GFI A;  2XAF A;  5FB2 A;  3TOA A;  5A2Q Z;  3ISP A;  3MCZ A;  2F5F A;  4LG0 A;  3D0S A;  3GVA A;  3WU0 A;  5ICC A;  1FBQ A;  3RPU A;  3ZMV A;  5DUK A;  2BEO A;  4MTD A;  3QP6 A;  1HXD A;  3CO6 C;  1PUE E;  3ZMD A;  5HVQ C;  1H9T A;  3K0L A;  5JR3 A;  5L3F A;  3SXY A;  3U1D A;  3Q9S A;  2O8X A;  1GXQ A;  2DQL A;  2F5D A;  3FWE A;  4HQM A;  4ASN A;  2O6G E;  4IVN A;  3FXU A;  4MQ9 F;  5D6F A;  2QBY A;  1ZGA A;  4IRH A;  2VE9 A;  4HDV A;  1FBU A;  4RB3 C;  4HAM A;  1MZB A;  5FLX Z;  5FD5 A;  4L9V A;  3F22 A;  2FE3 A;  3DPT A;  2VOO A;  2KJB A;  5H6R A;  2Z9O A;  4IHT A;  5K5Q A;  2M45 A;  4KNY A;  5H6Q A;  3KP3 A;  1MDM A;  2PI0 A;  3GFL A;  3W6J B;  4PGG A;  3BRO A;  4Y13 A;  3RPQ A;  1OR7 A;  4G8X A;  5FGM A;  2MBF A;  4R1H A;  4PGH A;  5HS7 A;  1W7P B;  3DQV C;  3MZY A;  2D1H A;  4M73 A;  5LGU A;  5FFX A;  4MQV A;  5IT9 Z;  4PCQ A;  1LDJ A;  2DFI A;  5ILV A;  3B02 A;  4LB5 A;  3GX4 X;  4U0Y A;  4OMZ A;  3IRQ A;  5L3E A;  1RUO A;  2ETH A;  2VE8 A;  2WTE A;  1ON2 A;  3SZP A;  5EEH A;  2IA2 A;  3JTH A;  1FYM A;  5TRD A;  2YR2 A;  2QVO A;  1YS7 A;  3SHF A;  3RTR A;  1MJB A;  4L18 B;  4HX4 A;  3F8B A;  2D1V A;  4NB5 A;  1IN5 A;  2K86 A;  1J59 A;  1FP1 D;  3WTY C;  2ZBK A;  1YIO A;  4O5V A;  4TV7 A;  2DLL A;  3LST A;  3LA3 A;  4HLY A;  1FSE A;  4A0Z A;  1RZ4 A;  4G6Q A;  3VB2 A;  2KIF A;  3V7R A;  1FC3 A;  1MJA A;  4IRG A;  4UV8 A;  2DPU A;  2QZ8 A;  2MC3 A;  3BP8 A;  3HTS B;  2C6Y A;  2RDP A;  2DPD A;  2NNY A;  3GXO A;  5BMZ A;  4LB6 B;  3BPV A;  3P9I A;  3OOP A;  4OIR F;  5HDN A;  4AIK A;  4KMF A;  3WGH A;  1U8R A;  1QZZ A;  3E97 A;  1TQI A;  1A04 A;  3F8C A;  1BC8 C;  5F6F A;  3ABU A;  1WSU A;  3J80 K;  5EEG A;  1O7F A;  3Q9V A;  3WOD F;  5LHG A;  3D5L A;  2BV6 A;  1MKM A;  5E20 A;  1LB2 A;  3Q5F A;  4Q4Z F;  1BI3 A;  2H27 A;  4G6D A;  2NNN A;  5LGN A;  5HDK A;  5HLG A;  1XSD A;  1DDN A;  4A6E A;  1B1B A;  2L01 A;  4CHU A;  3E5X A;  2DAO A;  2ZXJ A;  1YO5 C;  4BHP A;  2Q2E A;  4XLN F;  5JFR A;  4FX4 A;  4LJZ F;  2HQN A;  3RKY A;  1LQ1 A;  3F72 A;  2R7D A;  2M5W A;  2GXB A;  4EGZ A;  2FEZ A;  4LK0 F;  1MD0 A;  4BAY A;  5CVJ A;  4GYI A;  4I09 A;  2Y75 A;  3JTG A;  2QYO A;  5DCM B;  3LFK A;  3PFI A;  3T1B A;  5D5V B;  1XCB A;  4BHC A;  3NEU A;  2UXX A;  2UXN A;  4I0B A;  2ISY A;  5LEJ A;  3KP5 A;  5FD6 A;  2MLK A;  2PN6 A;  2P5L C;  4CIC A;  3ZMT A;  3EYY A;  4I98 B;  3IL2 A;  1DUX C;  3WGI A;  5FO5 A;  1HKT A;  2M87 A;  3MWM A;  3M8F A;  2E7X A;  2P5V A;  2OQR A;  2ZJ2 A;  3GWZ A;  2VT2 A;  1K6O A;  3KP2 A;  2ESN A;  2FMY A;  3TQN A;  5FFZ A;  2X0L A;  2FQ3 A;  5K5O A;  4NHJ A;  1XGO A;  1HKS A;  3DKW A;  3F23 A;  3CO7 C;  3RYR A;  3FXR A;  2FSW A;  2W84 A;  3FM3 A;  2FML A;  1ODD A;  4RGU A;  4I2O A;  4CDG A;  1F9N A;  3M7G A;  1YG2 A;  5DD8 A;  4RAZ A;  5HDG A;  1R58 A;  2EA2 A;  2CSO A;  4A2U A;  2J5O A;  5E8I A;  2EV5 A;  2EFO A;  3KP7 A;  3G3Z A;  3ZN1 A;  4LGW A;  4YG2 F;  2FOK A;  1K7A A;  1AOY A;  1ZHF A;  2KRF A;  4IXA A;  3J81 K;  1R1U A;  4UUV A;  3H92 A;  4MEY F;  1I5Z A;  4AIJ A;  1GHC A;  1HSJ A;  2ZME B;  3ML6 A;  3JSP A;  1K79 A;  2L02 A;  1YW7 A;  4KN4 X;  2CGP A;  4EJT A;  3V8L A;  1JHH A;  2P7V B;  2QBY B;  3R4K A;  2DK8 A;  4NQW A;  2FBK A;  3L9F A;  4CYD A;  4KIG A;  3T0Y A;  2NS0 A;  1ZGJ A;  6PAX A;  4Q47 A;  2F5C A;  3I59 B;  5ICE A;  2E7W A;  4ENK A;  4KN7 X;  2LKP A;  4RAY A;  4AD9 A;  1RNL A;  2A07 F;  3R0J A;  3CJN A;  1BI2 A;  3VOD A;  1REP C;  1IF1 A;  5E1Z B;  5ICF A;  4CXF A;  3TOB A;  2Q8K A;  4HF1 A;  3CUQ A;  1R5H A;  2V79 A;  1Z6T A;  1FX7 A;  4M71 A;  4G9Y A;  4D0P A;  4AWX B;  1RUN A;  1P92 A;  3LQR A;  1J7K A;  3KZY A;  1ZYR F;  4N0B A;  1Z05 A;  3WTW C;  2HKO A;  4IJA A;  4KFC A;  3K1N A;  3FMR A;  1P6R A;  4O3M A;  4RS8 A;  4ENN A;  5J8F A;  1GVJ A;  3V4G A;  3MEX A;  1FPQ A;  1W4M A;  4KMU X;  3U9G A;  2O0Y A;  3HRU A;  5A2Q K;  3O3K A;  4ETS A;  3F8N A;  1B9N A;  2XAS A;  1FYK A;  3REO A;  4PZJ A;  4I7H A;  1JHF A;  2JZY A;  5D8K B;  3BJ6 A;  4M9X A;  2A61 A;  2FA5 A;  1G3T A;  2MLG A;  1W5S A;  3HUG A;  1XMK A;  2EJR A;  3BDD A;  4BXU A;  1YYV A;  4U88 A;  4RGX A;  2MH2 A;  2RQP A;  1IW7 F;  3TGN A;  4EJU A;  4Y15 A;  2G7H A;  3J7A O;  3HSE A;  4XSX F;  2XKO A;  1F4K A;  2CYY A;  5BPI A;  2A6E F;  3CLO A;  3PQJ A;  1G6N A;  2EFP A;  1T39 A;  3FXQ A;  2ZME A;  4L0Z B;  1RI7 A;  3WU1 B;  1YTY A;  5LEK A;  1Z91 A;  4EV0 A;  2PJP A;  2KJC A;  3L00 A;  2A69 F;  3HRS A;  4A5N A;  1R1T A;  1R22 A;  5FLX K;  3HRM A;  3N97 A;  4G7O F;  3GLX A;  1DP7 P;  1SD5 A;  3GUD A;  1DPR A;  1HBX G;  2IA0 A;  1FSH A;  1SD7 A;  2D2W A;  1TLH B;  1FT9 A;  3I59 A;  3QPT A;  3IRR A;  1V3F A;  4IPA A;  3E6C C;  3QU6 A;  4LFU A;  5DV5 A;  2XGX A;  2CG4 A;  2P7C B;  5DDG A;  4L9N A;  3L7W A;  2ADU A;  4HX7 A;  3TO7 A;  4UHT A;  1VTN C;  5ICG A;  3QU3 A;  1S6L A;  1ZG3 A;  2QQ9 A;  5IT9 K;  2VOP A;  5ILU A;  5LHH A;  2EFW A;  1J0R A;  5D4S A;  3EQL F;  1QGP A;  2QM3 A;  3K69 A;  1W5T A;  3M1E A;  2COM A;  2V9V A;  4L5J A;  1BIA A;  4JK1 X;  4HF0 A;  4K2E A;  2FRH A;  2KKO A;  5HS9 A;  1GXP A;  5ILS A;  5D4R A;  1ZRC A;  3WE2 A;  1LJ9 A;  3RIR A;  2VBW A;  4EM1 A;  3RKW A;  4XLP F;  3DP7 A;  1QO0 D;  3BY6 A;  2H09 A;  3FM5 A;  3T5X A;  5LRS A;  2RN7 A;  4EMS A;  4XBF A;  2W24 A;  3LQQ A;  1SAX A;  1FLI A;  3H3U A;  2YU3 A;  2TDX A;  1PP8 F;  4HW0 A;  5LBQ A;  3IKT A;  1SMT A;  5F1R A;  4EJW A;  4H0E A;  1WRJ A;  4BYY A;  5HLH A;  3V7S A;  5D5U B;  2HR3 A;  4Z2Y A;  2CFX A;  1O57 A;  3V8J A;  4PDK A;  2MD5 A;  4UVB A;  1J5Y A;  2PLY A;  3KFW X;  4MHG A;  2O3F A;  1P2F A;  2WC2 A;  1IXR C;  3CUQ C;  3S2W A;  4EM2 A;  1JE8 A;  1J75 A;  4ZZD A;  5L3D A;  2STW A;  3I5U A;  3V8K A;  2HS5 A;  3C3W A;  2VC0 A;  1V4R A;  3DV8 A;  1QQI A;  2L4M A;  3R60 A;  1B6A A;  2VBX A;  4GXO A;  3G73 A;  2HWV A;  5L3B A;  4A0Y A;  4HX8 A;  3T8R A;  2XUB A;  3R61 A;  4I0A A;  2HEO A;  2F2E A;  4UV9 A;  4A0X A;  3C7J A;  2XAQ A;  4WK8 F;  2XAH A;  2EFQ A;  1L3L A;  3E3V A;  2L4A A;  4G94 A;  2ZO4 A;  1IZ1 A;  1YW8 A;  5DEQ A;  3WG9 A;  4AVP A;  1FOK A;  2L54 A;  2RC4 A;  3I58 A;  3F6V A;  2HDC A;  3JSO A;  3LAP A;  3IWF A;  4B09 A;  5HLI A;  3KET A;  1ZH5 A;  3ECO A;  3F6O A;  4M72 A;  3BOQ A;  1HQC A;  2JT1 A;  1UST A;  2W85 A;  2H94 A;  4G7Z F;  2JPC A;  4N9H A;  3O2P E;  3E6B A;  5BS6 A;  4KA4 A;  1ZG5 A;  1Z9C A;  2V1D A;  3ZN0 A;  4BH9 A;  2A5Y B;  1U6G A;  2MH9 A;  