3G4SI

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3g4sI00
3J7YJ 2QA4I 3CCJI 1HC8A 1ACIA 1YIJI 3G71I 3G4SI 5GAEJ 1YITI 1VQ6I 3I55I 3CCLI 3I56I 1YI2I 2ZJRF 2OTLI 1MMSA 2ZJQF 3PIPF 3CCQI 2NXNB 4IOAF 1Y39A 3CCEI 3CMEI 3PIOF 2FOWA 4UY8I 3CC2I 2E36A 3DLLF 1VQ8I 2E35A 3CJTB 3CCUI 2QEXI 3CC7I 2OTJI 1YJ9I 1FOWA 1FOYA 3CC4I 3CMAI 1YJNI 3G6EI 1VQNI 1YHQI 1VQ4I 1VQKI 1VQMI 2JQ7A 1VQLI 3CF5F 1FOXA 5JVGF 2K3FA 1VQ9I 1QA6A 3CD6I 2ZJPF 3CCVI 1VQPI 3J7ZI 2E34A 1VQ7I 5GAGJ 5GAHJ 1VQOI 3CCRI 4IO9F 3CCMI 2H8WA 5GADJ 4IOCF 1VQ5I 1YJWI 3CCSI 4V19K 1S72I 5DM7F 5DM6F
chains in the Genus database with same CATH superfamily
1XG1A 1MMAA 1UMQA 2E1NA 2COBA 2ACJA 4B8XA 1S3JA 1YIJI 4IXAA 3PQKA 3BDDA 2LRDA 3OS2A 3U1DA 4BAYA 5FGMA 2LD5A 2K4JA 1J09A 1XMXA 3HOYJ 2C6YA 2D2WA 3LA7A 2ECCA 2XF5A 1DP7P 4HNTA 3G1MA 2H94A 5ICEA 3W2AA 2DDAA 2L9RA 1ETXA 1XDSA 2OA4A 4UB6C 5A2QZ 1U3EM 1GT0C 2HOEA 2CQKA 3DPUA 4BY1J 3PIOF 3GTLJ 2CV0A 1MSEC 4UY8I 2DAOA 5HS9A 3TGNA 2IGNA 4BBSJ 3V8KA 1RIOH 4HOBA 4YFNF 2HGCA 1OFCX 2QCOA 3DPLC 5FFXA 4A2UA 5H6RA 1RKTA 2Z99A 2VE9A 1MSFC 1F43A 1TC3C 4G7OF 1TQMA 2EILH 4KIBA 1SAXA 2OTJI 2RQPA 3CP2A 4PSXA 3GZ5A 5D8LB 4ETSA 4U87A 1Z21A 3FXOA 4C2UA 3RZDJ 1LDDA 2DMPA 3CESA 2VPLA 2Z1DA 2GIZA 2WADA 3HSRA 4LIVA 3OIPA 1U78A 2XB0X 3EUKL 4L0ZB 3WTZA 3H35A 2L4AA 5CQEA 2WV0A 4ZZLA 2E2JJ 2JA8J 4OINF 1VQKI 1FOKA 3K1PA 2RV8A 2HZTA 1RNLA 1UELB 4PK4A 2A05A 5CLSA 1FOXA 5JVGF 3VPRA 1O3QA 3K4JA 1M1EB 3OYHA 4DYQA 2R7DA 5D6FA 4O3MA 4BNCA 1X2MA 3BZ6A 2CO5A 4QPOA 4UUTA 3RDIA 1ETWA 2K27A 1IAWA 2ISZA 2H1LA 1QPIA 4UNOA 1XGOA 2Y0MA 5GTHC 1IUYA 1MNEA 2DA2A 3RZOJ 1YFHA 1B72A 5IYCJ 4BXFA 1D3YA 3CLQA 2M45A 2K02A 3E5UA 2W00A 3QYBA 1IN7A 2HQAA 4UVAA 4XKVA 5IPAA 2R7TA 4HAMA 1X4OA 4JBAA 4U7BA 1REPC 1BBYA 1RRJA 4PJ0C 4ESBA 4LB6B 2GLOA 2R7UA 3GFMA 1QQIA 1TWCJ 5FLVA 2LKPA 5KHDA 3FX3A 3DCFA 2A68F 2CMPA 2VXDA 4IEJA 4PDKA 5JFRA 4BHCA 2FX0A 2WAEA 2X1EA 2Y31A 3K10A 2JSPA 4HZFA 4XN3A 1GXQA 3RQIA 1AU7A 5K5QA 1D0YA 2M2EA 4RMNA 5F1RA 1O3RA 4KIGA 3F3XA 3J7YJ 3O3KA 4E7LA 3M7GA 1WJBA 2Z33A 2Y2ZA 1JT6A 3DBRB 3G4SI 4E70A 1I6HJ 4Y17A 3S15J 3ZMDA 3AG4H 1IRGA 5HDKA 4AD9A 1AKHA 3RPQA 3A0HC 3CJQB 3U21A 3JTHA 5IYBJ 2GXBA 3K70C 2MW8A 1U0JA 2HDDA 1YX5A 4EM1A 1MBEA 4IOAF 4XLCA 2HYFA 3GFJA 3LNQA 1YG2A 1S29A 4NHJA 1HSTA 2WAQA 1ZHFA 1FP1D 4I6ZA 2H6BA 5H2FC 3QRFF 4NNJA 2E36A 4NB5A 3C7JA 4DYCA 4LB5A 4IF4A 2CUEA 3HSFA 1I27A 1QZEA 4N9HA 2PN6A 3CC7I 3IAS2 4FE7A 3K1MA 2DBBA 4M3DA 3UR3C 1EA3A 3E0JB 4JX6A 2YUSA 4I7HA 4EGZA 4FHTA 1D0XA 4JX4A 1A35A 3ZMVA 3ZMTA 4ENMA 3LSJA 3TP0A 1Z67A 2CW8A 1JKQC 5C3EJ 1K6YA 2R3SA 1OYIA 2ESHA 4BUPA 3CF5F 2LH9A 1SVMA 4IQ4A 3BR3A 1ORKA 3H3VK 5F08A 2NS8A 2K3FA 3SFIA 2VQLA 2KPMA 4RDUA 1UAAA 2DFFA 1JTYA 2VKVA 2AQFA 1R5GA 1X1DA 2FEZA 2GXGA 3MQ0A 1XS9A 2DFEA 2XAJA 2QYOA 1ZR4A 1LUJB 1BI0A 2E60A 2LY2A 4ZDOA 1OMIA 5CVRA 3GMEA 3F0CA 3O8GA 5GAHJ 2ZXHA 2E2HJ 5HLGA 2BW3A 2KIUA 3KPHA 1UG0A 3K7AJ 3GYHX 2QF7A 1TWGJ 4F91B 1HKTA 4L5EA 1K79A 3CMMA 2X1DA 1ETVA 1E0EA 2E5ZA 3QPLA 5J1UA 2XPVA 4QWQA 3AG3H 2BXZA 4MLOA 2O6GE 2JSCA 5DM7F 2K9QA 3FWEA 1BC7C 1QZZA 2HTSA 5E1WA 4GRIA 3JAMZ 3OR1C 3BTCA 1BI2A 3K4MA 3G71I 2Z16A 1VZ0A 2LFBA 1A6QA 1BOAA 4DZJA 3R0AA 3IH3A 2M8EA 1MD0A 1RR7A 1TWFJ 2WY7Q 3R60A 2XHKA 3C2GA 1HDPA 2LVSA 3K1NA 2JUGA 3H0GJ 1PUFA 2HTJA 2L7MP 5JHUA 1JGGA 2W57A 1LFPA 4BQOA 5LRSA 3F8FA 4U0YA 3KYCB 2R5ZA 4KT5C 1W0UA 2E7WA 4MQVA 3BJ6A 2ELKA 2P5VA 3KEOA 3TQNA 1L3LA 2UUZA 3BR2A 1C0WA 1FTTA 2HKXA 4RLFA 3OYAA 2CW7A 2CQQA 5EG0A 4RA2A 4BY7J 4A3DJ 2MH9A 5F04A 2HOTA 2OZ6A 2GAUA 2ZB9A 3GFIA 3Q0UA 4EM2A 2EZHA 4DJAA 3IL2A 3MKLA 3TW6A 3A01A 2MD0A 4BE2A 5KVRA 4ZTFA 4XL9A 4KN4X 2NVXJ 2IS4A 3K0LA 1BR2A 4U88A 1JUSA 3AG1H 3ZQLA 2WAQN 2ZFUA 4GFBA 4KFCA 1IZ1A 4TV7A 3KZYA 1JT0A 3ESWB 5E17F 3FIWA 3HEFA 3LOCA 2L9NA 1EH8A 1YS7A 2IA1A 2MLKA 2Q2EA 5E3OA 3HRSA 4JQFA 4XRFA 3HC7A 3RQ4A 2VOOA 5JLXA 1RI7A 1H9TA 5B66C 5FKNA 4BEHB 1STZA 4HW0A 5M5XJ 2YPRA 2VUMJ 1B6AA 2QENA 1JHFA 4HLYA 4M3GA 5ICGA 2VBZA 2P7CB 2GWRA 2F5EA 1SD5A 5FKLA 1KQ0A 3LA2A 3E5XA 3QWLA 3BG5A 2YX7A 3D5RC 1Y1WJ 1LE8A 2DK8A 3H5RA 1ZARA 2QQ8A 5FROA 5DCMB 4EMSA 2ID6A 5D8KB 2BXYA 3F21A 1FP2A 5E20A 2BZTA 1VFCA 3CZ6A 2O8XA 3IWFA 3CCSI 1Y6IA 1H8AC 1SEUA 1TZLA 1ZG1A 1G59A 2JMWA 3K4LA 3QQAA 5L3EA 3D0SA 1D8JA 3OIOA 2EV6A 5E3NA 4M3BA 2GQQA 3HOVJ 1UG2A 2PEXA 4CICA 2H27A 4G6TB 1XDUA 1WRJA 3F6VA 1RUNA 5BNGA 1J5YA 1RUOA 2ME0A 2KZGA 1YITI 3AL0C 1IV6A 1UHMA 2BV6A 5C44J 2XGDA 3OR2C 2X48A 1IRXA 3PFYA 4FISA 1O7LA 4PJMA 4CUGA 4B44A 4FTHA 1JXSA 1T33A 3LQRA 2OPTA 2VBXA 5CPRB 5FB2A 1E3HA 3FXKA 4QTRA 1ZYRF 1NTCA 3S8PA 3E6DA 1SVOA 4J01A 3S2HJ 2VB6A 1MBHA 5E79C 3DEEA 1UJ8A 3KETA 1OKRA 3F9KA 5AONA 3BG6A 2DFHA 2O7OA 2M9HA 4B3AA 1YLFA 2X1CA 2Z2SB 4M72A 3TL4X 4HRIA 2DMQA 3SEQA 3CQZJ 4M6YA 3BPXA 3HOWJ 3V7RA 4NDLA 3U9GA 2L2OA 2OZUA 1VNDA 2GIVA 4YIIA 5EGOA 2LREA 1H9GA 2LR8A 5F0CA 1R4MB 3C1DA 1XGSA 3M07A 3HBLA 2VPRA 1OCOH 4IHYA 2V79A 2UV1A 3P9KA 3WTXC 1DU0A 2A6HF 1IXSB 2VJ4A 2ZXJA 3OYCA 1Y0NA 2XGXA 3ZR8X 1J75A 4MQ9F 4CSWA 5E18F 4XLFA 1ETYA 3IV5A 3F22A 3HGGA 2WAFA 4RAFA 3GTGJ 5DUKA 5BQTA 3I59A 1IN4A 5D5XB 1FBUA 4EATA 3NQOA 2BY3A 4BJTA 2R7SA 2CWEA 4IJAA 2JWTA 4U0WA 3QU6A 4BHBA 4R8HA 4RB1A 4X0GA 4YFXF 1RPWA 3T0YA 3E1SA 4QIWN 5L3GA 4HYEA 1TNSA 4Y4RA 3L2CA 4MNUA 3BG3A 1G3SA 5F0FA 5HNHA 5F1JA 1WJDA 2FE3A 2W7NA 1B72B 2DODA 3E6MA 2IBDA 2R7WA 2BY2A 4R1HA 4UHTA 4BU2A 2VC1A 3IWZA 2YU3A 2H6CA 1WHUA 1IRZA 4Q4ZF 1IGNA 1YOVB 1OYWA 4X6AJ 1CF7A 3HOXJ 4AYBA 3CDIA 4XONA 3DTIA 5HLHA 1R58A 2NNNA 4PJNA 1W5CC 1HF0A 1R49A 1HC8A 1E17A 3JW4A 2O0YA 5HLIA 1IW7F 2JRTA 3I4NJ 4CA0A 4CCMA 4A12A 2KDOA 2N8GA 1GVJA 5ICCA 5LFAA 3TO9A 2MG4A 1LNWA 2EFOA 2HPMA 3KP3A 1U2WA 2DFIA 2ZJRF 4LGWA 2BY0A 1ZR2A 5J40A 1OCCH 1AKHB 2IS6A 1W5SA 3L2VA 2KDZA 2NXNB 4E4HA 2STWA 3PNTA 3KZZA 3JSOA 2ZMEA 3N97A 2G0EA 3L2RA 3KZIC 5HODA 3SZGA 3D1NI 3HJEA 3QPTA 1RC9A 3ELKA 3TMOA 2NVTJ 3WTTC 3VSKA 1MIJA 1P4AA 2XRLA 4ENJA 2MD5A 5IP7J 2QQ9A 3CCUI 4M74A 1BR1A 1D1CA 1ITYA 2NOGA 2ZXIA 3EUHA 3PO3J 5FLXK 1WSUA 2DA5A 4U7DA 5TRDA 1Z7LA 3DF8A 4C3IJ 2V1UA 4LJZF 1DGWY 3GTJJ 3HG9A 2XPWA 3CUQC 1ZRCA 1MH4A 5FD5A 1FSEA 5FRMA 1ETOA 5KNLA 2XF7A 3NAUA 3OWTA 1OISA 3RYRA 2XKPA 6PAXA 3ZMZA 4F3QA 1VQLI 2M5WA 3JRGA 4AIKA 2Q1ZB 2QZ8A 3BOQA 4MTEA 3G73A 3LFKA 1NG7A 1MNDA 3HM5A 1KU2A 3LSKA 3X2QH 4KMUX 4Z2YA 4D7NA 3CCVI 3S1QJ 1WJ5A 4E6KG 1R4NB 2HXOA 