2R5YA

Structure of scr/exd complex bound to a consensus hox-exd site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
73
Chain Sequence
GKKNPPQIYPWMKRVQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DTP*DGP*DAP*DTP*DTP*DTP*D
total genus 22
structure length 73
sequence length 88
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5yA00
1ETQA 3HOVJ 3HGGA 5DTDA 2AHQA 2DMPA 2WB1N 1MBHA 1U9OA 2DMUA 2JJ7A 4M3EA 5J1YA 2MW8A 1IJWC 1ZKGA 4BY1J 5IP9J 1XS9A 3E7LA 1GUUA 4C2MJ 3DCFA 2COBA 4MO7A 4S0HB 3RZOJ 1TWCJ 1OCTC 3OSGA 2FD5A 3LOCA 2JA5J 1IDZA 3GTGJ 3MKLA 5EZHA 2DA3A 2ECCA 3H3VK 2DMQA 3ZQLA 2DA1A 2QCOA 2K9SA 2R5ZA 3BG9A 5F04A 1F36A 1MBJA 3K2AA 1ZR4A 3A01B 1ZR2A 1JKRC 5IP7J 3RKQA 2M2EA 4DYRA 1HCRA 1E3OC 4DYCA 3PM1A 3BR1A 3G1OA 1SANA 2LR8A 4GFBA 1JJ8C 4IHVA 1BW6A 3Q0UA 3S1RJ 3FK6A 2KT0A 4B1RA 1FJLA 1JTXA 1A5JA 3S1MJ 3RZDJ 4BBSJ 4UUSA 5JLXA 2ID3A 4M3DA 1LE8B 1BL0A 2CUFA 2HOTA 4FCYA 4J19A 2XPWA 3TP3A 1RR7A 2CUEA 3M3YJ 3HGYA 3HOYJ 3S1NJ 2HI3A 1R9TJ 4CYCA 4XICA 3LSGA 4XRSA 2JA8J 2M34A 1GV5A 3TW6A 2OPTA 1MH4A 3QQAA 3S16J 2GLOA 3TEDA 4A3CJ 1FIPA 2NVYJ 1XG1A 3GTOJ 1TWGJ 4FTHA 2YS9A 4HNVA 3HOUJ 1PUFB 3JRCA 2DN0A 3JREA 2LD5A 2DA4A 2TCTA 5K7HA 4DYQA 4FE4A 3HBLA 4A3FJ 2M8GX 3BR2A 2QF7A 1SFOJ 3GTKJ 2HQ5A 5JLWA 2Y9ZA 4M3GA 1WPKA 1WGXA 1WI3A 1AU7A 4X1EA 3S1QJ 9ANTA 2WAQN 5EF6A 3JRHA 1UHSA 3ZQIA 2Y31A 2GM4A 4JX4A 1RPWA 1WCMJ 1Q1VA 3LSPA 5F27A 2P81A 1O4XA 5F08A 5GP9A 4A3BJ 4JP0A 3CMYA 4FE7A 2HOSA 2L7MP 1JUSA 2DA2A 4AYBN 1VF9A 3S14J 2XGCA 1A6IA 4C3HJ 3BTIA 3ZOBA 1JKQC 4A3EJ 3HB9A 1W0TA 3IH4A 1FTZA 1WH5A 5C4XJ 3HM5A 1NK2P 2K40A 2GBYA 3JRBA 1QPIA 1EF4A 3CQZJ 1IG7A 3L1PA 1GV2A 3O8GA 3PO2J 5EDNA 2R5YA 3BR3A 2H8RA 1I6HJ 5F1JA 1QRYA 2O8KA 5IOZA 2E19A 2XRLA 2G0EA 5J1UA 4L5EA 4QSHA 2YU9J 5M5YJ 2EH3A 1ETWA 2ECBA 3NARA 1ZQ3P 1PUFA 2JK3A 4D7MA 1XC5A 3VPRA 2TRTA 1MNMC 4ABZA 3RQIA 3G1MA 3UKGA 1TWHJ 2EZKA 1JGGA 2IAIA 5F0HA 2L9RA 2LTPA 3ZQFA 2FX0A 2NVQJ 4W1UA 3WHCA 1OJLA 1GT0C 1TWFJ 1IGNA 3GTLJ 1HDDC 3SFIA 1Y1WJ 1HOMA 2HXIA 5IP6A 1RKTA 1G2HA 1IV6A 3FKIJ 2E2HJ 2LFBA 5EGOB 1JKPC 1ITYA 4JYKA 1MH3A 2NVTJ 2DA6A 3JRFA 2JA7J 1LE8A 2R5ZB 3ZQGA 5C3EJ 2DMTA 3QPLA 2E2IJ 3BQZA 2XPUA 4M3FA 1VNDA 4IHXA 5C44J 1AHDP 3HOXJ 1B8IA 5GPCA 3OSFA 5IYDJ 1AKHB 2ID6A 2EZHA 2XGEA 3M4OJ 1MBKA 2Y30A 5F0CA 1YRNB 4V2FA 2EZLA 1MSEC 2R93J 1ETKA 1MBGA 2CQXA 2M0CA 2Y0SN 4FISA 3GTMJ 4IHWA 1APLC 2D5VA 1JUMA 1BJZA 4DW6A 3A01A 1RETA 4A3IJ 3HEFA 5FKKA 3FIWA 1ORKA 3GTQJ 1VFCA 3MN2A 2O7OA 4JX6A 1FEXA 4BKXA 2JMWA 4A3GJ 2K9NA 2ME0A 5FKMA 4DZJA 5E3LA 1OCPA 5FJ8J 1T56A 4A69C 1UMQA 4D7NA 4X6AJ 3PO3J 3LSRA 1QVTA 1IC8A 1VI0A 2PMZN 2X9DA 2VPRA 2EBIA 3Q0VA 3ZQCA 2XPVA 5EYRA 1HF0A 2VKVA 3TP0A 3I4MJ 1OFCX 3SDGA 2JWTA 1JKOC 3GTPJ 1ZGWA 4W97A 1T33A 1X58A 2X48A 3Q0WA 1JT6A 3H0GJ 1ETOA 2R7ZJ 4I6ZA 3BR6A 1Z0XA 1H89C 4UUTA 5E3MA 3D1NI 1TWAJ 4QTRA 2MG4A 2CU7A 2CRGA 2ME6A 2XSDC 1B72B 1IUFA 3SJMA 3F0CA 4XIDA 2W48A 3FISA 1NK3P 2NVXJ 2ELKA 2FJ1A 3A02A 3NAUA 4CYCB 4LOCA 4EEFG 2DTZA 3QPSA 1ZK8A 3TW7A 5K7FA 5M5WJ 1U8BA 2H1KA 1FTTA 3OOUA 2XB5A 3S2DJ 3GBGA 4BXXJ 2K9QA 1ENHA 2VI6A 1MBEA 5C4JJ 3JRDA 1RKWA 1AKHA 3IH3A 5FKLA 1FIAA 1JUPA 5HODA 1JT0A 5IYBJ 5J1RA 1Y1VJ 4MLOA 3BTJA 2MSYA 2EQRA 3O8HA 1MSFC 3HKZN 2KDZA 4XK4A 2I10A 2AO9A 2R92J 4B4CA 1POGA 5K7ZA 1BA5A 5EGOA 4V2GA 2IEKA 3K7AJ 2HYJA 4BY7J 2HDDA 2L7ZA 3BR0A 4IEJA 2R0QC 3B6CA 5DS9A 3JRIA 3I4NJ 2NS8A 1P7IA 2EZIA 3BT9A 2HOAA 2YUSA 4C3IJ 2DMNA 3IH2A 3FK7A 3B6AA 3LSJA 1NTCA 5FLMJ 5E3OA 1I3QJ 3LNQA 5IPAA 3W6VA 3C2BA 4XRSG 1P7JA 4A3JJ 4D5FA 2RAEA 3CCYA 1W0UA 4DZPA 2CJJA 3BG5A 1H8AC 1JJ6C 2WV1A 2NS7A 2CQQA 2IBDA 1WH7A 4A3MJ 3BTLA 2JA6J 4MFDA 1LFUP 1H88C 2DA7A 1LFBA 4JX5A 2HXOA 3DEWA 5F0FA 1K61A 1S7EA 4BBRJ 3JRGA 3GTJJ 4UUSB 1ETYA 3ZQHA 4RDUA 3HOZJ 5FKOA 4RBOA 1QVUA 2VKEA 2B63J 1HLVA 3S15J 4B3AA 1ZTRA 4A3DJ 3S2HJ 2R5YB 1D5YA 1ETXA 5EG0B 3CDLA 2L0KA 2M9HA 2Y9YA 2VUMJ 3BQYA 2LLKA 3S17J 3JR9A 2DA5A 2XB0X 4XRMA 4Y7NJ 1RESA 1GDTA 4D5CA 5EEAA 2LK2A 5M5XJ 4NDLA 5EZGA 1I50J 1X2NA 2N8GA 5J3LA 2MGQA 3MVPA 4M3BA 5FKNA 1IRZA 4QIWN 3BTCA 1DU0A 1YRNA 2JN6A 5EG0A 1GVDA 5FLVA 1F43A 3IV5A 3BR5A 2NOGA 3WHBA 5M3MJ 2OF7A 1ETVA 3JRAA 4A3KJ 1B8IB 1B72A 4A3LJ 5BNGA 1Z77A 2DJNA 2E1OA 2L7FP 2LY9A 1MBFA 4IHYA 5IOYA 4C3JJ 4AC0A 4MIMA 5M3FJ 3Q3SA 4MFEA 1CQTA 5IYCJ 3HOWJ 2XGDA 2LP0A 4A93J 1X2MA 2X6OA 4G12A 5GPAA 5E3NA 4Y52J 1DU6A 3OIOA 1UG2A 2E2JJ 4AUXA 1BW5A 1U78A 1K83J 1U9NA 2FQ4A 2LKXA 1HDPA 2ZB9A 3BG3A 4I76A 1JTYA 3HDDA 2O9LA 1IDYA 3A03A 4M6VA 1TC3C 2Y2ZA 3G1LA 2LVSA
chains in the Genus database with same CATH superfamily
3PFYA 3DPUA 4BEHB 3ASOH 3G71I 5FB2A 2LOOA 4E7ZA 3HGGA 5DTDA 2HQRA 1SFEA 1DUXC 3IHUA 1TL8A 2WB1N 1U9OA 2DMUA 2XAHA 2HWVA 1R6RA 3J7AO 3K70D 3F6OA 3TO6A 1T0FA 1IJWC 2CV1A 1I6XA 3VWBA 1MW7A 1ZKGA 5IP9J 2ZNYA 1XS9A 4XMYA 3G73A 2HKXA 2COBA 3RJPA 2M87A 1NHAA 2FD5A 2DK8A 1W5CC 3VYRB 2JA5J 1IDZA 3ROUA 5DYMA 2GZWA 1W36C 5EZHA 1G3WA 2UUZA 4HNUA 3I9V2 2ECCA 2DMQA 3ZQLA 2CS3A 1KU7A 2F4MB 2XAFA 2LDUA 5DD4A 2HDWA 1MMNA 3DPTA 5L3GA 2ZMEB 2XAGA 3C3WA 2BVLA 3GFMA 3KP3A 3QWLA 5CQGA 1F36A 1PUEE 5ICGA 3KZZA 4PCQA 5AIQA 5ICEA 2VBXA 2P7CB 2QVOA 3DU5A 3A01B 2O3FA 2VLAA 4DYRA 1SFKA 2E34A 4CHUA 3P7NA 3K69A 5DCMA 4QWQA 4MEXF 2LR8A 1I27A 3Q0UA 2UV1A 3CCEI 1UG0A 4PJMA 4B1RA 2DOFA 1JTXA 1A5JA 2WADA 2A05A 3S1MJ 3E6CC 5LEKA 4UUSA 2OBPA 3FXLA 1YITI 3BROA 1WWXA 1Y0NA 3WE3A 4UB6C 2RN7A 5L3FA 3OYKA 1BL0A 2VOPA 4I0AA 3HKZA 3FZVA 4J19A 2CUJA 3V8LA 1FWZA 3VYTB 5BPIA 1RR7A 2CUEA 3M3YJ 3FKJA 4NC8A 4M9SA 3HOYJ 1ODDA 2VJJA 2MFZA 3S1NJ 2HI3A 3I0TA 3NQOA 3SHFA 4LMYA 2OZ6A 2JA8J 1SAUA 4OAZA 4XOTA 3JAMZ 3OYGA 3M8EA 4B8XA 3H92A 3GMEA 4BEHA 3TEDA 2JQ7A 1FIPA 1MMGA 2VN2A 1Z3XA 1XG1A 1FX7A 2VBYA 2F5CA 1IN4A 1QNTA 1I39A 3P5JA 4XLAA 2LNBA 4FTHA 2W7NA 3Q5FA 2DK5A 4HNVA 2HZTA 1FOXA 4HV5A 3JRCA 3LFUA 3PIPF 4BDYA 2XHKA 3ZRGA 4HNTA 5K7HA 3OYNA 3KLOA 2W1OA 3GTKJ 2WAFA 3H36A 3ZPLA 2Y9ZA 2AXTC 2WB1A 3FMSA 2YX4A 4M3GA 5KAIC 3CCSI 2FOKA 5L3BA 3JRHA 2IGOA 1V5EA 2GA1A 1BR1A 5FGMA 2P5VA 4XRFA 2Y0SA 2P81A 2V7FA 2IS6A 1UZCA 1E3PA 3RKWA 5F08A 3PL8A 1K4SA 1YIJI 4A3BJ 3TOAA 4JP0A 4YFKF 1X4OA 2HOSA 1I5ZA 2F5FA 1EKEA 2L7MP 4E4HA 3HHHA 2XC7A 2DA2A 4IL6C 2KJCA 5K5QA 1WJDA 3LA7A 1MNEA 4Y15A 2HYGD 1PJRA 3O2PE 2DFEA 2NYXA 2NNYA 1QGPA 3VFZA 2VT2A 4A3EJ 5C4XJ 4KN4X 4ZYDA 1NK2P 4ZC3A 2GBYA 3LSHA 1P4AA 1XSXA 3CQZJ 4G6DA 3UR3C 2R7OA 3K4LA 3TO9A 4YIIA 2IW5A 2R5YA 4CCJA 3CP8A 1I6HJ 1QRYA 1YW9A 3ZN0A 1G6NA 1F5TA 2Z33A 2E19A 4E70A 2G0EA 2GOMA 2Q0OA 5J1UA 4L5EA 1MJ9A 2YU9J 2EH3A 1ETWA 2ADUA 2CO5A 3JW4A 4OAYA 2JK3A 2H8WA 5E79C 1XC5A 5JHUA 1MNMC 1D8JA 3R6SA 3Q9VA 4HSTA 3S93A 3K2ZA 1JGGA 2ZMEC 2LTPA 4P5OA 3RPQA 2FEZA 2GQQA 2WTEA 4W1UA 3WHCA 3RPUD 3VDXA 1IGNA 3U9GA 1WJEA 4XKBA 1Y1WJ 5DM6F 4IRIA 2XROA 4KJZA 5HOOA 2IPQX 1G2HA 2V4JC 3HRUA 3R0JA 1HW2A 3FKIJ 2E2HJ 4P96A 4XKCA 4NC7A 2NVTJ 2DA6A 3ZR8X 4BHCA 2O61A 4IHTA 3ABKH 4RB0A 3BC8A 1RNLA 4I2OA 1PVEA 1ON1A 4LIUA 1FP1D 4A5NA 3HRTA 1R4MB 1OPCA 3BJAA 1Y39A 3MZYA 5C44J 1B8IA 1I3AA 3I59A 4B47A 2B7EA 4RB1A 2IVMA 3FMQA 3HOSA 2JUGA 3HIFA 4RLFA 2ID6A 2XGEA 5HNFA 3K9TA 2EFPA 1T6SA 4I02A 3W6JB 1SMYF 2EZLA 5KCMA 5E1XA 4F93B 4PFOA 4KIGA 2G9WA 3I5UA 1APLC 4MQ9F 3A0HC 2D5VA 4N9HA 1PP7U 3F21A 3FXKA 2V6CA 2R7XA 1IXSB 2D1HA 1CGPA 4BUPA 4KMFA 2K9NA 4UV9A 4KDPA 4F7ZA 2ME0A 1J5YA 1FSEA 2YU3A 2DU9A 5FKMA 4BL0B 4DZJA 2ZXWH 5FJ8J 2PJRA 3VB2A 2GXAA 1VQ6I 1X1PA 1UMQA 1PYVA 5CVIA 4EATA 2RV8A 3FF5A 3HUGB 4X6AJ 5H6QA 4AVZA 1ZGAA 1QVTA 3F8MA 3BG6A 2EWNA 2Z99A 4RLQA 1Z05A 5ED4A 2VPRA 3Q0VA 1QQIA 1IN5A 2Z16A 3KLNA 4XN3A 3RYRA 2DO7A 3SYTA 5B1AH 1EH8A 1ZGWA 1JI8A 3Q0WA 3CD6I 5E1WA 4Q47A 3FBIB 1J0RA 1ETOA 4HAMA 3BR6A 3DV8A 2JPBA 3NEUA 3J80Z 1ZAOA 2IS2A 3ZMVA 2PX9A 5E3MA 2FE3A 1DDNA 4IQJA 1YOVB 3ZMTA 2O03A 1R1UA 4UNOA 2DOEA 3MKYB 1R5HA 1EJ9A 2W82A 5GTHC 1IUFA 5D5WB 3F0CA 3SZPA 5F6FA 3WE2A 2K4BA 3F8FA 4A0YA 4AIJA 3A02A 3NAUA 3EUKL 1ZHFA 2WC2A 4DOZA 3KCCA 2ESNA 4F91B 4CYCB 2BEOA 4EEFG 5M5WJ 2H1KA 4EM1A 3LSTA 2A5WA 2ZBKA 4BXXJ 2OU2A 3CC7I 1B59A 1ZG3A 3B73A 3S3NA 3QOPA 1YW7A 5LRRA 3BZCA 3SEZA 2PI0A 3OIQA 1SVLA 3DU6A 3KP6A 3KX2A 4M71A 2H27A 1JUPA 3HHGA 4MHGA 5B5EC 5IYBJ 3MFKA 1MMSA 2FBKA 4JOMA 1Y1VJ 4ESFA 1Y0UA 2DPUA 3DBRB 2M7AA 1HQCA 1OMIA 2EQRA 2XDVA 3GXOA 3H9QA 3O8HA 4HQMA 2X0LA 3WGHA 3EPZA 1Z6TA 1BM9A 3S32A 4PFPA 1Z7LA 5J40A 2IEKA 3L2CA 4XLNF 3K7AJ 2HYJA 4BY7J 3LWFA 5HVQC 2HDDA 2L7ZA 5LRSA 3R4KA 2DW4A 5DS9A 2IJLA 2HS5A 3CJQB 4ZZDA 5ILUA 3BT9A 3LSJA 5FLMJ 4NQWB 1T0FC 2M4GA 3ZQQA 5IPAA 2FRHA 2ZJRF 4U0YA 2EV5A 2DPDA 4N0BA 3W6VA 2ZJ2A 3W2WA 3WGGA 4XRSG 3WTTC 2NXNB 4CUGA 5HLIA 3CCYA 2CW8A 3FXUA 4R79A 2OJED 4E7SA 1W0UA 1CF7B 4G7OF 1H8AC 1H0MA 2ZCWA 2KP6A 4KMUX 4PK4A 