1YIJI

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yijI00
1YITI 5GAHJ 3CF5F 3CMEI 3I56I 3G4SI 3G71I 3CCUI 1YJ9I 3PIPF 3CCEI 3I55I 3CC7I 3CCVI 5DM7F 1Y39A 1YIJI 5GADJ 3J7ZI 1ACIA 2ZJRF 1VQ5I 3CC4I 2K3FA 3CC2I 1YJNI 2OTJI 2QEXI 4IOCF 2FOWA 3J7YJ 3DLLF 3CCLI 3CJTB 2ZJPF 3CCJI 3G6EI 2ZJQF 5DM6F 2E35A 1VQLI 3CCMI 3CD6I 1VQMI 1YJWI 1YI2I 1VQ6I 4IOAF 1VQPI 1FOXA 4UY8I 1YHQI 1VQKI 2OTLI 5GAEJ 3CMAI 1FOYA 5JVGF 1VQ4I 1FOWA 1HC8A 1MMSA 1VQ8I 1VQNI 2E36A 3PIOF 1S72I 4IO9F 3CCQI 2QA4I 1QA6A 1VQ9I 5GAGJ 1VQOI 2E34A 2NXNB 4V19K 3CCSI 2JQ7A 1VQ7I 3CCRI 2H8WA
chains in the Genus database with same CATH superfamily
1U0JA 4HSTA 5EYRA 4QTRA 4M9SA 2X0LA 2MFZA 2F5EA 1NK2P 3CO7C 3GTKJ 3QPTA 4ENNA 3FISA 1LJ9A 3M8EA 4HLYA 4XN0A 1LNWA 4NB5A 5FD5A 1MGTA 2W1OA 2R7QA 5HDNA 1B6AA 4XLPF 2IA0A 1OJLA 4C2MJ 3HRMA 3HXLA 2WBMA 2GIVA 2W00A 4L9TA 2ISZA 2PN6A 3OYIA 3EYIA 2HPIA 3GZ5A 3FXOA 2MW8A 4Y4RA 5GP9A 2UZKA 4FCYA 1MMAA 1TWAJ 2EV0A 5E79C 1W5CC 2JRMA 3A4CA 3K2ZA 1I39A 2CRGA 1YRNB 4FHTA 3LSGA 1K78B 5CVIA 4E4HA 3SQNA 5GADJ 2GA2A 1I3AA 3OYJA 1I5ZA 2FBIA 3K6GA 3FHNA 4O3MA 3B02A 1I1GA 2X51A 1R6RA 4OAYA 2FUG2 1Y6IA 4HZFA 2I8DA 3DCFA 1JTXA 2DDAA 3C2GA 3LSTA 2Z16A 4PJJA 3B6AA 4ETSA 1X3ZB 3O2PE 2TRTA 4RDUA 2X6OA 2E2JJ 4KUMA 3ASOH 3LSRA 2KZVA 1U2WA 4CCMA 2CUFA 1BIAA 1KU3A 2F5FA 4EV0A 3G6EI 1KU2A 2B63J 5D8KB 1IN7A 4AYBA 4S04A 3A0BC 2JT1A 4CO8A 4A3DJ 1R5GA 1VQMI 2XRNA 2COBA 5DCMA 3WODF 1A6QA 1KA8A 2Z2SB 1YYVA 4HRIA 2IGKA 1ODDA 3CP2A 1YHQI 1ETQA 1WSUA 3W2WA 4I99C 3DU5A 2DA5A 1P9QC 2VJ5A 2ZXHA 4A3CJ 2FE3A 2E1NA 1J5YA 1B8IA 1AKHB 2LP0A 4M3EA 3WTYC 3K1NA 3H92A 3GEZA 3Q3SA 5HS9A 1SFOJ 3KZZA 4UUSB 3E5UA 2IGMA 1KU7A 1HC8A 1TW2A 3PL8A 1S7EA 2K02A 2UUZA 2M2EA 2J5PA 1A36A 3ZQCA 3S1MJ 1IN5A 2DLLA 2VPLA 1X2NA 4HX7A 3AFHA 5GTIC 1T2KA 1QU3A 4G94A 2L02A 4EJWA 1E0EA 3GO5A 3GXOA 1IXSB 3LSIA 2MABA 2OBPA 1JUPA 2EB7A 1X4OA 2M5WA 2E7WA 3BQZA 3KCCA 4C3JJ 3I59B 2ZXJA 3T8TA 2D5VA 3CCRI 2GXBA 1K6YA 3U21A 2A61A 3AG1H 3L7WA 3O6BB 2HTJA 1Z3XA 3E6CC 4YG2F 1MBJA 2X9DA 3DV8A 3E6DA 2EZHA 4XKCA 3FM3A 2OZ6A 3OYHA 2DA1A 4ZH4F 4M74A 4LK1F 1SFEA 2VN2A 4W1UA 1I6HJ 2NVQJ 1OISA 2DPDA 4II3A 2XF7A 1XG1A 4AU7A 1DUXC 3BTLA 5B66C 2YR2A 4Y33A 1ULYA 1NG7A 3CCEI 4G7OF 1O3SA 1FMVA 3HDDA 3HSEA 3MKWB 3B6CA 4B47A 2ZFUA 3KZIC 3JRCA 2O9LA 3EUKL 2V1UA 2P81A 3CF2A 5J1RA 4D7MA 3KEOA 2ZJRF 3RQ4A 3BCBA 2L4AA 1LFUP 1T95A 1LKXA 2X1CA 3PUFA 2VKDA 3RJPA 3SHFA 1V5EA 2VXDA 2BY2A 4P1WA 5K5RA 4C9YA 4XLEA 4RGRA 5IOZA 3HPGA 3F6VA 4KT5C 3GTJJ 1N75A 1FIAA 1TZLA 1V54H 2MG4A 1UJ8A 1R22A 4A6EA 4FTHA 5K5QA 2MYSA 2CQXA 2HEOA 1FNNA 1DDNA 4I6ZA 5ICEA 2XPWA 3SZPA 3DKWA 3HRTA 3G1OA 4G8XA 3GW2A 2K4JA 2Z99A 1W0TA 3HKZN 2JVHA 5M5YJ 3CJNA 2FBKA 2LSOA 1YOVB 2V6CA 1ON1A 3TP3A 2FMYA 5M3FJ 5CLSA 1SANA 2DFIA 3MMYB 2HXOA 2NOGA 1X3UA 1B1BA 2YX4A 1GXQA 2FF4A 2LC2A 2O0YA 4G6TB 1EH7A 2EK5A 1BIBA 1JE8A 3MN2A 5LD2C 1Z77A 3L1PA 3AG4H 4PSXA 1FTZA 2QGUA 1I1SA 3B73A 1V5GA 1QRYA 2NVUB 3BP8A 3EUAA 1YFHA 4AIKA 4I02A 1HDDC 2DCEA 4E7LA 2XB5A 1ORKA 2DO7A 4UB6C 1F9NA 1QHHD 5F0FA 3E1SA 4IX7A 1F5TA 2Y0MA 1ZAOA 2GZWA 4XBFA 3F21A 1A04A 4BY7J 1H0MA 4IVNA 4HF2A 2DOFA 3VB2A 1QO0D 5DTDA 3CO6C 4HX4A 2L3DA 3OIQA 3TGNA 3H35A 2XKOA 1VTNC 3G4SI 1ZN2A 3QAHA 1ZRCA 1OKRA 1ZELA 3CCUI 1YJ9I 4A3IJ 4PFPA 1BOAA 2K9NA 3A0HC 1XDSA 1YQAA 2XGCA 4NQWB 4Q4ZF 2KIUA 3K1MA 1EV7A 1WGXA 5L3BA 3I0TA 2EQRA 3L2WA 4RS8A 3AG2H 3HOUJ 3HUGB 1TQPA 1Y8QB 1K79A 4P96A 2M1BA 2BY3A 3DBRB 3KE2A 3KFWX 3Q9SA 2HZTA 4BBSJ 1S7OA 4A6DA 4M72A 4FE7A 5E3LA 2L7FP 3BG9A 3GCMA 4JX5A 1TNSA 2DPUA 2BXZA 3FXUA 4G12A 3DBHB 2W82A 1V5FA 2KIFA 3HTUA 3SXYA 1QPMA 2VJJA 3TL4X 4KT6A 4GYGA 3EQLF 1TWGJ 2E5ZA 5J8CA 3CCJI 2ME6A 4JQFA 2DMTA 3DPLC 3P9IA 2HZDA 3BR3A 3P7NA 4IZZA 4N4NB 4MQVA 2KQRA 2ZMEB 2L9NA 3PFIA 3LSHA 3H3UA 5EG0A 5FLXK 1TTYA 4EJVA 1U5TB 4B3AA 3RKXA 4LG0B 1P4XA 1LUJB 3S1QJ 4A3EJ 1H9TA 2VI6A 1LVKA 1CF7B 3WU1B 3IH3A 2OQGA 3H5AA 3KP7A 4QPOA 2D1HA 4B43A 1R7JA 1FBUA 2YX7A 4ZJZA 1IO2A 1WCMJ 2CW7A 2P4WA 5DDGA 2KP6A 3MVPA 4F93B 4HG2A 4BH9A 1JGGA 1MJBA 1FLIA 1LFPA 4E70A 2R7ZJ 3HKZA 2DODA 3ULQB 3RIRA 1Z7UA 2JA8J 4HNUA 2LK2A 2X1DA 3F8CA 1FYKA 3QU3A 4OINF 3OYEA 3W2AA 2ESHA 3T0YA 5DD4A 4NHJA 5JI6A 1D0XA 1W36C 1EF4A 5F27A 1R23A 2JUGA 4R8HA 4MO7A 3WE2A 4DYCA 2PFBA 1XCVA 3ZR8X 4IPAA 4D5FA 3DTEA 2JA2A 1IXRC 2GLOA 1Z6RA 4D5CA 2OCEA 5ED4A 1YITI 2HOEA 3QWLA 1MNMC 4U7BA 1FSHA 4KN7X 2GOXB 1OMIA 1BJZA 3DPUA 5GPAA 3WTZA 3MKZA 1RI7A 2MH2A 2PJRA 1B59A 2BOLA 3GTPJ 4KICA 1J09A 2EWNA 3NAUA 4XNFA 1V3FA 1MDMB 4E7KA 2VL8A 2DMNA 4Q5SF 4AIHA 3M7GA 4EGYA 5HODA 1K4SA 1ETOA 5IP6A 2HDDA 1A6IA 2EA2A 4NC6A 3HOWJ 1NTCA 2XAJA 5ICGA 3HOXJ 3VFZA 2PJPA 3M07A 2UXXA 2IXSA 1K6OA 3WTVC 1RKTA 2F2EA 3KYCB 2QBYB 1N25A 3L2UA 5IT9Z 3J7ZI 2E2IJ 3RYRA 2MD5A 3IAM2 3HPHA 3TQNA 1DGWY 3TKYA 1A35A 4N9IA 1XSDA 1QVUA 3HRUA 5DS9A 2ECBA 3ZOBA 5HNFA 1A5JA 1I27A 1FP1D 2OTJI 3HEFA 4I0AA 4I09A 2QQBA 5CVJA 3BTCA 5KHDA 2BEOA 3DEEA 2QSGX 4OWRB 2VKEA 3OWTA 5J47A 1O3TA 2CQNA 1SD4A 4P9UA 4IHVA 2A3SA 3BJAA 2R7RA 2HFHA 4KIBA 5CKTA 2ZJQF 2RNJA 3TP0A 5FJ8J 4WK8F 5F6FA 5H6RA 1Z0XA 1L3LA 2KIMA 3V42A 4ZDPA 4Y15A 4UB8C 3OYFA 3IHUA 2YPRA 4G6QA 2CMPA 4HNVA 2ZFWA 2WV0A 3IP4B 3BC8A 3TBIA 1R00A 3K1PA 5LEJA 4LIUA 3W3CA 2M4KA 3BR0A 3FX3A 3DF8A 3X2QH 4RMNA 3C7JA 2M4GA 3OS2A 2MC3A 4B09A 3G1LA 3K69A 4IHWA 2R5YA 2XGEA 5GPCA 5EJCA 3VODA 4A0ZA 1VQNI 4IKFA 3VDXA 2DXIA 2WADA 4EJTA 2HTSA 5DUIA 9ANTA 3ZCOA 1JT6A 4PFOA 2AXLA 2EPFA 2Q0OA 2Y48A 4A69C 3DTIA 1SVMA 2G9WA 3M4OJ 2MA3A 2ETHA 2M3AA 2E1MB 3LA7A 3MEXA 5E8GA 4DBQA 3WE3A 1TL8A 3LMMA 2LLKA 1ENHA 2HI3A 2Y31A 2YS9A 4ZYEA 1IN6A 3BOQA 3FXMA 1WRJA 2Q1ZB 2IS4A 3QOEA 3BTJA 3J81K 1RETA 1WJ5A 3ZQFA 4PGHA 5DYMA 2R7UA 2QQ9A 1FSEA 4ASNA 2H8RA 2DI3A 3KEYA 3H9GA 2ID3A 2OV7A 1XSXA 4XRSA 1MSEC 4GDFA 2LKPA 2HOSA 3OY9A 5IT9K 4XICA 1ZG1A 5F0CA 4EMSA 4HW0A 3S2DJ 4AVZA 4DGWB 2VLAA 1NH3A 1PP8F 5F08A 3T8RA 1YE9A 2E19A 3PO2J 1PUEE 1CQTA 2BW3B 1X3WB 2DFHA 3LSMA 1WZ2A 3TW6A 5K5OA 5EDNA 3ONQA 3CLOA 3HB9A 1W7PA 4M3DA 4M9XA 4XLFA 3CDLA 3GF2A 3MKYB 2RREA 4G7HF 3CC2I 4L9JA 3HOSA 3TOAA 1QZZA 3K4LA 2QEXI 2CW0F 1IRZA 1G4DA 1W4MA 2Y9ZA 2FOWA 2OPTA 1EKEA 1ZTRA 3BDDA 3LQRA 4KA4A 3RKYA 1HW2A 1QGPA 2DQRA 4AM3A 4GXOA 2JA5J 3RYPA 1SMTA 2E7XA 3H3VK 1PJRA 5LEKA 2WC2A 4HV6A 1DGRM 4B48A 4FT8A 5E1XA 4BYYA 5CYVA 5F0HA 4HNTA 1YS7A 3DWLE 3LA2A 3OSFA 2E35A 1LEAA 2XIGA 3CESA 1UHWA 