2DFFA

Crystal structure of tk-rnase hii(1-204)-c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKITQDMIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 59
structure length 210
sequence length 210
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dffA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dffA01
5CZ1A 3VQ8A 4DSJA 2BANA 3OYBA 4CGHA 4E1NA 3OYCA 1RT3A 3K57A 1JL2A 3BDPA 1BQNA 1LW0A 3LALA 4CHZA 4DTSA 4HUGA 4GMJB 3LPTA 3OYHA 2HHWA 3M8PA 4KFBA 2RN2A 3VQ9A 1KSPA 3ULDA 3OYJA 3ZT1A 3FFIA 4IG0A 2X6NA 4UQGA 1S9EA 1NJWA 3HPHA 5K14A 3SUOA 1UA1A 4G1QA 3KK2A 1I39A 3DLBA 3DLEA 3QEPA 3VQBA 2VWKA 2BE2A 1KLMA 1T03A 2JGUA 3RTVA 2FBYA 4CJ3A 4FK2A 1QTMA 2HNZA 4PY5A 4KHSA 4EP5A 4E7LA 3QEXA 4LSLA 2G8HA 5KGWA 1RDDA 3K5MA 1LAWA 4IBNA 3DYAA 4RW4A 4E1MA 1ZBLA 4KB1A 3A2FA 3K59A 4R5PA 1RTJA 4CHQA 4FK4A 1MU2A 4KHNA 2GV9A 3AO3A 4KHUA 5T7BA 3EY1A 4O4GA 1O1WA 3E01A 3CQ8A 4DF4A 3TAPA 4FJJA 3V4IA 4DFMA 1SL2A 4BE2A 1U49A 1HNVA 3U3GA 4FM1A 2IOCA 4ZTFA 2BDPA 3KD5E 4E0DA 2YV0X 2O4GA 4O0JA 1U45A 1RT1A 3PX4A 3NGIA 1S1WA 2OPRA 1RBUA 3QETA 1KVBA 4B3OA 3SUQA 3G0ZA 4ELVA 3SI6A 1BCMA 4B8CA 2Z1IA 3L2VA 1U4BA 2JLEA 4KREA 2KW4A 2ETJA 3LANA 5CYMA 2A1RA 4B9NA 3LWMA 4FLTA 4C8LA 4OKEA 1N5YA 2YKNA 3MECA 3QERA 3OYEA 3RWUA 1T05A 3ALYA 3S9HA 4DFJA 4CF2A 4HCBA 3SCXA 1JLEA 4AHTA 1C0UA 3I0RA 4KAZA 4OPKA 1TKXA 1VSIA 4AH9A 3C94A 3OJUA 4KB0A 5J2QA 3F9KA 3OYNA 4FJGA 5KRTA 1Y97A 3AVKA 4HUFA 4FLWA 3ZT3A 3BGRA 1WSJA 1HNIA 2VG6A 1C1AA 4QAGA 5CZ2A 3V1OA 3HVTA 4E19A 3O4NA 5C25A 1U04A 5FRMA 3M8SA 3LZIA 3WNGA 1NK5A 4OLAA 1SL0A 3RR7A 1BGXT 1EX4A 4DSEA 4CK1A 4DSIA 4ICLA 5DMRA 4CFDA 3OYDA 1UAXA 1NOZA 2DFHA 3TAFA 4CERA 4CK2A 3V9WA 4BWMA 4Y1CA 4FLUA 4DS5A 1VSFA 4FLXA 4DFKA 3LZJA 4FJ8A 4JLHA 4DTXA 4J2BA 2O4IA 1RDBA 1HQEA 4NCBA 3KLFA 1JLAA 2KQ2A 5SZTA 4LD0A 3L2WA 1L5UA 5KI6A 4ELUA 1RT6A 4IKFA 4CGGA 4CGFA 2ATQA 3DM2A 3CFOA 3V1RA 1LWFA 3P5JA 1DTQA 3AVGA 3QNNA 3AVFA 3ZSQA 4NYNA 3VQ6A 3K5NA 3C6TA 2ITGA 3CYMA 2VWJA 1ZBHA 4EZ9A 3HJFA 4QCLA 3M8RA 3SYZA 4FJXA 1S1UA 3SQ4A 3MEDA 4I9LA 1QSLA 4CFCA 4ID5A 1JLQA 1KLNA 4M3WA 1JLFA 2LSNA 3NF8A 1RDCA 4FJ7A 3PX0A 1S6QA 4RW6A 2PY5A 4C8NA 1GOCA 1ZBUA 1GOBA 3QINA 4FJIA 5FRNA 3EZ5A 1Q9XA 2D0CA 3IG1A 3TAEA 4DSFA 4F4KA 5KRSA 1HJRA 2Q3SA 2XY8A 3CFRA 1RDAA 3AVHA 1BQMA 3OYFA 5J2NA 3DOLA 3ZSXA 4B8AB 4DLEA 3RMBA 1BI4B 4M41A 3AVLA 4JS5A 1RT2A 3TAMA 1RTDA 4KTQA 4E89A 2FBTA 2F96A 3D45A 2QK9A 4CCHA 1B9FA 2HNYA 1UWBA 4DMNA 4IG3A 1IKVA 1S1TA 1G15A 3DRPA 4B9LA 4FYDA 3DLRA 4FW2A 1YTAA 5D3GA 2HHUA 4HVJA 3MAQA 1DLOA 4FVMA 3T3FA 1S1VA 5HRRA 4C8OA 4FJMA 4CEDA 4CJFA 4J2EA 3PO4A 2XRIA 3L3VA 5C24A 1ITGA 3KLEA 4DQRA 3TWHA 1TAUA 3MXMA 3SUNA 1ASWA 4FJNA 3AA3A 4FJLA 1NK8A 5JS1A 4DTJA 3ZT2A 5KTQA 3HPOA 4CF9A 2E4LA 5C42A 4I2PA 3L3UA 4DWIA 2XO7A 4AHUA 3S3OA 4CFAA 4CJUA 4FM2A 4B9UA 1XWLA 3B6PA 3T19A 1LW2A 3HVRA 4CJRA 4B9SA 3HL8A 4CHOA 4YFUA 1WN7A 1T7PA 2XHBA 3L8BA 1CZBA 3SZ2A 4B9MA 4F2SA 4F2RA 4M3TA 2DFFA 3V9SA 4Z4IA 4LSNA 1ZYQA 3ZSRA 2NUBA 2W42A 4FJHA 1A5VA 3THVA 1BCOA 2VG7A 4RW8A 4M3ZA 4DQQA 3TR8A 3VQ7A 4OKKA 3SPZA 2HNDA 3KD1E 4NCGA 4Z4HA 1QSSA 4N76A 2X6SA 3IS9A 3KKSA 1BIZA 1W9HA 1S6PA 4Z4FA 1TVRA 4CGDA 4K8ZA 1LAVA 3ZSWA 4NCAA 2BGGA 1B9DA 4TSXA 4BDYA 3HT3A 3NH0A 4FZXC 1VSDA 1KFSA 1JLBA 5HRNA 1RBVA 3L2RA 3ZSZA 1S1XA 1VSLA 3CM5A 3ZCMA 4O44A 3WNEA 2D0BA 4FJKA 3OVNA 2Y1IA 4JS4A 3K5LA 2ZD1A 3VQDA 3KLHA 3KK3A 4Z4CA 3NF6A 1IKWA 4L8RB 1LWEA 1RCHA 4DSLA 3RRGA 1ZBFA 1SKRA 1NK4A 1L3TA 1N6QA 2I5JA 4N47A 3KK1A 1IKYA 3SQ1A 1D9FA 5HBMA 2OPSA 1W0HA 1BHLA 2HW3A 4DG1A 1VSJA 1WSGA 4CEFA 3MXJA 3JYTA 1D5AA 3OYGA 4E7KA 4DFPA 2D0AA 2QKKA 2HHSA 3RR8A 4YNQA 1TK8A 1C1CA 3ZSYA 3LAKA 4FXDA 2EHGA 3VQ5A 1TKZA 1ASVA 2IAJA 3AA4A 3SPYA 4KI4A 4W5RA 2FC0A 4IDKA 3HM9A 3OS0A 1NK9A 4CK3A 3KLIA 5HRPA 1HMVA 2Z1GA 3V9ZA 1QSYA 4KHQA 2G8UA 1SV5A 4CJ4A 1Q9YA 1L3UA 2FBXA 4OGEA 4DQSA 1YT3A 4CF1A 1NK0A 1X9MA 5EU7A 2RF2A 1SUQA 3LAMA 3NH2A 3PX6A 4CJLA 4DLGA 1Z26A 1KRPA 4C8KA 3LP2A 1KCFA 1IKXA 2YNIA 1NJXA 3OS1A 1TK5A 3V9UA 4PUOA 4DS4A 4RW7A 1RTIA 2X74A 3QEIA 3PV8A 2G8WA 4XIUA 3IRXA 1WSIA 4O55A 5J1EA 1HQUA 4NYFA 1SL1A 4I2QA 1VRUA 2X78A 4MQ3A 4H8KA 3VN5A 4CJSA 4M3YA 3RMDA 2IGIA 4DU1A 4IFYA 4CECA 1CXUA 1WAFA 2E6MA 3NE6A 4Z4GA 1ZBIA 2KZZA 3B6OA 1RT4A 4CF8A 4KHWA 3RRHA 1TGOA 4CEZA 3HO1A 1I3AA 2HHVA 5DK5A 3LP1A 4BE0A 4KKOA 2B5JA 4E3SA 4Q0BA 1BIUA 3MEGA 2WONA 4FW1A 4Z0UA 3EYZA 3AVJA 5CY4A 3L2QA 1KTQA 5E41A 4M42A 4CJWA 1EETA 1WSEA 3P83D 4FCYA 2OPPA 4QOZB 1X9WA 3NCIA 4E7JA 3DLGA 3K58A 1JKHA 3QIOA 3HK2A 2HHTA 3OY9A 1VRTA 3PUFA 2P51A 4JRPA 4FLVA 2HB5A 3I8DA 5JS2A 1EXQA 3PO5A 4FJ5A 4Z4EA 2DY4A 4CJEA 4JRQA 3DOKA 3HYFA 3VA0A 4J2AA 1CLQA 3O4QA 1U47A 1DTTA 4DTPA 3TABA 1TV6A 3NF9A 4BWJA 1EP4A 1RBTA 2B4JA 3VQAA 2DTUA 2E6LA 1UOCA 3RMAA 1C6VA 1UA0A 3KJVA 1BL3A 1CXQA 3TANA 3KKRA 4M3XA 1XC9A 3SV4A 3D0PA 2XY5A 5FROA 1TAQA 2D5RA 1KVAA 1T8EA 1HYZA 2VG5A 4DTMA 1LV5A 4E7HA 4HCCA 4KPYA 1NJZA 3SQ2A 1QQCA 4AHRA 3TAQA 4MFBA 1JXEA 1IH7A 3ZSVA 1BI4A 3NF7A 2PZSA 4CE9A 1D8YA 4CIEA 2DFEA 4FM0A 1HRHA 3QEVA 4FZZA 2YHAA 4CEOA 1C0TA 3O3HA 3O3GA 