3W6JB

Crystal structure of scpab core complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
168
structure length
168
Chain Sequence
KPAKAIVEALLFAAGDEGLSLSQIAAVLEVSELEAKAVIEELQQDCRREERGIQLVELGGVFLLATKKEHAPYLKKLVEAPGASPLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTGRPILYGTTPEFLDYFGLKTLEELPPLPEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ScpA
publication title Molecular basis of SMC ATPase activation: role of internal structural changes of the regulatory subcomplex ScpAB
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 42
structure length 168
sequence length 168
chains with identical sequence C, E, F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04079 SMC_ScpB Segregation and condensation complex subunit ScpB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3w6jB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3w6jB02
5IT3A 3ULQB 1SD6A 4HV6A 5L3FA 3WTUC 3J80Z 3QU3A 3FF5A 5DEQA 4AD9A 3DQVC 1FWZA 4AWXB 1STZA 4ASNA 4RB0A 2E1NA 2JPCA 1Z1DA 1YFHA 1D8KA 3I59B 2W24A 4U0WA 5ILVA 4Q47A 2QZ8A 3K69A 2P8TA 2QQ9A 4A0YA 4IVNA 1QBJA 5HS7A 2GWRA 3K2ZA 2ZFWA 3L9FA 3W6JB 1PUEE 5HS8A 3Q5FA 1O7LA 2RC4A 4MQVA 2O03A 4P96A 4ZYDA 1P2FA 3P7NA 1R1UA 5HLIA 1Z6RA 1R7JA 3IRQA 1R00A 4LLNA 4LD5A 1H9TA 3F8CA 3DPTA 2QQAA 2RN7A 2GZWA 3MFKA 1SMTA 4GYGA 2K7LA 5L3BA 2XASA 4CDGA 1HKQA 4DQ2A 1P92A 1S7AA 3SZTA 2GA1A 1SD4A 1XSXA 3O3KA 3VODA 3OOPA 4HV5A 4R8HA 1ZLJA 4BHCA 3HYIA 4BNCA 3HSEA 1JXSA 2PEXA 5AONA 1LDDA 1DP7P 3TO6A 2ZMEB 3RI4A 3HOSA 2RNJA 3WTWC 3KFWX 1B9NA 3I54A 2NNYA 4H0EA 4OOIA 1K78A 3CUOA 2F5FA 2VE9A 5FFXA 2EV6A 4MHGA 1F5TA 4GXOA 4KIGA 3H3ZA 1Z05A 4BHBA 1E17A 3DFGA 1ON1A 4ZZDA 4LB6B 2H6BA 3MAJA 2ZCWA 1WSUA 5JVTA 1J75A 2X4HA 1Z7UA 1KU2A 2R7FA 2JPBA 3TDUC 2OZUA 3WGIA 5LRSA 1FSEA 4NQWA 4CICA 1Z6TA 3HSRA 3WU1B 2P5LC 3HHGA 2QWWA 5E1XA 5E20A 5HVQC 4ZYEA 2IA1A 5KVRA 4EJOA 5LBQA 2KIUA 5K5RA 4ENJA 2O61A 2RDPA 1G6NA 3RTRA 4GCVA 1IN7A 3WTTC 4PDKA 2OD5A 3NRVA 5BS6A 5HS9A 1XGMA 4PCQA 1FY7A 4Y13A 1QO0D 1PDNC 3WU0A 2ISYA 1ZRCA 1MJ9A 4DNCA 3CDHA 3SHFA 2ETHA 1XCVA 4LJZF 1BJAA 1OMIA 1K78B 4UNOA 1T38A 3QP5A 3E6MA 4BH9A 3R0JA 3BPXA 3LSTA 3COAC 1IW7F 4LLGF 3KP5A 2OQGA 2VN2A 1YG2A 2FOKA 4A5NA 2ZXJA 3F8NA 4HX7A 2EK5A 1XDSA 2XHKA 3K9TA 4YFKF 1WRJA 4HLYA 2O6GE 2DT5A 4M71A 2HGCA 5LLQA 2OBPA 1F4KA 2ZNYA 2IT0A 5BPDA 1GVJA 1QQIA 4KIFA 2EFWA 3R60A 5BOXA 1JGSA 3BP8A 1IZ1A 3GEZA 3F8BA 1QZYA 5DUIA 1ZAOA 4PGGA 2M1BA 3GUDA 2GXGA 5HOOA 5A2QZ 1GHCA 1YW7A 1LEBA 3ZQ7A 2FEZA 2ZNZA 3QU6A 1C0WA 5LGNA 5HLGA 2NNNA 3HRSA 2VBYA 2VXZA 4MNUA 2VOOA 5HLHA 2HDCA 4LK1F 3DP7A 3RYRA 2BGCA 2NAZA 1YLFA 3LA2A 4WF2A 3E6DA 2DTRA 2P5VA 5E18F 1WQ2A 2A3SA 4I0BA 4ON0A 4G94A 4I7HA 1B4AA 4AVPA 1JE8A 1ZYRF 2K86A 4K2EA 1HQCA 1XMKA 3KP3A 5CLSA 3GXOA 3RJPA 2PQ8A 3JAMZ 3JSPA 5CJ9A 3WODF 3ZMTA 5CVVA 3LQRA 5EEGA 5K1YA 5D5XB 1OPCA 4RGRA 1LB2A 3IC7A 1PP7U 2NS0A 2BBYA 1FZPB 3LQQA 5FLXK 2A68F 2EFNA 3PQKA 1YQAA 3ROUA 3E97A 1BI3A 4XLPF 5BPIA 1ZRFA 3KP4A 2NRAC 2IW5A 3QOPA 5CVJA 1R36A 3ZPLA 3F6OA 5DD4A 1TBXA 1KGSA 1B1BA 1FP1D 2L4AA 1RNLA 1RZ4A 2L54A 3MCZA 1T39A 2F2EA 3HRMA 1D8JA 3V8KA 3BJAA 4RAYA 2CFXA 4ENNA 4KMUX 1B6AA 2XAGA 1WWXA 5E8IA 1KU9A 4P55A 5BMZA 1XN7A 2V9VA 4A12A 4XSZF 2HEOA 1LJ9A 3FMRA 1ZRDA 5A2QK 2QM3A 3VB2A 2V1DA 2QQBA 3J81K 1E2XA 2FBKA 4O5VA 2X0LA 2HZTA 3P9KA 3F3XA 1EH6A 4PGHA 2IPQX 4M74A 3KEQA 4MEXF 1S6LA 3BJ6A 1HKSA 1AOYA 1LEAA 2E7XA 2L3DA 2OQRA 4QWQA 5FFZA 2CSOA 2VBXA 1UCRA 1IN8A 1FYLA 4LG0A 3I0TA 2EV0A 2XROA 1PP8F 1YS6A 3ZMDA 4FX4A 1IAWA 2A6HF 4M9SA 3QP6A 2V1UA 2HQNA 2DPUA 4MQ9F 4B8XA 5D5UB 1U5TC 3D5LA 3GW2A 3M7GA 3IHUA 4MEYF 4NB5A 4L5JA 2XKPA 3GZ5A 4LK0F 1R23A 2PMHA 1IXSB 3TGNA 3GWZA 1HKTA 2LF8A 3DF8A 5LRRA 3N4MA 1USTA 1B9MA 2VOPA 1USSA 1YW9A 3JSOA 4HQEA 2KIFA 2CQKA 4G8XA 3ERED 2EFQA 2QUFA 4ENKA 1ZHFA 1MKMA 4YFNF 1SFXA 3WTXC 3FXQA 4IRGA 4EQQA 1XGNA 2P7CB 3H3UA 3CUQC 3N97A 4MGRA 2XAQA 4G9YA 3QPTA 4OINF 1CF7A 3T1BA 3HRTA 3GLXA 3ML6A 4A6DA 3DKWA 1BC8C 3ZMUA 4M9XA 5L3DA 1YW8A 2Z3YA 1SD7A 1J7KA 3R0AA 3LAJA 5HDKA 4BYYA 3LWFA 2PJPA 4G7OF 1S7OA 3R4KA 2HYGD 3FMQA 1FYMA 1IRGA 4ZH4F 3VEPA 5BQTA 2CO5A 1ONVA 3RYPA 3TOAA 2HYFA 4ESJA 4RS8A 5DDGA 2Y75A 4WK8F 1L3LA 1V4RA 1H9GA 1R5GA 4UVAA 1XCBA 4I98B 2A5YB 1R1TA 2VC1A 4CGZA 3ISPA 2M45A 1GXPA 4HX4A 1TW2A 2BE5F 2FBIA 5AIQA 1GXQA 2KJCA 1U3EM 4LLLA 3WTSC 2W57A 1KQ0A 4JQFA 4Y15A 3RIRA 4ZYGA 5FD6A 2VT2A 2QVOA 2COMA 1KQ9A 2CWEA 3TDZC 3I53A 3VFZA 1ZH5A 2F5EA 1TNSA 3KE2A 2A07F 1EH8A 5LGTA 3O6BB 4R1HA 4L9VA 1O3QA 5HDGA 2JZYA 2A69F 1W4MA 4KN7X 1QGPA 1TLHB 1P4WA 2Z33A 5IT9K 3GFJA 1R1VA 5HDNA 1MJBA 4M6XA 2XKOA 2AS5F 3BJOA 5ICCA 2VBZA 3KLNA 2PN6A 2STWA 1BC7C 2GAUA 1BI1A 2HWVA 4RGUA 3BROA 2MLGA 4EM1A 1ZG1A 1IN4A 1BIAA 1R58A 3K1PA 1XB4A 4U0VA 2IVMA 1FBQA 2V79A 2E7WA 1LQ1A 3ZMSA 3GYHX 5D8KB 5LEJA 2ZBKA 3CO6C 1XSVA 1W5SA 2FRHA 1BI2A 3FWEA 2XGXA 1ODDA 2VT3A 5F6FA 2VODA 1KYZA 2D45A 4HQMA 1YS7A 3CUQA 1WKMA 2EJRA 4A2UA 5ILUA 3FZVA 1Y0UA 2ACJA 1MZBA 5E1ZB 2RGVA 3E6BA 1FBUA 3F21A 2CYYA 3JTHA 3V8JA 2FMYA 3KEOA 5FLXZ 4ESFA 3F6VA 2E1CA 1OYYA 3HOTA 1V3FA 1DDNA 2WV0A 1FBSA 4I02A 1H0MA 3DEUA 4IHSA 4LGWA 3U2RA 2A6EF 2MA3A 4KA4A 3B02A 1RUOA 4M9ZA 2J5PA 2EB7A 1XD7A 4EJVA 3C18A 3REOA 4BXUA 2FU4A 3E6CC 1HSTA 5J8CA 2J5OA 2DLLA 4HF2A 5CVRA 4F7ZA 4P9FA 1HBXG 2EA2A 3F72A 4OU0A 1D5VA 1FLIA 3V4GA 4RB2C 2BEOA 2HTSA 2GIVA 3KP7A 1W5TA 1F9NA 3C3WA 3WGHA 5ICEA 3HUGA 5D8LB 3BY6A 2BV6A 2EFOA 4L9NA 4EV0A 3J81Z 3I71A 2IA2A 5H20A 4KFCA 3T8TA 4CO8A 4O3MA 4M73A 2OZ6A 2MH2A 5TRDA 1FC3A 4EJWA 1ZGAA 3MQ0A 1XSDA 5ED4A 3ECOA 4N9HA 5LEKA 2DPDA 1T2KA 1MDMA 5D4RA 3DV8A 3QRFF 3V7SA 1XGSA 1G3YA 3ZN0A 1BI0A 3HTUA 2HKXA 3IKVA 2G9WA 4IRIA 3WE3A 5ERIA 1K6OA 1K7AA 2GA2A 3QAHA 1XDUA 3CO7C 3KETA 1W7PA 4A0ZA 4O6JA 3KCCA 2AXLA 4UVCA 2P7VB 2ZJ2A 1IXRC 5DV5A 1K79A 5H6RA 3FM3A 2W85A 3KLOA 4FHTA 3GO5A 5DUKA 2YU3A 4GYIA 2LSOA 4EM2A 4G7ZF 3GX4X 1TQMA 1T6SA 4WXDA 3EETA 1O57A 4XLNF 1A04A 2FNAA 5TJJA 2TDXA 2G7UA 4ZYHA 2L01A 1DUXC 3C1DA 2Q2EA 4CZZA 2LF7A 3RKYA 4G7HF 3VOEA 4A6EA 5L3CA 2M8EA 4E70A 5D5VB 1UHMA 4N9IA 3EQLF 2JRTA 2XUBA 1OR7A 2K4BA 2P4WA 3JW4A 3GF2A 1IF1A 1MDMB 4G6DA 2LKPA 3E5UA 2DU9A 2NYXA 4KMFA 2D2WA 2V1XA 3C7JA 5DCFA 4HAMA 1U78A 3P9CA 1U6GA 2P6TA 2C6YA 4QLCU 1W7PB 2VONA 4BHPA 4EGYA 2IRFG 4WX9A 3B73A 4L18B 2D1HA 3HHHA 4AIKA 4D0PA 5LHGA 3FHZA 3QPHA 1NHAA 1U2WA 4HF1A 2ZKZA 2H09A 1MD0A 5F64A 1IUYA 4YIIA 4RB1A 1YTYA 2JSCA 2CG4A 4HA8A 2Q8KA 3PQJA 3P9IA 4YFXF 2EFPA 2DBBA 3R61A 1O3SA 1J9IA 5DYMA 2RQPA 2ZO4A 2IP2A 2MH9A 2XIGA 2DFIA 3MEXA 5IT9Z 2VE8A 4TV7A 1BIBA 2FQ3A 1D3YA 2O0YA 1CGPA 5CYVA 4M72A 2YPRA 1TQPA 1KA8A 5FO5A 1UFMA 2Q0OA 1LVAA 4PZJA 4HF0A 4HDVA 3V7CA 4HDUA 1QNTA 4HX8A 2K4JA 1P4AA 1O3RA 4HW0A 4UUVA 4Q48A 3BDDA 2MC3A 3KP2A 3TQNA 4HYEA 1UHWA 4KICA 2YR2A 4N0BA 3HSFA 3SZPA 5ILSA 1RIOH 4S05A 2DI3A 2GQQA 1BBYA 4XBFA 5D5WB 3WGGA 3EUHA 2ZMEA 2YX7A 2IA0A 1P6RA 4U88A 4I0AA 2PI0A 3T0YA 1HSJA 2K02A 3F22A 4LG0B 1WI9A 2WWYA 2DW4A 1RI7A 3FX3A 5E1WA 3WTVC 2O8XA 5LHIA 1S8NA 3I5UA 2M30A 2YX4A 1KU7A 2DQRA 3J7AO 1OYIA 4RGSA 4IPAA 4CYDA 5E17F 3E3VA 5CVUA 1HW5A 3E5QA 4A0XA 1J59A 2D1VA 3U9GA 4HLXA 1VTNC 2DO7A 1HW2A 1XMAA 2G7HA 3M1EA 5LHHA 2UWMA 3IRRA 1KQ8A 1ZG3A 4EVIA 1FNNA 1O3TA 5LGUA 2XAHA 4HZFA 4L0YB 2OU2A 1F1ZA 2XVCA 3SXYA 2W25A 4Z2YA 4NHJA 1SMYF 2PG4A 3S2WA 3KZZA 2FSWA 4WWCA 5F1RA 3M8EA 1L0OC 1SFUA 2UXNA 2H27A 4JBAA 4WXCA 3K0LA 1CF7B 3WTZA 3D0SA 3MZHA 2R7DA 4RAZA 4EGZA 5ICGA 1I1GA 2Y0MA 4EJUA 1U5TA 1YYVA 4UV9A 4L0ZB 1DPUA 2LDUA 4Q5SF 2PMUA 1R5HA 2W84A 2BYVE 4FX0A 2FNPA 2OAZA 2M87A 2L4MA 1ON2A 1TTYA 1TW3A 3KZYA 2ISZA 1FSHA 2STTA 2OA4A 2RVCA 2IJLA 2HQRA 3LA7A 3ZN1A 3HIFA 3DPLC 2GXBA 1P4XA 1FT9A 1QPMA 2VC0A 2HS5A 1ZN2A 2H94A 3EYIA 4MTEA 2A61A 5ICFA 4R79A 3IWFA 3CTAA 3J80K 3GFMA 2UXXA 1B59A 5JHUA 4I2OA 3U1DA 1KYWA 2LNBA 1I5ZA 2JT1A 2B0LA 3LA3A 5E8GA 2P6SA 2RKHA 4L9JA 4EM0B 2QBYA 4OIPF 1IRFA 4I01A 2XV4S 2F5DA 2EV5A 1U5TB 2RV8A 2P5KA 4U7BA 4IJAA 3L7WA 3V8LA 5JR3A 4XRFA 3T8RA 1BM9A 4U7DA 3GFLA 1Q1HA 1X3UA 2HFHA 3F8FA 3EYYA 1SFEA 3W6KB 5H6QA 3SFZA 4UV8A 5L3GA 3PFIA 2EWNA 3WTYC 3NQOA 2M5WA 3O2PE 4LFUA 1AWCA 3ABUA 5DCMA 2H6CA 3GZ6A 3RPUA 4KNYA 2DK8A 3L09A 2WC2A 1J0RA 3GFIA 1JHHA 3CUQB 3FMSA 2ELHA 4P5OA 4S04A 4UXNA 3G3ZA 5K5QA 2WTEA 4WXHA 4OIRF 4LMYA 2MBFA 3K1NA 4KYWA 1Z91A 2VBWA 1OKRA 3TOBA 1HW1A 1W7PD 1DPRA 3I64A 3RDIA 3LFKA 2JTVA 2L02A 5CVIA 1G3SA 2YSRA 4WCGA 4RGXA 2QBYB 5DD8A 3BZ6A 3Q9VA 2XAJA 3ZMZA 6PAXA 3HRUA 3NEUA 5AIPA 2V6CA 4YG2F 1ZARA 2KIMA 3CJNA 1FOKA 4OMZA 2PBIA 2HR3A 4U0YA 2K27A 2KRFA 4KUMA 2CW0F 3L00A 2QYOA 3GVAA 1BN5A 1TNTA 2Z5UA 4L9TA 4OIOF 5FB2A 1SD5A 3SQNA 5EEHA 4ZZLA 2Z99A 4RB3C 1ULYA 3OV8A 3JTGA 4M6YA 4IF4A 3EDPA 4YIFA 4BAYA 4FT8A 4KN4X 1Z9CA 4KT5C 4EJTA 1LDJA 5DCMB 3ABTA 2Y48A 4KIBA 3IKTA 5FD5A 2XRNA 5D6EA 5FGMA 2EA4A 2ESHA 4IHTA 3MWMA 3TO7A 5J8FA 3BOQA 3IL2A 4P9UA 3FXRA 5JFRA 4OMYA 3R6SA 3KP6A 2DK5A 3L2CA 2FF4A 2FXAA 2PFBA 1FYKA 2HOEA 5L3EA 2R3SA 3RKXA 1J2XA 3G73A 4IRHA 3IWZA 4HOBA 4GO1A 3I4PA 1S29A 1S3JA 1T0FA 4MTDA 4A5MA 2O3FA 1LNWA 3MZYA 3E5XA 2CGPA 1MGTA 4UVBA 2F5CA 1LDKB 1R22A 5D6FA 4IXAA 3LAPA 2FE3A 4ESBA 3M9AA 4AIJA 4G6QA 1REPC 3K1MA 4AIHA 1U8RA 2HKOA 2ADUA 3FM5A 4JK1X 1SAXA 1O7FA 1ZREA 4HBLA 3I58A 1OYWA 4UHTA 1KU3A 1ZG5A 1J5YA 4B09A 2FA5A 3ECHA 3M8FA 1IN5A 2PLYA 5D4SA 4XSXF 3WE2A 1G4DA 4ETSA 2DQLA 2KJBA 1FX7A 2DAOA 4L5IA 1ZGJA 1MJAA 3I59A 4CHUA 4BQAA 4EMSA 1EV7A 5K5OA 1YIOA 2MLKA 2KKOA 1G3TA 3V7RA 2FMLA 1G3WA 4LB5A 3AAFA 4GGGA 3ZP5A 1RUNA 1YO5C 5JI6A 1T98A 3JAMK 3TO9A 3CLOA 3BPVA 4I09A 4Y17A 2XAFA 1I6XA 3Q9SA 3F8MA 3TKYA 3DXJF 2QLZA 1TQIA 3WG9A 4CXFA 3BWGA 1XGOA 5KK1A 3RPQA 1EH7A 3RKWA 3FXUA 5J6XA 4Q4ZF 3F23A 2ESNA 1ZLKA 1QZZA 2Z9OA 1FP2A 2MD5A 4KDPA 1JHFA 2UZKA 1FPQA 3ZMVA 1I27A 4ENMA 2QENA 3ELKA 3HTSB 1I1SA 1BOAA 2FBHA 1UB9A 1IN6A 1HXDA 3T5XA 1IXCA 3H92A 2HTJA 4OIQF
chains in the Genus database with same CATH superfamily
5IT3A 3ULQB 1IDZA 1SD6A 4HV6A 5L3FA 3WTUC 3J80Z 3QU3A 1HDDC 4XLCA 3VPRA 3FF5A 5DEQA 4AD9A 2QEXI 4A3LJ 3DQVC 3PNVA 1MNDA 1FWZA 3DU5A 4QSHA 4AWXB 2NVTJ 1STZA 3PJRA 4ASNA 4RB0A 2E1NA 2JPCA 2UUZA 5J1RA 1Z1DA 1OCZH 4ZDLA 1ZTRA 1YFHA 1D8KA 3I59B 2K3PA 4BY1J 2W24A 3H5RA 4U0WA 5ILVA 1DU0A 4HEA2 2QZ8A 4Q47A 3K69A 2P8TA 1N77A 2QQ9A 2HVRA 2QF7A 4Y4RA 4A0YA 4IVNA 1QBJA 4ZJZA 5HS7A 2GWRA 3K2ZA 2PJRB 2V9KA 1UG2A 3F0CA 2ZFWA 3L9FA 4V2GA 3W6JB 2QSGX 3AG2H 1PUEE 2E2HJ 5HS8A 3Q5FA 1O7LA 1OCRH 2RC4A 4I76A 2O03A 2LH9A 3BG7A 4MQVA 4P96A 4ZYDA 2HXOA 3CF2A 1P2FA 3K4JA 3H35A 3P7NA 1R1UA 4BJ5C 5HLIA 1JGGA 2DXIA 1Z6RA 3I9V2 4B43A 1R7JA 2GOMA 3IRQA 3TBIA 2HPIA 4XQFA 1R00A 1RR8C 4LLNA 2R5YB 4LD5A 1H9TA 3F8CA 2ECBA 2QQAA 3DPTA 2RN7A 3JRBA 4AYBA 5GAHJ 2GZWA 4LIUA 3MFKA 5HNFA 1SMTA 2OJED 3SDGA 3S15J 4GYGA 5E79C 2HOAA 2K7LA 5L3BA 2XASA 4DZPA 4CDGA 1QVTA 1HKQA 4DQ2A 2XF6A 1R71A 1P92A 3KYLA 3AL0B 1S7AA 3KEYA 4ZDOA 3SZTA 2GA1A 1IG7A 3FXJA 2K85A 3BT9A 4II3A 1SD4A 1XSXA 1JI8A 3O3KA 3VODA 3OOPA 4HV5A 4R8HA 1ZQ3P 1ZLJA 4BHCA 2QQ8A 4NC8A 3HYIA 4BNCA 1N75A 4GFBA 3HSEA 1JXSA 2PEXA 1Y39A 5AONA 3Q0VA 1LDDA 1DP7P 3TO6A 2IS6A 4FCYA 2ZMEB 2R7SA 3FXMA 3RI4A 3HOSA 2RNJA 3WTWC 3KFWX 1B9NA 2ZXHA 3I54A 2NNYA 2FX0A 3VSLA 1Y8RB 4H0EA 3PL8A 4OOIA 1LUJB 3ONQA 1K78A 3CUOA 4NNJA 2F5FA 2VE9A 5FFXA 1YITI 3JRIA 2N8GA 2EV6A 2VQLA 2DODA 4Y7NJ 4MHGA 1F5TA 4GXOA 4M3FA 4KIGA 1TL8A 3H3ZA 1X3WB 1Z05A 4BHBA 2WA0A 1W0UA 1JKRC 5EDNA 2VL8A 1E17A 4BE0A 3DFGA 1JTXA 1ON1A 3AG4H 4LB6B 2BXYA 4ZZDA 2H6BA 3O8GA 2MYSA 4C3JJ 3D5SC 3MAJA 2ZCWA 1WSUA 1I50J 5JVTA 1BOBA 1J75A 2X4HA 1MMAA 2W7NA 3A03A 1Z7UA 1KU2A 2R7FA 1JUMA 2JPBA 4A3KJ 3TDUC 2OZUA 2AQFA 3OYJA 2EZKA 3WGIA 5CQGA 5K7HA 5LRSA 3QPLA 1FSEA 4NQWA 1O4XA 3HPHA 2I8DA 4CICA 4XMYA 1Z6TA 2K40A 2VLAA 3HSRA 2UV1A 1OCPA 