2DFFA

Crystal structure of tk-rnase hii(1-204)-c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKITQDMIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 59
structure length 210
sequence length 210
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dffA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dffA01
1YTAA 3K57A 1B9FA 4CEEA 4BACA 1B92A 3MEDA 4DTJA 3AVNA 3JYTA 3RMCA 4BE0A 4M42A 3QEVA 3RMBA 4QCLA 4CJKA 2RN2A 3RMAA 1S1TA 1BQNA 1U4BA 1HYSA 4CF9A 3KKSA 4E3SA 3AA5X 4JRPA 1LWCA 2IGIA 2VG7A 4DTUA 4OKEA 3KTQA 2FC0A 1J54A 4CK1A 1U48A 1SL0A 2RF2A 4J2EA 4H8KA 1CZ9A 3NHGA 1WNSA 4LD0A 1TKXA 1FKPA 1HYZA 1TK0A 3CFOA 1IO2A 3LWLA 1U47A 4Z4GA 3RWUA 4DSKA 3KLGA 1HNIA 4LY7A 2HVHA 4O4GA 2HHQA 2ITGA 4M3RA 4Z4FA 1YTUA 4KHYA 4PA1A 3RMDA 3CM5A 2JLEA 3OS1A 4OGEA 5HRPA 4AHUA 3SPYA 2GUIA 4FJIA 1JLFA 4FJMA 4AHTA 2XY8A 2G8WA 4Z4HA 2GBZA 3KD5E 1C6VA 1TL3A 1BCOA 1NOZA 2G8HA 1IKXA 3M8RA 4ELUA 1IKYA 4M3WA 5J2NA 3JSMA 3NH2A 4FLYA 3VQBA 3IS9A 4E0DA 4F2SA 3NFAA 4FJ7A 4DQPA 1HPZA 4FYDA 3LWMA 2YV0X 4FZZA 1HQUA 3I0RA 4FVMA 3WNFA 1SKWA 4DQSA 4OLBA 2QK9A 3VN5A 4N76A 3OJUA 3KKRA 3T1AA 3CG7A 3TI0A 1KVBA 1TAQA 3PX0A 1ZBFA 1GOAA 1RTDA 4FLUA 2KZZA 5JS1A 3L3VA 4OPJA 1YVUA 1TK8A 4DS5A 4HTUA 1QS4A 4Y1CA 4CJPA 1LAVA 5HRNA 3TAEA 2IC3A 4JRQA 4B3OA 3LDSA 3P83D 4O55A 1U04A 2KQ2A 3TANA 4DSLA 3NF8A 3HPHA 1C0UA 1RT4A 4CJ5A 4E7KA 2G8KA 2Z1JA 3OY9A 4CJSA 3CQ8A 2IDOA 3O3HA 1K6YA 3HK2A 2RPIA 4CJUA 2D5RA 5C42A 1JXEA 1RBSA 4FW2A 3ZSVA 3KIOA 3AA2A 4CEZA 2HHWA 2LSNA 1TKTA 4DTPA 1L3VA 3AVAA 4B08A 4PUOA 3HJFA 3DOLA 4K8XA 4KFBA 4Z0UA 3L2UA 3SI6A 5CZ1A 1HYVA 4FLXA 1L3UA 4IKFA 2Q3SA 3C94A 3V4IA 5HRSA 4MFBA 3S3MA 1O1WA 4EP5A 1JL2A 2D0AA 2PY5A 1RTJA 2YNGA 4DLEA 4AHCA 4NYFA 1N6QA 3DLGA 3DRPA 1BCMA 1C1AA 2DTUA 3E01A 4FJ9A 3C95A 2HB5A 4J2BA 3UIQA 4KREA 1X1PA 3IG1A 3PX4A 3HP6A 4BE2A 4CFAA 2HW3A 3OYGA 4RW8A 1QTMA 2HVIA 3DYAA 1RDAA 1N5YA 1S1UA 2F8TA 3NH0A 4DQRA 5KTQA 4KPYA 1VSIA 1ZBIA 2XO7A 4Z4EA 5CYMA 1HRHA 3HSTB 1RILA 4HUEA 3L2RA 1WSIA 1RT7A 3CFRA 2PZSA 4KHQA 2P5OA 1SL2A 4CJWA 3DM2A 4B9NA 3AV9A 4KV8A 4DLGA 5HP1A 4E7IA 3OYBA 5I42A 4M3ZA 4CIEA 4EZ9A 4DS4A 4M45A 4MQ3A 4E7JA 4M3TA 1WSEA 3QINA 3VQ7A 3QESA 1KFSA 4K8ZA 1RDBA 4KTWA 3V1OA 1WSHA 1JXBA 3C6TA 4DTMA 1WAJA 3DMJA 4OKJA 4DQIA 3NBPA 1VK0A 3AO1A 3KLHA 4DSIA 1BGXT 1Y97A 2P51A 3LPUA 1RT1A 4AILC 2BE2A 2X74A 2OA8A 3G10A 2DFFA 3ZSXA 3OYLA 3L2WA 2QKBA 2HHUA 1ZBLA 4IFYA 3LZIA 4DF8A 3HPGA 3MAQA 4B9LA 1JLQA 1ZYQA 2FBYA 3D45A 3P5JA 1LAWA 4DMNA 1JLBA 3AVMA 3PX6A 4Q0BA 1UWBA 4CFDA 1XI1A 1WSFA 4GMJB 1EKEA 5CYQA 4N56A 4LH4A 1XHZA 4FK0A 5FRNA 1QHTA 3S9HA 3H08A 4OKKA 1IKVA 1LWFA 4E1NA 5FROA 1SV5A 1VSKA 2I5JA 2JGUA 4TSXA 1ASWA 1Q8IA 2ZE2A 4CJTA 1VSJA 4H4OA 1NKCA 1SUQA 2FBTA 3I8DA 3TWHA 3NGZA 1JLAA 2YNHA 3ZCMA 3HPOA 1C1BA 3ULDA 4KTQA 4DTRA 4CHPA 3SQ4A 4NCBA 2Z1HA 4W5NA 5DMRA 4CF8A 4LH5A 1CZBA 3AA3A 3OS2A 4YFUA 4RG8A 4BDYA 1NJZA 3WNEA 4DSEA 3WNGA 3K5NA 4DU1A 4DU3A 4FK2A 4M3UA 4DSJA 3HT3A 3AVLA 4GW6A 4KRFA 1EX4A 3TABA 2OZSA 4Z4CA 4CJRA 1RBTA 4CJVA 4B9UA 2YNIA 1VSDA 2B5JA 3F9KA 4CJ3A 3ALYA 4CIFA 2FBVA 3K59A 1RBUA 2HNZA 3OYIA 4FJ5A 5KGWA 3DI6A 3HYFA 3SQ2A 1RBVA 3SUOA 3QNOA 2A1SA 3LALA 4B9MA 1SKRA 1CXUA 4DSFA 1NK6A 1DTTA 4HVJA 4AHVA 1BIUA 5JS2A 2YKNA 5EU7A 3HVTA 1EP4A 3BDPA 4IG3A 4L8RB 1C1CA 1NK5A 5HRRA 4NCAA 1QSSA 1ITGA 4CGDA 4CGHA 3RTVA 3SUNA 3EY1A 3I0SA 1B9DA 1SL1A 4HCBA 4N41A 4CEQA 1Z26A 1RDDA 4FJGA 1T7PA 4YNQA 1CLQA 4FJHA 4B8CA 2HHVA 4DF4A 1FKOA 3QEIA 4GVMA 4FW1A 1EETA 3ZSRA 4F4KA 4NCGA 1VSMA 4CK2A 4DFMA 3SUQA 1RTHA 4CFBA 2IOCA 3QETA 2DFHA 2DFEA 3V9UA 3F73A 4E19A 3LAMA 4I2QA 1D5AA 4JS4A 1XWLA 2HHSA 2YHBA 3U6FA 4M3YA 3MECA 1IG9A 3PUFA 3V1QA 4LSLA 4KHSA 5CY4A 1VRUA 3TAGA 1FXXA 1DTQA 1S9GA 3LP2A 1XHXA 3TR8A 4I9QA 1T03A 1JLGA 1QQCA 3AVIA 4KTZA 4OGCA 3ZT4A 5J1EA 1A5XA 3KK1A 1NK9A 2PYJA 2DY4A 3MXIA 5FDLA 4IFVA 3HM9A 2IAJA 4OJRA 3VQPA 3LP3A 1RCHA 4CGJA 1WSGA 4CHZA 4CHOA 3KLIA 3L2QA 3DRRA 4CJFA 4O5BA 4NYNA 1NK8A 2X78A 1UAXA 3QERA 3VQ8A 2EX3A 1UOCA 1RT2A 1G15A 3V1RA 4CK3A 4FM0A 4FLVA 5HROA 1NJYA 4OPKA 1ZBUA 1NJWA 1SKSA 3ZT2A 2NUBA 2PYLA 3AVGA 3MXMA 3G0ZA 2HMIA 4C8LA 2YNFA 1JL1A 1IH7A 2OPQA 4OVLA 3ZSWA 4CEAA 4E1MA 3SV3A 1Q9YA 1TL1A 3ZSOA 1L5UA 3OYAA 1RT5A 3CYMA 2P5GA 3SZ2A 3AVJA 1D9DA 3VQ4A 3B6PA 2VWJA 3OYFA 1R0AA 4I7FA 4FXDA 1W0HA 1VSEA 4E7LA 1RBRA 4HUGA 3DLBA 5HBMA 1QE1A 2E6MA 3HP9A 3HO1A 1VSLA 5KRSA 2QKKA 3DLRA 1WN7A 4FLZA 4RW6A 4E89A 4R5PA 2F96A 4FLTA 5J2PA 4BWMA 3QEPA 2HNDA 3VA0A 2ATQA 3ITHA 4FJ8A 3O4QA 3AVKA 4EP4A 4QOZB 4FZYA 2Z1IA 3V6DA 3TAQA 1NOYA 1VSHA 1ZBHA 3OVNA 2Y1JA 1BL3A 2G8UA 4OLAA 3QO9A 5E41A 2XY6A 3WNHA 3U3GA 4CHYA 3KD1E 4FK4A 5T7BA 2OYQA 4O0JA 1S9EA 4FM1A 1TGOA 3L8BA 4QAGA 3RRHA 3HVRA 1GOBA 3NF9A 3ZT0A 3K58A 3SQ0A 3ZSZA 1BI4A 3L3UA 3SUPA 2YKMA 1VSFA 3LP1A 1NK4A 1TKZA 1RTIA 3TAPA 4KO0A 3DLKA 4CF2A 1J5OA 2VG5A 3QIPA 1RT6A 3T19A 2B4JA 3SJJA 3NCIA 4BE1A 3MEEA 5SZTA 1LW2A 1L3TA 4BWJA 4PWDA 1WSJA 3B6OA 4IG0A 1JLCA 3VQ5A 4W5OA 3NAEA 4C8OA 2AJQA 1S5JA 1VRTA 1KCFA 4FZXC 2OPSA 4DTOA 1UA1A 2G8IA 5SWMA 1BI4B 1REVA 1W9HA 1S1WA 3ISNC 