4CA0A

Structural basis for the microtubule binding of the human kinetochore ska complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
119
Chain Sequence
MSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords SPINDLE AND KINETOCHORE-ASSOCIATED PROTEIN 1
publication title Structural Basis for Microtubule Recognition by the Human Kinetochore Ska Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 119
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1890 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ca0A00
4C9YA 4CA0A 2LYCA
chains in the Genus database with same CATH superfamily
2EB7A 4HNVA 1H0MA 5A2QK 1JKQC 2DPDA 1QHHD 4FX0A 3OYKA 2BV6A 3PNTA 5EG0A 1LVKA 1IRFA 4P96A 1N75A 2ZO4A 2VB6A 4F91B 5LEKA 2XAUA 2A05A 5FB2A 4RAYA 3G2BA 4PZJA 3H9GA 4P5OA 4HW0A 2R7XA 3CC2I 2DMTA 2EIMH 3VFZA 3GTQJ 2JA8J 3J7AO 2ZCWA 2ISYA 3J7ZI 3AL0B 2ZJPF 2IGOA 4BACA 3QQAA 1HLVA 2BVMA 3ROUA 2G7HA 2ZNYA 5EGOA 1FIAA 4B3XA 4KISA 4L5IA 3DEUA 5FLXZ 5IT9Z 3KCCA 1MBJA 1MJ9A 3BY6A 4NQWA 5M5WJ 3WGHA 2K02A 1FYMA 3IAM2 4O5VA 4PFOA 3M07A 4XN0A 5H20A 2FRHA 1SFXA 1G3TA 2UUZA 2HQ5A 3E6BA 2H09A 1LE8A 3EYIA 2B9SA 3G1OA 4HF0A 4A3CJ 2HNHA 3H5NA 4BU2A 2LKPA 1RKTA 4EM2A 1VQLI 2KISA 2JMWA 2Y48A 3C2HA 2X9DA 1BM9A 3BTIA 3VSKA 1DGRM 2DFFA 4RB0A 4G7ZF 3WE3A 5LHIA 3CF5F 4BE0A 3GO5A 2HVRA 1V55H 3QU6A 2XROA 3SJMA 2GZWA 1QZEA 5CQEA 5H6QA 5D8LB 4IXAA 3CJNA 1AOYA 1ZR2A 4XLNF 2PFBA 3NWSA 1USTA 4XRSG 2H27A 1JE8A 1IN6A 1XSDA 3DPTA 3OIPA 5EZHA 1W36C 3OR1C 1HW2A 2HZTA 3V8JA 2NVTJ 4P9UA 3DBRB 4UVCA 1Q1VA 3PM1A 2DFIA 4MFDA 4QLCU 3GYHX 2EV0A 3MKLA 1ETXA 2EQRA 3RCOA 4R79A 4IHSA 5IOZA 4MLOA 4KN4X 4HF2A 2BXYA 5GPAA 1GDTA 3DKWA 3H35A 5LFAA 3HB9A 2X1CA 4FX4A 4ESBA 5EEAA 4L5JA 2K3FA 2PQ8A 2XRNA 2QWWA 3M8FA 1MJBA 2O9LA 2DFHA 2GAUA 5GAEJ 4IQJA 4NC6A 2X1EA 3D5RC 3GFMA 3ECHA 3B6CA 1AHDP 4II2A 1U5TC 1AKHB 2L54A 3LFKA 1Y56A 1APLC 3OYDA 2JA6J 4OOIA 2YU3A 1T0FC 4E4HA 2P4WA 3V8KA 4XIDA 2ZNZA 3KPHA 2P7VB 2VKDA 2XB5A 2ACJA 3X2QH 3TW6A 2MABA 1VZ0A 2L01A 1I50J 3RPUA 4E6KG 3FWEA 2XC7A 2A61A 1JTYA 1XSVA 2EPFA 2GWRA 2HDWA 4BJTA 2QBYA 1EA3A 1YW7A 3K0LA 1MKMA 4M72A 4G12A 3ZMTA 4RAZA 4C30A 5DD4A 2GOXB 3BQZA 2DQRA 3IP4B 4D5CA 3C2GA 3CCLI 1WH7A 1Y8RB 1LDDA 2AHQA 2VJ4A 4XL9A 3BPVA 2ME0A 2Y0SN 4LIUA 4FCYA 2TCTA 2VPRA 3GTGJ 3GTLJ 1I1SA 4Y52J 2IEKA 1RI7A 1GV2A 1Z77A 1T95A 2RC4A 4PJ0C 5CVRA 5LRSA 3R0AA 5L3EA 2H8RA 4BE1A 1HSTA 1OYIA 1W7PB 3BOQA 1Z21A 1JT0A 2KRCA 1H9TA 1BA5A 5BQTA 2A6EF 1VQ7I 2LBFB 2N8GA 1XCBA 1WGXA 2WV1A 3EUHC 5F64A 5HLGA 3BR5A 2G9WA 4J01A 4N9HA 1DPRA 4DIQA 5C44J 2GQQA 1R5ID 1SMYF 2F4OB 3V4GA 4M6XA 1YIOA 3ZR8X 4RGUA 4ZTFA 1FOXA 1POGA 1UJ8A 4W97A 2EBIA 5M5XJ 3WTYC 4RLQA 4RGSA 3U1KA 2HXOA 2M7BA 4XOPA 4C2UA 4C9YA 3H5AA 1OCOH 3W2AA 4XKWA 4XLPF 3MMYB 2MH9A 4PK4A 4RAGA 1XMAA 3CO7C 2BY2A 2HWVA 1SVOA 2DO7A 3RSNA 2YUSA 3LSHA 2IBDA 3R4KA 3RQ4A 1FWZA 2PJRA 2VBXA 4B1RA 4C3HJ 1B8IB 3QPHA 3MN2A 4S0HB 1LNWA 5DM7F 2VOOA 5IPAA 5L3DA 3S1NJ 3HGYA 1A6QA 1KGSA 4G9YA 1R4NB 1HQCA 1DQUA 5KCMA 4IX7A 1EH7A 4H0EA 1SFEA 1WI9A 3GZNB 3TO6A 3SDGA 5IT3A 3LQRA 2R5ZA 4OWRB 2R5YA 2E35A 1IUYA 3G1LA 3UNGC 1EF4A 2VN2A 4HQMA 2HFHA 1YJ9I 5J1UA 4XRMA 4FT8A 1UG2A 1SFOJ 1FZPB 1BR2A 1DDNA 2NNYA 3HRUA 2FOWA 4F52A 2Y9ZA 1VQMI 1J75A 3T0YA 2XAGA 4HNTA 3W2WA 3EUAA 2W00A 3A03A 2UXXA 2MFZA 5CJ9A 3SZGA 1H88C 1ETVA 4DYRA 5E1ZB 2E60A 3E5UA 4DBQA 1FNNA 4XONA 4MNUA 3WG9A 3ELKA 5FKNA 4HSRA 2KKOA 4BL0B 2LDUA 2QUFA 4WK8F 5J40A 1O4XA 3LOCA 1OR7A 2X85A 1QHGA 2ADUA 4CCKA 3FXQA 1VQ8I 3G73A 2RAEA 4BBRJ 2M9HA 2HYFA 2VQHA 1TW3A 4L18B 3U21A 1ZR4A 3OL4A 5HS8A 2V1XA 2EFNA 2DQLA 4EEFG 3QAHA 3I71A 5LHHA 3DBHB 1YI2I 5ICGA 1OCZH 2FJ1A 4CUGA 3KLOA 4I6ZA 2LG4A 4BYYA 1ACIA 2IS1A 3I59A 1MH4A 4DOZA 4Y3OA 3FK7A 4CCMA 2W7NA 2L9RA 4ZC3A 4HQEA 5GTHC 3NAUA 4BQOA 2DN0A 2VE8A 4YELA 5IOYA 3OIQA 4D9JA 1B1BA 2HDDA 1EJ9A 1G6NA 3REOA 4NB5A 3I4PA 5B1AH 3OY9A 2OZUA 3DU5A 3GW2A 5LEJA 3BCAA 2L5QA 3T5XA 4A0ZA 2COMA 2X6WA 4XORA 3BLYA 1UHMA 5E3LA 2PN6A 2K9NA 1QPIA 2FNAA 2KZGA 2RNGA 5B3SH 1JHFA 3V7RA 1J9IA 4A12A 3R61A 2NVUB 1NK3P 3NEUA 3HEFA 5LGUA 3AKZA 3FX3A 3GF2A 1FYLA 1P4XA 4Q4ZF 4ZDOA 4HG2A 1F43A 2O5RA 1E2XA 3PO3J 1OCPA 1WWXA 4RM3A 2M34A 4YIFA 4HX4A 1V5FA 5TGTA 3JCUC 1YX5A 4PDKA 4FE7A 3PNYA 1JKRC 4PJJA 5K5OA 1OKRA 3ZQLA 3HOXJ 2C6YA 2BYVE 3GLLA 1FTTA 3I0TA 1R49A 1P2FA 5FGMA 1IF1A 3CP8A 3C1DA 3GMEA 2X1DA 3C3WA 1GVDA 4HRIA 4QTRA 4UUSA 5E20A 4PGHA 1FBSA 2D5VA 2F6CA 2KIQA 3GUDA 4IKFA 4BHCA 3PSIA 4WXCA 1F36A 4L0ZB 2A68F 1U6GA 1TWFJ 2BW3A 3HKZN 1S3JA 2A5YB 1VTNC 2HOAA 3BJAA 2R7RA 5K7ZA 1QBJA 3S3MA 2DK8A 4G7HF 2FMYA 3I5UA 2LMDA 3RYRA 2QCOA 3J80K 4NHJA 1YQAA 1D0XA 1PUEE 2DW4A 2EFOA 4M9ZA 1PP8F 3A02A 3S2WA 1IRZA 3PFIA 3HPGA 3VB2A 4KFCA 5DCMB 4BJ5C 4EJOA 3BPXA 3PUBA 3EUKL 3T8TA 2R3SA 1VNDA 1X1PA 2IS4A 1OFCX 2Z5UA 2LYCA 3VEPA 2VQLA 2P5VA 4I98B 5EEHA 2M4KA 1KA8A 2ESNA 1MBKA 3BJ6A 3ABMH 4U0YA 3JRGA 1TT0A 3I64A 3JTGA 5LGNA 1MBFA 1NG6A 2I5UA 2IW5A 3CZ6A 2P7CB 5KK1A 2VUMJ 3ASNH 3H3VK 2VJ5A 3H1CA 4X6AJ 2MBFA 2M0MA 1HC8A 2EWNA 1NH3A 3BTLA 2LKSA 2RVCA 5BMZA 2IRFG 3QRFF 2DA2A 1J59A 2E5NA 2VKEA 2EA2A 3SEQA 3L2CA 3F8BA 1BL0A 3L9FA 2DT5A 2WC2A 1CF7A 2KIMA 2K9MA 2R7UA 2VC1A 3FHNA 1SMTA 2BEOA 1XGNA 1ZAOA 2IAIA 4QWQA 1GUUA 1JI8A 3W6KB 4DW6A 2UWMA 1G3WA 2QVOA 5KAFC 4CA0A 2W1OA 1ENHA 2DOAA 5JVTA 3CQZJ 2F5FA 1PJRA 2IP2A 2RREA 1Y8QB 3H9JA 3O2PE 4HLYA 4LK0F 2QEXI 1R71A 4AIDA 4GRIA 1BJAA 4XKVA 3DP7A 3KZYA 5IYBJ 2HI3A 1ZRFA 4RB2C 3WTUC 2GIVA 4F7ZA 4HYEA 3ASOH 4HV6A 1NTCA 2HTJA 3E6DA 2K86A 1PVEA 1RC9A 3TKYA 1BOBA 1BR4A 5FKKA 1FSHA 4LLLA 3SXYA 3S16J 3E5XA 2FOKA 1HXDA 5GAHJ 3ZQFA 5K5RA 3G3ZA 3J80Z 2QYOA 3OS1A 3CCRI 5L3GA 3DFGA 3KZIC 4CCNA 3ABKH 3MZ8A 3HG9A 4NNJA 4LD5A 4DYCA 1TQMA 1XG1A 2CMPA 5GPCA 3CUQA 3V8LA 3S2HJ 3CMYA 1OR7C 1FP1D 3I9V2 2CQQA 3K2AA 1B59A 2FU4A 2JTVA 4MIMA 2GA1A 1W5CC 3I4NJ 4OU0A 2CV0A 1AA7A 2WB1A 2M87A 5C4XJ 1LKXA 1LFPA 3S2DJ 2CG4A 2DI3A 3BR6A 1I27A 3FBIB 3MFKA 1SC7A 1MDMB 5JR3A 3HZJA 3CCYA 3KE2A 3K6GA 4OAZA 5HNFA 1D1CA 4KT5C 1MGTA 2UZKA 2E1OA 3RKQA 1WJCA 2W25A 5J1RA 1SFUA 3CESA 3F8FA 1ETKA 2W85A 2CQXA 4BXUA 5F1JA 4E7JA 5HODA 4H4KC 4CH7A 1VQ4I 1X2NA 1TZLA 5F0CA 3DTEA 4LG0B 4ZYAA 3JSOA 3H36A 3P9CA 2XKPA 2P81A 2NNNA 4ZZDA 1ONVA 1R1VA 3HGGA 3BG7A 2VPLA 1RRJA 2QENA 2V9VA 2XIGA 3K4CA 2XHKA 2NS8A 4L5EA 3OYBA 4Z2YA 1RZ4A 1GXPA 5IT9K 2CWEA 3MCZA 1MNMC 1JTXA 1YFHA 2EZLA 3FDYA 1E3HA 2CU7A 2XAFA 4HDVA 3MAJA 2R4GA 4EMSA 4S04A 2OTJI 2OC6A 5CKTA 3N4MA 4ENKA 4JX4A 4PSWA 1O7LA 1F5TA 1PYVA 2HGCA 3CJTB 4D0PA 3TMOA 4FE4A 2KZVA 1TC3C 4G8XA 3RKXA 2GOMA 3VSLA 1OQYA 5HDKA 4IRIA 2NXNB 1VQOI 4JYKA 4IRHA 2JPBA 1FMVA 5EG0B 4I01A 4IVNA 1XGMA 4NC7A 4EQQA 4DNCA 3PFYA 4AC0A 2LLKA 2CFXA 3BT9A 2NRAC 4EJVA 2BBYA 2VBYA 2M45A 3U2RA 2ZJRF 4JOMA 1W5SA 4A5NA 3KEQA 2QZ8A 4O6JA 3F0CA 1MH3A 2KHMA 4Y33A 1JHHA 2DA4A 2L0KA 1R7JA 2ELJA 3RQIA 3DXJF 3NARA 5CLSA 4F92B 3ERED 4HX8A 1Z7LA 4XR6A 3WG7H 3QYBA 3A2KA 4YIRX 4WF2A 4YG2F 3ZMZA 1WQ2A 1B72B 2QQBA 4CCOA 1XN7A 4HX7A 4UUTA 1LEBA 2IVMA 3IAS2 2DYRH 1OYWA 2BHZA 1FMWA 3TGNA 4CGZA 3IH4A 5K7FA 1C0WA 2Y2ZA 5E3NA 1W7PD 4ENMA 4PUSA 1TNTA 3L7WA 5J6XA 2HYGD 4ESFA 1ZG5A 3HDDA 5FROA 5JHUA 2VJJA 4HSTA 4HAMA 3FXMA 1RUNA 2BY3A 5J1YA 5FD6A 1K4TA 1PUFA 1LFBA 1BIAA 5ILSA 1HDPA 4DYQA 2DAOA 3S1RJ 5E1XA 4J00A 1D1AA 2KT0A 1F9NA 4KIGA 5D5WB 4ZH4F 3W6JB 3WTWC 4ZYDA 1M1EB 4RAFA 4BXFA 4DZJA 3ERMA 4FETA 5AIQA 1YW9A 3QPSA 1TBXA 3L2UA 4AIHA 2RN7A 4IEJA 3HJEA 2L2OA 3GTPJ 5HVQC 4QIWN 2DPUA 3JRFA 2LSOA 