5DCFA 2NS7A 2CQQA 2H94A 1KU9A 2IBDA 1R1TA 5H20A 3FHZA 3V8KA 3WU1B 3E5QA 2PLYA 4GRIA 2DDAA 3W2AA 4MFDA 1LFUP 4OIQF 1OR7C 4HG2A 5TGTA 3RKYA 1K61A 1ULYA 1S7EA 3CMEI 2MABA 4NC6A 5ILVA 3FX3A 3JRGA 3KYLA 3GTJJ 3LL7A 4OINF 3COAC 3ZQHA 3BDDA 1LVAA 2IA0A 1LDDA 4IOAF 4RBOA 3KETA 2PJRB 2QBYA 5HDGA 2OTLI 1HSTA 3QPTA 1ZTRA 2EFQA 3U2RA 4ZH4F 3LAPA 1KYZA 1S29A 2R5YB 3J80K 1D5YA 3RYPA 4BQQA 4NB5A 3MMYB 4HYEA 1LEBA 2HQNA 4Z6YA 2OC6A 3BQYA 2LH9A 4OIOF 3DEUA 4D5CA 4E6KG 1VQOI 2N8GA 5EZGA 2BY3A 5J3LA 2OD5A 3S3MA 5FKNA 3CLQA 1IRZA 3ERMA 3FM5A 3VOEA 2EFOA 2JN6A 4LITA 1GVDA 2RNGA 4AIKA 4PUSA 1K4TA 5CVRA 3OYFA 4L0YB 3S3OA 5FLVA 3RKXA 2BW3B 2L5QA 1ETVA 2EV0A 5BNGA 1Z77A 1KU3A 3TBIA 1U8RA 2LY9A 1MBFA 3A1YA 5J6XA 4A0ZA 3OYBA 3TKYA 4RGSA 5FO5A 3W6KB 3CCMI 1JXSA 4PGHA 2E60A 2F5EA 1VQNI 4KIFA 3X2QH 4MIMA 1KYWA 1KA8A 2CH0A 4MFEA 1CQTA 3EDPA 3ML6A 2AQEA 2IGNA 4IJAA 1W7PD 3QODA 3L9FA 4A93J 2FF4A 1BN5A 1YS6A 1QHHD 3LFKA 1W5TA 2X6OA 2EINH 3R0AA 5GTIC 4AUXA 1BW5A 3FXMA 1K83J 1X1AA 3TMOA 2FQ4A 3EETA 1SFUA 1HDPA 4B09A 2QGUA 2AS5F 1JTYA 3K10A 3IKTA 2O9LA 3IUOA 1FYKA 1E3HA 3A03A 1TC3C 4ENJA 3ZQ7A 2VL8A 2Y48A 4XKWA 3E6DA 3G1LA 2DXIA 1XMXA 3E6BA 1MKMA 5H6RA 3CO7C 2VPLA 1PP8F 1RUOA 2DMPA 4E7HA 1YW8A 3GLXA 4M3EA 5J1YA 1LFPA 3AG1H 3N4MA 1IO2A 4OMYA 3AKZA 5LHHA 2OCEA 3RTRA 3E7LA 2ZJPF 2GIZA 4C2MJ 2EFNA 4MO7A 1TWCJ 5LEJA 2FMYA 1ZRCA 5LHGA 4L9TA 3CMAI 2F4OB 4WK8F 3CDIA 2FA5A 1R7JA 3RIRA 2CQ7A 3OYEA 2DA3A 3K6GA 2K9SA 2R5ZA 5HLGA 2WBMA 3KP2A 4WF2A 4ON0A 1ZR4A 4HZFA 2K5CA 5CVJA 5BS6A 1ZELA 4BXUA 2KFDA 1K6YA 1JKRC 5IP7J 3RKQA 2M2EA 1HC8A 4LB6B 1BIBA 5CQEA 2KRCA 2K4JA 1G4DA 3PM1A 4YG2F 3PNYA 4GFBA 1VZ0A 1G8XA 1OYWA 2ELHA 4LJZF 4BU2A 4HF1A 1JJ8C 4IHVA 2LY2A 4GYIA 1VTNC 3KYCB 3FK6A 2KT0A 1V4RA 2PMHA 3AG4H 1FJLA 1Y56A 4BBSJ 2F5DA 5D4RA 2ZC2A 4M3DA 3FXRA 2M1BA 1HW5A 1ERDA 2DCEA 2CUFA 3W2VA 3BCAA 3E6MA 1FLIA 3D0SA 1FYMA 2I8DA 4M73A 3F23A 2XPWA 3BZ6A 1N77A 3HGYA 2XAJA 2LKPA 4BH9A 2OTJI 1R9TJ 1EH6A 4I09A 4XICA 2P4WA 4XLCA 4XRSA 1Y8RB 2WA0A 3PIOF 2QA4I 1IXRC 4O6JA 3S16J 2WV0A 4RAFA 3ABMH 2VOOA 2EA2A 3CJNA 2BVMA 1MMAA 4IZZA 5K5RA 2EFWA 2Q2EB 1PUFB 2DN0A 2TDXA 3SQNA 1UHMA 2TCTA 4XNFA 3ZP5A 5E18F 1Z91A 2M8GX 3BR2A 5J4VA 1IF1A 4CZZA 3KP7A 4MEYF 1FP2A 2HQ5A 2K7LA 3DQVC 3V42A 4MGRA 5GAEJ 4XONA 1WPKA 3S1QJ 2K3PA 1TTYA 1N75A 2K3FA 4X1EA 1AOYA 2WAQN 3RI4A 3SXYA 5DUIA 4A2UA 2IS4A 1QZZA 1Z6RA 2E36A 3LSPA 3OV8A 2ESHA 3GZ6A 1SFXA 1ZG1A 4LK0F 1RRJA 3IP4B 3QU6A 3CESA 4A6EA 3CMYA 4D0PA 4R8HA 4IHSA 1JUSA 1W7PB 1TLHB 1XTAA 2Z2SB 5JVTA 1A6IA 2VT3A 1W0TA 1V5GA 3IH4A 1FTZA 1WH5A 3HM5A 3U21A 2D45A 4LB5A 4U7DA 5J8FA 2P5LC 2HVSA 2L9SA 5IT3A 1UAAA 2CG4A 3M07A 4JQFA 1QZEA 3BR3A 4HF0A 1R5GA 2RC4A 4X0GA 5J4YA 4RAYA 4GCVA 2HPIA 2GAUA 2ECBA 4P9UA 1ZQ3P 3OOPA 1K79A 1LDKB 4UHTA 1N25A 2L7KA 2Q2EA 3V7RA 2E71A 3CTAA 1MD0A 1FBSA 1D0XA 3KFWX 4ENKA 2EZKA 4H0EA 2IAIA 3CMMA 3O3KA 3E5XA 4WCGA 1GT0C 1TWFJ 3DXJF 1HDDC 2M4KA 3H9GA 1BR2A 5BPDA 1HKTA 3SFIA 2QSGX 1XPXA 5IP6A 2V9VA 1X19A 2M0MA 4UXNA 1RR8C 3HRSA 2IA1A 4BE0A 2R7UA 2CQNA 2LFBA 5EGOB 2CYYA 3M8JA 1RUNA 2RKHA 4JYKA 3VYUB 1MH3A 3L2RA 3DKYA 4Y3OA 4ENNA 2PBIA 2JA7J 1FOWA 1XDSA 2ZFUA 4CICA 1L0OC 2ZNZA 3GFJA 1X3WB 3FWEA 3BQZA 3H5AA 2IP2A 2XPUA 1OKRA 1VNDA 1Y6IA 2W4SA 1AHDP 2HOEA 2MD5A 4G9YA 4B44A 5GPCA 1AKHB 1MBKA 2X6YA 4AU7A 5F0CA 3G4SI 4V2FA 2R93J 1MBGA 3QP5A 2CQXA 2M0CA 2Y0SN 4FISA 4DGWB 3BCBA 2KKOA 4DW6A 1BJAA 2BHZA 1RETA 3PUFA 3PSIA 5FKKA 3FIWA 3M7GA 1ORKA 5F1RA 1VQ5I 2CV2A 1UFMA 2NVUB 1VFCA 3MN2A 2PJPA 1FEXA 2E5ZA 2EJRA 3MKWB 1J09A 5CJ9A 2Y75A 3OYDA 2JVGA 4U0WA 3KP4A 5J47A 1OCPA 3C7JA 1WI9A 5DM7F 1B1BA 2KIMA 3E97A 4A69C 4WXCA 2OUMA 4P55A 1J7KA 1LDJA 3TGNA 3KEQA 3O6BB 3RDIA 3DTKA 1F1ZA 2BY2A 1OCOH 3T0YA 3S8PA 1VI0A 2PMZN 2GXBA 2VXDA 2XPVA 1T95A 3I4MJ 1E0EA 1LNWA 1T33A 1X58A 1BI0A 1SVOA 2E7WA 1YHQI 3RCOA 1YX5A 2COMA 5L3DA 4I98B 3J7ZI 2R7ZJ 1J75A 4BJ6C 4NNJA 1YI2I 1HBXG 4G8XA 3F9KA 2STWA 4IF4A 4HPQA 3GWZA 1X1DA 3P9KA 2VXZA 2ZO4A 5AIPA 2CRGA 2ME6A 2DJIA 1B72B 4UVAA 4P1WA 3SJMA 4NQWA 1T39A 2CGPA 3E1SA 1NK3P 3FISA 3IRRA 5BOXA 4Y13A 2HTSA 3J81Z 3F72A 3I64A 2E1MB 1TNSA 4QPQA 2K27A 2DTZA 4BDZA 1U8BA 1J9IA 3WGIA 1FTTA 2FBHA 2DBBA 3IKVA 4RGXA 2G7UA 3MZ8A 1DPRA 2BYVE 5D5XB 1ENHA 2VI6A 1ONVA 3JRDA 3GW2A 1RKWA 4UVCA 2R7VA 2XAUA 3H5NA 2LF8A 3IH3A 2OA4A 3ZMDA 1JT0A 3DLAA 1H9GA 2E1MC 1X4PA 4LIVA 2HNHA 2R7DA 4BS9A 4MLOA 4U7BA 2BOLA 3BTJA 1N78A 4BGDA 1O7FA 4D1QA 2VJIA 4PJ0C 1POGA 4AD9A 5K7ZA 4L9VA 4XLPF 1YX3A 3IC7A 4A6DA 3CUQA 5D5VB 3E3VA 1DGRM 2LF7A 2A68F 2UZKA 2HKOA 2VBZA 3HC7A 1V54H 4OOIA 1YQAA 2R0QC 4ASNA 2DT5A 3JRIA 3F22A 1P7IA 1FNNA 2EZIA 4M9XA 4ETSA 1V5FA 2YUSA 3I53A 3OMYA 4KYWA 2QKLB 2V1DA 3B6AA 3D5LA 2RREA 3DTIA 3MKZA 2EIMH 4XOPA 2XV4S 1IRXA 1DGWY 2ETHA 1O3QA 1YIOA 4Q48A 4RM3A 1E17A 2MYSA 3JSPA 1P7JA 2KRHA 2KPMA 2P6SA 4WXDA 5HS8A 2RAEA 3CCUI 1XMAA 3VSKA 3SDBA 2OAZA 3GEZA 3L09A 1BI1A 1JJ6C 2WV1A 2VJ5A 4IVNA 1SMTA 4A3MJ 1MDMA 2ZSHB 3BTLA 3Q9SA 4CCLA 2OCCH 2JA6J 2MH9A 1R4NB 1XCBA 5LLQA 3OS2A 2VC1A 3SZTA 1LFBA 1Y8QB 4DBQA 1R71A 1ZH5A 1R00A 2CW0F 2QENA 2V26A 4DBRA 4BBRJ 3NRVA 1T38A 3EUHA 2MC3A 4HSRA 4RDUA 3H3ZA 4M74A 1HLVA 4B3AA 4A3DJ 1YG2A 1T08B 1U5TB 2DT6A 3OL3A 2RNJA 3K1PA 5EG0B 5H2FC 4K2EA 3BWGA 3T1BA 2LBFA 1KU2A 3FDYA 3U1DA 2DA5A 2XB0X 5HS9A 5LD2C 3MAJA 1RESA 1GDTA 1TQPA 1FZPB 1SEUA 4WXHA 3HXLA 3HL2A 1FT9A 1JHHA 4M3BA 4QIWN 1D0YA 4PSWA 1DU0A 4Y4RA 4NHJA 1XSVA 2A69F 2Z3YA 2ISZA 1F43A 3WHBA 1B8IB 1B4AA 3HPGA 3MWMA 3S2WA 2DJNA 3LSIA 2E1OA 1FBQA 2NOJB 3HSRA 1MIJA 2XUBA 2PFBA 3OYAA 4FT8A 4C3JJ 3L00A 5M3FJ 3I58A 3Q3SA 1XGOA 4YELA 4L9JA 4F3QA 2LC2A 3BP8A 2KISA 2ZXHA 2XGDA 2LP0A 4DJAA 1L3LA 2EIJH 2D1VA 1BR4A 4G12A 2VE8A 4NBQA 2DDBA 2J5OA 3G2BA 5E3NA 2A5YB 3CO6C 2E2JJ 1SD4A 4U0VA 1U78A 1U9NA 4PZJA 2QQBA 1LKXA 2XF7A 3IWZA 4HDUA 3U1KA 4I76A 1T2KA 2VE9A 1ZYRF 4LD5A 2VQGA 1IDYA 2EB7A 2A6TA 1BIAA 2L3DA 1X1BA 4GDFA 1S6LA 4M6YA 3ZMUA 2FOWA 3HOVJ 4EJWA 2LY1A 3N97A 3F8BA 4E7IA 1MBHA 2JJ7A 1TP4A 3L2VA 4IKFA 1JGSA 4ZDOA 1QU3A 4DIQA 1IRGA 1SD6A 2MW8A 1RI7A 4BY1J 5DEQA 3GVAA 2ZJQF 1GUUA 4A12A 3RZOJ 4G7ZF 2PG4A 2M7BA 1OCTC 1VQPI 3LOCA 3K1NA 2EA4A 4DNCA 2HR3A 1JHFA 3OYLA 2XGXA 3GTGJ 2J5PA 3GZNB 2X1DA 3MKLA 4C30A 4XLEA 5ICFA 4ENMA 4N4NB 3AFHA 2DA1A 2W85A 3ABTA 3BG9A 3LSKA 5F04A 5K5OA 1XD7A 1D1BA 2DAOA 1SAXA 4XL9A 2DODA 2HQAA 1W5SA 2A6HF 1ZR2A 1OISA 2FBIA 2HVRA 2X1EA 1HCRA 4IPAA 3GX4X 4U88A 3ZGKA 4DYCA 1A35A 3BR1A 3G1OA 1SANA 4C9YA 2XRNA 3K4NA 3PFIA 3J81K 3QYFA 3S1RJ 2Q8KA 3MQ0A 2PMUA 3GFIA 3TQNA 2LKSA 3CF5F 5JLXA 2IS1A 3JCUC 2R3SA 4RS8A 2R7SA 3K4CA 1XB4A 2L2OA 1R23A 1R36A 1WFXA 4FCYA 2ZXJA 2FMLA 5KHDA 4AIHA 5FLXZ 3LQRA 1ZLKA 3DFGA 1HW1A 4HA8A 2P5KA 2M34A 1GV5A 6PAXA 5IY5H 4L9NA 3G3ZA 1EH7A 3WG9A 2GLOA 4CZCA 3I71A 1OYIA 5B1BH 2CWEA 5D4SA 2NVYJ 2GWRA 5GAHJ 4CA0A 4EJOA 1TWGJ 2GA2A 2EK5A 2KDOA 3HZJA 3OL4A 1VQ4I 3HOUJ 4ZYHA 2DA4A 2BY1A 2LG4A 4M72A 1GXQA 4CDGA 3GFLA 4DYQA 4FE4A 1YO5C 1P4XA 3FHNA 3PNVA 4HX7A 3IAM2 4ZJZA 3C18A 3I56I 3KP5A 1WKMA 4IXAA 4ZZLA 1WGXA 1WI3A 5DCMB 9ANTA 2FQ3A 5GAGJ 4QPOA 5EF6A 1ZARA 2KHMA 4D9JA 2HZDA 2A3SA 2Y31A 3F3XA 4JX4A 3DTEA 1RPWA 1R58A 2PN6A 1VQ9I 1FMVA 1O57A 4I01A 4JBAA 5F27A 1XGNA 2KJBA 5TRDA 4V19K 1TQIA 5DD8A 1AWCA 2GXGA 3CCLI 2G7HA 1LVKA 4FE7A 4L5JA 4JK1X 1KZHA 4GO1A 5DV5A 3OYMA 1W36D 1LB2A 1Z3YA 3ONQA 1D8KA 1VF9A 4FETA 3S14J 2VIXA 3BTIA 4CCMA 3ABUA 1Z7UA 4BYYA 1WZ2A 3H9JA 1P4WA 2L4AA 4CCKA 3P9CA 3JRBA 1BI3A 2KQRA 1QPIA 1MDMB 1EF4A 5D6FA 4EM2A 3ESWB 4PGGA 3PO2J 5DUKA 4LFUA 2H8RA 5F1JA 5FRNA 5IOZA 3M1CA 2XRLA 3C2GA 3FXJA 4QSHA 2XF5A 2XVCA 5M5YJ 2M45A 3NARA 4YFNF 1TQMA 1PUFA 3K4MA 3KZYA 2TRTA 2RGVA 4C2TA 3G1MA 2M8EA 4XLHA 1G3TA 1FY7A 3ERED 3ZQFA 4FASD 5HDNA 3CCVI 2NVQJ 1SD7A 1OJLA 4BE1A 3GTLJ 5EJCA 5E17F 1ZN2A 3HTSB 1HOMA 4L0ZB 2HXIA 1YFHA 1USSA 2KMUA 3WTWC 3L2WA 4PSXA 3BJOA 2WAQA 1IV6A 3CUQB 3QRFF 1T8IA 1JKPC 3V7SA 1ITYA 1H9TA 2CV0A 2NAZA 1FC3A 3JRFA 4H4KC 3CUQC 5ILSA 3DWLE 2CW7A 4EM0B 1WJBA 2DMTA 3QPLA 1GLNA 1Z9CA 2P6TA 3GO5A 2LYCA 5AONA 2JZYA 4M3FA 1BOAA 4PJLA 1YJ9I 1O3SA 2AXLA 5KNLA 4BACA 5IYDJ 1OCRH 2ZKZA 2L01A 2EZHA 3RQ4A 3M4OJ 1K78B 2Y30A 2LREA 1ETKA 1SC7A 2H1LA 4ANJA 4XBFA 5JI6A 1BJZA 2KL4A 3BZKA 3I4PA 3GCMA 4A3IJ 1QA6A 3I59B 2E1CA 3GTQJ 4LLGF 2BV6A 4IO9F 5L3CA 2O0YA 4JX6A 3JTGA 2JMWA 4A3GJ 2MBFA 5E3LA 2HFHA 4F92B 1T56A 1TNTA 3GYHX 3KEYA 3LSMA 4EQQA 5CKTA 2HYFA 4BQOA 4S04A 4CXFA 4XORA 2X9DA 3A2KA 3F6VA 5CVVA 2EBIA 3ZQCA 1YLFA 2WAEA 5EYRA 4E7JA 2VKVA 5HLTA 1OFCX 3SDGA 2JWTA 1JKOC 3DLLF 2FNAA 4W97A 3J7AY 2X51A 4CCOA 1KGSA 1IW7F 3HRMA 4I6ZA 2BE5F 2XKOA 3ZMSA 1REPC 3V8JA 4HBLA 3EQLF 3WTSC 1KQ9A 4N4OB 1IN6A 3CC4I 3D1NI 2MG4A 4II3A 2W00A 4TV7A 3UNGC 4ZTFA 3WTVC 2NVXJ 