4Y33A 4DIQA 1NK2P 3S32A 3WU1B 2P5LC 3HHGA 2QWWA 5E1XA 3OSFA 3OR1C 5E20A 3OYNA 5HVQC 1W36D 2VUMJ 1MMSA 4ZYEA 2IA1A 1CQTA 5KVRA 4EJOA 5LBQA 2KIUA 4BS9A 5K5RA 4ENJA 2O61A 1Y8QB 1G6NA 2RDPA 3RTRA 4EATA 2X6WA 1FOXA 4GCVA 1FMWA 2XF5A 1IN7A 3WTTC 4PDKA 4OAYA 4BQOA 2OD5A 1R6RA 3NRVA 3A01A 5EG0A 4AIDA 1I3QJ 4Z6YA 5BS6A 3UKGA 5HS9A 1XGMA 2R7TA 4PCQA 4XL9A 2IGOA 2TCTA 1FY7A 1JUSA 1QO0D 4Y13A 1PDNC 1ERDA 3FK6A 2DFEA 2BW3A 3G4SI 3WU0A 4KISA 1VQ9I 1X58A 2NXNB 4XKBA 4Y52J 1PVEA 3HKZA 1ETKA 2JN6A 2ISYA 5FKOA 1TWCJ 1YJWI 5IYDJ 1ZRCA 1VQ7I 5FLVA 3KPHA 2WAQA 2DA3A 4B44A 1D0YA 1MJ9A 1D1BA 4DNCA 2JVHA 1HC8A 3ZQHA 3CDHA 3SHFA 2QCOA 2BZTA 2ETHA 3EUKL 1XCVA 3RPUD 4LJZF 1WGXA 2HDWA 1BJAA 1OMIA 3HB9A 5FRMA 2MW8A 1K78B 3K2AA 4ITVA 1T8IA 1X3ZB 5HLTA 1T38A 2CV2A 4UNOA 3QP5A 3E6MA 4BH9A 1K61A 3R0JA 4CA0A 5DM6F 1H8AC 2F48A 1YE9A 1UMQA 3BPXA 2L9NA 3LSTA 3VYUB 3COAC 2HOSA 1IW7F 4DYQA 4LLGF 3BTJA 2R5ZB 3BZKA 3KP5A 1YJ9I 2OQGA 2VN2A 1YG2A 2FOKA 4A5NA 2ZXJA 3F8NA 4HX7A 1NG7A 3ABLH 4BJ6C 3I56I 2EK5A 1XDSA 4FASD 2DJIA 2XHKA 3K9TA 4YFKF 4AC0A 1WRJA 4HLYA 1D1CA 2O6GE 2DA1A 2XGEA 2DMTA 2DT5A 4M71A 5GADJ 2HGCA 1A5JA 5LLQA 5FJ8J 4NQWB 2OBPA 1F4KA 2ZNYA 2IT0A 3HOUJ 5EGOA 2WB1N 5BPDA 2DT6A 1GVJA 1QQIA 4NBQA 4KIFA 2EFWA 1ETXA 1HDPA 1JGSA 3R60A 5BOXA 3BP8A 1QPIA 1IZ1A 2CUZA 2WADA 3GEZA 3F8BA 1UAAA 4DJAA 2X9DA 1E3HA 1QZYA 5DUIA 1ZAOA 3OYEA 3CCMI 4PGGA 2L7KA 2M1BA 3CDIA 3GUDA 2GXGA 5HOOA 5A2QZ 3HC7A 1YW7A 1GHCA 1OFCX 1LEBA 3ZQ7A 2FEZA 2ZNZA 3A01B 3QU6A 5JVGF 5EG0B 1C0WA 2X48A 4KJZA 2QKLB 1DQUA 5LGNA 5HLGA 1X1DA 2NNNA 3HRSA 4F52A 3M4OJ 3JR9A 2VBYA 1SFOJ 3CF5F 1X4PA 2CU7A 4L5EA 2VXZA 4MNUA 3LOCA 2VOOA 5HLHA 2HDCA 4LK1F 2BXZA 3OMYA 3ERMA 1PUFA 3DP7A 3RYRA 5B5EC 2BGCA 2NAZA 1YIJI 1YLFA 3LA2A 2L9SA 4WF2A 2XPVA 3PNYA 1MBGA 4ZTFA 3E6DA 2DTRA 2KRHA 1YI2I 2P5VA 5E18F 3DTKA 3WG7H 1WQ2A 2IXSA 2A3SA 4I0BA 4ON0A 4G94A 1TWAJ 2PX9A 2XDVA 4I7HA 1B4AA 5EF6A 4AVPA 5M3MJ 1JE8A 1ZYRF 3GTGJ 3HOZJ 3FXOA 2K86A 5GP9A 3SYTA 4K2EA 1HQCA 1XMKA 3KP3A 5CLSA 5LD2C 3QOEA 3S16J 1R5ID 3LSKA 4BKXA 1FOWA 3GXOA 3RJPA 2PQ8A 3JAMZ 5M5XJ 3JSPA 5CJ9A 3LFUA 3WODF 3ZMTA 3JREA 1WHUA 5CVVA 3LQRA 5EEGA 2KPMA 2O8KA 5K1YA 5D5XB 1OPCA 4RGRA 1LB2A 2IGMA 4A3GJ 3IC7A 1PP7U 2HVQA 2V9PA 2NS0A 2LOOA 2BBYA 1FZPB 3LQQA 5FLXK 2A68F 1J09A 2EFNA 5GAEJ 3PQKA 5CQEA 3CCVI 1YQAA 3ROUA 2DJNA 3E97A 3CMYA 1BI3A 1QHGA 4XLPF 2FUG2 5BPIA 2CH0A 1ZRFA 4XN3A 2CV0A 3KP4A 1X1BA 2OPTA 3JRFA 1JTYA 2NRAC 3BG6A 2IW5A 4V2FA 3QOPA 2HZDA 5IYBJ 1ORKA 2E36A 5CVJA 4XLAA 4UY8I 3A0HC 1R36A 3ZPLA 1T95A 1YRNB 3D1NI 3F6OA 5DD4A 3K10A 1TBXA 3JRHA 1KGSA 2OCEA 3MKWB 1B1BA 1P7IA 1FP1D 1PJRA 2L4AA 1RNLA 1RZ4A 3RZOJ 2L54A 2Y9ZA 3MCZA 3A0BC 1T39A 2F2EA 1BR2A 3HRMA 1D8JA 1VQOI 2VQHA 3V8KA 2ZSHB 1IRXA 1I39A 3BJAA 2JA6J 3DBRB 4QTRA 2KFDA 2JA5J 3ZQQA 4RAYA 2CFXA 4ENNA 2V7FA 2XF7A 3H9GA 1JKPC 1Q1VA 3GLLA 4KMUX 1Z3YA 1B6AA 2XAGA 2COBA 1WWXA 5E8IA 1KU9A 3L2QA 1RPWA 4P55A 5BMZA 1ETOA 1XN7A 5EYRA 3OS1A 2V9VA 3K4LA 4A12A 1NTCA 4XSZF 2DMPA 2HEOA 4IX7A 4RAFA 1LJ9A 4XLFA 3FMRA 1ZRDA 3I3LA 5A2QK 2DA2A 4RLQA 2F6CA 3CMMA 2QM3A 2NVUB 1GDTA 3VB2A 5LFAA 2OTLI 1Z3XA 2V1DA 4CCJA 1TWHJ 2QQBA 2WAFA 2EZHA 3BCBA 1R49A 3J81K 2EIKH 2HQAA 1E2XA 2FBKA 5KHDA 3ASNH 4O5VA 2X0LA 5M5YJ 2HZTA 2QSFX 2GLOA 3P9KA 3F3XA 1EH6A 2EINH 2JUCA 4PGHA 5J1YA 4XKCA 2IPQX 1ETYA 3V42A 4M74A 1DGRM 3KEQA 2E1MB 3CMAI 4MEXF 3QWLA 2JQ7A 1S6LA 3BJ6A 1HKSA 1AOYA 1RR7A 1LEAA 1MNEA 3FXKA 2E7XA 2L3DA 2OQRA 4QWQA 1FTTA 3ZR8X 5FFZA 2CSOA 2VBXA 1UCRA 1APLC 1IN8A 4X6AJ 3S8PA 2IAIA 3UNGC 1FYLA 3C2BA 3ABKH 2HI3A 4LG0A 3I0TA 2EV0A 1HF0A 1VQ5I 4NC7A 2XROA 3DLLF 4XKWA 5IP7J 2HNHA 2Q1ZB 1PP8F 1YS6A 3ZMDA 4FX4A 3PM1A 1Y6IA 1IAWA 2A6HF 4AM3A 2LK2A 4M9SA 3QP6A 3CDLA 2JSPA 2V1UA 3PO3J 2HQNA 2DPUA 2E35A 4MQ9F 5DM7F 3IP4B 4B8XA 5D5UB 1U5TC 3D5LA 3GW2A 1MBKA 3M7GA 2M4KA 4C9YA 3IHUA 4FTHA 2B63J 3FDYA 4IOCF 4IQJA 4MEYF 4NB5A 4L5JA 2XKPA 3GZ5A 4LK0F 5B3SH 3CESA 2XGCA 2CW7A 2JK3A 3H0DA 1R23A 2PMHA 1SFKA 1IXSB 2XPWA 3TGNA 3GWZA 1EJ9A 1HKTA 1E0EA 2LF8A 2XB0X 3DF8A 5LRRA 2KLOA 1GLNA 1JJ8C 3N4MA 4BU2A 1MBEA 1USTA 4W97A 3NWSA 1B9MA 2VOPA 1USSA 2LBFA 4A69C 1YW9A 3JSOA 4HQEA 2KIFA 2M9HA 1T08B 4D9JA 2CQKA 2OTJI 3S2DJ 4G8XA 4JX4A 4PJNA 2EFQA 3ERED 2QUFA 3JRCA 2OC6A 4YRVA 1ETVA 4ENKA 1ZHFA 1MKMA 3CC4I 2IS4A 5F0FA 4BBRJ 4YFNF 1SFXA 2ZC2A 2R4GA 2LR8A 1U8BA 3LSGA 3WTXC 4DYCA 1YHQI 3FXQA 1SVMA 4IRGA 4EQQA 3OIPA 1XGNA 2XC7A 2P7CB 3H3UA 3LSIA 5KCMA 3CUQC 3N97A 3ZQCA 4MGRA 2XAQA 2KZVA 2Z16A 3TP3A 5DTDA 2DMNA 4G9YA 3QPTA 4OINF 1CF7A 1ZELA 4IEJA 1AA7A 3HRTA 2JWTA 3GLXA 3T1BA 3VYSB 2NS8A 3ML6A 1IRZA 2L7MP 4A6DA 3H1CA 3DKWA 1OISA 3B6CA 3ZMUA 1BC8C 4XKVA 4M9XA 5L3DA 3G1LA 1YW8A 3CCRI 2VJJA 2Z3YA 1SD7A 1J7KA 3R0AA 5EJCA 3LAJA 5HDKA 4BYYA 3LWFA 2PJPA 4IO9F 1M1EB 3JRAA 4MLOA 4G7OF 1S7OA 3R4KA 4AUXA 4HNUA 2HYGD 2KDOA 2E71A 3FMQA 1FYMA 1IRGA 1TZLA 4UUSB 4ZH4F 4HRIA 3KYDB 2JMWA 4N4NB 3VEPA 1JT0A 5BQTA 2CO5A 2QKMB 3OYGA 2H1KA 1ONVA 3RYPA 1AU7A 4GDFA 3TOAA 1R4NB 4XOTA 2DDBA 2HYFA 2NOGA 4ESJA 3OY9A 5FKMA 4FE7A 4RS8A 2YS9A 5DDGA 2Y75A 4WK8F 4UB8C 1VFCA 1V4RA 1L3LA 1H9GA 1IV8A 1R5GA 3G1MA 4UVAA 1NH3A 1XCBA 4I98B 2A5YB 5J4VA 1R1TA 2VC1A 4B3AA 1UG0A 4QIWN 4CGZA 2BHYA 1R4MB 3ISPA 2M45A 1GXPA 4HX4A 1TW2A 3SDBA 3OYAA 2KZGA 1BL0A 2BE5F 2FBIA 2KMUA 2NS7A 5AIQA 1Z67A 5F04A 2Y9YA 1GXQA 3ZXSA 2KJCA 1U3EM 1S7EA 4LLLA 3CQZJ 3WTSC 2ME0A 2W57A 1B72A 1KQ0A 4JQFA 4Y15A 3RIRA 4ZYGA 5FD6A 2VT2A 2JUGA 2EPFA 2QVOA 2COMA 3PFYA 1KQ9A 2CWEA 3TDZC 4IHYA 2XB5A 2Y0SN 3I53A 3VFZA 1POGA 1ZH5A 2F5EA 1TNSA 2E19A 1VI0A 4FE4A 3U21A 4BEHA 3ZQIA 3W2AA 3KE2A 2M7BA 2A07F 1EH8A 1WVRA 2M34A 5C4XJ 3VDXA 5LGTA 3O6BB 4MIMA 4R1HA 3D5RC 2ECCA 4L9VA 1YOVB 1O3QA 5HDGA 2JZYA 4G12A 4D7NA 5GPCA 2A69F 1W4MA 1MW7A 1QGPA 3NWTA 4KN7X 1TLHB 1P4WA 3IAS2 4LG3A 2Z33A 3GFJA 1H89C 5IT9K 2W48A 1R1VA 1Z0XA 2HU9A 1FTZA 1K83J 3FBIB 5HDNA 5CKTA 3CP2A 1MJBA 3K4KA 2AHQA 2XKOA 4M6XA 2AS5F 3BJOA 2CV1A 5JLWA 1B8IA 1LFBA 5E3LA 3DLAA 1T56A 4F55A 5ICCA 1RESA 2VBZA 3KLNA 4HNTA 2EH3A 2PN6A 2STWA 2VIXA 1BC7C 2GAUA 1BI1A 2EILH 2HWVA 4RGUA 3BROA 2MLGA 3JRGA 3HGYA 3Q0WA 4EM1A 2VQGA 4ZTJA 3OYHA 1ZG1A 2LC2A 1IN4A 1BIAA 2F4OB 1D0ZA 3BR1A 1U9OA 3BCAA 2WY8Q 2KIQA 1W1WE 2ZB9A 4BQNA 1R58A 3K1PA 1X2MA 1XB4A 4U0VA 2B7EA 2IVMA 1FBQA 2WAEA 3AKZA 2VJ5A 2R7VA 2V79A 3BR0A 1QZEA 2E7WA 1LQ1A 3ZMSA 5C44J 3GYHX 5D8KB 5LEJA 2ZBKA 1YX3A 3CO6C 4IHXA 1XSVA 3OWTA 1W5SA 4RA2A 2FRHA 1BI2A 3CCQI 2VPRA 3RQ4A 3FWEA 2K5CA 3PNTA 5JHFA 2XGXA 1VQPI 1ODDA 4ZYAA 2VPLA 2VT3A 5F6FA 3EPZA 3MMYB 2VODA 1V55H 1KYZA 2O7OA 4BE2A 2D45A 4HQMA 1EKEA 1YS7A 3CUQA 4XLHA 3PSFA 1WKMA 3FKIJ 2H1LA 3S93A 3OYDA 3JRDA 2EJRA 2DFHA 4KITB 4GRIA 4A2UA 5ILUA 3J7ZI 4A3EJ 3CCLI 3FZVA 1Y0UA 2ACJA 1MZBA 3K4BA 2EIMH 4CH7A 3I4MJ 5E1ZB 5FLMJ 2RGVA 3E6BA 5IP6A 3ESWB 3W2WA 3K70D 1FBUA 4BEHB 2GM4A 3F21A 2CYYA 2BY0A 3JTHA 3V8JA 2FMYA 4JX6A 3BZCA 2ICWG 3BQZA 2IEKA 2L7FP 3IAM2 3KEOA 4XIDA 3LSHA 5FLXZ 4ESFA 2B9SA 1Z21A 3F6VA 3BQYA 4MFEA 1U0JA 2W4SA 3VYRB 2E1CA 1OYYA 3HOTA 1V3FA 2CQNA 3HZJA 3TW7A 4XM3A 1DDNA 2LD5A 2OV7A 2WV0A 1FBSA 1WH7A 3HM5A 1GV2A 3RCOA 1B8IB 4BBSJ 2R7UA 1A6IA 1D0XA 1NG6A 4I02A 2KDZA 1H0MA 3GTQJ 3DEUA 4RLFA 4IHSA 2E34A 4LGWA 3U2RA 1A31A 2A6EF 2LFBA 5KAFC 1VQNI 3G2BA 3A02A 1OR7C 2MA3A 4KA4A 2XSDC 3B02A 3RSNA 1RUOA 5E3MA 4M9ZA 2J5PA 2EB7A 1XD7A 3BG9A 4EJVA 2DA4A 2PMZN 4ANJA 3C18A 2BHZA 2FD5A 3REOA 4BXUA 2FU4A 3E6CC 1HSTA 4IL6C 4BXFA 5J8CA 2J5OA 2DLLA 5J3LA 1JJ6C 5CVRA 4HF2A 2M8GX 3OS2A 1FMVA 4U87A 2FJ1A 4F7ZA 4P9FA 1HBXG 5H2FC 2EA2A 3G71I 3F72A 4OU0A 4D7MA 1D5VA 1WZ2A 1AHDP 1FLIA 3V4GA 4RB2C 3IV5A 4BDZA 5E3NA 2BEOA 2HTSA 2GIVA 3KP7A 1W5TA 2O5RA 3M07A 1F9NA 3EUAA 3C3WA 1JUPA 3L2UA 3WGHA 5ICEA 3HUGA 2VKVA 5D8LB 3BY6A 3BG5A 5FKNA 2EBIA 2BV6A 2EFOA 4L9NA 4EV0A 3J81Z 3I71A 2IA2A 4PJ0C 2EZIA 4PJLA 5H20A 4KFCA 3T8TA 4CO8A 2NOJB 3CMEI 4O3MA 2P81A 4II2A 2BW3B 3OIQA 2JA8J 4MFDA 4M73A 2OZ6A 2MH2A 3VSKA 4C3IJ 3LSJA 1RRJA 3HKZN 2E5ZA 2IGNA 4LOCA 5TRDA 1FC3A 4EJWA 2RNGA 4A3JJ 1ZGAA 1X1CA 3MQ0A 1WH5A 2OCCH 1XSDA 4RM3A 5ED4A 9ANTA 2DOEA 3QYFA 3ECOA 3OYIA 4XNFA 4N9HA 1U9NA 5LEKA 5J4YA 3SJMA 2DPDA 3BC8A 1T2KA 1MDMA 5D4RA 3DV8A 3E7LA 3QRFF 3S1QJ 2VJIA 3V7SA 1LKXA 3HOVJ 1XGSA 4C2TA 3OIOA 1G3YA 2CMPA 3ZN0A 4PJJA 1TT5B 4E7JA 1SAUA 3M3YJ 1BI0A 3HTUA 4RM2A 2HKXA 3IKVA 2VASA 1Y56A 3DKYA 2G9WA 3ZRGA 2R7ZJ 4IRIA 3WE3A 5ERIA 1K6OA 1LE8A 1K7AA 2GA2A 3QAHA 1XDUA 4PUSA 3O8HA 1WJDA 3CO7C 1W0TA 3KETA 3ASOH 3LNQA 4E7ZA 1G59A 1W7PA 5FKKA 4A0ZA 4O6JA 3ZOBA 4MO7A 4RDUA 3KCCA 2AXLA 2ZXIA 4UVCA 1ETQA 2CQXA 2P7VB 2F5VA 2ZJ2A 3K6GA 4C2UA 1IXRC 4H4KC 5DV5A 1K79A 4RBOA 4YELA 3VWBA 2RQQA 3Q0UA 3FM3A 2W85A 3KLOA 5H6RA 4FHTA 3AL0C 2F4MB 3GO5A 5EGOB 1BR1A 5DUKA 2ZJRF 2YU3A 1Z77A 4GYIA 2LSOA 3C2HA 4EM2A 1VQMI 4G7ZF 2IGKA 2X1EA 4BL0B 3GX4X 1TQMA 4M3DA 1T6SA 4WXDA 3EETA 1O57A 3QQAA 4XLNF 4S0HB 2ELJA 3CCYA 4CYCA 1BJZA 2ZXWH 2DOAA 3HUGB 1A04A 2FNAA 1IV6A 5TJJA 4IOAF 2TDXA 1MH3A 1YX5A 2AQEA 2G7UA 3SFIA 4ZYHA 1GUUA 1VF9A 4JX5A 3EUHC 2ZMEC 2L01A 5DS9A 3MKYB 1DUXC 3S3MA 3C1DA 2Q2EA 4CZZA 2LF7A 2W82A 3RKYA 4G7HF 4PSXA 3CC2I 3VOEA 5EEAA 1ZGWA 4A6EA 5L3CA 2JVGA 2MC4A 1PUFB 2M8EA 4M3GA 4HSTA 2VI6A 4AU7A 4E70A 5D5VB 1UHMA 5C3EJ 2AXTC 5JLXA 4N9IA 4NDLA 2DDAA 2E1OA 3EQLF 2JRTA 2XUBA 1OR7A 4PSWA 1DU6A 2K4BA 2P4WA 3JW4A 2XRLA 3GF2A 1IF1A 3BTCA 1MDMB 3J7YJ 4G6DA 1RKWA 2LKPA 3S17J 1GV5A 5IP9J 4XRSG 3L2RA 1BW5A 2F4IA 3E5UA 2DU9A 2CW8A 3DEEA 2NYXA 4KMFA 2AO9A 2D2WA 2V1XA 2MSYA 3C7JA 4XRMA 5DCFA 3BG3A 4HAMA 1U78A 3P9CA 1U6GA 4FISA 2X6XA 5B1AH 2E60A 1KZHA 2DA6A 4C30A 2MABA 2P6TA 2C6YA 4QLCU 1W7PB 2VONA 2DYSH 4BHPA 2HYJA 1MH4A 3PSIA 3ZCOA 4EGYA 2IRFG 4WX9A 3B73A 1VQ8I 4L18B 2X1CA 2D1HA 3HHHA 4AIKA 3RZDJ 4D0PA 5LHGA 1VQ4I 4DZJA 2GXAA 2DT7B 3MZ8A 3FHZA 3QPHA 1N78A 2NVYJ 5F08A 1NHAA 1U2WA 4HF1A 4QPOA 2ZKZA 2H09A 1MD0A 5J40A 5F64A 1IUYA 3PIPF 1VQ6I 4YIIA 2WV1A 1X1PA 4RB1A 2BVMA 2NVXJ 2YUSA 1YTYA 1IJWC 4C2MJ 2JSCA 4CYCB 1X19A 2CG4A 4HA8A 3PQJA 4JP0A 2Q8KA 3PO2J 4BXXJ 3P9IA 4YFXF 2DBBA 2EFPA 3HL2A 2ID6A 2EIJH 3R61A 1O3SA 1J9IA 5DYMA 5F0CA 3FXLA 2RQPA 3OOUA 1XMXA 3UR3C 5F0HA 2ZO4A 5FRNA 4A3CJ 3TEDA 2Q2EB 1K6YA 2IP2A 2CJJA 2MH9A 3B6AA 1TP4A 2XIGA 2DFIA 3CP8A 3MEXA 5IT9Z 2VE8A 4ABZA 3E1SA 5GTIC 4TV7A 3GTPJ 2YU9J 3HGGA 2DA5A 1BIBA 2FQ3A 1D3YA 2O0YA 3H3VK 1CGPA 5CYVA 4M72A 2YPRA 1A36A 1TQPA 1D5YA 4M3EA 1KA8A 3MKLA 3S3NA 1A6QA 5FO5A 3ABMH 2Q0OA 1UFMA 1LVAA 2KISA 2MGQA 2W00A 4Y3OA 3BTLA 1X1AA 4PZJA 4HF0A 4RMNA 4V19K 3FKJA 4CUGA 3LSPA 4HDVA 3H9JA 3V7CA 3FHNA 4HDUA 1QNTA 1ITYA 4HX8A 4LITA 5C4JJ 2K4JA 1P4AA 1O3RA 2K9LA 4XK4A 4HW0A 4UUVA 4Q48A 2Z1DA 3BDDA 2MC3A 4JOMA 1XPXA 4PJMA 4OWRB 3KP2A 3ZGKA 3FBNB 3TQNA 2VXDA 4HYEA 1UHWA 4KICA 4QPQA 3GTKJ 2YR2A 1WI3A 4N0BA 3HSFA 3SZPA 5ILSA 1RIOH 2LG4A 4S05A 3HG9A 1R9TJ 3TP0A 2DI3A 2GQQA 1F43A 1FIPA 1BBYA 4XBFA 5D5WB 1MMGA 4I6ZA 1MNMC 1F36A 3WGGA 2R92J 2WBMA 1Y0NA 3EUHA 2ZMEA 2YX7A 4XORA 2IA0A 1P6RA 4U88A 4I0AA 5CPRB 2PI0A 3H36A 3T0YA 4F93B 3CD6I 2ELKA 2QA4I 1HSJA 3AFHA 2K02A 3F22A 4LG0B 3IH2A 1WI9A 1VQLI 2WWYA 3HOWJ 2DW4A 1V54H 1RI7A 2LP0A 3FX3A 5E1WA 3WTVC 2O8XA 2OUMA 5LHIA 1S8NA 2K3FA 3I5UA 1A35A 2M30A 2YX4A 3K7AJ 1KU7A 3LMMA 3BR6A 2JA2A 2CQ7A 2DQRA 2Y30A 3J7AO 2OF7A 1OYIA 1W36C 4RGSA 4IPAA 1LFPA 2VKDA 4CYDA 5E17F 3SZGA 2RREA 1V5GA 3CLQA 3S1MJ 3CJQB 3E3VA 5CVUA 1HW5A 2JRMA 3E5QA 4A0XA 3U1KA 1J59A 2D1VA 2L0KA 4D5FA 4A3IJ 2P0WA 3U9GA 2A05A 1E3PA 2DMQA 4HLXA 1VTNC 4M6VA 1FOYA 2DO7A 1XS9A 3OYLA 4CCOA 5IY5H 1HW2A 1KONA 3H0GJ 1XMAA 3FK7A 2G7HA 4BGDA 3C2GA 1AKHA 2ZFUA 3IH3A 2L5QA 2LBFB 5FROA 1WJAA 3M1EA 5LHHA 3K70C 2KQRA 2V26A 2UWMA 3IRRA 1P9QC 3LSRA 3CCEI 1KQ8A 1ZG3A 4EVIA 5TGTA 3N05A 1FNNA 4DGWB 3L2VA 2R7WA 1O3TA 3HOXJ 1K4SA 5LGUA 1RC9A 2XAHA 4HZFA 4DOZA 1BR4A 3DKXA 