1ONVA

Nmr structure of a complex containing the tfiif subunit rap74 and the rnap ii ctd phosphatase fcp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor IIF, alpha subunit
publication title NMR Structure of a Complex Containing the TFIIF Subunit RAP74 and the RNA polymerase II carboxyl-terminal domain phosphatase FCP1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1onvA00
1QPMA 1TTYA 3U9GA 4HOBA 1MGTA 2QLZA 2EWNA 3ZP5A 1XGNA 1S3JA 3KP4A 2A69F 1T98A 2E7WA 1XD7A 3VOEA 4KIBA 1FC3A 3MEXA 4M73A 1LDKB 5FFZA 2LDUA 1FX7A 3FX3A 3NEUA 4U0WA 2JZYA 1IRFA 4ENMA 2JSCA 2H6BA 2STWA 1HKSA 2HGCA 4BH9A 5E17F 2PQ8A 3K69A 1W7PA 2CG4A 4EMSA 4EJVA 2XVCA 3J80K 4KUMA 3TO9A 4FHTA 4WWCA 2O03A 3LWFA 1R1TA 4M9SA 2FSWA 4ENJA 3R61A 3TDUC 2Y48A 5KK1A 5CVIA 1U5TB 2P6TA 4AD9A 1KU3A 1KU7A 2HYGD 2PMUA 2CQKA 3H3UA 1FSEA 4N0BA 3HRUA 2OU2A 1YLFA 3JSOA 1KYWA 2OBPA 3RKXA 1XMAA 3ZN0A 1JGSA 3JTHA 3EUHA 4LGWA 1BI2A 1F1ZA 4HZFA 2UWMA 1O3RA 5HS7A 3IRRA 1TQPA 4L5IA 4CHUA 3K1NA 5DDGA 3MQ0A 5AIQA 2XAGA 2K4JA 4RGSA 2D1HA 3NQOA 5DUIA 3FWEA 1QBJA 4ESBA 4G8XA 2R3SA 4MQVA 4I2OA 2QM3A 5D6FA 5LBQA 2STTA 4QLCU 3QP6A 4UVBA 4GGGA 4I0BA 1ZRDA 4WXHA 2H6CA 1O7FA 5K5RA 1ON2A 1Y0UA 5DD4A 3LAPA 4U0VA 1DP7P 1XGMA 2O8XA 5FD5A 3KP2A 1R58A 3SXYA 4KNYA 2VBXA 3F8BA 1O57A 5H6QA 5TJJA 4CZZA 4HF0A 2F5EA 3P7NA 2OZUA 5L3FA 4UUVA 4NQWA 2C6YA 1GVJA 3KE2A 2H27A 1OMIA 3C1DA 2GA2A 1YW7A 2W57A 3CLOA 5LLQA 5DD8A 3I0TA 4YFXF 5ILUA 3TOBA 1R5HA 1PP8F 3L09A 4O3MA 2X0LA 5D4SA 3BJ6A 1WWXA 3ROUA 1ON1A 5E1ZB 2QUFA 1IUYA 1PP7U 4NHJA 4RAYA 4EJTA 1S29A 1ZN2A 2A07F 1CF7A 1V4RA 5DCMB 1Z6RA 2IA1A 2P4WA 2E7XA 2VE8A 1ZYRF 4M9XA 4MEYF 1DUXC 5BS6A 3BWGA 5D6EA 1Z1DA 1LDJA 1IN4A 2YU3A 3MZYA 5JFRA 1KGSA 2NNYA 1HBXG 1PUEE 4B8XA 2VOPA 2EV6A 2VC0A 2VE9A 3C18A 2OZ6A 3HTUA 1YQAA 4EVIA 3BDDA 1RUOA 4OIOF 4UVCA 3ZN1A 2HWVA 3C7JA 2Q8KA 3LAJA 1Q1HA 1LVAA 5L3BA 2RGVA 3HTSB 2OAZA 3DP7A 3E6CC 2FNAA 1FP1D 2DQRA 1G4DA 2XIGA 3KP3A 3F23A 3WU1B 1R1VA 3GX4X 1L0OC 2FEZA 1KQ9A 2TDXA 4MEXF 1TQIA 3Q5FA 2KJCA 1J2XA 2FXAA 2VODA 1L3LA 3H92A 3J7AO 2D45A 1T6SA 5CLSA 3DPTA 2IT0A 3F22A 2QWWA 4U88A 2RNJA 4RGXA 1IN6A 1FWZA 2DU9A 4U7BA 5D8KB 4KN4X 2HZTA 1XB4A 3ZMVA 5A2QZ 1Z7UA 2FOKA 4KDPA 2KIMA 1OYIA 4KIFA 4A0XA 2PI0A 2PBIA 3J81Z 3WODF 2RC4A 5JHUA 5JVTA 4ASNA 4LFUA 2IJLA 1U78A 5E1WA 4A6EA 2V1UA 3L9FA 4JBAA 5D4RA 1QNTA 2FQ3A 4RS8A 2FF4A 1LB2A 5H20A 4UV8A 2QQ9A 1ZREA 3RKWA 3LFKA 4OU0A 4CXFA 2DAOA 2FBIA 2M87A 4DQ2A 2KKOA 1VTNC 2PFBA 3L00A 4I7HA 2V79A 5TRDA 2CW0F 3ELKA 3E6DA 4S04A 5CVUA 1B1BA 2JPBA 4IXAA 4ENKA 1NHAA 1OPCA 3ZMDA 2E1NA 2HYFA 4EGYA 2R7FA 3M1EA 3PFIA 3WE3A 3SHFA 5HLIA 3MZHA 2VN2A 2DO7A 4LB6B 2D1VA 5A2QK 5AIPA 1LQ1A 3HSRA 3E5XA 4PGHA 4KT5C 3JW4A 3GFIA 3J81K 4ZZDA 4IRHA 2OD5A 1TNTA 3ECOA 3EETA 4JQFA 3R60A 6PAXA 4EQQA 4M9ZA 3HRTA 5JI6A 1QQIA 1USTA 4UV9A 1PDNC 2NRAC 3LQQA 5HS8A 2Y0MA 3ECHA 2G9WA 2G7HA 3CJNA 2PLYA 3KETA 2ETHA 4RB2C 4XSXF 2CWEA 1BIAA 1IZ1A 3F8FA 1R00A 2DBBA 4Q5SF 2CFXA 4MTEA 1EV7A 2A3SA 1HQCA 1GXPA 2WC2A 4IRIA 2YR2A 3E6BA 3F3XA 1BIBA 3QPHA 2IA0A 2HOEA 3ML6A 5ICCA 1SFXA 5HOOA 1BI3A 4IVNA 3IRQA 5IT9Z 2VT2A 1W4MA 3M9AA 1F4KA 3IKTA 4D0PA 4HV6A 4EM2A 1WQ2A 2XGXA 3GXOA 4ON0A 3M7GA 1FSHA 3BJOA 1EH6A 3FXQA 2RQPA 3WTSC 3D0SA 3LA2A 3WGHA 3V8KA 1IXSB 1P4AA 1YO5C 4G6DA 1UHWA 1YYVA 1YW9A 1UB9A 1T39A 2MA3A 1J59A 3T0YA 3HHGA 5J8CA 2OQRA 3HIFA 2Z5UA 5H6RA 5LEJA 1D3YA 3DF8A 4RGUA 2F5CA 4E70A 3QRFF 4LK0F 1MKMA 1JHHA 1YW8A 4L0ZB 1FYKA 2IW5A 4PDKA 1IN5A 3RJPA 3T1BA 4MTDA 1E2XA 3KP6A 4A5MA 4P5OA 3SQNA 2L4MA 3CTAA 4Q48A 1TW2A 1ZG3A 4WX9A 5AONA 1CF7B 3HRSA 4G94A 1TLHB 4EGZA 3OV8A 1U8RA 1G3YA 4A0ZA 1H0MA 2YSRA 3TO7A 2YPRA 4IRGA 5EEHA 1BI1A 2FBKA 3EDPA 1IN7A 1XN7A 4OMYA 5IT9K 2VBYA 4MQ9F 5LHIA 1LEBA 1R7JA 4UXNA 2ZNYA 1YIOA 1G3TA 3I53A 1ONVA 5KVRA 4MHGA 1SMTA 4ESFA 3KP7A 3AAFA 2P7VB 4OINF 4BAYA 4YIIA 4HLXA 5K5OA 1P2FA 1Z05A 2GA1A 3QAHA 4XLNF 4IJAA 2XROA 4EM0B 3V7CA 1J9IA 1TQMA 3L7WA 1S8NA 4G6QA 4EJOA 3O3KA 2LF7A 3RPUA 1EH7A 2EFQA 1U5TC 1OYWA 1GXQA 4N9HA 2QQAA 1D8JA 2DK8A 2L54A 1R5GA 5EEGA 3K1MA 4BYYA 2DK5A 2W24A 3E5QA 1MDMA 4R1HA 3LA3A 5HDKA 1ZLJA 2QVOA 1LNWA 2Y75A 3LA7A 1SD5A 2QENA 1I1GA 3V8JA 5HS9A 4CDGA 1WRJA 4EM1A 2DTRA 3BOQA 4KIGA 2XAJA 4G9YA 4LJZF 1FNNA 3GWZA 4HBLA 1W7PD 3N97A 2VT3A 5JR3A 3PQJA 1YTYA 1ZHFA 1S7AA 2CYYA 1MZBA 2FU4A 2UXXA 4AVPA 3EQLF 5LGUA 3K9TA 1HKTA 1BBYA 2IPQX 1K78B 1BM9A 2EB7A 4EJUA 2LF8A 4RAZA 1JE8A 2GZWA 2DI3A 2HTSA 1ZAOA 1MJ9A 1T38A 3WU0A 4P9UA 4HW0A 4WCGA 4WXDA 1XSVA 1T0FA 3CUOA 3ZMSA 2H09A 2VXZA 3EYIA 5LRRA 4NB5A 2QBYB 4GO1A 2IP2A 2EK5A 1FY7A 2AS5F 5BOXA 2HQRA 4IF4A 4HX8A 4RGRA 4G7ZF 1W5SA 4OIRF 5E20A 3N4MA 2HS5A 3IC7A 1FYMA 2K7LA 2D2WA 3ZMZA 5E8IA 1ZH5A 2PMHA 2EFNA 3GZ6A 1B4AA 2ELHA 5FB2A 2P5LC 1XSXA 2ADUA 3CUQB 2FBHA 3I71A 1LDDA 2ZFWA 2L02A 4U7DA 2LSOA 2M45A 5CYVA 4Q4ZF 4ZYGA 3MAJA 5BPDA 2F5FA 4EV0A 4G7HF 1I27A 1R22A 3ISPA 2KRFA 4LG0B 2MLGA 5F6FA 1TW3A 3C3WA 2RDPA 1IN8A 1Z6TA 2HFHA 4UHTA 4WF2A 2EFPA 3TKYA 4AWXB 4FX4A 1HXDA 2VBZA 2FMYA 4KYWA 3ABUA 3E6MA 4RB1A 3RYPA 2ISYA 4L18B 2XAQA 3HHHA 3I54A 1JHFA 2PJPA 4L9TA 4FX0A 3OOPA 2J5OA 3B73A 3VODA 1R23A 2GQQA 2OA4A 1IXRC 1MD0A 2XAFA 1XCBA 1K78A 2F5DA 5D5VB 2P8TA 4DNCA 1RIOH 1AWCA 2ISZA 5LEKA 3JSPA 4KMFA 3RPQA 1P4WA 1JXSA 1F9NA 3GFJA 2QQBA 4HX7A 4PGGA 2X4HA 3RI4A 4JK1X 5L3DA 3V8LA 4KA4A 4R79A 1R36A 5HVQC 4IPAA 1IRGA 3K1PA 5HLHA 2QBYA 2P6SA 3DQVC 3HSFA 3R0AA 2WV0A 1QZYA 2HKXA 3R4KA 5LGTA 4GYGA 1K6OA 2V1XA 1OR7A 2NS0A 1WI9A 3O2PE 3K0LA 2FRHA 3QPTA 2JT1A 4BNCA 4HV5A 4ZYDA 2JRTA 2IVMA 3FM5A 2NYXA 4LK1F 1U2WA 2IRFG 5F64A 5ILVA 5D5WB 3CUQA 1UCRA 3I4PA 2Z9OA 2MC3A 2ESHA 3RYRA 5DV5A 3GLXA 3I5UA 3IKVA 2K02A 4I98B 4Q47A 1B9NA 4ZYEA 3GF2A 1H9GA 4HDVA 3ZMTA 3Q9SA 4LG0A 2EA4A 1BOAA 2VBWA 5LHHA 3SZTA 1GHCA 1REPC 2V1DA 1FOKA 4ZZLA 1SD7A 5CVJA 3P9KA 1O7LA 5FLXZ 2GIVA 4BHCA 1T2KA 3GFMA 3KLNA 4GYIA 2L4AA 2V6CA 3ZQ7A 3ZPLA 1P92A 1YS7A 1ULYA 3ABTA 4A6DA 4PZJA 2HDCA 4TV7A 2KIUA 1UFMA 3KZZA 3HSEA 2EJRA 1STZA 3HRMA 3ULQB 2P5VA 4XRFA 5D5XB 5LGNA 4Y13A 3GW2A 1YFHA 1ZGJA 4YG2F 2FE3A 3G3ZA 2WWYA 2QYOA 2E1CA 2O6GE 2Q2EA 1HSTA 5E8GA 3I58A 5D8LB 1MDMB 2Z3YA 1FT9A 4YIFA 2FNPA 1USSA 3LSTA 4OIQF 3CO7C 3KZYA 1SD4A 1KYZA 5BPIA 2VC1A 3DEUA 4K2EA 4YFKF 4A0YA 3O6BB 4OMZA 5IT3A 2ACJA 1OKRA 1HSJA 2O0YA 5FLXK 1D5VA 3WG9A 1DPRA 2A6EF 1SAXA 2A68F 4XLPF 1E17A 4IHTA 4G7OF 1QGPA 2BV6A 3GZ5A 1Z91A 1WSUA 3I59B 5BQTA 4HF2A 5LHGA 1S6LA 3IWZA 1SFEA 3JAMZ 2Q0OA 3TGNA 1Z9CA 1LEAA 3KP5A 3MFKA 3F8CA 2FA5A 3WE2A 1IF1A 4LLGF 1BC8C 1ZG5A 4B09A 3GEZA 1ZRCA 4HX4A 5ICEA 2PN6A 2UZKA 2XV4S 1O3QA 4WK8F 3MCZA 2ZJ2A 4OIPF 2M1BA 1DDNA 3FF5A 3CDHA 4BQAA 3GUDA 1SFUA 4Y15A 4RB3C 2A6HF 3GO5A 4O6JA 3NRVA 1XGSA 1BI0A 3PQKA 3HOSA 4P55A 2EV0A 2EV5A 2W85A 2VONA 5FFXA 1K79A 1I6XA 5FGMA 2GAUA 2CO5A 4QWQA 1V3FA 4A5NA 4UVAA 3HUGA 3HYIA 3T8TA 3FZVA 2RKHA 1RUNA 1FPQA 3E5UA 3WTUC 3QOPA 2XKOA 4HA8A 1FYLA 2K86A 1XMKA 4BHPA 2QZ8A 2DPUA 1X3UA 3CO6C 3ZMUA 3WTTC 2M8EA 2NNNA 3FHZA 3W6JB 5CVVA 1SMYF 3IWFA 3VFZA 3WTWC 1P4XA 3DFGA 5ICGA 3JAMK 3GYHX 4CICA 5F1RA 2L3DA 1J7KA 5DEQA 2JPCA 4I0AA 2G7UA 3FMRA 1C0WA 3K2ZA 5LRSA 1HW5A 3BROA 3RIRA 1W5TA 4BXUA 3COAC 2O61A 3KFWX 4M71A 3I59A 2BEOA 2GXBA 1ZGAA 3WTYC 5CJ9A 3BJAA 2DW4A 5BMZA 4R8HA 5J6XA 1HKQA 3E97A 5FD6A 1J75A 4A12A 5E1XA 4CGZA 3S2WA 3HOTA 1FBQA 5L3CA 2M5WA 1ZLKA 5FO5A 1J5YA 4U0YA 2W25A 2F2EA 3WTVC 2DPDA 2BYVE 2JTVA 1J0RA 2CSOA 3FMQA 1B59A 4XSZF 3RTRA 3QP5A 3IHUA 3REOA 2DLLA 5ILSA 2LKPA 2XASA 4GXOA 5D5UB 4L0YB 1U5TA 4HDUA 2KIFA 2W84A 3KEOA 3BPXA 2PEXA 1QZZA 1IAWA 1B9MA 1FP2A 2YX4A 3V7SA 2R7DA 3M8EA 4KMUX 1KQ8A 3QU3A 3B02A 4HYEA 1IXCA 1BJAA 3FXUA 4L9JA 3P9IA 4F7ZA 3FM3A 1G3SA 4AIJA 4N9IA 3KEQA 2J5PA 3VB2A 2ZCWA 4ENNA 3QU6A 5HDGA 3U2RA 4IHSA 1OYYA 4KN7X 5ED4A 4LLLA 3T5XA 2V9VA 3W6KB 1IW7F 4LD5A 4HAMA 1F5TA 3WGGA 5L3GA 4M6YA 3SFZA 3P9CA 2YX7A 3BPVA 3BY6A 4EJWA 3BP8A 4RB0A 4I02A 2GXGA 1MJBA 2Z33A 1BN5A 4M6XA 1CGPA 3DXJF 4WXCA 3EYYA 4ESJA 4FT8A 4P9FA 1FBSA 1RZ4A 3VEPA 3CUQC 2RN7A 2A5YB 3LQRA 2MLKA 4L9VA 1G3WA 2BE5F 3D5LA 3TOAA 5ICFA 3F8NA 5HLGA 3RDIA 2UXNA 4Z2YA 1ZG1A 1P6RA 1XSDA 3FMSA 3DPLC 1XDUA 2EA2A 2WTEA 2CGPA 2MH9A 2RVCA 3R0JA 2XKPA 2ZMEB 4UNOA 3DV8A 3H3ZA 4OOIA 4LMYA 4A2UA 4HLYA 4HQEA 1HW2A 3TQNA 1XGOA 2ZXJA 5DCMA 2M30A 3T8RA 2MD5A 1EH8A 2EFWA 3F6VA 3Q9VA 3V4GA 2O3FA 4CYDA 4HQMA 4LLNA 1KU9A 3E3VA 1FZPB 1FLIA 4ETSA 3JTGA 3F8MA 3KLOA 4P96A 2ESNA 1AOYA 1HW1A 4BHBA 1RNLA 4AIKA 3F72A 1XCVA 3IL2A 2DFIA 3MWMA 1QO0D 4YFNF 2HTJA 1B6AA 3GFLA 5L3EA 2HQNA 1RI7A 3F21A 2BBYA 2K27A 1DPUA 1U6GA 2ZKZA 4GCVA 1SD6A 2EFOA 2B0LA 4XBFA 1YG2A 2XAHA 3L2CA 1YS6A 3G73A 1D8KA 2RV8A 1WKMA 1ZARA 2KJBA 5DCFA 2ZNZA 3WTZA 1KU2A 2H94A 2XRNA 4I01A 1LJ9A 1FBUA 4AIHA 5ERIA 1UHMA 5CVRA 2Z99A 4S05A 1O3SA 2BGCA 2HEOA 5DUKA 2HKOA 3TO6A 2GWRA 1W7PB 1BC7C 2MH2A 4CO8A 1I5ZA 3I64A 5J8FA 2XHKA 2LNBA 1H9TA 4L9NA 2MBFA 3BZ6A 4I09A 1O3TA 3DKWA 1I1SA 2P7CB 3R6SA 1K7AA 2A61A 3WGIA 4PCQA 5HDNA 2AXLA 4KFCA 3FXRA 1U3EM 1MJAA 2XUBA 2ZBKA 3TDZC 3WTXC 2COMA 3KCCA 4LB5A 5DYMA 2IA2A 1KA8A 1R1UA 4MNUA 3J80Z 1TNSA 1ODDA 3M8FA 2ZMEA 4M74A 4M72A 4ZH4F 3U1DA 5K5QA 2ZO4A 4H0EA 4L5JA 4HF1A 4Y17A 4MGRA 3SZPA 1TBXA 5K1YA 2FMLA 2NAZA 2P5KA 3F6OA 1G6NA 2DQLA 4O5VA 3V7RA 4ZYHA 2PG4A 2HR3A 4KICA 2K4BA 1S7OA 2L01A 1KQ0A 3ERED 3RKYA 2OQGA 1XDSA 1ZRFA 1A04A 3GVAA 2VOOA 5E18F 2DT5A
chains in the Genus database with same CATH superfamily
1UMQA 4HRIA 2WAQN 1QPMA 1TTYA 1HF0A 3U9GA 1B8IA 4HOBA 4B47A 1MGTA 3HPGA 3HZJA 4B43A 2QLZA 3SJMA 3DKYA 3I55I 2EWNA 3AL0B 3ZP5A 1XGNA 3LSPA 1S3JA 3KP4A 2A69F 1T98A 2E7WA 2QGUA 4PJMA 1XD7A 3QWLA 3TBIA 1IGNA 3VOEA 4KIBA 2BXZA 1FC3A 3MEXA 4M73A 1LDKB 5FFZA 2LDUA 1FX7A 3FX3A 3NEUA 3ZQHA 2GXAA 1V5GA 3FIWA 3K4KA 1X58A 4U0WA 1APLC 4NQWB 1OCZH 2JZYA 5HODA 3ZQQA 1IRFA 2JK3A 4D5CA 4ENMA 2JSCA 2H6BA 2RREA 5FKLA 3HOYJ 3HOVJ 2STWA 1HKSA 2HGCA 2DJNA 2JWTA 4RLFA 4BH9A 5E17F 2PQ8A 3K69A 1W7PA 2CG4A 4EMSA 4BGDA 4EJVA 2IS4A 1WJAA 2BHYA 2XVCA 3J80K 3E0JB 4KUMA 3TO9A 4FHTA 5CQGA 3H5NA 1BJZA 4WWCA 1GV2A 4E7SA 2O03A 5JHFA 3LWFA 1R1TA 4M9SA 5GADJ 2FSWA 2JN6A 4ENJA 3NWSA 4IO9F 1PJRA 3R61A 2L2OA 3TDUC 2Y48A 5KK1A 5CVIA 4BS9A 3G1MA 1U5TB 3KEYA 5J1UA 2P6TA 3CJRB 1KU3A 4AD9A 5DM7F 2W1OA 3LSRA 1KU7A 2HYGD 1I3QJ 2F5VA 2PMUA 2CQKA 2VKHA 5F08A 3K70C 3H3UA 1FSEA 4N0BA 2JMWA 2OU2A 3HRUA 1GVDA 1YLFA 3JSOA 1KYWA 2OBPA 2EQRA 1TWFJ 5IP6A 1F36A 2OPTA 3RKXA 1XMAA 3ZN0A 1LFPA 1JGSA 3JTHA 3L1PA 2V9KA 2AXTC 1X2NA 1ZKGA 5EG0A 1I50J 3EUHA 4ZTFA 4LGWA 5KCMA 3NWTA 1BI2A 1F1ZA 2X1CA 3BG6A 4HZFA 2X9DA 5JVGF 2UWMA 2ZJQF 4XKVA 1O3RA 4MO7A 2KL4A 2WY8Q 5HS7A 1XG1A 1TQPA 3HJEA 3IRRA 4L5IA 3CC2I 3J7YJ 3ZQCA 1QA6A 4CHUA 3VDXA 1LUJB 3K1NA 1N75A 2W4SA 2VLAA 2IS6A 5DDGA 3MQ0A 1M1EB 2VJ5A 5AIQA 2R5YA 1JGGA 2XAGA 2K4JA 4W97A 4RGSA 2D1HA 5LFAA 2CV1A 2JA2A 3NQOA 2PJRB 5DUIA 1BA5A 3DTIA 3FWEA 1QBJA 4ESBA 2CV2A 4E7IA 4G8XA 1YRNB 1RPWA 2R3SA 4MQVA 1T8IA 4I2OA 2TCTA 2DFEA 2LBFA 2QM3A 3S3OA 5D6FA 4NC7A 3CMEI 5LBQA 4X6AJ 1ETQA 3ASNH 2STTA 4QLCU 3QP6A 4UVBA 4GGGA 1H88C 4I0BA 3G71I 1ZRDA 3RZDJ 4WXHA 2H6CA 2QCOA 1O7FA 2XGCA 3X2QH 3OOUA 3QOEA 2WAQA 2WBMA 4BDYA 5K5RA 4C3JJ 2DA3A 2R5ZB 1ON2A 1QHHD 1Z3XA 1Y0UA 2RAEA 3JRCA 1ETVA 1GV5A 3OYGA 1JT6A 5DD4A 3ZGKA 3F9KA 3LAPA 2F6CA 4Y4RA 3HDDA 2H8RA 4U0VA 2XPVA 1DP7P 3O8HA 4D9JA 1XGMA 2LREA 2O8XA 5FD5A 3KP2A 1R58A 3SXYA 4KNYA 5C3EJ 2VBXA 2B7EA 3F8BA 1O57A 1R6RA 1XX5A 5H6QA 5FKKA 4HF0A 3Q0VA 1QHGA 2F5EA 5TJJA 4CZZA 3CCRI 4RMNA 3P7NA 2OZUA 1V5EA 5L3FA 4UUVA 4NQWA 2C6YA 1GVJA 3KE2A 2KRCA 3SEQA 2H27A 2FOWA 3P5JA 1OMIA 3C1DA 2GA2A 1WJEA 1YW7A 2W57A 4M3EA 5J1RA 3CLOA 5LLQA 5DD8A 3SEZA 3I0TA 4YFXF 5ILUA 3H3VK 3DCFA 1MMNA 4BXXJ 2DMNA 2N8GA 3TOBA 