3G4SI

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3g4sI00
1VQOI 1VQ8I 3CCQI 1YIJI 5DM7F 1FOYA 2QA4I 3CCEI 1MMSA 2NXNB 1YJ9I 1VQKI 3CCLI 3PIPF 5GADJ 3CMAI 3DLLF 3J7YJ 1HC8A 3G4SI 3CC2I 3PIOF 1YHQI 4IO9F 2QEXI 3CC7I 5GAEJ 2FOWA 1Y39A 2OTLI 2JQ7A 4V19K 3CCJI 4IOCF 3CF5F 1VQ6I 1YI2I 1S72I 5GAHJ 3CJTB 1VQ5I 3CD6I 2E34A 3I56I 5DM6F 1QA6A 4IOAF 1VQ7I 2ZJQF 3CCRI 2E35A 1YJWI 1FOXA 3G71I 1FOWA 5JVGF 2K3FA 3J7ZI 2OTJI 2ZJPF 3CCUI 3G6EI 2E36A 3I55I 1YJNI 2H8WA 1VQLI 1ACIA 3CC4I 3CCSI 3CCVI 2ZJRF 3CCMI 3CMEI 1YITI 5GAGJ 1VQNI 1VQ4I 1VQ9I 1VQMI 1VQPI 4UY8I
chains in the Genus database with same CATH superfamily
5F1JA 2BVLA 1BN5A 2AXLA 2DMUA 3J81Z 1ON2A 2L5QA 3IAM2 5DV5A 1VFCA 2Y48A 5J4VA 5IP9J 1ODDA 3PUBA 4L9JA 4C30A 1KQ0A 4AIKA 3LAPA 5DCFA 4P9UA 1AOYA 1H9GA 3S1QJ 3A03A 5E20A 3CCEI 5CVVA 2DFEA 3KP3A 1E3PA 2H27A 4Y15A 3U2RA 2G7HA 3M9AA 4JQFA 4YFNF 3FK7A 4XLFA 4ZDLA 4XONA 1OCCH 1XB4A 2V1NA 4L5IA 2BY3A 1QNTA 3S93A 5HOOA 2IS6A 2L7MP 3AL0C 3K4KA 3ASOH 2Z5UA 4AVPA 1K83J 5IYBJ 3DTIA 4EEFG 3QOPA 2FU4A 1HC8A 3LMMA 3HTUA 1SC7A 1C0WA 1D5VA 1KONA 3MZYA 4JBAA 2KJCA 3WGGA 2XC7A 3CC2I 3HC7A 3K69A 3ZOBA 2VQHA 2O5RA 2LBFB 5EGOB 3I3LA 2O61A 3O8HA 2ZKZA 3TQNA 1QRYA 1WHUA 2QEXI 3TGNA 1X19A 4MQ9F 3ROUA 3PL8A 1R6RA 4CUGA 1B4AA 2C6YA 2WAQA 1RZ4A 3T1BA 3UKGA 2JN6A 3UR3C 4ZYHA 2CS3A 3H3ZA 4NDLA 3L7WA 3L2RA 4MHGA 3G1LA 3PFIA 4KT5C 3ZRGA 3QPLA 2P4WA 3DEEA 1TNTA 2ID3A 2XKPA 5H2FC 2LMDA 4KFCA 3EUHA 2CUFA 2DI3A 5M5XJ 1YJWI 4MNUA 4C3IJ 3GTKJ 2COBA 3HSEA 1XGSA 3ZQCA 3QAHA 1ZRCA 3FHZA 3H5AA 5GTHC 3E0JB 4BE0A 1JT0A 1KA8A 1EF4A 3SDGA 3D1NI 3DBLB 1E2XA 2DLLA 4P96A 2OCEA 4IL6C 3I59B 1ZKGA 3K0LA 4HAMA 3V8KA 3OYBA 3S8PA 3CMEI 2RN7A 4B4CA 3I0TA 3MKLA 2Y0MA 1O7LA 4YRVA 3KP7A 3OL4A 4Y17A 5LRRA 2K27A 2KP6A 1WQ2A 2L4AA 1R1UA 3BR1A 1VQPI 1GV2A 3H3UA 1IN6A 5JFRA 1FBUA 2P7VB 4Q4ZF 4UB6C 2Y69H 3ML6A 5BMZA 3F6OA 5HLHA 1ZHFA 4DYRA 2DOAA 1F1ZA 1I27A 3QOEA 1TZLA 1OJLA 4Z2YA 3MN2A 2DT6A 4HZFA 5L3CA 1MNDA 2ZCWA 1S3JA 2CRGA 2D1HA 1RPWA 2VJIA 2WY8Q 1BI1A 4D9JA 3IKTA 3IKVA 1LJ9A 3MZ8A 3OY9A 2HPMA 2PMUA 2QQ9A 4PFOA 1U5TB 3FMRA 2H8RA 1AWCA 3OL3A 4XLAA 3OYMA 1H89C 1I1GA 2ELJA 4QWQA 1ZGJA 1YTYA 1B8IB 2R5YA 2JA5J 2LKSA 3AG2H 5F08A 2DJNA 4A3IJ 2J5PA 2BV6A 2VPLA 1T38A 1MIJA 4A3BJ 4IO9F 4N0BA 1RNLA 3GZ6A 3LQQA 2EA2A 4XLHA 2K4BA 3VDXA 4Y3OA 2LG4A 2EJRA 3GTPJ 3SYTA 3W6KB 2LY2A 1MMAA 2KZGA 3K4NA 5C3EJ 1G3WA 2F6CA 4E6KG 2CUEA 1FY7A 5GP9A 2K85A 2M8EA 4S04A 3IL2A 2KDZA 1LQ1A 1HDDC 2XSDC 2JRTA 3U9GA 5EG0B 2V1UA 2DDAA 2BE5F 2HWVA 4RLFA 3P9IA 4OIRF 4EM0B 1U5TC 1X4OA 2GWRA 1WSUA 1ZAOA 1JKQC 3PUFA 3RI4A 3KYLA 3LFKA 3N97A 4UNOA 3HHHA 3KP2A 2EK5A 2M2EA 5JVGF 1XC5A 1Z6RA 3E97A 4E7JA 4NNJA 2HS5A 4ESBA 2W57A 4JX5A 1I3QJ 5K1YA 3F9KA 4GCVA 5KCMA 4HF0A 2R5ZB 2IPQX 4WWCA 2HKXA 3HBLA 2GA1A 2H8WA 1V54H 2BGCA 1YIOA 3M4OJ 2LK2A 3BZ6A 2QSGX 4UVCA 2JSPA 3M8EA 1O3TA 4JP0A 3QWLA 1YITI 1TW2A 5F0HA 1OR7A 5K7HA 3GYHX 3I64A 4OIQF 4OAZA 3IRRA 3GTOJ 1YYVA 3CLQA 2P7CB 1I6HJ 3OS0A 2LRDA 3PNTA 1HF0A 3OWTA 4JX6A 1OQYA 3BC8A 4DJAA 1MJ9A 4HX8A 2PX9A 3V4GA 3MKZA 2QSFX 3RZOJ 1WRJA 1BM9A 1LEBA 1A6QA 2HQAA 1TBXA 3L2UA 3CCQI 5LLQA 1F43A 2MG4A 3SZGA 4OU0A 4AYBA 2Q1ZB 1W7PD 4GYIA 3NWSA 4LIVA 4RMNA 1F5TA 2N8GA 3L1PA 2KKOA 3GBGA 1JUMA 5ICEA 4WK8F 4DIQA 5FKNA 2O03A 4BNCA 5H6QA 3OYJA 3G3ZA 4XKWA 3ZQ7A 4IRIA 1SMYF 3H1CA 1RR7A 2RNJA 1F9NA 2CW8A 3WTUC 4ESFA 1ZQ3P 3OIQA 1TNSA 4ABZA 4BE2A 1NH3A 3NQOA 3ZMUA 1FMWA 2LDUA 2QCOA 4P55A 3PJRA 4AYBN 3OYIA 4CZCA 1XN7A 4OIPF 2DOFA 1DP3A 4KITB 3OSGA 3V7RA 4OAYA 2WA0A 3RKYA 3LSHA 1U8RA 5HLGA 4ENKA 2UZKA 4EGYA 4RB1A 3CC7I 1LEAA 2LY1A 3ECHA 4ZYDA 2YU9J 1FT9A 3AG4H 4XSXF 4G8XA 3ZP5A 4AD9A 3ERED 4IOCF 1J9IA 3RDIA 2VXDA 2QBYA 2JMWA 3NARA 3WU1B 4IPAA 3OYEA 4HLXA 2ESNA 2QF7A 5EEGA 2XDVA 1XGOA 1MMDA 2IGMA 3KYCB 4A5NA 4H0EA 5BNGA 2PJPA 1O7FA 1SD5A 2IS1A 2IGNA 2LY9A 1D3YA 2XAHA 4ZZLA 4F3QA 5ERIA 4S0HB 4CH7A 3MKYB 3EDPA 1DDNA 2M34A 3VODA 2K02A 4LG3A 1JTYA 4NC6A 2VASA 1JGSA 1UMQA 2JA8J 2YR2A 3BJ6A 4JK1X 3OOPA 1PP8F 3BZCA 4I09A 3C2HA 4Y7NJ 3VEPA 3TO6A 2H09A 2DA1A 5HODA 4Y33A 1QZEA 2BZTA 2DJIA 1YW8A 3BTIA 3NEUA 5LGNA 4OINF 1UHSA 1V3FA 3V8LA 1FLIA 4C3JJ 3LL7A 3CCMI 4Q48A 4U88A 2EFWA 3S1RJ 3IRQA 1FYMA 1S5LC 2E1NA 4B3XA 4AM3A 2VI6A 2DTRA 2PMHA 1W36D 2A6EF 4JX4A 2VQGA 4BHBA 1BC8C 2E5NA 5GPCA 4YELA 1FSEA 3OYAA 4UY8I 2A5YB 3W3CA 5FKMA 1MH4A 1TQIA 1J7KA 3C7JA 2O8XA 3PO3J 1MD0A 3FMSA 2CJJA 5CYVA 5D5WB 3DKWA 4I6ZA 1UG2A 3FXLA 4EJTA 4IX7A 3Q9VA 3OIOA 5B5EC 2DFIA 3E6CC 3I71A 5J1UA 3VYUB 3CJQB 4CHUA 4Q5SF 2EZIA 4D0PA 3S1NJ 4G7HF 1IN4A 4U7BA 4GO1A 4BQQA 1YJ9I 1AHDP 2R7TA 3G2BA 4HLYA 1ZG3A 3DCFA 1STZA 3F22A 1O3SA 2CW0F 3GVAA 5J6XA 2YU3A 3CJNA 4CO8A 1SAUA 2P6SA 1WH7A 1R4MB 3FBNB 3K1NA 4HRIA 2VONA 2Y0SN 1U6GA 4EJVA 2PG4A 1K79A 4EATA 3HUGB 3BG3A 3PIOF 1SEUA 5J47A 4B3AA 4GRIA 4I2OA 3WODF 4CCMA 1PUFA 4FE4A 5LHGA 2WADA 1OCRH 3OR1C 4IF4A 1ULYA 4HV5A 2X85A 4I02A 2CQ7A 2EIKH 1G3SA 1LUJB 4JOMA 3WU0A 5LD2C 4IHVA 2QLZA 2XKOA 3K70C 1IRZA 3BTLA 2JQ7A 2QWWA 3KP4A 3S2WA 2AQFA 3IWZA 2A07F 1TLHB 1PYVA 2ISYA 3R0AA 2EA4A 5GAHJ 2M4KA 2P8TA 2ZXHA 4N4OB 2F4OB 3QRFF 1WWXA 3HOWJ 1RIOH 4IOAF 3CJRB 3WHCA 1MBFA 4RB2C 4S05A 4GGGA 2XAGA 1MKMA 1T39A 2NOGA 2L54A 2CG4A 4G6TB 1WJDA 4U0WA 3TOBA 3BCAA 3DBHB 2TRTA 2WAEA 2XRLA 4A3GJ 3Q3SA 1XS9A 5D6EA 1R5ID 2PFBA 5DCMB 1NK2P 3WE2A 4P9FA 4P1WA 1XDUA 3GF2A 4RA2A 1IJWC 4BY1J 2R7FA 4OIOF 1KZHA 1Y0UA 5JHFA 1HA8A 2H6BA 2OU2A 1FC3A 1ZLJA 2VL8A 1EJ9A 2Z99A 2HR3A 2I5UA 2RKHA 3MCZA 1ZR4A 3FF5A 2NVUB 1K6YA 2R7QA 3DEWA 2OF7A 2M5WA 4XNFA 4D5CA 2QSHX 2O0YA 3BTCA 2DA2A 3HOTA 2HI3A 4XOTA 4WF2A 2BOLA 4I01A 4OMZA 1ITYA 4BL0B 4NBQA 2XPWA 5B1BH 1ZG5A 2R3SA 4BXFA 1WI3A 3DU5A 4A6EA 2LOOA 1FEXA 3IH4A 1WH5A 4CCOA 3HJEA 2KQRA 2VB6A 2EIMH 3PNVA 2X1DA 2WWYA 1TQPA 2TDXA 2RAEA 4U0VA 2FQ4A 2FXAA 1EH7A 2OV7A 1JHFA 2XAJA 4I0AA 3JRDA 3HOYJ 1TQMA 1ON1A 2O7OA 2CQXA 3U21A 3K1MA 5GADJ 3M1CA 3RCOA 1EV7A 3M1EA 3W2WA 2QUFA 2KRFA 4HEA2 5FLMJ 2HPIA 1X3UA 1R9TJ 2FQ3A 1N75A 3C2BA 1OMIA 1BIAA 1IO2A 2GXAA 3BR0A 1YRNA 3M07A 4UVBA 1HQCA 5BQTA 5FKOA 1BW5A 4M6XA 3CUQA 2FNAA 3N4MA 2FOWA 1T2KA 2HVQA 4BQNA 4ZDOA 1T0FC 3H36A 3BG6A 4UUSB 3GTMJ 4ZJZA 2JWTA 3HM5A 5A2QK 1LDDA 1HBXG 5IP7J 1VQ6I 2KL4A 5DD4A 4QSHA 2WV0A 2CQQA 1ETXA 1YX5A 5JR3A 5A2QZ 2E34A 5DM6F 1HLVA 2K9MA 4LIUA 3RKWA 1G8XA 4X0GA 5HVQC 3E5UA 1ERDA 5DD8A 3EUAA 4WCGA 3KZYA 3PSFA 