2LY9A 4L0YB 2OU2A 1F1ZA 2XVCA 3SXYA 2W25A 4Z2YA 5J47A 3GZNB 2O9LA 4NHJA 1SMYF 2PG4A 3S2WA 3X2QH 4E7SA 3KZZA 2FSWA 4WWCA 5F1RA 3M8EA 1MIJA 1P7JA 2MG4A 1X2NA 4PK4A 4B3XA 4IHVA 1L0OC 5TISC 4BY7J 1SFUA 1VNDA 2LMDA 4W1UA 2UXNA 2H27A 2R7XA 3FIWA 4JBAA 4WXCA 3K0LA 1ACIA 3K4CA 1CF7B 4YEJA 5K7FA 4XN0A 4N4OB 3WTZA 3D0SA 3MZHA 1GVDA 2R7DA 4RAZA 4EGZA 5ICGA 1I1GA 2Y0MA 2XGDA 1UZCA 4A3BJ 1WJ5A 2QSHX 1HCRA 4EJUA 1U5TA 1YYVA 5M5WJ 1LFUP 4J00A 3AG3H 2M4GA 3PUFA 4UV9A 4B1RA 2HVSA 4J01A 3DPUA 2BY1A 4L0ZB 1DPUA 2LDUA 4Q5SF 2PMUA 1RETA 5IOYA 1R5HA 2W84A 2BYVE 3KYCB 4RAGA 1WJEA 4FX0A 4I99C 2FNPA 2LYCA 2OAZA 2EZLA 2XSJC 3S3OA 2V4JC 2M87A 2L4MA 2D5VA 1ON2A 1TTYA 1TW3A 2KHMA 2QGUA 3KZYA 2ISZA 1FSHA 1VZ0A 2Z2SB 2STTA 2M0CA 2R5ZA 2OA4A 2RVCA 2VB6A 2IJLA 2KP6A 2HQRA 2BVLA 3LA7A 1OCTC 2PMZA 1HOMA 3ZN1A 3OYKA 3G6EI 3HIFA 3DPLC 1S5LC 2GXBA 1P4XA 1FT9A 1NK3P 3NARA 4AYBN 1QPMA 2BOLA 2WB1A 2CS3A 2VC0A 3H5AA 2HS5A 4XLEA 1ZN2A 5B66C 1AKHB 2H94A 3EYIA 4MTEA 2A61A 3GTLJ 1IGNA 1I3AA 1WPKA 3ZQFA 2H8WA 5ICFA 1IC8A 2GOXB 3IUOA 4R79A 1B72B 4FQGA 2Y2ZA 3IWFA 3CTAA 3J80K 1EF4A 1V5EA 3GFMA 2UXXA 2HPMA 1B59A 5JHUA 4I2OA 2LY2A 4X1EA 3U1DA 3L1PA 1WCMJ 3MD2A 4IHWA 2E1MC 4FETA 1S9HA 3MKZA 1W5CC 2DTZA 1KYWA 2LNBA 4DBRA 3P5JA 3H5NA 1D1AA 1I5ZA 2JT1A 2DCEA 1FJLA 4IKFA 3GMEA 4BACA 2X6YA 2B0LA 1I6HJ 3LA3A 5E8GA 2P6SA 4BE1A 2RKHA 3OYMA 4X0GA 4L9JA 3OL4A 4CCMA 1G8XA 4EM0B 2QBYA 2MFZA 4OIPF 3H9QA 4PFOA 1EA3A 4A3DJ 3M8JA 3TL4X 1IRFA 3SEQA 2A6TA 2ZSIB 1UJ8A 4I01A 1MMNA 2K9MA 2XV4S 2F5DA 3VYTB 1Y1WJ 3A4CA 4HNVA 1V5FA 2EV5A 1MSEC 1U5TB 2RV8A 2P5KA 4U7BA 4IJAA 3L7WA 3V8LA 5JR3A 4XRFA 1DGWY 3T8RA 2VKHA 5GTHC 3CCSI 3ZQGA 3CCJI 1BM9A 4U7DA 2EQRA 3S1RJ 4PFPA 3GFLA 4IQ4A 1T0FC 3DU6A 1Q1HA 3A1YA 2L7ZA 3I55I 1X3UA 2DA7A 2CUFA 2HFHA 3F8FA 3EYYA 3MVPA 1T33A 1SFEA 3W6KB 5H6QA 1HA8A 2M7AA 2LREA 3SFZA 1MMDA 4D1QA 1FIAA 4UV8A 4YIRX 3E0JB 2VKEA 3BR2A 1BA5A 5L3GA 2L2OA 3PFIA 1PYVA 2EWNA 3WTYC 3NQOA 2M5WA 4IZZA 2LVSA 1MBHA 3O2PE 3QPSA 4DYRA 4LFUA 3HOYJ 3WU2C 2K9SA 3HJEA 5IYCJ 2X1DA 3KZIC 4J19A 1AWCA 3W3CA 2XPUA 2KL4A 3ABUA 3JCUC 5DCMA 2H6CA 5EZHA 3RPUA 3GZ6A 4KNYA 2DK8A 3L09A 4E7KA 5F27A 3OS0A 2WC2A 4DW6A 1J0RA 2G0EA 3GFIA 3OYFA 1JHHA 3CUQB 3FMSA 2ELHA 4P5OA 4S04A 3CJTB 4UXNA 3GCMA 4E7LA 3G3ZA 5K5QA 3W6VA 2WTEA 1MBFA 4WXHA 2DOFA 4OIRF 4LMYA 2MBFA 1ZR4A 1IUFA 2XAUA 3K1NA 1QU3A 1JT6A 1WFXA 4E6KG 1Z91A 2VBWA 5K7ZA 1OKRA 1UHSA 3DBHB 4KYWA 3TOBA 1HW1A 3LSMA 2H8RA 3ZQLA 3MN2A 4OAZA 1WJBA 1W7PD 3KX2A 4CCNA 3K4NA 2X51A 1YRNA 3DBLB 4KT6A 1DPRA 2WAQN 1ETWA 3I64A 3RDIA 3HXLA 3LFKA 3QYBA 1SVOA 2JTVA 2L02A 2GBYA 1E3OC 5CVIA 1QRYA 1G3SA 2YSRA 4WCGA 4RGXA 2QBYB 5DD8A 1OQYA 3BZ6A 3Q9VA 2XAJA 3ZMZA 2HXIA 2E5NA 6PAXA 3HRUA 1WJCA 4CCLA 1G2HA 3NEUA 2LLKA 5AIPA 4G6TB 2V6CA 4YG2F 1ZARA 3J7AY 2KIMA 2E2JJ 1XG1A 1BW6A 2M2EA 3CJNA 3WHBA 1FOKA 2GIZA 4OMZA 3WHCA 2PBIA 1OJLA 2HR3A 4E7IA 1LPQA 4U0YA 2LY1A 2K27A 2KRFA 4KUMA 2CW0F 3L00A 3HBLA 2QYOA 1QVUA 3CZ6A 3GVAA 1X4OA 3GTMJ 1BN5A 4NUBA 5IOZA 4E7HA 5GPAA 1TNTA 2Z5UA 4HPQA 4B48A 4C3HJ 4L9TA 4OIOF 5FB2A 1SD5A 3SQNA 5EEHA 4ZZLA 2KRCA 2Z99A 2V6EA 1DP3A 4A3FJ 2IS2A 4RB3C 1ULYA 3OV8A 3JTGA 4M6YA 1RKTA 4IF4A 2KT0A 2Y31A 3EDPA 1TWFJ 2WY7Q 4A3MJ 4YIFA 4BAYA 3IH4A 4FT8A 1TC3C 4KN4X 1Z9CA 1ZKGA 1ZK8A 1ZR2A 3OYCA 4KT5C 1QA6A 3HDDA 4EJTA 3FISA 1LDJA 5HODA 3CC7I 5DCMB 3ABTA 1TWGJ 3QYEA 2Y48A 3GTJJ 2IBDA 4AVZA 4DBQA 4UUTA 4KIBA 5KAIC 3QODA 4XICA 2DYRH 2W1OA 3IKTA 5FD5A 1XTAA 2XRNA 2MD0A 4HSRA 5D6EA 5FGMA 4CZCA 2RAEA 2EA4A 2LKXA 3PUBA 2ESHA 3S14J 4IHTA 2CQQA 1H88C 3MWMA 4EEFG 4BUPA 1SC7A 3TO7A 5J8FA 3RQIA 3BOQA 1SVLA 3S1NJ 3IL2A 4P9UA 2K9QA 3FXRA 2Y69H 5JFRA 2L9VA 4OMYA 3R6SA 3KP6A 2DK5A 3L2CA 2DN0A 2FF4A 2FXAA 3DTEA 2PFBA 3OYBA 1FYKA 2HOEA 5L3EA 2R3SA 2TRTA 3RKXA 1J2XA 3G73A 4IRHA 2ID3A 3IWZA 4CSWA 2FQ4A 4HOBA 2R0QC 4GO1A 3I4PA 3BTIA 1S29A 4LIVA 1IO2A 3KIOA 1S3JA 1T0FA 4MTDA 3DEWA 2I5UA 4A5MA 2BY3A 2O3FA 1LNWA 5F1JA 3BR5A 3MZYA 3E5XA 2CGPA 3DCFA 1MGTA 4UVBA 5B1BH 1SEUA 2F5CA 4NC6A 1LDKB 2HDDA 1R22A 4XONA 5D6FA 4IXAA 3LAPA 2E2IJ 2FE3A 2R7QA 5IPAA 4ESBA 2X85A 3M9AA 4AIJA 2CFOA 3Q3SA 4XRSA 4G6QA 1REPC 3K1MA 2CUJA 4M3BA 4AIHA 4B47A 2DMUA 1LE8B 4ZDPA 2K9NA 1U8RA 2HKOA 2CRGA 2ADUA 3FM5A 4CCKA 4JK1X 1SAXA 1O7FA 3M1CA 2LRDA 1VQKI 1ZREA 3I4NJ 4HBLA 3I58A 5J1UA 3S2HJ 1OYWA 4UHTA 1KU3A 2I10A 1ZG5A 1J5YA 5E3OA 4B09A 1JKOC 3L2WA 4BJTA 1Y1VJ 2FA5A 3ECHA 3M8FA 1IN5A 2VJ4A 3SEZA 2LTPA 1K4TA 1IDYA 2DFFA 2PLYA 5D4SA 4F92B 4XSXF 3WE2A 4F91B 1LVKA 3K4MA 1XX5A 5KNLA 1G4DA 4UB6C 3DWLE 2R7OA 4ETSA 4BQQA 2DQLA 2KJBA 2ME6A 1FX7A 2DAOA 3BLYA 5M3FJ 4L5IA 1ZGJA 1JKQC 1MJAA 3I59A 2HQ5A 2V1NA 4CHUA 4BQAA 4EMSA 1EV7A 2M3AA 1YJNI 5K5OA 1MBJA 1S72I 1YIOA 2LKSA 2M0MA 1FEXA 2MLKA 2KKOA 1G3TA 2CUEA 3OR2C 3V7RA 2PJRA 2NVQJ 2FMLA 3TW6A 1WJFA 5FKLA 4UUSA 1Z7LA 1G3WA 3CJRB 4A93J 3OSGA 4LB5A 3AAFA 3NAUA 1ENHA 3HPGA 4GGGA 4XR6A 3ZP5A 1RUNA 1YO5C 5JI6A 1T98A 3TO9A 3JAMK 3CLOA 3BPVA 4I09A 3OL3A 4Y17A 3W2VA 2XAFA 1I6XA 3Q9SA 3F8MA 3TKYA 2R5YA 1HLVA 3GTOJ 3F9KA 3DXJF 2QLZA 3LL7A 3CCUI 1TQIA 3GBGA 3WG9A 4ZC3A 4P1WA 1XC5A 5BNGA 2R7RA 1UELB 4HG2A 2VQCA 3G1OA 4CXFA 3BWGA 1XGOA 3DTIA 1N25A 2A5WA 5KK1A 3RPQA 1EH7A 2R93J 4B4CA 3RKWA 3FXUA 5J6XA 4Q4ZF 3F23A 3BR3A 1OCCH 2FOWA 1QHHD 2ESNA 3AG1H 4JYKA 1ZLKA 3A2KA 2JJ7A 2L9RA 1QZZA 1GT0C 2Z9OA 1FP2A 2Y0SA 2MD5A 4KDPA 5GAGJ 3TMOA 1JHFA 2UZKA 5HNHA 2JA7J 1FPQA 2ZJQF 1MSFC 3ZMVA 1I27A 1OCOH 4ENMA 2QENA 3RKQA 4XOPA 3ELKA 3PIOF 3HTSB 2IS1A 4F3QA 1I1SA 2ZJPF 1BOAA 4BDYA 2HOTA 2FBHA 1UB9A 1IN6A 5EZGA 1HXDA 1SANA 4E4HA 3T5XA 1IXCA 3H92A 3HEFA 1OLTA 2HTJA 2BY2A 4D5CA 1TT0A 4OIQF 2X6OA
chains in the Genus database with same CATH topology
5IT3A 3ULQB 1SD6A 4HV6A 5L3FA 3WTUC 3J80Z 3QU3A 3FF5A 5DEQA 4AD9A 3DQVC 1FWZA 4AWXB 1STZA 4ASNA 4RB0A 2E1NA 2JPCA 1Z1DA 1YFHA 1D8KA 3I59B 2W24A 4U0WA 5ILVA 4Q47A 2QZ8A 3K69A 2P8TA 2QQ9A 4A0YA 4IVNA 1QBJA 5HS7A 2GWRA 3K2ZA 2ZFWA 3L9FA 3W6JB 1PUEE 5HS8A 3Q5FA 1O7LA 2RC4A 4MQVA 2O03A 4P96A 4ZYDA 1P2FA 3P7NA 1R1UA 5HLIA 1Z6RA 1R7JA 3IRQA 1R00A 4LLNA 4LD5A 1H9TA 3F8CA 3DPTA 2QQAA 2RN7A 2GZWA 3MFKA 1SMTA 4GYGA 2K7LA 5L3BA 2XASA 4CDGA 1HKQA 4DQ2A 1P92A 1S7AA 3SZTA 2GA1A 1SD4A 1XSXA 3O3KA 3VODA 3OOPA 4HV5A 4R8HA 1ZLJA 4BHCA 3HYIA 4BNCA 3HSEA 1JXSA 2PEXA 5AONA 1LDDA 1DP7P 3TO6A 2ZMEB 3RI4A 3HOSA 2RNJA 3WTWC 3KFWX 1B9NA 3I54A 2NNYA 4H0EA 4OOIA 1K78A 3CUOA 2F5FA 2VE9A 5FFXA 2EV6A 4MHGA 1F5TA 4GXOA 4KIGA 3H3ZA 1Z05A 4BHBA 1E17A 3DFGA 1ON1A 4ZZDA 4LB6B 2H6BA 3MAJA 2ZCWA 1WSUA 5JVTA 1J75A 2X4HA 1Z7UA 1KU2A 2R7FA 2JPBA 3TDUC 2OZUA 3WGIA 5LRSA 1FSEA 4NQWA 4CICA 1Z6TA 3HSRA 3WU1B 2P5LC 3HHGA 2QWWA 5E1XA 5E20A 5HVQC 4ZYEA 2IA1A 5KVRA 4EJOA 5LBQA 2KIUA 5K5RA 4ENJA 2O61A 2RDPA 1G6NA 3RTRA 4GCVA 1IN7A 3WTTC 4PDKA 2OD5A 3NRVA 5BS6A 5HS9A 1XGMA 4PCQA 1FY7A 4Y13A 1QO0D 1PDNC 3WU0A 2ISYA 1ZRCA 1MJ9A 4DNCA 3CDHA 3SHFA 2ETHA 1XCVA 4LJZF 1BJAA 1OMIA 1K78B 4UNOA 1T38A 3QP5A 3E6MA 4BH9A 3R0JA 3BPXA 3LSTA 3COAC 1IW7F 4LLGF 3KP5A 2OQGA 2VN2A 1YG2A 2FOKA 4A5NA 2ZXJA 3F8NA 4HX7A 2EK5A 1XDSA 2XHKA 3K9TA 4YFKF 1WRJA 4HLYA 2O6GE 2DT5A 4M71A 2HGCA 5LLQA 2OBPA 1F4KA 2ZNYA 2IT0A 5BPDA 1GVJA 1QQIA 4KIFA 2EFWA 3R60A 5BOXA 1JGSA 3BP8A 1IZ1A 3GEZA 3F8BA 1QZYA 5DUIA 1ZAOA 4PGGA 2M1BA 3GUDA 2GXGA 5HOOA 5A2QZ 1GHCA 1YW7A 1LEBA 3ZQ7A 2FEZA 2ZNZA 3QU6A 1C0WA 5LGNA 5HLGA 2NNNA 3HRSA 2VBYA 2VXZA 4MNUA 2VOOA 5HLHA 2HDCA 4LK1F 3DP7A 3RYRA 2BGCA 2NAZA 1YLFA 3LA2A 4WF2A 3E6DA 2DTRA 2P5VA 5E18F 1WQ2A 2A3SA 4I0BA 4ON0A 4G94A 4I7HA 1B4AA 4AVPA 1JE8A 1ZYRF 2K86A 4K2EA 1HQCA 1XMKA 3KP3A 5CLSA 3GXOA 3RJPA 2PQ8A 3JAMZ 3JSPA 5CJ9A 3WODF 3ZMTA 5CVVA 3LQRA 5EEGA 5K1YA 5D5XB 1OPCA 4RGRA 1LB2A 3IC7A 1PP7U 2NS0A 2BBYA 1FZPB 3LQQA 5FLXK 2A68F 2EFNA 3PQKA 1YQAA 3ROUA 3E97A 1BI3A 4XLPF 5BPIA 1ZRFA 3KP4A 2NRAC 2IW5A 3QOPA 5CVJA 1R36A 3ZPLA 3F6OA 5DD4A 1TBXA 1KGSA 1B1BA 1FP1D 2L4AA 1RNLA 1RZ4A 2L54A 3MCZA 1T39A 2F2EA 3HRMA 1D8JA 3V8KA 3BJAA 4RAYA 2CFXA 4ENNA 4KMUX 1B6AA 2XAGA 1WWXA 5E8IA 1KU9A 4P55A 5BMZA 1XN7A 2V9VA 4A12A 4XSZF 2HEOA 1LJ9A 3FMRA 1ZRDA 5A2QK 2QM3A 3VB2A 2V1DA 2QQBA 3J81K 1E2XA 2FBKA 4O5VA 2X0LA 2HZTA 3P9KA 3F3XA 1EH6A 4PGHA 2IPQX 4M74A 3KEQA 4MEXF 1S6LA 3BJ6A 1HKSA 1AOYA 1LEAA 2E7XA 2L3DA 2OQRA 4QWQA 5FFZA 2CSOA 2VBXA 1UCRA 1IN8A 1FYLA 4LG0A 3I0TA 2EV0A 2XROA 1PP8F 1YS6A 3ZMDA 4FX4A 1IAWA 2A6HF 4M9SA 3QP6A 2V1UA 2HQNA 2DPUA 4MQ9F 4B8XA 5D5UB 1U5TC 3D5LA 3GW2A 3M7GA 3IHUA 4MEYF 4NB5A 4L5JA 2XKPA 3GZ5A 4LK0F 1R23A 2PMHA 1IXSB 3TGNA 3GWZA 1HKTA 2LF8A 3DF8A 5LRRA 3N4MA 1USTA 1B9MA 2VOPA 1USSA 1YW9A 3JSOA 4HQEA 2KIFA 2CQKA 4G8XA 3ERED 2EFQA 2QUFA 4ENKA 1ZHFA 1MKMA 4YFNF 1SFXA 3WTXC 3FXQA 4IRGA 4EQQA 1XGNA 2P7CB 3H3UA 3CUQC 3N97A 4MGRA 2XAQA 4G9YA 3QPTA 4OINF 1CF7A 3T1BA 3HRTA 3GLXA 3ML6A 4A6DA 3DKWA 1BC8C 3ZMUA 4M9XA 5L3DA 1YW8A 2Z3YA 1SD7A 1J7KA 3R0AA 3LAJA 5HDKA 4BYYA 3LWFA 2PJPA 4G7OF 1S7OA 3R4KA 2HYGD 3FMQA 1FYMA 1IRGA 4ZH4F 3VEPA 5BQTA 2CO5A 1ONVA 3RYPA 3TOAA 2HYFA 4ESJA 4RS8A 5DDGA 2Y75A 4WK8F 1L3LA 1V4RA 1H9GA 1R5GA 4UVAA 1XCBA 4I98B 2A5YB 1R1TA 2VC1A 4CGZA 3ISPA 2M45A 1GXPA 4HX4A 1TW2A 2BE5F 2FBIA 5AIQA 1GXQA 2KJCA 1U3EM 4LLLA 3WTSC 2W57A 1KQ0A 4JQFA 4Y15A 3RIRA 4ZYGA 5FD6A 2VT2A 2QVOA 2COMA 1KQ9A 2CWEA 3TDZC 3I53A 3VFZA 1ZH5A 2F5EA 1TNSA 3KE2A 2A07F 1EH8A 5LGTA 3O6BB 4R1HA 4L9VA 1O3QA 5HDGA 2JZYA 2A69F 1W4MA 4KN7X 1QGPA 1TLHB 1P4WA 2Z33A 5IT9K 3GFJA 1R1VA 5HDNA 1MJBA 4M6XA 2XKOA 2AS5F 3BJOA 5ICCA 2VBZA 3KLNA 2PN6A 2STWA 1BC7C 2GAUA 1BI1A 2HWVA 4RGUA 3BROA 2MLGA 4EM1A 1ZG1A 1IN4A 1BIAA 1R58A 3K1PA 1XB4A 4U0VA 2IVMA 1FBQA 2V79A 2E7WA 1LQ1A 3ZMSA 3GYHX 5D8KB 5LEJA 2ZBKA 3CO6C 1XSVA 1W5SA 2FRHA 1BI2A 3FWEA 2XGXA 1ODDA 2VT3A 5F6FA 2VODA 1KYZA 2D45A 4HQMA 1YS7A 3CUQA 1WKMA 2EJRA 4A2UA 5ILUA 3FZVA 1Y0UA 2ACJA 1MZBA 5E1ZB 2RGVA 3E6BA 1FBUA 3F21A 2CYYA 3JTHA 3V8JA 2FMYA 3KEOA 5FLXZ 4ESFA 3F6VA 2E1CA 1OYYA 3HOTA 1V3FA 1DDNA 2WV0A 1FBSA 4I02A 1H0MA 3DEUA 4IHSA 4LGWA 3U2RA 2A6EF 2MA3A 4KA4A 3B02A 1RUOA 4M9ZA 2J5PA 2EB7A 1XD7A 4EJVA 3C18A 3REOA 4BXUA 2FU4A 3E6CC 1HSTA 5J8CA 2J5OA 2DLLA 4HF2A 5CVRA 4F7ZA 4P9FA 1HBXG 2EA2A 3F72A 4OU0A 1D5VA 1FLIA 3V4GA 4RB2C 2BEOA 2HTSA 2GIVA 3KP7A 1W5TA 1F9NA 3C3WA 3WGHA 5ICEA 3HUGA 5D8LB 3BY6A 2BV6A 2EFOA 4L9NA 4EV0A 3J81Z 3I71A 2IA2A 5H20A 4KFCA 3T8TA 4CO8A 4O3MA 4M73A 2OZ6A 2MH2A 5TRDA 1FC3A 4EJWA 1ZGAA 3MQ0A 1XSDA 5ED4A 3ECOA 4N9HA 5LEKA 2DPDA 1T2KA 1MDMA 5D4RA 3DV8A 3QRFF 3V7SA 1XGSA 1G3YA 3ZN0A 1BI0A 3HTUA 2HKXA 3IKVA 2G9WA 4IRIA 3WE3A 5ERIA 1K6OA 1K7AA 2GA2A 3QAHA 1XDUA 3CO7C 3KETA 1W7PA 4A0ZA 4O6JA 3KCCA 2AXLA 4UVCA 2P7VB 2ZJ2A 1IXRC 5DV5A 1K79A 5H6RA 3FM3A 2W85A 3KLOA 4FHTA 3GO5A 5DUKA 2YU3A 4GYIA 2LSOA 4EM2A 4G7ZF 3GX4X 1TQMA 1T6SA 4WXDA 3EETA 1O57A 4XLNF 1A04A 2FNAA 5TJJA 2TDXA 2G7UA 4ZYHA 2L01A 1DUXC 3C1DA 2Q2EA 4CZZA 2LF7A 3RKYA 4G7HF 3VOEA 4A6EA 5L3CA 2M8EA 4E70A 5D5VB 1UHMA 4N9IA 3EQLF 2JRTA 2XUBA 1OR7A 2K4BA 2P4WA 3JW4A 3GF2A 1IF1A 1MDMB 4G6DA 2LKPA 3E5UA 2DU9A 2NYXA 4KMFA 2D2WA 2V1XA 3C7JA 5DCFA 4HAMA 1U78A 3P9CA 1U6GA 2P6TA 2C6YA 4QLCU 1W7PB 2VONA 4BHPA 4EGYA 2IRFG 4WX9A 3B73A 4L18B 2D1HA 3HHHA 4AIKA 4D0PA 5LHGA 3FHZA 3QPHA 1NHAA 1U2WA 4HF1A 2ZKZA 2H09A 1MD0A 5F64A 1IUYA 4YIIA 4RB1A 1YTYA 2JSCA 2CG4A 4HA8A 2Q8KA 3PQJA 3P9IA 4YFXF 2EFPA 2DBBA 3R61A 1O3SA 1J9IA 5DYMA 2RQPA 2ZO4A 2IP2A 2MH9A 2XIGA 2DFIA 3MEXA 5IT9Z 2VE8A 4TV7A 1BIBA 2FQ3A 1D3YA 2O0YA 1CGPA 5CYVA 4M72A 2YPRA 1TQPA 1KA8A 5FO5A 1UFMA 2Q0OA 1LVAA 4PZJA 4HF0A 4HDVA 3V7CA 4HDUA 1QNTA 4HX8A 2K4JA 1P4AA 1O3RA 4HW0A 4UUVA 4Q48A 3BDDA 2MC3A 3KP2A 3TQNA 4HYEA 1UHWA 4KICA 2YR2A 4N0BA 3HSFA 3SZPA 5ILSA 1RIOH 4S05A 2DI3A 2GQQA 1BBYA 4XBFA 5D5WB 3WGGA 3EUHA 2ZMEA 2YX7A 2IA0A 1P6RA 4U88A 4I0AA 2PI0A 3T0YA 1HSJA 2K02A 3F22A 4LG0B 1WI9A 2WWYA 