2DFFA

Crystal structure of tk-rnase hii(1-204)-c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKITQDMIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 59
structure length 210
sequence length 210
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dffA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dffA01
4YFUA 3THVA 4CESA 4QOZB 1BCOA 4CGIA 4CF0A 3V81A 1T7PA 4DLGA 3OS1A 1HJRA 4CJLA 4J2EA 4CF8A 2OZSA 4F2RA 4AILC 4BACA 3NCIA 5KI6A 3OYEA 1RBSA 1QS4A 3O4QA 4CJ5A 1O1WA 2YNGA 3HPGA 2XY7A 5CYQA 3SI6A 4M45A 4JS5A 5HROA 3DOKA 3PX4A 3QLHA 4W5NA 1RTHA 4CE9A 3OYMA 4CJTA 1JL1A 4FLYA 4GMJB 1DLOA 1BHLA 1K6YA 1YT3A 2HHQA 4DTXA 4DU1A 1SKSA 4KAZA 4K8ZA 3LDSA 3OYGA 4HTUA 4C8LA 3ZSXA 4GVMA 3V4IA 2IDOA 4DTRA 4F4KA 1RILA 3KIOA 1RT2A 3SUNA 3AO3A 4DS5A 3ZT2A 1KFSA 3AVIA 4CJFA 4FJIA 3V9UA 4OPKA 3AO4A 3ZT3A 1EKEA 3QNOA 2G8WA 4CGHA 3LP0A 1D5AA 4CGGA 2VWKA 3SPYA 4FLXA 4L8RB 3LP1A 1ZYQA 4Z4EA 4BE0A 3KK2A 4CJQA 4M3TA 3B6OA 3AO5A 4FK2A 1C0UA 3CYMA 1RNHA 4DSIA 4LH4A 4CFCA 4FM0A 4DFPA 4OLBA 2IS3A 3QERA 3SUQA 4FZXC 3KKRA 1JL2A 3L2QA 4C8OA 3DRPA 4KV8A 2OZMA 3M8PA 1J54A 1Z25A 4Z4FA 2KFZA 4CJPA 3L8BA 2QXFA 2VG6A 3IRXA 3S3OA 1HNVA 4DF4A 1LW2A 3HT3A 4OGEA 1ZBFA 4PQUA 1UA0A 4Z0UA 4RW9A 1QHTA 3CM5A 3HSTB 4FJ8A 3V6DA 3HO1A 4DSEA 3CFRA 4FLZA 4B8CA 1T03A 2OPRA 5FDLA 4BDZA 3NE6A 4CHZA 4FLWA 4DU3A 1LWCA 4NYNA 2YHBA 4FCYA 1JLEA 4H4MA 3IAYA 1T05A 4RW6A 2QKKA 5HRSA 1VSKA 1X9MA 4DSJA 3U6FA 2HHTA 4CJKA 4B9UA 3M8SA 4FW2A 3AA4A 1WSIA 1RBRA 3RMCA 3MECA 1RT7A 1S1VA 3QINA 4E7IA 3QEIA 4B9SA 4N47A 1VSFA 4XIUA 1VSLA 1NJYA 3TAQA 4FJMA 3QIOA 1L3TA 3PO5A 3U3YA 4AHTA 4ZTJA 1SKRA 3C95A 4DU4A 3OS0A 4KRFA 1QTMA 1BI4B 4WE1A 1FXXA 3SQ4A 2PY5A 1DTQA 4CERA 1UAXA 5SZTA 4CEDA 3KLHA 1ASWA 4OKEA 3NHGA 1NK7A 3K5OA 4CEAA 5FRMA 4HUGA 1BIUA 2ATQA 2YNHA 1B9FA 2F8TA 3G10A 3NAEA 5HLFA 1VSJA 4DTUA 1WSHA 3DLHA 1I3AA 4M3UA 1S6PA 5J2QA 4AHRA 2G8IA 3QNNA 3T1AA 1S1TA 1S1XA 2GUIA 1REVA 2OYQA 4W5OA 3SZ2A 4NCBA 1Q8IA 4DTNA 2DFHA 1DTTA 2EHGA 3KLIA 3AVAA 3VQPA 3NH2A 1BGXT 4EP4A 3OYFA 1U45A 1RT5A 4Z4IA 1YTUA 1KTQA 4DFMA 4CJRA 1LV5A 3OVNA 3SV4A 3SUPA 2G8HA 1RBTA 4M3WA 4KREA 1KFDA 2RPIA 4CEFA 2G8UA 4B9VA 3S9HA 3EY1A 4CECA 2JGUA 4HHTA 3AA3A 5DK5A 3KK1A 3AVMA 3DMJA 1J9AA 2HMIA 4ZTFA 3VQ5A 3AA5X 2E6MA 3AVKA 4CEBA 1S9GA 4O0JA 3ZT4A 4BWJA 1NK4A 4DQIA 4FLUA 3EZ5A 3KD5E 1LAVA 3PV8A 2BE2A 3H08A 3QO9A 1ASUA 4IG3A 2ZQBA 4FM2A 1N5YA 2IC3A 1HPZA 3LANA 3U3GA 1VRTA 1TK0A 3RRGA 1KCFA 4MFBA 1NK9A 2G8VA 5C25A 4CJWA 4CJ4A 4JRPA 3VA0A 3TAPA 4FJLA 4M3XA 1GOBA 1UWBA 4W5RA 2XHBA 3CFPA 1L3VA 4AHVA 1RT1A 1JLQA 1KLMA 4CIEA 1S5JA 3VQQA 1XC9A 2Z1GA 4HCBA 3OYIA 3SYZA 1EP4A 3WNFA 2IGIA 3TI0A 1A5WA 4OPJA 3ZT1A 4KHYA 4O0IA 4ELVA 4DQPA 4OGCA 3VQ9A 3AVFA 4B9LA 3E01A 4IFVA 1TGOA 1CZBA 1NK0A 3KD1E 3OYHA 1JXBA 3OJSA 3AO1A 4DFJA 4FJXA 1KVBA 4RW4A 1S6QA 3SQ0A 1WAJA 4LH5A 3UIQA 2HHXA 2WONA 5SWMA 3RR7A 3HP9A 1BQMA 2EX3A 3M8QA 4BDYA 4EZ9A 4FK0A 3AVBA 4I2PA 3K58A 1WSJA 3ULDA 2E6LA 3F73A 4CGDA 3RTVA 1CXUA 2FBVA 3OYDA 1MU2A 3SCXA 4J2BA 4KHUA 4B3OA 3VQDA 3HP6A 3OJUA 4M3ZA 1QE1A 1RDBA 3LZIA 4DTMA 3RRHA 3DLEA 2W42A 1U4BA 1BIZA 2RKIA 2ITGA 3QEWA 3AVJA 1RT4A 5T7BA 1NKCA 2PYLA 2VWJA 3NGIA 4IDKA 1YTAA 4E1NA 2D0AA 3NF8A 3HVTA 2HHSA 4O5BA 1Y97A 2B4JA 3HVRA 3V1QA 2P51A 3O3HA 3ZSVA 3TAEA 3DLGA 1XHXA 3T19A 3SNNA 2BDPA 1ZBUA 1LW0A 4KFBA 3DLRA 2NUBA 1IH7A 4DSLA 3PX0A 4KHQA 5E41A 3ZSZA 3HPHA 4HUFA 4AHUA 1SL1A 4E89A 4FJ7A 1WNSA 4O55A 4EZ6A 4KI6A 1G15A 3LP2A 2HVHA 3DI6A 2I5JA 1L5UA 1WSGA 3IG1A 3TAGA 2E4LA 2VG5A 3V9SA 3MAQA 1RDDA 2RF2A 1NOYA 4DSKA 1L3SA 5HRNA 4FJJA 3V9WA 4N5SA 1TL1A 3RMBA 1N6QA 4F3OA 4KKOA 3VQ6A 4CK1A 1VK0A 2KW4A 1YVUA 3T3FA 1Q9XA 1TAUA 3KLEA 1FKPA 3ALYA 3VQAA 3AVNA 1C0TA 4NYFA 3NF7A 4FZYA 2KZZA 1S1UA 2QKBA 3QIPA 3NH0A 4OKJA 4HVJA 1TKZA 5C42A 4EP5A 3TAFA 4DF8A 1W0HA 3AVCA 3DOLA 3ZSQA 3NH1A 1XI1A 2P1JA 1KVCA 3HYFA 4FJ5A 1NK6A 1JLBA 1U49A 4KTQA 2IAJA 1T8EA 1SL0A 3AA2A 5CYMA 3VQ4A 5KRSA 1QQCA 3AVGA 1ZBHA 1IKYA 4E3SA 1CZ9A 4O44A 4E7JA 4DQQA 4B9MA 3OYKA 1KSPA 4BE2A 2ZD1A 3G0ZA 4B9NA 1J53A 2OPPA 4CJ3A 2D0BA 2ETJA 3KKSA 1CXQA 1NJWA 1B9DA 3I0RA 3QEPA 1RDCA 2KQ2A 2YNFA 3OY9A 4E7HA 1U47A 1NK8A 4CJVA 3JYTA 3VQEA 3DM2A 3ZSRA 2FBYA 4C8MA 1X9WA 4ELTA 1QSYA 4FJHA 4C8NA 3O3FA 3L2RA 2HW3A 1VSIA 4I9LA 3ZCMA 3ZSOA 4FVMA 2OPQA 4DLEA 2HHVA 3OYLA 3DLBA 3B6PA 1JKHA 3QEXA 4OKKA 4OVLA 3NF6A 3SJJA 2Q3SA 4ICLA 3MXMA 1TV6A 4M3RA 4CF2A 4NCGA 4FZZA 4DFKA 4FXDA 1LWFA 3OS2A 4H4OA 1RTIA 2F8SA 1RT3A 1LAWA 3HJFA 4JLHA 1RBUA 5I3UA 2X6NA 4Y1CA 3NFAA 4I7FA 1RBVA 1IO2A 3TWHA 1FKOA 1TKTA 3L2UA 3PY8A 3S3NA 2DY4A 3TAMA 5J1EA 1GOCA 2Z1JA 4QCLA 2FC0A 1EX4A 5JS2A 2X74A 3WNGA 4CF9A 2DFFA 4CEZA 4CIFA 4Q5VA 3BDPA 4FYDA 2PYJA 4IG0A 4DTJA 3LALA 1A5XA 1SV5A 4CF1A 4R5PA 1I39A 3I8DA 5J2PA 5JS1A 4DTPA 4RW7A 1QSLA 3KLGA 4K8XA 3F9KA 3L3VA 4LSNA 3OYAA 5HBMA 1IG9A 2Y1JA 2O4GA 1TVRA 3LWLA 1A5VA 3HL8A 3TABA 4PWDA 1HYVA 3DRRA 3HM9A 1TKDA 1C1AA 2HNYA 3DLKA 4CFBA 3D0PA 4CJSA 3D45A 4DSFA 4Y1DA 4M3YA 1C6VA 4HCCA 2P5OA 1CLQA 1SKWA 2A1RA 4CEQA 2P5GA 1SL2A 5C24A 3L2VA 3PUFA 1D9DA 1RTJA 3C6TA 