2F4MB

The mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
GHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide N-glycanase
publication title Structure of the mouse peptide N-glycanase-HR23 complex suggests co-evolution of the endoplasmic reticulum-associated degradation and DNA repair pathways.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2f4mB00
1TP4A 1PVEA 1QZEA 2F4MB 3ESWB 2F4OB 2QSGX 1X3ZB 4YIRX 1X3WB 1OQYA 2QSHX 2QSFX
chains in the Genus database with same CATH superfamily
5D6FA 3O6BB 3T8RA 3V8JA 4L0YB 1FP2A 1FT9A 4XQFA 3G73A 5KNLA 4GCVA 5L3GA 1ZHFA 3HTSB 1S7EA 2KQRA 4MQVA 3OYIA 4LB5A 2E1MB 2ZCWA 2WB1A 2QQAA 4BDZA 2WAEA 5FGMA 1IDYA 1VQ6I 2LKSA 3KYCB 1D1AA 3BR3A 5H6QA 4BAYA 1K61A 1CQTA 1UMQA 3OYBA 2NVTJ 5JHFA 4UXNA 4D0PA 3FXJA 3F8MA 2BE5F 1APLC 1XD7A 3OOPA 5LRRA 5M5XJ 2DK8A 1X3WB 4PJLA 2M7AA 4RAFA 3A2KA 1MH3A 3QWLA 1R5ID 3KEYA 1NK2P 2STTA 3AG4H 4MTEA 1MH4A 2UUZA 3J80K 4CCNA 1FOKA 1R4MB 3G1LA 3Q0WA 5F08A 4NC6A 5HLGA 2MA3A 5IP6A 1K6OA 3OYDA 3OYJA 2LVSA 2WY8Q 1BA5A 1WFXA 2EZKA 2OU2A 2IRFG 2VKHA 3KP6A 3FBNB 3P9CA 2R5ZB 4M6YA 1J5YA 2J5OA 3I64A 3IP4B 2UZKA 1AU7A 3F6VA 3T8TA 4JYKA 3K4MA 5B3SH 4PCQA 3OYAA 1TWAJ 1YX3A 4YFKF 1X19A 4BEHA 3KFWX 1ZGAA 4E7HA 4HSTA 5LHHA 2DAOA 1Y0NA 3LSKA 2V1DA 3FKJA 4ETSA 3MZHA 3VYRB 2KDZA 2JPCA 1BR2A 2ZXIA 4NNJA 4L9NA 3QU3A 5IP9J 2E19A 3KP4A 3WTUC 2MBFA 2KRFA 2XRLA 3FX3A 5FROA 4IJAA 3AG3H 3H3ZA 1UAAA 2YU9J 2EV0A 1LUJB 3PNYA 2QSHX 4I98B 3LSMA 1I50J 3OYMA 2OPTA 4JP0A 4PZJA 4KIGA 5E79C 3S8PA 1MNMC 2E35A 1W0UA 3CCEI 3SFIA 4AWXB 1JT6A 1LFBA 3QYFA 3LFKA 1OCTC 2OV7A 3EYIA 2DYSH 4XLAA 1P7JA 2XB0X 2E5ZA 5IOYA 1WRJA 5J40A 4F52A 2F6CA 2MGQA 4BU2A 3L2WA 2CJJA 3DEUA 2QA4I 1ETYA 2XGEA 4MFDA 2BGCA 5JLWA 3L7WA 1GVDA 1I3AA 1KU3A 4E4HA 1JI8A 4YIFA 4AD9A 1ZK8A 3CCYA 5HDGA 1DGRM 4E7KA 4C30A 5K5OA 4RM3A 3A01A 2EB7A 1RC9A 3KLNA 2R5ZA 3HIFA 2VQCA 3AG1H 3U1DA 2VLAA 3KP2A 3KZYA 1HKQA 4YFXF 4WCGA 4H0EA 2X51A 3GTKJ 3S93A 3TOBA 4D5CA 3TL4X 1B8IB 3N97A 4UV8A 2IEKA 3C18A 2P7VB 2F5EA 2CRGA 3OR1C 4BHPA 2EV6A 3EYYA 4M3FA 5DV5A 3VYTB 2WY7Q 3PQJA 5M5YJ 1OCRH 4NDLA 3G71I 3WHCA 2P81A 1U9NA 3DKXA 2PI0A 3S3NA 9ANTA 5E17F 1POGA 1BIBA 2Z2SB 2HOAA 4HSRA 5GP9A 3GEZA 4XORA 2L9RA 1ZR2A 2CSOA 3BJAA 1GT0C 3RPQA 3RCOA 3DWLE 2O8KA 3HRTA 3DKYA 2IW5A 2CQXA 5FLXK 4CH7A 4D7MA 5DTDA 2ZSHB 3MAJA 4LLLA 5J1YA 1XS9A 1YJNI 3E6MA 5ICEA 2VBZA 1X2NA 2MYSA 1FPQA 5FLMJ 1D8KA 2JWTA 3LOCA 2R7WA 2XV4S 1FYKA 1F4KA 3P7NA 3OYFA 3C2BA 2M2EA 5DD4A 4G8XA 1TC3C 3BG7A 2DN0A 4EJOA 2OC6A 2M87A 4G7HF 4OIPF 3M9AA 3J81Z 1SMTA 4M9SA 1KYZA 4LB6B 1QQIA 4JBAA 2ZMEB 3WGHA 1TW2A 2PFBA 3UKGA 4N0BA 1Z91A 2E5NA 2M34A 1SVMA 4A3BJ 4BH9A 1D0XA 3ZQCA 2V4JC 2ZJRF 1RPWA 2JT1A 2LLKA 2NOGA 1X58A 2QQ9A 5IY5H 5KHDA 1OKRA 2WWYA 4XSZF 2Y75A 1GLNA 2GZWA 3G1OA 3LFUA 2A61A 1FIPA 2ZXHA 5FKNA 2DT7B 4A6EA 5LRSA 2P4WA 3PM1A 1LVAA 2DA3A 1OCPA 3DF8A 5FLVA 1IRFA 1U5TB 4FHTA 3TO9A 5J6XA 2KJCA 4RA2A 5EJCA 3FHNA 2R5YB 3KPHA 1V5FA 3BR5A 4IHVA 1OCOH 4KICA 5CKTA 2CQ7A 1OYWA 2H09A 5ILUA 3F9KA 3KEOA 1LVKA 4KDPA 1MMDA 1YIOA 3A03A 1MGTA 3FM3A 3CO6C 3BLYA 3HUGB 4D5FA 1JHFA 1YS6A 5ILSA 2ZJ2A 1FC3A 2FNAA 2MW8A 2VASA 1FEXA 2E1CA 4BY1J 5JR3A 3VODA 1ERDA 1XMAA 4I7HA 2V1XA 4FASD 1ZGJA 1SANA 2HXOA 4XBFA 2EILH 1IUYA 1FYMA 3BZKA 2VN2A 5F0HA 1R6RA 4LGWA 2XRNA 3B6CA 4ZYEA 3IC7A 4LIUA 3JTGA 3CMMA 1H0MA 3GF2A 3ABUA 3BZCA 3M8JA 2PN6A 1VQMI 3MWMA 3JAMZ 3H35A 3AG2H 5B1BH 1W5TA 2OAZA 2L9NA 4GYIA 2IPQX 3TP3A 2OF7A 2F2EA 2OCEA 3MKWB 4F91B 4IXAA 1EH8A 3CCRI 2FE3A 3SXYA 1ULYA 1XDSA 3IKVA 3DBLB 2LD5A 2HS5A 4BJ5C 3GZNB 3FIWA 3PNVA 3ZQFA 3DP7A 3R61A 3NAUA 2M8GX 1SD7A 3WE2A 3ML6A 1UHMA 1PUEE 2FQ3A 3BY6A 3FM5A 2ZKZA 3VSKA 1V55H 2Y9ZA 4A3GJ 1U0JA 5IT9K 1J09A 4DZJA 4Q4ZF 1IN8A 4A0YA 3GTLJ 2VIXA 3S2WA 2EFPA 2DI3A 3RYRA 2IP2A 3JRHA 5FKMA 2LH9A 5LFAA 2ME0A 2R5YA 2QBYB 1XGSA 2K27A 5EEAA 2VQLA 4QPOA 2JMWA 2H8RA 1A6QA 2JPBA 2JUCA 3WTYC 4Y7NJ 2XPWA 5A2QK 2XKPA 3BG3A 1WQ2A 4I02A 4KN4X 3E1SA 3HUGA 4HLXA 4U0VA 3J80Z 4HF1A 4PJNA 3QPHA 1ETKA 1W1WE 4G12A 4U88A 1CF7B 5B66C 3C1DA 3BR0A 3H5RA 3BTLA 5CVUA 2ESHA 2RQPA 1ZR4A 3GTMJ 1TZLA 2NNYA 4J01A 4GGGA 5LEKA 2X1EA 3CLQA 1Y0UA 3HJEA 2DYRH 4MLOA 3LNQA 3OSGA 2CFOA 3HKZA 5JVTA 2XUBA 2XHKA 2UXXA 5CLSA 5B5EC 4ZC3A 1NTCA 2O9LA 1ORKA 3JR9A 1OMIA 3Q9VA 3CLOA 5DD8A 5CJ9A 1U8BA 2WAQN 5KAFC 2PG4A 2I8DA 3F21A 3W6JB 1G3YA 1QHHD 1S8NA 2KIFA 2KLOA 2JSCA 2R4GA 2VJJA 4P1WA 2FOWA 3OOUA 3IL2A 5HNHA 5J3LA 4V2GA 4PDKA 4RLFA 3FXKA 1V54H 1Z3XA 2E2IJ 1Z05A 1T95A 4RS8A 5CVJA 4KFCA 3N4MA 3HOWJ 1TNSA 1MSFC 3FDYA 1EV7A 5IPAA 2BW3B 3ELKA 4RLQA 2XF5A 3SZGA 1XPXA 2Y31A 4OAZA 3WU0A 2E60A 2Y0SN 2GAUA 4CZZA 3QP5A 4D1QA 1LPQA 4XOTA 5TJJA 5D6EA 3PFYA 2QBYA 3IH4A 2X48A 4WK8F 4XICA 4LOCA 1AKHB 1WWXA 4G94A 5HS7A 1IXRC 2QSFX 3HOTA 1JTXA 2E7WA 2J5PA 2HXIA 4BY7J 1PP7U 1TNTA 3TBIA 3ABMH 1KYWA 5EEHA 4ZYAA 4A0ZA 5DM6F 5EG0B 1QVUA 1T39A 2VL8A 2DMTA 4B44A 2Z16A 3P5JA 2RV8A 2QCOA 3K7AJ 4S0HB 2JA6J 5LGTA 2V6EA 2XPVA 3QP6A 2E1NA 2IJLA 3DPUA 4BJ6C 2BOLA 4DOZA 3HEFA 2V9PA 5DCMA 4C2UA 2DMPA 3K4KA 4FISA 2JRMA 3JW4A 2IGMA 3LSGA 3JREA 2R7ZJ 3BCAA 3H92A 3ZMZA 1IC8A 3JRIA 2Z5UA 1D0YA 2HVSA 2D1HA 2IS1A 3K10A 2CUZA 2K86A 3RI4A 5E1WA 1XG1A 2H1LA 4UUSB 5BPDA 2XGCA 2FNPA 1DU0A 4IQJA 6PAXA 3VPRA 3E0JB 2HTSA 4WX9A 1SFOJ 1OCCH 2IVMA 4KIFA 1IJWC 3KZZA 2HOSA 2XPUA 4DYQA 1PVEA 4UV9A 2FX0A 3BR1A 3FKIJ 4P96A 1K78B 2RAEA 4Q48A 1B72A 1Z67A 1Y1VJ 5HLHA 4MGRA 4B47A 3C2GA 4M9ZA 4HNTA 2DMNA 5FLXZ 1SVOA 1QA6A 4RB3C 2V79A 3GUDA 4ANJA 4I2OA 3L2RA 3HOZJ 1DDNA 1W7PA 4XRSG 4ON0A 4RAZA 1PP8F 1AKHA 1VQ5I 2PJRA 2DJIA 2CGPA 2FOKA 1KU7A 2KIMA 5E3NA 1HLVA 4HLYA 1IRZA 1Z3YA 1J7KA 2VE9A 1YIJI 1XCVA 2R7FA 3HGYA 1A5JA 5E1XA 3AFHA 2DODA 1UCRA 4ZJZA 3NQOA 5CYVA 4M6VA 3K9TA 1SAUA 3QPLA 2STWA 1IRGA 3QODA 5ICFA 2BXYA 1J2XA 2YS9A 1JUSA 2HDCA 2PQ8A 2RGVA 3VFZA 5GTHC 1GDTA 2L01A 4KUMA 1X1CA 3GTOJ 4IOCF 4AVZA 2ECBA 1R1TA 2R7OA 2WTEA 3I3LA 5K5RA 2FSWA 4NHJA 4EGYA 1V4RA 1R36A 4NQWB 3J81K 4L0ZB 4HDUA 2F5CA 2EPFA 3KCCA 2YPRA 1XMKA 4WXDA 1ZN2A 2DPUA 3KLOA 1ZARA 5F0FA 4DNCA 1ENHA 1BC8C 3QU6A 3HG9A 3QYBA 2V9VA 1UHSA 3CMYA 3GXOA 3HDDA 1YYVA 4MFEA 