1W0UA 2B7EA 3AAFA 2V7FA 2X4HA 3DPLC 3JW4A 4HEA2 3F21A 1IXRC 2F2EA 1X1BA 4HLXA 2DOFA 3CJRB 1D1BA 1CGPA 2DXIA 2KLOA 4GGGA 5E79C 2AQFA 4M9SA 2MD0A 2R7QA 2K85A 4F55A 5EDNA 2X6OA 1ZKGA 3D5SC 3FHZA 2VKHA 2HOSA 1BIBA 2H94A 1P92A 2NYXA 4ZDLA 4A3KJ 2AS5F 2Q0OA 3ZMSA 3HOUJ 1OMIA 3Q0UA 5DYMA 5DD8A 4OIOF 2X0LA 2ZBKA 5B1BH 4LMYA 3F9KA 2JA7J 4AD9A 2DA3A 2K3PA 5HS7A 4M74A 3FXRA 1ZQ3P 2LNBA 4ASNA 2NOGA 5FFXA 1LUJB 1YLFA 3Q0VA 3COAC 3OYCA 2KJBA 3IV5A 3CCUI 1O57A 3CUQC 2ID3A 3HUGA 5F27A 3KFWX 4LLGF 2NS0A 4U88A 1JT6A 2V1UA 2HXIA 2VXZA 2ZXWH 1ON2A 5LD2C 5JHFA 3S93A 1TT5B 1X1DA 2ZFUA 1NG7A 2DJNA 2DA7A 5FJ8J 1RUOA 3M9AA 1Y6IA 1VF9A 1ETWA 3LL7A 4CHUA 3CDHA 2X6YA 4G7OF 4AVZA 3M8EA 3CDIA 2NVYJ 2E1MC 2K9SA 2E7WA 3ABTA 1TWGJ 1ERDA 2DDAA 4L9JA 2LY1A 3LSJA 4D1QA 3WGGA 3ZPLA 3ZQCA 1KZHA 5J47A 3R0JA 3LWFA 1KQ0A 5LHGA 2MLGA 2BY1A 3GTJJ 1ETYA 3SYTA 3OMYA 2CV1A 4YIIA 4A5MA 2LD5A 1ETOA 2O61A 1AU7A 2HEOA 5IYDJ 3MKWB 2LF8A 2XGCA 1S9HA 4M3EA 2LTPA 4WWCA 4N9IA 4KDPA 2ZSHB 4M3DA 4AWXB 3ZQIA 5E3OA 2M30A 1U9OA 5ICFA 2EILH 1SVLA 2PLYA 1D0ZA 3KIOA 2CO5A 3F8NA 4MEXF 5J4YA 1J7KA 5IP6A 1Z3YA 1U78A 5K1YA 2VE9A 2I10A 2RKHA 3BG5A 2CQ7A 2QGUA 3QODA 3QP5A 2DMPA 2JSCA 3K4NA 1GVJA 2PMZN 2ID6A 2STWA 2D1VA 2ECBA 1D8JA 3PQKA 4FASD 4KYWA 4AIJA 2DTRA 2CJJA 3GEZA 1LEAA 3F3XA 2FA5A 2HPIA 3HYIA 1OLTA 2FQ4A 4PSXA 2P5KA 1BI1A 3PIOF 1SVMA 3L09A 2JN6A 3GFJA 1VQ9I 3HOSA 4IJAA 3OSFA 3MVPA 5HS9A 1HBXG 4MGRA 1DUXC 1AKHA 2VIXA 3BC8A 3H0DA 3VODA 1P6RA 1ZN2A 2Z33A 1ZGAA 5E1WA 1IN4A 1R1TA 3Q9SA 1R58A 1P7IA 2JPCA 4YFNF 2LK2A 2HKOA 2R7DA 1T08B 5HLTA 1YYVA 4L0YB 3OL3A 2Y30A 3ZP5A 5E8IA 3AG2H 2A69F 1FSEA 4F3QA 1S7EA 3R6SA 1MZBA 2IGKA 2VBWA 3FMQA 2F4MB 3O8HA 1Z91A 3BJOA 4FISA 3OYGA 3TW7A 2ZXHA 4MEYF 3QOEA 1X19A 3QYEA 3E5QA 3E6CC 3EYYA 2QKMB 4A2UA 5KNLA 2GLOA 4GCVA 3WGIA 1X58A 3JRCA 1UHWA 3LNQA 1XC5A 1BI2A 3DEEA 5FFZA 2RQPA 5AIPA 2OAZA 1W7PA 1DPUA 2OUMA 3E0JB 2OCCH 3S15J 1I3QJ 2EA4A 1S6LA 3TL4X 2XGXA 4BH9A 2VQCA 3GWZA 5GP9A 2D1HA 4MFEA 2O6GE 2LBFA 4P1WA 4UV8A 1FJLA 5BOXA 1G2HA 2LOOA 4BS9A 3R60A 2OZ6A 2XGDA 1R22A 3BR0A 2DA5A 2AXTC 4CICA 2XDVA 2LH9A 3HOWJ 2JT1A 3CLQA 3ZMDA 2Y0SA 2M2EA 3TO7A 4RMNA 4JP0A 3BZ6A 3LSKA 4MO7A 3JSPA 5TRDA 1A36A 4UB8C 3PSFA 1R5GA 2CQKA 3ISPA 2P0WA 2IA0A 1RPWA 1G59A 4MTEA 3IWFA 4NBQA 2KRHA 3LSPA 5C4JJ 2KQRA 4XNFA 2IS2A 1O3QA 1B8IA 1KU2A 1BR1A 2HDCA 2QQ8A 2ZJ2A 3EDPA 2AQEA 2E7XA 4JX5A 5DM6F 1E0EA 2ZMEB 4DBRA 1H9GA 4RB1A 1UG0A 3GVAA 1QRYA 3HSFA 4AU7A 4A0YA 2MH2A 4OIQF 4BNCA 4KUMA 1JUMA 4CSWA 3AL0C 2GXBA 1DP3A 1JJ8C 5CPRB 2WWYA 2LREA 3RYPA 1QU3A 4CZCA 3QPLA 3PL8A 1YX3A 2WAQN 5KVRA 1JKOC 4P55A 2ELKA 4HV5A 2CQNA 3SHFA 3GTMJ 2LC2A 1WHUA 1ORKA 1MBHA 4BY1J 2W4SA 2Z16A 3JRBA 1LB2A 5EYRA 3KZZA 5JFRA 5D5UB 4NUBA 2VL8A 3VWBA 1ETQA 2MSYA 1BW5A 1IJWC 1GLNA 2A6HF 1FOYA 3OYLA 2EIJH 3K4KA 3LFUA 3PIPF 2A07F 1ZLJA 3HHHA 3T1BA 4BDZA 3WU2C 1T2KA 4I7HA 5TISC 3F6VA 3O6BB 4IF4A 4DGWB 5IYCJ 1YRNB 5E8GA 4D5FA 1R00A 1YOVB 1XGOA 5FO5A 3TO9A 1L3LA 4UUVA 1SD4A 2V1DA 1IZ1A 2HR3A 2WY8Q 1P4WA 2M7AA 4BY7J 2BOLA 3C2BA 3I54A 3S3NA 1CQTA 1MBGA 2PG4A 1I6HJ 4I76A 4IHTA 2Q2EB 3BTJA 1T33A 2LY9A 4CDGA 4ETSA 3L2VA 2IA2A 3CMEI 2FBIA 4LOCA 3KETA 2XRLA 2FF4A 4KMFA 1S7OA 3M1CA 4M3FA 4EM1A 1TQIA 1A5JA 2PMHA 1RETA 1FY7A 3TOAA 3IH2A 1YHQI 3K1PA 1F4KA 4NDLA 2VONA 5M5YJ 2CW7A 2OBPA 2PMUA 5FLVA 1R5HA 2IXSA 5HOOA 1VQKI 2LF7A 3RKYA 3TOBA 4E7KA 3FZVA 1YIJI 1ZRCA 2CV2A 1SEUA 3ZQQA 3ZN0A 2GIZA 4HDUA 2MC4A 1KQ8A 5AONA 2HZDA 2EJRA 4GDFA 1VQ6I 2PJPA 1A35A 4ZJZA 4RLFA 1ZYRF 4ANJA 5BS6A 3SFIA 3MKYB 3L2WA 2W48A 5EEGA 1IC8A 2H6CA 3K2ZA 4A3BJ 3QWLA 2VJIA 2O3FA 3GXOA 4BEHB 3UKGA 2QM3A 4E7HA 1V3FA 1SD5A 1STZA 2M8EA 1KU9A 2CUJA 2MC3A 2YX4A 2OQRA 3ZQGA 1QNTA 2BVLA 3AG1H 3LA3A 5CVVA 4E7LA 4A93J 3CO6C 2DMQA 5F0HA 4B4CA 3L00A 1AWCA 3WU0A 1XCVA 1FBUA 2HQAA 2ZXJA 3CC7I 4G6DA 2KDZA 2ZSIB 1I3AA 4C3IJ 2D2WA 3E1SA 5D5VB 4W1UA 2H1LA 3MEXA 1D5VA 1G8XA 1R4MB 2OU2A 1RESA 3DTIA 4B44A 3OYAA 1TNSA 1HKSA 4EVIA 4A3JJ 3JTHA 4GO1A 5E18F 4QSHA 3OR2C 1Z9CA 3BG6A 4I99C 4AYBN 4XK4A 1D5YA 4U0WA 1MD0A 3RZOJ 1BN5A 2XUBA 3H92A 2D45A 2FX0A 3SZPA 3IH3A 2HU9A 1D3YA 5FD5A 1Y0NA 1QA6A 1TP4A 3K10A 3KEYA 2WAFA 1MJAA 4B09A 1X3UA 1XX5A 1YE9A 3JR9A 3K4MA 2M1BA 2ZFWA 1SD7A 3B6AA 3SZTA 2R7SA 1EH6A 2TRTA 3DQVC 3H3ZA 3LMMA 4HZFA 1BI3A 1MIJA 4BUPA 2ISZA 2HVQA 3FMSA 3I56I 1FC3A 1TWAJ 2RDPA 2Y69H 3MZHA 2IT0A 2VODA 5DCMA 4E70A 5ICEA 3VPRA 4A6EA 3CMAI 2NVXJ 1LQ1A 2QSGX 3ML6A 3ZCOA 2QQ9A 2XGEA 2DCEA 4Y17A 2XKOA 1WZ2A 4CYCB 1T8IA 1VQ5I 2ETHA 3ZMUA 4A6DA 5EZGA 3D0SA 1X4OA 3TQNA 3RZDJ 1ZGJA 1UAAA 2HVSA 2PEXA 2Y0MA 4XMYA 1MMNA 4XRSA 4G6QA 1U8RA 2Y75A 5KAIC 1VQNI 3A0BC 3FXKA 2Q8KA 4O3MA 4RGRA 2HTSA 3OYHA 3QP6A 4ZYHA 3K69A 1I6XA 1R23A 4GYIA 1IXCA 5K5QA 3GTOJ 1GV5A 3ESWB 3O8GA 1WJFA 2HS5A 3I4MJ 4A69C 1Z6TA 3BDDA 2L7FP 1LDKB 1Y1WJ 1ZHFA 3TBIA 3PNVA 4WXHA 3OWTA 4D7MA 3HC7A 1U5TB 1USSA 1K78B 1MSEC 1BW6A 1ITYA 5M3MJ 3M7GA 1T39A 3LSTA 3JRAA 1QQIA 1SFKA 3LA2A 1O7FA 1XTAA 4HF1A 1DU6A 1A04A 4ZYEA 2CYYA 3PO2J 2H8WA 3W2VA 3RI4A 3HRTA 3M1EA 4PJLA 4L9TA 2OQGA 3SQNA 2AXLA 2BZTA 3LSGA 2DYSH 4F93B 4L9NA 1K79A 1IO2A 1G4DA 3M8JA 3OYIA 1ZELA 4B48A 3WU1B 1I5ZA 3Q3SA 2FUG2 4XSZF 4M3BA 5DTDA 3S3OA 4IHWA 4A3DJ 4BKXA 1IDYA 4XM3A 4JX6A 1Q1HA 4KA4A 3F22A 1ZRDA 2DMNA 3FKIJ 4L9VA 2XAQA 3OYMA 1RKWA 3RKWA 2VASA 1E17A 2KPMA 3HRMA 1FOKA 1IUFA 2Z2SB 2WTEA 3RIRA 3HL2A 2CS3A 2EV5A 1IN7A 2LP0A 1K83J 1SAXA 2KRFA 2B0LA 2JQ7A 2K9LA 2OPTA 4CXFA 2IJLA 2AO9A 1B9NA 2YU9J 1YITI 4KJZA 1OISA 2COBA 4V19K 2F5VA 1V4RA 3HOVJ 3V42A 1MDMA 1KU7A 4K2EA 4AUXA 2XSDC 1A31A 2BY0A 3W6VA 2EINH 3A01B 1IRXA 1W5TA 3BZCA 2JUCA 3TEDA 1UB9A 1XS9A 3KYCB 5D4SA 4BDYA 1KU3A 4JQFA 2KFDA 2FXAA 2ESHA 2DTZA 5H6RA 2Z1DA 4LG0A 2DU9A 2P5LC 3V7CA 2ICWG 2VLAA 4A0XA 2JA5J 3DKYA 1FTZA 2DA6A 1QPMA 3HHGA 2GM4A 4E7SA 2FEZA 5E3MA 3OYFA 3BG3A 2ECCA 5F04A 1XDUA 3CF2A 3K4BA 2CUEA 3BR3A 3FBNB 3NWTA 4XN3A 1RR7A 2XASA 1WJBA 4B47A 3U9GA 3MKZA 1X1AA 2Z3YA 3BTCA 2XVCA 4Y7NJ 1E3PA 4M6VA 3CCJI 5EGOB 2E2HJ 4IOAF 3CJQB 3GZ5A 2XPUA 2E36A 4DZPA 3A0HC 2JJ7A 2EK5A 5D8KB 2DBBA 4NQWB 4RM2A 1BOAA 1WI3A 1U0JA 3I53A 2LRDA 3UR3C 2JZYA 4XSXF 2I8DA 3DTKA 1IAWA 2RV8A 3B02A 4CCLA 1HW1A 3H9QA 2PX9A 3KP2A 5HLHA 1D8KA 1ZARA 1DGWY 5ILUA 1LE8B 2DT7B 1KYWA 2KP6A 1HDDC 4XICA 4BAYA 3K1MA 2LKXA 1L0OC 1Z1DA 3K1NA 2OJED 5GADJ 4GYGA 3IC7A 3CLOA 2MGQA 2M5WA 1HSJA 2V6EA 1S72I 1J5YA 3ABUA 4BQQA 5FLMJ 5DS9A 1N77A 1XMKA 1TL8A 2ELHA 2BHYA 4ENJA 4YFKF 2CUZA 4LIVA 1JUSA 4B8XA 4N0BA 5ED4A 2CFOA 5JLXA 3GFIA 3BZKA 3CDLA 3F6OA 2QA4I 1TWCJ 2TDXA 1FOWA 1E3OC 1B72A 4GXOA 1IDZA 3DEWA 2VXDA 3F8CA 2K40A 2PI0A 3EPZA 1YG2A 1U2WA 5F0FA 3ULQB 1RIOH 2JA2A 5L3BA 2M3AA 3C7JA 4LFUA 3F23A 4ZTJA 1MNDA 3AG4H 5H2FC 2E1CA 4E7IA 3AG3H 5B5EC 3KP4A 1P4AA 3K9TA 1UCRA 2O8KA 3HSRA 1WFXA 3HUGB 1BC8C 2ZKZA 3JAMZ 2H6BA 1UMQA 1G3YA 3OV8A 3GLXA 3VYSB 4XRFA 5DCFA 2E2IJ 1WRJA 2EFWA 1HW5A 4ESJA 3S14J 5LLQA 3CCEI 3BP8A 2IPQX 3RDIA 2Z9OA 1ZK8A 2M4GA 1JGGA 1OCCH 4XLFA 5JLWA 1A6IA 2H1KA 4EJTA 3B73A 1Z7UA 3BG9A 1Y1VJ 3IWZA 3S32A 1QZZA 2L7MP 4WX9A 1QO0D 4OAYA 2O03A 3GCMA 3IRQA 1WKMA 2DT6A 1ZTRA 3RTRA 4ZDPA 3MWMA 1UFMA 5HNHA 1P7JA 2F5EA 5A2QZ 3ONQA 3HIFA 5J8FA 2JRTA 2UV1A 3OOPA 4XQFA 1I39A 4M9XA 1U9NA 3TP3A 2P6SA 2JWTA 2VOPA 3I3LA 3TP0A 2OF7A 4ZYGA 5TJJA 3FK6A 3LSIA 3HM5A 4LITA 1FX7A 5LGTA 3M3YJ 4XOTA 3IKTA 2QBYB 2IGNA 4I0BA 1WH5A 2CRGA 2XSJC 3WTTC 4DQ2A 4UV9A 2HOEA 2HQNA 1IXSB 4PGGA 3IL2A 1R1UA 2BXZA 2CW0F 3FXOA 1IRGA 1FLIA 2RGVA 1XSXA 3QPTA 