5FRNA 4BQNA 2R92J 2Z9OA 1JKOC 3GFJA 5EGOA 1XS9A 1WQ2A 4B44A 4KISA 2ZNZA 4BGDA 2M34A 1QPIA 4BL0B 3OV8A 2OTLI 2P7VB 3UR3C 4L9NA 3CMAI 4OAZA 4MEXF 1YW8A 2E60A 3ESWB 2IP2A 3E5QA 4XKBA 2COMA 1MZBA 2DT6A 3UNGC 3LSKA 4KIFA 5J1UA 1AWCA 2G0EA 1E2XA 1RUOA 1JXSA 1STZA 4IO9F 3GTOJ 3CCQI 4ZDOA 2JPCA 2XAQA 2XF6A 1JI8A 4RB0A 3QP6A 5EZHA 1L0OC 3H0GJ 3VSKA 1BR2A 4BXXJ 1ETKA 4K2EA 4RAFA 2O61A 4BJTA 3HOZJ 4ZYAA 3DLAA 4QLCU 5D4RA 4HAMA 1P92A 5D5XB 1G3SA 3FXKA 2ECCA 2XASA 4HBLA 4ZDLA 1FPQA 2WY7Q 4I01A 3CF5F 2Q2EB 3A01A 4KFCA 1BBYA 4V2GA 3I58A 2LBFA 2ZBKA 2ME0A 2O8KA 2AO9A 1SVOA 1JKRC 2LTPA 3AKZA 4LB6B 3ABKH 2XB0X 2QSFX 4ENJA 1E17A 2X4HA 3MWMA 5LLQA 3W6VA 4HA8A 2HVRA 1G3TA 2LOOA 2XRLA 2WWYA 4LG3A 2L9RA 5IYBJ 1FBSA 1R1VA 2HU9A 3W6KB 2LKXA 3S2WA 1JHHA 1LQ1A 2Z3YA 3AL0C 3LSJA 5F1RA 1XGMA 5FLMJ 3WTSC 1OYWA 4XLNF 3BR1A 4XONA 3HL2A 3HGGA 5FKNA 3LSPA 2FNPA 2VQGA 2A68F 2IGOA 4IQ4A 1FY7A 5FFZA 1UMQA 4RA2A 5IOYA 2KHMA 3I3LA 3REOA 1ZR2A 2RQQA 3H3ZA 1W5TA 1KU9A 1IGNA 1WI3A 3RDIA 3H1CA 5HDGA 2EZIA 1ZRDA 2Y75A 5DM6F 2E71A 1BA5A 3S14J 4KDPA 1X19A 1HW1A 1YJWI 2BV6A 3ZP5A 3S3MA 3RKWA 4EQQA 4IOAF 2IS1A 4A0XA 2YUSA 1WH7A 1NK3P 4RAYA 1GLNA 4F91B 5CJ9A 5LGNA 3K4NA 2LREA 1YW7A 1E3OC 2OUMA 2FQ3A 4CSWA 2PI0A 3JRGA 2HOTA 4UV8A 1ZQ3P 3C2BA 3ECOA 5HS7A 3FXJA 3W2VA 2RV8A 3A03A 1ZH5A 2XHKA 4B3XA 1GUUA 2W4SA 5KCMA 5L3CA 3JSOA 1HSTA 1ON2A 1LDDA 5GAGJ 2JWTA 2E5NA 3GMEA 2QQ8A 4JK1X 4WWCA 1GVDA 1XN7A 4OU0A 4V19K 3F8FA 3ZN1A 4Y52J 2DMQA 1U8BA 3A02A 3PM1A 4OIOF 3HHHA 1U9OA 1F43A 3V7RA 4F7ZA 5KAIC 2IAIA 1YRNA 5DV5A 1K78A 3GVAA 2R7VA 1Z1DA 1DU0A 3IKVA 3JRFA 3RCOA 1H8AC 4QSHA 2F6CA 2CWEA 4IJAA 2ZNYA 2VIXA 2QCOA 2D1VA 2CYYA 1S6LA 3OYCA 2CQQA 2J5OA 1REPC 2QYOA 4L0YB 1Q1VA 3P9KA 1LVAA 5E3MA 4TV7A 4M73A 4EJOA 2R7TA 2CO5A 3TW7A 4CH7A 3I5UA 1MNDA 5EZGA 3ABLH 3V8KA 5HNHA 4DZJA 3CCVI 4MTEA 4D7NA 1WJBA 4BEHB 4XRFA 2L01A 2VUMJ 4G6DA 1YO5C 2JSCA 1ZHFA 1HXDA 3HOVJ 5J40A 4JP0A 3IWZA 1FT9A 3K4KA 3H36A 4YIRX 3CUQB 4A3LJ 4RB2C 4MFEA 3M8FA 2MH9A 2K27A 2JA6J 4IHYA 1A31A 1J75A 2DW4A 5B1BH 1RNLA 2KDZA 4DNCA 4QPQA 5D8LB 3RZOJ 1ETWA 1IN8A 4LIVA 1YW9A 4HLXA 4RLFA 1U6GA 2MBFA 1IN4A 1TP4A 2H6CA 2XROA 1AKHA 3FBIB 2IS6A 4A3FJ 4UUSA 3M1CA 1Q1HA 1MJ9A 1NG6A 2DBBA 5BPDA 4BY1J 2R7WA 3OSGA 5CQGA 4YFXF 3E5XA 3MQ0A 4NNJA 3K70D 3CUOA 4Q47A 1IAWA 1YS6A 4L5EA 4RBOA 3MZ8A 1JT0A 3OMYA 1TQIA 2VE8A 2QENA 3L2QA 1EA3A 3HRSA 2X6YA 4KITB 3V7CA 2JRTA 4MHGA 1ITYA 3GTLJ 5JFRA 1G3WA 1VQ4I 2CQ7A 3I59A 3EYYA 3JRBA 2BY0A 2M0MA 1LE8B 1X4PA 3E97A 1JGSA 5C44J 1J9IA 2DTRA 2B0LA 3FK6A 3GUDA 2WAQN 2STWA 1S8NA 3GX4X 3F72A 2P5LC 4OMYA 3D1NI 1XB4A 1Y1VJ 3ERMA 4ON0A 1EH6A 4HDVA 4EM2A 5KVRA 1P6RA 4FX4A 3BG6A 2BVMA 4RM2A 4XLCA 5F04A 5D6FA 4BE1A 1ZK8A 1MBEA 3S16J 4XRMA 2PMZN 3HGYA 5CVVA 4DYQA 5E8IA 2Y30A 3OIPA 2IRFG 3E6BA 4PCQA 1KQ0A 3BR6A 5B3SH 3ZMUA 3CTAA 3R4KA 2DOAA 4DZPA 2NRAC 4AVPA 4EM0B 1F4KA 3FIWA 1WJEA 2QWWA 3DBLB 2BVLA 4MIMA 1O57A 1DU6A 4IQJA 3BPXA 2DT5A 3HSFA 5LGTA 3ZMVA 3Q0UA 4OOIA 3K2AA 4ZZDA 1W5SA 4H4KC 3K7AJ 5FKLA 2JSPA 5FRMA 1OR7A 5LRSA 2VPRA 1MNEA 2VKHA 2HVSA 1D0ZA 1SVLA 3KLNA 1SD7A 1OCTC 2UWMA 1XX5A 2V4JC 3K4BA 2IVMA 4UVAA 1IW7F 2EIKH 2NNYA 3F22A 1RZ4A 1HSJA 3L9FA 3PSIA 2E1OA 2HPMA 2RDPA 3MKLA 2H94A 3RKQA 3RZDJ 1J59A 2A05A 3WTXC 2NVTJ 3QODA 4XL9A 4M9ZA 4ESFA 2Y0SN 4PJNA 3BZKA 2HWVA 1IRGA 4ANJA 1Y56A 4PZJA 2XAFA 1R5HA 2PX9A 2YSRA 1OCCH 4RB1A 1P7IA 1KYWA 2KKOA 3KX2A 4O5VA 1R1TA 2XSJC 3K0LA 2EV5A 2GBYA 2DYSH 2FSWA 3H5NA 2X6XA 1WJCA 3OOUA 2UV1A 1YI2I 2ELHA 4P55A 1LDKB 2O8XA 3C18A 4A3GJ 5IY5H 4UV9A 2A07F 2FXAA 1J7KA 2Z33A 4UXNA 1TWHJ 3R6SA 3CMMA 5AIPA 4ABZA 4E7IA 5EEAA 1RRJA 2FD5A 1D1BA 5A2QZ 4ESBA 1O3RA 2VASA 5M5XJ 4BKXA 1FC3A 2P8TA 4WF2A 3MZYA 2LYCA 4XLAA 3JR9A 3ZMTA 1W7PD 1TNTA 5FFXA 3OL4A 1GV2A 1T6SA 2KPMA 2K86A 5E1ZB 2P7CB 2TDXA 5JLWA 4EEFG 3KP2A 2QA4I 5FKMA 2CFXA 2CS3A 1TBXA 2GIZA 5CVUA 4L0ZB 1U3EM 1KYZA 2VQCA 4M3BA 4E6KG 5KAFC 2JQ7A 2VONA 3HM5A 4NQWA 4MFDA 3BG7A 3QPSA 3ZRGA 5D5VB 2H8WA 2EZKA 4A3KJ 4E7HA 3HUGA 1IRFA 2WAQA 1SC7A 1IF1A 1TWCJ 4HV5A 3IRQA 1JJ6C 2ZJ2A 3P9CA 4AIJA 3ZQLA 3JSPA 1WJDA 3I56I 2O3FA 2IW5A 4JOMA 4FASD 1V4RA 2FQ4A 3QYEA 1QVTA 4HX8A 1X1PA 4MNUA 1UELB 4J00A 1SFUA 3WG9A 1OYYA 3HYIA 3I71A 3P5JA 1Y39A 3F23A 2M45A 3PO3J 3GLLA 4I7HA 4FX0A 1MIJA 1USTA 1BL0A 2LFBA 1ETYA 3DKYA 1FX7A 2G7HA 2FBHA 4CYCB 4PJMA 2ZMEA 2HYFA 1OQYA 1T33A 2FOKA 3OOPA 5JHUA 1ZRFA 3T1BA 2CV0A 1WVRA 3I4NJ 1U5TA 1IRXA 2EILH 3FM5A 3J7YJ 3O8HA 5BNGA 4LG0A 4BAYA 3LQQA 2VBYA 4EJUA 1APLC 3E3VA 3N05A 2DU9A 5F64A 1CF7A 5LRRA 5FD6A 5HDKA 3GTMJ 1LFBA 2CJJA 2JTVA 4N9HA 2R7DA 3HOYJ 4M6VA 2EFOA 5K7FA 2O6GE 1BC7C 1PVEA 1VI0A 3OYKA 1TC3C 2VE9A 1BN5A 1RKWA 3HIFA 3ZGKA 6PAXA 1D5VA 5AIQA 3ZPLA 4LOCA 1T0FA 2Y0SA 2YU3A 4AC0A 2TCTA 5A2QK 3ASNH 1KQ9A 3PNYA 4GO1A 2W85A 1UHMA 2W57A 4PJ0C 4WXDA 4BDZA 3WU2C 2WAEA 1RESA 3MFKA 2HXIA 3S93A 1XMKA 3EUHA 2KZGA 3HTSB 1IV6A 1FYMA 2FJ1A 2R7SA 3K4CA 3WTTC 1SAUA 5IYCJ 3IAS2 3M1EA 4U0VA 2FMLA 5H6QA 2R7FA 3S2HJ 1H9GA 1KGSA 5ICCA 4R79A 2BBYA 1MDMA 4A3BJ 5D5WB 4AUXA 3JW4A 1F1ZA 2DK8A 3OYAA 2GAUA 2CV1A 2XPUA 1ZR4A 2XAGA 2ZC2A 1U8RA 2Y2ZA 3ELKA 4KNYA 1YIOA 3VPRA 3PSFA 2XF5A 1JTYA 4XQFA 1R71A 4KN4X 2QBYA 3ZMSA 2ZCWA 3SEZA 3BCAA 2VQLA 2VJ4A 1XPXA 4BHCA 3ZXSA 2STTA 3ZQHA 2ID6A 2W25A 1T38A 1XSVA 3KLOA 1R4MB 5IPAA 2JJ7A 4XM3A 4FQGA 1Y1WJ 4IRIA 3HJEA 3BROA 1E3HA 4G9YA 1XCBA 3GTQJ 1WI9A 2DA7A 1P4AA 1BR4A 2BGCA 1JKQC 4BQQA 2NS7A 4PUSA 2VKVA 1ZLJA 1ACIA 1MD0A 1RPWA 4E7JA 1N78A 1D8JA 2OZUA 4A93J 3V7SA 3S1NJ 2ICWG 2K3FA 3DU6A 1B72B 2ACJA 2LY9A 1J2XA 1YJNI 1WFXA 3OYMA 2E1CA 1D1AA 4BDYA 2EV6A 5L3FA 1HF0A 1BI2A 1GXPA 4HQMA 2ELKA 3CCLI 1BW5A 4N0BA 1S5LC 1RR7A 1MMDA 3D0SA 2O03A 4C3HJ 4P9FA 3VYUB 1XGNA 3WGHA 1YX3A 4C3IJ 4DIQA 1X1DA 3K10A 3K70C 1P4WA 1U5TC 1VQLI 2BY1A 5FB2A 1Z05A 4RM3A 5HLGA 2EFWA 5DD8A 1BR1A 1WJFA 2CUJA 3TO6A 3KP4A 1MW7A 2G7UA 2XKPA 5FROA 2QVOA 3U9GA 4J19A 1PUFB 2HOAA 2L9VA 3IC7A 1FP2A 3M3YJ 2F5DA 3MD2A 2GA1A 4JX6A 3OR2C 2RN7A 5JVGF 1IUFA 1MMGA 1FEXA 1S29A 2KRFA 2L7ZA 4KYWA 4XKVA 2HQ5A 1UHSA 4E7ZA 2NOJB 2RNGA 3R61A 1MMSA 3Q0VA 4MTDA 4CDGA 2BHZA 2QM3A 2E2HJ 3ABTA 1XGSA 1DPRA 1R1UA 4F3QA 5GTHC 1D3YA 1JHFA 3PIOF 2R7OA 2XUBA 4E7SA 2CH0A 2WV1A 1KZHA 3SFIA 4IHXA 2M7BA 4BU2A 3PNVA 3DPTA 1IUYA 3PFYA 3TDUC 3C3WA 1DP7P 1R5ID 3EUHC 3BR2A 3QYFA 4CA0A 1B9NA 3ZMDA 5DCFA 3DEUA 2VJIA 2HGCA 5GAHJ 4IRHA 5HVQC 2HQAA 1HLVA 