2H1KA 3A02A 2E35A 5F0FA 3BJOA 3CMYA 4LD5A 2HXOA 1H0MA 1EH8A 2KIMA 5K7ZA 1PP7U 3WTWC 1J09A 1X58A 4UVAA 3F6VA 2HZDA 1B9NA 2EFQA 2PMZA 1W5SA 1G2HA 3C18A 3ZN1A 1K6OA 2X0LA 2ZFWA 3R0JA 4HDVA 4R8HA 4M9XA 5IY5H 1YX3A 4AWXB 3I55I 4J01A 2E7XA 5KAIC 2E2IJ 1QZZA 5B3SH 4D5FA 3LSRA 1UCRA 3LAJA 3SJMA 3HSRA 3DXJF 3NRVA 1QVTA 1LFBA 1I3AA 1MBEA 4XN3A 3K7AJ 3JSOA 2W48A 1MSEC 4KYWA 4A3CJ 3Q0UA 4A0ZA 1Y1VJ 3TW7A 3VSKA 1K78A 1Z7LA 2K7LA 1T56A 5ICFA 1S7AA 2PMZN 3CDHA 2NS8A 3A0BC 3DFGA 1BOAA 4IRHA 5E1WA 2M4GA 4ON0A 2WTEA 1CF7B 5LEJA 5L3BA 3QU3A 4I99C 2EBIA 3TW6A 4G12A 1O4XA 1W7PA 1JXSA 3L2WA 2VT3A 4UHTA 2FBIA 4ENJA 4XLNF 3SZPA 1XPXA 4KDPA 2HOAA 2MA3A 4BBRJ 3CZ6A 2XF6A 4XK4A 1FZPB 1ETVA 4EQQA 4LG0A 3COAC 2ELKA 4L0ZB 3BLYA 5F0CA 1VTNC 3VYRB 4DYCA 2CWEA 1RRJA 2DOEA 1SANA 3GTJJ 3K4LA 3HOXJ 2V1DA 2A68F 1KU3A 5FKLA 3DLLF 1UB9A 3S1MJ 1OLTA 4XM3A 3HYIA 3DF8A 2ADUA 5KVRA 4EJWA 3QPSA 3ZQHA 3KPHA 5LRSA 1AU7A 2DODA 4F52A 2FMLA 2A05A 3F3XA 4PZJA 2M7AA 3BP8A 4W97A 2W84A 3SDBA 2CV2A 3I4MJ 1HDPA 4A3FJ 1HSJA 1DU6A 1FPQA 3IUOA 3KETA 4F93B 3FXOA 2BY0A 3TP0A 4V19K 3FWEA 2CFOA 4WXCA 1XSVA 1HKSA 3FKIJ 3GUDA 3LWFA 4PJJA 5K7FA 2LYCA 4B1RA 4BEHA 4E7ZA 2JJ7A 4M3DA 3ISPA 2FEZA 3WTXC 3K4CA 1PVEA 4MO7A 2DTZA 1IXCA 1VQ7I 3SXYA 3HB9A 3LSIA 1IXRC 4IHYA 2L2OA 2IVMA 2P5VA 4L18B 3MMYB 3FHNA 5J3LA 3G71I 2HDDA 2IA0A 1MMNA 1S29A 2R0QC 1XDSA 2L9SA 1SFUA 3HRSA 1IUFA 1UG0A 2FJ1A 4CICA 3CCUI 4BACA 4U0YA 2DFHA 2LR8A 1Z67A 4IRGA 1DGWY 3RJPA 2KIUA 2HDCA 4XRSG 4V2GA 3BWGA 2EZHA 3WGIA 3FX3A 2H6CA 2IW5A 1BC7C 3OMYA 2F5DA 3H9QA 5EYRA 2ZBKA 5H6RA 4G9YA 4FCYA 1XCBA 1AA7A 4M74A 4AIHA 5C44J 2A5WA 2KFDA 4ZTJA 2PJRA 4QPOA 2JTVA 2FX0A 3LSMA 2HEOA 4IQ4A 4F7ZA 2E60A 1VQOI 2OJED 1TT5B 1Y56A 4XBFA 1Z91A 2DA7A 1JTXA 2VQCA 5J40A 4FTHA 2ZNYA 3F8BA 2BHZA 1TTYA 2ID6A 4LITA 3J7AO 1P9QC 4DGWB 1OFCX 4XOPA 1YS6A 3JSPA 2GIZA 4A93J 4RDUA 1X2MA 1QBJA 2NRAC 1U2WA 3E6BA 2XAUA 4LB5A 2G7UA 1QZYA 2BXZA 4LLLA 4KA4A 2WC2A 2XSJC 3BY6A 2M0MA 3ZCOA 1OISA 5FFZA 3KZIC 4BHCA 2FOKA 2JUCA 4A3MJ 3MFKA 2HOEA 2GM4A 1YG2A 1USSA 3S32A 4B44A 1WFXA 1FYLA 4RB0A 1YHQI 3WTYC 1WPKA 2XUBA 5E8GA 3GFMA 2VLAA 3RSNA 3FXMA 2HGCA 5TJJA 2GOXB 1WI9A 4E7KA 5L3FA 1T08B 3HRTA 2B9SA 2EB7A 3BPXA 3EUHC 1T6SA 2M3AA 4PDKA 1A31A 1R71A 5TGTA 1OPCA 4XLPF 5IYCJ 1VF9A 4OOIA 2CUZA 3MWMA 3M3YJ 2J5OA 1Z21A 3BOQA 4M3GA 5KHDA 2FF4A 2EINH 2HQRA 4RAZA 3FKJA 4G7OF 1FWZA 2XVCA 3I9V2 3TOAA 1NG6A 2BW3A 3CCRI 2K9LA 4B09A 1R5GA 3AG3H 3JTHA 5EJCA 4KT6A 4II3A 1FSHA 2P0WA 2M30A 5DDGA 3OSFA 1WVRA 2L7FP 3CDIA 2K3FA 1WGXA 3J7ZI 4LB6B 2OTJI 4AC0A 2W7NA 4HF1A 4UB8C 3FM5A 1V5GA 1WJAA 3ESWB 3A1YA 1QHGA 3RYPA 2EFPA 1S7OA 2DDBA 2DCEA 3RZDJ 1USTA 2R5YB 2HQ5A 9ANTA 2DA5A 2W85A 3LSKA 4M9ZA 1QHHD 3RYRA 4A3LJ 3CCVI 3VFZA 2ZMEA 3O3KA 1B6AA 4CCKA 3W6VA 2LFBA 5GAGJ 5CVRA 1KYWA 2E1OA 1VQNI 1BIBA 5F27A 2H94A 1SD6A 3OYFA 2BVMA 2XIGA 3EQLF 4B43A 1BJZA 1ZR2A 2V26A 2YSRA 4HW0A 3S3MA 2ZJ2A 3J7AY 3PFYA 5EEHA 4A3EJ 2YUSA 4AIDA 5LBQA 1L3LA 2AQEA 1APLC 1T95A 4RLQA 4DYQA 1VNDA 4D7MA 4HYEA 2QM3A 1I6XA 3DKXA 4NC7A 1BI2A 4XICA 2ME6A 2V9VA 2QA4I 2M7BA 2R7VA 3DPUA 2MYSA 1U78A 2MD0A 2X48A 1VQKI 4M72A 1WJBA 1LE8A 3OS1A 3P9CA 2CV1A 3F0CA 1JJ6C 3HSFA 2W24A 2DU9A 3FDYA 1ORKA 2HKOA 3WTTC 2X51A 5AIPA 4CYDA 3ZGKA 1JJ8C 1BR1A 2JPCA 4H4KC 3QYBA 2PEXA 4LLGF 5HLIA 1KQ9A 4MQVA 1X1DA 2DA3A 2XROA 3HEFA 2F48A 3TKYA 3GXOA 1UHWA 5GAEJ 1J2XA 5IP6A 3ZPLA 2LH9A 3ABUA 2DA6A 4E7HA 1G3YA 4CYCA 4BYYA 4L5EA 1YOVB 1BI0A 4HSTA 3I4NJ 2F5VA 1YI2I 2CSOA 1JHHA 4YIRX 1R7JA 2DMNA 2IP2A 3BR3A 3DLAA 1VQ5I 4KMFA 2XGEA 2FRHA 4IJAA 1YO5C 3ZXSA 3QPHA 1WJEA 2QQAA 5IYDJ 3SHFA 3LSTA 4DNCA 1JKOC 2KZVA 1SVMA 1ZARA 3W2AA 4FT8A 1Z7UA 4LOCA 4BAYA 2VC0A 3ABLH 5J1YA 2FD5A 5IOYA 3PNYA 3D0SA 1OR7C 4MFDA 3HXLA 3GW2A 2W25A 2KJBA 3LA3A 1BJAA 3A0HC 4DOZA 1P2FA 3V42A 4HX4A 2VIXA 1BOBA 2XGCA 1D1AA 2DW4A 2LSOA 1POGA 3R6SA 1S8NA 3K2ZA 3KZZA 2K4JA 2UXNA 3JRHA 1FMVA 2WAFA 4GXOA 2JK3A 3WTVC 3SEZA 4Y4RA 3X2QH 3HRUA 1GV5A 3RPUD 3Q0WA 3L09A 3S15J 1F4KA 1E17A 1ZELA 2ZO4A 2JA6J 1BL0A 2O3FA 2K5CA 2R7ZJ 3KYDB 3DKYA 1R23A 3FXKA 3ABKH 1DPRA 1B72A 2QBYB 1N78A 1D5YA 1JI8A 3LA2A 2M45A 4M3EA 3ABTA 3ZQGA 1IZ1A 1MZBA 3G73A 5BS6A 3F8NA 1P7IA 2HU9A 2OBPA 3ECOA 3RIRA 4ZH4F 4A3JJ 2QYOA 3AAFA 3KCCA 3O6BB 1IGNA 4R1HA 3DV8A 3RPQA 2Y2ZA 3K6GA 3LNQA 2OA4A 4RAFA 4OMYA 4J19A 2EZLA 5FRMA 3H9JA 5J8FA 2Z16A 1XMAA 1PJRA 4PJMA 4PJ0C 2XRNA 1AKHA 5L3GA 4G6DA 3CESA 1M1EB 1YLFA 5J8CA 2V6EA 3B6CA 2Y0SA 4NUBA 3S3NA 3VYSB 1SFXA 2Z3YA 2QKMB 1MGTA 4CCJA 2IA2A 2E71A 4W1UA 3EUKL 2VT2A 4PJNA 2CGPA 2MBFA 4I7HA 2L9RA 1ENHA 3K10A 2GZWA 2CO5A 5EZGA 4V2FA 2EV6A 3ASNH 1QVUA 5FROA 2B7EA 1ZLKA 5L3DA 1JE8A 4XMYA 2BHYA 4RM3A 2IGOA 2LTPA 4GDFA 1I50J 3I56I 3L9FA 3C3WA 4IXAA 5HS8A 2JPBA 4DW6A 1MDMA 2MGQA 3VSLA 5B1AH 4CCLA 2HYGD 2MW8A 4Q47A 3BDDA 2TCTA 4HNTA 1SD4A 3TBIA 2GLOA 2NAZA 3TDUC 3AKZA 1G4DA 5E3OA 1SVOA 1A6IA 2ZB9A 3ABMH 5DUIA 4FETA 2UWMA 4GFBA 5IPAA 1IAWA 2ZJPF 1LPQA 3OYDA 5J1RA 1X1CA 1DQUA 2RV8A 3B02A 2E19A 1MJBA 3CQZJ 2OC6A 4IEJA 4LGWA 4Y13A 3QPTA 4KMUX 3TEDA 4BU2A 6PAXA 1W5TA 2MLGA 3F8FA 2NVQJ 4C2TA 2UXXA 1OCPA 1JKRC 2LF7A 2JSCA 2ZJRF 1PUFB 2EWNA 4EGZA 2Z2SB 5E18F 5LGTA 4A6DA 4HQEA 2VKHA 4L0YB 1MBKA 3KEOA 1MNMC 5EF6A 4NC8A 1L0OC 3DTEA 2NS7A 4AUXA 1R58A 4A0XA 3K4BA 4I98B 1ZRDA 2R7SA 2O6GE 2WB1N 1TL8A 1DP7P 4YIIA 1VQ8I 3JCUC 1S9HA 3B6AA 1D8KA 3R60A 1TWHJ 2ZXWH 3LSPA 2G9WA 5C4JJ 1KGSA 1Z6TA 2BEOA 2GBYA 3L2VA 4KIFA 2HZTA 1FOYA 4PCQA 4YIFA 4NQWA 3L2CA 3FM3A 2STWA 3FZVA 1X1BA 3CCYA 3IH2A 3KEQA 5J4YA 1O57A 1IC8A 1P4XA 2IJLA 1GUUA 3H0DA 2COMA 1NTCA 2M0CA 1IRXA 1Y8QB 2Q2EA 2IRFG 2XPVA 1ETWA 1R49A 2OD5A 5HDGA 1X4PA 2RDPA 3OYKA 5F04A 1XX5A 2PLYA 3AG1H 2UUZA 3BT9A 2JRMA 3T5XA 3NWTA 1UAAA 2MH2A 2VXZA 3E5XA 3OR2C 2KIQA 2LD5A 5LFAA 4ZYAA 3D5LA 1W5CC 2OPTA 2MD5A 4E7LA 2P5KA 5DTDA 4BKXA 1R1TA 4L5JA 1R4NB 3K1PA 4XLEA 2Z9OA 3K9TA 2NVYJ 2VUMJ 4UUTA 2DA4A 4E70A 4XQFA 4UUVA 3ZMZA 3IH3A 4ESJA 5D4SA 4MEXF 1FIPA 3MEXA 2E2HJ 2YX7A 2EFNA 1QGPA 1S7EA 4RGUA 1T98A 4YEJA 2VE9A 2ETHA 2LF8A 4AVZA 2VODA 2ELHA 2NS0A 1Y6IA 2WV1A 1EA3A 1H88C 4PGHA 1ETYA 2D2WA 2M1BA 3EYYA 2B63J 4QLCU 1ETOA 2V1XA 4L9TA 5FO5A 1LNWA 3F72A 1BR2A 2W82A 1U0JA 4LK0F 1SFEA 4XKCA 3H0GJ 2KLOA 4BXXJ 1MBHA 1GVDA 2E36A 2I10A 5E3NA 1IDYA 3SZTA 2EQRA 2HTJA 2XGDA 3E1SA 1UFMA 3E6MA 3M8JA 4HPQA 3HHGA 3PSIA 1K4TA 1MSFC 1Y0NA 3O8GA 3ULQB 3H5RA 1YRNB 4MFEA 