1LJ9A

The crystal structure of the transcriptional regulator slya
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
144
structure length
144
Chain Sequence
b'TDILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEISQLADYLVRMRKNVSEDWEFVKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator SlyA
publication title Crystal structure of Enterococcus faecalis SlyA-like transcriptional factor
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 54
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lj9A00
3K0LA 4FX0A 4A0ZA 2NRAC 1E17A 1O3TA 5BPIA 3WTWC 4PZJA 2OA4A 2F5FA 2L3DA 2EFQA 2PJPA 2FBIA 3V8LA 1AWCA 3ECHA 2IW5A 2ADUA 3GLXA 1A04A 4LGWA 1SFEA 2KIUA 2YU3A 4M9SA 3QU6A 3TO9A 5FB2A 3F23A 3HRTA 1FYMA 3HIFA 4JBAA 4EGYA 1HW1A 3GZ5A 5CVRA 3VFZA 1FSEA 2FRHA 4XSXF 2F5CA 4YIFA 1CGPA 2YR2A 5DD4A 1ZG1A 1GVJA 3L09A 1R5HA 4KN4X 4Q48A 4BHBA 4P9FA 2HYFA 3TDZC 1YQAA 2BV6A 2NNNA 3ZN1A 2RVCA 5D5XB 4KFCA 3I5UA 1SFXA 2PI0A 2NNYA 2ZJ2A 3V4GA 2XVCA 1K6OA 3JTGA 1HKQA 1V4RA 3EUHA 1FWZA 4LB6B 5DCMB 2GA1A 4UNOA 1T98A 3KP5A 4HLXA 5E20A 2V1DA 5DDGA 1W7PA 2IJLA 2HZTA 2QVOA 5JVTA 2IA2A 3ZMUA 2M5WA 4IRGA 2K86A 1LDJA 1IAWA 1KQ9A 3ZMVA 2W24A 1IXSB 1RUOA 1TNSA 1SMYF 2Y48A 5HDKA 1R7JA 2DQLA 3LQRA 3CO6C 3PQKA 4ZZLA 3M1EA 2CG4A 2STWA 2GXBA 2VONA 4FT8A 5LGNA 3R6SA 4WX9A 5CVJA 1KU7A 1XGNA 4ESBA 4EM2A 2XAJA 5HS7A 5E18F 4BHPA 1R58A 3HTSB 4HX4A 1PDNC 3BPVA 1R36A 4WXCA 4UXNA 1C0WA 1TQMA 3EDPA 2YX4A 3ZPLA 4L5JA 1WRJA 3DKWA 5E1XA 3P7NA 2CWEA 2MA3A 1T6SA 4HQMA 4CO8A 5F64A 5K5OA 2P7CB 4JK1X 2V1UA 4KIGA 2HR3A 4RS8A 4I02A 4EJTA 1YW8A 2P6TA 3JSPA 4UV9A 2RC4A 3LSTA 4ESFA 3ZN0A 1IW7F 4M9XA 5DCFA 2LDUA 1BI1A 3SZPA 3L9FA 3WU0A 3QU3A 1KQ0A 3TGNA 2VC0A 1IN4A 4KIBA 1XGMA 5ERIA 3FMQA 2LF8A 5LHIA 3U9GA 1SFUA 3IL2A 5F6FA 1D3YA 1OR7A 3E6MA 4R1HA 2GA2A 2OU2A 3QP5A 2D1HA 2RGVA 1KU2A 2IA1A 4A0XA 3ISPA 1JGSA 3RPUA 4MQVA 2HS5A 2WV0A 2HDCA 4HF0A 2W57A 1KU9A 3ZQ7A 4ENKA 1JHFA 2RKHA 1T39A 1ZREA 2FMYA 4OMYA 2UZKA 1ZH5A 3B02A 5L3DA 1FYKA 3IWFA 4OOIA 4L0YB 3KLOA 1RIOH 2DAOA 5D6FA 1TBXA 1S7AA 5H20A 3GFJA 2P4WA 5HS8A 2P7VB 3HSEA 5E8IA 2P8TA 2IP2A 2GWRA 1HSJA 2ZFWA 1ZLJA 4I7HA 2PMHA 3BOQA 4MTEA 2FNAA 3C3WA 5JFRA 3O3KA 4HW0A 1XD7A 3WGHA 2TDXA 4R79A 4MHGA 4MEXF 4HOBA 2AXLA 5D5VB 1FY7A 1EH6A 3MZYA 5FGMA 2D45A 3GVAA 1K78A 3KZZA 3E6DA 1U5TA 2OZ6A 2A61A 2DT5A 1I1GA 4LD5A 3TO6A 4ZYEA 2VT2A 1ZG5A 5EEHA 3WTXC 4HX7A 1G6NA 4I2OA 4U0VA 3Q9VA 5D8LB 3IC7A 3SHFA 3E5XA 2HGCA 4S05A 3SXYA 3V8KA 1TW3A 2K7LA 3DPTA 3FM5A 3WTZA 3IHUA 2EV5A 2IRFG 3KEOA 1S8NA 1LDKB 4ZYHA 2JPBA 2WWYA 4ZZDA 5AONA 3T0YA 1MJAA 3LAPA 2D1VA 3TDUC 4MNUA 3K2ZA 4L9TA 4UVAA 2J5OA 2YSRA 1USTA 2XHKA 1T38A 1ZLKA 5L3FA 4HV6A 1IXCA 3WTYC 2OAZA 5BS6A 3DEUA 3R4KA 1IRFA 4L18B 2FBKA 4LMYA 5E8GA 3REOA 1Z9CA 2DW4A 4CYDA 2F2EA 2VBWA 2J5PA 4IVNA 1ULYA 1FBUA 5IT9Z 5DEQA 2FF4A 3F3XA 4LG0A 2JTVA 1U6GA 4EJVA 4RGRA 4G7HF 4OIRF 2XIGA 4UVBA 3JAMK 4L5IA 4WF2A 1XCBA 2IA0A 4A5NA 2Q8KA 1L3LA 4ESJA 5KVRA 3GUDA 3SFZA 4AWXB 1W4MA 5ICEA 1JXSA 2ZNYA 3P9KA 2MH9A 1QBJA 1XGOA 4TV7A 2MLKA 2VODA 3V7SA 1P4AA 4N0BA 1ON2A 4N9HA 1YYVA 2FNPA 3DXJF 1BC7C 2ESNA 1MKMA 2E1NA 1OYYA 3G73A 4P9UA 3PFIA 1YS6A 3MWMA 3GZ6A 5FO5A 3QRFF 5J8CA 2XAQA 2MH2A 1I1SA 1ZN2A 2ETHA 4N9IA 3K69A 3JSOA 2RV8A 2JZYA 3CO7C 3H3ZA 3GX4X 2RN7A 2P6SA 3GFIA 5HVQC 4LB5A 2O0YA 1FZPB 5L3BA 1OYWA 5JR3A 3E3VA 1U8RA 1BI0A 4A6DA 2KRFA 2W84A 3F6VA 1IN6A 4UUVA 2L4MA 4YIIA 2P5KA 1WQ2A 3I4PA 3G3ZA 3C1DA 2O03A 4PGHA 5BPDA 3FMSA 4ZYDA 2F5DA 1MD0A 1CF7A 3FF5A 1ZHFA 3BY6A 3P9CA 2VE9A 4ON0A 3IWZA 4HF1A 1Z91A 3FMRA 1QNTA 2G7UA 3FM3A 1UB9A 3WGGA 2Y75A 1KA8A 3RKYA 4O3MA 1F4KA 3V7RA 3L2CA 5ILSA 1MJBA 4EJWA 3C7JA 3N97A 1ZAOA 4ENNA 3CUQC 4BHCA 1H0MA 4BNCA 4PCQA 2ISYA 2A6HF 4WK8F 2FSWA 4IPAA 1USSA 5HS9A 2W85A 2CFXA 1YW9A 3EQLF 3HUGA 3QOPA 4MTDA 3GF2A 2KKOA 2Z99A 3RYPA 1MDMB 2XAGA 1XDSA 2DU9A 3KFWX 1TQIA 3IKVA 4U88A 4P5OA 2PBIA 2XRNA 3KP2A 4QWQA 5LGTA 1S3JA 5FLXZ 4IXAA 5FLXK 3R0AA 1FSHA 1I6XA 4B09A 4HDUA 1IUYA 2IVMA 3I59A 3CLOA 3MCZA 5J6XA 5DD8A 4EVIA 4P96A 2ZMEB 2LSOA 1U3EM 4Y17A 2XKPA 2R7FA 5AIPA 1ZG3A 1XSXA 5ILUA 1XB4A 5LBQA 1W5TA 4BQAA 5FFXA 3LAJA 4ASNA 2HKXA 2UXNA 2H27A 4GO1A 3QP6A 1LJ9A 1OMIA 4L9NA 3TQNA 5ED4A 1BI3A 1QZYA 5DV5A 3CUQB 1STZA 1WKMA 4IRHA 2L01A 1P4XA 5K1YA 1KYWA 1RZ4A 3SZTA 3L7WA 3D5LA 1EV7A 2M8EA 2V9VA 1BIBA 3F8FA 4DQ2A 4KUMA 1XSDA 4RB3C 5A2QZ 4M6XA 1J7KA 3T5XA 3E5UA 2LNBA 4AD9A 5D5WB 1BIAA 5LRRA 3BZ6A 1Z7UA 2A5YB 1BI2A 2XASA 2ZKZA 3Q9SA 2KJBA 2FU4A 5D5UB 4IHSA 4LK1F 3E97A 3KZYA 2QBYB 5HLIA 4CHUA 4LLLA 3B73A 3F6OA 2EWNA 2ZBKA 3J7AO 3NQOA 1LNWA 1BN5A 2PMUA 3FWEA 3RTRA 2W25A 3I0TA 4U7DA 5L3CA 2Z3YA 2HYGD 1J2XA 4Y15A 3T1BA 5CYVA 1YO5C 4CXFA 2P5LC 2QQBA 1H9TA 2AS5F 3BPXA 1XCVA 1SAXA 2V1XA 2ZXJA 1WI9A 3K1MA 3NRVA 2VT3A 2DPDA 4OINF 2G7HA 3WODF 2EB7A 3KP7A 4ZH4F 1HKSA 1F9NA 1HXDA 3RDIA 5H6QA 4LJZF 1EH8A 4RB2C 3E5QA 3ZMDA 1UCRA 1HW2A 2CO5A 3C18A 2DK5A 5FD6A 5CVVA 3ERED 1O57A 1MGTA 3E6CC 1BM9A 2LKPA 4G6DA 3IRQA 5TJJA 3BWGA 4UV8A 3EYYA 2HOEA 3BJOA 3KP6A 1UHMA 2R7DA 2Z5UA 3DP7A 4KYWA 3EYIA 1B9NA 4I01A 4AIKA 4ETSA 1R23A 1ZYRF 2VN2A 3RI4A 2X4HA 1R1UA 4WXHA 1Z1DA 5D6EA 5H6RA 2O8XA 1LQ1A 1YS7A 3M8EA 4Z2YA 3TO7A 4RGSA 1V3FA 3IKTA 3ML6A 2VBZA 4KMUX 4IHTA 4M73A 3JTHA 4XRFA 4HLYA 2DBBA 3HHHA 2KIMA 3GO5A 1YTYA 1Y0UA 4P55A 4KMFA 1ZARA 1TTYA 5BQTA 5DCMA 1D8JA 4EJOA 3ZMZA 4Q4ZF 3HOSA 5AIQA 2ESHA 2XROA 4OIQF 4G9YA 1R00A 2RNJA 3T8RA 2JPCA 1FBSA 1O3QA 1I5ZA 2VXZA 2XV4S 4YFKF 1J75A 2O61A 5HLHA 4BAYA 4HV5A 4OU0A 3KCCA 3I58A 2HQNA 1ODDA 4M74A 2STTA 1OKRA 3WE3A 2COMA 1LDDA 2PN6A 2L4AA 3WGIA 2DPUA 1S29A 1HBXG 1P2FA 3KP4A 2OQGA 3N4MA 2ZO4A 4O5VA 3BROA 4F7ZA 2WTEA 2G9WA 5HOOA 4E70A 3ZMTA 2EFOA 1P4WA 3VODA 2FEZA 3K1PA 3WTVC 2YPRA 1FNNA 1LEBA 2EV6A 3WTTC 4M9ZA 2HKOA 5ICCA 1TLHB 4IRIA 4IF4A 1XMAA 2GZWA 1TW2A 2E7WA 5IT9K 4NB5A 2NS0A 3FXRA 3M9AA 1DPUA 4FHTA 3BP8A 4EGZA 1U78A 4GXOA 4HBLA 1QQIA 2HEOA 3KETA 3I71A 5E1ZB 1XMKA 3R60A 1W7PB 5HDNA 3VB2A 4G7OF 2Z33A 2DI3A 1FPQA 4ENMA 3KLNA 2L02A 5E17F 1O7LA 4KICA 4RGUA 1SD4A 2M30A 3F22A 4AIJA 3V7CA 5HDGA 1B1BA 4LFUA 1YG2A 1MJ9A 1GHCA 3TKYA 2UWMA 4NQWA 1RNLA 1E2XA 4LLGF 3GW2A 4PGGA 1J5YA 2D2WA 3QPTA 2HQRA 1QZZA 3GWZA 4HYEA 3J81Z 2MC3A 2OD5A 1BBYA 2QZ8A 4KIFA 4KNYA 3U2RA 3CJNA 5LHGA 5D8KB 1FLIA 3BJAA 4XLPF 2VC1A 1DPRA 2DFIA 5ILVA 2JRTA 3K1NA 2YX7A 1D5VA 1O3RA 1SD6A 3HHGA 5KK1A 1K79A 3GFMA 5CVIA 3HSRA 4UHTA 4A2UA 1R22A 2BE5F 4FX4A 2HTJA 3WTUC 3EETA 1AOYA 3HSFA 2XUBA 2GAUA 3RPQA 4O6JA 4HAMA 1B4AA 1XDUA 4L9VA 4WWCA 4MEYF 2V6CA 2KIFA 4CICA 4LK0F 1T2KA 2E1CA 3T8TA 2EK5A 1R5GA 2IT0A 4OIPF 2ZCWA 4M71A 2QYOA 1BOAA 3WG9A 1IZ1A 1FP1D 1BC8C 3HTUA 1FP2A 2UXXA 4KT5C 2K4JA 2H6BA 5LEJA 2A6EF 1Z05A 1O3SA 2XAHA 1FYLA 3LQQA 2FXAA 2FE3A 2BEOA 3J80Z 4BYYA 3GFLA 3HRUA 1KYZA 4I0BA 1SD5A 5ICFA 1J9IA 4M6YA 4RAYA 3IRRA 1G3TA 5K5RA 3F8CA 4XLNF 5D4SA 3ECOA 1IXRC 1U5TC 4GYGA 1ZGJA 2DK8A 1X3UA 2A69F 2CW0F 3W6JB 2FQ3A 2JSCA 3CTAA 2OZUA 2PG4A 2HWVA 2RDPA 2Y0MA 1UFMA 4KA4A 3MZHA 1LEAA 2PQ8A 1REPC 2A68F 5EEGA 3COAC 2LF7A 4Y13A 2QENA 4G7ZF 3PQJA 2EFWA 3RYRA 3V8JA 3H92A 3DPLC 1W5SA 5BMZA 1G3YA 3TOBA 4HF2A 4JQFA 1G3WA 2VE8A 1GXPA 1YIOA 1DUXC 2GIVA 1J59A 1QPMA 5CLSA 4XBFA 1MZBA 3OOPA 4H0EA 4NHJA 4K2EA 1P6RA 3WU1B 4I09A 1K78B 3F8NA 4A5MA 1TNTA 5E1WA 1U5TB 4OIOF 1L0OC 1IF1A 5L3EA 4CDGA 2DTRA 2ELHA 1GXQA 3KE2A 2B0LA 2GQQA 3SQNA 3ZMSA 4D0PA 5A2QK 2H09A 4HDVA 2XKOA 4EM1A 1D8KA 2HFHA 1HW5A 3K9TA 3VEPA 2C6YA 2VBYA 3FZVA 2A07F 4WXDA 1LB2A 3O2PE 4HZFA 2DLLA 3LFKA 1HKTA 5DYMA 2ISZA 1RUNA 1F5TA 2F5EA 2VOOA 1KU3A 2ACJA 4L0ZB 1H9GA 3P9IA 2BBYA 2NAZA 5F1RA 4LG0B 5J8FA 5ICGA 3NEUA 4HX8A 1J0RA 1ONVA 4S04A 1TQPA 4GYIA 3TOAA 2OBPA 3KP3A 5JHUA 2XAFA 3MQ0A 4HQEA 3I53A 4MQ9F 2K02A 1FX7A 2E7XA 2JT1A 1ON1A 2KJCA 3F72A 3FX3A 3DFGA 4EMSA 2M1BA 2IPQX 3O6BB 3OV8A 1YFHA 1S7OA 4AVPA 3AAFA 5K5QA 3F21A 3DQVC 3ELKA 3RIRA 1Z6TA 5BOXA 1BJAA 4DNCA 2VBXA 4EM0B 6PAXA 4OMZA 3GEZA 1SD7A 3BDDA 1HSTA 4U7BA 1MDMA 1G3SA 4LLNA 2QWWA 1IN5A 1EH7A 3R61A 2EFNA 2Q0OA 2MD5A 1Q1HA 1HQCA 3ZP5A 3I64A 2EA2A 3I54A 1PP7U 3H3UA 2Z9OA 3CUOA 3RJPA 3GYHX 2QLZA 2FOKA 1B6AA 4RAZA 3ABTA 2GXGA 2ZMEA 2QM3A 1CF7B 1S6LA 3F8BA 2ZNZA 1NHAA 1O7FA 1R1VA 3RKWA 4U0WA 4L9JA 2NYXA 2O6GE 2PLYA 4IJAA 4G6QA 2FBHA 4EQQA 5L3GA 3QPHA 2EFPA 2K27A 2V79A 2PEXA 4BH9A 1B59A 1U2WA 3ABUA 4XSZF 4G94A 4YFNF 1WSUA 3CUQA 4A0YA 3FXUA 4EV0A 4GGGA 1XGSA 1OPCA 3W6KB 4PDKA 3E6BA 4KN7X 4I98B 1FT9A 1IRGA 5DUIA 2Q2EA 1IN8A 4CGZA 2K4BA 3ULQB 1XN7A 5CVUA 2QQ9A 4R8HA 4Q47A 1JE8A 2CQKA 4YG2F 1XSVA 4CZZA 2MLGA 3QAHA 4ENJA 2EA4A 2A3SA 1DP7P 1VTNC 1DDNA 4MGRA 5LHHA 4I0AA 3F8MA 2HTSA 4B8XA 3Q5FA 2DO7A 1T0FA 3HRSA 4WCGA 1QGPA 2QBYA 3HOTA 3BJ6A 2CYYA 3MFKA 5DUKA 1ZRCA 5FD5A 3I59B 1WWXA 4M72A 4A12A 2R3SA 4Q5SF 5JI6A 3ROUA 1UHWA 1QO0D 2O3FA 1ZRDA 1I27A 4QLCU 3L00A 3M7GA 1KGSA 1LVAA 4KDPA 1IN7A 1FOKA 3JAMZ 5IT3A 1KQ8A 2M45A 5TRDA 5LEKA 1Z6RA 1FBQA 1P92A 2WC2A 2X0LA 3R0JA 3HRMA 2L54A 3LWFA 4G8XA 4RB1A 3RKXA 5LLQA 5D4RA 3J81K 4GCVA 1PP8F 3D0SA 4YFXF 4A6EA 3MEXA 3GXOA 1B9MA 2OQRA 4BXUA 1OYIA 2CSOA 3CDHA 4EJUA 1R1TA 3MAJA 1RI7A 1SMTA 3U1DA 3LA2A 2H6CA 1YLFA 2RQPA 1YW7A 3HYIA 1JHHA 1PUEE 2QUFA 1K7AA 5LGUA 5HLGA 4UVCA 3VOEA 2XGXA 2EJRA 2QQAA 3S2WA 3WE2A 4U0YA 2M87A 5CJ9A 3FXQA 4RGXA 2BGCA 2H94A 4HA8A 2FMLA 3LA7A 2P5VA 3M8FA 3WTSC 3LA3A 4AIHA 2PFBA 2CGPA 2EV0A 3FHZA 3JW4A 5LRSA 4ZYGA 1ZRFA 1F1ZA 3DF8A 2DQRA 2FA5A 4RB0A 1W7PD 3J80K 5FFZA 1FC3A 2BYVE 2VOPA 3KEQA 1ZGAA 2MBFA 1G4DA 3DV8A
chains in the Genus database with same CATH superfamily
3K0LA 4FX0A 4A0ZA 2NRAC 1E17A 1O3TA 2JA5J 1TWAJ 3IAM2 1Z21A 1J09A 4HNTA 5BPIA 3WTWC 3ABMH 1RESA 1B72B 4PZJA 4XNFA 2OA4A 4IHVA 2F5FA 3ZQGA 1UG0A 2L3DA 4NC6A 1WHUA 3JRCA 2EFQA 2PJPA 2FBIA 3V8LA 2XF6A 1AWCA 1X1DA 3ECHA 1JGGA 2IW5A 4XOTA 4V2GA 1FOYA 3RQ4A 2ADUA 3GLXA 1A04A 3ZQQA 4IOCF 3H5AA 1LKXA 3CF5F 1FIAA 4LGWA 1SFEA 3DLLF 2KIUA 2YU3A 2ZSIB 1XMXA 4M9SA 5EDNA 3QU6A 3TO9A 5FB2A 3A01B 4BUPA 3HRTA 3F23A 1FYMA 5F0HA 3OS0A 1T08B 3HIFA 4JBAA 2XSDC 4EGYA 1HW1A 3GZ5A 5CVRA 4XLHA 4B4CA 3OYLA 2DA6A 1R49A 3VFZA 3AG2H 1FTTA 1FSEA 2FRHA 4M3GA 4XSXF 1BA5A 2F5CA 4YIFA 5J1YA 1CGPA 2YR2A 5DD4A 2ZB9A 1ZG1A 1GVJA 5J4VA 4BGDA 3DBLB 2QA4I 3L09A 2R93J 2R7XA 1R5HA 3C2BA 4KN4X 4Q48A 4BHBA 3JRDA 3IH3A 4P9FA 2HYFA 2Y30A 3HGYA 3TDZC 4Y3OA 1YQAA 2BV6A 1YRNA 2NNNA 1QZEA 3ZN1A 2RVCA 4C9YA 5D5XB 4BDYA 4KFCA 3I5UA 1SFXA 2PI0A 3RZOJ 2NNYA 2ZJ2A 1D0XA 3V4GA 1PVEA 2EH3A 2XVCA 2OCCH 1K6OA 3JTGA 1HKQA 3JRIA 3KYDB 1WH5A 2BY1A 1WJAA 1V4RA 3EUHA 1FWZA 4LB6B 5DCMB 2GA1A 2OTJI 5EEAA 4UNOA 1T98A 2OC6A 3KP5A 4HLXA 5E20A 2H1LA 2V1DA 1EF4A 4P1WA 5DDGA 3BLYA 1W7PA 2IJLA 2HZTA 4L5EA 2QVOA 1VQOI 4KITB 1LFBA 2BY3A 5JVTA 2IA2A 3ZMUA 2M5WA 2R7VA 3HM5A 4F55A 4IRGA 2CUZA 2K86A 4XQFA 1POGA 3CP2A 1LDJA 1IAWA 4XRSA 4XL9A 5F08A 1KQ9A 1SEUA 1AKHB 3QPLA 2KP6A 3ZMVA 2K3FA 1Y1WJ 5BNGA 4B1RA 2W24A 2NVQJ 3FXKA 1IXSB 1RUOA 3G1LA 1K83J 3WHBA 1TNSA 1QRYA 1SMYF 1V5FA 3HB9A 3FK7A 2LK2A 2XGDA 2Y48A 5HDKA 1WZ2A 2IS2A 3CQZJ 1R7JA 2DQLA 3LQRA 5F0CA 3K7AJ 3CO6C 3E7LA 5J1UA 3H35A 3PQKA 2ZXWH 3DBRB 3M1EA 3IP4B 4ZZLA 4XN0A 2CG4A 2VPRA 2STWA 1BR4A 2GXBA 2VONA 2IXSA 2PJRB 4FT8A 5LGNA 3R6SA 2V26A 4WX9A 4FQGA 5CVJA 1X4OA 1KU7A 1XGNA 1VQLI 2HYJA 4ESBA 4RLQA 4EM2A 2XAJA 3CF2A 1ZTRA 5HS7A 5E18F 2CUFA 4BHPA 1R58A 2JVHA 3HTSB 4HX4A 1PDNC 1MMSA 4HG2A 2VPLA 3BPVA 1R36A 4WXCA 1WVRA 4PFOA 4UXNA 2NS8A 4I76A 4RBOA 1TQMA 1C0WA 4GRIA 3EDPA 3WU2C 4DGWB 5IP6A 4XORA 3JCUC 2YX4A 1VQMI 3K70C 1R4MB 2LREA 2VQHA 3ZPLA 1Y8QB 1WRJA 2FQ4A 4L5JA 5J4YA 3DKWA 1N25A 1T95A 5E1XA 3V42A 3P7NA 2XSJC 3IV5A 4BDZA 3BG6A 2M4KA 2X1DA 2CWEA 2MA3A 3A2KA 1T6SA 4HQMA 4CO8A 5F64A 5K5OA 2X9DA 2DYRH 1WJFA 3EPZA 