1G2HA 3LFUA 2BW3A 4BE0A 4LB5A 4I2OA 3JCUC 1BI0A 1TT0A 1JJ8C 2R5ZB 3GLXA 3GBGA 4XKWA 4XIDA 1POGA 4HF0A 4B8XA 1JKPC 1BI1A 2KL4A 2K5CA 4S0HB 2F4IA 3BPVA 2OQRA 2KRCA 3BJ6A 1Z21A 5DM7F 2UXNA 1VFCA 1WH5A 2FEZA 3FMSA 3QYBA 1GHCA 3L00A 2DK5A 4XOPA 1I3QJ 2DT7B 4Y13A 3ABMH 1R36A 3MZHA 1UCRA 4YELA 4CZCA 1GVJA 2F5CA 3FF5A 1ZG3A 5EEHA 4J01A 4IOCF 3KETA 2M9HA 5J1YA 2KISA 1HW5A 3FWEA 1O7LA 2NNNA 3FHZA 2P5VA 1MH4A 1QZEA 4BHPA 4CCOA 2DJNA 2QLZA 3SYTA 2L5QA 4BE2A 1QNTA 3EPZA 5C4XJ 4EM1A 4HDUA 1SD6A 2V79A 4X1EA 2WB1N 2PBIA 2K40A 4LD5A 2X6WA 1C0WA 3F0CA 3QU6A 5IP9J 3FXRA 3L2VA 5IYDJ 2LVSA 3FZVA 3V4GA 1EH8A 2K85A 2ZXWH 5FGMA 4RAZA 2IA1A 2M0CA 1O7FA 2ELJA 2KJBA 2FX0A 1G3YA 1ETXA 2KFDA 4CXFA 2AQFA 1O4XA 2BZTA 3L09A 1WPKA 1Z67A 2R4GA 3H9JA 4I98B 2D45A 5DCMB 1CGPA 2VT3A 4LK0F 3VSLA 2Q2EA 2V1NA 3J7AO 1AHDP 2L7MP 4F55A 4FISA 4M3FA 2XDVA 2Z5UA 2H1LA 3RTRA 4W97A 1K4TA 1VQ9I 2E1MC 2CFOA 2WA0A 2E34A 5CVRA 1B8IB 1JUMA 1IG7A 3J80Z 5D5UB 2PQ8A 1WJAA 4DBRA 2M87A 1FYLA 2VOOA 4X0GA 3ERED 5DUKA 1XMAA 4BUPA 1MH3A 4Z6YA 5HLHA 2RQPA 3CJRB 3K4MA 4BQOA 4IF4A 1X1AA 3WTWC 4LLGF 1IDZA 3FMRA 4LGWA 3U1KA 4LLNA 2EIJH 1BI3A 3GFLA 3F9KA 3G71I 1X1CA 1ZGJA 4A5MA 1HKQA 5CQEA 2P6TA 2LMDA 3C2HA 2XGXA 4PK4A 4AWXB 3PJRA 3RPUA 2CUZA 2EZLA 2VBXA 1ZARA 2MLGA 2XAHA 1GDTA 4U87A 2L54A 4L9VA 2V9KA 3H9QA 4YFKF 3JRDA 5L3GA 2PMUA 4RB3C 1VQ5I 4CCJA 4F52A 4XRSG 3CC4I 1RIOH 1H89C 4BXFA 3GFMA 2QQAA 2RC4A 4A0YA 4CZZA 4M71A 1GT0C 4EATA 3Q5FA 3ZQ7A 1Z7LA 1UFMA 2OD5A 3C1DA 2DDBA 3OYGA 1G59A 2HS5A 3VYRB 2DOEA 2KT0A 4PGGA 3DLLF 3KYDB 3BTIA 1U78A 3S17J 2V9VA 3CJTB 3OIOA 2ZSIB 2L0KA 2KJCA 2KDOA 2NS0A 1Z9CA 4EGZA 1R4NB 3TMOA 2LKSA 3OS1A 2R7XA 1HKTA 1OYIA 4ZC3A 3S15J 2W24A 3Q0WA 2F4MB 4CYDA 1VNDA 3I4PA 4C30A 1HCRA 2PLYA 1NHAA 3L2CA 2GOMA 3H5RA 5ILVA 4GCVA 4NC7A 5H20A 1VQKI 1Z91A 3EDPA 2K9LA 3DEWA 4FETA 2LRDA 1TWFJ 2DTZA 2JA7J 3U1DA 4WCGA 1MMNA 4XR6A 1OCRH 4U88A 3CZ6A 2H09A 1ZG5A 3JTHA 4QIWN 4XSZF 4MQ9F 1FOWA 3OYBA 2FNAA 3BJOA 2WB1A 3D5LA 4IHSA 1XTAA 4MGRA 3ZQIA 1WHUA 5C4JJ 5B5EC 1R9TJ 3KEQA 2EFNA 3AG3H 3F6OA 4G7ZF 4GGGA 1XMXA 4HOBA 3J80K 1QA6A 3CQZJ 3I53A 4WX9A 1PP7U 3QRFF 3NEUA 3HG9A 4IL6C 3IH4A 1IV8A 1MSFC 1MBFA 4XK4A 3M8JA 1TQMA 2K9MA 1DQUA 2HQRA 4A3MJ 2VOPA 4X6AJ 4BEHA 5TISC 3HSRA 3A2KA 1MBHA 2K9SA 3WU0A 3N4MA 1RUNA 5E20A 3HOTA 4BQAA 5K1YA 3CUQA 3I54A 3W6JB 3PIPF 3UKGA 4QWQA 1V55H 1FMWA 1E3PA 2ESNA 1TT5B 2HYGD 2CSOA 4C2TA 2AHQA 2L7KA 2CG4A 1JUSA 5B1AH 4BHBA 2MC4A 4A2UA 4A3JJ 1IXCA 2FA5A 1I50J 4WXCA 4M6XA 5HS8A 2R3SA 4RGSA 2LD5A 1ZGWA 1R49A 3Q9VA 4ZTJA 3NRVA 4XOTA 5LHHA 2H1KA 5FLXZ 5D4SA 2WY8Q 1FTTA 2P0WA 4KIGA 4II2A 4ENMA 4BACA 3KZYA 1I6XA 3KYLA 2O5RA 2HQNA 3GWZA 2EH3A 2L4MA 3WG7H 2LF7A 3RSNA 1KQ8A 3KP3A 3NWSA 3S32A 3N97A 1LB2A 2RVCA 1H88C 4YIIA 5L3DA 2HKOA 3CCMI 4HQEA 1LE8A 2QZ8A 2O7OA 1D8KA 2QF7A 2ZO4A 1P7JA 2OC6A 3HBLA 1WKMA 3TEDA 2NS8A 1VQPI 3CDIA 4IEJA 2I5UA 3IWFA 3BT9A 2AS5F 2DFFA 4PSWA 2OA4A 3LNQA 4H0EA 3G73A 3FXLA 3OYLA 3HZJA 3NWTA 1K61A 3ZQQA 2OJED 5LBQA 3U2RA 3BZCA 3WGGA 4I0BA 5EG0B 5CPRB 2Y9YA 3NARA 3OS0A 2E36A 5KNLA 5JHFA 3PQKA 4BBRJ 3IV5A 2K7LA 5DEQA 2OF7A 2VBWA 3JREA 1UZCA 3V8JA 5J3LA 1ERDA 3IH2A 2H6BA 2IS2A 2VC1A 4LMYA 5J4YA 2EFPA 5E3OA 2CGPA 1IZ1A 1OCZH 2LY2A 2K4BA 1VQ7I 4A12A 2LDUA 3QPLA 1SMYF 4Z2YA 3LOCA 3O8GA 2YU9J 2JPBA 5HLIA 2VC0A 1R58A 4IRGA 3DP7A 2QSHX 2A6HF 3CMEI 2JVGA 1SEUA 1YX5A 3A1YA 2JZYA 4CCKA 3VEPA 1S7AA 5BOXA 1FIPA 5E18F 2Y69H 3BG3A 4MLOA 4XN3A 3M9AA 2DQLA 2A5YB 4CCLA 4IHTA 2KIQA 2LY1A 1UG2A 4ESJA 3F8BA 3LAPA 4BJ6C 5ERIA 5HLTA 1G6NA 3CC7I 4MEYF 4ZYHA 2IBDA 2XAUA 4BJ5C 2PJRB 4HF1A 1BJAA 4RGUA 2MSYA 4UUTA 4JYKA 1SFKA 3BZ6A 3CUQC 2KRHA 2NVYJ 2V6EA 2XSDC 3SZTA 2HVQA 1Y8RB 2GXAA 1LDJA 2CV2A 4UNOA 2RKHA 4XORA 3DFGA 3S3NA 4YRVA 3MCZA 3S8PA 2W84A 5L3EA 1S9HA 2XPVA 4B4CA 2X48A 3FK7A 1S3JA 2DA2A 3JRHA 1O3QA 1AU7A 2A69F 4GYIA 3TO9A 3CCYA 2GWRA 2PMZA 3O3KA 5J8FA 5LHGA 5M3MJ 2P6SA 2LNBA 4LITA 3CJQB 2XC7A 2HNHA 1YG2A 1HDPA 2CQKA 2AXTC 4IXAA 2L2OA 3CD6I 1XD7A 2DA6A 5F1JA 2VB6A 3VWBA 2DA3A 1VQ6I 5E3NA 4N4OB 4Y17A 1FOXA 3QP5A 4OIQF 1B4AA 2A6TA 2EJRA 4YEJA 2MD0A 3G3ZA 1OR7C 5ILUA 2M8GX 1AOYA 1HA8A 2L9SA 2XVCA 3OR1C 4U0WA 3LFKA 4LLLA 1MKMA 2IJLA 4D9JA 3FKJA 2K9QA 1YLFA 3G1MA 4AD9A 4PDKA 4ZYDA 3K4JA 1T98A 3RQIA 3JRAA 3CP8A 4OMZA 1QHGA 1VZ0A 1QQIA 4NC8A 4XSXF 2F5VA 1SD5A 1MJAA 4Y7NJ 2DA4A 5J6XA 1OFCX 4U7DA 4L5JA 2FRHA 1Z3YA 3PNTA 4UHTA 2H27A 1T39A 3D5SC 3J81Z 2CW8A 3LA3A 5IT3A 2DMUA 4KMUX 3J7AY 3FKIJ 1DP3A 3IKTA 5AONA 3CCSI 4BXUA 3SZGA 2JK3A 2BE5F 3ECHA 4CCNA 1BW6A 5TGTA 1ZGAA 4D1QA 5LHIA 2R5YB 4CICA 2HR3A 4GRIA 4S05A 4CHUA 2V1DA 1MBGA 5TJJA 5C3EJ 3OL3A 4I76A 4GFBA 4L5IA 3GTGJ 1DPUA 4CYCA 1OCOH 5BMZA 1GV5A 4HEA2 1T56A 2FU4A 3OYNA 3CMYA 1KONA 5ILSA 2EA4A 2VBZA 2BYVE 1LPQA 2EIMH 3I4MJ 2EINH 3GZNB 2DYRH 5KK1A 2ZXIA 2DN0A 2EBIA 2LG4A 2W7NA 3BWGA 3QPHA 4DJAA 2ZB9A 3WHBA 5M5WJ 1QBJA 1OPCA 1YIJI 2R93J 4KJZA 2IA2A 2LH9A 3TO7A 2DJIA 3BQYA 1D5YA 3LAJA 1ZREA 2KLOA 2CU7A 3D5RC 3OYDA 1ZKGA 5BPIA 2GQQA 2IGNA 3TOBA 3COAC 2C6YA 3WTUC 1BM9A 3AL0B 4M6YA 3S1RJ 3KPHA 2XGDA 2ZSHB 3CDHA 3KIOA 3HHGA 1B9MA 4NDLA 4PJLA 1D0YA 2HKXA 5J4VA 1T08B 4M3GA 5E17F 3GYHX 4OIRF 1TW3A 2GXGA 3R0JA 2NAZA 4JBAA 2BXYA 3ABUA 1OCPA 1W1WE 3PQJA 2A6EF 1ZLKA 2PEXA 3IRRA 4LJZF 5BS6A 1P2FA 4U0YA 2Z1DA 1W7PB 2IPQX 4XLHA 3BG5A 1SFXA 4ITVA 2DMPA 3FMQA 4L18B 2HDWA 2DFEA 1EJ9A 5K7ZA 2AQEA 3QOPA 2JMWA 3R60A 4UY8I 2KMUA 3FDYA 3TDZC 2MLKA 2BHYA 4RGXA 3MAJA 3R0AA 2K3PA 3I9V2 3RPUD 3DXJF 4KMFA 1FOYA 5ICFA 1FJLA 5LGUA 3JAMZ 3ZN0A 2QKMB 1UB9A 3LL7A 4R1HA 4WXHA 1W0UA 2ZMEC 3RI4A 1UG0A 3DTKA 3LWFA 4YIFA 2WTEA 4O6JA 3ZMZA 5EGOB 1J0RA 3F8MA 2RAEA 2M8EA 3E7LA 3BLYA 1AA7A 3L2RA 2XV4S 3F3XA 1T8IA 2Q8KA 4NUBA 1USSA 1Y0UA 1VQOI 2NXNB 1MBKA 2A5WA 3S3OA 3IUOA 2NVXJ 3GFIA 4CUGA 2OU2A 3HC7A 1HOMA 5EF6A 3ML6A 4ZTFA 1HKSA 3BY6A 3NQOA 4ZYGA 2PMHA 1T0FC 3FBNB 4Q48A 3G2BA 2X85A 2B7EA 1D1CA 2HYJA 3FXQA 1B72A 4BNCA 5K7HA 5FKOA 1RR8C 4Y3OA 2QUFA 4B1RA 1Z6TA 3VYSB 5JVTA 2CUEA 3QQAA 2W48A 3AAFA 2V26A 4YFNF 3PUBA 2VXZA 3I55I 1BOBA 1TLHB 3JTGA 2V7FA 1X2MA 2DAOA 1WWXA 1YTYA 4CGZA 3A01B 4LFUA 2IT0A 1M1EB 2V1XA 3H0DA 2R0QC 5HOOA 5E1WA 2IEKA 2LBFB 1LEBA 1IC8A 2OAZA 3ROUA 4AYBN 4HPQA 4DYRA 2ADUA 2M30A 3VOEA 4D0PA 1ZYRF 5TRDA 1BC8C 5IP7J 2F48A 4HYEA 4DOZA 2N8GA 5FLVA 2WAFA 3T5XA 4F92B 5D6EA 1SAXA 1IDYA 4EVIA 5BQTA 1IJWC 1HQCA 2ISYA 2PG4A 2B9SA 3SDBA 2JUCA 2VODA 5FKKA 2NYXA 1PUFA 2MGQA 2I10A 3F8NA 2ZJPF 2RGVA 2F4OB 3CLQA 5JLXA 3I64A 3IL2A 2VQHA 3GZ6A 3WHCA 3K9TA 4XMYA 2JN6A 1ETVA 4DQ2A 3KP5A 1G8XA 5EEGA 3EETA 1RC9A 3BR5A 2LR8A 3E0JB 3SJMA 1FOKA 1ONVA 1N77A 3DQVC 4C2UA 2GM4A 1Y0NA 3SDGA 3JAMK 1PYVA 4UUVA 3ZQGA 1F36A 4UVBA 5FO5A 2V9PA 1QZYA 5GAEJ 4V2FA 2HDCA 4RLQA 1XGOA 3JRIA 3WGIA 1XC5A 4NBQA 2P5KA 2VT2A 4DW6A 1VF9A 2X1EA 4OIPF 3SFZA 1X58A 3V8LA 4ZZLA 3E6MA 2ZKZA 4JX4A 4AIDA 1VQ8I 4HSRA 2LF8A 4RAGA 5JR3A 1K7AA 1K83J 2M7AA 4P5OA 1X1BA 5LFAA 1S72I 1PDNC 4ENKA 1OLTA 3SEQA 5H2FC 3ISPA 2D2WA 3RPQA 2QKLB 2EFQA 4UVCA 2R5ZA 1W36D 1UAAA 4BS9A 1FWZA 3DKXA 3VYTB 4FE4A 3KP6A 2OCCH 1U9NA 1FBQA 1FZPB 4A5NA 1HBXG 1XDUA