4ID5A 1NK7A 4N47A 1KTQA 1U49A 1KRPA 1TV6A 3VQCA 4CJLA 3M8SA 5HLFA 1NKBA 1F21A 2YHAA 3V9ZA 2R7YA 3TAMA 1C0TA 3BGRA 1A5WA 3FFIA 3THVA 1WAFA 4AHSA 1RDCA 1CXQA 3CM6A 3CFPA 2KFNA 3M8QA 1J53A 3OYJA 1TKDA 2GV9A 4JLHA 4FJXA 1EXQA 1KVCA 4IDKA 3PY8A 4CJQA 2P1JA 3TARA 4FJNA 4B9TA 1NKEA 1X9MA 3AO5A 4KKOA 3SQ1A 2EHGA 3LP0A 3KJVA 1TAUA 1I3AA 1HMVA 4O44A 1Q9XA 1KLNA 4C8NA 3IRXA 2X6SA 3LANA 1D9FA 4DQQA 4XIUA 4KI6A 4PY5A 4FLWA 1UA0A 1BISA 1JKHA 4KAZA 1S6QA 2D0BA 2VG6A 5J2MA 2RKIA 4KB1A 2ZD1A 4CIGA 3P1GA 1LW0A 2QXFA 3VQQA 2WONA 3QEXA 2G8VA 3DRSA 3SPZA 4CCHA 4Y1DA 2XY7A 3AO4A 1T8EA 4BDZA 3NH1A 4G1QA 4CFCA 4CE9A 4HUFA 2OZMA 4DWIA 1GOCA 4HCCA 4CEBA 4CJ4A 4RW7A 3HL8A 1S1VA 1FK9A 3AVHA 1BQMA 4B8AB 4E7HA 4J2AA 3DLEA 2VWKA 2E4LA 3U3YA 3S3OA 3RR8A 4DTNA 4DTXA 3NDKA 4ZTFA 2O4GA 1KFDA 4F8RA 3NGIA 3VQEA 1T05A 2W42A 3OYDA 4JS5A 2BANA 4IBNA 4DFJA 2FBXA 1L3SA 3ZT3A 4ICLA 4CGFA 4DG1A 1QSLA 4KHWA 3AVBA 4DU4A 3PV8A 1D8YA 2KW4A 3OJSA 5KRTA 4H4MA 2XRIA 1Z25A 3A2FA 5CZ2A 1S1XA 2HNYA 4FCYA 3SCXA 4HHTA 1X9SA 5K14A 4FJLA 4EZ6A 4PQUA 3AO3A 3LAKA 4N5SA 4BDPA 4CEOA 4CGIA 3M8PA 3ASMA 1TK5A 1U45A 3K5OA 3ZSQA 1LWEA 1RT3A 3DOKA 1RNHA 3O3GA 4B9SA 3KLEA 1BHLA 3ZT1A 3OYKA 4C8KA 3KK2A 5KGXA 3IAYA 3C6UA 3O3FA 3LZJA 1I39A 3K5MA 2B6AA 4ELTA 4O0IA 4RW9A 4RW4A 2G8FA 5DK5A 3VQAA 1X9WA 3QNNA 1HQEA 3MXJA 4CF1A 3AVFA 3EZ5A 2E6LA 2IS3A 3VA3A 1XC9A 3ZSYA 4KB0A 3L2VA 4Z4IA 2F8SA 2ZQBA 1KVAA 4FJKA 2KFZA 3LPTA 3D0PA 3AA4A 3O4NA 4Q5VA 3OS0A 3T3FA 1J9AA 4AHRA 2HHXA 4CHQA 1S6PA 3NGYA 3HXMA 3AVCA 4DFPA 3QLHA 4ZHRA 4CECA 4CJEA 1MU2A 3OYNA 4W5QA 4M41A 4UQGA 3KK3A 3EYZA 3SYZA 4DFKA 5J2QA 1QSYA 2XHBA 3OYHA 4ID1A 1DLOA 3VQDA 4I9LA 1YT3A 4KHUA 2XY5A 2Z1GA 3K2PA 3NE6A 1ASUA 3QIOA 4DTSA 3NF7A 2Y1IA 4W5RA 2O4IA 3V9XA 4FJJA 4KHNA 5C24A 2OPRA 1HNVA 4KI4A 3OYMA 4FM2A 4ELVA 3RR7A 1LV5A 3AO2A 1A5VA 4CEFA 1NK0A 3SNNA 4F3OA 2BGGA 2KTQA 3OYEA 3S3NA 4W5TA 2D0CA 3V81A 5KI6A 2A1RA 4F2RA 3MEGA 1NJXA 5C25A 4LSNA 4I2PA 3KLFA 5I3UA 2BDPA 2OPPA 4J2DA 4M3XA 4CERA 3QEWA 2KZMA 1TVRA 3NF6A 3PO5A 4C8MA 2ETJA 4ZTJA 1C0MA 3V9SA 1KLMA 4CF0A 3SV4A 2WOMA 2HHTA 4CGGA 1KSPA 1WLJA 4CESA 3K5LA 3TAFA 5FRMA 1JLEA 4CHNA 1ASVA 1IKWA 1HJRA 4AH9A 4B9VA 2X6NA 3V9WA 5D3GA 4WE1A 3VQ6A 4CEDA 3DLHA 4F3TA 3PO4A 3RRGA 1BIZA 3OYCA 3VQ9A
chains in the Genus database with same CATH superfamily
4HNVA 4A0ZA 3HUGB 3HOWJ 4PGGA 1JKRC 4Q5SF 1FTTA 1B9FA 1YTAA 3KK7A 2O8BA 5BRDA 2VQHA 2VONA 3CI5A 3WG9A 3JYTA 4BE0A 3QEVA 2EB7A 3F0CA 1BL0A 2P7CB 4CJKA 4RMNA 3AY9A 3RMAA 1Z7LA 3FBNB 2IGOA 2JN6A 4WQ5C 2GOMA 5EZGA 3FZLA 3K1NA 5D5WB 1SAUA 3KKSA 3AA5X 1RETA 3SQNA 3BF1A 4GFBA 3O8GA 3HM8A 4OKEA 4BRQA 2Q1ZB 2ID3A 2ZF5O 1ORKA 1YW8A 3ECHA 4JI2K 4CZFA 4J2EA 3QICA 4CO8A 3KCCA 3A02A 3MVPA 3FK7A 3IAS2 2NRAC 3NHGA 1BW6A 1TKXA 3ZR8X 2ZB9A 3A5MC 1G3SA 3KX2A 4KT6A 2E34A 2X51A 3OIOA 3VDXA 4G7ZF 1WJBA 2MD0A 3BF3A 2YUSA 4IO9F 4XOTA 4IZZA 3GTPJ 4M3RA 4JI0K 4OO1J 4Z4FA 1UZCA 4PA1A 2V7ZA 1MNEA 3T8TA 4O3MA 3SPYA 4FT8A 4F3QA 4FJIA 1SVLA 4ETSA 2XY8A 3GWZA 3JRBA 1BOTO 2GBZA 2Q97A 2XB0X 1Y0NA 3J7AY 4YIFA 4EIAA 2VL8A 2G8HA 1IKXA 1BI0A 4M3WA 4BR7A 5J2NA 1FYKA 1RIOH 1VQMI 5AQGA 1U9OA 4E0DA 4F2SA 4FJ7A 2FXUA 5C12A 4KN4X 1IAWA 4PUSA 2HOEA 4IJNA 3R6MA 1KU3A 4JI3K 4DR4K 2XRNA 5IY5H 3R9PA 4N76A 1F1ZA 3VWBA 2JWKA 5J1RA 3TI0A 3TSPA 2KP6A 1GOAA 2NOJB 5GIOA 4FLUA 4CZZA 1F5TA 4NB5A 3CMMA 3LDOA 5JS1A 2DW4A 3DQVC 1YVUA 4HBLA 5BS6A 5GAGP 2QYOA 1QS4A 4DS5A 3I59B 3WODF 2XIGA 1QZ5A 2LH9A 1YQAA 2QM1A 5AQOA 1TL8A 1PUEE 4HX4A 4BBSJ 4JRQA 1BR1A 3S2WA 4O55A 3ONQA 4PFOA 1SD7A 2V1XA 2XGEA 3FXJA 5CVUA 3IRQA 1U04A 1D5YA 3CF2A 4HV6A 2KQ2A 3TANA 3HPHA 1H89C 2R5YA 3EL2A 1D8KA 3UKUB 1XNQK 3GZ5A 4E7KA 3KVGA 1NGJA 4UXNA 2QI2A 4H5RA 4XLEA 2A07F 2K40A 3NMUA 4M3BA 4LF7K 3O8HA 4ZJZA 3TBIA 3ID6A 4OIOF 2R0QC 2D5RA 2GWJA 2BBYA 1YJNI 2R7ZJ 1JXEA 1RBSA 2ZMEC 2F5VA 2KDOA 3AA2A 2HHWA 4DTPA 1W5CC 2DPUA 4BS9A 5FJ8J 1XQSC 4PUOA 3GLXA 4G6DA 3U2RA 3HJFA 4GKJK 1REPC 3E6BA 2XSDC 2HBLA 3AAQA 3L2UA 4KFBA 1H9GA 4FLXA 3SI6A 1L3UA 3BR5A 4HLXA 4CSWA 2Q3SA 1VQNI 2GBYA 2RDPA 4JQFA 4B47A 2FF4A 3VYTB 1MSFC 3EE9A 3FMRA 5F27A 2R92J 1T6CA 1O1WA 4EP5A 2EPFA 3DLLF 2QA4N 3AL0C 3VMFB 3G1MA 2PY5A 1VQMN 2IS4A 1ON2A 2EZIA 2AHQA 3DRPA 1N6QA 2A68F 1BCMA 2NRVA 2XF6A 3GTLJ 2Q0RA 3ENHA 4BJ6C 3CMYA 2L7ZA 3C3WA 1UHSA 2HB5A 5C4JJ 3LDLA 1AU7A 3HRMA 2F5DA 4BG9A 5FLXO 5TJJA 3HP6A 3G6EN 3I64A 1QTMA 1NK7A 2HVIA 3DYAA 1RDAA 4LC9B 1X2NA 4CCKA 5KTQA 5FO5A 1VSIA 4DQRA 4KPYA 1VQPI 2XO7A 3SBTA 3TO6A 1WRJA 2G7UA 1YHQI 1LQ1A 1R1UA 4M9ZA 1RILA 1JJ6C 1Y39A 1V5GA 4FOIA 1RT7A 4LF9K 1MGTA 2FJ1A 2EK5A 2R7XA 3GDQA 2P5OA 4KHQA 3MCAB 2YCHA 1SL2A 1AKHA 1Q1VA 3G71N 1QVFM 5FLXZ 4B9NA 4IX7A 3AV9A 4DLGA 4EJUA 4E7IA 5BOXA 3QFUA 5FFXA 5I42A 5C4XJ 2YR2A 3FM5A 4DBRA 4K41A 3ZX0A 4BR4A 4M3ZA 3FXMA 2YX6A 3UKUA 1P4AA 3CZ6A 3FIWA 4XRFA 4E7JA 4M3TA 1BI1A 1ZBSA 3QINA 2H94A 2FOWA 3VQ7A 2VT3A 1T44A 3C6TA 4MEYF 4JI5K 2BXYA 2W4SA 4PJJA 1NJIO 3VETA 4DQ8A 4DSIA 3F8FA 1HLVA 1Y97A 2P51A 1W7AA 2EIKH 1S72I 4AILC 2BE2A 3E5QA 4RB2C 3CETA 4JKHA 4A5AA 1YW9A 2LVSA 4ZDLA 3R6SA 4YFXF 3EKUA 3LA7A 2VGMA 