2LG4A 2P7CB 2KZVA 5FLVA 4JK1X 2W4SA 1FOWA 2V1UA 4KIGA 2HR3A 1MH3A 2ID6A 4A3IJ 4RS8A 4I02A 1YITI 4EJTA 5FRMA 1YW8A 2P6TA 3JSPA 4UV9A 2L9SA 2RC4A 3LSTA 4ESFA 3ZN0A 1RETA 2LY1A 1IW7F 4M9XA 5DCFA 2LDUA 1BI1A 3SZPA 2LFBA 3L9FA 4XRMA 3WU0A 3QU3A 2MW8A 1KQ0A 3LSGA 3TGNA 2VC0A 5FKKA 1IN4A 4NQWB 1WI3A 3D5SC 2L7MP 4KIBA 4B3XA 4X0GA 3K2AA 1XGMA 5ERIA 3FMQA 2LF8A 2MSYA 5LHIA 3U9GA 1SFUA 3IL2A 1X2NA 5F6FA 1D3YA 3VWBA 1OR7A 1A36A 3E6MA 1GV2A 2KHMA 4R1HA 1T8IA 3CC2I 2GA2A 2OU2A 3QP5A 3K4BA 2E2HJ 1D1AA 1OCCH 2D1HA 2QKLB 2RGVA 4AU7A 3S16J 3IAS2 2KDOA 1KU2A 4RAFA 3S32A 3ABLH 2IA1A 4A0XA 4F92B 3ISPA 1JGSA 3RPUA 1E3PA 4MQVA 2KRCA 2HS5A 3MMYB 2D5VA 2WV0A 1P7JA 2HDCA 1ORKA 1JUMA 3DLAA 4HF0A 2W57A 1KU9A 3ZQ7A 4UB6C 4ENKA 1JHFA 2RKHA 1BJZA 4PSWA 3ZCOA 1T39A 1JKQC 1R6RA 4G12A 1ZREA 2FMYA 4A3MJ 4OMYA 3OYJA 1ZK8A 2UZKA 3B02A 1ZH5A 2LY9A 5L3DA 1FYKA 4S0HB 4IO9F 1HDPA 3IWFA 4C2MJ 2Y9ZA 4OOIA 4E7KA 1IV8A 3CCYA 2HZDA 4DIQA 4L0YB 1LVKA 3KLOA 1RIOH 2DAOA 1IJWC 4RM3A 2XC7A 5GTIC 3HOUJ 5D6FA 1TBXA 1S7AA 5H20A 3H5NA 3GFJA 2P4WA 1BW5A 5HS8A 2P7VB 2JUGA 4XOPA 1OCZH 2BXZA 3AG4H 2V4JC 3QYEA 2E60A 1ETXA 3HSEA 4W1UA 5E8IA 2P8TA 4NUBA 3I56I 1EKEA 3HKZN 1A5JA 4EATA 2IP2A 2HVRA 2GWRA 4W97A 1HSJA 1OCTC 1TWCJ 2ZFWA 1ZLJA 3ERMA 4FISA 4I7HA 1BR1A 3J7YJ 1VI0A 2PMHA 3DKXA 1YJWI 3BCBA 3BOQA 4MTEA 2OPTA 2FNAA 1FJLA 3G2BA 2ME0A 2XAUA 3LSMA 3C3WA 5JFRA 3O3KA 4HW0A 1XD7A 3S2DJ 3WGHA 2CV2A 2TDXA 1TT0A 4AYBN 4R79A 4MHGA 2QF7A 2Y2ZA 4MEXF 4HOBA 3UKGA 1W36D 2KISA 2AXLA 5D5VB 2F48A 1FY7A 1EH6A 3MZYA 5FGMA 2D45A 3GVAA 1K78A 1NH3A 3KZZA 2WB1N 3E6DA 4IQ4A 3L1PA 1ZKGA 4XRSG 1U5TA 2DA4A 2OZ6A 2A61A 2QKMB 1QHHD 2DT5A 1I1GA 3ZOBA 4LD5A 3TO6A 3TEDA 4A3BJ 4A93J 4ZYEA 1YOVB 2VT2A 3H36A 4JP0A 1ZG5A 1ACIA 5GPAA 5EEHA 3ZQLA 3WTXC 3Q0UA 4HX7A 1G6NA 4I2OA 4CYCA 4U0VA 4E7IA 4CH7A 3Q9VA 5D8LB 2HDDA 3IC7A 3SHFA 3E5XA 2HGCA 1IGNA 4S05A 4BQQA 3SXYA 3V8KA 4AVZA 2AQFA 1TW3A 1BOBA 2BY0A 2K7LA 4XMYA 3DPTA 2Z2SB 2Z16A 2ZSHB 3BTJA 3FM5A 3WTZA 2KLOA 3IHUA 2EV5A 2IRFG 3VYSB 3KEOA 1S8NA 1LDKB 4ZYHA 3ZRGA 3QPSA 4KISA 2JPBA 2WWYA 4ZZDA 5AONA 3T0YA 3BR0A 2XRLA 1MJAA 4CCKA 2D1VA 3LAPA 2VUMJ 1WJ5A 3TDUC 1OLTA 4MNUA 3K2ZA 4L9TA 2DT7B 3TW6A 4UVAA 3BR3A 4A3KJ 4IHWA 2J5OA 2YSRA 2ELJA 1USTA 2XHKA 4M3FA 1T38A 1ZLKA 5L3FA 4HV6A 2DMUA 1IXCA 3WTYC 3K4MA 2OAZA 2QSGX 5BS6A 3DEUA 5K7FA 3FXJA 1IRFA 2CH0A 2JN6A 2FBKA 2K85A 3R4KA 4LMYA 5J47A 3HDDA 5CQEA 5E8GA 2W82A 3REOA 2PMZA 1Z9CA 2DW4A 3K70D 1I50J 2X48A 4CYDA 2F2EA 2VBWA 2J5PA 2Y0SA 2DXIA 4IVNA 5GAHJ 1HA8A 1ULYA 2R5YB 3Q0VA 1FBUA 5IT9Z 4BY7J 1IDYA 2COBA 5DEQA 2R7QA 1P7IA 4ZTJA 2FF4A 4G6TB 3F3XA 3LMMA 4LG0A 2JTVA 2LKXA 4M3DA 1HDDC 3LSJA 1U6GA 2CW7A 3I9V2 4EJVA 4RGRA 2X6WA 3GCMA 4G7HF 4OIRF 1NK3P 4M3BA 1Z67A 1X1PA 2XIGA 3A03A 2HOSA 4UVBA 3JAMK 3CCRI 4L5IA 4OAYA 4WF2A 1XCBA 2IA0A 1FMVA 4A5NA 2Q8KA 2GOMA 2JWTA 1MMNA 3CCSI 1L3LA 2W48A 4ESJA 5KVRA 3KYLA 3GUDA 3B6AA 2DMPA 3SFZA 4AWXB 1E3HA 2E1MB 4MIMA 4NC8A 5JLXA 1DQUA 1UJ8A 1Y6IA 1W4MA 5ICEA 3OYMA 4DJAA 2DN0A 2RAEA 2QSFX 1VFCA 1JXSA 2X6XA 2ZNYA 3P9KA 2MH9A 2M3AA 1QBJA 1XGOA 3ESWB 1X1AA 4TV7A 3SYTA 2MLKA 3KZIC 1VQKI 3V7SA 2VODA 1P4AA 4N0BA 3PIPF 1ON2A 4N9HA 2K9MA 1YYVA 2FNPA 1LFPA 3DXJF 1BC7C 2ESNA 4BE2A 3GMEA 1MKMA 2E1NA 1OYYA 3G73A 4P9UA 3PFIA 1YS6A 3MWMA 3GZ6A 1YI2I 5FO5A 5CKTA 3QRFF 1YJ9I 3PO3J 3OSGA 2R5ZB 5J8CA 2FD5A 2XAQA 2OTLI 3S8PA 4AIDA 2XF7A 3OS1A 2JQ7A 2MH2A 4MFDA 1I1SA 1ZN2A 4JYKA 2ETHA 2V9KA 1SC7A 3J7AY 2NVTJ 1NG7A 4N9IA 3BG9A 5B1AH 3K69A 3JSOA 2RV8A 3ZXSA 2JZYA 3CO7C 3TL4X 3H3ZA 3GX4X 2RN7A 2DJIA 2P6SA 5HVQC 3GFIA 4LB5A 4QTRA 2O0YA 4MO7A 2WAQN 1FZPB 2EILH 1YHQI 5L3BA 1OYWA 2VI6A 3PSIA 5JR3A 3E3VA 1U8RA 3CDLA 4A3JJ 2LY2A 1BI0A 2DFEA 2QEXI 3U21A 4CCLA 4A3DJ 4A6DA 2KRFA 2W84A 4UUSA 3F6VA 4XLAA 1IN6A 3S1NJ 4UUVA 4CZCA 2L4MA 4YIIA 3VSKA 2P5KA 1WQ2A 3I4PA 3G3ZA 3OYFA 3C1DA 2O03A 4PGHA 5BPDA 3FMSA 4DZPA 5CPRB 4YRVA 4ZYDA 2F5DA 3JRBA 3HL2A 2ZJQF 1MD0A 5HNHA 1CF7A 3FF5A 2BW3B 1ZHFA 3BY6A 3P9CA 2KQRA 2VE9A 4ON0A 2BVMA 3IWZA 2JA2A 5B1BH 4HF1A 4ZDPA 1Z91A 2VJ4A 3FMRA 1QNTA 2G7UA 5K7HA 3FM3A 2MG4A 1UB9A 2QQ8A 3WGGA 3CC4I 2PX9A 2CU7A 1MMAA 2HDWA 5EYRA 4E7HA 2HQ5A 2Y75A 1KA8A 2VJJA 3RKYA 2WAEA 4O3MA 3CDIA 2WAFA 2R92J 2VQGA 1F4KA 3V7RA 3GTQJ 3L2CA 5ILSA 2XF5A 4DBRA 3CMEI 1VQ9I 1OJLA 1MJBA 3VYRB 4C2UA 4QPOA 5H2FC 4GDFA 4EJWA 3C7JA 3N97A 1ZAOA 4ENNA 2IAIA 3K4JA 3CUQC 4BHCA 3ASNH 1H0MA 4BNCA 4PCQA 2ISYA 2A6HF 5KCMA 4WK8F 1G8XA 2FSWA 4IPAA 1USSA 3G1MA 1YE9A 2W85A 5HS9A 2CFXA 4Y7NJ 2L7ZA 1YW9A 2V6EA 3EQLF 2V7FA 3HUGA 4E4HA 3QOPA 4MTDA 3GF2A 3OY9A 2KKOA 2DA5A 2I10A 5M3MJ 2Z99A 1VQNI 2LBFB 2K5CA 2LVSA 4BJ6C 3BT9A 3DBHB 3RYPA 3OYKA 2F4IA 2XAGA 5HODA 1MDMB 1XDSA 2DU9A 3KFWX 2VKEA 4ZJZA 2JVGA 2KZGA 2X51A 1TQIA 4D7MA 3IKVA 4U88A 4P5OA 3K6GA 2PBIA 1AU7A 2XRNA 3KP2A 2W00A 4QWQA 4BQNA 5LGTA 1Z3XA 5F27A 2B7EA 3BG7A 3CCUI 1S3JA 1MBGA 1V5GA 5FLXZ 4IXAA 3PJRA 4RAGA 2WY8Q 5EGOB 4HNVA 1MBHA 5FLXK 3R0AA 4J19A 1FSHA 1I6XA 4B09A 1T0FC 4HDUA 1RR8C 3KX2A 1IUYA 4X6AJ 2IVMA 3I59A 3CLOA 3F0CA 3MCZA 5J6XA 4C3HJ 3OMYA 5DD8A 4XIDA 1BL0A 4EVIA 5JVGF 4P96A 3U1KA 2ZMEB 2R7UA 3GTKJ 2Q1ZB 2LSOA 2BZTA 1U3EM 1X4PA 2O7OA 4Y17A 2XKPA 2R7FA 5AIPA 2M2EA 2DA7A 4XLFA 1ZG3A 4CA0A 1IUFA 1XSXA 1Z77A 5ILUA 1XB4A 4PJMA 2EZIA 4D1QA 5LBQA 1W5TA 4BQAA 5FFXA 2ME6A 4A3LJ 3LAJA 4ASNA 2HKXA 3GTOJ 2UXNA 3KEYA 1PJRA 2H27A 4B47A 1AA7A 5C44J 4GO1A 3LSPA 1DGRM 3QP6A 1FMWA 1LJ9A 2HOTA 1OMIA 2JA6J 4L9NA 2QCOA 4ITVA 3TQNA 1ETKA 5ED4A 1BI3A 3CMAI 1QZYA 3VPRA 5DM6F 5DV5A 5EJCA 3CUQB 1STZA 2DMNA 1WKMA 4XKBA 2LP0A 4IRHA 2L01A 2IEKA 4LIUA 4HRIA 1P4XA 1VQPI 4IKFA 1ETWA 1SVMA 5K1YA 3S93A 1KYWA 1RZ4A 3SZTA 3VDXA 2Q2EB 3L7WA 3D5LA 4HSTA 1EV7A 2M8EA 2V9VA 2R7WA 1BIBA 3F8FA 2VQCA 4PJJA 1D1CA 1MNDA 4DQ2A 4KUMA 1XSDA 4F3QA 4RB3C 2DOFA 2LD5A 3FBNB 5A2QZ 4M6XA 1A35A 1J7KA 3T5XA 3E5UA 2LNBA 2CV1A 2CV0A 1XC5A 1GDTA 4AD9A 1SANA 3HJEA 2MFZA 4DBQA 1D0YA 2M7AA 1BIAA 5D5WB 4BE1A 4PJNA 5LRRA 3BZ6A 1Z7UA 1MMGA 2A5YB 1BI2A 3O8HA 4BXFA 4IOAF 2XASA 2ZKZA 3Q9SA 4DYRA 2BY2A 2KJBA 2FU4A 5D5UB 4IHSA 2CS3A 3E97A 4LK1F 3KZYA 1OISA 2ZXIA 2QBYB 1S72I 5HLIA 2X1CA 4CHUA 4LLLA 5EG0B 4GFBA 2R7TA 1YX3A 3B73A 2XPVA 3F6OA 4IQJA 2EWNA 2ZBKA 3J7AO 3NQOA 1LNWA 3ZGKA 1W0UA 4DW6A 1BN5A 2PMUA 3FWEA 3RZDJ 1QVTA 3MKWB 2AO9A 3RTRA 5LD2C 2W25A 2X6YA 3I0TA 4U7DA 1UAAA 1PUFB 5L3CA 2Z3YA 2XGCA 2HYGD 4IHXA 4XK4A 3JRGA 1J2XA 4Y15A 3T1BA 5CYVA 3ONQA 2H8RA 4B44A 3QOEA 1YO5C 4CXFA 2EIJH 2P5LC 2QQBA 1H9TA 3M4OJ 2AS5F 3OSFA 2JK3A 3BPXA 1XCVA 1DGWY 3J7ZI 1I39A 2WBMA 1SAXA 1ERDA 1Z7LA 2AXTC 3RKQA 2IS6A 1X3ZB 2V1XA 2ZXJA 1NTCA 1WI9A 3K1MA 3OYDA 3NRVA 2VT3A 4CCNA 3RSNA 5B3SH 1I6HJ 4BKXA 2DPDA 3BZCA 4OINF 2G7HA 4E7ZA 3I3LA 3WODF 2EB7A 3OYGA 4YEJA 1HCRA 1VQ5I 3S1RJ 3KP7A 4ABZA 1BW6A 4ZH4F 4OAZA 1HKSA 4F91B 3S1QJ 1F9NA 1HXDA 4J00A 2LLKA 4BEHA 3RDIA 3MKYB 2OV7A 2ELKA 5H6QA 3SFIA 3OIQA 4LJZF 1EH8A 4RB2C 3E5QA 4DYQA 3GTMJ 4CSWA 1LE8B 1TT5B 3ZMDA 1UCRA 1X58A 1IRXA 1HW2A 3BR5A 2GM4A 2YU9J 2CO5A 3C18A 2DK5A 2CQXA 5FD6A 5CVVA 3ERED 4PJ0C 1O57A 4C30A 3TW7A 1MGTA 3E6CC 1BM9A 2LKPA 4G6DA 3IRQA 5TJJA 1B72A 3BWGA 4UV8A 1WCMJ 5IP7J 1ITYA 3KPHA 3EYYA 2WV1A 3SEQA 3I55I 3OL3A 1B8IB 2HOEA 3BJOA 3KP6A 4D9JA 1JT0A 1UHMA 2R7DA 2G0EA 3PM1A 4BBSJ 5J3LA 1K61A 1X1CA 2Z5UA 2IS1A 3DP7A 4KYWA 5K7ZA 3EYIA 5DTDA 1B9NA 4I01A 2FX0A 3A01A 1UELB 3DKYA 3L2WA 4AIKA 4ETSA 4II3A 5C3EJ 2MGQA 3HXLA 1N75A 2O8KA 1RKWA 2RNGA 5TISC 5FKNA 1R23A 1ZYRF 2VN2A 1U9NA 3RI4A 5KHDA 3OWTA 2X4HA 3GTPJ 1R1UA 1NG6A 4NBQA 5EZGA 4WXHA 1Z1DA 2XDVA 3CCLI 2KIQA 5D6EA 5H6RA 2R7SA 3MVPA 3BR2A 3ZQFA 1HOMA 2O8XA 4UB8C 1LQ1A 1YS7A 3M8EA 4Z2YA 3RQIA 1IRZA 3TO7A 4RGSA 4XKVA 2GIZA 3FBIB 1V3FA 1TL8A 3HOWJ 3IKTA 1YJNI 1MH4A 2CMPA 4M3EA 4I6ZA 3ML6A 2VBZA 3LL7A 4KMUX 2KFDA 1AHDP 2A5WA 2IGOA 2ZC2A 1MBFA 3VSLA 2M9HA 4IHTA 4M73A 3JTHA 4XRFA 4HLYA 2YUSA 2DBBA 3HHHA 2KIMA 3GO5A 3ASOH 1YTYA 1WH7A 1Y0UA 4P55A 4KMFA 1ZARA 3JRFA 1W0TA 4BU2A 1Y0NA 1OFCX 2RQQA 3TP0A 5GTHC 1D5YA 2JA7J 1TTYA 5BQTA 2CFOA 1TC3C 4NDLA 5DCMA 1D8JA 4EJOA 3ZMZA 5KNLA 3DTEA 2F4MB 4Q4ZF 1IG7A 3HG9A 3HOSA 1QA6A 3EUHC 4RDUA 5AIQA 2ESHA 3OS2A 2XROA 4OIQF 4G9YA 3WHCA 2JSPA 1R00A 2RNJA 1K4TA 3T8RA 3S14J 2JPCA 3HZJA 3A0BC 1FBSA 1O3QA 1I5ZA 2VXZA 2XV4S 4YFKF 1J75A 2O61A 1VQ7I 4I99C 5HLHA 4BAYA 3PO2J 4HV5A 4OU0A 2LMDA 3KCCA 2DA1A 2E1MC 4ZC3A 3I58A 2HQNA 1AKHA 1ODDA 4M74A 2STTA 2DYSH 1OKRA 2EBIA 3WE3A 2COMA 2F5VA 1LDDA 3S3OA 2JJ7A 2JUCA 2PN6A 4Y52J 2L4AA 3H5RA 3WGIA 1IC8A 2DPUA 4A3CJ 1S29A 1HBXG 1P2FA 3KP4A 2OQGA 4QSHA 1R5ID 3N4MA 2ZO4A 3LSRA 3H0DA 4O5VA 3BROA 4F7ZA 4II2A 4UUTA 2WTEA 2G9WA 1TWGJ 3ZMTA 2EFOA 1P4WA 3VODA 4E70A 5HOOA 2FEZA 3TMOA 3MKZA 2PJRA 3K1PA 4B43A 3WTVC 3BC8A 2YPRA 1FNNA 5GAEJ 1LEBA 1TWFJ 3CCEI 1WJEA 2EV6A 2XPWA 4HSRA 3KYCB 3WTTC 1WFXA 3FKJA 4M9ZA 3L2UA 2DOEA 3L2VA 2HKOA 2IS4A 5ICCA 3LSHA 1I3QJ 1TLHB 4IRIA 3L2QA 3ZQIA 3QWLA 3PFYA 2CQ7A 4IF4A 3OYNA 4KT6A 4AM3A 3DTKA 1XMAA 1YRNB 2GZWA 1TW2A 1APLC 2E7WA 5IT9K 4D7NA 3UR3C 3ZR8X 3NAUA 4NB5A 5IP9J 2NS0A 3H9JA 2L2OA 3FXRA 3VYTB 2R7ZJ 3M9AA 2X85A 1DPUA 2M8GX 4Y4RA 2PMZN 4FHTA 3BP8A 4IX7A 4EGZA 2IBDA 4GXOA 4HBLA 1U78A 1QVUA 1QQIA 2HEOA 2Y0SN 3I71A 3KETA 1FIPA 1R71A 2NVUB 1VF9A 1YX5A 5E1ZB 1XMKA 3R60A 1JTXA 1W7PB 2Z1DA 5HDNA 4CCJA 1EA3A 5M5YJ 2ECCA 3VB2A 4G7OF 2TRTA 2Z33A 2DI3A 2K40A 3OR2C 5M3FJ 1FPQA 4ENMA 2W1OA 2M7BA 1P9QC 2BOLA 3KLNA 2L02A 1TZLA 1O7LA 5E17F 4KICA 3K4NA 2DTZA 3NWSA 4RGUA 1SD4A 2M30A 2E1OA 3H9QA 4ZTFA 5IOYA 1MBJA 1Z0XA 3DWLE 1E3OC 1OCRH 2HOAA 3F22A 4AC0A 3V7CA 4AIJA 5E3OA 5HDGA 1B1BA 5DS9A 3HOZJ 1HC8A 4LFUA 1YG2A 1MJ9A 1GHCA 2MYSA 3TKYA 2UWMA 2QSHX 2ZFUA 4NQWA 1RNLA 1E2XA 2FOWA 2KRHA 4LLGF 2OJED 4HPQA 4RA2A 5EF6A 1M1EB 3GW2A 3BZKA 2YS9A 4PGGA 3JREA 1JKOC 1J5YA 2DDAA 1OQYA 3C2GA 3O8GA 2D2WA 3QPTA 2HQRA 1OR7C 1QZZA 3GWZA 4HYEA 3J81Z 1RR7A 2LKSA 2MC3A 3CCMI 2M0MA 2OD5A 1G59A 3G4SI 1BBYA 2QZ8A 4KJZA 4PSXA 4KIFA 4KNYA 3U2RA 3CJNA 1WPKA 1LPQA 5LHGA 2ZJRF 4IZZA 5D8KB 3I4NJ 1FLIA 3M8JA 4RMNA 3JRAA 3BJAA 3PIOF 3E0JB 3FXOA 4XLPF 2VC1A 1DPRA 3EUKL 2E2IJ 2L9VA 1B8IA 2EZKA 2DFIA 2JRTA 2KMUA 5ILVA 5FRNA 4JX6A 3K1NA 2YX7A 2L7KA 1D5VA 1O3RA 1SD6A 2WA0A 3HHGA 5KK1A 1K79A 3GFMA 1ETVA 5CVIA 3HSRA 4UHTA 1K4SA 4A2UA 2L0KA 5IYBJ 1R22A 2BE5F 4FE7A 2HTJA 4FX4A 2E2JJ 3ABKH 3EETA 3WTUC 1AOYA 4ZDOA 4IEJA 3HSFA 2XUBA 3HOXJ 2Y31A 5E3MA 2GAUA 1V5EA 3RPQA 4O6JA 4HAMA 1O4XA 1B4AA 1XDUA 4L9VA 2A05A 4MEYF 4WWCA 2V6CA 2KIFA 4CICA 4UY8I 2O5RA 4LK0F 3CD6I 4MFEA 1XG1A 1T2KA 2E1CA 2B63J 3T8TA 1ZELA 3S15J 2EK5A 1SFKA 1R5GA 3PUFA 2IT0A 4BY1J 2DA2A 3PSFA 2EINH 4OIPF 3FK6A 2ZCWA 4M71A 3MZ8A 2QYOA 5HLTA 1FTZA 1BOAA 3WG9A 1IZ1A 3FHNA 1LFUP 1FP1D 1BC8C 3HTUA 1FP2A 2IGMA 2ZMEC 2UXXA 4KT5C 4LITA 2K4JA 2H6BA 5LEJA 2A6EF 1Z05A 3X2QH 1O3SA 1RRJA 2XAHA 1FYLA 2HXOA 3LQQA 2FXAA 2FE3A 2Y69H 2BEOA 1T56A 3J80Z 4BYYA 3GFLA 3HRUA 2F6CA 1KYZA 4C3JJ 2K9SA 3DTIA 4I0BA 1SD5A 3HOVJ 5ICFA 1J9IA 1IDZA 4M6YA 2OUMA 4RAYA 3IRRA 1VZ0A 1G3TA 1RKTA 5K5RA 3F8CA 3H1CA 4XM3A 4BJ5C 2BHYA 3S2HJ 4XLNF 5D4SA 3ECOA 1IXRC 1U0JA 1W1WE 4QPQA 1U5TC 3G1OA 2L5QA 4GYGA 4N4OB 2VKDA 2R7OA 1ZGJA 3FIWA 5EZHA 2DK8A 1H89C 1X3UA 2A69F 2CW0F 3W6JB 3CMYA 3W2VA 1RC9A 2FQ3A 1PYVA 2JSCA 3CTAA 1SVOA 2OZUA 1GLNA 3ZQCA 2PG4A 3IH4A 2HWVA 2RDPA 3H9GA 3LOCA 1ETOA 2Y0MA 1UFMA 3NARA 2LTPA 4KA4A 3MZHA 1LEAA 2PQ8A 1REPC 1A6QA 2A68F 2CJJA 5EEGA 1A31A 3TBIA 2NVYJ 2JMWA 3FISA 3COAC 1JKRC 3HEFA 2LF7A 4DOZA 3CJRB 4Y13A 2QENA 3MN2A 4XONA 3GTLJ 4G7ZF 2ID3A 4A3EJ 3PQJA 3LSIA 2EFWA 1DU0A 3RYRA 3V8JA 3H92A 1ENHA 3DPLC 1E0EA 3IH2A 5CQGA 1W5SA 2VJ5A 2DCEA 5BMZA 1Y39A 3OIPA 3D1NI 1MBKA 1G3YA 4HEA2 1BR2A 3TOBA 4HF2A 3P5JA 1F43A 4OWRB 3OIOA 1IV6A 1X1BA 2P0WA 4JQFA 2LRDA 1U8BA 1G3WA 2VE8A 