1V54H

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1v54H00
3ABLH 1OCOH 3X2QH 2EIJH 3ASNH 3AG4H 5B1BH 1V55H 1V54H 2OCCH 1OCZH 3AG1H 3AG3H 5B1AH 5IY5H 2DYRH 2Y69H 5B3SH 3ABMH 3WG7H 2EIKH 2EINH 1OCCH 3AG2H 2DYSH 2EIMH 3ABKH 1OCRH 3ASOH 2ZXWH 2EILH
chains in the Genus database with same CATH superfamily
4A3LJ 4NB5A 4ZZLA 2EZKA 4CYDA 3CCQI 4HX4A 1V5EA 3OYFA 3GTKJ 2KKOA 2ZXHA 5J1YA 1VZ0A 3OYAA 2NOGA 3DP7A 1JUSA 5AONA 3AG1H 3DBHB 3N4MA 4MFDA 2YS9A 1JE8A 2MABA 2KDOA 5JLXA 5FRNA 1X1DA 2DAOA 3CJNA 2XF5A 2W84A 1I1GA 2CW0F 4EJWA 1NTCA 5IPAA 1MBHA 2O5RA 3EUHA 2DN0A 2GLOA 2DI3A 5DYMA 1VQPI 3BJ6A 3OMYA 3QPSA 1SD4A 3U1KA 2OQGA 5GAEJ 4DOZA 2QUFA 2EFPA 2XAJA 2LDUA 2R7SA 3PFYA 5F6FA 1Q1VA 3SJMA 2VLAA 3RDIA 2XUBA 3HB9A 1D5YA 2DQRA 3D5LA 4AVPA 4HW0A 2XB5A 4YIIA 2PG4A 4KISA 3I4NJ 5E79C 4FQGA 1D8KA 2X85A 1X2NA 3D5RC 3ZQHA 3M7GA 3GZNB 4KIBA 2M8GX 1IN8A 2HVQA 2BE5F 3HM5A 3KP4A 5CVJA 3WTZA 4BGDA 1FLIA 1UG0A 1F5TA 4YEJA 4BJ6C 3S15J 4XBFA 4G7HF 5JHFA 3S3OA 2VBZA 2A6TA 4LD5A 1REPC 3QYBA 1E2XA 4E7JA 4LB6B 3F3XA 5LGUA 3MVPA 4N9IA 2IW5A 1QZYA 3C18A 4L9TA 1YIJI 4IRIA 2TDXA 2L7FP 1XDUA 2VJ5A 3CDHA 1J75A 2CRGA 4M9XA 3WE2A 2ZCWA 3HGGA 3K6GA 4IOCF 3S3MA 4LIVA 3RKQA 4S04A 5FB2A 4BBSJ 3K1MA 1IW7F 3MKLA 3PNVA 5LFAA 3H0GJ 4YELA 3U9GA 5LRRA 3ZN1A 1IRFA 5B5EC 4ZDOA 2JWTA 2E34A 2BY2A 2QBYB 2BV6A 1OYWA 5D8LB 1QVTA 1USSA 3LSRA 1WCMJ 3FBNB 4QLCU 3L2RA 1HF0A 1A5JA 1XSXA 2RVCA 2A6HF 1BOBA 2G7UA 2YX4A 5CPRB 1QHGA 2RQQA 2MFZA 4D5FA 3OYJA 2O8KA 2XROA 2X1CA 2OU2A 3HUGA 2BEOA 1LVKA 2R7TA 3F72A 3OSGA 1JUPA 2IGOA 1W5CC 2ISYA 2EPFA 2I5UA 3KZZA 5FRMA 5DCMA 5F0CA 3G71I 3IV5A 1FTTA 1XGNA 3DTIA 4KT6A 3F6VA 2CS3A 1T8IA 2V7FA 3RSNA 2XPWA 4C2UA 3OYCA 1HW1A 1CGPA 3HJEA 4A3IJ 3CF2A 3OYMA 1YIOA 1FJLA 2VODA 2ICWG 4RGSA 3VYRB 3OYIA 2IXSA 2G7HA 3JRDA 4M9SA 3SYTA 4JK1X 3U1DA 4HNUA 3P7NA 2LSOA 4EJTA 2HI3A 2I8DA 4FHTA 5H6RA 1W0TA 3SEZA 4L5IA 4X0GA 3COAC 2M7BA 4A0XA 3CJTB 4C2MJ 3WG7H 4LB5A 4E7ZA 3JAMZ 2E36A 3E6DA 3ZMTA 4A3CJ 2DODA 4M73A 3CUQB 4N4NB 3ZQGA 2Q2EB 1TQIA 3RKWA 1XCVA 5LHHA 2ELJA 4E7SA 1GDTA 2HTJA 3EUKL 3BTCA 4MHGA 3QRFF 4G8XA 3DEEA 1FSEA 2DDBA 2NNYA 3ZQFA 2HYJA 2L7ZA 2QZ8A 4C30A 5IOYA 4RBOA 3BC8A 3T8RA 4A3GJ 4XQFA 2YUSA 4XIDA 4FX0A 1G59A 2LVSA 1Q1HA 1MDMB 3GTLJ 2X4HA 1VQLI 2CYYA 1LDKB 2X1DA 2HQAA 2KRHA 4AU7A 4RAGA 3BG3A 2H1LA 1OMIA 4PCQA 3NRVA 1T38A 3K4JA 1OCOH 3FXUA 1EH8A 1WJFA 3FKIJ 3K4KA 3PQKA 4MO7A 2M2EA 4AIHA 1YLFA 2LKPA 3EYYA 2COMA 3S16J 1HC8A 4UVBA 2BGCA 1F36A 2DA1A 2IVMA 3FXKA 3ISPA 5H20A 3RI4A 3GCMA 2HOSA 2PMUA 1VF9A 3H9QA 3GFMA 2GM4A 1VNDA 1R1VA 2KDZA 4PJ0C 1A36A 4MNUA 3CP8A 1ZN2A 1XD7A 1WGXA 3H5NA 2HQRA 4XKVA 1DU0A 1DGWY 1IN6A 2DT5A 4AYBA 2NVQJ 2HWVA 4I02A 4BHCA 1S7AA 2HXOA 2XSDC 3JR9A 3DFGA 3G1OA 3BP8A 1TWAJ 4OMZA 1IC8A 3NWTA 3PUFA 5KNLA 3HTSB 3A03A 3P9CA 1BC7C 2HVSA 2XIGA 3L2QA 5LGNA 2N8GA 5F64A 4RAFA 2OD5A 1FEXA 5L3EA 3BR2A 1NK2P 2JSCA 3VWBA 4RB2C 2IGMA 3V4GA 3NQOA 1TWGJ 4HBLA 2KT0A 4LIUA 3BR1A 1O3SA 1R5ID 2JA6J 4EVIA 3JAMK 1JJ8C 5D5XB 3DF8A 4BQQA 1QU3A 1AOYA 1OKRA 1ZG3A 4IF4A 1U8BA 1FBQA 2OZUA 1ZGJA 4CDGA 1B72A 3ZN0A 2VB6A 3A4CA 2M45A 4P1WA 1XB4A 5M5WJ 1EH6A 1POGA 2Z33A 4RB3C 1UELB 4L5JA 1DPUA 3CP2A 3OSFA 4I76A 1ULYA 5DD4A 2QVOA 3K4LA 2GXAA 5FROA 3GVAA 5TISC 2DFHA 2DMNA 1ORKA 2BXZA 1T0FC 2DDAA 4B48A 5HODA 4WX9A 1HA8A 2LLKA 3S2WA 1BL0A 2IAIA 4XRFA 2ZMEC 2QGUA 1FNNA 3K4NA 3P9IA 1ZRDA 4KIGA 2O3FA 1HCRA 5K7FA 1UFMA 1TTYA 3LSIA 2E19A 3F6OA 1R36A 2XHKA 1OQYA 2LNBA 2ZMEA 4F3QA 3FMSA 2UUZA 2VPRA 1D8JA 1WHUA 3M07A 4PK4A 2BHZA 3OS0A 1TWCJ 1ETKA 1X1CA 2DFEA 1JI8A 3KX2A 2PI0A 1PVEA 4L0YB 1YRNA 3CO7C 2LY1A 4BU2A 3E0JB 1WJ5A 5CQEA 2KHMA 3E5XA 5DM7F 2FOWA 2BBYA 4OU0A 3LSGA 3HHHA 1H0MA 2MLGA 2VASA 5EG0A 4M3GA 2JJ7A 5EDNA 2DFIA 2R7XA 5JI6A 5FO5A 4WXCA 4XLEA 2KP6A 2XAGA 2JA8J 5F1JA 2NS7A 3AL0B 2R7OA 3F8CA 4J00A 2VQLA 3CCVI 2D2WA 5GADJ 2V79A 4KN4X 3H0DA 1BI0A 3GZ5A 4F55A 2K3PA 1SVLA 1APLC 4Y33A 2VKHA 2RKHA 1BW5A 4W1UA 2EZHA 4UV8A 2H1KA 4IOAF 3WGGA 3Q0UA 1VQKI 3MQ0A 2O61A 2QKMB 1R7JA 6PAXA 5C44J 1Y39A 4B3AA 2DJIA 3J7ZI 2VL8A 5EJCA 2NRAC 2VBWA 3BG7A 4GGGA 4PDKA 3FXJA 3K70C 4UY8I 4FCYA 1YJNI 3DKXA 4CA0A 4B44A 5HNHA 2AS5F 2V1NA 3QU3A 3DPUA 2X6YA 3OIQA 3ERMA 2CUFA 2QEXI 3B02A 1MNDA 2TCTA 4ZH4F 1XMXA 1VI0A 2FXAA 3S8PA 4ZJZA 2OA4A 4B09A 2FNAA 1A35A 3HBLA 3LSJA 1B4AA 2DOAA 3RJPA 2OCCH 2DA2A 3NWSA 2VONA 2HTSA 1GXQA 5J40A 2QLZA 4Z6YA 2H27A 2B63J 1B9NA 1G6NA 5KAIC 4HA8A 1HOMA 1WI3A 3ZQ7A 3TDUC 4ZTJA 1R22A 1FWZA 2DMUA 2DFFA 1R5GA 3V8KA 1LUJB 4HX7A 4BXUA 3CDLA 2BHYA 2C6YA 2DK5A 5BOXA 3VSKA 1RIOH 1FMWA 1RRJA 2VPLA 3AKZA 4KUMA 4MQVA 1R23A 3HSRA 4II2A 5JR3A 1YX3A 3QAHA 4LMYA 1GVJA 1O7LA 3KP3A 4XLNF 3JRBA 4E7LA 1Z21A 2VKDA 4WXDA 1X3ZB 2P81A 1K61A 3VFZA 5B1AH 2OCEA 2P6TA 1ZRFA 1D1CA 1ETVA 2L02A 5J4YA 2H8RA 2HNHA 2VQGA 5FKKA 3L1PA 2EK5A 3MKWB 2NS0A 2CSOA 3BR0A 4XLHA 2K86A 2EV0A 2IS4A 2J5PA 3FXOA 1D1AA 5E8GA 4IO9F 1TC3C 1IRGA 1FYLA 1MJAA 3K2ZA 1LEAA 3SFZA 1QQIA 5IT3A 1U5TB 1MMAA 2VC0A 4DQ2A 1YRNB 3TO6A 2K5CA 3OIOA 4E7HA 3GTQJ 1LJ9A 3WTWC 1JT6A 2MA3A 4P55A 3BJAA 3RYRA 2CW8A 1SD6A 3D5SC 4LG0A 1N77A 4I09A 3CC2I 2XKPA 3BDDA 5FKMA 1UJ8A 1VQ9I 2FX0A 1AWCA 1CQTA 3ABUA 1YJ9I 4B43A 4BXXJ 4GCVA 4IHTA 1FP1D 2TRTA 4FASD 5DTDA 3E5QA 5E1ZB 3K9TA 2GOMA 5TJJA 3CCLI 4BH9A 4A3KJ 4E70A 1XDSA 4BACA 4XLAA 2WC2A 2XRLA 3CCRI 4HEA2 1F9NA 1U9NA 3GLLA 1EJ9A 1K6YA 3HOTA 2R0QC 5DV5A 5L3GA 3OYLA 3LSMA 4R79A 4DGWB 2VJJA 1O57A 2R4GA 1UMQA 3CF5F 3HSEA 5CVIA 4CYCB 2ZXWH 2VOPA 3ZMDA 3ZMVA 5FKOA 4A3FJ 3O3KA 1HQCA 1UCRA 2PMHA 2VT3A 3IH3A 4BQNA 4BS9A 1IRZA 1UB9A 4M6YA 4CICA 2FQ4A 2ADUA 1OYYA 4N4OB 4NUBA 2UZKA 5CLSA 2PX9A 2P5VA 4I7HA 3C2BA 1Y8QB 5KK1A 4AD9A 3DWLE 5DS9A 3DBRB 3ESWB 3HRTA 2F5VA 4E6KG 1UG2A 3SEQA 3R61A 4GYGA 4O5VA 2BY1A 4ZC3A 2WAEA 1R71A 1I3AA 1PUFA 2G9WA 3CDIA 4ABZA 3HDDA 2PQ8A 4DZPA 2V9KA 1R4NB 2Y69H 5FFXA 3M1CA 4F52A 3CO6C 1ZTRA 4HSRA 2WAFA 2CGPA 4IQ4A 3WTUC 3KCCA 5DDGA 5JLWA 4XLPF 2HQ5A 4QPOA 5ED4A 3ECOA 1YS6A 3SZPA 4ZYGA 5J47A 3E6MA 2NVXJ 4AIKA 1YI2I 3WTVC 2JZYA 2M7AA 3GYHX 2AHQA 3F0CA 3Q5FA 4KFCA 2XAFA 1HXDA 1FBSA 1ZGWA 1CF7B 4IKFA 4BXFA 3ROUA 5CVVA 1FPQA 4AVZA 1DDNA 4NHJA 2LC2A 2VJ4A 1OCCH 