1ONVA

Nmr structure of a complex containing the tfiif subunit rap74 and the rnap ii ctd phosphatase fcp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription initiation factor IIF, alpha subunit
publication title NMR Structure of a Complex Containing the TFIIF Subunit RAP74 and the RNA polymerase II carboxyl-terminal domain phosphatase FCP1
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1onvA00
2IVMA 1MDMB 2ZJ2A 4ZYEA 3BZ6A 3GWZA 2LSOA 2PJPA 1R5HA 3L00A 1RUOA 2FMLA 4HLYA 4RB2C 3FM5A 2ZKZA 2XKOA 4M71A 3QOPA 4LG0A 3BROA 1XMAA 2VXZA 4KIFA 3R60A 2ELHA 2NS0A 3MZHA 1XN7A 2KJBA 4XBFA 1U78A 2CWEA 3GF2A 4OIOF 2VONA 1LEAA 1YW7A 2BV6A 2PG4A 5L3FA 4LB6B 4KT5C 2V6CA 2NNYA 4ENNA 1J0RA 3RYRA 2XHKA 2P7VB 1OKRA 3ULQB 2GXGA 3WTSC 2D45A 3DPLC 3O6BB 3ZQ7A 3HHHA 3K1NA 3QPTA 3DV8A 1FT9A 2Q2EA 4WXHA 3ISPA 1P4AA 2G7HA 1FZPB 4ZYHA 2EFWA 2FMYA 1HKTA 2EFNA 3KP4A 1D8KA 4MEYF 4LB5A 1W5SA 5L3BA 4MQVA 2OAZA 2O61A 2OZUA 4HQEA 4WWCA 2UWMA 4WXCA 2F5CA 2DQRA 3CTAA 3RIRA 1XB4A 4O6JA 5LHGA 3EQLF 1G3TA 2Z33A 2YPRA 2V1XA 2Y48A 1XDSA 3E6BA 1XGNA 3RDIA 5IT3A 1WRJA 5J8FA 5D5WB 3WTVC 4HYEA 1FY7A 3ECHA 1V3FA 2IRFG 4BH9A 1W5TA 4CDGA 4FHTA 3K2ZA 5TRDA 3WODF 5DD4A 5LBQA 2XAGA 3EDPA 1XCVA 2JPCA 4BXUA 1I6XA 3ZMZA 2FBIA 2ISZA 1LB2A 5CVVA 3ABUA 1T38A 5E8GA 1KYZA 3WTZA 5AIPA 2EV5A 4ZZDA 1TW2A 2F2EA 1LVAA 1KYWA 3HHGA 1JHFA 1I1GA 4I0BA 1FBSA 1E2XA 3RI4A 2DFIA 1SD6A 3H92A 1J59A 1YQAA 4S05A 4GYGA 2H6BA 1KU7A 2OD5A 3V8LA 3DP7A 3L7WA 3SZPA 1B4AA 2VE8A 3HTUA 2F5EA 3IHUA 5L3GA 3JW4A 2ZO4A 1G6NA 1O7FA 2KJCA 5EEGA 1I1SA 3O2PE 3GO5A 5E1XA 2QUFA 1BI0A 5D4SA 2OQRA 2GA1A 1T6SA 3U9GA 3COAC 3M1EA 4EVIA 5BPIA 4HLXA 1B1BA 2P7CB 3BPXA 4LMYA 2XKPA 1JGSA 4P5OA 3DPTA 1Y0UA 5H20A 4I02A 3TOAA 1U5TC 3GVAA 2VBYA 1B9NA 1R58A 3RKWA 3QU3A 3GFIA 1PUEE 3NEUA 3KZZA 2V79A 3M8EA 3ML6A 3F22A 3BJ6A 4U88A 2FEZA 1XCBA 4PGHA 4OU0A 2GWRA 4CO8A 3V8JA 1RI7A 1IXCA 2VC0A 1D5VA 4UVBA 4YFNF 2A61A 3JAMZ 4RAZA 3N4MA 3CUQA 3ZMDA 1DPUA 2MD5A 4R1HA 2VOOA 2IA1A 3WGGA 1ZGJA 2FBHA 4UV9A 1PDNC 4G8XA 3I59A 3AAFA 5J8CA 3M8FA 1G3YA 4HZFA 4Y17A 1YTYA 1F5TA 2YX7A 3ELKA 4K2EA 3ZN1A 3GEZA 2KIMA 2YX4A 1UHMA 1R36A 1K6OA 5HDNA 4M6YA 1ZG1A 3QPHA 1EH6A 3GFJA 3DF8A 4RGXA 1CF7A 2ZNYA 1U8RA 3KCCA 1LJ9A 3ABTA 2H6CA 3FM3A 3R0AA 4M9ZA 1ZG5A 4LD5A 3ZMSA 5FO5A 1ZRFA 4EM0B 2M87A 2HOEA 2M45A 3PQJA 4G7OF 2Y75A 5HLGA 2STTA 1FSHA 1QO0D 2K02A 4A2UA 4ETSA 2H27A 3OV8A 4AVPA 2HYFA 4ZYGA 5LHIA 1C0WA 1RNLA 4M74A 1S7OA 3P9CA 4RGUA 5DV5A 4M72A 3P7NA 4Y13A 3K0LA 4EM1A 3D5LA 3FMSA 4CYDA 3WE2A 4FX4A 3Q5FA 2STWA 3WU0A 3R61A 4G7HF 2IA0A 1BI2A 1J9IA 5ILVA 4HX8A 4P9FA 3KZYA 2D2WA 4HX4A 2EFOA 1OYIA 4ASNA 3KEOA 3JTGA 3GYHX 2W25A 1MJ9A 2BE5F 2J5OA 3F8BA 1Z91A 4U0VA 2FNAA 2EJRA 4HV6A 3HRTA 3I53A 2O3FA 1IN6A 1O7LA 2F5FA 2HKOA 3SQNA 2A5YB 2Z99A 3O3KA 3HSEA 1GVJA 4KDPA 2A68F 3KETA 5HLIA 5H6RA 2XROA 1R5GA 2QBYA 2WTEA 2CW0F 1TQMA 3ERED 2CFXA 4A0XA 3F8CA 2XRNA 2RGVA 4GYIA 2DBBA 1USTA 3W6JB 2VBWA 2K7LA 3J80K 2E7XA 3GZ5A 1FNNA 4N0BA 1IF1A 4M9XA 4PDKA 3I54A 4LLLA 4LK1F 2FNPA 3QAHA 3IKTA 1MKMA 3IKVA 2A6EF 4L5JA 5LGUA 4G6QA 3EETA 2RNJA 3MCZA 4UVCA 4KICA 2O03A 3NRVA 4UXNA 5LGTA 3T5XA 2EV6A 3P9KA 1O3RA 2HTSA 2R3SA 4KIGA 3D0SA 1J5YA 5DCMA 4OOIA 3F3XA 2QYOA 3K1MA 4YFKF 2BGCA 2RKHA 4OIPF 2FXAA 2O0YA 3QP6A 5E1WA 4AIHA 3JAMK 1BIAA 1YFHA 2M30A 3F6VA 1FP2A 4CGZA 2PMUA 5ILUA 3B73A 1P6RA 1IN7A 1WQ2A 5H6QA 3MEXA 3E6DA 3FZVA 3I58A 4U7BA 2WWYA 4EJTA 1KGSA 3F72A 1S29A 1SD5A 3SZTA 4HAMA 1G3WA 4AIKA 3TO9A 2VODA 4IPAA 4RS8A 1RUNA 2CSOA 5E1ZB 3ZMUA 1FSEA 2K4JA 1STZA 2FBKA 3HIFA 2ZXJA 3LAJA 1EH8A 4IRHA 2RC4A 2E7WA 4LFUA 2DPDA 2P5KA 1UB9A 2VOPA 1Z1DA 1XGMA 2ACJA 4R8HA 2CQKA 3KP2A 3WTTC 3SXYA 3ZN0A 4KYWA 3L9FA 4M6XA 1LDKB 4RGSA 1H9GA 3FXRA 3EYYA 2NAZA 2HS5A 4GXOA 1G3SA 5JFRA 1BC7C 1OPCA 3RKYA 4ZH4F 3FMQA 5HDGA 2NYXA 4CZZA 3KP3A 5ICEA 2P8TA 1BJAA 1ZREA 4XLNF 3JTHA 4XSXF 1XSDA 5JR3A 4WK8F 3FXUA 2EFQA 2Q8KA 2CO5A 1ZGAA 1BIBA 2LDUA 3J7AO 5HS9A 1H9TA 4I2OA 3I0TA 2CG4A 1E17A 3KFWX 3L2CA 3W6KB 5DUKA 3FF5A 1P4WA 2OBPA 2ZNZA 2EB7A 4ESBA 3BJOA 2UZKA 1R7JA 2KIFA 1HW2A 2ADUA 4O3MA 5F1RA 5ICCA 2P5VA 2IPQX 4F7ZA 4ESFA 4KMFA 3NQOA 4FX0A 4RB3C 1ONVA 5K5QA 1HSJA 5FD5A 3HTSB 1R23A 3BY6A 2NNNA 5CVJA 5A2QZ 2Z9OA 2RN7A 4HX7A 3VEPA 2DTRA 3DXJF 1MJAA 3FWEA 5DCMB 4UHTA 4MTEA 4UNOA 2WV0A 1UFMA 1D8JA 5CJ9A 2MH2A 1B59A 5CLSA 3ROUA 3TO6A 5IT9K 4GO1A 4OMYA 4KIBA 2K4BA 1T98A 1A04A 3WE3A 1R1TA 4HDVA 3RTRA 4S04A 3F23A 2DW4A 4BHPA 4TV7A 3LA2A 2FE3A 2KIUA 4GGGA 3T0YA 5ICGA 4KN7X 4HA8A 4D0PA 1BC8C 5JVTA 3C1DA 2HDCA 1SAXA 2L02A 2PLYA 1QZZA 3V7RA 4RB1A 3MZYA 4Q48A 3TGNA 2UXNA 1AWCA 1WKMA 2MH9A 4L9VA 3L09A 4HOBA 4EJUA 1FYMA 2IW5A 5K1YA 1GHCA 5CVUA 1ON1A 4I98B 4LG0B 5D5UB 4MNUA 3F8MA 4IF4A 3E6CC 2L4MA 1FBQA 5LGNA 3IL2A 5DYMA 2FSWA 5JI6A 1FX7A 1Z9CA 2ETHA 1TNSA 2D1HA 3MWMA 5DDGA 2GAUA 1F4KA 4RB0A 1L0OC 5E17F 4IJAA 4EGYA 3BWGA 3IWFA 1UHWA 3RKXA 2VE9A 3IC7A 3J80Z 4L9NA 5E18F 2XIGA 4XLPF 2G7UA 1XDUA 2QQAA 1SMTA 1W4MA 2RQPA 2ZFWA 3CDHA 4EJWA 2M1BA 3N97A 5HLHA 4BQAA 1KQ0A 1USSA 4CICA 4HW0A 2VC1A 2WC2A 3GXOA 3HOSA 2ZMEA 5EEHA 4MEXF 2GIVA 3MQ0A 4HQMA 2EV0A 1IXSB 3ZMTA 3ZMVA 4A5NA 1B9MA 4OMZA 4M73A 3E5QA 2MLGA 1ZRCA 4A5MA 4UUVA 5BMZA 2MBFA 1F9NA 2XVCA 2OZ6A 3QP5A 1O3SA 4UV8A 3WGIA 3KLOA 5D6FA 2JRTA 3MFKA 5BQTA 4A6DA 1DP7P 5BOXA 4Q5SF 3LWFA 3WTXC 1QNTA 2JZYA 3M7GA 5LEJA 1FC3A 4P55A 3F21A 3KE2A 1FYLA 3T8RA 2A69F 3QRFF 1REPC 3K9TA 4OINF 3ZP5A 1LEBA 5D4RA 3LAPA 4BYYA 4HV5A 2JSCA 1K79A 1YW9A 1R1UA 3KP7A 3GFLA 2E1CA 2JPBA 3BPVA 1ZRDA 5A2QK 2FOKA 1SMYF 5DD8A 2ZBKA 5ERIA 3LQQA 4MHGA 2QENA 2GA2A 1ODDA 4B8XA 1XGSA 1TNTA 3HSFA 4NB5A 4I7HA 3B02A 4ENKA 2XAQA 4I0AA 2ISYA 3OOPA 1LQ1A 3WTUC 1HSTA 4EM2A 1FWZA 5D5XB 1HXDA 1JHHA 1MDMA 4L9JA 1T2KA 2BYVE 2FF4A 2CYYA 5K5OA 1TQIA 1UCRA 3J81K 1FPQA 4HDUA 4G7ZF 1IZ1A 3M9AA 1R00A 4JK1X 5HS7A 2HYGD 3IRRA 1QPMA 2DU9A 4N9HA 1K78A 1KA8A 4L5IA 2Q0OA 2MLKA 2XAFA 2DQLA 1SFXA 1TW3A 1HW1A 2JT1A 3IWZA 2GXBA 4IVNA 3KEQA 4P9UA 2P6TA 2BBYA 1Z6RA 1JXSA 3RYPA 1ZHFA 4PCQA 4WX9A 4KFCA 3HRUA 4EGZA 5IT9Z 1L3LA 2DT5A 5ED4A 4LLNA 3P9IA 3TDZC 2OU2A 2HGCA 1KU3A 3CUQB 1AOYA 4AD9A 4ZYDA 5AIQA 2F5DA 1H0MA 4NHJA 3CLOA 3LFKA 1OYYA 1YIOA 3G73A 3I59B 1FP1D 4G6DA 4I09A 3TO7A 4EJOA 5FFZA 3PFIA 3GFMA 2LF8A 3GX4X 2L01A 4OIRF 2B0LA 2YSRA 5F64A 1R1VA 1CGPA 5FD6A 1CF7B 1ZARA 3S2WA 2VN2A 2W57A 1IN8A 5L3EA 3V8KA 1GXQA 4A0YA 1F1ZA 2A3SA 1PP7U 3WTWC 3R6SA 3FMRA 3HOTA 1TQPA 3F8FA 2XAJA 1T0FA 3FXQA 1HKQA 2EA4A 2XAHA 3H3ZA 1MJBA 2PBIA 2FA5A 4KN4X 4EMSA 1BI3A 4DNCA 2EWNA 2EFPA 3JSPA 4ESJA 4RGRA 1Z05A 1WWXA 1I27A 4A0ZA 2QLZA 4R79A 2X4HA 2R7FA 3Q9VA 2PN6A 5CVRA 5L3DA 2MA3A 1OYWA 2ZCWA 1EV7A 2PFBA 4HF0A 4QLCU 5AONA 5LRRA 4CXFA 4PGGA 1ZH5A 4JBAA 4ENJA 1U3EM 2P6SA 3PQKA 1K78B 2KRFA 1BM9A 3CO6C 4UVAA 3HRMA 1I5ZA 3VODA 2VT2A 5FLXK 3V7SA 1O57A 4L0ZB 3EYIA 1TTYA 1FYKA 1ULYA 1S3JA 3I5UA 5FGMA 4ON0A 3TKYA 1GXPA 4XRFA 4Q47A 3WU1B 5LLQA 2QBYB 3HSRA 3FX3A 4NQWA 2KKOA 1JE8A 4LK0F 2X0LA 5TJJA 5KVRA 4IHSA 4P96A 3TDUC 5D8LB 2V1UA 1FBUA 3E3VA 2YR2A 2HQRA 5D5VB 1ZLKA 1W7PD 2R7DA 2ESHA 1ZYRF 3GUDA 4YIFA 2V1DA 4L9TA 3ECOA 4Z2YA 1J75A 1RIOH 1U6GA 3T8TA 2AXLA 1BN5A 1QBJA 4ZZLA 3RPUA 1S7AA 4U7DA 2V9VA 4OIQF 2M5WA 1HBXG 1XD7A 1V4RA 4L0YB 2FQ3A 1TLHB 2HKXA 2HWVA 2HZTA 1OMIA 3G3ZA 1LNWA 2P4WA 3SHFA 3GW2A 1IUYA 2AS5F 2OA4A 2BEOA 3C3WA 4WF2A 5DEQA 1MZBA 4M9SA 3J81Z 2FU4A 4BHCA 2IP2A 4EQQA 1YW8A 2H09A 1J2XA 2LNBA 4U0WA 4JQFA 1IXRC 1HQCA 1D3YA 3VB2A 1EH7A 1BBYA 2L54A 3KP5A 1IAWA 2HQNA 3WGHA 1MGTA 1ZN2A 3E6MA 4A6EA 1TBXA 1J7KA 3DQVC 1ZLJA 2DPUA 4WXDA 3FHZA 1XSVA 5D8KB 2RV8A 1WSUA 1XGOA 4A12A 5BS6A 2A6HF 4BAYA 1FOKA 2VBZA 4IHTA 1WI9A 4Y15A 3DEUA 1U5TA 1SD7A 3C7JA 1O3TA 2PMHA 2DO7A 5K5RA 3CO7C 4KUMA 1YS7A 2UXXA 5HOOA 4I01A 5ILSA 2GQQA 3KLNA 4KA4A 1RZ4A 2RVCA 2IT0A 1DDNA 1KQ8A 2XV4S 1G4DA 3HRSA 2W24A 2E1NA 3BOQA 4EJVA 5FB2A 5E20A 1Q1HA 1IW7F 1Z7UA 2L4AA 1SFUA 3BJAA 2IJLA 3C18A 1KU9A 2EK5A 4MQ9F 3REOA 5HVQC 3V4GA 2QM3A 5BPDA 2L3DA 1LDJA 5JHUA 3TQNA 1R22A 4YFXF 4LLGF 3K1PA 1YO5C 4HF1A 3I4PA 3K69A 1MD0A 1Z6TA 2DAOA 4HBLA 1KQ9A 1YS6A 4LJZF 4E70A 4IRGA 2DK8A 4KMUX 4BHBA 4QWQA 5HS8A 2LKPA 3CJNA 3F8NA 2TDXA 2JTVA 1SFEA 1FLIA 4O5VA 6PAXA 3EUHA 3GZ6A 1XMKA 3BP8A 4MGRA 2CGPA 2D1VA 2HFHA 3QU6A 3R0JA 1YLFA 3CUQC 2Z5UA 1W7PA 5J6XA 2IA2A 3KP6A 4H0EA 3U2RA 3TOBA 3H3UA 1K7AA 4GCVA 4DQ2A 4PZJA 1T39A 3LQRA 3HYIA 3IRQA 1DUXC 2Z3YA 1IN4A 1OR7A 3VOEA 1IRGA 2XASA 2C6YA 5E8IA 3T1BA 3RJPA 5FFXA 1YYVA 5FLXZ 2FRHA 5ICFA 1YG2A 4YG2F 2HEOA 4CHUA 1VTNC 3WG9A 3JSOA 1KU2A 2XUBA 2QWWA 2K27A 4MTDA 1O3QA 2PEXA 3LSTA 2PI0A 2QQBA 3SFZA 2QZ8A 3GLXA 3DKWA 1IN5A 2DI3A 1U5TB 4BNCA 2J5PA 4WCGA 5F6FA 1U2WA 3CUOA 1IRFA 4RAYA 3BDDA 2PQ8A 1QZYA 5CVIA 3I71A 3U1DA 4EV0A 1P4XA 3E5UA 5LEKA 3E97A 2OQGA 2VBXA 2O6GE 3Q9SA 1ZG3A 2VT3A 4FT8A 2ZMEB 1DPRA 2RDPA 4G9YA 1HKSA 4IRIA 2NRAC 2ESNA 2MC3A 1ON2A 4LGWA 5DCFA 5LRSA 1HW5A 2A07F 4AWXB 1XSXA 4Q4ZF 2DLLA 2EA2A 2YU3A 5LHHA 4XSZF 2P5LC 1P2FA 4AIJA 4U0YA 4IXAA 3I64A 3WTYC 3V7CA 1BOAA 2M8EA 3HUGA 1LDDA 1PP8F 3LA7A 2QVOA 2COMA 2LF7A 1B6AA 3RPQA 3VFZA 2DK5A 1SD4A 3MAJA 5CYVA 3F6OA 2HR3A 2XGXA 4ENMA 1NHAA 1W7PB 4KNYA 2W84A 2H94A 2W85A 2Y0MA 3DFGA 2G9WA 4YIIA 1S6LA 5HDKA 1S8NA 2GZWA 2K86A 3ZPLA 5DUIA 3E5XA 4N9IA 1BI1A 5D6EA 1QQIA 4G94A 1X3UA 2O8XA 1QGPA 5L3CA 1P92A 3R4KA 3LA3A 4HF2A 4L18B 2QQ9A 5KK1A 4B09A 1ZAOA 2HTJA
chains in the Genus database with same CATH superfamily
3G2BA 2IVMA 1MDMB 2ZJ2A 4BL0B 1WJAA 4AM3A 4ZYEA 4ZYAA 2ZSHB 2XGDA 3BZ6A 3HGYA 3BTLA 2WAQN 3GWZA 2LSOA 2XPWA 1N25A 2E2IJ 2NVXJ 3LSPA 1NTCA 1A36A 2PJPA 1R5HA 1TWGJ 2PMZA 3A0HC 3L00A 2LBFA 3S93A 1VFCA 3H1CA 1RUOA 2FMLA 1Z3XA 5FRMA 4H4KC 2K3PA 4HLYA 4XN0A 5M3FJ 4RB2C 3NWSA 3FM5A 4IKFA 2ZKZA 2IS6A 2XKOA 4M71A 1ENHA 4XR6A 1YRNA 2VQHA 2YS9A 3QOPA 3HZJA 4LG0A 2XDVA 3BROA 1XMAA 5F0FA 2VXZA 3DLAA 2VL8A 2E34A 3P5JA 4KIFA 1Z77A 3R60A 3M3YJ 2ELHA 2NS0A 4BU2A 3MZHA 2EH3A 1XN7A 2BY2A 2KJBA 3GTJJ 2CW8A 3DU5A 3H5RA 4XBFA 3WG7H 1DU0A 1UG2A 2GM4A 4Y33A 1NK2P 2DA6A 1BW6A 1WJDA 1D1AA 1ZKGA 1U78A 2CWEA 2IBDA 4W1UA 3GF2A 4OIOF 2VONA 1LEAA 1R4MB 1YW7A 1I3QJ 1H8AC 3BZKA 2BV6A 2PG4A 3OYAA 5L3FA 2ECBA 1I6HJ 1JUMA 4LB6B 4KT5C 2DN0A 2V6CA 4XLHA 2NNYA 3GMEA 4ENNA 1OLTA 3KPHA 3FXMA 3IH2A 1J0RA 4LOCA 3RYRA 2F4MB 2ZXWH 2ECCA 2XHKA 3LMMA 4FE7A 4E7JA 3ZQCA 1TL8A 1VQ5I 2FJ1A 2P7VB 1FTTA 3HBLA 1OKRA 3ULQB 2GXGA 3WTSC 2D45A 3S1NJ 3AFHA 3DPLC 3O6BB 3ZQ7A 3DTIA 3HHHA 3K1NA 3QPTA 3DV8A 2XPVA 1FT9A 1LFBA 1MMAA 2Q2EA 4WXHA 3ISPA 4XK4A 5LD2C 1P4AA 3SDGA 4IEJA 2G7HA 1FZPB 2R7TA 4ZYHA 3OMYA 3H35A 2FMYA 2EFWA 2VJ4A 1HKTA 2EFNA 3KP4A 1D8KA 3SEZA 4MEYF 3FKJA 2PX9A 4UB6C 4LB5A 1W5SA 5L3BA 3DPUA 5JLXA 3CMYA 1X4PA 4MQVA 2DMNA 2OAZA 1JTYA 2O61A 2OZUA 3JRIA 4DJAA 1ERDA 4HQEA 1U8BA 4N4NB 4WWCA 4AVZA 2UWMA 4WXCA 4BEHB 2WB1N 3CC4I 2F5CA 2DQRA 3CTAA 3PFYA 3RIRA 2R5ZA 1XB4A 2L0KA 4O6JA 1U0JA 2OC6A 5LHGA 2JRMA 2VKDA 2DDAA 3EQLF 2NVTJ 1G3TA 1Z0XA 2W1OA 2Z33A 1JJ8C 2V26A 5IY5H 2YPRA 3GZNB 4V19K 3AKZA 2V1XA 2Y48A 4KJZA 1XDSA 3DKYA 1XGNA 1RPWA 3E6BA 3JCUC 3RDIA 3G1LA 4QIWN 2VPLA 2Y69H 2HVRA 5IT3A 1WRJA 3FKIJ 5J8FA 5D5WB 3WTVC 4HYEA 1FY7A 3ECHA 3PO2J 1V3FA 2IRFG 4BH9A 1RESA 1W5TA 4CDGA 4FHTA 3FXLA 3K2ZA 1A6QA 5TRDA 3S2DJ 3WODF 2HNHA 1TT0A 5DD4A 5LBQA 1D5YA 4YRVA 4PUSA 2XAGA 3EDPA 1PUFA 3JRHA 4RLFA 1XCVA 4GFBA 2JPCA 2R7WA 4BXUA 4MFEA 1G59A 2H8WA 4X1EA 1I6XA 1MMDA 3ZMZA 1HDDC 2FBIA 3A1YA 4UB8C 2R93J 2JUCA 2ISZA 1LB2A 1MBJA 5CVVA 2BZTA 1X3ZB 3ABUA 1FOWA 1YITI 5FKKA 3AL0B 1WPKA 2XPUA 1T38A 5IYCJ 2RNGA 2DMUA 5E8GA 4F91B 1KYZA 3WTZA 4CCMA 5AIPA 3QYFA 2EV5A 4ZZDA 1TW2A 1ZR4A 2F2EA 1LVAA 2EZLA 1KYWA 2ID6A 3HHGA 2CQNA 1JHFA 3L2RA 2XGCA 4FQGA 1Y8QB 3KEYA 