3DLHA 3WNHA 1A5XA 1FXXA 4AILC 2OZSA 2EX3A 3NGZA 1HYSA 3DRRA 5HLFA 1TL1A 3V9XA 3DLKA 3QEWA 4PQUA 4OGCA 4H4MA 3M8QA 3VA3A 1J54A 4CEBA 4DTNA 1J5OA 1YTUA 3HP9A 3ITHA 2P1JA 4BACA 4BDZA 3QESA 3NHGA 3OYAA 3HPGA 5HRSA 4RG8A 4CF0A 2Z1JA 3NGYA 4AHSA 1Z25A 3QIPA 4F3OA 1NKCA 1TKTA 3AO4A 2GBZA 2IS3A 3HSTB 4KTWA 4CJKA 5J2MA 4M3UA 4CIGA 4DF8A 2HHQA 3AVIA 3VQCA 3C95A 3L2UA 1NK7A 2AJQA 3TI0A 3G10A 1U48A 3AA5X 4CHNA 1VSHA 3LP0A 3AVAA 3VQQA 4BDPA 2IDOA 1QE1A 1J9AA 3H08A 4KTZA 1A5WA 5CYQA 1RT5A 3K5OA 3OS2A 3LWLA 3HXMA 5J2PA 4OJRA 3SV3A 1JXBA 2F8SA 1VSMA 2IC3A 1HYVA 4OKJA 4C8MA 4W5QA 1SKWA 3VQEA 1CZ9A 4DSKA 4F3TA 2G8VA 2YNFA 2XY6A 1LWCA 1S9GA 1WLJA 3UIQA 1C1BA 1WNSA 3AVBA 1QHTA 3AVNA 3OYIA 4K8XA 2YHBA 2QKBA 3QNOA 4ZHRA 2R7YA 4OLBA 1TL3A 1TK0A 3NH1A 1WSFA 1J53A 3NBPA 3TAGA 5I42A 3SQ0A 2G8FA 4DTOA 3K2PA 3OYKA 3TARA 1Q8IA 4CEAA 4CESA 4CEQA 4DTRA 5HP1A 3MXIA 4PWDA 5KGXA 4GW6A 3RMCA 1WAJA 4H4OA 3CG7A 2YKMA 4LH5A 4EZ6A 4CJVA 1FK9A 2Y1JA 4FK0A 3AVCA 3OYMA 3V6DA 4HUEA 2F8TA 3C6UA 4ELTA 1IG9A 4DQIA 4N56A 3KTQA 2G8KA 4CEEA 2YNHA 4CJQA 3JSMA 4BE1A 4EP4A 4FLYA 4FLZA 3SJJA 1NJYA 2FBVA 4OVLA 3V81A 1FKOA 4CHPA 4N41A 1EKEA 1BISA 2ZE2A 3MEEA 1R0AA 3AO2A 5HROA 2OA8A 3IAYA 3NAEA 1JLGA 4W5NA 1JL1A 1VSEA 2Z1HA 3LPUA 3QO9A 4CGIA 3VQ4A 3AO5A 4W5TA 3ASMA 1VSKA 2KTQA 3F73A 4O5BA 4OPJA 3OJSA 2HHXA 4CGJA 4B9VA 1ASUA 1XHZA 3U3YA 2HMIA 1C0MA 1KVCA 4ID1A 4DU3A 2YNGA 1TKDA 4Q5VA 4M3RA 3DMJA 3T1AA 2PYLA 4WE1A 3NDKA 2P5OA 2KFZA 1VK0A 1NK6A 1FKPA 3ZT0A 4DQPA 2RPIA 4FZYA 1RTHA 4CJ5A 3SUPA 3O3FA 1L3VA 4DU4A 4W5OA 2XY7A 2HVIA 1KFDA 3ISNC 4AHCA 1RBRA 1RNHA 1YVUA 4PA1A 3PY8A 4CJPA 3OYLA 3KIOA 1X9SA 1NOYA 2PYJA 4M45A 1GOAA 4GVMA 3VQPA 1IO2A 4LY7A 5SWMA 2KZMA 4CHYA 1HPZA 1D9DA 4I7FA 3WNFA 2WOMA 2OPQA 3CFPA 2KFNA 1RT7A 2GUIA 3LDSA 4N5SA 1X1PA 4I9QA 4O0IA 1JLCA 1K6YA 1RILA 2HVHA 4FJ9A 4CFBA 3DRSA 2ZQBA 3HP6A 4AHVA 4E7IA 3QLHA 1SKSA 4J2DA 1RBSA 4B08A 1F21A 3ZT4A 2B6AA 2OYQA 2QXFA 3AV9A 4HHTA 5I3UA 4KHYA 3NFAA 2P5GA 2RKIA 3AO1A 2A1SA 1B92A 1S5JA 4Y1DA 1XI1A 4LH4A 1L3SA 4DTUA 2G8IA 4RW9A 3CM6A 3I0SA 4KV8A 3AA2A 4B9TA 3LP3A 4ZTJA 3P1GA 3DI6A 3V1QA 4CJTA 4CIFA 1NKBA 1XHXA 4HTUA 3SNNA 4IFVA 2OZMA 3ZSOA 3AVMA 4KI6A 1WSHA 1REVA 3KLGA 4KO0A 3S3NA 3S3MA 1NKEA 4F8RA 1QS4A 4KRFA 3U6FA 5FDLA
chains in the Genus database with same CATH superfamily
2JA6J 4RA2A 3R6SA 2VL8A 3OYCA 4PSWA 2OU2A 3VEVA 2X6NA 3I56I 3DAWA 3THWA 3KK2A 1Y56A 2HNZA 2LY1A 4A3IJ 1IZ1A 1TQPA 2KIFA 1IN8A 1YJNI 2DPNA 2Y0MA 1SFXA 3PIPL 2A3ZA 2BVLA 2Z3YA 3PQJA 4U7DA 4DV7K 3ZN0A 3VPZA 3F22A 1U4BA 2JLEA 1K7AA 2ETJA 1ATRA 3LANA 5CYMA 2CFXA 4A5NA 3QAHA 3S16J 3HOZJ 2HVQA 1JLEA 3K9TA 1TKXA 3OJUA 2Y48A 1VQNN 1C1AA 2HDDA 2JWTA 1X1DA 2CFOA 1BGXT 1RPWA 4ICLA 5E3OA 1WVRA 4FLXA 4FJ8A 4V2FA 3DF8A 3LZJA 4BRFA 5ED4A 2TRTA 4II3A 1OCOH 2FXUA 4ILHA 3EZWA 1PDNC 5I9EB 2P9PB 1U8BA 4WQ5C 3WTXC 3ESWB 5F2RA 4IQ4A 1IBLK 1Y8RB 3QP6A 4Y15A 2KP6A 3CC7I 4HV6A 2QW9A 4FSVA 1YITI 4M41A 1U2VA 4JS5A 3LM2A 1RTDA 2QK9A 2GOXB 2Q31A 2HDWA 4CZGA 1SMYF 4ABZA 5D3GA 1U5TB 1YRNA 3G3ZA 1JJ6C 3RPUD 3R0JA 4BC3A 3ULQB 1N34K 3CCRN 5C42A 2XO7A 3T19A 1ZGJA 4CHOA 4YFUA 5HS7A 4E7SA 4M3EA 5K5OA 3I54A 3VYTB 3ERED 5E3LA 4OKKA 4N76A 5DM7L 1OH5A 4CUGA 3ZSWA 2UXCK 4BRQA 3W2AA 2DTZA 3WNEA 3JAMK 2HQAA 2Y1IA 1QO0D 2FOKA 3VQDA 4A5AA 1T2KA 1YX3A 1QVUA 1SKRA 2MLKA 4CEFA 1VQLI 2QKKA 4H5WA 3LAKA 1QZ6A 1AA7A 1L3LA 1WJ5A 4F55A 1L3UA 1XGSA 4I0BA 5GPAA 4DNCA 1IRZA 1X9MA 1NK0A 1KRPA 3NH2A 5E18F 2VBZA 4NB5A 5LHGA 1V4SA 3VN5A 2DN0A 2MGQA 2P9KA 1ZBIA 1MW7A 1BC8C 3CCMN 4KKOA 4AQYK 4FW1A 1Y1WJ 2L9RA 1TWFJ 3NCIA 3DLGA 1VRTA 3FXRA 2R5YB 3ZQFA 5LGUA 3CO7C 1YS7A 4M7XA 1MMDA 4WF2A 3EPZA 3CCUN 3MD2A 1U0JA 4YIFA 6PAXA 2VONA 3TANA 3HKZA 1J59A 5GAEP 5LFAA 3OTOK 2NRZA 3NF7A 1FY7A 2M8EA 4FM0A 1AOYA 1C0TA 5FLXZ 5GP9A 3QEWA 2XGDA 3M8QA 3PFYA 4CEBA 3GBGA 3COAC 2WY8Q 2LD5A 4B3MK 4CJKA 5JLFA 1D0YA 2R7VA 1VQ6N 2E1MC 1VSMA 5C2DA 4DSKA 2YNFA 4DZJA 2CUJA 3O80A 3AVNA 2JWKA 2R7OA 5AQTA 1WSFA 2Q0RA 4A2BA 2HYGD 4EJOA 4PWDA 2E5LK 4DTRA 5KGXA 3LOCA 1W5TA 1FK9A 3EO3A 3HTSB 3DWLE 4FLYA 2IS4A 3MEEA 5AQUA 2K9LA 2X0LA 2XAJA 4ILGB 3IH4A 1WJEA 2FSWA 2E7XA 3BR0A 3K9KA 1RBRA 3O8GA 3OYLA 4Y4RA 3H3UA 3LSTA 4QTRA 1J5EK 2NVXJ 2EWSA 5LMNK 3SZGA 1QZYA 2BY2A 3L6QA 3BTCA 5J8CA 2E19A 4WX9A 3DPUA 3VDXA 4KH6A 2ZM6K 4UY8O 3CMAI 1ON1A 4R1HA 2XF7A 3C6HA 1VQPN 3WTYC 1TW2A 2DMUA 5D6EA 3RIRA 1FT9A 4XH1A 3L1PA 3U6FA 4CA0A 2NRTA 4RAGA 4K41A 4F9OA 1BQNA 4DTSA 1TC3C 3W3DA 1LKXA 2HKXA 1FBQA 1S9HA 1SEUA 3SMPA 3RKQA 4LF6K 1X4OA 4JK8A 4YFKF 4JKBA 4ZZDA 4JD2B 2XPVA 5K1YA 2PBIA 3THXB 3CF2A 2ZGZA 2DTRA 2ECBA 4FJJA 2YU3A 1SFUA 3S8PA 4H0VB 2Z5UA 3FFKB 4U67L 1Z77A 5H6QA 3QETA 2R3SA 4N4NB 1KVBA 2BY3A 1G99A 4W97A 4CHUA 2ZMEA 4FLTA 1EJ9A 4U0WA 3OYEA 4UVAA 3BDDA 4IXCA 4B1VA 5FLXO 3CJRB 2K4BA 4YOVA 4FJGA 3C94A 3OYNA 3AVKA 3SEQA 3C2BA 5HOOA 2VG6A 4M72A 3V1OA 4EM1A 4B3SK 5E20A 4B44A 3CQYA 1UAXA 1XI1A 3CMEI 1XMQK 1VF9A 5LHHA 3OIQA 4IL6C 4H5RA 3QPTA 3E6BA 1OKJA 1T44A 1IDYA 4J19A 1EH6A 4C3HJ 4ZH4F 5IT9Z 5LRRA 2VWJA 4XIDA 3DTIA 3CD6I 4FHTA 3UKUA 3R9PA 2ADUA 1ZR4A 4M3WA 