2DFFA

Crystal structure of tk-rnase hii(1-204)-c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKITQDMIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 59
structure length 210
sequence length 210
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dffA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dffA01
4W5QA 4I9LA 4DTRA 3NF7A 4CE9A 1SL1A 2PYJA 1IKYA 1LW0A 1GOBA 1Y97A 3K2PA 4FJHA 1DLOA 3G0ZA 4QOZB 2OYQA 2VWJA 3LDSA 2OA8A 2I5JA 3RR8A 1SL2A 4KB0A 2FC0A 3PUFA 1TL3A 2D0BA 3VN5A 4Z4IA 1XI1A 1BL3A 5HRPA 4FLYA 4FLVA 3FFIA 1JLBA 3CFOA 3MEEA 1C1BA 2WOMA 4H8KA 3HPOA 3K58A 5HROA 3DI6A 3O4QA 4GVMA 1KLMA 4CHOA 4LH5A 3LANA 4CK2A 3L3UA 4N56A 2YHAA 3DOLA 4FJ8A 4M3ZA 5CZ1A 1RBSA 4CHYA 1BCMA 4GW6A 4CEDA 1NK0A 2VG6A 4B3OA 1TAUA 5E41A 4FJXA 4KV8A 5J2PA 1SV5A 4Q0BA 4FZYA 4NYNA 4KI4A 3OYEA 4F8RA 1RDCA 2EX3A 1TKTA 3AV9A 4MFBA 4DU1A 2X78A 2VG5A 5I3UA 1L3SA 2DFHA 3NHGA 4W5NA 3VQQA 4BWMA 3KK1A 4E0DA 2YNIA 4RW8A 1F21A 2XY8A 4KFBA 3TABA 2ATQA 3VQEA 1BISA 4M42A 4KRFA 4LSLA 1NJZA 3LPTA 1TGOA 4FLWA 4N5SA 1RTDA 4KHQA 4M3WA 3UIQA 4OLBA 3DMJA 5FRNA 4Z0UA 3HO1A 5CYMA 2YHBA 1D5AA 3RR7A 1S9GA 2IC3A 2ZQBA 1L3UA 4F3TA 4OKEA 1C6VA 2GBZA 4IBNA 4CJ5A 3PO4A 2HHTA 2RPIA 4FM1A 4DTOA 4HVJA 4KHNA 4M3XA 4PWDA 3HM9A 4CJ3A 1VSMA 1RILA 1VSFA 4KKOA 3O3HA 4CFDA 1CZ9A 3CG7A 1N6QA 5J2MA 3G10A 1KTQA 3VQBA 1JL2A 3V9ZA 3MEGA 1WN7A 3AA4A 4FK4A 3TANA 1NOZA 4CJ4A 4BE2A 4C8OA 4J2BA 1VRTA 2JLEA 3VQ9A 3HSTB 4RW7A 4N41A 1HQUA 3RMBA 3RMAA 1BHLA 1RT5A 3M8PA 3C95A 4DF4A 3NDKA 2DTUA 3AVGA 3ULDA 3U6FA 1RTIA 3V9WA 3MXIA 1U45A 1DTQA 1I39A 3NFAA 1JKHA 3U3GA 4Z4CA 1C0MA 5KRTA 4F4KA 3LP3A 4CF2A 1BQNA 1TAQA 4CJRA 3AO4A 3KLFA 1SKWA 1KFSA 2G8UA 2OPPA 1J5OA 4O44A 2PZSA 3SV3A 4J2EA 1Q8IA 4KREA 1UA0A 4OPKA 1EKEA 5I42A 4CEBA 3KK2A 3QNNA 4W5RA 3V9UA 3V9SA 3H08A 2OPSA 2LSNA 4E7JA 2YKNA 4DSEA 4FZXC 1CXQA 4PA1A 3K57A 2O4IA 1KVBA 1SUQA 2Y1IA 3QIOA 5SWMA 4AILC 5CZ2A 1FKPA 2OPRA 2ZE2A 3MEDA 4I9QA 4ELTA 1Z25A 4KO0A 4CK1A 4E3SA 4B9MA 2P5GA 4CCHA 4CFCA 4CJFA 1XHXA 3MXMA 3DLHA 4DSLA 2E6MA 3TR8A 5KRSA 2Y1JA 5KGWA 3RRHA 3ZCMA 3ZSYA 2F96A 4FJ7A 4M3RA 1RT7A 2Z1IA 3M8RA 4CJPA 3K5LA 3TAFA 3LP0A 3DRPA 1JLQA 4WE1A 1RBRA 4RW9A 3VA0A 4BE0A 3OS2A 1S1VA 1WNSA 3L2RA 3IRXA 1IO2A 1DTTA 4FVMA 1U49A 3NGZA 3I0SA 4HCCA 1RTJA 3AVCA 3ZT1A 3E01A 2D0CA 3D0PA 5HP1A 2VG7A 1B92A 2G8FA 4F3OA 3SUNA 1R0AA 4DFJA 1UOCA 4B8AB 2OZSA 4O4GA 4CF0A 1RT4A 3K5NA 1I3AA 3TAPA 4ZTJA 1ZBHA 3NH2A 1L3VA 4I2QA 4IDKA 2KFZA 2XHBA 4CJLA 1S9EA 3HPGA 2GV9A 3CFRA 2W42A 3IS9A 3P1GA 4FK0A 3LWMA 4DSKA 3VQDA 3HL8A 4CEZA 1XHZA 4EZ9A 2YNFA 3OYHA 3SQ1A 5HRNA 1ZYQA 4M3YA 4CJTA 1VSDA 4RG8A 2HHQA 1NKBA 3P83D 1RT6A 3OJSA 3ALYA 1L3TA 4IKFA 2IDOA 1RTHA 2YKMA 4M3UA 3WNFA 4DTUA 4ELUA 1FK9A 3B6OA 4I2PA 1A5XA 4BE1A 1EP4A 3ZT4A 3AVIA 5HLFA 1X9SA 3DOKA 3HVTA 3IG1A 1QE1A 1NJXA 4DSJA 2QK9A 1BIZA 4OKKA 1QS4A 4DQIA 1HMVA 4G1QA 3MECA 4CHPA 2QKKA 1YTAA 1XC9A 1J54A 4Q5VA 4QCLA 2KZZA 4JRPA 4DU4A 1U48A 3NF6A 4L8RB 1MU2A 3V1OA 3CFPA 2IS3A 3ITHA 4FLUA 3SPYA 4C8NA 2HMIA 4KTQA 4YNQA 3VA3A 3ZT3A 1WSJA 4UQGA 1UAXA 3NBPA 2ITGA 3ASMA 4H4OA 3ISNC 3PX0A 4BDZA 4CESA 1SKRA 1CXUA 1QSYA 3QEIA 3M8QA 4CJSA 1C0UA 3AVKA 3PY8A 4IG3A 3F73A 3TAQA 1TVRA 3I0RA 4DTMA 3KD1E 4LH4A 2BGGA 3AVMA 3HYFA 2P1JA 3BGRA 4O55A 1RBUA 4OLAA 1SKSA 3OYMA 4FCYA 3VQ5A 3KLEA 1FXXA 5JS2A 4KHYA 4CJWA 3AO1A 1J53A 3F9KA 3DLKA 3NGYA 1BCOA 3DRRA 1NK5A 4FJNA 3WNEA 4EP4A 4DTSA 5FROA 4CJKA 3LWLA 3O3FA 3SQ0A 3LZJA 4Z4HA 1HYVA 1A5WA 5HRRA 4CF1A 1NK6A 4CGFA 4IG0A 1A5VA 1RDAA 1RBVA 5DK5A 3JYTA 1NOYA 3AO2A 4CGIA 2JGUA 3CYMA 4F2SA 5EU7A 3VQ8A 3TARA 4AHTA 3V6DA 1KSPA 1QHTA 1BIUA 4FZZA 3NH0A 5D3GA 4B9LA 4DTJA 2VWKA 2D0AA 2HB5A 3B6PA 1IH7A 4DTPA 3O4NA 3AO5A 4DFMA 1LWCA 5C42A 4B9TA 2YNHA 3M8SA 2EHGA 4KPYA 3L2VA 1X9WA 1RT1A 2HHWA 1C1AA 2X6SA 1NJYA 3RRGA 5C25A 4NYFA 3ZSWA 4CHQA 1HQEA 4E1MA 4HHTA 3A2FA 2FBVA 1HYSA 3PX4A 5FRMA 2E6LA 1LW2A 1U4BA 1WSEA 3OJUA 3QNOA 1D9DA 4E7IA 4CF8A 3KK3A 1YTUA 1IKXA 1KCFA 4O0JA 5SZTA 3HVRA 3ZT2A 4O0IA 3OYGA 4DWIA 1LAWA 1TV6A 3QINA 4C8KA 4ZTFA 1RBTA 4DQSA 4FXDA 3VQPA 1JLEA 1RT2A 1VRUA 1WSGA 1T03A 4E7HA 3KLIA 4MQ3A 1RDBA 3HP6A 4CHZA 3V1QA 1QQCA 1RCHA 2F8TA 4PY5A 4LD0A 1HRHA 2X6NA 3QETA 1JLFA 3SCXA 1S6QA 3L2QA 4HTUA 1NJWA 4IFVA 3OVNA 1BQMA 3ZSQA 2XY5A 3O3GA 4FJMA 2XY6A 4C8LA 4M41A 3HK2A 1LAVA 1LWEA 4AHCA 1VSIA 1TK0A 3V81A 4KI6A 3OS1A 4W5TA 2XO7A 1T7PA 3HJFA 4KTWA 4Z4FA 5HBMA 2YV0X 2ETJA 4OGCA 1KVCA 2PY5A 3LAMA 4B9SA 1KLNA 2B4JA 4OJRA 2FBTA 4LY7A 2AJQA 1TL1A 1ASVA 1S1TA 3K5OA 3WNHA 4CIFA 3EY1A 4AHUA 4FJJA 4FK2A 4KB1A 4RW4A 2HHSA 3QERA 4Y1DA 3AA2A 2BANA 3S9HA 3SNNA 3IAYA 4F2RA 1J9AA 4EZ6A 3D45A 4BDYA 4CIGA 2R7YA 2HVHA 1C0TA 5FDLA 1ASWA 3TAMA 4DF8A 2HW3A 4O5BA 4RW6A 4FW1A 4FYDA 3SUPA 3VQ4A 3V1RA 4NCAA 4KHUA 4M45A 2P5OA 1KVAA 4FJKA 1JXBA 1HJRA 4CEEA 1HYZA 1N5YA 3DLGA 1RNHA 4N47A 4CJUA 3K59A 3AVBA 3VQAA 1HNVA 3THVA 4DTXA 4DQPA 4Z4GA 2HHUA 4FLXA 3KKRA 4DLGA 3U3YA 3T19A 1ZBLA 4TSXA 4J2DA 3OY9A 5J2QA 3QESA 4E89A 4CHNA 3OYIA 3OYDA 3MXJA 4JRQA 4M3TA 1X9MA 1QSLA 3C6TA 1LV5A 3ZSZA 2IAJA 3CM5A 3HXMA 4DS4A 