2DFFA

Crystal structure of tk-rnase hii(1-204)-c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
b'MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKITQDMIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 59
structure length 210
sequence length 210
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dffA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dffA01
1BI4A 5J2NA 3TAFA 2X6NA 3RMDA 1LW0A 3DLEA 5KGXA 4XIUA 3K58A 4JLHA 3AVBA 5SZTA 3OYHA 1LAVA 1S1WA 1C0TA 1QE1A 2BANA 1QSSA 4KI4A 4CGJA 3JYTA 3P83D 1VRTA 3ISNC 1TKDA 1KSPA 3OYAA 3DOKA 1A5XA 3AO4A 3HJFA 3T19A 4QAGA 2BDPA 3DI6A 4DF4A 1SUQA 1S6QA 2I5JA 4KB0A 4CJUA 3HPHA 3TI0A 3NCIA 3F9KA 4Q0BA 1C1AA 3DLGA 1NJZA 2VG5A 3OYIA 1J5OA 3NH0A 4CIFA 3WNEA 4N41A 5JS1A 1TAQA 3SQ1A 4CJPA 3PUFA 2KZMA 4CIGA 1CXQA 4Z4GA 4CJFA 3DLBA 4CESA 1J9AA 4KKOA 4M3WA 3HPOA 4M41A 1GOAA 3QESA 3SCXA 5HLFA 3QEXA 4H4OA 4DMNA 4KTZA 2KTQA 3ZSVA 3RRHA 4KO0A 1TL1A 3D0PA 4BACA 1KFSA 2PZSA 4M42A 4FK0A 1NJYA 3KTQA 3AVKA 4KB1A 3LAMA 1C6VA 2D5RA 4B8CA 4R5PA 2OPQA 2Z1JA 4OLAA 2YHBA 1NKEA 2RPIA 1VSEA 3MEDA 4FLWA 4CJ4A 4HTUA 2XRIA 3BGRA 4IFVA 1LWFA 3EYZA 2D0AA 3NF9A 1DTQA 3L2VA 3T3FA 3MXJA 4BDPA 3OYMA 4LD0A 4Z4CA 1CXUA 2XHBA 1T03A 1I39A 1TKZA 3DRRA 1WSHA 3NF7A 1YT3A 3SQ4A 1U45A 3MXIA 4FK4A 3A2FA 4OKEA 3OYKA 1ZBUA 3LP1A 4LY7A 4RW8A 3EY1A 3DRSA 3QINA 4ZHRA 1ZBIA 3QEWA 3B6PA 4QOZB 1QS4A 5DMRA 1D5AA 3ULDA 3DLHA 3L2RA 1SL0A 4FJMA 1RDBA 1VSLA 2IDOA 5FROA 3ZT0A 1C1CA 3EZ5A 1JLEA 1HPZA 3C6TA 3OYDA 1YTUA 1ZBHA 2HB5A 4CCHA 4PQUA 1NOZA 4FLYA 1BCOA 2Q3SA 1EKEA 4I2PA 1XWLA 3CM6A 1QHTA 5EU7A 3AV9A 3VQDA 1QTMA 4AHCA 1RTIA 4KTQA 3HP9A 4IG3A 1HYSA 4DQIA 3LP0A 4FK2A 2B4JA 4I7FA 3KLGA 4DSLA 3TANA 1TGOA 4KHUA 4FZXC 1S6PA 1IKXA 3L2UA 4CHYA 3PV8A 1RT4A 2ETJA 4IG0A 4DQQA 2Z1GA 2OA8A 4CF8A 4BE1A 1JL1A 5KGWA 3VA0A 3PX6A 3VQCA 3SUPA 3SQ0A 2O4IA 1ASUA 1TK0A 1RBSA 3AO3A 1WNSA 4AHSA 3CM5A 3U3YA 4AHTA 2XY5A 4OKKA 1JL2A 5CYQA 3TWHA 4L8RB 2Y1IA 4YNQA 4ID1A 4CEOA 4HVJA 4CEZA 3O4NA 3OJUA 1U04A 3SPZA 4B9UA 1JLAA 4GMJB 3ZSYA 4CGDA 4CJQA 3SI6A 1KRPA 4B9TA 3KK1A 1BISA 5J2PA 2G8UA 5SWMA 3DYAA 1Z26A 3HYFA 1XC9A 4FJ9A 1KFDA 4CK3A 3IG1A 2KQ2A 4OLBA 4CHPA 3DOLA 4CK1A 2F8TA 3M8QA 4PWDA 3I0SA 4DG1A 2D0CA 3AO2A 3S3OA 3VQ6A 2X74A 4DTPA 2FBTA 2O4GA 4FJKA 3AA2A 4CECA 3K59A 5FRNA 1LWEA 2HHSA 2BE2A 1C0UA 1R0AA 1HNIA 3SNNA 4EZ9A 2HHXA 3FFIA 1L3SA 5E41A 1KCFA 4Y1DA 4DS5A 3HK2A 2HHTA 5HP1A 4DSKA 4E7LA 1DLOA 1WSGA 2RF2A 3QIPA 1U49A 3DLKA 2A1SA 1NKBA 1NOYA 2FBVA 3KJVA 4HUEA 1K6YA 4JS5A 1HYZA 1VSFA 3KLFA 1S5JA 4NCGA 3ZSXA 1T8EA 3PO4A 3RTVA 1NK0A 4KPYA 1TKXA 1Q9YA 4ELUA 2KZZA 1FKPA 4K8ZA 1WSJA 1UAXA 3V9UA 2HMIA 3OYLA 1D9FA 3LP2A 4KAZA 2G8WA 3OYCA 4DTXA 4RW4A 3O3FA 2ZD1A 4JRQA 1RT5A 3OYBA 1L3VA 1UOCA 3AVFA 4CJLA 2VWJA 3QEIA 4Z4EA 1UWBA 3MAQA 2YNHA 4DSJA 3BDPA 4NCBA 4F2RA 1TK5A 1JLCA 3L8BA 2XY7A 1Q9XA 4E7IA 1SKSA 1YVUA 1GOBA 4CGFA 3TAMA 1WAFA 1GOCA 4O55A 4FZYA 2G8KA 1DTTA 1VSKA 4KTWA 1RT6A 4GVMA 3NFAA 4F3TA 4CJ3A 3VQ9A 4HUFA 4DQRA 1X1PA 1TAUA 4DWIA 1S9EA 4O5BA 4WE1A 1L3TA 3RMBA 3L3VA 1BQNA 1VSMA 4J2BA 3HO1A 4KHWA 1VSIA 3DLRA 3ZSZA 4O44A 1BIZA 1S1VA 3ZT1A 2G8HA 5KTQA 4CF1A 4DLGA 5C25A 2KW4A 4FW2A 3LALA 3HP6A 1NK9A 3QO9A 3OYJA 3VQ8A 1FK9A 1S9GA 3NBPA 1KVCA 1ZYQA 3SV3A 3HL8A 4FCYA 3G10A 3VA3A 1HYVA 4ID5A 5HRNA 3ZT3A 4DSFA 1X9SA 4DTMA 3CYMA 4RW7A 4CF9A 3V1QA 3NAEA 2OZMA 4ELTA 5D3GA 4RW9A 1ZBLA 4DSEA 4B8AB 1U4BA 3CFOA 3AO1A 2FBXA 2YV0X 3V1RA 1BI4B 3VQ7A 4O0IA 2B6AA 2QK9A 2G8IA 1RCHA 4E19A 3H08A 3OY9A 3LWLA 3LZJA 1BCMA 4MQ3A 4DQPA 4M3YA 3U6FA 3IAYA 5C42A 3THVA 3TABA 1RILA 1BL3A 2E4LA 2HNYA 3ZT2A 3NHGA 3VQPA 1S1TA 1QSYA 2GV9A 2VG7A 4C8NA 4FJNA 4B3OA 1TK8A 4CJSA 1O1WA 1N5YA 4ICLA 2PYLA 1JLFA 1IH7A 1RDCA 4E1NA 4C8OA 5KRTA 4JS4A 3K5OA 2IOCA 3NH1A 4F2SA 5I42A 1L5UA 1D8YA 2YNGA 3SUNA 1G15A 1C0MA 2YNFA 3T1AA 3F73A 3QEVA 2ITGA 5T7BA 4Y1CA 3AVMA 4HCBA 1KLNA 3SPYA 3ZT4A 1I3AA 2YHAA 1KVBA 4HUGA 1IG9A 3SZ2A 4DTRA 1S1XA 3LZIA 4GW6A 3VQBA 1N6QA 1UA0A 4ZTFA 4FJ5A 3QETA 2F8SA 1IKYA 1VK0A 3WNHA 1X9WA 5FDLA 3MEGA 3KLHA 4DU3A 3V9WA 1J54A 2DY4A 1RT3A 3ZSOA 3ALYA 1RDDA 3S9HA 4M3UA 3LPUA 4Z4IA 1VSJA 2YKNA 3VQ4A 4I2QA 4E1MA 3K57A 4J2DA 4DTUA 1Y97A 1TVRA 2EHGA 4FJJA 5HRPA 4CE9A 2YKMA 5J2QA 1NK5A 1RTJA 1A5WA 1IKVA 1W0HA 3AA3A 4DTJA 3ZSWA 2P5GA 3ZCMA 2DFFA 3SUQA 2YNIA 5CZ2A 2XY6A 1NK8A 4Z4FA 4EZ6A 3ITHA 3V4IA 3RR7A 4FJGA 4KHNA 2OPSA 4N56A 4OJRA 4FXDA 4ZTJA 4NYNA 4CFDA 4CJ5A 4W5QA 1LW2A 3O4QA 3TR8A 1CZ9A 1F21A 1VRUA 1A5VA 2ATQA 3VQEA 1UA1A 3VN5A 3WNGA 1QSLA 4FM2A 4K8XA 4JRPA 3KK2A 5J2MA 1JKHA 5HBMA 5KRSA 3K2PA 4I9QA 4PY5A 4CJTA 3SYZA 5HROA 4DF8A 4PA1A 3TAQA 2LSNA 4NYFA 5DK5A 1CZBA 2VG6A 1SV5A 4KRFA 2KFNA 1B92A 3QEPA 1FXXA 4G1QA 3DM2A 1EP4A 3S3MA 4CJWA 4M45A 3PY8A 4W5NA 5K14A 4LSNA 4FZZA 4B08A 3OJSA 2E6MA 3DRPA 3ZSRA 3MXMA 1SKWA 4FM0A 2IAJA 3L2WA 2GBZA 4CIEA 2Y1JA 3CQ8A 3NGZA 1SL1A 3I0RA 3HVTA 3P5JA 4CHNA 4DFJA 1Z25A 4LH4A 4KHYA 1KVAA 3V9XA 4BWMA 1B9FA 3OS0A 3LDSA 4DTNA 3RMCA 3S3NA 3NF8A 1JXBA 4CHOA 4C8KA 5HRSA 3OS1A 3KLEA 1T05A 4ELVA 4B9MA 4CFCA 3NF6A 4E7JA 1BGXT 1NK7A 3V6DA 4J2EA 