3VPRA 5ICCA 4OAZA 4RGUA 1Z9CA 4G7OF 1T33A 2E5ZA 2LBFB 3CD6I 3PJRA 2M1BA 3G73A 2K9SA 2CV0A 3HOZJ 3M3YJ 2R5YB 1T2KA 4KITB 1R58A 2IA1A 2PN6A 2VBXA 3MD2A 1D0XA 1U6GA 2GA2A 3JTGA 2RREA 2K9QA 3WHBA 1PP8F 2EB7A 1P92A 2ELHA 3RPQA 2OTLI 2NVTJ 1GUUA 1RKWA 2R7FA 2MC4A 2VE8A 4KIFA 4CSWA 3S17J 2HQNA 2X1EA 1L3LA 3CLOA 2XGDA 4CXFA 2H6BA 2R7VA 5JVGF 4JP0A 2HDCA 4MGRA 4F93B 5J8FA 3A02A 1Z6RA 3FF5A 1XC5A 3BLYA 3KLOA 1S3JA 3GW2A 1G3WA 2MH9A 3GEZA 3HKZA 2HFHA 4KMFA 3PUBA 2YSRA 1UHSA 2B0LA 2L5QA 2OPTA 4BYYA 1R1TA 4BL0B 5GP9A 3MN2A 5FD5A 2RN7A 3DQVC 1Z1DA 3OL4A 1J2XA 5EGOB 1G2HA 3H36A 3LA7A 2F2EA 1OCTC 2A5YB 2WV0A 1BJAA 1YYVA 3EUHC 3CMAI 4CCNA 1MGTA 5HDGA 4D7NA 3WTTC 2O7OA 2PJPA 4IHYA 3K69A 2FJ1A 5FGMA 4NQWB 1WJDA 2RNGA 4RGRA 4XORA 1B8IB 1F1ZA 3DPTA 3BG9A 4HPQA 1KU3A 3H5RA 1RKTA 3CUQC 1FC3A 5E3MA 1GVDA 4CCKA 2JA7J 3GXOA 2BZTA 3K7AJ 3S32A 4RM3A 3KYDB 1ZG1A 2MH2A 1C0WA 1PUEE 3RYPA 4XSXF 3ZXSA 3CUQA 1S6LA 2HDWA 2EFOA 1SFXA 2Q2EA 3FM3A 3ZRGA 1VQNI 1YJWI 5HS9A 2DU9A 1JKPC 2XF6A 2RC4A 1MBGA 1MZBA 2IGKA 3I55I 1JT0A 2W25A 3LSPA 2HGCA 1PUFB 2FF4A 3CUOA 3ONQA 1JKOC 3GTJJ 1I50J 2EILH 1DP7P 1JTYA 1YW7A 2MSYA 1NG7A 3RQIA 5EZHA 2CV2A 3S3NA 2HXIA 3GFLA 1MDMA 3HSFA 3DBLB 1YG2A 3A0HC 1IDZA 4LK0F 3OOUA 1D3YA 2V26A 2D1HA 1X1PA 2BXYA 2EJRA 1BA5A 3BWGA 2BOLA 2ECBA 1WI9A 4KNYA 1ZKGA 2NNNA 2EIKH 1H9GA 3BTJA 4DBQA 5J8CA 3I0TA 5L3BA 1MBKA 3FHZA 1ZQ3P 5HOOA 3PNTA 2OJED 3HRSA 1V5FA 1MBEA 3DLLF 2ETHA 3J80Z 3FXMA 5LEKA 4DIQA 1R00A 3EDPA 1MNEA 4KICA 3OS2A 4BE1A 2A61A 2LKSA 2LRDA 3IRRA 1DGRM 1OR7C 1BJZA 3ZQIA 3D1NI 1QHHD 1U0JA 2DT6A 1VQ7I 1UZCA 3LNQA 1W36C 4Y52J 2CQKA 2WTEA 5F1RA 3N05A 4HF0A 1OR7A 3I3LA 1Z77A 4AYBN 2EIMH 1GLNA 2NVUB 2DPUA 2LTPA 4A69C 4V2GA 1KZHA 3TO9A 2CQ7A 3CCMI 3OL3A 3DLAA 4ESJA 4DYCA 2EA2A 2Z2SB 2XDVA 3VYSB 3RKXA 3BTIA 2LMDA 4LITA 3OYNA 1OCZH 1W1WE 4A5MA 1T98A 1IUFA 2E1MB 2DYRH 4N0BA 1P7IA 1YTYA 2EZLA 5H2FC 1XCBA 1W4MA 1ZLJA 3MZYA 4S0HB 2HKOA 2EINH 3K4CA 2X51A 3KP6A 4UUSB 2VOOA 2FRHA 4LLGF 4YFNF 3S2HJ 4P96A 5BNGA 4EATA 3IKVA 2O8XA 2XGXA 4N9HA 3F8FA 2V1DA 1KQ9A 3NEUA 4M3BA 4G6TB 2GA1A 5AIQA 3W6KB 2E7XA 2FSWA 2IBDA 4CCOA 3JW4A 3QWLA 3RPUA 3VYTB 2R7UA 4KT5C 4XONA 1T56A 2BVMA 2V9PA 4W97A 2FBHA 2CV1A 3AG2H 3R60A 3MZ8A 1P7JA 1Y1VJ 3BROA 4B3XA 2CMPA 2PFBA 2XPUA 4Z2YA 3T0YA 3M4OJ 3GUDA 1U78A 3UKGA 3CC4I 1JGSA 4ZYHA 1Z91A 2H94A 3I53A 1ZYRF 1ON2A 2G0EA 3FBIB 3J80K 1P2FA 2IA0A 3IKTA 2V6EA 1DP3A 2LFBA 3QPTA 1FOXA 1WSUA 1SC7A 1KYZA 3F9KA 3H35A 3AL0C 1MMDA 2M3AA 2LR8A 5FLXZ 3BG6A 2EZIA 3L7WA 4ENMA 3A01A 1MD0A 2DTRA 3FMQA 1VQ8I 2OTJI 1E17A 2F5EA 5KVRA 3WE3A 1IO2A 5FLMJ 5ILUA 3OYDA 3HC7A 3MWMA 4HQMA 2W7NA 5H6QA 4XLFA 3V8LA 2NOJB 4ZDLA 4FTHA 2RAEA 5EZGA 2GOXB 4MQ9F 3I5UA 1FTZA 5FFZA 5M3FJ 1IXSB 1TQMA 4E4HA 3CESA 5IOZA 2O6GE 1LVAA 3GMEA 1I6XA 4NC6A 1BIAA 4Y3OA 1W36D 5C3EJ 2ELKA 4C3JJ 1MJBA 3TMOA 2L3DA 3L09A 2LK2A 3E6BA 1UHWA 1MSFC 3WODF 1WRJA 2DW4A 4U0YA 4XN3A 3FHNA 2X6OA 4P5OA 5E1XA 4ANJA 1MSEC 3F8MA 3BR5A 4MEYF 4BKXA 2RQPA 3NAUA 1PP7U 1SFUA 5E18F 2JPBA 2KMUA 5IP7J 5IYBJ 3KIOA 1D0ZA 4X1EA 1DUXC 5IT9Z 3OS1A 3PL8A 4XRMA 1X4PA 1A6QA 1FBUA 2MD5A 5L3CA 3QPLA 1RC9A 3L2WA 2LP0A 9ANTA 2HOEA 1K4TA 1ZAOA 1MBFA 4YFXF 2W48A 1HLVA 5HS8A 4A3EJ 3WHCA 4UUVA 2JVGA 3RPUD 2JVHA 2KJCA 3JRIA 5FD6A 2JPCA 4R8HA 5FLXK 1L0OC 3FXQA 1K83J 3A1YA 1LEBA 2NS8A 3E5UA 4L9JA 3QOPA 4OMYA 1OISA 1U2WA 3WU1B 4A3BJ 2FUG2 1YW8A 2X6XA 1FX7A 2Y0SA 1LNWA 1K7AA 1VQMI 4C9YA 2GWRA 1G3YA 2DQLA 5JHUA 5LD2C 5EF6A 3V8JA 2MLKA 2GXGA 3TKYA 4XRSG 1R49A 4IRHA 2Y9ZA 1JJ6C 2XF7A 3QYFA 1GV5A 5K5QA 3I59B 1BI3A 2BVLA 2DCEA 3FWEA 3R0JA 1O3QA 4LOCA 1T08B 2CG4A 2K85A 5B3SH 3W6VA 1U5TA 2K4BA 2LY9A 1WJBA 3QP6A 3BZCA 2WADA 2FBIA 4G6QA 4DW6A 3BT9A 5ILSA 4ZYEA 5M3MJ 4A6DA 2W4SA 3A01B 1EA3A 4QPQA 2Z9OA 3OR2C 2L9RA 3SDGA 4UHTA 1OLTA 1E3PA 1Z0XA 5LGTA 3A2KA 1OFCX 4EM0B 3L2VA 2UXNA 4HV6A 4WF2A 1ZH5A 1X4OA 5IT9K 2R7QA 3ZOBA 1Y8RB 2RGVA 3LSHA 4JOMA 3HOUJ 1XS9A 1R5HA 2L9VA 5HLHA 1XGMA 4AM3A 3H3UA 2QCOA 4GFBA 4ZDPA 4EJOA 3BCAA 4BUPA 1X1BA 5JVTA 2HR3A 2MGQA 2IT0A 5GTHC 5E17F 1I5ZA 2MW8A 2CJJA 4OIRF 2M4KA 2Z16A 4OIOF 5F08A 5J1RA 4CYCA 3Q9SA 3VOEA 3KYLA 2RNJA 5J4VA 4HF2A 2K9LA 4IHVA 4A12A 3VDXA 3FKJA 1XGSA 3HOXJ 2GIVA 4F92B 4HDVA 2CQNA 1VQOI 1IXRC 2KQRA 3L9FA 1LFBA 2XSJC 3C3WA 4OIPF 1W7PB 5DD8A 2FOKA 2JRTA 4Y13A 1A6IA 2MG4A 3M9AA 4KDPA 3PM1A 2OQRA 4M71A 4WWCA 5LHIA 3KYCB 1BI1A 2UWMA 3JRHA 4EGZA 5KCMA 4BDYA 3F22A 5CYVA 2XVCA 1ZR4A 3R0AA 2OUMA 5E8IA 4L9VA 4GYIA 2KJBA 4HAMA 3HRMA 5FKNA 1FOWA 1HKSA 1USTA 3DEWA 5D5UB 3WTYC 4LJZF 2GAUA 2MC3A 3JRAA 2A05A 4XSZF 1W5TA 4S05A 4D9JA 3CMMA 4CCMA 1W5SA 4GXOA 4Y4RA 3KEYA 1E3HA 1KA8A 1D1BA 4LLNA 1V55H 1BIBA 3N97A 2M8EA 5E20A 2A3SA 2ID3A 1IAWA 1FP2A 2W85A 2NXNB 1W0UA 3D0SA 1TW3A 3ABTA 2PMZA 3ELKA 1LE8B 2F4OB 2L7MP 2EFWA 3JRGA 2IS1A 2PJRB 3F21A 2D1VA 2EV6A 3EETA 1CF7A 4DJAA 3ABLH 4KYWA 4UUTA 3P9KA 1XPXA 4HDUA 1TP4A 1RI7A 2E71A 3QU6A 4J19A 4CCLA 5A2QZ 3RZDJ 1A31A 5GPCA 5E3NA 2X0LA 4XICA 3VODA 2R7WA 1DQUA 4B1RA 1D0YA 3HG9A 2LBFA 3AG3H 4B8XA 4C3HJ 2Z1DA 1S7EA 3JRFA 1R6RA 2K40A 4RMNA 4BBRJ 2R5YA 1QO0D 3ERED 1B1BA 4GO1A 4AUXA 5M5YJ 3P5JA 1IDYA 5BPDA 2F4MB 4FX4A 4V2FA 2OC6A 1Z6TA 4CCJA 4Q4ZF 1G3TA 2OZ6A 1B6AA 1YQAA 3ZCOA 1X2MA 2M5WA 2OBPA 2JA2A 3ECHA 2FQ3A 1HW5A 2H09A 3WGHA 2XGEA 1Y0UA 1G3SA 2ZKZA 2VIXA 2F5CA 2EH3A 2QM3A 4M3DA 1BW6A 1S8NA 2IP2A 1K79A 1J7KA 1FYKA 2E60A 2EFQA 4B4CA 3EPZA 3A0BC 2F6CA 4MLOA 3J81Z 1XTAA 1PYVA 3HKZN 4IL6C 4YFKF 5EGOA 1SMYF 2WY7Q 3HZJA 3IH4A 1KQ8A 3AAFA 2WA0A 3J7AO 2ZB9A 2QSFX 3LSTA 3S14J 3FISA 1YE9A 3VEPA 3H3ZA 1U9OA 3L2CA 3SDBA 3PSFA 4G9YA 1YHQI 3LA2A 4UNOA 1NHAA 1IXCA 3TW6A 4LLLA 4XOTA 3GFJA 3ZQQA 3F8NA 4NQWA 3DU5A 3SXYA 4PFOA 4HV5A 1B8IA 3AFHA 3OYEA 5ILVA 2KRCA 2AQFA 2X48A 1U3EM 2F5DA 3OOPA 3L2UA 4IZZA 3KP7A 2DXIA 2KIQA 2NAZA 1F43A 1S9HA 4E7IA 2L54A 4XLCA 1ETQA 2ZJ2A 3C2HA 2ECCA 1VQ5I 2EWNA 2LOOA 3DV8A 2ZNYA 2ESHA 1MH4A 1FSHA 1RESA 2E5NA 1Y1WJ 1BI2A 4ZZDA 3V7SA 5JFRA 5A2QK 4OAYA 2L7KA 4BE2A 2D45A 1NG6A 5D6EA 1SEUA 2ZJPF 1S72I 3RKYA 2DA4A 2I10A 2L9SA 4Y7NJ 1RNLA 2XAUA 4PUSA 2GBYA 2LF8A 5TRDA 1MBJA 2Y75A 4XKWA 1U8RA 2PLYA 3FIWA 3VB2A 4I98B 3J7YJ 3JREA 1ITYA 1ODDA 1I39A 