3WU2C 3DP7A 2CU7A 2FMYA 3JAMZ 2GOMA 3CUQB 4RGRA 1WCMJ 1FBSA 1I39A 3P5JA 3A2KA 1ZH5A 2CFXA 2CQKA 5FD5A 1HOMA 3GMEA 2BBYA 2F4MB 2OUMA 1VQMI 2AXTC 3TO9A 3WHBA 1SAXA 2OCCH 3TDZC 3A01A 1XSDA 2YX4A 3DPTA 3HGYA 3RQIA 3E6DA 5E17F 4IVNA 2EPFA 3K2AA 5DM7F 1NHAA 3QU6A 2ECCA 2W00A 2KMUA 4J00A 3FXQA 3F23A 2NVTJ 4EV0A 1UJ8A 1TW3A 2ME0A 4M9SA 1OCZH 2KHMA 2NYXA 2I8DA 3E7LA 4XN0A 4DZPA 5HDNA 3JRAA 1FTTA 4BQAA 3G1MA 2Y9ZA 2IGKA 3GLXA 5HS9A 1RUNA 1LDKB 3ZN0A 5E3LA 4HV6A 5LHIA 1LFUP 3CUQC 2UV1A 2W1OA 3B73A 2VC1A 3UNGC 4BXUA 3KP6A 1VZ0A 4BJ5C 5FRNA 1BA5A 3PQJA 4BUPA 2NOJB 1D1BA 2K9QA 4CSWA 4YG2F 1SMTA 2JVGA 3W2VA 2HOSA 2GA2A 4DBRA 3GFIA 1T33A 5JI6A 1K78B 4R79A 3DPLC 3JR9A 2OTLI 3HKZN 3KIOA 1MH3A 1B59A 3TL4X 5CJ9A 1QPIA 1MBGA 4NB5A 1S72I 1YW9A 2HXIA 3HOSA 1ONVA 5ICCA 5E79C 3MAJA 3O2PE 2PI0A 1W7PB 1ZGWA 1QA6A 1XGMA 2DT7B 2XV4S 3FISA 1V5FA 2DYSH 4C2MJ 3I4PA 1GXQA 3K70D 3GLLA 2DFFA 1YQAA 1FOXA 4LG0B 3ZQFA 3QP5A 5ICGA 2EILH 4EM1A 2LLKA 4XIDA 5AONA 2F5EA 2A61A 2IA1A 2K9NA 3DWLE 2F2EA 3I5UA 1MNEA 1RESA 2ISZA 1DUXC 1GXPA 5DEQA 3IV5A 2OAZA 4IHWA 1Z9CA 2KT0A 4ENMA 2DO7A 2R7RA 3J80Z 1TWCJ 3I54A 3SFZA 3T0YA 1SVLA 1E0EA 4F91B 4EJUA 2LBFA 3S2DJ 2DN0A 5EGOA 3HIFA 3W6JB 3GTQJ 1KYZA 3CCSI 2LC2A 2FBHA 2G0EA 4MIMA 2P5LC 3RPUA 4YFXF 3OIPA 1ZGAA 1XMXA 2H1LA 4A69C 4OWRB 2X6XA 5EZHA 5F1RA 2DPUA 1LVKA 4PSWA 1DGRM 1R1VA 1U8BA 4U7DA 1R00A 4XKVA 4BEHB 2QVOA 4RGXA 2VBXA 2DK5A 2F4IA 1IUYA 3AFHA 2L4MA 1P7JA 1FOKA 1CQTA 5CLSA 2B0LA 2LP0A 1MBJA 1MW7A 3G1OA 1IG7A 3LA7A 3P9KA 1YW7A 3HZJA 4KJZA 2Q8KA 5IT3A 3BQYA 1K7AA 3GZ5A 1I5ZA 3GFLA 2L9VA 3GCMA 3J7YJ 1P92A 3RQ4A 5LGUA 3N05A 4KICA 1LKXA 5H20A 1WJ5A 1TWFJ 2QQBA 2V7FA 4XR6A 3ZQQA 1WKMA 5DS9A 2FSWA 3IC7A 2XGXA 3I59A 3GWZA 4M71A 4ENNA 5FLVA 1X2NA 2ECBA 1FP2A 1MMGA 5FJ8J 3GO5A 4D1QA 1J5YA 2Q0OA 1IV6A 2PJRB 1KU2A 2WAQN 3WG9A 2QENA 1TT0A 1ETQA 3HOVJ 2R7WA 4N9IA 1K4SA 1UHMA 2KIFA 1JUPA 4B48A 4IKFA 1D0YA 3EETA 2VQLA 3CJTB 4KUMA 4MTEA 3GTLJ 2CV0A 2R4GA 2VJ5A 5K5QA 1V5EA 4AU7A 4XKBA 1X1PA 3S16J 4A5MA 2BY1A 5D8KB 2RNGA 1HW5A 3ERMA 4G7ZF 2HOTA 1OYWA 2IEKA 4HSRA 3BR6A 3LSGA 4DZJA 1W0UA 2HYJA 1OYYA 4PUSA 4RS8A 1GT0C 1W36C 3FK6A 3WTSC 2BYVE 2QGUA 1U5TA 2XPUA 2L7ZA 4ANJA 5DYMA 3H9GA 3OS2A 4U87A 1CGPA 3OYLA 2CYYA 1B8IA 4NHJA 3MKWB 1WJFA 3MQ0A 3LOCA 3CC4I 2RREA 2L01A 1FJLA 1QU3A 4RB3C 4L9NA 5LEKA 3CLOA 4KISA 4O5VA 1BI3A 3OV8A 1FBQA 4C9YA 2ZFUA 4IHTA 2R7UA 1Z1DA 2JA2A 4BJ6C 2A3SA 1IXSB 2K40A 3Q9SA 2IBDA 4LJZF 3HGGA 2QZ8A 4LFUA 3ZMVA 3DU6A 2BXYA 5EG0A 3SQNA 2V79A 1G59A 5FFXA 2VN2A 4II2A 1YS7A 1U9OA 2BW3B 1D0ZA 3C2GA 1JT6A 4ETSA 3U1DA 3RKXA 1MMSA 2O8KA 2NXNB 2HVRA 3JREA 2X6YA 2CQNA 1XG1A 5HLTA 3BG7A 2XB0X 3PO2J 3CF2A 4UXNA 2NVXJ 4RBOA 3KE2A 2JZYA 5HDKA 5IOZA 3VB2A 5D6FA 5D4RA 2JT1A 4I0BA 1A36A 2RGVA 2KISA 4TV7A 5FKKA 2R5ZA 3CDLA 2F5FA 1J59A 2WBMA 2JUGA 1Y1WJ 4P5OA 4BE1A 4XSZF 3DBRB 1ZG1A 1S6LA 2OQGA 2AO9A 1B9MA 5D5UB 3P7NA 2ZMEB 2MSYA 4KIBA 4RAGA 3KEYA 2ZXIA 2EIJH 2MABA 4HG2A 3BG9A 1RC9A 3GEZA 4F92B 3GZNB 1ZTRA 5TISC 3Q5FA 1Y39A 1LVAA 2EZKA 3FMQA 5CQGA 4QIWN 3CF5F 3JRCA 3FXUA 1GHCA 2KRCA 1N25A 1IV8A 4BQOA 2FA5A 5TRDA 3IHUA 3QYFA 1GVJA 4ZYGA 4ZC3A 5KAFC 1P4AA 2MH9A 1EH6A 3CUOA 2VKEA 1FP1D 3FBIB 4MGRA 3JRFA 2ZJQF 2MLKA 3FXJA 1HCRA 3S2HJ 1WZ2A 5E1ZB 3OYHA 3H35A 2XHKA 4FE7A 4A0YA 3WTZA 1LE8B 2DMTA 3V7CA 2DBBA 2ZMEC 4KNYA 2X6OA 4O3MA 2EV5A 2D1VA 3OYGA 1Z77A 1Q1HA 3BZKA 4CA0A 1W4MA 1XD7A 3HL2A 3BR5A 1A04A 2YS9A 3L00A 1RUOA 1UELB 2E5ZA 2EV0A 4X1EA 1FNNA 4HA8A 1VQLI 2DAOA 2X1EA 3WG7H 5BPIA 4IQJA 3S14J 1OYIA 3REOA 3ZMTA 1HSTA 1XMKA 3BPVA 1DPUA 2R7OA 2KDOA 2FNPA 2QQ8A 3I53A 4XRMA 4HDUA 4RM2A 3RTRA 2GXBA 4G6QA 5CVJA 4CYCB 1F36A 1V55H 3CP8A 2A69F 2ZSIB 2XASA 1R5HA 4WXDA 2QKLB 3SEQA 2DQRA 4M3FA 5JVTA 4FASD 2VBYA 3TP3A 1W1WE 1FYKA 1Z0XA 2HFHA 4PFPA 2VBWA 1NK3P 1RKWA 4O6JA 3TMOA 4PJLA 4YFKF 1LDJA 2DQLA 2O9LA 3HPHA 3Q0VA 4X6AJ 2VOPA 2NNYA 5L3EA 4ZTFA 3ELKA 5FB2A 3PIPF 1OCTC 1SFKA 2DK8A 4HNVA 2FBKA 3GFJA 1Y8RB 1Z3XA 2BY2A 4XORA 5FD6A 2E1MB 3D5RC 1W0TA 1A35A 1D0XA 2X1CA 4PSXA 2STTA 2Y31A 4MEYF 4DBQA 5FGMA 4DQ2A 3OOUA 2DT5A 5K5RA 1DU0A 2IT0A 2R93J 4IHXA 5JLXA 2VBZA 3QQAA 4CDGA 1RETA 2E1CA 3JRBA 5IT9K 2VKVA 4M73A 1ZYRF 5BOXA 2R7XA 1PDNC 1MJAA 2L7KA 5HS7A 4LLNA 1B72B 5IT9Z 4K2EA 3HOUJ 2ACJA 1FIAA 2Z33A 4PK4A 3CD6I 2VE8A 5D5XB 2OZ6A 3FXRA 4BH9A 1TC3C 1IN7A 2E1MC 4FQGA 3BG5A 2XB5A 4MTDA 3EYIA 2PQ8A 1A5JA 1BBYA 2Y9YA 2HTSA 5M3MJ 3JRGA 4Y52J 3ZQIA 5ILVA 2X6WA 1FOWA 3KLNA 4XL9A 5M3FJ 5LHHA 3BR2A 2R7DA 3CTAA 1RI7A 3WE3A 2A6TA 2Y75A 1JGGA 5FLXK 2F5CA 1U9NA 2XAFA 3KFWX 1AKHB 5E8IA 3R4KA 2ZC2A 1REPC 3DQVC 1IN5A 1WJCA 3IP4B 2L9NA 1TP4A 3MVPA 3HUGA 5FLXZ 2ZXJA 4N9HA 3VOEA 3E5QA 2MC4A 1O3RA 3VWBA 4M3BA 2OQRA 2M87A 1U3EM 5ED4A 1LFPA 1B1BA 1V4RA 5KK1A 2GQQA 4BJTA 3IAS2 4FHTA 5JLWA 3F21A 1VQ9I 5ILSA 2IXSA 3JTGA 2PN6A 1N77A 2WB1A 2PBIA 3QYEA 3JRIA 4HQMA 5CKTA 3KP5A 2VPRA 1TWGJ 3KX2A 4MLOA 5CVIA 1MDMB 3MZHA 2KPMA 3SFIA 2EFOA 1LB2A 3T8RA 3OYCA 2E2JJ 1XSXA 3S17J 5JHUA 3CCLI 3I58A 1BW6A 3WGHA 2CH0A 2WY7Q 1PUEE 2RQQA 3DTKA 5DCMA 2RQPA 4HNUA 4E7SA 4BS9A 5B66C 3F8MA 3CMAI 2X9DA 3BTJA 3PQKA 4WXHA 2CUJA 3F8CA 2VOOA 2XF5A 3G4SI 3R61A 1X3WB 3QODA 4E4HA 1IW7F 1HW2A 2DYRH 2OZUA 3BROA 1FTZA 3M8FA 1IDZA 2P6TA 4RAYA 4CZZA 1RR8C 1RKTA 3RKQA 1ZRFA 1D1CA 2M8GX 2YPRA 1XCVA 3HOZJ 5EEAA 4KN4X 2AHQA 5BPDA 3QP6A 1H8AC 4A2UA 3M7GA 3NAUA 2V6CA 4GYGA 4UV9A 4HBLA 4EMSA 1D8JA 5M5WJ 3ZMSA 3OYNA 2P81A 1G6NA 3TO7A 2LNBA 1ZREA 2MC3A 3GX4X 3ZQLA 4NQWB 3ONQA 5DUKA 1KQ8A 1T0FA 1GDTA 5D5VB 1SD7A 1G3TA 4WX9A 2DMPA 5F6FA 2HYFA 2ZSHB 2Q2EB 1H9TA 3G6EI 2IAIA 4LK1F 1EKEA 1ZK8A 2GIVA 4N4NB 5E3MA 1T8IA 2AS5F 2DXIA 2V4JC 2VJ4A 1ETKA 2L3DA 2RC4A 1QO0D 1Q1VA 4C3HJ 5K5OA 3T8TA 1IN8A 2L0KA 3HDDA 4M6YA 1R36A 1ACIA 2LKPA 3LQRA 5M5YJ 3S3OA 1OCOH 3H5NA 5GTIC 1IF1A 1QPMA 1VI0A 3V7SA 3HG9A 4A3KJ 4AIJA 2V9KA 2EH3A 1VQ4I 4UUSA 2HVSA 3HTSB 3PM1A 1KU9A 3HRMA 4BY7J 2FE3A 2FUG2 1Z05A 1UZCA 4PGGA 4ZZDA 4IHSA 4CGZA 1YIJI 5E1XA 1Z3YA 1BR4A 1HXDA 1E3OC 1OKRA 3JAMK 4CCNA 2DMQA 4I76A 3CO6C 2CMPA 4B8XA 2HQNA 3D5SC 4A3DJ 3ZR8X 4XRSA 1O3QA 1HKQA 4EM2A 4BDZA 1J75A 1E3HA 2L02A 2D5VA 5EDNA 2D45A 2JA7J 2HNHA 4QTRA 4EJOA 1P4WA 5C4XJ 1JKPC 3KLOA 3GTGJ 4LMYA 3JW4A 3MD2A 5GPAA 4C2UA 4QPQA 2IS4A 3U1KA 2KRHA 2R92J 2XAQA 2VJJA 1ZN2A 1XTAA 4E7IA 2K3PA 4HX7A 5D8LB 2MFZA 3IWFA 1X1AA 4FX4A 5CPRB 3A4CA 5CQEA 3V8JA 4BGDA 4M6VA 3K4JA 4JYKA 1GLNA 4RGSA 2RVCA 3BQZA 4Z6YA 5HNFA 2E7WA 5AIQA 1X3ZB 1XGNA 1KU7A 2ICWG 4F55A 3CCJI 3DEUA 3HKZA 4HF2A 4ZDPA 3A01B 1JUSA 2V9PA 4B47A 1CF7A 4IZZA 1NG7A 3C1DA 4KN7X 1J0RA 3FIWA 3H92A 3VPRA 1SFOJ 2K86A 3CMMA 1FX7A 1YE9A 2GAUA 4KIGA 2VKDA 3LSJA 2IS2A 4ASNA 2GXGA 2ZNZA 3HPGA 2Z1DA 4EVIA 1IRFA 5ILUA 4FISA 2ESHA 3CO7C 3K4MA 4XRFA 3ZMDA 4ZYEA 2X4HA 2CW7A 5HNHA 1YFHA 2NNNA 5F64A 3LFUA 4BBSJ 1IRGA 3H3VK 4D7NA 1I1SA 2DPDA 1QQIA 1YJNI 4G94A 4A12A 1HW1A 4ITVA 4BHPA 2LVSA 3L2QA 4L9VA 2LREA 1TWAJ 1P6RA 5KNLA 2M9HA 1R22A 2HDWA 2Y30A 3EPZA 4BDYA 4XLCA 3AL0B 2A6HF 3E3VA 2K9SA 3BCBA 4FX0A 3BJAA 5CVUA 4CXFA 1HKTA 3VYTB 4UV8A 2W4SA 2LKXA 2JVHA 3J81K 2XF7A 4HOBA 3CP2A 3J80K 1K61A