5LGT A;  2EA4 A;  3WTT C;  4RGR A;  1XDS A;  4HV5 A;  4QWQ A;  1O3R A;  1BC7 C;  3R0A A;  1R5G A;  1FBS A;  2XHK A;  2G7U A;  1EH6 A;  2NAZ A;  1CF7 B;  4OIO F;  1XB4 A;  3KEO A;  3ZPL A;  2AXL A;  4R79 A;  2GQQ A;  1OPC A;  4MEX F;  2M30 A;  3CUQ B;  1ZRD A;  4R8H A;  1RIO H;  5L3C A;  4EM0 B;  4WF2 A;  5CVU A;  5CVI A;  4ESJ A;  2HYG D;  1YW9 A;  4OIQ F;  5J8C A;  4A12 A;  2V1U A;  2R7F A;  3GZ5 A;  5J6X A;  2Z3Y A;  1UB9 A;  4I01 A;  2FNP A;  2OU2 A;  2JSC A;  2CO5 A;  1OYI A;  5CVV A;  1G3S A;  2ZFW A;  1B59 A;  1IXS B;  3F21 A;  2FBH A;  2W25 A;  2OZ6 A;  3FMS A;  3CUO A;  2LF7 A;  3JAM Z;  1MJ9 A;  4U0W A;  1P4W A;  1P4X A;  4EGY A;  2FXA A;  2M8E A;  4M9Z A;  4BNC A;  1UCR A;  1XGS A;  4IHS A;  1H9G A;  2O03 A;  2UWM A;  4LK1 F;  1FY7 A;  2ZKZ A;  3K1M A;  5IT3 A;  3KE2 A;  2HTS A;  4UVA A;  2FU4 A;  4B8X A;  2HTJ A;  1W7P D;  3ZP5 A;  1UHM A;  3T8T A;  1BOA A;  4HV6 A;  3AAF A;  3H3Z A;  5AIQ A;  3MAJ A;  2VOD A;  3C1D A;  1YFH A;  3SZT A;  3GYH X;  1LEB A;  1DPU A;  3K1P A;  3K2Z A;  1O3S A;  1R1V A;  1TW3 A;  5BOX A;  4ZZL A;  4LLN A;  1KA8 A;  3E6D A;  5D5X B;  3F8M A;  3TDU C;  4HLX A;  5TJJ A;  4I02 A;  4HYE A;  2VXZ A;  2YX4 A;  1QBJ A;  1FWZ A;  1Y0U A;  4CZZ A;  1K78 B;  2YX7 A;  1FNN A;  4IRI A;  4N9I A;  2R3S A;  3F3X A;  4UVC A;  1LDD A;  2K4J A;  1XN7 A;  1R7J A;  3RDI A;  2BE5 F;  1OYY A;  1CF7 A;  2HYF A;  3EDP A;  2RNJ A;  4WWC A;  4HDU A;  4LMY A;  4E70 A;  3KP4 A;  2ISZ A;  1XSX A;  1T38 A;  1S3J A;  1JXS A;  4M74 A;  3FMQ A;  5AON A;  1U3E M;  2GAU A;  1U5T B;  3GFM A;  3ZQ7 A;  3LA2 A;  2GA1 A;  2QWW A;  3TO9 A;  1QPM A;  1I1S A;  3P9C A;  1TTY A;  2V6C A;  2EB7 A;  1IAW A;  3JW4 A;  1BI0 A;  4L9T A;  2G9W A;  3HSR A;  2QEN A;  3L09 A;  5ERI A;  3R6S A;  1AWC A;  1KQ9 A;  1HW1 A;  4LLG F;  4S05 A;  2DU9 A;  1QZY A;  4U7D A;  3KEQ A;  5DUI A;  3PQK A;  1OMI A;  2IJL A;  4UXN A;  2XKP A;  3ROU A;  3DPL C;  3TO6 A;  1ZN2 A;  2Z99 A;  5BPD A;  4EQQ A;  4ENJ A;  3C18 A;  1WI9 A;  3OV8 A;  3WTX C;  2QQB A;  1IN6 A;  2P4W A;  3VEP A;  2JPB A;  2A3S A;  4OU0 A;  5LLQ A;  1LNW A;  3RI4 A;  1KYZ A;  2A68 F;  1T98 A;  1Z6R A;  3O6B B;  2VBY A;  2DQR A;  3QRF F;  4ZYD A;  1Z7U A;  3E5Q A;  2J5P A;  1S7O A;  1YQA A;  2BYV E;  1ZAO A;  2UZK A;  4OIN F;  2K27 A;  2W57 A;  4HQE A;  2OQG A;  1G3W A;  1D8K A;  5JHU A;  4RB2 C;  2X4H A;  1F1Z A;  1D3Y A;  3ZMS A;  1ZRF A;  1SFU A;  5E1W A;  4FT8 A;  4OMY A;  4DNC A;  4FHT A;  3B73 A;  2STT A;  2ELH A;  1BJA A;  1D5V A;  3RJP A;  1HST A;  3WTU C;  2P8T A;  2IP2 A;  3I71 A;  1TW2 A;  2MA3 A;  3L2C A;  2FF4 A;  1CGP A;  2EK5 A;  1LVA A;  3I53 A;  1K78 A;  2ZNY A;  1BI1 A;  1EH8 A;  2IPQ X;  4WCG A;  3U2R A;  2DTR A;  5CJ9 A;  3KZZ A;  2PFB A;  4RB0 A;  5DCF A;  3I54 A;  1XSV A;  3EUH A;  2IRF G;  3DXJ F;  4U0V A;  2JTV A;  4QLC U;  3E5U A;  1J2X A;  1R36 A;  4KUM A;  1I27 A;  4ESF A;  4A6D A;  1T2K A;  3HRT A;  3VFZ A;  1JGS A;  2RVC A;  1ZRE A;  3MQ0 A;  1R23 A;  3ZMZ A;  3MFK A;  4EJO A;  1U5T A;  3HIF A;  4KT5 C;  2EWN A;  3HHG A;  2VC1 A;  3I4P A;  3KLO A;  2Z5U A;  2ZNZ A;  2O61 A;  1TBX A;  1ZLJ A;  2LF8 A;  1Z1D A;  5CYV A;  2CWE A;  1B9M A;  2OD5 A;  2PEX A;  4GYG A;  3GZ6 A;  4F7Z A;  2DW4 A;  1O3Q A;  1KYW A;  1T0F A;  4S04 A;  3E6M A;  4MGR A;  3EYI A;  5DYM A;  1TNS A;  3M9A A;  2WV0 A;  2LSO A;  1BN5 A;  2KIU A;  4Y17 A;  1KU9 A;  2QUF A;  2GWR A;  2DO7 A;  4DQ2 A;  1XCV A;  4M9S A;  4L0Y B;  1SFX A;  3IWZ A;  2GA2 A;  3I64 A;  3SFZ A;  4OIP F; 
#chains in the Genus database with same CATH topology
 2O9L A;  1SD4 A;  2KRH A;  4EJV A;  3ZMU A;  2DJN A;  4JBA A;  3MKW B;  2CUZ A;  2XIG A;  1X58 A;  4EVI A;  4HF2 A;  1QHG A;  3LNQ A;  1TP4 A;  3I0T A;  1IN8 A;  4IOA F;  1VQO I;  4GCV A;  2NS7 A;  3E1S A;  3HKZ N;  2ZXW H;  3QP5 A;  3G1M A;  1R5I D;  3H35 A;  3NRV A;  5GAD J;  3A1Y A;  2X51 A;  2L9S A;  3QAH A;  2OZU A;  3DWL E;  2IW5 A;  1XMA A;  1P4A A;  3OR2 C;  2WWY A;  1WZ2 A;  1MMN A;  4G7H F;  3F8F A;  3HGY A;  1DP3 A;  4M3G A;  1IUY A;  2XRN A;  2XSJ C;  1V5G A;  5F64 A;  1PDN C;  1UFM A;  4YFK F;  2Q0O A;  5FKL A;  1R4M B;  2OA4 A;  1HC8 A;  3GFJ A;  2VON A;  2TRT A;  1LDK B;  1M1E B;  1IN7 A;  5D8L B;  3MN2 A;  1B8I B;  2HGC A;  4C3H J;  2BBY A;  4UB6 C;  1Z3Y A;  3SYT A;  3LA7 A;  2P6T A;  2B63 J;  2CFO A;  3FIS A;  4LLL A;  1VZ0 A;  3H3V K;  1IXC A;  4M6Y A;  2RKH A;  2IA1 A;  5E1X A;  2LD5 A;  2K7L A;  2W4S A;  1YX3 A;  3DEU A;  2CV0 A;  3CZ6 A;  1KON A;  4YFN F;  4A93 J;  4GGG A;  5IPA A;  3RYP A;  3W2A A;  1U0J A;  5LRR A;  3ZQC A;  1EH7 A;  4P5O A;  4BE1 A;  1NHA A;  4MTE A;  3PNT A;  1TQP A;  2Y48 A;  1KQ8 A;  4PK4 A;  4MFD A;  5D5W B;  1K6Y A;  1ULY A;  2PQ8 A;  4XKV A;  5D6E A;  5AIP A;  3G4S I;  2IT0 A;  2NRA C;  4U7B A;  2HQ5 A;  3NAU A;  2K4B A;  2QQ8 A;  3BJA A;  1YOV B;  3IKV A;  3OYG A;  5HOD A;  1UAA A;  3BWG A;  2LY2 A;  2B0L A;  1LEA A;  5F04 A;  2L7M P;  3OIO A;  1BR4 A;  3QOD A;  3J80 Z;  2GZW A;  1B4A A;  1PP7 U;  1VQ6 I;  2PG4 A;  4GO1 A;  5J1R A;  3ZQF A;  2XVC A;  4YRV A;  2K40 A;  3BR2 A;  3K9T A;  2Y0M A;  4BHB A;  4CO8 A;  1HLV A;  5K5R A;  3M4O J;  4L9J A;  3ERE D;  1U2W A;  3SEQ A;  2AS5 F;  5JHF A;  1YJ9 I;  3FZV A;  4P96 A;  2ESH A;  3OIQ A;  4A3K J;  2P5K A;  2FBI A;  4LIU A;  3U1K A;  4P9U A;  1SAU A;  2ZJP F;  4CGZ A;  3L1P A;  4XRM A;  2L3D A;  4DZJ A;  1YS6 A;  1QVT A;  1E2X A;  1T6S A;  3NQO A;  2NYX A;  2OPT A;  2PBI A;  1VND A;  4E7Z A;  4IHX A;  3WTZ A;  4RBO A;  2HKX A;  1ONV A;  1OCT C;  2GXG A;  2K02 A;  3BG7 A;  3FXJ A;  1S7A A;  4CCK A;  2KRC A;  1ERD A;  3BZC A;  3LSK A;  2DBB A;  2LNB A;  3ONQ A;  3WE3 A;  1R00 A;  2V1X A;  3E0J B;  4D5C A;  2B9S A;  1YIJ I;  5F0C A;  4M6X A;  1X3U A;  3S93 A;  4RDU A;  2R5Y B;  1WQ2 A;  3JRC A;  4BS9 A;  4Q48 A;  2PMH A;  3QOE A;  3HGG A;  2CMP A;  1W7P A;  2EPF A;  2VIX A;  5F0H A;  3TDZ C;  3HOT A;  4BDZ A;  4HA8 A;  4CA0 A;  4IQJ A;  3N05 A;  3ABT A;  5M3F J;  2HU9 A;  4KIF A;  4MNU A;  2FNA A;  3SQN A;  3CDI A;  2VBZ A;  4A3M J;  1E17 A;  1X1D A;  4IF4 A;  3HOW J;  2JA2 A;  1U78 A;  5J3L A;  4FE4 A;  4A5M A;  1QNT A;  4ZH4 F;  2M7A A;  2TCT A;  3P9K A;  2H6C A;  4BQA A;  3AFH A;  4UNO A;  2CQK A;  1S29 A;  1IDY A;  3FF5 A;  2CW0 F;  3KP6 A;  1H0M A;  2CRG A;  5IP9 J;  2WAD A;  3JAM K;  1DU6 A;  3SZG A;  1JJ8 C;  4A3G J;  5KVR A;  3P7N A;  1E3P A;  4XOR A;  3GF2 A;  1WGX A;  4WXD A;  3SDB A;  4HOB