3SUOA 4FJ9A 3QLHA 3KLHA 1KRPA 2HHXA 2KZMA 3KIOA 1T05A 3ZSOA 2X74A 2BE2A 4CJVA 3LALA 3K5MA 1VSKA 3TAEA 1U47A 4AHVA 4DS5A 4B9VA 1NKEA 4BDPA 3SV4A 3AVLA 4FW2A 3TI0A 1WSIA 1GOAA 3KLGA 3SZ2A 3VQCA 3HP9A 3AVHA 4FJ5A 3HPHA 4CGJA 5KGXA 2P51A 4CEAA 1D8YA 4N76A 1IKVA 2FBXA 2ZD1A 2KQ2A 3AVFA 2GUIA 4AH9A 4CJEA 3V4IA 3TAGA 2E4LA 4W5OA 2RN2A 3ZT0A 1K6YA 1JLCA 4CIEA 1IG9A 1BI4A 1ZBUA 1VSHA 4DFPA 3AVJA 3PO5A 2FBYA 3LAKA 4FJLA 2XRIA 4J2AA 3ZSRA 1TKXA 1WLJA 1Z26A 3NH1A 3DLBA 4C8MA 1ASUA 3KKSA 3RMDA 3SI6A 2HNYA 1YVUA 5JS1A 3SUQA 3QIPA 1WSFA 3QEWA 2IOCA 1NK7A 1NK8A 2IGIA 4JS5A 4XIUA 3CM6A 3S3OA 1S5JA 5CYQA 1TKDA 4CERA 4ELVA 1U04A 2A1RA 4FLTA 4ID5A 2Z1HA 3NF8A 4JLHA 4YFUA 1Q9YA 1B9DA 4NCBA 5C24A 3AVNA 5J1EA 3PX6A 4QAGA 4E7LA 4DQQA 3KD5E 4OKJA 3S3NA 3QEVA 3OYKA 1L5UA 1QSSA 3P5JA 2QXFA 3NF9A 1RT3A 3OYAA 3KTQA 2BDPA 2KW4A 1JLAA 1WAFA 3RMCA 3C94A 4PUOA 2PYLA 4CEOA 1B9FA 4H4MA 1G15A 4JS4A 4R5PA 4DTNA 4BWJA 1KFDA 4CJQA 1ITGA 3L2WA 1YT3A 1W9HA 1UWBA 4FLZA 1WAJA 3NGIA 3AO3A 4DQRA 4B9NA 3WNGA 1BGXT 1C1CA 1VSLA 1W0HA 3DRSA 5J2NA 1WSHA 4DG1A 2RF2A 3SJJA 3VQ7A 2G8VA 3OYFA 3SQ4A 4EP5A 2RKIA 1IKWA 3S3MA 1TK5A 3LP1A 3EZ5A 3SYZA 3QEPA 1ZBFA 2B5JA 2O4GA 3L3VA 1Q9XA 2G8WA 1S1UA 3DM2A 1VSEA 3OYCA 1TKZA 3L8BA 4KTZA 4CGGA 4K8XA 3CQ8A 1RDDA 4NCGA 2A1SA 3JSMA 4B08A 2KFNA 4DMNA 1JLGA 2HNZA 2HNDA 2Z1GA 3VQ6A 4B8CA 4CGHA 3LP2A 3NE6A 1NK4A 4PQUA 2DFFA 3OYJA 1HPZA 1T8EA 1NK9A 4HUFA 1EXQA 4I7FA 4FJIA 4CFAA 2B6AA 4FM2A 2OZMA 1S1XA 4OPJA 4DSFA 3T3FA 3RWUA 4E19A 3ZSXA 1HNIA 1VK0A 4ZHRA 2NUBA 4FM0A 2DY4A 1JL1A 1D9FA 2G8IA 2Z1JA 3T1AA 4GMJB 4Z4EA 3QO9A 4KHWA 3AA5X 4AHSA 3SPZA 5KTQA 4KHSA 1ZBIA 4OGEA 4CK3A 4HCBA 3L2UA 4CGDA 4FJGA 2HHVA 5CY4A 3DLRA 3DYAA 4AHRA 2YNGA 1S6PA 2DFEA 3QEXA 1TK8A 5HRSA 4LSNA 2KTQA 3EYZA 1REVA 3PV8A 1GOCA 2QKBA 4DSIA 5KI6A 1EETA 5K14A 4HUGA 4CEFA 4B9UA 3NCIA 3I8DA 3HT3A 1CZBA 1BI4B 4OVLA 4Y1CA 1UA1A 4K8ZA 3C6UA 2F8SA 1VSJA 4CEQA 3AA3A 3MAQA 4CFBA 3SQ2A 3BDPA 1O1WA 3LPUA 5T7BA 3OS0A 1JXEA 3KJVA 2Q3SA 3OYNA 3ZSVA 4ID1A 1LWFA 3LZIA 4E7KA 4DU3A 4DFKA 4IFYA 3NAEA 1X1PA 4CECA 4KAZA 4DLEA 3TWHA 1CLQA 4CF9A 2G8HA 1EX4A 2WONA 2G8KA 1FKOA 2OPQA 3RTVA 2HVIA 3DLEA 3V9XA 2XY7A 1NKCA 1QTMA 2D5RA 3AVAA 3OYBA 3OYLA 5DMRA 4BACA 4ICLA 4E1NA 4HUEA 1S1WA 1XWLA 1SL0A
chains in the Genus database with same CATH superfamily
4W5QA 4CE9A 4H0PA 2AXLA 2HVRA 4CZLA 2E5LK 4FETA 1GOBA 3O5BA 1DLOA 1SZ2A 4PL7A 5F0FA 4IOXA 2VWJA 2NRXA 1AU7A 3DWLA 3H3VK 2E35A 4JAXA 4YHHK 2EFQA 2W24A 4HOBA 2K85A 1YG2A 3WGHA 4FPAA 3VOVA 3VN5A 2NAZA 2W6LA 4M3EA 1MIJA 2HOSA 4FLVA 3CIPA 3FFIA 4H8KA 2GXAA 5FGMA 3IAS2 1ITYA 3F0CA 3D5SC 2PFBA 2Y0MA 3G6EI 4GGGA 3RSNA 4CK2A 3CJNA 3WXLA 4CCOA 1TP4A 4CHYA 4R8HA 4GW6A 4AIDA 4B3TK 5CQEA 4DYCA 3MN9A 4CEDA 1NK0A 2GA1A 4FJXA 4KV8A 3G4SI 1WB9A 4NXNK 2EIJH 4FZYA 4IRHA 4KI4A 3OYEA 1OQYA 3WXJA 4F8RA 2E71A 4IEJA 3K69A 2EX3A 3BJ6A 4GYGA 3ZETA 4CGZA 5FLVA 3AV9A 4MFBA 4DU1A 1MWKA 5E3NA 3BTIA 3ZQGA 2X78A 4BWMA 3M6GA 1SAZA 2VN2A 3S16J 1HC8A 1F21A 2IGOA 2VJ5A 3DTKA 3ZN0A 1W5TA 4ENNA 1TC3C 1BISA 3IFRA 5BRDA 3ISPA 3LPTA 4IO9L 1X19A 3SZTA 5EY4A 1EO1A 1VQLI 3WXIA 1O57A 3VFZA 3C1DA 2Q2RA 3M1FA 5FRNA 4OLBA 3OTOK 3CMYA 3M4OJ 2DOAA 1GLCG 2CQQA 2YHBA 1S9GA 1EV7A 1YAGA 3ZOBA 4WK8F 4CW7B 4K42A 4F3TA 3L00A 1C6VA 4F55A 3PO4A 5HDGA 2O8BB 4FM1A 4C3JJ 3ZR8X 1K8KB 4KHNA 2BHYA 4HX8A 3CD6I 5EVZA 3SDBA 2WUSA 3SXYA 1RILA 4XRFA 2QEXN 1QVFM 3A5NC 3ZQLA 3NEUA 1XSVA 2GBYA 3G10A 5ILVA 2QWPA 4ISEA 1U3EM 1RC9A 2VGMA 3MEGA 1VQPN 1WN7A 3S2DJ 1T6CA 2Y2ZA 1NOZA 1NMNA 4BE2A 1MD0A 2HVSA 2PI0A 3H46O 4CJ4A 1W7PB 4KMUX 3TP0A 5H6QA 4DV7K 5CJ9A 4ABZA 2KQRA 1XMQK 4N41A 2AXTC 4AC0A 4IHYA 3E66A 3RMBA 1YX5A 3OW2M 1W4MA 2DTUA 3ULDA 4CICA 3U6FA 3HRTA 2WBNA 3PQJA 5JLHA 5E17F 3N4QA 2M7BA 3DLHA 3LP3A 5CE3A 4HLYA 1ZAOA 1QVTA 1BQNA 2D0PA 2DYRH 4CF2A 3H5RA 1MW7A 2KLAA 4EJWA 4G7ZF 3FM5A 2OZUA 4ZDPA 3WG7H 1JCFA 2RE2A 4HBLA 4HDUA 2H3GX 3C2GA 1GLAG 3V9SA 3DLAA 4DJAA 2VJIA 2BW3A 2OPSA 1HA8A 5AQSA 4BRLA 3LFUA 1IN8A 1KVBA 1SUQA 1ZKGA 2AHQA 3T5XA 3CCRI 3QIOA 3J7AO 2Y1IA 3Q0UA 5FKNA 2ZE2A 1U6GA 4FWSA 1CF7A 2QTDA 2KRCA 4AIHA 4KO0A 2P5GA 4KFCA 2FSNA 4HX7A 1S8NA 4DQ2A 1JHHA 1TQMA 3TR8A 2Y1JA 1Z67A 3JRIA 4A69C 3CO6C 2CQ7A 2M3AA 1IN5A 2JPCA 2JTVA 3MCZA 2IW5A 1O3QA 5FFZA 3S1QJ 1HSJA 1RT7A 2Z1IA 2GOMA 1OCOH 3K5LA 3DRPA 3GFIA 4XM3A 4WE1A 3I4NJ 2YS9A 3WTWC 2B0LA 2K27A 1FSHA 1SVOA 3FDYA 2UXXA 5DD4A 5GADP 2GIZA 2NOGA 3CJQB 5JVGL 3OA9A 3SAHA 1ETQA 1PJRA 4YIFA 4V2FA 4HCCA 5DUIA 1YE9A 3BROA 3CDIA 2G7HA 2G8FA 3MDQA 1R0AA 1FWZA 5D4RA 1YRNB 3QICA 2ZJPL 3TAPA 1HDPA 5JHFA 4L18B 3K5NA 4DBQA 4BQQA 4PUOA 2W48A 2A40A 3CF5L 1LFBA 5KCMA 2P6TA 2M7AA 3MKZA 2FBHA 3KP3A 2LDUA 3LSIA 2W6KA 3IDHA 1BL0A 4JKBA 2OQRA 3HPGA 1R22A 2PX9A 3HZJA 4QTRA 4B9QA 1HBXG 1W1WE 1O4XA 3LWMA 4DSKA 2P9UA 5M5XJ 4CEZA 3OYHA 4U7BA 4LOCA 4MEXF 1JTXA 2G0EA 2P5KA 2NVXJ 4JKAA 4N4OB 1HJOA 3M8FA 4M71A 4M6VA 3ALYA 1YJNN 3SBGA 2P9LA 3B6OA 3K2ZA 2DTZA 1EP4A 5B8HA 1N36K 3HEFA 2XIGA 4EGYA 3CP8A 3DOKA 3HVTA 3IG1A 1NJXA 3WEEB 4L5IA 4O5VA 3W2VA 1HMVA 1X2MA 5JR3A 2FLOA 1EF4A 3GLLA 2DTRA 4CHPA 