4W5RA 4FJXA 2HHVA 3AVCA 4CEEA 1RBUA 4BE2A 2XO7A 1JLBA 1MU2A 2OPRA 5HRRA 3K5MA 3K5LA 1ASWA 3AO5A 1IKWA 2P1JA 3G0ZA 4N47A 1KTQA 1VSDA 1JLQA 5JS2A 2E6LA 2OPPA 3AVHA 4AHVA 3KD5E 2DFEA 4RG8A 2VWKA 4CJKA 1QQCA 4AILC 3U3GA 3NGIA 3SQ2A 3TAPA 4FJLA 5I3UA 4M3RA 4RW6A 4CFBA 3V9ZA 4E3SA 4KI6A 4MFBA 3ASMA 4Z4HA 1RTHA 4FW1A 4YFUA 4O4GA 3KIOA 4IKFA 2HVIA 2QXFA 3CFPA 1JXEA 3QERA 3RR8A 2G8VA 1HQEA 5CZ1A 4FLXA 3KKSA 1WLJA 1XHZA 4DLEA 4H8KA 1NJWA 4FVMA 4KHSA 2IC3A 2IGIA 4B9NA 3KD1E 2JGUA 4CGGA 4CEAA 3HT3A 4DFMA 1SL2A 4J2AA 4CJVA 1LWCA 4EP5A 3V9SA 3SUOA 1TV6A 5FRMA 3AA5X 3L3UA 4FLVA 4CEDA 1RBVA 4BWJA 3NE6A 4KV8A 3RRGA 2FBYA 3V81A 3AVAA 1S1UA 4FYDA 4I9LA 3HM9A 1ASVA 1ITGA 2WONA 3LPTA 4CGHA 1L3UA 1XHXA 4FJIA 1HRHA 3OYGA 3HVRA 3NDKA 2HNZA 4DS4A 3P1GA 4NCAA 3KKRA 3ZSQA 4CEQA 4CFAA 1ZBFA 2PY5A 1WN7A 1RT2A 3QLHA 4FLZA 4CK2A 1LV5A 2X6SA 3OYNA 2IS3A 4CHQA 3LANA 3O3GA 1J53A 3HXMA 4C8LA 1EX4A 4O0JA 1BHLA 3AVLA 3E01A 4BE0A 1NKCA 1T7PA 4CEBA 3VQQA 2OYQA 4M3TA 4B9VA 4FJ7A 3KK3A 4OKJA 1RNHA 4CGIA 3M8PA 4AHRA 4CJRA 2P51A 4FLTA 4F4KA 4Q5VA 4UQGA 1RBRA 2RN2A 3CG7A 2HHUA 1HMVA 3IRXA 1SKRA 1KLMA 2W42A 5CY4A 4AH9A 3K5NA 4HCCA 3OYFA 1FKOA 1TL3A 4FJHA 1IO2A 3DMJA 2ZE2A 4DFKA 4F8RA 3AVGA 2AJQA 3TAGA 4B9SA 4Z0UA 1HQUA 3C94A 4OPJA 4IFYA 4FM1A 3HSTB 3LWMA 4DTOA 4AHUA 1WSFA 2F96A 4W5TA 3OVNA 4BDYA 5J1EA 3CFRA 2HVHA 4H4MA 3AA4A 3MEEA 2BGGA 5C24A 4M3ZA 3AVJA 1U48A 3RMAA 2KFZA 4E7KA 1VSHA 3SV4A 2G8FA 3AVNA 5KI6A 2A1RA 2P5OA 1EXQA 3O3HA 4CF2A 2HHQA 1RT1A 2HNDA 4KFBA 1D9DA 2XY8A 1EETA 2Z1IA 2ZQBA 2OZSA 3QNNA 1BQMA 4TSXA 1U47A 4FJ8A 3C95A 1B9DA 4DU1A 4IDKA 3NGYA 4FLUA 4N5SA 1LAWA 1RTDA 3WNFA 2QKKA 4OVLA 1X9MA 3QIOA 4M3XA 4OGCA 3TAEA 1NK4A 2EX3A 1XI1A 1NJXA 2Z1HA 4LSLA 3OYEA 3QNOA 2RKIA 3JSMA 4DTSA 2D0BA 3LAKA 3PO5A 4E7HA 3M8SA 1HJRA 4KREA 3MECA 4C8MA 4OGEA 2GUIA 4OPKA 4W5OA 3I8DA 4IBNA 3TARA 3LP3A 2DTUA 4B9LA 1RT7A 3HPGA 1RDAA 2QKBA 4E89A 3B6OA 3OS2A 1C1BA 1RBTA 1HNVA 4CHZA 2X78A 3IS9A 1WSIA 1BIUA 4CERA 2WOMA 2JLEA 4DSIA 2NUBA 1NK6A 3L2QA 2HW3A 4CF0A 4LH5A 1WSEA 3M8RA 4N76A 4KHQA 4HHTA 1TKTA 2FC0A 3VQ5A 4CEFA 1REVA 2B5JA 4EP4A 3PX0A 2PYJA 4F3OA 4QCLA 2HHWA 3UIQA 1WAJA 1Q8IA 3V1OA 5CYMA 3KLIA 1CLQA 4E0DA 3D45A 3SJJA 2DFHA 3VQAA 4PUOA 3AVIA 1W9HA 1YTAA 4CJEA 4DU4A 1JLGA 4DQSA 4BDZA 3NH2A 3RWUA 3PX4A 4DFPA 2R7YA 3C6UA
chains in the Genus database with same CATH superfamily
1E3OC 4JOMA 1YAGA 4F7ZA 3G71I 2GM4A 1S7AA 2OQGA 3CO7C 5EZHA 2KJCA 4PSWA 3A4CA 5E18F 5M1FA 3FMSA 4ESBA 4Q0BA 3FGUA 2XRNA 4N41A 4LG3A 3OL4A 1OLTA 3DLBA 3BQZA 3QESA 3REOA 4IPAA 3QB0A 1MNDA 4ITVA 1I50J 2CFXA 1YOVB 4B3RK 1KYWA 2HBKA 3WXIA 3A1YA 3CJTB 1VQ9I 4E7SA 3B6PA 1WGXA 5FROA 3E5UA 1ACIA 1ON1A 3JAMZ 3VPZA 2V4JC 4FLYA 4I2PA 1WHUA 2CW0F 1Z05A 3CMMA 3CMEI 4IEJA 2UWMA 4MIMA 4FZXC 3TW7A 2OA8A 3SQ0A 1ASUA 1TK0A 3BTLA 3ZX0A 3LDNA 1U6GA 5D5XB 2NYXA 5HLHA 1MDMA 4I01A 1P9QC 2FF4A 2KDOA 4WF9L 4FJ9A 4CK3A 4G9YA 4CK1A 2DYRH 3S3OA 3AO2A 3BJ6A 1USSA 3T7ZA 2A6EF 4J00A 2LY9A 2HOAA 2HHSA 4OX9K 2EZHA 2IGMA 4BR9A 2HHTA 1H0MA 1NKBA 5ICEA 2HQNA 1IXCA 2LF8A 1YJWI 3DU5A 1DQUA 2V9KA 3DLLF 2XF6A 2ZNYA 1UOCA 3PIPL 3WEEB 4NQWB 1G6NA 2CWEA 1QVTA 3BR0A 2IT0A 4B3SK 2DOEA 3NFAA 2ISYA 4N0BA 2X6WA 4BJ5C 4WCGA 3G73A 4KT5C 2ID3A 4CF1A 1YQAA 3OIPA 3SZTA 4FCYA 4ID5A 3UNGC 4A0YA 4I6MB 4HBLA 3VF4A 2IPQX 1NLVA 3LZJA 3H92A 1S1TA 3RQ4A 3V8KA 2QK9A 2E5LK 3T1AA 4LITA 3EE9A 4HCBA 4Y1CA 2L5QA 1NGHA 1FOXA 2H8WA 4RGSA 3CD6I 1IKYA 1IJJA 1FJLA 3S9HA 4KIGA 3UE5A 4L9NA 4WFNL 3H3ZA 5TKWA 3AA3A 2R7WA 2JZYA 1XMKA 1K4TA 3O8GA 3TR8A 2R0QC 3S8PA 5E17F 1BI2A 1SVMA 3GFIA 4DF8A 4IL6C 1SVLA 1CZBA 1FXXA 2DAOA 1ZKGA 4CO8A 1EWQA 3OW2M 3ABTA 3HVTA 1J5YA 3RI4A 3FK6A 1WJCA 2XKPA 4LH4A 3LSMA 1DEJA 4B4CA 3EPZA 2O9LA 3H0GJ 3CDHA 3LWFA 1IKWA 3D0SA 3EO3A 4N47A 3PSIA 2E6LA 2HBLA 5E8IA 2GZWA 5B5EC 3CFPA 5CZ1A 4DLEA 2DPNA 4XRSA 3VOEA 3H3OB 4CGGA 2LD5A 4XLAA 2M45A 3D2FB 4BWJA 2CQXA 4MEYF 5JLWA 3ID8A 1S1UA 3LSTA 3LSIA 4IQ4A 4BG9A 1NG9A 1LE8B 2Z3YA 2JQ7A 4ISEA 4CEBA 2Y69H 4D7MA 1ZYRF 1IV8A 4AM7A 1ODDA 2HYFA 4Q5VA 1JCGA 3BR5A 5JLFA 5H1SQ 3LDPA 3K5NA 3OYFA 4L18B 4YOVA 2NVTJ 2A5YB 1LPQA 4BRDA 1REPC 3AVNA 4HOBA 2BY1A 1NJIO 3C95A 2HQRA 1LJ9A 4DU1A 1NK4A 5EOYA 2RKIA 4ESFA 3I64A 3LAKA 1ZREA 1K79A 1TQIA 5GAEJ 4A3EJ 3I8DA 4N4OB 3E7LA 2QKBA 4A61A 2X6OA 2MH9A 2VGMA 5ILUA 4AU7A 4ZDLA 2R5YB 4KHQA 3WG9A 1NG7A 3HUGA 3P4IA 3EUHA 3ZR8X 1K61A 4IF4A 3C2GA 4HDVA 3TDUC 1KGSA 2LF7A 4MGRA 4KI4A 1S1WA 5ERIA 5GPCA 2Y0SN 4QAGA 2CYYA 3Q5FA 4IOXA 4CJUA 3C6AA 3TI0A 3DLLL 3HBLA 2H8RA 2OTLN 4ASNA 1SAZA 3QRFF 3IKVA 3UB5A 4D1QA 2K9QA 3QEXA 3E9PA 4B3MK 4HAMA 5C4XJ 2JVHA 1ZQ3P 4A0XA 3KTQA 4P9UA 3H5RA 2OPQA 1D5YA 1R71A 1YW8A 3K4NA 3PM1A 4OPHA 4HTUA 4U7BA 2HSTA 3ABLH 2FBIA 3K9KA 3FZHA 2EZIA 1BC8C 1YF5L 1ENHA 3QEWA 2HQAA 3OYDA 1HPZA 4GKKK 1XN7A 1W5SA 2VASA 4YFNF 3M8EA 1OCRH 1LVKA 2WAEA 3HP9A 4CW7B 4IG3A 4GVEA 3KHYA 2CV0A 3JRCA 1FIPA 1BBYA 1VQ4N 1RBSA 4AHTA 3GYHX 1JL2A 2A6AA 2D45A 2GWKA 4CEOA 1RGIA 1BA1A 2ECBA 3OHRA 2AHQA 4R79A 1Y6IA 5K1YA 3JRHA 2D0CA 2X74A 4C9YA 4B47A 5FRNA 3M1CA 2X85A 5CPRB 2M0CA 2GA2A 1ZAOA 1F4KA 