5C2FA 3LZIA 5GIPA 1M1KO 5J3LA 2FBYA 3D45A 3P5JA 4Q0BA 1QQNA 4DR1K 1NG7A 1DT9A 1XUPO 4I76A 3MX5A 4EMSA 1WJEA 1EKEA 4BEHA 1HW2A 4LH4A 2D1KA 2PG4A 1RKTA 3W3DA 2O8FB 4ZH4F 3GTJJ 3K7AJ 3VOEA 5ICCA 4HDVA 1VSKA 2JGUA 2YHWA 2ZE2A 4XH4A 4CJTA 1NKCA 1SUQA 4RGRA 3EUAA 2FBTA 2GWKA 3TWHA 5F2RA 3NGZA 2I8DA 3EYYA 3H46O 3VYSB 5TKYA 3ULDA 1HKBA 4KTQA 4CHPA 4XOPA 3THXB 1IXSB 5JHUA 3IUOA 2Z1HA 3GE1A 4A3FJ 3I4MJ 2CGKA 4LH5A 3RZOJ 3FXUA 1ZAOA 1BJZA 4DU1A 2Y9YA 4C2TA 2DU9A 4JV5K 1J5YA 4KRFA 3LM2A 4CJRA 5F04A 1DU6A 4B9UA 4BR9A 1YS7A 4HPQA 2STWA 1VSDA 2B5JA 2RHKA 4FJ5A 2VQLA 2L7KA 3GO5A 5KGWA 2ZGYA 1NGDA 3BY6A 3QNOA 3LALA 2AQFA 3C2HA 3H9JA 4M73A 5KPRA 5J4YA 1OH5A 2BVLA 2EBIA 1ZRCA 1S7EA 1ZTRA 3RKXA 3ZQQA 3J80K 4HVJA 4AHVA 1BIUA 2VKHA 2QA4I 2ASOA 4IHSA 1DQUA 1K8KB 2M1BA 1R71A 1C1CA 1NK5A 3FM3A 4HDUA 2HBJA 4CGDA 1XMXA 3T7ZA 2CW8A 1HF0A 3RTVA 3O6BB 2Y48A 1ZGAA 4ZDOA 3DXJF 3D2EB 4BJ5C 1B9DA 4RGXA 1SL1A 2W85A 2DYSH 1Z26A 4CEQA 1CLQA 1WKMA 3JR9A 2W84A 4ILGB 4FJHA 3WEEA 2VBZA 3VEXA 1A04A 1IBLK 4DBQA 1MMGA 3F5TA 4A3MJ 4EJTA 4NCBA 5ADXH 1IJJA 4JI1K 2DFHA 3W2WA 4YOVA 1BC7C 4L9JA 2PMUA 3JCUC 1GDTA 2H8RA 2PJPA 4QS7A 1XWLA 3H5AA 5HDGA 2O7OA 5D6FA 1SS6A 2LKSA 1Z0XA 3HXLA 5CY4A 1LEAA 2R7SA 4Q48A 1VRUA 3SK3A 3D0SA 3M8EA 4IPAA 1S22A 4AM7A 2NNYA 3VYRB 5E84A 4I9QA 5FFZA 4X6AJ 1JLGA 1V4RA 1RDWX 3KD1E 2IVNA 3KK1A 3WGHA 4OJRA 2VOOA 1RCHA 3S1MJ 3CCRI 3QU6A 2P9PA 4O5BA 4BQOA 5FPNA 1UAXA 1ZR4A 2NS0A 4FM0A 1G15A 4FLVA 1S7AA 1VQ7I 1T56A 1Y1WJ 4OPKA 1ZBUA 2QBYB 2J4RA 2JSCA 1HKGA 3VF4A 3ZT2A 2A3ZA 3AVGA 3VOVA 2PYLA 2J5PA 2E2NA 2LBFA 4BY1J 2DTZA 2V7FA 1JL1A 4OVLA 3BTCA 4JX5A 1YJ9I 4CEAA 3SV3A 1HDDC 5E1XA 4YFKF 4NBQA 3OYAA 1DU0A 2V1UA 1RT5A 3MWTA 1L5UA 3KE2A 2VASA 1F9NA 4HOBA 4RAGA 1ZLKA 1BR4A 3OYFA 4KA4A 1ZELA 1WHUA 1I1GA 5LHHA 2ZSIB 5CVRA 5HNFA 2O8FA 1W0UA 4IL6C 1WVRA 2VUMJ 1ETOA 2OCCH 2Y2ZA 4HYEA 4IJAA 2X1DA 5KRSA 1GLNA 2YS9A 3H9GA 4FETA 4XORA 2BY1A 3SXYA 1U5TA 2XV4S 3J80Z 2CWEA 2XSJC 4B1RA 2F96A 3QEPA 2HNDA 3VA0A 4QOZB 1GLDG 4EP4A 3HHGA 4KH5A 3HOTA 2HR3A 3BCBA 4C3IJ 4UY8I 5J47A 3THYB 1YRNB 5AQRA 3DKYA 2G8UA 1BL3A 1ZBHA 4GVEA 4XNFA 3WNHA 3U3GA 2L9VA 3C7JA 3FXKA 5FPDA 3PSIA 3IP4B 2BGCA 3M9AA 2OZ6A 3QDKA 4O0JA 3I56N 3R0JA 3TW7A 2K9NA 1OCRH 4BRIA 3HVRA 3K58A 2FSKA 3ZSZA 1RUNA 2F2EA 3L3UA 4DV4K 1UG0A 5CLSA 1D5VA 3DXKA 3SMSA 1NK4A 3DCFA 1D8JA 3DBHB 1RTIA 3K69A 1F4KA 3QP5A 2LR8A 3QIPA 1EA3A 5KQ8A 2MH9A 2B4JA 4BC3A 1R23A 2HF3A 5F0FA 4BEHB 3CPWM 3MZHA 4RM3A 2YHYA 4JN4A 4PZJA 4BWJA 5H1SQ 2HFHA 1L3TA 1WSJA 4PWDA 4LK1F 4HNUA 1QQOA 2ZJQL 1JLCA 3LMMA 1LDDA 2AJQA 4C8OA 2OUMA 1S5JA 1OCCH 4FZXC 2P8TA 3ZN0A 1JJ2M 3LL3A 4PSXA 4AVZA 1BR2A 3SEZA 2W82A 3KETA 2WAEA 1KTQA 4AYBA 2E20A 4WCGA 1LDJA 3G2BA 2MG4A 1JHFA 5IOYA 1F21A 2YHAA 1HNZK 1KZHA 1E3OC 1VAZA 3FXQA 3ABKH 4AHSA 5HVQC 3CM6A 2VKVA 3CFPA 3M8QA 4PK4A 4FPAA 3JTHA 5EG0A 1GLAG 1WBBA 4FJXA 4JLHA 3THYA 1N32K 3H5NA 1D0XA 1U6GA 1S8NA 3JS6A 4R79A 4FJNA 2E5NA 4B9TA 2P7VB 5L3BA 4RAZA 5K7HA 5LHGA 3KEQA 3TEDA 4I01A 1VF9A 2EHGA 2EZHA 1XGMA 2ADUA 3FE1A 1KLNA 4BXFA 3D1NI 3CHWA 1FYLA 2NOGA 3IRXA 1QU3A 1D9FA 4KI6A 4PY5A 4JHDA 3VTHA 4FLWA 9ANTA 5AQTA 5AIPA 5LL6Z 3QYBA 4M3FA 3MFKA 5D5XB 2D0BA 2H3GX 5J2MA 3ML6A 1EO1A 3ABLH 3LSGA 2ZD1A 4RAFA 3GOIA 3CDLA 2JUGA 2FX0A 2QXFA 3OBYA 4IDHA 1K73O 2VODA 1Z3XA 4XONA 4XBFA 1YIJN 2G8VA 5C44J 3BTLA 1WSUA 2EA2A 5DCMB 1L0OC 1VI0A 4BDZA 1J5EK 2RC4A 1MWKA 1IN4A 4HUFA 2LF8A 3U1KA 3OSFA 3QFPA 2IGKA 4IRHA 2L3DA 4Z2YA 5A2QZ 4HLYA 1J59A 3G73A 5DUKA 5DCFA 1BW5A 4E7HA 2VJ4A 1ATNA 4J2AA 2QWWA 2E4LA 3EDPA 4DTNA 4ZTFA 1XCBA 4WFNL 5LMUK 2HMPA 4DTXA 3NGIA 4RGUA 4ENNA 3L0QA 2NLXA 2F4VK 3K4LA 1TT5B 5AFUH 4WQ4A 4ENKA 2ZJPL 2E36A 3FK6A 3ZT3A 5LFAA 4KHWA 2JA8J 3CP2A 5FKMA 3AVBA 4DU4A 1TQIA 4IEEA 2CSOA 4DYCA 1D8YA 3H35A 3OJSA 3HOXJ 2XRIA 1JXSA 3EETA 5CZ2A 4DR5K 3WTXC 2E2OA 1TTYA 4NHJA 1R36A 2P9LB 3QBWA 2L9SA 4NC6A 4N5SA 5CYVA 3LSJA 1YI2I 3LAKA 3GTGJ 3OBWA 4BG8A 3M8PA 3CCVN 3RKWA 3VSKA 1G8XA 1LWEA 1IRFA 5IYCJ 2A42A 3CPEA 3D7EO 3K5OA 3KLEA 2DT5A 4R8HA 3BWGA 3ZT1A 5LEKA 4I0AA 3CC4I 4PHTX 5KGXA 2CV0A 3CJRB 2EIMH 3E7LA 3IAYA 2D1VA 1FJGK 3O3FA 1I5ZA 3F21A 3ZLJA 2B6AA 3H1CA 5DK5A 1RKWA 4YOWA 1HQEA 4M3YA 3HM5A 3VF2A 3VA3A 3JRCA 2E88A 3SMPA 3E5UA 2HXIA 3F22A 1KVAA 3B8AX 5KPTA 5JVHL 4YOXA 4NUBA 1FZPB 4QS8A 4DV0K 3T3FA 2LSOA 3LNQA 1KU7A 3M5RA 4JKGA 2X0LA 2KHMA 2OU2A 1S6PA 3PUBA 3DU5A 4DW6A 5AZIA 3HXMA 4XQFA 1ZG3A 4S04A 4IHTA 4MTEA 4CECA 3PM1A 4BGAA 1X9JA 1O57A 2CQXA 1JT0A 5EDNA 5J2QA 1RGIA 4OAYA 3AG1H 3JAMZ 2XHBA 3KYCB 4CA0A 3HOUJ 3RZDJ 1MD0A 2MLKA 4I9LA 1H88C 5J1YA 4BBRJ 4BROA 2Z1GA 2GA1A 2L5QA 4JK8A 1IV0A 1Z77A 4IZ9A 1ASUA 2NXNB 2O4IA 4W5RA 4UVCA 4CCNA 4EVIA 3LSMA 3WQUA 1B6AA 2AXLA 2OPRA 5FKLA 4JYAK 4AM6A 3RR7A 3L2CA 1JKPC 4CEFA 2WBMA 3F9MA 1KGSA 1NK0A 4F3OA 3X2QH 3OYEA 3CDHA 5GTHC 4A3KJ 2HZTA 1TT0A 1H8AC 2QM3A 4W5TA 2D0CA 4F2RA 3IKVA 3MEGA 2BE5F 4LSNA 3W6VA 1ETKA 5C25A 3KLFA 2FSWA 4PSWA 4C1NK 2VC0A 1NM1A 2P9NA 4B1XB 5TRDA 1TVRA 3M1CA 3H9QA 1Z6RA 5CVJA 4ZTJA 1OKRA 3PO5A 2KZMA 1P9QC 1OPCA 4XN3A 4UNOA 1OCTC 1YS6A 1T39A 2NNWA 3OA9A 1YE9A 