2F6CA 2W48A 3GF2A 1MMDA 2FJ1A 5ICCA 1MNDA 2VODA 3ASNH 4LOCA 3W3CA 3QPSA 5K7FA 1ZK8A 3TW7A 3A4CA 1ZG5A 3OOUA 4BE2A 3ZXSA 1U0JA 2F48A 2JSCA 3AG2H 1VQ8I 1IAWA 1B6AA 3DF8A 1MGTA 2L9NA 4ZDPA 5C4JJ 3TDUC 1K78A 4GYGA 1AKHA 1FOKA 2MH2A 1ON2A 5FKLA 3TO7A 2X85A 3TOBA 5FROA 4I0BA 5J1RA 2FSWA 2QUFA 3IWFA 3AAFA 2M30A 3QP6A 1G59A 3CJTB 1K6OA 2YX7A 3HKZN 1VQ7I 4XK4A 2I10A 4AYBA 4BQNA 4AM3A 2AO9A 1GVJA 3EUHC 3IRQA 4UVBA 2R92J 2V6EA 3CJRB 3IAS2 2A07F 4FHTA 1R49A 2JTVA 1IN7A 4AWXB 4IX7A 5FD6A 3BR0A 2ICWG 1FSHA 2QM3A 3I4NJ 4KN7X 2KZVA 1HKSA 2HOAA 1K7AA 2DMNA 1IZ1A 1LEAA 3FK7A 1B9MA 1NTCA 5D8LB 3BG7A 1I3QJ 5E3OA 5KVRA 4U87A 4QLCU 1V3FA 5J8CA 2L02A 2HDCA 1TT0A 4NUBA 5CVUA 1WSUA 4A3JJ 4LLLA 4EMSA 1D5VA 5D6EA 4UV8A 2WY7Q 2CJJA 1HKQA 3OYIA 3B02A 2VQCA 1P92A 1WH7A 1D3YA 5LGTA 1EA3A 4RA2A 1R5ID 3QYEA 4I99C 1E2XA 5CLSA 1X3UA 4JX5A 2H6BA 3T5XA 2HXOA 5F0FA 2WWYA 2V9PA 4LG0B 3MZHA 2Q1ZB 1DQUA 1STZA 3OR2C 3PQJA 5HLHA 4UUSB 1ETYA 1W7PA 2P0WA 2Y0MA 1KQ0A 5EEGA 3HOZJ 2QZ8A 1QVUA 2DFFA 1U3EM 2VKEA 3EUAA 2E5NA 4PJNA 3S2HJ 1B9NA 4YIFA 1ETXA 4AIDA 2L0KA 2Y9YA 3OS1A 3S17J 2DI3A 2HEOA 3K1MA 4C2UA 4YIRX 2UWMA 3QYBA 5EEAA 2JA2A 3BLYA 2LK2A 1DP7P 2BZTA 1O7LA 3BPVA 3AL0C 1I50J 1UHWA 3KE2A 2K85A 1IN8A 4BJ5C 1Z1DA 3BTCA 1YRNA 2VJ4A 3PNTA 4CCNA 1XCVA 3IV5A 3BR5A 2NOGA 5M3MJ 3OYCA 2OF7A 2V1NA 4EJUA 3KIOA 5CPRB 1AA7A 4HF2A 1I1SA 4IRGA 1HXDA 3WTXC 2R7WA 4IHYA 2XSJC 5IOYA 4AC0A 2OQRA 3M9AA 2VKDA 3J7YJ 3HOWJ 3K4BA 2X6XA 1LJ9A 1BC8C 1RZ4A 4KT6A 5TISC 2R7TA 4HEA2 3WTUC 3QOEA 3WU2C 3V4GA 4BNCA 2OZUA 4N9IA 2QQ8A 4EJVA 2X4HA 2LBFB 5GPAA 1QZYA 4CYDA 1W4MA 1UG2A 4II2A 2YSRA 2LKXA 3I3LA 3WTZA 2DFHA 2FNPA 4MQVA 3HDDA 4L18B 3QPHA 2QBYB 4RM2A 2FUG2 1WRJA 4HOBA 2W24A 4M6VA 2F5VA 3OYJA 4B4CA 1VQKI 3H5RA 3ELKA 1ETQA 4KIBA 3PQKA 3D5SC 1QHGA 4BHPA 4MTDA 2V1XA 4P9FA 4HQEA 2LRDA 2AHQA 2EPFA 1ZRDA 1U5TC 4UB8C 3WU0A 4XKVA 4ESBA 3DBHB 1WQ2A 4EVIA 1WVRA 4G6QA 4HDVA 3V7CA 5JHFA 3DCFA 4S0HB 5FLXK 3OSGA 4XSZF 4ZYAA 4RB3C 3H0DA 4GGGA 3OY9A 2MC4A 2CFXA 4GXOA 4Y17A 2JSPA 3DEEA 2A6EF 2HGCA 3H3VK 2QQAA 2ZXIA 1JE8A 2QCOA 2M5WA 2CFOA 5A2QZ 3CCQI 2K9LA 1NG7A 4A5MA 1BC7C 1MBJA 3K2AA 1QO0D 1Z67A 2JRMA 4KUMA 3VEPA 1TW3A 5FRMA 3LA2A 1PDNC 4FQGA 4PJJA 3R61A 1E3OC 5LGUA 3BY6A 2JUCA 3DPLC 3OR1C 1YYVA 4FX0A 2Z5UA 1OLTA 2KIFA 2QSFX 1IXCA 2XIGA 3DBLB 5GADJ 1BW6A 3F8CA 3TDZC 3MD2A 3L2QA 3RZDJ 3AL0B 1YS7A 4M6XA 4B3XA 4HLXA 5D8KB 2DQRA 2ID3A 2D2WA 1LE8B 2QQ9A 4OIRF 1P6RA 4YRVA 3WODF 1TT5B 2HOTA 1G3SA 2JRTA 3TP3A 1O3TA 2XASA 4O5VA 1A04A 1S8NA 2EIKH 2RVCA 2K9MA 4CYCA 3LSGA 3TW6A 2OPTA 1CF7A 1F4KA 1MH4A 3QQAA 5F64A 2MA3A 4A3CJ 5FD5A 2QEXI 5JR3A 4UUVA 5KAFC 2E1NA 3GTOJ 2KIQA 3HPHA 4HRIA 4BHBA 2NS0A 3CUOA 3SEQA 1J2XA 1YE9A 4LLNA 2YS9A 3VODA 2VC0A 2VBWA 2PQ8A 2VKHA 4BAYA 3JREA 2LD5A 3HBLA 2W57A 4A3FJ 2IT0A 2W25A 2L4MA 2QF7A 3RSNA 1SFOJ 3T8TA 1A36A 2E7XA 5JLWA 5D5UB 4BQAA 1Q1HA 1AU7A 4MNUA 5IT9K 2BHYA 4KT5C 1W1WE 1UHSA 3ZQIA 2GM4A 2VB6A 1WCMJ 1Q1VA 2O8XA 2VQHA 1OYYA 2ELJA 1XSDA 2XF6A 2FXAA 1O4XA 1ZREA 3BPXA 1UB9A 1HSJA 1X3ZB 2BY0A 1WHUA 2EILH 2K02A 2L54A 2L9VA 5GP9A 3AG3H 3HOTA 1U5TA 1BI2A 2IGKA 4ZTJA 1S5LC 1ZGJA 3DP7A 2MLGA 3QAHA 5FFZA 1KQ8A 1XGMA 2BGCA 1OR7A 4AYBN 2YPRA 2LSOA 5LBQA 5E8IA 2XGCA 3JAMK 1DPUA 1P9QC 4C3HJ 4HW0A 1ACIA 3C1DA 5E8GA 1QPMA 3ZOBA 1JKQC 2VQLA 3HB9A 3CF2A 4ZYEA 1WJFA 2FU4A 2K40A 2W84A 1IG7A 1TZLA 1R22A 3L1PA 1GV2A 3O8GA 3WG7H 5EDNA 4XR6A 1A6QA 3LQQA 2O8KA 4HLYA 2CSOA 3E0JB 3ULQB 2OQGA 1XGSA 2KLOA 1OCZH 3DKWA 2CUZA 3G6EI 2X6WA 1XDUA 1D1AA 3M1EA 2MD0A 4D7MA 3VPRA 5EEHA 4ABZA 3RQIA 2QKMB 3UKGA 1UCRA 1TWHJ 1S7AA 4F52A 5F0HA 2L9RA 2FX0A 2RQPA 2PMZA 4G94A 3CC2I 2BBYA 2CMPA 2GIVA 3OIPA 4WWCA 3I55I 4IQ4A 2P7VB 1J59A 2RDPA 1LPQA 1IUYA 1RKTA 1KONA 5CYVA 2VONA 3JSOA 3HUGA 3HJEA 1WJCA 2DYRH 4RB2C 4Q4ZF 3K0LA 2X1CA 2A61A 5KK1A 1IV8A 1LE8A 2R5ZB 3ZQGA 5L3EA 4RGUA 5B3SH 5C3EJ 2P8TA 4KICA 4I7HA 5LHIA 2E2IJ 3QU3A 3I54A 4IHXA 3HOXJ 1S9HA 4G6TB 3RPUA 1V55H 4E7KA 3MCZA 3OSFA 1S72I 4PDKA 2F2EA 2R7FA 3FXOA 2AQFA 3MEXA 2QWWA 1R1VA 1YRNB 1YJWI 3ZN1A 3KZIC 5BMZA 3HSFA 1MSEC 3GTMJ 4IHWA 1VQLI 1TBXA 1JUMA 4L5IA 3A01A 2ZSIB 5FFXA 3HEFA 3OYHA 1Z21A 1GHCA 4XLFA 5IT9Z 2O7OA 4BKXA 4ZDLA 2NNNA 1XMKA 1GXPA 3FM3A 3KYDB 3SFZA 3GLLA 3LA3A 2JVHA 4B43A 4EGZA 4D7NA 4A0XA 4RMNA 4HV6A 3PO3J 2HTJA 3LSRA 1O3RA 1IC8A 3ECOA 1HF0A 3TP0A 2STTA 5E20A 3GTPJ 1WJAA 2BXZA 2X48A 2I5UA 1JT6A 3CCRI 3H0GJ 3REOA 4B48A 3L7WA 1MJBA 2JPCA 4OMZA 3LMMA 3HTUA 1Z0XA 3CZ6A 3PUBA 1H89C 4HX8A 4HX4A 3NWSA 2E35A 3KEOA 4UUTA 1BBYA 3EYYA 1TWAJ 3BJ6A 4QTRA 1TW2A 5BQTA 1UELB 2CU7A 5JVGF 2XSDC 1S3JA 2BW3A 2H6CA 2HU9A 4OWRB 5ERIA 3A0BC 2UXXA 3ABLH 2DFIA 2LMDA 4XIDA 1F9NA 2ELKA 1FYLA 2YR2A 3OWTA 4BXFA 5HS7A 1EV7A 2EV6A 1LUJB 2QYOA 2BXYA 2XB5A 4Y33A 4KFCA 4EJTA 3S2DJ 3GBGA 2K9QA 3FMRA 1MBEA 4KA4A 1P2FA 3K70C 5B66C 1C0WA 4RAGA 2PEXA 3OS0A 1FIAA 4ITVA 5HODA 2ACJA 3ISPA 4M9ZA 3CDHA 4XN0A 1X1CA 1D0ZA 3BOQA 2M3AA 3HSEA 2IRFG 2B0LA 2MSYA 4YFXF 2H09A 4CO8A 3DKXA 1MSFC 3ZCOA 2KDZA 3LAJA 2Y69H 2IGMA 2ZFWA 2GOXB 3M8FA 1BA5A 5EGOA 4V2GA 2OV7A 4EV0A 5HNHA 2O6GE 4IEJA 5JFRA 3B6CA 1DP3A 1M1EB 2NS8A 3ZMZA 2HVQA 3H3UA 2R7RA 4C3IJ 1XX5A 3GZ5A 3H1CA 2F4IA 3TL4X 1FOYA 2DYSH 2CQKA 3IH2A 4ZYGA 4Z2YA 3VYSB 2Z1DA 4XQFA 3LNQA 2K86A 2R7QA 3F8NA 4R1HA 5HDKA 3C2BA 1ZLJA 1WJ5A 2IA2A 4LG0A 4UY8I 4D5FA 3E5UA 2DTRA 4DZPA 4FX4A 4CGZA 3CP2A 3BG5A 3GUDA 1FBUA 1XN7A 4J00A 3PJRA 1T98A 5K1YA 4CH7A 3JTHA 2XAQA 3IL2A 4BJTA 2QLZA 1MJAA 2DLLA 1HA8A 2QSHX 1H88C 1D1CA 2DA7A 4J01A 4KITB 1QBJA 2C6YA 4YEJA 3DEWA 5DDGA 2VASA 3HYIA 2Z9OA 3P9IA 4OIPF 4E7LA 1YTYA 5FKOA 2B63J 3S15J 2V9KA 1NH3A 4KISA 2DQLA 2KIUA 4AVPA 3CDLA 3L2UA 2M9HA 2RQQA 3K4KA 2VUMJ 5E1ZB 4F55A 2DT7B 4XSXF 2XKPA 3JR9A 4Q5SF 4XRMA 4G7HF 3T8RA 4Y7NJ 3EYIA 3PSFA 4IOCF 5M5XJ 4NDLA 1X2NA 5LGNA 2MGQA 3MVPA 4DQ2A 4LGWA 1USTA 2B9SA 4S05A 3ECHA 2DOAA 2ZMEA 5EG0A 2MLKA 1G3YA 3FXQA 2R4GA 4RGRA 2NRAC 4KNYA 1S7OA 3NWTA 3JRAA 4A3KJ 1B72A 1I1GA 2V79A 3C2HA 4A3LJ 2JT1A 2IXSA 3FBNB 3HG9A 3WTYC 1VQMI 4XM3A 2L7FP 1FMWA 1RC9A 2ISYA 2KZGA 3D5RC 3CLOA 3H35A 1ZRFA 3CCJI 5IYCJ 1LQ1A 4WX9A 1OCCH 2UXNA 1FPQA 1IRFA 5A2QK 5LFAA 4OU0A 3K4JA 1X2MA 1U6GA 1SD5A 4RAZA 2O5RA 1OQYA 1MZBA 3KPHA 1SVMA 5TJJA 3VSLA 1A31A 4MTEA 4Y52J 1DU6A 3OIOA 4LK1F 1U2WA 1YJNI 1RIOH 4O3MA 4IRHA 2HPMA 1BOBA 2ZB9A 3SZGA 4ESJA 3BG3A 2WY8Q 1NG6A 4LG3A 2V1UA 4EGYA 2KRFA 4CSWA 1UJ8A 3R60A 2Y2ZA 3N05A 2LLKA 2LVSA
chains in the Genus database with same CATH topology
1ETQA 3HOVJ 3HGGA 5DTDA 2AHQA 2DMPA 2WB1N 1MBHA 1U9OA 2DMUA 2JJ7A 4M3EA 5J1YA 2MW8A 1IJWC 1ZKGA 4BY1J 5IP9J 1XS9A 3E7LA 1GUUA 4C2MJ 3DCFA 2COBA 4MO7A 4S0HB 3RZOJ 1TWCJ 1OCTC 3OSGA 2FD5A 3LOCA 2JA5J 1IDZA 3GTGJ 3MKLA 5EZHA 2DA3A 2ECCA 3H3VK 2DMQA 3ZQLA 2DA1A 2QCOA 2K9SA 2R5ZA 3BG9A 5F04A 1F36A 1MBJA 3K2AA 1ZR4A 3A01B 1ZR2A 1JKRC 5IP7J 3RKQA 2M2EA 4DYRA 1HCRA 1E3OC 4DYCA 3PM1A 3BR1A 3G1OA 1SANA 2LR8A 4GFBA 1JJ8C 4IHVA 1BW6A 3Q0UA 3S1RJ 3FK6A 2KT0A 4B1RA 1FJLA 1JTXA 1A5JA 3S1MJ 3RZDJ 4BBSJ 4UUSA 5JLXA 2ID3A 4M3DA 1LE8B 1BL0A 2CUFA 2HOTA 4FCYA 4J19A 2XPWA 3TP3A 1RR7A 2CUEA 3M3YJ 3HGYA 3HOYJ 3S1NJ 2HI3A 1R9TJ 4CYCA 4XICA 3LSGA 4XRSA 2JA8J 2M34A 1GV5A 3TW6A 2OPTA 1MH4A 3QQAA 3S16J 2GLOA 3TEDA 4A3CJ 1FIPA 2NVYJ 1XG1A 3GTOJ 1TWGJ 4FTHA 2YS9A 4HNVA 3HOUJ 1PUFB 3JRCA 2DN0A 3JREA 2LD5A 2DA4A 2TCTA 5K7HA 4DYQA 4FE4A 3HBLA 4A3FJ 2M8GX 3BR2A 2QF7A 1SFOJ 3GTKJ 2HQ5A 5JLWA 2Y9ZA 4M3GA 1WPKA 1WGXA 1WI3A 1AU7A 4X1EA 3S1QJ 9ANTA 2WAQN 5EF6A 3JRHA 1UHSA 3ZQIA 2Y31A 2GM4A 4JX4A 1RPWA 1WCMJ 1Q1VA 3LSPA 5F27A 2P81A 1O4XA 5F08A 5GP9A 4A3BJ 4JP0A 3CMYA 4FE7A 2HOSA 2L7MP 1JUSA 2DA2A 4AYBN 1VF9A 3S14J 2XGCA 1A6IA 4C3HJ 3BTIA 3ZOBA 1JKQC 4A3EJ 3HB9A 1W0TA 3IH4A 1FTZA 1WH5A 5C4XJ 3HM5A 1NK2P 2K40A 2GBYA 3JRBA 1QPIA 1EF4A 3CQZJ 1IG7A 3L1PA 1GV2A 3O8GA 3PO2J 5EDNA 2R5YA 3BR3A 2H8RA 1I6HJ 5F1JA 1QRYA 2O8KA 5IOZA 2E19A 2XRLA 2G0EA 5J1UA 4L5EA 4QSHA 2YU9J 5M5YJ 2EH3A 1ETWA 2ECBA 3NARA 1ZQ3P 1PUFA 2JK3A 4D7MA 1XC5A 3VPRA 2TRTA 1MNMC 4ABZA 3RQIA 3G1MA 3UKGA 1TWHJ 2EZKA 1JGGA 2IAIA 5F0HA 2L9RA 2LTPA 3ZQFA 2FX0A 2NVQJ 4W1UA 3WHCA 1OJLA 1GT0C 1TWFJ 1IGNA 3GTLJ 1HDDC 3SFIA 1Y1WJ 1HOMA 2HXIA 5IP6A 1RKTA 1G2HA 1IV6A 3FKIJ 2E2HJ 2LFBA 5EGOB 1JKPC 1ITYA 4JYKA 1MH3A 2NVTJ 2DA6A 3JRFA 2JA7J 1LE8A 2R5ZB 3ZQGA 5C3EJ 2DMTA 3QPLA 2E2IJ 3BQZA 2XPUA 4M3FA 1VNDA 4IHXA 5C44J 1AHDP 3HOXJ 1B8IA 5GPCA 3OSFA 5IYDJ 1AKHB 2ID6A 2EZHA 2XGEA 3M4OJ 1MBKA 2Y30A 5F0CA 1YRNB 4V2FA 2EZLA 1MSEC 2R93J 1ETKA 1MBGA 2CQXA 2M0CA 2Y0SN 4FISA 3GTMJ 4IHWA 1APLC 2D5VA 1JUMA 1BJZA 4DW6A 3A01A 1RETA 4A3IJ 3HEFA 5FKKA 3FIWA 1ORKA 3GTQJ 1VFCA 3MN2A 2O7OA 4JX6A 1FEXA 4BKXA 2JMWA 4A3GJ 2K9NA 2ME0A 5FKMA 4DZJA 5E3LA 1OCPA 5FJ8J 1T56A 4A69C 