3ZMVA 3D1NI 4LB5A 4XKBA 4JBAA 4YRVA 4KIBA 2W82A 1VQPI 4X0GA 3HSEA 2E71A 1K6YA 3D5LA 1X4PA 2WA0A 1H8AC 4LB6B 2R7FA 1DU0A 2NOJB 4ON0A 5LBQA 2J5OA 4RS8A 2E1NA 2MYSA 1O3RA 5DUKA 2OTLI 1TWHJ 4LK1F 4BXXJ 4GFBA 2MD5A 2K5CA 2DA1A 2KMUA 9ANTA 2P8TA 4IQ4A 4TV7A 3JRHA 4IHXA 3DV8A 1D0YA 2VT2A 5HDGA 3RJPA 2FSWA 1BI0A 3J7AY 2ZXIA 2J5PA 2EV6A 2KIUA 3VYTB 4CZZA 2K7LA 3K70D 3CC4I 2KL4A 1XDSA 2Z99A 4I0AA 1U3EM 5DEQA 3OS0A 3RPQA 3E3VA 3I58A 2NS7A 4U7BA 1ON1A 3FXLA 3FISA 3L2QA 3G4SI 3GZ6A 1SD6A 1ZG3A 4X1EA 4U87A 4UB6C 3CMMA 2Y9YA 3CUOA 2HPMA 2CH0A 4PFPA 4OMZA 1REPC 4G6TB 3DU6A 3SDBA 3QYFA 1O3SA 4AIKA 2WV0A 4B3AA 3WTSC 4RA2A 1WVRA 3SEZA 2PJRB 4KT6A 1HA8A 4IPAA 3IKVA 3W3CA 4KNYA 3PQJA 2XPWA 1IV8A 3VYRB 1OCRH 2R92J 3L1PA 3CCSI 4ENNA 3OSGA 1MMGA 1KYZA 1YS7A 2R5ZB 5BPDA 2R5YB 2RQQA 3CCQI 3WTXC 1DP7P 1V5EA 2ZC2A 3FXUA 2IA1A 4V2GA 3S17J 4Y4RA 2V79A 2P6TA 2VI6A 4U0VA 3TDUC 5F1RA 4EGYA 2JRMA 1X1CA 1TQPA 1YJWI 1VI0A 3BROA 3Q0WA 3ZQHA 4JK1X 2QQAA 2STTA 3HTUA 2E5ZA 2WAEA 3S1MJ 1VFCA 1BJZA 1IG7A 2HOTA 4OMYA 3V7SA 3IRRA 1Z3XA 2YX7A 2K4JA 4MQ9F 4XKCA 4A3EJ 1XD7A 2L7KA 1F1ZA 4M3GA 2KIFA 1MNEA 1O3TA 3EQLF 2PMZA 3FM3A 2JUGA 3MD2A 3K7AJ 1OYYA 4BHBA 1K4SA 5CQGA 5KHDA 2O0YA 1TTYA 3KP3A 1ZLKA 3WTVC 4OINF 3S8PA 5ICCA 1WSUA 2GA2A 4KIFA 1FEXA 4IL6C 4KICA 1QGPA 3QU3A 4EJWA 3JRIA 2EZIA 2VQGA 3VOEA 1FPQA 4QPQA 3EETA 1FT9A 2VT3A 3I59B 1TLHB 5F6FA 3JREA 1K7AA 2L9SA 4OIPF 4U7DA 1XPXA 5D4RA 3HXLA 4A3FJ 2KJCA 1BC7C 5J8CA 4J19A 3KEOA 1MMAA 5HLIA 4EV0A 4HOBA 1S7AA 2L3DA 2XAHA 4M6YA 2B63J 1W36D 3BWGA 1X2MA 2MG4A 3T8RA 5M3FJ 2W57A 1K61A 4P9FA 1XGSA 3DCFA 3CCVI 3HRSA 4IRGA 2L4AA 3FMRA 3DPUA 4PCQA 1HOMA 1K6OA 4ITVA 4DJAA 2Q1ZB 1Z0XA 2X6XA 4KITB 4EATA 1N78A 4PJNA 3OYJA 1KONA 1JKPC 4NC8A 3K4JA 3LA7A 4KMUX 2FBKA 1LVAA 3G1MA 4ABZA 4IO9F 4R1HA 4Q47A 4LJZF 4RGXA 1QVUA 5L3CA 2R7OA 2X48A 2ZMEA 3F8MA 2FD5A 2JVHA 3H0GJ 1PP7U 3J7YJ 3GBGA 4UUSB 4A3LJ 5JVGF 4D7NA 5K7HA 3G71I 3N97A 5ERIA 1MBEA 2CW8A 5C3EJ 1HF0A 1X3WB 5DV5A 3KYLA 4IZZA 3I55I 3HTSB 2BW3B 1B4AA 2XF7A 1I1GA 4Y15A 1YS6A 3FF5A 3J81K 2O8XA 3CP2A 4BQNA 3VDXA 2GXAA 5FKOA 2GXGA 2L02A 1V54H 2DMUA 5IP9J 2EFPA 1LPQA 1Y0UA 2V26A 3PUFA 4UVAA 1LJ9A 2YSRA 2UXNA 4AVPA 1Z67A 4RBOA 3VYUB 3DLLF 1W0TA 3MZYA 2CGPA 1IN8A 1YW8A 3P7NA 1YRNA 3Q5FA 1S29A 3NRVA 2G7UA 3S1QJ 2LFBA 1HCRA 3WHBA 2FE3A 2RNJA 1GHCA 5J4VA 2PBIA 5CVIA 2V4JC 3KP6A 4I09A 3U1DA 3ZOBA 3P9IA 1FBQA 1Z6RA 2WAQA 3WE2A 4BE2A 1MSFC 4UVBA 1R36A 4A3MJ 2Q2EA 3H5RA 1MW7A 2F5DA 5DUIA 2VC0A 2G0EA 4V2FA 2EIKH 2IGMA 1RNLA 3A4CA 4Q5SF 4N4NB 1H89C 5CYVA 2YR2A 2DJIA 1LDJA 2V6CA 3KX2A 1T56A 4WXDA 3Q9VA 2QSFX 3HOZJ 5EF6A 1ULYA 3CCMI 3ECOA 2QLZA 3ZRGA 5HDNA 3LSRA 2JVGA 1V5GA 2K9QA 4IHYA 2R7ZJ 4A3IJ 3E97A 1CF7B 2OCEA 3JRDA 4RDUA 1SANA 1NK2P 1EV7A 3FIWA 4ZZLA 4LG3A 5BNGA 3KLNA 1PDNC 3CD6I 4Y13A 3BCBA 4LLNA 1IW7F 1S5LC 4XLCA 2FBHA 2ME6A 1IV6A 2YPRA 4BEHA 4EJUA 4G94A 4FHTA 1UZCA 1EKEA 3LAJA 1UELB 2K27A 1OPCA 3BR1A 3J81Z 2FNPA 3GX4X 1YJNI 1ZGWA 5CVJA 2LY2A 2WB1N 3ABLH 3F72A 3E7LA 3ZGKA 2FMLA 3K4LA 2EH3A 2CUFA 5FKMA 2IS6A 3CTAA 2F5CA 4RB3C 1JJ6C 5FRNA 4AM3A 4XBFA 5BPIA 3HKZA 4QPOA 4S05A 3KP7A 1KQ9A 2MLKA 1MMDA 3P5JA 4M73A 1JGSA 3BQYA 2R7WA 5FRMA 1X3ZB 3CUQB 1Y39A 1MMSA 4UHTA 2R7TA 2CSOA 5D6EA 3ZN1A 2EFQA 3HOYJ 2HQRA 4UNOA 2WADA 5IP7J 1YTYA 2A3SA 2F4IA 2HKXA 1W4MA 1T38A 1UHSA 4CCJA 2L9VA 4HA8A 1FP2A 3IUOA 2ZJQF 2E34A 2R7VA 3OS2A 1EH8A 4XLAA 1GXQA 1Z05A 4HPQA 3OOUA 4YEJA 5LRRA 4CO8A 2E1MB 2WY7Q 1U8BA 3H3UA 5GAGJ 5JI6A 4MTDA 1FYKA 1JUPA 3L2RA 1IN5A 1GT0C 2L4MA 3HPHA 5ILVA 2MA3A 4A3GJ 4C3JJ 1OCTC 2JSPA 3PJRA 1G3SA 3OIOA 4CYCA 4AYBA 3DWLE 5FKLA 1P9QC 5B66C 4FTHA 4BGDA 2LVSA 3KYDB 5EJCA 1J0RA 1B9MA 2XV4S 4CYDA 1YO5C 3LSMA 1T6SA 1S8NA 2BE5F 1XMXA 3DBLB 2DK5A 2M8GX 3SFZA 3WTZA 2DDBA 3C18A 1QVTA 4HNUA 1WJDA 4HBLA 4OIRF 2W24A 2R0QC 3OYNA 2JK3A 3MQ0A 3TDZC 2OA4A 3A1YA 2OV7A 5IY5H 1J2XA 1HKQA 1R6RA 2NAZA 2XB0X 2A5WA 2V9PA 2FQ3A 4II3A 6PAXA 4BQAA 1J09A 2DFEA 4MQVA 4WCGA 1JXSA 3DF8A 2VKVA 2EZHA 2WBMA 2XAJA 4BBSJ 2A6TA 2ZMEC 2ZB9A 2VBZA 1LFUP 3FM5A 1ZH5A 1U5TA 1K78A 2DOEA 2E19A 2HYJA 3DKXA 4EGZA 3GTKJ 1T0FA 4I02A 2L7ZA 4XLEA 5F08A 1QZYA 3NQOA 3IHUA 2E2JJ 1WCMJ 4LGWA 2V1NA 3RPUD 4BHPA 1W1WE 3ZXSA 4C2MJ 4E7ZA 4Z6YA 4C2TA 3BR2A 1SAUA 2K4BA 2MW8A 5CVUA 2GBYA 3N05A 2X51A 1WJEA 1IGNA 1WJ5A 5J3LA 3DLAA 4EM0B 3GFLA 2BGCA 3LAPA 4YFXF 4UY8I 5FLXK 1WJAA 2O7OA 3HBLA 2L9NA 3WHCA 4I2OA 1RR8C 5D5XB 4MHGA 2V9KA 5L3FA 3E6MA 2OD5A 5DDGA 3JAMK 1ODDA 3AFHA 4UXNA 5E17F 3KP5A 2XF5A 2QSHX 1FIPA 2QKLB 1ZREA 5D6FA 2EZKA 2DLLA 1TW2A 2XPVA 2F48A 3P9KA 4PJMA 3WODF 4IOCF 1T98A 2R93J 4N4OB 4M71A 1OJLA 3K70C 1B6AA 1ZG1A 3EUHA 2DODA 5GTIC 1PUFB 1HKTA 3M4OJ 3G6EI 2KDOA 4Q48A 3ZQ7A 3HOTA 2M0CA 1R9TJ 4BJ6C 1NHAA 3FXJA 1XB4A 3QOPA 3FKJA 4B43A 4FQGA 1BBYA 3A01A 2NVQJ 4KN7X 2YS9A 4XLHA 1WPKA 2LR8A 1N25A 4IHVA 4R8HA 2QF7A 2XF6A 3LQQA 3O3KA 3OYEA 2Y31A 2W84A
chains in the Genus database with same CATH topology
4XKVA 2VL8A 4IQ4A 3VWBA 1GLNA 3OYLA 1QHHD 3OYKA 3K4KA 3LFUA 1D0YA 3PNTA 3J7AY 4BDZA 2ZXIA 1BOBA 1BR4A 1LVKA 4DGWB 1N75A 2VB6A 3VYTB 4F91B 3K70D 2XAUA 2KL4A 3G2BA 3H9GA 4P5OA 3OS0A 4U7BA 2R7XA 3OS1A 2WY8Q 3L2QA 2M7AA 4CCNA 2BOLA 4U87A 3HG9A 4NNJA 3S3NA 3CMMA 3AL0B 2HPMA 2CH0A 4PFPA 2CMPA 2IGOA 4BACA 2Q2EB 3DU6A 4G6TB 3QYFA 3SDBA 3L2VA 2BVMA 1OR7C 3I9V2 3M1CA 3SEZA 2PJRB 4B3XA 4KT6A 1HA8A 4KISA 3W3CA 3VYRB 2CV0A 2CW7A 1AA7A 1MMGA 2WB1A 3IAM2 2IXSA 1LKXA 4PFOA 4XN0A 5HOOA 1LFPA 2RQQA 2UUZA 4E7KA 1V5EA 2CV2A 4Y4RA 3ZQQA 3FBIB 2MC4A 1X1CA 2HZDA 3K6GA 4OAZA 4ZJZA 4RLFA 4ANJA 5HNFA 3MKYB 2HNHA 3L2WA 3H5NA 1D1CA 4BU2A 2E5ZA 1WJCA 2WAEA 2VJIA 4BEHB 3CESA 3C2HA 1Z3XA 3VSKA 4E7HA 1DGRM 4E7JA 4XKCA 4H4KC 4CH7A 1TZLA 2CUJA 4BE0A 2L7KA 2HVRA 3DTEA 5CQEA 4ZYAA 1MNEA 2BVLA 4E7LA 2PMZA 2JUGA 3MD2A 3NWSA 2HQAA 5CQGA 3BG7A 3DPTA 3OIPA 5KHDA 2VPLA 2ZSIB 3K4CA 1W36C 3E1SA 3OR1C 3OYBA 3S8PA 1G8XA 3DTIA 4B44A 3OYAA 2VQGA 4QPQA 3FDYA 3OR2C 3BG6A 3RCOA 4R79A 2L9SA 2R4GA 4MLOA 2OC6A 5CKTA 2HU9A 3HXLA 3H35A 5LFAA 3K10A 4PSWA 2X1CA 3KEYA 2WAFA 1MMAA 1PYVA 1YE9A 3TMOA 2KZVA 3K4MA 2GOMA 3VSLA 2R7SA 1W36D 3DQVC 3LMMA 4IQJA 2X1EA 4BUPA 3D5RC 2HVQA 1FMVA 4NC7A 3PFYA 4II2A 1Y56A 3OYDA 4E4HA 1T0FC 4JOMA 3DPUA 3ZCOA 2DCEA 4ITVA 4DJAA 2VKDA 2KHMA 2Q1ZB 4Y33A 2X6XA 4KITB 2MABA 1VZ0A 4EATA 1N78A 4PJNA 3OYJA 1KONA 1X4OA 3K4JA 4NC8A 4E6KG 2ELJA 1UAAA 4F92B 2XC7A 2HVSA 4XMYA 1MMNA 1Z7LA 4XR6A 2HDWA 3QYBA 3A2KA 4BJTA 1EA3A 4CCOA 2R7OA 3OYHA 3IAS2 1FMWA 4C30A 2JVHA 3OYEA 2GOXB 3IP4B 3GBGA 4PUSA 3C2GA 1WJFA 2CW8A 2VJ4A 4XL9A 3KYLA 5FROA 2VJJA 4LIUA 4HSTA 4IZZA 1LDKB 2BW3B 2XF7A 3TBIA 1T95A 3PNVA 3OWTA 4BE1A 3CP2A 4BQNA 3VDXA 1Z21A 3HC7A 4J00A 1D1AA 2KRCA 4BXFA 4FETA 2V26A 1SFKA 2LBFB 3L2UA 3VYUB 3EUHC 4J01A 4DIQA 2L2OA 5HVQC 3W2VA 3ZR8X 2V7FA 3DPLC 4HEA2 4ZTFA 4PJLA 1X1BA 4RLQA 3CJRB 1D1BA 3LSGA 2DXIA 2KLOA 2M7BA 2AQFA 2MD0A 4F93B 2R7QA 4XOPA 2V4JC 4F55A 4C2UA 2WAQA 3H5AA 3M8JA 3D5SC 4C9YA 4XKWA 2VKHA 1ZELA 4B48A 3OYIA 4BE2A 3W2AA 3MMYB 2FUG2 3S3OA 4ZDLA 4PK4A 3H5RA 1MW7A 4XM3A 2IGMA 3RSNA 3OYMA 3LSHA 3A4CA 3RQ4A 2VASA 2PJRA 2KPMA 3F9KA 4N4NB 2DJIA 2K3PA 2Z2SB 3KX2A 3HL2A 2CS3A 1DQUA 5KCMA 4IX7A 3OYCA 3ZRGA 2K9LA 2JVGA 1V5GA 4OWRB 3UNGC 4KJZA 2VXZA 1BR2A 5LD2C 2F5VA 4F52A 3V42A 5JHFA 3S93A 4HNTA 3W2WA 1X1DA 3EUAA 2W00A 2ZFUA 1NG7A 4LG3A 1IRXA 3BCBA 2MFZA 1Y6IA 4XLCA 3SZGA 4BEHA 2E60A 4DBQA 3LL7A 4XONA 1UELB 2X6YA 4AVZA 4BDYA 2E1MC 4HSRA 4JQFA 4BL0B 1ERDA 2Z1DA 2LY1A 4D1QA 2LY2A 