4JRQA 1SUQA 1WN7A 3NGYA 4FJNA 4JS4A 3VA3A 1J5OA 4B9TA 3RWUA 3MXIA 3LPUA 1TKXA 3SPZA 3CQ8A 4Z4CA 1ASVA 1NOZA 3DYAA 3C94A 1XWLA 4FLTA 1WSEA 4KO0A 4FW1A 1EXQA 3KLFA 1UA1A 4ID1A 2GBZA 1NJZA 1TL3A 2F96A 4FM1A 3SQ1A 1RT6A 4IKFA 2X6SA 1C1BA 1RTDA 2HHUA 3C6UA 2ZE2A 3BGRA 1B92A 3M8RA 5CZ2A 4I2QA 4KHNA 5KGXA 4ELUA 4FJ9A 1VSDA 1LWEA 1D9FA 1KRPA 4LSLA 4W5QA 4BDPA 2BANA 5J2MA 4CCHA 1IKXA 4FK4A 4E7KA 5KTQA 1WAFA 3PO4A 4OLAA 4CGJA 2HHWA 2XY6A 4W5TA 3NBPA 3ZSYA 2XO7A 4DQRA 3RMAA 4DTOA 1HRHA 5HP1A 3I0SA 1GOAA 4CK3A 1BCMA 2DFEA 4Q0BA 3SUOA 2JLEA 5K14A 4J2AA 3CG7A 3NGZA 2KFNA 2AJQA 1NJXA 2Y1IA 1HNIA 1C0MA 1KVAA 4KB0A 1VRUA 4CHOA 2WOMA 5DMRA 4KHSA 1RDAA 3ASMA 1HMVA 3K5LA 4CJEA 4DS4A 4CHPA 3K5NA 3EYZA 4Z4GA 1BISA 3AVHA 2VG7A 5FROA 4DG1A 3KK3A 4FJGA 3QEVA 1JLAA 2HVIA 1WLJA 2FBTA 3AO2A 4QAGA 3QETA 3OYJA 3V9ZA 4BWMA 2DTUA 2LSNA 4OJRA 5KRTA 4LY7A 3ZSWA 3ZT0A 1ITGA 3A2FA 3ITHA 4B8AB 3HPOA 5I42A 1RCHA 1D8YA 2G8FA 4IBNA 2XY5A 5EU7A 4I9QA 1NKEA 3VQCA 5CZ1A 1JLGA 4C8KA 1ZBLA 4CK2A 3PX6A 3NF9A 1HQUA 4O4GA 5KGWA 3V1RA 1XHZA 3FFIA 4J2DA 4LD0A 4HUEA 1NKBA 4CIGA 1W9HA 2B5JA 1S1WA 3L3UA 4AH9A 3IS9A 1TAQA 2A1SA 3P1GA 2OPSA 2PZSA 1JLFA 3K2PA 4M42A 3HK2A 2IOCA 3VQ8A 1TK8A 3CM6A 2B6AA 3MEGA 2HNZA 5J2NA 4UQGA 2GV9A 3KTQA 2OA8A 3P83D 2YKMA 3MEDA 2BGGA 3QESA 1BQNA 1L3UA 3K57A 1R0AA 4E1MA 3LAKA 3JSMA 5FRNA 1UOCA 3V9XA 3OYBA 1VSHA 4RW8A 4NCAA 1TK5A 4CFDA 3VN5A 3O3GA 3ISNC 2FBXA 2Z1IA 3NDKA 4MQ3A 3MXJA 4G1QA 5HRRA 3K59A 4CHNA 2YV0X 3MEEA 1NK5A 4PA1A 1C1CA 1KLNA 4KB1A 3S3MA 1BI4A 2XRIA 3V1OA 3HXMA 4DQSA 3LPTA 4E0DA 5CY4A 4F2SA 4F3TA 3TR8A 1S9EA 3AVLA 4DTSA 2YNIA 2O4IA 4PY5A 3RR8A 3WNHA 4PUOA 4DWIA 4AHSA 3AV9A 4KPYA 3LAMA 2KTQA 1HYZA 3VQ7A 2HB5A 3OYNA 2D5RA 4M41A 1X9SA 1BL3A 3K5MA 3RMDA 5HRPA 3L2WA 4FJKA 4CJUA 4YNQA 4N41A 4CEOA 2QK9A 1JLCA 4B08A 3P5JA 1HQEA 3LZJA 2YKNA 4Z4HA 4ZHRA 4DMNA 2D0CA 1Q9YA 2RN2A 4E7LA 3LP3A 4CFAA 1EETA 4E19A 4BE1A 2X78A 4F8RA 4KHWA 5D3GA 3TARA 2G8KA 4H8KA 4N76A 3CFOA 1IKVA 3KJVA 4KI4A 4N56A 4KTWA 4CHYA 4TSXA 3O4NA 1X1PA 2Z1HA 1FK9A 3SV3A 4FLVA 1IKWA 1F21A 4ID5A 3WNEA 4AHCA 1QSSA 2R7YA 1WSFA 4RG8A 4CEEA 1ZBIA 1U48A 2XY8A 1HYSA 3LWMA 1VSEA 4GW6A 4CHQA 4KTZA 4IFYA 1Z26A 4CGFA 2HNDA 2KZMA 3OYCA 1JXEA 1U04A 3DRSA 3VQBA 3TANA 3SQ2A 2YHAA 1VSMA
chains in the Genus database with same CATH superfamily
1LE8B 2AS5F 2FE3A 4DLGA 2NNYA 4KT5C 1YIOA 3RPQA 4ZYDA 3HOTA 5CYQA 4JS5A 1YJWN 4HNTA 5J1RA 5GAGP 1N77A 4CJTA 4KH5A 4RGXA 1D1AA 2HGCA 1ITYA 3I55N 3AVIA 3CP2A 1K7AA 1YYVA 2DMQA 1NM1A 3RSEB 4M3TA 4JI6K 3UKRB 3GLLA 2P5LC 4FM0A 3HSRA 2A6EF 1V55H 1Z25A 4IHSA 2P9NB 3GTPJ 3HSTB 3K9TA 2WAQA 4B8CA 2X85A 2OPRA 3GCMA 1LFUP 1VFCA 2P9UA 3U6FA 2EWNA 2F5EA 2ZXHA 3QEIA 4B09A 4J01A 4KRFA 2NRTA 5ELZA 4OKEA 2X1CA 4CEAA 1HKCA 4B44A 3BG6A 4JI8K 3RCOA 5DM7L 2HF4A 1LFPA 1YS6A 2VBZA 2IBDA 3FDYA 2IW5A 3LOCA 1XUPO 3I64A 2AXTC 4B47A 3S14J 3FIWA 2HVQA 1S22A 3AA3A 2QUFA 3AA5X 4CEBA 5GP9A 4K42A 1TK0A 3WXJA 4MFBA 3OHRA 5TGTA 3TAPA 4F52A 5AFUH 3VQQA 3CLOA 2IGIA 3U21A 4IRGA 4OGCA 2VONA 4HOBA 4WWCA 2VASA 2EFPA 3E5XA 2XAFA 3SQ0A 3M7GA 1I6XA 4C2TA 5JFRA 3PIPL 4E1NA 4BRNA 2BDPA 2NVXJ 3DXKB 3O6WA 1BA1A 1GV2A 2Z2SB 1U6ZA 4M9XA 4C3IJ 2QSFX 4B1UB 2FSNA 2DODA 3QMLA 3HRSA 1LEBA 1C0TA 3QIPA 3RVCA 2UXXA 3NH1A 1HKTA 1YIJN 3BOQA 2DMUA 1GUUA 4O44A 2NRAC 4XBFA 1CXQA 1B9DA 4JX5A 1OR7A 1TWFJ 4DR4K 1Y6IA 1BN5A 4L0YB 1R1TA 1XSXA 3ZSOA 5LHIA 2HHVA 1F43A 1HUXA 2R5YB 3G4SN 5I3UA 2BE5F 1VQ4I 2MFZA 4BNCA 2WC9A 1A5JA 2X74A 1GLFO 3RIRA 3JRDA 2Y9ZA 3MWMA 1SD7A 1U9OA 2XPVA 3N05A 2P5GA 3NAUA 1V3FA 1J9IA 3K9JA 4M3FA 3U1DA 4C3HJ 3CCSN 2VBWA 4LC9B 3LAJA 2EFOA 2ZGYA 2RC4A 5AONA 4BVOA 3L6QA 2EIMH 3Q0WA 2R7OA 2FXUA 1MNEA 5C0YA 2XY6A 2XO7A 4DQRA 5J4VA 4C3JJ 4XLHA 3G71I 4Q0BA 2W4SA 2KFNA 4ZZDA 4HSTA 2HI3A 2RNGA 3O8HA 2LREA 1OCCH 3GBGA 2XSDC 3OYJA 3V9ZA 2DTUA 4M73A 4LY7A 2Y0SA 2L7MP 1AU7A 2HYJA 2K85A 2XY5A 5EU7A 3FHNA 4CZEA 4CUGA 3PX6A 1W7AA 4MO4A 1XC5A 3GTQJ 2KZVA 3L0QA 2RAEA 1S1WA 4AH9A 1F1ZA 1I3QJ 1X19A 3UE5A 2M4KA 2IOCA 2STWA 2OA8A 1T3VA 4OPHA 1J09A 3M1FA 1ZTRA 3CCMI 4PA1A 2ZMEA 4L5EA 4LB6B 4KPYA 1VQ5I 2MH2A 2D5RA 4BRCA 3F8BA 2P9IA 3SFIA 4D5FA 5LHHA 2IS4A 4HSRA 2ZSHB 3HSFA 1XGNA 2A42A 1Q1VA 3OV8A 1QVFM 3PLAA 5M3FJ 1EETA 4DV1K 1B4AA 3O4NA 2P9PA 4ITVA 1P92A 1HNXK 4A6EA 4CEEA 1TT0A 4CHQA 4IFYA 2BYVE 4FWMA 3P9IA 2O7OA 3BF3A 1DGKN 5ICGA 2EK5A 1QS4A 1O1WA 3EYIA 3E9LA 3CJNA 2JTVA 3Q7CA 4KAZA 2UU9K 4A3IJ 3L00A 1S29A 4O8KA 1KFSA 3V9UA 3JRAA 4MDAA 4LG0A 2DAOA 4FLXA 5FLMJ 4BE0A 4CJ7A 5IOYA 5IP7J 2CH6A 4LH4A 5LBQA 1K79A 1TNTA 3SJHA 3G6EI 3CJBA 2YUSA 1IXRC 2HBLA 4OIQF 4BDZA 2HOTA 2YHBA 4JK7A 3UB5A 1QHAA 4AC0A 1OLTA 5K5QA 1IV0A 4BY7J 2VB6A 1RT7A 4E7IA 4N47A 4AM3A 1CF7A 3U3YA 3KE2A 1RGIA 5EY4A 4BR5A 2YSRA 3WE2A 1YJWI 1NK7A 3W2AA 4RAFA 3LQRA 4PDKA 4CH7A 2YCHA 5IT9Z 1S6PA 1Z7UA 4AD9A 3OMYA 2YHWA 2CUZA 3I59B 3T69A 3SZ2A 2CO5A 3OYFA 3VDXA 3THWB 2ESHA 4LFUA 5A2QO 4KREA 1P2FA 2CV0A 4FQGA 3C6HA 4O5FA 2HMIA 3TMOA 2WB1N 3CETA 3AVKA 1S9GA 3F8FA 4O0JA 1F9NA 2OC6A 1HBXG 1N5YA 3MCZA 2GLOA 3GWZA 1HSTA 3J80O 1XC9A 1TQPA 4HCBA 3OYIA 3SYZA 