4I7HA 1BR1A 4E4HA 3AL0B 1R36A 4IHVA 2QEXN 1BI4B 3MAJA 5IWAK 2LMDA 4X0GA 2CGKA 2YI1A 1H9TA 1XX5A 2Y69H 2MG4A 4JI2K 2VASA 3L3VA 1T08B 3EE9A 4ASNA 1ASWA 2K9MA 4G7OF 4HSRA 4A5MA 5J8FA 3L3UA 3ZMVA 3GZNB 3L2CA 1ZXOA 4IO9L 2FE3A 4DR1K 1YG2A 3L8BA 2W85A 1AKHA 1FNNA 3EUKL 3F2KA 3BP8A 2D1KA 4CZJA 1SVLA 3SBGA 4O44A 2P6SA 3OVNA 3DLLL 3EUAA 3A5LC 4JI6K 1IKYA 2P9UB 1UG0A 4E7KA 5DCFA 2GIZA 2CWEA 3CLQA 5J47A 1HDDC 4JX5A 1VTNC 3SPYA 5KQDA 5M1PA 1OKRA 3S17J 3BG5A 1NJXA 1K83J 2K86A 2X6WA 3DLAA 2E5NA 3T8RA 5IYBJ 1DUXC 3R60A 5CVJA 4U7BA 3A5MC 1I1GA 2FBKA 1QPMA 4KHWA 3AG4H 1JTXA 3T7ZA 1PP8F 1IN4A 3K58A 2O8FB 3HK2A 2PMZN 1BU6O 4FJ5A 5TGTA 4RMNA 1DTTA 5HLIA 4JBAA 5C3EJ 4GYGA 5D5UB 3ZR8X 1XC9A 5IT9O 1LE8A 2J4RA 4GV9A 2RV8A 1QQCA 4AHRA 4HTLA 1DGWY 3NQOA 5IPAA 3LSHA 1VQPI 1WZ2A 4FZZA 4HPQA 5GINA 4CCKA 4KHPK 3GTJJ 4DV6K 3WNHA 4A12A 3VENA 2DA2A 1UMQA 3TP3A 4IOAL 3V8KA 1MMAA 3CCSN 2EIMH 4JHDB 4BQOA 3PNTA 1U9NA 1O7LA 3G4SI 3AVAA 4J00A 2QCOA 3HXMA 5EG0B 2GXBA 3DKYA 1LWCA 4K8XA 3S2WA 2F2EA 4NC8A 1Q8IA 4HF1A 2ZBKA 1BW5A 4R8HA 1J0RA 5GAHJ 2F8TA 1NG6A 4DQIA 4N56A 4AVZA 2I7PA 2EK5A 2YNHA 4FLZA 4ENKA 4PJ0C 1TWGJ 3BF1A 4QWQA 2IPQX 3LAPA 1HNZK 3QO9A 3DKWA 2FRHA 4CGJA 4B9VA 1ASUA 2B63J 4ID1A 3V42A 3CCVN 4RLQA 1ZTRA 1HKTA 4HBLA 5C44J 1D8JA 4RAZA 3G2BA 2P5VA 2FMYA 1E3HA 4PJMA 1E2XA 1X9SA 2A07F 3GW2A 3F9MA 2XUBA 1NGFA 1USTA 4WYBA 3WNFA 2L4MA 4JP0A 1ITYA 2ZQBA 2WWYA 4C2MJ 3IRRA 3FZVA 2OYQA 1Z7LA 2MD0A 4RB3C 4GDFA 4MNUA 1NG9A 5AQPA 5CR4A 5BPIA 2IJLA 1T3VA 3O9QA 3S3MA 3S3NA 3KK7A 1F1ZA 2BUPA 3CERA 3QOEA 4IG0A 1NK2P 2F4OB 3B6CA 3VQBA 4IXAA 4FK2A 1MBKA 2BOLA 3J7YP 1ZHFA 3BG9A 4WWCA 3PJRA 1T8IA 2P0WA 1NLVA 1DEJA 3E01A 3TAPA 1J09A 5FFXA 4ZTFA 5AZIB 1X1CA 3L2VA 2VJIA 4FO0A 1YFHA 5GIPA 5FLXK 4AHTA 1C0UA 4OPKA 3IC7A 5KRTA 4QAGA 2GTDA 3A0HC 4KBOA 4Y33A 3OBWA 4Y1CA 4FLUA 4JI7K 3WHBA 2O4IA 4J2BA 1MSEC 2HR3A 5EDNA 3RZOJ 2KKZA 3DM2A 3UKRA 5ILSA 4QIWN 3BG3A 4IQJA 2JWLA 4I76A 4Y7NJ 4BEHB 2V26A 2H6CA 2ZMEC 5AQJA 2FA5A 2D0CA 3AVHA 3AVLA 5HNFA 4G6TB 5KHDA 4S0HB 3G71N 3A0BC 4YORA 5J6XA 5HRRA 4FJMA 3HSRA 2OTLN 1FBUA 4J2EA 3P39A 2NRVA 4NLCA 5H20A 1GHCA 5KTQA 3HPOA 2VKDA 2HGCA 3WGIA 1IN7A 1TYQA 3ONQA 3HL8A 1CZBA 1GXQA 2HYFA 2D4WA 2LP0A 2KFDA 2UXXA 3RSEB 4H5VA 4EVIA 3SPZA 3IKTA 3BQYA 4EJTA 4NCAA 2CYYA 4BXUA 4YFNF 3ZSZA 3CM5A 4AYBA 3ZRGA 1WGXA 2IS2A 2CGPA 3MVPA 3WTWC 1BR4A 4IEJA 2ZSHB 1A04A 2WAFA 1EQYA 3EYIA 3S1NJ 5JVGF 4JX6A 4JAXA 4W5RA 5EGOA 1NGIA 3QFUA 1BI2A 4KIBA 2HF4A 1XN7A 3RYRA 3PX6A 3A5OC 4OMZA 4DS4A 1TZLA 5J1EA 4N9IA 2IVPA 4LLGF 2BW3B 4H0PA 2OC6A 4MGRA 5D5VB 4FL9A 4JNEA 1R4MB 3RRHA 3H6EA 2CO5A 2XROA 3F3XA 1BJZA 3S15J 4M6XA 1ATNA 3D2FB 5KQ8A 2E2PA 3VA0A 2OCCH 3O9SA 5GTIC 4G6DA 3WQTA 4FQGA 5FB2A 4BG8A 1ETXA 1I27A 3OWTA 3SV4A 3LMMA 2DW4A 1T8EA 1GLAG 4LF5K 4HLXA 5IT9K 4GCVA 3CQXA 3SQ2A 4CE9A 4BHPA 1XG1A 2OZSA 2QM1A 2X6OA 3V9XA 2H09A 3JRAA 1J7KA 4OGCA 2IS1A 1J54A 1YTUA 1ILYA 3NGYA 3O9RA 1NGAA 1HJOA 3DV8A 1NK7A 3HRMA 3A03A 2L5QA 1A5WA 1S7EA 2IC3A 3UIQA 1WNSA 1TL3A 4XN0A 1QVGM 3ENBA 2XB5A 3MZ8A 3E5QA 4HAMA 3H1CA 2E35A 5LGNA 3OYMA 4HDVA 2LY9A 2M0CA 1IG9A 1XPXA 5AQIA 1ZG5A 2LDUA 3VOVA 4CGIA 4O5BA 4GYIA 3OJSA 1VQ5I 3ZMZA 2HMIA 2O3FA 3PIPF 4JKFA 2P5OA 4WCEL 4JI0K 1I6HJ 1W7PA 2ZJPL 3CJ9A 3SEZA 3ABUA 1BOAA 2VC1A 2X6XA 4DV4K 5JVTA 3DBLB 2EZHA 3S1RJ 4A2AA 3K4JA 3QYFA 4B4CA 1KU2A 3FXUA 1YQAA 4KHYA 5DTDA 2E2JJ 3FK6A 2LOOA 4RW9A 2PJPA 4I02A 2CGLA 1GLDG 3FKJA 3LSRA 3K4KA 2DDBA 5FPEA 3CUQB 3H1QA 3E1SA 3G71I 5F1JA 2R7ZJ 1VZ0A 3BOQA 3ULDA 3MKYB 4G1QA 2KDOA 3DLEA 3QEPA 2XC7A 3GTLJ 1YIJN 2BE2A 3D1NI 4PY5A 2H8WA 4EP5A 4RTFD 2PEXA 1P7JA 1LAWA 1ETKA 1XUPO 3JXUA 2L7MP 4PKGA 3EKSA 4XORA 1O3TA 1O1WA 2KHMA 4D5CA 3QBXA 4FM1A 2IOCA 1RR7A 3SUQA 1R1VA 2X1EA 3KP3A 2PMZA 1Z7UA 4DFJA 4YOTA 2W6LA 3I0RA 3QFPA 4KAZA 1SD7A 2DMQA 2IGMA 3ZETB 2XSJC 1KQ8A 2I10A 2KMUA 5DM7F 2BVMA 1NOZA 4YEJA 4DS5A 3H45C 1MZBA 5KVRA 5GADP 3V8LA 1V4RA 2XAHA 2D1HA 4DGWB 2EZLA 1YW9A 3GTMJ 2E36A 2V9KA 2O8KA 5KI6A 3V1RA 2M0MA 1PUFA 1YAGA 4BBSJ 2DU9A 3MEDA 4AIDA 2BXZA 3ZMSA 2LG4A 3H0GJ 5AQLA 1GLEG 4O8UA 4M9XA 1NHAA 3BR1A 4DLEA 2PFBA 5IOYA 4A6DA 1KGSA 3NARA 3KWIA 2JQ7A 2QENA 4C8OA 4I6ZA 1X3MA 4XOTA 4AVPA 5EZHA 1EO1A 1A5JA 1Y39A 2E60A 2LSOA 3ZX2A 4FOIA 1FP1D 1N36K 2XAQA 3WT0A 2GIVA 3T8TA 1H0MA 2W42A 3SJHA 3THVA 4RW8A 3QPHA 2V52B 1OFCX 2PX9A 1BIZA 2LYCA 2O8DA 5IYCJ 1LAVA 4TSXA 3I4PA 4P96A 3BROA 4IX7A 1BN5A 4PGHA 3SHFA 1S1XA 3ZCMA 3U4LA 3CCLN 2TCTA 4HNUA 1BR2A 3K5LA 4PFPA 1SD5A 2XRLA 3AG3H 1QZEA 5GIOA 4ZYGA 1W2BM 1V5GA 2GQQA 3W6KB 2CH5A 1XMKA 4C23A 3U1KA 1B9MA 3VPRA 1O13A 4KIFA 1YO5C 2FX0A 1Q86O 1SUQA 3OS1A 1UJ8A 1IBMK 1RTIA 1WJAA 1G3SA 4I6MB 3Q5FA 3PO2J 1H88C 3J81Z 2WB1N 3I64A 2AS5F 4HZFA 4XK4A 4E3SA 5CY4A 3L2QA 2VGNA 3E1YA 4M42A 3LSGA 1QHAA 5BREA 2DA6A 3MCAB 2V6CA 5E8IA 1IAWA 2WTUA 3OIPA 4GXOA 1RBTA 2NNYA 2GZWA 3VQAA 3RVCA 4PZJA 1S72N 3FXLA 3KJVA 1MDUB 4B1XB 3KKRA 2Q1NA 2E88A 3VGKA 4BRMA 3AGRA 1MBEA 3MCPA 1PJRA 1ZN2A 4FWLA 4GKJK 3DLKA 4PQUA 3M8EA 2V79A 5EVZA 1JKQC 3HSTB 3VTIA 3GCMA 1VQON 1U48A 3AA5X 1IRGA 1SD4A 3MX5A 1PVEA 1RT5A 1FW6A 