A;  3EUH C;  3GW2 A;  1FYL A;  2YUS A;  5TIS C;  5F1J A;  3GEZ A;  3FHZ A;  2ZJQ F;  1IRG A;  1EA3 A;  2BXZ A;  4ZYE A;  4ENM A;  1BIB A;  2RV8 A;  1WHU A;  1X2M A;  5EZG A;  3J7Y J;  4PJN A;  3BZ6 A;  1KU3 A;  2QSG X;  4LOC A;  2VJ4 A;  1ZAR A;  1IN4 A;  3A4C A;  1ZLK A;  1F5T A;  1FP2 A;  1TNT A;  2E2J J;  1IGN A;  2ACJ A;  1MMA A;  1ON1 A;  4HBL A;  2GIV A;  3V7C A;  1ETW A;  2RQQ A;  5EZH A;  4RB1 A;  1ZG1 A;  2VT3 A;  1AKH A;  2X9D A;  3RQI A;  4WXC A;  4WXH A;  1N77 A;  2VXD A;  5K1Y A;  4KYW A;  3CF5 F;  4UB8 C;  2E1N A;  3J7Z I;  3VOE A;  2QA4 I;  3S1R J;  2BXY A;  4XLF A;  4BUP A;  3OYK A;  1OJL A;  5L3G A;  1S9H A;  4YFX F;  4YEJ A;  1ZR2 A;  1ETV A;  1U5T C;  5CLS A;  2HOT A;  1T33 A;  1KU2 A;  1XGN A;  1QHH D;  3PUF A;  2MGQ A;  3RKX A;  4UY8 I;  5E79 C;  3OYE A;  4BDY A;  5CVR A;  4Y7N J;  1O7L A;  1XGM A;  2M1B A;  4RGS A;  5HOO A;  2V26 A;  4HG2 A;  2HZT A;  2DT5 A;  2R7U A;  2W82 A;  3CTA A;  3KX2 A;  2YPR A;  3LAJ A;  2P6S A;  1KQ0 A;  3WTS C;  4W1U A;  1HA8 A;  3ZQI A;  3W6K B;  4YII A;  1RKW A;  3PNV A;  5KK1 A;  4ZTJ A;  1DQU A;  4F92 B;  1PVE A;  3IAM 2;  3QYF A;  5CPR B;  1SVL A;  5JLW A;  1J09 A;  2E1M C;  1BM9 A;  1I1G A;  4GDF A;  4XKC A;  2V4J C;  4LG0 B;  3PUB A;  1T0F C;  4KIB A;  3COA C;  2M0C A;  3CME I;  4C3J J;  1HW2 A;  2BGC A;  1NG7 A;  1G59 A;  3C2G A;  4CH7 A;  4HZF A;  2JA5 J;  5J1Y A;  3CLQ A;  1MBF A;  2QLZ A;  2VN2 A;  2L9V A;  3CDH A;  4NNJ A;  1L0O C;  3HSF A;  3QOP A;  1ETY A;  3ULQ B;  4J01 A;  3OYC A;  2DI3 A;  4ESB A;  3GO5 A;  4RAF A;  1WWX A;  4E6K G;  3DF8 A;  4JP0 A;  4F91 B;  4KDP A;  2HQR A;  4B4C A;  2QQA A;  2VKD A;  4ZYH A;  4ANJ A;  3HYI A;  1OKR A;  1YLF A;  3GME A;  2R7O A;  3M07 A;  1ITY A;  3M8E A;  1YJN I;  2N8G A;  3OYH A;  2KIM A;  3FX3 A;  2VL8 A;  2XRO A;  1OCC H;  4WX9 A;  1XDU A;  4ON0 A;  4DBR A;  3J81 Z;  2KLO A;  5BQT A;  2XAJ A;  3KLN A;  5E8G A;  1I6X A;  2L9R A;  1C0W A;  2JRT A;  3MZ8 A;  4MFE A;  2EV6 A;  1SMY F;  3HOS A;  4DOZ A;  1LVK A;  2EBI A;  2VQC A;  3BJO A;  3ZQH A;  5E18 F;  2MW8 A;  3QQA A;  1ZKG A;  4M3B A;  1STZ A;  4OAZ A;  1WKM A;  5FKM A;  5DD4 A;  2OBP A;  3J7A Y;  2E1C A;  3HHH A;  3DFG A;  1Z77 A;  4PJJ A;  1FOY A;  1WJE A;  5DTD A;  2EFN A;  1D8J A;  3ELK A;  2KIQ A;  2XPW A;  4PUS A;  3FK7 A;  1UG2 A;  4P9F A;  1SFE A;  3QPH A;  3CMM A;  3HG9 A;  2XV4 S;  1E3O C;  3JRD A;  2OAZ A;  3WGG A;  2JVH A;  3OYI A;  1N75 A;  3WTV C;  2PMU A;  2GM4 A;  1FJL A;  3IC7 A;  4B48 A;  1F43 A;  1IO2 A;  1USS A;  2IVM A;  2LDU A;  2VB6 A;  3LSI A;  1SD6 A;  3LWF A;  4OAY A;  4DYC A;  5ED4 A;  4O6J A;  4B47 A;  1UHW A;  1Q1H A;  1Z67 A;  2K3P A;  3OYM A;  4XOP A;  4HNT A;  3MKY B;  2AQF A;  1O3T A;  5HS8 A;  1MDM B;  5H20 A;  5TGT A;  3BG6 A;  1IRF A;  3W3C A;  2GOX B;  3MMY B;  1HKQ A;  4AIH A;  2WY8 Q;  5JI6 A;  4EAT A;  4FX0 A;  1KGS A;  2CQX A;  3TKY A;  2XAG A;  2HOE A;  4DBQ A;  3K70 D;  1NK3 P;  2XRL A;  4UUS B;  3HEF A;  5DCM A;  3H5R A;  2EQR A;  3BLY A;  4LD5 A;  4PSW A;  1VQ4 I;  3OYF A;  2YSR A;  4QIW N;  3S32 A;  1VQ8 I;  5DM7 F;  4KIC A;  2K9S A;  1ORK A;  2VKH A;  3CCM I;  3HPH A;  1A6I A;  2NVT J;  4IHW A;  3VYT B;  2OTL I;  3H0G J;  4P55 A;  1OYW A;  2H6B A;  3IHU A;  2R7Z J;  1VQP I;  4IO9 F;  2F5E A;  4XKB A;  4L5I A;  4BJ6 C;  3A01 B;  3W2W A;  2D45 A;  1HW5 A;  5IYD J;  3KCC A;  2E1M B;  2W7N A;  4ZTF A;  4CSW A;  2DK5 A;  3N4M A;  3CCR I;  2WV1 A;  1S8N A;  4YIF A;  1TQM A;  1TWH J;  3EET A;  2E1O A;  2DA6 A;  2DA4 A;  1G4D A;  2LLK A;  1XC5 A;  4JQF A;  4XSZ F;  2RGV A;  3HTU A;  5LHI A;  4Q5S F;  1EV7 A;  3ECH A;  2ID6 A;  2Z33 A;  3TP3 A;  2OUM A;  3BPX A;  4DYQ A;  1A6Q A;  1J9I A;  2EIM H;  2DYS H;  5B1B H;  4XLC A;  4ZYG A;  3K10 A;  3B6A A;  4ABZ A;  2ZCW A;  4OOI A;  3MZH A;  2HFH A;  1MBK A;  1TL8 A;  2EV0 A;  5E17 F;  4XRF A;  1MGT A;  2A6H F;  1XD7 A;  1DGW Y;  1BBY A;  5JVT A;  1TC3 C;  5E3M A;  2JA7 J;  1G3Y A;  2I8D A;  2LC2 A;  1XMX A;  2IGM A;  2L7Z A;  3QWL A;  2BY2 A;  1KU7 A;  1Q1V A;  1FZP B;  3GFI A;  2XGC A;  2XAF A;  4NBQ A;  1EKE A;  2K9M A;  4F52 A;  5FB2 A;  3TOA A;  5A2Q Z;  3ZRG A;  5EDN A;  3ISP A;  3MCZ A;  1X1B A;  4Y52 J;  3D1N I;  1WI3 A;  2R7S A;  2DOF A;  2DFH A;  2CQQ A;  4XOT A;  2AHQ A;  2F5F A;  3LL7 A;  1WFX A;  3CCQ I;  3EPZ A;  4M3F A;  3CC2 I;  4LG0 A;  3VYS B;  2VJ5 A;  3D0S A;  4D7N A;  5IYC J;  3GVA A;  3WU0 A;  3FXM A;  5ICC A;  1FBQ A;  4N4N B;  3RPU A;  3ZMV A;  1LE8 A;  5DUK A;  2M34 A;  2BEO A;  4MTD A;  3QP6 A;  1HXD A;  3CO6 C;  2X6X A;  1PUE E;  4PJL A;  1ETO A;  3ZMD A;  1T8I A;  5F0F A;  3VYU B;  4XLH A;  4XLE A;  4ITV A;  4B3A A;  5HVQ C;  1H9T A;  1MNE A;  3K0L A;  2NS8 A;  5EJC A;  5JR3 A;  5L3F A;  3SXY A;  3U1D A;  3Q9S A;  1P9Q C;  2O8X A;  1GXQ A;  2DQL A;  1GV2 A;  3ZXS A;  2F5D A;  3FWE A;  2VJJ A;  4HQM A;  4ASN A;  3ZQQ A;  2O6G E;  3NWS A;  4HNV A;  4IVN A;  3FXU A;  2FX0 A;  2DCE A;  3TP0 A;  4CUG A;  2GIZ A;  2E2I J;  4MQ9 F;  5D6F A;  2QBY A;  1ZGA A;  2WAQ A;  1X2N A;  3OIP A;  1R9T J;  1JGG A;  2MC4 A;  4IRH A;  3KEY A;  4C2T A;  2IXS A;  2VE9 A;  4HDV A;  2LOO A;  1FBU A;  3C2B A;  4RB3 C;  4HAM A;  1MZB A;  5FLX Z;  3Q0W A;  4GRI A;  5FD5 A;  3FBI B;  4V2F A;  1SFO J;  4L9V A;  3F22 A;  2FE3 A;  5EG0 A;  3DPT A;  2VOO A;  2KJB A;  1W0T A;  5H6R A;  2Z9O A;  4IHT A;  5K5Q A;  3GTK J;  2M45 A;  4KNY A;  2ZXH A;  5H6Q A;  3KP3 A;  1MDM A;  2QKM B;  2X6W A;  2DT6 A;  3CES A;  4G6T B;  4B3X A;  4FAS D;  4NDL A;  2PI0 A;  3GFL A;  3W6J B;  3H0D A;  2R4G A;  1Z7L A;  4PGG A;  3BRO A;  4Y13 A;  4PJM A;  2IS4 A;  3RPQ A;  1OR7 A;  4G8X A;  2DJI A;  3OMY A;  5FGM A;  2MBF A;  2D5V A;  4R1H A;  1X1A A;  3RZO J;  4PGH A;  3I4M J;  5HS7 A;  1W7P B;  2Y0S A;  4DGW B;  3OSG A;  3DQV C;  3MZY A;  2BY1 A;  2D1H A;  4M73 A;  5LGU A;  5FFX A;  3A02 A;  3X2Q H;  4MQV A;  4F55 A;  3SDG A;  4HRI A;  5IT9 Z;  4PCQ A;  3VYR B;  3V42 A;  1ZGW A;  1LDJ A;  3OYN A;  2DFI A;  5CQG A;  5ILV A;  3B02 A;  2E35 A;  4LB5 A;  2HI3 A;  3GX4 X;  1IDZ A;  4U0Y A;  4OMZ A;  3IRQ A;  2XGD A;  1JUS A;  4JX6 A;  5L3E A;  1RUO A;  4J19 A;  2ETH A;  2VE8 A;  2WTE A;  4BE2 A;  5M5X J;  1ON2 A;  1K4S A;  2OC6 A;  2VKV A;  3SZP A;  5EEH A;  2IA2 A;  5E3O A;  1YX5 A;  3JTH A;  2VPR A;  4N4O B;  1FYM A;  1VQ9 I;  3BR3 A;  5TRD A;  2YR2 A;  2FUG 2;  2WBM A;  5J4V A;  2LRE A;  2QVO A;  1YS7 A;  1Y0N A;  2DA1 A;  3SHF A;  3RTR A;  4IHV