1V54H

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1v54H00
1OCRH 3X2QH 3AG2H 3ABMH 1V54H 5IY5H 1OCCH 2EIKH 1OCOH 2EILH 3ASOH 2DYRH 2EIJH 5B3SH 3ABKH 3AG1H 3AG4H 2EIMH 5B1AH 1OCZH 2ZXWH 3AG3H 2OCCH 3ABLH 2Y69H 2DYSH 2EINH 1V55H 3ASNH 5B1BH 3WG7H
chains in the Genus database with same CATH superfamily
2CW8A 2LBFA 3LQQA 5J40A 2HI3A 4L9TA 3H9QA 4D1QA 2CQ7A 5L3GA 1MNEA 1HW1A 2ZXJA 4DYQA 5HOOA 2HKXA 2RGVA 2QSFX 4IO9F 4HQMA 2J5PA 2BVMA 3VFZA 4N9HA 4HPQA 3DPLC 3K7AJ 5EG0A 2VBXA 3G3ZA 2L9NA 2E71A 5F08A 4WCGA 4A3JJ 1Y39A 2EJRA 3EUKL 4CA0A 2VOOA 4EM1A 3CC4I 5IP9J 3OWTA 1MBJA 1BI0A 1YI2I 2P8TA 1LFUP 4JP0A 3D5SC 4B3AA 4IPAA 2QBYB 1WHUA 2A07F 1U5TB 3RQ4A 2DA4A 1U8BA 3GTOJ 3SXYA 3M4OJ 3I9V2 3MZ8A 1LFPA 2KKOA 3SZTA 4JK1X 3DTIA 3BR6A 1NHAA 1Y1VJ 4A0XA 1JJ6C 3R4KA 3OL4A 1AOYA 2X48A 2LY9A 1OR7A 5E79C 5M3MJ 3RYRA 1JE8A 2CV1A 3J81K 2CUFA 3H0DA 2FX0A 3LQRA 4WXCA 4RM2A 4KIFA 1FEXA 3ZRGA 2K9MA 2IA0A 5IP6A 5JHFA 3J7ZI 1WVRA 3GFJA 1G2HA 4HG2A 4PJ0C 1L3LA 3WG9A 3NRVA 4BY1J 4OIOF 3HPHA 5HDKA 5FJ8J 5KK1A 3GTKJ 2DMNA 9ANTA 4FQGA 3TBIA 2E2JJ 1ETYA 2ZB9A 3HHHA 3PNVA 5B3SH 1A36A 2O9LA 3HBLA 5BPDA 1R49A 3FXMA 3HRMA 2EWNA 4KT6A 4HNTA 1OCZH 3L00A 2NVXJ 4LLNA 2OZ6A 3J81Z 2HEOA 3TOAA 4HOBA 4Q4ZF 3F8BA 2JPCA 1PJRA 3O8GA 1Y6IA 5D4RA 3K69A 3FXUA 2BYVE 2VT2A 4M9XA 4HZFA 4JX4A 1H8AC 2JWTA 1J5YA 5L3FA 1CQTA 2GXBA 5E17F 2L9RA 3TOBA 2EILH 2E7XA 5E8GA 4EM0B 4A3KJ 1F36A 1E3HA 3GBGA 1R5GA 4BDZA 4ESBA 5EGOA 4EQQA 2BXYA 3OYJA 5D5XB 1FSEA 2RVCA 3F6VA 2STTA 2EFPA 2L9VA 3K4JA 3T8TA 3L09A 2K4BA 2R7VA 1FOWA 2ECBA 4RGXA 3U9GA 1P6RA 2QCOA 1IO2A 3V8LA 1D0ZA 1FIPA 1JUMA 5H6QA 3BTLA 4M71A 3RJPA 5DV5A 2XAFA 2HTJA 3LSPA 1Z3YA 1ACIA 4A3BJ 5EZGA 4RB1A 3BR2A 2XIGA 1S29A 4WWCA 2DA2A 2K9SA 2KMUA 4IRHA 4XKCA 2E2IJ 2QQ9A 2EA4A 3KZIC 2XKOA 3AG1H 1GXPA 3HPGA 3BPXA 2AO9A 2Y9YA 2YX4A 4XKBA 3JRDA 3PFYA 2X6WA 4A3MJ 3IAM2 3ABTA 4LB6B 2K86A 2ZCWA 4LG3A 3S14J 3DBLB 1D5VA 3OIPA 3U2RA 2HVQA 2K9NA 2K3PA 2LR8A 1SC7A 4A3CJ 1S7AA 2DA7A 4I6ZA 2HWVA 3SQNA 5KAFC 3QRFF 4HW0A 4DQ2A 4H0EA 2ZO4A 1B6AA 2F5CA 2QQBA 2VIXA 2PBIA 2IGOA 3BROA 3LNQA 2UXNA 3MQ0A 2FBIA 2PLYA 2FA5A 3A2KA 4CGZA 3K1PA 2DJNA 3GMEA 3I4PA 4LLGF 4B3XA 1MMNA 4N4NB 2DMPA 1DGRM 1K61A 1BW6A 1ZGJA 1BI3A 3ZPLA 2XV4S 5E1XA 2E1NA 5HNHA 2IW5A 3K1NA 3T8RA 4UUSB 3Q3SA 5E3LA 3CTAA 1LVAA 4M3DA 5GAGJ 1R22A 4A69C 3CUQC 4E7HA 3FZVA 1I39A 4ZYHA 1VTNC 4LOCA 1ZGWA 3GO5A 2KHMA 4UY8I 5CPRB 3V7RA 2X51A 4PJNA 3H9JA 3FXKA 3JTHA 2XF5A 4LJZF 2LKSA 2XGDA 3E97A 3F8MA 1STZA 1JUSA 4OIRF 3CUQA 1MKMA 3DXJF 4U0YA 3I58A 1HKSA 5E1ZB 4WXHA 1J0RA 4GCVA 2RNGA 2H09A 1JTXA 2E1MB 2QWWA 4FX0A 2HOAA 2WAEA 3ZQGA 1OFCX 3LL7A 1PP8F 1TNSA 2DOFA 2CJJA 4W1UA 3CO7C 1W36C 1SEUA 2V1DA 2VBZA 1NK3P 2CW0F 1P7JA 2RNJA 2E36A 4J00A 2BZTA 4RB2C 1P7IA 4RAYA 2VXZA 4JQFA 4A0YA 2NRAC 4G6QA 5ICFA 4MNUA 4BXXJ 2BE5F 5K7ZA 2XF7A 1OISA 4RAGA 1ZTRA 3B73A 3V7CA 1FZPB 2EIKH 1H9GA 4ZYDA 3GLXA 3W3CA 1R4MB 1HQCA 5FKMA 1Y56A 2PMZN 2P4WA 2OTJI 3DV8A 4G94A 4M6VA 2DMUA 5IT3A 1LDKB 1T6SA 5FLMJ 1BM9A 2NNYA 4RB3C 1PYVA 3KYCB 1YJ9I 1SANA 5F1JA 1POGA 4I7HA 1YITI 4BEHB 5M5YJ 3PSFA 4A3FJ 1SVLA 1OJLA 3M1CA 3C18A 1K6OA 1BBYA 1W0TA 1TW3A 1P9QC 4BNCA 3KEOA 2IGKA 1IAWA 1MIJA 3RYPA 2ZJQF 1U5TA 2NS0A 4CO8A 1R00A 5D8KB 3UR3C 1AKHA 2PX9A 2FF4A 2JRMA 3RPUA 4B44A 3RKQA 1O3RA 5J4VA 1CGPA 4OMYA 4FX4A 2BBYA 2VXDA 3EETA 2LKPA 4GXOA 3JAMK 1JUPA 4DBRA 4V19K 2NVQJ 3S2DJ 1D8JA 1Q1VA 3I64A 3IRRA 2KJCA 2BY2A 2M5WA 5BQTA 1PUEE 3OYNA 5D8LB 5KAIC 2V6EA 1YLFA 2LTPA 3IH4A 3QOEA 4ZDLA 1T38A 4NHJA 3PNTA 2FD5A 2LKXA 3O3KA 2R7TA 2N8GA 1NTCA 1FJLA 1D1CA 3OYCA 1D8KA 2CH0A 4LIUA 3HSRA 4CUGA 3DF8A 3HKZA 2WV1A 2ZNYA 4XLEA 3MZHA 1XGSA 1SVMA 2JN6A 4XNFA 3MVPA 3HOSA 4B09A 2HZDA 5A2QZ 3T5XA 4X1EA 2M87A 2F4OB 4QLCU 4RGUA 3W2AA 4IEJA 3I5UA 1H89C 5GADJ 1RNLA 2JA6J 2GBYA 2KDOA 4CCLA 2M4KA 3WU2C 2R3SA 4I0BA 1Y8QB 2OBPA 3IC7A 3IP4B 1YW7A 4ZH4F 4D5FA 1OCOH 1I6HJ 1ON1A 4XRFA 2M3AA 2XB5A 2MH9A 1WJCA 2BVLA 3FKIJ 4CDGA 1LB2A 1HKQA 2R4GA 1R23A 1MDMA 3A01A 3BLYA 3LFKA 4GRIA 1ETXA 1VQ4I 3EUAA 4BUPA 2V7FA 3DKWA 4JX6A 1MW7A 2LVSA 4XMYA 5LFAA 3E6MA 4WX9A 2DQRA 1W4MA 3HTUA 2WY7Q 4I09A 4KN7X 3KETA 1TWGJ 2YX7A 4C3JJ 2VJIA 4K2EA 2GIVA 2XSDC 2LOOA 2CQXA 3K4CA 3KYDB 2DT5A 3FKJA 1MSFC 1WCMJ 3L2UA 4V2FA 2CMPA 2MG4A 2Y0SN 5CVRA 3HOWJ 1KU3A 1FWZA 3VYTB 2O0YA 4MQVA 1MMAA 3QPSA 1YTYA 1TWAJ 2VKEA 4A6DA 4EATA 1DP7P 2P7VB 4PGGA 2CO5A 1TWFJ 2ETHA 2CQKA 5IY5H 3W6JB 4A3DJ 4E7SA 4ITVA 5JFRA 2IS6A 1VQ9I 3TDZC 4KJZA 1RKWA 4PCQA 3KP7A 1UHWA 4N4OB 3I53A 2QYOA 1MBFA 3DKXA 3LA3A 1AWCA 4BE1A 2BOLA 2NOJB 4BJTA 4YFKF 2HYFA 2VJJA 2OAZA 3ZQCA 2JA2A 2LDUA 2VI6A 3GFLA 2LP0A 1QPIA 1MMDA 2XGXA 1WI9A 2EZHA 3ONQA 4YEJA 2ZJ2A 3TW7A 2FEZA 3S32A 4DJAA 4EJUA 2M34A 3BP8A 3CP2A 3Q9VA 1QU3A 5DUKA 3CMEI 5LRRA 1B8IB 1ETWA 3TKYA 2XKPA 2M0MA 4Y7NJ 3DPTA 2E1MC 4CXFA 2PEXA 2CS3A 3NAUA 4LIVA 4I02A 1R1TA 2X1EA 4N9IA 2R7XA 3AG2H 5F04A 2Y0MA 2CUJA 1QZYA 2ZFWA 3NWSA 4KN4X 2ZBKA 4BYYA 3B02A 3OS1A 4PJMA 3CLOA 1SMYF 1FYKA 2HYGD 2KISA 2DO7A 4BY7J 4A3GJ 3ASOH 1B9NA 3LWFA 1T2KA 1WGXA 3SDGA 5CYVA 2XRLA 3K2AA 1YJNI 4GYGA 1IN6A 4ZC3A 2AXLA 3DKYA 4WF2A 3WU1B 2JTVA 2CV2A 3FMRA 3H3UA 4A0ZA 1ZQ3P 1TZLA 3GYHX 1F1ZA 3J80K 3A4CA 3CC2I 2XPVA 5HLHA 1RUNA 5ICEA 3JRFA 4DBQA 3PUBA 4XKVA 4M3BA 1YJWI 3OIQA 1KA8A 3MAJA 1H0MA 1IN5A 3PQJA 5IPAA 3BZ6A 1MZBA 3HRTA 4LITA 2XHKA 3HB9A 3WODF 2K9QA 5HNFA 3M3YJ 1P4AA 3CJRB 1GVDA 1ZH5A 4BQQA 3A03A 2X85A 3N05A 4U88A 1HLVA 1USSA 3RZDJ 2EFOA 3C2GA 4F52A 4MLOA 3DP7A 3IWFA 2ZJRF 2XSJC 1QBJA 1FTZA 4IOAF 3BQZA 1D1AA 3P9KA 3TO7A 4B47A 2W85A 1VFCA 2CW7A 4KYWA 3LMMA 2K4JA 2K5CA 4MO7A 1R5ID 3K4NA 3WHBA 4MEYF 4CZZA 2FNAA 1TNTA 3EUHC 4UNOA 3LAJA 2KIUA 2XAGA 2O5RA 2Y2ZA 4J01A 2J5OA 4UV8A 2Z5UA 3VYUB 3RPUD 4EGYA 1VQPI 4B43A 2FQ4A 5DM6F 2O8KA 5CVJA 1MJ9A 4A93J 3Q0VA 3FM3A 3AL0C 2CGPA 2R93J 2B63J 1WQ2A 2DODA 1WRJA 1XC5A 2E1CA 2ECCA 1LPQA 1ETOA 2R7FA 4F92B 3L9FA 3AFHA 4X6AJ 2ESNA 4C3IJ 3HJEA 1TWCJ 4Y17A 3DLLF 3ZOBA 2DA3A 1FTTA 4II3A 2PMUA 2EV5A 2EV6A 5EF6A 1KU9A 1IXCA 3PM1A 1FSHA 1J2XA 5E18F 4D0PA 3M07A 4BE0A 1FYMA 2H1KA 3B6CA 1YOVB 5CQEA 3F6OA 4GGGA 2MABA 3RPQA 4ESFA 3B6AA 1W7PB 2BGCA 2PJRA 4C3HJ 2L2OA 