1LJ9A

The crystal structure of the transcriptional regulator slya
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
144
structure length
144
Chain Sequence
TDILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEISQLADYLVRMRKNVSEDWEFVKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator SlyA
publication title Crystal structure of Enterococcus faecalis SlyA-like transcriptional factor
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 54
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lj9A00
3QU3A 2A07F 5H6QA 1CF7B 2TDXA 5TJJA 1CF7A 2OAZA 2XUBA 4N9HA 3C7JA 2WV0A 3BJOA 1G3YA 4ZYGA 5D6FA 3DXJF 1LDDA 3F21A 2L4AA 3GVAA 3ZMZA 4MQVA 4D0PA 4OIPF 5LHGA 1S29A 3WGHA 1RUNA 4L9TA 4E70A 5ILUA 1B4AA 5HOOA 2H09A 3CO7C 3HHHA 1YIOA 2DPDA 1KU7A 4RAZA 4HF2A 1ON2A 4NB5A 1BI1A 2P5KA 4OINF 2M87A 4N0BA 4A12A 5ERIA 4HOBA 4A0XA 3FM3A 3TO6A 3KEQA 4M73A 2ZCWA 1B59A 2IRFG 2VT2A 2HKXA 2WWYA 1TQPA 2HQNA 2V1DA 1SFEA 1LQ1A 4AWXB 4OIQF 2HR3A 4CO8A 4JK1X 1QO0D 3C18A 4BHBA 5CVVA 5TRDA 1JGSA 3WU0A 4UV8A 1IZ1A 4ASNA 4EM0B 1G3SA 3E5UA 4Y13A 3OV8A 4A0ZA 2Z3YA 2YR2A 5JFRA 2LKPA 3DFGA 5JR3A 1BIBA 2P6TA 3IWFA 1K79A 1W7PB 2R7FA 3P9KA 1W7PA 1R36A 3LQRA 5E1WA 4NQWA 2V1UA 3EYIA 3LA3A 1QZZA 1J9IA 2VOOA 1LDKB 2COMA 4P96A 3O2PE 5D6EA 5K5QA 1ZREA 2FXAA 2ZXJA 2JPBA 2Z9OA 1ZLJA 4HBLA 4A5NA 2EJRA 2EV5A 2A61A 4M72A 3IC7A 3VFZA 3V4GA 3ERED 3HHGA 1YFHA 3L7WA 2VOPA 3O3KA 5BS6A 1W4MA 1MJ9A 1UHMA 3HRTA 5HS7A 1FPQA 2QBYB 2QBYA 1HKSA 5DYMA 4HV5A 1O3SA 2STWA 3ZMSA 3E6MA 2HTJA 5D5XB 4R1HA 1F9NA 1YTYA 1R5HA 1T39A 4I7HA 3I0TA 2VXZA 3QU6A 3HSEA 2QZ8A 2HDCA 3I54A 4CHUA 2RC4A 1FYKA 3QOPA 5LHIA 2FA5A 5L3GA 4BHCA 1DPUA 4U7DA 1KQ8A 2NYXA 3ZMDA 2ZFWA 4HQEA 3TO9A 3BZ6A 3MAJA 3MFKA 1T6SA 2IVMA 1CGPA 2V6CA 5DUKA 2M1BA 2QUFA 4HDVA 3BWGA 5FLXZ 4XLPF 1ZG1A 1HBXG 3ZP5A 2Y0MA 3HRSA 4Q47A 3KP5A 1ZLKA 3EQLF 2IA1A 2RQPA 2Y75A 4GGGA 2FBKA 1KYWA 2XAFA 2IA2A 5D4SA 5IT9K 1YYVA 2A3SA 2E7WA 5EEHA 2JRTA 3BPXA 1HSJA 4O5VA 3DKWA 4PDKA 1MJAA 4BAYA 2PBIA 4LMYA 4DQ2A 4UV9A 4R8HA 5LEJA 1REPC 1O57A 4R79A 5K5OA 2DU9A 1ZRCA 2DK8A 2L01A 4WXHA 3MWMA 1R00A 2PMUA 4ESBA 4XSXF 4EV0A 2A6EF 3HYIA 3HOSA 1OYYA 2OBPA 4EVIA 2E7XA 3DP7A 5FB2A 4M9ZA 2Q0OA 1J2XA 3VODA 4EM1A 1BI3A 3M8FA 1FWZA 3WE3A 4ENNA 1XMKA 2D1VA 5CYVA 2ZMEB 2XKOA 1I27A 5KVRA 3CTAA 1WKMA 3LSTA 5DV5A 3HRMA 1BC8C 3JAMK 1LEBA 5BQTA 3BPVA 2IA0A 5K1YA 1XSXA 5LHHA 2STTA 2XGXA 4K2EA 3ZN0A 1W7PD 3TGNA 1IRGA 1R7JA 1UB9A 3DQVC 3VB2A 1IN8A 4LLNA 2QQAA 3GUDA 4GXOA 2EWNA 2OU2A 3KP6A 1EH8A 5A2QK 1USTA 2EFOA 1USSA 3CO6C 5D5UB 1W5SA 4HLYA 1FZPB 3D0SA 2E1CA 3HSFA 4UVCA 2UWMA 1PP8F 1S6LA 1HQCA 4HAMA 4NHJA 2QVOA 2CFXA 1P4WA 1ZYRF 5J6XA 5BOXA 4CGZA 4CDGA 4HV6A 3WTZA 2FBHA 4YFKF 4YFNF 4Q4ZF 2O6GE 2M5WA 1R58A 4KT5C 3TQNA 1ZRDA 2OQRA 5JVTA 1XGNA 3GO5A 2RGVA 2GA1A 4U7BA 5E18F 2P6SA 5K5RA 2ESNA 5DDGA 1W5TA 3RKYA 4WXCA 3F6OA 3COAC 2JZYA 1NHAA 3LFKA 3TKYA 2PN6A 1K6OA 4BNCA 4JQFA 1D3YA 1O3RA 4U88A 1KU9A 3WG9A 5LRSA 1MD0A 4G6QA 2ZO4A 2PMHA 1V4RA 4G7OF 1DP7P 3RIRA 1A04A 5HS9A 3KZYA 2HYFA 1OYIA 2IPQX 3IRQA 1QNTA 2EFNA 5L3BA 1LVAA 1XGSA 3O6BB 2M30A 2K4BA 2XAGA 1I1GA 2BEOA 1U5TA 3ML6A 4KN7X 3ECHA 3E5QA 3I59A 4RS8A 3VOEA 4P9UA 2E1NA 1J7KA 1QGPA 3JTGA 1K78A 1WQ2A 1XDSA 5ICEA 1S8NA 2FMLA 2XROA 4IRHA 5L3DA 2QENA 5LGNA 2CWEA 1TQMA 1Q1HA 1ULYA 1DPRA 5AONA 4LB5A 4OMZA 2RVCA 1SFXA 4LK0F 3V7SA 5HS8A 1H0MA 1MGTA 4EJWA 4ESJA 2K02A 3ULQB 5EEGA 3ROUA 4WWCA 1F1ZA 3H3ZA 1G4DA 1KQ9A 2O0YA 1IW7F 3RKWA 2QQ9A 1YW9A 4IRGA 2LDUA 2K7LA 4BHPA 1XMAA 1G3TA 1D5VA 2JPCA 4I2OA 2P5LC 1P6RA 4YIIA 3ABUA 4Y17A 1QPMA 1B9NA 3J81Z 1BI0A 3SZPA 4OIRF 2MLGA 2LF8A 2P7VB 3BP8A 4L0ZB 2W25A 2DAOA 1OKRA 1I1SA 4MEYF 3EYYA 1ZG3A 1LNWA 1J59A 5ICGA 3DEUA 3WTXC 4ZYEA 3QP5A 1LB2A 4IVNA 3WTSC 1BIAA 4KDPA 2ETHA 1HSTA 4HQMA 2KKOA 2HOEA 5E1XA 1PP7U 1FBQA 2DQRA 1O7FA 1P2FA 3BOQA 2Q8KA 2A6HF 3ECOA 1PUEE 2GZWA 2ISZA 2P5VA 1KU3A 3GFJA 2EK5A 1KYZA 2PI0A 4FT8A 3E6DA 1FBSA 1TLHB 2IT0A 4GYGA 1XCVA 3TDZC 1ZG5A 1QZYA 4Q5SF 1GVJA 4YG2F 3QPHA 2RV8A 2NS0A 2O03A 1E2XA 3CUQB 1R5GA 3KCCA 4XLNF 3CUQA 2F2EA 2VC1A 1YW7A 3FMRA 2L4MA 2XIGA 2EV6A 2X4HA 3R0JA 3CDHA 3FX3A 2A5YB 5FD6A 1ZHFA 4HX8A 3GFLA 1EH7A 5L3FA 1RNLA 3JSPA 4O6JA 3Q5FA 1HKTA 2PJPA 2UXXA 3BROA 4FHTA 1IXRC 3JAMZ 2F5DA 3FF5A 3QPTA 4EJTA 4MGRA 5DUIA 2O3FA 3E5XA 4I02A 4L5IA 2A68F 2NRAC 3J7AO 2QYOA 5CVJA 1SD6A 4BH9A 1XGMA 3ZMTA 5E8IA 1TQIA 4RAYA 1I6XA 2AS5F 4KIFA 1XD7A 3FZVA 3F8FA 4LLLA 4G9YA 5A2QZ 2RN7A 4CYDA 1R1TA 4WXDA 4H0EA 6PAXA 3I64A 4TV7A 2FU4A 3MZHA 3WTTC 3MEXA 2PFBA 2XAJA 2XAQA 4OU0A 1XDUA 4PGGA 1Z7UA 2L3DA 1QBJA 2MD5A 2IP2A 2YX7A 4MEXF 3F8CA 3M7GA 1FT9A 1KA8A 2XV4S 2KJBA 4B09A 3NQOA 2W24A 4Z2YA 3R60A 2VN2A 1IUYA 1IF1A 2CQKA 2HZTA 2M8EA 3T8RA 4AIHA 1U78A 3H3UA 1MKMA 3KLOA 2F5FA 5J8CA 3B02A 1GHCA 5BMZA 5AIQA 3QAHA 3GZ6A 1H9GA 4RGRA 3HOTA 2A69F 1YS7A 1UCRA 1BN5A 2QLZA 3KLNA 4ON0A 3TDUC 4KUMA 3FWEA 3GZ5A 1OPCA 2HQRA 3ZPLA 1P4AA 3GEZA 2P8TA 4G8XA 4XRFA 2M45A 5LEKA 2ZNZA 3J80Z 1MJBA 2R7DA 2GXGA 1YG2A 2EFWA 1IAWA 3MZYA 1FOKA 1TW2A 1I5ZA 4KIGA 1XB4A 3B73A 2D45A 3WTYC 4L9VA 4QWQA 3P9IA 4EQQA 3IKTA 5F64A 4L0YB 4MHGA 2XAHA 2BV6A 4HX4A 2KIMA 3SZTA 4LLGF 2ZBKA 3F8MA 5H20A 1IN7A 5ILSA 4EGYA 1BOAA 2ZMEA 1WSUA 2VONA 2HFHA 2R3SA 2D2WA 1KU2A 1FSHA 4G7ZF 4PZJA 1ONVA 4IHSA 2DO7A 3U1DA 2NNNA 3KETA 5E1ZB 5FO5A 3NRVA 3K1PA 3WU1B 3KFWX 1VTNC 4A2UA 3F3XA 1V3FA 3PFIA 4ESFA 4HX7A 2DI3A 3OOPA 3PQKA 1SD7A 3EDPA 4I0BA 2CSOA 1SD5A 2YU3A 1F5TA 3HRUA 2PQ8A 4UVAA 3R4KA 4MQ9F 1S7AA 2GQQA 5CLSA 2VBWA 2W84A 2UXNA 3GXOA 2Z5UA 2P4WA 3V8JA 3KE2A 1OYWA 2O61A 4RB0A 4HF0A 2G7HA 2OA4A 2FSWA 2HEOA 2YPRA 1RZ4A 2V79A 5FFZA 2VE9A 1R1VA 1TW3A 4ZZLA 1Z91A 5DD4A 5FLXK 3FHZA 1TTYA 2FNPA 4ENKA 1LDJA 5CVUA 1BJAA 3DPLC 2FNAA 3RPQA 3C1DA 2J5PA 3RYRA 2H6CA 5D8LB 4G94A 3LWFA 1U2WA 4KICA 4RB2C 2BGCA 5LLQA 5AIPA 4AIJA 2DFIA 5LRRA 4PCQA 1IN5A 2BE5F 1FLIA 2QWWA 1DDNA 4KYWA 1L0OC 1R1UA 5L3CA 1JXSA 4M6XA 3T8TA 4S04A 3REOA 4A6DA 2Z33A 1F4KA 2J5OA 1L3LA 5E17F 3T5XA 3GFMA 3HUGA 2EA2A 2DBBA 1P4XA 1S3JA 3M1EA 1U6GA 3FMQA 1ZH5A 1YO5C 4UNOA 2MH2A 3BJ6A 3V8KA 3I71A 2V9VA 3V7CA 4YIFA 2LF7A 3SXYA 2NNYA 5HVQC 2IW5A 2H27A 3T0YA 4ETSA 4S05A 2DPUA 1XSDA 5FD5A 1AWCA 5HDKA 1MDMB 1J75A 1MDMA 3C3WA 3CLOA 2VBZA 4KNYA 3BY6A 4GCVA 2BBYA 1JE8A 2GAUA 4GYIA 3W6KB 4KMUX 2PG4A 2YSRA 2IJLA 3GLXA 2WC2A 5JHUA 3WGGA 4KMFA 5J8FA 1YLFA 2FMYA 2YX4A 5IT3A 2JTVA 1TNSA 1IXSB 5CVIA 3GWZA 5HLHA 3QRFF 1SAXA 4HDUA 2HKOA 4EGZA 1O3QA 1R23A 5JI6A 4P55A 1KGSA 3RPUA 4L9NA 3I4PA 2XKPA 1Z6RA 3F72A 4LG0B 2OZUA 2MA3A 1ZARA 5DEQA 4LG0A 1R22A 2CW0F 2NAZA 2L02A 4A6EA 1WI9A 4IF4A 5LGTA 2MC3A 2OZ6A 1YS6A 2BYVE 3GFIA 4CZZA 3RI4A 1G6NA 2JSCA 1QQIA 4FX0A 4AVPA 4HZFA 1TBXA 3CJNA 1T98A 3F22A 1SD4A 2GWRA 4CXFA 1JHHA 1BC7C 3RTRA 3PQJA 1ZGAA 4CICA 4L9JA 4IHTA 5IT9Z 2UZKA 2FF4A 4OIOF 3HTSB 2DLLA 3LAJA 5E8GA 3ZMVA 4M9SA 3TOBA 4MTEA 3JTHA 3F8NA 4M6YA 5HLIA 1BBYA 2FQ3A 4ZH4F 3KZZA 3WTVC 2RKHA 2KRFA 4IPAA 2EB7A 4Q48A 3ZQ7A 3KP4A 3T1BA 3F23A 3K1NA 3EETA 4I09A 3LA2A 1YW8A 2C6YA 1HKQA 3SHFA 5E20A 1SMYF 3K2ZA 4UVBA 1S7OA 4RB3C 3IL2A 4RGXA 2K86A 4U0YA 3I5UA 2FBIA 4LFUA 5BPDA 1RIOH 5ICFA 1ZGJA 4IJAA 1XCBA 2ESHA 3RDIA 2ZNYA 4GO1A 2W85A 2RNJA 3V8LA 3WODF 1MZBA 1HW2A 3Q9VA 3E6CC 3R6SA 4M71A 4AIKA 4UXNA 2P7CB 3WE2A 5HLGA 5L3EA 1T38A 4UUVA 2QQBA 3JSOA 3AAFA 2XASA 1P92A 3RKXA 2JT1A 3ABTA 4BXUA 3DV8A 4F7ZA 2DT5A 1FX7A 4EMSA 3L09A 2GIVA 3MQ0A 1U5TC 3S2WA 3N4MA 1X3UA 1Z1DA 4U0VA 5D5VB 1FP1D 4ZYDA 3Q9SA 3MCZA 4EJVA 2F5CA 3SFZA 3U2RA 1ZAOA 3GYHX 3IHUA 1BI2A 3M8EA 3I53A 3GX4X 1IRFA 2DK5A 3J81K 1FYLA 5LGUA 2ADUA 3U9GA 3V7RA 1EH6A 2HGCA 3VEPA 4WX9A 4HW0A 1ZRFA 3GW2A 1LEAA 4B8XA 2Q2EA 3K1MA 4O3MA 3DPTA 3CUOA 4I0AA 1FP2A 1GXQA 5KK1A 2DQLA 4HF1A 3R0AA 3GF2A 4HLXA 1TNTA 4LB6B 4ENJA 3EUHA 1B9MA 1ZN2A 2MLKA 4Y15A 3WTWC 4A5MA 1AOYA 2H6BA 2ACJA 3ZN1A 1GXPA 3SQNA 2KIFA 4WF2A 1RI7A 3W6JB 1U8RA 3E3VA 4HYEA 2AXLA 2VC0A 2VODA 2DTRA 1STZA 5FFXA 3E97A 2Y48A 2CYYA 2X0LA 4MTDA 1BM9A 5CJ9A 1XN7A 2PLYA 3IRRA 2G9WA 3WGIA 4KIBA 1WWXA 1D8JA 4L5JA 2FRHA 4WK8F 1KQ0A 3FMSA 1FSEA 1ODDA 2EV0A 3KP3A 4LJZF 3KEOA 1FC3A 4N9IA 5F6FA 1HW5A 3ISPA 1OMIA 3FXRA 4XBFA 2RDPA 2VBXA 3QP6A 3HSRA 5CVRA 4A0YA 5DCMB 5DCMA 2GXBA 3K9TA 5D8KB 3ZMUA 5LBQA 1U3EM 4L18B 4YFXF 1UHWA 1WRJA 3JW4A 2EFQA 2EFPA 4JBAA 1T0FA 2HS5A 3D5LA 4WCGA 2CG4A 3RJPA 5HDGA 4OOIA 2XRNA 1K7AA 3CUQC 2ZJ2A 3HIFA 1Z05A 2ZKZA 1EV7A 4U0WA 4P9FA 3P9CA 3I58A 3FXUA 2FEZA 3H92A 4RGUA 1Y0UA 3G73A 1J0RA 2GA2A 3IKVA 5DD8A 2KJCA 4IXAA 2D1HA 3R61A 5BPIA 3L9FA 4UHTA 4RB1A 3E6BA 4EM2A 1OR7A 4LK1F 1O3TA 4XSZF 1JHFA 3TO7A 3FXQA 1T2KA 4OMYA 4MNUA 1G3WA 3TOAA 1IN6A 2CO5A 1XSVA 2VBYA 2MH9A 4AD9A 4I01A 4KA4A 4DNCA 5D5WB 2HWVA 3ELKA 4LGWA 3K0LA 1HXDA 4KFCA 1ON1A 2K27A 2FOKA 3BJAA 3LAPA 5F1RA 2VE8A 4EJUA 1LJ9A 3N97A 4BQAA 4KN4X 4RGSA 3L00A 5H6RA 1Z6TA 3M9AA 3KP2A 2KIUA 3K69A 2OD5A 1UFMA 2MBFA 3J80K 1SFUA 1FNNA 2DW4A 4ZYHA 4LD5A 2HTSA 4ENMA 1J5YA 5ICCA 3BDDA 2XHKA 1IXCA 2G7UA 2ELHA 2EA4A 2FE3A 2PEXA 1FYMA 3F8BA 2K4JA 3HTUA 4PGHA 3WTUC 2CGPA 2QM3A 1O7LA 4IRIA 1E17A 2W57A 3FM5A 2B0LA 1PDNC 4I98B 3G3ZA 1B1BA 2LNBA 4EJOA 5FGMA 3F6VA 2ISYA 5ILVA 2H94A 1U5TB 1YQAA 2WTEA 5ED4A 2XVCA 5DCFA 1Z9CA 3I59B 3LA7A 4G6DA 2V1XA 2VT3A 4M9XA 1D8KA 2F5EA 1FY7A 5HDNA 4G7HF 2LSOA 3P7NA 1IN4A 4FX4A 1K78B 3KP7A 5D4RA 3L2CA 1C0WA 3DF8A 4BYYA 1RUOA 2HYGD 2OQGA 1FBUA 1XGOA 4QLCU 1H9TA 3RYPA 2O8XA 4P5OA 4ZZDA 1HW1A 1SMTA 3IWZA 4HA8A 2Z99A 3LQQA 1DUXC 2L54A 3NEUA 1B6AA 4M74A
chains in the Genus database with same CATH superfamily
4DIQA 3QU3A 3LSPA 2ZMEC 4LIVA 5H6QA 1ORKA 1CF7B 2A07F 2DFEA 2TDXA 5TJJA 1CF7A 2OAZA 2XUBA 5J40A 2KDOA 2KISA 4LIUA 1XG1A 2ZFUA 3QPSA 5TGTA 3FBNB 3C7JA 3HM5A 2WV0A 3BJOA 4N9HA 2L7KA 5GAGJ 1G3YA 4ZYGA 5D6FA 3DXJF 1LDDA 4UUTA 3TP3A 2B63J 3F21A 1I50J 4IOAF 2L4AA 1WJBA 3Q0UA 3GVAA 3ZMZA 4MQVA 4ZC3A 4D0PA 4OIPF 5LHGA 1S29A 3WGHA 1RUNA 4L9TA 2CH0A 4E70A 5ILUA 1QVUA 2VL8A 1B4AA 1J09A 5HOOA 2H09A 3CO7C 2VXDA 2BY2A 3HHHA 1YIOA 2DPDA 1KU7A 4RAZA 3BQZA 4IOCF 4Y3OA 4DW6A 1SVMA 2I10A 4NUBA 4HF2A 1ON2A 1JT6A 2Q1ZB 4NB5A 3OYGA 3MN2A 1BI1A 3OIPA 2P5KA 4OINF 2M87A 4N0BA 3PIPF 4A12A 5ERIA 2XPUA 4I6ZA 4XRSG 1I39A 4HOBA 2CQ7A 4A0XA 3FM3A 3TO6A 3OSFA 1Y6IA 2LP0A 3CCVI 1E3OC 1LE8B 3H9JA 3KEQA 1IG7A 4M73A 1U9OA 2ZCWA 4CCOA 3JREA 1B59A 2IRFG 2VT2A 2HKXA 2WWYA 2E60A 1TQPA 2HQNA 1UG2A 4GFBA 2V1DA 2M7BA 1SFEA 1OCCH 4AWXB 1LQ1A 4OIQF 2HR3A 4CO8A 1QZEA 4RM3A 4JK1X 1Z67A 1QO0D 4CCLA 3C18A 4BHBA 3QODA 5K7FA 5CVVA 4A93J 5TRDA 4W97A 1I6HJ 1JGSA 3WU0A 4UV8A 1IZ1A 4ASNA 1V5GA 4EM0B 1RR7A 1G3SA 1E3PA 3E5UA 2AO9A 4Y13A 3OV8A 3ZXSA 4A0ZA 1X2NA 2Z3YA 2QF7A 2YR2A 5JFRA 3HXLA 4CSWA 2LY1A 3BG7A 1S9HA 2LKPA 3DFGA 5JR3A 2IS1A 1BIBA 2P6TA 3IWFA 3IH4A 1R9TJ 2VJ5A 1K79A 1TP4A 1W7PB 2R7FA 3P9KA 1W7PA 1N78A 1R36A 3E7LA 3LQRA 5E1WA 4NQWA 2V1UA 3AL0C 1Z3XA 3EYIA 3OYFA 3LA3A 1QZZA 4ZYAA 2VOOA 1J9IA 5KAFC 3K4LA 1LDKB 3CC7I 3G1OA 2COMA 3BR2A 4P96A 2R0QC 3O2PE 5D6EA 2DMQA 5K5QA 2VKDA 2LD5A 1R71A 1ZREA 2FXAA 2ZXJA 2JPBA 2ZJRF 2XB5A 2Z9OA 3OWTA 1ZLJA 1X2MA 4CCMA 4HBLA 2DJIA 4A5NA 2EJRA 2EV5A 2ZXIA 2A61A 1HCRA 4M72A 2CU7A 3IC7A 2JK3A 4PK4A 5J1RA 2Y0SN 4AVZA 2MYSA 1VQ5I 2K3PA 3VFZA 3V4GA 3ERED 3HHGA 4M3BA 1RR8C 1YFHA 4IHWA 3L7WA 3OYHA 4D5CA 4F3QA 3J7ZI 2E2IJ 1P9QC 2CQQA 4J00A 2VOPA 5J1YA 3O3KA 5BS6A 2XGEA 1W4MA 1MJ9A 1F36A 5GP9A 4CYCB 3ZRGA 1UHMA 3GCMA 4YRVA 2F4OB 3HRTA 5HS7A 1TL8A 3SZGA 1FPQA 4ZTJA 1MH3A 2E5ZA 2QBYB 2VKVA 3OS2A 3ZQIA 2QBYA 1HKSA 3CMYA 1JT0A 5DYMA 3KZIC 3K6GA 4HV5A 3JRHA 2DFFA 1O3SA 2STWA 2MSYA 4CUGA 3ZMSA 2EINH 4XQFA 3E6MA 4A3GJ 3ASNH 2HTJA 2IGMA 3WHCA 2KMUA 5DTDA 5D5XB 2XSDC 4R1HA 1JTXA 1F9NA 2R7TA 3B6AA 1YTYA 1R5HA 1T39A 4I7HA 1P7IA 