3WNFA 5BNGA 4BGAA 4IQJA 2BUPA 5GADJ 1CZBA 5AQJA 2OAZA 3KP4A 5SWMA 4BDYA 2EX3A 1VQLN 1H89C 4MQ9F 3OJUA 3T0YA 1R5GA 2RKIA 3ATVA 1GHCA 5D6EA 3A5NC 3HVTA 3MZ8A 3DLRA 2PMHA 4E89A 3DXMA 1G15A 1OR7C 3RPUA 1NU0A 4V2GA 2DMPA 3NF7A 4K43A 3ZSQA 4DUZK 3SYTA 1XI1A 4Y52J 4GY2B 5AQVA 1FYKA 5J47A 5H20A 3E7LA 4E3SA 3CD6N 5D8LB 3LMMA 3KKSA 4IWVA 3KEQA 4A5BA 3OY9A 4GKKK 3T1YK 3DM2A 4MLOA 1FYMA 4AIDA 4A6DA 4CYDA 1FOXA 2VLAA 2IA2A 4DHYA 4JD2B 2A5WA 1U5TB 2TCTA 4IJNA 5GINA 4OKKA 4YFKF 5JVTA 4GV9A 1H8AC 2O8FB 1APLC 4YOUA 4RS8A 4I0BA 4BREA 2HEOA 3N4PA 3WNGA 4CIFA 2WADA 4ZYAA 2COBA 4LOCA 3DRRA 3NARA 3AAFA 4CI6A 2DDBA 1GDTA 2FBKA 4DBRA 4BEHA 1SL2A 5C24A 5DD4A 1S8NA 1VQPN 1V4RA 2JVGA 1EF4A 4JKBA 4AVPA 3ASOH 1TTYA 1YIJI 3SPZA 1Z05A 4XONA 3X2QH 5KVRA 1ZLKA 4KO0A 1XMXA 5GAEP 1TLHB 2ZE2A 1O3SA 5CZ2A 3H3OB 5BMZA 3IAS2 4W5QA 3OOPA 4MO5A 2IJLA 4BHPA 1OH7A 4CK3A 1CZAN 4EM0B 4DR1K 3AL0C 3HI0A 3TTCA 4KHSA 3GTJJ 1GXPA 3G4SI 3I33A 1PUFB 3AVHA 3QETA 2G8FA 2ZMEC 4I9QA 3LM2A 3KETA 4FWKA 4DV0K 2CV1A 1SC7A 3V1RA 5C12A 4WQ4C 1MBGA 4GKJK 1TWHJ 4CZIA 1BIBA 4WFNL 4CCMA 3VQ8A 3CCSI 5FPNA 5TISC 3GZ5A 4M63C 1MBEA 3JSMA 1W5SA 3LFUA 3LSMA 3TTDA 2Q1ZB 1BC7C 1HW2A 4CHNA 2KMUA 4FPAA 4DQ2A 1GLDG 4U67L 1NGDA 4OAZA 1NH3A 2DJNA 1S5LC 2Q0UA 5TKWA 1MDMB 4YNQA 3R0JA 5K7ZA 4LF4K 3BZ6A 4P96A 3VGKA 2YHXA 3VERA 3KPHA 2HTJA 2XF7A 1ZBIA 1T2KA 2RV8A 4BHCA 1FP2A 1T98A 4O8UA 2LF8A 3A1YA 4CF0A 2HQNA 2CUFA 4W1UA 3HRGA 2QWRA 4QWQA 2HHQA 4XIDA 3M1EA 4C8LA 4PHTX 4I7HA 4GVMA 4A2AA 3CCVN 2PI0A 1KQ9A 4CJFA 5LGUA 2NRXA 4CGGA 1B9MA 4NLCA 3FE1A 3H9GA 4UV9A 1R5ID 2IS3A 3REOA 3HOUJ 2WFBA 4KV8A 1VQNI 3DCFA 2Q36A 3FM3A 4FOEA 4CJPA 1HNVA 3WU0A 1LW2A 4OGEA 4LMYA 3SMPA 1VQ9N 4M3DA 3GLXA 4A3LJ 3IC7A 2QM3A 4JI7K 4K25A 3IAYA 4H5VA 2UXBK 4A12A 2E20A 3MMVA 1TC3C 4LLNA 4B9SA 1NJYA 3TAQA 4ZTJA 2MA3A 3PNVA 2R7QA 4OO1J 2E88A 1FXXA 1T08B 1N33K 3KLHA 4CICA 5AQIA 1BIUA 4IQ4A 5DCMB 2OQRA 2HBKA 2DFHA 2O8EB 2EFNA 3JRGA 4Z4IA 2KPMA 2F4IA 5I9EB 4FWNA 5H2FC 3IL2A 4B3AA 5DK5A 5DD8A 4BWJA 4OX9K 4H5WA 1ETXA 3LANA 4XSZF 3K6GA 3HTVA 3RSNA 2IGMA 3EO3A 1S5JA 3O6BB 5DM6L 1A04A 1EP4A 4O3MA 4OMYA 5BPIA 1X4PA 3UIQA 5GPCA 3W6VA 2E2OA 4LF6K 3OYDA 3H5RA 2WB1A 4XL9A 1YE9A 1BIZA 5BS6A 2DPNA 3E9OA 2NOJB 2BEOA 1NGAA 3TAEA 4ZYGA 2OZUA 3VTIA 3ZSZA 3MK6A 1V4SA 3LP2A 3DI6A 2GAUA 2W6LA 3MFKA 2FBHA 1W7PA 3MAQA 3K4LA 1JKOC 1ON1A 4XH4A 4A59A 5KPRA 2PFUA 1I5ZA 1S1UA 2IRFG 3S16J 3HYFA 3GYHX 3LA2A 3KP2A 5B5EC 4WXDA 1UELB 2AQFA 3FHZA 1NJWA 2P5KA 2W40A 2NLXA 2F5CA 4A3CJ 4AYBN 4M3EA 3WTUC 3PIOL 4DV6K 1K8KA 1VQLI 1MBFA 3P31A 2KRCA 4HNUA 1KC8O 1KU2A 2DY4A 3S3NA 1FW6A 5JS2A 1V5EA 2PYJA 3R9PA 1SV5A 5JS1A 1IG9A 2GOXB 1MA9B 2O4GA 1FIPA 2YX7A 1C1AA 4Y1DA 4PJ0C 4QS9A 4AF1A 5LMUK 2X6WA 2A05A 3ZMZA 1SD4A 4ID1A 4HZFA 2CV2A 3BGRA 2Q1NA 5BRHA 2CW8A 2WA0A 1BDGA 2YU3A 4B1WB 2LYCA 3BQZA 4BR0A 4XNFA 3KEOA 2DFEA 1ZG3A 1D8JA 5HVQC 2GEMA 2NRZA 1Z1DA 2DN0A 3ONQA 1B8IA 4EIAA 3K5LA 4S05A 1R00A 4IO9F 1BISA 4LF8K 2E60A 3TO7A 4CA0A 3ISPA 2DTRA 2ECBA 1EQYA 2P7VB 1DDNA 4J2DA 2FD5A 3EEQA 4EFHA 4D9JA 2WV0A 1VQPI 2B6AA 2AHQA 2DT5A 3BCBA 1VSHA 4RW8A 2XF5A 3PO2J 1IJWC 2BVLA 1NK5A 2HDWA 2PJRA 1BR1A 2CGPA 4B1ZA 1H9TA 3RKQA 3ULEB 5ICCA 3K5MA 4CJUA 1MSEC 4YOTA 3C0BA 4EATA 1YXQA 4CSWA 1FBUA 2D0CA 4F8RA 1L3LA 1T6DA 4N56A 1TWGJ 4A3MJ 2MLGA 3THYA 4A69C 5GAHJ 2AA4A 2R5ZB 2EV0A 4L5IA 3OIQA 3K4KA 4BRHA 4CZLA 3M3ZA 4JKGA 3J7ZO 3K0LA 4EJTA 1R58A 2EB7A 1BHLA 2DDAA 1Y8QB 3DU6A 4DTRA 3ZT2A 1USSA 1AWCA 4YOVA 3QNOA 4LD5A 2VWKA 2JRMA 1NWKA 5E3LA 4UVCA 1AHDP 3EKUA 1SD5A 4HYEA 2ISZA 4Z4FA 3GZNB 1UHSA 4JI1K 1XDUA 3HO1A 4XH1A 2OBPA 2MBFA 2LTPA 2BTFA 4UNOA 4BRQA 1FSEA 3IRRA 4AIJA 1VQ8N 4B9UA 1YI2N 5E79C 5HNHA 1VSFA 5DS9A 3H1CA 5IPAA 2XAUA 5FRMA 2GXAA 5LLQA 3W3CA 1WGXA 1S7AA 3LFKA 5FD6A 2R7UA 1YAGA 1YTUA 5FD5A 4P9FA 3GTMJ 4WCEL 4FWPA 5AQKA 1X1AA 1BOAA 3AVMA 3K70D 3U8XA 3VQ5A 2HQ5A 3MKYB 4K41A 1LAVA 3WHCA 4G7OF 2AQEA 4DR3K 5AQPA 4JRPA 3BTCA 5AQQA 1VQ9I 1UWBA 1E17A 3WTVC 5EYRA 2ELJA 3TI0A 1KYZA 1MWKA 4IFVA 1XD7A 2W57A 3K4CA 2WBNA 1XG1A 4XM3A 3RR7A 3FBNB 3S32A 4U87A 1TT5B 4KHUA 2W42A 5LEKA 4JKAA 5C3EJ 3CUQB 4BRAA 5H1SQ 3T19A 4I6MB 3CPEA 3QRFF 1ZG5A 4HUFA 3GTKJ 1MBHA 2H94A 3OR2C 4M6YA 2VG5A 1N6QA 5J40A 3T3FA 3CO6C 3ALYA 4KICA 3QDKA 3SDGA 9ANTA 3ZP5A 1HCRA 4RBOA 1IRFA 5BRFA 1IG8A 1IN8A 3R1XA 1IKYA 4A2UA 5FKKA 2ZD1A 2ETJA 2CQKA 3I0RA 1JE8A 2WTEA 1RDWX 4CJVA 4D7MA 5AFUA 1YITN 2WWYA 1R1UA 3QYFA 4I9LA 1VNDA 4EHTA 2W84A 3OYLA 1E3OC 4V2FA 3ENOA 5GAGJ 2OTJN 2X48A 4ILHA 4NCGA 2A61A 2M8EA 4F55A 2FC0A 3ROUA 4HG2A 3LALA 4ISEA 3I8DA 3LL7A 5FLXK 3OYAA 2EWSA 5J1YA 1A5VA 3HL8A 4AYBA 1QQMA 3D45A 2JWLA 3VEPA 4M3YA 1LCUA 4JI0K 2NZTA 4L5JA 1TKXA 4BRDA 4Z4CA 5EG0B 3DYAA 1LQ1A 3OTOK 1TL3A 2WV1A 4IHVA 1RTDA 4A3BJ 4LK0F 4A3KJ 3G1MA 2PBIA 4BDPA 5LEJA 2FNAA 4DTOA 2LBFB 2BVMA 3F6VA 3CG7A 3BQYA 1C0FA 1KVAA 3JAMZ 4DS4A 1T95A 4Z4GA 3SAHA 1VQMI 1GVJA 2NRVA 4QAGA 2BY1A 3FK7A 3HXLA 4NQWB 3UKUB 3F22A 4MLHA 3ERED 1XPXA 4KMFA 2QWQA 2XAGA 2F7TA 1SFXA 1TAQA 2WY8Q 3VGMA 3HGYA 2ME6A 3QP6A 2OTLN 1MH4A 4NO7A 2GV9A 3GMEA 5FFZA 3QESA 4B3MK 3K57A 