2XROA 2QZ8A 4AUXA 3VODA 2K3FA 3HSFA 4KITB 3ABKH 3ZQHA 2AQFA 2P5LC 2QSHX 3BY6A 1ETQA 1I1GA 2HNHA 5EEHA 3CJTB 5LHHA 5HLIA 3MZYA 3BG6A 2WWYA 1OCRH 1YYVA 5F0HA 3I4MJ 3PO2J 4U87A 2O6GE 4E7IA 1IV8A 1HBXG 1SD6A 1H9TA 5BNGA 2Y75A 1QGPA 1U8RA 4EJVA 1O4XA 4EJOA 2HOTA 3BG9A 3DU6A 1WH7A 1Y1WJ 5DCFA 3TO6A 2JA8J 3J7YJ 4P9UA 1AHDP 3PNYA 3E5UA 3FK7A 2GXAA 4G7HF 2P6TA 1KYWA 2MA3A 3NARA 3F72A 1YX3A 3HGYA 3KP5A 4EGZA 2Z33A 3HIFA 3TQNA 5DTDA 3ZCOA 1XMXA 2NNNA 3S15J 2NXNB 1RPWA 2QUFA 3OYKA 2OF7A 5F0CA 2XPWA 5DM7F 3IKTA 5C4XJ 2BW3B 3FK6A 4KUMA 4IF4A 2KFDA 1DDNA 4BQAA 1IV6A 3FMSA 1Y0NA 2BV6A 4KT5C 5D4SA 3HRUA 3GX4X 3OYFA 3KX2A 3L2CA 2O8XA 1IN4A 3GTJJ 3FBNB 3BWGA 3GTLJ 2ISYA 4ESJA 3BDDA 1LKXA 3BT9A 2WAQN 3QPTA 3PUFA 2DAOA 2KPMA 2M4GA 5K1YA 3PJRA 4KIBA 3CCLI 2Z2SB 1F9NA 2FXAA 2WADA 2STWA 2XAHA 2JUCA 1TWHJ 3U21A 2JRTA 3HGGA 5J4YA 2VE8A 3K70C 4DNCA 5DUIA 2AS5F 2V6CA 1B8IA 2LF8A 1X1PA 1OMIA 2EZIA 4NC7A 3S1NJ 2TDXA 4BKXA 2X1CA 3MWMA 4UVAA 2F4IA 3ZMDA 2DT6A 2WB1A 3GTGJ 2PG4A 2GQQA 5GP9A 4HBLA 2WC2A 4BDYA 4LD5A 2NVYJ 3CJNA 2KIFA 4ON0A 4M3EA 1R1UA 3QPLA 3JSOA 1ZRDA 5FLVA 4HRIA 1FX7A 3KPHA 1X1DA 1OPCA 1WH5A 1DPRA 3H9GA 2W82A 4OAZA 3CCUI 2DOAA 3TDUC 1ZG3A 5C44J 3F8FA 5CVVA 3HOUJ 3OYHA 2QQAA 2QA4I 4NB5A 2VASA 4XSXF 2QSGX 4ENJA 3JR9A 4EV0A 4H4KC 3E3VA 3FBIB 2P81A 2Y30A 2H1LA 4V2GA 5TRDA 3IHUA 1R36A 1RESA 1QO0D 4UVCA 1OCTC 4I0AA 2FRHA 4Y52J 3VSKA 1X3UA 4M3FA 2HVRA 1Z05A 3H5AA 1T8IA 4G6DA 4RGSA 3ZMVA 2P0WA 1USTA 2UUZA 4CCNA 5FD6A 4YELA 1WI3A 3W6VA 3K6GA 2FNPA 2LREA 5JLWA 2M2EA 3REOA 2G0EA 1ZG5A 1R9TJ 1HC8A 2R5ZB 1U6GA 5F27A 3K1MA 3SYTA 1QZEA 2B7EA 1T39A 2V9VA 3VOEA 2IPQX 1XSXA 3TP0A 2LY2A 4OIQF 2WY8Q 1MNMC 1UJ8A 2WAFA 2ZSIB 4HF1A 3LSTA 3JREA 1OQYA 2L5QA 1IGNA 4HEA2 3FF5A 2EIJH 3L7WA 3BCAA 2IS2A 3BJ6A 4L5IA 2V9KA 5JI6A 1YE9A 2VPLA 3ERMA 1QHGA 4BACA 3SHFA 1HA8A 1WJBA 3BPVA 1IXSB 4G6TB 1K4TA 3EYYA 1ZAOA 3HOZJ 4XIDA 2DA1A 4HA8A 4B4CA 3SFZA 1MJBA 4U0VA 3RKXA 2M30A 4EVIA 2DLLA 4UHTA 1LVKA 4KDPA 2L0KA 2X0LA 1RKTA 2HXOA 3F8CA 1YG2A 3S16J 2Q2EA 4F93B 5LGTA 4I2OA 3H1CA 1YS6A 3O6BB 1Z0XA 4A2UA 4XICA 1PUFB 1LEAA 2RDPA 1XB4A 4ZTJA 3QP6A 3ZQIA 2YU9J 2Y0SA 1LDJA 4HDVA 1I1SA 3ZXSA 3F9KA 4BJ5C 2JPBA 3RI4A 1ZREA 3CF5F 4NNJA 2PJPA 3OS2A 2E35A 4IRGA 4LG0B 3S1RJ 1ULYA 1W7PA 5BS6A 1MSEC 2CUEA 4UXNA 1NK2P 1SD7A 3I54A 3K4KA 3SDBA 1BR4A 3HM5A 4EJTA 3VPRA 4ZYEA 3COAC 4MTEA 4G9YA 2DFEA 2HZTA 3DTEA 4XLFA 1ON2A 1ZRFA 4D5CA 2COMA 5KHDA 2K40A 2ZXWH 3R6SA 4KA4A 1TT5B 2XUBA 1I50J 1SMTA 2Y9ZA 4HQEA 2NAZA 3ASNH 3BG3A 1O7LA 2IXSA 2L02A 3QPHA 1QZZA 2HDWA 2L7MP 2P6SA 3X2QH 3I55I 2DOEA 2F6CA 1V54H 4CHUA 1HDDC 1IRXA 3DEUA 2GM4A 1E17A 1X2MA 3V4GA 5J8FA 2NOGA 2DK8A 3LSGA 1VQ7I 3OYAA 1B1BA 2H8RA 5HLTA 3V8KA 4JBAA 3FXJA 1JI8A 2LRDA 2P5KA 1FMWA 3LSMA 5GAHJ 4LK0F 5EYRA 1FPQA 2BEOA 3HXLA 5HS8A 2KRCA 2OTLI 3WTVC 5J8CA 1Z91A 4QPOA 3BJOA 1Z3XA 2YU3A 5FGMA 2W84A 3PO3J 1IN8A 1XN7A 3N4MA 2KZVA 1HOMA 1TQMA 2MBFA 3S2HJ 1XSDA 2XDVA 4Y33A 2FMLA 4D7NA 3LFUA 2LC2A 2XPUA 3P9IA 5HS9A 3K9TA 4U7BA 4U7DA 2ZC2A 4KFCA 1BI2A 1F43A 3TEDA 1N75A 2JVGA 2FQ3A 3CF2A 3WTWC 3GFIA 4BS9A 1S9HA 1XSVA 2DCEA 3VWBA 3D5LA 4C2UA 1CF7B 3CCRI 1BW5A 2DA5A 3GVAA 1ZYRF 2JT1A 4AYBA 4UUTA 3M7GA 5ICGA 4XN3A 2QBYA 1OLTA 5LGNA 2JUGA 3G4SI 3RCOA 2HGCA 1M1EB 2MYSA 5ILVA 3HOTA 2CQQA 3C3WA 3E7LA 1K79A 1W5SA 2OCEA 2F4MB 1S7EA 5A2QK 2OD5A 3S1MJ 3FIWA 2O3FA 3ECHA 3KLNA 4I98B 2ICWG 1JHFA 4BXFA 3CQZJ 1FLIA 1I3QJ 2AQEA 2F5EA 2L01A 5JHUA 5DD4A 3R0JA 4YIIA 1EH7A 2DMQA 3GUDA 1IG7A 3CCYA 5TISC 1I3AA 3WGHA 4YFXF 3DTKA 3FHZA 4W97A 3AL0B 2IGMA 4XRSG 2KT0A 3BQYA 1X1AA 5AIQA 1O57A 3WHCA 1FYLA 5E1WA 2D1VA 2XRNA 1XGNA 1RR8C 3QU6A 4IZZA 5CVUA 3FWEA 2EB7A 2X6OA 3CMYA 3BR3A 2L4MA 4A3LJ 1KQ0A 5LLQA 4RB0A 2KL4A 3JRBA 3ZN1A 1V4RA 3WG7H 4M72A 3OV8A 1BC8C 2RAEA 1G3YA 1XG1A 4XOPA 5EZHA 2IP2A 4DYRA 4B1RA 5GTIC 1JKOC 1MBHA 3IAS2 4KIGA 4YFNF 4IJAA 4LFUA 4FTHA 4OOIA 2DT7B 3E6BA 1RR7A 2ZMEC 3FMQA 1EV7A 1DP3A 2CFOA 1GHCA 1MMGA 2A3SA 1S72I 1FC3A 1SD5A 5LHGA 1XTAA 1Z67A 2MC3A 2X9DA 3KP4A 2HVSA 2DBBA 3F23A 5CVIA 1Z7UA 5K5OA 2W00A 4XBFA 2BY0A 3SZGA 3KEQA 2VQHA 3BR1A 4Q48A 2R5ZA 4C2TA 3WE3A 2GAUA 1MBKA 1WJEA 2KZGA 4C2MJ 2HPIA 2DDBA 3EQLF 1YW9A 4NC6A 5E20A 2IA2A 2OQGA 2R7WA 4XQFA 3E6CC 2XF6A 1UCRA 1B72B 1YIOA 2B0LA 2LD5A 2ELJA 2TRTA 3K2ZA 2D45A 1WKMA 3VYRB 4DYCA 1BR2A 4UUVA 1G8XA 4MQ9F 2A68F 3W2VA 4DZPA 1YX5A 4DIQA 1NG6A 4BE2A 2HPMA 2DU9A 2OC6A 1Z7LA 3ZQLA 3CO6C 4Y3OA 4A5MA 3QQAA 1J75A 4XORA 2ZNZA 3Q0UA 4CH7A 3S3OA 5D6FA 1GV2A 3OS0A 3Q5FA 2WTEA 2IA1A 2PMHA 1MNDA 5B1AH 5IOZA 5JVGF 3K4MA 2EPFA 2DPUA 3JRHA 2W57A 3A0HC 4QWQA 5ERIA 1QA6A 1WJDA 4E70A 1KQ9A 2QEXI 1SFOJ 5IT9Z 1ETKA 1ZHFA 3P9CA 2R92J 3KLOA 4OIPF 4UUSA 1IZ1A 3DPUA 2IEKA 4LG0A 4JX5A 4RA2A 2NYXA 5D5WB 1N25A 1SAUA 5M5WJ 2HDCA 3H5NA 1W7PD 4IHWA 5BMZA 5BPIA 4KMUX 4A6EA 1B59A 4AVZA 1UFMA 3O2PE 1A04A 3ZQFA 4ZYGA 2GOXB 3HC7A 2EINH 4II2A 4HAMA 1T0FC 3IRQA 2XGCA 1WFXA 5CKTA 2EK5A 3HOXJ 2NVUB 4ZZDA 3C7JA 2M1BA 2VKHA 1VQMI 1JTYA 1X58A 2VKVA 4A12A 5J47A 3CCQI 4BXUA 3CDIA 3OYIA 5JLXA 1ODDA 4ZZLA 4NQWB 4ZDOA 1D3YA 1SFKA 2OV7A 3O8HA 1T0FA 2HKOA 3E5QA 2IAIA 5JR3A 4HDUA 1QNTA 1FOXA 4LMYA 2LFBA 5GPAA 1HW2A 5FKOA 1IN7A 3OYDA 3WGGA 2EH3A 1KZHA 2MGQA 4QIWN 5FKNA 2G7HA 5DD8A 3R60A 4BL0B 5L3CA 1P4WA 5EEAA 5FRMA 2GA2A 4FISA 3VYSB 4IQJA 2DW4A 4ABZA 3W2WA 4PJJA 4XLHA 3V7SA 5BOXA 2JMWA 1W36D 5LEKA 3DU5A 3F21A 2OUMA 1PDNC 1S8NA 2IVMA 3F3XA 1LQ1A 4XRSA 2LLKA 3LSHA 2NVTJ 3OYLA 1VQKI 1T33A 1S3JA 4Z2YA 4G8XA 5K7FA 1X4OA 2VBWA 1VNDA 2GOMA 4Y15A 2L7KA 1TQPA 1OYYA 1CF7A 3SJMA 4XLAA 4BEHA 1I6XA 4GDFA 1WJAA 3IWZA 3LA2A 2ME6A 1BL0A 2KQRA 1BIBA 4ZYAA 1V3FA 4S04A 2W24A 3RZOJ 3GCMA 2DPDA 3OMYA 3L2VA 2R7DA 3BG7A 1YRNB 2ISZA 2ZFUA 1BI1A 5HDGA 2I8DA 3L2QA 3PL8A 3G1OA 3KP3A 3QU3A 4E7ZA 4B8XA 3E6DA 4AU7A 2IS1A 5F0FA 2VQGA 3EUHA 2LNBA 2OQRA 5F1RA 2ZJPF 1A35A 3PFIA 3ULQB 4F7ZA 2VJ4A 1XD7A 3KEYA 2L4AA 3BTIA 1GT0C 3M8JA 5D6EA 4KISA 1L0OC 4HF0A 1JKQC 1TT0A 2UV1A 3JTGA 3HRSA 5ILUA 4YIRX 4O3MA 1VQNI 4J19A 2V1UA 4NBQA 2CU7A 1ZELA 3BR5A 1V5FA 3CCJI 3RKYA 3K0LA 4C30A 3BOQA 2YPRA 3CMMA 3U1DA 1TTYA 1S7OA 4M9SA 3HSEA 1H88C 2YUSA 2KP6A 3H36A 3IKVA 3FXLA 3OSGA 2B9SA 1APLC 