3S2DJ 1K6YA 4XKBA 4EEFG 3HHGA 4KPYA 1QPMA 1YITN 2O8FA 3OYLA 3RQIA 5M5WJ 3CMEN 1IRZA 4FTHA 2CH5A 4CGFA 1DTTA 4B1UB 1X1PA 3L3VA 4AD9A 4O44A 1NK9A 2WB1A 5AQPA 2EFQA 3ZT3A 3P9IA 5LGTA 5D3GA 1MIJA 3S1RJ 4EAHD 2YV0X 1BI4B 3WTUC 1AKHA 1GUUA 2IA1A 4PK4A 1XB4A 2PEXA 4KIBA 1HKBA 1S7EA 3CCLI 1RDCA 5EGOA 1YJWN 1IUFA 4XSZF 4PHTX 5FKOA 5T7BA 3HSRA 2R7XA 3AVMA 1TNTA 3KEYA 2K85A 4NHJA 1I3AA 2UV1A 4Y17A 1W36D 2ECCA 3WNHA 2HS5A 3D1NI 4WK8F 3K6GA 1E3MA 3VQ4A 4I6ZA 1RUNA 5CZ2A 4F3QA 2LVSA 2EFPA 4CJ5A 4NUBA 3VEOA 2OC6A 2XDVA 5B1AH 4DQ8A 3K2PA 5E3LA 4FSVA 5FB2A 1SV5A 3SMSA 3DM2A 4M74A 5GIPA 4LSNA 4B08A 4QTRA 2A69F 4P55A 2P9UB 3DKXA 1CF7A 1OH8A 5IY5H 4CIEA 4L0ZB 4DFJA 3WGHA 3AG1H 4RAGA 3AVCA 3CD6N 3O5BA 2R5ZB 1OCPA 2V1XA 1FTTA 1BW6A 1AU7A 3HSCA 5GIOA 3CC2N 2F4VK 2PMUA 5GP9A 4RG8A 5HVQC 2PJRA 1ORKA 4DHYA 2PFUA 3VYUB 2Z16A 4IQJA 2EK5A 1R9TJ 4UB8C 5KPRA 5DD8A 3HT3A 4E70A 4CJVA 4H4KC 3MKZA 5FRMA 3TOAA 3NDKA 2UXBK 2B9SA 1LDDA 1J7KA 3K2AA 3AVLA 4B3AA 2GXBA 5D8LB 3ZQ7A 1TWFJ 3MMVA 2PG4A 3EDPA 4OKJA 4UQGA 1KLMA 2O0YA 3LDLA 1H9TA 1SEUA 3DWLA 1VAZA 1IXRC 2ISZA 3F23A 1WUAA 5TGTA 2IVOA 3HGGA 1JE8A 3LWMA 4BRFA 3CCSI 4B09A 2MC4A 3ATVA 1WRJA 2ZMEC 2HHQA 4AYBA 4FQGA 4A6DA 2LYCA 1YIJN 5LGNA 5AQUA 4EJWA 3C7NB 1LDJA 3B6AA 1HKSA 2DMPA 1RUOA 3B6OA 5KQDA 1TWCJ 5C12A 1Q82O 1WSIA 1FY7A 1IC8A 1LOTB 1U8BA 1Z3XA 3LSPA 1WSEA 4UV8A 4HWIA 4HQEA 3FBIB 4N4NB 2QVOA 3ZQHA 3K70D 3CCUI 2UU9K 5KCMA 2BANA 1N8RO 3DEUA 1D5VA 2QF7A 3CP2A 5AZIB 4JNEA 3HPHA 2M2EA 1D8JA 4FISA 3SQ1A 1CXQA 1O3QA 4CESA 2DLLA 3Q9SA 1NJYA 3LAJA 3AVKA 4OLAA 1X4PA 4D5CA 2RPIA 1R7JA 1W7PA 2KZVA 2GOMA 1DTQA 1H8AC 3O9UA 1MWKA 2CG4A 2QQ8A 3DPUA 2LOOA 1LB2A 2K5CA 3ERED 2EINH 1UCRA 1D1BA 3QOPA 3WG7H 2R93J 1TT0A 3FX3A 3CESA 3GTJJ 1FYKA 2A42A 4FK2A 2UUZA 4LB6B 3TANA 4B1RA 2W85A 5KGWA 3BZCA 1KU7A 3L00A 4RM3A 4A93J 4HVJA 5GAHJ 3DYAA 3QFUA 3CF5F 2YPRA 3O9TA 4PWDA 3ZN1A 4BC4A 2L54A 2FBTA 4CYCA 3AA2A 1LUJB 3OOPA 1HDDC 1GV5A 1HQCA 3SJMA 2FBVA 3R4KA 3PO4A 2E19A 2CGLA 3PLAA 4KAZA 3ZMVA 1FMVA 2WC9A 2D2WA 2VBWA 1RT5A 1L3VA 4JI7K 4Z4EA 3CUQC 1UWBA 2YNHA 4J19A 3J7AY 4CZMA 1JLCA 4IJAA 4D7NA 4P96A 3EZWA 4ZJZA 4JKEA 1X3ZB 4DV6K 3DLRA 2M5WA 4DLGA 5E3MA 2E1YA 4HG2A 2D4WA 3RSNA 1EWRA 1NHAA 2KPMA 4AIHA 3V1QA 2ICWG 5AQHA 2QLZA 1YRNB 1X1AA 3IH4A 1RILA 1OCZH 5D5WB 4BHBA 1ESVA 4BREA 3GFJA 1I3QJ 2JTVA 2KJBA 1XMAA 4M6XA 4UY8I 3ZETA 4BQNA 2KT0A 2YHAA 4A3BJ 2AS5F 4WQ4C 1Z77A 1HF0A 1ZTRA 1USTA 1VK0A 5BR8K 1P8ZA 1TW3A 2P9NB 3TEDA 1WB9A 4J2DA 1KONA 3GFMA 1J0RA 3CUQA 4HF0A 4RLQA 5M3FJ 3W3DA 4A3IJ 2JA2A 2WBMA 2ZCWA 1X1BA 2BVMA 2MGQA 3VDXA 3VN5A 2ADUA 4C3IJ 4H0PA 2QWRA 5ICCA 5K7HA 2OAZA 5DK5A 2KFNA 5M1KA 3KP7A 3KP6A 3J8AA 3FDYA 3CCLN 3BY5A 3F8FA 2XB0X 4WQ5C 5ICGA 1I6HJ 3TO7A 1Z25A 3DXKA 2GIVA 5DDGA 3OS1A 4W5RA 3KP4A 4QPQA 5HRRA 2XAGA 2CH6A 3KD5E 2VWKA 2O7OA 3SQ2A 1BC7C 4FX4A 2RVCA 4O4GA 1I27A 5AQVA 4CZZA 1NK2P 2Q36A 1WLJA 3G1LA 2E60A 3FIWA 3SXYA 4DJAA 2NNYA 4KV8A 3RRGA 5AIQA 1O57A 4IRGA 1ASVA 2WONA 3UKRA 2FNPA 2ZF5O 3WTXC 4M7XA 2FMYA 2WA0A 3WUHA 2PX9A 3OYNA 3O3GA 2V1DA 1J53A 1SD5A 4EHTA 3FZMA 2BV6A 2TRTA 4FPAA 3ELKA 3KEQA 3S1QJ 4AHRA 1XC3A 4WQ5A 4F4KA 4PCQA 1HMVA 4O8KA 1TL3A 1P4XA 4F9OA 4FJHA 4R8HA 5E1XA 1H88C 3TAGA 5IYBJ 2BEOA 2LSOA 2P8TA 5GAGJ 4A2UA 4MHGA 2HVHA 1WSUA 3IDHA 2EFOA 4CBUA 5LMNK 1XCVA 1EXQA 3A02A 3ZPLA 2HNDA 1SFKA 1EETA 4FJ8A 5DEQA 5FLXO 4FLUA 1RTDA 2IIRA 4OGCA 1MGTA 1U2WA 2OPTA 1G99A 3F6VA 4W5OA 3RSEB 3KLNA 4JAXA 3I5UA 2X4HA 1RBTA 5LMUK 3CF5L 4DSIA 2VPLA 3L2QA 2CSOA 4F3OA 1VQNN 1WI9A 4FOEA 3ML6A 4IOCF 4FWMA 3VEYA 1R4NB 1BN5A 2ID6A 4JLHA 1MBJA 2P9PB 5SZTA 5D5UB 3GLXA 4CZCA 3RPUD 4DV2K 3HYIA 1OR7A 4A5BA 3NH0A 3PUFA 4EQQA 1GLBG 4H4OA 2EV6A 4ZDOA 4ZYGA 2FA5A 5HNFA 5GAEP 4R5PA 2QI2A 4ENMA 3G4SI 3A5OC 4HEA2 3MEDA 1NMNA 5ELZA 2X6XA 3L2VA 3MXJA 3H3NO 3WU0A 3CJAA 1WSHA 2P9SA 1YT3A 3A2FA 2E1MC 1OVYA 2YHYA 5ICFA 4ZHRA 1QNTA 4BNCA 1VSLA 1C1CA 2LG4A 1XGOA 3Q3SA 3I3LA 3IH2A 4JQFA 2HVRA 4DQIA 2E8AA 3ABUA 4BE1A 1FOYA 4CF8A 4BS9A 4KIFA 3NARA 3AO3A 2QSHX 2HFHA 2KIQA 3MKWB 1VZ0A 4RS8A 3SPZA 1TZLA 4GMJB 4CGDA 5J2PA 1BI1A 5M1PA 5BPIA 1R23A 1PUEE 2H94A 3Q9VA 4Y33A 5IT9O 3CCQN 1SFEA 4XR6A 3O6BB 2MG4A 3OL3A 2LR8A 1K83J 1Q9YA 4BQLA 2KZZA 4CZJA 5LEJA 3M1FA 4RW4A 1ETWA 3OYBA 4GNIA 5F04A 4CJLA 3MAQA 3L8BA 1FTZA 4H0YB 3TAMA 2ZXHA 4FWKA 4I7HA 2AA4A 4KTWA 1RT6A 1R5GA 4G6TB 4F3TA 4KMUX 5ADXH 4DQRA 1L3TA 3RMBA 1BQNA 3HO1A 3ZSZA 5KTQA 1HX1A 5C25A 3QO9A 4A6EA 1BI0A 1ETYA 1DPUA 3FXOA 4RW9A 2ZNZA 3PQKA 1MH3A 2QQ9A 4NLBA 1K78B 4HSTA 3C6HA 3LSGA 3FXQA 1T44A 4XLFA 3CCRI 3CDLA 3IP4B 3IWZA 1KLNA 3HG9A 3ZX3A 3MWPA 3VQBA 4ZTFA 1RETA 1O7LA 2L9RA 2F8SA 2DY4A 3KLOA 3H1VX 3LPUA 4OAYA 2VBXA 3K57A 3WTTC 1Y97A 2YCHA 1FLIA 1S6LA 4BRHA 4F93B 2QM3A 5D8KB 4L0YB 1DP3A 3ULQB 4EJTA 1GLDG 3EL2A 3HGYA 4PY5A 4I9QA 2HZTA 3FHNA 2UUAK 1PP7U 4BVOA 4JI3K 3DRPA 4FM0A 1SL1A 5JMVA 1KVAA 3C2BA 9ANTA 4DB3A 3VPRA 1O7FA 4JEPA 1IBLK 3IUOA 3K5LA 4LF4K 4IOCL 2ZSHB 3DEWA 3K4KA 4YDUC 1RI7A 2XGCA 4CFBA 2HOTA 3E6DA 3K0SA 2VQEK 4IKFA 1JXEA 2HKXA 4FLXA 3CLOA 4KHSA 2DTRA 1R1TA 5AR0A 1ATSA 4J2AA 3QPSA 3WXLA 