chains in the Genus database with same CATH topology
1VQOI 1VQ8I 3CCQI 1YIJI 5DM7F 1FOYA 2QA4I 3CCEI 1MMSA 2NXNB 1YJ9I 1VQKI 3CCLI 3PIPF 5GADJ 3CMAI 3DLLF 3J7YJ 1HC8A 3G4SI 3CC2I 3PIOF 1YHQI 4IO9F 2QEXI 3CC7I 5GAEJ 2FOWA 1Y39A 2OTLI 2JQ7A 4V19K 3CCJI 4IOCF 3CF5F 1VQ6I 1YI2I 1S72I 5GAHJ 3CJTB 1VQ5I 3CD6I 2E34A 3I56I 5DM6F 1QA6A 4IOAF 1VQ7I 2ZJQF 3CCRI 2E35A 1YJWI 1FOXA 3G71I 1FOWA 5JVGF 2K3FA 3J7ZI 2OTJI 2ZJPF 3CCUI 3G6EI 2E36A 3I55I 1YJNI 2H8WA 1VQLI 1ACIA 3CC4I 3CCSI 3CCVI 2ZJRF 3CCMI 3CMEI 1YITI 5GAGJ 1VQNI 1VQ4I 1VQ9I 1VQMI 1VQPI 4UY8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO I;  1VQ8 I;  3CCQ I;  1YIJ I;  5DM7 F;  1FOY A;  2QA4 I;  3CCE I;  1MMS A;  2NXN B;  1YJ9 I;  1VQK I;  3CCL I;  3PIP F;  5GAD J;  3CMA I;  3DLL F;  3J7Y J;  1HC8 A;  3G4S I;  3CC2 I;  3PIO F;  1YHQ I;  4IO9 F;  2QEX I;  3CC7 I;  5GAE J;  2FOW A;  1Y39 A;  2OTL I;  2JQ7 A;  4V19 K;  3CCJ I;  4IOC F;  3CF5 F;  1VQ6 I;  1YI2 I;  1S72 I;  5GAH J;  3CJT B;  1VQ5 I;  3CD6 I;  2E34 A;  3I56 I;  5DM6 F;  1QA6 A;  4IOA F;  1VQ7 I;  2ZJQ F;  3CCR I;  2E35 A;  1YJW I;  1FOX A;  3G71 I;  1FOW A;  5JVG F;  2K3F A;  3J7Z I;  2OTJ I;  2ZJP F;  3CCU I;  3G6E I;  2E36 A;  3I55 I;  1YJN I;  2H8W A;  1VQL I;  1ACI A;  3CC4 I;  3CCS I;  3CCV I;  2ZJR F;  3CCM I;  3CME I;  1YIT I;  5GAG J;  1VQN I;  1VQ4 I;  1VQ9 I;  1VQM I;  1VQP I;  4UY8 I; 
#chains in the Genus database with same CATH topology
 5F1J A;  2BVL A;  1BN5 A;  2AXL A;  2DMU A;  3J81 Z;  1ON2 A;  2L5Q A;  3IAM 2;  5DV5 A;  1VFC A;  2Y48 A;  5J4V A;  5IP9 J;  1ODD A;  3PUB A;  4L9J A;  4C30 A;  1KQ0 A;  4AIK A;  3LAP A;  5DCF A;  4P9U A;  1AOY A;  1H9G A;  3S1Q J;  3A03 A;  5E20 A;  3CCE I;  5CVV A;  2DFE A;  3KP3 A;  1E3P A;  2H27 A;  4Y15 A;  3U2R A;  2G7H A;  3M9A A;  4JQF A;  4YFN F;  3FK7 A;  4XLF A;  4ZDL A;  4XON A;  1OCC H;  1XB4 A;  2V1N A;  4L5I A;  2BY3 A;  1QNT A;  3S93 A;  5HOO A;  2IS6 A;  2L7M P;  3AL0 C;  3K4K A;  3ASO H;  2Z5U A;  4AVP A;  1K83 J;  5IYB J;  3DTI A;  4EEF G;  3QOP A;  2FU4 A;  1HC8 A;  3LMM A;  3HTU A;  1SC7 A;  1C0W A;  1D5V A;  1KON A;  3MZY A;  4JBA A;  2KJC A;  3WGG A;  2XC7 A;  3CC2 I;  3HC7 A;  3K69 A;  3ZOB A;  2VQH A;  2O5R A;  2LBF B;  5EGO B;  3I3L A;  2O61 A;  3O8H A;  2ZKZ A;  3TQN A;  1QRY A;  1WHU A;  2QEX I;  3TGN A;  1X19 A;  4MQ9 F;  3ROU A;  3PL8 A;  1R6R A;  4CUG A;  1B4A A;  2C6Y A;  2WAQ A;  1RZ4 A;  3T1B A;  3UKG A;  2JN6 A;  3UR3 C;  4ZYH A;  2CS3 A;  3H3Z A;  4NDL A;  3L7W A;  3L2R A;  4MHG A;  3G1L A;  3PFI A;  4KT5 C;  3ZRG A;  3QPL A;  2P4W A;  3DEE A;  1TNT A;  2ID3 A;  2XKP A;  5H2F C;  2LMD A;  4KFC A;  3EUH A;  2CUF A;  2DI3 A;  5M5X J;  1YJW I;  4MNU A;  4C3I J;  3GTK J;  2COB A;  3HSE A;  1XGS A;  3ZQC A;  3QAH A;  1ZRC A;  3FHZ A;  3H5A A;  5GTH C;  3E0J B;  4BE0 A;  1JT0 A;  1KA8 A;  1EF4 A;  3SDG A;  3D1N I;  3DBL B;  1E2X A;  2DLL A;  4P96 A;  2OCE A;  4IL6 C;  3I59 B;  1ZKG A;  3K0L A;  4HAM A;  3V8K A;  3OYB A;  3S8P A;  3CME I;  2RN7 A;  4B4C A;  3I0T A;  3MKL A;  2Y0M A;  1O7L A;  4YRV A;  3KP7 A;  3OL4 A;  4Y17 A;  5LRR A;  2K27 A;  2KP6 A;  1WQ2 A;  2L4A A;  1R1U A;  3BR1 A;  1VQP I;  1GV2 A;  3H3U A;  1IN6 A;  5JFR A;  1FBU A;  2P7V B;  4Q4Z F;  4UB6 C;  2Y69 H;  3ML6 A;  5BMZ A;  3F6O A;  5HLH A;  1ZHF A;  4DYR A;  2DOA A;  1F1Z A;  1I27 A;  3QOE A;  1TZL A;  1OJL A;  4Z2Y A;  3MN2 A;  2DT6 A;  4HZF A;  5L3C A;  1MND A;  2ZCW A;  1S3J A;  2CRG A;  2D1H A;  1RPW A;  2VJI A;  2WY8 Q;  1BI1 A;  4D9J A;  3IKT A;  3IKV A;  1LJ9 A;  3MZ8 A;  3OY9 A;  2HPM A;  2PMU A;  2QQ9 A;  4PFO A;  1U5T B;  3FMR A;  2H8R A;  1AWC A;  3OL3 A;  4XLA A;  3OYM A;  1H89 C;  1I1G A;  2ELJ A;  4QWQ A;  1ZGJ A;  1YTY A;  1B8I B;  2R5Y A;  2JA5 J;  2LKS A;  3AG2 H;  5F08 A;  2DJN A;  4A3I J;  2J5P A;  2BV6 A;  2VPL A;  1T38 A;  1MIJ A;  4A3B J;  4IO9 F;  4N0B A;  1RNL A;  3GZ6 A;  3LQQ A;  2EA2 A;  4XLH A;  2K4B A;  3VDX A;  4Y3O A;  2LG4 A;  2EJR A;  3GTP J;  3SYT A;  3W6K B;  2LY2 A;  1MMA A;  2KZG A;  3K4N A;  5C3E J;  1G3W A;  2F6C A;  4E6K G;  2CUE A;  1FY7 A;  5GP9 A;  2K85 A;  2M8E A;  4S04 A;  3IL2 A;  2KDZ A;  1LQ1 A;  1HDD C;  2XSD C;  2JRT A;  3U9G A;  5EG0 B;  2V1U A;  2DDA A;  2BE5 F;  2HWV A;  4RLF A;  3P9I A;  4OIR F;  4EM0 B;  1U5T C;  1X4O A;  2GWR A;  1WSU A;  1ZAO A;  1JKQ C;  3PUF A;  3RI4 A;  3KYL A;  3LFK A;  3N97 A;  4UNO A;  3HHH A;  3KP2 A;  2EK5 A;  2M2E A;  5JVG F;  1XC5 A;  1Z6R A;  3E97 A;  4E7J A;  4NNJ A;  2HS5 A;  4ESB A;  2W57 A;  4JX5 A;  1I3Q J;  5K1Y A;  3F9K A;  4GCV A;  5KCM A;  4HF0 A;  2R5Z B;  2IPQ X;  4WWC A;  2HKX A;  3HBL A;  2GA1 A;  2H8W A;  1V54 H;  2BGC A;  1YIO A;  3M4O J;  2LK2 A;  3BZ6 A;  2QSG X;  4UVC A;  2JSP A;  3M8E A;  1O3T A;  4JP0 A;  3QWL A;  1YIT I;  1TW2 A;  5F0H A;  1OR7 A;  5K7H A;  3GYH X;  3I64 A;  4OIQ F;  4OAZ A;  3IRR A;  3GTO J;  1YYV A;  3CLQ A;  2P7C B;  1I6H J;  3OS0 A;  2LRD A;  3PNT A;  1HF0 A;  3OWT A;  4JX6 A;  1OQY A;  3BC8 A;  4DJA A;  1MJ9 A;  4HX8 A;  2PX9 A;  3V4G A;  3MKZ A;  2QSF X;  3RZO J;  1WRJ A;  1BM9 A;  1LEB A;  1A6Q A;  2HQA A;  1TBX A;  3L2U A;  3CCQ I;  5LLQ A;  1F43 A;  2MG4 A;  3SZG A;  4OU0 A;  4AYB A;  2Q1Z B;  1W7P D;  4GYI A;  3NWS A;  4LIV A;  4RMN A;  1F5T A;  2N8G A;  3L1P A;  2KKO A;  3GBG A;  1JUM A;  5ICE A;  4WK8 F;  4DIQ A;  5FKN A;  2O03 A;  4BNC A;  5H6Q A;  3OYJ A;  3G3Z A;  4XKW A;  3ZQ7 A;  4IRI A;  1SMY F;  3H1C A;  1RR7 A;  2RNJ A;  1F9N A;  2CW8 A;  3WTU C;  4ESF A;  1ZQ3 P;  3OIQ A;  1TNS A;  4ABZ A;  4BE2 A;  1NH3 A;  3NQO A;  