1YIJI

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yijI00
1VQ7I 3I55I 3CD6I 5GAEJ 4IOCF 3CCRI 4IO9F 1S72I 3PIPF 2QEXI 1VQNI 3CC7I 2OTJI 1ACIA 1HC8A 5DM7F 1Y39A 3CCMI 3CCUI 3DLLF 1VQ5I 1FOYA 3G4SI 4IOAF 3I56I 4UY8I 2H8WA 3CJTB 3CCQI 3J7YJ 2ZJPF 5GADJ 3CMAI 2ZJRF 3CCSI 1VQPI 1YJWI 1VQKI 5GAHJ 3CCVI 5DM6F 2ZJQF 3CCEI 2FOWA 1YI2I 1YJNI 1QA6A 2NXNB 1VQ8I 2OTLI 1YHQI 1VQ4I 2K3FA 3CCLI 2E34A 1YITI 2QA4I 1VQOI 2JQ7A 1MMSA 2E36A 3G71I 3CMEI 1YIJI 5JVGF 1FOXA 3PIOF 1VQMI 1YJ9I 1VQ6I 1VQ9I 3CC2I 4V19K 1FOWA 3CC4I 3CF5F 3G6EI 3J7ZI 3CCJI 2E35A 5GAGJ 1VQLI
chains in the Genus database with same CATH superfamily
1HKTA 1NK2P 5ED4A 3TO9A 1O57A 2HXIA 1JT6A 5LGNA 1D0YA 1KQ9A 1R49A 1BR2A 3ML6A 1V5GA 5B66C 4XL9A 1QGPA 3JAMZ 3OYAA 1VQ5I 3JRDA 3HZJA 4A3DJ 4Q5SF 3HRTA 2XKPA 4JK1X 4AYBA 3A01B 3CTAA 1T6SA 1UMQA 2ELHA 3F8BA 5K5RA 5EF6A 3ZOBA 1KQ0A 2H09A 1WI9A 2ECBA 3DBHB 1FBSA 5E1WA 1VQ7I 3MKYB 2W7NA 4L0YB 3S1NJ 2DJNA 1XSDA 5GTIC 4MGRA 3K1NA 5D8KB 3HHHA 4AIDA 3CCUI 1YFHA 3RZDJ 4UY8I 2R5YA 3A0HC 4E7JA 3FKJA 2K5CA 2KHMA 3TGNA 2NS0A 3OMYA 1G4DA 1YX3A 3PFYA 2XGDA 3HGYA 4XLPF 1QBJA 3VSLA 4HDVA 1GV2A 4ANJA 3WTXC 4EVIA 1SFKA 2ZXWH 2XGCA 1YJ9I 3H9GA 3ZN0A 2COBA 4HOBA 1J59A 1K6OA 3QYFA 1P6RA 3DQVC 4UV8A 1ZKGA 2HOAA 1U78A 4IHWA 2GIVA 4DBRA 1P2FA 2JA8J 2LP0A 5JR3A 5HDNA 3SXYA 3OYKA 4XRSA 1WWXA 4CCNA 1N78A 1Q1VA 2ELKA 2JRTA 2A3SA 4M3GA 4BNCA 2LBFB 4O5VA 1D1AA 2BXYA 4OAZA 4JOMA 5GAHJ 3JRIA 2ZJQF 4PSWA 3HBLA 3ZR8X 2M4KA 2DOAA 2XAFA 1R4NB 4E6KG 2FF4A 3F3XA 1OCZH 3DF8A 5ICCA 3E3VA 2UXXA 3A2KA 1U3EM 1OCRH 1NTCA 1Z05A 4PGHA 2BVLA 2JRMA 4BQOA 1ORKA 5C44J 4RDUA 3L2WA 1PJRA 2IT0A 4J19A 2QYOA 1IRGA 4UVCA 4V2GA 3LA2A 3I4NJ 1MMGA 2V9KA 3DKWA 4HV6A 3R60A 3RPUA 4E7IA 2OUMA 5F08A 2IS2A 1IXCA 2EZLA 3QYEA 1T33A 3JSPA 1FIAA 2Z2SB 5H6RA 4ZYAA 4ZDLA 3K70D 3A1YA 3FXJA 5FLXZ 3TOBA 4ZTJA 2IS6A 2XAJA 2BEOA 2ZB9A 2MG4A 2A5YB 1FWZA 3AKZA 4Y33A 3FHNA 1TP4A 3O2PE 5ICFA 3C18A 3V8LA 2BY3A 3HEFA 4DGWB 1WJDA 4CCOA 1DP7P 5JLXA 1R4MB 3Q0VA 3K4MA 5IP6A 2QUFA 5FD5A 3CCEI 1H9TA 2CQNA 2QGUA 3BTJA 2UZKA 4ENKA 1H0MA 2K3FA 4NBQA 3LA3A 3KEYA 5B3SH 2PJRB 3FF5A 1Y56A 2GA2A 3FXKA 3R0JA 3VYSB 2L9VA 4IX7A 1TWAJ 4RB0A 1IAWA 1MNEA 2DDAA 2X48A 3UKGA 2X1EA 2Y75A 2YUSA 5JI6A 2CV1A 1SVLA 2X6XA 1WQ2A 4CO8A 2IEKA 3OOUA 3PSFA 2HTSA 5F6FA 4GGGA 1AKHA 2L9SA 3FM5A 4WK8F 4UV9A 3W2AA 2HQNA 4BACA 1OQYA 2OU2A 2MYSA 3BTLA 5HLTA 1ZG3A 3NQOA 2VOOA 2DODA 2XRNA 2HNHA 2X6OA 1MIJA 5LHGA 2O3FA 2LR8A 1FOKA 2VUMJ 1Y6IA 3KYDB 4IHSA 1P9QC 5BMZA 2EV6A 2DFEA 3H3UA 3LSRA 4I6ZA 3OIPA 2FD5A 1CF7A 4OMZA 3J80K 4M3FA 5IY5H 3OYNA 1Y0UA 5J47A 3WTSC 3KYCB 4OINF 1TZLA 2NOJB 4PDKA 1U5TA 3K70C 3L9FA 2NYXA 5E3NA 1W4MA 2M0CA 3IV5A 2IS1A 4DYRA 1VFCA 3EYIA 2HQAA 4M3BA 3NWTA 4RB1A 1PYVA 4P9UA 1R1UA 5DM7F 5DD4A 5EGOA 1SFEA 1LFBA 1DQUA 1JHFA 3SJMA 1RC9A 3RKXA 3LFKA 4A5NA 4EATA 1QA6A 4OIPF 5FO5A 2CRGA 3CJRB 4UUSA 3CCLI 4Y17A 3QYBA 3KEOA 1J2XA 2R7XA 4B44A 2W24A 4BXUA 3J81K 4B8XA 1LVKA 1BW6A 4MNUA 3EDPA 3DTIA 4A3KJ 5F27A 5FLXK 2EZKA 1K4SA 4G12A 5LHIA 2EINH 2I8DA 3TEDA 2L7MP 4IRHA 1W36C 3ZXSA 1HA8A 3M9AA 4C3HJ 4DZJA 5J1UA 1YQAA 3GTMJ 4YRVA 1N25A 4RGXA 5LRRA 3BTCA 2D45A 3G1LA 1BC7C 2GLOA 3HJEA 4BJ5C 3HL2A 3RI4A 2F2EA 1O7FA 2G7UA 3L1PA 1WJBA 5J8FA 1W0TA 3F9KA 3CCYA 3BJOA 2BXZA 4OIRF 1WFXA 3Q9SA 5GP9A 3TDZC 3PJRA 1S5LC 1LEBA 1VQLI 3VFZA 2WAFA 4HLXA 4Z2YA 2Y9YA 3NEUA 3LSHA 4BQQA 3VOEA 2LG4A 2VJ5A 1K4TA 4MIMA 3HB9A 3TW7A 3IKTA 1FC3A 5E1ZB 3U1KA 3H5AA 4L5IA 5GPCA 3WHBA 3EUHC 4I2OA 1F5TA 3GFJA 5GADJ 2ZXIA 3FBIB 1PP8F 2IS4A 4GDFA 3WU2C 4MQVA 1KYWA 3L2UA 2E19A 1XDUA 3L00A 2KL4A 5K5OA 1VQMI 2V79A 2CQKA 4ASNA 2RNGA 2VC0A 4N4NB 3HUGA 2E35A 1YW7A 3BG3A 4BKXA 2G0EA 1C0WA 1H8AC 1ONVA 2JJ7A 2VKHA 2YPRA 2JA7J 4IZZA 1FP1D 3ZMUA 3RYPA 1KA8A 4I99C 3KE2A 4Q4ZF 2E7XA 2M7BA 2STWA 5ILVA 3J7YJ 4A3LJ 2Y48A 3REOA 2KRCA 3ZMTA 2HZTA 3HG9A 2EQRA 1MMSA 5DCFA 2CMPA 2G7HA 2IA2A 2PMZN 1WCMJ 3JTHA 3TP0A 3GTPJ 3WU1B 5GTHC 3W2WA 1DGWY 2HGCA 4ENJA 4KFCA 2VKEA 2MH9A 3ZQHA 2GM4A 1X2NA 4M74A 1MJAA 1S7EA 1SD5A 2E71A 4FE4A 3F22A 5E17F 3AG2H 2W82A 2A69F 4FCYA 1D5VA 2WB1N 4JP0A 4RGSA 4KN4X 1CF7B 3M3YJ 1TTYA 4K2EA 4E7LA 5IT9Z 2QLZA 2NS7A 2EWNA 2XF5A 2ME6A 4CUGA 5F0CA 3KP4A 4DIQA 2CS3A 1BJAA 2IAIA 2E2HJ 1MBHA 4RAZA 1ZH5A 1MSEC 1U5TC 3MQ0A 5IOZA 4A3BJ 2KT0A 2LKSA 3WG7H 3GEZA 5IT3A 1ENHA 1XG1A 4F55A 3TKYA 3W6JB 1G3YA 5LEKA 3OYFA 1ZG5A 2NVQJ 1IN4A 2I5UA 2L7FP 2LLKA 2R7FA 5C3EJ 3GLLA 5M3MJ 2H27A 1I50J 2KJCA 4RS8A 2NVUB 3E6DA 3HOWJ 4LJZF 2VN2A 3ERED 2STTA 2M4GA 2VXDA 1Z7LA 1GVDA 2FJ1A 3JREA 1MBKA 3MWMA 2A6HF 1FJLA 2A5WA 2CW8A 1BOBA 1LKXA 1JGGA 5EZGA 2L3DA 2LYCA 3H0GJ 2VL8A 5JLWA 3LFUA 4Y13A 4FTHA 5BPDA 3HIFA 2QZ8A 5M5WJ 1V5FA 2A68F 2GXGA 1XPXA 3CCSI 5CVVA 5FLMJ 4RAGA 5L3FA 1J7KA 4XLNF 2CW0F 4ZDOA 1WKMA 3CDIA 1ZREA 3I59B 3GTOJ 2MC4A 3KP6A 3QOPA 1T39A 1TW2A 2K85A 2DA3A 3G73A 1ETWA 3MZYA 2XIGA 3FXMA 1FYKA 2B7EA 3EYYA 1B4AA 2WC2A 2R7UA 2QKMB 2JA2A 3K69A 2H6BA 3WGGA 2Q8KA 5HDKA 3JW4A 2P5LC 2Y0SN 2FQ4A 1QHHD 2V7FA 4EM2A 3M07A 1BJZA 3RZOJ 2BHZA 3VWBA 1TQMA 1K78B 3BOQA 2IVMA 4RA2A 1UZCA 4G8XA 2R5YB 4XMYA 3ZQCA 4TV7A 2R93J 3FZVA 3Q9VA 2CV2A 2RKHA 4LIVA 5FFXA 4LD5A 1JJ8C 1F1ZA 4U7BA 4KT6A 3BWGA 1Z6TA 3W6KB 2P81A 5H6QA 2CQXA 3ABUA 4HBLA 4GYIA 2CJJA 4G7HF 2OAZA 3S2HJ 1MBFA 3I53A 3JSOA 2OCEA 1ZQ3P 2GZWA 3A02A 1UFMA 1XGMA 3CZ6A 3LWFA 1A31A 1FT9A 3SDGA 2VPLA 1QO0D 1DPRA 5FFZA 4EJOA 1R71A 1G6NA 3OYMA 1QHGA 3I4PA 4OOIA 5HDGA 3CC4I 1Z7UA 4HF1A 2FBKA 2KDOA 2ZSHB 1HKSA 2AS5F 1RKWA 5J1YA 3HYIA 1I1SA 2X1DA 1AA7A 1ZRFA 5IP7J 4R8HA 2ZJPF 2JK3A 2HPMA 3ZPLA 1IW7F 4LB6B 5F0HA 2XC7A 2CGPA 3CP2A 5JFRA 2QCOA 4CYCB 3WTUC 2L54A 4ESFA 4BBSJ 2O0YA 1LUJB 4XNFA 2VBXA 2M34A 3CP8A 1Y1WJ 4YEJA 3G6EI 4XM3A 2L5QA 4M72A 2WAQN 2OC6A 1BL0A 4XKBA 5HNHA 2UV1A 4XR6A 1IV8A 3CCMI 2LC2A 4O6JA 3TMOA 3DBRB 3I56I 2ECCA 2P0WA 1S7AA 2V6CA 3VB2A 3CCQI 1XMKA 3DPUA 4I98B 1YE9A 1OR7A 4HX8A 3CC2I 4YFKF 3CF2A 3BR3A 4BEHB 2HOSA 1JXSA 4PSXA 4IQ4A 5CPRB 1T08B 3F6OA 2KRHA 4WWCA 3I3LA 2EIJH 2YR2A 4NQWA 2VI6A 2K9LA 2GA1A 1B6AA 3K1PA 4BY7J 1SFUA 4B3AA 5EJCA 1A6IA 2YS9A 3L7WA 3DPLC 4HX7A 3KX2A 4C2TA 1D8JA 3TL4X 3F8FA 1XD7A 2F5FA 5EGOB 4AIKA 3KP2A 3LSKA 4ON0A 3SZTA 3D1NI 1N75A 3ZGKA 4HDUA 5FD6A 3BP8A 2M45A 3GFMA 3OOPA 1QRYA 2L7KA 2VB6A 3G2BA 2V1XA 1IDYA 4PGGA 4F93B 5M3FJ 5DEQA 4BAYA 5K1YA 1BIBA 3JAMK 1MNDA 4U0WA 2H8WA 4ZH4F 4XQFA 