2F4MB

The mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
GHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords peptide N-glycanase
publication title Structure of the mouse peptide N-glycanase-HR23 complex suggests co-evolution of the endoplasmic reticulum-associated degradation and DNA repair pathways.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2f4mB00
2F4OB 1OQYA 1TP4A 1PVEA 4YIRX 1QZEA 1X3ZB 2F4MB 2QSGX 1X3WB 2QSHX 2QSFX 3ESWB
chains in the Genus database with same CATH superfamily
2HGCA 4XKVA 1MW7A 1XN7A 1APLC 4KISA 1QO0D 3ELKA 1BI2A 5DCMA 2OCCH 4UVBA 1FY7A 4LIVA 3MQ0A 3SHFA 4KYWA 1G59A 3HGYA 2DA1A 4ABZA 1T08B 1MDMB 2ZXHA 4IO9F 4F93B 2L9RA 3CUOA 1ON1A 4XN3A 3KEYA 3SEQA 2V6EA 1AHDP 3T0YA 4A6EA 4HEA2 5FKOA 2ETHA 2K9MA 5DD8A 4HSRA 4DYQA 1N78A 4D9JA 4ZTFA 3FXLA 2MD0A 4ZYAA 4IQ4A 1G6NA 4L9JA 4LFUA 3FXOA 3GO5A 2GQQA 4IHXA 3H9QA 4BBRJ 2N8GA 4ITVA 5BMZA 3HYIA 3I9V2 1BJZA 1R22A 2BGCA 4JOMA 3RKYA 4HLXA 2Y75A 1HBXG 2FJ1A 2TCTA 5FRNA 2DDAA 3JRFA 1RESA 1V3FA 2XAHA 2R92J 2E1NA 3KP3A 3ABMH 1KYZA 1TNTA 2OD5A 4V2GA 2AHQA 4HQEA 4BAYA 1P7IA 2CW7A 4I7HA 2VBXA 1SD6A 3VDXA 1T33A 1OLTA 4A3FJ 2QBYB 4MHGA 4HAMA 5IOYA 1U6GA 1I1SA 2FMYA 3PIPF 3FIWA 4G6DA 4CH7A 3GUDA 4M3EA 5L3CA 4NC8A 3GTLJ 4XSXF 3CD6I 3HRTA 2RAEA 1OCRH 1ENHA 2XPVA 3LSHA 3DEEA 3CMAI 3HHHA 3IC7A 3L2UA 2WB1N 2GBYA 4HOBA 1PP7U 1T0FC 2FSWA 2JPBA 3EUHA 4RB1A 1ETKA 2CW8A 1VQ4I 3RPUA 1MMAA 3QYBA 3LSPA 3PO3J 1BIAA 4BKXA 2W1OA 1JKPC 1Y8QB 1GXPA 1MGTA 1X4OA 2L0KA 4GXOA 1TWHJ 4KN4X 1KU2A 3P7NA 1X19A 1Z77A 4IHSA 3MCZA 2BE5F 1IN5A 4A5NA 2BVLA 2BV6A 1GVJA 2W85A 3QPTA 4NQWA 3MVPA 3OYJA 1TT0A 4EVIA 1XCVA 4BHCA 3ZMZA 3I55I 2E2JJ 2VOPA 1JI8A 2A61A 2B63J 1Z6TA 2NOJB 2ZSIB 4E7SA 2MD5A 2WY8Q 2F5EA 2DW4A 3RQ4A 1MMGA 4A3GJ 2WB1A 4EM2A 3VODA 4II3A 2Y9ZA 5HDGA 3F0CA 2VONA 5IP6A 2R7WA 3V8LA 4L9VA 3O6BB 5M3FJ 3KYDB 1LDDA 2DCEA 2O0YA 4NDLA 1MH3A 4I0AA 2GOMA 1O3SA 1H89C 2X9DA 5J1RA 3OYEA 2X51A 3HSEA 3SDGA 4IX7A 3ZCOA 2O6GE 3I54A 4I01A 4FASD 2XSDC 3H92A 1ON2A 2VI6A 3CQZJ 5ICFA 1BR2A 2CWEA 2DO7A 3Q0UA 1FMVA 2LBFA 4RGRA 5LRSA 4X0GA 3HOYJ 2XVCA 2ZSHB 2FXAA 4BBSJ 4MTEA 1YO5C 3Q3SA 1FIPA 5CYVA 1PYVA 4ZYHA 2KQRA 1LEAA 3I56I 2IBDA 2FF4A 2MFZA 1GUUA 4QPOA 1H0MA 4I76A 2L9SA 3V4GA 1U2WA 3BCBA 5HLIA 3RCOA 2W25A 3RSNA 1IC8A 1XG1A 2JA2A 3VYRB 2KL4A 4P1WA 1JHHA 1YOVB 1XMAA 5BOXA 2IXSA 2KDOA 3VEPA 2D5VA 4NB5A 2TDXA 4M73A 1WKMA 1XGMA 2JMWA 3PO2J 5FRMA 1O7LA 2H09A 5EGOA 4E7IA 1UG0A 2WA0A 2E71A 1Y39A 1LEBA 3LWFA 1WI3A 4EMSA 5IPAA 4KMUX 4KUMA 4BUPA 1KYWA 2QKMB 1IUFA 3K4JA 4C2TA 4CYCA 5FD5A 3J7ZI 2OV7A 3FXRA 3WTSC 2MSYA 3ECOA 3TO7A 3MD2A 3MN2A 5J4YA 5E1XA 5GPAA 3KCCA 3BY6A 4L18B 3ZQIA 3CMYA 2D2WA 3T5XA 3K69A 1IDYA 4HA8A 2FEZA 3L2QA 5FLXZ 5GP9A 1IV8A 2IGNA 5HS8A 3AKZA 4BEHA 2QM3A 4IXAA 2CUEA 1BM9A 3FHNA 1BC7C 2O9LA 1IV6A 2FA5A 5EEAA 2QQAA 1U5TC 5E8GA 3ZMSA 1S9HA 2DK5A 3QOEA 5J1UA 3LSIA 5AONA 4L0YB 5HNFA 1Z7LA 1F4KA 2CUZA 3OSGA 3G73A 3WGIA 3KE2A 2OBPA 1TQPA 2FNAA 3SFZA 4BQQA 1WQ2A 5M5XJ 4ESJA 4W1UA 4DZPA 4EV0A 3H5NA 1SFXA 2CU7A 2R5YA 3M8EA 1RC9A 3OYGA 3FMRA 4M9ZA 4ENNA 5E3NA 3RI4A 2KPMA 5L3FA 2ME0A 3F8BA 3BG3A 4FT8A 5DM6F 5E3LA 1I3QJ 3ROUA 1X1BA 5LHIA 2EFWA 1P6RA 1YE9A 2MLKA 1H9GA 4OWRB 3NEUA 2PMHA 3W6KB 4CUGA 3BOQA 1ETQA 3BTLA 3HOVJ 5JVTA 2BEOA 1P7JA 3IRQA 3KZZA 1MBFA 4CCJA 5CVIA 3U2RA 3LA7A 4PJMA 1R7JA 3AL0B 4D5FA 2XGEA 3IP4B 1OCOH 4PDKA 1LE8A 1FYLA 2V26A 4KFCA 4IQJA 4P9UA 1Z21A 5IYBJ 3K70D 3S2DJ 2K9QA 2LTPA 4FCYA 1A31A 2H6BA 1MMNA 2WWYA 3DTKA 4J19A 1FEXA 2K4JA 2JA5J 2NS7A 3BTCA 4OMYA 4ENJA 3ZR8X 1BW6A 1UCRA 4MEYF 3F6VA 2GA2A 5HOOA 2M87A 2F4OB 2AXTC 1YJ9I 3B6CA 5K7ZA 5CVVA 4FX0A 3TW6A 4JK1X 1VQMI 2OJED 2RC4A 1IJWC 2ELJA 2GIZA 5H6QA 1KA8A 1GHCA 4V19K 3HOZJ 2WAQN 1I5ZA 3RYRA 1NG6A 4ZYGA 1H9TA 3FMSA 5EF6A 2QQBA 4YRVA 1T8IA 1WH7A 1NHAA 4ZTJA 3GMEA 1Z05A 3SEZA 1TWFJ 4FHTA 2UV1A 3OY9A 1U78A 1Y6IA 1Y8RB 3U1KA 2B7EA 2PJRA 2A6EF 2FBHA 3ZXSA 2HXOA 1S7EA 2CQQA 3OMYA 1E17A 2PQ8A 3BTIA 1Q1HA 2F5DA 2XF7A 3DKWA 3H3VK 2D1HA 1RETA 2VXZA 5D4SA 2X1EA 4PGGA 2DMPA 1ZN2A 4PGHA 2H8RA 2HTJA 3L2VA 1VZ0A 2BHZA 3AAFA 1Z6RA 2ZC2A 2L7KA 3CJTB 2Q2EA 3ZMTA 2F5CA 3EPZA 2OAZA 4YFKF 3CCMI 2PMUA 4DZJA 4EJVA 4XRSA 2M2EA 2IGMA 3L1PA 3L7WA 2LDUA 3VFZA 1WWXA 4J00A 3HOSA 2P4WA 2LY1A 2IPQX 1SVLA 2NVQJ 1KONA 3HRUA 2J5OA 3P9IA 3H5RA 4G7HF 2L4AA 3HHGA 1S6LA 3SZPA 2JQ7A 3UR3C 2HFHA 2LVSA 2KKOA 3EQLF 4A3IJ 1ODDA 3BR5A 2DT6A 2CQXA 3WTZA 3JTGA 2R7ZJ 3EETA 5GAHJ 5E8IA 5CVUA 3J81Z 1ZQ3P 1ULYA 1VQPI 3C2HA 4D1QA 3FKIJ 2JA8J 1Y0NA 2NS8A 3M8JA 4JX5A 3C2BA 1ZG3A 1R6RA 3GCMA 2A05A 2L3DA 4OOIA 1RPWA 2HU9A 3KPHA 1W36D 3DEUA 2CYYA 1AKHB 3SXYA 4L5EA 3QYFA 1YX3A 4FISA 1DDNA 4AM3A 1TTYA 2HKXA 4OIOF 2KZVA 2H1LA 3CCLI 2RNGA 4XKWA 4AU7A 5HS7A 5FB2A 3ASNH 1D0YA 2E1OA 1RKTA 2XGDA 4M6YA 4RGSA 2FOKA 2PMZA 2QCOA 4Y52J 2BOLA 2HOAA 3H5AA 2VXDA 3HEFA 3S1QJ 3F8FA 4BHPA 4OU0A 4HX7A 3RJPA 5FFZA 1JGSA 3CESA 3LSMA 5JFRA 5LFAA 2IS1A 4B09A 2BXZA 2LRDA 2IS4A 2EZKA 3BG7A 3CCVI 4MFEA 5E18F 5BNGA 4IRGA 2K85A 1Z1DA 4CA0A 3P9KA 1WJAA 2ADUA 1V5FA 2EIJH 2DJIA 5LGTA 1KU9A 1JKQC 3GBGA 4PJJA 3N97A 3VWBA 3L00A 2LMDA 4O6JA 3OS2A 1KQ8A 3A1YA 5JR3A 1X3WB 4L5IA 3SZGA 5LGUA 4BJ5C 2EK5A 5TGTA 3WTVC 5M3MJ 3K10A 2ME6A 2Y0SN 5IOZA 3OL3A 4LK0F 2IS6A 1WCMJ 4JP0A 4WX9A 2CQNA 3O2PE 1ETXA 3J7AY 4BACA 2M4GA 2A6HF 2IGKA 3RQIA 1KQ9A 4EJOA 4HSTA 3CZ6A 1LVKA 3ZQHA 1B1BA 3F8MA 2PJPA 2ZCWA 4BE1A 1DGRM 2XGCA 3FXQA 3V42A 1VQ6I 3ESWB 4JYKA 2M30A 3OYHA 3GFLA 3A2KA 4F91B 3V7RA 1P4XA 2YPRA 4E7ZA 2HZDA 1BL0A 4KMFA 2KISA 1NG7A 2X1DA 5E1ZB 2Y0SA 3ZN0A 1WHUA 2R5ZB 3T8RA 3KIOA 2QF7A 2BW3B 2J5PA 2QSFX 1K4TA 2XRNA 5DEQA 1B9MA 3RPUD 1U3EM 1KQ0A 2NOGA 1D1BA 5J47A 5L3BA 1NTCA 5FLVA 2DMUA 2R7QA 2HOSA 3A01A 2DDBA 5B1AH 2FE3A 3S2HJ 2P8TA 2LKSA 2Z3YA 4M71A 4G9YA 2STWA 5L3GA 4DGWB 5EJCA 5HNHA 5C4JJ 1UHMA 1FSEA 5KAFC 3DEWA 2DPDA 2JUGA 5D6EA 2ACJA 4DYRA 2HYFA 4DW6A 1MJBA 3OS0A 4M9SA 3C18A 1R4NB 5F6FA 1G3SA 1IW7F 1PDNC 1VF9A 2STTA 1B72A 1OKRA 2P81A 1K7AA 2R7OA 3ERED 1R71A 4I2OA 4ZDLA 4HQMA 1HCRA 3GX4X 3MEXA 2ISZA 3J7YJ 1FYMA 1TNSA 1QPIA 4C2MJ 1SC7A 2DFFA 4XIDA 3BWGA 1N25A 2BHYA 2M45A 