3BZKA 3E0JB 4BBSJ 1WJFA 2M8EA 3MN2A 3QYEA 3R61A 1FY7A 2HU9A 2LG4A 2LF7A 3S3MA 2I5UA 2L9SA 3BJAA 1DU6A 5GPCA 1FIAA 2VUMJ 3NEUA 4E4HA 3IH3A 3OR1C 4P1WA 2DTRA 3GZ6A 1SFUA 3S93A 4RS8A 1YS7A 5L3EA 2VONA 2V79A 3AG3H 4YIFA 2DQLA 4MGRA 3TL4X 1ZLKA 2JA7J 1WSUA 1O3QA 1P2FA 4NDLA 2DYSH 5LGUA 3CDHA 4MTDA 2M8GX 5F64A 4M73A 2E5ZA 2O03A 2GZWA 3T0YA 4HNUA 3OYBA 4FHTA 4IVNA 2JSCA 1RZ4A 2IT0A 3TMOA 2I10A 4N0BA 2L7ZA 5AONA 2CG4A 3IUOA 2IRFG 1GDTA 1FBSA 2ID3A 1YHQI 4UV9A 1RRJA 4DW6A 2HOEA 4M74A 1B72A 1JXSA 2XGEA 1BOBA 1Y0UA 3AG4H 1JGSA 1IF1A 3M8FA 2M7BA 1D0YA 3MKYB 3C1DA 4A5NA 3TO9A 4AC0A 2KIQA 2XAJA 3CMAI 2NS8A 2D1HA 2DJIA 2RREA 4HNVA 3ZMTA 3F8NA 2VODA 1I5ZA 3MKZA 2FMYA 1LE8B 1REPC 4AIDA 3KYLA 2ZXIA 4L0ZB 1K78B 3QOPA 4ZTFA 2D2WA 1UG0A 5CJ9A 1K83J 2DTZA 3KIOA 1FOKA 2V1XA 3ECOA 2V26A 3DWLE 2BHZA 1R1VA 4IHXA 5FLXZ 2M9HA 2MD0A 1XCVA 2BY1A 1LUJB 5FKLA 1S5LC 5M3FJ 2CRGA 5DYMA 2FOWA 3LOCA 2PFBA 3J7AY 5B66C 3ML6A 4R1HA 3PQKA 4XONA 2GLOA 1F5TA 2A69F 2UXXA 1JHHA 1KGSA 4BGDA 4PUSA 1XCBA 1XS9A 3G6EI 3U1KA 4XLPF 1Z6TA 2RC4A 2M0CA 2RQQA 4RAZA 4BU2A 4HX7A 5KCMA 3PSIA 3D1NI 1TBXA 4S0HB 2QQ8A 2ZSHB 2R7OA 4PDKA 4Y13A 2BY3A 4EMSA 2PMZA 2HQAA 2Z16A 3CLQA 3ABLH 1GLNA 5EJCA 6PAXA 3N97A 2C6YA 3HDDA 2JVHA 1QRYA 3MEXA 2IS4A 4C9YA 1IW7F 1OR7C 2MLKA 2X6YA 3V42A 3HUGB 1AKHB 5ICCA 3KCCA 4M6YA 2K27A 1WPKA 4RM3A 1W5TA 4CCMA 4I99C 3T1BA 5K7HA 2R7ZJ 5EEGA 2FSWA 4NQWA 4PSWA 2QKMB 1SFXA 2VLAA 2GWRA 3PIOF 4ANJA 2HTSA 1EJ9A 4BHCA 1DUXC 1SAXA 2A5WA 2MFZA 5C4JJ 3ERED 3TP3A 3DEWA 5DDGA 2F5FA 2X1DA 2KJBA 2W1OA 1ZG1A 2XB0X 1X1BA 4D9JA 2H94A 4WK8F 3ZMZA 1WJ5A 2MD5A 1QVTA 1E3OC 2HXIA 4IHYA 2A61A 2F5VA 1QPMA 1QVUA 3CCEI 3P7NA 2G7UA 3I3LA 4AVPA 3W6KB 5LEJA 1ZR2A 1JJ8C 5FKKA 4BHPA 5H2FC 3JRAA 4ZJZA 2ZMEB 1MBEA 4PGHA 1K6YA 1TLHB 4IHSA 3FXOA 3S2WA 1E2XA 1G3WA 1NG7A 4M6XA 4XSZF 5HDNA 2Z3YA 5IYBJ 3JRIA 4R79A 4TV7A 4KNYA 4L18B 2JA5J 1X2NA 3WE2A 2CWEA 4JOMA 4Q47A 1O3SA 1JT6A 1MDMB 3A01B 1T08B 3ROUA 1YRNA 1FNNA 4XR6A 2DFFA 2Q0OA 4EEFG 1ZLJA 5TGTA 4E7LA 2MH2A 3GF2A 3GFMA 3FX3A 5E3OA 2FBHA 2VE9A 2OPTA 3BG5A 4BH9A 2OZUA 1ORKA 3UNGC 3QODA 2EFWA 4ENMA 4HF2A 2L3DA 1ZARA 2XAUA 3K4BA 3VDXA 3GZNB 1ITYA 2HQRA 3Q0WA 3DCFA 4E7JA 5HVQC 1YQAA 2KRHA 4CYCB 2ZKZA 3DFGA 4XK4A 1V5EA 5J1YA 2ID6A 2BXZA 2OCCH 1IRFA 4CICA 4RGRA 2YS9A 1FP2A 1G3SA 1TQIA 2DMTA 1IC8A 5L3BA 1GVJA 1W0UA 2VBYA 2VC0A 1OYWA 3S17J 1OYIA 1A31A 3L1PA 1Z1DA 3D5RC 1RC9A 1XDUA 3I56I 2E1OA 2FOKA 2RV8A 2OJED 5LRSA 1IDZA 1KQ8A 1ERDA 1X3ZB 4E7KA 2E7WA 4PFOA 5LHIA 2YSRA 3ZP5A 4MFEA 5DS9A 3FXRA 4P96A 4AM3A 4P5OA 1MJAA 4XLCA 4RAFA 2ACJA 2HDDA 1VQ5I 5K5QA 1VQOI 3EYIA 1HSTA 2Y48A 3ZMUA 1YW8A 1I27A 1E3PA 3QYFA 3RIRA 4PZJA 4LLLA 4KMFA 2RKHA 1XMAA 4XL9A 1XGOA 2UWMA 4O6JA 3M8EA 1GUUA 2EFQA 4XKWA 1PVEA 3HZJA 2BHYA 1SFEA 3HG9A 4AWXB 4BBRJ 3G73A 3GW2A 4F91B 5M5XJ 1BR1A 4OU0A 2PQ8A 2A6HF 3A02A 2XASA 1D1BA 3GXOA 3QP5A 2CV0A 2WBMA 3I71A 3BC8A 4DOZA 5KVRA 1ZKGA 1X19A 1K4SA 1RUOA 2E60A 4Y4RA 2MW8A 4A3IJ 3ISPA 3ZQ7A 3ESWB 2EBIA 4HX8A 2HQNA 2ZXHA 2O7OA 4FT8A 3VB2A 4AIHA 2V9PA 1F4KA 2OA4A 1ZN2A 1OCCH 3KE2A 1LE8A 2DI3A 5TJJA 3LA7A 5FROA 2BW3A 3VSLA 1U78A 1X3WB 1K78A 2DFHA 2W48A 1YFHA 2JZYA 1BIAA 4KICA 3HOVJ 2CSOA 1E0EA 3AKZA 4UVBA 1DPUA 4IRIA 5JVTA 3DBHB 3DEEA 1U0JA 1R7JA 2GIZA 1X4PA 1U9OA 1RI7A 4GFBA 2RQPA 3RSNA 2P5VA 3H3ZA 2H6CA 3DLAA 2O61A 2DYRH 2FUG2 1EF4A 2VQCA 3K10A 4QSHA 2MC4A 1O3TA 4BQOA 4FCYA 2VOPA 3IH2A 2VT3A 3OIOA 1LEBA 4OINF 1U5TC 2QKLB 1FBUA 4GO1A 3F22A 1TP4A 2LYCA 2WB1N 3KZYA 3JSPA 1UHSA 1IUYA 1D5YA 1O7FA 3CCSI 4E6KG 3HYIA 2MSYA 3FHNA 3SEQA 4DZJA 5DCMB 4BJ6C 5K5RA 1RETA 4OWRB 1MH4A 2K85A 3RKWA 3MFKA 1GV5A 2NS7A 2DN0A 4FE7A 4OMZA 3K70D 3LSJA 3CUOA 3H5RA 3FISA 3HUGA 3QWLA 3CJQB 5D5VB 3RTRA 3HTSB 1J09A 3E1SA 3ABUA 1ETVA 1DQUA 2V4JC 4HSTA 3G1LA 1T56A 2VB6A 3GLLA 3JRGA 2Z1DA 3WTYC 2FU4A 4HLXA 2KIMA 1XX5A 2LH9A 2JSPA 5LBQA 2EQRA 3EDPA 1IXRC 1V55H 3WTSC 2KDZA 3I0TA 4F3QA 5J6XA 5GAEJ 3OYGA 4B48A 3NQOA 4U0WA 1P92A 3BCBA 2LY1A 4XOTA 1WWXA 4LB5A 1BA5A 1UB9A 3LSKA 1UG2A 3CZ6A 4S05A 4DGWB 3WTXC 1EH8A 3BTCA 4RLFA 1DU0A 1HCRA 4L9NA 2F2EA 4PJLA 1T95A 1Z21A 4LK1F 3LSRA 3CC7I 2YR2A 1Z6RA 1B4AA 2UZKA 1G4DA 3JAMZ 1R4NB 2QGUA 5E8IA 5D5UB 4ENNA 1YIJI 2P7CB 2VPRA 2K02A 1R71A 2KLOA 1R6RA 5CLSA 1B9MA 2EFNA 2M7AA 2ZMEA 4F55A 3KFWX 3SEZA 3ZN0A 4P9FA 4RMNA 1T98A 2PJRB 2FE3A 1LNWA 2OU2A 2CFXA 5F6FA 2EZLA 2G9WA 3OYMA 3C2BA 2DXIA 4CCJA 1IRGA 1J9IA 4L5EA 4WXDA 1BJAA 2DFIA 2FBKA 4UB6C 5FO5A 4G12A 2JK3A 3G2BA 2EV0A 1KU7A 2WA0A 4M3GA 5AIPA 4CCKA 4G7ZF 4AIKA 3OR2C 1FOYA 2VJ5A 2VC1A 3HEFA 2CYYA 3G1MA 5IT9K 1HF0A 2L7FP 2R5YB 2PN6A 1MMSA 3I4NJ 2HYJA 1BN5A 1VQ6I 3I59B 2JJ7A 2A6TA 4IX7A 1EA3A 3TW6A 4IOCF 4CYCA 1NH3A 2Q1ZB 1SVOA 3MD2A 4HV6A 4YG2F 2H27A 1TW2A 5E3MA 3IV5A 1JT0A 1Z77A 2LBFB 1PUFA 1IDYA 2AXTC 1XPXA 1XDSA 3OYEA 1ZRCA 2D5VA 1X1CA 5IOYA 1MH3A 2JQ7A 1P4XA 3CP8A 4M9ZA 4IHTA 3CD6I 2HR3A 4IKFA 1FT9A 2DA6A 1EH6A 2V1NA 3QYBA 5EG0B 2ELKA 4O5VA 1ENHA 4HYEA 4NUBA 5J1RA 4L9VA 3WTUC 1G59A 4L0YB 4A3EJ 2QVOA 4BHBA 3PIPF 3H0GJ 5IP7J 1RIOH 2HOSA 3DQVC 1HSJA 5J1UA 2R0QC 2HS5A 2KRFA 5B1BH 3FM5A 2WAQA 4IXAA 5L3DA 2ELHA 2VKDA 3ELKA 1Q1HA 4FASD 4GYIA 5FRNA 3WGIA 4AD9A 1SD4A 4ETSA 1A6QA 1KU2A 3GEZA 3P5JA 2EZKA 4RBOA 1LFBA 3MKWB 2VN2A 2VQLA 4XM3A 5KNLA 2K7LA 3HHGA 2X6XA 2Q8KA 1HKTA 2VL8A 3LAPA 1MBGA 3OL3A 2XVCA 4MEXF 5DEQA 2IGNA 1ZR4A 1JGGA 2F48A 2Z99A 3FXQA 4CYDA 4HV5A 2AHQA 2XC7A 2HFHA 2HQ5A 4OAYA 2QENA 4EJWA 1FMVA 1QQIA 1ZGAA 1VI0A 2W4SA 1VQLI 5ED4A 5HLGA 5CQGA 1HW5A 2QM3A 5EDNA 3A1YA 1K7AA 1YO5C 1HDPA 4FETA 4JYKA 5FFXA 3IL2A 3JW4A 1OKRA 4P55A 4BQNA 3GWZA 3H92A 4MFDA 1N78A 4HSRA 1UELB 3R0AA 4AYBN 4PFPA 4AIJA 3OSFA 1AU7A 3C2HA 4IL6C 5LD2C 3WU0A 1C0WA 1LDDA 1UAAA 2E34A 2R7SA 1J7KA 1LJ9A 3MMYB 2K9LA 1G3TA 4HLYA 4XLNF 3WTTC 5HS7A 3K4LA 3ZQQA 3DBRB 5C3EJ 5EGOB 3L2RA 5GTHC 4YRVA 3CCVI 3D0SA 1IJWC 1A6IA 1UMQA 4ENKA 3KP6A 2EIMH 3CDLA 3HL2A 2R7UA 4I76A 3RDIA 2LSOA 1BOAA 3J80Z 3GTQJ 3CCMI 4MHGA 2PI0A 2LMDA 3NWTA 2FJ1A 1JKPC 1J59A 4G7OF 3S8PA 3UKGA 4EM2A 1PP7U 1U3EM 3ABMH 3M9AA 5DCMA 2R7QA 3HKZN 3SZPA 2Y31A 2W7NA 3H3VK 2WV0A 3S1QJ 4RDUA 1FP1D 1VQ8I 3AAFA 4Q5SF 2GA1A 3OOUA 1FBQA 1KONA 1A5JA 1UZCA 