2R5YA

Structure of scr/exd complex bound to a consensus hox-exd site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
73
Chain Sequence
GKKNPPQIYPWMKRVQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DTP*DGP*DAP*DTP*DTP*DTP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 22
structure length 73
sequence length 88
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5yA00
3M3YJ 1H88C 5IOZA 4J19A 2M8GX 4RBOA 4D5FA 5EF6A 2O7OA 1JKQC 1X2MA 5FKKA 1IG7A 1RETA 2JK3A 3MKLA 3HGGA 5FJ8J 2R92J 1IDZA 2HOTA 5FKMA 4XRMA 2XB0X 2HOAA 1Q1VA 1IRZA 4L5EA 5C44J 3JRDA 3QPLA 3ZOBA 1MBFA 1BJZA 4B1RA 5E3LA 3O8HA 4A3KJ 1ZTRA 1X2NA 1HLVA 1AKHB 1DU0A 1LE8B 2K9QA 3HGYA 3I4NJ 1E3OC 3A02A 3BTLA 2X9DA 2XRLA 4DYRA 5EYRA 1TWAJ 3HM5A 3S14J 3LNQA 4XRSA 2EQRA 1WGXA 1PUFB 3FK7A 3JR9A 4B4CA 3BG9A 2CQQA 1P7JA 1MH4A 4BBRJ 1IDYA 2IEKA 4M3DA 2X6OA 4AUXA 3ZQCA 1MSEC 1ENHA 4XK4A 1WCMJ 5E3NA 2R5ZA 2NS8A 4I76A 4MIMA 3IH4A 2LLKA 2W48A 4DW6A 3FKIJ 2X48A 5J1UA 5F0HA 5GPCA 2DA4A 1ORKA 2OF7A 1HDDC 4A3LJ 5F04A 3S16J 4X6AJ 2N8GA 1TC3C 4BY1J 4DYCA 2H8RA 3BTJA 3BG3A 3PM1A 1GDTA 1POGA 4MO7A 3CCYA 4MFDA 2I10A 1G2HA 1OJLA 4FTHA 5EGOB 4XRSG 4X1EA 2L7MP 5IP9J 4A69C 4W97A 2LFBA 4BXXJ 2DMPA 2DA1A 1JGGA 2IAIA 3GTGJ 3JRGA 5EZGA 1GT0C 3GTQJ 3FIWA 2HDDA 1MBGA 1NTCA 2JWTA 2KT0A 1JUSA 2JA7J 3S15J 3GTLJ 4FE4A 1Y1VJ 3TW6A 4A93J 5EEAA 3G1MA 2M34A 1IUFA 2ID6A 2RAEA 3Q0WA 4BY7J 1D5YA 1ZR4A 4NDLA 4A3JJ 1CQTA 3NARA 4I6ZA 3RZOJ 1HCRA 1W0TA 2CRGA 4C2MJ 1RPWA 1MNMC 1BA5A 5K7FA 3BTCA 5IP6A 2DA6A 1NK3P 4A3CJ 3ZQLA 2H1KA 3UKGA 5FLVA 3PO2J 5GP9A 2MG4A 3JRAA 1VI0A 1IV6A 2Y30A 4JP0A 3IH3A 2E2JJ 2ZB9A 4QTRA 3HKZN 2LKXA 4FISA 1I3QJ 1FTZA 5IYDJ 3HOVJ 2ME0A 1JJ8C 1FJLA 5F27A 3BQZA 1R9TJ 1WH7A 3NAUA 1ZGWA 2WV1A 5BNGA 1W0UA 1MBEA 4BKXA 2DMQA 4V2FA 2DA5A 2MGQA 2AHQA 2Y9YA 1RKTA 4Y7NJ 4M3EA 3BR0A 2DN0A 1JJ6C 1WI3A 1YRNB 1JKPC 4IHVA 5C3EJ 2Y2ZA 4A3BJ 2NVTJ 3A01B 1F36A 5E3MA 1JUMA 1X58A 1Z77A 2XB5A 2ECBA 2XPWA 3E7LA 3TEDA 4A3DJ 1XS9A 1FTTA 2CUEA 1JUPA 3JRFA 4M6VA 2HXIA 4DYQA 3LSRA 3HOYJ 5J3LA 2VKEA 2VPRA 5IP7J 2B63J 2VKVA 3D1NI 1IC8A 3S2HJ 3MVPA 5EDNA 4JX5A 2K40A 5M3FJ 1I6HJ 1B8IB 3GTOJ 1AU7A 2D5VA 5M5YJ 1U9NA 2M2EA 5EGOA 1BW5A 1H89C 3F0CA 4FCYA 3S17J 4XIDA 1B72A 2AO9A 1JKRC 1UG2A 2DA3A 1U78A 3S2DJ 2JMWA 2QCOA 5F0CA 3JRHA 2ME6A 2NVQJ 3LSGA 5J1RA 2DMUA 1ZK8A 3W6VA 1JTXA 3ZQGA 4CYCA 4UUTA 2EZLA 3K2AA 3IH2A 4JYKA 1GVDA 1UHSA 2R5YB 3G1OA 3Q3SA 3S1NJ 1EF4A 2CUFA 3I4MJ 2VI6A 1WPKA 1BL0A 2R7ZJ 2XPVA 3BR5A 4A3IJ 2JA8J 4C3JJ 5EG0A 1MBJA 4IHYA 3HBLA 9ANTA 5F0FA 2TCTA 3S1MJ 4MLOA 3L1PA 4EEFG 1F43A 2COBA 2JA6J 5F08A 4C3HJ 4AC0A 1A6IA 3SDGA 1VFCA 2O8KA 3ZQIA 2XSDC 2ID3A 2Y31A 4M3GA 2HXOA 2FD5A 1NK2P 2EZKA 2G0EA 1LFBA 5C4JJ 5EZHA 3VPRA 1I50J 3TW7A 2LVSA 1LFUP 2L9RA 2WB1N 1QPIA 4B3AA 2NVYJ 1AKHA 3A01A 1T56A 2M0CA 1UMQA 2L7FP 2R5ZB 1GV2A 3M4OJ 1RR7A 1ZR2A 2HI3A 5HODA 3LSJA 2YU9J 4S0HB 1LE8A 4IHWA 1FIPA 2E1OA 2E2IJ 4GFBA 2M9HA 5J1YA 4A3FJ 1U9OA 1MSFC 2JA5J 3RZDJ 1TWGJ 3BR1A 5IYCJ 3HEFA 3S1RJ 3HDDA 4A3GJ 4UUSB 4QIWN 4DZJA 2LR8A 3CDLA 3OIOA 1A5JA 5JLWA 1WH5A 1ETYA 4JX6A 3OSGA 4V2GA 5IPAA 3HOXJ 1VF9A 2NOGA 3BT9A 3CMYA 1TWHJ 1PUFA 1QRYA 1B8IA 2CJJA 3OSFA 1OCPA 4AYBN 2NVXJ 1MBKA 3TP0A 2QF7A 3GTJJ 1VNDA 1JT6A 2GBYA 5M5XJ 1DU6A 5FKOA 1HF0A 3S1QJ 1FIAA 5IOYA 1TWFJ 4M3FA 3ZQHA 3PO3J 1ETKA 3GTKJ 3SJMA 3O8GA 3CQZJ 2JN6A 3GTMJ 2XPUA 4BBSJ 2HYJA 3JRIA 2L7ZA 2P81A 5E3OA 4DZPA 1K61A 2FQ4A 3A03A 3TP3A 3BG5A 2DMTA 2DJNA 2R5YA 2Y0SN 2K9SA 3LOCA 2R93J 1ETXA 2EH3A 1JKOC 1TWCJ 5C4XJ 2Y9ZA 4IEJA 3WHCA 2DMNA 1XG1A 3ZQFA 2CU7A 3BTIA 1RESA 1XC5A 2XGEA 2NS7A 3DCFA 2VUMJ 1JTYA 1ETOA 3FK6A 2DA2A 4Y52J 2YS9A 4D7MA 1ETWA 1HOMA 2DTZA 5F1JA 3JRCA 1JT0A 2GM4A 1RKWA 2ECCA 4JX4A 2R0QC 1AHDP 2IBDA 4IHXA 1HDPA 2JJ7A 3H0GJ 4A3EJ 1GV5A 3G1LA 3Q0UA 1GUUA 4RDUA 1MH3A 1Y1WJ 1ZQ3P 4A3MJ 5IYBJ 1SANA 3C2BA 5DS9A 1SFOJ 1QVUA 4QSHA 3HB9A 5K7ZA 4ABZA 3HOZJ 1BW6A 1Z0XA 3LSPA 5FLMJ 2YUSA 3BQYA 3SFIA 4LOCA 2KDZA 4UUSA 1ETQA 4D5CA 1OCTC 1MBHA 3HOUJ 1U8BA 2O9LA 1OFCX 3BR6A 3BR2A 3K7AJ 2ELKA 3B6AA 2HQ5A 2PMZN 2XGDA 5K7HA 3FISA 2FX0A 5M5WJ 2TRTA 3HOWJ 3QQAA 1B72B 2LK2A 2HOSA 1YRNA 1APLC 1S7EA 2DA7A 4G12A 3MN2A 3GTPJ 1ETVA 1P7IA 5FKNA 3H3VK 4FE7A 5DTDA 4D7NA 2FJ1A 4C3IJ 3RKQA 2EZIA 2EBIA 4CYCB 3JREA 1K83J 3RQIA 2E2HJ 2MW8A 2GLOA 4MFEA 2MSYA 2LD5A 5JLXA 1O4XA 2K9NA 5FKLA 1QVTA 1IJWC 2LY9A 3DEWA 1IGNA 2L0KA 2XGCA 3Q0VA 4W1UA 3WHBA 2LTPA 3GBGA 5GPAA 5M3MJ 1T33A 5EG0B 1H8AC 4HNVA 2LP0A 3B6CA 4XICA 2E19A 1ZKGA 3IV5A 2OPTA 3OOUA 2EZHA 1FEXA 3QPSA 3JRBA 2CQXA 2WAQN 3BR3A 1ITYA 4M3BA
chains in the Genus database with same CATH superfamily
1LVKA 3L09A 1H88C 3PNVA 2M8GX 2M3AA 3F23A 1JHFA 3IUOA 2IVMA 3WODF 1JKQC 2VJIA 3S93A 4HG2A 2Y69H 1TT5B 4CSWA 2JK3A 4L9VA 1DPRA 3FZVA 1E17A 2OZUA 5J4VA 4XRMA 2HOAA 4N9IA 3F9KA 2PX9A 3W2VA 2DJIA 1XGSA 2LBFA 1MBFA 5HS7A 2IW5A 4B1RA 2O3FA 4EM2A 3E6CC 1J5YA 5GADJ 3OR2C 3OYBA 1IRXA 1U5TA 2Z2SB 3KP7A 3ZGKA 1OQYA 3EUHC 1QZYA 3V4GA 3WG7H 2DOEA 3W2AA 2X6WA 4IF4A 1MKMA 2ZJQF 3G4SI 2PLYA 2MBFA 1D3YA 3A02A 5DCFA 4B47A 3AG3H 3CJTB 3DFGA 3HM5A 3TO9A 3LNQA 1B59A 1V5GA 2A5WA 3ZN0A 4GYGA 3D0SA 2KKOA 3FXJA 3ZQQA 1WGXA 3WGIA 2X1DA 3GLXA 4I01A 1D1BA 4B4CA 2EK5A 1NHAA 1O3QA 1BR4A 3DXJF 5IT3A 1IDYA 2FXAA 1TQMA 2EV5A 3D5LA 2DQRA 3KEYA 4M74A 1ZH5A 1FZPB 3MZYA 4E7JA 1FP1D 3KIOA 3BDDA 3CJNA 4N9HA 5E3NA 2MD0A 2NS8A 1G3YA 4I76A 3PFYA 1XSDA 4AWXB 2QZ8A 2LMDA 5F0HA 3OYCA 1PVEA 5GPCA 1LB2A 5D5VB 4A3LJ 4E7SA 4RAFA 4II2A 4LFUA 1TT0A 1Z05A 4ZTFA 2WAQA 3S16J 2FNAA 4MTEA 3NEUA 2CW7A 3F8FA 2N8GA 1TC3C 4DYCA 3W3CA 3BTJA 3C2HA 2CFXA 5KCMA 4MO7A 2JT1A 3ASOH 5E1ZB 4IJAA 5BMZA 2IGKA 3ML6A 2VQHA 5EGOB 1LDJA 5IP9J 5ED4A 4BXXJ 2Y75A 3PQKA 3K2ZA 4XNFA 1JGGA 2I5UA 2Y0SA 2QA4I 3MKYB 1FOKA 3FIWA 1NTCA 2BVLA 2JWTA 2Q8KA 1T2KA 5EEAA 3DPLC 1S7AA 1TNSA 1D5YA 3EUAA 3HPHA 2OA4A 4UVCA 3BPXA 3MFKA 3MZ8A 4ANJA 2A05A 1W0TA 2V9KA 1MNMC 1RPWA 3HHHA 2VBZA 4I0AA 4K2EA 4BQNA 2DA6A 4UV9A 1NK3P 1YFHA 2H1KA 2E5NA 2JPCA 4OMYA 4Y33A 1R5GA 5K5OA 3BCAA 2MG4A 1EV7A 4DQ2A 1UHWA 3EQLF 3VYTB 2PJPA 1UZCA 1ZN2A 1YITI 3A1YA 3PNTA 4JP0A 4CCOA 2E2JJ 2BYVE 2IS2A 3HKZN 1O57A 4CO8A 4CCMA 1KZHA 3HOVJ 3FM5A 5GTIC 1JJ8C 1FJLA 5J47A 1IN6A 3T5XA 1G3SA 1MMGA 2JVGA 4XQFA 5FLXZ 4L0YB 3H3UA 2V1UA 1SAXA 2LSOA 3SXYA 3BLYA 4XORA 1FOYA 2QQ9A 1ZARA 5BNGA 4E7ZA 1TP4A 3HXLA 3P9KA 4U7BA 4BKXA 2MYSA 3DKWA 1ON2A 2KHMA 2MGQA 3ZMUA 4ZJZA 2AHQA 2Y9YA 3C18A 4BGDA 4Y7NJ 1YS6A 2DN0A 1WI3A 2IXSA 5C3EJ 2X6XA 4S05A 2J5PA 1FBQA 1QO0D 2LF7A 2XB5A 3E7LA 2PMZA 5LEJA 1JUPA 2RC4A 1B9MA 2E7XA 3P9IA 2F5DA 3DBRB 4KIFA 4Q4ZF 2C6YA 5HOOA 4MHGA 3BY6A 3KP2A 2WADA 3G71I 3ABMH 2MLGA 2VKDA 2B63J 5LRSA 2VQGA 2WY7Q 3CC4I 2ACJA 3MVPA 4XKVA 4UVAA 5EDNA 4JX5A 4LG0A 1B8IB 1AU7A 2KRFA 2VC1A 5ILVA 5EGOA 4WXHA 1D5VA 3F0CA 2VQCA 4DOZA 1J7KA 4RAGA 4XIDA 5H6RA 2ZXWH 4KYWA 4KMUX 1UG2A 1F5TA 4BJTA 2LF8A 4WXDA 2HYFA 2JMWA 3JRHA 3HSRA 3EETA 3LSGA 4M72A 1WFXA 1OYWA 4P55A 4KDPA 2QSGX 4HAMA 2DI3A 4XRFA 2EFNA 1XB4A 2K3PA 3K2AA 5F64A 4AVPA 4BACA 1D0YA 1BOAA 4EM1A 5D5XB 2XF7A 5HS9A 1EF4A 2HPIA 2CUFA 3I4MJ 2VI6A 1D0ZA 2XPVA 3FXRA 2KIMA 2JA8J 5L3DA 4CXFA 5EG0A 4BXFA 2KZGA 1MBJA 5FGMA 4M73A 2CMPA 2M4KA 2XGXA 2M4GA 4I99C 3FXUA 3IKVA 9ANTA 1K7AA 2P8TA 1BI3A 3L1PA 3K1PA 3MEXA 4NQWA 4XLNF 1R36A 4RS8A 1Y0UA 1S6LA 3SDGA 1VFCA 4PGGA 5EEGA 4R79A 2XSDC 3OL4A 3PSIA 2LY1A 3FXMA 2XSJC 2Y31A 3DEEA 3VYUB 2HXOA 3R0AA 4BJ6C 1X3UA 4CZCA 2F4IA 3FXOA 4EQQA 1Z9CA 2MD5A 4RA2A 1YI2I 3L2VA 2X1CA 4XM3A 1IN5A 3WTUC 2B7EA 3TW7A 2IP2A 2KFDA 2XC7A 2OUMA 1QPIA 2EV6A 4XN3A 2H6BA 2DO7A 2M0CA 2NXNB 1ZR2A 2HI3A 1XGNA 4G6DA 1OKRA 1R7JA 4RLFA 5HODA 1LE8A 5K5RA 1D8JA 2JQ7A 4BDZA 1T39A 3V7CA 2Q2EA 2QKLB 1G3TA 1U9OA 1MSFC 1VQLI 2XASA 2QSHX 2HQAA 2MH9A 2B9SA 4LK0F 1UG0A 3OYHA 3OYMA 4PSXA 4WK8F 4BJ5C 4XKBA 1O3TA 2EPFA 4A0YA 4KISA 1A5JA 2FMLA 2ADUA 1ETYA 4XLFA 3OV8A 3OSGA 2DU9A 4IQJA 1VF9A 4HX4A 2ZBKA 3H5AA 3NRVA 1TW3A 4YFNF 1QRYA 1B8IA 3WTWC 2CJJA 2OCCH 4IRIA 2CQNA 1OCPA 1EJ9A 3V8KA 3LQQA 4AYBN 1O7LA 3VYRB 2W4SA 2JRTA 1VNDA 1RR8C 1P4WA 1DU6A 3AG2H 4I7HA 1HF0A 4L5JA 3CCLI 1IAWA 3MAJA 1U0JA 4RLQA 2O8XA 4F91B 1YX5A 2ZO4A 4RMNA 4ZZLA 1XCBA 3PFIA 5FB2A 3GTKJ 4IRGA 1U5TC 5CQGA 1X3ZB 5AIQA 3OY9A 2E1MB 4BU2A 2LKSA 2HYJA 1GVJA 2L7ZA 5TJJA 2P81A 5E3OA 3F6VA 3WG9A 3K69A 3A03A 2HPMA 5TRDA 4HQMA 2PJRB 2K9SA 2R93J 2EH3A 3F3XA 5C4XJ 3C2GA 4BQOA 2Y9ZA 1LEAA 1BI1A 4U87A 3K9TA 4XLHA 2STTA 3QPHA 2V1XA 3L2RA 3KE2A 1JE8A 4A6DA 3I9V2 3DF8A 2LOOA 2MC3A 1XPXA 1VQNI 2EINH 4UB6C 4PCQA 3ZR8X 2XRNA 3LQRA 2JTVA 3CLQA 3FK6A 4B3XA 2M87A 4Y52J 2P5VA 4YIRX 1HOMA 2RDPA 2JRMA 4A6EA 3NWTA 1W5CC 2R0QC 4IHXA 4BQAA 2JJ7A 3KZYA 1IO2A 4YELA 3BWGA 4XONA 3ISPA 3JCUC 2E1CA 2A3SA 