1XC9A 2XV4S 3R1XA 4JRPA 1U48A 3O8HA 3K6GA 1G8XA 1KAZA 3FXOA 3V1OA 1JJ2M 3FK7A 1OYWA 4AYBN 2HDDA 3VA3A 3QP5A 2CSOA 5KNLA 5BR9A 5KPTA 3ISNC 3REOA 1Z7LA 3OIOA 1MBHA 2XAFA 2O3FA 3W3CA 2XF6A 4ETSA 1TL8A 1SAXA 1CXUA 3EKSA 3M8QA 2VBWA 3CCUI 2ZBKA 4CJSA 3F73A 2AA4A 3CJ9A 4UUTA 3LDQA 5D5WB 3I0RA 3TAQA 4PKIA 3GG4A 2OANA 3IRRA 2DMTA 2IEKA 3GBGA 1M90O 2QZ8A 4HF0A 3HYFA 2Z16A 3FXJA 4M63C 3ZQHA 3S8PA 1YITN 2BXYA 3RQ4A 4KHYA 2E7XA 4LFUA 1LNWA 1Y8RB 3FXQA 2ACJA 3QYBA 5CKTA 1BCOA 1DKGD 1RDUA 4JKGA 4EP4A 5AQQA 1G3YA 4DTSA 1SAUA 2VL8A 5FROA 2BY1A 1N77A 1D8JA 3BEXA 3LZJA 2XPWA 1XSXA 4Q5SF 2F4OB 2QQ8A 4I02A 2WBMA 4CF1A 4CGFA 1RDAA 3I55I 2FMYA 3A0HC 2QW9A 3MCAB 3K70D 4RCHA 1VQKN 4FO0A 4WXHA 2WAFA 3Q9SA 4CSWA 2QWMA 3QPSA 3C0BA 3A02A 1U9OA 1BIUA 4DB3A 4FZZA 5BOXA 1T08B 1X1AA 4A3JJ 1H9GA 2YX4A 1Z6TA 3ASOH 4FHTA 2R7QA 2EZHA 4K2EA 2A61A 4BRDA 1BR4A 2QA4N 3PM1A 5C42A 1LDDA 4B9TA 2EHGA 4KPYA 3NQOA 1SD5A 2TCTA 5EG0A 5LJVA 2YPRA 1R58A 3RKXA 3GW2A 5C25A 3ZSWA 2ESNA 4LLNA 1HQEA 4QIWN 3RRGA 5FKKA 3JAMK 2FBVA 4ASNA 3QPHA 3CCVI 1RETA 2IGNA 2G9WA 4DYRA 2QEXI 2VCPA 4HV5A 1U4BA 2HZTA 1W97L 2WTEA 3DWLE 2L0KA 5HDKA 4KT6A 3TEDA 1D9DA 2QM1A 1ON2A 2RN7A 3O9UA 2IXSA 4XKWA 4JX4A 2X48A 2KFDA 1FYKA 1YF5L 1P6RA 2R93J 2IVOA 4DWIA 1LAWA 1TV6A 3QINA 3ZQFA 1VQ8I 3DTEA 5LJWA 5M1KA 3R60A 1G99A 3M8EA 4X64K 3QMLA 2UUBK 1PVEA 2F4MB 4MQ3A 3CCSN 2P5LC 3HP6A 1PUFB 2O8DB 3FIWA 3ABKH 3EUHA 1FW6A 3A01B 1ZGAA 3N4MA 3BJAA 4FWMA 5F0CA 3V7SA 3K4NA 3HUGA 2BYVE 2P7VB 4RGRA 5IYDJ 1BQMA 2QWRA 3OVNA 4FWOA 3TO7A 4B47A 5LD2C 1JUPA 3VYRB 3DKXA 2EFOA 4JHDA 1ZREA 2EA4A 3ATUA 3SAFA 3LDLA 3HK2A 1E3MA 1LAVA 4CXFA 1LWEA 3KFWX 4AHCA 2V4JC 2HYFA 1VSIA 3V81A 1TK0A 2E5ZA 3HTSB 1XCVA 5EEHA 1ZR2A 3HOSA 2O03A 1NMDA 4XLCA 5LGUA 1Y64A 2KZVA 5D8LB 2AP1A 2W41A 3VTHA 2A69F 2YV0X 3Q7CA 1OVQA 2KPMA 1DDNA 3L0QA 3LDNA 4OGCA 1T2KA 2PY5A 4C2UA 4B9SA 2B4JA 2DMPA 3RSEB 1QZEA 2GQQA 2ELJA 2K86A 2L01A 2HXIA 4Y7NJ 1GDTA 3A2KA 3MKLA 1SFXA 3VEPA 1YRNA 1ASVA 1S1TA 4NQWA 4QS9A 4XH4A 4FJJA 2E34A 1KA8A 4A3BJ 3HXLA 2D1HA 3DXMB 4KB1A 2OBPA 2ZMEC 2ICWG 3LA7A 1SFUA 5BN9A 3QERA 3ZN1A 2BANA 3H5NA 4A61A 4BAYA 1HF0A 3QPLA 4N9IA 4E7ZA 4OAZA 2IT0A 3LMMA 2HVHA 1MBKA 1YS6A 2CWEA 1SEUA 2ZMEB 1IV6A 2WA0A 3C6AA 4GVEA 1C0WA 4O5BA 1K78A 2HW3A 4YFXF 3SUPA 1A35A 2ZFUA 1E17A 1JUSA 4M45A 2XVCA 2P9IA 1WJAA 1NLVA 2JWKA 5J3LA 1X3UA 3DFGA 2VOPA 1S3XA 3AAFA 1YUWA 1JXBA 2E2NA 5DM7F 1HYZA 2P9LB 4CEEA 4MLEA 2EV0A 4UY8O 1V5FA 1RNHA 1IUFA 1V54H 2MFZA 5FKMA 1JT0A 3PFIA 3FZMA 2X6XA 3JXUA 3G1MA 3LL3A 4A3CJ 4DTXA 4DQPA 1K61A 2V1XA 4JI1K 3U3YA 3M07A 2CU7A 3R4KA 5J2QA 2V9KA 2NRZA 3C7NB 3OYIA 3ECHA 2YCHA 4BRPA 1S72N 3GDQA 3BLYA 2CW0F 2QBYA 4C3IJ 5E1XA 4BROA 3DKYA 3CM5A 1ETYA 4QPQA 3HXMA 4IZ9A 1KRPA 3HB9A 4NXMK 3L09A 1T05A 4L3QA 4UVBA 3CCMI 4Y0WA 1U8BA 1OFCX 3VF2A 3S1NJ 3LALA 3K5MA 4B9VA 1U47A 3TO6A 1DU0A 1NKEA 5AZJB 1K9MO 1LPQA 1KQ0A 1NG7A 3AVLA 3GZNB 3CJ7A 4FW2A 5AFUH 3Q7BA 3KYLA 3TI0A 5JICA 2ECCA 3KLGA 2XAQA 1IN4A 3OL4A 3T3FA 3R0AA 3VQCA 3AAQA 2P9PA 2P8TA 5D6EA 1VQNI 3O80A 3OBWA 4CEAA 1GUUA 1VNDA 2EH3A 2Z5UA 3BZ6A 1S9HA 4I01A 1AA7A 2FBIA 2R7RA 2GUIA 1HNWK 4CCMA 2Y9YA 3TAGA 3O2PE 4A0ZA 4XNFA 3ELKA 3WTUC 1JLCA 5AZIA 1EA3A 3AL0C 3UR3C 1U2VA 3LSPA 3FXLA 4HEA2 4HLXA 4XOTA 3CF5F 3JRHA 4ENMA 4A5AA 2XRIA 3G71I 3ZSRA 1WLJA 3G73A 4B48A 4JOMA 1LFPA 1X1CA 3GTKJ 4BBSJ 1ASUA 1XDUA 5L3EA 3RMDA 2LBFA 4ILHA 5AJ3K 3JRGA 1YYVA 2GA2A 5F0HA 3JRDA 3C3WA 2CV2A 5JS1A 3SUQA 3MZHA 2P9NA 3I59B 3LA3A 1QO0D 2ID3A 2IOCA 3RVCA 3SHFA 4XIUA 3VB2A 1ZGJA 4F3QA 5ICCA 1H0MA 2Q0RA 1WUAA 5DM6L 4ENKA 4XRMA 1U04A 2HI3A 2R5YB 3CJAA 3NF8A 3BDDA 4LJZF 2OUMA 4YFUA 1R5ID 5GAGP 2ETHA 1MMSA 2VJJA 2UUZA 3P9CA 1RNLA 4QAGA 3S14J 4LGWA 4WFBL 3KD5E 2WFBA 3GFMA 5B1AH 1MWMA 1EH6A 4G7HF 5AZIB 5KPZA 3QEVA 1QSSA 4IDHA 3GBTA 2RGVA 2BUPA 2BDPA 3PNTA 2QCOA 4KIGA 4L9TA 3GTMJ 2PEXA 2RVCA 4AUXA 3S17J 2W4SA 2PYLA 3RPQA 2ISYA 3K4KA 3CLOA 2V52B 4BBRJ 3GTOJ 4CJQA 3DKWA 3T1YK 2NVTJ 3L2WA 1YT3A 1I27A 3OHRA 2BTFA 4FJHA 1I6XA 2W82A 2VXZA 4UVCA 5TJJA 5HL7L 4XORA 4DQRA 2VYPA 1JCEA 2DN0A 1S72I 3ZQCA 6PAXA 3ZMUA 1WSHA 2HQRA 4DG1A 1UG0A 1W36C 1ZBSA 3P7NA 2G8VA 3O6BB 3GTGJ 2IS6A 3S3MA 1HW2A 3SEZA 1I1SA 2VQLA 3EZ5A 1BA1A 2WB1N 1F4KA 2NRTA 4FLWA 4YELA 1S1UA 2GLOA 3DBRB 2RC4A 1IRFA 5J8CA 2FE3A 2ISZA 1BO5O 1BUPA 5M1OA 3AG2H 3J81Z 1RDDA 4KICA 4NCGA 4YORA 5B66C 1FOXA 4B08A 2XKOA 2HNZA 1SANA 2VIXA 2HNDA 3AO1A 3EE9A 3ULEB 4JI8K 2ZB9A 4IVNA 1BW6A 2CUJA 3DU6A 3FMQA 1JHFA 3RSEA 5E8IA 1NK9A 2WTUA 4OIOF 3BT9A 1QZ5A 4I7FA 4ZYHA 3J80Z 3FZFA 4KREA 3SBTA 1BOAA 2OZMA 3EYYA 1IAWA 1Q1VA 1KAYA 2OU2A 4BR7A 3HHHA 2NVQJ 1TYQA 4BQLA 5FD6A 1D9FA 3IL2A 2GWRA 3PNVA 3FMSA 1Z3XA 1TUYA 4JKCA 3T1AA 4KHWA 4Z4EA 2CFXA 3O6WA 3AA5X 5KQ8A 1Z21A 1Z91A 2JWLA 3TTDA 3L2UA 2KJCA 4G12A 4BRQA 2D0OA 2ZJQL 1MNEA 1MZBA 1U5TC 3DYAA 4BR5A 1XN7A 2GWKA 2XHKA 3JW4A 1IDYA 5E3OA 1VQ5I 3T8RA 1S6PA 1OJLA 2FSKA 2DJIA 2Q1ZB 2XSJC 5EZHA 3GEZA 5E3MA 3KP6A 3LSTA 4OMZA 1EH7A 3H45C 4LSNA 4BRIA 3BG7A 3WQUA 2EFWA 3D0SA 5KI6A 2KTQA 2I5UA 4PJLA 1DU6A 4B9UA 2W57A 3NWTA 4HG2A 4AYBA 4A59A 4EEFG 