3TGNA 5FFZA 5H20A 2LK2A 4R8HA 4CSWA 4IHVA 2RN7A 1HXDA 3S3NA 2A5YB 2TCTA 3FDYA 2A05A 3MCZA 5ILSA 2Q2EB 2E2HJ 1XGMA 1IUFA 4PSXA 1S6LA 4X0GA 3GZ5A 2E19A 1UHMA 2COBA 3H35A 1N77A 3SFIA 1GXQA 1MGTA 1KYZA 2Z9OA 1ONVA 2X4HA 3GTPJ 4L9JA 3OOPA 3OY9A 2H8WA 2EA2A 3KZZA 4UB8C 4NC8A 2IBDA 3ZMSA 2CUZA 2Y69H 4CCOA 4Z6YA 1EKEA 4QTRA 5E3NA 4LGWA 4QPQA 1DGWY 3E5XA 1ZK8A 1R58A 5H6RA 2E5NA 4ZDPA 3QAHA 2R7RA 1JKRC 3MKLA 1G6NA 2MLGA 1TC3C 3Q9SA 3L2WA 3CESA 3KP2A 2ESHA 2M45A 2DDAA 1TL8A 3BR0A 1OCPA 1WZ2A 2QLZA 1R5HA 4XRMA 4MIMA 3GTMJ 5FLXK 2F5DA 1U9NA 3BTJA 3JCUC 3LSIA 3ZGKA 1IRZA 1VF9A 1W5CC 1Y8RB 1U2WA 2CQNA 2L54A 5HODA 3CUQB 2ADUA 3HOYJ 1BC7C 1D0XA 4BAYA 5FB2A 3WTZA 2IJLA 3G71I 5FD5A 1VZ0A 3BZCA 3VEPA 5IYDJ 1Z9CA 4XN0A 1AA7A 4D7MA 4CZCA 2A6EF 3M1EA 5B5EC 5IYCJ 2H6BA 3JRCA 1XMKA 4HX4A 4PK4A 2R5YA 3V8JA 3F0CA 1V5GA 2DK5A 2W25A 4RLQA 4L5JA 4I01A 1BJZA 2GXGA 3ZR8X 3I59A 4ASNA 2ME0A 4IQ4A 2XAQA 1W1WE 3EPZA 3J7AO 5J3LA 1MD0A 3A0BC 2QF7A 1QHHD 3RQIA 4FE4A
chains in the Genus database with same CATH topology
1OCRH 3X2QH 3AG2H 3ABMH 1V54H 5IY5H 1OCCH 2EIKH 1OCOH 2EILH 3ASOH 2DYRH 2EIJH 5B3SH 3ABKH 3AG1H 3AG4H 2EIMH 5B1AH 1OCZH 2ZXWH 3AG3H 2OCCH 3ABLH 2Y69H 2DYSH 2EINH 1V55H 3ASNH 5B1BH 3WG7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR H;  3X2Q H;  3AG2 H;  3ABM H;  1V54 H;  5IY5 H;  1OCC H;  2EIK H;  1OCO H;  2EIL H;  3ASO H;  2DYR H;  2EIJ H;  5B3S H;  3ABK H;  3AG1 H;  3AG4 H;  2EIM H;  5B1A H;  1OCZ H;  2ZXW H;  3AG3 H;  2OCC H;  3ABL H;  2Y69 H;  2DYS H;  2EIN H;  1V55 H;  3ASN H;  5B1B H;  3WG7 H; 
#chains in the Genus database with same CATH topology
 2CW8 A;  2LBF A;  3LQQ A;  5J40 A;  2HI3 A;  4L9T A;  3H9Q A;  4D1Q A;  2CQ7 A;  5L3G A;  1MNE A;  1HW1 A;  2ZXJ A;  4DYQ A;  5HOO A;  2HKX A;  2RGV A;  2QSF X;  4IO9 F;  4HQM A;  2J5P A;  2BVM A;  3VFZ A;  4N9H A;  4HPQ A;  3DPL C;  3K7A J;  5EG0 A;  2VBX A;  3G3Z A;  2L9N A;  2E71 A;  5F08 A;  4WCG A;  4A3J J;  1Y39 A;  2EJR A;  3EUK L;  4CA0 A;  2VOO A;  4EM1 A;  3CC4 I;  5IP9 J;  3OWT A;  1MBJ A;  1BI0 A;  1YI2 I;  2P8T A;  1LFU P;  4JP0 A;  3D5S C;  4B3A A;  4IPA A;  2QBY B;  1WHU A;  2A07 F;  1U5T B;  3RQ4 A;  2DA4 A;  1U8B A;  3GTO J;  3SXY A;  3M4O J;  3I9V 2;  3MZ8 A;  1LFP A;  2KKO A;  3SZT A;  4JK1 X;  3DTI A;  3BR6 A;  1NHA A;  1Y1V J;  4A0X A;  1JJ6 C;  3R4K A;  3OL4 A;  1AOY A;  2X48 A;  2LY9 A;  1OR7 A;  5E79 C;  5M3M J;  3RYR A;  1JE8 A;  2CV1 A;  3J81 K;  2CUF A;  3H0D A;  2FX0 A;  3LQR A;  4WXC A;  4RM2 A;  4KIF A;  1FEX A;  3ZRG A;  2K9M A;  2IA0 A;  5IP6 A;  5JHF A;  3J7Z I;  1WVR A;  3GFJ A;  1G2H A;  4HG2 A;  4PJ0 C;  1L3L A;  3WG9 A;  3NRV A;  4BY1 J;  4OIO F;  3HPH A;  5HDK A;  5FJ8 J;  5KK1 A;  3GTK J;  2DMN A;  9ANT A;  4FQG A;  3TBI A;  2E2J J;  1ETY A;  2ZB9 A;  3HHH A;  3PNV A;  5B3S H;  1A36 A;  2O9L A;  3HBL A;  5BPD A;  1R49 A;  3FXM A;  3HRM A;  2EWN A;  4KT6 A;  4HNT A;  1OCZ H;  3L00 A;  2NVX J;  4LLN A;  2OZ6 A;  3J81 Z;  2HEO A;  3TOA A;  4HOB A;  4Q4Z F;  3F8B A;  2JPC A;  1PJR A;  3O8G A;  1Y6I A;  5D4R A;  3K69 A;  3FXU A;  2BYV E;  2VT2 A;  4M9X A;  4HZF A;  4JX4 A;  1H8A C;  2JWT A;  1J5Y A;  5L3F A;  1CQT A;  2GXB A;  5E17 F;  2L9R A;  3TOB A;  2EIL H;  2E7X A;  5E8G A;  4EM0 B;  4A3K J;  1F36 A;  1E3H A;  3GBG A;  1R5G A;  4BDZ A;  4ESB A;  5EGO A;  4EQQ A;  2BXY A;  3OYJ A;  5D5X B;  1FSE A;  2RVC A;  3F6V A;  2STT A;  2EFP A;  2L9V A;  3K4J A;  3T8T A;  3L09 A;  2K4B A;  2R7V A;  1FOW A;  2ECB A;  4RGX A;  3U9G A;  1P6R A;  2QCO A;  1IO2 A;  3V8L A;  1D0Z A;  1FIP A;  1JUM A;  5H6Q A;  3BTL A;  4M71 A;  3RJP A;  5DV5 A;  2XAF A;  2HTJ A;  3LSP A;  1Z3Y A;  1ACI A;  4A3B J;  5EZG A;  4RB1 A;  3BR2 A;  2XIG A;  1S29 A;  4WWC A;  2DA2 A;  2K9S A;  2KMU A;  4IRH A;  4XKC A;  2E2I J;  2QQ9 A;  2EA4 A;  3KZI C;  2XKO A;  3AG1 H;  1GXP A;  3HPG A;  3BPX A;  2AO9 A;  2Y9Y A;  2YX4 A;  4XKB A;  3JRD A;  3PFY A;  2X6W A;  4A3M J;  3IAM 2;  3ABT A;  4LB6 B;  2K86 A;  2ZCW A;  4LG3 A;  3S14 J;  3DBL B;  1D5V A;  3OIP A;  3U2R A;  2HVQ A;  2K9N A;  2K3P A;  2LR8 A;  1SC7 A;  4A3C J;  1S7A A;  2DA7 A;  4I6Z A;  2HWV A;  3SQN A;  5KAF C;  3QRF F;  4HW0 A;  4DQ2 A;  4H0E A;  2ZO4 A;  1B6A A;  2F5C A;  2QQB A;  2VIX A;  2PBI A;  2IGO A;  3BRO A;  3LNQ A;  2UXN A;  3MQ0 A;  2FBI A;  2PLY A;  2FA5 A;  3A2K A;  4CGZ A;  3K1P A;  2DJN A;  3GME A;  3I4P A;  4LLG F;  4B3X A;  1MMN A;  4N4N B;  2DMP A;  1DGR M;  1K61 A;  1BW6 A;  1ZGJ A;  1BI3 A;  3ZPL A;  2XV4 S;  5E1X A;  2E1N A;  5HNH A;  2IW5 A;  3K1N A;  3T8R A;  4UUS B;  3Q3S A;  5E3L A;  3CTA A;  1LVA A;  4M3D A;  5GAG J;  1R22 A;  4A69 C;  3CUQ C;  4E7H A;  3FZV A;  1I39 A;  4ZYH A;  1VTN C;  4LOC A;  1ZGW A;  3GO5 A;  2KHM A;  4UY8 I;  5CPR B;  3V7R A;  2X51 A;  4PJN A;  3H9J A;  3FXK A;  3JTH A;  2XF5 A;  4LJZ F;  2LKS A;  2XGD A;  3E97 A;  3F8M A;  1STZ A;  1JUS A;  4OIR F;  3CUQ A;  1MKM A;  3DXJ F;  4U0Y A;  3I58 A;  1HKS A;  5E1Z B;  4WXH A;  1J0R A;  4GCV A;  2RNG A;  2H09 A;  1JTX A;  2E1M B;  2QWW A;  4FX0 A;  2HOA A;  2WAE A;  3ZQG A;  1OFC X;  3LL7 A;  1PP8 F;  1TNS A;  2DOF A;  2CJJ A;  4W1U A;  3CO7 C;  1W36 C;  1SEU A;  2V1D A;  2VBZ A;  1NK3 P;  2CW0 F;  1P7J A;  2RNJ A;  2E36 A;  4J00 A;  2BZT A;  4RB2 C;  1P7I A;  4RAY A;  2VXZ A;  4JQF A;  4A0Y A;  2NRA C;  4G6Q A;  5ICF A;  4MNU A;  4BXX J;  2BE5 F;  5K7Z A;  2XF7 A;  1OIS A;  4RAG A;  1ZTR A;  3B73 A;  3V7C A;  1FZP B;  2EIK H;  1H9G A;  4ZYD A;  3GLX A;  3W3C A;  1R4M B;  1HQC A;  5FKM A;  1Y56 A;  2PMZ N;  2P4W A;  2OTJ I;  3DV8 A;  4G94 A;  4M6V A;  2DMU A;  5IT3 A;  1LDK B;  1T6S A;  5FLM J;  1BM9 A;  2NNY A;  4RB3 C;  1PYV A;  3KYC B;  1YJ9 I;  1SAN A;  5F1J A;  1POG A;  4I7H A;  1YIT I;  4BEH B;  5M5Y J;  3PSF A;  4A3F J;  1SVL A;  1OJL A;  3M1C A;  3C18 A;  1K6O A;  1BBY A;  1W0T A;  1TW3 A;  1P9Q C;  4BNC A;  3KEO A;  2IGK A;  1IAW A;  1MIJ A;  3RYP A;  2ZJQ F;  1U5T A;  2NS0 A;  4CO8 A;  1R00 A;  5D8K B;  3UR3 C;  1AKH A;  2PX9 A;  2FF4 A;  2JRM A;  3RPU A;  4B44 A;  3RKQ A;  1O3R A;  5J4V A;  1CGP A;  