3I9V2 3NARA 1N36K 1KSPA 4CESA 2PQ8A 4LG3A 2HDCA 1F43A 3TAFA 5FRMA 3TOBA 2XPVA 1JLEA 4OIQF 5ILUA 2D5VA 3C6HA 1ASVA 4PKIA 1IKWA 5BR9A 5D3GA 4B9VA 1K78A 2ZXJA 1T3VA 3KHYA 4CEDA 1TNTA 3DLHA 1D0ZA 1TWGJ 3MN2A 4A5BA 2XB5A 4CGIA 2PYJA 1WJ5A 3O2PE 4FWLA 1ZYRF 4CEEA 5CVIA 1B92A 4DTJA 2M45A 1N78A 3AVNA 3ZX3A 5M1KA 4CD3A 2ECCA 2DQRA 4I09A 1BQNA 1OH6A 3BG5A 4BRLA 4NQWB 5HLHA 4CF9A 2ZJRL 5AQPA 4JRPA 2R7WA 1LWCA 5E1WA 2P5LC 2BOLA 4HAMA 1CQTA 1SL0A 1FOWA 1SFXA 5JVTA 2UWMA 4L3QA 2ASPA 3RIRA 2E2PA 1MJ9A 1SD5A 4DSJA 1FWZA 2QVOA 3KP3A 1HYZA 1E3HA 3CUQB 1U3EM 3MN9A 2VBYA 4NLCA 4LD0A 3LWLA 1U47A 3RWUA 4LD5A 1QZYA 3ZXSA 3TO7A 4A6EA 2HVHA 4O4GA 3L6QA 2N8GA 2NVXJ 4KN7X 3VEVA 3ZQIA 2ELHA 1J09A 1SFEA 3CJTB 2HZDA 1IV6A 3A1YA 1YF5L 3ZMVA 2JLEA 2PBDA 3KZBA 1P4WA 2ID6A 2XKPA 4XH5A 2GUIA 5EYRA 2VN2A 2OTLI 1IN7A 1JLFA 2G8WA 3CD6N 2ZMEA 4KIGA 2IGMA 2CYYA 2W24A 3GUDA 4WQ4C 1HKTA 5AQSA 1NOZA 1KQSM 4ELUA 4MLEA 1X3WB 5EXWA 2ZJPF 2CRGA 3BROA 3TO9A 3DPUA 3IS9A 1MSEC 4BRHA 1HPZA 3WXLA 1KQ0A 2GZWA 3HKZN 2QWQA 3BR6A 3DEUA 3LWMA 1FP1D 5FD6A 3WNFA 2E2HJ 1SKWA 4DQSA 2HQ5A 1ZQ3P 2LK2A 3VN5A 5AQUA 3OJUA 3KKRA 2PX9A 5ICFA 3FLCO 3T1AA 3E1SA 1LE8B 3ATUA 4GGGA 4FO0A 4N9HA 3S1NJ 4GNIA 4HW0A 1RTDA 2KZZA 3D5RC 3NWSA 5H2FC 3TL4X 3WTVC 4B4CA 4CJPA 5HRNA 1HUXA 2V6CA 3U9ZA 4BQLA 3TAEA 2ICWG 2AP1A 3B73A 2ITMA 4EFHA 1OISA 1ZHFA 4IHWA 2FEZA 2DMPA 4DSLA 2F7TA 2O8CB 2UUZA 4DGWB 5GAGJ 4H0EA 1Q7YO 2G8KA 4CZHA 4CJSA 1W7PD 4G7HF 1A36A 2L9RA 5JLHA 5DTDA 1DDNA 1H9TA 1E3PA 5I9EB 1IBMK 5EX5A 2HS5A 2IA0A 2XPWA 3KYDB 1O7FA 3V7SA 2WC9A 4FW2A 3ZSVA 3VEZA 4CEZA 1C0FA 2LSNA 2O0YA 1XSDA 1TKTA 3CMEN 1N33K 5CKTA 3LQRA 4A5MA 3S16J 2EWSA 3DOLA 5BRHA 1YJNN 1V55H 3PSFA 5CZ1A 1HYVA 2QWLA 3V4IA 3I54A 5HRSA 2GOXB 4X0GA 4PKHA 4P9FA 3H3VK 4BR2A 2FUG2 3LWFA 2EIJH 3GX4X 3S3MA 4WQ5A 2OA4A 2LDUA 3UR3C 3CCQI 2O8CA 1JGSA 3OV8A 2E71A 1UFMA 4AHCA 2VJIA 4WK8F 3DLGA 4AQYK 1YLFA 2LBFB 5BMZA 2A61A 2DTUA 2P6SA 2DK8A 3QYFA 3WU1B 3KYLA 1IJWC 4XSXF 4HF1A 4LB5A 3C95A 1X1PA 1TUYA 1VQ7N 1HKCA 3PX4A 4M72A 2HW3A 2WTEA 1RESA 2IS6A 1N5YA 1F36A 2KIFA 2F8TA 1U8BA 3M3ZA 1GV2A 2P9IB 3FZKA 4PL8A 3WQTA 1LEBA 5CYMA 2BY0A 3F6OA 3HSTB 4CZMA 3HDDA 1WSIA 3FFKB 5KAFC 3L4IA 4YRVA 3CFRA 2JWTA 4G6QA 2VT2A 4BU2A 2ELJA 3DEWA 4QWQA 1E0EA 1YHQN 1Q81O 4KV8A 5HP1A 2CFOA 3BZCA 3OYBA 2KRFA 2OZUA 3T69A 1QO0D 4EZ9A 1GLEG 1FSEA 4C3JJ 4YORA 1ZARA 1ERDA 4MQ3A 1R59O 4ABZA 1JHHA 5KNLA 4LLNA 4K8ZA 1R1TA 5HS8A 2OV7A 3S1QJ 2W25A 1NU0A 2QW9A 2UXCK 1JKQC 4KTWA 3V1OA 4JK1X 1JXBA 4DTMA 3DMJA 4DQIA 2K9SA 3CD6I 1P7JA 2D0PA 4AIDA 2L02A 1VK0A 1WOQA 1TP4A 5B8HA 1BGXT 2GWRA 5H20A 3K70C 4KHPK 3OSGA 1RT1A 1UAAA 3LPUA 2OA8A 2ZNYA 3MEXA 1MZBA 2DFFA 3ZSXA 4BGBA 4J01A 4JKCA 3ZEUA 1ETXA 3OOPA 3CUOA 4BRKA 4CW7B 4DF8A 3HPGA 1JLQA 1ZYQA 2JK3A 4DMNA 3QBXA 5ELZA 3PX6A 4TV7A 3CF5F 3P31A 2W40A 1IDZA 4CFDA 3KZIC 3LSPA 2DXIA 5KVRA 3M07A 3DKXA 4N56A 1OR7C 4E7SA 3MWPA 1ETWA 4UUSA 1YG2A 4M9XA 1QHTA 3S9HA 3HSFA 1OJLA 5FROA 5IYDJ 1GXQA 1P90A 4D7NA 4DOZA 1QNTA 4I7HA 4TSXA 2X6WA 4H4OA 2EFWA 3I8DA 3MXMA 3AKZA 4O6JA 5D4SA 4A2BA 5BPMA 2LD5A 1D0YA 2IPQX 1IRGA 5DM7F 1ITYA 2DK5A 4DTRA 3P38A 2X6OA 2PAVA 5KCMA 3BP8A 3MDQA 1FPQA 4XH1A 3CCJN 2E5ZA 5GPAA 2HTSA 3UE5A 3FISA 1YITI 4QPOA 3N4QA 4ILJA 4MNUA 3HT3A 1GUUA 3TABA 3ECOA 2KIQA 4ISGA 3O9SA 3GXOA 3GFJA 3F9KA 2CO5A 5F0HA 2ISZA 3BEXA 4KBOA 4OLBA 3G1LA 2CH5A 2FBVA 2BV6A 4B44A 2HNZA 3OYIA 2WTUA 3L7WA 4DUYK 2A1SA 3JW4A 3FZMA 5EZHA 2FNAA 4HX7A 1VQKI 2HSTA 5FLMJ 1NGCA 1TWHJ 2RNGA 3CJAA 5E3OA 5JS2A 2YKNA 5C3EJ 2HDDA 1EP4A 2HI3A 4CI6A 3NRVA 5EEHA 4A5NA 2DA4A 3S1RJ 1B8IA 4NCAA 4XN0A 1ITGA 5LEJA 4CGHA 2P9SB 4YHHK 3SUNA 2XF5A 3I0SA 3S14J 3BPXA 1KYWA 3HSCA 3E97A 2DJNA 3LSIA 1YJWN 4C2UA 1VQ4I 1OYWA 1IN8A 4BXUA 1TQPA 5DCMA 1VTNC 4B8CA 1U8RA 2EV6A 4C2MJ 5AQNA 3VERA 4F4KA 3KP5A 2NS8A 1W7PA 4P5OA 4XLAA 1P6RA 2XROA 1RTHA 2HQAA 1ZG1A 1V5EA 2QUFA 2ELKA 3G3ZA 2RNJA 3TOAA 4E19A 2CW7A 4HF0A 1IZ1A 4YOUA 4K2EA 4JD2A 1YITN 3JAMO 3THWA 1T8IA 2HHSA 3HYIA 1T0FC 4ASNA 3V4GA 2IEKA 5C10A 1OFCX 4RBOA 2CJJA 4XR6A 4ZYGA 2E2QA 3TAGA 1EWRA 1FXXA 2LREA 4B3MK 1TW3A 2PMZA 4H5NA 1XHXA 1K7AA 1DUXC 2QK9A 1QQCA 1BOAA 1XN7A 1Y8RB 2CUEA 4HX8A 4DIQA 3IRRA 1CGPA 1A5XA 4ENMA 3I8BA 5DDGA 1JJ8C 5GAEP 3VF6A 3HM9A 4LFBK 1ILYA 2X1CA 4IFEA 1WSGA 3U8XA 2JQ7A 5DM6L 5JHFA 3DRRA 2RE2A 2MH2A 4NYNA 3EUHC 4G94A 2K85A 2X78A 3JRAA 3ID8A 3VQ8A 3OWTA 2M9HA 2EX3A 4PL7A 1UOCA 1RT2A 3V1RA 3QERA 1NJYA 2DY4A 1QHAA 3KLNA 2VI6A 2XASA 3GMEA 2HBKA 1SKSA 3DP7A 1BU6O 1NGBA 1WZ2A 2XAHA 4QIWN 1S3JA 2DJIA 1TZLA 3WU2C 5IOZA 4H0VB 4C8LA 1Q9YA 3TW6A 4EZ6A 1T6DA 2FMYA 3A0IX 2OQGA 4W97A 3CMAN 4ESFA 2PN6A 2A6AA 4M3GA 2QSFX 1RR8C 4D5FA 1G4DA 1B72B 3N4PA 5M3FJ 3VQ4A 1YJ9N 4I7FA 1R0AA 1O3SA 1W0HA 3R1XA 1SVMA 4L9NA 1P8ZA 5M1FA 5HBMA 3DLBA 3LSTA 3S8PA 3K2ZA 3BZKA 1MDUB 1QE1A 3HO1A 4A6DA 5FKKA 2WV0A 2HVRA 2QKKA 1XS9A 1WN7A 3DLRA 3GG4A 3VGKA 4FLZA 3CCSI 3HRGA 3OW2M 5J2PA 1GHCA 4BWMA 2QWPA 4FJ8A 1ENHA 3GFMA 1XMOK 3HB9A 3I4NJ 3CCSN 3CTAA 2W1OA 3IUCA 3V6DA 4A3DJ 3OVNA 1T05A 4MEXF 2DN0A 2R7TA 3PIOF 3HTVA 3J7YJ 4CHYA 3FMQA 5T7BA 1VQLI 