3K4LA 4M3FA 2M34A 3FM3A 3V7CA 1SFEA 5FJ8J 3E6DA 4FE4A 4BJ6C 3JSPA 2UUZA 1G3TA 2P5VA 2K4BA 2VJ4A 3TEDA 1D0XA 2NYXA 4RAZA 2JVGA 2ZFUA 2F2EA 3LAJA 2KLOA 1S8NA 2KMUA 2E35A 4BE0A 3FXMA 1U8RA 2WV0A 4C3IJ 2QSHX 1TW2A 5EG0A 2UWMA 2B0LA 2DJNA 3QPHA 3I4NJ 4RB2C 2O03A 2DYSH 3ZQCA 3S32A 1LFBA 1H88C 4Q5SF 2K40A 1ZHFA 1USTA 1W0UA 3GEZA 2EQRA 3H3UA 2L01A 2VBWA 1VQOI 2GXBA 1R58A 3LA3A 4H0EA 2JVHA 1VQKI 4XR6A 2CG4A 1ACIA 3E6CC 3G1LA 2JSCA 2OUMA 3G3ZA 2ZFWA 4OINF 4XBFA 3ULQB 4AVZA 4CXFA 3K1PA 5EZGA 4HYEA 3TO6A 1XSVA 1KU7A 4F55A 3H35A 1F43A 3LSGA 3PJRA 1TZLA 4B1RA 4K2EA 1ZRDA 3DBHB 4RB0A 5DD4A 4AYBN 1VTNC 2MGQA 2IGOA 4RAGA 1W1WE 2A68F 1OISA 1GV2A 1SFOJ 3TP3A 2JTVA 4A3BJ 4RA2A 4LG0B 3HIFA 2EJRA 4ETSA 2E36A 1K78A 3R0JA 1I6HJ 1OYYA 1XDSA 6PAXA 1BI0A 5EYRA 3RZOJ 3IH2A 5DCMB 1IN8A 4XOTA 3NQOA 2PBIA 1QZEA 2R4GA 4IF4A 4G12A 1IN6A 2X1CA 2FQ4A 1R1UA 1F5TA 2EZLA 4XRMA 1OCZH 4UV9A 4KIGA 4YFNF 3SJMA 2FNPA 1R5HA 4LB6B 1R23A 3LFKA 2NVTJ 1BC8C 2IP2A 4V2FA 3EUKL 1N77A 3J7AO 4NNJA 3PUBA 3ECHA 1VI0A 4KJZA 4MGRA 3S2WA 3T1BA 3MZ8A 1EV7A 2XAFA 3I64A 4YG2F 3L2WA 2Z99A 4N4NB 3MAJA 2DN0A 2HI3A 1VQ8I 2OZ6A 1FNNA 1ZYRF 4GYGA 1YX5A 4OIRF 4EEFG 1PJRA 4ESBA 3DTIA 3PUFA 3W3CA 2L4MA 3SQNA 4F3QA 2OU2A 4S0HB 1ZG1A 1E3PA 2LH9A 2XB5A 1GVDA 5IYCJ 3A02A 4J01A 2HDCA 1VQ9I 5HS9A 2L2OA 4HLYA 1QBJA 2HTSA 3MFKA 2DT5A 2O3FA 4HBLA 2YU9J 1RI7A 1BR1A 1JXSA 3ZMVA 1HC8A 5LHHA 3DPUA 3E1SA 4P9FA 4UVCA 2X6XA 2JN6A 4B47A 4DIQA 1NK3P 3I59A 4HF0A 2LD5A 1ITYA 1W7PA 4UUVA 2LK2A 2VE9A 1QU3A 3WE2A 2NVYJ 4HX8A 4RM2A 5HLHA 3VYTB 2ZJQF 2CMPA 2P5LC 1HW2A 3AFHA 5A2QZ 2W57A 3OYNA 1OJLA 4AUXA 1U9NA 2XB0X 2WV1A 1YS7A 2CW0F 4M3DA 4NQWB 4BDZA 4AIJA 2DTZA 2EFPA 1JT0A 1R5ID 1K6OA 4JX6A 4CDGA 4HPQA 1OYWA 4IKFA 1PUFA 1Y1WJ 3F8CA 3B02A 1ZTRA 3M1EA 1IXCA 5CJ9A 3G1MA 2EA4A 3K0LA 4B3AA 2JA6J 3FWEA 3RKXA 4EJTA 1ETVA 1E3OC 2ZNZA 3BJAA 2L5QA 2R0QC 4XM3A 2K27A 2R7RA 1IZ1A 4HW0A 3IAS2 1HKSA 4XLCA 5HLGA 2QQ8A 2Y69H 1TWGJ 3L9FA 5E3OA 9ANTA 2RREA 1LVAA 1XD7A 2QQ9A 3TP0A 1XC5A 5LLQA 4U7BA 4A3JJ 4UVAA 3CTAA 2LBFB 4U0YA 4IL6C 2P7CB 1DU6A 3L09A 2IAIA 4AC0A 4CO8A 3CCUI 4GRIA 4CICA 2VPLA 5ILVA 2Z33A 2W00A 3BR1A 1RZ4A 2LREA 3ABLH 5J40A 1GLNA 1X1PA 2AQFA 1YLFA 2KP6A 3X2QH 4AIDA 4ENMA 3HG9A 3TKYA 3KYCB 3M07A 1MMDA 5FD6A 3JRBA 3QP5A 2YX7A 3ZMDA 3CDIA 1JUPA 4FX4A 3M7GA 2VB6A 3GFIA 2H27A 1QRYA 3CO6C 1HKTA 1TQMA 2K02A 3D5RC 2MA3A 5C4XJ 3DTEA 1WGXA 3FISA 5EGOB 1S3JA 1W0TA 1FPQA 3B6AA 5E1WA 2G0EA 3K1MA 3S17J 1UB9A 2E1CA 1E3HA 4Z2YA 3CCSI 1X3ZB 2ID3A 2DA5A 1F9NA 1A36A 2OTLI 1I50J 1VFCA 1N75A 4C2UA 2DQRA 2W7NA 4CYCB 2R7VA 4A0XA 2PLYA 1T0FA 1SEUA 2KHMA 1HDPA 4BS9A 2P5KA 2A5YB 2EZHA 3LNQA 4M3BA 4ZDPA 3FBIB 3J80K 3KLOA 3SYTA 4YIFA 1ZRFA 4UNOA 2KJBA 3GF2A 3LSKA 2Z1DA 1UHSA 4S05A 3BG9A 1YQAA 2E7WA 4BEHB 1IAWA 2HQAA 2BY2A 1E0EA 1G8XA 2P0WA 3U9GA 5E79C 3G4SI 4CCNA 4CZCA 1XX5A 3OYAA 3CO7C 2XDVA 3DLLF 3ZQLA 3TQNA 3OYFA 4E7LA 5D8KB 3E6MA 3AG2H 1SVMA 4E6KG 1G2HA 2V1DA 2NXNB 4KITB 4JQFA 4R79A 1XDUA 5BPDA 5CKTA 1OR7C 3FHZA 2HEOA 5DUKA 1FX7A 1S7AA 1PUEE 4A3DJ 1MNDA 2QZ8A 4ZZLA 4UY8I 2R5YB 2WC2A 2CH0A 4MQVA 1JTYA 2E34A 1D3YA 1SFKA 1SVOA 1ZR4A 1BA5A 2YS9A 1K61A 3GTKJ 3CLQA 1ZK8A 3A4CA 1GV5A 2MYSA 1YW7A 4D7MA 2R93J 3ABUA 2LSOA 4XONA 1W4MA 3C3WA 2BVMA 1D5YA 2Z9OA 3HPHA 2DTRA 3GXOA 5HODA 2CO5A 3MKWB 3W2AA 2OTJI 3CCYA 1K79A 4BGDA 2MLGA 4I0BA 1VQ5I 2IRFG 3RYPA 2EIMH 3G71I 1WSUA 2M3AA 1R1VA 1YJWI 3QPLA 1X3UA 2E2HJ 1J5YA 2A3SA 3OYMA 4IZZA 1LE8B 2CQ7A 3WU0A 3BPXA 3E7LA 1TC3C 4A0YA 1J0RA 1JE8A 2RV8A 4UHTA 4QLCU 4KN7X 2JZYA 3HRSA 4O3MA 1KU3A 3OS1A 1JGGA 2MABA 4BJTA 5IP9J 3WTUC 1IG7A 1WJ5A 2V1NA 3I3LA 3HSRA 1V55H 1HA8A 1X58A 5DYMA 3QRFF 4G8XA 5FKNA 3BJ6A 4PFOA 2KIFA 2XIGA 1JKOC 1WFXA 4BH9A 2P6TA 4A69C 3EYIA 5EEGA 3LOCA 2ESNA 4GO1A 2L7FP 3HTUA 2FRHA 2IA1A 1RNLA 5B66C 1ZRCA 3CUQC 4AIHA 4BQNA 2JK3A 2COBA 2H6CA 4CYDA 5L3DA 5ILUA 4DQ2A 3M3YJ 3HTSB 4LK1F 1EA3A 4GFBA 3N05A 1U8BA 5FFXA 2EPFA 2EILH 2PJRB 2E19A 2GWRA 2R7DA 5M5WJ 2VC1A 2DFHA 2X6OA 3JCUC 1U5TA 4EM1A 2UZKA 2LR8A 3CCRI 1YW9A 2WAQA 5LBQA 5F0CA 4AIKA 2E60A 1HXDA 3LL7A 1TP4A 2DYRH 2BZTA 4ASNA 1MSFC 4A2UA 3H1CA 2V9PA 4E7JA 3A0BC 3E5XA 3W2VA 1R9TJ 3KP6A 2M5WA 5DUIA 1OR7A 4LLGF 1NK2P 3F8NA 1JJ6C 1O3TA 3S15J 1BBYA 1TL8A 4P55A 2G9WA 4G7OF 2BY3A 3E97A 3HUGA 3WODF 4BXUA 1YI2I 3K70C 4OIPF 2Q2EB 3DU6A 4XKCA 3OV8A 1I27A 2KFDA 3CDLA 1WJBA 3FX3A 4U87A 3HDDA 4OMZA 3CF5F 3SDBA 3FK7A 2R7XA 2LY9A 1MJ9A 3S1RJ 1JUSA 3Q9SA 2XROA 5K5QA 1FOYA 3ONQA 1T98A 2MW8A 3C7JA 4BNCA 1RR7A 3IL2A 1FZPB 4BY1J 1R5GA 3DWLE 2XF6A 5LRRA 1FBQA 1FBUA 1P2FA 2F5VA 3DBLB 3TDUC 2DK8A 2I10A 2RQPA 2VQCA 2YUSA 2JT1A 4E7KA 1MNMC 4S04A 4KT6A 2NVXJ 2VL8A 4UUSA 3E0JB 4ZZDA 4I09A 4UXNA 4I6ZA 2DOFA 4L0ZB 3IWFA 3T8TA 4RMNA 4ESFA 2KJCA 3ABKH 4IHYA 1R00A 2EV0A 3JRDA 3OR2C 2CJJA 3GZ6A 1V5GA 1FMWA 1OYIA 3W2WA 3TDZC 2L7MP 3CC2I 3BLYA 3V8KA 5FLXK 2LYCA 3DCFA 2XGXA 5BQTA 4B43A 5FLMJ 3Q0VA 2HXIA 4DNCA 3LA2A 2VUMJ 4LMYA 3PNTA 4A3KJ 2XAGA 5GAEJ 1XGNA 1XSXA 1NH3A 3BT9A 3HGGA 3CUQA 2F6CA 1KGSA 5FO5A 2Y31A 3D5LA 1LQ1A 4RGUA 3BZCA 1GXQA 4XLEA 2DA4A 1LKXA 1F1ZA 3IV5A 4Z6YA 2LY2A 4MLOA 1OMIA 2Y30A 1ZH5A 1R36A 1ZGAA 2HS5A 2MH2A 1WJFA 2OQRA 2VQLA 5H20A 1YFHA 4E4HA 1RUOA 3K4KA 3HB9A 4FETA 2DI3A 3PQJA 2RGVA 2M7AA 2ZMEC 3PFIA 4I98B 3PIOF 3GTPJ 4OAZA 2WTEA 3PL8A 3HOTA 2DOAA 5LHGA 1IXRC 4H4KC 5D5VB 2FMLA 3RZDJ 1FWZA 1B6AA 1E2XA 1QZYA 2W48A 3BQZA 5D8LB 5IT9K 5KAIC 2XAQA 1ZELA 4C3HJ 1EH7A 1XCBA 4IPAA 1DPRA 3ASOH 3GTMJ 3DP7A 2XKOA 1I6XA 1FOWA 1TQIA 2VT3A 2WAFA 1YRNA 2XHKA 4U0VA 1OQYA 2COMA 5GPCA 4Y15A 5BPIA 2JRMA 1RRJA 1S5LC 3QPSA 5H6RA 2VODA 2DXIA 2VPRA 4HG2A 2KIQA 3TO9A 5FROA 4LOCA 4HDVA 1XPXA 2O7OA 1YJNI 3CF2A 2QENA 1XMXA 1T56A 1HW1A 2P7VB 2QGUA 3FXJA 3CCEI 3TOAA 1AWCA 2K9LA 4I99C 3BPVA 2W24A 2RQQA 3DF8A 1B8IA 1HDDC 4X6AJ 2K86A 4DBQA 3OOUA 2HR3A 2XPUA 1J59A 1G3WA 1W7PD 1X1AA 2YSRA 3KEOA 2G7UA 4YFXF 3QWLA 5KHDA 4ON0A 2K3FA 5LEJA 4EJWA 1D5VA 2EH3A 1DP3A 3IH3A 3MKLA 3KEQA 2GIVA 2MC4A 3A01B 4IJAA 3KP7A 4R1HA 1K6YA 1R4MB 2DMTA 3DBRB 5J6XA 5LD2C 2HVSA 1I1GA 5GTIC 1HLVA 2MH9A 3VSLA 2V9VA 5LGNA 2AQEA 2HPMA 2EFQA 4XSZF 4X1EA 5CQGA 2ZJRF 5J3LA 2W82A 