1GXPA 1NK2P 4V2FA 5IYDJ 1D0ZA 2GBYA 2BXYA 2IGKA 4NC7A 4XICA 1YIOA 2R5YA 1DUXC 2GIVA 1N77A 4BACA 1J59A 1QPMA 3GZNB 5CLSA 4XBFA 1MIJA 1MZBA 2AHQA 3A4CA 3OOPA 3BG5A 4H0EA 3AG1H 4NHJA 3S3MA 2HVQA 2DOAA 1IO2A 4K2EA 1P6RA 4F93B 1A6IA 3WU1B 3W6VA 3M3YJ 2XPUA 4L18B 4I09A 1K78B 1Z3YA 3F8NA 1MW7A 4YELA 4A5MA 1TNTA 1WGXA 5KAFC 3RCOA 5E1WA 1S5LC 5E3LA 1U5TB 4OIOF 1L0OC 1HF0A 3DPUA 4IL6C 1IF1A 1W36C 5L3EA 4FCYA 2I5UA 2OF7A 5HNFA 3AG3H 4CDGA 2CQNA 2M34A 4MLOA 2K9QA 2DTRA 1QU3A 2E34A 5FKLA 2ELHA 4CYCB 3S17J 1GXQA 4JOMA 5FKMA 5F1JA 5C4JJ 3KE2A 2B0LA 5B66C 4FE4A 3CMMA 2GQQA 2OCEA 3KIOA 3S3NA 4BL0B 5J1RA 3SQNA 3ZMSA 5JHFA 1G2HA 3CZ6A 2LR8A 4D0PA 3PNYA 1EJ9A 3HPHA 3H0GJ 5GAGJ 5A2QK 2H09A 4HDVA 2XKOA 4EM1A 2NXNB 1D8KA 2HFHA 1HW5A 3K4KA 2EPFA 3K9TA 3VEPA 2C6YA 3SEZA 1XTAA 3QYBA 2EZLA 3CP8A 2VBYA 2WY7Q 2R5ZA 3CC7I 3RPUD 1F36A 3FZVA 2A07F 4WXDA 1LB2A 3F9KA 3QQAA 3O2PE 2L9NA 3DEEA 3FDYA 4M6VA 4BXXJ 2E35A 4HZFA 2DLLA 3LFKA 1HKTA 4FETA 5DYMA 1WJBA 3EUAA 2ISZA 1RUNA 1F5TA 2DMQA 2DFHA 3BG3A 1VQ4I 3QODA 2F5EA 4E7JA 2VOOA 2M0CA 1KU3A 2CQQA 2ACJA 4L0ZB 2VKHA 1K6YA 1H9GA 5J40A 1U9OA 2L9RA 3P9IA 1TWHJ 2BBYA 2NAZA 2M4GA 2E71A 5F1RA 1MNMC 9ANTA 4LG0B 5J8FA 2WADA 5ICGA 3PNTA 3NEUA 2DODA 2VLAA 4HX8A 1J0RA 3HPGA 1ONVA 4S04A 1JI8A 2EIMH 1TQPA 2Y9YA 4GYIA 2A6TA 3TOAA 2OBPA 2L7FP 3KP3A 5JHUA 2ZJPF 1JTYA 2X6OA 1V54H 2XAFA 3MKLA 2LYCA 3MQ0A 2BW3A 4HQEA 3BQZA 2QGUA 3I53A 2VB6A 1I3AA 4MQ9F 2K02A 4C3IJ 4IHYA 1FX7A 1OCPA 1GV5A 2E7XA 2JT1A 1ON1A 3JR9A 3HBLA 2XGEA 5IYCJ 2HPMA 2KJCA 1T33A 1TP4A 3F72A 2BVLA 3FX3A 3N05A 4BJTA 3DFGA 1OCOH 5FKOA 4EMSA 2M1BA 3CCQI 2MABA 2IPQX 3O6BB 4XN3A 3OV8A 1YFHA 1S7OA 2NOGA 2LC2A 4AVPA 3AAFA 1SFOJ 3B6CA 5K5QA 3TP3A 3F21A 2X1EA 3DQVC 3BTIA 3ELKA 3RIRA 1Z6TA 1UMQA 5BOXA 1X3WB 5F0FA 4LOCA 1BJAA 4DNCA 4PJLA 2ZXHA 4DZJA 4PFPA 4E7SA 1ZGWA 3BTLA 1GUUA 2VJIA 2VBXA 4EM0B 6PAXA 1W5CC 3DU5A 4XR6A 4OMZA 2VASA 3W2AA 3GEZA 5M5XJ 1SD7A 3BDDA 2LBFA 3JRHA 3H3VK 1HSTA 1ZQ3P 4U7BA 1MDMA 1G3SA 3PL8A 4XKCA 2JRMA 1ZR2A 4LLNA 2QWWA 1IN5A 1EH7A 3R61A 2HVSA 3HKZA 2E19A 2EFNA 2Q0OA 2MD5A 3M1CA 4UUSB 5E3NA 2HI3A 1Q1HA 1HQCA 3WG7H 5EGOA 3ZP5A 2H1KA 1JUPA 3I64A 2EA2A 4EEFG 5IPAA 3I54A 1PP7U 3H3UA 3LNQA 3CCJI 2Z9OA 3CUOA 3RJPA 4AYBA 1JUSA 2E36A 2LH9A 4RM2A 3GYHX 2QLZA 2FOKA 3DCFA 3SDGA 1B6AA 1V55H 3ABTA 4RAZA 3OYAA 4N4NB 2GXGA 2ZMEA 2QM3A 1CF7B 1S6LA 3F8BA 2ZNZA 2VKVA 4XKWA 1R4NB 2WB1A 1NHAA 1O7FA 1R1VA 3RKWA 5KAIC 1KONA 4LIVA 4U0WA 4L9JA 1N78A 1D1BA 2NYXA 3A1YA 2DJNA 1XX5A 3K4LA 2O6GE 2KT0A 2E5ZA 2PLYA 4IJAA 2KL4A 4G6QA 2FBHA 1S9HA 4E6KG 1ZR4A 2K9LA 4EQQA 2H8WA 5L3GA 3QPHA 2O9LA 2EFPA 2K27A 1MNEA 2V79A 5FROA 2PEXA 4BH9A 1XPXA 3GTJJ 1B59A 3OR1C 1U2WA 2MD0A 1JT6A 3Q3SA 4E7LA 3ABUA 4XSZF 4B3AA 1Y8RB 4G94A 5GP9A 2FJ1A 3W3CA 4YFNF 1WSUA 3S1MJ 3CUQA 4A0YA 3FXUA 4X1EA 4EV0A 3BTCA 4GGGA 1H88C 1XGSA 2DDBA 1OPCA 2CW8A 3W6KB 5IY5H 4PDKA 2K9NA 5IOZA 3E6BA 4KN7X 3D5RC 3OYEA 4I98B 1WJCA 3ZQHA 1FT9A 5M5WJ 3AL0C 1YIJI 2EQRA 1IRGA 5DUIA 2Q2EA 4Y33A 3BQYA 1IN8A 3K4CA 4CGZA 3HUGB 2K4BA 4V19K 3ULQB 1H8AC 1XN7A 5CVUA 2QQ9A 4R8HA 4Q47A 5JLWA 5GPCA 1JE8A 2CQKA 1Q1VA 4YG2F 4A3FJ 2EZHA 1XSVA 2DA3A 2KDZA 4CZZA 2DT6A 2MLGA 3QAHA 4ENJA 2EA4A 2A3SA 1DP7P 4PUSA 1VTNC 1DDNA 4MGRA 1DU6A 5LHHA 4I0AA 3F8MA 2HTSA 4B8XA 3Q5FA 2DO7A 5F04A 3L2RA 3GTGJ 1T0FA 3HRSA 3SJMA 2DMTA 3MD2A 4A69C 2HU9A 3QYFA 2GXAA 4WCGA 1QGPA 2MC4A 3A0HC 2HPIA 2QBYA 3HOTA 2ICWG 3BJ6A 5EG0A 2CYYA 4Z6YA 1MSFC 3MFKA 5DUKA 1ZRCA 5FD5A 3I59B 1WWXA 4M72A 4H4KC 4A12A 1JJ6C 2R3SA 4Q5SF 2VXDA 5JI6A 2AQEA 3ROUA 1FEXA 2XB0X 3A02A 1Y56A 2CRGA 1DP3A 5B5EC 1UHWA 1SAUA 1QO0D 3SDBA 1MBEA 2O3FA 4ZYAA 1ZRDA 1PUFA 4CCOA 1I27A 4QLCU 2LOOA 3L00A 3M7GA 2EIKH 3SZGA 2KPMA 3FXMA 2HXIA 1KGSA 3OOUA 1KZHA 2F4OB 1LVAA 2E5NA 5FLMJ 4KDPA 1IN7A 1FOKA 2B9SA 3JAMZ 2JA8J 5GADJ 2NOJB 1JJ8C 1GT0C 4ANJA 5IT3A 1KQ8A 2VIXA 2M45A 1QHGA 5LEKA 5TRDA 1Z6RA 1FBQA 1P92A 2V1NA 4NNJA 3GLLA 2WC2A 3AL0B 2X0LA 5FJ8J 3R0JA 3HRMA 1SVLA 4ZDLA 2P81A 2R0QC 2L54A 3LWFA 1LE8A 4G8XA 4RB1A 3I4MJ 1S7EA 1UHSA 3RKXA 5LLQA 1R9TJ 3BR1A 2N8GA 4U87A 2NS7A 3CLQA 4BE0A 2UV1A 1MSEC 4QIWN 5D4RA 3M07A 3J81K 4GCVA 2GOXB 1PP8F 3D0SA 4YFXF 1FOXA 2HNHA 2FUG2 4A6EA 1GVDA 4D5FA 3MEXA 3GXOA 1B9MA 2OQRA 2GLOA 4XLEA 1HLVA 2I8DA 3HC7A 4BXUA 3GBGA 1VQ6I 3FXLA 3E1SA 1OYIA 2XB5A 2R7RA 4A3GJ 2CSOA 3CDHA 2WAQA 5C4XJ 4C2TA 4EJUA 3K10A 1R1TA 1ETQA 3MAJA 3G71I 1RI7A 1SMTA 1VNDA 4HNUA 1CQTA 3DEWA 4PK4A 2NVXJ 2R4GA 3U1DA 3LA2A 2VQLA 2H6CA 2TCTA 1YLFA 4BQOA 4F52A 2RQPA 4CCMA 1YW7A 4BS9A 1UZCA 1X2MA 3G6EI 3HYIA 1JHHA 1RPWA 1PUEE 3CESA 3BR6A 2QUFA 3C2HA 5LGUA 5HLGA 1K7AA 3HGGA 2V9PA 4UVCA 3LFUA 3VOEA 5DM7F 2XGXA 3PUBA 4AUXA 3Q0WA 2EJRA 3NWTA 5E79C 4J01A 2QQAA 2K3PA 3S2WA 3WE2A 4U0YA 1MMDA 2M87A 3DU6A 3W2WA 2IGNA 5CJ9A 1JKPC 4JX5A 2BHZA 3VYUB 2CUJA 2CUEA 3FXQA 5LFAA 2UUZA 2BGCA 2H94A 3OL4A 4RGXA 4HA8A 2FMLA 4JX4A 1UG2A 3LA7A 1XS9A 2P5VA 3CJTB 3BCAA 3IUOA 1WJDA 3M8FA 3WTSC 2DFFA 4BBRJ 4CUGA 3LA3A 4AIHA 1VQ8I 2PFBA 2HQAA 2CGPA 2EV0A 3LSKA 3FHZA 3JW4A 5LRSA 3PNVA 4ZYGA 1ZRFA 1F1ZA 3AFHA 3DF8A 4XLCA 2DQRA 4FTHA 2FA5A 4RB0A 1QPIA 1W7PD 2ECBA 2RREA 1X19A 2VL8A 3FKIJ 1FC3A 5FFZA 3J80K 2W7NA 3CJQB 4YIRX 3OYCA 4BEHB 4LG3A 3CCVI 3OYBA 2BYVE 2VOPA 3KEQA 4D5CA 4FASD 3AKZA 3HOYJ 1ZGAA 4B48A 4RLFA 1LUJB 1Y1VJ 1ETYA 3OYHA 2MBFA 3OYIA 5TGTA 1G4DA 3DV8A 4DYCA 3UNGC
chains in the Genus database with same CATH topology
3K0LA 4FX0A 4A0ZA 2NRAC 1E17A 1O3TA 5BPIA 3WTWC 4PZJA 2OA4A 2F5FA 2L3DA 2EFQA 2PJPA 2FBIA 3V8LA 1AWCA 3ECHA 2IW5A 2ADUA 3GLXA 1A04A 4LGWA 1SFEA 2KIUA 2YU3A 4M9SA 3QU6A 3TO9A 5FB2A 3F23A 3HRTA 1FYMA 3HIFA 4JBAA 4EGYA 1HW1A 3GZ5A 5CVRA 3VFZA 1FSEA 2FRHA 4XSXF 2F5CA 4YIFA 1CGPA 2YR2A 5DD4A 1ZG1A 1GVJA 3L09A 1R5HA 4KN4X 4Q48A 4BHBA 4P9FA 2HYFA 3TDZC 1YQAA 2BV6A 2NNNA 3ZN1A 2RVCA 5D5XB 4KFCA 3I5UA 1SFXA 2PI0A 2NNYA 2ZJ2A 3V4GA 2XVCA 1K6OA 3JTGA 1HKQA 1V4RA 3EUHA 1FWZA 4LB6B 5DCMB 2GA1A 4UNOA 1T98A 3KP5A 4HLXA 5E20A 2V1DA 5DDGA 1W7PA 2IJLA 2HZTA 2QVOA 5JVTA 2IA2A 3ZMUA 2M5WA 4IRGA 2K86A 1LDJA 1IAWA 1KQ9A 3ZMVA 2W24A 1IXSB 1RUOA 1TNSA 1SMYF 2Y48A 5HDKA 1R7JA 2DQLA 3LQRA 3CO6C 3PQKA 4ZZLA 3M1EA 2CG4A 2STWA 2GXBA 2VONA 4FT8A 5LGNA 3R6SA 4WX9A 5CVJA 1KU7A 1XGNA 4ESBA 4EM2A 2XAJA 5HS7A 5E18F 4BHPA 1R58A 3HTSB 4HX4A 1PDNC 3BPVA 1R36A 4WXCA 4UXNA 1C0WA 1TQMA 3EDPA 2YX4A 3ZPLA 4L5JA 1WRJA 3DKWA 5E1XA 3P7NA 2CWEA 2MA3A 1T6SA 4HQMA 4CO8A 5F64A 5K5OA 2P7CB 4JK1X 2V1UA 4KIGA 2HR3A 4RS8A 4I02A 4EJTA 1YW8A 2P6TA 3JSPA 4UV9A 2RC4A 3LSTA 4ESFA 3ZN0A 1IW7F 4M9XA 5DCFA 2LDUA 1BI1A 3SZPA 3L9FA 3WU0A 3QU3A 1KQ0A 3TGNA 2VC0A 1IN4A 4KIBA 1XGMA 5ERIA 3FMQA 2LF8A 5LHIA 3U9GA 1SFUA 3IL2A 5F6FA 1D3YA 1OR7A 3E6MA 4R1HA 2GA2A 2OU2A 3QP5A 2D1HA 2RGVA 1KU2A 2IA1A 4A0XA 3ISPA 1JGSA 3RPUA 4MQVA 2HS5A 2WV0A 2HDCA 4HF0A 2W57A 1KU9A 3ZQ7A 4ENKA 1JHFA 2RKHA 1T39A 1ZREA 2FMYA 4OMYA 2UZKA 1ZH5A 3B02A 5L3DA 1FYKA 3IWFA 4OOIA 4L0YB 3KLOA 1RIOH 2DAOA 5D6FA 1TBXA 1S7AA 5H20A 3GFJA 2P4WA 5HS8A 2P7VB 3HSEA 5E8IA 2P8TA 2IP2A 2GWRA 1HSJA 2ZFWA 1ZLJA 4I7HA 2PMHA 3BOQA 4MTEA 2FNAA 3C3WA 5JFRA 3O3KA 4HW0A 1XD7A 3WGHA 2TDXA 4R79A 4MHGA 4MEXF 4HOBA 2AXLA 5D5VB 1FY7A 1EH6A 3MZYA 5FGMA 2D45A 3GVAA 1K78A 3KZZA 3E6DA 1U5TA 2OZ6A 2A61A 2DT5A 1I1GA 4LD5A 3TO6A 4ZYEA 2VT2A 1ZG5A 5EEHA 3WTXC 4HX7A 1G6NA 4I2OA 4U0VA 3Q9VA 5D8LB 3IC7A 3SHFA 3E5XA 2HGCA 4S05A 3SXYA 3V8KA 1TW3A 2K7LA 3DPTA 3FM5A 3WTZA 3IHUA 2EV5A 2IRFG 3KEOA 1S8NA 1LDKB 4ZYHA 2JPBA 2WWYA 4ZZDA 5AONA 3T0YA 1MJAA 3LAPA 2D1VA 3TDUC 4MNUA 3K2ZA 4L9TA 4UVAA 2J5OA 2YSRA 1USTA 2XHKA 1T38A 1ZLKA 5L3FA 4HV6A 1IXCA 3WTYC 2OAZA 5BS6A 3DEUA 3R4KA 1IRFA 4L18B 2FBKA 4LMYA 5E8GA 3REOA 1Z9CA 2DW4A 4CYDA 2F2EA 2VBWA 2J5PA 4IVNA 1ULYA 1FBUA 5IT9Z 5DEQA 2FF4A 3F3XA 4LG0A 2JTVA 1U6GA 4EJVA 4RGRA 4G7HF 4OIRF 2XIGA 4UVBA 3JAMK 4L5IA 4WF2A 1XCBA 2IA0A 4A5NA 2Q8KA 1L3LA 4ESJA 5KVRA 3GUDA 3SFZA 4AWXB 1W4MA 5ICEA 1JXSA 2ZNYA 3P9KA 2MH9A 1QBJA 1XGOA 4TV7A 2MLKA 2VODA 3V7SA 1P4AA 4N0BA 1ON2A 4N9HA 1YYVA 2FNPA 3DXJF 1BC7C 2ESNA 1MKMA 2E1NA 1OYYA 3G73A 4P9UA 3PFIA 1YS6A 3MWMA 3GZ6A 5FO5A 3QRFF 5J8CA 2XAQA 2MH2A 1I1SA 1ZN2A 2ETHA 4N9IA 3K69A 3JSOA 2RV8A 2JZYA 3CO7C 3H3ZA 3GX4X 2RN7A 2P6SA 3GFIA 5HVQC 4LB5A 2O0YA 1FZPB 5L3BA 1OYWA 5JR3A 3E3VA 1U8RA 1BI0A 4A6DA 2KRFA 2W84A 3F6VA 1IN6A 4UUVA 2L4MA 4YIIA 2P5KA 1WQ2A 3I4PA 3G3ZA 3C1DA 2O03A 4PGHA 5BPDA 3FMSA 4ZYDA 2F5DA 1MD0A 1CF7A 3FF5A 1ZHFA 3BY6A 3P9CA 2VE9A 4ON0A 3IWZA 4HF1A 1Z91A 3FMRA 1QNTA 2G7UA 3FM3A 1UB9A 3WGGA 2Y75A 1KA8A 3RKYA 4O3MA 1F4KA 3V7RA 3L2CA 5ILSA 1MJBA 4EJWA 3C7JA 3N97A 1ZAOA 4ENNA 3CUQC 4BHCA 1H0MA 4BNCA 4PCQA 2ISYA 2A6HF 4WK8F 2FSWA 4IPAA 1USSA 5HS9A 2W85A 2CFXA 1YW9A 3EQLF 3HUGA 3QOPA 4MTDA 3GF2A 2KKOA 2Z99A 3RYPA 1MDMB 2XAGA 1XDSA 2DU9A 3KFWX 1TQIA 3IKVA 4U88A 4P5OA 2PBIA 2XRNA 3KP2A 4QWQA 5LGTA 1S3JA 5FLXZ 4IXAA 5FLXK 3R0AA 1FSHA 1I6XA 4B09A 4HDUA 1IUYA 2IVMA 3I59A 3CLOA 3MCZA 5J6XA 5DD8A 4EVIA 4P96A 2ZMEB 2LSOA 1U3EM 4Y17A 2XKPA 2R7FA 5AIPA 1ZG3A 1XSXA 5ILUA 1XB4A 5LBQA 1W5TA 4BQAA 5FFXA 3LAJA 4ASNA 2HKXA 2UXNA 2H27A 4GO1A 3QP6A 1LJ9A 1OMIA 4L9NA 3TQNA 5ED4A 1BI3A 1QZYA 5DV5A 3CUQB 1STZA 1WKMA 4IRHA 2L01A 1P4XA 5K1YA 1KYWA 1RZ4A 3SZTA 3L7WA 3D5LA 1EV7A 2M8EA 2V9VA 1BIBA 3F8FA 4DQ2A 4KUMA 1XSDA 4RB3C 5A2QZ 4M6XA 1J7KA 3T5XA 3E5UA 2LNBA 4AD9A 5D5WB 1BIAA 5LRRA 3BZ6A 1Z7UA 2A5YB 1BI2A 2XASA 2ZKZA 3Q9SA 2KJBA 2FU4A 5D5UB 4IHSA 4LK1F 3E97A 3KZYA 2QBYB 5HLIA 4CHUA 4LLLA 3B73A 3F6OA 2EWNA 2ZBKA 3J7AO 3NQOA 1LNWA 1BN5A 2PMUA 3FWEA 3RTRA 2W25A 3I0TA 4U7DA 5L3CA 2Z3YA 2HYGD 1J2XA 4Y15A 3T1BA 5CYVA 1YO5C 4CXFA 2P5LC 2QQBA 1H9TA 2AS5F 3BPXA 1XCVA 1SAXA 2V1XA 2ZXJA 1WI9A 3K1MA 3NRVA 2VT3A 2DPDA 4OINF 2G7HA 3WODF 2EB7A 3KP7A 4ZH4F 1HKSA 1F9NA 1HXDA 3RDIA 5H6QA 4LJZF 1EH8A 4RB2C 3E5QA 3ZMDA 1UCRA 1HW2A 2CO5A 3C18A 2DK5A 5FD6A 5CVVA 3ERED 1O57A 1MGTA 3E6CC 1BM9A 2LKPA 4G6DA 3IRQA 5TJJA 3BWGA 4UV8A 3EYYA 2HOEA 3BJOA 3KP6A 1UHMA 2R7DA 2Z5UA 3DP7A 4KYWA 3EYIA 1B9NA 4I01A 4AIKA 4ETSA 1R23A 1ZYRF 2VN2A 3RI4A 2X4HA 1R1UA 4WXHA 1Z1DA 5D6EA 5H6RA 2O8XA 1LQ1A 1YS7A 3M8EA 4Z2YA 3TO7A 4RGSA 1V3FA 3IKTA 3ML6A 2VBZA 4KMUX 4IHTA 4M73A 3JTHA 4XRFA 4HLYA 2DBBA 3HHHA 2KIMA 3GO5A 1YTYA 1Y0UA 4P55A 4KMFA 1ZARA 1TTYA 5BQTA 5DCMA 1D8JA 4EJOA 3ZMZA 4Q4ZF 3HOSA 5AIQA 2ESHA 2XROA 4OIQF 4G9YA 1R00A 2RNJA 3T8RA 2JPCA 1FBSA 1O3QA 1I5ZA 2VXZA 2XV4S 4YFKF 1J75A 2O61A 5HLHA 4BAYA 4HV5A 4OU0A 3KCCA 3I58A 2HQNA 1ODDA 4M74A 2STTA 1OKRA 3WE3A 2COMA 1LDDA 2PN6A 2L4AA 3WGIA 2DPUA 1S29A 1HBXG 1P2FA 3KP4A 2OQGA 3N4MA 2ZO4A 4O5VA 3BROA 4F7ZA 2WTEA 2G9WA 5HOOA 4E70A 3ZMTA 2EFOA 1P4WA 3VODA 2FEZA 3K1PA 3WTVC 2YPRA 1FNNA 1LEBA 2EV6A 3WTTC 4M9ZA 2HKOA 5ICCA 1TLHB 4IRIA 4IF4A 1XMAA 2GZWA 1TW2A 2E7WA 5IT9K 4NB5A 2NS0A 3FXRA 3M9AA 1DPUA 4FHTA 3BP8A 4EGZA 1U78A 4GXOA 4HBLA 1QQIA 2HEOA 3KETA 3I71A 5E1ZB 1XMKA 3R60A 1W7PB 5HDNA 3VB2A 4G7OF 2Z33A 2DI3A 1FPQA 4ENMA 3KLNA 2L02A 5E17F 1O7LA 4KICA 4RGUA 1SD4A 2M30A 3F22A 4AIJA 3V7CA 5HDGA 1B1BA 4LFUA 1YG2A 1MJ9A 1GHCA 3TKYA 2UWMA 4NQWA 1RNLA 1E2XA 4LLGF 3GW2A 4PGGA 1J5YA 2D2WA 3QPTA 2HQRA 1QZZA 3GWZA 4HYEA 3J81Z 2MC3A 2OD5A 1BBYA 2QZ8A 4KIFA 4KNYA 3U2RA 3CJNA 5LHGA 5D8KB 1FLIA 3BJAA 4XLPF 2VC1A 1DPRA 2DFIA 5ILVA 2JRTA 3K1NA 2YX7A 1D5VA 1O3RA 1SD6A 3HHGA 5KK1A 1K79A 3GFMA 5CVIA 3HSRA 4UHTA 4A2UA 1R22A 2BE5F 4FX4A 2HTJA 3WTUC 3EETA 1AOYA 3HSFA 2XUBA 2GAUA 3RPQA 4O6JA 4HAMA 1B4AA 1XDUA 4L9VA 4WWCA 4MEYF 2V6CA 2KIFA 4CICA 4LK0F 1T2KA 2E1CA 3T8TA 2EK5A 1R5GA 2IT0A 4OIPF 2ZCWA 4M71A 2QYOA 1BOAA 3WG9A 1IZ1A 1FP1D 1BC8C 3HTUA 1FP2A 2UXXA 4KT5C 2K4JA 2H6BA 5LEJA 2A6EF 1Z05A 1O3SA 2XAHA 1FYLA 3LQQA 2FXAA 2FE3A 2BEOA 3J80Z 4BYYA 3GFLA 3HRUA 1KYZA 4I0BA 1SD5A 5ICFA 1J9IA 4M6YA 4RAYA 