4OMY A;  4FX4 A;  2BBY A;  2VXD A;  3EET A;  2LKP A;  4GXO A;  3JAM K;  1JUP A;  4DBR A;  4V19 K;  2NVQ J;  3S2D J;  1D8J A;  1Q1V A;  3I64 A;  3IRR A;  2KJC A;  2BY2 A;  2M5W A;  5BQT A;  1PUE E;  3OYN A;  5D8L B;  5KAI C;  2V6E A;  1YLF A;  2LTP A;  3IH4 A;  3QOE A;  4ZDL A;  1T38 A;  4NHJ A;  3PNT A;  2FD5 A;  2LKX A;  3O3K A;  2R7T A;  2N8G A;  1NTC A;  1FJL A;  1D1C A;  3OYC A;  1D8K A;  2CH0 A;  4LIU A;  3HSR A;  4CUG A;  3DF8 A;  3HKZ A;  2WV1 A;  2ZNY A;  4XLE A;  3MZH A;  1XGS A;  1SVM A;  2JN6 A;  4XNF A;  3MVP A;  3HOS A;  4B09 A;  2HZD A;  5A2Q Z;  3T5X A;  4X1E A;  2M87 A;  2F4O B;  4QLC U;  4RGU A;  3W2A A;  4IEJ A;  3I5U A;  1H89 C;  5GAD J;  1RNL A;  2JA6 J;  2GBY A;  2KDO A;  4CCL A;  2M4K A;  3WU2 C;  2R3S A;  4I0B A;  1Y8Q B;  2OBP A;  3IC7 A;  3IP4 B;  1YW7 A;  4ZH4 F;  4D5F A;  1OCO H;  1I6H J;  1ON1 A;  4XRF A;  2M3A A;  2XB5 A;  2MH9 A;  1WJC A;  2BVL A;  3FKI J;  4CDG A;  1LB2 A;  1HKQ A;  2R4G A;  1R23 A;  1MDM A;  3A01 A;  3BLY A;  3LFK A;  4GRI A;  1ETX A;  1VQ4 I;  3EUA A;  4BUP A;  2V7F A;  3DKW A;  4JX6 A;  1MW7 A;  2LVS A;  4XMY A;  5LFA A;  3E6M A;  4WX9 A;  2DQR A;  1W4M A;  3HTU A;  2WY7 Q;  4I09 A;  4KN7 X;  3KET A;  1TWG J;  2YX7 A;  4C3J J;  2VJI A;  4K2E A;  2GIV A;  2XSD C;  2LOO A;  2CQX A;  3K4C A;  3KYD B;  2DT5 A;  3FKJ A;  1MSF C;  1WCM J;  3L2U A;  4V2F A;  2CMP A;  2MG4 A;  2Y0S N;  5CVR A;  3HOW J;  1KU3 A;  1FWZ A;  3VYT B;  2O0Y A;  4MQV A;  1MMA A;  3QPS A;  1YTY A;  1TWA J;  2VKE A;  4A6D A;  4EAT A;  1DP7 P;  2P7V B;  4PGG A;  2CO5 A;  1TWF J;  2ETH A;  2CQK A;  5IY5 H;  3W6J B;  4A3D J;  4E7S A;  4ITV A;  5JFR A;  2IS6 A;  1VQ9 I;  3TDZ C;  4KJZ A;  1RKW A;  4PCQ A;  3KP7 A;  1UHW A;  4N4O B;  3I53 A;  2QYO A;  1MBF A;  3DKX A;  3LA3 A;  1AWC A;  4BE1 A;  2BOL A;  2NOJ B;  4BJT A;  4YFK F;  2HYF A;  2VJJ A;  2OAZ A;  3ZQC A;  2JA2 A;  2LDU A;  2VI6 A;  3GFL A;  2LP0 A;  1QPI A;  1MMD A;  2XGX A;  1WI9 A;  2EZH A;  3ONQ A;  4YEJ A;  2ZJ2 A;  3TW7 A;  2FEZ A;  3S32 A;  4DJA A;  4EJU A;  2M34 A;  3BP8 A;  3CP2 A;  3Q9V A;  1QU3 A;  5DUK A;  3CME I;  5LRR A;  1B8I B;  1ETW A;  3TKY A;  2XKP A;  2M0M A;  4Y7N J;  3DPT A;  2E1M C;  4CXF A;  2PEX A;  2CS3 A;  3NAU A;  4LIV A;  4I02 A;  1R1T A;  2X1E A;  4N9I A;  2R7X A;  3AG2 H;  5F04 A;  2Y0M A;  2CUJ A;  1QZY A;  2ZFW A;  3NWS A;  4KN4 X;  2ZBK A;  4BYY A;  3B02 A;  3OS1 A;  4PJM A;  3CLO A;  1SMY F;  1FYK A;  2HYG D;  2KIS A;  2DO7 A;  4BY7 J;  4A3G J;  3ASO H;  1B9N A;  3LWF A;  1T2K A;  1WGX A;  3SDG A;  5CYV A;  2XRL A;  3K2A A;  1YJN I;  4GYG A;  1IN6 A;  4ZC3 A;  2AXL A;  3DKY A;  4WF2 A;  3WU1 B;  2JTV A;  2CV2 A;  3FMR A;  3H3U A;  4A0Z A;  1ZQ3 P;  1TZL A;  3GYH X;  1F1Z A;  3J80 K;  3A4C A;  3CC2 I;  2XPV A;  5HLH A;  1RUN A;  5ICE A;  3JRF A;  4DBQ A;  3PUB A;  4XKV A;  4M3B A;  1YJW I;  3OIQ A;  1KA8 A;  3MAJ A;  1H0M A;  1IN5 A;  3PQJ A;  5IPA A;  3BZ6 A;  1MZB A;  3HRT A;  4LIT A;  2XHK A;  3HB9 A;  3WOD F;  2K9Q A;  5HNF A;  3M3Y J;  1P4A A;  3CJR B;  1GVD A;  1ZH5 A;  4BQQ A;  3A03 A;  2X85 A;  3N05 A;  4U88 A;  1HLV A;  1USS A;  3RZD J;  2EFO A;  3C2G A;  4F52 A;  4MLO A;  3DP7 A;  3IWF A;  2ZJR F;  2XSJ C;  1QBJ A;  1FTZ A;  4IOA F;  3BQZ A;  1D1A A;  3P9K A;  3TO7 A;  4B47 A;  2W85 A;  1VFC A;  2CW7 A;  4KYW A;  3LMM A;  2K4J A;  2K5C A;  4MO7 A;  1R5I D;  3K4N A;  3WHB A;  4MEY F;  4CZZ A;  2FNA A;  1TNT A;  3EUH C;  4UNO A;  3LAJ A;  2KIU A;  2XAG A;  2O5R A;  2Y2Z A;  4J01 A;  2J5O A;  4UV8 A;  2Z5U A;  3VYU B;  3RPU D;  4EGY A;  1VQP I;  4B43 A;  2FQ4 A;  5DM6 F;  2O8K A;  5CVJ A;  1MJ9 A;  4A93 J;  3Q0V A;  3FM3 A;  3AL0 C;  2CGP A;  2R93 J;  2B63 J;  1WQ2 A;  2DOD A;  1WRJ A;  1XC5 A;  2E1C A;  2ECC A;  1LPQ A;  1ETO A;  2R7F A;  4F92 B;  3L9F A;  3AFH A;  4X6A J;  2ESN A;  4C3I J;  3HJE A;  1TWC J;  4Y17 A;  3DLL F;  3ZOB A;  2DA3 A;  1FTT A;  4II3 A;  2PMU A;  2EV5 A;  2EV6 A;  5EF6 A;  1KU9 A;  1IXC A;  3PM1 A;  1FSH A;  1J2X A;  5E18 F;  4D0P A;  3M07 A;  4BE0 A;  1FYM A;  2H1K A;  3B6C A;  1YOV B;  5CQE A;  3F6O A;  4GGG A;  2MAB A;  3RPQ A;  4ESF A;  3B6A A;  1W7P B;  2BGC A;  2PJR A;  4C3H J;  2L2O A;  2XRO A;  2QZ8 A;  4AUX A;  3VOD A;  2K3F A;  3HSF A;  4KIT B;  3ABK H;  3ZQH A;  2AQF A;  2P5L C;  2QSH X;  3BY6 A;  1ETQ A;  1I1G A;  2HNH A;  5EEH A;  3CJT B;  5LHH A;  5HLI A;  3MZY A;  3BG6 A;  2WWY A;  1OCR H;  1YYV A;  5F0H A;  3I4M J;  3PO2 J;  4U87 A;  2O6G E;  4E7I A;  1IV8 A;  1HBX G;  1SD6 A;  1H9T A;  5BNG A;  2Y75 A;  1QGP A;  1U8R A;  4EJV A;  1O4X A;  4EJO A;  2HOT A;  3BG9 A;  3DU6 A;  1WH7 A;  1Y1W J;  5DCF A;  3TO6 A;  2JA8 J;  3J7Y J;  4P9U A;  1AHD P;  3PNY A;  3E5U A;  3FK7 A;  2GXA A;  4G7H F;  2P6T A;  1KYW A;  2MA3 A;  3NAR A;  3F72 A;  1YX3 A;  3HGY A;  3KP5 A;  4EGZ A;  2Z33 A;  3HIF A;  3TQN A;  5DTD A;  3ZCO A;  1XMX A;  2NNN A;  3S15 J;  2NXN B;  1RPW A;  2QUF A;  3OYK A;  2OF7 A;  5F0C A;  2XPW A;  5DM7 F;  3IKT A;  5C4X J;  2BW3 B;  3FK6 A;  4KUM A;  4IF4 A;  2KFD A;  1DDN A;  4BQA A;  1IV6 A;  3FMS A;  1Y0N A;  2BV6 A;  4KT5 C;  5D4S A;  3HRU A;  3GX4 X;  3OYF A;  3KX2 A;  3L2C A;  2O8X A;  1IN4 A;  3GTJ J;  3FBN B;  3BWG A;  3GTL J;  2ISY A;  4ESJ A;  3BDD A;  1LKX A;  3BT9 A;  2WAQ N;  3QPT A;  3PUF A;  2DAO A;  2KPM A;  2M4G A;  5K1Y A;  3PJR A;  4KIB A;  3CCL I;  2Z2S B;  1F9N A;  2FXA A;  2WAD A;  2STW A;  2XAH A;  2JUC A;  1TWH J;  3U21 A;  2JRT A;  3HGG A;  5J4Y A;  2VE8 A;  3K70 C;  4DNC A;  5DUI A;  2AS5 F;  2V6C A;  1B8I A;  2LF8 A;  1X1P A;  1OMI A;  2EZI A;  4NC7 A;  3S1N J;  2TDX A;  4BKX A;  2X1C A;  3MWM A;  4UVA A;  2F4I A;  3ZMD A;  2DT6 A;  2WB1 A;  3GTG J;  2PG4 A;  2GQQ A;  5GP9 A;  4HBL A;  2WC2 A;  4BDY A;  4LD5 A;  2NVY J;  3CJN A;  2KIF A;  4ON0 A;  4M3E A;  1R1U A;  3QPL A;  3JSO A;  1ZRD A;  5FLV A;  4HRI A;  1FX7 A;  3KPH A;  1X1D A;  1OPC A;  1WH5 A;  1DPR A;  3H9G A;  2W82 A;  4OAZ A;  3CCU I;  2DOA A;  3TDU C;  1ZG3 A;  5C44 J;  3F8F A;  5CVV A;  3HOU J;  3OYH A;  2QQA A;  2QA4 I;  4NB5 A;  2VAS A;  4XSX F;  2QSG