2LK2A 1I1GA 4I0BA 1MNDA 1MBEA 1FBSA 1E2XA 3RI4A 1SC7A 2DFIA 3K10A 1SD6A 3H0DA 2QGUA 4BDYA 4ZTFA 3C2BA 2A6TA 3H92A 1J59A 2BVMA 1XMXA 1FOXA 4ZDOA 1YQAA 2LBFB 3A2KA 2VJ5A 2QCOA 4S05A 2VXDA 4GYGA 3OSGA 2H6BA 1Y1VJ 4NBQA 1KU7A 2OD5A 3UKGA 1FMVA 3V8LA 4XKCA 3W2VA 4M3GA 3DP7A 3L7WA 2KL4A 3SZPA 1B4AA 2VE8A 3NWTA 3HTUA 2F5EA 2G0EA 3IHUA 5L3GA 3JW4A 2ZO4A 1G6NA 5GTHC 3IUOA 1O7FA 4E7SA 2KJCA 4CCOA 4HRIA 2B7EA 4DZPA 5GAGJ 5EEGA 3JRCA 1I1SA 3O2PE 2DOAA 3GO5A 5E1XA 2QUFA 2KT0A 1BI0A 2VI6A 3K70D 5D4SA 2GLOA 2OQRA 2CW7A 1X2NA 2GA1A 2L7MP 2EILH 1T6SA 3U9GA 3COAC 3BR6A 3M1EA 3OIPA 2CMPA 4NQWB 4EVIA 5BPIA 1POGA 3RCOA 4HLXA 1B1BA 3S3MA 2P7CB 1Y8RB 3BPXA 4LMYA 2XKPA 1JGSA 1UG0A 2Y0SA 2HPIA 2X6YA 4P5OA 4CZCA 2HOAA 3CJTB 1Y0UA 3CJRB 3DPTA 4I02A 5H20A 4BKXA 3TOAA 1U5TC 3GVAA 4M3FA 1R5ID 2NOJB 4HEA2 1DQUA 2VBYA 1B9NA 3M8JA 3FBIB 1R58A 3ASNH 3RKWA 3QU3A 3GFIA 1PUEE 4X0GA 3NEUA 3KZZA 2V79A 3M8EA 4V2GA 2DYSH 3ML6A 4Y3OA 2R5YB 3LSRA 3F22A 3SEQA 3BJ6A 4U88A 3I55I 2FEZA 2YUSA 2ZSIB 1XCBA 4PGHA 4OU0A 2GWRA 4CO8A 3V8JA 2LH9A 1RI7A 2E36A 2JWTA 1IXCA 2X85A 3TBIA 2VC0A 4I6ZA 1D5VA 3FDYA 4UVBA 4YFNF 2L5QA 2A61A 4YEJA 5B1BH 1GLNA 2XC7A 2M4GA 3JAMZ 4RM3A 4RAZA 2BY0A 3N4MA 5GPCA 3CUQA 3ZMDA 2DA4A 3QODA 2EIKH 1DPUA 2R5ZB 2MD5A 2QF7A 2ZMEC 4PJJA 4R1HA 2BXYA 2EBIA 4HNVA 4RA2A 2VOOA 2IA1A 2M3AA 1ETQA 3WGGA 1Y0NA 1ZGJA 2CQ7A 2FBHA 1ZQ3P 4UV9A 2M4KA 2BXZA 1PDNC 4G8XA 3I59A 1X1PA 3AAFA 2R7VA 1RR7A 3E1SA 5J8CA 3M8FA 1G3YA 1VQ8I 3HJEA 4OWRB 4HZFA 4Y17A 1YTYA 1F5TA 4Y4RA 2YX7A 3ELKA 4KISA 2JA7J 4K2EA 5EDNA 3ZN1A 3ZQQA 2M9HA 3L1PA 3GEZA 2KIMA 1G2HA 2K85A 2HZDA 1PUFB 2NVYJ 2YX4A 1UHMA 1R36A 3SYTA 1K6OA 5HDNA 1OCOH 4M6YA 1OJLA 1ZG1A 4AC0A 3QPHA 4DYRA 1EH6A 3GFJA 1K6YA 3DF8A 4RGXA 2VPRA 4KT6A 1CF7A 1FEXA 2ZNYA 3IAM2 1U8RA 3KCCA 3KZIC 1LJ9A 4X6AJ 1B72B 4A3JJ 3ABTA 1IDYA 2CUJA 2H6CA 3EUHC 1SFOJ 2TCTA 3FM3A 3R0AA 4M9ZA 3A01A 1ZG5A 1T08B 1HLVA 4LD5A 5FJ8J 3ZMSA 5FO5A 1ZRFA 4EM0B 2P81A 2M87A 3C2GA 2HOEA 1WJCA 2M45A 4I99C 3PQJA 3BTCA 3K7AJ 2QA4I 4G7OF 2QKLB 2Y75A 1OCTC 2R7SA 2X1CA 5HLGA 2STTA 4UUTA 3DCFA 1FSHA 1QO0D 2K02A 2DTZA 4A2UA 4ETSA 2KMUA 4CYCA 2H27A 3S15J 3OV8A 4AVPA 3L2UA 2PJRA 2HYFA 4ZYGA 5LHIA 4CUGA 3K4JA 1C0WA 1RNLA 4M74A 3H9JA 4NDLA 3HKZA 2LLKA 5EF6A 1S7OA 3P9CA 5E3OA 4RGUA 5DV5A 4M72A 3P7NA 4Y13A 2AHQA 3K0LA 4EM1A 1WFXA 5M5XJ 3D5LA 3FMSA 4CYDA 3WE2A 5B1AH 4E7IA 4FX4A 3Q5FA 2STWA 1Z21A 3WU0A 3R61A 4G7HF 2IA0A 1BI2A 3FXOA 2CQXA 5ILVA 1J9IA 4HX8A 4P9FA 1VZ0A 3KZYA 5IOZA 2D2WA 4C3IJ 3FXJA 3IP4B 3J7YJ 2GXAA 4HX4A 2EFOA 1OYIA 4ASNA 3KEOA 1IRXA 3QYEA 3JTGA 3GYHX 2W25A 1WGXA 1MJ9A 2BE5F 2J5OA 3ZQHA 3F8BA 1SVOA 4LIUA 1Z91A 4U0VA 3CP2A 3CP8A 1IDZA 2FNAA 2EJRA 3K4MA 4HV6A 3HRTA 4DW6A 3I53A 1B8IB 3GTGJ 1GUUA 2O3FA 1IN6A 2BHZA 1O7LA 4B4CA 3Q0WA 1MIJA 2F5FA 2HKOA 5F0HA 3SQNA 1D0XA 2A5YB 4C2TA 2Z99A 1AKHA 5J4VA 3O3KA 1A35A 3HSEA 1Y56A 1GVJA 2X1DA 3KX2A 1BA5A 4KDPA 4YIRX 2A68F 3KETA 1WJBA 2V7FA 5HLIA 5H6RA 1JGGA 1JKRC 2XROA 1R5GA 2QBYA 2XB5A 3MKLA 2WTEA 4RBOA 2CW0F 1TQMA 3ERED 2CFXA 4A0XA 4B3XA 3F8CA 2IGNA 1R9TJ 2XRNA 2DJNA 2RGVA 1JT0A 4GYIA 5K7HA 4F93B 2LTPA 2DBBA 1USTA 3W6JB 1PYVA 3FIWA 2VBWA 3MVPA 3OYNA 3CF5F 3HB9A 1FIAA 2K7LA 4CA0A 1XC5A 4XLCA 3J80K 3ESWB 2E7XA 3GZ5A 5J47A 1FNNA 1TT5B 4N0BA 1IF1A 5E3NA 1T56A 4M9XA 4PDKA 5EYRA 3I54A 3OL3A 4LLLA 4LK1F 2FNPA 3QAHA 4FISA 3IKTA 1MKMA 3IKVA 2A6EF 4L5JA 5LGUA 3LNQA 2LD5A 4G6QA 3EETA 2MFZA 2RNJA 2R4GA 3MCZA 1YX5A 4UVCA 1D1BA 4F55A 3LOCA 3S3OA 4KICA 1YJ9I 9ANTA 2O03A 3NRVA 4UXNA 5LGTA 3T5XA 1LE8A 3U21A 4B3AA 2EV6A 2RREA 3P9KA 3AG1H 1O3RA 2HTSA 1NH3A 1V55H 2R3SA 3CLQA 4BXXJ 4KIGA 3D0SA 4BS9A 1WH5A 1J5YA 5DCMA 1ZELA 3OR2C 2WBMA 4OOIA 3BR5A 2QYOA 3F3XA 3SZGA 2CH0A 3K1MA 4ZTJA 4YFKF 5EG0A 3JRBA 2BGCA 4M3BA 3GTMJ 1Y6IA 2RAEA 2MSYA 2RKHA 4OIPF 2FXAA 5FROA 4NC8A 2O0YA 3Q3SA 3QP6A 1W36D 5E1WA 3S1RJ 4AIHA 3JAMK 2A05A 1VNDA 1BIAA 1TWAJ 1YFHA 2M30A 3F6VA 1IGNA 4HNTA 1FP2A 4XONA 4CGZA 1HCRA 2PMUA 5ILUA 1VQNI 5EJCA 3B73A 4MLOA 1P6RA 1IN7A 1WQ2A 2NXNB 3HC7A 3QPLA 5H6QA 3MEXA 3E6DA 4CCNA 4A3EJ 3FZVA 3I58A 4U7BA 2WWYA 2BVLA 4EJTA 1OCRH 1TWFJ 4BJ6C 2X1EA 4A3KJ 5FKLA 1KGSA 3F72A 1S29A 1SD5A 3SZTA 2OUMA 2L9SA 4HAMA 2E2HJ 1G3WA 3LL7A 4AIKA 1MSEC 3HEFA 3TO9A 2E71A 2ZJPF 5C3EJ 2VODA 4IPAA 4RS8A 1RUNA 3ZQLA 2CSOA 4CYCB 4D5CA 2O7OA 5E1ZB 1MMSA 3ZMUA 2L9NA 1FSEA 2K4JA 1STZA 2FBKA 3MD2A 3HIFA 2ZXJA 3LAJA 2VKVA 1T0FC 2V1NA 2KDZA 5FKNA 1EH8A 4IRHA 2E2JJ 1LKXA 3PIOF 2RC4A 2E7WA 4LFUA 3VYTB 2DPDA 2R7ZJ 3L2QA 2DA3A 4ANJA 2P5KA 1UB9A 2VOPA 1Z1DA 1XGMA 2X48A 1ETWA 2CQQA 4BE1A 2ACJA 2W82A 3M07A 4JP0A 2L7ZA 2OCEA 4R8HA 2LKXA 2CQKA 3KP2A 4BY7J 3AL0C 3WTTC 3SXYA 3PUFA 3ZN0A 2MC4A 4KYWA 3L9FA 4M6XA 2L9RA 3CC2I 4A3LJ 3H0GJ 1LDKB 4RGSA 1H9GA 3FXRA 2Z2SB 2P0WA 5LFAA 3EYYA 2NAZA 2H8RA 3VYRB 1YOVB 2HS5A 4GXOA 1G3SA 5JFRA 5M3MJ 1BC7C 2OTLI 2MW8A 4JX6A 1OPCA 3RKYA 4ZH4F 3HOYJ 3FMQA 4E7LA 2GOMA 1YX3A 2NYXA 5HDGA 4CZZA 3KP3A 5ICEA 1IG7A 3LSHA 1FJLA 2P8TA 1BJAA 3AG3H 1ZREA 3UNGC 4XLNF 2DMTA 4XM3A 3HGGA 3SFIA 3JTHA 4XSXF 1XSDA 5JR3A 5M5YJ 4WK8F 3FXUA 2EFQA 3ABMH 3BZCA 2Q8KA 5C4JJ 2CO5A 1ZGAA 1BIBA 2ELKA 3QOEA 2LDUA 3J7AO 5HS9A 2JJ7A 4XQFA 1H9TA 1MSFC 3I0TA 4I2OA 2CG4A 1Q1VA 3DLLF 1TZLA 3S8PA 3GBGA 1E17A 3KFWX 3A4CA 2VQCA 5DM6F 3L2CA 2IS4A 1UMQA 1FTZA 3OYCA 2JVHA 3W6KB 1QPIA 3PJRA 5DUKA 3SJMA 3GTKJ 3FF5A 1P4WA 2LMDA 2OBPA 2ZNZA 3OIOA 2EB7A 4ESBA 3BJOA 2UZKA 2V9PA 1R7JA 2LP0A 2KIFA 1HW2A 3HUGB 2ADUA 2F4IA 4O3MA 5F1RA 5ICCA 2P5VA 3QQAA 2IPQX 4F7ZA 3BCBA 3OIQA 2KZVA 4ESFA 4KMFA 1IC8A 3NQOA 4FX0A 2VUMJ 3S32A 1YJWI 4A3MJ 3RQIA 1Y1WJ 3BCAA 2CV1A 1RKWA 4RB3C 1ONVA 3NAUA 1HSJA 5K5QA 5FD5A 3HTSB 2K9NA 4XLFA 1R23A 5IPAA 5EGOA 5C4XJ 3BY6A 4FTHA 2NNNA 5CVJA 2E5ZA 2UUZA 4C9YA 5A2QZ 2B9SA 2Z9OA 1H89C 4XIDA 1BW5A 2RN7A 3FK6A 4HX7A 3D5RC 2R0QC 4UY8I 1HOMA 3VEPA 1UJ8A 2DTRA 2KZGA 3DXJF 3CMAI 1MJAA 4PK4A 3FWEA 5DCMB 2IAIA 3KYDB 1G8XA 4UHTA 4AU7A 4MTEA 4UNOA 2WV0A 5DM7F 1OFCX 1UFMA 1D8JA 5CJ9A 2MH2A 1B59A 3H36A 5CLSA 5CQGA 3ROUA 3TO6A 4GO1A 4KITB 4KIBA 2K4BA 4OMYA 3FXKA 5IT9K 4HNUA 5IP7J 2BW3A 3CZ6A 1T98A 1A04A 4XNFA 3WE3A 2HU9A 3RZOJ 1R1TA 1P7IA 4HDVA 3ABKH 4QPOA 3RTRA 4S04A 5TISC 3F23A 2DW4A 2M0MA 1IO2A 4BHPA 1W0TA 3TMOA 4TV7A 3LA2A 2AQEA 2FE3A 1K4TA 4B48A 2KIUA 4GGGA 3T0YA 1Z3YA 1IV6A 4BUPA 1S7EA 5ICGA 4KN7X 3ABLH 2K9SA 2KQRA 1VQLI 2Y31A 5FLMJ 4HA8A 4D0PA 1MMNA 1BC8C 4Y52J 5JVTA 3C1DA 3BG7A 2HDCA 1EF4A 1SAXA 2L02A 2PLYA 1S9HA 1QZZA 3V7RA 4RB1A 3MZYA 4Q48A 3TGNA 2UXNA 1MBGA 1ETYA 1AWCA 1WKMA 2MH9A 4L9VA 3L09A 4HOBA 4EJUA 4J01A 1FYMA 3W3CA 2IW5A 3JRAA 4BBSJ 1MBKA 5K1YA 1GHCA 5CVUA 1ON1A 1FIPA 1YRNB 4XRSG 2EZHA 4I98B 4LG0B 5D5UB 4MNUA 2V9KA 3F8MA 5F0CA 2HQAA 4IF4A 3E6CC 1DGWY 4RM2A 2L4MA 1FBQA 3H3VK 3MZ8A 3E7LA 5LGNA 3IL2A 5DYMA 2FSWA 1R71A 2ZXIA 5JI6A 1FX7A 1Z9CA 2ETHA 3DWLE 3MMYB 3ZR8X 1TNSA 4ZDLA 2D1HA 3MWMA 5DDGA 3TW6A 3FISA 2GAUA 2NOGA 2W4SA 4XRSA 1N75A 4RB0A 1L0OC 1F4KA 5E17F 3J7AY 3KYLA 4IJAA 4EGYA 4B43A 1SVLA 3BWGA 1GV2A 3IWFA 1UHWA 1TWCJ 3RKXA 2VE9A 3IC7A 5FLVA 4II3A 1F36A 3BR2A 3J80Z 1HC8A 4L9NA 2LFBA 3E0JB 5E18F 2XIGA 2JA2A 1WJ5A 3OS1A 1OCPA 3F9KA 4XLPF 2G7UA 4RDUA 2OJED 3O8GA 1APLC 1XDUA 2QQAA 1SMTA 2HPMA 2CV2A 1W4MA 2RQPA 2ZFWA 3CDHA 3OWTA 4EJWA 2M1BA 3OSFA 3N97A 1YI2I 5HLHA 4XN3A 3MN2A 4BQAA 2H1KA 1KQ0A 3FBNB 1USSA 1ZTRA 4CICA 2Q2EB 4HW0A 2R92J 2VC1A 2WC2A 1UAAA 3GXOA 3HOSA 2ZMEA 3CESA 3OY9A 5EEHA 2DA7A 3BC8A 1VQKI 4P1WA 2FUG2 1PVEA 2VLAA 4MEXF 2GIVA 2KDOA 4AYBA 3MQ0A 4HQMA 2EV0A 1MH3A 4BE2A 1IXSB 4IOAF 1V5EA 3ZMTA 3ZMVA 3DBRB 2DFFA 2MYSA 2LY1A 1RRJA 4A5NA 1B9MA 4OMZA 4M73A 3E5QA 2F4OB 2MLGA 3LSGA 2V4JC 3CJQB 1T95A 2HI3A 2WY7Q 3K4CA 4LITA 5BNGA 1ZRCA 4A5MA 4DGWB 4XKVA 1VQ7I 4DIQA 5BMZA 4UUVA 4IL6C 2MBFA 3BT9A 2L7KA 1A5JA 1F9NA 2XVCA 2OZ6A 2N8GA 2R7QA 2XSDC 2FD5A 3QP5A 1O3SA 1TC3C 5M5WJ 4IHVA 1QHGA 1N77A 2CUFA 3LFUA 5EGOB 3CC7I 1F43A 4XLEA 3K2AA 4HG2A 4UV8A 3WGIA 3KLOA 5B66C 5D6FA 5J40A 1XPXA 3CCMI 3J7ZI 3TP0A 2JRTA 4BDZA 3MFKA 3OR1C 5BQTA 4PJLA 4A6DA 2E35A 2HDWA 1DP7P 5BOXA 1N78A 1JUPA 2DOEA 4Q5SF 3LWFA 3HPHA 3VDXA 4I76A 1JJ6C 3WTXC 1QNTA 2GOXB 5KAFC 1QA6A 3G1OA 1RKTA 2JZYA 3M7GA 4CH7A 5LEJA 2BW3B 2DDBA 5C44J 1FC3A 4P55A 1SAUA 3F21A 1JUSA 2CUZA 2K9QA 3KE2A 4E7HA 4UUSA 1FYLA 3T8RA 2W7NA 2A69F 3QRFF 1REPC 3K9TA 4OINF 3ZP5A 3ZQGA 5KHDA 1LEBA 5D4RA 3PSFA 2LY9A 3OL4A 3LAPA 2JN6A 2Y30A 3PO3J 4BYYA 3KIOA 4HV5A 2JSCA 1RR8C 1K79A 1YW9A 1R1UA 1PJRA 3JR9A 2EIJH 3KP7A 3GFLA 1BL0A 2QSHX 2NVQJ 2E5NA 3B6AA 3OYEA 2E1CA 1SVMA 2JPBA 4C3JJ 3BPVA 1ZRDA 5A2QK 4JX5A 3CCJI 2FOKA 2JA8J 1SMYF 3W6VA 1IUFA 1RC9A 5DS9A 5DD8A 1V5GA 4JX4A 2O8KA 1E3PA 3I9V2 2ZBKA 5HNFA 3BTJA 3BQYA 5ERIA 3LQQA 2D5VA 1UHSA 4MHGA 2JSPA 2QENA 2GA2A 3TW7A 1KZHA 2JA5J 2BY3A 3H9QA 1ODDA 4B8XA 2BOLA 1BR4A 1UZCA 1XGSA 2MGQA 1TNTA 3HSFA 4NB5A 4I7HA 3B02A 1MNMC 4ENKA 2XAQA 4I0AA 2ISYA 3OOPA 1LQ1A 3WTUC 1YIJI 1HSTA 4EM2A 3DEEA 2L7FP 1FWZA 5D5XB 4GRIA 2DMPA 4JYKA 1HXDA 1OR7C 2JA6J 1JHHA 1MDMA 1X1CA 2VKHA 2Y0SN 4L9JA 4RMNA 1QRYA 1T2KA 2BYVE 5F04A 2FF4A 5CQEA 4XICA 2CYYA 5K5OA 1OCZH 4PJMA 4EATA 1TQIA 4L5EA 1UCRA 1S5LC 3J81K 3U1KA 2VKEA 2JK3A 2OCCH 1FPQA 1XS9A 4HDUA 4G7ZF 2W00A 1IZ1A 3M9AA 1R00A 2NS8A 4JK1X 5HS7A 2HYGD 1X3WB 3IRRA 1QPMA 2DU9A 2IXSA 1X1AA 3OYJA 3S1QJ 2KRHA 2JVGA 3CCYA 4N9HA 3ZQIA 1K78A 4OAZA 1KA8A 2Y2ZA 2K40A 1LFUP 1GV5A 4L5IA 1OCCH 2Q0OA 2MLKA 2HOSA 4MFDA 2WAQA 2XAFA 2ID3A 2DQLA 1SFXA 1TW3A 1HW1A 3GTOJ 3M1CA 3S3NA 2JT1A 4M6VA 4NUBA 3IWZA 5KNLA 2GXBA 4IVNA 3KEQA 4XOTA 1W0UA 3HXLA 2P6TA 4P9UA 2BBYA 3TL4X 5IP9J 2OPTA 1Z6RA 4BACA 3K4KA 3G6EI 3RYPA 1JXSA 1ZHFA 4PCQA 3N05A 1VQMI 1FOYA 4WX9A 4BXFA 4S0HB 2IEKA 4KFCA 1D1CA 3HRUA 2O5RA 2E60A 4EGZA 5IT9Z 1L3LA 2DT5A 4C30A 5ED4A 4LLNA 3P9IA 4CCLA 3TDZC 2OU2A 4DYCA 1U9OA 1DU6A 2HGCA 1KU3A 3CUQB 1AOYA 4AD9A 2AQFA 4ZYDA 3S16J 1M1EB 5AIQA 2F5DA 1ZGWA 2RQQA 1H0MA 4A93J 2EIMH 4NHJA 1WZ2A 3EUKL 3CLOA 4EEFG 3LFKA 1I39A 4QPQA 1VI0A 1VQ6I 1OYYA 3CMMA 1YIOA 3G73A 2W48A 3I59B 1FP1D 4AIDA 1S72I 3NARA 3ZGKA 4G6DA 5F08A 3CDIA 2WAFA 2I10A 3JREA 4MIMA 4I09A 3TO7A 1KONA 4BEHA 4EJOA 2XF6A 3PFIA 5FFZA 3GFMA 1D0YA 2LF8A 2L01A 3GX4X 1JKOC 4IZZA 4N4OB 1Z7LA 2M2EA 3QWLA 4OIRF 2B0LA 3K70C 3HM5A 4C2UA 2LRDA 4XRMA 3K4LA 4W97A 1WJEA 2YSRA 4A3DJ 1X58A 2QKMB 3M4OJ 5F64A 1R1VA 1CGPA 3CCLI 5FD6A 2HVSA 1CF7B 1ZARA 3S2WA 4ABZA 2VN2A 2EQRA 3I4NJ 4XMYA 5HNHA 2W57A 5F27A 2XRLA 1IN8A 3TP3A 5L3EA 3V8KA 1GXQA 2R7RA 3HKZN 2LKSA 4A0YA 1F1ZA 2A3SA 2WB1A 1PP7U 3A01B 2XF5A 3R6SA 3FMRA 3WTWC 3HOTA 4IX7A 1R49A 2DCEA 1TQPA 3BQZA 3F8FA 4A3GJ 2XAJA 1T0FA 3FXQA 2LVSA 1HKQA 2EA4A 2XAHA 3BR1A 3H3ZA 2CUEA 5J1YA 2YU9J 1MNEA 1MJBA 2KISA 2EINH 2PBIA 4F3QA 2FA5A 4KN4X 4EMSA 1BI3A 5EZGA 4DNCA 2DA1A 1ZK8A 2EWNA 2EFPA 3JSPA 4ESJA 4RGRA 4BBRJ 1LVKA 5K7ZA 1Z05A 3PL8A 2IGMA 2PJRB 1WWXA 1I27A 3VPRA 4A0ZA 2QLZA 2VJIA 4BQOA 2X4HA 4R79A 3CCUI 2R7FA 3WU2C 2LG4A 4JOMA 3Q9VA 3SDBA 4J00A 2PN6A 4CCJA 5CVRA 1EJ9A 5L3DA 2MA3A 1OYWA 2ZCWA 1EV7A 4BY1J 2PFBA 4HF0A 4YELA 4QLCU 5AONA 3Q0VA 1ETXA 5LRRA 4QSHA 4CXFA 4PGGA 1ZH5A 1A31A 4G6TB 3RQ4A 4JBAA 3CCRI 4ENJA 5E79C 1U3EM 4Y7NJ 1E3HA 1JKQC 2CRGA 1SEUA 4IO9F 1W5CC 2B63J 3VSKA 2P6SA 3PQKA 3DKXA 3ZXSA 1K78B 1H88C 2KRFA 1BR1A 2KRCA 1BM9A 4M3DA 3JRGA 3CO6C 3ONQA 4UVAA 2F5VA 3HRMA 1I5ZA 1QZEA 2AO9A 5GAHJ 2GIZA 3H5NA 3VODA 3CMEI 2VT2A 3PNTA 5FLXK 3V7SA 1O57A 4L0ZB 3EYIA 1TTYA 2WV1A 5GPAA 1ULYA 4BJ5C 1FYKA 1OQYA 1AKHB 1S3JA 1MH4A 2CJJA 3I5UA 3S14J 5FGMA 4ON0A 4FCYA 1ETVA 1XTAA 3VYSB 3TKYA 2ZJQF 1GXPA 4XRFA 1CQTA 4Q47A 2HOTA 1OISA 5IYBJ 2WY8Q 1IRZA 3WU1B 1R6RA 5LLQA 2HVQA 2QBYB 3HSRA 3FX3A 4NQWA 2DA5A 2KKOA 3F0CA 1P7JA 4LK0F 2X0LA 1JE8A 2L2OA 5TJJA 2HDDA 5KVRA 3PUBA 2O9LA 1AU7A 4IHSA 