4KA4A 1B72B 2BBYA 3EUAA 1QZZA 4MTDA 3V8JA 2R7TA 5IP7J 4QPQA 3G2BA 3K2ZA 3REOA 5C3EJ 3OYBA 3IWZA 3W6VA 2CV2A 4GDFA 1UG2A 2DA6A 2NAZA 1EKEA 2V79A 2X0LA 4XOPA 5HDKA 2G7HA 2V1XA 5HLTA 3GTJJ 2WBMA 2QVOA 3WTYC 1QVUA 1CF7A 3GTGJ 1Z3YA 2FQ3A 4XRSG 3KLNA 1LDJA 4XLPF 1EF4A 3IHUA 2M8GX 1DP7P 1DU0A 3DQVC 2LFBA 2VT2A 2RNJA 3Q9VA 1O7FA 2DA2A 4UV8A 4UB6C 4IVNA 5H2FC 1IF1A 2HWVA 5EG0B 2OQGA 1T95A 3AG1H 3ERMA 1QA6A 2FBIA 2ZMEA 4WCGA 2XUBA 1MMSA 4EQQA 2IS2A 1MD0A 1WPKA 4D7NA 2XC7A 1R1TA 4KT5C 1FC3A 1W5TA 3QOPA 4F7ZA 1J9IA 5AIQA 3M8FA 4NUBA 3OWTA 2ZXJA 3C1DA 3BZKA 3EUHC 3LSJA 1JKRC 1DPUA 1Z9CA 2H94A 4ANJA 3ZQFA 2NVUB 2IEKA 3KP2A 5DS9A 3P5JA 1AOYA 5JHFA 3OIOA 4M6VA 5JLXA 3IH4A 2L54A 3DPTA 1ZAOA 2E7XA 1U0JA 3SFIA 2X6WA 3BR3A 1LB2A 2RKHA 5F04A 3I53A 2EB7A 3FZVA 5K1YA 1UMQA 3IAM2 4LLNA 2ID6A 4YEJA 1P4WA 5FKMA 1MKMA 2VQGA 2DA3A 2BY1A 1XGSA 2Z2SB 3QP6A 4KICA 4A0ZA 4U7DA 1ZKGA 1J7KA 3I5UA 4XN0A 3MZHA 1P92A 1TT5B 1X4PA 1K78B 1QQIA 3DLAA 2CS3A 4XICA 2HDDA 3CMEI 2M7BA 4YELA 1CGPA 3BG5A 3WTTC 2K9SA 3J80Z 4WWCA 4AYBA 3OYCA 3ZOBA 3W6JB 3S3MA 2V1UA 1U9OA 3ZN1A 4CCOA 4PCQA 5AIPA 4LITA 5FKKA 5F0HA 1J75A 2PI0A 2HZTA 1ORKA 2M4KA 1ERDA 2F4MB 1TWCJ 1MDMA 5K5OA 3JSOA 2O5RA 2V7FA 3GFMA 3WG7H 3S14J 2FU4A 3GWZA 3K4BA 5TISC 1TLHB 4CHUA 4FQGA 1YW8A 3TW7A 2M0MA 3ZGKA 2K9NA 1PP8F 4BE2A 3FMQA 3NWSA 1VQNI 2Q1ZB 2ZXIA 3I0TA 1HF0A 3LSRA 2XSJC 3LAPA 4HF1A 4IHVA 1S7OA 4DJAA 2VJ5A 4BHBA 3GVAA 3K7AJ 2DU9A 3MMYB 2DAOA 3KX2A 5ICEA 2GXAA 1V5EA 4HNVA 5TRDA 4AD9A 4CSWA 2QUFA 2K3PA 1T6SA 3TL4X 3F6OA 3VYSB 4DYCA 2QLZA 1FYKA 4E7HA 3JAMK 3S3OA 1BI1A 2L9VA 3CP2A 3JRCA 1B59A 2HQRA 3K6GA 3DV8A 1G4DA 3VB2A 3E3VA 4D0PA 2KRCA 3HJEA 1X1CA 3HM5A 2QBYA 3JTHA 2AXLA 3JREA 2XRLA 2E1MB 2A69F 1QHGA 5ICCA 3R61A 2RVCA 2R7SA 1IRXA 3V7SA 3O3KA 1FSHA 3I59B 2XAJA 5ED4A 1IRFA 4WXDA 4D5CA 1W7PB 2P6SA 4B3XA 1MBJA 1XTAA 5DCFA 4AWXB 1SMYF 4HV6A 5BS6A 1D0ZA 3KFWX 4BYYA 3NARA 1ONVA 4F52A 2A5WA 4I02A 1UJ8A 2V4JC 2LKXA 4IHTA 3RTRA 2VBYA 3HPGA 3PNVA 2M9HA 5J8CA 3HSFA 4MIMA 1D8JA 2F5FA 3QODA 1WRJA 1PUFB 2QEXI 4L5JA 3D0SA 3F3XA 3HOXJ 2Y0MA 2FUG2 2OCEA 4IOCF 3R4KA 1MBHA 3R60A 1ETWA 2GOXB 4HZFA 3FBNB 2DMQA 3PQKA 3D5SC 2MG4A 3H0DA 4ZYDA 4A3CJ 1VNDA 3WG9A 3EDPA 4TV7A 1UHWA 3HZJA 1STZA 3BDDA 2DFEA 4A3MJ 3IKTA 4UB8C 3WE3A 1SFUA 2QA4I 4LB5A 2Z5UA 2ZJ2A 4RM3A 4Q48A 1Y0UA 4QWQA 1FLIA 3I4PA 3HOUJ 2ELKA 3BC8A 3BTJA 4BL0B 1RIOH 3BCAA 1UELB 2OF7A 1XMKA 4EM0B 4WK8F 2BXYA 1TWAJ 3DXJF 1JUMA 2ELHA 1P9QC 2O8XA 5M5YJ 2VJJA 4B44A 5IY5H 1O4XA 1LNWA 1REPC 3KETA 1USSA 2QYOA 5FGMA 2VKDA 2XF5A 4OAYA 4RBOA 5D5WB 1R49A 3AL0C 3TOBA 4KIFA 4N9HA 3BR0A 2PFBA 3MKZA 3S3NA 3HKZN 5F64A 3CC4I 2DT7B 3HXLA 3WHCA 3CJNA 2DBBA 1S72I 3F72A 2MC3A 5CQEA 2VOOA 4XRFA 2ZBKA 1ZARA 2K5CA 2PN6A 3H9JA 4HRIA 3IRRA 1UZCA 3CJRB 3U1DA 2X6YA 1SAUA 2GM4A 2FOWA 3QAHA 1KZHA 5F0FA 1Y56A 4L9TA 2M0CA 3OYDA 4U88A 4PSXA 4B8XA 2LKPA 1HSTA 1A04A 4AVPA 3H36A 4Y3OA 3QU6A 4IRIA 3RKQA 4CGZA 2IT0A 3PSIA 5JLWA 3HKZA 2IVMA 3R0AA 4XORA 3WGHA 3CCJI 3I4MJ 1IO2A 2UXNA 3HBLA 1DUXC 1A35A 4C3JJ 2VE8A 3K1NA 4PK4A 2PEXA 1BOBA 4FE7A 1MBGA 2EV6A 5HDNA 3GLLA 1MSEC 2ESHA 2VKEA 1QGPA 3VYUB 4BDYA 1O57A 2DLLA 2RDPA 1PVEA 3S93A 5DM7F 2Y9YA 1JHFA 2HYGD 1Z91A 5ILSA 2GA1A 1TW3A 4XLHA 4XMYA 1ZREA 1WVRA 2NNYA 2L9NA 4A3EJ 2K7LA 1IXSB 2ECCA 1OCTC 4Q4ZF 1ZLKA 2QWWA 5GAGJ 2EZIA 1X2MA 5CVRA 2XKPA 4IRHA 2DPUA 3M1CA 4BU2A 2HVRA 4PJ0C 4XLFA 2AS5F 2HPIA 2GXGA 3QU3A 2ZNYA 4MFDA 2E2IJ 3OIQA 1V54H 4ZYEA 5K7FA 2H8WA 4M74A 4XLNF 3DPLC 3FXKA 5J1YA 4LG3A 2OA4A 1W5SA 1WJCA 1LFPA 3S1MJ 3B73A 3OIPA 5CVJA 1X2NA 3OR1C 2O8KA 1FP2A 2Y48A 2BYVE 1JJ8C 4BQAA 2KRHA 4KDPA 4EATA 2DOEA 3R6SA 5F1JA 2CGPA 1WI9A 1Y1VJ 2KIUA 4HX4A 1RUNA 4HNUA 1YS6A 4DOZA 3CDHA 4A93J 2NNNA 3E6BA 2EFOA 2IA0A 2R7UA 2CV0A 4PUSA 4ZC3A 4RS8A 2TRTA 3ZP5A 3JRHA 4L9NA 1XS9A 2JPCA 1QVTA 1A6QA 2HKOA 4LJZF 2BY0A 2Z16A 1OCCH 4CCKA 2VC0A 1FP1D 3CCQI 5IT9Z 2R7FA 5J4VA 3HC7A 3CMMA 3Q0WA 4M3GA 4A12A 1JTXA 5E17F 4LIUA 2FD5A 2PG4A 5D6FA 1SAXA 3LQRA 3L2RA 2ZXWH 2X85A 5D5UB 4PFPA 1XB4A 4N4OB 3IUOA 4IOAF 1V4RA 1J09A 1O3QA 3JW4A 5A2QK 3HOWJ 4M9XA 3S8PA 4LLLA 5DTDA 1C0WA 3E5QA 1WJDA 3BJOA 1OFCX 2KT0A 3KZIC 4U0WA 5B5EC 3FM5A 3CP8A 3O8HA 1FOKA 4IEJA 5ICGA 1LPQA 2JJ7A 3H0GJ 4HNTA 3H3ZA 1YHQI 1K4SA 3I58A 2XPWA 1S29A 2VLAA 3QYEA 3OYIA 3JRGA 2NRAC 2EBIA 4UUTA 3A03A 4M6XA 2I8DA 2M1BA 2XASA 1T39A 5FKLA 1D1AA 4F92B 1J2XA 2YU3A 3S1NJ 3ABTA 4RLQA 1HOMA 1SANA 5CPRB 4HDUA 1Z67A 5LEKA 4BXFA 3GZ5A 4XKBA 1U5TB 1ETYA 1EJ9A 2X4HA 4NBQA 1GT0C 4PJNA 4A3LJ 4MO7A 1Z0XA 4CZZA 1MBKA 5IT3A 5EZHA 5KNLA 2ICWG 4MQ9F 1XSDA 1IN7A 1YITI 3K2AA 2HOTA 2MBFA 3LMMA 4XK4A 4NC7A 3DFGA 2E5ZA 2EFNA 3BQYA 1OCPA 3OOPA 4II2A 4Y7NJ 1P4AA 2EINH 2A07F 1W5CC 2LG4A 3HUGB 1IRZA 1Z7UA 1LJ9A 3BG6A 3TMOA 4B48A 3FF5A 3F23A 2LNBA 3GTQJ 4XNFA 2AO9A 2EIKH 2CFOA 5GADJ 1B9NA 2L7ZA 3H9GA 2VIXA 2ISYA 2XAUA 3KZYA 1ZR2A 3G1OA 4P5OA 4A5MA 1H8AC 1IRGA 2JSPA 1D8KA 2H1KA 3K4NA 4RAFA 1GDTA 5K5RA 4R8HA 4ZH4F 4EGYA 1MNEA 5KK1A 1SMTA 4GGGA 4PZJA 1BW5A 2HQ5A 2VQHA 3CC7I 1SD7A 2VJIA 3AG4H 1T38A 5C44J 2M8EA 2DMNA 1WZ2A 3I71A 1DGWY 1B4AA 2A6TA 5F1RA 4Y4RA 4WXHA 4UUSB 1SD4A 4DBRA 4XL9A 3RDIA 3MKYB 4BQOA 3BP8A 2HYJA 2DQLA 1IUYA 1AU7A 3JR9A 5GTHC 3LFUA 2E5NA 4KIBA 1RKWA 2CRGA 4N0BA 2VBZA 1G3YA 1FOXA 2JRTA 1BI3A 3ZPLA 1IN4A 4WXCA 4PSWA 4EJUA 1DQUA 2ZKZA 4Q47A 2JWTA 1LDKB 3LQQA 3PSFA 1FTZA 2C6YA 4NHJA 3OSFA 2HNHA 2PMZN 1POGA 3VSKA 3PNYA 1IDZA 3F22A 1EH8A 5CLSA 2ZB9A 1MZBA 1ZG5A 3DKXA 1AKHA 2F4IA 5JI6A 4YIRX 4MEXF 1I39A 4OIQF 2W84A 3ZQQA 2V9KA 3CUQB 2LP0A 3JRIA 1D1CA 3CLOA 4KNYA 3PFYA 2CSOA 3QQAA 1QNTA 3WHBA 3GW2A 4PJLA 1HQCA 3CJQB 5F08A 3KP4A 2FBKA 3ZQ7A 3WU2C 1Z3XA 2QSGX 1L0OC 2CQKA 3ZQGA 1ZGWA 1WH5A 2LOOA 1BJAA 3WU1B 1ZLJA 3UKGA 2WAEA 4GCVA 3M4OJ 2I5UA 2Y2ZA 1BOAA 1HW5A 3BROA 3ZRGA 4RB3C 3ISPA 4RDUA 3VPRA 5L3EA 2GAUA 1A5JA 4WF2A 1ZGJA 1F36A 3DKYA 2X48A 3E5UA 5IYDJ 4BY7J 1K83J 2LF7A 1LFUP 4RLFA 1FIAA 3BR2A 3FK6A 1QPMA 1YRNB 5D5XB 4IHWA 3COAC 2KRFA 3GFJA 1UAAA 1ETOA 1FT9A 4G6QA 5B3SH 4A6DA 3JAMZ 1I3AA 4CCLA 5KVRA 4Y33A 3JRAA 3KYLA 1YTYA 1W36C 3ML6A 1QHHD 4ENKA 2CFXA 4P96A 3GTOJ 2DODA 3Q5FA 3K9TA 1L3LA 5DV5A 