3F8BA 2LKSA 5EEHA 5FKMA 4ZHRA 5D8KB 2DCEA 2ZWHA 4CESA 1MWMA 2HS5A 3CG7A 4CJVA 2Y1JA 3C6UA 4CZIA 5C0YA 2GUPA 4BE1A 1OR7C 1IXSB 2RAEA 3BZKA 5B66C 1BISA 4M73A 4W5TA 3EYYA 1RIOH 2XGXA 1ZREA 2VE8A 2EB7A 3VEOA 2HVIA 4A3BJ 3R6MA 4CJPA 4GVMA 4WQ4A 2KZMA 4BQNA 2DOFA 3WXKA 4S05A 5CVRA 2FQ3A 1QGPA 4FPAA 2VXZA 2P5GA 3ZQLA 4MFDA 4RBOA 3CDHA 4BU2A 1UCRA 3KZIC 4OMYA 1NBWA 2V1UA 1NKEA 4AM6A 3VSKA 3J81O 2IVMA 3V4GA 1U5TA 4L5EA 4EATA 5K7FA 3WG9A 1NJWA 2A41A 3QPLA 4YOWA 2VT2A 1VQ9N 3CQZJ 1ORKA 1XGOA 3TO6A 4EGYA 5KGWA 3EUHA 1YLFA 3CDIA 1O7FA 5JMVA 3M4OJ 1V5FA 1HNVA 4NXMK 2BDPA 1VQ7N 1VQ8N 2BY0A 3GF2A 5JLHA 3IHUA 1QZ5A 4B9NA 4S04A 2YKNA 2WBNA 3C6AA 2EILH 4IO9F 4H5NA 4CF2A 3SCXA 5D5WB 1WUAA 3M8JA 2HWVA 2NS8A 2R5ZB 2COBA 4DSEA 4RAFA 2ID6A 4MLHA 4BWMA 1R23A 2LLKA 1U9OA 2Q2EA 1NGBA 3KLNA 1U6ZA 3WTUC 3DQVC 2A6AA 5HDGA 1EA3A 3DLLF 1DPRA 1FBSA 1DPUA 4WCGA 1I5ZA 3EZ5A 1M1KO 4CDGA 3QBWA 5KRSA 1GLLO 1BOBA 3AKZA 4ENNA 2JMWA 4MFEA 2DYSH 4FVMA 1HC8A 1FIAA 2R5YA 3S41A 1YI2N 4A57A 3BJAA 2CRGA 1K6OA 1SFKA 1UAAA 3W2VA 3TWHA 4LK0F 1R5GA 2AXLA 4OIOF 4XM3A 1B72B 5FKKA 2I7NA 4FM2A 4B9UA 1D0ZA 4XLNF 3M07A 1X3ZB 3VGMA 1WN7A 3SZ2A 4Z4IA 4DR5K 1S3XA 2QWNA 3HOXJ 1G3YA 2MSYA 1I50J 1HSTA 3BQZA 3CIPA 1JXSA 1R1TA 1R5ID 3K4BA 1JLBA 2VJ5A 4JI1K 5K7ZA 5AQMA 1FSEA 2P7CB 2BY1A 2KRHA 4L8RB 4WFBL 3B73A 4DCHA 4RWTA 4IOAF 2D0AA 3RR8A 2Q1ZB 3GEZA 4FXDA 3GXOA 1XMXA 3OS0A 3KLIA 3WE2A 3LSJA 4C3JJ 1R9TJ 2ACJA 2EFOA 3O4WA 1ZG3A 5FPDA 1TT0A 2WC2A 5H1SQ 4C9YA 2A5YB 2BHZA 1B6AA 4HWIA 4DW6A 2VKVA 4JK9A 5TRDA 2EV0A 3FM5A 4CCMA 3L4QA 1NGDA 4D5FA 4YOXA 4BE0A 4DQ2A 2B5JA 1U78A 3AAQA 3K7AJ 3PO3J 1NJIO 4NUBA 3CI5A 1W97L 3J80Z 4JRPA 4FLVA 3UKGA 2XKOA 3Q7CA 2OQGA 5FPNA 1A6IA 3A0IX 2M1BA 2D0PA 4YELA 4A3JJ 2QWPA 1C6VA 1VAZA 3RDIA 3DFGA 5KK1A 2KJBA 2M9HA 3S93A 4WXDA 1GLBG 1Q7YO 1LCUA 4L0YB 4OIRF 4D9JA 1DKGD 1KQ9A 4HG2A 3TU5A 3FX3A 2DFEA 1MH4A 3GTOJ 2YHAA 1HNXK 1J9IA 2NOGA 1TW3A 1C0WA 2XAFA 2R7XA 1HLVA 4B8XA 2P1JA 4BDZA 1Y8QB 1MJBA 1Z25A 1VQ9I 4ITVA 4DF8A 4XKWA 3VQCA 2P9IB 5FKLA 3LP0A 4EM0B 4KTZA 3SV3A 1Q81O 4Z2YA 4JD2A 1D1BA 1C1BA 1V54H 3THXA 3QNOA 3MN2A 3TAGA 3TARA 1WAJA 4ISEA 4B1UB 5FD6A 1R0AA 1PP7U 4PJJA 3L9FA 1LFUP 4OPJA 3NVKA 3N05A 1KVCA 4AIKA 3SK3A 2O0YA 3NEUA 1YVNA 4IRGA 1BIAA 2DJIA 5CQEA 1JUSA 3E9PA 1R1UA 4B3RK 3WHCA 2WBMA 4AHCA 5D6FA 4XNFA 1ETWA 4AF1A 3IAS2 4Q47A 3FE1A 5H2FC 5JHUA 1PUEE 3BEXA 5AONA 2W84A 3BLYA 2IVNA 2HNHA 2FD5A 3AV9A 3UNGC 4IO8A 1D0XA 3FKIJ 3LQRA 3JW4A 3E6CC 4KI6A 1U3EM 3VODA 3VQ8A 4YOYA 2JT1A 5AQRA 2VN2A 3HPHA 1I39A 2LKXA 4C1NK 3FMRA 1W36D 2VIXA 2OF7A 3J80O 2O8BA 4LSLA 2VCPA 1RDDA 2OTJN 1DP3A 4QS8A 1AWCA 2QWRA 3FDYA 4PJLA 1MU2A 4KHUA 4A61A 4MO5A 3O3KA 4O0JA 3AY9A 2W1OA 1S1WA 3P9KA 2OPRA 5GAGP 2XRNA 1XTAA 1FYKA 4A3LJ 2K85A 4BJTA 3EL2A 2ZNZA 1HNIA 3W3CA 3BZ6A 2O03A 2V4JC 1SL0A 3LWFA 4HNTA 4L3QA 4XSXF 4CK2A 1OH6A 2D2WA 2P9UA 1WRJA 5ILVA 4IKFA 1YUWA 1R4NB 1NGCA 3QNNA 1MMSA 3VQ6A 3O6WA 4XLFA 4ZJZA 3SQ4A 4KA4A 3BWGA 2MABA 1ZBUA 1GOBA 3JSPA 2W82A 3KZYA 3VYUB 1BQMA 2ECCA 2DA4A 2E8AA 1QHGA 2GBYA 2FBTA 1SAUA 3L7WA 1B9FA 3H3VK 4HX8A 4DMNA 5JLWA 2NNNA 3LA2A 1G15A 4LGWA 3DPLC 4CCJA 2A68F 2Y0SN 3AFHA 2G7UA 1ITGA 4EMSA 4G6QA 3MN7A 1IUYA 2ELJA 1TP4A 2NOJB 3F0CA 3S3OA 1ETQA 2LBFB 4YDUA 4ON0A 1A6QA 2HVSA 1FTZA 2GELA 2DA7A 4R79A 2QSHX 3WODF 2O7OA 3RTRA 2O5RA 3SYTA 4UUTA 5ADXA 1QSSA 5LHIA 1RDUA 3KKSA 4Z4FA 1EWRA 4ISFA 1K78A 2VQHA 2QKMB 1RBVA 2BYVE 4JHDA 4FJKA 3KK3A 4UVBA 1K8AO 2KZVA 1YJ9I 1OPCA 4GKKK 2HKOA 4DFPA 2MLGA 4A59A 1HNWK 3BT9A 1S5LC 1T0FC 4FWQA 3O5BA 4M6YA 4P9UA 4KHQA 1T39A 2QSGX 5EU7A 1Z26A 3R61A 1R7JA 2G8WA 1MDMB 3O9TA 1SL1A 5L3CA 4I2QA 5HDNA 3F8NA 1KD1O 4M3YA 1I1SA 3OIOA 2HFHA 2VQLA 4KJZA 3NE6A 3LDQA 4BR4A 3EYZA 2W40A 2EFPA 1SZ2A 2HB5A 1J2XA 1TLHB 1UHMA 2JA2A 4FTHA 2KIQA 4F7ZA 1XSVA 1TL8A 2DTUA 3THWB 2HHHK 1UOCA 2CUFA 2VG5A 4DTMA 2ZJPF 5HS9A 1NJZA 2L9SA 2HYJA 3CJ1A 3HIFA 2HPIA 2NS0A 3CTAA 3OMYA 3NHGA 4DR2K 4AHSA 3JRIA 4B48A 1HKCA 3L00A 4JX4A 3KEQA 2ESHA 3I5UA 1ZC6A 4YIIA 1QE1A 1DDNA 2P81A 2X9DA 3F23A 5EXWA 2G8VA 2DJNA 2YHBA 2P6TA 1HLUA 3K2PA 2HOSA 3GG4A 2HSTA 4WQ5A 2P9LA 3T1BA 3JSMA 3C7NB 4EP4A 5GADJ 4G9ZA 3W2WA 3C7JA 2ZXJA 1W36C 1FKOA 4D0PA 5H6RA 3IAYA 1QBJA 4BRAA 3J7AO 1Q1HA 4CYCA 1L3VA 1U2VB 3KIOA 3Q9SA 2MBFA 3GTQJ 1W1WE 1A36A 5BPLA 4BEHA 4PSXA 3S2DJ 2B6AA 2L0KA 1XDUA 4ZDOA 5K7HA 2R7FA 1W0TA 3DI6A 1XHXA 1OYIA 4HEA2 4DV2K 5AQWA 2JSCA 4BGBA 1RT3A 1JL2A 2HMPA 3LALA 4CHZA 2VOOA 4GMJB 3TBIA 2P5KA 1KSPA 3OYJA 2E2IJ 4HX4A 3HUGB 1IBKK 3BY5A 3P9IA 1DT9A 4XH5A 4CJ3A 1CQTA 2Y9ZA 4CBUA 1TWHJ 4XOPA 1A31A 4DYQA 4BC2A 4JKAA 4MDBA 4BQLA 4KHNA 4CZKA 3VMFB 2GAUA 2D0OA 1ZRDA 3AL0C 1N77A 1J5YA 1JHFA 4HF2A 2DXIA 2A1RA 3LWMA 2NRAC 4AUXA 3ALYA 3GFMA 3ZYYX 3G6EI 2WV0A 5J2QA 1Y97A 4M6VA 3ZT3A 3O4NA 4ENMA 2P9KB 2R7TA 3RR7A 2F5FA 4DSIA 3NRVA 1OCTC 4U0VA 1WFXA 3IV5A 3F5TA 4C2UA 1GVJA 1VQ4N 5A2QO 1UZCA 4L9JA 1LWFA 4JI5K 4BRLA 3K5NA 3ABMH 2F4MB 3ZX0A 5B1AH 1WJBA 2P5LC 1S1UA 4XLCA 1JLQA 2UYTA 3NF8A 3ABKH 2PY5A 3J7AP 1GOCA 1Q9XA 2BW3A 2ZJRL 1R58A 2IEKA 1C0GA 3CFRA 2HPMA 2PMHA 3DOLA 3VEWA 1UWBA 