2W82A 3ZN0A 3QP5A 3OYBA 3DPUA 2HZDA 3E6BA 2FBXA 3ABUA 3FXQA 5EDNA 4I99C 1ETQA 2YX4A 4V19S 1A6IA 2XB5A 4M41A 1TW3A 3KZYA 5HRPA 1D0YA 5M5YJ 1LKXA 2IVNA 2PMZN 1NNEA 1HDDC 4FL9A 4QTRA 4E70A 3RI4A 3ZQ7A 1Q9YA 3HUGA 3LP3A 1VQ6N 4ENNA 3DFGA 2O0YA 2QQAA 1U04A 1FBQA 3DJCA 1ATNA 2D0PA 2XSJC 3MAJA 1QZ5A 3FZMA 2JVHA 1ZH5A 3CJRB 3D2EB 4CZKA 3OYEA 2ZBKA 1QQIA 1OH6A 4CE9A 3ZETB 4NDLA 1K6YA 3FK6A 1SKSA 5JMVA 4F4KA 1O4XA 3AO3A 1WJEA 4FWLA 1MMNA 1ZR2A 3CYMA 2M45A 1WWXA 1W36D 2JMWA 2YX6A 3F8CA 1NK3P 4DF4A 1HF0A 2OD5A 1GLEG 2GM4A 1WCMJ 1WBBA 2V1UA 2Z99A 2XGDA 1UB9A 1T05A 1FMWA 1F4KA 4H03B 5E3NA 5EGOB 5D4SA 3HZ6A 4D7NA 3MECA 2Q0OA 3BDDA 3DTKA 5CKTA 4WE1A 1QA6A 1DTQA 3K5OA 3H3NO 4BR7A 1NGHA 2KRHA 1ZBSA 5J2QA 4XSXF 2A07F 3AVAA 2Y30A 1IGNA 4EVIA 2RKHA 5E1XA 2G8UA 4B9VA 4FWSA 5BR9A 4Q4ZF 1B59A 3R61A 2Y31A 2F4OB 3PSFA 3VEOA 2E36A 1H9GA 1KGSA 3E66A 1JLQA 1ZARA 2Z1GA 5GIOA 3LAPA 3OBYA 4GRIA 3ZMTA 1IV8A 1SVOA 1VQ8I 4EZ9A 1W1WE 1YI2I 4B8XA 5BQTA 2E6LA 4M6XA 1FYLA 5EZGA 1HKQA 3ID8A 1ACIA 1I1SA 5BPLA 2P6SA 4CYCA 3Q7BA 4JX6A 1NKCA 1FSHA 1Y1WJ 3NF8A 5C2DA 3DLAA 3TKYA 3O3KA 4H0EA 3H9JA 3V7SA 1LNWA 5AJ3K 1H0MA 2QXLA 5E41A 1JUMA 3LSRA 1L5UA 4UUSA 1LDKB 1L3SA 1TL1A 3CQYA 2VGMA 4RWTA 2R7DA 4I02A 2HHHK 5KAIC 1FLIA 4EP5A 4FJ5A 1ZLJA 2F5FA 1NK6A 3U9GA 4XRSA 3AA2A 5GADP 2O03A 1ESVA 3CTAA 2JZYA 4LF9K 4X65K 4E7HA 3D2FB 3ATUA 2CQNA 2M87A 3P38A 2M7BA 1WOQA 1NG9A 1JI8A 1OYWA 3DLBA 2V1NA 3B6PA 5CVUA 4HX7A 3THXB 2VQCA 1BBYA 4XOPA 1RR7A 3R3LA 4Y1CA 3TWHA 3L2UA 1FKOA 1BJAA 4RGRA 4M71A 4CF9A 2DFFA 3VYTB 5J2PA 3W3DA 4I09A 1GT0C 5EVZA 4CZMA 4U88A 1XNRK 1HSJA 3VGLA 2EZHA 3GBTA 1MKMA 2GWRA 1SUQA 1G3SA 2E5LK 4A3EJ 1M90O 3WXLA 1DT9A 5CVJA 4I2QA 4L9JA 1MDUB 2BANA 2A6HF 2HHWA 1MD0A 4W5TA 1QHGA 1HKSA 2KP6A 2D1HA 5IYDJ 2OTJI 1IC8A 1SEUA 2HF3A 3K7AJ 3FXMA 3HZJA 1D5VA 3H1QA 2VOPA 3EKSA 4YOXA 3N97A 5KRTA 2UXCK 4PFOA 2DCEA 1W5CC 3IAM2 5I42A 3M07A 4CCKA 1ZBLA 3ZX2A 3JS6A 3CMAN 3LSGA 3FFIA 4J00A 4LD0A 4HUEA 1YRNB 4CIGA 2OPSA 3K2PA 1TQIA 3HK2A 1PJRA 3HJEA 3TSUA 1OH5A 1Z67A 5D4RA 1AA7A 3VESA 2D5VA 3ISNC 3HJFA 4M6VA 4G1QA 1BI4A 1RNLA 3WNHA 3OYNA 1BJZA 5AZJB 2VE8A 4IHXA 2BHZA 4DKWA 2NAZA 3CJ7A 2P9LA 1J6ZA 2CU7A 4KTWA 3IH2A 4KIGA 3R6SA 1FK9A 1WSFA 1DP3A 3LWMA 3ZYYX 4A5NA 2QWMA 2HNDA 4RDUA 4DV2K 4YFUA 1G2HA 4WCGA 4QOZB 1VI0A 3HHHA 2L7FP 3U2RA 4CJLA 4BJ5C 4EV0A 2LKXA 3GTOJ 1BUPA 2PMZA 3NCIA 1RBSA 5M1PA 2OTLI 3FR0A 3BP8A 4JKEA 4K8ZA 1QVTA 2GBYA 4FVUA 1E3HA 2IDOA 3HBTA 2XKOA 1RT2A 3V7RA 4BY1J 6PAXA 3RZDJ 4FJIA 3J81O 4CGHA 2EV6A 2ZJQL 2EBIA 1ZYQA 1Q82O 2IA1A 3QU3A 2VXZA 4CJQA 3AO5A 2BXYA 3H3UA 3SUQA 3CF2A 4OOIA 1BR2A 3M8PA 4LG3A 3S3OA 1B72B 2XPUA 2P8TA 3CC2N 1YUWA 2BZTA 3TDZC 2IVOA 4IL6C 4X64K 3LA3A 5J1UA 5AQLA 3M8SA 3RQ4A 3FXJA 5HLHA 2ICWG 3PO5A 3FF5A 4IOAF 2M0CA 1SKRA 4BH9A 3VEVA 2GUPA 3KZIC 2PY5A 5SZTA 2R3SA 2K4BA 4RAYA 4CEDA 5EJCA 1Z3YA 1HNZK 4E6KG 2ATQA 4IXAA 2HOEA 1MMAA 1ONVA 3IDHA 1JUSA 4NCBA 1RT5A 4ZYHA 2VYPA 4M3WA 2DO7A 5FKLA 3KK1A 1X2MA 4DV5K 4RB1A 4QLCU 1J2XA 1YX3A 3A01A 3TQNA 4AHVA 5IT9O 5HDKA 5DM7F 2EINH 2J5OA 4HWIA 4ELVA 3AVFA 3EUAA 3OYHA 4DFJA 1HA8A 3CUOA 2QTDA 3BG9A 1QE1A 2A3SA 2W24A 4I76A 4RMNA 3QEWA 4LFAK 3NGIA 1IBKK 2D0AA 1Y97A 2B4JA 3ZQCA 2V7YA 5KNLA 3ZSVA 2QM1A 2CFXA 4FISA 4Y3OA 3QB0A 5JI6A 3V7CA 3ZX0A 1I27A 1MNDA 1EH7A 4QS7A 5F27A 4CCOA 2KRFA 2QKBA 5JVGL 4DF8A 1WBDA 1BIAA 1FBSA 2P4WA 2ECCA 4MNUA 1JHFA 4E7JA 4BR2A 2VJ4A 2M4GA 1J53A 1V4TA 3FWEA 3QEPA 1U47A 2QSHX 2Q0RA 4KN4X 4PK4A 3V4GA 4WF2A 4G7HF 5IOZA 5LRSA 2E2PA 3CC4N 4M72A 5IP6A 1IN5A 5K7HA 3QAHA 3MXMA 3S17J 1YTYA 1FOYA 2VQFK 2K5CA 4OIPF 1RT3A 4IRHA 1IO2A 1TKTA 1T0FA 1YW7A 4IG0A 4K8XA 4CW7B 2Y1JA 4UV8A 3LWLA 5CE3A 2OCEA 1TKDA 4HCCA 4E1JA 1SKWA 2A1RA 2K9NA 4YIFA 2RN7A 5FB2A 1X4OA 3O9SA 1J5OA 4BG9A 3MD2A 4RA2A 5FLXZ 2LY9A 3IWFA 1UA1A 4JKFA 1Y0UA 2O8KA 1KU9A 3DBRB 3JRIA 1D9FA 4X1EA 3KYDB 4DV7K 2VQEK 4H0VB 1QQNA 4B3TK 3ZQGA 3B6CA 3I54A 3H36A 5HP1A 3OSFA 4CD3A 5JLXA 3A4CA 2H6BA 2MGQA 2WOMA 1WJBA 4BL0B 4CJEA 2YR2A 4RB0A 2P9SA 3QEVA 1ILYA 5KCMA 3A2FA 4DR5K 3KWIA 1YO5C 1JCGA 4YOWA 3DKXA 3S2DJ 5ADXA 2A1SA 4L0ZB 2PZSA 1JLFA 1CGPA 4II2A 4UQGA 2MC3A 4GYIA 3S1MJ 3L2CA 3PNTA 2YS9A 2UYTA 3ESWB 1R5HA 1H88C 3NDKA 3I8BA 4MIMA 4BQLA 4F9OA 1P7JA 3VFZA 2JSCA 3TR8A 4X62K 4UY8I 1YLFA 2E2IJ 1FOKA 4B3XA 1X9SA 4BRFA 2L4AA 3W2WA 4JK1X 1E3MA 3I9V2 2RN2A 1E0EA 2Z33A 3G25A 1F21A 4E7SA 2CYYA 5LGNA 1S7EA 3NWTA 2NVQJ 1OQYA 2YHAA 1VSMA 4F92B 3CMAI 1D3YA 2ZCWA 1QZYA 1BCOA 4CGIA 3HRTA 3OS1A 2G7HA 4CVNE 2F5DA 1EH6A 3V8KA 1BU6O 3MCAB 2YNGA 2Z3YA 1JL1A 4GMJB 2I7NA 3NMUA 3KIOA 1SFEA 3DBHB 3SUNA 4NB5A 5K7FA 3C7NA 2G8WA 3FZKA 5F08A 3VPRA 1EJ9A 4CCJA 2YJFA 4H5RA 5LMNK 4EM2A 2QI2A 2JK3A 4RM3A 4RW9A 3CM5A 2JT1A 3V6DA 5GAHP 3PO3J 3HBLA 4BU2A 1MIJA 1HLUA 2XUBA 4FCYA 4H4MA 4U0VA 4F7ZA 2KIQA 3BJAA 2QA4N 4CJKA 2QQ8A 2VODA 1F36A 4DR2K 4NUBA 3T1HK 4XKVA 4CZJA 2DMNA 4PKIA 3SXYA 1TZLA 2O8DA 3IMXA 1ASWA 3CF5L 2YNHA 2F8TA 3DLHA 2P9IB 5BN8A 4JK8A 2YI1A 2E5ZA 4G12A 4W5OA 1Z7LA 5LRRA 1GV5A 4EP4A 4CBUA 1SS6A 3U4LA 1LV5A 3VYSB 1KYWA 1Y64A 1AOYA 2LD5A 1RBTA 1KFDA 3F72A 