3ZMU A;  1FMW A;  2LDU A;  2QCO A;  4P55 A;  3PJR A;  4AYB N;  3OYI A;  4CZC A;  1XN7 A;  4OIP F;  2DOF A;  1DP3 A;  4KIT B;  3OSG A;  3V7R A;  4OAY A;  2WA0 A;  3RKY A;  3LSH A;  1U8R A;  5HLG A;  4ENK A;  2UZK A;  4EGY A;  4RB1 A;  3CC7 I;  1LEA A;  2LY1 A;  3ECH A;  4ZYD A;  2YU9 J;  1FT9 A;  3AG4 H;  4XSX F;  4G8X A;  3ZP5 A;  4AD9 A;  3ERE D;  4IOC F;  1J9I A;  3RDI A;  2VXD A;  2QBY A;  2JMW A;  3NAR A;  3WU1 B;  4IPA A;  3OYE A;  4HLX A;  2ESN A;  2QF7 A;  5EEG A;  2XDV A;  1XGO A;  1MMD A;  2IGM A;  3KYC B;  4A5N A;  4H0E A;  5BNG A;  2PJP A;  1O7F A;  1SD5 A;  2IS1 A;  2IGN A;  2LY9 A;  1D3Y A;  2XAH A;  4ZZL A;  4F3Q A;  5ERI A;  4S0H B;  4CH7 A;  3MKY B;  3EDP A;  1DDN A;  2M34 A;  3VOD A;  2K02 A;  4LG3 A;  1JTY A;  4NC6 A;  2VAS A;  1JGS A;  1UMQ A;  2JA8 J;  2YR2 A;  3BJ6 A;  4JK1 X;  3OOP A;  1PP8 F;  3BZC A;  4I09 A;  3C2H A;  4Y7N J;  3VEP A;  3TO6 A;  2H09 A;  2DA1 A;  5HOD A;  4Y33 A;  1QZE A;  2BZT A;  2DJI A;  1YW8 A;  3BTI A;  3NEU A;  5LGN A;  4OIN F;  1UHS A;  1V3F A;  3V8L A;  1FLI A;  4C3J J;  3LL7 A;  3CCM I;  4Q48 A;  4U88 A;  2EFW A;  3S1R J;  3IRQ A;  1FYM A;  1S5L C;  2E1N A;  4B3X A;  4AM3 A;  2VI6 A;  2DTR A;  2PMH A;  1W36 D;  2A6E F;  4JX4 A;  2VQG A;  4BHB A;  1BC8 C;  2E5N A;  5GPC A;  4YEL A;  1FSE A;  3OYA A;  4UY8 I;  2A5Y B;  3W3C A;  5FKM A;  1MH4 A;  1TQI A;  1J7K A;  3C7J A;  2O8X A;  3PO3 J;  1MD0 A;  3FMS A;  2CJJ A;  5CYV A;  5D5W B;  3DKW A;  4I6Z A;  1UG2 A;  3FXL A;  4EJT A;  4IX7 A;  3Q9V A;  3OIO A;  5B5E C;  2DFI A;  3E6C C;  3I71 A;  5J1U A;  3VYU B;  3CJQ B;  4CHU A;  4Q5S F;  2EZI A;  4D0P A;  3S1N J;  4G7H F;  1IN4 A;  4U7B A;  4GO1 A;  4BQQ A;  1YJ9 I;  1AHD P;  2R7T A;  3G2B A;  4HLY A;  1ZG3 A;  3DCF A;  1STZ A;  3F22 A;  1O3S A;  2CW0 F;  3GVA A;  5J6X A;  2YU3 A;  3CJN A;  4CO8 A;  1SAU A;  2P6S A;  1WH7 A;  1R4M B;  3FBN B;  3K1N A;  4HRI A;  2VON A;  2Y0S N;  1U6G A;  4EJV A;  2PG4 A;  1K79 A;  4EAT A;  3HUG B;  3BG3 A;  3PIO F;  1SEU A;  5J47 A;  4B3A A;  4GRI A;  4I2O A;  3WOD F;  4CCM A;  1PUF A;  4FE4 A;  5LHG A;  2WAD A;  1OCR H;  3OR1 C;  4IF4 A;  1ULY A;  4HV5 A;  2X85 A;  4I02 A;  2CQ7 A;  2EIK H;  1G3S A;  1LUJ B;  4JOM A;  3WU0 A;  5LD2 C;  4IHV A;  2QLZ A;  2XKO A;  3K70 C;  1IRZ A;  3BTL A;  2JQ7 A;  2QWW A;  3KP4 A;  3S2W A;  2AQF A;  3IWZ A;  2A07 F;  1TLH B;  1PYV A;  2ISY A;  3R0A A;  2EA4 A;  5GAH J;  2M4K A;  2P8T A;  2ZXH A;  4N4O B;  2F4O B;  3QRF F;  1WWX A;  3HOW J;  1RIO H;  4IOA F;  3CJR B;  3WHC A;  1MBF A;  4RB2 C;  4S05 A;  4GGG A;  2XAG A;  1MKM A;  1T39 A;  2NOG A;  2L54 A;  2CG4 A;  4G6T B;  1WJD A;  4U0W A;  3TOB A;  3BCA A;  3DBH B;  2TRT A;  2WAE A;  2XRL A;  4A3G J;  3Q3S A;  1XS9 A;  5D6E A;  1R5I D;  2PFB A;  5DCM B;  1NK2 P;  3WE2 A;  4P9F A;  4P1W A;  1XDU A;  3GF2 A;  4RA2 A;  1IJW C;  4BY1 J;  2R7F A;  4OIO F;  1KZH A;  1Y0U A;  5JHF A;  1HA8 A;  2H6B A;  2OU2 A;  1FC3 A;  1ZLJ A;  2VL8 A;  1EJ9 A;  2Z99 A;  2HR3 A;  2I5U A;  2RKH A;  3MCZ A;  1ZR4 A;  3FF5 A;  2NVU B;  1K6Y A;  2R7Q A;  3DEW A;  2OF7 A;  2M5W A;  4XNF A;  4D5C A;  2QSH X;  2O0Y A;  3BTC A;  2DA2 A;  3HOT A;  2HI3 A;  4XOT A;  4WF2 A;  2BOL A;  4I01 A;  4OMZ A;  1ITY A;  4BL0 B;  4NBQ A;  2XPW A;  5B1B H;  1ZG5 A;  2R3S A;  4BXF A;  1WI3 A;  3DU5 A;  4A6E A;  2LOO A;  1FEX A;  3IH4 A;  1WH5 A;  4CCO A;  3HJE A;  2KQR A;  2VB6 A;  2EIM H;  3PNV A;  2X1D A;  2WWY A;  1TQP A;  2TDX A;  2RAE A;  4U0V A;  2FQ4 A;  2FXA A;  1EH7 A;  2OV7 A;  1JHF A;  2XAJ A;  4I0A A;  3JRD A;  3HOY J;  1TQM A;  1ON1 A;  2O7O A;  2CQX A;  3U21 A;  3K1M A;  5GAD J;  3M1C A;  3RCO A;  1EV7 A;  3M1E A;  3W2W A;  2QUF A;  2KRF A;  4HEA 2;  5FLM J;  2HPI A;  1X3U A;  1R9T J;  2FQ3 A;  1N75 A;  3C2B A;  1OMI A;  1BIA A;  1IO2 A;  2GXA A;  3BR0 A;  1YRN A;  3M07 A;  4UVB A;  1HQC A;  5BQT A;  5FKO A;  1BW5 A;  4M6X A;  3CUQ A;  2FNA A;  3N4M A;  2FOW A;  1T2K A;  2HVQ A;  4BQN A;  4ZDO A;  1T0F C;  3H36 A;  3BG6 A;  4UUS B;  3GTM J;  4ZJZ A;  2JWT A;  3HM5 A;  5A2Q K;  1LDD A;  1HBX G;  5IP7 J;  1VQ6 I;  2KL4 A;  5DD4 A;  4QSH A;  2WV0 A;  2CQQ A;  1ETX A;  1YX5 A;  5JR3 A;  5A2Q Z;  2E34 A;  5DM6 F;  1HLV A;  2K9M A;  4LIU A;  3RKW A;  1G8X A;  4X0G A;  5HVQ C;  3E5U A;  1ERD A;  5DD8 A;  3EUA A;  4WCG A;  3KZY A;  3PSF A;  2H1K A;  3A02 A;  2E35 A;  5F0F A;  3BJO A;  3CMY A;  4LD5 A;  2HXO A;  1H0M A;  1EH8 A;  2KIM A;  5K7Z A;  1PP7 U;  3WTW C;  1J09 A;  1X58 A;  4UVA A;  3F6V A;  2HZD A;  1B9N A;  2EFQ A;  2PMZ A;  1W5S A;  1G2H A;  3C18 A;  3ZN1 A;  1K6O A;  2X0L A;  2ZFW A;  3R0J A;  4HDV A;  4R8H A;  4M9X A;  5IY5 H;  1YX3 A;  4AWX B;  3I55 I;  4J01 A;  2E7X A;  5KAI C;  2E2I J;  1QZZ A;  5B3S H;  4D5F A;  3LSR A;  1UCR A;  3LAJ A;  3SJM A;  3HSR A;  3DXJ F;  3NRV A;  1QVT A;  1LFB A;  1I3A A;  1MBE A;  4XN3 A;  3K7A J;  3JSO A;  2W48 A;  1MSE C;  4KYW A;  4A3C J;  3Q0U A;  4A0Z A;  1Y1V J;  3TW7 A;  3VSK A;  1K78 A;  1Z7L A;  2K7L A;  1T56 A;  5ICF A;  1S7A A;  2PMZ N;  3CDH A;  2NS8 A;  3A0B C;  3DFG A;  1BOA A;  4IRH A;  5E1W A;  2M4G A;  4ON0 A;  2WTE A;  1CF7 B;  5LEJ A;  5L3B A;  3QU3 A;  4I99 C;  2EBI A;  3TW6 A;  4G12 A;  1O4X A;  1W7P A;  1JXS A;  3L2W A;  2VT3 A;  4UHT A;  2FBI A;  4ENJ A;  4XLN F;  3SZP A;  1XPX A;  4KDP A;  2HOA A;  2MA3 A;  4BBR J;  3CZ6 A;  2XF6 A;  4XK4 A;  1FZP B;  1ETV A;  4EQQ A;  4LG0 A;  3COA C;  2ELK A;  4L0Z B;  3BLY A;  5F0C A;  1VTN C;  3VYR B;  4DYC A;  2CWE A;  1RRJ A;  2DOE A;  1SAN A;  3GTJ J;  3K4L A;  3HOX J;  2V1D A;  2A68 F;  1KU3 A;  5FKL A;  3DLL F;  1UB9 A;  3S1M J;  1OLT A;  4XM3 A;  3HYI A;  3DF8 A;  2ADU A;  5KVR A;  4EJW A;  3QPS A;  3ZQH A;  3KPH A;  5LRS A;  1AU7 A;  2DOD A;  4F52 A;  2FML A;  2A05 A;  3F3X A;  4PZJ A;  2M7A A;  3BP8 A;  4W97 A;  2W84 A;  3SDB A;  2CV2 A;  3I4M J;  1HDP A;  4A3F J;  1HSJ A;  1DU6 A;  1FPQ A;  3IUO A;  3KET A;  4F93 B;  3FXO A;  2BY0 A;  3TP0 A;  4V19 K;  3FWE A;  2CFO A;  4WXC A;  1XSV A;  1HKS A;  3FKI J;  3GUD A;  3LWF A;  4PJJ A;  5K7F A;  2LYC A;  4B1R A;  4BEH A;  4E7Z A;  2JJ7 A;  4M3D A;  3ISP A;  2FEZ A;  3WTX C;  3K4C A;  1PVE A;  4MO7 A;  2DTZ A;  1IXC A;  1VQ7 I;  3SXY A;  3HB9 A;  3LSI A;  1IXR C;  4IHY A;  2L2O A;  2IVM A;  2P5V A;  4L18 