2DFFA

Crystal structure of tk-rnase hii(1-204)-c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKITQDMIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 59
structure length 210
sequence length 210
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dffA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dffA01
3CFOA 3ITHA 4CHYA 4DTRA 2X78A 3DYAA 2YNHA 4KHNA 2D5RA 1CXQA 1RBUA 5JS2A 4DTUA 3KIOA 4IBNA 1DLOA 5SZTA 3LAMA 2B4JA 4KKOA 3SQ4A 3T19A 3L2UA 3QIPA 2Z1GA 4ZTJA 5HBMA 1NK8A 3DRSA 3SUNA 5HRRA 1RILA 4AH9A 4KHQA 4CHPA 3D45A 4OKEA 1U4BA 4DSFA 3V1RA 3HL8A 4M45A 3U6FA 1RT2A 1ASVA 3TI0A 1RDDA 4L8RB 1JLCA 2VG7A 4M3UA 4DF4A 4CESA 4FJ9A 3AVIA 3VQ7A 4EZ9A 2Z1IA 1S1TA 4I9LA 4NYFA 3MEEA 2YV0X 4RW4A 3AA2A 4DS4A 4DFPA 5HROA 3TAQA 1FKPA 3TABA 4W5TA 3F73A 4Z4FA 3VQEA 1WSHA 3ZT0A 5C24A 4CJ5A 4CIEA 3RR8A 4EZ6A 1QQCA 4C8NA 1BISA 1ZBLA 4J2BA 4GMJB 2B6AA 3HXMA 4FVMA 2O4GA 1U45A 4DU1A 4PQUA 4CGDA 4DFKA 3VQAA 1D9DA 4DQIA 3MEGA 4LH4A 1Y97A 4CF0A 1RBRA 1Q9YA 4OPKA 1JLFA 2IGIA 1B9DA 4ID5A 4LH5A 1L5UA 2HVIA 1YTUA 3SV4A 4LSNA 3RMAA 4N5SA 4DU3A 4CEEA 2HHVA 4NYNA 1NJYA 1Q9XA 3QEVA 3VQQA 1REVA 3AVKA 4J2DA 3OYGA 4Z4CA 3AO2A 3SV3A 4FJKA 2IC3A 3AVGA 3VQ5A 1X9WA 1SL1A 1SKSA 3KTQA 1FK9A 3AVMA 1N5YA 5FROA 4CCHA 4I9QA 1B92A 4K8XA 1VSJA 2HHSA 1BQNA 1TKTA 5EU7A 3KLEA 2HHQA 1S9EA 3D0PA 1GOAA 1HYZA 4CGFA 3C6UA 1BQMA 1S1XA 1VK0A 3O4QA 4OGEA 4DWIA 4HUGA 4KO0A 4AHUA 4HCBA 3KLHA 4Z4GA 2FBXA 3U3YA 1JLAA 2RPIA 5J2PA 4F2SA 1BCOA 1T05A 3VQBA 4DF8A 2D0BA 3ZSXA 3HVTA 1SL2A 1IG9A 1RT6A 3ZSQA 3OYMA 3DLRA 3QESA 3S3NA 2KFZA 4FJ5A 1KVAA 3MAQA 1S6PA 3IG1A 4CERA 4E1MA 3LP3A 4CF2A 2Y1JA 4FJMA 3AO5A 4CJPA 1TK8A 1RT5A 1RTDA 1C1BA 4E1NA 1UA0A 2ATQA 3RWUA 1RBTA 3NF9A 5J1EA 2OA8A 1EXQA 4KHWA 4FXDA 1CXUA 5I42A 4CJRA 2Q3SA 3M8PA 4DQRA 4FLUA 4C8MA 1ZBIA 3AVHA 5K14A 1O1WA 1RTIA 5CY4A 4DTJA 1T8EA 2GBZA 2VWJA 4FLVA 3K58A 3QO9A 5JS1A 1C1AA 4OJRA 4XIUA 3NGYA 4FLXA 2A1SA 3QETA 4CGJA 2OZSA 2QK9A 4M3ZA 4I7FA 4F3TA 4G1QA 1JLBA 1JXBA 4Q5VA 1RBSA 4O5BA 3AA4A 1IH7A 3RMCA 4F3OA 4FLWA 1BCMA 1BGXT 1TL3A 2E4LA 2VWKA 3KJVA 3V9SA 4E7IA 5HP1A 1KFSA 2G8WA 3S3MA 4DTSA 3BGRA 1LAWA 2YHBA 4E3SA 1VSFA 4CEAA 4BACA 4AHVA 3SI6A 3PO4A 1RCHA 1GOBA 4DTNA 4O4GA 3G0ZA 3OS0A 2I5JA 2ZQBA 4Y1CA 1MU2A 3V9ZA 2R7YA 1RT3A 1LWFA 5KI6A 4ID1A 1SUQA 4AHRA 4CGIA 4DQQA 3VA3A 2G8VA 1EKEA 1WSEA 3LANA 3DOKA 3O4NA 4M3YA 3TARA 3L2VA 2WOMA 1IKVA 3NH0A 3KK3A 3JSMA 4Q0BA 4PA1A 4CJFA 4NCGA 4ELUA 2YKMA 3RR7A 4CHZA 3CM5A 1LW0A 1ZBUA 3L3UA 4KHSA 2NUBA 3VQ6A 3K5LA 4AHSA 5E41A 3O3FA 4HTUA 5HLFA 2Z1HA 3RRGA 1HNIA 1NOYA 2XY7A 4Z4HA 1L3VA 1IKWA 3QEXA 1BI4A 1C0TA 1LW2A 3SZ2A 4E7KA 4DS5A 1L3TA 1I39A 1LWEA 1VRTA 3NDKA 3NE6A 1S5JA 2HNZA 3NGIA 1QSLA 3SQ1A 2P1JA 4Z0UA 2YNGA 4CK2A 4BE1A 2D0AA 3OYIA 2O4IA 2X6NA 1U47A 4M3RA 3OY9A 5C42A 1NKBA 3AVCA 1D9FA 3OYAA 3ALYA 1JXEA 1G15A 1RT4A 3AO4A 3CM6A 2IDOA 3V1QA 4W5OA 1QSSA 1WAFA 3FFIA 1WSFA 1R0AA 1XWLA 4O0JA 1CZ9A 4IFYA 2EX3A 1ITGA 1SKWA 3TWHA 4BWMA 3VQ8A 5HRPA 1RTJA 3VQ9A 1KFDA 2YNIA 1TV6A 4DLGA 4DTXA 3IAYA 4CEZA 1HJRA 1UOCA 2E6MA 5CYMA 1NJXA 4B9SA 4DG1A 3DM2A 1L3UA 1KCFA 2DFHA 1WSIA 2OPPA 4YNQA 3LWMA 4N56A 3K57A 1NK0A 3E01A 3QEIA 4B8CA 1LV5A 2YNFA 5SWMA 1X9MA 2F96A 5J2QA 4KPYA 3O3HA 1HQUA 1QHTA 2JGUA 3U3GA 3SPYA 2BDPA 5J2MA 1QE1A 3M8QA 3CYMA 3TANA 4B9VA 3B6PA 1KVCA 3P83D 4WE1A 4CJSA 3L2QA 4I2QA 3LZJA 1TKZA 3MEDA 4B08A 3K5NA 4HUEA 4DFJA 2DY4A 2HNDA 1HNVA 3SJJA 3AVLA 1T7PA 3OJSA 4OVLA 3DLHA 4DQPA 3AV9A 1FXXA 3KLIA 2OPRA 4E0DA 2KZMA 1W0HA 3K5MA 3SQ2A 3QEPA 5DK5A 1S9GA 4KI6A 3QLHA 3LDSA 1NKCA 3ZT1A 4ICLA 2E6LA 2G8KA 2FBTA 4GVMA 2ZE2A 4DSKA 1EX4A 1KTQA 4FW1A 3ULDA 3V6DA 1SV5A 3DLKA 4F4KA 4KAZA 4B9UA 2RF2A 3MXMA 3OYKA 3L8BA 4QAGA 4M3WA 3VN5A 4IFVA 5J2NA 5KTQA 3PX0A 1HYSA 2HHTA 3DOLA 3IS9A 4E19A 4OLBA 4CJTA 3AA5X 3VQPA 3V9UA 4ZHRA 3PX4A 2ITGA 3NHGA 2G8FA 2OPSA 2DFEA 5HRNA 4PY5A 2KQ2A 3AA3A 1J54A 1VSLA 4DLEA 1QTMA 4B9NA 5D3GA 4JS4A 2G8HA 1NJZA 4E89A 1KLMA 2P5GA 4HHTA 4N76A 2XY5A 4FJ8A 4RW7A 3QERA 4CF1A 4KREA 3P1GA 3LALA 1TK5A 1BI4B 4N47A 1LAVA 2QXFA 1SKRA 2XY6A 1TVRA 3A2FA 3EY1A 1S1VA 4FYDA 3KD5E 3QEWA 4M3TA 3KKSA 4AHCA 2XY8A 4CJKA 3CFPA 1NK7A 5FRNA 4M42A 1XC9A 1D8YA 4KTQA 1D5AA 1Z25A 4FK0A 1I3AA 3HT3A 4FJHA 1CLQA 4CECA 4OLAA 3MXJA 1TK0A 2EHGA 1WSJA 2DFFA 1U04A 4J2AA 4N41A 3QNNA 1L3SA 1N6QA 1S1UA 3LP1A 2IAJA 4MQ3A 1S1WA 3QNOA 1C0MA 2HMIA 4DSJA 3HJFA 3KLGA 4CJLA 4MFBA 3K59A 2IOCA 3C95A 1NK9A 1BHLA 2RN2A 3C6TA 4CJ3A 3NAEA 2YKNA 1CZBA 3SUPA 5FDLA 4LSLA 4JLHA 4CHQA 1QSYA 1C1CA 1VSEA 4BE2A 3TR8A 3ZCMA 3SUOA 4FJJA 4CJWA 3TAGA 2VG5A 1ZYQA 3LZIA 3AVJA 4CEQA 4TSXA 4YFUA 4RW9A 3SQ0A 3I8DA 4J2EA 3LAKA 2F8SA 4EP5A 2HW3A 1VSKA 2QKBA 4KTZA 1S6QA 2FBVA 1WNSA 3L2RA 3V81A 4CEOA 3KD1E 3JYTA 3OYLA 1SL0A 4KI4A 3NBPA 3SPZA 3T3FA 1U49A 4M3XA 1ZBFA 5I3UA 4RG8A 4CE9A 4R5PA 3M8RA 2FC0A 3B6OA 2KFNA 4DFMA 4FJLA 4ELTA 4FZXC 4CK1A 4W5RA 1KVBA 3VA0A 4B8AB 2RKIA 4E7LA 3NCIA 2JLEA 3OYNA 2IS3A 3RRHA 3OYFA 1RDCA 4QCLA 3QIOA 4KFBA 1WSGA 4CJEA 3PUFA 4DQSA 2OZMA 1VSIA 3I0RA 4CF8A 4B9MA 4FJGA 3RMBA 1EETA 4E7JA 1Z26A 1B9FA 1F21A 