2WAFA 3I56I 1E17A 1VI0A 2GXAA 1D8JA 3V7SA 1MD0A 3JRDA 3MKYB 3S16J 1WCMJ 3TMOA 3R0JA 4YEJA 1RESA 2LY1A 2W24A 2QYOA 1XSVA 2HOTA 1X4PA 4HDVA 3MD2A 3BR6A 2VOOA 2K9NA 2W4SA 2ESNA 1A35A 2VPLA 4Y17A 4CO8A 2FU4A 1RR8C 3DPLC 3FHZA 2V7FA 4BJTA 2XAJA 3CJTB 3SFZA 4C3IJ 1OJLA 1K4SA 4B8XA 4RMNA 3Q9SA 3S1NJ 3DLLF 3ZMTA 3G6EI 3T5XA 1J75A 4J00A 3K1MA 4F92B 2K40A 3U2RA 4KMUX 3HOUJ 4DZPA 4BE0A 2DA6A 5TRDA 4I76A 1ZLJA 5K1YA 5ICCA 4UVBA 1YE9A 2RN7A 4EV0A 1T08B 3Q0UA 2O0YA 2P5KA 3NARA 4YFNF 4G6DA 2HZDA 1GVJA 2X6OA 3TDZC 4AM3A 3DU6A 2DLLA 1RIOH 4M3EA 2K3FA 4BBSJ 3DEWA 2XSDC 4BEHB 3S1MJ 1BR1A 1WJAA 1K83J 1PJRA 3I0TA 4YELA 4OMYA 2MLGA 3I4NJ 2MLKA 4F55A 3RQ4A 1H89C 2DTRA 2K5CA 5IT9Z 5K7FA 3I54A 4CXFA 1UB9A 3GTQJ 1WGXA 2ZC2A 4A0XA 1SVLA 5KK1A 3DV8A 1XTAA 4UHTA 2JA8J 1Y8RB 2OD5A 1E3OC 2CQQA 2EZIA 5A2QZ 3CCVI 2W1OA 1HC8A 1IW7F 1HW1A 4EQQA 3H1CA 3CDLA 2CH0A 1FY7A 1WH5A 3FF5A 1D5VA 5JLXA 1N25A 1S7AA 4HOBA 4EJVA 5J8CA 2BYVE 1Z7LA 2KIUA 1LEBA 1HW5A 3K1NA 5FD5A 1R9TJ 1K7AA 1A36A 3IWZA 3OV8A 1Y8QB 3PJRA 2IA1A 3R60A 3COAC 3RZOJ 5C4XJ 1IDZA 5F04A 3OMYA 4CGZA 3TGNA 3PUFA 2R0QC 1Y1WJ 1TQPA 4IKFA 3OIPA 2VOPA 2PX9A 2TDXA 1H88C 3A01B 1I6XA 3DFGA 3SHFA 4EM0B 5JFRA 1U6GA 2DOFA 3PL8A 1ZH5A 4FT8A 2W48A 2EV5A 1TP4A 4U87A 1FOYA 1X1DA 2DJNA 1Z21A 2CG4A 2YR2A 2BY2A 2ISZA 2JZYA 4FE7A 2HQRA 1VNDA 4KT5C 5IT3A 4S04A 2KMUA 3W6VA 4I6ZA 2CYYA 2UWMA 2HDDA 1FIAA 1IN5A 1R7JA 2VBYA 1N77A 1XGOA 2EIJH 4U7DA 4A3EJ 3RKWA 2GXGA 2FF4A 5IP7J 1Z77A 2FMYA 2M1BA 1U78A 1W7PD 3CDHA 1NHAA 3QPSA 1BW5A 2FEZA 3VWBA 2L4MA 2NS8A 1T8IA 1R23A 3HXLA 5F1RA 2VI6A 2JUGA 3F72A 3HSRA 4AYBN 2I5UA 3Q3SA 4LD5A 1ONVA 3SJMA 2EFWA 4E7ZA 2H6CA 5HODA 3ECOA 3PUBA 2DA1A 2L02A 3DTKA 1T0FC 4DJAA 1WJEA 4RBOA 4KIBA 4Y52J 4IHWA 4LLGF 4EM2A 3OYHA 5ERIA 3V8KA 2VJ5A 1YHQI 1JXSA 1R58A 3E5XA 5M3FJ 4GXOA 2VQGA 4MTDA 1LFPA 4ZYHA 5L3BA 4ZDPA 3TDUC 1HXDA 2E1OA 4HQMA 5AIPA 4LK0F 2RNGA 4IHXA 2P8TA 1YX5A 3FK7A 2W7NA 4V2FA 2BEOA 1XX5A 3ZQGA 3B02A 4UY8I 3LA2A 1EH7A 1KU2A 4I0AA 4ITVA 3HHHA 3H3VK 2IS6A 1EF4A 3CESA 3DTEA 4IZZA 2PMUA 4BHCA 3DCFA 1G2HA 1Z7UA 2BV6A 1QPIA 4I01A 5HS9A 3FXLA 2D1VA 5LLQA 1XMXA 3I5UA 4HBLA 4HYEA 2HVRA 3HM5A 4CCMA 1BN5A 1VF9A 4NB5A 3PIPF 1JUPA 4ZYDA 1FWZA 4S05A 2RDPA 4OWRB 4X0GA 4PGHA 4J19A 2GWRA 2IA2A 2VKVA 2K9MA 2UXNA 4BYYA 2F4IA 3TO6A 3F8BA 4EMSA 3KP5A 4QTRA 2M4GA 4AVPA 2KZVA 1V3FA 3CQZJ 4A3LJ 3S14J 4L18B 3PQKA 1VQ4I 1QO0D 4BQOA 1QZEA 2B9SA 1S5LC 1H9TA 4ENJA 1FBSA 2ZJQF 3E97A 4UVAA 4B09A 2IAIA 3J7AO 4XLCA 1G59A 4IPAA 3LL7A 2QF7A 4KN7X 1RZ4A 4E70A 5AIQA 3CCSI 4BXUA 4L5IA 2M8EA 3SZTA 1XB4A 1W5CC 1XSXA 2RVCA 5DEQA 2A68F 3GO5A 3BG6A 2PMZN 4ZH4F 2EIMH 1XDUA 4A3MJ 3S2DJ 4WXHA 1ODDA 4LMYA 2L9SA 2CUEA 2DQRA 3QAHA 4IL6C 2K7LA 4FTHA 1EJ9A 1XGMA 1YG2A 2JSPA 1BM9A 2NVYJ 4XN0A 4IF4A 2O6GE 5E8IA 4XKVA 4RAYA 3BQZA 1RKTA 1CGPA 4ESJA 2ELJA 4V19K 1B6AA 3BROA 3LSHA 2V6CA 2V26A 3HPGA 1UZCA 2JVGA 5DS9A 3VYSB 3OS2A 2WADA 1RRJA 3IKTA 3ZCOA 5HVQC 5D4RA 1FSEA 1QHGA 3PSFA 4IO9F 2HR3A 3QQAA 4C2TA 1T0FA 4HRIA 4R8HA 4RB1A 2VT3A 2JK3A 3TEDA 3BT9A 1IRXA 4HF0A 2QM3A 4RB2C 4B43A 4I0BA 1QNTA 3T1BA 3ISPA 2E71A 3WTWC 3HSFA 1VTNC 1UG0A 1BI1A 5LBQA 1NG6A 1FTTA 1OLTA 3ABTA 3CJQB 4GO1A 3BTJA 5C3EJ 2V1NA 2V9KA 5HLTA 1IN4A 1FBQA 4XL9A 1IN6A 1JKPC 1MBJA 2ADUA 2HKXA 4AC0A 5F64A 2XAHA 3ZMVA 5E3LA 1TL8A 3CUOA 5JHUA 1ZG3A 1W4MA 2HQ5A 3J7AY 2VODA 3HB9A 2K9QA 2NS0A 3LSPA 2Q1ZB 2XB5A 4NC8A 4NBQA 2KT0A 2ZB9A 5EGOA 1BL0A 4AIHA 1S72I 3BWGA 3EETA 3EPZA 3F3XA 5DDGA 1AOYA 3ZQQA 3W2AA 4XLHA 5HNFA 1Z6TA 4F3QA 2XGDA 1QRYA 3PNTA 3ZGKA 4HX4A 1BJZA 3E6BA 2Y2ZA 1X4OA 3FK6A 1RETA 2JA2A 4II3A 4L5EA 3GZ6A 3BCBA 3HBLA 2XF6A 1ZQ3P 3JCUC 3WTTC 5DYMA 2QEXI 1JKRC 3H36A 2NRAC 1DP3A 1O7FA 1MIJA 4C9YA 4M71A 1JE8A 2R7VA 1N75A 2EJRA 3V42A 4C3HJ 2X6XA 3F8NA 5GADJ 2LP0A 1JKOC 3RSNA 1QPMA 3RDIA 3OS0A 3OYEA 3WGIA 5D8LB 4WF2A 4XRFA 1MZBA 1XN7A 1DQUA 1RUNA 4CCKA 1G3TA 2L7ZA 1L3LA 1NH3A 4L9TA 5DCMB 4FX0A 1R00A 2A5WA 3LAPA 1RKWA 3GLLA 3V8LA 3OY9A 1IXCA 1Q1HA 1F1ZA 1M1EB 2FUG2 2FD5A 5FFZA 2R7RA 3FZVA 5D8KB 1S3JA 1Z9CA 5LGUA 1JTYA 1DUXC 5KAIC 4DIQA 2CWEA 2MG4A 2QQBA 4QLCU 2K02A 3BG9A 4RGXA 3V4GA 1SC7A 4XR6A 1G3SA 2PBIA 2O3FA 4W97A 4X6AJ 3GLXA 5CVRA 4KT6A 1R5GA 2XAFA 3RQIA 1YS7A 2Y48A 2VB6A 3ABKH 2VJ4A 4B3XA 4Y13A 3I71A 3RZDJ 1ON2A 1OISA 3CJRB 2Y0MA 3CP8A 5CQGA 5BQTA 1WSUA 4CUGA 1PDNC 1SFKA 2QWWA 2MSYA 2FBHA 3K4NA 1FTZA 1IV8A 1WJFA 4A3IJ 1ZRFA 1Z6RA 3REOA 1B72B 2CV1A 1MMGA 2HQAA 2BZTA 1HOMA 1G3WA 3LMMA 2EFQA 3SEQA 1D5YA 3LQRA 3U9GA 3V7RA 1SEUA 3HZJA 2GQQA 3RPUD 3JRCA 2WBMA 2K3PA 5K7HA 2BY1A 3HRUA 2R7SA 2WC2A 4ESBA 2XDVA 1W7PB 3GFJA 1IUFA 4MHGA 2R7QA 3ZP5A 2PJRB 1ACIA 2DPDA 4XRSA 1SFXA 2KISA 3ERED 4Y33A 4FX4A 4Q5SF 1VQ8I 4A3FJ 1R1VA 2LK2A 2OTLI 4OINF 1AHDP 1USTA 4PJJA 3CC2I 1O3TA 3OYCA 5E18F 5ICGA 4M9XA 1IF1A 2DFHA 2OBPA 2W85A 4XNFA 4EJWA 3JSOA 2NXNB 3K4LA 4FE4A 4JOMA 1O7LA 2BVMA 1IGNA 2B0LA 1ZG1A 3DBHB 1TQMA 5EEGA 1FYLA 4WXCA 4UUTA 4PSXA 1YRNB 1O3SA 1U8RA 2A6HF 1HA8A 3OWTA 3F6OA 5DUKA 1YW8A 2RKHA 1IO2A 4WWCA 4YIRX 3ZXSA 2BY0A 4C2MJ 4RGRA 4EVIA 1G6NA 3CJNA 3FXRA 4O3MA 3PO2J 1P2FA 3FXOA 4A3CJ 3VOEA 1A6IA 3CCQI 3GFMA 3KZIC 4LIVA 3LSTA 3Q5FA 2Z99A 1B9NA 2R7TA 3TP0A 4DBRA 2XKOA 2DW4A 3RKQA 1LFUP 2G9WA 4CDGA 1TWCJ 4M3GA 5J1RA 3R0AA 3WTVC 4YG2F 4A12A 1LEAA 3NRVA 2CQNA 2W84A 2L4AA 1MNDA 2LOOA 3P9IA 1WH7A 4KITB 4MEYF 4IHSA 3M4OJ 1QZZA 3CZ6A 1E0EA 2HYJA 2A05A 1TT5B 5J47A 1H9GA 2MC3A 2OZ6A 3D5SC 5K5QA 2HGCA 4U0WA 4ENNA 2LBFB 2DCEA 3I53A 4XK4A 3BG5A 2N8GA 2BY3A 3NWTA 4A93J 1LDDA 5GAHJ 1F43A 2ICWG 2FXAA 2WAQA 3K4CA 1ETXA 3EDPA 1KQ0A 3CO7C 2NYXA 3M8FA 2ZFUA 3WTZA 5GPCA 2G7HA 4ENMA 3GCMA 1LB2A 2X6WA 4LG0A 3AKZA 2HDWA 2RREA 2VXDA 2XAUA 4FQGA 2EFNA 3U21A 3I59A 5DM7F 1YI2I 5FB2A 1SAXA 3ESWB 3BP8A 1YRNA 2CV0A 4PSWA 2MH2A 4M3DA 2L7KA 2JN6A 2Y0SA 3DU5A 4A2UA 5HDKA 5L3DA 4XM3A 3E5QA 3GX4X 1YJWI 3DQVC 3W2WA 2HYFA 4GDFA 3ZMDA 4E7JA 1X1AA 1FBUA 2ELHA 4LITA 4AIJA 3G2BA 2WB1N 1MSEC 2NVQJ 3KYLA 4OIRF 4B48A 3MMYB 3E3VA 2HWVA 3ABLH 4A69C 4OMZA 1T56A 2LTPA 2WA0A 3S2HJ 4A5NA 4JX5A 1VQPI 1Z0XA 2LRDA 3N05A 1FZPB 3AL0C 4BQNA 3G1MA 2LREA 2W25A 2KJBA 1B4AA 2CV2A 1G8XA 1R4NB 2DTZA 