B;  3MMY B;  3FHN A;  5J3L A;  3G71 I;  2HDD A;  2IA0 A;  1MMN A;  1S29 A;  2R0Q C;  1XDS A;  2L9S A;  1SFU A;  3HRS A;  1IUF A;  1UG0 A;  2FJ1 A;  4CIC A;  3CCU I;  4BAC A;  4U0Y A;  2DFH A;  2LR8 A;  1Z67 A;  4IRG A;  1DGW Y;  3RJP A;  2KIU A;  2HDC A;  4XRS G;  4V2G A;  3BWG A;  2EZH A;  3WGI A;  3FX3 A;  2H6C A;  2IW5 A;  1BC7 C;  3OMY A;  2F5D A;  3H9Q A;  5EYR A;  2ZBK A;  5H6R A;  4G9Y A;  4FCY A;  1XCB A;  1AA7 A;  4M74 A;  4AIH A;  5C44 J;  2A5W A;  2KFD A;  4ZTJ A;  2PJR A;  4QPO A;  2JTV A;  2FX0 A;  3LSM A;  2HEO A;  4IQ4 A;  4F7Z A;  2E60 A;  1VQO I;  2OJE D;  1TT5 B;  1Y56 A;  4XBF A;  1Z91 A;  2DA7 A;  1JTX A;  2VQC A;  5J40 A;  4FTH A;  2ZNY A;  3F8B A;  2BHZ A;  1TTY A;  2ID6 A;  4LIT A;  3J7A O;  1P9Q C;  4DGW B;  1OFC X;  4XOP A;  1YS6 A;  3JSP A;  2GIZ A;  4A93 J;  4RDU A;  1X2M A;  1QBJ A;  2NRA C;  1U2W A;  3E6B A;  2XAU A;  4LB5 A;  2G7U A;  1QZY A;  2BXZ A;  4LLL A;  4KA4 A;  2WC2 A;  2XSJ C;  3BY6 A;  2M0M A;  3ZCO A;  1OIS A;  5FFZ A;  3KZI C;  4BHC A;  2FOK A;  2JUC A;  4A3M J;  3MFK A;  2HOE A;  2GM4 A;  1YG2 A;  1USS A;  3S32 A;  4B44 A;  1WFX A;  1FYL A;  4RB0 A;  1YHQ I;  3WTY C;  1WPK A;  2XUB A;  5E8G A;  3GFM A;  2VLA A;  3RSN A;  3FXM A;  2HGC A;  5TJJ A;  2GOX B;  1WI9 A;  4E7K A;  5L3F A;  1T08 B;  3HRT A;  2B9S A;  2EB7 A;  3BPX A;  3EUH C;  1T6S A;  2M3A A;  4PDK A;  1A31 A;  1R71 A;  5TGT A;  1OPC A;  4XLP F;  5IYC J;  1VF9 A;  4OOI A;  2CUZ A;  3MWM A;  3M3Y J;  2J5O A;  1Z21 A;  3BOQ A;  4M3G A;  5KHD A;  2FF4 A;  2EIN H;  2HQR A;  4RAZ A;  3FKJ A;  4G7O F;  1FWZ A;  2XVC A;  3I9V 2;  3TOA A;  1NG6 A;  2BW3 A;  3CCR I;  2K9L A;  4B09 A;  1R5G A;  3AG3 H;  3JTH A;  5EJC A;  4KT6 A;  4II3 A;  1FSH A;  2P0W A;  2M30 A;  5DDG A;  3OSF A;  1WVR A;  2L7F P;  3CDI A;  2K3F A;  1WGX A;  3J7Z I;  4LB6 B;  2OTJ I;  4AC0 A;  2W7N A;  4HF1 A;  4UB8 C;  3FM5 A;  1V5G A;  1WJA A;  3ESW B;  3A1Y A;  1QHG A;  3RYP A;  2EFP A;  1S7O A;  2DDB A;  2DCE A;  3RZD J;  1UST A;  2R5Y B;  2HQ5 A;  9ANT A;  2DA5 A;  2W85 A;  3LSK A;  4M9Z A;  1QHH D;  3RYR A;  4A3L J;  3CCV I;  3VFZ A;  2ZME A;  3O3K A;  1B6A A;  4CCK A;  3W6V A;  2LFB A;  5GAG J;  5CVR A;  1KYW A;  2E1O A;  1VQN I;  1BIB A;  5F27 A;  2H94 A;  1SD6 A;  3OYF A;  2BVM A;  2XIG A;  3EQL F;  4B43 A;  1BJZ A;  1ZR2 A;  2V26 A;  2YSR A;  4HW0 A;  3S3M A;  2ZJ2 A;  3J7A Y;  3PFY A;  5EEH A;  4A3E J;  2YUS A;  4AID A;  5LBQ A;  1L3L A;  2AQE A;  1APL C;  1T95 A;  4RLQ A;  4DYQ A;  1VND A;  4D7M A;  4HYE A;  2QM3 A;  1I6X A;  3DKX A;  4NC7 A;  1BI2 A;  4XIC A;  2ME6 A;  2V9V A;  2QA4 I;  2M7B A;  2R7V A;  3DPU A;  2MYS A;  1U78 A;  2MD0 A;  2X48 A;  1VQK I;  4M72 A;  1WJB A;  1LE8 A;  3OS1 A;  3P9C A;  2CV1 A;  3F0C A;  1JJ6 C;  3HSF A;  2W24 A;  2DU9 A;  3FDY A;  1ORK A;  2HKO A;  3WTT C;  2X51 A;  5AIP A;  4CYD A;  3ZGK A;  1JJ8 C;  1BR1 A;  2JPC A;  4H4K C;  3QYB A;  2PEX A;  4LLG F;  5HLI A;  1KQ9 A;  4MQV A;  1X1D A;  2DA3 A;  2XRO A;  3HEF A;  2F48 A;  3TKY A;  3GXO A;  1UHW A;  5GAE J;  1J2X A;  5IP6 A;  3ZPL A;  2LH9 A;  3ABU A;  2DA6 A;  4E7H A;  1G3Y A;  4CYC A;  4BYY A;  4L5E A;  1YOV B;  1BI0 A;  4HST A;  3I4N J;  2F5V A;  1YI2 I;  2CSO A;  1JHH A;  4YIR X;  1R7J A;  2DMN A;  2IP2 A;  3BR3 A;  3DLA A;  1VQ5 I;  4KMF A;  2XGE A;  2FRH A;  4IJA A;  1YO5 C;  3ZXS A;  3QPH A;  1WJE A;  2QQA A;  5IYD J;  3SHF A;  3LST A;  4DNC A;  1JKO C;  2KZV A;  1SVM A;  1ZAR A;  3W2A A;  4FT8 A;  1Z7U A;  4LOC A;  4BAY A;  2VC0 A;  3ABL H;  5J1Y A;  2FD5 A;  5IOY A;  3PNY A;  3D0S A;  1OR7 C;  4MFD A;  3HXL A;  3GW2 A;  2W25 A;  2KJB A;  3LA3 A;  1BJA A;  3A0H C;  4DOZ A;  1P2F A;  3V42 A;  4HX4 A;  2VIX A;  1BOB A;  2XGC A;  1D1A A;  2DW4 A;  2LSO A;  1POG A;  3R6S A;  1S8N A;  3K2Z A;  3KZZ A;  2K4J A;  2UXN A;  3JRH A;  1FMV A;  2WAF A;  4GXO A;  2JK3 A;  3WTV C;  3SEZ A;  4Y4R A;  3X2Q H;  3HRU A;  1GV5 A;  3RPU D;  3Q0W A;  3L09 A;  3S15 J;  1F4K A;  1E17 A;  1ZEL A;  2ZO4 A;  2JA6 J;  1BL0 A;  2O3F A;  2K5C A;  2R7Z J;  3KYD B;  3DKY A;  1R23 A;  3FXK A;  3ABK H;  1DPR A;  1B72 A;  2QBY B;  1N78 A;  1D5Y A;  1JI8 A;  3LA2 A;  2M45 A;  4M3E A;  3ABT A;  3ZQG A;  1IZ1 A;  1MZB A;  3G73 A;  5BS6 A;  3F8N A;  1P7I A;  2HU9 A;  2OBP A;  3ECO A;  3RIR A;  4ZH4 F;  4A3J J;  2QYO A;  3AAF A;  3KCC A;  3O6B B;  1IGN A;  4R1H A;  3DV8 A;  3RPQ A;  2Y2Z A;  3K6G A;  3LNQ A;  2OA4 A;  4RAF A;  4OMY A;  4J19 A;  2EZL A;  5FRM A;  3H9J A;  5J8F A;  2Z16 A;  1XMA A;  1PJR A;  4PJM A;  4PJ0 C;  2XRN A;  1AKH A;  5L3G A;  4G6D A;  3CES A;  1M1E B;  1YLF A;  5J8C A;  2V6E A;  3B6C A;  2Y0S A;  4NUB A;  3S3N A;  3VYS B;  1SFX A;  2Z3Y A;  2QKM B;  1MGT A;  4CCJ A;  2IA2 A;  2E71 A;  4W1U A;  3EUK L;  2VT2 A;  4PJN A;  2CGP A;  2MBF A;  4I7H A;  2L9R A;  1ENH A;  3K10 A;  2GZW A;  2CO5 A;  5EZG A;  4V2F A;  2EV6 A;  3ASN H;  1QVU A;  5FRO A;  2B7E A;  1ZLK A;  5L3D A;  1JE8 A;  4XMY A;  2BHY A;  4RM3 A;  2IGO A;  2LTP A;  4GDF A;  1I50 J;  3I56 I;  3L9F A;  3C3W A;  4IXA A;  5HS8 A;  2JPB A;  4DW6 A;  1MDM A;  2MGQ A;  3VSL A;  5B1A H;  4CCL A;  2HYG D;  2MW8 A;  4Q47 A;  3BDD A;  2TCT A;  4HNT A;  1SD4 A;  3TBI A;  2GLO A;  2NAZ A;  3TDU C;  3AKZ A;  1G4D A;  5E3O A;  1SVO A;  1A6I A;  2ZB9 A;  3ABM H;  5DUI A;  4FET A;  2UWM A;  4GFB A;  5IPA A;  1IAW A;  2ZJP F;  1LPQ A;  3OYD A;  5J1R A;  1X1C A;  1DQU A;  2RV8 A;  3B02 A;  2E19 A;  1MJB A;  3CQZ J;  2OC6 A;  4IEJ A;  4LGW A;  4Y13 A;  3QPT A;  4KMU X;  3TED A;  4BU2 A;  6PAX A;  1W5T A;  2MLG A;  3F8F A;  2NVQ J;  4C2T A;  2UXX A;  1OCP A;  1JKR C;  2LF7 A;  2JSC A;  2ZJR F;  1PUF B;  2EWN A;  4EGZ A;  2Z2S B;  5E18 F;  5LGT A;  4A6D A;  4HQE A;  2VKH A;  4L0Y B;  1MBK A;  3KEO A;  1MNM C;  5EF6 A;  4NC8 A;  1L0O C;  3DTE A;  2NS7 A;  4AUX A;  1R58 A;  4A0X A;  3K4B A;  4I98 B;  1ZRD A;  2R7S A;  2O6G E;  2WB1 N;  1TL8 A;  1DP7 P;  4YII A;  1VQ8 I;  3JCU C;  1S9H A;  3B6A A;  1D8K A;  3R60 A;  1TWH J;  2ZXW H;  3LSP A;  2G9W A;  5C4J J;  1KGS A;  1Z6T A;  2BEO A;  2GBY A;  3L2V A;  4KIF A;  2HZT A;  1FOY A;  4PCQ A;  4YIF A;  4NQW A;  3L2C A;  3FM3 A;  2STW A;  3FZV A;  1X1B A;  3CCY A;  3IH2 A;  3KEQ A;  5J4Y A;  1O57 A;  1IC8 A;  1P4X A;  2IJL A;  1GUU A;  3H0D A;  2COM A;  