3HPHA 4NCBA 4O55A 1ASUA 3WNFA 1WAJA 3ZSZA 4FZZA 4FK4A 1RBVA 4CFBA 3WNGA 3OYJA 1U48A 3NF6A 4H4MA 3KK1A 3L2WA 1UWBA 2WONA 3DRRA 3CG7A 3MECA 3NF7A 4CEDA 3NFAA 4KV8A 3KK2A 4NCAA 3OS2A 1IKXA 3VQDA 1JLGA 3HK2A 4HVJA 2BE2A 2AJQA 3K5OA 3OYHA 2HVHA 3ISNC 2G8IA 1HPZA 1ASWA 2PZSA 4IG3A 3UIQA 1J9AA 1JLEA 3NH1A 3KLFA 2XO7A 3DI6A 3HPOA 3WNEA 3VQ4A 5CYQA 3V9XA 1FKOA 2B5JA 2X74A 3HSTB 3V4IA 2F8TA 1BIUA 1A5WA 3T1AA 3NGZA 3AO3A 4CIGA 2KTQA 2Y1IA 3HP9A 1TKDA 1DTTA 4H8KA 4CFAA 4CIFA 3OYBA 4B9LA 4DSLA 1UAXA 4DU4A 1RNHA 4JRPA 4IDKA 4LY7A 3TAMA 3V1OA 3AVFA 1NK5A 2KZZA 2BGGA 1UA1A 1TL1A 3KKRA 1J53A 4FZYA 1Q8IA 4KHUA 2X6SA 1HYVA 1JKHA 2HHWA 2GUIA 3EZ5A 4C8KA 3O3GA 5KGWA 1WN7A 3G10A 4W5NA 3NF8A 3AVAA 1KRPA 2ZD1A 1GOCA 2GV9A 2KW4A 3TAFA 1RT1A 4O44A 3TAEA 3S3OA 4C8OA 3ZSVA 5KGXA 1NK4A 1JL2A 1VSDA 4B3OA 5HRSA 4E7HA 3WNHA 1JLQA 4GW6A 3HP6A 3C94A 1RTHA 3AO1A 4FCYA 4EP4A 2ETJA 4OPJA 3SYZA 1X9SA 4CFDA 1TAUA 3OYDA 3EYZA 3DRPA 3VQCA 3LP2A 4FLZA 4KTWA 2OYQA 2D0CA 2P5OA 1VRUA 3THVA 4IG0A 1EP4A 1BIZA 1TAQA 1VSHA 3OYEA 1NOZA 3AVBA 4DTMA 3PX6A 5KRSA 4IKFA 3MXIA 1HQEA 4KHYA 1XHXA 3ASMA 3ZT4A 4B9TA 4RW6A 4DSIA 3OYCA 1KSPA 3LP0A 3IRXA 4FW2A 1NK6A 4K8ZA 3LWLA 2OPQA 3HYFA 3OVNA 1RDBA 4CHNA 4FJNA 1K6YA 2PYJA 4DTPA 1HMVA 3SNNA 3LPTA 4FK2A 4QOZB 1A5VA 4FM0A 3ZT2A 3F9KA 4DTOA 1XHZA 1NJWA 4FLYA 3BDPA 3OS1A 3DLBA 1IKYA 4FLTA 2P51A 2QKKA 1RDAA 5KRTA 3CFRA 4I2PA 4M41A 1A5XA 2HB5A 3ZSYA 3SUQA 1XI1A 3M8SA 3AVNA 1NKEA 1HRHA 4UQGA 4BDPA 4CJQA 4DMNA 2HHUA 4CJUA 4F2RA 1YVUA 4KB1A 4Z4EA 3RMDA 5DMRA 4RW8A 3ZT3A 1DTQA 4PWDA 4OKKA 4CJ4A 1W9HA 2W42A 4FM2A 3V9WA 4JRQA 4AILC 4PUOA 2HNYA 1C0UA 3ZSOA 3NH2A 4Y1DA 4CGHA 3PY8A 1T03A 3DLEA 3HVRA 2BANA 3I0SA 3QINA 4CK3A 5T7BA 4F8RA 2Z1JA 4Z4IA 1KLNA 2YHAA 1IO2A 2G8UA 4LD0A 3RTVA 4HCCA 4KB0A 2LSNA 4KRFA 1X1PA 4BDYA 2XRIA 4OKJA 1WLJA 3H08A 4O0IA 2XHBA 3HO1A 3P5JA 4BE0A 3SCXA 4CGGA 4CEFA 1J5OA 3S9HA 4BDZA 2DTUA 1C6VA 4OGCA 4CEBA 3HM9A 3TAPA 2A1RA 4FJ7A 5CZ2A 4FJXA 3PV8A 4FJIA 4CJVA 1VSMA 1QS4A 4C8LA 4CF9A 1TGOA 3DLGA 1YTAA 3L3VA 3OJUA 4DSEA 1YT3A 2PY5A 4ZTFA 4AHTA 4H4OA 1LWCA 2HHXA 4FM1A 1RT7A 5FRMA 3LPUA 5C25A 3CQ8A 4CFCA 4CHOA 1BL3A 3ZSRA 3HPGA 3ZSWA 3PO5A 2VG6A 4BWJA 4ELVA 1JL1A 4HUFA 2PYLA 3DMJA 4JS5A 1ZBHA 3K2PA 1TKXA 5CZ1A 2FBYA 4W5QA
chains in the Genus database with same CATH superfamily
2O8XA 1YAGA 4YFXF 4BVPA 4XMYA 3DBLB 3CJNA 2ZFUA 1YLFA 4CCKA 2Z16A 1LFPA 4M45A 1RDDA 1JLCA 2E5LK 5GAHJ 3VB2A 2UUCK 2DQRA 1FKPA 3F9MA 1A6QA 2OZ6A 3CMEI 3BG9A 3SDBA 2K9LA 4ILJA 4CF0A 1BW6A 1DT9A 1JLFA 2VPLA 4ID5A 1R5GA 3RMAA 4CEEA 1NJYA 1REVA 4J2DA 2PBDA 3MEXA 3SV3A 5FROA 3WEEB 4RGUA 4JK9A 3DKXA 3QU3A 1NNEA 1BQNA 4PZJA 5EU7A 3KLEA 4B1YB 3Q5FA 1D5VA 4WQ4A 3HG9A 1IG9A 2QLZA 3HBLA 4HV5A 2OANA 2RKHA 2VBWA 3AY9A 4E1MA 2CGJA 2OA8A 2RHKA 1IUFA 3V42A 4PFPA 3EUHA 1JGGA 5E1ZB 5EDNA 2TRTA 5CVVA 4Q5VA 5ILUA 4E3SA 4JHDB 1WI9A 2VKVA 4DTNA 4Y1CA 2GZWA 4BNCA 1SFOJ 2JQ7A 5KK1A 1ZG5A 2YKMA 4WFBL 1SS6A 3H46O 3KP5A 2NVYJ 5C0YA 3S32A 1L3TA 1WBBA 4ZYDA 1S5JA 3VETA 3H3OB 2GAUA 2V6EA 3AVCA 3OA9A 1HNXK 2QEXI 3E6DA 3G1LA 5IT9K 3A0IX 5HRPA 3R6SA 1KGSA 4EJVA 5C2DA 4G7OF 4AQYK 4K25A 2M1BA 3JS6A 1D8KA 2R3SA 3VOEA 1TQPA 4DZPA 2IP2A 4B08A 3K5NA 1FXXA 4E0DA 3ZQIA 3VDXA 4KI6A 2ZJPL 4IL6C 2LKPA 1XDSA 4ABZA 1DKGD 1MMGA 5AJ3K 5L3DA 5KTQA 5GPCA 3HM8A 2FSKA 2BHYA 3WODF 3G4SN 2FXAA 1Q82O 2UXBK 3U1DA 4QS8A 4N9IA 3M1CA 1ETQA 4Y52J 5EF6A 4BHCA 3A2FA 5E84A 4A3EJ 2QKLB 3FXMA 4FJHA 4OLAA 3U1KA 2B63J 3AL0B 2ELJA 1OYIA 3M8FA 2IAJA 3UB5A 4DV4K 1RUNA 2WAQN 3U21A 3SUPA 1SFKA 4JLHA 3K1MA 4HEA2 4FQGA 1MDMB 3D6RA 3AVJA 3OR2C 5J4YA 2JUGA 5D5UB 2Q36A 1U49A 3CQYA 3QB0A 4W5RA 3N4PA 4BRGA 3RRHA 1BR1A 3QIOA 1WBDA 3S2HJ 2ZJ2A 4R79A 2E1ZA 4FZZA 2HOEA 2WONA 3NF7A 1JLGA 1IN6A 4HVJA 2DK8A 5E1XA 1WH5A 1HPZA 4B1UB 2DA1A 2OUMA 4HDVA 2WADA 3Q9VA 2FBIA 1LE8A 3LDLA 3CCUN 2DYSH 1XD7A 1GT0C 2D1KA 4ESBA 3V1OA 2HHWA 1JKHA 4ENJA 1XSVA 3OSGA 1ETOA 4A59A 1KRPA 2ZD1A 2JZYA 4OPJA 3WUHA 1RI7A 1U2WA 3EYZA 1K79A 2PAVA 4F52A 4PCQA 4DB3A 3EPZA 4FWQA 1XHXA 1USTA 1NK6A 5A2QZ 3WTSC 1K6YA 3ENHA 2IS1A 3LPTA 1HX1A 1F5TA 1WH7A 5D5WB 3FK7A 3K4JA 1GLAG 1BA5A 3O8MA 1FX7A 1SFEA 4WK8F 3ZSOA 1M90O 2NNYA 2WY7Q 1O3QA 3WQUA 3FGUA 4OKJA 4M6YA 4OINF 4D1QA 5MLCQ 3S9HA 1OMIA 4GV3A 5K5RA 2V52B 2A1RA 4ISFA 5L3BA 2E5ZA 1YT3A 1QHGA 1LWCA 2KZVA 2X85A 4DZJA 2IS4A 4BRHA 3ZSRA 3SZTA 2VG6A 3IWZA 5EGOA 2JPCA 2M30A 4JS5A 5ICCA 2ICWG 4OOIA 1TWHJ 3THYA 3ZN1A 1RILA 2DA2A 4H0VB 2HBLA 2VG7A 3RVCA 3F6VA 5FLMJ 4JKHA 3R6MA 2YV0X 3BCBA 3DJCA 1ZBLA 1KXPA 3CQXA 4GFBA 4IQ4A 4NYNA 4IOCL 4Z4CA 3QWLA 2VN2A 2EWNA 5GINA 1ZGAA 3LWFA 3HXLA 1GOAA 1VQ9I 4KO0A 1YOVB 4G6TB 2D0BA 3HVTA 1NG9A 3ZSQA 1ZRDA 1IJWC 4FJMA 2B9SA 4H0OA 2XAUA 1ILYA 3RWUA 1RBTA 2E2JJ 4UHTA 3FMRA 4C8MA 4LFAK 4FLVA 2JSCA 2HTJA 1BGXT 3WGGA 5DCFA 2UU9K 5ED4A 1MU2A 3DWLE 1XPXA 2E34A 1C0GA 1UHWA 1RESA 2ZM6K 1Z6TA 4ASNA 1NOYA 3G1OA 2HYFA 3J81Z 5BRDA 1LWEA 2GWRA 1FBUA 4DV0K 4JD2A 5DD8A 3K6GA 3CF5F 4IXAA 5C42A 5EX5A 2IA1A 1FSHA 3BY6A 4U67L 3Q3SA 1S29A 1ITGA 2HFHA 2K9SA 1Q81O 5JVGF 2W00A 3VQ9A 5LFAA 1X19A 3T69A 3OV8A 