3HT3A 1MH3A 1BI4B 3ABMH 4BHPA 1S7EA 2MGQA 2XGEA 3HHGA 4CYCA 3RYPA 3WU1B 1I6HJ 4K8ZA 1BG3A 2F8SA 1YITI 4DYQA 4RBOA 3EO3A 1O1WA 3G1LA 4FOIA 5CVUA 3H6EA 3TPQA 5IT9K 2CUZA 3LQRA 2Q3SA 4KBOA 3ZSVA 3KJVA 1LWFA 3LZIA 4KH4A 4DU3A 1OH6A 4IFYA 4IHVA 1X1PA 2O8CA 3HOWJ 1A36A 3CCSI 5J40A 2UWMA 5DEQA 4CF9A 3CJTB 2WONA 1Q82O 4F52A 4BG9A 2G8KA 2G8HA 3BR0A 4GFBA 1ETWA 4BACA 3MX2A 5DMRA 1S1WA 2FEZA 5FPNA 4CZCA 3NVMA 3M1EA 4QPOA 1SL1A 4G6QA 1Y97A 2DT5A 3O9SA 2W1OA 4NO7A 3H3ZA 1XGMA 4WF2A 4HF1A 1XPXA 4LLLA 3G0ZA 4JI3K 2OYQA 3S1MJ 2KZGA 1G3SA 4XN0A 1PUEE 1QZ6A 1YFHA 2KT0A 3QOEA 1LB2A 2I5JA 1HX1A 1QZZA 1SL2A 1I50J 2JA5J 2D0BA 4DSEA 2P5VA 3OSGA 4JKDA 1HW1A 4Z4IA 1XI1A 1ZH5A 2QGUA 3E97A 3MAJA 4RAFA 4AM6A 1VQMI 3VEYA 2M87A 2ZM6K 5HROA 1YJWI 2KFZA 2JSPA 3O08A 3E3VA 4GVMA 3ZP5A 4C2MJ 1KLMA 3LANA 3EZWA 3L3UA 4LH5A 1B1BA 2DA6A 3ML6A 1B8IA 2CV1A 3J80K 4C9YA 1V5EA 5CZ1A 1BCMA 1ILYA 5HDNA 4G7OF 4H4KC 2JVHA 4M3DA 3R0JA 5K7ZA 1MMAA 3QP6A 4J00A 1D3YA 2VG6A 3QFPA 4B1YB 4Q0BA 1SV5A 4CJ7A 4HPQA 4NYNA 4ZZLA 1O3TA 4PL8A 3BP8A 3CUQC 2E7WA 3KP2A 2KIUA 3F6OA 1YW9A 1B72A 1OVYA 3I3LA 2HZDA 2X1DA 4W5NA 1R5GA 2BY3A 3DBHB 3OIPA 1V4TA 3VQQA 4EHUA 1FJGK 3KK1A 1IZ1A 2FOWA 4RW8A 4L0ZB 3QDKA 3TABA 4KRFA 3LSRA 1NBWA 2BV6A 3IV5A 3VGKA 1XGSA 1NJZA 1ZC6A 1R1UA 1JJ6C 3FWEA 2R7SA 4GV9A 3RI4A 1W7PD 2M34A 1R71A 1SS6A 1RTDA 2QI2A 4Z0UA 2OTLN 5CYMA 3RR7A 3WEEA 2X6YA 1RPWA 1HKTA 2IPQX 2XPVA 1ZRDA 2DPUA 2F5EA 3H1CA 3H9GA 2E88A 3AAPA 5EX5A 4IBNA 1J09A 2OCCH 1NTCA 2VKVA 3E6MA 3WTSC 4CJ5A 3HBLA 2LD5A 3G2BA 4CJ3A 2R7DA 4EAHD 1VSFA 5M1QA 1B9NA 3ABTA 4RM2A 3CG7A 2NRRA 4G6DA 1N6QA 2AJQA 1BDGA 2NRWA 4OOIA 3JRCA 4G9YA 4AVZA 4RM3A 1JL2A 1FMWA 5IY5H 2NS0A 2IVNA 3AA4A 2FA5A 3TL4X 2Y69H 3MN7A 3K10A 3TANA 4FK4A 4C8OA 4BY7J 4I6ZA 2RHKA 1VRTA 3R3LA 4J2BA 2JLEA 3A0BC 4B43A 3VQ9A 1ON1A 4D5FA 4DV4K 5HS8A 1A04A 2A3SA 1BHLA 3PSIA 3UKGA 4UB6C 4DF4A 5CVRA 2EPFA 4BC3A 2HHHK 2KIFA 2KKZA 1IRGA 1RTIA 1DTQA 1VQ5N 3DF8A 1JKHA 1FP1D 2EILH 1C0MA 4Z4CA 1UB9A 4B1WB 1HKBA 1NU0A 2I7PA 3EKUA 1Y1VJ 4DV3K 2DQRA 4CJRA 2V9PA 3KLFA 4XL9A 1KFSA 2G8UA 1OCRH 3DV8A 3ZMZA 3SV3A 1IBKK 3O9QA 4J2EA 1P92A 1KU7A 1XMKA 2Y75A 3EUKL 3BR3A 2BGCA 3VOEA 2MD5A 3VENA 3E9OA 3RDIA 2HQAA 1S3JA 2LKXA 3CF2A 4MTDA 3GTPJ 3PIPL 3V9UA 3QNNA 1YHQN 4JI7K 4R79A 2UXDK 3E5UA 1ENHA 4YRVA 1ODDA 4E7JA 2NNNA 2LSNA 3JSPA 2HMPA 1OKRA 1QGPA 5CVJA 2O4IA 4DCHA 4KYWA 5CZ2A 3BTJA 4D1QA 3HJEA 5BPDA 4I9QA 2STTA 4ELTA 4E3SA 3H3OB 4B9MA 3ZXSA 1RUOA 4CJFA 4EFHA 3MXMA 2CQKA 1WRJA 4UV8A 2PMZA 2KISA 4XOPA 4DZPA 1N33K 1C0GA 3HSCA 2ELHA 4KA4A 3CZ6A 4W1UA 4MO4A 2F96A 1ETXA 4ZDOA 4M3GA 2HBMA 2IA0A 3AG4H 4CJPA 1G59A 4WCEL 4DUZK 3TAFA 3LP0A 3WTXC 4UUVA 3F9MA 3VA0A 2K3PA 3DU5A 4BE0A 1S1VA 1Y56A 3NRVA 1WNSA 1DTTA 1QZYA 2ZGZA 3IRXA 3IKTA 3K9JA 4WQ4A 3ID6A 3I0SA 1FSEA 2HSTA 2ZXWH 1QPMA 3F8NA 3AVCA 2X1CA 4H0TB 5LBQA 1DT9A 3DXMA 4OPKA 1VQ7N 3P9KA 4FX4A 1GLLO 4B8AB 2OZSA 4BQNA 2E2JJ 5GPCA 1Q18A 2O8CB 2EZIA 2ZFWA 1BN5A 3DLLL 2YR2A 2VC0A 3NH2A 4B3AA 4PUSA 1T33A 4HWIA 1H89C 2VKDA 3I5UA 4IOCF 4FK0A 2W42A 1WJFA 3P1GA 3BF1A 2MH2A 3BR1A 1XHZA 2KMUA 5GAGJ 1ZYQA 2V1DA 3PFYA 4CJTA 4JKHA 1XNQK 2CMPA 4N0BA 5L3DA 2FNAA 4MNUA 3TO9A 4D7MA 2BZTA 4AWXB 1RT6A 3D2EB 3JS6A 3IWFA 4TV7A 4WF9L 1RTHA 4M3UA 2KRHA 2GEMA 4DTUA 4ELUA 4M6XA 2BY0A 5K7HA 1FK9A 5HLFA 3TW6A 2E2QA 3ZT4A 5K7FA 1QE1A 2QK9A 2K9QA 1YW8A 4CHUA 4A62A 4DR6K 5J1RA 1DQUA 4JD2A 1J54A 4BQAA 4UV9A 3WTVC 3THWB 3WE2A 1UHSA 3CCQI 4B1UB 5A2QK 3ENOA 3SPYA 1WGXA 3CMEN 2HMIA 3JRFA 1T38A 5MLCQ 1WSJA 4IXAA 2P9UB 1W5SA 4XKBA 4NQWB 1X9JA 4H4OA 4KIFA 4N4NB 4PKGA 2O9LA 1FX7A 4A3IJ 1QQOA 1R1TA 2ZJQF 1C0UA 1X3MA 3AVKA 4IG3A 1U2WA 3IAM2 3LSJA 3PUBA 4UVAA 4JK9A 4LH4A 2FSJA 3PL8A 4BJ5C 1KQSM 5FPMA 3HOUJ 3AG1H 1NKBA 3RKYA 2J5OA 1J53A 2V9VA 2R7VA 3NGYA 3DRRA 3W6JB 1NK5A 1BM9A 3AGKA 3W3DA 4FJNA 3TBIA 2VI6A 3GUDA 3DJCA 1OCTC 3LWLA 1KXPA 3SQ0A 2BE5F 2XKPA 1QHAA 1HYVA 4Z4HA 3OIQA 5HRRA 1OH7A 2UXBK 2HHUA 3V4GA 1A5VA 2E2PA 2EINH 1NOYA 2HDWA 1S5LC 2K7LA 5GPAA 1SFOJ 3AO2A 4CGIA 1YXQA 3I71A 1YO5C 3CYMA 3JSOA 1HPMA 5D4SA 1PUFA 3SMPA 4XBFA 3WXKA 3TARA 4AHTA 1N8RO 1T0FC 2YI1A 3FGUA 4ZC3A 2MD0A 1S22A 1D0YA 3E6DA 2HPIA 5DS9A 3CMAI 1R23A 4FWNA 3LDPA 3OL3A 4C3HJ 3JTGA 2HB5A 3C65A 4XH5A 3SDGA 3V8JA 3IUOA 2YNHA 3M8SA 4M42A 5E18F 5DDGA 3HRSA 2HHWA 1C1AA 4M3FA 1NJYA 2B7EA 3LNQA 4B3RK 2CRGA 4HHTA 3CJCA 5AQUA 2JK3A 5FRMA 3PX4A 2LKSA 1SVMA 2HFHA 3ZX0A 4JK1X 4A5NA 1WSEA 2CFOA 4JNEA 2KKOA 2GAUA 2PMHA 4WQ5C 3QNOA 1WHUA 3HM8A 3ERMA 4E7IA 4CF8A 2Q2EA 4FVUA 2GZWA 3KK3A 2EB7A 4LLGF 1H1VA 1KONA 4CYDA 4O0JA 3FK6A 3OYGA 1QQCA 3ZT2A 4C8KA 3WG9A 3G71N 5E1ZB 2MC4A 4FXDA 4H5NA 3VQPA 3CQXA 1RR7A 2EK5A 2P6SA 1JLEA 1VRUA 1WSGA 4JD2B 3MN6A 3SFIA 3KLIA 1TT0A 1P7JA 5E3LA 5JVHL 4YOVA 4RS8A 4HQEA 1N75A 5AONA 1X58A 2CJJA 3V8KA 3WGGA 1XSDA 4S0HB 9ANTA 2X6NA 3KZBA 4LD0A 2KRFA 1FJLA 3SCXA 1STZA 4G6TB 1NJWA 5E8GA 4IXCA 3PNYA 4XEIA 1WCMJ 2PJPA 2HBKA 2KHOA 2LH9A 1PDNC 4CZGA 2JSCA 4H0OA 1T0FA 4FJMA 2ZJRF 1GV2A 2XGDA 4JYKA 3C2BA 1GLJO 3VEVA 2P9PB 1I5ZA 4BC4A 2VKEA 4GV3A 3ZEUB 4AQYK 4ZH4F 3GFJA 3VODA 3OS1A 