1AA7A 1S9EA 1VFCA 3L8BA 3J8AA 4QAGA 1KYZA 5IP9J 3IHUA 4FM1A 3RRHA 1GOBA 1S3XA 4FOEA 3ZT0A 3VFZA 2IA2A 2YSRA 3KP6A 4BH9A 3HIFA 3CCRN 4RB1A 3SQ0A 3HZJA 2A6EF 2MD5A 3SPZA 4KDPA 1Z1DA 2O61A 4GKKK 3CC2I 1T38A 3HRTA 3TAPA 3DLKA 2KLAA 1XB4A 4IRIA 2AO9A 2IVOA 2BH1A 3NCIA 3MEEA 5F0CA 4ZYAA 1IN5A 3G25A 3SDGA 3U9DA 2MW8A 4KJZA 4B1YB 3QB0A 5K7FA 1XTAA 2E1MB 5FPEA 2I7NA 2UZKA 3RSNA 5DS9A 5EGOA 4II2A 1VRTA 3ZYYX 2DCEA 3LDQA 3E6CC 3WTZA 3GFIA 2B7EA 4PFPA 2R5YB 5EEAA 1J0RA 2VC1A 4MGRA 1REVA 1S1WA 2FQ4A 2CQQA 3LQQA 1OMIA 2X48A 1U49A 3CCEN 4A3LJ 3DFGA 1SAXA 2P5GA 1HBXG 3V9ZA 2R7YA 3TAMA 5AJ3K 5JVGL 2PJRA 2CFXA 1A5WA 3LL7A 1PUFA 1T98A 3HSRA 1CXQA 1RDCA 2VWBA 1UHWA 2M4KA 2BTFA 4LLGF 1O7LA 4WF2A 1FYMA 2IIRA 4IXCA 4B1WB 3TDZC 4Y4RA 1WJDA 5IP7J 4G7OF 2HYGD 1KVCA 4A59A 3DV8A 3ZRGA 1NWKA 4CJQA 1X4OA 1E17A 4IVNA 1UG2A 3IAM2 4YDUC 2GIVA 4DR2K 4DV6K 2V9PA 1MBGA 2LG4A 3LP0A 3MK6A 4JK9A 3KJVA 3SQ1A 1HMVA 1Q9XA 5J8FA 4RS8A 1JTYA 4CYDA 4OIPF 3GL1A 1HDPA 2OJED 1JUMA 5IT3A 4C8NA 4A61A 3WTWC 4YIIA 3ROUA 3BC8A 3HKZA 4RB0A 3V8KA 4MQ9F 1GVDA 2EILH 1JKHA 4BQNA 3AG2H 3OR1C 4LGWA 1YOVB 4HEA2 2IW5A 4LFCK 1EH6A 4A12A 4CIGA 3RSEB 4M7YA 4AIHA 1YUWA 2D4WA 2EJRA 2NS7A 1TLHB 2XGXA 3E01A 2CV1A 4JOMA 2FXAA 5F1RA 5D6EA 3NH1A 4G1QA 1MNMC 4CFCA 2E1OA 1M90O 3AGKA 5AQKA 4A57A 3K2AA 4U0VA 1EH8A 2OBPA 2A5YB 2HOTA 5GAHP 4LIUA 3HTSB 3HL8A 1S1VA 4FASD 3DLEA 2ACJA 4ITVA 3U3YA 5E18F 5B1BH 1K79A 4F8RA 1TWAJ 5FKNA 5HOOA 1VQ6I 3QEIA 1NGAA 4BQAA 1MBEA 2ZJRF 3LDNA 3P9CA 5HLGA 2AXTC 1X1BA 3OYDA 1TYQB 1R7JA 4IBNA 4JS5A 3DTKA 4J2DA 2E1ZA 5AQJA 2V52B 4HQMA 4DYRA 2C6YA 1QSLA 4GY2B 3Q7CA 3FZVA 4WXHA 3GLLA 3H0DA 2KW4A 2GXGA 5KRTA 3HUGA 2KDZA 3EE8A 3D2FB 1MDMA 3DXKB 3PLAA 2MABA 4FCYA 3MZYA 2HNYA 4HHTA 1X9SA 5K14A 2M8EA 2VQEK 2JUCA 5HS9A 4YOTA 2KPMA 4PDKA 1BA5A 1ZN2A 3AO3A 4BDPA 3O9UA 1N75A 1TK5A 4I6ZA 4L5EA 4PJMA 1SMYF 3HTUA 3DOKA 3H6EA 4C23A 1O3RA 1K4TA 1BHLA 3UKRB 3WE3A 4BRFA 1KXPA 3ENOA 4C8KA 5F0XA 3CC7N 3CUQA 4L9TA 1MH3A 3GBTA 2F4MB 3RSEA 1QBJA 2L54A 4XEIA 1I50J 4RW9A 1WWXA 3MWMA 4RW4A 1QPIA 4WF9L 2A40A 3I5UA 5D4RA 4YDUA 5AQQA 3K4MA 3ZSYA 1R6RA 5CE3A 2ZQBA 3WTSC 3WGGA 3IL2A 2KJCA 4ESJA 1AWCA 3A5NC 3OTOK 3HG9A 3GTQJ 3O4NA 2HVQA 5E8GA 3OS0A 4GV3A 2KFDA 4UB6C 2OTLN 2ZMEB 1SANA 1XMAA 1UELB 5CPRB 4X64K 5ILSA 1MMNA 1QHHD 2MGQA 2JWLA 3OIQA 5IT9K 3AVCA 4DSFA 2R93J 2P9KB 5ADXA 2ZGZA 3FKJA 3JTGA 1GLFO 1NMNA 3O1BA 1Z67A 4Y7NJ 5H6QA 4A2AA 4DUZK 4WCEL 4ID1A 3A0BC 3VQDA 3GYHX 4F9OA 5JICA 1BWFO 2DA7A 2DPNA 2W48A 3WXIA 5E17F 4CF1A 3HOVJ 2F6CA 2XY5A 4KHUA 1HKSA 4FWMA 3K2PA 2VPRA 1G99A 4DV5K 3O80A 3QIOA 4WFAL 4CUGA 2P9SA 2CQKA 3V9XA 4CCJA 1XC5A 4FWSA 1HNVA 4NO7A 3V7CA 4CJ7A 3OYMA 3NWTA 2O8DB 3K4CA 4G9ZA 4XLFA 3DKWA 2BEOA 3JSOA 2XPUA 4JBAA 3PFYA 2KTQA 1MMAA 2HF4A 3VENA 3D6RA 4I98B 1VQPN 4UY8O 2A1RA 2UXDK 4CDGA 4D0PA 3RYRA 3SZTA 2HWVA 1HX1A 5GINA 4MLHA 1FBQA 2BDPA 1EV7A 2GM4A 1HSJA 1ZG5A 1X1DA 3NF6A 2ETJA 4OPAA 2VE9A 1C0WA 1KLMA 3R61A 4CF0A 2FU4A 2WOMA 4CGGA 1W1WE 4HF2A 2LC2A 3WHBA 5ICEA 5JLWA 1LB2A 3E66A 4BL0B 2GUPA 3H3ZA 1W36D 1K6OA 4AH9A 1IW7F 3V9WA 3VODA 3DBLB 1BJAA 2TRTA 3VQ6A 1XCVA 3K4KA 4N0BA 3OYCA 3K1PA 4HG2A 1J6ZA 1SFUA 4KH4A 2EA4A 1XGSA 1JCEA 3E9OA 4BACA 3Q7BA 5C2DA 4B1UB 3K57A 4GV6A 3E6DA 3KP7A 1NGIA 3MEDA 3DBRB 5D5UB 4CZEA 5HL7L 2GELA 3Q9VA 2RN2A 3I3LA 4QCLA 2XF7A 3VEPA 1S1TA 4CD1A 5ED4A 3FZHA 1U4BA 2KJBA 4ZYDA 1FX7A 3KTQA 2IGIA 5EJCA 2VG7A 4CK1A 2A5XA 1X58A 4Y33A 1RPWA 3VEWA 1P92A 4OAZA 3WHCA 1NG9A 4H8KA 4NLBA 1FKPA 2K4BA 3EPZA 4L5JA 5AQHA 4JKFA 4JI6K 4Z94A 2Z5UA 4H5WA 3J7ZO 1N8RO 1T08B 4Z4GA 1X19A 3GTOJ 2WB1N 5IT9Z 3FX3A 4C1NI 2CS3A 2ITGA 3ELKA 4EHUA 4O8KA 4NC7A 3I55N 2G0EA 3RMDA 1A6IA 1LNWA 2P9LA 3FGUA 3IWZA 4YY3K 4OGEA 2Y31A 4XLNF 4ZYEA 5K5RA 1RC9A 1VQ6N 2OC6A 4B8XA 1S29A 2Q2EB 4JKGB 2BYVE 2O8KA 2ZFUA 4RA2A 3AGRA 3KD5E 3A4CA 3D5SC 1BCOA 2GX9A 1Q82O 2QZ8A 3ZQFA 3TQNA 3EEQA 2Y9ZA 4XRMA 4BVPA 3DPTA 1FJLA 4BR5A 3NAUA 5J40A 3NFAA 2XUBA 1SD6A 3C2GA 5GADJ 4RB3C 2R7VA 2QXLA 2WBNA 4H0TB 3FWEA 1XMQK 4FYDA 2E2JJ 2MYSA 1HQUA 4IOCF 2YV0X 2EINH 2ME0A 2R7DA 3I0RA 4ILHA 1MIJA 4QS9A 4PKGA 4IXAA 2P5KA 1KVBA 1TAQA 5EOYA 1YX5A 1XNRK 3PX0A 1ZBFA 4KFCA 4H0PA 1DPRA 4WXCA 2E1MC 3MZ8A 5E3NA 3PIOL 4OPJA 1TK8A 2MBFA 4M6XA 3ZP5A 4Y1CA 4KYWA 4CGZA 1LAVA 3RVCA 1QVUA 3O1WA 2P5VA 5K5QA 3VGLA 1B4AA 4BYYA 4B3OA 2Z33A 4XRSG 3NF8A 5K5OA 3QAHA 1NMDA 1ZREA 1RT4A 1YVNA 3E9LA 3EKSA 2DA3A 3OY9A 5A2QK 2YU9J 2IDOA 4PGHA 1N34K 5M1QA 5CHIA 3SZ2A 2VXDA 2R4GA 4CJUA 2H27A 4IQJA 5C42A 2NRXA 4BNCA 3KIOA 2YU3A 4F7ZA 3M1EA 4GDFA 1ETYA 3P4IA 3AVAA 3PNTA 4DQ2A 3C18A 4Z0UA 3EUHA 2JMWA 4HV5A 4PJ0C 2WUSA 4HTLA 1DEJA 5H6RA 1JI8A 2NVUB 4KUMA 1BC8C 2VYPA 2NYXA 3C94A 5EY4A 2HHHK 4MFBA 2MC3A 2DDAA 3E5XA 4MIMA 4M6VA 1HC8A 1HNWK 1LJ9A 1KC8O 2UUCK 2CH0A 1NGHA 3W2AA 1RTJA 2E35A 2Y30A 4LITA 5LLQA 3QPSA 3PIPF 2KZVA 3C0BA 5E1ZB 4NYFA 3DF8A 4FWOA 2K9MA 2PI0A 3QYEA 4EGYA 1WUAA 4D1QA 2G7HA 3UIQA 4KREA 4FE4A 3IG1A 1NNEA 4U0YA 4BE2A 4CFAA 5BPIA 1FOXA 3ZCOA 1R4NB 1YJWI 1U9NA 2EZLA 4H4KC 1G6NA 1O3TA 1S1UA 4DYQA 3NH0A 4MFDA 3FHZA 3M7GA 4H5TA 4Z4EA 3DEEA 