3G1LA 2WY8Q 2QQBA 4A3MJ 1YJ9I 3C2BA 2OJED 4MQVA 5JHFA 1SFOJ 1IV8A 1ZLKA 4HV6A 1L0OC 4QSHA 1O7FA 1Y8RB 3PQJA 4F7ZA 1I1SA 3DV8A 4XL9A 2OTJI 3OIPA 5FLMJ 4AD9A 2KRHA 2QKMB 3SFIA 3IWZA 4PZJA 3O6BB 1W7PD 2KDZA 1ETQA 4YFXF 1OCTC 4G7ZF 3GFLA 4ESJA 2ELKA 2HU9A 4I0BA 2HQ5A 2XF5A 3VOEA 1LPQA 2XGDA 1Z6RA 1UELB 2X85A 4Y13A 2FX0A 4BHBA 4EMSA 3CP8A 3HOWJ 1B72B 2BXZA 3LMMA 2LK2A 3CMMA 4O6JA 1VQ9I 2H27A 1MGTA 1O3RA 4RGRA 5B5EC 1S7EA 2K27A 1ETVA 3SHFA 3MMYB 3TGNA 1HSTA 2IPQX 4ENMA 1MJ9A 3HYIA 1OCRH 4F3QA 4E7HA 2PMHA 4C3IJ 3RKQA 1ERDA 3ZN1A 1XMXA 4GCVA 4LITA 3RQIA 1ZG5A 2MW8A 1S5LC 2FSWA 2KIQA 1WKMA 2GLOA 3V42A 3CMEI 2PQ8A 2K9NA 1MDMB 2LY9A 2L0KA 4WF2A 1VQ7I 4AVZA 1KU9A 3JAMZ 1Z1DA 2LTPA 3K4KA 5GPAA 3RI4A 5M3MJ 4C2UA 3PUBA 4IHSA 2HFHA 1H9GA 2HDCA 2YSRA 4CCNA 1DPUA 2DPUA 2L4AA 1E0EA 2EZHA 5J4YA 1K79A 3F8MA 1BOBA 4C2TA 2R7XA 1WHUA 2E71A 1BN5A 3GW2A 2VJ4A 2EB7A 4J19A 1BC8C 2YPRA 1Z7UA 2W57A 3HUGB 1X2MA 3M8EA 4PFOA 2BY0A 2RVCA 4BH9A 3DPUA 3H35A 3WGHA 1IDZA 2HOTA 2BGCA 1E3HA 1K6YA 1SVMA 1Q1VA 5CVJA 1GXQA 4HF0A 2JVHA 3QPLA 3HHGA 3K1MA 5E3LA 3BJ6A 3A2KA 4HZFA 1X2NA 3FMRA 1W7PB 3QOEA 1AKHB 4HDVA 4LB5A 4LGWA 5LGUA 1DU0A 2CQKA 2QGUA 3OWTA 4ITVA 4PJLA 1W36D 4MEXF 2VOPA 3ELKA 2R7UA 3HGYA 1WRJA 2MLKA 3QAHA 5LRRA 5HS8A 1E3OC 2X9DA 2FRHA 4DYRA 3K0LA 4LLNA 1TWAJ 2WB1A 3S14J 4D1QA 2ZXHA 1FP2A 2K86A 4ETSA 1QU3A 2GOXB 5LBQA 1QBJA 2LY2A 1CF7B 1HQCA 3SQNA 4E7LA 4R1HA 4M6XA 1PUFB 2EV0A 1V55H 3SZPA 3OYLA 4E70A 3BG9A 1T8IA 2CQQA 1P7JA 3KLOA 1IRGA 4RM2A 2LNBA 2CW0F 4BBRJ 4KUMA 4I09A 5BS6A 4M3DA 3R6SA 2X6OA 1MSEC 3U2RA 2ZFUA 1ON1A 1YOVB 2K7LA 4UV8A 4CCJA 4XOPA 2K85A 3IH4A 2LLKA 1QGPA 2W48A 3FKIJ 4XMYA 2X48A 2FE3A 2QBYB 2R4GA 5D5WB 2DA4A 2OF7A 5GTHC 4JBAA 2R7QA 2EIJH 2HQRA 3NWSA 1A35A 3DQVC 3E97A 4ENJA 3H92A 4O3MA 1R4NB 4A12A 2XHKA 2DT7B 2W25A 3CZ6A 2AS5F 3AL0C 3UR3C 1E2XA 1BI0A 4BY1J 3GZ6A 2H8RA 3W2WA 2A5YB 3BG3A 4Q48A 1I5ZA 1GDTA 1FC3A 3TO6A 3CCYA 3K70D 1RIOH 4U7DA 4ZYGA 3E1SA 2L54A 4FTHA 3FXQA 1ZG3A 4W97A 4EJWA 1PP8F 5ILUA 4HA8A 3OS1A 3OYAA 2Y48A 2L9VA 2IAIA 2K4JA 2HDDA 1XSXA 3JAMK 3S15J 2IS1A 3GTLJ 4E6KG 4FE4A 2NNYA 5KK1A 3LL7A 3E0JB 3PL8A 2VL8A 4M6YA 5HLGA 1IUFA 2VLAA 2RAEA 4BY7J 1ZR4A 4NDLA 2FBKA 4H4KC 3NARA 1CQTA 2O03A 5DD4A 2CRGA 4C2MJ 2Z1DA 3M8FA 4RAYA 3MCZA 3LSKA 1LDDA 4ZC3A 3G73A 2LDUA 4CCKA 1EH6A 4A3CJ 2VXDA 1I3AA 3ZQLA 2CG4A 4IO9F 5FLVA 3OYJA 1R1TA 4GRIA 4GGGA 4KT5C 2DW4A 2EFPA 1R23A 2DBBA 2ZB9A 4BEHA 2LKXA 1JGSA 2NS0A 4O5VA 4ZYHA 3IRRA 1TLHB 1Y8QB 4EJUA 4CHUA 5HLHA 1LKXA 5E17F 1UFMA 4XN0A 3H0DA 1U2WA 5F27A 3N97A 5FFZA 1R9TJ 1XGMA 2PFBA 1WJDA 1G8XA 3E5UA 3CUQA 1MBEA 2DMQA 1V54H 3JSPA 3E6MA 3BOQA 4V2FA 1IZ1A 4BUPA 2AXTC 4OAZA 3PJRA 1LUJB 3VSKA 1JKPC 4A3BJ 2Y2ZA 3EUKL 1XMKA 3A01B 1SEUA 1JUMA 1X58A 1Z77A 4A3DJ 3JW4A 1YE9A 2P6SA 1D8KA 2ETHA 3JRFA 2P4WA 2E5ZA 3KFWX 3F8BA 1SVOA 3TOBA 2VKEA 3CUOA 4CZZA 4GDFA 2LREA 3MQ0A 3S2HJ 2V9PA 3KLNA 2JSPA 1VQPI 3BP8A 3QP6A 1S9HA 2K40A 3SZGA 1I6HJ 2EIMH 4MGRA 5CVIA 4DJAA 3C7JA 2BY1A 4FCYA 3S17J 3L9FA 2QM3A 2TDXA 4HOBA 2AO9A 2P7VB 1VQMI 2DA3A 2HR3A 3L2WA 3O2PE 1LNWA 2ME6A 2CYYA 2LYCA 1Z6TA 4WXCA 2EA2A 3FHNA 3QU6A 3FBNB 3CJRB 2EA4A 4IZZA 1BM9A 1WI9A 2NVQJ 2Z3YA 4YRVA 3I56I 1F4KA 2VQLA 1DDNA 3ZQGA 5LD2C 4CYCA 2QUFA 4OWRB 3RCOA 1P6RA 1AWCA 2PI0A 3M1EA 4N4NB 2BV6A 4JYKA 3VSLA 2UWMA 1FMWA 3OIQA 4A2UA 1KU7A 1UHSA 3G1OA 3PUFA 5E8IA 1DGWY 5JVTA 3CF5F 4A3IJ 1XTAA 3A0BC 2QWWA 3GZ5A 3L7WA 4Y15A 4BQQA 1K78B 5F0FA 5E8GA 2MA3A 1FPQA 3V7RA 2F2EA 2B0LA 4BXUA 4FX0A 5J6XA 3K4NA 1F43A 2ZMEA 2COBA 3V8LA 4AIDA 3KZZA 2DTRA 3H1CA 5F08A 3T0YA 2X6YA 4C3HJ 5FO5A 2O8KA 4HLXA 3DLAA 2ID3A 4M3GA 5LEKA 5HDNA 1DP7P 1BJAA 2E35A 2A6TA 5ERIA 1OMIA 4RB1A 4XSZF 2G0EA 3CCUI 4HDUA 1K4SA 5C4JJ 5HDGA 4LIVA 5B3SH 3AAFA 2IA2A 3ERED 2VJ5A 4DBQA 1YIJI 1HKTA 1TQIA 1I50J 4XOTA 4MQ9F 2FEZA 2V4JC 2PN6A 2E36A 2L9RA 1X4OA 4B3AA 3IAM2 3A01A 1T56A 5CVVA 2R5ZB 2L7FP 3CC7I 1GV2A 4HX7A 3M4OJ 2UXXA 4DNCA 2FBIA 3LSJA 1TNTA 3L2UA 1G6NA 2FQ3A 3OYFA 1FIPA 1A6QA 3I59B 1K4TA 4KNYA 3KEOA 2M9HA 5D8KB 5J1YA 3I55I 1RRJA 2JA5J 1X1CA 4GO1A 3HDDA 1R00A 2VOOA 2NYXA 4NC8A 1MMDA 3RTRA 1IUYA 2IJLA 1WH5A 5JLWA 1SC7A 4JX6A 2G7UA 3VODA 2QYOA 3HOXJ 2NOGA 3SZTA 3HJEA 3D5SC 5BPDA 2RQPA 3TDZC 2CH0A 5BPIA 4XLEA 2VT2A 3GZNB 4C9YA 2QQAA 2HEOA 1MBKA 4E7IA 1WJ5A 2DAOA 1T0FA 2XV4S 3PNYA 5M5XJ 2F5FA 2HGCA 2RQQA 3DTKA 5FD5A 3S1QJ 1SAUA 1V3FA 2A69F 1XMAA 4I2OA 1BBYA 4M3FA 3PO3J 4L9NA 2W84A 1ETKA 4OOIA 4PSWA 1SD5A 3HG9A 3CQZJ 1FBUA 4ESFA 3GTMJ 4BBSJ 1T38A 1WJEA 1XSVA 2W00A 1SMYF 1BR1A 1GLNA 2RNJA 4Y4RA 2F6CA 1X1AA 3RKWA 1ZRDA 1SMTA 3K4JA 1BC7C 4MTDA 4PFPA 3BG5A 4OU0A 2Y0SN 4YG2F 1ETXA 1IXSB 3FMSA 1TWCJ 1SD6A 1VTNC 5FD6A 1MW7A 4NHJA 3IKTA 3DU6A 2M7AA 2DMNA 1XG1A 3K4MA 3LWFA 2CU7A 1YJNI 1RESA 1QZZA 1XC5A 2XGEA 2YX4A 2NS7A 1U8RA 5AIPA 5ICEA 3GO5A 1JTYA 2NVUB 2W85A 3CD6I 3GVAA 3LAJA 3N05A 1KONA 2DA2A 3AFHA 2MH2A 4B48A 1OCZH 4FHTA 4ZDLA 5D4SA 5HDKA 2R7VA 2DCEA 2M0MA 3HRSA 2R7WA 4XBFA 4IX7A 3R61A 1ZG1A 4IKFA 2OQRA 5EJCA 1J59A 1IN7A 2M45A 3JRCA 4HX8A 2GM4A 1WVRA 2ECCA 1XCVA 2HVSA 1KQ0A 4PJMA 2W7NA 4L5IA 1N25A 2X1EA 2RNGA 1NG6A 4A3EJ 2VN2A 1SANA 3R0JA 5DYMA 4G94A 5ICFA 2L9SA 1QVUA 3HB9A 2F4MB 3I59A 4ABZA 5K7ZA 2BHYA 4P9FA 3GUDA 1Z0XA 1DGRM 1X19A 1T95A 3PIOF 2UUZA 2V1NA 1WJAA 2ZJPF 3WU1B 2IS6A 2HOEA 2K9LA 2XAFA 3RPUD 1MBHA 3QPTA 3CCJI 2DLLA 4XKWA 3AKZA 3BR2A 3J7ZI 1N78A 2FA5A 3I5UA 2IGMA 3B6AA 1R5ID 2PMZN 3JSOA 4LD5A 4P9UA 5CKTA 3N4MA 2H1LA 5M5WJ 3OYGA 2CW8A 2EFWA 3KP3A 3QQAA 2F5VA 2FU4A 2JSCA 2HOSA 1ONVA 4B09A 2E34A 2OD5A 5FLXK 1SVLA 4LLLA 4G6QA 1WJBA 1P2FA 1PDNC 2Q0OA 4AIJA 3HOTA 3H3VK 4FE7A 3GFMA 4LIUA 1SD4A 2XIGA 5DTDA 3GX4X 2A61A 2FJ1A 2KPMA 2EZIA 5JR3A 2EBIA 1K83J 1RZ4A 1R6RA 4MFEA 1FWZA 5JLXA 3RIRA 5FKLA 1Z3XA 3DEWA 1IGNA 3Q0VA 1FYLA 3CLOA 3F22A 2CS3A 3Q5FA 4ENNA 3U1DA 3OL3A 3KYLA 4E7KA 3S3OA 4HNVA 2E19A 4OMZA 4KA4A 2V79A 2IA1A 1FSHA 3QPSA 3FHZA 1R4MB 2XVCA 2VC0A 3ESWB 3BR3A 3M7GA 4ZDPA 3LA3A 2R7FA 4KMFA 4RBOA 3VWBA 1V5FA 2XAUA 2O7OA 2GXBA 1DQUA 2XAHA 1R58A 4HBLA 4B43A 3I71A 2GA1A 2BZTA 5FJ8J 1B6AA 5FKMA 2NNNA 3D5RC 1R71A 2CFOA 2F5CA 2ZNYA 5C44J 3JRDA 4L9JA 1BJZA 2QQ8A 2OU2A 3O8HA 4A3KJ 5FRNA 1ACIA 1HLVA 5FFXA 2EJRA 5D8LB 3C3WA 2GOMA 3IC7A 4UXNA 1YW8A 2VT3A 1R5HA 1ZHFA 4ZYDA 3I4NJ 2BBYA 2P5KA 2XRLA 2KDOA 1R1UA 2OTLI 4QPOA 4XRSA 2EQRA 1KQ8A 5DEQA 3J7AO 4XKCA 1LFPA 2F48A 3QP5A 5IY5H 2Z5UA 4OAYA 3ULQB 4EJTA 4WCGA 2BY3A 2KL4A 1BI2A 5B1BH 4HLYA 4HPQA 2IEKA 3I0TA 2VE9A 5H20A 4AUXA 3ZQCA 3QYBA 3CCEI 2K9MA 4KN4X 1ENHA 3FBIB 4XK4A 3RKYA 1ZRFA 3FKJA 2O61A 2MFZA 5DUKA 3HC7A 4RB2C 2JUCA 3HTUA 5J8FA 2VKHA 1P92A 2PEXA 1SFEA 4E4HA 2JPBA 1G59A 1KU3A 2D45A 1HDDC 3HRTA 1D1AA 3WE2A 2R3SA 1S8NA 1Y39A 2XKOA 2JA2A 1MNEA 1HW5A 3S32A 4X6AJ 1XGOA 1X1DA 4IQ4A 5CLSA 1NG7A 5L3GA 3BZKA 3QYFA 3IRQA 4IOCF 2CUJA 3ROUA 3S2WA 5GAHJ 3PM1A 1POGA 1D1CA 3WGGA 3TBIA 1G2HA 1OISA 1P4XA 3DBHB 2BEOA 5HNHA 4X1EA 2O0YA 3LFKA 1S29A 2DA1A 4NC7A 2O5RA 4DBRA 3U21A 3JRGA 1GT0C 1KA8A 1JUSA 4J01A 2JA7J 3BC8A 4A93J 3H9GA 3TW6A 2M34A 2ZKZA 4BYYA 2K02A 4KIGA 3RZOJ 3T8TA 2HVRA 2HQNA 2WA0A 3OOPA 1BA5A 2EFQA 3M1CA 2PJRA 5K7FA 4EGZA 3BTCA 5IP6A 1U6GA 2ZNZA 1UAAA 3BJAA 3KYCB 3UKGA 5DCMB 3PO2J 2HZTA 3DP7A 3JRAA 1VI0A 4BE2A 1OLTA 3E6DA 2Y30A 4FT8A 2DT5A 3B73A 3GFJA 2HNHA 2KMUA 3LSTA 1I3QJ 2VASA 1FTZA 5DUIA 1VQKI 5TGTA 2J5OA 1T0FC 4IOAF 3KX2A 1YG2A 3BCBA 4UVBA 3ZRGA 3J7AY 1I27A 5LFAA 1X1BA 2R7DA 3NAUA 1ZGWA 4NB5A 2VJJA 2YU3A 2VPLA 2OV7A 3OMYA 1W0UA 1OR7A 2IGNA 4B44A 5A2QZ 2EFOA 1EKEA 1NH3A 4M3EA 4N0BA 3BR0A 1YRNB 2CSOA 1JHHA 5EEHA 3REOA 2WV0A 1GXPA 2XPWA 3TEDA 4EM0B 2ISZA 2BE5F 1VQ6I 4M6VA 2HXIA 4DYQA 3HOYJ 1WSUA 1CGPA 4FASD 2OQGA 1QQIA 2VPRA 1A31A 1ODDA 4XR6A 2BY2A 2VKVA 1AA7A 3NQOA 3GEZA 1IW7F 2JZYA 2KZVA 4GXOA 1QHHD 4CA0A 3DLLF 1YO5C 3R60A 3GTOJ 2D5VA 1U9NA 5BOXA 1BW5A 1H89C 1B72A 3U1KA 1K6OA 5BQTA 4EJVA 1UCRA 1YS7A 4CICA 5F0CA 1T08B 3CO7C 2DMUA 2G7HA 3MZHA 3OYNA 3BZCA 1ZK8A 4H0EA 3W6VA 1JTXA 4OIQF 5D5UB 2KQRA 1XDUA 2L5QA 3ABKH 5JHUA 2CQ7A 3ZP5A 2WWYA 4WWCA 1MDMA 1RI7A 2LBFB 3G6EI 3Q3SA 2XF6A 1BL0A 2NOJB 1KGSA 2ZSHB 1U5TB 4BE1A 3HBLA 1PUEE 3SEZA 2TCTA 1TW2A 2FMYA 5DDGA 4HW0A 3K1NA 3Q9SA 4UUVA 3GLLA 4EEFG 3G2BA 4G7OF 1FT9A 4TV7A 3GFIA 5JVGF 1OCCH 2Z99A 1ZRCA 1KYWA 2KIUA 3ZQIA 4IPAA 3HUGA 3DEUA 1KU2A 1NK2P 2P0WA 2EWNA 2Y0MA 1RC9A 3VPRA 3ZXSA 5TISC 2V6EA 2E7WA 2OCEA 5D4RA 1FX7A 4L0ZB 2LVSA 2QENA 2ZJ2A 3X2QH 4QWQA 2WB1N 5E20A 4KICA 1W7PA 4P5OA 4B8XA 5DM6F 1UMQA 3S3MA 1AKHA 1QA6A 4YEJA 3LSHA 1RR7A 3RPQA 2YU9J 1E3PA 3GYHX 1AOYA 4HSRA 1USTA 2DK8A 2GXGA 2HKOA 4GFBA 2H8WA 4A3FJ 3F8NA 4DIQA 1Z21A 2OZ6A 1TWGJ 5A2QK 5IYCJ 5FRMA 1YIOA 1Y56A 1KYZA 1XD7A 3S1RJ 1DP3A 4P96A 2FOKA 3KPHA 4M71A 