2MD0A 3BR3A 2IS1A 4P96A 4HSRA 4A69C 3TDUC 4FASD 5GP9A 5D8LB 4BE0A 5H2FC 1HA8A 4XL9A 1YJNI 2V1UA 2R5YA 1FBUA 3E3VA 2YR2A 2X9DA 2HQRA 4RLQA 2KLOA 5D5VB 1ZLKA 1W7PD 5DTDA 2OTJI 2R7DA 2ESHA 1ZYRF 3GUDA 2X6WA 2QEXI 4YIFA 2ZB9A 2DYRH 2V1DA 4L9TA 1LE8B 2ZFUA 1JTXA 3ECOA 3AG2H 4Z2YA 3W2AA 4DBQA 2Q1ZB 1J75A 2DFEA 1RIOH 3DTKA 3A02A 1U6GA 3T8TA 2AXLA 3ZQFA 3L2WA 1BN5A 1U9NA 1QBJA 5E3MA 4E6KG 4ZZLA 3RPUA 1S7AA 4U7DA 2V9VA 2OV7A 4D9JA 4OIQF 5EG0B 3HL2A 4IQJA 3BG3A 2VB6A 1X19A 2M5WA 1WI3A 1XD7A 4BQNA 1HBXG 1V4RA 2M7BA 4RAFA 5EZHA 1X4OA 4L0YB 2FQ3A 1TLHB 2HKXA 3RSNA 2HWVA 2HZTA 1AA7A 1OMIA 5J4YA 3HPGA 2Y9YA 3G3ZA 1LNWA 3S1MJ 2EPFA 2P4WA 3SHFA 5HODA 3GW2A 3S17J 1IUYA 2BHYA 2AS5F 2PMZN 2OA4A 2DT7B 5GADJ 2BEOA 1MBFA 3C3WA 4WF2A 1MMGA 5DEQA 1MZBA 3D1NI 4M9SA 2JMWA 3J81Z 2FU4A 4BHCA 2IP2A 4EQQA 5FKOA 1YW8A 4A3FJ 3FHNA 2H09A 1J2XA 4BQQA 3PM1A 2LNBA 3ASOH 4U0WA 4JQFA 1IXRC 1V54H 1HQCA 1D3YA 2COBA 4XOPA 3VB2A 1EH7A 1BBYA 2Z16A 1LFPA 2L54A 3KP5A 2VQLA 1E0EA 1IAWA 2HQNA 2K3FA 1B72A 3WGHA 1MGTA 2LC2A 1ZN2A 3E6MA 2UV1A 4A6EA 3G4SI 1TBXA 2XB0X 4XKWA 1J7KA 3DQVC 4IHWA 3GCMA 3BTIA 3I4MJ 3PNVA 4LIVA 1ZLJA 2DPUA 4WXDA 3MKZA 3FHZA 1O4XA 1XSVA 2HXOA 4NNJA 3HG9A 1MW7A 4U87A 1BR2A 5D8KB 2RV8A 5K7FA 2MABA 1WSUA 2BY1A 4PSXA 1XGOA 4A12A 2FX0A 5BS6A 3X2QH 2A6HF 4BAYA 1EA3A 1FOKA 2QSGX 3ZRGA 2JQ7A 5CPRB 2VBZA 4IHTA 4IHXA 1WI9A 4XORA 4Y15A 1VF9A 3DEUA 4E7ZA 2F6CA 1U5TA 3EUAA 1GVDA 1SD7A 1UELB 3C7JA 1O3TA 2PMHA 2DO7A 5K5RA 3CO7C 1J09A 1ZR2A 1WVRA 4KUMA 2KHMA 3K4NA 1YS7A 3CCQI 1Y39A 4A3CJ 2UXXA 3OYGA 2A5WA 5HOOA 4HPQA 2CV0A 2KP6A 1IJWC 2FOWA 3RKQA 2E1OA 3A03A 4I01A 1W36C 4M3EA 2LYCA 5ILSA 3JRFA 3GLLA 2KIQA 3CDLA 2GQQA 3KLNA 4NC7A 1RZ4A 2RVCA 3ZOBA 4DYQA 3MKWB 4KA4A 1DDNA 2IT0A 2V6EA 1KQ8A 3GTQJ 3DTEA 2MG4A 2DA2A 2XV4S 4D1QA 4IHYA 1G4DA 3HRSA 1QVTA 2E1NA 2W24A 3BOQA 4AUXA 4EJVA 5E20A 5FB2A 1Q1HA 2NS7A 1VQ9I 1B8IA 3OYDA 1IW7F 1Z7UA 2L4AA 2X6OA 3UR3C 5J1UA 1SFUA 3H9GA 4J19A 1NG7A 3CD6I 3HOVJ 3BJAA 2IJLA 1R4NB 3C18A 3I3LA 1KU9A 2EK5A 3Q0UA 4MQ9F 3LSIA 2ICWG 3REOA 5HVQC 3V4GA 2QM3A 3HOXJ 5BPDA 5JHFA 2VIXA 2IGOA 3PSIA 2L3DA 1LDJA 5JHUA 1JT6A 1Z67A 4ZJZA 3TQNA 1R22A 2NVUB 4LLGF 4YFXF 3OYLA 1WHUA 2VQGA 3K1PA 3OYIA 1YO5C 4HF1A 4DBRA 4PFOA 3I4PA 1EKEA 2DOFA 5E3LA 3K69A 1MD0A 1Z6TA 2DFHA 2DAOA 4HBLA 3BR0A 4D7MA 1KQ9A 1YS6A 2E1MC 2ME0A 4FETA 4LJZF 5IP6A 4E70A 1ITYA 4IRGA 2DK8A 4KMUX 4BHBA 4QWQA 4B1RA 5HS8A 2LKPA 3CJNA 4D5FA 3LSKA 3F8NA 2TDXA 2ZXHA 3EPZA 1K4SA 4PFPA 2Z1DA 4A3IJ 3GTLJ 3GTPJ 4CSWA 2JTVA 1SFEA 5HLTA 2GBYA 1FLIA 1MBHA 2QQ8A 4O5VA 6PAXA 3EUHA 3GZ6A 1XMKA 1QU3A 3BP8A 5JVGF 4MGRA 2CGPA 5IOYA 2D1VA 2HFHA 3QU6A 3R0JA 1YLFA 2X51A 2HXIA 1TWHJ 1X2MA 2WADA 4II2A 4F92B 3CUQC 1LPQA 1A6IA 2Z5UA 4ZC3A 5EEAA 4MO7A 1W7PA 5J6XA 4LG3A 2IA2A 4PSWA 1I50J 3CQZJ 3KP6A 4H0EA 3U2RA 3G1MA 1SFKA 3TOBA 3VYUB 4V2FA 3H3UA 3OYHA 1K7AA 5F1JA 4GCVA 4DQ2A 1GDTA 2M0CA 4PZJA 1T39A 4ZDPA 3LQRA 2AXTC 1NK3P 3HYIA 2DXIA 3IRQA 1DUXC 1HF0A 2Z3YA 4QTRA 1IN4A 1OR7A 1WJFA 2OF7A 2CU7A 3VOEA 5FRNA 2XASA 1IRGA 2C6YA 5J3LA 5E8IA 1ORKA 5GAEJ 1YE9A 3T1BA 2DMQA 3RJPA 4PJ0C 5FFXA 4Z6YA 1AHDP 2ELJA 1YYVA 5FLXZ 3KYCB 2FRHA 5ICFA 1ETKA 2EZIA 2H1LA 1YG2A 4YG2F 2HEOA 4CHUA 3W2WA 1VTNC 3WG9A 2CS3A 2I8DA 3JSOA 1KU2A 2XUBA 1JI8A 1P9QC 2QWWA 3OYFA 2K27A 4MTDA 1VQOI 1O3QA 2PEXA 3IAS2 2EZKA 3LSTA 2R7XA 3HOZJ 3OYMA 2PI0A 2WA0A 2QQBA 1ETOA 3QPSA 1NG6A 1QVUA 1TP4A 2QZ8A 4PJNA 3SFZA 2R7UA 4DOZA 3GLXA 3DKWA 1IN5A 5TGTA 2XF7A 1XX5A 2DI3A 4OAYA 1LUJB 1U5TB 2M8GX 3BG5A 1VQPI 4BNCA 2J5PA 3QYBA 3ERMA 4WCGA 2ZJRF 3OYBA 5F6FA 5GTIC 3OS2A 3VWBA 1K83J 1U2WA 3CUOA 3D5SC 4XLAA 3S2HJ 2XGEA 1X1BA 4AYBN 2KFDA 4GDFA 1IRFA 4RAYA 3BDDA 3H5AA 2PQ8A 2VJJA 1QZYA 1E3OC 1VQ4I 4CCKA 5CVIA 4D7NA 1IV8A 3I71A 3U1DA 4EV0A 1P4XA 3E5UA 2X6XA 2TRTA 3CF2A 5JLWA 3I56I 1WH7A 5LEKA 2E1MB 2LY2A 3E97A 3PIPF 2OQGA 3TEDA 2VBXA 3B6CA 3Q9SA 3L2VA 2O6GE 1ZG3A 4E7KA 2VT3A 4FT8A 2ZMEB 1DPRA 2L9VA 5KCMA 3AG4H 2RDPA 2QSFX 4G9YA 1HKSA 5KAIC 4F52A 4IRIA 2NRAC 2M34A 2ESNA 4C3HJ 4HSTA 2LOOA 2MC3A 1ON2A 4LGWA 2XAUA 5DCFA 2E19A 3RPUD 4B47A 3BG9A 2HQ5A 3K6GA 3OOUA 3HOUJ 5LRSA 1HW5A 3C2HA 1X1DA 2A07F 1DP3A 4ITVA 4AWXB 3DU6A 4FE4A 1T33A 2CFOA 1XSXA 3G71I 4Q4ZF 5CKTA 2DLLA 3DEWA 1RETA 2EA2A 2YU3A 5LHHA 2DODA 3IH3A 3IV5A 2K5CA 2K9MA 4XSZF 1HDPA 2P5LC 4B44A 1W1WE 4IOCF 5IYDJ 1P2FA 5B3SH 4A3BJ 3LSMA 4AIJA 4U0YA 3JRDA 4IXAA 3I64A 3WTYC 3V7CA 1BOAA 2M8EA 1ACIA 3HUGA 2HYJA 1I3AA 2VASA 1LDDA 5B5EC 1PP8F 2M7AA 2QVOA 3LA7A 1JKPC 2COMA 2LF7A 3O8HA 1BOBA 1YHQI 1B6AA 1GT0C 2I5UA 4BJTA 3RPQA 3VFZA 2FQ4A 2DK5A 1SD4A 3ZCOA 3HOWJ 3MAJA 3WHBA 5CYVA 3F6OA 1BJZA 3DBLB 3BLYA 4IQ4A 1XG1A 4RAGA 2K9LA 4UUSB 1WCMJ 2DJIA 2HR3A 1V5FA 4NC6A 2XGXA 4ENMA 1NHAA 3HDDA 1W7PB 2R7OA 4KNYA 3BG6A 4BGDA 2W84A 3IH4A 2H94A 2W85A 2WAEA 2Y0MA 3CCVI 3DFGA 2G9WA 3RZDJ 3CCEI 4YIIA 1S6LA 2JUGA 3A0BC 5HDKA 3OS0A 2F48A 3LSJA 1S8NA 2GZWA 1K61A 2K86A 2ME6A 3ZPLA 1D0ZA 5DUIA 3E5XA 4N9IA 4XKBA 1BI1A 3FK7A 4DZJA 5D6EA 1QQIA 4C2MJ 1FMWA 3WHCA 3V42A 4E4HA 3DBHB 4G94A 1X3UA 2O8XA 2XSJC 3OYKA 1QGPA 2DT6A 2Y9ZA 2IS2A 5FKMA 1DGRM 3PNYA 5L3CA 2LR8A 5J1RA 1P92A 2ZC2A 3R4KA 1QHHD 3K4BA 4G12A 3VSLA 3LA3A 4HF2A 3MKYB 2IGKA 1SANA 3CCSI 4L18B 2LREA 2QQ9A 5KK1A 4B09A 1ZAOA 2KPMA 1T8IA 2HTJA
chains in the Genus database with same CATH topology
2IVMA 1MDMB 2ZJ2A 4ZYEA 3BZ6A 3GWZA 2LSOA 2PJPA 1R5HA 3L00A 1RUOA 2FMLA 4HLYA 4RB2C 3FM5A 2ZKZA 2XKOA 4M71A 3QOPA 4LG0A 3BROA 1XMAA 2VXZA 4KIFA 3R60A 2ELHA 2NS0A 3MZHA 1XN7A 2KJBA 4XBFA 1U78A 2CWEA 3GF2A 4OIOF 2VONA 1LEAA 1YW7A 2BV6A 2PG4A 5L3FA 4LB6B 4KT5C 2V6CA 2NNYA 4ENNA 1J0RA 3RYRA 2XHKA 2P7VB 1OKRA 3ULQB 2GXGA 3WTSC 2D45A 3DPLC 3O6BB 3ZQ7A 3HHHA 3K1NA 3QPTA 3DV8A 1FT9A 2Q2EA 4WXHA 3ISPA 1P4AA 2G7HA 1FZPB 4ZYHA 2EFWA 2FMYA 1HKTA 2EFNA 3KP4A 1D8KA 4MEYF 4LB5A 1W5SA 5L3BA 4MQVA 2OAZA 2O61A 2OZUA 4HQEA 4WWCA 2UWMA 4WXCA 2F5CA 2DQRA 3CTAA 3RIRA 1XB4A 4O6JA 5LHGA 3EQLF 1G3TA 2Z33A 2YPRA 2V1XA 2Y48A 1XDSA 3E6BA 1XGNA 3RDIA 5IT3A 1WRJA 5J8FA 5D5WB 3WTVC 4HYEA 1FY7A 3ECHA 1V3FA 2IRFG 4BH9A 1W5TA 4CDGA 4FHTA 3K2ZA 5TRDA 3WODF 5DD4A 5LBQA 2XAGA 3EDPA 1XCVA 2JPCA 4BXUA 1I6XA 3ZMZA 2FBIA 2ISZA 1LB2A 5CVVA 3ABUA 1T38A 5E8GA 1KYZA 3WTZA 5AIPA 2EV5A 4ZZDA 1TW2A 2F2EA 1LVAA 1KYWA 3HHGA 1JHFA 1I1GA 4I0BA 1FBSA 1E2XA 3RI4A 2DFIA 1SD6A 3H92A 1J59A 1YQAA 4S05A 4GYGA 2H6BA 1KU7A 2OD5A 3V8LA 3DP7A 3L7WA 3SZPA 1B4AA 2VE8A 3HTUA 2F5EA 3IHUA 5L3GA 3JW4A 2ZO4A 1G6NA 1O7FA 2KJCA 5EEGA 1I1SA 3O2PE 3GO5A 5E1XA 2QUFA 1BI0A 5D4SA 2OQRA 2GA1A 1T6SA 3U9GA 3COAC 3M1EA 4EVIA 5BPIA 4HLXA 1B1BA 2P7CB 3BPXA 4LMYA 2XKPA 1JGSA 4P5OA 3DPTA 1Y0UA 5H20A 4I02A 3TOAA 1U5TC 3GVAA 2VBYA 1B9NA 1R58A 3RKWA 3QU3A 3GFIA 1PUEE 3NEUA 3KZZA 2V79A 3M8EA 3ML6A 3F22A 3BJ6A 4U88A 2FEZA 1XCBA 4PGHA 4OU0A 2GWRA 4CO8A 3V8JA 1RI7A 1IXCA 2VC0A 1D5VA 4UVBA 4YFNF 2A61A 3JAMZ 4RAZA 3N4MA 3CUQA 3ZMDA 1DPUA 2MD5A 4R1HA 2VOOA 2IA1A 3WGGA 1ZGJA 2FBHA 4UV9A 1PDNC 4G8XA 3I59A 3AAFA 5J8CA 3M8FA 1G3YA 4HZFA 4Y17A 1YTYA 1F5TA 2YX7A 3ELKA 4K2EA 3ZN1A 3GEZA 2KIMA 2YX4A 1UHMA 1R36A 1K6OA 5HDNA 4M6YA 1ZG1A 3QPHA 1EH6A 3GFJA 3DF8A 4RGXA 1CF7A 2ZNYA 1U8RA 3KCCA 1LJ9A 3ABTA 2H6CA 3FM3A 3R0AA 4M9ZA 1ZG5A 4LD5A 3ZMSA 5FO5A 1ZRFA 4EM0B 2M87A 2HOEA 2M45A 3PQJA 4G7OF 2Y75A 5HLGA 2STTA 1FSHA 1QO0D 2K02A 4A2UA 4ETSA 2H27A 3OV8A 4AVPA 2HYFA 4ZYGA 5LHIA 1C0WA 1RNLA 4M74A 1S7OA 3P9CA 4RGUA 5DV5A 4M72A 3P7NA 4Y13A 3K0LA 4EM1A 3D5LA 3FMSA 4CYDA 3WE2A 4FX4A 3Q5FA 2STWA 3WU0A 3R61A 4G7HF 2IA0A 1BI2A 1J9IA 5ILVA 4HX8A 4P9FA 3KZYA 2D2WA 4HX4A 2EFOA 1OYIA 4ASNA 3KEOA 3JTGA 3GYHX 2W25A 1MJ9A 2BE5F 2J5OA 3F8BA 1Z91A 4U0VA 2FNAA 2EJRA 4HV6A 3HRTA 3I53A 2O3FA 1IN6A 1O7LA 2F5FA 2HKOA 3SQNA 2A5YB 2Z99A 3O3KA 3HSEA 1GVJA 4KDPA 2A68F 3KETA 5HLIA 5H6RA 2XROA 1R5GA 2QBYA 2WTEA 2CW0F 1TQMA 3ERED 2CFXA 4A0XA 3F8CA 2XRNA 2RGVA 4GYIA 2DBBA 1USTA 3W6JB 2VBWA 2K7LA 3J80K 2E7XA 3GZ5A 1FNNA 4N0BA 1IF1A 4M9XA 4PDKA 3I54A 4LLLA 4LK1F 2FNPA 3QAHA 3IKTA 1MKMA 3IKVA 2A6EF 4L5JA 5LGUA 4G6QA 3EETA 2RNJA 3MCZA 4UVCA 4KICA 2O03A 3NRVA 4UXNA 5LGTA 3T5XA 2EV6A 3P9KA 1O3RA 2HTSA 2R3SA 4KIGA 3D0SA 1J5YA 5DCMA 4OOIA 3F3XA 2QYOA 3K1MA 4YFKF 2BGCA 2RKHA 4OIPF 2FXAA 2O0YA 3QP6A 5E1WA 4AIHA 3JAMK 1BIAA 1YFHA 2M30A 3F6VA 1FP2A 4CGZA 2PMUA 5ILUA 3B73A 1P6RA 1IN7A 1WQ2A 5H6QA 3MEXA 3E6DA 3FZVA 3I58A 4U7BA 2WWYA 4EJTA 1KGSA 3F72A 1S29A 1SD5A 3SZTA 4HAMA 1G3WA 4AIKA 3TO9A 2VODA 4IPAA 4RS8A 1RUNA 2CSOA 5E1ZB 3ZMUA 1FSEA 2K4JA 1STZA 2FBKA 3HIFA 2ZXJA 3LAJA 1EH8A 4IRHA 2RC4A 2E7WA 4LFUA 2DPDA 2P5KA 1UB9A 2VOPA 1Z1DA 1XGMA 2ACJA 4R8HA 2CQKA 3KP2A 3WTTC 3SXYA 3ZN0A 4KYWA 3L9FA 4M6XA 1LDKB 4RGSA 1H9GA 3FXRA 3EYYA 2NAZA 2HS5A 4GXOA 1G3SA 5JFRA 1BC7C 1OPCA 3RKYA 4ZH4F 3FMQA 5HDGA 2NYXA 4CZZA 3KP3A 5ICEA 2P8TA 1BJAA 1ZREA 4XLNF 3JTHA 4XSXF 1XSDA 5JR3A 4WK8F 3FXUA 2EFQA 2Q8KA 2CO5A 1ZGAA 1BIBA 2LDUA 3J7AO 5HS9A 1H9TA 4I2OA 3I0TA 2CG4A 1E17A 3KFWX 3L2CA 3W6KB 5DUKA 3FF5A 1P4WA 2OBPA 2ZNZA 2EB7A 4ESBA 3BJOA 2UZKA 1R7JA 2KIFA 1HW2A 2ADUA 4O3MA 5F1RA 5ICCA 2P5VA 2IPQX 4F7ZA 4ESFA 4KMFA 3NQOA 4FX0A 4RB3C 1ONVA 5K5QA 1HSJA 5FD5A 3HTSB 1R23A 3BY6A 2NNNA 5CVJA 5A2QZ 2Z9OA 2RN7A 4HX7A 3VEPA 2DTRA 3DXJF 1MJAA 3FWEA 5DCMB 4UHTA 4MTEA 4UNOA 2WV0A 1UFMA 1D8JA 5CJ9A 2MH2A 1B59A 5CLSA 3ROUA 3TO6A 5IT9K 4GO1A 4OMYA 4KIBA 2K4BA 1T98A 1A04A 3WE3A 1R1TA 4HDVA 3RTRA 4S04A 3F23A 2DW4A 4BHPA 4TV7A 3LA2A 2FE3A 2KIUA 4GGGA 3T0YA 5ICGA 4KN7X 4HA8A 4D0PA 1BC8C 5JVTA 3C1DA 2HDCA 1SAXA 2L02A 2PLYA 1QZZA 3V7RA 4RB1A 3MZYA 4Q48A 3TGNA 2UXNA 1AWCA 1WKMA 2MH9A 4L9VA 3L09A 4HOBA 4EJUA 1FYMA 2IW5A 5K1YA 1GHCA 5CVUA 1ON1A 4I98B 4LG0B 5D5UB 4MNUA 3F8MA 4IF4A 3E6CC 2L4MA 1FBQA 5LGNA 3IL2A 5DYMA 2FSWA 5JI6A 1FX7A 1Z9CA 2ETHA 1TNSA 2D1HA 3MWMA 5DDGA 2GAUA 1F4KA 4RB0A 1L0OC 5E17F 4IJAA 4EGYA 3BWGA 3IWFA 1UHWA 3RKXA 2VE9A 3IC7A 3J80Z 4L9NA 5E18F 2XIGA 4XLPF 2G7UA 1XDUA 2QQAA 1SMTA 1W4MA 2RQPA 2ZFWA 3CDHA 4EJWA 2M1BA 3N97A 5HLHA 4BQAA 1KQ0A 1USSA 4CICA 4HW0A 2VC1A 2WC2A 3GXOA 3HOSA 2ZMEA 5EEHA 4MEXF 2GIVA 3MQ0A 4HQMA 2EV0A 1IXSB 3ZMTA 3ZMVA 4A5NA 1B9MA 4OMZA 4M73A 3E5QA 2MLGA 1ZRCA 4A5MA 4UUVA 5BMZA 2MBFA 1F9NA 2XVCA 2OZ6A 3QP5A 1O3SA 4UV8A 3WGIA 3KLOA 5D6FA 2JRTA 3MFKA 5BQTA 4A6DA 1DP7P 5BOXA 4Q5SF 3LWFA 3WTXC 1QNTA 2JZYA 3M7GA 5LEJA 1FC3A 4P55A 3F21A 3KE2A 1FYLA 3T8RA 2A69F 3QRFF 1REPC 3K9TA 4OINF 3ZP5A 1LEBA 5D4RA 3LAPA 4BYYA 4HV5A 2JSCA 1K79A 1YW9A 1R1UA 3KP7A 3GFLA 2E1CA 2JPBA 3BPVA 1ZRDA 5A2QK 2FOKA 1SMYF 5DD8A 2ZBKA 5ERIA 3LQQA 4MHGA 2QENA 2GA2A 1ODDA 4B8XA 1XGSA 1TNTA 3HSFA 4NB5A 4I7HA 3B02A 4ENKA 2XAQA 4I0AA 2ISYA 3OOPA 1LQ1A 3WTUC 1HSTA 4EM2A 1FWZA 5D5XB 1HXDA 1JHHA 1MDMA 4L9JA 1T2KA 2BYVE 2FF4A 2CYYA 5K5OA 1TQIA 1UCRA 3J81K 1FPQA 4HDUA 4G7ZF 1IZ1A 3M9AA 1R00A 4JK1X 5HS7A 2HYGD 3IRRA 1QPMA 2DU9A 4N9HA 1K78A 1KA8A 4L5IA 2Q0OA 2MLKA 2XAFA 2DQLA 1SFXA 1TW3A 1HW1A 2JT1A 3IWZA 2GXBA 4IVNA 3KEQA 4P9UA 2P6TA 2BBYA 1Z6RA 1JXSA 3RYPA 1ZHFA 4PCQA 4WX9A 4KFCA 3HRUA 4EGZA 5IT9Z 1L3LA 2DT5A 5ED4A 4LLNA 3P9IA 3TDZC 2OU2A 2HGCA 1KU3A 3CUQB 1AOYA 4AD9A 4ZYDA 5AIQA 2F5DA 1H0MA 4NHJA 3CLOA 3LFKA 1OYYA 1YIOA 3G73A 3I59B 1FP1D 4G6DA 4I09A 3TO7A 4EJOA 5FFZA 3PFIA 3GFMA 2LF8A 3GX4X 2L01A 4OIRF 2B0LA 2YSRA 5F64A 1R1VA 1CGPA 5FD6A 1CF7B 1ZARA 3S2WA 2VN2A 2W57A 1IN8A 5L3EA 3V8KA 1GXQA 4A0YA 1F1ZA 2A3SA 1PP7U 3WTWC 3R6SA 3FMRA 3HOTA 1TQPA 3F8FA 2XAJA 1T0FA 3FXQA 1HKQA 2EA4A 2XAHA 3H3ZA 1MJBA 2PBIA 2FA5A 4KN4X 4EMSA 1BI3A 4DNCA 2EWNA 2EFPA 3JSPA 4ESJA 4RGRA 1Z05A 1WWXA 1I27A 4A0ZA 2QLZA 4R79A 2X4HA 2R7FA 3Q9VA 2PN6A 5CVRA 5L3DA 2MA3A 1OYWA 2ZCWA 1EV7A 2PFBA 4HF0A 4QLCU 5AONA 5LRRA 4CXFA 4PGGA 1ZH5A 4JBAA 4ENJA 1U3EM 2P6SA 3PQKA 1K78B 2KRFA 1BM9A 3CO6C 4UVAA 