4WWCA 4KUMA 5LHGA 3I4MJ 2YX4A 1BW6A 5IOZA 4G7ZF 3QU3A 2Y30A 1ZAOA 5F6FA 1MJ9A 2GM4A 2HVRA 1XC5A 4N9IA 2B9SA 4J00A 4UUSB 2EZIA 4D5CA 4GO1A 1HXDA 2O5RA 4UVCA 4IKFA 3FM5A 5LLQA 4C3HJ 3BTJA 2BW3B 1OQYA 3ZOBA 2HWVA 2JN6A 5HLTA 1JTXA 4CYCA 1R9TJ 3QP5A 1BL0A 4BBRJ 3WTVC 2W4SA 2A3SA 2CSOA 3ABLH 1IV8A 2NYXA 1DP3A 1UCRA 1EH6A 4DBRA 3PUBA 3FXRA 3CP8A 3HXLA 4MIMA 4WF2A 4P5OA 3K4CA 1T39A 1S8NA 3OIQA 3LSGA 4M6XA 1ACIA 4AUXA 2BE5F 1A36A 2OCCH 2MBFA 5HDNA 1OJLA 2H8RA 1HOMA 2VODA 1ZN2A 2W25A 3BZKA 3TO6A 3WTSC 3CJNA 2QKMB 1Z3XA 3CCLI 3CUOA 3TDZC 2BVLA 4A5NA 5J8FA 2P8TA 3ZQQA 2DPUA 3MEXA 3NEUA 5DV5A 3BWGA 1SFOJ 1X19A 2DW4A 3OYIA 2PJPA 3OSGA 2KJBA 1T8IA 2X6OA 5DTDA 4CXFA 3T1BA 2DN0A 2P6TA 3QYEA 1PUFB 4XQFA 3ECOA 2HS5A 2EZLA 4K2EA 3DKWA 2DT6A 1OPCA 2EPFA 1FC3A 4OMYA 2NVYJ 4G6DA 2EV5A 1A6IA 2ZBKA 1FPQA 3KP4A 4LLLA 4DOZA 1VQ8I 5J1RA 2W48A 5JI6A 2DI3A 3H36A 3HHGA 5ICFA 1TWHJ 4V19K 2CUZA 2Q8KA 3MZYA 2EFNA 5A2QK 1FOYA 2VKHA 4ON0A 3OSFA 1LPQA 3GCMA 1W36C 4R79A 2ZC2A 1P4WA 5EG0B 2R7RA 4L5JA 3G6EI 2KLOA 2X0LA 4L9NA 2D1VA 2QVOA 1LFBA 3RPUA 1J59A 1ZG3A 3C2BA 4A0XA 1G6NA 2L3DA 3CCYA 3A01B 1E3OC 1QZYA 2VASA 5DD4A 2JZYA 5TISC 1MBFA 5GPAA 3SJMA 2KKOA 2XRNA 1VQ9I 3FF5A 3CD6I 4P1WA 5JR3A 2M7AA 3TEDA 1PUEE 4DBQA 1TL8A 2V9VA 3DTKA 3MMYB 2F6CA 4HF0A 1JE8A 4CH7A 2M0MA 1H89C 2EA4A 3R6SA 3LSMA 4EJVA 5GAGJ 1WKMA 1YQAA 2F48A 2Z5UA 3FBIB 2IGMA 2M8GX 4AM3A 4EM0B 2HR3A 2ZNZA 3D5LA 4BQQA 4W97A 5F64A 3PM1A 5LBQA 1MW7A 1S6LA 4IOCF 4L9TA 3ZCOA 3BG7A 2X85A 4M9XA 4AC0A 4F92B 3EYIA 2IA2A 1LE8B 1UHWA 1HW2A 1KYZA 3GTPJ 1WH5A 2VC0A 3TO7A 2DLLA 3MVPA 4UXNA 3MKWB 2LTPA 3BTIA 3SZTA 4XK4A 4XR6A 2M0CA 1TT5B 3OL3A 3F6OA 3E6CC 3VFZA 1FT9A 3I64A 1K83J 4ZYGA 4FCYA 2KFDA 4H0EA 3RTRA 3TW7A 2LKSA 3L9FA 1QHHD 1ZG5A 2CV1A 2DT7B 2FQ4A 5M5WJ 3M9AA 3FISA 2CGPA 1K6OA 3QYFA 4ZYEA 3GX4X 2V7FA 4YIFA 3G3ZA 3ZQIA 2HQNA 2W85A 5D6EA 1Z05A 3MN2A 2X51A 2MFZA 5FO5A 1MJAA 5LRRA 1TWAJ 2I5UA 1PP8F 2PX9A 4Q47A 1B8IA 4XM3A 3DLLF 2WC2A 2XAUA 4EQQA 2HEOA 2LC2A 2DOEA 4DGWB 4IX7A 3PL8A 4ZTJA 3S2WA 2JJ7A 4LMYA 2R93J 3R4KA 2OQGA 4XSXF 4A3JJ 3PQJA 3BR6A 3ECHA 3H5NA 1XSVA 2ZO4A 2X6WA 3ERED 3KX2A 3OS0A 1YRNB 2XAHA 5EGOB 4AIHA 1ZQ3P 1LVAA 2P81A 4ZC3A 2RDPA 1FYKA 2V9PA 3MAJA 3U2RA 5BPIA 2UWMA 1S5LC 3S16J 5D5WB 1V5FA 3ONQA 4HNUA 1IRFA 2K85A 4I0BA 1MMDA 1BIAA 5J4YA 3JRCA 2HI3A 5CVJA 2XGCA 1RESA 1Z6RA 4CCLA 3HB9A 2E19A 3R0JA 2DT5A 3G1LA 4G9YA 4RAZA 4C9YA 2IW5A 3OYGA 2EQRA 4E7SA 2KL4A 2NOJB 2ISYA 3VDXA 2HDWA 1U8BA 5CKTA 2DO7A 1D5YA 2KZVA 1U6GA 3I59B 1T0FC 1V5EA 2EINH 1Q1VA 1RKWA 2H09A 2PBIA 3NRVA 3N4MA 3H92A 3DWLE 1XMKA 2M34A 4LK0F 5L3DA 3CCRI 3FXJA 2JA2A 3DEWA 1R1VA 3U1KA 2LMDA 1KU3A 2HPIA 2Y69H 5CJ9A 5EZGA 2Y75A 3DV8A 1T2KA 1IXCA 1I3AA 4G94A 3TOAA 4XLEA 3LSRA 2BVMA 4HX4A 3JRHA 3SQNA 2EIKH 2MGQA 2NS7A 5GP9A 3T8RA 1HSJA 1T56A 1OCPA 1WVRA 3HOUJ 2ZKZA 2DOAA 2L0KA 1CF7B 1LEBA 3CCJI 3GBGA 1MDMA 2EIJH 2MC4A 2VBYA 2GOMA 3IH2A 3RKYA 2Z9OA 5KK1A 2VE8A 3VYRB 4I02A 2QBYA 3S1MJ 2R7ZJ 4ENNA 2E2IJ 2VOPA 2VJIA 1ETQA 3Q3SA 1O3TA 4P96A 2HYGD 2NVQJ 3A2KA 3ABUA 3ZQGA 4HDVA 2OU2A 4KT6A 3QAHA 4Z6YA 2VI6A 4JOMA 3JAMK 3O6BB 2XGEA 3JCUC 1QVUA 1T0FA 3WU2C 2VIXA 4BS9A 2LBFA 2F4MB 2LF8A 3LSHA 3K4KA 2KRCA 4PJLA 2WWYA 2PLYA 1V55H 2EZKA 2HFHA 2ZMEB 2VBWA 4YEJA 5TGTA 3GTMJ 1I50J 4HBLA 1G3WA 3LAPA 1SMTA 2IAIA 2QQBA 2XPUA 1APLC 2O3FA 2QEXI 3KYLA 1L0OC 2XUBA 1ZTRA 2XB5A 2A61A 4GYIA 1EKEA 3FMQA 3OYDA 4HV5A 3IKTA 4EGYA 1PP7U 4XICA 2M4KA 4PGGA 2HVQA 2E1MB 3S32A 3WG9A 1LFUP 2QKLB 3KP2A 3H0DA 1V3FA 1SFXA 2VL8A 1U5TC 5EEHA 2ZSIB 4WK8F 2VN2A 2GOXB 3HHHA 1QGPA 1ON2A 2PQ8A 1AWCA 3RJPA 3F8BA 1ZRFA 2DTZA 1X3UA 4E7ZA 4MFEA 1VTNC 2R7VA 1ODDA 4XMYA 2IA0A 4BL0B 1W5TA 2L7FP 2EA2A 3GWZA 2V6CA 1OCRH 2WB1A 4HLXA 1W0TA 1QA6A 2WA0A 1FIPA 2ZJPF 2H1KA 1BC8C 3DBHB 3ZN1A 4GCVA 3OYEA 5AIQA 2TCTA 4JP0A 4W1UA 2CU7A 4NQWB 1SFKA 2W82A 4CZZA 3TOBA 2CQ7A 4XRSG 3ZMUA 2FJ1A 1F5TA 2V1DA 3VB2A 1U8RA 2L9SA 3H5AA 2FBKA 3QPSA 1WI9A 2ETHA 2FBIA 1LVKA 2ID3A 2P6SA 3BT9A 3FBNB 2ICWG 4IHWA 1R5ID 1Y0UA 4HDUA 3MFKA 4IL6C 2FF4A 1I5ZA 2IGKA 2K5CA 3IH4A 3OYFA 4II2A 3SHFA 4B43A 4BE0A 1PJRA 1JJ8C 1V4RA 3KE2A 2PI0A 4V2FA 1Z77A 4ZH4F 2ZFWA 2AO9A 1U5TA 4M3FA 3VYSB 2HXIA 4CCKA 5IP9J 4CYCB 2KIQA 5LGTA 3ZQHA 3BR0A 2QWWA 3ZGKA 2DPDA 1O3SA 5GAEJ 3W6VA 4F55A 1X1AA 3CO7C 1SD6A 2FU4A 2ZXWH 1V54H 1HLVA 4FASD 3IUOA 2BY1A 2DA3A 4KN7X 3PFIA 2R7XA 2K86A 2M1BA 3HOSA 1JGSA 5IY5H 3LA3A 1HW5A 4FE4A 2J5OA 1OCZH 2BGCA 2JRMA 5FKKA 1N75A 3DU5A 2L5QA 1LEAA 4XOTA 1YW7A 1KZHA 4ZDLA 3UNGC 1FYLA 4V2GA 4RM2A 5H6QA 3KLNA 3RCOA 2XVCA 4GYGA 4XKWA 3B6CA 4ENKA 1N78A 4FETA 5LEJA 2DMTA 3VODA 4FX4A 4YIRX 4OIOF 2VQHA 2XSDC 1K78A 3IC7A 2HU9A 2LY9A 1ZK8A 2RQQA 3HTSB 2G7HA 1D1BA 4XNFA 1ZLJA 2XAQA 3REOA 3V4GA 3B6AA 3WHBA 3RKXA 2F4OB 3I54A 3HUGA 1IN6A 2KIMA 3H3UA 1P9QC 4RBOA 4A3KJ 2GXAA 3BC8A 4Y7NJ 4ESJA 1IG7A 3B02A 1TW3A 1DQUA 2G9WA 3DPTA 5J8CA 1U9OA 3CLOA 2L54A 3I9V2 2DA1A 1FSHA 4IHSA 3GZ6A 2J5PA 3FXUA 1B4AA 1TQIA 1IF1A 2CFXA 1WJCA 4JX5A 4WCGA 3FM3A 3LAJA 3FXMA 3VOEA 4AIDA 5AIPA 4G8XA 1SFEA 4RB2C 1B59A 1MBJA 4OWRB 4EV0A 5EEGA 3I0TA 4HQEA 4PCQA 1VQOI 2MYSA 2OQRA 4ZYHA 4XKCA 4IO9F 1QU3A 4BDYA 2IRFG 3NARA 2AHQA 2VJJA 1T95A 2WB1N 4LD5A 2XDVA 1P7IA 2BBYA 2CJJA 1VQ5I 4AVZA 3JRDA 3V7SA 1CGPA 4L0YB 2XAFA 1GV5A 5E3MA 3KFWX 1EJ9A 1LDJA 1YS6A 2K9MA 3BROA 1Y1VJ 2HKOA 3EPZA 1HCRA 2R7QA 1XB4A 4U0VA 4JYKA 1F4KA 2VKDA 5EZHA 4BXXJ 1Z0XA 4H4KC 2OD5A 2W84A 4UVBA 3V42A 5HOOA 3M1EA 1R1TA 3TKYA 3K2AA 4EEFG 1ETKA 1P4XA 1B1BA 2V1NA 4HX8A 1LKXA 3RI4A 1YI2I 1P92A 4HEA2 2O9LA 1WQ2A 4CHUA 2ZJQF 1WCMJ 2LOOA 2X6YA 2V6EA 1HW1A 3CCQI 1NK3P 2RC4A 2EBIA 3ABTA 4PSWA 4CCOA 1WJFA 3V8LA 2L9VA 3GEZA 4II3A 1JJ6C 1FLIA 1HA8A 5HDGA 5KAFC 4I99C 4DNCA 1J0RA 4UUVA 1X3WB 3CJRB 2GA1A 1MGTA 4PJJA 1TNTA 3CDLA 4CCJA 2V26A 2VJ5A 4DZPA 1R00A 3LSIA 3FXLA 4A0ZA 2KQRA 1IXRC 3ABMH 3WE3A 2UXXA 4RM3A 4RAGA 5FKMA 4F93B 2UXNA 3DKXA 5EYRA 3MCZA 4ITVA 2MABA 4I98B 2IS2A 2DTRA 3OYKA 4BYYA 1T38A 1Z1DA 2CUJA 3OYJA 4BDZA 2PJRA 2COMA 1TLHB 3WHCA 4LLNA 3BCAA 1T98A 4Y3OA 4IRHA 3ISPA 3GW2A 1F36A 1SANA 4FX0A 2YSRA 2UZKA 1VI0A 4ZJZA 4QLCU 3GZNB 1R1UA 3JSPA 4HSRA 2IXSA 3WGGA 2FA5A 5E1XA 2R7FA 3WG7H 4XSZF 5F0HA 2HOSA 1XSDA 1I39A 3F23A 2XF6A 4PFOA 4NC6A 2ZSHB 3EQLF 3EYYA 4O5VA 1USSA 4RB0A 3BQYA 1VQPI 1QHGA 3SFZA 4IHVA 1WH7A 2DYSH 3M8JA 1YX3A 2R4GA 3BLYA 4PFPA 1RETA 4E7IA 2IT0A 4XLNF 3RPUD 