1B1BA 3A03A 4XKWA 1XGNA 1YRNA 3GZ5A 1I39A 2A6EF 5DM6F 1H88C 5LFAA 4X1EA 2NXNB 2R7ZJ 1QVUA 2H1KA 2XHKA 2W84A 1ZGJA 5FKNA 2W85A 5KAFC 3KP7A 2MSYA 2CQ7A 3DPTA 5J6XA 4G94A 1XCVA 2DMPA 1GDTA 4MEXF 2UUZA 1X4OA 3AL0B 1IZ1A 3BR2A 4AVPA 1YYVA 3C2HA 4ZC3A 1OFCX 5HLHA 1Z67A 3WODF 1LDKB 3OR2C 1EKEA 1T0FA 2GIZA 3JRCA 3RPQA 1LDJA 1MSFC 1J9IA 4Q47A 1ON2A 1YITI 2WA0A 1OYIA 3H1CA 1RR7A 3NRVA 1SD6A 2E1CA 2YU9J 2DQLA 2MH2A 2XGEA 3MKZA 2IP2A 4UB8C 4RAYA 2GAUA 4JX4A 2QSHX 4NC8A 4ABZA 2GXBA 2DT5A 4I02A 4G6TB 3ABMH 4UUSB 1HW2A 1B72B 4D5FA 1SAUA 2VXZA 3ZQGA 4QSHA 3WTYC 4PJ0C 5BPIA 2FMYA 2RDPA 3T8RA 2VKVA 5J1RA 5HLGA 2DO7A 1WPKA 3QU3A 3GMEA 4C30A 4XBFA 1TL8A 5CJ9A 2ZC2A 4HF2A 1AHDP 3IAS2 2HQ5A 2DA6A 4NHJA 2DAOA 2DA7A 4P55A 4L9VA 2R7SA 4MQ9F 3SFIA 2PX9A 3WTTC 6PAXA 1KQ8A 1Z21A 5L3BA 1FTZA 1SFOJ 3FISA 3U1DA 3RJPA 4IOAF 2FBHA 4N0BA 1P7JA 3CLQA 2HDCA 1FIPA 3CD6I 1UG0A 1VI0A 1BI3A 5L3DA 2ZSIB 1IN7A 2Q2EB 3F6VA 1HXDA 1G2HA 1ZAOA 1ZARA 2ETHA 2VODA 2E5ZA 4A12A 1HDDC 2F4IA 4LB5A 3FK6A 4BHBA 1WJCA 1D8KA 3K1MA 2K3PA 4HG2A 2FNPA 1BBYA 2LFBA 4KIGA 4Y52J 1VTNC 4I0AA 1YS6A 4D7MA 2V26A 4AU7A 2BVMA 1DP3A 1SVOA 2FU4A 2LD5A 4LIUA 3TOAA 2CUFA 2QA4I 4C3JJ 4YIFA 2XROA 2DA1A 1Z0XA 3MCZA 2RC4A 5KCMA 1VQ9I 1JUSA 4M6VA 4KUMA 2DMQA 5FROA 4B47A 3OWTA 2R3SA 1VF9A 3BR1A 4M6XA 3RYRA 1I6XA 3FDYA 4QPOA 2R7TA 2JUGA 3BROA 3FKIJ 4U0YA 2K9QA 5CKTA 2QF7A 2VONA 2LTPA 1ZHFA 3UR3C 1KU7A 4S04A 3ROUA 3K4BA 4WXHA 3H35A 2DA4A 1BR1A 1YRNB 2LREA 1UJ8A 5J8CA 3TO7A 2EZIA 4BE1A 2PMHA 2OTLI 2GOXB 1VQ8I 1R58A 1OYWA 2WADA 2Y2ZA 1HKQA 4IRGA 1JUPA 5HS8A 4RLFA 4PCQA 3GVAA 2LDUA 3N4MA 1UELB 3S93A 2JVHA 2L4AA 3DKXA 3EUKL 2PI0A 1WRJA 3IRQA 4H4KC 1B72A 2HOTA 3F8MA 1MMDA 1ZN2A 3IHUA 2DMTA 5ERIA 2F4OB 2MLKA 5HOOA 2EJRA 3OIOA 4XONA 3T1BA 1F36A 1YW9A 3F23A 3F72A 1S29A 3FXQA 5HNFA 4XIDA 4B4CA 5L3CA 3DBLB 4HF0A 5KK1A 2HZDA 1ON1A 2V4JC 4N9HA 1SMTA 2M30A 3CDHA 2ZO4A 2VC1A 2ESNA 4XRMA 4IRIA 2BE5F 1OISA 2R7DA 1B9MA 2W4SA 4LMYA 3TO6A 4CCMA 5CQGA 1B8IB 3C3WA 2PN6A 1ACIA 1T98A 3F0CA 1RETA 2VKDA 3HC7A 4JYKA 3GXOA 3M1EA 1AKHB 1WH5A 3HTUA 3PNTA 5K5QA 3CDLA 1AOYA 1O3RA 2HKOA 4L9NA 4N4OB 3VSKA 1HF0A 4FX0A 1RUNA 4EQQA 4CCLA 1KZHA 3C2BA 2W00A 4AC0A 3E6MA 2MD0A 3HOYJ 3FMRA 1XMXA 3IH4A 3CF5F 3K9TA 2MABA 4FE7A 2P5VA 2XRLA 1S72I 2CQQA 2K40A 3CCRI 2DYRH 2E1MB 4EJWA 3HM5A 1FNNA 2ELJA 4A5MA 4R79A 2IW5A 1T95A 4PJLA 2BGCA 4A0ZA 2MGQA 4DQ2A 1EF4A 3D5RC 2YX7A 3RCOA 3S2WA 1H9GA 2VJ4A 1Y8RB 2QENA 2DQRA 4BS9A 3GWZA 5JVTA 2PMUA 4P96A 2HR3A 3KFWX 1SMYF 3OSFA 1W7PD 2MW8A 3BZCA 2CV0A 1JT0A 3J7AO 2FA5A 4KICA 4QIWN 1U8BA 2VQHA 3DU6A 4G6DA 3S17J 4XN0A 3WTWC 1YX5A 2MLGA 3V7CA 4XSXF 2L9RA 3P7NA 1NHAA 5L3EA 3KIOA 1P7IA 2H8RA 2EK5A 4UUVA 3DXJF 4B3XA 3IC7A 2VBZA 1E3HA 4CZCA 1ZG1A 2EV0A 1B8IA 3HOUJ 2L7ZA 3L2CA 2IA1A 4HAMA 3OL4A 4GO1A 2O6GE 2FUG2 2DT6A 3LQRA 3FX3A 4II2A 2DOFA 1JGSA 4ENNA 4JX5A 3LQQA 4MEYF 3E0JB 2L4MA 1UHWA 1Z91A 4KIBA 4RLQA 1RESA 3E5UA 5CVRA 3C7JA 1E0EA 3S1RJ 2RVCA 3CUQA 4XKCA 2X6YA 3W2VA 2GQQA 2FX0A 2JSPA 3C2GA 3K4KA 4LLLA 2Z1DA 5C4XJ 2LKPA 2VE8A 2ZMEC 4J01A 2JA6J 1KYZA 5D6EA 2RREA 1T2KA 2KMUA 3E7LA 2F48A 1IUFA 3L2VA 2LNBA 2OJED 4BH9A 4L9TA 1ETKA 1RRJA 4A0XA 5M5XJ 2XAQA 3M8FA 2HDWA 1Y39A 2Y30A 2H1LA 2LRDA 3DLLF 2NAZA 2CYYA 4QTRA 1IV6A 1A6QA 2FOWA 3FXRA 4W1UA 3P9CA 5EYRA 3MAJA 2Q1ZB 1Y8QB 2ZFWA 1FMVA 2KRFA 5D5XB 1QZZA 1K6YA 3OY9A 1S6LA 3HSEA 3DWLE 4BUPA 1L3LA 3KEQA 4YFXF 4N9IA 2WY8Q 5E18F 2EFNA 3S1MJ 3HOXJ 1ZGWA 2FRHA 2HWVA 3QP5A 3QWLA 1WZ2A 2DU9A 3K4NA 1J5YA 2ZMEB 4II3A 1TT0A 1YOVB 5LEJA 1IXSB 5HVQC 4IHVA 5IYBJ 2JZYA 2EFWA 2R7OA 5B1BH 1WHUA 2HTJA 4OIQF 2L9NA 3QOEA 2XV4S 4L0ZB 2EB7A 3PFIA 4A3EJ 2EA2A 5L3GA 5B1AH 5D4RA 1E2XA 2J5PA 2VPRA 4YIRX 3KZZA 3ELKA 3PL8A 5A2QK 2JSCA 3IAM2 2X4HA 3M8JA 3ZQLA 1O3TA 1Z3XA 3BT9A 2OTJI 2Y0SA 1IDZA 2V9VA 3I64A 5J4YA 3BR0A 1L0OC 1HLVA 2QQBA 3GUDA 3LSPA 4Q48A 3ABKH 3BCAA 1OPCA 2Z99A 3HSFA 2F4MB 2QM3A 1MKMA 3ABTA 3OS1A 1MBEA 3GX4X 2JQ7A 2HDDA 3EETA 1TC3C 2BV6A 3ASNH 2QBYA 1PUFA 5H2FC 1APLC 2IGOA 3B6CA 2BZTA 4HQMA 5D8LB 2X9DA 2PG4A 2IPQX 3ZRGA 3LAPA 5DD8A 4EMSA 2DLLA 2QQ8A 4KA4A 1KONA 1MJBA 3O3KA 4ITVA 3HOZJ 3BJ6A 3EQLF 2OF7A 3M1CA 3E5XA 4LGWA 2GXAA 2Z16A 2X1CA 5CLSA 3OS0A 2X85A 4BQAA 1GLNA 1IF1A 1W36D 1V54H 3S3OA 1X3ZB 3RKQA 2E36A 2DCEA 3Q0UA 4FQGA 1A04A 5HS7A 5KNLA 4M73A 5JVGF 1S8NA 4C9YA 3HRUA 4E7HA 1U0JA 5TGTA 2DN0A 3V8JA 5IP9J 3OYHA 1WGXA 4PFOA 3EUAA 2FSWA 3J81Z 2OPTA 2MBFA 1K7AA 1SANA 3K6GA 4LG3A 4XORA 3GZ6A 3HOSA 1HC8A 1USTA 1V3FA 3IP4B 3LL7A 3QP6A 4CCKA 4D0PA 4KMUX 1BI0A 4IL6C 4MTEA 1T56A 5DV5A 1JTXA 4YG2F 3FXLA 3BY6A 4O3MA 2XF7A 4P5OA 4PJJA 2BY1A 1JTYA 2A6TA 2IGMA 2M3AA 3FXOA 3LSTA 2ZNYA 3JR9A 2R92J 5EZHA 4UVAA 4FETA 3A01A 1XGOA 2O9LA 1PDNC 2R7QA 1X1DA 2M2EA 4F91B 4OAYA 1OR7C 1FOYA 2XDVA 4IPAA 1JKPC 2H94A 4HNUA 1GUUA 3F8NA 4BJ6C 4G7OF 5K7ZA 2DA5A 1AWCA 1I3QJ 4KT5C 5E3MA 3ZQ7A 1DUXC 1OMIA 2YX4A 2A61A 2KIUA 4RAFA 2BY0A 1XSVA 4MLOA 5B5EC 3BR6A 2QVOA 2LK2A 3SFZA 2K7LA 4X0GA 1TQIA 1BIAA 4EV0A 3CESA 4FT8A 4AVZA 1WJ5A 2RAEA 1X2MA 4HSRA 5LHHA 2AQFA 1Z6RA 1G8XA 3CMAI 3SQNA 3ZMDA 1IUYA 3FMQA 2P7CB 3OYEA 1PUFB 2KIMA 3P5JA 1G3SA 4AIJA 1ETYA 2RNJA 1X4PA 2D2WA 2DK8A 3BTIA 1O3SA 2OA4A 5DS9A 1ETVA 3ONQA 3U2RA 3T5XA 1WJAA 2PJRA 1HQCA 1IGNA 2V1DA 1GV5A 5F1JA 3HTSB 3I59A 2LKXA 1BN5A 3IWZA 1I5ZA 2PMZA 4M3DA 3KLNA 4BGDA 4EGYA 2VQGA 5LRSA 1X1BA 2PEXA 3CLOA 2ESHA 4PJMA 4E7SA 2DMNA 1SC7A 2L2OA 2D1VA 3IWFA 1U8RA 2IBDA 4KISA 3I0TA 1OCCH 2QBYB 2XAUA 2AHQA 2HYJA 4XSZF 3K10A 2WY7Q 1JKQC 2NVYJ 3E5QA 2M87A 2OZ6A 1UHSA 3KP5A 3WU0A 2PQ8A 3K2AA 2EIMH 3GF2A 4JBAA 1ZTRA 3S8PA 4U0VA 4BE0A 3VEPA 4RMNA 1EH6A 1KGSA 3SEQA 3BC8A 1LQ1A 2VJJA 4E70A 4CXFA 3ASOH 3O6BB 2RQQA 3QAHA 4DNCA 3HOTA 2CFOA 3L2QA 1ZGAA 3HHGA 3PNVA 4BEHA 1BI2A 1FY7A 2AXTC 2KZGA 2Q2EA 5JHUA 4IHYA 1W7PB 2P8TA 3GZNB 1GXQA 3DEWA 2VBYA 4OWRB 2D5VA 4DW6A 1XN7A 3GTLJ 2CUEA 5CVJA 4MFDA 2DBBA 2IJLA 1R6RA 3N05A 1QPMA 4RGUA 3PM1A 2M9HA 3OV8A 1V4RA 1SD4A 5D6FA 1HSTA 2KQRA 1YG2A 3U21A 5F04A 1QVTA 2CSOA 2M7AA 4QWQA 3JRHA 1MMAA 3HPHA 2Q0OA 3KZIC 1IN5A 5FRMA 1T38A 2HYFA 4ZTFA 1G3TA 1KU3A 4B1RA 4OIOF 1OCPA 4R1HA 2BY2A 3HPGA 4NC7A 1ZRCA 3FM3A 2OQGA 4LFUA 5EEAA 1HSJA 5AIPA 5GAGJ 1XCBA 1S9HA 3CQZJ 2DA2A 4BY1J 3RKYA 3KLOA 3RDIA 2JPCA 3LNQA 1ZLJA 3ABLH 3CMMA 1HW5A 3QODA 3G4SI 2B63J 4XLCA 1I27A 1XMAA 2O7OA 2Y69H 4EM1A 1ZLKA 1VQKI 2Y9ZA 1WI3A 2PBIA 2E7WA 4XOTA 3V8KA 3BQYA 1K79A 2HPIA 1P4XA 3F8CA 4HYEA 2K9SA 3K4CA 1ODDA 3Q0WA 3ULQB 3CUOA 1V5EA 3DKYA 4KIFA 4MFEA 4PJNA 2DXIA 4L18B 1R23A 3LAJA 4A0YA 4IXAA 4U87A 2WV0A 1OYYA 3GFLA 1QQIA 4BU2A 1UB9A 5TISC 4A6EA 3G1OA 5ILSA 4RB3C 1PP7U 3TQNA 2EILH 4KYWA 1J75A 5LLQA 2JVGA 3ZP5A 5IYDJ 1YHQI 4EJUA 4I01A 3HDDA 1BM9A 3DLAA 2HS5A 2M8EA 3U9GA 2XSJC 3KPHA 5A2QZ 1DDNA 3PNYA 1U6GA 3FBNB 4BQNA 1FYLA 1DU0A 4CH7A 4FX4A 1D3YA 1RZ4A 1UG2A 4D1QA 4PK4A 3H92A 3PSIA 1TBXA 1Q1HA 4NNJA 3SZPA 3FXUA 4IQJA 1D1CA 3W3CA 1YIOA 3ECHA 4BXFA 3CC7I 1PUEE 1P92A 2KP6A 4HW0A 1TLHB 1IN8A 3B6AA 1Y1VJ 4UNOA 4DOZA 1W5CC 3ECOA 2FBIA 5C4JJ 4PZJA 5CYVA 4CGZA 3ZMSA 2GBYA 3DEEA 2EBIA 2D1HA 5HODA 3MZ8A 2KKOA 1CQTA 4MO7A 3K4LA 1R00A 3RTRA 1H89C 2V1NA 3OSGA 2OBPA 1HW1A 1F9NA 2Y0MA 1FZPB 3KZYA 1KU2A 1X58A 5F1RA 3OYIA 2MA3A 4M3EA 5E8GA 1Z9CA 5DUKA 3SHFA 1EA3A 2JN6A 1R5ID 2FEZA 4YFNF 3I9V2 3I54A 4AD9A 5E79C 4H0EA 5TJJA 2DT7B 4CA0A 2ZBKA 1IXRC 1QNTA 2YSRA 1Z77A 2Z3YA 3V42A 5IOYA 3P9IA 4UUTA 3ZN1A 4M9SA 1Y0NA 3ESWB 4DYQA 1ULYA 1ETXA 2RQPA 3BPXA 2FQ3A 3HRSA 3I5UA 3ZQIA 2QEXI 4LG0A 2O5RA 3A4CA 3MD2A 2VE9A 5D5WB 1HCRA 2F5VA 4C2MJ 3O8GA 3E97A 5DUIA 1IC8A 4XKVA 1W0UA 4ZZDA 4E4HA 5ICEA 2WTEA 4EJVA 2EH3A 5D4SA 1JUMA 2V9PA 2K27A 2JWTA 3K0LA 4BHPA 3WGIA 4BHCA 5K7HA 1MH3A 1E3PA 2KIQA 1O3QA 3P9KA 2WV1A 3RQIA 2J5OA 2K9NA 4KITB 2QSGX 3J80Z 3JCUC 1D1BA 3S16J 2TDXA 4L9JA 4B43A 2ADUA 2F5DA 4QLCU 1E3OC 3MMYB 2O61A 5TRDA 2DTRA 1IRXA 4M71A 3QU6A 1YTYA 3R61A 3JRBA 4NC6A 4AIHA 2KLOA 2E1MC 2ID3A 1QZYA 5FB2A 1LVAA 1UAAA 3E1SA 3IUOA 3RQ4A 5EEHA 4V2FA 2OV7A 2CU7A 4IF4A 5F64A 5DTDA 2IRFG 2KDZA 2PFBA 1ZR4A 1SAXA 3VYTB 3PO2J 4KJZA 3BZ6A 3ZMZA 4IHXA 3ZCOA 1DPUA 4MHGA 3IL2A 5FJ8J 4EGZA 2NNYA 3Q5FA 4WF2A 3LOCA 1MGTA 3GFIA 2HFHA 2JTVA 1S3JA 3GW2A 3LSMA 4LLNA 1MJ9A 2HU9A 4CZZA 1R1VA 3S15J 2XPVA 3R6SA 1CGPA 3BR5A 3KYLA 3OYDA 2XPWA 2KPMA 1J09A 4A3CJ 2XASA 1O4XA 3AAFA 1MDMA 3CUQC 1KU9A 5E20A 3PUBA 2K9MA 4P9FA 4XLAA 4CICA 2NVXJ 1EV7A 5FKMA 1X1CA 2E34A 2VT2A 2M5WA 2RGVA 2TRTA 3L2RA 4JX6A 4DYCA 2F5CA 1B9NA 1FSEA 2Z9OA 3OYGA 1DU6A 4A2UA 3I4MJ 3MVPA 2JMWA 4AWXB 5DCMA 1HOMA 2FMLA 4DBQA 1RI7A 4HV5A 1W1WE 1VQNI 1TNTA 4A3GJ 2GOMA 1YLFA 1YW8A 3G1MA 1R1TA 3H3VK 2EPFA 3H36A 1WSUA 1O7LA 2VQLA 3MN2A 4WCGA 4I09A 2VJIA 1ZK8A 3KCCA 4HEA2 2WBMA 1OLTA 3FMSA 4CDGA 4ZJZA 3M4OJ 1MH4A 1R22A 2JPBA 2HXOA 1SEUA 1NG7A 1MNMC 3GYHX 4A3FJ 4HRIA 1WJFA 1MBGA 1G3WA 1ZR2A 4PUSA 4XOPA 1K78A 4X6AJ 4LG0B 1LJ9A 5FGMA 1TQPA 2UXNA 1MW7A 3FK7A 3WHCA 3EUHA 3FWEA 4RM3A 3JTGA 1G59A 4PFPA 3TBIA 3EPZA 2H6CA 4QPQA 4V19K 1ZELA 1WJEA 3LSJA 3E6BA 4LK0F 2EFPA 1VNDA 3OYBA 2L02A 4ESJA 3QRFF 2QSFX 2KJBA 2RV8A 5GAEJ 3PQJA 1IJWC 5BS6A 4B48A 3HGGA 3RKWA 3RPUD 1YO5C 2AO9A 1JI8A 1P4WA 1BW5A 2DJIA 2VASA 1M1EB 4AUXA 4BE2A 2JUCA 3HKZN 4C2UA 2BHYA 3CO7C 3MFKA 1FYMA 1A35A 2MD5A 4D5CA 3M7GA 3AG3H 1IRZA 1TT5B 1XC5A 3NWSA 3OR1C 3DTKA 3G71I 4BJTA 4NUBA 3S3NA 3KP3A 3ISPA 4BXXJ 5FKLA 3JRFA 2XGXA 1OJLA 5HLIA 4CYCA 5HS9A 4LOCA 4GYGA 2VQCA 5EEGA 4A69C 2Y31A 3R0AA 2X0LA 5JHFA 4EJTA 4AM3A 2DK5A 3H3ZA 5LD2C 3SZGA 1R9TJ 1RPWA 2XUBA 1POGA 4ESBA 2HVSA 4EEFG 4ZYHA 3CO6C 2NS8A 4HPQA 2W25A 1SD7A 2DPUA 2F6CA 3SYTA 3DU5A 3K7AJ 3HUGB 4B09A 1MZBA 5DCMB 4AYBN 1QU3A 5M5YJ 4MTDA 2EFQA 2K4BA 4LLGF 2UWMA 1FMWA 1FEXA 4DZPA 1W5TA 4W97A 3KETA 3F21A 1U9NA 1RIOH 2ISYA 2BOLA 4HQEA 2DFHA 4ZYGA 2EV5A 4GCVA 1UHMA 5LGUA 3S3MA 5D5VB 2O8KA 4KDPA 4BYYA 1JKOC 3J7AY 3FHZA 3NARA 4XK4A 2OD5A 2QWWA 3CCVI 4FHTA 3WE3A 5KVRA 5K7FA 3W6VA 3PUFA 4BBRJ 3BG9A 4XLFA 1Z1DA 2COMA 2QKLB 1ITYA 1FOXA 2CUJA 1BOAA 2GWRA 3CUQB 1FOWA 2E2IJ 2CUZA 1LFPA 2LBFA 1HBXG 4XLEA 5E1XA 2LY1A 1SFXA 2R5ZB 3A0BC 5KHDA 1ZYRF 4UVBA 3TDUC 2QQ9A 4IHTA 4IOCF 2XVCA 2CO5A 4KN7X 2IA0A 1LFUP 2CG4A 4M9ZA 1FBQA 5EG0A 2IGNA 2DFFA 1REPC 5CVIA 1RNLA 4Y7NJ 3GTKJ 2VT3A 1YJNI 1X19A 2ZMEA 2XF6A 3BQZA 3BG5A 3Q3SA 3PQKA 3S1QJ 1XSXA 2FOKA 2LY2A 4Y15A 4DJAA 1FPQA 3HRMA 2V6EA 1VQ6I 1P4AA 2WAEA 2ICWG 3T8TA 2NRAC 2OCCH 4GFBA 4LK1F 2DPDA 3D5LA 1QZEA 2LF8A 2XPUA 3HXLA 3L09A 3PIPF 1TW3A 3MEXA 1YS7A 4KNYA 1DGRM 3DP7A 3CJNA 2IGKA 3V4GA 2FNAA 1A5JA 2ZNZA 2HI3A 2M0MA 4HNTA 2ME0A 1N77A 2E1NA 1XTAA 5IT9K 1BR4A 1D5YA 1ETOA 2A05A 1A36A 3LA7A 5E3OA 3UNGC 5FRNA 1XX5A 4XICA 4E7ZA 1SVMA 4HX4A 1BA5A 1JE8A 3DEUA 2LOOA 3NAUA 2BW3A 1LE8B 4KMFA 2M1BA 3CMEI 2HYGD 3PIOF 4A3MJ 2G9WA 2WB1A 2NNNA 2W57A 4WXCA 1TNSA 4D7NA 3AG4H 4YIIA 1LDDA 3V7SA 4G7ZF 3B73A 3GLXA 5J40A 3QPSA 1JHHA 1NH3A 3IKVA 1TWFJ 4YELA 9ANTA 1GHCA 2JT1A 2O8XA 2WWYA 1F43A 4Z6YA 3IH2A 2ZJRF 2Z5UA 3TW6A 5LGTA 4D9JA 2LF7A 1LPQA 1RUOA 1U9OA 1RKTA 3QPHA 2OQRA 2P6SA 3N97A 1YIJI 1GVJA 1I1GA 3T0YA 3ZQFA 3I58A 4GXOA 4BDYA 2P4WA 1X1PA 2IXSA 5H20A 5J4VA 4XLHA 2ZJ2A 2DW4A 3D0SA 2C6YA 2VIXA 2LSOA 2XB0X 3VODA 3IRRA 2A07F 2V1UA 2DOEA 3ZMVA 1XB4A 1ERDA 4CHUA 4WX9A 2I10A 2FXAA 1T8IA 2VOPA 5IYCJ 2X6WA 3BDDA 4Y4RA 2R0QC 1R7JA 4WXDA 1JKRC 1E17A 1NK3P 2F5EA 2N8GA 5EDNA 2EZHA 2K86A 1MBJA 2HOEA 5E8IA 1Z3YA 2BBYA 3VPRA 1BC8C 3RSNA 2CH0A 3QPLA 5IPAA 2KFDA 5ILUA 4U7DA 2OZUA 3LMMA 1FSHA 4HSTA 1OKRA 3GO5A 2EFOA 1U2WA 5GPAA 4FISA 5FLVA 2WAQA 1K83J 1U5TB 2AQEA 4HNVA 3S14J 4HA8A 5D5UB 1TWCJ 2EA4A 3JRAA 2JA5J 3QPTA 4CSWA 3VDXA 4BL0B 1RR8C 4GRIA 4I7HA 5FKKA 1X1AA 1XDSA 4ZYEA 4I76A 2R7VA 3I71A 2DMUA 1UCRA 1I6HJ 2VLAA 2PLYA 2K02A 1X3UA 2LH9A 4ZYDA 2L0KA 3DFGA 4IEJA 1PVEA 3QQAA 3OYLA 4HLYA 4RGRA 3I55I 2KZVA 5EG0B 3AG1H 3HKZA 1FTTA 1GXPA 3LSGA 4OU0A 1QPIA 2ACJA 5BOXA 4BDZA 2E2JJ 4ZZLA 4M6YA 4RB2C 1OCOH 2KISA 1MDMB 2E1OA 1EJ9A 3LSIA 4IJAA 1USSA 1X3WB 2O03A 3COAC 1VQ4I 3G3ZA 1F4KA 2HKXA 3BJAA 3WTVC 4J00A 3PO3J 3BG6A 1FLIA 4NQWB 1IG7A 2ZXJA 3GTJJ 3H0DA 1T0FC 2DTZA 3RIRA 3S32A 3DV8A 3S2DJ 3WGHA 1FX7A 1LEAA 4C3IJ 1XS9A 3CMYA 3B02A 1B59A 2ZCWA 2DI3A 3VYRB 4NB5A 1LNWA 2AXLA 2R7WA 2K4JA 1LB2A 2FE3A 2MC3A 4A93J 3JRGA 2ISZA 2ID6A 3OIQA 5J3LA 1BI1A 2CFXA 2L01A 4ENMA 1D0XA 1ZRDA 3OYJA 4UXNA 1AU7A 3FIWA 5CQEA 2ZFUA 3BLYA 1WVRA 5KAIC 3H5NA 2DDBA 2LVSA 4OMYA 3BCBA 5DDGA 4RM2A 1STZA 2XSDC 5E3LA 3MKWB 4E7KA 1TWHJ 3AFHA 2R4GA 2Z33A 1VZ0A 1EH8A 3BG7A 3WTZA 1V55H 3D5SC 4JQFA 1IO2A 1S7OA 3SDBA 2R5ZA 5AIQA 2M8GX 2DFIA 2R7RA 3SEZA 3OYCA 1VQPI 2XB5A 2XAGA 3M8EA 2B0LA 3DCFA 1MMNA 2ZKZA 3ZQQA 1HDPA 2HVQA 4S05A 3MZHA 2LY9A 4A6DA 2RN7A 4IVNA 5BNGA 1W7PA 3CJQB 4F92B 2HEOA 4F52A 1MD0A 1R36A 4IO9F 4IKFA 3H9JA 2EIKH 3AL0C 2NVTJ 3C1DA 2QQAA 2BYVE 3WE2A 3OL3A 4ZDPA 2P7VB 5FKOA 4Y3OA 2XKOA 1XGSA 3IH3A 2W48A 3K2ZA 1IN6A 2E5NA 4LITA 2MFZA 1IRFA 1VQOI 2P5KA 3O8HA 4A3JJ 2P6TA 4RBOA 3GTGJ 1R5HA 3GBGA 4XN3A 4XRSG 2BW3B 1LE8A 1NG6A 4UB6C 3X2QH 1J0RA 3V7RA 4CYDA 2B9SA 1OCTC 4HZFA 4XRFA 3BPVA 1JJ6C 2KIFA 1I3AA 4EM0B 4ETSA 4G6QA 2X51A 1W5SA 2YU3A 5DYMA 2NOGA 5BQTA 2DYSH 4UHTA 2CWEA 2XAHA 3DTEA 4F3QA 3BZKA 4F7ZA 3R4KA 3GTQJ 4G9YA 3OS2A 1EH7A 4CCJA 3H5RA 1D0ZA 4M9XA 5CVUA 1FP2A 4A3IJ 2LMDA 3GCMA 1GT0C 4P1WA 1K61A 4FASD 2W1OA 3TP3A 3MKLA 1TWGJ 1ETQA 4U88A 3CJTB 3WG9A 3K4JA 1YJWI 2PJPA 1YI2I 5AONA 2E60A 2HQRA 2TCTA 2VBWA 2ZXHA 5ICGA 5LBQA 5F0FA 3H9QA 1R5GA 4I0BA 4NDLA 4S0HB 3HOVJ 3ERMA 3E6CC 2CW7A 4L5EA 2HVRA 1WH7A 3CCJI 3J7ZI 3VYUB 4L5JA 3HSRA 1FBUA