3IRRA 1G3TA 5K5RA 3F8CA 4XLNF 5D4SA 3ECOA 1IXRC 1U5TC 4GYGA 1ZGJA 2DK8A 1X3UA 2A69F 2CW0F 3W6JB 2FQ3A 2JSCA 3CTAA 2OZUA 2PG4A 2HWVA 2RDPA 2Y0MA 1UFMA 4KA4A 3MZHA 1LEAA 2PQ8A 1REPC 2A68F 5EEGA 3COAC 2LF7A 4Y13A 2QENA 4G7ZF 3PQJA 2EFWA 3RYRA 3V8JA 3H92A 3DPLC 1W5SA 5BMZA 1G3YA 3TOBA 4HF2A 4JQFA 1G3WA 2VE8A 1GXPA 1YIOA 1DUXC 2GIVA 1J59A 1QPMA 5CLSA 4XBFA 1MZBA 3OOPA 4H0EA 4NHJA 4K2EA 1P6RA 3WU1B 4I09A 1K78B 3F8NA 4A5MA 1TNTA 5E1WA 1U5TB 4OIOF 1L0OC 1IF1A 5L3EA 4CDGA 2DTRA 2ELHA 1GXQA 3KE2A 2B0LA 2GQQA 3SQNA 3ZMSA 4D0PA 5A2QK 2H09A 4HDVA 2XKOA 4EM1A 1D8KA 2HFHA 1HW5A 3K9TA 3VEPA 2C6YA 2VBYA 3FZVA 2A07F 4WXDA 1LB2A 3O2PE 4HZFA 2DLLA 3LFKA 1HKTA 5DYMA 2ISZA 1RUNA 1F5TA 2F5EA 2VOOA 1KU3A 2ACJA 4L0ZB 1H9GA 3P9IA 2BBYA 2NAZA 5F1RA 4LG0B 5J8FA 5ICGA 3NEUA 4HX8A 1J0RA 1ONVA 4S04A 1TQPA 4GYIA 3TOAA 2OBPA 3KP3A 5JHUA 2XAFA 3MQ0A 4HQEA 3I53A 4MQ9F 2K02A 1FX7A 2E7XA 2JT1A 1ON1A 2KJCA 3F72A 3FX3A 3DFGA 4EMSA 2M1BA 2IPQX 3O6BB 3OV8A 1YFHA 1S7OA 4AVPA 3AAFA 5K5QA 3F21A 3DQVC 3ELKA 3RIRA 1Z6TA 5BOXA 1BJAA 4DNCA 2VBXA 4EM0B 6PAXA 4OMZA 3GEZA 1SD7A 3BDDA 1HSTA 4U7BA 1MDMA 1G3SA 4LLNA 2QWWA 1IN5A 1EH7A 3R61A 2EFNA 2Q0OA 2MD5A 1Q1HA 1HQCA 3ZP5A 3I64A 2EA2A 3I54A 1PP7U 3H3UA 2Z9OA 3CUOA 3RJPA 3GYHX 2QLZA 2FOKA 1B6AA 4RAZA 3ABTA 2GXGA 2ZMEA 2QM3A 1CF7B 1S6LA 3F8BA 2ZNZA 1NHAA 1O7FA 1R1VA 3RKWA 4U0WA 4L9JA 2NYXA 2O6GE 2PLYA 4IJAA 4G6QA 2FBHA 4EQQA 5L3GA 3QPHA 2EFPA 2K27A 2V79A 2PEXA 4BH9A 1B59A 1U2WA 3ABUA 4XSZF 4G94A 4YFNF 1WSUA 3CUQA 4A0YA 3FXUA 4EV0A 4GGGA 1XGSA 1OPCA 3W6KB 4PDKA 3E6BA 4KN7X 4I98B 1FT9A 1IRGA 5DUIA 2Q2EA 1IN8A 4CGZA 2K4BA 3ULQB 1XN7A 5CVUA 2QQ9A 4R8HA 4Q47A 1JE8A 2CQKA 4YG2F 1XSVA 4CZZA 2MLGA 3QAHA 4ENJA 2EA4A 2A3SA 1DP7P 1VTNC 1DDNA 4MGRA 5LHHA 4I0AA 3F8MA 2HTSA 4B8XA 3Q5FA 2DO7A 1T0FA 3HRSA 4WCGA 1QGPA 2QBYA 3HOTA 3BJ6A 2CYYA 3MFKA 5DUKA 1ZRCA 5FD5A 3I59B 1WWXA 4M72A 4A12A 2R3SA 4Q5SF 5JI6A 3ROUA 1UHWA 1QO0D 2O3FA 1ZRDA 1I27A 4QLCU 3L00A 3M7GA 1KGSA 1LVAA 4KDPA 1IN7A 1FOKA 3JAMZ 5IT3A 1KQ8A 2M45A 5TRDA 5LEKA 1Z6RA 1FBQA 1P92A 2WC2A 2X0LA 3R0JA 3HRMA 2L54A 3LWFA 4G8XA 4RB1A 3RKXA 5LLQA 5D4RA 3J81K 4GCVA 1PP8F 3D0SA 4YFXF 4A6EA 3MEXA 3GXOA 1B9MA 2OQRA 4BXUA 1OYIA 2CSOA 3CDHA 4EJUA 1R1TA 3MAJA 1RI7A 1SMTA 3U1DA 3LA2A 2H6CA 1YLFA 2RQPA 1YW7A 3HYIA 1JHHA 1PUEE 2QUFA 1K7AA 5LGUA 5HLGA 4UVCA 3VOEA 2XGXA 2EJRA 2QQAA 3S2WA 3WE2A 4U0YA 2M87A 5CJ9A 3FXQA 4RGXA 2BGCA 2H94A 4HA8A 2FMLA 3LA7A 2P5VA 3M8FA 3WTSC 3LA3A 4AIHA 2PFBA 2CGPA 2EV0A 3FHZA 3JW4A 5LRSA 4ZYGA 1ZRFA 1F1ZA 3DF8A 2DQRA 2FA5A 4RB0A 1W7PD 3J80K 5FFZA 1FC3A 2BYVE 2VOPA 3KEQA 1ZGAA 2MBFA 1G4DA 3DV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0L A;  4FX0 A;  4A0Z A;  2NRA C;  1E17 A;  1O3T A;  5BPI A;  3WTW C;  4PZJ A;  2OA4 A;  2F5F A;  2L3D A;  2EFQ A;  2PJP A;  2FBI A;  3V8L A;  1AWC A;  3ECH A;  2IW5 A;  2ADU A;  3GLX A;  1A04 A;  4LGW A;  1SFE A;  2KIU A;  2YU3 A;  4M9S A;  3QU6 A;  3TO9 A;  5FB2 A;  3F23 A;  3HRT A;  1FYM A;  3HIF A;  4JBA A;  4EGY A;  1HW1 A;  3GZ5 A;  5CVR A;  3VFZ A;  1FSE A;  2FRH A;  4XSX F;  2F5C A;  4YIF A;  1CGP A;  2YR2 A;  5DD4 A;  1ZG1 A;  1GVJ A;  3L09 A;  1R5H A;  4KN4 X;  4Q48 A;  4BHB A;  4P9F A;  2HYF A;  3TDZ C;  1YQA A;  2BV6 A;  2NNN A;  3ZN1 A;  2RVC A;  5D5X B;  4KFC A;  3I5U A;  1SFX A;  2PI0 A;  2NNY A;  2ZJ2 A;  3V4G A;  2XVC A;  1K6O A;  3JTG A;  1HKQ A;  1V4R A;  3EUH A;  1FWZ A;  4LB6 B;  5DCM B;  2GA1 A;  4UNO A;  1T98 A;  3KP5 A;  4HLX A;  5E20 A;  2V1D A;  5DDG A;  1W7P A;  2IJL A;  2HZT A;  2QVO A;  5JVT A;  2IA2 A;  3ZMU A;  2M5W A;  4IRG A;  2K86 A;  1LDJ A;  1IAW A;  1KQ9 A;  3ZMV A;  2W24 A;  1IXS B;  1RUO A;  1TNS A;  1SMY F;  2Y48 A;  5HDK A;  1R7J A;  2DQL A;  3LQR A;  3CO6 C;  3PQK A;  4ZZL A;  3M1E A;  2CG4 A;  2STW A;  2GXB A;  2VON A;  4FT8 A;  5LGN A;  3R6S A;  4WX9 A;  5CVJ A;  1KU7 A;  1XGN A;  4ESB A;  4EM2 A;  2XAJ A;  5HS7 A;  5E18 F;  4BHP A;  1R58 A;  3HTS B;  4HX4 A;  1PDN C;  3BPV A;  1R36 A;  4WXC A;  4UXN A;  1C0W A;  1TQM A;  3EDP A;  2YX4 A;  3ZPL A;  4L5J A;  1WRJ A;  3DKW A;  5E1X A;  3P7N A;  2CWE A;  2MA3 A;  1T6S A;  4HQM A;  4CO8 A;  5F64 A;  5K5O A;  2P7C B;  4JK1 X;  2V1U A;  4KIG A;  2HR3 A;  4RS8 A;  4I02 A;  4EJT A;  1YW8 A;  2P6T A;  3JSP A;  4UV9 A;  2RC4 A;  3LST A;  4ESF A;  3ZN0 A;  1IW7 F;  4M9X A;  5DCF A;  2LDU A;  1BI1 A;  3SZP A;  3L9F A;  3WU0 A;  3QU3 A;  1KQ0 A;  3TGN A;  2VC0 A;  1IN4 A;  4KIB A;  1XGM A;  5ERI A;  3FMQ A;  2LF8 A;  5LHI A;  3U9G A;  1SFU A;  3IL2 A;  5F6F A;  1D3Y A;  1OR7 A;  3E6M A;  4R1H A;  2GA2 A;  2OU2 A;  3QP5 A;  2D1H A;  2RGV A;  1KU2 A;  2IA1 A;  4A0X A;  3ISP A;  1JGS A;  3RPU A;  4MQV A;  2HS5 A;  2WV0 A;  2HDC A;  4HF0 A;  2W57 A;  1KU9 A;  3ZQ7 A;  4ENK A;  1JHF A;  2RKH A;  1T39 A;  1ZRE A;  2FMY A;  4OMY A;  2UZK A;  1ZH5 A;  3B02 A;  5L3D A;  1FYK A;  3IWF A;  4OOI A;  4L0Y B;  3KLO A;  1RIO H;  2DAO A;  5D6F A;  1TBX A;  1S7A A;  5H20 A;  3GFJ A;  2P4W A;  5HS8 A;  2P7V B;  3HSE A;  5E8I A;  2P8T A;  2IP2 A;  2GWR A;  1HSJ A;  2ZFW A;  1ZLJ A;  4I7H A;  2PMH A;  3BOQ A;  4MTE A;  2FNA A;  3C3W A;  5JFR A;  3O3K A;  4HW0 A;  1XD7 A;  3WGH A;  2TDX A;  4R79 A;  4MHG A;  4MEX F;  4HOB A;  2AXL A;  5D5V B;  1FY7 A;  1EH6 A;  3MZY A;  5FGM A;  2D45 A;  3GVA A;  1K78 A;  3KZZ A;  3E6D A;  1U5T A;  2OZ6 A;  2A61 A;  2DT5 A;  1I1G A;  4LD5 A;  3TO6 A;  4ZYE A;  2VT2 A;  1ZG5 A;  5EEH A;  3WTX C;  4HX7 A;  1G6N A;  4I2O A;  4U0V A;  3Q9V A;  5D8L B;  3IC7 A;  3SHF A;  3E5X A;  2HGC A;  4S05 A;  3SXY A;  3V8K A;  1TW3 A;  2K7L A;  3DPT A;  3FM5 A;  3WTZ A;  3IHU A;  2EV5 A;  2IRF G;  3KEO A;  1S8N A;  1LDK B;  4ZYH A;  2JPB A;  2WWY A;  4ZZD A;  5AON A;  3T0Y A;  1MJA A;  3LAP A;  2D1V A;  3TDU C;  4MNU A;  3K2Z A;  4L9T A;  4UVA A;  2J5O A;  2YSR A;  1UST A;  2XHK A;  1T38 A;  1ZLK A;  5L3F A;  4HV6 A;  1IXC A;  3WTY C;  2OAZ A;  5BS6 A;  3DEU A;  3R4K A;  1IRF A;  4L18 B;  2FBK A;  4LMY A;  5E8G A;  3REO A;  1Z9C A;  2DW4 A;  4CYD A;  2F2E A;  2VBW A;  2J5P A;  4IVN A;  1ULY A;  1FBU A;  5IT9 Z;  5DEQ A;  2FF4 A;  3F3X A;  4LG0 A;  2JTV A;  1U6G A;  4EJV A;  4RGR A;  4G7H F;  4OIR F;  2XIG A;  4UVB A;  3JAM K;  4L5I A;  4WF2 A;  1XCB A;  2IA0 A;  4A5N A;  2Q8K A;  1L3L A;  4ESJ A;  5KVR A;  3GUD A;  3SFZ A;  4AWX B;  1W4M A;  5ICE A;  1JXS A;  2ZNY A;  3P9K A;  2MH9 A;  1QBJ A;  1XGO A;  4TV7 A;  2MLK A;  2VOD A;  3V7S A;  1P4A A;  4N0B A;  1ON2 A;  4N9H A;  1YYV A;  2FNP A;  3DXJ F;  1BC7 C;  2ESN A;  1MKM A;  2E1N A;  1OYY A;  3G73 A;  4P9U A;  3PFI A;  1YS6 A;  3MWM A;  3GZ6 A;  5FO5 A;  3QRF F;  5J8C A;  2XAQ A;  2MH2 A;  1I1S A;  1ZN2 A;  2ETH A;  4N9I A;  3K69 A;  3JSO A;  2RV8 A;  2JZY A;  3CO7 C;  3H3Z A;  3GX4 X;  2RN7 A;  2P6S A;  3GFI A;  5HVQ C;  4LB5 A;  2O0Y A;  1FZP B;  5L3B A;  1OYW A;  5JR3 A;  3E3V A;  1U8R A;  1BI0 A;  4A6D A;  2KRF A;  2W84 A;  3F6V A;  1IN6 A;  4UUV A;  2L4M A;  4YII A;  2P5K A;  1WQ2 A;  3I4P A;  3G3Z A;  3C1D A;  2O03 A;  4PGH A;  5BPD A;  3FMS A;  4ZYD A;  2F5D A;  1MD0 A;  1CF7 A;  3FF5 A;  1ZHF A;  3BY6 A;  3P9C A;  2VE9 A;  4ON0 A;  3IWZ A;  4HF1 A;  1Z91 A;  3FMR A;  1QNT A;  2G7U A;  3FM3 A;  1UB9 A;  3WGG A;  2Y75 A;  1KA8 A;  3RKY A;  4O3M A;  1F4K A;  3V7R A;  3L2C A;  5ILS A;  1MJB A;  4EJW A;  3C7J A;  3N97 A;  1ZAO A;  4ENN A;  3CUQ C;  4BHC A;  1H0M A;  4BNC A;  4PCQ A;  2ISY A;  2A6H F;  4WK8 F;  2FSW A;  4IPA A;  1USS A;  5HS9 A;  2W85 A;  2CFX A;  1YW9 A;  3EQL F;  3HUG A;  3QOP A;  4MTD A;  3GF2 A;  2KKO A;  2Z99 A;  3RYP A;  1MDM B;  2XAG A;  1XDS A;  2DU9 A;  3KFW X;  1TQI A;  3IKV A;  4U88 A;  4P5O A;  2PBI A;  2XRN A;  3KP2 A;  4QWQ A;  5LGT A;  1S3J A;  5FLX Z;  4IXA A;  5FLX K;  3R0A A;  1FSH A;  1I6X A;  4B09 A;  4HDU A;  1IUY A;  2IVM A;  3I59 A;  3CLO A;  3MCZ A;  5J6X A;  5DD8 A;  4EVI A;  4P96 A;  2ZME B;  2LSO A;  1U3E M;  4Y17 A;  2XKP A;  2R7F A;  5AIP A;  1ZG3 A;  1XSX A;  5ILU A;  1XB4 A;  5LBQ A;  1W5T A;  4BQA A;  5FFX A;  3LAJ A;  4ASN A;  2HKX A;  2UXN A;  2H27 A;  4GO1 A;  3QP6 A;  1LJ9 A;  1OMI A;  4L9N A;  3TQN A;  5ED4 A;  1BI3 A;  1QZY A;  5DV5 A;  3CUQ B;  1STZ A;  1WKM A;  4IRH A;  2L01 A;  1P4X A;  5K1Y A;  1KYW A;  1RZ4 A;  3SZT A;  3L7W A;  3D5L A;  1EV7 A;  2M8E A;  2V9V A;  1BIB A;  3F8F A;  4DQ2 A;  4KUM A;  1XSD A;  4RB3 C;  5A2Q Z;  4M6X A;  1J7K A;  3T5X A;  3E5U A;  2LNB A;  4AD9 A;  5D5W B;  1BIA A;  5LRR A;  3BZ6 A;  1Z7U A;  2A5Y B;  1BI2 A;  2XAS A;  2ZKZ A;  3Q9S A;  2KJB A;  2FU4 A;  5D5U B;  4IHS A;  4LK1 F;  3E97 A;  3KZY A;  2QBY B;  5HLI A;  4CHU A;  4LLL A;  3B73 A;  3F6O A;  2EWN A;  2ZBK A;  3J7A O;  3NQO A;  1LNW A;  1BN5 A;  2PMU A;  3FWE A;  3RTR A;  2W25 A;  3I0T A;  4U7D A;  5L3C A;  2Z3Y A;  2HYG D;  1J2X A;  4Y15 A;  3T1B A;  5CYV A;  1YO5 C;  4CXF A;  2P5L C;  2QQB A;  1H9T A;  2AS5 F;  3BPX A;  1XCV A;  1SAX A;  2V1X A;  2ZXJ A;  1WI9 A;  3K1M A;  3NRV A;  2VT3 A;  2DPD A;  4OIN F;  2G7H A;  3WOD F;  2EB7 A;  3KP7 A;  4ZH4 F;  1HKS A;  1F9N A;  1HXD A;  3RDI A;  5H6Q A;  4LJZ F;  1EH8 A;  4RB2 C;  3E5Q A;  3ZMD A;  1UCR A;  1HW2 A;  2CO5 A;  3C18 A;  2DK5 A;  5FD6 A;  5CVV A;  3ERE D;  1O57 A;  1MGT A;  3E6C C;  1BM9 A;  2LKP A;  4G6D A;  3IRQ A;  5TJJ A;  3BWG A;  4UV8 A;  3EYY A;  2HOE A;  3BJO A;  3KP6 A;  1UHM A;  2R7D A;  2Z5U A;  3DP7 A;  4KYW A;  3EYI A;  1B9N A;  4I01 A;  4AIK A;  4ETS A;  1R23 A;  1ZYR F;  2VN2 A;  3RI4 A;  2X4H A;  1R1U A;  4WXH A;  1Z1D A;  5D6E A;  5H6R A;  2O8X A;  1LQ1 A;  1YS7 A;  3M8E A;  4Z2Y A;  3TO7 A;  4RGS A;  1V3F A;  3IKT A;  3ML6 A;  2VBZ A;  4KMU X;  4IHT A;  4M73 A;  3JTH A;  4XRF A;  4HLY A;  2DBB A;  3HHH A;  2KIM A;  3GO5 A;  1YTY A;  1Y0U A;  4P55 A;  4KMF A;  1ZAR A;  1TTY A;  5BQT A;  5DCM A;  1D8J A;  4EJO A;  3ZMZ A;  4Q4Z F;  3HOS A;  5AIQ A;  2ESH A;  2XRO A;  4OIQ F;  4G9Y A;  1R00 A;  2RNJ A;  3T8R A;  2JPC A;  1FBS A;  1O3Q A;  1I5Z A;  2VXZ A;  2XV4 S;  4YFK F;  1J75 A;  2O61 A;  5HLH A;  4BAY A;  4HV5 A;  4OU0 A;  3KCC A;  3I58 A;  2HQN A;  1ODD A;  4M74 A;  2STT A;  1OKR A;  3WE3 A;  2COM A;  1LDD A;  2PN6 A;  2L4A A;  3WGI A;  2DPU A;  1S29 A;  1HBX G;  1P2F A;  3KP4 A;  2OQG A;  3N4M A;  2ZO4 A;  4O5V A;  3BRO A;  4F7Z A;  2WTE A;  2G9W A;  5HOO A;  4E70 A;  3ZMT A;  2EFO A;  1P4W A;  3VOD A;  2FEZ A;  3K1P A;  3WTV C;  2YPR A;  1FNN A;  1LEB A;  2EV6 A;  3WTT C;  4M9Z A;  2HKO A;  5ICC A;  1TLH B;  4IRI A;  4IF4 A;  1XMA A;  2GZW A;  1TW2 A;  2E7W A;  5IT9 K;  4NB5 A;  2NS0 A;  3FXR A;  3M9A A;  1DPU A;  4FHT A;  3BP8 A;  4EGZ A;  1U78 A;  4GXO A;  4HBL A;  1QQI A;  2HEO A;  3KET A;  3I71 A;  5E1Z B;  1XMK A;  3R60 A;  1W7P B;  5HDN A;  3VB2 A;  4G7O F;  2Z33 A;  2DI3 A;  1FPQ A;  4ENM A;  3KLN A;  2L02 A;  5E17 F;  1O7L A;  4KIC A;  4RGU A;  1SD4 A;  2M30 A;  3F22 A;  4AIJ A;  3V7C A;  5HDG A;  1B1B A;  4LFU A;  1YG2 A;  1MJ9 A;  1GHC A;  3TKY A;  2UWM A;  4NQW A;  1RNL A;  1E2X A;  4LLG F;  3GW2 A;  4PGG A;  1J5Y A;  2D2W A;  3QPT A;  2HQR A;  1QZZ A;  3GWZ A;  4HYE A;  3J81 Z;  2MC3 A;  2OD5 A;  1BBY A;  2QZ8 A;  4KIF A;  4KNY A;  3U2R A;  3CJN A;  5LHG A;  5D8K B;  1FLI A;  3BJA A;  4XLP F;  2VC1 A;  1DPR A;  2DFI A;  5ILV A;  2JRT A;  3K1N A;  2YX7 A;  1D5V A;  1O3R A;  1SD6 A;  3HHG A;  5KK1 A;  1K79 A;  3GFM A;  5CVI A;  3HSR A;  4UHT A;  4A2U A;  1R22 A;  2BE5 F;  4FX4 A;  2HTJ A;  3WTU C;  3EET A;  1AOY A;  3HSF A;  2XUB A;  2GAU A;  3RPQ A;  4O6J A;  4HAM A;  1B4A A;  1XDU A;  4L9V A;  4WWC A;  4MEY F;  2V6C A;  