3J81Z 4N4NB 5K5OA 5IP6A 1X3ZB 3C18A 4HNVA 2YS9A 2ELHA 4WXCA 5IYDJ 2VQCA 3S3OA 2DJIA 2PMHA 3G1OA 3ZQCA 3HPHA 1QPMA 1RZ4A 4P55A 1W7PA 4BQNA 2JT1A 3WTYC 3LL7A 1QVTA 3PSFA 3RSNA 4A3CJ 3H9JA 5L3BA 1HKQA 2E1CA 1BJZA 2V9KA 3H1CA 2JTVA 3VWBA 1WZ2A 5ED4A 2FQ3A 3W6JB 1F9NA 2ZNYA 1JUPA 5EJCA 3ZP5A 5M3MJ 2K7LA 1X2NA 4AU7A 4HG2A 1ZREA 4M9SA 4YG2F 2CFOA 5D4RA 2LY1A 1BJAA 3MWMA 4Y15A 1BOBA 2EJRA 2NVUB 2DDBA 2RNJA 1MDMB 3I55I 3GXOA 2M7BA 3I56I 4A69C 1Z7UA 3K69A 3F8CA 3OY9A 1VF9A 1P7JA 3A1YA 3EUAA 2QBYB 4XLHA 4I0AA 3PIPF 2M4GA 3LSPA 2EH3A 3CUQA 1SFUA 3KIOA 1YE9A 2QM3A 3SDBA 4BJ6C 2XC7A 4LG0A 2JA6J 3JRFA 2L7KA 1UB9A 5FJ8J 3CMEI 2M87A 1YTYA 5IT9Z 2L01A 3TBIA 2FXAA 3IRQA 3VSLA 1ZGAA 3W2WA 1ZKGA 2CW0F 3A02A 3MKYB 2LBFB 4QSHA 4LFUA 2XAGA 4IPAA 4LOCA 4EJUA 3O8HA 1X4PA 4B3XA 1YJ9I 3HOTA 1X1PA 3J80Z 5BOXA 3OOPA 1FEXA 2AQEA 2Y0SA 5LHIA 4IZZA 3V8JA 1UFMA 1J9IA 4CCNA 4YELA 4LIUA 2KP6A 5HS7A 1VQNI 2ME6A 1ERDA 3A0BC 2OUMA 2F5VA 1KQ8A 4A5MA 2DOFA 5J3LA 2JQ7A 2JA7J 3ASOH 4B47A 4CZCA 2R5ZB 1DPRA 5CQGA 3HTUA 2K3PA 1RR8C 3E97A 5EF6A 1P6RA 5LHHA 4OMZA 2DMNA 4NBQA 4KITB 1ZRDA 3ABKH 2FD5A 3F8NA 1BIBA 2EWNA 4S0HB 4EJOA 2B7EA 1R7JA 1G3TA 2EIMH 3GLLA 1D0ZA 2OF7A 3BZCA 1G3YA 1W1WE 3ZRGA 4XRSA 1TP4A 5L3CA 3JR9A 5E1ZB 3DLAA 5HNFA 3GTKJ 3HGYA 3QPHA 1IDYA 2AS5F 3LFUA 4Y33A 3BPVA 1XN7A 4RGSA 2JVGA 4GDFA 4NC8A 4N4OB 2A6EF 1FBSA 1KQ9A 5GADJ 2CRGA 1OLTA 1SD4A 5ILVA 3M1CA 3IRRA 3DEUA 1PYVA 1XGNA 5EDNA 3C2HA 2IJLA 2KRHA 4A3FJ 2RKHA 1R36A 3AAFA 3CTAA 2R92J 4BKXA 2Q2EB 2LSOA 4M6VA 3E5QA 2IGOA 2QA4I 1U5TB 2HVSA 4E7JA 2XIGA 3L1PA 4EJTA 2P7VB 2M3AA 4QPQA 1ZELA 5ILUA 2NAZA 3KEYA 2X9DA 5FKOA 4B1RA 1LB2A 1FMWA 1SC7A 2X6XA 4L9VA 2DA7A 2OJED 3K70D 3FMRA 5E8IA 4OU0A 3ZMSA 5K7ZA 4A93J 3S14J 2EFQA 1AOYA 2VKEA 3P9IA 4IHTA 1GHCA 1TT0A 2XKOA 2YR2A 3PSIA 3CCEI 1B9MA 2QUFA 1DUXC 4CYDA 3FXQA 4MHGA 3M8FA 2OC6A 4MFDA 2W24A 4RS8A 4BACA 4OIRF 2GZWA 1JUMA 2HYJA 2DK5A 4RAYA 5J4VA 2P5LC 3CMYA 3S1RJ 2O61A 4RLQA 4NUBA 3SYTA 2KHMA 3FK7A 2L02A 3ZXSA 3Q5FA 4A3EJ 3S2DJ 5L3FA 3CF2A 3WU1B 1K78B 5CVUA 2DA4A 1YHQI 2HZDA 3OMYA 1T08B 2FOKA 1VQMI 2A5WA 1HDDC 2VXZA 3W3CA 4GGGA 3HUGB 5LGNA 2A69F 2R5YA 2EFWA 4X1EA 2EB7A 2KT0A 4P9UA 1ZGJA 2Y9YA 1PDNC 2Q0OA 1I6XA 2Y0SN 2E34A 2MH2A 1FYMA 3COAC 3K4BA 3W2VA 2OBPA 3S3MA 1TQPA 3D5SC 2FRHA 3PUFA 4FT8A 3OYBA 1DPUA 1K4TA 1EV7A 4KJZA 4B48A 5DUIA 4HF1A 3DTEA 3L2UA 1XCBA 5J47A 2FUG2 3V7CA 1YW9A 3Q0WA 4XOPA 4AVPA 3SEZA 3CCMI 4NC7A 4PZJA 4BJ5C 2JPBA 3WODF 5D5VB 1S9HA 5KCMA 3ASNH 4OIPF 4UV8A 3MZ8A 2O03A 1MKMA 4MO7A 2OV7A 3FK6A 3DKYA 1YJWI 3AL0B 1U9NA 2OAZA 2QSHX 3S3NA 3I5UA 1R23A 5HS8A 4Y13A 1S72I 1IC8A 5ERIA 3F72A 3I3LA 2M30A 3BP8A 1DDNA 2R0QC 5JHFA 2Y9ZA 5DS9A 1Y8QB 4FQGA 1F1ZA 2MA3A 2VQGA 3OYNA 1MZBA 3BY6A 1IUFA 4LK1F 3KP5A 3P9CA 2FMLA 4IVNA 2I10A 1Y39A 2WTEA 3S17J 1KU9A 4ESFA 5B1BH 2JPCA 2JVHA 5E3LA 4XRMA 4LLGF 1G8XA 1EH7A 4ANJA 2LK2A 1ZLKA 1SAUA 3BG9A 2EK5A 3WGHA 1ENHA 5C4JJ 4DYRA 1O7FA 4HX7A 1XCVA 4KISA 1OCTC 1PVEA 2PMUA 2CQXA 3M4OJ 2F2EA 1XGMA 4MTDA 2KMUA 1USTA 1AA7A 4M73A 4UV9A 1IDZA 1R6RA 1B9NA 3GO5A 2BHZA 4UUSA 2HQRA 1SVLA 1IN5A 4I76A 3DBLB 1OYYA 4BH9A 2FSWA 3E6BA 3M3YJ 3J7AY 1BI3A 1E2XA 1FJLA 3K9TA 2IPQX 4N0BA 4RGRA 2PJRB 2HNHA 4M9ZA 1ON1A 2IEKA 2DQLA 1IJWC 3FHZA 1S7EA 1WPKA 2HOAA 1NG6A 2Z3YA 5B3SH 5B5EC 2QQAA 2RN7A 3BR5A 5IT3A 2XROA 2P4WA 4ZZDA 4HQMA 1R71A 1N25A 2RVCA 5D5UB 2DA6A 1ZH5A 5K7HA 3NWSA 3N05A 2I8DA 1A04A 2EFPA 1AHDP 3A4CA 2YU9J 2NNYA 4YFKF 1VQ7I 1BA5A 5ILSA 1ULYA 2MSYA 2DXIA 3ML6A 3DFGA 3GTQJ 4XLAA 5TJJA 3BJAA 3DQVC 9ANTA 3HRUA 4KA4A 4L18B 2H8WA 1UZCA 2CH0A 2K40A 2TDXA 2IS1A 3HOZJ 5LEKA 1W4MA 2F5CA 1W7PB 3K4NA 4Q5SF 4C30A 1I1GA 3FDYA 3DU6A 5DM6F 1H0MA 3K6GA 3EETA 2G7UA 3VYUB 2P5KA 4F7ZA 4DQ2A 2CV2A 3KP7A 2NS0A 3IAM2 2CYYA 1MMGA 4A6DA 4XIDA 5B1AH 2AXTC 2CQNA 2FMYA 1XMAA 2VT2A 3GFLA 1MMSA 2ESNA 1NH3A 3A03A 1JKRC 4IHXA 4RGUA 2ADUA 2GA2A 5M3FJ 4XBFA 1R22A 1YO5C 2WBMA 2GBYA 3ULQB 3TP3A 4Y52J 5D4SA 2PFBA 3GUDA 3LMMA 3CUQB 3H9QA 2FOWA 1WJAA 4L5IA 2A07F 3CC2I 2K9NA 4LG0B 4BQAA 4CDGA 2EV0A 3HKZA 3HDDA 1YYVA 3CJTB 1MBGA 3P7NA 3HIFA 4KDPA 1G2HA 4MGRA 1A5JA 1TBXA 4LITA 2XASA 1FOWA 5FLMJ 3PNVA 2LG4A 3CC4I 4B09A 2LF7A 4M71A 2RAEA 4IRGA 4Q48A 5K7FA 1YJNI 4KYWA 3G2BA 1HBXG 3ROUA 5BPDA 3S93A 4A3GJ 2X4HA 1NHAA 1K61A 1NK2P 1TW2A 1LJ9A 3ZQ7A 1EF4A 4A0YA 1KA8A 3SXYA 2MC3A 2O8KA 3J7AO 1QO0D 1IN8A 3AFHA 2LYCA 2DU9A 2NRAC 4IRIA 4D0PA 3WTUC 3WTWC 3GF2A 1J2XA 2MLGA 3B73A 4A3BJ 3J7ZI 4EVIA 1GUUA 2B0LA 5LGUA 3FHNA 3AG2H 3L00A 1XSXA 1KGSA 3DXJF 4C2MJ 3L7WA 4I09A 5H20A 5J1YA 2LDUA 1BI1A 3ZN0A 5IOYA 4CGZA 1KU7A 3WU0A 5CVIA 4IQJA 2BOLA 3PJRA 2ELJA 3HRMA 4E7HA 1S7AA 2LP0A 1Y8RB 4C3JJ 4WXDA 5F27A 1T6SA 1XPXA 5DYMA 3MZHA 2E5NA 2E7XA 2KIFA 3HYIA 3Q0VA 1GDTA 1OR7C 3RKWA 3LWFA 2CS3A 2D45A 2AXLA 2VONA 2WV1A 4PUSA 4D1QA 5JVTA 4HPQA 2PMZA 1KONA 3FKIJ 2K9SA 2ZCWA 4KMFA 1S7OA 2DQRA 4ZDPA 1FX7A 5JLWA 1ZGWA 4I2OA 3TDUC 3ZQFA 3LQQA 4LG3A 3KLOA 3QP6A 3MKZA 1MNMC 1YRNA 1W7PD 4ZYAA 1X1CA 1Z91A 4P9FA 1UHSA 2BEOA 1FMVA 2OTLI 1MMNA 4G12A 1GXPA 4A3MJ 4HA8A 4BHPA 1WWXA 3IKVA 2A5YB 3AKZA 5DDGA 5DD8A 3WGIA 4BGDA 1P2FA 3P5JA 2DCEA 2OCEA 1FWZA 3JRBA 3L2QA 1CQTA 2VLAA 3H3ZA 1QNTA 4WXHA 4WX9A 4B4CA 1YW8A 3VEPA 2E35A 1FBQA 3Q9SA 3RIRA 3OYLA 3PO2J 1IO2A 3QOEA 5DEQA 3QODA 4UB8C 4OAZA 1BN5A 1OR7A 2E1OA 1JHHA 2ZMEC 5BMZA 1FNNA 2XSJC 2F5DA 1MJBA 4BXUA 4J19A 1MBKA 3BCBA 1ONVA 3CDHA 4OAYA 4AIJA 2L4MA 5K5RA 1FZPB 3HL2A 3HZJA 1GLNA 2B63J 1O57A 3HKZN 2QSGX 3C3WA 2A6TA 2E1MC 1Z9CA 5K1YA 4HV6A 4EJWA 1HQCA 1E3PA 3JTGA 2QGUA 3EUHC 4S04A 4MEYF 1B8IB 3DP7A 2HDCA 2R5YB 3E7LA 4XN0A 4A3IJ 3HPGA 2V4JC 1I3QJ 4HF2A 1MH3A 2W1OA 4MEXF 2V1XA 2D1HA 3Q9VA 5KAIC 4D9JA 2DMUA 3LSTA 5J6XA 3JRAA 1QBJA 2IVMA 4OIQF 2RNGA 4HSTA 4GXOA 1R5HA 3PNYA 3BR1A 2KJCA 1Q1HA 3SZPA 5CYVA 3T8TA 1POGA 3KCCA 4KNYA 2F5FA 1GV2A 3WE2A 4ASNA 5GTIC 2QSFX 1WFXA 2IP2A 2DYRH 4O6JA 2VT3A 3F8MA 3RKQA 1FIAA 1XD7A 3J81K 1JKPC 4ABZA 3FMSA 1BR4A 3K2ZA 1YIOA 3CO6C 1K7AA 1D8KA 1A31A 1DU6A 2L7ZA 4RB3C 1JKOC 2CG4A 3NWTA 3HSEA 1FTZA 2KRFA 4S05A 3R61A 2LKXA 3BQZA 2BHYA 2DJNA 3L09A 4CO8A 1DGRM 2K9LA 4YRVA 4I01A 3L2WA 1VQ6I 3BTLA 2WY8Q 1N77A 3BJOA 3I53A 4G6QA 4C2TA 5DCFA 1WJEA 4D7MA 1X1BA 1X58A 3S1NJ 4M3EA 4D5FA 3HRTA 3T5XA 5FFZA 5FLXZ 2RREA 3OYMA 1FY7A 1SD7A 2PMZN 5FD6A 1XX5A 2HQ5A 2F4IA 3GLXA 1BM9A 1KYWA 2LNBA 4KIFA 2K4BA 5LD2C 3JRIA 1V5GA 2FNAA 4OOIA 2TRTA 3FZVA 1Z6TA 1D1AA 3KP6A 1SMYF 1BW5A 3ZPLA 3IHUA 1O4XA 3H9GA 1WGXA 4NQWA 1H88C 2LLKA 3OV8A 4RGXA 1TTYA 1XTAA 4JK1X 3I4PA 3CMAI 5IT9K 1W36D 4G7HF 3OL4A 3GVAA 2JK3A 3I58A 2BYVE 2E71A 1J7KA 3FKJA 3QOPA 1VQ4I 4F52A 3ERMA 5BS6A 5GPCA 5EEAA 2ECBA 2JA5J 4DIQA 3J80K 3RYPA 1K4SA 5C4XJ 1GVDA 2KISA 4DW6A 3IP4B 3SDGA 1Y56A 2FBHA 1D5VA 1JI8A 1I1SA 2ZJ2A 4BEHA 2PG4A 3GTOJ 1LQ1A 2Y48A 2CUFA 3I71A 3JREA 4AWXB 2R7OA 1QRYA 3KYDB 4KICA 3O2PE 3KEQA 2P0WA 1G4DA 3MD2A 3M8EA 2FNPA 5E8GA 4A3LJ 2QLZA 4XLPF 5DCMA 3E3VA 3OS1A 5FRNA 2RGVA 1HKSA 3W6KB 5M5YJ 1WI3A 4PGHA 4A6EA 1LDKB 2JUCA 2D5VA 3EDPA 5CVVA 4XORA 3OOUA 5HVQC 4ZYDA 4AYBN 4L9JA 2STTA 4XKBA 3VYTB 4E7KA 2XV4S 3UKGA 1Z3YA 4BE1A