3FXLA 2H27A 4DOZA 2P9PB 3ZT4A 3KP5A 4NBQA 1WJ5A 1HPZA 3U3GA 5DYMA 5L3DA 2LSOA 1RT1A 1NMDA 2HOAA 3CC2I 3S1QJ 1A5WA 4OPJA 4FETA 2D2WA 1JXBA 2EILH 1S6QA 3K1NA 1QPMA 4BR9A 1NHAA 3A0BC 4ILGB 4DTMA 4LG0B 4UUTA 1YW9A 2KLAA 5EOYA 4WXCA 2X6YA 3HPHA 2FSKA 4KITB 5HLIA 5ICEA 4YFXF 2K9LA 1BI3A 1TBXA 2MD5A 4FE4A 1U6GA 1MMDA 3NH0A 2CQQA 1TKZA 1W0HA 1U5TC 3M1CA 1RESA 3TSPA 4BJTA 1DKGD 1UMQA 1UCRA 2IGKA 2ZJRL 1T39A 5LHGA 1CZ9A 5LD2C 1CF7B 4J19A 3NQOA 1QHHD 3L1PA 3JYTA 1T44A 1FP1D 2QWNA 3LDNA 3ZSRA 5DTDA 1QSYA 3L2RA 1L0OC 1VSIA 3J80Z 1YJNN 3TW6A 3F8MA 2ACJA 4H4KC 3VPZA 3JSOA 2F8SA 1LAWA 3BG7A 2O8CA 1HLVA 1EA3A 1RBVA 3I4NJ 3O4WA 4LB5A 4BAYA 5CVVA 5TKYA 1QVUA 4ESFA 3HG9A 1NMNA 4KH4A 3C65A 1D9DA 1X2NA 1RETA 4YHHK 4CBXA 4YIRX 4A93J 3ZCOA 1XWLA 1RR8C 4BRMA 1EXQA 4QIWN 4XKWA 4XLEA 5L3GA 4IKFA 2DJIA 3M8RA 1HPMA 1BW6A 4LSLA 4X6AJ 4OIOF 1VHXA 3BT9A 1POGA 3CC4I 3WUHA 4WQ5A 3SUOA 1A36A 3DXMB 1ZRCA 2CH5A 3L7WA 3OIOA 1WUAA 1NJXA 5M5WJ 4O5VA 5KAFC 1HNIA 1H1VA 2L01A 4FJGA 2ADUA 4IOAL 5M1KA 1ITGA 1NGCA 2PQ8A 3AGRA 3GVAA 5F1XA 5KGWA 4OIRF 2F9TA 1TYQA 3L3UA 3E97A 3IS9A 4R8HA 3P1GA 1WHUA 1BL0A 4M42A 2OQGA 2VQGA 2VQLA 1ATSA 1S3XA 3MEGA 3BJOA 2G0EA 3P83D 2RHKA 2OZ6A 4A5MA 3WQUA 2A6AA 4N9IA 3H3VK 3MXJA 3LDPA 1O3RA 2LFBA 1BG3A 5FKNA 3ULEA 2QQBA 1J7KA 1BL3A 3D6RA 4FJKA 1KQ0A 3LDOA 2IVPA 1FJLA 2VJIA 1IKVA 2Z5UA 4BEHB 3GOIA 1X1PA 1T8IA 2RNJA 4MTDA 4KA4A 3UKGA 1MMSA 2KDZA 4KFCA 1XCVA 3K4JA 3MCPA 3SQ2A 5TRDA 1K78A 1VQ7N 3THVA 5D5XB 5IT3A 3HC7A 1E3PA 4HX8A 1OCTC 2QLZA 2GZWA 3ZR8X 3DBLB 4M45A 2ZJPL 1XN7A 1R22A 2R7SA 4X0GA 1KZHA 1XMAA 3OYGA 4C9YA 1MW7A 3GW2A 4DYRA 3LA7A 2DK5A 2QYOA 2K3FA 1K6OA 4IPAA 1K61A 4ESBA 3HRMA 3H92A 1D1CA 3WTYC 3EPZA 2E2QA 2GTDA 1J54A 3NVMA 2QXFA 3HT3A 1S7OA 1GLAG 2VOOA 3DV8A 5FDLA 2RDPA 3TDUC 4I01A 2XGEA 1D5YA 2UXNA 3RMCA 1S1VA 3SFZA 3QYBA 1L3TA 3S2HJ 4AU7A 4DU4A 1WQ2A 3M9AA 2I5UA 2TDXA 2V1XA 3MQ0A 1MJ9A 3NHGA 4EJOA 1OPCA 4HPQA 1VSJA 3R6MA 3T1AA 1S1TA 4AIHA 1REVA 4L9NA 1ATRA 3KLIA 2PMUA 1KTQA 1K9MO 3O5BA 1ZELA 3DU5A 2GWKA 4B4CA 3WXMB 3OVNA 3JRCA 5ILSA 2A5XA 1TWCJ 2FSJA 4IG3A 3H08A 1QO0D 1ASUA 2ZQBA 3L4QA 2G8VA 4DR6K 4FJLA 1QBJA 4OWRB 3VODA 3K1MA 4O0IA 3R4KA 3PFIA 5KQDA 2QA4I 3PQKA 1WAJA 3IUOA 4WFBL 3O9UA 4A62A 1R9TJ 2QVOA 2OF7A 5EEHA 2FBVA 4B3OA 3NVKA 3IRQA 3RRHA 2O8BA 1G3TA 3ECHA 3A0IX 3O1BA 2XKPA 5BOXA 2DU9A 5DM6F 1N8RO 1YX5A 3S93A 2NNWA 3TAGA 3V9SA 4A3JJ 2KJBA 5HRNA 5FGMA 2M7AA 4CK1A 4NLBA 1TAUA 3WTZA 2NS8A 1JGGA 3JRHA 2PAVA 3AVGA 1ZBHA 3DLLL 1QZ6A 4CJ3A 4CZGA 3COAC 2KQ2A 3FBIB 4JI5K 5C15A 3KP7A 5D5WB 2DQLA 2HQRA 2BY0A 4JEPA 2OPQA 4Q48A 4P5OA 3L4IA 3WTWC 4YRVA 4JQFA 1LWFA 1RTIA 4C30A 2WTUA 3PY8A 3WE3A 1ERDA 2DPDA 4WQ4A 4H5TA 4CEZA 2MC4A 2XDVA 1VQNN 4R5PA 1XSDA 3L3VA 1LDJA 2LOOA 3F2KA 3ZXSA 4NC6A 3PIOF 4PJMA 3P7NA 3FZVA 4WQ5C 3E1SA 4PKHA 3D1NI 3NGYA 3GFIA 2M2EA 1FWZA 2NXNB 1NOZA 2BY3A 3C94A 1WSEA 1YVNA 2FUG2 1PUEE 4MTEA 1B92A 3E3VA 2BGCA 4RLFA 4XQFA 1W5TA 3GG4A 2HWVA 1YJNI 1ZKGA 5J3LA 1W7PB 4LF5K 4FWOA 3BG3A 1VRUA 3ASMA 1ZG1A 5L3EA 3I0TA 2GQQA 3KK3A 5E20A 4RM2A 2COMA 3DPLC 3TPQA 2LSNA 1WJFA 4B8AB 3UKUA 1IBLK 3BROA 4IBNA 3GL1A 2Q31A 4B1RA 4GNIA 1U2VA 3VF6A 3HGGA 1QNTA 5M3MJ 1JGSA 2LR8A 1SZ2A 5F64A 4BQZA 2LC2A 3CM6A 2M5WA 2QWLA 2R7WA 1EWQA 3G73A 1K8KB 5E1ZB 4NCAA 3O3GA 3QBWA 4XICA 3K59A 3K70C 3WEEA 3MN2A 3A8YA 5CY4A 4IHWA 2F48A 4AHSA 3LAMA 2OV7A 3C3WA 3ZMDA 1STZA 1HQEA 4JP0A 3CO7C 4CFAA 3S41A 2KQRA 5F04A 3I56N 2D4WA 2Z1HA 4JKDA 2B9SA 4XKBA 1JJ2M 5E17F 2IPQX 4AIKA 2DA2A 4UVAA 3A5MC 1HJRA 5E3MA 4IRIA 1OKRA 2OZSA 3HHGA 4WK8F 3E5QA 3N4QA 3A02A 3SI6A 3EL2A 3SK3A 2DT6A 1KAYA 5DDGA 4RLQA 1SVLA 1BO5O 2MG4A 3WXKA 2E1MC 1OCPA 3GFJA 3ZT3A 1B8IB 3SPYA 4DSIA 2DBBA 4FZXC 3F0CA 2OZMA 3L8BA 3ZQFA 4BG8A 3CIPA 2O61A 2EV5A 4FLZA 4YY3K 4IZ9A 2GA1A 1LWCA 2HXIA 4KNYA 3U9ZA 4EMSA 5HRSA 4DSJA 4FW2A 1XCBA 1VQ7I 3DTIA 4XIUA 2JA5J 2PJRB 4BVPA 3SQ4A 2Y2ZA 1RRJA 5AQFA 3G10A 5HLFA 4PJNA 4XEIA 4AHRA 3MWTA 2L54A 1FT9A 3FFKB 4DTNA 2XC7A 3CCRI 3HEFA 2E2JJ 1DGRM 1R71A 3BG5A 1D4XA 2LY1A 3TTFA 4HHTA 1YJ9N 1LDDA 2ZWHA 3BR5A 3THYB 2V9PA 4BGBA 4Y15A 5K5OA 1WH7A 5L3FA 3TOAA 1KCFA 5E8IA 4CJ4A 3VA0A 4M3XA 2N8GA 5HLGA 3HB9A 4JKGB 4L3QA 4C23A 4XR6A 1RPWA 4IEJA 3SBGA 3E6DA 1K83J 4GFBA 4HF2A 3OJSA 5HL7L 4RW4A 3MN5A 2HS5A 3VYRB 3AVBA 2E5NA 2F6CA 3QYEA 4RAGA 3JAMK 3ULQB 3DLEA 5HDNA 5DUKA 2E1NA 2VWJA 2HHSA 1BWFO 2G9WA 1IXCA 1LW0A 2DTZA 1WNSA 2Q2EA 2E4LA 4M3BA 5DV5A 2LP0A 1JKRC 4F3OA 1U9NA 2LLKA 1YVUA 3TGNA 4OKJA 1V5FA 1QPIA 3DOLA 2QEXN 4GDFA 2H1KA 1PP7U 3VQ4A 5KRSA 2OU2A 2DA1A 4DQQA 1KSPA 2XGCA 3H9QA 2D0BA 4IEIA 1Z6RA 1T38A 4IOCL 2ME0A 3ECOA 3GTLJ 1ETVA 4JNEA 5IYCJ 4HLYA 4DGWB 3OWTA 3CMEN 2FA5A 3M8JA 2MD0A 4EEFG 2QBYA 1X1BA 3IFRA 3LL3A 2ZKZA 3LDQA 4JI3K 3NFAA 2HFHA 2J5PA 2HQAA 2H3GX 4B43A 3BC8A 2IS1A 3IWZA 1XS9A 1AKHA 3BR3A 1OISA 2W7NA 5AQHA 2KIMA 2JSPA 4A3GJ 3PUFA 2P9KA 5ILUA 3LPUA 4A5AA 4ESJA 5JICA 3FXKA 1G3WA 1HOMA 1NBWA 1I1GA 4FW1A 3SZGA 3WODF 3AARA 3T7ZA 3E5UA 1W36C 3QODA 3SLCA 2H1LA 2CGKA 3ELKA 4E4HA 2EZKA 1GOAA 1WJCA 2JLEA 1SAZA 3HIFA 3NGZA 1GLCG 5TJJA 5F1RA 4YDUA 4CHOA 