4HF2A 1X1DA 4G94A 3RKWA 1TBXA 1MJAA 3F9KA 1B8IB 2JUCA 3S16J 2B9SA 3WGGA 3OYKA 2WY7Q 3L2CA 4W97A 3OL4A 3TGNA 5EEHA 2R5ZA 2UXXA 3MWMA 2BW3A 2HVQA 3LSTA 2DA7A 2L02A 2KIMA 2EV5A 2CV1A 2EA2A 1RR8C 3K4CA 2R3SA 4Y17A 4QTRA 3BR6A 3C2GA 3G6EI 2JA7J 3NWTA 4N9IA 5ERIA 1IGNA 2YX4A 3N4MA 5EDNA 2OPTA 3BZ6A 2Q0OA 2XV4S 1VQLI 2OC6A 2OZUA 5DDGA 5HVQC 4YIIA 1YG2A 5D4RA 1O3RA 3FXUA 4Y13A 2VKVA 4CCMA 1VQ7I 4JBAA 2F48A 3WTWC 1BIBA 3FKJA 4JX4A 2KDZA 4B4CA 3NRVA 3FDYA 1FJLA 2HQNA 2VKHA 2GZWA 3GLXA 3NAUA 3VOEA 2Q8KA 3TBIA 4BXXJ 3ZMUA 2PX9A 4MNUA 1CF7B 2HDWA 2QKLB 1CQTA 1M1EB 1FTTA 1A6IA 2FX0A 5JVGF 1OPCA 2CUFA 3GZNB 4G6TB 4EGZA 2HOEA 5B1BH 4ZDOA 1MH4A 5E20A 1UFMA 1AA7A 4FTHA 2VN2A 2V6CA 2EWNA 5KCMA 2LC2A 3RIRA 3K4MA 2ZMEB 1YIOA 4RAYA 2IJLA 4RGXA 2D45A 2CUJA 4E70A 2KZGA 2E1MC 3DU5A 4XLAA 1MIJA 1LUJB 4LGWA 2LLKA 1BN5A 3AG3H 3MZYA 3SZTA 5J8FA 3GYHX 3KP5A 3UNGC 3OYLA 2ZO4A 1FBSA 3IKVA 3A0HC 2IA2A 2DFIA 4HV5A 1HKQA 2O61A 3J81K 4QSHA 1YIJI 2D1VA 3HRMA 4ZJZA 3M9AA 1WJEA 1HSJA 1XGOA 5E3MA 3D1NI 1Q1VA 4QIWN 3P9CA 2VASA 2ECBA 3EYYA 1T2KA 4C30A 1SD5A 4O5VA 1JT6A 2ZJPF 4G7ZF 4XQFA 1EH6A 2NS0A 2RN7A 3WTXC 3O8GA 3RPQA 4C9YA 2IW5A 2WADA 5JHUA 5K7HA 3U21A 4M72A 1MBEA 2GLOA 1BR4A 2W4SA 2LF8A 4LD5A 3PM1A 3HL2A 2YR2A 4LG0A 4GYIA 4NC6A 5F27A 1YYVA 3F21A 5TJJA
chains in the Genus database with same CATH topology
2F4OB 1OQYA 1TP4A 1PVEA 4YIRX 1QZEA 1X3ZB 2F4MB 2QSGX 1X3WB 2QSHX 2QSFX 3ESWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4O B;  1OQY A;  1TP4 A;  1PVE A;  4YIR X;  1QZE A;  1X3Z B;  2F4M B;  2QSG X;  1X3W B;  2QSH X;  2QSF X;  3ESW B; 
#chains in the Genus database with same CATH topology
 2HGC A;  4XKV A;  1MW7 A;  1XN7 A;  1APL C;  4KIS A;  1QO0 D;  3ELK A;  1BI2 A;  5DCM A;  2OCC H;  4UVB A;  1FY7 A;  4LIV A;  3MQ0 A;  3SHF A;  4KYW A;  1G59 A;  3HGY A;  2DA1 A;  4ABZ A;  1T08 B;  1MDM B;  2ZXH A;  4IO9 F;  4F93 B;  2L9R A;  3CUO A;  1ON1 A;  4XN3 A;  3KEY A;  3SEQ A;  2V6E A;  1AHD P;  3T0Y A;  4A6E A;  4HEA 2;  5FKO A;  2ETH A;  2K9M A;  5DD8 A;  4HSR A;  4DYQ A;  1N78 A;  4D9J A;  4ZTF A;  3FXL A;  2MD0 A;  4ZYA A;  4IQ4 A;  1G6N A;  4L9J A;  4LFU A;  3FXO A;  3GO5 A;  2GQQ A;  4IHX A;  3H9Q A;  4BBR J;  2N8G A;  4ITV A;  5BMZ A;  3HYI A;  3I9V 2;  1BJZ A;  1R22 A;  2BGC A;  4JOM A;  3RKY A;  4HLX A;  2Y75 A;  1HBX G;  2FJ1 A;  2TCT A;  5FRN A;  2DDA A;  3JRF A;  1RES A;  1V3F A;  2XAH A;  2R92 J;  2E1N A;  3KP3 A;  3ABM H;  1KYZ A;  1TNT A;  2OD5 A;  4V2G A;  2AHQ A;  4HQE A;  4BAY A;  1P7I A;  2CW7 A;  4I7H A;  2VBX A;  1SD6 A;  3VDX A;  1T33 A;  1OLT A;  4A3F J;  2QBY B;  4MHG A;  4HAM A;  5IOY A;  1U6G A;  1I1S A;  2FMY A;  3PIP F;  3FIW A;  4G6D A;  4CH7 A;  3GUD A;  4M3E A;  5L3C A;  4NC8 A;  3GTL J;  4XSX F;  3CD6 I;  3HRT A;  2RAE A;  1OCR H;  1ENH A;  2XPV A;  3LSH A;  3DEE A;  3CMA I;  3HHH A;  3IC7 A;  3L2U A;  2WB1 N;  2GBY A;  4HOB A;  1PP7 U;  1T0F C;  2FSW A;  2JPB A;  3EUH A;  4RB1 A;  1ETK A;  2CW8 A;  1VQ4 I;  3RPU A;  1MMA A;  3QYB A;  3LSP A;  3PO3 J;  1BIA A;  4BKX A;  2W1O A;  1JKP C;  1Y8Q B;  1GXP A;  1MGT A;  1X4O A;  2L0K A;  4GXO A;  1TWH J;  4KN4 X;  1KU2 A;  3P7N A;  1X19 A;  1Z77 A;  4IHS A;  3MCZ A;  2BE5 F;  1IN5 A;  4A5N A;  2BVL A;  2BV6 A;  1GVJ A;  2W85 A;  3QPT A;  4NQW A;  3MVP A;  3OYJ A;  1TT0 A;  4EVI A;  1XCV A;  4BHC A;  3ZMZ A;  3I55 I;  2E2J J;  2VOP A;  1JI8 A;  2A61 A;  2B63 J;  1Z6T A;  2NOJ B;  2ZSI B;  4E7S A;  2MD5 A;  2WY8 Q;  2F5E A;  2DW4 A;  3RQ4 A;  1MMG A;  4A3G J;  2WB1 A;  4EM2 A;  3VOD A;  4II3 A;  2Y9Z A;  5HDG A;  3F0C A;  2VON A;  5IP6 A;  2R7W A;  3V8L A;  4L9V A;  3O6B B;  5M3F J;  3KYD B;  1LDD A;  2DCE A;  2O0Y A;  4NDL A;  1MH3 A;  4I0A A;  2GOM A;  1O3S A;  1H89 C;  2X9D A;  5J1R A;  3OYE A;  2X51 A;  3HSE A;  3SDG A;  4IX7 A;  3ZCO A;  2O6G E;  3I54 A;  4I01 A;  4FAS D;  2XSD C;  3H92 A;  1ON2 A;  2VI6 A;  3CQZ J;  5ICF A;  1BR2 A;  2CWE A;  2DO7 A;  3Q0U A;  1FMV A;  2LBF A;  4RGR A;  5LRS A;  4X0G A;  3HOY J;  2XVC A;  2ZSH B;  2FXA A;  4BBS J;  4MTE A;  1YO5 C;  3Q3S A;  1FIP A;  5CYV A;  1PYV A;  4ZYH A;  2KQR A;  1LEA A;  3I56 I;  2IBD A;  2FF4 A;  2MFZ A;  1GUU A;  4QPO A;  1H0M A;  4I76 A;  2L9S A;  3V4G A;  1U2W A;  3BCB A;  5HLI A;  3RCO A;  2W25 A;  3RSN A;  1IC8 A;  1XG1 A;  2JA2 A;  3VYR B;  2KL4 A;  4P1W A;  1JHH A;  1YOV B;  1XMA A;  5BOX A;  2IXS A;  2KDO A;  3VEP A;  2D5V A;  4NB5 A;  2TDX A;  4M73 A;  1WKM A;  1XGM A;  2JMW A;  3PO2 J;  5FRM A;  1O7L A;  2H09 A;  5EGO A;  4E7I A;  1UG0 A;  2WA0 A;  2E71 A;  1Y39 A;  1LEB A;  3LWF A;  1WI3 A;  4EMS A;  5IPA A;  4KMU X;  4KUM A;  4BUP A;  1KYW A;  2QKM B;  1IUF A;  3K4J A;  4C2T A;  4CYC A;  5FD5 A;  3J7Z I;  2OV7 A;  3FXR A;  3WTS C;  2MSY A;  3ECO A;  3TO7 A;  3MD2 A;  3MN2 A;  5J4Y A;  5E1X A;  5GPA A;  3KCC A;  3BY6 A;  4L18 B;  3ZQI A;  3CMY A;  2D2W A;  3T5X A;  3K69 A;  1IDY A;  4HA8 A;  2FEZ A;  3L2Q A;  5FLX Z;  5GP9 A;  1IV8 A;  2IGN A;  5HS8 A;  3AKZ A;  4BEH A;  2QM3 A;  4IXA A;  2CUE A;  1BM9 A;  3FHN A;  1BC7 C;  2O9L A;  1IV6 A;  2FA5 A;  5EEA A;  2QQA A;  1U5T C;  5E8G A;  3ZMS A;  1S9H A;  2DK5 A;  3QOE A;  5J1U A;  3LSI A;  5AON A;  4L0Y B;  5HNF A;  1Z7L A;  1F4K A;  2CUZ A;  3OSG A;  3G73 A;  3WGI A;  3KE2 A;  2OBP A;  1TQP A;  2FNA A;  3SFZ A;  4BQQ A;  1WQ2 A;  5M5X J;  4ESJ A;  4W1U A;  4DZP A;  4EV0 A;  3H5N A;  1SFX A;  2CU7 A;  2R5Y A;  3M8E A;  1RC9 A;  3OYG A;  3FMR A;  4M9Z A;  4ENN A;  5E3N A;  3RI4 A;  2KPM A;  5L3F A;  2ME0 A;  3F8B A;  3BG3 A;  4FT8 A;  5DM6 F;  5E3L A;  1I3Q J;  3ROU A;  1X1B A;  5LHI A;  2EFW A;  1P6R A;  1YE9 A;  2MLK A;  1H9G A;  4OWR B;  3NEU A;  2PMH A;  3W6K B;  4CUG A;  3BOQ A;  1ETQ A;  3BTL A;  3HOV J;  5JVT A;  2BEO A;  1P7J A;  3IRQ A;  3KZZ A;  1MBF A;  4CCJ A;  5CVI A;  3U2R A;  3LA7 A;  4PJM A;  1R7J A;  3AL0 B;  4D5F A;  2XGE A;  3IP4 B;  1OCO H;  4PDK A;  1LE8 A;  1FYL A;  2V26 A;  4KFC A;  4IQJ A;  4P9U A;  1Z21 A;  5IYB J;  3K70 D;  3S2D J;  2K9Q A;  2LTP A;  4FCY A;  1A31 A;  2H6B A;  1MMN A;  