3AG4H 1R5HA 1PP8F 3L09A 4O3MA 2X0LA 5D4SA 3BJ6A 1WWXA 3ROUA 1ON1A 4QTRA 5E1ZB 4BY1J 2QUFA 1IUYA 2L7ZA 1PP7U 4NHJA 3GCMA 4RAYA 4EJTA 1Z77A 1S29A 1ZN2A 3BTLA 4RM3A 2A07F 1CF7A 4A3FJ 1V4RA 5DCMB 2R92J 1Z6RA 5K7FA 4CZCA 3JREA 4A3BJ 3MVPA 2IA1A 2P4WA 2E7XA 3CCLI 4IOCF 2JRMA 2CQQA 2VE8A 1ZYRF 4M9XA 2ZSHB 4MEYF 2E1OA 3HPHA 4CSWA 3GTOJ 1DUXC 5BS6A 3BWGA 5D6EA 4B3AA 1Z1DA 1LDJA 2LY1A 1IN4A 5J4VA 4XIDA 2YU3A 3MZYA 1K83J 5JFRA 1KGSA 2NNYA 1HBXG 1PUEE 2BZTA 3HKZN 1MSEC 3V42A 5EJCA 4B8XA 2VOPA 3HG9A 2Y9YA 3RPUD 4J01A 1B72B 2EV6A 2ID3A 2VC0A 4Y52J 2W7NA 2VE9A 3C18A 2OZ6A 1AA7A 3HTUA 1YQAA 4EVIA 5DS9A 3BDDA 1RUOA 4OIOF 4UVCA 3AG1H 3ZN1A 2HWVA 4E7KA 1RR7A 1SANA 4IQ4A 3MKZA 3VWBA 4MFEA 2VQLA 3C7JA 4X0GA 2R93J 2Q8KA 3LAJA 2ZJRF 1MMGA 1Q1HA 2XF7A 1LVAA 1E3HA 5L3BA 2OCEA 5TGTA 2RGVA 2R0QC 3HTSB 2R7WA 1ZR2A 1P7IA 3FXLA 2PJRA 2VKVA 1A6IA 4UUSA 2OAZA 3DP7A 3E6CC 2FNAA 1FP1D 2DQRA 1G4DA 1BR1A 2XIGA 3KP3A 2XRLA 1LE8B 2HPMA 3OL4A 3F23A 1VQ9I 3WU1B 1R1VA 3GX4X 1T08B 1L0OC 2FEZA 2KRHA 4BQOA 3PUFA 1KQ9A 2TDXA 2CW7A 2XSDC 1YJNI 4MEXF 2BXYA 1TQIA 1Q1VA 2CRGA 3Q5FA 2KJCA 1J2XA 1NH3A 2FXAA 1VQ7I 1Y1VJ 4L5EA 2VODA 1L3LA 3H92A 4BL0B 3J7AO 2ZXIA 2D45A 1T6SA 5FKOA 3PO2J 1Y56A 1AU7A 3J7AY 5CLSA 2JUCA 2R5ZA 3DPTA 2IT0A 5EDNA 3F22A 2GOMA 2QWWA 4U88A 4LG3A 2RNJA 4RGXA 5M5WJ 4RAGA 1IN6A 2R7ZJ 2EZLA 1FWZA 3VYUB 2DU9A 5H2FC 3GTMJ 3JRBA 3GMEA 4U7BA 3S93A 5D8KB 4KN4X 2HZTA 4CCKA 1XB4A 1J09A 3ZMVA 5A2QZ 1Z7UA 2FOKA 1UJ8A 1QZEA 2DDBA 3WHCA 4KDPA 2KIMA 3HOXJ 1OYIA 4KIFA 2GLOA 1U8BA 4BE2A 5HNHA 2LKXA 4A0XA 3PUBA 2PI0A 2PBIA 3J81Z 3WODF 2RC4A 5JHUA 4N4OB 1JKOC 1VQ5I 5JVTA 4ASNA 3GTJJ 4LFUA 2CW8A 2ZSIB 2IJLA 4CUGA 1U78A 4Y3OA 5E1WA 2KLOA 3BTIA 4HNUA 2E2IJ 3OSFA 2DJIA 4A6EA 1NK2P 2V1UA 3QYBA 4DZJA 3L9FA 3GLLA 3Q0WA 4JBAA 5D4RA 1QNTA 4BJ6C 2FQ3A 4RS8A 2BY2A 2FF4A 3HL2A 1LB2A 3TEDA 3A0HC 4BU2A 5H20A 1Z21A 4UV8A 2QQ9A 1H89C 1ZREA 3RKWA 1F43A 3LFKA 4OU0A 2GIZA 2MFZA 4CXFA 4DOZA 2DAOA 3LMMA 1UELB 2FBIA 3DU5A 1TWGJ 2M87A 1GLNA 4DQ2A 2KKOA 1VTNC 2D5VA 2PFBA 3L00A 4I7HA 4C3HJ 1IG7A 2V79A 2F48A 2GBYA 3HKZA 2E5ZA 2VJIA 3LSHA 5TRDA 2JA8J 1LFBA 2CW0F 3ELKA 2DTZA 3CD6I 3VPRA 4XR6A 2EZIA 1B72A 3E6DA 4S04A 4XOPA 5CVUA 4XRSG 3M1CA 4II3A 5FRNA 3HGGA 1B1BA 1WJBA 3FDYA 2ZMEC 2I5UA 2JPBA 1QVTA 5HLTA 4IXAA 1VQKI 4ENKA 1VF9A 1NHAA 1OPCA 3ZMDA 3K4NA 5FRMA 2E1NA 2HYFA 4EGYA 4JX4A 2R7FA 3M1EA 4RM2A 2Z2SB 3PFIA 1Z7LA 2V7FA 3WE3A 3SHFA 5HLIA 2LYCA 3MZHA 3CDLA 2VN2A 5F0HA 3EUAA 2DO7A 2OJED 2DFHA 1R49A 2QA4I 2JJ7A 1LE8A 1TL8A 3VYTB 4F93B 4LB6B 3CC7I 2LOOA 2K9QA 2D1VA 5A2QK 5AIPA 3OYMA 4PSWA 1LQ1A 2CJJA 4ZJZA 2Y69H 3VSLA 1WJCA 1IDYA 4XRSA 2WADA 4JP0A 3HSRA 4E7LA 1D1AA 3DU6A 3E5XA 2PX9A 4PGHA 4KT5C 3OYKA 3JW4A 4KJZA 5IOYA 4BACA 3GFIA 4V2FA 3J81K 2LG4A 2W82A 4ZZDA 3U1KA 1T95A 4B4CA 4CCNA 4IRHA 3MN2A 2DOFA 1AHDP 2OD5A 1MBHA 1TNTA 2LP0A 3JRGA 4IKFA 3ECOA 2EBIA 2W48A 3EETA 4JQFA 3R60A 5J3LA 2L0KA 4HSTA 4M6VA 6PAXA 4EQQA 2LRDA 3HB9A 1XMXA 2CUEA 1IRZA 4G6TB 3W2VA 4M9ZA 4UB6C 2Z16A 4UY8I 3HRTA 2M7AA 1WCMJ 5JI6A 3BTCA 1NK3P 4PFOA 2HVRA 1QQIA 4NUBA 1Y39A 1USTA 4UV9A 2MC4A 1W0UA 1YX5A 4JX5A 1PDNC 2NRAC 2X51A 3LQQA 3LNQA 5HS8A 2Y0MA 3D5SC 3QPLA 2HXOA 3ECHA 4XOTA 4F92B 2G9WA 1EF4A 1GT0C 3BG7A 2G7HA 3CJNA 2PLYA 2Y30A 5FKMA 3KETA 2ETHA 4RB2C 2QSHX 1WJ5A 4XSXF 4DGWB 1BIAA 2CWEA 2HDWA 5EG0B 1S7EA 1QU3A 5EZGA 2FJ1A 2JSPA 5FKNA 1IZ1A 3F8FA 1R00A 3S1QJ 2DBBA 3TW7A 3S8PA 3SDGA 3OYLA 2CFXA 4Q5SF 4MTEA 1EV7A 5F04A 2A3SA 1HQCA 1GXPA 2WC2A 3H9JA 4IRIA 2YR2A 4DZPA 2M3AA 2BY3A 3E6BA 2VASA 4C2UA 5JLXA 3F3XA 1BIBA 4XONA 3QPHA 4S0HB 4BKXA 2IA0A 4ANJA 2HOEA 5HNFA 3ML6A 5ICCA 2WY7Q 2R5YB 3L2VA 3HBLA 1SFXA 3GTKJ 5E3NA 5HOOA 1BI3A 3UNGC 4IVNA 3IRQA 1VZ0A 5IT9Z 2VT2A 1W4MA 1ZGWA 3M9AA 1F4KA 3IKTA 4D0PA 2ZC2A 4HV6A 4EM2A 5J47A 1WQ2A 2XGXA 3GXOA 2KDZA 2XGDA 4FTHA 4ON0A 3L2RA 2E2JJ 5F1JA 3IH4A 3M7GA 3W3CA 3BJOA 1EH6A 1XC5A 5BNGA 4RDUA 1FSHA 2WB1N 1ZQ3P 2UUZA 3FXQA 1JKPC 2QSGX 2DT6A 4CH7A 4HEA2 2RQPA 3CCMI 4QPQA 2DA1A 3TMOA 3WTSC 2VQGA 3H35A 2ZXWH 3D0SA 4NC6A 1P7JA 3IH2A 3LA2A 2CUZA 3V8KA 3WGHA 3PL8A 1IXSB 1P4AA 3EUHC 1YO5C 4G6DA 1UZCA 2KT0A 3PNVA 3AG2H 2HOTA 3L2WA 3M8JA 5K7ZA 1UHWA 1YYVA 1YW9A 1UB9A 3OMYA 1T39A 2MA3A 1UAAA 3M07A 4ZYAA 3ZOBA 4P1WA 2EPFA 2M4KA 2H1KA 1J59A 3JRIA 3T0YA 3HHGA 2NVYJ 1A5JA 5J8CA 3VYSB 2OQRA 4JYKA 3HIFA 1MMDA 1X3ZB 2DCEA 1D1CA 3DTKA 2KPMA 2Z5UA 2WV1A 5H6RA 3HM5A 1XS9A 2EIKH 5LEJA 1D3YA 3DF8A 4RGUA 2F5CA 4E70A 4LK0F 3QRFF 1MKMA 1JHHA 1YW8A 2YU9J 1IO2A 5LD2C 3J7ZI 3BR2A 3H0DA 3S1NJ 3CC4I 4L0ZB 1FYKA 2IW5A 1W36C 3Q0UA 4PDKA 1DU6A 3HC7A 1IN5A 3RJPA 3T1BA 4F3QA 4MTDA 1SC7A 1DP3A 3CMAI 1E2XA 3KP6A 4A5MA 4P5OA 3SQNA 2L4MA 3CTAA 3DTEA 3OYIA 4YIRX 4Q48A 2DMUA 1BR2A 4MIMA 4IHVA 1TW2A 1ZG3A 4WX9A 1MBGA 5AONA 3HRSA 3HXLA 1CF7B 4IHWA 2UV1A 3FHNA 4G94A 3OYCA 1OCOH 4I6ZA 1VI0A 5FJ8J 1TLHB 4EGZA 3I56I 2RNGA 3OV8A 1U8RA 2Y2ZA 1G3YA 4A0ZA 2ME6A 1H0MA 2YSRA 3C2HA 9ANTA 3TO7A 2YPRA 4IRGA 5EEHA 1BI1A 3IAS2 1YE9A 3DBLB 3OYEA 3JRDA 2FBKA 3EDPA 1X2MA 1IN7A 1XN7A 4OMYA 3PIOF 5IT9K 2VBYA 3OS1A 4A3EJ 1A35A 4MQ9F 5LHIA 1MMAA 2BW3B 1LEBA 1R7JA 3GTLJ 2XF6A 1H8AC 4UXNA 2ZNYA 1YIOA 1G3TA 2NOJB 3BG9A 3I53A 2FQ4A 2VXDA 4N4NB 1ONVA 5KVRA 4MHGA 3W2WA 1SMTA 1WJFA 2HU9A 3KP7A 4ESFA 2P7VB 4XL9A 1OQYA 3AAFA 1V54H 3CCSI 2NS7A 4OINF 4BAYA 4F52A 4YIIA 4HLXA 5K5OA 2O9LA 1R4MB 1P2FA 1Z05A 3OYBA 4V19K 2GA1A 5M5YJ 1SEUA 1GUUA 3QAHA 4XLNF 4I76A 2R7UA 2I8DA 1A36A 1ENHA 1RETA 2CV0A 2X48A 4IJAA 2XROA 3O8GA 1LPQA 2HOSA 2YUSA 2K3FA 3OSGA 1D0YA 3V7CA 4D5FA 4EM0B 1J9IA 1TQMA 3L7WA 2F4OB 1AKHB 2CH0A 1FTTA 1S8NA 4UUSB 2R7VA 4G6QA 4EJOA 5B3SH 3O3KA 2LF7A 3MKLA 3RPUA 1EH7A 4PJJA 2EFQA 3VSKA 1K4TA 1IV8A 1OYWA 1GXQA 1U5TC 4N9HA 2QQAA 3QYFA 1D8JA 5M3FJ 2DK8A 3H36A 4NDLA 4C9YA 2BVMA 3BTJA 2L54A 3FISA 2WB1A 1R5GA 3RQ4A 4A93J 5EEGA 3K1MA 4BYYA 2DK5A 2W24A 2EINH 3E5QA 1MDMA 2QKMB 5KAIC 2DMPA 1BW5A 4R1HA 4QSHA 3LA3A 3B6AA 1DGRM 2IGOA 2LTPA 4AYBN 5F0CA 5HDKA 3DLAA 2X6YA 3CJTB 1ZLJA 2QVOA 2LH9A 1LNWA 2Y75A 2B63J 3LA7A 1SD5A 5C44J 3GZNB 2QENA 1I1GA 3V8JA 1SVMA 3FKJA 5HS9A 4CDGA 1MMSA 1WRJA 2K85A 4EM1A 2OTJI 5GTHC 2DTRA 3ZQIA 3DBRB 3BR0A 3BOQA 4IOAF 2M4GA 4KIGA 4ZDOA 2MSYA 5B1AH 2XGEA 3OIOA 1JJ8C 2VQCA 5GP9A 3LSJA 3CDIA 5IYDJ 2XAJA 2DA7A 4NC8A 3CMMA 1JUPA 4G9YA 1Z0XA 4LJZF 4U87A 1FIAA 1FNNA 4C30A 3A4CA 3HOUJ 3GWZA 4HBLA 1FIPA 3JRFA 4NNJA 3B6CA 1VQ8I 1W7PD 3N97A 2VT3A 3TP0A 5JR3A 4DIQA 3PQJA 1D1BA 1YTYA 1ZHFA 1S7AA 2JVHA 3I4NJ 2VKDA 2CYYA 1MZBA 2TRTA 2FU4A 2UXXA 3I3LA 4AVPA 5E3MA 3EQLF 3FK6A 5LGUA 3K9TA 3S17J 1HKTA 3W2AA 2W00A 1BBYA 5EEAA 2Y31A 1VFCA 1A31A 2IPQX 1K78B 1BM9A 2EB7A 4EJUA 2LF8A 2HQAA 1SAUA 2A5WA 3ABMH 4RAZA 1JE8A 1SVOA 3K2AA 1K6YA 3PNYA 1VQLI 2GZWA 2DI3A 2HTSA 4DBRA 1ZAOA 1MJ9A 3CCVI 1T38A 3OYJA 3WU0A 4F91B 4P9UA 4HW0A 4WCGA 4WXDA 1X1BA 1XSVA 1T0FA 3CUOA 4A3IJ 3ZMSA 5B66C 4BQQA 2H09A 5J4YA 2VXZA 4BDZA 4A3CJ 3HOWJ 3GBGA 5EZHA 3EYIA 2BW3A 5LRRA 4QIWN 4Y33A 4NB5A 2QBYB 1LVKA 4GO1A 5FLVA 1R71A 2IP2A 4X1EA 2EK5A 3C2GA 1FY7A 2AS5F 2EZHA 5BOXA 2HQRA 4IF4A 4HX8A 4A3MJ 1IUFA 2VPRA 4RGRA 4G7ZF 2EIJH 2F4IA 1K61A 1W5SA 2O5RA 4OIRF 5E20A 3N4MA 2BOLA 2NXNB 3S2HJ 2HS5A 3G1LA 3CCJI 3BG3A 1D0ZA 3IC7A 1RKWA 2AO9A 1FYMA 2K7LA 4ZDPA 1I3AA 2D2WA 3OYDA 1MIJA 3ABKH 3ZMZA 3OYHA 5E8IA 4PJ0C 1AKHA 1ZH5A 2PMHA 2BHZA 2QQ8A 2Z1DA 2EFNA 3GZ6A 1B4AA 2ELHA 4AUXA 5FB2A 1JKRC 2MABA 2P5LC 1XSXA 2ADUA 4FASD 1W0TA 2H8WA 1TWCJ 3CUQB 4V2GA 3GTQJ 2FBHA 1WH5A 2M34A 3I71A 4M3FA 3IH3A 5E3LA 1LDDA 1T33A 2ZFWA 2V4JC 2L02A 4E7HA 2IEKA 3JCUC 4CCLA 2VI6A 5DTDA 2KP6A 4U7DA 2LSOA 2M45A 5CYVA 4Q4ZF 2V1NA 1S5LC 1OFCX 2DA6A 4ZYGA 3MAJA 5BPDA 3ASOH 3G1OA 4AYBA 2F5FA 4DYCA 4EV0A 1MNDA 2K5CA 4G7HF 1I27A 2CQNA 4NBQA 1XTAA 4AIDA 1R22A 1VQOI 3LSGA 3ISPA 3NAUA 2KRFA 4LG0B 3ERMA 3FBNB 3S16J 2E1MB 1I6HJ 2MLGA 5F6FA 1TW3A 3SYTA 2BVLA 3C3WA 2RDPA 1IN8A 1Z6TA 2HFHA 3BR3A 3H5RA 4OAZA 4UHTA 4WF2A 1LFUP 4HG2A 2EFPA 3TKYA 4AWXB 1FOYA 4FX4A 1HXDA 2VBZA 4H4KC 2FMYA 2XC7A 2ID6A 2LY2A 4KYWA 3K70D 3ABUA 1IJWC 3E6MA 4II2A 4QPOA 2L5QA 4RB1A 3RYPA 2ISYA 3DLLF 4DYRA 4L18B 2XAQA 3HHHA 4XMYA 3I54A 3HOZJ 4LITA 3A01B 4XLFA 1JUMA 1JHFA 2PJPA 3PSIA 4L9TA 4FX0A 2IAIA 3OOPA 4DW6A 3MKYB 3A2KA 1YOVB 2J5OA 1KONA 5GAHJ 2NVXJ 2DOAA 3B73A 3FXOA 1R23A 3VODA 2HVSA 4OAYA 2GQQA 1MW7A 3UKGA 2OA4A 3ZXSA 2GM4A 2DODA 2DN0A 1IXRC 2KIQA 1MD0A 3K6GA 3KPHA 2M2EA 2XAFA 1XCBA 1K78A 3LFUA 2ELJA 2F5DA 2V6EA 3PO3J 4PK4A 4XICA 5D5VB 4XRMA 2P8TA 4DNCA 2R7RA 2DMTA 1RIOH 1AWCA 5LEKA 2ISZA 3JSPA 3H0GJ 4KMFA 3RPQA 5IP9J 2OUMA 1P4WA 1JXSA 1F9NA 3GFJA 4BUPA 2QQBA 4HX7A 4PGGA 2X4HA 3ZRGA 3RI4A 2DYSH 4JK1X 5L3DA 3V8LA 3PJRA 3AFHA 4R79A 4KA4A 1R36A 1Z67A 5HVQC 1OCPA 2ZFUA 4IPAA 2Q2EB 2CMPA 3QYEA 4FISA 2HOAA 1IRGA 3K1PA 5IY5H 5HLHA 2QBYA 2P6SA 3DQVC 3HSFA 3MZ8A 3R0AA 2VPLA 2WV0A 1DU0A 1QZYA 5M3MJ 1JKQC 3CP2A 2HKXA 3BR1A 3R4KA 5LGTA 4FETA 3JR9A 4B3XA 4CCOA 4BE0A 4GYGA 4XLAA 2VKEA 1K6OA 2V1XA 1OR7A 3S2DJ 2NS0A 1PUFB 1WI9A 4BQNA 3O2PE 1G2HA 4ZTJA 3K0LA 1T56A 2FRHA 4FE4A 2LK2A 2G0EA 3QPTA 2Y9ZA 2JT1A 3BQYA 4BNCA 4HV5A 4ZYDA 2JRTA 2IVMA 4ZC3A 4J00A 1NTCA 3FM5A 4XKCA 1OISA 2NYXA 4LK1F 1U2WA 4FQGA 3QODA 2IRFG 5F64A 5ILVA 2CQ7A 5D5WB 3CUQA 1UCRA 3I4PA 2NVTJ 2Z9OA 2MC3A 2ESHA 1FJLA 4KITB 3RYRA 1ETKA 1IDZA 3BG5A 5DV5A 3GLXA 1DQUA 2AHQA 4A3JJ 1WFXA 2M9HA 1MH3A 3CF5F 3I5UA 5IOZA 3IKVA 2LLKA 2K02A 4I98B 4Q47A 1B9NA 3BCAA 4ZYEA 2MG4A 3GF2A 1EJ9A 2K3PA 1H9GA 4UB8C 4RBOA 4HDVA 3ZMTA 4IX7A 3Q9SA 4LG0A 2EA4A 2NS8A 2DT7B 1BOAA 2VBWA 5LHHA 3SZTA 2QSFX 1REPC 1GHCA 2V1DA 1FOKA 4YEJA 4ZZLA 4ABZA 2COBA 1HC8A 2YS9A 2KZGA 4MFDA 1P9QC 1SD7A 1BOBA 1JTXA 5CVJA 3P9KA 4XN3A 1BW6A 1O7LA 1A6QA 5FLXZ 2GIVA 1R5ID 4J19A 1R9TJ 4BHCA 2QF7A 1T2KA 3GFMA 1WGXA 2HZDA 3KLNA 4XLEA 1YJWI 2M0CA 3CF2A 3A01A 4GYIA 2L4AA 2V6CA 3ZQ7A 2VJ4A 2VQHA 3ZPLA 2RQQA 4XORA 2ZXHA 1RKTA 1P92A 5EYRA 1YS7A 5J1YA 2KHMA 1ULYA 4A3KJ 2KQRA 2X6WA 3ABTA 4AU7A 3RKQA 4A6DA 3U21A 3RCOA 4PZJA 2KISA 2HDCA 4TV7A 2KIUA 1UFMA 2DA4A 3KZZA 3HSEA 2EJRA 3HUGB 2EILH 3S3MA 1STZA 3HRMA 3ULQB 2P5VA 2VL8A 4XRFA 5D5XB 5LGNA 4Y13A 2LY9A 3GW2A 1OCRH 1Z3YA 2O7OA 2CU7A 1YFHA 4XLHA 3DBHB 3G4SI 1ZGJA 4YG2F 2FE3A 3CESA 3G3ZA 2WWYA 2QYOA 2E1CA 1ZR4A 1YJ9I 2O6GE 2Q2EA 1HSTA 1S9HA 3S1RJ 5E8GA 3RSNA 1HDDC 3I58A 5C4XJ 5D8LB 1MDMB 2PMZN 1GDTA 2Z3YA 1RC9A 1FT9A 4YIFA 2FNPA 1USSA 3LSTA 4RLQA 4OIQF 4M3DA 2X1EA 3ABLH 3BCBA 3CO7C 3KZYA 5B5EC 1SFKA 5EGOB 1I39A 1PUFA 1SD4A 3MMYB 3OYFA 2CFOA 1MSFC 1Y8RB 1KYZA 5BPIA 1HA8A 2VC1A 3DEUA 1UHSA 1Y1WJ 4K2EA 4A3DJ 3F0CA 3OS0A 2ELKA 4YFKF 3CZ6A 4A0YA 1D5YA 3O6BB 4OMZA 1ITYA 5IT3A 2ACJA 1MBJA 2GOXB 1OKRA 1HSJA 2O0YA 5KNLA 5KHDA 5FLXK 2IXSA 1D5VA 4RA2A 2QEXI 3WG9A 1DPRA 2A6EF 3BQZA 3L2QA 3FXKA 1DGWY 4IQJA 1SAXA 1HDPA 3BZCA 2A68F 4XLPF 1E17A 1IC8A 4IHTA 1Y6IA 3OL3A 1LKXA 2L7KA 1QGPA 2BV6A 5IP7J 4CYCB 4G7OF 3GZ5A 1Z91A 1WSUA 3I59B 3A02A 3LSMA 1G59A 2AQEA 2OCCH 1VNDA 1XPXA 5BQTA 3FXMA 4HF2A 5LHGA 1S6LA 3IWZA 1SFEA 1X4OA 3JAMZ 2Q0OA 5E3OA 3TGNA 1Z9CA 1LEAA 3KP5A 3MFKA 3A0BC 3K4LA 3F8CA 5K7HA 2FA5A 2HQ5A 1FTZA 3WE2A 1IF1A 1ERDA 2M7BA 2L9VA 2DXIA 3GTPJ 2XB5A 4LLGF 1BC8C 1ZG5A 4B09A 3C2BA 3GEZA 4PSXA 1ZRCA 4HX4A 2BY0A 1W1WE 1ETXA 4CA0A 5ICEA 1U0JA 2PN6A 2UZKA 2XV4S 1O3QA 3KIOA 4WK8F 3AKZA 3MCZA 2ZJ2A 4E4HA 4OIPF 2M1BA 4AC0A 1DDNA 3FF5A 3CDHA 4BQAA 3K4JA 5C4JJ 3GUDA 2MD0A 4Y15A 1SFUA 4RB3C 2A6HF 3GO5A 4O6JA 3ZQLA 3KYCB 3BT9A 3NRVA 1XGSA 1VQ4I 1BI0A 3PQKA 3HOSA 2L7FP 4P55A 5CPRB 2EV0A 3S15J 4PUSA 2EV5A 3K4BA 2W85A 2VONA 3SZGA 5FFXA 4DYQA 1K79A 2CS3A 3S32A 1V5FA 1I6XA 1POGA 5FGMA 2GAUA 4DBQA 2IBDA 2CO5A 2H1LA 4QWQA 1V3FA 1SVLA 4Z6YA 3A03A 3KYDB 4A5NA 4UVAA 3HUGA 1RRJA 5JLWA 1IRXA 3HYIA 4M3BA 5TISC 3OYAA 3T8TA 