1X4PA 2GA2A 5LRSA 2JSPA 4JX6A 4IHXA 4AIJA 4II3A 4QPQA 3A0HC 1DGKN 2Z16A 2KRHA 2DODA 2QWNA 1ZH5A 2L4MA 4JEPA 2R7OA 4OMZA 4FVUA 3ZMZA 3QPHA 3Q3SA 4FWNA 4ON0A 3ZETA 4UUSB 2RKHA 1ZKGA 1I3QJ 2EFPA 1R1VA 2EQRA 1FC3A 1Q18A 2HOAA 4DS4A 2IVMA 3TSQA 2CW0F 3K4BA 4AUXA 4A3JJ 1WSEA 2LLKA 4U87A 4XKBA 5K7ZA 3E9PA 4Y15A 3UNGC 1RDBA 4JKBA 2WADA 3QESA 2O8XA 3HGGA 1WSHA 3AAFA 2A5WA 3FBIB 1KAZA 2Q2EA 3NBPA 3AO1A 3J7ZI 2YHXA 1ZC6A 3JAMK 3MKWB 4OINF 3TSUA 2X74A 4BC2A 2F48A 2Q1NA 4I6MA 1I27A 2HHUA 2QKBA 2QWOA 2QGUA 1ZBLA 4IFYA 3MAQA 4B9LA 4M63C 1LAWA 4F55A 1UWBA 2P9NB 1KONA 3RDIA 3O9QA 2AA4A 4GMJB 4XSZF 2YPRA 2KHOA 3CO7C 1B9MA 3DAWA 3QQAA 5CYQA 4FK0A 3ZETB 2Q8KA 4B3AA 3G4SI 1T2KA 3H08A 1IKVA 1LWFA 3O9TA 4OKKA 4AF1A 2BW3A 1BM9A 1SV5A 3G6EI 4E1NA 3K5NA 2DFIA 3E0JB 4IF4A 3QOPA 2NRZA 1W36C 3ZMUA 4S0HB 1H0MA 1RNLA 2YNHA 3MX2A 1IUFA 1C1BA 1VQ8I 3ZCMA 3HPOA 3SQ4A 3QODA 4BRNA 2CH6A 2P9IA 5EF6A 3O4WA 4CZJA 3GEZA 5DMRA 3SJMA 3K0LA 4CF8A 1PJRA 5GAEJ 3OS2A 1XDUA 3AA3A 4YFUA 2ECBA 4B43A 2JRMA 5TISC 1U2VB 2DA1A 2KMUA 5DEQA 3M8FA 1ZR2A 4DU3A 4FK2A 3P7NA 5K1YA 3AVLA 4EQQA 1FMWA 2GTDA 4GW6A 3ULEB 3JXUA 1MJBA 2M0CA 2OZSA 3C2BA 1J9IA 2E1CA 1RBTA 4CJVA 4E6KG 3RQ4A 4DB3A 4EHTA 2ZM6K 4DHYA 1QZZA 3M8JA 3LDPA 3K59A 3DI6A 3SUOA 5BR8K 3EYIA 3SQ2A 5D5VB 3DXMA 1WI3A 2M4GA 4B9MA 4YEJA 5HODA 1SKRA 5FLXK 1CXUA 4EEFG 1NK6A 5M1PA 4LFAK 3JRHA 2WY8Q 3LSRA 3EQLF 3CIPA 1SD4A 3ABTA 2XAQA 4OMYA 3HVTA 5EU7A 3GW2A 1P4XA 5DD4A 4IG3A 4L8RB 2BVMA 5HRRA 3N05A 4N4OB 1QSSA 1BIBA 3BLYA 1NG6A 1LCUA 5LGNA 5HLTA 3BJOA 2PFBA 4JKEA 2F4IA 2JJ7A 4UVAA 5CJ9A 3EY1A 3CLQA 5C15A 5J6XA 2EV0A 3T1HK 4HCBA 1IG7A 4FJGA 1HLUA 4IO8A 4YNQA 2XC7A 1T7PA 1PUFB 4ISEA 2HHVA 2A6TA 1NTCA 1FKOA 4DF4A 4BXXJ 2WB1A 3FHNA 1EETA 1NGFA 2IRFG 1JT6A 3PQJA 4XICA 2P9UB 4FW1A 4NCGA 3ZSRA 3PFIA 2XAJA 4CK2A 3S15J 4CFBA 4XL9A 3QETA 2DFEA 2L7FP 4FSVA 3V9UA 3AG3H 4U88A 1JUPA 2VCPA 5AQWA 1P2FA 1G59A 3QWLA 3WTTC 1R22A 3F8CA 3I58A 3W2VA 5EGOB 2R5ZB 2QSHX 1FSHA 1BA0A 3C7NA 3WXJA 2VLAA 3PUFA 3HJEA 4KHSA 4DKWA 2A6HF 4XLHA 1UCRA 5AQFA 2K86A 1DTQA 1S9GA 4LJZF 3VPZA 2CV2A 3MN6A 3DJCA 3TR8A 3AVIA 3ZT4A 1KQ9A 3CJCA 1QZ6A 3MXIA 4X1EA 4IFVA 3VQPA 2IS2A 4CHOA 3CF5L 2XKOA 4GO1A 2K3PA 1FT9A 3KLIA 3NVKA 2H1LA 1TNSA 3T0YA 2JA5J 3CJ9A 4BHBA 4CK3A 2QTDA 1S5LC 2GIZA 4XLCA 5HROA 3ZGKA 5CVVA 3CC2N 1ETQA 1NJWA 4N9IA 1DGRM 4LMYA 2ME6A 4J19A 4V19S 1GXPA 3SLCA 2Z1DA 1ZK8A 2LTPA 1XGNA 3K9KA 3TTCA 3RQIA 3UKRA 2OPQA 2P9KA 3ZSWA 4E1MA 2A3SA 4DQPA 3SZGA 5LD2C 1HA8A 1PP8F 2BUPA 1UHMA 2EFNA 2G9WA 2VQCA 1XSVA 1ZLJA 3VB2A 1QGPA 2HEOA 3PO3J 1MMSA 1MBFA 1OVQA 3AVJA 4LB6B 5JR3A 3REOA 1IUYA 1U2VA 3B6PA 1MKMA 5AQLA 3HZ6A 3EO3A 5MLCQ 4E7LA 1RBRA 4FWPA 4HUGA 2PEXA 4KMUX 2LYCA 3HP9A 3BR1A 1DP3A 1XC3A 3RPQA 5AQVA 1ATRA 4OX9K 1USSA 5DD8A 4M6YA 1SZ2A 1V3FA 4FLTA 4R5PA 4A0YA 1JUSA 1X3NA 1GT0C 2H09A 3WGIA 3ITHA 3O4QA 2XRLA 3AVKA 4FZYA 3AAPA 3MKZA 4XIDA 2Y69H 1Y6IA 5EG0B 3THWB 1NOYA 1VSHA 1GLJO 1SAZA 3R3LA 3WTUC 5E41A 2XY6A 2XHKA 2HKXA 5D8KB 2Q31A 4BAYA 2DI3A 1IRXA 3ISPA 4LG0A 1N25A 2KLOA 1KA8A 4ZZDA 4EGZA 1TGOA 2FA5A 3KLOA 2BXZA 3NF9A 3N97A 3MCPA 3F8MA 1VQLN 3LSHA 1FY7A 1IN6A 1RRJA 3SUPA 1K4SA 3ZN1A 2V9KA 2YJFA 4O5VA 1OR7A 2MC4A 2RVCA 1LVKA 3GVAA 2ZO4A 4FWRA 1KU9A 2MA3A 5HDKA 3V42A 2W41A 5ICGA 4OPHA 4KO0A 4DR6K 2FOKA 1U0JA 2ZC2A 3T5XA 5M5XJ 4A3IJ 1YRNA 3T19A 1DPUA 3K0SA 1U5TC 3SJJA 3TKYA 3IWFA 1YIJI 1FEXA 1KAYA 1LW2A 3IV5A 3CDIA 2P6TA 2FE3A 5F64A 3Q0VA 1LPQA 3H0GJ 3M6GA 2V51B 4XKWA 4W5OA 5LBQA 1KCFA 4BY7J 2Z3YA 1YAGA 4DTOA 1UA1A 2HPIA 1QPMA 4ID5A 3ISNC 1RFQA 3A5OC 2M7AA 4L9VA 4XKVA 4MHGA 1SQKA 4H0YB 2E19A 3FMSA 1TV6A 5AQZA 3VQCA 3M8SA 3H5RA 3RTRA 3MN5A 5FGMA 2EFQA 4EM1A 4DR3K 3HBTA 5HDNA 3BT9A 2HQNA 1C0TA 3AG4H 3D2FA 1QRYA 3WTYC 3SAFA 3FFIA 3THVA 1WAFA 3J81O 3Q5FA 3CESA 4Y0WA 3S32A 4HSTA 4AVPA 1Y0UA 1GVJA 4F52A 1R4MB 4LLLA 1J53A 1TKDA 2GV9A 4CBUA 4CZIA 5DM7L 4IDKA 4UUTA 3PY8A 3BJ6A 1RI7A 4JNEA 1FTZA 3TARA 5AZIB 2IXSA 4C3HJ 4UHTA 1XDSA 1NKEA 1HOMA 3IKMA 1YO5C 3AO5A 2L4AA 4KKOA 1TAUA 1I3AA 1XMKA 4O44A 2OTJI 5IT9O 5E8IA 1ESVA 3LANA 2X6SA 2CGPA 4DQQA 4X65K 4H03B 2PBIA 4I02A 3IKTA 1U2WA 1IXCA 3T8RA 3G1OA 5E3MA 1BISA 4KAZA 1S6QA 3LAJA 4MTDA 5GPCA 2RKIA 4KH6A 4KB1A 2Z99A 2DMQA 4E70A 2CMPA 1PYVA 2CGJA 3MMVA 3P1GA 3HHHA 2LNBA 2PJRB 3H92A 1KD1O 2FBIA 3K4JA 5AIQA 1ZGWA 3DRSA 5LY3A 4CCHA 4Y1DA 4A3GJ 2NRRA 1MBKA 3FXOA 2OF7A 3ZEUB 3CUQC 2XY7A 1VZ0A 1T8EA 2ZXWH 3LA2A 1SFOJ 1L3LA 2F5CA 4M74A 2BY3A 1U6ZA 3BR2A 4JAXA 3RPUA 3SJHA 1WGXA 4CEBA 2O8EB 3GBGA 3RKQA 1FK9A 2LKXA 2JA2A 3CJBA 1X1CA 4WWCA 4B8AB 3GTMJ 3CJQB 2KL4A 3B6CA 1PVEA 3HRSA 3I4PA 2JRTA 3RR8A 4IWVA 2OANA 3NDKA 4XMYA 3O08A 3ZX2A 2K4JA 1WCMJ 2EH3A 3T1BA 4K42A 4FHTA 1W0TA 2W42A 2Q2RA 2EFOA 1Q86O 2BANA 2VQFK 1HSTA 1R5GA 2DLLA 2QF7A 2HYFA 2Q0OA 1D4XA 3BG6A 3CCYA 4EM2A 1GLLO 4ICLA 1TWFJ 1YYVA 1SFKA 2FSJA 4BRDA 2V6EA 4DG1A 3PV8A 5AR0A 3M4OJ 1LKXA 1KAXA 4EJWA 2UXNA 4E4HA 1Z25A 3A2FA 4LF6K 3DTEA 3HI0A 1S1XA 3CQYA 2UUBK 3VYUB 4AC0A 2F9TA 3UKGA 2DMTA 2RAEA 2V79A 1XX5A 5FD5A 3ATVA 1B59A 4FPBA 3LOCA 3ASMA 1V5FA 3DWLA 2X6YA 2GQQA 3E1YA 