2VLAA 2X85A 1QHGA 4CCKA 3ZGKA 3K4LA 3DKYA 2IS6A 2VQHA 3SYTA 3OMYA 2CV1A 5FRNA 4E7SA 3U21A 3OL4A 3HKZA 4QPOA 3OYFA 1MMDA 3K4BA 3CF2A 3MKWB 1S9HA 3FBNB 3NWTA 4XN3A 2R7WA 1WJBA 4B47A 4CUGA 5FRMA 3MKZA 1X1AA 2ZSHB 2LG4A 2R7TA 1D0ZA 2IS1A 4DOZA 4Y3OA 4CCMA 2W7NA 4ZC3A 3CJQB 2WADA 4BQOA 1Z3YA 4YELA 3OIQA 2F4IA 4D9JA 4CCJA 3QODA 3IUOA 4NQWB 4RM2A 3OY9A 1U0JA 3K4NA 3DU5A 3OS2A 2R7VA 3BCAA 2LRDA 2L5QA 4XLAA 3UR3C 4FASD 2X6WA 2I8DA 3BLYA 2HPIA 3DTKA 1OLTA 3OOUA 4HPQA 4XORA 4YEJA 2E1MB 4PSXA 4CCLA 3H9QA 2WY7Q 1DGWY 3L2RA 2DT7B 2RNGA 2KP6A 3HOSA 3HPHA 2VIXA 3BC8A 3H0DA 3AKZA 2V6EA 2JSPA 4BQQA 4ZDOA 4HG2A 1N77A 3PJRA 2O5RA 4AYBA 2CUZA 3DWLE 4LIVA 1P9QC 4RM3A 4BGDA 2CFOA 1V5FA 5TGTA 1YX5A 3LSMA 5HLTA 3PNYA 4PJJA 3OL3A 2VXDA 4F3QA 4HNUA 1WJDA 3EPZA 3CP8A 2JA2A 2IGKA 3OYNA 2M3AA 2X1DA 4ZTJA 1MNDA 4HRIA 4E7IA 3A1YA 3OYGA 2ZXHA 2OV7A 3QOEA 1WFXA 1X19A 2F6CA 4IKFA 1R6RA 3QYEA 3HUGB 3PSIA 2A5WA 2QKMB 4II3A 5KNLA 1J09A 2BW3A 3VYSB 2WBMA 2R7RA 2A6TA 3DEEA 3S3MA 2M4GA 2OUMA 3E0JB 3DKXA 4XLFA 3TL4X 2VQCA 4XLEA 3S32A 2LBFA 4OAYA 4P1WA 1D0XA 2LOOA 4BS9A 2DT6A 2V1NA 3RPUD 3RTRA 4ZDPA 3HPGA 3ZXSA 5HNHA 4E7ZA 2XDVA 4C2TA 2LH9A 1SAUA 4BJ5C 3ONQA 3N05A 3EUKL 2X51A 2Y0SA 3PUBA 1WJEA 4RMNA 2UV1A 3LSKA 1WJ5A 4XQFA 3PSFA 3DLAA 2IS4A 2P0WA 2LYCA 3I3LA 2VQLA 3LSIA 1G59A 1WJAA 4LITA 2KRHA 2L9NA 2M4KA 2KQRA 4XNFA 2IS2A 2V9KA 4XOTA 1TT0A 2IGNA 1BR1A 1NG6A 3CZ6A 2AQEA 1E0EA 3AFHA 2VJ5A 4DBRA 2XSJC 1UG0A 2M0MA 2XF5A 4AU7A 2QKLB 2E5NA 3AL0C 4CSWA 4PJMA 3SEQA 1DP3A 4N4OB 4XKBA 5CPRB 3K70C 2LREA 4YRVA 1QU3A 4CZCA 2R7UA 2W82A 2K9MA 4X0GA 3FHNA 3PL8A 1YX3A 1K6YA 3D5LA 2KDOA 1X4PA 2WA0A 1JI8A 3HOTA 4BJ6C 2UWMA 4B43A 3FKJA 2LC2A 2NOJB 2DOAA 2W1OA 4CA0A 1PJRA 2MYSA 2RREA 3H9JA 2W4SA 4XLHA 2Z16A 2XF6A 2K5CA 4GRIA 2KMUA 4NUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9Y A;  4CA0 A;  2LYC A; 
#chains in the Genus database with same CATH topology
 2EB7 A;  4HNV A;  1H0M A;  5A2Q K;  1JKQ C;  2DPD A;  1QHH D;  4FX0 A;  3OYK A;  2BV6 A;  3PNT A;  5EG0 A;  1LVK A;  1IRF A;  4P96 A;  1N75 A;  2ZO4 A;  2VB6 A;  4F91 B;  5LEK A;  2XAU A;  2A05 A;  5FB2 A;  4RAY A;  3G2B A;  4PZJ A;  3H9G A;  4P5O A;  4HW0 A;  2R7X A;  3CC2 I;  2DMT A;  2EIM H;  3VFZ A;  3GTQ J;  2JA8 J;  3J7A O;  2ZCW A;  2ISY A;  3J7Z I;  3AL0 B;  2ZJP F;  2IGO A;  4BAC A;  3QQA A;  1HLV A;  2BVM A;  3ROU A;  2G7H A;  2ZNY A;  5EGO A;  1FIA A;  4B3X A;  4KIS A;  4L5I A;  3DEU A;  5FLX Z;  5IT9 Z;  3KCC A;  1MBJ A;  1MJ9 A;  3BY6 A;  4NQW A;  5M5W J;  3WGH A;  2K02 A;  1FYM A;  3IAM 2;  4O5V A;  4PFO A;  3M07 A;  4XN0 A;  5H20 A;  2FRH A;  1SFX A;  1G3T A;  2UUZ A;  2HQ5 A;  3E6B A;  2H09 A;  1LE8 A;  3EYI A;  2B9S A;  3G1O A;  4HF0 A;  4A3C J;  2HNH A;  3H5N A;  4BU2 A;  2LKP A;  1RKT A;  4EM2 A;  1VQL I;  2KIS A;  2JMW A;  2Y48 A;  3C2H A;  2X9D A;  1BM9 A;  3BTI A;  3VSK A;  1DGR M;  2DFF A;  4RB0 A;  4G7Z F;  3WE3 A;  5LHI A;  3CF5 F;  4BE0 A;  3GO5 A;  2HVR A;  1V55 H;  3QU6 A;  2XRO A;  3SJM A;  2GZW A;  1QZE A;  5CQE A;  5H6Q A;  5D8L B;  4IXA A;  3CJN A;  1AOY A;  1ZR2 A;  4XLN F;  2PFB A;  3NWS A;  1UST A;  4XRS G;  2H27 A;  1JE8 A;  1IN6 A;  1XSD A;  3DPT A;  3OIP A;  5EZH A;  1W36 C;  3OR1 C;  1HW2 A;  2HZT A;  3V8J A;  2NVT J;  4P9U A;  3DBR B;  4UVC A;  1Q1V A;  3PM1 A;  2DFI A;  4MFD A;  4QLC U;  3GYH X;  2EV0 A;  3MKL A;  1ETX A;  2EQR A;  3RCO A;  4R79 A;  4IHS A;  5IOZ A;  4MLO A;  4KN4 X;  4HF2 A;  2BXY A;  5GPA A;  1GDT A;  3DKW A;  3H35 A;  5LFA A;  3HB9 A;  2X1C A;  4FX4 A;  4ESB A;  5EEA A;  4L5J A;  2K3F A;  2PQ8 A;  2XRN A;  2QWW A;  3M8F A;  1MJB A;  2O9L A;  2DFH A;  2GAU A;  5GAE J;  4IQJ A;  4NC6 A;  2X1E A;  3D5R C;  3GFM A;  3ECH A;  3B6C A;  1AHD P;  4II2 A;  1U5T C;  1AKH B;  2L54 A;  3LFK A;  1Y56 A;  1APL C;  3OYD A;  2JA6 J;  4OOI A;  2YU3 A;  1T0F C;  4E4H A;  2P4W A;  3V8K A;  4XID A;  2ZNZ A;  3KPH A;  2P7V B;  2VKD A;  2XB5 A;  2ACJ A;  3X2Q H;  3TW6 A;  2MAB A;  1VZ0 A;  2L01 A;  1I50 J;  3RPU A;  4E6K G;  3FWE A;  2XC7 A;  2A61 A;  1JTY A;  1XSV A;  2EPF A;  2GWR A;  2HDW A;  4BJT A;  2QBY A;  1EA3 A;  1YW7 A;  3K0L A;  1MKM A;  4M72 A;  4G12 A;  3ZMT A;  4RAZ A;  4C30 A;  5DD4 A;  2GOX B;  3BQZ A;  2DQR A;  3IP4 B;  4D5C A;  3C2G A;  3CCL I;  1WH7 A;  1Y8R B;  1LDD A;  2AHQ A;  2VJ4 A;  4XL9 A;  3BPV A;  2ME0 A;  2Y0S N;  4LIU A;  4FCY A;  2TCT A;  2VPR A;  3GTG J;  3GTL J;  1I1S A;  4Y52 J;  2IEK A;  1RI7 A;  1GV2 A;  1Z77 A;  1T95 A;  2RC4 A;  4PJ0 C;  5CVR A;  5LRS A;  3R0A A;  5L3E A;  2H8R A;  4BE1 A;  1HST A;  1OYI A;  1W7P B;  3BOQ A;  1Z21 A;  1JT0 A;  2KRC A;  1H9T A;  1BA5 A;  5BQT A;  2A6E F;  1VQ7 I;  2LBF B;  2N8G A;  1XCB A;  1WGX A;  2WV1 A;  3EUH C;  5F64 A;  5HLG A;  3BR5 A;  2G9W A;  4J01 A;  4N9H A;  1DPR A;  4DIQ A;  5C44 J;  2GQQ A;  1R5I D;  1SMY F;  2F4O B;  3V4G A;  4M6X A;  1YIO A;  3ZR8 X;  4RGU A;  4ZTF A;  1FOX A;  1POG A;  1UJ8 A;  4W97 A;  2EBI A;  5M5X J;  3WTY C;  4RLQ A;  4RGS A;  3U1K A;  2HXO A;  2M7B A;  4XOP A;  4C2U A;  4C9Y A;  3H5A A;  1OCO H;  3W2A A;  4XKW A;  4XLP F;  3MMY B;  2MH9 A;  4PK4 A;  4RAG A;  1XMA A;  3CO7 C;  2BY2 A;  2HWV A;  1SVO A;  2DO7 A;  3RSN A;  2YUS A;  3LSH A;  2IBD A;  3R4K A;  3RQ4 A;  1FWZ A;  2PJR A;  2VBX A;  4B1R A;  4C3H J;  1B8I B;  3QPH A;  3MN2 A;  4S0H B;  1LNW A;  5DM7 F;  2VOO A;  5IPA A;  5L3D A;  3S1N J;  3HGY A;  1A6Q A;  1KGS A;  4G9Y A;  1R4N B;  1HQC A;  1DQU A;  5KCM A;  4IX7 A;  1EH7 A;  4H0E A;  1SFE A;  1WI9 A;  3GZN B;  3TO6 A;  3SDG A;  5IT3 A;  3LQR A;  2R5Z A;  4OWR B;  2R5Y A;  2E35 A;  1IUY A;  3G1L A;  3UNG C;  1EF4 A;  2VN2 A;  4HQM A;  2HFH A;  1YJ9 I;  5J1U A;  4XRM A;  4FT8 A;  1UG2 A;  1SFO J;  1FZP B;  1BR2 A;  1DDN A;  2NNY A;  3HRU A;  2FOW A;  4F52 A;  2Y9Z A;  1VQM I;  1J75 A;  3T0Y A;  2XAG A;  4HNT A;  3W2W A;  3EUA A;  2W00 A;  3A03 A;  2UXX A;  2MFZ A;  5CJ9 A;  3SZG A;  1H88 C;  1ETV A;  4DYR A;  5E1Z B;  2E60 A;  3E5U A;  4DBQ A;  1FNN A;  4XON A;  4MNU A;  3WG9 A;  3ELK A;  5FKN A;  4HSR A;  2KKO A;  4BL0 B;  2LDU A;  2QUF A;  4WK8 F;  5J40 A;  1O4X A;  3LOC A;  1OR7 A;  2X85 A;  1QHG A;  2ADU A;  4CCK A;  3FXQ A;  1VQ8 I;  3G73 A;  2RAE A;  4BBR J;  2M9H A;  2HYF A;  2VQH A;  1TW3 A;  4L18 B;  3U21 A;  1ZR4 A;  3OL4 A;  5HS8 A;  2V1X A;  2EFN A;  2DQL A;  4EEF G;  3QAH A;  3I71 A;  5LHH A;  3DBH B;  1YI2 I;  5ICG A;  1OCZ H;  2FJ1 A;  4CUG A;  3KLO A;  4I6Z A;  2LG4 A;  4BYY A;  1ACI A;  2IS1 A;  3I59 A;  1MH4 A;  4DOZ A;  4Y3O A;  3FK7 A;  4CCM A;  2W7N A;  2L9R A;  4ZC3 A;  4HQE A;  5GTH C;  3NAU A;  4BQO A;  2DN0 A;  2VE8 A;  4YEL A;  5IOY A;  3OIQ A;  4D9J A;  1B1B A;  2HDD A;  1EJ9 A;  1G6N A;  3REO A;  4NB5 A;  3I4P A;  5B1A H;  3OY9 A;  2OZU A;  3DU5 A;  3GW2 A;  5LEJ A;  3BCA A;  2L5Q A;  3T5X A;  4A0Z A;  2COM A;  2X6W A;  4XOR A;  3BLY A;  1UHM A;  5E3L A;  2PN6 A;  2K9N A;  1QPI A;  2FNA A;  2KZG A;  2RNG A;  5B3S H;  1JHF A;  3V7R A;  1J9I A;  4A12 A;  3R61 A;  2NVU B;  1NK3 P;  3NEU A;  3HEF A;  5LGU A;  3AKZ A;  3FX3 A;  3GF2 A;  1FYL A;  1P4X A;  4Q4Z F;  4ZDO A;  4HG2 A;  1F43 A;  2O5R A;  1E2X A;  3PO3 J;  1OCP A;  1WWX A;  4RM3 A;  2M34 A;  4YIF A;  4HX4 A;  1V5F A;  5TGT A;  3JCU C;  1YX5 A;  4PDK A;  4FE7 A;  3PNY A;  1JKR C;  4PJJ A;  5K5O A;  1OKR A;  3ZQL A;  3HOX J;  2C6Y A;  2BYV E;  3GLL A;  1FTT A;  