2LBFA 5FD6A 3JSPA 3MVPA 4A6DA 4ZZLA 2K9SA 1JJ6C 4MIMA 2QVOA 3F23A 2W82A 3GYHX 3LA3A 1WI3A 2H1KA 3HTUA 1IV6A 5ILVA 3GVAA 3SEZA 2WV1A 2R7XA 4QWQA 3GFIA 3A02A 4L5JA 3IHUA 1BOAA 2PEXA 1FMVA 2CW0F 2HOEA 2OA4A 4UB8C 4XLEA 4ZZDA 1H8AC 3J7ZI 2DA7A 1P4XA 1B59A 1PYVA 2K9LA 2F48A 3E6CC 3M07A 1GUUA 2PMHA 1MDMA 5JI6A 3LWFA 2PLYA 4L9JA 4ENKA 4D9JA 2IA0A 2L0KA 3RTRA 2XSJC 5BPIA 5E3MA 2BVLA 3FWEA 4Q47A 1J59A 4XONA 1MJAA 1K4TA 1UFMA 2FJ1A 2ME6A 4M73A 2K85A 2HU9A 5FKKA 3MEXA 4DYRA 5C4JJ 5FJ8J 1O4XA 3M1CA 2VBXA 3DBRB 3FMQA 1JJ8C 2ZNYA 3DTIA 3TO7A 4IEJA 2LF7A 2ELKA 5JVGF 2ZO4A 4BE1A 5M3MJ 5TGTA 3K4BA 5E8GA 4ASNA 4HW0A 2GBYA 2KDOA 2HFHA 1XSDA 3PO3J 1FP1D 2ID3A 3CCLI 3R4KA 4YIIA 3AL0B 4E7SA 2LNBA 1FLIA 2HPIA 1TQIA 2X0LA 3ZN1A 4IOAF 3GBGA 3F8CA 2DMQA 2ZBKA 3BJOA 3GW2A 4XRMA 3S3MA 3M1EA 5DCFA 2MD0A 2EZLA 1I1SA 2CFXA 1S7OA 3TQNA 2ECCA 5LGNA 2DFEA 3ULQB 1A31A 1YOVB 2X85A 3ECHA 4IRHA 3RKYA 2M0MA 4MO7A 4AUXA 2HYGD 3GTJJ 3ZOBA 3OL4A 1ETVA 1TWGJ 2HNHA 4QPQA 4HNUA 1FOWA 2MC4A 1NK3P 1VQ7I 2K4JA 2O61A 2LY2A 5B1AH 3I55I 1REPC 2W57A 3H3UA 4PFOA 3EUHC 4IRGA 5CVVA 1QGPA 1SMYF 4OAYA 3SYTA 3HL2A 1O3QA 5D5VB 3WTXC 2O03A 2M45A 3G3ZA 4U0YA 1GXPA 5FKOA 2D2WA 2L7MP 1HDPA 3O8HA 3SZPA 3W2VA 2A69F 5ED4A 2EIKH 5EYRA 3F8FA 2IXSA 1OPCA 2E2HJ 2EWNA 1I39A 2IT0A 2BHYA 1DGWY 5FRMA 3MN2A 4KMFA 1R71A 2M3AA 2HI3A 1KQ8A 2VC1A 1V5EA 5LD2C 1UELB 3HPHA 4DW6A 3MZYA 4HZFA 1ETWA 4HV5A 5HOOA 5C44J 1OQYA 3VYUB 2BXZA 2WV0A 2IGKA 2ISYA 4BNCA 3C3WA 4MQ9F 1LQ1A 1U9OA 2QKLB 3S3OA 4IHTA 1WJCA 3ERMA 2E36A 1HF0A 2QSGX 3S1RJ 2H94A 1ZLKA 4C3JJ 3RIRA 4GYGA 4LJZF 2LMDA 5IYDJ 2R93J 1R1UA 3J7YJ 1LDKB 2F5FA 2MFZA 2GA2A 3PIOF 2NVXJ 2NVUB 4UNOA 3JRBA 1F5TA 2LC2A 3ASOH 3NWSA 1PUFB 1LKXA 2FBIA 4BXFA 4JQFA 3K2AA 3Q0VA 3H9JA 1MKMA 3QOPA 4D7NA 4BQAA 4EJTA 3ZRGA 3K0LA 1V5GA 2HPMA 4O5VA 5L3FA 2OJED 5FO5A 5LEJA 3ZN0A 4E6KG 4ABZA 4BKXA 1E3HA 1C0WA 5H6RA 3HRSA 2E2JJ 2GM4A 1A04A 1VQKI 1ITYA 2ZNZA 1P4AA 3A1YA 4G6QA 4F93B 1RR7A 2YSRA 2UV1A 3MCZA 2ZJPF 3HOVJ 5BOXA 4G9YA 3C2HA 2ACJA 4CYCB 4E7LA 4BGDA 3WODF 2NAZA 2X4HA 3E5UA 3DPTA 1T6SA 4M3BA 1ZG5A 2IGOA 5F27A 5CVIA 1HCRA 4CICA 1D3YA 2FBKA 2ZMEC 2ZSIB 1KU9A 4XKWA 2GOXB 3LSIA 1Y56A 2I10A 3CC4I 2VJIA 3KE2A 5EZGA 2VPRA 2TCTA 1MW7A 2M0CA 2OUMA 1UJ8A 4XSXF 3CF2A 2F5VA 2DK5A 3ZQIA 4CSWA 4HF2A 3X2QH 3RPUA 4RB0A 5BS6A 1VZ0A 1OYYA 2CW8A 1SD5A 2C6YA 1O57A 1ON1A 3A0HC 2B7EA 3ROUA 3ZQLA 1XGNA 1HQCA 4IRIA 2CO5A 5EDNA 2EH3A 3M3YJ 2KZGA 3KP3A 3L2VA 2VKDA 1U5TC 2CMPA 4EATA 1O3RA 3BR2A 1JGGA 2Q8KA 3OYKA 4XLPF 3VDXA 3VSLA 1FSHA 3VB2A 1PUFA 4OIOF 1S29A 1P92A 1ZREA 4DQ2A 3IAS2 1UG2A 1BJAA 3E7LA 1MJBA 3S32A 2DOEA 2KKOA 1MBHA 4CCJA 2X1DA 4HG2A 1P7IA 2O7OA 5FFXA 4PK4A 4ZDLA 3EUHA 2DT6A 2EK5A 1YJ9I 3IV5A 4JX4A 4XLFA 5K7ZA 3E6DA 3L2CA 1L0OC 4AYBA 3I4MJ 1T2KA 2KIQA 1B9MA 4EM1A 4OIQF 5GAGJ 4XKBA 4HA8A 4HX7A 4CYCA 1N78A 4N9IA 5EGOB 4PGGA 3FXUA 3JRAA 1T38A 4OOIA 4MNUA 4NUBA 1FJLA 4LLNA 1D0ZA 1WKMA 3H0GJ 5F0CA 3S1QJ 1YTYA 2YX4A 1TWFJ 3QPTA 4ESFA 4MEXF 2O5RA 2KP6A 4XIDA 1WHUA 2EBIA 5J4VA 1LNWA 3WHBA 1B8IA 3L1PA 4DBQA 1USSA 2Z9OA 4TV7A 3L2QA 3LA7A 3A0BC 3IH3A 2D45A 3JRFA 1K6YA 3BJ6A 3IRRA 1QBJA 2Z33A 3HKZN 1B1BA 2B63J 2Y9YA 4R1HA 3WE3A 2DFIA 2LKPA 3I58A 5F6FA 1BI0A 3QRFF 2Q2EB 2X9DA 3S15J 1F9NA 2L7FP 3HYIA 1MMNA 4BQQA 2VXZA 4YRVA 4QIWN 3ASNH 2DO7A 4XMYA 3T0YA 1KGSA 2A3SA 3V7CA 1P6RA 3ZR8X 3TW7A 2BBYA 2CUJA 5E3OA 4KYWA 1WJ5A 3GTPJ 2FQ4A 4KNYA 2QUFA 2DA5A 1D1CA 2XGXA 2FMLA 5TISC 2GIZA 2LKXA 3CCJI 3FMSA 4HAMA 3DLAA 4Z6YA 3CMAI 4IX7A 2VT2A 4M74A 3EUKL 2A6EF 2DBBA 2TRTA 1BIAA 3O3KA 3D0SA 1F36A 5HDNA 1BI2A 4BHBA 3AAFA 1SFUA 1SD4A 4P5OA 2JVHA 4CA0A 3MZ8A 2EA2A 1LJ9A 4HEA2 3CTAA 4G7OF 5EZHA 1QU3A 2DA4A 5GAEJ 3OR2C 4HNVA 1J9IA 4CHUA 2R7UA 3FBIB 1W36D 1E2XA 3HOSA 1HW2A 2M9HA 3VEPA 4LK1F 2DU9A 1IAWA 3G4SI 1J0RA 2ZMEA 5BMZA 2W00A 3L9FA 3ZMSA 2H8WA 1RNLA 1Y6IA 2MD5A 1QVTA 2Z1DA 2M5WA 3ZMUA 4CCLA 1WZ2A 1FMWA 2COBA 3B73A 2R92J 2LR8A 4EJUA 1FX7A 4A3KJ 4LFUA 2IS4A 2OQRA 4L9VA 3JRGA 3H5NA 2P7CB 4KJZA 4QSHA 1R5HA 3R6SA 3CCUI 4GRIA 4ZDOA 4BUPA 3P9KA 4XOPA 4CCOA 3LQQA 4PUSA 3LSRA 1MMSA 2Q2EA 3HC7A 1OR7C 2HTJA 5KCMA 2PMZA 2ZFWA 3WU2C 1U5TA 1EH6A 4KISA 2DOAA 1TT0A 2RNJA 2EFOA 3JTHA 2VKEA 3CMEI 4P55A 1FOXA 3OYNA 2ZXWH 3DKWA 2P6TA 1Z1DA 3FXMA 2XF7A 3PSIA 2GOMA 4G6TB 1KA8A 3BC8A 3HOXJ 1E3PA 3KYDB 4CZCA 5LHIA 2GXBA 1Q1VA 4IVNA 3WTSC 2KRHA 4Z2YA 1SD6A 2KL4A 1VQ9I 1YFHA 5FRNA 1X1BA 4Y15A 3H5AA 1BW6A 1ZYRF 2Y69H 2DA2A 3BPVA 4PJ0C 4B1RA 2KFDA 4OU0A 1BOBA 2JRTA 2M4KA 3MQ0A 2K4BA 2F4OB 3HSEA 3SQNA 1KQ9A 1GXQA 2E7XA 3CUQC 1QZYA 3BDDA 4KA4A 1TBXA 1GV5A 3I9V2 5IYCJ 4M72A 1X1PA 1XCBA 2VE8A 2XVCA 4N9HA 3K70D 4A3DJ 3MFKA 1DPUA 4P9UA 2QENA 3C7JA 1BR4A 1DPRA 1IN7A 3BQYA 5FKLA 3TKYA 5EF6A 1ZGWA 1AWCA 1XC5A 3K2ZA 1TTYA 2COMA 1YQAA 1KONA 2F5DA 2VC0A 2Q0OA 4CYDA 2XIGA 3I4PA 1HSJA 5J1UA 5L3EA 2JTVA 3HOYJ 2IGNA 4JX6A 3OS1A 3KETA 2DXIA 5KVRA 1FNNA 3L2UA 2VONA 2CQKA 5AONA 3WG7H 1T33A 1MBKA 5HS8A 2IBDA 3K6GA 5LHGA 3OIQA 3BOQA 2ID6A 3KEQA 5IYBJ 4AU7A 2DQLA 1T98A 3ZQ7A 2HVQA 4RDUA 3ZPLA 3BTIA 1ZAOA 5BNGA 4HPQA 4LG0B 2JJ7A 3RKXA 1HKTA 2P0WA 1STZA 3CDIA 1AA7A 2X6YA 4FCYA 1LE8B 1MBEA 2AXTC 3MKLA 2HZTA 3K4JA 3I59B 4EGZA 2H27A 3QYEA 3M8EA 5D5WB 1YW7A 2DDAA 3PFIA 1WVRA 1D1BA 1X3ZB 2XASA 1I5ZA 1TLHB 4BXXJ 4A3JJ 3O8GA 1CF7A 4I09A 2M30A 3HRMA 3OL3A 3L09A 3CP2A 2XAGA 3D1NI 1MBFA 2QKMB 3F22A 4N4NB 2EZHA 2G7UA 1W5SA 3UR3C 3CUQB 4JK1X 2PJPA 2Y30A 3OSFA 4RGSA 2JQ7A 1RUOA 2JA5J 3W6KB 1MNEA 2BHZA 4M6XA 1K79A 2LDUA 1W0TA 1ZELA 2LYCA 5CPRB 1ETQA 3WU1B 5CQEA 1WJBA 3K69A 1X3UA 3KP7A 3D5LA 3H9QA 2AO9A 2F4MB 3IUOA 4BDYA 4N4OB 4Y4RA 4BBRJ 5E1ZB 1P9QC 2X1CA 2G0EA 1TWHJ 1YO5C 1U3EM 3GMEA 4GFBA 3W3CA 1VFCA 4XKCA 2A5YB 1BC7C 2A6TA 1I3QJ 2BW3A 3U1KA 3BZ6A 2L5QA 2MH9A 4A5MA 2GA1A 5GPAA 2RQQA 4UUVA 3DEEA 3H0DA 2CW7A 1GHCA 5L3CA 1OR7A 1HBXG 3O2PE 1S9HA 1ZKGA 4F7ZA 5DUIA 5H2FC 1LE8A 1R22A 3IH2A 1MDMB 1R49A 2HEOA 3K1PA 1HSTA 1JGSA 2ZXJA 2CUFA 1OCZH 2QGUA 4IHYA 3D5RC 4PJMA 3CCMI 2NNNA 3IAM2 2VQHA 3WGGA 4I99C 4ZYGA 3M7GA 1OFCX 2QQ8A 1WI9A 5EG0A 4LG3A 1IXSB 3FXQA 4AIKA 3RYPA 2Z3YA 1JT0A 1ZRCA 1P4WA 2MABA 3HGGA 2P5LC 2LY9A 1S6LA 