chains in the Genus database with same CATH topology
1YITI 5GAHJ 3CF5F 3CMEI 3I56I 3G4SI 3G71I 3CCUI 1YJ9I 3PIPF 3CCEI 3I55I 3CC7I 3CCVI 5DM7F 1Y39A 1YIJI 5GADJ 3J7ZI 1ACIA 2ZJRF 1VQ5I 3CC4I 2K3FA 3CC2I 1YJNI 2OTJI 2QEXI 4IOCF 2FOWA 3J7YJ 3DLLF 3CCLI 3CJTB 2ZJPF 3CCJI 3G6EI 2ZJQF 5DM6F 2E35A 1VQLI 3CCMI 3CD6I 1VQMI 1YJWI 1YI2I 1VQ6I 4IOAF 1VQPI 1FOXA 4UY8I 1YHQI 1VQKI 2OTLI 5GAEJ 3CMAI 1FOYA 5JVGF 1VQ4I 1FOWA 1HC8A 1MMSA 1VQ8I 1VQNI 2E36A 3PIOF 1S72I 4IO9F 3CCQI 2QA4I 1QA6A 1VQ9I 5GAGJ 1VQOI 2E34A 2NXNB 4V19K 3CCSI 2JQ7A 1VQ7I 3CCRI 2H8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT I;  5GAH J;  3CF5 F;  3CME I;  3I56 I;  3G4S I;  3G71 I;  3CCU I;  1YJ9 I;  3PIP F;  3CCE I;  3I55 I;  3CC7 I;  3CCV I;  5DM7 F;  1Y39 A;  1YIJ I;  5GAD J;  3J7Z I;  1ACI A;  2ZJR F;  1VQ5 I;  3CC4 I;  2K3F A;  3CC2 I;  1YJN I;  2OTJ I;  2QEX I;  4IOC F;  2FOW A;  3J7Y J;  3DLL F;  3CCL I;  3CJT B;  2ZJP F;  3CCJ I;  3G6E I;  2ZJQ F;  5DM6 F;  2E35 A;  1VQL I;  3CCM I;  3CD6 I;  1VQM I;  1YJW I;  1YI2 I;  1VQ6 I;  4IOA F;  1VQP I;  1FOX A;  4UY8 I;  1YHQ I;  1VQK I;  2OTL I;  5GAE J;  3CMA I;  1FOY A;  5JVG F;  1VQ4 I;  1FOW A;  1HC8 A;  1MMS A;  1VQ8 I;  1VQN I;  2E36 A;  3PIO F;  1S72 I;  4IO9 F;  3CCQ I;  2QA4 I;  1QA6 A;  1VQ9 I;  5GAG J;  1VQO I;  2E34 A;  2NXN B;  4V19 K;  3CCS I;  2JQ7 A;  1VQ7 I;  3CCR I;  2H8W A; 
#chains in the Genus database with same CATH topology
 1U0J A;  4HST A;  5EYR A;  4QTR A;  4M9S A;  2X0L A;  2MFZ A;  2F5E A;  1NK2 P;  3CO7 C;  3GTK J;  3QPT A;  4ENN A;  3FIS A;  1LJ9 A;  3M8E A;  4HLY A;  4XN0 A;  1LNW A;  4NB5 A;  5FD5 A;  1MGT A;  2W1O A;  2R7Q A;  5HDN A;  1B6A A;  4XLP F;  2IA0 A;  1OJL A;  4C2M J;  3HRM A;  3HXL A;  2WBM A;  2GIV A;  2W00 A;  4L9T A;  2ISZ A;  2PN6 A;  3OYI A;  3EYI A;  2HPI A;  3GZ5 A;  3FXO A;  2MW8 A;  4Y4R A;  5GP9 A;  2UZK A;  4FCY A;  1MMA A;  1TWA J;  2EV0 A;  5E79 C;  1W5C C;  2JRM A;  3A4C A;  3K2Z A;  1I39 A;  2CRG A;  1YRN B;  4FHT A;  3LSG A;  1K78 B;  5CVI A;  4E4H A;  3SQN A;  5GAD J;  2GA2 A;  1I3A A;  3OYJ A;  1I5Z A;  2FBI A;  3K6G A;  3FHN A;  4O3M A;  3B02 A;  1I1G A;  2X51 A;  1R6R A;  4OAY A;  2FUG 2;  1Y6I A;  4HZF A;  2I8D A;  3DCF A;  1JTX A;  2DDA A;  3C2G A;  3LST A;  2Z16 A;  4PJJ A;  3B6A A;  4ETS A;  1X3Z B;  3O2P E;  2TRT A;  4RDU A;  2X6O A;  2E2J J;  4KUM A;  3ASO H;  3LSR A;  2KZV A;  1U2W A;  4CCM A;  2CUF A;  1BIA A;  1KU3 A;  2F5F A;  4EV0 A;  3G6E I;  1KU2 A;  2B63 J;  5D8K B;  1IN7 A;  4AYB A;  4S04 A;  3A0B C;  2JT1 A;  4CO8 A;  4A3D J;  1R5G A;  1VQM I;  2XRN A;  2COB A;  5DCM A;  3WOD F;  1A6Q A;  1KA8 A;  2Z2S B;  1YYV A;  4HRI A;  2IGK A;  1ODD A;  3CP2 A;  1YHQ I;  1ETQ A;  1WSU A;  3W2W A;  4I99 C;  3DU5 A;  2DA5 A;  1P9Q C;  2VJ5 A;  2ZXH A;  4A3C J;  2FE3 A;  2E1N A;  1J5Y A;  1B8I A;  1AKH B;  2LP0 A;  4M3E A;  3WTY C;  3K1N A;  3H92 A;  3GEZ A;  3Q3S A;  5HS9 A;  1SFO J;  3KZZ A;  4UUS B;  3E5U A;  2IGM A;  1KU7 A;  1HC8 A;  1TW2 A;  3PL8 A;  1S7E A;  2K02 A;  2UUZ A;  2M2E A;  2J5P A;  1A36 A;  3ZQC A;  3S1M J;  1IN5 A;  2DLL A;  2VPL A;  1X2N A;  4HX7 A;  3AFH A;  5GTI C;  1T2K A;  1QU3 A;  4G94 A;  2L02 A;  4EJW A;  1E0E A;  3GO5 A;  3GXO A;  1IXS B;  3LSI A;  2MAB A;  2OBP A;  1JUP A;  2EB7 A;  1X4O A;  2M5W A;  2E7W A;  3BQZ A;  3KCC A;  4C3J J;  3I59 B;  2ZXJ A;  3T8T A;  2D5V A;  3CCR I;  2GXB A;  1K6Y A;  3U21 A;  2A61 A;  3AG1 H;  3L7W A;  3O6B B;  2HTJ A;  1Z3X A;  3E6C C;  4YG2 F;  1MBJ A;  2X9D A;  3DV8 A;  3E6D A;  2EZH A;  4XKC A;  3FM3 A;  2OZ6 A;  3OYH A;  2DA1 A;  4ZH4 F;  4M74 A;  4LK1 F;  1SFE A;  2VN2 A;  4W1U A;  1I6H J;  2NVQ J;  1OIS A;  2DPD A;  4II3 A;  2XF7 A;  1XG1 A;  4AU7 A;  1DUX C;  3BTL A;  5B66 C;  2YR2 A;  4Y33 A;  1ULY A;  1NG7 A;  3CCE I;  4G7O F;  1O3S A;  1FMV A;  3HDD A;  3HSE A;  3MKW B;  3B6C A;  4B47 A;  2ZFU A;  3KZI C;  3JRC A;  2O9L A;  3EUK L;  2V1U A;  2P81 A;  3CF2 A;  5J1R A;  4D7M A;  3KEO A;  2ZJR F;  3RQ4 A;  3BCB A;  2L4A A;  1LFU P;  1T95 A;  1LKX A;  2X1C A;  3PUF A;  2VKD A;  3RJP A;  3SHF A;  1V5E A;  2VXD A;  2BY2 A;  4P1W A;  5K5R A;  4C9Y A;  4XLE A;  4RGR A;  5IOZ A;  3HPG A;  3F6V A;  4KT5 C;  3GTJ J;  1N75 A;  1FIA A;  1TZL A;  1V54 H;  2MG4 A;  1UJ8 A;  1R22 A;  4A6E A;  4FTH A;  5K5Q A;  2MYS A;  2CQX A;  2HEO A;  1FNN A;  1DDN A;  4I6Z A;  5ICE A;  2XPW A;  3SZP A;  3DKW A;  3HRT A;  3G1O A;  4G8X A;  3GW2 A;  2K4J A;  2Z99 A;  1W0T A;  3HKZ N;  2JVH A;  5M5Y J;  3CJN A;  2FBK A;  2LSO A;  1YOV B;  2V6C A;  1ON1 A;  3TP3 A;  2FMY A;  5M3F J;  5CLS A;  1SAN A;  2DFI A;  3MMY B;  2HXO A;  2NOG A;  1X3U A;  1B1B A;  2YX4 A;  1GXQ A;  2FF4 A;  2LC2 A;  2O0Y A;  4G6T B;  1EH7 A;  2EK5 A;  1BIB A;  1JE8 A;  3MN2 A;  5LD2 C;  1Z77 A;  3L1P A;  3AG4 H;  4PSX A;  1FTZ A;  2QGU A;  1I1S A;  3B73 A;  1V5G A;  1QRY A;  2NVU B;  3BP8 A;  3EUA A;  1YFH A;  4AIK A;  4I02 A;  1HDD C;  2DCE A;  4E7L A;  2XB5 A;  1ORK A;  2DO7 A;  4UB6 C;  1F9N A;  1QHH D;  5F0F A;  3E1S A;  4IX7 A;  1F5T A;  2Y0M A;  1ZAO A;  2GZW A;  4XBF A;  3F21 A;  1A04 A;  4BY7 J;  1H0M A;  4IVN A;  4HF2 A;  2DOF A;  3VB2 A;  1QO0 D;  5DTD A;  3CO6 C;  4HX4 A;  2L3D A;  3OIQ A;  3TGN A;  3H35 A;  2XKO A;  1VTN C;  3G4S I;  1ZN2 A;  3QAH A;  1ZRC A;  1OKR A;  1ZEL A;  3CCU I;  1YJ9 I;  4A3I J;  4PFP A;  1BOA A;  2K9N A;  3A0H C;  1XDS A;  1YQA A;  2XGC A;  4NQW B;  4Q4Z F;  2KIU A;  3K1M A;  1EV7 A;  1WGX A;  5L3B A;  3I0T A;  2EQR A;  3L2W A;  4RS8 A;  3AG2 H;  3HOU J;  3HUG B;  1TQP A;  1Y8Q B;  1K79 A;  