chains in the Genus database with same CATH topology
3J7YJ 2QA4I 3CCJI 1HC8A 1ACIA 1YIJI 3G71I 3G4SI 5GAEJ 1YITI 1VQ6I 3I55I 3CCLI 3I56I 1YI2I 2ZJRF 2OTLI 1MMSA 2ZJQF 3PIPF 3CCQI 2NXNB 4IOAF 1Y39A 3CCEI 3CMEI 3PIOF 2FOWA 4UY8I 3CC2I 2E36A 3DLLF 1VQ8I 2E35A 3CJTB 3CCUI 2QEXI 3CC7I 2OTJI 1YJ9I 1FOWA 1FOYA 3CC4I 3CMAI 1YJNI 3G6EI 1VQNI 1YHQI 1VQ4I 1VQKI 1VQMI 2JQ7A 1VQLI 3CF5F 1FOXA 5JVGF 2K3FA 1VQ9I 1QA6A 3CD6I 2ZJPF 3CCVI 1VQPI 3J7ZI 2E34A 1VQ7I 5GAGJ 5GAHJ 1VQOI 3CCRI 4IO9F 3CCMI 2H8WA 5GADJ 4IOCF 1VQ5I 1YJWI 3CCSI 4V19K 1S72I 5DM7F 5DM6F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y J;  2QA4 I;  3CCJ I;  1HC8 A;  1ACI A;  1YIJ I;  3G71 I;  3G4S I;  5GAE J;  1YIT I;  1VQ6 I;  3I55 I;  3CCL I;  3I56 I;  1YI2 I;  2ZJR F;  2OTL I;  1MMS A;  2ZJQ F;  3PIP F;  3CCQ I;  2NXN B;  4IOA F;  1Y39 A;  3CCE I;  3CME I;  3PIO F;  2FOW A;  4UY8 I;  3CC2 I;  2E36 A;  3DLL F;  1VQ8 I;  2E35 A;  3CJT B;  3CCU I;  2QEX I;  3CC7 I;  2OTJ I;  1YJ9 I;  1FOW A;  1FOY A;  3CC4 I;  3CMA I;  1YJN I;  3G6E I;  1VQN I;  1YHQ I;  1VQ4 I;  1VQK I;  1VQM I;  2JQ7 A;  1VQL I;  3CF5 F;  1FOX A;  5JVG F;  2K3F A;  1VQ9 I;  1QA6 A;  3CD6 I;  2ZJP F;  3CCV I;  1VQP I;  3J7Z I;  2E34 A;  1VQ7 I;  5GAG J;  5GAH J;  1VQO I;  3CCR I;  4IO9 F;  3CCM I;  2H8W A;  5GAD J;  4IOC F;  1VQ5 I;  1YJW I;  3CCS I;  4V19 K;  1S72 I;  5DM7 F;  5DM6 F; 
#chains in the Genus database with same CATH topology
 1XG1 A;  1MMA A;  1UMQ A;  2E1N A;  2COB A;  2ACJ A;  4B8X A;  1S3J A;  1YIJ I;  4IXA A;  3PQK A;  3BDD A;  2LRD A;  3OS2 A;  3U1D A;  4BAY A;  5FGM A;  2LD5 A;  2K4J A;  1J09 A;  1XMX A;  3HOY J;  2C6Y A;  2D2W A;  3LA7 A;  2ECC A;  2XF5 A;  1DP7 P;  4HNT A;  3G1M A;  2H94 A;  5ICE A;  3W2A A;  2DDA A;  2L9R A;  1ETX A;  1XDS A;  2OA4 A;  4UB6 C;  5A2Q Z;  1U3E M;  1GT0 C;  2HOE A;  2CQK A;  3DPU A;  4BY1 J;  3PIO F;  3GTL J;  2CV0 A;  1MSE C;  4UY8 I;  2DAO A;  5HS9 A;  3TGN A;  2IGN A;  4BBS J;  3V8K A;  1RIO H;  4HOB A;  4YFN F;  2HGC A;  1OFC X;  2QCO A;  3DPL C;  5FFX A;  4A2U A;  5H6R A;  1RKT A;  2Z99 A;  2VE9 A;  1MSF C;  1F43 A;  1TC3 C;  4G7O F;  1TQM A;  2EIL H;  4KIB A;  1SAX A;  2OTJ I;  2RQP A;  3CP2 A;  4PSX A;  3GZ5 A;  5D8L B;  4ETS A;  4U87 A;  1Z21 A;  3FXO A;  4C2U A;  3RZD J;  1LDD A;  2DMP A;  3CES A;  2VPL A;  2Z1D A;  2GIZ A;  2WAD A;  3HSR A;  4LIV A;  3OIP A;  1U78 A;  2XB0 X;  3EUK L;  4L0Z B;  3WTZ A;  3H35 A;  2L4A A;  5CQE A;  2WV0 A;  4ZZL A;  2E2J J;  2JA8 J;  4OIN F;  1VQK I;  1FOK A;  3K1P A;  2RV8 A;  2HZT A;  1RNL A;  1UEL B;  4PK4 A;  2A05 A;  5CLS A;  1FOX A;  5JVG F;  3VPR A;  1O3Q A;  3K4J A;  1M1E B;  3OYH A;  4DYQ A;  2R7D A;  5D6F A;  4O3M A;  4BNC A;  1X2M A;  3BZ6 A;  2CO5 A;  4QPO A;  4UUT A;  3RDI A;  1ETW A;  2K27 A;  1IAW A;  2ISZ A;  2H1L A;  1QPI A;  4UNO A;  1XGO A;  2Y0M A;  5GTH C;  1IUY A;  1MNE A;  2DA2 A;  3RZO J;  1YFH A;  1B72 A;  5IYC J;  4BXF A;  1D3Y A;  3CLQ A;  2M45 A;  2K02 A;  3E5U A;  2W00 A;  3QYB A;  1IN7 A;  2HQA A;  4UVA A;  4XKV A;  5IPA A;  2R7T A;  4HAM A;  1X4O A;  4JBA A;  4U7B A;  1REP C;  1BBY A;  1RRJ A;  4PJ0 C;  4ESB A;  4LB6 B;  2GLO A;  2R7U A;  3GFM A;  1QQI A;  1TWC J;  5FLV A;  2LKP A;  5KHD A;  3FX3 A;  3DCF A;  2A68 F;  2CMP A;  2VXD A;  4IEJ A;  4PDK A;  5JFR A;  4BHC A;  2FX0 A;  2WAE A;  2X1E A;  2Y31 A;  3K10 A;  2JSP A;  4HZF A;  4XN3 A;  1GXQ A;  3RQI A;  1AU7 A;  5K5Q A;  1D0Y A;  2M2E A;  4RMN A;  5F1R A;  1O3R A;  4KIG A;  3F3X A;  3J7Y J;  3O3K A;  4E7L A;  3M7G A;  1WJB A;  2Z33 A;  2Y2Z A;  1JT6 A;  3DBR B;  3G4S I;  4E70 A;  1I6H J;  4Y17 A;  3S15 J;  3ZMD A;  3AG4 H;  1IRG A;  5HDK A;  4AD9 A;  1AKH A;  3RPQ A;  3A0H C;  3CJQ B;  3U21 A;  3JTH A;  5IYB J;  2GXB A;  3K70 C;  2MW8 A;  1U0J A;  2HDD A;  1YX5 A;  4EM1 A;  1MBE A;  4IOA F;  4XLC A;  2HYF A;  3GFJ A;  3LNQ A;  1YG2 A;  1S29 A;  4NHJ A;  1HST A;  2WAQ A;  1ZHF A;  1FP1 D;  4I6Z A;  2H6B A;  5H2F C;  3QRF F;  4NNJ A;  2E36 A;  4NB5 A;  3C7J A;  4DYC A;  4LB5 A;  4IF4 A;  2CUE A;  3HSF A;  1I27 A;  1QZE A;  4N9H A;  2PN6 A;  3CC7 I;  3IAS 2;  4FE7 A;  3K1M A;  2DBB A;  4M3D A;  3UR3 C;  1EA3 A;  3E0J B;  4JX6 A;  2YUS A;  4I7H A;  4EGZ A;  4FHT A;  1D0X A;  4JX4 A;  1A35 A;  3ZMV A;  3ZMT A;  4ENM A;  3LSJ A;  3TP0 A;  1Z67 A;  2CW8 A;  1JKQ C;  5C3E J;  1K6Y A;  2R3S A;  1OYI A;  2ESH A;  4BUP A;  3CF5 F;  2LH9 A;  1SVM A;  4IQ4 A;  3BR3 A;  1ORK A;  3H3V K;  5F08 A;  2NS8 A;  2K3F A;  3SFI A;  2VQL A;  2KPM A;  4RDU A;  1UAA A;  2DFF A;  1JTY A;  2VKV A;  2AQF A;  1R5G A;  1X1D A;  2FEZ A;  2GXG A;  3MQ0 A;  1XS9 A;  2DFE A;  2XAJ A;  2QYO A;  1ZR4 A;  1LUJ B;  1BI0 A;  2E60 A;  2LY2 A;  4ZDO A;  1OMI A;  5CVR A;  3GME A;  3F0C A;  3O8G A;  5GAH J;  2ZXH A;  2E2H J;  5HLG A;  2BW3 A;  2KIU A;  3KPH A;  1UG0 A;  3K7A J;  3GYH X;  2QF7 A;  1TWG J;  4F91 B;  1HKT A;  4L5E A;  1K79 A;  3CMM A;  2X1D A;  1ETV A;  1E0E A;  2E5Z A;  3QPL A;  5J1U A;  2XPV A;  4QWQ A;  3AG3 H;  2BXZ A;  4MLO A;  2O6G E;  2JSC A;  5DM7 F;  2K9Q A;  3FWE A;  1BC7 C;  1QZZ A;  2HTS A;  5E1W A;  4GRI A;  3JAM Z;  3OR1 C;  3BTC A;  1BI2 A;  3K4M A;  3G71 I;  2Z16 A;  1VZ0 A;  2LFB A;  1A6Q A;  1BOA A;  4DZJ A;  3R0A A;  3IH3 A;  2M8E A;  1MD0 A;  1RR7 A;  1TWF J;  2WY7 Q;  3R60 A;  2XHK A;  3C2G A;  1HDP A;  2LVS A;  3K1N A;  2JUG A;  3H0G J;  1PUF A;  2HTJ A;  2L7M P;  5JHU A;  1JGG A;  2W57 A;  1LFP A;  4BQO A;  5LRS A;  3F8F A;  4U0Y A;  3KYC B;  2R5Z A;  4KT5 C;  1W0U A;  2E7W A;  4MQV A;  3BJ6 A;  2ELK A;  2P5V A;  3KEO A;  