5E3OA 2ZFUA 4PGGA 1P4AA 1AA7A 1IN5A 3DPLC 4KA4A 3I54A 3BPXA 1LB2A 4UXNA 4PJMA 4U0WA 1WFXA 3OV8A 3IP4B 2FEZA 4L0ZB 1QGPA 4ZYDA 1XSVA 4WK8F 3B6AA 1H89C 3H5AA 1Y0NA 2Y48A 3H1CA 3REOA 3J81K 5FLVA 5F27A 5IP6A 2XAHA 5DEQA 3FK7A 1IG7A 2EQRA 2EV5A 3I64A 4XM3A 1IN4A 3B73A 2XV4S 2ZNZA 3UNGC 4BAYA 2FE3A 1BR4A 2Y30A 2BW3A 2VT2A 3G6EI 1O4XA 4OOIA 3LFUA 4XL9A 5F04A 1AKHB 3GWZA 1SD5A 2EIJH 2O03A 5CJ9A 4M6XA 1MMSA 5HNFA 2CU7A 3R6SA 1VQ6I 3H9JA 1IN7A 5HDKA 1O7FA 4PZJA 4MTDA 1D5VA 4A2UA 4QWQA 1WZ2A 4UB8C 2E1MC 4BNCA 1Z05A 1EKEA 3O8GA 3DTKA 3GTOJ 4FISA 4IPAA 4II3A 3S1QJ 1UHMA 3GFIA 2QF7A 2F48A 1BN5A 1KYWA 2WB1A 1H8AC 1S7OA 2KL4A 2P7VB 2HPIA 3RCOA 3IAS2 2K7LA 1NK3P 5IY5H 5L3DA 4DNCA 4D0PA 5AIPA 4UUSA 1Z7LA 2GIZA 2KRFA 2JTVA 2LF7A 3DEUA 1IF1A 2NYXA 4UB6C 3G3ZA 1LPQA 3CCEI 2A5WA 5K5OA 2YX7A 2R7DA 4DYQA 2R93J 2M87A 1XSDA 2E2IJ 2MYSA 2DT7B 2W57A 2LYCA 2OF7A 1SVMA 4IEJA 1KGSA 4HG2A 1F4KA 3TDZC 2E2JJ 1KU2A 4FT8A 2IS6A 3AG4H 3ZQLA 4XKBA 1ETXA 3I58A 5D4SA 3KETA 3LAJA 2STTA 2YU9J 1ON1A 4I6ZA 2F5FA 5IYCJ 4JQFA 4XK4A 2DMQA 5LEJA 1SFKA 1X1AA 1X58A 1IV8A 3IL2A 3JRCA 4O6JA 2BYVE 3V42A 3ZMZA 5CVRA 3ULQB 3CMEI 5D4RA 3Q9VA 2ZJRF 4FE4A 1K78B 4J01A 3V7CA 2E1NA 4BDZA 1SANA 1TT5B 3MCZA 2M9HA 4PJJA 5GAGJ 4U0VA 3LL7A 2WAQA 3HYIA 2P8TA 2QSHX 2DPDA 1ZLKA 2Y9YA 1P6RA 3DKWA 2GZWA 3RIRA 3KP5A 3JSOA 2DOFA 2FMLA 4HOBA 3IAM2 1IJWC 3QQAA 3QPHA 2EBIA 3F8BA 3BTLA 4OIQF 2JSPA 3B6CA 2V1UA 1Y56A 1ZELA 3E97A 3MAJA 5LRSA 2HOAA 2QYOA 3BQYA 3M1EA 2CFOA 1BOAA 4HX8A 1KU7A 3X2QH 4BEHB 2BY0A 2KPMA 4RM2A 4IX7A 1ETOA 5BQTA 3GTPJ 2VUMJ 2AXTC 3HTUA 3TO7A 2IJLA 2ZXJA 2QQAA 3V7RA 4D1QA 2K9MA 2WWYA 1BBYA 1OCPA 2BW3B 1X19A 4PJLA 1ZG5A 3FXRA 4PJNA 2LD5A 1XGOA 4RS8A 4HYEA 1E3OC 1J9IA 2Z3YA 2JRMA 3IC7A 4RGXA 2ZSIB 4Y17A 1VTNC 2FU4A 2XPVA 4RLQA 4BY1J 1SVOA 1TWHJ 1DPRA 2K4JA 2HYFA 2A07F 2KISA 1BC8C 3TOBA 4IHXA 4OWRB 4WXHA 3BJOA 5KHDA 2KZGA 3BZ6A 1MH3A 5D8KB 2FA5A 3HPGA 2KFDA 4JX6A 5B66C 3IWZA 4DZJA 1H9TA 2HKXA 2LG4A 1JKQC 2X9DA 1BR2A 1ZARA 2ID6A 2Z99A 1ACIA 3PQJA 2JUGA 3TL4X 3FZVA 3ZR8X 5IP9J 4IQJA 1SFEA 5ERIA 3PSIA 2EFNA 1I3QJ 2NVYJ 5TGTA 1XN7A 3VYUB 1X3UA 4Q48A 1MW7A 1SMTA 1G8XA 1TBXA 1ZK8A 3WTSC 2DMTA 1QVUA 3I71A 4MFEA 3H3VK 1JTXA 2H8WA 2PBIA 4BQAA 3JCUC 3SFIA 2ZJQF 4H4KC 3PIPF 3ZPLA 2Q1ZB 2Y0SN 1GXPA 2BY3A 1JHHA 4IHWA 3I59A 2XASA 2YR2A 2DTZA 4BHBA 3HIFA 4HZFA 2RDPA 3DKYA 1XMAA 3TBIA 1QZEA 1FOYA 1PDNC 1GT0C 3WG9A 3CMYA 2W1OA 4IVNA 3T1BA 4KMUX 4LGWA 2P5LC 2CO5A 4JBAA 4YIFA 2DO7A 3FXLA 5J3LA 4PGHA 3R4KA 4I0AA 2E1OA 4ITVA 3HGYA 4Q5SF 2QQ9A 1I1SA 5EEAA 3L00A 2HU9A 4EQQA 3K4MA 2VXZA 3LQRA 1IRXA 1S29A 2ZFWA 3CLQA 5DUKA 4NNJA 4X6AJ 1V3FA 2DMPA 1G4DA 1BM9A 2XB0X 4EEFG 1LFUP 1WJCA 3CJQB 4A3DJ 4L9NA 2AXLA 3QYEA 1XX5A 2FBKA 3G2BA 2KZVA 2LH9A 5C4JJ 4RB1A 2DLLA 5DCFA 4RA2A 3J7AY 1WKMA 2M4GA 5CQGA 1GHCA 5FJ8J 1EH7A 2E7WA 3Q0VA 4L5EA 1ONVA 1BR1A 3LFKA 2P7CB 1LKXA 1HSTA 1T39A 1FY7A 2AO9A 1R9TJ 1JGGA 4RLFA 4ESFA 5GAHJ 1H88C 1N78A 1IUYA 1HKQA 1WPKA 3BPVA 1RPWA 1TZLA 2K27A 1N25A 2ZSHB 5LLQA 3LAPA 3GTGJ 4EV0A 4CUGA 4HF1A 1MMNA 4ENNA 3LQQA 4G6DA 2FD5A 3TGNA 3MZHA 3I4MJ 3M8EA 3KPHA 1W7PA 1K6OA 4U88A 4M6VA 1TNTA 3RQ4A 4CZCA 4V19K 1GV2A 2YPRA 1A04A 4B47A 2QA4I 2L01A 3TEDA 2F4IA 5CVUA 3FDYA 2P6SA 2A69F 3ABMH 1NH3A 2FMYA 2OV7A 5CKTA 5DUIA 2V4JC 4NDLA 1OJLA 3T8TA 2XRNA 5EEGA 4YRVA 4G7ZF 5BPIA 4C2TA 2HYGD 2Z5UA 4U7BA 4U7DA 3ZQCA 4A3JJ 4PSXA 3OYHA 1O3TA 3W2WA 2HDDA 3K10A 1O3RA 4HSTA 4JX5A 1TWFJ 3LWFA 3OYKA 4FE7A 1FZPB 2Q8KA 3O8HA 1LDDA 1N75A 2GQQA 4G94A 1JXSA 2W24A 1MNMC 1Z7UA 1P4WA 2DJNA 3Q0WA 2VJIA 3HUGB 2Y0MA 3MFKA 1FMVA 1TL8A 3KZYA 4BJ5C 3HL2A 2COBA 3K0LA 2R7ZJ 3FM5A 2IPQX 4RAZA 2UXXA 3GTMJ 2P4WA 4IJAA 3GO5A 1VFCA 2O9LA 2D5VA 5DCMB 5BS6A 2XKOA 2R7RA 1QPMA 4F7ZA 4A5NA 2Q0OA 3TOAA 1FT9A 2JMWA 4YG2F 1WWXA 1LE8A 1RETA 1FIAA 5F0FA 2EA4A 2A6EF 1U5TC 2IEKA 3OIPA 3C7JA 2L9NA 4GDFA 3W2AA 2VKEA 3PIOF 2PJRA 3HRUA 3HOYJ 2PMZN 4KJZA 2IGNA 1JUMA 5LBQA 2IA2A 4P9UA 4E7KA 1MMGA 5J1UA 1ZR2A 3SHFA 4HQEA 1WJAA 3S1MJ 5IYDJ 1LFPA 1HDPA 2DOEA 4CZZA 4WCGA 3KFWX 4M3EA 3K4BA 1T0FA 2W82A 2KLOA 2QQ8A 1QBJA 3VSLA 3CTAA 1YO5C 2ACJA 1YW9A 1V54H 3DXJF 3G1MA 3S93A 1I27A 1LQ1A 3GF2A 3HOVJ 1M1EB 4IRGA 1T95A 1ETYA 2B7EA 3KP2A 4UVAA 1QPIA 4A93J 2XAQA 1P4XA 3K1NA 5HLIA 3K2AA 1MJ9A 2M34A 1YFHA 1PJRA 2DA5A 4XMYA 3JSPA 2OAZA 2KIFA 1LDJA 3FMRA 3GLXA 4NC7A 5L3FA 1B59A 1EF4A 3PFIA 1W7PD 2CUJA 4QSHA 1Z67A 2HEOA 5EYRA 3TP0A 3PO3J 1KQ0A 2MD0A 4RAYA 2JT1A 5LHGA 2P0WA 1FOKA 4L18B 1HKTA 1YOVB 4D5CA 2E2HJ 3GX4X 2K02A 2JA5J 3IWFA 2K3FA 2HPMA 4A3MJ 2STWA 3CJRB 2ZXIA 4PSWA 4ENJA 1IGNA 3S1NJ 1FYMA 3LOCA 4CGZA 1ZGAA 3TW7A 2JN6A 2QSGX 3JTHA 3IUOA 4IXAA 5B1BH 4M3FA 5M5XJ 1WH7A 2XGCA 2L4MA 4NBQA 3RZOJ 3E1SA 1T6SA 1QA6A 4Y15A 4BY7J 5K1YA 3MKZA 4PFPA 1S5LC 3SQNA 3I4PA 4Q47A 4G12A 5GTIC 3C2GA 3OY9A 3IRQA 1KONA 5K5RA 1JHFA 5HLTA 1WVRA 2ZC2A 3H92A 3PO2J 4EGYA 5EEHA 3LA3A 3BG5A 4XKCA 2P5KA 2CW7A 2E35A 2R5ZA 2V9VA 4LK1F 3BOQA 4OINF 5D5VB 1QZZA 4EM2A 5D5WB 2CUEA 5HS7A 2ESNA 3BZKA 3W2VA 4DYRA 2W00A 3HHGA 3TQNA 4HLYA 2M0CA 1YS7A 2ZO4A 4CO8A 3S1RJ 1MIJA 1K4SA 1B72B 5C4XJ 2CWEA 1J0RA 5F0HA 4UVCA 3W6JB 3WU0A 2DA3A 3PNYA 4XOPA 2H6CA 3MEXA 3HOWJ 3QODA 3IH2A 4I01A 4HNTA 2HVRA 2WV1A 2ZBKA 2QKLB 4AWXB 4HLXA 4ASNA 1TQPA 3SZGA 2JQ7A 4JYKA 3O2PE 3ZMUA 2ISZA 2CH0A 2PEXA 3BY6A 4I2OA 1SFOJ 2IRFG 3E3VA 1WH5A 4NC8A 3WU2C 3CCSI 1ZREA 4O3MA 3LMMA 3K1PA 2HOTA 1RR8C 1J09A 2HZDA 2CUZA 4HNVA 5E3LA 3CZ6A 1AKHA 3CC7I 2QWWA 2ZMEB 1STZA 3RTRA 4EJVA 4A0YA 4XRSA 1Y6IA 3MKYB 5BMZA 3ZMSA 3G1LA 2DK8A 1TLHB 4ESBA 3UR3C 1Z3YA 5FKLA 2RV8A 4EMSA 3FK6A 4R1HA 1J59A 1YX5A 4HRIA 1TT0A 3FX3A 1WJEA 4U87A 4XNFA 2L2OA 2QENA 5EG0B 4RDUA 4ZYAA 2X6WA 3CCUI 5HVQC 3BR6A 2VC1A 1WQ2A 1JKRC 2KIMA 3HOSA 1ZRCA 5ICGA 4A6EA 1X3WB 2VXDA 3E6CC 3KLNA 2VI6A 2CQXA 2WY8Q 1OCRH 2WB1N 1ZHFA 2LREA 4AIDA 2LY2A 4BJTA 3F23A 4FETA 3ZP5A 4BQOA 2Y31A 2L4AA 1HSJA 4I99C 4BE0A 1RR7A 2FNPA 5K7HA 3EYIA 2WBMA 3U2RA 2HS5A 3H9GA 1E0EA 2KIUA 2V6CA 4CH7A 3M8FA 3ML6A 2R3SA 4M74A 2O0YA 4GRIA 3OR1C 1I6HJ 3DCFA 1HBXG 3K70D 3BCBA 2JUCA 1ETWA 3BR3A 4BHPA 3WGIA 3QOEA 5KAFC 3DTEA 5E1WA 4A0ZA 4IHSA 3ASOH 1R1UA 3ZGKA 3CCYA 5HDNA 2HZTA 2CFXA 4H0EA 1P9QC 