2LNBA 1J0RA 2E7WA 4RCHA 5GAGJ 2LDUA 1KD1O 1HQUA 2OTJI 2JGUA 3O08A 1VQMN 1BDGA 3H36A 1GHCA 4ENMA 1KVCA 4ZDLA 4KISA 1XTAA 3LOCA 2ZO4A 4BS9A 2XB5A 5TRDA 1EH8A 3S1MJ 3CJCA 4GVMA 4DIQA 4CBWA 4F4KA 3BT9A 3TO9A 1E3PA 4TV7A 3BEXA 2PX9A 4ISEA 2ITGA 4XRSG 4FJ8A 2EJRA 3HOVJ 1TK5A 1BI4B 2F9WA 4N47A 3EY1A 2OQGA 1JTYA 3HGYA 2IW5A 1I3AA 4IHVA 2IGKA 3MKWB 3QNNA 2H1KA 1T08B 2HMIA 2GM4A 3ZQQA 4MFBA 3BTCA 5F1XA 3K59A 3C95A 4BXFA 1SAZA 2RN2A 4OIRF 4HSTA 3QYEA 3LL7A 3TR8A 3ZCMA 3SUOA 1T98A 2DPNA 4CJWA 2HS5A 1EWQA 1WNSA 3OYLA 1WUAA 2IS6A 2E7XA 3NBPA 2Y9ZA 5I3UA 5F27A 2CW8A 1OVYA 2D1HA 4RB0A 4UUVA 3A01A 1E0EA 2N8GA 1VSIA 3SAHA 3HPHA 1TYQB 2LF8A 3VEVA 1WHUA 3CPEA 2BTFA 1U48A 4EM2A 2HBJA 3FMSA 3TKYA 1UWBA 3C65A 3KK2A 2YSRA 3Q7CA 1IKXA 1VQNN 2PFUA 1SC7A 2P9IA 3I4NJ 2PJRA 1X3ZB 1CGPA 4DR1K 3PIOL 1XGOA 3JAMK 5AR0A 3ZP5A 1FP2A 4JYKA 2Y1IA 3W6VA 5E8IA 3KCCA 4JRPA 3WG9A 4JI8K 5ADXA 1CF7B 2KZZA 2FRHA 2E19A 1WJCA 4DV7K 1W4MA 1N8RO 4K43A 2EBIA 5KGXA 4GDFA 4IO9F 3LP2A 1FOYA 2OYQA 1IBKK 4FTHA 4HLXA 4B4CA 2JT1A 3DPLC 5EG0A 4LFCK 3ASMA 3V8JA 1BA1A 1SD4A 4KT5C 4DR5K 3HRSA 1S72I 4EM1A 3I58A 3FXOA 4XH4A 4DQ8A 3O1BA 3SUQA 3GLLA 5FGMA 3AVNA 2ISZA 2HU9A 3RMDA 2M0CA 2EINH 2DJIA 4Z4FA 4PUOA 4JRQA 4AILC 3NH2A 3IP4B 4F7ZA 4MDBA 3WHCA 4KH5A 4BDYA 3DEUA 1IDYA 5EEAA 1IV0A 4LB5A 4YFNF 4KIFA 1IBLK 2XROA 3EO3A 4FM1A 5FRMA 5C25A 5IYBJ 4HNTA 3E0JB 3DMJA 1LFBA 4N9HA 3O6WA 2OTLN 4DTRA 2ZXIA 5SZTA 4UVCA 1PJRA 5CKTA 3QIPA 3SXYA 3NVKA 3HZ6A 3FDYA 1KU2A 1VQON 3FHNA 3TI0A 4H5WA 2FOWA 2RNJA 4B1WB 2ZNZA 3OIOA 4NYFA 3MEEA 5AIPA 4EAHD 2VGMA 4EZ6A 4R1HA 4NLCA 2FQ4A 3ZMSA 2FNAA 2QQ8A 5FKNA 5E1WA 4E4HA 2HVIA 1ZG3A 1YW9A 1J2XA 3R60A 3AVGA 5J40A 2GXGA 3D0PA 1BQMA 1ZTRA 3CC4N 3U3YA 4L5IA 4UXNA 4NC6A 2CUFA 1Z1DA 2WAEA 3BPXA 1UA0A 2ATQA 3NF9A 5I42A 4X66K 4EEFG 1I50J 4BROA 2O0YA 4CZCA 1W5TA 2QVOA 2KRFA 1R5HA 3CCLI 4H0YB 3GO5A 3V9SA 3ONQA 4E7IA 2QZ8A 2YX6A 1J7KA 3LQQA 1Z3YA 1LWFA 4A3CJ 3HI0A 3A2KA 2HTSA 3I59A 5JLXA 3VQ6A 4Y4RA 3RRGA 1F1ZA 2NRZA 5KAFC 3K0LA 1C0TA 2UV1A 1R4NB 3FZMA 3OY9A 3O6BB 5FPEA 3OL4A 1D9FA 1WJAA 2EWSA 4EJTA 1Q1HA 4MO4A 1D1AA 4JX5A 1OKRA 3ZQCA 1KFDA 3IAYA 1UOCA 3QAHA 5FLVA 1JT6A 2EIMH 1KC8O 4GY2B 5J2MA 1QE1A 3J80Z 3P83D 3L2QA 2A05A 3S14J 4ISGA 4FASD 1T7PA 2V7FA 2G9WA 3FM5A 5L3FA 3ZT1A 4L18B 5E3OA 5EXWA 3LA3A 2K5CA 4B3RK 2K85A 4J8FA 3K4CA 2FOKA 5FPMA 1S6LA 5AQSA 2DPDA 5D3GA 4KREA 4ILGB 1O7LA 3QQAA 3SLCA 3JRCA 2Q31A 4CYDA 2PJPA 3LM9A 3HTVA 3UKUA 4IOAF 1Z25A 4BQAA 3ZLJA 3I0TA 1XCBA 3U9ZA 3LP1A 3MZYA 1N32K 2IOCA 4CJ3A 1CZBA 3C0BA 5EJCA 1XN7A 1H88C 2VJIA 4A0XA 4MTEA 3ABLH 2YUSA 4XSZF 2BEOA 4YFUA 2ZWHA 2HYGD 3I8DA 3HOSA 3WTZA 3LAKA 2ZSIB 4R5PA 5BR8K 2P9UA 4KBOA 1MBEA 4H5TA 5HS8A 3I0RA 3OL3A 3BR0A 1IRXA 4LB6B 3OOPA 4LF5K 1GXPA 3L2WA 3VEZA 3NARA 4CUGA 3TU5A 3OS2A 2AJQA 2PZSA 2K4JA 2LLKA 2V79A 1Q86O 3WNEA 4KH4A 2X74A 1IRFA 1TNTA 4HSRA 4CFAA 4CIFA 4IDKA 4B1RA 4CCMA 2FD5A 3E3VA 4XH5A 1YE9A 3E9LA 3ZSVA 2CU7A 4KITB 3VFZA 3FHZA 3AO1A 2XPUA 3CJ7A 4YELA 3SYZA 1NM1A 3BDDA 4FLZA 1VRUA 3VEOA 3H1CA 3FXQA 1HQEA 1H9GA 3UKGA 2A6HF 2YJEA 3IRXA 2F6CA 1TWCJ 5AQFA 1OVQA 1ZN2A 1NJWA 1LNWA 4CZEA 1ETWA 2K3PA 4HDUA 4KHPK 4IZ9A 4JI2K 4LF4K 3BWGA 1FMVA 3W2AA 4F2RA 1YVUA 1P9QC 3BR2A 5BQTA 4BGDA 2XAJA 3VENA 3WEEA 3PY8A 3PSFA 3CJ9A 4I0BA 5C4JJ 3I3LA 1U9OA 2W6KA 4I2OA 3GXOA 4XOPA 2JJ7A 3K70D 2GXBA 5BRFA 2XHBA 4KICA 1SD7A 4BE0A 2A68F 3PIPL 3ZXSA 4HLYA 3TAPA 1OCCH 1U0JA 4CJVA 3RZDJ 1VSMA 2W48A 3DLGA 4KT6A 5KPZA 2HHXA 1GLBG 1NG6A 1MD0A 3IV5A 1E3MA 4OU0A 3CCJN 2P5LC 5DYMA 1ON2A 3CFOA 4CHYA 4HZFA 3V8LA 1RDUA 2XDVA 1DLOA 3LAMA 3PJRA 1SAUA 2HBMA 4E7SA 2IVOA 5E17F 2E2OA 4CHPA 5EZHA 4JHDA 3RQIA 1UZCA 4EZ9A 3HSEA 2Z1IA 4I9LA 3KP7A 2O5RA 2X4HA 2XGCA 3MMYB 3RZOJ 2KPMA 5A2QK 1VAZA 3F0CA 5I9EB 1ACIA 2UXNA 4MFEA 4EJWA 5AIQA 3BJ6A 3VQQA 3OYGA 3J7AP 1OCRH 4DYQA 4E6KG 3TP0A 3R3LA 1XC3A 3PLAA 1T6SA 4OAYA 2L9RA 5J2PA 4F2SA 4QS7A 1BBYA 4BHBA 3CF5L 4AF1A 2VWBA 4PGGA 4JI6K 3QESA 4CSWA 5B5EC 2ASPA 3O2PE 5AQHA 4E1NA 3CCUI 1JKRC 2Q3SA 1MDUB 5DTDA 1ZBIA 2MC3A 5L3CA 3SZPA 3M5RA 2L9NA 4QPOA 1Y56A 3NGYA 4F3TA 4CGJA 4FISA 2QSHX 1SVOA 3MK6A 1TC3C 1IH7A 3KJVA 4NC7A 5D4SA 2CO5A 1W2BM 1VSFA 2ZMEA 3G0ZA 5HLHA 2E1NA 3RTRA 2I5JA 2ZQBA 3K1NA 4JI7K 4CZMA 2O8CB 1EKEA 3JTHA 4DUYK 2JA7J 4ZYHA 3D0SA 1HJOA 4B44A 3O1WA 1OH6A 1AHDP 4MGRA 1BC7C 1BOBA 2V1UA 2YNGA 1SMYF 2GTDA 3FFIA 4F9OA 1FP1D 3S1NJ 4BRIA 3PQKA 2YNIA 1RKTA 1MDMA 3CUQB 3ZX2A 1YIJI 3SPYA 2Y0MA 1TBXA 2EILH 3H92A 3NEUA 1HC8A 3SQNA 2C6YA 4LF7K 2EFPA 4O8KA 2W25A 2DA6A 2PEXA 3I9V2 3P9CA 4JNEA 1AOYA 1F43A 2HOSA 4BRFA 3OYKA 3L8BA 1Z77A 1XX5A 1ZK8A 5HRNA 3GEZA 1SKRA 3S17J 2ELHA 3J7YJ 2DW4A 3J81K 3KKSA 1F36A 1R00A 3A5LC 2DAOA 1MSEC 1W36D 2DFFA 3ECHA 1NTCA 1RUOA 4MQ3A 1EJ9A 1ZRFA 4EHTA 4B43A 3JAMO 1VSEA 4M71A 1VSKA 2HHHK 1WJEA 2E5NA 4M3XA 4FJLA 4CCNA 1IXRC 3QPLA 3HB9A 4K2EA 3MD2A 2IS3A 2QWPA 4YIRX 3H3VK 4HBLA 1KAYA 4JX4A 3QICA 3H5NA 5JVTA 3W2VA 3ZMTA 1WAJA 1MJAA 4LFUA 4JI1K 3EYIA 2GA1A 2L01A 2Z5UA 1K73O 2G8IA 2DCEA 2H6BA 2M34A 5FFXA 1TNSA 5BPLA 3B8AX 5CYQA 1T2KA 2ASMA 2PMHA 2HDWA 4V19S 2KTQA 