1UMQA 4D7NA 4X6AJ 3PO3J 3LSRA 1QVTA 1IC8A 1VI0A 2PMZN 2X9DA 2VPRA 2EBIA 3Q0VA 3ZQCA 2XPVA 5EYRA 1HF0A 2VKVA 3TP0A 3I4MJ 1OFCX 3SDGA 2JWTA 1JKOC 3GTPJ 1ZGWA 4W97A 1T33A 1X58A 2X48A 3Q0WA 1JT6A 3H0GJ 1ETOA 2R7ZJ 4I6ZA 3BR6A 1Z0XA 1H89C 4UUTA 5E3MA 3D1NI 1TWAJ 4QTRA 2MG4A 2CU7A 2CRGA 2ME6A 2XSDC 1B72B 1IUFA 3SJMA 3F0CA 4XIDA 2W48A 3FISA 1NK3P 2NVXJ 2ELKA 2FJ1A 3A02A 3NAUA 4CYCB 4LOCA 4EEFG 2DTZA 3QPSA 1ZK8A 3TW7A 5K7FA 5M5WJ 1U8BA 2H1KA 1FTTA 3OOUA 2XB5A 3S2DJ 3GBGA 4BXXJ 2K9QA 1ENHA 2VI6A 1MBEA 5C4JJ 3JRDA 1RKWA 1AKHA 3IH3A 5FKLA 1FIAA 1JUPA 5HODA 1JT0A 5IYBJ 5J1RA 1Y1VJ 4MLOA 3BTJA 2MSYA 2EQRA 3O8HA 1MSFC 3HKZN 2KDZA 4XK4A 2I10A 2AO9A 2R92J 4B4CA 1POGA 5K7ZA 1BA5A 5EGOA 4V2GA 2IEKA 3K7AJ 2HYJA 4BY7J 2HDDA 2L7ZA 3BR0A 4IEJA 2R0QC 3B6CA 5DS9A 3JRIA 3I4NJ 2NS8A 1P7IA 2EZIA 3BT9A 2HOAA 2YUSA 4C3IJ 2DMNA 3IH2A 3FK7A 3B6AA 3LSJA 1NTCA 5FLMJ 5E3OA 1I3QJ 3LNQA 5IPAA 3W6VA 3C2BA 4XRSG 1P7JA 4A3JJ 4D5FA 2RAEA 3CCYA 1W0UA 4DZPA 2CJJA 3BG5A 1H8AC 1JJ6C 2WV1A 2NS7A 2CQQA 2IBDA 1WH7A 4A3MJ 3BTLA 2JA6J 4MFDA 1LFUP 1H88C 2DA7A 1LFBA 4JX5A 2HXOA 3DEWA 5F0FA 1K61A 1S7EA 4BBRJ 3JRGA 3GTJJ 4UUSB 1ETYA 3ZQHA 4RDUA 3HOZJ 5FKOA 4RBOA 1QVUA 2VKEA 2B63J 1HLVA 3S15J 4B3AA 1ZTRA 4A3DJ 3S2HJ 2R5YB 1D5YA 1ETXA 5EG0B 3CDLA 2L0KA 2M9HA 2Y9YA 2VUMJ 3BQYA 2LLKA 3S17J 3JR9A 2DA5A 2XB0X 4XRMA 4Y7NJ 1RESA 1GDTA 4D5CA 5EEAA 2LK2A 5M5XJ 4NDLA 5EZGA 1I50J 1X2NA 2N8GA 5J3LA 2MGQA 3MVPA 4M3BA 5FKNA 1IRZA 4QIWN 3BTCA 1DU0A 1YRNA 2JN6A 5EG0A 1GVDA 5FLVA 1F43A 3IV5A 3BR5A 2NOGA 3WHBA 5M3MJ 2OF7A 1ETVA 3JRAA 4A3KJ 1B8IB 1B72A 4A3LJ 5BNGA 1Z77A 2DJNA 2E1OA 2L7FP 2LY9A 1MBFA 4IHYA 5IOYA 4C3JJ 4AC0A 4MIMA 5M3FJ 3Q3SA 4MFEA 1CQTA 5IYCJ 3HOWJ 2XGDA 2LP0A 4A93J 1X2MA 2X6OA 4G12A 5GPAA 5E3NA 4Y52J 1DU6A 3OIOA 1UG2A 2E2JJ 4AUXA 1BW5A 1U78A 1K83J 1U9NA 2FQ4A 2LKXA 1HDPA 2ZB9A 3BG3A 4I76A 1JTYA 3HDDA 2O9LA 1IDYA 3A03A 4M6VA 1TC3C 2Y2ZA 3G1LA 2LVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETQ A;  3HOV J;  3HGG A;  5DTD A;  2AHQ A;  2DMP A;  2WB1 N;  1MBH A;  1U9O A;  2DMU A;  2JJ7 A;  4M3E A;  5J1Y A;  2MW8 A;  1IJW C;  1ZKG A;  4BY1 J;  5IP9 J;  1XS9 A;  3E7L A;  1GUU A;  4C2M J;  3DCF A;  2COB A;  4MO7 A;  4S0H B;  3RZO J;  1TWC J;  1OCT C;  3OSG A;  2FD5 A;  3LOC A;  2JA5 J;  1IDZ A;  3GTG J;  3MKL A;  5EZH A;  2DA3 A;  2ECC A;  3H3V K;  2DMQ A;  3ZQL A;  2DA1 A;  2QCO A;  2K9S A;  2R5Z A;  3BG9 A;  5F04 A;  1F36 A;  1MBJ A;  3K2A A;  1ZR4 A;  3A01 B;  1ZR2 A;  1JKR C;  5IP7 J;  3RKQ A;  2M2E A;  4DYR A;  1HCR A;  1E3O C;  4DYC A;  3PM1 A;  3BR1 A;  3G1O A;  1SAN A;  2LR8 A;  4GFB A;  1JJ8 C;  4IHV A;  1BW6 A;  3Q0U A;  3S1R J;  3FK6 A;  2KT0 A;  4B1R A;  1FJL A;  1JTX A;  1A5J A;  3S1M J;  3RZD J;  4BBS J;  4UUS A;  5JLX A;  2ID3 A;  4M3D A;  1LE8 B;  1BL0 A;  2CUF A;  2HOT A;  4FCY A;  4J19 A;  2XPW A;  3TP3 A;  1RR7 A;  2CUE A;  3M3Y J;  3HGY A;  3HOY J;  3S1N J;  2HI3 A;  1R9T J;  4CYC A;  4XIC A;  3LSG A;  4XRS A;  2JA8 J;  2M34 A;  1GV5 A;  3TW6 A;  2OPT A;  1MH4 A;  3QQA A;  3S16 J;  2GLO A;  3TED A;  4A3C J;  1FIP A;  2NVY J;  1XG1 A;  3GTO J;  1TWG J;  4FTH A;  2YS9 A;  4HNV A;  3HOU J;  1PUF B;  3JRC A;  2DN0 A;  3JRE A;  2LD5 A;  2DA4 A;  2TCT A;  5K7H A;  4DYQ A;  4FE4 A;  3HBL A;  4A3F J;  2M8G X;  3BR2 A;  2QF7 A;  1SFO J;  3GTK J;  2HQ5 A;  5JLW A;  2Y9Z A;  4M3G A;  1WPK A;  1WGX A;  1WI3 A;  1AU7 A;  4X1E A;  3S1Q J;  9ANT A;  2WAQ N;  5EF6 A;  3JRH A;  1UHS A;  3ZQI A;  2Y31 A;  2GM4 A;  4JX4 A;  1RPW A;  1WCM J;  1Q1V A;  3LSP A;  5F27 A;  2P81 A;  1O4X A;  5F08 A;  5GP9 A;  4A3B J;  4JP0 A;  3CMY A;  4FE7 A;  2HOS A;  2L7M P;  1JUS A;  2DA2 A;  4AYB N;  1VF9 A;  3S14 J;  2XGC A;  1A6I A;  4C3H J;  3BTI A;  3ZOB A;  1JKQ C;  4A3E J;  3HB9 A;  1W0T A;  3IH4 A;  1FTZ A;  1WH5 A;  5C4X J;  3HM5 A;  1NK2 P;  2K40 A;  2GBY A;  3JRB A;  1QPI A;  1EF4 A;  3CQZ J;  1IG7 A;  3L1P A;  1GV2 A;  3O8G A;  3PO2 J;  5EDN A;  2R5Y A;  3BR3 A;  2H8R A;  1I6H J;  5F1J A;  1QRY A;  2O8K A;  5IOZ A;  2E19 A;  2XRL A;  2G0E A;  5J1U A;  4L5E A;  4QSH A;  2YU9 J;  5M5Y J;  2EH3 A;  1ETW A;  2ECB A;  3NAR A;  1ZQ3 P;  1PUF A;  2JK3 A;  4D7M A;  1XC5 A;  3VPR A;  2TRT A;  1MNM C;  4ABZ A;  3RQI A;  3G1M A;  3UKG A;  1TWH J;  2EZK A;  1JGG A;  2IAI A;  5F0H A;  2L9R A;  2LTP A;  3ZQF A;  2FX0 A;  2NVQ J;  4W1U A;  3WHC A;  1OJL A;  1GT0 C;  1TWF J;  1IGN A;  3GTL J;  1HDD C;  3SFI A;  1Y1W J;  1HOM A;  2HXI A;  5IP6 A;  1RKT A;  1G2H A;  1IV6 A;  3FKI J;  2E2H J;  2LFB A;  5EGO B;  1JKP C;  1ITY A;  4JYK A;  1MH3 A;  2NVT J;  2DA6 A;  3JRF A;  2JA7 J;  1LE8 A;  2R5Z B;  3ZQG A;  5C3E J;  2DMT A;  3QPL A;  2E2I J;  3BQZ A;  2XPU A;  4M3F A;  1VND A;  4IHX A;  5C44 J;  1AHD P;  3HOX J;  1B8I A;  5GPC A;  3OSF A;  5IYD J;  1AKH B;  2ID6 A;  2EZH A;  2XGE A;  3M4O J;  1MBK A;  2Y30 A;  5F0C A;  1YRN B;  4V2F A;  2EZL A;  1MSE C;  2R93 J;  1ETK A;  1MBG A;  2CQX A;  2M0C A;  2Y0S N;  4FIS A;  3GTM J;  4IHW A;  1APL C;  2D5V A;  1JUM A;  1BJZ A;  4DW6 A;  3A01 A;  1RET A;  4A3I J;  3HEF A;  5FKK A;  3FIW A;  1ORK A;  3GTQ J;  1VFC A;  3MN2 A;  2O7O A;  4JX6 A;  1FEX A;  4BKX A;  2JMW A;  4A3G J;  2K9N A;  2ME0 A;  5FKM A;  4DZJ A;  5E3L A;  1OCP A;  5FJ8 J;  1T56 A;  4A69 C;  1UMQ A;  4D7N A;  4X6A J;  3PO3 J;  3LSR A;  1QVT A;  1IC8 A;  1VI0 A;  2PMZ N;  2X9D A;  2VPR A;  2EBI A;  3Q0V A;  3ZQC A;  2XPV A;  5EYR A;  1HF0 A;  2VKV A;  3TP0 A;  3I4M J;  1OFC X;  3SDG A;  2JWT A;  1JKO C;  3GTP J;  1ZGW A;  4W97 A;  1T33 A;  1X58 A;  2X48 A;  3Q0W A;  1JT6 A;  3H0G J;  1ETO A;  2R7Z J;  4I6Z A;  3BR6 A;  1Z0X A;  1H89 C;  4UUT A;  5E3M A;  3D1N I;  1TWA J;  4QTR A;  2MG4 A;  2CU7 A;  2CRG A;  2ME6 A;  2XSD C;  1B72 B;  1IUF A;  3SJM A;  3F0C A;  4XID A;  2W48 A;  3FIS A;  1NK3 P;  2NVX J;  2ELK A;  2FJ1 A;  3A02 A;  3NAU A;  4CYC B;  4LOC A;  4EEF G;  2DTZ A;  3QPS A;  1ZK8 A;  3TW7 A;  5K7F A;  5M5W J;  1U8B A;  2H1K A;  1FTT A;  3OOU A;  2XB5 A;  3S2D J;  3GBG A;  4BXX J;  2K9Q A;  1ENH A;  2VI6 A;  1MBE A;  5C4J J;  3JRD A;  1RKW A;  1AKH A;  3IH3 A;  5FKL A;  1FIA A;  1JUP A;  5HOD A;  1JT0 A;  5IYB J;  5J1R A;  1Y1V J;  4MLO A;  3BTJ A;  2MSY A;  2EQR A;  3O8H A;  1MSF C;  3HKZ N;  2KDZ A;  4XK4 A;  2I10 A;  2AO9 A;  2R92 J;  4B4C A;  1POG A;  5K7Z A;  1BA5 A;  5EGO A;  4V2G A;  2IEK A;  3K7A J;  2HYJ A;  4BY7 J;  2HDD A;  2L7Z A;  3BR0 A;  4IEJ A;  2R0Q C;  3B6C A;  5DS9 A;  3JRI A;  3I4N J;  2NS8 A;  1P7I A;  2EZI A;  3BT9 A;  2HOA A;  2YUS A;  4C3I J;  2DMN A;  3IH2 A;  3FK7 A;  3B6A A;  3LSJ A;  1NTC A;  5FLM J;  5E3O A;  1I3Q J;  3LNQ A;  5IPA A;  3W6V A;  3C2B A;  4XRS G;  1P7J A;  4A3J J;  4D5F A;  2RAE A;  3CCY A;  1W0U A;  4DZP A;  2CJJ A;  3BG5 A;  1H8A C;  1JJ6 C;  2WV1 A;  2NS7 A;  2CQQ A;  2IBD A;  1WH7 A;  4A3M J;  3BTL A;  2JA6 J;  4MFD A;  1LFU P;  1H88 C;  2DA7 A;  1LFB A;  4JX5 A;  2HXO A;  3DEW A;  5F0F A;  1K61 A;  1S7E A;  4BBR J;  3JRG A;  3GTJ J;  4UUS B;  1ETY A;  3ZQH A;  4RDU A;  3HOZ J;  5FKO A;  4RBO A;  1QVU A;  2VKE A;  2B63 J;  1HLV A;  3S15 J;  4B3A A;  1ZTR A;  4A3D J;  3S2H J;  2R5Y B;  1D5Y A;  1ETX A;  5EG0 B;  3CDL A;  2L0K A;  2M9H A;  2Y9Y A;  2VUM J;  3BQY A;  2LLK A;  3S17 J;  3JR9 A;  2DA5 A;  2XB0 X;  4XRM A;  4Y7N J;  1RES A;  1GDT A;  4D5C A;  5EEA A;  2LK2 A;  5M5X J;  4NDL A;  5EZG A;  1I50 J;  1X2N A;  2N8G A;  5J3L A;  2MGQ A;  3MVP A;  4M3B A;  5FKN A;  1IRZ A;  4QIW N;  3BTC A;  1DU0 A;  1YRN A;  2JN6 A;  5EG0 A;  1GVD A;  5FLV A;  1F43 A;  3IV5 A;  3BR5 A;  2NOG A;  3WHB A;  5M3M J;  2OF7 A;  1ETV A;  3JRA A;  4A3K J;  1B8I B;  1B72 A;  4A3L J;  5BNG A;  1Z77 A;  2DJN A;  2E1O A;  2L7F P;  2LY9 A;  1MBF A;  4IHY A;  5IOY A;  4C3J J;  4AC0 A;  4MIM A;  5M3F J;  3Q3S A;  4MFE A;  1CQT A;  5IYC J;  3HOW J;  2XGD A;  2LP0 A;  4A93 J;  1X2M A;  2X6O A;  4G12 A;  5GPA A;  5E3N A;  4Y52 J;  1DU6 A;  3OIO A;  1UG2 A;  2E2J J;  4AUX A;  1BW5 A;  1U78 A;  1K83 J;  1U9N A;  2FQ4 A;  2LKX A;  1HDP A;  2ZB9 A;  3BG3 A;  4I76 A;  1JTY A;  3HDD A;  2O9L A;  1IDY A;  3A03 A;  4M6V A;  1TC3 C;  2Y2Z A;  3G1L A;  2LVS A; 
#chains in the Genus database with same CATH topology