3I0TA 2VXZA 4RBOA 3QU6A 3HSEA 2QZ8A 2HDCA 3I54A 4CHUA 4FCYA 2OTJI 1V55H 3PNYA 2RC4A 1FYKA 3QOPA 4QTRA 5LHIA 2FA5A 5L3GA 3BG5A 5GADJ 3K4JA 4BHCA 1DP3A 4BACA 1DPUA 4FISA 2K9MA 4U7DA 1KQ8A 2NYXA 4BU2A 2YS9A 2JA2A 5KHDA 2R7VA 3ZMDA 2DMTA 2ZFWA 5F1JA 2R7SA 1Z7LA 4HQEA 4A69C 3TO9A 3ZQGA 3BZ6A 2O8KA 3MAJA 3MFKA 1T6SA 2IVMA 1CGPA 2V6CA 5DUKA 3J7AY 2M1BA 2LH9A 2HQAA 2K9LA 1I3QJ 2QUFA 4HDVA 1Q1VA 3BWGA 5FLXZ 4XLPF 1ZG1A 1HBXG 1MMDA 2DYRH 3G6EI 3ZP5A 2Y0MA 3H5RA 3HRSA 2HQ5A 4QSHA 4Q47A 3KP5A 1ZLKA 3EQLF 2IA1A 2K9SA 4ABZA 2HI3A 2RQPA 2Y75A 3HJEA 1Y56A 1X58A 4GGGA 2W7NA 4AU7A 2FBKA 1KYWA 2M9HA 3N05A 5F08A 4F93B 2XAFA 2IA2A 2EZIA 5D4SA 2HPIA 5IT9K 1EJ9A 1WI3A 1YYVA 4XR6A 2A3SA 3NAUA 2E5NA 4BEHA 1Y39A 2E7WA 5EEHA 3CCEI 2R5ZB 4IX7A 2JRTA 2IEKA 3BPXA 2R5ZA 1HSJA 4O5VA 3DKWA 4PDKA 4A3LJ 1ETKA 4B1RA 1MJAA 4D7NA 4BAYA 3BR3A 4XLAA 2PBIA 2M4GA 1UAAA 4LMYA 4DQ2A 2I8DA 4R8HA 4UV9A 5LEJA 1REPC 3SFIA 1FJLA 1YE9A 1VQLI 4IO9F 1O57A 2X9DA 3RQIA 3ZGKA 4R79A 5K5OA 1MIJA 4YELA 2DU9A 1ZRCA 3CCRI 2HOTA 2DK8A 2L01A 4WXHA 3LSJA 3MWMA 1T56A 1MBJA 1R00A 2BXYA 2PMUA 4ESBA 3CCLI 1ERDA 3ZQLA 2LKSA 2YUSA 3CCJI 1MSFC 3W2AA 4XSXF 1S5LC 4EV0A 4ZTFA 2A6EF 2E36A 3HYIA 3HOSA 5JLXA 3CJQB 1OCPA 1OYYA 2OBPA 2E7XA 3BQYA 4EVIA 5JHFA 2IS4A 1RRJA 2DCEA 3DP7A 5FB2A 4M9ZA 2MG4A 2Q0OA 1F43A 2OCCH 1H8AC 1J2XA 1ETXA 1FOWA 3VODA 2VLAA 1D5YA 3BTIA 4EM1A 1BI3A 3M8FA 1FWZA 2QA4I 2W82A 3WE3A 3DU6A 4PJLA 4ENNA 3HOUJ 1XMKA 4XLFA 2H1KA 3K7AJ 2D1VA 2BVMA 3M4OJ 1H88C 5CYVA 2ZMEB 1VQ7I 2XKOA 3W3CA 1I27A 3CC4I 1DU6A 5KVRA 3CTAA 4X6AJ 1WKMA 3LSTA 1XC5A 3VYTB 5DV5A 2LTPA 3HRMA 4BJ6C 1BC8C 4MFDA 5CQEA 2KQRA 2HVRA 2XDVA 3JAMK 1LEBA 5BQTA 3BPVA 2R92J 1UELB 1ACIA 2IA0A 5K1YA 2ZJQF 1YJ9I 1XSXA 2L0KA 5LHHA 4Z6YA 2STTA 3OYDA 2XGXA 3OYIA 4K2EA 4A3CJ 4ITVA 2OV7A 2VASA 3S8PA 2DTZA 2QKLB 3ZN0A 1W7PD 3TGNA 2BZTA 2X6OA 2KZGA 1DGWY 2QEXI 3I4MJ 2V1NA 2L9VA 1IRGA 1R7JA 1X4OA 1UB9A 3CF2A 3DQVC 3VB2A 3A4CA 1IN8A 2L9NA 4HSTA 4LLNA 2QQAA 3GUDA 4GXOA 2EWNA 5J4VA 2OU2A 1IDYA 2QKMB 3KP6A 1EH8A 5A2QK 1USTA 2MD0A 9ANTA 2EFOA 2WADA 4YIRX 1USSA 5GTHC 5IOZA 5D5UB 3CO6C 1W5SA 4XLHA 4HLYA 1FZPB 1NTCA 3D0SA 4B43A 2E1CA 3H0GJ 2WB1A 3HSFA 3WU2C 4UVCA 2UWMA 1PP8F 1S6LA 1HQCA 2Z1DA 4HAMA 4NHJA 2QVOA 2M34A 2CFXA 5GTIC 1P4WA 4NC8A 5F0HA 5GAHJ 1ZYRF 5J6XA 5BOXA 2HDWA 4CGZA 4CDGA 1RESA 2IXSA 2OC6A 4HV6A 3WTZA 2FBHA 4YFKF 1O4XA 4YFNF 4Q4ZF 1JI8A 1QU3A 2O6GE 5EEAA 5HNHA 2M5WA 4RA2A 4KITB 3ABLH 1R58A 4OWRB 2HPMA 4KT5C 1JUSA 3DBLB 3AL0B 3G71I 4BE0A 1FOXA 3RZOJ 1NH3A 3TQNA 1ZRDA 4A3MJ 1U9NA 5HLTA 4A3IJ 2OQRA 5JVTA 1XGNA 3GO5A 2RGVA 5B66C 3GBGA 1TWGJ 2GA1A 4U7BA 4ANJA 5E18F 3FXJA 1N77A 3S32A 4XMYA 1ITYA 2P6SA 4I76A 5K5RA 1G2HA 2ESNA 5DDGA 1W5TA 3RKYA 4WXCA 3F6OA 5EZGA 2JZYA 3COAC 5IYCJ 1WJCA 4XRSA 4BGDA 4BJ5C 1NHAA 2JA7J 3LFKA 1T33A 4FE4A 3TKYA 4CCJA 2PN6A 4D1QA 1GT0C 1YX3A 2JA5J 3HOYJ 3DBHB 1K6OA 4BNCA 4JQFA 1HC8A 2DMNA 1XMXA 3GLLA 1D3YA 3I3LA 1O3RA 4U88A 1SAUA 1KU9A 4IQJA 3WG9A 5LRSA 1MD0A 2E2JJ 4G6QA 1X4PA 4CCKA 1WH5A 2ZO4A 2PMHA 1V4RA 4G7OF 1P7JA 2FOWA 4Y4RA 4M3GA 3RIRA 3K4NA 3ZQQA 1DP7P 1A04A 4UUSB 5HS9A 3KZYA 5C3EJ 2HYFA 4UUSA 3LFUA 1OYIA 2IPQX 5IYBJ 5FROA 3IRQA 2DXIA 1QNTA 5CKTA 3SEQA 3DEEA 1BOBA 2EFNA 3O8HA 4DZPA 4XKWA 5L3BA 1LVAA 1WH7A 1XGSA 2PMZN 3S1MJ 2N8GA 3SYTA 2WAQN 3EUHC 3O6BB 2M30A 2K4BA 1YOVB 2XAGA 2ME6A 1MMSA 1I1GA 5FLMJ 3AG3H 3MMYB 4II3A 2BEOA 3IP4B 1QRYA 1U5TA 5FJ8J 3ML6A 3FXKA 4BE1A 4KN7X 4BXFA 4C30A 3ECHA 4XN3A 3E5QA 3BC8A 3I59A 3S3MA 1NG6A 4RS8A 3VOEA 4AIDA 1Y8QB 3FHNA 3JRGA 4P9UA 3CLQA 4J01A 5EGOB 2BXZA 2E1NA 1BR1A 5EGOA 1J7KA 1QGPA 2JUGA 4PJ0C 1SVLA 4DYQA 3JTGA 3BG3A 1ETYA 2DT6A 1WQ2A 2A05A 2KT0A 1K78A 1XDSA 2L9RA 5ICEA 3OYBA 1S8NA 2FMLA 2XROA 5GPAA 4IRHA 4E7LA 5L3DA 2QENA 5LGNA 2CWEA 1OCZH 1TQMA 3I56I 1Q1HA 2E19A 1ULYA 5HNFA 1ZQ3P 1DPRA 2K40A 2CQXA 3DPUA 4XKVA 3ZOBA 5AONA 1LUJB 1EA3A 4LB5A 4OMZA 2RVCA 1IUFA 4E7IA 1SFXA 1ZR2A 4LK0F 3TMOA 3V7SA 4UB6C 2PJRB 5F0FA 2PJRA 5HS8A 3FXLA 1H0MA 1OLTA 1LKXA 2DOFA 2DA1A 1MGTA 4HSRA 4EJWA 4ESJA 2K02A 3ULQB 2VPLA 5EEGA 3PO3J 3A02A 3ROUA 4WWCA 1F1ZA 4EEFG 3H3ZA 1G4DA 5FRNA 4PFOA 1KQ9A 2O0YA 3OYJA 1XS9A 2NVXJ 1IW7F 3GTJJ 3D5RC 1AHDP 3RKWA 1FIPA 2QQ9A 1YW9A 3ASOH 4IRGA 2LDUA 3PM1A 1KZHA 4IEJA 2K7LA 4BHPA 4KT6A 1VQNI 1XMAA 5M5YJ 2Y9ZA 1G3TA 2KIQA 2XPVA 4XOTA 1D5VA 2JPCA 4I2OA 3BLYA 2P5LC 1P6RA 4YIIA 1KONA 2CV1A 3ABUA 4E7JA 4Y17A 1D0ZA 1QPMA 1B9NA 3J81Z 4B44A 1BI0A 3KPHA 2VPRA 4HNTA 3CMMA 1UG0A 1R4NB 3SZPA 1MMNA 2HOAA 4OIRF 2MLGA 4Y33A 1W0TA 2DDBA 2JUCA 2K9NA 2L7MP 2LF8A 2P7VB 3BP8A 2ZB9A 1IO2A 4L0ZB 1FEXA 2W25A 2DAOA 2EPFA 3ZCOA 1BW6A 3HC7A 2ZSHB 2RREA 1OKRA 2DMPA 4DBRA 1I1SA 4MEYF 3EYYA 3U21A 1S72I 1ZG3A 1LNWA 1J59A 5ICGA 3HOWJ 3DEUA 3WTXC 4ZYEA 1LE8A 4DZJA 3QP5A 1LB2A 3VDXA 3H5NA 4IVNA 5F27A 1TWCJ 3WTSC 1BIAA 4KDPA 3HOXJ 2ETHA 3HEFA 5M3MJ 2VJ4A 1HSTA 1ETQA 4V19K 1UJ8A 4HQMA 2KKOA 1R4MB 1X3WB 2HOEA 5E1XA 4XICA 1U0JA 1PP7U 1FBQA 2DQRA 5JVGF 2JSPA 1O7FA 1P2FA 3BOQA 5B3SH 1TT5B 2Q8KA 2W4SA 2A6HF 4ZDPA 3ECOA 3S2HJ 1PUEE 1JKRC 3HB9A 2GZWA 2ISZA 2P5VA 1OR7C 1FTZA 1KU3A 2MFZA 2KFDA 3GFJA 2EK5A 2LVSA 4BE2A 4DBQA 5HODA 2H1LA 4IHYA 3NWTA 3MZ8A 4DJAA 1KYZA 2PI0A 4FT8A 3OIOA 3CF5F 3E6DA 1FBSA 1TLHB 3KYDB 4GYGA 4RLFA 2NVUB 5DS9A 3CMEI 2IT0A 1XCVA 4BKXA 2UV1A 3TBIA 3TDZC 1ZG5A 1QZYA 5B1AH 1ETWA 3S3NA 4Q5SF 3BR0A 1GVJA 2R7OA 3QPHA 4YG2F 2M8GX 3A2KA 2RV8A 3H35A 3DKYA 4XKCA 2NS0A 2F48A 3A01B 2O03A 1E2XA 3CUQB 1R5GA 3KCCA 4XLNF 3OYCA 1QA6A 3CUQA 3F9KA 2F2EA 1RKTA 2VC1A 2W48A 1YW7A 3FMRA 2X6YA 2COBA 2LBFB 3HKZN 2L4MA 2XIGA 2EV6A 2X4HA 3R0JA 2DODA 2EIMH 3CDHA 3QWLA 3VYSB 3GTPJ 3PJRA 5B5EC 3FX3A 2X6WA 1POGA 5C44J 2A5YB 3LSIA 5FD6A 2CJJA 2TRTA 2KDZA 1ZHFA 4HX8A 2M2EA 1DU0A 3GFLA 1EH7A 2L7ZA 5L3FA 1IV8A 2JVHA 4CYCA 3G4SI 1FMVA 2MC4A 4ZDLA 2R7UA 4E7ZA 1RNLA 1WZ2A 3JSPA 4O6JA 1SFKA 3Q5FA 3LSKA 1HKTA 4C3IJ 3JRFA 1WGXA 2Y9YA 2PJPA 1OCTC 2UXXA 3BROA 4FHTA 1GV2A 1IXRC 3L2RA 3JAMZ 3HZJA 4UB8C 1HOMA 1H89C 2F5DA 3FF5A 3MVPA 4M74A 2V6EA 3QPTA 4IZZA 4EJTA 4MGRA 5DUIA 3AKZA 1TWAJ 2O3FA 3E5XA 4I02A 2LR8A 4L5IA 1Z21A 2A68F 4HPQA 1VI0A 4Y7NJ 2NRAC 4BXXJ 3J7AO 1JUMA 2QYOA 4PFPA 2K3FA 1WJFA 5CVJA 1Y1VJ 3PL8A 1SD6A 3FXMA 3H5AA 3OL4A 4BH9A 3OYMA 1XGMA 3AG4H 2VJJA 3ZMTA 5E8IA 1TQIA 2IS6A 4M6VA 3A1YA 4RAYA 3FDYA 3W6VA 1I6XA 2AS5F 1IRZA 2R93J 4KIFA 1TT0A 4F52A 1XD7A 1W0UA 1JJ6C 3S2DJ 3FZVA 3K2AA 3F8FA 4LLLA 4G9YA 5A2QZ 2IBDA 2RN7A 1R1TA 4WXDA 4CYDA 4H0EA 6PAXA 2K5CA 3I64A 3OYLA 4TV7A 4OAZA 3OY9A 2FU4A 3MZHA 3WTTC 4II2A 3MEXA 2PFBA 2XAJA 2XAQA 4OU0A 1V5EA 1XDUA 4J19A 4PGGA 1Z7UA 2L3DA 2ME0A 1QBJA 2IAIA 2GXAA 3CQZJ 3DLAA 3A03A 5KAIC 2CV2A 1X1AA 2MD5A 2IP2A 2MABA 5H2FC 2YX7A 4MEXF 5IY5H 3LSRA 3F8CA 3M7GA 5F04A 1FT9A 1KA8A 1PYVA 3CCMI 2XV4S 2KJBA 1BL0A 4B09A 3NQOA 2W24A 4Z2YA 3OIQA 3R60A 1VQPI 1R49A 3A0HC 3HPHA 1OFCX 2VN2A 1IUYA 2CMPA 1IF1A 2CQKA 2HZTA 2M8EA 3T8RA 4AIHA 2XAUA 5FKMA 1U78A 3H3UA 1MKMA 3KLOA 2F5FA 3C2BA 5J8CA 1W36C 3B02A 2KRCA 1GHCA 1VQ6I 1TWHJ 5BMZA 3V42A 5AIQA 3AFHA 5TISC 2MW8A 4RM2A 2E1MC 3UR3C 3QAHA 3VSKA 3GZ6A 1A5JA 1H9GA 3P5JA 4RGRA 3QYFA 3HOTA 2A69F 5E3LA 5J3LA 1YS7A 3IH3A 1UCRA 1LFUP 1BN5A 2X1EA 2QLZA 2ID3A 3KLNA 4ON0A 3TDUC 4KUMA 3FWEA 1RKWA 4JYKA 3GZ5A 2NVTJ 3BR6A 1OPCA 1K6YA 3I4NJ 2XF6A 3ABMH 2HQRA 3ZPLA 2HZDA 1P4AA 3GEZA 2V7FA 2BW3B 2P8TA 4G8XA 2BW3A 4XRFA 2M45A 3H0DA 3E0JB 4AYBA 5LEKA 2ZNZA 3GTOJ 3J80Z 3BZCA 1GVDA 1MJBA 2R7DA 4QPOA 2GXGA 1YG2A 3PSIA 2EFWA 1IAWA 3MZYA 1FOKA 1TW2A 2HXOA 2ELKA 2EZHA 3ZQHA 3TL4X 1UMQA 1I5ZA 3SDGA 2FJ1A 2KRHA 1XB4A 3B73A 4KIGA 2D45A 3WTYC 4L9VA 4QWQA 3GZNB 3P9IA 2F6CA 4EQQA 3IKTA 2O9LA 5F64A 4C2TA 4L0YB 4MHGA 1NK2P 2FD5A 2CUJA 2XAHA 2BV6A 4HX4A 1X1PA 2KIMA 3SZTA 4LLGF 3GTMJ 1Y0NA 5EG0B 2ZBKA 1DGRM 3F8MA 5H20A 1IN7A 5FRMA 5ILSA 4EGYA 2EILH 1TWFJ 1BOAA 3HDDA 1SEUA 2ZMEA 1A35A 1WSUA 2KHMA 4BBRJ 2VONA 2HFHA 3CJRB 2CS3A 2R3SA 3O8GA 1YRNB 2D2WA 5FKKA 1KU2A 1FSHA 1YRNA 4G7ZF 4PZJA 1ONVA 2IGOA 3HBLA 3FKIJ 2K9QA 3NARA 1MNEA 3ABKH 4IHSA 2KZVA 2DO7A 3U1DA 2NNNA 3KETA 2B9SA 5E1ZB 5FO5A 3NRVA 3K1PA 2VJIA 3WU1B 3KFWX 3BR1A 2BY3A 1VTNC 3QPLA 4A2UA 3F3XA 1V3FA 1X1BA 2V26A 3PFIA 2X6XA 3H3VK 1MBEA 4ESFA 4HX7A 2DI3A 4BJTA 1WJ5A 2KPMA 3KYCB 4XKBA 4XNFA 3OOPA 2ID6A 3PQKA 4RMNA 1SD7A 3EDPA 4I0BA 2CSOA 1SD5A 2L7FP 2OPTA 2QCOA 2YU3A 1F5TA 3HRUA 1YITI 1IV6A 4CCNA 2PQ8A 4UVAA 4P1WA 2NOGA 3ESWB 3R4KA 2DA5A 2P0WA 1TC3C 4MQ9F 4AUXA 2EIKH 1T8IA 1S7AA 2GQQA 5CLSA 2VBWA 2W84A 4PUSA 2UXNA 3GXOA 4JOMA 1QHHD 2Z5UA 4PSWA 2WAFA 3JRBA 2P4WA 3V8JA 1S7EA 3KE2A 2NS8A 1OYWA 2DA2A 4A3JJ 1CQTA 2O61A 1M1EB 4MFEA 4RB0A 4HF0A 2G7HA 3L2VA 2OA4A 2FSWA 2HEOA 2YPRA 1RZ4A 3GTKJ 2LLKA 2V79A 5FFZA 2VE9A 3NWSA 3HG9A 1R1VA 3B6CA 1TW3A 5B1BH 1AKHB 2QSHX 4ZZLA 1AKHA 3S1QJ 1Z91A 2WBMA 5DD4A 2JA6J 2VKEA 5FLXK 3L1PA 3FHZA 1TTYA 1GUUA 2FNPA 2L2OA 3LNQA 4ENKA 1LDJA 2V9PA 5CVUA 4A3BJ 1BJAA 4MIMA 2XF5A 3DPLC 2FNAA 3RPQA 3C1DA 2J5PA 3RYRA 4M3EA 2WB1N 1N25A 2H6CA 2VQGA 5D8LB 2X1DA 4G94A 4W1UA 3LWFA 1U2WA 1PUFB 2XB0X 3TW6A 4KICA 2VQHA 2OCEA 3OL3A 4RB2C 3BCBA 4RAFA 2BGCA 4CA0A 3DEWA 2VKHA 4M3FA 5LLQA 5AIPA 3LSGA 4AIJA 1JKPC 2RQQA 3CJTB 2VUMJ 2ICWG 2DFIA 3JCUC 4MO7A 1GDTA 5LRRA 3JR9A 5IOYA 2NS7A 1WFXA 2DFHA 2R5YB 2OTLI 1MNDA 4PCQA 1IN5A 5FKNA 2BE5F 2R5YA 2EIJH 1FLIA 1X1DA 4X0GA 2QWWA 1OCRH 1ZK8A 1MBKA 2M3AA 2Y69H 1D0YA 2FQ4A 2WAQA 1DDNA 2CFOA 1MBFA 4KYWA 1L0OC 2XGCA 1R1UA 5L3CA 1JXSA 1R6RA 4M6XA 4OAYA 1JKQC 1VQOI 3T8TA 4S04A 1XPXA 3L2WA 2TCTA 4PJNA 3REOA 4A6DA 2Z33A 1F4KA 4RAGA 2J5OA 3G1LA 4B3AA 1L3LA 5E17F 4NNJA 3HUGB 1D1AA 3T5XA 3GFMA 3HUGA 2DBBA 2EA2A 2R7QA 1P4XA 1S3JA 3M1EA 1U6GA 3FMQA 1WPKA 4DOZA 2LG4A 2OUMA 1ZH5A 5E79C 1YO5C 2LY2A 3VPRA 1YX5A 4UNOA 1K61A 2MH2A 3BJ6A 2R7ZJ 4BDZA 3V8KA 3CDIA 3I71A 2V9VA 1QPIA 3SDBA 3V7CA 4YIFA 2LF7A 3SXYA 1WJEA 2ELJA 2NNYA 2VB6A 4A3FJ 5HVQC 2DT7B 4IHXA 1MMGA 1SVOA 2IW5A 4B47A 2H27A 1XX5A 2BY0A 3T0YA 4ETSA 4S05A 2DPUA 4D9JA 3KIOA 2Y30A 1XSDA 1IDZA 5FD5A 1AWCA 5HDKA 1MDMB 1J75A 5E3OA 1IC8A 1MDMA 3KX2A 2GBYA 1JJ8C 3C3WA 3CLOA 2VBZA 1HLVA 3FKJA 3C2GA 4KNYA 4S0HB 3HOZJ 3K70D 4B48A 3BY6A 3PO2J 2BHZA 2JA8J 4GCVA 2BBYA 1JE8A 5DM6F 4GRIA 3OS0A 2GAUA 4GYIA 4KMUX 3W6KB 2PG4A 2YSRA 2PX9A 3OR1C 3CMAI 2IJLA 2CV0A 3GLXA 3JRAA 2WC2A 2JN6A 5JHUA 3GTGJ 3BR5A 3WGGA 4KMFA 3JRDA 5J8FA 1YLFA 3QYBA 4B4CA 2R7WA 2A6TA 3DWLE 2NVQJ 2LREA 1G59A 4BUPA 2FMYA 2YX4A 5IT3A 2JTVA 1TNSA 1IXSB 5EYRA 5CVIA 2RAEA 5BNGA 3RCOA 3DKXA 3LL7A 3GWZA 2ZXWH 1LFPA 5HLHA 3QRFF 1FTTA 1SAXA 4HDUA 2HKOA 4EGZA 3MKYB 4F92B 1O3QA 1R23A 5JI6A 2E1MB 3QOEA 2LKXA 4AC0A 4P55A 1KGSA 3RPUA 4L9NA 3I4PA 2XKPA 2Z2SB 1Z6RA 2BHYA 3F72A 4LG0B 2LOOA 1XTAA 2MA3A 2OZUA 1ZARA 4U87A 5DEQA 4LG0A 1R22A 2CW0F 2NAZA 3ONQA 2L02A 4N4NB 3G2BA 1WI9A 4A6EA 3SJMA 2CW7A 4IF4A 1MSEC 2LFBA 2HDDA 3CP2A 5LGTA 3G1MA 2MC3A 2XC7A 1ZR4A 1D1CA 4XORA 3KYLA 1NG7A 2OZ6A 1YS6A 2BYVE 3GFIA 4CZZA 1T0FC 2DJNA 5FLVA 3CP8A 3RI4A 1G6NA 2F4MB 2KL4A 1U8BA 2AHQA 5GPCA 2JSCA 1QQIA 4FETA 4FX0A 4Y52J 4AVPA 2RNGA 4HZFA 1HF0A 1TBXA 1AA7A 2JMWA 2E2HJ 3CJNA 4BS9A 1T98A 3F22A 1HDDC 1SD4A 1N75A 4GDFA 2ZJPF 1A36A 2NOJB 4V2FA 3JRIA 2GWRA 1K4SA 1A6QA 4A3KJ 4CXFA 1JHHA 1BC7C 1VQ4I 2HU9A 4C3HJ 1B8IB 5EF6A 3SEZA 1ZELA 1HDPA 2EZLA 3RTRA 3PQJA 1B8IA 1ZGAA 4CICA 4L9JA 2XRLA 3IUOA 4IHTA 5IT9Z 4N4OB 1Y1WJ 4E7KA 2UZKA 3DCFA 2FF4A 3PIOF 4OIOF 2JJ7A 3HTSB 2WY7Q 4LITA 2DLLA 3LAJA 5E8GA 2E71A 2HNHA 3ZMVA 4M9SA 3TOBA 3S16J 4MTEA 3H9QA 4DGWB 2CUZA 4F55A 3JTHA 5EZHA 3F8NA 4M6YA 3M8JA 5HLIA 2H8RA 2IGNA 2V4JC 1BBYA 2Y0SA 1BJZA 2FQ3A 1K4TA 4ZH4F 2DA3A 4E7HA 3KZZA 4KJZA 3WTVC 2EZKA 1FIAA 1FMWA 2RKHA 3HKZA 2KRFA 4D5FA 3UKGA 4IPAA 2EB7A 2HYJA 1MBHA 4Q48A 3ZQ7A 4NQWB 3KP4A 4L5EA 3T1BA 3F23A 3U1KA 3J7YJ 