3I0T A;  1R49 A;  1P2F A;  5FGM A;  1IF1 A;  3CP8 A;  3C1D A;  3GME A;  2X1D A;  3C3W A;  1GVD A;  4HRI A;  4QTR A;  4UUS A;  5E20 A;  4PGH A;  1FBS A;  2D5V A;  2F6C A;  2KIQ A;  3GUD A;  4IKF A;  4BHC A;  3PSI A;  4WXC A;  1F36 A;  4L0Z B;  2A68 F;  1U6G A;  1TWF J;  2BW3 A;  3HKZ N;  1S3J A;  2A5Y B;  1VTN C;  2HOA A;  3BJA A;  2R7R A;  5K7Z A;  1QBJ A;  3S3M A;  2DK8 A;  4G7H F;  2FMY A;  3I5U A;  2LMD A;  3RYR A;  2QCO A;  3J80 K;  4NHJ A;  1YQA A;  1D0X A;  1PUE E;  2DW4 A;  2EFO A;  4M9Z A;  1PP8 F;  3A02 A;  3S2W A;  1IRZ A;  3PFI A;  3HPG A;  3VB2 A;  4KFC A;  5DCM B;  4BJ5 C;  4EJO A;  3BPX A;  3PUB A;  3EUK L;  3T8T A;  2R3S A;  1VND A;  1X1P A;  2IS4 A;  1OFC X;  2Z5U A;  2LYC A;  3VEP A;  2VQL A;  2P5V A;  4I98 B;  5EEH A;  2M4K A;  1KA8 A;  2ESN A;  1MBK A;  3BJ6 A;  3ABM H;  4U0Y A;  3JRG A;  1TT0 A;  3I64 A;  3JTG A;  5LGN A;  1MBF A;  1NG6 A;  2I5U A;  2IW5 A;  3CZ6 A;  2P7C B;  5KK1 A;  2VUM J;  3ASN H;  3H3V K;  2VJ5 A;  3H1C A;  4X6A J;  2MBF A;  2M0M A;  1HC8 A;  2EWN A;  1NH3 A;  3BTL A;  2LKS A;  2RVC A;  5BMZ A;  2IRF G;  3QRF F;  2DA2 A;  1J59 A;  2E5N A;  2VKE A;  2EA2 A;  3SEQ A;  3L2C A;  3F8B A;  1BL0 A;  3L9F A;  2DT5 A;  2WC2 A;  1CF7 A;  2KIM A;  2K9M A;  2R7U A;  2VC1 A;  3FHN A;  1SMT A;  2BEO A;  1XGN A;  1ZAO A;  2IAI A;  4QWQ A;  1GUU A;  1JI8 A;  3W6K B;  4DW6 A;  2UWM A;  1G3W A;  2QVO A;  5KAF C;  4CA0 A;  2W1O A;  1ENH A;  2DOA A;  5JVT A;  3CQZ J;  2F5F A;  1PJR A;  2IP2 A;  2RRE A;  1Y8Q B;  3H9J A;  3O2P E;  4HLY A;  4LK0 F;  2QEX I;  1R71 A;  4AID A;  4GRI A;  1BJA A;  4XKV A;  3DP7 A;  3KZY A;  5IYB J;  2HI3 A;  1ZRF A;  4RB2 C;  3WTU C;  2GIV A;  4F7Z A;  4HYE A;  3ASO H;  4HV6 A;  1NTC A;  2HTJ A;  3E6D A;  2K86 A;  1PVE A;  1RC9 A;  3TKY A;  1BOB A;  1BR4 A;  5FKK A;  1FSH A;  4LLL A;  3SXY A;  3S16 J;  3E5X A;  2FOK A;  1HXD A;  5GAH J;  3ZQF A;  5K5R A;  3G3Z A;  3J80 Z;  2QYO A;  3OS1 A;  3CCR I;  5L3G A;  3DFG A;  3KZI C;  4CCN A;  3ABK H;  3MZ8 A;  3HG9 A;  4NNJ A;  4LD5 A;  4DYC A;  1TQM A;  1XG1 A;  2CMP A;  5GPC A;  3CUQ A;  3V8L A;  3S2H J;  3CMY A;  1OR7 C;  1FP1 D;  3I9V 2;  2CQQ A;  3K2A A;  1B59 A;  2FU4 A;  2JTV A;  4MIM A;  2GA1 A;  1W5C C;  3I4N J;  4OU0 A;  2CV0 A;  1AA7 A;  2WB1 A;  2M87 A;  5C4X J;  1LKX A;  1LFP A;  3S2D J;  2CG4 A;  2DI3 A;  3BR6 A;  1I27 A;  3FBI B;  3MFK A;  1SC7 A;  1MDM B;  5JR3 A;  3HZJ A;  3CCY A;  3KE2 A;  3K6G A;  4OAZ A;  5HNF A;  1D1C A;  4KT5 C;  1MGT A;  2UZK A;  2E1O A;  3RKQ A;  1WJC A;  2W25 A;  5J1R A;  1SFU A;  3CES A;  3F8F A;  1ETK A;  2W85 A;  2CQX A;  4BXU A;  5F1J A;  4E7J A;  5HOD A;  4H4K C;  4CH7 A;  1VQ4 I;  1X2N A;  1TZL A;  5F0C A;  3DTE A;  4LG0 B;  4ZYA A;  3JSO A;  3H36 A;  3P9C A;  2XKP A;  2P81 A;  2NNN A;  4ZZD A;  1ONV A;  1R1V A;  3HGG A;  3BG7 A;  2VPL A;  1RRJ A;  2QEN A;  2V9V A;  2XIG A;  3K4C A;  2XHK A;  2NS8 A;  4L5E A;  3OYB A;  4Z2Y A;  1RZ4 A;  1GXP A;  5IT9 K;  2CWE A;  3MCZ A;  1MNM C;  1JTX A;  1YFH A;  2EZL A;  3FDY A;  1E3H A;  2CU7 A;  2XAF A;  4HDV A;  3MAJ A;  2R4G A;  4EMS A;  4S04 A;  2OTJ I;  2OC6 A;  5CKT A;  3N4M A;  4ENK A;  4JX4 A;  4PSW A;  1O7L A;  1F5T A;  1PYV A;  2HGC A;  3CJT B;  4D0P A;  3TMO A;  4FE4 A;  2KZV A;  1TC3 C;  4G8X A;  3RKX A;  2GOM A;  3VSL A;  1OQY A;  5HDK A;  4IRI A;  2NXN B;  1VQO I;  4JYK A;  4IRH A;  2JPB A;  1FMV A;  5EG0 B;  4I01 A;  4IVN A;  1XGM A;  4NC7 A;  4EQQ A;  4DNC A;  3PFY A;  4AC0 A;  2LLK A;  2CFX A;  3BT9 A;  2NRA C;  4EJV A;  2BBY A;  2VBY A;  2M45 A;  3U2R A;  2ZJR F;  4JOM A;  1W5S A;  4A5N A;  3KEQ A;  2QZ8 A;  4O6J A;  3F0C A;  1MH3 A;  2KHM A;  4Y33 A;  1JHH A;  2DA4 A;  2L0K A;  1R7J A;  2ELJ A;  3RQI A;  3DXJ F;  3NAR A;  5CLS A;  4F92 B;  3ERE D;  4HX8 A;  1Z7L A;  4XR6 A;  3WG7 H;  3QYB A;  3A2K A;  4YIR X;  4WF2 A;  4YG2 F;  3ZMZ A;  1WQ2 A;  1B72 B;  2QQB A;  4CCO A;  1XN7 A;  4HX7 A;  4UUT A;  1LEB A;  2IVM A;  3IAS 2;  2DYR H;  1OYW A;  2BHZ A;  1FMW A;  3TGN A;  4CGZ A;  3IH4 A;  5K7F A;  1C0W A;  2Y2Z A;  5E3N A;  1W7P D;  4ENM A;  4PUS A;  1TNT A;  3L7W A;  5J6X A;  2HYG D;  4ESF A;  1ZG5 A;  3HDD A;  5FRO A;  5JHU A;  2VJJ A;  4HST A;  4HAM A;  3FXM A;  1RUN A;  2BY3 A;  5J1Y A;  5FD6 A;  1K4T A;  1PUF A;  1LFB A;  1BIA A;  5ILS A;  1HDP A;  4DYQ A;  2DAO A;  3S1R J;  5E1X A;  4J00 A;  1D1A A;  2KT0 A;  1F9N A;  4KIG A;  5D5W B;  4ZH4 F;  3W6J B;  3WTW C;  4ZYD A;  1M1E B;  4RAF A;  4BXF A;  4DZJ A;  3ERM A;  4FET A;  5AIQ A;  1YW9 A;  3QPS A;  1TBX A;  3L2U A;  4AIH A;  2RN7 A;  4IEJ A;  3HJE A;  2L2O A;  3GTP J;  5HVQ C;  4QIW N;  2DPU A;  3JRF A;  2LSO A;  1W0U A;  2B7E A;  3AAF A;  2V7F A;  2X4H A;  3DPL C;  3JW4 A;  4HEA 2;  3F21 A;  1IXR C;  2F2E A;  1X1B A;  4HLX A;  2DOF A;  3CJR B;  1D1B A;  1CGP A;  2DXI A;  2KLO A;  4GGG A;  5E79 C;  2AQF A;  4M9S A;  2MD0 A;  2R7Q A;  2K85 A;  4F55 A;  5EDN A;  2X6O A;  1ZKG A;  3D5S C;  3FHZ A;  2VKH A;  2HOS A;  1BIB A;  2H94 A;  1P92 A;  2NYX A;  4ZDL A;  4A3K J;  2AS5 F;  2Q0O A;  3ZMS A;  3HOU J;  1OMI A;  3Q0U A;  5DYM A;  5DD8 A;  4OIO F;  2X0L A;  2ZBK A;  5B1B H;  4LMY A;  3F9K A;  2JA7 J;  4AD9 A;  2DA3 A;  2K3P A;  5HS7 A;  4M74 A;  3FXR A;  1ZQ3 P;  2LNB A;  4ASN A;  2NOG A;  5FFX A;  1LUJ B;  1YLF A;  3Q0V A;  3COA C;  3OYC A;  2KJB A;  3IV5 A;  3CCU I;  1O57 A;  3CUQ C;  2ID3 A;  3HUG A;  5F27 A;  3KFW X;  4LLG F;  2NS0 A;  4U88 A;  1JT6 A;  2V1U A;  2HXI A;  2VXZ A;  2ZXW H;  1ON2 A;  5LD2 C;  5JHF A;  3S93 A;  1TT5 B;  1X1D A;  2ZFU A;  1NG7 A;  2DJN A;  2DA7 A;  5FJ8 J;  1RUO A;  3M9A A;  1Y6I A;  1VF9 A;  1ETW A;  3LL7 A;  4CHU A;  3CDH A;  2X6Y A;  4G7O F;  4AVZ A;  3M8E A;  3CDI A;  2NVY J;  2E1M C;  2K9S A;  2E7W A;  3ABT A;  1TWG J;  1ERD A;  2DDA A;  4L9J A;  2LY1 A;  3LSJ A;  4D1Q A;  3WGG A;  3ZPL A;  3ZQC A;  1KZH A;  5J47 A;  3R0J A;  3LWF A;  1KQ0 A;  5LHG A;  2MLG A;  2BY1 A;  3GTJ J;  1ETY A;  3SYT A;  3OMY A;  2CV1 A;  4YII A;  4A5M A;  2LD5 A;  1ETO A;  2O61 A;  1AU7 A;  2HEO A;  5IYD J;  3MKW B;  2LF8 A;  2XGC A;  1S9H A;  4M3E A;  2LTP A;  4WWC A;  4N9I A;  4KDP A;  2ZSH B;  4M3D A;  4AWX B;  3ZQI A;  5E3O A;  2M30 A;  1U9O A;  5ICF A;  2EIL H;  1SVL A;  2PLY A;  1D0Z A;  3KIO A;  2CO5 A;  3F8N A;  4MEX F;  5J4Y A;  1J7K A;  5IP6 A;  1Z3Y A;  1U78 A;  5K1Y A;  2VE9 A;  2I10 A;  2RKH A;  3BG5 A;  2CQ7 A;  2QGU A;  3QOD A;  3QP5 A;  2DMP A;  2JSC A;  3K4N A;  1GVJ A;  2PMZ N;  2ID6 A;  2STW A;  2D1V A;  2ECB A;  1D8J A;  3PQK A;  4FAS D;  4KYW A;  4AIJ A;  2DTR A;  2CJJ A;  3GEZ A;  1LEA A;  3F3X A;  2FA5 A;  2HPI A;  3HYI A;  1OLT A;  2FQ4 A;  4PSX A;  2P5K A;  1BI1 A;  3PIO F;  1SVM A;  3L09 A;  2JN6 A;  3GFJ A;  1VQ9 I;  3HOS A;  4IJA A;  3OSF A;  3MVP A;  5HS9 A;  1HBX G;  4MGR A;  1DUX C;  1AKH A;  2VIX A;  3BC8 A;  3H0D A;  3VOD A;  1P6R A;  1ZN2 A;  2Z33 A;  1ZGA A;  5E1W A;  1IN4 A;  1R1T A;  3Q9S A;  1R58 A;  1P7I A;  2JPC A;  4YFN F;  2LK2 A;  2HKO A;  2R7D A;  1T08 B;  5HLT A;  1YYV A;  4L0Y B;  3OL3 A;  2Y30 A;  3ZP5 A;  5E8I A;  3AG2 H;  2A69 F;  1FSE A;  4F3Q A;  1S7E A;  3R6S A;  1MZB A;  2IGK A;  2VBW A;  3FMQ A;  2F4M B;  3O8H A;  1Z91 A;  3BJO A;  4FIS A;  3OYG A;  3TW7 A;  2ZXH A;  4MEY F;  3QOE A;  1X19 A;  3QYE A;  3E5Q A;  3E6C C;  3EYY A;  2QKM B;  4A2U A;  5KNL A;  2GLO A;  4GCV A;  3WGI A;  