4UUSB 4QIWN 3M8JA 2LR8A 3OIOA 4ON0A 2A07F 2EIKH 3SYTA 2LKPA 2VIXA 1CF7A 1OCOH 1Q1HA 1EH7A 3BT9A 3HRUA 3CMAI 1TWHJ 1PUFA 1HXDA 1S72I 2ZC2A 4XSXF 3OSFA 2GAUA 3H5RA 3DKXA 4ZH4F 1XDSA 3A4CA 3TQNA 1B1BA 3TP0A 3ZMZA 3GTJJ 4F52A 2Z33A 4OINF 3RKXA 3KP6A 2X51A 2DDBA 1WJFA 5FKOA 2H94A 3L00A 3CDHA 4BS9A 5LHIA 3K4BA 3FWEA 3ZQHA 1X3WB 1W5TA 3OS0A 5E1XA 2V7FA 1WQ2A 2L2OA 2QBYA 2GZWA 1TQPA 2BOLA 5L3EA 2JN6A 1ZREA 2BW3B 4HYEA 4RAZA 3WU2C 2OBPA 3JRIA 4DZPA 1P9QC 1K61A 1WWXA 3TKYA 2DJNA 4YFKF 3EDPA 2CV1A 4UHTA 2VBWA 4GYIA 1YQAA 2KLOA 4G6TB 1QHGA 4IEJA 2ELHA 2YR2A 4JK1X 3WHCA 5F1RA 3QU3A 4HF1A 2VBYA 3BTIA 2G9WA 5L3BA 3FF5A 4FX4A 3KYDB 3HSFA 2VB6A 3KEQA 2R7SA 5J8CA 3CCQI 3F21A 5ICGA 1IF1A 1F1ZA 2YS9A 4FQGA 4U0YA 2XUBA 1UB9A 3BJOA 1ETWA 2ZJRF 1FMVA 3DTIA 5F1JA 3DU5A 1JT0A 2I8DA 1L3LA 1RKWA 1T6SA 2F4OB 4BL0B 5JFRA 2QLZA 4L9TA 2IBDA 3HKZA 2M7BA 3ZMTA 4X0GA 5HVQC 4JOMA 4D9JA 3HRMA 4G7HF 1MMSA 4I02A 1MH3A 1Y1WJ 3P5JA 3GCMA 4S04A 5IYBJ 1RUNA 1EH8A 5CQEA 1J75A 1QPMA 1SFKA 4XLCA 2P6TA 2XKPA 3KP5A 2ZFWA 4LJZF 2WAEA 1BW6A 5KHDA 3LSPA 2HDWA 2JUGA 1MJAA 3AG4H 5H2FC 2WC2A 2CUZA 2Q1ZB 4UUSA 3BPVA 4NNJA 3HOUJ 3CESA 3GXOA 2KP6A 5KAIC 4HQEA 2DK5A 3K7AJ 1TL8A 4R8HA 1VQ4I 3Q9VA 4LG0B 2HTSA 5K7HA 2DOAA 1V4RA 4AIKA 1VQ5I 2M30A 4PJNA 1QNTA 4RGUA 4QPQA 1LVAA 2E1MC 3C1DA 3KCCA 3HL2A 2DT6A 1APLC 5KNLA 4N4OB 2DPDA 1F9NA 2VBXA 1LDKB 5FKNA 4Z2YA 1A36A 4BAYA 1WJCA 2BW3A 2L4MA 2FNPA 1SFUA 4V19K 4Q47A 2L02A 3TO7A 2LD5A 1O4XA 1QVTA 2EILH 2XGCA 1UHMA 3F6OA 3LSMA 3LAPA 1H9TA 1S7OA 2FUG2 2PBIA 3GBGA 2YX7A 2DFEA 5EG0B 1MMNA 2LP0A 3W6JB 3B6CA 4XICA 5FROA 3L2CA 1DUXC 2LRDA 5CVRA 1ZKGA 4U88A 3IV5A 2OPTA 1W5SA 3OOUA 4PUSA 1R49A 1IXCA 3JRBA 1HW1A 4EVIA 1OR7C 2CQXA 4LLGF 2WAQN 1FNNA 4NQWB 3AL0B 4LB6B 1FSEA 2ESHA 5LHHA 3HOZJ 3M3YJ 4HNUA 5HNFA 2UZKA 5IOZA 3WU0A 1U3EM 4D5FA 1PP7U 5EF6A 4EGYA 4M9SA 2X0LA 1W4MA 5FKKA 1IG7A 4M9XA 4BHCA 1HW2A 1D0XA 1RETA 2GQQA 2AXLA 3MKLA 3HGGA 2R92J 3OS2A 4UB8C 1G4DA 2XB0X 2UV1A 3ABTA 3CC2I 4YIFA 5JI6A 2LG4A 1J9IA 1IRZA 4L5EA 5CVUA 3ZOBA 1FLIA 3V8JA 2V9VA 4PJJA 3FDYA 1VQOI 3QYEA 1FYMA 1ZTRA 2BHZA 3SFZA 1X1PA 3FX3A 3J7YJ 3KZIC 1SD7A 2VODA 4PJ0C 3M07A 1K78A 1LE8B 4RM3A 2K9QA 3QWLA 2D2WA 3COAC 2MABA 2Q2EB 5K5QA 1YJWI 3ZMVA 1ZGJA 2HYGD 5D6FA 3VDXA 2GA2A 4WX9A 3BTLA 1TZLA 5EYRA 3IL2A 3K4CA 3L2QA 3QRFF 4FETA 1M1EB 2ZXIA 3MKZA 4OIRF 4LG3A 3QOPA 5DV5A 4IHTA 2HTJA 2RGVA 3M9AA 3FK7A 3JR9A 4C30A 2DXIA 3J81Z 3RDIA 3SDBA 1MH4A 5HLIA 3FXLA 4EJOA 2DFHA 3IP4B 3MD2A 2FF4A 2V26A 3CJQB 5DM7F 1IRFA 4D0PA 4AU7A 1WCMJ 3I54A 2R5ZA 1GHCA 5D6EA 3HPGA 3VB2A 2RN7A 4UY8I 1R1VA 4MIMA 3ERMA 4DW6A 4QLCU 3ASNH 5J1UA 4BHPA 4AYBA 1HC8A 1ORKA 3DBLB 3I3LA 2M8EA 5F04A 3VFZA 2ELJA 2H09A 3CCVI 2KRCA 2PG4A 2WBMA 3DPTA 2R7RA 2ZSIB 2L9NA 2VXZA 4OIPF 1T98A 1WZ2A 5J40A 3CCSI 5AONA 3EPZA 2ESNA 4G8XA 1J2XA 4MFDA 2I10A 3S8PA 3WTXC 1OJLA 3O3KA 4XRSG 5IT9Z 2L7MP 4P1WA 1B9NA 2L01A 4A69C 1HKSA 2LFBA 2DMPA 3TDUC 3GTGJ 3HIFA 1OYIA 5EZGA 2DYRH 3GTQJ 1HBXG 1MBGA 3DKYA 2KT0A 3RYRA 1Y1VJ 1BR2A 2XROA 3G1MA 2MC4A 1Z3YA 1ULYA 2ID6A 3Q0WA 4A3JJ 4I6ZA 4IL6C 1HCRA 3ZMSA 3FMQA 3RJPA 1MMAA 4ZYAA 3V7SA 3OYKA 2R7TA 4A0ZA 4U0VA 1BIAA 1KQ9A 2V1DA 4ESBA 5LHGA 5GP9A 3MKWB 1VZ0A 1W1WE 1IV6A 1MIJA 3IH3A 4QTRA 3B02A 4FISA 3KETA 3CUQC 5IYDJ 4CYDA 2Z16A 2ME0A 2ISYA 3I58A 5ILSA 5B1AH 5LGNA 4BE0A 4Q5SF 2HS5A 5HLTA 3T8RA 3BQZA 2V6CA 1WH7A 4ZTJA 2D1HA 2WTEA 2WV1A 3E6BA 1ZLJA 3I4PA 3CDIA 3P7NA 4HV5A 2M1BA 2CWEA 2DA5A 4KT6A 5GAGJ 1RKTA 1OYYA 4IRHA 1MZBA 2E1NA 1JJ6C 2IT0A 2XAJA 2STWA 4IHVA 3HTSB 2W82A 2NVTJ 4KJZA 1F36A 1YLFA 5E3MA 2ECBA 3U9GA 1FY7A 1Z67A 1XS9A 3WTYC 1FTTA 2CUEA 3WTVC 4M9ZA 3J81K 3LSRA 2CV2A 3JTGA 3ZQ7A 2CV0A 2W24A 5J3LA 3BG7A 2ZXJA 3J80Z 3ECHA 3IHUA 3LSIA 2XDVA 5IP7J 1FOWA 1Y6IA 3I53A 3D1NI 1N75A 1IC8A 1YW9A 5L3FA 1ZAOA 3EUHA 3E3VA 2GWRA 5M3FJ 2DODA 1XN7A 2Z9OA 5M5YJ 1JXSA 4CDGA 1YTYA 2M2EA 4XLPF 2H6CA 3JTHA 3H5NA 1PYVA 1JKRC 1W36C 1U78A 4ENKA 4EATA 3S2DJ 5LLQA 2QCOA 5CYVA 3UNGC 4CCLA 3OR1C 1RUOA 3GF2A 5J1RA 3TL4X 1Z91A 3VEPA 4EV0A 1VQ8I 4UUTA 3ECOA 5IT9K 2A6EF 3PIPF 2EZLA 3IH2A 4HRIA 2E60A 6PAXA 4IVNA 2QEXI 4CGZA 1FYKA 2WAFA 1GVDA 3PSFA 3R4KA 2R5YB 1N77A 2ZMEC 3S1NJ 3G3ZA 1J09A 2XAGA 2R7ZJ 1WPKA 3BR5A 4LMYA 4C3JJ 5CJ9A 3RQ4A 2RKHA 4HNTA 4IHYA 3DWLE 3S1MJ 2RREA 4MLOA 1A04A 2CGPA 4PK4A 2JA6J 2DDAA 2DFIA 3I64A 2IRFG 4YIIA 2GXAA 4AC0A 1A6IA 1XX5A 3T1BA 4ZYEA 4I98B 2A68F 2ICWG 1IN4A 4HSTA 2FD5A 2EZKA 5DD8A 1LFBA 5EZHA 3LFUA 3AG1H 3DTEA 3P9CA 4F93B 2LC2A 3KP4A 1ZELA 1Z7LA 2AQFA 2DFFA 3LA2A 3K70C 1LFUP 2P5LC 3CCRI 1C0WA 2CO5A 2NVYJ 1STZA 3RPUA 2NRAC 4S0HB 1TTYA 2QSFX 2KJBA 3F72A 3CP2A 1REPC 4IHWA 2E1OA 2E2IJ 3F8CA 3K6GA 2FOWA 4RGXA 4ZZDA 3RZDJ 2PMUA 3BR1A 2VONA 3HEFA 2P7CB 4BDYA 3H9QA 2LH9A 4DZJA 3CDLA 1J0RA 4L18B 2F5EA 4IXAA 2HWVA 4NBQA 4MNUA 4HF2A 4V2GA 5IPAA 3CMYA 1BIBA 1UJ8A 3GMEA 1HSJA 1R22A 2W1OA 1H0MA 4II3A 3VYSB 1S3JA 2NVXJ 1SFXA 2QF7A 1JT6A 1LQ1A 3J80K 3CTAA 2GBYA 1FOXA 2X4HA 1FIAA 5IOYA 5E79C 1TWFJ 2BVMA 2L3DA 3E5QA 2OC6A 3CF2A 3SJMA 2D1VA 3O8GA 1V5EA 2DOFA 3H3ZA 5KVRA 2XPUA 3HOSA 1QZEA 4HEA2 2FQ4A 3TP3A 4F55A 3BROA 3ZMDA 2DMTA 3LA7A 2R5YA 4OIOF 3LOCA 2GIVA 2IA0A 1JKOC 1O3SA 3H36A 4RGSA 4Y3OA 3WE3A 4BNCA 3TMOA 1YX3A 1HKQA 4NC6A 2HZDA 3ZQFA 3W6KB 3HZJA 4CH7A 1G3WA 4AM3A 3ZCOA 3DCFA 4BEHB 5H6QA 2UXNA 2VUMJ 2O6GE 1ETOA 5B66C 2XAQA 1IN8A 3RYPA 1I1GA 1I6XA 1LEBA 4Y17A 1JI8A 4D7MA 5CPRB 2DTZA 2A6HF 4JX4A 1AHDP 5E1WA 5KAFC 1HDPA 2HKXA 3CUQB 3WTZA 3H0GJ 4ZDOA 3EYYA 3GWZA 1GV5A 3Q0UA 1GUUA 4RDUA 2RV8A 2K4BA 1ZQ3P 2DYSH 5DCMA 1ZYRF 5DS9A 4UNOA 4U0WA 5F6FA 4MEYF 1YHQI 3CCMI 2YUSA 3SEQA 3BQYA 3A0HC 3FXKA 4LK1F 4LOCA 3S3NA 2IGOA 3ABUA 4JQFA 2AQEA 4D5CA 4PGHA 5E18F 3WTTC 4NUBA 5LGTA 1U8BA 2O9LA 1OFCX 3BR6A 4A0XA 1LJ9A 2NAZA 3K4LA 3QODA 2DQLA 4KFCA 2KISA 3TOAA 1YW7A 4F92B 3HSEA 3OYEA 3FISA 3RSNA 4KIBA 2L7KA 4A5MA 4AIHA 2ZCWA 2TRTA 3ZPLA 4PDKA 5L3CA 1RNLA 4RB0A 3FM3A 1YRNA 3EYIA 3E5XA 3ABLH 2DA7A 2QVOA 4G12A 2M5WA 3H9JA 4XLAA 3MN2A 4ASNA 3WTSC 1MJBA 2VE8A 4G9YA 3GTPJ 3BG6A 1P7IA 4A5NA 1PJRA 2GIZA 4CUGA 4KN7X 1I39A 4D7NA 1USSA 4Z6YA 5GAEJ 2HVQA 4CYCB 3JREA 3OYIA 2E2HJ 2KJCA 2K5CA 4RB3C 2FBHA 4DGWB 3IAS2 2OAZA 2MSYA 1OPCA 4J00A 3OYDA 4A3GJ 1MD0A 1TBXA 1IJWC 2K3FA 4W1UA 3MWMA 1HA8A 3WHBA 1B4AA 4KITB 5K1YA 3K10A 1YYVA 2R7OA 1T33A 5ICCA 3IWFA 1FBSA 1H8AC 2KIFA 3BZ6A 2IS4A 1Y0NA 1P4AA 1ZGAA 2COMA 1X4PA 1FEXA 3CO6C 1EA3A 2ZMEB 1MNDA 2BXYA 1IXRC 3ONQA 1ITYA 4M3BA
chains in the Genus database with same CATH topology
3M3YJ 1H88C 5IOZA 4J19A 2M8GX 4RBOA 4D5FA 5EF6A 2O7OA 1JKQC 1X2MA 5FKKA 1IG7A 1RETA 2JK3A 3MKLA 3HGGA 5FJ8J 2R92J 1IDZA 2HOTA 5FKMA 4XRMA 2XB0X 2HOAA 1Q1VA 1IRZA 4L5EA 5C44J 3JRDA 3QPLA 3ZOBA 1MBFA 1BJZA 4B1RA 5E3LA 3O8HA 4A3KJ 1ZTRA 1X2NA 1HLVA 1AKHB 1DU0A 1LE8B 2K9QA 3HGYA 3I4NJ 1E3OC 3A02A 3BTLA 2X9DA 2XRLA 4DYRA 5EYRA 1TWAJ 3HM5A 3S14J 3LNQA 4XRSA 2EQRA 1WGXA 1PUFB 3FK7A 3JR9A 4B4CA 3BG9A 2CQQA 1P7JA 1MH4A 4BBRJ 1IDYA 2IEKA 4M3DA 2X6OA 4AUXA 3ZQCA 1MSEC 1ENHA 4XK4A 1WCMJ 5E3NA 2R5ZA 2NS8A 4I76A 4MIMA 3IH4A 2LLKA 2W48A 4DW6A 3FKIJ 2X48A 5J1UA 5F0HA 5GPCA 2DA4A 1ORKA 2OF7A 1HDDC 4A3LJ 5F04A 3S16J 4X6AJ 2N8GA 1TC3C 4BY1J 4DYCA 2H8RA 3BTJA 3BG3A 3PM1A 1GDTA 1POGA 4MO7A 3CCYA 4MFDA 2I10A 1G2HA 1OJLA 4FTHA 5EGOB 4XRSG 4X1EA 2L7MP 5IP9J 4A69C 4W97A 2LFBA 4BXXJ 2DMPA 2DA1A 1JGGA 2IAIA 3GTGJ 3JRGA 5EZGA 1GT0C 3GTQJ 3FIWA 2HDDA 1MBGA 1NTCA 2JWTA 2KT0A 1JUSA 2JA7J 3S15J 3GTLJ 4FE4A 1Y1VJ 3TW6A 4A93J 5EEAA 3G1MA 2M34A 1IUFA 2ID6A 2RAEA 3Q0WA 4BY7J 1D5YA 1ZR4A 4NDLA 4A3JJ 1CQTA 3NARA 4I6ZA 3RZOJ 1HCRA 1W0TA 2CRGA 4C2MJ 1RPWA 1MNMC 1BA5A 5K7FA 3BTCA 5IP6A 2DA6A 1NK3P 4A3CJ 3ZQLA 2H1KA 3UKGA 5FLVA 3PO2J 5GP9A 2MG4A 3JRAA 1VI0A 1IV6A 2Y30A 4JP0A 3IH3A 2E2JJ 2ZB9A 4QTRA 3HKZN 2LKXA 4FISA 1I3QJ 1FTZA 5IYDJ 3HOVJ 2ME0A 1JJ8C 1FJLA 5F27A 3BQZA 1R9TJ 1WH7A 3NAUA 1ZGWA 2WV1A 5BNGA 1W0UA 1MBEA 4BKXA 2DMQA 4V2FA 2DA5A 2MGQA 2AHQA 2Y9YA 1RKTA 4Y7NJ 4M3EA 3BR0A 2DN0A 1JJ6C 1WI3A 1YRNB 1JKPC 4IHVA 5C3EJ 2Y2ZA 4A3BJ 2NVTJ 3A01B 1F36A 5E3MA 1JUMA 1X58A 1Z77A 2XB5A 2ECBA 2XPWA 3E7LA 3TEDA 4A3DJ 1XS9A 1FTTA 2CUEA 1JUPA 3JRFA 4M6VA 2HXIA 4DYQA 3LSRA 3HOYJ 5J3LA 2VKEA 2VPRA 5IP7J 2B63J 2VKVA 3D1NI 1IC8A 3S2HJ 3MVPA 5EDNA 4JX5A 2K40A 5M3FJ 1I6HJ 1B8IB 3GTOJ 1AU7A 2D5VA 5M5YJ 1U9NA 2M2EA 5EGOA 1BW5A 1H89C 3F0CA 4FCYA 3S17J 4XIDA 1B72A 2AO9A 1JKRC 1UG2A 2DA3A 1U78A 3S2DJ 2JMWA 2QCOA 5F0CA 3JRHA 2ME6A 2NVQJ 3LSGA 5J1RA 2DMUA 1ZK8A 3W6VA 1JTXA 3ZQGA 4CYCA 4UUTA 2EZLA 3K2AA 3IH2A 4JYKA 1GVDA 1UHSA 2R5YB 3G1OA 3Q3SA 3S1NJ 1EF4A 2CUFA 3I4MJ 2VI6A 1WPKA 1BL0A 2R7ZJ 2XPVA 3BR5A 4A3IJ 2JA8J 4C3JJ 5EG0A 1MBJA 4IHYA 3HBLA 9ANTA 5F0FA 2TCTA 3S1MJ 4MLOA 3L1PA 4EEFG 1F43A 