3K1NA 3EETA 3L2QA 3A01A 4I09A 2DDAA 2AQFA 1YW8A 3LA2A 3Q0VA 3PUBA 2GLOA 5KCMA 3GTQJ 3M1CA 2C6YA 1HKQA 3SHFA 3CZ6A 5E20A 1SMYF 3K2ZA 4UVBA 1S7OA 2LBFA 4RB3C 3IL2A 1YHQI 3C2HA 4RGXA 2K86A 4U0YA 4B3XA 4E7SA 3VSLA 1RC9A 2E34A 1NK3P 4NBQA 3I5UA 2FBIA 4C3JJ 4HEA2 4LFUA 5KNLA 5BPDA 3OYEA 1RIOH 1BW5A 4YEJA 1OQYA 5ICFA 1ZGJA 3EUAA 4IJAA 1XCBA 1VQMI 3F0CA 1MH4A 2ESHA 4NC7A 1WCMJ 2LC2A 3RDIA 2ZNYA 2CW8A 1VQ9I 4GO1A 2F5VA 4M3DA 2W85A 2RNJA 3GMEA 3V8LA 4BQOA 3I9V2 2G0EA 3WODF 2QSFX 5J1UA 4XRMA 3CCUI 4C2MJ 3BG9A 3WHBA 2A5WA 1MZBA 1HW2A 3Q9VA 1DQUA 2DOEA 3E6CC 3R6SA 2K85A 2R7RA 4M71A 3W2VA 1W5CC 2I5UA 4UXNA 4AIKA 3WE2A 2P7CB 5HLGA 3OYNA 5L3EA 1T38A 1B72B 4UUVA 3FISA 4JX5A 3RSNA 2QQBA 3HOVJ 3LMMA 3CCSI 1B72A 3JSOA 3AAFA 2XASA 3M3YJ 1X3ZB 1P92A 3BCAA 3RKXA 3CESA 4F91B 2JT1A 2UUZA 3ABTA 4BXUA 2QSGX 2R7XA 4LG3A 3DV8A 4F7ZA 2NVYJ 4FTHA 2DT5A 3H36A 2DA6A 4HNVA 3QQAA 3X2QH 4XOPA 5J47A 1FX7A 3FK6A 3UNGC 3L09A 4EMSA 3HL2A 2GIVA 2JVGA 3MQ0A 1FOYA 2VIXA 1ZTRA 3S3OA 1U5TC 4E6KG 3K4MA 3S2WA 3N4MA 1X3UA 1Z1DA 4U0VA 5D5VB 2W00A 2ZSIB 4BQQA 1EF4A 1FP1D 2EBIA 2GOXB 3EPZA 4ZYDA 3Q9SA 3MCZA 4EJVA 2F5CA 3SFZA 3U2RA 2BY1A 1ZAOA 3IAM2 3GYHX 2EQRA 2H8WA 3IHUA 1BI2A 3M8EA 1SC7A 2AQEA 3BZKA 3I53A 3GX4X 1IRFA 2DK5A 2DA4A 3J81K 4BBSJ 1FYLA 3QYEA 3D5SC 5LGUA 2ADUA 3U9GA 3OR2C 3V7RA 1ZGWA 1EH6A 3AG1H 3GTLJ 1EKEA 3M07A 3DTEA 4ZJZA 2HGCA 3VEPA 1YI2I 1IGNA 3HPGA 2KP6A 4WX9A 5FKLA 2X48A 4HW0A 1ZRFA 1Z3YA 5JLWA 2XSJC 3GW2A 2EH3A 5C4XJ 2Z16A 2Q2EB 3DLLF 2WY8Q 1LEAA 2V9KA 4XK4A 4FQGA 4B8XA 2Q2EA 3K1MA 3IAS2 1MNMC 4O3MA 2LK2A 4BY1J 1IRXA 2ZC2A 3DPTA 1PJRA 3CUOA 4NC6A 4BDYA 4I0AA 1A6IA 1FP2A 1GXQA 1YJNI 5KK1A 2DQLA 4JX6A 5FKOA 4HF1A 3R0AA 3GF2A 3I55I 2BOLA 3EUKL 2FX0A 4HLXA 1TNTA 4LB6B 1VZ0A 3EUHA 4ENJA 1B9MA 1ZN2A 2MLKA 4Y15A 3WTWC 3PNVA 4A5MA 3KEYA 3FBIB 1RPWA 5IYDJ 3L2UA 4FASD 1GV5A 2IGKA 1AOYA 2DMUA 2H6BA 2ACJA 3ZN1A 1GXPA 1WJAA 1TZLA 4BEHB 4MLOA 3SQNA 2KIFA 4FE7A 4WF2A 1RETA 2LY9A 1W36D 1RI7A 3W6JB 2O7OA 5E3NA 3BT9A 1U8RA 4H4KC 1JGGA 2HXIA 3RPUD 2VQLA 2DA7A 4RDUA 4XIDA 3E3VA 4JX4A 4HRIA 4HYEA 2AXLA 4DYCA 2L9SA 3A0BC 2VC0A 4C9YA 1V54H 2VODA 1Y8RB 5EJCA 2DTRA 1MMAA 1STZA 3DTIA 4ZDOA 5FFXA 3E97A 3TP0A 2Y48A 2CYYA 2X0LA 5IP9J 1BM9A 5CJ9A 4MTDA 2IS2A 1XN7A 1UHSA 2PLYA 3IRRA 2G9WA 4XLEA 4KIBA 3WGIA 5E3MA 1QVTA 1WWXA 1VQ8I 3ZQCA 1D8JA 4L5JA 4V2GA 2FRHA 4I99C 1WJDA 1ETVA 5EG0A 4WK8F 1E3HA 1KQ0A 4BY7J 2DYSH 3FMSA 1FSEA 1G8XA 1BR2A 1ODDA 2EV0A 2XF7A 1HA8A 3KP3A 4A3EJ 3K4BA 2YU9J 4IKFA 4A3DJ 4LJZF 4AYBN 2ZXHA 3KEOA 1FC3A 4N9IA 5K7HA 5F6FA 3LSHA 1HW5A 2O5RA 3ISPA 1OMIA 3FXRA 4XBFA 2HVQA 4IQ4A 2RDPA 2VBXA 3CC2I 1V5FA 3S17J 3QP6A 3HSRA 4XN0A 5CVRA 4C2UA 4A0YA 5DCMB 1E0EA 5DCMA 5LD2C 1LVKA 2LYCA 2GXBA 3K9TA 4CZCA 5D8KB 2QQ8A 3ZMUA 5LBQA 1U3EM 1VQKI 4L18B 3TEDA 4XL9A 1D0XA 4YFXF 1UHWA 3IH2A 3S14J 1WRJA 3JW4A 1UZCA 2EFQA 2WV1A 4DYRA 3CD6I 2EFPA 4JBAA 3H1CA 3MKWB 1T0FA 1Z0XA 3Q3SA 2HS5A 3D5LA 1AU7A 4WCGA 1T08B 2LRDA 2CG4A 3RJPA 3OSGA 5HDGA 3HGGA 4OOIA 3CCQI 2XRNA 1MW7A 1K7AA 3CUQC 2ZJ2A 3HIFA 1Z05A 2HVSA 2ZKZA 1ENHA 1EV7A 4U0WA 3BTCA 4P9FA 3P9CA 3I58A 4PJMA 3FXUA 1LPQA 2GOMA 1Z77A 2FEZA 2VQCA 2XGDA 3E1SA 1LFBA 1K83J 1VNDA 3H92A 3CDLA 3VYUB 4LOCA 4RGUA 1JKOC 1Y0UA 2GM4A 2LMDA 2JQ7A 3G73A 1J0RA 1MBGA 2GA2A 2NXNB 3IKVA 5DD8A 2KJCA 1YIJI 4IXAA 2D1HA 3MKLA 3R61A 4PSXA 2FUG2 2DOAA 4BL0B 5BPIA 3L9FA 4D7MA 2AXTC 4UHTA 5DM7F 5IP7J 1R5ID 2ECBA 3E6BA 4RB1A 2Y2ZA 4EM2A 1OR7A 1X1CA 1JTYA 4LK1F 3W2WA 1O3TA 2BVLA 2X51A 4XSZF 2W1OA 1JHFA 1OISA 3TO7A 3MKZA 2KLOA 3TW7A 5M5XJ 3FXQA 1T2KA 4OMYA 2GIZA 3JRCA 3IV5A 3RKQA 1QHGA 4MNUA 3FK7A 1SFOJ 2CRGA 2OJED 3DBRB 1G3WA 3TOAA 4NDLA 2CUFA 4QIWN 3S93A 4RLQA 1IN6A 2M0MA 1PUFA 3PSFA 2CO5A 1XSVA 3H9GA 1OCOH 2MGQA 3MD2A 2VBYA 2E35A 3K4CA 2MH9A 4AD9A 4QPQA 4I01A 4KA4A 4DNCA 5D5WB 2CUEA 3S1NJ 2HWVA 3ELKA 4LGWA 3K0LA 3VYRB 1HXDA 4KFCA 1ON1A 3OS1A 1BA5A 2K27A 4E4HA 2VI6A 4G12A 2FOKA 3BJAA 3LAPA 5C4JJ 4HG2A 5F1RA 2VE8A 1OJLA 4EJUA 1LJ9A 1YJWI 3N97A 2XPWA 5LFAA 4BQAA 5K7ZA 2PMZA 1T95A 3HGYA 4KN4X 4RGSA 3L00A 5H6RA 4HNUA 4X1EA 3RQ4A 3K4KA 4XONA 4JP0A 5M5WJ 1Z6TA 3M9AA 3KP2A 2KIUA 3K69A 4CH7A 5IPAA 2OD5A 1UFMA 2X85A 2MBFA 3BTLA 3J80K 3OYKA 1SFUA 1FNNA 2DW4A 4ZYHA 4LD5A 2X1CA 2HTSA 4ENMA 1J5YA 1SANA 5ICCA 4BQNA 3BDDA 1PVEA 3BTJA 3WG7H 2XHKA 1A31A 1IXCA 2G7UA 2ELHA 3BG6A 2EA4A 2FE3A 2PEXA 1FYMA 4IHVA 3RZDJ 3F8BA 1ETOA 2K4JA 3HTUA 2OF7A 3ERMA 2M7AA 4PJJA 2F4IA 4PGHA 5IP6A 3WTUC 2B7EA 2QM3A 3OYAA 2CGPA 1O7LA 4IRIA 2ECCA 1E17A 1I3AA 2W57A 2DN0A 1JUPA 3D1NI 3FM5A 5EDNA 2B0LA 1D1BA 4I98B 1PDNC 4IL6C 3K10A 3G3ZA 2WA0A 2JWTA 5J4YA 1B1BA 2LNBA 1GLNA 5GAEJ 3VWBA 1WHUA 4XM3A 4EJOA 2L5QA 5FGMA 3F6VA 2ISYA 4UY8I 5ILVA 2H94A 1U5TB 3FIWA 1YQAA 3PUFA 2WTEA 5ED4A 3FXOA 2XVCA 5DCFA 3LOCA 5M3FJ 2QGUA 4XLCA 1Z9CA 3I59B 5CPRB 3PFYA 3LA7A 4G6DA 4EATA 2V1XA 2VT3A 1W1WE 1APLC 4M9XA 1D8KA 2F5EA 3OOUA 5F0CA 3DU5A 3K70C 1FY7A 2WAEA 3CCYA 5HDNA 2E1OA 2P81A 4G7HF 2LSOA 3P7NA 1IJWC 3DTKA 1IN4A 3OMYA 3PNTA 4FX4A 3Q0WA 1VFCA 2Y31A 1K78B 3ZQFA 3KP7A 5D4RA 3S1RJ 4G6TB 3L2CA 1C0WA 1BR4A 2D5VA 3DF8A 4BYYA 1RUOA 4AM3A 2HYGD 2OQGA 1FBUA 1XGOA 3AG2H 4QLCU 2R4GA 1ZKGA 1VF9A 1H9TA 1X19A 3RYPA 4KISA 5CQGA 2M0CA 2O8XA 4P5OA 4ZZDA 1HW1A 1WVRA 2HOSA 1SMTA 3IWZA 4HA8A 2Z99A 3ZR8X 3LQQA 1DUXC 2M4KA 2L54A 2JRMA 3NEUA 1B6AA 3LSMA 2CQNA 3S15J
chains in the Genus database with same CATH topology
3QU3A 2A07F 5H6QA 1CF7B 2TDXA 5TJJA 1CF7A 2OAZA 2XUBA 4N9HA 3C7JA 2WV0A 3BJOA 1G3YA 4ZYGA 5D6FA 3DXJF 1LDDA 3F21A 2L4AA 3GVAA 3ZMZA 4MQVA 4D0PA 4OIPF 5LHGA 1S29A 3WGHA 1RUNA 4L9TA 4E70A 5ILUA 1B4AA 5HOOA 2H09A 3CO7C 3HHHA 1YIOA 2DPDA 1KU7A 4RAZA 4HF2A 1ON2A 4NB5A 1BI1A 2P5KA 4OINF 2M87A 4N0BA 4A12A 5ERIA 4HOBA 4A0XA 3FM3A 3TO6A 3KEQA 4M73A 2ZCWA 1B59A 2IRFG 2VT2A 2HKXA 2WWYA 1TQPA 2HQNA 2V1DA 1SFEA 1LQ1A 4AWXB 4OIQF 2HR3A 4CO8A 4JK1X 1QO0D 3C18A 4BHBA 5CVVA 5TRDA 1JGSA 3WU0A 4UV8A 1IZ1A 4ASNA 4EM0B 1G3SA 3E5UA 4Y13A 3OV8A 4A0ZA 2Z3YA 2YR2A 5JFRA 2LKPA 3DFGA 5JR3A 1BIBA 2P6TA 3IWFA 1K79A 1W7PB 2R7FA 3P9KA 1W7PA 1R36A 3LQRA 5E1WA 4NQWA 2V1UA 3EYIA 3LA3A 1QZZA 1J9IA 2VOOA 1LDKB 2COMA 4P96A 3O2PE 5D6EA 5K5QA 1ZREA 2FXAA 2ZXJA 2JPBA 2Z9OA 1ZLJA 4HBLA 4A5NA 2EJRA 2EV5A 2A61A 4M72A 3IC7A 3VFZA 3V4GA 3ERED 3HHGA 1YFHA 3L7WA 2VOPA 3O3KA 5BS6A 1W4MA 1MJ9A 1UHMA 3HRTA 5HS7A 1FPQA 2QBYB 2QBYA 1HKSA 5DYMA 4HV5A 1O3SA 2STWA 3ZMSA 3E6MA 2HTJA 5D5XB 4R1HA 1F9NA 1YTYA 1R5HA 1T39A 4I7HA 3I0TA 2VXZA 3QU6A 3HSEA 2QZ8A 2HDCA 3I54A 4CHUA 2RC4A 1FYKA 3QOPA 5LHIA 2FA5A 5L3GA 4BHCA 1DPUA 4U7DA 1KQ8A 2NYXA 3ZMDA 2ZFWA 4HQEA 3TO9A 3BZ6A 3MAJA 3MFKA 1T6SA 2IVMA 1CGPA 2V6CA 5DUKA 2M1BA 2QUFA 4HDVA 3BWGA 5FLXZ 4XLPF 1ZG1A 1HBXG 3ZP5A 2Y0MA 3HRSA 4Q47A 3KP5A 1ZLKA 3EQLF 2IA1A 2RQPA 2Y75A 4GGGA 2FBKA 1KYWA 2XAFA 2IA2A 5D4SA 5IT9K 1YYVA 2A3SA 2E7WA 5EEHA 2JRTA 3BPXA 1HSJA 4O5VA 3DKWA 4PDKA 1MJAA 4BAYA 2PBIA 4LMYA 4DQ2A 4UV9A 4R8HA 5LEJA 1REPC 1O57A 4R79A 5K5OA 2DU9A 1ZRCA 2DK8A 2L01A 4WXHA 3MWMA 1R00A 2PMUA 4ESBA 4XSXF 4EV0A 2A6EF 3HYIA 3HOSA 1OYYA 2OBPA 4EVIA 2E7XA 3DP7A 5FB2A 4M9ZA 2Q0OA 1J2XA 3VODA 4EM1A 1BI3A 3M8FA 1FWZA 3WE3A 4ENNA 1XMKA 2D1VA 5CYVA 2ZMEB 2XKOA 1I27A 5KVRA 3CTAA 1WKMA 3LSTA 5DV5A 3HRMA 1BC8C 3JAMK 1LEBA 5BQTA 3BPVA 2IA0A 5K1YA 1XSXA 5LHHA 2STTA 2XGXA 4K2EA 3ZN0A 1W7PD 3TGNA 1IRGA 1R7JA 1UB9A 3DQVC 3VB2A 1IN8A 4LLNA 2QQAA 3GUDA 4GXOA 2EWNA 2OU2A 3KP6A 1EH8A 5A2QK 1USTA 2EFOA 1USSA 3CO6C 5D5UB 1W5SA 4HLYA 1FZPB 3D0SA 2E1CA 3HSFA 4UVCA 2UWMA 1PP8F 1S6LA 1HQCA 4HAMA 4NHJA 2QVOA 2CFXA 1P4WA 1ZYRF 5J6XA 5BOXA 4CGZA 4CDGA 4HV6A 3WTZA 2FBHA 4YFKF 4YFNF 4Q4ZF 2O6GE 2M5WA 1R58A 4KT5C 3TQNA 1ZRDA 2OQRA 5JVTA 1XGNA 3GO5A 2RGVA 2GA1A 4U7BA 5E18F 2P6SA 5K5RA 2ESNA 5DDGA 1W5TA 3RKYA 4WXCA 3F6OA 3COAC 2JZYA 1NHAA 3LFKA 3TKYA 2PN6A 1K6OA 4BNCA 4JQFA 1D3YA 1O3RA 4U88A 1KU9A 3WG9A 5LRSA 1MD0A 4G6QA 2ZO4A 2PMHA 1V4RA 4G7OF 1DP7P 3RIRA 1A04A 5HS9A 3KZYA 2HYFA 1OYIA 2IPQX 3IRQA 1QNTA 2EFNA 5L3BA 1LVAA 1XGSA 3O6BB 2M30A 2K4BA 2XAGA 1I1GA 2BEOA 1U5TA 3ML6A 4KN7X 3ECHA 3E5QA 3I59A 4RS8A 3VOEA 4P9UA 2E1NA 1J7KA 1QGPA 3JTGA 1K78A 1WQ2A 1XDSA 5ICEA 1S8NA 2FMLA 2XROA 4IRHA 5L3DA 2QENA 5LGNA 2CWEA 1TQMA 1Q1HA 1ULYA 1DPRA 5AONA 4LB5A 4OMZA 2RVCA 1SFXA 4LK0F 3V7SA 5HS8A 1H0MA 1MGTA 4EJWA 4ESJA 2K02A 3ULQB 5EEGA 3ROUA 4WWCA 1F1ZA 3H3ZA 1G4DA 1KQ9A 2O0YA 1IW7F 3RKWA 2QQ9A 1YW9A 4IRGA 2LDUA 2K7LA 4BHPA 1XMAA 1G3TA 1D5VA 2JPCA 4I2OA 2P5LC 1P6RA 4YIIA 3ABUA 4Y17A 1QPMA 1B9NA 3J81Z 1BI0A 3SZPA 4OIRF 2MLGA 2LF8A 2P7VB 3BP8A 4L0ZB 2W25A 2DAOA 1OKRA 1I1SA 4MEYF 3EYYA 1ZG3A 1LNWA 1J59A 5ICGA 3DEUA 3WTXC 4ZYEA 3QP5A 1LB2A 4IVNA 3WTSC 1BIAA 4KDPA 2ETHA 1HSTA 4HQMA 2KKOA 2HOEA 5E1XA 1PP7U 1FBQA 2DQRA 1O7FA 1P2FA 3BOQA 2Q8KA 2A6HF 3ECOA 1PUEE 2GZWA 2ISZA 2P5VA 1KU3A 3GFJA 2EK5A 1KYZA 2PI0A 4FT8A 3E6DA 1FBSA 1TLHB 2IT0A 4GYGA 1XCVA 3TDZC 1ZG5A 1QZYA 4Q5SF 1GVJA 4YG2F 3QPHA 2RV8A 2NS0A 2O03A 1E2XA 3CUQB 1R5GA 3KCCA 4XLNF 3CUQA 2F2EA 2VC1A 1YW7A 3FMRA 2L4MA 2XIGA 2EV6A 2X4HA 3R0JA 3CDHA 3FX3A 2A5YB 5FD6A 1ZHFA 4HX8A 3GFLA 1EH7A 5L3FA 1RNLA 3JSPA 4O6JA 3Q5FA 1HKTA 2PJPA 2UXXA 3BROA 4FHTA 1IXRC 3JAMZ 2F5DA 3FF5A 3QPTA 4EJTA 4MGRA 5DUIA 2O3FA 3E5XA 4I02A 4L5IA 2A68F 2NRAC 3J7AO 2QYOA 5CVJA 1SD6A 4BH9A 1XGMA 3ZMTA 5E8IA 1TQIA 4RAYA 1I6XA 2AS5F 4KIFA 1XD7A 3FZVA 3F8FA 4LLLA 4G9YA 5A2QZ 2RN7A 4CYDA 1R1TA 4WXDA 4H0EA 6PAXA 3I64A 4TV7A 2FU4A 3MZHA 3WTTC 3MEXA 2PFBA 2XAJA 2XAQA 4OU0A 1XDUA 4PGGA 1Z7UA 2L3DA 1QBJA 2MD5A 2IP2A 2YX7A 4MEXF 3F8CA 3M7GA 1FT9A 1KA8A 2XV4S 2KJBA 4B09A 3NQOA 2W24A 4Z2YA 3R60A 2VN2A 1IUYA 1IF1A 2CQKA 2HZTA 2M8EA 3T8RA 4AIHA 1U78A 3H3UA 1MKMA 3KLOA 2F5FA 5J8CA 3B02A 1GHCA 5BMZA 5AIQA 3QAHA 3GZ6A 1H9GA 4RGRA 3HOTA 2A69F 1YS7A 1UCRA 1BN5A 2QLZA 3KLNA 4ON0A 3TDUC 4KUMA 3FWEA 3GZ5A 1OPCA 2HQRA 3ZPLA 1P4AA 3GEZA 2P8TA 4G8XA 4XRFA 2M45A 5LEKA 2ZNZA 3J80Z 1MJBA 2R7DA 2GXGA 1YG2A 2EFWA 1IAWA 3MZYA 1FOKA 1TW2A 1I5ZA 4KIGA 1XB4A 3B73A 2D45A 3WTYC 4L9VA 4QWQA 3P9IA 4EQQA 3IKTA 5F64A 4L0YB 4MHGA 2XAHA 2BV6A 4HX4A 2KIMA 3SZTA 4LLGF 2ZBKA 3F8MA 5H20A 1IN7A 5ILSA 4EGYA 1BOAA 2ZMEA 1WSUA 2VONA 2HFHA 2R3SA 2D2WA 1KU2A 1FSHA 4G7ZF 4PZJA 1ONVA 4IHSA 2DO7A 3U1DA 2NNNA 3KETA 5E1ZB 5FO5A 3NRVA 3K1PA 3WU1B 3KFWX 1VTNC 4A2UA 3F3XA 1V3FA 3PFIA 4ESFA 4HX7A 2DI3A 3OOPA 3PQKA 1SD7A 3EDPA 4I0BA 2CSOA 1SD5A 2YU3A 1F5TA 3HRUA 2PQ8A 4UVAA 3R4KA 4MQ9F 1S7AA 2GQQA 5CLSA 2VBWA 2W84A 2UXNA 3GXOA 2Z5UA 2P4WA 3V8JA 3KE2A 1OYWA 2O61A 4RB0A 4HF0A 2G7HA 2OA4A 2FSWA 2HEOA 2YPRA 1RZ4A 2V79A 5FFZA 2VE9A 1R1VA 1TW3A 4ZZLA 1Z91A 5DD4A 5FLXK 3FHZA 1TTYA 2FNPA 4ENKA 1LDJA 5CVUA 1BJAA 3DPLC 2FNAA 3RPQA 3C1DA 2J5PA 3RYRA 2H6CA 5D8LB 4G94A 3LWFA 1U2WA 4KICA 4RB2C 2BGCA 5LLQA 5AIPA 4AIJA 2DFIA 5LRRA 4PCQA 1IN5A 2BE5F 1FLIA 2QWWA 1DDNA 4KYWA 1L0OC 1R1UA 5L3CA 1JXSA 4M6XA 3T8TA 4S04A 3REOA 4A6DA 2Z33A 1F4KA 2J5OA 1L3LA 5E17F 3T5XA 3GFMA 3HUGA 2EA2A 2DBBA 1P4XA 1S3JA 3M1EA 1U6GA 3FMQA 1ZH5A 1YO5C 4UNOA 2MH2A 3BJ6A 3V8KA 3I71A 2V9VA 3V7CA 4YIFA 2LF7A 3SXYA 2NNYA 5HVQC 2IW5A 2H27A 3T0YA 4ETSA 4S05A 2DPUA 1XSDA 5FD5A 1AWCA 5HDKA 1MDMB 1J75A 1MDMA 3C3WA 3CLOA 2VBZA 4KNYA 3BY6A 4GCVA 2BBYA 1JE8A 2GAUA 4GYIA 3W6KB 4KMUX 2PG4A 2YSRA 2IJLA 3GLXA 2WC2A 5JHUA 3WGGA 4KMFA 5J8FA 1YLFA 2FMYA 2YX4A 5IT3A 2JTVA 1TNSA 1IXSB 5CVIA 3GWZA 5HLHA 3QRFF 1SAXA 4HDUA 2HKOA 4EGZA 1O3QA 1R23A 5JI6A 4P55A 1KGSA 3RPUA 4L9NA 3I4PA 2XKPA 1Z6RA 3F72A 4LG0B 2OZUA 2MA3A 1ZARA 5DEQA 4LG0A 1R22A 2CW0F 2NAZA 2L02A 4A6EA 1WI9A 4IF4A 5LGTA 2MC3A 2OZ6A 1YS6A 2BYVE 3GFIA 4CZZA 3RI4A 1G6NA 2JSCA 1QQIA 4FX0A 4AVPA 4HZFA 1TBXA 3CJNA 1T98A 3F22A 1SD4A 2GWRA 4CXFA 1JHHA 1BC7C 3RTRA 3PQJA 1ZGAA 4CICA 4L9JA 4IHTA 5IT9Z 2UZKA 2FF4A 4OIOF 