1X58 A;  3JRC A;  1UHW A;  3LNQ A;  1XC5 A;  1BI2 A;  3DEE A;  5FFZ A;  2RQP A;  5AIP A;  2OAZ A;  1W7P A;  1DPU A;  2OUM A;  3E0J B;  2OCC H;  3S15 J;  1I3Q J;  2EA4 A;  1S6L A;  3TL4 X;  2XGX A;  4BH9 A;  2VQC A;  3GWZ A;  5GP9 A;  2D1H A;  4MFE A;  2O6G E;  2LBF A;  4P1W A;  4UV8 A;  1FJL A;  5BOX A;  1G2H A;  2LOO A;  4BS9 A;  3R60 A;  2OZ6 A;  2XGD A;  1R22 A;  3BR0 A;  2DA5 A;  2AXT C;  4CIC A;  2XDV A;  2LH9 A;  3HOW J;  2JT1 A;  3CLQ A;  3ZMD A;  2Y0S A;  2M2E A;  3TO7 A;  4RMN A;  4JP0 A;  3BZ6 A;  3LSK A;  4MO7 A;  3JSP A;  5TRD A;  1A36 A;  4UB8 C;  3PSF A;  1R5G A;  2CQK A;  3ISP A;  2P0W A;  2IA0 A;  1RPW A;  1G59 A;  4MTE A;  3IWF A;  4NBQ A;  2KRH A;  3LSP A;  5C4J J;  2KQR A;  4XNF A;  2IS2 A;  1O3Q A;  1B8I A;  1KU2 A;  1BR1 A;  2HDC A;  2QQ8 A;  2ZJ2 A;  3EDP A;  2AQE A;  2E7X A;  4JX5 A;  5DM6 F;  1E0E A;  2ZME B;  4DBR A;  1H9G A;  4RB1 A;  1UG0 A;  3GVA A;  1QRY A;  3HSF A;  4AU7 A;  4A0Y A;  2MH2 A;  4OIQ F;  4BNC A;  4KUM A;  1JUM A;  4CSW A;  3AL0 C;  2GXB A;  1DP3 A;  1JJ8 C;  5CPR B;  2WWY A;  2LRE A;  3RYP A;  1QU3 A;  4CZC A;  3QPL A;  3PL8 A;  1YX3 A;  2WAQ N;  5KVR A;  1JKO C;  4P55 A;  2ELK A;  4HV5 A;  2CQN A;  3SHF A;  3GTM J;  2LC2 A;  1WHU A;  1ORK A;  1MBH A;  4BY1 J;  2W4S A;  2Z16 A;  3JRB A;  1LB2 A;  5EYR A;  3KZZ A;  5JFR A;  5D5U B;  4NUB A;  2VL8 A;  3VWB A;  1ETQ A;  2MSY A;  1BW5 A;  1IJW C;  1GLN A;  2A6H F;  1FOY A;  3OYL A;  2EIJ H;  3K4K A;  3LFU A;  3PIP F;  2A07 F;  1ZLJ A;  3HHH A;  3T1B A;  4BDZ A;  3WU2 C;  1T2K A;  4I7H A;  5TIS C;  3F6V A;  3O6B B;  4IF4 A;  4DGW B;  5IYC J;  1YRN B;  5E8G A;  4D5F A;  1R00 A;  1YOV B;  1XGO A;  5FO5 A;  3TO9 A;  1L3L A;  4UUV A;  1SD4 A;  2V1D A;  1IZ1 A;  2HR3 A;  2WY8 Q;  1P4W A;  2M7A A;  4BY7 J;  2BOL A;  3C2B A;  3I54 A;  3S3N A;  1CQT A;  1MBG A;  2PG4 A;  1I6H J;  4I76 A;  4IHT A;  2Q2E B;  3BTJ A;  1T33 A;  2LY9 A;  4CDG A;  4ETS A;  3L2V A;  2IA2 A;  3CME I;  2FBI A;  4LOC A;  3KET A;  2XRL A;  2FF4 A;  4KMF A;  1S7O A;  3M1C A;  4M3F A;  4EM1 A;  1TQI A;  1A5J A;  2PMH A;  1RET A;  1FY7 A;  3TOA A;  3IH2 A;  1YHQ I;  3K1P A;  1F4K A;  4NDL A;  2VON A;  5M5Y J;  2CW7 A;  2OBP A;  2PMU A;  5FLV A;  1R5H A;  2IXS A;  5HOO A;  1VQK I;  2LF7 A;  3RKY A;  3TOB A;  4E7K A;  3FZV A;  1YIJ I;  1ZRC A;  2CV2 A;  1SEU A;  3ZQQ A;  3ZN0 A;  2GIZ A;  4HDU A;  2MC4 A;  1KQ8 A;  5AON A;  2HZD A;  2EJR A;  4GDF A;  1VQ6 I;  2PJP A;  1A35 A;  4ZJZ A;  4RLF A;  1ZYR F;  4ANJ A;  5BS6 A;  3SFI A;  3MKY B;  3L2W A;  2W48 A;  5EEG A;  1IC8 A;  2H6C A;  3K2Z A;  4A3B J;  3QWL A;  2VJI A;  2O3F A;  3GXO A;  4BEH B;  3UKG A;  2QM3 A;  4E7H A;  1V3F A;  1SD5 A;  1STZ A;  2M8E A;  1KU9 A;  2CUJ A;  2MC3 A;  2YX4 A;  2OQR A;  3ZQG A;  1QNT A;  2BVL A;  3AG1 H;  3LA3 A;  5CVV A;  4E7L A;  4A93 J;  3CO6 C;  2DMQ A;  5F0H A;  4B4C A;  3L00 A;  1AWC A;  3WU0 A;  1XCV A;  1FBU A;  2HQA A;  2ZXJ A;  3CC7 I;  4G6D A;  2KDZ A;  2ZSI B;  1I3A A;  4C3I J;  2D2W A;  3E1S A;  5D5V B;  4W1U A;  2H1L A;  3MEX A;  1D5V A;  1G8X A;  1R4M B;  2OU2 A;  1RES A;  3DTI A;  4B44 A;  3OYA A;  1TNS A;  1HKS A;  4EVI A;  4A3J J;  3JTH A;  4GO1 A;  5E18 F;  4QSH A;  3OR2 C;  1Z9C A;  3BG6 A;  4I99 C;  4AYB N;  4XK4 A;  1D5Y A;  4U0W A;  1MD0 A;  3RZO J;  1BN5 A;  2XUB A;  3H92 A;  2D45 A;  2FX0 A;  3SZP A;  3IH3 A;  2HU9 A;  1D3Y A;  5FD5 A;  1Y0N A;  1QA6 A;  1TP4 A;  3K10 A;  3KEY A;  2WAF A;  1MJA A;  4B09 A;  1X3U A;  1XX5 A;  1YE9 A;  3JR9 A;  3K4M A;  2M1B A;  2ZFW A;  1SD7 A;  3B6A A;  3SZT A;  2R7S A;  1EH6 A;  2TRT A;  3DQV C;  3H3Z A;  3LMM A;  4HZF A;  1BI3 A;  1MIJ A;  4BUP A;  2ISZ A;  2HVQ A;  3FMS A;  3I56 I;  1FC3 A;  1TWA J;  2RDP A;  2Y69 H;  3MZH A;  2IT0 A;  2VOD A;  5DCM A;  4E70 A;  5ICE A;  3VPR A;  4A6E A;  3CMA I;  2NVX J;  1LQ1 A;  2QSG X;  3ML6 A;  3ZCO A;  2QQ9 A;  2XGE A;  2DCE A;  4Y17 A;  2XKO A;  1WZ2 A;  4CYC B;  1T8I A;  1VQ5 I;  2ETH A;  3ZMU A;  4A6D A;  5EZG A;  3D0S A;  1X4O A;  3TQN A;  3RZD J;  1ZGJ A;  1UAA A;  2HVS A;  2PEX A;  2Y0M A;  4XMY A;  1MMN A;  4XRS A;  4G6Q A;  1U8R A;  2Y75 A;  5KAI C;  1VQN I;  3A0B C;  3FXK A;  2Q8K A;  4O3M A;  4RGR A;  2HTS A;  3OYH A;  3QP6 A;  4ZYH A;  3K69 A;  1I6X A;  1R23 A;  4GYI A;  1IXC A;  5K5Q A;  3GTO J;  1GV5 A;  3ESW B;  3O8G A;  1WJF A;  2HS5 A;  3I4M J;  4A69 C;  1Z6T A;  3BDD A;  2L7F P;  1LDK B;  1Y1W J;  1ZHF A;  3TBI A;  3PNV A;  4WXH A;  3OWT A;  4D7M A;  3HC7 A;  1U5T B;  1USS A;  1K78 B;  1MSE C;  1BW6 A;  1ITY A;  5M3M J;  3M7G A;  1T39 A;  3LST A;  3JRA A;  1QQI A;  1SFK A;  3LA2 A;  1O7F A;  1XTA A;  4HF1 A;  1DU6 A;  1A04 A;  4ZYE A;  2CYY A;  3PO2 J;  2H8W A;  3W2V A;  3RI4 A;  3HRT A;  3M1E A;  4PJL A;  4L9T A;  2OQG A;  3SQN A;  2AXL A;  2BZT A;  3LSG A;  2DYS H;  4F93 B;  4L9N A;  1K79 A;  1IO2 A;  1G4D A;  3M8J A;  3OYI A;  1ZEL A;  4B48 A;  3WU1 B;  1I5Z A;  3Q3S A;  2FUG 2;  4XSZ F;  4M3B A;  5DTD A;  3S3O A;  4IHW A;  4A3D J;  4BKX A;  1IDY A;  4XM3 A;  4JX6 A;  1Q1H A;  4KA4 A;  3F22 A;  1ZRD A;  2DMN A;  3FKI J;  4L9V A;  2XAQ A;  3OYM A;  1RKW A;  3RKW A;  2VAS A;  1E17 A;  2KPM A;  3HRM A;  1FOK A;  1IUF A;  2Z2S B;  2WTE A;  3RIR A;  3HL2 A;  2CS3 A;  2EV5 A;  1IN7 A;  2LP0 A;  1K83 J;  1SAX A;  2KRF A;  2B0L A;  2JQ7 A;  2K9L A;  2OPT A;  4CXF A;  2IJL A;  2AO9 A;  1B9N A;  2YU9 J;  1YIT I;  4KJZ A;  1OIS A;  2COB A;  4V19 K;  2F5V A;  1V4R A;  3HOV J;  3V42 A;  1MDM A;  1KU7 A;  4K2E A;  4AUX A;  2XSD C;  1A31 A;  2BY0 A;  3W6V A;  2EIN H;  3A01 B;  1IRX A;  1W5T A;  3BZC A;  2JUC A;  3TED A;  1UB9 A;  1XS9 A;  3KYC B;  5D4S A;  4BDY A;  1KU3 A;  4JQF A;  2KFD A;  2FXA A;  2ESH A;  2DTZ A;  5H6R A;  2Z1D A;  4LG0 A;  2DU9 A;  2P5L C;  3V7C A;  2ICW G;  2VLA A;  4A0X A;  2JA5 J;  3DKY A;  1FTZ A;  2DA6 A;  1QPM A;  3HHG A;  2GM4 A;  4E7S A;  2FEZ A;  5E3M A;  3OYF A;  3BG3 A;  2ECC A;  5F04 A;  1XDU A;  3CF2 A;  3K4B A;  2CUE A;  3BR3 A;  3FBN B;  3NWT A;  4XN3 A;  1RR7 A;  2XAS A;  1WJB A;  4B47 A;  3U9G A;  3MKZ A;  1X1A A;  2Z3Y A;  3BTC A;  2XVC A;  4Y7N J;  1E3P A;  4M6V A;  3CCJ I;  5EGO B;  2E2H J;  4IOA F;  3CJQ B;  3GZ5 A;  2XPU A;  2E36 A;  4DZP A;  3A0H C;  2JJ7 A;  2EK5 A;  5D8K B;  2DBB A;  4NQW B;  4RM2 A;  1BOA A;  1WI3 A;  1U0J A;  3I53 A;  2LRD A;  3UR3 C;  2JZY A;  4XSX F;  2I8D A;  3DTK A;  1IAW A;  2RV8 A;  3B02 A;  4CCL A;  1HW1 A;  3H9Q A;  2PX9 A;  3KP2 A;  5HLH A;  1D8K A;  1ZAR A;  1DGW Y;  5ILU A;  1LE8 B;  2DT7 B;  1KYW A;  2KP6 A;  1HDD C;  4XIC A;  4BAY A;  3K1M A;  2LKX A;  1L0O C;  1Z1D A;  3K1N A;  2OJE D;  5GAD J;  4GYG A;  3IC7 A;  3CLO A;  2MGQ A;  2M5W A;  1HSJ A;  2V6E A;  1S72 I;  1J5Y A;  3ABU A;  4BQQ A;  5FLM J;  5DS9 A;  1N77 A;  1XMK A;  1TL8 A;  2ELH A;  2BHY A;  4ENJ A;  4YFK F;  2CUZ A;  4LIV A;  1JUS A;  4B8X A;  4N0B A;  5ED4 A;  2CFO A;  5JLX A;  3GFI A;  3BZK A;  3CDL A;  3F6O A;  2QA4 I;  1TWC J;  2TDX A;  1FOW A;  1E3O C;  1B72 A;  4GXO A;  1IDZ A;  3DEW A;  2VXD A;  3F8C A;  2K40 A;  2PI0 A;  3EPZ A;  1YG2 A;  1U2W A;  5F0F A;  3ULQ B;  1RIO H;  2JA2 A;  5L3B A;  2M3A A;  3C7J A;  4LFU A;  3F23 A;  4ZTJ A;  1MND A;  3AG4 H;  5H2F C;  2E1C A;  4E7I A;  3AG3 H;  5B5E C;  3KP4 A;  1P4A A;  3K9T A;  1UCR A;  2O8K A;  3HSR A;  1WFX A;  3HUG B;  1BC8 C;  2ZKZ A;  3JAM Z;  2H6B A;  1UMQ A;  1G3Y A;  3OV8 A;  3GLX A;  3VYS B;  4XRF A;  5DCF A;  2E2I J;  1WRJ A;  2EFW A;  1HW5 A;  4ESJ A;  3S14 J;  5LLQ A;  3CCE I;  3BP8 A;  2IPQ X;  3RDI A;  2Z9O A;  1ZK8 A;  2M4G A;  1JGG A;  1OCC H;  4XLF A;  5JLW A;  1A6I A;  2H1K A;  4EJT A;  3B73 A;  1Z7U A;  3BG9 A;  1Y1V J;  3IWZ A;  3S32 A;  1QZZ A;  2L7M P;  4WX9 A;  1QO0 D;  4OAY A;  2O03 A;  3GCM A;  3IRQ A;  1WKM A;  2DT6 A;  1ZTR A;  3RTR A;  4ZDP A;  3MWM A;  1UFM A;  5HNH A;  1P7J A;  2F5E A;  5A2Q Z;  3ONQ A;  3HIF A;  5J8F A;  2JRT A;  2UV1 A;  3OOP A;  4XQF A;  1I39 A;  4M9X A;  1U9N A;  3TP3 A;  2P6S A;  2JWT A;  2VOP A;  3I3L A;  3TP0 A;  2OF7 A;  4ZYG A;  5TJJ A;  3FK6 A;  3LSI A;  3HM5 A;  4LIT A;  1FX7 A;  5LGT A;  3M3Y J;  4XOT A;  3IKT A;  2QBY B;  2IGN A;  4I0B A;  1WH5 A;  2CRG A;  2XSJ C;  3WTT C;  4DQ2 A;  4UV9 A;  2HOE A;  2HQN A;  1IXS B;  4PGG A;  3IL2 A;  1R1U A;  2BXZ A;  2CW0 F;  3FXO A;  1IRG A;  1FLI A;  2RGV A;  1XSX A;  3QPT A;  3ZMV A;  3D1N I;  4LB5 A;  4XKB A;  4JBA A;  4YRV A;  4KIB A;  2W82 A;  1VQP I;  4X0G A;  3HSE A;  2E71 A;  1K6Y A;  3D5L A;  1X4P A;  2WA0 A;  1H8A C;  4LB6 B;  2R7F A;  1DU0 A;  2NOJ B;  4ON0 A;  5LBQ A;  2J5O A;  4RS8 A;  2E1N A;  2MYS A;  1O3R A;  5DUK A;  2OTL I;  1TWH J;  4LK1 F;  4BXX J;  4GFB A;  2MD5 A;  2K5C A;  2DA1 A;  2KMU A;  9ANT A;  2P8T A;  4IQ4 A;  4TV7 A;  3JRH A;  4IHX A;  3DV8 A;  1D0Y A;  2VT2 A;  5HDG A;  3RJP A;  2FSW A;  1BI0 A;  3J7A Y;  2ZXI A;  2J5P A;  2EV6 A;  2KIU A;  3VYT B;  4CZZ A;  2K7L A;  3K70 D;  3CC4 I;  2KL4 A;  1XDS A;  2Z99 A;  4I0A A;  1U3E M;  5DEQ A;  3OS0 A;  3RPQ A;  3E3V A;  3I58 A;  2NS7 A;  4U7B A;  1ON1 A;  3FXL A;  3FIS A;  3L2Q A;  3G4S I;  3GZ6 A;  1SD6 A;  1ZG3 A;  4X1E A;  4U87 A;  4UB6 C;  3CMM A;  2Y9Y A;  3CUO A;  2HPM A;  2CH0 A;  4PFP A;  4OMZ A;  1REP C;  4G6T B;  3DU6 A;  3SDB A;  3QYF A;  1O3S A;  4AIK A;  2WV0 A;  4B3A A;  3WTS C;  4RA2 A;  1WVR A;  3SEZ A;  2PJR B;  4KT6 A;  1HA8 A;  4IPA A;  3IKV A;  3W3C A;  4KNY A;  3PQJ A;  2XPW A;  1IV8 A;  3VYR B;  1OCR H;  2R92 J;  3L1P A;  3CCS I;  4ENN A;  3OSG A;  1MMG A;  1KYZ A;  1YS7 A;  2R5Z B;  5BPD A;  2R5Y B;  2RQQ A;  3CCQ I;  3WTX C;  1DP7 P;  1V5E A;  2ZC2 A;  3FXU A;  2IA1 A;  4V2G A;  3S17 J;  4Y4R A;  2V79 A;  2P6T A;  2VI6 A;  4U0V A;  3TDU C;  5F1R A;  4EGY A;  2JRM A;  1X1C A;  1TQP A;  1YJW I;  1VI0 A;  3BRO A;  3Q0W A;  3ZQH A;  4JK1 X;  2QQA A;  2STT A;  3HTU A;  2E5Z A;  2WAE A;  3S1M J;  1VFC A;  1BJZ A;  1IG7 A;  2HOT A;  4OMY A;  3V7S A;  3IRR A;  1Z3X A;  2YX7 A;  2K4J A;  4MQ9 F;  4XKC A;  4A3E J;  1XD7 A;  2L7K A;  1F1Z A;  4M3G A;  2KIF A;  1MNE A;  1O3T A;  3EQL F;  2PMZ A;  3FM3 A;  2JUG A;  3MD2 A;  3K7A J;  1OYY A;  4BHB A;  1K4S A;  5CQG A;  5KHD A;  2O0Y A;  1TTY A;  3KP3 A;  1ZLK A;  3WTV C;  4OIN F;  3S8P A;  5ICC A;  1WSU A;  2GA2 A;  4KIF A;  1FEX A;  4IL6 C;  4KIC A;  1QGP A;  3QU3 A;  4EJW A;  3JRI A;  2EZI A;  2VQG A;  3VOE A;  1FPQ A;  4QPQ A;  3EET A;  1FT9 A;  2VT3 A;  3I59 B;  1TLH B;  5F6F A;  3JRE A;  1K7A A;  2L9S A;  4OIP F;  4U7D A;  1XPX A;  5D4R A;  3HXL A;  4A3F J;  2KJC A;  1BC7 C;  5J8C A;  4J19 A;  3KEO A;  1MMA A;  5HLI A;  4EV0 A;  4HOB A;  1S7A A;  2L3D A;  2XAH A;  4M6Y A;  2B63 J;  1W36 D;  3BWG A;  1X2M A;  2MG4 A;  3T8R A;  5M3F J;  2W57 A;  1K61 A;  4P9F A;  1XGS A;  3DCF A;  3CCV I;  3HRS A;  4IRG A;  2L4A A;  3FMR A;  3DPU A;  4PCQ A;  1HOM A;  1K6O A;  4ITV A;  4DJA A;  2Q1Z B;  1Z0X A;  2X6X A;  4KIT B;  4EAT A;  1N78 A;  4PJN A;  3OYJ A;  1KON A;  1JKP C;  4NC8 A;  3K4J A;  3LA7 A;  4KMU X;  2FBK A;  1LVA A;  3G1M A;  4ABZ A;  4IO9 F;  4R1H A;  4Q47 A;  4LJZ F;  4RGX A;  1QVU A;  5L3C A;  2R7O A;  2X48 A;  2ZME A;  3F8M A;  2FD5 A;  2JVH A;  3H0G J;  1PP7 U;  3J7Y J;  3GBG A;  4UUS B;  4A3L J;  5JVG F;  4D7N A;  5K7H A;  3G71 I;  3N97 A;  5ERI A;  1MBE A;  2CW8 A;  5C3E J;  1HF0 A;  1X3W B;  5DV5 A;  3KYL A;  4IZZ A;  3I55 I;  3HTS B;  2BW3 B;  1B4A A;  2XF7 A;  1I1G A;  4Y15 A;  1YS6 A;  3FF5 A;  3J81 K;  2O8X A;  3CP2 A;  4BQN A;  3VDX A;  2GXA A;  5FKO A;  2GXG A;  2L02 A;  1V54 H;  2DMU A;  5IP9 J;  2EFP A;  1LPQ A;  1Y0U A;  2V26 A;  3PUF A;  4UVA A;  1LJ9 A;  2YSR A;  2UXN A;  4AVP A;  1Z67 A;  4RBO A;  3VYU B;  3DLL F;  1W0T A;  3MZY A;  2CGP A;  1IN8 A;  1YW8 A;  3P7N A;  1YRN A;  3Q5F A;  1S29 A;  3NRV A;  2G7U A;  3S1Q J;  2LFB A;  1HCR A;  3WHB A;  2FE3 A;  2RNJ A;  1GHC A;  5J4V A;  2PBI A;  5CVI A;  2V4J C;  3KP6 A;  4I09 A;  3U1D A;  3ZOB A;  3P9I A;  1FBQ A;  1Z6R A;  2WAQ A;  3WE2 A;  4BE2 A;  1MSF C;  4UVB A;  1R36 A;  4A3M J;  2Q2E A;  3H5R A;  1MW7 A;  2F5D A;  5DUI A;  2VC0 A;  2G0E A;  4V2F A;  2EIK H;  2IGM A;  1RNL A;  3A4C A;  4Q5S F;  4N4N B;  1H89 C;  5CYV A;  2YR2 A;  2DJI A;  1LDJ A;  2V6C A;  3KX2 A;  1T56 A;  4WXD A;  3Q9V A;  2QSF X;  3HOZ J;  5EF6 A;  1ULY A;  3CCM I;  3ECO A;  2QLZ A;  3ZRG A;  5HDN A;  3LSR A;  2JVG A;  1V5G A;  2K9Q A;  4IHY A;  2R7Z J;  4A3I J;  3E97 A;  1CF7 B;  2OCE A;  3JRD A;  4RDU A;  1SAN A;  1NK2 P;  1EV7 A;  3FIW A;  4ZZL A;  4LG3 A;  5BNG A;  3KLN A;  1PDN C;  3CD6 I;  4Y13 A;  3BCB A;  4LLN A;  1IW7 F;  1S5L C;  4XLC A;  2FBH A;  2ME6 A;  1IV6 A;  2YPR A;  4BEH A;  4EJU A;  4G94 A;  4FHT A;  1UZC A;  1EKE A;  3LAJ A;  1UEL B;  2K27 A;  1OPC A;  3BR1 A;  3J81 Z;  2FNP A;  3GX4 X;  1YJN I;  1ZGW A;  5CVJ A;  2LY2 A;  2WB1 N;  3ABL H;  3F72 A;  3E7L A;  3ZGK A;  2FML A;  3K4L A;  2EH3 A;  2CUF A;  5FKM A;  2IS6 A;  3CTA A;  2F5C A;  4RB3 C;  1JJ6 C;  5FRN A;  4AM3 A;  4XBF A;  5BPI A;  3HKZ A;  4QPO A;  4S05 A;  3KP7 A;  1KQ9 A;  2MLK A;  1MMD A;  3P5J A;  4M73 A;  1JGS A;  3BQY A;  2R7W A;  5FRM A;  1X3Z B;  3CUQ B;  1Y39 A;  1MMS A;  4UHT A;  2R7T A;  2CSO A;  5D6E A;  3ZN1 A;  2EFQ A;  3HOY J;  2HQR A;  4UNO A;  2WAD A;  5IP7 J;  1YTY A;  2A3S A;  2F4I A;  2HKX A;  1W4M A;  1T38 A;  1UHS A;  4CCJ A;  2L9V A;  4HA8 A;  1FP2 A;  3IUO A;  2ZJQ F;  2E34 A;  2R7V A;  3OS2 A;  1EH8 A;  4XLA A;  1GXQ A;  1Z05 A;  4HPQ A;  3OOU A;  4YEJ A;  5LRR A;  4CO8 A;  2E1M B;  2WY7 Q;  1U8B A;  3H3U A;  5GAG J;  5JI6 A;  4MTD A;  1FYK A;  1JUP A;  3L2R A;  1IN5 A;  1GT0 C;  2L4M A;  3HPH A;  5ILV A;  2MA3 A;  4A3G J;  4C3J J;  1OCT C;  2JSP A;  3PJR A;  1G3S A;  3OIO A;  4CYC A;  4AYB A;  3DWL E;  5FKL A;  1P9Q C;  5B66 C;  4FTH A;  4BGD A;  2LVS A;  3KYD B;  5EJC A;  1J0R A;  1B9M A;  2XV4 S;  4CYD A;  1YO5 C;  3LSM A;  1T6S A;  1S8N A;  2BE5 F;  1XMX A;  3DBL B;  2DK5 A;  2M8G X;  3SFZ A;  3WTZ A;  2DDB A;  3C18 A;  1QVT A;  4HNU A;  1WJD A;  4HBL A;  4OIR F;  2W24 A;  2R0Q C;  3OYN A;  2JK3 A;  3MQ0 A;  3TDZ C;  2OA4 A;  3A1Y A;  2OV7 A;  5IY5 H;  1J2X A;  1HKQ A;  1R6R A;  2NAZ A;  2XB0 X;  2A5W A;  2V9P A;  2FQ3 A;  4II3 A;  6PAX A;  4BQA A;  1J09 A;  2DFE A;  4MQV A;  4WCG A;  1JXS A;  3DF8 A;  2VKV A;  2EZH A;  2WBM A;  2XAJ A;  4BBS J;  2A6T A;  2ZME C;  2ZB9 A;  2VBZ A;  1LFU P;  3FM5 A;  1ZH5 A;  1U5T A;  1K78 A;  2DOE A;  2E19 A;  2HYJ A;  3DKX A;  4EGZ A;  3GTK J;  1T0F A;  4I02 A;  2L7Z A;  4XLE A;  5F08 A;  1QZY A;  3NQO A;  3IHU A;  2E2J J;  1WCM J;  4LGW A;  2V1N A;  3RPU D;  4BHP A;  1W1W E;  3ZXS A;  4C2M J;  4E7Z A;  4Z6Y A;  4C2T A;  3BR2 A;  1SAU A;  2K4B A;  2MW8 A;  5CVU A;  2GBY A;  3N05 A;  2X51 A;  1WJE A;  1IGN A;  1WJ5 A;  5J3L A;  3DLA A;  4EM0 B;  3GFL A;  2BGC A;  3LAP A;  4YFX F;  4UY8 I;  5FLX K;  1WJA A;  2O7O A;  3HBL A;  2L9N A;  3WHC A;  4I2O A;  1RR8 C;  5D5X B;  4MHG A;  2V9K A;  5L3F A;  3E6M A;  2OD5 A;  5DDG A;  3JAM K;  1ODD A;  3AFH A;  4UXN A;  5E17 F;  3KP5 A;  2XF5 A;  2QSH X;  1FIP A;  2QKL B;  1ZRE A;  5D6F A;  2EZK A;  2DLL A;  1TW2 A;  2XPV A;  2F48 A;  3P9K A;  4PJM A;  3WOD F;  4IOC F;  1T98 A;  2R93 J;  4N4O B;  4M71 A;  1OJL A;  3K70 C;  1B6A A;  1ZG1 A;  3EUH A;  2DOD A;  5GTI C;  1PUF B;  1HKT A;  3M4O J;  3G6E I;  2KDO A;  4Q48 A;  3ZQ7 A;  3HOT A;  2M0C A;  1R9T J;  4BJ6 C;  1NHA A;  3FXJ A;  1XB4 A;  3QOP A;  3FKJ A;  4B43 A;  4FQG A;  1BBY A;  3A01 A;  2NVQ J;  4KN7 X;  2YS9 A;  4XLH A;  1WPK A;  2LR8 A;  1N25 A;  4IHV A;  4R8H A;  2QF7 A;  2XF6 A;  3LQQ A;  3O3K A;  3OYE A;  2Y31 A;  2W84 A; 