4PGGA 5DCFA 3QPLA 1BC8C 2WAEA 3R0AA 4OJRA 3ITHA 4YIIA 3WXIA 2HYFA 4BC3A 2E35A 4BC5A 1TQMA 1QVGM 1W9HA 2YJEA 4CDGA 1NGFA 4ZZLA 3F21A 3DAWA 1OKJA 1L3UA 2NS7A 3LWFA 1X58A 2BV6A 4IFEA 5HRRA 4KB1A 1XMQK 3LPTA 4E0DA 3DF8A 2STTA 2YNIA 3RKWA 4PY5A 4IVNA 4HX4A 2XAHA 4ZYEA 4IO8A 4HAMA 3RMDA 2VPRA 3L2WA 5AZJA 2VJJA 2YKNA 2DLLA 1FJGK 3D5LA 1IN6A 1Q7YO 4H8KA 1Y39A 4EGYA 4CHYA 4ID5A 5C10A 1U48A 2NVTJ 3DQVC 1JXEA 4U0WA 3VQBA 3TANA 2DW4A 1OCOH 3K0SA 5B1AH 3RQIA 1O57A 2FX0A 3O9QA 2KKZA 3HPGA 4MEYF 4C2MJ 3DOKA 3PX4A 3K4BA 3CCUN 4MLEA 2O6GE 4EJVA 4HTUA 1IXSB 4M9ZA 2Q97A 3CJTB 1OCRH 1SFOJ 2K27A 4Z4EA 3QOPA 3LSHA 3B6OA 2F9WA 3VTHA 2P5VA 2OPTA 4UUVA 5GIPA 1MGTA 5CJ9A 5AQXA 3IRXA 3JRBA 1LVKA 5GTIC 2A40A 1N34K 4BXUA 4U7BA 1QHTA 5AQTA 2K7LA 3I56I 2KL4A 3BR0A 2LVSA 3LSJA 2K02A 4RW6A 5AQWA 1VSKA 1X9MA 3HOWJ 4FJMA 3IHUA 1OMIA 3HTSB 2QGUA 3EYYA 1ZC6A 3A2KA 3FLCO 2BXZA 4DZPA 2D45A 4DTUA 3KZBA 4ENMA 2OYQA 1Q8IA 3SBTA 1YHQI 4B1VA 3ZQHA 3HUGB 2V4JC 1DU6A 1VQMN 5HS9A 1J9AA 1WFXA 1MWMA 4LIVA 2E6MA 4JI2K 2P0WA 5ADXH 4AQYK 2Q8KA 4GVEA 1L3VA 4BRKA 1KLMA 4CIEA 2NS0A 2LRDA 3EE9A 3VQ9A 3E01A 3O8MA 4BRIA 3AO1A 1WH5A 5IY5H 4H0PA 4LH5A 2ZF5O 4G8XA 5BREA 4O6JA 3TOBA 1FX7A 4I2PA 4XH5A 3HP6A 5T7BA 1X3ZB 4ON0A 4G94A 1RUOA 2VIXA 4B9QA 3HRUA 3RMBA 1QU3A 4KKOA 1VK0A 1Y56A 5EZHA 3HKZN 1YJ9I 3VQAA 4NYFA 4ZDPA 4HVJA 5C42A 4BXFA 5H6RA 1WPKA 1KVCA 3GUDA 4M7XA 3ZMVA 5FPMA 2LK2A 4UXNA 1Q81O 4BE2A 2HKXA 5E3OA 3HSEA 1WB9A 2DA5A 2NRRA 3CPWM 2HW3A 3ZCMA 1Q86O 4XLNF 1R59O 3CJ1A 2GOMA 3G3ZA 2VBXA 1LOTB 5GTHC 1JCFA 2XAJA 3O2PE 2L9NA 3MX5A 3KK7A 1NGBA 4H4OA 4JHDA 4BR4A 2W00A 1UAAA 1XQSC 5J6XA 3M6GA 3GFMA 4BYYA 4FYDA 3B02A 5E18F 2PBDA 4DTJA 3GF2A 4DTPA 1QSLA 3F9KA 2DA6A 4PWDA 1SAUA 5HS7A 3D0PA 4G7ZF 1C6VA 4N4NB 1ETOA 4JRQA 2QEXI 2XB0X 1WN7A 4JS4A 4YDUC 2ASOA 2FOKA 1P4WA 3HTUA 3SQ1A 3BJ6A 4XN0A 2VCPA 4CYCB 3QOEA 1UZCA 3TP3A 1QGPA 1HRHA 3AAQA 3CMEI 3P9KA 3AG4H 4H0XB 4UUSB 2AJQA 4BY9C 5D6FA 1JXSA 2VT3A 4DYQA 1ZN2A 3K5NA 4DG1A 4XMYA 1KQ8A 5FLXO 3VENA 2DI3A 3CXCM 2W25A 3CCLN 3MEXA 4RTFD 5CZ1A 2EPFA 1HQUA 4HLXA 3WGHA 5EXWA 4N0BA 1TNSA 4MDBA 1TK8A 3R60A 5IP9J 2HNZA 4M7YA 2M0MA 1V5GA 3BR2A 3SJMA 2Z1IA 1B1BA 4DJAA 4DQSA 2O4IA 1KQSM 2LG4A 3AV9A 2VT2A 4B3SK 5AQSA 4G9ZA 4A2BA 2DXIA 4N41A 2V6CA 1ETKA 3P5JA 3SHFA 4BXXJ 2HU9A 1Z91A 4E19A 3PJRA 3S2WA 2X78A 5MLCQ 4KI4A 2EZIA 4UY8O 1O7FA 3KLNA 3F23A 2XY8A 2M3AA 4CGFA 1I6HJ 3BTJA 2JA7J 2IVMA 1BI0A 3V81A 3VOVA 2OCCH 3GFLA 4BACA 2K40A 5BPDA 4LGWA 2RREA 4FLYA 4DTXA 1P9QC 4XRSG 4KISA 4G9YA 2FBIA 3V4IA 1RILA 2KHOA 2JA6J 2XRLA 2VI6A 3FXUA 1JT0A 4B48A 1S72I 2XROA 2R7XA 2IAIA 4DFPA 5ICFA 1YG2A 3ERMA 2VG6A 2ETHA 4NXMK 2X9DA 4F93B 3ZEUA 1ETWA 3DEWA 3ABTA 4XN3A 3E0JB 3ID6A 5FPEA 4NYNA 4C1NK 3HM5A 2ZFWA 4NXNK 2ZJQF 2JA2A 1RBRA 4XLPF 4AHTA 2NVYJ 1BI4B 2EIKH 1JHHA 4A3FJ 3O9TA 4M9SA 3CCUI 5LY3A 5ED4A 2H6CA 2I8DA 3J7AP 1WSHA 1WRJA 4DR7K 3QNNA 1BGXT 1FPQA 2DFIA 3M3YJ 4DFMA 4CBWA 2P9LB 1Y0NA 2ZSIB 3DMJA 1G99A 1K8AO 4ILJA 1TWAJ 2ELKA 5AIQA 3J81Z 2MSYA 3DXJF 3KD5E 1N75A 3HOSA 1GOBA 2P81A 1SQKA 3MKLA 3T8TA 3K2ZA 4KHYA 2L3DA 3VWBA 4DQPA 4B9LA 3C18A 1TGOA 4A0YA 3KP3A 3VEYA 5FO5A 4BGDA 1BQMA 3HYIA 3SEQA 4NC7A 3KP6A 3F73A 3EETA 1RDBA 2DPUA 1HX1A 2ITGA 1C0GA 2PYLA 4IDKA 1WKMA 4BQAA 4OPAA 1T6CA 3V1QA 2UUZA 2IT0A 3SNNA 1IAWA 1IH7A 4BBSJ 4ZDLA 2DYRH 1A31A 1NGGA 3E9PA 2MYSA 1NOYA 2L7ZA 1NTCA 3ZPLA 1W0TA 3D5SC 1BA5A 2CS3A 2VUMJ 3F8NA 2LDUA 1B6AA 3J7YJ 3MKZA 4B9MA 5F2RA 1N25A 3HOVJ 1IN4A 2HSTA 3CCQN 3VQEA 3G1OA 1W97L 1G8XA 5DEQA 4ABZA 1N36K 4C8NA 3PM1A 1VAZA 2OANA 1K4SA 3HKZA 2GELA 1UG2A 2M34A 1JKHA 3I55I 5JVGF 3HSCA 4GV3A 4CF2A 2FOWA 5HOOA 3A5LC 1PDNC 5AZIA 3U9DA 2TRTA 1XX5A 1I94K 1MNMC 3O1WA 1W2BM 2HDDA 3KLGA 2ZM6K 3A01B 5KPZA 1WSUA 1LJ9A 2ZXIA 1G4DA 3HM9A 3ML6A 2FF3B 2HNYA 1TUYA 2XV4S 4DSFA 1X1CA 3J8AA 2A5YB 5CQGA 2DOFA 3C6TA 1XGMA 4BUPA 3TEDA 4JYKA 1HKGA 3W0LA 1LE8A 2JA8J 3UNGC 3H3ZA 2YU9J 2KIFA 2KZGA 5B3SH 1E4GT 3H46O 1VSDA 4FO0A 4CCHA 5KTQA 5ILVA 3ZSYA 3LQQA 3RMAA 1KD1O 1QRYA 3EQLF 1BCMA 4J2AA 4JI4K 3VMFB 3FMQA 4GXOA 4ZJZA 3MMYB 1C0MA 4MFEA 1VTNC 1P8ZA 4F91B 4KIBA 3BF1A 1Z21A 2RE2A 1RDAA 3LDLA 3EYZA 4H0YB 3RSEA 3RYPA 5FROA 1HR0K 2QWWA 3UKRA 1JLAA 1XDSA 2FBTA 3AO2A 2NNNA 4YOYA 3HPOA 2K9MA 4V19K 2P9NA 1NKEA 4CZFA 4C8KA 5EEGA 2F5VA 4O4GA 2PX9A 4HTLA 2LF7A 1NKBA 3KCCA 1RKWA 3D0SA 3QFUA 5J2NA 5HLTA 3MEDA 4A61A 2IS2A 1WVRA 1BQNA 3T1BA 3JTGA 3LAKA 4E1MA 2X51A 2ZB9A 2R7RA 2E8AA 2QKLB 1KXPA 4MQ3A 1YF5L 3FKIJ 2X1EA 1OVQA 2CMPA 1S9EA 1WJDA 4WXHA 1RC9A 4PUOA 3BR1A 2B63J 2KJCA 1OVYA 1MMGA 1GLNA 4D0PA 3GO5A 5D3GA 3JR9A 3TARA 3KJVA 2RGVA 1HW1A 4RB3C 1VSEA 4KTZA 3CCLI 1ORKA 1TUUA 4U0YA 5D5VB 1T7PA 3OW2M 2MLKA 2LMDA 5CR4A 4F2RA 2E1OA 1D8KA 5HROA 3QLHA 3OL3A 4WFAL 3AG3H 3BWGA 4X66K 2HVRA 5F0CA 2PFBA 3W6JB 4DS5A 4EGZA 4BRGA 3WGIA 4BRPA 3LP0A 4PL8A 4L8RB 3LP1A 3MDQA 2VJ5A 2P9SB 1RNHA 4OLBA 4Y17A 3J7AO 3QERA 1ON2A 5A2QK 3KKRA 3L2QA 3DXKA 2KFZA 3AKZA 4PQUA 1KU7A 1D0ZA 4FE7A 3CFRA 4KN7X 3ZQIA 4ETSA 4DU3A 1R1VA 4JX4A 2QKKA 3J80K 2A41A 2P7CB 2V7FA 2ZNZA 1VZ0A 2FQ4A 3C95A 3OS0A 5FKOA 4CERA 