2COBA 2JA6J 5F08A 4C3HJ 4AC0A 1A6IA 3SDGA 1VFCA 2O8KA 3ZQIA 2XSDC 2ID3A 2Y31A 4M3GA 2HXOA 2FD5A 1NK2P 2EZKA 2G0EA 1LFBA 5C4JJ 5EZHA 3VPRA 1I50J 3TW7A 2LVSA 1LFUP 2L9RA 2WB1N 1QPIA 4B3AA 2NVYJ 1AKHA 3A01A 1T56A 2M0CA 1UMQA 2L7FP 2R5ZB 1GV2A 3M4OJ 1RR7A 1ZR2A 2HI3A 5HODA 3LSJA 2YU9J 4S0HB 1LE8A 4IHWA 1FIPA 2E1OA 2E2IJ 4GFBA 2M9HA 5J1YA 4A3FJ 1U9OA 1MSFC 2JA5J 3RZDJ 1TWGJ 3BR1A 5IYCJ 3HEFA 3S1RJ 3HDDA 4A3GJ 4UUSB 4QIWN 4DZJA 2LR8A 3CDLA 3OIOA 1A5JA 5JLWA 1WH5A 1ETYA 4JX6A 3OSGA 4V2GA 5IPAA 3HOXJ 1VF9A 2NOGA 3BT9A 3CMYA 1TWHJ 1PUFA 1QRYA 1B8IA 2CJJA 3OSFA 1OCPA 4AYBN 2NVXJ 1MBKA 3TP0A 2QF7A 3GTJJ 1VNDA 1JT6A 2GBYA 5M5XJ 1DU6A 5FKOA 1HF0A 3S1QJ 1FIAA 5IOYA 1TWFJ 4M3FA 3ZQHA 3PO3J 1ETKA 3GTKJ 3SJMA 3O8GA 3CQZJ 2JN6A 3GTMJ 2XPUA 4BBSJ 2HYJA 3JRIA 2L7ZA 2P81A 5E3OA 4DZPA 1K61A 2FQ4A 3A03A 3TP3A 3BG5A 2DMTA 2DJNA 2R5YA 2Y0SN 2K9SA 3LOCA 2R93J 1ETXA 2EH3A 1JKOC 1TWCJ 5C4XJ 2Y9ZA 4IEJA 3WHCA 2DMNA 1XG1A 3ZQFA 2CU7A 3BTIA 1RESA 1XC5A 2XGEA 2NS7A 3DCFA 2VUMJ 1JTYA 1ETOA 3FK6A 2DA2A 4Y52J 2YS9A 4D7MA 1ETWA 1HOMA 2DTZA 5F1JA 3JRCA 1JT0A 2GM4A 1RKWA 2ECCA 4JX4A 2R0QC 1AHDP 2IBDA 4IHXA 1HDPA 2JJ7A 3H0GJ 4A3EJ 1GV5A 3G1LA 3Q0UA 1GUUA 4RDUA 1MH3A 1Y1WJ 1ZQ3P 4A3MJ 5IYBJ 1SANA 3C2BA 5DS9A 1SFOJ 1QVUA 4QSHA 3HB9A 5K7ZA 4ABZA 3HOZJ 1BW6A 1Z0XA 3LSPA 5FLMJ 2YUSA 3BQYA 3SFIA 4LOCA 2KDZA 4UUSA 1ETQA 4D5CA 1OCTC 1MBHA 3HOUJ 1U8BA 2O9LA 1OFCX 3BR6A 3BR2A 3K7AJ 2ELKA 3B6AA 2HQ5A 2PMZN 2XGDA 5K7HA 3FISA 2FX0A 5M5WJ 2TRTA 3HOWJ 3QQAA 1B72B 2LK2A 2HOSA 1YRNA 1APLC 1S7EA 2DA7A 4G12A 3MN2A 3GTPJ 1ETVA 1P7IA 5FKNA 3H3VK 4FE7A 5DTDA 4D7NA 2FJ1A 4C3IJ 3RKQA 2EZIA 2EBIA 4CYCB 3JREA 1K83J 3RQIA 2E2HJ 2MW8A 2GLOA 4MFEA 2MSYA 2LD5A 5JLXA 1O4XA 2K9NA 5FKLA 1QVTA 1IJWC 2LY9A 3DEWA 1IGNA 2L0KA 2XGCA 3Q0VA 4W1UA 3WHBA 2LTPA 3GBGA 5GPAA 5M3MJ 1T33A 5EG0B 1H8AC 4HNVA 2LP0A 3B6CA 4XICA 2E19A 1ZKGA 3IV5A 2OPTA 3OOUA 2EZHA 1FEXA 3QPSA 3JRBA 2CQXA 2WAQN 3BR3A 1ITYA 4M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y J;  1H88 C;  5IOZ A;  4J19 A;  2M8G X;  4RBO A;  4D5F A;  5EF6 A;  2O7O A;  1JKQ C;  1X2M A;  5FKK A;  1IG7 A;  1RET A;  2JK3 A;  3MKL A;  3HGG A;  5FJ8 J;  2R92 J;  1IDZ A;  2HOT A;  5FKM A;  4XRM A;  2XB0 X;  2HOA A;  1Q1V A;  1IRZ A;  4L5E A;  5C44 J;  3JRD A;  3QPL A;  3ZOB A;  1MBF A;  1BJZ A;  4B1R A;  5E3L A;  3O8H A;  4A3K J;  1ZTR A;  1X2N A;  1HLV A;  1AKH B;  1DU0 A;  1LE8 B;  2K9Q A;  3HGY A;  3I4N J;  1E3O C;  3A02 A;  3BTL A;  2X9D A;  2XRL A;  4DYR A;  5EYR A;  1TWA J;  3HM5 A;  3S14 J;  3LNQ A;  4XRS A;  2EQR A;  1WGX A;  1PUF B;  3FK7 A;  3JR9 A;  4B4C A;  3BG9 A;  2CQQ A;  1P7J A;  1MH4 A;  4BBR J;  1IDY A;  2IEK A;  4M3D A;  2X6O A;  4AUX A;  3ZQC A;  1MSE C;  1ENH A;  4XK4 A;  1WCM J;  5E3N A;  2R5Z A;  2NS8 A;  4I76 A;  4MIM A;  3IH4 A;  2LLK A;  2W48 A;  4DW6 A;  3FKI J;  2X48 A;  5J1U A;  5F0H A;  5GPC A;  2DA4 A;  1ORK A;  2OF7 A;  1HDD C;  4A3L J;  5F04 A;  3S16 J;  4X6A J;  2N8G A;  1TC3 C;  4BY1 J;  4DYC A;  2H8R A;  3BTJ A;  3BG3 A;  3PM1 A;  1GDT A;  1POG A;  4MO7 A;  3CCY A;  4MFD A;  2I10 A;  1G2H A;  1OJL A;  4FTH A;  5EGO B;  4XRS G;  4X1E A;  2L7M P;  5IP9 J;  4A69 C;  4W97 A;  2LFB A;  4BXX J;  2DMP A;  2DA1 A;  1JGG A;  2IAI A;  3GTG J;  3JRG A;  5EZG A;  1GT0 C;  3GTQ J;  3FIW A;  2HDD A;  1MBG A;  1NTC A;  2JWT A;  2KT0 A;  1JUS A;  2JA7 J;  3S15 J;  3GTL J;  4FE4 A;  1Y1V J;  3TW6 A;  4A93 J;  5EEA A;  3G1M A;  2M34 A;  1IUF A;  2ID6 A;  2RAE A;  3Q0W A;  4BY7 J;  1D5Y A;  1ZR4 A;  4NDL A;  4A3J J;  1CQT A;  3NAR A;  4I6Z A;  3RZO J;  1HCR A;  1W0T A;  2CRG A;  4C2M J;  1RPW A;  1MNM C;  1BA5 A;  5K7F A;  3BTC A;  5IP6 A;  2DA6 A;  1NK3 P;  4A3C J;  3ZQL A;  2H1K A;  3UKG A;  5FLV A;  3PO2 J;  5GP9 A;  2MG4 A;  3JRA A;  1VI0 A;  1IV6 A;  2Y30 A;  4JP0 A;  3IH3 A;  2E2J J;  2ZB9 A;  4QTR A;  3HKZ N;  2LKX A;  4FIS A;  1I3Q J;  1FTZ A;  5IYD J;  3HOV J;  2ME0 A;  1JJ8 C;  1FJL A;  5F27 A;  3BQZ A;  1R9T J;  1WH7 A;  3NAU A;  1ZGW A;  2WV1 A;  5BNG A;  1W0U A;  1MBE A;  4BKX A;  2DMQ A;  4V2F A;  2DA5 A;  2MGQ A;  2AHQ A;  2Y9Y A;  1RKT A;  4Y7N J;  4M3E A;  3BR0 A;  2DN0 A;  1JJ6 C;  1WI3 A;  1YRN B;  1JKP C;  4IHV A;  5C3E J;  2Y2Z A;  4A3B J;  2NVT J;  3A01 B;  1F36 A;  5E3M A;  1JUM A;  1X58 A;  1Z77 A;  2XB5 A;  2ECB A;  2XPW A;  3E7L A;  3TED A;  4A3D J;  1XS9 A;  1FTT A;  2CUE A;  1JUP A;  3JRF A;  4M6V A;  2HXI A;  4DYQ A;  3LSR A;  3HOY J;  5J3L A;  2VKE A;  2VPR A;  5IP7 J;  2B63 J;  2VKV A;  3D1N I;  1IC8 A;  3S2H J;  3MVP A;  5EDN A;  4JX5 A;  2K40 A;  5M3F J;  1I6H J;  1B8I B;  3GTO J;  1AU7 A;  2D5V A;  5M5Y J;  1U9N A;  2M2E A;  5EGO A;  1BW5 A;  1H89 C;  3F0C A;  4FCY A;  3S17 J;  4XID A;  1B72 A;  2AO9 A;  1JKR C;  1UG2 A;  2DA3 A;  1U78 A;  3S2D J;  2JMW A;  2QCO A;  5F0C A;  3JRH A;  2ME6 A;  2NVQ J;  3LSG A;  5J1R A;  2DMU A;  1ZK8 A;  3W6V A;  1JTX A;  3ZQG A;  4CYC A;  4UUT A;  2EZL A;  3K2A A;  3IH2 A;  4JYK A;  1GVD A;  1UHS A;  2R5Y B;  3G1O A;  3Q3S A;  3S1N J;  1EF4 A;  2CUF A;  3I4M J;  2VI6 A;  1WPK A;  1BL0 A;  2R7Z J;  2XPV A;  3BR5 A;  4A3I J;  2JA8 J;  4C3J J;  5EG0 A;  1MBJ A;  4IHY A;  3HBL A;  9ANT A;  5F0F A;  2TCT A;  3S1M J;  4MLO A;  3L1P A;  4EEF G;  1F43 A;  2COB A;  2JA6 J;  5F08 A;  4C3H J;  4AC0 A;  1A6I A;  3SDG A;  1VFC A;  2O8K A;  3ZQI A;  2XSD C;  2ID3 A;  2Y31 A;  4M3G A;  2HXO A;  2FD5 A;  1NK2 P;  2EZK A;  2G0E A;  1LFB A;  5C4J J;  5EZH A;  3VPR A;  1I50 J;  3TW7 A;  2LVS A;  1LFU P;  2L9R A;  2WB1 N;  1QPI A;  4B3A A;  2NVY J;  1AKH A;  3A01 A;  1T56 A;  2M0C A;  1UMQ A;  2L7F P;  2R5Z B;  1GV2 A;  3M4O J;  1RR7 A;  1ZR2 A;  2HI3 A;  5HOD A;  3LSJ A;  2YU9 J;  4S0H B;  1LE8 A;  4IHW A;  1FIP A;  2E1O A;  2E2I J;  4GFB A;  2M9H A;  5J1Y A;  4A3F J;  1U9O A;  1MSF C;  2JA5 J;  3RZD J;  1TWG J;  3BR1 A;  5IYC J;  3HEF A;  3S1R J;  3HDD A;  4A3G J;  4UUS B;  4QIW N;  4DZJ A;  2LR8 A;  3CDL A;  3OIO A;  1A5J A;  5JLW A;  1WH5 A;  1ETY A;  4JX6 A;  3OSG A;  4V2G A;  5IPA A;  3HOX J;  1VF9 A;  2NOG A;  3BT9 A;  3CMY A;  1TWH J;  1PUF A;  1QRY A;  1B8I A;  2CJJ A;  3OSF A;  1OCP A;  4AYB N;  2NVX J;  1MBK A;  3TP0 A;  2QF7 A;  3GTJ J;  1VND A;  1JT6 A;  2GBY A;  5M5X J;  1DU6 A;  5FKO A;  1HF0 A;  3S1Q J;  1FIA A;  5IOY A;  1TWF J;  4M3F A;  3ZQH A;  3PO3 J;  1ETK A;  3GTK J;  3SJM A;  3O8G A;  3CQZ J;  2JN6 A;  3GTM J;  2XPU A;  4BBS J;  2HYJ A;  3JRI A;  2L7Z A;  2P81 A;  5E3O A;  4DZP A;  1K61 A;  2FQ4 A;  3A03 A;  3TP3 A;  3BG5 A;  2DMT A;  2DJN A;  2R5Y A;  2Y0S N;  2K9S A;  3LOC A;  2R93 J;  1ETX A;  2EH3 A;  1JKO C;  1TWC J;  5C4X J;  2Y9Z A;  4IEJ A;  3WHC A;  2DMN A;  1XG1 A;  3ZQF A;  2CU7 A;  3BTI A;  1RES A;  1XC5 A;  2XGE A;  2NS7 A;  3DCF A;  2VUM J;  1JTY A;  1ETO A;  3FK6 A;  2DA2 A;  4Y52 J;  2YS9 A;  4D7M A;  1ETW A;  1HOM A;  2DTZ A;  5F1J A;  3JRC A;  1JT0 A;  2GM4 A;  1RKW A;  2ECC A;  4JX4 A;  2R0Q C;  1AHD P;  2IBD A;  4IHX A;  1HDP A;  2JJ7 A;  3H0G J;  4A3E J;  1GV5 A;  3G1L A;  3Q0U A;  1GUU A;  4RDU A;  1MH3 A;  1Y1W J;  1ZQ3 P;  4A3M J;  5IYB J;  1SAN A;  3C2B A;  5DS9 A;  1SFO J;  1QVU A;  4QSH A;  3HB9 A;  5K7Z A;  4ABZ A;  3HOZ J;  1BW6 A;  1Z0X A;  3LSP A;  5FLM J;  2YUS A;  3BQY A;  3SFI A;  4LOC A;  2KDZ A;  4UUS A;  1ETQ A;  4D5C A;  1OCT C;  1MBH A;  3HOU J;  1U8B A;  2O9L A;  1OFC X;  3BR6 A;  3BR2 A;  3K7A J;  2ELK A;  3B6A A;  2HQ5 A;  2PMZ N;  2XGD A;  5K7H A;  3FIS A;  2FX0 A;  5M5W J;  2TRT A;  3HOW J;  3QQA A;  1B72 B;  2LK2 A;  2HOS A;  1YRN A;  1APL C;  1S7E A;  2DA7 A;  4G12 A;  3MN2 A;  3GTP J;  1ETV A;  1P7I A;  5FKN A;  3H3V K;  4FE7 A;  5DTD A;  4D7N A;  2FJ1 A;  4C3I J;  3RKQ A;  2EZI A;  2EBI A;  4CYC B;  3JRE A;  1K83 J;  3RQI A;  2E2H J;  2MW8 A;  2GLO A;  4MFE A;  2MSY A;  2LD5 A;  5JLX A;  1O4X A;  2K9N A;  5FKL A;  1QVT A;  1IJW C;  2LY9 A;  3DEW A;  1IGN A;  2L0K A;  2XGC A;  3Q0V A;  4W1U A;  3WHB A;  2LTP A;  3GBG A;  5GPA A;  5M3M J;  1T33 A;  5EG0 B;  1H8A C;  4HNV A;  2LP0 A;  3B6C A;  4XIC A;  2E19 A;  1ZKG A;  3IV5 A;  2OPT A;  3OOU A;  2EZH A;  1FEX A;  3QPS A;  3JRB A;  2CQX A;  2WAQ N;  3BR3 A;  1ITY A;  4M3B A; 
#chains in the Genus database with same CATH topology