4RDUA 3KX2A 2P6SA 2QENA 4NO7A 2DA7A 1HKCA 3PO3J 3MWMA 3HOUJ 1S9HA 3C6AA 3NF8A 4GRIA 3AVAA 1C0FA 4O44A 3C2HA 4E7HA 3H9JA 3L6QA 4EP4A 3FXLA 3BG6A 3QYFA 2O3FA 3UKRB 5M1KA 3R0AA 2L7KA 5BR9A 4ZZDA 2VQCA 5GADP 4MLEA 2GELA 3OYCA 4FWKA 1UJ8A 4EATA 2VI6A 4ETSA 4I98B 2X51A 1XHZA 1K6OA 1VQMI 1SVMA 1Y8RB 4K41A 2BY1A 3WU0A 4OPAA 3E7LA 1S3JA 1RETA 2XSJC 3K0SA 4KI4A 1T03A 3H45C 2BANA 2KMUA 2YJFA 2KIFA 1M1KO 4C3HJ 4KH6A 3HTSB 2HDDA 3LSPA 2O8FA 1TT5B 3CCQI 3HO1A 2OV7A 4CGGA 4JN4A 5CQGA 1Q18A 4FJIA 1VI0A 4EMSA 3KETA 4H0EA 3VF2A 4CYCB 2OCEA 1Y64A 3AG3H 4X1EA 1PP7U 1TKXA 3Q0VA 2LY2A 4I9QA 3HC7A 3ZOBA 2MABA 3DYAA 2JSPA 2A41A 4C1NK 2NOGA 3HL8A 5F0FA 1RT2A 1PUFA 1IXSB 4M3UA 1VQ6N 3AVIA 4DFPA 1JE8A 3DEWA 5HLTA 4BVOA 1MBGA 2R7RA 1JUMA 2ME6A 1X3MA 1ZYRF 4C2TA 1WJDA 4UY8I 4AYBN 1X9WA 3F8NA 2Y9YA 5FLXZ 4B09A 2KKZA 3CMMA 4CZIA 1HYZA 3ERMA 3G6EN 3ZSXA 3HKZN 4CCOA 1KVAA 1ZELA 4LIVA 3DLLF 3K2AA 1RT5A 4AIHA 1LEAA 5J1EA 1CXUA 3EN9A 3M8PA 1VQLN 2LH9A 1JXSA 1GVJA 4NLBA 4XL9A 3REOA 1HBXG 4Y0WA 3GFLA 5M5XJ 5F64A 3BGRA 1Z6RA 1OCOH 5JMVA 3K4NA 3HOZJ 2DJNA 3GTOJ 3IRRA 2KRHA 2R7YA 2ZJRF 3ZPLA 3R9PA 3KK3A 1X1BA 2QXLA 1BI1A 3BF1A 4M3FA 4KDPA 2HKXA 3K5LA 4E1JA 2XGDA 5DD4A 1QQNA 1YUWA 1L3VA 1Z7LA 4A5BA 1BI4A 3HK2A 3NDKA 2D0AA 3FXJA 3FF5A 1U3EM 5BN9A 4IFYA 1VQ4N 3ZX0A 1R22A 4BRDA 2J5OA 2A5YB 5IOYA 4L9VA 2DFHA 4BRLA 1PP8F 4JKFA 1BOAA 5SWMA 4XSXF 4BHPA 2V1NA 2KL4A 4NB5A 4CJSA 5AZIB 1FY7A 1HNVA 3DLHA 4LJZF 4DQPA 2MBFA 3K5MA 1S9GA 5CJ9A 1YJ9N 2KFDA 5M1FA 2OTLI 1IV6A 2HMPA 1SV5A 4KAZA 4X6AJ 3WGIA 4WF2A 5KNLA 4PJNA 1ZLJA 1VQOI 3IS9A 2KQ2A 4WX9A 5AQRA 3T1HK 5AQJA 3G25A 1JKQC 5DM6F 2XY6A 2JRTA 5FKOA 2M8EA 4CJKA 1CF7A 4M42A 1XC9A 2XAGA 3VGKA 1X3WB 2R92J 2X0LA 4WWCA 1U04A 4JI3K 1L3SA 1T44A 2UXXA 1BHLA 2BE5F 3RKQA 4PFOA 3AAPA 3O5BA 3CC4I 3KP6A 2QKBA 2UUZA 3J80K 2OC6A 1HXDA 2F48A 3ELKA 4D0PA 2A42A 4IVNA 4QCLA 5ADXH 4UV9A 2E36A 4QPQA 2RQPA 3TGNA 3BJOA 1W7PD 2L9VA 2ECCA 2Z2SB 4HX8A 4KV8A 3AG2H 4XN3A 3WHBA 2ID6A 1G59A 1POGA 2IVMA 3T1YK 1R5ID 5HOOA 2YX4A 2F5FA 4CD3A 4H0TB 5HS7A 1X4OA 2IVNA 1HYVA 1HUXA 4FO0A 4C8KA 1NGFA 2HF3A 5KGWA 4C8OA 1DP7P 3LSIA 3HRTA 2H6CA 1JCGA 3HRMA 2HPIA 1VQ7N 3BC8A 1BIZA 4ZDOA 1W5SA 3HRUA 5IT9Z 3PX6A 4BJ6C 3B02A 4C3IJ 2K40A 4KHYA 3AFHA 4DSIA 3LWLA 2OPQA 2IA2A 5ICFA 4HF1A 2NRWA 4YRVA 2A5XA 3ERED 2M2EA 4A5NA 3E6BA 1FTZA 4PSWA 2VASA 1NK3P 2VBZA 1QVFM 2Z1DA 3LL3A 3CC2I 3HUGB 1BG3A 5A2QO 1RR8C 3KK7A 2HXIA 4XK4A 2WY8Q 4FJXA 3PV8A 1YF5L 4OMYA 2GLOA 1YTAA 4IHWA 3DTIA 4G9ZA 2X78A 1CXQA 3UR3C 1DDNA 3N4QA 3SQ4A 3CZ6A 2HSTA 3D45A 4H5RA 4ESJA 4U0WA 5TKWA 1WZ2A 2XPWA 2VQLA 4BR2A 3HXMA 1AKHB 1KQ8A 2GWKA 2O4GA 4PQUA 4A3LJ 4BBRJ 2HEOA 1NGHA 2M8GX 1T33A 4XRMA 3S16J 5ICGA 3E5XA 4EIAA 3MWPA 4O5VA 4H03B 2ACJA 2HOAA 2V7YA 1ZH5A 1Y1WJ 2A07F 1KU7A 1VK0A 5CVIA 3MKZA 4YOVA 1C0WA 2KJBA 2W41A 3DLRA 2X6OA 3K4BA 2EK5A 4A69C 2A69F 2MA3A 3LFKA 2Q97A 2K02A 4FXDA 2FSJA 3WQTA 4FETA 4XIUA 5AQTA 5AQNA 3ENOA 4ESFA 1TL3A 3CJ1A 1S3XA 4AHVA 3PO4A 2V1XA 1V5GA 2I10A 3C3WA 4AD9A 4L0ZB 4AHRA 3TARA 3VYRB 4CJFA 4FX0A 4U0YA 1ZBUA 4M3GA 4KHSA 4HTUA 4PK4A 4Z4HA 1FT9A 3ML6A 4E7KA 1I39A 1NGJA 4GV9A 3NGIA 4BRAA 1U47A 2GBYA 5DM7F 1KQ0A 1QSSA 3LSGA 4HX4A 3HGGA 3VQ8A 5GPAA 4CEZA 1ONVA 4B9SA 4BR0A 4D5FA 4OWRB 1B6AA 4YIIA 3J81O 4A3GJ 1HKSA 3GBTA 4WE1A 1WJBA 1TKZA 4PUSA 4G8XA 3FK6A 3AVLA 1Z7UA 5DK5A 3JXUA 2WAQA 3CCJI 4UNOA 4JK8A 4BR9A 3CC7N 3ASOH 4FW1A 1HF0A 3DLKA 4Y33A 4QAGA 3ZYYX 4CJTA 3AA5X 3V9UA 4PY5A 5LJVA 4XICA 2ITMA 2FUG2 2NZTA 3FXUA 4OAZA 5HS9A 1P90A 2LRDA 2P9LB 3P9KA 1BJAA 3ABTA 5AQVA 1V4RA 4FK0A 1ZKGA 4KIBA 2VKDA 1ZHFA 1A35A 5F0CA 1S1UA 4XQFA 3KLGA 4GYGA 4CHQA 2H09A 3TAGA 2VG5A 2YCHA 4CEQA 4TSXA 3HSFA 3CJRB 5J3LA 4UB6C 1WOQA 4A0ZA 4E7LA 1WVRA 3M8JA 3OYFA 3K9JA 3IUOA 3RI4A 2Q2EB 2QA4N 3FXRA 3MQ0A 3WNGA 3SJMA 1IUYA 1K4TA 3NFAA 4NCAA 2R7VA 2QSFX 3QOEA 2EIKH 3V4IA 1FLIA 3NGZA 4RLQA 1TKDA 3OYBA 4AVPA 1HNZK 4B3TK 4LLNA 1WN7A 2G7UA 3CJAA 1NK4A 2JRMA 5B8HA 5AQZA 4C2MJ 2W4SA 4AIJA 4CA0A 5DEQA 3SMSA 1TAUA 3DRPA 1EP4A 3BF3A 2GA2A 4DTMA 1YIOA 3QDKA 2F7TA 1O3TA 5AQQA 3DXMB 3OVNA 4CHNA 1YJNN 2ZGYA 1LEBA 4HWIA 2A61A 1A5VA 3U4LA 4BKXA 3DLBA 2QYOA 5C2FA 5CYVA 4DW6A 4M74A 4I0AA 1NKEA 4UQGA 1UMQA 3CIPA 2KLOA 2V7ZA 3ZT3A 1WGXA 3A03A 3C2GA 1C0UA 4Y1DA 1TT0A 1D5YA 3G2BA 4CO8A 1ESVA 3QINA 5T7BA 1KLNA 2YHAA 1IO2A 4BJ5C 1X1PA 1ETYA 3S2WA 3KYDB 1J5OA 2DTUA 1JHFA 1U8BA 1S5LC 2F5CA 2DMQA 3CQ8A 4NXMK 4ELVA 1KAXA 2PYLA 5CZ1A 4CFBA 3AG1H 2CW0F 2RVCA 2B4JA 2RQQA 5HBMA 2R7OA 4A3JJ 5HRRA 1UCRA 2CW7A 4AH9A 2PI0A 1VF9A 4QTRA 3CJBA 1H89C 2KP6A 4XLHA 4DF4A 4CESA 4NB4A 3NQOA 3HYIA 3AA2A 5HROA 1OQYA 4RGSA 3A5OC 2O8CA 1JUPA 3KPHA 3E6CC 2CH0A 4CGDA 1WQ2A 2BY3A 4BRKA 3J7AO 1T6DA 3SV4A 2V26A 2XIGA 4AUXA 1SKSA 1I1SA 1U78A 4P9UA 4FPAA 4MDAA 3MN6A 2HZDA 3RYRA 2CUEA 1ZQ3P 3PL8A 3F6OA 1YO5C 4MTDA 1K61A 2V9PA 1TK8A 3CUQA 2HQ5A 2IGMA 4DUZK 3L09A 5LHHA 4U7BA 1I3QJ 2QBYB 4GGGA 2YU9J 2WC2A 5K14A 5HL7L 4OO1J 3U8XA 3S3MA 4DTSA 2F5DA 3TOAA 3BZKA 3M07A 5LMUK 1VQKN 2AP1A 4WFNL 4A2UA 3K4LA 4PA1A 3ECOA 4HA8A 4CHZA 1NGDA 3O3FA 3C6HA 1HKTA 4II2A 4XNFA 