2WWY A;  3DTK A;  4J19 A;  1FEX A;  2K4J A;  2JA5 J;  2NS7 A;  3BTC A;  4OMY A;  4ENJ A;  3ZR8 X;  1BW6 A;  1UCR A;  4MEY F;  3F6V A;  2GA2 A;  5HOO A;  2M87 A;  2F4O B;  2AXT C;  1YJ9 I;  3B6C A;  5K7Z A;  5CVV A;  4FX0 A;  3TW6 A;  4JK1 X;  1VQM I;  2OJE D;  2RC4 A;  1IJW C;  2ELJ A;  2GIZ A;  5H6Q A;  1KA8 A;  1GHC A;  4V19 K;  3HOZ J;  2WAQ N;  1I5Z A;  3RYR A;  1NG6 A;  4ZYG A;  1H9T A;  3FMS A;  5EF6 A;  2QQB A;  4YRV A;  1T8I A;  1WH7 A;  1NHA A;  4ZTJ A;  3GME A;  1Z05 A;  3SEZ A;  1TWF J;  4FHT A;  2UV1 A;  3OY9 A;  1U78 A;  1Y6I A;  1Y8R B;  3U1K A;  2B7E A;  2PJR A;  2A6E F;  2FBH A;  3ZXS A;  2HXO A;  1S7E A;  2CQQ A;  3OMY A;  1E17 A;  2PQ8 A;  3BTI A;  1Q1H A;  2F5D A;  2XF7 A;  3DKW A;  3H3V K;  2D1H A;  1RET A;  2VXZ A;  5D4S A;  2X1E A;  4PGG A;  2DMP A;  1ZN2 A;  4PGH A;  2H8R A;  2HTJ A;  3L2V A;  1VZ0 A;  2BHZ A;  3AAF A;  1Z6R A;  2ZC2 A;  2L7K A;  3CJT B;  2Q2E A;  3ZMT A;  2F5C A;  3EPZ A;  2OAZ A;  4YFK F;  3CCM I;  2PMU A;  4DZJ A;  4EJV A;  4XRS A;  2M2E A;  2IGM A;  3L1P A;  3L7W A;  2LDU A;  3VFZ A;  1WWX A;  4J00 A;  3HOS A;  2P4W A;  2LY1 A;  2IPQ X;  1SVL A;  2NVQ J;  1KON A;  3HRU A;  2J5O A;  3P9I A;  3H5R A;  4G7H F;  2L4A A;  3HHG A;  1S6L A;  3SZP A;  2JQ7 A;  3UR3 C;  2HFH A;  2LVS A;  2KKO A;  3EQL F;  4A3I J;  1ODD A;  3BR5 A;  2DT6 A;  2CQX A;  3WTZ A;  3JTG A;  2R7Z J;  3EET A;  5GAH J;  5E8I A;  5CVU A;  3J81 Z;  1ZQ3 P;  1ULY A;  1VQP I;  3C2H A;  4D1Q A;  3FKI J;  2JA8 J;  1Y0N A;  2NS8 A;  3M8J A;  4JX5 A;  3C2B A;  1ZG3 A;  1R6R A;  3GCM A;  2A05 A;  2L3D A;  4OOI A;  1RPW A;  2HU9 A;  3KPH A;  1W36 D;  3DEU A;  2CYY A;  1AKH B;  3SXY A;  4L5E A;  3QYF A;  1YX3 A;  4FIS A;  1DDN A;  4AM3 A;  1TTY A;  2HKX A;  4OIO F;  2KZV A;  2H1L A;  3CCL I;  2RNG A;  4XKW A;  4AU7 A;  5HS7 A;  5FB2 A;  3ASN H;  1D0Y A;  2E1O A;  1RKT A;  2XGD A;  4M6Y A;  4RGS A;  2FOK A;  2PMZ A;  2QCO A;  4Y52 J;  2BOL A;  2HOA A;  3H5A A;  2VXD A;  3HEF A;  3S1Q J;  3F8F A;  4BHP A;  4OU0 A;  4HX7 A;  3RJP A;  5FFZ A;  1JGS A;  3CES A;  3LSM A;  5JFR A;  5LFA A;  2IS1 A;  4B09 A;  2BXZ A;  2LRD A;  2IS4 A;  2EZK A;  3BG7 A;  3CCV I;  4MFE A;  5E18 F;  5BNG A;  4IRG A;  2K85 A;  1Z1D A;  4CA0 A;  3P9K A;  1WJA A;  2ADU A;  1V5F A;  2EIJ H;  2DJI A;  5LGT A;  1KU9 A;  1JKQ C;  3GBG A;  4PJJ A;  3N97 A;  3VWB A;  3L00 A;  2LMD A;  4O6J A;  3OS2 A;  1KQ8 A;  3A1Y A;  5JR3 A;  1X3W B;  4L5I A;  3SZG A;  5LGU A;  4BJ5 C;  2EK5 A;  5TGT A;  3WTV C;  5M3M J;  3K10 A;  2ME6 A;  2Y0S N;  5IOZ A;  3OL3 A;  4LK0 F;  2IS6 A;  1WCM J;  4JP0 A;  4WX9 A;  2CQN A;  3O2P E;  1ETX A;  3J7A Y;  4BAC A;  2M4G A;  2A6H F;  2IGK A;  3RQI A;  1KQ9 A;  4EJO A;  4HST A;  3CZ6 A;  1LVK A;  3ZQH A;  1B1B A;  3F8M A;  2PJP A;  2ZCW A;  4BE1 A;  1DGR M;  2XGC A;  3FXQ A;  3V42 A;  1VQ6 I;  3ESW B;  4JYK A;  2M30 A;  3OYH A;  3GFL A;  3A2K A;  4F91 B;  3V7R A;  1P4X A;  2YPR A;  4E7Z A;  2HZD A;  1BL0 A;  4KMF A;  2KIS A;  1NG7 A;  2X1D A;  5E1Z B;  2Y0S A;  3ZN0 A;  1WHU A;  2R5Z B;  3T8R A;  3KIO A;  2QF7 A;  2BW3 B;  2J5P A;  2QSF X;  1K4T A;  2XRN A;  5DEQ A;  1B9M A;  3RPU D;  1U3E M;  1KQ0 A;  2NOG A;  1D1B A;  5J47 A;  5L3B A;  1NTC A;  5FLV A;  2DMU A;  2R7Q A;  2HOS A;  3A01 A;  2DDB A;  5B1A H;  2FE3 A;  3S2H J;  2P8T A;  2LKS A;  2Z3Y A;  4M71 A;  4G9Y A;  2STW A;  5L3G A;  4DGW B;  5EJC A;  5HNH A;  5C4J J;  1UHM A;  1FSE A;  5KAF C;  3DEW A;  2DPD A;  2JUG A;  5D6E A;  2ACJ A;  4DYR A;  2HYF A;  4DW6 A;  1MJB A;  3OS0 A;  4M9S A;  3C18 A;  1R4N B;  5F6F A;  1G3S A;  1IW7 F;  1PDN C;  1VF9 A;  2STT A;  1B72 A;  1OKR A;  2P81 A;  1K7A A;  2R7O A;  3ERE D;  1R71 A;  4I2O A;  4ZDL A;  4HQM A;  1HCR A;  3GX4 X;  3MEX A;  2ISZ A;  3J7Y J;  1FYM A;  1TNS A;  1QPI A;  4C2M J;  1SC7 A;  2DFF A;  4XID A;  3BWG A;  1N25 A;  2BHY A;  2M45 A;  3K4L A;  4M3F A;  2M34 A;  3FM3 A;  3V7C A;  1SFE A;  5FJ8 J;  3E6D A;  4FE4 A;  4BJ6 C;  3JSP A;  2UUZ A;  1G3T A;  2P5V A;  2K4B A;  2VJ4 A;  3TED A;  1D0X A;  2NYX A;  4RAZ A;  2JVG A;  2ZFU A;  2F2E A;  3LAJ A;  2KLO A;  1S8N A;  2KMU A;  2E35 A;  4BE0 A;  3FXM A;  1U8R A;  2WV0 A;  4C3I J;  2QSH X;  1TW2 A;  5EG0 A;  2UWM A;  2B0L A;  2DJN A;  3QPH A;  3I4N J;  4RB2 C;  2O03 A;  2DYS H;  3ZQC A;  3S32 A;  1LFB A;  1H88 C;  4Q5S F;  2K40 A;  1ZHF A;  1UST A;  1W0U A;  3GEZ A;  2EQR A;  3H3U A;  2L01 A;  2VBW A;  1VQO I;  2GXB A;  1R58 A;  3LA3 A;  4H0E A;  2JVH A;  1VQK I;  4XR6 A;  2CG4 A;  1ACI A;  3E6C C;  3G1L A;  2JSC A;  2OUM A;  3G3Z A;  2ZFW A;  4OIN F;  4XBF A;  3ULQ B;  4AVZ A;  4CXF A;  3K1P A;  5EZG A;  4HYE A;  3TO6 A;  1XSV A;  1KU7 A;  4F55 A;  3H35 A;  1F43 A;  3LSG A;  3PJR A;  1TZL A;  4B1R A;  4K2E A;  1ZRD A;  3DBH B;  4RB0 A;  5DD4 A;  4AYB N;  1VTN C;  2MGQ A;  2IGO A;  4RAG A;  1W1W E;  2A68 F;  1OIS A;  1GV2 A;  1SFO J;  3TP3 A;  2JTV A;  4A3B J;  4RA2 A;  4LG0 B;  3HIF A;  2EJR A;  4ETS A;  2E36 A;  1K78 A;  3R0J A;  1I6H J;  1OYY A;  1XDS A;  6PAX A;  1BI0 A;  5EYR A;  3RZO J;  3IH2 A;  5DCM B;  1IN8 A;  4XOT A;  3NQO A;  2PBI A;  1QZE A;  2R4G A;  4IF4 A;  4G12 A;  1IN6 A;  2X1C A;  2FQ4 A;  1R1U A;  1F5T A;  2EZL A;  4XRM A;  1OCZ H;  4UV9 A;  4KIG A;  4YFN F;  3SJM A;  2FNP A;  1R5H A;  4LB6 B;  1R23 A;  3LFK A;  2NVT J;  1BC8 C;  2IP2 A;  4V2F A;  3EUK L;  1N77 A;  3J7A O;  4NNJ A;  3PUB A;  3ECH A;  1VI0 A;  4KJZ A;  4MGR A;  3S2W A;  3T1B A;  3MZ8 A;  1EV7 A;  2XAF A;  3I64 A;  4YG2 F;  3L2W A;  2Z99 A;  4N4N B;  3MAJ A;  2DN0 A;  2HI3 A;  1VQ8 I;  2OZ6 A;  1FNN A;  1ZYR F;  4GYG A;  1YX5 A;  4OIR F;  4EEF G;  1PJR A;  4ESB A;  3DTI A;  3PUF A;  3W3C A;  2L4M A;  3SQN A;  4F3Q A;  2OU2 A;  4S0H B;  1ZG1 A;  1E3P A;  2LH9 A;  2XB5 A;  1GVD A;  5IYC J;  3A02 A;  4J01 A;  2HDC A;  1VQ9 I;  5HS9 A;  2L2O A;  4HLY A;  1QBJ A;  2HTS A;  3MFK A;  2DT5 A;  2O3F A;  4HBL A;  2YU9 J;  1RI7 A;  1BR1 A;  1JXS A;  3ZMV A;  1HC8 A;  5LHH A;  3DPU A;  3E1S A;  4P9F A;  4UVC A;  2X6X A;  2JN6 A;  4B47 A;  4DIQ A;  1NK3 P;  