3HRMA 1I5ZA 3VODA 2VT2A 5FLXK 3V7SA 1O57A 4L0ZB 3EYIA 1TTYA 1FYKA 1ULYA 1S3JA 3I5UA 5FGMA 4ON0A 3TKYA 1GXPA 4XRFA 4Q47A 3WU1B 5LLQA 2QBYB 3HSRA 3FX3A 4NQWA 2KKOA 1JE8A 4LK0F 2X0LA 5TJJA 5KVRA 4IHSA 4P96A 3TDUC 5D8LB 2V1UA 1FBUA 3E3VA 2YR2A 2HQRA 5D5VB 1ZLKA 1W7PD 2R7DA 2ESHA 1ZYRF 3GUDA 4YIFA 2V1DA 4L9TA 3ECOA 4Z2YA 1J75A 1RIOH 1U6GA 3T8TA 2AXLA 1BN5A 1QBJA 4ZZLA 3RPUA 1S7AA 4U7DA 2V9VA 4OIQF 2M5WA 1HBXG 1XD7A 1V4RA 4L0YB 2FQ3A 1TLHB 2HKXA 2HWVA 2HZTA 1OMIA 3G3ZA 1LNWA 2P4WA 3SHFA 3GW2A 1IUYA 2AS5F 2OA4A 2BEOA 3C3WA 4WF2A 5DEQA 1MZBA 4M9SA 3J81Z 2FU4A 4BHCA 2IP2A 4EQQA 1YW8A 2H09A 1J2XA 2LNBA 4U0WA 4JQFA 1IXRC 1HQCA 1D3YA 3VB2A 1EH7A 1BBYA 2L54A 3KP5A 1IAWA 2HQNA 3WGHA 1MGTA 1ZN2A 3E6MA 4A6EA 1TBXA 1J7KA 3DQVC 1ZLJA 2DPUA 4WXDA 3FHZA 1XSVA 5D8KB 2RV8A 1WSUA 1XGOA 4A12A 5BS6A 2A6HF 4BAYA 1FOKA 2VBZA 4IHTA 1WI9A 4Y15A 3DEUA 1U5TA 1SD7A 3C7JA 1O3TA 2PMHA 2DO7A 5K5RA 3CO7C 4KUMA 1YS7A 2UXXA 5HOOA 4I01A 5ILSA 2GQQA 3KLNA 4KA4A 1RZ4A 2RVCA 2IT0A 1DDNA 1KQ8A 2XV4S 1G4DA 3HRSA 2W24A 2E1NA 3BOQA 4EJVA 5FB2A 5E20A 1Q1HA 1IW7F 1Z7UA 2L4AA 1SFUA 3BJAA 2IJLA 3C18A 1KU9A 2EK5A 4MQ9F 3REOA 5HVQC 3V4GA 2QM3A 5BPDA 2L3DA 1LDJA 5JHUA 3TQNA 1R22A 4YFXF 4LLGF 3K1PA 1YO5C 4HF1A 3I4PA 3K69A 1MD0A 1Z6TA 2DAOA 4HBLA 1KQ9A 1YS6A 4LJZF 4E70A 4IRGA 2DK8A 4KMUX 4BHBA 4QWQA 5HS8A 2LKPA 3CJNA 3F8NA 2TDXA 2JTVA 1SFEA 1FLIA 4O5VA 6PAXA 3EUHA 3GZ6A 1XMKA 3BP8A 4MGRA 2CGPA 2D1VA 2HFHA 3QU6A 3R0JA 1YLFA 3CUQC 2Z5UA 1W7PA 5J6XA 2IA2A 3KP6A 4H0EA 3U2RA 3TOBA 3H3UA 1K7AA 4GCVA 4DQ2A 4PZJA 1T39A 3LQRA 3HYIA 3IRQA 1DUXC 2Z3YA 1IN4A 1OR7A 3VOEA 1IRGA 2XASA 2C6YA 5E8IA 3T1BA 3RJPA 5FFXA 1YYVA 5FLXZ 2FRHA 5ICFA 1YG2A 4YG2F 2HEOA 4CHUA 1VTNC 3WG9A 3JSOA 1KU2A 2XUBA 2QWWA 2K27A 4MTDA 1O3QA 2PEXA 3LSTA 2PI0A 2QQBA 3SFZA 2QZ8A 3GLXA 3DKWA 1IN5A 2DI3A 1U5TB 4BNCA 2J5PA 4WCGA 5F6FA 1U2WA 3CUOA 1IRFA 4RAYA 3BDDA 2PQ8A 1QZYA 5CVIA 3I71A 3U1DA 4EV0A 1P4XA 3E5UA 5LEKA 3E97A 2OQGA 2VBXA 2O6GE 3Q9SA 1ZG3A 2VT3A 4FT8A 2ZMEB 1DPRA 2RDPA 4G9YA 1HKSA 4IRIA 2NRAC 2ESNA 2MC3A 1ON2A 4LGWA 5DCFA 5LRSA 1HW5A 2A07F 4AWXB 1XSXA 4Q4ZF 2DLLA 2EA2A 2YU3A 5LHHA 4XSZF 2P5LC 1P2FA 4AIJA 4U0YA 4IXAA 3I64A 3WTYC 3V7CA 1BOAA 2M8EA 3HUGA 1LDDA 1PP8F 3LA7A 2QVOA 2COMA 2LF7A 1B6AA 3RPQA 3VFZA 2DK5A 1SD4A 3MAJA 5CYVA 3F6OA 2HR3A 2XGXA 4ENMA 1NHAA 1W7PB 4KNYA 2W84A 2H94A 2W85A 2Y0MA 3DFGA 2G9WA 4YIIA 1S6LA 5HDKA 1S8NA 2GZWA 2K86A 3ZPLA 5DUIA 3E5XA 4N9IA 1BI1A 5D6EA 1QQIA 4G94A 1X3UA 2O8XA 1QGPA 5L3CA 1P92A 3R4KA 3LA3A 4HF2A 4L18B 2QQ9A 5KK1A 4B09A 1ZAOA 2HTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVM A;  1MDM B;  2ZJ2 A;  4ZYE A;  3BZ6 A;  3GWZ A;  2LSO A;  2PJP A;  1R5H A;  3L00 A;  1RUO A;  2FML A;  4HLY A;  4RB2 C;  3FM5 A;  2ZKZ A;  2XKO A;  4M71 A;  3QOP A;  4LG0 A;  3BRO A;  1XMA A;  2VXZ A;  4KIF A;  3R60 A;  2ELH A;  2NS0 A;  3MZH A;  1XN7 A;  2KJB A;  4XBF A;  1U78 A;  2CWE A;  3GF2 A;  4OIO F;  2VON A;  1LEA A;  1YW7 A;  2BV6 A;  2PG4 A;  5L3F A;  4LB6 B;  4KT5 C;  2V6C A;  2NNY A;  4ENN A;  1J0R A;  3RYR A;  2XHK A;  2P7V B;  1OKR A;  3ULQ B;  2GXG A;  3WTS C;  2D45 A;  3DPL C;  3O6B B;  3ZQ7 A;  3HHH A;  3K1N A;  3QPT A;  3DV8 A;  1FT9 A;  2Q2E A;  4WXH A;  3ISP A;  1P4A A;  2G7H A;  1FZP B;  4ZYH A;  2EFW A;  2FMY A;  1HKT A;  2EFN A;  3KP4 A;  1D8K A;  4MEY F;  4LB5 A;  1W5S A;  5L3B A;  4MQV A;  2OAZ A;  2O61 A;  2OZU A;  4HQE A;  4WWC A;  2UWM A;  4WXC A;  2F5C A;  2DQR A;  3CTA A;  3RIR A;  1XB4 A;  4O6J A;  5LHG A;  3EQL F;  1G3T A;  2Z33 A;  2YPR A;  2V1X A;  2Y48 A;  1XDS A;  3E6B A;  1XGN A;  3RDI A;  5IT3 A;  1WRJ A;  5J8F A;  5D5W B;  3WTV C;  4HYE A;  1FY7 A;  3ECH A;  1V3F A;  2IRF G;  4BH9 A;  1W5T A;  4CDG A;  4FHT A;  3K2Z A;  5TRD A;  3WOD F;  5DD4 A;  5LBQ A;  2XAG A;  3EDP A;  1XCV A;  2JPC A;  4BXU A;  1I6X A;  3ZMZ A;  2FBI A;  2ISZ A;  1LB2 A;  5CVV A;  3ABU A;  1T38 A;  5E8G A;  1KYZ A;  3WTZ A;  5AIP A;  2EV5 A;  4ZZD A;  1TW2 A;  2F2E A;  1LVA A;  1KYW A;  3HHG A;  1JHF A;  1I1G A;  4I0B A;  1FBS A;  1E2X A;  3RI4 A;  2DFI A;  1SD6 A;  3H92 A;  1J59 A;  1YQA A;  4S05 A;  4GYG A;  2H6B A;  1KU7 A;  2OD5 A;  3V8L A;  3DP7 A;  3L7W A;  3SZP A;  1B4A A;  2VE8 A;  3HTU A;  2F5E A;  3IHU A;  5L3G A;  3JW4 A;  2ZO4 A;  1G6N A;  1O7F A;  2KJC A;  5EEG A;  1I1S A;  3O2P E;  3GO5 A;  5E1X A;  2QUF A;  1BI0 A;  5D4S A;  2OQR A;  2GA1 A;  1T6S A;  3U9G A;  3COA C;  3M1E A;  4EVI A;  5BPI A;  4HLX A;  1B1B A;  2P7C B;  3BPX A;  4LMY A;  2XKP A;  1JGS A;  4P5O A;  3DPT A;  1Y0U A;  5H20 A;  4I02 A;  3TOA A;  1U5T C;  3GVA A;  2VBY A;  1B9N A;  1R58 A;  3RKW A;  3QU3 A;  3GFI A;  1PUE E;  3NEU A;  3KZZ A;  2V79 A;  3M8E A;  3ML6 A;  3F22 A;  3BJ6 A;  4U88 A;  2FEZ A;  1XCB A;  4PGH A;  4OU0 A;  2GWR A;  4CO8 A;  3V8J A;  1RI7 A;  1IXC A;  2VC0 A;  1D5V A;  4UVB A;  4YFN F;  2A61 A;  3JAM Z;  4RAZ A;  3N4M A;  3CUQ A;  3ZMD A;  1DPU A;  2MD5 A;  4R1H A;  2VOO A;  2IA1 A;  3WGG A;  1ZGJ A;  2FBH A;  4UV9 A;  1PDN C;  4G8X A;  3I59 A;  3AAF A;  5J8C A;  3M8F A;  1G3Y A;  4HZF A;  4Y17 A;  1YTY A;  1F5T A;  2YX7 A;  3ELK A;  4K2E A;  3ZN1 A;  3GEZ A;  2KIM A;  2YX4 A;  1UHM A;  1R36 A;  1K6O A;  5HDN A;  4M6Y A;  1ZG1 A;  3QPH A;  1EH6 A;  3GFJ A;  3DF8 A;  4RGX A;  1CF7 A;  2ZNY A;  1U8R A;  3KCC A;  1LJ9 A;  3ABT A;  2H6C A;  3FM3 A;  3R0A A;  4M9Z A;  1ZG5 A;  4LD5 A;  3ZMS A;  5FO5 A;  1ZRF A;  4EM0 B;  2M87 A;  2HOE A;  2M45 A;  3PQJ A;  4G7O F;  2Y75 A;  5HLG A;  2STT A;  1FSH A;  1QO0 D;  2K02 A;  4A2U A;  4ETS A;  2H27 A;  3OV8 A;  4AVP A;  2HYF A;  4ZYG A;  5LHI A;  1C0W A;  1RNL A;  4M74 A;  1S7O A;  3P9C A;  4RGU A;  5DV5 A;  4M72 A;  3P7N A;  4Y13 A;  3K0L A;  4EM1 A;  3D5L A;  3FMS A;  4CYD A;  3WE2 A;  4FX4 A;  3Q5F A;  2STW A;  3WU0 A;  3R61 A;  4G7H F;  2IA0 A;  1BI2 A;  1J9I A;  5ILV A;  4HX8 A;  4P9F A;  3KZY A;  2D2W A;  4HX4 A;  2EFO A;  1OYI A;  4ASN A;  3KEO A;  3JTG A;  3GYH X;  2W25 A;  1MJ9 A;  2BE5 F;  2J5O A;  3F8B A;  1Z91 A;  4U0V A;  2FNA A;  2EJR A;  4HV6 A;  3HRT A;  3I53 A;  2O3F A;  1IN6 A;  1O7L A;  2F5F A;  2HKO A;  3SQN A;  2A5Y B;  2Z99 A;  3O3K A;  3HSE A;  1GVJ A;  4KDP A;  2A68 F;  3KET A;  5HLI A;  5H6R A;  2XRO A;  1R5G A;  2QBY A;  2WTE A;  2CW0 F;  1TQM A;  3ERE D;  2CFX A;  4A0X A;  3F8C A;  2XRN A;  2RGV A;  4GYI A;  2DBB A;  1UST A;  3W6J B;  2VBW A;  2K7L A;  3J80 K;  2E7X A;  3GZ5 A;  1FNN A;  4N0B A;  1IF1 A;  4M9X A;  4PDK A;  3I54 A;  4LLL A;  4LK1 F;  2FNP A;  3QAH A;  3IKT A;  1MKM A;  3IKV A;  2A6E F;  4L5J A;  5LGU A;  4G6Q A;  3EET A;  2RNJ A;  3MCZ A;  4UVC A;  4KIC A;  2O03 A;  3NRV A;  4UXN A;  5LGT A;  3T5X A;  2EV6 A;  3P9K A;  1O3R A;  2HTS A;  2R3S A;  4KIG A;  3D0S A;  1J5Y A;  5DCM A;  4OOI A;  3F3X A;  2QYO A;  3K1M A;  4YFK F;  2BGC A;  2RKH A;  4OIP F;  2FXA A;  2O0Y A;  3QP6 A;  5E1W A;  4AIH A;  3JAM K;  1BIA A;  1YFH A;  2M30 A;  3F6V A;  1FP2 A;  4CGZ A;  2PMU A;  5ILU A;  3B73 A;  1P6R A;  1IN7 A;  1WQ2 A;  5H6Q A;  3MEX A;  3E6D A;  3FZV A;  3I58 A;  4U7B A;  2WWY A;  4EJT A;  1KGS A;  3F72 A;  1S29 A;  1SD5 A;  3SZT A;  4HAM A;  1G3W A;  4AIK A;  3TO9 A;  2VOD A;  4IPA A;  4RS8 A;  1RUN A;  2CSO A;  5E1Z B;  3ZMU A;  1FSE A;  2K4J A;  1STZ A;  2FBK A;  3HIF A;  2ZXJ A;  3LAJ A;  1EH8 A;  4IRH A;  2RC4 A;  2E7W A;  4LFU A;  2DPD A;  2P5K A;  1UB9 A;  2VOP A;  1Z1D A;  1XGM A;  2ACJ A;  4R8H A;  2CQK A;  3KP2 A;  3WTT C;  3SXY A;  3ZN0 A;  4KYW A;  3L9F A;  4M6X A;  1LDK B;  4RGS A;  1H9G A;  3FXR A;  3EYY A;  2NAZ A;  2HS5 A;  4GXO A;  1G3S A;  5JFR A;  1BC7 C;  1OPC A;  3RKY A;  4ZH4 F;  3FMQ A;  5HDG A;  2NYX A;  4CZZ A;  3KP3 A;  5ICE A;  2P8T A;  1BJA A;  1ZRE A;  4XLN F;  3JTH A;  4XSX F;  1XSD A;  5JR3 A;  4WK8 F;  3FXU A;  2EFQ A;  2Q8K A;  2CO5 A;  1ZGA A;  1BIB A;  2LDU A;  3J7A O;  5HS9 A;  1H9T A;  4I2O A;  3I0T A;  2CG4 A;  1E17 A;  3KFW X;  3L2C A;  3W6K B;  5DUK A;  3FF5 A;  1P4W A;  2OBP A;  2ZNZ A;  2EB7 A;  4ESB A;  3BJO A;  2UZK A;  1R7J A;  2KIF A;  1HW2 A;  2ADU A;  4O3M A;  5F1R A;  5ICC A;  2P5V A;  2IPQ X;  4F7Z A;  4ESF A;  4KMF A;  3NQO A;  4FX0 A;  4RB3 C;  1ONV A;  5K5Q A;  1HSJ A;  5FD5 A;  3HTS B;  1R23 A;  3BY6 A;  2NNN A;  5CVJ A;  5A2Q Z;  2Z9O A;  2RN7 A;  4HX7 A;  3VEP A;  2DTR A;  3DXJ F;  1MJA A;  3FWE A;  5DCM B;  4UHT A;  4MTE A;  4UNO A;  2WV0 A;  1UFM A;  1D8J A;  5CJ9 A;  2MH2 A;  1B59 A;  5CLS A;  3ROU A;  3TO6 A;  5IT9 K;  4GO1 A;  4OMY A;  4KIB A;  2K4B A;  1T98 A;  1A04 A;  3WE3 A;  1R1T A;  4HDV A;  3RTR A;  4S04 A;  3F23 A;  2DW4 A;  4BHP A;  4TV7 A;  3LA2 A;  2FE3 A;  2KIU A;  4GGG A;  3T0Y A;  5ICG A;  4KN7 X;  4HA8 A;  4D0P A;  1BC8 C;  5JVT A;  3C1D A;  2HDC A;  1SAX A;  2L02 A;  2PLY A;  1QZZ A;  3V7R A;  4RB1 A;  3MZY A;  4Q48 A;  3TGN A;  2UXN A;  1AWC A;  1WKM A;  2MH9 A;  4L9V A;  3L09 A;  4HOB A;  4EJU A;  1FYM A;  2IW5 A;  5K1Y A;  1GHC A;  5CVU A;  1ON1 A;  4I98 B;  4LG0 B;  5D5U B;  4MNU A;  3F8M A;  4IF4 A;  3E6C C;  2L4M A;  1FBQ A;  5LGN A;  3IL2 A;  5DYM A;  2FSW A;  5JI6 A;  1FX7 A;  1Z9C A;  2ETH A;  1TNS A;  2D1H A;  3MWM A;  5DDG A;  2GAU A;  1F4K A;  4RB0 A;  1L0O C;  5E17 F;  4IJA A;  4EGY A;  3BWG A;  3IWF A;  1UHW A;  3RKX A;  2VE9 A;  3IC7 A;  3J80 Z;  4L9N A;  5E18 F;  2XIG A;  4XLP F;  2G7U A;  1XDU A;  2QQA A;  1SMT A;  1W4M A;  2RQP A;  2ZFW A;  3CDH A;  4EJW A;  2M1B A;  3N97 A;  5HLH A;  4BQA A;  1KQ0 A;  1USS A;  4CIC A;  4HW0 A;  2VC1 A;  2WC2 A;  3GXO A;  3HOS A;  2ZME A;  5EEH A;  4MEX F;  2GIV A;  3MQ0 A;  4HQM A;  2EV0 A;  1IXS B;  3ZMT A;  3ZMV A;  4A5N A;  1B9M A;  4OMZ A;  4M73 A;  3E5Q A;  2MLG A;  1ZRC A;  4A5M A;  4UUV A;  5BMZ A;  2MBF A;  1F9N A;  2XVC A;  2OZ6 A;  3QP5 A;  1O3S A;  4UV8 A;  3WGI A;  3KLO A;  5D6F A;  2JRT A;  3MFK A;  5BQT A;  4A6D A;  1DP7 P;  5BOX A;  4Q5S F;  3LWF A;  3WTX C;  1QNT A;  2JZY A;  3M7G A;  5LEJ A;  1FC3 A;  4P55 A;  3F21 A;  3KE2 A;  1FYL A;  3T8R A;  2A69 F;  3QRF F;  1REP C;  3K9T A;  4OIN F;  3ZP5 A;  1LEB A;  5D4R A;  3LAP A;  4BYY A;  4HV5 A;  2JSC A;  1K79 A;  1YW9 A;  1R1U A;  3KP7 A;  3GFL A;  2E1C A;  2JPB A;  3BPV A;  1ZRD A;  5A2Q K;  2FOK A;  1SMY F;  5DD8 A;  2ZBK A;  5ERI A;  3LQQ A;  4MHG A;  2QEN A;  2GA2 A;  1ODD A;  4B8X A;  1XGS A;  1TNT A;  3HSF A;  4NB5 A;  4I7H A;  3B02 A;  4ENK A;  2XAQ A;  4I0A A;  2ISY A;  3OOP A;  1LQ1 A;  3WTU C;  1HST A;  4EM2 A;  1FWZ A;  5D5X B;  1HXD A;  1JHH A;  1MDM A;  4L9J A;  1T2K A;  2BYV E;  2FF4 A;  2CYY A;  5K5O A;  1TQI A;  1UCR A;  3J81 K;  1FPQ A;  4HDU A;  4G7Z F;  1IZ1 A;  3M9A A;  1R00 A;  4JK1 X;  5HS7 A;  2HYG D;  3IRR A;  1QPM A;  2DU9 A;  4N9H A;  1K78 A;  1KA8 A;  4L5I A;  2Q0O A;  2MLK A;  2XAF A;  2DQL A;  1SFX A;  1TW3 A;  1HW1 A;  2JT1 A;  3IWZ A;  2GXB A;  4IVN A;  3KEQ A;  4P9U A;  2P6T A;  2BBY A;  1Z6R A;  1JXS A;  3RYP A;  1ZHF A;  4PCQ A;  4WX9 A;  4KFC A;  3HRU A;  4EGZ A;  5IT9 Z;  1L3L A;  2DT5 A;  5ED4 A;  4LLN A;  3P9I A;  3TDZ C;  2OU2 A;  2HGC A;  1KU3 A;  3CUQ B;  1AOY A;  4AD9 A;  4ZYD A;  5AIQ A;  2F5D A;  1H0M A;  4NHJ A;  3CLO A;  3LFK A;  1OYY A;  1YIO A;  3G73 A;  3I59 B;  1FP1 D;  4G6D A;  4I09 A;  3TO7 A;  4EJO A;  5FFZ A;  3PFI A;  3GFM A;  2LF8 A;  3GX4 X;  2L01 A;  4OIR F;  2B0L A;  2YSR A;  5F64 A;  1R1V A;  1CGP A;  5FD6 A;  1CF7 B;  1ZAR A;  3S2W A;  2VN2 A;  2W57 A;  1IN8 A;  5L3E A;  3V8K A;  1GXQ A;  4A0Y A;  1F1Z A;  2A3S A;  1PP7 U;  3WTW C;  3R6S A;  3FMR A;  3HOT A;  1TQP A;  3F8F A;  2XAJ A;  1T0F A;  3FXQ A;  