1ETWA 3FZVA 2DOEA 2RKHA 1RUNA 1EA3A 4LIUA 2L9RA 4W1UA 4XNFA 1FPQA 3DKXA 5GPCA 3TW6A 2V9PA 1FMVA 3E5UA 3WTUC 2JVGA 3QOPA 3HEFA 2XKOA 4HA8A 1X1AA 2K86A 4I99C 1JT0A 1FYLA 2EH3A 1ORKA 1XMKA 1FOWA 2ZJPF 4BHPA 2QZ8A 3S3NA 4E7JA 2DPUA 1X3UA 3CO6C 4AVZA 1T0FC 3ZMUA 3WTTC 2M8EA 1TC3C 2NNNA 3FHZA 1QPIA 5GAEJ 3W6JB 1KZHA 2VB6A 5CVVA 1SMYF 2PMZA 3I9V2 3JRAA 3IWFA 3OS2A 2JUGA 2IS2A 2FX0A 3VFZA 2KDOA 3WTWC 1YX3A 2CUJA 4BY7J 2NOGA 1MBFA 1P4XA 4LIVA 3DFGA 5ICGA 3JAMK 3GYHX 4BBRJ 1VQPI 1X3WB 2WAFA 2DA2A 4CCJA 1OCTC 1YIJI 4XLCA 3D1NI 4CICA 5F1RA 1HLVA 5GPAA 2L3DA 5EGOA 2B9SA 1J7KA 3L2UA 2X6OA 3G2BA 4EATA 4GDFA 1ETOA 1RR8C 5DEQA 3DEEA 2JPCA 4I0AA 3PIPF 2G7UA 3FMRA 2E60A 1C0WA 4RAFA 3S14J 3K2ZA 5GAGJ 1HW5A 3BROA 5LRSA 1MBKA 5DM6F 2FD5A 4IHXA 4E7ZA 3PM1A 3RIRA 1W5TA 4BXUA 3COAC 5FROA 2O61A 3KFWX 4M71A 3CQZJ 2LR8A 4XKBA 4G12A 4XKWA 1UG2A 2HDDA 4CYCA 2NVUB 3I59A 1YHQI 2HNHA 2BEOA 2R7OA 2GXBA 2ECBA 1ACIA 3VYRB 3OY9A 1ZGAA 3WTYC 5CJ9A 3BJAA 2E2HJ 1BR4A 2M0MA 2OV7A 2DW4A 1JUSA 4PFPA 1BL0A 1WHUA 2E34A 3AG3H 2WAEA 3N05A 1HCRA 5GTIC 5BMZA 4R8HA 2R7SA 2E5NA 4ZDLA 5J6XA 1HKQA 3E97A 5FD6A 1J75A 4A12A 5E1XA 4IZZA 4CGZA 3ZQFA 3S2WA 4BE1A 1PYVA 4GFBA 3HOTA 1FBQA 5L3CA 2M5WA 1ZLKA 5FO5A 1E0EA 2MGQA 1J5YA 2VIXA 1WVRA 4U0YA 2W25A 2E35A 2F2EA 4UUTA 3WTVC 2BYVE 2DPDA 3OR1C 4YELA 4A3GJ 3HGYA 3BR6A 3Q3SA 2JTVA 1J0RA 2CSOA 3FMQA 1B59A 4XSZF 3RTRA 3QP5A 3IHUA 3REOA 2DLLA 1YITI 5ILSA 2LKPA 2XASA 4GXOA 4XN0A 2K9MA 5D5UB 2JQ7A 4L0YB 3SDBA 1U5TA 4HDUA 1FOXA 2ECCA 3ONQA 2KIFA 2W84A 3KEOA 3BPXA 2PEXA 3DPUA 1S72I 3D5RC 2DDAA 1QZZA 1IAWA 1B9MA 1FP2A 4A69C 3A1YA 2YX4A 3V7SA 2R7DA 1WZ2A 2MYSA 4M3GA 3FKIJ 3ZQGA 4D1QA 3M8EA 4KMUX 1KQ8A 1TT5B 2A05A 3QU3A 2JA5J 3B02A 4HYEA 4IHYA 1IXCA 1BJAA 2LVSA 3FXUA 4L9JA 1N77A 3P9IA 4F7ZA 3FM3A 1G3SA 3FK7A 4FE7A 2K9NA 4AIJA 1YI2I 1OLTA 4N9IA 3KEQA 2NVQJ 4XQFA 1QRYA 2J5PA 4OWRB 3VB2A 4BJ5C 2ZCWA 4ENNA 3QU6A 5CKTA 5HDGA 5M5XJ 1W36D 1FEXA 3SFIA 1D0XA 2A6TA 3U2RA 4IHSA 1OYYA 1EKEA 1TT0A 4KN7X 4C2TA 5KAFC 5ED4A 3PSFA 4LLLA 3T5XA 2V9VA 3W6KB 2WA0A 4BXFA 1ZELA 3OIPA 1IW7F 4LD5A 4HAMA 1F5TA 3WGGA 3K10A 2Y0SN 5IPAA 1TWHJ 4M6YA 5L3GA 1YRNA 3SFZA 2XDVA 3P9CA 2YX7A 3IP4B 3BPVA 3BY6A 4EJWA 1E3OC 1JTYA 1OR7C 1W5CC 2DYRH 3BP8A 2VUMJ 3QQAA 1OCCH 4RB0A 2DFFA 4I02A 1IV6A 3H5AA 2GXGA 2IGNA 2CUFA 1MJBA 2Z33A 3KYLA 1BN5A 1FMWA 4M6XA 1CGPA 2IS1A 5J40A 3DXJF 4WXCA 4BEHB 4IL6C 4KT6A 2ZB9A 3EYYA 4ESJA 3DWLE 1X1PA 1ZTRA 4FT8A 4P9FA 5E79C 2LD5A 3AL0C 1FBSA 1RZ4A 2HI3A 2X85A 3VEPA 1NG6A 1QVUA 2E36A 3CUQC 2ICWG 2OF7A 2RN7A 1PVEA 3UR3C 2JA6J 2A5YB 2M8GX 3LQRA 4IEJA 2MLKA 4L9VA 1G3WA 3BC8A 3CCEI 3IUOA 3NARA 4B1RA 5FLMJ 2DA5A 2BE5F 3D5LA 3TOAA 4MLOA 2ME0A 1TWAJ 5ICFA 3F8NA 5HLGA 3RDIA 1G8XA 1X1DA 2UXNA 4Z2YA 4HPQA 2MW8A 1ZG1A 1P6RA 2R4GA 1JJ6C 3K4CA 1XSDA 3FMSA 1X1CA 3DPLC 3CCQI 1VQNI 1XDUA 4XM3A 2EA2A 2E1MC 3CCYA 4PJLA 2JA7J 2OC6A 2WTEA 3MD2A 2CGPA 2MH9A 2HPIA 1X4PA 3TL4X 2RVCA 1TP4A 4Y7NJ 3G6EI 3CMYA 3W6VA 3R0JA 1U9OA 2XKPA 2ZMEB 4UNOA 3DV8A 3H3ZA 4HNTA 4BBSJ 4OOIA 4LMYA 3BLYA 4A2UA 2KMUA 1O4XA 4HLYA 4B44A 4DJAA 4HQEA 3ZR8X 1HW2A 3CJQB 4KISA 3K7AJ 3TQNA 1XGOA 2EIMH 2ZXJA 3ZCOA 2L9SA 3S1MJ 5DCMA 2M30A 3T8RA 1MBEA 2MD5A 1EH8A 1X19A 2EFWA 3F6VA 2K9SA 3Q9VA 3V4GA 1N25A 1K4SA 1MNEA 2O3FA 4CYDA 4HQMA 2LFBA 3CLQA 2E19A 4LLNA 2X6XA 1KU9A 3E3VA 3OR2C 1FZPB 1FLIA 3OYNA 1ETYA 3WHBA 3M3YJ 4ETSA 3JTGA 3F8MA 3KLOA 2P0WA 1VQMI 4P96A 2ESNA 1AOYA 1HW1A 1WPKA 4BHBA 1RNLA 4AIKA 2LMDA 1NG7A 1XCVA 3F72A 5F27A 3IL2A 1ZK8A 2XAUA 3OIQA 2F4MB 2DFIA 3MWMA 5IYBJ 1QO0D 4HSRA 4YFNF 5CQEA 2HTJA 1B6AA 3LL7A 3GFLA 5L3EA 1CQTA 1MNMC 1JI8A 2HQNA 1RI7A 3F21A 4D7MA 2BBYA 2K27A 2I10A 2HXIA 4BJTA 4B48A 1B8IB 4GRIA 1DPUA 1U6GA 2ZKZA 2XSJC 3OWTA 4GCVA 1SD6A 3FXJA 2EFOA 3KZIC 2B0LA 2KZVA 1YG2A 2XAHA 4XBFA 4E6KG 3L2CA 1YS6A 3G73A 1D8KA 3RZOJ 2RV8A 1WKMA 3PNTA 2XPUA 1ZARA 2KJBA 4F55A 5DCFA 2FUG2 2ZNZA 3WTZA 1UG0A 3H9GA 4XK4A 2Y0SA 2R7QA 5F0FA 2R7XA 1KU2A 3PFYA 2H94A 2XRNA 1WH7A 4I01A 1R4NB 2AQFA 1LJ9A 1FBUA 5ERIA 3WG7H 1UHMA 3LSKA 5CVRA 4AIHA 2O8KA 2Z99A 1WI3A 5EF6A 4S05A 1O3SA 2BGCA 2HEOA 4AM3A 1U9NA 5DUKA 5IYCJ 2HKOA 3GTGJ 1HOMA 3TO6A 2GWRA 1W7PB 3QPSA 3MKWB 4BEHA 4HNVA 1BC7C 2MH2A 3BZKA 4CO8A 1I5ZA 3I64A 2EZKA 3M4OJ 1MH4A 2Q1ZB 1E3PA 5J8FA 1N78A 2XHKA 1RESA 2LNBA 3ESWB 1H9TA 3LSIA 5B1BH 4L9NA 2XPWA 1Y8QB 2MBFA 3BZ6A 3BR5A 1TZLA 4I09A 1O3TA 3DKWA 4ITVA 1I1SA 2XF5A 2P7CB 3R6SA 1K7AA 3E7LA 2A61A 2L7MP 1Y0NA 3WGIA 2VJJA 3K4MA 1V55H 4PCQA 5HDNA 2R7TA 4YRVA 2AXLA 4KFCA 3FXRA 3E1SA 1U3EM 1MJAA 1SFOJ 2XUBA 2ZBKA 3TDZC 3WTXC 2COMA 2IGMA 3DEWA 3RQIA 3KCCA 4LB5A 5DYMA 2IA2A 1KA8A 2LKSA 1R1UA 2L9NA 2LC2A 4MNUA 3J80Z 1TNSA 1ODDA 4FCYA 3CP8A 3M8FA 4C3IJ 2HYJA 3H9QA 2ZMEA 4M74A 2KFDA 4M72A 4ZH4F 2HVQA 3I4MJ 1WJDA 2XB0X 3U1DA 4CCMA 5K5QA 2ZO4A 4H0EA 3FBIB 2E71A 4L5JA 4HF1A 4Y17A 4MGRA 3SZPA 3EPZA 1TBXA 5K1YA 2QKLB 2FMLA 2NAZA 1OJLA 4JOMA 2P5KA 2IGKA 3F6OA 1G6NA 4A3LJ 2P81A 2V26A 2DQLA 4O5VA 2CQXA 2K9LA 3V7RA 4ZYHA 4EEFG 3LOCA 4D7NA 2PG4A 2LBFB 4PJNA 3EUKL 3TP3A 4JX6A 2HR3A 4KICA 3CCUI 2K4BA 1S7OA 3WU2C 2L01A 3IV5A 3JRHA 1KQ0A 3ERED 3IAM2 3RKYA 4LOCA 2OQGA 1XDSA 4C2MJ 1A04A 3GVAA 1ZRFA 2X1DA 3H1CA 2VOOA 3KX2A 2BY1A 1VQ6I 5E18F 2OTLI 2DT5A 2K40A 2DMQA
chains in the Genus database with same CATH topology
1QPMA 1TTYA 3U9GA 4HOBA 1MGTA 2QLZA 2EWNA 3ZP5A 1XGNA 1S3JA 3KP4A 2A69F 1T98A 2E7WA 1XD7A 3VOEA 4KIBA 1FC3A 3MEXA 4M73A 1LDKB 5FFZA 2LDUA 1FX7A 3FX3A 3NEUA 4U0WA 2JZYA 1IRFA 4ENMA 2JSCA 2H6BA 2STWA 1HKSA 2HGCA 4BH9A 5E17F 2PQ8A 3K69A 1W7PA 2CG4A 4EMSA 4EJVA 2XVCA 3J80K 4KUMA 3TO9A 4FHTA 4WWCA 2O03A 3LWFA 1R1TA 4M9SA 2FSWA 4ENJA 3R61A 3TDUC 2Y48A 5KK1A 5CVIA 1U5TB 2P6TA 4AD9A 1KU3A 1KU7A 2HYGD 2PMUA 2CQKA 3H3UA 1FSEA 4N0BA 3HRUA 2OU2A 1YLFA 3JSOA 1KYWA 2OBPA 3RKXA 1XMAA 3ZN0A 1JGSA 3JTHA 3EUHA 4LGWA 1BI2A 1F1ZA 4HZFA 2UWMA 1O3RA 5HS7A 3IRRA 1TQPA 4L5IA 4CHUA 3K1NA 5DDGA 3MQ0A 5AIQA 2XAGA 2K4JA 4RGSA 2D1HA 3NQOA 5DUIA 3FWEA 1QBJA 4ESBA 4G8XA 2R3SA 4MQVA 4I2OA 2QM3A 5D6FA 5LBQA 2STTA 4QLCU 3QP6A 4UVBA 4GGGA 4I0BA 1ZRDA 4WXHA 2H6CA 1O7FA 5K5RA 1ON2A 1Y0UA 5DD4A 3LAPA 4U0VA 1DP7P 1XGMA 2O8XA 5FD5A 3KP2A 1R58A 3SXYA 4KNYA 2VBXA 3F8BA 1O57A 5H6QA 5TJJA 4CZZA 4HF0A 2F5EA 3P7NA 2OZUA 5L3FA 4UUVA 4NQWA 2C6YA 1GVJA 3KE2A 2H27A 1OMIA 3C1DA 2GA2A 1YW7A 2W57A 3CLOA 5LLQA 5DD8A 3I0TA 4YFXF 5ILUA 3TOBA 1R5HA 1PP8F 3L09A 4O3MA 2X0LA 5D4SA 3BJ6A 1WWXA 3ROUA 1ON1A 5E1ZB 2QUFA 1IUYA 1PP7U 4NHJA 4RAYA 4EJTA 1S29A 1ZN2A 2A07F 1CF7A 1V4RA 5DCMB 1Z6RA 2IA1A 2P4WA 2E7XA 2VE8A 1ZYRF 4M9XA 4MEYF 1DUXC 5BS6A 3BWGA 5D6EA 1Z1DA 1LDJA 1IN4A 2YU3A 3MZYA 5JFRA 1KGSA 2NNYA 1HBXG 1PUEE 4B8XA 2VOPA 2EV6A 2VC0A 2VE9A 3C18A 2OZ6A 3HTUA 1YQAA 4EVIA 3BDDA 1RUOA 4OIOF 4UVCA 3ZN1A 2HWVA 3C7JA 2Q8KA 3LAJA 1Q1HA 1LVAA 5L3BA 2RGVA 3HTSB 2OAZA 3DP7A 3E6CC 2FNAA 1FP1D 2DQRA 1G4DA 2XIGA 3KP3A 3F23A 3WU1B 1R1VA 3GX4X 1L0OC 2FEZA 1KQ9A 2TDXA 4MEXF 1TQIA 3Q5FA 2KJCA 1J2XA 2FXAA 2VODA 1L3LA 3H92A 3J7AO 2D45A 1T6SA 5CLSA 3DPTA 2IT0A 3F22A 2QWWA 4U88A 2RNJA 4RGXA 1IN6A 1FWZA 2DU9A 4U7BA 5D8KB 4KN4X 2HZTA 1XB4A 3ZMVA 5A2QZ 1Z7UA 2FOKA 4KDPA 2KIMA 1OYIA 4KIFA 4A0XA 2PI0A 2PBIA 3J81Z 3WODF 2RC4A 5JHUA 5JVTA 4ASNA 4LFUA 2IJLA 1U78A 5E1WA 4A6EA 2V1UA 3L9FA 4JBAA 5D4RA 1QNTA 2FQ3A 4RS8A 2FF4A 1LB2A 5H20A 4UV8A 2QQ9A 1ZREA 3RKWA 3LFKA 4OU0A 4CXFA 2DAOA 2FBIA 2M87A 4DQ2A 2KKOA 1VTNC 2PFBA 3L00A 4I7HA 2V79A 5TRDA 2CW0F 3ELKA 3E6DA 4S04A 5CVUA 1B1BA 2JPBA 4IXAA 4ENKA 1NHAA 1OPCA 3ZMDA 2E1NA 2HYFA 4EGYA 2R7FA 3M1EA 3PFIA 3WE3A 3SHFA 5HLIA 3MZHA 2VN2A 2DO7A 4LB6B 2D1VA 5A2QK 5AIPA 1LQ1A 3HSRA 3E5XA 4PGHA 4KT5C 3JW4A 3GFIA 3J81K 4ZZDA 4IRHA 2OD5A 1TNTA 3ECOA 3EETA 4JQFA 3R60A 6PAXA 4EQQA 4M9ZA 3HRTA 5JI6A 1QQIA 1USTA 4UV9A 1PDNC 2NRAC 3LQQA 5HS8A 2Y0MA 3ECHA 2G9WA 2G7HA 3CJNA 2PLYA 3KETA 2ETHA 4RB2C 4XSXF 2CWEA 1BIAA 1IZ1A 3F8FA 1R00A 2DBBA 4Q5SF 2CFXA 4MTEA 1EV7A 2A3SA 1HQCA 1GXPA 2WC2A 4IRIA 2YR2A 3E6BA 3F3XA 1BIBA 3QPHA 2IA0A 2HOEA 3ML6A 5ICCA 1SFXA 5HOOA 1BI3A 4IVNA 3IRQA 5IT9Z 2VT2A 1W4MA 3M9AA 1F4KA 3IKTA 4D0PA 4HV6A 4EM2A 1WQ2A 2XGXA 3GXOA 4ON0A 3M7GA 1FSHA 3BJOA 1EH6A 3FXQA 2RQPA 3WTSC 3D0SA 3LA2A 3WGHA 3V8KA 1IXSB 1P4AA 1YO5C 4G6DA 1UHWA 1YYVA 1YW9A 1UB9A 1T39A 2MA3A 1J59A 3T0YA 3HHGA 5J8CA 2OQRA 3HIFA 2Z5UA 5H6RA 5LEJA 1D3YA 3DF8A 4RGUA 2F5CA 4E70A 3QRFF 4LK0F 1MKMA 1JHHA 1YW8A 4L0ZB 1FYKA 2IW5A 4PDKA 1IN5A 3RJPA 3T1BA 4MTDA 1E2XA 3KP6A 4A5MA 4P5OA 3SQNA 2L4MA 3CTAA 4Q48A 1TW2A 1ZG3A 4WX9A 5AONA 1CF7B 3HRSA 4G94A 1TLHB 4EGZA 3OV8A 1U8RA 1G3YA 4A0ZA 1H0MA 2YSRA 3TO7A 2YPRA 4IRGA 5EEHA 1BI1A 2FBKA 3EDPA 1IN7A 1XN7A 4OMYA 5IT9K 2VBYA 4MQ9F 5LHIA 1LEBA 1R7JA 4UXNA 2ZNYA 1YIOA 1G3TA 3I53A 1ONVA 5KVRA 4MHGA 1SMTA 4ESFA 3KP7A 3AAFA 2P7VB 4OINF 4BAYA 4YIIA 4HLXA 5K5OA 1P2FA 1Z05A 2GA1A 3QAHA 4XLNF 4IJAA 2XROA 4EM0B 3V7CA 1J9IA 1TQMA 3L7WA 1S8NA 4G6QA 4EJOA 3O3KA 2LF7A 3RPUA 1EH7A 2EFQA 1U5TC 1OYWA 1GXQA 4N9HA 2QQAA 1D8JA 2DK8A 2L54A 1R5GA 5EEGA 3K1MA 4BYYA 2DK5A 2W24A 3E5QA 1MDMA 4R1HA 3LA3A 5HDKA 1ZLJA 2QVOA 1LNWA 2Y75A 3LA7A 1SD5A 2QENA 1I1GA 3V8JA 5HS9A 4CDGA 1WRJA 4EM1A 2DTRA 3BOQA 4KIGA 2XAJA 4G9YA 4LJZF 1FNNA 3GWZA 4HBLA 1W7PD 3N97A 2VT3A 5JR3A 3PQJA 1YTYA 1ZHFA 1S7AA 2CYYA 1MZBA 2FU4A 2UXXA 4AVPA 3EQLF 5LGUA 3K9TA 1HKTA 1BBYA 2IPQX 1K78B 1BM9A 2EB7A 4EJUA 2LF8A 4RAZA 1JE8A 2GZWA 2DI3A 2HTSA 1ZAOA 1MJ9A 1T38A 3WU0A 4P9UA 4HW0A 4WCGA 4WXDA 1XSVA 1T0FA 3CUOA 3ZMSA 2H09A 2VXZA 3EYIA 5LRRA 4NB5A 2QBYB 4GO1A 2IP2A 2EK5A 1FY7A 2AS5F 5BOXA 2HQRA 4IF4A 4HX8A 4RGRA 4G7ZF 1W5SA 4OIRF 5E20A 3N4MA 2HS5A 3IC7A 1FYMA 2K7LA 2D2WA 3ZMZA 5E8IA 1ZH5A 2PMHA 2EFNA 3GZ6A 1B4AA 2ELHA 5FB2A 2P5LC 1XSXA 2ADUA 3CUQB 2FBHA 3I71A 1LDDA 2ZFWA 2L02A 4U7DA 2LSOA 2M45A 5CYVA 4Q4ZF 4ZYGA 3MAJA 5BPDA 2F5FA 4EV0A 4G7HF 1I27A 1R22A 3ISPA 2KRFA 4LG0B 2MLGA 5F6FA 1TW3A 3C3WA 2RDPA 1IN8A 1Z6TA 2HFHA 4UHTA 4WF2A 2EFPA 3TKYA 4AWXB 4FX4A 1HXDA 2VBZA 2FMYA 4KYWA 3ABUA 3E6MA 4RB1A 3RYPA 2ISYA 4L18B 2XAQA 3HHHA 3I54A 1JHFA 2PJPA 4L9TA 4FX0A 3OOPA 2J5OA 3B73A 3VODA 1R23A 2GQQA 2OA4A 1IXRC 1MD0A 2XAFA 1XCBA 1K78A 2F5DA 5D5VB 2P8TA 4DNCA 1RIOH 1AWCA 2ISZA 5LEKA 3JSPA 4KMFA 3RPQA 1P4WA 1JXSA 1F9NA 3GFJA 2QQBA 4HX7A 4PGGA 2X4HA 3RI4A 4JK1X 5L3DA 3V8LA 4KA4A 4R79A 1R36A 5HVQC 4IPAA 1IRGA 3K1PA 5HLHA 2QBYA 2P6SA 3DQVC 3HSFA 3R0AA 2WV0A 1QZYA 2HKXA 3R4KA 5LGTA 4GYGA 1K6OA 2V1XA 1OR7A 2NS0A 1WI9A 3O2PE 3K0LA 2FRHA 3QPTA 2JT1A 4BNCA 4HV5A 4ZYDA 2JRTA 2IVMA 3FM5A 2NYXA 4LK1F 1U2WA 2IRFG 5F64A 5ILVA 5D5WB 3CUQA 1UCRA 3I4PA 2Z9OA 2MC3A 2ESHA 3RYRA 5DV5A 3GLXA 3I5UA 3IKVA 2K02A 4I98B 4Q47A 1B9NA 4ZYEA 3GF2A 1H9GA 4HDVA 3ZMTA 3Q9SA 4LG0A 2EA4A 1BOAA 2VBWA 5LHHA 3SZTA 1GHCA 1REPC 2V1DA 1FOKA 4ZZLA 1SD7A 5CVJA 3P9KA 1O7LA 5FLXZ 2GIVA 4BHCA 1T2KA 3GFMA 3KLNA 4GYIA 2L4AA 2V6CA 3ZQ7A 3ZPLA 1P92A 1YS7A 1ULYA 3ABTA 4A6DA 4PZJA 2HDCA 4TV7A 2KIUA 1UFMA 3KZZA 3HSEA 2EJRA 1STZA 3HRMA 3ULQB 2P5VA 4XRFA 5D5XB 5LGNA 4Y13A 3GW2A 1YFHA 1ZGJA 4YG2F 2FE3A 3G3ZA 2WWYA 2QYOA 2E1CA 2O6GE 2Q2EA 1HSTA 5E8GA 3I58A 5D8LB 1MDMB 2Z3YA 1FT9A 4YIFA 2FNPA 1USSA 3LSTA 4OIQF 3CO7C 3KZYA 1SD4A 1KYZA 5BPIA 2VC1A 3DEUA 4K2EA 4YFKF 4A0YA 3O6BB 4OMZA 5IT3A 2ACJA 1OKRA 1HSJA 2O0YA 5FLXK 1D5VA 3WG9A 1DPRA 2A6EF 1SAXA 2A68F 4XLPF 1E17A 4IHTA 4G7OF 1QGPA 2BV6A 3GZ5A 1Z91A 1WSUA 3I59B 5BQTA 4HF2A 5LHGA 1S6LA 3IWZA 1SFEA 3JAMZ 2Q0OA 3TGNA 1Z9CA 1LEAA 3KP5A 3MFKA 3F8CA 2FA5A 3WE2A 1IF1A 4LLGF 1BC8C 1ZG5A 4B09A 3GEZA 1ZRCA 4HX4A 5ICEA 2PN6A 2UZKA 2XV4S 1O3QA 4WK8F 3MCZA 2ZJ2A 4OIPF 2M1BA 1DDNA 3FF5A 3CDHA 4BQAA 3GUDA 1SFUA 4Y15A 4RB3C 2A6HF 3GO5A 4O6JA 3NRVA 1XGSA 1BI0A 3PQKA 3HOSA 4P55A 2EV0A 2EV5A 2W85A 2VONA 5FFXA 1K79A 1I6XA 