X;  4ENJ A;  3JR9 A;  4EV0 A;  4H4K C;  3E3V A;  3FBI B;  2P81 A;  2Y30 A;  2H1L A;  4V2G A;  5TRD A;  3IHU A;  1R36 A;  1RES A;  1QO0 D;  4UVC A;  1OCT C;  4I0A A;  2FRH A;  4Y52 J;  3VSK A;  1X3U A;  4M3F A;  2HVR A;  1Z05 A;  3H5A A;  1T8I A;  4G6D A;  4RGS A;  3ZMV A;  2P0W A;  1UST A;  2UUZ A;  4CCN A;  5FD6 A;  4YEL A;  1WI3 A;  3W6V A;  3K6G A;  2FNP A;  2LRE A;  5JLW A;  2M2E A;  3REO A;  2G0E A;  1ZG5 A;  1R9T J;  1HC8 A;  2R5Z B;  1U6G A;  5F27 A;  3K1M A;  3SYT A;  1QZE A;  2B7E A;  1T39 A;  2V9V A;  3VOE A;  2IPQ X;  1XSX A;  3TP0 A;  2LY2 A;  4OIQ F;  2WY8 Q;  1MNM C;  1UJ8 A;  2WAF A;  2ZSI B;  4HF1 A;  3LST A;  3JRE A;  1OQY A;  2L5Q A;  1IGN A;  4HEA 2;  3FF5 A;  2EIJ H;  3L7W A;  3BCA A;  2IS2 A;  3BJ6 A;  4L5I A;  2V9K A;  5JI6 A;  1YE9 A;  2VPL A;  3ERM A;  1QHG A;  4BAC A;  3SHF A;  1HA8 A;  1WJB A;  3BPV A;  1IXS B;  4G6T B;  1K4T A;  3EYY A;  1ZAO A;  3HOZ J;  4XID A;  2DA1 A;  4HA8 A;  4B4C A;  3SFZ A;  1MJB A;  4U0V A;  3RKX A;  2M30 A;  4EVI A;  2DLL A;  4UHT A;  1LVK A;  4KDP A;  2L0K A;  2X0L A;  1RKT A;  2HXO A;  3F8C A;  1YG2 A;  3S16 J;  2Q2E A;  4F93 B;  5LGT A;  4I2O A;  3H1C A;  1YS6 A;  3O6B B;  1Z0X A;  4A2U A;  4XIC A;  1PUF B;  1LEA A;  2RDP A;  1XB4 A;  4ZTJ A;  3QP6 A;  3ZQI A;  2YU9 J;  2Y0S A;  1LDJ A;  4HDV A;  1I1S A;  3ZXS A;  3F9K A;  4BJ5 C;  2JPB A;  3RI4 A;  1ZRE A;  3CF5 F;  4NNJ A;  2PJP A;  3OS2 A;  2E35 A;  4IRG A;  4LG0 B;  3S1R J;  1ULY A;  1W7P A;  5BS6 A;  1MSE C;  2CUE A;  4UXN A;  1NK2 P;  1SD7 A;  3I54 A;  3K4K A;  3SDB A;  1BR4 A;  3HM5 A;  4EJT A;  3VPR A;  4ZYE A;  3COA C;  4MTE A;  4G9Y A;  2DFE A;  2HZT A;  3DTE A;  4XLF A;  1ON2 A;  1ZRF A;  4D5C A;  2COM A;  5KHD A;  2K40 A;  2ZXW H;  3R6S A;  4KA4 A;  1TT5 B;  2XUB A;  1I50 J;  1SMT A;  2Y9Z A;  4HQE A;  2NAZ A;  3ASN H;  3BG3 A;  1O7L A;  2IXS A;  2L02 A;  3QPH A;  1QZZ A;  2HDW A;  2L7M P;  2P6S A;  3X2Q H;  3I55 I;  2DOE A;  2F6C A;  1V54 H;  4CHU A;  1HDD C;  1IRX A;  3DEU A;  2GM4 A;  1E17 A;  1X2M A;  3V4G A;  5J8F A;  2NOG A;  2DK8 A;  3LSG A;  1VQ7 I;  3OYA A;  1B1B A;  2H8R A;  5HLT A;  3V8K A;  4JBA A;  3FXJ A;  1JI8 A;  2LRD A;  2P5K A;  1FMW A;  3LSM A;  5GAH J;  4LK0 F;  5EYR A;  1FPQ A;  2BEO A;  3HXL A;  5HS8 A;  2KRC A;  2OTL I;  3WTV C;  5J8C A;  1Z91 A;  4QPO A;  3BJO A;  1Z3X A;  2YU3 A;  5FGM A;  2W84 A;  3PO3 J;  1IN8 A;  1XN7 A;  3N4M A;  2KZV A;  1HOM A;  1TQM A;  2MBF A;  3S2H J;  1XSD A;  2XDV A;  4Y33 A;  2FML A;  4D7N A;  3LFU A;  2LC2 A;  2XPU A;  3P9I A;  5HS9 A;  3K9T A;  4U7B A;  4U7D A;  2ZC2 A;  4KFC A;  1BI2 A;  1F43 A;  3TED A;  1N75 A;  2JVG A;  2FQ3 A;  3CF2 A;  3WTW C;  3GFI A;  4BS9 A;  1S9H A;  1XSV A;  2DCE A;  3VWB A;  3D5L A;  4C2U A;  1CF7 B;  3CCR I;  1BW5 A;  2DA5 A;  3GVA A;  1ZYR F;  2JT1 A;  4AYB A;  4UUT A;  3M7G A;  5ICG A;  4XN3 A;  2QBY A;  1OLT A;  5LGN A;  2JUG A;  3G4S I;  3RCO A;  2HGC A;  1M1E B;  2MYS A;  5ILV A;  3HOT A;  2CQQ A;  3C3W A;  3E7L A;  1K79 A;  1W5S A;  2OCE A;  2F4M B;  1S7E A;  5A2Q K;  2OD5 A;  3S1M J;  3FIW A;  2O3F A;  3ECH A;  3KLN A;  4I98 B;  2ICW G;  1JHF A;  4BXF A;  3CQZ J;  1FLI A;  1I3Q J;  2AQE A;  2F5E A;  2L01 A;  5JHU A;  5DD4 A;  3R0J A;  4YII A;  1EH7 A;  2DMQ A;  3GUD A;  1IG7 A;  3CCY A;  5TIS C;  1I3A A;  3WGH A;  4YFX F;  3DTK A;  3FHZ A;  4W97 A;  3AL0 B;  2IGM A;  4XRS G;  2KT0 A;  3BQY A;  1X1A A;  5AIQ A;  1O57 A;  3WHC A;  1FYL A;  5E1W A;  2D1V A;  2XRN A;  1XGN A;  1RR8 C;  3QU6 A;  4IZZ A;  5CVU A;  3FWE A;  2EB7 A;  2X6O A;  3CMY A;  3BR3 A;  2L4M A;  4A3L J;  1KQ0 A;  5LLQ A;  4RB0 A;  2KL4 A;  3JRB A;  3ZN1 A;  1V4R A;  3WG7 H;  4M72 A;  3OV8 A;  1BC8 C;  2RAE A;  1G3Y A;  1XG1 A;  4XOP A;  5EZH A;  2IP2 A;  4DYR A;  4B1R A;  5GTI C;  1JKO C;  1MBH A;  3IAS 2;  4KIG A;  4YFN F;  4IJA A;  4LFU A;  4FTH A;  4OOI A;  2DT7 B;  3E6B A;  1RR7 A;  2ZME C;  3FMQ A;  1EV7 A;  1DP3 A;  2CFO A;  1GHC A;  1MMG A;  2A3S A;  1S72 I;  1FC3 A;  1SD5 A;  5LHG A;  1XTA A;  1Z67 A;  2MC3 A;  2X9D A;  3KP4 A;  2HVS A;  2DBB A;  3F23 A;  5CVI A;  1Z7U A;  5K5O A;  2W00 A;  4XBF A;  2BY0 A;  3SZG A;  3KEQ A;  2VQH A;  3BR1 A;  4Q48 A;  2R5Z A;  4C2T A;  3WE3 A;  2GAU A;  1MBK A;  1WJE A;  2KZG A;  4C2M J;  2HPI A;  2DDB A;  3EQL F;  1YW9 A;  4NC6 A;  5E20 A;  2IA2 A;  2OQG A;  2R7W A;  4XQF A;  3E6C C;  2XF6 A;  1UCR A;  1B72 B;  1YIO A;  2B0L A;  2LD5 A;  2ELJ A;  2TRT A;  3K2Z A;  2D45 A;  1WKM A;  3VYR B;  4DYC A;  1BR2 A;  4UUV A;  1G8X A;  4MQ9 F;  2A68 F;  3W2V A;  4DZP A;  1YX5 A;  4DIQ A;  1NG6 A;  4BE2 A;  2HPM A;  2DU9 A;  2OC6 A;  1Z7L A;  3ZQL A;  3CO6 C;  4Y3O A;  4A5M A;  3QQA A;  1J75 A;  4XOR A;  2ZNZ A;  3Q0U A;  4CH7 A;  3S3O A;  5D6F A;  1GV2 A;  3OS0 A;  3Q5F A;  2WTE A;  2IA1 A;  2PMH A;  1MND A;  5B1A H;  5IOZ A;  5JVG F;  3K4M A;  2EPF A;  2DPU A;  3JRH A;  2W57 A;  3A0H C;  4QWQ A;  5ERI A;  1QA6 A;  1WJD A;  4E70 A;  1KQ9 A;  2QEX I;  1SFO J;  5IT9 Z;  1ETK A;  1ZHF A;  3P9C A;  2R92 J;  3KLO A;  4OIP F;  4UUS A;  1IZ1 A;  3DPU A;  2IEK A;  4LG0 A;  4JX5 A;  4RA2 A;  2NYX A;  5D5W B;  1N25 A;  1SAU A;  5M5W J;  2HDC A;  3H5N A;  1W7P D;  4IHW A;  5BMZ A;  5BPI A;  4KMU X;  4A6E A;  1B59 A;  4AVZ A;  1UFM A;  3O2P E;  1A04 A;  3ZQF A;  4ZYG A;  2GOX B;  3HC7 A;  2EIN H;  4II2 A;  4HAM A;  1T0F C;  3IRQ A;  2XGC A;  1WFX A;  5CKT A;  2EK5 A;  3HOX J;  2NVU B;  4ZZD A;  3C7J A;  2M1B A;  2VKH A;  1VQM I;  1JTY A;  1X58 A;  2VKV A;  4A12 A;  5J47 A;  3CCQ I;  4BXU A;  3CDI A;  3OYI A;  5JLX A;  1ODD A;  4ZZL A;  4NQW B;  4ZDO A;  1D3Y A;  1SFK A;  2OV7 A;  3O8H A;  1T0F A;  2HKO A;  3E5Q A;  2IAI A;  5JR3 A;  4HDU A;  1QNT A;  1FOX A;  4LMY A;  2LFB A;  5GPA A;  1HW2 A;  5FKO A;  1IN7 A;  3OYD A;  3WGG A;  2EH3 A;  1KZH A;  2MGQ A;  4QIW N;  5FKN A;  2G7H A;  5DD8 A;  3R60 A;  4BL0 B;  5L3C A;  1P4W A;  5EEA A;  5FRM A;  2GA2 A;  4FIS A;  3VYS B;  4IQJ A;  2DW4 A;  4ABZ A;  3W2W A;  4PJJ A;  4XLH A;  3V7S A;  5BOX A;  2JMW A;  1W36 D;  5LEK A;  3DU5 A;  3F21 A;  2OUM A;  1PDN