2DW4A 1RI7A 3FX3A 5E1WA 3WTVC 2O8XA 5LHIA 1S8NA 3I5UA 2M30A 2YX4A 1KU7A 2DQRA 3J7AO 1OYIA 4RGSA 4IPAA 4CYDA 5E17F 3E3VA 5CVUA 1HW5A 3E5QA 4A0XA 1J59A 2D1VA 3U9GA 4HLXA 1VTNC 2DO7A 1HW2A 1XMAA 2G7HA 3M1EA 5LHHA 2UWMA 3IRRA 1KQ8A 1ZG3A 4EVIA 1FNNA 1O3TA 5LGUA 2XAHA 4HZFA 4L0YB 2OU2A 1F1ZA 2XVCA 3SXYA 2W25A 4Z2YA 4NHJA 1SMYF 2PG4A 3S2WA 3KZZA 2FSWA 4WWCA 5F1RA 3M8EA 1L0OC 1SFUA 2UXNA 2H27A 4JBAA 4WXCA 3K0LA 1CF7B 3WTZA 3D0SA 3MZHA 2R7DA 4RAZA 4EGZA 5ICGA 1I1GA 2Y0MA 4EJUA 1U5TA 1YYVA 4UV9A 4L0ZB 1DPUA 2LDUA 4Q5SF 2PMUA 1R5HA 2W84A 2BYVE 4FX0A 2FNPA 2OAZA 2M87A 2L4MA 1ON2A 1TTYA 1TW3A 3KZYA 2ISZA 1FSHA 2STTA 2OA4A 2RVCA 2IJLA 2HQRA 3LA7A 3ZN1A 3HIFA 3DPLC 2GXBA 1P4XA 1FT9A 1QPMA 2VC0A 2HS5A 1ZN2A 2H94A 3EYIA 4MTEA 2A61A 5ICFA 4R79A 3IWFA 3CTAA 3J80K 3GFMA 2UXXA 1B59A 5JHUA 4I2OA 3U1DA 1KYWA 2LNBA 1I5ZA 2JT1A 2B0LA 3LA3A 5E8GA 2P6SA 2RKHA 4L9JA 4EM0B 2QBYA 4OIPF 1IRFA 4I01A 2XV4S 2F5DA 2EV5A 1U5TB 2RV8A 2P5KA 4U7BA 4IJAA 3L7WA 3V8LA 5JR3A 4XRFA 3T8RA 1BM9A 4U7DA 3GFLA 1Q1HA 1X3UA 2HFHA 3F8FA 3EYYA 1SFEA 3W6KB 5H6QA 3SFZA 4UV8A 5L3GA 3PFIA 2EWNA 3WTYC 3NQOA 2M5WA 3O2PE 4LFUA 1AWCA 3ABUA 5DCMA 2H6CA 3GZ6A 3RPUA 4KNYA 2DK8A 3L09A 2WC2A 1J0RA 3GFIA 1JHHA 3CUQB 3FMSA 2ELHA 4P5OA 4S04A 4UXNA 3G3ZA 5K5QA 2WTEA 4WXHA 4OIRF 4LMYA 2MBFA 3K1NA 4KYWA 1Z91A 2VBWA 1OKRA 3TOBA 1HW1A 1W7PD 1DPRA 3I64A 3RDIA 3LFKA 2JTVA 2L02A 5CVIA 1G3SA 2YSRA 4WCGA 4RGXA 2QBYB 5DD8A 3BZ6A 3Q9VA 2XAJA 3ZMZA 6PAXA 3HRUA 3NEUA 5AIPA 2V6CA 4YG2F 1ZARA 2KIMA 3CJNA 1FOKA 4OMZA 2PBIA 2HR3A 4U0YA 2K27A 2KRFA 4KUMA 2CW0F 3L00A 2QYOA 3GVAA 1BN5A 1TNTA 2Z5UA 4L9TA 4OIOF 5FB2A 1SD5A 3SQNA 5EEHA 4ZZLA 2Z99A 4RB3C 1ULYA 3OV8A 3JTGA 4M6YA 4IF4A 3EDPA 4YIFA 4BAYA 4FT8A 4KN4X 1Z9CA 4KT5C 4EJTA 1LDJA 5DCMB 3ABTA 2Y48A 4KIBA 3IKTA 5FD5A 2XRNA 5D6EA 5FGMA 2EA4A 2ESHA 4IHTA 3MWMA 3TO7A 5J8FA 3BOQA 3IL2A 4P9UA 3FXRA 5JFRA 4OMYA 3R6SA 3KP6A 2DK5A 3L2CA 2FF4A 2FXAA 2PFBA 1FYKA 2HOEA 5L3EA 2R3SA 3RKXA 1J2XA 3G73A 4IRHA 3IWZA 4HOBA 4GO1A 3I4PA 1S29A 1S3JA 1T0FA 4MTDA 4A5MA 2O3FA 1LNWA 3MZYA 3E5XA 2CGPA 1MGTA 4UVBA 2F5CA 1LDKB 1R22A 5D6FA 4IXAA 3LAPA 2FE3A 4ESBA 3M9AA 4AIJA 4G6QA 1REPC 3K1MA 4AIHA 1U8RA 2HKOA 2ADUA 3FM5A 4JK1X 1SAXA 1O7FA 1ZREA 4HBLA 3I58A 1OYWA 4UHTA 1KU3A 1ZG5A 1J5YA 4B09A 2FA5A 3ECHA 3M8FA 1IN5A 2PLYA 5D4SA 4XSXF 3WE2A 1G4DA 4ETSA 2DQLA 2KJBA 1FX7A 2DAOA 4L5IA 1ZGJA 1MJAA 3I59A 4CHUA 4BQAA 4EMSA 1EV7A 5K5OA 1YIOA 2MLKA 2KKOA 1G3TA 3V7RA 2FMLA 1G3WA 4LB5A 3AAFA 4GGGA 3ZP5A 1RUNA 1YO5C 5JI6A 1T98A 3JAMK 3TO9A 3CLOA 3BPVA 4I09A 4Y17A 2XAFA 1I6XA 3Q9SA 3F8MA 3TKYA 3DXJF 2QLZA 1TQIA 3WG9A 4CXFA 3BWGA 1XGOA 5KK1A 3RPQA 1EH7A 3RKWA 3FXUA 5J6XA 4Q4ZF 3F23A 2ESNA 1ZLKA 1QZZA 2Z9OA 1FP2A 2MD5A 4KDPA 1JHFA 2UZKA 1FPQA 3ZMVA 1I27A 4ENMA 2QENA 3ELKA 3HTSB 1I1SA 1BOAA 2FBHA 1UB9A 1IN6A 1HXDA 3T5XA 1IXCA 3H92A 2HTJA 4OIQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT3 A;  3ULQ B;  1SD6 A;  4HV6 A;  5L3F A;  3WTU C;  3J80 Z;  3QU3 A;  3FF5 A;  5DEQ A;  4AD9 A;  3DQV C;  1FWZ A;  4AWX B;  1STZ A;  4ASN A;  4RB0 A;  2E1N A;  2JPC A;  1Z1D A;  1YFH A;  1D8K A;  3I59 B;  2W24 A;  4U0W A;  5ILV A;  4Q47 A;  2QZ8 A;  3K69 A;  2P8T A;  2QQ9 A;  4A0Y A;  4IVN A;  1QBJ A;  5HS7 A;  2GWR A;  3K2Z A;  2ZFW A;  3L9F A;  3W6J B;  1PUE E;  5HS8 A;  3Q5F A;  1O7L A;  2RC4 A;  4MQV A;  2O03 A;  4P96 A;  4ZYD A;  1P2F A;  3P7N A;  1R1U A;  5HLI A;  1Z6R A;  1R7J A;  3IRQ A;  1R00 A;  4LLN A;  4LD5 A;  1H9T A;  3F8C A;  3DPT A;  2QQA A;  2RN7 A;  2GZW A;  3MFK A;  1SMT A;  4GYG A;  2K7L A;  5L3B A;  2XAS A;  4CDG A;  1HKQ A;  4DQ2 A;  1P92 A;  1S7A A;  3SZT A;  2GA1 A;  1SD4 A;  1XSX A;  3O3K A;  3VOD A;  3OOP A;  4HV5 A;  4R8H A;  1ZLJ A;  4BHC A;  3HYI A;  4BNC A;  3HSE A;  1JXS A;  2PEX A;  5AON A;  1LDD A;  1DP7 P;  3TO6 A;  2ZME B;  3RI4 A;  3HOS A;  2RNJ A;  3WTW C;  3KFW X;  1B9N A;  3I54 A;  2NNY A;  4H0E A;  4OOI A;  1K78 A;  3CUO A;  2F5F A;  2VE9 A;  5FFX A;  2EV6 A;  4MHG A;  1F5T A;  4GXO A;  4KIG A;  3H3Z A;  1Z05 A;  4BHB A;  1E17 A;  3DFG A;  1ON1 A;  4ZZD A;  4LB6 B;  2H6B A;  3MAJ A;  2ZCW A;  1WSU A;  5JVT A;  1J75 A;  2X4H A;  1Z7U A;  1KU2 A;  2R7F A;  2JPB A;  3TDU C;  2OZU A;  3WGI A;  5LRS A;  1FSE A;  4NQW A;  4CIC A;  1Z6T A;  3HSR A;  3WU1 B;  2P5L C;  3HHG A;  2QWW A;  5E1X A;  5E20 A;  5HVQ C;  4ZYE A;  2IA1 A;  5KVR A;  4EJO A;  5LBQ A;  2KIU A;  5K5R A;  4ENJ A;  2O61 A;  2RDP A;  1G6N A;  3RTR A;  4GCV A;  1IN7 A;  3WTT C;  4PDK A;  2OD5 A;  3NRV A;  5BS6 A;  5HS9 A;  1XGM A;  4PCQ A;  1FY7 A;  4Y13 A;  1QO0 D;  1PDN C;  3WU0 A;  2ISY A;  1ZRC A;  1MJ9 A;  4DNC A;  3CDH A;  3SHF A;  2ETH A;  1XCV A;  4LJZ F;  1BJA A;  1OMI A;  1K78 B;  4UNO A;  1T38 A;  3QP5 A;  3E6M A;  4BH9 A;  3R0J A;  3BPX A;  3LST A;  3COA C;  1IW7 F;  4LLG F;  3KP5 A;  2OQG A;  2VN2 A;  1YG2 A;  2FOK A;  4A5N A;  2ZXJ A;  3F8N A;  4HX7 A;  2EK5 A;  1XDS A;  2XHK A;  3K9T A;  4YFK F;  1WRJ A;  4HLY A;  2O6G E;  2DT5 A;  4M71 A;  2HGC A;  5LLQ A;  2OBP A;  1F4K A;  2ZNY A;  2IT0 A;  5BPD A;  1GVJ A;  1QQI A;  4KIF A;  2EFW A;  3R60 A;  5BOX A;  1JGS A;  3BP8 A;  1IZ1 A;  3GEZ A;  3F8B A;  1QZY A;  5DUI A;  1ZAO A;  4PGG A;  2M1B A;  3GUD A;  2GXG A;  5HOO A;  5A2Q Z;  1GHC A;  1YW7 A;  1LEB A;  3ZQ7 A;  2FEZ A;  2ZNZ A;  3QU6 A;  1C0W A;  5LGN A;  5HLG A;  2NNN A;  3HRS A;  2VBY A;  2VXZ A;  4MNU A;  2VOO A;  5HLH A;  2HDC A;  4LK1 F;  3DP7 A;  3RYR A;  2BGC A;  2NAZ A;  1YLF A;  3LA2 A;  4WF2 A;  3E6D A;  2DTR A;  2P5V A;  5E18 F;  1WQ2 A;  2A3S A;  4I0B A;  4ON0 A;  4G94 A;  4I7H A;  1B4A A;  4AVP A;  1JE8 A;  1ZYR F;  2K86 A;  4K2E A;  1HQC A;  1XMK A;  3KP3 A;  5CLS A;  3GXO A;  3RJP A;  2PQ8 A;  3JAM Z;  3JSP A;  5CJ9 A;  3WOD F;  3ZMT A;  5CVV A;  3LQR A;  5EEG A;  5K1Y A;  5D5X B;  1OPC A;  4RGR A;  1LB2 A;  3IC7 A;  1PP7 U;  2NS0 A;  2BBY A;  1FZP B;  3LQQ A;  5FLX K;  2A68 F;  2EFN A;  3PQK A;  1YQA A;  3ROU A;  3E97 A;  1BI3 A;  4XLP F;  5BPI A;  1ZRF A;  3KP4 A;  2NRA C;  2IW5 A;  3QOP A;  5CVJ A;  1R36 A;  3ZPL A;  3F6O A;  5DD4 A;  1TBX A;  1KGS A;  1B1B A;  1FP1 D;  2L4A A;  1RNL A;  1RZ4 A;  2L54 A;  3MCZ A;  1T39 A;  2F2E A;  3HRM A;  1D8J A;  3V8K A;  3BJA A;  4RAY A;  2CFX A;  4ENN A;  4KMU X;  1B6A A;  2XAG A;  1WWX A;  5E8I A;  1KU9 A;  4P55 A;  5BMZ A;  1XN7 A;  2V9V A;  4A12 A;  4XSZ F;  2HEO A;  1LJ9 A;  3FMR A;  1ZRD A;  5A2Q K;  2QM3 A;  3VB2 A;  2V1D A;  2QQB A;  3J81 K;  1E2X A;  2FBK A;  4O5V A;  2X0L A;  2HZT A;  3P9K A;  3F3X A;  1EH6 A;  4PGH A;  2IPQ X;  4M74 A;  3KEQ A;  4MEX F;  1S6L A;  3BJ6 A;  1HKS A;  1AOY A;  1LEA A;  2E7X A;  2L3D A;  2OQR A;  4QWQ A;  5FFZ A;  2CSO A;  2VBX A;  1UCR A;  1IN8 A;  1FYL A;  4LG0 A;  3I0T A;  2EV0 A;  2XRO A;  1PP8 F;  1YS6 A;  3ZMD A;  4FX4 A;  1IAW A;  2A6H F;  4M9S A;  3QP6 A;  2V1U A;  2HQN A;  2DPU A;  4MQ9 F;  4B8X A;  5D5U B;  1U5T C;  3D5L A;  3GW2 A;  3M7G A;  3IHU A;  4MEY F;  4NB5 A;  4L5J A;  2XKP A;  3GZ5 A;  4LK0 F;  1R23 A;  2PMH A;  1IXS B;  3TGN A;  3GWZ A;  1HKT A;  2LF8 A;  3DF8 A;  5LRR A;  3N4M A;  1UST A;  1B9M A;  2VOP A;  1USS A;  1YW9 A;  3JSO A;  4HQE A;  2KIF A;  2CQK A;  4G8X A;  3ERE D;  2EFQ A;  2QUF A;  4ENK A;  1ZHF A;  1MKM A;  4YFN F;  1SFX A;  3WTX C;  3FXQ A;  4IRG A;  4EQQ A;  1XGN A;  2P7C B;  3H3U A;  3CUQ C;  3N97 A;  4MGR A;  2XAQ A;  4G9Y A;  3QPT A;  4OIN F;  1CF7 A;  3T1B A;  3HRT A;  3GLX A;  3ML6 A;  4A6D A;  3DKW A;  1BC8 C;  3ZMU A;  4M9X A;  5L3D A;  1YW8 A;  2Z3Y A;  1SD7 A;  1J7K A;  3R0A A;  3LAJ A;  5HDK A;  4BYY A;  3LWF A;  2PJP A;  4G7O F;  1S7O A;  3R4K A;  2HYG D;  3FMQ A;  1FYM A;  1IRG A;  4ZH4 F;  3VEP A;  5BQT A;  2CO5 A;  1ONV A;  3RYP A;  3TOA A;  2HYF A;  4ESJ A;  4RS8 A;  5DDG A;  2Y75 A;  4WK8 F;  1L3L A;  1V4R A;  1H9G A;  1R5G A;  4UVA A;  1XCB A;  4I98 B;  2A5Y B;  1R1T A;  2VC1 A;  4CGZ A;  3ISP A;  2M45 A;  1GXP A;  4HX4 A;  1TW2 A;  2BE5 F;  2FBI A;  5AIQ A;  1GXQ A;  2KJC A;  1U3E M;  4LLL A;  3WTS C;  2W57 A;  1KQ0 A;  4JQF A;  4Y15 A;  3RIR A;  4ZYG A;  5FD6 A;  2VT2 A;  2QVO A;  2COM A;  1KQ9 A;  2CWE A;  3TDZ C;  3I53 A;  3VFZ A;  1ZH5 A;  2F5E A;  1TNS A;  3KE2 A;  2A07 F;  1EH8 A;  5LGT A;  3O6B B;  4R1H A;  4L9V A;  1O3Q A;  5HDG A;  2JZY A;  2A69 F;  1W4M A;  4KN7 X;  1QGP A;  1TLH B;  1P4W A;  2Z33 A;  5IT9 K;  3GFJ A;  1R1V A;  5HDN A;  1MJB A;  4M6X A;  2XKO A;  2AS5 F;  3BJO A;  5ICC A;  2VBZ A;  3KLN A;  2PN6 A;  2STW A;  1BC7 C;  2GAU A;  1BI1 A;  2HWV A;  4RGU A;  3BRO A;  2MLG A;  4EM1 A;  1ZG1 A;  1IN4 A;  1BIA A;  1R58 A;  3K1P A;  1XB4 A;  4U0V A;  2IVM A;  1FBQ A;  2V79 A;  2E7W A;  1LQ1 A;  3ZMS A;  3GYH X;  5D8K B;  5LEJ A;  2ZBK A;  3CO6 C;  1XSV A;  1W5S A;  2FRH A;  1BI2 A;  3FWE A;  2XGX A;  1ODD A;  2VT3 A;  5F6F A;  2VOD A;  1KYZ A;  2D45 A;  4HQM A;  1YS7 A;  3CUQ A;  1WKM A;  2EJR A;  4A2U A;  5ILU A;  3FZV A;  1Y0U A;  2ACJ A;  1MZB A;  5E1Z B;  2RGV A;  3E6B A;  1FBU A;  3F21 A;  2CYY A;  3JTH A;  3V8J A;  2FMY A;  3KEO A;  5FLX Z;  4ESF A;  3F6V A;  2E1C A;  1OYY A;  3HOT A;  1V3F A;  1DDN A;  2WV0 A;  1FBS A;  4I02 A;  1H0M A;  3DEU A;  4IHS A;  4LGW A;  3U2R A;  2A6E F;  2MA3 A;  4KA4 A;  3B02 A;  1RUO A;  4M9Z A;  2J5P A;  2EB7 A;  1XD7 A;  4EJV A;  3C18 A;  3REO A;  4BXU A;  2FU4 A;  3E6C C;  1HST A;  5J8C A;  2J5O A;  2DLL A;  4HF2 A;  5CVR A;  4F7Z A;  4P9F A;  1HBX G;  2EA2 A;  3F72 A;  4OU0 A;  1D5V A;  1FLI A;  3V4G A;  4RB2 C;  2BEO A;  2HTS A;  2GIV A;  3KP7 A;  1W5T A;  1F9N A;  3C3W A;  3WGH A;  5ICE A;  3HUG A;  5D8L B;  3BY6 A;  2BV6 A;  2EFO A;  4L9N A;  4EV0 A;  3J81 Z;  3I71 A;  2IA2 A;  5H20 A;  4KFC A;  3T8T A;  4CO8 A;  4O3M A;  4M73 A;  2OZ6 A;  2MH2 A;  5TRD A;  1FC3 A;  4EJW A;  1ZGA A;  3MQ0 A;  1XSD A;  5ED4 A;  3ECO A;  4N9H A;  5LEK A;  2DPD A;  1T2K A;  1MDM A;  5D4R A;  3DV8 A;  3QRF F;  3V7S A;  1XGS A;  1G3Y A;  3ZN0 A;  1BI0 A;  3HTU A;  2HKX A;  3IKV A;  2G9W A;  4IRI A;  3WE3 A;  5ERI A;  1K6O A;  1K7A A;  2GA2 A;  3QAH A;  1XDU A;  3CO7 C;  3KET A;  1W7P A;  4A0Z A;  4O6J A;  3KCC A;  2AXL A;  4UVC A;  2P7V B;  2ZJ2 A;  1IXR C;  5DV5 A;  1K79 A;  5H6R A;  3FM3 A;  2W85 A;  3KLO A;  4FHT A;  3GO5 A;  5DUK A;  2YU3 A;  4GYI A;  2LSO A;  4EM2 A;  4G7Z F;  3GX4 X;  1TQM A;  1T6S A;  4WXD A;  3EET A;  1O57 A;  4XLN F;  1A04 A;  2FNA A;  5TJJ A;  2TDX A;  2G7U A;  4ZYH A;  2L01 A;  1DUX C;  3C1D A;  2Q2E A;  4CZZ A;  2LF7 A;  3RKY A;  4G7H F;  3VOE A;  4A6E A;  5L3C A;  2M8E A;  4E70 A;  5D5V B;  1UHM A;  4N9I A;  3EQL F;  2JRT A;  2XUB A;  1OR7 A;  2K4B A;  2P4W A;  3JW4 A;  3GF2 A;  1IF1 A;  1MDM B;  4G6D A;  2LKP A;  3E5U A;  2DU9 A;  2NYX A;  4KMF A;  2D2W A;  2V1X A;  3C7J A;  5DCF A;  4HAM A;  1U78 A;  3P9C A;  1U6G A;  2P6T A;  2C6Y A;  4QLC U;  1W7P B;  2VON A;  4BHP A;  4EGY A;  2IRF G;  4WX9 A;  3B73 A;  4L18 B;  2D1H A;  3HHH A;  4AIK A;  4D0P A;  5LHG A;  3FHZ A;  3QPH A;  1NHA A;  1U2W A;  4HF1 A;  2ZKZ A;  2H09 A;  1MD0 A;  5F64 A;  1IUY A;  4YII A;  4RB1 A;  1YTY A;  2JSC A;  2CG4 A;  4HA8 A;  2Q8K A;  3PQJ A;  3P9I A;  4YFX F;  2EFP A;  2DBB A;  3R61 A;  1O3S A;  1J9I A;  5DYM A;  2RQP A;  2ZO4 A;  2IP2 A;  2MH9 A;  2XIG A;  2DFI A;  3MEX A;  5IT9 Z;  2VE8 A;  4TV7 A;  1BIB A;  2FQ3 A;  1D3Y A;  2O0Y A;  1CGP A;  5CYV A;  4M72 A;  2YPR A;  1TQP A;  1KA8 A;  5FO5 A;  1UFM A;  2Q0O A;  1LVA A;  4PZJ A;  4HF0 A;  4HDV A;  3V7C A;  4HDU A;  1QNT A;  4HX8 A;  2K4J A;  1P4A A;  1O3R A;  4HW0 A;  4UUV A;  4Q48 A;  3BDD A;  2MC3 A;  3KP2 A;  3TQN A;  4HYE A;  1UHW A;  4KIC A;  2YR2 