3HTSB 2DLLA 3LAJA 5E8GA 3ZMVA 4M9SA 3TOBA 4MTEA 3JTHA 3F8NA 4M6YA 5HLIA 1BBYA 2FQ3A 4ZH4F 3KZZA 3WTVC 2RKHA 2KRFA 4IPAA 2EB7A 4Q48A 3ZQ7A 3KP4A 3T1BA 3F23A 3K1NA 3EETA 4I09A 3LA2A 1YW8A 2C6YA 1HKQA 3SHFA 5E20A 1SMYF 3K2ZA 4UVBA 1S7OA 4RB3C 3IL2A 4RGXA 2K86A 4U0YA 3I5UA 2FBIA 4LFUA 5BPDA 1RIOH 5ICFA 1ZGJA 4IJAA 1XCBA 2ESHA 3RDIA 2ZNYA 4GO1A 2W85A 2RNJA 3V8LA 3WODF 1MZBA 1HW2A 3Q9VA 3E6CC 3R6SA 4M71A 4AIKA 4UXNA 2P7CB 3WE2A 5HLGA 5L3EA 1T38A 4UUVA 2QQBA 3JSOA 3AAFA 2XASA 1P92A 3RKXA 2JT1A 3ABTA 4BXUA 3DV8A 4F7ZA 2DT5A 1FX7A 4EMSA 3L09A 2GIVA 3MQ0A 1U5TC 3S2WA 3N4MA 1X3UA 1Z1DA 4U0VA 5D5VB 1FP1D 4ZYDA 3Q9SA 3MCZA 4EJVA 2F5CA 3SFZA 3U2RA 1ZAOA 3GYHX 3IHUA 1BI2A 3M8EA 3I53A 3GX4X 1IRFA 2DK5A 3J81K 1FYLA 5LGUA 2ADUA 3U9GA 3V7RA 1EH6A 2HGCA 3VEPA 4WX9A 4HW0A 1ZRFA 3GW2A 1LEAA 4B8XA 2Q2EA 3K1MA 4O3MA 3DPTA 3CUOA 4I0AA 1FP2A 1GXQA 5KK1A 2DQLA 4HF1A 3R0AA 3GF2A 4HLXA 1TNTA 4LB6B 4ENJA 3EUHA 1B9MA 1ZN2A 2MLKA 4Y15A 3WTWC 4A5MA 1AOYA 2H6BA 2ACJA 3ZN1A 1GXPA 3SQNA 2KIFA 4WF2A 1RI7A 3W6JB 1U8RA 3E3VA 4HYEA 2AXLA 2VC0A 2VODA 2DTRA 1STZA 5FFXA 3E97A 2Y48A 2CYYA 2X0LA 4MTDA 1BM9A 5CJ9A 1XN7A 2PLYA 3IRRA 2G9WA 3WGIA 4KIBA 1WWXA 1D8JA 4L5JA 2FRHA 4WK8F 1KQ0A 3FMSA 1FSEA 1ODDA 2EV0A 3KP3A 4LJZF 3KEOA 1FC3A 4N9IA 5F6FA 1HW5A 3ISPA 1OMIA 3FXRA 4XBFA 2RDPA 2VBXA 3QP6A 3HSRA 5CVRA 4A0YA 5DCMB 5DCMA 2GXBA 3K9TA 5D8KB 3ZMUA 5LBQA 1U3EM 4L18B 4YFXF 1UHWA 1WRJA 3JW4A 2EFQA 2EFPA 4JBAA 1T0FA 2HS5A 3D5LA 4WCGA 2CG4A 3RJPA 5HDGA 4OOIA 2XRNA 1K7AA 3CUQC 2ZJ2A 3HIFA 1Z05A 2ZKZA 1EV7A 4U0WA 4P9FA 3P9CA 3I58A 3FXUA 2FEZA 3H92A 4RGUA 1Y0UA 3G73A 1J0RA 2GA2A 3IKVA 5DD8A 2KJCA 4IXAA 2D1HA 3R61A 5BPIA 3L9FA 4UHTA 4RB1A 3E6BA 4EM2A 1OR7A 4LK1F 1O3TA 4XSZF 1JHFA 3TO7A 3FXQA 1T2KA 4OMYA 4MNUA 1G3WA 3TOAA 1IN6A 2CO5A 1XSVA 2VBYA 2MH9A 4AD9A 4I01A 4KA4A 4DNCA 5D5WB 2HWVA 3ELKA 4LGWA 3K0LA 1HXDA 4KFCA 1ON1A 2K27A 2FOKA 3BJAA 3LAPA 5F1RA 2VE8A 4EJUA 1LJ9A 3N97A 4BQAA 4KN4X 4RGSA 3L00A 5H6RA 1Z6TA 3M9AA 3KP2A 2KIUA 3K69A 2OD5A 1UFMA 2MBFA 3J80K 1SFUA 1FNNA 2DW4A 4ZYHA 4LD5A 2HTSA 4ENMA 1J5YA 5ICCA 3BDDA 2XHKA 1IXCA 2G7UA 2ELHA 2EA4A 2FE3A 2PEXA 1FYMA 3F8BA 2K4JA 3HTUA 4PGHA 3WTUC 2CGPA 2QM3A 1O7LA 4IRIA 1E17A 2W57A 3FM5A 2B0LA 1PDNC 4I98B 3G3ZA 1B1BA 2LNBA 4EJOA 5FGMA 3F6VA 2ISYA 5ILVA 2H94A 1U5TB 1YQAA 2WTEA 5ED4A 2XVCA 5DCFA 1Z9CA 3I59B 3LA7A 4G6DA 2V1XA 2VT3A 4M9XA 1D8KA 2F5EA 1FY7A 5HDNA 4G7HF 2LSOA 3P7NA 1IN4A 4FX4A 1K78B 3KP7A 5D4RA 3L2CA 1C0WA 3DF8A 4BYYA 1RUOA 2HYGD 2OQGA 1FBUA 1XGOA 4QLCU 1H9TA 3RYPA 2O8XA 4P5OA 4ZZDA 1HW1A 1SMTA 3IWZA 4HA8A 2Z99A 3LQQA 1DUXC 2L54A 3NEUA 1B6AA 4M74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QU3 A;  2A07 F;  5H6Q A;  1CF7 B;  2TDX A;  5TJJ A;  1CF7 A;  2OAZ A;  2XUB A;  4N9H A;  3C7J A;  2WV0 A;  3BJO A;  1G3Y A;  4ZYG A;  5D6F A;  3DXJ F;  1LDD A;  3F21 A;  2L4A A;  3GVA A;  3ZMZ A;  4MQV A;  4D0P A;  4OIP F;  5LHG A;  1S29 A;  3WGH A;  1RUN A;  4L9T A;  4E70 A;  5ILU A;  1B4A A;  5HOO A;  2H09 A;  3CO7 C;  3HHH A;  1YIO A;  2DPD A;  1KU7 A;  4RAZ A;  4HF2 A;  1ON2 A;  4NB5 A;  1BI1 A;  2P5K A;  4OIN F;  2M87 A;  4N0B A;  4A12 A;  5ERI A;  4HOB A;  4A0X A;  3FM3 A;  3TO6 A;  3KEQ A;  4M73 A;  2ZCW A;  1B59 A;  2IRF G;  2VT2 A;  2HKX A;  2WWY A;  1TQP A;  2HQN A;  2V1D A;  1SFE A;  1LQ1 A;  4AWX B;  4OIQ F;  2HR3 A;  4CO8 A;  4JK1 X;  1QO0 D;  3C18 A;  4BHB A;  5CVV A;  5TRD A;  1JGS A;  3WU0 A;  4UV8 A;  1IZ1 A;  4ASN A;  4EM0 B;  1G3S A;  3E5U A;  4Y13 A;  3OV8 A;  4A0Z A;  2Z3Y A;  2YR2 A;  5JFR A;  2LKP A;  3DFG A;  5JR3 A;  1BIB A;  2P6T A;  3IWF A;  1K79 A;  1W7P B;  2R7F A;  3P9K A;  1W7P A;  1R36 A;  3LQR A;  5E1W A;  4NQW A;  2V1U A;  3EYI A;  3LA3 A;  1QZZ A;  1J9I A;  2VOO A;  1LDK B;  2COM A;  4P96 A;  3O2P E;  5D6E A;  5K5Q A;  1ZRE A;  2FXA A;  2ZXJ A;  2JPB A;  2Z9O A;  1ZLJ A;  4HBL A;  4A5N A;  2EJR A;  2EV5 A;  2A61 A;  4M72 A;  3IC7 A;  3VFZ A;  3V4G A;  3ERE D;  3HHG A;  1YFH A;  3L7W A;  2VOP A;  3O3K A;  5BS6 A;  1W4M A;  1MJ9 A;  1UHM A;  3HRT A;  5HS7 A;  1FPQ A;  2QBY B;  2QBY A;  1HKS A;  5DYM A;  4HV5 A;  1O3S A;  2STW A;  3ZMS A;  3E6M A;  2HTJ A;  5D5X B;  4R1H A;  1F9N A;  1YTY A;  1R5H A;  1T39 A;  4I7H A;  3I0T A;  2VXZ A;  3QU6 A;  3HSE A;  2QZ8 A;  2HDC A;  3I54 A;  4CHU A;  2RC4 A;  1FYK A;  3QOP A;  5LHI A;  2FA5 A;  5L3G A;  4BHC A;  1DPU A;  4U7D A;  1KQ8 A;  2NYX A;  3ZMD A;  2ZFW A;  4HQE A;  3TO9 A;  3BZ6 A;  3MAJ A;  3MFK A;  1T6S A;  2IVM A;  1CGP A;  2V6C A;  5DUK A;  2M1B A;  2QUF A;  4HDV A;  3BWG A;  5FLX Z;  4XLP F;  1ZG1 A;  1HBX G;  3ZP5 A;  2Y0M A;  3HRS A;  4Q47 A;  3KP5 A;  1ZLK A;  3EQL F;  2IA1 A;  2RQP A;  2Y75 A;  4GGG A;  2FBK A;  1KYW A;  2XAF A;  2IA2 A;  5D4S A;  5IT9 K;  1YYV A;  2A3S A;  2E7W A;  5EEH A;  2JRT A;  3BPX A;  1HSJ A;  4O5V A;  3DKW A;  4PDK A;  1MJA A;  4BAY A;  2PBI A;  4LMY A;  4DQ2 A;  4UV9 A;  4R8H A;  5LEJ A;  1REP C;  1O57 A;  4R79 A;  5K5O A;  2DU9 A;  1ZRC A;  2DK8 A;  2L01 A;  4WXH A;  3MWM A;  1R00 A;  2PMU A;  4ESB A;  4XSX F;  4EV0 A;  2A6E F;  3HYI A;  3HOS A;  1OYY A;  2OBP A;  4EVI A;  2E7X A;  3DP7 A;  5FB2 A;  4M9Z A;  2Q0O A;  1J2X A;  3VOD A;  4EM1 A;  1BI3 A;  3M8F A;  1FWZ A;  3WE3 A;  4ENN A;  1XMK A;  2D1V A;  5CYV A;  2ZME B;  2XKO A;  1I27 A;  5KVR A;  3CTA A;  1WKM A;  3LST A;  5DV5 A;  3HRM A;  1BC8 C;  3JAM K;  1LEB A;  5BQT A;  3BPV A;  2IA0 A;  5K1Y A;  1XSX A;  5LHH A;  2STT A;  2XGX A;  4K2E A;  3ZN0 A;  1W7P D;  3TGN A;  1IRG A;  1R7J A;  1UB9 A;  3DQV C;  3VB2 A;  1IN8 A;  4LLN A;  2QQA A;  3GUD A;  4GXO A;  2EWN A;  2OU2 A;  3KP6 A;  1EH8 A;  5A2Q K;  1UST A;  2EFO A;  1USS A;  3CO6 C;  5D5U B;  1W5S A;  4HLY A;  1FZP B;  3D0S A;  2E1C A;  3HSF A;  4UVC A;  2UWM A;  1PP8 F;  1S6L A;  1HQC A;  4HAM A;  4NHJ A;  2QVO A;  2CFX A;  1P4W A;  1ZYR F;  5J6X A;  5BOX A;  4CGZ A;  4CDG A;  4HV6 A;  3WTZ A;  2FBH A;  4YFK F;  4YFN F;  4Q4Z F;  2O6G E;  2M5W A;  1R58 A;  4KT5 C;  3TQN A;  1ZRD A;  2OQR A;  5JVT A;  1XGN A;  3GO5 A;  2RGV A;  2GA1 A;  4U7B A;  5E18 F;  2P6S A;  5K5R A;  2ESN A;  5DDG A;  1W5T A;  3RKY A;  4WXC A;  3F6O A;  3COA C;  2JZY A;  1NHA A;  3LFK A;  3TKY A;  2PN6 A;  1K6O A;  4BNC A;  4JQF A;  1D3Y A;  1O3R A;  4U88 A;  1KU9 A;  3WG9 A;  5LRS A;  1MD0 A;  4G6Q A;  2ZO4 A;  2PMH A;  1V4R A;  4G7O F;  1DP7 P;  3RIR A;  1A04 A;  5HS9 A;  3KZY A;  2HYF A;  1OYI A;  2IPQ X;  3IRQ A;  1QNT A;  2EFN A;  5L3B A;  1LVA A;  1XGS A;  3O6B B;  2M30 A;  2K4B A;  2XAG A;  1I1G A;  2BEO A;  1U5T A;  3ML6 A;  4KN7 X;  3ECH A;  3E5Q A;  3I59 A;  4RS8 A;  3VOE A;  4P9U A;  2E1N A;  1J7K A;  1QGP A;  3JTG A;  1K78 A;  1WQ2 A;  1XDS A;  5ICE A;  1S8N A;  2FML A;  2XRO A;  4IRH A;  5L3D A;  2QEN A;  5LGN A;  2CWE A;  1TQM A;  1Q1H A;  1ULY A;  1DPR A;  5AON A;  4LB5 A;  4OMZ A;  2RVC A;  1SFX A;  4LK0 F;  3V7S A;  5HS8 A;  1H0M A;  1MGT A;  4EJW A;  4ESJ A;  2K02 A;  3ULQ B;  5EEG A;  3ROU A;  4WWC A;  1F1Z A;  3H3Z A;  1G4D A;  1KQ9 A;  2O0Y A;  1IW7 F;  3RKW A;  2QQ9 A;  1YW9 A;  4IRG A;  2LDU A;  2K7L A;  4BHP A;  1XMA A;  1G3T A;  1D5V A;  2JPC A;  4I2O A;  2P5L C;  1P6R A;  4YII A;  3ABU A;  4Y17 A;  1QPM A;  1B9N A;  3J81 Z;  1BI0 A;  3SZP A;  4OIR F;  2MLG A;  2LF8 A;  2P7V B;  3BP8 A;  4L0Z B;  2W25 A;  2DAO A;  1OKR A;  1I1S A;  4MEY F;  3EYY A;  1ZG3 A;  1LNW A;  1J59 A;  5ICG A;  3DEU A;  3WTX C;  4ZYE A;  3QP5 A;  1LB2 A;  4IVN A;  3WTS C;  1BIA A;  4KDP A;  2ETH A;  1HST A;  4HQM A;  2KKO A;  2HOE A;  5E1X A;  1PP7 U;  1FBQ A;  2DQR A;  1O7F A;  1P2F A;  3BOQ A;  2Q8K A;  2A6H F;  3ECO A;  1PUE E;  2GZW A;  2ISZ A;  2P5V A;  1KU3 A;  3GFJ A;  2EK5 A;  1KYZ A;  2PI0 A;  4FT8 A;  3E6D A;  1FBS A;  1TLH B;  2IT0 A;  4GYG A;  1XCV A;  3TDZ C;  1ZG5 A;  1QZY A;  4Q5S F;  1GVJ A;  4YG2 F;  3QPH A;  2RV8 A;  2NS0 A;  2O03 A;  1E2X A;  3CUQ B;  1R5G A;  3KCC A;  4XLN F;  3CUQ A;  2F2E A;  2VC1 A;  1YW7 A;  3FMR A;  2L4M A;  2XIG A;  2EV6 A;  2X4H A;  3R0J A;  3CDH A;  3FX3 A;  2A5Y B;  5FD6 A;  1ZHF A;  4HX8 A;  3GFL A;  1EH7 A;  5L3F A;  1RNL A;  3JSP A;  4O6J A;  3Q5F A;  1HKT A;  2PJP A;  2UXX A;  3BRO A;  4FHT A;  1IXR C;  3JAM Z;  2F5D A;  3FF5 A;  3QPT A;  4EJT A;  4MGR A;  5DUI A;  2O3F A;  3E5X A;  4I02 A;  4L5I A;  2A68 F;  2NRA C;  3J7A O;  2QYO A;  5CVJ A;  1SD6 A;  4BH9 A;  1XGM A;  3ZMT A;  5E8I A;  1TQI A;  4RAY A;  1I6X A;  2AS5 F;  4KIF A;  1XD7 A;  3FZV A;  3F8F A;  4LLL A;  4G9Y A;  5A2Q Z;  2RN7 A;  4CYD A;  1R1T A;  4WXD A;  4H0E A;  6PAX A;  3I64 A;  4TV7 A;  2FU4 A;  3MZH A;  3WTT C;  3MEX A;  2PFB A;  2XAJ A;  2XAQ A;  4OU0 A;  1XDU A;  4PGG A;  1Z7U A;  2L3D A;  1QBJ A;  2MD5 A;  2IP2 A;  2YX7 A;  4MEX F;  3F8C A;  3M7G A;  1FT9 A;  1KA8 A;  2XV4 S;  2KJB A;  4B09 A;  3NQO A;  2W24 A;  4Z2Y A;  3R60 A;  2VN2 A;  1IUY A;  1IF1 A;  2CQK A;  2HZT A;  2M8E A;  3T8R A;  4AIH A;  1U78 A;  3H3U A;  1MKM A;  3KLO A;  2F5F A;  5J8C A;  3B02 A;  1GHC A;  5BMZ A;  5AIQ A;  3QAH A;  3GZ6 A;  1H9G A;  4RGR A;  3HOT A;  2A69 F;  1YS7 A;  1UCR A;  1BN5 A;  2QLZ A;  3KLN A;  4ON0 A;  3TDU C;  4KUM A;  3FWE A;  3GZ5 A;  1OPC A;  2HQR A;  3ZPL A;  1P4A A;  3GEZ A;  2P8T A;  4G8X A;  4XRF A;  2M45 A;  5LEK A;  2ZNZ A;  3J80 Z;  1MJB A;  2R7D A;  2GXG A;  1YG2 A;  2EFW A;  1IAW A;  3MZY A;  1FOK A;  1TW2 A;  1I5Z A;  4KIG A;  1XB4 A;  3B73 A;  2D45 A;  3WTY C;  4L9V A;  4QWQ A;  3P9I A;  4EQQ A;  3IKT A;  5F64 A;  4L0Y B;  4MHG A;  2XAH A;  2BV6 A;  4HX4 A;  2KIM A;  3SZT A;  4LLG F;  2ZBK A;  3F8M A;  5H20 A;  1IN7 A;  5ILS A;  4EGY A;  1BOA A;  2ZME A;  1WSU A;  2VON A;  2HFH A;  2R3S A;  2D2W A;  1KU2 A;  1FSH A;  4G7Z F;  4PZJ A;  1ONV A;  4IHS A;  2DO7 A;  3U1D A;  2NNN A;  3KET A;  5E1Z B;  5FO5 A;  3NRV A;  3K1P A;  3WU1 B;  3KFW X;  1VTN C;  4A2U A;  3F3X A;  1V3F A;  3PFI A;  4ESF A;  4HX7 A;  2DI3 A;  3OOP A;  3PQK A;  1SD7 A;  3EDP A;  4I0B A;  2CSO A;  1SD5 A;  2YU3 A;  1F5T A;  3HRU A;  2PQ8 A;  4UVA A;  3R4K A;  4MQ9 F;  1S7A A;  2GQQ A;  5CLS A;  2VBW A;  2W84 A;  2UXN A;  3GXO A;  2Z5U A;  2P4W A;  3V8J A;  3KE2 A;  1OYW A;  2O61 A;  4RB0 A;  4HF0 A;  2G7H A;  2OA4 A;  2FSW A;  2HEO A;  2YPR A;  1RZ4 A;  2V79 A;  5FFZ A;  2VE9 A;  1R1V A;  1TW3 A;  4ZZL A;  1Z91 A;  5DD4 A;  5FLX K;  3FHZ A;  1TTY A;  2FNP A;  4ENK A;  1LDJ A;  5CVU A;  1BJA A;  3DPL C;  2FNA A;  3RPQ A;  3C1D A;  2J5P A;  3RYR A;  2H6C A;  5D8L B;  4G94 A;  3LWF A;  1U2W A;  4KIC A;  4RB2 C;  2BGC A;  5LLQ A;  5AIP A;  4AIJ A;  2DFI A;  5LRR A;  4PCQ A;  1IN5 A;  2BE5 F;  1FLI A;  2QWW A;  1DDN A;  4KYW A;  1L0O C;  1R1U A;  5L3C A;  1JXS A;  4M6X A;  3T8T A;  4S04 A;  3REO A;  4A6D A;  2Z33 A;  1F4K A;  2J5O A;  1L3L A;  5E17 F;  3T5X A;  3GFM A;  3HUG A;  2EA2 A;  2DBB A;  1P4X A;  1S3J A;  3M1E A;  1U6G A;  3FMQ A;  1ZH5 A;  1YO5 C;  4UNO A;  2MH2 A;  3BJ6 A;  3V8K A;  3I71 A;  2V9V A;  3V7C A;  4YIF A;  2LF7 A;  3SXY A;  2NNY A;  5HVQ C;  2IW5 A;  2H27 A;  3T0Y A;  4ETS A;  4S05 A;  2DPU A;  1XSD A;  5FD5 A;  1AWC A;  5HDK A;  1MDM B;  1J75 A;  1MDM A;  3C3W A;  3CLO A;  2VBZ A;  4KNY A;  3BY6 A;  4GCV A;  2BBY A;  1JE8 A;  2GAU A;  4GYI A;  3W6K B;  4KMU X;  2PG4 A;  2YSR A;  2IJL A;  3GLX A;  2WC2 A;  5JHU A;  3WGG A;  4KMF A;  5J8F A;  1YLF A;  2FMY A;  2YX4 A;  5IT3 A;  2JTV A;  1TNS A;  1IXS B;  5CVI A;  3GWZ A;  5HLH A;  3QRF F;  1SAX A;  4HDU A;  2HKO A;  4EGZ A;  1O3Q A;  1R23 A;  5JI6 A;  4P55 A;  1KGS A;  3RPU A;  4L9N A;  3I4P A;  2XKP A;  1Z6R A;  3F72 A;  4LG0 B;  