1O3RA 4IO8A 1IRGA 1Z9CA 2JWLA 3ZQHA 3AO4A 2IDOA 4W5OA 3KZBA 1WSFA 3KEQA 1XWLA 2XRNA 1W5CC 3A02A 5B3SH 5DM6L 4XRFA 2XKOA 2NRTA 2VC1A 2RV8A 3VF6A 1OH7A 4C1NI 2E6MA 2OPPA 2LTPA 3EE9A 2BDPA 5B1AH 1DEJA 3C7NB 3GZ5A 1BC8C 3IKMA 3ID8A 3G71N 1O7FA 3OJSA 3BLYA 3KLIA 2R93J 2E20A 3F21A 3SQ2A 3C18A 5E3LA 2XGEA 2VB6A 2KDZA 2JWKA 2DA4A 3VEPA 4X0GA 2GIVA 3DOLA 4FSVA 3J80O 1R59O 3VERA 2I7PA 3QRFF 3F3XA 3ZMDA 1DU0A 4HQMA 4IDHA 4IHSA 4XLNF 4OIOF 3JRDA 3FWEA 3M7GA 1YTYA 3GYHX 1HKBA 1TK0A 4HYEA 4IRGA 3T7ZA 2P9NB 2P4WA 4CJLA 1YI2N 3VEYA 3KVGA 3T5XA 3UKRA 3G6EI 2GWJA 3I55N 1AWCA 1XCVA 4KN7X 2KFNA 4ELTA 4B8AB 1FYLA 2RKIA 1WJFA 1MJ9A 4H0XB 2OZMA 4BC4A 1R49A 1NG7A 1VQLI 3RMBA 5HDGA 1F21A 4EFHA 3WNFA 2GOXB 4DCHA 5F04A 2OJED 3OYJA 3KK1A 4X62K 5JVHL 3K5OA 2KJCA 4Y15A 1QBJA 1X3UA 2HVQA 4Y13A 1JLEA 3NH1A 5K7ZA 2F8TA 1NWKA 3AO3A 2D1VA 2ZJQL 4B9LA 2LBFB 1NK5A 5B66C 5FKKA 3HHHA 2VODA 1FWZA 4BC5A 3O3GA 1JI8A 4JI5K 3TAFA 2GV9A 4CYCA 1A04A 3GE1A 1JL2A 3IWFA 2AS5F 2YPRA 5J1YA 2NRAC 4CFDA 1VQ4I 1O13A 5J4VA 3THVA 4S04A 1FIAA 3CD6N 1NOZA 2CQ7A 1LQ1A 5EYRA 4IKFA 4B9TA 3LP0A 3R8EA 5GADJ 1YITN 1JJ2M 3ZQ7A 4FLYA 1YVNA 5IY5H 5KRTA 3LSTA 2NS7A 4NDLA 4CJUA 4Z4EA 2O8EA 1YJ9I 2HNYA 4LD5A 5LGTA 4NHJA 4F91B 5JR3A 3TSQA 5FPNA 4KRFA 2KHOA 2X1CA 2Y0SN 4O0IA 1LFUP 1BO5O 4CBUA 3EZWA 4WQ5C 3LPUA 4BU2A 3HPGA 3MDQA 4QLCU 2DOFA 4MEXF 1S7EA 3CMAN 4I09A 3CCMN 2DYRH 3T19A 1RR7A 2RNGA 2XF7A 3SEQA 1E17A 3WGHA 3U6FA 1F9NA 2NVXJ 1KAZA 4KNYA 1MH4A 4RB3C 3TABA 5J1UA 2QM1A 1U45A 3MCAB 3CCRI 3JRGA 2NS8A 2VKHA 4I76A 2VJ4A 1B9DA 1MWMA 1SVLA 4CI6A 4IWVA 2HHVA 4FJKA 3KTQA 2KLAA 3GFMA 3D2FB 1X4PA 2WFBA 1QZ5A 2YR2A 1TKTA 1S9EA 4CGFA 4OGEA 2O9LA 2K86A 4LG0B 3SK3A 3S1QJ 2IS2A 1BCOA 4HOBA 3NRVA 2LREA 5DM7L 4CERA 2WAFA 2LYCA 4L5JA 2M7BA 1GVDA 3GOIA 5JHFA 2R7FA 3V7RA 3AVHA 1V5FA 3A8YA 4DTJA 5AZIA 4RS8A 4NNJA 3H3UA 1S7OA 1T39A 1LAWA 2QQAA 4R8HA 5DDGA 4M3BA 1MNEA 1LE8B 1VQ7I 4PJMA 1VQ5N 1RT3A 3P4IA 4ID1A 2G8VA 3DOKA 5FJ8J 4M7XA 1V55H 3QBWA 2EFQA 3QEXA 3SZ2A 4DS5A 3D1NI 4JKEA 4KFCA 1T0FC 4Z0UA 4CK2A 3KE2A 4M3RA 2LD5A 2O03A 1HSJA 2H27A 5CVUA 3PSIA 4GCVA 5BPMA 5D4RA 4O8UA 3LDOA 1IG8A 1TV6A 2RGVA 3RCOA 2YS9A 4DG1A 3IKTA 5HNFA 2A6AA 2ZB9A 4AM6A 1LV5A 2CGLA 2NS0A 2W40A 3U3GA 5LGNA 3VSLA 1BWFO 1V5EA 2EZIA 4GNIA 4I2QA 1G8XA 4BQOA 2X48A 2KT0A 1DGRM 5F08A 3CLQA 2KZMA 1ZR2A 2B0LA 4YOTA 4ICLA 3DKWA 2OU2A 1A5JA 2BGCA 2P6TA 3A4CA 1BR2A 1Z21A 2RF2A 2Y48A 5IWAK 3MXMA 4JEPA 1HYSA 2HHTA 3TTDA 3AA3A 4AU7A 4B47A 3WU2C 3QPSA 1HDPA 4N76A 3VYSB 3BR1A 3F8MA 3DU6A 1MW7A 1B9MA 4JOMA 2HVSA 2CWEA 1GXQA 2XUBA 2ZXJA 4M3TA 3CDIA 3AGRA 4KTQA 3GZ6A 1N25A 1JT0A 5GP9A 4CD1A 3O9SA 2ECBA 3E1SA 5LGUA 5JICA 2YKNA 5FDLA 3GCMA 1OCPA 2ESNA 4BRCA 2DOEA 1XSDA 2K9QA 1XMKA 1IXCA 4BRPA 4EJOA 3RIRA 2L2OA 2WA0A 3H6EA 2LSOA 4YHHK 1KVBA 4NXNK 2ZNYA 5F1RA 3RPUA 2EB7A 2F9TA 3HHGA 1EETA 5LBQA 4CZFA 1ASUA 4JV5K 2FE3A 4YFKF 1NBWA 3DPUA 2QUFA 3VPRA 4A3FJ 3BOQA 4PSXA 1HDDC 4EM0B 1QVUA 3HUGA 2B5JA 4GKJK 2VKEA 2NVTJ 4JYAK 1MKMA 2P9KB 1ODDA 3WTYC 1K7AA 1QNTA 4WQ5A 1MWKA 4FZYA 2F2EA 5E20A 1K9MO 2L3DA 3BQYA 4A3IJ 3OWTA 1BU6O 3W2WA 2W24A 2IGNA 1Q1VA 3MXIA 2F5EA 4JD2B 3VMFB 2PYJA 3O3KA 4N0BA 1A31A 2KISA 1G99A 4P55A 1RDAA 2MGQA 4I2PA 3CJTB 1NHAA 2F4VK 3K2ZA 4CZZA 4WXCA 4BL0B 4IRIA 4C30A 1DTQA 2EV0A 3V9WA 1OYWA 5LHIA 3I0SA 4CK3A 4F8RA 3CC7I 1QHAA 1BL0A 2B7EA 1ETKA 2JK3A 4KB0A 1UFMA 2KQRA 4HG2A 1TUYA 4BQLA 4NQWB 2Q0OA 1W7AA 3SCXA 3KWGA 3OOUA 1EF4A 4C8LA 4CF9A 3AAFA 5BMZA 3SJHA 5C10A 2DT7B 2E1CA 1BL3A 1UELB 1S8NA 2PQ8A 2RE2A 2MSYA 4IEIA 3I71A 4HF2A 1XQSC 1FJGK 1VNDA 3J8AA 4DTUA 4RA2A 3IH2A 3VYUB 3SFZA 2V9KA 2WV0A 3HL2A 4OKEA 2P9SB 1LPQA 3V1RA 2DMTA 3H5AA 5AONA 4L8RB 5KVRA 2MH9A 2X6WA 4DS4A 5AQUA 3AGKA 1WSUA 1ZAOA 3O9QA 4CIEA 3HBTA 5CE3A 1BISA 3ATUA 3JRIA 4YOYA 3EL2A 3VQAA 3MEGA 4HQEA 3KEOA 1T0FA 1Q9XA 3RKWA 3K69A 3AO2A 1YJWI 2JWTA 2XVCA 4JKGA 3SDGA 2QA4I 3ABKH 1W0TA 1B8IB 1FOKA 2VJ5A 1GLNA 1YXQA 3WT0A 5EY4A 3ZETA 4XR6A 3WXMB 4MIMA 2TDXA 4M72A 1NU0A 1XDUA 1X58A 2HBKA 1PDNC 2BY2A 4PHTX 5FLXO 2JA2A 2IGOA 1PYVA 2E60A 2VE8A 1BCMA 3BY5A 3CTAA 1ATRA 1GOBA 1YRNA 2EH3A 1WSEA 3M9AA 4ZDPA 3JSMA 4DV2K 2NUBA 1YJNI 5C12A 3HDDA 2P9LA 5M5YJ 1QSLA 1YX3A 3IFRA 4BE1A 2FMLA 4XLFA 2O4IA 1LCUA 3P31A 3IDHA 3G3ZA 2CS3A 1G15A 4D7MA 3Q0UA 1RT4A 3V1QA 4HF0A 1H0MA 2Z33A 3HOYJ 3P38A 3K57A 1WSIA 1NK0A 4O6JA 3QEIA 1ZRCA 2F96A 1IN8A 1OR7C 2R4GA 2LKSA 2XHKA 1YHQN 4KA4A 2HKOA 4M3DA 4O3MA 5JFRA 4DFJA 1K83J 3UNGC 2M9HA 2GX9A 1W0HA 1T56A 2Y30A 3RPUD 2Q2EA 1VQPN 3ULDA 3COAC 1ZXOA 5HODA 3PNYA 3LM2A 2ESHA 4D7NA 4AM3A 1MA9B 5J2NA 3L0QA 3ID6A 4PJJA 1NJZA 4XLAA 3CETA 4HHTA 2DA3A 3EKUA 2XY5A 5DS9A 4V2FA 3GFIA 5IYDJ 1J6ZA 5H6RA 2XKPA 3K4KA 1UHSA 5K7FA 4DSJA 3SEZA 2L5QA 1NK9A 3NAEA 3ULQB 4BE2A 1E4FT 4ZJZA 3I4PA 4A12A 4CEOA 1QA6A 3DXMA 4RG8A 3B6OA 3ENBA 4ENNA 1NGEA 4FWSA 4JI4K 3OYNA 1RDCA 4CJEA 3PUFA 4B9QA 4I6MB 4I01A 1Z26A 5K5OA 1J9IA 5E18F 4FK4A 1A36A 3T0YA 1HKQA 2L4MA 3T8TA 2UXCK 2BE2A 3OYHA 2Z3YA 1PUEE 1IN4A 2EA4A 3HPOA 1S72N 3DI6A 4KJZA 2VOPA 3FIWA 1BIUA 2P7CB 4K0KK 5HNHA 2BW3B 3KYLA 2ETJA 1XS9A 