4EJUA 1QNTA 2M0MA 3QP5A 4UV9A 1AU7A 1B9MA 1UAAA 4D7MA 3U21A 2VQHA 2QQBA 4MIMA 4XN0A 1QRYA 1V4RA 3EUAA 2IS2A 3T5XA 1AHDP 1XG1A 1K78A 4AC0A 3E7LA 5HLGA 2R5ZB 1XMKA 3HEFA 4MTEA 2XC7A 2DYSH 2VQCA 1J5YA 4K2EA 4QTRA 1ENHA 1EV7A 1RZ4A 3ABKH 2K9NA 4KN7X 1Z3XA 5ICEA 4TV7A 4ETSA 3SZTA 2WAQN 2R92J 3ASNH 3KEOA 1YITI 2CQQA 1IZ1A 2VN2A 1HW2A 5D6FA 3G4SI 3OWTA 1DU6A 3TP3A 1IV6A 4BEHA 3BQZA 2LKXA 4ENKA 1TNSA 3CQZJ 3S2DJ 1RUNA 4QIWN 3NARA 3OYBA 2M30A 3C1DA 4ZTFA 4DBRA 5K7ZA 3WTXC 2VKVA 2Y2ZA 1SAXA 4XR6A 1R4MB 2ME0A 1HDDC 1SAUA 2VBYA 2DA6A 5J6XA 4CHUA 4RB0A 3W3CA 2MBFA 3O6BB 3EQLF 4F91B 4I0BA 2DBBA 3KEQA 4P9FA 4M9ZA 2E1CA 1FIPA 2GXBA 3KZIC 4LFUA 2ME6A 4C3IJ 3MMYB 2VE9A 4MEXF 1RUOA 4LG0B 4EM1A 5DM6F 2L0KA 1ERDA 4YIRX 1TW2A 1VQ4I 3LSKA 2QBYA 1OYIA 1V5GA 2JK3A 1OPCA 3HPHA 3I9V2 2UV1A 3IHUA 4ON0A 2A68F 4M72A 3GBGA 2V1XA 3GZ6A 1MKMA 5GPAA 2DA7A 3I56I 3HXLA 2AQEA 3KE2A 4AIJA 4JX4A 4LG3A 3Q3SA 1KU9A 1SD7A 2B9SA 3M8JA 3CCJI 5ICFA 3OYGA 2YU3A 2J5OA 3DU6A
chains in the Genus database with same CATH topology
3ABLH 1OCOH 3X2QH 2EIJH 3ASNH 3AG4H 5B1BH 1V55H 1V54H 2OCCH 1OCZH 3AG1H 3AG3H 5B1AH 5IY5H 2DYRH 2Y69H 5B3SH 3ABMH 3WG7H 2EIKH 2EINH 1OCCH 3AG2H 2DYSH 2EIMH 3ABKH 1OCRH 3ASOH 2ZXWH 2EILH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL H;  1OCO H;  3X2Q H;  2EIJ H;  3ASN H;  3AG4 H;  5B1B H;  1V55 H;  1V54 H;  2OCC H;  1OCZ H;  3AG1 H;  3AG3 H;  5B1A H;  5IY5 H;  2DYR H;  2Y69 H;  5B3S H;  3ABM H;  3WG7 H;  2EIK H;  2EIN H;  1OCC H;  3AG2 H;  2DYS H;  2EIM H;  3ABK H;  1OCR H;  3ASO H;  2ZXW H;  2EIL H; 
#chains in the Genus database with same CATH topology
 4A3L J;  4NB5 A;  4ZZL A;  2EZK A;  4CYD A;  3CCQ I;  4HX4 A;  1V5E A;  3OYF A;  3GTK J;  2KKO A;  2ZXH A;  5J1Y A;  1VZ0 A;  3OYA A;  2NOG A;  3DP7 A;  1JUS A;  5AON A;  3AG1 H;  3DBH B;  3N4M A;  4MFD A;  2YS9 A;  1JE8 A;  2MAB A;  2KDO A;  5JLX A;  5FRN A;  1X1D A;  2DAO A;  3CJN A;  2XF5 A;  2W84 A;  1I1G A;  2CW0 F;  4EJW A;  1NTC A;  5IPA A;  1MBH A;  2O5R A;  3EUH A;  2DN0 A;  2GLO A;  2DI3 A;  5DYM A;  1VQP I;  3BJ6 A;  3OMY A;  3QPS A;  1SD4 A;  3U1K A;  2OQG A;  5GAE J;  4DOZ A;  2QUF A;  2EFP A;  2XAJ A;  2LDU A;  2R7S A;  3PFY A;  5F6F A;  1Q1V A;  3SJM A;  2VLA A;  3RDI A;  2XUB A;  3HB9 A;  1D5Y A;  2DQR A;  3D5L A;  4AVP A;  4HW0 A;  2XB5 A;  4YII A;  2PG4 A;  4KIS A;  3I4N J;  5E79 C;  4FQG A;  1D8K A;  2X85 A;  1X2N A;  3D5R C;  3ZQH A;  3M7G A;  3GZN B;  4KIB A;  2M8G X;  1IN8 A;  2HVQ A;  2BE5 F;  3HM5 A;  3KP4 A;  5CVJ A;  3WTZ A;  4BGD A;  1FLI A;  1UG0 A;  1F5T A;  4YEJ A;  4BJ6 C;  3S15 J;  4XBF A;  4G7H F;  5JHF A;  3S3O A;  2VBZ A;  2A6T A;  4LD5 A;  1REP C;  3QYB A;  1E2X A;  4E7J A;  4LB6 B;  3F3X A;  5LGU A;  3MVP A;  4N9I A;  2IW5 A;  1QZY A;  3C18 A;  4L9T A;  1YIJ I;  4IRI A;  2TDX A;  2L7F P;  1XDU A;  2VJ5 A;  3CDH A;  1J75 A;  2CRG A;  4M9X A;  3WE2 A;  2ZCW A;  3HGG A;  3K6G A;  4IOC F;  3S3M A;  4LIV A;  3RKQ A;  4S04 A;  5FB2 A;  4BBS J;  3K1M A;  1IW7 F;  3MKL A;  3PNV A;  5LFA A;  3H0G J;  4YEL A;  3U9G A;  5LRR A;  3ZN1 A;  1IRF A;  5B5E C;  4ZDO A;  2JWT A;  2E34 A;  2BY2 A;  2QBY B;  2BV6 A;  1OYW A;  5D8L B;  1QVT A;  1USS A;  3LSR A;  1WCM J;  3FBN B;  4QLC U;  3L2R A;  1HF0 A;  1A5J A;  1XSX A;  2RVC A;  2A6H F;  1BOB A;  2G7U A;  2YX4 A;  5CPR B;  1QHG A;  2RQQ A;  2MFZ A;  4D5F A;  3OYJ A;  2O8K A;  2XRO A;  2X1C A;  2OU2 A;  3HUG A;  2BEO A;  1LVK A;  2R7T A;  3F72 A;  3OSG A;  1JUP A;  2IGO A;  1W5C C;  2ISY A;  2EPF A;  2I5U A;  3KZZ A;  5FRM A;  5DCM A;  5F0C A;  3G71 I;  3IV5 A;  1FTT A;  1XGN A;  3DTI A;  4KT6 A;  3F6V A;  2CS3 A;  1T8I A;  2V7F A;  3RSN A;  2XPW A;  4C2U A;  3OYC A;  1HW1 A;  1CGP A;  3HJE A;  4A3I J;  3CF2 A;  3OYM A;  1YIO A;  1FJL A;  2VOD A;  2ICW G;  4RGS A;  3VYR B;  3OYI A;  2IXS A;  2G7H A;  3JRD A;  4M9S A;  3SYT A;  4JK1 X;  3U1D A;  4HNU A;  3P7N A;  2LSO A;  4EJT A;  2HI3 A;  2I8D A;  4FHT A;  5H6R A;  1W0T A;  3SEZ A;  4L5I A;  4X0G A;  3COA C;  2M7B A;  4A0X A;  3CJT B;  4C2M J;  3WG7 H;  4LB5 A;  4E7Z A;  3JAM Z;  2E36 A;  3E6D A;  3ZMT A;  4A3C J;  2DOD A;  4M73 A;  3CUQ B;  4N4N B;  3ZQG A;  2Q2E B;  1TQI A;  3RKW A;  1XCV A;  5LHH A;  2ELJ A;  4E7S A;  1GDT A;  2HTJ A;  3EUK L;  3BTC A;  4MHG A;  3QRF F;  4G8X A;  3DEE A;  1FSE A;  2DDB A;  2NNY A;  3ZQF A;  2HYJ A;  2L7Z A;  2QZ8 A;  4C30 A;  5IOY A;  4RBO A;  3BC8 A;  3T8R A;  4A3G J;  4XQF A;  2YUS A;  4XID A;  4FX0 A;  1G59 A;  2LVS A;  1Q1H A;  1MDM B;  3GTL J;  2X4H A;  1VQL I;  2CYY A;  1LDK B;  2X1D A;  2HQA A;  2KRH A;  4AU7 A;  4RAG A;  3BG3 A;  2H1L A;  1OMI A;  4PCQ A;  3NRV A;  1T38 A;  3K4J A;  1OCO H;  3FXU A;  1EH8 A;  1WJF A;  3FKI J;  3K4K A;  3PQK A;  4MO7 A;  2M2E A;  4AIH A;  1YLF A;  2LKP A;  3EYY A;  2COM A;  3S16 J;  1HC8 A;  4UVB A;  2BGC A;  1F36 A;  2DA1 A;  2IVM A;  3FXK A;  3ISP A;  5H20 A;  3RI4 A;  3GCM A;  2HOS A;  2PMU A;  1VF9 A;  3H9Q A;  3GFM A;  2GM4 A;  1VND A;  1R1V A;  2KDZ A;  4PJ0 C;  1A36 A;  4MNU A;  3CP8 A;  1ZN2 A;  1XD7 A;  1WGX A;  3H5N A;  2HQR A;  4XKV A;  1DU0 A;  1DGW Y;  1IN6 A;  2DT5 A;  4AYB A;  2NVQ J;  2HWV A;  4I02 A;  4BHC A;  1S7A A;  2HXO A;  2XSD C;  3JR9 A;  3DFG A;  3G1O A;  3BP8 A;  1TWA J;  4OMZ A;  1IC8 A;  3NWT A;  3PUF A;  5KNL A;  3HTS B;  3A03 A;  3P9C A;  1BC7 C;  2HVS A;  2XIG A;  3L2Q A;  5LGN A;  2N8G A;  5F64 A;  4RAF A;  2OD5 A;  1FEX A;  5L3E A;  3BR2 A;  1NK2 P;  2JSC A;  3VWB A;  4RB2 C;  2IGM A;  3V4G A;  3NQO A;  1TWG J;  4HBL A;  2KT0 A;  4LIU A;  3BR1 A;  1O3S A;  1R5I D;  2JA6 J;  4EVI A;  3JAM K;  1JJ8 C;  5D5X B;  3DF8 A;  4BQQ A;  1QU3 A;  1AOY A;  1OKR A;  1ZG3 A;  4IF4 A;  1U8B A;  1FBQ A;  2OZU A;  1ZGJ A;  4CDG A;  1B72 A;  3ZN0 A;  2VB6 A;  3A4C A;  2M45 A;  4P1W A;  1XB4 A;  5M5W J;  1EH6 A;  1POG A;  2Z33 A;  4RB3 C;  1UEL B;  4L5J A;  1DPU A;  3CP2 A;  3OSF A;  4I76 A;  1ULY A;  5DD4 A;  2QVO A;  3K4L A;  2GXA A;  5FRO A;  3GVA A;  5TIS C;  2DFH A;  2DMN A;  1ORK A;  2BXZ A;  1T0F C;  2DDA A;  4B48 A;  5HOD A;  4WX9 A;  1HA8 A;  