3I59 A;  4HF0 A;  2LD5 A;  1ITY A;  1W7P A;  4UUV A;  2LK2 A;  2VE9 A;  1QU3 A;  3WE2 A;  2NVY J;  4HX8 A;  4RM2 A;  5HLH A;  3VYT B;  2ZJQ F;  2CMP A;  2P5L C;  1HW2 A;  3AFH A;  5A2Q Z;  2W57 A;  3OYN A;  1OJL A;  4AUX A;  1U9N A;  2XB0 X;  2WV1 A;  1YS7 A;  2CW0 F;  4M3D A;  4NQW B;  4BDZ A;  4AIJ A;  2DTZ A;  2EFP A;  1JT0 A;  1R5I D;  1K6O A;  4JX6 A;  4CDG A;  4HPQ A;  1OYW A;  4IKF A;  1PUF A;  1Y1W J;  3F8C A;  3B02 A;  1ZTR A;  3M1E A;  1IXC A;  5CJ9 A;  3G1M A;  2EA4 A;  3K0L A;  4B3A A;  2JA6 J;  3FWE A;  3RKX A;  4EJT A;  1ETV A;  1E3O C;  2ZNZ A;  3BJA A;  2L5Q A;  2R0Q C;  4XM3 A;  2K27 A;  2R7R A;  1IZ1 A;  4HW0 A;  3IAS 2;  1HKS A;  4XLC A;  5HLG A;  2QQ8 A;  2Y69 H;  1TWG J;  3L9F A;  5E3O A;  9ANT A;  2RRE A;  1LVA A;  1XD7 A;  2QQ9 A;  3TP0 A;  1XC5 A;  5LLQ A;  4U7B A;  4A3J J;  4UVA A;  3CTA A;  2LBF B;  4U0Y A;  4IL6 C;  2P7C B;  1DU6 A;  3L09 A;  2IAI A;  4AC0 A;  4CO8 A;  3CCU I;  4GRI A;  4CIC A;  2VPL A;  5ILV A;  2Z33 A;  2W00 A;  3BR1 A;  1RZ4 A;  2LRE A;  3ABL H;  5J40 A;  1GLN A;  1X1P A;  2AQF A;  1YLF A;  2KP6 A;  3X2Q H;  4AID A;  4ENM A;  3HG9 A;  3TKY A;  3KYC B;  3M07 A;  1MMD A;  5FD6 A;  3JRB A;  3QP5 A;  2YX7 A;  3ZMD A;  3CDI A;  1JUP A;  4FX4 A;  3M7G A;  2VB6 A;  3GFI A;  2H27 A;  1QRY A;  3CO6 C;  1HKT A;  1TQM A;  2K02 A;  3D5R C;  2MA3 A;  5C4X J;  3DTE A;  1WGX A;  3FIS A;  5EGO B;  1S3J A;  1W0T A;  1FPQ A;  3B6A A;  5E1W A;  2G0E A;  3K1M A;  3S17 J;  1UB9 A;  2E1C A;  1E3H A;  4Z2Y A;  3CCS I;  1X3Z B;  2ID3 A;  2DA5 A;  1F9N A;  1A36 A;  2OTL I;  1I50 J;  1VFC A;  1N75 A;  4C2U A;  2DQR A;  2W7N A;  4CYC B;  2R7V A;  4A0X A;  2PLY A;  1T0F A;  1SEU A;  2KHM A;  1HDP A;  4BS9 A;  2P5K A;  2A5Y B;  2EZH A;  3LNQ A;  4M3B A;  4ZDP A;  3FBI B;  3J80 K;  3KLO A;  3SYT A;  4YIF A;  1ZRF A;  4UNO A;  2KJB A;  3GF2 A;  3LSK A;  2Z1D A;  1UHS A;  4S05 A;  3BG9 A;  1YQA A;  2E7W A;  4BEH B;  1IAW A;  2HQA A;  2BY2 A;  1E0E A;  1G8X A;  2P0W A;  3U9G A;  5E79 C;  3G4S I;  4CCN A;  4CZC A;  1XX5 A;  3OYA A;  3CO7 C;  2XDV A;  3DLL F;  3ZQL A;  3TQN A;  3OYF A;  4E7L A;  5D8K B;  3E6M A;  3AG2 H;  1SVM A;  4E6K G;  1G2H A;  2V1D A;  2NXN B;  4KIT B;  4JQF A;  4R79 A;  1XDU A;  5BPD A;  5CKT A;  1OR7 C;  3FHZ A;  2HEO A;  5DUK A;  1FX7 A;  1S7A A;  1PUE E;  4A3D J;  1MND A;  2QZ8 A;  4ZZL A;  4UY8 I;  2R5Y B;  2WC2 A;  2CH0 A;  4MQV A;  1JTY A;  2E34 A;  1D3Y A;  1SFK A;  1SVO A;  1ZR4 A;  1BA5 A;  2YS9 A;  1K61 A;  3GTK J;  3CLQ A;  1ZK8 A;  3A4C A;  1GV5 A;  2MYS A;  1YW7 A;  4D7M A;  2R93 J;  3ABU A;  2LSO A;  4XON A;  1W4M A;  3C3W A;  2BVM A;  1D5Y A;  2Z9O A;  3HPH A;  2DTR A;  3GXO A;  5HOD A;  2CO5 A;  3MKW B;  3W2A A;  2OTJ I;  3CCY A;  1K79 A;  4BGD A;  2MLG A;  4I0B A;  1VQ5 I;  2IRF G;  3RYP A;  2EIM H;  3G71 I;  1WSU A;  2M3A A;  1R1V A;  1YJW I;  3QPL A;  1X3U A;  2E2H J;  1J5Y A;  2A3S A;  3OYM A;  4IZZ A;  1LE8 B;  2CQ7 A;  3WU0 A;  3BPX A;  3E7L A;  1TC3 C;  4A0Y A;  1J0R A;  1JE8 A;  2RV8 A;  4UHT A;  4QLC U;  4KN7 X;  2JZY A;  3HRS A;  4O3M A;  1KU3 A;  3OS1 A;  1JGG A;  2MAB A;  4BJT A;  5IP9 J;  3WTU C;  1IG7 A;  1WJ5 A;  2V1N A;  3I3L A;  3HSR A;  1V55 H;  1HA8 A;  1X58 A;  5DYM A;  3QRF F;  4G8X A;  5FKN A;  3BJ6 A;  4PFO A;  2KIF A;  2XIG A;  1JKO C;  1WFX A;  4BH9 A;  2P6T A;  4A69 C;  3EYI A;  5EEG A;  3LOC A;  2ESN A;  4GO1 A;  2L7F P;  3HTU A;  2FRH A;  2IA1 A;  1RNL A;  5B66 C;  1ZRC A;  3CUQ C;  4AIH A;  4BQN A;  2JK3 A;  2COB A;  2H6C A;  4CYD A;  5L3D A;  5ILU A;  4DQ2 A;  3M3Y J;  3HTS B;  4LK1 F;  1EA3 A;  4GFB A;  3N05 A;  1U8B A;  5FFX A;  2EPF A;  2EIL H;  2PJR B;  2E19 A;  2GWR A;  2R7D A;  5M5W J;  2VC1 A;  2DFH A;  2X6O A;  3JCU C;  1U5T A;  4EM1 A;  2UZK A;  2LR8 A;  3CCR I;  1YW9 A;  2WAQ A;  5LBQ A;  5F0C A;  4AIK A;  2E60 A;  1HXD A;  3LL7 A;  1TP4 A;  2DYR H;  2BZT A;  4ASN A;  1MSF C;  4A2U A;  3H1C A;  2V9P A;  4E7J A;  3A0B C;  3E5X A;  3W2V A;  1R9T J;  3KP6 A;  2M5W A;  5DUI A;  1OR7 A;  4LLG F;  1NK2 P;  3F8N A;  1JJ6 C;  1O3T A;  3S15 J;  1BBY A;  1TL8 A;  4P55 A;  2G9W A;  4G7O F;  2BY3 A;  3E97 A;  3HUG A;  3WOD F;  4BXU A;  1YI2 I;  3K70 C;  4OIP F;  2Q2E B;  3DU6 A;  4XKC A;  3OV8 A;  1I27 A;  2KFD A;  3CDL A;  1WJB A;  3FX3 A;  4U87 A;  3HDD A;  4OMZ A;  3CF5 F;  3SDB A;  3FK7 A;  2R7X A;  2LY9 A;  1MJ9 A;  3S1R J;  1JUS A;  3Q9S A;  2XRO A;  5K5Q A;  1FOY A;  3ONQ A;  1T98 A;  2MW8 A;  3C7J A;  4BNC A;  1RR7 A;  3IL2 A;  1FZP B;  4BY1 J;  1R5G A;  3DWL E;  2XF6 A;  5LRR A;  1FBQ A;  1FBU A;  1P2F A;  2F5V A;  3DBL B;  3TDU C;  2DK8 A;  2I10 A;  2RQP A;  2VQC A;  2YUS A;  2JT1 A;  4E7K A;  1MNM C;  4S04 A;  4KT6 A;  2NVX J;  2VL8 A;  4UUS A;  3E0J B;  4ZZD A;  4I09 A;  4UXN A;  4I6Z A;  2DOF A;  4L0Z B;  3IWF A;  3T8T A;  4RMN A;  4ESF A;  2KJC A;  3ABK H;  4IHY A;  1R00 A;  2EV0 A;  3JRD A;  3OR2 C;  2CJJ A;  3GZ6 A;  1V5G A;  1FMW A;  1OYI A;  3W2W A;  3TDZ C;  2L7M P;  3CC2 I;  3BLY A;  3V8K A;  5FLX K;  2LYC A;  3DCF A;  2XGX A;  5BQT A;  4B43 A;  5FLM J;  3Q0V A;  2HXI A;  4DNC A;  3LA2 A;  2VUM J;  4LMY A;  3PNT A;  4A3K J;  2XAG A;  5GAE J;  1XGN A;  1XSX A;  1NH3 A;  3BT9 A;  3HGG A;  3CUQ A;  2F6C A;  1KGS A;  5FO5 A;  2Y31 A;  3D5L A;  1LQ1 A;  4RGU A;  3BZC A;  1GXQ A;  4XLE A;  2DA4 A;  1LKX A;  1F1Z A;  3IV5 A;  4Z6Y A;  2LY2 A;  4MLO A;  1OMI A;  2Y30 A;  1ZH5 A;  1R36 A;  1ZGA A;  2HS5 A;  2MH2 A;  1WJF A;  2OQR A;  2VQL A;  5H20 A;  1YFH A;  4E4H A;  1RUO A;  3K4K A;  3HB9 A;  4FET A;  2DI3 A;  3PQJ A;  2RGV A;  2M7A A;  2ZME C;  3PFI A;  4I98 B;  3PIO F;  3GTP J;  4OAZ A;  2WTE A;  3PL8 A;  3HOT A;  2DOA A;  5LHG A;  1IXR C;  4H4K C;  5D5V B;  2FML A;  3RZD J;  1FWZ A;  1B6A A;  1E2X A;  1QZY A;  2W48 A;  3BQZ A;  5D8L B;  5IT9 K;  5KAI C;  2XAQ A;  1ZEL A;  4C3H J;  1EH7 A;  1XCB A;  4IPA A;  1DPR A;  3ASO H;  3GTM J;  3DP7 A;  2XKO A;  1I6X A;  1FOW A;  1TQI A;  2VT3 A;  2WAF A;  1YRN A;  2XHK A;  4U0V A;  1OQY A;  2COM A;  5GPC A;  4Y15 A;  5BPI A;  2JRM A;  