2OZU A;  2MA3 A;  1ZAR A;  5DEQ A;  4LG0 A;  1R22 A;  2CW0 F;  2NAZ A;  2L02 A;  4A6E A;  1WI9 A;  4IF4 A;  5LGT A;  2MC3 A;  2OZ6 A;  1YS6 A;  2BYV E;  3GFI A;  4CZZ A;  3RI4 A;  1G6N A;  2JSC A;  1QQI A;  4FX0 A;  4AVP A;  4HZF A;  1TBX A;  3CJN A;  1T98 A;  3F22 A;  1SD4 A;  2GWR A;  4CXF A;  1JHH A;  1BC7 C;  3RTR A;  3PQJ A;  1ZGA A;  4CIC A;  4L9J A;  4IHT A;  5IT9 Z;  2UZK A;  2FF4 A;  4OIO F;  3HTS B;  2DLL A;  3LAJ A;  5E8G A;  3ZMV A;  4M9S A;  3TOB A;  4MTE A;  3JTH A;  3F8N A;  4M6Y A;  5HLI A;  1BBY A;  2FQ3 A;  4ZH4 F;  3KZZ A;  3WTV C;  2RKH A;  2KRF A;  4IPA A;  2EB7 A;  4Q48 A;  3ZQ7 A;  3KP4 A;  3T1B A;  3F23 A;  3K1N A;  3EET A;  4I09 A;  3LA2 A;  1YW8 A;  2C6Y A;  1HKQ A;  3SHF A;  5E20 A;  1SMY F;  3K2Z A;  4UVB A;  1S7O A;  4RB3 C;  3IL2 A;  4RGX A;  2K86 A;  4U0Y A;  3I5U A;  2FBI A;  4LFU A;  5BPD A;  1RIO H;  5ICF A;  1ZGJ A;  4IJA A;  1XCB A;  2ESH A;  3RDI A;  2ZNY A;  4GO1 A;  2W85 A;  2RNJ A;  3V8L A;  3WOD F;  1MZB A;  1HW2 A;  3Q9V A;  3E6C C;  3R6S A;  4M71 A;  4AIK A;  4UXN A;  2P7C B;  3WE2 A;  5HLG A;  5L3E A;  1T38 A;  4UUV A;  2QQB A;  3JSO A;  3AAF A;  2XAS A;  1P92 A;  3RKX A;  2JT1 A;  3ABT A;  4BXU A;  3DV8 A;  4F7Z A;  2DT5 A;  1FX7 A;  4EMS A;  3L09 A;  2GIV A;  3MQ0 A;  1U5T C;  3S2W A;  3N4M A;  1X3U A;  1Z1D A;  4U0V A;  5D5V B;  1FP1 D;  4ZYD A;  3Q9S A;  3MCZ A;  4EJV A;  2F5C A;  3SFZ A;  3U2R A;  1ZAO A;  3GYH X;  3IHU A;  1BI2 A;  3M8E A;  3I53 A;  3GX4 X;  1IRF A;  2DK5 A;  3J81 K;  1FYL A;  5LGU A;  2ADU A;  3U9G A;  3V7R A;  1EH6 A;  2HGC A;  3VEP A;  4WX9 A;  4HW0 A;  1ZRF A;  3GW2 A;  1LEA A;  4B8X A;  2Q2E A;  3K1M A;  4O3M A;  3DPT A;  3CUO A;  4I0A A;  1FP2 A;  1GXQ A;  5KK1 A;  2DQL A;  4HF1 A;  3R0A A;  3GF2 A;  4HLX A;  1TNT A;  4LB6 B;  4ENJ A;  3EUH A;  1B9M A;  1ZN2 A;  2MLK A;  4Y15 A;  3WTW C;  4A5M A;  1AOY A;  2H6B A;  2ACJ A;  3ZN1 A;  1GXP A;  3SQN A;  2KIF A;  4WF2 A;  1RI7 A;  3W6J B;  1U8R A;  3E3V A;  4HYE A;  2AXL A;  2VC0 A;  2VOD A;  2DTR A;  1STZ A;  5FFX A;  3E97 A;  2Y48 A;  2CYY A;  2X0L A;  4MTD A;  1BM9 A;  5CJ9 A;  1XN7 A;  2PLY A;  3IRR A;  2G9W A;  3WGI A;  4KIB A;  1WWX A;  1D8J A;  4L5J A;  2FRH A;  4WK8 F;  1KQ0 A;  3FMS A;  1FSE A;  1ODD A;  2EV0 A;  3KP3 A;  4LJZ F;  3KEO A;  1FC3 A;  4N9I A;  5F6F A;  1HW5 A;  3ISP A;  1OMI A;  3FXR A;  4XBF A;  2RDP A;  2VBX A;  3QP6 A;  3HSR A;  5CVR A;  4A0Y A;  5DCM B;  5DCM A;  2GXB A;  3K9T A;  5D8K B;  3ZMU A;  5LBQ A;  1U3E M;  4L18 B;  4YFX F;  1UHW A;  1WRJ A;  3JW4 A;  2EFQ A;  2EFP A;  4JBA A;  1T0F A;  2HS5 A;  3D5L A;  4WCG A;  2CG4 A;  3RJP A;  5HDG A;  4OOI A;  2XRN A;  1K7A A;  3CUQ C;  2ZJ2 A;  3HIF A;  1Z05 A;  2ZKZ A;  1EV7 A;  4U0W A;  4P9F A;  3P9C A;  3I58 A;  3FXU A;  2FEZ A;  3H92 A;  4RGU A;  1Y0U A;  3G73 A;  1J0R A;  2GA2 A;  3IKV A;  5DD8 A;  2KJC A;  4IXA A;  2D1H A;  3R61 A;  5BPI A;  3L9F A;  4UHT A;  4RB1 A;  3E6B A;  4EM2 A;  1OR7 A;  4LK1 F;  1O3T A;  4XSZ F;  1JHF A;  3TO7 A;  3FXQ A;  1T2K A;  4OMY A;  4MNU A;  1G3W A;  3TOA A;  1IN6 A;  2CO5 A;  1XSV A;  2VBY A;  2MH9 A;  4AD9 A;  4I01 A;  4KA4 A;  4DNC A;  5D5W B;  2HWV A;  3ELK A;  4LGW A;  3K0L A;  1HXD A;  4KFC A;  1ON1 A;  2K27 A;  2FOK A;  3BJA A;  3LAP A;  5F1R A;  2VE8 A;  4EJU A;  1LJ9 A;  3N97 A;  4BQA A;  4KN4 X;  4RGS A;  3L00 A;  5H6R A;  1Z6T A;  3M9A A;  3KP2 A;  2KIU A;  3K69 A;  2OD5 A;  1UFM A;  2MBF A;  3J80 K;  1SFU A;  1FNN A;  2DW4 A;  4ZYH A;  4LD5 A;  2HTS A;  4ENM A;  1J5Y A;  5ICC A;  3BDD A;  2XHK A;  1IXC A;  2G7U A;  2ELH A;  2EA4 A;  2FE3 A;  2PEX A;  1FYM A;  3F8B A;  2K4J A;  3HTU A;  4PGH A;  3WTU C;  2CGP A;  2QM3 A;  1O7L A;  4IRI A;  1E17 A;  2W57 A;  3FM5 A;  2B0L A;  1PDN C;  4I98 B;  3G3Z A;  1B1B A;  2LNB A;  4EJO A;  5FGM A;  3F6V A;  2ISY A;  5ILV A;  2H94 A;  1U5T B;  1YQA A;  2WTE A;  5ED4 A;  2XVC A;  5DCF A;  1Z9C A;  3I59 B;  3LA7 A;  4G6D A;  2V1X A;  2VT3 A;  4M9X A;  1D8K A;  2F5E A;  1FY7 A;  5HDN A;  4G7H F;  2LSO A;  3P7N A;  1IN4 A;  4FX4 A;  1K78 B;  3KP7 A;  5D4R A;  3L2C A;  1C0W A;  3DF8 A;  4BYY A;  1RUO A;  2HYG D;  2OQG A;  1FBU A;  1XGO A;  4QLC U;  1H9T A;  3RYP A;  2O8X A;  4P5O A;  4ZZD A;  1HW1 A;  1SMT A;  3IWZ A;  4HA8 A;  2Z99 A;  3LQQ A;  1DUX C;  2L54 A;  3NEU A;  1B6A A;  4M74 A; 
#chains in the Genus database with same CATH topology
 4DIQ A;  3QU3 A;  3LSP A;  2ZME C;  4LIV A;  5H6Q A;  1ORK A;  1CF7 B;  2A07 F;  2DFE A;  2TDX A;  5TJJ A;  1CF7 A;  2OAZ A;  2XUB A;  5J40 A;  2KDO A;  2KIS A;  4LIU A;  1XG1 A;  2ZFU A;  3QPS A;  5TGT A;  3FBN B;  3C7J A;  3HM5 A;  2WV0 A;  3BJO A;  4N9H A;  2L7K A;  5GAG J;  1G3Y A;  4ZYG A;  5D6F A;  3DXJ F;  1LDD A;  4UUT A;  3TP3 A;  2B63 J;  3F21 A;  1I50 J;  4IOA F;  2L4A A;  1WJB A;  3Q0U A;  3GVA A;  3ZMZ A;  4MQV A;  4ZC3 A;  4D0P A;  4OIP F;  5LHG A;  1S29 A;  3WGH A;  1RUN A;  4L9T A;  2CH0 A;  4E70 A;  5ILU A;  1QVU A;  2VL8 A;  1B4A A;  1J09 A;  5HOO A;  2H09 A;  3CO7 C;  2VXD A;  2BY2 A;  3HHH A;  1YIO A;  2DPD A;  1KU7 A;  4RAZ A;  3BQZ A;  4IOC F;  4Y3O A;  4DW6 A;  1SVM A;  2I10 A;  4NUB A;  4HF2 A;  1ON2 A;  1JT6 A;  2Q1Z B;  4NB5 A;  3OYG A;  3MN2 A;  1BI1 A;  3OIP A;  2P5K A;  4OIN F;  2M87 A;  4N0B A;  3PIP F;  4A12 A;  5ERI A;  2XPU A;  4I6Z A;  4XRS G;  1I39 A;  4HOB A;  2CQ7 A;  4A0X A;  3FM3 A;  3TO6 A;  3OSF A;  1Y6I A;  2LP0 A;  3CCV I;  1E3O C;  1LE8 B;  3H9J A;  3KEQ A;  1IG7 A;  4M73 A;  1U9O A;  2ZCW A;  4CCO A;  3JRE A;  1B59 A;  2IRF G;  2VT2 A;  2HKX A;  2WWY A;  2E60 A;  1TQP A;  2HQN A;  1UG2 A;  4GFB A;  2V1D A;  2M7B A;  1SFE A;  1OCC H;  4AWX B;  1LQ1 A;  4OIQ F;  2HR3 A;  4CO8 A;  1QZE A;  4RM3 A;  4JK1 X;  1Z67 A;  1QO0 D;  4CCL A;  3C18 A;  4BHB A;  3QOD A;  5K7F A;  5CVV A;  4A93 J;  5TRD A;  4W97 A;  1I6H J;  1JGS A;  3WU0 A;  4UV8 A;  1IZ1 A;  4ASN A;  1V5G A;  4EM0 B;  1RR7 A;  1G3S A;  1E3P A;  3E5U A;  2AO9 A;  4Y13 A;  3OV8 A;  3ZXS A;  4A0Z A;  1X2N A;  2Z3Y A;  2QF7 A;  2YR2 A;  5JFR A;  3HXL A;  4CSW A;  2LY1 A;  3BG7 A;  1S9H A;  2LKP A;  3DFG A;  5JR3 A;  2IS1 A;  1BIB A;  2P6T A;  3IWF A;  3IH4 A;  1R9T J;  2VJ5 A;  1K79 A;  1TP4 A;  1W7P B;  2R7F A;  3P9K A;  1W7P A;  1N78 A;  1R36 A;  3E7L A;  3LQR A;  5E1W A;  4NQW A;  2V1U A;  3AL0 C;  1Z3X A;  3EYI A;  3OYF A;  3LA3 A;  1QZZ A;  4ZYA A;  2VOO A;  1J9I A;  5KAF C;  3K4L A;  1LDK B;  3CC7 I;  3G1O A;  2COM A;  3BR2 A;  4P96 A;  2R0Q C;  3O2P E;  5D6E A;  2DMQ A;  5K5Q A;  2VKD A;  2LD5 A;  1R71 A;  1ZRE A;  2FXA A;  2ZXJ A;  2JPB A;  2ZJR F;  2XB5 A;  2Z9O A;  3OWT A;  1ZLJ A;  1X2M A;  4CCM A;  4HBL A;  2DJI A;  4A5N A;  2EJR A;  2EV5 A;  2ZXI A;  2A61 A;  1HCR A;  4M72 A;  2CU7 A;  3IC7 A;  2JK3 A;  4PK4 A;  5J1R A;  2Y0S N;  4AVZ A;  2MYS A;  1VQ5 I;  2K3P A;  3VFZ A;  3V4G A;  3ERE D;  3HHG A;  4M3B A;  1RR8 C;  1YFH A;  4IHW A;  3L7W A;  3OYH A;  4D5C A;  4F3Q A;  3J7Z I;  2E2I J;  1P9Q C;  2CQQ A;  4J00 A;  2VOP A;  5J1Y A;  3O3K A;  5BS6 A;  2XGE A;  1W4M A;  1MJ9 A;  1F36 A;  5GP9 A;  4CYC B;  3ZRG A;  1UHM A;  3GCM A;  4YRV A;  2F4O B;  3HRT A;  5HS7 A;  1TL8 A;  3SZG A;  1FPQ A;  4ZTJ A;  1MH3 A;  2E5Z A;  2QBY B;  2VKV A;  3OS2 A;  3ZQI A;  2QBY A;  1HKS A;  3CMY A;  1JT0 A;  5DYM A;  3KZI C;  3K6G A;  4HV5 A;  3JRH A;  2DFF A;  1O3S A;  2STW A;  2MSY A;  4CUG A;  3ZMS A;  2EIN H;  4XQF A;  3E6M A;  4A3G J;  3ASN H;  2HTJ A;  2IGM A;  3WHC A;  2KMU A;  5DTD A;  5D5X B;  2XSD C;  4R1H A;  1JTX A;  1F9N A;  2R7T A;  3B6A A;  1YTY A;  1R5H A;  1T39 A;  4I7H A;  1P7I A;  3I0T A;  2VXZ A;  4RBO A;  3QU6 A;  3HSE A;  2QZ8 A;  2HDC A;  3I54 A;  4CHU A;  4FCY A;  2OTJ I;  1V55 H;  3PNY A;  2RC4 A;  1FYK A;  3QOP A;  4QTR A;  5LHI A;  2FA5 A;  5L3G A;  3BG5 A;  5GAD J;  3K4J A;  4BHC A;  1DP3 A;  4BAC A;  1DPU A;  4FIS A;  2K9M A;  4U7D A;  1KQ8 A;  2NYX A;  4BU2 A;  2YS9 A;  2JA2 A;  5KHD A;  2R7V A;  3ZMD A;  2DMT A;  2ZFW A;  5F1J A;  2R7S A;  1Z7L A;  4HQE A;  4A69 C;  3TO9 A;  3ZQG A;  3BZ6 A;  2O8K A;  3MAJ A;  3MFK A;  1T6S A;  2IVM A;  1CGP A;  2V6C A;  5DUK A;  3J7A Y;  2M1B A;  2LH9 A;  2HQA A;  2K9L A;  1I3Q J;  2QUF A;  4HDV A;  1Q1V A;  3BWG A;  5FLX Z;  4XLP F;  1ZG1 A;  1HBX G;  1MMD A;  2DYR H;  3G6E I;  3ZP5 A;  2Y0M A;  3H5R A;  3HRS A;  2HQ5 A;  4QSH A;  4Q47 A;  3KP5 A;  1ZLK A;  3EQL F;  2IA1 A;  2K9S A;  4ABZ A;  2HI3 A;  2RQP A;  2Y75 A;  3HJE A;  1Y56 A;  1X58 A;  4GGG A;  2W7N A;  4AU7 A;  2FBK A;  1KYW A;  2M9H A;  3N05 A;  5F08 A;  4F93 B;  2XAF A;  2IA2 A;  2EZI A;  5D4S A;  2HPI A;  5IT9 K;  1EJ9 A;  1WI3 A;  1YYV A;  4XR6 A;  2A3S A;  3NAU A;  2E5N A;  4BEH A;  1Y39 A;  2E7W A;  5EEH A;  3CCE I;  2R5Z B;  4IX7 A;  2JRT A;  2IEK A;  3BPX A;  2R5Z A;  1HSJ A;  4O5V A;  3DKW A;  4PDK A;  4A3L J;  1ETK A;  4B1R A;  1MJA A;  4D7N A;  4BAY A;  3BR3 A;  4XLA A;  2PBI A;  2M4G A;  1UAA A;  4LMY A;  4DQ2 A;  2I8D A;  4R8H A;  4UV9 A;  5LEJ A;  1REP C;  3SFI A;  1FJL A;  1YE9 A;  1VQL I;  4IO9 F;  1O57 A;  2X9D A;  3RQI A;  3ZGK A;  4R79 A;  5K5O A;  1MIJ A;  4YEL A;  2DU9 A;  1ZRC A;  3CCR I;  2HOT A;  2DK8 A;  2L01 A;  4WXH A;  3LSJ A;  3MWM A;  1T56 A;  1MBJ A;  1R00 A;  2BXY A;  2PMU A;  4ESB A;  3CCL I;  1ERD A;  3ZQL A;  2LKS A;  2YUS A;  3CCJ I;  1MSF C;  3W2A A;  4XSX F;  1S5L C;  4EV0 A;  4ZTF A;  2A6E F;  2E36 A;  3HYI A;  3HOS A;  5JLX A;  3CJQ B;  1OCP A;  1OYY A;  2OBP A;  2E7X A;  3BQY A;  4EVI A;  5JHF A;  2IS4 A;  1RRJ A;  2DCE A;  3DP7 A;  5FB2 A;  4M9Z A;  2MG4 A;  2Q0O A;  1F43 A;  2OCC H;  1H8A C;  1J2X A;  1ETX A;  1FOW A;  3VOD A;  2VLA A;  1D5Y A;  3BTI A;  4EM1 A;  1BI3 A;  3M8F A;  1FWZ A;  2QA4 I;  2W82 A;  3WE3 A;  3DU6 A;  4PJL A;  4ENN A;  3HOU J;  1XMK A;  4XLF A;  2H1K A;  3K7A J;  2D1V A;  2BVM A;  3M4O J;  1H88 C;  5CYV A;  2ZME B;  1VQ7 I;  2XKO A;  3W3C A;  1I27 A;  3CC4 I;  1DU6 A;  5KVR A;  3CTA A;  4X6A J;  1WKM A;  3LST A;  1XC5 A;  3VYT B;  5DV5 A;  2LTP A;  3HRM A;  4BJ6 C;  1BC8 C;  4MFD A;  5CQE A;  2KQR A;  2HVR A;  2XDV A;  3JAM K;  1LEB A;  5BQT A;  3BPV A;  2R92 J;  1UEL B;  1ACI A;  2IA0 A;  5K1Y A;  2ZJQ F;  1YJ9 I;  1XSX A;  2L0K A;  5LHH A;  4Z6Y A;  2STT A;  3OYD A;  2XGX A;  3OYI A;  4K2E A;  4A3C J;  4ITV A;  2OV7 A;  2VAS A;  3S8P A;  2DTZ A;  2QKL B;  3ZN0 A;  1W7P D;  3TGN A;  2BZT A;  2X6O A;  2KZG A;  1DGW Y;  2QEX I;  3I4M J;  2V1N A;  2L9V A;  1IRG A;  1R7J A;  1X4O A;  1UB9 A;  3CF2 A;  3DQV C;  3VB2 A;  3A4C A;  1IN8 A;  2L9N A;  4HST A;  4LLN A;  2QQA A;  3GUD A;  4GXO A;  2EWN A;  5J4V A;  2OU2 A;  1IDY A;  2QKM B;  3KP6 A;  1EH8 A;  5A2Q K;  1UST A;  2MD0 A;  9ANT A;  2EFO A;  2WAD A;  4YIR X;  1USS A;  5GTH C;  5IOZ A;  5D5U B;  3CO6 C;  1W5S A;  4XLH A;  4HLY A;  1FZP B;  1NTC A;  3D0S A;  4B43 A;  2E1C A;  3H0G J;  2WB1 A;  3HSF A;  3WU2 C;  4UVC A;  2UWM A;  1PP8 F;  1S6L A;  1HQC A;  2Z1D A;  4HAM A;  4NHJ A;  2QVO A;  2M34 A;  2CFX A;  5GTI C;  1P4W A;  4NC8 A;  5F0H A;  5GAH J;  1ZYR F;  5J6X A;  5BOX A;  2HDW A;  4CGZ A;  4CDG A;  1RES A;  2IXS A;  2OC6 A;  4HV6 A;  3WTZ A;  2FBH A;  4YFK F;  1O4X A;  4YFN F;  4Q4Z F;  1JI8 A;  1QU3 A;  2O6G E;  5EEA A;  5HNH A;  2M5W A;  4RA2 A;  4KIT B;  3ABL H;  1R58 A;  4OWR B;  2HPM A;  4KT5 C;  1JUS A;  3DBL B;  3AL0 B;  3G71 I;  4BE0 A;  1FOX A;  3RZO J;  1NH3 A;  3TQN A;  1ZRD A;  4A3M J;  1U9N A;  5HLT A;  4A3I J;  2OQR A;  5JVT A;  1XGN A;  3GO5 A;  2RGV A;  5B66 C;  3GBG A;  1TWG J;  2GA1 A;  4U7B A;  4ANJ A;  5E18 F;  3FXJ A;  1N77 A;  3S32 A;  4XMY A;  1ITY A;  2P6S A;  4I76 A;  5K5R A;  1G2H A;  2ESN A;  5DDG A;  1W5T A;  3RKY A;  4WXC A;  3F6O A;  5EZG A;  2JZY A;  3COA C;  5IYC J;  1WJC A;  4XRS A;  4BGD A;  4BJ5 C;  1NHA A;  2JA7 J;  3LFK A;  1T33 A;  4FE4 A;  3TKY A;  4CCJ A;  2PN6 A;  4D1Q A;  1GT0 C;  1YX3 A;  2JA5 J;  3HOY J;  3DBH B;  1K6O A;  4BNC A;  4JQF A;  1HC8 A;  2DMN A;  1XMX A;  3GLL A;  1D3Y A;  3I3L A;  1O3R A;  4U88 A;  1SAU A;  1KU9 A;  4IQJ A;  3WG9 A;  5LRS A;  1MD0 A;  2E2J J;  4G6Q A;  1X4P A;  4CCK A;  1WH5 A;  2ZO4 A;  2PMH A;  1V4R A;  4G7O F;  1P7J A;  2FOW A;  4Y4R A;  4M3G A;  3RIR A;  3K4N A;  3ZQQ A;  1DP7 P;  1A04 A;  4UUS B;  5HS9 A;  3KZY A;  5C3E J;  2HYF A;  4UUS A;  3LFU A;  1OYI A;  2IPQ X;  5IYB J;  5FRO A;  3IRQ A;  2DXI A;  1QNT A;  5CKT A;  3SEQ A;  3DEE A;  1BOB A;  2EFN A;  3O8H A;  4DZP A;  4XKW A;  5L3B A;  1LVA A;  1WH7 A;  1XGS A;  2PMZ N;  3S1M J;  2N8G A;  3SYT A;  2WAQ N;  3EUH C;  3O6B B;  2M30 A;  2K4B A;  1YOV B;  2XAG A;  2ME6 A;  1MMS A;  1I1G A;  5FLM J;  3AG3 H;  3MMY B;  4II3 A;  2BEO A;  3IP4 B;  1QRY A;  1U5T A;  5FJ8 J;  3ML6 A;  3FXK A;  4BE1 A;  4KN7 X;  4BXF A;  4C30 A;  3ECH A;  4XN3 A;  3E5Q A;  3BC8 A;  3I59 A;  3S3M A;  1NG6 A;  4RS8 A;  3VOE A;  4AID A;  1Y8Q B;  3FHN A;  3JRG A;  4P9U A;  3CLQ A;  4J01 A;  5EGO B;  2BXZ A;  2E1N A;  1BR1 A;  5EGO A;  1J7K A;  1QGP A;  2JUG A;  4PJ0 C;  1SVL A;  4DYQ A;  3JTG A;  3BG3 A;  1ETY A;  2DT6 A;  1WQ2 A;  2A05 A;  2KT0 A;  1K78 A;  1XDS A;  2L9R A;  5ICE A;  3OYB A;  1S8N A;  2FML A;  2XRO A;  5GPA A;  4IRH A;  4E7L A;  5L3D A;  2QEN A;  5LGN A;  2CWE A;  1OCZ H;  1TQM A;  3I56 I;  1Q1H A;  2E19 A;  1ULY A;  5HNF A;  1ZQ3 P;  1DPR A;  2K40 A;  2CQX A;  3DPU A;  4XKV A;  3ZOB A;  5AON A;  1LUJ B;  1EA3 A;  4LB5 A;  4OMZ A;  2RVC A;  1IUF A;  4E7I A;  1SFX A;  1ZR2 A;  4LK0 F;  3TMO A;  3V7S A;  4UB6 C;  2PJR B;  5F0F A;  2PJR A;  5HS8 A;  3FXL A;  1H0M A;  1OLT A;  1LKX A;  2DOF A;  2DA1 A;  1MGT A;  4HSR A;  4EJW A;  4ESJ A;  2K02 A;  3ULQ B;  2VPL A;  5EEG A;  3PO3 J;  3A02 A;  3ROU A;  4WWC A;  1F1Z A;  4EEF G;  3H3Z A;  1G4D A;  5FRN A;  4PFO A;  1KQ9 A;  2O0Y A;  3OYJ A;  1XS9 A;  2NVX J;  1IW7 F;  3GTJ J;  3D5R C;  1AHD P;  3RKW A;  1FIP A;  2QQ9 A;  1YW9 A;  3ASO H;  4IRG A;  2LDU A;  3PM1 A;  1KZH A;  4IEJ A;  2K7L A;  4BHP A;  4KT6 A;  1VQN I;  1XMA A;  5M5Y J;  2Y9Z A;  1G3T A;  2KIQ A;  2XPV A;  4XOT A;  1D5V A;  2JPC A;  4I2O A;  3BLY A;  2P5L C;  1P6R A;  4YII A;  1KON A;  2CV1 A;  3ABU A;  4E7J A;  4Y17 A;  1D0Z A;  1QPM A;  1B9N A;  3J81 Z;  4B44 A;  1BI0 A;  3KPH A;  2VPR A;  4HNT A;  3CMM A;  1UG0 A;  1R4N B;  3SZP A;  1MMN A;  2HOA A;  4OIR F;  2MLG A;  4Y33 A;  1W0T A;  2DDB A;  2JUC A;  2K9N A;  2L7M P;  2LF8 A;  2P7V B;  3BP8 A;  2ZB9 A;  1IO2 A;  4L0Z B;  1FEX A;  2W25 A;  2DAO A;  2EPF A;  3ZCO A;  1BW6 A;  3HC7 A;  2ZSH B;  2RRE A;  1OKR A;  2DMP A;  4DBR A;  1I1S A;  4MEY F;  3EYY A;  3U21 A;  1S72 I;  1ZG3 A;  1LNW A;  1J59 A;  5ICG A;  3HOW J;  3DEU A;  3WTX C;  4ZYE A;  1LE8 A;  4DZJ A;  3QP5 A;  1LB2 A;  3VDX A;  3H5N A;  4IVN A;  5F27 A;  1TWC J;  3WTS C;  1BIA A;  4KDP A;  3HOX J;  2ETH A;  3HEF A;  5M3M J;  2VJ4 A;  1HST A;  1ETQ A;  4V19 K;  1UJ8 A;  4HQM A;  2KKO A;  1R4M B;  1X3W B;  2HOE A;  5E1X A;  4XIC A;  1U0J A;  1PP7 U;  1FBQ A;  2DQR A;  5JVG F;  2JSP A;  1O7F A;  1P2F A;  3BOQ A;  5B3S H;  1TT5 B;  2Q8K A;  2W4S A;  2A6H F;  4ZDP A;  3ECO A;  3S2H J;  1PUE E;  1JKR C;  3HB9 A;  2GZW A;  2ISZ A;  2P5V A;  1OR7 C;  1FTZ A;  1KU3 A;  2MFZ A;  2KFD A;  3GFJ A;  2EK5 A;  2LVS A;  4BE2 A;  4DBQ A;  5HOD A;  2H1L A;  4IHY A;  3NWT A;  3MZ8 A;  4DJA A;  1KYZ A;  2PI0 A;  4FT8 A;  3OIO A;  3CF5 F;  3E6D A;  1FBS A;  1TLH B;  3KYD B;  4GYG A;  4RLF A;  2NVU B;  5DS9 A;  3CME I;  2IT0 A;  1XCV A;  4BKX A;  2UV1 A;  3TBI A;  3TDZ C;  1ZG5 A;  1QZY A;  5B1A H;  1ETW A;  3S3N A;  4Q5S F;  3BR0 A;  1GVJ A;  2R7O A;  3QPH A;  4YG2 F;  2M8G X;  3A2K A;  2RV8 A;  3H35 A;  3DKY A;  4XKC A;  2NS0 A;  2F48 A;  3A01 B;  2O03 A;  1E2X A;  3CUQ B;  1R5G A;  3KCC A;  4XLN F;  3OYC A;  1QA6 A;  3CUQ A;  3F9K A;  2F2E A;  1RKT A;  2VC1 A;  2W48 A;  1YW7 A;  3FMR A;  2X6Y A;  2COB A;  2LBF B;  3HKZ N;  2L4M A;  2XIG A;  2EV6 A;  2X4H A;  3R0J A;  2DOD A;  2EIM H;  3CDH A;  3QWL A;  3VYS B;  3GTP J;  3PJR A;  5B5E C;  3FX3 A;  2X6W A;  1POG A;  5C44 J;  2A5Y B;  3LSI A;  5FD6 A;  2CJJ A;  2TRT A;  2KDZ A;  1ZHF A;  4HX8 A;  2M2E A;  1DU0 A;  3GFL A;  1EH7 A;  2L7Z A;  5L3F A;  1IV8 A;  2JVH A;  4CYC A;  3G4S I;  1FMV A;  2MC4 A;  4ZDL A;  2R7U A;  4E7Z A;  1RNL A;  1WZ2 A;  3JSP A;  4O6J A;  1SFK A;  3Q5F A;  3LSK A;  1HKT A;  4C3I J;  3JRF A;  1WGX A;  2Y9Y A;  2PJP A;  1OCT C;  2UXX A;  3BRO A;  4FHT A;  1GV2 A;  1IXR C;  3L2R A;  3JAM Z;  3HZJ A;  4UB8 C;  1HOM A;  1H89 C;  2F5D A;  3FF5 A;  3MVP A;  4M74 A;  2V6E A;  3QPT A;  4IZZ A;  4EJT A;  4MGR A;  5DUI A;  3AKZ A;  1TWA J;  2O3F A;  3E5X A;  4I02 A;  2LR8 A;  4L5I A;  1Z21 A;  2A68 F;  4HPQ A;  1VI0 A;  4Y7N J;  2NRA C;  4BXX J;  3J7A O;  1JUM A;  2QYO A;  4PFP A;  2K3F A;  1WJF A;  5CVJ A;  1Y1V J;  3PL8 A;  1SD6 A;  3FXM A;  3H5A A;  3OL4 A;  4BH9 A;  3OYM A;  1XGM A;  3AG4 H;  2VJJ A;  3ZMT A;  5E8I A;  1TQI A;  2IS6 A;  4M6V A;  3A1Y A;  4RAY A;  3FDY A;  3W6V A;  1I6X A;  2AS5 F;  1IRZ A;  2R93 J;  4KIF A;  1TT0 A;  4F52 A;  1XD7 A;  1W0U A;  1JJ6 C;  3S2D J;  3FZV A;  3K2A A;  3F8F A;  4LLL A;  4G9Y A;  5A2Q Z;  2IBD A;  2RN7 A;  1R1T A;  4WXD A;  4CYD A;  4H0E A;  6PAX A;  2K5C A;  3I64 A;  3OYL A;  4TV7 A;  4OAZ A;  3OY9 A;  2FU4 A;  3MZH A;  3WTT C;  4II2 A;  3MEX A;  2PFB A;  2XAJ A;  2XAQ A;  4OU0 A;  1V5E A;  1XDU A;  4J19 A;  4PGG A;  1Z7U A;  2L3D A;  2ME0 A;  1QBJ A;  2IAI A;  2GXA A;  3CQZ J;  3DLA A;  3A03 A;  5KAI C;  2CV2 A;  1X1A A;  2MD5 A;  2IP2 A;  2MAB A;  5H2F C;  2YX7 A;  4MEX F;  5IY5 H;  3LSR A;  3F8C A;  3M7G A;  5F04 A;  1FT9 A;  1KA8 A;  1PYV A;  3CCM I;  2XV4 S;  2KJB A;  1BL0 A;  4B09 A;  3NQO A;  2W24 A;  4Z2Y A;  3OIQ A;  3R60 A;  1VQP I;  1R49 A;  3A0H C;  3HPH A;  1OFC X;  2VN2 A;  1IUY A;  2CMP A;  1IF1 A;  2CQK A;  2HZT A;  2M8E A;  3T8R A;  4AIH A;  2XAU A;  5FKM A;  1U78 A;  3H3U A;  1MKM A;  3KLO A;  2F5F A;  3C2B A;  5J8C A;  1W36 C;  3B02 A;  2KRC A;  1GHC A;  1VQ6 I;  1TWH J;  5BMZ A;  3V42 A;  5AIQ A;  3AFH A;  5TIS C;  2MW8 A;  4RM2 A;  2E1M C;  3UR3 C;  3QAH A;  3VSK A;  3GZ6 A;  1A5J A;  1H9G A;  3P5J A;  4RGR A;  3QYF A;  3HOT A;  2A69 F;  5E3L A;  5J3L A;  1YS7 A;  3IH3 A;  1UCR A;  1LFU P;  1BN5 A;  2X1E A;  2QLZ A;  2ID3 A;  3KLN A;  4ON0 A;  3TDU C;  4KUM A;  3FWE A;  1RKW A;  4JYK A;  3GZ5 A;  2NVT J;  3BR6 A;  1OPC A;  1K6Y A;  3I4N J;  2XF6 A;  3ABM H;  2HQR A;  3ZPL A;  2HZD A;  1P4A A;  3GEZ A;  2V7F A;  2BW3 B;  2P8T A;  4G8X A;  2BW3 A;  4XRF A;  2M45 A;  3H0D A;  3E0J B;  4AYB A;  5LEK A;  2ZNZ A;  3GTO J;  3J80 Z;  3BZC A;  1GVD A;  1MJB A;  2R7D A;  4QPO A;  2GXG A;  1YG2 A;  3PSI A;  2EFW A;  1IAW A;  3MZY A;  1FOK A;  1TW2 A;  2HXO A;  2ELK A;  2EZH A;  3ZQH A;  3TL4 X;  1UMQ A;  1I5Z A;  3SDG A;  2FJ1 A;  2KRH A;  1XB4 A;  3B73 A;  4KIG A;  2D45 A;  3WTY C;  4L9V A;  4QWQ A;  3GZN B;  3P9I A;  2F6C A;  4EQQ A;  3IKT A;  2O9L A;  5F64 A;  4C2T A;  4L0Y B;  4MHG A;  1NK2 P;  2FD5 A;  2CUJ A;  2XAH A;  2BV6 A;  4HX4 A;  1X1P A;  2KIM A;  3SZT A;  4LLG F;  3GTM J;  1Y0N A;  5EG0 B;  2ZBK A;  1DGR M;  3F8M A;  5H20 A;  1IN7 A;  5FRM A;  5ILS A;  4EGY A;  2EIL H;  1TWF J;  1BOA A;  3HDD A;  1SEU A;  2ZME A;  1A35 A;  1WSU A;  2KHM A;  4BBR J;  2VON A;  2HFH A;  3CJR B;  2CS3 A;  2R3S A;  3O8G A;  1YRN B;  2D2W A;  5FKK A;  1KU2 A;  1FSH A;  1YRN A;  4G7Z F;  4PZJ A;  1ONV A;  2IGO A;  3HBL A;  3FKI J;  2K9Q A;  3NAR A;  1MNE A;  3ABK H;  4IHS A;  2KZV A;  2DO7 A;  3U1D A;  2NNN A;  3KET A;  2B9S A;  5E1Z B;  5FO5 A;  3NRV A;  3K1P A;  2VJI A;  3WU1 B;  3KFW X;  3BR1 A;  2BY3 A;  1VTN C;  3QPL A;  4A2U A;  3F3X A;  1V3F A;  1X1B A;  2V26 A;  3PFI A;  2X6X A;  3H3V K;  1MBE A;  4ESF A;  4HX7 A;  2DI3 A;  4BJT A;  1WJ5 A;  2KPM A;  3KYC B;  4XKB A;  4XNF A;  3OOP A;  2ID6 A;  3PQK A;  4RMN A;  1SD7 A;  3EDP A;  4I0B A;  2CSO A;  1SD5 A;  2L7F P;  2OPT A;  2QCO A;  2YU3 A;  1F5T A;  3HRU A;  1YIT I;  1IV6 A;  4CCN A;  2PQ8 A;  4UVA A;  4P1W A;  2NOG A;  3ESW B;  3R4K A;  2DA5 A;  2P0W A;  1TC3 C;  4MQ9 F;  4AUX A;  2EIK H;  1T8I A;  1S7A A;  2GQQ A;  5CLS A;  2VBW A;  2W84 A;  4PUS A;  2UXN A;  3GXO A;  4JOM A;  1QHH D;  2Z5U A;  4PSW A;  2WAF A;  3JRB A;  2P4W A;  3V8J A;  1S7E A;  3KE2 A;  2NS8 A;  1OYW A;  2DA2 A;  4A3J J;  1CQT A;  2O61 A;  1M1E B;  4MFE A;  4RB0 A;  4HF0 A;  2G7H A;  3L2V A;  2OA4 A;  2FSW A;  2HEO A;  2YPR A;  1RZ4 A;  3GTK J;  2LLK A;  2V79 A;  5FFZ A;  2VE9 A;  3NWS A;  3HG9 A;  1R1V A;  3B6C A;  1TW3 A;  5B1B H;  1AKH B;  2QSH X;  4ZZL A;  1AKH A;  3S1Q J;  1Z91 A;  2WBM A;  5DD4 A;  2JA6 J;  2VKE A;  5FLX K;  3L1P A;  3FHZ A;  1TTY A;  1GUU A;  2FNP A;  2L2O A;  3LNQ A;  4ENK A;  1LDJ A;  2V9P A;  5CVU A;  4A3B J;  1BJA A;  4MIM A;  2XF5 A;  3DPL C;  2FNA A;  3RPQ A;  3C1D A;  2J5P A;  3RYR A;  4M3E A;  2WB1 N;  1N25 A;  2H6C A;  2VQG A;  5D8L B;  2X1D A;  4G94 A;  4W1U A;  3LWF A;  1U2W A;  1PUF B;  2XB0 X;  3TW6 A;  4KIC A;  2VQH A;  2OCE A;  3OL3 A;  4RB2 C;  3BCB A;  4RAF A;  2BGC A;  4CA0 A;  3DEW A;  2VKH A;  4M3F A;  5LLQ A;  5AIP A;  3LSG A;  4AIJ A;  1JKP C;  2RQQ A;  3CJT B;  2VUM J;  2ICW G;  2DFI A;  3JCU C;  4MO7 A;  1GDT A;  5LRR A;  3JR9 A;  5IOY A;  2NS7 A;  1WFX A;  2DFH A;  2R5Y B;  2OTL I;  1MND A;  4PCQ A;  1IN5 A;  5FKN A;  2BE5 F;  2R5Y A;  2EIJ H;  1FLI A;  1X1D A;  4X0G A;  2QWW A;  1OCR H;  1ZK8 A;  1MBK A;  2M3A A;  2Y69 H;  1D0Y A;  2FQ4 A;  2WAQ A;  1DDN A;  2CFO A;  1MBF A;  4KYW A;  1L0O C;  2XGC A;  1R1U A;  5L3C A;  1JXS A;  1R6R A;  4M6X A;  4OAY A;  1JKQ C;  1VQO I;  3T8T A;  4S04 A;  1XPX A;  3L2W A;  2TCT A;  4PJN A;  3REO A;  4A6D A;  2Z33 A;  1F4K A;  4RAG A;  2J5O A;  3G1L A;  4B3A A;  1L3L A;  5E17 F;  4NNJ A;  3HUG B;  1D1A A;  3T5X A;  3GFM A;  3HUG A;  2DBB A;  2EA2 A;  2R7Q A;  1P4X A;  1S3J A;  3M1E A;  1U6G A;  3FMQ A;  1WPK A;  4DOZ A;  2LG4 A;  2OUM A;  1ZH5 A;  5E79 C;  1YO5 C;  2LY2 A;  3VPR A;  1YX5 A;  4UNO A;  1K61 A;  2MH2 A;  3BJ6 A;  2R7Z J;  4BDZ A;  3V8K A;  3CDI A;  3I71 A;  2V9V A;  1QPI A;  3SDB A;  3V7C A;  4YIF A;  2LF7 A;  3SXY A;  1WJE A;  2ELJ A;  2NNY A;  2VB6 A;  4A3F J;  5HVQ C;  2DT7 B;  4IHX A;  1MMG A;  1SVO A;  2IW5 A;  4B47 A;  2H27 A;  1XX5 A;  2BY0 A;  3T0Y A;  4ETS A;  4S05 A;  2DPU A;  4D9J A;  3KIO A;  2Y30 A;  1XSD A;  1IDZ A;  5FD5 A;  1AWC A;  5HDK A;  1MDM B;  1J75 A;  5E3O A;  1IC8 A;  1MDM A;  3KX2 A;  2GBY A;  1JJ8 C;  3C3W A;  3CLO A;  2VBZ A;  1HLV A;  3FKJ A;  3C2G A;  4KNY A;  4S0H B;  3HOZ J;  3K70 D;  4B48 A;  3BY6 A;  3PO2 J;  2BHZ A;  2JA8 J;  4GCV A;  2BBY A;  1JE8 A;  5DM6 F;  4GRI A;  3OS0 A;  2GAU A;  4GYI A;  4KMU X;  3W6K B;  2PG4 A;  2YSR A;  2PX9 A;  3OR1 C;  3CMA I;  2IJL A;  2CV0 A;  3GLX A;  3JRA A;  2WC2 A;  2JN6 A;  5JHU A;  3GTG J;  3BR5 A;  3WGG A;  4KMF A;  3JRD A;  5J8F A;  1YLF A;  3QYB A;  4B4C A;  2R7W A;  2A6T A;  3DWL E;  2NVQ J;  2LRE A;  1G59 A;  4BUP A;  2FMY A;  2YX4 A;  5IT3 A;  2JTV A;  1TNS A;  1IXS B;  5EYR A;  5CVI A;  2RAE A;  5BNG A;  3RCO A;  3DKX A;  3LL7 A;  3GWZ A;  2ZXW H;  1LFP A;  5HLH A;  3QRF F;  