 3PFY A;  3DPU A;  4BEH B;  3ASO H;  3G71 I;  5FB2 A;  2LOO A;  4E7Z A;  3HGG A;  5DTD A;  2HQR A;  1SFE A;  1DUX C;  3IHU A;  1TL8 A;  2WB1 N;  1U9O A;  2DMU A;  2XAH A;  2HWV A;  1R6R A;  3J7A O;  3K70 D;  3F6O A;  3TO6 A;  1T0F A;  1IJW C;  2CV1 A;  1I6X A;  3VWB A;  1MW7 A;  1ZKG A;  5IP9 J;  2ZNY A;  1XS9 A;  4XMY A;  3G73 A;  2HKX A;  2COB A;  3RJP A;  2M87 A;  1NHA A;  2FD5 A;  2DK8 A;  1W5C C;  3VYR B;  2JA5 J;  1IDZ A;  3ROU A;  5DYM A;  2GZW A;  1W36 C;  5EZH A;  1G3W A;  2UUZ A;  4HNU A;  3I9V 2;  2ECC A;  2DMQ A;  3ZQL A;  2CS3 A;  1KU7 A;  2F4M B;  2XAF A;  2LDU A;  5DD4 A;  2HDW A;  1MMN A;  3DPT A;  5L3G A;  2ZME B;  2XAG A;  3C3W A;  2BVL A;  3GFM A;  3KP3 A;  3QWL A;  5CQG A;  1F36 A;  1PUE E;  5ICG A;  3KZZ A;  4PCQ A;  5AIQ A;  5ICE A;  2VBX A;  2P7C B;  2QVO A;  3DU5 A;  3A01 B;  2O3F A;  2VLA A;  4DYR A;  1SFK A;  2E34 A;  4CHU A;  3P7N A;  3K69 A;  5DCM A;  4QWQ A;  4MEX F;  2LR8 A;  1I27 A;  3Q0U A;  2UV1 A;  3CCE I;  1UG0 A;  4PJM A;  4B1R A;  2DOF A;  1JTX A;  1A5J A;  2WAD A;  2A05 A;  3S1M J;  3E6C C;  5LEK A;  4UUS A;  2OBP A;  3FXL A;  1YIT I;  3BRO A;  1WWX A;  1Y0N A;  3WE3 A;  4UB6 C;  2RN7 A;  5L3F A;  3OYK A;  1BL0 A;  2VOP A;  4I0A A;  3HKZ A;  3FZV A;  4J19 A;  2CUJ A;  3V8L A;  1FWZ A;  3VYT B;  5BPI A;  1RR7 A;  2CUE A;  3M3Y J;  3FKJ A;  4NC8 A;  4M9S A;  3HOY J;  1ODD A;  2VJJ A;  2MFZ A;  3S1N J;  2HI3 A;  3I0T A;  3NQO A;  3SHF A;  4LMY A;  2OZ6 A;  2JA8 J;  1SAU A;  4OAZ A;  4XOT A;  3JAM Z;  3OYG A;  3M8E A;  4B8X A;  3H92 A;  3GME A;  4BEH A;  3TED A;  2JQ7 A;  1FIP A;  1MMG A;  2VN2 A;  1Z3X A;  1XG1 A;  1FX7 A;  2VBY A;  2F5C A;  1IN4 A;  1QNT A;  1I39 A;  3P5J A;  4XLA A;  2LNB A;  4FTH A;  2W7N A;  3Q5F A;  2DK5 A;  4HNV A;  2HZT A;  1FOX A;  4HV5 A;  3JRC A;  3LFU A;  3PIP F;  4BDY A;  2XHK A;  3ZRG A;  4HNT A;  5K7H A;  3OYN A;  3KLO A;  2W1O A;  3GTK J;  2WAF A;  3H36 A;  3ZPL A;  2Y9Z A;  2AXT C;  2WB1 A;  3FMS A;  2YX4 A;  4M3G A;  5KAI C;  3CCS I;  2FOK A;  5L3B A;  3JRH A;  2IGO A;  1V5E A;  2GA1 A;  1BR1 A;  5FGM A;  2P5V A;  4XRF A;  2Y0S A;  2P81 A;  2V7F A;  2IS6 A;  1UZC A;  1E3P A;  3RKW A;  5F08 A;  3PL8 A;  1K4S A;  1YIJ I;  4A3B J;  3TOA A;  4JP0 A;  4YFK F;  1X4O A;  2HOS A;  1I5Z A;  2F5F A;  1EKE A;  2L7M P;  4E4H A;  3HHH A;  2XC7 A;  2DA2 A;  4IL6 C;  2KJC A;  5K5Q A;  1WJD A;  3LA7 A;  1MNE A;  4Y15 A;  2HYG D;  1PJR A;  3O2P E;  2DFE A;  2NYX A;  2NNY A;  1QGP A;  3VFZ A;  2VT2 A;  4A3E J;  5C4X J;  4KN4 X;  4ZYD A;  1NK2 P;  4ZC3 A;  2GBY A;  3LSH A;  1P4A A;  1XSX A;  3CQZ J;  4G6D A;  3UR3 C;  2R7O A;  3K4L A;  3TO9 A;  4YII A;  2IW5 A;  2R5Y A;  4CCJ A;  3CP8 A;  1I6H J;  1QRY A;  1YW9 A;  3ZN0 A;  1G6N A;  1F5T A;  2Z33 A;  2E19 A;  4E70 A;  2G0E A;  2GOM A;  2Q0O A;  5J1U A;  4L5E A;  1MJ9 A;  2YU9 J;  2EH3 A;  1ETW A;  2ADU A;  2CO5 A;  3JW4 A;  4OAY A;  2JK3 A;  2H8W A;  5E79 C;  1XC5 A;  5JHU A;  1MNM C;  1D8J A;  3R6S A;  3Q9V A;  4HST A;  3S93 A;  3K2Z A;  1JGG A;  2ZME C;  2LTP A;  4P5O A;  3RPQ A;  2FEZ A;  2GQQ A;  2WTE A;  4W1U A;  3WHC A;  3RPU D;  3VDX A;  1IGN A;  3U9G A;  1WJE A;  4XKB A;  1Y1W J;  5DM6 F;  4IRI A;  2XRO A;  4KJZ A;  5HOO A;  2IPQ X;  1G2H A;  2V4J C;  3HRU A;  3R0J A;  1HW2 A;  3FKI J;  2E2H J;  4P96 A;  4XKC A;  4NC7 A;  2NVT J;  2DA6 A;  3ZR8 X;  4BHC A;  2O61 A;  4IHT A;  3ABK H;  4RB0 A;  3BC8 A;  1RNL A;  4I2O A;  1PVE A;  1ON1 A;  4LIU A;  1FP1 D;  4A5N A;  3HRT A;  1R4M B;  1OPC A;  3BJA A;  1Y39 A;  3MZY A;  5C44 J;  1B8I A;  1I3A A;  3I59 A;  4B47 A;  2B7E A;  4RB1 A;  2IVM A;  3FMQ A;  3HOS A;  2JUG A;  3HIF A;  4RLF A;  2ID6 A;  2XGE A;  5HNF A;  3K9T A;  2EFP A;  1T6S A;  4I02 A;  3W6J B;  1SMY F;  2EZL A;  5KCM A;  5E1X A;  4F93 B;  4PFO A;  4KIG A;  2G9W A;  3I5U A;  1APL C;  4MQ9 F;  3A0H C;  2D5V A;  4N9H A;  1PP7 U;  3F21 A;  3FXK A;  2V6C A;  2R7X A;  1IXS B;  2D1H A;  1CGP A;  4BUP A;  4KMF A;  2K9N A;  4UV9 A;  4KDP A;  4F7Z A;  2ME0 A;  1J5Y A;  1FSE A;  2YU3 A;  2DU9 A;  5FKM A;  4BL0 B;  4DZJ A;  2ZXW H;  5FJ8 J;  2PJR A;  3VB2 A;  2GXA A;  1VQ6 I;  1X1P A;  1UMQ A;  1PYV A;  5CVI A;  4EAT A;  2RV8 A;  3FF5 A;  3HUG B;  4X6A J;  5H6Q A;  4AVZ A;  1ZGA A;  1QVT A;  3F8M A;  3BG6 A;  2EWN A;  2Z99 A;  4RLQ A;  1Z05 A;  5ED4 A;  2VPR A;  3Q0V A;  1QQI A;  1IN5 A;  2Z16 A;  3KLN A;  4XN3 A;  3RYR A;  2DO7 A;  3SYT A;  5B1A H;  1EH8 A;  1ZGW A;  1JI8 A;  3Q0W A;  3CD6 I;  5E1W A;  4Q47 A;  3FBI B;  1J0R A;  1ETO A;  4HAM A;  3BR6 A;  3DV8 A;  2JPB A;  3NEU A;  3J80 Z;  1ZAO A;  2IS2 A;  3ZMV A;  2PX9 A;  5E3M A;  2FE3 A;  1DDN A;  4IQJ A;  1YOV B;  3ZMT A;  2O03 A;  1R1U A;  4UNO A;  2DOE A;  3MKY B;  1R5H A;  1EJ9 A;  2W82 A;  5GTH C;  1IUF A;  5D5W B;  3F0C A;  3SZP A;  5F6F A;  3WE2 A;  2K4B A;  3F8F A;  4A0Y A;  4AIJ A;  3A02 A;  3NAU A;  3EUK L;  1ZHF A;  2WC2 A;  4DOZ A;  3KCC A;  2ESN A;  4F91 B;  4CYC B;  2BEO A;  4EEF G;  5M5W J;  2H1K A;  4EM1 A;  3LST A;  2A5W A;  2ZBK A;  4BXX J;  2OU2 A;  3CC7 I;  1B59 A;  1ZG3 A;  3B73 A;  3S3N A;  3QOP A;  1YW7 A;  5LRR A;  3BZC A;  3SEZ A;  2PI0 A;  3OIQ A;  1SVL A;  3DU6 A;  3KP6 A;  3KX2 A;  4M71 A;  2H27 A;  1JUP A;  3HHG A;  4MHG A;  5B5E C;  5IYB J;  3MFK A;  1MMS A;  2FBK A;  4JOM A;  1Y1V J;  4ESF A;  1Y0U A;  2DPU A;  3DBR B;  2M7A A;  1HQC A;  1OMI A;  2EQR A;  2XDV A;  3GXO A;  3H9Q A;  3O8H A;  4HQM A;  2X0L A;  3WGH A;  3EPZ A;  1Z6T A;  1BM9 A;  3S32 A;  4PFP A;  1Z7L A;  5J40 A;  2IEK A;  3L2C A;  4XLN F;  3K7A J;  2HYJ A;  4BY7 J;  3LWF A;  5HVQ C;  2HDD A;  2L7Z A;  5LRS A;  3R4K A;  2DW4 A;  5DS9 A;  2IJL A;  2HS5 A;  3CJQ B;  4ZZD A;  5ILU A;  3BT9 A;  3LSJ A;  5FLM J;  4NQW B;  1T0F C;  2M4G A;  3ZQQ A;  5IPA A;  2FRH A;  2ZJR F;  4U0Y A;  2EV5 A;  2DPD A;  4N0B A;  3W6V A;  2ZJ2 A;  3W2W A;  3WGG A;  4XRS G;  3WTT C;  2NXN B;  4CUG A;  5HLI A;  3CCY A;  2CW8 A;  3FXU A;  4R79 A;  2OJE D;  4E7S A;  1W0U A;  1CF7 B;  4G7O F;  1H8A C;  1H0M A;  2ZCW A;  2KP6 A;  4KMU X;  4PK4 A;  5DCF A;  2NS7 A;  2CQQ A;  2H94 A;  1KU9 A;  2IBD A;  1R1T A;  5H20 A;  3FHZ A;  3V8K A;  3WU1 B;  3E5Q A;  2PLY A;  4GRI A;  2DDA A;  3W2A A;  4MFD A;  1LFU P;  4OIQ F;  1OR7 C;  4HG2 A;  5TGT A;  3RKY A;  1K61 A;  1ULY A;  1S7E A;  3CME I;  2MAB A;  4NC6 A;  5ILV A;  3FX3 A;  3JRG A;  3KYL A;  3GTJ J;  3LL7 A;  4OIN F;  3COA C;  3ZQH A;  3BDD A;  1LVA A;  2IA0 A;  1LDD A;  4IOA F;  4RBO A;  3KET A;  2PJR B;  2QBY A;  5HDG A;  2OTL I;  1HST A;  3QPT A;  1ZTR A;  2EFQ A;  3U2R A;  4ZH4 F;  3LAP A;  1KYZ A;  1S29 A;  2R5Y B;  3J80 K;  1D5Y A;  3RYP A;  4BQQ A;  4NB5 A;  3MMY B;  4HYE A;  1LEB A;  2HQN A;  4Z6Y A;  2OC6 A;  3BQY A;  2LH9 A;  4OIO F;  3DEU A;  4D5C A;  4E6K G;  1VQO I;  2N8G A;  5EZG A;  2BY3 A;  5J3L A;  2OD5 A;  3S3M A;  5FKN A;  3CLQ A;  1IRZ A;  3ERM A;  3FM5 A;  3VOE A;  2EFO A;  2JN6 A;  4LIT A;  1GVD A;  2RNG A;  4AIK A;  4PUS A;  1K4T A;  5CVR A;  3OYF A;  4L0Y B;  3S3O A;  5FLV A;  3RKX A;  2BW3 B;  2L5Q A;  1ETV A;  2EV0 A;  5BNG A;  1Z77 A;  1KU3 A;  3TBI A;  1U8R A;  2LY9 A;  1MBF A;  3A1Y A;  5J6X A;  4A0Z A;  3OYB A;  3TKY A;  4RGS A;  5FO5 A;  3W6K B;  3CCM I;  1JXS A;  4PGH A;  2E60 A;  2F5E A;  1VQN I;  4KIF A;  3X2Q H;  4MIM A;  1KYW A;  1KA8 A;  2CH0 A;  4MFE A;  1CQT A;  3EDP A;  3ML6 A;  2AQE A;  2IGN A;  4IJA A;  1W7P D;  3QOD A;  3L9F A;  4A93 J;  2FF4 A;  1BN5 A;  1YS6 A;  1QHH D;  3LFK A;  1W5T A;  2X6O A;  2EIN H;  3R0A A;  5GTI C;  4AUX A;  1BW5 A;  3FXM A;  1K83 J;  1X1A A;  3TMO A;  2FQ4 A;  3EET A;  1SFU A;  1HDP A;  4B09 A;  2QGU A;  2AS5 F;  1JTY A;  3K10 A;  3IKT A;  2O9L A;  3IUO A;  1FYK A;  1E3H A;  3A03 A;  1TC3 C;  4ENJ A;  3ZQ7 A;  2VL8 A;  2Y48 A;  4XKW A;  3E6D A;  3G1L A;  2DXI A;  1XMX A;  3E6B A;  1MKM A;  5H6R A;  3CO7 C;  2VPL A;  1PP8 F;  1RUO A;  2DMP A;  4E7H A;  1YW8 A;  3GLX A;  4M3E A;  5J1Y A;  1LFP A;  3AG1 H;  3N4M A;  1IO2 A;  4OMY A;  3AKZ A;  5LHH A;  2OCE A;  3RTR A;  3E7L A;  2ZJP F;  2GIZ A;  4C2M J;  2EFN A;  4MO7 A;  1TWC J;  5LEJ A;  2FMY A;  1ZRC A;  5LHG A;  4L9T A;  3CMA I;  2F4O B;  4WK8 F;  3CDI A;  2FA5 A;  1R7J A;  3RIR A;  2CQ7 A;  3OYE A;  2DA3 A;  3K6G A;  2K9S A;  2R5Z A;  5HLG A;  2WBM A;  3KP2 A;  4WF2 A;  4ON0 A;  1ZR4 A;  4HZF A;  2K5C A;  5CVJ A;  5BS6 A;  1ZEL A;  4BXU A;  2KFD A;  1K6Y A;  1JKR C;  5IP7 J;  3RKQ A;  2M2E A;  1HC8 A;  4LB6 B;  1BIB A;  5CQE A;  2KRC A;  2K4J A;  1G4D A;  3PM1 A;  4YG2 F;  3PNY A;  4GFB A;  1VZ0 A;  1G8X A;  1OYW A;  2ELH A;  4LJZ F;  4BU2 A;  4HF1 A;  1JJ8 C;  4IHV A;  2LY2 A;  4GYI A;  1VTN C;  3KYC B;  3FK6 A;  2KT0 A;  1V4R A;  2PMH A;  3AG4 H;  1FJL A;  1Y56 A;  4BBS J;  2F5D A;  5D4R A;  2ZC2 A;  4M3D A;  3FXR A;  2M1B A;  1HW5 A;  1ERD A;  2DCE A;  2CUF A;  3W2V A;  3BCA A;  3E6M A;  1FLI A;  3D0S A;  1FYM A;  2I8D A;  4M73 A;  3F23 A;  2XPW A;  3BZ6 A;  1N77 A;  3HGY A;  2XAJ A;  