1HKQ A;  2EA4 A;  2XAH A;  3H3Z A;  1MJB A;  2PBI A;  2FA5 A;  4KN4 X;  4EMS A;  1BI3 A;  4DNC A;  2EWN A;  2EFP A;  3JSP A;  4ESJ A;  4RGR A;  1Z05 A;  1WWX A;  1I27 A;  4A0Z A;  2QLZ A;  4R79 A;  2X4H A;  2R7F A;  3Q9V A;  2PN6 A;  5CVR A;  5L3D A;  2MA3 A;  1OYW A;  2ZCW A;  1EV7 A;  2PFB A;  4HF0 A;  4QLC U;  5AON A;  5LRR A;  4CXF A;  4PGG A;  1ZH5 A;  4JBA A;  4ENJ A;  1U3E M;  2P6S A;  3PQK A;  1K78 B;  2KRF A;  1BM9 A;  3CO6 C;  4UVA A;  3HRM A;  1I5Z A;  3VOD A;  2VT2 A;  5FLX K;  3V7S A;  1O57 A;  4L0Z B;  3EYI A;  1TTY A;  1FYK A;  1ULY A;  1S3J A;  3I5U A;  5FGM A;  4ON0 A;  3TKY A;  1GXP A;  4XRF A;  4Q47 A;  3WU1 B;  5LLQ A;  2QBY B;  3HSR A;  3FX3 A;  4NQW A;  2KKO A;  1JE8 A;  4LK0 F;  2X0L A;  5TJJ A;  5KVR A;  4IHS A;  4P96 A;  3TDU C;  5D8L B;  2V1U A;  1FBU A;  3E3V A;  2YR2 A;  2HQR A;  5D5V B;  1ZLK A;  1W7P D;  2R7D A;  2ESH A;  1ZYR F;  3GUD A;  4YIF A;  2V1D A;  4L9T A;  3ECO A;  4Z2Y A;  1J75 A;  1RIO H;  1U6G A;  3T8T A;  2AXL A;  1BN5 A;  1QBJ A;  4ZZL A;  3RPU A;  1S7A A;  4U7D A;  2V9V A;  4OIQ F;  2M5W A;  1HBX G;  1XD7 A;  1V4R A;  4L0Y B;  2FQ3 A;  1TLH B;  2HKX A;  2HWV A;  2HZT A;  1OMI A;  3G3Z A;  1LNW A;  2P4W A;  3SHF A;  3GW2 A;  1IUY A;  2AS5 F;  2OA4 A;  2BEO A;  3C3W A;  4WF2 A;  5DEQ A;  1MZB A;  4M9S A;  3J81 Z;  2FU4 A;  4BHC A;  2IP2 A;  4EQQ A;  1YW8 A;  2H09 A;  1J2X A;  2LNB A;  4U0W A;  4JQF A;  1IXR C;  1HQC A;  1D3Y A;  3VB2 A;  1EH7 A;  1BBY A;  2L54 A;  3KP5 A;  1IAW A;  2HQN A;  3WGH A;  1MGT A;  1ZN2 A;  3E6M A;  4A6E A;  1TBX A;  1J7K A;  3DQV C;  1ZLJ A;  2DPU A;  4WXD A;  3FHZ A;  1XSV A;  5D8K B;  2RV8 A;  1WSU A;  1XGO A;  4A12 A;  5BS6 A;  2A6H F;  4BAY A;  1FOK A;  2VBZ A;  4IHT A;  1WI9 A;  4Y15 A;  3DEU A;  1U5T A;  1SD7 A;  3C7J A;  1O3T A;  2PMH A;  2DO7 A;  5K5R A;  3CO7 C;  4KUM A;  1YS7 A;  2UXX A;  5HOO A;  4I01 A;  5ILS A;  2GQQ A;  3KLN A;  4KA4 A;  1RZ4 A;  2RVC A;  2IT0 A;  1DDN A;  1KQ8 A;  2XV4 S;  1G4D A;  3HRS A;  2W24 A;  2E1N A;  3BOQ A;  4EJV A;  5FB2 A;  5E20 A;  1Q1H A;  1IW7 F;  1Z7U A;  2L4A A;  1SFU A;  3BJA A;  2IJL A;  3C18 A;  1KU9 A;  2EK5 A;  4MQ9 F;  3REO A;  5HVQ C;  3V4G A;  2QM3 A;  5BPD A;  2L3D A;  1LDJ A;  5JHU A;  3TQN A;  1R22 A;  4YFX F;  4LLG F;  3K1P A;  1YO5 C;  4HF1 A;  3I4P A;  3K69 A;  1MD0 A;  1Z6T A;  2DAO A;  4HBL A;  1KQ9 A;  1YS6 A;  4LJZ F;  4E70 A;  4IRG A;  2DK8 A;  4KMU X;  4BHB A;  4QWQ A;  5HS8 A;  2LKP A;  3CJN A;  3F8N A;  2TDX A;  2JTV A;  1SFE A;  1FLI A;  4O5V A;  6PAX A;  3EUH A;  3GZ6 A;  1XMK A;  3BP8 A;  4MGR A;  2CGP A;  2D1V A;  2HFH A;  3QU6 A;  3R0J A;  1YLF A;  3CUQ C;  2Z5U A;  1W7P A;  5J6X A;  2IA2 A;  3KP6 A;  4H0E A;  3U2R A;  3TOB A;  3H3U A;  1K7A A;  4GCV A;  4DQ2 A;  4PZJ A;  1T39 A;  3LQR A;  3HYI A;  3IRQ A;  1DUX C;  2Z3Y A;  1IN4 A;  1OR7 A;  3VOE A;  1IRG A;  2XAS A;  2C6Y A;  5E8I A;  3T1B A;  3RJP A;  5FFX A;  1YYV A;  5FLX Z;  2FRH A;  5ICF A;  1YG2 A;  4YG2 F;  2HEO A;  4CHU A;  1VTN C;  3WG9 A;  3JSO A;  1KU2 A;  2XUB A;  2QWW A;  2K27 A;  4MTD A;  1O3Q A;  2PEX A;  3LST A;  2PI0 A;  2QQB A;  3SFZ A;  2QZ8 A;  3GLX A;  3DKW A;  1IN5 A;  2DI3 A;  1U5T B;  4BNC A;  2J5P A;  4WCG A;  5F6F A;  1U2W A;  3CUO A;  1IRF A;  4RAY A;  3BDD A;  2PQ8 A;  1QZY A;  5CVI A;  3I71 A;  3U1D A;  4EV0 A;  1P4X A;  3E5U A;  5LEK A;  3E97 A;  2OQG A;  2VBX A;  2O6G E;  3Q9S A;  1ZG3 A;  2VT3 A;  4FT8 A;  2ZME B;  1DPR A;  2RDP A;  4G9Y A;  1HKS A;  4IRI A;  2NRA C;  2ESN A;  2MC3 A;  1ON2 A;  4LGW A;  5DCF A;  5LRS A;  1HW5 A;  2A07 F;  4AWX B;  1XSX A;  4Q4Z F;  2DLL A;  2EA2 A;  2YU3 A;  5LHH A;  4XSZ F;  2P5L C;  1P2F A;  4AIJ A;  4U0Y A;  4IXA A;  3I64 A;  3WTY C;  3V7C A;  1BOA A;  2M8E A;  3HUG A;  1LDD A;  1PP8 F;  3LA7 A;  2QVO A;  2COM A;  2LF7 A;  1B6A A;  3RPQ A;  3VFZ A;  2DK5 A;  1SD4 A;  3MAJ A;  5CYV A;  3F6O A;  2HR3 A;  2XGX A;  4ENM A;  1NHA A;  1W7P B;  4KNY A;  2W84 A;  2H94 A;  2W85 A;  2Y0M A;  3DFG A;  2G9W A;  4YII A;  1S6L A;  5HDK A;  1S8N A;  2GZW A;  2K86 A;  3ZPL A;  5DUI A;  3E5X A;  4N9I A;  1BI1 A;  5D6E A;  1QQI A;  4G94 A;  1X3U A;  2O8X A;  1QGP A;  5L3C A;  1P92 A;  3R4K A;  3LA3 A;  4HF2 A;  4L18 B;  2QQ9 A;  5KK1 A;  4B09 A;  1ZAO A;  2HTJ A; 
#chains in the Genus database with same CATH topology
 3G2B A;  2IVM A;  1MDM B;  2ZJ2 A;  4BL0 B;  1WJA A;  4AM3 A;  4ZYE A;  4ZYA A;  2ZSH B;  2XGD A;  3BZ6 A;  3HGY A;  3BTL A;  2WAQ N;  3GWZ A;  2LSO A;  2XPW A;  1N25 A;  2E2I J;  2NVX J;  3LSP A;  1NTC A;  1A36 A;  2PJP A;  1R5H A;  1TWG J;  2PMZ A;  3A0H C;  3L00 A;  2LBF A;  3S93 A;  1VFC A;  3H1C A;  1RUO A;  2FML A;  1Z3X A;  5FRM A;  4H4K C;  2K3P A;  4HLY A;  4XN0 A;  5M3F J;  4RB2 C;  3NWS A;  3FM5 A;  4IKF A;  2ZKZ A;  2IS6 A;  2XKO A;  4M71 A;  1ENH A;  4XR6 A;  1YRN A;  2VQH A;  2YS9 A;  3QOP A;  3HZJ A;  4LG0 A;  2XDV A;  3BRO A;  1XMA A;  5F0F A;  2VXZ A;  3DLA A;  2VL8 A;  2E34 A;  3P5J A;  4KIF A;  1Z77 A;  3R60 A;  3M3Y J;  2ELH A;  2NS0 A;  4BU2 A;  3MZH A;  2EH3 A;  1XN7 A;  2BY2 A;  2KJB A;  3GTJ J;  2CW8 A;  3DU5 A;  3H5R A;  4XBF A;  3WG7 H;  1DU0 A;  1UG2 A;  2GM4 A;  4Y33 A;  1NK2 P;  2DA6 A;  1BW6 A;  1WJD A;  1D1A A;  1ZKG A;  1U78 A;  2CWE A;  2IBD A;  4W1U A;  3GF2 A;  4OIO F;  2VON A;  1LEA A;  1R4M B;  1YW7 A;  1I3Q J;  1H8A C;  3BZK A;  2BV6 A;  2PG4 A;  3OYA A;  5L3F A;  2ECB A;  1I6H J;  1JUM A;  4LB6 B;  4KT5 C;  2DN0 A;  2V6C A;  4XLH A;  2NNY A;  3GME A;  4ENN A;  1OLT A;  3KPH A;  3FXM A;  3IH2 A;  1J0R A;  4LOC A;  3RYR A;  2F4M B;  2ZXW H;  2ECC A;  2XHK A;  3LMM A;  4FE7 A;  4E7J A;  3ZQC A;  1TL8 A;  1VQ5 I;  2FJ1 A;  2P7V B;  1FTT A;  3HBL A;  1OKR A;  3ULQ B;  2GXG A;  3WTS C;  2D45 A;  3S1N J;  3AFH A;  3DPL C;  3O6B B;  3ZQ7 A;  3DTI A;  3HHH A;  3K1N A;  3QPT A;  3DV8 A;  2XPV A;  1FT9 A;  1LFB A;  1MMA A;  2Q2E A;  4WXH A;  3ISP A;  4XK4 A;  5LD2 C;  1P4A A;  3SDG A;  4IEJ A;  2G7H A;  1FZP B;  2R7T A;  4ZYH A;  3OMY A;  3H35 A;  2FMY A;  2EFW A;  2VJ4 A;  1HKT A;  2EFN A;  3KP4 A;  1D8K A;  3SEZ A;  4MEY F;  3FKJ A;  2PX9 A;  4UB6 C;  4LB5 A;  1W5S A;  5L3B A;  3DPU A;  5JLX A;  3CMY A;  1X4P A;  4MQV A;  2DMN A;  2OAZ A;  1JTY A;  2O61 A;  2OZU A;  3JRI A;  4DJA A;  1ERD A;  4HQE A;  1U8B A;  4N4N B;  4WWC A;  4AVZ A;  2UWM A;  4WXC A;  4BEH B;  2WB1 N;  3CC4 I;  2F5C A;  2DQR A;  3CTA A;  3PFY A;  3RIR A;  2R5Z A;  1XB4 A;  2L0K A;  4O6J A;  1U0J A;  2OC6 A;  5LHG A;  2JRM A;  2VKD A;  2DDA A;  3EQL F;  2NVT J;  1G3T A;  1Z0X A;  2W1O A;  2Z33 A;  1JJ8 C;  2V26 A;  5IY5 H;  2YPR A;  3GZN B;  4V19 K;  3AKZ A;  2V1X A;  2Y48 A;  4KJZ A;  1XDS A;  3DKY A;  1XGN A;  1RPW A;  3E6B A;  3JCU C;  3RDI A;  3G1L A;  4QIW N;  2VPL A;  2Y69 H;  2HVR A;  5IT3 A;  1WRJ A;  3FKI J;  5J8F A;  5D5W B;  3WTV C;  4HYE A;  1FY7 A;  3ECH A;  3PO2 J;  1V3F A;  2IRF G;  4BH9 A;  1RES A;  1W5T A;  4CDG A;  4FHT A;  3FXL A;  3K2Z A;  1A6Q A;  5TRD A;  3S2D J;  3WOD F;  2HNH A;  1TT0 A;  5DD4 A;  5LBQ A;  1D5Y A;  4YRV A;  4PUS A;  2XAG A;  3EDP A;  1PUF A;  3JRH A;  4RLF A;  1XCV A;  4GFB A;  2JPC A;  2R7W A;  4BXU A;  4MFE A;  1G59 A;  2H8W A;  4X1E A;  1I6X A;  1MMD A;  3ZMZ A;  1HDD C;  2FBI A;  3A1Y A;  4UB8 C;  2R93 J;  2JUC A;  2ISZ A;  1LB2 A;  1MBJ A;  5CVV A;  2BZT A;  1X3Z B;  3ABU A;  1FOW A;  1YIT I;  5FKK A;  3AL0 B;  1WPK A;  2XPU A;  1T38 A;  5IYC J;  2RNG A;  2DMU A;  5E8G A;  4F91 B;  1KYZ A;  3WTZ A;  4CCM A;  5AIP A;  3QYF A;  2EV5 A;  4ZZD A;  1TW2 A;  1ZR4 A;  2F2E A;  1LVA A;  2EZL A;  1KYW A;  2ID6 A;  3HHG A;  2CQN A;  1JHF A;  3L2R A;  2XGC A;  4FQG A;  1Y8Q B;  3KEY A;  2LK2 A;  1I1G A;  4I0B A;  1MND A;  1MBE A;  1FBS A;  1E2X A;  3RI4 A;  1SC7 A;  2DFI A;  3K10 A;  1SD6 A;  3H0D A;  2QGU A;  4BDY A;  4ZTF A;  3C2B A;  2A6T A;  3H92 A;  1J59 A;  2BVM A;  1XMX A;  1FOX A;  4ZDO A;  1YQA A;  2LBF B;  3A2K A;  2VJ5 A;  2QCO A;  4S05 A;  2VXD A;  4GYG A;  3OSG A;  2H6B A;  1Y1V J;  4NBQ A;  1KU7 A;  2OD5 A;  3UKG A;  1FMV A;  3V8L A;  4XKC A;  3W2V A;  4M3G A;  3DP7 A;  3L7W A;  2KL4 A;  3SZP A;  1B4A A;  2VE8 A;  3NWT A;  3HTU A;  2F5E A;  2G0E A;  3IHU A;  5L3G A;  3JW4 A;  2ZO4 A;  1G6N A;  5GTH C;  3IUO A;  1O7F A;  4E7S A;  2KJC A;  4CCO A;  4HRI A;  2B7E A;  4DZP A;  5GAG J;  5EEG A;  3JRC A;  1I1S A;  3O2P E;  2DOA A;  3GO5 A;  5E1X A;  2QUF A;  2KT0 A;  1BI0 A;  2VI6 A;  3K70 D;  5D4S A;  2GLO A;  2OQR A;  2CW7 A;  1X2N A;  2GA1 A;  2L7M P;  2EIL H;  1T6S A;  3U9G A;  3COA C;  3BR6 A;  3M1E A;  3OIP A;  2CMP A;  4NQW B;  4EVI A;  5BPI A;  1POG A;  3RCO A;  4HLX A;  1B1B A;  3S3M A;  2P7C B;  1Y8R B;  3BPX A;  4LMY A;  2XKP A;  1JGS A;  1UG0 A;  2Y0S A;  2HPI A;  2X6Y A;  4P5O A;  4CZC A;  2HOA A;  3CJT B;  1Y0U A;  3CJR B;  3DPT A;  4I02 A;  5H20 A;  4BKX A;  3TOA A;  1U5T C;  3GVA A;  4M3F A;  1R5I D;  2NOJ B;  4HEA 2;  1DQU A;  2VBY A;  1B9N A;  3M8J A;  3FBI B;  1R58 A;  3ASN H;  3RKW A;  3QU3 A;  3GFI A;  1PUE E;  4X0G A;  3NEU A;  3KZZ A;  2V79 A;  3M8E A;  4V2G A;  2DYS H;  3ML6 A;  4Y3O A;  2R5Y B;  3LSR A;  3F22 A;  3SEQ A;  3BJ6 A;  4U88 A;  3I55 I;  2FEZ A;  2YUS A;  2ZSI B;  1XCB A;  4PGH A;  4OU0 A;  2GWR A;  4CO8 A;  3V8J A;  2LH9 A;  1RI7 A;  2E36 A;  2JWT A;  1IXC A;  2X85 A;  3TBI A;  2VC0 A;  4I6Z A;  1D5V A;  3FDY A;  4UVB A;  4YFN F;  2L5Q A;  2A61 A;  4YEJ A;  5B1B H;  1GLN A;  2XC7 A;  2M4G A;  3JAM Z;  4RM3 A;  4RAZ A;  2BY0 A;  3N4M A;  5GPC A;  3CUQ A;  3ZMD A;  2DA4 A;  3QOD A;  2EIK H;  1DPU A;  2R5Z B;  2MD5 A;  2QF7 A;  2ZME C;  4PJJ A;  4R1H A;  2BXY A;  2EBI A;  4HNV A;  4RA2 A;  2VOO A;  2IA1 A;  2M3A A;  1ETQ A;  3WGG A;  1Y0N A;  1ZGJ A;  2CQ7 A;  2FBH A;  1ZQ3 P;  4UV9 A;  2M4K A;  2BXZ A;  1PDN C;  4G8X A;  3I59 A;  1X1P A;  3AAF A;  2R7V A;  1RR7 A;  3E1S A;  5J8C A;  3M8F A;  1G3Y A;  1VQ8 I;  3HJE A;  4OWR B;  4HZF A;  4Y17 A;  1YTY A;  1F5T A;  4Y4R A;  2YX7 A;  3ELK A;  4KIS A;  2JA7 J;  4K2E A;  5EDN A;  3ZN1 A;  3ZQQ A;  2M9H A;  3L1P A;  3GEZ A;  2KIM A;  1G2H A;  2K85 A;  2HZD A;  1PUF B;  2NVY J;  2YX4 A;  1UHM A;  1R36 A;  3SYT A;  1K6O A;  5HDN A;  1OCO H;  4M6Y A;  1OJL A;  1ZG1 A;  4AC0 A;  3QPH A;  4DYR A;  1EH6 A;  3GFJ A;  1K6Y A;  3DF8 A;  4RGX A;  2VPR A;  4KT6 A;  1CF7 A;  1FEX A;  2ZNY A;  3IAM 2;  1U8R A;  3KCC A;  3KZI C;  1LJ9 A;  4X6A J;  1B72 B;  4A3J J;  3ABT A;  1IDY A;  2CUJ A;  2H6C A;  3EUH C;  1SFO J;  2TCT A;  3FM3 A;  3R0A A;  4M9Z A;  3A01 A;  1ZG5 A;  1T08 B;  1HLV A;  4LD5 A;  5FJ8 J;  3ZMS A;  5FO5 A;  1ZRF A;  4EM0 B;  2P81 A;  2M87 A;  3C2G A;  2HOE A;  1WJC A;  2M45 A;  4I99 C;  3PQJ A;  3BTC A;  3K7A J;  2QA4 I;  4G7O F;  2QKL B;  2Y75 A;  1OCT C;  2R7S A;  2X1C A;  5HLG A;  2STT A;  4UUT A;  3DCF A;  1FSH A;  1QO0 D;  2K02 A;  2DTZ A;  4A2U A;  4ETS A;  2KMU A;  4CYC A;  2H27 A;  3S15 J;  3OV8 A;  4AVP A;  3L2U A;  2PJR A;  2HYF A;  4ZYG A;  5LHI A;  4CUG A;  3K4J A;  1C0W A;  1RNL A;  4M74 A;  3H9J A;  4NDL A;  3HKZ A;  2LLK A;  5EF6 A;  1S7O A;  3P9C A;  5E3O A;  4RGU A;  5DV5 A;  4M72 A;  3P7N A;  4Y13 A;  2AHQ A;  3K0L A;  4EM1 A;  1WFX A;  5M5X J;  3D5L A;  3FMS A;  4CYD A;  3WE2 A;  5B1A H;  4E7I A;  4FX4 A;  3Q5F A;  2STW A;  1Z21 A;  3WU0 A;  3R61 A;  4G7H F;  2IA0 A;  1BI2 A;  3FXO A;  2CQX A;  5ILV A;  1J9I A;  4HX8 A;  4P9F A;  1VZ0 A;  3KZY A;  5IOZ A;  2D2W A;  4C3I J;  3FXJ A;  3IP4 B;  3J7Y J;  2GXA A;  4HX4 A;  2EFO A;  1OYI A;  4ASN A;  3KEO A;  1IRX A;  3QYE A;  