4P96 A;  2M1B A;  2BY3 A;  3DBR B;  3KE2 A;  3KFW X;  3Q9S A;  2HZT A;  4BBS J;  1S7O A;  4A6D A;  4M72 A;  4FE7 A;  5E3L A;  2L7F P;  3BG9 A;  3GCM A;  4JX5 A;  1TNS A;  2DPU A;  2BXZ A;  3FXU A;  4G12 A;  3DBH B;  2W82 A;  1V5F A;  2KIF A;  3HTU A;  3SXY A;  1QPM A;  2VJJ A;  3TL4 X;  4KT6 A;  4GYG A;  3EQL F;  1TWG J;  2E5Z A;  5J8C A;  3CCJ I;  2ME6 A;  4JQF A;  2DMT A;  3DPL C;  3P9I A;  2HZD A;  3BR3 A;  3P7N A;  4IZZ A;  4N4N B;  4MQV A;  2KQR A;  2ZME B;  2L9N A;  3PFI A;  3LSH A;  3H3U A;  5EG0 A;  5FLX K;  1TTY A;  4EJV A;  1U5T B;  4B3A A;  3RKX A;  4LG0 B;  1P4X A;  1LUJ B;  3S1Q J;  4A3E J;  1H9T A;  2VI6 A;  1LVK A;  1CF7 B;  3WU1 B;  3IH3 A;  2OQG A;  3H5A A;  3KP7 A;  4QPO A;  2D1H A;  4B43 A;  1R7J A;  1FBU A;  2YX7 A;  4ZJZ A;  1IO2 A;  1WCM J;  2CW7 A;  2P4W A;  5DDG A;  2KP6 A;  3MVP A;  4F93 B;  4HG2 A;  4BH9 A;  1JGG A;  1MJB A;  1FLI A;  1LFP A;  4E70 A;  2R7Z J;  3HKZ A;  2DOD A;  3ULQ B;  3RIR A;  1Z7U A;  2JA8 J;  4HNU A;  2LK2 A;  2X1D A;  3F8C A;  1FYK A;  3QU3 A;  4OIN F;  3OYE A;  3W2A A;  2ESH A;  3T0Y A;  5DD4 A;  4NHJ A;  5JI6 A;  1D0X A;  1W36 C;  1EF4 A;  5F27 A;  1R23 A;  2JUG A;  4R8H A;  4MO7 A;  3WE2 A;  4DYC A;  2PFB A;  1XCV A;  3ZR8 X;  4IPA A;  4D5F A;  3DTE A;  2JA2 A;  1IXR C;  2GLO A;  1Z6R A;  4D5C A;  2OCE A;  5ED4 A;  1YIT I;  2HOE A;  3QWL A;  1MNM C;  4U7B A;  1FSH A;  4KN7 X;  2GOX B;  1OMI A;  1BJZ A;  3DPU A;  5GPA A;  3WTZ A;  3MKZ A;  1RI7 A;  2MH2 A;  2PJR A;  1B59 A;  2BOL A;  3GTP J;  4KIC A;  1J09 A;  2EWN A;  3NAU A;  4XNF A;  1V3F A;  1MDM B;  4E7K A;  2VL8 A;  2DMN A;  4Q5S F;  4AIH A;  3M7G A;  4EGY A;  5HOD A;  1K4S A;  1ETO A;  5IP6 A;  2HDD A;  1A6I A;  2EA2 A;  4NC6 A;  3HOW J;  1NTC A;  2XAJ A;  5ICG A;  3HOX J;  3VFZ A;  2PJP A;  3M07 A;  2UXX A;  2IXS A;  1K6O A;  3WTV C;  1RKT A;  2F2E A;  3KYC B;  2QBY B;  1N25 A;  3L2U A;  5IT9 Z;  3J7Z I;  2E2I J;  3RYR A;  2MD5 A;  3IAM 2;  3HPH A;  3TQN A;  1DGW Y;  3TKY A;  1A35 A;  4N9I A;  1XSD A;  1QVU A;  3HRU A;  5DS9 A;  2ECB A;  3ZOB A;  5HNF A;  1A5J A;  1I27 A;  1FP1 D;  2OTJ I;  3HEF A;  4I0A A;  4I09 A;  2QQB A;  5CVJ A;  3BTC A;  5KHD A;  2BEO A;  3DEE A;  2QSG X;  4OWR B;  2VKE A;  3OWT A;  5J47 A;  1O3T A;  2CQN A;  1SD4 A;  4P9U A;  4IHV A;  2A3S A;  3BJA A;  2R7R A;  2HFH A;  4KIB A;  5CKT A;  2ZJQ F;  2RNJ A;  3TP0 A;  5FJ8 J;  4WK8 F;  5F6F A;  5H6R A;  1Z0X A;  1L3L A;  2KIM A;  3V42 A;  4ZDP A;  4Y15 A;  4UB8 C;  3OYF A;  3IHU A;  2YPR A;  4G6Q A;  2CMP A;  4HNV A;  2ZFW A;  2WV0 A;  3IP4 B;  3BC8 A;  3TBI A;  1R00 A;  3K1P A;  5LEJ A;  4LIU A;  3W3C A;  2M4K A;  3BR0 A;  3FX3 A;  3DF8 A;  3X2Q H;  4RMN A;  3C7J A;  2M4G A;  3OS2 A;  2MC3 A;  4B09 A;  3G1L A;  3K69 A;  4IHW A;  2R5Y A;  2XGE A;  5GPC A;  5EJC A;  3VOD A;  4A0Z A;  1VQN I;  4IKF A;  3VDX A;  2DXI A;  2WAD A;  4EJT A;  2HTS A;  5DUI A;  9ANT A;  3ZCO A;  1JT6 A;  4PFO A;  2AXL A;  2EPF A;  2Q0O A;  2Y48 A;  4A69 C;  3DTI A;  1SVM A;  2G9W A;  3M4O J;  2MA3 A;  2ETH A;  2M3A A;  2E1M B;  3LA7 A;  3MEX A;  5E8G A;  4DBQ A;  3WE3 A;  1TL8 A;  3LMM A;  2LLK A;  1ENH A;  2HI3 A;  2Y31 A;  2YS9 A;  4ZYE A;  1IN6 A;  3BOQ A;  3FXM A;  1WRJ A;  2Q1Z B;  2IS4 A;  3QOE A;  3BTJ A;  3J81 K;  1RET A;  1WJ5 A;  3ZQF A;  4PGH A;  5DYM A;  2R7U A;  2QQ9 A;  1FSE A;  4ASN A;  2H8R A;  2DI3 A;  3KEY A;  3H9G A;  2ID3 A;  2OV7 A;  1XSX A;  4XRS A;  1MSE C;  4GDF A;  2LKP A;  2HOS A;  3OY9 A;  5IT9 K;  4XIC A;  1ZG1 A;  5F0C A;  4EMS A;  4HW0 A;  3S2D J;  4AVZ A;  4DGW B;  2VLA A;  1NH3 A;  1PP8 F;  5F08 A;  3T8R A;  1YE9 A;  2E19 A;  3PO2 J;  1PUE E;  1CQT A;  2BW3 B;  1X3W B;  2DFH A;  3LSM A;  1WZ2 A;  3TW6 A;  5K5O A;  5EDN A;  3ONQ A;  3CLO A;  3HB9 A;  1W7P A;  4M3D A;  4M9X A;  4XLF A;  3CDL A;  3GF2 A;  3MKY B;  2RRE A;  4G7H F;  3CC2 I;  4L9J A;  3HOS A;  3TOA A;  1QZZ A;  3K4L A;  2QEX I;  2CW0 F;  1IRZ A;  1G4D A;  1W4M A;  2Y9Z A;  2FOW A;  2OPT A;  1EKE A;  1ZTR A;  3BDD A;  3LQR A;  4KA4 A;  3RKY A;  1HW2 A;  1QGP A;  2DQR A;  4AM3 A;  4GXO A;  2JA5 J;  3RYP A;  1SMT A;  2E7X A;  3H3V K;  1PJR A;  5LEK A;  2WC2 A;  4HV6 A;  1DGR M;  4B48 A;  4FT8 A;  5E1X A;  4BYY A;  5CYV A;  5F0H A;  4HNT A;  1YS7 A;  3DWL E;  3LA2 A;  3OSF A;  2E35 A;  1LEA A;  2XIG A;  3CES A;  1UHW A;  5FRN A;  4BQN A;  2R92 J;  2Z9O A;  1JKO C;  3GFJ A;  5EGO A;  1XS9 A;  1WQ2 A;  4B44 A;  4KIS A;  2ZNZ A;  4BGD A;  2M34 A;  1QPI A;  4BL0 B;  3OV8 A;  2OTL I;  2P7V B;  3UR3 C;  4L9N A;  3CMA I;  4OAZ A;  4MEX F;  1YW8 A;  2E60 A;  3ESW B;  2IP2 A;  3E5Q A;  4XKB A;  2COM A;  1MZB A;  2DT6 A;  3UNG C;  3LSK A;  4KIF A;  5J1U A;  1AWC A;  2G0E A;  1E2X A;  1RUO A;  1JXS A;  1STZ A;  4IO9 F;  3GTO J;  3CCQ I;  4ZDO A;  2JPC A;  2XAQ A;  2XF6 A;  1JI8 A;  4RB0 A;  3QP6 A;  5EZH A;  1L0O C;  3H0G J;  3VSK A;  1BR2 A;  4BXX J;  1ETK A;  4K2E A;  4RAF A;  2O61 A;  4BJT A;  3HOZ J;  4ZYA A;  3DLA A;  4QLC U;  5D4R A;  4HAM A;  1P92 A;  5D5X B;  1G3S A;  3FXK A;  2ECC A;  2XAS A;  4HBL A;  4ZDL A;  1FPQ A;  2WY7 Q;  4I01 A;  3CF5 F;  2Q2E B;  3A01 A;  4KFC A;  1BBY A;  4V2G A;  3I58 A;  2LBF A;  2ZBK A;  2ME0 A;  2O8K A;  2AO9 A;  1SVO A;  1JKR C;  2LTP A;  3AKZ A;  4LB6 B;  3ABK H;  2XB0 X;  2QSF X;  4ENJ A;  1E17 A;  2X4H A;  3MWM A;  5LLQ A;  3W6V A;  4HA8 A;  2HVR A;  1G3T A;  2LOO A;  2XRL A;  2WWY A;  4LG3 A;  2L9R A;  5IYB J;  1FBS A;  1R1V A;  2HU9 A;  3W6K B;  2LKX A;  3S2W A;  1JHH A;  1LQ1 A;  2Z3Y A;  3AL0 C;  3LSJ A;  5F1R A;  1XGM A;  5FLM J;  3WTS C;  1OYW A;  4XLN F;  3BR1 A;  4XON A;  3HL2 A;  3HGG A;  5FKN A;  3LSP A;  2FNP A;  2VQG A;  2A68 F;  2IGO A;  4IQ4 A;  1FY7 A;  5FFZ A;  1UMQ A;  4RA2 A;  5IOY A;  2KHM A;  3I3L A;  3REO A;  1ZR2 A;  2RQQ A;  3H3Z A;  1W5T A;  1KU9 A;  1IGN A;  1WI3 A;  3RDI A;  3H1C A;  5HDG A;  2EZI A;  1ZRD A;  2Y75 A;  5DM6 F;  2E71 A;  1BA5 A;  3S14 J;  4KDP A;  1X19 A;  1HW1 A;  1YJW I;  2BV6 A;  3ZP5 A;  3S3M A;  3RKW A;  4EQQ A;  4IOA F;  2IS1 A;  4A0X A;  2YUS A;  1WH7 A;  1NK3 P;  4RAY A;  1GLN A;  4F91 B;  5CJ9 A;  5LGN A;  3K4N A;  2LRE A;  1YW7 A;  1E3O C;  2OUM A;  2FQ3 A;  4CSW A;  2PI0 A;  3JRG A;  2HOT A;  4UV8 A;  1ZQ3 P;  3C2B A;  3ECO A;  5HS7 A;  3FXJ A;  3W2V A;  2RV8 