3TQN A;  1L3L A;  2UUZ A;  3BR2 A;  1C0W A;  1FTT A;  2HKX A;  4RLF A;  3OYA A;  2CW7 A;  2CQQ A;  5EG0 A;  4RA2 A;  4BY7 J;  4A3D J;  2MH9 A;  5F04 A;  2HOT A;  2OZ6 A;  2GAU A;  2ZB9 A;  3GFI A;  3Q0U A;  4EM2 A;  2EZH A;  4DJA A;  3IL2 A;  3MKL A;  3TW6 A;  3A01 A;  2MD0 A;  4BE2 A;  5KVR A;  4ZTF A;  4XL9 A;  4KN4 X;  2NVX J;  2IS4 A;  3K0L A;  1BR2 A;  4U88 A;  1JUS A;  3AG1 H;  3ZQL A;  2WAQ N;  2ZFU A;  4GFB A;  4KFC A;  1IZ1 A;  4TV7 A;  3KZY A;  1JT0 A;  3ESW B;  5E17 F;  3FIW A;  3HEF A;  3LOC A;  2L9N A;  1EH8 A;  1YS7 A;  2IA1 A;  2MLK A;  2Q2E A;  5E3O A;  3HRS A;  4JQF A;  4XRF A;  3HC7 A;  3RQ4 A;  2VOO A;  5JLX A;  1RI7 A;  1H9T A;  5B66 C;  5FKN A;  4BEH B;  1STZ A;  4HW0 A;  5M5X J;  2YPR A;  2VUM J;  1B6A A;  2QEN A;  1JHF A;  4HLY A;  4M3G A;  5ICG A;  2VBZ A;  2P7C B;  2GWR A;  2F5E A;  1SD5 A;  5FKL A;  1KQ0 A;  3LA2 A;  3E5X A;  3QWL A;  3BG5 A;  2YX7 A;  3D5R C;  1Y1W J;  1LE8 A;  2DK8 A;  3H5R A;  1ZAR A;  2QQ8 A;  5FRO A;  5DCM B;  4EMS A;  2ID6 A;  5D8K B;  2BXY A;  3F21 A;  1FP2 A;  5E20 A;  2BZT A;  1VFC A;  3CZ6 A;  2O8X A;  3IWF A;  3CCS I;  1Y6I A;  1H8A C;  1SEU A;  1TZL A;  1ZG1 A;  1G59 A;  2JMW A;  3K4L A;  3QQA A;  5L3E A;  3D0S A;  1D8J A;  3OIO A;  2EV6 A;  5E3N A;  4M3B A;  2GQQ A;  3HOV J;  1UG2 A;  2PEX A;  4CIC A;  2H27 A;  4G6T B;  1XDU A;  1WRJ A;  3F6V A;  1RUN A;  5BNG A;  1J5Y A;  1RUO A;  2ME0 A;  2KZG A;  1YIT I;  3AL0 C;  1IV6 A;  1UHM A;  2BV6 A;  5C44 J;  2XGD A;  3OR2 C;  2X48 A;  1IRX A;  3PFY A;  4FIS A;  1O7L A;  4PJM A;  4CUG A;  4B44 A;  4FTH A;  1JXS A;  1T33 A;  3LQR A;  2OPT A;  2VBX A;  5CPR B;  5FB2 A;  1E3H A;  3FXK A;  4QTR A;  1ZYR F;  1NTC A;  3S8P A;  3E6D A;  1SVO A;  4J01 A;  3S2H J;  2VB6 A;  1MBH A;  5E79 C;  3DEE A;  1UJ8 A;  3KET A;  1OKR A;  3F9K A;  5AON A;  3BG6 A;  2DFH A;  2O7O A;  2M9H A;  4B3A A;  1YLF A;  2X1C A;  2Z2S B;  4M72 A;  3TL4 X;  4HRI A;  2DMQ A;  3SEQ A;  3CQZ J;  4M6Y A;  3BPX A;  3HOW J;  3V7R A;  4NDL A;  3U9G A;  2L2O A;  2OZU A;  1VND A;  2GIV A;  4YII A;  5EGO A;  2LRE A;  1H9G A;  2LR8 A;  5F0C A;  1R4M B;  3C1D A;  1XGS A;  3M07 A;  3HBL A;  2VPR A;  1OCO H;  4IHY A;  2V79 A;  2UV1 A;  3P9K A;  3WTX C;  1DU0 A;  2A6H F;  1IXS B;  2VJ4 A;  2ZXJ A;  3OYC A;  1Y0N A;  2XGX A;  3ZR8 X;  1J75 A;  4MQ9 F;  4CSW A;  5E18 F;  4XLF A;  1ETY A;  3IV5 A;  3F22 A;  3HGG A;  2WAF A;  4RAF A;  3GTG J;  5DUK A;  5BQT A;  3I59 A;  1IN4 A;  5D5X B;  1FBU A;  4EAT A;  3NQO A;  2BY3 A;  4BJT A;  2R7S A;  2CWE A;  4IJA A;  2JWT A;  4U0W A;  3QU6 A;  4BHB A;  4R8H A;  4RB1 A;  4X0G A;  4YFX F;  1RPW A;  3T0Y A;  3E1S A;  4QIW N;  5L3G A;  4HYE A;  1TNS A;  4Y4R A;  3L2C A;  4MNU A;  3BG3 A;  1G3S A;  5F0F A;  5HNH A;  5F1J A;  1WJD A;  2FE3 A;  2W7N A;  1B72 B;  2DOD A;  3E6M A;  2IBD A;  2R7W A;  2BY2 A;  4R1H A;  4UHT A;  4BU2 A;  2VC1 A;  3IWZ A;  2YU3 A;  2H6C A;  1WHU A;  1IRZ A;  4Q4Z F;  1IGN A;  1YOV B;  1OYW A;  4X6A J;  1CF7 A;  3HOX J;  4AYB A;  3CDI A;  4XON A;  3DTI A;  5HLH A;  1R58 A;  2NNN A;  4PJN A;  1W5C C;  1HF0 A;  1R49 A;  1HC8 A;  1E17 A;  3JW4 A;  2O0Y A;  5HLI A;  1IW7 F;  2JRT A;  3I4N J;  4CA0 A;  4CCM A;  4A12 A;  2KDO A;  2N8G A;  1GVJ A;  5ICC A;  5LFA A;  3TO9 A;  2MG4 A;  1LNW A;  2EFO A;  2HPM A;  3KP3 A;  1U2W A;  2DFI A;  2ZJR F;  4LGW A;  2BY0 A;  1ZR2 A;  5J40 A;  1OCC H;  1AKH B;  2IS6 A;  1W5S A;  3L2V A;  2KDZ A;  2NXN B;  4E4H A;  2STW A;  3PNT A;  3KZZ A;  3JSO A;  2ZME A;  3N97 A;  2G0E A;  3L2R A;  3KZI C;  5HOD A;  3SZG A;  3D1N I;  3HJE A;  3QPT A;  1RC9 A;  3ELK A;  3TMO A;  2NVT J;  3WTT C;  3VSK A;  1MIJ A;  1P4A A;  2XRL A;  4ENJ A;  2MD5 A;  5IP7 J;  2QQ9 A;  3CCU I;  4M74 A;  1BR1 A;  1D1C A;  1ITY A;  2NOG A;  2ZXI A;  3EUH A;  3PO3 J;  5FLX K;  1WSU A;  2DA5 A;  4U7D A;  5TRD A;  1Z7L A;  3DF8 A;  4C3I J;  2V1U A;  4LJZ F;  1DGW Y;  3GTJ J;  3HG9 A;  2XPW A;  3CUQ C;  1ZRC A;  1MH4 A;  5FD5 A;  1FSE A;  5FRM A;  1ETO A;  5KNL A;  2XF7 A;  3NAU A;  3OWT A;  1OIS A;  3RYR A;  2XKP A;  6PAX A;  3ZMZ A;  4F3Q A;  1VQL I;  2M5W A;  3JRG A;  4AIK A;  2Q1Z B;  2QZ8 A;  3BOQ A;  4MTE A;  3G73 A;  3LFK A;  1NG7 A;  1MND A;  3HM5 A;  1KU2 A;  3LSK A;  3X2Q H;  4KMU X;  4Z2Y A;  4D7N A;  3CCV I;  3S1Q J;  1WJ5 A;  4E6K G;  1R4N B;  2HXO A;  4WWC A;  4KUM A;  5LHG A;  3I4M J;  2YX4 A;  1BW6 A;  5IOZ A;  4G7Z F;  3QU3 A;  2Y30 A;  1ZAO A;  5F6F A;  1MJ9 A;  2GM4 A;  2HVR A;  1XC5 A;  4N9I A;  2B9S A;  4J00 A;  4UUS B;  2EZI A;  4D5C A;  4GO1 A;  1HXD A;  2O5R A;  4UVC A;  4IKF A;  3FM5 A;  5LLQ A;  4C3H J;  3BTJ A;  2BW3 B;  1OQY A;  3ZOB A;  2HWV A;  2JN6 A;  5HLT A;  1JTX A;  4CYC A;  1R9T J;  3QP5 A;  1BL0 A;  4BBR J;  3WTV C;  2W4S A;  2A3S A;  2CSO A;  3ABL H;  1IV8 A;  2NYX A;  1DP3 A;  1UCR A;  1EH6 A;  4DBR A;  3PUB A;  3FXR A;  3CP8 A;  3HXL A;  4MIM A;  4WF2 A;  4P5O A;  3K4C A;  1T39 A;  1S8N A;  3OIQ A;  3LSG A;  4M6X A;  1ACI A;  4AUX A;  2BE5 F;  1A36 A;  2OCC H;  2MBF A;  5HDN A;  1OJL A;  2H8R A;  1HOM A;  2VOD A;  1ZN2 A;  2W25 A;  3BZK A;  3TO6 A;  3WTS C;  3CJN A;  2QKM B;  1Z3X A;  3CCL I;  3CUO A;  3TDZ C;  2BVL A;  4A5N A;  5J8F A;  2P8T A;  3ZQQ A;  2DPU A;  3MEX A;  3NEU A;  5DV5 A;  3BWG A;  1SFO J;  1X19 A;  2DW4 A;  3OYI A;  2PJP A;  3OSG A;  2KJB A;  1T8I A;  2X6O A;  5DTD A;  4CXF A;  3T1B A;  2DN0 A;  2P6T A;  3QYE A;  1PUF B;  4XQF A;  3ECO A;  2HS5 A;  2EZL A;  4K2E A;  3DKW A;  2DT6 A;  1OPC A;  2EPF A;  1FC3 A;  4OMY A;  2NVY J;  4G6D A;  2EV5 A;  1A6I A;  2ZBK A;  1FPQ A;  3KP4 A;  4LLL A;  4DOZ A;  1VQ8 I;  5J1R A;  2W48 A;  5JI6 A;  2DI3 A;  3H36 A;  3HHG A;  5ICF A;  1TWH J;  4V19 K;  2CUZ A;  2Q8K A;  3MZY A;  2EFN A;  5A2Q K;  1FOY A;  2VKH A;  4ON0 A;  3OSF A;  1LPQ A;  3GCM A;  1W36 C;  4R79 A;  2ZC2 A;  1P4W A;  5EG0 B;  2R7R A;  4L5J A;  3G6E I;  2KLO A;  2X0L A;  4L9N A;  2D1V A;  2QVO A;  1LFB A;  3RPU A;  1J59 A;  1ZG3 A;  3C2B A;  4A0X A;  1G6N A;  2L3D A;  3CCY A;  3A01 B;  1E3O C;  1QZY A;  2VAS A;  5DD4 A;  2JZY A;  5TIS C;  1MBF A;  5GPA A;  3SJM A;  2KKO A;  2XRN A;  1VQ9 I;  3FF5 A;  3CD6 I;  4P1W A;  5JR3 A;  2M7A A;  3TED A;  1PUE E;  4DBQ A;  1TL8 A;  2V9V A;  3DTK A;  3MMY B;  2F6C A;  4HF0 A;  1JE8 A;  4CH7 