2KIF A;  4CIC A;  4LK0 F;  1T2K A;  2E1C A;  3T8T A;  2EK5 A;  1R5G A;  2IT0 A;  4OIP F;  2ZCW A;  4M71 A;  2QYO A;  1BOA A;  3WG9 A;  1IZ1 A;  1FP1 D;  1BC8 C;  3HTU A;  1FP2 A;  2UXX A;  4KT5 C;  2K4J A;  2H6B A;  5LEJ A;  2A6E F;  1Z05 A;  1O3S A;  2XAH A;  1FYL A;  3LQQ A;  2FXA A;  2FE3 A;  2BEO A;  3J80 Z;  4BYY A;  3GFL A;  3HRU A;  1KYZ A;  4I0B A;  1SD5 A;  5ICF A;  1J9I A;  4M6Y A;  4RAY A;  3IRR A;  1G3T A;  5K5R A;  3F8C A;  4XLN F;  5D4S A;  3ECO A;  1IXR C;  1U5T C;  4GYG A;  1ZGJ A;  2DK8 A;  1X3U A;  2A69 F;  2CW0 F;  3W6J B;  2FQ3 A;  2JSC A;  3CTA A;  2OZU A;  2PG4 A;  2HWV A;  2RDP A;  2Y0M A;  1UFM A;  4KA4 A;  3MZH A;  1LEA A;  2PQ8 A;  1REP C;  2A68 F;  5EEG A;  3COA C;  2LF7 A;  4Y13 A;  2QEN A;  4G7Z F;  3PQJ A;  2EFW A;  3RYR A;  3V8J A;  3H92 A;  3DPL C;  1W5S A;  5BMZ A;  1G3Y A;  3TOB A;  4HF2 A;  4JQF A;  1G3W A;  2VE8 A;  1GXP A;  1YIO A;  1DUX C;  2GIV A;  1J59 A;  1QPM A;  5CLS A;  4XBF A;  1MZB A;  3OOP A;  4H0E A;  4NHJ A;  4K2E A;  1P6R A;  3WU1 B;  4I09 A;  1K78 B;  3F8N A;  4A5M A;  1TNT A;  5E1W A;  1U5T B;  4OIO F;  1L0O C;  1IF1 A;  5L3E A;  4CDG A;  2DTR A;  2ELH A;  1GXQ A;  3KE2 A;  2B0L A;  2GQQ A;  3SQN A;  3ZMS A;  4D0P A;  5A2Q K;  2H09 A;  4HDV A;  2XKO A;  4EM1 A;  1D8K A;  2HFH A;  1HW5 A;  3K9T A;  3VEP A;  2C6Y A;  2VBY A;  3FZV A;  2A07 F;  4WXD A;  1LB2 A;  3O2P E;  4HZF A;  2DLL A;  3LFK A;  1HKT A;  5DYM A;  2ISZ A;  1RUN A;  1F5T A;  2F5E A;  2VOO A;  1KU3 A;  2ACJ A;  4L0Z B;  1H9G A;  3P9I A;  2BBY A;  2NAZ A;  5F1R A;  4LG0 B;  5J8F A;  5ICG A;  3NEU A;  4HX8 A;  1J0R A;  1ONV A;  4S04 A;  1TQP A;  4GYI A;  3TOA A;  2OBP A;  3KP3 A;  5JHU A;  2XAF A;  3MQ0 A;  4HQE A;  3I53 A;  4MQ9 F;  2K02 A;  1FX7 A;  2E7X A;  2JT1 A;  1ON1 A;  2KJC A;  3F72 A;  3FX3 A;  3DFG A;  4EMS A;  2M1B A;  2IPQ X;  3O6B B;  3OV8 A;  1YFH A;  1S7O A;  4AVP A;  3AAF A;  5K5Q A;  3F21 A;  3DQV C;  3ELK A;  3RIR A;  1Z6T A;  5BOX A;  1BJA A;  4DNC A;  2VBX A;  4EM0 B;  6PAX A;  4OMZ A;  3GEZ A;  1SD7 A;  3BDD A;  1HST A;  4U7B A;  1MDM A;  1G3S A;  4LLN A;  2QWW A;  1IN5 A;  1EH7 A;  3R61 A;  2EFN A;  2Q0O A;  2MD5 A;  1Q1H A;  1HQC A;  3ZP5 A;  3I64 A;  2EA2 A;  3I54 A;  1PP7 U;  3H3U A;  2Z9O A;  3CUO A;  3RJP A;  3GYH X;  2QLZ A;  2FOK A;  1B6A A;  4RAZ A;  3ABT A;  2GXG A;  2ZME A;  2QM3 A;  1CF7 B;  1S6L A;  3F8B A;  2ZNZ A;  1NHA A;  1O7F A;  1R1V A;  3RKW A;  4U0W A;  4L9J A;  2NYX A;  2O6G E;  2PLY A;  4IJA A;  4G6Q A;  2FBH A;  4EQQ A;  5L3G A;  3QPH A;  2EFP A;  2K27 A;  2V79 A;  2PEX A;  4BH9 A;  1B59 A;  1U2W A;  3ABU A;  4XSZ F;  4G94 A;  4YFN F;  1WSU A;  3CUQ A;  4A0Y A;  3FXU A;  4EV0 A;  4GGG A;  1XGS A;  1OPC A;  3W6K B;  4PDK A;  3E6B A;  4KN7 X;  4I98 B;  1FT9 A;  1IRG A;  5DUI A;  2Q2E A;  1IN8 A;  4CGZ A;  2K4B A;  3ULQ B;  1XN7 A;  5CVU A;  2QQ9 A;  4R8H A;  4Q47 A;  1JE8 A;  2CQK A;  4YG2 F;  1XSV A;  4CZZ A;  2MLG A;  3QAH A;  4ENJ A;  2EA4 A;  2A3S A;  1DP7 P;  1VTN C;  1DDN A;  4MGR A;  5LHH A;  4I0A A;  3F8M A;  2HTS A;  4B8X A;  3Q5F A;  2DO7 A;  1T0F A;  3HRS A;  4WCG A;  1QGP A;  2QBY A;  3HOT A;  3BJ6 A;  2CYY A;  3MFK A;  5DUK A;  1ZRC A;  5FD5 A;  3I59 B;  1WWX A;  4M72 A;  4A12 A;  2R3S A;  4Q5S F;  5JI6 A;  3ROU A;  1UHW A;  1QO0 D;  2O3F A;  1ZRD A;  1I27 A;  4QLC U;  3L00 A;  3M7G A;  1KGS A;  1LVA A;  4KDP A;  1IN7 A;  1FOK A;  3JAM Z;  5IT3 A;  1KQ8 A;  2M45 A;  5TRD A;  5LEK A;  1Z6R A;  1FBQ A;  1P92 A;  2WC2 A;  2X0L A;  3R0J A;  3HRM A;  2L54 A;  3LWF A;  4G8X A;  4RB1 A;  3RKX A;  5LLQ A;  5D4R A;  3J81 K;  4GCV A;  1PP8 F;  3D0S A;  4YFX F;  4A6E A;  3MEX A;  3GXO A;  1B9M A;  2OQR A;  4BXU A;  1OYI A;  2CSO A;  3CDH A;  4EJU A;  1R1T A;  3MAJ A;  1RI7 A;  1SMT A;  3U1D A;  3LA2 A;  2H6C A;  1YLF A;  2RQP A;  1YW7 A;  3HYI A;  1JHH A;  1PUE E;  2QUF A;  1K7A A;  5LGU A;  5HLG A;  4UVC A;  3VOE A;  2XGX A;  2EJR A;  2QQA A;  3S2W A;  3WE2 A;  4U0Y A;  2M87 A;  5CJ9 A;  3FXQ A;  4RGX A;  2BGC A;  2H94 A;  4HA8 A;  2FML A;  3LA7 A;  2P5V A;  3M8F A;  3WTS C;  3LA3 A;  4AIH A;  2PFB A;  2CGP A;  2EV0 A;  3FHZ A;  3JW4 A;  5LRS A;  4ZYG A;  1ZRF A;  1F1Z A;  3DF8 A;  2DQR A;  2FA5 A;  4RB0 A;  1W7P D;  3J80 K;  5FFZ A;  1FC3 A;  2BYV E;  2VOP A;  3KEQ A;  1ZGA A;  2MBF A;  1G4D A;  3DV8 A; 
#chains in the Genus database with same CATH topology
 3K0L A;  4FX0 A;  4A0Z A;  2NRA C;  1E17 A;  1O3T A;  2JA5 J;  1TWA J;  3IAM 2;  1Z21 A;  1J09 A;  4HNT A;  5BPI A;  3WTW C;  3ABM H;  1RES A;  1B72 B;  4PZJ A;  4XNF A;  2OA4 A;  4IHV A;  2F5F A;  3ZQG A;  1UG0 A;  2L3D A;  4NC6 A;  1WHU A;  3JRC A;  2EFQ A;  2PJP A;  2FBI A;  3V8L A;  2XF6 A;  1AWC A;  1X1D A;  3ECH A;  1JGG A;  2IW5 A;  4XOT A;  4V2G A;  1FOY A;  3RQ4 A;  2ADU A;  3GLX A;  1A04 A;  3ZQQ A;  4IOC F;  3H5A A;  1LKX A;  3CF5 F;  1FIA A;  4LGW A;  1SFE A;  3DLL F;  2KIU A;  2YU3 A;  2ZSI B;  1XMX A;  4M9S A;  5EDN A;  3QU6 A;  3TO9 A;  5FB2 A;  3A01 B;  4BUP A;  3HRT A;  3F23 A;  1FYM A;  5F0H A;  3OS0 A;  1T08 B;  3HIF A;  4JBA A;  2XSD C;  4EGY A;  1HW1 A;  3GZ5 A;  5CVR A;  4XLH A;  4B4C A;  3OYL A;  2DA6 A;  1R49 A;  3VFZ A;  3AG2 H;  1FTT A;  1FSE A;  2FRH A;  4M3G A;  4XSX F;  1BA5 A;  2F5C A;  4YIF A;  5J1Y A;  1CGP A;  2YR2 A;  5DD4 A;  2ZB9 A;  1ZG1 A;  1GVJ A;  5J4V A;  4BGD A;  3DBL B;  2QA4 I;  3L09 A;  2R93 J;  2R7X A;  1R5H A;  3C2B A;  4KN4 X;  4Q48 A;  4BHB A;  3JRD A;  3IH3 A;  4P9F A;  2HYF A;  2Y30 A;  3HGY A;  3TDZ C;  4Y3O A;  1YQA A;  2BV6 A;  1YRN A;  2NNN A;  1QZE A;  3ZN1 A;  2RVC A;  4C9Y A;  5D5X B;  4BDY A;  4KFC A;  3I5U A;  1SFX A;  2PI0 A;  3RZO J;  2NNY A;  2ZJ2 A;  1D0X A;  3V4G A;  1PVE A;  2EH3 A;  2XVC A;  2OCC H;  1K6O A;  3JTG A;  1HKQ A;  3JRI A;  3KYD B;  1WH5 A;  2BY1 A;  1WJA A;  1V4R A;  3EUH A;  1FWZ A;  4LB6 B;  5DCM B;  2GA1 A;  2OTJ I;  5EEA A;  4UNO A;  1T98 A;  2OC6 A;  3KP5 A;  4HLX A;  5E20 A;  2H1L A;  2V1D A;  1EF4 A;  4P1W A;  5DDG A;  3BLY A;  1W7P A;  2IJL A;  2HZT A;  4L5E A;  2QVO A;  1VQO I;  4KIT B;  1LFB A;  2BY3 A;  5JVT A;  2IA2 A;  3ZMU A;  2M5W A;  2R7V A;  3HM5 A;  4F55 A;  4IRG A;  2CUZ A;  2K86 A;  4XQF A;  1POG A;  3CP2 A;  1LDJ A;  1IAW A;  4XRS A;  4XL9 A;  5F08 A;  1KQ9 A;  1SEU A;  1AKH B;  3QPL A;  2KP6 A;  3ZMV A;  2K3F A;  1Y1W J;  5BNG A;  4B1R A;  2W24 A;  2NVQ J;  3FXK A;  1IXS B;  1RUO A;  3G1L A;  1K83 J;  3WHB A;  1TNS A;  1QRY A;  1SMY F;  1V5F A;  3HB9 A;  3FK7 A;  2LK2 A;  2XGD A;  2Y48 A;  5HDK A;  1WZ2 A;  2IS2 A;  3CQZ J;  1R7J A;  2DQL A;  3LQR A;  5F0C A;  3K7A J;  3CO6 C;  3E7L A;  5J1U A;  3H35 A;  3PQK A;  2ZXW H;  3DBR B;  3M1E A;  3IP4 B;  4ZZL A;  4XN0 A;  2CG4 A;  2VPR A;  2STW A;  1BR4 A;  2GXB A;  2VON A;  2IXS A;  2PJR B;  4FT8 A;  5LGN A;  3R6S A;  2V26 A;  4WX9 A;  4FQG A;  5CVJ A;  1X4O A;  1KU7 A;  1XGN A;  1VQL I;  2HYJ A;  4ESB A;  4RLQ A;  4EM2 A;  2XAJ A;  3CF2 A;  1ZTR A;  5HS7 A;  5E18 F;  2CUF A;  4BHP A;  1R58 A;  2JVH A;  3HTS B;  4HX4 A;  1PDN C;  1MMS A;  4HG2 A;  2VPL A;  3BPV A;  1R36 A;  4WXC A;  1WVR A;  4PFO A;  4UXN A;  2NS8 A;  4I76 A;  4RBO A;  1TQM A;  1C0W A;  4GRI A;  3EDP A;  3WU2 C;  4DGW B;  5IP6 A;  4XOR A;  3JCU C;  2YX4 A;  1VQM I;  3K70 C;  1R4M B;  2LRE A;  2VQH A;  3ZPL A;  1Y8Q B;  1WRJ A;  2FQ4 A;  4L5J A;  5J4Y A;  3DKW A;  1N25 A;  1T95 A;  5E1X A;  3V42 A;  3P7N A;  2XSJ C;  3IV5 A;  4BDZ A;  3BG6 A;  2M4K A;  2X1D A;  2CWE A;  2MA3 A;  3A2K A;  1T6S A;  4HQM A;  4CO8 A;  5F64 A;  5K5O A;  2X9D A;  2DYR H;  1WJF A;  3EPZ A;  2LG4 A;  2P7C B;  2KZV A;  5FLV A;  4JK1 X;  2W4S A;  1FOW A;  2V1U A;  4KIG A;  2HR3 A;  1MH3 A;  2ID6 A;  4A3I J;  4RS8 A;  4I02 A;  1YIT I;  4EJT A;  5FRM A;  1YW8 A;  2P6T A;  3JSP A;  4UV9 A;  2L9S A;  2RC4 A;  3LST A;  4ESF A;  3ZN0 A;  1RET A;  2LY1 A;  1IW7 F;  4M9X A;  5DCF A;  2LDU A;  1BI1 A;  3SZP A;  2LFB A;  3L9F A;  4XRM A;  3WU0 A;  3QU3 A;  2MW8 A;  1KQ0 A;  3LSG A;  3TGN A;  2VC0 A;  5FKK A;  1IN4 A;  4NQW B;  1WI3 A;  3D5S C;  2L7M P;  4KIB A;  4B3X A;  4X0G A;  3K2A A;  1XGM A;  5ERI A;  3FMQ A;  2LF8 A;  2MSY A;  5LHI A;  3U9G A;  1SFU A;  3IL2 A;  1X2N A;  5F6F A;  1D3Y A;  3VWB A;  1OR7 A;  1A36 A;  3E6M A;  1GV2 A;  2KHM A;  4R1H A;  1T8I A;  3CC2 I;  2GA2 A;  2OU2 A;  3QP5 A;  3K4B A;  2E2H J;  1D1A A;  1OCC H;  2D1H A;  2QKL B;  2RGV A;  4AU7 A;  3S16 J;  3IAS 2;  2KDO A;  1KU2 A;  4RAF A;  3S32 A;  3ABL H;  2IA1 A;  4A0X A;  4F92 B;  3ISP A;  1JGS A;  3RPU A;  1E3P A;  4MQV A;  2KRC A;  2HS5 A;  3MMY B;  2D5V A;  2WV0 A;  1P7J A;  2HDC A;  1ORK A;  1JUM A;  3DLA A;  4HF0 A;  2W57 A;  1KU9 A;  3ZQ7 A;  4UB6 C;  4ENK A;  1JHF A;  2RKH A;  1BJZ A;  4PSW A;  3ZCO A;  1T39 A;  1JKQ C;  1R6R A;  4G12 A;  1ZRE A;  2FMY A;  4A3M J;  4OMY A;  3OYJ A;  1ZK8 A;  2UZK A;  3B02 A;  1ZH5 A;  2LY9 A;  5L3D A;  1FYK A;  4S0H B;  4IO9 F;  1HDP A;  3IWF A;  4C2M J;  2Y9Z A;  4OOI A;  4E7K A;  1IV8 A;  3CCY A;  2HZD A;  4DIQ A;  4L0Y B;  1LVK A;  3KLO A;  1RIO H;  2DAO A;  1IJW C;  4RM3 A;  2XC7 A;  5GTI C;  3HOU J;  5D6F A;  1TBX A;  1S7A A;  5H20 A;  3H5N A;  3GFJ A;  2P4W A;  1BW5 A;  5HS8 A;  2P7V B;  2JUG A;  4XOP A;  1OCZ H;  2BXZ A;  3AG4 H;  2V4J C;  3QYE A;  2E60 A;  1ETX A;  3HSE A;  4W1U A;  5E8I A;  2P8T A;  4NUB A;  3I56 I;  1EKE A;  3HKZ N;  1A5J A;  4EAT A;  2IP2 A;  2HVR A;  2GWR A;  4W97 A;  1HSJ A;  1OCT C;  1TWC J;  2ZFW A;  1ZLJ A;  3ERM A;  4FIS A;  4I7H A;  1BR1 A;  3J7Y J;  1VI0 A;  2PMH A;  3DKX A;  1YJW I;  3BCB A;  3BOQ A;  4MTE A;  2OPT A;  2FNA A;  1FJL A;  3G2B A;  2ME0 A;  2XAU A;  3LSM A;  3C3W A;  5JFR A;  3O3K A;  4HW0 A;  1XD7 A;  3S2D J;  3WGH A;  2CV2 A;  2TDX A;  1TT0 A;  4AYB N;  4R79 A;  4MHG A;  2QF7 A;  2Y2Z A;  4MEX F;  4HOB A;  3UKG A;  1W36 D;  2KIS A;  2AXL A;  5D5V B;  2F48 A;  1FY7 A;  1EH6 A;  3MZY A;  5FGM A;  2D45 A;  3GVA A;  1K78 A;  1NH3 A;  3KZZ A;  2WB1 N;  3E6D A;  4IQ4 A;  3L1P A;  1ZKG A;  4XRS G;  1U5T A;  2DA4 A;  2OZ6 A;  2A61 A;  2QKM B;  1QHH D;  2DT5 A;  1I1G A;  3ZOB A;  4LD5 A;  3TO6 A;  3TED A;  4A3B J;  4A93 J;  4ZYE A;  1YOV B;  2VT2 A;  3H36 A;  4JP0 A;  1ZG5 A;  1ACI A;  5GPA A;  5EEH A;  3ZQL A;  3WTX C;  3Q0U A;  4HX7 A;  1G6N A;  4I2O A;  4CYC A;  4U0V A;  4E7I A;  4CH7 A;  3Q9V A;  5D8L B;  2HDD A;  3IC7 A;  3SHF A;  3E5X A;  2HGC A;  1IGN A;  4S05 A;  4BQQ A;  3SXY A;  3V8K A;  4AVZ A;  2AQF A;  1TW3 A;  1BOB A;  2BY0 A;  2K7L A;  4XMY A;  3DPT A;  2Z2S B;  2Z16 A;  2ZSH B;  3BTJ A;  3FM5 A;  3WTZ A;  2KLO A;  3IHU A;  2EV5 A;  2IRF G;  3VYS B;  3KEO A;  1S8N A;  1LDK B;  4ZYH A;  3ZRG A;  3QPS A;  4KIS A;  2JPB A;  2WWY A;  4ZZD A;  5AON A;  3T0Y A;  3BR0 A;  2XRL A;  1MJA A;  4CCK A;  2D1V A;  3LAP A;  2VUM J;  1WJ5 A;  3TDU C;  1OLT A;  4MNU A;  3K2Z A;  4L9T A;  2DT7 B;  3TW6 A;  4UVA A;  3BR3 A;  4A3K J;  4IHW A;  2J5O A;  2YSR A;  2ELJ A;  1UST A;  2XHK A;  4M3F A;  1T38 A;  1ZLK A;  5L3F A;  4HV6 A;  2DMU A;  1IXC A;  3WTY C;  3K4M A;  2OAZ A;  2QSG X;  5BS6 A;  3DEU A;  5K7F A;  3FXJ A;  1IRF A;  2CH0 A;  2JN6 A;  2FBK A;  2K85 A;  3R4K A;  4LMY A;  5J47 A;  3HDD A;  5CQE A;  5E8G A;  2W82 A;  3REO A;  2PMZ A;  1Z9C A;  2DW4 A;  3K70 D;  1I50 J;  2X48 A;  4CYD A;  2F2E A;  2VBW A;  2J5P A;  2Y0S A;  2DXI A;  4IVN A;  5GAH J;  1HA8 A;  1ULY A;  2R5Y B;  3Q0V A;  1FBU A;  5IT9 Z;  4BY7 J;  1IDY A;  2COB A;  5DEQ A;  2R7Q A;  1P7I A;  4ZTJ A;  2FF4 A;  4G6T B;  3F3X A;  3LMM A;  4LG0 A;  2JTV A;  2LKX A;  4M3D