2CRGA 3DBLB 1VQKI 1ITGA 3HZJA 5F64A 3H1QA 1ZBFA 3DTIA 4CK2A 4M72A 3TQNA 2HYJA 1CQTA 3R6SA 1X3NA 4CGIA 5HDKA 3N4PA 4U67L 2VOPA 5BN8A 3DMJA 3SFZA 2FSKA 4UV9A 2HVQA 4FM1A 3KP2A 4H4MA 5DYMA 1K4SA 5C3EJ 3RPQA 4YDUA 1LDKB 2L01A 2M4GA 5IT9K 2P5KA 4YY3K 3QIOA 2JA6J 3WEEA 4LSLA 4BXUA 3VYRB 5IT3A 4IOAL 2MYSA 1MBKA 5BMZA 1DKGD 4OIRF 3MECA 2FBKA 3EEQA 3PL8A 3FM3A 4GGGA 3IS9A 2HEOA 1T95A 2X1EA 4LH5A 3T8RA 2FC0A 3VQ5A 1WAJA 4E0DA 4K42A 3VQAA 1YTAA 4F92B 4I6MA 5AQIA 1Z67A 1D0XA 3HRSA 2EIMH 1LW0A 1LAVA 4ISFA 2JN6A 1KSPA 4O5VA 3T19A 3S14J 2XASA 3ZQCA 1XMQK 4KH4A 1J5OA 2K9NA 1G3WA 2K9MA 3G6EI 4BRCA 3OIQA 1VTNC 4RB3C 1NGAA 4KKOA 4M3WA 4DMNA 4JK8A 4DKWA 1NKEA 3BTIA 3HUGB 3C1DA 3LFKA 3PUBA 4ZC3A 5LD2C 4UVAA 3NF7A 1JTXA 3U21A 3D2EA 3CCMI 2L9NA 4FWPA 3HHHA 4QS8A 2P6SA 4BRPA 4PKGA 3I4NJ 2K9SA 3OMYA 4W1UA 2HB5A 5FFZA 4MO5A 2I5UA 4MO7A 1WVRA 3CDIA 3LP0A 3QPTA 3S32A 4RGUA 1HKQA 4DQQA 1KZHA 3WTSC 3U3YA 4KT6A 4LLNA 3AL0C 2VUMJ 3GZ6A 2G8UA 2ZJRL 3G4SN 3HRTA 4CVNE 1MJ9A 3F21A 2Y9ZA 1ZLJA 4XK4A 2VYPA 1ETVA 4CECA 3P38A 3BPVA 3HK2A 1GLEG 5HP1A 3IH3A 3QIPA 4H5NA 3QMLA 1HYZA 2CUFA 2XKOA 2L7FP 4RDUA 4M73A 2PBDA 3VEWA 3D2FA 1MZBA 3ZX2A 1GLNA 4KITB 4F2RA 1Q9XA 1YVUA 4G7HF 4EFHA 1GOCA 3KPHA 1LE8A 3WQTA 4JV5K 1XGNA 4XM3A 3WXMB 2VGNA 1RPWA 5FFXA 4AIJA 1TBXA 2K3PA 3SV3A 1XMXA 4DTMA 4M6VA 4CF9A 1AHDP 2OZMA 3FKIJ 2ETHA 3OR1C 4E19A 4ILHA 4GY2B 3LWLA 4M3YA 3TMOA 1K6OA 3ZT2A 2KKZA 2PI0A 4B3OA 2ZGYA 1WJ5A 3ZMUA 2NNWA 5KRTA 3E9OA 3PO2J 1IDYA 1Y56A 3L1PA 4H5WA 4UUSA 1FYMA 3QEVA 4A3CJ 3MN6A 3SPYA 1KVBA 3D5RC 3F5TA 3BZ6A 2P81A 4FJ5A 4FWNA 5FDLA 4A5AA 3IWFA 4M3UA 2WTUA 5A2QO 1VSJA 1Q7YO 4HQMA 2FNAA 2DPDA 2E34A 4CE9A 1I1SA 5DTDA 2ME6A 4CZKA 2OPSA 4ZTJA 3O4QA 2COMA 5DUIA 1MJBA 1AA7A 2L7ZA 4I09A 3VEVA 2KL4A 4PJMA 3I4PA 4PA1A 2B7EA 3E0JB 3S3MA 3PY8A 3TDZC 4M7YA 3JAMO 3ZCOA 2KLOA 3I56I 1M1KO 1QRYA 1T56A 2NRAC 2E2PA 1IG8A 4FWLA 5D6EA 5HRSA 1ZARA 5EDNA 1XSXA 2UUBK 3JRAA 4YELA 4XNFA 2M1BA 5JS2A 3CMAN 3U3GA 1G59A 2NRHA 3V9ZA 4F52A 2LRDA 3DF8A 1A5JA 4RM2A 5C15A 5HS7A 5BPMA 2IA0A 4HSRA 2VC1A 3GG4A 1QA6A 3LOCA 3O8HA 2PMZA 2OTJI 4FE7A 3U1KA 1ZHFA 3RCOA 2A3SA 1QHHD 2CUJA 2RNGA 3VYSB 2NVUB 3J81O 1EX4A 3WXJA 4RTFD 3V42A 3C3WA 3TOBA 1SKRA 4YFXF 1FKOA 2QWMA 4ENJA 6PAXA 4OPJA 2A5WA 3ENBA 3F3XA 3E5XA 3CFRA 2BGGA 1MNMC 1PP8F 1T6SA 2QUFA 5D4SA 5D6FA 4FETA 3THWB 1SD6A 2CV2A 1ZC6A 1Z7UA 4M9SA 4BRIA 2CO5A 3E97A 1VQKN 4ILGB 1HW2A 3CCJI 3I55I 1R5ID 5AQLA 1C1BA 2M30A 3OR2C 1BIUA 1I94K 2F2EA 4JI5K 1T8IA 1Z1DA 4EP4A 2HHWA 1FYLA 4MDAA 2EFNA 1SFUA 2ZXJA 2R7YA 4L5EA 1BI4A 1QHAA 3TSUA 3KYDB 3FR0A 3ZXSA 3IUCA 3GTMJ 2XPWA 1A31A 1QZ6A 1PUFA 2WAQN 2A3ZA 1S6QA 3GW2A 1XDUA 1UFMA 4QLCU 3ENHA 4BRGA 2VXDA 1EH6A 2Z1DA 3OV8A 3GO5A 3SCXA 3ZN0A 5F0CA 4XKWA 2JA8J 2KTQA 3ZSVA 4A3MJ 4K0KK 4ENKA 3A5MC 3G2BA 5EEGA 4BXFA 4Y15A 5L3DA 2CUZA 2RQPA 4RA2A 5FLXZ 4Z4CA 4II3A 2QSGX 4H5VA 1JUSA 3MFKA 3DRSA 4QOZB 1FEXA 2E1ZA 1SL0A 1RDBA 5FPMA 1U0JA 2GAUA 1NOZA 1EKEA 4EMSA 5EU7A 4S05A 4LG0B 3R0AA 2P9UA 1S6PA 3L2UA 2ZMEB 3ZMZA 3GEZA 4XH5A 2R7SA 3PX6A 1MMGA 2GELA 3G6EN 5AQJA 4OKKA 3CCEI 5CYQA 4L8RB 1W7PB 3MKLA 1EJ9A 3LNQA 3OJUA 1ON2A 1L3LA 4L5IA 2R5ZA 3MN2A 3IG1A 2HTJA 3BP8A 2O8EB 3DOLA 2HR3A 2JUGA 4FX0A 2DXIA 5KQ8A 3FFKB 1MMNA 4DS5A 2NOGA 1WQ2A 3HRGA 1U2VA 3KK7A 1KQ8A 4GV9A 5E26A 3LP2A 3O8MA 1W2BM 2NRVA 4DTXA 3P9KA 4BBSJ 4WXDA 2DA5A 1ETKA 3BCAA 3CJ7A 4E7IA 5E3OA 2G8KA 2ESHA 1ILYA 1TAUA 1WH7A 3ZT1A 4IO9F 2FQ3A 2VPRA 3HP6A 1S9GA 1NBWA 3V4GA 4DSFA 4CCOA 2CMPA 3Q7BA 3L4QA 4ELTA 3LDQA 3V1RA 1N36K 1IAWA 2OUMA 2YJFA 3BDDA 2VG7A 1HSTA 2CQQA 3FE1A 1ZXOA 3W2AA 2NS8A 2LP0A 3CIPA 3SUNA 2FF3B 2FSWA 1ERDA 4OPAA 4YOUA 2ZB9A 2HOSA 3LA2A 3HDDA 3QETA 4DU3A 3V9WA 4KDPA 2NS0A 5B3SH 1R4MB 3WODF 4G12A 5M1OA 4Y4RA 1ZRDA 1NK8A 3GTPJ 2FOKA 5LRRA 3ITHA 3V4IA 3RR7A 2HDWA 2Z2SB 3FXUA 1F21A 2R3SA 2FUG2 3BG9A 1QSLA 4Y52J 3H6EA 5AQZA 3TPQA 5CVIA 2BW3A 1FMWA 5JVHL 1ZR4A 1MBGA 3LDSA 3WTZA 3VYTB 4J2EA 5EY4A 3KVGA 3J80Z 1Z6TA 2L7MP 3W6JB 4AHVA 1QBJA 3IFRA 3T8TA 2TDXA 1IV6A 4MFBA 2NLXA 4FW1A 4JKBA 1W5CC 3HXLA 2G8VA 2VBZA 2DA2A 4DGWB 2F9TA 2IC3A 1HDPA 1BIBA 1YFHA 4CGZA 3NVMA 4DFMA 2QQBA 3SUOA 2G7HA 3NRVA 1RBVA 3NE6A 3GTKJ 4OIPF 5E8GA 2OD5A 1XHXA 3OYGA 2CW8A 4FLZA 3I56N 3TTCA 1SAXA 4OAZA 2IS3A 1ZGJA 2IGNA 2E2JJ 1BHLA 5FO5A 2AP1A 1YS7A 3BUZB 2L9VA 1GXQA 2RN2A 4B1VA 1TLHB 4LF6K 3VETA 3CCVN 4A3LJ 4DFKA 1T33A 1JJ8C 4Y13A 4UVCA 1Y1VJ 4ANJA 4W5TA 1S9HA 3JRBA 3ZRGA 1U48A 3LQQA 5J6XA 3UKRB 4YG2F 1PVEA 4KFBA 1BQMA 2GLOA 4CJ7A 2M34A 2WTEA 1LAWA 3WNFA 4M3XA 2GX9A 4YHHK 3PIOF 5LHHA 2VKDA 4BKXA 1DP7P 4BBRJ 4HDUA 2VJ4A 2DTUA 4Z2YA 1V5FA 2ZFWA 4X64K 3WE2A 3S17J 4HHTA 1U8RA 3HOYJ 2L9SA 4X0GA 1CZAN 5AQXA 1O3RA 5AQTA 4CJEA 2W84A 5CHIA 3RWUA 3VQDA 2ZO4A 1ONVA 1K9MO 3DLEA 1HKGA 4BY1J 3T1HK 2W4SA 3O1BA 1TKDA 3G3ZA 3DOKA 4M3EA 4U7DA 4IO8A 5J8FA 4JHDA 2HOEA 4S04A 1Q1HA 5KK1A 1I5ZA 3FHZA 3RRHA 3QYFA 2NRZA 1VSEA 2P9NA 4FLWA 4IO9L 2VN2A 4BRKA 4MDBA 1S8NA 1I39A 1HW1A 4HTLA 1ZBUA 1IBMK 1ZBIA 3ULDA 1NK3P 3H9QA 4UUVA 2L2OA 1CGPA 4CHUA 3VTHA 4EV0A 4NO7A 2DTZA 1TTYA 3R6MA 4EGYA 2QZ8A 1VQOI 3U9DA 