A;  3A03 A;  1ZH5 A;  2XHK A;  4B3X A;  1GUU A;  2W4S A;  5KCM A;  5L3C A;  3JSO A;  1HST A;  1ON2 A;  1LDD A;  5GAG J;  2JWT A;  2E5N A;  3GME A;  2QQ8 A;  4JK1 X;  4WWC A;  1GVD A;  1XN7 A;  4OU0 A;  4V19 K;  3F8F A;  3ZN1 A;  4Y52 J;  2DMQ A;  1U8B A;  3A02 A;  3PM1 A;  4OIO F;  3HHH A;  1U9O A;  1F43 A;  3V7R A;  4F7Z A;  5KAI C;  2IAI A;  1YRN A;  5DV5 A;  1K78 A;  3GVA A;  2R7V A;  1Z1D A;  1DU0 A;  3IKV A;  3JRF A;  3RCO A;  1H8A C;  4QSH A;  2F6C A;  2CWE A;  4IJA A;  2ZNY A;  2VIX A;  2QCO A;  2D1V A;  2CYY A;  1S6L A;  3OYC A;  2CQQ A;  2J5O A;  1REP C;  2QYO A;  4L0Y B;  1Q1V A;  3P9K A;  1LVA A;  5E3M A;  4TV7 A;  4M73 A;  4EJO A;  2R7T A;  2CO5 A;  3TW7 A;  4CH7 A;  3I5U A;  1MND A;  5EZG A;  3ABL H;  3V8K A;  5HNH A;  4DZJ A;  3CCV I;  4MTE A;  4D7N A;  1WJB A;  4BEH B;  4XRF A;  2L01 A;  2VUM J;  4G6D A;  1YO5 C;  2JSC A;  1ZHF A;  1HXD A;  3HOV J;  5J40 A;  4JP0 A;  3IWZ A;  1FT9 A;  3K4K A;  3H36 A;  4YIR X;  3CUQ B;  4A3L J;  4RB2 C;  4MFE A;  3M8F A;  2MH9 A;  2K27 A;  2JA6 J;  4IHY A;  1A31 A;  1J75 A;  2DW4 A;  5B1B H;  1RNL A;  2KDZ A;  4DNC A;  4QPQ A;  5D8L B;  3RZO J;  1ETW A;  1IN8 A;  4LIV A;  1YW9 A;  4HLX A;  4RLF A;  1U6G A;  2MBF A;  1IN4 A;  1TP4 A;  2H6C A;  2XRO A;  1AKH A;  3FBI B;  2IS6 A;  4A3F J;  4UUS A;  3M1C A;  1Q1H A;  1MJ9 A;  1NG6 A;  2DBB A;  5BPD A;  4BY1 J;  2R7W A;  3OSG A;  5CQG A;  4YFX F;  3E5X A;  3MQ0 A;  4NNJ A;  3K70 D;  3CUO A;  4Q47 A;  1IAW A;  1YS6 A;  4L5E A;  4RBO A;  3MZ8 A;  1JT0 A;  3OMY A;  1TQI A;  2VE8 A;  2QEN A;  3L2Q A;  1EA3 A;  3HRS A;  2X6Y A;  4KIT B;  3V7C A;  2JRT A;  4MHG A;  1ITY A;  3GTL J;  5JFR A;  1G3W A;  1VQ4 I;  2CQ7 A;  3I59 A;  3EYY A;  3JRB A;  2BY0 A;  2M0M A;  1LE8 B;  1X4P A;  3E97 A;  1JGS A;  5C44 J;  1J9I A;  2DTR A;  2B0L A;  3FK6 A;  3GUD A;  2WAQ N;  2STW A;  1S8N A;  3GX4 X;  3F72 A;  2P5L C;  4OMY A;  3D1N I;  1XB4 A;  1Y1V J;  3ERM A;  4ON0 A;  1EH6 A;  4HDV A;  4EM2 A;  5KVR A;  1P6R A;  4FX4 A;  3BG6 A;  2BVM A;  4RM2 A;  4XLC A;  5F04 A;  5D6F A;  4BE1 A;  1ZK8 A;  1MBE A;  3S16 J;  4XRM A;  2PMZ N;  3HGY A;  5CVV A;  4DYQ A;  5E8I A;  2Y30 A;  3OIP A;  2IRF G;  3E6B A;  4PCQ A;  1KQ0 A;  3BR6 A;  5B3S H;  3ZMU A;  3CTA A;  3R4K A;  2DOA A;  4DZP A;  2NRA C;  4AVP A;  4EM0 B;  1F4K A;  3FIW A;  1WJE A;  2QWW A;  3DBL B;  2BVL A;  4MIM A;  1O57 A;  1DU6 A;  4IQJ A;  3BPX A;  2DT5 A;  3HSF A;  5LGT A;  3ZMV A;  3Q0U A;  4OOI A;  3K2A A;  4ZZD A;  1W5S A;  4H4K C;  3K7A J;  5FKL A;  2JSP A;  5FRM A;  1OR7 A;  5LRS A;  2VPR A;  1MNE A;  2VKH A;  2HVS A;  1D0Z A;  1SVL A;  3KLN A;  1SD7 A;  1OCT C;  2UWM A;  1XX5 A;  2V4J C;  3K4B A;  2IVM A;  4UVA A;  1IW7 F;  2EIK H;  2NNY A;  3F22 A;  1RZ4 A;  1HSJ A;  3L9F A;  3PSI A;  2E1O A;  2HPM A;  2RDP A;  3MKL A;  2H94 A;  3RKQ A;  3RZD J;  1J59 A;  2A05 A;  3WTX C;  2NVT J;  3QOD A;  4XL9 A;  4M9Z A;  4ESF A;  2Y0S N;  4PJN A;  3BZK A;  2HWV A;  1IRG A;  4ANJ A;  1Y56 A;  4PZJ A;  2XAF A;  1R5H A;  2PX9 A;  2YSR A;  1OCC H;  4RB1 A;  1P7I A;  1KYW A;  2KKO A;  3KX2 A;  4O5V A;  1R1T A;  2XSJ C;  3K0L A;  2EV5 A;  2GBY A;  2DYS H;  2FSW A;  3H5N A;  2X6X A;  1WJC A;  3OOU A;  2UV1 A;  1YI2 I;  2ELH A;  4P55 A;  1LDK B;  2O8X A;  3C18 A;  4A3G J;  5IY5 H;  4UV9 A;  2A07 F;  2FXA A;  1J7K A;  2Z33 A;  4UXN A;  1TWH J;  3R6S A;  3CMM A;  5AIP A;  4ABZ A;  4E7I A;  5EEA A;  1RRJ A;  2FD5 A;  1D1B A;  5A2Q Z;  4ESB A;  1O3R A;  2VAS A;  5M5X J;  4BKX A;  1FC3 A;  2P8T A;  4WF2 A;  3MZY A;  2LYC A;  4XLA A;  3JR9 A;  3ZMT A;  1W7P D;  1TNT A;  5FFX A;  3OL4 A;  1GV2 A;  1T6S A;  2KPM A;  2K86 A;  5E1Z B;  2P7C B;  2TDX A;  5JLW A;  4EEF G;  3KP2 A;  2QA4 I;  5FKM A;  2CFX A;  2CS3 A;  1TBX A;  2GIZ A;  5CVU A;  4L0Z B;  1U3E M;  1KYZ A;  2VQC A;  4M3B A;  4E6K G;  5KAF C;  2JQ7 A;  2VON A;  3HM5 A;  4NQW A;  4MFD A;  3BG7 A;  3QPS A;  3ZRG A;  5D5V B;  2H8W A;  2EZK A;  4A3K J;  4E7H A;  3HUG A;  1IRF A;  2WAQ A;  1SC7 A;  1IF1 A;  1TWC J;  4HV5 A;  3IRQ A;  1JJ6 C;  2ZJ2 A;  3P9C A;  4AIJ A;  3ZQL A;  3JSP A;  1WJD A;  3I56 I;  2O3F A;  2IW5 A;  4JOM A;  4FAS D;  1V4R A;  2FQ4 A;  3QYE A;  1QVT A;  4HX8 A;  1X1P A;  4MNU A;  1UEL B;  4J00 A;  1SFU A;  3WG9 A;  1OYY A;  3HYI A;  3I71 A;  3P5J A;  1Y39 A;  3F23 A;  2M45 A;  3PO3 J;  3GLL A;  4I7H A;  4FX0 A;  1MIJ A;  1UST A;  1BL0 A;  2LFB A;  1ETY A;  3DKY A;  1FX7 A;  2G7H A;  2FBH A;  4CYC B;  4PJM A;  2ZME A;  2HYF A;  1OQY A;  1T33 A;  2FOK A;  3OOP A;  5JHU A;  1ZRF A;  3T1B A;  2CV0 A;  1WVR A;  3I4N J;  1U5T A;  1IRX A;  2EIL H;  3FM5 A;  3J7Y J;  3O8H A;  5BNG A;  4LG0 A;  4BAY A;  3LQQ A;  2VBY A;  4EJU A;  1APL C;  3E3V A;  3N05 A;  2DU9 A;  5F64 A;  1CF7 A;  5LRR A;  5FD6 A;  5HDK A;  3GTM J;  1LFB A;  2CJJ A;  2JTV A;  4N9H A;  2R7D A;  3HOY J;  4M6V A;  2EFO A;  5K7F A;  2O6G E;  1BC7 C;  1PVE A;  1VI0 A;  3OYK A;  1TC3 C;  2VE9 A;  1BN5 A;  1RKW A;  3HIF A;  3ZGK A;  6PAX A;  1D5V A;  5AIQ A;  3ZPL A;  4LOC A;  1T0F A;  2Y0S A;  2YU3 A;  4AC0 A;  2TCT A;  5A2Q K;  3ASN H;  1KQ9 A;  3PNY A;  4GO1 A;  2W85 A;  1UHM A;  2W57 A;  4PJ0 C;  4WXD A;  4BDZ A;  3WU2 C;  2WAE A;  1RES A;  3MFK A;  2HXI A;  3S93 A;  1XMK A;  3EUH A;  2KZG A;  3HTS B;  1IV6 A;  1FYM A;  2FJ1 A;  2R7S A;  3K4C A;  3WTT C;  1SAU A;  5IYC J;  3IAS 2;  3M1E A;  4U0V A;  2FML A;  5H6Q A;  2R7F A;  3S2H J;  1H9G A;  1KGS A;  5ICC A;  4R79 A;  2BBY A;  1MDM A;  4A3B J;  5D5W B;  4AUX A;  3JW4 A;  1F1Z A;  2DK8 A;  3OYA A;  2GAU A;  2CV1 A;  2XPU A;  1ZR4 A;  2XAG A;  2ZC2 A;  1U8R A;  2Y2Z A;  3ELK A;  4KNY A;  1YIO A;  3VPR A;  3PSF A;  2XF5 A;  1JTY A;  4XQF A;  1R71 A;  4KN4 X;  2QBY A;  3ZMS A;  2ZCW A;  3SEZ A;  3BCA A;  2VQL A;  2VJ4 A;  1XPX A;  4BHC A;  3ZXS A;  2STT A;  3ZQH A;  2ID6 A;  2W25 A;  1T38 A;  1XSV A;  3KLO A;  1R4M B;  5IPA A;  2JJ7 A;  4XM3 A;  4FQG A;  1Y1W J;  4IRI A;  3HJE A;  3BRO A;  1E3H A;  4G9Y A;  1XCB A;  3GTQ J;  1WI9 A;  2DA7 A;  1P4A A;  1BR4 A;  2BGC A;  1JKQ C;  4BQQ A;  2NS7 A;  4PUS A;  2VKV A;  1ZLJ A;  1ACI A;  1MD0 A;  1RPW A;  4E7J A;  1N78 A;  1D8J A;  2OZU A;  4A93 J;  3V7S A;  3S1N J;  2ICW G;  2K3F A;  3DU6 A;  1B72 B;  2ACJ A;  2LY9 A;  1J2X A;  1YJN I;  1WFX A;  3OYM A;  