1ZRCA 1XMOK 4F92B 5EDNA 2R7ZJ 4OIPF 1GLDG 1KLNA 3CC4N 4N9HA 4Z2YA 1PP7U 5EZGA 4OJRA 3RYRA 5IP7J 3IC7A 1M1KO 2J4RA 2DJNA 4HNUA 1TL1A 3ULEA 3OSFA 2QXLA 1BOBA 5BRHA 1QBJA 1L3LA 1QQNA 3EY1A 3THYB 4CZMA 2VKHA 4XSXF 3CQYA 1D5VA 4Y1DA 3S9HA 3IAYA 5JHUA 3TDZC 4V19S 2VBZA 1J9AA 1RZ4A 1T56A 4EZ6A 3D45A 4E7SA 3TW7A 4CIGA 3F8CA 4PJMA 1NGCA 3TAMA 2DA7A 5AZJA 4DF8A 3FKIJ 4OIQF 3FBNB 2DA5A 4JBAA 1V5GA 3CUOA 1POGA 1RIOH 3K9KA 3VQ4A 3V1RA 4NCAA 1XGNA 2WY8Q 2P5OA 3BJOA 2H6CA 1FOYA 1ONVA 4CD3A 4KHUA 5IOYA 5AQIA 4FJKA 4S04A 3OMYA 3A5MC 3DLGA 3NARA 5BREA 2G7UA 5EYRA 3ROUA 2UUAK 4U0YA 3J80O 3QWLA 4JK7A 2DA4A 1JGSA 3KKRA 3WT0A 1J59A 5BPIA 2K4JA 4RMNA 2Q2EB 1T44A 4A3KJ 3J7ZO 1IXSB 3O1WA 1Y0UA 4JRQA 5DCMB 1X9MA 2BVLA 3D7EO 1ETVA 1NHAA 2CQNA 4Y15A 2AS5F 3ZSZA 2COBA 2IAJA 3FZVA 2G8WA 2O8DA 2W25A 3SUOA 3KLHA 2KZMA 4OWRB 4WFAL 3K1PA 3ZSOA 2VT2A 2OCEA 2DT7B 3F22A 2P9IB 3FFKB 3MEXA 4IF4A 4IPAA 4XMYA 1IRXA 4YFNF 2D45A 4N5SA 1VSKA 4AHVA 5F1RA 4BDPA 3SV4A 4NC8A 1P4AA 2M2EA 4BHBA 1WSIA 1GOAA 4ILJA 5B5EC 5KHDA 1R4MB 5JLFA 3HP9A 2DW4A 3HPHA 4CGJA 4YOTA 2P51A 5L3GA 1BOTO 4N76A 1IKVA 2HF4A 5IWAK 1U8RA 2QENA 2ZNZA 3V4IA 4QS8A 3CP2A 2RN2A 1K6YA 3WTTC 1JXSA 1WI3A 1WOQA 1IG9A 3KYCB 5J1YA 4A5MA 2EJRA 5TRDA 1HLVA 2Q0UA 4CIFA 2Z1DA 2CQXA 2E1OA 2ZCWA 2A41A 2FBYA 2IS4A 4FJLA 1X3ZB 4J2AA 2BHZA 2MH9A 3PO2J 4X65K 4OGEA 4BRMA 3DLBA 4NHJA 1IF1A 3ABLH 1V3FA 2W00A 4CCLA 1NG9A 3V42A 4IJNA 4NLCA 1T39A 3VETA 3TGNA 1BA0A 4U87A 3QIPA 4M74A 3S2HJ 3WU2C 4XICA 3TP3A 3SFZA 1ATNA 4KH6A 4B09A 1WKMA 4MHGA 2Y9ZA 2EV6A 3MX5A 2IGIA 5EOYA 5AQWA 3CTAA 3J81K 4XRSG 2IS2A 2A6AA 3HGYA 4CERA 2A1RA 5AQJA 4ELVA 4ID5A 1JUMA 2NS7A 3QQAA 2JMWA 2R5ZB 4EM0B 1YJNI 1B9DA 4NCBA 2K4BA 1J0RA 5C24A 3PX6A 4J8FA 4LMYA 3BZKA 2B9SA 3GOIA 2PBDA 3NAUA 4I0BA 2D1KA 3DTIA 4HAMA 2HTSA 1WJEA 1RT3A 2DYSH 3FZKA 1ZN2A 3RMCA 2HKOA 4CEOA 3EL2A 4YIIA 3T1BA 3VGMA 1JKOC 4R5PA 4DTNA 1KFDA 3ZLJA 4A5BA 2HQ5A 2CGPA 4O5FA 2IVMA 4X66K 3AO3A 2EWNA 4IO9F 2JRMA 1BGXT 1VSLA 1W0HA 1MMGA 2KLOA 5J2NA 3I0TA 4NC6A 4A3FJ 1J7KA 1MMDA 3KWGA 1MSFC 1RDWX 3VESA 4DIQA 3CQZJ 2RF2A 3VWBA 5A2QO 2F5VA 3DEUA 4EP5A 2HR3A 5EEAA 1TK5A 1HKGA 2NRVA 5AIQA 4MIMA 1K7AA 1LKXA 5GAHJ 2O4GA 3N05A 4BQOA 2HOAA 3F8MA 4RAZA 2YHXA 3OYCA 2ZSHB 3DM2A 1TKZA 4LF8K 4KHPK 3JREA 3RIRA 4K8XA 3CXCM 1WJ5A 2A1SA 4ZDLA 1N25A 3J7ZI 2KFNA 2IIRA 1JLGA 4NUBA 2Z1GA 3VQ6A 1U5TA 4B8CA 1QNTA 3E6CC 3LP2A 5ICEA 2L9SA 2A68F 1NGHA 4YOWA 1XS9A 4XRSA 2R7XA 3D2FA 2Y0SN 3J81O 4HUFA 4Y17A 4FX0A 2KIMA 1S1XA 4OPJA 3TSPA 4CZFA 2Q1NA 2DDBA 4CYCB 2D1VA 1HNIA 4ZHRA 1ZELA 1D8KA 2G8IA 4CZZA 1YTYA 1HCRA 2Z1JA 3LM9A 4RA2A 4CA0A 3WU0A 4GMJB 1Z7UA 2R7OA 3E0JB 4ENJA 3MVPA 1H88C 2QYOA 1ZG5A 2ZGYA 3HL2A 1ZTRA 1ZBIA 4EM1A 4IRGA 1CF7B 4H0XB 2OD5A 2A05A 2DT6A 1KU2A 3GXOA 3CCJI 3SYTA 4HSTA 3HI0A 4CGDA 1Z3YA 3CC7N 2Y0SA 4AHRA 1J6ZA 2LKPA 4FWRA 5C4JJ 1IGNA 2RAEA 2R92J 5DV5A 2VQHA 3VERA 3PQKA 1REVA 3EYZA 2O8EB 1GOCA 2HVQA 4XH1A 3L4QA 5F64A 4EMSA 4DSIA 2DLLA 2QKBA 3I8DA 2L9RA 1CZBA 4OVLA 1Z1DA 4PSWA 1R4NB 3Q5FA 4WCGA 3BQZA 1TUUA 4UUSA 2VLAA 4CEQA 3LPUA 4CFBA 4X6AJ 3SQ2A 2WY7Q 5T7BA 4LF4K 2XDVA 4A3DJ 1JXEA 4LC9B 4BY9C 3I4PA 2JUGA 1GXPA 3TSQA 1UZCA 5DTDA 3NAEA 2VC1A 1KD1O 1I94K 5LY3A 4H5WA 4DQ8A 4KNYA 2QQ9A 5AQTA 2MC3A 3BTLA 4BHCA 1EX4A 1DGKN 1XCBA 1FKOA 2OPQA 1QTMA 2QSHX 3OYBA 3H5AA 3OYLA 2NVYJ 1X3NA 4ICLA 4V2GA 4HUEA 3THXA 3VF4A 4F2SA 1BI1A 2XGCA 3RCOA 2XROA 2PMUA 4I9LA 1MBEA 4PKHA 1QVUA 4DTRA 4IRIA 1IKYA 1V55H 1LW0A 3K2PA 2O8EA 1G4DA 1SMTA 1NGEA 2EZKA 2BVMA 2IA2A 1USSA 3GTJJ 3EPZA 2HDCA 2ZWHA 2OA8A 4J01A 3J7AP 1YIOA 2QWOA 3KVGA 3KHYA 2FC0A 1JKQC 1S29A 1TL3A 5BPNA 1FIPA 3CCRN 4Q47A 2DA2A 5HRPA 2LK2A 1TNSA 1JLBA 3CFOA 3HPOA 1C1BA 2WOMA 2W40A 3K58A 1YHQI 1Z0XA 4Q48A 3H9QA 3OYJA 3CCEI 2MLKA 1IUYA 1DP3A 2FJ1A 1B6AA 4IJAA 1TLHB 3RKWA 5FLMJ 4UB8C 1J75A 3EE8A 2Z3YA 2A5WA 1LE8A 3GWZA 2DXIA 1BA5A 1F5TA 5J4YA 4B3OA 1TAUA 5E41A 4PZJA 1WJBA 2BH1A 4KITB 4MO5A 1W5CC 1HDDC 4DR1K 4XLAA 2DA1A 5CR4A 2Z2SB 2HXOA 1RDCA 1HXDA 3DBLB 3T0YA 3KEOA 3J8AA 5KPRA 1TKTA 4XKVA 2LR8A 3BZCA 4XLHA 1TWAJ 4YOYA 5I3UA 3F21A 2VG5A 3P38A 2DFHA 3NHGA 1OR7A 2TRTA 4PK4A 3VEXA 2L7ZA 2YNIA 4E0DA 4I6MA 4KFBA 2BOLA 3WODF 1Y1WJ 2ATQA 4LSLA 4FE4A 5LHGA 5D6FA 1T95A 4H0YB 2L3DA 2NOJB 2E1ZA 4EJTA 4D0PA 4M3WA 3FXUA 3UIQA 3DMJA 2F6CA 3COAC 4JX5A 1WWXA 2FXAA 2XB5A 2PAVA 1KQ9A 2IC3A 1D1AA 1VHXA 4OKEA 3WHBA 4NDLA 1MNMC 1NGDA 2HHTA 4DTOA 1SD7A 3CDHA 3DQVC 3UKUA 4HVJA 2HQNA 3UE5A 1TWCJ 1VSMA 2P9SA 4BG8A 5FPEA 4XONA 2OTLI 4KKOA 2V1NA 1B72B 4O8KA 3L7WA 1H8AC 3O3HA 3P4IA 1CZ9A 4BJ6C 5HLTA 1KTQA 3VQBA 1FZPB 3V9ZA 2ITMA 4U0WA 4IOAL 1Q86O 3M8JA 3GO5A 2GELA 3PIOF 5E1WA 2IJLA 3JRAA 2WAQN 2YU9J 1P90A 4CD1A 3HRGA 4BEHA 3HSTB 2WADA 4RW7A 3CPEA 3QOPA 2DMUA 1HQUA 4XN3A 3VTIA 3RMAA 3THXB 2M1BA 1S6LA 1GVJA 3MQ0A 3QODA 1RT5A 3CJRB 1JKPC 2DCEA 3C95A 3QBWA 4CZJA 3NDKA 3AVGA 3MXIA 3CCLI 4XKCA 1U45A 4CBXA 1I39A 1MNDA 3NFAA 5KRTA 4ZJZA 4G94A 3IH2A 3F5TA 5J1UA 1J2XA 2E1MB 3J7YJ 1TTYA 4Q4ZF 1TAQA 3JCUC 2Q97A 3AO4A 2PZSA 2IGMA 2OPPA 1J5OA 3HOYJ 5BQTA 4O44A 4PCQA 1Q1HA 3K9TA 2W84A 2XASA 