1USTA 2ZXJA 4XLFA 2V79A 1ETYA 2KIUA 1VQON 2G8IA 3ZMUA 3LM9A 2G7UA 1U45A 2FMYA 4MO7A 5CVRA 4BQQA 3WU2C 2WBMA 1X3MA 3SUPA 2R5YA 3K4MA 1ZYRF 4CEFA 3VOEA 1LUJB 3C2BA 3SQNA 4AUXA 3JTHA 4RCHA 1ZHFA 4Q5SF 4DQIA 3PV8A 2BE2A 2H09A 4FM2A 2IA0A 2BY2A 3RRGA 1XC3A 4FWQA 3CF5F 1NGIA 2XHBA 2H8WA 2UXDK 2BBYA 4PZJA 2EA2A 3GDQA 4G6TB 2D1KA 1RKTA 1IF1A 2ZGZA 4B1YB 1G6NA 1ZRFA 2CSOA 3K58A 3PNYA 5C44J 5LJWA 3C7NB 2VWBA 4CZZA 3GZ6A 1RT4A 4DW6A 2X4HA 5AQGA 5M1OA 1QZZA 3JREA 3O3HA 3TU5A 1XHXA 1GLBG 2QF7A 4DSLA 4AHUA 1XSVA 4EZ6A 2I5JA 5EF6A 2RF2A 4JN4A 1Q9XA 4D5CA 3KLEA 4RGUA 1UG0A 2FJ1A 3AVCA 2P1JA 1JLBA 4U7DA 5J4YA 4IXCA 2P6TA 4QPQA 2PN6A 1BI1A 3CDHA 2CW0F 2PEXA 2A6TA 1J59A 1JJ8C 1NK8A 2O8DB 1B9NA 3Q9VA 4RB2C 2FBYA 2KKOA 4ISGA 1IRGA 4DLEA 2EFWA 4OMZA 2ZNYA 5B66C 1R7JA 1A35A 3WTXC 3OS2A 4M74A 1KA8A 2ZJRF 2F4MB 5J1EA 1GOCA 2Z1JA 4QCLA 1EX4A 3BDPA 2HVSA 2M30A 1I39A 1ZGJA 1TVRA 3C2HA 1JJ6C 1HYVA 2ELHA 3PQJA 1FTTA 2HBJA 1CLQA 4CEQA 4JAXA 2Y69H 2IEKA 2CRGA 1JKQC 2X0LA 4FJNA 3VA3A 4B9TA 2L02A 1Z0XA 4FLTA 3H5NA 1SFKA 2A69F 2F96A 5CVIA 2EA4A 4AM7A 1NG7A 4KHNA 4ELUA 3CCQI 4KJZA 5J2MA 3DWLE 4PJLA 3PO4A 2ID6A 3S15J 1RUNA 3I0SA 5H6QA 1LB2A 2K9QA 2KHMA 3ZMSA 4HEA2 1WLJA 1WI9A 1J75A 3ZT0A 2DT7B 2O9LA 2BW3B 1UFMA 5F0XA 3KYCB 4DV4K 4Y4RA 5CPRB 2VKVA 4LF7K 1U78A 2O3FA 1R4MB 1FTZA 4FX4A 3ZLJA 3CJ9A 1R0AA 5B8HA 3V9XA 3TO9A 3CQZJ 2DMTA 5FFXA 4KBOA 2XRNA 2I7PA 4F2SA 3AVLA 2O8CB 4PSWA 4DTSA 1YS7A 2IXSA 1PYVA 1VQKN 3HL2A 4IEEA 1R49A 2M9HA 3I59A 1IZ1A 4B08A 3THWA 4OU0A 3CFOA 4I2OA 3DTEA 3SZPA 2VC1A 5C4XJ 3WU1B 4L18B 3M8QA 3CCEN 3CD6I 4JBAA 4W5NA 3VF2A 1RTHA 3IKTA 2HPMA 4LITA 3LDSA 2LNBA 3KYLA 1J0RA 5FPDA 1W0UA 4FOIA 2F2EA 2GWJA 1SMYF 3ZN1A 3AO4A 1MJAA 2V6EA 4YELA 2D1VA 2ASPA 2VBYA 3ENBA 1JTXA 4MFDA 1SVMA 1JL2A 5K5RA 2UV1A 3DRPA 3A5OC 2KISA 3MWPA 2KT0A 2ZJPF 4Z6YA 1U2WA 4BC2A 2A68F 1Y8RB 3FM5A 4FJ8A 2XAQA 3RKXA 1HJOA 1TYQB 2BOLA 1ZAOA 2FQ3A 3M8FA 2EQRA 2BHYA 1TL8A 2AXLA 2P9UB 5KHDA 3QPHA 4YFNF 1MZBA 4ZDOA 4AM6A 1GVDA 1X9JA 4F3QA 1BM9A 4WX9A 5M5XJ 3FXRA 2Z16A 1I3AA 1ZREA 1UHWA 5JHUA 1Z77A 3O08A 4K0KK 1S1XA 1UHMA 1IN7A 4MQVA 4JD2A 1U5TA 2A3ZA 3ABKH 3RDIA 1IG7A 3I58A 5CLSA 4C1NI 5E1WA 2O8FA 2G8HA 5HODA 3CC7N 4AVZA 2UUCK 2QSGX 3EY1A 2JGUA 3SDBA 2CJJA 4ZTFA 2Y48A 1FIAA 1NK4A 3EZ5A 1XB4A 1KLNA 3QO9A 2QCOA 1K78B 4W5RA 1ZQ3P 2DQRA 3F6OA 2HR3A 3H1VX 2DA7A 1J5YA 1YW8A 4J8FA 4JK9A 5F0HA 2DOAA 3PUBA 2IP2A 1KVBA 2CUEA 3C1DA 1NJIO 4W97A 2FF4A 4J2BA 3S1NJ 3B6AA 3LZIA 1IRZA 2W48A 5BN9A 3ABMH 2DYSH 2DOEA 2RVCA 3OIPA 3PX0A 1VQOI 1SL1A 4KI6A 1MH3A 4O55A 1WSGA 3IG1A 3CCJN 1O13A 4DSKA 3I4PA 3H35A 4D1QA 3TBIA 1GLLO 2E1MB 1PUFA 3Q9SA 4ZH4F 4DNCA 3L9FA 1U49A 2IAJA 3OR1C 1A6QA 4KUMA 3OSGA 4MHGA 2LKSA 4B9NA 1DEJA 5CHIA 3M5RA 3BUZB 3BPVA 4ELTA 4G6DA 4FJHA 3CCVI 1JCEA 3NF6A 2CFOA 3SJJA 3EZWA 2VGNA 2L2OA 4HDVA 4DFKA 2X6NA 4CZHA 3H0DA 2Q2RA 3DLLF 2CH0A 2L4MA 1U8BA 1UJ8A 3ZX3A 4IHTA 1MDMA 4GYGA 2QKMB 4Y7NJ 3DLKA 2CWEA 2P5OA 1SFUA 5LFAA 3L2VA 4YEJA 2GXBA 1RTJA 2UUBK 3AFHA 3EDPA 1V54H 4I0AA 2NVUB 3Q0VA 4JOMA 3H5AA 2AP1A 4FM1A 1RT6A 4IX7A 4DCHA 2E7WA 3CMMA 2O8BB 4DIQA 4UB8C 4XOTA 1IKXA 1K73O 3FZHA 4P1WA 3QPTA 5M1QA 2QQ9A 1ZK8A 3N4MA 4CHPA 1JT6A 3CERA 1BR4A 3OBWA 2YHYA 1JTYA 4BQOA 4AWXB 1HNWK 2BH1A 5BRDA 2MH9A 2R4GA 3FZFA 3ASNH 3ZQLA 1K4TA 3AL0B 5ERIA 4DBQA 2R7FA 4CXFA 2BGGA 3L09A 3D5RC 3M4OJ 5FRNA 3CJAA 5B1BH 1TK5A 4CFDA 3RJPA 2ZMEB 1C1CA 3S3MA 2LKPA 5AQYA 3K2AA 1NG6A 5AQUA 3I5UA 5DCMA 3Q5FA 5C4JJ 2O8EA 3VEZA 4Z4HA 1P6RA 2YPRA 4BRLA 4WYBA 3I4MJ 4E7LA 4R1HA 3FXOA 4KHWA 4KDPA 5L3CA 2G8KA 2EIJH 4N76A 3PFYA 3C7JA 4IHYA 1C0WA 5FLVA 1QSSA 1IDYA 4PL7A 2EJRA 4RG8A 4Y33A 2L9SA 5JLFA 4S0HB 4FASD 4CESA 3VSLA 1RDUA 4CF8A 1O3TA 3EUKL 1HW5A 4FPBA 4CJ5A 3MZYA 4MEXF 3KX2A 4N9HA 4P9UA 1DLOA 1IW7F 1N32K 1EKEA 5K1YA 4EAHD 3KLOA 1VQKI 2M1BA 5E26A 1U8RA 3V42A 4PFPA 1UA0A 1SANA 1U2VB 2X1DA 4XLAA 4HDUA 5F6FA 2JWKA 3W2VA 5BPNA 5A2QZ 4WF9L 1TW2A 3AA4A 3CCEI 1T33A 5KQ8A 4KYWA 3E6MA 1VSLA 2HNHA 3QIOA 4GCVA 3VEXA 1S6LA 3WEEB 5FJ8J 1QTMA 3BTLA 3CDIA 3AGKA 2VKHA 2HPIA 4ENJA 4HQEA 1B9FA 1GXQA 1OH8A 1FC3A 1NLVA 2GUIA 3FMSA 3IKMA 1DTTA 3VQPA 3BZKA 4ISFA 1ZGAA 3DEUA 2DA3A 4CJRA 5M1NA 3QQAA 4BJ6C 3S9HA 3F9MA 1SMTA 5AQNA 3QWLA 1VRTA 3E6CC 2GXGA 2CG4A 2VE9A 2LH9A 3IP4B 4CGZA 3A03A 3ENHA 1P90A 4PSXA 2R92J 1ENHA 1OYIA 1NGEA 3VETA 3JSPA 3JXUA 3NRVA 2JPCA 2W1OA 4JV5K 4IJAA 4B1XB 1WSJA 3RTVA 2CUJA 1N78A 3VQDA 1MJBA 1JUPA 4LJZF 2V7ZA 1FEXA 1YTAA 2E7XA 2NRWA 2P51A 4XK4A 3DLGA 5JLWA 3LSIA 1T56A 2NUBA 4KHQA 1X3WB 1XMKA 2HVHA 1SD6A 4I6ZA 2E1YA 1X3UA 4L9TA 3V9WA 3CC7I 2RQQA 1G3YA 2QWOA 3TAFA 3HOZJ 4N4OB 4UB6C 4KHPK 1T8EA 2ZFUA 4PGHA 1QQCA 2L0KA 1QQOA 3G0ZA 3AG1H 2JJ7A 4QPOA 2QWPA 1ZRDA 3AY9A 4GV6A 3H0GJ 4G6QA 2AO9A 1OYYA 3QPSA 2H8RA 2HBMA 3ZGKA 1NGJA 4M3RA 3QU6A 4FZZA 2HKOA 4JLHA 1TP4A 3KHYA 4Q5VA 3CZ6A 4NNJA 4IOCF 1EH8A 3WHBA 5HBMA 3HM8A 3CCJI 3S8PA 4FHTA 1HDPA 2R7ZJ 4CFBA 4CJSA 4C2UA 3J7YP 3C6AA 1F5TA 2R5ZA 3RWUA 3CQ8A 3MN9A 3IH4A 4IO9L 4NB4A 2X6XA 3RYRA 2XF6A 2X6SA 5EX5A 3C6UA 2ZXWH 1LWEA 1KRPA 2E19A 4CGJA 3WG9A 3T5XA 1KAZA 1R4NB 