A;  4N0B A;  3HSF A;  3SZP A;  5ILS A;  1RIO H;  4S05 A;  2DI3 A;  2GQQ A;  1BBY A;  4XBF A;  5D5W B;  3WGG A;  3EUH A;  2ZME A;  2YX7 A;  2IA0 A;  1P6R A;  4U88 A;  4I0A A;  2PI0 A;  3T0Y A;  1HSJ A;  2K02 A;  3F22 A;  4LG0 B;  1WI9 A;  2WWY A;  2DW4 A;  1RI7 A;  3FX3 A;  5E1W A;  3WTV C;  2O8X A;  5LHI A;  1S8N A;  3I5U A;  2M30 A;  2YX4 A;  1KU7 A;  2DQR A;  3J7A O;  1OYI A;  4RGS A;  4IPA A;  4CYD A;  5E17 F;  3E3V A;  5CVU A;  1HW5 A;  3E5Q A;  4A0X A;  1J59 A;  2D1V A;  3U9G A;  4HLX A;  1VTN C;  2DO7 A;  1HW2 A;  1XMA A;  2G7H A;  3M1E A;  5LHH A;  2UWM A;  3IRR A;  1KQ8 A;  1ZG3 A;  4EVI A;  1FNN A;  1O3T A;  5LGU A;  2XAH A;  4HZF A;  4L0Y B;  2OU2 A;  1F1Z A;  2XVC A;  3SXY A;  2W25 A;  4Z2Y A;  4NHJ A;  1SMY F;  2PG4 A;  3S2W A;  3KZZ A;  2FSW A;  4WWC A;  5F1R A;  3M8E A;  1L0O C;  1SFU A;  2UXN A;  2H27 A;  4JBA A;  4WXC A;  3K0L A;  1CF7 B;  3WTZ A;  3D0S A;  3MZH A;  2R7D A;  4RAZ A;  4EGZ A;  5ICG A;  1I1G A;  2Y0M A;  4EJU A;  1U5T A;  1YYV A;  4UV9 A;  4L0Z B;  1DPU A;  2LDU A;  4Q5S F;  2PMU A;  1R5H A;  2W84 A;  2BYV E;  4FX0 A;  2FNP A;  2OAZ A;  2M87 A;  2L4M A;  1ON2 A;  1TTY A;  1TW3 A;  3KZY A;  2ISZ A;  1FSH A;  2STT A;  2OA4 A;  2RVC A;  2IJL A;  2HQR A;  3LA7 A;  3ZN1 A;  3HIF A;  3DPL C;  2GXB A;  1P4X A;  1FT9 A;  1QPM A;  2VC0 A;  2HS5 A;  1ZN2 A;  2H94 A;  3EYI A;  4MTE A;  2A61 A;  5ICF A;  4R79 A;  3IWF A;  3CTA A;  3J80 K;  3GFM A;  2UXX A;  1B59 A;  5JHU A;  4I2O A;  3U1D A;  1KYW A;  2LNB A;  1I5Z A;  2JT1 A;  2B0L A;  3LA3 A;  5E8G A;  2P6S A;  2RKH A;  4L9J A;  4EM0 B;  2QBY A;  4OIP F;  1IRF A;  4I01 A;  2XV4 S;  2F5D A;  2EV5 A;  1U5T B;  2RV8 A;  2P5K A;  4U7B A;  4IJA A;  3L7W A;  3V8L A;  5JR3 A;  4XRF A;  3T8R A;  1BM9 A;  4U7D A;  3GFL A;  1Q1H A;  1X3U A;  2HFH A;  3F8F A;  3EYY A;  1SFE A;  3W6K B;  5H6Q A;  3SFZ A;  4UV8 A;  5L3G A;  3PFI A;  2EWN A;  3WTY C;  3NQO A;  2M5W A;  3O2P E;  4LFU A;  1AWC A;  3ABU A;  5DCM A;  2H6C A;  3GZ6 A;  3RPU A;  4KNY A;  2DK8 A;  3L09 A;  2WC2 A;  1J0R A;  3GFI A;  1JHH A;  3CUQ B;  3FMS A;  2ELH A;  4P5O A;  4S04 A;  4UXN A;  3G3Z A;  5K5Q A;  2WTE A;  4WXH A;  4OIR F;  4LMY A;  2MBF A;  3K1N A;  4KYW A;  1Z91 A;  2VBW A;  1OKR A;  3TOB A;  1HW1 A;  1W7P D;  1DPR A;  3I64 A;  3RDI A;  3LFK A;  2JTV A;  2L02 A;  5CVI A;  1G3S A;  2YSR A;  4WCG A;  4RGX A;  2QBY B;  5DD8 A;  3BZ6 A;  3Q9V A;  2XAJ A;  3ZMZ A;  6PAX A;  3HRU A;  3NEU A;  5AIP A;  2V6C A;  4YG2 F;  1ZAR A;  2KIM A;  3CJN A;  1FOK A;  4OMZ A;  2PBI A;  2HR3 A;  4U0Y A;  2K27 A;  2KRF A;  4KUM A;  2CW0 F;  3L00 A;  2QYO A;  3GVA A;  1BN5 A;  1TNT A;  2Z5U A;  4L9T A;  4OIO F;  5FB2 A;  1SD5 A;  3SQN A;  5EEH A;  4ZZL A;  2Z99 A;  4RB3 C;  1ULY A;  3OV8 A;  3JTG A;  4M6Y A;  4IF4 A;  3EDP A;  4YIF A;  4BAY A;  4FT8 A;  4KN4 X;  1Z9C A;  4KT5 C;  4EJT A;  1LDJ A;  5DCM B;  3ABT A;  2Y48 A;  4KIB A;  3IKT A;  5FD5 A;  2XRN A;  5D6E A;  5FGM A;  2EA4 A;  2ESH A;  4IHT A;  3MWM A;  3TO7 A;  5J8F A;  3BOQ A;  3IL2 A;  4P9U A;  3FXR A;  5JFR A;  4OMY A;  3R6S A;  3KP6 A;  2DK5 A;  3L2C A;  2FF4 A;  2FXA A;  2PFB A;  1FYK A;  2HOE A;  5L3E A;  2R3S A;  3RKX A;  1J2X A;  3G73 A;  4IRH A;  3IWZ A;  4HOB A;  4GO1 A;  3I4P A;  1S29 A;  1S3J A;  1T0F A;  4MTD A;  4A5M A;  2O3F A;  1LNW A;  3MZY A;  3E5X A;  2CGP A;  1MGT A;  4UVB A;  2F5C A;  1LDK B;  1R22 A;  5D6F A;  4IXA A;  3LAP A;  2FE3 A;  4ESB A;  3M9A A;  4AIJ A;  4G6Q A;  1REP C;  3K1M A;  4AIH A;  1U8R A;  2HKO A;  2ADU A;  3FM5 A;  4JK1 X;  1SAX A;  1O7F A;  1ZRE A;  4HBL A;  3I58 A;  1OYW A;  4UHT A;  1KU3 A;  1ZG5 A;  1J5Y A;  4B09 A;  2FA5 A;  3ECH A;  3M8F A;  1IN5 A;  2PLY A;  5D4S A;  4XSX F;  3WE2 A;  1G4D A;  4ETS A;  2DQL A;  2KJB A;  1FX7 A;  2DAO A;  4L5I A;  1ZGJ A;  1MJA A;  3I59 A;  4CHU A;  4BQA A;  4EMS A;  1EV7 A;  5K5O A;  1YIO A;  2MLK A;  2KKO A;  1G3T A;  3V7R A;  2FML A;  1G3W A;  4LB5 A;  3AAF A;  4GGG A;  3ZP5 A;  1RUN A;  1YO5 C;  5JI6 A;  1T98 A;  3JAM K;  3TO9 A;  3CLO A;  3BPV A;  4I09 A;  4Y17 A;  2XAF A;  1I6X A;  3Q9S A;  3F8M A;  3TKY A;  3DXJ F;  2QLZ A;  1TQI A;  3WG9 A;  4CXF A;  3BWG A;  1XGO A;  5KK1 A;  3RPQ A;  1EH7 A;  3RKW A;  3FXU A;  5J6X A;  4Q4Z F;  3F23 A;  2ESN A;  1ZLK A;  1QZZ A;  2Z9O A;  1FP2 A;  2MD5 A;  4KDP A;  1JHF A;  2UZK A;  1FPQ A;  3ZMV A;  1I27 A;  4ENM A;  2QEN A;  3ELK A;  3HTS B;  1I1S A;  1BOA A;  2FBH A;  1UB9 A;  1IN6 A;  1HXD A;  3T5X A;  1IXC A;  3H92 A;  2HTJ A;  4OIQ F; 
#chains in the Genus database with same CATH topology
 5IT3 A;  3ULQ B;  1IDZ A;  1SD6 A;  4HV6 A;  5L3F A;  3WTU C;  3J80 Z;  3QU3 A;  1HDD C;  4XLC A;  3VPR A;  3FF5 A;  5DEQ A;  4AD9 A;  2QEX I;  4A3L J;  3DQV C;  3PNV A;  1MND A;  1FWZ A;  3DU5 A;  4QSH A;  4AWX B;  2NVT J;  1STZ A;  3PJR A;  4ASN A;  4RB0 A;  2E1N A;  2JPC A;  2UUZ A;  5J1R A;  1Z1D A;  1OCZ H;  4ZDL A;  1ZTR A;  1YFH A;  1D8K A;  3I59 B;  2K3P A;  4BY1 J;  2W24 A;  3H5R A;  4U0W A;  5ILV A;  1DU0 A;  4HEA 2;  2QZ8 A;  4Q47 A;  3K69 A;  2P8T A;  1N77 A;  2QQ9 A;  2HVR A;  2QF7 A;  4Y4R A;  4A0Y A;  4IVN A;  1QBJ A;  4ZJZ A;  5HS7 A;  2GWR A;  3K2Z A;  2PJR B;  2V9K A;  1UG2 A;  3F0C A;  2ZFW A;  3L9F A;  4V2G A;  3W6J B;  2QSG X;  3AG2 H;  1PUE E;  2E2H J;  5HS8 A;  3Q5F A;  1O7L A;  1OCR H;  2RC4 A;  4I76 A;  2O03 A;  2LH9 A;  3BG7 A;  4MQV A;  4P96 A;  4ZYD A;  2HXO A;  3CF2 A;  1P2F A;  3K4J A;  3H35 A;  3P7N A;  1R1U A;  4BJ5 C;  5HLI A;  1JGG A;  2DXI A;  1Z6R A;  3I9V 2;  4B43 A;  1R7J A;  2GOM A;  3IRQ A;  3TBI A;  2HPI A;  4XQF A;  1R00 A;  1RR8 C;  4LLN A;  2R5Y B;  4LD5 A;  1H9T A;  3F8C A;  2ECB A;  2QQA A;  3DPT A;  2RN7 A;  3JRB A;  4AYB A;  5GAH J;  2GZW A;  4LIU A;  3MFK A;  5HNF A;  1SMT A;  2OJE D;  3SDG A;  3S15 J;  4GYG A;  5E79 C;  2HOA A;  2K7L A;  5L3B A;  2XAS A;  4DZP A;  4CDG A;  1QVT A;  1HKQ A;  4DQ2 A;  2XF6 A;  1R71 A;  1P92 A;  3KYL A;  3AL0 B;  1S7A A;  3KEY A;  4ZDO A;  3SZT A;  2GA1 A;  1IG7 A;  3FXJ A;  2K85 A;  3BT9 A;  4II3 A;  1SD4 A;  1XSX A;  1JI8 A;  3O3K A;  3VOD A;  3OOP A;  4HV5 A;  4R8H A;  1ZQ3 P;  1ZLJ A;  4BHC A;  2QQ8 A;  4NC8 A;  3HYI A;  4BNC A;  1N75 A;  4GFB A;  3HSE A;  1JXS A;  2PEX A;  1Y39 A;  5AON A;  3Q0V A;  1LDD A;  1DP7 P;  3TO6 A;  2IS6 A;  4FCY A;  2ZME B;  2R7S A;  3FXM A;  3RI4 A;  3HOS A;  2RNJ A;  3WTW C;  3KFW X;  1B9N A;  2ZXH A;  3I54 A;  2NNY A;  2FX0 A;  3VSL A;  1Y8R B;  4H0E A;  3PL8 A;  4OOI A;  1LUJ B;  3ONQ A;  1K78 A;  3CUO A;  4NNJ A;  2F5F A;  2VE9 A;  5FFX A;  1YIT I;  3JRI A;  2N8G A;  2EV6 A;  2VQL A;  2DOD A;  4Y7N J;  4MHG A;  1F5T A;  4GXO A;  4M3F A;  4KIG A;  1TL8 A;  3H3Z A;  1X3W B;  1Z05 A;  4BHB A;  2WA0 A;  1W0U A;  1JKR C;  5EDN A;  2VL8 A;  1E17 A;  4BE0 A;  3DFG A;  1JTX A;  1ON1 A;  3AG4 H;  4LB6 B;  2BXY A;  4ZZD A;  2H6B A;  3O8G A;  2MYS A;  4C3J J;  3D5S C;  3MAJ A;  2ZCW A;  1WSU A;  1I50 J;  5JVT A;  1BOB A;  1J75 A;  2X4H A;  1MMA A;  2W7N A;  3A03 A;  1Z7U A;  1KU2 A;  2R7F A;  1JUM A;  2JPB A;  4A3K J;  3TDU C;  2OZU A;  2AQF A;  3OYJ A;  2EZK A;  3WGI A;  5CQG A;  5K7H A;  5LRS A;  3QPL A;  1FSE A;  4NQW A;  1O4X A;  3HPH A;  2I8D A;  4CIC A;  4XMY A;  1Z6T A;  2K40 A;  2VLA A;  3HSR A;  2UV1 A;  1OCP A;  4Y33 A;  4DIQ A;  1NK2 P;  3S32 A;  3WU1 B;  2P5L C;  3HHG A;  2QWW A;  5E1X A;  3OSF A;  3OR1 C;  5E20 A;  3OYN A;  5HVQ C;  1W36 D;  2VUM J;  1MMS A;  4ZYE A;  2IA1 A;  1CQT A;  5KVR A;  4EJO A;  5LBQ A;  2KIU A;  4BS9 A;  5K5R A;  4ENJ A;  2O61 A;  1Y8Q B;  1G6N A;  2RDP A;  3RTR A;  4EAT A;  2X6W A;  1FOX A;  4GCV A;  1FMW A;  2XF5 A;  1IN7 A;  3WTT C;  4PDK A;  4OAY A;  4BQO A;  2OD5 A;  1R6R A;  3NRV A;  3A01 A;  5EG0 A;  4AID A;  1I3Q J;  4Z6Y A;  5BS6 A;  3UKG A;  5HS9 A;  1XGM A;  2R7T A;  4PCQ A;  4XL9 A;  2IGO A;  2TCT A;  1FY7 A;  1JUS A;  1QO0 D;  4Y13 A;  1PDN C;  1ERD A;  3FK6 A;  2DFE A;  2BW3 A;  3G4S I;  3WU0 A;  4KIS A;  1VQ9 I;  1X58 A;  2NXN B;  4XKB A;  4Y52 J;  1PVE A;  3HKZ A;  1ETK A;  2JN6 A;  2ISY A;  5FKO A;  1TWC J;  1YJW I;  5IYD J;  1ZRC A;  1VQ7 I;  5FLV A;  3KPH A;  2WAQ A;  2DA3 A;  4B44 A;  1D0Y A;  1MJ9 A;  1D1B A;  4DNC A;  2JVH A;  1HC8 A;  3ZQH A;  3CDH A;  3SHF A;  2QCO A;  2BZT A;  2ETH A;  3EUK L;  1XCV A;  3RPU D;  4LJZ F;  1WGX A;  2HDW A;  1BJA A;  1OMI A;  3HB9 A;  5FRM A;  2MW8 A;  1K78 B;  3K2A A;  4ITV A;  1T8I A;  1X3Z B;  5HLT A;  1T38 A;  2CV2 A;  4UNO A;  3QP5 A;  3E6M A;  4BH9 A;  1K61 A;  3R0J A;  4CA0 A;  5DM6 F;  1H8A C;  2F48 A;  1YE9 A;  1UMQ A;  3BPX A;  2L9N A;  3LST A;  3VYU B;  3COA C;  2HOS A;  1IW7 F;  4DYQ A;  4LLG F;  3BTJ A;  2R5Z B;  3BZK A;  3KP5 A;  1YJ9 I;  2OQG A;  2VN2 A;  1YG2 A;  2FOK A;  4A5N A;  2ZXJ A;  3F8N A;  4HX7 A;  1NG7 A;  3ABL H;  4BJ6 C;  3I56 I;  2EK5 A;  1XDS A;  4FAS D;  2DJI A;  2XHK A;  3K9T A;  4YFK F;  4AC0 A;  1WRJ A;  4HLY A;  1D1C A;  2O6G E;  2DA1 A;  2XGE A;  2DMT A;  2DT5 A;  4M71 A;  5GAD J;  2HGC A;  1A5J A;  5LLQ A;  5FJ8 J;  4NQW B;  2OBP A;  1F4K A;  2ZNY A;  2IT0 A;  3HOU J;  5EGO A;  2WB1 N;  5BPD A;  2DT6 A;  1GVJ A;  1QQI A;  4NBQ A;  4KIF A;  2EFW A;  1ETX A;  1HDP A;  1JGS A;  3R60 A;  5BOX A;  3BP8 A;  1QPI A;  1IZ1 A;  2CUZ A;  2WAD A;  3GEZ A;  3F8B A;  1UAA A;  4DJA A;  2X9D A;  1E3H A;  1QZY A;  5DUI A;  1ZAO A;  3OYE A;  3CCM I;  4PGG A;  2L7K A;  2M1B A;  3CDI A;  3GUD A;  2GXG A;  5HOO A;  5A2Q Z;  3HC7 A;  1YW7 A;  1GHC A;  1OFC X;  1LEB A;  3ZQ7 A;  2FEZ A;  2ZNZ A;  3A01 B;  3QU6 A;  5JVG F;  5EG0 B;  1C0W A;  2X48 A;  4KJZ A;  2QKL B;  1DQU A;  5LGN A;  5HLG A;  1X1D A;  2NNN A;  3HRS A;  4F52 A;  3M4O J;  3JR9 A;  2VBY A;  1SFO J;  3CF5 F;  1X4P A;  2CU7 A;  4L5E A;  2VXZ A;  4MNU A;  3LOC A;  2VOO A;  5HLH A;  2HDC A;  4LK1 F;  2BXZ A;  3OMY A;  3ERM A;  1PUF A;  3DP7 A;  3RYR A;  5B5E C;  2BGC A;  2NAZ A;  1YIJ I;  1YLF A;  3LA2 A;  2L9S A;  4WF2 A;  2XPV A;  3PNY A;  1MBG A;  4ZTF A;  3E6D A;  2DTR A;  2KRH A;  1YI2 I;  2P5V A;  5E18 F;  3DTK A;  3WG7 H;  1WQ2 A;  2IXS A;  2A3S A;  4I0B A;  4ON0 A;  4G94 A;  1TWA J;  2PX9 A;  2XDV A;  4I7H A;  1B4A A;  5EF6 A;  4AVP A;  5M3M J;  1JE8 A;  1ZYR F;  3GTG J;  3HOZ J;  3FXO A;  2K86 A;  5GP9 A;  3SYT A;  4K2E A;  1HQC A;  1XMK A;  3KP3 A;  5CLS A;  5LD2 C;  3QOE A;  3S16 J;  1R5I D;  3LSK A;  4BKX A;  1FOW A;  3GXO A;  3RJP A;  2PQ8 A;  3JAM Z;  5M5X J;  3JSP A;  5CJ9 A;  3LFU A;  3WOD F;  3ZMT A;  3JRE A;  1WHU A;  5CVV A;  3LQR A;  5EEG A;  2KPM A;  2O8K A;  5K1Y A;  5D5X B;  1OPC A;  4RGR A;  1LB2 A;  2IGM A;  4A3G J;  3IC7 A;  1PP7 U;  2HVQ A;  2V9P A;  2NS0 A;  2LOO A;  2BBY A;  1FZP B;  3LQQ A;  5FLX K;  2A68 F;  1J09 A;  2EFN A;  5GAE J;  3PQK A;  5CQE A;  3CCV I;  1YQA A;  3ROU A;  2DJN A;  3E97 A;  3CMY A;  1BI3 A;  1QHG A;  4XLP F;  2FUG 2;  5BPI A;  2CH0 A;  1ZRF A;  4XN3 A;  2CV0 A;  3KP4 A;  1X1B A;  2OPT A;  3JRF A;  1JTY A;  2NRA C;  3BG6 A;  2IW5 A;  4V2F A;  3QOP A;  2HZD A;  5IYB J;  1ORK A;  2E36 A;  5CVJ A;  4XLA A;  4UY8 I;  3A0H C;  1R36 A;  3ZPL A;  1T95 A;  1YRN B;  3D1N I;  3F6O A;  5DD4 A;  3K10 A;  1TBX A;  3JRH A;  1KGS A;  2OCE A;  3MKW B;  1B1B A;  1P7I A;  1FP1 D;  1PJR A;  2L4A A;  1RNL A;  1RZ4 A;  3RZO J;  2L54 A;  2Y9Z A;  3MCZ A;  3A0B C;  1T39 A;  2F2E A;  1BR2 A;  3HRM A;  1D8J A;  1VQO I;  2VQH A;  3V8K A;  2ZSH B;  1IRX A;  1I39 A;  3BJA A;  2JA6 J;  3DBR B;  4QTR A;  2KFD A;  2JA5 J;  3ZQQ A;  4RAY A;  2CFX A;  4ENN A;  2V7F A;  2XF7 A;  3H9G A;  1JKP C;  1Q1V A;  3GLL A;  4KMU X;  1Z3Y A;  1B6A A;  2XAG A;  