3HB9A 3EN9A 3L7WA 1XNQK 5L3GA 3GBGA 2DJNA 4CZHA 3VSKA 2IRFG 3I0SA 4DTPA 3GTGJ 3K0LA 4RBOA 3RVCA 1HLUA 4XONA 1Z3YA 2OA4A 4JS5A 1T8EA 4NCGA 3OOUA 3ZSXA 3TTFA 1YX5A 4WWCA 3A03A 4I98B 3PIPF 1VQLN 2KMUA 1E4GT 1WSJA 3V9UA 1D9FA 4LIUA 3OYCA 4ZYHA 5IWAK 4YORA 2HWVA 2ACJA 1P2FA 4M6YA 3WU2C 3MAJA 1BU6O 1S9EA 4DWIA 4CI6A 5HLGA 4IHXA 1ATRA 1B6AA 1ETXA 3LM9A 3LQRA 4JX6A 2K40A 4B8AB 1U4BA 1Y0NA 4O0IA 2A68F 1FIAA 3J7ZO 2E1MB 3GDQA 1SD4A 3THVA 5B1BH 2ESNA 2PYLA 2VCPA 2M3AA 4Q47A 1S29A 3ECOA 4CCMA 2QEXI 2L4MA 3ZT4A 2NRRA 2YJEA 2PJPA 1V5GA 5AQWA 1N6QA 4GRIA 4EHUA 4EM1A 2Q1ZB 4C2UA 2CH0A 5FD5A 4I2QA 1JHFA 4ISGA 4JD2A 3JTGA 4M3BA 1TVRA 3FZFA 4BVPA 1GDTA 2W82A 4Z4FA 2LLKA 1JKRC 4KHNA 4N56A 1HKCA 4W5QA 2P9PA 3S1NJ 2ATQA 2E20A 2E88A 3C2HA 3SYZA 3MZHA 2QENA 4Q4ZF 4FZZA 1QQIA 3PIOL 3L2WA 3OS0A 1BWFO 4DTNA 3PSFA 4B9MA 3U1DA 2XRLA 4CYDA 3MMYB 1EQYA 1T6CA 3CQXA 3H36A 1BL0A 1MMAA 1VSDA 2W24A 3CC7N 4IEEA 3BROA 1IRFA 4KI6A 3IRQA 2BUPA 3QYEA 1LCUA 2OQRA 3L0QA 1VQ4I 1V4RA 3IRRA 5JLHA 3FXMA 4LF8K 5A2QZ 5C10A 4FLVA 3W0LA 3CPWM 5HLIA 4FE4A 3P1GA 3HM8A 1KQ0A 4CEQA 1WN7A 5J1RA 1EA3A 5LRSA 4C8LA 1IN6A 5LGUA 1B8IB 1WWXA 4DR5K 3KP5A 1VFCA 3KK3A 2A40A 1MJAA 4AVZA 3PO3J 4CJRA 5KVRA 2V9VA 4XQFA 2JSCA 2DA7A 4YOWA 3L09A 1YITI 4JKAA 1O3TA 2XF5A 2WC2A 4L9VA 2IS1A 5D4RA 1XNRK 1E3PA 1RT1A 4BY7J 2OF7A 5EXWA 4CBWA 1OYIA 3THYB 3QNOA 4DTSA 2D0BA 3LM2A 4BROA 4GYGA 2O61A 3K7AJ 3CJCA 3K70C 4B9LA 1DU0A 1ZRFA 4JI1K 4E89A 5DCFA 1NK6A 2HW3A 1KAZA 4CF0A 1BR4A 3M8RA 5CYMA 2DFHA 1FZPB 3BR1A 5FKNA 3QYBA 1QO0D 2LC2A 1IGNA 5KGXA 4XIUA 3J81Z 1K78A 5AQKA 3ISNC 5BRFA 1BJAA 1A5XA 3HJFA 4NB4A 3ABMH 1VQ6N 3OSFA 4UB6C 4NBQA 3WHCA 3NCIA 1C1AA 2DOAA 2VG5A 1J9IA 2NVQJ 4CJPA 3M07A 3WTVC 1Q86O 4HYEA 4KO0A 4BR7A 5DCMA 2OJED 4B8CA 5CVJA 2CQ7A 4CJ4A 3BGRA 3D5SC 3KYLA 3KX2A 1TKZA 1U45A 3OYKA 3WHBA 4LY7A 2M8EA 5JVTA 2Y9YA 3RKWA 3EZ5A 4DYCA 3DCFA 3I4MJ 3V7CA 4OO1J 2G7UA 3AV9A 4KH5A 4JX4A 1OPCA 2D0PA 3N4MA 3SUPA 3K69A 4XLPF 4AHSA 3CC2I 1U04A 3SI6A 5J4YA 1XC9A 2DQLA 3D2EB 4OLBA 4HX8A 3K10A 4G9ZA 2O4GA 4FJKA 2RC4A 2E2HJ 4WFAL 1LWEA 1R0AA 1C0UA 4Y1DA 1NGJA 3U9ZA 2CFOA 1S5JA 1G3YA 3MWTA 4ELUA 4O8UA 4DR1K 2VWBA 1GT0C 2G8WA 3RYRA 4AWXB 2LKXA 1VQON 3O1WA 1WAFA 5ILSA 1U78A 5BQTA 1QU3A 1G8XA 4PSXA 3GTQJ 2WUSA 3CJQB 2ZSIB 2XB5A 4CSWA 3NAEA 2HQ5A 2XHKA 4DV1K 4DSEA 1FT9A 3IL2A 3VQ7A 2B6AA 2G8IA 1YIJI 5TJJA 3OY9A 3HOZJ 1YIOA 2KZGA 3IAYA 1WCMJ 3ROUA 4E7ZA 4E1NA 3K5OA 1OJLA 2IOCA 3SAHA 1NGEA 3NH1A 4NC6A 4CD1A 3H35A 2E35A 4DUZK 2F7TA 2DODA 4HRIA 1S1XA 5F27A 2HMPA 1J54A 2CGPA 4BQQA 4OMYA 4FHTA 2CGJA 2EHGA 3AL0B 3PFYA 1A5WA 1IKVA 3LSJA 3ZCMA 2F4MB 1V3FA 4FJGA 4HF1A 1VRUA 1ETOA 3VF2A 3ESWB 4K8XA 1NTCA 5HBMA 2UUCK 4XEIA 5HROA 4UUSB 2IS6A 4ZH4F 4B8XA 4IRIA 2XPUA 2X1CA 2UXNA 1SKWA 3DKWA 3P5JA 3AFHA 4AQYK 4G94A 4YIIA 2QEXN 1SMYF 2RE2A 3V6DA 1POGA 1KYZA 2R7RA 3DPTA 1ASWA 1B59A 3AO5A 3DLAA 1MMDA 2F9WA 1IG7A 3JSPA 5J40A 1WI3A 1KU3A 2KQRA 3EE8A 1IN4A 3N4QA 3V9SA 1YI2N 2YX4A 3CQYA 1GV2A 3D6RA 2X6SA 2BGCA 3SBGA 2KHOA 2OYQA 3K1MA 3TBIA 1JKQC 1RNHA 2KIMA 1LEBA 1K8KB 2KHMA 4H5TA 4CCJA 1IO2A 2D5VA 2QA4I 2D1KA 3OVNA 4RWTA 5F08A 4UVBA 3JCUC 1QZ5A 3O3HA 1QQNA 3A0IX 5GTIC 2D0OA 3HTVA 4L5JA 1YJNN 2O8KA 2QWNA 2MSYA 2Z1HA 3SDGA 2WAQA 3ZP5A 1HA8A 1J6ZA 3H46O 5AFUA 4YFKF 1RDAA 3ERMA 4CHZA 4MO4A 3VOVA 2GXGA 2R7UA 2HI3A 5BPLA 3JRGA 2QWLA 1TKTA 4CEFA 4MFEA 4F55A 5JHUA 2OU2A 1UHSA 4EJOA 2YU9J 2IGKA 4HX4A 4PUOA 2VQHA 3HOVJ 3RYPA 1OCOH 4DQSA 2AQFA 1E17A 3HSFA 3RMDA 5LHIA 4JKGB 5GPAA 5CR4A 4DF4A 3W3CA 1Z9CA 2CUEA 1IXSB 3I0TA 3C0BA 4XOPA 3F9KA 3HOXJ 3KYCB 4CIGA 4JYAK 1R36A 4Z4GA 5DM6F 3THXA 2OZUA 3QPHA 2HPIA 3T69A 5H6RA 3QBWA 4EM0B 2M4KA 4PDKA 2WBNA 5F1RA 1IF1A 4QWQA 1MBFA 1LFUP 2V6EA 1LWFA 1YHQN 3T3FA 4BDPA 4DYRA 2WV0A 3BZKA 3SQ4A 3MXIA 2DW4A 4AUXA 4YIRX 3EY1A 2DMUA 1PUFB 3SAGA 1D0ZA 3TGNA 3EKUA 3RPUA 2P0WA 2A41A 5L3FA 4FASD 3VODA 1HXDA 3BCBA 2O8XA 1F5TA 2UXDK 3V7SA 3I71A 1F43A 1QTMA 2MABA 3RTRA 3GWZA 4MQVA 1JL1A 3GBTA 3CC4N 1WNSA 3CM5A 4BC3A 1P92A 4BJTA 1RKWA 1H1VA 1J09A 1I6XA 3AAPA 1SC7A 3F9MA 3DP7A 4DUYK 3FBNB 4Y0WA 4DV7K 4XBFA 4XRMA 2K4JA 4FVUA 3S41A 4LK0F 5L3EA 4LFBK 2WY8Q 1N33K 5E41A 1KCFA 2HTSA 1AOYA 5K5OA 1FKPA 3O80A 1S7OA 1SZ2A 1SVOA 1UAXA 1LFBA 4U88A 1AWCA 3BG7A 3JR9A 2QXLA 3GTOJ 3MCZA 2KDZA 3A0HC 2VC0A 4DV0K 4CJ3A 4KYWA 4J2BA 4KHWA 4AM3A 1KVCA 4L9JA 1HYVA 4Y3OA 3I33A 1MA9B 1NG6A 1U2VB 5B8HA 4A3KJ 1ZBLA 4BRLA 2O8BA 3IV5A 4JN4A 2ITMA 4OWRB 4CD3A 2P9KA 3THWA 3QWLA 4M9XA 4BG8A 4CJSA 4JS4A 3VWBA 2ZJPF 1VNDA 4CUGA 4DOZA 4FOIA 1VQNI 1JI8A 3HRMA 1GVJA 2R7FA 4X6AJ 3OBWA 4DTRA 1VF9A 1Y39A 5M1NA 1WZ2A 2MW8A 1MD0A 5CLSA 1JJ2M 4E1JA 3U8XA 3JSOA 3SJHA 3HZ6A 3MN5A 2PMZN 4EGZA 2VB6A 1U5TC 1VQMN 2H6CA 4CFDA 3VQEA 3I59A 5HNHA 1RKTA 2KRHA 3VFZA 2Q1NA 2E1OA 3CHWA 1X1DA 5M1QA 5J3LA 1ZLKA 3W6KB 1OCCH 4CHNA 1IJWC 3V9XA 4C8KA 1T05A 3Q7CA 1X2MA 2IS4A 4Q48A 1TT5B 1Y0UA 1RBUA 1EH7A 2XO7A 5LJVA 1LKXA 2FEZA 3CUOA 4OIQF 2P1JA 2DK8A 3FXRA 4XKVA 1Z0XA 4M3RA 4RW6A 4ZDPA 3FM5A 4YFUA 2BW3B 2IGIA 4B9NA 4O6JA 4LG0A 1LWCA 4EP5A 2EV5A 2ZKZA 2H3GX 3L3UA 3NQOA 4A0ZA 2ZMEA 