chains in the Genus database with same CATH topology
1VQ7I 3I55I 3CD6I 5GAEJ 4IOCF 3CCRI 4IO9F 1S72I 3PIPF 2QEXI 1VQNI 3CC7I 2OTJI 1ACIA 1HC8A 5DM7F 1Y39A 3CCMI 3CCUI 3DLLF 1VQ5I 1FOYA 3G4SI 4IOAF 3I56I 4UY8I 2H8WA 3CJTB 3CCQI 3J7YJ 2ZJPF 5GADJ 3CMAI 2ZJRF 3CCSI 1VQPI 1YJWI 1VQKI 5GAHJ 3CCVI 5DM6F 2ZJQF 3CCEI 2FOWA 1YI2I 1YJNI 1QA6A 2NXNB 1VQ8I 2OTLI 1YHQI 1VQ4I 2K3FA 3CCLI 2E34A 1YITI 2QA4I 1VQOI 2JQ7A 1MMSA 2E36A 3G71I 3CMEI 1YIJI 5JVGF 1FOXA 3PIOF 1VQMI 1YJ9I 1VQ6I 1VQ9I 3CC2I 4V19K 1FOWA 3CC4I 3CF5F 3G6EI 3J7ZI 3CCJI 2E35A 5GAGJ 1VQLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 I;  3I55 I;  3CD6 I;  5GAE J;  4IOC F;  3CCR I;  4IO9 F;  1S72 I;  3PIP F;  2QEX I;  1VQN I;  3CC7 I;  2OTJ I;  1ACI A;  1HC8 A;  5DM7 F;  1Y39 A;  3CCM I;  3CCU I;  3DLL F;  1VQ5 I;  1FOY A;  3G4S I;  4IOA F;  3I56 I;  4UY8 I;  2H8W A;  3CJT B;  3CCQ I;  3J7Y J;  2ZJP F;  5GAD J;  3CMA I;  2ZJR F;  3CCS I;  1VQP I;  1YJW I;  1VQK I;  5GAH J;  3CCV I;  5DM6 F;  2ZJQ F;  3CCE I;  2FOW A;  1YI2 I;  1YJN I;  1QA6 A;  2NXN B;  1VQ8 I;  2OTL I;  1YHQ I;  1VQ4 I;  2K3F A;  3CCL I;  2E34 A;  1YIT I;  2QA4 I;  1VQO I;  2JQ7 A;  1MMS A;  2E36 A;  3G71 I;  3CME I;  1YIJ I;  5JVG F;  1FOX A;  3PIO F;  1VQM I;  1YJ9 I;  1VQ6 I;  1VQ9 I;  3CC2 I;  4V19 K;  1FOW A;  3CC4 I;  3CF5 F;  3G6E I;  3J7Z I;  3CCJ I;  2E35 A;  5GAG J;  1VQL I; 
#chains in the Genus database with same CATH topology
 1HKT A;  1NK2 P;  5ED4 A;  3TO9 A;  1O57 A;  2HXI A;  1JT6 A;  5LGN A;  1D0Y A;  1KQ9 A;  1R49 A;  1BR2 A;  3ML6 A;  1V5G A;  5B66 C;  4XL9 A;  1QGP A;  3JAM Z;  3OYA A;  1VQ5 I;  3JRD A;  3HZJ A;  4A3D J;  4Q5S F;  3HRT A;  2XKP A;  4JK1 X;  4AYB A;  3A01 B;  3CTA A;  1T6S A;  1UMQ A;  2ELH A;  3F8B A;  5K5R A;  5EF6 A;  3ZOB A;  1KQ0 A;  2H09 A;  1WI9 A;  2ECB A;  3DBH B;  1FBS A;  5E1W A;  1VQ7 I;  3MKY B;  2W7N A;  4L0Y B;  3S1N J;  2DJN A;  1XSD A;  5GTI C;  4MGR A;  3K1N A;  5D8K B;  3HHH A;  4AID A;  3CCU I;  1YFH A;  3RZD J;  4UY8 I;  2R5Y A;  3A0H C;  4E7J A;  3FKJ A;  2K5C A;  2KHM A;  3TGN A;  2NS0 A;  3OMY A;  1G4D A;  1YX3 A;  3PFY A;  2XGD A;  3HGY A;  4XLP F;  1QBJ A;  3VSL A;  4HDV A;  1GV2 A;  4ANJ A;  3WTX C;  4EVI A;  1SFK A;  2ZXW H;  2XGC A;  1YJ9 I;  3H9G A;  3ZN0 A;  2COB A;  4HOB A;  1J59 A;  1K6O A;  3QYF A;  1P6R A;  3DQV C;  4UV8 A;  1ZKG A;  2HOA A;  1U78 A;  4IHW A;  2GIV A;  4DBR A;  1P2F A;  2JA8 J;  2LP0 A;  5JR3 A;  5HDN A;  3SXY A;  3OYK A;  4XRS A;  1WWX A;  4CCN A;  1N78 A;  1Q1V A;  2ELK A;  2JRT A;  2A3S A;  4M3G A;  4BNC A;  2LBF B;  4O5V A;  1D1A A;  2BXY A;  4OAZ A;  4JOM A;  5GAH J;  3JRI A;  2ZJQ F;  4PSW A;  3HBL A;  3ZR8 X;  2M4K A;  2DOA A;  2XAF A;  1R4N B;  4E6K G;  2FF4 A;  3F3X A;  1OCZ H;  3DF8 A;  5ICC A;  3E3V A;  2UXX A;  3A2K A;  1U3E M;  1OCR H;  1NTC A;  1Z05 A;  4PGH A;  2BVL A;  2JRM A;  4BQO A;  1ORK A;  5C44 J;  4RDU A;  3L2W A;  1PJR A;  2IT0 A;  4J19 A;  2QYO A;  1IRG A;  4UVC A;  4V2G A;  3LA2 A;  3I4N J;  1MMG A;  2V9K A;  3DKW A;  4HV6 A;  3R60 A;  3RPU A;  4E7I A;  2OUM A;  5F08 A;  2IS2 A;  1IXC A;  2EZL A;  3QYE A;  1T33 A;  3JSP A;  1FIA A;  2Z2S B;  5H6R A;  4ZYA A;  4ZDL A;  3K70 D;  3A1Y A;  3FXJ A;  5FLX Z;  3TOB A;  4ZTJ A;  2IS6 A;  2XAJ A;  2BEO A;  2ZB9 A;  2MG4 A;  2A5Y B;  1FWZ A;  3AKZ A;  4Y33 A;  3FHN A;  1TP4 A;  3O2P E;  5ICF A;  3C18 A;  3V8L A;  2BY3 A;  3HEF A;  4DGW B;  1WJD A;  4CCO A;  1DP7 P;  5JLX A;  1R4M B;  3Q0V A;  3K4M A;  5IP6 A;  2QUF A;  5FD5 A;  3CCE I;  1H9T A;  2CQN A;  2QGU A;  3BTJ A;  2UZK A;  4ENK A;  1H0M A;  2K3F A;  4NBQ A;  3LA3 A;  3KEY A;  5B3S H;  2PJR B;  3FF5 A;  1Y56 A;  2GA2 A;  3FXK A;  3R0J A;  3VYS B;  2L9V A;  4IX7 A;  1TWA J;  4RB0 A;  1IAW A;  1MNE A;  2DDA A;  2X48 A;  3UKG A;  2X1E A;  2Y75 A;  2YUS A;  5JI6 A;  2CV1 A;  1SVL A;  2X6X A;  1WQ2 A;  4CO8 A;  2IEK A;  3OOU A;  3PSF A;  2HTS A;  5F6F A;  4GGG A;  1AKH A;  2L9S A;  3FM5 A;  4WK8 F;  4UV9 A;  3W2A A;  2HQN A;  4BAC A;  1OQY A;  2OU2 A;  2MYS A;  3BTL A;  5HLT A;  1ZG3 A;  3NQO A;  2VOO A;  2DOD A;  2XRN A;  2HNH A;  2X6O A;  1MIJ A;  5LHG A;  2O3F A;  2LR8 A;  1FOK A;  2VUM J;  1Y6I A;  3KYD B;  4IHS A;  1P9Q C;  5BMZ A;  2EV6 A;  2DFE A;  3H3U A;  3LSR A;  4I6Z A;  3OIP A;  2FD5 A;  1CF7 A;  4OMZ A;  3J80 K;  4M3F A;  5IY5 H;  3OYN A;  1Y0U A;  5J47 A;  3WTS C;  3KYC B;  4OIN F;  1TZL A;  2NOJ B;  4PDK A;  1U5T A;  3K70 C;  3L9F A;  2NYX A;  5E3N A;  1W4M A;  2M0C A;  3IV5 A;  2IS1 A;  4DYR A;  1VFC A;  3EYI A;  2HQA A;  4M3B A;  3NWT A;  4RB1 A;  1PYV A;  4P9U A;  1R1U A;  5DM7 F;  5DD4 A;  5EGO A;  1SFE A;  1LFB A;  1DQU A;  1JHF A;  3SJM A;  1RC9 A;  3RKX A;  3LFK A;  4A5N A;  4EAT A;  1QA6 A;  4OIP F;  5FO5 A;  2CRG A;  3CJR B;  4UUS A;  3CCL I;  4Y17 A;  3QYB A;  3KEO A;  1J2X A;  2R7X A;  4B44 A;  2W24 A;  4BXU A;  3J81 K;  4B8X A;  1LVK A;  1BW6 A;  4MNU A;  3EDP A;  3DTI A;  4A3K J;  5F27 A;  5FLX K;  2EZK A;  1K4S A;  4G12 A;  5LHI A;  2EIN H;  2I8D A;  3TED A;  2L7M P;  4IRH A;  1W36 C;  3ZXS A;  1HA8 A;  3M9A A;  4C3H J;  4DZJ A;  5J1U A;  1YQA A;  3GTM J;  4YRV A;  1N25 A;  4RGX A;  5LRR A;  3BTC A;  2D45 A;  3G1L A;  1BC7 C;  2GLO A;  3HJE A;  4BJ5 C;  3HL2 A;  3RI4 A;  2F2E A;  1O7F A;  2G7U A;  3L1P A;  1WJB A;  5J8F A;  1W0T A;  3F9K A;  3CCY A;  3BJO A;  2BXZ A;  4OIR F;  1WFX A;  3Q9S A;  5GP9 A;  3TDZ C;  3PJR A;  1S5L C;  1LEB A;  1VQL I;  3VFZ A;  2WAF A;  4HLX A;  4Z2Y A;  2Y9Y A;  3NEU A;  3LSH A;  4BQQ A;  3VOE A;  2LG4 A;  2VJ5 A;  1K4T A;  4MIM A;  