3JTG A;  3GYH X;  2W25 A;  1WGX A;  1MJ9 A;  2BE5 F;  2J5O A;  3ZQH A;  3F8B A;  1SVO A;  4LIU A;  1Z91 A;  4U0V A;  3CP2 A;  3CP8 A;  1IDZ A;  2FNA A;  2EJR A;  3K4M A;  4HV6 A;  3HRT A;  4DW6 A;  3I53 A;  1B8I B;  3GTG J;  1GUU A;  2O3F A;  1IN6 A;  2BHZ A;  1O7L A;  4B4C A;  3Q0W A;  1MIJ A;  2F5F A;  2HKO A;  5F0H A;  3SQN A;  1D0X A;  2A5Y B;  4C2T A;  2Z99 A;  1AKH A;  5J4V A;  3O3K A;  1A35 A;  3HSE A;  1Y56 A;  1GVJ A;  2X1D A;  3KX2 A;  1BA5 A;  4KDP A;  4YIR X;  2A68 F;  3KET A;  1WJB A;  2V7F A;  5HLI A;  5H6R A;  1JGG A;  1JKR C;  2XRO A;  1R5G A;  2QBY A;  2XB5 A;  3MKL A;  2WTE A;  4RBO A;  2CW0 F;  1TQM A;  3ERE D;  2CFX A;  4A0X A;  4B3X A;  3F8C A;  2IGN A;  1R9T J;  2XRN A;  2DJN A;  2RGV A;  1JT0 A;  4GYI A;  5K7H A;  4F93 B;  2LTP A;  2DBB A;  1UST A;  3W6J B;  1PYV A;  3FIW A;  2VBW A;  3MVP A;  3OYN A;  3CF5 F;  3HB9 A;  1FIA A;  2K7L A;  4CA0 A;  1XC5 A;  4XLC A;  3J80 K;  3ESW B;  2E7X A;  3GZ5 A;  5J47 A;  1FNN A;  1TT5 B;  4N0B A;  1IF1 A;  5E3N A;  1T56 A;  4M9X A;  4PDK A;  5EYR A;  3I54 A;  3OL3 A;  4LLL A;  4LK1 F;  2FNP A;  3QAH A;  4FIS A;  3IKT A;  1MKM A;  3IKV A;  2A6E F;  4L5J A;  5LGU A;  3LNQ A;  2LD5 A;  4G6Q A;  3EET A;  2MFZ A;  2RNJ A;  2R4G A;  3MCZ A;  1YX5 A;  4UVC A;  1D1B A;  4F55 A;  3LOC A;  3S3O A;  4KIC A;  1YJ9 I;  9ANT A;  2O03 A;  3NRV A;  4UXN A;  5LGT A;  3T5X A;  1LE8 A;  3U21 A;  4B3A A;  2EV6 A;  2RRE A;  3P9K A;  3AG1 H;  1O3R A;  2HTS A;  1NH3 A;  1V55 H;  2R3S A;  3CLQ A;  4BXX J;  4KIG A;  3D0S A;  4BS9 A;  1WH5 A;  1J5Y A;  5DCM A;  1ZEL A;  3OR2 C;  2WBM A;  4OOI A;  3BR5 A;  2QYO A;  3F3X A;  3SZG A;  2CH0 A;  3K1M A;  4ZTJ A;  4YFK F;  5EG0 A;  3JRB A;  2BGC A;  4M3B A;  3GTM J;  1Y6I A;  2RAE A;  2MSY A;  2RKH A;  4OIP F;  2FXA A;  5FRO A;  4NC8 A;  2O0Y A;  3Q3S A;  3QP6 A;  1W36 D;  5E1W A;  3S1R J;  4AIH A;  3JAM K;  2A05 A;  1VND A;  1BIA A;  1TWA J;  1YFH A;  2M30 A;  3F6V A;  1IGN A;  4HNT A;  1FP2 A;  4XON A;  4CGZ A;  1HCR A;  2PMU A;  5ILU A;  1VQN I;  5EJC A;  3B73 A;  4MLO A;  1P6R A;  1IN7 A;  1WQ2 A;  2NXN B;  3HC7 A;  3QPL A;  5H6Q A;  3MEX A;  3E6D A;  4CCN A;  4A3E J;  3FZV A;  3I58 A;  4U7B A;  2WWY A;  2BVL A;  4EJT A;  1OCR H;  1TWF J;  4BJ6 C;  2X1E A;  4A3K J;  5FKL A;  1KGS A;  3F72 A;  1S29 A;  1SD5 A;  3SZT A;  2OUM A;  2L9S A;  4HAM A;  2E2H J;  1G3W A;  3LL7 A;  4AIK A;  1MSE C;  3HEF A;  3TO9 A;  2E71 A;  2ZJP F;  5C3E J;  2VOD A;  4IPA A;  4RS8 A;  1RUN A;  3ZQL A;  2CSO A;  4CYC B;  4D5C A;  2O7O A;  5E1Z B;  1MMS A;  3ZMU A;  2L9N A;  1FSE A;  2K4J A;  1STZ A;  2FBK A;  3MD2 A;  3HIF A;  2ZXJ A;  3LAJ A;  2VKV A;  1T0F C;  2V1N A;  2KDZ A;  5FKN A;  1EH8 A;  4IRH A;  2E2J J;  1LKX A;  3PIO F;  2RC4 A;  2E7W A;  4LFU A;  3VYT B;  2DPD A;  2R7Z J;  3L2Q A;  2DA3 A;  4ANJ A;  2P5K A;  1UB9 A;  2VOP A;  1Z1D A;  1XGM A;  2X48 A;  1ETW A;  2CQQ A;  4BE1 A;  2ACJ A;  2W82 A;  3M07 A;  4JP0 A;  2L7Z A;  2OCE A;  4R8H A;  2LKX A;  2CQK A;  3KP2 A;  4BY7 J;  3AL0 C;  3WTT C;  3SXY A;  3PUF A;  3ZN0 A;  2MC4 A;  4KYW A;  3L9F A;  4M6X A;  2L9R A;  3CC2 I;  4A3L J;  3H0G J;  1LDK B;  4RGS A;  1H9G A;  3FXR A;  2Z2S B;  2P0W A;  5LFA A;  3EYY A;  2NAZ A;  2H8R A;  3VYR B;  1YOV B;  2HS5 A;  4GXO A;  1G3S A;  5JFR A;  5M3M J;  1BC7 C;  2OTL I;  2MW8 A;  4JX6 A;  1OPC A;  3RKY A;  4ZH4 F;  3HOY J;  3FMQ A;  4E7L A;  2GOM A;  1YX3 A;  2NYX A;  5HDG A;  4CZZ A;  3KP3 A;  5ICE A;  1IG7 A;  3LSH A;  1FJL A;  2P8T A;  1BJA A;  3AG3 H;  1ZRE A;  3UNG C;  4XLN F;  2DMT A;  4XM3 A;  3HGG A;  3SFI A;  3JTH A;  4XSX F;  1XSD A;  5JR3 A;  5M5Y J;  4WK8 F;  3FXU A;  2EFQ A;  3ABM H;  3BZC A;  2Q8K A;  5C4J J;  2CO5 A;  1ZGA A;  1BIB A;  2ELK A;  3QOE A;  2LDU A;  3J7A O;  5HS9 A;  2JJ7 A;  4XQF A;  1H9T A;  1MSF C;  3I0T A;  4I2O A;  2CG4 A;  1Q1V A;  3DLL F;  1TZL A;  3S8P A;  3GBG A;  1E17 A;  3KFW X;  3A4C A;  2VQC A;  5DM6 F;  3L2C A;  2IS4 A;  1UMQ A;  1FTZ A;  3OYC A;  2JVH A;  3W6K B;  1QPI A;  3PJR A;  5DUK A;  3SJM A;  3GTK J;  3FF5 A;  1P4W A;  2LMD A;  2OBP A;  2ZNZ A;  3OIO A;  2EB7 A;  4ESB A;  3BJO A;  2UZK A;  2V9P A;  1R7J A;  2LP0 A;  2KIF A;  1HW2 A;  3HUG B;  2ADU A;  2F4I A;  4O3M A;  5F1R A;  5ICC A;  2P5V A;  3QQA A;  2IPQ X;  4F7Z A;  3BCB A;  3OIQ A;  2KZV A;  4ESF A;  4KMF A;  1IC8 A;  3NQO A;  4FX0 A;  2VUM J;  3S32 A;  1YJW I;  4A3M J;  3RQI A;  1Y1W J;  3BCA A;  2CV1 A;  1RKW A;  4RB3 C;  1ONV A;  3NAU A;  1HSJ A;  5K5Q A;  5FD5 A;  3HTS B;  2K9N A;  4XLF A;  1R23 A;  5IPA A;  5EGO A;  5C4X J;  3BY6 A;  4FTH A;  2NNN A;  5CVJ A;  2E5Z A;  2UUZ A;  4C9Y A;  5A2Q Z;  2B9S A;  2Z9O A;  1H89 C;  4XID A;  1BW5 A;  2RN7 A;  3FK6 A;  4HX7 A;  3D5R C;  2R0Q C;  4UY8 I;  1HOM A;  3VEP A;  1UJ8 A;  2DTR A;  2KZG A;  3DXJ F;  3CMA I;  1MJA A;  4PK4 A;  3FWE A;  5DCM B;  2IAI A;  3KYD B;  1G8X A;  4UHT A;  4AU7 A;  4MTE A;  4UNO A;  2WV0 A;  5DM7 F;  1OFC X;  1UFM A;  1D8J A;  5CJ9 A;  2MH2 A;  1B59 A;  3H36 A;  5CLS A;  5CQG A;  3ROU A;  3TO6 A;  4GO1 A;  4KIT B;  4KIB A;  2K4B A;  4OMY A;  3FXK A;  5IT9 K;  4HNU A;  5IP7 J;  2BW3 A;  3CZ6 A;  1T98 A;  1A04 A;  4XNF A;  3WE3 A;  2HU9 A;  3RZO J;  1R1T A;  1P7I A;  4HDV A;  3ABK H;  4QPO A;  3RTR A;  4S04 A;  5TIS C;  3F23 A;  2DW4 A;  2M0M A;  1IO2 A;  4BHP A;  1W0T A;  3TMO A;  4TV7 A;  3LA2 A;  2AQE A;  2FE3 A;  1K4T A;  4B48 A;  2KIU A;  4GGG A;  3T0Y A;  1Z3Y A;  1IV6 A;  4BUP A;  1S7E A;  5ICG A;  4KN7 X;  3ABL H;  2K9S A;  2KQR A;  1VQL I;  2Y31 A;  5FLM J;  4HA8 A;  4D0P A;  1MMN A;  1BC8 C;  4Y52 J;  5JVT A;  3C1D A;  3BG7 A;  2HDC A;  1EF4 A;  1SAX A;  2L02 A;  2PLY A;  1S9H A;  1QZZ A;  3V7R A;  4RB1 A;  3MZY A;  4Q48 A;  3TGN A;  2UXN A;  1MBG A;  1ETY A;  1AWC A;  1WKM A;  2MH9 A;  4L9V A;  3L09 A;  4HOB A;  4EJU A;  4J01 A;  1FYM A;  3W3C A;  2IW5 A;  3JRA A;  4BBS J;  1MBK A;  5K1Y A;  1GHC A;  5CVU A;  1ON1 A;  1FIP A;  1YRN B;  4XRS G;  2EZH A;  4I98 B;  4LG0 B;  5D5U B;  4MNU A;  2V9K A;  3F8M A;  5F0C A;  2HQA A;  4IF4 A;  3E6C C;  1DGW Y;  4RM2 A;  2L4M A;  1FBQ A;  3H3V K;  3MZ8 A;  3E7L A;  5LGN A;  3IL2 A;  5DYM A;  2FSW A;  1R71 A;  2ZXI A;  5JI6 A;  1FX7 A;  1Z9C A;  2ETH A;  3DWL E;  3MMY B;  3ZR8 X;  1TNS A;  4ZDL A;  2D1H A;  3MWM A;  5DDG A;  3TW6 A;  3FIS A;  2GAU A;  2NOG A;  2W4S A;  4XRS A;  1N75 A;  4RB0 A;  1L0O C;  1F4K A;  5E17 F;  3J7A Y;  3KYL A;  4IJA A;  4EGY A;  4B43 A;  1SVL A;  3BWG A;  1GV2 A;  3IWF A;  1UHW A;  1TWC J;  3RKX A;  2VE9 A;  3IC7 A;  5FLV A;  4II3 A;  1F36 A;  3BR2 A;  3J80 Z;  1HC8 A;  4L9N A;  2LFB A;  3E0J B;  5E18 F;  2XIG A;  2JA2 A;  1WJ5 A;  3OS1 A;  1OCP A;  3F9K A;  4XLP F;  2G7U A;  4RDU A;  2OJE D;  3O8G A;  1APL C;  1XDU A;  2QQA A;  1SMT A;  2HPM A;  2CV2 A;  1W4M A;  2RQP A;  2ZFW A;  3CDH A;  3OWT A;  4EJW A;  2M1B A;  3OSF A;  3N97 A;  1YI2 I;  5HLH A;  4XN3 A;  3MN2 A;  4BQA A;  2H1K A;  1KQ0 A;  3FBN B;  1USS A;  1ZTR A;  4CIC A;  2Q2E B;  4HW0 A;  2R92 J;  2VC1 A;  2WC2 A;  1UAA A;  3GXO A;  3HOS A;  2ZME A;  3CES A;  3OY9 A;  5EEH A;  2DA7 A;  3BC8 A;  1VQK I;  4P1W A;  2FUG 2;  1PVE A;  2VLA A;  4MEX F;  2GIV A;  2KDO A;  4AYB A;  3MQ0 A;  4HQM A;  2EV0 A;  1MH3 A;  4BE2 A;  1IXS B;  4IOA F;  1V5E A;  3ZMT A;  3ZMV A;  3DBR B;  2DFF A;  2MYS A;  2LY1 A;  1RRJ A;  4A5N A;  1B9M A;  4OMZ A;  4M73 A;  3E5Q A;  2F4O B;  2MLG A;  3LSG A;  2V4J C;  3CJQ B;  1T95 A;  2HI3 A;  2WY7 Q;  3K4C A;  4LIT A;  5BNG A;  1ZRC A;  4A5M A;  4DGW B;  4XKV A;  1VQ7 I;  4DIQ A;  5BMZ A;  4UUV A;  4IL6 C;  2MBF A;  3BT9 A;  2L7K A;  1A5J A;  1F9N A;  2XVC A;  2OZ6 A;  2N8G A;  2R7Q A;  2XSD C;  2FD5 A;  3QP5 A;  1O3S A;  1TC3 C;  5M5W J;  4IHV A;  1QHG A;  1N77 A;  2CUF A;  3LFU A;  5EGO B;  3CC7 I;  1F43 A;  4XLE A;  3K2A A;  4HG2 A;  4UV8 A;  3WGI A;  3KLO A;  5B66 C;  5D6F A;  5J40 A;  1XPX A;  3CCM I;  3J7Z I;  3TP0 A;  2JRT A;  4BDZ A;  3MFK A;  3OR1 C;  5BQT A;  4PJL A;  4A6D A;  2E35 A;  2HDW A;  1DP7 P;  5BOX A;  1N78 A;  1JUP A;  2DOE A;  4Q5S F;  3LWF A;  3HPH A;  3VDX A;  4I76 A;  1JJ6 C;  3WTX C;  1QNT A;  2GOX B;  5KAF C;  1QA6 A;  3G1O A;  1RKT A;  2JZY A;  3M7G A;  4CH7 A;  5LEJ A;  2BW3 B;  2DDB A;  5C44 J;  1FC3 A;  4P55 A;  1SAU A;  3F21 A;  1JUS A;  2CUZ A;  2K9Q A;  3KE2 A;  4E7H A;  4UUS A;  1FYL A;  3T8R A;  2W7N A;  2A69 F;  3QRF F;  1REP C;  3K9T A;  4OIN F;  3ZP5 A;  3ZQG A;  5KHD A;  1LEB A;  5D4R A;  3PSF A;  2LY9 A;  3OL4 A;  3LAP A;  2JN6 A;  2Y30 A;  3PO3 J;  4BYY A;  3KIO A;  4HV5 A;  2JSC A;  1RR8 C;  1K79 A;  1YW9 A;  1R1U A;  1PJR A;  3JR9 A;  2EIJ H;  3KP7 A;  3GFL A;  1BL0 A;  2QSH X;  2NVQ J;  2E5N A;  3B6A A;  3OYE A;  2E1C A;  1SVM A;  2JPB A;  4C3J J;  3BPV A;  1ZRD A;  5A2Q K;  4JX5 A;  3CCJ I;  2FOK A;  2JA8 J;  1SMY F;  3W6V A;  1IUF A;  1RC9 A;  5DS9 A;  5DD8 A;  1V5G A;  4JX4 A;  2O8K A;  1E3P A;  3I9V 2;  2ZBK A;  5HNF A;  3BTJ A;  3BQY A;  5ERI A;  3LQQ A;  2D5V A;  1UHS A;  4MHG A;  2JSP A;  2QEN A;  2GA2 A;  3TW7 A;  1KZH A;  2JA5 J;  2BY3 A;  3H9Q A;  1ODD A;  4B8X A;  2BOL A;  1BR4 A;  1UZC A;  1XGS A;  2MGQ A;  1TNT A;  3HSF A;  4NB5 A;  4I7H A;  3B02 A;  1MNM C;  4ENK A;  2XAQ A;  4I0A A;  2ISY A;  3OOP A;  1LQ1 A;  3WTU C;  1YIJ I;  1HST A;  4EM2 A;  3DEE A;  2L7F P;  1FWZ A;  5D5X B;  4GRI A;  2DMP A;  4JYK A;  1HXD A;  1OR7 C;  2JA6 J;  1JHH A;  1MDM A;  1X1C A;  2VKH A;  2Y0S N;  4L9J A;  4RMN A;  1QRY A;  1T2K A;  2BYV E;  5F04 A;  2FF4 A;  5CQE A;  4XIC A;  2CYY A;  5K5O A;  1OCZ H;  4PJM A;  4EAT A;  1TQI A;  4L5E A;  1UCR A;  1S5L C;  3J81 K;  3U1K A;  2VKE A;  2JK3 A;  2OCC H;  1FPQ A;  1XS9 A;  4HDU A;  4G7Z F;  2W00 A;  1IZ1 A;  3M9A A;  1R00 A;  2NS8 A;  4JK1 X;  5HS7 A;  2HYG D;  1X3W B;  3IRR A;  1QPM A;  2DU9 A;  2IXS A;  1X1A A;  3OYJ A;  3S1Q J;  2KRH A;  2JVG A;  3CCY A;  4N9H A;  3ZQI A;  1K78 A;  4OAZ A;  1KA8 A;  2Y2Z A;  2K40 A;  1LFU P;  1GV5 A;  4L5I A;  1OCC H;  2Q0O A;  2MLK A;  2HOS A;  4MFD A;  2WAQ A;  2XAF A;  2ID3 A;  2DQL A;  1SFX A;  1TW3 A;  1HW1 A;  3GTO J;  3M1C A;  3S3N A;  2JT1 A;  4M6V A;  4NUB A;  3IWZ A;  5KNL A;  2GXB A;  4IVN A;  3KEQ A;  4XOT A;  1W0U A;  3HXL A;  2P6T A;  4P9U A;  2BBY A;  3TL4 X;  5IP9 J;  2OPT A;  1Z6R A;  4BAC A;  3K4K A;  3G6E I;  3RYP A;  1JXS A;  1ZHF A;  4PCQ A;  3N05 A;  1VQM I;  1FOY A;  4WX9 A;  4BXF A;  4S0H B;  2IEK A;  4KFC A;  1D1C A;  3HRU A;  2O5R A;  2E60 A;  4EGZ A;  5IT9 Z;  1L3L A;  2DT5 A;  4C30 A;  5ED4 A;  4LLN A;  3P9I A;  4CCL A;  3TDZ C;  2OU2 A;  4DYC A;  1U9O A;  1DU6 A;  2HGC A;  1KU3 A;  3CUQ B;  1AOY A;  4AD9 A;  2AQF A;  4ZYD A;  3S16 J;  1M1E B;  5AIQ A;  2F5D A;  1ZGW A;  2RQQ A;  1H0M A;  4A93 J;  2EIM H;  4NHJ A;  1WZ2 A;  3EUK L;  3CLO A;  4EEF G;  3LFK A;  1I39 A;  4QPQ A;  1VI0 A;  1VQ6 I;  1OYY A;  3CMM A;  1YIO A;  3G73 A;  2W48 A;  3I59 B;  1FP1 D;  4AID A;  1S72 I;  3NAR A;  3ZGK A;  4G6D A;  5F08 A;  3CDI A;  2WAF A;  2I10 A;  3JRE A;  4MIM A;  4I09 A;  3TO7 A;  1KON A;  4BEH A;  4EJO A;  2XF6 A;  3PFI A;  5FFZ A;  3GFM A;  1D0Y A;  2LF8 A;  2L01 A;  3GX4 X;  1JKO C;  4IZZ A;  4N4O B;  1Z7L A;  2M2E A;  3QWL A;  4OIR F;  2B0L A;  3K70 C;  3HM5 A;  4C2U A;  2LRD A;  4XRM A;  3K4L A;  4W97 A;  1WJE A;  2YSR A;  4A3D J;  1X58 A;  2QKM B;  3M4O J;  5F64 A;  1R1V A;  1CGP A;  3CCL I;  5FD6 A;  2HVS A;  1CF7 B;  1ZAR A;  3S2W A;  4ABZ A;  2VN2 A;  2EQR A;  3I4N J;  4XMY A;  5HNH A;  2W57 A;  5F27 A;  2XRL A;  1IN8 A;  3TP3 A;  