5FGMA 2GAUA 2CO5A 4QWQA 1V3FA 4A5NA 4UVAA 3HUGA 3HYIA 3T8TA 3FZVA 2RKHA 1RUNA 1FPQA 3E5UA 3WTUC 3QOPA 2XKOA 4HA8A 1FYLA 2K86A 1XMKA 4BHPA 2QZ8A 2DPUA 1X3UA 3CO6C 3ZMUA 3WTTC 2M8EA 2NNNA 3FHZA 3W6JB 5CVVA 1SMYF 3IWFA 3VFZA 3WTWC 1P4XA 3DFGA 5ICGA 3JAMK 3GYHX 4CICA 5F1RA 2L3DA 1J7KA 5DEQA 2JPCA 4I0AA 2G7UA 3FMRA 1C0WA 3K2ZA 5LRSA 1HW5A 3BROA 3RIRA 1W5TA 4BXUA 3COAC 2O61A 3KFWX 4M71A 3I59A 2BEOA 2GXBA 1ZGAA 3WTYC 5CJ9A 3BJAA 2DW4A 5BMZA 4R8HA 5J6XA 1HKQA 3E97A 5FD6A 1J75A 4A12A 5E1XA 4CGZA 3S2WA 3HOTA 1FBQA 5L3CA 2M5WA 1ZLKA 5FO5A 1J5YA 4U0YA 2W25A 2F2EA 3WTVC 2DPDA 2BYVE 2JTVA 1J0RA 2CSOA 3FMQA 1B59A 4XSZF 3RTRA 3QP5A 3IHUA 3REOA 2DLLA 5ILSA 2LKPA 2XASA 4GXOA 5D5UB 4L0YB 1U5TA 4HDUA 2KIFA 2W84A 3KEOA 3BPXA 2PEXA 1QZZA 1IAWA 1B9MA 1FP2A 2YX4A 3V7SA 2R7DA 3M8EA 4KMUX 1KQ8A 3QU3A 3B02A 4HYEA 1IXCA 1BJAA 3FXUA 4L9JA 3P9IA 4F7ZA 3FM3A 1G3SA 4AIJA 4N9IA 3KEQA 2J5PA 3VB2A 2ZCWA 4ENNA 3QU6A 5HDGA 3U2RA 4IHSA 1OYYA 4KN7X 5ED4A 4LLLA 3T5XA 2V9VA 3W6KB 1IW7F 4LD5A 4HAMA 1F5TA 3WGGA 5L3GA 4M6YA 3SFZA 3P9CA 2YX7A 3BPVA 3BY6A 4EJWA 3BP8A 4RB0A 4I02A 2GXGA 1MJBA 2Z33A 1BN5A 4M6XA 1CGPA 3DXJF 4WXCA 3EYYA 4ESJA 4FT8A 4P9FA 1FBSA 1RZ4A 3VEPA 3CUQC 2RN7A 2A5YB 3LQRA 2MLKA 4L9VA 1G3WA 2BE5F 3D5LA 3TOAA 5ICFA 3F8NA 5HLGA 3RDIA 2UXNA 4Z2YA 1ZG1A 1P6RA 1XSDA 3FMSA 3DPLC 1XDUA 2EA2A 2WTEA 2CGPA 2MH9A 2RVCA 3R0JA 2XKPA 2ZMEB 4UNOA 3DV8A 3H3ZA 4OOIA 4LMYA 4A2UA 4HLYA 4HQEA 1HW2A 3TQNA 1XGOA 2ZXJA 5DCMA 2M30A 3T8RA 2MD5A 1EH8A 2EFWA 3F6VA 3Q9VA 3V4GA 2O3FA 4CYDA 4HQMA 4LLNA 1KU9A 3E3VA 1FZPB 1FLIA 4ETSA 3JTGA 3F8MA 3KLOA 4P96A 2ESNA 1AOYA 1HW1A 4BHBA 1RNLA 4AIKA 3F72A 1XCVA 3IL2A 2DFIA 3MWMA 1QO0D 4YFNF 2HTJA 1B6AA 3GFLA 5L3EA 2HQNA 1RI7A 3F21A 2BBYA 2K27A 1DPUA 1U6GA 2ZKZA 4GCVA 1SD6A 2EFOA 2B0LA 4XBFA 1YG2A 2XAHA 3L2CA 1YS6A 3G73A 1D8KA 2RV8A 1WKMA 1ZARA 2KJBA 5DCFA 2ZNZA 3WTZA 1KU2A 2H94A 2XRNA 4I01A 1LJ9A 1FBUA 4AIHA 5ERIA 1UHMA 5CVRA 2Z99A 4S05A 1O3SA 2BGCA 2HEOA 5DUKA 2HKOA 3TO6A 2GWRA 1W7PB 1BC7C 2MH2A 4CO8A 1I5ZA 3I64A 5J8FA 2XHKA 2LNBA 1H9TA 4L9NA 2MBFA 3BZ6A 4I09A 1O3TA 3DKWA 1I1SA 2P7CB 3R6SA 1K7AA 2A61A 3WGIA 4PCQA 5HDNA 2AXLA 4KFCA 3FXRA 1U3EM 1MJAA 2XUBA 2ZBKA 3TDZC 3WTXC 2COMA 3KCCA 4LB5A 5DYMA 2IA2A 1KA8A 1R1UA 4MNUA 3J80Z 1TNSA 1ODDA 3M8FA 2ZMEA 4M74A 4M72A 4ZH4F 3U1DA 5K5QA 2ZO4A 4H0EA 4L5JA 4HF1A 4Y17A 4MGRA 3SZPA 1TBXA 5K1YA 2FMLA 2NAZA 2P5KA 3F6OA 1G6NA 2DQLA 4O5VA 3V7RA 4ZYHA 2PG4A 2HR3A 4KICA 2K4BA 1S7OA 2L01A 1KQ0A 3ERED 3RKYA 2OQGA 1XDSA 1ZRFA 1A04A 3GVAA 2VOOA 5E18F 2DT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPM A;  1TTY A;  3U9G A;  4HOB A;  1MGT A;  2QLZ A;  2EWN A;  3ZP5 A;  1XGN A;  1S3J A;  3KP4 A;  2A69 F;  1T98 A;  2E7W A;  1XD7 A;  3VOE A;  4KIB A;  1FC3 A;  3MEX A;  4M73 A;  1LDK B;  5FFZ A;  2LDU A;  1FX7 A;  3FX3 A;  3NEU A;  4U0W A;  2JZY A;  1IRF A;  4ENM A;  2JSC A;  2H6B A;  2STW A;  1HKS A;  2HGC A;  4BH9 A;  5E17 F;  2PQ8 A;  3K69 A;  1W7P A;  2CG4 A;  4EMS A;  4EJV A;  2XVC A;  3J80 K;  4KUM A;  3TO9 A;  4FHT A;  4WWC A;  2O03 A;  3LWF A;  1R1T A;  4M9S A;  2FSW A;  4ENJ A;  3R61 A;  3TDU C;  2Y48 A;  5KK1 A;  5CVI A;  1U5T B;  2P6T A;  4AD9 A;  1KU3 A;  1KU7 A;  2HYG D;  2PMU A;  2CQK A;  3H3U A;  1FSE A;  4N0B A;  3HRU A;  2OU2 A;  1YLF A;  3JSO A;  1KYW A;  2OBP A;  3RKX A;  1XMA A;  3ZN0 A;  1JGS A;  3JTH A;  3EUH A;  4LGW A;  1BI2 A;  1F1Z A;  4HZF A;  2UWM A;  1O3R A;  5HS7 A;  3IRR A;  1TQP A;  4L5I A;  4CHU A;  3K1N A;  5DDG A;  3MQ0 A;  5AIQ A;  2XAG A;  2K4J A;  4RGS A;  2D1H A;  3NQO A;  5DUI A;  3FWE A;  1QBJ A;  4ESB A;  4G8X A;  2R3S A;  4MQV A;  4I2O A;  2QM3 A;  5D6F A;  5LBQ A;  2STT A;  4QLC U;  3QP6 A;  4UVB A;  4GGG A;  4I0B A;  1ZRD A;  4WXH A;  2H6C A;  1O7F A;  5K5R A;  1ON2 A;  1Y0U A;  5DD4 A;  3LAP A;  4U0V A;  1DP7 P;  1XGM A;  2O8X A;  5FD5 A;  3KP2 A;  1R58 A;  3SXY A;  4KNY A;  2VBX A;  3F8B A;  1O57 A;  5H6Q A;  5TJJ A;  4CZZ A;  4HF0 A;  2F5E A;  3P7N A;  2OZU A;  5L3F A;  4UUV A;  4NQW A;  2C6Y A;  1GVJ A;  3KE2 A;  2H27 A;  1OMI A;  3C1D A;  2GA2 A;  1YW7 A;  2W57 A;  3CLO A;  5LLQ A;  5DD8 A;  3I0T A;  4YFX F;  5ILU A;  3TOB A;  1R5H A;  1PP8 F;  3L09 A;  4O3M A;  2X0L A;  5D4S A;  3BJ6 A;  1WWX A;  3ROU A;  1ON1 A;  5E1Z B;  2QUF A;  1IUY A;  1PP7 U;  4NHJ A;  4RAY A;  4EJT A;  1S29 A;  1ZN2 A;  2A07 F;  1CF7 A;  1V4R A;  5DCM B;  1Z6R A;  2IA1 A;  2P4W A;  2E7X A;  2VE8 A;  1ZYR F;  4M9X A;  4MEY F;  1DUX C;  5BS6 A;  3BWG A;  5D6E A;  1Z1D A;  1LDJ A;  1IN4 A;  2YU3 A;  3MZY A;  5JFR A;  1KGS A;  2NNY A;  1HBX G;  1PUE E;  4B8X A;  2VOP A;  2EV6 A;  2VC0 A;  2VE9 A;  3C18 A;  2OZ6 A;  3HTU A;  1YQA A;  4EVI A;  3BDD A;  1RUO A;  4OIO F;  4UVC A;  3ZN1 A;  2HWV A;  3C7J A;  2Q8K A;  3LAJ A;  1Q1H A;  1LVA A;  5L3B A;  2RGV A;  3HTS B;  2OAZ A;  3DP7 A;  3E6C C;  2FNA A;  1FP1 D;  2DQR A;  1G4D A;  2XIG A;  3KP3 A;  3F23 A;  3WU1 B;  1R1V A;  3GX4 X;  1L0O C;  2FEZ A;  1KQ9 A;  2TDX A;  4MEX F;  1TQI A;  3Q5F A;  2KJC A;  1J2X A;  2FXA A;  2VOD A;  1L3L A;  3H92 A;  3J7A O;  2D45 A;  1T6S A;  5CLS A;  3DPT A;  2IT0 A;  3F22 A;  2QWW A;  4U88 A;  2RNJ A;  4RGX A;  1IN6 A;  1FWZ A;  2DU9 A;  4U7B A;  5D8K B;  4KN4 X;  2HZT A;  1XB4 A;  3ZMV A;  5A2Q Z;  1Z7U A;  2FOK A;  4KDP A;  2KIM A;  1OYI A;  4KIF A;  4A0X A;  2PI0 A;  2PBI A;  3J81 Z;  3WOD F;  2RC4 A;  5JHU A;  5JVT A;  4ASN A;  4LFU A;  2IJL A;  1U78 A;  5E1W A;  4A6E A;  2V1U A;  3L9F A;  4JBA A;  5D4R A;  1QNT A;  2FQ3 A;  4RS8 A;  2FF4 A;  1LB2 A;  5H20 A;  4UV8 A;  2QQ9 A;  1ZRE A;  3RKW A;  3LFK A;  4OU0 A;  4CXF A;  2DAO A;  2FBI A;  2M87 A;  4DQ2 A;  2KKO A;  1VTN C;  2PFB A;  3L00 A;  4I7H A;  2V79 A;  5TRD A;  2CW0 F;  3ELK A;  3E6D A;  4S04 A;  5CVU A;  1B1B A;  2JPB A;  4IXA A;  4ENK A;  1NHA A;  1OPC A;  3ZMD A;  2E1N A;  2HYF A;  4EGY A;  2R7F A;  3M1E A;  3PFI A;  3WE3 A;  3SHF A;  5HLI A;  3MZH A;  2VN2 A;  2DO7 A;  4LB6 B;  2D1V A;  5A2Q K;  5AIP A;  1LQ1 A;  3HSR A;  3E5X A;  4PGH A;  4KT5 C;  3JW4 A;  3GFI A;  3J81 K;  4ZZD A;  4IRH A;  2OD5 A;  1TNT A;  3ECO A;  3EET A;  4JQF A;  3R60 A;  6PAX A;  4EQQ A;  4M9Z A;  3HRT A;  5JI6 A;  1QQI A;  1UST A;  4UV9 A;  1PDN C;  2NRA C;  3LQQ A;  5HS8 A;  2Y0M A;  3ECH A;  2G9W A;  2G7H A;  3CJN A;  2PLY A;  3KET A;  2ETH A;  4RB2 C;  4XSX F;  2CWE A;  1BIA A;  1IZ1 A;  3F8F A;  1R00 A;  2DBB A;  4Q5S F;  2CFX A;  4MTE A;  1EV7 A;  2A3S A;  1HQC A;  1GXP A;  2WC2 A;  4IRI A;  2YR2 A;  3E6B A;  3F3X A;  1BIB A;  3QPH A;  2IA0 A;  2HOE A;  3ML6 A;  5ICC A;  1SFX A;  5HOO A;  1BI3 A;  4IVN A;  3IRQ A;  5IT9 Z;  2VT2 A;  1W4M A;  3M9A A;  1F4K A;  3IKT A;  4D0P A;  4HV6 A;  4EM2 A;  1WQ2 A;  2XGX A;  3GXO A;  4ON0 A;  3M7G A;  1FSH A;  3BJO A;  1EH6 A;  3FXQ A;  2RQP A;  3WTS C;  3D0S A;  3LA2 A;  3WGH A;  3V8K A;  1IXS B;  1P4A A;  1YO5 C;  4G6D A;  1UHW A;  1YYV A;  1YW9 A;  1UB9 A;  1T39 A;  2MA3 A;  1J59 A;  3T0Y A;  3HHG A;  5J8C A;  2OQR A;  3HIF A;  2Z5U A;  5H6R A;  5LEJ A;  1D3Y A;  3DF8 A;  4RGU A;  2F5C A;  4E70 A;  3QRF F;  4LK0 F;  1MKM A;  1JHH A;  1YW8 A;  4L0Z B;  1FYK A;  2IW5 A;  4PDK A;  1IN5 A;  3RJP A;  3T1B A;  4MTD A;  1E2X A;  3KP6 A;  4A5M A;  4P5O A;  3SQN A;  2L4M A;  3CTA A;  4Q48 A;  1TW2 A;  1ZG3 A;  4WX9 A;  5AON A;  1CF7 B;  3HRS A;  4G94 A;  1TLH B;  4EGZ A;  3OV8 A;  1U8R A;  1G3Y A;  4A0Z A;  1H0M A;  2YSR A;  3TO7 A;  2YPR A;  4IRG A;  5EEH A;  1BI1 A;  2FBK A;  3EDP A;  1IN7 A;  1XN7 A;  4OMY A;  5IT9 K;  2VBY A;  4MQ9 F;  5LHI A;  1LEB A;  1R7J A;  4UXN A;  2ZNY A;  1YIO A;  1G3T A;  3I53 A;  1ONV A;  5KVR A;  4MHG A;  1SMT A;  4ESF A;  3KP7 A;  3AAF A;  2P7V B;  4OIN F;  4BAY A;  4YII A;  4HLX A;  5K5O A;  1P2F A;  1Z05 A;  2GA1 A;  3QAH A;  4XLN F;  4IJA A;  2XRO A;  4EM0 B;  3V7C A;  1J9I A;  1TQM A;  3L7W A;  1S8N A;  4G6Q A;  4EJO A;  3O3K A;  2LF7 A;  3RPU A;  1EH7 A;  2EFQ A;  1U5T C;  1OYW A;  1GXQ A;  4N9H A;  2QQA A;  1D8J A;  2DK8 A;  2L54 A;  1R5G A;  5EEG A;  3K1M A;  4BYY A;  2DK5 A;  2W24 A;  3E5Q A;  1MDM A;  4R1H A;  3LA3 A;  5HDK A;  1ZLJ A;  2QVO A;  1LNW A;  2Y75 A;  3LA7 A;  1SD5 A;  2QEN A;  1I1G A;  3V8J A;  5HS9 A;  4CDG A;  1WRJ A;  4EM1 A;  2DTR A;  3BOQ A;  4KIG A;  2XAJ A;  4G9Y A;  4LJZ F;  1FNN A;  3GWZ A;  4HBL A;  1W7P D;  3N97 A;  2VT3 A;  5JR3 A;  3PQJ A;  1YTY A;  1ZHF A;  1S7A A;  2CYY A;  1MZB A;  2FU4 A;  2UXX A;  4AVP A;  3EQL F;  5LGU A;  3K9T A;  1HKT A;  1BBY A;  2IPQ X;  1K78 B;  1BM9 A;  2EB7 A;  4EJU A;  2LF8 A;  4RAZ A;  1JE8 A;  2GZW A;  2DI3 A;  2HTS A;  1ZAO A;  1MJ9 A;  1T38 A;  3WU0 A;  4P9U A;  4HW0 A;  4WCG A;  4WXD A;  1XSV A;  1T0F A;  3CUO A;  3ZMS A;  2H09 A;  2VXZ A;  3EYI A;  5LRR A;  4NB5 A;  2QBY B;  4GO1 A;  2IP2 A;  2EK5 A;  1FY7 A;  2AS5 F;  5BOX A;  2HQR A;  4IF4 A;  4HX8 A;  4RGR A;  4G7Z F;  1W5S A;  4OIR F;  5E20 A;  3N4M A;  2HS5 A;  3IC7 A;  1FYM A;  2K7L A;  2D2W A;  3ZMZ A;  5E8I A;  1ZH5 A;  2PMH A;  2EFN A;  3GZ6 A;  1B4A A;  2ELH A;  5FB2 A;  2P5L C;  1XSX A;  2ADU A;  3CUQ B;  2FBH A;  3I71 A;  1LDD A;  2ZFW A;  2L02 A;  4U7D A;  2LSO A;  2M45 A;  5CYV A;  4Q4Z F;  4ZYG A;  3MAJ A;  5BPD A;  2F5F A;  4EV0 A;  4G7H F;  1I27 A;  1R22 A;  3ISP A;  2KRF A;  4LG0 B;  2MLG A;  5F6F A;  1TW3 A;  3C3W A;  2RDP A;  1IN8 A;  1Z6T A;  2HFH A;  4UHT A;  4WF2 A;  2EFP A;  3TKY A;  4AWX B;  4FX4 A;  1HXD A;  2VBZ A;  2FMY A;  4KYW A;  3ABU A;  3E6M A;  4RB1 A;  3RYP A;  2ISY A;  4L18 B;  2XAQ A;  3HHH A;  3I54 A;  1JHF A;  2PJP A;  4L9T A;  4FX0 A;  3OOP A;  2J5O A;  3B73 A;  3VOD A;  1R23 A;  2GQQ A;  2OA4 A;  1IXR C;  1MD0 A;  2XAF A;  1XCB A;  1K78 A;  2F5D A;  5D5V B;  2P8T A;  4DNC A;  1RIO H;  1AWC A;  2ISZ A;  5LEK A;  3JSP A;  4KMF A;  3RPQ A;  1P4W A;  1JXS A;  1F9N A;  3GFJ A;  2QQB A;  4HX7 A;  4PGG A;  2X4H A;  3RI4 A;  4JK1 X;  5L3D A;  3V8L A;  4KA4 A;  4R79 A;  1R36 A;  5HVQ C;  4IPA A;  1IRG A;  3K1P A;  5HLH A;  2QBY A;  2P6S A;  3DQV C;  3HSF A;  3R0A A;  2WV0 A;  1QZY A;  2HKX A;  3R4K A;  5LGT A;  4GYG A;  1K6O A;  2V1X A;  1OR7 A;  2NS0 A;  1WI9 A;  3O2P E;  3K0L A;  2FRH A;  3QPT A;  2JT1 A;  4BNC A;  4HV5 A;  4ZYD A;  2JRT A;  2IVM A;  3FM5 A;  2NYX A;  4LK1 F;  1U2W A;  2IRF G;  5F64 A;  5ILV A;  5D5W B;  3CUQ A;  1UCR A;  3I4P A;  2Z9O A;  2MC3 A;  2ESH A;  3RYR A;  5DV5 A;  3GLX A;  3I5U A;  3IKV A;  2K02 A;  4I98 B;  4Q47 A;  1B9N A;  4ZYE A;  3GF2 A;  1H9G A;  4HDV A;  3ZMT A;  3Q9S A;  4LG0 A;  2EA4 A;  1BOA A;  2VBW A;  5LHH A;  3SZT A;  1GHC A;  1REP C;  2V1D A;  1FOK A;  4ZZL A;  1SD7 A;  5CVJ A;  3P9K A;  1O7L A;  5FLX Z;  2GIV A;  4BHC A;  1T2K A;  3GFM A;  3KLN A;  4GYI A;  2L4A A;  2V6C A;  3ZQ7 A;  3ZPL A;  1P92 A;  1YS7 A;  1ULY A;  3ABT A;  4A6D A;  4PZJ A;  2HDC A;  4TV7 A;  2KIU A;  1UFM A;  3KZZ A;  3HSE A;  2EJR A;  1STZ A;  3HRM A;  3ULQ B;  2P5V A;  4XRF A;  5D5X B;  5LGN A;  4Y13 A;  3GW2 A;  1YFH A;  1ZGJ A;  4YG2 F;  2FE3 A;  3G3Z A;  2WWY A;  2QYO A;  2E1C A;  2O6G E;  2Q2E A;  1HST A;  5E8G A;  3I58 A;  5D8L B;  1MDM B;  2Z3Y A;  1FT9 A;  4YIF A;  2FNP A;  1USS A;  3LST A;  4OIQ F;  3CO7 C;  3KZY A;  1SD4 A;  1KYZ A;  5BPI A;  2VC1 A;  3DEU A;  4K2E A;  4YFK F;  4A0Y A;  3O6B B;  4OMZ A;  5IT3 A;  2ACJ A;  1OKR A;  1HSJ A;  2O0Y A;  5FLX K;  1D5V A;  3WG9 A;  1DPR A;  2A6E F;  1SAX A;  2A68 F;  4XLP F;  1E17 A;  4IHT A;  4G7O F;  1QGP A;  2BV6 A;  3GZ5 A;  1Z91 A;  1WSU A;  3I59 B;  5BQT A;  4HF2 A;  5LHG A;  1S6L A;  3IWZ A;  1SFE A;  3JAM Z;  2Q0O