3HB9 A;  3TW7 A;  3IKT A;  1FC3 A;  5E1Z B;  3U1K A;  3H5A A;  4L5I A;  5GPC A;  3WHB A;  3EUH C;  4I2O A;  1F5T A;  3GFJ A;  5GAD J;  2ZXI A;  3FBI B;  1PP8 F;  2IS4 A;  4GDF A;  3WU2 C;  4MQV A;  1KYW A;  3L2U A;  2E19 A;  1XDU A;  3L00 A;  2KL4 A;  5K5O A;  1VQM I;  2V79 A;  2CQK A;  4ASN A;  2RNG A;  2VC0 A;  4N4N B;  3HUG A;  2E35 A;  1YW7 A;  3BG3 A;  4BKX A;  2G0E A;  1C0W A;  1H8A C;  1ONV A;  2JJ7 A;  2VKH A;  2YPR A;  2JA7 J;  4IZZ A;  1FP1 D;  3ZMU A;  3RYP A;  1KA8 A;  4I99 C;  3KE2 A;  4Q4Z F;  2E7X A;  2M7B A;  2STW A;  5ILV A;  3J7Y J;  4A3L J;  2Y48 A;  3REO A;  2KRC A;  3ZMT A;  2HZT A;  3HG9 A;  2EQR A;  1MMS A;  5DCF A;  2CMP A;  2G7H A;  2IA2 A;  2PMZ N;  1WCM J;  3JTH A;  3TP0 A;  3GTP J;  3WU1 B;  5GTH C;  3W2W A;  1DGW Y;  2HGC A;  4ENJ A;  4KFC A;  2VKE A;  2MH9 A;  3ZQH A;  2GM4 A;  1X2N A;  4M74 A;  1MJA A;  1S7E A;  1SD5 A;  2E71 A;  4FE4 A;  3F22 A;  5E17 F;  3AG2 H;  2W82 A;  2A69 F;  4FCY A;  1D5V A;  2WB1 N;  4JP0 A;  4RGS A;  4KN4 X;  1CF7 B;  3M3Y J;  1TTY A;  4K2E A;  4E7L A;  5IT9 Z;  2QLZ A;  2NS7 A;  2EWN A;  2XF5 A;  2ME6 A;  4CUG A;  5F0C A;  3KP4 A;  4DIQ A;  2CS3 A;  1BJA A;  2IAI A;  2E2H J;  1MBH A;  4RAZ A;  1ZH5 A;  1MSE C;  1U5T C;  3MQ0 A;  5IOZ A;  4A3B J;  2KT0 A;  2LKS A;  3WG7 H;  3GEZ A;  5IT3 A;  1ENH A;  1XG1 A;  4F55 A;  3TKY A;  3W6J B;  1G3Y A;  5LEK A;  3OYF A;  1ZG5 A;  2NVQ J;  1IN4 A;  2I5U A;  2L7F P;  2LLK A;  2R7F A;  5C3E J;  3GLL A;  5M3M J;  2H27 A;  1I50 J;  2KJC A;  4RS8 A;  2NVU B;  3E6D A;  3HOW J;  4LJZ F;  2VN2 A;  3ERE D;  2STT A;  2M4G A;  2VXD A;  1Z7L A;  1GVD A;  2FJ1 A;  3JRE A;  1MBK A;  3MWM A;  2A6H F;  1FJL A;  2A5W A;  2CW8 A;  1BOB A;  1LKX A;  1JGG A;  5EZG A;  2L3D A;  2LYC A;  3H0G J;  2VL8 A;  5JLW A;  3LFU A;  4Y13 A;  4FTH A;  5BPD A;  3HIF A;  2QZ8 A;  5M5W J;  1V5F A;  2A68 F;  2GXG A;  1XPX A;  3CCS I;  5CVV A;  5FLM J;  4RAG A;  5L3F A;  1J7K A;  4XLN F;  2CW0 F;  4ZDO A;  1WKM A;  3CDI A;  1ZRE A;  3I59 B;  3GTO J;  2MC4 A;  3KP6 A;  3QOP A;  1T39 A;  1TW2 A;  2K85 A;  2DA3 A;  3G73 A;  1ETW A;  3MZY A;  2XIG A;  3FXM A;  1FYK A;  2B7E A;  3EYY A;  1B4A A;  2WC2 A;  2R7U A;  2QKM B;  2JA2 A;  3K69 A;  2H6B A;  3WGG A;  2Q8K A;  5HDK A;  3JW4 A;  2P5L C;  2Y0S N;  2FQ4 A;  1QHH D;  2V7F A;  4EM2 A;  3M07 A;  1BJZ A;  3RZO J;  2BHZ A;  3VWB A;  1TQM A;  1K78 B;  3BOQ A;  2IVM A;  4RA2 A;  1UZC A;  4G8X A;  2R5Y B;  4XMY A;  3ZQC A;  4TV7 A;  2R93 J;  3FZV A;  3Q9V A;  2CV2 A;  2RKH A;  4LIV A;  5FFX A;  4LD5 A;  1JJ8 C;  1F1Z A;  4U7B A;  4KT6 A;  3BWG A;  1Z6T A;  3W6K B;  2P81 A;  5H6Q A;  2CQX A;  3ABU A;  4HBL A;  4GYI A;  2CJJ A;  4G7H F;  2OAZ A;  3S2H J;  1MBF A;  3I53 A;  3JSO A;  2OCE A;  1ZQ3 P;  2GZW A;  3A02 A;  1UFM A;  1XGM A;  3CZ6 A;  3LWF A;  1A31 A;  1FT9 A;  3SDG A;  2VPL A;  1QO0 D;  1DPR A;  5FFZ A;  4EJO A;  1R71 A;  1G6N A;  3OYM A;  1QHG A;  3I4P A;  4OOI A;  5HDG A;  3CC4 I;  1Z7U A;  4HF1 A;  2FBK A;  2KDO A;  2ZSH B;  1HKS A;  2AS5 F;  1RKW A;  5J1Y A;  3HYI A;  1I1S A;  2X1D A;  1AA7 A;  1ZRF A;  5IP7 J;  4R8H A;  2ZJP F;  2JK3 A;  2HPM A;  3ZPL A;  1IW7 F;  4LB6 B;  5F0H A;  2XC7 A;  2CGP A;  3CP2 A;  5JFR A;  2QCO A;  4CYC B;  3WTU C;  2L54 A;  4ESF A;  4BBS J;  2O0Y A;  1LUJ B;  4XNF A;  2VBX A;  2M34 A;  3CP8 A;  1Y1W J;  4YEJ A;  3G6E I;  4XM3 A;  2L5Q A;  4M72 A;  2WAQ N;  2OC6 A;  1BL0 A;  4XKB A;  5HNH A;  2UV1 A;  4XR6 A;  1IV8 A;  3CCM I;  2LC2 A;  4O6J A;  3TMO A;  3DBR B;  3I56 I;  2ECC A;  2P0W A;  1S7A A;  2V6C A;  3VB2 A;  3CCQ I;  1XMK A;  3DPU A;  4I98 B;  1YE9 A;  1OR7 A;  4HX8 A;  3CC2 I;  4YFK F;  3CF2 A;  3BR3 A;  4BEH B;  2HOS A;  1JXS A;  4PSX A;  4IQ4 A;  5CPR B;  1T08 B;  3F6O A;  2KRH A;  4WWC A;  3I3L A;  2EIJ H;  2YR2 A;  4NQW A;  2VI6 A;  2K9L A;  2GA1 A;  1B6A A;  3K1P A;  4BY7 J;  1SFU A;  4B3A A;  5EJC A;  1A6I A;  2YS9 A;  3L7W A;  3DPL C;  4HX7 A;  3KX2 A;  4C2T A;  1D8J A;  3TL4 X;  3F8F A;  1XD7 A;  2F5F A;  5EGO B;  4AIK A;  3KP2 A;  3LSK A;  4ON0 A;  3SZT A;  3D1N I;  1N75 A;  3ZGK A;  4HDU A;  5FD6 A;  3BP8 A;  2M45 A;  3GFM A;  3OOP A;  1QRY A;  2L7K A;  2VB6 A;  3G2B A;  2V1X A;  1IDY A;  4PGG A;  4F93 B;  5M3F J;  5DEQ A;  4BAY A;  5K1Y A;  1BIB A;  3JAM K;  1MND A;  4U0W A;  2H8W A;  4ZH4 F;  4XQF A;  1B1B A;  3A03 A;  4XKW A;  1XGN A;  1YRN A;  3GZ5 A;  1I39 A;  2A6E F;  5DM6 F;  1H88 C;  5LFA A;  4X1E A;  2NXN B;  2R7Z J;  1QVU A;  2H1K A;  2XHK A;  2W84 A;  1ZGJ A;  5FKN A;  2W85 A;  5KAF C;  3KP7 A;  2MSY A;  2CQ7 A;  3DPT A;  5J6X A;  4G94 A;  1XCV A;  2DMP A;  1GDT A;  4MEX F;  2UUZ A;  1X4O A;  3AL0 B;  1IZ1 A;  3BR2 A;  4AVP A;  1YYV A;  3C2H A;  4ZC3 A;  1OFC X;  5HLH A;  1Z67 A;  3WOD F;  1LDK B;  3OR2 C;  1EKE A;  1T0F A;  2GIZ A;  3JRC A;  3RPQ A;  1LDJ A;  1MSF C;  1J9I A;  4Q47 A;  1ON2 A;  1YIT I;  2WA0 A;  1OYI A;  3H1C A;  1RR7 A;  3NRV A;  1SD6 A;  2E1C A;  2YU9 J;  2DQL A;  2MH2 A;  2XGE A;  3MKZ A;  2IP2 A;  4UB8 C;  4RAY A;  2GAU A;  4JX4 A;  2QSH X;  4NC8 A;  4ABZ A;  2GXB A;  2DT5 A;  4I02 A;  4G6T B;  3ABM H;  4UUS B;  1HW2 A;  1B72 B;  4D5F A;  1SAU A;  2VXZ A;  3ZQG A;  4QSH A;  3WTY C;  4PJ0 C;  5BPI A;  2FMY A;  2RDP A;  3T8R A;  2VKV A;  5J1R A;  5HLG A;  2DO7 A;  1WPK A;  3QU3 A;  3GME A;  4C30 A;  4XBF A;  1TL8 A;  5CJ9 A;  2ZC2 A;  4HF2 A;  1AHD P;  3IAS 2;  2HQ5 A;  2DA6 A;  4NHJ A;  2DAO A;  2DA7 A;  4P55 A;  4L9V A;  2R7S A;  4MQ9 F;  3SFI A;  2PX9 A;  3WTT C;  6PAX A;  1KQ8 A;  1Z21 A;  5L3B A;  1FTZ A;  1SFO J;  3FIS A;  3U1D A;  3RJP A;  4IOA F;  2FBH A;  4N0B A;  1P7J A;  3CLQ A;  2HDC A;  1FIP A;  3CD6 I;  1UG0 A;  1VI0 A;  1BI3 A;  5L3D A;  2ZSI B;  1IN7 A;  2Q2E B;  3F6V A;  1HXD A;  1G2H A;  1ZAO A;  1ZAR A;  2ETH A;  2VOD A;  2E5Z A;  4A12 A;  1HDD C;  2F4I A;  4LB5 A;  3FK6 A;  4BHB A;  1WJC A;  1D8K A;  3K1M A;  2K3P A;  4HG2 A;  2FNP A;  1BBY A;  2LFB A;  4KIG A;  4Y52 J;  1VTN C;  4I0A A;  1YS6 A;  4D7M A;  2V26 A;  4AU7 A;  2BVM A;  1DP3 A;  1SVO A;  2FU4 A;  2LD5 A;  4LIU A;  3TOA A;  2CUF A;  2QA4 I;  4C3J J;  4YIF A;  2XRO A;  2DA1 A;  1Z0X A;  3MCZ A;  2RC4 A;  5KCM A;  1VQ9 I;  1JUS A;  4M6V A;  4KUM A;  2DMQ A;  5FRO A;  4B47 A;  3OWT A;  2R3S A;  1VF9 A;  3BR1 A;  4M6X