1RRJ A;  1S5L C;  3QPS A;  5H6R A;  2VOD A;  2DXI A;  2VPR A;  4HG2 A;  2KIQ A;  3TO9 A;  5FRO A;  4LOC A;  4HDV A;  1XPX A;  2O7O A;  1YJN I;  3CF2 A;  2QEN A;  1XMX A;  1T56 A;  1HW1 A;  2P7V B;  2QGU A;  3FXJ A;  3CCE I;  3TOA A;  1AWC A;  2K9L A;  4I99 C;  3BPV A;  2W24 A;  2RQQ A;  3DF8 A;  1B8I A;  1HDD C;  4X6A J;  2K86 A;  4DBQ A;  3OOU A;  2HR3 A;  2XPU A;  1J59 A;  1G3W A;  1W7P D;  1X1A A;  2YSR A;  3KEO A;  2G7U A;  4YFX F;  3QWL A;  5KHD A;  4ON0 A;  2K3F A;  5LEJ A;  4EJW A;  1D5V A;  2EH3 A;  1DP3 A;  3IH3 A;  3MKL A;  3KEQ A;  2GIV A;  2MC4 A;  3A01 B;  4IJA A;  3KP7 A;  4R1H A;  1K6Y A;  1R4M B;  2DMT A;  3DBR B;  5J6X A;  5LD2 C;  2HVS A;  1I1G A;  5GTI C;  1HLV A;  2MH9 A;  3VSL A;  2V9V A;  5LGN A;  2AQE A;  2HPM A;  2EFQ A;  4XSZ F;  4X1E A;  5CQG A;  2ZJR F;  5J3L A;  2W82 A;  4KA4 A;  1B72 B;  2BBY A;  3EUA A;  1QZZ A;  4MTD A;  3V8J A;  2R7T A;  5IP7 J;  4QPQ A;  3G2B A;  3K2Z A;  3REO A;  5C3E J;  3OYB A;  3IWZ A;  3W6V A;  2CV2 A;  4GDF A;  1UG2 A;  2DA6 A;  2NAZ A;  1EKE A;  2V79 A;  2X0L A;  4XOP A;  5HDK A;  2G7H A;  2V1X A;  5HLT A;  3GTJ J;  2WBM A;  2QVO A;  3WTY C;  1QVU A;  1CF7 A;  3GTG J;  1Z3Y A;  2FQ3 A;  4XRS G;  3KLN A;  1LDJ A;  4XLP F;  1EF4 A;  3IHU A;  2M8G X;  1DP7 P;  1DU0 A;  3DQV C;  2LFB A;  2VT2 A;  2RNJ A;  3Q9V A;  1O7F A;  2DA2 A;  4UV8 A;  4UB6 C;  4IVN A;  5H2F C;  1IF1 A;  2HWV A;  5EG0 B;  2OQG A;  1T95 A;  3AG1 H;  3ERM A;  1QA6 A;  2FBI A;  2ZME A;  4WCG A;  2XUB A;  1MMS A;  4EQQ A;  2IS2 A;  1MD0 A;  1WPK A;  4D7N A;  2XC7 A;  1R1T A;  4KT5 C;  1FC3 A;  1W5T A;  3QOP A;  4F7Z A;  1J9I A;  5AIQ A;  3M8F A;  4NUB A;  3OWT A;  2ZXJ A;  3C1D A;  3BZK A;  3EUH C;  3LSJ A;  1JKR C;  1DPU A;  1Z9C A;  2H94 A;  4ANJ A;  3ZQF A;  2NVU B;  2IEK A;  3KP2 A;  5DS9 A;  3P5J A;  1AOY A;  5JHF A;  3OIO A;  4M6V A;  5JLX A;  3IH4 A;  2L54 A;  3DPT A;  1ZAO A;  2E7X A;  1U0J A;  3SFI A;  2X6W A;  3BR3 A;  1LB2 A;  2RKH A;  5F04 A;  3I53 A;  2EB7 A;  3FZV A;  5K1Y A;  1UMQ A;  3IAM 2;  4LLN A;  2ID6 A;  4YEJ A;  1P4W A;  5FKM A;  1MKM A;  2VQG A;  2DA3 A;  2BY1 A;  1XGS A;  2Z2S B;  3QP6 A;  4KIC A;  4A0Z A;  4U7D A;  1ZKG A;  1J7K A;  3I5U A;  4XN0 A;  3MZH A;  1P92 A;  1TT5 B;  1X4P A;  1K78 B;  1QQI A;  3DLA A;  2CS3 A;  4XIC A;  2HDD A;  3CME I;  2M7B A;  4YEL A;  1CGP A;  3BG5 A;  3WTT C;  2K9S A;  3J80 Z;  4WWC A;  4AYB A;  3OYC A;  3ZOB A;  3W6J B;  3S3M A;  2V1U A;  1U9O A;  3ZN1 A;  4CCO A;  4PCQ A;  5AIP A;  4LIT A;  5FKK A;  5F0H A;  1J75 A;  2PI0 A;  2HZT A;  1ORK A;  2M4K A;  1ERD A;  2F4M B;  1TWC J;  1MDM A;  5K5O A;  3JSO A;  2O5R A;  2V7F A;  3GFM A;  3WG7 H;  3S14 J;  2FU4 A;  3GWZ A;  3K4B A;  5TIS C;  1TLH B;  4CHU A;  4FQG A;  1YW8 A;  3TW7 A;  2M0M A;  3ZGK A;  2K9N A;  1PP8 F;  4BE2 A;  3FMQ A;  3NWS A;  1VQN I;  2Q1Z B;  2ZXI A;  3I0T A;  1HF0 A;  3LSR A;  2XSJ C;  3LAP A;  4HF1 A;  4IHV A;  1S7O A;  4DJA A;  2VJ5 A;  4BHB A;  3GVA A;  3K7A J;  2DU9 A;  3MMY B;  2DAO A;  3KX2 A;  5ICE A;  2GXA A;  1V5E A;  4HNV A;  5TRD A;  4AD9 A;  4CSW A;  2QUF A;  2K3P A;  1T6S A;  3TL4 X;  3F6O A;  3VYS B;  4DYC A;  2QLZ A;  1FYK A;  4E7H A;  3JAM K;  3S3O A;  1BI1 A;  2L9V A;  3CP2 A;  3JRC A;  1B59 A;  2HQR A;  3K6G A;  3DV8 A;  1G4D A;  3VB2 A;  3E3V A;  4D0P A;  2KRC A;  3HJE A;  1X1C A;  3HM5 A;  2QBY A;  3JTH A;  2AXL A;  3JRE A;  2XRL A;  2E1M B;  2A69 F;  1QHG A;  5ICC A;  3R61 A;  2RVC A;  2R7S A;  1IRX A;  3V7S A;  3O3K A;  1FSH A;  3I59 B;  2XAJ A;  5ED4 A;  1IRF A;  4WXD A;  4D5C A;  1W7P B;  2P6S A;  4B3X A;  1MBJ A;  1XTA A;  5DCF A;  4AWX B;  1SMY F;  4HV6 A;  5BS6 A;  1D0Z A;  3KFW X;  4BYY A;  3NAR A;  1ONV A;  4F52 A;  2A5W A;  4I02 A;  1UJ8 A;  2V4J C;  2LKX A;  4IHT A;  3RTR A;  2VBY A;  3HPG A;  3PNV A;  2M9H A;  5J8C A;  3HSF A;  4MIM A;  1D8J A;  2F5F A;  3QOD A;  1WRJ A;  1PUF B;  2QEX I;  4L5J A;  3D0S A;  3F3X A;  3HOX J;  2Y0M A;  2FUG 2;  2OCE A;  4IOC F;  3R4K A;  1MBH A;  3R60 A;  1ETW A;  2GOX B;  4HZF A;  3FBN B;  2DMQ A;  3PQK A;  3D5S C;  2MG4 A;  3H0D A;  4ZYD A;  4A3C J;  1VND A;  3WG9 A;  3EDP A;  4TV7 A;  1UHW A;  3HZJ A;  1STZ A;  3BDD A;  2DFE A;  4A3M J;  3IKT A;  4UB8 C;  3WE3 A;  1SFU A;  2QA4 I;  4LB5 A;  2Z5U A;  2ZJ2 A;  4RM3 A;  4Q48 A;  1Y0U A;  4QWQ A;  1FLI A;  3I4P A;  3HOU J;  2ELK A;  3BC8 A;  3BTJ A;  4BL0 B;  1RIO H;  3BCA A;  1UEL B;  2OF7 A;  1XMK A;  4EM0 B;  4WK8 F;  2BXY A;  1TWA J;  3DXJ F;  1JUM A;  2ELH A;  1P9Q C;  2O8X A;  5M5Y J;  2VJJ A;  4B44 A;  5IY5 H;  1O4X A;  1LNW A;  1REP C;  3KET A;  1USS A;  2QYO A;  5FGM A;  2VKD A;  2XF5 A;  4OAY A;  4RBO A;  5D5W B;  1R49 A;  3AL0 C;  3TOB A;  4KIF A;  4N9H A;  3BR0 A;  2PFB A;  3MKZ A;  3S3N A;  3HKZ N;  5F64 A;  3CC4 I;  2DT7 B;  3HXL A;  3WHC A;  3CJN A;  2DBB A;  1S72 I;  3F72 A;  2MC3 A;  5CQE A;  2VOO A;  4XRF A;  2ZBK A;  1ZAR A;  2K5C A;  2PN6 A;  3H9J A;  4HRI A;  3IRR A;  1UZC A;  3CJR B;  3U1D A;  2X6Y A;  1SAU A;  2GM4 A;  2FOW A;  3QAH A;  1KZH A;  5F0F A;  1Y56 A;  4L9T A;  2M0C A;  3OYD A;  4U88 A;  4PSX A;  4B8X A;  2LKP A;  1HST A;  1A04 A;  4AVP A;  3H36 A;  4Y3O A;  3QU6 A;  4IRI A;  3RKQ A;  4CGZ A;  2IT0 A;  3PSI A;  5JLW A;  3HKZ A;  2IVM A;  3R0A A;  4XOR A;  3WGH A;  3CCJ I;  3I4M J;  1IO2 A;  2UXN A;  3HBL A;  1DUX C;  1A35 A;  4C3J J;  2VE8 A;  3K1N A;  4PK4 A;  2PEX A;  1BOB A;  4FE7 A;  1MBG A;  2EV6 A;  5HDN A;  3GLL A;  1MSE C;  2ESH A;  2VKE A;  1QGP A;  3VYU B;  4BDY A;  1O57 A;  2DLL A;  2RDP A;  1PVE A;  3S93 A;  5DM7 F;  2Y9Y A;  1JHF A;  2HYG D;  1Z91 A;  5ILS A;  2GA1 A;  1TW3 A;  4XLH A;  4XMY A;  1ZRE A;  1WVR A;  2NNY A;  2L9N A;  4A3E J;  2K7L A;  1IXS B;  2ECC A;  1OCT C;  4Q4Z F;  1ZLK A;  2QWW A;  5GAG J;  2EZI A;  1X2M A;  5CVR A;  2XKP A;  4IRH A;  2DPU A;  3M1C A;  4BU2 A;  2HVR A;  4PJ0 C;  4XLF A;  2AS5 F;  2HPI A;  2GXG A;  3QU3 A;  2ZNY A;  4MFD A;  2E2I J;  3OIQ A;  1V54 H;  4ZYE A;  5K7F A;  2H8W A;  4M74 A;  4XLN F;  3DPL C;  3FXK A;  5J1Y A;  4LG3 A;  