2LKP A;  4BH9 A;  2OTJ I;  1R9T J;  1EH6 A;  4I09 A;  4XIC A;  2P4W A;  4XLC A;  4XRS A;  1Y8R B;  2WA0 A;  3PIO F;  2QA4 I;  1IXR C;  4O6J A;  3S16 J;  2WV0 A;  4RAF A;  3ABM H;  2VOO A;  2EA2 A;  3CJN A;  2BVM A;  1MMA A;  4IZZ A;  5K5R A;  2EFW A;  2Q2E B;  1PUF B;  2DN0 A;  2TDX A;  3SQN A;  1UHM A;  2TCT A;  4XNF A;  3ZP5 A;  5E18 F;  1Z91 A;  2M8G X;  3BR2 A;  5J4V A;  1IF1 A;  4CZZ A;  3KP7 A;  4MEY F;  1FP2 A;  2HQ5 A;  2K7L A;  3DQV C;  3V42 A;  4MGR A;  5GAE J;  4XON A;  1WPK A;  3S1Q J;  2K3P A;  1TTY A;  1N75 A;  2K3F A;  4X1E A;  1AOY A;  2WAQ N;  3RI4 A;  3SXY A;  5DUI A;  4A2U A;  2IS4 A;  1QZZ A;  1Z6R A;  2E36 A;  3LSP A;  3OV8 A;  2ESH A;  3GZ6 A;  1SFX A;  1ZG1 A;  4LK0 F;  1RRJ A;  3IP4 B;  3QU6 A;  3CES A;  4A6E A;  3CMY A;  4D0P A;  4R8H A;  4IHS A;  1JUS A;  1W7P B;  1TLH B;  1XTA A;  2Z2S B;  5JVT A;  1A6I A;  2VT3 A;  1W0T A;  1V5G A;  3IH4 A;  1FTZ A;  1WH5 A;  3HM5 A;  3U21 A;  2D45 A;  4LB5 A;  4U7D A;  5J8F A;  2P5L C;  2HVS A;  2L9S A;  5IT3 A;  1UAA A;  2CG4 A;  3M07 A;  4JQF A;  1QZE A;  3BR3 A;  4HF0 A;  1R5G A;  2RC4 A;  4X0G A;  5J4Y A;  4RAY A;  4GCV A;  2HPI A;  2GAU A;  2ECB A;  4P9U A;  1ZQ3 P;  3OOP A;  1K79 A;  1LDK B;  4UHT A;  1N25 A;  2L7K A;  2Q2E A;  3V7R A;  2E71 A;  3CTA A;  1MD0 A;  1FBS A;  1D0X A;  3KFW X;  4ENK A;  2EZK A;  4H0E A;  2IAI A;  3CMM A;  3O3K A;  3E5X A;  4WCG A;  1GT0 C;  1TWF J;  3DXJ F;  1HDD C;  2M4K A;  3H9G A;  1BR2 A;  5BPD A;  1HKT A;  3SFI A;  2QSG X;  1XPX A;  5IP6 A;  2V9V A;  1X19 A;  2M0M A;  4UXN A;  1RR8 C;  3HRS A;  2IA1 A;  4BE0 A;  2R7U A;  2CQN A;  2LFB A;  5EGO B;  2CYY A;  3M8J A;  1RUN A;  2RKH A;  4JYK A;  3VYU B;  1MH3 A;  3L2R A;  3DKY A;  4Y3O A;  4ENN A;  2PBI A;  2JA7 J;  1FOW A;  1XDS A;  2ZFU A;  4CIC A;  1L0O C;  2ZNZ A;  3GFJ A;  1X3W B;  3FWE A;  3BQZ A;  3H5A A;  2IP2 A;  2XPU A;  1OKR A;  1VND A;  1Y6I A;  2W4S A;  1AHD P;  2HOE A;  2MD5 A;  4G9Y A;  4B44 A;  5GPC A;  1AKH B;  1MBK A;  2X6Y A;  4AU7 A;  5F0C A;  3G4S I;  4V2F A;  2R93 J;  1MBG A;  3QP5 A;  2CQX A;  2M0C A;  2Y0S N;  4FIS A;  4DGW B;  3BCB A;  2KKO A;  4DW6 A;  1BJA A;  2BHZ A;  1RET A;  3PUF A;  3PSI A;  5FKK A;  3FIW A;  3M7G A;  1ORK A;  5F1R A;  1VQ5 I;  2CV2 A;  1UFM A;  2NVU B;  1VFC A;  3MN2 A;  2PJP A;  1FEX A;  2E5Z A;  2EJR A;  3MKW B;  1J09 A;  5CJ9 A;  2Y75 A;  3OYD A;  2JVG A;  4U0W A;  3KP4 A;  5J47 A;  1OCP A;  3C7J A;  1WI9 A;  5DM7 F;  1B1B A;  2KIM A;  3E97 A;  4A69 C;  4WXC A;  2OUM A;  4P55 A;  1J7K A;  1LDJ A;  3TGN A;  3KEQ A;  3O6B B;  3RDI A;  3DTK A;  1F1Z A;  2BY2 A;  1OCO H;  3T0Y A;  3S8P A;  1VI0 A;  2PMZ N;  2GXB A;  2VXD A;  2XPV A;  1T95 A;  3I4M J;  1E0E A;  1LNW A;  1T33 A;  1X58 A;  1BI0 A;  1SVO A;  2E7W A;  1YHQ I;  3RCO A;  1YX5 A;  2COM A;  5L3D A;  4I98 B;  3J7Z I;  2R7Z J;  1J75 A;  4BJ6 C;  4NNJ A;  1YI2 I;  1HBX G;  4G8X A;  3F9K A;  2STW A;  4IF4 A;  4HPQ A;  3GWZ A;  1X1D A;  3P9K A;  2VXZ A;  2ZO4 A;  5AIP A;  2CRG A;  2ME6 A;  2DJI A;  1B72 B;  4UVA A;  4P1W A;  3SJM A;  4NQW A;  1T39 A;  2CGP A;  3E1S A;  1NK3 P;  3FIS A;  3IRR A;  5BOX A;  4Y13 A;  2HTS A;  3J81 Z;  3F72 A;  3I64 A;  2E1M B;  1TNS A;  4QPQ A;  2K27 A;  2DTZ A;  4BDZ A;  1U8B A;  1J9I A;  3WGI A;  1FTT A;  2FBH A;  2DBB A;  3IKV A;  4RGX A;  2G7U A;  3MZ8 A;  1DPR A;  2BYV E;  5D5X B;  1ENH A;  2VI6 A;  1ONV A;  3JRD A;  3GW2 A;  1RKW A;  4UVC A;  2R7V A;  2XAU A;  3H5N A;  2LF8 A;  3IH3 A;  2OA4 A;  3ZMD A;  1JT0 A;  3DLA A;  1H9G A;  2E1M C;  1X4P A;  4LIV A;  2HNH A;  2R7D A;  4BS9 A;  4MLO A;  4U7B A;  2BOL A;  3BTJ A;  1N78 A;  4BGD A;  1O7F A;  4D1Q A;  2VJI A;  4PJ0 C;  1POG A;  4AD9 A;  5K7Z A;  4L9V A;  4XLP F;  1YX3 A;  3IC7 A;  4A6D A;  3CUQ A;  5D5V B;  3E3V A;  1DGR M;  2LF7 A;  2A68 F;  2UZK A;  2HKO A;  2VBZ A;  3HC7 A;  1V54 H;  4OOI A;  1YQA A;  2R0Q C;  4ASN A;  2DT5 A;  3JRI A;  3F22 A;  1P7I A;  1FNN A;  2EZI A;  4M9X A;  4ETS A;  1V5F A;  2YUS A;  3I53 A;  3OMY A;  4KYW A;  2QKL B;  2V1D A;  3B6A A;  3D5L A;  2RRE A;  3DTI A;  3MKZ A;  2EIM H;  4XOP A;  2XV4 S;  1IRX A;  1DGW Y;  2ETH A;  1O3Q A;  1YIO A;  4Q48 A;  4RM3 A;  1E17 A;  2MYS A;  3JSP A;  1P7J A;  2KRH A;  2KPM A;  2P6S A;  4WXD A;  5HS8 A;  2RAE A;  3CCU I;  1XMA A;  3VSK A;  3SDB A;  2OAZ A;  3GEZ A;  3L09 A;  1BI1 A;  1JJ6 C;  2WV1 A;  2VJ5 A;  4IVN A;  1SMT A;  4A3M J;  1MDM A;  2ZSH B;  3BTL A;  3Q9S A;  4CCL A;  2OCC H;  2JA6 J;  2MH9 A;  1R4N B;  1XCB A;  5LLQ A;  3OS2 A;  2VC1 A;  3SZT A;  1LFB A;  1Y8Q B;  4DBQ A;  1R71 A;  1ZH5 A;  1R00 A;  2CW0 F;  2QEN A;  2V26 A;  4DBR A;  4BBR J;  3NRV A;  1T38 A;  3EUH A;  2MC3 A;  4HSR A;  4RDU A;  3H3Z A;  4M74 A;  1HLV A;  4B3A A;  4A3D J;  1YG2 A;  1T08 B;  1U5T B;  2DT6 A;  3OL3 A;  2RNJ A;  3K1P A;  5EG0 B;  5H2F C;  4K2E A;  3BWG A;  3T1B A;  2LBF A;  1KU2 A;  3FDY A;  3U1D A;  2DA5 A;  2XB0 X;  5HS9 A;  5LD2 C;  3MAJ A;  1RES A;  1GDT A;  1TQP A;  1FZP B;  1SEU A;  4WXH A;  3HXL A;  3HL2 A;  1FT9 A;  1JHH A;  4M3B A;  4QIW N;  1D0Y A;  4PSW A;  1DU0 A;  4Y4R A;  4NHJ A;  1XSV A;  2A69 F;  2Z3Y A;  2ISZ A;  1F43 A;  3WHB A;  1B8I B;  1B4A A;  3HPG A;  3MWM A;  3S2W A;  2DJN A;  3LSI A;  2E1O A;  1FBQ A;  2NOJ B;  3HSR A;  1MIJ A;  2XUB A;  2PFB A;  3OYA A;  4FT8 A;  4C3J J;  3L00 A;  5M3F J;  3I58 A;  3Q3S A;  1XGO A;  4YEL A;  4L9J A;  4F3Q A;  2LC2 A;  3BP8 A;  2KIS A;  2ZXH A;  2XGD A;  2LP0 A;  4DJA A;  1L3L A;  2EIJ H;  2D1V A;  1BR4 A;  4G12 A;  2VE8 A;  4NBQ A;  2DDB A;  2J5O A;  3G2B A;  5E3N A;  2A5Y B;  3CO6 C;  2E2J J;  1SD4 A;  4U0V A;  1U78 A;  1U9N A;  4PZJ A;  2QQB A;  1LKX A;  2XF7 A;  3IWZ A;  4HDU A;  3U1K A;  4I76 A;  1T2K A;  2VE9 A;  1ZYR F;  4LD5 A;  2VQG A;  1IDY A;  2EB7 A;  2A6T A;  1BIA A;  2L3D A;  1X1B A;  4GDF A;  1S6L A;  4M6Y A;  3ZMU A;  2FOW A;  3HOV J;  4EJW A;  2LY1 A;  3N97 A;  3F8B A;  4E7I A;  1MBH A;  2JJ7 A;  1TP4 A;  3L2V A;  4IKF A;  1JGS A;  4ZDO A;  1QU3 A;  4DIQ A;  1IRG A;  1SD6 A;  2MW8 A;  1RI7 A;  4BY1 J;  5DEQ A;  3GVA A;  2ZJQ F;  1GUU A;  4A12 A;  3RZO J;  4G7Z F;  2PG4 A;  2M7B A;  1OCT C;  1VQP I;  3LOC A;  3K1N A;  2EA4 A;  4DNC A;  2HR3 A;  1JHF A;  3OYL A;  2XGX A;  3GTG J;  2J5P A;  3GZN B;  2X1D A;  3MKL A;  4C30 A;  4XLE A;  5ICF A;  4ENM A;  4N4N B;  3AFH A;  2DA1 A;  2W85 A;  3ABT A;  3BG9 A;  3LSK A;  5F04 A;  5K5O A;  1XD7 A;  1D1B A;  2DAO A;  1SAX A;  4XL9 A;  2DOD A;  2HQA A;  1W5S A;  2A6H F;  1ZR2 A;  1OIS A;  2FBI A;  2HVR A;  2X1E A;  1HCR A;  4IPA A;  3GX4 X;  4U88 A;  3ZGK A;  4DYC A;  1A35 A;  3BR1 A;  3G1O A;  1SAN A;  4C9Y A;  2XRN A;  3K4N A;  3PFI A;  3J81 K;  3QYF A;  3S1R J;  2Q8K A;  3MQ0 A;  2PMU A;  3GFI A;  3TQN A;  2LKS A;  3CF5 F;  5JLX A;  2IS1 A;  3JCU C;  2R3S A;  4RS8 A;  2R7S A;  3K4C A;  1XB4 A;  2L2O A;  1R23 A;  1R36 A;  1WFX A;  4FCY A;  2ZXJ A;  2FML A;  5KHD A;  4AIH A;  5FLX Z;  3LQR A;  1ZLK A;  3DFG A;  1HW1 A;  4HA8 A;  2P5K A;  2M34 A;  1GV5 A;  6PAX A;  5IY5 H;  4L9N A;  3G3Z A;  1EH7 A;  3WG9 A;  2GLO A;  4CZC A;  3I71 A;  1OYI A;  5B1B H;  2CWE A;  5D4S A;  2NVY J;  2GWR A;  5GAH J;  4CA0 A;  4EJO A;  1TWG J;  2GA2 A;  2EK5 A;  2KDO A;  3HZJ A;  3OL4 A;  1VQ4 I;  3HOU J;  4ZYH A;  2DA4 A;  2BY1 A;  2LG4 A;  4M72 A;  1GXQ A;  4CDG A;  3GFL A;  4DYQ A;  4FE4 A;  1YO5 C;  1P4X A;  3FHN A;  3PNV A;  4HX7 A;  3IAM 2;  4ZJZ A;  3C18 A;  3I56 I;  3KP5 A;  1WKM A;  4IXA A;  4ZZL A;  1WGX A;  1WI3 A;  5DCM B;  9ANT A;  2FQ3 A;  5GAG J;  4QPO A;  5EF6 A;  1ZAR A;  2KHM A;  4D9J A;  2HZD A;  2A3S A;  2Y31 A;  3F3X A;  4JX4 A;  3DTE A;  1RPW A;  1R58 A;  2PN6 A;  1VQ9 I;  1FMV A;  1O57 A;  4I01 A;  4JBA A;  5F27 A;  1XGN A;  2KJB A;  5TRD A;  4V19 K;  1TQI A;  5DD8 A;  1AWC A;  2GXG A;  3CCL I;  2G7H A;  1LVK A;  4FE7 A;  4L5J A;  4JK1 X;  1KZH A;  4GO1 A;  5DV5 A;  3OYM A;  1W36 D;  1LB2 A;  1Z3Y A;  3ONQ A;  1D8K A;  1VF9 A;  4FET A;  3S14 J;  2VIX A;  3BTI A;  4CCM A;  3ABU A;  1Z7U A;  4BYY A;  1WZ2 A;  3H9J A;  1P4W A;  2L4A A;  4CCK A;  3P9C A;  3JRB A;  1BI3 A;  2KQR A;  1QPI A;  1MDM B;  1EF4 A;  5D6F A;  4EM2 A;  3ESW B;  4PGG A;  3PO2 J;  5DUK A;  4LFU A;  2H8R A;  5F1J A;  5FRN A;  5IOZ A;  3M1C A;  2XRL A;  3C2G A;  3FXJ A;  4QSH A;  2XF5 A;  2XVC A;  5M5Y J;  2M45 A;  3NAR A;  4YFN F;  1TQM A;  1PUF A;  3K4M A;  3KZY A;  2TRT A;  2RGV A;  4C2T A;  3G1M A;  2M8E A;  4XLH A;  1G3T A;  1FY7 A;  3ERE D;  3ZQF A;  4FAS D;  5HDN A;  3CCV I;  2NVQ J;  1SD7 A;  1OJL A;  4BE1 A;  3GTL J;  5EJC A;  5E17 F;  