A;  3RYR A;  1I6X A;  3FDY A;  4QPO A;  2R7T A;  2JUG A;  3BRO A;  3FKI J;  4U0Y A;  2K9Q A;  5CKT A;  2QF7 A;  2VON A;  2LTP A;  1ZHF A;  3UR3 C;  1KU7 A;  4S04 A;  3ROU A;  3K4B A;  4WXH A;  3H35 A;  2DA4 A;  1BR1 A;  1YRN B;  2LRE A;  1UJ8 A;  5J8C A;  3TO7 A;  2EZI A;  4BE1 A;  2PMH A;  2OTL I;  2GOX B;  1VQ8 I;  1R58 A;  1OYW A;  2WAD A;  2Y2Z A;  1HKQ A;  4IRG A;  1JUP A;  5HS8 A;  4RLF A;  4PCQ A;  3GVA A;  2LDU A;  3N4M A;  1UEL B;  3S93 A;  2JVH A;  2L4A A;  3DKX A;  3EUK L;  2PI0 A;  1WRJ A;  3IRQ A;  4H4K C;  1B72 A;  2HOT A;  3F8M A;  1MMD A;  1ZN2 A;  3IHU A;  2DMT A;  5ERI A;  2F4O B;  2MLK A;  5HOO A;  2EJR A;  3OIO A;  4XON A;  3T1B A;  1F36 A;  1YW9 A;  3F23 A;  3F72 A;  1S29 A;  3FXQ A;  5HNF A;  4XID A;  4B4C A;  5L3C A;  3DBL B;  4HF0 A;  5KK1 A;  2HZD A;  1ON1 A;  2V4J C;  4N9H A;  1SMT A;  2M30 A;  3CDH A;  2ZO4 A;  2VC1 A;  2ESN A;  4XRM A;  4IRI A;  2BE5 F;  1OIS A;  2R7D A;  1B9M A;  2W4S A;  4LMY A;  3TO6 A;  4CCM A;  5CQG A;  1B8I B;  3C3W A;  2PN6 A;  1ACI A;  1T98 A;  3F0C A;  1RET A;  2VKD A;  3HC7 A;  4JYK A;  3GXO A;  3M1E A;  1AKH B;  1WH5 A;  3HTU A;  3PNT A;  5K5Q A;  3CDL A;  1AOY A;  1O3R A;  2HKO A;  4L9N A;  4N4O B;  3VSK A;  1HF0 A;  4FX0 A;  1RUN A;  4EQQ A;  4CCL A;  1KZH A;  3C2B A;  2W00 A;  4AC0 A;  3E6M A;  2MD0 A;  3HOY J;  3FMR A;  1XMX A;  3IH4 A;  3CF5 F;  3K9T A;  2MAB A;  4FE7 A;  2P5V A;  2XRL A;  1S72 I;  2CQQ A;  2K40 A;  3CCR I;  2DYR H;  2E1M B;  4EJW A;  3HM5 A;  1FNN A;  2ELJ A;  4A5M A;  4R79 A;  2IW5 A;  1T95 A;  4PJL A;  2BGC A;  4A0Z A;  2MGQ A;  4DQ2 A;  1EF4 A;  3D5R C;  2YX7 A;  3RCO A;  3S2W A;  1H9G A;  2VJ4 A;  1Y8R B;  2QEN A;  2DQR A;  4BS9 A;  3GWZ A;  5JVT A;  2PMU A;  4P96 A;  2HR3 A;  3KFW X;  1SMY F;  3OSF A;  1W7P D;  2MW8 A;  3BZC A;  2CV0 A;  1JT0 A;  3J7A O;  2FA5 A;  4KIC A;  4QIW N;  1U8B A;  2VQH A;  3DU6 A;  4G6D A;  3S17 J;  4XN0 A;  3WTW C;  1YX5 A;  2MLG A;  3V7C A;  4XSX F;  2L9R A;  3P7N A;  1NHA A;  5L3E A;  3KIO A;  1P7I A;  2H8R A;  2EK5 A;  4UUV A;  3DXJ F;  4B3X A;  3IC7 A;  2VBZ A;  1E3H A;  4CZC A;  1ZG1 A;  2EV0 A;  1B8I A;  3HOU J;  2L7Z A;  3L2C A;  2IA1 A;  4HAM A;  3OL4 A;  4GO1 A;  2O6G E;  2FUG 2;  2DT6 A;  3LQR A;  3FX3 A;  4II2 A;  2DOF A;  1JGS A;  4ENN A;  4JX5 A;  3LQQ A;  4MEY F;  3E0J B;  2L4M A;  1UHW A;  1Z91 A;  4KIB A;  4RLQ A;  1RES A;  3E5U A;  5CVR A;  3C7J A;  1E0E A;  3S1R J;  2RVC A;  3CUQ A;  4XKC A;  2X6Y A;  3W2V A;  2GQQ A;  2FX0 A;  2JSP A;  3C2G A;  3K4K A;  4LLL A;  2Z1D A;  5C4X J;  2LKP A;  2VE8 A;  2ZME C;  4J01 A;  2JA6 J;  1KYZ A;  5D6E A;  2RRE A;  1T2K A;  2KMU A;  3E7L A;  2F48 A;  1IUF A;  3L2V A;  2LNB A;  2OJE D;  4BH9 A;  4L9T A;  1ETK A;  1RRJ A;  4A0X A;  5M5X J;  2XAQ A;  3M8F A;  2HDW A;  1Y39 A;  2Y30 A;  2H1L A;  2LRD A;  3DLL F;  2NAZ A;  2CYY A;  4QTR A;  1IV6 A;  1A6Q A;  2FOW A;  3FXR A;  4W1U A;  3P9C A;  5EYR A;  3MAJ A;  2Q1Z B;  1Y8Q B;  2ZFW A;  1FMV A;  2KRF A;  5D5X B;  1QZZ A;  1K6Y A;  3OY9 A;  1S6L A;  3HSE A;  3DWL E;  4BUP A;  1L3L A;  3KEQ A;  4YFX F;  4N9I A;  2WY8 Q;  5E18 F;  2EFN A;  3S1M J;  3HOX J;  1ZGW A;  2FRH A;  2HWV A;  3QP5 A;  3QWL A;  1WZ2 A;  2DU9 A;  3K4N A;  1J5Y A;  2ZME B;  4II3 A;  1TT0 A;  1YOV B;  5LEJ A;  1IXS B;  5HVQ C;  4IHV A;  5IYB J;  2JZY A;  2EFW A;  2R7O A;  5B1B H;  1WHU A;  2HTJ A;  4OIQ F;  2L9N A;  3QOE A;  2XV4 S;  4L0Z B;  2EB7 A;  3PFI A;  4A3E J;  2EA2 A;  5L3G A;  5B1A H;  5D4R A;  1E2X A;  2J5P A;  2VPR A;  4YIR X;  3KZZ A;  3ELK A;  3PL8 A;  5A2Q K;  2JSC A;  3IAM 2;  2X4H A;  3M8J A;  3ZQL A;  1O3T A;  1Z3X A;  3BT9 A;  2OTJ I;  2Y0S A;  1IDZ A;  2V9V A;  3I64 A;  5J4Y A;  3BR0 A;  1L0O C;  1HLV A;  2QQB A;  3GUD A;  3LSP A;  4Q48 A;  3ABK H;  3BCA A;  1OPC A;  2Z99 A;  3HSF A;  2F4M B;  2QM3 A;  1MKM A;  3ABT A;  3OS1 A;  1MBE A;  3GX4 X;  2JQ7 A;  2HDD A;  3EET A;  1TC3 C;  2BV6 A;  3ASN H;  2QBY A;  1PUF A;  5H2F C;  1APL C;  2IGO A;  3B6C A;  2BZT A;  4HQM A;  5D8L B;  2X9D A;  2PG4 A;  2IPQ X;  3ZRG A;  3LAP A;  5DD8 A;  4EMS A;  2DLL A;  2QQ8 A;  4KA4 A;  1KON A;  1MJB A;  3O3K A;  4ITV A;  3HOZ J;  3BJ6 A;  3EQL F;  2OF7 A;  3M1C A;  3E5X A;  4LGW A;  2GXA A;  2Z16 A;  2X1C A;  5CLS A;  3OS0 A;  2X85 A;  4BQA A;  1GLN A;  1IF1 A;  1W36 D;  1V54 H;  3S3O A;  1X3Z B;  3RKQ A;  2E36 A;  2DCE A;  3Q0U A;  4FQG A;  1A04 A;  5HS7 A;  5KNL A;  4M73 A;  5JVG F;  1S8N A;  4C9Y A;  3HRU A;  4E7H A;  1U0J A;  5TGT A;  2DN0 A;  3V8J A;  5IP9 J;  3OYH A;  1WGX A;  4PFO A;  3EUA A;  2FSW A;  3J81 Z;  2OPT A;  2MBF A;  1K7A A;  1SAN A;  3K6G A;  4LG3 A;  4XOR A;  3GZ6 A;  3HOS A;  1HC8 A;  1UST A;  1V3F A;  3IP4 B;  3LL7 A;  3QP6 A;  4CCK A;  4D0P A;  4KMU X;  1BI0 A;  4IL6 C;  4MTE A;  1T56 A;  5DV5 A;  1JTX A;  4YG2 F;  3FXL A;  3BY6 A;  4O3M A;  2XF7 A;  4P5O A;  4PJJ A;  2BY1 A;  1JTY A;  2A6T A;  2IGM A;  2M3A A;  3FXO A;  3LST A;  2ZNY A;  3JR9 A;  2R92 J;  5EZH A;  4UVA A;  4FET A;  3A01 A;  1XGO A;  2O9L A;  1PDN C;  2R7Q A;  1X1D A;  2M2E A;  4F91 B;  4OAY A;  1OR7 C;  1FOY A;  2XDV A;  4IPA A;  1JKP C;  2H94 A;  4HNU A;  1GUU A;  3F8N A;  4BJ6 C;  4G7O F;  5K7Z A;  2DA5 A;  1AWC A;  1I3Q J;  4KT5 C;  5E3M A;  3ZQ7 A;  1DUX C;  1OMI A;  2YX4 A;  2A61 A;  2KIU A;  4RAF A;  2BY0 A;  1XSV A;  4MLO A;  5B5E C;  3BR6 A;  2QVO A;  2LK2 A;  3SFZ A;  2K7L A;  4X0G A;  1TQI A;  1BIA A;  4EV0 A;  3CES A;  4FT8 A;  4AVZ A;  1WJ5 A;  2RAE A;  1X2M A;  4HSR A;  5LHH A;  2AQF A;  1Z6R A;  1G8X A;  3CMA I;  3SQN A;  3ZMD A;  1IUY A;  3FMQ A;  2P7C B;  3OYE A;  1PUF B;  2KIM A;  3P5J A;  1G3S A;  4AIJ A;  1ETY A;  2RNJ A;  1X4P A;  2D2W A;  2DK8 A;  3BTI A;  1O3S A;  2OA4 A;  5DS9 A;  1ETV A;  3ONQ A;  3U2R A;  3T5X A;  1WJA A;  2PJR A;  1HQC A;  1IGN A;  2V1D A;  1GV5 A;  5F1J A;  3HTS B;  3I59 A;  2LKX A;  1BN5 A;  3IWZ A;  1I5Z A;  2PMZ A;  4M3D A;  3KLN A;  4BGD A;  4EGY A;  2VQG A;  5LRS A;  1X1B A;  2PEX A;  3CLO A;  2ESH A;  4PJM A;  4E7S A;  2DMN A;  1SC7 A;  2L2O A;  2D1V A;  3IWF A;  1U8R A;  2IBD A;  4KIS A;  3I0T A;  1OCC H;  2QBY B;  2XAU A;  2AHQ A;  2HYJ A;  4XSZ F;  3K10 A;  2WY7 Q;  1JKQ C;  2NVY J;  3E5Q A;  2M87 A;  2OZ6 A;  1UHS A;  3KP5 A;  3WU0 A;  2PQ8 A;  3K2A A;  2EIM H;  