A;  1MJB A;  4L18 B;  1WJB A;  2BOL A;  1FIA A;  4HX4 A;  3CCJ I;  3MKZ A;  3F8B A;  2D1V A;  4NB5 A;  1IN5 A;  2K86 A;  1J59 A;  2ELK A;  2O5R A;  1FP1 D;  3Q3S A;  3WTY C;  2ZBK A;  4BY7 J;  1AKH B;  5LD2 C;  1VQ5 I;  2O7O A;  2UV1 A;  1YIO A;  2LFB A;  1U8B A;  4P1W A;  4O5V A;  4BL0 B;  4TV7 A;  2DLL A;  3LST A;  3LA3 A;  4HLY A;  2DA7 A;  2ZSI B;  1FSE A;  2X1E A;  4A0Z A;  1RZ4 A;  5GAH J;  4G6Q A;  3QYB A;  3TL4 X;  3VB2 A;  2KIF A;  3V7R A;  3GTM J;  1FC3 A;  3BTL A;  1MJA A;  4A3D J;  3BCA A;  2FOW A;  4D1Q A;  4IRG A;  1BA5 A;  5GAG J;  4UV8 A;  2R7R A;  1W5C C;  2DPU A;  2QZ8 A;  2DFE A;  3HPG A;  2Z1D A;  2IBD A;  2R92 J;  3ERM A;  2MC3 A;  2CS3 A;  3BP8 A;  5KAI C;  2DA2 A;  2IS6 A;  3HTS B;  3DKY A;  3DBL B;  2C6Y A;  2RDP A;  2DPD A;  2Y30 A;  3BR1 A;  2NNY A;  3GXO A;  3RSN A;  3BTI A;  1A36 A;  5BMZ A;  3HOY J;  4A3L J;  1S72 I;  1TZL A;  4E7H A;  2CW7 A;  2VLA A;  4ZC3 A;  9ANT A;  4LB6 B;  3BPV A;  3DPU A;  1F36 A;  3P9I A;  1DU0 A;  3OOP A;  1N78 A;  2JMW A;  4OIR F;  3DKX A;  1Y8Q B;  5HDN A;  2FJ1 A;  4AIK A;  4KMF A;  3WGH A;  1U8R A;  1QZZ A;  1SVO A;  1TQI A;  2W1O A;  1A04 A;  3E97 A;  3F8C A;  1NH3 A;  4ZJZ A;  1BC8 C;  4C9Y A;  2EZI A;  5F6F A;  4V2G A;  3ABU A;  1WSU A;  3J80 K;  4XQF A;  5EEG A;  3S3N A;  1Y6I A;  3KYL A;  2L0K A;  3S8P A;  1JI8 A;  2XF5 A;  2ZC2 A;  2MSY A;  3MD2 A;  1O7F A;  3BR5 A;  4IEJ A;  3BT9 A;  3Q9V A;  3WOD F;  5LHG A;  3OYA A;  3S2H J;  3D5L A;  2A05 A;  2BV6 A;  2OCE A;  1MKM A;  1H88 C;  2L2O A;  3BR6 A;  3FXL A;  5E20 A;  5DS9 A;  3Q5F A;  1LB2 A;  2YS9 A;  4Q4Z F;  1BI3 A;  2H27 A;  4G6D A;  3GTP J;  5GPC A;  3WG7 H;  1QZE A;  2NNN A;  2L7K A;  3BTJ A;  1V55 H;  5LGN A;  5HDK A;  4BE0 A;  5HLG A;  3UNG C;  1XSD A;  1DDN A;  4A6E A;  4I99 C;  1ZK8 A;  3O8G A;  1H89 C;  2PJR B;  1B1B A;  2L01 A;  4CHU A;  1UEL B;  3E5X A;  2HXO A;  2Q1Z B;  2Y31 A;  2JQ7 A;  2DAO A;  1Y39 A;  1GV5 A;  4FE7 A;  2ZXJ A;  1LKX A;  3GBG A;  2HVQ A;  1YO5 C;  2IGK A;  4BHP A;  2NVX J;  2R7W A;  5DM6 F;  2Q2E A;  3CCU I;  3QPL A;  4XLN F;  5JFR A;  4FX4 A;  2KP6 A;  4LIV A;  4LJZ F;  2HQN A;  2CQN A;  4B1R A;  2ME0 A;  3DLA A;  1GVD A;  2LMD A;  3RKY A;  4DIQ A;  2DA5 A;  3IV5 A;  3AG3 H;  3HOX J;  4X1E A;  2HVR A;  1LQ1 A;  4RLF A;  3F72 A;  3RCO A;  2R7D A;  3GTQ J;  2M5W A;  2GXB A;  4EGZ A;  1XX5 A;  2FEZ A;  1YHQ I;  4LK0 F;  1MD0 A;  2R7V A;  4BAY A;  5CVJ A;  4GYI A;  4I09 A;  2JRM A;  4XIC A;  2Y75 A;  3U21 A;  3JTG A;  5M5W J;  2QYO A;  3ESW B;  4OWR B;  1W36 D;  5DCM B;  3LFK A;  3RQ4 A;  3DEE A;  1RR8 C;  3PFI A;  3PIP F;  2WAQ N;  3T1B A;  5D5V B;  2EIK H;  2BVM A;  2KFD A;  1XCB A;  5GTH C;  3FIW A;  4BHC A;  3NEU A;  2UXX A;  3CMA I;  2UXN A;  2OTJ I;  1MSF C;  4FTH A;  4I0B A;  2ISY A;  5LEJ A;  3KP5 A;  5FD6 A;  1GT0 C;  1NG6 A;  2MLK A;  4E7I A;  3G6E I;  2PN6 A;  2P5L C;  2EZH A;  4CIC A;  1IUF A;  3ZMT A;  3EYY A;  4C2M J;  4I98 B;  1ETX A;  3IL2 A;  1DUX C;  2BVL A;  3WGI A;  4I76 A;  1JKQ C;  2E36 A;  5C4J J;  3UR3 C;  5FO5 A;  3ZCO A;  1HKT A;  1P7J A;  2IGO A;  2M87 A;  1SAN A;  3MWM A;  3M8F A;  2E7X A;  2ECC A;  4L5E A;  1IRZ A;  2P5V A;  2OQR A;  2ZJ2 A;  3BZK A;  3GWZ A;  3K4N A;  2MG4 A;  2COB A;  2VT2 A;  4J00 A;  1K6O A;  3HDD A;  3TW7 A;  2Y0S N;  3OL3 A;  3KP2 A;  2QEX I;  1OR7 C;  2ESN A;  2FMY A;  3TQN A;  5FFZ A;  5IY5 H;  2CUJ A;  2X0L A;  3FKJ A;  1QVU A;  2FQ3 A;  3GTO J;  5K5O A;  1FMW A;  4NHJ A;  1XGO A;  1HKS A;  2F4M B;  3DKW A;  3D5S C;  3OS2 A;  1YJW I;  3IUO A;  3F23 A;  3AG2 H;  3CO7 C;  1YIT I;  2NVQ J;  3RYR A;  1D5Y A;  2K9Q A;  3CD6 I;  1U9N A;  3FXR A;  1ENH A;  2V9K A;  3K4B A;  2H8R A;  3S17 J;  3AG4 H;  2FSW A;  2X1D A;  2W84 A;  2K3F A;  3FM3 A;  4ZYA A;  1A5J A;  2FML A;  1ODD A;  1SC7 A;  4RGU A;  1PJR A;  1X3Z B;  4I2O A;  4CDG A;  1F9N A;  3M7G A;  1YG2 A;  5IYB J;  4AYB A;  5DD8 A;  4RAZ A;  5HDG A;  1R58 A;  2F4I A;  2IS1 A;  2EA2 A;  2CSO A;  4A2U A;  2J5O A;  5E8I A;  3S1M J;  3LSJ A;  2EV5 A;  2EFO A;  4HEA 2;  2KIS A;  3ASO H;  3KP7 A;  1LE8 B;  3G3Z A;  3ZN1 A;  4OIP F;  4LGW A;  4YG2 F;  3S15 J;  2FOK A;  1UZC A;  3GTJ J;  1K7A A;  2UUZ A;  1AOY A;  1ZHF A;  2CUF A;  2XSD C;  2ZXI A;  1Y1V J;  2KRF A;  4IXA A;  4LG3 A;  5IOY A;  1Y1W J;  1FOX A;  4BEH A;  3DBR B;  3J81 K;  5IP6 A;  1R1U A;  4UUV A;  1LFB A;  2EIL H;  2ZSH B;  3H92 A;  4QSH A;  3H5N A;  4MEY F;  2ELJ A;  1I5Z A;  3PL8 A;  5CQE A;  4AIJ A;  1GHC A;  1AA7 A;  1K61 A;  1HSJ A;  4BJT A;  2ZME B;  3ML6 A;  2VJI A;  3JSP A;  3S2D J;  2CV1 A;  1LUJ B;  1K79 A;  2L02 A;  1YW7 A;  4D7M A;  3OSF A;  4KN4 X;  1TT0 A;  1OCO H;  2K85 A;  3OYL A;  3OR1 C;  2CGP A;  4EJT A;  1RES A;  3DTK A;  3V8L A;  3KPH A;  5M3M J;  1JT6 A;  3PSF A;  1JHH A;  2P7V B;  4A3C J;  3CC7 I;  2VKE A;  4A3I J;  5K7F A;  2QBY B;  4B43 A;  2PJR A;  2M8G X;  3R4K A;  4AC0 A;  3DEW A;  4NC6 A;  2DK8 A;  4NQW A;  2FBK A;  1HDP A;  3L9F A;  4CYD A;  4KIG A;  1I39 A;  3MKL A;  3T0Y A;  4B44 A;  3CCY A;  4XM3 A;  2NS0 A;  4E7J A;  1ZGJ A;  6PAX A;  2LG4 A;  2AQE A;  4Q47 A;  2F5C A;  4W97 A;  3I59 B;  1WJC A;  5ICE A;  5FJ8 J;  2KQR A;  5EG0 B;  4JOM A;  2F6C A;  1IRX A;  2CW8 A;  2E7W A;  3CJT B;  2XF7 A;  4ENK A;  4KN7 X;  5FLV A;  4Y3O A;  2LKP A;  4XNF A;  3OS1 A;  4RAY A;  4AD9 A;  3G1L A;  1RNL A;  2GXA A;  2A07 F;  3R0J A;  3CJN A;  5FRM A;  1BI2 A;  3VOD A;  3EUK L;  1Z0X A;  4DJA A;  1IF1 A;  1REP C;  1VQL I;  5E1Z B;  2G0E A;  5ICF A;  4CXF A;  3TOB A;  2M9H A;  2CQ7 A;  3VSL A;  2Q8K A;  1YRN B;  4HF1 A;  3CUQ A;  1R5H A;  2V79 A;  1Z6T A;  1FX7 A;  4M71 A;  4G9Y A;  4D0P A;  4AWX B;  1RUN A;  3DU5 A;  2Z16 A;  1P92 A;  2ECB A;  2L5Q A;  3LQR A;  3OOU A;  5B5E C;  4KIS A;  1J7K A;  2IAI A;  3KZY A;  3CJQ B;  1ZYR F;  4E4H A;  1MNM C;  1FTT A;  4N0B A;  1Z05 A;  3WTW C;  2HKO A;  4IJA A;  4KFC A;  3K1N A;  4D9J A;  1EJ9 A;  1Z21 A;  3FMR A;  3OY9 A;  1P6R A;  4A3F J;  5GTI C;  2ZFU A;  1K83 J;  2XDV A;  1AU7 A;  2WB1 A;  4PFP A;  4O3M A;  2JN6 A;  4RS8 A;  4ENN A;  5J8F A;  2LRD A;  1GVJ A;  2MFZ A;  4A3E J;  1OCZ H;  3V4G A;  2VPL A;  2NOJ B;  3MEX A;  2F48 A;  1FPQ A;  1W4M A;  4EEF G;  2R7T A;  4KMU X;  3U9G A;  2NXN B;  4NC8 A;  4BJ5 C;  2O0Y A;  3HRU A;  2ICW G;  2XPU A;  5A2Q K;  3O3K A;  1ZR4 A;  3A0B C;  3DTE A;  4ETS A;  3F8N A;  1B9N A;  2XAS A;  4M6V A;  1FYK A;  3M3Y J;  3REO A;  4PZJ A;  4XON A;  4I7H A;  1CQT