2E1C A;  1D1A A;  4BDY A;  2EV6 A;  5L3F A;  1HF0 A;  1BI2 A;  1GXP A;  4HQM A;  2ELK A;  3CCL I;  1BW5 A;  4N0B A;  1S5L C;  1RR7 A;  1MMD A;  3D0S A;  2O03 A;  4C3H J;  4P9F A;  3VYU B;  1XGN A;  3WGH A;  1YX3 A;  4C3I J;  4DIQ A;  1X1D A;  3K10 A;  3K70 C;  1P4W A;  1U5T C;  1VQL I;  2BY1 A;  5FB2 A;  1Z05 A;  4RM3 A;  5HLG A;  2EFW A;  5DD8 A;  1BR1 A;  1WJF A;  2CUJ A;  3TO6 A;  3KP4 A;  1MW7 A;  2G7U A;  2XKP A;  5FRO A;  2QVO A;  3U9G A;  4J19 A;  1PUF B;  2HOA A;  2L9V A;  3IC7 A;  1FP2 A;  3M3Y J;  2F5D A;  3MD2 A;  2GA1 A;  4JX6 A;  3OR2 C;  2RN7 A;  5JVG F;  1IUF A;  1MMG A;  1FEX A;  1S29 A;  2KRF A;  2L7Z A;  4KYW A;  4XKV A;  2HQ5 A;  1UHS A;  4E7Z A;  2NOJ B;  2RNG A;  3R61 A;  1MMS A;  3Q0V A;  4MTD A;  4CDG A;  2BHZ A;  2QM3 A;  2E2H J;  3ABT A;  1XGS A;  1DPR A;  1R1U A;  4F3Q A;  5GTH C;  1D3Y A;  1JHF A;  3PIO F;  2R7O A;  2XUB A;  4E7S A;  2CH0 A;  2WV1 A;  1KZH A;  3SFI A;  4IHX A;  2M7B A;  4BU2 A;  3PNV A;  3DPT A;  1IUY A;  3PFY A;  3TDU C;  3C3W A;  1DP7 P;  1R5I D;  3EUH C;  3BR2 A;  3QYF A;  4CA0 A;  1B9N A;  3ZMD A;  5DCF A;  3DEU A;  2VJI A;  2HGC A;  5GAH J;  4IRH A;  5HVQ C;  2HQA A;  1HLV A;  1G2H A;  3LFU A;  2BW3 A;  4BE0 A;  4LB5 A;  4I2O A;  3JCU C;  1BI0 A;  1TT0 A;  1JJ8 C;  2R5Z B;  3GLX A;  3GBG A;  4XKW A;  4XID A;  1POG A;  4HF0 A;  4B8X A;  1JKP C;  1BI1 A;  2KL4 A;  2K5C A;  4S0H B;  2F4I A;  3BPV A;  2OQR A;  2KRC A;  3BJ6 A;  1Z21 A;  5DM7 F;  2UXN A;  1VFC A;  1WH5 A;  2FEZ A;  3FMS A;  3QYB A;  1GHC A;  3L00 A;  2DK5 A;  4XOP A;  1I3Q J;  2DT7 B;  4Y13 A;  3ABM H;  1R36 A;  3MZH A;  1UCR A;  4YEL A;  4CZC A;  1GVJ A;  2F5C A;  3FF5 A;  1ZG3 A;  5EEH A;  4J01 A;  4IOC F;  3KET A;  2M9H A;  5J1Y A;  2KIS A;  1HW5 A;  3FWE A;  1O7L A;  2NNN A;  3FHZ A;  2P5V A;  1MH4 A;  1QZE A;  4BHP A;  4CCO A;  2DJN A;  2QLZ A;  3SYT A;  2L5Q A;  4BE2 A;  1QNT A;  3EPZ A;  5C4X J;  4EM1 A;  4HDU A;  1SD6 A;  2V79 A;  4X1E A;  2WB1 N;  2PBI A;  2K40 A;  4LD5 A;  2X6W A;  1C0W A;  3F0C A;  3QU6 A;  5IP9 J;  3FXR A;  3L2V A;  5IYD J;  2LVS A;  3FZV A;  3V4G A;  1EH8 A;  2K85 A;  2ZXW H;  5FGM A;  4RAZ A;  2IA1 A;  2M0C A;  1O7F A;  2ELJ A;  2KJB A;  2FX0 A;  1G3Y A;  1ETX A;  2KFD A;  4CXF A;  2AQF A;  1O4X A;  2BZT A;  3L09 A;  1WPK A;  1Z67 A;  2R4G A;  3H9J A;  4I98 B;  2D45 A;  5DCM B;  1CGP A;  2VT3 A;  4LK0 F;  3VSL A;  2Q2E A;  2V1N A;  3J7A O;  1AHD P;  2L7M P;  4F55 A;  4FIS A;  4M3F A;  2XDV A;  2Z5U A;  2H1L A;  3RTR A;  4W97 A;  1K4T A;  1VQ9 I;  2E1M C;  2CFO A;  2WA0 A;  2E34 A;  5CVR A;  1B8I B;  1JUM A;  1IG7 A;  3J80 Z;  5D5U B;  2PQ8 A;  1WJA A;  4DBR A;  2M87 A;  1FYL A;  2VOO A;  4X0G A;  3ERE D;  5DUK A;  1XMA A;  4BUP A;  1MH3 A;  4Z6Y A;  5HLH A;  2RQP A;  3CJR B;  3K4M A;  4BQO A;  4IF4 A;  1X1A A;  3WTW C;  4LLG F;  1IDZ A;  3FMR A;  4LGW A;  3U1K A;  4LLN A;  2EIJ H;  1BI3 A;  3GFL A;  3F9K A;  3G71 I;  1X1C A;  1ZGJ A;  4A5M A;  1HKQ A;  5CQE A;  2P6T A;  2LMD A;  3C2H A;  2XGX A;  4PK4 A;  4AWX B;  3PJR A;  3RPU A;  2CUZ A;  2EZL A;  2VBX A;  1ZAR A;  2MLG A;  2XAH A;  1GDT A;  4U87 A;  2L54 A;  4L9V A;  2V9K A;  3H9Q A;  4YFK F;  3JRD A;  5L3G A;  2PMU A;  4RB3 C;  1VQ5 I;  4CCJ A;  4F52 A;  4XRS G;  3CC4 I;  1RIO H;  1H89 C;  4BXF A;  3GFM A;  2QQA A;  2RC4 A;  4A0Y A;  4CZZ A;  4M71 A;  1GT0 C;  4EAT A;  3Q5F A;  3ZQ7 A;  1Z7L A;  1UFM A;  2OD5 A;  3C1D A;  2DDB A;  3OYG A;  1G59 A;  2HS5 A;  3VYR B;  2DOE A;  2KT0 A;  4PGG A;  3DLL F;  3KYD B;  3BTI A;  1U78 A;  3S17 J;  2V9V A;  3CJT B;  3OIO A;  2ZSI B;  2L0K A;  2KJC A;  2KDO A;  2NS0 A;  1Z9C A;  4EGZ A;  1R4N B;  3TMO A;  2LKS A;  3OS1 A;  2R7X A;  1HKT A;  1OYI A;  4ZC3 A;  3S15 J;  2W24 A;  3Q0W A;  2F4M B;  4CYD A;  1VND A;  3I4P A;  4C30 A;  1HCR A;  2PLY A;  1NHA A;  3L2C A;  2GOM A;  3H5R A;  5ILV A;  4GCV A;  4NC7 A;  5H20 A;  1VQK I;  1Z91 A;  3EDP A;  2K9L A;  3DEW A;  4FET A;  2LRD A;  1TWF J;  2DTZ A;  2JA7 J;  3U1D A;  4WCG A;  1MMN A;  4XR6 A;  1OCR H;  4U88 A;  3CZ6 A;  2H09 A;  1ZG5 A;  3JTH A;  4QIW N;  4XSZ F;  4MQ9 F;  1FOW A;  3OYB A;  2FNA A;  3BJO A;  2WB1 A;  3D5L A;  4IHS A;  1XTA A;  4MGR A;  3ZQI A;  1WHU A;  5C4J J;  5B5E C;  1R9T J;  3KEQ A;  2EFN A;  3AG3 H;  3F6O A;  4G7Z F;  4GGG A;  1XMX A;  4HOB A;  3J80 K;  1QA6 A;  3CQZ J;  3I53 A;  4WX9 A;  1PP7 U;  3QRF F;  3NEU A;  3HG9 A;  4IL6 C;  3IH4 A;  1IV8 A;  1MSF C;  1MBF A;  4XK4 A;  3M8J A;  1TQM A;  2K9M A;  1DQU A;  2HQR A;  4A3M J;  2VOP A;  4X6A J;  4BEH A;  5TIS C;  3HSR A;  3A2K A;  1MBH A;  2K9S A;  3WU0 A;  3N4M A;  1RUN A;  5E20 A;  3HOT A;  4BQA A;  5K1Y A;  3CUQ A;  3I54 A;  3W6J B;  3PIP F;  3UKG A;  4QWQ A;  1V55 H;  1FMW A;  1E3P A;  2ESN A;  1TT5 B;  2HYG D;  2CSO A;  4C2T A;  2AHQ A;  2L7K A;  2CG4 A;  1JUS A;  5B1A H;  4BHB A;  2MC4 A;  4A2U A;  4A3J J;  1IXC A;  2FA5 A;  1I50 J;  4WXC A;  4M6X A;  5HS8 A;  2R3S A;  4RGS A;  2LD5 A;  1ZGW A;  1R49 A;  3Q9V A;  4ZTJ A;  3NRV A;  4XOT A;  5LHH A;  2H1K A;  5FLX Z;  5D4S A;  2WY8 Q;  1FTT A;  2P0W A;  4KIG A;  4II2 A;  4ENM A;  4BAC A;  3KZY A;  1I6X A;  3KYL A;  2O5R A;  2HQN A;  3GWZ A;  2EH3 A;  2L4M A;  3WG7 H;  2LF7 A;  3RSN A;  1KQ8 A;  3KP3 A;  3NWS A;  3S32 A;  3N97 A;  1LB2 A;  2RVC A;  1H88 C;  4YII A;  5L3D A;  2HKO A;  3CCM I;  4HQE A;  1LE8 A;  2QZ8 A;  2O7O A;  1D8K A;  2QF7 A;  2ZO4 A;  1P7J A;  2OC6 A;  3HBL A;  1WKM A;  3TED A;  2NS8 A;  1VQP I;  3CDI A;  4IEJ A;  2I5U A;  3IWF A;  3BT9 A;  2AS5 F;  2DFF A;  4PSW A;  2OA4 A;  3LNQ A;  4H0E A;  3G73 A;  3FXL A;  3OYL A;  3HZJ A;  3NWT A;  1K61 A;  3ZQQ A;  2OJE D;  5LBQ A;  3U2R A;  3BZC A;  3WGG A;  4I0B A;  5EG0 B;  5CPR B;  2Y9Y A;  3NAR A;  3OS0 A;  2E36 A;  5KNL A;  5JHF A;  3PQK A;  4BBR J;  3IV5 A;  2K7L A;  5DEQ A;  2OF7 A;  2VBW A;  3JRE A;  1UZC A;  3V8J A;  5J3L A;  1ERD A;  3IH2 A;  2H6B A;  2IS2 A;  2VC1 A;  4LMY A;  5J4Y A;  2EFP A;  5E3O A;  2CGP A;  1IZ1 A;  1OCZ H;  2LY2 A;  2K4B A;  1VQ7 I;  4A12 A;  2LDU A;  3QPL A;  1SMY F;  4Z2Y A;  3LOC A;  3O8G A;  2YU9 J;  2JPB A;  5HLI A;  2VC0 A;  1R58 A;  4IRG A;  3DP7 A;  2QSH X;  2A6H F;  3CME I;  2JVG A;  1SEU A;  1YX5 A;  3A1Y A;  2JZY A;  4CCK A;  3VEP A;  1S7A A;  5BOX A;  1FIP A;  5E18 F;  2Y69 