3GF2 A;  4JBA A;  1ZTR A;  3S8P A;  4U0V A;  4BE0 A;  3VEP A;  4RMN A;  1EH6 A;  1KGS A;  3SEQ A;  3BC8 A;  1LQ1 A;  2VJJ A;  4E70 A;  4CXF A;  3ASO H;  3O6B B;  2RQQ A;  3QAH A;  4DNC A;  3HOT A;  2CFO A;  3L2Q A;  1ZGA A;  3HHG A;  3PNV A;  4BEH A;  1BI2 A;  1FY7 A;  2AXT C;  2KZG A;  2Q2E A;  5JHU A;  4IHY A;  1W7P B;  2P8T A;  3GZN B;  1GXQ A;  3DEW A;  2VBY A;  4OWR B;  2D5V A;  4DW6 A;  1XN7 A;  3GTL J;  2CUE A;  5CVJ A;  4MFD A;  2DBB A;  2IJL A;  1R6R A;  3N05 A;  1QPM A;  4RGU A;  3PM1 A;  2M9H A;  3OV8 A;  1V4R A;  1SD4 A;  5D6F A;  1HST A;  2KQR A;  1YG2 A;  3U21 A;  5F04 A;  1QVT A;  2CSO A;  2M7A A;  4QWQ A;  3JRH A;  1MMA A;  3HPH A;  2Q0O A;  3KZI C;  1IN5 A;  5FRM A;  1T38 A;  2HYF A;  4ZTF A;  1G3T A;  1KU3 A;  4B1R A;  4OIO F;  1OCP A;  4R1H A;  2BY2 A;  3HPG A;  4NC7 A;  1ZRC A;  3FM3 A;  2OQG A;  4LFU A;  5EEA A;  1HSJ A;  5AIP A;  5GAG J;  1XCB A;  1S9H A;  3CQZ J;  2DA2 A;  4BY1 J;  3RKY A;  3KLO A;  3RDI A;  2JPC A;  3LNQ A;  1ZLJ A;  3ABL H;  3CMM A;  1HW5 A;  3QOD A;  3G4S I;  2B63 J;  4XLC A;  1I27 A;  1XMA A;  2O7O A;  2Y69 H;  4EM1 A;  1ZLK A;  1VQK I;  2Y9Z A;  1WI3 A;  2PBI A;  2E7W A;  4XOT A;  3V8K A;  3BQY A;  1K79 A;  2HPI A;  1P4X A;  3F8C A;  4HYE A;  2K9S A;  3K4C A;  1ODD A;  3Q0W A;  3ULQ B;  3CUO A;  1V5E A;  3DKY A;  4KIF A;  4MFE A;  4PJN A;  2DXI A;  4L18 B;  1R23 A;  3LAJ A;  4A0Y A;  4IXA A;  4U87 A;  2WV0 A;  1OYY A;  3GFL A;  1QQI A;  4BU2 A;  1UB9 A;  5TIS C;  4A6E A;  3G1O A;  5ILS A;  4RB3 C;  1PP7 U;  3TQN A;  2EIL H;  4KYW A;  1J75 A;  5LLQ A;  2JVG A;  3ZP5 A;  5IYD J;  1YHQ I;  4EJU A;  4I01 A;  3HDD A;  1BM9 A;  3DLA A;  2HS5 A;  2M8E A;  3U9G A;  2XSJ C;  3KPH A;  5A2Q Z;  1DDN A;  3PNY A;  1U6G A;  3FBN B;  4BQN A;  1FYL A;  1DU0 A;  4CH7 A;  4FX4 A;  1D3Y A;  1RZ4 A;  1UG2 A;  4D1Q A;  4PK4 A;  3H92 A;  3PSI A;  1TBX A;  1Q1H A;  4NNJ A;  3SZP A;  3FXU A;  4IQJ A;  1D1C A;  3W3C A;  1YIO A;  3ECH A;  4BXF A;  3CC7 I;  1PUE E;  1P92 A;  2KP6 A;  4HW0 A;  1TLH B;  1IN8 A;  3B6A A;  1Y1V J;  4UNO A;  4DOZ A;  1W5C C;  3ECO A;  2FBI A;  5C4J J;  4PZJ A;  5CYV A;  4CGZ A;  3ZMS A;  2GBY A;  3DEE A;  2EBI A;  2D1H A;  5HOD A;  3MZ8 A;  2KKO A;  1CQT A;  4MO7 A;  3K4L A;  1R00 A;  3RTR A;  1H89 C;  2V1N A;  3OSG A;  2OBP A;  1HW1 A;  1F9N A;  2Y0M A;  1FZP B;  3KZY A;  1KU2 A;  1X58 A;  5F1R A;  3OYI A;  2MA3 A;  4M3E A;  5E8G A;  1Z9C A;  5DUK A;  3SHF A;  1EA3 A;  2JN6 A;  1R5I D;  2FEZ A;  4YFN F;  3I9V 2;  3I54 A;  4AD9 A;  5E79 C;  4H0E A;  5TJJ A;  2DT7 B;  4CA0 A;  2ZBK A;  1IXR C;  1QNT A;  2YSR A;  1Z77 A;  2Z3Y A;  3V42 A;  5IOY A;  3P9I A;  4UUT A;  3ZN1 A;  4M9S A;  1Y0N A;  3ESW B;  4DYQ A;  1ULY A;  1ETX A;  2RQP A;  3BPX A;  2FQ3 A;  3HRS A;  3I5U A;  3ZQI A;  2QEX I;  4LG0 A;  2O5R A;  3A4C A;  3MD2 A;  2VE9 A;  5D5W B;  1HCR A;  2F5V A;  4C2M J;  3O8G A;  3E97 A;  5DUI A;  1IC8 A;  4XKV A;  1W0U A;  4ZZD A;  4E4H A;  5ICE A;  2WTE A;  4EJV A;  2EH3 A;  5D4S A;  1JUM A;  2V9P A;  2K27 A;  2JWT A;  3K0L A;  4BHP A;  3WGI A;  4BHC A;  5K7H A;  1MH3 A;  1E3P A;  2KIQ A;  1O3Q A;  3P9K A;  2WV1 A;  3RQI A;  2J5O A;  2K9N A;  4KIT B;  2QSG X;  3J80 Z;  3JCU C;  1D1B A;  3S16 J;  2TDX A;  4L9J A;  4B43 A;  2ADU A;  2F5D A;  4QLC U;  1E3O C;  3MMY B;  2O61 A;  5TRD A;  2DTR A;  1IRX A;  4M71 A;  3QU6 A;  1YTY A;  3R61 A;  3JRB A;  4NC6 A;  4AIH A;  2KLO A;  2E1M C;  2ID3 A;  1QZY A;  5FB2 A;  1LVA A;  1UAA A;  3E1S A;  3IUO A;  3RQ4 A;  5EEH A;  4V2F A;  2OV7 A;  2CU7 A;  4IF4 A;  5F64 A;  5DTD A;  2IRF G;  2KDZ A;  2PFB A;  1ZR4 A;  1SAX A;  3VYT B;  3PO2 J;  4KJZ A;  3BZ6 A;  3ZMZ A;  4IHX A;  3ZCO A;  1DPU A;  4MHG A;  3IL2 A;  5FJ8 J;  4EGZ A;  2NNY A;  3Q5F A;  4WF2 A;  3LOC A;  1MGT A;  3GFI A;  2HFH A;  2JTV A;  1S3J A;  3GW2 A;  3LSM A;  4LLN A;  1MJ9 A;  2HU9 A;  4CZZ A;  1R1V A;  3S15 J;  2XPV A;  3R6S A;  1CGP A;  3BR5 A;  3KYL A;  3OYD A;  2XPW A;  2KPM A;  1J09 A;  4A3C J;  2XAS A;  1O4X A;  3AAF A;  1MDM A;  3CUQ C;  1KU9 A;  5E20 A;  3PUB A;  2K9M A;  4P9F A;  4XLA A;  4CIC A;  2NVX J;  1EV7 A;  5FKM A;  1X1C A;  2E34 A;  2VT2 A;  2M5W A;  2RGV A;  2TRT A;  3L2R A;  4JX6 A;  4DYC A;  2F5C A;  1B9N A;  1FSE A;  2Z9O A;  3OYG A;  1DU6 A;  4A2U A;  3I4M J;  3MVP A;  2JMW A;  4AWX B;  5DCM A;  1HOM A;  2FML A;  4DBQ A;  1RI7 A;  4HV5 A;  1W1W E;  1VQN I;  1TNT A;  4A3G J;  2GOM A;  1YLF A;  1YW8 A;  3G1M A;  1R1T A;  3H3V K;  2EPF A;  3H36 A;  1WSU A;  1O7L A;  2VQL A;  3MN2 A;  4WCG A;  4I09 A;  2VJI A;  1ZK8 A;  3KCC A;  4HEA 2;  2WBM A;  1OLT A;  3FMS A;  4CDG A;  4ZJZ A;  3M4O J;  1MH4 A;  1R22 A;  2JPB A;  2HXO A;  1SEU A;  1NG7 A;  1MNM C;  3GYH X;  4A3F J;  4HRI A;  1WJF A;  1MBG A;  1G3W A;  1ZR2 A;  4PUS A;  4XOP A;  1K78 A;  4X6A J;  4LG0 B;  1LJ9 A;  5FGM A;  1TQP A;  2UXN A;  1MW7 A;  3FK7 A;  3WHC A;  3EUH A;  3FWE A;  4RM3 A;  3JTG A;  1G59 A;  4PFP A;  3TBI A;  3EPZ A;  2H6C A;  4QPQ A;  4V19 K;  1ZEL A;  1WJE A;  3LSJ A;  3E6B A;  4LK0 F;  2EFP A;  1VND A;  3OYB A;  2L02 A;  4ESJ A;  3QRF F;  2QSF X;  2KJB A;  2RV8 A;  5GAE J;  3PQJ A;  1IJW C;  5BS6 A;  4B48 A;  3HGG A;  3RKW A;  3RPU D;  1YO5 C;  2AO9 A;  1JI8 A;  1P4W A;  1BW5 A;  2DJI A;  2VAS A;  1M1E B;  4AUX A;  4BE2 A;  2JUC A;  3HKZ N;  4C2U A;  2BHY A;  3CO7 C;  3MFK A;  1FYM A;  1A35 A;  2MD5 A;  4D5C A;  3M7G A;  3AG3 H;  1IRZ A;  1TT5 B;  1XC5 A;  3NWS A;  3OR1 C;  3DTK A;  3G71 I;  4BJT A;  4NUB A;  3S3N A;  3KP3 A;  3ISP A;  4BXX J;  5FKL A;  3JRF A;  2XGX A;  1OJL A;  5HLI A;  4CYC A;  5HS9 A;  4LOC A;  4GYG A;  2VQC A;  5EEG A;  4A69 C;  2Y31 A;  3R0A A;  2X0L A;  5JHF A;  4EJT A;  4AM3 A;  2DK5 A;  3H3Z A;  5LD2 C;  3SZG A;  1R9T J;  1RPW A;  2XUB A;  1POG A;  4ESB A;  2HVS A;  4EEF G;  4ZYH A;  3CO6 C;  2NS8 A;  4HPQ A;  2W25 A;  1SD7 A;  2DPU A;  2F6C A;  3SYT A;  3DU5 A;  3K7A J;  3HUG B;  4B09 A;  1MZB A;  5DCM B;  4AYB N;  1QU3 A;  5M5Y J;  4MTD A;  2EFQ A;  2K4B A;  4LLG F;  2UWM A;  1FMW A;  1FEX A;  4DZP A;  1W5T A;  4W97 A;  3KET A;  3F21 A;  1U9N A;  1RIO H;  2ISY A;  2BOL A;  4HQE A;  2DFH A;  4ZYG A;  2EV5 A;  4GCV A;  1UHM A;  5LGU A;  3S3M A;  5D5V B;  2O8K A;  4KDP A;  4BYY A;  1JKO C;  3J7A Y;  3FHZ A;  3NAR A;  4XK4 