1FTT A;  1SAX A;  4HDU A;  2HKO A;  4EGZ A;  3MKY B;  4F92 B;  1O3Q A;  1R23 A;  5JI6 A;  2E1M B;  3QOE A;  2LKX A;  4AC0 A;  4P55 A;  1KGS A;  3RPU A;  4L9N A;  3I4P A;  2XKP A;  2Z2S B;  1Z6R A;  2BHY A;  3F72 A;  4LG0 B;  2LOO A;  1XTA A;  2MA3 A;  2OZU A;  1ZAR A;  4U87 A;  5DEQ A;  4LG0 A;  1R22 A;  2CW0 F;  2NAZ A;  3ONQ A;  2L02 A;  4N4N B;  3G2B A;  1WI9 A;  4A6E A;  3SJM A;  2CW7 A;  4IF4 A;  1MSE C;  2LFB A;  2HDD A;  3CP2 A;  5LGT A;  3G1M A;  2MC3 A;  2XC7 A;  1ZR4 A;  1D1C A;  4XOR A;  3KYL A;  1NG7 A;  2OZ6 A;  1YS6 A;  2BYV E;  3GFI A;  4CZZ A;  1T0F C;  2DJN A;  5FLV A;  3CP8 A;  3RI4 A;  1G6N A;  2F4M B;  2KL4 A;  1U8B A;  2AHQ A;  5GPC A;  2JSC A;  1QQI A;  4FET A;  4FX0 A;  4Y52 J;  4AVP A;  2RNG A;  4HZF A;  1HF0 A;  1TBX A;  1AA7 A;  2JMW A;  2E2H J;  3CJN A;  4BS9 A;  1T98 A;  3F22 A;  1HDD C;  1SD4 A;  1N75 A;  4GDF A;  2ZJP F;  1A36 A;  2NOJ B;  4V2F A;  3JRI A;  2GWR A;  1K4S A;  1A6Q A;  4A3K J;  4CXF A;  1JHH A;  1BC7 C;  1VQ4 I;  2HU9 A;  4C3H J;  1B8I B;  5EF6 A;  3SEZ A;  1ZEL A;  1HDP A;  2EZL A;  3RTR A;  3PQJ A;  1B8I A;  1ZGA A;  4CIC A;  4L9J A;  2XRL A;  3IUO A;  4IHT A;  5IT9 Z;  4N4O B;  1Y1W J;  4E7K A;  2UZK A;  3DCF A;  2FF4 A;  3PIO F;  4OIO F;  2JJ7 A;  3HTS B;  2WY7 Q;  4LIT A;  2DLL A;  3LAJ A;  5E8G A;  2E71 A;  2HNH A;  3ZMV A;  4M9S A;  3TOB A;  3S16 J;  4MTE A;  3H9Q A;  4DGW B;  2CUZ A;  4F55 A;  3JTH A;  5EZH A;  3F8N A;  4M6Y A;  3M8J A;  5HLI A;  2H8R A;  2IGN A;  2V4J C;  1BBY A;  2Y0S A;  1BJZ A;  2FQ3 A;  1K4T A;  4ZH4 F;  2DA3 A;  4E7H A;  3KZZ A;  4KJZ A;  3WTV C;  2EZK A;  1FIA A;  1FMW A;  2RKH A;  3HKZ A;  2KRF A;  4D5F A;  3UKG A;  4IPA A;  2EB7 A;  2HYJ A;  1MBH A;  4Q48 A;  3ZQ7 A;  4NQW B;  3KP4 A;  4L5E A;  3T1B A;  3F23 A;  3U1K A;  3J7Y J;  3K1N A;  3EET A;  3L2Q A;  3A01 A;  4I09 A;  2DDA A;  2AQF A;  1YW8 A;  3LA2 A;  3Q0V A;  3PUB A;  2GLO A;  5KCM A;  3GTQ J;  3M1C A;  2C6Y A;  1HKQ A;  3SHF A;  3CZ6 A;  5E20 A;  1SMY F;  3K2Z A;  4UVB A;  1S7O A;  2LBF A;  4RB3 C;  3IL2 A;  1YHQ I;  3C2H A;  4RGX A;  2K86 A;  4U0Y A;  4B3X A;  4E7S A;  3VSL A;  1RC9 A;  2E34 A;  1NK3 P;  4NBQ A;  3I5U A;  2FBI A;  4C3J J;  4HEA 2;  4LFU A;  5KNL A;  5BPD A;  3OYE A;  1RIO H;  1BW5 A;  4YEJ A;  1OQY A;  5ICF A;  1ZGJ A;  3EUA A;  4IJA A;  1XCB A;  1VQM I;  3F0C A;  1MH4 A;  2ESH A;  4NC7 A;  1WCM J;  2LC2 A;  3RDI A;  2ZNY A;  2CW8 A;  1VQ9 I;  4GO1 A;  2F5V A;  4M3D A;  2W85 A;  2RNJ A;  3GME A;  3V8L A;  4BQO A;  3I9V 2;  2G0E A;  3WOD F;  2QSF X;  5J1U A;  4XRM A;  3CCU I;  4C2M J;  3BG9 A;  3WHB A;  2A5W A;  1MZB A;  1HW2 A;  3Q9V A;  1DQU A;  2DOE A;  3E6C C;  3R6S A;  2K85 A;  2R7R A;  4M71 A;  3W2V A;  1W5C C;  2I5U A;  4UXN A;  4AIK A;  3WE2 A;  2P7C B;  5HLG A;  3OYN A;  5L3E A;  1T38 A;  1B72 B;  4UUV A;  3FIS A;  4JX5 A;  3RSN A;  2QQB A;  3HOV J;  3LMM A;  3CCS I;  1B72 A;  3JSO A;  3AAF A;  2XAS A;  3M3Y J;  1X3Z B;  1P92 A;  3BCA A;  3RKX A;  3CES A;  4F91 B;  2JT1 A;  2UUZ A;  3ABT A;  4BXU A;  2QSG X;  2R7X A;  4LG3 A;  3DV8 A;  4F7Z A;  2NVY J;  4FTH A;  2DT5 A;  3H36 A;  2DA6 A;  4HNV A;  3QQA A;  3X2Q H;  4XOP A;  5J47 A;  1FX7 A;  3FK6 A;  3UNG C;  3L09 A;  4EMS A;  3HL2 A;  2GIV A;  2JVG A;  3MQ0 A;  1FOY A;  2VIX A;  1ZTR A;  3S3O A;  1U5T C;  4E6K G;  3K4M A;  3S2W A;  3N4M A;  1X3U A;  1Z1D A;  4U0V A;  5D5V B;  2W00 A;  2ZSI B;  4BQQ A;  1EF4 A;  1FP1 D;  2EBI A;  2GOX B;  3EPZ A;  4ZYD A;  3Q9S A;  3MCZ A;  4EJV A;  2F5C A;  3SFZ A;  3U2R A;  2BY1 A;  1ZAO A;  3IAM 2;  3GYH X;  2EQR A;  2H8W A;  3IHU A;  1BI2 A;  3M8E A;  1SC7 A;  2AQE A;  3BZK A;  3I53 A;  3GX4 X;  1IRF A;  2DK5 A;  2DA4 A;  3J81 K;  4BBS J;  1FYL A;  3QYE A;  3D5S C;  5LGU A;  2ADU A;  3U9G A;  3OR2 C;  3V7R A;  1ZGW A;  1EH6 A;  3AG1 H;  3GTL J;  1EKE A;  3M07 A;  3DTE A;  4ZJZ A;  2HGC A;  3VEP A;  1YI2 I;  1IGN A;  3HPG A;  2KP6 A;  4WX9 A;  5FKL A;  2X48 A;  4HW0 A;  1ZRF A;  1Z3Y A;  5JLW A;  2XSJ C;  3GW2 A;  2EH3 A;  5C4X J;  2Z16 A;  2Q2E B;  3DLL F;  2WY8 Q;  1LEA A;  2V9K A;  4XK4 A;  4FQG A;  4B8X A;  2Q2E A;  3K1M A;  3IAS 2;  1MNM C;  4O3M A;  2LK2 A;  4BY1 J;  1IRX A;  2ZC2 A;  3DPT A;  1PJR A;  3CUO A;  4NC6 A;  4BDY A;  4I0A A;  1A6I A;  1FP2 A;  1GXQ A;  1YJN I;  5KK1 A;  2DQL A;  4JX6 A;  5FKO A;  4HF1 A;  3R0A A;  3GF2 A;  3I55 I;  2BOL A;  3EUK L;  2FX0 A;  4HLX A;  1TNT A;  4LB6 B;  1VZ0 A;  3EUH A;  4ENJ A;  1B9M A;  1ZN2 A;  2MLK A;  4Y15 A;  3WTW C;  3PNV A;  4A5M A;  3KEY A;  3FBI B;  1RPW A;  5IYD J;  3L2U A;  4FAS D;  1GV5 A;  2IGK A;  1AOY A;  2DMU A;  2H6B A;  2ACJ A;  3ZN1 A;  1GXP A;  1WJA A;  1TZL A;  4BEH B;  4MLO A;  3SQN A;  2KIF A;  4FE7 A;  4WF2 A;  1RET A;  2LY9 A;  1W36 D;  1RI7 A;  3W6J B;  2O7O A;  5E3N A;  3BT9 A;  1U8R A;  4H4K C;  1JGG A;  2HXI A;  3RPU D;  2VQL A;  2DA7 A;  4RDU A;  4XID A;  3E3V A;  4JX4 A;  4HRI A;  4HYE A;  2AXL A;  4DYC A;  2L9S A;  3A0B C;  2VC0 A;  4C9Y A;  1V54 H;  2VOD A;  1Y8R B;  5EJC A;  2DTR A;  1MMA A;  1STZ A;  3DTI A;  4ZDO A;  5FFX A;  3E97 A;  3TP0 A;  2Y48 A;  2CYY A;  2X0L A;  5IP9 J;  1BM9 A;  5CJ9 A;  4MTD A;  2IS2 A;  1XN7 A;  1UHS A;  2PLY A;  3IRR A;  2G9W A;  4XLE A;  4KIB A;  3WGI A;  5E3M A;  1QVT A;  1WWX A;  1VQ8 I;  3ZQC A;  1D8J A;  4L5J A;  4V2G A;  2FRH A;  4I99 C;  1WJD A;  1ETV A;  5EG0 A;  4WK8 F;  1E3H A;  1KQ0 A;  4BY7 J;  2DYS H;  3FMS A;  1FSE A;  1G8X A;  1BR2 A;  1ODD A;  2EV0 A;  2XF7 A;  1HA8 A;  3KP3 A;  4A3E J;  3K4B A;  2YU9 J;  4IKF A;  4A3D J;  4LJZ F;  4AYB N;  2ZXH A;  3KEO A;  1FC3 A;  4N9I A;  5K7H A;  5F6F A;  3LSH A;  1HW5 A;  2O5R A;  3ISP A;  1OMI A;  3FXR A;  4XBF A;  2HVQ A;  4IQ4 A;  2RDP A;  2VBX A;  3CC2 I;  1V5F A;  3S17 J;  3QP6 A;  3HSR A;  4XN0 A;  5CVR A;  4C2U A;  4A0Y A;  5DCM B;  1E0E A;  5DCM A;  5LD2 C;  1LVK A;  2LYC A;  2GXB A;  3K9T A;  4CZC A;  5D8K B;  2QQ8 A;  3ZMU A;  5LBQ A;  1U3E M;  1VQK I;  4L18 B;  3TED A;  4XL9 A;  1D0X A;  4YFX F;  1UHW A;  3IH2 A;  3S14 J;  1WRJ A;  3JW4 A;  1UZC A;  2EFQ A;  2WV1 A;  4DYR A;  3CD6 I;  2EFP A;  4JBA A;  3H1C A;  3MKW B;  1T0F A;  1Z0X A;  3Q3S A;  2HS5 A;  3D5L A;  1AU7 A;  4WCG A;  1T08 B;  2LRD A;  2CG4 A;  3RJP A;  3OSG A;  5HDG A;  3HGG A;  4OOI A;  3CCQ I;  2XRN A;  1MW7 A;  1K7A A;  3CUQ C;  2ZJ2 A;  3HIF A;  1Z05 A;  2HVS A;  2ZKZ A;  1ENH A;  1EV7 A;  4U0W A;  3BTC A;  4P9F A;  3P9C A;  3I58 A;  4PJM A;  3FXU A;  1LPQ A;  2GOM A;  1Z77 A;  2FEZ A;  2VQC A;  2XGD A;  3E1S A;  1LFB A;  1K83 J;  1VND A;  3H92 A;  3CDL A;  3VYU B;  4LOC A;  4RGU A;  1JKO C;  1Y0U A;  2GM4 A;  2LMD A;  2JQ7 A;  3G73 A;  1J0R A;  1MBG A;  2GA2 A;  2NXN B;  3IKV A;  5DD8 A;  2KJC A;  1YIJ I;  4IXA A;  2D1H A;  3MKL A;  3R61 A;  4PSX A;  2FUG 2;  2DOA A;  4BL0 B;  5BPI A;  3L9F A;  4D7M A;  2AXT C;  4UHT A;  5DM7 F;  5IP7 J;  1R5I D;  2ECB A;  3E6B A;  4RB1 A;  2Y2Z A;  4EM2 A;  1OR7 A;  1X1C A;  1JTY A;  4LK1 F;  3W2W A;  1O3T A;  2BVL A;  2X51 A;  4XSZ F;  2W1O A;  1JHF A;  1OIS A;  3TO7 A;  3MKZ A;  2KLO A;  3TW7 A;  5M5X J;  3FXQ A;  1T2K A;  4OMY A;  2GIZ A;  3JRC A;  3IV5 A;  3RKQ A;  1QHG A;  4MNU A;  3FK7 A;  1SFO J;  2CRG A;  2OJE D;  3DBR B;  1G3W A;  3TOA A;  4NDL A;  2CUF A;  4QIW N;  3S93 A;  4RLQ A;  1IN6 A;  2M0M A;  1PUF A;  3PSF A;  2CO5 A;  1XSV A;  3H9G A;  1OCO H;  2MGQ A;  3MD2 A;  2VBY A;  2E35 A;  3K4C A;  2MH9 A;  4AD9 A;  4QPQ A;  4I01 A;  4KA4 A;  4DNC A;  5D5W B;  2CUE A;  3S1N J;  2HWV A;  3ELK A;  4LGW A;  3K0L A;  3VYR B;  1HXD A;  4KFC A;  1ON1 A;  3OS1 A;  1BA5 A;  2K27 A;  4E4H A;  2VI6 A;  4G12 A;  2FOK A;  3BJA A;  3LAP A;  5C4J J;  4HG2 A;  5F1R A;  2VE8 A;  1OJL A;  4EJU A;  1LJ9 A;  1YJW I;  3N97 A;  2XPW A;  5LFA A;  4BQA A;  5K7Z A;  2PMZ A;  1T95 A;  3HGY A;  4KN4 X;  4RGS A;  3L00 A;  5H6R A;  4HNU A;  4X1E A;  3RQ4 A;  3K4K A;  4XON A;  4JP0 A;  5M5W J;  1Z6T A;  3M9A A;  3KP2 A;  2KIU A;  3K69 A;  4CH7 A;  5IPA A;  2OD5 A;  1UFM A;  2X85 A;  2MBF A;  3BTL A;  3J80 K;  3OYK A;  1SFU A;  1FNN A;  2DW4 A;  4ZYH A;  4LD5 A;  2X1C A;  2HTS A;  4ENM A;  1J5Y A;  1SAN A;  5ICC A;  4BQN A;  3BDD A;  1PVE A;  3BTJ A;  3WG7 H;  2XHK A;  1A31 A;  1IXC A;  2G7U A;  2ELH A;  3BG6 A;  2EA4 A;  2FE3 A;  2PEX A;  1FYM A;  4IHV A;  3RZD J;  3F8B A;  1ETO A;  2K4J A;  3HTU A;  2OF7 A;  3ERM A;  2M7A A;  4PJJ A;  2F4I A;  4PGH A;  5IP6 A;  3WTU C;  2B7E A;  2QM3 A;  3OYA A;  2CGP A;  1O7L A;  4IRI A;  2ECC A;  1E17 A;  1I3A A;  2W57 A;  2DN0 A;  1JUP A;  3D1N I;  3FM5 A;  5EDN A;  2B0L A;  1D1B A;  4I98 B;  1PDN C;  4IL6 C;  3K10 A;  3G3Z A;  2WA0 A;  2JWT A;  5J4Y A;  1B1B A;  2LNB A;  1GLN A;  5GAE J;  3VWB A;  1WHU A;  4XM3 A;  4EJO A;  2L5Q A;  5FGM A;  3F6V A;  2ISY A;  4UY8 I;  5ILV A;  2H94 A;  1U5T B;  3FIW A;  1YQA A;  3PUF A;  2WTE A;  5ED4 A;  3FXO A;  2XVC A;  5DCF A;  3LOC A;  5M3F J;  2QGU A;  4XLC A;  1Z9C A;  3I59 B;  5CPR B;  3PFY A;  3LA7 A;  4G6D A;  4EAT A;  2V1X A;  2VT3 A;  1W1W E;  1APL C;  4M9X A;  1D8K A;  2F5E A;  3OOU A;  5F0C A;  3DU5 A;  3K70 C;  1FY7 A;  2WAE A;  3CCY A;  5HDN A;  2E1O A;  2P81 A;  4G7H F;  2LSO A;  3P7N A;  1IJW C;  3DTK A;  1IN4 A;  3OMY A;  3PNT A;  4FX4 A;  3Q0W A;  1VFC A;  2Y31 A;  1K78 B;  3ZQF A;  3KP7 A;  5D4R A;  3S1R J;  4G6T B;  3L2C A;  1C0W A;  1BR4 A;  2D5V A;  3DF8 A;  4BYY A;  1RUO A;  4AM3 A;  2HYG D;  2OQG A;  1FBU A;  1XGO A;  3AG2 H;  4QLC U;  2R4G A;  1ZKG A;  1VF9 A;  1H9T A;  1X19 A;  3RYP A;  4KIS A;  5CQG A;  2M0C A;  2O8X A;  4P5O A;  4ZZD A;  1HW1 A;  1WVR A;  2HOS A;  1SMT A;  3IWZ A;  4HA8 A;  2Z99 A;  3ZR8 X;  3LQQ A;  1DUX C;  2M4K A;  2L54 A;  2JRM A;  3NEU A;  1B6A A;  3LSM A;  2CQN A;  3S15 J; 
#chains in the Genus database with same CATH homology
 3QU3 A;  2A07 F;  5H6Q A;  1CF7 B;  2TDX A;  5TJJ A;  1CF7 A;  2OAZ A;  2XUB A;  4N9H A;  3C7J A;  2WV0 A;  3BJO A;  1G3Y A;  4ZYG A;  5D6F A;  3DXJ F;  1LDD A;  3F21 A;  2L4A A;  3GVA A;  3ZMZ A;  4MQV A;  4D0P A;  4OIP F;  5LHG A;  1S29 A;  3WGH A;  1RUN A;  4L9T A;  4E70 A;  5ILU A;  1B4A A;  5HOO A;  2H09 A;  3CO7 C;  3HHH A;  1YIO A;  2DPD A;  1KU7 A;  4RAZ A;  4HF2 A;  1ON2 A;  4NB5 A;  1BI1 A;  2P5K A;  4OIN F;  2M87 A;  4N0B A;  4A12 A;  5ERI A;  4HOB A;  4A0X A;  3FM3 A;  3TO6 A;  3KEQ A;  4M73 A;  2ZCW A;  1B59 A;  2IRF G;  2VT2 A;  2HKX A;  2WWY A;  1TQP A;  2HQN A;  2V1D A;  1SFE A;  1LQ1 A;  4AWX B;  4OIQ F;  2HR3 A;  4CO8 A;  4JK1 X;  1QO0 D;  3C18 A;  4BHB A;  5CVV A;  5TRD A;  1JGS A;  3WU0 A;  4UV8 A;  1IZ1 A;  4ASN A;  4EM0 B;  1G3S A;  3E5U A;  4Y13 A;  3OV8 A;  4A0Z A;  2Z3Y A;  2YR2 A;  5JFR A;  2LKP A;  3DFG A;  5JR3 A;  1BIB A;  2P6T A;  3IWF A;  1K79 A;  1W7P B;  2R7F A;  3P9K A;  1W7P A;  1R36 A;  3LQR A;  5E1W A;  4NQW A;  2V1U A;  3EYI A;  3LA3 A;  1QZZ A;  1J9I A;  2VOO A;  1LDK B;  2COM A;  4P96 A;  3O2P E;  5D6E A;  5K5Q A;  1ZRE A;  2FXA A;  2ZXJ A;  2JPB A;  2Z9O A;  1ZLJ A;  4HBL A;  4A5N A;  2EJR A;  2EV5 A;  2A61 A;  4M72 A;  3IC7 A;  3VFZ A;  3V4G A;  3ERE D;  3HHG A;  1YFH A;  3L7W A;  2VOP A;  3O3K A;  5BS6 A;  1W4M A;  1MJ9 A;  1UHM A;  3HRT A;  5HS7 A;  1FPQ A;  2QBY B;  2QBY A;  1HKS A;  5DYM A;  4HV5 A;  1O3S A;  2STW A;  3ZMS A;  3E6M A;  2HTJ A;  5D5X B;  4R1H A;  1F9N A;  1YTY A;  1R5H A;  1T39 A;  4I7H A;  3I0T A;  2VXZ A;  3QU6 A;  3HSE A;  2QZ8 A;  2HDC A;  3I54 A;  4CHU A;  2RC4 A;  1FYK A;  3QOP A;  5LHI A;  2FA5 A;  5L3G A;  4BHC A;  1DPU A;  4U7D A;  1KQ8 A;  2NYX A;  