 1LVK A;  3L09 A;  1H88 C;  3PNV A;  2M8G X;  2M3A A;  3F23 A;  1JHF A;  3IUO A;  2IVM A;  3WOD F;  1JKQ C;  2VJI A;  3S93 A;  4HG2 A;  2Y69 H;  1TT5 B;  4CSW A;  2JK3 A;  4L9V A;  1DPR A;  3FZV A;  1E17 A;  2OZU A;  5J4V A;  4XRM A;  2HOA A;  4N9I A;  3F9K A;  2PX9 A;  3W2V A;  2DJI A;  1XGS A;  2LBF A;  1MBF A;  5HS7 A;  2IW5 A;  4B1R A;  2O3F A;  4EM2 A;  3E6C C;  1J5Y A;  5GAD J;  3OR2 C;  3OYB A;  1IRX A;  1U5T A;  2Z2S B;  3KP7 A;  3ZGK A;  1OQY A;  3EUH C;  1QZY A;  3V4G A;  3WG7 H;  2DOE A;  3W2A A;  2X6W A;  4IF4 A;  1MKM A;  2ZJQ F;  3G4S I;  2PLY A;  2MBF A;  1D3Y A;  3A02 A;  5DCF A;  4B47 A;  3AG3 H;  3CJT B;  3DFG A;  3HM5 A;  3TO9 A;  3LNQ A;  1B59 A;  1V5G A;  2A5W A;  3ZN0 A;  4GYG A;  3D0S A;  2KKO A;  3FXJ A;  3ZQQ A;  1WGX A;  3WGI A;  2X1D A;  3GLX A;  4I01 A;  1D1B A;  4B4C A;  2EK5 A;  1NHA A;  1O3Q A;  1BR4 A;  3DXJ F;  5IT3 A;  1IDY A;  2FXA A;  1TQM A;  2EV5 A;  3D5L A;  2DQR A;  3KEY A;  4M74 A;  1ZH5 A;  1FZP B;  3MZY A;  4E7J A;  1FP1 D;  3KIO A;  3BDD A;  3CJN A;  4N9H A;  5E3N A;  2MD0 A;  2NS8 A;  1G3Y A;  4I76 A;  3PFY A;  1XSD A;  4AWX B;  2QZ8 A;  2LMD A;  5F0H A;  3OYC A;  1PVE A;  5GPC A;  1LB2 A;  5D5V B;  4A3L J;  4E7S A;  4RAF A;  4II2 A;  4LFU A;  1TT0 A;  1Z05 A;  4ZTF A;  2WAQ A;  3S16 J;  2FNA A;  4MTE A;  3NEU A;  2CW7 A;  3F8F A;  2N8G A;  1TC3 C;  4DYC A;  3W3C A;  3BTJ A;  3C2H A;  2CFX A;  5KCM A;  4MO7 A;  2JT1 A;  3ASO H;  5E1Z B;  4IJA A;  5BMZ A;  2IGK A;  3ML6 A;  2VQH A;  5EGO B;  1LDJ A;  5IP9 J;  5ED4 A;  4BXX J;  2Y75 A;  3PQK A;  3K2Z A;  4XNF A;  1JGG A;  2I5U A;  2Y0S A;  2QA4 I;  3MKY B;  1FOK A;  3FIW A;  1NTC A;  2BVL A;  2JWT A;  2Q8K A;  1T2K A;  5EEA A;  3DPL C;  1S7A A;  1TNS A;  1D5Y A;  3EUA A;  3HPH A;  2OA4 A;  4UVC A;  3BPX A;  3MFK A;  3MZ8 A;  4ANJ A;  2A05 A;  1W0T A;  2V9K A;  1MNM C;  1RPW A;  3HHH A;  2VBZ A;  4I0A A;  4K2E A;  4BQN A;  2DA6 A;  4UV9 A;  1NK3 P;  1YFH A;  2H1K A;  2E5N A;  2JPC A;  4OMY A;  4Y33 A;  1R5G A;  5K5O A;  3BCA A;  2MG4 A;  1EV7 A;  4DQ2 A;  1UHW A;  3EQL F;  3VYT B;  2PJP A;  1UZC A;  1ZN2 A;  1YIT I;  3A1Y A;  3PNT A;  4JP0 A;  4CCO A;  2E2J J;  2BYV E;  2IS2 A;  3HKZ N;  1O57 A;  4CO8 A;  4CCM A;  1KZH A;  3HOV J;  3FM5 A;  5GTI C;  1JJ8 C;  1FJL A;  5J47 A;  1IN6 A;  3T5X A;  1G3S A;  1MMG A;  2JVG A;  4XQF A;  5FLX Z;  4L0Y B;  3H3U A;  2V1U A;  1SAX A;  2LSO A;  3SXY A;  3BLY A;  4XOR A;  1FOY A;  2QQ9 A;  1ZAR A;  5BNG A;  4E7Z A;  1TP4 A;  3HXL A;  3P9K A;  4U7B A;  4BKX A;  2MYS A;  3DKW A;  1ON2 A;  2KHM A;  2MGQ A;  3ZMU A;  4ZJZ A;  2AHQ A;  2Y9Y A;  3C18 A;  4BGD A;  4Y7N J;  1YS6 A;  2DN0 A;  1WI3 A;  2IXS A;  5C3E J;  2X6X A;  4S05 A;  2J5P A;  1FBQ A;  1QO0 D;  2LF7 A;  2XB5 A;  3E7L A;  2PMZ A;  5LEJ A;  1JUP A;  2RC4 A;  1B9M A;  2E7X A;  3P9I A;  2F5D A;  3DBR B;  4KIF A;  4Q4Z F;  2C6Y A;  5HOO A;  4MHG A;  3BY6 A;  3KP2 A;  2WAD A;  3G71 I;  3ABM H;  2MLG A;  2VKD A;  2B63 J;  5LRS A;  2VQG A;  2WY7 Q;  3CC4 I;  2ACJ A;  3MVP A;  4XKV A;  4UVA A;  5EDN A;  4JX5 A;  4LG0 A;  1B8I B;  1AU7 A;  2KRF A;  2VC1 A;  5ILV A;  5EGO A;  4WXH A;  1D5V A;  3F0C A;  2VQC A;  4DOZ A;  1J7K A;  4RAG A;  4XID A;  5H6R A;  2ZXW H;  4KYW A;  4KMU X;  1UG2 A;  1F5T A;  4BJT A;  2LF8 A;  4WXD A;  2HYF A;  2JMW A;  3JRH A;  3HSR A;  3EET A;  3LSG A;  4M72 A;  1WFX A;  1OYW A;  4P55 A;  4KDP A;  2QSG X;  4HAM A;  2DI3 A;  4XRF A;  2EFN A;  1XB4 A;  2K3P A;  3K2A A;  5F64 A;  4AVP A;  4BAC A;  1D0Y A;  1BOA A;  4EM1 A;  5D5X B;  2XF7 A;  5HS9 A;  1EF4 A;  2HPI A;  2CUF A;  3I4M J;  2VI6 A;  1D0Z A;  2XPV A;  3FXR A;  2KIM A;  2JA8 J;  5L3D A;  4CXF A;  5EG0 A;  4BXF A;  2KZG A;  1MBJ A;  5FGM A;  4M73 A;  2CMP A;  2M4K A;  2XGX A;  2M4G A;  4I99 C;  3FXU A;  3IKV A;  9ANT A;  1K7A A;  2P8T A;  1BI3 A;  3L1P A;  3K1P A;  3MEX A;  4NQW A;  4XLN F;  1R36 A;  4RS8 A;  1Y0U A;  1S6L A;  3SDG A;  1VFC A;  4PGG A;  5EEG A;  4R79 A;  2XSD C;  3OL4 A;  3PSI A;  2LY1 A;  3FXM A;  2XSJ C;  2Y31 A;  3DEE A;  3VYU B;  2HXO A;  3R0A A;  4BJ6 C;  1X3U A;  4CZC A;  2F4I A;  3FXO A;  4EQQ A;  1Z9C A;  2MD5 A;  4RA2 A;  1YI2 I;  3L2V A;  2X1C A;  4XM3 A;  1IN5 A;  3WTU C;  2B7E A;  3TW7 A;  2IP2 A;  2KFD A;  2XC7 A;  2OUM A;  1QPI A;  2EV6 A;  4XN3 A;  2H6B A;  2DO7 A;  2M0C A;  2NXN B;  1ZR2 A;  2HI3 A;  1XGN A;  4G6D A;  1OKR A;  1R7J A;  4RLF A;  5HOD A;  1LE8 A;  5K5R A;  1D8J A;  2JQ7 A;  4BDZ A;  1T39 A;  3V7C A;  2Q2E A;  2QKL B;  1G3T A;  1U9O A;  1MSF C;  1VQL I;  2XAS A;  2QSH X;  2HQA A;  2MH9 A;  2B9S A;  4LK0 F;  1UG0 A;  3OYH A;  3OYM A;  4PSX A;  4WK8 F;  4BJ5 C;  4XKB A;  1O3T A;  2EPF A;  4A0Y A;  4KIS A;  1A5J A;  2FML A;  2ADU A;  1ETY A;  4XLF A;  3OV8 A;  3OSG A;  2DU9 A;  4IQJ A;  1VF9 A;  4HX4 A;  2ZBK A;  3H5A A;  3NRV A;  1TW3 A;  4YFN F;  1QRY A;  1B8I A;  3WTW C;  2CJJ A;  2OCC H;  4IRI A;  2CQN A;  1OCP A;  1EJ9 A;  3V8K A;  3LQQ A;  4AYB N;  1O7L A;  3VYR B;  2W4S A;  2JRT A;  1VND A;  1RR8 C;  1P4W A;  1DU6 A;  3AG2 H;  4I7H A;  1HF0 A;  4L5J A;  3CCL I;  1IAW A;  3MAJ A;  1U0J A;  4RLQ A;  2O8X A;  4F91 B;  1YX5 A;  2ZO4 A;  4RMN A;  4ZZL A;  1XCB A;  3PFI A;  5FB2 A;  3GTK J;  4IRG A;  1U5T C;  5CQG A;  1X3Z B;  5AIQ A;  3OY9 A;  2E1M B;  4BU2 A;  2LKS A;  2HYJ A;  1GVJ A;  2L7Z A;  5TJJ A;  2P81 A;  5E3O A;  3F6V A;  3WG9 A;  3K69 A;  3A03 A;  2HPM A;  5TRD A;  4HQM A;  2PJR B;  2K9S A;  2R93 J;  2EH3 A;  3F3X A;  5C4X J;  3C2G A;  4BQO A;  2Y9Z A;  1LEA A;  1BI1 A;  4U87 A;  3K9T A;  4XLH A;  2STT A;  3QPH A;  2V1X A;  3L2R A;  3KE2 A;  1JE8 A;  4A6D A;  3I9V 2;  3DF8 A;  2LOO A;  2MC3 A;  1XPX A;  1VQN I;  2EIN H;  4UB6 C;  4PCQ A;  3ZR8 X;  2XRN A;  3LQR A;  2JTV A;  3CLQ A;  3FK6 A;  4B3X A;  2M87 A;  4Y52 J;  2P5V A;  4YIR X;  1HOM A;  2RDP A;  2JRM A;  4A6E A;  3NWT A;  1W5C C;  2R0Q C;  4IHX A;  4BQA A;  2JJ7 A;  3KZY A;  1IO2 A;  4YEL A;  3BWG A;  4XON A;  3ISP A;  3JCU C;  2E1C A;  2A3S A;  3G1L A;  2WY8 Q;  2QQB A;  4A3M J;  1YJ9 I;  3C2B A;  2OJE D;  4MQV A;  5JHF A;  1SFO J;  1IV8 A;  1ZLK A;  4HV6 A;  1L0O C;  4QSH A;  1O7F A;  1Y8R B;  3PQJ A;  4F7Z A;  1I1S A;  3DV8 A;  4XL9 A;  2OTJ I;  3OIP A;  5FLM J;  4AD9 A;  2KRH A;  2QKM B;  3SFI A;  3IWZ A;  4PZJ A;  3O6B B;  1W7P D;  2KDZ A;  1ETQ A;  4YFX F;  1OCT C;  4G7Z F;  3GFL A;  4ESJ A;  2ELK A;  2HU9 A;  4I0B A;  2HQ5 A;  2XF5 A;  3VOE A;  1LPQ A;  2XGD A;  1Z6R A;  1UEL B;  2X85 A;  4Y13 A;  2FX0 A;  4BHB A;  4EMS A;  3CP8 A;  3HOW J;  1B72 B;  2BXZ A;  3LMM A;  2LK2 A;  3CMM A;  4O6J A;  1VQ9 I;  2H27 A;  1MGT A;  1O3R A;  4RGR A;  5B5E C;  1S7E A;  2K27 A;  1ETV A;  3SHF A;  3MMY B;  3TGN A;  1HST A;  2IPQ X;  4ENM A;  1MJ9 A;  3HYI A;  1OCR H;  4F3Q A;  4E7H A;  2PMH A;  4C3I J;  3RKQ A;  1ERD A;  3ZN1 A;  1XMX A;  4GCV A;  4LIT A;  3RQI A;  1ZG5 A;  2MW8 A;  1S5L C;  2FSW A;  2KIQ A;  1WKM A;  2GLO A;  3V42 A;  3CME I;  2PQ8 A;  2K9N A;  1MDM B;  2LY9 A;  2L0K A;  4WF2 A;  1VQ7 I;  4AVZ A;  1KU9 A;  3JAM Z;  1Z1D A;  2LTP A;  3K4K A;  5GPA A;  3RI4 A;  5M3M J;  4C2U A;  3PUB A;  4IHS A;  2HFH A;  1H9G A;  2HDC A;  2YSR A;  4CCN A;  1DPU A;  2DPU A;  2L4A A;  1E0E A;  2EZH A;  5J4Y A;  1K79 A;  3F8M A;  1BOB A;  4C2T A;  2R7X A;  1WHU A;  2E71 A;  1BN5 A;  3GW2 A;  2VJ4 A;  2EB7 A;  4J19 A;  1BC8 C;  2YPR A;  1Z7U A;  2W57 A;  3HUG B;  1X2M A;  3M8E A;  4PFO A;  2BY0 A;  2RVC A;  4BH9 A;  3DPU A;  3H35 A;  3WGH A;  1IDZ A;  2HOT A;  2BGC A;  1E3H A;  1K6Y A;  1SVM A;  1Q1V A;  5CVJ A;  1GXQ A;  4HF0 A;  2JVH A;  3QPL A;  3HHG A;  3K1M A;  5E3L A;  3BJ6 A;  3A2K A;  4HZF A;  1X2N A;  3FMR A;  1W7P B;  3QOE A;  1AKH B;  4HDV A;  4LB5 A;  4LGW A;  5LGU A;  1DU0 A;  2CQK A;  2QGU A;  3OWT A;  4ITV A;  4PJL A;  1W36 D;  4MEX F;  2VOP A;  3ELK A;  2R7U A;  3HGY A;  1WRJ A;  2MLK A;  3QAH A;  5LRR A;  5HS8 A;  1E3O C;  2X9D A;  2FRH A;  4DYR A;  3K0L A;  4LLN A;  1TWA J;  2WB1 A;  3S14 J;  4D1Q A;  2ZXH A;  1FP2 A;  2K86 A;  4ETS A;  1QU3 A;  2GOX B;  5LBQ A;  1QBJ A;  2LY2 A;  1CF7 B;  1HQC A;  3SQN A;  4E7L A;  4R1H A;  4M6X A;  1PUF B;  2EV0 A;  1V55 H;  3SZP A;  3OYL A;  4E70 A;  3BG9 A;  1T8I A;  2CQQ A;  1P7J A;  3KLO A;  1IRG A;  4RM2 A;  2LNB A;  2CW0 F;  4BBR J;  4KUM A;  4I09 A;  5BS6 A;  4M3D A;  3R6S A;  2X6O A;  1MSE C;  3U2R A;  2ZFU A;  1ON1 A;  1YOV B;  2K7L A;  4UV8 A;  4CCJ A;  4XOP A;  2K85 A;  3IH4 A;  2LLK A;  1QGP A;  2W48 A;  3FKI J;  4XMY A;  2X48 A;  2FE3 A;  2QBY B;  2R4G A;  5D5W B;  2DA4 A;  2OF7 A;  5GTH C;  4JBA A;  2R7Q A;  2EIJ H;  2HQR A;  3NWS A;  1A35 A;  3DQV C;  3E97 A;  4ENJ A;  3H92 A;  4O3M A;  1R4N B;  4A12 A;  2XHK A;  2DT7 B;  2W25 A;  3CZ6 A;  2AS5 F;  3AL0 C;  3UR3 C;  1E2X A;  1BI0 A;  4BY1 J;  3GZ6 A;  2H8R A;  3W2W A;  2A5Y B;  3BG3 A;  4Q48 A;  1I5Z A;  1GDT A;  1FC3 A;  3TO6 A;  3CCY A;  3K70 D;  1RIO H;  4U7D A;  4ZYG A;  3E1S A;  2L54 