A;  1HDD C;  3LSJ A;  1U6G A;  2CW7 A;  3I9V 2;  4EJV A;  4RGR A;  2X6W A;  3GCM A;  4G7H F;  4OIR F;  1NK3 P;  4M3B A;  1Z67 A;  1X1P A;  2XIG A;  3A03 A;  2HOS A;  4UVB A;  3JAM K;  3CCR I;  4L5I A;  4OAY A;  4WF2 A;  1XCB A;  2IA0 A;  1FMV A;  4A5N A;  2Q8K A;  2GOM A;  2JWT A;  1MMN A;  3CCS I;  1L3L A;  2W48 A;  4ESJ A;  5KVR A;  3KYL A;  3GUD A;  3B6A A;  2DMP A;  3SFZ A;  4AWX B;  1E3H A;  2E1M B;  4MIM A;  4NC8 A;  5JLX A;  1DQU A;  1UJ8 A;  1Y6I A;  1W4M A;  5ICE A;  3OYM A;  4DJA A;  2DN0 A;  2RAE A;  2QSF X;  1VFC A;  1JXS A;  2X6X A;  2ZNY A;  3P9K A;  2MH9 A;  2M3A A;  1QBJ A;  1XGO A;  3ESW B;  1X1A A;  4TV7 A;  3SYT A;  2MLK A;  3KZI C;  1VQK I;  3V7S A;  2VOD A;  1P4A A;  4N0B A;  3PIP F;  1ON2 A;  4N9H A;  2K9M A;  1YYV A;  2FNP A;  1LFP A;  3DXJ F;  1BC7 C;  2ESN A;  4BE2 A;  3GME A;  1MKM A;  2E1N A;  1OYY A;  3G73 A;  4P9U A;  3PFI A;  1YS6 A;  3MWM A;  3GZ6 A;  1YI2 I;  5FO5 A;  5CKT A;  3QRF F;  1YJ9 I;  3PO3 J;  3OSG A;  2R5Z B;  5J8C A;  2FD5 A;  2XAQ A;  2OTL I;  3S8P A;  4AID A;  2XF7 A;  3OS1 A;  2JQ7 A;  2MH2 A;  4MFD A;  1I1S A;  1ZN2 A;  4JYK A;  2ETH A;  2V9K A;  1SC7 A;  3J7A Y;  2NVT J;  1NG7 A;  4N9I A;  3BG9 A;  5B1A H;  3K69 A;  3JSO A;  2RV8 A;  3ZXS A;  2JZY A;  3CO7 C;  3TL4 X;  3H3Z A;  3GX4 X;  2RN7 A;  2DJI A;  2P6S A;  5HVQ C;  3GFI A;  4LB5 A;  4QTR A;  2O0Y A;  4MO7 A;  2WAQ N;  1FZP B;  2EIL H;  1YHQ I;  5L3B A;  1OYW A;  2VI6 A;  3PSI A;  5JR3 A;  3E3V A;  1U8R A;  3CDL A;  4A3J J;  2LY2 A;  1BI0 A;  2DFE A;  2QEX I;  3U21 A;  4CCL A;  4A3D J;  4A6D A;  2KRF A;  2W84 A;  4UUS A;  3F6V A;  4XLA A;  1IN6 A;  3S1N J;  4UUV A;  4CZC A;  2L4M A;  4YII A;  3VSK A;  2P5K A;  1WQ2 A;  3I4P A;  3G3Z A;  3OYF A;  3C1D A;  2O03 A;  4PGH A;  5BPD A;  3FMS A;  4DZP A;  5CPR B;  4YRV A;  4ZYD A;  2F5D A;  3JRB A;  3HL2 A;  2ZJQ F;  1MD0 A;  5HNH A;  1CF7 A;  3FF5 A;  2BW3 B;  1ZHF A;  3BY6 A;  3P9C A;  2KQR A;  2VE9 A;  4ON0 A;  2BVM A;  3IWZ A;  2JA2 A;  5B1B H;  4HF1 A;  4ZDP A;  1Z91 A;  2VJ4 A;  3FMR A;  1QNT A;  2G7U A;  5K7H A;  3FM3 A;  2MG4 A;  1UB9 A;  2QQ8 A;  3WGG A;  3CC4 I;  2PX9 A;  2CU7 A;  1MMA A;  2HDW A;  5EYR A;  4E7H A;  2HQ5 A;  2Y75 A;  1KA8 A;  2VJJ A;  3RKY A;  2WAE A;  4O3M A;  3CDI A;  2WAF A;  2R92 J;  2VQG A;  1F4K A;  3V7R A;  3GTQ J;  3L2C A;  5ILS A;  2XF5 A;  4DBR A;  3CME I;  1VQ9 I;  1OJL A;  1MJB A;  3VYR B;  4C2U A;  4QPO A;  5H2F C;  4GDF A;  4EJW A;  3C7J A;  3N97 A;  1ZAO A;  4ENN A;  2IAI A;  3K4J A;  3CUQ C;  4BHC A;  3ASN H;  1H0M A;  4BNC A;  4PCQ A;  2ISY A;  2A6H F;  5KCM A;  4WK8 F;  1G8X A;  2FSW A;  4IPA A;  1USS A;  3G1M A;  1YE9 A;  2W85 A;  5HS9 A;  2CFX A;  4Y7N J;  2L7Z A;  1YW9 A;  2V6E A;  3EQL F;  2V7F A;  3HUG A;  4E4H A;  3QOP A;  4MTD A;  3GF2 A;  3OY9 A;  2KKO A;  2DA5 A;  2I10 A;  5M3M J;  2Z99 A;  1VQN I;  2LBF B;  2K5C A;  2LVS A;  4BJ6 C;  3BT9 A;  3DBH B;  3RYP A;  3OYK A;  2F4I A;  2XAG A;  5HOD A;  1MDM B;  1XDS A;  2DU9 A;  3KFW X;  2VKE A;  4ZJZ A;  2JVG A;  2KZG A;  2X51 A;  1TQI A;  4D7M A;  3IKV A;  4U88 A;  4P5O A;  3K6G A;  2PBI A;  1AU7 A;  2XRN A;  3KP2 A;  2W00 A;  4QWQ A;  4BQN A;  5LGT A;  1Z3X A;  5F27 A;  2B7E A;  3BG7 A;  3CCU I;  1S3J A;  1MBG A;  1V5G A;  5FLX Z;  4IXA A;  3PJR A;  4RAG A;  2WY8 Q;  5EGO B;  4HNV A;  1MBH A;  5FLX K;  3R0A A;  4J19 A;  1FSH A;  1I6X A;  4B09 A;  1T0F C;  4HDU A;  1RR8 C;  3KX2 A;  1IUY A;  4X6A J;  2IVM A;  3I59 A;  3CLO A;  3F0C A;  3MCZ A;  5J6X A;  4C3H J;  3OMY A;  5DD8 A;  4XID A;  1BL0 A;  4EVI A;  5JVG F;  4P96 A;  3U1K A;  2ZME B;  2R7U A;  3GTK J;  2Q1Z B;  2LSO A;  2BZT A;  1U3E M;  1X4P A;  2O7O A;  4Y17 A;  2XKP A;  2R7F A;  5AIP A;  2M2E A;  2DA7 A;  4XLF A;  1ZG3 A;  4CA0 A;  1IUF A;  1XSX A;  1Z77 A;  5ILU A;  1XB4 A;  4PJM A;  2EZI A;  4D1Q A;  5LBQ A;  1W5T A;  4BQA A;  5FFX A;  2ME6 A;  4A3L J;  3LAJ A;  4ASN A;  2HKX A;  3GTO J;  2UXN A;  3KEY A;  1PJR A;  2H27 A;  4B47 A;  1AA7 A;  5C44 J;  4GO1 A;  3LSP A;  1DGR M;  3QP6 A;  1FMW A;  1LJ9 A;  2HOT A;  1OMI A;  2JA6 J;  4L9N A;  2QCO A;  4ITV A;  3TQN A;  1ETK A;  5ED4 A;  1BI3 A;  3CMA I;  1QZY A;  3VPR A;  5DM6 F;  5DV5 A;  5EJC A;  3CUQ B;  1STZ A;  2DMN A;  1WKM A;  4XKB A;  2LP0 A;  4IRH A;  2L01 A;  2IEK A;  4LIU A;  4HRI A;  1P4X A;  1VQP I;  4IKF A;  1ETW A;  1SVM A;  5K1Y A;  3S93 A;  1KYW A;  1RZ4 A;  3SZT A;  3VDX A;  2Q2E B;  3L7W A;  3D5L A;  4HST A;  1EV7 A;  2M8E A;  2V9V A;  2R7W A;  1BIB A;  3F8F A;  2VQC A;  4PJJ A;  1D1C A;  1MND A;  4DQ2 A;  4KUM A;  1XSD A;  4F3Q A;  4RB3 C;  2DOF A;  2LD5 A;  3FBN B;  5A2Q Z;  4M6X A;  1A35 A;  1J7K A;  3T5X A;  3E5U A;  2LNB A;  2CV1 A;  2CV0 A;  1XC5 A;  1GDT A;  4AD9 A;  1SAN A;  3HJE A;  2MFZ A;  4DBQ A;  1D0Y A;  2M7A A;  1BIA A;  5D5W B;  4BE1 A;  4PJN A;  5LRR A;  3BZ6 A;  1Z7U A;  1MMG A;  2A5Y B;  1BI2 A;  3O8H A;  4BXF A;  4IOA F;  2XAS A;  2ZKZ A;  3Q9S A;  4DYR A;  2BY2 A;  2KJB A;  2FU4 A;  5D5U B;  4IHS A;  2CS3 A;  3E97 A;  4LK1 F;  3KZY A;  1OIS A;  2ZXI A;  2QBY B;  1S72 I;  5HLI A;  2X1C A;  4CHU A;  4LLL A;  5EG0 B;  4GFB A;  2R7T A;  1YX3 A;  3B73 A;  2XPV A;  3F6O A;  4IQJ A;  2EWN A;  2ZBK A;  3J7A O;  3NQO A;  1LNW A;  3ZGK A;  1W0U A;  4DW6 A;  1BN5 A;  2PMU A;  3FWE A;  3RZD J;  1QVT A;  3MKW B;  2AO9 A;  3RTR A;  5LD2 C;  2W25 A;  2X6Y A;  3I0T A;  4U7D A;  1UAA A;  1PUF B;  5L3C A;  2Z3Y A;  2XGC A;  2HYG D;  4IHX A;  4XK4 A;  3JRG A;  1J2X A;  4Y15 A;  3T1B A;  5CYV A;  3ONQ A;  2H8R A;  4B44 A;  3QOE A;  1YO5 C;  4CXF A;  2EIJ H;  2P5L C;  2QQB A;  1H9T A;  3M4O J;  2AS5 F;  3OSF A;  2JK3 A;  3BPX A;  1XCV A;  1DGW Y;  3J7Z I;  1I39 A;  2WBM A;  1SAX A;  1ERD A;  1Z7L A;  2AXT C;  3RKQ A;  2IS6 A;  1X3Z B;  2V1X A;  2ZXJ A;  1NTC A;  1WI9 A;  3K1M A;  3OYD A;  3NRV A;  2VT3 A;  4CCN A;  3RSN A;  5B3S H;  1I6H J;  4BKX A;  2DPD A;  3BZC A;  4OIN F;  2G7H A;  4E7Z A;  3I3L A;  3WOD F;  2EB7 A;  3OYG A;  4YEJ A;  1HCR A;  1VQ5 I;  3S1R J;  3KP7 A;  4ABZ A;  1BW6 A;  4ZH4 F;  4OAZ A;  1HKS A;  4F91 B;  3S1Q J;  1F9N A;  1HXD A;  4J00 A;  2LLK A;  4BEH A;  3RDI A;  3MKY B;  2OV7 A;  2ELK A;  5H6Q A;  3SFI A;  3OIQ A;  4LJZ F;  1EH8 A;  4RB2 C;  3E5Q A;  4DYQ A;  3GTM J;  4CSW A;  1LE8 B;  1TT5 B;  3ZMD A;  1UCR A;  1X58 A;  1IRX A;  1HW2 A;  3BR5 A;  2GM4 A;  2YU9 J;  2CO5 A;  3C18 A;  2DK5 A;  2CQX A;  5FD6 A;  5CVV A;  3ERE D;  4PJ0 C;  1O57 A;  4C30 A;  3TW7 A;  1MGT A;  3E6C C;  1BM9 A;  2LKP A;  4G6D A;  3IRQ A;  5TJJ A;  1B72 A;  3BWG A;  4UV8 A;  1WCM J;  5IP7 J;  1ITY A;  3KPH A;  3EYY A;  2WV1 A;  3SEQ A;  3I55 I;  3OL3 A;  1B8I B;  2HOE A;  3BJO A;  3KP6 A;  4D9J A;  1JT0 A;  1UHM A;  2R7D A;  2G0E A;  3PM1 A;  4BBS J;  5J3L A;  1K61 A;  1X1C A;  2Z5U A;  2IS1 A;  3DP7 A;  4KYW A;  5K7Z A;  3EYI A;  5DTD A;  1B9N A;  4I01 A;  2FX0 A;  3A01 A;  1UEL B;  3DKY A;  3L2W A;  4AIK A;  4ETS A;  4II3 A;  5C3E J;  2MGQ A;  3HXL A;  1N75 A;  2O8K A;  1RKW A;  2RNG A;  5TIS C;  5FKN A;  1R23 A;  1ZYR F;  2VN2 A;  1U9N A;  3RI4 A;  5KHD A;  3OWT A;  2X4H A;  3GTP J;  1R1U A;  1NG6 A;  4NBQ A;  5EZG A;  4WXH A;  1Z1D A;  2XDV A;  3CCL I;  2KIQ A;  5D6E A;  5H6R A;  2R7S A;  3MVP A;  3BR2 A;  3ZQF A;  1HOM A;  2O8X A;  4UB8 C;  1LQ1 A;  1YS7 A;  3M8E A;  4Z2Y A;  3RQI A;  1IRZ A;  3TO7 A;  4RGS A;  4XKV A;  2GIZ A;  3FBI B;  1V3F A;  1TL8 A;  3HOW J;  3IKT A;  1YJN I;  1MH4 A;  2CMP A;  4M3E A;  4I6Z A;  3ML6 A;  2VBZ A;  3LL7 A;  4KMU X;  2KFD A;  1AHD P;  2A5W A;  2IGO A;  2ZC2 A;  1MBF A;  3VSL A;  2M9H A;  4IHT A;  4M73 A;  3JTH A;  4XRF A;  4HLY A;  2YUS A;  2DBB A;  3HHH A;  2KIM A;  3GO5 A;  3ASO H;  1YTY A;  1WH7 A;  1Y0U A;  4P55 A;  4KMF A;  1ZAR A;  3JRF A;  1W0T A;  4BU2 A;  1Y0N A;  1OFC X;  2RQQ A;  3TP0 A;  5GTH C;  1D5Y A;  2JA7 J;  1TTY A;  5BQT A;  2CFO A;  1TC3 C;  4NDL A;  5DCM A;  1D8J A;  4EJO A;  3ZMZ A;  5KNL A;  3DTE A;  2F4M B;  4Q4Z F;  1IG7 A;  3HG9 A;  3HOS A;  1QA6 A;  3EUH C;  4RDU A;  5AIQ A;  2ESH A;  3OS2 A;  2XRO A;  4OIQ F;  4G9Y A;  3WHC A;  2JSP A;  1R00 A;  2RNJ A;  1K4T A;  3T8R A;  3S14 J;  2JPC A;  3HZJ A;  3A0B C;  1FBS A;  1O3Q A;  1I5Z A;  2VXZ A;  2XV4 S;  4YFK F;  1J75 A;  2O61 A;  1VQ7 I;  4I99 C;  5HLH A;  4BAY A;  3PO2 J;  4HV5 A;  4OU0 A;  2LMD A;  3KCC A;  2DA1 A;  2E1M C;  4ZC3 A;  3I58 A;  2HQN A;  1AKH A;  1ODD A;  4M74 A;  2STT A;  2DYS H;  1OKR A;  2EBI A;  3WE3 A;  2COM A;  2F5V A;  1LDD A;  3S3O A;  2JJ7 A;  2JUC A;  2PN6 A;  4Y52 J;  2L4A A;  3H5R A;  3WGI A;  1IC8 A;  2DPU A;  4A3C J;  1S29 A;  1HBX G;  1P2F A;  3KP4 A;  2OQG A;  4QSH A;  1R5I D;  3N4M A;  2ZO4 A;  3LSR A;  3H0D A;  4O5V A;  3BRO A;  4F7Z A;  4II2 A;  4UUT A;  2WTE A;  2G9W A;  1TWG J;  3ZMT A;  2EFO A;  1P4W A;  3VOD A;  4E70 A;  5HOO A;  2FEZ A;  3TMO A;  3MKZ A;  2PJR A;  3K1P A;  4B43 A;  3WTV C;  3BC8 A;  2YPR A;  1FNN A;  5GAE J;  1LEB A;  1TWF J;  3CCE I;  1WJE A;  2EV6 A;  2XPW A;  4HSR A;  3KYC B;  3WTT C;  1WFX A;  3FKJ A;  4M9Z A;  3L2U A;  2DOE A;  3L2V A;  2HKO A;  2IS4 A;  5ICC A;  3LSH A;  1I3Q J;  1TLH B;  4IRI A;  3L2Q A;  3ZQI A;  3QWL A;  3PFY A;  2CQ7 A;  4IF4 A;  3OYN A;  4KT6 A;  4AM3 A;  3DTK A;  1XMA A;  1YRN B;  2GZW A;  1TW2 A;  1APL C;  2E7W A;  5IT9 K;  4D7N A;  3UR3 C;  3ZR8 X;  3NAU A;  4NB5 A;  5IP9 J;  2NS0 A;  3H9J A;  2L2O A;  3FXR A;  3VYT B;  2R7Z J;  3M9A A;  2X85 A;  1DPU A;  2M8G X;  4Y4R A;  2PMZ N;  4FHT A;  3BP8 A;  4IX7 A;  4EGZ A;  2IBD A;  4GXO A;  4HBL A;  1U78 A;  1QVU A;  1QQI A;  2HEO A;  2Y0S N;  3I71 A;  3KET A;  1FIP A;  1R71 A;  2NVU B;  1VF9 A;  1YX5 A;  5E1Z B;  1XMK A;  3R60 A;  1JTX A;  1W7P B;  2Z1D A;  5HDN A;  4CCJ A;  1EA3 A;  5M5Y J;  2ECC A;  3VB2 A;  4G7O F;  2TRT A;  2Z33 A;  2DI3 A;  2K40 A;  3OR2 C;  5M3F J;  1FPQ A;  4ENM A;  2W1O A;  2M7B A;  1P9Q C;  2BOL A;  3KLN A;  2L02 A;  1TZL A;  1O7L A;  5E17 F;  4KIC A;  3K4N A;  2DTZ A;  3NWS A;  4RGU A;  1SD4 A;  2M30 A;  2E1O A;  3H9Q A;  4ZTF A;  5IOY A;  1MBJ A;  1Z0X A;  3DWL E;  1E3O C;  1OCR H;  2HOA A;  3F22 A;  4AC0 A;  3V7C A;  4AIJ A;  5E3O A;  5HDG A;  1B1B A;  5DS9 A;  3HOZ J;  1HC8 A;  4LFU A;  1YG2 A;  1MJ9 A;  1GHC A;  2MYS A;  3TKY A;  2UWM A;  2QSH X;  2ZFU A;  4NQW A;  1RNL A;  1E2X A;  2FOW A;  2KRH A;  4LLG F;  2OJE D;  4HPQ A;  4RA2 A;  5EF6 A;  1M1E B;  3GW2 A;  3BZK A;  2YS9 A;  4PGG A;  3JRE A;  1JKO C;  1J5Y A;  2DDA A;  1OQY A;  3C2G A;  3O8G A;  2D2W A;  3QPT A;  2HQR A;  1OR7 C;  1QZZ A;  3GWZ A;  4HYE A;  3J81 Z;  1RR7 A;  2LKS A;  2MC3 A;  3CCM I;  2M0M A;  2OD5 A;  1G59 A;  3G4S I;  1BBY A;  2QZ8 A;  4KJZ A;  4PSX A;  4KIF A;  4KNY A;  3U2R A;  3CJN A;  1WPK A;  1LPQ A;  5LHG A;  2ZJR F;  4IZZ A;  5D8K B;  3I4N J;  1FLI A;  3M8J A;  4RMN A;  3JRA A;  3BJA A;  3PIO F;  3E0J B;  3FXO A;  4XLP F;  2VC1 A;  1DPR A;  3EUK L;  2E2I J;  2L9V A;  1B8I A;  2EZK A;  2DFI A;  2JRT A;  2KMU A;  5ILV A;  5FRN A;  4JX6 A;  3K1N A;  2YX7 A;  2L7K A;  1D5V A;  1O3R A;  1SD6 A;  2WA0 A;  3HHG A;  5KK1 A;  1K79 A;  3GFM A;  1ETV A;  5CVI A;  3HSR A;  4UHT A;  1K4S A;  4A2U A;  2L0K A;  5IYB J;  1R22 A;  2BE5 F;  4FE7 A;  2HTJ A;  4FX4 A;  2E2J J;  3ABK H;  3EET A;  3WTU C;  1AOY A;  4ZDO A;  4IEJ A;  3HSF A;  2XUB A;  3HOX J;  2Y31 A;  5E3M A;  2GAU A;  1V5E A;  3RPQ A;  4O6J A;  4HAM A;  1O4X A;  1B4A A;  1XDU A;  4L9V A;  2A05 A;  4MEY F;  4WWC A;  2V6C A;  2KIF A;  4CIC A;  4UY8 I;  2O5R A;  4LK0 F;  3CD6 I;  4MFE A;  1XG1 A;  1T2K A;  