A;  3FXO A;  4RM2 A;  4U87 A;  2M4K A;  4RMN A;  1JHF A;  2JZY A;  5D8K B;  3BJ6 A;  4M9X A;  3G2B A;  2A61 A;  2FA5 A;  1G3T A;  3UKG A;  3HB9 A;  4M3E A;  2EIN H;  1S5L C;  2MLG A;  1MSE C;  2ID3 A;  1W5S A;  3HUG A;  5B3S H;  3CCE I;  1XMK A;  2EJR A;  3BDD A;  3H9Q A;  4BXU A;  5KNL A;  3IH2 A;  1YYV A;  4U88 A;  2HPI A;  2OF7 A;  1X4P A;  2AXT C;  2HDW A;  4XL9 A;  1V54 H;  2XAU A;  1VQK I;  3IP4 B;  4MO7 A;  2GLO A;  4RGX A;  2MH2 A;  3H36 A;  4BXX J;  5C4X J;  2RQP A;  1IW7 F;  2RRE A;  3TGN A;  4EJU A;  4Y15 A;  2G7H A;  2P0W A;  4YEL A;  3J7A O;  3HSE A;  4NC7 A;  4XSX F;  4FQG A;  1TWG J;  2W48 A;  2XKO A;  3BC8 A;  1H8A C;  1F4K A;  2X85 A;  1BOB A;  5J4Y A;  2KDZ A;  2CYY A;  5BPI A;  1O4X A;  2HVS A;  2A6E F;  3CLO A;  3PQJ A;  1G6N A;  3TMO A;  2EFP A;  3FXK A;  1T39 A;  2NVY J;  2VUM J;  3FXQ A;  2A5W A;  2ZME A;  4L0Z B;  1RI7 A;  4CCJ A;  3WU1 B;  2B7E A;  1OFC X;  3B6C A;  1YTY A;  5LEK A;  4II2 A;  1Z91 A;  2R7Q A;  1QA6 A;  4EV0 A;  2PJP A;  2KJC A;  3FKI J;  3L00 A;  4RM3 A;  1N25 A;  2A69 F;  3HRS A;  1V5F A;  5KCM A;  4UUT A;  4A5N A;  1R1T A;  2HQA A;  4X0G A;  1R22 A;  3H9J A;  4FIS A;  5FLX K;  3HRM A;  2M7B A;  3N97 A;  4G7O F;  3GLX A;  1BL0 A;  1DP7 P;  1SD5 A;  2CJJ A;  2V9P A;  4QPO A;  3JRI A;  3GUD A;  3K2A A;  1DPR A;  3IH4 A;  1HBX G;  3W6V A;  1TWA J;  2IA0 A;  5EGO A;  1FSH A;  4IKF A;  1SD7 A;  4QPQ A;  2K9N A;  2D2W A;  1TLH B;  1FT9 A;  1VF9 A;  3I59 A;  2MYS A;  3QPT A;  3TED A;  5E3L A;  3IRR A;  2BW3 B;  1V3F A;  4IPA A;  3I55 I;  3E6C C;  4AM3 A;  3QU6 A;  4LFU A;  3F9K A;  4AYB N;  2DMN A;  1W1W E;  3QPS A;  5DV5 A;  1GDT A;  2XGX A;  4CZC A;  3FHN A;  2CG4 A;  3KIO A;  2P7C B;  5DDG A;  1HOM A;  4L9N A;  3L7W A;  2ADU A;  4HX7 A;  3K4L A;  3TO7 A;  4UHT A;  2E19 A;  3K70 C;  1VTN C;  5ICG A;  1GLN A;  4HNU A;  3SEZ A;  1FEX A;  3QU3 A;  2DN0 A;  2Q2E B;  2QF7 A;  1IV6 A;  1S6L A;  1ZG3 A;  2EZK A;  2QQ9 A;  5IT9 K;  2NVU B;  1WVR A;  2VOP A;  5K7Z A;  3VPR A;  1YRN A;  5ILU A;  5GPA A;  5LHH A;  4S0H B;  2EFW A;  1J0R A;  3PO3 J;  5D4S A;  3EQL F;  5EYR A;  2ME6 A;  1QGP A;  2QM3 A;  2MD0 A;  2OJE D;  4QTR A;  1FTZ A;  4IQ4 A;  3K69 A;  1W5T A;  3M1E A;  1RET A;  2COM A;  1OLT A;  2V9V A;  2V1N A;  4L5J A;  1BIA A;  2BZT A;  4JK1 X;  4A3J J;  4HF0 A;  3ABM H;  1ZTR A;  4K2E A;  1X3W B;  2FRH A;  2KKO A;  5FRO A;  5HS9 A;  1GXP A;  5ILS A;  5D4R A;  5KAF C;  1ZRC A;  3WE2 A;  1LJ9 A;  3O8H A;  3RIR A;  5IOZ A;  2VBW A;  4EM1 A;  3CC4 I;  1OIS A;  3RKW A;  4XLP F;  1ZQ3 P;  4XN3 A;  1G2H A;  3DP7 A;  1QO0 D;  3BY6 A;  2Y9Y A;  2H09 A;  3FM5 A;  3L2Q A;  3T5X A;  5LRS A;  2M4G A;  1Y56 A;  2RN7 A;  4EMS A;  3A03 A;  4XBF A;  4ZDO A;  3NWT A;  4Y33 A;  2W24 A;  3C2H A;  2LK2 A;  3LQQ A;  1WJF A;  1SAX A;  1FLI A;  3BTC A;  1ETQ A;  3H3U A;  2LR8 A;  3G1O A;  2YU3 A;  2TDX A;  4XRS A;  1PP8 F;  1NK2 P;  4HW0 A;  5LBQ A;  3WHB A;  3IKT A;  1SMT A;  5F1R A;  4EJW A;  4H0E A;  1WRJ A;  3JRE A;  4BYY A;  4KJZ A;  5HLH A;  3V7S A;  5D5U B;  2BY3 A;  2HR3 A;  2Y2Z A;  1FOW A;  3CQZ J;  5BNG A;  3I3L A;  4Z2Y A;  3BG5 A;  2CFX A;  1O57 A;  3LSM A;  3F0C A;  3V8J A;  1IC8 A;  4PDK A;  2MD5 A;  4UVB A;  3LSR A;  1J5Y A;  2PLY A;  4IX7 A;  3KFW X;  2CH0 A;  2ZB9 A;  4MHG A;  2O3F A;  3HOZ J;  4A69 C;  4CYC B;  1P2F A;  4IOC F;  1BW6 A;  2WC2 A;  1IXR C;  3CUQ C;  3S2W A;  4EM2 A;  1JE8 A;  1J75 A;  4ZZD A;  3ZGK A;  5L3D A;  2STW A;  1V5E A;  3I5U A;  3V8K A;  2PMZ A;  2HS5 A;  3FBN B;  1SVM A;  5J40 A;  3C3W A;  2DMQ A;  2KZG A;  4DW6 A;  2VC0 A;  2DDA A;  2F5V A;  1V4R A;  5HNF A;  3DV8 A;  1QQI A;  2L4M A;  3R60 A;  1B6A A;  2VBX A;  4GXO A;  5EF6 A;  3G73 A;  2HWV A;  5L3B A;  4A0Y A;  2YU9 J;  3K4K A;  4HX8 A;  2WB1 N;  1Y8R B;  3T8R A;  2XUB A;  3R61 A;  1JT0 A;  4I0A A;  3KZI C;  4XLA A;  2HEO A;  1I3Q J;  2F2E A;  4UV9 A;  4A0X A;  3C7J A;  2XAQ A;  4WK8 F;  2P81 A;  3K6G A;  3ZQG A;  1JKP C;  2XAH A;  5JLX A;  2EFQ A;  1QU3 A;  3PFY A;  3HJE A;  5LFA A;  1L3L A;  3E3V A;  3QYE A;  2L4A A;  4G94 A;  1JUP A;  2F4O B;  3HL2 A;  2ZO4 A;  3OYD A;  2I5U A;  1IZ1 A;  1YW8 A;  3W2V A;  5DEQ A;  1FIP A;  3WG9 A;  4AVP A;  2DXI A;  1FOK A;  2L54 A;  4BQO A;  2RC4 A;  3I58 A;  1MIJ A;  3F6V A;  4BEH B;  5IP7 J;  2HDC A;  4CCO A;  3Q0U A;  1PYV A;  2KMU A;  3JSO A;  3LAP A;  3IWF A;  3ZOB A;  4B09 A;  3CF2 A;  3Q0V A;  2KPM A;  5HLI A;  1POG A;  3FK6 A;  1VQM I;  1MW7 A;  4A3B J;  4XMY A;  2JUG A;  3KET A;  1ZH5 A;  3ECO A;  3F6O A;  4M72 A;  4F93 B;  3BOQ A;  3M8J A;  1HQC A;  1R6R A;  2JT1 A;  1UST A;  3HC7 A;  4ZDL A;  2W85 A;  2H94 A;  2K5C A;  4G7Z F;  2BW3 A;  2JPC A;  4N9H A;  3O2P E;  1R71 A;  2VQH A;  4NQW B;  3S3M A;  2HNH A;  3E6B A;  5BS6 A;  1KZH A;  4KA4 A;  1ZG5 A;  3BQY A;  1Z9C A;  2KL4 A;  5JVG F;  4RAG A;  2V1D A;  3ZN0 A;  4BH9 A;  3GCM A;  2A5Y B;  1U6G A;  4XK4 A;  2MAB A;  2MH9 A;  1PUF B;  5LGT A;  3VWB A;  3VSK A;  3KYC B;  2CV2 A;  1NTC A;  2L7F P;  2EA4 A;  3WTT C;  2HYJ A;  2Y69 H;  4RGR A;  2IEK A;  4BKX A;  1XDS A;  4HV5 A;  4QWQ A;  1O3R A;  1BC7 C;  3R0A A;  3OYB A;  1R5G A;  1JTY A;  1FBS A;  4AID A;  2XHK A;  2G7U A;  1EH6 A;  2EZL A;  2NAZ A;  1CF7 B;  4OIO F;  1XB4 A;  3KEO A;  4AUX A;  3A0H C;  2ZJR F;  4IZZ A;  2AXL A;  1WCM J;  3ZPL A;  4R79 A;  2GQQ A;  4HSR A;  5GP9 A;  1OPC A;  3SFI A;  2M30 A;  4MEX F;  5FLM J;  2ZME C;  1X1P A;  2R93 J;  2M0M A;  3CUQ B;  1ZRD A;  4R8H A;  2W00 A;  1RIO H;  5L3C A;  4EM0 B;  4WF2 A;  5CVU A;  3JRB A;  1I50 J;  3IH3 A;  5CVI A;  4ESJ A;  2HYG D;  1YW9 A;  4OIQ F;  2X6Y A;  5J8C A;  4A12 A;  2V1U A;  2R7F A;  1D1C A;  2E71 A;  2R0Q C;  3GZ5 A;  5J6X A;  2Z3Y A;  1UB9 A;  4I01 A;  4CCM A;  1JJ6 C;  4FET A;  5CKT A;  2FNP A;  1WH5 A;  2OU2 A;  3BG9 A;  2JSC A;  2CO5 A;  3CP8 A;  2DOE A;  1OYI A;  5CVV A;  1G3S A;  3LSH A;  2ZFW A;  3M1C A;  1TWF J;  1B59 A;  3BQZ A;  1IXS B;  1A35 A;  1TWC J;  1IJW C;  3F21 A;  2XB5 A;  2HZD A;  2FBH A;  2W25 A;  2OZ6 A;  1D0Y A;  2O8K A;  3FMS A;  3CUO A;  2LF7 A;  4GFB A;  1LFP A;  1MMS A;  3JAM Z;  3FDY A;  1MJ9 A;  3LSP A;  3DTI A;  2KZV A;  4U0W A;  1P4W A;  4D5F A;  3S1N J;  3S3O A;  1X4O A;  3GZN B;  5HLT A;  1P4X A;  4CYC A;  4EGY A;  2FXA A;  3CCS I;  2M8E A;  2GOM A;  1R49 A;  2DTZ A;  3AL0 C;  3K7A J;  1WJD A;  3K4M A;  2DA3 A;  4M9Z A;  2HOA A;  2XPV A;  4BNC A;  1UCR A;  5B66 C;  1IV8 A;  1XGS A;  3VDX A;  