A;  4FTH A;  3FXQ A;  1ZG3 A;  4W97 A;  4EJW A;  1PP8 F;  5ILU A;  4HA8 A;  3OS1 A;  3OYA A;  2Y48 A;  2L9V A;  2IAI A;  2K4J A;  2HDD A;  1XSX A;  3JAM K;  3S15 J;  2IS1 A;  3GTL J;  4E6K G;  4FE4 A;  2NNY A;  5KK1 A;  3LL7 A;  3E0J B;  3PL8 A;  2VL8 A;  4M6Y A;  5HLG A;  1IUF A;  2VLA A;  2RAE A;  4BY7 J;  1ZR4 A;  4NDL A;  2FBK A;  4H4K C;  3NAR A;  1CQT A;  2O03 A;  5DD4 A;  2CRG A;  4C2M J;  2Z1D A;  3M8F A;  4RAY A;  3MCZ A;  3LSK A;  1LDD A;  4ZC3 A;  3G73 A;  2LDU A;  4CCK A;  1EH6 A;  4A3C J;  2VXD A;  1I3A A;  3ZQL A;  2CG4 A;  4IO9 F;  5FLV A;  3OYJ A;  1R1T A;  4GRI A;  4GGG A;  4KT5 C;  2DW4 A;  2EFP A;  1R23 A;  2DBB A;  2ZB9 A;  4BEH A;  2LKX A;  1JGS A;  2NS0 A;  4O5V A;  4ZYH A;  3IRR A;  1TLH B;  1Y8Q B;  4EJU A;  4CHU A;  5HLH A;  1LKX A;  5E17 F;  1UFM A;  4XN0 A;  3H0D A;  1U2W A;  5F27 A;  3N97 A;  5FFZ A;  1R9T J;  1XGM A;  2PFB A;  1WJD A;  1G8X A;  3E5U A;  3CUQ A;  1MBE A;  2DMQ A;  1V54 H;  3JSP A;  3E6M A;  3BOQ A;  4V2F A;  1IZ1 A;  4BUP A;  2AXT C;  4OAZ A;  3PJR A;  1LUJ B;  3VSK A;  1JKP C;  4A3B J;  2Y2Z A;  3EUK L;  1XMK A;  3A01 B;  1SEU A;  1JUM A;  1X58 A;  1Z77 A;  4A3D J;  3JW4 A;  1YE9 A;  2P6S A;  1D8K A;  2ETH A;  3JRF A;  2P4W A;  2E5Z A;  3KFW X;  3F8B A;  1SVO A;  3TOB A;  2VKE A;  3CUO A;  4CZZ A;  4GDF A;  2LRE A;  3MQ0 A;  3S2H J;  2V9P A;  3KLN A;  2JSP A;  1VQP I;  3BP8 A;  3QP6 A;  1S9H A;  2K40 A;  3SZG A;  1I6H J;  2EIM H;  4MGR A;  5CVI A;  4DJA A;  3C7J A;  2BY1 A;  4FCY A;  3S17 J;  3L9F A;  2QM3 A;  2TDX A;  4HOB A;  2AO9 A;  2P7V B;  1VQM I;  2DA3 A;  2HR3 A;  3L2W A;  3O2P E;  1LNW A;  2ME6 A;  2CYY A;  2LYC A;  1Z6T A;  4WXC A;  2EA2 A;  3FHN A;  3QU6 A;  3FBN B;  3CJR B;  2EA4 A;  4IZZ A;  1BM9 A;  1WI9 A;  2NVQ J;  2Z3Y A;  4YRV A;  3I56 I;  1F4K A;  2VQL A;  1DDN A;  3ZQG A;  5LD2 C;  4CYC A;  2QUF A;  4OWR B;  3RCO A;  1P6R A;  1AWC A;  2PI0 A;  3M1E A;  4N4N B;  2BV6 A;  4JYK A;  3VSL A;  2UWM A;  1FMW A;  3OIQ A;  4A2U A;  1KU7 A;  1UHS A;  3G1O A;  3PUF A;  5E8I A;  1DGW Y;  5JVT A;  3CF5 F;  4A3I J;  1XTA A;  3A0B C;  2QWW A;  3GZ5 A;  3L7W A;  4Y15 A;  4BQQ A;  1K78 B;  5F0F A;  5E8G A;  2MA3 A;  1FPQ A;  3V7R A;  2F2E A;  2B0L A;  4BXU A;  4FX0 A;  5J6X A;  3K4N A;  1F43 A;  2ZME A;  2COB A;  3V8L A;  4AID A;  3KZZ A;  2DTR A;  3H1C A;  5F08 A;  3T0Y A;  2X6Y A;  4C3H J;  5FO5 A;  2O8K A;  4HLX A;  3DLA A;  2ID3 A;  4M3G A;  5LEK A;  5HDN A;  1DP7 P;  1BJA A;  2E35 A;  2A6T A;  5ERI A;  1OMI A;  4RB1 A;  4XSZ F;  2G0E A;  3CCU I;  4HDU A;  1K4S A;  5C4J J;  5HDG A;  4LIV A;  5B3S H;  3AAF A;  2IA2 A;  3ERE D;  2VJ5 A;  4DBQ A;  1YIJ I;  1HKT A;  1TQI A;  1I50 J;  4XOT A;  4MQ9 F;  2FEZ A;  2V4J C;  2PN6 A;  2E36 A;  2L9R A;  1X4O A;  4B3A A;  3IAM 2;  3A01 A;  1T56 A;  5CVV A;  2R5Z B;  2L7F P;  3CC7 I;  1GV2 A;  4HX7 A;  3M4O J;  2UXX A;  4DNC A;  2FBI A;  3LSJ A;  1TNT A;  3L2U A;  1G6N A;  2FQ3 A;  3OYF A;  1FIP A;  1A6Q A;  3I59 B;  1K4T A;  4KNY A;  3KEO A;  2M9H A;  5D8K B;  5J1Y A;  3I55 I;  1RRJ A;  2JA5 J;  1X1C A;  4GO1 A;  3HDD A;  1R00 A;  2VOO A;  2NYX A;  4NC8 A;  1MMD A;  3RTR A;  1IUY A;  2IJL A;  1WH5 A;  5JLW A;  1SC7 A;  4JX6 A;  2G7U A;  3VOD A;  2QYO A;  3HOX J;  2NOG A;  3SZT A;  3HJE A;  3D5S C;  5BPD A;  2RQP A;  3TDZ C;  2CH0 A;  5BPI A;  4XLE A;  2VT2 A;  3GZN B;  4C9Y A;  2QQA A;  2HEO A;  1MBK A;  4E7I A;  1WJ5 A;  2DAO A;  1T0F A;  2XV4 S;  3PNY A;  5M5X J;  2F5F A;  2HGC A;  2RQQ A;  3DTK A;  5FD5 A;  3S1Q J;  1SAU A;  1V3F A;  2A69 F;  1XMA A;  4I2O A;  1BBY A;  4M3F A;  3PO3 J;  4L9N A;  2W84 A;  1ETK A;  4OOI A;  4PSW A;  1SD5 A;  3HG9 A;  3CQZ J;  1FBU A;  4ESF A;  3GTM J;  4BBS J;  1T38 A;  1WJE A;  1XSV A;  2W00 A;  1SMY F;  1BR1 A;  1GLN A;  2RNJ A;  4Y4R A;  2F6C A;  1X1A A;  3RKW A;  1ZRD A;  1SMT A;  3K4J A;  1BC7 C;  4MTD A;  4PFP A;  3BG5 A;  4OU0 A;  2Y0S N;  4YG2 F;  1ETX A;  1IXS B;  3FMS A;  1TWC J;  1SD6 A;  1VTN C;  5FD6 A;  1MW7 A;  4NHJ A;  3IKT A;  3DU6 A;  2M7A A;  2DMN A;  1XG1 A;  3K4M A;  3LWF A;  2CU7 A;  1YJN I;  1RES A;  1QZZ A;  1XC5 A;  2XGE A;  2YX4 A;  2NS7 A;  1U8R A;  5AIP A;  5ICE A;  3GO5 A;  1JTY A;  2NVU B;  2W85 A;  3CD6 I;  3GVA A;  3LAJ A;  3N05 A;  1KON A;  2DA2 A;  3AFH A;  2MH2 A;  4B48 A;  1OCZ H;  4FHT A;  4ZDL A;  5D4S A;  5HDK A;  2R7V A;  2DCE A;  2M0M A;  3HRS A;  2R7W A;  4XBF A;  4IX7 A;  3R61 A;  1ZG1 A;  4IKF A;  2OQR A;  5EJC A;  1J59 A;  1IN7 A;  2M45 A;  3JRC A;  4HX8 A;  2GM4 A;  1WVR A;  2ECC A;  1XCV A;  2HVS A;  1KQ0 A;  4PJM A;  2W7N A;  4L5I A;  1N25 A;  2X1E A;  2RNG A;  1NG6 A;  4A3E J;  2VN2 A;  1SAN A;  3R0J A;  5DYM A;  4G94 A;  5ICF A;  2L9S A;  1QVU A;  3HB9 A;  2F4M B;  3I59 A;  4ABZ A;  5K7Z A;  2BHY A;  4P9F A;  3GUD A;  1Z0X A;  1DGR M;  1X19 A;  1T95 A;  3PIO F;  2UUZ A;  2V1N A;  1WJA A;  2ZJP F;  3WU1 B;  2IS6 A;  2HOE A;  2K9L A;  2XAF A;  3RPU D;  1MBH A;  3QPT A;  3CCJ I;  2DLL A;  4XKW A;  3AKZ A;  3BR2 A;  3J7Z I;  1N78 A;  2FA5 A;  3I5U A;  2IGM A;  3B6A A;  1R5I D;  2PMZ N;  3JSO A;  4LD5 A;  4P9U A;  5CKT A;  3N4M A;  2H1L A;  5M5W J;  3OYG A;  2CW8 A;  2EFW A;  3KP3 A;  3QQA A;  2F5V A;  2FU4 A;  2JSC A;  2HOS A;  1ONV A;  4B09 A;  2E34 A;  2OD5 A;  5FLX K;  1SVL A;  4LLL A;  4G6Q A;  1WJB A;  1P2F A;  1PDN C;  2Q0O A;  4AIJ A;  3HOT A;  3H3V K;  4FE7 A;  3GFM A;  4LIU A;  1SD4 A;  2XIG A;  5DTD A;  3GX4 X;  2A61 A;  2FJ1 A;  2KPM A;  2EZI A;  5JR3 A;  2EBI A;  1K83 J;  1RZ4 A;  1R6R A;  4MFE A;  1FWZ A;  5JLX A;  3RIR A;  5FKL A;  1Z3X A;  3DEW A;  1IGN A;  3Q0V A;  1FYL A;  3CLO A;  3F22 A;  2CS3 A;  3Q5F A;  4ENN A;  3U1D A;  3OL3 A;  3KYL A;  4E7K A;  3S3O A;  4HNV A;  2E19 A;  4OMZ A;  4KA4 A;  2V79 A;  2IA1 A;  1FSH A;  3QPS A;  3FHZ A;  1R4M B;  2XVC A;  2VC0 A;  3ESW B;  3BR3 A;  3M7G A;  4ZDP A;  3LA3 A;  2R7F A;  4KMF A;  4RBO A;  3VWB A;  1V5F A;  2XAU A;  2O7O A;  2GXB A;  1DQU A;  2XAH A;  1R58 A;  4HBL A;  4B43 A;  3I71 A;  2GA1 A;  2BZT A;  5FJ8 J;  1B6A A;  5FKM A;  2NNN A;  3D5R C;  1R71 A;  2CFO A;  2F5C A;  2ZNY A;  5C44 J;  3JRD A;  4L9J A;  1BJZ A;  2QQ8 A;  2OU2 A;  3O8H A;  4A3K J;  5FRN A;  1ACI A;  1HLV A;  5FFX A;  2EJR A;  5D8L B;  3C3W A;  2GOM A;  3IC7 A;  4UXN A;  1YW8 A;  2VT3 A;  1R5H A;  1ZHF A;  4ZYD A;  3I4N J;  2BBY A;  2P5K A;  2XRL A;  2KDO A;  1R1U A;  2OTL I;  4QPO A;  4XRS A;  2EQR A;  1KQ8 A;  5DEQ A;  3J7A O;  4XKC A;  1LFP A;  2F48 A;  3QP5 A;  5IY5 H;  2Z5U A;  4OAY A;  3ULQ B;  4EJT A;  4WCG A;  2BY3 A;  2KL4 A;  1BI2 A;  5B1B H;  4HLY A;  4HPQ A;  2IEK A;  3I0T A;  2VE9 A;  5H20 A;  4AUX A;  3ZQC A;  3QYB A;  3CCE I;  2K9M A;  4KN4 X;  1ENH A;  3FBI B;  4XK4 A;  3RKY A;  1ZRF A;  3FKJ A;  2O61 A;  2MFZ A;  5DUK A;  3HC7 A;  4RB2 C;  2JUC A;  3HTU A;  5J8F A;  2VKH A;  1P92 A;  2PEX A;  1SFE A;  4E4H A;  2JPB A;  1G59 A;  1KU3 A;  2D45 A;  1HDD C;  3HRT A;  1D1A A;  3WE2 A;  2R3S A;  1S8N A;  1Y39 A;  2XKO A;  2JA2 A;  1MNE A;  1HW5 A;  3S32 A;  4X6A J;  1XGO A;  1X1D A;  4IQ4 A;  5CLS A;  1NG7 A;  5L3G A;  3BZK A;  3QYF A;  3IRQ A;  4IOC F;  2CUJ A;  3ROU A;  3S2W A;  5GAH J;  3PM1 A;  1POG A;  1D1C A;  3WGG A;  3TBI A;  1G2H A;  1OIS A;  1P4X A;  3DBH B;  2BEO A;  5HNH A;  4X1E A;  2O0Y A;  3LFK A;  1S29 A;  2DA1 A;  4NC7 A;  2O5R A;  4DBR A;  3U21 A;  3JRG A;  1GT0 C;  1KA8 A;  1JUS A;  4J01 A;  2JA7 J;  3BC8 A;  4A93 J;  3H9G A;  3TW6 A;  2M34 A;  2ZKZ A;  4BYY A;  2K02 A;  4KIG A;  3RZO J;  3T8T A;  2HVR A;  2HQN A;  2WA0 A;  3OOP A;  1BA5 A;  2EFQ A;  3M1C A;  2PJR A;  5K7F A;  4EGZ A;  3BTC A;  5IP6 A;  1U6G A;  2ZNZ A;  1UAA A;  3BJA A;  3KYC B;  3UKG A;  5DCM B;  3PO2 J;  2HZT A;  3DP7 A;  3JRA A;  1VI0 A;  4BE2 A;  1OLT A;  3E6D A;  2Y30 A;  4FT8 A;  2DT5 A;  3B73 A;  3GFJ A;  2HNH A;  2KMU A;  3LST A;  1I3Q J;  2VAS A;  1FTZ A;  5DUI A;  1VQK I;  5TGT A;  2J5O A;  1T0F C;  4IOA F;  3KX2 A;  1YG2 A;  3BCB A;  4UVB A;  3ZRG A;  3J7A Y;  1I27 A;  5LFA A;  1X1B A;  2R7D A;  3NAU A;  1ZGW A;  4NB5 A;  2VJJ A;  2YU3 A;  2VPL A;  2OV7 A;  3OMY A;  1W0U A;  1OR7 A;  2IGN A;  4B44 A;  5A2Q Z;  2EFO A;  1EKE A;  1NH3 A;  4M3E A;  4N0B A;  3BR0 A;  1YRN B;  2CSO A;  1JHH A;  5EEH A;  3REO A;  2WV0 A;  1GXP A;  2XPW A;  3TED A;  4EM0 B;  2ISZ A;  2BE5 F;  1VQ6 I;  4M6V A;  2HXI A;  4DYQ A;  3HOY J;  1WSU A;  1CGP A;  4FAS D;  2OQG A;  1QQI A;  2VPR A;  1A31 A;  1ODD A;  4XR6 A;  2BY2 A;  2VKV A;  1AA7 A;  3NQO A;  3GEZ A;  1IW7 F;  2JZY A;  2KZV A;  4GXO A;  1QHH D;  4CA0 A;  3DLL F;  1YO5 C;  