C;  1S8N A;  2IVM A;  3F3X A;  1LQ1 A;  4XRS A;  2LLK A;  3LSH A;  2NVT J;  3OYL A;  1VQK I;  1T33 A;  1S3J A;  4Z2Y A;  4G8X A;  5K7F A;  1X4O A;  2VBW A;  1VND A;  2GOM A;  4Y15 A;  2L7K A;  1TQP A;  1OYY A;  1CF7 A;  3SJM A;  4XLA A;  4BEH A;  1I6X A;  4GDF A;  1WJA A;  3IWZ A;  3LA2 A;  2ME6 A;  1BL0 A;  2KQR A;  1BIB A;  4ZYA A;  1V3F A;  4S04 A;  2W24 A;  3RZO J;  3GCM A;  2DPD A;  3OMY A;  3L2V A;  2R7D A;  3BG7 A;  1YRN B;  2ISZ A;  2ZFU A;  1BI1 A;  5HDG A;  2I8D A;  3L2Q A;  3PL8 A;  3G1O A;  3KP3 A;  3QU3 A;  4E7Z A;  4B8X A;  3E6D A;  4AU7 A;  2IS1 A;  5F0F A;  2VQG A;  3EUH A;  2LNB A;  2OQR A;  5F1R A;  2ZJP F;  1A35 A;  3PFI A;  3ULQ B;  4F7Z A;  2VJ4 A;  1XD7 A;  3KEY A;  2L4A A;  3BTI A;  1GT0 C;  3M8J A;  5D6E A;  4KIS A;  1L0O C;  4HF0 A;  1JKQ C;  1TT0 A;  2UV1 A;  3JTG A;  3HRS A;  5ILU A;  4YIR X;  4O3M A;  1VQN I;  4J19 A;  2V1U A;  4NBQ A;  2CU7 A;  1ZEL A;  3BR5 A;  1V5F A;  3CCJ I;  3RKY A;  3K0L A;  4C30 A;  3BOQ A;  2YPR A;  3CMM A;  3U1D A;  1TTY A;  1S7O A;  4M9S A;  3HSE A;  1H88 C;  2YUS A;  2KP6 A;  3H36 A;  3IKV A;  3FXL A;  3OSG A;  2B9S A;  1APL C;  3BZK A;  3E0J B;  4BBS J;  1WJF A;  2M8E A;  3MN2 A;  3QYE A;  3R61 A;  1FY7 A;  2HU9 A;  2LG4 A;  2LF7 A;  3S3M A;  2I5U A;  2L9S A;  3BJA A;  1DU6 A;  5GPC A;  1FIA A;  2VUM J;  3NEU A;  4E4H A;  3IH3 A;  3OR1 C;  4P1W A;  2DTR A;  3GZ6 A;  1SFU A;  3S93 A;  4RS8 A;  1YS7 A;  5L3E A;  2VON A;  2V79 A;  3AG3 H;  4YIF A;  2DQL A;  4MGR A;  3TL4 X;  1ZLK A;  2JA7 J;  1WSU A;  1O3Q A;  1P2F A;  4NDL A;  2DYS H;  5LGU A;  3CDH A;  4MTD A;  2M8G X;  5F64 A;  4M73 A;  2E5Z A;  2O03 A;  2GZW A;  3T0Y A;  4HNU A;  3OYB A;  4FHT A;  4IVN A;  2JSC A;  1RZ4 A;  2IT0 A;  3TMO A;  2I10 A;  4N0B A;  2L7Z A;  5AON A;  2CG4 A;  3IUO A;  2IRF G;  1GDT A;  1FBS A;  2ID3 A;  1YHQ I;  4UV9 A;  1RRJ A;  4DW6 A;  2HOE A;  4M74 A;  1B72 A;  1JXS A;  2XGE A;  1BOB A;  1Y0U A;  3AG4 H;  1JGS A;  1IF1 A;  3M8F A;  2M7B A;  1D0Y A;  3MKY B;  3C1D A;  4A5N A;  3TO9 A;  4AC0 A;  2KIQ A;  2XAJ A;  3CMA I;  2NS8 A;  2D1H A;  2DJI A;  2RRE A;  4HNV A;  3ZMT A;  3F8N A;  2VOD A;  1I5Z A;  3MKZ A;  2FMY A;  1LE8 B;  1REP C;  4AID A;  3KYL A;  2ZXI A;  4L0Z B;  1K78 B;  3QOP A;  4ZTF A;  2D2W A;  1UG0 A;  5CJ9 A;  1K83 J;  2DTZ A;  3KIO A;  1FOK A;  2V1X A;  3ECO A;  2V26 A;  3DWL E;  2BHZ A;  1R1V A;  4IHX A;  5FLX Z;  2M9H A;  2MD0 A;  1XCV A;  2BY1 A;  1LUJ B;  5FKL A;  1S5L C;  5M3F J;  2CRG A;  5DYM A;  2FOW A;  3LOC A;  2PFB A;  3J7A Y;  5B66 C;  3ML6 A;  4R1H A;  3PQK A;  4XON A;  2GLO A;  1F5T A;  2A69 F;  2UXX A;  1JHH A;  1KGS A;  4BGD A;  4PUS A;  1XCB A;  1XS9 A;  3G6E I;  3U1K A;  4XLP F;  1Z6T A;  2RC4 A;  2M0C A;  2RQQ A;  4RAZ A;  4BU2 A;  4HX7 A;  5KCM A;  3PSI A;  3D1N I;  1TBX A;  4S0H B;  2QQ8 A;  2ZSH B;  2R7O A;  4PDK A;  4Y13 A;  2BY3 A;  4EMS A;  2PMZ A;  2HQA A;  2Z16 A;  3CLQ A;  3ABL H;  1GLN A;  5EJC A;  6PAX A;  3N97 A;  2C6Y A;  3HDD A;  2JVH A;  1QRY A;  3MEX A;  2IS4 A;  4C9Y A;  1IW7 F;  1OR7 C;  2MLK A;  2X6Y A;  3V42 A;  3HUG B;  1AKH B;  5ICC A;  3KCC A;  4M6Y A;  2K27 A;  1WPK A;  4RM3 A;  1W5T A;  4CCM A;  4I99 C;  3T1B A;  5K7H A;  2R7Z J;  5EEG A;  2FSW A;  4NQW A;  4PSW A;  2QKM B;  1SFX A;  2VLA A;  2GWR A;  3PIO F;  4ANJ A;  2HTS A;  1EJ9 A;  4BHC A;  1DUX C;  1SAX A;  2A5W A;  2MFZ A;  5C4J J;  3ERE D;  3TP3 A;  3DEW A;  5DDG A;  2F5F A;  2X1D A;  2KJB A;  2W1O A;  1ZG1 A;  2XB0 X;  1X1B A;  4D9J A;  2H94 A;  4WK8 F;  3ZMZ A;  1WJ5 A;  2MD5 A;  1QVT A;  1E3O C;  2HXI A;  4IHY A;  2A61 A;  2F5V A;  1QPM A;  1QVU A;  3CCE I;  3P7N A;  2G7U A;  3I3L A;  4AVP A;  3W6K B;  5LEJ A;  1ZR2 A;  1JJ8 C;  5FKK A;  4BHP A;  5H2F C;  3JRA A;  4ZJZ A;  2ZME B;  1MBE A;  4PGH A;  1K6Y A;  1TLH B;  4IHS A;  3FXO A;  3S2W A;  1E2X A;  1G3W A;  1NG7 A;  4M6X A;  4XSZ F;  5HDN A;  2Z3Y A;  5IYB J;  3JRI A;  4R79 A;  4TV7 A;  4KNY A;  4L18 B;  2JA5 J;  1X2N A;  3WE2 A;  2CWE A;  4JOM A;  4Q47 A;  1O3S A;  1JT6 A;  1MDM B;  3A01 B;  1T08 B;  3ROU A;  1YRN A;  1FNN A;  4XR6 A;  2DFF A;  2Q0O A;  4EEF G;  1ZLJ A;  5TGT A;  4E7L A;  2MH2 A;  3GF2 A;  3GFM A;  3FX3 A;  5E3O A;  2FBH A;  2VE9 A;  2OPT A;  3BG5 A;  4BH9 A;  2OZU A;  1ORK A;  3UNG C;  3QOD A;  2EFW A;  4ENM A;  4HF2 A;  2L3D A;  1ZAR A;  2XAU A;  3K4B A;  3VDX A;  3GZN B;  1ITY A;  2HQR A;  3Q0W A;  3DCF A;  4E7J A;  5HVQ C;  1YQA A;  2KRH A;  4CYC B;  2ZKZ A;  3DFG A;  4XK4 A;  1V5E A;  5J1Y A;  2ID6 A;  2BXZ A;  2OCC H;  1IRF A;  4CIC A;  4RGR A;  2YS9 A;  1FP2 A;  1G3S A;  1TQI A;  2DMT A;  1IC8 A;  5L3B A;  1GVJ A;  1W0U A;  2VBY A;  2VC0 A;  1OYW A;  3S17 J;  1OYI A;  1A31 A;  3L1P A;  1Z1D A;  3D5R C;  1RC9 A;  1XDU A;  3I56 I;  2E1O A;  2FOK A;  2RV8 A;  2OJE D;  5LRS A;  1IDZ A;  1KQ8 A;  1ERD A;  1X3Z B;  4E7K A;  2E7W A;  4PFO A;  5LHI A;  2YSR A;  3ZP5 A;  4MFE A;  5DS9 A;  3FXR A;  4P96 A;  4AM3 A;  4P5O A;  1MJA A;  4XLC A;  4RAF A;  2ACJ A;  2HDD A;  1VQ5 I;  5K5Q A;  1VQO I;  3EYI A;  1HST A;  2Y48 A;  3ZMU A;  1YW8 A;  1I27 A;  1E3P A;  3QYF A;  3RIR A;  4PZJ A;  4LLL A;  4KMF A;  2RKH A;  1XMA A;  4XL9 A;  1XGO A;  2UWM A;  4O6J A;  3M8E A;  1GUU A;  2EFQ A;  4XKW A;  1PVE A;  3HZJ A;  2BHY A;  1SFE A;  3HG9 A;  4AWX B;  4BBR J;  3G73 A;  3GW2 A;  4F91 B;  5M5X J;  1BR1 A;  4OU0 A;  2PQ8 A;  2A6H F;  3A02 A;  2XAS A;  1D1B A;  3GXO A;  3QP5 A;  2CV0 A;  2WBM A;  3I71 A;  3BC8 A;  4DOZ A;  5KVR A;  1ZKG A;  1X19 A;  1K4S A;  1RUO A;  2E60 A;  4Y4R A;  2MW8 A;  4A3I J;  3ISP A;  3ZQ7 A;  3ESW B;  2EBI A;  4HX8 A;  2HQN A;  2ZXH A;  2O7O A;  4FT8 A;  3VB2 A;  4AIH A;  2V9P A;  1F4K A;  2OA4 A;  1ZN2 A;  1OCC H;  3KE2 A;  1LE8 A;  2DI3 A;  5TJJ A;  3LA7 A;  5FRO A;  2BW3 A;  3VSL A;  1U78 A;  1X3W B;  1K78 A;  2DFH A;  2W48 A;  1YFH A;  2JZY A;  1BIA A;  4KIC A;  3HOV J;  2CSO A;  1E0E A;  3AKZ A;  4UVB A;  1DPU A;  4IRI A;  5JVT A;  3DBH B;  3DEE A;  1U0J A;  1R7J A;  2GIZ A;  1X4P A;  1U9O A;  1RI7 A;  4GFB A;  2RQP A;  3RSN A;  2P5V A;  3H3Z A;  2H6C