2E1C A;  2B63 J;  3T8T A;  1ZEL A;  3S15 J;  2EK5 A;  1SFK A;  1R5G A;  3PUF A;  2IT0 A;  4BY1 J;  2DA2 A;  3PSF A;  2EIN H;  4OIP F;  3FK6 A;  2ZCW A;  4M71 A;  3MZ8 A;  2QYO A;  5HLT A;  1FTZ A;  1BOA A;  3WG9 A;  1IZ1 A;  3FHN A;  1LFU P;  1FP1 D;  1BC8 C;  3HTU A;  1FP2 A;  2IGM A;  2ZME C;  2UXX A;  4KT5 C;  4LIT A;  2K4J A;  2H6B A;  5LEJ A;  2A6E F;  1Z05 A;  3X2Q H;  1O3S A;  1RRJ A;  2XAH A;  1FYL A;  2HXO A;  3LQQ A;  2FXA A;  2FE3 A;  2Y69 H;  2BEO A;  1T56 A;  3J80 Z;  4BYY A;  3GFL A;  3HRU A;  2F6C A;  1KYZ A;  4C3J J;  2K9S A;  3DTI A;  4I0B A;  1SD5 A;  3HOV J;  5ICF A;  1J9I A;  1IDZ A;  4M6Y A;  2OUM A;  4RAY A;  3IRR A;  1VZ0 A;  1G3T A;  1RKT A;  5K5R A;  3F8C A;  3H1C A;  4XM3 A;  4BJ5 C;  2BHY A;  3S2H J;  4XLN F;  5D4S A;  3ECO A;  1IXR C;  1U0J A;  1W1W E;  4QPQ A;  1U5T C;  3G1O A;  2L5Q A;  4GYG A;  4N4O B;  2VKD A;  2R7O A;  1ZGJ A;  3FIW A;  5EZH A;  2DK8 A;  1H89 C;  1X3U A;  2A69 F;  2CW0 F;  3W6J B;  3CMY A;  3W2V A;  1RC9 A;  2FQ3 A;  1PYV A;  2JSC A;  3CTA A;  1SVO A;  2OZU A;  1GLN A;  3ZQC A;  2PG4 A;  3IH4 A;  2HWV A;  2RDP A;  3H9G A;  3LOC A;  1ETO A;  2Y0M A;  1UFM A;  3NAR A;  2LTP A;  4KA4 A;  3MZH A;  1LEA A;  2PQ8 A;  1REP C;  1A6Q A;  2A68 F;  2CJJ A;  5EEG A;  1A31 A;  3TBI A;  2NVY J;  2JMW A;  3FIS A;  3COA C;  1JKR C;  3HEF A;  2LF7 A;  4DOZ A;  3CJR B;  4Y13 A;  2QEN A;  3MN2 A;  4XON A;  3GTL J;  4G7Z F;  2ID3 A;  4A3E J;  3PQJ A;  3LSI A;  2EFW A;  1DU0 A;  3RYR A;  3V8J A;  3H92 A;  1ENH A;  3DPL C;  1E0E A;  3IH2 A;  5CQG A;  1W5S A;  2VJ5 A;  2DCE A;  5BMZ A;  1Y39 A;  3OIP A;  3D1N I;  1MBK A;  1G3Y A;  4HEA 2;  1BR2 A;  3TOB A;  4HF2 A;  3P5J A;  1F43 A;  4OWR B;  3OIO A;  1IV6 A;  1X1B A;  2P0W A;  4JQF A;  2LRD A;  1U8B A;  1G3W A;  2VE8 A;  1GXP A;  1NK2 P;  4V2F A;  5IYD J;  1D0Z A;  2GBY A;  2BXY A;  2IGK A;  4NC7 A;  4XIC A;  1YIO A;  2R5Y A;  1DUX C;  2GIV A;  1N77 A;  4BAC A;  1J59 A;  1QPM A;  3GZN B;  5CLS A;  4XBF A;  1MIJ A;  1MZB A;  2AHQ A;  3A4C A;  3OOP A;  3BG5 A;  4H0E A;  3AG1 H;  4NHJ A;  3S3M A;  2HVQ A;  2DOA A;  1IO2 A;  4K2E A;  1P6R A;  4F93 B;  1A6I A;  3WU1 B;  3W6V A;  3M3Y J;  2XPU A;  4L18 B;  4I09 A;  1K78 B;  1Z3Y A;  3F8N A;  1MW7 A;  4YEL A;  4A5M A;  1TNT A;  1WGX A;  5KAF C;  3RCO A;  5E1W A;  1S5L C;  5E3L A;  1U5T B;  4OIO F;  1L0O C;  1HF0 A;  3DPU A;  4IL6 C;  1IF1 A;  1W36 C;  5L3E A;  4FCY A;  2I5U A;  2OF7 A;  5HNF A;  3AG3 H;  4CDG A;  2CQN A;  2M34 A;  4MLO A;  2K9Q A;  2DTR A;  1QU3 A;  2E34 A;  5FKL A;  2ELH A;  4CYC B;  3S17 J;  1GXQ A;  4JOM A;  5FKM A;  5F1J A;  5C4J J;  3KE2 A;  2B0L A;  5B66 C;  4FE4 A;  3CMM A;  2GQQ A;  2OCE A;  3KIO A;  3S3N A;  4BL0 B;  5J1R A;  3SQN A;  3ZMS A;  5JHF A;  1G2H A;  3CZ6 A;  2LR8 A;  4D0P A;  3PNY A;  1EJ9 A;  3HPH A;  3H0G J;  5GAG J;  5A2Q K;  2H09 A;  4HDV A;  2XKO A;  4EM1 A;  2NXN B;  1D8K A;  2HFH A;  1HW5 A;  3K4K A;  2EPF A;  3K9T A;  3VEP A;  2C6Y A;  3SEZ A;  1XTA A;  3QYB A;  2EZL A;  3CP8 A;  2VBY A;  2WY7 Q;  2R5Z A;  3CC7 I;  3RPU D;  1F36 A;  3FZV A;  2A07 F;  4WXD A;  1LB2 A;  3F9K A;  3QQA A;  3O2P E;  2L9N A;  3DEE A;  3FDY A;  4M6V A;  4BXX J;  2E35 A;  4HZF A;  2DLL A;  3LFK A;  1HKT A;  4FET A;  5DYM A;  1WJB A;  3EUA A;  2ISZ A;  1RUN A;  1F5T A;  2DMQ A;  2DFH A;  3BG3 A;  1VQ4 I;  3QOD A;  2F5E A;  4E7J A;  2VOO A;  2M0C A;  1KU3 A;  2CQQ A;  2ACJ A;  4L0Z B;  2VKH A;  1K6Y A;  1H9G A;  5J40 A;  1U9O A;  2L9R A;  3P9I A;  1TWH J;  2BBY A;  2NAZ A;  2M4G A;  2E71 A;  5F1R A;  1MNM C;  9ANT A;  4LG0 B;  5J8F A;  2WAD A;  5ICG A;  3PNT A;  3NEU A;  2DOD A;  2VLA A;  4HX8 A;  1J0R A;  3HPG A;  1ONV A;  4S04 A;  1JI8 A;  2EIM H;  1TQP A;  2Y9Y A;  4GYI A;  2A6T A;  3TOA A;  2OBP A;  2L7F P;  3KP3 A;  5JHU A;  2ZJP F;  1JTY A;  2X6O A;  1V54 H;  2XAF A;  3MKL A;  2LYC A;  3MQ0 A;  2BW3 A;  4HQE A;  3BQZ A;  2QGU A;  3I53 A;  2VB6 A;  1I3A A;  4MQ9 F;  2K02 A;  4C3I J;  4IHY A;  1FX7 A;  1OCP A;  1GV5 A;  2E7X A;  2JT1 A;  1ON1 A;  3JR9 A;  3HBL A;  2XGE A;  5IYC J;  2HPM A;  2KJC A;  1T33 A;  1TP4 A;  3F72 A;  2BVL A;  3FX3 A;  3N05 A;  4BJT A;  3DFG A;  1OCO H;  5FKO A;  4EMS A;  2M1B A;  3CCQ I;  2MAB A;  2IPQ X;  3O6B B;  4XN3 A;  3OV8 A;  1YFH A;  1S7O A;  2NOG A;  2LC2 A;  4AVP A;  3AAF A;  1SFO J;  3B6C A;  5K5Q A;  3TP3 A;  3F21 A;  2X1E A;  3DQV C;  3BTI A;  3ELK A;  3RIR A;  1Z6T A;  1UMQ A;  5BOX A;  1X3W B;  5F0F A;  4LOC A;  1BJA A;  4DNC A;  4PJL A;  2ZXH A;  4DZJ A;  4PFP A;  4E7S A;  1ZGW A;  3BTL A;  1GUU A;  2VJI A;  2VBX A;  4EM0 B;  6PAX A;  1W5C C;  3DU5 A;  4XR6 A;  4OMZ A;  2VAS A;  3W2A A;  3GEZ A;  5M5X J;  1SD7 A;  3BDD A;  2LBF A;  3JRH A;  3H3V K;  1HST A;  1ZQ3 P;  4U7B A;  1MDM A;  1G3S A;  3PL8 A;  4XKC A;  2JRM A;  1ZR2 A;  4LLN A;  2QWW A;  1IN5 A;  1EH7 A;  3R61 A;  2HVS A;  3HKZ A;  2E19 A;  2EFN A;  2Q0O A;  2MD5 A;  3M1C A;  4UUS B;  5E3N A;  2HI3 A;  1Q1H A;  1HQC A;  3WG7 H;  5EGO A;  3ZP5 A;  2H1K A;  1JUP A;  3I64 A;  2EA2 A;  4EEF G;  5IPA A;  3I54 A;  1PP7 U;  3H3U A;  3LNQ A;  3CCJ I;  2Z9O A;  3CUO A;  3RJP A;  4AYB A;  1JUS A;  2E36 A;  2LH9 A;  4RM2 A;  3GYH X;  2QLZ A;  2FOK A;  3DCF A;  3SDG A;  1B6A A;  1V55 H;  3ABT A;  4RAZ A;  3OYA A;  4N4N B;  2GXG A;  2ZME A;  2QM3 A;  1CF7 B;  1S6L A;  3F8B A;  2ZNZ A;  2VKV A;  4XKW A;  1R4N B;  2WB1 A;  1NHA A;  1O7F A;  1R1V A;  3RKW A;  5KAI C;  1KON A;  4LIV A;  4U0W A;  4L9J A;  1N78 A;  1D1B A;  2NYX A;  3A1Y A;  2DJN A;  1XX5 A;  3K4L A;  2O6G E;  2KT0 A;  2E5Z A;  2PLY A;  4IJA A;  2KL4 A;  4G6Q A;  2FBH A;  1S9H A;  4E6K G;  1ZR4 A;  2K9L A;  4EQQ A;  2H8W A;  5L3G A;  3QPH A;  2O9L A;  2EFP A;  2K27 A;  1MNE A;  2V79 A;  5FRO A;  2PEX A;  4BH9 A;  1XPX A;  3GTJ J;  1B59 A;  3OR1 C;  1U2W A;  2MD0 A;  1JT6 A;  3Q3S A;  4E7L A;  3ABU A;  4XSZ F;  4B3A A;  1Y8R B;  4G94 A;  5GP9 A;  2FJ1 A;  3W3C A;  4YFN F;  1WSU A;  3S1M J;  3CUQ A;  4A0Y A;  3FXU A;  4X1E A;  4EV0 A;  3BTC A;  4GGG A;  1H88 C;  1XGS A;  2DDB A;  1OPC A;  2CW8 A;  3W6K B;  5IY5 H;  4PDK A;  2K9N A;  5IOZ A;  3E6B A;  4KN7 X;  3D5R C;  3OYE A;  4I98 B;  1WJC A;  3ZQH A;  1FT9 A;  5M5W J;  3AL0 C;  1YIJ I;  2EQR A;  1IRG A;  5DUI A;  2Q2E A;  4Y33 A;  3BQY A;  1IN8 A;  3K4C A;  4CGZ A;  3HUG B;  2K4B A;  4V19 K;  3ULQ B;  1H8A C;  1XN7 A;  5CVU A;  2QQ9 A;  4R8H A;  4Q47 A;  5JLW A;  5GPC A;  1JE8 A;  2CQK A;  1Q1V A;  4YG2 F;  4A3F J;  2EZH A;  1XSV A;  2DA3 A;  2KDZ A;  4CZZ A;  2DT6 A;  2MLG A;  3QAH A;  4ENJ A;  2EA4 A;  2A3S A;  1DP7 P;  4PUS A;  1VTN C;  1DDN A;  4MGR A;  1DU6 A;  5LHH A;  4I0A A;  3F8M A;  2HTS A;  4B8X A;  3Q5F A;  2DO7 A;  5F04 A;  3L2R A;  3GTG J;  1T0F A;  3HRS A;  3SJM A;  2DMT A;  3MD2 A;  4A69 C;  2HU9 A;  3QYF A;  2GXA A;  4WCG A;  1QGP A;  2MC4 A;  3A0H C;  2HPI A;  2QBY A;  3HOT A;  2ICW G;  3BJ6 A;  5EG0 A;  2CYY A;  4Z6Y A;  1MSF C;  3MFK A;  5DUK A;  1ZRC A;  5FD5 A;  3I59 B;  1WWX A;  4M72 A;  4H4K C;  4A12 A;  1JJ6 C;  2R3S A;  4Q5S F;  2VXD A;  5JI6 A;  2AQE A;  3ROU A;  1FEX A;  2XB0 X;  3A02 A;  1Y56 A;  2CRG A;  1DP3 A;  5B5E C;  1UHW A;  1SAU A;  1QO0 D;  3SDB A;  1MBE A;  2O3F A;  4ZYA A;  1ZRD A;  1PUF A;  4CCO A;  1I27 A;  4QLC U;  2LOO A;  3L00 A;  3M7G A;  2EIK H;  3SZG A;  2KPM A;  3FXM A;  2HXI A;  1KGS A;  3OOU A;  1KZH A;  2F4O B;  1LVA A;  2E5N A;  5FLM J;  4KDP A;  1IN7 A;  1FOK A;  2B9S A;  3JAM Z;  2JA8 J;  5GAD J;  2NOJ B;  1JJ8 C;  1GT0 C;  4ANJ A;  5IT3 A;  1KQ8 A;  2VIX A;  2M45 A;  1QHG A;  5LEK A;  5TRD A;  1Z6R A;  1FBQ A;  1P92 A;  2V1N A;  4NNJ A;  3GLL A;  2WC2 A;  3AL0 B;  2X0L A;  5FJ8 J;  3R0J A;  3HRM A;  1SVL A;  4ZDL A;  2P81 A;  2R0Q C;  2L54 A;  3LWF A;  1LE8 A;  4G8X A;  4RB1 A;  3I4M J;  1S7E A;  1UHS A;  3RKX A;  5LLQ A;  1R9T J;  3BR1 A;  2N8G A;  4U87 A;  2NS7 A;  3CLQ A;  4BE0 A;  2UV1 A;  1MSE C;  4QIW N;  5D4R A;  3M07 A;  3J81 K;  4GCV A;  2GOX B;  1PP8 F;  3D0S A;  4YFX F;  1FOX A;  2HNH A;  2FUG 2;  4A6E A;  1GVD A;  4D5F A;  3MEX A;  3GXO A;  1B9M A;  2OQR A;  2GLO A;  4XLE A;  1HLV A;  2I8D A;  3HC7 A;  4BXU A;  3GBG A;  1VQ6 I;  3FXL A;  3E1S A;  1OYI A;  2XB5 A;  2R7R A;  4A3G J;  2CSO A;  3CDH A;  2WAQ A;  5C4X J;  4C2T A;  4EJU A;  3K10 A;  1R1T A;  1ETQ A;  3MAJ A;  3G71 I;  1RI7 A;  1SMT A;  1VND A;  4HNU A;  1CQT A;  3DEW A;  4PK4 A;  2NVX J;  2R4G A;  3U1D A;  3LA2 A;  2VQL A;  2H6C A;  2TCT A;  1YLF A;  4BQO A;  4F52 A;  2RQP A;  4CCM A;  1YW7 A;  4BS9 A;  1UZC A;  1X2M A;  3G6E I;  3HYI A;  1JHH A;  1RPW A;  1PUE E;  3CES A;  3BR6 A;  2QUF A;  3C2H A;  5LGU A;  5HLG A;  1K7A A;  3HGG A;  2V9P A;  4UVC A;  3LFU A;  3VOE A;  5DM7 F;  2XGX A;  3PUB A;  4AUX A;  3Q0W A;  2EJR A;  3NWT A;  5E79 C;  4J01 A;  2QQA A;  2K3P A;  3S2W A;  3WE2 A;  4U0Y A;  1MMD A;  2M87 A;  3DU6 A;  3W2W A;  2IGN A;  5CJ9 A;  1JKP C;  4JX5 A;  2BHZ A;  3VYU B;  2CUJ A;  2CUE A;  3FXQ A;  5LFA A;  2UUZ A;  2BGC A;  2H94 A;  3OL4 A;  4RGX A;  4HA8 A;  2FML A;  4JX4 A;  1UG2 A;  3LA7 A;  1XS9 A;  2P5V A;  3CJT B;  3BCA A;  3IUO A;  1WJD A;  3M8F A;  3WTS C;  2DFF A;  4BBR J;  4CUG A;  3LA3 A;  4AIH A;  1VQ8 I;  2PFB A;  2HQA A;  2CGP A;  2EV0 A;  3LSK A;  3FHZ A;  3JW4 A;  5LRS A;  3PNV A;  4ZYG A;  1ZRF A;  1F1Z A;  3AFH A;  3DF8 A;  4XLC A;  2DQR A;  4FTH A;  2FA5 A;  4RB0 A;  1QPI A;  1W7P D;  2ECB A;  2RRE A;  1X19 A;  2VL8 A;  3FKI J;  1FC3 A;  5FFZ A;  3J80 K;  2W7N A;  3CJQ B;  4YIR X;  3OYC A;  4BEH B;  4LG3 A;  3CCV I;  3OYB A;  2BYV E;  2VOP A;  3KEQ A;  4D5C A;  4FAS D;  3AKZ A;  3HOY J;  1ZGA A;  4B48 A;  4RLF A;  1LUJ B;  1Y1V J;  1ETY A;  3OYH A;  2MBF A;  3OYI A;  5TGT A;  1G4D A;  3DV8 A;  4DYC A;  3UNG C; 
#chains in the Genus database with same CATH homology
 3K0L A;  4FX0 A;  4A0Z A;  2NRA C;  1E17 A;  1O3T A;  5BPI A;  3WTW C;  4PZJ A;  2OA4 A;  2F5F A;  2L3D A;  2EFQ A;  2PJP A;  2FBI A;  3V8L A;  1AWC A;  3ECH A;  2IW5 A;  2ADU A;  3GLX A;  1A04 A;  4LGW A;  1SFE A;  2KIU A;  2YU3 A;  4M9S A;  3QU6 A;  3TO9 A;  5FB2 A;  3F23 A;  3HRT A;  1FYM A;  3HIF A;  4JBA A;  4EGY A;  1HW1 A;  3GZ5 A;  5CVR A;  3VFZ A;  1FSE A;  2FRH A;  4XSX F;  2F5C A;  4YIF A;  1CGP A;  2YR2 A;  5DD4 A;  1ZG1 A;  1GVJ A;  3L09 A;  1R5H A;  4KN4 X;  4Q48 A;  4BHB A;  4P9F A;  2HYF A;  3TDZ C;  1YQA A;  2BV6 A;  2NNN A;  3ZN1 A;  2RVC A;  5D5X B;  4KFC A;  3I5U A;  1SFX A;  2PI0 A;  2NNY A;  2ZJ2 A;  3V4G A;  2XVC A;  1K6O A;  3JTG A;  1HKQ A;  1V4R A;  3EUH A;  1FWZ A;  4LB6 B;  5DCM B;  2GA1 A;  4UNO A;  1T98 A;  3KP5 A;  4HLX A;  5E20 A;  2V1D A;  5DDG A;  1W7P A;  2IJL A;  2HZT A;  2QVO A;  5JVT A;  2IA2 A;  3ZMU A;  2M5W A;  4IRG A;  2K86 A;  1LDJ A;  1IAW A;  1KQ9 A;  3ZMV A;  2W24 A;  1IXS B;  1RUO A;  1TNS A;  1SMY F;  2Y48 A;  5HDK A;  1R7J A;  2DQL A;  3LQR A;  3CO6 C;  3PQK A;  4ZZL A;  3M1E A;  2CG4 A;  2STW A;  2GXB A;  2VON A;  4FT8 A;  5LGN A;  3R6S A;  4WX9 A;  5CVJ A;  1KU7 A;  1XGN A;  4ESB A;  4EM2 A;  2XAJ A;  5HS7 A;  5E18 F;  4BHP A;  1R58 A;  3HTS B;  4HX4 A;  1PDN C;  3BPV A;  1R36 A;  4WXC A;  4UXN A;  1C0W A;  1TQM A;  3EDP A;  2YX4 A;  3ZPL A;  4L5J A;  1WRJ A;  3DKW A;  5E1X A;  3P7N A;  2CWE A;  2MA3 A;  1T6S A;  4HQM A;  4CO8 A;  5F64 A;  5K5O A;  2P7C B;  4JK1 X;  2V1U A;  4KIG A;  2HR3 A;  4RS8 A;  4I02 A;  4EJT A;  1YW8 A;  2P6T A;  3JSP A;  4UV9 A;  2RC4 A;  3LST A;  4ESF A;  3ZN0 A;  1IW7 F;  4M9X A;  5DCF A;  2LDU A;  1BI1 A;  3SZP A;  3L9F A;  3WU0 A;  3QU3 A;  