3R60 A;  3GTO J;  2D5V A;  1U9N A;  5BOX A;  1BW5 A;  1H89 C;  1B72 A;  3U1K A;  1K6O A;  5BQT A;  4EJV A;  1UCR A;  1YS7 A;  4CIC A;  5F0C A;  1T08 B;  3CO7 C;  2DMU A;  2G7H A;  3MZH A;  3OYN A;  3BZC A;  1ZK8 A;  4H0E A;  3W6V A;  1JTX A;  4OIQ F;  5D5U B;  2KQR A;  1XDU A;  2L5Q A;  3ABK H;  5JHU A;  2CQ7 A;  3ZP5 A;  2WWY A;  4WWC A;  1MDM A;  1RI7 A;  2LBF B;  3G6E I;  3Q3S A;  2XF6 A;  1BL0 A;  2NOJ B;  1KGS A;  2ZSH B;  1U5T B;  4BE1 A;  3HBL A;  1PUE E;  3SEZ A;  2TCT A;  1TW2 A;  2FMY A;  5DDG A;  4HW0 A;  3K1N A;  3Q9S A;  4UUV A;  3GLL A;  4EEF G;  3G2B A;  4G7O F;  1FT9 A;  4TV7 A;  3GFI A;  5JVG F;  1OCC H;  2Z99 A;  1ZRC A;  1KYW A;  2KIU A;  3ZQI A;  4IPA A;  3HUG A;  3DEU A;  1KU2 A;  1NK2 P;  2P0W A;  2EWN A;  2Y0M A;  1RC9 A;  3VPR A;  3ZXS A;  5TIS C;  2V6E A;  2E7W A;  2OCE A;  5D4R A;  1FX7 A;  4L0Z B;  2LVS A;  2QEN A;  2ZJ2 A;  3X2Q H;  4QWQ A;  2WB1 N;  5E20 A;  4KIC A;  1W7P A;  4P5O A;  4B8X A;  5DM6 F;  1UMQ A;  3S3M A;  1AKH A;  1QA6 A;  4YEJ A;  3LSH A;  1RR7 A;  3RPQ A;  2YU9 J;  1E3P A;  3GYH X;  1AOY A;  4HSR A;  1UST A;  2DK8 A;  2GXG A;  2HKO A;  4GFB A;  2H8W A;  4A3F J;  3F8N A;  4DIQ A;  1Z21 A;  2OZ6 A;  1TWG J;  5A2Q K;  5IYC J;  5FRM A;  1YIO A;  1Y56 A;  1KYZ A;  1XD7 A;  3S1R J;  1DP3 A;  4P96 A;  2FOK A;  3KPH A;  4M71 A;  4UUS B;  4QIW N;  3M8J A;  2LR8 A;  3OIO A;  4ON0 A;  2A07 F;  2EIK H;  3SYT A;  2LKP A;  2VIX A;  1CF7 A;  1OCO H;  1Q1H A;  1EH7 A;  3BT9 A;  3HRU A;  3CMA I;  1TWH J;  1PUF A;  1HXD A;  1S72 I;  2ZC2 A;  4XSX F;  3OSF A;  2GAU A;  3H5R A;  3DKX A;  4ZH4 F;  1XDS A;  3A4C A;  3TQN A;  1B1B A;  3TP0 A;  3ZMZ A;  3GTJ J;  4F52 A;  2Z33 A;  4OIN F;  3RKX A;  3KP6 A;  2X51 A;  2DDB A;  1WJF A;  5FKO A;  2H94 A;  3L00 A;  3CDH A;  4BS9 A;  5LHI A;  3K4B A;  3FWE A;  3ZQH A;  1X3W B;  1W5T A;  3OS0 A;  5E1X A;  2V7F A;  1WQ2 A;  2L2O A;  2QBY A;  2GZW A;  1TQP A;  2BOL A;  5L3E A;  2JN6 A;  1ZRE A;  2BW3 B;  4HYE A;  4RAZ A;  3WU2 C;  2OBP A;  3JRI A;  4DZP A;  1P9Q C;  1K61 A;  1WWX A;  3TKY A;  2DJN A;  4YFK F;  3EDP A;  2CV1 A;  4UHT A;  2VBW A;  4GYI A;  1YQA A;  2KLO A;  4G6T B;  1QHG A;  4IEJ A;  2ELH A;  2YR2 A;  4JK1 X;  3WHC A;  5F1R A;  3QU3 A;  4HF1 A;  2VBY A;  3BTI A;  2G9W A;  5L3B A;  3FF5 A;  4FX4 A;  3KYD B;  3HSF A;  2VB6 A;  3KEQ A;  2R7S A;  5J8C A;  3CCQ I;  3F21 A;  5ICG A;  1IF1 A;  1F1Z A;  2YS9 A;  4FQG A;  4U0Y A;  2XUB A;  1UB9 A;  3BJO A;  1ETW A;  2ZJR F;  1FMV A;  3DTI A;  5F1J A;  3DU5 A;  1JT0 A;  2I8D A;  1L3L A;  1RKW A;  1T6S A;  2F4O B;  4BL0 B;  5JFR A;  2QLZ A;  4L9T A;  2IBD A;  3HKZ A;  2M7B A;  3ZMT A;  4X0G A;  5HVQ C;  4JOM A;  4D9J A;  3HRM A;  4G7H F;  1MMS A;  4I02 A;  1MH3 A;  1Y1W J;  3P5J A;  3GCM A;  4S04 A;  5IYB J;  1RUN A;  1EH8 A;  5CQE A;  1J75 A;  1QPM A;  1SFK A;  4XLC A;  2P6T A;  2XKP A;  3KP5 A;  2ZFW A;  4LJZ F;  2WAE A;  1BW6 A;  5KHD A;  3LSP A;  2HDW A;  2JUG A;  1MJA A;  3AG4 H;  5H2F C;  2WC2 A;  2CUZ A;  2Q1Z B;  4UUS A;  3BPV A;  4NNJ A;  3HOU J;  3CES A;  3GXO A;  2KP6 A;  5KAI C;  4HQE A;  2DK5 A;  3K7A J;  1TL8 A;  4R8H A;  1VQ4 I;  3Q9V A;  4LG0 B;  2HTS A;  5K7H A;  2DOA A;  1V4R A;  4AIK A;  1VQ5 I;  2M30 A;  4PJN A;  1QNT A;  4RGU A;  4QPQ A;  1LVA A;  2E1M C;  3C1D A;  3KCC A;  3HL2 A;  2DT6 A;  1APL C;  5KNL A;  4N4O B;  2DPD A;  1F9N A;  2VBX A;  1LDK B;  5FKN A;  4Z2Y A;  1A36 A;  4BAY A;  1WJC A;  2BW3 A;  2L4M A;  2FNP A;  1SFU A;  4V19 K;  4Q47 A;  2L02 A;  3TO7 A;  2LD5 A;  1O4X A;  1QVT A;  2EIL H;  2XGC A;  1UHM A;  3F6O A;  3LSM A;  3LAP A;  1H9T A;  1S7O A;  2FUG 2;  2PBI A;  3GBG A;  2YX7 A;  2DFE A;  5EG0 B;  1MMN A;  2LP0 A;  3W6J B;  3B6C A;  4XIC A;  5FRO A;  3L2C A;  1DUX C;  2LRD A;  5CVR A;  1ZKG A;  4U88 A;  3IV5 A;  2OPT A;  1W5S A;  3OOU A;  4PUS A;  1R49 A;  1IXC A;  3JRB A;  1HW1 A;  4EVI A;  1OR7 C;  2CQX A;  4LLG F;  2WAQ N;  1FNN A;  4NQW B;  3AL0 B;  4LB6 B;  1FSE A;  2ESH A;  5LHH A;  3HOZ J;  3M3Y J;  4HNU A;  5HNF A;  2UZK A;  5IOZ A;  3WU0 A;  1U3E M;  4D5F A;  1PP7 U;  5EF6 A;  4EGY A;  4M9S A;  2X0L A;  1W4M A;  5FKK A;  1IG7 A;  4M9X A;  4BHC A;  1HW2 A;  1D0X A;  1RET A;  2GQQ A;  2AXL A;  3MKL A;  3HGG A;  2R92 J;  3OS2 A;  4UB8 C;  1G4D A;  2XB0 X;  2UV1 A;  3ABT A;  3CC2 I;  4YIF A;  5JI6 A;  2LG4 A;  1J9I A;  1IRZ A;  4L5E A;  5CVU A;  3ZOB A;  1FLI A;  3V8J A;  2V9V A;  4PJJ A;  3FDY A;  1VQO I;  3QYE A;  1FYM A;  1ZTR A;  2BHZ A;  3SFZ A;  1X1P A;  3FX3 A;  3J7Y J;  3KZI C;  1SD7 A;  2VOD A;  4PJ0 C;  3M07 A;  1K78 A;  1LE8 B;  4RM3 A;  2K9Q A;  3QWL A;  2D2W A;  3COA C;  2MAB A;  2Q2E B;  5K5Q A;  1YJW I;  3ZMV A;  1ZGJ A;  2HYG D;  5D6F A;  3VDX A;  2GA2 A;  4WX9 A;  3BTL A;  1TZL A;  5EYR A;  3IL2 A;  3K4C A;  3L2Q A;  3QRF F;  4FET A;  1M1E B;  2ZXI A;  3MKZ A;  4OIR F;  4LG3 A;  3QOP A;  5DV5 A;  4IHT A;  2HTJ A;  2RGV A;  3M9A A;  3FK7 A;  3JR9 A;  4C30 A;  2DXI A;  3J81 Z;  3RDI A;  3SDB A;  1MH4 A;  5HLI A;  3FXL A;  4EJO A;  2DFH A;  3IP4 B;  3MD2 A;  2FF4 A;  2V26 A;  3CJQ B;  5DM7 F;  1IRF A;  4D0P A;  4AU7 A;  1WCM J;  3I54 A;  2R5Z A;  1GHC A;  5D6E A;  3HPG A;  3VB2 A;  2RN7 A;  4UY8 I;  1R1V A;  4MIM A;  3ERM A;  4DW6 A;  4QLC U;  3ASN H;  5J1U A;  4BHP A;  4AYB A;  1HC8 A;  1ORK A;  3DBL B;  3I3L A;  2M8E A;  5F04 A;  3VFZ A;  2ELJ A;  2H09 A;  3CCV I;  2KRC A;  2PG4 A;  2WBM A;  3DPT A;  2R7R A;  2ZSI B;  2L9N A;  2VXZ A;  4OIP F;  1T98 A;  1WZ2 A;  5J40 A;  3CCS I;  5AON A;  3EPZ A;  2ESN A;  4G8X A;  1J2X A;  4MFD A;  2I10 A;  3S8P A;  3WTX C;  1OJL A;  3O3K A;  4XRS G;  5IT9 Z;  2L7M P;  4P1W A;  1B9N A;  2L01 A;  4A69 C;  1HKS A;  2LFB A;  2DMP A;  3TDU C;  3GTG J;  3HIF A;  1OYI A;  5EZG A;  2DYR H;  3GTQ J;  1HBX G;  1MBG A;  3DKY A;  2KT0 A;  3RYR A;  1Y1V J;  1BR2 A;  2XRO A;  3G1M A;  2MC4 A;  1Z3Y A;  1ULY A;  2ID6 A;  3Q0W A;  4A3J J;  4I6Z A;  4IL6 C;  1HCR A;  3ZMS A;  3FMQ A;  3RJP A;  1MMA A;  4ZYA A;  3V7S A;  3OYK A;  2R7T A;  4A0Z A;  4U0V A;  1BIA A;  1KQ9 A;  2V1D A;  4ESB A;  5LHG A;  5GP9 A;  3MKW B;  1VZ0 A;  1W1W E;  1IV6 A;  1MIJ A;  3IH3 A;  4QTR A;  3B02 A;  4FIS A;  3KET A;  3CUQ C;  5IYD J;  4CYD A;  2Z16 A;  2ME0 A;  2ISY A;  3I58 A;  5ILS A;  5B1A H;  5LGN A;  4BE0 A;  4Q5S F;  2HS5 A;  5HLT A;  3T8R A;  3BQZ A;  2V6C A;  1WH7 A;  4ZTJ A;  2D1H A;  2WTE A;  2WV1 A;  3E6B A;  1ZLJ A;  3I4P A;  3CDI A;  3P7N A;  4HV5 A;  2M1B A;  2CWE A;  2DA5 A;  4KT6 A;  5GAG J;  1RKT A;  1OYY A;  4IRH A;  1MZB A;  2E1N A;  1JJ6 C;  2IT0 A;  2XAJ A;  2STW A;  4IHV A;  3HTS B;  2W82 A;  2NVT J;  4KJZ A;  1F36 A;  1YLF A;  5E3M A;  2ECB A;  3U9G A;  1FY7 A;  1Z67 A;  1XS9 A;  3WTY C;  1FTT A;  2CUE A;  3WTV C;  4M9Z A;  3J81 K;  3LSR A;  2CV2 A;  3JTG A;  3ZQ7 A;  2CV0 A;  2W24 A;  5J3L A;  3BG7 A;  2ZXJ A;  3J80 Z;  3ECH A;  3IHU A;  3LSI A;  2XDV A;  5IP7 J;  1FOW A;  1Y6I A;  3I53 A;  3D1N I;  1N75 A;  1IC8 A;  1YW9 A;  5L3F A;  1ZAO A;  3EUH A;  3E3V A;  2GWR A;  5M3F J;  2DOD A;  1XN7 A;  2Z9O A;  5M5Y J;  1JXS A;  4CDG A;  1YTY A;  2M2E A;  4XLP F;  2H6C A;  3JTH A;  3H5N A;  1PYV A;  1JKR C;  1W36 C;  1U78 A;  4ENK A;  4EAT A;  3S2D J;  5LLQ A;  2QCO A;  5CYV A;  3UNG C;  4CCL A;  3OR1 C;  1RUO A;  3GF2 A;  5J1R A;  3TL4 X;  1Z91 A;  3VEP A;  4EV0 A;  1VQ8 I;  4UUT A;  3ECO A;  5IT9 K;  2A6E F;  3PIP F;  2EZL A;  3IH2 A;  4HRI A;  2E60 A;  6PAX A;  4IVN A;  2QEX I;  4CGZ A;  1FYK A;  2WAF A;  1GVD A;  3PSF A;  3R4K A;  2R5Y B;  1N77 A;  2ZME C;  3S1N J;  3G3Z A;  1J09 A;  2XAG A;  2R7Z J;  1WPK A;  3BR5 A;  4LMY A;  4C3J J;  5CJ9 A;  3RQ4 A;  2RKH A;  4HNT A;  4IHY A;  3DWL E;  3S1M J;  2RRE A;  4MLO A;  1A04 A;  2CGP A;  4PK4 A;  2JA6 J;  2DDA A;  2DFI A;  3I64 A;  2IRF G;  4YII A;  2GXA A;  4AC0 A;  1A6I A;  1XX5 A;  3T1B A;  4ZYE A;  4I98 B;  2A68 F;  2ICW G;  1IN4 A;  4HST A;  2FD5 A;  2EZK A;  5DD8 A;  1LFB A;  5EZH A;  3LFU A;  3AG1 H;  3DTE A;  3P9C A;  4F93 B;  2LC2 A;  3KP4 A;  1ZEL A;  1Z7L A;  2AQF A;  2DFF A;  3LA2 A;  3K70 C;  1LFU P;  2P5L C;  3CCR I;  1C0W A;  2CO5 A;  2NVY J;  1STZ A;  3RPU A;  2NRA C;  4S0H B;  1TTY A;  2QSF X;  2KJB A;  3F72 A;  3CP2 A;  1REP C;  4IHW A;  2E1O A;  2E2I J;  3F8C A;  3K6G A;  2FOW A;  4RGX A;  4ZZD A;  3RZD J;  2PMU A;  3BR1 A;  2VON A;  3HEF A;  2P7C B;  4BDY A;  3H9Q A;  2LH9 A;  4DZJ A;  3CDL A;  1J0R A;  4L18 B;  2F5E A;  4IXA A;  2HWV A;  4NBQ A;  4MNU A;  4HF2 A;  4V2G A;  5IPA A;  3CMY A;  1BIB A;  1UJ8 A;  3GME A;  1HSJ A;  1R22 A;  2W1O A;  1H0M A;  4II3 A;  