H;  3BG3 A;  4MLO A;  4XN3 A;  3M9A A;  2DQL A;  2A5Y B;  4CCL A;  4IHT A;  2KIQ A;  2LY1 A;  1UG2 A;  4ESJ A;  3F8B A;  3LAP A;  4BJ6 C;  5ERI A;  5HLT A;  1G6N A;  3CC7 I;  4MEY F;  4ZYH A;  2IBD A;  2XAU A;  4BJ5 C;  2PJR B;  4HF1 A;  1BJA A;  4RGU A;  2MSY A;  4UUT A;  4JYK A;  1SFK A;  3BZ6 A;  3CUQ C;  2KRH A;  2NVY J;  2V6E A;  2XSD C;  3SZT A;  2HVQ A;  1Y8R B;  2GXA A;  1LDJ A;  2CV2 A;  4UNO A;  2RKH A;  4XOR A;  3DFG A;  3S3N A;  4YRV A;  3MCZ A;  3S8P A;  2W84 A;  5L3E A;  1S9H A;  2XPV A;  4B4C A;  2X48 A;  3FK7 A;  1S3J A;  2DA2 A;  3JRH A;  1O3Q A;  1AU7 A;  2A69 F;  4GYI A;  3TO9 A;  3CCY A;  2GWR A;  2PMZ A;  3O3K A;  5J8F A;  5LHG A;  5M3M J;  2P6S A;  2LNB A;  4LIT A;  3CJQ B;  2XC7 A;  2HNH A;  1YG2 A;  1HDP A;  2CQK A;  2AXT C;  4IXA A;  2L2O A;  3CD6 I;  1XD7 A;  2DA6 A;  5F1J A;  2VB6 A;  3VWB A;  2DA3 A;  1VQ6 I;  5E3N A;  4N4O B;  4Y17 A;  1FOX A;  3QP5 A;  4OIQ F;  1B4A A;  2A6T A;  2EJR A;  4YEJ A;  2MD0 A;  3G3Z A;  1OR7 C;  5ILU A;  2M8G X;  1AOY A;  1HA8 A;  2L9S A;  2XVC A;  3OR1 C;  4U0W A;  3LFK A;  4LLL A;  1MKM A;  2IJL A;  4D9J A;  3FKJ A;  2K9Q A;  1YLF A;  3G1M A;  4AD9 A;  4PDK A;  4ZYD A;  3K4J A;  1T98 A;  3RQI A;  3JRA A;  3CP8 A;  4OMZ A;  1QHG A;  1VZ0 A;  1QQI A;  4NC8 A;  4XSX F;  2F5V A;  1SD5 A;  1MJA A;  4Y7N J;  2DA4 A;  5J6X A;  1OFC X;  4U7D A;  4L5J A;  2FRH A;  1Z3Y A;  3PNT A;  4UHT A;  2H27 A;  1T39 A;  3D5S C;  3J81 Z;  2CW8 A;  3LA3 A;  5IT3 A;  2DMU A;  4KMU X;  3J7A Y;  3FKI J;  1DP3 A;  3IKT A;  5AON A;  3CCS I;  4BXU A;  3SZG A;  2JK3 A;  2BE5 F;  3ECH A;  4CCN A;  1BW6 A;  5TGT A;  1ZGA A;  4D1Q A;  5LHI A;  2R5Y B;  4CIC A;  2HR3 A;  4GRI A;  4S05 A;  4CHU A;  2V1D A;  1MBG A;  5TJJ A;  5C3E J;  3OL3 A;  4I76 A;  4GFB A;  4L5I A;  3GTG J;  1DPU A;  4CYC A;  1OCO H;  5BMZ A;  1GV5 A;  4HEA 2;  1T56 A;  2FU4 A;  3OYN A;  3CMY A;  1KON A;  5ILS A;  2EA4 A;  2VBZ A;  2BYV E;  1LPQ A;  2EIM H;  3I4M J;  2EIN H;  3GZN B;  2DYR H;  5KK1 A;  2ZXI A;  2DN0 A;  2EBI A;  2LG4 A;  2W7N A;  3BWG A;  3QPH A;  4DJA A;  2ZB9 A;  3WHB A;  5M5W J;  1QBJ A;  1OPC A;  1YIJ I;  2R93 J;  4KJZ A;  2IA2 A;  2LH9 A;  3TO7 A;  2DJI A;  3BQY A;  1D5Y A;  3LAJ A;  1ZRE A;  2KLO A;  2CU7 A;  3D5R C;  3OYD A;  1ZKG A;  5BPI A;  2GQQ A;  2IGN A;  3TOB A;  3COA C;  2C6Y A;  3WTU C;  1BM9 A;  3AL0 B;  4M6Y A;  3S1R J;  3KPH A;  2XGD A;  2ZSH B;  3CDH A;  3KIO A;  3HHG A;  1B9M A;  4NDL A;  4PJL A;  1D0Y A;  2HKX A;  5J4V A;  1T08 B;  4M3G A;  5E17 F;  3GYH X;  4OIR F;  1TW3 A;  2GXG A;  3R0J A;  2NAZ A;  4JBA A;  2BXY A;  3ABU A;  1OCP A;  1W1W E;  3PQJ A;  2A6E F;  1ZLK A;  2PEX A;  3IRR A;  4LJZ F;  5BS6 A;  1P2F A;  4U0Y A;  2Z1D A;  1W7P B;  2IPQ X;  4XLH A;  3BG5 A;  1SFX A;  4ITV A;  2DMP A;  3FMQ A;  4L18 B;  2HDW A;  2DFE A;  1EJ9 A;  5K7Z A;  2AQE A;  3QOP A;  2JMW A;  3R60 A;  4UY8 I;  2KMU A;  3FDY A;  3TDZ C;  2MLK A;  2BHY A;  4RGX A;  3MAJ A;  3R0A A;  2K3P A;  3I9V 2;  3RPU D;  3DXJ F;  4KMF A;  1FOY A;  5ICF A;  1FJL A;  5LGU A;  3JAM Z;  3ZN0 A;  2QKM B;  1UB9 A;  3LL7 A;  4R1H A;  4WXH A;  1W0U A;  2ZME C;  3RI4 A;  1UG0 A;  3DTK A;  3LWF A;  4YIF A;  2WTE A;  4O6J A;  3ZMZ A;  5EGO B;  1J0R A;  3F8M A;  2RAE A;  2M8E A;  3E7L A;  3BLY A;  1AA7 A;  3L2R A;  2XV4 S;  3F3X A;  1T8I A;  2Q8K A;  4NUB A;  1USS A;  1Y0U A;  1VQO I;  2NXN B;  1MBK A;  2A5W A;  3S3O A;  3IUO A;  2NVX J;  3GFI A;  4CUG A;  2OU2 A;  3HC7 A;  1HOM A;  5EF6 A;  3ML6 A;  4ZTF A;  1HKS A;  3BY6 A;  3NQO A;  4ZYG A;  2PMH A;  1T0F C;  3FBN B;  4Q48 A;  3G2B A;  2X85 A;  2B7E A;  1D1C A;  2HYJ A;  3FXQ A;  1B72 A;  4BNC A;  5K7H A;  5FKO A;  1RR8 C;  4Y3O A;  2QUF A;  4B1R A;  1Z6T A;  3VYS B;  5JVT A;  2CUE A;  3QQA A;  2W48 A;  3AAF A;  2V26 A;  4YFN F;  3PUB A;  2VXZ A;  3I55 I;  1BOB A;  1TLH B;  3JTG A;  2V7F A;  1X2M A;  2DAO A;  1WWX A;  1YTY A;  4CGZ A;  3A01 B;  4LFU A;  2IT0 A;  1M1E B;  2V1X A;  3H0D A;  2R0Q C;  5HOO A;  5E1W A;  2IEK A;  2LBF B;  1LEB A;  1IC8 A;  2OAZ A;  3ROU A;  4AYB N;  4HPQ A;  4DYR A;  2ADU A;  2M30 A;  3VOE A;  4D0P A;  1ZYR F;  5TRD A;  1BC8 C;  5IP7 J;  2F48 A;  4HYE A;  4DOZ A;  2N8G A;  5FLV A;  2WAF A;  3T5X A;  4F92 B;  5D6E A;  1SAX A;  1IDY A;  4EVI A;  5BQT A;  1IJW C;  1HQC A;  2ISY A;  2PG4 A;  2B9S A;  3SDB A;  2JUC A;  2VOD A;  5FKK A;  2NYX A;  1PUF A;  2MGQ A;  2I10 A;  3F8N A;  2ZJP F;  2RGV A;  2F4O B;  3CLQ A;  5JLX A;  3I64 A;  3IL2 A;  2VQH A;  3GZ6 A;  3WHC A;  3K9T A;  4XMY A;  2JN6 A;  1ETV A;  4DQ2 A;  3KP5 A;  1G8X A;  5EEG A;  3EET A;  1RC9 A;  3BR5 A;  2LR8 A;  3E0J B;  3SJM A;  1FOK A;  1ONV A;  1N77 A;  3DQV C;  4C2U A;  2GM4 A;  1Y0N A;  3SDG A;  3JAM K;  1PYV A;  4UUV A;  3ZQG A;  1F36 A;  4UVB A;  5FO5 A;  2V9P A;  1QZY A;  5GAE J;  4V2F A;  2HDC A;  4RLQ A;  1XGO A;  3JRI A;  3WGI A;  1XC5 A;  4NBQ A;  2P5K A;  2VT2 A;  4DW6 A;  1VF9 A;  2X1E A;  4OIP F;  3SFZ A;  1X58 A;  3V8L A;  4ZZL A;  3E6M A;  2ZKZ A;  4JX4 A;  4AID A;  1VQ8 I;  4HSR A;  2LF8 A;  4RAG A;  5JR3 A;  1K7A A;  1K83 J;  2M7A A;  4P5O A;  1X1B A;  5LFA A;  1S72 I;  1PDN C;  4ENK A;  1OLT A;  3SEQ A;  5H2F C;  3ISP A;  2D2W A;  3RPQ A;  2QKL B;  2EFQ A;  4UVC A;  2R5Z A;  1W36 D;  1UAA A;  4BS9 A;  1FWZ A;  3DKX A;  3VYT B;  4FE4 A;  3KP6 A;  2OCC H;  1U9N A;  1FBQ A;  1FZP B;  4A5N A;  1HBX G;  1XDU A; 
#chains in the Genus database with same CATH homology
 1YIT I;  5GAH J;  3CF5 F;  3CME I;  3I56 I;  3G4S I;  3G71 I;  3CCU I;  1YJ9 I;  3PIP F;  3CCE I;  3I55 I;  3CC7 I;  3CCV I;  5DM7 F;  1Y39 A;  1YIJ I;  5GAD J;  3J7Z I;  1ACI A;  2ZJR F;  1VQ5 I;  3CC4 I;  2K3F A;  3CC2 I;  1YJN I;  2OTJ I;  2QEX I;  4IOC F;  2FOW A;  3J7Y J;  3DLL F;  3CCL I;  3CJT B;  2ZJP F;  3CCJ I;  3G6E I;  2ZJQ F;  5DM6 F;  2E35 A;  1VQL I;  3CCM I;  3CD6 I;  1VQM I;  1YJW I;  1YI2 I;  1VQ6 I;  4IOA F;  1VQP I;  1FOX A;  4UY8 I;  1YHQ I;  1VQK I;  2OTL I;  5GAE J;  3CMA I;  1FOY A;  5JVG F;  1VQ4 I;  1FOW A;  1HC8 A;  1MMS A;  1VQ8 I;  1VQN I;  2E36 A;  3PIO F;  1S72 I;  4IO9 F;  3CCQ I;  2QA4 I;  1QA6 A;  1VQ9 I;  5GAG J;  1VQO I;  2E34 A;  2NXN B;  4V19 K;  3CCS I;  2JQ7 A;  1VQ7 I;  3CCR I;  2H8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...