3HOV J;  4IHS A;  3IAS 2;  3JRA A;  2Y9Z A;  1WPK A;  4E7S A;  1H9G A;  4BQQ A;  1VI0 A;  2O03 A;  2UWM A;  2LH9 A;  4LK1 F;  1FY7 A;  4G12 A;  3HUG B;  4RA2 A;  2ZKZ A;  3K1M A;  1UJ8 A;  3ABL H;  1VQN I;  1XS9 A;  1K4T A;  3A2K A;  5IT3 A;  3KE2 A;  2HTS A;  3H5A A;  1JKO C;  2OCC H;  1GUU A;  2DFF A;  4XID A;  1HCR A;  2H1L A;  4HST A;  4UVA A;  2FU4 A;  4B8X A;  2HTJ A;  1W7P D;  3ZP5 A;  1B8I A;  3GTG J;  1XG1 A;  1UHM A;  3T8T A;  1BOA A;  4HV6 A;  3AAF A;  3H3Z A;  1IG7 A;  5AIQ A;  3MAJ A;  2A6T A;  2VOD A;  1BR2 A;  3C1D A;  1YFH A;  3SZT A;  2HDD A;  3TBI A;  1D1A A;  3BCB A;  3GYH X;  5FRN A;  4MLO A;  1LEB A;  4Y4R A;  3KYD B;  2JSP A;  1DPU A;  2JJ7 A;  3K1P A;  1SFK A;  2H1K A;  3P5J A;  4NUB A;  3K2Z A;  1O3S A;  1JTX A;  3K4C A;  1R1V A;  1TW3 A;  4PFO A;  5BOX A;  4ZZL A;  4LLN A;  1KA8 A;  3E6D A;  3L2U A;  5D5X B;  1E3H A;  4MIM A;  1SEU A;  3F8M A;  1X1C A;  2LY9 A;  3TDU C;  5HNH A;  2LYC A;  4HLX A;  4PJ0 C;  4I02 A;  5TJJ A;  3EUA A;  1OCP A;  4HYE A;  2HOS A;  4DZP A;  3G71 I;  2DOA A;  2VXZ A;  3L2V A;  1AHD P;  2PMZ N;  1R4N B;  2YX4 A;  3JRG A;  3L2R A;  1QBJ A;  2LTP A;  1FWZ A;  1MBJ A;  3TW6 A;  1LPQ A;  1Y0U A;  5EGO B;  4V19 K;  4CZZ A;  2WAE A;  2IGN A;  1T56 A;  2V7F A;  2R5Z B;  1K78 B;  1PUF A;  4BU2 A;  2YX7 A;  1FNN A;  4FCY A;  4IRI A;  4N9I A;  2R3S A;  3S14 J;  2NOG A;  3F3X A;  3HXL A;  4UVC A;  4YIR X;  2X1C A;  1LDD A;  2K4J A;  2LP0 A;  1XN7 A;  1P7I A;  1R7J A;  3RDI A;  2BE5 F;  1MBH A;  1OYY A;  1UMQ A;  1OCR H;  1CF7 A;  1W36 C;  2DMU A;  3PIO F;  2HYF A;  3EDP A;  1MH3 A;  2RNJ A;  5F27 A;  4H4K C;  4WWC A;  3H1C A;  3ZQL A;  4HDU A;  2KDO A;  4LMY A;  2RAE A;  2QSF X;  2LVS A;  4E70 A;  2R5Y A;  3AL0 B;  1JKR C;  3KP4 A;  2ISZ A;  1XSX A;  3LMM A;  1T38 A;  1S3J A;  1JXS A;  4E7K A;  4M74 A;  3FMQ A;  5AON A;  3CCV I;  1U3E M;  2LBF B;  2GAU A;  1U5T B;  3GFM A;  3JRH A;  3I4N J;  2CUE A;  3ZR8 X;  1OQY A;  3LA2 A;  3ZQ7 A;  2GA1 A;  2QWW A;  3TO9 A;  5FKO A;  2LY1 A;  1QPM A;  1I1S A;  4KT6 A;  3OS0 A;  3RKQ A;  1DGR M;  2XGE A;  4HPQ A;  2XB0 X;  3P9C A;  2E5Z A;  3HKZ A;  1TTY A;  2V6C A;  2FD5 A;  2LKS A;  3L2W A;  2EB7 A;  1IAW A;  3JW4 A;  1YI2 I;  1BI0 A;  4L9T A;  4BGD A;  2G9W A;  3S16 J;  4DYR A;  4Z6Y A;  3HSR A;  2QEN A;  3L09 A;  5ERI A;  4CCL A;  5J1U A;  3R6S A;  1KQ9 A;  1AWC A;  4F3Q A;  1HW1 A;  4LLG F;  1TT5 B;  5F08 A;  3JRF A;  2JA6 J;  4S05 A;  2DU9 A;  4IL6 C;  1QZY A;  4U7D A;  3S1Q J;  3KEQ A;  2DOD A;  5DUI A;  1ACI A;  4M3D A;  4BAC A;  3PQK A;  5FKK A;  1OMI A;  1WH7 A;  2IJL A;  4UXN A;  2XKP A;  3ROU A;  3PSI A;  4II3 A;  3CJR B;  3DPL C;  2M3A A;  3TO6 A;  1ZN2 A;  2Z99 A;  5BPD A;  2K9L A;  4EQQ A;  4ENJ A;  3C18 A;  1WI9 A;  3OV8 A;  3WTX C;  2QQB A;  2BHY A;  1WJ5 A;  1IN6 A;  2P4W A;  3VEP A;  1D0X A;  2JPB A;  1RR7 A;  1B72 B;  3H9G A;  2A3S A;  4OU0 A;  5LLQ A;  1MBE A;  1LNW A;  2DT7 B;  2E60 A;  1WJA A;  3RI4 A;  1KYZ A;  2A68 F;  3MVP A;  1G8X A;  1T98 A;  1Z6R A;  3O6B B;  1D0Z A;  2VBY A;  2DQR A;  5E3N A;  4JX5 A;  4XKW A;  4JYK A;  4KIT B;  4E7L A;  3QRF F;  3BR0 A;  2AO9 A;  3CCL I;  4ZYD A;  2HXI A;  2QGU A;  5C3E J;  3I56 I;  1Z7U A;  3E5Q A;  2DYR H;  2J5P A;  2QKL B;  1S7O A;  1YQA A;  2BYV E;  1ZAO A;  2E2H J;  2UZK A;  3ASN H;  5C44 J;  4OIN F;  3OWT A;  2K27 A;  2W57 A;  2KT0 A;  1W0U A;  2JA8 J;  2QSH X;  1RKT A;  1XTA A;  1T08 B;  4HQE A;  4BQN A;  2OQG A;  2EH3 A;  1ETK A;  1G3W A;  1D8K A;  4RLQ A;  5JHU A;  5K7H A;  4RB2 C;  2X4H A;  1F1Z A;  3DCF A;  3HBL A;  1D3Y A;  3ZMS A;  2V6E A;  3PM1 A;  1ZRF A;  1SFU A;  5E1W A;  4IHY A;  3WHC A;  4FT8 A;  1UHS A;  1MBG A;  3GLL A;  1UG0 A;  3I9V 2;  4OMY A;  4DNC A;  4FHT A;  2XF6 A;  2JWT A;  4BXF A;  1I3A A;  3B73 A;  2STT A;  1X19 A;  2Z2S B;  1MMD A;  2ELH A;  3JR9 A;  1BJA A;  2E5N A;  1D5V A;  3RJP A;  1HST A;  2P8T A;  2IP2 A;  4PSX A;  3WTU C;  3I71 A;  1TW2 A;  3AKZ A;  3HZJ A;  4C3I J;  2JUC A;  3DU6 A;  2MA3 A;  4BBS J;  3L2C A;  2FF4 A;  3K4J A;  5M5Y J;  2KHM A;  1CGP A;  2EK5 A;  3JCU C;  3LFU A;  3DLL F;  1LVA A;  3PO2 J;  3I53 A;  2WAF A;  4AU7 A;  3AG1 H;  3DBH B;  2ZNY A;  2R5Z A;  1K78 A;  1BI1 A;  1VQ7 I;  1EH8 A;  2IPQ X;  4WCG A;  2DMT A;  3U2R A;  2DTR A;  5CJ9 A;  1T95 A;  3KZZ A;  2PFB A;  4RB0 A;  3HOU J;  4LIT A;  1QRY A;  5DCF A;  2VQL A;  2WA0 A;  3I54 A;  5H2F C;  2L9N A;  1XSV A;  3EUH A;  4XRS G;  2IRF G;  3DXJ F;  4U0V A;  2JTV A;  4CCN A;  3ABK H;  2PX9 A;  2BHZ A;  3E5U A;  1J2X A;  4QLC U;  1R36 A;  4KUM A;  1I27 A;  4ESF A;  1YE9 A;  2VAS A;  4A6D A;  2XC7 A;  3HRT A;  1MH4 A;  3VFZ A;  1T2K A;  1JGS A;  4BY1 J;  1E0E A;  2RVC A;  2WY7 Q;  3PNY A;  3LSG A;  2BY0 A;  1ZRE A;  5B1A H;  4XR6 A;  2DMP A;  3MQ0 A;  2CU7 A;  1R23 A;  3NAR A;  1HF0 A;  3D5R C;  3LOC A;  5KHD A;  3PJR A;  3ZMZ A;  3MFK A;  1VFC A;  4EJO A;  2LBF A;  1U5T A;  2I10 A;  3HIF A;  2HPM A;  2RNG A;  4KT5 C;  1QPI A;  2VI6 A;  1MND A;  2EWN A;  3HHG A;  1BW5 A;  2VC1 A;  5FKN A;  3I4P A;  4UUS A;  2GBY A;  3KLO A;  2Z5U A;  2ZNZ A;  3E7L A;  2O61 A;  1XPX A;  4BBR J;  3CMY A;  1MMG A;  2EIJ H;  2JVG A;  1TBX A;  1ZLJ A;  3GTL J;  3RPU D;  2FQ4 A;  3HM5 A;  1FMV A;  1RRJ A;  3OL4 A;  1BR1 A;  2QCO A;  1ZEL A;  2DDB A;  2LF8 A;  5EEA A;  1Z1D A;  5J47 A;  1RPW A;  5CYV A;  2CWE A;  4ZDP A;  1B9M A;  2OD5 A;  2PEX A;  4GYG A;  1HDD C;  3GZ6 A;  3WU2 C;  3A01 A;  4F7Z A;  1JUM A;  2DW4 A;  4AVZ A;  2LKX A;  1S7E A;  5GAE J;  1A31 A;  1EF4 A;  1BJZ A;  4C30 A;  3OYJ A;  1O3Q A;  1KYW A;  1T0F A;  2X48 A;  4S04 A;  2M2E A;  3E6M A;  4MGR A;  3EYI A;  5DYM A;  1TNS A;  3M9A A;  2WV0 A;  2LSO A;  1BN5 A;  1D1B A;  2JK3 A;  2KIU A;  2R7X A;  4Y17 A;  3RZD J;  1KU9 A;  2QUF A;  2OV7 A;  2GWR A;  4C2U A;  1RC9 A;  2DO7 A;  4DQ2 A;  1B72 A;  1LFU P;  1Z3X A;  2H8W A;  1APL C;  4I6Z A;  2X6O A;  3CDL A;  2IS2 A;  1XCV A;  2E34 A;  3BG3 A;  3SJM A;  4X6A J;  4M9S A;  4XN0 A;  4L0Y B;  3CP2 A;  1SFX A;  3IWZ A;  2GA2 A;  2VQG A;  3I64 A;  4JX4 A;  3SFZ A;  1I6H J;  1U9O A; 
#chains in the Genus database with same CATH homology