1KU2A 1RT3A 5TGTA 3WU0A 4CYCB 3K6GA 4Y17A 4CZCA 3ZSQA 1N77A 3O3GA 3C1DA 4G6TB 4J8FA 2ZXIA 2XAGA 3EN9A 1WPKA 3LZJA 4LIVA 1I39A 1IC8A 4FWQA 4ELTA 4EJOA 4CVNE 4O0IA 2AQEA 2DMUA 2XDVA 3VQAA 1POGA 2PLYA 1QQMA 3QNNA 2UYTA 3A5LC 3MXJA 1A5JA 2XGCA 3V8JA 1A31A 1Y64A 5F1JA 4IOXA 4WXDA 4KB0A 4Z4IA 1O3QA 3PNVA 4C9YA 2E2IJ 5FPMA 2WA0A 2KFZA 3LPTA 2JT1A 5LGTA 3WG7H 3AA4A 1J75A 3VESA 3D0PA 3IH3A 2O8EA 2L9NA 4KITB 2HOSA 1Q1HA 4AHRA 1NBWA 4CXFA 1FIAA 5BN8A 2K02A 3W6KB 3DXMB 3QLHA 4ZHRA 4CJEA 1HNXK 3OYNA 4YG2F 4W5QA 4UQGA 4DFKA 2XAFA 5L3FA 4A3EJ 2KKZA 5BPLA 4GYIA 1QSYA 3CXCM 2UXXA 2CQNA 1WFXA 4M3DA 1B1BA 3OYHA 3MKYB 1GLCG 2QEXN 1YT3A 2DBBA 3PNYA 4KIFA 1XD7A 2VBXA 4HWIA 3ESWB 1V54H 1GLBG 3CLOA 5CQGA 4XLPF 3NE6A 3D2EA 5AQMA 4HSRA 2Q36A 2R7FA 1SC7A 1WJFA 3WUHA 2DDBA 4IOCL 4EJVA 3IMXA 3PL8A 1WJCA 3KZYA 4FM2A 4JI7K 2O8DA 1APLC 1B9NA 5AZJB 3AO2A 4BHCA 4ZDPA 1A5VA 4YOYA 1I6XA 5LJVA 4LOCA 1ZXOA 1HKQA 2BW3B 2V26A 2X4HA 4XM3A 2QSGX 3V81A 3S2HJ 5KI6A 2XAUA 4A3BJ 4HNTA 4IEIA 4I2PA 1U78A 2VGNA 2OQRA 4BRCA 3QEWA 4IHVA 2IGNA 3SDBA 4Y13A 1ULYA 3BOQA 1J7KA 3FKIJ 2ZCWA 3S17J 1NGGA 3V9SA 3SYTA 1L3SA 4UVBA 2VJ5A 2FNPA 1G3YA 4XRSA 2W6KA 3JRFA 2WV1A 3SV4A 1W2BM 2CGLA 3KPHA 3LSKA 4NNJA 5AQIA 1WLJA 3K5LA 5M5YJ 2K27A 1XGOA 2EV5A 4GXOA 2NVYJ 1UB9A 5L3CA 3AARA 4JP0A 4B3TK 4KMFA 4FX0A 5F08A 1EH7A 1X1AA 4HQEA 4DV2K 4B3XA 4I2OA 3MQ0A 2X6NA 5A2QO 4WE1A 2ESHA 4BRMA 1STZA 2DOFA 1WB9A 3RRGA 4F3TA 3MMYB 3ERMA 2JA7J 4RAYA 3IH4A 1TQMA 2DQLA 3Q0WA 2Y0SA 5JLXA 2WAFA 3S93A 3BJAA 1HPMA 3RMCA 3VEOA 4M42A 5B66C 4NXMK 3RMBA 1R9TJ 1Z6TA 2MLGA 2W7NA 4JX4A 5EEGA 1HYSA 2ZJ2A 4NQWA 1O4XA 1CF7A 2AS5F 3A03A 1FBUA 1I1SA 3VEYA 4E3SA 4DTUA 3JREA 4JD2B 2FC0A 1J54A 3OMYA 1U48A 3G4SN 2DPDA 3BY5A 4Q4ZF 2RF2A 3Q0UA 1QZEA 3SEQA 3U21A 1CZ9A 5IPAA 1WNSA 1VQ5N 2P81A 1TK0A 5M1OA 3CFOA 1IO2A 1R58A 3L00A 3A2KA 4KICA 4ESBA 3KLGA 1HNIA 4LY7A 4DSKA 3ABMH 4JKAA 2HHQA 5C0YA 4B3SK 1A6QA 1T95A 5E20A 1J2XA 2LP0A 1YTUA 1WJAA 3K4NA 1MBJA 4FXDA 4KHYA 1X2MA 4K25A 2QBYA 1E4FT 3GCMA 4LK0F 2HBMA 1USTA 3RCOA 3CM5A 4BQZA 1JE8A 3I59A 4PJNA 3OS1A 3H36A 4AHUA 3FZFA 5HRPA 3H3UA 1QVGM 3HBLA 4AHTA 4FJMA 3RKYA 2UXBK 4LF5K 4Z4HA 3KZZA 2GEMA 2A05A 4MO7A 1C6VA 1TL3A 3DTIA 3ZMTA 3M8RA 1YFHA 1IKYA 2QCOA 3H3NO 1IDYA 2MSYA 4BC5A 3NH2A 1IG8A 3JSMA 3VQBA 2LMDA 4FLYA 2ESNA 1DP7P 1MW7A 2KT0A 2DTRA 4ANJA 1MBHA 5IYBJ 2HVSA 3C6AA 4FZZA 1OLTA 4FVMA 3F6VA 1MA9B 1U5TB 3L1PA 4IEJA 4XK4A 2M5WA 2B63J 3CG7A 4AWXB 1AOYA 5M1NA 5IP6A 1YI2N 3TDUC 3OIPA 3CCMI 4V19K 1T0FA 4FL9A 2L2OA 3L3VA 3NVMA 3F23A 1XPXA 2LFBA 1HJOA 4M7XA 3W3CA 1Z91A 3SFIA 2E1YA 2L7MP 5JMVA 3CC7I 1HW5A 2DAOA 4HTUA 2O8BB 3BQYA 3O6WA 1WH7A 1W5SA 2IC3A 1NLVA 3BG9A 3P83D 3LDSA 1FW6A 2VJJA 4S05A 2YJEA 4JI8K 4BR0A 4CYCA 2KQRA 2DOEA 2DMNA 1ZGJA 1NK3P 2R7QA 1KQ8A 3ASOH 1C0UA 3H1QA 4KT5C 3VTIA 2NVQJ 4CJ5A 1A35A 2Z1JA 2VXZA 3R8EA 4JYKA 4D5CA 2A69F 5DM6F 3O3HA 1GV5A 1K6YA 2V1DA 1NGEA 3CQ8A 3THXA 3HK2A 2NRTA 3OL3A 3ZMSA 3ASNH 2RPIA 3KWIA 4CZKA 3KEYA 4YIRX 5F1XA 4J00A 3V8LA 1SMTA 3TMOA 3TGNA 2HU9A 2VE8A 2WY7Q 5B5EC 3VSLA 4B08A 5AZJA 1L3VA 4FISA 2LY9A 1OCOH 2HKOA 2DA5A 3TP0A 4IKFA 2IAIA 2FQ3A 2XVCA 4OIRF 4B09A 3CMEI 4IHYA 1IRZA 5AFUA 1E4GT 4RWTA 2RQPA 2F5FA 4BRGA 4I0BA 5B3SH 5AQYA 1JL2A 3E6MA 2D0AA 2YNGA 3PIPL 1JKOC 3DWLE 2Q0UA 1T6SA 1C1AA 4UV9A 4GCVA 5BREA 4M9SA 1O13A 4FWKA 4Q47A 4J2BA 4FJ9A 1YIOA 3BG3A 3HSEA 2Z9OA 4BREA 4EAHD 2W6LA 5L3GA 1IBKK 2F5EA 5SWMA 5M3MJ 2ZKZA 3OYGA 2DA2A 4RW8A 2D0OA 2HGCA 3U4LA 1VQ4N 3FXLA 4M71A 1WBDA 1ZBIA 4L0YB 3WEEB 5GP9A 1HRHA 4HUEA 3TP3A 3L2RA 1Z21A 2QQ8A 4QLCU 3IH2A 1BDGA 4DV1K 2PZSA 4EM0B 5TKWA 3HOYJ 2R3SA 4CJWA 2JVGA 3DM2A 2P0WA 1D1CA 1Y8QB 1Z05A 2HTJA 3N4MA 2M30A 1C0GA 2R7UA 4BC4A 2CUZA 1ZRDA 4ZZLA 4CIEA 3I55I 3KP4A 2KRCA 3G71I 4H5VA 4M45A 4B1ZA 3HOSA 3ZQCA 2Y75A 5BPDA 3HOZJ 2V7YA 3M1FA 3B6AA 1KFSA 1WI9A 2QQAA 3KFWX 3QOEA 1OVYA 3F3XA 1WAJA 4OKJA 2VKDA 2DYRH 2HNHA 1K61A 2KZGA 2E7WA 2VIXA 1JCFA 3TU5A 4BRAA 3KLHA 1VQKN 3RJPA 4CH7A 3BTJA 1B72A 4B48A 3ZSOA 2COBA 2OAZA 5I3UA 1D1BA 3HEFA 3G10A 1VQNN 3FF5A 3L2WA 3OYLA 2HPMA 3KEOA 2WFBA 2VPLA 3BR0A 2DO7A 4DZJA 1BN5A 4YELA 1MJAA 1QVTA 1JLBA 1OYIA 3AVMA 1MMDA 4CICA 1XI1A 1W4MA 1WSFA 3LAPA 3IFRA 5KAIC 5FRNA 3HRUA 1XHZA 1ATSA 2L0KA 3ABUA 3HL2A 2DT6A 3CCUN 2I5JA 4JHDB 3CO6C 1ASWA 2VBWA 3J7AO 1Q8IA 1VSJA 2FF6A 5FLVA 3IC7A 3TTDA 2YX7A 4DJAA 1JLAA 5ILVA 1LFPA 3J81Z 5J8CA 4HZFA 3KP2A 4I6MB 1OH7A 4W5NA 1X3MA 2W00A 3M3YJ 2GXAA 1CZBA 4BDYA 2NAZA 4RG8A 1NJZA 2XGDA 1I94K 1VQ8N 3WNEA 4DSEA 3WNGA 2NZTA 3EZWA 2JPBA 3CCJI 1DGWY 4M3UA 5HLIA 4DNCA 1EX4A 3ULEA 2DA6A 2NRHA 4Z4CA 1FP2A 2W57A 2WAQN 5F6FA 1K78B 1OKJA 1YXQA 2YNIA 3ALYA 1YX3A 2OD5A 2YX4A 5GAHJ 1HXDA 3A01A 4CJ3A 4CIFA 1HR0K 1RBUA 5DV5A 2L01A 4RLQA 3HYFA 2JPCA 4NDLA 1RBVA 4CZGA 3DLLL 3QPLA 5J1UA 1EJ9A 3E3VA 2V1NA 3CQZJ 3EUKL 1DTTA 2O6GE 1S72N 1HW1A 3AFHA 4NXNK 4XKCA 3CCQN 4DV3K 3BDPA 4L5IA 1FBSA 3JSPA 1I6HJ 3OHRA 2M2EA 1CF7B 3ZQGA 4GV9A 3K1MA 4RGSA 1P7IA 3JRGA 1R5ID 1Y56A 3RPUD 4P1WA 4YFNF 4RCHA 3O3KA 5LRRA 4DR7K 2NNNA 4EATA 2KIMA 4I99C 4FE7A 3K9TA 2E8AA 4N41A 1RDDA 2CUFA 