2JRTA 5K14A 2Q2EB 3CCRN 3RPUD 5JR3A 1HMVA 3BY6A 2HVIA 3EN9A 2RQPA 1OCZH 2R7VA 3ZSWA 3WG7H 1D8YA 1RCHA 1JLGA 1RIOH 5D8KB 3NF9A 4EHUA 1I50J 1RI7A 3PL8A 3CJCA 5HDGA 2CW7A 2QZ8A 2YKMA 3JRFA 1UOCA 3VEWA 1PVEA 4JYAK 3VN5A 1Y1VJ 3TL4X 2QBYB 1X3NA 1S9HA 3KZZA 4IZZA 1X1DA 2WAFA 2XHKA 1IUYA 3CDLA 3V8LA 3LSTA 5KPTA 4FT8A 4EQQA 1JLCA 2X6OA 1AKHB 3LZJA 3HDDA 1IV6A 4HRIA 2W6KA 4NHJA 1Q18A 3P9CA 2R7YA 4DUYK 2P9KB 1RFQA 1HYSA 2Y0MA 3BCAA 2FU4A 4H5NA 4B3RK 3E1YA 4LLGF 4J2EA 3KFWX 2CGJA 2R0QC 5KI6A 2IGNA 1YITI 2HDCA 1ZR4A 1R6RA 3OYMA 2NOGA 1ZXOA 1EV7A 3WQTA 4DU1A 2QENA 2E71A 3ZSXA 1IRXA 2XGXA 4IDHA 1Z3XA 4BHBA 1D0XA 3UR3C 3CUQA 1C0UA 4CFCA 3VSKA 4HV6A 4I6MA 1U3EM 4C8OA 3AG2H 4DB3A 3BY5A 3I71A 1XGOA 2Z1DA 1ODDA 4Q47A 4Z0UA 4DZJA 5AQRA 5F0FA 1T03A 3P39A 3BR6A 1BI2A 1JLEA 2JUCA 2J4RA 3BEXA 4BS9A 2HZTA 3I3LA 3FKJA 3FMRA 4LFCK 1EWRA 2QW9A 3FGUA 3BPXA 3DWLA 2VKDA 2FF6A 4HUGA 3DKWA 2OUMA 2EFQA 4M3UA 2L7KA 4M3GA 2GA2A 2B7EA 2EHGA 3NH2A 2VQHA 2GX9A 3SV4A 3MZHA 1DUXC 3CQXA 4S04A 2ID3A 4CECA 3QICA 3JCUC 2W85A 4II3A 4OAYA 2IC3A 5BPMA 4JKHA 4CJWA 1LPQA 1BOBA 2HMPA 1YOVB 4Z2YA 2CQXA 1NK0A 3KD1E 3TSQA 2Z9OA 2O8XA 4FJXA 3RTRA 1DPUA 2WONA 5JLHA 3HP9A 5EG0A 3CCYA 3MKWB 3ULDA 2OA4A 1MU2A 4A57A 3DP7A 1U4BA 2I10A 4I98B 3AVJA 3IKVA 2EH3A 3K9KA 1MBJA 3HVRA 3T8RA 2GIVA 3QFPA 3LSKA 2LBFA 4DV3K 4H0OA 2WY7Q 4FJ7A 1FNNA 2M8GX 3CP8A 1LVAA 3J7AY 2XASA 4E7ZA 2IIRA 3VQ6A 1VQ6I 2KW4A 1FMVA 1P7IA 1FKPA 4CCNA 3AVNA 1R36A 4FZYA 2KZZA 4IOXA 4NQWA 2XVCA 5IYBJ 3GEZA 4KTQA 4HF1A 1DGWY 2OJED 1SL0A 2MW8A 2K4JA 2OPPA 2NRHA 3LNQA 1XTAA 2JN6A 2YNFA 5JHFA 3ZRGA 1U0JA 3IH3A 5GAEJ 3JAMO 3F3XA 4FVMA 2UUAK 2NYXA 3MX2A 3ZOBA 4OVLA 2Q3SA 1CQTA 3MN6A 4FXDA 1E4FT 2E1CA 4Y13A 3OOUA 4KIFA 5KK1A 1KONA 1P4AA 3R8EA 4CF1A 2UZKA 3OA9A 2ISYA 1KU3A 5CQEA 4XLCA 2GIZA 4EJWA 5C2FA 2R93J 2XPWA 3MN7A 4FSVA 2IGOA 1O7LA 3RKYA 3MXIA 1ASVA 3TO6A 4UVBA 3KLFA 3SZTA 4R79A 2GBZA 1GLJO 1NJZA 2L9RA 2HHUA 3W6KB 1C1BA 3D2EA 4CHUA 4HNVA 4E7KA 5E8GA 3H6EA 2V51B 3ZETA 1KAXA 2IS6A 4TV7A 3NEUA 4YORA 2ITMA 1W7PD 2K3PA 2Y1IA 1YHQN 2HYGD 2ASMA 1BA0A 1SAXA 3U1KA 2VN2A 3PIPF 1LEAA 3V8JA 5HNFA 3KEYA 1EO1A 4DQ8A 1XHZA 5J8FA 3G1LA 5AIPA 2B5JA 5EGOA 3QBXA 4QS8A 2FEZA 4HF0A 1D1BA 3WTTC 4A3DJ 3RR8A 2YV0X 4JHDB 3GTGJ 4F3TA 4ENKA 3J81K 3H45C 4DWIA 5EEAA 2KTQA 3VQ7A 2HB5A 1MBKA 4FX0A 1OFCX 3JW4A 4LFBK 5M1FA 2JWTA 3FX3A 2DK8A 3BLYA 1DP7P 1PP8F 4ZHRA 4A0ZA 3BZCA 1P4XA 4A0XA 3J7ZI 3HOXJ 3K4NA 4TSXA 2FLOA 4FLVA 2PJPA 3WNEA 3DKYA 3Q3SA 2JUGA 1Z26A 3IUCA 3OYCA 4ASNA 3BTIA 1JKPC 2V52B 2FXAA 4Y0WA 2FSWA 3CUQC 3GE1A 1DPRA 4ANJA 2ZC2A 4AILC 3EUHA 5DUIA 3O4QA 2XY7A 1R23A 2WAQN 1NK2P 1BOTO 1YT3A 2CQ7A 3K10A 3CHWA 4BQNA 3CLQA 5CYVA 4OPKA 3DEEA 2E2HJ 2O5RA 2CGLA 3LSPA 4HW0A 1D5AA 2E2NA 2HTSA 1J5EK 3KK2A 3GX4X 1VF9A 4FK2A 3F5TA 1W4MA 2UWMA 5AQOA 1ZBFA 3CI5A 4DSEA 4BROA 3NE6A 4CHZA 2FMLA 1M1EB 4FLWA 3C2GA 2WC2A 3WT0A 1HQCA 5BR8K 2VPLA 4K2EA 5IT9K 2HHTA 1WI3A 1WSIA 3QINA 4UHTA 1FY7A 2FRHA 3PSIA 4XRFA 3Q0UA 4HA8A 4PUSA 2JPBA 1UAXA 3D2FA 5L3BA 4KH6A 3NAEA 2Y9YA 2ZJ2A 2XIGA 4FK4A 5D5UB 4LK1F 1LFBA 3THXA 1HC8A 3FISA 4Z94A 1IJJA 4HQMA 4FWRA 3TW7A 2B0LA 1YFHA 2RPIA 4BC4A 5AR0A 4LLLA 1IUFA 3B73A 3WTSC 4FLUA 5FKMA 3SEZA 1NK9A 4HBLA 4PKGA 5C25A 3CFPA 5J8CA 4XRMA 3VF4A 3OL4A 4IF4A 1RZ4A 4FTHA 3ZT1A 1FZPB 1XGSA 5AQZA 2LY2A 4P55A 2HHXA 4FK0A 3A0HC 3AAPA 3ABLH 3P4IA 2V9VA 4CGDA 4XKCA 1CXUA 3SCXA 1WJAA 5JVHL 1YQAA 3I53A 1IDZA 4M3ZA 4PJJA 2V9KA 1XNQK 1E2XA 2L9VA 1VQ4N 2L5QA 4O5BA 1ULYA 4RAZA 1ZBUA 4KFBA 2MABA 3VYUB 4L9VA 2HOSA 3NWSA 1RDDA 4FJJA 3ZEUB 4N5SA 3B8AX 2EZLA 1DU0A 3SAGA 1OJLA 3K1PA 3KVGA 2E1ZA 2VL8A 4NC8A 1HXDA 3O8GA 4EJUA 4GO1A 3ZQQA 5CYMA 4XORA 3K69A 1Z9CA 3OYKA 1YRNA 2F4VK 1RDCA 5GPAA 3GXOA 3CMYA 2KFDA 4C8MA 3S1RJ 1X9WA 1FOWA 1Z6TA 3O3FA 3VB2A 3G71N 3QEXA 4QSHA 4ICLA 1BW5A 1TV6A 1S72N 1RBUA 4RGSA 4I7FA 2W41A 3TAMA 1M1KO 2PG4A 3O80A 1WZ2A 3O9RA 5E84A 4PCQA 1G59A 2FNPA 1A5XA 4RW7A 4LSNA 4CO8A 5LGTA 2PLYA 3TABA 4MGRA 1T6SA 3KWGA 5F1JA 2Y75A 2KLOA 1ZGWA 2VXDA 2KDOA 4BBRJ 2V1DA 2Y0SN 4H0TB 3CCMN 4JKCA 5KGXA 4FJ9A 1WAFA 4OLAA 3NBPA 1VQ5N 2WUSA 1XMOK 3MVPA 1HKBA 1Q1HA 4KB0A 3CJQB 5DMRA 5HS8A 3DPTA 3G2BA 1MSFC 2VKEA 1IBMK 4HV5A 5LL6Z 3D7EO 2VG7A 1DQUA 3IV5A 4BWMA 3CESA 4KMUX 2BW3A 3VQCA 1B72A 4CK2A 1T0FC 4ZC3A 3WGGA 2K9SA 2V26A 4EM1A 2E34A 3KTQA 2C6YA 3HOYJ 4CCLA 2HXOA 3TP0A 2ZO4A 3SMSA 5LJVA 3MEEA 2XRIA 3HXMA 4DYCA 3V1OA 4LIUA 1REPC 4GGGA 5AZIB 5AQMA 2DA4A 3FZLA 1HYZA 2D0OA 2K86A 1S3JA 5IWAK 4OINF 4CEOA 4CD1A 2QK9A 4CZCA 3G6EN 3EUHC 4DMNA 4KT6A 3RZOJ 4BE1A 1QZEA 2ESNA 3M8EA 2R7TA 3SAFA 3SV3A 2JQ7A 1IKWA 4AHCA 3EE8A 2VC0A 4GW6A 4BKXA 1O3QA 2KZMA 4YG2F 3DRSA
chains in the Genus database with same CATH topology
4YFUA 3THVA 4CESA 4QOZB 1BCOA 4CGIA 4CF0A 3V81A 1T7PA 4DLGA 3OS1A 1HJRA 4CJLA 4J2EA 4CF8A 2OZSA 4F2RA 4AILC 4BACA 3NCIA 5KI6A 3OYEA 1RBSA 1QS4A 3O4QA 4CJ5A 1O1WA 2YNGA 3HPGA 2XY7A 5CYQA 3SI6A 4M45A 4JS5A 5HROA 3DOKA 3PX4A 3QLHA 4W5NA 1RTHA 4CE9A 3OYMA 4CJTA 1JL1A 4FLYA 4GMJB 1DLOA 1BHLA 1K6YA 1YT3A 2HHQA 4DTXA 4DU1A 1SKSA 4KAZA 4K8ZA 3LDSA