1KQ0 A;  3TGN A;  2VC0 A;  1IN4 A;  4KIB A;  1XGM A;  5ERI A;  3FMQ A;  2LF8 A;  5LHI A;  3U9G A;  1SFU A;  3IL2 A;  5F6F A;  1D3Y A;  1OR7 A;  3E6M A;  4R1H A;  2GA2 A;  2OU2 A;  3QP5 A;  2D1H A;  2RGV A;  1KU2 A;  2IA1 A;  4A0X A;  3ISP A;  1JGS A;  3RPU A;  4MQV A;  2HS5 A;  2WV0 A;  2HDC A;  4HF0 A;  2W57 A;  1KU9 A;  3ZQ7 A;  4ENK A;  1JHF A;  2RKH A;  1T39 A;  1ZRE A;  2FMY A;  4OMY A;  2UZK A;  1ZH5 A;  3B02 A;  5L3D A;  1FYK A;  3IWF A;  4OOI A;  4L0Y B;  3KLO A;  1RIO H;  2DAO A;  5D6F A;  1TBX A;  1S7A A;  5H20 A;  3GFJ A;  2P4W A;  5HS8 A;  2P7V B;  3HSE A;  5E8I A;  2P8T A;  2IP2 A;  2GWR A;  1HSJ A;  2ZFW A;  1ZLJ A;  4I7H A;  2PMH A;  3BOQ A;  4MTE A;  2FNA A;  3C3W A;  5JFR A;  3O3K A;  4HW0 A;  1XD7 A;  3WGH A;  2TDX A;  4R79 A;  4MHG A;  4MEX F;  4HOB A;  2AXL A;  5D5V B;  1FY7 A;  1EH6 A;  3MZY A;  5FGM A;  2D45 A;  3GVA A;  1K78 A;  3KZZ A;  3E6D A;  1U5T A;  2OZ6 A;  2A61 A;  2DT5 A;  1I1G A;  4LD5 A;  3TO6 A;  4ZYE A;  2VT2 A;  1ZG5 A;  5EEH A;  3WTX C;  4HX7 A;  1G6N A;  4I2O A;  4U0V A;  3Q9V A;  5D8L B;  3IC7 A;  3SHF A;  3E5X A;  2HGC A;  4S05 A;  3SXY A;  3V8K A;  1TW3 A;  2K7L A;  3DPT A;  3FM5 A;  3WTZ A;  3IHU A;  2EV5 A;  2IRF G;  3KEO A;  1S8N A;  1LDK B;  4ZYH A;  2JPB A;  2WWY A;  4ZZD A;  5AON A;  3T0Y A;  1MJA A;  3LAP A;  2D1V A;  3TDU C;  4MNU A;  3K2Z A;  4L9T A;  4UVA A;  2J5O A;  2YSR A;  1UST A;  2XHK A;  1T38 A;  1ZLK A;  5L3F A;  4HV6 A;  1IXC A;  3WTY C;  2OAZ A;  5BS6 A;  3DEU A;  3R4K A;  1IRF A;  4L18 B;  2FBK A;  4LMY A;  5E8G A;  3REO A;  1Z9C A;  2DW4 A;  4CYD A;  2F2E A;  2VBW A;  2J5P A;  4IVN A;  1ULY A;  1FBU A;  5IT9 Z;  5DEQ A;  2FF4 A;  3F3X A;  4LG0 A;  2JTV A;  1U6G A;  4EJV A;  4RGR A;  4G7H F;  4OIR F;  2XIG A;  4UVB A;  3JAM K;  4L5I A;  4WF2 A;  1XCB A;  2IA0 A;  4A5N A;  2Q8K A;  1L3L A;  4ESJ A;  5KVR A;  3GUD A;  3SFZ A;  4AWX B;  1W4M A;  5ICE A;  1JXS A;  2ZNY A;  3P9K A;  2MH9 A;  1QBJ A;  1XGO A;  4TV7 A;  2MLK A;  2VOD A;  3V7S A;  1P4A A;  4N0B A;  1ON2 A;  4N9H A;  1YYV A;  2FNP A;  3DXJ F;  1BC7 C;  2ESN A;  1MKM A;  2E1N A;  1OYY A;  3G73 A;  4P9U A;  3PFI A;  1YS6 A;  3MWM A;  3GZ6 A;  5FO5 A;  3QRF F;  5J8C A;  2XAQ A;  2MH2 A;  1I1S A;  1ZN2 A;  2ETH A;  4N9I A;  3K69 A;  3JSO A;  2RV8 A;  2JZY A;  3CO7 C;  3H3Z A;  3GX4 X;  2RN7 A;  2P6S A;  3GFI A;  5HVQ C;  4LB5 A;  2O0Y A;  1FZP B;  5L3B A;  1OYW A;  5JR3 A;  3E3V A;  1U8R A;  1BI0 A;  4A6D A;  2KRF A;  2W84 A;  3F6V A;  1IN6 A;  4UUV A;  2L4M A;  4YII A;  2P5K A;  1WQ2 A;  3I4P A;  3G3Z A;  3C1D A;  2O03 A;  4PGH A;  5BPD A;  3FMS A;  4ZYD A;  2F5D A;  1MD0 A;  1CF7 A;  3FF5 A;  1ZHF A;  3BY6 A;  3P9C A;  2VE9 A;  4ON0 A;  3IWZ A;  4HF1 A;  1Z91 A;  3FMR A;  1QNT A;  2G7U A;  3FM3 A;  1UB9 A;  3WGG A;  2Y75 A;  1KA8 A;  3RKY A;  4O3M A;  1F4K A;  3V7R A;  3L2C A;  5ILS A;  1MJB A;  4EJW A;  3C7J A;  3N97 A;  1ZAO A;  4ENN A;  3CUQ C;  4BHC A;  1H0M A;  4BNC A;  4PCQ A;  2ISY A;  2A6H F;  4WK8 F;  2FSW A;  4IPA A;  1USS A;  5HS9 A;  2W85 A;  2CFX A;  1YW9 A;  3EQL F;  3HUG A;  3QOP A;  4MTD A;  3GF2 A;  2KKO A;  2Z99 A;  3RYP A;  1MDM B;  2XAG A;  1XDS A;  2DU9 A;  3KFW X;  1TQI A;  3IKV A;  4U88 A;  4P5O A;  2PBI A;  2XRN A;  3KP2 A;  4QWQ A;  5LGT A;  1S3J A;  5FLX Z;  4IXA A;  5FLX K;  3R0A A;  1FSH A;  1I6X A;  4B09 A;  4HDU A;  1IUY A;  2IVM A;  3I59 A;  3CLO A;  3MCZ A;  5J6X A;  5DD8 A;  4EVI A;  4P96 A;  2ZME B;  2LSO A;  1U3E M;  4Y17 A;  2XKP A;  2R7F A;  5AIP A;  1ZG3 A;  1XSX A;  5ILU A;  1XB4 A;  5LBQ A;  1W5T A;  4BQA A;  5FFX A;  3LAJ A;  4ASN A;  2HKX A;  2UXN A;  2H27 A;  4GO1 A;  3QP6 A;  1LJ9 A;  1OMI A;  4L9N A;  3TQN A;  5ED4 A;  1BI3 A;  1QZY A;  5DV5 A;  3CUQ B;  1STZ A;  1WKM A;  4IRH A;  2L01 A;  1P4X A;  5K1Y A;  1KYW A;  1RZ4 A;  3SZT A;  3L7W A;  3D5L A;  1EV7 A;  2M8E A;  2V9V A;  1BIB A;  3F8F A;  4DQ2 A;  4KUM A;  1XSD A;  4RB3 C;  5A2Q Z;  4M6X A;  1J7K A;  3T5X A;  3E5U A;  2LNB A;  4AD9 A;  5D5W B;  1BIA A;  5LRR A;  3BZ6 A;  1Z7U A;  2A5Y B;  1BI2 A;  2XAS A;  2ZKZ A;  3Q9S A;  2KJB A;  2FU4 A;  5D5U B;  4IHS A;  4LK1 F;  3E97 A;  3KZY A;  2QBY B;  5HLI A;  4CHU A;  4LLL A;  3B73 A;  3F6O A;  2EWN A;  2ZBK A;  3J7A O;  3NQO A;  1LNW A;  1BN5 A;  2PMU A;  3FWE A;  3RTR A;  2W25 A;  3I0T A;  4U7D A;  5L3C A;  2Z3Y A;  2HYG D;  1J2X A;  4Y15 A;  3T1B A;  5CYV A;  1YO5 C;  4CXF A;  2P5L C;  2QQB A;  1H9T A;  2AS5 F;  3BPX A;  1XCV A;  1SAX A;  2V1X A;  2ZXJ A;  1WI9 A;  3K1M A;  3NRV A;  2VT3 A;  2DPD A;  4OIN F;  2G7H A;  3WOD F;  2EB7 A;  3KP7 A;  4ZH4 F;  1HKS A;  1F9N A;  1HXD A;  3RDI A;  5H6Q A;  4LJZ F;  1EH8 A;  4RB2 C;  3E5Q A;  3ZMD A;  1UCR A;  1HW2 A;  2CO5 A;  3C18 A;  2DK5 A;  5FD6 A;  5CVV A;  3ERE D;  1O57 A;  1MGT A;  3E6C C;  1BM9 A;  2LKP A;  4G6D A;  3IRQ A;  5TJJ A;  3BWG A;  4UV8 A;  3EYY A;  2HOE A;  3BJO A;  3KP6 A;  1UHM A;  2R7D A;  2Z5U A;  3DP7 A;  4KYW A;  3EYI A;  1B9N A;  4I01 A;  4AIK A;  4ETS A;  1R23 A;  1ZYR F;  2VN2 A;  3RI4 A;  2X4H A;  1R1U A;  4WXH A;  1Z1D A;  5D6E A;  5H6R A;  2O8X A;  1LQ1 A;  1YS7 A;  3M8E A;  4Z2Y A;  3TO7 A;  4RGS A;  1V3F A;  3IKT A;  3ML6 A;  2VBZ A;  4KMU X;  4IHT A;  4M73 A;  3JTH A;  4XRF A;  4HLY A;  2DBB A;  3HHH A;  2KIM A;  3GO5 A;  1YTY A;  1Y0U A;  4P55 A;  4KMF A;  1ZAR A;  1TTY A;  5BQT A;  5DCM A;  1D8J A;  4EJO A;  3ZMZ A;  4Q4Z F;  3HOS A;  5AIQ A;  2ESH A;  2XRO A;  4OIQ F;  4G9Y A;  1R00 A;  2RNJ A;  3T8R A;  2JPC A;  1FBS A;  1O3Q A;  1I5Z A;  2VXZ A;  2XV4 S;  4YFK F;  1J75 A;  2O61 A;  5HLH A;  4BAY A;  4HV5 A;  4OU0 A;  3KCC A;  3I58 A;  2HQN A;  1ODD A;  4M74 A;  2STT A;  1OKR A;  3WE3 A;  2COM A;  1LDD A;  2PN6 A;  2L4A A;  3WGI A;  2DPU A;  1S29 A;  1HBX G;  1P2F A;  3KP4 A;  2OQG A;  3N4M A;  2ZO4 A;  4O5V A;  3BRO A;  4F7Z A;  2WTE A;  2G9W A;  5HOO A;  4E70 A;  3ZMT A;  2EFO A;  1P4W A;  3VOD A;  2FEZ A;  3K1P A;  3WTV C;  2YPR A;  1FNN A;  1LEB A;  2EV6 A;  3WTT C;  4M9Z A;  2HKO A;  5ICC A;  1TLH B;  4IRI A;  4IF4 A;  1XMA A;  2GZW A;  1TW2 A;  2E7W A;  5IT9 K;  4NB5 A;  2NS0 A;  3FXR A;  3M9A A;  1DPU A;  4FHT A;  3BP8 A;  4EGZ A;  1U78 A;  4GXO A;  4HBL A;  1QQI A;  2HEO A;  3KET A;  3I71 A;  5E1Z B;  1XMK A;  3R60 A;  1W7P B;  5HDN A;  3VB2 A;  4G7O F;  2Z33 A;  2DI3 A;  1FPQ A;  4ENM A;  3KLN A;  2L02 A;  5E17 F;  1O7L A;  4KIC A;  4RGU A;  1SD4 A;  2M30 A;  3F22 A;  4AIJ A;  3V7C A;  5HDG A;  1B1B A;  4LFU A;  1YG2 A;  1MJ9 A;  1GHC A;  3TKY A;  2UWM A;  4NQW A;  1RNL A;  1E2X A;  4LLG F;  3GW2 A;  4PGG A;  1J5Y A;  2D2W A;  3QPT A;  2HQR A;  1QZZ A;  3GWZ A;  4HYE A;  3J81 Z;  2MC3 A;  2OD5 A;  1BBY A;  2QZ8 A;  4KIF A;  4KNY A;  3U2R A;  3CJN A;  5LHG A;  5D8K B;  1FLI A;  3BJA A;  4XLP F;  2VC1 A;  1DPR A;  2DFI A;  5ILV A;  2JRT A;  3K1N A;  2YX7 A;  1D5V A;  1O3R A;  1SD6 A;  3HHG A;  5KK1 A;  1K79 A;  3GFM A;  5CVI A;  3HSR A;  4UHT A;  4A2U A;  1R22 A;  2BE5 F;  4FX4 A;  2HTJ A;  3WTU C;  3EET A;  1AOY A;  3HSF A;  2XUB A;  2GAU A;  3RPQ A;  4O6J A;  4HAM A;  1B4A A;  1XDU A;  4L9V A;  4WWC A;  4MEY F;  2V6C A;  2KIF A;  4CIC A;  4LK0 F;  1T2K A;  2E1C A;  3T8T A;  2EK5 A;  1R5G A;  2IT0 A;  4OIP F;  2ZCW A;  4M71 A;  2QYO A;  1BOA A;  3WG9 A;  1IZ1 A;  1FP1 D;  1BC8 C;  3HTU A;  1FP2 A;  2UXX A;  4KT5 C;  2K4J A;  2H6B A;  5LEJ A;  2A6E F;  1Z05 A;  1O3S A;  2XAH A;  1FYL A;  3LQQ A;  2FXA A;  2FE3 A;  2BEO A;  3J80 Z;  4BYY A;  3GFL A;  3HRU A;  1KYZ A;  4I0B A;  1SD5 A;  5ICF A;  1J9I A;  4M6Y A;  4RAY A;  3IRR A;  1G3T A;  5K5R A;  3F8C A;  4XLN F;  5D4S A;  3ECO A;  1IXR C;  1U5T C;  4GYG A;  1ZGJ A;  2DK8 A;  1X3U A;  2A69 F;  2CW0 F;  3W6J B;  2FQ3 A;  2JSC A;  3CTA A;  2OZU A;  2PG4 A;  2HWV A;  2RDP A;  2Y0M A;  1UFM A;  4KA4 A;  3MZH A;  1LEA A;  2PQ8 A;  1REP C;  2A68 F;  5EEG A;  3COA C;  2LF7 A;  4Y13 A;  2QEN A;  4G7Z F;  3PQJ A;  2EFW A;  3RYR A;  3V8J A;  3H92 A;  3DPL C;  1W5S A;  5BMZ A;  1G3Y A;  3TOB A;  4HF2 A;  4JQF A;  1G3W A;  2VE8 A;  1GXP A;  1YIO A;  1DUX C;  2GIV A;  1J59 A;  1QPM A;  5CLS A;  4XBF A;  1MZB A;  3OOP A;  4H0E A;  4NHJ A;  4K2E A;  1P6R A;  3WU1 B;  4I09 A;  1K78 B;  3F8N A;  4A5M A;  1TNT A;  5E1W A;  1U5T B;  4OIO F;  1L0O C;  1IF1 A;  5L3E A;  4CDG A;  2DTR A;  2ELH A;  1GXQ A;  3KE2 A;  2B0L A;  2GQQ A;  3SQN A;  3ZMS A;  4D0P A;  5A2Q K;  2H09 A;  4HDV A;  2XKO A;  4EM1 A;  1D8K A;  2HFH A;  1HW5 A;  3K9T A;  3VEP A;  2C6Y A;  2VBY A;  3FZV A;  2A07 F;  4WXD A;  1LB2 A;  3O2P E;  4HZF A;  2DLL A;  3LFK A;  1HKT A;  5DYM A;  2ISZ A;  1RUN A;  1F5T A;  2F5E A;  2VOO A;  1KU3 A;  2ACJ A;  4L0Z B;  1H9G A;  3P9I A;  2BBY A;  2NAZ A;  5F1R A;  4LG0 B;  5J8F A;  5ICG A;  3NEU A;  4HX8 A;  1J0R A;  1ONV A;  4S04 A;  1TQP A;  4GYI A;  3TOA A;  2OBP A;  3KP3 A;  5JHU A;  2XAF A;  3MQ0 A;  4HQE A;  3I53 A;  4MQ9 F;  2K02 A;  1FX7 A;  2E7X A;  2JT1 A;  1ON1 A;  2KJC A;  3F72 A;  3FX3 A;  3DFG A;  4EMS A;  2M1B A;  2IPQ X;  3O6B B;  3OV8 A;  1YFH A;  1S7O A;  4AVP A;  3AAF A;  5K5Q A;  3F21 A;  3DQV C;  3ELK A;  3RIR A;  1Z6T A;  5BOX A;  1BJA A;  4DNC A;  2VBX A;  4EM0 B;  6PAX A;  4OMZ A;  3GEZ A;  1SD7 A;  3BDD A;  1HST A;  4U7B A;  1MDM A;  1G3S A;  4LLN A;  2QWW A;  1IN5 A;  1EH7 A;  3R61 A;  2EFN A;  2Q0O A;  2MD5 A;  1Q1H A;  1HQC A;  3ZP5 A;  3I64 A;  2EA2 A;  3I54 A;  1PP7 U;  3H3U A;  2Z9O A;  3CUO A;  3RJP A;  3GYH X;  2QLZ A;  2FOK A;  1B6A A;  4RAZ A;  3ABT A;  2GXG A;  2ZME A;  2QM3 A;  1CF7 B;  1S6L A;  3F8B A;  2ZNZ A;  1NHA A;  1O7F A;  1R1V A;  3RKW A;  4U0W A;  4L9J A;  2NYX A;  2O6G E;  2PLY A;  4IJA A;  4G6Q A;  2FBH A;  4EQQ A;  5L3G A;  3QPH A;  2EFP A;  2K27 A;  2V79 A;  2PEX A;  4BH9 A;  1B59 A;  1U2W A;  3ABU A;  4XSZ F;  4G94 A;  4YFN F;  1WSU A;  3CUQ A;  4A0Y A;  3FXU A;  4EV0 A;  4GGG A;  1XGS A;  1OPC A;  3W6K B;  4PDK A;  3E6B A;  4KN7 X;  4I98 B;  1FT9 A;  1IRG A;  5DUI A;  2Q2E A;  1IN8 A;  4CGZ A;  2K4B A;  3ULQ B;  1XN7 A;  5CVU A;  2QQ9 A;  4R8H A;  4Q47 A;  1JE8 A;  2CQK A;  4YG2 F;  1XSV A;  4CZZ A;  2MLG A;  3QAH A;  4ENJ A;  2EA4 A;  2A3S A;  1DP7 P;  1VTN C;  1DDN A;  4MGR A;  5LHH A;  4I0A A;  3F8M A;  2HTS A;  4B8X A;  3Q5F A;  2DO7 A;  1T0F A;  3HRS A;  4WCG A;  1QGP A;  2QBY A;  3HOT A;  3BJ6 A;  2CYY A;  3MFK A;  5DUK A;  1ZRC A;  5FD5 A;  3I59 B;  1WWX A;  4M72 A;  4A12 A;  2R3S A;  4Q5S F;  5JI6 A;  3ROU A;  1UHW A;  1QO0 D;  2O3F A;  1ZRD A;  1I27 A;  4QLC U;  3L00 A;  3M7G A;  1KGS A;  1LVA A;  4KDP A;  1IN7 A;  1FOK A;  3JAM Z;  5IT3 A;  1KQ8 A;  2M45 A;  5TRD A;  5LEK A;  1Z6R A;  1FBQ A;  1P92 A;  2WC2 A;  2X0L A;  3R0J A;  3HRM A;  2L54 A;  3LWF A;  4G8X A;  4RB1 A;  3RKX A;  5LLQ A;  5D4R A;  3J81 K;  4GCV A;  1PP8 F;  3D0S A;  4YFX F;  4A6E A;  3MEX A;  3GXO A;  1B9M A;  2OQR A;  4BXU A;  1OYI A;  2CSO A;  3CDH A;  4EJU A;  1R1T A;  3MAJ A;  1RI7 A;  1SMT A;  3U1D A;  3LA2 A;  2H6C A;  1YLF A;  2RQP A;  1YW7 A;  3HYI A;  1JHH A;  1PUE E;  2QUF A;  1K7A A;  5LGU A;  5HLG A;  4UVC A;  3VOE A;  2XGX A;  2EJR A;  2QQA A;  3S2W A;  3WE2 A;  4U0Y A;  2M87 A;  5CJ9 A;  3FXQ A;  4RGX A;  2BGC A;  2H94 A;  4HA8 A;  2FML A;  3LA7 A;  2P5V A;  3M8F A;  3WTS C;  3LA3 A;  4AIH A;  2PFB A;  2CGP A;  2EV0 A;  3FHZ A;  3JW4 A;  5LRS A;  4ZYG A;  1ZRF A;  1F1Z A;  3DF8 A;  2DQR A;  2FA5 A;  4RB0 A;  1W7P D;  3J80 K;  5FFZ A;  1FC3 A;  2BYV E;  2VOP A;  3KEQ A;  1ZGA A;  2MBF A;  1G4D A;  3DV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...