2COB A;  1WWX A;  5E8I A;  1KU9 A;  3L2Q A;  1RPW A;  4P55 A;  5BMZ A;  1ETO A;  1XN7 A;  5EYR A;  3OS1 A;  2V9V A;  3K4L A;  4A12 A;  1NTC A;  4XSZ F;  2DMP A;  2HEO A;  4IX7 A;  4RAF A;  1LJ9 A;  4XLF A;  3FMR A;  1ZRD A;  3I3L A;  5A2Q K;  2DA2 A;  4RLQ A;  2F6C A;  3CMM A;  2QM3 A;  2NVU B;  1GDT A;  3VB2 A;  5LFA A;  2OTL I;  1Z3X A;  2V1D A;  4CCJ A;  1TWH J;  2QQB A;  2WAF A;  2EZH A;  3BCB A;  1R49 A;  3J81 K;  2EIK H;  2HQA A;  1E2X A;  2FBK A;  5KHD A;  3ASN H;  4O5V A;  2X0L A;  5M5Y J;  2HZT A;  2QSF X;  2GLO A;  3P9K A;  3F3X A;  1EH6 A;  2EIN H;  2JUC A;  4PGH A;  5J1Y A;  4XKC A;  2IPQ X;  1ETY A;  3V42 A;  4M74 A;  1DGR M;  3KEQ A;  2E1M B;  3CMA I;  4MEX F;  3QWL A;  2JQ7 A;  1S6L A;  3BJ6 A;  1HKS A;  1AOY A;  1RR7 A;  1LEA A;  1MNE A;  3FXK A;  2E7X A;  2L3D A;  2OQR A;  4QWQ A;  1FTT A;  3ZR8 X;  5FFZ A;  2CSO A;  2VBX A;  1UCR A;  1APL C;  1IN8 A;  4X6A J;  3S8P A;  2IAI A;  3UNG C;  1FYL A;  3C2B A;  3ABK H;  2HI3 A;  4LG0 A;  3I0T A;  2EV0 A;  1HF0 A;  1VQ5 I;  4NC7 A;  2XRO A;  3DLL F;  4XKW A;  5IP7 J;  2HNH A;  2Q1Z B;  1PP8 F;  1YS6 A;  3ZMD A;  4FX4 A;  3PM1 A;  1Y6I A;  1IAW A;  2A6H F;  4AM3 A;  2LK2 A;  4M9S A;  3QP6 A;  3CDL A;  2JSP A;  2V1U A;  3PO3 J;  2HQN A;  2DPU A;  2E35 A;  4MQ9 F;  5DM7 F;  3IP4 B;  4B8X A;  5D5U B;  1U5T C;  3D5L A;  3GW2 A;  1MBK A;  3M7G A;  2M4K A;  4C9Y A;  3IHU A;  4FTH A;  2B63 J;  3FDY A;  4IOC F;  4IQJ A;  4MEY F;  4NB5 A;  4L5J A;  2XKP A;  3GZ5 A;  4LK0 F;  5B3S H;  3CES A;  2XGC A;  2CW7 A;  2JK3 A;  3H0D A;  1R23 A;  2PMH A;  1SFK A;  1IXS B;  2XPW A;  3TGN A;  3GWZ A;  1EJ9 A;  1HKT A;  1E0E A;  2LF8 A;  2XB0 X;  3DF8 A;  5LRR A;  2KLO A;  1GLN A;  1JJ8 C;  3N4M A;  4BU2 A;  1MBE A;  1UST A;  4W97 A;  3NWS A;  1B9M A;  2VOP A;  1USS A;  2LBF A;  4A69 C;  1YW9 A;  3JSO A;  4HQE A;  2KIF A;  2M9H A;  1T08 B;  4D9J A;  2CQK A;  2OTJ I;  3S2D J;  4G8X A;  4JX4 A;  4PJN A;  2EFQ A;  3ERE D;  2QUF A;  3JRC A;  2OC6 A;  4YRV A;  1ETV A;  4ENK A;  1ZHF A;  1MKM A;  3CC4 I;  2IS4 A;  5F0F A;  4BBR J;  4YFN F;  1SFX A;  2ZC2 A;  2R4G A;  2LR8 A;  1U8B A;  3LSG A;  3WTX C;  4DYC A;  1YHQ I;  3FXQ A;  1SVM A;  4IRG A;  4EQQ A;  3OIP A;  1XGN A;  2XC7 A;  2P7C B;  3H3U A;  3LSI A;  5KCM A;  3CUQ C;  3N97 A;  3ZQC A;  4MGR A;  2XAQ A;  2KZV A;  2Z16 A;  3TP3 A;  5DTD A;  2DMN A;  4G9Y A;  3QPT A;  4OIN F;  1CF7 A;  1ZEL A;  4IEJ A;  1AA7 A;  3HRT A;  2JWT A;  3GLX A;  3T1B A;  3VYS B;  2NS8 A;  3ML6 A;  1IRZ A;  2L7M P;  4A6D A;  3H1C A;  3DKW A;  1OIS A;  3B6C A;  3ZMU A;  1BC8 C;  4XKV A;  4M9X A;  5L3D A;  3G1L A;  1YW8 A;  3CCR I;  2VJJ A;  2Z3Y A;  1SD7 A;  1J7K A;  3R0A A;  5EJC A;  3LAJ A;  5HDK A;  4BYY A;  3LWF A;  2PJP A;  4IO9 F;  1M1E B;  3JRA A;  4MLO A;  4G7O F;  1S7O A;  3R4K A;  4AUX A;  4HNU A;  2HYG D;  2KDO A;  2E71 A;  3FMQ A;  1FYM A;  1IRG A;  1TZL A;  4UUS B;  4ZH4 F;  4HRI A;  3KYD B;  2JMW A;  4N4N B;  3VEP A;  1JT0 A;  5BQT A;  2CO5 A;  2QKM B;  3OYG A;  2H1K A;  1ONV A;  3RYP A;  1AU7 A;  4GDF A;  3TOA A;  1R4N B;  4XOT A;  2DDB A;  2HYF A;  2NOG A;  4ESJ A;  3OY9 A;  5FKM A;  4FE7 A;  4RS8 A;  2YS9 A;  5DDG A;  2Y75 A;  4WK8 F;  4UB8 C;  1VFC A;  1V4R A;  1L3L A;  1H9G A;  1IV8 A;  1R5G A;  3G1M A;  4UVA A;  1NH3 A;  1XCB A;  4I98 B;  2A5Y B;  5J4V A;  1R1T A;  2VC1 A;  4B3A A;  1UG0 A;  4QIW N;  4CGZ A;  2BHY A;  1R4M B;  3ISP A;  2M45 A;  1GXP A;  4HX4 A;  1TW2 A;  3SDB A;  3OYA A;  2KZG A;  1BL0 A;  2BE5 F;  2FBI A;  2KMU A;  2NS7 A;  5AIQ A;  1Z67 A;  5F04 A;  2Y9Y A;  1GXQ A;  3ZXS A;  2KJC A;  1U3E M;  1S7E A;  4LLL A;  3CQZ J;  3WTS C;  2ME0 A;  2W57 A;  1B72 A;  1KQ0 A;  4JQF A;  4Y15 A;  3RIR A;  4ZYG A;  5FD6 A;  2VT2 A;  2JUG A;  2EPF A;  2QVO A;  2COM A;  3PFY A;  1KQ9 A;  2CWE A;  3TDZ C;  4IHY A;  2XB5 A;  2Y0S N;  3I53 A;  3VFZ A;  1POG A;  1ZH5 A;  2F5E A;  1TNS A;  2E19 A;  1VI0 A;  4FE4 A;  3U21 A;  4BEH A;  3ZQI A;  3W2A A;  3KE2 A;  2M7B A;  2A07 F;  1EH8 A;  1WVR A;  2M34 A;  5C4X J;  3VDX A;  5LGT A;  3O6B B;  4MIM A;  4R1H A;  3D5R C;  2ECC A;  4L9V A;  1YOV B;  1O3Q A;  5HDG A;  2JZY A;  4G12 A;  4D7N A;  5GPC A;  2A69 F;  1W4M A;  1MW7 A;  1QGP A;  3NWT A;  4KN7 X;  1TLH B;  1P4W A;  3IAS 2;  4LG3 A;  2Z33 A;  3GFJ A;  1H89 C;  5IT9 K;  2W48 A;  1R1V A;  1Z0X A;  2HU9 A;  1FTZ A;  1K83 J;  3FBI B;  5HDN A;  5CKT A;  3CP2 A;  1MJB A;  3K4K A;  2AHQ A;  2XKO A;  4M6X A;  2AS5 F;  3BJO A;  2CV1 A;  5JLW A;  1B8I A;  1LFB A;  5E3L A;  3DLA A;  1T56 A;  4F55 A;  5ICC A;  1RES A;  2VBZ A;  3KLN A;  4HNT A;  2EH3 A;  2PN6 A;  2STW A;  2VIX A;  1BC7 C;  2GAU A;  1BI1 A;  2EIL H;  2HWV A;  4RGU A;  3BRO A;  2MLG A;  3JRG A;  3HGY A;  3Q0W A;  4EM1 A;  2VQG A;  4ZTJ A;  3OYH A;  1ZG1 A;  2LC2 A;  1IN4 A;  1BIA A;  2F4O B;  1D0Z A;  3BR1 A;  1U9O A;  3BCA A;  2WY8 Q;  2KIQ A;  1W1W E;  2ZB9 A;  4BQN A;  1R58 A;  3K1P A;  1X2M A;  1XB4 A;  4U0V A;  2B7E A;  2IVM A;  1FBQ A;  2WAE A;  3AKZ A;  2VJ5 A;  2R7V A;  2V79 A;  3BR0 A;  1QZE A;  2E7W A;  1LQ1 A;  3ZMS A;  5C44 J;  3GYH X;  5D8K B;  5LEJ A;  2ZBK A;  1YX3 A;  3CO6 C;  4IHX A;  1XSV A;  3OWT A;  1W5S A;  4RA2 A;  2FRH A;  1BI2 A;  3CCQ I;  2VPR A;  3RQ4 A;  3FWE A;  2K5C A;  3PNT A;  5JHF A;  2XGX A;  1VQP I;  1ODD A;  4ZYA A;  2VPL A;  2VT3 A;  5F6F A;  3EPZ A;  3MMY B;  2VOD A;  1V55 H;  1KYZ A;  2O7O A;  4BE2 A;  2D45 A;  4HQM A;  1EKE A;  1YS7 A;  3CUQ A;  4XLH A;  3PSF A;  1WKM A;  3FKI J;  2H1L A;  3S93 A;  3OYD A;  3JRD A;  2EJR A;  2DFH A;  4KIT B;  4GRI A;  4A2U A;  5ILU A;  3J7Z I;  4A3E J;  3CCL I;  3FZV A;  1Y0U A;  2ACJ A;  1MZB A;  3K4B A;  2EIM H;  4CH7 A;  3I4M J;  5E1Z B;  5FLM J;  2RGV A;  3E6B A;  5IP6 A;  3ESW B;  3W2W A;  3K70 D;  1FBU A;  4BEH B;  2GM4 A;  3F21 A;  2CYY A;  2BY0 A;  3JTH A;  3V8J A;  2FMY A;  4JX6 A;  3BZC A;  2ICW G;  3BQZ A;  2IEK A;  2L7F P;  3IAM 2;  3KEO A;  4XID A;  3LSH A;  5FLX Z;  4ESF A;  2B9S A;  1Z21 A;  3F6V A;  3BQY A;  4MFE A;  1U0J A;  2W4S A;  3VYR B;  2E1C A;  1OYY A;  3HOT A;  1V3F A;  2CQN A;  3HZJ A;  3TW7 A;  4XM3 A;  1DDN A;  2LD5 A;  2OV7 A;  2WV0 A;  1FBS A;  1WH7 A;  3HM5 A;  1GV2 A;  3RCO A;  1B8I B;  4BBS J;  2R7U A;  1A6I A;  1D0X A;  1NG6 A;  4I02 A;  2KDZ A;  1H0M A;  3GTQ J;  3DEU A;  4RLF A;  4IHS A;  2E34 A;  4LGW A;  3U2R A;  1A31 A;  2A6E F;  2LFB A;  5KAF C;  1VQN I;  3G2B A;  3A02 A;  1OR7 C;  2MA3 A;  4KA4 A;  2XSD C;  3B02 A;  3RSN A;  1RUO A;  5E3M A;  4M9Z A;  2J5P A;  2EB7 A;  1XD7 A;  3BG9 A;  4EJV A;  2DA4 A;  2PMZ N;  4ANJ A;  3C18 A;  2BHZ A;  2FD5 A;  3REO A;  4BXU A;  2FU4 A;  3E6C C;  1HST A;  4IL6 C;  4BXF A;  5J8C A;  2J5O A;  2DLL A;  5J3L A;  1JJ6 C;  5CVR A;  4HF2 A;  2M8G X;  3OS2 A;  1FMV A;  4U87 A;  2FJ1 A;  4F7Z A;  4P9F A;  1HBX G;  5H2F C;  2EA2 A;  3G71 I;  3F72 A;  4OU0 A;  4D7M A;  1D5V A;  1WZ2 A;  1AHD P;  1FLI A;  3V4G A;  4RB2 C;  3IV5 A;  4BDZ A;  5E3N A;  2BEO A;  2HTS A;  2GIV A;  3KP7 A;  1W5T A;  2O5R A;  3M07 A;  1F9N A;  3EUA A;  3C3W A;  1JUP A;  3L2U A;  3WGH A;  5ICE A;  3HUG A;  2VKV A;  5D8L B;  3BY6 A;  3BG5 A;  5FKN A;  2EBI A;  2BV6 A;  2EFO A;  4L9N A;  4EV0 A;  3J81 Z;  3I71 A;  2IA2 A;  4PJ0 C;  2EZI A;  4PJL A;  5H20 A;  4KFC A;  3T8T A;  4CO8 A;  2NOJ B;  3CME I;  4O3M A;  2P81 A;  4II2 A;  2BW3 B;  3OIQ A;  2JA8 J;  4MFD A;  4M73 A;  2OZ6 A;  2MH2 A;  3VSK A;  4C3I J;  3LSJ A;  1RRJ A;  3HKZ N;  2E5Z A;  2IGN A;  4LOC A;  5TRD A;  1FC3 A;  4EJW A;  2RNG A;  4A3J J;  1ZGA A;  1X1C A;  3MQ0 A;  1WH5 A;  2OCC H;  1XSD A;  4RM3 A;  5ED4 A;  9ANT A;  2DOE A;  3QYF A;  3ECO A;  3OYI A;  4XNF A;  4N9H A;  1U9N A;  5LEK A;  5J4Y A;  3SJM A;  2DPD A;  3BC8 A;  1T2K A;  1MDM A;  5D4R A;  3DV8 A;  3E7L A;  3QRF F;  3S1Q J;  2VJI A;  3V7S A;  1LKX A;  3HOV J;  1XGS A;  4C2T A;  3OIO A;  1G3Y A;  2CMP A;  3ZN0 A;  4PJJ A;  1TT5 B;  4E7J A;  1SAU A;  3M3Y J;  1BI0 A;  3HTU A;  4RM2 A;  2HKX A;  3IKV A;  2VAS A;  1Y56 A;  3DKY A;  2G9W A;  3ZRG A;  2R7Z J;  4IRI A;  3WE3 A;  5ERI A;  1K6O A;  1LE8 A;  1K7A A;  2GA2 A;  3QAH A;  1XDU A;  4PUS A;  3O8H A;  1WJD A;  3CO7 C;  1W0T A;  3KET A;  3ASO H;  3LNQ A;  4E7Z A;  1G59 A;  1W7P A;  5FKK A;  4A0Z A;  4O6J A;  3ZOB A;  4MO7 A;  4RDU A;  3KCC A;  2AXL A;  2ZXI A;  4UVC A;  1ETQ A;  2CQX A;  2P7V B;  2F5V A;  2ZJ2 A;  3K6G A;  4C2U A;  1IXR C;  4H4K C;  5DV5 A;  1K79 A;  4RBO A;  4YEL A;  3VWB A;  2RQQ A;  3Q0U A;  3FM3 A;  2W85 A;  3KLO A;  5H6R A;  4FHT A;  3AL0 C;  2F4M B;  3GO5 A;  5EGO B;  1BR1 A;  5DUK A;  2ZJR F;  2YU3 A;  1Z77 A;  4GYI A;  2LSO A;  3C2H A;  4EM2 A;  1VQM I;  4G7Z F;  2IGK A;  2X1E A;  4BL0 B;  3GX4 X;  1TQM A;  4M3D A;  1T6S A;  4WXD A;  3EET A;  1O57 A;  3QQA A;  4XLN F;  4S0H B;  2ELJ A;  3CCY A;  4CYC A;  1BJZ A;  2ZXW H;  2DOA A;  3HUG B;  1A04 A;  2FNA A;  1IV6 A;  5TJJ A;  4IOA F;  2TDX A;  1MH3 A;  1YX5 A;  2AQE A;  2G7U A;  3SFI A;  4ZYH A;  1GUU A;  1VF9 A;  4JX5 A;  3EUH C;  2ZME C;  2L01 A;  5DS9 A;  3MKY B;  1DUX C;  3S3M A;  3C1D A;  2Q2E A;  4CZZ A;  2LF7 A;  2W82 A;  3RKY A;  4G7H F;  4PSX A;  3CC2 I;  3VOE A;  5EEA A;  1ZGW A;  4A6E A;  5L3C A;  2JVG A;  2MC4 A;  1PUF B;  2M8E A;  4M3G A;  4HST A;  2VI6 A;  4AU7 A;  4E70 A;  5D5V B;  1UHM A;  5C3E J;  2AXT C;  5JLX A;  4N9I A;  4NDL A;  2DDA A;  2E1O A;  3EQL F;  2JRT A;  2XUB A;  1OR7 A;  4PSW A;  1DU6 A;  2K4B A;  2P4W A;  3JW4 A;  2XRL A;  3GF2 A;  1IF1 A;  3BTC A;  1MDM B;  3J7Y J;  4G6D A;  1RKW A;  2LKP A;  3S17 J;  1GV5 A;  5IP9 J;  4XRS G;  3L2R A;  1BW5 A;  2F4I A;  3E5U A;  2DU9 A;  2CW8 A;  3DEE A;  2NYX A;  4KMF A;  2AO9 A;  2D2W A;  2V1X A;  2MSY A;  3C7J A;  4XRM A;  5DCF A;  3BG3 A;  4HAM A;  1U78 A;  3P9C A;  1U6G A;  4FIS A;  2X6X A;  5B1A H;  2E60 A;  1KZH A;  2DA6 A;  4C30 A;  2MAB A;  2P6T A;  2C6Y A;  4QLC U;  1W7P B;  2VON A;  2DYS H;  4BHP A;  2HYJ A;  1MH4 A;  3PSI A;  3ZCO A;  4EGY A;  2IRF G;  4WX9 A;  3B73 A;  1VQ8 I;  4L18 B;  2X1C A;  2D1H A;  3HHH A;  4AIK A;  3RZD J;  4D0P A;  5LHG A;  1VQ4 I;  4DZJ A;  2GXA A;  2DT7 B;  3MZ8 A;  3FHZ A;  3QPH A;  1N78 A;  2NVY J;  5F08 A;  1NHA A;  1U2W A;  4HF1 A;  4QPO A;  2ZKZ A;  2H09 A;  1MD0 A;  5J40 A;  5F64 A;  1IUY A;  3PIP F;  1VQ6 I;  4YII A;  2WV1 A;  1X1P A;  4RB1 A;  2BVM A;  2NVX J;  2YUS A;  1YTY A;  1IJW C;  4C2M J;  2JSC A;  4CYC B;  1X19 A;  2CG4 A;  4HA8 A;  3PQJ A;  4JP0 A;  2Q8K A;  3PO2 J;  4BXX J;  3P9I A;  4YFX F;  2DBB A;  2EFP A;  3HL2 A;  2ID6 A;  2EIJ H;  3R61 A;  1O3S A;  1J9I A;  5DYM A;  5F0C A;  3FXL A;  2RQP A;  3OOU A;  1XMX A;  3UR3 C;  5F0H A;  2ZO4 A;  5FRN A;  4A3C J;  3TED A;  2Q2E B;  1K6Y A;  2IP2 A;  2CJJ A;  2MH9 A;  3B6A A;  1TP4 A;  2XIG A;  2DFI A;  3CP8 A;  3MEX A;  5IT9 Z;  2VE8 A;  4ABZ A;  3E1S A;  5GTI C;  4TV7 A;  3GTP J;  2YU9 J;  3HGG A;  2DA5 A;  1BIB A;  2FQ3 A;  1D3Y A;  2O0Y A;  3H3V K;  1CGP A;  5CYV A;  4M72 A;  2YPR A;  1A36 A;  1TQP A;  1D5Y A;  4M3E A;  1KA8 A;  3MKL A;  3S3N A;  1A6Q A;  5FO5 A;  3ABM H;  2Q0O A;  1UFM A;  1LVA A;  2KIS A;  2MGQ A;  2W00 A;  4Y3O A;  3BTL A;  1X1A A;  4PZJ A;  4HF0 A;  4RMN A;  4V19 K;  3FKJ A;  4CUG A;  3LSP A;  4HDV A;  3H9J A;  3V7C A;  3FHN A;  4HDU A;  1QNT A;  1ITY A;  4HX8 A;  4LIT A;  5C4J J;  2K4J A;  1P4A A;  1O3R A;  2K9L A;  4XK4 A;  4HW0 A;  4UUV A;  4Q48 A;  2Z1D A;  3BDD A;  2MC3 A;  4JOM A;  1XPX A;  4PJM A;  4OWR B;  3KP2 A;  3ZGK A;  3FBN B;  3TQN A;  2VXD A;  4HYE A;  1UHW A;  4KIC A;  4QPQ A;  3GTK J;  2YR2 A;  1WI3 A;  4N0B A;  3HSF A;  