1NTC A;  2M0C A;  1IRX A;  1Y8Q B;  2Q2E A;  2IRF G;  2XPV A;  1ETW A;  1R49 A;  2OD5 A;  5HDG A;  1X4P A;  2RDP A;  3OYK A;  5F04 A;  1XX5 A;  2PLY A;  3AG1 H;  2UUZ A;  3BT9 A;  2JRM A;  3T5X A;  3NWT A;  1UAA A;  2MH2 A;  2VXZ A;  3E5X A;  3OR2 C;  2KIQ A;  2LD5 A;  5LFA A;  4ZYA A;  3D5L A;  1W5C C;  2OPT A;  2MD5 A;  4E7L A;  2P5K A;  5DTD A;  4BKX A;  1R1T A;  4L5J A;  1R4N B;  3K1P A;  4XLE A;  2Z9O A;  3K9T A;  2NVY J;  2VUM J;  4UUT A;  2DA4 A;  4E70 A;  4XQF A;  4UUV A;  3ZMZ A;  3IH3 A;  4ESJ A;  5D4S A;  4MEX F;  1FIP A;  3MEX A;  2E2H J;  2YX7 A;  2EFN A;  1QGP A;  1S7E A;  4RGU A;  1T98 A;  4YEJ A;  2VE9 A;  2ETH A;  2LF8 A;  4AVZ A;  2VOD A;  2ELH A;  2NS0 A;  1Y6I A;  2WV1 A;  1EA3 A;  1H88 C;  4PGH A;  1ETY A;  2D2W A;  2M1B A;  3EYY A;  2B63 J;  4QLC U;  1ETO A;  2V1X A;  4L9T A;  5FO5 A;  1LNW A;  3F72 A;  1BR2 A;  2W82 A;  1U0J A;  4LK0 F;  1SFE A;  4XKC A;  3H0G J;  2KLO A;  4BXX J;  1MBH A;  1GVD A;  2E36 A;  2I10 A;  5E3N A;  1IDY A;  3SZT A;  2EQR A;  2HTJ A;  2XGD A;  3E1S A;  1UFM A;  3E6M A;  3M8J A;  4HPQ A;  3HHG A;  3PSI A;  1K4T A;  1MSF C;  1Y0N A;  3O8G A;  3ULQ B;  3H5R A;  1YRN B;  4MFE A;  3WU2 C;  3DP7 A;  2CU7 A;  2FMY A;  3JAM Z;  2GOM A;  3CUQ B;  4RGR A;  1WCM J;  1FBS A;  1I39 A;  3P5J A;  3A2K A;  1ZH5 A;  2CFX A;  2CQK A;  5FD5 A;  1HOM A;  3GME A;  2BBY A;  2F4M B;  2OUM A;  1VQM I;  2AXT C;  3TO9 A;  3WHB A;  1SAX A;  2OCC H;  3TDZ C;  3A01 A;  1XSD A;  2YX4 A;  3DPT A;  3HGY A;  3RQI A;  3E6D A;  5E17 F;  4IVN A;  2EPF A;  3K2A A;  5DM7 F;  1NHA A;  3QU6 A;  2ECC A;  2W00 A;  2KMU A;  4J00 A;  3FXQ A;  3F23 A;  2NVT J;  4EV0 A;  1UJ8 A;  1TW3 A;  2ME0 A;  4M9S A;  1OCZ H;  2KHM A;  2NYX A;  2I8D A;  3E7L A;  4XN0 A;  4DZP A;  5HDN A;  3JRA A;  1FTT A;  4BQA A;  3G1M A;  2Y9Z A;  2IGK A;  3GLX A;  5HS9 A;  1RUN A;  1LDK B;  3ZN0 A;  5E3L A;  4HV6 A;  5LHI A;  1LFU P;  3CUQ C;  2UV1 A;  2W1O A;  3B73 A;  2VC1 A;  3UNG C;  4BXU A;  3KP6 A;  1VZ0 A;  4BJ5 C;  5FRN A;  1BA5 A;  3PQJ A;  4BUP A;  2NOJ B;  1D1B A;  2K9Q A;  4CSW A;  4YG2 F;  1SMT A;  2JVG A;  3W2V A;  2HOS A;  2GA2 A;  4DBR A;  3GFI A;  1T33 A;  5JI6 A;  1K78 B;  4R79 A;  3DPL C;  3JR9 A;  2OTL I;  3HKZ N;  3KIO A;  1MH3 A;  1B59 A;  3TL4 X;  5CJ9 A;  1QPI A;  1MBG A;  4NB5 A;  1S72 I;  1YW9 A;  2HXI A;  3HOS A;  1ONV A;  5ICC A;  5E79 C;  3MAJ A;  3O2P E;  2PI0 A;  1W7P B;  1ZGW A;  1QA6 A;  1XGM A;  2DT7 B;  2XV4 S;  3FIS A;  1V5F A;  2DYS H;  4C2M J;  3I4P A;  1GXQ A;  3K70 D;  3GLL A;  2DFF A;  1YQA A;  1FOX A;  4LG0 B;  3ZQF A;  3QP5 A;  5ICG A;  2EIL H;  4EM1 A;  2LLK A;  4XID A;  5AON A;  2F5E A;  2A61 A;  2IA1 A;  2K9N A;  3DWL E;  2F2E A;  3I5U A;  1MNE A;  1RES A;  2ISZ A;  1DUX C;  1GXP A;  5DEQ A;  3IV5 A;  2OAZ A;  4IHW A;  1Z9C A;  2KT0 A;  4ENM A;  2DO7 A;  2R7R A;  3J80 Z;  1TWC J;  3I54 A;  3SFZ A;  3T0Y A;  1SVL A;  1E0E A;  4F91 B;  4EJU A;  2LBF A;  3S2D J;  2DN0 A;  5EGO A;  3HIF A;  3W6J B;  3GTQ J;  1KYZ A;  3CCS I;  2LC2 A;  2FBH A;  2G0E A;  4MIM A;  2P5L C;  3RPU A;  4YFX F;  3OIP A;  1ZGA A;  1XMX A;  2H1L A;  4A69 C;  4OWR B;  2X6X A;  5EZH A;  5F1R A;  2DPU A;  1LVK A;  4PSW A;  1DGR M;  1R1V A;  1U8B A;  4U7D A;  1R00 A;  4XKV A;  4BEH B;  2QVO A;  4RGX A;  2VBX A;  2DK5 A;  2F4I A;  1IUY A;  3AFH A;  2L4M A;  1P7J A;  1FOK A;  1CQT A;  5CLS A;  2B0L A;  2LP0 A;  1MBJ A;  1MW7 A;  3G1O A;  1IG7 A;  3LA7 A;  3P9K A;  1YW7 A;  3HZJ A;  4KJZ A;  2Q8K A;  5IT3 A;  3BQY A;  1K7A A;  3GZ5 A;  1I5Z A;  3GFL A;  2L9V A;  3GCM A;  3J7Y J;  1P92 A;  3RQ4 A;  5LGU A;  3N05 A;  4KIC A;  1LKX A;  5H20 A;  1WJ5 A;  1TWF J;  2QQB A;  2V7F A;  4XR6 A;  3ZQQ A;  1WKM A;  5DS9 A;  2FSW A;  3IC7 A;  2XGX A;  3I59 A;  3GWZ A;  4M71 A;  4ENN A;  5FLV A;  1X2N A;  2ECB A;  1FP2 A;  1MMG A;  5FJ8 J;  3GO5 A;  4D1Q A;  1J5Y A;  2Q0O A;  1IV6 A;  2PJR B;  1KU2 A;  2WAQ N;  3WG9 A;  2QEN A;  1TT0 A;  1ETQ A;  3HOV J;  2R7W A;  4N9I A;  1K4S A;  1UHM A;  2KIF A;  1JUP A;  4B48 A;  4IKF A;  1D0Y A;  3EET A;  2VQL A;  3CJT B;  4KUM A;  4MTE A;  3GTL J;  2CV0 A;  2R4G A;  2VJ5 A;  5K5Q A;  1V5E A;  4AU7 A;  4XKB A;  1X1P A;  3S16 J;  4A5M A;  2BY1 A;  5D8K B;  2RNG A;  1HW5 A;  3ERM A;  4G7Z F;  2HOT A;  1OYW A;  2IEK A;  4HSR A;  3BR6 A;  3LSG A;  4DZJ A;  1W0U A;  2HYJ A;  1OYY A;  4PUS A;  4RS8 A;  1GT0 C;  1W36 C;  3FK6 A;  3WTS C;  2BYV E;  2QGU A;  1U5T A;  2XPU A;  2L7Z A;  4ANJ A;  5DYM A;  3H9G A;  3OS2 A;  4U87 A;  1CGP A;  3OYL A;  2CYY A;  1B8I A;  4NHJ A;  3MKW B;  1WJF A;  3MQ0 A;  3LOC A;  3CC4 I;  2RRE A;  2L01 A;  1FJL A;  1QU3 A;  4RB3 C;  4L9N A;  5LEK A;  3CLO A;  4KIS A;  4O5V A;  1BI3 A;  3OV8 A;  1FBQ A;  4C9Y A;  2ZFU A;  4IHT A;  2R7U A;  1Z1D A;  2JA2 A;  4BJ6 C;  2A3S A;  1IXS B;  2K40 A;  3Q9S A;  2IBD A;  4LJZ F;  3HGG A;  2QZ8 A;  4LFU A;  3ZMV A;  3DU6 A;  2BXY A;  5EG0 A;  3SQN A;  2V79 A;  1G59 A;  5FFX A;  2VN2 A;  4II2 A;  1YS7 A;  1U9O A;  2BW3 B;  1D0Z A;  3C2G A;  1JT6 A;  4ETS A;  3U1D A;  3RKX A;  1MMS A;  2O8K A;  2NXN B;  2HVR A;  3JRE A;  2X6Y A;  2CQN A;  1XG1 A;  5HLT A;  3BG7 A;  2XB0 X;  3PO2 J;  3CF2 A;  4UXN A;  2NVX J;  4RBO A;  3KE2 A;  2JZY A;  5HDK A;  5IOZ A;  3VB2 A;  5D6F A;  5D4R A;  2JT1 A;  4I0B A;  1A36 A;  2RGV A;  2KIS A;  4TV7 A;  5FKK A;  2R5Z A;  3CDL A;  2F5F A;  1J59 A;  2WBM A;  2JUG A;  1Y1W J;  4P5O A;  4BE1 A;  4XSZ F;  3DBR B;  1ZG1 A;  1S6L A;  2OQG A;  2AO9 A;  1B9M A;  5D5U B;  3P7N A;  2ZME B;  2MSY A;  4KIB A;  4RAG A;  3KEY A;  2ZXI A;  2EIJ H;  2MAB A;  4HG2 A;  3BG9 A;  1RC9 A;  3GEZ A;  4F92 B;  3GZN B;  1ZTR A;  5TIS C;  3Q5F A;  1Y39 A;  1LVA A;  2EZK A;  3FMQ A;  5CQG A;  4QIW N;  3CF5 F;  3JRC A;  3FXU A;  1GHC A;  2KRC A;  1N25 A;  1IV8 A;  4BQO A;  2FA5 A;  5TRD A;  3IHU A;  3QYF A;  1GVJ A;  4ZYG A;  4ZC3 A;  5KAF C;  1P4A A;  2MH9 A;  1EH6 A;  3CUO A;  2VKE A;  1FP1 D;  3FBI B;  4MGR A;  3JRF A;  2ZJQ F;  2MLK A;  3FXJ A;  1HCR A;  3S2H J;  1WZ2 A;  5E1Z B;  3OYH A;  3H35 A;  2XHK A;  4FE7 A;  4A0Y A;  3WTZ A;  1LE8 B;  2DMT A;  3V7C A;  2DBB A;  2ZME C;  4KNY A;  2X6O A;  4O3M A;  2EV5 A;  2D1V A;  3OYG A;  1Z77 A;  1Q1H A;  3BZK A;  4CA0 A;  1W4M A;  1XD7 A;  3HL2 A;  3BR5 A;  1A04 A;  2YS9 