A;  2M0M A;  1H89 C;  2EA4 A;  3R6S A;  3LSM A;  4EJV A;  5GAG J;  1WKM A;  1YQA A;  2F48 A;  2Z5U A;  3FBI B;  2IGM A;  2M8G X;  4AM3 A;  4EM0 B;  2HR3 A;  2ZNZ A;  3D5L A;  4BQQ A;  4W97 A;  5F64 A;  3PM1 A;  5LBQ A;  1MW7 A;  1S6L A;  4IOC F;  4L9T A;  3ZCO A;  3BG7 A;  2X85 A;  4M9X A;  4AC0 A;  4F92 B;  3EYI A;  2IA2 A;  1LE8 B;  1UHW A;  1HW2 A;  1KYZ A;  3GTP J;  1WH5 A;  2VC0 A;  3TO7 A;  2DLL A;  3MVP A;  4UXN A;  3MKW B;  2LTP A;  3BTI A;  3SZT A;  4XK4 A;  4XR6 A;  2M0C A;  1TT5 B;  3OL3 A;  3F6O A;  3E6C C;  3VFZ A;  1FT9 A;  3I64 A;  1K83 J;  4ZYG A;  4FCY A;  2KFD A;  4H0E A;  3RTR A;  3TW7 A;  2LKS A;  3L9F A;  1QHH D;  1ZG5 A;  2CV1 A;  2DT7 B;  2FQ4 A;  5M5W J;  3M9A A;  3FIS A;  2CGP A;  1K6O A;  3QYF A;  4ZYE A;  3GX4 X;  2V7F A;  4YIF A;  3G3Z A;  3ZQI A;  2HQN A;  2W85 A;  5D6E A;  1Z05 A;  3MN2 A;  2X51 A;  2MFZ A;  5FO5 A;  1MJA A;  5LRR A;  1TWA J;  2I5U A;  1PP8 F;  2PX9 A;  4Q47 A;  1B8I A;  4XM3 A;  3DLL F;  2WC2 A;  2XAU A;  4EQQ A;  2HEO A;  2LC2 A;  2DOE A;  4DGW B;  4IX7 A;  3PL8 A;  4ZTJ A;  3S2W A;  2JJ7 A;  4LMY A;  2R93 J;  3R4K A;  2OQG A;  4XSX F;  4A3J J;  3PQJ A;  3BR6 A;  3ECH A;  3H5N A;  1XSV A;  2ZO4 A;  2X6W A;  3ERE D;  3KX2 A;  3OS0 A;  1YRN B;  2XAH A;  5EGO B;  4AIH A;  1ZQ3 P;  1LVA A;  2P81 A;  4ZC3 A;  2RDP A;  1FYK A;  2V9P A;  3MAJ A;  3U2R A;  5BPI A;  2UWM A;  1S5L C;  3S16 J;  5D5W B;  1V5F A;  3ONQ A;  4HNU A;  1IRF A;  2K85 A;  4I0B A;  1MMD A;  1BIA A;  5J4Y A;  3JRC A;  2HI3 A;  5CVJ A;  2XGC A;  1RES A;  1Z6R A;  4CCL A;  3HB9 A;  2E19 A;  3R0J A;  2DT5 A;  3G1L A;  4G9Y A;  4RAZ A;  4C9Y A;  2IW5 A;  3OYG A;  2EQR A;  4E7S A;  2KL4 A;  2NOJ B;  2ISY A;  3VDX A;  2HDW A;  1U8B A;  5CKT A;  2DO7 A;  1D5Y A;  2KZV A;  1U6G A;  3I59 B;  1T0F C;  1V5E A;  2EIN H;  1Q1V A;  1RKW A;  2H09 A;  2PBI A;  3NRV A;  3N4M A;  3H92 A;  3DWL E;  1XMK A;  2M34 A;  4LK0 F;  5L3D A;  3CCR I;  3FXJ A;  2JA2 A;  3DEW A;  1R1V A;  3U1K A;  2LMD A;  1KU3 A;  2HPI A;  2Y69 H;  5CJ9 A;  5EZG A;  2Y75 A;  3DV8 A;  1T2K A;  1IXC A;  1I3A A;  4G94 A;  3TOA A;  4XLE A;  3LSR A;  2BVM A;  4HX4 A;  3JRH A;  3SQN A;  2EIK H;  2MGQ A;  2NS7 A;  5GP9 A;  3T8R A;  1HSJ A;  1T56 A;  1OCP A;  1WVR A;  3HOU J;  2ZKZ A;  2DOA A;  2L0K A;  1CF7 B;  1LEB A;  3CCJ I;  3GBG A;  1MDM A;  2EIJ H;  2MC4 A;  2VBY A;  2GOM A;  3IH2 A;  3RKY A;  2Z9O A;  5KK1 A;  2VE8 A;  3VYR B;  4I02 A;  2QBY A;  3S1M J;  2R7Z J;  4ENN A;  2E2I J;  2VOP A;  2VJI A;  1ETQ A;  3Q3S A;  1O3T A;  4P96 A;  2HYG D;  2NVQ J;  3A2K A;  3ABU A;  3ZQG A;  4HDV A;  2OU2 A;  4KT6 A;  3QAH A;  4Z6Y A;  2VI6 A;  4JOM A;  3JAM K;  3O6B B;  2XGE A;  3JCU C;  1QVU A;  1T0F A;  3WU2 C;  2VIX A;  4BS9 A;  2LBF A;  2F4M B;  2LF8 A;  3LSH A;  3K4K A;  2KRC A;  4PJL A;  2WWY A;  2PLY A;  1V55 H;  2EZK A;  2HFH A;  2ZME B;  2VBW A;  4YEJ A;  5TGT A;  3GTM J;  1I50 J;  4HBL A;  1G3W A;  3LAP A;  1SMT A;  2IAI A;  2QQB A;  2XPU A;  1APL C;  2O3F A;  2QEX I;  3KYL A;  1L0O C;  2XUB A;  1ZTR A;  2XB5 A;  2A61 A;  4GYI A;  1EKE A;  3FMQ A;  3OYD A;  4HV5 A;  3IKT A;  4EGY A;  1PP7 U;  4XIC A;  2M4K A;  4PGG A;  2HVQ A;  2E1M B;  3S32 A;  3WG9 A;  1LFU P;  2QKL B;  3KP2 A;  3H0D A;  1V3F A;  1SFX A;  2VL8 A;  1U5T C;  5EEH A;  2ZSI B;  4WK8 F;  2VN2 A;  2GOX B;  3HHH A;  1QGP A;  1ON2 A;  2PQ8 A;  1AWC A;  3RJP A;  3F8B A;  1ZRF A;  2DTZ A;  1X3U A;  4E7Z A;  4MFE A;  1VTN C;  2R7V A;  1ODD A;  4XMY A;  2IA0 A;  4BL0 B;  1W5T A;  2L7F P;  2EA2 A;  3GWZ A;  2V6C A;  1OCR H;  2WB1 A;  4HLX A;  1W0T A;  1QA6 A;  2WA0 A;  1FIP A;  2ZJP F;  2H1K A;  1BC8 C;  3DBH B;  3ZN1 A;  4GCV A;  3OYE A;  5AIQ A;  2TCT A;  4JP0 A;  4W1U A;  2CU7 A;  4NQW B;  1SFK A;  2W82 A;  4CZZ A;  3TOB A;  2CQ7 A;  4XRS G;  3ZMU A;  2FJ1 A;  1F5T A;  2V1D A;  3VB2 A;  1U8R A;  2L9S A;  3H5A A;  2FBK A;  3QPS A;  1WI9 A;  2ETH A;  2FBI A;  1LVK A;  2ID3 A;  2P6S A;  3BT9 A;  3FBN B;  2ICW G;  4IHW A;  1R5I D;  1Y0U A;  4HDU A;  3MFK A;  4IL6 C;  2FF4 A;  1I5Z A;  2IGK A;  2K5C A;  3IH4 A;  3OYF A;  4II2 A;  3SHF A;  4B43 A;  4BE0 A;  1PJR A;  1JJ8 C;  1V4R A;  3KE2 A;  2PI0 A;  4V2F A;  1Z77 A;  4ZH4 F;  2ZFW A;  2AO9 A;  1U5T A;  4M3F A;  3VYS B;  2HXI A;  4CCK A;  5IP9 J;  4CYC B;  2KIQ A;  5LGT A;  3ZQH A;  3BR0 A;  2QWW A;  3ZGK A;  2DPD A;  1O3S A;  5GAE J;  3W6V A;  4F55 A;  1X1A A;  3CO7 C;  1SD6 A;  2FU4 A;  2ZXW H;  1V54 H;  1HLV A;  4FAS D;  3IUO A;  2BY1 A;  2DA3 A;  4KN7 X;  3PFI A;  2R7X A;  2K86 A;  2M1B A;  3HOS A;  1JGS A;  5IY5 H;  3LA3 A;  1HW5 A;  4FE4 A;  2J5O A;  1OCZ H;  2BGC A;  2JRM A;  5FKK A;  1N75 A;  3DU5 A;  2L5Q A;  1LEA A;  4XOT A;  1YW7 A;  1KZH A;  4ZDL A;  3UNG C;  1FYL A;  4V2G A;  4RM2 A;  5H6Q A;  3KLN A;  3RCO A;  2XVC A;  4GYG A;  4XKW A;  3B6C A;  4ENK A;  1N78 A;  4FET A;  5LEJ A;  2DMT A;  3VOD A;  4FX4 A;  4YIR X;  4OIO F;  2VQH A;  2XSD C;  1K78 A;  3IC7 A;  2HU9 A;  2LY9 A;  1ZK8 A;  2RQQ A;  3HTS B;  2G7H A;  1D1B A;  4XNF A;  1ZLJ A;  2XAQ A;  3REO A;  3V4G A;  3B6A A;  3WHB A;  3RKX A;  2F4O B;  3I54 A;  3HUG A;  1IN6 A;  2KIM A;  3H3U A;  1P9Q C;  4RBO A;  4A3K J;  2GXA A;  3BC8 A;  4Y7N J;  4ESJ A;  1IG7 A;  3B02 A;  1TW3 A;  1DQU A;  2G9W A;  3DPT A;  5J8C A;  1U9O A;  3CLO A;  2L54 A;  3I9V 2;  2DA1 A;  1FSH A;  4IHS A;  3GZ6 A;  2J5P A;  3FXU A;  1B4A A;  1TQI A;  1IF1 A;  2CFX A;  1WJC A;  4JX5 A;  4WCG A;  3FM3 A;  3LAJ A;  3FXM A;  3VOE A;  4AID A;  5AIP A;  4G8X A;  1SFE A;  4RB2 C;  1B59 A;  1MBJ A;  4OWR B;  4EV0 A;  5EEG A;  3I0T A;  4HQE A;  4PCQ A;  1VQO I;  2MYS A;  2OQR A;  4ZYH A;  4XKC A;  4IO9 F;  1QU3 A;  4BDY A;  2IRF G;  3NAR A;  2AHQ A;  2VJJ A;  1T95 A;  2WB1 N;  4LD5 A;  2XDV A;  1P7I A;  2BBY A;  2CJJ A;  1VQ5 I;  4AVZ A;  3JRD A;  3V7S A;  1CGP A;  4L0Y B;  2XAF A;  1GV5 A;  5E3M A;  3KFW X;  1EJ9 A;  1LDJ A;  1YS6 A;  2K9M A;  3BRO A;  1Y1V J;  2HKO A;  3EPZ A;  1HCR A;  2R7Q A;  1XB4 A;  4U0V A;  4JYK A;  1F4K A;  2VKD A;  5EZH A;  4BXX J;  1Z0X A;  4H4K C;  2OD5 A;  2W84 A;  4UVB A;  3V42 A;  5HOO A;  3M1E A;  1R1T A;  3TKY A;  3K2A A;  4EEF G;  1ETK A;  1P4X A;  1B1B A;  2V1N A;  4HX8 A;  1LKX A;  3RI4 A;  1YI2 I;  1P92 A;  4HEA 2;  2O9L A;  1WQ2 A;  4CHU A;  2ZJQ F;  