3VYS B;  1S3J A;  2NVX J;  1SFX A;  2QF7 A;  1JT6 A;  1LQ1 A;  3J80 K;  3CTA A;  2GBY A;  1FOX A;  2X4H A;  1FIA A;  5IOY A;  5E79 C;  1TWF J;  2BVM A;  2L3D A;  3E5Q A;  2OC6 A;  3CF2 A;  3SJM A;  2D1V A;  3O8G A;  1V5E A;  2DOF A;  3H3Z A;  5KVR A;  2XPU A;  3HOS A;  1QZE A;  4HEA 2;  2FQ4 A;  3TP3 A;  4F55 A;  3BRO A;  3ZMD A;  2DMT A;  3LA7 A;  2R5Y A;  4OIO F;  3LOC A;  2GIV A;  2IA0 A;  1JKO C;  1O3S A;  3H36 A;  4RGS A;  4Y3O A;  3WE3 A;  4BNC A;  3TMO A;  1YX3 A;  1HKQ A;  4NC6 A;  2HZD A;  3ZQF A;  3W6K B;  3HZJ A;  4CH7 A;  1G3W A;  4AM3 A;  3ZCO A;  3DCF A;  4BEH B;  5H6Q A;  2UXN A;  2VUM J;  2O6G E;  1ETO A;  5B66 C;  2XAQ A;  1IN8 A;  3RYP A;  1I1G A;  1I6X A;  1LEB A;  4Y17 A;  1JI8 A;  4D7M A;  5CPR B;  2DTZ A;  2A6H F;  4JX4 A;  1AHD P;  5E1W A;  5KAF C;  1HDP A;  2HKX A;  3CUQ B;  3WTZ A;  3H0G J;  4ZDO A;  3EYY A;  3GWZ A;  1GV5 A;  3Q0U A;  1GUU A;  4RDU A;  2RV8 A;  2K4B A;  1ZQ3 P;  2DYS H;  5DCM A;  1ZYR F;  5DS9 A;  4UNO A;  4U0W A;  5F6F A;  4MEY F;  1YHQ I;  3CCM I;  2YUS A;  3SEQ A;  3BQY A;  3A0H C;  3FXK A;  4LK1 F;  4LOC A;  3S3N A;  2IGO A;  3ABU A;  4JQF A;  2AQE A;  4D5C A;  4PGH A;  5E18 F;  3WTT C;  4NUB A;  5LGT A;  1U8B A;  2O9L A;  1OFC X;  3BR6 A;  4A0X A;  1LJ9 A;  2NAZ A;  3K4L A;  3QOD A;  2DQL A;  4KFC A;  2KIS A;  3TOA A;  1YW7 A;  4F92 B;  3HSE A;  3OYE A;  3FIS A;  3RSN A;  4KIB A;  2L7K A;  4A5M A;  4AIH A;  2ZCW A;  2TRT A;  3ZPL A;  4PDK A;  5L3C A;  1RNL A;  4RB0 A;  3FM3 A;  1YRN A;  3EYI A;  3E5X A;  3ABL H;  2DA7 A;  2QVO A;  4G12 A;  2M5W A;  3H9J A;  4XLA A;  3MN2 A;  4ASN A;  3WTS C;  1MJB A;  2VE8 A;  4G9Y A;  3GTP J;  3BG6 A;  1P7I A;  4A5N A;  1PJR A;  2GIZ A;  4CUG A;  4KN7 X;  1I39 A;  4D7N A;  1USS A;  4Z6Y A;  5GAE J;  2HVQ A;  4CYC B;  3JRE A;  3OYI A;  2E2H J;  2KJC A;  2K5C A;  4RB3 C;  2FBH A;  4DGW B;  3IAS 2;  2OAZ A;  2MSY A;  1OPC A;  4J00 A;  3OYD A;  4A3G J;  1MD0 A;  1TBX A;  1IJW C;  2K3F A;  4W1U A;  3MWM A;  1HA8 A;  3WHB A;  1B4A A;  4KIT B;  5K1Y A;  3K10 A;  1YYV A;  2R7O A;  1T33 A;  5ICC A;  3IWF A;  1FBS A;  1H8A C;  2KIF A;  3BZ6 A;  2IS4 A;  1Y0N A;  1P4A A;  1ZGA A;  2COM A;  1X4P A;  1FEX A;  3CO6 C;  1EA3 A;  2ZME B;  1MND A;  2BXY A;  1IXR C;  3ONQ A;  1ITY A;  4M3B A; 
#chains in the Genus database with same CATH homology
 3M3Y J;  1H88 C;  5IOZ A;  4J19 A;  2M8G X;  4RBO A;  4D5F A;  5EF6 A;  2O7O A;  1JKQ C;  1X2M A;  5FKK A;  1IG7 A;  1RET A;  2JK3 A;  3MKL A;  3HGG A;  5FJ8 J;  2R92 J;  1IDZ A;  2HOT A;  5FKM A;  4XRM A;  2XB0 X;  2HOA A;  1Q1V A;  1IRZ A;  4L5E A;  5C44 J;  3JRD A;  3QPL A;  3ZOB A;  1MBF A;  1BJZ A;  4B1R A;  5E3L A;  3O8H A;  4A3K J;  1ZTR A;  1X2N A;  1HLV A;  1AKH B;  1DU0 A;  1LE8 B;  2K9Q A;  3HGY A;  3I4N J;  1E3O C;  3A02 A;  3BTL A;  2X9D A;  2XRL A;  4DYR A;  5EYR A;  1TWA J;  3HM5 A;  3S14 J;  3LNQ A;  4XRS A;  2EQR A;  1WGX A;  1PUF B;  3FK7 A;  3JR9 A;  4B4C A;  3BG9 A;  2CQQ A;  1P7J A;  1MH4 A;  4BBR J;  1IDY A;  2IEK A;  4M3D A;  2X6O A;  4AUX A;  3ZQC A;  1MSE C;  1ENH A;  4XK4 A;  1WCM J;  5E3N A;  2R5Z A;  2NS8 A;  4I76 A;  4MIM A;  3IH4 A;  2LLK A;  2W48 A;  4DW6 A;  3FKI J;  2X48 A;  5J1U A;  5F0H A;  5GPC A;  2DA4 A;  1ORK A;  2OF7 A;  1HDD C;  4A3L J;  5F04 A;  3S16 J;  4X6A J;  2N8G A;  1TC3 C;  4BY1 J;  4DYC A;  2H8R A;  3BTJ A;  3BG3 A;  3PM1 A;  1GDT A;  1POG A;  4MO7 A;  3CCY A;  4MFD A;  2I10 A;  1G2H A;  1OJL A;  4FTH A;  5EGO B;  4XRS G;  4X1E A;  2L7M P;  5IP9 J;  4A69 C;  4W97 A;  2LFB A;  4BXX J;  2DMP A;  2DA1 A;  1JGG A;  2IAI A;  3GTG J;  3JRG A;  5EZG A;  1GT0 C;  3GTQ J;  3FIW A;  2HDD A;  1MBG A;  1NTC A;  2JWT A;  2KT0 A;  1JUS A;  2JA7 J;  3S15 J;  3GTL J;  4FE4 A;  1Y1V J;  3TW6 A;  4A93 J;  5EEA A;  3G1M A;  2M34 A;  1IUF A;  2ID6 A;  2RAE A;  3Q0W A;  4BY7 J;  1D5Y A;  1ZR4 A;  4NDL A;  4A3J J;  1CQT A;  3NAR A;  4I6Z A;  3RZO J;  1HCR A;  1W0T A;  2CRG A;  4C2M J;  1RPW A;  1MNM C;  1BA5 A;  5K7F A;  3BTC A;  5IP6 A;  2DA6 A;  1NK3 P;  4A3C J;  3ZQL A;  2H1K A;  3UKG A;  5FLV A;  3PO2 J;  5GP9 A;  2MG4 A;  3JRA A;  1VI0 A;  1IV6 A;  2Y30 A;  4JP0 A;  3IH3 A;  2E2J J;  2ZB9 A;  4QTR A;  3HKZ N;  2LKX A;  4FIS A;  1I3Q J;  1FTZ A;  5IYD J;  3HOV J;  2ME0 A;  1JJ8 C;  1FJL A;  5F27 A;  3BQZ A;  1R9T J;  1WH7 A;  3NAU A;  1ZGW A;  2WV1 A;  5BNG A;  1W0U A;  1MBE A;  4BKX A;  2DMQ A;  4V2F A;  2DA5 A;  2MGQ A;  2AHQ A;  2Y9Y A;  1RKT A;  4Y7N J;  4M3E A;  3BR0 A;  2DN0 A;  1JJ6 C;  1WI3 A;  1YRN B;  1JKP C;  4IHV A;  5C3E J;  2Y2Z A;  4A3B J;  2NVT J;  3A01 B;  1F36 A;  5E3M A;  1JUM A;  1X58 A;  1Z77 A;  2XB5 A;  2ECB A;  2XPW A;  3E7L A;  3TED A;  4A3D J;  1XS9 A;  1FTT A;  2CUE A;  1JUP A;  3JRF A;  4M6V A;  2HXI A;  4DYQ A;  3LSR A;  3HOY J;  5J3L A;  2VKE A;  2VPR A;  5IP7 J;  2B63 J;  2VKV A;  3D1N I;  1IC8 A;  3S2H J;  3MVP A;  5EDN A;  4JX5 A;  2K40 A;  5M3F J;  1I6H J;  1B8I B;  3GTO J;  1AU7 A;  2D5V A;  5M5Y J;  1U9N A;  2M2E A;  5EGO A;  1BW5 A;  1H89 C;  3F0C A;  4FCY A;  3S17 J;  4XID A;  1B72 A;  2AO9 A;  1JKR C;  1UG2 A;  2DA3 A;  1U78 A;  3S2D J;  2JMW A;  2QCO A;  5F0C A;  3JRH A;  2ME6 A;  2NVQ J;  3LSG A;  5J1R A;  2DMU A;  1ZK8 A;  3W6V A;  1JTX A;  3ZQG A;  4CYC A;  4UUT A;  2EZL A;  3K2A A;  3IH2 A;  4JYK A;  1GVD A;  1UHS A;  2R5Y B;  3G1O A;  3Q3S A;  3S1N J;  1EF4 A;  2CUF A;  3I4M J;  2VI6 A;  1WPK A;  1BL0 A;  2R7Z J;  2XPV A;  3BR5 A;  4A3I J;  2JA8 J;  4C3J J;  5EG0 A;  1MBJ A;  4IHY A;  3HBL A;  9ANT A;  5F0F A;  2TCT A;  3S1M J;  4MLO A;  3L1P A;  4EEF G;  1F43 A;  2COB A;  2JA6 J;  5F08 A;  4C3H J;  4AC0 A;  1A6I A;  3SDG A;  1VFC A;  2O8K A;  3ZQI A;  2XSD C;  2ID3 A;  2Y31 A;  4M3G A;  2HXO A;  2FD5 A;  1NK2 P;  2EZK A;  2G0E A;  1LFB A;  5C4J J;  5EZH A;  3VPR A;  1I50 J;  3TW7 A;  2LVS A;  1LFU P;  2L9R A;  2WB1 N;  1QPI A;  4B3A A;  2NVY J;  1AKH A;  3A01 A;  1T56 A;  2M0C A;  1UMQ A;  2L7F P;  2R5Z B;  1GV2 A;  3M4O J;  1RR7 A;  1ZR2 A;  2HI3 A;  5HOD A;  3LSJ A;  2YU9 J;  4S0H B;  1LE8 A;  4IHW A;  1FIP A;  2E1O A;  2E2I J;  4GFB A;  2M9H A;  5J1Y A;  4A3F J;  1U9O A;  1MSF C;  2JA5 J;  3RZD J;  1TWG J;  3BR1 A;  5IYC J;  3HEF A;  3S1R J;  3HDD A;  4A3G J;  4UUS B;  4QIW N;  4DZJ A;  2LR8 A;  3CDL A;  3OIO A;  1A5J A;  5JLW A;  1WH5 A;  1ETY A;  4JX6 A;  3OSG A;  4V2G A;  5IPA A;  3HOX J;  1VF9 A;  2NOG A;  3BT9 A;  3CMY A;  1TWH J;  1PUF A;  1QRY A;  1B8I A;  2CJJ A;  3OSF A;  1OCP A;  4AYB N;  2NVX J;  1MBK A;  3TP0 A;  2QF7 A;  3GTJ J;  1VND A;  1JT6 A;  2GBY A;  5M5X J;  1DU6 A;  5FKO A;  1HF0 A;  3S1Q J;  1FIA A;  5IOY A;  1TWF J;  4M3F A;  3ZQH A;  3PO3 J;  1ETK A;  3GTK J;  3SJM A;  3O8G A;  3CQZ J;  2JN6 A;  3GTM J;  2XPU A;  4BBS J;  2HYJ A;  3JRI A;  2L7Z A;  2P81 A;  5E3O A;  4DZP A;  1K61 A;  2FQ4 A;  3A03 A;  3TP3 A;  3BG5 A;  2DMT A;  2DJN A;  2R5Y A;  2Y0S N;  2K9S A;  3LOC A;  2R93 J;  1ETX A;  2EH3 A;  1JKO C;  1TWC J;  5C4X J;  2Y9Z A;  4IEJ A;  3WHC A;  2DMN A;  1XG1 A;  3ZQF A;  2CU7 A;  3BTI A;  1RES A;  1XC5 A;  2XGE A;  2NS7 A;  3DCF A;  2VUM J;  1JTY A;  1ETO A;  3FK6 A;  2DA2 A;  4Y52 J;  2YS9 A;  4D7M A;  1ETW A;  1HOM A;  2DTZ A;  5F1J A;  3JRC A;  1JT0 A;  2GM4 A;  1RKW A;  2ECC A;  4JX4 A;  2R0Q C;  1AHD P;  2IBD A;  4IHX A;  1HDP A;  2JJ7 A;  3H0G J;  4A3E J;  1GV5 A;  3G1L A;  3Q0U A;  1GUU A;  4RDU A;  1MH3 A;  1Y1W J;  1ZQ3 P;  4A3M J;  5IYB J;  1SAN A;  3C2B A;  5DS9 A;  1SFO J;  1QVU A;  4QSH A;  3HB9 A;  5K7Z A;  4ABZ A;  3HOZ J;  1BW6 A;  1Z0X A;  3LSP A;  5FLM J;  2YUS A;  3BQY A;  3SFI A;  4LOC A;  2KDZ A;  4UUS A;  1ETQ A;  4D5C A;  1OCT C;  1MBH A;  3HOU J;  1U8B A;  2O9L A;  1OFC X;  3BR6 A;  3BR2 A;  3K7A J;  2ELK A;  3B6A A;  2HQ5 A;  2PMZ N;  2XGD A;  5K7H A;  3FIS A;  2FX0 A;  5M5W J;  2TRT A;  3HOW J;  3QQA A;  1B72 B;  2LK2 A;  2HOS A;  1YRN A;  1APL C;  1S7E A;  2DA7 A;  4G12 A;  3MN2 A;  3GTP J;  1ETV A;  1P7I A;  5FKN A;  3H3V K;  4FE7 A;  5DTD A;  4D7N A;  2FJ1 A;  4C3I J;  3RKQ A;  2EZI A;  2EBI A;  4CYC B;  3JRE A;  1K83 J;  3RQI A;  2E2H J;  2MW8 A;  2GLO A;  4MFE A;  2MSY A;  2LD5 A;  5JLX A;  1O4X A;  2K9N A;  5FKL A;  1QVT A;  1IJW C;  2LY9 A;  3DEW A;  1IGN A;  2L0K A;  2XGC A;  3Q0V A;  4W1U A;  3WHB A;  2LTP A;  3GBG A;  5GPA A;  5M3M J;  1T33 A;  5EG0 B;  1H8A C;  4HNV A;  2LP0 A;  3B6C A;  4XIC A;  2E19 A;  1ZKG A;  3IV5 A;  2OPT A;  3OOU A;  2EZH A;  1FEX A;  3QPS A;  3JRB A;  2CQX A;  2WAQ N;  3BR3 A;  1ITY A;  4M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...