A;  2OD5 A;  2QWW A;  3CCV I;  4FHT A;  3WE3 A;  5KVR A;  5K7F A;  3W6V A;  3PUF A;  4BBR J;  3BG9 A;  4XLF A;  1Z1D A;  2COM A;  2QKL B;  1ITY A;  1FOX A;  2CUJ A;  1BOA A;  2GWR A;  3CUQ B;  1FOW A;  2E2I J;  2CUZ A;  1LFP A;  2LBF A;  1HBX G;  4XLE A;  5E1X A;  2LY1 A;  1SFX A;  2R5Z B;  3A0B C;  5KHD A;  1ZYR F;  4UVB A;  3TDU C;  2QQ9 A;  4IHT A;  4IOC F;  2XVC A;  2CO5 A;  4KN7 X;  2IA0 A;  1LFU P;  2CG4 A;  4M9Z A;  1FBQ A;  5EG0 A;  2IGN A;  2DFF A;  1REP C;  5CVI A;  1RNL A;  4Y7N J;  3GTK J;  2VT3 A;  1YJN I;  1X19 A;  2ZME A;  2XF6 A;  3BQZ A;  3BG5 A;  3Q3S A;  3PQK A;  3S1Q J;  1XSX A;  2FOK A;  2LY2 A;  4Y15 A;  4DJA A;  1FPQ A;  3HRM A;  2V6E A;  1VQ6 I;  1P4A A;  2WAE A;  2ICW G;  3T8T A;  2NRA C;  2OCC H;  4GFB A;  4LK1 F;  2DPD A;  3D5L A;  1QZE A;  2LF8 A;  2XPU A;  3HXL A;  3L09 A;  3PIP F;  1TW3 A;  3MEX A;  1YS7 A;  4KNY A;  1DGR M;  3DP7 A;  3CJN A;  2IGK A;  3V4G A;  2FNA A;  1A5J A;  2ZNZ A;  2HI3 A;  2M0M A;  4HNT A;  2ME0 A;  1N77 A;  2E1N A;  1XTA A;  5IT9 K;  1BR4 A;  1D5Y A;  1ETO A;  2A05 A;  1A36 A;  3LA7 A;  5E3O A;  3UNG C;  5FRN A;  1XX5 A;  4XIC A;  4E7Z A;  1SVM A;  4HX4 A;  1BA5 A;  1JE8 A;  3DEU A;  2LOO A;  3NAU A;  2BW3 A;  1LE8 B;  4KMF A;  2M1B A;  3CME I;  2HYG D;  3PIO F;  4A3M J;  2G9W A;  2WB1 A;  2NNN A;  2W57 A;  4WXC A;  1TNS A;  4D7N A;  3AG4 H;  4YII A;  1LDD A;  3V7S A;  4G7Z F;  3B73 A;  3GLX A;  5J40 A;  3QPS A;  1JHH A;  1NH3 A;  3IKV A;  1TWF J;  4YEL A;  9ANT A;  1GHC A;  2JT1 A;  2O8X A;  2WWY A;  1F43 A;  4Z6Y A;  3IH2 A;  2ZJR F;  2Z5U A;  3TW6 A;  5LGT A;  4D9J A;  2LF7 A;  1LPQ A;  1RUO A;  1U9O A;  1RKT A;  3QPH A;  2OQR A;  2P6S A;  3N97 A;  1YIJ I;  1GVJ A;  1I1G A;  3T0Y A;  3ZQF A;  3I58 A;  4GXO A;  4BDY A;  2P4W A;  1X1P A;  2IXS A;  5H20 A;  5J4V A;  4XLH A;  2ZJ2 A;  2DW4 A;  3D0S A;  2C6Y A;  2VIX A;  2LSO A;  2XB0 X;  3VOD A;  3IRR A;  2A07 F;  2V1U A;  2DOE A;  3ZMV A;  1XB4 A;  1ERD A;  4CHU A;  4WX9 A;  2I10 A;  2FXA A;  1T8I A;  2VOP A;  5IYC J;  2X6W A;  3BDD A;  4Y4R A;  2R0Q C;  1R7J A;  4WXD A;  1JKR C;  1E17 A;  1NK3 P;  2F5E A;  2N8G A;  5EDN A;  2EZH A;  2K86 A;  1MBJ A;  2HOE A;  5E8I A;  1Z3Y A;  2BBY A;  3VPR A;  1BC8 C;  3RSN A;  2CH0 A;  3QPL A;  5IPA A;  2KFD A;  5ILU A;  4U7D A;  2OZU A;  3LMM A;  1FSH A;  4HST A;  1OKR A;  3GO5 A;  2EFO A;  1U2W A;  5GPA A;  4FIS A;  5FLV A;  2WAQ A;  1K83 J;  1U5T B;  2AQE A;  4HNV A;  3S14 J;  4HA8 A;  5D5U B;  1TWC J;  2EA4 A;  3JRA A;  2JA5 J;  3QPT A;  4CSW A;  3VDX A;  4BL0 B;  1RR8 C;  4GRI A;  4I7H A;  5FKK A;  1X1A A;  1XDS A;  4ZYE A;  4I76 A;  2R7V A;  3I71 A;  2DMU A;  1UCR A;  1I6H J;  2VLA A;  2PLY A;  2K02 A;  1X3U A;  2LH9 A;  4ZYD A;  2L0K A;  3DFG A;  4IEJ A;  1PVE A;  3QQA A;  3OYL A;  4HLY A;  4RGR A;  3I55 I;  2KZV A;  5EG0 B;  3AG1 H;  3HKZ A;  1FTT A;  1GXP A;  3LSG A;  4OU0 A;  1QPI A;  2ACJ A;  5BOX A;  4BDZ A;  2E2J J;  4ZZL A;  4M6Y A;  4RB2 C;  1OCO H;  2KIS A;  1MDM B;  2E1O A;  1EJ9 A;  3LSI A;  4IJA A;  1USS A;  1X3W B;  2O03 A;  3COA C;  1VQ4 I;  3G3Z A;  1F4K A;  2HKX A;  3BJA A;  3WTV C;  4J00 A;  3PO3 J;  3BG6 A;  1FLI A;  4NQW B;  1IG7 A;  2ZXJ A;  3GTJ J;  3H0D A;  1T0F C;  2DTZ A;  3RIR A;  3S32 A;  3DV8 A;  3S2D J;  3WGH A;  1FX7 A;  1LEA A;  4C3I J;  1XS9 A;  3CMY A;  3B02 A;  1B59 A;  2ZCW A;  2DI3 A;  3VYR B;  4NB5 A;  1LNW A;  2AXL A;  2R7W A;  2K4J A;  1LB2 A;  2FE3 A;  2MC3 A;  4A93 J;  3JRG A;  2ISZ A;  2ID6 A;  3OIQ A;  5J3L A;  1BI1 A;  2CFX A;  2L01 A;  4ENM A;  1D0X A;  1ZRD A;  3OYJ A;  4UXN A;  1AU7 A;  3FIW A;  5CQE A;  2ZFU A;  3BLY A;  1WVR A;  5KAI C;  3H5N A;  2DDB A;  2LVS A;  4OMY A;  3BCB A;  5DDG A;  4RM2 A;  1STZ A;  2XSD C;  5E3L A;  3MKW B;  4E7K A;  1TWH J;  3AFH A;  2R4G A;  2Z33 A;  1VZ0 A;  1EH8 A;  3BG7 A;  3WTZ A;  1V55 H;  3D5S C;  4JQF A;  1IO2 A;  1S7O A;  3SDB A;  2R5Z A;  5AIQ A;  2M8G X;  2DFI A;  2R7R A;  3SEZ A;  3OYC A;  1VQP I;  2XB5 A;  2XAG A;  3M8E A;  2B0L A;  3DCF A;  1MMN A;  2ZKZ A;  3ZQQ A;  1HDP A;  2HVQ A;  4S05 A;  3MZH A;  2LY9 A;  4A6D A;  2RN7 A;  4IVN A;  5BNG A;  1W7P A;  3CJQ B;  4F92 B;  2HEO A;  4F52 A;  1MD0 A;  1R36 A;  4IO9 F;  4IKF A;  3H9J A;  2EIK H;  3AL0 C;  2NVT J;  3C1D A;  2QQA A;  2BYV E;  3WE2 A;  3OL3 A;  4ZDP A;  2P7V B;  5FKO A;  4Y3O A;  2XKO A;  1XGS A;  3IH3 A;  2W48 A;  3K2Z A;  1IN6 A;  2E5N A;  4LIT A;  2MFZ A;  1IRF A;  1VQO I;  2P5K A;  3O8H A;  4A3J J;  2P6T A;  4RBO A;  3GTG J;  1R5H A;  3GBG A;  4XN3 A;  4XRS G;  2BW3 B;  1LE8 A;  1NG6 A;  4UB6 C;  3X2Q H;  1J0R A;  3V7R A;  4CYD A;  2B9S A;  1OCT C;  4HZF A;  4XRF A;  3BPV A;  1JJ6 C;  2KIF A;  1I3A A;  4EM0 B;  4ETS A;  4G6Q A;  2X51 A;  1W5S A;  2YU3 A;  5DYM A;  2NOG A;  5BQT A;  2DYS H;  4UHT A;  2CWE A;  2XAH A;  3DTE A;  4F3Q A;  3BZK A;  4F7Z A;  3R4K A;  3GTQ J;  4G9Y A;  3OS2 A;  1EH7 A;  4CCJ A;  3H5R A;  1D0Z A;  4M9X A;  5CVU A;  1FP2 A;  4A3I J;  2LMD A;  3GCM A;  1GT0 C;  4P1W A;  1K61 A;  4FAS D;  2W1O A;  3TP3 A;  3MKL A;  1TWG J;  1ETQ A;  4U88 A;  3CJT B;  3WG9 A;  3K4J A;  1YJW I;  2PJP A;  1YI2 I;  5AON A;  2E60 A;  2HQR A;  2TCT A;  2VBW A;  2ZXH A;  5ICG A;  5LBQ A;  5F0F A;  3H9Q A;  1R5G A;  4I0B A;  4NDL A;  4S0H B;  3HOV J;  3ERM A;  3E6C C;  2CW7 A;  4L5E A;  2HVR A;  1WH7 A;  3CCJ I;  3J7Z I;  3VYU B;  4L5J A;  3HSR A;  1FBU A; 
#chains in the Genus database with same CATH homology
 1VQ7 I;  3I55 I;  3CD6 I;  5GAE J;  4IOC F;  3CCR I;  4IO9 F;  1S72 I;  3PIP F;  2QEX I;  1VQN I;  3CC7 I;  2OTJ I;  1ACI A;  1HC8 A;  5DM7 F;  1Y39 A;  3CCM I;  3CCU I;  3DLL F;  1VQ5 I;  1FOY A;  3G4S I;  4IOA F;  3I56 I;  4UY8 I;  2H8W A;  3CJT B;  3CCQ I;  3J7Y J;  2ZJP F;  5GAD J;  3CMA I;  2ZJR F;  3CCS I;  1VQP I;  1YJW I;  1VQK I;  5GAH J;  3CCV I;  5DM6 F;  2ZJQ F;  3CCE I;  2FOW A;  1YI2 I;  1YJN I;  1QA6 A;  2NXN B;  1VQ8 I;  2OTL I;  1YHQ I;  1VQ4 I;  2K3F A;  3CCL I;  2E34 A;  1YIT I;  2QA4 I;  1VQO I;  2JQ7 A;  1MMS A;  2E36 A;  3G71 I;  3CME I;  1YIJ I;  5JVG F;  1FOX A;  3PIO F;  1VQM I;  1YJ9 I;  1VQ6 I;  1VQ9 I;  3CC2 I;  4V19 K;  1FOW A;  3CC4 I;  3CF5 F;  3G6E I;  3J7Z I;  3CCJ I;  2E35 A;  5GAG J;  1VQL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...