1DGKN 3VQCA 2FF6A 3U9GA 4RM2A 2D0CA 1TAQA 1VSHA 2OF7A 5F0HA 2ZF5O 3GTPJ 2E2NA 1ENHA 1R36A 2X6YA 9ANTA 1BM9A 3U9DA 1IAWA 3BPVA 3IKVA 1J09A 2FEZA 1RPWA 1FOXA 2VPRA 4JKDA 3OS1A 1ORKA 2DFIA 2NRVA 4JAXA 1HA8A 2JVGA 1MNDA 3ZX3A 1TUUA 3LA7A 4JK7A 4FM2A 5IT9O 5M1OA 4PKHA 3DLEA 3OIPA 3LAPA 3H35A 2G8UA 5FD6A 5H6QA 4L0YB 2MLKA 4A3BJ 2FQ3A 4U7DA 4OGCA 2KDOA 3L00A 4AYBA 4ZTFA 5KPRA 4IJAA 4H4OA 2JN6A 2R7SA 4CHOA 3TQNA 1I6XA 3MMVA 2QBYA 1QZZA 1O4XA 2FBYA 2UUAK 3DQVC 1TW3A 4KHNA 4JKAA 1UG2A 5JI6A 4RGXA 4RWTA 3ZRGA 3BG7A 3HKZA 4ZC3A 1MBHA 3K1PA 1YI2I 3CCEI 3MX2A 2Q1ZB 4FJ9A 4RW4A 5LMNK 2KRCA 3P39A 5C24A 1B59A 1QU3A 1R1UA 4LH4A 2G7HA 2DLLA 5CLSA 2YI1A 3IC7A 4NBQA 3CCLN 5LJWA 3MZ8A 3RJPA 1SL1A 2AO9A 3AVMA 3VF4A 2FX0A 3FMQA 5J8CA 4FPBA 4M63C 4X65K 2DMPA 1MGTA 2ME0A 3O4QA 4E70A 2R7XA 2P9UB 3RDIA 2QM3A 2FBHA 3C1DA 3VQBA 4BG9A 4L9NA 3S3NA 1J59A 4FJ5A 1XMXA 3KFWX 3MCZA 1LVAA 2CJJA 5JLHA 4XLCA 5D5XB 4DR4K 3I33A 1O1WA 3PIOF 3C7NA 3PQJA 5CY4A 2QK9A 2BOLA 3Q7BA 4I7FA 3SBGA 4DHYA 1WFXA 1G3TA 2G8WA 1SMTA 3GMEA 1HCRA 5KI6A 3CD6I 5GAEJ 4M3YA 2RC4A 3IH3A 3NH0A 4LLGF 3WXKA 4B3MK 3E6MA 5D6FA 4BQZA 3CCSN 2H1LA 1GLLO 3GTQJ 1IKWA 3E5UA 3FZFA 3E66A 5C15A 2VGNA 3FX3A 5HDNA 2J5PA 2Z99A 2QSGX 5H20A 1R0AA 2QWRA 5B1BH 5LD2C 2P9NA 4DLGA 5CYMA 2DMNA 1JGSA 4XONA 2RREA 2NRXA 2EFWA 2YNFA 5J2QA 4PKGA 4DKWA 2P9PA 2QWMA 2D5VA 1P4WA 5LL6Z 4B9VA 2LG4A 3B6PA 3LZJA 1X9JA 2E88A 3MEDA 2VE9A 4BGBA 5E3MA 5LEKA 4BAYA 3CHWA 1ZG1A 3SAGA 3CMAI 3N4MA 1MMNA 3CCMI 4DSKA 2IT0A 1KTQA 1G4DA 4CDGA 3DBRB 2LK2A 2OPSA 3R4KA 4RAGA 1Y0NA 3SYTA 3W6JB 3P1GA 5F1JA 1VFCA 2GUPA 2LBFA 5M3MJ 1MBFA 4F3QA 3QU6A 1LKXA 2XY8A 3SMPA 4LK0F 2CGKA 1OYYA 4LK1F 2ID3A 4J19A 3HRGA 4LSLA 2D4WA 3JRBA 1IW7F 4IZZA 3SQ0A 4J2EA 4HRIA 1G3WA 1SL0A 3FLCO 3SPZA 4Q5SF 4DFMA 3BROA 3G4SI 1GLJO 2JLEA 2UYTA 4BGAA 1ZGWA 3LNQA 1NMDA 4BY1J 1VQ8N 4CEDA 5IOZA 2HYJA 2AXLA 1ASWA 4CCJA 3G1MA 1VQ5I 4IHXA 2BH1A 3QYBA 1TLHB 2H94A 4CIGA 5GTHC 4BY9C 1TP4A 1UAXA 2D0PA 2BHZA 1BN5A 3DBHB 4FL9A 2KW4A 2ZMEB 1RT1A 1VSDA 2VYPA 4GW6A 5DV5A 1OKJA 4DJAA 2P5OA 2FSNA 3JRHA 2WB1N 1K4SA 4XLPF 3J7YP 2OAZA 1NJIO 3DPTA 4MLOA 4DTPA 4MLHA 4QOZB 3AKZA 4WYBA 4FLTA 2VBYA 3ZEUB 5FFZA 2HB5A 1XI1A 5JVGL 4HAMA 1BW5A 2HHUA 2Y75A 4KB1A 4CJ4A 2CQXA 4GV6A 2CG4A 3WXJA 1JJ8C 3D2FA 2F4IA 4WFAL 2G0EA 4G94A 1BUPA 4LD0A 2QF7A 4PL8A 2DA5A 2R5ZB 1WLJA 2O6GE 4LG0A 1FIPA 1T8IA 1H1VA 2LR8A 2ZKZA 4IFEA 1I6HJ 5CVJA 3LDQA 4RGRA 1TGOA 4AHTA 1RT7A 1BI2A 4OPHA 2PBIA 4A3MJ 1QRYA 4LF6K 2D5RA 3KIOA 4KKOA 3EETA 1NK8A 3DRSA 2K9NA 3M1EA 1K78B 1JCFA 5C3EJ 2R7DA 2KKOA 3NAUA 2EFNA 2FSWA 5TKYA 2EZKA 4FVMA 4DU1A 2EQRA 1N33K 1Y8QB 4CH7A 4KIGA 1XMAA 3VSKA 3VQ5A 4K42A 2HWVA 1FK9A 4GVEA 1R23A 3V7SA 2HHSA 5AQMA 2HHQA 2VXDA 4DWIA 3GTLJ 3P9IA 4H5VA 4HUGA 2V9VA 1D1CA 2NVUB 2VXZA 1SL2A 3OYMA 4YEJA 4LF8K 4A3KJ 4CF2A 2VUMJ 5M1PA 1IN7A 4E7ZA 4CJRA 1D0XA 4DQRA 4LGWA 5AQKA 2GBZA 2A1SA 1RBSA 2KZGA 3L9FA 3S8PA 1IDZA 2YHBA 4CZJA 5FO5A 3SI6A 3L4QA 3H9QA 2R5YB 5K7HA 1YIJN 3V9ZA 1OH8A 4DQ2A 4BY7J 2I7NA 2MG4A 5GTIC 3L2VA 2WOMA 1FNNA 3EEQA 4B8XA 4O5FA 1EV7A 4UY8O 1IGNA 4IO9L 2XY7A 4LC9B 2HXOA 4G6QA 2DTZA 2BY0A 3EUKL 1DGWY 5FKLA 3CM6A 2FLOA 1CZ9A 2EX3A 1RIOH 4FX4A 4EJUA 1RTJA 1NMNA 1HJRA 1W7PB 3DM2A 4YNQA 4N56A 1BR4A 3D5SC 3TANA 2I5UA 2P0WA 3WTUC 4HUEA 3DEEA 1OH5A 3PIPF 2HQAA 2A3ZA 4P5OA 2JVHA 2AA4A 1XUPO 2G8KA 3B6AA 2DPUA 1EX4A 3V6DA 1S22A 2O8FB 2DT5A 1P8ZA 3LQRA 1MZBA 2G8FA 2DFEA 1HW2A 5CHIA 1QTMA 1VSLA 1FPQA 3QERA 1LAVA 2EIJH 3JSPA 4BRNA 2P9KA 4BC3A 4L9TA 4AHCA 3W6KB 2BYVE 1RFQA 1D5AA 4Z6YA 2VJJA 3ZMZA 1PUFB 2A6TA 1N6QA 4YIFA 2K3FA 3HJFA 2VCPA 4UV8A 2CMPA 1ZYQA 3BJAA 1NLVA 4EP5A 3SBTA 3KD1E 4FZXC 1FBSA 1Y0UA 1NK2P 2QWWA 1B9FA 4B3AA 4O55A 3K70C 1TWGJ 2FA5A 3MCPA 2J4RA 3CG7A 1VHXA 4IX7A 3IAS2 2V51B 2BXZA 3VQDA 1ZREA 5J8FA 3ISNC 4FWLA 4I99C 2E1MB 4GXOA 3H5RA 3WTXC 3V9XA 3ZN0A 2PMUA 4NQWA 4Q47A 3HP9A 1NGIA 3EYYA 1OJLA 1QVGM 3R61A 3OBWA 1DQUA 3S3OA 5HRSA 3WNHA 1JLQA 3SHFA 5KAIC 3FZHA 2VONA 3CCQN 2FF3B 2NRHA 2XGXA 2L9SA 3S41A 3FZLA 1V3FA 2FJ1A 3CQZJ 1QHHD 1IZ1A 1KYWA 1VQNI 2P9SA 3H0GJ 3SZGA 4BRQA 4RW6A 4RAFA 2IAIA 3HJEA 2Y31A 1BJZA 2X1EA 1BI0A 1P4AA 3JW4A 3F8FA 1WKMA 2YHXA 1EH6A 2OD5A 1YHQI 3CFRA 1XNQK 2XRLA 2NLXA 3HSRA 1P6RA 4DMNA 5ICEA 3GL1A 2ZXWH 2UUBK 2CH5A 1HLVA 1VQPI 2M87A 1B8IA 4GKKK 3O8GA 4JKBA 3P5JA 4CEFA 5H2FC 3MWTA 4CEBA 5KQDA 5CZ2A 2IJLA 3OJUA 2QI2A 5K5QA 5AZJB 1D1BA 4BR5A 3FISA 1JKPC 5EVZA 4W5QA 4W1UA 1LB2A 3LA2A 5ERIA 3MZHA 1MBJA 2O7OA 3SUNA 4KHQA 2CQQA 4LG3A 2Q0RA 2YU3A 5IP9J 1IN5A 3CP2A 4BXXJ 2WTEA 5DUKA 4IOAL 1LJ9A 4C8NA 3CO6C 4J2BA 2HOTA 2ISYA 1Y97A 2IGIA 3MAJA 2ETHA 1H8AC 1E4GT 4BEHB 2O8BB 3QEVA 1N5YA 2D0OA 4CCHA 2FMYA 1I5ZA 4GYIA 1SFUA 1TYQA 2ZGZA 3VGMA 4BRMA 3KLHA 4DF8A 2ASOA 3H1VX 3CCVN 3THWB 1R6RA 2KFZA 2KIQA 3MAQA 1S6PA 1V4SA 4A2BA 4CJPA 1YS7A 3IL2A 2CUZA 3WG7H 1Z05A 1X1AA 1RTIA 3WXLA 2E2QA 2VWJA 5LRSA 1C1AA 4OJRA 4FLXA 3QETA 4M3ZA 3HEFA 5IYCJ 3NVMA 3S15J 2L54A 3S93A 2L4AA 5BPIA 1D3YA 4PL7A 3BZ6A 5AQLA 1I94K 1SUQA 3JRFA 1FYMA 3O4NA 3OMYA 1JTXA 1N34K 1W36C 4LF9K 4NCGA 4ELUA 1LW0A 2PFBA 