2GLOA 2FRHA 1YITI 2KHMA 2P5VA 3CUQA 2D5VA 1TW3A 2KPMA 3B6AA 1I1GA 4E7IA 3CC7I 2YX7A 2QZ8A 1KZHA 2XROA 3LSJA 2FA5A 2KRCA 2LG4A 3OYLA 4P9FA 1W36C 2L54A 1OYIA 4BS9A 4UUSA 3A4CA 2GIVA 4BACA 1ZTRA 2XAQA 4G7ZF 1I6HJ 4PFPA 1Y39A 2DDBA 1I27A 3GZ5A 2L9VA 3HHGA 3L00A 3FISA 2EA4A 4HQEA 1LDJA 5J8FA 2P6SA 4K2EA 4B4CA 4H4KC 4XLNF 2ETHA 2H6BA 2R3SA 2YU3A 3LAJA 2A07F 4BL0B 3UNGC 2AS5F 3QOEA 2DMUA 2L3DA 2JA7J 1MBGA 1U2WA 1IZ1A 4FETA 3NEUA 1WPKA 4DYCA 5D4SA 3SDGA 4B3AA 2AXLA 5HLIA 1K78A 3S17J 3BPXA 2E34A 1G4DA 2EINH 3TOAA 2LF8A 3H9GA 1YW9A 1HDDC 4DGWB 5F1JA 4HX8A 2E1MC 4NC7A 2VUMJ 3KIOA 5H20A 2NOJB 3CD6I 2RC4A 1NG7A 4O6JA 2EQRA 4ZTFA 4W1UA 3GFLA 1ZRDA 2VBWA 3GTGJ 4BE2A 4HV6A 2AQEA 4IQ4A 3BTCA 3MKZA 4II2A 1JHHA 4EEFG 2OTJI 2LFBA 3KX2A 1WJDA 3FMRA 3TW6A 1IG7A 3F0CA 5E20A 5D5XB 4AIDA 4RGUA 5J4YA 3IRQA 2V1UA 1JUMA 4R79A 1MJ9A 4X1EA 1GV2A 2AQFA 1DU6A 3K70C 3WG9A 1BI3A 1VQOI 1SFEA 3ZQHA 4UB6C 2IS2A 4RAGA 1X2MA 1YLFA 1VQLI 3EUAA 2LSOA 3EQLF 2HKOA 3CF5F 2CU7A 3OIOA 4RM2A 2M7BA 2NS7A 1JKQC 4UVCA 5M5WJ 1ETOA 2CS3A 2OZUA 2AHQA 3RJPA 4NQWA 2OCCH 2O8XA 1EA3A 3SDBA 1MMAA 2OQGA 1RI7A 3ONQA 3JAMK 5D5UB 2YUSA 1UHWA 1VQNI 2DT5A 3OYGA 4Y3OA 1DP7P 2QLZA 3GWZA 3IWFA 1BBYA 4XN3A 4ZTJA 5IOZA 1HKSA 2R7DA 3DXJF 4U7BA 2XC7A 2L2OA 2DFFA 1EKEA 5GTIC 2HQNA
chains in the Genus database with same CATH topology
1TP4A 1PVEA 1QZEA 2F4MB 3ESWB 2F4OB 2QSGX 1X3ZB 4YIRX 1X3WB 1OQYA 2QSHX 2QSFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP4 A;  1PVE A;  1QZE A;  2F4M B;  3ESW B;  2F4O B;  2QSG X;  1X3Z B;  4YIR X;  1X3W B;  1OQY A;  2QSH X;  2QSF X; 
#chains in the Genus database with same CATH topology
 5D6F A;  3O6B B;  3T8R A;  3V8J A;  4L0Y B;  1FP2 A;  1FT9 A;  4XQF A;  3G73 A;  5KNL A;  4GCV A;  5L3G A;  1ZHF A;  3HTS B;  1S7E A;  2KQR A;  4MQV A;  3OYI A;  4LB5 A;  2E1M B;  2ZCW A;  2WB1 A;  2QQA A;  4BDZ A;  2WAE A;  5FGM A;  1IDY A;  1VQ6 I;  2LKS A;  3KYC B;  1D1A A;  3BR3 A;  5H6Q A;  4BAY A;  1K61 A;  1CQT A;  1UMQ A;  3OYB A;  2NVT J;  5JHF A;  4UXN A;  4D0P A;  3FXJ A;  3F8M A;  2BE5 F;  1APL C;  1XD7 A;  3OOP A;  5LRR A;  5M5X J;  2DK8 A;  1X3W B;  4PJL A;  2M7A A;  4RAF A;  3A2K A;  1MH3 A;  3QWL A;  1R5I D;  3KEY A;  1NK2 P;  2STT A;  3AG4 H;  4MTE A;  1MH4 A;  2UUZ A;  3J80 K;  4CCN A;  1FOK A;  1R4M B;  3G1L A;  3Q0W A;  5F08 A;  4NC6 A;  5HLG A;  2MA3 A;  5IP6 A;  1K6O A;  3OYD A;  3OYJ A;  2LVS A;  2WY8 Q;  1BA5 A;  1WFX A;  2EZK A;  2OU2 A;  2IRF G;  2VKH A;  3KP6 A;  3FBN B;  3P9C A;  2R5Z B;  4M6Y A;  1J5Y A;  2J5O A;  3I64 A;  3IP4 B;  2UZK A;  1AU7 A;  3F6V A;  3T8T A;  4JYK A;  3K4M A;  5B3S H;  4PCQ A;  3OYA A;  1TWA J;  1YX3 A;  4YFK F;  1X19 A;  4BEH A;  3KFW X;  1ZGA A;  4E7H A;  4HST A;  5LHH A;  2DAO A;  1Y0N A;  3LSK A;  2V1D A;  3FKJ A;  4ETS A;  3MZH A;  3VYR B;  2KDZ A;  2JPC A;  1BR2 A;  2ZXI A;  4NNJ A;  4L9N A;  3QU3 A;  5IP9 J;  2E19 A;  3KP4 A;  3WTU C;  2MBF A;  2KRF A;  2XRL A;  3FX3 A;  5FRO A;  4IJA A;  3AG3 H;  3H3Z A;  1UAA A;  2YU9 J;  2EV0 A;  1LUJ B;  3PNY A;  2QSH X;  4I98 B;  3LSM A;  1I50 J;  3OYM A;  2OPT A;  4JP0 A;  4PZJ A;  4KIG A;  5E79 C;  3S8P A;  1MNM C;  2E35 A;  1W0U A;  3CCE I;  3SFI A;  4AWX B;  1JT6 A;  1LFB A;  3QYF A;  3LFK A;  1OCT C;  2OV7 A;  3EYI A;  2DYS H;  4XLA A;  1P7J A;  2XB0 X;  2E5Z A;  5IOY A;  1WRJ A;  5J40 A;  4F52 A;  2F6C A;  2MGQ A;  4BU2 A;  3L2W A;  2CJJ A;  3DEU A;  2QA4 I;  1ETY A;  2XGE A;  4MFD A;  2BGC A;  5JLW A;  3L7W A;  1GVD A;  1I3A A;  1KU3 A;  4E4H A;  1JI8 A;  4YIF A;  4AD9 A;  1ZK8 A;  3CCY A;  5HDG A;  1DGR M;  4E7K A;  4C30 A;  5K5O A;  4RM3 A;  3A01 A;  2EB7 A;  1RC9 A;  3KLN A;  2R5Z A;  3HIF A;  2VQC A;  3AG1 H;  3U1D A;  2VLA A;  3KP2 A;  3KZY A;  1HKQ A;  4YFX F;  4WCG A;  4H0E A;  2X51 A;  3GTK J;  3S93 A;  3TOB A;  4D5C A;  3TL4 X;  1B8I B;  3N97 A;  4UV8 A;  2IEK A;  3C18 A;  2P7V B;  2F5E A;  2CRG A;  3OR1 C;  4BHP A;  2EV6 A;  3EYY A;  4M3F A;  5DV5 A;  3VYT B;  2WY7 Q;  3PQJ A;  5M5Y J;  1OCR H;  4NDL A;  3G71 I;  3WHC A;  2P81 A;  1U9N A;  3DKX A;  2PI0 A;  3S3N A;  9ANT A;  5E17 F;  1POG A;  1BIB A;  2Z2S B;  2HOA A;  4HSR A;  5GP9 A;  3GEZ A;  4XOR A;  2L9R A;  1ZR2 A;  2CSO A;  3BJA A;  1GT0 C;  3RPQ A;  3RCO A;  3DWL E;  2O8K A;  3HRT A;  3DKY A;  2IW5 A;  2CQX A;  5FLX K;  4CH7 A;  4D7M A;  5DTD A;  2ZSH B;  3MAJ A;  4LLL A;  5J1Y A;  1XS9 A;  1YJN I;  3E6M A;  5ICE A;  2VBZ A;  1X2N A;  2MYS A;  1FPQ A;  5FLM J;  1D8K A;  2JWT A;  3LOC A;  2R7W A;  2XV4 S;  1FYK A;  1F4K A;  3P7N A;  3OYF A;  3C2B A;  2M2E A;  5DD4 A;  4G8X A;  1TC3 C;  3BG7 A;  2DN0 A;  4EJO A;  2OC6 A;  2M87 A;  4G7H F;  4OIP F;  3M9A A;  3J81 Z;  1SMT A;  4M9S A;  1KYZ A;  4LB6 B;  1QQI A;  4JBA A;  2ZME B;  3WGH A;  1TW2 A;  2PFB A;  3UKG A;  4N0B A;  1Z91 A;  2E5N A;  2M34 A;  1SVM A;  4A3B J;  4BH9 A;  1D0X A;  3ZQC A;  2V4J C;  2ZJR F;  1RPW A;  2JT1 A;  2LLK A;  2NOG A;  1X58 A;  2QQ9 A;  5IY5 H;  5KHD A;  1OKR A;  2WWY A;  4XSZ F;  2Y75 A;  1GLN A;  2GZW A;  3G1O A;  3LFU A;  2A61 A;  1FIP A;  2ZXH A;  5FKN A;  2DT7 B;  4A6E A;  5LRS A;  2P4W A;  3PM1 A;  1LVA A;  2DA3 A;  1OCP A;  3DF8 A;  5FLV A;  1IRF A;  1U5T B;  4FHT A;  3TO9 A;  5J6X A;  2KJC A;  4RA2 A;  5EJC A;  3FHN A;  2R5Y B;  3KPH A;  1V5F A;  3BR5 A;  4IHV A;  1OCO H;  4KIC A;  5CKT A;  2CQ7 A;  1OYW A;  2H09 A;  5ILU A;  3F9K A;  3KEO A;  1LVK A;  4KDP A;  1MMD A;  1YIO A;  3A03 A;  1MGT A;  3FM3 A;  3CO6 C;  3BLY A;  3HUG B;  4D5F A;  1JHF A;  1YS6 A;  5ILS A;  2ZJ2 A;  1FC3 A;  2FNA A;  2MW8 A;  2VAS A;  1FEX A;  2E1C A;  4BY1 J;  5JR3 A;  3VOD A;  1ERD A;  1XMA A;  4I7H A;  2V1X A;  4FAS D;  1ZGJ A;  1SAN A;  2HXO A;  4XBF A;  2EIL H;  1IUY A;  1FYM A;  3BZK A;  2VN2 A;  5F0H A;  1R6R A;  4LGW A;  2XRN A;  3B6C A;  4ZYE A;  3IC7 A;  4LIU A;  3JTG A;  3CMM A;  1H0M A;  3GF2 A;  3ABU A;  3BZC A;  3M8J A;  2PN6 A;  1VQM I;  3MWM A;  3JAM Z;  3H35 A;  3AG2 H;  5B1B H;  1W5T A;  2OAZ A;  2L9N A;  4GYI A;  2IPQ X;  3TP3 A;  2OF7 A;  2F2E A;  2OCE A;  3MKW B;  4F91 