1JGGA 5LEKA 1N34K 5C15A 3ZX2A 3KK2A 1YJWN 5CVVA 3MKWB 3BF3A 1VQMN 3H08A 2VE9A 4I7HA 2YKNA 3IWZA 4FWPA 5BS6A 3K57A 2A6HF 2LLKA 4YDUA 1JT6A 3KETA 2JT1A 5SWMA 1SD6A 2QUFA 2R4GA 2Q0OA 1NWKA 2OPRA 3B6CA 4QWQA 3K2AA 1Z25A 3MEDA 5F6FA 2WV0A 2H1KA 5AQKA 1CQTA 4R1HA 2P0WA 3ABUA 4DSLA 3BG5A 2E6MA 3WNHA 4C1NI 2HBLA 4JKEA 5KGWA 3RRHA 1T3VA 4V19K 1ZXOA 2V51B 1FC3A 3TTCA 3ZCMA 3ZSYA 4G8XA 1AOYA 4M3RA 1MBFA 4FJ7A 3LAJA 2XSDC 4CDGA 4FASD 3KEQA 5DYMA 1VQ6N 1W2BM 1HQCA 1BIBA 2OQGA 1RBRA 1ETOA 5D8KB 2L4AA 1HLUA 4BU2A 1IO2A 1U49A 2ASPA 2K40A 3CJBA 2ID6A 2RQQA 4LITA 1MDMB 3ZT1A 3D0PA 5HP1A 3H0GJ 2VG7A 4JI5K 1UMQA 2PJRA 4F3OA 3ULQB 2L9VA 3UB5A 3SUNA 4DFJA 3CUQB 1UOCA 2YU3A 4O4GA 1ZBHA 3EUHC 4BRAA 4M3BA 4FTHA 4IO8A 3TKYA 1BW5A 1L3VA 3RQIA 4NC7A 4QS7A 3W2WA 4RB1A 1ZYRF 2E1CA 2FF3B 3IKVA 3VYSB 2GV9A 2Q36A 3CHWA 3CFRA 1ETKA 4PDKA 2IP2A 1LUJB 4XSZF 2ME6A 5M5YJ 3VQDA 4XLFA 3I53A 2NZTA 4EZ9A 4AM3A 5GIOA 4M3YA 3K4LA 5GADJ 1VSDA 2HHQA 2M8EA 3OJSA 4M6YA 3ZQIA 1HOMA 4LFBK 1M1EB 2V6CA 3D5RC 4UNOA 1L3TA 1UFMA 4IKFA 4RGXA 1YX3A 4U0VA 4GCVA 4BH9A 2IDOA 2VE8A 2YKMA 5AQZA 4WYBA 3BG9A 1XC5A 1OMIA 4BE1A 2NRHA 4ZYAA 4DSJA 2FX0A 1ZLJA 2VJ4A 3LSHA 1MSEC 4B8XA 4NB4A 4OKKA 4G1QA 1PYVA 3K0SA 4L5JA 4LG3A 3MECA 4CI6A 2QKKA 2OV7A 5BPLA 4Q5VA 1YVNA 2KZZA 1GLNA 3SZGA 4DU4A 2DOEA 1HKQA 3KCCA 3NF6A 1FBUA 4JI0K 1K8AO 1WPKA 3ERED 3BPXA 2IS3A 3CFPA 1VQ8N 4KTQA 3EEQA 4YNQA 1TYQB 1D0XA 4H5VA 2FOKA 2HOEA 2DK5A 4RLFA 1NK2P 1UAXA 3ASMA 3NBPA 2LC2A 3THYA 1E3OC 2PJRB 4A2AA 3QYFA 4CESA 2KIQA 1SKRA 2M30A 5FB2A 1ZG1A 1Y39A 3D2EA 3R61A 3QEIA 5GP9A 3IH3A 1ZK8A 2V79A 3QU3A 4RDUA 2ASOA 3PY8A 5AIPA 4DTMA 1QRYA 3KD1E 3HOVJ 3WTZA 5EGOB 4IEIA 3I9V2 4NLBA 4O55A 3CETA 4OLAA 3I33A 3OYMA 4FCYA 3RKQA 3S1RJ 4AVPA 2BEOA 2MLGA 4BY1J 2QKLB 3FXMA 1R1VA 2ZXIA 4KN4X 3DLKA 4U88A 3C18A 2VT3A 3ECOA 3AFHA 1NGAA 3CJ1A 2OA4A 4KDPA 4FSVA 3WNEA 3F72A 3HYIA 4LB5A 1LEBA 3K1NA 5C0YA 1GXQA 5C3EJ 2QLZA 4HQMA 3K70C 1QA6A 1A5WA 3KK7A 2D5VA 4IG0A 3R8EA 4ESFA 4W97A 5H1SQ 3A01A 3DPLC 3KPHA 3CI5A 2EFPA 4NBQA 4D5CA 2F7TA 3PIOL 1LDJA 4AU7A 1BI2A 5EU7A 3VQ8A 2LY1A 3DPUA 3V6DA 1QHTA 4P5OA 3R6SA 5E84A 3NH0A 5D3GA 3TOAA 5DD8A 5KAIC 2M8GX 1IRZA 4B9LA 2CGJA 2D0AA 4HNTA 2K5CA 1A6QA 2W85A 2VQFK 2CGLA 1IH7A 3HRMA 1X1DA 3KP5A 3MFKA 1LWCA 3O4NA 4PGGA 4JHDB 4DFMA 1MKMA 3L2VA 2LY2A 1K79A 2OJED 4E70A 2LNBA 1TWHJ 3HUGB 2DO7A 1DGRM 2E20A 4MLHA 4E1MA 3A2FA 4CHQA 4QOZB 1VI0A 2E6LA 3E6BA 2EFNA 2R5YA 2ZNYA 1K4SA 1WJDA 3GL1A 5EXWA 5M5WJ 3DPTA 2O61A 1CGPA 2X9DA 1QSYA 1XDSA 3E7LA 5B1BH 2DMNA 3H3UA 1NK3P 3LSGA 4BGAA 4EV0A 3AY9A 1WVRA 1YTUA 2NYXA 2MABA 3I8BA 1AKHB 1LE8B 3C6HA 2JN6A 2HWVA 4Z6YA 2R0QC 1DEJA 4GXOA 1LVAA 4DQSA 2XAGA 3CMEI 3THWA 2O0YA 5GAEP 2VB6A 5AR0A 3G3ZA 5TGTA 1Z77A 1ATSA 4ESBA 3CCQN 2PQ8A 1A6IA 3HSRA 2KL4A 4AIJA 1RDBA 4HZFA 4KT5C 4MO7A 2LF7A 2VBYA 2P9KA 2DK8A 2F8TA 4GY2B 3H35A 1C0FA 1HRHA 3VEZA 1EWQA 3HC7A 3L2QA 2WC2A 3LWFA 5DCFA 4B3SK 1BJAA 3BG3A 1GLEG 3ZSQA 1QHHD 4OMYA 2JWTA 3H0DA 2VQEK 4C8LA 3F8FA 5CPRB 4IHWA 2I7NA 4X62K 3FX3A 3PJRA 3FHNA 3U9ZA 3D1NI 1R00A 2JVGA 5D5XB 3SEQA 4CCNA 1FYMA 1E0EA 1WJCA 3MN5A 4BRGA 4JV5K 4W5TA 2F5FA 1T7PA 3GE1A 3LM2A 4KTWA 4MDAA 4Z4FA 4WQ4C 3RZOJ 1FTZA 3LAMA 5ADXA 3ZYYX 3CCLN 1WQ2A 1DPUA 2FBTA 1J5YA 4DZJA 2TDXA 4BR0A 4GKJK 1YQAA 2V7FA 1QVGM 1WH7A 2I8DA 4B3XA 2RNJA 2V1UA 3CUQA 3BOQA 4NNJA 2R7FA 2VQCA 3QPTA 3UNGC 1XGOA 2P81A 4EVIA 4QLCU 4XLPF 1RESA 1LQ1A 2WAQA 3L9FA 4AHUA 5C2DA 4ZYGA 2HHSA 2ZKZA 1RI7A 5A2QZ 2HU9A 2V7ZA 3V8LA 3O9TA 2ZF5O 3T69A 3SNNA 4F2RA 3FISA 4AM7A 1ZRFA 5FKOA 4LF6K 5M1PA 4AIKA 1C0TA 3HKZN 1ASWA 5FDLA 4BGBA 4RW6A 4CZHA 4DV6K 2K3FA 2Y31A 2E2OA 3FR0A 2BBYA 1KZHA 2L2OA 2LYCA 3JTHA 5AQMA 5M3FJ 3VSKA 2XPUA 2ZJ2A 1MA9B 3RPUD 3TDUC 4PJJA 4GYIA 2LMDA 3M7GA 3FE1A 1VAZA 4IOCL 1HJRA 1N5YA 5H20A 4MTEA 2XGXA 1ZQ3P 5AFUA 4N47A 3VQAA 1HNVA 4Z4GA 2IGKA 3S32A 1K4TA 2D2WA 3DLLF 1WFXA 4HDVA 4FLXA 2M4KA 3HRUA 4DLGA 1G2HA 1R36A 2ELKA 4TSXA 3OY9A 3E1YA 3T19A 1ZBLA 1GHCA 1IBMK 1TT5B 2VONA 4MFEA 2HNHA 3ZCOA 2QA4I 3MXJA 1USTA 4M3TA 1K83J 1QSLA 1EJ9A 1WBBA 3QU6A 4Y3OA 3D2FB 3DXKA 4JKFA 3F8BA 2AQEA 4HW0A 2HBJA 3C6TA 1LV5A 4GKKK 5LHIA 3QYEA 3GLXA 1J5EK 4LD5A 2UZKA 4A3LJ 2R7WA 2P9SB 3QLHA 3WE3A 4DS4A 2HHXA 3KIOA 3LQQA 4OX9K 1FNNA 2XAUA 1P7IA 4RGUA 3I55N 4BGDA 3LA2A 1X4OA 3CC7I 4A6DA 2EBIA 3EUAA 4EJUA 3BCBA 3L6QA 1Z05A 3KP7A 2FRHA 3DXJF 2H94A 5IP9J 1R5HA 2YUSA 2QSGX 2R5ZA 1LVKA 3KLOA 4LIVA 1NGIA 3MD2A 5CLSA 2Q31A 5AQFA 4FJ5A 1D8YA 1TWFJ 2A3ZA 4H0EA 2CG4A 3LSMA 1Y6IA 2KQ2A 2ZD1A 1X1BA 1KAXA 1U5TB 1BI3A 3AVFA 5E79C 3JAMO 4A3MJ 2E4LA 5M1NA 4W5OA 5K5QA 4CIEA 1HUXA 4GO1A 1W7AA 2M4GA 5L3CA 1K6OA 4RLQA 2X51A 3LSKA 4LF9K 1OPCA 2P7CB 2JA6J 1QHGA 1ULYA 1F9NA 5LRRA 3DXKB 5F27A 4CBWA 3PO5A 2JZYA 3K4JA 2YHYA 4YY3K 2X6OA 4LIUA 4MQVA 5GINA 4L9JA 1TKXA 2JPBA 3U2RA 1Z26A 2NNYA 3O3KA 4PFPA 4C8MA 3C7NA 2VUMJ 3LDOA 3KKSA 2UYTA 2HNYA 2WB1A 2OPTA 3FMRA 4YFKF 4F93B 2W7NA 3ZMDA 1YVUA 4ISGA 1KQ8A 2F48A 2ZO4A 1XD7A 2L7MP 1NK8A 2FU4A 4JS5A 3S3OA 3L1PA 3CM6A 3CCVN 1S5JA 5CYQA 1XQSC 1TKDA 2ESHA 1V4SA 2HKXA 4FLTA 1XMAA 4AD9A 4L5EA 