1U6GA 1S8NA 2QF7A 4BL0B 3Q9VA 3MXMA 2UUCK 2E4LA 4I2PA 1IXRC 4HF0A 5M1FA 3KHYA 3B6PA 1ULYA 2YR2A 2BHYA 2DFFA 1WCMJ 3HTUA 1FC3A 1KU3A 1OLTA 1BC7C 3H5RA 1F5TA 2L9VA 2M4GA 5K5QA 3SFIA 2J5OA 1S7AA 3BJOA 2BZTA 5C4XJ 3LL7A 5FKNA 1YTYA 1D9FA 3F21A 1BIBA 1B8IA 3Q0WA 1T6SA 4M9SA 2KDZA 1HW2A 3WGGA 3A01B 2QQBA 4KI4A 2Y2ZA 3THYB 1Q82O 2ZXIA 1YT3A 3K6GA 3C65A 4FWOA 3WXLA 4F92B 2KRCA 4RW7A 4IHSA 4NYFA 3H3NO 3GVAA 2QVOA 4K42A 1BIUA 4Z0UA 5C15A 2KPMA 3ID6A 3P83D 5M1OA 4K0KK 2OPPA 1FPQA 3QU3A 5FJ8J 1BA5A 1EXQA 3HBTA 1SD6A 3DOKA 3O4QA 2N8GA 1MJAA 1U47A 4DTPA 1EP4A 2R7WA 2CW8A 3MMYB 3ZPLA 2ISZA 3D0PA 5C2FA 1HXDA 2XB0X 2NRWA 4E7HA 2STTA 3FZHA 3MWPA 4CIEA 3S1QJ 1R6RA 1ETOA 3DRRA 3RPUA 4IPAA 5HLTA 2UUAK 4I0AA 2GX9A 5F64A 3QIPA 3J7ZO 3I58A 1YHQI 3SFZA 5E17F 3I71A 1NH3A 3MK6A 3CMMA 3RQIA 2UXDK 1G4DA 4KFCA 4F3QA 3WEEA 1JXBA 4Y13A 4PKIA 3PL8A 3CO6C 3DXKA 1Z21A 3AVBA 1QHTA 3N4MA 4M3FA 4DB3A 4OLBA 1WH7A 4DIQA 1XSDA 3M1EA 2OBPA 1W0UA 4CEAA 4CEQA 5DD4A 2Q97A 2FNAA 3T69A 3QOPA 4D7MA 3CJNA 4ELTA 4CVNE 4CEEA 4OOIA 2FBVA 4OVLA 3KFWX 2Y0SA 4XRFA 3K0SA 5HROA 1VSKA 3ZETA 2PYLA 3H35A 1VQMI 1VK0A 3SUPA 4M3BA 3ISNC 5KPZA 1YVUA 5AQQA 2AQEA 4I7FA 3HRSA 1RT7A 1USSA 2GUIA 5EY4A 3BTLA 1HBXG 1RILA 3QPSA 5DCMB 4JKGA 4E7IA 3KVGA 2CMPA 4IHYA 1N32K 4KNYA 5TKYA 2L7ZA 5E26A 2KISA 3G1OA 3I0SA 5BMZA 3ERMA 5DD8A 2XPUA 3SNNA 1ZAOA 4B3TK 4U88A 3PSFA 2A6TA 1IRXA 2ZJ2A 2OCEA 2X4HA 2HHWA 1ZH5A 2STWA 3SUOA 2AQFA 1KYWA 3G25A 4LFUA 2EV5A 5E84A 2MYSA 5E1WA 3H9JA 3VGLA 1VI0A 3V4IA 1RT1A 5ICFA 4CJ7A 4BGDA 3SI6A 4A0ZA 1G59A 1HR0K 4C8LA 1N5YA 1GLNA 2W41A 4K2EA 1VSIA 5J4VA 4HUFA 4FLWA 1WSJA 3HVTA 1GV5A 2Y30A 3RJPA 3I4NJ 2AP1A 1MBHA 2JPBA 3OYDA 3CJQB 1RUNA 2OV7A 3CJCA 4JLHA 1YW7A 4IJNA 3KLFA 2XPWA 5SZTA 1WB9A 5ICGA 1IV8A 5A2QK 2YHYA 2VXDA 1ZBHA 1JLFA 3CCQN 3VEZA 4KYWA 5HODA 4JI8K 1FIPA 4QPQA 5CKTA 2W48A 4DV3K 5M3MJ 1HKQA 2KIMA 3OR2C 3MKLA 1RNLA 2HHUA 5E1ZB 3KLEA 5AFUH 4BRGA 2QUFA 2DLLA 1SAXA 3FISA 4HRIA 1LDDA 2VYPA 4L9VA 3CC4I 2Z16A 4P55A 1V4TA 1NMNA 5M1KA 1LFBA 2NUBA 2RQPA 2X51A 2LFBA 4NCGA 3CJTB 4DR7K 3JRHA 2YX6A 1D1AA 3LDNA 1TVRA 3EQLF 3HSCA 4BG9A 5M5XJ 1KFSA 2E1NA 5HRNA 4P9FA 3DXJF 1V3FA 2L4AA 5HS8A 2YX4A 4NLBA 4UV9A 3K10A 3H0DA 5AZJB 3KYDB 5HBMA 2GWJA 1X3WB 1RGIA 1WHUA 3VQ5A 2ME6A 2QWOA 2ZF5O 2BBYA 1HMVA 3J8AA 4CF1A 3H5AA 3W6VA 5EZGA 3ABTA 3BCAA 1QZZA 1VQNI 1NGEA 2LC2A 3LNQA 2PJRA 4DU1A 1I6XA 4GGGA 1YXQA 4ZYHA 4V2GA 2HHVA 4BRKA 1T33A 3QODA 1J75A 2NVYJ 2KKOA 1KTQA 2COMA 4RLFA 5JI6A 1EETA 1P7IA 1X9WA 3GYHX 2GXGA 4Z4EA 3LSMA 4XKVA 2YS9A 5E3MA 3HYFA 3UB5A 4EJVA 1RKWA 1TV6A 3CHWA 2QA4N 4BS9A 3CXCM 3TGNA 4BR2A 1CF7A 3GFLA 3U9GA 2D5RA 1LV5A 4KN7X 2ZGYA 3IWFA 1V55H 2R7SA 3O3HA 5TJJA 4CZHA 3HM8A 2KZGA 4XONA 3D5SC 1KZHA 2O8EB 2VC0A 3ITHA 1GLFO 1OCRH 1BJAA 4XSZF 2HHQA 3CCRI 3K4CA 1R71A 3G10A 3M1CA 1LNWA 2AXTC 2RVCA 5BRHA 5F04A 3QQAA 3H08A 3LWLA 2BH1A 3TW7A 4GVEA 4F3TA 2M3AA 1CZ9A 3KP2A 2AA4A 4L9NA 5D5XB 3ZEUA 1YF5L 2QGUA 2ELHA 2O8XA 3KX2A 2GLOA 3I55N 2O9LA 2M34A 3CUQC 1ONVA 2HZTA 3GZ5A 4M74A 1NG7A 5HVQC 2G8KA 1T56A 2A3SA 4HDUA 2XAUA 3KCCA 1T38A 1Z67A 3P7NA 3WTVC 4MLOA 3ASMA 4UY8I 2EIKH 3HL2A 1X19A 4WE1A 3U8XA 1ZKGA 2R5ZA 3H3OB 4WXCA 1RTHA 1KFDA 3I33A 4PA1A 3SDBA 1NOYA 3HHHA 5CVIA 2NRHA 1X1PA 4FE4A 3GTPJ 4XRMA 4O8KA 4FT8A 5FLVA 4BNCA 3K4MA 2FEZA 5I3UA 1R49A 2WFBA 4KV8A 5LMUK 3CCMI 4WF9L 4B9TA 2H1LA 4LJZF 4ZTJA 4CIFA 4CJTA 4BQAA 3ZSOA 1P92A 3NVMA 3AO4A 2DA5A 3QWLA 4UNOA 4V19S 3HOTA 1SAZA 4ILJA 3CCUI 3OYHA 3HEFA 3M8PA 3SQNA 1Y1VJ 3JTHA 2AHQA 4LITA 1YJWN 1FP2A 1VHXA 3BJ6A 2VWKA 3MEXA 1FJGK 2ASMA 4E7LA 2H27A 1D5VA 4XLPF 1B72A 3KWGA 3KEOA 3F8MA 5J1RA 3K59A 4CHQA 4RB0A 3OL4A 4AU7A 4FPBA 2Z99A 3ENHA 3EY1A 4O4GA 3HI0A 3VTHA 1SL2A 2K9SA 1BI0A 3KD5E 3PX4A 4B3OA 2VBYA 1RBUA 3VWBA 4B8CA 2GM4A 2Z1IA 2LF7A 5KAFC 5EGOB 1SMTA 3TDZC 1UFMA 2BV6A 2RDPA 1VQ6I 3ELKA 1ZK8A 5C25A 5BOXA 1MBFA 3LZIA 3TAFA 4RB2C 2H6BA 4DTXA 4WK8F 4GO1A 1JLAA 3NAUA 4LD0A 4CGFA 3OR1C 2ATQA 2G0EA 4OO1J 3AVFA 2NVQJ 4EZ9A 3HJFA 2E34A 4LOCA 4U87A 1N33K 1HF0A 2HQRA 1QSLA 1M90O 1KLNA 3FZFA 3HSEA 2EPFA 3KZZA 4RW6A 4ISGA 3WTSC 3I59A 2DDAA 4DSFA 3VSLA 3DKXA 2ESNA 3GL1A 1RDAA 4LF4K 4YY3K 4M3DA 4RGUA 3ID8A 4Y52J 2VT3A 2GWRA 3BUZB 3TSQA 2L7KA 1JCGA 2Q8KA 4B9LA 3ULEA 2IGKA 3ZOBA 1K73O 4WFAL 1TAUA 5IY5H 2QA4I 2XDVA 3A2KA 4A3KJ 4DTJA 4AHUA 5LLQA 3HG9A 5J40A 2GXAA 1RKTA 4K25A 4EM2A 1WKMA 2EFQA 4LF8K 1OJLA 2CJJA 2HNDA 2W7NA 3KD1E 3FBNB 3QDKA 3WE3A 4CGDA 4OIPF 1B9DA 2YX7A 1TWCJ 4BDYA 1KXPA 3CP8A 1FLIA 4FZXC 1VSDA 3L2RA 4BBRJ 4GFBA 1HPMA 3PUBA 3E6DA 2P9IA 2ZD1A 3HKZN 1FOXA 2FOWA 1LOTB 1LVAA 1YYVA 1P90A 1L3TA 1WH5A 2LH9A 4EJUA 5M5YJ 2OPSA 5GAHP 3SXYA 3ML6A 4B1YB 2A6EF 3D7EO 1W7PB 2PBDA 4B9QA 1Q9YA 2VB6A 4LC9B 4FASD 2FLOA 4D1QA 4HOBA 1KCFA 4I2OA 4A0XA 2H8RA 4CJSA 3RZDJ 3LDLA 1WAFA 2E6MA 3O1BA 1RT4A 2BXYA 1TGOA 5C12A 3MEGA 3M3ZA 2VBXA 4NDLA 4KMFA 2R0QC 5E41A 4MTEA 2HZDA 4H0EA 3WU2C 1XNRK 1JKHA 3I8DA 5JS2A 3RPQA 3PSIA 1JTYA 3NF9A 3I56N 1UA0A 3H46O 4RGXA 2PG4A 3JRGA 4M3XA 2QM3A 4KPYA 1BBYA 2QEXI 3TAQA 1FJLA 4MFBA 2FU4A 2PZSA 4ZDLA 2DMPA 1HRHA 3FMSA 3I53A 1FXXA 1YJNN 2NYXA 4DKWA 5AR0A 3HP9A 3BTIA 1TKTA 2IS3A 5J2MA 3U9ZA 1X1BA 4PFOA 2AJQA 4DUYK 1OCZH 1YIOA 2JVGA 5J2PA 3QU6A 4I98B 2QQAA 3HHGA 5LRSA 2EINH 2A6HF 2B0LA 3AVCA 5AQKA 2MD5A 3V6DA 1PUFB 2VUMJ 3S32A 1FZPB 2FSKA 1EKEA 1H8AC 3NAEA 1UB9A 2Y31A 3WTTC 2DK8A 1RZ4A 2KFZA 3ZT0A 4UVCA 2H1KA 1STZA 3CC7N 2EFWA 4EHUA 3PY8A 4LG3A 2VODA 4IJAA 4M45A 5JLXA 4EFHA 1FTTA 1D9DA 1VQKN 1MBJA 3C1DA 3BG7A 4N5SA 5E1XA 4RCHA 2LF8A 4IZZA 3HP6A 3ATVA 4B08A 2RN7A 5HNHA 1F21A 3DU6A 2CQQA 1KAZA 2Q36A 4F91B 1S5JA 1ETYA 1R22A 5IOZA 2G8IA 2PN6A 3LP3A 2P9SA 3OSFA 3BF3A 4D7NA 1WSHA 2IA2A 1IV6A 4HV5A 4F8RA 4KRFA 5CZ1A 3ABLH 4E1NA 1I94K 3MQ0A 4E70A 2O8DB 4HUGA 3NMUA 3LPTA 4JKCA 3ZT1A 3IWZA 2OJED 2ZJRF 3EE8A 3RTVA 1QTMA 4A6EA 3K2ZA 4LK1F 4JQFA 4E1MA 3VEXA 1O3QA 4KB1A 1RTJA 1WSUA 4XR6A 1KAYA 4UV8A 3E97A 1U49A 1IRFA 1VQLN 2YSRA 4OU0A 4GV3A 3CCSI 3CUOA 4DUZK 5E3NA 2A42A 1BDGA 3N4PA 4B1ZA 1JT6A 1ACIA 4BROA 1Q1VA 1ZELA 3CJAA 5FRMA 3M8SA 4N9HA 4B3AA 3JR9A 3WNGA 1IGNA 2VWBA 5BRFA 1O3RA 1W5SA 4JKDA 3V9WA 5FD5A 1HKGA 2KIUA 4ELUA 1F9NA 1K79A 3CFOA 3F72A 2D45A 1BG3A 1QNTA 2LREA 3LDOA 1X1AA 2M5WA 3KP6A 1MDMA 5E8GA 3CCVI 3SZTA 4FJIA 3HDDA 1QRYA 3GLLA 5BS6A 2EWNA 3KYLA 4W1UA 1WI3A 1EH7A 4XICA 2FSNA 3RMBA 2DPUA 3TAMA 2F96A 3S14J 2M7AA 3DRPA 5AQSA 1YTAA 2MC4A 3F6VA 5IT3A 2FF6A 3K2AA 3TO9A 5C24A 1IN5A 4K43A 3TOAA 3B02A 1ZR2A 3EN9A 1NK8A 1BI3A 1ZLJA 4ENJA 1UG2A 2V6EA 2FJ1A 4HQMA 2F5DA 1K61A 2VI6A 4B9SA 3IKMA 1T7PA 3I8BA 4M3GA 3O6BB 4LSNA 2E1OA 1JUPA 2X48A 4CZZA 2QBYA 1OR7A 1T6DA 4BY7J 5D8LB 1W4MA 4B43A 1G3TA 1ZRFA 3HT3A 3FGUA 3NH0A 3HYIA 4OWRB 4IVNA 2NXNB 2UUBK 2B9SA 4L5JA 2RQQA 1LWEA 3G1LA 3U21A 5LJWA 2W24A 1TWAJ 3HGYA 1NTCA 1WSGA 5CYVA 3HZJA 4LIVA 1P2FA 5AQYA 3CETA 1C1CA 2XKPA 4BRNA 2IAJA 1ASVA 4BAYA 1Z3XA 2A69F 4IDKA 1QSYA 4L0ZB 3E3VA 1TNTA 3C7NA 1WSIA 5LEJA 5J3LA 4CXFA 2GA1A 4DBQA 4CECA 1HA8A 1LDKB 2HQ5A 1T6CA 3CMAN 2L02A 3VB2A 2YHXA 1WSEA 4MO4A 4CCLA 2WAQN 1VQKI 2PFUA 3V7SA 2UWMA 5BN8A 5IYDJ 4A3MJ 1ZGWA 4AIHA 5HDKA 5TISC 2A61A 1JCEA 4OX9K 1TAQA 2K3FA 3OOUA 5J4YA 5DM6L 5IP7J 3B8AX 1OYWA 3QEVA 3GO5A 2V9VA 4BVOA 3H36A 5KCMA 3O3GA 2R7UA 1P4XA 1A5XA 2EX3A 2OTLI 3F8FA 1N75A 1V5EA 2W6KA 3HPGA 4F3OA 4A3EJ 3AAFA 3HUGA 4CIGA 2EBIA 1D4XA 3C95A 2DOEA 4BJ5C 4X62K 3GBTA 2A05A 1HYVA 3VQEA 2FQ4A 1QVFM 2R7YA 5LGTA 4QS9A 3SQ0A 1B4AA 1E0EA 3CMEN 3RMCA 2Q2EB 3VETA 4LH5A 4UB6C 3MN6A 3I9V2 2DO7A 4BKXA 3HRTA 4UXNA 3SJJA 2IA0A 3CD6N 2E1YA 3QYEA 5AIQA 1VSEA 2Z1HA 2KTQA 3K1MA 4ESBA 2YNGA 1TKDA 2JA5J 4HSTA 4M3RA 3OV8A 4FISA 3O3FA 2UU9K 1RNHA 3EKUA 5FLMJ 4NO7A 3KPHA 2OPQA 2V1DA 3B6AA 5AQGA 3E9OA 4FJ9A 2QTDA 4AHVA 5AQOA 2DFIA 2PI0A 5DDGA 4ZYEA 4IOCL 4RM3A 2V7YA 4IRHA 2QLZA 1NGGA 3GOIA 5GAEJ 4MLEA 4XMYA 1QS4A 4MHGA 2CUZA 4G12A 1Z6RA 2E2HJ 3IMXA 2ZFUA 1JUMA 1ZBSA 3QEXA 4X64K 2CW7A 2DBBA 3ZQGA 2V51B 1B9NA 4FK4A 1O4XA 2K27A 2X1DA 1RDWX 1RUOA 3CF5L 3MZYA 2FF4A 4OINF 1SC7A 5BPDA 3S2HJ 4X6AJ 4OKEA 2WAEA 4XLHA 4ZZLA 2QZ8A 2P9NB 3BGRA 1IJJA 1MSFC 2HBJA 2GEMA 2R92J 1NK5A 1GXPA 1FYLA 1D3YA 3H9GA 4P1WA 2DMTA 2P8TA 1L5UA 3A01A 2CSOA 3L2WA 5JVHL 1APLC 1RT6A 1MNDA 1QQIA 2XASA 3THYA 2ITGA 3A5NC 1GT0C 3M8RA 4AYBN 2RREA 2Z1DA 2DA3A 1L0OC 1A35A 3FHNA 5LJVA 4EGZA 3IG1A 2XY8A 3ZSXA 4B8AB 3Q3SA 4L18B 3JRFA 1S1TA 1K8KA 3T3FA 1S1VA 3ZQCA 2JN6A 1HW5A 2VQGA 4C3IJ 3A8YA 4DQRA 2ZCWA 1NGJA 1BM9A 1Q18A 3DPTA 4NQWA 5M1NA 4IRIA 1G6NA 2E2QA 4CFAA 4CJUA 5F0CA 3G4SN 3HVRA 1YW8A 2RC4A 3C2HA 2DOAA 3O8MA 4KUMA 3HSFA 3PIOL 1QU3A 4G7ZF 3E5XA 4HYEA 3BZCA 1YIJI 3ECOA 4LF9K 4RDUA 1RI7A 3GLXA 1JI8A 2D0BA 2E7WA 3DCFA 1IKWA 1OH8A 4FWPA 1RCHA 3MWTA 1ZARA 2NS7A 2ZC2A 2I5JA 4DJAA 4BR7A 3U1DA 2HW3A 3MXJA 2HHSA 4BRCA 1G3WA 1VNDA 4UUSB 4YNQA 2W25A 3IP4B 1MIJA 1TKZA 2ZSIB 5HRPA 1SV5A 2FBXA 2G7HA 1FMVA 4BUPA 1TK5A 5ILUA 3FK7A 2GWKA 2RHKA 2MFZA 1F36A 4MQ3A 3C3WA 2DYRH 1FOKA 1RFQA 2KT0A 3P31A 3T1YK 3HB9A 5LBQA 5DYMA 4AC0A 5C4JJ 1GUUA 2UZKA 5CLSA 2F4IA 3VF2A 4QSHA 1OQYA 4QOZB 4E7JA 3QIOA 3PUFA 3NWSA 2P51A 1E3OC 2K7LA 4JRQA 1XD7A 4J2AA 2P9PA 2B4JA 2BEOA 5DCMA 4RGRA 1GVDA 2ZXHA 3WU0A 1BL3A 2E5ZA 4Q4ZF 1IC8A 4OIQF 5EEAA 2O8BB 1HYZA 4MIMA 2K40A 1X2MA 2IVOA 2ETHA 3CDLA 4JKHA 5EYRA 3NGZA 4LFCK 2PMUA 2PQ8A 3BC8A 3VA3A 4DTNA 1J5OA 3QESA 3OYAA 3H9QA 5BPNA 2Z1JA 1U2WA 3BR3A 2K9QA 5IP6A 1BOTO 3TI0A 1LJ9A 3EETA 1UHSA 2LR8A 2KQRA 1ON2A 2QWQA 1X9JA 4WFNL 1WLJA 2QKBA 1P6RA 1IJWC 3NH1A 3NBPA 4YIRX 4ZYAA 5HP1A 3DTKA 5AIPA 4CZFA 4FK0A 3N97A 2VLAA 4JEPA 3GDQA 5KPRA 3CCLI 1Z9CA 3WGHA 2OA8A 1WWXA 3FF5A 1Z91A 3FWEA 1C0MA 2LY2A 4Y3OA 2HBMA 2VQCA 3MWMA 3TPQA 1BW6A 4CBWA 3C18A 1K4SA 5SWMA 1Y0UA 2HQNA 4C1NI 4C2TA 5AQFA 3HTVA 4BC4A 3K4NA 1SKSA 2NNWA 4JK1X 4Y0WA 4CZMA 5D4SA 3ZT4A 4M71A 1B92A 4LH4A 2K9NA 3R0AA 1OVYA 2R7RA 3IUOA 1ETVA 2QYOA 2JRMA 2Y9YA 1MGTA 4B09A 5FDLA 4DSJA 5HL7L 4BQQA 2V7FA 3BDPA 4DOZA 3SLCA 2FMLA 4LLLA 3FFIA 3FHZA 1K78B 1S72I 3TTFA 4A2UA 1IG7A 1KLMA 2ASOA 2JGUA 4L9TA 1S7OA 3FXKA 4JI4K 4H0YB 4CZEA 4KT6A 4IBNA 4RW4A 4BY9C 1HUXA 2IBDA 1T0FA 2LK2A 3BTJA 2XGEA 4RAYA 4A0YA 5T7BA 5FFZA 4RB1A 5ELZA 3CQ8A 5AQVA 4DFMA 1WPKA 3HOUJ 1EH8A 1U45A 3NGIA 