5L3E A;  3V8K A;  1GXQ A;  2R7R A;  3HKZ N;  2LKS A;  4A0Y A;  1F1Z A;  2A3S A;  2WB1 A;  1PP7 U;  3A01 B;  2XF5 A;  3R6S A;  3FMR A;  3WTW C;  3HOT A;  4IX7 A;  1R49 A;  2DCE A;  1TQP A;  3BQZ A;  3F8F A;  4A3G J;  2XAJ A;  1T0F A;  3FXQ A;  2LVS A;  1HKQ A;  2EA4 A;  2XAH A;  3BR1 A;  3H3Z A;  2CUE A;  5J1Y A;  2YU9 J;  1MNE A;  1MJB A;  2KIS A;  2EIN H;  2PBI A;  4F3Q A;  2FA5 A;  4KN4 X;  4EMS A;  1BI3 A;  5EZG A;  4DNC A;  2DA1 A;  1ZK8 A;  2EWN A;  2EFP A;  3JSP A;  4ESJ A;  4RGR A;  4BBR J;  1LVK A;  5K7Z A;  1Z05 A;  3PL8 A;  2IGM A;  2PJR B;  1WWX A;  1I27 A;  3VPR A;  4A0Z A;  2QLZ A;  2VJI A;  4BQO A;  2X4H A;  4R79 A;  3CCU I;  2R7F A;  3WU2 C;  2LG4 A;  4JOM A;  3Q9V A;  3SDB A;  4J00 A;  2PN6 A;  4CCJ A;  5CVR A;  1EJ9 A;  5L3D A;  2MA3 A;  1OYW A;  2ZCW A;  1EV7 A;  4BY1 J;  2PFB A;  4HF0 A;  4YEL A;  4QLC U;  5AON A;  3Q0V A;  1ETX A;  5LRR A;  4QSH A;  4CXF A;  4PGG A;  1ZH5 A;  1A31 A;  4G6T B;  3RQ4 A;  4JBA A;  3CCR I;  4ENJ A;  5E79 C;  1U3E M;  4Y7N J;  1E3H A;  1JKQ C;  2CRG A;  1SEU A;  4IO9 F;  1W5C C;  2B63 J;  3VSK A;  2P6S A;  3PQK A;  3DKX A;  3ZXS A;  1K78 B;  1H88 C;  2KRF A;  1BR1 A;  2KRC A;  1BM9 A;  4M3D A;  3JRG A;  3CO6 C;  3ONQ A;  4UVA A;  2F5V A;  3HRM A;  1I5Z A;  1QZE A;  2AO9 A;  5GAH J;  2GIZ A;  3H5N A;  3VOD A;  3CME I;  2VT2 A;  3PNT A;  5FLX K;  3V7S A;  1O57 A;  4L0Z B;  3EYI A;  1TTY A;  2WV1 A;  5GPA A;  1ULY A;  4BJ5 C;  1FYK A;  1OQY A;  1AKH B;  1S3J A;  1MH4 A;  2CJJ A;  3I5U A;  3S14 J;  5FGM A;  4ON0 A;  4FCY A;  1ETV A;  1XTA A;  3VYS B;  3TKY A;  2ZJQ F;  1GXP A;  4XRF A;  1CQT A;  4Q47 A;  2HOT A;  1OIS A;  5IYB J;  2WY8 Q;  1IRZ A;  3WU1 B;  1R6R A;  5LLQ A;  2HVQ A;  2QBY B;  3HSR A;  3FX3 A;  4NQW A;  2DA5 A;  2KKO A;  3F0C A;  1P7J A;  4LK0 F;  2X0L A;  1JE8 A;  2L2O A;  5TJJ A;  2HDD A;  5KVR A;  3PUB A;  2O9L A;  1AU7 A;  4IHS A;  2MD0 A;  3BR3 A;  2IS1 A;  4P96 A;  4HSR A;  4A69 C;  3TDU C;  4FAS D;  5GP9 A;  5D8L B;  4BE0 A;  5H2F C;  1HA8 A;  4XL9 A;  1YJN I;  2V1U A;  2R5Y A;  1FBU A;  3E3V A;  2YR2 A;  2X9D A;  2HQR A;  4RLQ A;  2KLO A;  5D5V B;  1ZLK A;  1W7P D;  5DTD A;  2OTJ I;  2R7D A;  2ESH A;  1ZYR F;  3GUD A;  2X6W A;  2QEX I;  4YIF A;  2ZB9 A;  2DYR H;  2V1D A;  4L9T A;  1LE8 B;  2ZFU A;  1JTX A;  3ECO A;  3AG2 H;  4Z2Y A;  3W2A A;  4DBQ A;  2Q1Z B;  1J75 A;  2DFE A;  1RIO H;  3DTK A;  3A02 A;  1U6G A;  3T8T A;  2AXL A;  3ZQF A;  3L2W A;  1BN5 A;  1U9N A;  1QBJ A;  5E3M A;  4E6K G;  4ZZL A;  3RPU A;  1S7A A;  4U7D A;  2V9V A;  2OV7 A;  4D9J A;  4OIQ F;  5EG0 B;  3HL2 A;  4IQJ A;  3BG3 A;  2VB6 A;  1X19 A;  2M5W A;  1WI3 A;  1XD7 A;  4BQN A;  1HBX G;  1V4R A;  2M7B A;  4RAF A;  5EZH A;  1X4O A;  4L0Y B;  2FQ3 A;  1TLH B;  2HKX A;  3RSN A;  2HWV A;  2HZT A;  1AA7 A;  1OMI A;  5J4Y A;  3HPG A;  2Y9Y A;  3G3Z A;  1LNW A;  3S1M J;  2EPF A;  2P4W A;  3SHF A;  5HOD A;  3GW2 A;  3S17 J;  1IUY A;  2BHY A;  2AS5 F;  2PMZ N;  2OA4 A;  2DT7 B;  5GAD J;  2BEO A;  1MBF A;  3C3W A;  4WF2 A;  1MMG A;  5DEQ A;  1MZB A;  3D1N I;  4M9S A;  2JMW A;  3J81 Z;  2FU4 A;  4BHC A;  2IP2 A;  4EQQ A;  5FKO A;  1YW8 A;  4A3F J;  3FHN A;  2H09 A;  1J2X A;  4BQQ A;  3PM1 A;  2LNB A;  3ASO H;  4U0W A;  4JQF A;  1IXR C;  1V54 H;  1HQC A;  1D3Y A;  2COB A;  4XOP A;  3VB2 A;  1EH7 A;  1BBY A;  2Z16 A;  1LFP A;  2L54 A;  3KP5 A;  2VQL A;  1E0E A;  1IAW A;  2HQN A;  2K3F A;  1B72 A;  3WGH A;  1MGT A;  2LC2 A;  1ZN2 A;  3E6M A;  2UV1 A;  4A6E A;  3G4S I;  1TBX A;  2XB0 X;  4XKW A;  1J7K A;  3DQV C;  4IHW A;  3GCM A;  3BTI A;  3I4M J;  3PNV A;  4LIV A;  1ZLJ A;  2DPU A;  4WXD A;  3MKZ A;  3FHZ A;  1O4X A;  1XSV A;  2HXO A;  4NNJ A;  3HG9 A;  1MW7 A;  4U87 A;  1BR2 A;  5D8K B;  2RV8 A;  5K7F A;  2MAB A;  1WSU A;  2BY1 A;  4PSX A;  1XGO A;  4A12 A;  2FX0 A;  5BS6 A;  3X2Q H;  2A6H F;  4BAY A;  1EA3 A;  1FOK A;  2QSG X;  3ZRG A;  2JQ7 A;  5CPR B;  2VBZ A;  4IHT A;  4IHX A;  1WI9 A;  4XOR A;  4Y15 A;  1VF9 A;  3DEU A;  4E7Z A;  2F6C A;  1U5T A;  3EUA A;  1GVD A;  1SD7 A;  1UEL B;  3C7J A;  1O3T A;  2PMH A;  2DO7 A;  5K5R A;  3CO7 C;  1J09 A;  1ZR2 A;  1WVR A;  4KUM A;  2KHM A;  3K4N A;  1YS7 A;  3CCQ I;  1Y39 A;  4A3C J;  2UXX A;  3OYG A;  2A5W A;  5HOO A;  4HPQ A;  2CV0 A;  2KP6 A;  1IJW C;  2FOW A;  3RKQ A;  2E1O A;  3A03 A;  4I01 A;  1W36 C;  4M3E A;  2LYC A;  5ILS A;  3JRF A;  3GLL A;  2KIQ A;  3CDL A;  2GQQ A;  3KLN A;  4NC7 A;  1RZ4 A;  2RVC A;  3ZOB A;  4DYQ A;  3MKW B;  4KA4 A;  1DDN A;  2IT0 A;  2V6E A;  1KQ8 A;  3GTQ J;  3DTE A;  2MG4 A;  2DA2 A;  2XV4 S;  4D1Q A;  4IHY A;  1G4D A;  3HRS A;  1QVT A;  2E1N A;  2W24 A;  3BOQ A;  4AUX A;  4EJV A;  5E20 A;  5FB2 A;  1Q1H A;  2NS7 A;  1VQ9 I;  1B8I A;  3OYD A;  1IW7 F;  1Z7U A;  2L4A A;  2X6O A;  3UR3 C;  5J1U A;  1SFU A;  3H9G A;  4J19 A;  1NG7 A;  3CD6 I;  3HOV J;  3BJA A;  2IJL A;  1R4N B;  3C18 A;  3I3L A;  1KU9 A;  2EK5 A;  3Q0U A;  4MQ9 F;  3LSI A;  2ICW G;  3REO A;  5HVQ C;  3V4G A;  2QM3 A;  3HOX J;  5BPD A;  5JHF A;  2VIX A;  2IGO A;  3PSI A;  2L3D A;  1LDJ A;  5JHU A;  1JT6 A;  1Z67 A;  4ZJZ A;  3TQN A;  1R22 A;  2NVU B;  4LLG F;  4YFX F;  3OYL A;  1WHU A;  2VQG A;  3K1P A;  3OYI A;  1YO5 C;  4HF1 A;  4DBR A;  4PFO A;  3I4P A;  1EKE A;  2DOF A;  5E3L A;  3K69 A;  1MD0 A;  1Z6T A;  2DFH A;  2DAO A;  4HBL A;  3BR0 A;  4D7M A;  1KQ9 A;  1YS6 A;  2E1M C;  2ME0 A;  4FET A;  4LJZ F;  5IP6 A;  4E70 A;  1ITY A;  4IRG A;  2DK8 A;  4KMU X;  4BHB A;  4QWQ A;  4B1R A;  5HS8 A;  2LKP A;  3CJN A;  4D5F A;  3LSK A;  3F8N A;  2TDX A;  2ZXH A;  3EPZ A;  1K4S A;  4PFP A;  2Z1D A;  4A3I J;  3GTL J;  3GTP J;  4CSW A;  2JTV A;  1SFE A;  5HLT A;  2GBY A;  1FLI A;  1MBH A;  2QQ8 A;  4O5V A;  6PAX A;  3EUH A;  3GZ6 A;  1XMK A;  1QU3 A;  3BP8 A;  5JVG F;  4MGR A;  2CGP A;  5IOY A;  2D1V A;  2HFH A;  3QU6 A;  3R0J A;  1YLF A;  2X51 A;  2HXI A;  1TWH J;  1X2M A;  2WAD A;  4II2 A;  4F92 B;  3CUQ C;  1LPQ A;  1A6I A;  2Z5U A;  4ZC3 A;  5EEA A;  4MO7 A;  1W7P A;  5J6X A;  4LG3 A;  2IA2 A;  4PSW A;  1I50 J;  3CQZ J;  3KP6 A;  4H0E A;  3U2R A;  3G1M A;  1SFK A;  3TOB A;  3VYU B;  4V2F A;  3H3U A;  3OYH A;  1K7A A;  5F1J A;  4GCV A;  4DQ2 A;  1GDT A;  2M0C A;  4PZJ A;  1T39 A;  4ZDP A;  3LQR A;  2AXT C;  1NK3 P;  3HYI A;  2DXI A;  3IRQ A;  1DUX C;  1HF0 A;  2Z3Y A;  4QTR A;  1IN4 A;  1OR7 A;  1WJF A;  2OF7 A;  2CU7 A;  3VOE A;  5FRN A;  2XAS A;  1IRG A;  2C6Y A;  5J3L A;  5E8I A;  1ORK A;  5GAE J;  1YE9 A;  3T1B A;  2DMQ A;  3RJP A;  4PJ0 C;  5FFX A;  4Z6Y A;  1AHD P;  2ELJ A;  1YYV A;  5FLX Z;  3KYC B;  2FRH A;  5ICF A;  1ETK A;  2EZI A;  2H1L A;  1YG2 A;  4YG2 F;  2HEO A;  4CHU A;  3W2W A;  1VTN C;  3WG9 A;  2CS3 A;  2I8D A;  3JSO A;  1KU2 A;  2XUB A;  1JI8 A;  1P9Q C;  2QWW A;  3OYF A;  2K27 A;  4MTD A;  1VQO I;  1O3Q A;  2PEX A;  3IAS 2;  2EZK A;  3LST A;  2R7X A;  3HOZ J;  3OYM A;  2PI0 A;  2WA0 A;  2QQB A;  1ETO A;  3QPS A;  1NG6 A;  1QVU A;  1TP4 A;  2QZ8 A;  4PJN A;  3SFZ A;  2R7U A;  4DOZ A;  3GLX A;  3DKW A;  1IN5 A;  5TGT A;  2XF7 A;  1XX5 A;  2DI3 A;  4OAY A;  1LUJ B;  1U5T B;  2M8G X;  3BG5 A;  1VQP I;  4BNC A;  2J5P A;  3QYB A;  3ERM A;  4WCG A;  2ZJR F;  3OYB A;  5F6F A;  5GTI C;  3OS2 A;  3VWB A;  1K83 J;  1U2W A;  3CUO A;  3D5S C;  4XLA A;  3S2H J;  2XGE A;  1X1B A;  4AYB N;  2KFD A;  4GDF A;  1IRF A;  4RAY A;  3BDD A;  3H5A A;  2PQ8 A;  2VJJ A;  1QZY A;  1E3O C;  1VQ4 I;  4CCK A;  5CVI A;  4D7N A;  1IV8 A;  3I71 A;  3U1D A;  4EV0 A;  1P4X A;  3E5U A;  2X6X A;  2TRT A;  3CF2 A;  5JLW A;  3I56 I;  1WH7 A;  5LEK A;  2E1M B;  2LY2 A;  3E97 A;  3PIP F;  2OQG A;  3TED A;  2VBX A;  3B6C A;  3Q9S A;  3L2V A;  2O6G E;  1ZG3 A;  4E7K A;  2VT3 A;  4FT8 A;  2ZME B;  1DPR A;  2L9V A;  5KCM A;  3AG4 H;  2RDP A;  2QSF X;  4G9Y A;  1HKS A;  5KAI C;  4F52 A;  4IRI A;  2NRA C;  2M34 A;  2ESN A;  4C3H J;  4HST A;  2LOO A;  2MC3 A;  1ON2 A;  4LGW A;  2XAU A;  5DCF A;  2E19 A;  3RPU D;  4B47 A;  3BG9 A;  2HQ5 A;  3K6G A;  3OOU A;  3HOU J;  5LRS A;  1HW5 A;  3C2H A;  1X1D A;  2A07 F;  1DP3 A;  4ITV A;  4AWX B;  3DU6 A;  4FE4 A;  1T33 A;  2CFO A;  1XSX A;  3G71 I;  4Q4Z F;  5CKT A;  2DLL A;  3DEW A;  1RET A;  2EA2 A;  2YU3 A;  5LHH A;  2DOD A;  3IH3 A;  3IV5 A;  2K5C A;  2K9M A;  4XSZ F;  1HDP A;  2P5L C;  4B44 A;  1W1W E;  4IOC F;  5IYD J;  1P2F A;  5B3S H;  4A3B J;  3LSM A;  4AIJ A;  4U0Y A;  3JRD A;  4IXA A;  3I64 A;  3WTY C;  3V7C A;  1BOA A;  2M8E A;  1ACI A;  3HUG A;  2HYJ A;  1I3A A;  2VAS A;  1LDD A;  5B5E C;  1PP8 F;  2M7A A;  2QVO A;  3LA7 A;  1JKP C;  2COM A;  2LF7 A;  3O8H A;  1BOB A;  1YHQ I;  1B6A A;  1GT0 C;  2I5U A;  4BJT A;  3RPQ A;  3VFZ A;  2FQ4 A;  2DK5 A;  1SD4 A;  3ZCO A;  3HOW J;  3MAJ A;  3WHB A;  5CYV A;  3F6O A;  1BJZ A;  3DBL B;  3BLY A;  4IQ4 A;  1XG1 A;  4RAG A;  2K9L A;  4UUS B;  1WCM J;  2DJI A;  2HR3 A;  1V5F A;  4NC6 A;  2XGX A;  4ENM A;  1NHA A;  3HDD A;  1W7P B;  2R7O A;  4KNY A;  3BG6 A;  4BGD A;  2W84 A;  3IH4 A;  2H94 A;  2W85 A;  2WAE A;  2Y0M A;  3CCV I;  3DFG A;  2G9W A;  3RZD J;  3CCE I;  4YII A;  1S6L A;  2JUG A;  3A0B C;  5HDK A;  3OS0 A;  2F48 A;  3LSJ A;  1S8N A;  2GZW A;  1K61 A;  2K86 A;  2ME6 A;  3ZPL A;  1D0Z A;  5DUI A;  3E5X A;  4N9I A;  4XKB A;  1BI1 A;  3FK7 A;  4DZJ A;  5D6E A;  1QQI A;  4C2M J;  1FMW A;  3WHC A;  3V42 A;  4E4H A;  3DBH B;  4G94 A;  1X3U A;  2O8X A;  2XSJ C;  3OYK A;  1QGP A;  2DT6 A;  2Y9Z A;  2IS2 A;  5FKM A;  1DGR M;  3PNY A;  5L3C A;  2LR8 A;  5J1R A;  1P92 A;  2ZC2 A;  3R4K A;  1QHH D;  3K4B A;  4G12 A;  3VSL A;  3LA3 A;  4HF2 A;  3MKY B;  2IGK A;  1SAN A;  3CCS I;  4L18 B;  2LRE A;  2QQ9 A;  5KK1 A;  4B09 A;  1ZAO A;  2KPM A;  1T8I A;  2HTJ A; 
#chains in the Genus database with same CATH homology
 2IVM A;  1MDM B;  2ZJ2 A;  4ZYE A;  3BZ6 A;  3GWZ A;  2LSO A;  2PJP A;  1R5H A;  3L00 A;  1RUO A;  2FML A;  4HLY A;  4RB2 C;  3FM5 A;  2ZKZ A;  2XKO A;  4M71 A;  3QOP A;  4LG0 A;  3BRO A;  1XMA A;  2VXZ A;  4KIF A;  3R60 A;  2ELH A;  2NS0 A;  3MZH A;  1XN7 A;  2KJB A;  4XBF A;  1U78 A;  2CWE A;  3GF2 A;  4OIO F;  2VON A;  1LEA A;  1YW7 A;  2BV6 A;  2PG4 A;  5L3F A;  4LB6 B;  4KT5 C;  2V6C A;  2NNY A;  4ENN A;  1J0R A;  3RYR A;  2XHK A;  2P7V B;  1OKR A;  3ULQ B;  2GXG A;  3WTS C;  2D45 A;  3DPL C;  3O6B B;  3ZQ7 A;  3HHH A;  3K1N A;  3QPT A;  3DV8 A;  1FT9 A;  2Q2E A;  4WXH A;  3ISP A;  1P4A A;  2G7H A;  1FZP B;  4ZYH A;  2EFW A;  2FMY A;  1HKT A;  2EFN A;  3KP4 A;  1D8K A;  4MEY F;  4LB5 A;  1W5S A;  5L3B A;  4MQV A;  2OAZ A;  2O61 A;  2OZU A;  4HQE A;  4WWC A;  2UWM A;  4WXC A;  2F5C A;  2DQR A;  3CTA A;  3RIR A;  1XB4 A;  4O6J A;  5LHG A;  3EQL F;  1G3T A;  2Z33 A;  2YPR A;  2V1X A;  2Y48 A;  1XDS A;  3E6B A;  1XGN A;  3RDI A;  5IT3 A;  1WRJ A;  5J8F A;  5D5W B;  3WTV C;  4HYE A;  1FY7 A;  3ECH A;  1V3F A;  2IRF G;  4BH9 A;  1W5T A;  4CDG A;  4FHT A;  3K2Z A;  5TRD A;  3WOD F;  5DD4 A;  5LBQ A;  2XAG A;  3EDP A;  1XCV A;  2JPC A;  4BXU A;  1I6X A;  3ZMZ A;  2FBI A;  2ISZ A;  1LB2 A;  5CVV A;  3ABU A;  1T38 A;  5E8G A;  1KYZ A;  3WTZ A;  5AIP A;  2EV5 A;  4ZZD A;  1TW2 A;  2F2E A;  1LVA A;  1KYW A;  3HHG A;  1JHF A;  1I1G A;  4I0B A;  1FBS A;  1E2X A;  3RI4 A;  2DFI A;  1SD6 A;  3H92 A;  1J59 A;  1YQA A;  4S05 A;  4GYG A;  2H6B A;  1KU7 A;  2OD5 A;  3V8L A;  3DP7 A;  3L7W A;  3SZP A;  1B4A A;  2VE8 A;  3HTU A;  2F5E A;  3IHU A;  5L3G A;  3JW4 A;  2ZO4 A;  1G6N A;  1O7F A;  2KJC A;  5EEG A;  1I1S A;  3O2P E;  3GO5 A;  5E1X A;  2QUF