3SZP A;  5ILS A;  1RIO H;  2LG4 A;  4S05 A;  3HG9 A;  1R9T J;  3TP0 A;  2DI3 A;  2GQQ A;  1F43 A;  1FIP A;  1BBY A;  4XBF A;  5D5W B;  1MMG A;  4I6Z A;  1MNM C;  1F36 A;  3WGG A;  2R92 J;  2WBM A;  1Y0N A;  3EUH A;  2ZME A;  2YX7 A;  4XOR A;  2IA0 A;  1P6R A;  4U88 A;  4I0A A;  5CPR B;  2PI0 A;  3H36 A;  3T0Y A;  4F93 B;  3CD6 I;  2ELK A;  2QA4 I;  1HSJ A;  3AFH A;  2K02 A;  3F22 A;  4LG0 B;  3IH2 A;  1WI9 A;  1VQL I;  2WWY A;  3HOW J;  2DW4 A;  1V54 H;  1RI7 A;  2LP0 A;  3FX3 A;  5E1W A;  3WTV C;  2O8X A;  2OUM A;  5LHI A;  1S8N A;  2K3F A;  3I5U A;  1A35 A;  2M30 A;  2YX4 A;  3K7A J;  1KU7 A;  3LMM A;  3BR6 A;  2JA2 A;  2CQ7 A;  2DQR A;  2Y30 A;  3J7A O;  2OF7 A;  1OYI A;  1W36 C;  4RGS A;  4IPA A;  1LFP A;  2VKD A;  4CYD A;  5E17 F;  3SZG A;  2RRE A;  1V5G A;  3CLQ A;  3S1M J;  3CJQ B;  3E3V A;  5CVU A;  1HW5 A;  2JRM A;  3E5Q A;  4A0X A;  3U1K A;  1J59 A;  2D1V A;  2L0K A;  4D5F A;  4A3I J;  2P0W A;  3U9G A;  2A05 A;  1E3P A;  2DMQ A;  4HLX A;  1VTN C;  4M6V A;  1FOY A;  2DO7 A;  1XS9 A;  3OYL A;  4CCO A;  5IY5 H;  1HW2 A;  1KON A;  3H0G J;  1XMA A;  3FK7 A;  2G7H A;  4BGD A;  3C2G A;  1AKH A;  2ZFU A;  3IH3 A;  2L5Q A;  2LBF B;  5FRO A;  1WJA A;  3M1E A;  5LHH A;  3K70 C;  2KQR A;  2V26 A;  2UWM A;  3IRR A;  1P9Q C;  3LSR A;  3CCE I;  1KQ8 A;  1ZG3 A;  4EVI A;  5TGT A;  3N05 A;  1FNN A;  4DGW B;  3L2V A;  2R7W A;  1O3T A;  3HOX J;  1K4S A;  5LGU A;  1RC9 A;  2XAH A;  4HZF A;  4DOZ A;  1BR4 A;  3DKX A;  2LY9 A;  4L0Y B;  2OU2 A;  1F1Z A;  2XVC A;  3SXY A;  2W25 A;  4Z2Y A;  5J47 A;  3GZN B;  2O9L A;  4NHJ A;  1SMY F;  2PG4 A;  3S2W A;  3X2Q H;  4E7S A;  3KZZ A;  2FSW A;  4WWC A;  5F1R A;  3M8E A;  1MIJ A;  1P7J A;  2MG4 A;  1X2N A;  4PK4 A;  4B3X A;  4IHV A;  1L0O C;  5TIS C;  4BY7 J;  1SFU A;  1VND A;  2LMD A;  4W1U A;  2UXN A;  2H27 A;  2R7X A;  3FIW A;  4JBA A;  4WXC A;  3K0L A;  1ACI A;  3K4C A;  1CF7 B;  4YEJ A;  5K7F A;  4XN0 A;  4N4O B;  3WTZ A;  3D0S A;  3MZH A;  1GVD A;  2R7D A;  4RAZ A;  4EGZ A;  5ICG A;  1I1G A;  2Y0M A;  2XGD A;  1UZC A;  4A3B J;  1WJ5 A;  2QSH X;  1HCR A;  4EJU A;  1U5T A;  1YYV A;  5M5W J;  1LFU P;  4J00 A;  3AG3 H;  2M4G A;  3PUF A;  4UV9 A;  4B1R A;  2HVS A;  4J01 A;  3DPU A;  2BY1 A;  4L0Z B;  1DPU A;  2LDU A;  4Q5S F;  2PMU A;  1RET A;  5IOY A;  1R5H A;  2W84 A;  2BYV E;  3KYC B;  4RAG A;  1WJE A;  4FX0 A;  4I99 C;  2FNP A;  2LYC A;  2OAZ A;  2EZL A;  2XSJ C;  3S3O A;  2V4J C;  2M87 A;  2L4M A;  2D5V A;  1ON2 A;  1TTY A;  1TW3 A;  2KHM A;  2QGU A;  3KZY A;  2ISZ A;  1FSH A;  1VZ0 A;  2Z2S B;  2STT A;  2M0C A;  2R5Z A;  2OA4 A;  2RVC A;  2VB6 A;  2IJL A;  2KP6 A;  2HQR A;  2BVL A;  3LA7 A;  1OCT C;  2PMZ A;  1HOM A;  3ZN1 A;  3OYK A;  3G6E I;  3HIF A;  3DPL C;  1S5L C;  2GXB A;  1P4X A;  1FT9 A;  1NK3 P;  3NAR A;  4AYB N;  1QPM A;  2BOL A;  2WB1 A;  2CS3 A;  2VC0 A;  3H5A A;  2HS5 A;  4XLE A;  1ZN2 A;  5B66 C;  1AKH B;  2H94 A;  3EYI A;  4MTE A;  2A61 A;  3GTL J;  1IGN A;  1I3A A;  1WPK A;  3ZQF A;  2H8W A;  5ICF A;  1IC8 A;  2GOX B;  3IUO A;  4R79 A;  1B72 B;  4FQG A;  2Y2Z A;  3IWF A;  3CTA A;  3J80 K;  1EF4 A;  1V5E A;  3GFM A;  2UXX A;  2HPM A;  1B59 A;  5JHU A;  4I2O A;  2LY2 A;  4X1E A;  3U1D A;  3L1P A;  1WCM J;  3MD2 A;  4IHW A;  2E1M C;  4FET A;  1S9H A;  3MKZ A;  1W5C C;  2DTZ A;  1KYW A;  2LNB A;  4DBR A;  3P5J A;  3H5N A;  1D1A A;  1I5Z A;  2JT1 A;  2DCE A;  1FJL A;  4IKF A;  3GME A;  4BAC A;  2X6Y A;  2B0L A;  1I6H J;  3LA3 A;  5E8G A;  2P6S A;  4BE1 A;  2RKH A;  3OYM A;  4X0G A;  4L9J A;  3OL4 A;  4CCM A;  1G8X A;  4EM0 B;  2QBY A;  2MFZ A;  4OIP F;  3H9Q A;  4PFO A;  1EA3 A;  4A3D J;  3M8J A;  3TL4 X;  1IRF A;  3SEQ A;  2A6T A;  2ZSI B;  1UJ8 A;  4I01 A;  1MMN A;  2K9M A;  2XV4 S;  2F5D A;  3VYT B;  1Y1W J;  3A4C A;  4HNV A;  1V5F A;  2EV5 A;  1MSE C;  1U5T B;  2RV8 A;  2P5K A;  4U7B A;  4IJA A;  3L7W A;  3V8L A;  5JR3 A;  4XRF A;  1DGW Y;  3T8R A;  2VKH A;  5GTH C;  3CCS I;  3ZQG A;  3CCJ I;  1BM9 A;  4U7D A;  2EQR A;  3S1R J;  4PFP A;  3GFL A;  4IQ4 A;  1T0F C;  3DU6 A;  1Q1H A;  3A1Y A;  2L7Z A;  3I55 I;  1X3U A;  2DA7 A;  2CUF A;  2HFH A;  3F8F A;  3EYY A;  3MVP A;  1T33 A;  1SFE A;  3W6K B;  5H6Q A;  1HA8 A;  2M7A A;  2LRE A;  3SFZ A;  1MMD A;  4D1Q A;  1FIA A;  4UV8 A;  4YIR X;  3E0J B;  2VKE A;  3BR2 A;  1BA5 A;  5L3G A;  2L2O A;  3PFI A;  1PYV A;  2EWN A;  3WTY C;  3NQO A;  2M5W A;  4IZZ A;  2LVS A;  1MBH A;  3O2P E;  3QPS A;  4DYR A;  4LFU A;  3HOY J;  3WU2 C;  2K9S A;  3HJE A;  5IYC J;  2X1D A;  3KZI C;  4J19 A;  1AWC A;  3W3C A;  2XPU A;  2KL4 A;  3ABU A;  3JCU C;  5DCM A;  2H6C A;  5EZH A;  3RPU A;  3GZ6 A;  4KNY A;  2DK8 A;  3L09 A;  4E7K A;  5F27 A;  3OS0 A;  2WC2 A;  4DW6 A;  1J0R A;  2G0E A;  3GFI A;  3OYF A;  1JHH A;  3CUQ B;  3FMS A;  2ELH A;  4P5O A;  4S04 A;  3CJT B;  4UXN A;  3GCM A;  4E7L A;  3G3Z A;  5K5Q A;  3W6V A;  2WTE A;  1MBF A;  4WXH A;  2DOF A;  4OIR F;  4LMY A;  2MBF A;  1ZR4 A;  1IUF A;  2XAU A;  3K1N A;  1QU3 A;  1JT6 A;  1WFX A;  4E6K G;  1Z91 A;  2VBW A;  5K7Z A;  1OKR A;  1UHS A;  3DBH B;  4KYW A;  3TOB A;  1HW1 A;  3LSM A;  2H8R A;  3ZQL A;  3MN2 A;  4OAZ A;  1WJB A;  1W7P D;  3KX2 A;  4CCN A;  3K4N A;  2X51 A;  1YRN A;  3DBL B;  4KT6 A;  1DPR A;  2WAQ N;  1ETW A;  3I64 A;  3RDI A;  3HXL A;  3LFK A;  3QYB A;  1SVO A;  2JTV A;  2L02 A;  2GBY A;  1E3O C;  5CVI A;  1QRY A;  1G3S A;  2YSR A;  4WCG A;  4RGX A;  2QBY B;  5DD8 A;  1OQY A;  3BZ6 A;  3Q9V A;  2XAJ A;  3ZMZ A;  2HXI A;  2E5N A;  6PAX A;  3HRU A;  1WJC A;  4CCL A;  1G2H A;  3NEU A;  2LLK A;  5AIP A;  4G6T B;  2V6C A;  4YG2 F;  1ZAR A;  3J7A Y;  2KIM A;  2E2J J;  1XG1 A;  1BW6 A;  2M2E A;  3CJN A;  3WHB A;  1FOK A;  2GIZ A;  4OMZ A;  3WHC A;  2PBI A;  1OJL A;  2HR3 A;  4E7I A;  1LPQ A;  4U0Y A;  2LY1 A;  2K27 A;  2KRF A;  4KUM A;  2CW0 F;  3L00 A;  3HBL A;  2QYO A;  1QVU A;  3CZ6 A;  3GVA A;  1X4O A;  3GTM J;  1BN5 A;  4NUB A;  5IOZ A;  4E7H A;  5GPA A;  1TNT A;  2Z5U A;  4HPQ A;  4B48 A;  4C3H J;  4L9T A;  4OIO F;  5FB2 A;  1SD5 A;  3SQN A;  5EEH A;  4ZZL A;  2KRC A;  2Z99 A;  2V6E A;  1DP3 A;  4A3F J;  2IS2 A;  4RB3 C;  1ULY A;  3OV8 A;  3JTG A;  4M6Y A;  1RKT A;  4IF4 A;  2KT0 A;  2Y31 A;  3EDP A;  1TWF J;  2WY7 Q;  4A3M J;  4YIF A;  4BAY A;  3IH4 A;  4FT8 A;  1TC3 C;  4KN4 X;  1Z9C A;  1ZKG A;  1ZK8 A;  1ZR2 A;  3OYC A;  4KT5 C;  1QA6 A;  3HDD A;  4EJT A;  3FIS A;  1LDJ A;  5HOD A;  3CC7 I;  5DCM B;  3ABT A;  1TWG J;  3QYE A;  2Y48 A;  3GTJ J;  2IBD A;  4AVZ A;  4DBQ A;  4UUT A;  4KIB A;  5KAI C;  3QOD A;  4XIC A;  2DYR H;  2W1O A;  3IKT A;  5FD5 A;  1XTA A;  2XRN A;  2MD0 A;  4HSR A;  5D6E A;  5FGM A;  4CZC A;  2RAE A;  2EA4 A;  2LKX A;  3PUB A;  2ESH A;  3S14 J;  4IHT A;  2CQQ A;  1H88 C;  3MWM A;  4EEF G;  4BUP A;  1SC7 A;  3TO7 A;  5J8F A;  3RQI A;  3BOQ A;  1SVL A;  3S1N J;  3IL2 A;  4P9U A;  2K9Q A;  3FXR A;  2Y69 H;  5JFR A;  2L9V A;  4OMY A;  3R6S A;  3KP6 A;  2DK5 A;  3L2C A;  2DN0 A;  2FF4 A;  2FXA A;  3DTE A;  2PFB A;  3OYB A;  1FYK A;  2HOE A;  5L3E A;  2R3S A;  2TRT A;  3RKX A;  1J2X A;  3G73 A;  4IRH A;  2ID3 A;  3IWZ A;  4CSW A;  2FQ4 A;  4HOB A;  2R0Q C;  4GO1 A;  3I4P A;  3BTI A;  1S29 A;  4LIV A;  1IO2 A;  3KIO A;  1S3J A;  1T0F A;  4MTD A;  3DEW A;  2I5U A;  4A5M A;  2BY3 A;  2O3F A;  1LNW A;  5F1J A;  3BR5 A;  3MZY A;  3E5X A;  2CGP A;  3DCF A;  1MGT A;  4UVB A;  5B1B H;  1SEU A;  2F5C A;  4NC6 A;  1LDK B;  2HDD A;  1R22 A;  4XON A;  5D6F A;  4IXA A;  3LAP A;  2E2I J;  2FE3 A;  2R7Q A;  5IPA A;  4ESB A;  2X85 A;  3M9A A;  4AIJ A;  2CFO A;  3Q3S A;  4XRS A;  4G6Q A;  1REP C;  3K1M A;  2CUJ A;  4M3B A;  4AIH A;  4B47 A;  2DMU A;  1LE8 B;  4ZDP A;  2K9N A;  1U8R A;  2HKO A;  2CRG A;  2ADU A;  3FM5 A;  4CCK A;  4JK1 X;  1SAX A;  1O7F A;  3M1C A;  2LRD A;  1VQK I;  1ZRE A;  3I4N J;  4HBL A;  3I58 A;  5J1U A;  3S2H J;  1OYW A;  4UHT A;  1KU3 A;  2I10 A;  1ZG5 A;  1J5Y A;  5E3O A;  4B09 A;  1JKO C;  3L2W A;  4BJT A;  1Y1V J;  2FA5 A;  3ECH A;  3M8F A;  1IN5 A;  2VJ4 A;  3SEZ A;  2LTP A;  1K4T A;  1IDY A;  2DFF A;  2PLY A;  5D4S A;  4F92 B;  4XSX F;  3WE2 A;  4F91 B;  1LVK A;  3K4M A;  1XX5 A;  5KNL A;  1G4D A;  4UB6 C;  3DWL E;  2R7O A;  4ETS A;  4BQQ A;  2DQL A;  2KJB A;  2ME6 A;  1FX7 A;  2DAO A;  3BLY A;  5M3F J;  4L5I A;  1ZGJ A;  1JKQ C;  1MJA A;  3I59 A;  2HQ5 A;  2V1N A;  4CHU A;  4BQA A;  4EMS A;  1EV7 A;  2M3A A;  1YJN I;  5K5O A;  1MBJ A;  1S72 I;  1YIO A;  2LKS A;  2M0M A;  1FEX A;  2MLK A;  2KKO A;  1G3T A;  2CUE A;  3OR2 C;  3V7R A;  2PJR A;  2NVQ J;  2FML A;  3TW6 A;  1WJF A;  5FKL A;  4UUS A;  1Z7L A;  1G3W A;  3CJR B;  4A93 J;  3OSG A;  4LB5 A;  3AAF A;  3NAU A;  1ENH A;  3HPG A;  4GGG A;  4XR6 A;  3ZP5 A;  1RUN A;  1YO5 C;  5JI6 A;  1T98 A;  3TO9 A;  3JAM K;  3CLO A;  3BPV A;  4I09 A;  3OL3 A;  4Y17 A;  3W2V A;  2XAF A;  1I6X A;  3Q9S A;  3F8M A;  3TKY A;  2R5Y A;  1HLV A;  3GTO J;  3F9K A;  3DXJ F;  2QLZ A;  3LL7 A;  3CCU I;  1TQI A;  3GBG A;  3WG9 A;  4ZC3 A;  4P1W A;  1XC5 A;  5BNG A;  2R7R A;  1UEL B;  4HG2 A;  2VQC A;  3G1O A;  4CXF A;  3BWG A;  1XGO A;  3DTI A;  1N25 A;  2A5W A;  5KK1 A;  3RPQ A;  1EH7 A;  2R93 J;  4B4C A;  3RKW A;  3FXU A;  5J6X A;  4Q4Z F;  3F23 A;  3BR3 A;  1OCC H;  2FOW A;  1QHH D;  2ESN A;  3AG1 H;  4JYK A;  1ZLK A;  3A2K A;  2JJ7 A;  2L9R A;  1QZZ A;  1GT0 C;  2Z9O A;  1FP2 A;  2Y0S A;  2MD5 A;  4KDP A;  5GAG J;  3TMO A;  1JHF A;  2UZK A;  5HNH A;  2JA7 J;  1FPQ A;  2ZJQ F;  1MSF C;  3ZMV A;  1I27 A;  1OCO H;  4ENM A;  2QEN A;  3RKQ A;  4XOP A;  3ELK A;  3PIO F;  3HTS B;  2IS1 A;  4F3Q A;  1I1S A;  2ZJP F;  1BOA A;  4BDY A;  2HOT A;  2FBH A;  1UB9 A;  1IN6 A;  5EZG A;  1HXD A;  1SAN A;  4E4H A;  3T5X A;  1IXC A;  3H92 A;  3HEF A;  1OLT A;  2HTJ A;  2BY2 A;  4D5C A;  1TT0 A;  4OIQ F;  2X6O A; 
#chains in the Genus database with same CATH homology