#chains in the Genus database with same CATH homology
 4XKV A;  2VL8 A;  4IQ4 A;  3VWB A;  1GLN A;  3OYL A;  1QHH D;  3OYK A;  3K4K A;  3LFU A;  1D0Y A;  3PNT A;  3J7A Y;  4BDZ A;  2ZXI A;  1BOB A;  1BR4 A;  1LVK A;  4DGW B;  1N75 A;  2VB6 A;  3VYT B;  4F91 B;  3K70 D;  2XAU A;  2KL4 A;  3G2B A;  3H9G A;  4P5O A;  3OS0 A;  4U7B A;  2R7X A;  3OS1 A;  2WY8 Q;  3L2Q A;  2M7A A;  4CCN A;  2BOL A;  4U87 A;  3HG9 A;  4NNJ A;  3S3N A;  3CMM A;  3AL0 B;  2HPM A;  2CH0 A;  4PFP A;  2CMP A;  2IGO A;  4BAC A;  2Q2E B;  3DU6 A;  4G6T B;  3QYF A;  3SDB A;  3L2V A;  2BVM A;  1OR7 C;  3I9V 2;  3M1C A;  3SEZ A;  2PJR B;  4B3X A;  4KT6 A;  1HA8 A;  4KIS A;  3W3C A;  3VYR B;  2CV0 A;  2CW7 A;  1AA7 A;  1MMG A;  2WB1 A;  3IAM 2;  2IXS A;  1LKX A;  4PFO A;  4XN0 A;  5HOO A;  1LFP A;  2RQQ A;  2UUZ A;  4E7K A;  1V5E A;  2CV2 A;  4Y4R A;  3ZQQ A;  3FBI B;  2MC4 A;  1X1C A;  2HZD A;  3K6G A;  4OAZ A;  4ZJZ A;  4RLF A;  4ANJ A;  5HNF A;  3MKY B;  2HNH A;  3L2W A;  3H5N A;  1D1C A;  4BU2 A;  2E5Z A;  1WJC A;  2WAE A;  2VJI A;  4BEH B;  3CES A;  3C2H A;  1Z3X A;  3VSK A;  4E7H A;  1DGR M;  4E7J A;  4XKC A;  4H4K C;  4CH7 A;  1TZL A;  2CUJ A;  4BE0 A;  2L7K A;  2HVR A;  3DTE A;  5CQE A;  4ZYA A;  1MNE A;  2BVL A;  4E7L A;  2PMZ A;  2JUG A;  3MD2 A;  3NWS A;  2HQA A;  5CQG A;  3BG7 A;  3DPT A;  3OIP A;  5KHD A;  2VPL A;  2ZSI B;  3K4C A;  1W36 C;  3E1S A;  3OR1 C;  3OYB A;  3S8P A;  1G8X A;  3DTI A;  4B44 A;  3OYA A;  2VQG A;  4QPQ A;  3FDY A;  3OR2 C;  3BG6 A;  3RCO A;  4R79 A;  2L9S A;  2R4G A;  4MLO A;  2OC6 A;  5CKT A;  2HU9 A;  3HXL A;  3H35 A;  5LFA A;  3K10 A;  4PSW A;  2X1C A;  3KEY A;  2WAF A;  1MMA A;  1PYV A;  1YE9 A;  3TMO A;  2KZV A;  3K4M A;  2GOM A;  3VSL A;  2R7S A;  1W36 D;  3DQV C;  3LMM A;  4IQJ A;  2X1E A;  4BUP A;  3D5R C;  2HVQ A;  1FMV A;  4NC7 A;  3PFY A;  4II2 A;  1Y56 A;  3OYD A;  4E4H A;  1T0F C;  4JOM A;  3DPU A;  3ZCO A;  2DCE A;  4ITV A;  4DJA A;  2VKD A;  2KHM A;  2Q1Z B;  4Y33 A;  2X6X A;  4KIT B;  2MAB A;  1VZ0 A;  4EAT A;  1N78 A;  4PJN A;  3OYJ A;  1KON A;  1X4O A;  3K4J A;  4NC8 A;  4E6K G;  2ELJ A;  1UAA A;  4F92 B;  2XC7 A;  2HVS A;  4XMY A;  1MMN A;  1Z7L A;  4XR6 A;  2HDW A;  3QYB A;  3A2K A;  4BJT A;  1EA3 A;  4CCO A;  2R7O A;  3OYH A;  3IAS 2;  1FMW A;  4C30 A;  2JVH A;  3OYE A;  2GOX B;  3IP4 B;  3GBG A;  4PUS A;  3C2G A;  1WJF A;  2CW8 A;  2VJ4 A;  4XL9 A;  3KYL A;  5FRO A;  2VJJ A;  4LIU A;  4HST A;  4IZZ A;  1LDK B;  2BW3 B;  2XF7 A;  3TBI A;  1T95 A;  3PNV A;  3OWT A;  4BE1 A;  3CP2 A;  4BQN A;  3VDX A;  1Z21 A;  3HC7 A;  4J00 A;  1D1A A;  2KRC A;  4BXF A;  4FET A;  2V26 A;  1SFK A;  2LBF B;  3L2U A;  3VYU B;  3EUH C;  4J01 A;  4DIQ A;  2L2O A;  5HVQ C;  3W2V A;  3ZR8 X;  2V7F A;  3DPL C;  4HEA 2;  4ZTF A;  4PJL A;  1X1B A;  4RLQ A;  3CJR B;  1D1B A;  3LSG A;  2DXI A;  2KLO A;  2M7B A;  2AQF A;  2MD0 A;  4F93 B;  2R7Q A;  4XOP A;  2V4J C;  4F55 A;  4C2U A;  2WAQ A;  3H5A A;  3M8J A;  3D5S C;  4C9Y A;  4XKW A;  2VKH A;  1ZEL A;  4B48 A;  3OYI A;  4BE2 A;  3W2A A;  3MMY B;  2FUG 2;  3S3O A;  4ZDL A;  4PK4 A;  3H5R A;  1MW7 A;  4XM3 A;  2IGM A;  3RSN A;  3OYM A;  3LSH A;  3A4C A;  3RQ4 A;  2VAS A;  2PJR A;  2KPM A;  3F9K A;  4N4N B;  2DJI A;  2K3P A;  2Z2S B;  3KX2 A;  3HL2 A;  2CS3 A;  1DQU A;  5KCM A;  4IX7 A;  3OYC A;  3ZRG A;  2K9L A;  2JVG A;  1V5G A;  4OWR B;  3UNG C;  4KJZ A;  2VXZ A;  1BR2 A;  5LD2 C;  2F5V A;  4F52 A;  3V42 A;  5JHF A;  3S93 A;  4HNT A;  3W2W A;  1X1D A;  3EUA A;  2W00 A;  2ZFU A;  1NG7 A;  4LG3 A;  1IRX A;  3BCB A;  2MFZ A;  1Y6I A;  4XLC A;  3SZG A;  4BEH A;  2E60 A;  4DBQ A;  3LL7 A;  4XON A;  1UEL B;  2X6Y A;  4AVZ A;  4BDY A;  2E1M C;  4HSR A;  4JQF A;  4BL0 B;  1ERD A;  2Z1D A;  2LY1 A;  4D1Q A;  2LY2 A;  2VLA A;  2X85 A;  1QHG A;  4CCK A;  3ZGK A;  3K4L A;  3DKY A;  2IS6 A;  2VQH A;  3SYT A;  3OMY A;  2CV1 A;  5FRN A;  4E7S A;  3U21 A;  3OL4 A;  3HKZ A;  4QPO A;  3OYF A;  1MMD A;  3K4B A;  3CF2 A;  3MKW B;  1S9H A;  3FBN B;  3NWT A;  4XN3 A;  2R7W A;  1WJB A;  4B47 A;  4CUG A;  5FRM A;  3MKZ A;  1X1A A;  2ZSH B;  2LG4 A;  2R7T A;  1D0Z A;  2IS1 A;  4DOZ A;  4Y3O A;  4CCM A;  2W7N A;  4ZC3 A;  3CJQ B;  2WAD A;  4BQO A;  1Z3Y A;  4YEL A;  3OIQ A;  2F4I A;  4D9J A;  4CCJ A;  3QOD A;  3IUO A;  4NQW B;  4RM2 A;  3OY9 A;  1U0J A;  3K4N A;  3DU5 A;  3OS2 A;  2R7V A;  3BCA A;  2LRD A;  2L5Q A;  4XLA A;  3UR3 C;  4FAS D;  2X6W A;  2I8D A;  3BLY A;  2HPI A;  3DTK A;  1OLT A;  3OOU A;  4HPQ A;  4XOR A;  4YEJ A;  2E1M B;  4PSX A;  4CCL A;  3H9Q A;  2WY7 Q;  1DGW Y;  3L2R A;  2DT7 B;  2RNG A;  2KP6 A;  3HOS A;  3HPH A;  2VIX A;  3BC8 A;  3H0D A;  3AKZ A;  2V6E A;  2JSP A;  4BQQ A;  4ZDO A;  4HG2 A;  1N77 A;  3PJR A;  2O5R A;  4AYB A;  2CUZ A;  3DWL E;  4LIV A;  1P9Q C;  4RM3 A;  4BGD A;  2CFO A;  1V5F A;  5TGT A;  1YX5 A;  3LSM A;  5HLT A;  3PNY A;  4PJJ A;  3OL3 A;  2VXD A;  4F3Q A;  4HNU A;  1WJD A;  3EPZ A;  3CP8 A;  2JA2 A;  2IGK A;  3OYN A;  2M3A A;  2X1D A;  4ZTJ A;  1MND A;  4HRI A;  4E7I A;  3A1Y A;  3OYG A;  2ZXH A;  2OV7 A;  3QOE A;  1WFX A;  1X19 A;  2F6C A;  4IKF A;  1R6R A;  3QYE A;  3HUG B;  3PSI A;  2A5W A;  2QKM B;  4II3 A;  5KNL A;  1J09 A;  2BW3 A;  3VYS B;  2WBM A;  2R7R A;  2A6T A;  3DEE A;  3S3M A;  2M4G A;  2OUM A;  3E0J B;  3DKX A;  4XLF A;  3TL4 X;  2VQC A;  4XLE A;  3S32 A;  2LBF A;  4OAY A;  4P1W A;  1D0X A;  2LOO A;  4BS9 A;  2DT6 A;  2V1N A;  3RPU D;  3RTR A;  4ZDP A;  3HPG A;  3ZXS A;  5HNH A;  4E7Z A;  2XDV A;  4C2T A;  2LH9 A;  1SAU A;  4BJ5 C;  3ONQ A;  3N05 A;  3EUK L;  2X51 A;  2Y0S A;  3PUB A;  1WJE A;  4RMN A;  2UV1 A;  3LSK A;  1WJ5 A;  4XQF A;  3PSF A;  3DLA A;  2IS4 A;  2P0W A;  2LYC A;  3I3L A;  2VQL A;  3LSI A;  1G59 A;  1WJA A;  4LIT A;  2KRH A;  2L9N A;  2M4K A;  2KQR A;  4XNF A;  2IS2 A;  2V9K A;  4XOT A;  1TT0 A;  2IGN A;  1BR1 A;  1NG6 A;  3CZ6 A;  2AQE A;  1E0E A;  3AFH A;  2VJ5 A;  4DBR A;  2XSJ C;  1UG0 A;  2M0M A;  2XF5 A;  4AU7 A;  2QKL B;  2E5N A;  3AL0 C;  4CSW A;  4PJM A;  3SEQ A;  1DP3 A;  4N4O B;  4XKB A;  5CPR B;  3K70 C;  2LRE A;  4YRV A;  1QU3 A;  4CZC A;  2R7U A;  2W82 A;  2K9M A;  4X0G A;  3FHN A;  3PL8 A;  1YX3 A;  1K6Y A;  3D5L A;  2KDO A;  1X4P A;  2WA0 A;  1JI8 A;  3HOT A;  4BJ6 C;  2UWM A;  4B43 A;  3FKJ A;  2LC2 A;  2NOJ B;  2DOA A;  2W1O A;  4CA0 A;  1PJR A;  2MYS A;  2RRE A;  3H9J A;  2W4S A;  4XLH A;  2Z16 A;  2XF6 A;  2K5C A;  4GRI A;  2KMU A;  4NUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...