5E41A 2VQEK 2D45A 1QVTA 1LW2A 3T1BA 3WXIA 3W3DA 2OA4A 2R7ZJ 2BVLA 2X6NA 2Q0UA 3ALYA 1MSFC 1E3OC 3HZJA 3VODA 3D7EO 5L3EA 3C7JA 2K7LA 5K1YA 4DTXA 3D2EB 4DR3K 4JBAA 3E01A 2GQQA 3CUOA 2EZHA 1F4KA 1X9MA 4KPYA 2HF4A 2WBMA 3CYMA 4M9ZA 2FBKA 2E1OA 1X3NA 2BVMA 4DR6K 5AQYA 3QEPA 1MJBA 1NKCA 4I6MA 2CV0A 3QPHA 2FBTA 1N78A 5GIOA 3OBYA 2EZLA 4RM3A 4IFVA 1T3VA 3PX4A 4H4KC 1XGSA 1V54H 1LUJB 4DOZA 5E79C 1TTYA 5BOXA 2DU9A 4W97A 2P5GA 4RW7A 4QWQA 4IRHA 3LALA 2QXFA 4JQFA 2VQHA 2Q2RA 3LDPA 3L1PA 3M1FA 3VTHA 4CECA 2EHGA 2BW3A 1HKGA 1O3SA 1C0MA 4IEEA 1QSYA 4D5CA 1SEUA 2HVRA 2M4GA 2F8SA 2HW3A 2BV6A 4RBOA 2W85A 3M8RA 3THXB 4CK1A 5FKMA 3QMLA 2VT3A 1WSGA 4CF8A 4M9XA 4A5MA 5D8LB 4A6DA 4NCBA 4IEJA 3M4OJ 1RBVA 1Y6IA 2E2IJ 2AQEA 3D5LA 4AWXB 1OFCX 1J9AA 2XO7A 3VQ4A 3GBGA 4CBXA 1FKOA 3HSTB 2YX7A 2A40A 1JCEA 1UHMA 2K27A 1HW1A 3G73A 4DU4A 3PM1A 3AVFA 4M6VA 1UA1A 2X6SA 3CCSI 1NGAA 3GTJJ 3GF2A 4WCEL 5BN8A 2WV1A 3AAQA 4B3OA 3GTKJ 3CC2N 1KA8A 1XB4A 5AFUA 3R1XA 1U9NA 2ZMEC 4X64K 3GZNB 1STZA 2Y0SA 1D8JA 1YW7A 3QOPA 4HV6A 1SD6A 3ZT2A 3BDPA 5ILVA 3L7WA 2DN0A 4M41A 1A5XA 4UVAA 3ZSYA 2VT2A 3H9GA 1HRHA 4MEYF 3AL0C 4MFDA 1SQKA 3DCFA 3VTIA 2DTRA 4Z4IA 2IEKA 2VLAA 1RNLA 1FBQA 2ZXHA 3H08A 1TW2A 3E5QA 3J7AY 4BDZA 3FZKA 3HM9A 3T8RA 1YG2A 1QS4A 3L3VA 5HDKA 1N75A 1OPCA 3R0JA 4LMYA 2EA2A 3IAM2 1RGIA 2NAZA 3MN5A 5M1NA 2JMWA 3LSHA 2Z1GA 1B1BA 2M0MA 3TEDA 2UZKA 1U4BA 1P2FA 2M45A 1ASVA 1TWFJ 3CF2A 3VQ7A 3BR5A 3CI5A 3VGLA 2P5VA 3TAQA 4BR4A 1XMOK 2IIRA 4W5TA 2BXYA 4CJ5A 4ITVA 3RR8A 3KP4A 2A3SA 3BG3A 4U88A 1RBRA 1Q9YA 4OPKA 1EO1A 1L5UA 1YTUA 2P5KA 4LSNA 4HW0A 4IF4A 4DU3A 1RZ4A 1WJ5A 2AQFA 2L0KA 1VZ0A 3GX4X 1K8KB 3I56N 1VQ8I 1B92A 4B1VA 5HLGA 4AIDA 1YYVA 5AQPA 4AIKA 4YDUC 3CDLA 2E2PA 4AHUA 4CXFA 4BC2A 1B72B 2RPIA 4MO7A 1E2XA 4DR2K 1WB9A 2Y1JA 3AO5A 3DXJF 1NH3A 3IRQA 3WTTC 3TTCA 1J5EK 2JA6J 1ULYA 3JREA 2YHWA 5JS1A 3QBXA 1R4MB 4F93B 3TL4X 1JXBA 4O5BA 3AA4A 3RMCA 2O8DB 1KFSA 2NOJB 3K9TA 1RCHA 3I4MJ 3DFGA 1TQIA 4CGIA 2HGCA 2IA0A 2HR3A 1IKVA 1U5TB 4Q0BA 3GDQA 3S2DJ 2PN6A 3CM5A 4CZHA 3L3UA 3VYTB 4AHSA 3TSUA 3LSMA 2DY4A 3NE6A 4DV3K 1QPMA 3PFIA 3OYIA 3ROUA 3VWBA 3BUZB 1U6GA 5DCMB 3MVPA 1WAFA 3IMXA 4ZYEA 4IQJA 2STWA 3ULEB 2QCOA 4JP0A 2BUPA 3OSFA 2W7NA 2XAHA 4DV5K 1BOTO 4BH9A 1OCZH 4P9FA 2CYYA 2W1OA 2ZFWA 1U2VB 2MW8A 2NYXA 3F2KA 3WTWC 2XPVA 4ON0A 1RDWX 1UG0A 4OVLA 4B1XB 1BA0A 4XKWA 4HPQA 3LDSA 3TP3A 4ZYGA 2IPQX 2Q8KA 3MX5A 2QWOA 1VTNC 2V1DA 4ILHA 1EQYA 3PUBA 3QFUA 4G6DA 3RKYA 3M6GA 4DLEA 1YQAA 3M3YJ 2X6XA 1YX5A 2H8WA 1OISA 2OBPA 5LLQA 1S1VA 3QEWA 1NK7A 1QO0D 1CLQA 3U2RA 1SZ2A 4N41A 2X9DA 1ETXA 3Q9SA 3TPQA 3E9PA 4BYYA 3BR6A 1PVEA 2I8DA 3NWSA 4CZGA 1HPMA 4CE9A 2FC0A 5KCMA 4BQNA 4Y7NJ 4DQSA 4B9MA 4FJGA 4L9JA 4KMUX 3ZEUA 3TMOA 2R7WA 3TO7A 1NGBA 3PO2J 3NF6A 2TCTA 4UUSB 4HTLA 4DGWB 3N97A 3O9TA 1XGNA 3DLLL 3I64A 1ETVA 1KYZA 3D5RC 5LEJA 3BCAA 1A5WA 2R5ZA 4UUTA 2AXTC 2E1MC 4DSLA 2COMA 3TAMA 3QODA 4NC8A 4F55A 1HQCA 1Q8IA 1J75A 2LOOA 2PG4A 4W5NA 2M7AA 3G10A 4Z94A 5L3GA 3TAEA 5E8GA 5LHGA 4Q48A 2ZJRL 2NXNB 1QZ6A 1T38A 4DBRA 3OYDA 2O8KA 3WU1B 4I7HA 5BNGA 2E1YA 2W84A 3DXKB 4IG0A 1K78A 3HYFA 1QQMA 1RDBA 4FJNA 3MN2A 4FM0A 3F9KA 4DTOA 4CHUA 4N4OB 1KU3A 1IKYA 3FKJA 4RAYA 3W3CA 5IP6A 1LOTB 4LFBK 3JRAA 2VQFK 3CLOA 4BDPA 1XC5A 3HOXJ 2QQBA 3F23A 3C2BA 4DYCA 3JTGA 5AQGA 2ZC2A 4RB2C 3FR0A 2XV4S 4YDUA 2XF6A 2Z1JA 3V4GA 3RTVA 1FC3A 5E26A 1APLC 1GV5A 5EEGA 4M7YA 1JJ6C 2IRFG 2XRIA 3HIFA 1GV2A 3RSEB 4FJ7A 2QWNA 4L3QA 2A5WA 2DO7A 1HSTA 2R7UA 1QPIA 4CFCA 1SAXA 2COBA 4FVUA 1JL1A 2VC0A 3K2PA 1XGMA 2JA5J 2Y2ZA 3ITHA 3KEYA 2D2WA 4IBNA 4BR7A 2ZBKA 3L2UA 4C9YA 3MN9A 5GAHP 4DSFA 4YOWA 1QQIA 2R5YA 4BQQA 3ZQLA 3F8CA 1LVKA 5C44J 3VQEA 3ZT0A 4GMJB 1NGGA 3F22A 4XKVA 2F4OB 3QP5A 1J5YA 2JTVA 3LMMA 4N5SA 1HOMA 2L7FP 4RLFA 3AVKA 2Z9OA 3EKSA 5CR4A 4BBSJ 1XMQK 4DYRA 3LSRA 4FWPA 3TDUC 3OHRA 1S1XA 4HCBA 2WC9A 2FBXA 1MNMC 1WWXA 5EEHA 1JLAA 3X2QH 1W7PA 3LP3A 1GDTA 1RTDA 1W0UA 3DLAA 2LMDA 1C1BA 1VQ6I 3TW7A 5AQWA 4KHWA 5BPDA 4Q4ZF 1FZPB 4KUMA 2M5WA 2DK5A 1R7JA 3QO9A 1XNRK 2OZSA 3TW6A 2O61A 2LY9A 5F2RA 2R7QA 4F3OA 3BP8A 4FLWA 2VWKA 4MHGA 4BACA 4BREA 1ON1A 3K7AJ 3OS0A 2XAFA 2MD5A 4II3A 3GW2A 4DQQA 3A5MC 1ZR4A 1D4XA 1O57A 3FM3A 3JR9A 3FZVA 1DPUA 2JUCA 1HNIA 1B9NA 1DU6A 1AU7A 1HW5A 4YOXA 5IT3A 3A1YA 1REPC 2P1JA 2AHQA 3DF8A 4M6XA 1WCMJ 1P92A 1QGPA 2QGUA 5M5WJ 2CFOA 2DI3A 4O0JA 1KQ9A 4CVNE 1SKWA 3TWHA 4BWMA 1G3SA 1U8RA 2HZTA 3EUAA 1X2MA 1FJLA 4MQ9F 1L3UA 1KCFA 3BG5A 3H1QA 1IRZA 4WCGA 1E3HA 3CESA 3O3HA 1RC9A 1QHTA 3H3NO 4MNUA 1XSXA 3ZGKA 3PNVA 2O8EB 1K8AO 4XBFA 5BREA 1TZLA 2OPRA 2GIZA 4P1WA 4A57A 1P7JA 4HNUA 1BI3A 3ZMUA 2Q1NA 4H0PA 3JSOA 2F5VA 5M3FJ 4B9UA 1CQTA 5BPNA 1Z91A 1X2NA 4M3WA 2RN7A 2DODA 4E19A 4OLBA 3VQPA 3NHGA 5FB2A 2FXUA 4XN0A 1T95A 4CF1A 1MH3A 4B3SK 4G7ZF 3BTIA 3GWZA 5HVQC 4L5EA 3KD5E 2K4BA 3NMUA 3HT3A 1LDDA 4XH1A 4ZH4F 2K9MA 1KZHA 2ADUA 3PFYA 1AA7A 3VOVA 1C1CA 1XG1A 1ITYA 3DP7A 2NNNA 2NVQJ 2HQNA 1MIJA 3DV8A 4KTZA 3CMEN 3L2RA 3CCVI 2BZTA 2R7TA 4A62A 1EA3A 3VA0A 4EQQA 4KFBA 1ZARA 4V19K 2E71A 4JX6A 1HR0K 1MBKA 3ZSZA 1HLUA 4WXHA 