3QPLA 4FYDA 1L3UA 5DM6L 1DT9A 5EG0A 3QLHA 1B9NA 4I2OA 5DD4A 1PDNC 2LNBA 2Q8KA 2JWTA 3CCQI 1T7PA 2YR2A 5JHFA 4XRFA 2O8EA 2JPBA 2F5EA 2BHZA 2FRHA 1RBRA 3KEOA 4LFUA 3ECHA 5TISC 2ZC2A 1Z21A 1NGBA 1WPKA 2LH9A 3CJ1A 4B9SA 2OCEA 2OCCH 4A3DJ 2JK3A 2JUCA 3RMAA 1W0TA 2HDCA 1R58A 3QNNA 4LMYA 1U47A 2Z5UA 4IDKA 4A57A 2E71A 2DA4A 1X9MA 3OTOK 3OYEA 2BZTA 1N75A 4KREA 2KP6A 4C8MA 5AQMA 2LFBA 1RT7A 3HPGA 2QSFX 3BR6A 2EJRA 3J7AO 3GLLA 4CERA 4N76A 4W97A 1JLGA 1FJGK 1OISA 4FWQA 3WXKA 3TAFA 1U9OA 3MN7A 3HI0A 2O3FA 2QA4N 3VTIA 2FX0A 2I5JA 4C2MJ 1A35A 2R7DA 2VKEA 2XGEA 4HNUA 3CQZJ 5JS1A 2BXZA 1S3JA 3BC8A 1GOAA 4CA0A 1TYQB 2AO9A 1IBKK 1KFSA 4M42A 3C65A 4IJNA 3MQ0A 4M9ZA 1DU6A 5AQOA 4CZGA 4MLOA 1W4MA 3DXMA 1R1VA 5ILVA 2VT2A 1VQPI 1T03A 2QQAA 2XAHA 4KMFA 4FK4A 2WV1A 4RW8A 3FKJA 2IDOA 2QCOA 3ZT0A 4JHDB 3GFLA 1BM9A 3PNYA 1BCOA 1R6RA 5FJ8J 2ZJPL 1XGMA 5JFRA 4I7FA 1KAXA 4IG0A 4A2BA 2XY5A 2EIKH 4ID1A 2HBJA 1YW7A 1BISA 1X9JA 1Z26A 1XX5A 2RQQA 5F0FA 1MSFC 2XAQA 1IRXA 3K4LA 1SMTA 4NXNK 2W6LA 2BE2A 4NB5A 1P4WA 4BGDA 1XGSA 4UNOA 3GVAA 2Q2EA 4GV3A 4FWRA 2O5RA 2AXLA 1BDGA 3O9RA 4JBAA 1T2KA 1WJFA 3DEEA 4XL9A 3O3FA 3DJCA 1YLFA 3AVFA 2VWJA 2A07F 3QEIA 4DYQA 1NGDA 2A6TA 2Q97A 4DR6K 4DR2K 1XC5A 1XDSA 1VSKA 4GVMA 2X51A 1ZG1A 4KBOA 4HUFA 1BG3A 4O5BA 1V55H 1HCRA 1BIZA 1S1VA 2Q0UA 4WQ4A 2KW4A 5CQEA 4FW2A 3VQ8A 4JK7A 5HRNA 3Q0WA 4B1YB 3TO6A 3EYIA 1SFOJ 3HIFA 4A2AA 1B4AA 1T0FC 1WJAA 5FLVA 1BI3A 1DGRM 2L0KA 3H5NA 2M87A 1FX7A 2XSJC 3M6GA 1D8YA 2YNGA 5IP6A 2LKSA 2YUSA 1FBUA 2G0EA 3RKXA 5BOXA 4HUGA 4F91B 4CZIA 4NC7A 3ZSOA 5HRPA 4OMZA 2L4AA 4DTJA 1JGGA 2P5GA 2YNIA 2EFWA 4RB2C 4MTEA 4FXDA 3QDKA 1IN5A 2M9HA 3KK2A 1OKRA 3B8AX 1JKHA 2EQRA 1HPMA 3KFWX 3PFIA 4BRAA 3OIOA 4QIWN 3TSPA 1R59O 2CQNA 4CJWA 4Y7NJ 4ABZA 2HHHK 4KN7X 1T0FA 3I0RA 4ILJA 4XLEA 1WJDA 4PKHA 4JD2B 2EA2A 1ZGWA 2MLKA 4D5FA 2HHVA 3I58A 1H89C 4KICA 1EV7A 3CJRB 1JLQA 2OPPA 3HBTA 4LF9K 2HDDA 1QQCA 3TAPA 1K8AO 2TCTA 3KIOA 4IHYA 2PMHA 2HXIA 1O3SA 1N77A 5BREA 1NM1A 1GVDA 4BUPA 4FJIA 2VE9A 1ZN2A 3HVRA 4DS4A 4NCAA 3KKRA 1RT2A 3A8YA 4A62A 2Y48A 2X1DA 2CV1A 2VQFK 5IYDJ 5FKKA 2IJLA 3SYTA 2Y2ZA 3M8PA 4WXHA 2I8DA 2STWA 4YOYA 2W42A 4AH9A 1SANA 2ZE2A 4ESJA 1KC8O 2DQRA 4DTOA 2F96A 4HLYA 4I02A 3GX4X 4M3ZA 2IP2A 4L9TA 1RDWX 3DKYA 2A1RA 4EVIA 2XY8A 2ZQBA 3NEUA 2VE8A 2K3FA 4IOAF 4I99C 3NGYA 3AGKA 3MDQA 2QKKA 4OVLA 3JW4A 3GL1A 3OSGA 1OYWA 1LNWA 1XSDA 3TARA 2JT1A 4QSHA 3OS2A 3TO9A 2DO7A 5C4JJ 2QBYB 1W0UA 4X1EA 3K4MA 1ZRCA 4A5NA 4LFCK 1O13A 4DV4K 2PYJA 5AIPA 3UIQA 1Q8IA 1XCBA 5CKTA 3LL3A 1YW9A 3ZLJA 4LOCA 1VHXA 2RGVA 2BHYA 4M71A 3H0DA 1QSSA 5BRDA 1VRTA 1F1ZA 3BWGA 2WFBA 4MQ9F 1BW5A 3OYIA 3AY9A 1TAQA 5F1XA 3QFPA 4CJFA 3IHUA 1R1UA 4A12A 3EUKL 1HNWK 2V9PA 2Z1JA 5AJ3K 2RNJA 3EUHC 4BHPA 4HA8A 2O03A 2D1VA 3J80O 1OYYA 2IW5A 1B9MA 4FO0A 3VGMA 3CF2A 3LFUA 2Q3SA 3ZQFA 4AHCA 2JJ7A 1NGCA 4BGAA 1IKXA 1E0EA 5DCMB 3O3KA 1O4XA 3VA0A 3QU6A 5FLXK 1ZR2A 2ZJRF 3TWHA 3CMAI 1FOWA 4PL7A 2R7TA 3O4NA 4B9UA 1DGKN 5L3CA 4CJQA 3KK1A 1DDNA 1X3MA 1OH7A 4CHPA 1N32K 3ATUA 1S22A 3IMXA 4XLCA 4FT8A 3O9QA 5E79C 5E20A 2QWPA 1VQPN 1WOQA 3ZMSA 2P5LC 3FFIA 3M3YJ 3FZKA 1G4DA 2K4BA 1DLOA 4MEXF 3KJVA 3CLQA 4ETSA 4PGHA 4NDLA 3CJ9A 3J7AP 1N34K 4H0OA 4PJLA 2A6HF 4JRQA 3GCMA 5D5VB 3K4JA 4DSJA 4NNJA 4O55A 1B8IA 4IX7A 1TL8A 3SEZA 3TW6A 2VQCA 4YOXA 2JA5J 3SHFA 4OINF 1VSIA 4AIDA 1E4FT 2ZFUA 5HDGA 1YYVA 2MFZA 1X3WB 5IOZA 3NBPA 3NMUA 2NNNA 2XC7A 4EM2A 2IVNA 3CYMA 4RW7A 1GLCG 3AO1A 4AC0A 2DMQA 2ASOA 2V52B 4DW6A 3R3LA 3JRIA 2IXSA 2NXNB 3OBYA 3G71N 3THYA 1C0FA 1L5UA 1G15A 1P90A 1QPIA 3I53A 2W00A 4PFPA 2JVGA 4MTDA 3SZ2A 2F5FA 1X9WA 3N05A 2E2NA 4BQZA 5JICA 2QGUA 2H1LA 3AKZA 1ZELA 3MVPA 3MCPA 3COAC 4M3GA 1E3HA 5FLMJ 4MLHA 4FPBA 2UZKA 4PJNA 2RREA 1RRJA 3TAQA 1VQ9N 4GFBA 3EETA 3MX2A 3DV8A 3OJSA 3ID6A 4JK9A 4BRQA 2PQ8A 3H45C 5HS8A 2KISA 3TL4X 1MSEC 3NF6A 2BH1A 4FJXA 3MD2A 2R4GA 1FOKA 4K41A 1X4OA 1JLBA 3J7YJ 2IEKA 2DYSH 3G0ZA 5J8CA 2FOWA 3NGIA 4E3SA 2OZ6A 3WQUA 2HXOA 2XV4S 2RHKA 4IZZA 3F8MA 1HQEA 1TWHJ 3DTEA 3RZDJ 4U0YA 3BG3A 3SQNA 3KD1E 2JGUA 5EX5A 2W25A 1SL2A 3KZZA 4EIAA 3BT9A 2GIZA 2VL8A 3J80K 1HW5A 2QKLB 4CGHA 4B9QA 2RAEA 3D5LA 3VQQA 5BRHA 3QODA 2HHUA 3S93A 3AG4H 2CS3A 2DA6A 3UR3C 5CYVA 3QBXA 4F8RA 2AJQA 3C94A 1UB9A 4KHPK 4AHUA 2F4OB 5J1EA 2COBA 1X1CA 2LBFA 4RB1A 3LDOA 2K86A 3D7EO 3AG3H 4M3DA 1D9DA 2Z1IA 3OA9A 2NZTA 2NRXA 4BHCA 2JPCA 1SQKA 1XI1A 2BE5F 4GV6A 3SZGA 4OPKA 4U0WA 4LF7K 1W7AA 2JLEA 4P9FA 2XAFA 5FD6A 3I8BA 3PX0A 3UKUA 1REVA 2IA2A 3V1OA 5CE3A 2CJJA 2I7NA 3PX4A 3C6UA 3U2RA 5J47A 4RAYA 3K58A 3OYHA 2Q31A 1Y64A 3P83D 2E1NA 5BNGA 2FXUA 3DI6A 4KB0A 5I9EB 3NAUA 3IC7A 1UHMA 2DT7B 4KJZA 4B48A 5HLFA 1TL1A 1OH6A 1W97L 3LAMA 4IXAA 2BVLA 1G3TA 2DJIA 1MMSA 3L9FA 4IFVA 2V1NA 4I0BA 3JTHA 2MC3A 3K9JA 2NAZA 3AG2H 4YRVA 1D5AA 4HPQA 4FJMA 2V1UA 3KWIA 4HNVA 3H5AA 3C6TA 2STTA 3OWTA 2DBBA 2O6GE 3T0YA 4CCHA 1YS6A 2HVSA 4X62K 3A01A 5AQGA 2Y0MA 2JWLA 5HL7L 5EZGA 4CZFA 4KTQA 5AQSA 3THXB 3PQJA 1TGOA 1M90O 4B43A 3RZOJ 1R00A 2O4IA 5FPNA 4XIDA 1XQSC 3VENA 3MKYB 3BG5A 2P4WA 4B3TK 3ZSYA 4BR2A 4B9TA 3TTDA 3E1YA 