A;  3TGN A;  1Z9C A;  1LEA A;  3KP5 A;  3MFK A;  3F8C A;  2FA5 A;  3WE2 A;  1IF1 A;  4LLG F;  1BC8 C;  1ZG5 A;  4B09 A;  3GEZ A;  1ZRC A;  4HX4 A;  5ICE A;  2PN6 A;  2UZK A;  2XV4 S;  1O3Q A;  4WK8 F;  3MCZ A;  2ZJ2 A;  4OIP F;  2M1B A;  1DDN A;  3FF5 A;  3CDH A;  4BQA A;  3GUD A;  1SFU A;  4Y15 A;  4RB3 C;  2A6H F;  3GO5 A;  4O6J A;  3NRV A;  1XGS A;  1BI0 A;  3PQK A;  3HOS A;  4P55 A;  2EV0 A;  2EV5 A;  2W85 A;  2VON A;  5FFX A;  1K79 A;  1I6X A;  5FGM A;  2GAU A;  2CO5 A;  4QWQ A;  1V3F A;  4A5N A;  4UVA A;  3HUG A;  3HYI A;  3T8T A;  3FZV A;  2RKH A;  1RUN A;  1FPQ A;  3E5U A;  3WTU C;  3QOP A;  2XKO A;  4HA8 A;  1FYL A;  2K86 A;  1XMK A;  4BHP A;  2QZ8 A;  2DPU A;  1X3U A;  3CO6 C;  3ZMU A;  3WTT C;  2M8E A;  2NNN A;  3FHZ A;  3W6J B;  5CVV A;  1SMY F;  3IWF A;  3VFZ A;  3WTW C;  1P4X A;  3DFG A;  5ICG A;  3JAM K;  3GYH X;  4CIC A;  5F1R A;  2L3D A;  1J7K A;  5DEQ A;  2JPC A;  4I0A A;  2G7U A;  3FMR A;  1C0W A;  3K2Z A;  5LRS A;  1HW5 A;  3BRO A;  3RIR A;  1W5T A;  4BXU A;  3COA C;  2O61 A;  3KFW X;  4M71 A;  3I59 A;  2BEO A;  2GXB A;  1ZGA A;  3WTY C;  5CJ9 A;  3BJA A;  2DW4 A;  5BMZ A;  4R8H A;  5J6X A;  1HKQ A;  3E97 A;  5FD6 A;  1J75 A;  4A12 A;  5E1X A;  4CGZ A;  3S2W A;  3HOT A;  1FBQ A;  5L3C A;  2M5W A;  1ZLK A;  5FO5 A;  1J5Y A;  4U0Y A;  2W25 A;  2F2E A;  3WTV C;  2DPD A;  2BYV E;  2JTV A;  1J0R A;  2CSO A;  3FMQ A;  1B59 A;  4XSZ F;  3RTR A;  3QP5 A;  3IHU A;  3REO A;  2DLL A;  5ILS A;  2LKP A;  2XAS A;  4GXO A;  5D5U B;  4L0Y B;  1U5T A;  4HDU A;  2KIF A;  2W84 A;  3KEO A;  3BPX A;  2PEX A;  1QZZ A;  1IAW A;  1B9M A;  1FP2 A;  2YX4 A;  3V7S A;  2R7D A;  3M8E A;  4KMU X;  1KQ8 A;  3QU3 A;  3B02 A;  4HYE A;  1IXC A;  1BJA A;  3FXU A;  4L9J A;  3P9I A;  4F7Z A;  3FM3 A;  1G3S A;  4AIJ A;  4N9I A;  3KEQ A;  2J5P A;  3VB2 A;  2ZCW A;  4ENN A;  3QU6 A;  5HDG A;  3U2R A;  4IHS A;  1OYY A;  4KN7 X;  5ED4 A;  4LLL A;  3T5X A;  2V9V A;  3W6K B;  1IW7 F;  4LD5 A;  4HAM A;  1F5T A;  3WGG A;  5L3G A;  4M6Y A;  3SFZ A;  3P9C A;  2YX7 A;  3BPV A;  3BY6 A;  4EJW A;  3BP8 A;  4RB0 A;  4I02 A;  2GXG A;  1MJB A;  2Z33 A;  1BN5 A;  4M6X A;  1CGP A;  3DXJ F;  4WXC A;  3EYY A;  4ESJ A;  4FT8 A;  4P9F A;  1FBS A;  1RZ4 A;  3VEP A;  3CUQ C;  2RN7 A;  2A5Y B;  3LQR A;  2MLK A;  4L9V A;  1G3W A;  2BE5 F;  3D5L A;  3TOA A;  5ICF A;  3F8N A;  5HLG A;  3RDI A;  2UXN A;  4Z2Y A;  1ZG1 A;  1P6R A;  1XSD A;  3FMS A;  3DPL C;  1XDU A;  2EA2 A;  2WTE A;  2CGP A;  2MH9 A;  2RVC A;  3R0J A;  2XKP A;  2ZME B;  4UNO A;  3DV8 A;  3H3Z A;  4OOI A;  4LMY A;  4A2U A;  4HLY A;  4HQE A;  1HW2 A;  3TQN A;  1XGO A;  2ZXJ A;  5DCM A;  2M30 A;  3T8R A;  2MD5 A;  1EH8 A;  2EFW A;  3F6V A;  3Q9V A;  3V4G A;  2O3F A;  4CYD A;  4HQM A;  4LLN A;  1KU9 A;  3E3V A;  1FZP B;  1FLI A;  4ETS A;  3JTG A;  3F8M A;  3KLO A;  4P96 A;  2ESN A;  1AOY A;  1HW1 A;  4BHB A;  1RNL A;  4AIK A;  3F72 A;  1XCV A;  3IL2 A;  2DFI A;  3MWM A;  1QO0 D;  4YFN F;  2HTJ A;  1B6A A;  3GFL A;  5L3E A;  2HQN A;  1RI7 A;  3F21 A;  2BBY A;  2K27 A;  1DPU A;  1U6G A;  2ZKZ A;  4GCV A;  1SD6 A;  2EFO A;  2B0L A;  4XBF A;  1YG2 A;  2XAH A;  3L2C A;  1YS6 A;  3G73 A;  1D8K A;  2RV8 A;  1WKM A;  1ZAR A;  2KJB A;  5DCF A;  2ZNZ A;  3WTZ A;  1KU2 A;  2H94 A;  2XRN A;  4I01 A;  1LJ9 A;  1FBU A;  4AIH A;  5ERI A;  1UHM A;  5CVR A;  2Z99 A;  4S05 A;  1O3S A;  2BGC A;  2HEO A;  5DUK A;  2HKO A;  3TO6 A;  2GWR A;  1W7P B;  1BC7 C;  2MH2 A;  4CO8 A;  1I5Z A;  3I64 A;  5J8F A;  2XHK A;  2LNB A;  1H9T A;  4L9N A;  2MBF A;  3BZ6 A;  4I09 A;  1O3T A;  3DKW A;  1I1S A;  2P7C B;  3R6S A;  1K7A A;  2A61 A;  3WGI A;  4PCQ A;  5HDN A;  2AXL A;  4KFC A;  3FXR A;  1U3E M;  1MJA A;  2XUB A;  2ZBK A;  3TDZ C;  3WTX C;  2COM A;  3KCC A;  4LB5 A;  5DYM A;  2IA2 A;  1KA8 A;  1R1U A;  4MNU A;  3J80 Z;  1TNS A;  1ODD A;  3M8F A;  2ZME A;  4M74 A;  4M72 A;  4ZH4 F;  3U1D A;  5K5Q A;  2ZO4 A;  4H0E A;  4L5J A;  4HF1 A;  4Y17 A;  4MGR A;  3SZP A;  1TBX A;  5K1Y A;  2FML A;  2NAZ A;  2P5K A;  3F6O A;  1G6N A;  2DQL A;  4O5V A;  3V7R A;  4ZYH A;  2PG4 A;  2HR3 A;  4KIC A;  2K4B A;  1S7O A;  2L01 A;  1KQ0 A;  3ERE D;  3RKY A;  2OQG A;  1XDS A;  1ZRF A;  1A04 A;  3GVA A;  2VOO A;  5E18 F;  2DT5 A; 
#chains in the Genus database with same CATH topology
 1UMQ A;  4HRI A;  2WAQ N;  1QPM A;  1TTY A;  1HF0 A;  3U9G A;  1B8I A;  4HOB A;  4B47 A;  1MGT A;  3HPG A;  3HZJ A;  4B43 A;  2QLZ A;  3SJM A;  3DKY A;  3I55 I;  2EWN A;  3AL0 B;  3ZP5 A;  1XGN A;  3LSP A;  1S3J A;  3KP4 A;  2A69 F;  1T98 A;  2E7W A;  2QGU A;  4PJM A;  1XD7 A;  3QWL A;  3TBI A;  1IGN A;  3VOE A;  4KIB A;  2BXZ A;  1FC3 A;  3MEX A;  4M73 A;  1LDK B;  5FFZ A;  2LDU A;  1FX7 A;  3FX3 A;  3NEU A;  3ZQH A;  2GXA A;  1V5G A;  3FIW A;  3K4K A;  1X58 A;  4U0W A;  1APL C;  4NQW B;  1OCZ H;  2JZY A;  5HOD A;  3ZQQ A;  1IRF A;  2JK3 A;  4D5C A;  4ENM A;  2JSC A;  2H6B A;  2RRE A;  5FKL A;  3HOY J;  3HOV J;  2STW A;  1HKS A;  2HGC A;  2DJN A;  2JWT A;  4RLF A;  4BH9 A;  5E17 F;  2PQ8 A;  3K69 A;  1W7P A;  2CG4 A;  4EMS A;  4BGD A;  4EJV A;  2IS4 A;  1WJA A;  2BHY A;  2XVC A;  3J80 K;  3E0J B;  4KUM A;  3TO9 A;  4FHT A;  5CQG A;  3H5N A;  1BJZ A;  4WWC A;  1GV2 A;  4E7S A;  2O03 A;  5JHF A;  3LWF A;  1R1T A;  4M9S A;  5GAD J;  2FSW A;  2JN6 A;  4ENJ A;  3NWS A;  4IO9 F;  1PJR A;  3R61 A;  2L2O A;  3TDU C;  2Y48 A;  5KK1 A;  5CVI A;  4BS9 A;  3G1M A;  1U5T B;  3KEY A;  5J1U A;  2P6T A;  3CJR B;  1KU3 A;  4AD9 A;  5DM7 F;  2W1O A;  3LSR A;  1KU7 A;  2HYG D;  1I3Q J;  2F5V A;  2PMU A;  2CQK A;  2VKH A;  5F08 A;  3K70 C;  3H3U A;  1FSE A;  4N0B A;  2JMW A;  2OU2 A;  3HRU A;  1GVD A;  1YLF A;  3JSO A;  1KYW A;  2OBP A;  2EQR A;  1TWF J;  5IP6 A;  1F36 A;  2OPT A;  3RKX A;  1XMA A;  3ZN0 A;  1LFP A;  1JGS A;  3JTH A;  3L1P A;  2V9K A;  2AXT C;  1X2N A;  1ZKG A;  5EG0 A;  1I50 J;  3EUH A;  4ZTF A;  4LGW A;  5KCM A;  3NWT A;  1BI2 A;  1F1Z A;  2X1C A;  3BG6 A;  4HZF A;  2X9D A;  5JVG F;  2UWM A;  2ZJQ F;  4XKV A;  1O3R A;  4MO7 A;  2KL4 A;  2WY8 Q;  5HS7 A;  1XG1 A;  1TQP A;  3HJE A;  3IRR A;  4L5I A;  3CC2 I;  3J7Y J;  3ZQC A;  1QA6 A;  4CHU A;  3VDX A;  1LUJ B;  3K1N A;  1N75 A;  2W4S A;  2VLA A;  2IS6 A;  5DDG A;  3MQ0 A;  1M1E B;  2VJ5 A;  5AIQ A;  2R5Y A;  1JGG A;  2XAG A;  2K4J A;  4W97 A;  4RGS A;  2D1H A;  5LFA A;  2CV1 A;  2JA2 A;  3NQO A;  2PJR B;  5DUI A;  1BA5 A;  3DTI A;  3FWE A;  1QBJ A;  4ESB A;  2CV2 A;  4E7I A;  4G8X A;  1YRN B;  1RPW A;  2R3S A;  4MQV A;  1T8I A;  4I2O A;  2TCT A;  2DFE A;  2LBF A;  2QM3 A;  3S3O A;  5D6F A;  4NC7 A;  3CME I;  5LBQ A;  4X6A J;  1ETQ A;  3ASN H;  2STT A;  4QLC U;  3QP6 A;  4UVB A;  4GGG A;  1H88 C;  4I0B A;  3G71 I;  1ZRD A;  3RZD J;  4WXH A;  2H6C A;  2QCO A;  1O7F A;  2XGC A;  3X2Q H;  3OOU A;  3QOE A;  2WAQ A;  2WBM A;  4BDY A;  5K5R A;  4C3J J;  2DA3 A;  2R5Z B;  1ON2 A;  1QHH D;  1Z3X A;  1Y0U A;  2RAE A;  3JRC A;  1ETV A;  1GV5 A;  3OYG A;  1JT6 A;  5DD4 A;  3ZGK A;  3F9K A;  3LAP A;  2F6C A;  4Y4R A;  3HDD A;  2H8R A;  4U0V A;  2XPV A;  1DP7 P;  3O8H A;  4D9J A;  1XGM A;  2LRE A;  2O8X A;  5FD5 A;  3KP2 A;  1R58 A;  3SXY A;  4KNY A;  5C3E J;  2VBX A;  2B7E A;  3F8B A;  1O57 A;  1R6R A;  1XX5 A;  5H6Q A;  5FKK A;  4HF0 A;  3Q0V A;  1QHG A;  2F5E A;  5TJJ A;  4CZZ A;  3CCR I;  4RMN A;  3P7N A;  2OZU A;  1V5E A;  5L3F A;  4UUV A;  4NQW A;  2C6Y A;  1GVJ A;  3KE2 A;  2KRC A;  3SEQ A;  2H27 A;  2FOW A;  3P5J A;  1OMI A;  3C1D A;  2GA2 A;  1WJE A;  1YW7 A;  2W57 A;  4M3E A;  5J1R A;  3CLO A;  5LLQ A;  5DD8 A;  3SEZ A;  3I0T A;  4YFX F;  5ILU A;  3H3V K;  3DCF A;  1MMN A;  4BXX J;  2DMN A;  2N8G A;  3TOB A;  3AG4 H;  1R5H A;  1PP8 F;  3L09 A;  4O3M A;  2X0L A;  5D4S A;  3BJ6 A;  1WWX A;  3ROU A;  1ON1 A;  4QTR A;  5E1Z B;  4BY1 J;  2QUF A;  1IUY A;  2L7Z A;  1PP7 U;  4NHJ A;  3GCM A;  4RAY A;  4EJT A;  1Z77 A;  1S29 A;  1ZN2 A;  3BTL A;  4RM3 A;  2A07 F;  1CF7 A;  4A3F J;  1V4R A;  5DCM B;  2R92 J;  1Z6R A;  5K7F A;  4CZC A;  3JRE A;  4A3B J;  3MVP A;  2IA1 A;  2P4W A;  2E7X A;  3CCL I;  4IOC F;  2JRM A;  2CQQ A;  2VE8 A;  1ZYR F;  4M9X A;  2ZSH B;  4MEY F;  2E1O A;  3HPH A;  4CSW A;  3GTO J;  1DUX C;  5BS6 A;  3BWG A;  5D6E A;  4B3A A;  1Z1D A;  1LDJ A;  2LY1 A;  1IN4 A;  5J4V A;  4XID A;  2YU3 A;  3MZY A;  1K83 J;  5JFR A;  1KGS A;  2NNY A;  1HBX G;  1PUE E;  2BZT A;  3HKZ N;  1MSE C;  3V42 A;  5EJC A;  4B8X A;  2VOP A;  3HG9 A;  2Y9Y A;  3RPU D;  4J01 A;  1B72 B;  2EV6 A;  2ID3 A;  2VC0 A;  4Y52 J;  2W7N A;  2VE9 A;  3C18 A;  2OZ6 A;  1AA7 A;  3HTU A;  1YQA A;  4EVI A;  5DS9 A;  3BDD A;  1RUO A;  4OIO F;  4UVC A;  3AG1 H;  3ZN1 A;  2HWV A;  4E7K A;  1RR7 A;  1SAN A;  4IQ4 A;  3MKZ A;  3VWB A;  4MFE A;  2VQL A;  3C7J A;  4X0G A;  2R93 J;  2Q8K A;  3LAJ A;  2ZJR F;  1MMG A;  1Q1H A;  2XF7 A;  1LVA A;  1E3H A;  5L3B A;  2OCE A;  5TGT A;  2RGV A;  2R0Q C;  3HTS B;  2R7W A;  1ZR2 A;  1P7I A;  3FXL A;  2PJR A;  2VKV A;  1A6I A;  4UUS A;  2OAZ A;  3DP7 A;  3E6C C;  2FNA A;  1FP1 D;  2DQR A;  1G4D A;  1BR1 A;  2XIG A;  3KP3 A;  2XRL A;  1LE8 B;  2HPM A;  3OL4 A;  3F23 A;  1VQ9 I;  3WU1 B;  1R1V A;  3GX4 X;  1T08 B;  1L0O C;  2FEZ A;  2KRH A;  4BQO A;  3PUF A;  1KQ9 A;  2TDX A;  2CW7 A;  2XSD C;  1YJN I;  4MEX F;  2BXY A;  1TQI A;  1Q1V A;  2CRG A;  3Q5F A;  2KJC A;  1J2X A;  1NH3 A;  2FXA A;  1VQ7 I;  1Y1V J;  4L5E A;  2VOD A;  1L3L A;  3H92 A;  4BL0 B;  3J7A O;  2ZXI A;  2D45 A;  1T6S A;  5FKO A;  3PO2 J;  1Y56 A;  1AU7 A;  3J7A Y;  5CLS A;  2JUC A;  2R5Z A;  3DPT A;  2IT0 A;  5EDN A;  3F22 A;  2GOM A;  2QWW A;  4U88 A;  4LG3 A;  2RNJ A;  4RGX A;  5M5W J;  4RAG A;  1IN6 A;  2R7Z J;  2EZL A;  1FWZ A;  3VYU B;  2DU9 A;  5H2F C;  3GTM J;  3JRB A;  3GME A;  4U7B A;  3S93 A;  5D8K B;  4KN4 X;  2HZT A;  4CCK A;  1XB4 A;  1J09 A;  3ZMV A;  5A2Q Z;  1Z7U A;  2FOK A;  1UJ8 A;  1QZE A;  2DDB A;  3WHC A;  4KDP A;  2KIM A;  3HOX J;  1OYI A;  4KIF A;  2GLO A;  1U8B A;  4BE2 A;  5HNH A;  2LKX A;  4A0X A;  3PUB A;  2PI0 A;  2PBI A;  3J81 Z;  3WOD F;  2RC4 A;  5JHU A;  4N4O B;  1JKO C;  1VQ5 I;  5JVT A;  4ASN A;  3GTJ J;  4LFU A;  2CW8 A;  2ZSI B;  2IJL A;  4CUG A;  1U78 A;  4Y3O A;  5E1W A;  2KLO A;  3BTI A;  4HNU A;  2E2I J;  3OSF A;  2DJI A;  4A6E A;  1NK2 P;  2V1U A;  3QYB A;  4DZJ A;  3L9F A;  3GLL A;  3Q0W A;  4JBA A;  5D4R A;  1QNT A;  4BJ6 C;  2FQ3 A;  4RS8 A;  2BY2 A;  2FF4 A;  3HL2 A;  1LB2 A;  3TED A;  3A0H C;  4BU2 A;  5H20 A;  1Z21 A;  4UV8 A;  2QQ9 A;  1H89 C;  1ZRE A;  3RKW A;  1F43 A;  3LFK A;  4OU0 A;  2GIZ A;  2MFZ A;  4CXF A;  4DOZ A;  2DAO A;  3LMM A;  1UEL B;  2FBI A;  3DU5 A;  1TWG J;  2M87 A;  1GLN A;  4DQ2 A;  2KKO A;  1VTN C;  2D5V A;  2PFB A;  3L00 A;  4I7H A;  4C3H J;  1IG7 A;  2V79 A;  2F48 A;  2GBY A;  3HKZ A;  2E5Z A;  2VJI A;  3LSH A;  5TRD A;  2JA8 J;  1LFB A;  2CW0 F;  3ELK A;  2DTZ A;  3CD6 I;  3VPR A;  4XR6 A;  2EZI A;  1B72 A;  3E6D A;  4S04 A;  4XOP A;  5CVU A;  4XRS G;  3M1C A;  4II3 A;  5FRN A;  3HGG A;  1B1B A;  1WJB A;  3FDY A;  2ZME C;  2I5U A;  2JPB A;  1QVT A;  5HLT A;  4IXA A;  1VQK I;  4ENK A;  1VF9 A;  1NHA A;  1OPC A;  3ZMD A;  3K4N A;  5FRM A;  2E1N A;  2HYF A;  4EGY A;  4JX4 A;  2R7F A;  3M1E A;  4RM2 A;  2Z2S B;  3PFI A;  1Z7L A;  2V7F A;  3WE3 A;  3SHF A;  5HLI A;  2LYC A;  3MZH A;  3CDL A;  2VN2 A;  5F0H A;  3EUA A;  2DO7 A;  2OJE D;  2DFH A;  1R49 A;  2QA4 I;  2JJ7 A;  1LE8 A;  1TL8 A;  3VYT B;  4F93 B;  4LB6 B;  3CC7 I;  2LOO A;  2K9Q A;  