1ZN2 A;  3HTS B;  1HOM A;  4L0Z B;  2HXI A;  1YFH A;  1USS A;  2KMU A;  3WTW C;  3L2W A;  4PSX A;  3BJO A;  2WAQ A;  1IV6 A;  3CUQ B;  3QRF F;  1T8I A;  1JKP C;  3V7S A;  1ITY A;  1H9T A;  2CV0 A;  2NAZ A;  1FC3 A;  3JRF A;  4H4K C;  3CUQ C;  5ILS A;  3DWL E;  2CW7 A;  4EM0 B;  1WJB A;  2DMT A;  3QPL A;  1GLN A;  1Z9C A;  2P6T A;  3GO5 A;  2LYC A;  5AON A;  2JZY A;  4M3F A;  1BOA A;  4PJL A;  1YJ9 I;  1O3S A;  2AXL A;  5KNL A;  4BAC A;  5IYD J;  1OCR H;  2ZKZ A;  2L01 A;  2EZH A;  3RQ4 A;  3M4O J;  1K78 B;  2Y30 A;  2LRE A;  1ETK A;  1SC7 A;  2H1L A;  4ANJ A;  4XBF A;  5JI6 A;  1BJZ A;  2KL4 A;  3BZK A;  3I4P A;  3GCM A;  4A3I J;  1QA6 A;  3I59 B;  2E1C A;  3GTQ J;  4LLG F;  2BV6 A;  4IO9 F;  5L3C A;  2O0Y A;  4JX6 A;  3JTG A;  2JMW A;  4A3G J;  2MBF A;  5E3L A;  2HFH A;  4F92 B;  1T56 A;  1TNT A;  3GYH X;  3KEY A;  3LSM A;  4EQQ A;  5CKT A;  2HYF A;  4BQO A;  4S04 A;  4CXF A;  4XOR A;  2X9D A;  3A2K A;  3F6V A;  5CVV A;  2EBI A;  3ZQC A;  1YLF A;  2WAE A;  5EYR A;  4E7J A;  2VKV A;  5HLT A;  1OFC X;  3SDG A;  2JWT A;  1JKO C;  3DLL F;  2FNA A;  4W97 A;  3J7A Y;  2X51 A;  4CCO A;  1KGS A;  1IW7 F;  3HRM A;  4I6Z A;  2BE5 F;  2XKO A;  3ZMS A;  1REP C;  3V8J A;  4HBL A;  3EQL F;  3WTS C;  1KQ9 A;  4N4O B;  1IN6 A;  3CC4 I;  3D1N I;  2MG4 A;  4II3 A;  2W00 A;  4TV7 A;  3UNG C;  4ZTF A;  3WTV C;  2NVX J;  2F6C A;  2W48 A;  3GF2 A;  1MMD A;  2FJ1 A;  5ICC A;  1MND A;  2VOD A;  3ASN H;  4LOC A;  3W3C A;  3QPS A;  5K7F A;  1ZK8 A;  3TW7 A;  3A4C A;  1ZG5 A;  3OOU A;  4BE2 A;  3ZXS A;  1U0J A;  2F48 A;  2JSC A;  3AG2 H;  1VQ8 I;  1IAW A;  1B6A A;  3DF8 A;  1MGT A;  2L9N A;  4ZDP A;  5C4J J;  3TDU C;  1K78 A;  4GYG A;  1AKH A;  1FOK A;  2MH2 A;  1ON2 A;  5FKL A;  3TO7 A;  2X85 A;  3TOB A;  5FRO A;  4I0B A;  5J1R A;  2FSW A;  2QUF A;  3IWF A;  3AAF A;  2M30 A;  3QP6 A;  1G59 A;  3CJT B;  1K6O A;  2YX7 A;  3HKZ N;  1VQ7 I;  4XK4 A;  2I10 A;  4AYB A;  4BQN A;  4AM3 A;  2AO9 A;  1GVJ A;  3EUH C;  3IRQ A;  4UVB A;  2R92 J;  2V6E A;  3CJR B;  3IAS 2;  2A07 F;  4FHT A;  1R49 A;  2JTV A;  1IN7 A;  4AWX B;  4IX7 A;  5FD6 A;  3BR0 A;  2ICW G;  1FSH A;  2QM3 A;  3I4N J;  4KN7 X;  2KZV A;  1HKS A;  2HOA A;  1K7A A;  2DMN A;  1IZ1 A;  1LEA A;  3FK7 A;  1B9M A;  1NTC A;  5D8L B;  3BG7 A;  1I3Q J;  5E3O A;  5KVR A;  4U87 A;  4QLC U;  1V3F A;  5J8C A;  2L02 A;  2HDC A;  1TT0 A;  4NUB A;  5CVU A;  1WSU A;  4A3J J;  4LLL A;  4EMS A;  1D5V A;  5D6E A;  4UV8 A;  2WY7 Q;  2CJJ A;  1HKQ A;  3OYI A;  3B02 A;  2VQC A;  1P92 A;  1WH7 A;  1D3Y A;  5LGT A;  1EA3 A;  4RA2 A;  1R5I D;  3QYE A;  4I99 C;  1E2X A;  5CLS A;  1X3U A;  4JX5 A;  2H6B A;  3T5X A;  2HXO A;  5F0F A;  2WWY A;  2V9P A;  4LG0 B;  3MZH A;  2Q1Z B;  1DQU A;  1STZ A;  3OR2 C;  3PQJ A;  5HLH A;  4UUS B;  1ETY A;  1W7P A;  2P0W A;  2Y0M A;  1KQ0 A;  5EEG A;  3HOZ J;  2QZ8 A;  1QVU A;  2DFF A;  1U3E M;  2VKE A;  3EUA A;  2E5N A;  4PJN A;  3S2H J;  1B9N A;  4YIF A;  1ETX A;  4AID A;  2L0K A;  2Y9Y A;  3OS1 A;  3S17 J;  2DI3 A;  2HEO A;  3K1M A;  4C2U A;  4YIR X;  2UWM A;  3QYB A;  5EEA A;  2JA2 A;  3BLY A;  2LK2 A;  1DP7 P;  2BZT A;  1O7L A;  3BPV A;  3AL0 C;  1I50 J;  1UHW A;  3KE2 A;  2K85 A;  1IN8 A;  4BJ5 C;  1Z1D A;  3BTC A;  1YRN A;  2VJ4 A;  3PNT A;  4CCN A;  1XCV A;  3IV5 A;  3BR5 A;  2NOG A;  5M3M J;  3OYC A;  2OF7 A;  2V1N A;  4EJU A;  3KIO A;  5CPR B;  1AA7 A;  4HF2 A;  1I1S A;  4IRG A;  1HXD A;  3WTX C;  2R7W A;  4IHY A;  2XSJ C;  5IOY A;  4AC0 A;  2OQR A;  3M9A A;  2VKD A;  3J7Y J;  3HOW J;  3K4B A;  2X6X A;  1LJ9 A;  1BC8 C;  1RZ4 A;  4KT6 A;  5TIS C;  2R7T A;  4HEA 2;  3WTU C;  3QOE A;  3WU2 C;  3V4G A;  4BNC A;  2OZU A;  4N9I A;  2QQ8 A;  4EJV A;  2X4H A;  2LBF B;  5GPA A;  1QZY A;  4CYD A;  1W4M A;  1UG2 A;  4II2 A;  2YSR A;  2LKX A;  3I3L A;  3WTZ A;  2DFH A;  2FNP A;  4MQV A;  3HDD A;  4L18 B;  3QPH A;  2QBY B;  4RM2 A;  2FUG 2;  1WRJ A;  4HOB A;  2W24 A;  4M6V A;  2F5V A;  3OYJ A;  4B4C A;  1VQK I;  3H5R A;  3ELK A;  1ETQ A;  4KIB A;  3PQK A;  3D5S C;  1QHG A;  4BHP A;  4MTD A;  2V1X A;  4P9F A;  4HQE A;  2LRD A;  2AHQ A;  2EPF A;  1ZRD A;  1U5T C;  4UB8 C;  3WU0 A;  4XKV A;  4ESB A;  3DBH B;  1WQ2 A;  4EVI A;  1WVR A;  4G6Q A;  4HDV A;  3V7C A;  5JHF A;  3DCF A;  4S0H B;  5FLX K;  3OSG A;  4XSZ F;  4ZYA A;  4RB3 C;  3H0D A;  4GGG A;  3OY9 A;  2MC4 A;  2CFX A;  4GXO A;  4Y17 A;  2JSP A;  3DEE A;  2A6E F;  2HGC A;  3H3V K;  2QQA A;  2ZXI A;  1JE8 A;  2QCO A;  2M5W A;  2CFO A;  5A2Q Z;  3CCQ I;  2K9L A;  1NG7 A;  4A5M A;  1BC7 C;  1MBJ A;  3K2A A;  1QO0 D;  1Z67 A;  2JRM A;  4KUM A;  3VEP A;  1TW3 A;  5FRM A;  3LA2 A;  1PDN C;  4FQG A;  4PJJ A;  3R61 A;  1E3O C;  5LGU A;  3BY6 A;  2JUC A;  3DPL C;  3OR1 C;  1YYV A;  4FX0 A;  2Z5U A;  1OLT A;  2KIF A;  2QSF X;  1IXC A;  2XIG A;  3DBL B;  5GAD J;  1BW6 A;  3F8C A;  3TDZ C;  3MD2 A;  3L2Q A;  3RZD J;  3AL0 B;  1YS7 A;  4M6X A;  4B3X A;  4HLX A;  5D8K B;  2DQR A;  2ID3 A;  2D2W A;  1LE8 B;  2QQ9 A;  4OIR F;  1P6R A;  4YRV A;  3WOD F;  1TT5 B;  2HOT A;  1G3S A;  2JRT A;  3TP3 A;  1O3T A;  2XAS A;  4O5V A;  1A04 A;  1S8N A;  2EIK H;  2RVC A;  2K9M A;  4CYC A;  3LSG A;  3TW6 A;  2OPT A;  1CF7 A;  1F4K A;  1MH4 A;  3QQA A;  5F64 A;  2MA3 A;  4A3C J;  5FD5 A;  2QEX I;  5JR3 A;  4UUV A;  5KAF C;  2E1N A;  3GTO J;  2KIQ A;  3HPH A;  4HRI A;  4BHB A;  2NS0 A;  3CUO A;  3SEQ A;  1J2X A;  1YE9 A;  4LLN A;  2YS9 A;  3VOD A;  2VC0 A;  2VBW A;  2PQ8 A;  2VKH A;  4BAY A;  3JRE A;  2LD5 A;  3HBL A;  2W57 A;  4A3F J;  2IT0 A;  2W25 A;  2L4M A;  2QF7 A;  3RSN A;  1SFO J;  3T8T A;  1A36 A;  2E7X A;  5JLW A;  5D5U B;  4BQA A;  1Q1H A;  1AU7 A;  4MNU A;  5IT9 K;  2BHY A;  4KT5 C;  1W1W E;  1UHS A;  3ZQI A;  2GM4 A;  2VB6 A;  1WCM J;  1Q1V A;  2O8X A;  2VQH A;  1OYY A;  2ELJ A;  1XSD A;  2XF6 A;  2FXA A;  1O4X A;  1ZRE A;  3BPX A;  1UB9 A;  1HSJ A;  1X3Z B;  2BY0 A;  1WHU A;  2EIL H;  2K02 A;  2L54 A;  2L9V A;  5GP9 A;  3AG3 H;  3HOT A;  1U5T A;  1BI2 A;  2IGK A;  4ZTJ A;  1S5L C;  1ZGJ A;  3DP7 A;  2MLG A;  3QAH A;  5FFZ A;  1KQ8 A;  1XGM A;  2BGC A;  1OR7 A;  4AYB N;  2YPR A;  2LSO A;  5LBQ A;  5E8I A;  2XGC A;  3JAM K;  1DPU A;  1P9Q C;  4C3H J;  4HW0 A;  1ACI A;  3C1D A;  5E8G A;  1QPM A;  3ZOB A;  1JKQ C;  2VQL A;  3HB9 A;  3CF2 A;  4ZYE A;  1WJF A;  2FU4 A;  2K40 A;  2W84 A;  1IG7 A;  1TZL A;  1R22 A;  3L1P A;  1GV2 A;  3O8G A;  3WG7 H;  5EDN A;  4XR6 A;  1A6Q A;  3LQQ A;  2O8K A;  4HLY A;  2CSO A;  3E0J B;  3ULQ B;  2OQG A;  1XGS A;  2KLO A;  1OCZ H;  3DKW A;  2CUZ A;  3G6E I;  2X6W A;  1XDU A;  1D1A A;  3M1E A;  2MD0 A;  4D7M A;  3VPR A;  5EEH A;  4ABZ A;  3RQI A;  2QKM B;  3UKG A;  1UCR A;  1TWH J;  1S7A A;  4F52 A;  5F0H A;  2L9R A;  2FX0 A;  2RQP A;  2PMZ A;  4G94 A;  3CC2 I;  2BBY A;  2CMP A;  2GIV A;  3OIP A;  4WWC A;  3I55 I;  4IQ4 A;  2P7V B;  1J59 A;  2RDP A;  1LPQ A;  1IUY A;  1RKT A;  1KON A;  5CYV A;  2VON A;  3JSO A;  3HUG A;  3HJE A;  1WJC A;  2DYR H;  4RB2 C;  4Q4Z F;  3K0L A;  2X1C A;  2A61 A;  5KK1 A;  1IV8 A;  1LE8 A;  2R5Z B;  3ZQG A;  5L3E A;  4RGU A;  5B3S H;  5C3E J;  2P8T A;  4KIC A;  4I7H A;  5LHI A;  2E2I J;  3QU3 A;  3I54 A;  4IHX A;  3HOX J;  1S9H A;  4G6T B;  3RPU A;  1V55 H;  4E7K A;  3MCZ A;  3OSF A;  1S72 I;  4PDK A;  2F2E A;  2R7F A;  3FXO A;  2AQF A;  3MEX A;  2QWW A;  1R1V A;  1YRN B;  1YJW I;  3ZN1 A;  3KZI C;  5BMZ A;  3HSF A;  1MSE C;  3GTM J;  4IHW A;  1VQL I;  1TBX A;  1JUM A;  4L5I A;  3A01 A;  2ZSI B;  5FFX A;  3HEF A;  3OYH A;  1Z21 A;  1GHC A;  4XLF A;  5IT9 Z;  2O7O A;  4BKX A;  4ZDL A;  2NNN A;  1XMK A;  1GXP A;  3FM3 A;  3KYD B;  3SFZ A;  3GLL A;  3LA3 A;  2JVH A;  4B43 A;  4EGZ A;  4D7N A;  4A0X A;  4RMN A;  4HV6 A;  3PO3 J;  2HTJ A;  3LSR A;  1O3R A;  1IC8 A;  3ECO A;  1HF0 A;  3TP0 A;  2STT A;  5E20 A;  3GTP J;  1WJA A;  2BXZ A;  2X48 A;  2I5U A;  1JT6 A;  3CCR I;  3H0G J;  3REO A;  4B48 A;  3L7W A;  1MJB A;  2JPC A;  4OMZ A;  3LMM A;  3HTU A;  1Z0X A;  3CZ6 A;  3PUB A;  1H89 C;  4HX8 A;  4HX4 A;  3NWS A;  2E35 A;  3KEO A;  4UUT A;  1BBY A;  3EYY A;  1TWA J;  3BJ6 A;  4QTR A;  1TW2 A;  5BQT A;  1UEL B;  2CU7 A;  5JVG F;  2XSD C;  1S3J A;  2BW3 A;  2H6C A;  2HU9 A;  4OWR B;  5ERI A;  3A0B C;  2UXX A;  3ABL H;  2DFI A;  2LMD A;  4XID A;  1F9N A;  2ELK A;  1FYL A;  2YR2 A;  3OWT A;  4BXF A;  5HS7 A;  1EV7 A;  2EV6 A;  1LUJ B;  2QYO A;  2BXY A;  2XB5 A;  4Y33 A;  4KFC A;  4EJT A;  3S2D J;  3GBG A;  2K9Q A;  3FMR A;  1MBE A;  4KA4 A;  1P2F A;  3K70 C;  5B66 C;  1C0W A;  4RAG A;  2PEX A;  3OS0 A;  1FIA