 1SD4 A;  4EJV A;  3ZMU A;  4JBA A;  2XIG A;  4EVI A;  4HF2 A;  3I0T A;  1IN8 A;  4GCV A;  3QP5 A;  3NRV A;  3QAH A;  2OZU A;  2IW5 A;  1XMA A;  1P4A A;  2WWY A;  4G7H F;  3F8F A;  1IUY A;  2XRN A;  1PDN C;  5F64 A;  1UFM A;  4YFK F;  2Q0O A;  2OA4 A;  3GFJ A;  2VON A;  1LDK B;  1IN7 A;  5D8L B;  2HGC A;  2BBY A;  3LA7 A;  2P6T A;  4LLL A;  1IXC A;  4M6Y A;  2RKH A;  2IA1 A;  5E1X A;  2K7L A;  3DEU A;  4YFN F;  4GGG A;  3RYP A;  5LRR A;  1EH7 A;  4P5O A;  1NHA A;  4MTE A;  1TQP A;  2Y48 A;  1KQ8 A;  5D5W B;  1ULY A;  2PQ8 A;  5D6E A;  5AIP A;  2IT0 A;  2NRA C;  4U7B A;  2K4B A;  3BJA A;  3IKV A;  3BWG A;  2B0L A;  1LEA A;  3J80 Z;  2GZW A;  1B4A A;  1PP7 U;  2PG4 A;  4GO1 A;  2XVC A;  3K9T A;  4BHB A;  4CO8 A;  2Y0M A;  5K5R A;  4L9J A;  3ERE D;  1U2W A;  2AS5 F;  3FZV A;  4P96 A;  2ESH A;  2P5K A;  2FBI A;  4P9U A;  4CGZ A;  2L3D A;  1YS6 A;  1E2X A;  1T6S A;  3NQO A;  2NYX A;  2PBI A;  3WTZ A;  2HKX A;  1ONV A;  2GXG A;  2K02 A;  1S7A A;  2DBB A;  2LNB A;  3WE3 A;  1R00 A;  2V1X A;  4M6X A;  1X3U A;  1WQ2 A;  4Q48 A;  2PMH A;  1W7P A;  3TDZ C;  3HOT A;  4HA8 A;  3ABT A;  4KIF A;  4MNU A;  2FNA A;  3SQN A;  2VBZ A;  1E17 A;  4IF4 A;  1U78 A;  4A5M A;  1QNT A;  4ZH4 F;  3P9K A;  4BQA A;  2H6C A;  4UNO A;  2CQK A;  1S29 A;  3FF5 A;  2CW0 F;  3KP6 A;  1H0M A;  3JAM K;  5KVR A;  3P7N A;  3GF2 A;  4WXD A;  4HOB A;  3GW2 A;  1FYL A;  3GEZ A;  3FHZ A;  1IRG A;  4ENM A;  4ZYE A;  1BIB A;  2RV8 A;  3BZ6 A;  1KU3 A;  1ZAR A;  1IN4 A;  1ZLK A;  1F5T A;  1FP2 A;  1TNT A;  2ACJ A;  1ON1 A;  4HBL A;  2GIV A;  3V7C A;  4RB1 A;  1ZG1 A;  2VT3 A;  4WXC A;  4WXH A;  5K1Y A;  4KYW A;  2E1N A;  3VOE A;  5L3G A;  4YFX F;  1U5T C;  5CLS A;  1KU2 A;  1XGN A;  3RKX A;  5CVR A;  1O7L A;  1XGM A;  2M1B A;  4RGS A;  5HOO A;  2HZT A;  2DT5 A;  3CTA A;  2YPR A;  3LAJ A;  2P6S A;  1KQ0 A;  3WTS C;  3W6K B;  4YII A;  5KK1 A;  1BM9 A;  1I1G A;  4LG0 B;  4KIB A;  3COA C;  1HW2 A;  2BGC A;  4HZF A;  2QLZ A;  2VN2 A;  3CDH A;  1L0O C;  3HSF A;  3QOP A;  3ULQ B;  2DI3 A;  4ESB A;  3GO5 A;  1WWX A;  3DF8 A;  4KDP A;  2HQR A;  2QQA A;  4ZYH A;  3HYI A;  1OKR A;  1YLF A;  3M8E A;  2KIM A;  3FX3 A;  2XRO A;  4WX9 A;  1XDU A;  4ON0 A;  3J81 Z;  5BQT A;  2XAJ A;  3KLN A;  5E8G A;  1I6X A;  1C0W A;  2JRT A;  2EV6 A;  1SMY F;  3HOS A;  3BJO A;  5E18 F;  1STZ A;  1WKM A;  5DD4 A;  2OBP A;  2E1C A;  3HHH A;  3DFG A;  2EFN A;  1D8J A;  3ELK A;  4P9F A;  1SFE A;  3QPH A;  2XV4 S;  2OAZ A;  3WGG A;  3WTV C;  2PMU A;  3IC7 A;  1USS A;  2IVM A;  2LDU A;  1SD6 A;  3LWF A;  5ED4 A;  4O6J A;  1UHW A;  1Q1H A;  1O3T A;  5HS8 A;  1MDM B;  5H20 A;  1IRF A;  1HKQ A;  4AIH A;  5JI6 A;  4FX0 A;  1KGS A;  3TKY A;  2XAG A;  2HOE A;  5DCM A;  4LD5 A;  2YSR A;  4KIC A;  4P55 A;  1OYW A;  2H6B A;  3IHU A;  2F5E A;  4L5I A;  2D45 A;  1HW5 A;  3KCC A;  2DK5 A;  3N4M A;  1S8N A;  4YIF A;  1TQM A;  3EET A;  1G4D A;  4JQF A;  4XSZ F;  2RGV A;  3HTU A;  5LHI A;  4Q5S F;  1EV7 A;  3ECH A;  2Z33 A;  3BPX A;  1J9I A;  4ZYG A;  2ZCW A;  4OOI A;  3MZH A;  2HFH A;  2EV0 A;  5E17 F;  4XRF A;  1MGT A;  2A6H F;  1XD7 A;  1BBY A;  5JVT A;  1G3Y A;  1KU7 A;  1FZP B;  3GFI A;  2XAF A;  5FB2 A;  3TOA A;  5A2Q Z;  3ISP A;  3MCZ A;  2F5F A;  4LG0 A;  3D0S A;  3GVA A;  3WU0 A;  5ICC A;  1FBQ A;  3RPU A;  3ZMV A;  5DUK A;  2BEO A;  4MTD A;  3QP6 A;  1HXD A;  3CO6 C;  1PUE E;  3ZMD A;  5HVQ C;  1H9T A;  3K0L A;  5JR3 A;  5L3F A;  3SXY A;  3U1D A;  3Q9S A;  2O8X A;  1GXQ A;  2DQL A;  2F5D A;  3FWE A;  4HQM A;  4ASN A;  2O6G E;  4IVN A;  3FXU A;  4MQ9 F;  5D6F A;  2QBY A;  1ZGA A;  4IRH A;  2VE9 A;  4HDV A;  1FBU A;  4RB3 C;  4HAM A;  1MZB A;  5FLX Z;  5FD5 A;  4L9V A;  3F22 A;  2FE3 A;  3DPT A;  2VOO A;  2KJB A;  5H6R A;  2Z9O A;  4IHT A;  5K5Q A;  2M45 A;  4KNY A;  5H6Q A;  3KP3 A;  1MDM A;  2PI0 A;  3GFL A;  3W6J B;  4PGG A;  3BRO A;  4Y13 A;  3RPQ A;  1OR7 A;  4G8X A;  5FGM A;  2MBF A;  4R1H A;  4PGH A;  5HS7 A;  1W7P B;  3DQV C;  3MZY A;  2D1H A;  4M73 A;  5LGU A;  5FFX A;  4MQV A;  5IT9 Z;  4PCQ A;  1LDJ A;  2DFI A;  5ILV A;  3B02 A;  4LB5 A;  3GX4 X;  4U0Y A;  4OMZ A;  3IRQ A;  5L3E A;  1RUO A;  2ETH A;  2VE8 A;  2WTE A;  1ON2 A;  3SZP A;  5EEH A;  2IA2 A;  3JTH A;  1FYM A;  5TRD A;  2YR2 A;  2QVO A;  1YS7 A;  3SHF A;  3RTR A;  1MJB A;  4L18 B;  4HX4 A;  3F8B A;  2D1V A;  4NB5 A;  1IN5 A;  2K86 A;  1J59 A;  1FP1 D;  3WTY C;  2ZBK A;  1YIO A;  4O5V A;  4TV7 A;  2DLL A;  3LST A;  3LA3 A;  4HLY A;  1FSE A;  4A0Z A;  1RZ4 A;  4G6Q A;  3VB2 A;  2KIF A;  3V7R A;  1FC3 A;  1MJA A;  4IRG A;  4UV8 A;  2DPU A;  2QZ8 A;  2MC3 A;  3BP8 A;  3HTS B;  2C6Y A;  2RDP A;  2DPD A;  2NNY A;  3GXO A;  5BMZ A;  4LB6 B;  3BPV A;  3P9I A;  3OOP A;  4OIR F;  5HDN A;  4AIK A;  4KMF A;  3WGH A;  1U8R A;  1QZZ A;  3E97 A;  1TQI A;  1A04 A;  3F8C A;  1BC8 C;  5F6F A;  3ABU A;  1WSU A;  3J80 K;  5EEG A;  1O7F A;  3Q9V A;  3WOD F;  5LHG A;  3D5L A;  2BV6 A;  1MKM A;  5E20 A;  1LB2 A;  3Q5F A;  4Q4Z F;  1BI3 A;  2H27 A;  4G6D A;  2NNN A;  5LGN A;  5HDK A;  5HLG A;  1XSD A;  1DDN A;  4A6E A;  1B1B A;  2L01 A;  4CHU A;  3E5X A;  2DAO A;  2ZXJ A;  1YO5 C;  4BHP A;  2Q2E A;  4XLN F;  5JFR A;  4FX4 A;  4LJZ F;  2HQN A;  3RKY A;  1LQ1 A;  3F72 A;  2R7D A;  2M5W A;  2GXB A;  4EGZ A;  2FEZ A;  4LK0 F;  1MD0 A;  4BAY A;  5CVJ A;  4GYI A;  4I09 A;  2Y75 A;  3JTG A;  2QYO A;  5DCM B;  3LFK A;  3PFI A;  3T1B A;  5D5V B;  1XCB A;  4BHC A;  3NEU A;  2UXX A;  2UXN A;  4I0B A;  2ISY A;  5LEJ A;  3KP5 A;  5FD6 A;  2MLK A;  2PN6 A;  2P5L C;  4CIC A;  3ZMT A;  3EYY A;  4I98 B;  3IL2 A;  1DUX C;  3WGI A;  5FO5 A;  1HKT A;  2M87 A;  3MWM A;  3M8F A;  2E7X A;  2P5V A;  2OQR A;  2ZJ2 A;  3GWZ A;  2VT2 A;  1K6O A;  3KP2 A;  2ESN A;  2FMY A;  3TQN A;  5FFZ A;  2X0L A;  2FQ3 A;  5K5O A;  4NHJ A;  1XGO A;  1HKS A;  3DKW A;  3F23 A;  3CO7 C;  3RYR A;  3FXR A;  2FSW A;  2W84 A;  3FM3 A;  2FML A;  1ODD A;  4RGU A;  4I2O A;  4CDG A;  1F9N A;  3M7G A;  1YG2 A;  5DD8 A;  4RAZ A;  5HDG A;  1R58 A;  2EA2 A;  2CSO A;  4A2U A;  2J5O A;  5E8I A;  2EV5 A;  2EFO A;  3KP7 A;  3G3Z A;  3ZN1 A;  4LGW A;  4YG2 F;  2FOK A;  1K7A A;  1AOY A;  1ZHF A;  2KRF A;  4IXA A;  3J81 K;  1R1U A;  4UUV A;  3H92 A;  4MEY F;  1I5Z A;  4AIJ A;  1GHC A;  1HSJ A;  2ZME B;  3ML6 A;  3JSP A;  1K79 A;  2L02 A;  1YW7 A;  4KN4 X;  2CGP A;  4EJT A;  3V8L A;  1JHH A;  2P7V B;  2QBY B;  3R4K A;  2DK8 A;  4NQW A;  2FBK A;  3L9F A;  4CYD A;  4KIG A;  3T0Y A;  2NS0 A;  1ZGJ A;  6PAX A;  4Q47 A;  2F5C A;  3I59 B;  5ICE A;  2E7W A;  4ENK A;  4KN7 X;  2LKP A;  4RAY A;  4AD9 A;  1RNL A;  2A07 F;  3R0J A;  3CJN A;  1BI2 A;  3VOD A;  1REP C;  1IF1 A;  5E1Z B;  5ICF A;  4CXF A;  3TOB A;  2Q8K A;  4HF1 A;  3CUQ A;  1R5H A;  2V79 A;  1Z6T A;  