 5IT3 A;  3ULQ B;  1SD6 A;  4HV6 A;  5L3F A;  3WTU C;  3J80 Z;  3QU3 A;  3FF5 A;  5DEQ A;  4AD9 A;  3DQV C;  1FWZ A;  4AWX B;  1STZ A;  4ASN A;  4RB0 A;  2E1N A;  2JPC A;  1Z1D A;  1YFH A;  1D8K A;  3I59 B;  2W24 A;  4U0W A;  5ILV A;  4Q47 A;  2QZ8 A;  3K69 A;  2P8T A;  2QQ9 A;  4A0Y A;  4IVN A;  1QBJ A;  5HS7 A;  2GWR A;  3K2Z A;  2ZFW A;  3L9F A;  3W6J B;  1PUE E;  5HS8 A;  3Q5F A;  1O7L A;  2RC4 A;  4MQV A;  2O03 A;  4P96 A;  4ZYD A;  1P2F A;  3P7N A;  1R1U A;  5HLI A;  1Z6R A;  1R7J A;  3IRQ A;  1R00 A;  4LLN A;  4LD5 A;  1H9T A;  3F8C A;  3DPT A;  2QQA A;  2RN7 A;  2GZW A;  3MFK A;  1SMT A;  4GYG A;  2K7L A;  5L3B A;  2XAS A;  4CDG A;  1HKQ A;  4DQ2 A;  1P92 A;  1S7A A;  3SZT A;  2GA1 A;  1SD4 A;  1XSX A;  3O3K A;  3VOD A;  3OOP A;  4HV5 A;  4R8H A;  1ZLJ A;  4BHC A;  3HYI A;  4BNC A;  3HSE A;  1JXS A;  2PEX A;  5AON A;  1LDD A;  1DP7 P;  3TO6 A;  2ZME B;  3RI4 A;  3HOS A;  2RNJ A;  3WTW C;  3KFW X;  1B9N A;  3I54 A;  2NNY A;  4H0E A;  4OOI A;  1K78 A;  3CUO A;  2F5F A;  2VE9 A;  5FFX A;  2EV6 A;  4MHG A;  1F5T A;  4GXO A;  4KIG A;  3H3Z A;  1Z05 A;  4BHB A;  1E17 A;  3DFG A;  1ON1 A;  4ZZD A;  4LB6 B;  2H6B A;  3MAJ A;  2ZCW A;  1WSU A;  5JVT A;  1J75 A;  2X4H A;  1Z7U A;  1KU2 A;  2R7F A;  2JPB A;  3TDU C;  2OZU A;  3WGI A;  5LRS A;  1FSE A;  4NQW A;  4CIC A;  1Z6T A;  3HSR A;  3WU1 B;  2P5L C;  3HHG A;  2QWW A;  5E1X A;  5E20 A;  5HVQ C;  4ZYE A;  2IA1 A;  5KVR A;  4EJO A;  5LBQ A;  2KIU A;  5K5R A;  4ENJ A;  2O61 A;  2RDP A;  1G6N A;  3RTR A;  4GCV A;  1IN7 A;  3WTT C;  4PDK A;  2OD5 A;  3NRV A;  5BS6 A;  5HS9 A;  1XGM A;  4PCQ A;  1FY7 A;  4Y13 A;  1QO0 D;  1PDN C;  3WU0 A;  2ISY A;  1ZRC A;  1MJ9 A;  4DNC A;  3CDH A;  3SHF A;  2ETH A;  1XCV A;  4LJZ F;  1BJA A;  1OMI A;  1K78 B;  4UNO A;  1T38 A;  3QP5 A;  3E6M A;  4BH9 A;  3R0J A;  3BPX A;  3LST A;  3COA C;  1IW7 F;  4LLG F;  3KP5 A;  2OQG A;  2VN2 A;  1YG2 A;  2FOK A;  4A5N A;  2ZXJ A;  3F8N A;  4HX7 A;  2EK5 A;  1XDS A;  2XHK A;  3K9T A;  4YFK F;  1WRJ A;  4HLY A;  2O6G E;  2DT5 A;  4M71 A;  2HGC A;  5LLQ A;  2OBP A;  1F4K A;  2ZNY A;  2IT0 A;  5BPD A;  1GVJ A;  1QQI A;  4KIF A;  2EFW A;  3R60 A;  5BOX A;  1JGS A;  3BP8 A;  1IZ1 A;  3GEZ A;  3F8B A;  1QZY A;  5DUI A;  1ZAO A;  4PGG A;  2M1B A;  3GUD A;  2GXG A;  5HOO A;  5A2Q Z;  1GHC A;  1YW7 A;  1LEB A;  3ZQ7 A;  2FEZ A;  2ZNZ A;  3QU6 A;  1C0W A;  5LGN A;  5HLG A;  2NNN A;  3HRS A;  2VBY A;  2VXZ A;  4MNU A;  2VOO A;  5HLH A;  2HDC A;  4LK1 F;  3DP7 A;  3RYR A;  2BGC A;  2NAZ A;  1YLF A;  3LA2 A;  4WF2 A;  3E6D A;  2DTR A;  2P5V A;  5E18 F;  1WQ2 A;  2A3S A;  4I0B A;  4ON0 A;  4G94 A;  4I7H A;  1B4A A;  4AVP A;  1JE8 A;  1ZYR F;  2K86 A;  4K2E A;  1HQC A;  1XMK A;  3KP3 A;  5CLS A;  3GXO A;  3RJP A;  2PQ8 A;  3JAM Z;  3JSP A;  5CJ9 A;  3WOD F;  3ZMT A;  5CVV A;  3LQR A;  5EEG A;  5K1Y A;  5D5X B;  1OPC A;  4RGR A;  1LB2 A;  3IC7 A;  1PP7 U;  2NS0 A;  2BBY A;  1FZP B;  3LQQ A;  5FLX K;  2A68 F;  2EFN A;  3PQK A;  1YQA A;  3ROU A;  3E97 A;  1BI3 A;  4XLP F;  5BPI A;  1ZRF A;  3KP4 A;  2NRA C;  2IW5 A;  3QOP A;  5CVJ A;  1R36 A;  3ZPL A;  3F6O A;  5DD4 A;  1TBX A;  1KGS A;  1B1B A;  1FP1 D;  2L4A A;  1RNL A;  1RZ4 A;  2L54 A;  3MCZ A;  1T39 A;  2F2E A;  3HRM A;  1D8J A;  3V8K A;  3BJA A;  4RAY A;  2CFX A;  4ENN A;  4KMU X;  1B6A A;  2XAG A;  1WWX A;  5E8I A;  1KU9 A;  4P55 A;  5BMZ A;  1XN7 A;  2V9V A;  4A12 A;  4XSZ F;  2HEO A;  1LJ9 A;  3FMR A;  1ZRD A;  5A2Q K;  2QM3 A;  3VB2 A;  2V1D A;  2QQB A;  3J81 K;  1E2X A;  2FBK A;  4O5V A;  2X0L A;  2HZT A;  3P9K A;  3F3X A;  1EH6 A;  4PGH A;  2IPQ X;  4M74 A;  3KEQ A;  4MEX F;  1S6L A;  3BJ6 A;  1HKS A;  1AOY A;  1LEA A;  2E7X A;  2L3D A;  2OQR A;  4QWQ A;  5FFZ A;  2CSO A;  2VBX A;  1UCR A;  1IN8 A;  1FYL A;  4LG0 A;  3I0T A;  2EV0 A;  2XRO A;  1PP8 F;  1YS6 A;  3ZMD A;  4FX4 A;  1IAW A;  2A6H F;  4M9S A;  3QP6 A;  2V1U A;  2HQN A;  2DPU A;  4MQ9 F;  4B8X A;  5D5U B;  1U5T C;  3D5L A;  3GW2 A;  3M7G A;  3IHU A;  4MEY F;  4NB5 A;  4L5J A;  2XKP A;  3GZ5 A;  4LK0 F;  1R23 A;  2PMH A;  1IXS B;  3TGN A;  3GWZ A;  1HKT A;  2LF8 A;  3DF8 A;  5LRR A;  3N4M A;  1UST A;  1B9M A;  2VOP A;  1USS A;  1YW9 A;  3JSO A;  4HQE A;  2KIF A;  2CQK A;  4G8X A;  3ERE D;  2EFQ A;  2QUF A;  4ENK A;  1ZHF A;  1MKM A;  4YFN F;  1SFX A;  3WTX C;  3FXQ A;  4IRG A;  4EQQ A;  1XGN A;  2P7C B;  3H3U A;  3CUQ C;  3N97 A;  4MGR A;  2XAQ A;  4G9Y A;  3QPT A;  4OIN F;  1CF7 A;  3T1B A;  3HRT A;  3GLX A;  3ML6 A;  4A6D A;  3DKW A;  1BC8 C;  3ZMU A;  4M9X A;  5L3D A;  1YW8 A;  2Z3Y A;  1SD7 A;  1J7K A;  3R0A A;  3LAJ A;  5HDK A;  4BYY A;  3LWF A;  2PJP A;  4G7O F;  1S7O A;  3R4K A;  2HYG D;  3FMQ A;  1FYM A;  1IRG A;  4ZH4 F;  3VEP A;  5BQT A;  2CO5 A;  1ONV A;  3RYP A;  3TOA A;  2HYF A;  4ESJ A;  4RS8 A;  5DDG A;  2Y75 A;  4WK8 F;  1L3L A;  1V4R A;  1H9G A;  1R5G A;  4UVA A;  1XCB A;  4I98 B;  2A5Y B;  1R1T A;  2VC1 A;  4CGZ A;  3ISP A;  2M45 A;  1GXP A;  4HX4 A;  1TW2 A;  2BE5 F;  2FBI A;  5AIQ A;  1GXQ A;  2KJC A;  1U3E M;  4LLL A;  3WTS C;  2W57 A;  1KQ0 A;  4JQF A;  4Y15 A;  3RIR A;  4ZYG A;  5FD6 A;  2VT2 A;  2QVO A;  2COM A;  1KQ9 A;  2CWE A;  3TDZ C;  3I53 A;  3VFZ A;  1ZH5 A;  2F5E A;  1TNS A;  3KE2 A;  2A07 F;  1EH8 A;  5LGT A;  3O6B B;  4R1H A;  4L9V A;  1O3Q A;  5HDG A;  2JZY A;  2A69 F;  1W4M A;  4KN7 X;  1QGP A;  1TLH B;  1P4W A;  2Z33 A;  5IT9 K;  3GFJ A;  1R1V A;  5HDN A;  1MJB A;  4M6X A;  2XKO A;  2AS5 F;  3BJO A;  5ICC A;  2VBZ A;  3KLN A;  2PN6 A;  2STW A;  1BC7 C;  2GAU A;  1BI1 A;  2HWV A;  4RGU A;  3BRO A;  2MLG A;  4EM1 A;  1ZG1 A;  1IN4 A;  1BIA A;  1R58 A;  3K1P A;  1XB4 A;  4U0V A;  2IVM A;  1FBQ A;  2V79 A;  2E7W A;  1LQ1 A;  3ZMS A;  3GYH X;  5D8K B;  5LEJ A;  2ZBK A;  3CO6 C;  1XSV A;  1W5S A;  2FRH A;  1BI2 A;  3FWE A;  2XGX A;  1ODD A;  2VT3 A;  5F6F A;  2VOD A;  1KYZ A;  2D45 A;  4HQM A;  1YS7 A;  3CUQ A;  1WKM A;  2EJR A;  4A2U A;  5ILU A;  3FZV A;  1Y0U A;  2ACJ A;  1MZB A;  5E1Z B;  2RGV A;  3E6B A;  1FBU A;  3F21 A;  2CYY A;  3JTH A;  3V8J A;  2FMY A;  3KEO A;  5FLX Z;  4ESF A;  3F6V A;  2E1C A;  1OYY A;  3HOT A;  1V3F A;  1DDN A;  2WV0 A;  1FBS A;  4I02 A;  1H0M A;  3DEU A;  4IHS A;  4LGW A;  3U2R A;  2A6E F;  2MA3 A;  4KA4 A;  3B02 A;  1RUO A;  4M9Z A;  2J5P A;  2EB7 A;  1XD7 A;  4EJV A;  3C18 A;  3REO A;  4BXU A;  2FU4 A;  3E6C C;  1HST A;  5J8C A;  2J5O A;  2DLL A;  4HF2 A;  5CVR A;  4F7Z A;  4P9F A;  1HBX G;  2EA2 A;  3F72 A;  4OU0 A;  1D5V A;  1FLI A;  3V4G A;  4RB2 C;  2BEO A;  2HTS A;  2GIV A;  3KP7 A;  1W5T A;  1F9N A;  3C3W A;  3WGH A;  5ICE A;  3HUG A;  5D8L B;  3BY6 A;  2BV6 A;  2EFO A;  4L9N A;  4EV0 A;  3J81 Z;  3I71 A;  2IA2 A;  5H20 A;  4KFC A;  3T8T A;  4CO8 A;  4O3M A;  4M73 A;  2OZ6 A;  2MH2 A;  5TRD A;  1FC3 A;  4EJW A;  1ZGA A;  3MQ0 A;  1XSD A;  5ED4 A;  3ECO A;  4N9H A;  5LEK A;  2DPD A;  1T2K A;  1MDM A;  5D4R A;  3DV8 A;  3QRF F;  3V7S A;  1XGS A;  1G3Y A;  3ZN0 A;  1BI0 A;  3HTU A;  2HKX A;  3IKV A;  2G9W A;  4IRI A;  3WE3 A;  5ERI A;  1K6O A;  1K7A A;  2GA2 A;  3QAH A;  1XDU A;  3CO7 C;  3KET A;  1W7P A;  4A0Z A;  4O6J A;  3KCC A;  2AXL A;  4UVC A;  2P7V B;  2ZJ2 A;  1IXR C;  5DV5 A;  1K79 A;  5H6R A;  3FM3 A;  2W85 A;  3KLO A;  4FHT A;  3GO5 A;  5DUK A;  2YU3 A;  4GYI A;  2LSO A;  4EM2 A;  4G7Z F;  3GX4 X;  1TQM A;  1T6S A;  4WXD A;  3EET A;  1O57 A;  4XLN F;  1A04 A;  2FNA A;  5TJJ A;  2TDX A;  2G7U A;  4ZYH A;  2L01 A;  1DUX C;  3C1D A;  2Q2E A;  4CZZ A;  2LF7 A;  3RKY A;  4G7H F;  3VOE A;  4A6E A;  5L3C A;  2M8E A;  4E70 A;  5D5V B;  1UHM A;  4N9I A;  3EQL F;  2JRT A;  2XUB A;  1OR7 A;  2K4B A;  2P4W A;  3JW4 A;  3GF2 A;  1IF1 A;  1MDM B;  4G6D A;  2LKP A;  3E5U A;  2DU9 A;  2NYX A;  4KMF A;  2D2W A;  2V1X A;  3C7J A;  5DCF A;  4HAM A;  1U78 A;  3P9C A;  1U6G A;  2P6T A;  2C6Y A;  4QLC U;  1W7P B;  2VON A;  4BHP A;  4EGY A;  2IRF G;  4WX9 A;  3B73 A;  4L18 B;  2D1H A;  3HHH A;  4AIK A;  4D0P A;  5LHG A;  3FHZ A;  3QPH A;  1NHA A;  1U2W A;  4HF1 A;  2ZKZ A;  2H09 A;  1MD0 A;  5F64 A;  1IUY A;  4YII A;  4RB1 A;  1YTY A;  2JSC A;  2CG4 A;  4HA8 A;  2Q8K A;  3PQJ A;  3P9I A;  4YFX F;  2EFP A;  2DBB A;  3R61 A;  1O3S A;  1J9I A;  5DYM A;  2RQP A;  2ZO4 A;  2IP2 A;  2MH9 A;  2XIG A;  2DFI A;  3MEX A;  5IT9 Z;  2VE8 A;  4TV7 A;  1BIB A;  2FQ3 A;  1D3Y A;  2O0Y A;  1CGP A;  5CYV A;  4M72 A;  2YPR A;  1TQP A;  1KA8 A;  5FO5 A;  1UFM A;  2Q0O A;  1LVA A;  4PZJ A;  4HF0 A;  4HDV A;  3V7C A;  4HDU A;  1QNT A;  4HX8 A;  2K4J A;  1P4A A;  1O3R A;  4HW0 A;  4UUV A;  4Q48 A;  3BDD A;  2MC3 A;  3KP2 A;  3TQN A;  4HYE A;  1UHW A;  4KIC A;  2YR2 A;  4N0B A;  3HSF A;  3SZP A;  5ILS A;  1RIO H;  4S05 A;  2DI3 A;  2GQQ A;  1BBY A;  4XBF A;  5D5W B;  3WGG A;  3EUH A;  2ZME A;  2YX7 A;  2IA0 A;  1P6R A;  4U88 A;  4I0A A;  2PI0 A;  3T0Y A;  1HSJ A;  2K02 A;  3F22 A;  4LG0 B;  1WI9 A;  2WWY A;  2DW4 A;  1RI7 A;  3FX3 A;  5E1W A;  3WTV C;  2O8X A;  5LHI A;  1S8N A;  3I5U A;  2M30 A;  2YX4 A;  1KU7 A;  2DQR A;  3J7A O;  1OYI A;  4RGS A;  4IPA A;  4CYD A;  5E17 F;  3E3V A;  5CVU A;  1HW5 A;  3E5Q A;  4A0X A;  1J59 A;  2D1V A;  3U9G A;  4HLX A;  1VTN C;  2DO7 A;  1HW2 A;  1XMA A;  2G7H A;  3M1E A;  5LHH A;  2UWM A;  3IRR A;  1KQ8 A;  1ZG3 A;  4EVI A;  1FNN A;  1O3T A;  5LGU A;  2XAH A;  4HZF A;  4L0Y B;  2OU2 A;  1F1Z A;  2XVC A;  3SXY A;  2W25 A;  4Z2Y A;  4NHJ A;  1SMY F;  2PG4 A;  3S2W A;  3KZZ A;  2FSW A;  4WWC A;  5F1R A;  3M8E A;  1L0O C;  1SFU A;  2UXN A;  2H27 A;  4JBA A;  4WXC A;  3K0L A;  1CF7 B;  3WTZ A;  3D0S A;  3MZH A;  2R7D A;  4RAZ A;  4EGZ A;  5ICG A;  1I1G A;  2Y0M A;  4EJU A;  1U5T A;  1YYV A;  4UV9 A;  4L0Z B;  1DPU A;  2LDU A;  4Q5S F;  2PMU A;  1R5H A;  2W84 A;  2BYV E;  4FX0 A;  2FNP A;  2OAZ A;  2M87 A;  2L4M A;  1ON2 A;  1TTY A;  1TW3 A;  3KZY A;  2ISZ A;  1FSH A;  2STT A;  2OA4 A;  2RVC A;  2IJL A;  2HQR A;  3LA7 A;  3ZN1 A;  3HIF A;  3DPL C;  2GXB A;  1P4X A;  1FT9 A;  1QPM A;  2VC0 A;  2HS5 A;  1ZN2 A;  2H94 A;  3EYI A;  4MTE A;  2A61 A;  5ICF A;  4R79 A;  3IWF A;  3CTA A;  3J80 K;  3GFM A;  2UXX A;  1B59 A;  5JHU A;  4I2O A;  3U1D A;  1KYW A;  2LNB A;  1I5Z A;  2JT1 A;  2B0L A;  3LA3 A;  5E8G A;  2P6S A;  2RKH A;  4L9J A;  4EM0 B;  2QBY A;  4OIP F;  1IRF A;  4I01 A;  2XV4 S;  2F5D A;  2EV5 A;  1U5T B;  2RV8 A;  2P5K A;  4U7B A;  4IJA A;  3L7W A;  3V8L A;  5JR3 A;  4XRF A;  3T8R A;  1BM9 A;  4U7D A;  3GFL A;  1Q1H A;  1X3U A;  2HFH A;  3F8F A;  3EYY A;  1SFE A;  3W6K B;  5H6Q A;  3SFZ A;  4UV8 A;  5L3G A;  3PFI A;  2EWN A;  3WTY C;  3NQO A;  2M5W A;  3O2P E;  4LFU A;  1AWC A;  3ABU A;  5DCM A;  2H6C A;  3GZ6 A;  3RPU A;  4KNY A;  2DK8 A;  3L09 A;  2WC2 A;  1J0R A;  3GFI A;  1JHH A;  3CUQ B;  3FMS A;  2ELH A;  4P5O A;  4S04 A;  4UXN A;  3G3Z A;  5K5Q A;  2WTE A;  4WXH A;  4OIR F;  4LMY A;  2MBF A;  3K1N A;  4KYW A;  1Z91 A;  2VBW A;  1OKR A;  3TOB A;  1HW1 A;  1W7P D;  1DPR A;  3I64 A;  3RDI A;  3LFK A;  2JTV A;  2L02 A;  5CVI A;  1G3S A;  2YSR A;  4WCG A;  4RGX A;  2QBY B;  5DD8 A;  3BZ6 A;  3Q9V A;  2XAJ A;  3ZMZ A;  6PAX A;  3HRU A;  3NEU A;  5AIP A;  2V6C A;  4YG2 F;  1ZAR A;  2KIM A;  3CJN A;  1FOK A;  4OMZ A;  2PBI A;  2HR3 A;  4U0Y A;  2K27 A;  2KRF A;  4KUM A;  2CW0 F;  3L00 A;  2QYO A;  3GVA A;  1BN5 A;  1TNT A;  2Z5U A;  4L9T A;  4OIO F;  5FB2 A;  1SD5 A;  3SQN A;  5EEH A;  4ZZL A;  2Z99 A;  4RB3 C;  1ULY A;  3OV8 A;  3JTG A;  4M6Y A;  4IF4 A;  3EDP A;  4YIF A;  4BAY A;  4FT8 A;  4KN4 X;  1Z9C A;  4KT5 C;  4EJT A;  1LDJ A;  5DCM B;  3ABT A;  2Y48 A;  4KIB A;  3IKT A;  5FD5 A;  2XRN A;  5D6E A;  5FGM A;  2EA4 A;  2ESH A;  4IHT A;  3MWM A;  3TO7 A;  5J8F A;  3BOQ A;  3IL2 A;  4P9U A;  3FXR A;  5JFR A;  4OMY A;  3R6S A;  3KP6 A;  2DK5 A;  3L2C A;  2FF4 A;  2FXA A;  2PFB A;  1FYK A;  2HOE A;  5L3E A;  2R3S A;  3RKX A;  1J2X A;  3G73 A;  4IRH A;  3IWZ A;  4HOB A;  4GO1 A;  3I4P A;  1S29 A;  1S3J A;  1T0F A;  4MTD A;  4A5M A;  2O3F A;  1LNW A;  3MZY A;  3E5X A;  2CGP A;  1MGT A;  4UVB A;  2F5C A;  1LDK B;  1R22 A;  5D6F A;  4IXA A;  3LAP A;  2FE3 A;  4ESB A;  3M9A A;  4AIJ A;  4G6Q A;  1REP C;  3K1M A;  4AIH A;  1U8R A;  2HKO A;  2ADU A;  3FM5 A;  4JK1 X;  1SAX A;  1O7F A;  1ZRE A;  4HBL A;  3I58 A;  1OYW A;  4UHT A;  1KU3 A;  1ZG5 A;  1J5Y A;  4B09 A;  2FA5 A;  3ECH A;  3M8F A;  1IN5 A;  2PLY A;  5D4S A;  4XSX F;  3WE2 A;  1G4D A;  4ETS A;  2DQL A;  2KJB A;  1FX7 A;  2DAO A;  4L5I A;  1ZGJ A;  1MJA A;  3I59 A;  4CHU A;  4BQA A;  4EMS A;  1EV7 A;  5K5O A;  1YIO A;  2MLK A;  2KKO A;  1G3T A;  3V7R A;  2FML A;  1G3W A;  4LB5 A;  3AAF A;  4GGG A;  3ZP5 A;  1RUN A;  1YO5 C;  5JI6 A;  1T98 A;  3JAM K;  3TO9 A;  3CLO A;  3BPV A;  4I09 A;  4Y17 A;  2XAF A;  1I6X A;  3Q9S A;  3F8M A;  3TKY A;  3DXJ F;  2QLZ A;  1TQI A;  3WG9 A;  4CXF A;  3BWG A;  1XGO A;  5KK1 A;  3RPQ A;  1EH7 A;  3RKW A;  3FXU A;  5J6X A;  4Q4Z F;  3F23 A;  2ESN A;  1ZLK A;  1QZZ A;  2Z9O A;  1FP2 A;  2MD5 A;  4KDP A;  1JHF A;  2UZK A;  1FPQ A;  3ZMV A;  1I27 A;  4ENM A;  2QEN A;  3ELK A;  3HTS B;  1I1S A;  1BOA A;  2FBH A;  1UB9 A;  1IN6 A;  1HXD A;  3T5X A;  1IXC A;  3H92 A;  2HTJ A;  4OIQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...