2LLK A;  3S2W A;  1BL0 A;  2IAI A;  4XRF A;  2ZME C;  2QGU A;  1FNN A;  3K4N A;  3P9I A;  1ZRD A;  4KIG A;  2O3F A;  1HCR A;  5K7F A;  1UFM A;  1TTY A;  3LSI A;  2E19 A;  3F6O A;  1R36 A;  2XHK A;  1OQY A;  2LNB A;  2ZME A;  4F3Q A;  3FMS A;  2UUZ A;  2VPR A;  1D8J A;  1WHU A;  3M07 A;  4PK4 A;  2BHZ A;  3OS0 A;  1TWC J;  1ETK A;  1X1C A;  2DFE A;  1JI8 A;  3KX2 A;  2PI0 A;  1PVE A;  4L0Y B;  1YRN A;  3CO7 C;  2LY1 A;  4BU2 A;  3E0J B;  1WJ5 A;  5CQE A;  2KHM A;  3E5X A;  5DM7 F;  2FOW A;  2BBY A;  4OU0 A;  3LSG A;  3HHH A;  1H0M A;  2MLG A;  2VAS A;  5EG0 A;  4M3G A;  2JJ7 A;  5EDN A;  2DFI A;  2R7X A;  5JI6 A;  5FO5 A;  4WXC A;  4XLE A;  2KP6 A;  2XAG A;  2JA8 J;  5F1J A;  2NS7 A;  3AL0 B;  2R7O A;  3F8C A;  4J00 A;  2VQL A;  3CCV I;  2D2W A;  5GAD J;  2V79 A;  4KN4 X;  3H0D A;  1BI0 A;  3GZ5 A;  4F55 A;  2K3P A;  1SVL A;  1APL C;  4Y33 A;  2VKH A;  2RKH A;  1BW5 A;  4W1U A;  2EZH A;  4UV8 A;  2H1K A;  4IOA F;  3WGG A;  3Q0U A;  1VQK I;  3MQ0 A;  2O61 A;  2QKM B;  1R7J A;  6PAX A;  5C44 J;  1Y39 A;  4B3A A;  2DJI A;  3J7Z I;  2VL8 A;  5EJC A;  2NRA C;  2VBW A;  3BG7 A;  4GGG A;  4PDK A;  3FXJ A;  3K70 C;  4UY8 I;  4FCY A;  1YJN I;  3DKX A;  4CA0 A;  4B44 A;  5HNH A;  2AS5 F;  2V1N A;  3QU3 A;  3DPU A;  2X6Y A;  3OIQ A;  3ERM A;  2CUF A;  2QEX I;  3B02 A;  1MND A;  2TCT A;  4ZH4 F;  1XMX A;  1VI0 A;  2FXA A;  3S8P A;  4ZJZ A;  2OA4 A;  4B09 A;  2FNA A;  1A35 A;  3HBL A;  3LSJ A;  1B4A A;  2DOA A;  3RJP A;  2OCC H;  2DA2 A;  3NWS A;  2VON A;  2HTS A;  1GXQ A;  5J40 A;  2QLZ A;  4Z6Y A;  2H27 A;  2B63 J;  1B9N A;  1G6N A;  5KAI C;  4HA8 A;  1HOM A;  1WI3 A;  3ZQ7 A;  3TDU C;  4ZTJ A;  1R22 A;  1FWZ A;  2DMU A;  2DFF A;  1R5G A;  3V8K A;  1LUJ B;  4HX7 A;  4BXU A;  3CDL A;  2BHY A;  2C6Y A;  2DK5 A;  5BOX A;  3VSK A;  1RIO H;  1FMW A;  1RRJ A;  2VPL A;  3AKZ A;  4KUM A;  4MQV A;  1R23 A;  3HSR A;  4II2 A;  5JR3 A;  1YX3 A;  3QAH A;  4LMY A;  1GVJ A;  1O7L A;  3KP3 A;  4XLN F;  3JRB A;  4E7L A;  1Z21 A;  2VKD A;  4WXD A;  1X3Z B;  2P81 A;  1K61 A;  3VFZ A;  5B1A H;  2OCE A;  2P6T A;  1ZRF A;  1D1C A;  1ETV A;  2L02 A;  5J4Y A;  2H8R A;  2HNH A;  2VQG A;  5FKK A;  3L1P A;  2EK5 A;  3MKW B;  2NS0 A;  2CSO A;  3BR0 A;  4XLH A;  2K86 A;  2EV0 A;  2IS4 A;  2J5P A;  3FXO A;  1D1A A;  5E8G A;  4IO9 F;  1TC3 C;  1IRG A;  1FYL A;  1MJA A;  3K2Z A;  1LEA A;  3SFZ A;  1QQI A;  5IT3 A;  1U5T B;  1MMA A;  2VC0 A;  4DQ2 A;  1YRN B;  3TO6 A;  2K5C A;  3OIO A;  4E7H A;  3GTQ J;  1LJ9 A;  3WTW C;  1JT6 A;  2MA3 A;  4P55 A;  3BJA A;  3RYR A;  2CW8 A;  1SD6 A;  3D5S C;  4LG0 A;  1N77 A;  4I09 A;  3CC2 I;  2XKP A;  3BDD A;  5FKM A;  1UJ8 A;  1VQ9 I;  2FX0 A;  1AWC A;  1CQT A;  3ABU A;  1YJ9 I;  4B43 A;  4BXX J;  4GCV A;  4IHT A;  1FP1 D;  2TRT A;  4FAS D;  5DTD A;  3E5Q A;  5E1Z B;  3K9T A;  2GOM A;  5TJJ A;  3CCL I;  4BH9 A;  4A3K J;  4E70 A;  1XDS A;  4BAC A;  4XLA A;  2WC2 A;  2XRL A;  3CCR I;  4HEA 2;  1F9N A;  1U9N A;  3GLL A;  1EJ9 A;  1K6Y A;  3HOT A;  2R0Q C;  5DV5 A;  5L3G A;  3OYL A;  3LSM A;  4R79 A;  4DGW B;  2VJJ A;  1O57 A;  2R4G A;  1UMQ A;  3CF5 F;  3HSE A;  5CVI A;  4CYC B;  2ZXW H;  2VOP A;  3ZMD A;  3ZMV A;  5FKO A;  4A3F J;  3O3K A;  1HQC A;  1UCR A;  2PMH A;  2VT3 A;  3IH3 A;  4BQN A;  4BS9 A;  1IRZ A;  1UB9 A;  4M6Y A;  4CIC A;  2FQ4 A;  2ADU A;  1OYY A;  4N4O B;  4NUB A;  2UZK A;  5CLS A;  2PX9 A;  2P5V A;  4I7H A;  3C2B A;  1Y8Q B;  5KK1 A;  4AD9 A;  3DWL E;  5DS9 A;  3DBR B;  3ESW B;  3HRT A;  2F5V A;  4E6K G;  1UG2 A;  3SEQ A;  3R61 A;  4GYG A;  4O5V A;  2BY1 A;  4ZC3 A;  2WAE A;  1R71 A;  1I3A A;  1PUF A;  2G9W A;  3CDI A;  4ABZ A;  3HDD A;  2PQ8 A;  4DZP A;  2V9K A;  1R4N B;  2Y69 H;  5FFX A;  3M1C A;  4F52 A;  3CO6 C;  1ZTR A;  4HSR A;  2WAF A;  2CGP A;  4IQ4 A;  3WTU C;  3KCC A;  5DDG A;  5JLW A;  4XLP F;  2HQ5 A;  4QPO A;  5ED4 A;  3ECO A;  1YS6 A;  3SZP A;  4ZYG A;  5J47 A;  3E6M A;  2NVX J;  4AIK A;  1YI2 I;  3WTV C;  2JZY A;  2M7A A;  3GYH X;  2AHQ A;  3F0C A;  3Q5F A;  4KFC A;  2XAF A;  1HXD A;  1FBS A;  1ZGW A;  1CF7 B;  4IKF A;  4BXF A;  3ROU A;  5CVV A;  1FPQ A;  4AVZ A;  1DDN A;  4NHJ A;  2LC2 A;  2VJ4 A;  1OCC H;  3VPR A;  5ICC A;  4OAZ A;  4RGU A;  1Z9C A;  4G7O F;  1T33 A;  2E5Z A;  2LBF B;  3CD6 I;  3PJR A;  2M1B A;  3G73 A;  2K9S A;  2CV0 A;  3HOZ J;  3M3Y J;  2R5Y B;  1T2K A;  4KIT B;  1R58 A;  2IA1 A;  2PN6 A;  2VBX A;  3MD2 A;  1D0X A;  1U6G A;  2GA2 A;  3JTG A;  2RRE A;  2K9Q A;  3WHB A;  1PP8 F;  2EB7 A;  1P92 A;  2ELH A;  3RPQ A;  2OTL I;  2NVT J;  1GUU A;  1RKW A;  2R7F A;  2MC4 A;  2VE8 A;  4KIF A;  4CSW A;  3S17 J;  2HQN A;  2X1E A;  1L3L A;  3CLO A;  2XGD A;  4CXF A;  2H6B A;  2R7V A;  5JVG F;  4JP0 A;  2HDC A;  4MGR A;  4F93 B;  5J8F A;  3A02 A;  1Z6R A;  3FF5 A;  1XC5 A;  3BLY A;  3KLO A;  1S3J A;  3GW2 A;  1G3W A;  2MH9 A;  3GEZ A;  3HKZ A;  2HFH A;  4KMF A;  3PUB A;  2YSR A;  1UHS A;  2B0L A;  2L5Q A;  2OPT A;  4BYY A;  1R1T A;  4BL0 B;  5GP9 A;  3MN2 A;  5FD5 A;  2RN7 A;  3DQV C;  1Z1D A;  3OL4 A;  1J2X A;  5EGO B;  1G2H A;  3H36 A;  3LA7 A;  2F2E A;  1OCT C;  2A5Y B;  2WV0 A;  1BJA A;  1YYV A;  3EUH C;  3CMA I;  4CCN A;  1MGT A;  5HDG A;  4D7N A;  3WTT C;  2O7O A;  2PJP A;  4IHY A;  3K69 A;  2FJ1 A;  5FGM A;  4NQW B;  1WJD A;  2RNG A;  4RGR A;  4XOR A;  1B8I B;  1F1Z A;  3DPT A;  3BG9 A;  4HPQ A;  1KU3 A;  3H5R A;  1RKT A;  3CUQ C;  1FC3 A;  5E3M A;  1GVD A;  4CCK A;  2JA7 J;  3GXO A;  2BZT A;  3K7A J;  3S32 A;  4RM3 A;  3KYD B;  1ZG1 A;  2MH2 A;  1C0W A;  1PUE E;  3RYP A;  4XSX F;  3ZXS A;  3CUQ A;  1S6L A;  2HDW A;  2EFO A;  1SFX A;  2Q2E A;  3FM3 A;  3ZRG A;  1VQN I;  1YJW I;  5HS9 A;  2DU9 A;  1JKP C;  2XF6 A;  2RC4 A;  1MBG A;  1MZB A;  2IGK A;  3I55 I;  1JT0 A;  2W25 A;  3LSP A;  2HGC A;  1PUF B;  2FF4 A;  3CUO A;  3ONQ A;  1JKO C;  3GTJ J;  1I50 J;  2EIL H;  1DP7 P;  1JTY A;  1YW7 A;  2MSY A;  1NG7 A;  3RQI A;  5EZH A;  2CV2 A;  3S3N A;  2HXI A;  3GFL A;  1MDM A;  3HSF A;  3DBL B;  1YG2 A;  3A0H C;  1IDZ A;  4LK0 F;  3OOU A;  1D3Y A;  2V26 A;  2D1H A;  