2E2HJ 4HTLA 1R7JA 1DGWY 2XAJA 1OR7C 1IDZA 5BRFA 3GYHX 1BR2A 1U0JA 5J1EA 1HSTA 4FL9A 3VEWA 5FD5A 2PBIA 3HJFA 5FPDA 3OYKA 1L5UA 2QXFA 1IG7A 3NF9A 3KTQA 4KISA 1JLAA 1WAFA 2KW4A 3TTFA 4H5TA 2DODA 1B9FA 5K1YA 4H4MA 1LJ9A 1IC8A 5BN8A 1FLIA 1ITGA 1OISA 4KIBA 2M0CA 1UWBA 3BY6A 3CCJN 4B9NA 3WNGA 5IP6A 5C10A 1OYYA 3DRSA 3ZX3A 1U9NA 1FMVA 1MJBA 3S15J 3SJJA 1W7PA 4IHSA 1DUXC 3SQ4A 3S41A 2L02A 2RKIA 1IKWA 5IYBJ 1VQPI 4M7XA 1XB4A 3QEPA 1ZBFA 2LVSA 3AGRA 2GXBA 1IV8A 1J9IA 3HBTA 2L7KA 3Q3SA 2OTJI 4IFEA 4E1JA 4MGRA 4U7DA 4CGGA 3CQ8A 2VPRA 4IWVA 5F2RA 2R3SA 4II2A 4DMNA 1KSPA 4CGHA 3GF2A 5HS9A 4CZIA 3ATVA 3BUZB 2FNPA 2FSWA 4PQUA 4LF7K 4B1ZA 4K25A 4MQ9F 1N78A 3OBYA 1T8EA 3TQNA 1DPRA 4Z94A 5GTHC 2EWSA 2JRTA 2LTPA 1E2XA 1ATRA 2GWJA 4A3EJ 1D5YA 4Y33A 3MWPA 5E26A 4CFAA 1TWGJ 3BR2A 4FWQA 4FM2A 3U1KA 4DR4K 2QWWA 3RWUA 3ZSXA 1BI0A 2DY4A 1VQNN 1L0OC 3GMEA 1U2VB 3W2AA 4EGZA 3ID8A 2F4IA 4BRKA 4KHSA 4AHSA 3SPZA 4RAGA 1E3PA 3QB0A 5ADXH 4CK3A 4B4CA 4HCBA 3P39A 4FJGA 2LP0A 1B9MA 3HSEA 5CY4A 5AQNA 2HHVA 3GZ5A 1O7LA 1UHMA 3CCMN 1ZARA 3H92A 1XMXA 1YOVB 5LHHA 2LY9A 2YNGA 3SMSA 2CUEA 2DFEA 3U9GA 3MWTA 4K0KK 1TK8A 4DKWA 2R7UA 5HRSA 3J7AY 4LG0A 1ZG3A 4C30A 4BVOA 4X1EA 4G9ZA 1QPIA 1EETA 5K14A 5K5RA 4GRIA 5JFRA 2DQLA 5AQGA 4BC5A 3KZYA 1UA1A 4A2BA 4L9VA 3C6UA 3GVAA 1IXRC 1VSJA 4JQFA 3MAQA 4L0YB 5H2FC 3CC2N 2EA2A 3IKMA 2XAHA 2IA1A 1I3QJ 4A2UA 3OS0A 2GXGA 3B8AX 1YIJN 1N32K 3OYNA 4ID1A 2QBYB 5AQLA 3MWMA 5IT9Z 3CD6N 5DCMA 4HA8A 1OCCH 4KAZA 4CVNE 4DW6A 3CESA 3MZ8A 3WXMB 1FBQA 3MN2A 4BRNA 4DV5K 1YW7A 1HNXK 3RTVA 3V9XA 2XY7A 1X4PA 2XF5A 1MJAA 1MBGA 2JUCA 3L2CA 1OCZH 5ILUA 3FHZA 1YJ9I 4JYAK 4BYYA 3HKZA 4E1NA 5GAEJ 1IBLK 1IJJA 1P2FA 3GFLA 3NF7A 1Z9CA 4LG0B 4LFCK 2OC6A 2CGKA 2DDAA 2COMA 3I64A 4I98B 3RZDJ 4HRIA 3BCAA 4DHYA 3C7JA 2YJFA 3X2QH 3LDSA 3GX4X 3IUCA 3RR8A 5HODA 4KB0A 5LRSA 2GUPA 5FO5A 3PUFA 1T98A 3K4MA 5AQYA 1BL3A 4FLYA 3U8XA 3PSFA 3MEEA 2KJBA 5FKLA 5H6RA 3DI6A 3O4QA 4DUYK 4WXCA 3JR9A 2K9LA 2YHAA 3ONQA 3DOLA 4FJ8A 4M3ZA 3IH4A 1RBSA 3A8YA 1PP8F 3EQLF 5TISC 3G6EN 1X3WB 3HTVA 4P96A 5J2PA 4I0AA 1OKJA 3ESWB 2HOTA 1UAAA 4B44A 1SVLA 1FIAA 3K0LA 1SFEA 2KHMA 1APLC 3D5LA 1D1BA 1RUNA 5KK1A 1E4FT 3NVKA 4ZZDA 3TU5A 4YG2F 1L3SA 2RREA 3OOPA 4HV6A 3VSLA 3TOBA 4CCKA 1EQYA 2XY8A 4B3MK 3A4CA 2KDZA 4O3MA 4KUMA 3VQEA 3B6AA 1NM1A 5ICGA 4IQ4A 4ZYDA 2N8GA 1KYWA 1A31A 4KHQA 1TGOA 4XIDA 1WI9A 2EIKH 2VBXA 2FUG2 2C6YA 1O3SA 1GT0C 2NRAC 1ACIA 4JN4A 4J19A 3HO1A 4XK4A 2QVOA 4A0YA 5JLWA 2L4MA 1D5AA 2XUBA 1IN6A 2D4WA 3EETA 4D7NA 2PLYA 4QSHA 1FPQA 3GCMA 2VASA 5JVTA 3HOTA 2ZQBA 3A0IX 3E9LA 2GBZA 1NH3A 1R49A 1HKCA 1L3UA 2RPIA 4M3XA 4PWDA 1UG2A 3KZIC 3HM9A 2B63J 4FWLA 5C4XJ 4JEPA 3I4MJ 4CFDA 3QFUA 1VQLN 2NS8A 5J2MA 3P9IA 4I2OA 1Q7YO 2F9TA 3KZZA 4DNCA 3KX2A 3MKYB 2BW3B 3BR5A 4HX4A 5DM6F 4BXXJ 3FLCO 4BQZA 5HLIA 2UU9K 4PSXA 4B1VA 4YOXA 4IZZA 4RAYA 2M45A 4F7ZA 2PG4A 2CH6A 4I99C 2E1MC 2BY2A 3BC8A 3M8PA 5K5OA 4OO1J 2UXNA 3VGLA 3K1MA 3CC4I 3E5QA 1XC3A 3V9WA 2CH5A 4F4KA 3U3GA 1NJIO 3FBIB 3B73A 1NGGA 1VQKI 1Q81O 1VZ0A 2YSRA 1MDMA 5HNFA 1FOWA 3H9JA 5D5VB 1RFQA 1SMYF 1SKWA 5ELZA 1F36A 3RTRA 2JJ7A 2O8FA 2VXDA 1Q8IA 2DOFA 3HM5A 1VQOI 2WC9A 1TNTA 1UA0A 1EKEA 5ICFA 2GIVA 2IAIA 2XF7A 5E20A 5J4VA 4CEBA 5I42A 4W5RA 2Q8KA 4FE7A 3M1CA 4XLNF 2J5PA 1BBYA 5GIPA 4XR6A 4FZXC 2VWBA 3M3ZA 1AWCA 1CXQA 1KU9A 4A6EA 4RGSA 2STWA 2GX9A 1A5JA 4PA1A 1NGFA 2XRNA 4JI2K 4LK1F 2VGNA 2O6GE 3A5OC 1T6SA 1FKPA 4RTFD 2JA8J 2K9NA 4AILC 5IT9O 2MBFA 3FXKA 4CK1A 4CCHA 2FD5A 1UELB 4CFCA 1XHXA 3VYUB 2P9NB 1U78A 4CZKA 5KRSA 5ED4A 4WX9A 3SZPA 3GTLJ 2L7FP 4BEHB 3IP4B 5CVIA 3VEOA 4A0XA 3M8RA 1YJ9N 1FP2A 2RNGA 5LMNK 2OTJN 2E60A 3ZEUA 2FQ3A 3E1SA 1JLQA 4OPHA 2ME0A 4FT8A 4RW9A 2H8WA 2CH0A 3NWSA 3OS2A 3L2RA 1YS7A 4FVMA 2PYJA 2O8FB 2V7YA 5C2FA 3NGZA 1V4RA 2CO5A 2HS5A 5ILSA 2FBKA 1RTJA 3I56N 3E01A 3FKJA 1TZLA 2D0CA 3H1VX 3VF6A 3VPZA 4BRFA 1B92A 4CBUA 1TW2A 3ENHA 5C12A 1VQ4N 4LK0F 2E36A 2DMQA 4X0GA 1DP7P 3WGIA 4YIRX 1RT4A 1I3AA 4ZTJA 3A5LC 4CF0A 2O8BA 2OZ6A 1KGSA 3F2KA 5JVGF 2H8RA 3ZQ7A 2ZMEA 3DEEA 4JP0A 3FXRA 2HYJA 3L4IA 4I2QA 1ZR4A 4IDKA 5LL6Z 4CJLA 2XHBA 1S9EA 3AG3H 3N97A 1O13A 3IS9A 5DM7L 3OV8A 4P9FA 5LEJA 5EG0B 4YDUC 3HL8A 2YNFA 3SQ1A 1YI2N 5HRNA 4BREA 1VTNC 4RG8A 1D0ZA 4BR2A 4BKXA 2VODA 3P83D 4BRCA 4B1RA 2FXUA 3MMYB 5AQRA 5FLXK 4P55A 3SJHA 3KEYA 3F23A 1B4AA 3WNFA 3MZYA 4I2PA 1A5XA 4L8RB 3AVIA 2A42A 4M72A 1X9SA 1MH4A 4RB2C 4OAYA 1BIZA 1HR0K 1QS4A 2X85A 4DQIA 5FJ8J 2K9MA 3OOUA 1VQ7I 3WQTA 5M1FA 2A5YB 1YTAA 3O8MA 4QCLA 4FISA 1SFKA 4H5RA 4JKGB 2YX6A 1MU2A 4FLUA 3ITHA 1R59O 4DV1K 4C8NA 3F6VA 1TW3A 3ZT3A 5CHIA 4PJ0C 4UQGA 5JMVA 4Y13A 2ITGA 2DBBA 3PX0A 3HIFA 1MMNA 3KE2A 5HLGA 1QQIA 3WHCA 4FQGA 4BDZA 4A93J 2FF6A 4M9XA 2DA3A 2L5QA 3QBXA 2GM4A 1LOTB 3M3YJ 4IOAF 5KVRA 1TVRA 1X2NA 1XG1A 1XX5A 2DPNA 5LGTA 2BGGA 1FT9A 3AVMA 2P1JA 3BGRA 4PGHA 1RBUA 4M7YA 5HLHA 4OIRF 4A3GJ 2PFUA 3EYIA 5AQXA 2DU9A 4PFOA 3CC2I 1FXXA 5JS2A 3VQ5A 2UV1A 4CJWA 3SJMA 3KLEA 4CCJA 4LFAK 3F9KA 3Q0WA 1FTTA 4O8UA 1UHWA 4Y4RA 2YX7A 4EQQA 5IPAA 3UKRB 2MSYA 2QWQA 2H6BA 3Q0VA 1P9QC 2M5WA 1ZLKA 