1FW6A 5TJJA 1T6CA 1X1CA 3LSKA 2HVHA 3V8KA 4MO5A 4IG3A 1KU9A 3UE5A 2HNHA 4V2GA 3HTUA 3FBIB 1HNWK 1DTTA 2BGGA 1TL1A 1J53A 3EZ5A 2H3GX 1WPKA 1G3YA 5F0XA 5AZJA 4YOUA 2CH6A 4FCYA 2V6CA 2KHMA 2RDPA 3KZYA 2NNWA 2QWLA 4QS9A 5KRSA 2LY1A 5F6FA 5FPDA 5DUIA 3MKYB 3EDPA 2QTDA 4EHUA 1MMDA 5D8KB 4FW2A 4M3EA 4A5AA 3QPTA 3L4IA 1IJJA 2IXSA 3NWTA 1Z0XA 2DOAA 5CQEA 4C2UA 5TGTA 4LLLA 2ZCWA 4CJQA 2QEXN 1ZC6A 4BEHA 2O8BA 4DNCA 4RW8A 4IJNA 4OKKA 5EOYA 2X1DA 2FU4A 2OCCH 4XKCA 1UB9A 2LSNA 3O80A 3CCRN 4OMZA 1MMAA 4RAZA 1QZYA 3THWA 3H3ZA 3OR1C 2HQRA 3BTLA 2E8AA 4BWJA 1V4TA 3RKXA 4FOIA 2YNHA 5JS2A 1RBUA 5CPRB 3FFKB 3BQZA 5LY3A 2DXIA 3O4WA 3B73A 3HSCA 4PKIA 4ENKA 3S1RJ 3FE1A 2EV6A 2GOMA 1WSHA 1QQCA 3KP3A 2B6AA 4EGYA 3TTFA 4DFKA 4IOXA 1D9DA 4DQIA 3AG4H 3ZR8X 2XC7A 3QP6A 1FSEA 5GIPA 4BJTA 2IC3A 3KHYA 2M4KA 1EH7A 4PJ0C 4IXCA 3DKYA 1Z3XA 4CICA 1FMWA 5D6EA 5BS6A 5EZGA 3ZCOA 3ATVA 2BBYA 2P81A 3LFUA 3BTJA 3CP8A 4Z4GA 1D0ZA 1T05A 3ESWB 2ZSHB 3AARA 4M73A 3D2EA 2F4MB 2PMZA 2E35A 3IG1A 4AM7A 5JLFA 1LDKB 4G7HF 4H5NA 2JPBA 2LF7A 4B48A 2OZUA 3FBNB 3KZZA 4FE4A 5EGOB 3EE8A 4FLUA 2UXDK 4B1ZA 1T8EA 4Z2YA 3K58A 3BZCA 1GLDG 1OLTA 2ZJQF 4JKCA 3THYB 2E4LA 3F72A 5HP1A 3WTVC 4CEAA 4DV6K 4NUBA 3DTEA 4IPAA 1IV8A 3TBIA 3VA3A 4LITA 3CO7C 2CQKA 4FE7A 3F8BA 5D5VB 1G2HA 3WE2A 3H0DA 3RR7A 3J7ZO 4CZKA 4QSHA 5KQ8A 1U5TC 3ZMVA 3GG4A 4A61A 2FNPA 1NKBA 3OYAA 2DDBA 5FD5A 4J01A 4DR7K 4ZZLA 1P7IA 4CGZA 3O8HA 1LDJA 1WI3A 4F92B 4JI0K 1NJXA 5GAGP 4U0VA 4WF9L 3LWMA 4BXUA 3VEWA 4B8CA 1Y39A 1JKOC 1Q7YO 2GXAA 4XORA 3THXA 3SJJA 2MD0A 2EPFA 3CMYA 3QLHA 4CZLA 1FEXA 2MLGA 2E6LA 3IHUA 4XIDA 1R9TJ 2PLYA 4FWNA 1X1DA 2ZE2A 4WXDA 3GUDA 1BIBA 5IPAA 2NRRA 3VN5A 4Y3OA 3PX0A 4ZHRA 4M9SA 1GLFO 1J54A 4B9NA 2DT6A 2VL8A 4OIPF 4YORA 4E89A 3KLNA 1TVRA 3DU5A 3Q0WA 4LIUA 2DBBA 3CFPA 1D8YA 1AKHA 3MXJA 3K4MA 4J2AA 3RQ4A 1S1WA 1YW8A 5HLIA 3I56I 4BG8A 1KQSM 1I1GA 3DWLA 3TDZC 1R58A 4FJJA 2DMUA 2STTA 3I53A 3LZIA 4MQVA 2ELKA 4RW9A 2DQLA 3W0LA 1R1TA 2ZJPF 2FBVA 1UAAA 4FYDA 4IHYA 3JYTA 4HNVA 1ZBFA 3KWIA 2R0QC 4XM3A 4JKGB 3NCIA 3TSPA 3LDNA 4E7JA 4XRSA 2CSOA 4CJ7A 2QKMB 2XB0X 4N4NB 2WB1A 5AFUH 1VQ9N 3ZETB 1FYKA 3MN7A 2KIUA 3UIQA 3KLFA 2RAEA 4ANJA 1Z67A 3DAWA 2XSDC 3B6CA 3CUQC 4A3DJ 4H8KA 1RNHA 3CJQB 3P7NA 1DPRA 1JHHA 2W82A 3A5NC 2GUIA 1GOCA 4XLEA 1YRNB 2WWYA 2KIMA 3J7ZI 2H8RA 3HP6A 3C94A 1YS6A 4A2AA 4OX9K 2CUJA 1X9SA 2DDAA 3FXKA 1DUXC 1TWAJ 4P96A 3ZQGA 2UWMA 3OYEA 3AVBA 3IH4A 2GEMA 2MFZA 2XF5A 4K8ZA 5JLWA 1HMVA 3SNNA 4FK2A 4AC0A 3A01B 4Y17A 4KMFA 2P51A 1RKWA 1QZEA 2LP0A 4G12A 1CZAN 1W9HA 2P9IB 3LAJA 4CGHA 2PJRB 1K8KA 3L2CA 4IHTA 3E97A 1GUUA 4KN4X 4HCCA 4FWMA 3GTMJ 1B72A 2OTJN 3CCYA 3JCUC 3A0HC 4QIWN 1GLCG 2WTUA 1YJWN 4C3JJ 4CCLA 2E2HJ 2CV1A 1ZGJA 4HUFA 1ZBHA 2VIXA 4FHTA 3F5TA 1RRJA 5ILSA 4ZTJA 1IC8A 1IF1A 2O8DA 5EG0B 3PNTA 5AQIA 1R1VA 1JUSA 4ZYAA 1S1TA 2CFXA 3F73A 1L3LA 1U5TA 3HOWJ 3E9OA 1IG7A 2XAQA 4LH5A 2QW9A 3BR3A 4FT8A 3M3ZA 1OCTC 4XOTA 4K8XA 1VSJA 5DCMA 4PDKA 3C6UA 1GLEG 4AVZA 3ULEA 1RT6A 1R71A 4G9YA 1U2VA 2EV5A 1EXQA 1DP3A 1N77A 2WBNA 1U6ZA 3ABUA 4D9JA 4G1QA 1JLBA 1NGCA 3OW2M 4J00A 1EWRA 4YY3K 1M1EB 3TO6A 4O4GA 2IBDA 4GO1A 4IOCF 3LANA 1A6IA 3RPQA 4EVIA 4A0YA 1USSA 1I27A 3KLOA 3GFJA 1QQOA 2YHYA 5HLFA 3GLXA 2Y69H 2Z1HA 1ATSA 1VRTA 2HNZA 1KONA 3SQ1A 3O9UA 4YG2F 1JXEA 3A0BC 3K10A 4U87A 4S05A 3ASNH 3O9RA 3TOBA 1BIAA 3N05A 2IVPA 3GVAA 4B3XA 4FOEA 5J47A 4WQ4C 3ZQFA 3OTOK 2VOOA 1D0YA 2CQNA 4BUPA 3SAFA 3M8QA 4I6ZA 1VQKI 2HNDA 4PJLA 3AV9A 3RSNA 5KPTA 3EUHC 2L7ZA 4UUSA 2FF4A 1ZBSA 3IUCA 3CERA 2XASA 1FTTA 4JS4A 3I59B 3JAMZ 2G8HA 1KLMA 2P7VB 2M3AA 4PGHA 4I02A 6PAXA 1SANA 5J1RA 3FKIJ 2MYSA 2MC4A 2VQGA 3OIQA 4RMNA 5FRNA 3M8EA 1MMSA 4DBQA 1P4XA 1WSJA 2CV2A 3G71I 2OPTA 3QNOA 3SFIA 5GAEP 4JK1X 3CPWM 3WE3A 3I8BA 3C6TA 1TL8A 5BRHA 2HPMA 2CGPA 3DXKA 2MH2A 1S6QA 3V81A 4HX7A 2EFOA 3T3FA 2QQ9A 1ATNA 1B4AA 3ABMH 2HI3A 4A6EA 2P8TA 3KZIC 5FLXK 1ZLKA 5KHDA 4XEIA 2OQRA 4XKBA 4H4MA 3DRRA 2W57A 3MECA 2L02A 3EQLF 2LFBA 2LVSA 1Y1VJ 4RTFD 3I54A 5IP7J 5ELZA 3KYCB 5E3NA 2VBXA 3T1AA 3I5UA 4LY7A 4C23A 3RSEA 2JA8J 3UKUB 1IBMK 1L0OC 4CW7B 2A6EF 3I55I 3KKRA 4KHUA 2HDCA 5CVRA 1G6NA 1TQMA 4UVBA 3V7CA 4S0HB 2LKXA 4DV1K 3HOTA 5AQOA 2W6LA 3VEXA 4EGZA 4FWOA 1RTHA 2LC2A 3CDHA 1SD5A 1SFXA 3LSJA 3KP2A 4KTWA 2L7MP 1W1WE 1N36K 4KYWA 5AQXA 3ZT4A 1KSPA 4EV0A 3MFKA 3QFPA 1S7AA 3RYPA 5C4XJ 5J6XA 1OR7A 5TISC 1FOWA 3MKLA 4UB8C 4RB1A 1W97L 2QKKA 4FWRA 5M1QA 3VESA 3M8SA 3VPZA 3K9KA 5DMRA 3CCEN 4PWDA 1H9TA 3HM5A 1YFHA 2W42A 3HVRA 1ERDA 4OIQF 5LRRA 3ISPA 3CXCM 2P9PB 2CRGA 2QWQA 5JHUA 2V4JC 1WRJA 1C6VA 4LOCA 4A93J 4DSEA 5H1SQ 2PY5A 3GTGJ 3DTKA 3ZSWA 3PO5A 1YITI 2PMZN 2WUSA 3E1YA
chains in the Genus database with same CATH topology
3CFOA 3ITHA 4CHYA 4DTRA 2X78A 3DYAA 2YNHA 4KHNA 2D5RA 1CXQA 1RBUA 5JS2A 4DTUA 3KIOA 4IBNA 1DLOA 5SZTA 3LAMA 2B4JA 4KKOA 3SQ4A 3T19A 3L2UA 3QIPA 2Z1GA 4ZTJA 5HBMA 1NK8A 3DRSA 3SUNA 5HRRA 1RILA 4AH9A 4KHQA 4CHPA 3D45A 4OKEA 1U4BA 4DSFA 3V1RA 3HL8A 4M45A 3U6FA 1RT2A 1ASVA 3TI0A 1RDDA 4L8RB 1JLCA 2VG7A 4M3UA 4DF4A 4CESA 4FJ9A 3AVIA 3VQ7A 4EZ9A