1X1P A;  2BXY A;  2EJR A;  1BA5 A;  3BWG A;  2BOL A;  2ECB A;  1WI9 A;  4KNY A;  1ZKG A;  2NNN A;  2EIK H;  1H9G A;  3BTJ A;  4DBQ A;  5J8C A;  3I0T A;  5L3B A;  1MBK A;  3FHZ A;  1ZQ3 P;  5HOO A;  3PNT A;  2OJE D;  3HRS A;  1V5F A;  1MBE A;  3DLL F;  2ETH A;  3J80 Z;  3FXM A;  5LEK A;  4DIQ A;  1R00 A;  3EDP A;  1MNE A;  4KIC A;  3OS2 A;  4BE1 A;  2A61 A;  2LKS A;  2LRD A;  3IRR A;  1DGR M;  1OR7 C;  1BJZ A;  3ZQI A;  3D1N I;  1QHH D;  1U0J A;  2DT6 A;  1VQ7 I;  1UZC A;  3LNQ A;  1W36 C;  4Y52 J;  2CQK A;  2WTE A;  5F1R A;  3N05 A;  4HF0 A;  1OR7 A;  3I3L A;  1Z77 A;  4AYB N;  2EIM H;  1GLN A;  2NVU B;  2DPU A;  2LTP A;  4A69 C;  4V2G A;  1KZH A;  3TO9 A;  2CQ7 A;  3CCM I;  3OL3 A;  3DLA A;  4ESJ A;  4DYC A;  2EA2 A;  2Z2S B;  2XDV A;  3VYS B;  3RKX A;  3BTI A;  2LMD A;  4LIT A;  3OYN A;  1OCZ H;  1W1W E;  4A5M A;  1T98 A;  1IUF A;  2E1M B;  2DYR H;  4N0B A;  1P7I A;  1YTY A;  2EZL A;  5H2F C;  1XCB A;  1W4M A;  1ZLJ A;  3MZY A;  4S0H B;  2HKO A;  2EIN H;  3K4C A;  2X51 A;  3KP6 A;  4UUS B;  2VOO A;  2FRH A;  4LLG F;  4YFN F;  3S2H J;  4P96 A;  5BNG A;  4EAT A;  3IKV A;  2O8X A;  2XGX A;  4N9H A;  3F8F A;  2V1D A;  1KQ9 A;  3NEU A;  4M3B A;  4G6T B;  2GA1 A;  5AIQ A;  3W6K B;  2E7X A;  2FSW A;  2IBD A;  4CCO A;  3JW4 A;  3QWL A;  3RPU A;  3VYT B;  2R7U A;  4KT5 C;  4XON A;  1T56 A;  2BVM A;  2V9P A;  4W97 A;  2FBH A;  2CV1 A;  3AG2 H;  3R60 A;  3MZ8 A;  1P7J A;  1Y1V J;  3BRO A;  4B3X A;  2CMP A;  2PFB A;  2XPU A;  4Z2Y A;  3T0Y A;  3M4O J;  3GUD A;  1U78 A;  3UKG A;  3CC4 I;  1JGS A;  4ZYH A;  1Z91 A;  2H94 A;  3I53 A;  1ZYR F;  1ON2 A;  2G0E A;  3FBI B;  3J80 K;  1P2F A;  2IA0 A;  3IKT A;  2V6E A;  1DP3 A;  2LFB A;  3QPT A;  1FOX A;  1WSU A;  1SC7 A;  1KYZ A;  3F9K A;  3H35 A;  3AL0 C;  1MMD A;  2M3A A;  2LR8 A;  5FLX Z;  3BG6 A;  2EZI A;  3L7W A;  4ENM A;  3A01 A;  1MD0 A;  2DTR A;  3FMQ A;  1VQ8 I;  2OTJ I;  1E17 A;  2F5E A;  5KVR A;  3WE3 A;  1IO2 A;  5FLM J;  5ILU A;  3OYD A;  3HC7 A;  3MWM A;  4HQM A;  2W7N A;  5H6Q A;  4XLF A;  3V8L A;  2NOJ B;  4ZDL A;  4FTH A;  2RAE A;  5EZG A;  2GOX B;  4MQ9 F;  3I5U A;  1FTZ A;  5FFZ A;  5M3F J;  1IXS B;  1TQM A;  4E4H A;  3CES A;  5IOZ A;  2O6G E;  1LVA A;  3GME A;  1I6X A;  4NC6 A;  1BIA A;  4Y3O A;  1W36 D;  5C3E J;  2ELK A;  4C3J J;  1MJB A;  3TMO A;  2L3D A;  3L09 A;  2LK2 A;  3E6B A;  1UHW A;  1MSF C;  3WOD F;  1WRJ A;  2DW4 A;  4U0Y A;  4XN3 A;  3FHN A;  2X6O A;  4P5O A;  5E1X A;  4ANJ A;  1MSE C;  3F8M A;  3BR5 A;  4MEY F;  4BKX A;  2RQP A;  3NAU A;  1PP7 U;  1SFU A;  5E18 F;  2JPB A;  2KMU A;  5IP7 J;  5IYB J;  3KIO A;  1D0Z A;  4X1E A;  1DUX C;  5IT9 Z;  3OS1 A;  3PL8 A;  4XRM A;  1X4P A;  1A6Q A;  1FBU A;  2MD5 A;  5L3C A;  3QPL A;  1RC9 A;  3L2W A;  2LP0 A;  9ANT A;  2HOE A;  1K4T A;  1ZAO A;  1MBF A;  4YFX F;  2W48 A;  1HLV A;  5HS8 A;  4A3E J;  3WHC A;  4UUV A;  2JVG A;  3RPU D;  2JVH A;  2KJC A;  3JRI A;  5FD6 A;  2JPC A;  4R8H A;  5FLX K;  1L0O C;  3FXQ A;  1K83 J;  3A1Y A;  1LEB A;  2NS8 A;  3E5U A;  4L9J A;  3QOP A;  4OMY A;  1OIS A;  1U2W A;  3WU1 B;  4A3B J;  2FUG 2;  1YW8 A;  2X6X A;  1FX7 A;  2Y0S A;  1LNW A;  1K7A A;  1VQM I;  4C9Y A;  2GWR A;  1G3Y A;  2DQL A;  5JHU A;  5LD2 C;  5EF6 A;  3V8J A;  2MLK A;  2GXG A;  3TKY A;  4XRS G;  1R49 A;  4IRH A;  2Y9Z A;  1JJ6 C;  2XF7 A;  3QYF A;  1GV5 A;  5K5Q A;  3I59 B;  1BI3 A;  2BVL A;  2DCE A;  3FWE A;  3R0J A;  1O3Q A;  4LOC A;  1T08 B;  2CG4 A;  2K85 A;  5B3S H;  3W6V A;  1U5T A;  2K4B A;  2LY9 A;  1WJB A;  3QP6 A;  3BZC A;  2WAD A;  2FBI A;  4G6Q A;  4DW6 A;  3BT9 A;  5ILS A;  4ZYE A;  5M3M J;  4A6D A;  2W4S A;  3A01 B;  1EA3 A;  4QPQ A;  2Z9O A;  3OR2 C;  2L9R A;  3SDG A;  4UHT A;  1OLT A;  1E3P A;  1Z0X A;  5LGT A;  3A2K A;  1OFC X;  4EM0 B;  3L2V A;  2UXN A;  4HV6 A;  4WF2 A;  1ZH5 A;  1X4O A;  5IT9 K;  2R7Q A;  3ZOB A;  1Y8R B;  2RGV A;  3LSH A;  4JOM A;  3HOU J;  1XS9 A;  1R5H A;  2L9V A;  5HLH A;  1XGM A;  4AM3 A;  3H3U A;  2QCO A;  4GFB A;  4ZDP A;  4EJO A;  3BCA A;  4BUP A;  1X1B A;  5JVT A;  2HR3 A;  2MGQ A;  2IT0 A;  5GTH C;  5E17 F;  1I5Z A;  2MW8 A;  2CJJ A;  4OIR F;  2M4K A;  2Z16 A;  4OIO F;  5F08 A;  5J1R A;  4CYC A;  3Q9S A;  3VOE A;  3KYL A;  2RNJ A;  5J4V A;  4HF2 A;  2K9L A;  4IHV A;  4A12 A;  3VDX A;  3FKJ A;  1XGS A;  3HOX J;  2GIV A;  4F92 B;  4HDV A;  2CQN A;  1VQO I;  1IXR C;  2KQR A;  3L9F A;  1LFB A;  2XSJ C;  3C3W A;  4OIP F;  1W7P B;  5DD8 A;  2FOK A;  2JRT A;  4Y13 A;  1A6I A;  2MG4 A;  3M9A A;  4KDP A;  3PM1 A;  2OQR A;  4M71 A;  4WWC A;  5LHI A;  3KYC B;  1BI1 A;  2UWM A;  3JRH A;  4EGZ A;  5KCM A;  4BDY A;  3F22 A;  5CYV A;  2XVC A;  1ZR4 A;  3R0A A;  2OUM A;  5E8I A;  4L9V A;  4GYI A;  2KJB A;  4HAM A;  3HRM A;  5FKN A;  1FOW A;  1HKS A;  1UST A;  3DEW A;  5D5U B;  3WTY C;  4LJZ F;  2GAU A;  2MC3 A;  3JRA A;  2A05 A;  4XSZ F;  1W5T A;  4S05 A;  4D9J A;  3CMM A;  4CCM A;  1W5S A;  4GXO A;  4Y4R A;  3KEY A;  1E3H A;  1KA8 A;  1D1B A;  4LLN A;  1V55 H;  1BIB A;  3N97 A;  2M8E A;  5E20 A;  2A3S A;  2ID3 A;  1IAW A;  1FP2 A;  2W85 A;  2NXN B;  1W0U A;  3D0S A;  1TW3 A;  3ABT A;  2PMZ A;  3ELK A;  1LE8 B;  2F4O B;  2L7M P;  2EFW A;  3JRG A;  2IS1 A;  2PJR B;  3F21 A;  2D1V A;  2EV6 A;  3EET A;  1CF7 A;  4DJA A;  3ABL H;  4KYW A;  4UUT A;  3P9K A;  1XPX A;  4HDU A;  1TP4 A;  1RI7 A;  2E71 A;  3QU6 A;  4J19 A;  4CCL A;  5A2Q Z;  3RZD J;  1A31 A;  5GPC A;  5E3N A;  2X0L A;  4XIC A;  3VOD A;  2R7W A;  1DQU A;  4B1R A;  1D0Y A;  3HG9 A;  2LBF A;  3AG3 H;  4B8X A;  4C3H J;  2Z1D A;  1S7E A;  3JRF A;  1R6R A;  2K40 A;  4RMN A;  4BBR J;  2R5Y A;  1QO0 D;  3ERE D;  1B1B A;  4GO1 A;  4AUX A;  5M5Y J;  3P5J A;  1IDY A;  5BPD A;  2F4M B;  4FX4 A;  4V2F A;  2OC6 A;  1Z6T A;  4CCJ A;  4Q4Z F;  1G3T A;  2OZ6 A;  1B6A A;  1YQA A;  3ZCO A;  1X2M A;  2M5W A;  2OBP A;  2JA2 A;  3ECH A;  2FQ3 A;  1HW5 A;  2H09 A;  3WGH A;  2XGE A;  1Y0U A;  1G3S A;  2ZKZ A;  2VIX A;  2F5C A;  2EH3 A;  2QM3 A;  4M3D A;  1BW6 A;  1S8N A;  2IP2 A;  1K79 A;  1J7K A;  1FYK A;  2E60 A;  2EFQ A;  4B4C