B;  4IXA A;  1EH8 A;  3CCR I;  2FE3 A;  3SXY A;  1ULY A;  1XDS A;  3IKV A;  3DBL B;  2LD5 A;  2HS5 A;  4BJ5 C;  3GZN B;  3FIW A;  3PNV A;  3ZQF A;  3DP7 A;  3R61 A;  3NAU A;  2M8G X;  1SD7 A;  3WE2 A;  3ML6 A;  1UHM A;  1PUE E;  2FQ3 A;  3BY6 A;  3FM5 A;  2ZKZ A;  3VSK A;  1V55 H;  2Y9Z A;  4A3G J;  1U0J A;  5IT9 K;  1J09 A;  4DZJ A;  4Q4Z F;  1IN8 A;  4A0Y A;  3GTL J;  2VIX A;  3S2W A;  2EFP A;  2DI3 A;  3RYR A;  2IP2 A;  3JRH A;  5FKM A;  2LH9 A;  5LFA A;  2ME0 A;  2R5Y A;  2QBY B;  1XGS A;  2K27 A;  5EEA A;  2VQL A;  4QPO A;  2JMW A;  2H8R A;  1A6Q A;  2JPB A;  2JUC A;  3WTY C;  4Y7N J;  2XPW A;  5A2Q K;  2XKP A;  3BG3 A;  1WQ2 A;  4I02 A;  4KN4 X;  3E1S A;  3HUG A;  4HLX A;  4U0V A;  3J80 Z;  4HF1 A;  4PJN A;  3QPH A;  1ETK A;  1W1W E;  4G12 A;  4U88 A;  1CF7 B;  5B66 C;  3C1D A;  3BR0 A;  3H5R A;  3BTL A;  5CVU A;  2ESH A;  2RQP A;  1ZR4 A;  3GTM J;  1TZL A;  2NNY A;  4J01 A;  4GGG A;  5LEK A;  2X1E A;  3CLQ A;  1Y0U A;  3HJE A;  2DYR H;  4MLO A;  3LNQ A;  3OSG A;  2CFO A;  3HKZ A;  5JVT A;  2XUB A;  2XHK A;  2UXX A;  5CLS A;  5B5E C;  4ZC3 A;  1NTC A;  2O9L A;  1ORK A;  3JR9 A;  1OMI A;  3Q9V A;  3CLO A;  5DD8 A;  5CJ9 A;  1U8B A;  2WAQ N;  5KAF C;  2PG4 A;  2I8D A;  3F21 A;  3W6J B;  1G3Y A;  1QHH D;  1S8N A;  2KIF A;  2KLO A;  2JSC A;  2R4G A;  2VJJ A;  4P1W A;  2FOW A;  3OOU A;  3IL2 A;  5HNH A;  5J3L A;  4V2G A;  4PDK A;  4RLF A;  3FXK A;  1V54 H;  1Z3X A;  2E2I J;  1Z05 A;  1T95 A;  4RS8 A;  5CVJ A;  4KFC A;  3N4M A;  3HOW J;  1TNS A;  1MSF C;  3FDY A;  1EV7 A;  5IPA A;  2BW3 B;  3ELK A;  4RLQ A;  2XF5 A;  3SZG A;  1XPX A;  2Y31 A;  4OAZ A;  3WU0 A;  2E60 A;  2Y0S N;  2GAU A;  4CZZ A;  3QP5 A;  4D1Q A;  1LPQ A;  4XOT A;  5TJJ A;  5D6E A;  3PFY A;  2QBY A;  3IH4 A;  2X48 A;  4WK8 F;  4XIC A;  4LOC A;  1AKH B;  1WWX A;  4G94 A;  5HS7 A;  1IXR C;  2QSF X;  3HOT A;  1JTX A;  2E7W A;  2J5P A;  2HXI A;  4BY7 J;  1PP7 U;  1TNT A;  3TBI A;  3ABM H;  1KYW A;  5EEH A;  4ZYA A;  4A0Z A;  5DM6 F;  5EG0 B;  1QVU A;  1T39 A;  2VL8 A;  2DMT A;  4B44 A;  2Z16 A;  3P5J A;  2RV8 A;  2QCO A;  3K7A J;  4S0H B;  2JA6 J;  5LGT A;  2V6E A;  2XPV A;  3QP6 A;  2E1N A;  2IJL A;  3DPU A;  4BJ6 C;  2BOL A;  4DOZ A;  3HEF A;  2V9P A;  5DCM A;  4C2U A;  2DMP A;  3K4K A;  4FIS A;  2JRM A;  3JW4 A;  2IGM A;  3LSG A;  3JRE A;  2R7Z J;  3BCA A;  3H92 A;  3ZMZ A;  1IC8 A;  3JRI A;  2Z5U A;  1D0Y A;  2HVS A;  2D1H A;  2IS1 A;  3K10 A;  2CUZ A;  2K86 A;  3RI4 A;  5E1W A;  1XG1 A;  2H1L A;  4UUS B;  5BPD A;  2XGC A;  2FNP A;  1DU0 A;  4IQJ A;  6PAX A;  3VPR A;  3E0J B;  2HTS A;  4WX9 A;  1SFO J;  1OCC H;  2IVM A;  4KIF A;  1IJW C;  3KZZ A;  2HOS A;  2XPU A;  4DYQ A;  1PVE A;  4UV9 A;  2FX0 A;  3BR1 A;  3FKI J;  4P96 A;  1K78 B;  2RAE A;  4Q48 A;  1B72 A;  1Z67 A;  1Y1V J;  5HLH A;  4MGR A;  4B47 A;  3C2G A;  4M9Z A;  4HNT A;  2DMN A;  5FLX Z;  1SVO A;  1QA6 A;  4RB3 C;  2V79 A;  3GUD A;  4ANJ A;  4I2O A;  3L2R A;  3HOZ J;  1DDN A;  1W7P A;  4XRS G;  4ON0 A;  4RAZ A;  1PP8 F;  1AKH A;  1VQ5 I;  2PJR A;  2DJI A;  2CGP A;  2FOK A;  1KU7 A;  2KIM A;  5E3N A;  1HLV A;  4HLY A;  1IRZ A;  1Z3Y A;  1J7K A;  2VE9 A;  1YIJ I;  1XCV A;  2R7F A;  3HGY A;  1A5J A;  5E1X A;  3AFH A;  2DOD A;  1UCR A;  4ZJZ A;  3NQO A;  5CYV A;  4M6V A;  3K9T A;  1SAU A;  3QPL A;  2STW A;  1IRG A;  3QOD A;  5ICF A;  2BXY A;  1J2X A;  2YS9 A;  1JUS A;  2HDC A;  2PQ8 A;  2RGV A;  3VFZ A;  5GTH C;  1GDT A;  2L01 A;  4KUM A;  1X1C A;  3GTO J;  4IOC F;  4AVZ A;  2ECB A;  1R1T A;  2R7O A;  2WTE A;  3I3L A;  5K5R A;  2FSW A;  4NHJ A;  4EGY A;  1V4R A;  1R36 A;  4NQW B;  3J81 K;  4L0Z B;  4HDU A;  2F5C A;  2EPF A;  3KCC A;  2YPR A;  1XMK A;  4WXD A;  1ZN2 A;  2DPU A;  3KLO A;  1ZAR A;  5F0F A;  4DNC A;  1ENH A;  1BC8 C;  3QU6 A;  3HG9 A;  3QYB A;  2V9V A;  1UHS A;  3CMY A;  3GXO A;  3HDD A;  1YYV A;  4MFE A;  2WAF A;  3I56 I;  1E17 A;  1VI0 A;  2GXA A;  1D8J A;  3V7S A;  1MD0 A;  3JRD A;  3MKY B;  3S16 J;  1WCM J;  3TMO A;  3R0J A;  4YEJ A;  1RES A;  2LY1 A;  2W24 A;  2QYO A;  1XSV A;  2HOT A;  1X4P A;  4HDV A;  3MD2 A;  3BR6 A;  2VOO A;  2K9N A;  2W4S A;  2ESN A;  1A35 A;  2VPL A;  4Y17 A;  4CO8 A;  2FU4 A;  1RR8 C;  3DPL C;  3FHZ A;  2V7F A;  4BJT A;  2XAJ A;  3CJT B;  3SFZ A;  4C3I J;  1OJL A;  1K4S A;  4B8X A;  4RMN A;  3Q9S A;  3S1N J;  3DLL F;  3ZMT A;  3G6E I;  3T5X A;  1J75 A;  4J00 A;  3K1M A;  4F92 B;  2K40 A;  3U2R A;  4KMU X;  3HOU J;  4DZP A;  4BE0 A;  2DA6 A;  5TRD A;  4I76 A;  1ZLJ A;  5K1Y A;  5ICC A;  4UVB A;  1YE9 A;  2RN7 A;  4EV0 A;  1T08 B;  3Q0U A;  2O0Y A;  2P5K A;  3NAR A;  4YFN F;  4G6D A;  2HZD A;  1GVJ A;  2X6O A;  3TDZ C;  4AM3 A;  3DU6 A;  2DLL A;  1RIO H;  4M3E A;  2K3F A;  4BBS J;  3DEW A;  2XSD C;  4BEH B;  3S1M J;  1BR1 A;  1WJA A;  1K83 J;  1PJR A;  3I0T A;  4YEL A;  4OMY A;  2MLG A;  3I4N J;  2MLK A;  4F55 A;  3RQ4 A;  1H89 C;  2DTR A;  2K5C A;  5IT9 Z;  5K7F A;  3I54 A;  4CXF A;  1UB9 A;  3GTQ J;  1WGX A;  2ZC2 A;  4A0X A;  1SVL A;  5KK1 A;  3DV8 A;  1XTA A;  4UHT A;  2JA8 J;  1Y8R B;  2OD5 A;  1E3O C;  2CQQ A;  2EZI A;  5A2Q Z;  3CCV I;  2W1O A;  1HC8 A;  1IW7 F;  1HW1 A;  4EQQ A;  3H1C A;  3CDL A;  2CH0 A;  1FY7 A;  1WH5 A;  3FF5 A;  1D5V A;  5JLX A;  1N25 A;  1S7A A;  4HOB A;  4EJV A;  5J8C A;  2BYV E;  1Z7L A;  2KIU A;  1LEB A;  1HW5 A;  3K1N A;  5FD5 A;  1R9T J;  1K7A A;  1A36 A;  3IWZ A;  3OV8 A;  1Y8Q B;  3PJR A;  2IA1 A;  3R60 A;  3COA C;  3RZO J;  5C4X J;  1IDZ A;  5F04 A;  3OMY A;  4CGZ A;  3TGN A;  3PUF A;  2R0Q C;  1Y1W J;  1TQP A;  4IKF A;  3OIP A;  2VOP A;  2PX9 A;  2TDX A;  1H88 C;  3A01 B;  1I6X A;  3DFG A;  3SHF A;  4EM0 B;  5JFR A;  1U6G A;  2DOF A;  3PL8 A;  1ZH5 A;  4FT8 A;  2W48 A;  2EV5 A;  1TP4 A;  4U87 A;  1FOY A;  1X1D A;  2DJN A;  1Z21 A;  2CG4 A;  2YR2 A;  2BY2 A;  2ISZ A;  2JZY A;  4FE7 A;  2HQR A;  1VND A;  4KT5 C;  5IT3 A;  4S04 A;  2KMU A;  3W6V A;  4I6Z A;  2CYY A;  2UWM A;  2HDD A;  1FIA A;  1IN5 A;  1R7J A;  2VBY A;  1N77 A;  1XGO A;  2EIJ H;  4U7D A;  4A3E J;  