2NAZA 5KAIC 3FXOA 1JGSA 4I99C 1IXCA 3LA3A 2WAQA 3MECA 1VQOI 3RWUA 4II2A 3FZMA 4G94A 4KISA 1ODDA 2LTPA 4E19A 5L3GA 4CI6A 4OLAA 1GLCG 5DMRA 5TKWA 4CFDA 5AZJA 1HKBA 1KONA 3SAHA 3ZMUA 2XAGA 1RDBA 4FWRA 2Z2SB 4QLCU 1MA9B 4CGGA 1WQ2A 4FWSA 3ZSQA 4ESFA 2CU7A 4IF4A 3PQKA 1G2HA 1DP7P 1RDCA 2FXAA 3KP7A 2PLYA 5FGMA 3SZPA 4F4KA 1HJRA 2Q3SA 1ERDA 2ID3A 4ZYDA 2HI3A 2BTFA 2JJ7A 2JSPA 5B3SH 4KTQA 4E89A 3D45A 4CCHA 2IA1A 1OMIA 4FW2A 3MAQA 4CJFA 4PL7A 5AQNA 4YRVA 2A5XA 1LW2A 3FMQA 4CJRA 3WXJA 3D2EB 2XHBA 4F2RA 1RESA 3J7YJ 3ISPA 1XC3A 3ZQHA 3IS9A 5F0HA 2IGOA 4BR0A 3F6OA 2VOPA 1TQMA 2O8EA 2P9LB 4X1EA 3W0LA 1CZAN 4Z4CA 3NF6A 2NRXA 4U0YA 3RRGA 1ZBFA 3MMVA 1HCRA 1VQ5N 3LAJA 1YX5A 1VQ7I 1VQ8I 3FZLA 4CYCB 1DU6A 4BY1J 3PNVA 2EHGA 4BHBA 1JJ2M 2W57A 3V9ZA 3OA9A 4BGAA 2JUGA 2X1CA 4OGEA 4DQSA 3LP2A 4NC6A 3QEIA 2X74A 4JKEA 2OPTA 4DQ8A 2X78A 9ANTA 4ETSA 5F0FA 3BPXA 4OPHA 1XGNA 5DUIA 2ELKA 2DT7B 3HO1A 1I3AA 1LFPA 4G7HF 3E9LA 5DK5A 2E2NA 2VQFK 3MX2A 1GLJO 2M7BA 3ZMDA 3IUCA 3ZCOA 1B1BA 2FBHA 4A62A 2HF3A 4ESJA 2HBLA 2CH0A 3VESA 3AGKA 3ZX3A 1ZYRF 1LB2A 1BI4A 3HZ6A 2DI3A 3KEYA 3DLHA 3VERA 2O8CB 2NVUB 1HYSA 1TL1A 3WTZA 1YI2I 3CCYA 2K3PA 2NZTA 1XB4A 4BR5A 5HRSA 1G8XA 3S1MJ 3IRQA 2CW0F 3FBIB 5M3FJ 4KTWA 3HJEA 2F7TA 3GE1A 2F9WA 1E4FT 5LD2C 5ICCA 2IDOA 4AWXB 2F4VK 2WB1A 3LSPA 2XY6A 1WJCA 2V7ZA 1LVKA 4JYAK 2OANA 2CV0A 2Q0UA 3FM3A 3M6GA 4BC5A 2UV1A 5BNGA 4PGGA 3KTQA 4EAHD 2HDCA 4GRIA 1R59O 4N41A 2BGCA 3LSKA 2ZE2A 2ITMA 1Y0NA 1SVMA 5B8HA 4LFAK 2HHXA 1XHZA 4BJ6C 3IAM2 2G9WA 3O08A 2H3GX 3T1AA 2IIRA 4CJ5A 1QHHD 3ZXSA 2L7FP 1POGA 2IAIA 4HX7A 1H9GA 5EJCA 4CZLA 5AJ3K 3X2QH 3OBYA 5HLHA 4O0IA 2IGNA 3HRGA 4J2DA 2E1MB 1RBSA 4O5FA 1B59A 4PCQA 2DPDA 3R4KA 1P4AA 4O3MA 4Y1DA 5MLCQ 1ZQ3P 3GZ6A 3VEYA 3LM9A 2CUEA 3KP4A 2EIJH 2VE9A 3AG2H 1NKBA 5F6FA 4LG0B 5KNLA 3OOPA 2O8FA 2BANA 3BPVA 4MQVA 1JE8A 4IOXA 5KPTA 2RGVA 2WTEA 3ZP5A 5K14A 3DXMB 3QMLA 5JR3A 2FF3B 4KHSA 2WY7Q 4E7ZA 3K5MA 1ZBLA 3CPWM 3AO3A 1TNSA 3U3GA 1B8IB 3VF4A 2O4GA 2EFNA 4ELVA 2K4JA 1SANA 2F5EA 4KREA 2KHOA 4O5VA 3F8CA 3BR6A 4Q48A 3QERA 3ENOA 3S9HA 2HU9A 4EV0A 4PUSA 3BG6A 4AH9A 3PFIA 5EG0A 4L5IA 3CPEA 3DTEA 4CERA 4DFKA 3RQ4A 1ZLKA 1MBGA 3SAFA 2QWWA 3AVGA 1LDJA 2XGCA 3GUDA 4I9LA 2YJEA 4ID5A 2LSNA 4FJ7A 1AHDP 1IF1A 1JHHA 4C8NA 5J1UA 3TAEA 1KYZA 3GWZA 2ME0A 2JTVA 3VYRB 2L9NA 1LQ1A 5C10A 4IG3A 1IKVA 2E1CA 4QS7A 3M7GA 3DLRA 2EZIA 2UXBK 4HVJA 2QSFX 3BY6A 4BQZA 3PO4A 2XRIA 5FO5A 3MCZA 2JUCA 5AQHA 5HLGA 2HEOA 4I09A 4GV6A 4BRPA 3P9CA 3WEEB 4CCNA 1YOVB 3DU5A 3V9SA 3DXKB 3ZSRA 2DT5A 2VG7A 1IN6A 4A3GJ 3TR8A 3DEWA 2R4GA 3U2RA 2BGGA 3QB0A 2KJCA 3LSIA 4FETA 1IUFA 5DM6F 3TP0A 4AIJA 5A2QZ 2OTJI 1NNEA 1R00A 4G9YA 3JRDA 1E3MA 5EEGA 1E4GT 3WQUA 5M1QA 3ZQIA 3L0QA 1OVQA 4CZCA 4DR6K 1D5AA 3OYGA 4KIGA 5AZIA 3WXMB 1TK8A 3ZSYA 3CCJN 4CK3A 2I5UA 3H1VX 4CJLA 4C8KA 4PUOA 2YNIA 1W7PD 3V9UA 4X65K 2ZFWA 3E0JB 4JKGB 4O55A 1RRJA 4H8KA 3K4LA 5CE3A 4H0XB 3OHRA 2RNJA 3K0LA 3B6OA 4CF8A 3VFZA 4IDHA 1FMWA 2MW8A 3JRBA 4CJWA 4J01A 2WUSA 4YFXF 2QI2A 2XV4S 3PLAA 4KICA 4Q5SF 2DY4A 1OCPA 1YRNB 4EHTA 1RC9A 4BWJA 2XIGA 4DV0K 4E1JA 5JFRA 3FR0A 1U8RA 3SAGA 1CXQA 3E66A 3ROUA 2OD5A 2IP2A 3V8JA 4OAYA 4B1RA 3JRCA 1IH7A 2YU9J 2EQRA 4LIUA 3R8EA 2HOTA 4KN4X 2LVSA 3CZ6A 4CEOA 3L4IA 1BO5O 1W5CC 1P8ZA 4WXHA 4H4MA 5GTHC 4LB5A 4RG8A 1WOQA 3TTCA 3SJMA 2GBZA 4IOCF 3DP7A 4G8XA 1NMDA 1OCCH 4CHNA 4H4KC 3OS2A 2F8SA 4W5QA 3RSEA 4XLEA 1S29A 3SBTA 3MXIA 2HVRA 4GW6A 3ASOH 4TV7A 4HUEA 1BUPA 2KRFA 4PDKA 2JRTA 3HC7A 2Q0OA 1TUUA 4I01A 4QPOA 2IT0A 3AO2A 3I4MJ 3F73A 2IW5A 1QVTA 3IDHA 4FVUA 2W00A 1JT0A 3DMJA 3CF5F 3NDKA 3REOA 2RPIA 2DQLA 4FZYA 1GOAA 3K70D 3VQPA 1H89C 4MEXF 2HTSA 3LDSA 2OUMA 1Z6TA 2QXFA 4JN4A 2A1SA 2M8GX 4GNIA 2YCHA 2ZJQL 1BA1A 3CM6A 4DZPA 3AA2A 4UHTA 3V1QA 2GA2A 4IFVA 2D5VA 3D2FA 3BCBA 3KLGA 4XH4A 4XRSG 4FJHA 2J5PA 4CCOA 3OYBA 2KLAA 3ZQQA 3K57A 1RR8C 4DR3K 4NHJA 1HX1A 2XSDC 3DLBA 1IW7F 2G8HA 3WUHA 3H5NA 1NWKA 1QQMA 2P4WA 5DUKA 4FWNA 3A2FA 3QP5A 1WBBA 1GV2A 1YS6A 3LL3A 2CQ7A 1ESVA 1QQNA 4AD9A 4E0DA 2YV0X 4YHHK 3ZMTA 1ZRCA 5ADXH 1H1VA 1S3JA 1Z0XA 2R7DA 4HCBA 1FSHA 3F9KA 4DYCA 2P7VB 2PJRB 1U04A 2ZO4A 4UB8C 1BI1A 3PIOF 2DFHA 4PJNA 2RKHA 2W4SA 4M9ZA 4BHCA 1XGMA 3CCJI 3TEDA 1FOWA 4FWMA 4CW7B 3C6TA 3W6JB 3MKZA 2XF6A 4JV5K 2F5CA 3AAPA 1NM1A 3MZHA 3A1YA 3KP5A 5FRNA 3QINA 5BR8K 1CF7B 3PNYA 3T0YA 1Z05A 5JICA 4BR9A 1RT2A 3IH3A 4LFBK 1C0FA 4BREA 1XQSC 2HOEA 1XS9A 5J1YA 4A69C 3DBHB 2LKPA 3RI4A 4FJNA 3K9JA 4MEYF 4CF9A 3PM1A 4DWIA 2EA4A 1XWLA 4A3DJ 2A5WA 4B9MA 4M3TA 3CUQA 3M8FA 1O57A 1BCOA 4DQQA 4Y17A 3E7LA 4Z4HA 2X6SA 3L09A 1SVOA 1S6PA 4A93J 3ZEUB 2E71A 2YUSA 2MC3A 3TKYA 2LRDA 2ZMEB 4Z6YA 5L3FA 2IRFG 2Q2RA 3FLCO 3ECHA 1P4WA 1X3UA 2KL4A 4KMUX 4RGSA 2EA2A 4JS4A 4DHYA 3KLHA 1JGGA 4RM2A 2CQNA 1X3NA 2QXLA 4N47A 5CQGA 1VSJA 1DGRM 3G73A 5L3EA 1X4PA 4B1WB 3HM9A 4MQ9F 1LEBA 4CJ4A 2O61A 2IXSA 2F9TA 2JPCA 3UKUB 2M87A 3PV8A 4XIUA 1HQUA 2JZYA 2IGIA 4IFYA 4AM3A 2KZZA 1GDTA 1O3SA 1VQ4I 1NGHA 3TO7A 3ZN1A 2D1VA 1Y64A 3J7ZI 4CYDA 2XVCA 1DQUA 3ZGKA 2NRRA 3Q0UA 4A3FJ 2AO9A 5FKOA 1TBXA 4XEIA 3EDPA 4CD1A 