2D1V A;  5A2Q K;  5AIP A;  3OYM A;  4PSW A;  1LQ1 A;  2CJJ A;  4ZJZ A;  2Y69 H;  3VSL A;  1WJC A;  1IDY A;  4XRS A;  2WAD A;  4JP0 A;  3HSR A;  4E7L A;  1D1A A;  3DU6 A;  3E5X A;  2PX9 A;  4PGH A;  4KT5 C;  3OYK A;  3JW4 A;  4KJZ A;  5IOY A;  4BAC A;  3GFI A;  4V2F A;  3J81 K;  2LG4 A;  2W82 A;  4ZZD A;  3U1K A;  1T95 A;  4B4C A;  4CCN A;  4IRH A;  3MN2 A;  2DOF A;  1AHD P;  2OD5 A;  1MBH A;  1TNT A;  2LP0 A;  3JRG A;  4IKF A;  3ECO A;  2EBI A;  2W48 A;  3EET A;  4JQF A;  3R60 A;  5J3L A;  2L0K A;  4HST A;  4M6V A;  6PAX A;  4EQQ A;  2LRD A;  3HB9 A;  1XMX A;  2CUE A;  1IRZ A;  4G6T B;  3W2V A;  4M9Z A;  4UB6 C;  2Z16 A;  4UY8 I;  3HRT A;  2M7A A;  1WCM J;  5JI6 A;  3BTC A;  1NK3 P;  4PFO A;  2HVR A;  1QQI A;  4NUB A;  1Y39 A;  1UST A;  4UV9 A;  2MC4 A;  1W0U A;  1YX5 A;  4JX5 A;  1PDN C;  2NRA C;  2X51 A;  3LQQ A;  3LNQ A;  5HS8 A;  2Y0M A;  3D5S C;  3QPL A;  2HXO A;  3ECH A;  4XOT A;  4F92 B;  2G9W A;  1EF4 A;  1GT0 C;  3BG7 A;  2G7H A;  3CJN A;  2PLY A;  2Y30 A;  5FKM A;  3KET A;  2ETH A;  4RB2 C;  2QSH X;  1WJ5 A;  4XSX F;  4DGW B;  1BIA A;  2CWE A;  2HDW A;  5EG0 B;  1S7E A;  1QU3 A;  5EZG A;  2FJ1 A;  2JSP A;  5FKN A;  1IZ1 A;  3F8F A;  1R00 A;  3S1Q J;  2DBB A;  3TW7 A;  3S8P A;  3SDG A;  3OYL A;  2CFX A;  4Q5S F;  4MTE A;  1EV7 A;  5F04 A;  2A3S A;  1HQC A;  1GXP A;  2WC2 A;  3H9J A;  4IRI A;  2YR2 A;  4DZP A;  2M3A A;  2BY3 A;  3E6B A;  2VAS A;  4C2U A;  5JLX A;  3F3X A;  1BIB A;  4XON A;  3QPH A;  4S0H B;  4BKX A;  2IA0 A;  4ANJ A;  2HOE A;  5HNF A;  3ML6 A;  5ICC A;  2WY7 Q;  2R5Y B;  3L2V A;  3HBL A;  1SFX A;  3GTK J;  5E3N A;  5HOO A;  1BI3 A;  3UNG C;  4IVN A;  3IRQ A;  1VZ0 A;  5IT9 Z;  2VT2 A;  1W4M A;  1ZGW A;  3M9A A;  1F4K A;  3IKT A;  4D0P A;  2ZC2 A;  4HV6 A;  4EM2 A;  5J47 A;  1WQ2 A;  2XGX A;  3GXO A;  2KDZ A;  2XGD A;  4FTH A;  4ON0 A;  3L2R A;  2E2J J;  5F1J A;  3IH4 A;  3M7G A;  3W3C A;  3BJO A;  1EH6 A;  1XC5 A;  5BNG A;  4RDU A;  1FSH A;  2WB1 N;  1ZQ3 P;  2UUZ A;  3FXQ A;  1JKP C;  2QSG X;  2DT6 A;  4CH7 A;  4HEA 2;  2RQP A;  3CCM I;  4QPQ A;  2DA1 A;  3TMO A;  3WTS C;  2VQG A;  3H35 A;  2ZXW H;  3D0S A;  4NC6 A;  1P7J A;  3IH2 A;  3LA2 A;  2CUZ A;  3V8K A;  3WGH A;  3PL8 A;  1IXS B;  1P4A A;  3EUH C;  1YO5 C;  4G6D A;  1UZC A;  2KT0 A;  3PNV A;  3AG2 H;  2HOT A;  3L2W A;  3M8J A;  5K7Z A;  1UHW A;  1YYV A;  1YW9 A;  1UB9 A;  3OMY A;  1T39 A;  2MA3 A;  1UAA A;  3M07 A;  4ZYA A;  3ZOB A;  4P1W A;  2EPF A;  2M4K A;  2H1K A;  1J59 A;  3JRI A;  3T0Y A;  3HHG A;  2NVY J;  1A5J A;  5J8C A;  3VYS B;  2OQR A;  4JYK A;  3HIF A;  1MMD A;  1X3Z B;  2DCE A;  1D1C A;  3DTK A;  2KPM A;  2Z5U A;  2WV1 A;  5H6R A;  3HM5 A;  1XS9 A;  2EIK H;  5LEJ A;  1D3Y A;  3DF8 A;  4RGU A;  2F5C A;  4E70 A;  4LK0 F;  3QRF F;  1MKM A;  1JHH A;  1YW8 A;  2YU9 J;  1IO2 A;  5LD2 C;  3J7Z I;  3BR2 A;  3H0D A;  3S1N J;  3CC4 I;  4L0Z B;  1FYK A;  2IW5 A;  1W36 C;  3Q0U A;  4PDK A;  1DU6 A;  3HC7 A;  1IN5 A;  3RJP A;  3T1B A;  4F3Q A;  4MTD A;  1SC7 A;  1DP3 A;  3CMA I;  1E2X A;  3KP6 A;  4A5M A;  4P5O A;  3SQN A;  2L4M A;  3CTA A;  3DTE A;  3OYI A;  4YIR X;  4Q48 A;  2DMU A;  1BR2 A;  4MIM A;  4IHV A;  1TW2 A;  1ZG3 A;  4WX9 A;  1MBG A;  5AON A;  3HRS A;  3HXL A;  1CF7 B;  4IHW A;  2UV1 A;  3FHN A;  4G94 A;  3OYC A;  1OCO H;  4I6Z A;  1VI0 A;  5FJ8 J;  1TLH B;  4EGZ A;  3I56 I;  2RNG A;  3OV8 A;  1U8R A;  2Y2Z A;  1G3Y A;  4A0Z A;  2ME6 A;  1H0M A;  2YSR A;  3C2H A;  9ANT A;  3TO7 A;  2YPR A;  4IRG A;  5EEH A;  1BI1 A;  3IAS 2;  1YE9 A;  3DBL B;  3OYE A;  3JRD A;  2FBK A;  3EDP A;  1X2M A;  1IN7 A;  1XN7 A;  4OMY A;  3PIO F;  5IT9 K;  2VBY A;  3OS1 A;  4A3E J;  1A35 A;  4MQ9 F;  5LHI A;  1MMA A;  2BW3 B;  1LEB A;  1R7J A;  3GTL J;  2XF6 A;  1H8A C;  4UXN A;  2ZNY A;  1YIO A;  1G3T A;  2NOJ B;  3BG9 A;  3I53 A;  2FQ4 A;  2VXD A;  4N4N B;  1ONV A;  5KVR A;  4MHG A;  3W2W A;  1SMT A;  1WJF A;  2HU9 A;  3KP7 A;  4ESF A;  2P7V B;  4XL9 A;  1OQY A;  3AAF A;  1V54 H;  3CCS I;  2NS7 A;  4OIN F;  4BAY A;  4F52 A;  4YII A;  4HLX A;  5K5O A;  2O9L A;  1R4M B;  1P2F A;  1Z05 A;  3OYB A;  4V19 K;  2GA1 A;  5M5Y J;  1SEU A;  1GUU A;  3QAH A;  4XLN F;  4I76 A;  2R7U A;  2I8D A;  1A36 A;  1ENH A;  1RET A;  2CV0 A;  2X48 A;  4IJA A;  2XRO A;  3O8G A;  1LPQ A;  2HOS A;  2YUS A;  2K3F A;  3OSG A;  1D0Y A;  3V7C A;  4D5F A;  4EM0 B;  1J9I A;  1TQM A;  3L7W A;  2F4O B;  1AKH B;  2CH0 A;  1FTT A;  1S8N A;  4UUS B;  2R7V A;  4G6Q A;  4EJO A;  5B3S H;  3O3K A;  2LF7 A;  3MKL A;  3RPU A;  1EH7 A;  4PJJ A;  2EFQ A;  3VSK A;  1K4T A;  1IV8 A;  1OYW A;  1GXQ A;  1U5T C;  4N9H A;  2QQA A;  3QYF A;  1D8J A;  5M3F J;  2DK8 A;  3H36 A;  4NDL A;  4C9Y A;  2BVM A;  3BTJ A;  2L54 A;  3FIS A;  2WB1 A;  1R5G A;  3RQ4 A;  4A93 J;  5EEG A;  3K1M A;  4BYY A;  2DK5 A;  2W24 A;  2EIN H;  3E5Q A;  1MDM A;  2QKM B;  5KAI C;  2DMP A;  1BW5 A;  4R1H A;  4QSH A;  3LA3 A;  3B6A A;  1DGR M;  2IGO A;  2LTP A;  4AYB N;  5F0C A;  5HDK A;  3DLA A;  2X6Y A;  3CJT B;  1ZLJ A;  2QVO A;  2LH9 A;  1LNW A;  2Y75 A;  2B63 J;  3LA7 A;  1SD5 A;  5C44 J;  3GZN B;  2QEN A;  1I1G A;  3V8J A;  1SVM A;  3FKJ A;  5HS9 A;  4CDG A;  1MMS A;  1WRJ A;  2K85 A;  4EM1 A;  2OTJ I;  5GTH C;  2DTR A;  3ZQI A;  3DBR B;  3BR0 A;  3BOQ A;  4IOA F;  2M4G A;  4KIG A;  4ZDO A;  2MSY A;  5B1A H;  2XGE A;  3OIO A;  1JJ8 C;  2VQC A;  5GP9 A;  3LSJ A;  3CDI A;  5IYD J;  2XAJ A;  2DA7 A;  4NC8 A;  3CMM A;  1JUP A;  4G9Y A;  1Z0X A;  4LJZ F;  4U87 A;  1FIA A;  1FNN A;  4C30 A;  3A4C A;  3HOU J;  3GWZ A;  4HBL A;  1FIP A;  3JRF A;  4NNJ A;  3B6C A;  1VQ8 I;  1W7P D;  3N97 A;  2VT3 A;  3TP0 A;  5JR3 A;  4DIQ A;  3PQJ A;  1D1B A;  1YTY A;  1ZHF A;  1S7A A;  2JVH A;  3I4N J;  2VKD A;  2CYY A;  1MZB A;  2TRT A;  2FU4 A;  2UXX A;  3I3L A;  4AVP A;  5E3M A;  3EQL F;  3FK6 A;  5LGU A;  3K9T A;  3S17 J;  1HKT A;  3W2A A;  2W00 A;  1BBY A;  5EEA A;  2Y31 A;  1VFC A;  1A31 A;  2IPQ X;  1K78 B;  1BM9 A;  2EB7 A;  4EJU A;  2LF8 A;  2HQA A;  1SAU A;  2A5W A;  3ABM H;  4RAZ A;  1JE8 A;  1SVO A;  3K2A A;  1K6Y A;  3PNY A;  1VQL I;  2GZW A;  2DI3 A;  2HTS A;  4DBR A;  1ZAO A;  1MJ9 A;  3CCV I;  1T38 A;  3OYJ A;  3WU0 A;  4F91 B;  4P9U A;  4HW0 A;  4WCG A;  4WXD A;  1X1B A;  1XSV A;  1T0F A;  3CUO A;  4A3I J;  3ZMS A;  5B66 C;  4BQQ A;  2H09 A;  5J4Y A;  2VXZ A;  4BDZ A;  4A3C J;  3HOW J;  3GBG A;  5EZH A;  3EYI A;  2BW3 A;  5LRR A;  4QIW N;  4Y33 A;  4NB5 A;  2QBY B;  1LVK A;  4GO1 A;  5FLV A;  1R71 A;  2IP2 A;  4X1E A;  2EK5 A;  3C2G A;  1FY7 A;  2AS5 F;  2EZH A;  5BOX A;  2HQR A;  4IF4 A;  4HX8 A;  4A3M J;  1IUF A;  2VPR A;  4RGR A;  4G7Z F;  2EIJ H;  2F4I A;  1K61 A;  1W5S A;  2O5R A;  4OIR F;  5E20 A;  3N4M A;  2BOL A;  2NXN B;  3S2H J;  2HS5 A;  3G1L A;  3CCJ I;  3BG3 A;  1D0Z A;  3IC7 A;  1RKW A;  2AO9 A;  1FYM A;  2K7L A;  4ZDP A;  1I3A A;  2D2W A;  3OYD A;  1MIJ A;  3ABK H;  3ZMZ A;  3OYH A;  5E8I A;  4PJ0 C;  1AKH A;  1ZH5 A;  2PMH A;  2BHZ A;  2QQ8 A;  2Z1D A;  2EFN A;  3GZ6 A;  1B4A A;  2ELH A;  4AUX A;  5FB2 A;  1JKR C;  2MAB A;  2P5L C;  1XSX A;  2ADU A;  4FAS D;  1W0T A;  2H8W A;  1TWC J;  3CUQ B;  4V2G A;  3GTQ J;  2FBH A;  1WH5 A;  2M34 A;  3I71 A;  4M3F A;  3IH3 A;  5E3L A;  1LDD A;  1T33 A;  2ZFW A;  2V4J C;  2L02 A;  4E7H A;  2IEK A;  3JCU C;  4CCL A;  2VI6 A;  5DTD A;  2KP6 A;  4U7D A;  2LSO A;  2M45 A;  5CYV A;  4Q4Z F;  2V1N A;  1S5L C;  1OFC X;  2DA6 A;  4ZYG A;  3MAJ A;  5BPD A;  3ASO H;  3G1O A;  4AYB A;  2F5F A;  4DYC A;  4EV0 A;  1MND A;  2K5C A;  4G7H F;  1I27 A;  2CQN A;  4NBQ A;  1XTA A;  4AID A;  1R22 A;  1VQO I;  3LSG A;  3ISP A;  3NAU A;  2KRF A;  4LG0 B;  3ERM A;  3FBN B;  3S16 J;  2E1M B;  1I6H J;  2MLG A;  5F6F A;  1TW3 A;  3SYT A;  2BVL A;  3C3W A;  2RDP A;  1IN8 A;  1Z6T A;  2HFH A;  3BR3 A;  3H5R A;  4OAZ A;  4UHT A;  4WF2 A;  1LFU P;  4HG2 A;  2EFP A;  3TKY A;  4AWX B;  1FOY A;  4FX4 A;  1HXD A;  2VBZ A;  4H4K C;  2FMY A;  2XC7 A;  2ID6 A;  2LY2 A;  4KYW A;  3K70 D;  3ABU A;  1IJW C;  3E6M A;  4II2 A;  4QPO A;  2L5Q A;  4RB1 A;  3RYP A;  2ISY A;  3DLL F;  4DYR A;  4L18 B;  2XAQ A;  3HHH A;  4XMY A;  3I54 A;  3HOZ J;  4LIT A;  3A01 B;  4XLF A;  1JUM A;  1JHF A;  2PJP A;  3PSI A;  4L9T A;  4FX0 A;  2IAI A;  3OOP A;  4DW6 A;  3MKY B;  3A2K A;  1YOV B;  2J5O A;  1KON A;  5GAH J;  2NVX J;  2DOA A;  3B73 A;  3FXO A;  1R23 A;  3VOD A;  2HVS A;  4OAY A;  2GQQ A;  1MW7 A;  3UKG A;  2OA4 A;  3ZXS A;  2GM4 A;  2DOD A;  2DN0 A;  1IXR C;  2KIQ A;  1MD0 A;  3K6G A;  3KPH A;  2M2E A;  2XAF A;  1XCB A;  1K78 A;  3LFU A;  2ELJ A;  2F5D A;  2V6E A;  3PO3 J;  4PK4 A;  4XIC A;  5D5V B;  4XRM A;  2P8T A;  4DNC A;  2R7R A;  2DMT A;  1RIO H;  1AWC A;  5LEK A;  2ISZ A;  3JSP A;  3H0G J;  4KMF A;  3RPQ A;  5IP9 J;  2OUM A;  1P4W A;  1JXS A;  1F9N A;  3GFJ A;  4BUP A;  2QQB A;  4HX7 A;  4PGG A;  2X4H A;  3ZRG A;  3RI4 A;  2DYS H;  4JK1 X;  5L3D A;  3V8L A;  3PJR A;  3AFH A;  4R79 A;  4KA4 A;  1R36 A;  1Z67 A;  5HVQ C;  1OCP A;  2ZFU A;  4IPA A;  2Q2E B;  2CMP A;  3QYE A;  4FIS A;  2HOA A;  1IRG A;  3K1P A;  5IY5 H;  5HLH A;  2QBY A;  2P6S A;  3DQV C;  3HSF A;  3MZ8 A;  3R0A A;  2VPL A;  2WV0 A;  1DU0 A;  1QZY A;  5M3M J;  1JKQ C;  3CP2 A;  2HKX A;  3BR1 A;  3R4K A;  5LGT A;  4FET A;  3JR9 A;  4B3X A;  4CCO A;  4BE0 A;  4GYG A;  4XLA A;  2VKE A;  1K6O A;  2V1X A;  1OR7 A;  3S2D J;  2NS0 A;  1PUF B;  1WI9 A;  4BQN A;  3O2P E;  1G2H A;  4ZTJ A;  3K0L A;  1T56 A;  2FRH A;  4FE4 A;  2LK2 A;  2G0E A;  3QPT A;  2Y9Z A;  2JT1 A;  3BQY A;  4BNC A;  4HV5 A;  4ZYD A;  2JRT A;  2IVM A;  4ZC3 A;  4J00 A;  1NTC A;  3FM5 A;  4XKC A;  1OIS A;  2NYX A;  4LK1 F;  1U2W A;  4FQG A;  3QOD A;  2IRF G;  5F64 A;  5ILV A;  2CQ7 A;  5D5W B;  3CUQ A;  1UCR A;  3I4P A;  2NVT J;  2Z9O A;  2MC3 A;  2ESH A;  1FJL A;  4KIT B;  3RYR A;  1ETK A;  1IDZ A;  3BG5 A;  5DV5 A;  3GLX A;  1DQU A;  2AHQ A;  4A3J J;  1WFX A;  2M9H A;  1MH3 A;  3CF5 F;  3I5U A;  5IOZ A;  3IKV A;  2LLK A;  2K02 A;  4I98 B;  4Q47 A;  1B9N A;  3BCA A;  4ZYE A;  2MG4 A;  3GF2 A;  1EJ9 A;  2K3P A;  1H9G A;  4UB8 C;  4RBO A;  4HDV A;  3ZMT A;  4IX7 A;  3Q9S A;  4LG0 A;  2EA4 A;  2NS8 A;  2DT7 B;  1BOA A;  2VBW A;  5LHH A;  3SZT A;  2QSF X;  1REP C;  1GHC A;  2V1D A;  1FOK A;  4YEJ A;  4ZZL A;  4ABZ A;  2COB A;  1HC8 A;  2YS9 A;  2KZG A;  4MFD A;  1P9Q C;  1SD7 A;  1BOB A;  1JTX A;  5CVJ A;  3P9K A;  4XN3 A;  1BW6 A;  1O7L A;  1A6Q A;  5FLX Z;  2GIV A;  1R5I D;  4J19 A;  1R9T J;  4BHC A;  2QF7 A;  1T2K A;  3GFM A;  1WGX A;  2HZD A;  3KLN A;  4XLE A;  1YJW I;  2M0C A;  3CF2 A;  3A01 A;  4GYI A;  2L4A A;  2V6C A;  3ZQ7 A;  2VJ4 A;  2VQH A;  3ZPL A;  2RQQ A;  4XOR A;  2ZXH A;  1RKT A;  1P92 A;  5EYR A;  1YS7 A;  5J1Y A;  2KHM A;  1ULY A;  4A3K J;  2KQR A;  2X6W A;  3ABT A;  4AU7 A;  3RKQ A;  4A6D A;  3U21 A;  3RCO A;  4PZJ A;  2KIS A;  2HDC A;  4TV7 A;  2KIU A;  1UFM A;  2DA4 A;  3KZZ A;  3HSE A;  2EJR A;  3HUG B;  2EIL H;  3S3M A;  1STZ A;  3HRM A;  3ULQ B;  2P5V A;  2VL8 A;  4XRF A;  5D5X B;  5LGN A;  4Y13 A;  2LY9 A;  3GW2 A;  1OCR H;  1Z3Y A;  2O7O A;  2CU7 A;  1YFH A;  4XLH A;  3DBH B;  3G4S I;  1ZGJ A;  4YG2 F;  2FE3 A;  3CES A;  3G3Z A;  2WWY A;  2QYO A;  2E1C A;  1ZR4 A;  1YJ9 I;  2O6G E;  2Q2E A;  1HST A;  1S9H A;  3S1R J;  5E8G A;  3RSN A;  1HDD C;  3I58 A;  5C4X J;  5D8L B;  1MDM B;  2PMZ N;  1GDT A;  2Z3Y A;  1RC9 A;  1FT9 A;  4YIF A;  2FNP A;  1USS A;  3LST A;  4RLQ A;  4OIQ F;  4M3D A;  2X1E A;  3ABL H;  3BCB A;  3CO7 