A;  3L00 A;  1RUO A;  1UEL B;  2E5Z A;  2EV0 A;  4X1E A;  1FNN A;  4HA8 A;  1VQL I;  2DAO A;  2X1E A;  3WG7 H;  5BPI A;  4IQJ A;  3S14 J;  1OYI A;  3REO A;  3ZMT A;  1HST A;  1XMK A;  3BPV A;  1DPU A;  2R7O A;  2KDO A;  2FNP A;  2QQ8 A;  3I53 A;  4XRM A;  4HDU A;  4RM2 A;  3RTR A;  2GXB A;  4G6Q A;  5CVJ A;  4CYC B;  1F36 A;  1V55 H;  3CP8 A;  2A69 F;  2ZSI B;  2XAS A;  1R5H A;  4WXD A;  2QKL B;  3SEQ A;  2DQR A;  4M3F A;  5JVT A;  4FAS D;  2VBY A;  3TP3 A;  1W1W E;  1FYK A;  1Z0X A;  2HFH A;  4PFP A;  2VBW A;  1NK3 P;  1RKW A;  4O6J A;  3TMO A;  4PJL A;  4YFK F;  1LDJ A;  2DQL A;  2O9L A;  3HPH A;  3Q0V A;  4X6A J;  2VOP A;  2NNY A;  5L3E A;  4ZTF A;  3ELK A;  5FB2 A;  3PIP F;  1OCT C;  1SFK A;  2DK8 A;  4HNV A;  2FBK A;  3GFJ A;  1Y8R B;  1Z3X A;  2BY2 A;  4XOR A;  5FD6 A;  2E1M B;  3D5R C;  1W0T A;  1A35 A;  1D0X A;  2X1C A;  4PSX A;  2STT A;  2Y31 A;  4MEY F;  4DBQ A;  5FGM A;  4DQ2 A;  3OOU A;  2DT5 A;  5K5R A;  1DU0 A;  2IT0 A;  2R93 J;  4IHX A;  5JLX A;  2VBZ A;  3QQA A;  4CDG A;  1RET A;  2E1C A;  3JRB A;  5IT9 K;  2VKV A;  4M73 A;  1ZYR F;  5BOX A;  2R7X A;  1PDN C;  1MJA A;  2L7K A;  5HS7 A;  4LLN A;  1B72 B;  5IT9 Z;  4K2E A;  3HOU J;  2ACJ A;  1FIA A;  2Z33 A;  4PK4 A;  3CD6 I;  2VE8 A;  5D5X B;  2OZ6 A;  3FXR A;  4BH9 A;  1TC3 C;  1IN7 A;  2E1M C;  4FQG A;  3BG5 A;  2XB5 A;  4MTD A;  3EYI A;  2PQ8 A;  1A5J A;  1BBY A;  2Y9Y A;  2HTS A;  5M3M J;  3JRG A;  4Y52 J;  3ZQI A;  5ILV A;  2X6W A;  1FOW A;  3KLN A;  4XL9 A;  5M3F J;  5LHH A;  3BR2 A;  2R7D A;  3CTA A;  1RI7 A;  3WE3 A;  2A6T A;  2Y75 A;  1JGG A;  5FLX K;  2F5C A;  1U9N A;  2XAF A;  3KFW X;  1AKH B;  5E8I A;  3R4K A;  2ZC2 A;  1REP C;  3DQV C;  1IN5 A;  1WJC A;  3IP4 B;  2L9N A;  1TP4 A;  3MVP A;  3HUG A;  5FLX Z;  2ZXJ A;  4N9H A;  3VOE A;  3E5Q A;  2MC4 A;  1O3R A;  3VWB A;  4M3B A;  2OQR A;  2M87 A;  1U3E M;  5ED4 A;  1LFP A;  1B1B A;  1V4R A;  5KK1 A;  2GQQ A;  4BJT A;  3IAS 2;  4FHT A;  5JLW A;  3F21 A;  1VQ9 I;  5ILS A;  2IXS A;  3JTG A;  2PN6 A;  1N77 A;  2WB1 A;  2PBI A;  3QYE A;  3JRI A;  4HQM A;  5CKT A;  3KP5 A;  2VPR A;  1TWG J;  3KX2 A;  4MLO A;  5CVI A;  1MDM B;  3MZH A;  2KPM A;  3SFI A;  2EFO A;  1LB2 A;  3T8R A;  3OYC A;  2E2J J;  1XSX A;  3S17 J;  5JHU A;  3CCL I;  3I58 A;  1BW6 A;  3WGH A;  2CH0 A;  2WY7 Q;  1PUE E;  2RQQ A;  3DTK A;  5DCM A;  2RQP A;  4HNU A;  4E7S A;  4BS9 A;  5B66 C;  3F8M A;  3CMA I;  2X9D A;  3BTJ A;  3PQK A;  4WXH A;  2CUJ A;  3F8C A;  2VOO A;  2XF5 A;  3G4S I;  3R61 A;  1X3W B;  3QOD A;  4E4H A;  1IW7 F;  1HW2 A;  2DYR H;  2OZU A;  3BRO A;  1FTZ A;  3M8F A;  1IDZ A;  2P6T A;  4RAY A;  4CZZ A;  1RR8 C;  1RKT A;  3RKQ A;  1ZRF A;  1D1C A;  2M8G X;  2YPR A;  1XCV A;  3HOZ J;  5EEA A;  4KN4 X;  2AHQ A;  5BPD A;  3QP6 A;  1H8A C;  4A2U A;  3M7G A;  3NAU A;  2V6C A;  4GYG A;  4UV9 A;  4HBL A;  4EMS A;  1D8J A;  5M5W J;  3ZMS A;  3OYN A;  2P81 A;  1G6N A;  3TO7 A;  2LNB A;  1ZRE A;  2MC3 A;  3GX4 X;  3ZQL A;  4NQW B;  3ONQ A;  5DUK A;  1KQ8 A;  1T0F A;  1GDT A;  5D5V B;  1SD7 A;  1G3T A;  4WX9 A;  2DMP A;  5F6F A;  2HYF A;  2ZSH B;  2Q2E B;  1H9T A;  3G6E I;  2IAI A;  4LK1 F;  1EKE A;  1ZK8 A;  2GIV A;  4N4N B;  5E3M A;  1T8I A;  2AS5 F;  2DXI A;  2V4J C;  2VJ4 A;  1ETK A;  2L3D A;  2RC4 A;  1QO0 D;  1Q1V A;  4C3H J;  5K5O A;  3T8T A;  1IN8 A;  2L0K A;  3HDD A;  4M6Y A;  1R36 A;  1ACI A;  2LKP A;  3LQR A;  5M5Y J;  3S3O A;  1OCO H;  3H5N A;  5GTI C;  1IF1 A;  1QPM A;  1VI0 A;  3V7S A;  3HG9 A;  4A3K J;  4AIJ A;  2V9K A;  2EH3 A;  1VQ4 I;  4UUS A;  2HVS A;  3HTS B;  3PM1 A;  1KU9 A;  3HRM A;  4BY7 J;  2FE3 A;  2FUG 2;  1Z05 A;  1UZC A;  4PGG A;  4ZZD A;  4IHS A;  4CGZ A;  1YIJ I;  5E1X A;  1Z3Y A;  1BR4 A;  1HXD A;  1E3O C;  1OKR A;  3JAM K;  4CCN A;  2DMQ A;  4I76 A;  3CO6 C;  2CMP A;  4B8X A;  2HQN A;  3D5S C;  4A3D J;  3ZR8 X;  4XRS A;  1O3Q A;  1HKQ A;  4EM2 A;  4BDZ A;  1J75 A;  1E3H A;  2L02 A;  2D5V A;  5EDN A;  2D45 A;  2JA7 J;  2HNH A;  4QTR A;  4EJO A;  1P4W A;  5C4X J;  1JKP C;  3KLO A;  3GTG J;  4LMY A;  3JW4 A;  3MD2 A;  5GPA A;  4C2U A;  4QPQ A;  2IS4 A;  3U1K A;  2KRH A;  2R92 J;  2XAQ A;  2VJJ A;  1ZN2 A;  1XTA A;  4E7I A;  2K3P A;  4HX7 A;  5D8L B;  2MFZ A;  3IWF A;  1X1A A;  4FX4 A;  5CPR B;  3A4C A;  5CQE A;  3V8J A;  4BGD A;  4M6V A;  3K4J A;  4JYK A;  1GLN A;  4RGS A;  2RVC A;  3BQZ A;  4Z6Y A;  5HNF A;  2E7W A;  5AIQ A;  1X3Z B;  1XGN A;  1KU7 A;  2ICW G;  4F55 A;  3CCJ I;  3DEU A;  3HKZ A;  4HF2 A;  4ZDP A;  3A01 B;  1JUS A;  2V9P A;  4B47 A;  1CF7 A;  4IZZ A;  1NG7 A;  3C1D A;  4KN7 X;  1J0R A;  3FIW A;  3H92 A;  3VPR A;  1SFO J;  2K86 A;  3CMM A;  1FX7 A;  1YE9 A;  2GAU A;  4KIG A;  2VKD A;  3LSJ A;  2IS2 A;  4ASN A;  2GXG A;  2ZNZ A;  3HPG A;  2Z1D A;  4EVI A;  1IRF A;  5ILU A;  4FIS A;  2ESH A;  3CO7 C;  3K4M A;  4XRF A;  3ZMD A;  4ZYE A;  2X4H A;  2CW7 A;  5HNH A;  1YFH A;  2NNN A;  5F64 A;  3LFU A;  4BBS J;  1IRG A;  3H3V K;  4D7N A;  1I1S A;  2DPD A;  1QQI A;  1YJN I;  4G94 A;  4A12 A;  1HW1 A;  4ITV A;  4BHP A;  2LVS A;  3L2Q A;  4L9V A;  2LRE A;  1TWA J;  1P6R A;  5KNL A;  2M9H A;  1R22 A;  2HDW A;  2Y30 A;  3EPZ A;  4BDY A;  4XLC A;  3AL0 B;  2A6H F;  3E3V A;  2K9S A;  3BCB A;  4FX0 A;  3BJA A;  5CVU A;  4CXF A;  1HKT A;  3VYT B;  4UV8 A;  2W4S A;  2LKX A;  2JVH A;  3J81 K;  2XF7 A;  4HOB A;  3CP2 A;  3J80 K;  1K61 A; 
#chains in the Genus database with same CATH homology
 1VQO I;  1VQ8 I;  3CCQ I;  1YIJ I;  5DM7 F;  1FOY A;  2QA4 I;  3CCE I;  1MMS A;  2NXN B;  1YJ9 I;  1VQK I;  3CCL I;  3PIP F;  5GAD J;  3CMA I;  3DLL F;  3J7Y J;  1HC8 A;  3G4S I;  3CC2 I;  3PIO F;  1YHQ I;  4IO9 F;  2QEX I;  3CC7 I;  5GAE J;  2FOW A;  1Y39 A;  2OTL I;  2JQ7 A;  4V19 K;  3CCJ I;  4IOC F;  3CF5 F;  1VQ6 I;  1YI2 I;  1S72 I;  5GAH J;  3CJT B;  1VQ5 I;  3CD6 I;  2E34 A;  3I56 I;  5DM6 F;  1QA6 A;  4IOA F;  1VQ7 I;  2ZJQ F;  3CCR I;  2E35 A;  1YJW I;  1FOX A;  3G71 I;  1FOW A;  5JVG F;  2K3F A;  3J7Z I;  2OTJ I;  2ZJP F;  3CCU I;  3G6E I;  2E36 A;  3I55 I;  1YJN I;  2H8W A;  1VQL I;  1ACI A;  3CC4 I;  3CCS I;  3CCV I;  2ZJR F;  3CCM I;  3CME I;  1YIT I;  5GAG J;  1VQN I;  1VQ4 I;  1VQ9 I;  1VQM I;  1VQP I;  4UY8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...