A;  1BI0 A;  5D4S A;  2OQR A;  2GA1 A;  1T6S A;  3U9G A;  3COA C;  3M1E A;  4EVI A;  5BPI A;  4HLX A;  1B1B A;  2P7C B;  3BPX A;  4LMY A;  2XKP A;  1JGS A;  4P5O A;  3DPT A;  1Y0U A;  5H20 A;  4I02 A;  3TOA A;  1U5T C;  3GVA A;  2VBY A;  1B9N A;  1R58 A;  3RKW A;  3QU3 A;  3GFI A;  1PUE E;  3NEU A;  3KZZ A;  2V79 A;  3M8E A;  3ML6 A;  3F22 A;  3BJ6 A;  4U88 A;  2FEZ A;  1XCB A;  4PGH A;  4OU0 A;  2GWR A;  4CO8 A;  3V8J A;  1RI7 A;  1IXC A;  2VC0 A;  1D5V A;  4UVB A;  4YFN F;  2A61 A;  3JAM Z;  4RAZ A;  3N4M A;  3CUQ A;  3ZMD A;  1DPU A;  2MD5 A;  4R1H A;  2VOO A;  2IA1 A;  3WGG A;  1ZGJ A;  2FBH A;  4UV9 A;  1PDN C;  4G8X A;  3I59 A;  3AAF A;  5J8C A;  3M8F A;  1G3Y A;  4HZF A;  4Y17 A;  1YTY A;  1F5T A;  2YX7 A;  3ELK A;  4K2E A;  3ZN1 A;  3GEZ A;  2KIM A;  2YX4 A;  1UHM A;  1R36 A;  1K6O A;  5HDN A;  4M6Y A;  1ZG1 A;  3QPH A;  1EH6 A;  3GFJ A;  3DF8 A;  4RGX A;  1CF7 A;  2ZNY A;  1U8R A;  3KCC A;  1LJ9 A;  3ABT A;  2H6C A;  3FM3 A;  3R0A A;  4M9Z A;  1ZG5 A;  4LD5 A;  3ZMS A;  5FO5 A;  1ZRF A;  4EM0 B;  2M87 A;  2HOE A;  2M45 A;  3PQJ A;  4G7O F;  2Y75 A;  5HLG A;  2STT A;  1FSH A;  1QO0 D;  2K02 A;  4A2U A;  4ETS A;  2H27 A;  3OV8 A;  4AVP A;  2HYF A;  4ZYG A;  5LHI A;  1C0W A;  1RNL A;  4M74 A;  1S7O A;  3P9C A;  4RGU A;  5DV5 A;  4M72 A;  3P7N A;  4Y13 A;  3K0L A;  4EM1 A;  3D5L A;  3FMS A;  4CYD A;  3WE2 A;  4FX4 A;  3Q5F A;  2STW A;  3WU0 A;  3R61 A;  4G7H F;  2IA0 A;  1BI2 A;  1J9I A;  5ILV A;  4HX8 A;  4P9F A;  3KZY A;  2D2W A;  4HX4 A;  2EFO A;  1OYI A;  4ASN A;  3KEO A;  3JTG A;  3GYH X;  2W25 A;  1MJ9 A;  2BE5 F;  2J5O A;  3F8B A;  1Z91 A;  4U0V A;  2FNA A;  2EJR A;  4HV6 A;  3HRT A;  3I53 A;  2O3F A;  1IN6 A;  1O7L A;  2F5F A;  2HKO A;  3SQN A;  2A5Y B;  2Z99 A;  3O3K A;  3HSE A;  1GVJ A;  4KDP A;  2A68 F;  3KET A;  5HLI A;  5H6R A;  2XRO A;  1R5G A;  2QBY A;  2WTE A;  2CW0 F;  1TQM A;  3ERE D;  2CFX A;  4A0X A;  3F8C A;  2XRN A;  2RGV A;  4GYI A;  2DBB A;  1UST A;  3W6J B;  2VBW A;  2K7L A;  3J80 K;  2E7X A;  3GZ5 A;  1FNN A;  4N0B A;  1IF1 A;  4M9X A;  4PDK A;  3I54 A;  4LLL A;  4LK1 F;  2FNP A;  3QAH A;  3IKT A;  1MKM A;  3IKV A;  2A6E F;  4L5J A;  5LGU A;  4G6Q A;  3EET A;  2RNJ A;  3MCZ A;  4UVC A;  4KIC A;  2O03 A;  3NRV A;  4UXN A;  5LGT A;  3T5X A;  2EV6 A;  3P9K A;  1O3R A;  2HTS A;  2R3S A;  4KIG A;  3D0S A;  1J5Y A;  5DCM A;  4OOI A;  3F3X A;  2QYO A;  3K1M A;  4YFK F;  2BGC A;  2RKH A;  4OIP F;  2FXA A;  2O0Y A;  3QP6 A;  5E1W A;  4AIH A;  3JAM K;  1BIA A;  1YFH A;  2M30 A;  3F6V A;  1FP2 A;  4CGZ A;  2PMU A;  5ILU A;  3B73 A;  1P6R A;  1IN7 A;  1WQ2 A;  5H6Q A;  3MEX A;  3E6D A;  3FZV A;  3I58 A;  4U7B A;  2WWY A;  4EJT A;  1KGS A;  3F72 A;  1S29 A;  1SD5 A;  3SZT A;  4HAM A;  1G3W A;  4AIK A;  3TO9 A;  2VOD A;  4IPA A;  4RS8 A;  1RUN A;  2CSO A;  5E1Z B;  3ZMU A;  1FSE A;  2K4J A;  1STZ A;  2FBK A;  3HIF A;  2ZXJ A;  3LAJ A;  1EH8 A;  4IRH A;  2RC4 A;  2E7W A;  4LFU A;  2DPD A;  2P5K A;  1UB9 A;  2VOP A;  1Z1D A;  1XGM A;  2ACJ A;  4R8H A;  2CQK A;  3KP2 A;  3WTT C;  3SXY A;  3ZN0 A;  4KYW A;  3L9F A;  4M6X A;  1LDK B;  4RGS A;  1H9G A;  3FXR A;  3EYY A;  2NAZ A;  2HS5 A;  4GXO A;  1G3S A;  5JFR A;  1BC7 C;  1OPC A;  3RKY A;  4ZH4 F;  3FMQ A;  5HDG A;  2NYX A;  4CZZ A;  3KP3 A;  5ICE A;  2P8T A;  1BJA A;  1ZRE A;  4XLN F;  3JTH A;  4XSX F;  1XSD A;  5JR3 A;  4WK8 F;  3FXU A;  2EFQ A;  2Q8K A;  2CO5 A;  1ZGA A;  1BIB A;  2LDU A;  3J7A O;  5HS9 A;  1H9T A;  4I2O A;  3I0T A;  2CG4 A;  1E17 A;  3KFW X;  3L2C A;  3W6K B;  5DUK A;  3FF5 A;  1P4W A;  2OBP A;  2ZNZ A;  2EB7 A;  4ESB A;  3BJO A;  2UZK A;  1R7J A;  2KIF A;  1HW2 A;  2ADU A;  4O3M A;  5F1R A;  5ICC A;  2P5V A;  2IPQ X;  4F7Z A;  4ESF A;  4KMF A;  3NQO A;  4FX0 A;  4RB3 C;  1ONV A;  5K5Q A;  1HSJ A;  5FD5 A;  3HTS B;  1R23 A;  3BY6 A;  2NNN A;  5CVJ A;  5A2Q Z;  2Z9O A;  2RN7 A;  4HX7 A;  3VEP A;  2DTR A;  3DXJ F;  1MJA A;  3FWE A;  5DCM B;  4UHT A;  4MTE A;  4UNO A;  2WV0 A;  1UFM A;  1D8J A;  5CJ9 A;  2MH2 A;  1B59 A;  5CLS A;  3ROU A;  3TO6 A;  5IT9 K;  4GO1 A;  4OMY A;  4KIB A;  2K4B A;  1T98 A;  1A04 A;  3WE3 A;  1R1T A;  4HDV A;  3RTR A;  4S04 A;  3F23 A;  2DW4 A;  4BHP A;  4TV7 A;  3LA2 A;  2FE3 A;  2KIU A;  4GGG A;  3T0Y A;  5ICG A;  4KN7 X;  4HA8 A;  4D0P A;  1BC8 C;  5JVT A;  3C1D A;  2HDC A;  1SAX A;  2L02 A;  2PLY A;  1QZZ A;  3V7R A;  4RB1 A;  3MZY A;  4Q48 A;  3TGN A;  2UXN A;  1AWC A;  1WKM A;  2MH9 A;  4L9V A;  3L09 A;  4HOB A;  4EJU A;  1FYM A;  2IW5 A;  5K1Y A;  1GHC A;  5CVU A;  1ON1 A;  4I98 B;  4LG0 B;  5D5U B;  4MNU A;  3F8M A;  4IF4 A;  3E6C C;  2L4M A;  1FBQ A;  5LGN A;  3IL2 A;  5DYM A;  2FSW A;  5JI6 A;  1FX7 A;  1Z9C A;  2ETH A;  1TNS A;  2D1H A;  3MWM A;  5DDG A;  2GAU A;  1F4K A;  4RB0 A;  1L0O C;  5E17 F;  4IJA A;  4EGY A;  3BWG A;  3IWF A;  1UHW A;  3RKX A;  2VE9 A;  3IC7 A;  3J80 Z;  4L9N A;  5E18 F;  2XIG A;  4XLP F;  2G7U A;  1XDU A;  2QQA A;  1SMT A;  1W4M A;  2RQP A;  2ZFW A;  3CDH A;  4EJW A;  2M1B A;  3N97 A;  5HLH A;  4BQA A;  1KQ0 A;  1USS A;  4CIC A;  4HW0 A;  2VC1 A;  2WC2 A;  3GXO A;  3HOS A;  2ZME A;  5EEH A;  4MEX F;  2GIV A;  3MQ0 A;  4HQM A;  2EV0 A;  1IXS B;  3ZMT A;  3ZMV A;  4A5N A;  1B9M A;  4OMZ A;  4M73 A;  3E5Q A;  2MLG A;  1ZRC A;  4A5M A;  4UUV A;  5BMZ A;  2MBF A;  1F9N A;  2XVC A;  2OZ6 A;  3QP5 A;  1O3S A;  4UV8 A;  3WGI A;  3KLO A;  5D6F A;  2JRT A;  3MFK A;  5BQT A;  4A6D A;  1DP7 P;  5BOX A;  4Q5S F;  3LWF A;  3WTX C;  1QNT A;  2JZY A;  3M7G A;  5LEJ A;  1FC3 A;  4P55 A;  3F21 A;  3KE2 A;  1FYL A;  3T8R A;  2A69 F;  3QRF F;  1REP C;  3K9T A;  4OIN F;  3ZP5 A;  1LEB A;  5D4R A;  3LAP A;  4BYY A;  4HV5 A;  2JSC A;  1K79 A;  1YW9 A;  1R1U A;  3KP7 A;  3GFL A;  2E1C A;  2JPB A;  3BPV A;  1ZRD A;  5A2Q K;  2FOK A;  1SMY F;  5DD8 A;  2ZBK A;  5ERI A;  3LQQ A;  4MHG A;  2QEN A;  2GA2 A;  1ODD A;  4B8X A;  1XGS A;  1TNT A;  3HSF A;  4NB5 A;  4I7H A;  3B02 A;  4ENK A;  2XAQ A;  4I0A A;  2ISY A;  3OOP A;  1LQ1 A;  3WTU C;  1HST A;  4EM2 A;  1FWZ A;  5D5X B;  1HXD A;  1JHH A;  1MDM A;  4L9J A;  1T2K A;  2BYV E;  2FF4 A;  2CYY A;  5K5O A;  1TQI A;  1UCR A;  3J81 K;  1FPQ A;  4HDU A;  4G7Z F;  1IZ1 A;  3M9A A;  1R00 A;  4JK1 X;  5HS7 A;  2HYG D;  3IRR A;  1QPM A;  2DU9 A;  4N9H A;  1K78 A;  1KA8 A;  4L5I A;  2Q0O A;  2MLK A;  2XAF A;  2DQL A;  1SFX A;  1TW3 A;  1HW1 A;  2JT1 A;  3IWZ A;  2GXB A;  4IVN A;  3KEQ A;  4P9U A;  2P6T A;  2BBY A;  1Z6R A;  1JXS A;  3RYP A;  1ZHF A;  4PCQ A;  4WX9 A;  4KFC A;  3HRU A;  4EGZ A;  5IT9 Z;  1L3L A;  2DT5 A;  5ED4 A;  4LLN A;  3P9I A;  3TDZ C;  2OU2 A;  2HGC A;  1KU3 A;  3CUQ B;  1AOY A;  4AD9 A;  4ZYD A;  5AIQ A;  2F5D A;  1H0M A;  4NHJ A;  3CLO A;  3LFK A;  1OYY A;  1YIO A;  3G73 A;  3I59 B;  1FP1 D;  4G6D A;  4I09 A;  3TO7 A;  4EJO A;  5FFZ A;  3PFI A;  3GFM A;  2LF8 A;  3GX4 X;  2L01 A;  4OIR F;  2B0L A;  2YSR A;  5F64 A;  1R1V A;  1CGP A;  5FD6 A;  1CF7 B;  1ZAR A;  3S2W A;  2VN2 A;  2W57 A;  1IN8 A;  5L3E A;  3V8K A;  1GXQ A;  4A0Y A;  1F1Z A;  2A3S A;  1PP7 U;  3WTW C;  3R6S A;  3FMR A;  3HOT A;  1TQP A;  3F8F A;  2XAJ A;  1T0F A;  3FXQ A;  1HKQ A;  2EA4 A;  2XAH A;  3H3Z A;  1MJB A;  2PBI A;  2FA5 A;  4KN4 X;  4EMS A;  1BI3 A;  4DNC A;  2EWN A;  2EFP A;  3JSP A;  4ESJ A;  4RGR A;  1Z05 A;  1WWX A;  1I27 A;  4A0Z A;  2QLZ A;  4R79 A;  2X4H A;  2R7F A;  3Q9V A;  2PN6 A;  5CVR A;  5L3D A;  2MA3 A;  1OYW A;  2ZCW A;  1EV7 A;  2PFB A;  4HF0 A;  4QLC U;  5AON A;  5LRR A;  4CXF A;  4PGG A;  1ZH5 A;  4JBA A;  4ENJ A;  1U3E M;  2P6S A;  3PQK A;  1K78 B;  2KRF A;  1BM9 A;  3CO6 C;  4UVA A;  3HRM A;  1I5Z A;  3VOD A;  2VT2 A;  5FLX K;  3V7S A;  1O57 A;  4L0Z B;  3EYI A;  1TTY A;  1FYK A;  1ULY A;  1S3J A;  3I5U A;  5FGM A;  4ON0 A;  3TKY A;  1GXP A;  4XRF A;  4Q47 A;  3WU1 B;  5LLQ A;  2QBY B;  3HSR A;  3FX3 A;  4NQW A;  2KKO A;  1JE8 A;  4LK0 F;  2X0L A;  5TJJ A;  5KVR A;  4IHS A;  4P96 A;  3TDU C;  5D8L B;  2V1U A;  1FBU A;  3E3V A;  2YR2 A;  2HQR A;  5D5V B;  1ZLK A;  1W7P D;  2R7D A;  2ESH A;  1ZYR F;  3GUD A;  4YIF A;  2V1D A;  4L9T A;  3ECO A;  4Z2Y A;  1J75 A;  1RIO H;  1U6G A;  3T8T A;  2AXL A;  1BN5 A;  1QBJ A;  4ZZL A;  3RPU A;  1S7A A;  4U7D A;  2V9V A;  4OIQ F;  2M5W A;  1HBX G;  1XD7 A;  1V4R A;  4L0Y B;  2FQ3 A;  1TLH B;  2HKX A;  2HWV A;  2HZT A;  1OMI A;  3G3Z A;  1LNW A;  2P4W A;  3SHF A;  3GW2 A;  1IUY A;  2AS5 F;  2OA4 A;  2BEO A;  3C3W A;  4WF2 A;  5DEQ A;  1MZB A;  4M9S A;  3J81 Z;  2FU4 A;  4BHC A;  2IP2 A;  4EQQ A;  1YW8 A;  2H09 A;  1J2X A;  2LNB A;  4U0W A;  4JQF A;  1IXR C;  1HQC A;  1D3Y A;  3VB2 A;  1EH7 A;  1BBY A;  2L54 A;  3KP5 A;  1IAW A;  2HQN A;  3WGH A;  1MGT A;  1ZN2 A;  3E6M A;  4A6E A;  1TBX A;  1J7K A;  3DQV C;  1ZLJ A;  2DPU A;  4WXD A;  3FHZ A;  1XSV A;  5D8K B;  2RV8 A;  1WSU A;  1XGO A;  4A12 A;  5BS6 A;  2A6H F;  4BAY A;  1FOK A;  2VBZ A;  4IHT A;  1WI9 A;  4Y15 A;  3DEU A;  1U5T A;  1SD7 A;  3C7J A;  1O3T A;  2PMH A;  2DO7 A;  5K5R A;  3CO7 C;  4KUM A;  1YS7 A;  2UXX A;  5HOO A;  4I01 A;  5ILS A;  2GQQ A;  3KLN A;  4KA4 A;  1RZ4 A;  2RVC A;  2IT0 A;  1DDN A;  1KQ8 A;  2XV4 S;  1G4D A;  3HRS A;  2W24 A;  2E1N A;  3BOQ A;  4EJV A;  5FB2 A;  5E20 A;  1Q1H A;  1IW7 F;  1Z7U A;  2L4A A;  1SFU A;  3BJA A;  2IJL A;  3C18 A;  1KU9 A;  2EK5 A;  4MQ9 F;  3REO A;  5HVQ C;  3V4G A;  2QM3 A;  5BPD A;  2L3D A;  1LDJ A;  5JHU A;  3TQN A;  1R22 A;  4YFX F;  4LLG F;  3K1P A;  1YO5 C;  4HF1 A;  3I4P A;  3K69 A;  1MD0 A;  1Z6T A;  2DAO A;  4HBL A;  1KQ9 A;  1YS6 A;  4LJZ F;  4E70 A;  4IRG A;  2DK8 A;  4KMU X;  4BHB A;  4QWQ A;  5HS8 A;  2LKP A;  3CJN A;  3F8N A;  2TDX A;  2JTV A;  1SFE A;  1FLI A;  4O5V A;  6PAX A;  3EUH A;  3GZ6 A;  1XMK A;  3BP8 A;  4MGR A;  2CGP A;  2D1V A;  2HFH A;  3QU6 A;  3R0J A;  1YLF A;  3CUQ C;  2Z5U A;  1W7P A;  5J6X A;  2IA2 A;  3KP6 A;  4H0E A;  3U2R A;  3TOB A;  3H3U A;  1K7A A;  4GCV A;  4DQ2 A;  4PZJ A;  1T39 A;  3LQR A;  3HYI A;  3IRQ A;  1DUX C;  2Z3Y A;  1IN4 A;  1OR7 A;  3VOE A;  1IRG A;  2XAS A;  2C6Y A;  5E8I A;  3T1B A;  3RJP A;  5FFX A;  1YYV A;  5FLX Z;  2FRH A;  5ICF A;  1YG2 A;  4YG2 F;  2HEO A;  4CHU A;  1VTN C;  3WG9 A;  3JSO A;  1KU2 A;  2XUB A;  2QWW A;  2K27 A;  4MTD A;  1O3Q A;  2PEX A;  3LST A;  2PI0 A;  2QQB A;  3SFZ A;  2QZ8 A;  3GLX A;  3DKW A;  1IN5 A;  2DI3 A;  1U5T B;  4BNC A;  2J5P A;  4WCG A;  5F6F A;  1U2W A;  3CUO A;  1IRF A;  4RAY A;  3BDD A;  2PQ8 A;  1QZY A;  5CVI A;  3I71 A;  3U1D A;  4EV0 A;  1P4X A;  3E5U A;  5LEK A;  3E97 A;  2OQG A;  2VBX A;  2O6G E;  3Q9S A;  1ZG3 A;  2VT3 A;  4FT8 A;  2ZME B;  1DPR A;  2RDP A;  4G9Y A;  1HKS A;  4IRI A;  2NRA C;  2ESN A;  2MC3 A;  1ON2 A;  4LGW A;  5DCF A;  5LRS A;  1HW5 A;  2A07 F;  4AWX B;  1XSX A;  4Q4Z F;  2DLL A;  2EA2 A;  2YU3 A;  5LHH A;  4XSZ F;  2P5L C;  1P2F A;  4AIJ A;  4U0Y A;  4IXA A;  3I64 A;  3WTY C;  3V7C A;  1BOA A;  2M8E A;  3HUG A;  1LDD A;  1PP8 F;  3LA7 A;  2QVO A;  2COM A;  2LF7 A;  1B6A A;  3RPQ A;  3VFZ A;  2DK5 A;  1SD4 A;  3MAJ A;  5CYV A;  3F6O A;  2HR3 A;  2XGX A;  4ENM A;  1NHA A;  1W7P B;  4KNY A;  2W84 A;  2H94 A;  2W85 A;  2Y0M A;  3DFG A;  2G9W A;  4YII A;  1S6L A;  5HDK A;  1S8N A;  2GZW A;  2K86 A;  3ZPL A;  5DUI A;  3E5X A;  4N9I A;  1BI1 A;  5D6E A;  1QQI A;  4G94 A;  1X3U A;  2O8X A;  1QGP A;  5L3C A;  1P92 A;  3R4K A;  3LA3 A;  4HF2 A;  4L18 B;  2QQ9 A;  5KK1 A;  4B09 A;  1ZAO A;  2HTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...