1WCM J;  2LOO A;  2X6Y A;  2V6E A;  1HW1 A;  3CCQ I;  1NK3 P;  2RC4 A;  2EBI A;  3ABT A;  4PSW A;  4CCO A;  1WJF A;  3V8L A;  2L9V A;  3GEZ A;  4II3 A;  1JJ6 C;  1FLI A;  1HA8 A;  5HDG A;  5KAF C;  4I99 C;  4DNC A;  1J0R A;  4UUV A;  1X3W B;  3CJR B;  2GA1 A;  1MGT A;  4PJJ A;  1TNT A;  3CDL A;  4CCJ A;  2V26 A;  2VJ5 A;  4DZP A;  1R00 A;  3LSI A;  3FXL A;  4A0Z A;  2KQR A;  1IXR C;  3ABM H;  3WE3 A;  2UXX A;  4RM3 A;  4RAG A;  5FKM A;  4F93 B;  2UXN A;  3DKX A;  5EYR A;  3MCZ A;  4ITV A;  2MAB A;  4I98 B;  2IS2 A;  2DTR A;  3OYK A;  4BYY A;  1T38 A;  1Z1D A;  2CUJ A;  3OYJ A;  4BDZ A;  2PJR A;  2COM A;  1TLH B;  3WHC A;  4LLN A;  3BCA A;  1T98 A;  4Y3O A;  4IRH A;  3ISP A;  3GW2 A;  1F36 A;  1SAN A;  4FX0 A;  2YSR A;  2UZK A;  1VI0 A;  4ZJZ A;  4QLC U;  3GZN B;  1R1U A;  3JSP A;  4HSR A;  2IXS A;  3WGG A;  2FA5 A;  5E1X A;  2R7F A;  3WG7 H;  4XSZ F;  5F0H A;  2HOS A;  1XSD A;  1I39 A;  3F23 A;  2XF6 A;  4PFO A;  4NC6 A;  2ZSH B;  3EQL F;  3EYY A;  4O5V A;  1USS A;  4RB0 A;  3BQY A;  1VQP I;  1QHG A;  3SFZ A;  4IHV A;  1WH7 A;  2DYS H;  3M8J A;  1YX3 A;  2R4G A;  3BLY A;  4PFP A;  1RET A;  4E7I A;  2IT0 A;  4XLN F;  3RPU D;  3J81 Z;  4N4N B;  5K5O A;  5IP6 A;  1X3Z B;  3C18 A;  4HNV A;  2YS9 A;  2ELH A;  4WXC A;  5IYD J;  2VQC A;  3S3O A;  2DJI A;  2PMH A;  3G1O A;  3ZQC A;  3HPH A;  1QPM A;  1RZ4 A;  4P55 A;  1W7P A;  4BQN A;  2JT1 A;  3WTY C;  3LL7 A;  1QVT A;  3PSF A;  3RSN A;  4A3C J;  3H9J A;  5L3B A;  1HKQ A;  2E1C A;  1BJZ A;  2V9K A;  3H1C A;  2JTV A;  3VWB A;  1WZ2 A;  5ED4 A;  2FQ3 A;  3W6J B;  1F9N A;  2ZNY A;  1JUP A;  5EJC A;  3ZP5 A;  5M3M J;  2K7L A;  1X2N A;  4AU7 A;  4HG2 A;  1ZRE A;  4M9S A;  4YG2 F;  2CFO A;  5D4R A;  2LY1 A;  1BJA A;  3MWM A;  4Y15 A;  1BOB A;  2EJR A;  2NVU B;  2DDB A;  2RNJ A;  1MDM B;  3I55 I;  3GXO A;  2M7B A;  3I56 I;  4A69 C;  1Z7U A;  3K69 A;  3F8C A;  3OY9 A;  1VF9 A;  1P7J A;  3A1Y A;  3EUA A;  2QBY B;  4XLH A;  4I0A A;  3PIP F;  2M4G A;  3LSP A;  2EH3 A;  3CUQ A;  1SFU A;  3KIO A;  1YE9 A;  2QM3 A;  3SDB A;  4BJ6 C;  2XC7 A;  4LG0 A;  2JA6 J;  3JRF A;  2L7K A;  1UB9 A;  5FJ8 J;  3CME I;  2M87 A;  1YTY A;  5IT9 Z;  2L01 A;  3TBI A;  2FXA A;  3IRQ A;  3VSL A;  1ZGA A;  3W2W A;  1ZKG A;  2CW0 F;  3A02 A;  3MKY B;  2LBF B;  4QSH A;  4LFU A;  2XAG A;  4IPA A;  4LOC A;  4EJU A;  3O8H A;  1X4P A;  4B3X A;  1YJ9 I;  3HOT A;  1X1P A;  3J80 Z;  5BOX A;  3OOP A;  1FEX A;  2AQE A;  2Y0S A;  5LHI A;  4IZZ A;  3V8J A;  1UFM A;  1J9I A;  4CCN A;  4YEL A;  4LIU A;  2KP6 A;  5HS7 A;  1VQN I;  2ME6 A;  1ERD A;  3A0B C;  2OUM A;  2F5V A;  1KQ8 A;  4A5M A;  2DOF A;  5J3L A;  2JQ7 A;  2JA7 J;  3ASO H;  4B47 A;  4CZC A;  2R5Z B;  1DPR A;  5CQG A;  3HTU A;  2K3P A;  1RR8 C;  3E97 A;  5EF6 A;  1P6R A;  5LHH A;  4OMZ A;  2DMN A;  4NBQ A;  4KIT B;  1ZRD A;  3ABK H;  2FD5 A;  3F8N A;  1BIB A;  2EWN A;  4S0H B;  4EJO A;  2B7E A;  1R7J A;  1G3T A;  2EIM H;  3GLL A;  1D0Z A;  2OF7 A;  3BZC A;  1G3Y A;  1W1W E;  3ZRG A;  4XRS A;  1TP4 A;  5L3C A;  3JR9 A;  5E1Z B;  3DLA A;  5HNF A;  3GTK J;  3HGY A;  3QPH A;  1IDY A;  2AS5 F;  3LFU A;  4Y33 A;  3BPV A;  1XN7 A;  4RGS A;  2JVG A;  4GDF A;  4NC8 A;  4N4O B;  2A6E F;  1FBS A;  1KQ9 A;  5GAD J;  2CRG A;  1OLT A;  1SD4 A;  5ILV A;  3M1C A;  3IRR A;  3DEU A;  1PYV A;  1XGN A;  5EDN A;  3C2H A;  2IJL A;  2KRH A;  4A3F J;  2RKH A;  1R36 A;  3AAF A;  3CTA A;  2R92 J;  4BKX A;  2Q2E B;  2LSO A;  4M6V A;  3E5Q A;  2IGO A;  2QA4 I;  1U5T B;  2HVS A;  4E7J A;  2XIG A;  3L1P A;  4EJT A;  2P7V B;  2M3A A;  4QPQ A;  1ZEL A;  5ILU A;  2NAZ A;  3KEY A;  2X9D A;  5FKO A;  4B1R A;  1LB2 A;  1FMW A;  1SC7 A;  2X6X A;  4L9V A;  2DA7 A;  2OJE D;  3K70 D;  3FMR A;  5E8I A;  4OU0 A;  3ZMS A;  5K7Z A;  4A93 J;  3S14 J;  2EFQ A;  1AOY A;  2VKE A;  3P9I A;  4IHT A;  1GHC A;  1TT0 A;  2XKO A;  2YR2 A;  3PSI A;  3CCE I;  1B9M A;  2QUF A;  1DUX C;  4CYD A;  3FXQ A;  4MHG A;  3M8F A;  2OC6 A;  4MFD A;  2W24 A;  4RS8 A;  4BAC A;  4OIR F;  2GZW A;  1JUM A;  2HYJ A;  2DK5 A;  4RAY A;  5J4V A;  2P5L C;  3CMY A;  3S1R J;  2O61 A;  4RLQ A;  4NUB A;  3SYT A;  2KHM A;  3FK7 A;  2L02 A;  3ZXS A;  3Q5F A;  4A3E J;  3S2D J;  5L3F A;  3CF2 A;  3WU1 B;  1K78 B;  5CVU A;  2DA4 A;  1YHQ I;  2HZD A;  3OMY A;  1T08 B;  2FOK A;  1VQM I;  2A5W A;  1HDD C;  2VXZ A;  3W3C A;  4GGG A;  3HUG B;  5LGN A;  2A69 F;  2R5Y A;  2EFW A;  4X1E A;  2EB7 A;  2KT0 A;  4P9U A;  1ZGJ A;  2Y9Y A;  1PDN C;  2Q0O A;  1I6X A;  2Y0S N;  2E34 A;  2MH2 A;  1FYM A;  3COA C;  3K4B A;  3W2V A;  2OBP A;  3S3M A;  1TQP A;  3D5S C;  2FRH A;  3PUF A;  4FT8 A;  3OYB A;  1DPU A;  1K4T A;  1EV7 A;  4KJZ A;  4B48 A;  5DUI A;  4HF1 A;  3DTE A;  3L2U A;  1XCB A;  5J47 A;  2FUG 2;  3V7C A;  1YW9 A;  3Q0W A;  4XOP A;  4AVP A;  3SEZ A;  3CCM I;  4NC7 A;  4PZJ A;  4BJ5 C;  2JPB A;  3WOD F;  5D5V B;  1S9H A;  5KCM A;  3ASN H;  4OIP F;  4UV8 A;  3MZ8 A;  2O03 A;  1MKM A;  4MO7 A;  2OV7 A;  3FK6 A;  3DKY A;  1YJW I;  3AL0 B;  1U9N A;  2OAZ A;  2QSH X;  3S3N A;  3I5U A;  1R23 A;  5HS8 A;  4Y13 A;  1S72 I;  1IC8 A;  5ERI A;  3F72 A;  3I3L A;  2M30 A;  3BP8 A;  1DDN A;  2R0Q C;  5JHF A;  2Y9Z A;  5DS9 A;  1Y8Q B;  4FQG A;  1F1Z A;  2MA3 A;  2VQG A;  3OYN A;  1MZB A;  3BY6 A;  1IUF A;  4LK1 F;  3KP5 A;  3P9C A;  2FML A;  4IVN A;  2I10 A;  1Y39 A;  2WTE A;  3S17 J;  1KU9 A;  4ESF A;  5B1B H;  2JPC A;  2JVH A;  5E3L A;  4XRM A;  4LLG F;  1G8X A;  1EH7 A;  4ANJ A;  2LK2 A;  1ZLK A;  1SAU A;  3BG9 A;  2EK5 A;  3WGH A;  1ENH A;  5C4J J;  4DYR A;  1O7F A;  4HX7 A;  1XCV A;  4KIS A;  1OCT C;  1PVE A;  2PMU A;  2CQX A;  3M4O J;  2F2E A;  1XGM A;  4MTD A;  2KMU A;  1UST A;  1AA7 A;  4M73 A;  4UV9 A;  1IDZ A;  1R6R A;  1B9N A;  3GO5 A;  2BHZ A;  4UUS A;  2HQR A;  1SVL A;  1IN5 A;  4I76 A;  3DBL B;  1OYY A;  4BH9 A;  2FSW A;  3E6B A;  3M3Y J;  3J7A Y;  1BI3 A;  1E2X A;  1FJL A;  3K9T A;  2IPQ X;  4N0B A;  4RGR A;  2PJR B;  2HNH A;  4M9Z A;  1ON1 A;  2IEK A;  2DQL A;  1IJW C;  3FHZ A;  1S7E A;  1WPK A;  2HOA A;  1NG6 A;  2Z3Y A;  5B3S H;  5B5E C;  2QQA A;  2RN7 A;  3BR5 A;  5IT3 A;  2XRO A;  2P4W A;  4ZZD A;  4HQM A;  1R71 A;  1N25 A;  2RVC A;  5D5U B;  2DA6 A;  1ZH5 A;  5K7H A;  3NWS A;  3N05 A;  2I8D A;  1A04 A;  2EFP A;  1AHD