3RKW A;  2GXG A;  2FF4 A;  5IP7 J;  1Z77 A;  2FMY A;  2M1B A;  1U78 A;  1W7P D;  3CDH A;  1NHA A;  3QPS A;  1BW5 A;  2FEZ A;  3VWB A;  2L4M A;  2NS8 A;  1T8I A;  1R23 A;  3HXL A;  5F1R A;  2VI6 A;  2JUG A;  3F72 A;  3HSR A;  4AYB N;  2I5U A;  3Q3S A;  4LD5 A;  1ONV A;  3SJM A;  2EFW A;  4E7Z A;  2H6C A;  5HOD A;  3ECO A;  3PUB A;  2DA1 A;  2L02 A;  3DTK A;  1T0F C;  4DJA A;  1WJE A;  4RBO A;  4KIB A;  4Y52 J;  4IHW A;  4LLG F;  4EM2 A;  3OYH A;  5ERI A;  3V8K A;  2VJ5 A;  1YHQ I;  1JXS A;  1R58 A;  3E5X A;  5M3F J;  4GXO A;  2VQG A;  4MTD A;  1LFP A;  4ZYH A;  5L3B A;  4ZDP A;  3TDU C;  1HXD A;  2E1O A;  4HQM A;  5AIP A;  4LK0 F;  2RNG A;  4IHX A;  2P8T A;  1YX5 A;  3FK7 A;  2W7N A;  4V2F A;  2BEO A;  1XX5 A;  3ZQG A;  3B02 A;  4UY8 I;  3LA2 A;  1EH7 A;  1KU2 A;  4I0A A;  4ITV A;  3HHH A;  3H3V K;  2IS6 A;  1EF4 A;  3CES A;  3DTE A;  4IZZ A;  2PMU A;  4BHC A;  3DCF A;  1G2H A;  1Z7U A;  2BV6 A;  1QPI A;  4I01 A;  5HS9 A;  3FXL A;  2D1V A;  5LLQ A;  1XMX A;  3I5U A;  4HBL A;  4HYE A;  2HVR A;  3HM5 A;  4CCM A;  1BN5 A;  1VF9 A;  4NB5 A;  3PIP F;  1JUP A;  4ZYD A;  1FWZ A;  4S05 A;  2RDP A;  4OWR B;  4X0G A;  4PGH A;  4J19 A;  2GWR A;  2IA2 A;  2VKV A;  2K9M A;  2UXN A;  4BYY A;  2F4I A;  3TO6 A;  3F8B A;  4EMS A;  3KP5 A;  4QTR A;  2M4G A;  4AVP A;  2KZV A;  1V3F A;  3CQZ J;  4A3L J;  3S14 J;  4L18 B;  3PQK A;  1VQ4 I;  1QO0 D;  4BQO A;  1QZE A;  2B9S A;  1S5L C;  1H9T A;  4ENJ A;  1FBS A;  2ZJQ F;  3E97 A;  4UVA A;  4B09 A;  2IAI A;  3J7A O;  4XLC A;  1G59 A;  4IPA A;  3LL7 A;  2QF7 A;  4KN7 X;  1RZ4 A;  4E70 A;  5AIQ A;  3CCS I;  4BXU A;  4L5I A;  2M8E A;  3SZT A;  1XB4 A;  1W5C C;  1XSX A;  2RVC A;  5DEQ A;  2A68 F;  3GO5 A;  3BG6 A;  2PMZ N;  4ZH4 F;  2EIM H;  1XDU A;  4A3M J;  3S2D J;  4WXH A;  1ODD A;  4LMY A;  2L9S A;  2CUE A;  2DQR A;  3QAH A;  4IL6 C;  2K7L A;  4FTH A;  1EJ9 A;  1XGM A;  1YG2 A;  2JSP A;  1BM9 A;  2NVY J;  4XN0 A;  4IF4 A;  2O6G E;  5E8I A;  4XKV A;  4RAY A;  3BQZ A;  1RKT A;  1CGP A;  4ESJ A;  2ELJ A;  4V19 K;  1B6A A;  3BRO A;  3LSH A;  2V6C A;  2V26 A;  3HPG A;  1UZC A;  2JVG A;  5DS9 A;  3VYS B;  3OS2 A;  2WAD A;  1RRJ A;  3IKT A;  3ZCO A;  5HVQ C;  5D4R A;  1FSE A;  1QHG A;  3PSF A;  4IO9 F;  2HR3 A;  3QQA A;  4C2T A;  1T0F A;  4HRI A;  4R8H A;  4RB1 A;  2VT3 A;  2JK3 A;  3TED A;  3BT9 A;  1IRX A;  4HF0 A;  2QM3 A;  4RB2 C;  4B43 A;  4I0B A;  1QNT A;  3T1B A;  3ISP A;  2E71 A;  3WTW C;  3HSF A;  1VTN C;  1UG0 A;  1BI1 A;  5LBQ A;  1NG6 A;  1FTT A;  1OLT A;  3ABT A;  3CJQ B;  4GO1 A;  3BTJ A;  5C3E J;  2V1N A;  2V9K A;  5HLT A;  1IN4 A;  1FBQ A;  4XL9 A;  1IN6 A;  1JKP C;  1MBJ A;  2ADU A;  2HKX A;  4AC0 A;  5F64 A;  2XAH A;  3ZMV A;  5E3L A;  1TL8 A;  3CUO A;  5JHU A;  1ZG3 A;  1W4M A;  2HQ5 A;  3J7A Y;  2VOD A;  3HB9 A;  2K9Q A;  2NS0 A;  3LSP A;  2Q1Z B;  2XB5 A;  4NC8 A;  4NBQ A;  2KT0 A;  2ZB9 A;  5EGO A;  1BL0 A;  4AIH A;  1S72 I;  3BWG A;  3EET A;  3EPZ A;  3F3X A;  5DDG A;  1AOY A;  3ZQQ A;  3W2A A;  4XLH A;  5HNF A;  1Z6T A;  4F3Q A;  2XGD A;  1QRY A;  3PNT A;  3ZGK A;  4HX4 A;  1BJZ A;  3E6B A;  2Y2Z A;  1X4O A;  3FK6 A;  1RET A;  2JA2 A;  4II3 A;  4L5E A;  3GZ6 A;  3BCB A;  3HBL A;  2XF6 A;  1ZQ3 P;  3JCU C;  3WTT C;  5DYM A;  2QEX I;  1JKR C;  3H36 A;  2NRA C;  1DP3 A;  1O7F A;  1MIJ A;  4C9Y A;  4M71 A;  1JE8 A;  2R7V A;  1N75 A;  2EJR A;  3V42 A;  4C3H J;  2X6X A;  3F8N A;  5GAD J;  2LP0 A;  1JKO C;  3RSN A;  1QPM A;  3RDI A;  3OS0 A;  3OYE A;  3WGI A;  5D8L B;  4WF2 A;  4XRF A;  1MZB A;  1XN7 A;  1DQU A;  1RUN A;  4CCK A;  1G3T A;  2L7Z A;  1L3L A;  1NH3 A;  4L9T A;  5DCM B;  4FX0 A;  1R00 A;  2A5W A;  3LAP A;  1RKW A;  3GLL A;  3V8L A;  3OY9 A;  1IXC A;  1Q1H A;  1F1Z A;  1M1E B;  2FUG 2;  2FD5 A;  5FFZ A;  2R7R A;  3FZV A;  5D8K B;  1S3J A;  1Z9C A;  5LGU A;  1JTY A;  1DUX C;  5KAI C;  4DIQ A;  2CWE A;  2MG4 A;  2QQB A;  4QLC U;  2K02 A;  3BG9 A;  4RGX A;  3V4G A;  1SC7 A;  4XR6 A;  1G3S A;  2PBI A;  2O3F A;  4W97 A;  4X6A J;  3GLX A;  5CVR A;  4KT6 A;  1R5G A;  2XAF A;  3RQI A;  1YS7 A;  2Y48 A;  2VB6 A;  3ABK H;  2VJ4 A;  4B3X A;  4Y13 A;  3I71 A;  3RZD J;  1ON2 A;  1OIS A;  3CJR B;  2Y0M A;  3CP8 A;  5CQG A;  5BQT A;  1WSU A;  4CUG A;  1PDN C;  1SFK A;  2QWW A;  2MSY A;  2FBH A;  3K4N A;  1FTZ A;  1IV8 A;  1WJF A;  4A3I J;  1ZRF A;  1Z6R A;  3REO A;  1B72 B;  2CV1 A;  1MMG A;  2HQA A;  2BZT A;  1HOM A;  1G3W A;  3LMM A;  2EFQ A;  3SEQ A;  1D5Y A;  3LQR A;  3U9G A;  3V7R A;  1SEU A;  3HZJ A;  2GQQ A;  3RPU D;  3JRC A;  2WBM A;  2K3P A;  5K7H A;  2BY1 A;  3HRU A;  2R7S A;  2WC2 A;  4ESB A;  2XDV A;  1W7P B;  3GFJ A;  1IUF A;  4MHG A;  2R7Q A;  3ZP5 A;  2PJR B;  1ACI A;  2DPD A;  4XRS A;  1SFX A;  2KIS A;  3ERE D;  4Y33 A;  4FX4 A;  4Q5S F;  1VQ8 I;  4A3F J;  1R1V A;  2LK2 A;  2OTL I;  4OIN F;  1AHD P;  1UST A;  4PJJ A;  3CC2 I;  1O3T A;  3OYC A;  5E18 F;  5ICG A;  4M9X A;  1IF1 A;  2DFH A;  2OBP A;  2W85 A;  4XNF A;  4EJW A;  3JSO A;  2NXN B;  3K4L A;  4FE4 A;  4JOM A;  1O7L A;  2BVM A;  1IGN A;  2B0L A;  1ZG1 A;  3DBH B;  1TQM A;  5EEG A;  1FYL A;  4WXC A;  4UUT A;  4PSX A;  1YRN B;  1O3S A;  1U8R A;  2A6H F;  1HA8 A;  3OWT A;  3F6O A;  5DUK A;  1YW8 A;  2RKH A;  1IO2 A;  4WWC A;  4YIR X;  3ZXS A;  2BY0 A;  4C2M J;  4RGR A;  4EVI A;  1G6N A;  3CJN A;  3FXR A;  4O3M A;  3PO2 J;  1P2F A;  3FXO A;  4A3C J;  3VOE A;  1A6I A;  3CCQ I;  3GFM A;  3KZI C;  4LIV A;  3LST A;  3Q5F A;  2Z99 A;  1B9N A;  2R7T A;  3TP0 A;  4DBR A;  2XKO A;  2DW4 A;  3RKQ A;  1LFU P;  2G9W A;  4CDG A;  1TWC J;  4M3G A;  5J1R A;  3R0A A;  3WTV C;  4YG2 F;  4A12 A;  1LEA A;  3NRV A;  2CQN A;  2W84 A;  2L4A A;  1MND A;  2LOO A;  3P9I A;  1WH7 A;  4KIT B;  4MEY F;  4IHS A;  3M4O J;  1QZZ A;  3CZ6 A;  1E0E A;  2HYJ A;  2A05 A;  1TT5 B;  5J47 A;  1H9G A;  2MC3 A;  2OZ6 A;  3D5S C;  5K5Q A;  2HGC A;  4U0W A;  4ENN A;  2LBF B;  2DCE A;  3I53 A;  4XK4 A;  3BG5 A;  2N8G A;  2BY3 A;  3NWT A;  4A93 J;  1LDD A;  5GAH J;  1F43 A;  2ICW G;  2FXA A;  2WAQ A;  3K4C A;  