1BO5O 4Z6YA 4G8XA 4XOTA 2X6YA 4BRMA 2F8TA 3ZEUB 4XMYA 4K43A 3R1XA 2V7FA 1TUYA 3FLCO 3SFIA 4KNYA 4E7LA 1YJ9I 1U49A 2E36A 1UG2A 3ASNH 1TC3C 3HL2A 4BR5A 3ZYYX 4CBXA 2AXTC 3H3VK 1JKOC 5C2DA 3I9V2 2ZD1A 1Z6RA 3B73A 4NCBA 2X9DA 1V4SA 1TK5A 2XY7A 5AQQA 2E5NA 4V19S 2DU9A 2MLGA 3HKZA 2K7LA 4J01A 3CCVI 4WF2A 4IRHA 2KRCA 3A2KA 2CU7A 2HU9A 1BA5A 2G8HA 3MN9A 3ULEB 1KAYA 3HOUJ 1K8KA 3OYJA 1FK9A 1ZYQA 3VA3A 1FSEA 2P9LB 3BG6A 2R7QA 1JHHA 2ZGZA 4M63C 3CFOA 2BXYA 4RAFA 1RCHA 1QZYA 3CETA 4V2FA 2FF6A 2W57A 4MQ3A 3P7NA 3BJAA 1RDUA 1BIAA 3FZLA 4B3XA 1JLFA 3C7JA 4BEHA 4F2SA 3ZMDA 2PY5A 2YNFA 3F73A 2ZXIA 1ZH5A 3DBHB 3CJNA 2O8DB 4H0XB 2F5VA 1IG9A 2UXCK 3FK7A 4GW6A 1UA0A 2A05A 4RAZA 2EZKA 1YO5C 1ITYA 1H9GA 1UAAA 3S1MJ 2EZLA 3M1EA 3ZQGA 4E1MA 2NVXJ 4FJJA 5GINA 2O8BB 3KP3A 3S2HJ 3K4BA 2KRFA 2VIXA 5FPEA 2P9KB 1IN8A 1YX3A 4I0AA 1UA1A 1M1EB 4FM2A 2JRMA 2FLOA 4JKGA 3ZQIA 4B44A 4CJTA 4YEJA 2LSNA 3NWTA 3W2VA 4G1QA 2VI6A 3O08A 1J5EK 2GBZA 2GUPA 3CQ8A 1K7AA 3WTWC 3KE2A 2EA4A 1B9FA 4BWMA 3KLEA 1QGPA 1XUPO 4CFCA 4E7JA 3BTCA 2LK2A 4BE2A 3X2QH 1JKPC 2LDUA 3UKGA 3BF3A 3AAQA 5AZJA 2E2QA 1J2XA 3I59B 2VONA 1APLC 2Q0RA 2HVIA 2QXFA 4LGWA 2JSPA 5GTHC 3RDIA 4HLXA 3JS6A 1TV6A 3K1PA 5BS6A 1HR0K 5CVVA 3HM9A 4XLHA 4GKJK 2HNZA 3H1CA 2M0MA 1LV5A 1BOBA 4IFEA 3PJRA 3KZIC 1JUPA 3O9SA 4A3GJ 1NKCA 4C1NI 4M3TA 4B9VA 4FJ7A 2QWQA 4OU0A 4CZLA 4FLTA 4BH9A 4PFOA 2ZJ2A 2XGDA 5A2QK 3PNVA 1VQLI 4Z0UA 2BYVE 3R60A 2XAJA 1WSFA 4BDYA 1QVUA 4IVNA 4KA4A 3AVJA 5LY3A 2R7OA 3SV4A 1U5TB 1XSVA 1HC8A 3MEXA 2OZSA 5EG0B 2XROA 1TUUA 4N5SA 1HKTA 4LF5K 3PO5A 2IVMA 4UY8O 2GUIA 3JAMK 3LP3A 2BBYA 2V7YA 2X78A 2FD5A 2WOMA 2H27A 1JTYA 4HNTA 3TKYA 5E3NA 4V19K 3Q0UA 4K25A 2YS9A 4Q5SF 2EV0A 2HBMA 1HNXK 1BOTO 4DU4A 3NH2A 1PJRA 1Q18A 1FW6A 3ZQLA 1BR2A 5H20A 4EJUA 2GEMA 1WJEA 4EATA 5H6QA 1B72B 3AO4A 2R7VA 4PUSA 2QKMB 4FL9A 2DI3A 4G7ZF 2M7BA 4CIFA 2J4RA 1D1AA 1ULYA 1J9AA 4M41A 4EJVA 5LL6Z 1WBBA 1F36A 1D8KA 2PZSA 4KB1A 1QZZA 2D5RA 2XF7A 2YHBA 1FSHA 2O8CB 4DCHA 4I76A 3J81K 3EYZA 3E6BA 1OQYA 1SFXA 1CXUA 1EO1A 1TWAJ 4OKEA 3QINA 4BRNA 2GXAA 5E1WA 1QS4A 2P9IB 4MFDA 4JKCA 1V5EA 3M8JA 1ZBHA 4PQUA 3GXOA 1OR7C 1XWLA 4JKDA 1QHTA 4R1HA 4OIOF 1OKJA 4KHUA 2VLAA 4O3MA 3ZQQA 1WBDA 1S72I 3DXMB 3CC7I 4IZ9A 3W6VA 3HYFA 5LLQA 4UHTA 4DG1A 3F2KA 3VB2A 1I1GA 3VQ6A 3B02A 4LB5A 5HODA 4C2TA 3DXJF 2YHXA 5CVRA 1HNIA 3DTKA 1L3SA 4LLLA 3H3UA 2GBYA 1PYVA 4A3JJ 2RV8A 1WSGA 2ASPA 4WX9A 3KLFA 1X58A 2YX6A 2PLYA 2Z9OA 4P1WA 5AQFA 1EF4A 4TV7A 3CCSN 4O5FA 5F0XA 5JVGF 1GOBA 3SEQA 2PBIA 2PAVA 1Q81O 4C23A 1FNNA 3VQ9A 4GDFA 1JT6A 1A6QA 2YI1A 1BUPA 3LALA 2CQKA 1X9SA 2P5VA 2VQGA 2Q2EB 4XKCA 2K9LA 4JYKA 3H08A 5M5YJ 1YJ9N 3GMEA 4BL0B 2E4LA 2HNYA 3E3VA 1KU9A 2GV9A 4C8NA 2MD5A 3T1BA 4BQOA 1IN7A 4ICLA 3I54A 3M4OJ 4IWVA 4HX7A 3P31A 4JKFA 3DPLC 2EWSA 3CCUN 3E5QA 4JI4K 2IS2A 2W48A 4DBQA 4BU2A 3F6OA 3JXUA 3T5XA 3NVKA 1BOAA 3FXKA 1GLJO 3BLYA 4KFCA 1NGGA 1RT3A 3ALYA 1P4AA 2WADA 3F8CA 1HOMA 2B0LA 1W0HA 1YXQA 3SUQA 2QWOA 1VQ6I 5F1JA 4C1NK 3M5RA 5AQYA 1LW2A 1LVAA 4DQ2A 1SS6A 4JRPA 5J2MA 1IRGA 5HOOA 3R8EA 4NYFA 4N9HA 2GA1A 3GF2A 1B92A 3QEPA 1L0OC 2F4IA 4U0VA 4M45A 3G1MA 2FQ4A 1UHWA 4ZZDA 3ONQA 2VKVA 2P7VB 3P39A 1TYQA 4XRSG 3BTJA 1XG1A 3QICA 1JXBA 4ELVA 2YX7A 1MDMB 3VEZA 3DAWA 3K5MA 2HNHA 2DK5A 1NH3A 1LEAA 3BF1A 5K7ZA 4CJKA 2ELHA 3VESA 4FJLA 4WCEL 5I3UA 3DU6A 5F2RA 3ASMA 4AIKA 3KKSA 1XHZA 4BYYA 2I7PA 1C0WA 3AA5X 2FBYA 3V81A 3AVAA 2X48A 1NU0A 3LPTA 4GYIA 4ZYAA 4BR0A 3SK3A 2OANA 4DV3K 2M7AA 2V6CA 3LA7A 3LANA 1T38A 1W1WE 5IYCJ 1IUYA 1NGIA 3F22A 3IRXA 3J7YP 3FXJA 3AVGA 4IHWA 4QS7A 1UJ8A 5K7FA 1KQSM 4CZEA 5KNLA 2R7ZJ 2EH3A 5KI6A 1XTAA 2P5OA 2W41A 4CF2A 4TSXA 3CI5A 1QVFM 5FPDA 3TAEA 2EX3A 4PJ0C 3JSMA 4E7HA 4OGEA 1NNEA 4NC8A 4IHSA 3SAFA 5JLXA 1NGFA 1FBSA 3A0BC 1JXSA 1VQ5I 2NUBA 5DS9A 2QYOA 1W7PD 1UELB 1IDZA 2HGCA 2L7KA 3AVIA 3ZMTA 4G7OF 4LC9B 2JRTA 2X0LA 2W1OA 5EYRA 3IKMA 5J2NA 3J7ZI 4IHVA 2YHWA 1QE1A 3JYTA 5GADJ 2OV7A 1Y1WJ 4WFBL 5K5QA 4DZJA 2BDPA 2W7NA 2NOJB 1R5HA 4PKIA 4UXNA 2HPMA 4II2A 5JVGL 2RDPA 3HPOA 5KAIC 1MNEA 4HZFA 4KTZA 5J1UA 5ADXA 1JT0A 1FC3A 2XRIA 3NF9A 4L3QA 3OYMA 4LD0A 3LP1A 4RGRA 1A36A 4BXXJ 2MA3A 3HEFA 2Z33A 5DMRA 3DLHA 1JLEA 3A5LC 2L02A 1YTUA 2Y75A 3EUAA 5KAFC 2VKHA 2N8GA 3KLGA 4DSLA 4P5OA 1T6DA 2DDBA 3O6WA 4CHYA 3PV8A 1RT4A 2ETJA 2Z1GA 2IVPA 3LAPA 1A6IA 2Y1IA 4YNQA 4CEZA 4NQWA 2DT5A 2Y0SA 2NRTA 2KQ2A 4JI6K 3N97A 2K02A 3M8QA 4JKHA 2V79A 1R49A 2BY3A 2EILH 2AQEA 5EF6A 3SNNA 1X2NA 1XS9A 4DSKA 4PGGA 4NXMK 1NOYA 2RF2A 3ZGKA 2A1SA 1YI2I 1ZK8A 2BOLA 1G2HA 2E1CA 4J8FA 4H5RA 4DR7K 2ZBKA 1QVGM 4K8ZA 3VEXA 3Q0VA 1VQ8I 4V2GA 1HBXG 3WGIA 2VJJA 2ZM6K 2IBDA 1SKSA 4JI2K 4FZYA 1S72N 2FE3A 1OVQA 5EVZA 1ZBSA 3VERA 3ASOH 2H1KA 3AGRA 3TU5A 5L3BA 5LHGA 3HOSA 3VMFB 1YJNI 4LJZF 4CH7A 2GWRA 2GWJA 3TABA 1BL3A 4FJNA 3KCCA 3SZPA 3QP6A 4MNUA 3HM5A 3T1YK 3DFGA 5C2FA 1X19A 3MCAB 3BR3A 2QBYA 2QW9A 1RDDA 1MBEA 1QZEA 1D0YA 2GTDA 5J2QA 2YKMA 2F5CA 1FWZA 1UMQA 5IP9J 2XY6A 2LY2A 4EZ6A 3EQLF 3A5NC 4OJRA 3BPXA 4KISA 5LFAA 1A5VA 1YG2A 4JK1X 5KRSA 3F72A 5AONA 2D1HA 3S15J 3L2CA 2Y31A 1IV0A 3WU1B 