5LY3A 4EQQA 2BE5F 4HCCA 4N0BA 1AKHB 3FZKA 5DS9A 3CJBA 1REPC 5HLFA 1N25A 2QKLB 1MKMA 3K70C 1JKPC 2F5VA 4NB4A 1VFCA 4BRDA 1MNEA 5F0XA 4BACA 4LB6B 1MJ9A 1CGPA 3AVIA 2E2OA 1D5YA 3LFUA 4BDPA 5ERIA 1J9AA 5CYQA 3TOBA 4OJRA 3KYCB 2XHKA 4NNJA 4OKJA 1EV7A 4H5TA 4KDPA 3K1NA 3TMOA 2TDXA 5LL6Z 2CV2A 2JA8J 4BVPA 3MN9A 1LEAA 3CLOA 3LQQA 4PK4A 1TTYA 4CO8A 4EEFG 4DV1K 3O1WA 3RCOA 1NJYA 3V81A 1EF4A 2KLOA 2FBIA 1JLGA 4A5BA 3LPUA 3AO5A 2P9NA 4NC7A 4DU3A 3I59B 3K69A 1FKPA 2VKHA 2XY7A 5JHFA 3KLOA 1T98A 2GOMA 2H94A 5CPRB 3TTDA 1IO2A 5DEQA 4KH5A 1HPZA 3ULEB 4YG2F 1JCFA 3CFPA 4I9QA 1K6YA 1JLCA 1OYYA 3DRSA 3QLHA 1DU0A 4PKHA 4I6MA 1XSXA 1XDSA 3R3LA 2RKIA 2WC9A 1LE8B 2R7QA 4GY2B 3RYPA 2F6CA 5BQTA 4NXNK 4HQEA 3MDQA 2L2OA 4CGHA 4NBQA 2CQXA 1LW0A 2DT6A 3ATUA 2OZ6A 4KFBA 1KAXA 4BYYA 3HOWJ 3SDGA 1T03A 4HA8A 1KQSM 3R1XA 2RNGA 2VPLA 2LNBA 1OISA 4HLYA 1I3QJ 4IZ9A 2RE2A 2PAVA 4BXFA 4CD3A 1YJ9N 1QPIA 4IFEA 1FWZA 1NU0A 4BE2A 3QYBA 1KU9A 1BWFO 4F52A 3AARA 3G0ZA 1BCMA 1SQKA 3VYSB 4BRHA 4ZDPA 3U9DA 1KU7A 4KB0A 4IHWA 5CZ2A 2V9PA 3O2PE 1XNQK 2M2EA 5BN9A 3IL2A 4CK1A 3UR3C 3GMEA 1PYVA 1E3PA 4UUSA 1HQEA 2KQ2A 3MN5A 3TQNA 5CVUA 1DTQA 3T5XA 5EF6A 3FXQA 3SYZA 4FJXA 3RKWA 3E5UA 4CFCA 2OA4A 5B5EC 2Z33A 1IV0A 3OYFA 5J2NA 4M7YA 4PHTX 1XCVA 4IEIA 3P38A 4IWVA 3JSOA 3MFKA 5M5WJ 2FNPA 5CVVA 1SFOJ 1HOMA 4CEDA 3J81K 2E20A 4WQ4C 3AA3A 4FJLA 2DQRA 4KT5C 4LMYA 1ATSA 2IS6A 2C6YA 3OL3A 3H3ZA 3TSPA 1A5VA 3D5LA 4LLNA 4V19K 1W9HA 4CH7A 4CSWA 2ZNYA 4OAZA 3AG1H 4H03B 5D4RA 2L3DA 3DJCA 1KA8A 4XL9A 3QICA 1WJDA 4ANJA 5L3BA 5F27A 5GAGJ 1ZGAA 1U5TC 3N4QA 3MKWB 1KC8O 4DSLA 4OPAA 3M1FA 2NLXA 1N6QA 3IKVA 1UELB 5DV5A 1IDZA 1BHLA 2JA7J 3JYTA 3LA7A 1JJ8C 3HGGA 3EUHC 3HBLA 4DR4K 4P5OA 3AA4A 2FC0A 1NK9A 2Z1GA 3UKRB 4A3CJ 2MH9A 2DA1A 4DLGA 1IKXA 3VF6A 5K5RA 1VRUA 4MDAA 3RMDA 1CXUA 1MD0A 2VJ4A 4CEZA 2P9SB 3LP1A 4Q0BA 4RS8A 3AVJA 3TDUC 4FCYA 1XMOK 4MTDA 5CHIA 3PO5A 1CLQA 5FPMA 4MO7A 3WXIA 3CCQI 2L01A 2E6LA 3RMAA 3T1HK 1TYQB 5FROA 1KVAA 2K5CA 3FXJA 4H0TB 3ZSVA 3D0SA 1Y6IA 4BH9A 3HRUA 4CGZA 1SS6A 3QRFF 4PL8A 1LUJB 2UUZA 1RETA 1HW1A 3CESA 4CF0A 5E79C 2ZKZA 4UUVA 1D8KA 1VSHA 3VQQA 2CG4A 3G6EN 3O8HA 4EJWA 4JK7A 3OYIA 4H0OA 1TK0A 2VPRA 1J53A 4Z94A 5I42A 4F93B 1FX7A 4DTOA 3OYKA 3JTGA 3CCEN 1MNMC 4KITB 3CC2N 2UXNA 1P9QC 4CHPA 1HQCA 1QA6A 3VQ4A 1MWKA 1XC5A 4AM7A 4Q5VA 3CP2A 1NK6A 2A40A 4DQPA 2OQRA 2PYJA 2X85A 3O9UA 4LD5A 2HVHA 4CFBA 2V1NA 1BL0A 4IHXA 4HHTA 3NFAA 4FX0A 1L3SA 4DTUA 5EOYA 3P1GA 3C0BA 2OZMA 3AVMA 4XQFA 3WU1B 2DK5A 1REVA 3JAMZ 2DAOA 3GX4X 2M30A 2QBYB 3KETA 2RN2A 3VQ9A 3LDPA 4XLAA 5BR9A 2WA0A 4UQGA 1S9EA 3JREA 1UA1A 2Y75A 3C2GA 3A4CA 2FBYA 1YE9A 3G1MA 3NWTA 2NVTJ 5AQZA 3DYAA 4R5PA 2DMNA 1Z3YA 2GV9A 3D2EA 5F1RA 4DF4A 3SMSA 2QQ9A 1HKSA 1UHWA 2QWMA 3ASNH 3KZBA 4M63C 3DEEA 2DODA 2KW4A 3ZLJA 3CJ7A 4FE7A 1T05A 5B1BH 4XBFA 3DEUA 4FX4A 2MA3A 3GFJA 2CV1A 4JI3K 4B3XA 5BRDA 2HBKA 3I3LA 1X58A 4JOMA 4XN3A 1EX4A 3VEPA 4O6JA 1VSFA 2M4KA 3I55I 3IH2A 4XRSA 4NCBA 3WG7H 1AU7A 4HW0A 3GTKJ 2F48A 3P5JA 4NYNA 4QCLA 3RSNA 2CS3A 2K02A 3CYMA 4J8FA 1NK3P 3K1PA 3I0TA 1K4TA 2L54A 1MH3A 3PX0A 1S6QA 1TUYA 3RKXA 1MMGA 2ZB9A 3TSUA 3GTGJ 3HOYJ 1OH7A 4X66K 4IEEA 1T95A 3LFKA 2HTJA 2VQEK 2HXOA 1JKRC 1K9MO 2VBWA 2HNYA 1F4KA 2VJJA 4DYRA 4FYDA 3HXLA 1S6LA 1DLOA 3OW2M 2OZUA 2HOAA 4BXXJ 1D1CA 2QQ8A 5F08A 3SUNA 1DGKN 5JS1A 3ZT2A 4IHTA 2I8DA 1YHQN 1XMAA 3FIWA 2Z9OA 4B47A 4FWKA 3J80K 4F2SA 4CBXA 5BPMA 1ZYQA 1SFEA 4M3ZA 1J6ZA 3OSGA 3VQ7A 4C30A 2O8CA 2YPRA 2OAZA 4K8ZA 5ICEA 1YJWI 3VOEA 1Z1DA 1FYMA 5LEKA 1VSLA 3JAMO 5AQXA 1R5HA 2VKEA 2FUG2 1BA0A 1NK4A 3KK1A 3SQ1A 1W7AA 3IFRA 2VGMA 1W0HA 4DG1A 3BR5A 1VQMN 1FOYA 1JKOC 2ISYA 3CCEI 2G8UA 3EEQA 4YOUA 3RKYA 3P4IA 3Q7BA 2RF2A 3LAMA 3CC2I 1WI9A 3IRXA 3Q0VA 1KQ0A 1WBDA 3HOVJ 3HM5A 4Z4GA 3FXMA 2EV6A 3D5RC 5IP9J 1YITN 1E17A 2WONA 2JK3A 4XKCA 2HHTA 4N4OB 1EWQA 3OY9A 2YJFA 5AFUA 1HSJA 3JCUC 4CJEA 1WJFA 3D6RA 2WADA 3TABA 3CMYA 3DBRB 3BR2A 2MH2A 3DWLA 2XY5A 4FOEA 2ASPA 1TT5B 1M1EB 1JXEA 1X2NA 1N8RO 2WV1A 1D8YA 3UE5A 5EX5A 1ZG1A 4LG0A 4DV5K 2B7EA 4AILC 2XF5A 1QQOA 2YHWA 5JVGL 1NKCA 2ZJQF 1XCBA 4M3UA 3KE2A 3DXMA 4KH4A 3L2UA 4JYKA 2QWLA 2CH6A 2LBFA 4E6KG 3K5OA 4C8MA 2E1ZA 1SKWA 3V7RA 1S9GA 3M3YJ 1N78A 4DBRA 3M5RA 4BRIA 2G8FA 4YDUC 1FEXA 4H4OA 2FSJA 2YKMA 4EZ6A 2HXIA 1LPQA 4ZC3A 2CQKA 3M9AA 3V7CA 1F43A 3TL4X 5L3DA 4CJQA 2O6GE 2EJRA 4W5NA 3TW6A 3GFIA 1JL1A 3E6MA 2M45A 1ENHA 2V1XA 3U3YA 4EIAA 4CICA 5CJ9A 1HDPA 2CGJA 4DU4A 4W5OA 4HNVA 1TQIA 1S22A 3ZQ7A 2ICWG 3A02A 4XKBA 2JVHA 1IG8A 4LY7A 4CHYA 3HOSA 4LF7K 3J7AY 2WOMA 2KFNA 2EZKA 2EH3A 2ZXWH 1K8KB 5GPCA 5F1XA 3AO1A 2R93J 4NQWB 1MMNA 3JS6A 2X6YA 4HTUA 3CC4N 3H92A 4KO0A
chains in the Genus database with same CATH topology
5CZ1A 3VQ8A 4DSJA 2BANA 3OYBA 4CGHA 4E1NA 3OYCA 1RT3A 3K57A 1JL2A 3BDPA 1BQNA 1LW0A 3LALA 4CHZA 4DTSA 4HUGA 4GMJB 3LPTA 3OYHA 2HHWA 3M8PA 4KFBA 2RN2A 3VQ9A 1KSPA 3ULDA 3OYJA 3ZT1A 3FFIA 4IG0A 2X6NA 4UQGA 1S9EA 1NJWA 3HPHA 5K14A 3SUOA 1UA1A 4G1QA 3KK2A 1I39A 3DLBA 3DLEA 3QEPA 3VQBA 2VWKA 2BE2A 1KLMA 1T03A 2JGUA 3RTVA 2FBYA 4CJ3A 4FK2A 1QTMA