1FX7 A;  4M71 A;  4G9Y A;  4D0P A;  4AWX B;  1RUN A;  1P92 A;  3LQR A;  1J7K A;  3KZY A;  1ZYR F;  4N0B A;  1Z05 A;  3WTW C;  2HKO A;  4IJA A;  4KFC A;  3K1N A;  3FMR A;  1P6R A;  4O3M A;  4RS8 A;  4ENN A;  5J8F A;  1GVJ A;  3V4G A;  3MEX A;  1FPQ A;  1W4M A;  4KMU X;  3U9G A;  2O0Y A;  3HRU A;  5A2Q K;  3O3K A;  4ETS A;  3F8N A;  1B9N A;  2XAS A;  1FYK A;  3REO A;  4PZJ A;  4I7H A;  1JHF A;  2JZY A;  5D8K B;  3BJ6 A;  4M9X A;  2A61 A;  2FA5 A;  1G3T A;  2MLG A;  1W5S A;  3HUG A;  1XMK A;  2EJR A;  3BDD A;  4BXU A;  1YYV A;  4U88 A;  4RGX A;  2MH2 A;  2RQP A;  1IW7 F;  3TGN A;  4EJU A;  4Y15 A;  2G7H A;  3J7A O;  3HSE A;  4XSX F;  2XKO A;  1F4K A;  2CYY A;  5BPI A;  2A6E F;  3CLO A;  3PQJ A;  1G6N A;  2EFP A;  1T39 A;  3FXQ A;  2ZME A;  4L0Z B;  1RI7 A;  3WU1 B;  1YTY A;  5LEK A;  1Z91 A;  4EV0 A;  2PJP A;  2KJC A;  3L00 A;  2A69 F;  3HRS A;  4A5N A;  1R1T A;  1R22 A;  5FLX K;  3HRM A;  3N97 A;  4G7O F;  3GLX A;  1DP7 P;  1SD5 A;  3GUD A;  1DPR A;  1HBX G;  2IA0 A;  1FSH A;  1SD7 A;  2D2W A;  1TLH B;  1FT9 A;  3I59 A;  3QPT A;  3IRR A;  1V3F A;  4IPA A;  3E6C C;  3QU6 A;  4LFU A;  5DV5 A;  2XGX A;  2CG4 A;  2P7C B;  5DDG A;  4L9N A;  3L7W A;  2ADU A;  4HX7 A;  3TO7 A;  4UHT A;  1VTN C;  5ICG A;  3QU3 A;  1S6L A;  1ZG3 A;  2QQ9 A;  5IT9 K;  2VOP A;  5ILU A;  5LHH A;  2EFW A;  1J0R A;  5D4S A;  3EQL F;  1QGP A;  2QM3 A;  3K69 A;  1W5T A;  3M1E A;  2COM A;  2V9V A;  4L5J A;  1BIA A;  4JK1 X;  4HF0 A;  4K2E A;  2FRH A;  2KKO A;  5HS9 A;  1GXP A;  5ILS A;  5D4R A;  1ZRC A;  3WE2 A;  1LJ9 A;  3RIR A;  2VBW A;  4EM1 A;  3RKW A;  4XLP F;  3DP7 A;  1QO0 D;  3BY6 A;  2H09 A;  3FM5 A;  3T5X A;  5LRS A;  2RN7 A;  4EMS A;  4XBF A;  2W24 A;  3LQQ A;  1SAX A;  1FLI A;  3H3U A;  2YU3 A;  2TDX A;  1PP8 F;  4HW0 A;  5LBQ A;  3IKT A;  1SMT A;  5F1R A;  4EJW A;  4H0E A;  1WRJ A;  4BYY A;  5HLH A;  3V7S A;  5D5U B;  2HR3 A;  4Z2Y A;  2CFX A;  1O57 A;  3V8J A;  4PDK A;  2MD5 A;  4UVB A;  1J5Y A;  2PLY A;  3KFW X;  4MHG A;  2O3F A;  1P2F A;  2WC2 A;  1IXR C;  3CUQ C;  3S2W A;  4EM2 A;  1JE8 A;  1J75 A;  4ZZD A;  5L3D A;  2STW A;  3I5U A;  3V8K A;  2HS5 A;  3C3W A;  2VC0 A;  1V4R A;  3DV8 A;  1QQI A;  2L4M A;  3R60 A;  1B6A A;  2VBX A;  4GXO A;  3G73 A;  2HWV A;  5L3B A;  4A0Y A;  4HX8 A;  3T8R A;  2XUB A;  3R61 A;  4I0A A;  2HEO A;  2F2E A;  4UV9 A;  4A0X A;  3C7J A;  2XAQ A;  4WK8 F;  2XAH A;  2EFQ A;  1L3L A;  3E3V A;  2L4A A;  4G94 A;  2ZO4 A;  1IZ1 A;  1YW8 A;  5DEQ A;  3WG9 A;  4AVP A;  1FOK A;  2L54 A;  2RC4 A;  3I58 A;  3F6V A;  2HDC A;  3JSO A;  3LAP A;  3IWF A;  4B09 A;  5HLI A;  3KET A;  1ZH5 A;  3ECO A;  3F6O A;  4M72 A;  3BOQ A;  1HQC A;  2JT1 A;  1UST A;  2W85 A;  2H94 A;  4G7Z F;  2JPC A;  4N9H A;  3O2P E;  3E6B A;  5BS6 A;  4KA4 A;  1ZG5 A;  1Z9C A;  2V1D A;  3ZN0 A;  4BH9 A;  2A5Y B;  1U6G A;  2MH9 A;  5LGT A;  2EA4 A;  3WTT C;  4RGR A;  1XDS A;  4HV5 A;  4QWQ A;  1O3R A;  1BC7 C;  3R0A A;  1R5G A;  1FBS A;  2XHK A;  2G7U A;  1EH6 A;  2NAZ A;  1CF7 B;  4OIO F;  1XB4 A;  3KEO A;  3ZPL A;  2AXL A;  4R79 A;  2GQQ A;  1OPC A;  4MEX F;  2M30 A;  3CUQ B;  1ZRD A;  4R8H A;  1RIO H;  5L3C A;  4EM0 B;  4WF2 A;  5CVU A;  5CVI A;  4ESJ A;  2HYG D;  1YW9 A;  4OIQ F;  5J8C A;  4A12 A;  2V1U A;  2R7F A;  3GZ5 A;  5J6X A;  2Z3Y A;  1UB9 A;  4I01 A;  2FNP A;  2OU2 A;  2JSC A;  2CO5 A;  1OYI A;  5CVV A;  1G3S A;  2ZFW A;  1B59 A;  1IXS B;  3F21 A;  2FBH A;  2W25 A;  2OZ6 A;  3FMS A;  3CUO A;  2LF7 A;  3JAM Z;  1MJ9 A;  4U0W A;  1P4W A;  1P4X A;  4EGY A;  2FXA A;  2M8E A;  4M9Z A;  4BNC A;  1UCR A;  1XGS A;  4IHS A;  1H9G A;  2O03 A;  2UWM A;  4LK1 F;  1FY7 A;  2ZKZ A;  3K1M A;  5IT3 A;  3KE2 A;  2HTS A;  4UVA A;  2FU4 A;  4B8X A;  2HTJ A;  1W7P D;  3ZP5 A;  1UHM A;  3T8T A;  1BOA A;  4HV6 A;  3AAF A;  3H3Z A;  5AIQ A;  3MAJ A;  2VOD A;  3C1D A;  1YFH A;  3SZT A;  3GYH X;  1LEB A;  1DPU A;  3K1P A;  3K2Z A;  1O3S A;  1R1V A;  1TW3 A;  5BOX A;  4ZZL A;  4LLN A;  1KA8 A;  3E6D A;  5D5X B;  3F8M A;  3TDU C;  4HLX A;  5TJJ A;  4I02 A;  4HYE A;  2VXZ A;  2YX4 A;  1QBJ A;  1FWZ A;  1Y0U A;  4CZZ A;  1K78 B;  2YX7 A;  1FNN A;  4IRI A;  4N9I A;  2R3S A;  3F3X A;  4UVC A;  1LDD A;  2K4J A;  1XN7 A;  1R7J A;  3RDI A;  2BE5 F;  1OYY A;  1CF7 A;  2HYF A;  3EDP A;  2RNJ A;  4WWC A;  4HDU A;  4LMY A;  4E70 A;  3KP4 A;  2ISZ A;  1XSX A;  1T38 A;  1S3J A;  1JXS A;  4M74 A;  3FMQ A;  5AON A;  1U3E M;  2GAU A;  1U5T B;  3GFM A;  3ZQ7 A;  3LA2 A;  2GA1 A;  2QWW A;  3TO9 A;  1QPM A;  1I1S A;  3P9C A;  1TTY A;  2V6C A;  2EB7 A;  1IAW A;  3JW4 A;  1BI0 A;  4L9T A;  2G9W A;  3HSR A;  2QEN A;  3L09 A;  5ERI A;  3R6S A;  1AWC A;  1KQ9 A;  1HW1 A;  4LLG F;  4S05 A;  2DU9 A;  1QZY A;  4U7D A;  3KEQ A;  5DUI A;  3PQK A;  1OMI A;  2IJL A;  4UXN A;  2XKP A;  3ROU A;  3DPL C;  3TO6 A;  1ZN2 A;  2Z99 A;  5BPD A;  4EQQ A;  4ENJ A;  3C18 A;  1WI9 A;  3OV8 A;  3WTX C;  2QQB A;  1IN6 A;  2P4W A;  3VEP A;  2JPB A;  2A3S A;  4OU0 A;  5LLQ A;  1LNW A;  3RI4 A;  1KYZ A;  2A68 F;  1T98 A;  1Z6R A;  3O6B B;  2VBY A;  2DQR A;  3QRF F;  4ZYD A;  1Z7U A;  3E5Q A;  2J5P A;  1S7O A;  1YQA A;  2BYV E;  1ZAO A;  2UZK A;  4OIN F;  2K27 A;  2W57 A;  4HQE A;  2OQG A;  1G3W A;  1D8K A;  5JHU A;  4RB2 C;  2X4H A;  1F1Z A;  1D3Y A;  3ZMS A;  1ZRF A;  1SFU A;  5E1W A;  4FT8 A;  4OMY A;  4DNC A;  4FHT A;  3B73 A;  2STT A;  2ELH A;  1BJA A;  1D5V A;  3RJP A;  1HST A;  3WTU C;  2P8T A;  2IP2 A;  3I71 A;  1TW2 A;  2MA3 A;  3L2C A;  2FF4 A;  1CGP A;  2EK5 A;  1LVA A;  3I53 A;  1K78 A;  2ZNY A;  1BI1 A;  1EH8 A;  2IPQ X;  4WCG A;  3U2R A;  2DTR A;  5CJ9 A;  3KZZ A;  2PFB A;  4RB0 A;  5DCF A;  3I54 A;  1XSV A;  3EUH A;  2IRF G;  3DXJ F;  4U0V A;  2JTV A;  4QLC U;  3E5U A;  1J2X A;  1R36 A;  4KUM A;  1I27 A;  4ESF A;  4A6D A;  1T2K A;  3HRT A;  3VFZ A;  1JGS A;  2RVC A;  1ZRE A;  3MQ0 A;  1R23 A;  3ZMZ A;  3MFK A;  4EJO A;  1U5T A;  3HIF A;  4KT5 C;  2EWN A;  3HHG A;  2VC1 A;  3I4P A;  3KLO A;  2Z5U A;  2ZNZ A;  2O61 A;  1TBX A;  1ZLJ A;  2LF8 A;  1Z1D A;  5CYV A;  2CWE A;  1B9M A;  2OD5 A;  2PEX A;  4GYG A;  3GZ6 A;  4F7Z A;  2DW4 A;  1O3Q A;  1KYW A;  1T0F A;  4S04 A;  3E6M A;  4MGR A;  3EYI A;  5DYM A;  1TNS A;  3M9A A;  2WV0 A;  2LSO A;  1BN5 A;  2KIU A;  4Y17 A;  1KU9 A;  2QUF A;  2GWR A;  2DO7 A;  4DQ2 A;  1XCV A;  4M9S A;  4L0Y B;  1SFX A;  3IWZ A;  2GA2 A;  3I64 A;  3SFZ A;  4OIP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...