A;  3DLA A;  2O61 A;  2DYR H;  2FUG 2;  1EF4 A;  2VQC A;  3K10 A;  4QSH A;  2MC4 A;  1O3T A;  4BQO A;  4FCY A;  2VOP A;  3IH2 A;  2VT3 A;  3OIO A;  1LEB A;  4OIN F;  1U5T C;  2QKL B;  1FBU A;  4GO1 A;  3F22 A;  1TP4 A;  2LYC A;  2WB1 N;  3KZY A;  3JSP A;  1UHS A;  1IUY A;  1D5Y A;  1O7F A;  3CCS I;  4E6K G;  3HYI A;  2MSY A;  3FHN A;  3SEQ A;  4DZJ A;  5DCM B;  4BJ6 C;  5K5R A;  1RET A;  4OWR B;  1MH4 A;  2K85 A;  3RKW A;  3MFK A;  1GV5 A;  2NS7 A;  2DN0 A;  4FE7 A;  4OMZ A;  3K70 D;  3LSJ A;  3CUO A;  3H5R A;  3FIS A;  3HUG A;  3QWL A;  3CJQ B;  5D5V B;  3RTR A;  3HTS B;  1J09 A;  3E1S A;  3ABU A;  1ETV A;  1DQU A;  2V4J C;  4HST A;  3G1L A;  1T56 A;  2VB6 A;  3GLL A;  3JRG A;  2Z1D A;  3WTY C;  2FU4 A;  4HLX A;  2KIM A;  1XX5 A;  2LH9 A;  2JSP A;  5LBQ A;  2EQR A;  3EDP A;  1IXR C;  1V55 H;  3WTS C;  2KDZ A;  3I0T A;  4F3Q A;  5J6X A;  5GAE J;  3OYG A;  4B48 A;  3NQO A;  4U0W A;  1P92 A;  3BCB A;  2LY1 A;  4XOT A;  1WWX A;  4LB5 A;  1BA5 A;  1UB9 A;  3LSK A;  1UG2 A;  3CZ6 A;  4S05 A;  4DGW B;  3WTX C;  1EH8 A;  3BTC A;  4RLF A;  1DU0 A;  1HCR A;  4L9N A;  2F2E A;  4PJL A;  1T95 A;  1Z21 A;  4LK1 F;  3LSR A;  3CC7 I;  2YR2 A;  1Z6R A;  1B4A A;  2UZK A;  1G4D A;  3JAM Z;  1R4N B;  2QGU A;  5E8I A;  5D5U B;  4ENN A;  1YIJ I;  2P7C B;  2VPR A;  2K02 A;  1R71 A;  2KLO A;  1R6R A;  5CLS A;  1B9M A;  2EFN A;  2M7A A;  2ZME A;  4F55 A;  3KFW X;  3SEZ A;  3ZN0 A;  4P9F A;  4RMN A;  1T98 A;  2PJR B;  2FE3 A;  1LNW A;  2OU2 A;  2CFX A;  5F6F A;  2EZL A;  2G9W A;  3OYM A;  3C2B A;  2DXI A;  4CCJ A;  1IRG A;  1J9I A;  4L5E A;  4WXD A;  1BJA A;  2DFI A;  2FBK A;  4UB6 C;  5FO5 A;  4G12 A;  2JK3 A;  3G2B A;  2EV0 A;  1KU7 A;  2WA0 A;  4M3G A;  5AIP A;  4CCK A;  4G7Z F;  4AIK A;  3OR2 C;  1FOY A;  2VJ5 A;  2VC1 A;  3HEF A;  2CYY A;  3G1M A;  5IT9 K;  1HF0 A;  2L7F P;  2R5Y B;  2PN6 A;  1MMS A;  3I4N J;  2HYJ A;  1BN5 A;  1VQ6 I;  3I59 B;  2JJ7 A;  2A6T A;  4IX7 A;  1EA3 A;  3TW6 A;  4IOC F;  4CYC A;  1NH3 A;  2Q1Z B;  1SVO A;  3MD2 A;  4HV6 A;  4YG2 F;  2H27 A;  1TW2 A;  5E3M A;  3IV5 A;  1JT0 A;  1Z77 A;  2LBF B;  1PUF A;  1IDY A;  2AXT C;  1XPX A;  1XDS A;  3OYE A;  1ZRC A;  2D5V A;  1X1C A;  5IOY A;  1MH3 A;  2JQ7 A;  1P4X A;  3CP8 A;  4M9Z A;  4IHT A;  3CD6 I;  2HR3 A;  4IKF A;  1FT9 A;  2DA6 A;  1EH6 A;  2V1N A;  3QYB A;  5EG0 B;  2ELK A;  4O5V A;  1ENH A;  4HYE A;  4NUB A;  5J1R A;  4L9V A;  3WTU C;  1G59 A;  4L0Y B;  4A3E J;  2QVO A;  4BHB A;  3PIP F;  3H0G J;  5IP7 J;  1RIO H;  2HOS A;  3DQV C;  1HSJ A;  5J1U A;  2R0Q C;  2HS5 A;  2KRF A;  5B1B H;  3FM5 A;  2WAQ A;  4IXA A;  5L3D A;  2ELH A;  2VKD A;  3ELK A;  1Q1H A;  4FAS D;  4GYI A;  5FRN A;  3WGI A;  4AD9 A;  1SD4 A;  4ETS A;  1A6Q A;  1KU2 A;  3GEZ A;  3P5J A;  2EZK A;  4RBO A;  1LFB A;  3MKW B;  2VN2 A;  2VQL A;  4XM3 A;  5KNL A;  2K7L A;  3HHG A;  2X6X A;  2Q8K A;  1HKT A;  2VL8 A;  3LAP A;  1MBG A;  3OL3 A;  2XVC A;  4MEX F;  5DEQ A;  2IGN A;  1ZR4 A;  1JGG A;  2F48 A;  2Z99 A;  3FXQ A;  4CYD A;  4HV5 A;  2AHQ A;  2XC7 A;  2HFH A;  2HQ5 A;  4OAY A;  2QEN A;  4EJW A;  1FMV A;  1QQI A;  1ZGA A;  1VI0 A;  2W4S A;  1VQL I;  5ED4 A;  5HLG A;  5CQG A;  1HW5 A;  2QM3 A;  5EDN A;  3A1Y A;  1K7A A;  1YO5 C;  1HDP A;  4FET A;  4JYK A;  5FFX A;  3IL2 A;  3JW4 A;  1OKR A;  4P55 A;  4BQN A;  3GWZ A;  3H92 A;  4MFD A;  1N78 A;  4HSR A;  1UEL B;  3R0A A;  4AYB N;  4PFP A;  4AIJ A;  3OSF A;  1AU7 A;  3C2H A;  4IL6 C;  5LD2 C;  3WU0 A;  1C0W A;  1LDD A;  1UAA A;  2E34 A;  2R7S A;  1J7K A;  1LJ9 A;  3MMY B;  2K9L A;  1G3T A;  4HLY A;  4XLN F;  3WTT C;  5HS7 A;  3K4L A;  3ZQQ A;  3DBR B;  5C3E J;  5EGO B;  3L2R A;  5GTH C;  4YRV A;  3CCV I;  3D0S A;  1IJW C;  1A6I A;  1UMQ A;  4ENK A;  3KP6 A;  2EIM H;  3CDL A;  3HL2 A;  2R7U A;  4I76 A;  3RDI A;  2LSO A;  1BOA A;  3J80 Z;  3GTQ J;  3CCM I;  4MHG A;  2PI0 A;  2LMD A;  3NWT A;  2FJ1 A;  1JKP C;  1J59 A;  4G7O F;  3S8P A;  3UKG A;  4EM2 A;  1PP7 U;  1U3E M;  3ABM H;  3M9A A;  5DCM A;  2R7Q A;  3HKZ N;  3SZP A;  2Y31 A;  2W7N A;  3H3V K;  2WV0 A;  3S1Q J;  4RDU A;  1FP1 D;  1VQ8 I;  3AAF A;  4Q5S F;  2GA1 A;  3OOU A;  1FBQ A;  1KON A;  1A5J A;  1UZC A;  3TGN A;  5FFZ A;  5H20 A;  2LK2 A;  4R8H A;  4CSW A;  4IHV A;  2RN7 A;  1HXD A;  3S3N A;  2A5Y B;  2TCT A;  3FDY A;  2A05 A;  3MCZ A;  5ILS A;  2Q2E B;  2E2H J;  1XGM A;  1IUF A;  4PSX A;  1S6L A;  4X0G A;  3GZ5 A;  2E19 A;  1UHM A;  2COB A;  3H35 A;  1N77 A;  3SFI A;  1GXQ A;  1MGT A;  1KYZ A;  2Z9O A;  1ONV A;  2X4H A;  3GTP J;  4L9J A;  3OOP A;  3OY9 A;  2H8W A;  2EA2 A;  3KZZ A;  4UB8 C;  4NC8 A;  2IBD A;  3ZMS A;  2CUZ A;  2Y69 H;  4CCO A;  4Z6Y A;  1EKE A;  4QTR A;  5E3N A;  4LGW A;  4QPQ A;  1DGW Y;  3E5X A;  1ZK8 A;  1R58 A;  5H6R A;  2E5N A;  4ZDP A;  3QAH A;  2R7R A;  1JKR C;  3MKL A;  1G6N A;  2MLG A;  1TC3 C;  3Q9S A;  3L2W A;  3CES A;  3KP2 A;  2ESH A;  2M45 A;  2DDA A;  1TL8 A;  3BR0 A;  1OCP A;  1WZ2 A;  2QLZ A;  1R5H A;  4XRM A;  4MIM A;  3GTM J;  5FLX K;  2F5D A;  1U9N A;  3BTJ A;  3JCU C;  3LSI A;  3ZGK A;  1IRZ A;  1VF9 A;  1W5C C;  1Y8R B;  1U2W A;  2CQN A;  2L54 A;  5HOD A;  3CUQ B;  2ADU A;  3HOY J;  1BC7 C;  1D0X A;  4BAY A;  5FB2 A;  3WTZ A;  2IJL A;  3G71 I;  5FD5 A;  1VZ0 A;  3BZC A;  3VEP A;  5IYD J;  1Z9C A;  4XN0 A;  1AA7 A;  4D7M A;  4CZC A;  2A6E F;  3M1E A;  5B5E C;  5IYC J;  2H6B A;  3JRC A;  1XMK A;  4HX4 A;  4PK4 A;  2R5Y A;  3V8J A;  3F0C A;  1V5G A;  2DK5 A;  2W25 A;  4RLQ A;  4L5J A;  4I01 A;  1BJZ A;  2GXG A;  3ZR8 X;  3I59 A;  4ASN A;  2ME0 A;  4IQ4 A;  2XAQ A;  1W1W E;  3EPZ A;  3J7A O;  5J3L A;  1MD0 A;  3A0B C;  2QF7 A;  1QHH D;  3RQI A;  4FE4 A; 
#chains in the Genus database with same CATH homology
 1OCR H;  3X2Q H;  3AG2 H;  3ABM H;  1V54 H;  5IY5 H;  1OCC H;  2EIK H;  1OCO H;  2EIL H;  3ASO H;  2DYR H;  2EIJ H;  5B3S H;  3ABK H;  3AG1 H;  3AG4 H;  2EIM H;  5B1A H;  1OCZ H;  2ZXW H;  3AG3 H;  2OCC H;  3ABL H;  2Y69 H;  2DYS H;  2EIN H;  1V55 H;  3ASN H;  5B1B H;  3WG7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...