1ETX A;  3EDP A;  1KQ0 A;  3CO7 C;  2NYX A;  3M8F A;  2ZFU A;  3WTZ A;  5GPC A;  2G7H A;  4ENM A;  3GCM A;  1LB2 A;  2X6W A;  4LG0 A;  3AKZ A;  2HDW A;  2RRE A;  2VXD A;  2XAU A;  4FQG A;  2EFN A;  3U21 A;  3I59 A;  5DM7 F;  1YI2 I;  5FB2 A;  1SAX A;  3ESW B;  3BP8 A;  1YRN A;  2CV0 A;  4PSW A;  2MH2 A;  4M3D A;  2L7K A;  2JN6 A;  2Y0S A;  3DU5 A;  4A2U A;  5HDK A;  5L3D A;  4XM3 A;  3E5Q A;  3GX4 X;  1YJW I;  3DQV C;  3W2W A;  2HYF A;  4GDF A;  3ZMD A;  4E7J A;  1X1A A;  1FBU A;  2ELH A;  4LIT A;  4AIJ A;  3G2B A;  2WB1 N;  1MSE C;  2NVQ J;  3KYL A;  4OIR F;  4B48 A;  3MMY B;  3E3V A;  2HWV A;  3ABL H;  4A69 C;  4OMZ A;  1T56 A;  2LTP A;  2WA0 A;  3S2H J;  4A5N A;  4JX5 A;  1VQP I;  1Z0X A;  2LRD A;  3N05 A;  1FZP B;  3AL0 C;  4BQN A;  3G1M A;  2LRE A;  2W25 A;  2KJB A;  1B4A A;  2CV2 A;  1G8X A;  1R4N B;  2DTZ A;  2LBF A;  5FD6 A;  3JSP A;  3MVP A;  4A6D A;  4ZZL A;  2K9S A;  1JJ6 C;  4MIM A;  2QVO A;  3F23 A;  2W82 A;  3GYH X;  3LA3 A;  1WI3 A;  2H1K A;  3HTU A;  1IV6 A;  5ILV A;  3GVA A;  3SEZ A;  2WV1 A;  2R7X A;  4QWQ A;  3GFI A;  3A02 A;  4L5J A;  3IHU A;  1BOA A;  2PEX A;  1FMV A;  2CW0 F;  2HOE A;  2OA4 A;  4UB8 C;  4XLE A;  4ZZD A;  1H8A C;  3J7Z I;  2DA7 A;  1P4X A;  1B59 A;  1PYV A;  2K9L A;  2F48 A;  3E6C C;  3M07 A;  1GUU A;  2PMH A;  1MDM A;  5JI6 A;  3LWF A;  2PLY A;  4L9J A;  4ENK A;  4D9J A;  2IA0 A;  2L0K A;  3RTR A;  2XSJ C;  5BPI A;  5E3M A;  2BVL A;  3FWE A;  4Q47 A;  1J59 A;  4XON A;  1MJA A;  1K4T A;  1UFM A;  2FJ1 A;  2ME6 A;  4M73 A;  2K85 A;  2HU9 A;  5FKK A;  3MEX A;  4DYR A;  5C4J J;  5FJ8 J;  1O4X A;  3M1C A;  2VBX A;  3DBR B;  3FMQ A;  1JJ8 C;  2ZNY A;  3DTI A;  3TO7 A;  4IEJ A;  2LF7 A;  2ELK A;  5JVG F;  2ZO4 A;  4BE1 A;  5M3M J;  5TGT A;  3K4B A;  5E8G A;  4ASN A;  4HW0 A;  2GBY A;  2KDO A;  2HFH A;  1XSD A;  3PO3 J;  1FP1 D;  2ID3 A;  3CCL I;  3R4K A;  4YII A;  3AL0 B;  4E7S A;  2LNB A;  1FLI A;  2HPI A;  1TQI A;  2X0L A;  3ZN1 A;  4IOA F;  3GBG A;  3F8C A;  2DMQ A;  2ZBK A;  3BJO A;  3GW2 A;  4XRM A;  3S3M A;  3M1E A;  5DCF A;  2MD0 A;  2EZL A;  1I1S A;  2CFX A;  1S7O A;  3TQN A;  2ECC A;  5LGN A;  2DFE A;  3ULQ B;  1A31 A;  1YOV B;  2X85 A;  3ECH A;  4IRH A;  3RKY A;  2M0M A;  4MO7 A;  4AUX A;  2HYG D;  3GTJ J;  3ZOB A;  3OL4 A;  1ETV A;  1TWG J;  2HNH A;  4QPQ A;  4HNU A;  1FOW A;  2MC4 A;  1NK3 P;  1VQ7 I;  2K4J A;  2O61 A;  2LY2 A;  5B1A H;  3I55 I;  1REP C;  2W57 A;  3H3U A;  4PFO A;  3EUH C;  4IRG A;  5CVV A;  1QGP A;  1SMY F;  4OAY A;  3SYT A;  3HL2 A;  1O3Q A;  5D5V B;  3WTX C;  2O03 A;  2M45 A;  3G3Z A;  4U0Y A;  1GXP A;  5FKO A;  2D2W A;  2L7M P;  1HDP A;  3O8H A;  3SZP A;  3W2V A;  2A69 F;  5ED4 A;  2EIK H;  5EYR A;  3F8F A;  2IXS A;  1OPC A;  2E2H J;  2EWN A;  1I39 A;  2IT0 A;  2BHY A;  1DGW Y;  5FRM A;  3MN2 A;  4KMF A;  1R71 A;  2M3A A;  2HI3 A;  1KQ8 A;  2VC1 A;  1V5E A;  5LD2 C;  1UEL B;  3HPH A;  4DW6 A;  3MZY A;  4HZF A;  1ETW A;  4HV5 A;  5HOO A;  5C44 J;  1OQY A;  3VYU B;  2BXZ A;  2WV0 A;  2IGK A;  2ISY A;  4BNC A;  3C3W A;  4MQ9 F;  1LQ1 A;  1U9O A;  2QKL B;  3S3O A;  4IHT A;  1WJC A;  3ERM A;  2E36 A;  1HF0 A;  2QSG X;  3S1R J;  2H94 A;  1ZLK A;  4C3J J;  3RIR A;  4GYG A;  4LJZ F;  2LMD A;  5IYD J;  2R93 J;  1R1U A;  3J7Y J;  1LDK B;  2F5F A;  2MFZ A;  2GA2 A;  3PIO F;  2NVX J;  2NVU B;  4UNO A;  3JRB A;  1F5T A;  2LC2 A;  3ASO H;  3NWS A;  1PUF B;  1LKX A;  2FBI A;  4BXF A;  4JQF A;  3K2A A;  3Q0V A;  3H9J A;  1MKM A;  3QOP A;  4D7N A;  4BQA A;  4EJT A;  3ZRG A;  3K0L A;  1V5G A;  2HPM A;  4O5V A;  5L3F A;  2OJE D;  5FO5 A;  5LEJ A;  3ZN0 A;  4E6K G;  4ABZ A;  4BKX A;  1E3H A;  1C0W A;  5H6R A;  3HRS A;  2E2J J;  2GM4 A;  1A04 A;  1VQK I;  1ITY A;  2ZNZ A;  1P4A A;  3A1Y A;  4G6Q A;  4F93 B;  1RR7 A;  2YSR A;  2UV1 A;  3MCZ A;  2ZJP F;  3HOV J;  5BOX A;  4G9Y A;  3C2H A;  2ACJ A;  4CYC B;  4E7L A;  4BGD A;  3WOD F;  2NAZ A;  2X4H A;  3E5U A;  3DPT A;  1T6S A;  4M3B A;  1ZG5 A;  2IGO A;  5F27 A;  5CVI A;  1HCR A;  4CIC A;  1D3Y A;  2FBK A;  2ZME C;  2ZSI B;  1KU9 A;  4XKW A;  2GOX B;  3LSI A;  1Y56 A;  2I10 A;  3CC4 I;  2VJI A;  3KE2 A;  5EZG A;  2VPR A;  2TCT A;  1MW7 A;  2M0C A;  2OUM A;  1UJ8 A;  4XSX F;  3CF2 A;  2F5V A;  2DK5 A;  3ZQI A;  4CSW A;  4HF2 A;  3X2Q H;  3RPU A;  4RB0 A;  5BS6 A;  1VZ0 A;  1OYY A;  2CW8 A;  1SD5 A;  2C6Y A;  1O57 A;  1ON1 A;  3A0H C;  2B7E A;  3ROU A;  3ZQL A;  1XGN A;  1HQC A;  4IRI A;  2CO5 A;  5EDN A;  2EH3 A;  3M3Y J;  2KZG A;  3KP3 A;  3L2V A;  2VKD A;  1U5T C;  2CMP A;  4EAT A;  1O3R A;  3BR2 A;  1JGG A;  2Q8K A;  3OYK A;  4XLP F;  3VDX A;  3VSL A;  1FSH A;  3VB2 A;  1PUF A;  4OIO F;  1S29 A;  1P92 A;  1ZRE A;  4DQ2 A;  3IAS 2;  1UG2 A;  1BJA A;  3E7L A;  1MJB A;  3S32 A;  2DOE A;  2KKO A;  1MBH A;  4CCJ A;  2X1D A;  4HG2 A;  1P7I A;  2O7O A;  5FFX A;  4PK4 A;  4ZDL A;  3EUH A;  2DT6 A;  2EK5 A;  1YJ9 I;  3IV5 A;  4JX4 A;  4XLF A;  5K7Z A;  3E6D A;  3L2C A;  1L0O C;  4AYB A;  3I4M J;  1T2K A;  2KIQ A;  1B9M A;  4EM1 A;  4OIQ F;  5GAG J;  4XKB A;  4HA8 A;  4HX7 A;  4CYC A;  1N78 A;  4N9I A;  5EGO B;  4PGG A;  3FXU A;  3JRA A;  1T38 A;  4OOI A;  4MNU A;  4NUB A;  1FJL A;  4LLN A;  1D0Z A;  1WKM A;  3H0G J;  5F0C A;  3S1Q J;  1YTY A;  2YX4 A;  1TWF J;  3QPT A;  4ESF A;  4MEX F;  2O5R A;  2KP6 A;  4XID A;  1WHU A;  2EBI A;  5J4V A;  1LNW A;  3WHB A;  1B8I A;  3L1P A;  4DBQ A;  1USS A;  2Z9O A;  4TV7 A;  3L2Q A;  3LA7 A;  3A0B C;  3IH3 A;  2D45 A;  3JRF A;  1K6Y A;  3BJ6 A;  3IRR A;  1QBJ A;  2Z33 A;  3HKZ N;  1B1B A;  2B63 J;  2Y9Y A;  4R1H A;  3WE3 A;  2DFI A;  2LKP A;  3I58 A;  5F6F A;  1BI0 A;  3QRF F;  2Q2E B;  2X9D A;  3S15 J;  1F9N A;  2L7F P;  3HYI A;  1MMN A;  4BQQ A;  2VXZ A;  4YRV A;  4QIW N;  3ASN H;  2DO7 A;  4XMY A;  3T0Y A;  1KGS A;  2A3S A;  3V7C A;  1P6R A;  3ZR8 X;  3TW7 A;  2BBY A;  2CUJ A;  5E3O A;  4KYW A;  1WJ5 A;  3GTP J;  2FQ4 A;  4KNY A;  2QUF A;  2DA5 A;  1D1C A;  2XGX A;  2FML A;  5TIS C;  2GIZ A;  2LKX A;  3CCJ I;  3FMS A;  4HAM A;  3DLA A;  4Z6Y A;  