2OA4 A;  1W5S A;  1WJC A;  1LFP A;  3S1M J;  3B73 A;  3OIP A;  5CVJ A;  1X2N A;  3OR1 C;  2O8K A;  1FP2 A;  2Y48 A;  2BYV E;  1JJ8 C;  4BQA A;  2KRH A;  4KDP A;  4EAT A;  2DOE A;  3R6S A;  5F1J A;  2CGP A;  1WI9 A;  1Y1V J;  2KIU A;  4HX4 A;  1RUN A;  4HNU A;  1YS6 A;  4DOZ A;  3CDH A;  4A93 J;  2NNN A;  3E6B A;  2EFO A;  2IA0 A;  2R7U A;  2CV0 A;  4PUS A;  4ZC3 A;  4RS8 A;  2TRT A;  3ZP5 A;  3JRH A;  4L9N A;  1XS9 A;  2JPC A;  1QVT A;  1A6Q A;  2HKO A;  4LJZ F;  2BY0 A;  2Z16 A;  1OCC H;  4CCK A;  2VC0 A;  1FP1 D;  3CCQ I;  5IT9 Z;  2R7F A;  5J4V A;  3HC7 A;  3CMM A;  3Q0W A;  4M3G A;  4A12 A;  1JTX A;  5E17 F;  4LIU A;  2FD5 A;  2PG4 A;  5D6F A;  1SAX A;  3LQR A;  3L2R A;  2ZXW H;  2X85 A;  5D5U B;  4PFP A;  1XB4 A;  4N4O B;  3IUO A;  4IOA F;  1V4R A;  1J09 A;  1O3Q A;  3JW4 A;  5A2Q K;  3HOW J;  4M9X A;  3S8P A;  4LLL A;  5DTD A;  1C0W A;  3E5Q A;  1WJD A;  3BJO A;  1OFC X;  2KT0 A;  3KZI C;  4U0W A;  5B5E C;  3FM5 A;  3CP8 A;  3O8H A;  1FOK A;  4IEJ A;  5ICG A;  1LPQ A;  2JJ7 A;  3H0G J;  4HNT A;  3H3Z A;  1YHQ I;  1K4S A;  3I58 A;  2XPW A;  1S29 A;  2VLA A;  3QYE A;  3OYI A;  3JRG A;  2NRA C;  2EBI A;  4UUT A;  3A03 A;  4M6X A;  2I8D A;  2M1B A;  2XAS A;  1T39 A;  5FKL A;  1D1A A;  4F92 B;  1J2X A;  2YU3 A;  3S1N J;  3ABT A;  4RLQ A;  1HOM A;  1SAN A;  5CPR B;  4HDU A;  1Z67 A;  5LEK A;  4BXF A;  3GZ5 A;  4XKB A;  1U5T B;  1ETY A;  1EJ9 A;  2X4H A;  4NBQ A;  1GT0 C;  4PJN A;  4A3L J;  4MO7 A;  1Z0X A;  4CZZ A;  1MBK A;  5IT3 A;  5EZH A;  5KNL A;  2ICW G;  4MQ9 F;  1XSD A;  1IN7 A;  1YIT I;  3K2A A;  2HOT A;  2MBF A;  3LMM A;  4XK4 A;  4NC7 A;  3DFG A;  2E5Z A;  2EFN A;  3BQY A;  1OCP A;  3OOP A;  4II2 A;  4Y7N J;  1P4A A;  2EIN H;  2A07 F;  1W5C C;  2LG4 A;  3HUG B;  1IRZ A;  1Z7U A;  1LJ9 A;  3BG6 A;  3TMO A;  4B48 A;  3FF5 A;  3F23 A;  2LNB A;  3GTQ J;  4XNF A;  2AO9 A;  2EIK H;  2CFO A;  5GAD J;  1B9N A;  2L7Z A;  3H9G A;  2VIX A;  2ISY A;  2XAU A;  3KZY A;  1ZR2 A;  3G1O A;  4P5O A;  4A5M A;  1H8A C;  1IRG A;  2JSP A;  1D8K A;  2H1K A;  3K4N A;  4RAF A;  1GDT A;  5K5R A;  4R8H A;  4ZH4 F;  4EGY A;  1MNE A;  5KK1 A;  1SMT A;  4GGG A;  4PZJ A;  1BW5 A;  2HQ5 A;  2VQH A;  3CC7 I;  1SD7 A;  2VJI A;  3AG4 H;  1T38 A;  5C44 J;  2M8E A;  2DMN A;  1WZ2 A;  3I71 A;  1DGW Y;  1B4A A;  2A6T A;  5F1R A;  4Y4R A;  4WXH A;  4UUS B;  1SD4 A;  4DBR A;  4XL9 A;  3RDI A;  3MKY B;  4BQO A;  3BP8 A;  2HYJ A;  2DQL A;  1IUY A;  1AU7 A;  3JR9 A;  5GTH C;  3LFU A;  2E5N A;  4KIB A;  1RKW A;  2CRG A;  4N0B A;  2VBZ A;  1G3Y A;  1FOX A;  2JRT A;  1BI3 A;  3ZPL A;  1IN4 A;  4WXC A;  4PSW A;  4EJU A;  1DQU A;  2ZKZ A;  4Q47 A;  2JWT A;  1LDK B;  3LQQ A;  3PSF A;  1FTZ A;  2C6Y A;  4NHJ A;  3OSF A;  2HNH A;  2PMZ N;  1POG A;  3VSK A;  3PNY A;  1IDZ A;  3F22 A;  1EH8 A;  5CLS A;  2ZB9 A;  1MZB A;  1ZG5 A;  3DKX A;  1AKH A;  2F4I A;  5JI6 A;  4YIR X;  4MEX F;  1I39 A;  4OIQ F;  2W84 A;  3ZQQ A;  2V9K A;  3CUQ B;  2LP0 A;  3JRI A;  1D1C A;  3CLO A;  4KNY A;  3PFY A;  2CSO A;  3QQA A;  1QNT A;  3WHB A;  3GW2 A;  4PJL A;  1HQC A;  3CJQ B;  5F08 A;  3KP4 A;  2FBK A;  3ZQ7 A;  3WU2 C;  1Z3X A;  2QSG X;  1L0O C;  2CQK A;  3ZQG A;  1ZGW A;  1WH5 A;  2LOO A;  1BJA A;  3WU1 B;  1ZLJ A;  3UKG A;  2WAE A;  4GCV A;  3M4O J;  2I5U A;  2Y2Z A;  1BOA A;  1HW5 A;  3BRO A;  3ZRG A;  4RB3 C;  3ISP A;  4RDU A;  3VPR A;  5L3E A;  2GAU A;  1A5J A;  4WF2 A;  1ZGJ A;  1F36 A;  3DKY A;  2X48 A;  3E5U A;  5IYD J;  4BY7 J;  1K83 J;  2LF7 A;  1LFU P;  4RLF A;  1FIA A;  3BR2 A;  3FK6 A;  1QPM A;  1YRN B;  5D5X B;  4IHW A;  3COA C;  2KRF A;  3GFJ A;  1UAA A;  1ETO A;  1FT9 A;  4G6Q A;  5B3S H;  4A6D A;  3JAM Z;  1I3A A;  4CCL A;  5KVR A;  4Y33 A;  3JRA A;  3KYL A;  1YTY A;  1W36 C;  3ML6 A;  1QHH D;  4ENK A;  2CFX A;  4P96 A;  3GTO J;  2DOD A;  3Q5F A;  3K9T A;  1L3L A;  5DV5 A;  4HF2 A;  1X1D A;  4G94 A;  3RKW A;  1TBX A;  1MJA A;  3F9K A;  1B8I B;  2JUC A;  3S16 J;  2B9S A;  3WGG A;  3OYK A;  2WY7 Q;  3L2C A;  4W97 A;  3OL4 A;  3TGN A;  5EEH A;  2R5Z A;  2UXX A;  3MWM A;  2BW3 A;  2HVQ A;  3LST A;  2DA7 A;  2L02 A;  2KIM A;  2EV5 A;  2CV1 A;  2EA2 A;  1RR8 C;  3K4C A;  2R3S A;  4Y17 A;  4QTR A;  3BR6 A;  3C2G A;  3G6E I;  2JA7 J;  3NWT A;  4N9I A;  5ERI A;  1IGN A;  2YX4 A;  3N4M A;  5EDN A;  2OPT A;  3BZ6 A;  2Q0O A;  2XV4 S;  1VQL I;  2OC6 A;  2OZU A;  5DDG A;  5HVQ C;  4YII A;  1YG2 A;  5D4R A;  1O3R A;  3FXU A;  4Y13 A;  2VKV A;  4CCM A;  1VQ7 I;  4JBA A;  2F48 A;  3WTW C;  1BIB A;  3FKJ A;  4JX4 A;  2KDZ A;  4B4C A;  3NRV A;  3FDY A;  1FJL A;  2HQN A;  2VKH A;  2GZW A;  3GLX A;  3NAU A;  3VOE A;  2Q8K A;  3TBI A;  4BXX J;  3ZMU A;  2PX9 A;  4MNU A;  1CF7 B;  2HDW A;  2QKL B;  1CQT A;  1M1E B;  1FTT A;  1A6I A;  2FX0 A;  5JVG F;  1OPC A;  2CUF A;  3GZN B;  4G6T B;  4EGZ A;  2HOE A;  5B1B H;  4ZDO A;  1MH4 A;  5E20 A;  1UFM A;  1AA7 A;  4FTH A;  2VN2 A;  2V6C A;  2EWN A;  5KCM A;  2LC2 A;  3RIR A;  3K4M A;  2ZME B;  1YIO A;  4RAY A;  2IJL A;  4RGX A;  2D45 A;  2CUJ A;  4E70 A;  2KZG A;  2E1M C;  3DU5 A;  4XLA A;  1MIJ A;  1LUJ B;  4LGW A;  2LLK A;  1BN5 A;  3AG3 H;  3MZY A;  3SZT A;  5J8F A;  3GYH X;  3KP5 A;  3UNG C;  3OYL A;  2ZO4 A;  1FBS A;  3IKV A;  3A0H C;  2IA2 A;  2DFI A;  4HV5 A;  1HKQ A;  2O61 A;  3J81 K;  4QSH A;  1YIJ I;  2D1V A;  3HRM A;  4ZJZ A;  3M9A A;  1WJE A;  1HSJ A;  1XGO A;  5E3M A;  3D1N I;  1Q1V A;  4QIW N;  3P9C A;  2VAS A;  2ECB A;  3EYY A;  1T2K A;  4C30 A;  1SD5 A;  4O5V A;  1JT6 A;  2ZJP F;  4G7Z F;  4XQF A;  1EH6 A;  2NS0 A;  2RN7 A;  3WTX C;  3O8G A;  3RPQ A;  4C9Y A;  2IW5 A;  2WAD A;  5JHU A;  5K7H A;  3U21 A;  4M72 A;  1MBE A;  2GLO A;  1BR4 A;  2W4S A;  2LF8 A;  4LD5 A;  3PM1 A;  3HL2 A;  2YR2 A;  4LG0 A;  4GYI A;  4NC6 A;  5F27 A;  1YYV A;  3F21 A;  5TJJ A; 
#chains in the Genus database with same CATH homology
 2F4O B;  1OQY A;  1TP4 A;  1PVE A;  4YIR X;  1QZE A;  1X3Z B;  2F4M B;  2QSG X;  1X3W B;  2QSH X;  2QSF X;  3ESW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...