A;  3EPZ A;  3A0B C;  2F6C A;  4MLO A;  3J81 Z;  1XTA A;  1PYV A;  3HKZ N;  4IL6 C;  4YFK F;  5EGO A;  1SMY F;  2WY7 Q;  3HZJ A;  3IH4 A;  1KQ8 A;  3AAF A;  2WA0 A;  3J7A O;  2ZB9 A;  2QSF X;  3LST A;  3S14 J;  3FIS A;  1YE9 A;  3VEP A;  3H3Z A;  1U9O A;  3L2C A;  3SDB A;  3PSF A;  4G9Y A;  1YHQ I;  3LA2 A;  4UNO A;  1NHA A;  1IXC A;  3TW6 A;  4LLL A;  4XOT A;  3GFJ A;  3ZQQ A;  3F8N A;  4NQW A;  3DU5 A;  3SXY A;  4PFO A;  4HV5 A;  1B8I A;  3AFH A;  3OYE A;  5ILV A;  2KRC A;  2AQF A;  2X48 A;  1U3E M;  2F5D A;  3OOP A;  3L2U A;  4IZZ A;  3KP7 A;  2DXI A;  2KIQ A;  2NAZ A;  1F43 A;  1S9H A;  4E7I A;  2L54 A;  4XLC A;  1ETQ A;  2ZJ2 A;  3C2H A;  2ECC A;  1VQ5 I;  2EWN A;  2LOO A;  3DV8 A;  2ZNY A;  2ESH A;  1MH4 A;  1FSH A;  1RES A;  2E5N A;  1Y1W J;  1BI2 A;  4ZZD A;  3V7S A;  5JFR A;  5A2Q K;  4OAY A;  2L7K A;  4BE2 A;  2D45 A;  1NG6 A;  5D6E A;  1SEU A;  2ZJP F;  1S72 I;  3RKY A;  2DA4 A;  2I10 A;  2L9S A;  4Y7N J;  1RNL A;  2XAU A;  4PUS A;  2GBY A;  2LF8 A;  5TRD A;  1MBJ A;  2Y75 A;  4XKW A;  1U8R A;  2PLY A;  3FIW A;  3VB2 A;  4I98 B;  3J7Y J;  3JRE A;  1ITY A;  1ODD A;  1I39 A;  5E3O A;  2ZFU A;  4PGG A;  1P4A A;  1AA7 A;  1IN5 A;  3DPL C;  4KA4 A;  3I54 A;  3BPX A;  1LB2 A;  4UXN A;  4PJM A;  4U0W A;  1WFX A;  3OV8 A;  3IP4 B;  2FEZ A;  4L0Z B;  1QGP A;  4ZYD A;  1XSV A;  4WK8 F;  3B6A A;  1H89 C;  3H5A A;  1Y0N A;  2Y48 A;  3H1C A;  3REO A;  3J81 K;  5FLV A;  5F27 A;  5IP6 A;  2XAH A;  5DEQ A;  3FK7 A;  1IG7 A;  2EQR A;  2EV5 A;  3I64 A;  4XM3 A;  1IN4 A;  3B73 A;  2XV4 S;  2ZNZ A;  3UNG C;  4BAY A;  2FE3 A;  1BR4 A;  2Y30 A;  2BW3 A;  2VT2 A;  3G6E I;  1O4X A;  4OOI A;  3LFU A;  4XL9 A;  5F04 A;  1AKH B;  3GWZ A;  1SD5 A;  2EIJ H;  2O03 A;  5CJ9 A;  4M6X A;  1MMS A;  5HNF A;  2CU7 A;  3R6S A;  1VQ6 I;  3H9J A;  1IN7 A;  5HDK A;  1O7F A;  4PZJ A;  4MTD A;  1D5V A;  4A2U A;  4QWQ A;  1WZ2 A;  4UB8 C;  2E1M C;  4BNC A;  1Z05 A;  1EKE A;  3O8G A;  3DTK A;  3GTO J;  4FIS A;  4IPA A;  4II3 A;  3S1Q J;  1UHM A;  3GFI A;  2QF7 A;  2F48 A;  1BN5 A;  1KYW A;  2WB1 A;  1H8A C;  1S7O A;  2KL4 A;  2P7V B;  2HPI A;  3RCO A;  3IAS 2;  2K7L A;  1NK3 P;  5IY5 H;  5L3D A;  4DNC A;  4D0P A;  5AIP A;  4UUS A;  1Z7L A;  2GIZ A;  2KRF A;  2JTV A;  2LF7 A;  3DEU A;  1IF1 A;  2NYX A;  4UB6 C;  3G3Z A;  1LPQ A;  3CCE I;  2A5W A;  5K5O A;  2YX7 A;  2R7D A;  4DYQ A;  2R93 J;  2M87 A;  1XSD A;  2E2I J;  2MYS A;  2DT7 B;  2W57 A;  2LYC A;  2OF7 A;  1SVM A;  4IEJ A;  1KGS A;  4HG2 A;  1F4K A;  3TDZ C;  2E2J J;  1KU2 A;  4FT8 A;  2IS6 A;  3AG4 H;  3ZQL A;  4XKB A;  1ETX A;  3I58 A;  5D4S A;  3KET A;  3LAJ A;  2STT A;  2YU9 J;  1ON1 A;  4I6Z A;  2F5F A;  5IYC J;  4JQF A;  4XK4 A;  2DMQ A;  5LEJ A;  1SFK A;  1X1A A;  1X58 A;  1IV8 A;  3IL2 A;  3JRC A;  4O6J A;  2BYV E;  3V42 A;  3ZMZ A;  5CVR A;  3ULQ B;  3CME I;  5D4R A;  3Q9V A;  2ZJR F;  4FE4 A;  1K78 B;  4J01 A;  3V7C A;  2E1N A;  4BDZ A;  1SAN A;  1TT5 B;  3MCZ A;  2M9H A;  4PJJ A;  5GAG J;  4U0V A;  3LL7 A;  2WAQ A;  3HYI A;  2P8T A;  2QSH X;  2DPD A;  1ZLK A;  2Y9Y A;  1P6R A;  3DKW A;  2GZW A;  3RIR A;  3KP5 A;  3JSO A;  2DOF A;  2FML A;  4HOB A;  3IAM 2;  1IJW C;  3QQA A;  3QPH A;  2EBI A;  3F8B A;  3BTL A;  4OIQ F;  2JSP A;  3B6C A;  2V1U A;  1Y56 A;  1ZEL A;  3E97 A;  3MAJ A;  5LRS A;  2HOA A;  2QYO A;  3BQY A;  3M1E A;  2CFO A;  1BOA A;  4HX8 A;  1KU7 A;  3X2Q H;  4BEH B;  2BY0 A;  2KPM A;  4RM2 A;  4IX7 A;  1ETO A;  5BQT A;  3GTP J;  2VUM J;  2AXT C;  3HTU A;  3TO7 A;  2IJL A;  2ZXJ A;  2QQA A;  3V7R A;  4D1Q A;  2K9M A;  2WWY A;  1BBY A;  1OCP A;  2BW3 B;  1X19 A;  4PJL A;  1ZG5 A;  3FXR A;  4PJN A;  2LD5 A;  1XGO A;  4RS8 A;  4HYE A;  1E3O C;  1J9I A;  2Z3Y A;  2JRM A;  3IC7 A;  4RGX A;  2ZSI B;  4Y17 A;  1VTN C;  2FU4 A;  2XPV A;  4RLQ A;  4BY1 J;  1SVO A;  1TWH J;  1DPR A;  2K4J A;  2HYF A;  2A07 F;  2KIS A;  1BC8 C;  3TOB A;  4IHX A;  4OWR B;  4WXH A;  3BJO A;  5KHD A;  2KZG A;  3BZ6 A;  1MH3 A;  5D8K B;  2FA5 A;  3HPG A;  2KFD A;  4JX6 A;  5B66 C;  3IWZ A;  4DZJ A;  1H9T A;  2HKX A;  2LG4 A;  1JKQ C;  2X9D A;  1BR2 A;  1ZAR A;  2ID6 A;  2Z99 A;  1ACI A;  3PQJ A;  2JUG A;  3TL4 X;  3FZV A;  3ZR8 X;  5IP9 J;  4IQJ A;  1SFE A;  5ERI A;  3PSI A;  2EFN A;  1I3Q J;  2NVY J;  5TGT A;  1XN7 A;  3VYU B;  1X3U A;  4Q48 A;  1MW7 A;  1SMT A;  1G8X A;  1TBX A;  1ZK8 A;  3WTS C;  2DMT A;  1QVU A;  3I71 A;  4MFE A;  3H3V K;  1JTX A;  2H8W A;  2PBI A;  4BQA A;  3JCU C;  3SFI A;  2ZJQ F;  4H4K C;  3PIP F;  3ZPL A;  2Q1Z B;  2Y0S N;  1GXP A;  2BY3 A;  1JHH A;  4IHW A;  3I59 A;  2XAS A;  2YR2 A;  2DTZ A;  4BHB A;  3HIF A;  4HZF A;  2RDP A;  3DKY A;  1XMA A;  3TBI A;  1QZE A;  1FOY A;  1PDN C;  1GT0 C;  3WG9 A;  3CMY A;  2W1O A;  4IVN A;  3T1B A;  4KMU X;  4LGW A;  2P5L C;  2CO5 A;  4JBA A;  4YIF A;  2DO7 A;  3FXL A;  5J3L A;  4PGH A;  3R4K A;  4I0A A;  2E1O A;  4ITV A;  3HGY A;  4Q5S F;  2QQ9 A;  1I1S A;  5EEA A;  3L00 A;  2HU9 A;  4EQQ A;  3K4M A;  2VXZ A;  3LQR A;  1IRX A;  1S29 A;  2ZFW A;  3CLQ A;  5DUK A;  4NNJ A;  4X6A J;  1V3F A;  2DMP A;  1G4D A;  1BM9 A;  2XB0 X;  4EEF G;  1LFU P;  1WJC A;  3CJQ B;  4A3D J;  4L9N A;  2AXL A;  3QYE A;  1XX5 A;  2FBK A;  3G2B A;  2KZV A;  2LH9 A;  5C4J J;  4RB1 A;  2DLL A;  5DCF A;  4RA2 A;  3J7A Y;  1WKM A;  2M4G A;  5CQG A;  1GHC A;  5FJ8 J;  1EH7 A;  2E7W A;  3Q0V A;  4L5E A;  1ONV A;  1BR1 A;  3LFK A;  2P7C B;  1LKX A;  1HST A;  1T39 A;  1FY7 A;  2AO9 A;  1R9T J;  1JGG A;  4RLF A;  4ESF A;  5GAH J;  1H88 C;  1N78 A;  1IUY A;  1HKQ A;  1WPK A;  3BPV A;  1RPW A;  1TZL A;  2K27 A;  1N25 A;  2ZSH B;  5LLQ A;  3LAP A;  3GTG J;  4EV0 A;  4CUG A;  4HF1 A;  1MMN A;  4ENN A;  3LQQ A;  4G6D A;  2FD5 A;  3TGN A;  3MZH A;  3I4M J;  3M8E A;  3KPH A;  1W7P A;  1K6O A;  4U88 A;  4M6V A;  1TNT A;  3RQ4 A;  4CZC A;  4V19 K;  1GV2 A;  2YPR A;  1A04 A;  4B47 A;  2QA4 I;  2L01 A;  3TED A;  2F4I A;  5CVU A;  3FDY A;  2P6S A;  2A69 F;  3ABM H;  1NH3 A;  2FMY A;  2OV7 A;  5CKT A;  5DUI A;  2V4J C;  4NDL A;  1OJL A;  3T8T A;  2XRN A;  5EEG A;  4YRV