P;  3A4C A;  2YU9 J;  2NNY A;  4YFK F;  1VQ7 I;  1BA5 A;  5ILS A;  1ULY A;  2MSY A;  2DXI A;  3ML6 A;  3DFG A;  3GTQ J;  4XLA A;  5TJJ A;  3BJA A;  3DQV C;  9ANT A;  3HRU A;  4KA4 A;  4L18 B;  2H8W A;  1UZC A;  2CH0 A;  2K40 A;  2TDX A;  2IS1 A;  3HOZ J;  5LEK A;  1W4M A;  2F5C A;  1W7P B;  3K4N A;  4Q5S F;  4C30 A;  1I1G A;  3FDY A;  3DU6 A;  5DM6 F;  1H0M A;  3K6G A;  3EET A;  2G7U A;  3VYU B;  2P5K A;  4F7Z A;  4DQ2 A;  2CV2 A;  3KP7 A;  2NS0 A;  3IAM 2;  2CYY A;  1MMG A;  4A6D A;  4XID A;  5B1A H;  2AXT C;  2CQN A;  2FMY A;  1XMA A;  2VT2 A;  3GFL A;  1MMS A;  2ESN A;  1NH3 A;  3A03 A;  1JKR C;  4IHX A;  4RGU A;  2ADU A;  2GA2 A;  5M3F J;  4XBF A;  1R22 A;  1YO5 C;  2WBM A;  2GBY A;  3ULQ B;  3TP3 A;  4Y52 J;  5D4S A;  2PFB A;  3GUD A;  3LMM A;  3CUQ B;  3H9Q A;  2FOW A;  1WJA A;  4L5I A;  2A07 F;  3CC2 I;  2K9N A;  4LG0 B;  4BQA A;  4CDG A;  2EV0 A;  3HKZ A;  3HDD A;  1YYV A;  3CJT B;  1MBG A;  3P7N A;  3HIF A;  4KDP A;  1G2H A;  4MGR A;  1A5J A;  1TBX A;  4LIT A;  2XAS A;  1FOW A;  5FLM J;  3PNV A;  2LG4 A;  3CC4 I;  4B09 A;  2LF7 A;  4M71 A;  2RAE A;  4IRG A;  4Q48 A;  5K7F A;  1YJN I;  4KYW A;  3G2B A;  1HBX G;  3ROU A;  5BPD A;  3S93 A;  4A3G J;  2X4H A;  1NHA A;  1K61 A;  1NK2 P;  1TW2 A;  1LJ9 A;  3ZQ7 A;  1EF4 A;  4A0Y A;  1KA8 A;  3SXY A;  2MC3 A;  2O8K A;  3J7A O;  1QO0 D;  1IN8 A;  3AFH A;  2LYC A;  2DU9 A;  2NRA C;  4IRI A;  4D0P A;  3WTU C;  3WTW C;  3GF2 A;  1J2X A;  2MLG A;  3B73 A;  4A3B J;  3J7Z I;  4EVI A;  1GUU A;  2B0L A;  5LGU A;  3FHN A;  3AG2 H;  3L00 A;  1XSX A;  1KGS A;  3DXJ F;  4C2M J;  3L7W A;  4I09 A;  5H20 A;  5J1Y A;  2LDU A;  1BI1 A;  3ZN0 A;  5IOY A;  4CGZ A;  1KU7 A;  3WU0 A;  5CVI A;  4IQJ A;  2BOL A;  3PJR A;  2ELJ A;  3HRM A;  4E7H A;  1S7A A;  2LP0 A;  1Y8R B;  4C3J J;  4WXD A;  5F27 A;  1T6S A;  1XPX A;  5DYM A;  3MZH A;  2E5N A;  2E7X A;  2KIF A;  3HYI A;  3Q0V A;  1GDT A;  1OR7 C;  3RKW A;  3LWF A;  2CS3 A;  2D45 A;  2AXL A;  2VON A;  2WV1 A;  4PUS A;  4D1Q A;  5JVT A;  4HPQ A;  2PMZ A;  1KON A;  3FKI J;  2K9S A;  2ZCW A;  4KMF A;  1S7O A;  2DQR A;  4ZDP A;  1FX7 A;  5JLW A;  1ZGW A;  4I2O A;  3TDU C;  3ZQF A;  3LQQ A;  4LG3 A;  3KLO A;  3QP6 A;  3MKZ A;  1MNM C;  1YRN A;  1W7P D;  4ZYA A;  1X1C A;  1Z91 A;  4P9F A;  1UHS A;  2BEO A;  1FMV A;  2OTL I;  1MMN A;  4G12 A;  1GXP A;  4A3M J;  4HA8 A;  4BHP A;  1WWX A;  3IKV A;  2A5Y B;  3AKZ A;  5DDG A;  5DD8 A;  3WGI A;  4BGD A;  1P2F A;  3P5J A;  2DCE A;  2OCE A;  1FWZ A;  3JRB A;  3L2Q A;  1CQT A;  2VLA A;  3H3Z A;  1QNT A;  4WXH A;  4WX9 A;  4B4C A;  1YW8 A;  3VEP A;  2E35 A;  1FBQ A;  3Q9S A;  3RIR A;  3OYL A;  3PO2 J;  1IO2 A;  3QOE A;  5DEQ A;  3QOD A;  4UB8 C;  4OAZ A;  1BN5 A;  1OR7 A;  2E1O A;  1JHH A;  2ZME C;  5BMZ A;  1FNN A;  2XSJ C;  2F5D A;  1MJB A;  4BXU A;  4J19 A;  1MBK A;  3BCB A;  1ONV A;  3CDH A;  4OAY A;  4AIJ A;  2L4M A;  5K5R A;  1FZP B;  3HL2 A;  3HZJ A;  1GLN A;  2B63 J;  1O57 A;  3HKZ N;  2QSG X;  3C3W A;  2A6T A;  2E1M C;  1Z9C A;  5K1Y A;  4HV6 A;  4EJW A;  1HQC A;  1E3P A;  3JTG A;  2QGU A;  3EUH C;  4S04 A;  4MEY F;  1B8I B;  3DP7 A;  2HDC A;  2R5Y B;  3E7L A;  4XN0 A;  4A3I J;  3HPG A;  2V4J C;  1I3Q J;  4HF2 A;  1MH3 A;  2W1O A;  4MEX F;  2V1X A;  2D1H A;  3Q9V A;  5KAI C;  4D9J A;  2DMU A;  3LST A;  5J6X A;  3JRA A;  1QBJ A;  2IVM A;  4OIQ F;  2RNG A;  4HST A;  4GXO A;  1R5H A;  3PNY A;  3BR1 A;  2KJC A;  1Q1H A;  3SZP A;  5CYV A;  3T8T A;  1POG A;  3KCC A;  4KNY A;  2F5F A;  1GV2 A;  3WE2 A;  4ASN A;  5GTI C;  2QSF X;  1WFX A;  2IP2 A;  2DYR H;  4O6J A;  2VT3 A;  3F8M A;  3RKQ A;  1FIA A;  1XD7 A;  3J81 K;  1JKP C;  4ABZ A;  3FMS A;  1BR4 A;  3K2Z A;  1YIO A;  3CO6 C;  1K7A A;  1D8K A;  1A31 A;  1DU6 A;  2L7Z A;  4RB3 C;  1JKO C;  2CG4 A;  3NWT A;  3HSE A;  1FTZ A;  2KRF A;  4S05 A;  3R61 A;  2LKX A;  3BQZ A;  2BHY A;  2DJN A;  3L09 A;  4CO8 A;  1DGR M;  2K9L A;  4YRV A;  4I01 A;  3L2W A;  1VQ6 I;  3BTL A;  2WY8 Q;  1N77 A;  3BJO A;  3I53 A;  4G6Q A;  4C2T A;  5DCF A;  1WJE A;  4D7M A;  1X1B A;  1X58 A;  3S1N J;  4M3E A;  4D5F A;  3HRT A;  3T5X A;  5FFZ A;  5FLX Z;  2RRE A;  3OYM A;  1FY7 A;  1SD7 A;  2PMZ N;  5FD6 A;  1XX5 A;  2HQ5 A;  2F4I A;  3GLX A;  1BM9 A;  1KYW A;  2LNB A;  4KIF A;  2K4B A;  5LD2 C;  3JRI A;  1V5G A;  2FNA A;  4OOI A;  2TRT A;  3FZV A;  1Z6T A;  1D1A A;  3KP6 A;  1SMY F;  1BW5 A;  3ZPL A;  3IHU A;  1O4X A;  3H9G A;  1WGX A;  4NQW A;  1H88 C;  2LLK A;  3OV8 A;  4RGX A;  1TTY A;  1XTA A;  4JK1 X;  3I4P A;  3CMA I;  5IT9 K;  1W36 D;  4G7H F;  3OL4 A;  3GVA A;  2JK3 A;  3I58 A;  2BYV E;  2E71 A;  1J7K A;  3FKJ A;  3QOP A;  1VQ4 I;  4F52 A;  3ERM A;  5BS6 A;  5GPC A;  5EEA A;  2ECB A;  2JA5 J;  4DIQ A;  3J80 K;  3RYP A;  1K4S A;  5C4X J;  1GVD A;  2KIS A;  4DW6 A;  3IP4 B;  3SDG A;  1Y56 A;  2FBH A;  1D5V A;  1JI8 A;  1I1S A;  2ZJ2 A;  4BEH A;  2PG4 A;  3GTO J;  1LQ1 A;  2Y48 A;  2CUF A;  3I71 A;  3JRE A;  4AWX B;  2R7O A;  1QRY A;  3KYD B;  4KIC A;  3O2P E;  3KEQ A;  2P0W A;  1G4D A;  3MD2 A;  3M8E A;  2FNP A;  5E8G A;  4A3L J;  2QLZ A;  4XLP F;  5DCM A;  3E3V A;  3OS1 A;  5FRN A;  2RGV A;  1HKS A;  3W6K B;  5M5Y J;  1WI3 A;  4PGH A;  4A6E A;  1LDK B;  2JUC A;  2D5V A;  3EDP A;  5CVV A;  4XOR A;  3OOU A;  5HVQ C;  4ZYD A;  4AYB N;  4L9J A;  2STT A;  4XKB A;  3VYT B;  4E7K A;  2XV4 S;  3UKG A;  1Z3Y A;  4BE1 A; 
#chains in the Genus database with same CATH homology
 3J7Y J;  2QA4 I;  3CCJ I;  1HC8 A;  1ACI A;  1YIJ I;  3G71 I;  3G4S I;  5GAE J;  1YIT I;  1VQ6 I;  3I55 I;  3CCL I;  3I56 I;  1YI2 I;  2ZJR F;  2OTL I;  1MMS A;  2ZJQ F;  3PIP F;  3CCQ I;  2NXN B;  4IOA F;  1Y39 A;  3CCE I;  3CME I;  3PIO F;  2FOW A;  4UY8 I;  3CC2 I;  2E36 A;  3DLL F;  1VQ8 I;  2E35 A;  3CJT B;  3CCU I;  2QEX I;  3CC7 I;  2OTJ I;  1YJ9 I;  1FOW A;  1FOY A;  3CC4 I;  3CMA I;  1YJN I;  3G6E I;  1VQN I;  1YHQ I;  1VQ4 I;  1VQK I;  1VQM I;  2JQ7 A;  1VQL I;  3CF5 F;  1FOX A;  5JVG F;  2K3F A;  1VQ9 I;  1QA6 A;  3CD6 I;  2ZJP F;  3CCV I;  1VQP I;  3J7Z I;  2E34 A;  1VQ7 I;  5GAG J;  5GAH J;  1VQO I;  3CCR I;  4IO9 F;  3CCM I;  2H8W A;  5GAD J;  4IOC F;  1VQ5 I;  1YJW I;  3CCS I;  4V19 K;  1S72 I;  5DM7 F;  5DM6 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...