3L9FA 5EVZA 1G3TA 4Y3OA 1XG1A 1TUUA 4QSHA 2K9LA 3ZMDA 2JVHA 1UJ8A 1E3MA 4GVMA 3BCAA 1X3ZB 2K5CA 3S2DJ 4GRIA 3Q9SA 1VSMA 4DFMA 3SUQA 2FF3B 2IOCA 4MO4A 3GFLA 2BHYA 4FQGA 1MDMB 3F73A 2E60A 2F4OB 3R60A 5BRFA 3LAMA 4I2QA 2K9QA 4HRIA 1D5AA 4JS4A 1HQCA 4RLFA 4E7ZA 2LY1A 3JRIA 2PMZN 4CZLA 2YHBA 4DCHA 2WC2A 1LDKB 3MECA 3U6FA 1IG9A 3V1QA 1D3YA 4PJLA 5E3LA 1VNDA 2GLOA 4LSLA 1R5HA 5BPNA 2E5LK 1VQ9I 3FXRA 1TYQA 1V4TA 3LP2A 1UMQA 2ISYA 2UU9K 2O9LA 2ZJQF 4JK7A 1T03A 2RGVA 4KTZA 3I56I 4OGCA 1NK9A 3P9KA 3HGYA 3V7RA 3PO2J 4CEOA 5FDLA 2B0LA 2IAJA 5M5WJ 4CGJA 3LP3A 3L2QA 1E2XA 3OR2C 4CHZA 2KISA 4MQVA 4CJFA 5JI6A 2LKPA 1NK8A 2LF7A 2NVTJ 5L3EA 3J81K 1MWMA 3R4KA 2O3FA 2TDXA 1OCZH 1YW7A 4CBWA 3F8NA 2OTJN 2IT0A 3C7NB 1BIAA 2NUBA 2LRDA 4N4NB 4DZPA 2FBKA 4D7MA 3CMAI 3QPTA 3COAC 4AYBN 4CCMA 5JVGF 3BPVA 3G0ZA 1JGGA 2HMIA 1G2HA 1IH7A 2YNFA 3CCUI 1S7OA 2FBHA 5DYMA 1LFUP 3PJRA 3PQKA 1TL1A 3OOUA 4A0XA 1TC3C 2O5RA 1YTYA 2H1KA 2IJLA 1BUPA 1SEUA 1TW2A 3CCVI 3CYMA 1Z3YA 1D9DA 2K3FA 2VWJA 5AQXA 2M0MA 3SHFA 3TPQA 3QP6A 1VSEA 2JTVA 1R49A 3A8YA 1FMVA 1RUOA 1LOTB 2E6MA 4MO5A 3LFUA 1VSLA 1TWCJ 3JRDA 3ULQB 5BNGA 5FB2A 4UUVA 3CERA 2CUJA 1EWQA 3SZPA 2M87A 4RW6A 3W6JB 3P9IA 4E89A 4K8XA 1S9HA 2ATQA 4DV7K 3I0TA 1PDNC 3OL4A 5JFRA 2Z1IA 3T1YK 3TAQA 2D1HA 3CJ1A 1ODDA 2FBXA 3O9RA 3A01B 3VGMA 2Y1JA 4OLAA 3QO9A 3ZQ7A 5ERIA 5HNHA 4CCOA 1BO5O 3DPLC 3NEUA 2A41A 4Z6YA 2GXBA 4FK4A 4LG0B 2ZBKA 2B9SA 2OYQA 4WYBA 1IGNA 2IP2A 2NRWA 2VQGA 4U7DA 1Y1VJ 2KKOA 1RDUA 4HA8A 2HDWA 2COMA 1BI4A 3SBGA 5GTIC 1ZRFA 2YKMA 1VSFA 2P9PB 3LP1A 4B3RK 1LE8A 1TKZA 4GYGA 4ENJA 4JI4K 1OYYA 2E1NA 4CF2A 3SAHA 3TTFA 1J5OA 2VG5A 5J1EA 3RI4A 1RT6A 4BE1A 2X6XA 2M7BA 5SZTA 2G8FA 3I53A 4AU7A 3F72A 5LJWA 2Y0SN 3B6OA 4IG0A 4A93J 2DT7B 3VQ5A 3NAEA 4U67L 3MAJA 3ZPLA 2R7RA 1OQYA 2I7PA 3DU6A 4MDBA 2BY2A 2OPSA 2G8IA 4ZYHA 5J4VA 1BI4B 1W9HA 2ASMA 4X66K 1HCRA 1SVOA 4N47A 4X62K 1KRPA 1NHAA 4CJLA 5HLFA 4B9QA 5LGUA 5E79C 4H0OA 1G3WA 4AM3A 3LM9A 1Z7UA 2STTA 1ACIA 1S6LA 2V4JC 4AIKA 3BGRA 3S41A 3O5BA 2UUAK 3LA3A 1JTXA 2KFNA 2GAUA 1VHXA 3I33A 3OYJA 1W97L 4MDAA 5B1AH 1K8AO 3WXMB 1AHDP 3GF2A 1EXQA 3BUZB 4Y52J 1DKGD 3C65A 2P4WA 2P1JA 1JCGA 2QEXI 2H6CA 4BKXA 4WFBL 2ZWHA 1NH3A 2M34A 5KHDA 1X9MA 5CQEA 1H1VA 3K70D 4L18B 4LFUA 5E26A 3D5LA 2BZTA 2KIUA 1FNNA 3MCZA 1BOBA 1TBXA 4EV0A 2HXOA 3K9JA 4XIUA 1VQON 5JLFA 3FR0A 1UA0A 3AL0B 3CP8A 2HQRA 2OPTA 5IWAK 2LOOA 3J80O 2QENA 5LHIA 2X9DA 2VG6A 2CU7A 2QWRA 4K43A 1FOKA 4RM2A 4WX9A 4DLEA 4BY9C 4U7BA 1LW0A 3VQQA 5GADP 4OWRB 2P9UA 2WONA 3QEXA 2UV1A 2QKLB 3CJNA 2ETHA 2K7LA 2MFZA 4P55A 1VQ5I 1EQYA 3ENBA 2EZKA 3AO4A 3KWGA 2ZNZA 4OOIA 2WWYA 1M1EB 4CE9A 4F93B 1R00A 5FKOA 1W7PB 3RYPA 2WAQA 1BI3A 1CZAN 2OZMA 1QHGA 4DWIA 1GOCA 4HCCA 4CJ4A 4QTRA 4RW7A 3WXKA 3CCEI 2Y0MA 3AVHA 2J5OA 1BQMA 1MNDA 2H8WA 3CCLI 4OU0A 6PAXA 4CBXA 3R0AA 2VWKA 3UB5A 2RV8A 3S3OA 2VOPA 1V4SA 3WE2A 2O4GA 1KFDA 4G12A 2I10A 3VQEA 5LMNK 4KIBA 5KK1A 3SAGA 3HC7A 1BBYA 2M3AA 4W1UA 1QQIA 4C30A 2JA6J 1PP7U 3BTIA 2FSNA 2FRHA 4DFJA 1K9MO 5DUIA 3P39A 4CGFA 2RQQA 1AKHB 4BVOA 1RZ4A 4IOAF 2D2WA 2ZSHB 4G9YA 4BHPA 4H4MA 1EF4A 4BRPA 4F91B 4K0KK 4BGDA 4E1JA 4LF8K 2VKEA 4BUPA 4MFEA 2RN7A 2Z2SB 3J7YP 3SCXA 4FJLA 3BG7A 1FIPA 4PQUA 1VQOI 2OCEA 3U1DA 3ZOBA 1IXRC 3I71A 4O8UA 2CQ7A 1NK2P 1U45A 3CCMN 4B9SA 2E7XA 3L09A 1RNHA 3L4QA 2PMHA 1ONVA 3LFKA 5HS7A 2I5UA 3OYKA 1OH8A 1D1AA 2BHZA 4V2FA 2PFUA 4JKDA 3KK2A 2QLZA 2ZFWA 2IVPA 3C6UA 5L3DA 5D8LB 4RDUA 3H3OB 3W0LA 3BR3A 4O5FA 2IS1A 3K10A 3K5MA 4M3EA 4UB8C 1K83J 3WT0A 2V9VA 4P96A 3CC4N 4IO9L 1X9WA 3QRFF 1BI2A 2CG4A 4B1VA 3GTKJ 1B8IB 3EZ5A 3AVFA 2F8SA 2E6LA 2IS3A 1XC9A 4ISFA 1LUJB 3L2VA 2O03A 3MN7A 4FJKA 4Q5VA 3MD2A 1X3UA 1J9AA 2QKMB 4IRGA 3CCLN 3MKLA 2QQ9A 4CHQA 3NGYA 1LFBA 2HHXA 5KQDA 1WH5A 2HYJA 4BJTA 3SFZA 4DFPA 3BDDA 3EYZA 1FOYA 3NQOA 1MU2A 2FMLA 3KK3A 1XSXA 4M41A 4A3CJ 1BA1A 4IQ4A 3SYZA 1MH4A 4F92B 2YI1A 3H45C 1FLIA 5BN9A 1DLOA 3QMLA 1QA6A 3H1VX 3ZQLA 2X85A 4UV8A 3FDYA 4A62A 3CJ7A 1LVAA 2DOAA 3BZ6A 5AONA 2IA1A 3B02A 2QWMA 1VQ9N 4IOAL 1IV8A 2TCTA 1W5TA 4AD9A 3CQXA 2H6BA 4CCLA 4DTSA 3NF7A 2Y1IA 2QQBA 1NKBA 4FJJA 4KHNA 1OCPA 5C24A 4P9UA 4FX4A 4KI4A 4ZC3A 4ELVA 3J7AP 3GZNB 1LV5A 2D45A 2FLOA 3ZQHA 4LF4K 3QU3A 2M8GX 4KISA 4MLOA 4R1HA 1Z9CA 5KPZA 2X1EA 3SNNA 2BGGA 3S3NA 2JZYA 3F2KA 3IDHA 1ON1A 3BQZA 4G8XA 2FD5A 1NJXA 3DLAA 2EWNA 4PCQA 4H0XB 2LY2A 5BQTA 2OPPA 4M3XA 4CERA 3O8MA 1K8KA 4C8MA 1C0MA 4BQQA 4KNYA 4D9JA 2HHTA 2R5ZA 4V2GA 3ERED 4NB4A 1BG3A 4RTFD 1ETVA 2IBDA 1WQ2A 2VB6A 3F8BA 4CHUA 4CHNA 1RR7A 4A69C 4NC8A 4A2UA 1IF1A 3GZ6A 1HJRA 5CR4A 2ZXHA 1T33A 4FTHA 4L0ZB 3PO4A 3VPRA 3U9GA 2F9WA 2RREA 1BIZA 3VQ9A 4U0WA
chains in the Genus database with same CATH topology
1YTAA 3K57A 1B9FA 4CEEA 4BACA 1B92A 3MEDA 4DTJA 3AVNA 3JYTA 3RMCA 4BE0A 4M42A 3QEVA 3RMBA 4QCLA 4CJKA 2RN2A 3RMAA 1S1TA 1BQNA 1U4BA 1HYSA 4CF9A 3KKSA 4E3SA 3AA5X 4JRPA 1LWCA 2IGIA 2VG7A 4DTUA 4OKEA 3KTQA 2FC0A 1J54A 4CK1A 1U48A 1SL0A 2RF2A 4J2EA 4H8KA 1CZ9A 3NHGA 1WNSA 4LD0A 1TKXA 1FKPA 1HYZA 1TK0A 3CFOA 1IO2A 3LWLA 1U47A 4Z4GA 3RWUA 4DSKA 3KLGA