C;  3KZY A;  5B5E C;  1SFK A;  5EGO B;  1I39 A;  1PUF A;  1SD4 A;  3MMY B;  3OYF A;  2CFO A;  1MSF C;  1Y8R B;  1KYZ A;  5BPI A;  1HA8 A;  2VC1 A;  3DEU A;  1UHS A;  1Y1W J;  4K2E A;  4A3D J;  3F0C A;  3OS0 A;  2ELK A;  4YFK F;  3CZ6 A;  4A0Y A;  1D5Y A;  3O6B B;  4OMZ A;  1ITY A;  5IT3 A;  2ACJ A;  1MBJ A;  2GOX B;  1OKR A;  1HSJ A;  2O0Y A;  5KNL A;  5KHD A;  5FLX K;  2IXS A;  1D5V A;  4RA2 A;  2QEX I;  3WG9 A;  1DPR A;  2A6E F;  3BQZ A;  3L2Q A;  3FXK A;  1DGW Y;  4IQJ A;  1SAX A;  1HDP A;  3BZC A;  2A68 F;  4XLP F;  1E17 A;  1IC8 A;  4IHT A;  1Y6I A;  3OL3 A;  1LKX A;  2L7K A;  1QGP A;  2BV6 A;  5IP7 J;  4CYC B;  4G7O F;  3GZ5 A;  1Z91 A;  1WSU A;  3I59 B;  3A02 A;  3LSM A;  1G59 A;  2AQE A;  2OCC H;  1VND A;  1XPX A;  5BQT A;  3FXM A;  4HF2 A;  5LHG A;  1S6L A;  3IWZ A;  1SFE A;  1X4O A;  3JAM Z;  2Q0O A;  5E3O A;  3TGN A;  1Z9C A;  1LEA A;  3KP5 A;  3MFK A;  3A0B C;  3K4L A;  3F8C A;  5K7H A;  2FA5 A;  2HQ5 A;  1FTZ A;  3WE2 A;  1IF1 A;  1ERD A;  2M7B A;  2L9V A;  2DXI A;  3GTP J;  2XB5 A;  4LLG F;  1BC8 C;  1ZG5 A;  4B09 A;  3C2B A;  3GEZ A;  4PSX A;  1ZRC A;  4HX4 A;  2BY0 A;  1W1W E;  1ETX A;  4CA0 A;  5ICE A;  1U0J A;  2PN6 A;  2UZK A;  2XV4 S;  1O3Q A;  3KIO A;  4WK8 F;  3AKZ A;  3MCZ A;  2ZJ2 A;  4E4H A;  4OIP F;  2M1B A;  4AC0 A;  1DDN A;  3FF5 A;  3CDH A;  4BQA A;  3K4J A;  5C4J J;  3GUD A;  2MD0 A;  4Y15 A;  1SFU A;  4RB3 C;  2A6H F;  3GO5 A;  4O6J A;  3ZQL A;  3KYC B;  3BT9 A;  3NRV A;  1XGS A;  1VQ4 I;  1BI0 A;  3PQK A;  3HOS A;  2L7F P;  4P55 A;  5CPR B;  2EV0 A;  3S15 J;  4PUS A;  2EV5 A;  3K4B A;  2W85 A;  2VON A;  3SZG A;  5FFX A;  4DYQ A;  1K79 A;  2CS3 A;  3S32 A;  1V5F A;  1I6X A;  1POG A;  5FGM A;  2GAU A;  4DBQ A;  2IBD A;  2CO5 A;  2H1L A;  4QWQ A;  1V3F A;  1SVL A;  4Z6Y A;  3A03 A;  3KYD B;  4A5N A;  4UVA A;  3HUG A;  1RRJ A;  5JLW A;  1IRX A;  3HYI A;  4M3B A;  5TIS C;  3OYA A;  3T8T A;  1ETW A;  3FZV A;  2DOE A;  2RKH A;  1RUN A;  1EA3 A;  4LIU A;  2L9R A;  4W1U A;  4XNF A;  1FPQ A;  3DKX A;  5GPC A;  3TW6 A;  2V9P A;  1FMV A;  3E5U A;  3WTU C;  2JVG A;  3QOP A;  3HEF A;  2XKO A;  4HA8 A;  1X1A A;  2K86 A;  4I99 C;  1JT0 A;  1FYL A;  2EH3 A;  1ORK A;  1XMK A;  1FOW A;  2ZJP F;  4BHP A;  2QZ8 A;  3S3N A;  4E7J A;  2DPU A;  1X3U A;  3CO6 C;  4AVZ A;  1T0F C;  3ZMU A;  3WTT C;  2M8E A;  1TC3 C;  2NNN A;  3FHZ A;  1QPI A;  5GAE J;  3W6J B;  1KZH A;  2VB6 A;  5CVV A;  1SMY F;  2PMZ A;  3I9V 2;  3JRA A;  3IWF A;  3OS2 A;  2JUG A;  2IS2 A;  2FX0 A;  3VFZ A;  2KDO A;  3WTW C;  1YX3 A;  2CUJ A;  4BY7 J;  2NOG A;  1MBF A;  1P4X A;  4LIV A;  3DFG A;  5ICG A;  3JAM K;  3GYH X;  4BBR J;  1VQP I;  1X3W B;  2WAF A;  2DA2 A;  4CCJ A;  1OCT C;  1YIJ I;  4XLC A;  3D1N I;  4CIC A;  5F1R A;  1HLV A;  5GPA A;  2L3D A;  5EGO A;  2B9S A;  1J7K A;  3L2U A;  2X6O A;  3G2B A;  4EAT A;  4GDF A;  1ETO A;  1RR8 C;  5DEQ A;  3DEE A;  2JPC A;  4I0A A;  3PIP F;  2G7U A;  3FMR A;  2E60 A;  1C0W A;  4RAF A;  3S14 J;  3K2Z A;  5GAG J;  1HW5 A;  3BRO A;  5LRS A;  1MBK A;  5DM6 F;  2FD5 A;  4IHX A;  4E7Z A;  3PM1 A;  3RIR A;  1W5T A;  4BXU A;  3COA C;  5FRO A;  2O61 A;  3KFW X;  4M71 A;  3CQZ J;  2LR8 A;  4XKB A;  4G12 A;  4XKW A;  1UG2 A;  2HDD A;  4CYC A;  2NVU B;  3I59 A;  1YHQ I;  2HNH A;  2BEO A;  2R7O A;  2GXB A;  2ECB A;  1ACI A;  3VYR B;  3OY9 A;  1ZGA A;  3WTY C;  5CJ9 A;  3BJA A;  2E2H J;  1BR4 A;  2M0M A;  2OV7 A;  2DW4 A;  1JUS A;  4PFP A;  1BL0 A;  1WHU A;  2E34 A;  3AG3 H;  2WAE A;  3N05 A;  1HCR A;  5GTI C;  5BMZ A;  4R8H A;  2R7S A;  2E5N A;  4ZDL A;  5J6X A;  1HKQ A;  3E97 A;  5FD6 A;  1J75 A;  4A12 A;  5E1X A;  4IZZ A;  4CGZ A;  3ZQF A;  3S2W A;  4BE1 A;  1PYV A;  4GFB A;  3HOT A;  1FBQ A;  5L3C A;  2M5W A;  1ZLK A;  5FO5 A;  1E0E A;  2MGQ A;  1J5Y A;  2VIX A;  1WVR A;  4U0Y A;  2W25 A;  2E35 A;  2F2E A;  4UUT A;  3WTV C;  2BYV E;  2DPD A;  3OR1 C;  4YEL A;  4A3G J;  3HGY A;  3BR6 A;  3Q3S A;  2JTV A;  1J0R A;  2CSO A;  3FMQ A;  1B59 A;  4XSZ F;  3RTR A;  3QP5 A;  3IHU A;  3REO A;  2DLL A;  1YIT I;  5ILS A;  2LKP A;  2XAS A;  4GXO A;  4XN0 A;  2K9M A;  5D5U B;  2JQ7 A;  4L0Y B;  3SDB A;  1U5T A;  4HDU A;  1FOX A;  2ECC A;  3ONQ A;  2KIF A;  2W84 A;  3KEO A;  3BPX A;  2PEX A;  3DPU A;  1S72 I;  3D5R C;  2DDA A;  1QZZ A;  1IAW A;  1B9M A;  1FP2 A;  4A69 C;  3A1Y A;  2YX4 A;  3V7S A;  2R7D A;  1WZ2 A;  2MYS A;  4M3G A;  3FKI J;  3ZQG A;  4D1Q A;  3M8E A;  4KMU X;  1KQ8 A;  1TT5 B;  2A05 A;  3QU3 A;  2JA5 J;  3B02 A;  4HYE A;  4IHY A;  1IXC A;  1BJA A;  2LVS A;  3FXU A;  4L9J A;  1N77 A;  3P9I A;  4F7Z A;  3FM3 A;  1G3S A;  3FK7 A;  4FE7 A;  2K9N A;  4AIJ A;  1YI2 I;  1OLT A;  4N9I A;  3KEQ A;  2NVQ J;  4XQF A;  1QRY A;  2J5P A;  4OWR B;  3VB2 A;  4BJ5 C;  2ZCW A;  4ENN A;  3QU6 A;  5CKT A;  5HDG A;  5M5X J;  1W36 D;  1FEX A;  3SFI A;  1D0X A;  2A6T A;  3U2R A;  4IHS A;  1OYY A;  1EKE A;  1TT0 A;  4KN7 X;  4C2T A;  5KAF C;  5ED4 A;  3PSF A;  4LLL A;  3T5X A;  2V9V A;  3W6K B;  2WA0 A;  4BXF A;  1ZEL A;  3OIP A;  1IW7 F;  4LD5 A;  4HAM A;  1F5T A;  3WGG A;  3K10 A;  2Y0S N;  5IPA A;  1TWH J;  4M6Y A;  5L3G A;  1YRN A;  3SFZ A;  2XDV A;  3P9C A;  2YX7 A;  3IP4 B;  3BPV A;  3BY6 A;  4EJW A;  1E3O C;  1JTY A;  1OR7 C;  1W5C C;  2DYR H;  3BP8 A;  2VUM J;  3QQA A;  1OCC H;  4RB0 A;  2DFF A;  4I02 A;  1IV6 A;  3H5A A;  2GXG A;  2IGN A;  2CUF A;  1MJB A;  2Z33 A;  3KYL A;  1BN5 A;  1FMW A;  4M6X A;  1CGP A;  2IS1 A;  5J40 A;  3DXJ F;  4WXC A;  4BEH B;  4IL6 C;  4KT6 A;  2ZB9 A;  3EYY A;  4ESJ A;  3DWL E;  1X1P A;  1ZTR A;  4FT8 A;  4P9F A;  5E79 C;  2LD5 A;  3AL0 C;  1FBS A;  1RZ4 A;  2HI3 A;  2X85 A;  3VEP A;  1NG6 A;  1QVU A;  2E36 A;  3CUQ C;  2ICW G;  2OF7 A;  2RN7 A;  1PVE A;  3UR3 C;  2JA6 J;  2A5Y B;  2M8G X;  3LQR A;  4IEJ A;  2MLK A;  4L9V A;  1G3W A;  3BC8 A;  3CCE I;  3IUO A;  3NAR A;  4B1R A;  5FLM J;  2DA5 A;  2BE5 F;  3D5L A;  3TOA A;  4MLO A;  2ME0 A;  1TWA J;  5ICF A;  3F8N A;  5HLG A;  3RDI A;  1G8X A;  1X1D A;  2UXN A;  4Z2Y A;  4HPQ A;  2MW8 A;  1ZG1 A;  1P6R A;  2R4G A;  1JJ6 C;  3K4C A;  1XSD A;  3FMS A;  1X1C A;  3DPL C;  3CCQ I;  1VQN I;  1XDU A;  4XM3 A;  2EA2 A;  2E1M C;  3CCY A;  4PJL A;  2JA7 J;  2OC6 A;  2WTE A;  3MD2 A;  2CGP A;  2MH9 A;  2HPI A;  1X4P A;  3TL4 X;  2RVC A;  1TP4 A;  4Y7N J;  3G6E I;  3CMY A;  3W6V A;  3R0J A;  1U9O A;  2XKP A;  2ZME B;  4UNO A;  3DV8 A;  3H3Z A;  4HNT A;  4BBS J;  4OOI A;  4LMY A;  3BLY A;  4A2U A;  2KMU A;  1O4X A;  4HLY A;  4B44 A;  4DJA A;  4HQE A;  3ZR8 X;  1HW2 A;  3CJQ B;  4KIS A;  3K7A J;  3TQN A;  1XGO A;  2EIM H;  2ZXJ A;  3ZCO A;  2L9S A;  3S1M J;  5DCM A;  2M30 A;  3T8R A;  1MBE A;  2MD5 A;  1EH8 A;  1X19 A;  2EFW A;  3F6V A;  2K9S A;  3Q9V A;  3V4G A;  1N25 A;  1K4S A;  1MNE A;  2O3F A;  4CYD A;  4HQM A;  2LFB A;  3CLQ A;  2E19 A;  4LLN A;  2X6X A;  1KU9 A;  3E3V A;  3OR2 C;  1FZP B;  1FLI A;  3OYN A;  1ETY A;  3WHB A;  3M3Y J;  4ETS A;  3JTG A;  3F8M A;  3KLO A;  2P0W A;  1VQM I;  4P96 A;  2ESN A;  1AOY A;  1HW1 A;  1WPK A;  4BHB A;  1RNL A;  4AIK A;  2LMD A;  1NG7 A;  1XCV A;  3F72 A;  5F27 A;  3IL2 A;  1ZK8 A;  2XAU A;  3OIQ A;  2F4M B;  2DFI A;  3MWM A;  5IYB J;  1QO0 D;  4HSR A;  4YFN F;  5CQE A;  2HTJ A;  1B6A A;  3LL7 A;  3GFL A;  5L3E A;  1CQT A;  1MNM C;  1JI8 A;  2HQN A;  1RI7 A;  3F21 A;  4D7M A;  2BBY A;  2K27 A;  2I10 A;  2HXI A;  4BJT A;  4B48 A;  1B8I B;  4GRI A;  1DPU A;  1U6G A;  2ZKZ A;  2XSJ C;  3OWT A;  4GCV A;  1SD6 A;  3FXJ A;  2EFO A;  3KZI C;  2B0L A;  2KZV A;  1YG2 A;  2XAH A;  4XBF A;  4E6K G;  3L2C A;  1YS6 A;  3G73 A;  1D8K A;  3RZO J;  2RV8 A;  1WKM A;  3PNT A;  2XPU A;  1ZAR A;  2KJB A;  4F55 A;  5DCF A;  2FUG 2;  2ZNZ A;  3WTZ A;  1UG0 A;  3H9G A;  4XK4 A;  2Y0S A;  2R7Q A;  5F0F A;  2R7X A;  1KU2 A;  3PFY A;  2H94 A;  2XRN A;  1WH7 A;  4I01 A;  1R4N B;  2AQF A;  1LJ9 A;  1FBU A;  5ERI A;  3WG7 H;  1UHM A;  3LSK A;  5CVR A;  4AIH A;  2O8K A;  2Z99 A;  1WI3 A;  5EF6 A;  4S05 A;  1O3S A;  2BGC A;  2HEO A;  4AM3 A;  1U9N A;  5DUK A;  5IYC J;  2HKO A;  3GTG J;  1HOM A;  3TO6 A;  2GWR A;  1W7P B;  3QPS A;  3MKW B;  4BEH A;  4HNV A;  1BC7 C;  2MH2 A;  3BZK A;  4CO8 A;  1I5Z A;  3I64 A;  2EZK A;  3M4O J;  1MH4 A;  2Q1Z B;  1E3P A;  5J8F A;  1N78 A;  2XHK A;  1RES A;  2LNB A;  3ESW B;  1H9T A;  3LSI A;  5B1B H;  4L9N A;  2XPW A;  1Y8Q B;  2MBF A;  3BZ6 A;  3BR5 A;  1TZL A;  4I09 A;  1O3T A;  3DKW A;  4ITV A;  1I1S A;  2XF5 A;  2P7C B;  3R6S A;  1K7A A;  3E7L A;  2A61 A;  2L7M P;  1Y0N A;  3WGI A;  2VJJ A;  3K4M A;  1V55 H;  4PCQ A;  5HDN A;  2R7T A;  4YRV A;  2AXL A;  4KFC A;  3FXR A;  3E1S A;  1U3E M;  1MJA A;  1SFO J;  2XUB A;  2ZBK A;  3TDZ C;  3WTX C;  2COM A;  2IGM A;  3DEW A;  3RQI A;  3KCC A;  4LB5 A;  5DYM A;  2IA2 A;  1KA8 A;  2LKS A;  1R1U A;  2L9N A;  2LC2 A;  4MNU A;  3J80 Z;  1TNS A;  1ODD A;  4FCY A;  3CP8 A;  3M8F A;  4C3I J;  2HYJ A;  3H9Q A;  2ZME A;  4M74 A;  2KFD A;  4M72 A;  4ZH4 F;  2HVQ A;  3I4M J;  1WJD A;  2XB0 X;  3U1D A;  4CCM A;  5K5Q A;  2ZO4 A;  4H0E A;  3FBI B;  2E71 A;  4L5J A;  4HF1 A;  4Y17 A;  4MGR A;  3SZP A;  3EPZ A;  1TBX A;  5K1Y A;  2QKL B;  2FML A;  2NAZ A;  1OJL A;  4JOM A;  2P5K A;  2IGK A;  3F6O A;  1G6N A;  4A3L J;  2P81 A;  2V26 A;  2DQL A;  4O5V A;  2CQX A;  2K9L A;  3V7R A;  4ZYH A;  4EEF G;  3LOC A;  4D7N A;  2PG4 A;  2LBF B;  4PJN A;  3EUK L;  3TP3 A;  4JX6 A;  2HR3 A;  4KIC A;  3CCU I;  2K4B A;  1S7O A;  3WU2 C;  2L01 A;  3IV5 A;  3JRH A;  1KQ0 A;  3ERE D;  3IAM 2;  3RKY A;  4LOC A;  2OQG A;  1XDS A;  4C2M J;  1A04 A;  3GVA A;  1ZRF A;  2X1D A;  3H1C A;  2VOO A;  3KX2 A;  2BY1 A;  1VQ6 I;  5E18 F;  2OTL I;  2DT5 A;  2K40 A;  2DMQ A; 
#chains in the Genus database with same CATH homology
 1QPM A;  1TTY A;  3U9G A;  4HOB A;  1MGT A;  2QLZ A;  2EWN A;  3ZP5 A;  1XGN A;  1S3J A;  3KP4 A;  2A69 F;  1T98 A;  2E7W A;  1XD7 A;  3VOE A;  4KIB A;  1FC3 A;  3MEX A;  4M73 A;  1LDK B;  5FFZ A;  2LDU A;  1FX7 A;  3FX3 A;  3NEU A;  4U0W A;  2JZY A;  1IRF A;  4ENM A;  2JSC A;  2H6B A;  2STW A;  1HKS A;  2HGC A;  4BH9 A;  5E17 F;  2PQ8 A;  3K69 A;  1W7P A;  2CG4 A;  4EMS A;  4EJV A;  2XVC A;  3J80 K;  4KUM A;  3TO9 A;  4FHT A;  4WWC A;  2O03 A;  3LWF A;  1R1T A;  4M9S A;  2FSW A;  4ENJ A;  3R61 A;  3TDU C;  2Y48 A;  5KK1 A;  5CVI A;  1U5T B;  2P6T A;  4AD9 A;  1KU3 A;  1KU7 A;  2HYG D;  2PMU A;  2CQK A;  3H3U A;  1FSE A;  4N0B A;  3HRU A;  2OU2 A;  1YLF A;  3JSO A;  1KYW A;  2OBP A;  3RKX A;  1XMA A;  3ZN0 A;  1JGS A;  3JTH A;  3EUH A;  4LGW A;  1BI2 A;  1F1Z A;  4HZF A;  2UWM A;  1O3R A;  5HS7 A;  3IRR A;  1TQP A;  4L5I A;  4CHU A;  3K1N A;  5DDG A;  3MQ0 A;  5AIQ A;  2XAG A;  2K4J A;  4RGS A;  2D1H A;  3NQO A;  5DUI A;  3FWE A;  1QBJ A;  4ESB A;  4G8X A;  2R3S A;  4MQV A;  4I2O A;  2QM3 A;  5D6F A;  5LBQ A;  2STT A;  4QLC U;  3QP6 A;  4UVB A;  4GGG A;  4I0B A;  1ZRD A;  4WXH A;  2H6C A;  1O7F A;  5K5R A;  1ON2 A;  1Y0U A;  5DD4 A;  3LAP A;  4U0V A;  1DP7 P;  1XGM A;  2O8X A;  5FD5 A;  3KP2 A;  1R58 A;  3SXY A;  4KNY A;  2VBX A;  3F8B A;  1O57 A;  5H6Q A;  5TJJ A;  4CZZ A;  4HF0 A;  2F5E A;  3P7N A;  2OZU A;  5L3F A;  4UUV A;  4NQW A;  2C6Y A;  1GVJ A;  3KE2 A;  2H27 A;  1OMI A;  3C1D A;  2GA2 A;  1YW7 A;  2W57 A;  3CLO A;  5LLQ A;  5DD8 A;  3I0T A;  4YFX F;  5ILU A;  3TOB A;  1R5H A;  1PP8 F;  3L09 A;  4O3M A;  2X0L A;  5D4S A;  3BJ6 A;  1WWX A;  3ROU A;  1ON1 A;  5E1Z B;  2QUF A;  1IUY A;  1PP7 U;  4NHJ A;  4RAY A;  4EJT A;  1S29 A;  