4CJKA 3O3FA 4UXNA 1REPC 1RKWA 2H09A 1NK6A 3FF5A 5L3FA 5J8FA 1RBVA 2ZXJA 5DK5A 3JYTA 2QKMB 1UJ8A 1FOKA 1QU3A 2ASMA 1WZ2A 2JGUA 2NNWA 2KDOA 5C44J 5DUKA 4MDBA 4XLEA 2X4HA 1TQIA 3LL7A 4DTJA 4BUPA 3K7AJ 2VWKA 4P1WA 3ZMVA 3CLQA 2XC7A 2LF8A 1AHDP 3O8GA 1LFUP 3AKZA 4HF2A 3AO5A 3B6PA 1G3TA 3A1YA 5IYCJ 3G25A 4FWKA 4DTPA 4BJTA 3QRFF 3HTUA 1RT1A 3V7RA 2X6SA 4IL6C 1X9WA 2L54A 4B1XB 4NYFA 4I09A 4DGWB 1HYSA 2LRDA 3PIPF 3E9PA 5IT3A 4RB0A 1LW2A 3E5XA 2A07F 3HOZJ 1ORKA 2IVPA 3HG9A 3JAMZ 2E1NA 3GZ6A 3MCPA 3W6KB 2F9WA 3OJUA 4F91B 4HSRA 4K43A 1ZHFA 4JX6A 3W0LA 5GAHP 1IKXA 1KCFA 4K41A 5SZTA 2HGCA 3HVRA 1KYZA 4O0IA 1FYLA 2ZXHA 1HKSA 1ZGWA 1LEAA 2X1EA 2E19A 5J6XA 1YLFA 2M0MA 3FM3A 1OYIA 3DP7A 5LGNA 3ZMTA 4ZTFA 3PO3J 1RBTA 1BIAA 3RJPA 1RT2A 4OPAA 1T03A 4E7HA 1D1CA 4P9UA 3Q9VA 3M9AA 4OINF 4BXFA 4KMFA 3LAPA 4CHZA 3V1QA 1RCHA 1XNRK 3ASNH 1JKRC 1SQKA 3QETA 4ZYEA 2V26A 1JLFA 2P4WA 3AL0B 4E6KG 1S6QA 4HTUA 1GV5A 1K73O 4IFVA 2ECBA 3OR2C 4WXDA 2XY5A 3O3GA 3VYTB 2XY6A 2JA2A 1Y0NA 2WAEA 3KLNA 4M41A 4MFDA 1LCUA 2RQPA 2LREA 1KU3A 3KP4A 1JTYA 1YI2I 4U67L 3ZQQA 4AF1A 4KI6A 2HF3A 2XO7A 3P31A 5HBMA 2ETJA 3K4BA 2R7TA 1KVCA 3LOCA 4EATA 5CQGA 4WWCA 4C2TA 5J47A 2ZC2A 3JRBA 1JJ8C 4LY7A 1F1ZA 1EWRA 3MK6A 5EJCA 4L9NA 2WV1A 3K5OA 1IN7A 2QQBA 2RKHA 3T8TA 3ENBA 4ILGB 4FK2A 2K02A 1B8IB 4RW4A 5KQDA 2MG4A 3KYDB 3AA2A 5CYVA 4PHTX 2VQGA 2QSFX 2DI3A 5F1JA 5B3SH 4BDYA 5EGOA 1FBSA 3HGGA 2R7YA 3ZETB 2VPLA 1G6NA 2O8KA 2UUCK 4FW1A 2CV0A 4FYDA 3O1BA 5I9EB 3A03A 4LF5K 4EJOA 4BXUA 3CCUN 3LFKA 1OLTA 2FF4A 4UHTA 4YEJA 5F1XA 3SAGA 3IMXA 3H36A 5IOZA 3HDDA 1KVAA 1MDUB 4YOUA 1O7FA 2ADUA 2IRFG 2JA7J 3BPVA 5LFAA 2LG4A 5BPMA 3PLAA 1BR1A 3BG6A 3VDXA 5AQOA 4EJVA 4CHOA 4CJUA 3K59A 3ZPLA 3AVBA 2LOOA 1RGIA 3MMVA 3THVA 3B02A 5LLQA 2WWYA 4DV0K 1HW5A 2I10A 1GVDA 5BMZA 3W6VA 1BWFO 4J2DA 2EZLA 3TSUA 2A6TA 4ISFA 4E89A 3QESA 4CHNA 4KH5A 2BXZA 3OYDA 3KWIA 1B59A 2M9HA 1E3HA 3WTYC 1JE8A 1BC7C 3RPUA 5GTIC 3VPRA 4FJ9A 4XQFA 1OH5A 2E2IJ 4MEYF 1OH8A 4BS9A 2V6EA 1XUPO 1Z6RA 4M9ZA 2NLXA 3IHUA 2X74A 4HNVA 1TQPA 5TKYA 4A57A 1BJZA 2AQFA 2BE2A 2QWLA 2H1LA 1MJ9A 1T6DA 4CJVA 2VOOA 4DS5A 3TAEA 4RB3C 2PMZN 1IW7F 2LSOA 3HZ6A 4IQJA 5AQPA 5F0XA 2L9NA 3SZ2A 3CCEN 4DR5K 2EV5A 1VF9A 5F04A 1S7AA 3AVHA 5KGXA 4PY5A 2Z9OA 4JK8A 2FBXA 5JI6A 5EF6A 4AH9A 4CJEA 2DFIA 1VQ4I 1T8IA 4BVPA 2OAZA 2KP6A 4GDFA 3ZT0A 1JCGA 2HPMA 1P4XA 2DPDA 3S93A 1BI4A 1ZBUA 4MLOA 1VSHA 2AO9A 4DFPA 5FFXA 4ESJA 3AVJA 3U9DA 3LAKA 2YHWA 4FOEA 4EHTA 5HS7A 3NH1A 5JLXA 1E4GT 1SD4A 2CW7A 5FLXO 2A5XA 3SI6A 4UY8I 1I1GA 4Y52J 1WSFA 3QEWA 2E5NA 2EIMH 2PN6A 3EN9A 1NK7A 2CW8A 2O5RA 5FLXZ 1IG8A 1P8ZA 3R6MA 3ZGKA 4CUGA 5BR8K 2FMLA 1MGTA 1UCRA 3OR1C 1FY7A 3BTCA 4H03B 4H0VB 4DOZA 3I54A 2YJEA 4LB6B 2Z1HA 4I6MB 1NG6A 4JLHA 1S7OA 3ZMSA 1Q9YA 4RWTA 3T1HK 1KC8O 4GV6A 4BRHA 4M73A 3S2WA 3ZRGA 4D9JA 4E7LA 3AVNA 2QM3A 2K9SA 4DQQA 3S3NA 4OKJA 2RDPA 3O9RA 1GLFO 1VQON 2MW8A 3CMMA 3P5JA 1R6RA 4CO8A 3OYAA 1RR8C 4BNCA 4M9SA 4JI4K 1IJWC 3C94A 3R9PA 1BC8C 4I76A 1AKHA 2XB0X 1ESVA 4DR7K 1G15A 4JS4A 1CZAN 4BWJA 3O4WA 3UKUB 1NNEA 2ZSIB 3OWTA 4OU0A 1NGJA 1K8KA 1W9HA 4FLZA 3I59A 1W0TA 1WAJA 4ON0A 4DBRA 3NGIA 5ERIA 2Y30A 2O7OA 3U1DA 1C1CA 4EIAA 1K78B 1XTAA 1MBJA 4HYEA 2P9KB 4E4HA 4KJZA 4BR9A 4A12A 2RV8A 5HOOA 3VQ7A 2F5DA 4IX7A 3OYFA 3V7CA 2HYGD 3M5RA 3LP1A 5AQVA 3SYZA 2Z99A 3EDPA 2B5JA 2GTDA 4ITVA 3L3VA 1VQ9N 2CS3A 1H9TA 3CCYA 3CPWM 1Q9XA 2HEOA 2IS1A 1VSEA 3L8BA 1IV0A 2A6EF 5M3MJ 5HNHA 2E1YA 5F08A 2MYSA 2E8AA 3DAWA 4KTZA 3JSMA 4KN7X 2QWNA 3G1OA 4C1NK 1R9TJ 3FZLA 4DR3K 3NE6A 1NK4A 2DFFA 3K4CA 2H27A 2FQ4A 3GTQJ 1HPZA 1U6ZA 1NGBA 3FZHA 2Y48A 3CERA 5D5UB 1EXQA 3D6RA 4FJIA 3TMOA 1IXCA 2QQAA 2B6AA 3VMFB 1YIJI 4IHXA 3DEWA 4DSFA 3I58A 4PJNA 2F5CA 3BY5A 3N4PA 1G3WA 4UUSB 2CYYA 1VK0A 4E19A 3HSFA 5BNGA 2NUBA 4FM0A 3CDLA 5EEGA 5L3BA 1JL1A 2LFBA 1SKSA 1LDKB 4O6JA 3QO9A 3J7YP 4IHTA 2LBFB 5KTQA 3U21A 3BQYA 2EQRA 3SQNA 3CMAN 2O8XA 1W0UA 2ZJRL 2F2EA 2X0LA 1BU6O 2OF7A 2JQ7A 3DLRA 1VFCA 4ANJA 1RRJA 5HVQC 1SC7A 3C2HA 5LMUK 2QF7A 3IRQA 3DCFA 3G4SN 3QEXA 4DR2K 3SK3A 2F4VK 3U4LA 3WUHA 4C23A 4FPBA 3BR6A 1D4XA 4EM2A 3PV8A 3NMUA 3HOXJ 2Z33A 1WBDA 4HUGA 3H1QA 4CEFA 3NCIA 4IEEA 4BL0B 2XRLA 1FEXA 1GLBG 3UKRA 2DAOA 4Y1CA 1OCPA 2NVUB 1TBXA 1WH5A 4S05A 1Y8QB 1W36D 2UXCK 3AA3A 4BR4A 3BDPA 1JI8A 2IBDA 3CO7C 1RKTA 1P4WA 2CUFA 3SLCA 4CZEA 4DV2K 5AQHA 4E7KA 3F3XA 4DFKA 3QAHA 1WSUA 4N56A 1HNZK 1QQMA 4JI6K 1ERDA 3I56I 2NXNB 3AARA 4BC2A 4CECA 1EH8A 4DLEA 3TWHA 2X6WA 1CLQA 1F43A 2HTJA 1O3RA 2MA3A 4F9OA 3BWGA 2HVIA 3DLEA 4WQ5A 3T7ZA 1NKCA 1VQ6I 2D5RA 3AVAA 4CH7A 5KAFC 2GOXB 3H3NO 4II3A 5TKWA 2ZJPF 4WFNL 4NB5A 4GNIA 1XWLA 1SL0A 1VQ9I
chains in the Genus database with same CATH topology
4W5QA 4I9LA 4DTRA 3NF7A 4CE9A 1SL1A 2PYJA 1IKYA 1LW0A 1GOBA 1Y97A 3K2PA 4FJHA 1DLOA 3G0ZA 4QOZB 2OYQA 2VWJA 3LDSA 2OA8A 2I5JA 3RR8A 1SL2A 4KB0A 2FC0A 3PUFA 1TL3A 2D0BA 3VN5A 4Z4IA 1XI1A 1BL3A 5HRPA 4FLYA 4FLVA 3FFIA 1JLBA 3CFOA 3MEEA 1C1BA 2WOMA 4H8KA 3HPOA 3K58A 5HROA 3DI6A 3O4QA 4GVMA 1KLMA 4CHOA 4LH5A 3LANA 4CK2A 3L3UA 4N56A 2YHAA 3DOLA 4FJ8A