A;  4G7Z F;  5BPI A;  4C2T A;  2HYG D;  2Z5U A;  4U7B A;  4U7D A;  3ZQC A;  4A3J J;  4PSX A;  3OYH A;  1O3T A;  3W2W A;  2HDD A;  3K10 A;  1O3R A;  4HST A;  4JX5 A;  1TWF J;  3LWF A;  3OYK A;  4FE7 A;  1FZP B;  2Q8K A;  3O8H A;  1LDD A;  1N75 A;  2GQQ A;  4G94 A;  1JXS A;  2W24 A;  1MNM C;  1Z7U A;  1P4W A;  2DJN A;  3Q0W A;  2VJI A;  3HUG B;  2Y0M A;  3MFK A;  1FMV A;  1TL8 A;  3KZY A;  4BJ5 C;  3HL2 A;  2COB A;  3K0L A;  2R7Z J;  3FM5 A;  2IPQ X;  4RAZ A;  2UXX A;  3GTM J;  2P4W A;  4IJA A;  3GO5 A;  1VFC A;  2O9L A;  2D5V A;  5DCM B;  5BS6 A;  2XKO A;  2R7R A;  1QPM A;  4F7Z A;  4A5N A;  2Q0O A;  3TOA A;  1FT9 A;  2JMW A;  4YG2 F;  1WWX A;  1LE8 A;  1RET A;  1FIA A;  5F0F A;  2EA4 A;  2A6E F;  1U5T C;  2IEK A;  3OIP A;  3C7J A;  2L9N A;  4GDF A;  3W2A A;  2VKE A;  3PIO F;  2PJR A;  3HRU A;  3HOY J;  2PMZ N;  4KJZ A;  2IGN A;  1JUM A;  5LBQ A;  2IA2 A;  4P9U A;  4E7K A;  1MMG A;  5J1U A;  1ZR2 A;  3SHF A;  4HQE A;  1WJA A;  3S1M J;  5IYD J;  1LFP A;  1HDP A;  2DOE A;  4CZZ A;  4WCG A;  3KFW X;  4M3E A;  3K4B A;  1T0F A;  2W82 A;  2KLO A;  2QQ8 A;  1QBJ A;  3VSL A;  3CTA A;  1YO5 C;  2ACJ A;  1YW9 A;  1V54 H;  3DXJ F;  3G1M A;  3S93 A;  1I27 A;  1LQ1 A;  3GF2 A;  3HOV J;  1M1E B;  4IRG A;  1T95 A;  1ETY A;  2B7E A;  3KP2 A;  4UVA A;  1QPI A;  4A93 J;  2XAQ A;  1P4X A;  3K1N A;  5HLI A;  3K2A A;  1MJ9 A;  2M34 A;  1YFH A;  1PJR A;  2DA5 A;  4XMY A;  3JSP A;  2OAZ A;  2KIF A;  1LDJ A;  3FMR A;  3GLX A;  4NC7 A;  5L3F A;  1B59 A;  1EF4 A;  3PFI A;  1W7P D;  2CUJ A;  4QSH A;  1Z67 A;  2HEO A;  5EYR A;  3TP0 A;  3PO3 J;  1KQ0 A;  2MD0 A;  4RAY A;  2JT1 A;  5LHG A;  2P0W A;  1FOK A;  4L18 B;  1HKT A;  1YOV B;  4D5C A;  2E2H J;  3GX4 X;  2K02 A;  2JA5 J;  3IWF A;  2K3F A;  2HPM A;  4A3M J;  2STW A;  3CJR B;  2ZXI A;  4PSW A;  4ENJ A;  1IGN A;  3S1N J;  1FYM A;  3LOC A;  4CGZ A;  1ZGA A;  3TW7 A;  2JN6 A;  2QSG X;  3JTH A;  3IUO A;  4IXA A;  5B1B H;  4M3F A;  5M5X J;  1WH7 A;  2XGC A;  2L4M A;  4NBQ A;  3RZO J;  3E1S A;  1T6S A;  1QA6 A;  4Y15 A;  4BY7 J;  5K1Y A;  3MKZ A;  4PFP A;  1S5L C;  3SQN A;  3I4P A;  4Q47 A;  4G12 A;  5GTI C;  3C2G A;  3OY9 A;  3IRQ A;  1KON A;  5K5R A;  1JHF A;  5HLT A;  1WVR A;  2ZC2 A;  3H92 A;  3PO2 J;  4EGY A;  5EEH A;  3LA3 A;  3BG5 A;  4XKC A;  2P5K A;  2CW7 A;  2E35 A;  2R5Z A;  2V9V A;  4LK1 F;  3BOQ A;  4OIN F;  5D5V B;  1QZZ A;  4EM2 A;  5D5W B;  2CUE A;  5HS7 A;  2ESN A;  3BZK A;  3W2V A;  4DYR A;  2W00 A;  3HHG A;  3TQN A;  4HLY A;  2M0C A;  1YS7 A;  2ZO4 A;  4CO8 A;  3S1R J;  1MIJ A;  1K4S A;  1B72 B;  5C4X J;  2CWE A;  1J0R A;  5F0H A;  4UVC A;  3W6J B;  3WU0 A;  2DA3 A;  3PNY A;  4XOP A;  2H6C A;  3MEX A;  3HOW J;  3QOD A;  3IH2 A;  4I01 A;  4HNT A;  2HVR A;  2WV1 A;  2ZBK A;  2QKL B;  4AWX B;  4HLX A;  4ASN A;  1TQP A;  3SZG A;  2JQ7 A;  4JYK A;  3O2P E;  3ZMU A;  2ISZ A;  2CH0 A;  2PEX A;  3BY6 A;  4I2O A;  1SFO J;  2IRF G;  3E3V A;  1WH5 A;  4NC8 A;  3WU2 C;  3CCS I;  1ZRE A;  4O3M A;  3LMM A;  3K1P A;  2HOT A;  1RR8 C;  1J09 A;  2HZD A;  2CUZ A;  4HNV A;  5E3L A;  3CZ6 A;  1AKH A;  3CC7 I;  2QWW A;  2ZME B;  1STZ A;  3RTR A;  4EJV A;  4A0Y A;  4XRS A;  1Y6I A;  3MKY B;  5BMZ A;  3ZMS A;  3G1L A;  2DK8 A;  1TLH B;  4ESB A;  3UR3 C;  1Z3Y A;  5FKL A;  2RV8 A;  4EMS A;  3FK6 A;  4R1H A;  1J59 A;  1YX5 A;  4HRI A;  1TT0 A;  3FX3 A;  1WJE A;  4U87 A;  4XNF A;  2L2O A;  2QEN A;  5EG0 B;  4RDU A;  4ZYA A;  2X6W A;  3CCU I;  5HVQ C;  3BR6 A;  2VC1 A;  1WQ2 A;  1JKR C;  2KIM A;  3HOS A;  1ZRC A;  5ICG A;  4A6E A;  1X3W B;  2VXD A;  3E6C C;  3KLN A;  2VI6 A;  2CQX A;  2WY8 Q;  1OCR H;  2WB1 N;  1ZHF A;  2LRE A;  4AID A;  2LY2 A;  4BJT A;  3F23 A;  4FET A;  3ZP5 A;  4BQO A;  2Y31 A;  2L4A A;  1HSJ A;  4I99 C;  4BE0 A;  1RR7 A;  2FNP A;  5K7H A;  3EYI A;  2WBM A;  3U2R A;  2HS5 A;  3H9G A;  1E0E A;  2KIU A;  2V6C A;  4CH7 A;  3M8F A;  3ML6 A;  2R3S A;  4M74 A;  2O0Y A;  4GRI A;  3OR1 C;  1I6H J;  3DCF A;  1HBX G;  3K70 D;  3BCB A;  2JUC A;  1ETW A;  3BR3 A;  4BHP A;  3WGI A;  3QOE A;  5KAF C;  3DTE A;  5E1W A;  4A0Z A;  4IHS A;  3ASO H;  1R1U A;  3ZGK A;  3CCY A;  5HDN A;  2HZT A;  2CFX A;  4H0E A;  1P9Q C;  4EJU A;  1QNT A;  2M0M A;  3QP5 A;  4UV9 A;  1AU7 A;  1B9M A;  1UAA A;  4D7M A;  3U21 A;  2VQH A;  2QQB A;  4MIM A;  4XN0 A;  1QRY A;  1V4R A;  3EUA A;  2IS2 A;  3T5X A;  1AHD P;  1XG1 A;  1K78 A;  4AC0 A;  3E7L A;  5HLG A;  2R5Z B;  1XMK A;  3HEF A;  4MTE A;  2XC7 A;  2DYS H;  2VQC A;  1J5Y A;  4K2E A;  4QTR A;  1ENH A;  1EV7 A;  1RZ4 A;  3ABK H;  2K9N A;  4KN7 X;  1Z3X A;  5ICE A;  4TV7 A;  4ETS A;  3SZT A;  2WAQ N;  2R92 J;  3ASN H;  3KEO A;  1YIT I;  2CQQ A;  1IZ1 A;  2VN2 A;  1HW2 A;  5D6F A;  3G4S I;  3OWT A;  1DU6 A;  3TP3 A;  1IV6 A;  4BEH A;  3BQZ A;  2LKX A;  4ENK A;  1TNS A;  3CQZ J;  3S2D J;  1RUN A;  4QIW N;  3NAR A;  3OYB A;  2M30 A;  3C1D A;  4ZTF A;  4DBR A;  5K7Z A;  3WTX C;  2VKV A;  2Y2Z A;  1SAX A;  4XR6 A;  1R4M B;  2ME0 A;  1HDD C;  1SAU A;  2VBY A;  2DA6 A;  5J6X A;  4CHU A;  4RB0 A;  3W3C A;  2MBF A;  3O6B B;  3EQL F;  4F91 B;  4I0B A;  2DBB A;  3KEQ A;  4P9F A;  4M9Z A;  2E1C A;  1FIP A;  2GXB A;  3KZI C;  4LFU A;  2ME6 A;  4C3I J;  3MMY B;  2VE9 A;  4MEX F;  1RUO A;  4LG0 B;  4EM1 A;  5DM6 F;  2L0K A;  1ERD A;  4YIR X;  1TW2 A;  1VQ4 I;  3LSK A;  2QBY A;  1OYI A;  1V5G A;  2JK3 A;  1OPC A;  3HPH A;  3I9V 2;  2UV1 A;  3IHU A;  4ON0 A;  2A68 F;  4M72 A;  3GBG A;  2V1X A;  3GZ6 A;  1MKM A;  5GPA A;  2DA7 A;  3I56 I;  3HXL A;  2AQE A;  3KE2 A;  4AIJ A;  4JX4 A;  4LG3 A;  3Q3S A;  1KU9 A;  1SD7 A;  2B9S A;  3M8J A;  3CCJ I;  5ICF A;  3OYG A;  2YU3 A;  2J5O A;  3DU6 A; 
#chains in the Genus database with same CATH homology
 3ABL H;  1OCO H;  3X2Q H;  2EIJ H;  3ASN H;  3AG4 H;  5B1B H;  1V55 H;  1V54 H;  2OCC H;  1OCZ H;  3AG1 H;  3AG3 H;  5B1A H;  5IY5 H;  2DYR H;  2Y69 H;  5B3S H;  3ABM H;  3WG7 H;  2EIK H;  2EIN H;  1OCC H;  3AG2 H;  2DYS H;  2EIM H;  3ABK H;  1OCR H;  3ASO H;  2ZXW H;  2EIL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...