1ZN2 A;  2A07 F;  1CF7 A;  1V4R A;  5DCM B;  1Z6R A;  2IA1 A;  2P4W A;  2E7X A;  2VE8 A;  1ZYR F;  4M9X A;  4MEY F;  1DUX C;  5BS6 A;  3BWG A;  5D6E A;  1Z1D A;  1LDJ A;  1IN4 A;  2YU3 A;  3MZY A;  5JFR A;  1KGS A;  2NNY A;  1HBX G;  1PUE E;  4B8X A;  2VOP A;  2EV6 A;  2VC0 A;  2VE9 A;  3C18 A;  2OZ6 A;  3HTU A;  1YQA A;  4EVI A;  3BDD A;  1RUO A;  4OIO F;  4UVC A;  3ZN1 A;  2HWV A;  3C7J A;  2Q8K A;  3LAJ A;  1Q1H A;  1LVA A;  5L3B A;  2RGV A;  3HTS B;  2OAZ A;  3DP7 A;  3E6C C;  2FNA A;  1FP1 D;  2DQR A;  1G4D A;  2XIG A;  3KP3 A;  3F23 A;  3WU1 B;  1R1V A;  3GX4 X;  1L0O C;  2FEZ A;  1KQ9 A;  2TDX A;  4MEX F;  1TQI A;  3Q5F A;  2KJC A;  1J2X A;  2FXA A;  2VOD A;  1L3L A;  3H92 A;  3J7A O;  2D45 A;  1T6S A;  5CLS A;  3DPT A;  2IT0 A;  3F22 A;  2QWW A;  4U88 A;  2RNJ A;  4RGX A;  1IN6 A;  1FWZ A;  2DU9 A;  4U7B A;  5D8K B;  4KN4 X;  2HZT A;  1XB4 A;  3ZMV A;  5A2Q Z;  1Z7U A;  2FOK A;  4KDP A;  2KIM A;  1OYI A;  4KIF A;  4A0X A;  2PI0 A;  2PBI A;  3J81 Z;  3WOD F;  2RC4 A;  5JHU A;  5JVT A;  4ASN A;  4LFU A;  2IJL A;  1U78 A;  5E1W A;  4A6E A;  2V1U A;  3L9F A;  4JBA A;  5D4R A;  1QNT A;  2FQ3 A;  4RS8 A;  2FF4 A;  1LB2 A;  5H20 A;  4UV8 A;  2QQ9 A;  1ZRE A;  3RKW A;  3LFK A;  4OU0 A;  4CXF A;  2DAO A;  2FBI A;  2M87 A;  4DQ2 A;  2KKO A;  1VTN C;  2PFB A;  3L00 A;  4I7H A;  2V79 A;  5TRD A;  2CW0 F;  3ELK A;  3E6D A;  4S04 A;  5CVU A;  1B1B A;  2JPB A;  4IXA A;  4ENK A;  1NHA A;  1OPC A;  3ZMD A;  2E1N A;  2HYF A;  4EGY A;  2R7F A;  3M1E A;  3PFI A;  3WE3 A;  3SHF A;  5HLI A;  3MZH A;  2VN2 A;  2DO7 A;  4LB6 B;  2D1V A;  5A2Q K;  5AIP A;  1LQ1 A;  3HSR A;  3E5X A;  4PGH A;  4KT5 C;  3JW4 A;  3GFI A;  3J81 K;  4ZZD A;  4IRH A;  2OD5 A;  1TNT A;  3ECO A;  3EET A;  4JQF A;  3R60 A;  6PAX A;  4EQQ A;  4M9Z A;  3HRT A;  5JI6 A;  1QQI A;  1UST A;  4UV9 A;  1PDN C;  2NRA C;  3LQQ A;  5HS8 A;  2Y0M A;  3ECH A;  2G9W A;  2G7H A;  3CJN A;  2PLY A;  3KET A;  2ETH A;  4RB2 C;  4XSX F;  2CWE A;  1BIA A;  1IZ1 A;  3F8F A;  1R00 A;  2DBB A;  4Q5S F;  2CFX A;  4MTE A;  1EV7 A;  2A3S A;  1HQC A;  1GXP A;  2WC2 A;  4IRI A;  2YR2 A;  3E6B A;  3F3X A;  1BIB A;  3QPH A;  2IA0 A;  2HOE A;  3ML6 A;  5ICC A;  1SFX A;  5HOO A;  1BI3 A;  4IVN A;  3IRQ A;  5IT9 Z;  2VT2 A;  1W4M A;  3M9A A;  1F4K A;  3IKT A;  4D0P A;  4HV6 A;  4EM2 A;  1WQ2 A;  2XGX A;  3GXO A;  4ON0 A;  3M7G A;  1FSH A;  3BJO A;  1EH6 A;  3FXQ A;  2RQP A;  3WTS C;  3D0S A;  3LA2 A;  3WGH A;  3V8K A;  1IXS B;  1P4A A;  1YO5 C;  4G6D A;  1UHW A;  1YYV A;  1YW9 A;  1UB9 A;  1T39 A;  2MA3 A;  1J59 A;  3T0Y A;  3HHG A;  5J8C A;  2OQR A;  3HIF A;  2Z5U A;  5H6R A;  5LEJ A;  1D3Y A;  3DF8 A;  4RGU A;  2F5C A;  4E70 A;  3QRF F;  4LK0 F;  1MKM A;  1JHH A;  1YW8 A;  4L0Z B;  1FYK A;  2IW5 A;  4PDK A;  1IN5 A;  3RJP A;  3T1B A;  4MTD A;  1E2X A;  3KP6 A;  4A5M A;  4P5O A;  3SQN A;  2L4M A;  3CTA A;  4Q48 A;  1TW2 A;  1ZG3 A;  4WX9 A;  5AON A;  1CF7 B;  3HRS A;  4G94 A;  1TLH B;  4EGZ A;  3OV8 A;  1U8R A;  1G3Y A;  4A0Z A;  1H0M A;  2YSR A;  3TO7 A;  2YPR A;  4IRG A;  5EEH A;  1BI1 A;  2FBK A;  3EDP A;  1IN7 A;  1XN7 A;  4OMY A;  5IT9 K;  2VBY A;  4MQ9 F;  5LHI A;  1LEB A;  1R7J A;  4UXN A;  2ZNY A;  1YIO A;  1G3T A;  3I53 A;  1ONV A;  5KVR A;  4MHG A;  1SMT A;  4ESF A;  3KP7 A;  3AAF A;  2P7V B;  4OIN F;  4BAY A;  4YII A;  4HLX A;  5K5O A;  1P2F A;  1Z05 A;  2GA1 A;  3QAH A;  4XLN F;  4IJA A;  2XRO A;  4EM0 B;  3V7C A;  1J9I A;  1TQM A;  3L7W A;  1S8N A;  4G6Q A;  4EJO A;  3O3K A;  2LF7 A;  3RPU A;  1EH7 A;  2EFQ A;  1U5T C;  1OYW A;  1GXQ A;  4N9H A;  2QQA A;  1D8J A;  2DK8 A;  2L54 A;  1R5G A;  5EEG A;  3K1M A;  4BYY A;  2DK5 A;  2W24 A;  3E5Q A;  1MDM A;  4R1H A;  3LA3 A;  5HDK A;  1ZLJ A;  2QVO A;  1LNW A;  2Y75 A;  3LA7 A;  1SD5 A;  2QEN A;  1I1G A;  3V8J A;  5HS9 A;  4CDG A;  1WRJ A;  4EM1 A;  2DTR A;  3BOQ A;  4KIG A;  2XAJ A;  4G9Y A;  4LJZ F;  1FNN A;  3GWZ A;  4HBL A;  1W7P D;  3N97 A;  2VT3 A;  5JR3 A;  3PQJ A;  1YTY A;  1ZHF A;  1S7A A;  2CYY A;  1MZB A;  2FU4 A;  2UXX A;  4AVP A;  3EQL F;  5LGU A;  3K9T A;  1HKT A;  1BBY A;  2IPQ X;  1K78 B;  1BM9 A;  2EB7 A;  4EJU A;  2LF8 A;  4RAZ A;  1JE8 A;  2GZW A;  2DI3 A;  2HTS A;  1ZAO A;  1MJ9 A;  1T38 A;  3WU0 A;  4P9U A;  4HW0 A;  4WCG A;  4WXD A;  1XSV A;  1T0F A;  3CUO A;  3ZMS A;  2H09 A;  2VXZ A;  3EYI A;  5LRR A;  4NB5 A;  2QBY B;  4GO1 A;  2IP2 A;  2EK5 A;  1FY7 A;  2AS5 F;  5BOX A;  2HQR A;  4IF4 A;  4HX8 A;  4RGR A;  4G7Z F;  1W5S A;  4OIR F;  5E20 A;  3N4M A;  2HS5 A;  3IC7 A;  1FYM A;  2K7L A;  2D2W A;  3ZMZ A;  5E8I A;  1ZH5 A;  2PMH A;  2EFN A;  3GZ6 A;  1B4A A;  2ELH A;  5FB2 A;  2P5L C;  1XSX A;  2ADU A;  3CUQ B;  2FBH A;  3I71 A;  1LDD A;  2ZFW A;  2L02 A;  4U7D A;  2LSO A;  2M45 A;  5CYV A;  4Q4Z F;  4ZYG A;  3MAJ A;  5BPD A;  2F5F A;  4EV0 A;  4G7H F;  1I27 A;  1R22 A;  3ISP A;  2KRF A;  4LG0 B;  2MLG A;  5F6F A;  1TW3 A;  3C3W A;  2RDP A;  1IN8 A;  1Z6T A;  2HFH A;  4UHT A;  4WF2 A;  2EFP A;  3TKY A;  4AWX B;  4FX4 A;  1HXD A;  2VBZ A;  2FMY A;  4KYW A;  3ABU A;  3E6M A;  4RB1 A;  3RYP A;  2ISY A;  4L18 B;  2XAQ A;  3HHH A;  3I54 A;  1JHF A;  2PJP A;  4L9T A;  4FX0 A;  3OOP A;  2J5O A;  3B73 A;  3VOD A;  1R23 A;  2GQQ A;  2OA4 A;  1IXR C;  1MD0 A;  2XAF A;  1XCB A;  1K78 A;  2F5D A;  5D5V B;  2P8T A;  4DNC A;  1RIO H;  1AWC A;  2ISZ A;  5LEK A;  3JSP A;  4KMF A;  3RPQ A;  1P4W A;  1JXS A;  1F9N A;  3GFJ A;  2QQB A;  4HX7 A;  4PGG A;  2X4H A;  3RI4 A;  4JK1 X;  5L3D A;  3V8L A;  4KA4 A;  4R79 A;  1R36 A;  5HVQ C;  4IPA A;  1IRG A;  3K1P A;  5HLH A;  2QBY A;  2P6S A;  3DQV C;  3HSF A;  3R0A A;  2WV0 A;  1QZY A;  2HKX A;  3R4K A;  5LGT A;  4GYG A;  1K6O A;  2V1X A;  1OR7 A;  2NS0 A;  1WI9 A;  3O2P E;  3K0L A;  2FRH A;  3QPT A;  2JT1 A;  4BNC A;  4HV5 A;  4ZYD A;  2JRT A;  2IVM A;  3FM5 A;  2NYX A;  4LK1 F;  1U2W A;  2IRF G;  5F64 A;  5ILV A;  5D5W B;  3CUQ A;  1UCR A;  3I4P A;  2Z9O A;  2MC3 A;  2ESH A;  3RYR A;  5DV5 A;  3GLX A;  3I5U A;  3IKV A;  2K02 A;  4I98 B;  4Q47 A;  1B9N A;  4ZYE A;  3GF2 A;  1H9G A;  4HDV A;  3ZMT A;  3Q9S A;  4LG0 A;  2EA4 A;  1BOA A;  2VBW A;  5LHH A;  3SZT A;  1GHC A;  1REP C;  2V1D A;  1FOK A;  4ZZL A;  1SD7 A;  5CVJ A;  3P9K A;  1O7L A;  5FLX Z;  2GIV A;  4BHC A;  1T2K A;  3GFM A;  3KLN A;  4GYI A;  2L4A A;  2V6C A;  3ZQ7 A;  3ZPL A;  1P92 A;  1YS7 A;  1ULY A;  3ABT A;  4A6D A;  4PZJ A;  2HDC A;  4TV7 A;  2KIU A;  1UFM A;  3KZZ A;  3HSE A;  2EJR A;  1STZ A;  3HRM A;  3ULQ B;  2P5V A;  4XRF A;  5D5X B;  5LGN A;  4Y13 A;  3GW2 A;  1YFH A;  1ZGJ A;  4YG2 F;  2FE3 A;  3G3Z A;  2WWY A;  2QYO A;  2E1C A;  2O6G E;  2Q2E A;  1HST A;  5E8G A;  3I58 A;  5D8L B;  1MDM B;  2Z3Y A;  1FT9 A;  4YIF A;  2FNP A;  1USS A;  3LST A;  4OIQ F;  3CO7 C;  3KZY A;  1SD4 A;  1KYZ A;  5BPI A;  2VC1 A;  3DEU A;  4K2E A;  4YFK F;  4A0Y A;  3O6B B;  4OMZ A;  5IT3 A;  2ACJ A;  1OKR A;  1HSJ A;  2O0Y A;  5FLX K;  1D5V A;  3WG9 A;  1DPR A;  2A6E F;  1SAX A;  2A68 F;  4XLP F;  1E17 A;  4IHT A;  4G7O F;  1QGP A;  2BV6 A;  3GZ5 A;  1Z91 A;  1WSU A;  3I59 B;  5BQT A;  4HF2 A;  5LHG A;  1S6L A;  3IWZ A;  1SFE A;  3JAM Z;  2Q0O A;  3TGN A;  1Z9C A;  1LEA A;  3KP5 A;  3MFK A;  3F8C A;  2FA5 A;  3WE2 A;  1IF1 A;  4LLG F;  1BC8 C;  1ZG5 A;  4B09 A;  3GEZ A;  1ZRC A;  4HX4 A;  5ICE A;  2PN6 A;  2UZK A;  2XV4 S;  1O3Q A;  4WK8 F;  3MCZ A;  2ZJ2 A;  4OIP F;  2M1B A;  1DDN A;  3FF5 A;  3CDH A;  4BQA A;  3GUD A;  1SFU A;  4Y15 A;  4RB3 C;  2A6H F;  3GO5 A;  4O6J A;  3NRV A;  1XGS A;  1BI0 A;  3PQK A;  3HOS A;  4P55 A;  2EV0 A;  2EV5 A;  2W85 A;  2VON A;  5FFX A;  1K79 A;  1I6X A;  5FGM A;  2GAU A;  2CO5 A;  4QWQ A;  1V3F A;  4A5N A;  4UVA A;  3HUG A;  3HYI A;  3T8T A;  3FZV A;  2RKH A;  1RUN A;  1FPQ A;  3E5U A;  3WTU C;  3QOP A;  2XKO A;  4HA8 A;  1FYL A;  2K86 A;  1XMK A;  4BHP A;  2QZ8 A;  2DPU A;  1X3U A;  3CO6 C;  3ZMU A;  3WTT C;  2M8E A;  2NNN A;  3FHZ A;  3W6J B;  5CVV A;  1SMY F;  3IWF A;  3VFZ A;  3WTW C;  1P4X A;  3DFG A;  5ICG A;  3JAM K;  3GYH X;  4CIC A;  5F1R A;  2L3D A;  1J7K A;  5DEQ A;  2JPC A;  4I0A A;  2G7U A;  3FMR A;  1C0W A;  3K2Z A;  5LRS A;  1HW5 A;  3BRO A;  3RIR A;  1W5T A;  4BXU A;  3COA C;  2O61 A;  3KFW X;  4M71 A;  3I59 A;  2BEO A;  2GXB A;  1ZGA A;  3WTY C;  5CJ9 A;  3BJA A;  2DW4 A;  5BMZ A;  4R8H A;  5J6X A;  1HKQ A;  3E97 A;  5FD6 A;  1J75 A;  4A12 A;  5E1X A;  4CGZ A;  3S2W A;  3HOT A;  1FBQ A;  5L3C A;  2M5W A;  1ZLK A;  5FO5 A;  1J5Y A;  4U0Y A;  2W25 A;  2F2E A;  3WTV C;  2DPD A;  2BYV E;  2JTV A;  1J0R A;  2CSO A;  3FMQ A;  1B59 A;  4XSZ F;  3RTR A;  3QP5 A;  3IHU A;  3REO A;  2DLL A;  5ILS A;  2LKP A;  2XAS A;  4GXO A;  5D5U B;  4L0Y B;  1U5T A;  4HDU A;  2KIF A;  2W84 A;  3KEO A;  3BPX A;  2PEX A;  1QZZ A;  1IAW A;  1B9M A;  1FP2 A;  2YX4 A;  3V7S A;  2R7D A;  3M8E A;  4KMU X;  1KQ8 A;  3QU3 A;  3B02 A;  4HYE A;  1IXC A;  1BJA A;  3FXU A;  4L9J A;  3P9I A;  4F7Z A;  3FM3 A;  1G3S A;  4AIJ A;  4N9I A;  3KEQ A;  2J5P A;  3VB2 A;  2ZCW A;  4ENN A;  3QU6 A;  5HDG A;  3U2R A;  4IHS A;  1OYY A;  4KN7 X;  5ED4 A;  4LLL A;  3T5X A;  2V9V A;  3W6K B;  1IW7 F;  4LD5 A;  4HAM A;  1F5T A;  3WGG A;  5L3G A;  4M6Y A;  3SFZ A;  3P9C A;  2YX7 A;  3BPV A;  3BY6 A;  4EJW A;  3BP8 A;  4RB0 A;  4I02 A;  2GXG A;  1MJB A;  2Z33 A;  1BN5 A;  4M6X A;  1CGP A;  3DXJ F;  4WXC A;  3EYY A;  4ESJ A;  4FT8 A;  4P9F A;  1FBS A;  1RZ4 A;  3VEP A;  3CUQ C;  2RN7 A;  2A5Y B;  3LQR A;  2MLK A;  4L9V A;  1G3W A;  2BE5 F;  3D5L A;  3TOA A;  5ICF A;  3F8N A;  5HLG A;  3RDI A;  2UXN A;  4Z2Y A;  1ZG1 A;  1P6R A;  1XSD A;  3FMS A;  3DPL C;  1XDU A;  2EA2 A;  2WTE A;  2CGP A;  2MH9 A;  2RVC A;  3R0J A;  2XKP A;  2ZME B;  4UNO A;  3DV8 A;  3H3Z A;  4OOI A;  4LMY A;  4A2U A;  4HLY A;  4HQE A;  1HW2 A;  3TQN A;  1XGO A;  2ZXJ A;  5DCM A;  2M30 A;  3T8R A;  2MD5 A;  1EH8 A;  2EFW A;  3F6V A;  3Q9V A;  3V4G A;  2O3F A;  4CYD A;  4HQM A;  4LLN A;  1KU9 A;  3E3V A;  1FZP B;  1FLI A;  4ETS A;  3JTG A;  3F8M A;  3KLO A;  4P96 A;  2ESN A;  1AOY A;  1HW1 A;  4BHB A;  1RNL A;  4AIK A;  3F72 A;  1XCV A;  3IL2 A;  2DFI A;  3MWM A;  1QO0 D;  4YFN F;  2HTJ A;  1B6A A;  3GFL A;  5L3E A;  2HQN A;  1RI7 A;  3F21 A;  2BBY A;  2K27 A;  1DPU A;  1U6G A;  2ZKZ A;  4GCV A;  1SD6 A;  2EFO A;  2B0L A;  4XBF A;  1YG2 A;  2XAH A;  3L2C A;  1YS6 A;  3G73 A;  1D8K A;  2RV8 A;  1WKM A;  1ZAR A;  2KJB A;  5DCF A;  2ZNZ A;  3WTZ A;  1KU2 A;  2H94 A;  2XRN A;  4I01 A;  1LJ9 A;  1FBU A;  4AIH A;  5ERI A;  1UHM A;  5CVR A;  2Z99 A;  4S05 A;  1O3S A;  2BGC A;  2HEO A;  5DUK A;  2HKO A;  3TO6 A;  2GWR A;  1W7P B;  1BC7 C;  2MH2 A;  4CO8 A;  1I5Z A;  3I64 A;  5J8F A;  2XHK A;  2LNB A;  1H9T A;  4L9N A;  2MBF A;  3BZ6 A;  4I09 A;  1O3T A;  3DKW A;  1I1S A;  2P7C B;  3R6S A;  1K7A A;  2A61 A;  3WGI A;  4PCQ A;  5HDN A;  2AXL A;  4KFC A;  3FXR A;  1U3E M;  1MJA A;  2XUB A;  2ZBK A;  3TDZ C;  3WTX C;  2COM A;  3KCC A;  4LB5 A;  5DYM A;  2IA2 A;  1KA8 A;  1R1U A;  4MNU A;  3J80 Z;  1TNS A;  1ODD A;  3M8F A;  2ZME A;  4M74 A;  4M72 A;  4ZH4 F;  3U1D A;  5K5Q A;  2ZO4 A;  4H0E A;  4L5J A;  4HF1 A;  4Y17 A;  4MGR A;  3SZP A;  1TBX A;  5K1Y A;  2FML A;  2NAZ A;  2P5K A;  3F6O A;  1G6N A;  2DQL A;  4O5V A;  3V7R A;  4ZYH A;  2PG4 A;  2HR3 A;  4KIC A;  2K4B A;  1S7O A;  2L01 A;  1KQ0 A;  3ERE D;  3RKY A;  2OQG A;  1XDS A;  1ZRF A;  1A04 A;  3GVA A;  2VOO A;  5E18 F;  2DT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...