3ZMD A;  2ZFW A;  4HQE A;  3TO9 A;  3BZ6 A;  3MAJ A;  3MFK A;  1T6S A;  2IVM A;  1CGP A;  2V6C A;  5DUK A;  2M1B A;  2QUF A;  4HDV A;  3BWG A;  5FLX Z;  4XLP F;  1ZG1 A;  1HBX G;  3ZP5 A;  2Y0M A;  3HRS A;  4Q47 A;  3KP5 A;  1ZLK A;  3EQL F;  2IA1 A;  2RQP A;  2Y75 A;  4GGG A;  2FBK A;  1KYW A;  2XAF A;  2IA2 A;  5D4S A;  5IT9 K;  1YYV A;  2A3S A;  2E7W A;  5EEH A;  2JRT A;  3BPX A;  1HSJ A;  4O5V A;  3DKW A;  4PDK A;  1MJA A;  4BAY A;  2PBI A;  4LMY A;  4DQ2 A;  4UV9 A;  4R8H A;  5LEJ A;  1REP C;  1O57 A;  4R79 A;  5K5O A;  2DU9 A;  1ZRC A;  2DK8 A;  2L01 A;  4WXH A;  3MWM A;  1R00 A;  2PMU A;  4ESB A;  4XSX F;  4EV0 A;  2A6E F;  3HYI A;  3HOS A;  1OYY A;  2OBP A;  4EVI A;  2E7X A;  3DP7 A;  5FB2 A;  4M9Z A;  2Q0O A;  1J2X A;  3VOD A;  4EM1 A;  1BI3 A;  3M8F A;  1FWZ A;  3WE3 A;  4ENN A;  1XMK A;  2D1V A;  5CYV A;  2ZME B;  2XKO A;  1I27 A;  5KVR A;  3CTA A;  1WKM A;  3LST A;  5DV5 A;  3HRM A;  1BC8 C;  3JAM K;  1LEB A;  5BQT A;  3BPV A;  2IA0 A;  5K1Y A;  1XSX A;  5LHH A;  2STT A;  2XGX A;  4K2E A;  3ZN0 A;  1W7P D;  3TGN A;  1IRG A;  1R7J A;  1UB9 A;  3DQV C;  3VB2 A;  1IN8 A;  4LLN A;  2QQA A;  3GUD A;  4GXO A;  2EWN A;  2OU2 A;  3KP6 A;  1EH8 A;  5A2Q K;  1UST A;  2EFO A;  1USS A;  3CO6 C;  5D5U B;  1W5S A;  4HLY A;  1FZP B;  3D0S A;  2E1C A;  3HSF A;  4UVC A;  2UWM A;  1PP8 F;  1S6L A;  1HQC A;  4HAM A;  4NHJ A;  2QVO A;  2CFX A;  1P4W A;  1ZYR F;  5J6X A;  5BOX A;  4CGZ A;  4CDG A;  4HV6 A;  3WTZ A;  2FBH A;  4YFK F;  4YFN F;  4Q4Z F;  2O6G E;  2M5W A;  1R58 A;  4KT5 C;  3TQN A;  1ZRD A;  2OQR A;  5JVT A;  1XGN A;  3GO5 A;  2RGV A;  2GA1 A;  4U7B A;  5E18 F;  2P6S A;  5K5R A;  2ESN A;  5DDG A;  1W5T A;  3RKY A;  4WXC A;  3F6O A;  3COA C;  2JZY A;  1NHA A;  3LFK A;  3TKY A;  2PN6 A;  1K6O A;  4BNC A;  4JQF A;  1D3Y A;  1O3R A;  4U88 A;  1KU9 A;  3WG9 A;  5LRS A;  1MD0 A;  4G6Q A;  2ZO4 A;  2PMH A;  1V4R A;  4G7O F;  1DP7 P;  3RIR A;  1A04 A;  5HS9 A;  3KZY A;  2HYF A;  1OYI A;  2IPQ X;  3IRQ A;  1QNT A;  2EFN A;  5L3B A;  1LVA A;  1XGS A;  3O6B B;  2M30 A;  2K4B A;  2XAG A;  1I1G A;  2BEO A;  1U5T A;  3ML6 A;  4KN7 X;  3ECH A;  3E5Q A;  3I59 A;  4RS8 A;  3VOE A;  4P9U A;  2E1N A;  1J7K A;  1QGP A;  3JTG A;  1K78 A;  1WQ2 A;  1XDS A;  5ICE A;  1S8N A;  2FML A;  2XRO A;  4IRH A;  5L3D A;  2QEN A;  5LGN A;  2CWE A;  1TQM A;  1Q1H A;  1ULY A;  1DPR A;  5AON A;  4LB5 A;  4OMZ A;  2RVC A;  1SFX A;  4LK0 F;  3V7S A;  5HS8 A;  1H0M A;  1MGT A;  4EJW A;  4ESJ A;  2K02 A;  3ULQ B;  5EEG A;  3ROU A;  4WWC A;  1F1Z A;  3H3Z A;  1G4D A;  1KQ9 A;  2O0Y A;  1IW7 F;  3RKW A;  2QQ9 A;  1YW9 A;  4IRG A;  2LDU A;  2K7L A;  4BHP A;  1XMA A;  1G3T A;  1D5V A;  2JPC A;  4I2O A;  2P5L C;  1P6R A;  4YII A;  3ABU A;  4Y17 A;  1QPM A;  1B9N A;  3J81 Z;  1BI0 A;  3SZP A;  4OIR F;  2MLG A;  2LF8 A;  2P7V B;  3BP8 A;  4L0Z B;  2W25 A;  2DAO A;  1OKR A;  1I1S A;  4MEY F;  3EYY A;  1ZG3 A;  1LNW A;  1J59 A;  5ICG A;  3DEU A;  3WTX C;  4ZYE A;  3QP5 A;  1LB2 A;  4IVN A;  3WTS C;  1BIA A;  4KDP A;  2ETH A;  1HST A;  4HQM A;  2KKO A;  2HOE A;  5E1X A;  1PP7 U;  1FBQ A;  2DQR A;  1O7F A;  1P2F A;  3BOQ A;  2Q8K A;  2A6H F;  3ECO A;  1PUE E;  2GZW A;  2ISZ A;  2P5V A;  1KU3 A;  3GFJ A;  2EK5 A;  1KYZ A;  2PI0 A;  4FT8 A;  3E6D A;  1FBS A;  1TLH B;  2IT0 A;  4GYG A;  1XCV A;  3TDZ C;  1ZG5 A;  1QZY A;  4Q5S F;  1GVJ A;  4YG2 F;  3QPH A;  2RV8 A;  2NS0 A;  2O03 A;  1E2X A;  3CUQ B;  1R5G A;  3KCC A;  4XLN F;  3CUQ A;  2F2E A;  2VC1 A;  1YW7 A;  3FMR A;  2L4M A;  2XIG A;  2EV6 A;  2X4H A;  3R0J A;  3CDH A;  3FX3 A;  2A5Y B;  5FD6 A;  1ZHF A;  4HX8 A;  3GFL A;  1EH7 A;  5L3F A;  1RNL A;  3JSP A;  4O6J A;  3Q5F A;  1HKT A;  2PJP A;  2UXX A;  3BRO A;  4FHT A;  1IXR C;  3JAM Z;  2F5D A;  3FF5 A;  3QPT A;  4EJT A;  4MGR A;  5DUI A;  2O3F A;  3E5X A;  4I02 A;  4L5I A;  2A68 F;  2NRA C;  3J7A O;  2QYO A;  5CVJ A;  1SD6 A;  4BH9 A;  1XGM A;  3ZMT A;  5E8I A;  1TQI A;  4RAY A;  1I6X A;  2AS5 F;  4KIF A;  1XD7 A;  3FZV A;  3F8F A;  4LLL A;  4G9Y A;  5A2Q Z;  2RN7 A;  4CYD A;  1R1T A;  4WXD A;  4H0E A;  6PAX A;  3I64 A;  4TV7 A;  2FU4 A;  3MZH A;  3WTT C;  3MEX A;  2PFB A;  2XAJ A;  2XAQ A;  4OU0 A;  1XDU A;  4PGG A;  1Z7U A;  2L3D A;  1QBJ A;  2MD5 A;  2IP2 A;  2YX7 A;  4MEX F;  3F8C A;  3M7G A;  1FT9 A;  1KA8 A;  2XV4 S;  2KJB A;  4B09 A;  3NQO A;  2W24 A;  4Z2Y A;  3R60 A;  2VN2 A;  1IUY A;  1IF1 A;  2CQK A;  2HZT A;  2M8E A;  3T8R A;  4AIH A;  1U78 A;  3H3U A;  1MKM A;  3KLO A;  2F5F A;  5J8C A;  3B02 A;  1GHC A;  5BMZ A;  5AIQ A;  3QAH A;  3GZ6 A;  1H9G A;  4RGR A;  3HOT A;  2A69 F;  1YS7 A;  1UCR A;  1BN5 A;  2QLZ A;  3KLN A;  4ON0 A;  3TDU C;  4KUM A;  3FWE A;  3GZ5 A;  1OPC A;  2HQR A;  3ZPL A;  1P4A A;  3GEZ A;  2P8T A;  4G8X A;  4XRF A;  2M45 A;  5LEK A;  2ZNZ A;  3J80 Z;  1MJB A;  2R7D A;  2GXG A;  1YG2 A;  2EFW A;  1IAW A;  3MZY A;  1FOK A;  1TW2 A;  1I5Z A;  4KIG A;  1XB4 A;  3B73 A;  2D45 A;  3WTY C;  4L9V A;  4QWQ A;  3P9I A;  4EQQ A;  3IKT A;  5F64 A;  4L0Y B;  4MHG A;  2XAH A;  2BV6 A;  4HX4 A;  2KIM A;  3SZT A;  4LLG F;  2ZBK A;  3F8M A;  5H20 A;  1IN7 A;  5ILS A;  4EGY A;  1BOA A;  2ZME A;  1WSU A;  2VON A;  2HFH A;  2R3S A;  2D2W A;  1KU2 A;  1FSH A;  4G7Z F;  4PZJ A;  1ONV A;  4IHS A;  2DO7 A;  3U1D A;  2NNN A;  3KET A;  5E1Z B;  5FO5 A;  3NRV A;  3K1P A;  3WU1 B;  3KFW X;  1VTN C;  4A2U A;  3F3X A;  1V3F A;  3PFI A;  4ESF A;  4HX7 A;  2DI3 A;  3OOP A;  3PQK A;  1SD7 A;  3EDP A;  4I0B A;  2CSO A;  1SD5 A;  2YU3 A;  1F5T A;  3HRU A;  2PQ8 A;  4UVA A;  3R4K A;  4MQ9 F;  1S7A A;  2GQQ A;  5CLS A;  2VBW A;  2W84 A;  2UXN A;  3GXO A;  2Z5U A;  2P4W A;  3V8J A;  3KE2 A;  1OYW A;  2O61 A;  4RB0 A;  4HF0 A;  2G7H A;  2OA4 A;  2FSW A;  2HEO A;  2YPR A;  1RZ4 A;  2V79 A;  5FFZ A;  2VE9 A;  1R1V A;  1TW3 A;  4ZZL A;  1Z91 A;  5DD4 A;  5FLX K;  3FHZ A;  1TTY A;  2FNP A;  4ENK A;  1LDJ A;  5CVU A;  1BJA A;  3DPL C;  2FNA A;  3RPQ A;  3C1D A;  2J5P A;  3RYR A;  2H6C A;  5D8L B;  4G94 A;  3LWF A;  1U2W A;  4KIC A;  4RB2 C;  2BGC A;  5LLQ A;  5AIP A;  4AIJ A;  2DFI A;  5LRR A;  4PCQ A;  1IN5 A;  2BE5 F;  1FLI A;  2QWW A;  1DDN A;  4KYW A;  1L0O C;  1R1U A;  5L3C A;  1JXS A;  4M6X A;  3T8T A;  4S04 A;  3REO A;  4A6D A;  2Z33 A;  1F4K A;  2J5O A;  1L3L A;  5E17 F;  3T5X A;  3GFM A;  3HUG A;  2EA2 A;  2DBB A;  1P4X A;  1S3J A;  3M1E A;  1U6G A;  3FMQ A;  1ZH5 A;  1YO5 C;  4UNO A;  2MH2 A;  3BJ6 A;  3V8K A;  3I71 A;  2V9V A;  3V7C A;  4YIF A;  2LF7 A;  3SXY A;  2NNY A;  5HVQ C;  2IW5 A;  2H27 A;  3T0Y A;  4ETS A;  4S05 A;  2DPU A;  1XSD A;  5FD5 A;  1AWC A;  5HDK A;  1MDM B;  1J75 A;  1MDM A;  3C3W A;  3CLO A;  2VBZ A;  4KNY A;  3BY6 A;  4GCV A;  2BBY A;  1JE8 A;  2GAU A;  4GYI A;  3W6K B;  4KMU X;  2PG4 A;  2YSR A;  2IJL A;  3GLX A;  2WC2 A;  5JHU A;  3WGG A;  4KMF A;  5J8F A;  1YLF A;  2FMY A;  2YX4 A;  5IT3 A;  2JTV A;  1TNS A;  1IXS B;  5CVI A;  3GWZ A;  5HLH A;  3QRF F;  1SAX A;  4HDU A;  2HKO A;  4EGZ A;  1O3Q A;  1R23 A;  5JI6 A;  4P55 A;  1KGS A;  3RPU A;  4L9N A;  3I4P A;  2XKP A;  1Z6R A;  3F72 A;  4LG0 B;  2OZU A;  2MA3 A;  1ZAR A;  5DEQ A;  4LG0 A;  1R22 A;  2CW0 F;  2NAZ A;  2L02 A;  4A6E A;  1WI9 A;  4IF4 A;  5LGT A;  2MC3 A;  2OZ6 A;  1YS6 A;  2BYV E;  3GFI A;  4CZZ A;  3RI4 A;  1G6N A;  2JSC A;  1QQI A;  4FX0 A;  4AVP A;  4HZF A;  1TBX A;  3CJN A;  1T98 A;  3F22 A;  1SD4 A;  2GWR A;  4CXF A;  1JHH A;  1BC7 C;  3RTR A;  3PQJ A;  1ZGA A;  4CIC A;  4L9J A;  4IHT A;  5IT9 Z;  2UZK A;  2FF4 A;  4OIO F;  3HTS B;  2DLL A;  3LAJ A;  5E8G A;  3ZMV A;  4M9S A;  3TOB A;  4MTE A;  3JTH A;  3F8N A;  4M6Y A;  5HLI A;  1BBY A;  2FQ3 A;  4ZH4 F;  3KZZ A;  3WTV C;  2RKH A;  2KRF A;  4IPA A;  2EB7 A;  4Q48 A;  3ZQ7 A;  3KP4 A;  3T1B A;  3F23 A;  3K1N A;  3EET A;  4I09 A;  3LA2 A;  1YW8 A;  2C6Y A;  1HKQ A;  3SHF A;  5E20 A;  1SMY F;  3K2Z A;  4UVB A;  1S7O A;  4RB3 C;  3IL2 A;  4RGX A;  2K86 A;  4U0Y A;  3I5U A;  2FBI A;  4LFU A;  5BPD A;  1RIO H;  5ICF A;  1ZGJ A;  4IJA A;  1XCB A;  2ESH A;  3RDI A;  2ZNY A;  4GO1 A;  2W85 A;  2RNJ A;  3V8L A;  3WOD F;  1MZB A;  1HW2 A;  3Q9V A;  3E6C C;  3R6S A;  4M71 A;  4AIK A;  4UXN A;  2P7C B;  3WE2 A;  5HLG A;  5L3E A;  1T38 A;  4UUV A;  2QQB A;  3JSO A;  3AAF A;  2XAS A;  1P92 A;  3RKX A;  2JT1 A;  3ABT A;  4BXU A;  3DV8 A;  4F7Z A;  2DT5 A;  1FX7 A;  4EMS A;  3L09 A;  2GIV A;  3MQ0 A;  1U5T C;  3S2W A;  3N4M A;  1X3U A;  1Z1D A;  4U0V A;  5D5V B;  1FP1 D;  4ZYD A;  3Q9S A;  3MCZ A;  4EJV A;  2F5C A;  3SFZ A;  3U2R A;  1ZAO A;  3GYH X;  3IHU A;  1BI2 A;  3M8E A;  3I53 A;  3GX4 X;  1IRF A;  2DK5 A;  3J81 K;  1FYL A;  5LGU A;  2ADU A;  3U9G A;  3V7R A;  1EH6 A;  2HGC A;  3VEP A;  4WX9 A;  4HW0 A;  1ZRF A;  3GW2 A;  1LEA A;  4B8X A;  2Q2E A;  3K1M A;  4O3M A;  3DPT A;  3CUO A;  4I0A A;  1FP2 A;  1GXQ A;  5KK1 A;  2DQL A;  4HF1 A;  3R0A A;  3GF2 A;  4HLX A;  1TNT A;  4LB6 B;  4ENJ A;  3EUH A;  1B9M A;  1ZN2 A;  2MLK A;  4Y15 A;  3WTW C;  4A5M A;  1AOY A;  2H6B A;  2ACJ A;  3ZN1 A;  1GXP A;  3SQN A;  2KIF A;  4WF2 A;  1RI7 A;  3W6J B;  1U8R A;  3E3V A;  4HYE A;  2AXL A;  2VC0 A;  2VOD A;  2DTR A;  1STZ A;  5FFX A;  3E97 A;  2Y48 A;  2CYY A;  2X0L A;  4MTD A;  1BM9 A;  5CJ9 A;  1XN7 A;  2PLY A;  3IRR A;  2G9W A;  3WGI A;  4KIB A;  1WWX A;  1D8J A;  4L5J A;  2FRH A;  4WK8 F;  1KQ0 A;  3FMS A;  1FSE A;  1ODD A;  2EV0 A;  3KP3 A;  4LJZ F;  3KEO A;  1FC3 A;  4N9I A;  5F6F A;  1HW5 A;  3ISP A;  1OMI A;  3FXR A;  4XBF A;  2RDP A;  2VBX A;  3QP6 A;  3HSR A;  5CVR A;  4A0Y A;  5DCM B;  5DCM A;  2GXB A;  3K9T A;  5D8K B;  3ZMU A;  5LBQ A;  1U3E M;  4L18 B;  4YFX F;  1UHW A;  1WRJ A;  3JW4 A;  2EFQ A;  2EFP A;  4JBA A;  1T0F A;  2HS5 A;  3D5L A;  4WCG A;  2CG4 A;  3RJP A;  5HDG A;  4OOI A;  2XRN A;  1K7A A;  3CUQ C;  2ZJ2 A;  3HIF A;  1Z05 A;  2ZKZ A;  1EV7 A;  4U0W A;  4P9F A;  3P9C A;  3I58 A;  3FXU A;  2FEZ A;  3H92 A;  4RGU A;  1Y0U A;  3G73 A;  1J0R A;  2GA2 A;  3IKV A;  5DD8 A;  2KJC A;  4IXA A;  2D1H A;  3R61 A;  5BPI A;  3L9F A;  4UHT A;  4RB1 A;  3E6B A;  4EM2 A;  1OR7 A;  4LK1 F;  1O3T A;  4XSZ F;  1JHF A;  3TO7 A;  3FXQ A;  1T2K A;  4OMY A;  4MNU A;  1G3W A;  3TOA A;  1IN6 A;  2CO5 A;  1XSV A;  2VBY A;  2MH9 A;  4AD9 A;  4I01 A;  4KA4 A;  4DNC A;  5D5W B;  2HWV A;  3ELK A;  4LGW A;  3K0L A;  1HXD A;  4KFC A;  1ON1 A;  2K27 A;  2FOK A;  3BJA A;  3LAP A;  5F1R A;  2VE8 A;  4EJU A;  1LJ9 A;  3N97 A;  4BQA A;  4KN4 X;  4RGS A;  3L00 A;  5H6R A;  1Z6T A;  3M9A A;  3KP2 A;  2KIU A;  3K69 A;  2OD5 A;  1UFM A;  2MBF A;  3J80 K;  1SFU A;  1FNN A;  2DW4 A;  4ZYH A;  4LD5 A;  2HTS A;  4ENM A;  1J5Y A;  5ICC A;  3BDD A;  2XHK A;  1IXC A;  2G7U A;  2ELH A;  2EA4 A;  2FE3 A;  2PEX A;  1FYM A;  3F8B A;  2K4J A;  3HTU A;  4PGH A;  3WTU C;  2CGP A;  2QM3 A;  1O7L A;  4IRI A;  1E17 A;  2W57 A;  3FM5 A;  2B0L A;  1PDN C;  4I98 B;  3G3Z A;  1B1B A;  2LNB A;  4EJO A;  5FGM A;  3F6V A;  2ISY A;  5ILV A;  2H94 A;  1U5T B;  1YQA A;  2WTE A;  5ED4 A;  2XVC A;  5DCF A;  1Z9C A;  3I59 B;  3LA7 A;  4G6D A;  2V1X A;  2VT3 A;  4M9X A;  1D8K A;  2F5E A;  1FY7 A;  5HDN A;  4G7H F;  2LSO A;  3P7N A;  1IN4 A;  4FX4 A;  1K78 B;  3KP7 A;  5D4R A;  3L2C A;  1C0W A;  3DF8 A;  4BYY A;  1RUO A;  2HYG D;  2OQG A;  1FBU A;  1XGO A;  4QLC U;  1H9T A;  3RYP A;  2O8X A;  4P5O A;  4ZZD A;  1HW1 A;  1SMT A;  3IWZ A;  4HA8 A;  2Z99 A;  3LQQ A;  1DUX C;  2L54 A;  3NEU A;  1B6A A;  4M74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...