A;  4ITV A;  5HOD A;  2ACJ A;  3ISP A;  4M9Z A;  3CDH A;  4XN0 A;  1X1C A;  1D0Z A;  3BOQ A;  2M3A A;  3HSE A;  2IRF G;  2B0L A;  2MSY A;  4YFX F;  2H09 A;  4CO8 A;  3DKX A;  1MSF C;  3ZCO A;  2KDZ A;  3LAJ A;  2Y69 H;  2IGM A;  2ZFW A;  2GOX B;  3M8F A;  1BA5 A;  5EGO A;  4V2G A;  2OV7 A;  4EV0 A;  5HNH A;  2O6G E;  4IEJ A;  5JFR A;  3B6C A;  1DP3 A;  1M1E B;  2NS8 A;  3ZMZ A;  2HVQ A;  3H3U A;  2R7R A;  4C3I J;  1XX5 A;  3GZ5 A;  3H1C A;  2F4I A;  3TL4 X;  1FOY A;  2DYS H;  2CQK A;  3IH2 A;  4ZYG A;  4Z2Y A;  3VYS B;  2Z1D A;  4XQF A;  3LNQ A;  2K86 A;  2R7Q A;  3F8N A;  4R1H A;  5HDK A;  3C2B A;  1ZLJ A;  1WJ5 A;  2IA2 A;  4LG0 A;  4UY8 I;  4D5F A;  3E5U A;  2DTR A;  4DZP A;  4FX4 A;  4CGZ A;  3CP2 A;  3BG5 A;  3GUD A;  1FBU A;  1XN7 A;  4J00 A;  3PJR A;  1T98 A;  5K1Y A;  4CH7 A;  3JTH A;  2XAQ A;  3IL2 A;  4BJT A;  2QLZ A;  1MJA A;  2DLL A;  1HA8 A;  2QSH X;  1H88 C;  1D1C A;  2DA7 A;  4J01 A;  4KIT B;  1QBJ A;  2C6Y A;  4YEJ A;  3DEW A;  5DDG A;  2VAS A;  3HYI A;  2Z9O A;  3P9I A;  4OIP F;  4E7L A;  1YTY A;  5FKO A;  2B63 J;  3S15 J;  2V9K A;  1NH3 A;  4KIS A;  2DQL A;  2KIU A;  4AVP A;  3CDL A;  3L2U A;  2M9H A;  2RQQ A;  3K4K A;  2VUM J;  5E1Z B;  4F55 A;  2DT7 B;  4XSX F;  2XKP A;  3JR9 A;  4Q5S F;  4XRM A;  4G7H F;  3T8R A;  4Y7N J;  3EYI A;  3PSF A;  4IOC F;  5M5X J;  4NDL A;  1X2N A;  5LGN A;  2MGQ A;  3MVP A;  4DQ2 A;  4LGW A;  1UST A;  2B9S A;  4S05 A;  3ECH A;  2DOA A;  2ZME A;  5EG0 A;  2MLK A;  1G3Y A;  3FXQ A;  2R4G A;  4RGR A;  2NRA C;  4KNY A;  1S7O A;  3NWT A;  3JRA A;  4A3K J;  1B72 A;  1I1G A;  2V79 A;  3C2H A;  4A3L J;  2JT1 A;  2IXS A;  3FBN B;  3HG9 A;  3WTY C;  1VQM I;  4XM3 A;  2L7F P;  1FMW A;  1RC9 A;  2ISY A;  2KZG A;  3D5R C;  3CLO A;  3H35 A;  1ZRF A;  3CCJ I;  5IYC J;  1LQ1 A;  4WX9 A;  1OCC H;  2UXN A;  1FPQ A;  1IRF A;  5A2Q K;  5LFA A;  4OU0 A;  3K4J A;  1X2M A;  1U6G A;  1SD5 A;  4RAZ A;  2O5R A;  1OQY A;  1MZB A;  3KPH A;  1SVM A;  5TJJ A;  3VSL A;  1A31 A;  4MTE A;  4Y52 J;  1DU6 A;  3OIO A;  4LK1 F;  1U2W A;  1YJN I;  1RIO H;  4O3M A;  4IRH A;  2HPM A;  1BOB A;  2ZB9 A;  3SZG A;  4ESJ A;  3BG3 A;  2WY8 Q;  1NG6 A;  4LG3 A;  2V1U A;  4EGY A;  2KRF A;  4CSW A;  1UJ8 A;  3R60 A;  2Y2Z A;  3N05 A;  2LLK A;  2LVS A; 
#chains in the Genus database with same CATH homology
 1ETQ A;  3HOV J;  3HGG A;  5DTD A;  2AHQ A;  2DMP A;  2WB1 N;  1MBH A;  1U9O A;  2DMU A;  2JJ7 A;  4M3E A;  5J1Y A;  2MW8 A;  1IJW C;  1ZKG A;  4BY1 J;  5IP9 J;  1XS9 A;  3E7L A;  1GUU A;  4C2M J;  3DCF A;  2COB A;  4MO7 A;  4S0H B;  3RZO J;  1TWC J;  1OCT C;  3OSG A;  2FD5 A;  3LOC A;  2JA5 J;  1IDZ A;  3GTG J;  3MKL A;  5EZH A;  2DA3 A;  2ECC A;  3H3V K;  2DMQ A;  3ZQL A;  2DA1 A;  2QCO A;  2K9S A;  2R5Z A;  3BG9 A;  5F04 A;  1F36 A;  1MBJ A;  3K2A A;  1ZR4 A;  3A01 B;  1ZR2 A;  1JKR C;  5IP7 J;  3RKQ A;  2M2E A;  4DYR A;  1HCR A;  1E3O C;  4DYC A;  3PM1 A;  3BR1 A;  3G1O A;  1SAN A;  2LR8 A;  4GFB A;  1JJ8 C;  4IHV A;  1BW6 A;  3Q0U A;  3S1R J;  3FK6 A;  2KT0 A;  4B1R A;  1FJL A;  1JTX A;  1A5J A;  3S1M J;  3RZD J;  4BBS J;  4UUS A;  5JLX A;  2ID3 A;  4M3D A;  1LE8 B;  1BL0 A;  2CUF A;  2HOT A;  4FCY A;  4J19 A;  2XPW A;  3TP3 A;  1RR7 A;  2CUE A;  3M3Y J;  3HGY A;  3HOY J;  3S1N J;  2HI3 A;  1R9T J;  4CYC A;  4XIC A;  3LSG A;  4XRS A;  2JA8 J;  2M34 A;  1GV5 A;  3TW6 A;  2OPT A;  1MH4 A;  3QQA A;  3S16 J;  2GLO A;  3TED A;  4A3C J;  1FIP A;  2NVY J;  1XG1 A;  3GTO J;  1TWG J;  4FTH A;  2YS9 A;  4HNV A;  3HOU J;  1PUF B;  3JRC A;  2DN0 A;  3JRE A;  2LD5 A;  2DA4 A;  2TCT A;  5K7H A;  4DYQ A;  4FE4 A;  3HBL A;  4A3F J;  2M8G X;  3BR2 A;  2QF7 A;  1SFO J;  3GTK J;  2HQ5 A;  5JLW A;  2Y9Z A;  4M3G A;  1WPK A;  1WGX A;  1WI3 A;  1AU7 A;  4X1E A;  3S1Q J;  9ANT A;  2WAQ N;  5EF6 A;  3JRH A;  1UHS A;  3ZQI A;  2Y31 A;  2GM4 A;  4JX4 A;  1RPW A;  1WCM J;  1Q1V A;  3LSP A;  5F27 A;  2P81 A;  1O4X A;  5F08 A;  5GP9 A;  4A3B J;  4JP0 A;  3CMY A;  4FE7 A;  2HOS A;  2L7M P;  1JUS A;  2DA2 A;  4AYB N;  1VF9 A;  3S14 J;  2XGC A;  1A6I A;  4C3H J;  3BTI A;  3ZOB A;  1JKQ C;  4A3E J;  3HB9 A;  1W0T A;  3IH4 A;  1FTZ A;  1WH5 A;  5C4X J;  3HM5 A;  1NK2 P;  2K40 A;  2GBY A;  3JRB A;  1QPI A;  1EF4 A;  3CQZ J;  1IG7 A;  3L1P A;  1GV2 A;  3O8G A;  3PO2 J;  5EDN A;  2R5Y A;  3BR3 A;  2H8R A;  1I6H J;  5F1J A;  1QRY A;  2O8K A;  5IOZ A;  2E19 A;  2XRL A;  2G0E A;  5J1U A;  4L5E A;  4QSH A;  2YU9 J;  5M5Y J;  2EH3 A;  1ETW A;  2ECB A;  3NAR A;  1ZQ3 P;  1PUF A;  2JK3 A;  4D7M A;  1XC5 A;  3VPR A;  2TRT A;  1MNM C;  4ABZ A;  3RQI A;  3G1M A;  3UKG A;  1TWH J;  2EZK A;  1JGG A;  2IAI A;  5F0H A;  2L9R A;  2LTP A;  3ZQF A;  2FX0 A;  2NVQ J;  4W1U A;  3WHC A;  1OJL A;  1GT0 C;  1TWF J;  1IGN A;  3GTL J;  1HDD C;  3SFI A;  1Y1W J;  1HOM A;  2HXI A;  5IP6 A;  1RKT A;  1G2H A;  1IV6 A;  3FKI J;  2E2H J;  2LFB A;  5EGO B;  1JKP C;  1ITY A;  4JYK A;  1MH3 A;  2NVT J;  2DA6 A;  3JRF A;  2JA7 J;  1LE8 A;  2R5Z B;  3ZQG A;  5C3E J;  2DMT A;  3QPL A;  2E2I J;  3BQZ A;  2XPU A;  4M3F A;  1VND A;  4IHX A;  5C44 J;  1AHD P;  3HOX J;  1B8I A;  5GPC A;  3OSF A;  5IYD J;  1AKH B;  2ID6 A;  2EZH A;  2XGE A;  3M4O J;  1MBK A;  2Y30 A;  5F0C A;  1YRN B;  4V2F A;  2EZL A;  1MSE C;  2R93 J;  1ETK A;  1MBG A;  2CQX A;  2M0C A;  2Y0S N;  4FIS A;  3GTM J;  4IHW A;  1APL C;  2D5V A;  1JUM A;  1BJZ A;  4DW6 A;  3A01 A;  1RET A;  4A3I J;  3HEF A;  5FKK A;  3FIW A;  1ORK A;  3GTQ J;  1VFC A;  3MN2 A;  2O7O A;  4JX6 A;  1FEX A;  4BKX A;  2JMW A;  4A3G J;  2K9N A;  2ME0 A;  5FKM A;  4DZJ A;  5E3L A;  1OCP A;  5FJ8 J;  1T56 A;  4A69 C;  1UMQ A;  4D7N A;  4X6A J;  3PO3 J;  3LSR A;  1QVT A;  1IC8 A;  1VI0 A;  2PMZ N;  2X9D A;  2VPR A;  2EBI A;  3Q0V A;  3ZQC A;  2XPV A;  5EYR A;  1HF0 A;  2VKV A;  3TP0 A;  3I4M J;  1OFC X;  3SDG A;  2JWT A;  1JKO C;  3GTP J;  1ZGW A;  4W97 A;  1T33 A;  1X58 A;  2X48 A;  3Q0W A;  1JT6 A;  3H0G J;  1ETO A;  2R7Z J;  4I6Z A;  3BR6 A;  1Z0X A;  1H89 C;  4UUT A;  5E3M A;  3D1N I;  1TWA J;  4QTR A;  2MG4 A;  2CU7 A;  2CRG A;  2ME6 A;  2XSD C;  1B72 B;  1IUF A;  3SJM A;  3F0C A;  4XID A;  2W48 A;  3FIS A;  1NK3 P;  2NVX J;  2ELK A;  2FJ1 A;  3A02 A;  3NAU A;  4CYC B;  4LOC A;  4EEF G;  2DTZ A;  3QPS A;  1ZK8 A;  3TW7 A;  5K7F A;  5M5W J;  1U8B A;  2H1K A;  1FTT A;  3OOU A;  2XB5 A;  3S2D J;  3GBG A;  4BXX J;  2K9Q A;  1ENH A;  2VI6 A;  1MBE A;  5C4J J;  3JRD A;  1RKW A;  1AKH A;  3IH3 A;  5FKL A;  1FIA A;  1JUP A;  5HOD A;  1JT0 A;  5IYB J;  5J1R A;  1Y1V J;  4MLO A;  3BTJ A;  2MSY A;  2EQR A;  3O8H A;  1MSF C;  3HKZ N;  2KDZ A;  4XK4 A;  2I10 A;  2AO9 A;  2R92 J;  4B4C A;  1POG A;  5K7Z A;  1BA5 A;  5EGO A;  4V2G A;  2IEK A;  3K7A J;  2HYJ A;  4BY7 J;  2HDD A;  2L7Z A;  3BR0 A;  4IEJ A;  2R0Q C;  3B6C A;  5DS9 A;  3JRI A;  3I4N J;  2NS8 A;  1P7I A;  2EZI A;  3BT9 A;  2HOA A;  2YUS A;  4C3I J;  2DMN A;  3IH2 A;  3FK7 A;  3B6A A;  3LSJ A;  1NTC A;  5FLM J;  5E3O A;  1I3Q J;  3LNQ A;  5IPA A;  3W6V A;  3C2B A;  4XRS G;  1P7J A;  4A3J J;  4D5F A;  2RAE A;  3CCY A;  1W0U A;  4DZP A;  2CJJ A;  3BG5 A;  1H8A C;  1JJ6 C;  2WV1 A;  2NS7 A;  2CQQ A;  2IBD A;  1WH7 A;  4A3M J;  3BTL A;  2JA6 J;  4MFD A;  1LFU P;  1H88 C;  2DA7 A;  1LFB A;  4JX5 A;  2HXO A;  3DEW A;  5F0F A;  1K61 A;  1S7E A;  4BBR J;  3JRG A;  3GTJ J;  4UUS B;  1ETY A;  3ZQH A;  4RDU A;  3HOZ J;  5FKO A;  4RBO A;  1QVU A;  2VKE A;  2B63 J;  1HLV A;  3S15 J;  4B3A A;  1ZTR A;  4A3D J;  3S2H J;  2R5Y B;  1D5Y A;  1ETX A;  5EG0 B;  3CDL A;  2L0K A;  2M9H A;  2Y9Y A;  2VUM J;  3BQY A;  2LLK A;  3S17 J;  3JR9 A;  2DA5 A;  2XB0 X;  4XRM A;  4Y7N J;  1RES A;  1GDT A;  4D5C A;  5EEA A;  2LK2 A;  5M5X J;  4NDL A;  5EZG A;  1I50 J;  1X2N A;  2N8G A;  5J3L A;  2MGQ A;  3MVP A;  4M3B A;  5FKN A;  1IRZ A;  4QIW N;  3BTC A;  1DU0 A;  1YRN A;  2JN6 A;  5EG0 A;  1GVD A;  5FLV A;  1F43 A;  3IV5 A;  3BR5 A;  2NOG A;  3WHB A;  5M3M J;  2OF7 A;  1ETV A;  3JRA A;  4A3K J;  1B8I B;  1B72 A;  4A3L J;  5BNG A;  1Z77 A;  2DJN A;  2E1O A;  2L7F P;  2LY9 A;  1MBF A;  4IHY A;  5IOY A;  4C3J J;  4AC0 A;  4MIM A;  5M3F J;  3Q3S A;  4MFE A;  1CQT A;  5IYC J;  3HOW J;  2XGD A;  2LP0 A;  4A93 J;  1X2M A;  2X6O A;  4G12 A;  5GPA A;  5E3N A;  4Y52 J;  1DU6 A;  3OIO A;  1UG2 A;  2E2J J;  4AUX A;  1BW5 A;  1U78 A;  1K83 J;  1U9N A;  2FQ4 A;  2LKX A;  1HDP A;  2ZB9 A;  3BG3 A;  4I76 A;  1JTY A;  3HDD A;  2O9L A;  1IDY A;  3A03 A;  4M6V A;  1TC3 C;  2Y2Z A;  3G1L A;  2LVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...