5K14A 1HJOA 2E6MA 5M5XJ 2IAJA 4IXCA 2DDAA 1YHQI 1OH5A 4CHOA 3MK6A 3V7RA 3IAM2 1NK7A 2DFIA 2MBFA 4DV5K 3SMPA 1UG0A 1OFCX 1MU2A 2OPRA 4LFAK 1W5TA 3HTSB 1KTQA 3AVHA 1XD7A 3F8NA 4AILC 5GAHP 4QPOA 5C0YA 4DBRA 4GXOA 3FMRA 4RGXA 3K4CA 1NJWA 1SD7A 3CC4I 4D9JA 4A69C 3HTUA 3IKTA 5TRDA 2O8FB 3R9PA 2ASMA 4I9LA 5E84A 3CZ6A 3VEPA 4YOTA 3BR2A 1ATNA 4BC5A 3HXMA 3LA3A 4O0JA 1RC9A 4RMNA 2XPVA 4KUMA 1RESA 1JUMA 2VQLA 3QU3A 2R5YA 1ZG5A 1DPRA 3AARA 4IFYA 1TQMA 4A59A 1AKHB 2XUBA 1Z91A 4E7KA 2G8FA 1V54H 5LEKA 3FMQA 3WTYC 5EGOB 2HKOA 2WWYA 3L4IA 5ED4A 5F0HA 3KZBA 3CERA 4ZZLA 2LKPA 3M8SA 1VQ7I 1GXPA 2LREA 3U4LA 1GLFO 2VOOA 2DA3A 3SLCA 2HF3A 1HNVA 3CCRN 3BQYA 5TKYA 4IHTA 3IAS2 1STZA 1QQMA 4JI8K 2EB7A 3KLIA 2L3DA 1KXPA 3D45A 3SJJA 2YSRA 3WGGA 4BDZA 2LBFB 3R0JA 3HC7A 2IAIA 2X6NA 3RKQA 2B63J 5J4VA 1SAUA 3WE3A 3M9AA 2A5XA 1C0TA 4CGJA 5CVUA 3OYAA 1SUQA 3DQVC 1A04A 4MLEA 3O4WA 2FJ1A 2E7XA 2QTDA 3GZ5A 1E2XA 1CF7B 2FU4A 2GQQA 3CTAA 4BACA 4LIVA 4NLCA 4FK0A 3UKUB 1RNLA 3HRUA 1FP1D 2RN7A 1VQMI 1VQ5N 3LMMA 2DMNA 3DRRA 1U9NA 2PJRB 3K2ZA 1JCEA 2ELKA 5M3MJ 2W40A 4N9IA 5DV5A 3TSQA 3ISPA 3RIRA 1FPQA 5JR3A 1MKMA 4OOIA 3VF6A 3K1NA 2P7CB 1JCFA 3E66A 2KKOA 4E4HA 3VQCA 5FKMA 3JRDA 1T08B 5AFUH 1JLAA 2XVCA 4RLFA 2FXAA 2DT6A 2PFBA 2H09A 4BQAA 3CO6C 2VODA 4A3FJ 3KETA 1BR1A 3NWSA 5K5RA 1T3VA 4PJJA 2RKHA 2HHXA 3A01B 4CXFA 2VXZA 2K27A 5BPNA 3S2WA 1NK0A 3WT0A 1TKXA 2XAUA 5AQRA 2HMIA 5J1YA 5GAGP 5B66C 5H2FC 1K73O 5KHDA 1GLLO 3BDPA 3CJBA 3R61A 2ZJQF 3F0CA 2I10A 4H0EA 1U6ZA 4XN0A 4PL8A 3PNTA 1VSMA 5EEAA 3G10A 1Q1VA 5IPAA 1WH5A 4YIFA 2ZXWH 2W6KA 3E1SA 3BOQA 3U6FA 5C42A 1RFQA 2JWKA 3NHGA 1QSYA 3VQPA 1ZGAA 1TK8A 1Y8RB 1O1WA 1N5YA 4C8OA 1NWKA 4AVPA 5I42A 2P6TA 3BJOA 3ABKH 1C0MA 2VJIA 4B1XB 1ZG3A 1VQ8N 2EPFA 3LZIA 2WB1N 1P6RA 3O2PE 1F9NA 1C0GA 4Z4IA 2YKNA 4DTUA 3JREA 3LSKA 4BGBA 3ZSWA 2DFFA 4CCLA 1LQ1A 4NYNA 1RR7A 2LY1A 1CZ9A 3LL7A 3WNGA 5EEHA 3CMYA 4BEHB 1IZ1A 2A61A 2FSJA 4AF1A 2ELJA 2VG6A 3CCMN 4KRFA 3DWLE 4Z94A 1TNSA 5CQGA 3CXCM 3ZSRA 3MXMA 3FXLA 1RZ4A 4KHYA 2DMTA 3RMCA 1WJBA 3S3NA 3NF8A 1BJZA 2R92J 4XH1A 4XSXF 4B1ZA 4XLNF 4CEEA 1Y8QB 3GZNB 2G9WA 2DFEA 3FF5A 4CYCB 2JA7J 4BR4A 1QHGA 4Z4HA 1UZCA 3E6CC 1RTHA 3QERA 3EKSA 2F5DA 3W2WA 4WYBA 1GHCA 1XMOK 1JJ6C 4H8KA 4FVMA 4LK1F 4CEAA 2EIJH 5DM7F 1MDUB 1YE9A 3ZSQA 4CFAA 2LTPA 2HZDA 4CHQA 3H9GA 4BE0A 3E01A 3G1OA 4KH6A 5AZJB 5IT9Z 3E6MA 3C7NA 1S5LC 1G3SA 3P9CA 2J5PA 3ZEUA 4GO1A 5IOYA 5CY4A 2HYGD 1HQUA 1KA8A 3SBTA 1R22A 4IEIA 3AA4A 3MEEA 2KFZA 1VSHA 1B9DA 1NJXA 5AZIA 4XICA 3GTLJ 1HJRA 5EJCA 3ZETB 5HS9A 1OMIA 4K2EA 3ENOA 4H0VB 2NS7A 2M8GX 5KPTA 4JX5A 2J5OA 4XORA 3TP0A 3VSLA 3ULEA 3U9GA 3EYYA 4HV6A 3CUQB 4GCVA 1CLQA 2P9LA 2HF4A 4G6DA 4AYBN 3LSRA 3AVBA 1P7JA 1LFPA 3BEXA 2QWWA 2ZWHA 3V8LA 3JRFA 3DLGA 1NJZA 4FWSA 3WNEA 1P7IA 1RR8C 4HV5A 1YVNA 2KZMA 4DZPA 3AAFA 3K9TA 2ZJQL 2O8DA 1D1CA 2ME0A 3DXKB 2KFDA 3D0PA 1VQ7N 1C6VA 1HUXA 1N25A 5DUKA 4FWOA 2MD0A 2D0AA 3ZOBA 4JI0K 3DBRB 1DUXC 2WY7Q 2XHBA 2WAFA 5LBQA 1XPXA 1GLAG 1WKMA 4ON0A 3SDBA 4BC2A 1HNZK 1FP2A 3L2RA 3F8BA 5HLTA 3HKZN 1TQPA 3LSHA 1N78A 5GADP 3CM6A 1VI0A 3RJPA 1WFXA 1RTIA 1ETQA 1HYSA 4JP0A 2B4JA 5CJ9A 1D3YA 3M8FA 4B1WB 2YU3A 2PN6A 1KRPA 2OTJN 5SWMA 1YUWA 1KFDA 5MLCQ 2XSDC 2OBPA 1KQ9A 3KZYA 4PZJA 4ZYEA 4H03B 3K59A 2UXXA 4KN4X 2Z99A 2MH2A 4RB0A 4DR4K 4EZ9A 4M3FA 1QQOA 3DLKA 4HUEA 1VSFA 1DGWY 3RTVA 2JMWA 3GUDA 1YRNA 4U87A 5E1ZB 2EBIA 5KPZA 4G6QA 2VT3A 2KIFA 2UYTA 5HDNA 5JI6A 3QOEA 1T39A 3GOIA 4WE1A 5BR9A 3RKYA 2QM1A 4C3HJ 1EH8A 3BY6A 3CCJN 3MX5A 3I55N 3HL8A 2BY2A 4LLGF 3E9LA 2EWNA 1J75A 2H6BA 4C3JJ 1NMDA 2FBXA 2E2IJ 1MBHA 5FGMA 1BCMA 4DQPA 1U5TA 3M3ZA 1IW7F 4BY9C 2FSNA 5BPDA 1IH7A 1X3UA 3TP3A 5DM7L 3L6QA 3HOTA 3FWEA 2ITGA 5BN9A 2NRWA 3MWMA 3HSEA 2XGXA 2DPUA 3MEGA 3KLHA 3KWGA 2DOFA 3M7GA 1YTYA 2XIGA 2IGOA 1TP4A 1NK5A 1RTJA 1JGSA 1MH4A 1S3XA 2P9SB 2DCEA 1RIOH 4HW0A 1B72A 1BA0A 4X65K 4LD5A 1EP4A 4X66K 4W5NA 3V8JA 4CICA 1FBQA 4QS9A 2CW7A 2Y1JA 2C6YA 3NGZA 2BTFA 3QQAA 1BGXT 1Z7LA 1MW7A 2FBHA 2O8CA 3B6CA 2Y30A 1HSJA 3CCYA 4HF2A 3S16J 2V7ZA 3CCEN 3HOWJ 4DNCA 4E6KG 3CP8A 1KU2A 2P9IA 4IDHA 4BJ6C 1KD1O 3MZ8A 3RR8A 3QP5A 4XH4A 2VBYA 2Q2RA 4BAYA 4CCKA 1W36C 4CEDA 5IP7J 1V4TA 3G25A 3VGKA 1HRHA 2LMDA 2V51B 4XN3A 5F6FA 2V26A 2F48A 2KIUA 3C18A 4UUTA 4C30A 3RSEA 3FZVA 2P51A 3QAHA 3CG7A 4H0TB 2GOXB 4HCCA 1J59A 4WXCA 2DN0A 3FISA 3VGLA 2NVYJ 1D4XA 3HSTB 2CGKA 5AQNA 1OCTC 3MZYA 2E2OA 5C24A 4DR3K 4CCNA 2OTLI 4S0HB 3H9JA 4QCLA 2VJ5A 5FKLA 1U3EM 1TWGJ 1B1BA 4RCHA 2Q0OA 4A5MA 5C44J 2E7WA 3HJEA 1T98A 1HLVA 2DA1A 1TW2A 4IBNA 2E5ZA 4ZYDA 3GE1A 4DIQA 4CDGA 5LJWA 2BY0A 2B5JA 4D0PA 3CPEA 1MWMA 2KLAA 1W9HA 2F6CA 4AM6A 4DFPA 4ENNA 2FMLA
chains in the Genus database with same CATH topology
1BI4A 5J2NA 3TAFA 2X6NA 3RMDA 1LW0A 3DLEA 5KGXA 4XIUA 3K58A 4JLHA 3AVBA 5SZTA 3OYHA 1LAVA 1S1WA 1C0TA 1QE1A 2BANA 1QSSA 4KI4A 4CGJA 3JYTA 3P83D 1VRTA 3ISNC 1TKDA 1KSPA 3OYAA 3DOKA 1A5XA 3AO4A 3HJFA 3T19A 4QAGA 2BDPA 3DI6A 4DF4A 1SUQA 1S6QA 2I5JA 4KB0A 4CJUA 3HPHA 3TI0A 3NCIA 3F9KA 4Q0BA 1C1AA 3DLGA 1NJZA 2VG5A 3OYIA 1J5OA 3NH0A 4CIFA 3WNEA