3CMA I;  4IX7 A;  2VT2 A;  4M74 A;  3EUK L;  2A6E F;  2DBB A;  2TRT A;  1BIA A;  3O3K A;  3D0S A;  1F36 A;  5HDN A;  1BI2 A;  4BHB A;  3AAF A;  1SFU A;  1SD4 A;  4P5O A;  2JVH A;  4CA0 A;  3MZ8 A;  2EA2 A;  1LJ9 A;  4HEA 2;  3CTA A;  4G7O F;  5EZH A;  1QU3 A;  2DA4 A;  5GAE J;  3OR2 C;  4HNV A;  1J9I A;  4CHU A;  2R7U A;  3FBI B;  1W36 D;  1E2X A;  3HOS A;  1HW2 A;  2M9H A;  3VEP A;  4LK1 F;  2DU9 A;  1IAW A;  3G4S I;  1J0R A;  2ZME A;  5BMZ A;  2W00 A;  3L9F A;  3ZMS A;  2H8W A;  1RNL A;  1Y6I A;  2MD5 A;  1QVT A;  2Z1D A;  2M5W A;  3ZMU A;  4CCL A;  1WZ2 A;  1FMW A;  2COB A;  3B73 A;  2R92 J;  2LR8 A;  4EJU A;  1FX7 A;  4A3K J;  4LFU A;  2IS4 A;  2OQR A;  4L9V A;  3JRG A;  3H5N A;  2P7C B;  4KJZ A;  4QSH A;  1R5H A;  3R6S A;  3CCU I;  4GRI A;  4ZDO A;  4BUP A;  3P9K A;  4XOP A;  4CCO A;  3LQQ A;  4PUS A;  3LSR A;  1MMS A;  2Q2E A;  3HC7 A;  1OR7 C;  2HTJ A;  5KCM A;  2PMZ A;  2ZFW A;  3WU2 C;  1U5T A;  1EH6 A;  4KIS A;  2DOA A;  1TT0 A;  2RNJ A;  2EFO A;  3JTH A;  2VKE A;  3CME I;  4P55 A;  1FOX A;  3OYN A;  2ZXW H;  3DKW A;  2P6T A;  1Z1D A;  3FXM A;  2XF7 A;  3PSI A;  2GOM A;  4G6T B;  1KA8 A;  3BC8 A;  3HOX J;  1E3P A;  3KYD B;  4CZC A;  5LHI A;  2GXB A;  1Q1V A;  4IVN A;  3WTS C;  2KRH A;  4Z2Y A;  1SD6 A;  2KL4 A;  1VQ9 I;  1YFH A;  5FRN A;  1X1B A;  4Y15 A;  3H5A A;  1BW6 A;  1ZYR F;  2Y69 H;  2DA2 A;  3BPV A;  4PJ0 C;  4B1R A;  2KFD A;  4OU0 A;  1BOB A;  2JRT A;  2M4K A;  3MQ0 A;  2K4B A;  2F4O B;  3HSE A;  3SQN A;  1KQ9 A;  1GXQ A;  2E7X A;  3CUQ C;  1QZY A;  3BDD A;  4KA4 A;  1TBX A;  1GV5 A;  3I9V 2;  5IYC J;  4M72 A;  1X1P A;  1XCB A;  2VE8 A;  2XVC A;  4N9H A;  3K70 D;  4A3D J;  3MFK A;  1DPU A;  4P9U A;  2QEN A;  3C7J A;  1BR4 A;  1DPR A;  1IN7 A;  3BQY A;  5FKL A;  3TKY A;  5EF6 A;  1ZGW A;  1AWC A;  1XC5 A;  3K2Z A;  1TTY A;  2COM A;  1YQA A;  1KON A;  2F5D A;  2VC0 A;  2Q0O A;  4CYD A;  2XIG A;  3I4P A;  1HSJ A;  5J1U A;  5L3E A;  2JTV A;  3HOY J;  2IGN A;  4JX6 A;  3OS1 A;  3KET A;  2DXI A;  5KVR A;  1FNN A;  3L2U A;  2VON A;  2CQK A;  5AON A;  3WG7 H;  1T33 A;  1MBK A;  5HS8 A;  2IBD A;  3K6G A;  5LHG A;  3OIQ A;  3BOQ A;  2ID6 A;  3KEQ A;  5IYB J;  4AU7 A;  2DQL A;  1T98 A;  3ZQ7 A;  2HVQ A;  4RDU A;  3ZPL A;  3BTI A;  1ZAO A;  5BNG A;  4HPQ A;  4LG0 B;  2JJ7 A;  3RKX A;  1HKT A;  2P0W A;  1STZ A;  3CDI A;  1AA7 A;  2X6Y A;  4FCY A;  1LE8 B;  1MBE A;  2AXT C;  3MKL A;  2HZT A;  3K4J A;  3I59 B;  4EGZ A;  2H27 A;  3QYE A;  3M8E A;  5D5W B;  1YW7 A;  2DDA A;  3PFI A;  1WVR A;  1D1B A;  1X3Z B;  2XAS A;  1I5Z A;  1TLH B;  4BXX J;  4A3J J;  3O8G A;  1CF7 A;  4I09 A;  2M30 A;  3HRM A;  3OL3 A;  3L09 A;  3CP2 A;  2XAG A;  3D1N I;  1MBF A;  2QKM B;  3F22 A;  4N4N B;  2EZH A;  2G7U A;  1W5S A;  3UR3 C;  3CUQ B;  4JK1 X;  2PJP A;  2Y30 A;  3OSF A;  4RGS A;  2JQ7 A;  1RUO A;  2JA5 J;  3W6K B;  1MNE A;  2BHZ A;  4M6X A;  1K79 A;  2LDU A;  1W0T A;  1ZEL A;  2LYC A;  5CPR B;  1ETQ A;  3WU1 B;  5CQE A;  1WJB A;  3K69 A;  1X3U A;  3KP7 A;  3D5L A;  3H9Q A;  2AO9 A;  2F4M B;  3IUO A;  4BDY A;  4N4O B;  4Y4R A;  4BBR J;  5E1Z B;  1P9Q C;  2X1C A;  2G0E A;  1TWH J;  1YO5 C;  1U3E M;  3GME A;  4GFB A;  3W3C A;  1VFC A;  4XKC A;  2A5Y B;  1BC7 C;  2A6T A;  1I3Q J;  2BW3 A;  3U1K A;  3BZ6 A;  2L5Q A;  2MH9 A;  4A5M A;  2GA1 A;  5GPA A;  2RQQ A;  4UUV A;  3DEE A;  3H0D A;  2CW7 A;  1GHC A;  5L3C A;  1OR7 A;  1HBX G;  3O2P E;  1S9H A;  1ZKG A;  4F7Z A;  5DUI A;  5H2F C;  1LE8 A;  1R22 A;  3IH2 A;  1MDM B;  1R49 A;  2HEO A;  3K1P A;  1HST A;  1JGS A;  2ZXJ A;  2CUF A;  1OCZ H;  2QGU A;  4IHY A;  3D5R C;  4PJM A;  3CCM I;  2NNN A;  3IAM 2;  2VQH A;  3WGG A;  4I99 C;  4ZYG A;  3M7G A;  1OFC X;  2QQ8 A;  1WI9 A;  5EG0 A;  4LG3 A;  1IXS B;  3FXQ A;  4AIK A;  3RYP A;  2Z3Y A;  1JT0 A;  1ZRC A;  1P4W A;  2MAB A;  3HGG A;  2P5L C;  2LY9 A;  1S6L A;  2GLO A;  2FRH A;  1YIT I;  2KHM A;  2P5V A;  3CUQ A;  2D5V A;  1TW3 A;  2KPM A;  3B6A A;  1I1G A;  4E7I A;  3CC7 I;  2YX7 A;  2QZ8 A;  1KZH A;  2XRO A;  3LSJ A;  2FA5 A;  2KRC A;  2LG4 A;  3OYL A;  4P9F A;  1W36 C;  2L54 A;  1OYI A;  4BS9 A;  4UUS A;  3A4C A;  2GIV A;  4BAC A;  1ZTR A;  2XAQ A;  4G7Z F;  1I6H J;  4PFP A;  1Y39 A;  2DDB A;  1I27 A;  3GZ5 A;  2L9V A;  3HHG A;  3L00 A;  3FIS A;  2EA4 A;  4HQE A;  1LDJ A;  5J8F A;  2P6S A;  4K2E A;  4B4C A;  4H4K C;  4XLN F;  2ETH A;  2H6B A;  2R3S A;  2YU3 A;  3LAJ A;  2A07 F;  4BL0 B;  3UNG C;  2AS5 F;  3QOE A;  2DMU A;  2L3D A;  2JA7 J;  1MBG A;  1U2W A;  1IZ1 A;  4FET A;  3NEU A;  1WPK A;  4DYC A;  5D4S A;  3SDG A;  4B3A A;  2AXL A;  5HLI A;  1K78 A;  3S17 J;  3BPX A;  2E34 A;  1G4D A;  2EIN H;  3TOA A;  2LF8 A;  3H9G A;  1YW9 A;  1HDD C;  4DGW B;  5F1J A;  4HX8 A;  2E1M C;  4NC7 A;  2VUM J;  3KIO A;  5H20 A;  2NOJ B;  3CD6 I;  2RC4 A;  1NG7 A;  4O6J A;  2EQR A;  4ZTF A;  4W1U A;  3GFL A;  1ZRD A;  2VBW A;  3GTG J;  4BE2 A;  4HV6 A;  2AQE A;  4IQ4 A;  3BTC A;  3MKZ A;  4II2 A;  1JHH A;  4EEF G;  2OTJ I;  2LFB A;  3KX2 A;  1WJD A;  3FMR A;  3TW6 A;  1IG7 A;  3F0C A;  5E20 A;  5D5X B;  4AID A;  4RGU A;  5J4Y A;  3IRQ A;  2V1U A;  1JUM A;  4R79 A;  1MJ9 A;  4X1E A;  1GV2 A;  2AQF A;  1DU6 A;  3K70 C;  3WG9 A;  1BI3 A;  1VQO I;  1SFE A;  3ZQH A;  4UB6 C;  2IS2 A;  4RAG A;  1X2M A;  1YLF A;  1VQL I;  3EUA A;  2LSO A;  3EQL F;  2HKO A;  3CF5 F;  2CU7 A;  3OIO A;  4RM2 A;  2M7B A;  2NS7 A;  1JKQ C;  4UVC A;  5M5W J;  1ETO A;  2CS3 A;  2OZU A;  2AHQ A;  3RJP A;  4NQW A;  2OCC H;  2O8X A;  1EA3 A;  3SDB A;  1MMA A;  2OQG A;  1RI7 A;  3ONQ A;  3JAM K;  5D5U B;  2YUS A;  1UHW A;  1VQN I;  2DT5 A;  3OYG A;  4Y3O A;  1DP7 P;  2QLZ A;  3GWZ A;  3IWF A;  1BBY A;  4XN3 A;  4ZTJ A;  5IOZ A;  1HKS A;  2R7D A;  3DXJ F;  4U7B A;  2XC7 A;  2L2O A;  2DFF A;  1EKE A;  5GTI C;  2HQN A; 
#chains in the Genus database with same CATH homology
 1TP4 A;  1PVE A;  1QZE A;  2F4M B;  3ESW B;  2F4O B;  2QSG X;  1X3Z B;  4YIR X;  1X3W B;  1OQY A;  2QSH X;  2QSF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...