1YIJI

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yijI00
2E36A 3CC2I 5GAHJ 3G4SI 1YITI 4IOAF 3DLLF 2ZJPF 3CCJI 1VQNI 3CMAI 1MMSA 1VQ4I 3I56I 3CMEI 2JQ7A 1YJWI 1QA6A 2FOWA 2ZJRF 1S72I 3CCMI 2OTLI 1YJNI 5GADJ 3CCSI 3CC7I 1HC8A 3CCRI 2OTJI 3CJTB 3PIOF 3J7ZI 2E35A 5GAEJ 2ZJQF 1FOWA 3PIPF 4V19K 1YHQI 1VQKI 3J7YJ 1FOXA 4IOCF 4UY8I 1VQMI 1VQ5I 3G6EI 1FOYA 3CF5F 2K3FA 4IO9F 1YJ9I 1Y39A 1ACIA 1VQ6I 2E34A 1VQ9I 3CCLI 1VQOI 5DM7F 5DM6F 1VQPI 3CCVI 5GAGJ 2QA4I 1YIJI 1VQ8I 1YI2I 1VQLI 1VQ7I 3CD6I 2H8WA 3I55I 3CCEI 3G71I 5JVGF 3CCQI 3CCUI 2NXNB 2QEXI 3CC4I
chains in the Genus database with same CATH superfamily
3I3LA 2VC0A 3PFYA 2EFWA 2DAOA 5IY5H 1UG0A 4QPQA 2ZJPF 3DCFA 1CF7A 3ZRGA 4B44A 1XSVA 2FEZA 3TP3A 5ICEA 2XPVA 2LSOA 2MBFA 4E7KA 1FMWA 1D5VA 1JKRC 2E2IJ 5B1AH 5D8KB 2XSJC 3A0BC 2VXDA 1KQ0A 2D2WA 1Y1VJ 4UV8A 2LP0A 3ABMH 4ENMA 4ZZLA 4FETA 2VKEA 3KYCB 4A6DA 1WH5A 3LQQA 5J8FA 5DUKA 3S2DJ 1QHHD 3GMEA 5DD4A 1DP3A 1ZRFA 2HYGD 2DU9A 1X1PA 2K3PA 1MH4A 5IYBJ 1ZN2A 4J01A 2KZGA 2RAEA 3BTLA 3C2HA 2QSGX 1BN5A 4PK4A 3CDLA 4O6JA 1MNDA 1QVTA 4CCMA 3OYCA 3OIQA 3FM3A 2R92J 1FY7A 2R7XA 2FQ4A 3C2BA 5D5UB 3GO5A 2OQGA 4RM2A 5CVRA 1BJAA 1ETQA 1TZLA 3IC7A 1VQ6I 4IF4A 3RKXA 2XKPA 4DW6A 4ENNA 3K7AJ 3GLLA 3I53A 2OC6A 1R22A 3ZQFA 3J81Z 3R6SA 1MDMB 1RRJA 1IUYA 3TQNA 3F8MA 1R71A 3I59A 3P9KA 3OR2C 4C3IJ 3BJAA 3QAHA 5JR3A 2FBKA 3BG9A 2E5ZA 5JHFA 3K4LA 5EEAA 3DEUA 4BXFA 2GXAA 1XMAA 1JTXA 2ZJQF 3HB9A 3NRVA 4KN7X 5TJJA 3CUQC 2L5QA 5CKTA 1E3OC 2JA6J 2K7LA 3H5RA 5K1YA 5E79C 4HRIA 4HV5A 2JA8J 3J80K 5ICFA 5LHHA 2M3AA 4ZYHA 1EV7A 1GVJA 2STTA 2O61A 2XKOA 4E7JA 3BCAA 2YUSA 3CMMA 2EILH 2WC2A 2MA3A 2L7ZA 1XD7A 3CCMI 1HKQA 3C7JA 3H0DA 3TW7A 2Y9ZA 3ZN0A 1T6SA 1GV2A 3FXUA 1E0EA 1QPMA 2FA5A 3JRBA 5E17F 3M8EA 4EJUA 1SD7A 1VQPI 4BEHB 3L2VA 4CSWA 3OL4A 3HOTA 2M5WA 4JX6A 4ESBA 1REPC 1GDTA 1PYVA 2XAJA 4E7HA 1WJBA 4KMFA 1ZH5A 4D7MA 1B8IA 2ZKZA 2A69F 2ELKA 2W82A 2F4MB 2KJBA 3AAFA 2ZSIB 1K4TA 4IHTA 3FKJA 3ZMDA 1U3EM 4LLLA 1MW7A 4A5MA 1BR2A 1DGWY 3MKWB 3ABTA 1IXSB 5K7HA 3GVAA 2ZNZA 2O8KA 3OOPA 3ZR8X 2N8GA 1DU0A 4LLNA 3GTLJ 4IVNA 1VQ7I 3CLQA 2ZXIA 1MMAA 1C0WA 4GO1A 4CA0A 5KNLA 2ESHA 3GBGA 4BXUA 1OJLA 4KUMA 3VPRA 2F2EA 3BPVA 3DLLF 3AG2H 5HNFA 3C18A 2R4GA 5J1RA 2JQ7A 4HF1A 2LK2A 2FU4A 4RA2A 2JZYA 3S8PA 4NHJA 4A3CJ 2L4AA 2HOTA 1XTAA 4A69C 4DJAA 1YW9A 2KMUA 1D3YA 3FXOA 3DKYA 5HVQC 3TMOA 3V7RA 1YO5C 1PUFA 3VSKA 1YTYA 1YRNB 4ZYEA 4B8XA 3BR6A 4R1HA 1EJ9A 1S3JA 4HSRA 1LPQA 3WTSC 4Z2YA 4BE1A 3C1DA 1TW3A 2R7RA 3M1CA 1ZLJA 1WQ2A 2E1OA 3G4SI 5FRNA 4GFBA 3P9CA 3OYAA 3E6CC 2HI3A 1LFUP 1ULYA 3I4NJ 2EZLA 1MSFC 2LY1A 4HLYA 2EPFA 5F6FA 4RAFA 2E1CA 2Y31A 1FYLA 1SD4A 2A3SA 3E5UA 1S6LA 1UCRA 3KP6A 1H89C 1YS6A 2KQRA 4DOZA 5IOYA 1T2KA 2ISYA 1R4MB 4IOCF 1FBQA 2AQEA 3ONQA 2HQNA 3BTJA 2YSRA 2E7WA 3PNYA 3S16J 3ZN1A 3IWFA 2IT0A 3OY9A 1R9TJ 2VASA 5HNHA 4DBRA 2G7HA 2P81A 3R60A 4QPOA 2AS5F 3OYNA 1SEUA 4HEA2 4W97A 1APLC 1LJ9A 1IXCA 2FMYA 1BM9A 2M1BA 2X51A 4N9IA 2EFOA 5EZHA 2E2JJ 4YRVA 5HDNA 2VC1A 4L0YB 2A6EF 2DK8A 3FMRA 5H6RA 4XLNF 5IT9Z 5E3MA 1A5JA 1U9OA 5EG0B 2QA4I 4L9JA 1KYWA 1O3QA 2EINH 4N9HA 2VE9A 3K2AA 1XMKA 2BGCA 2V1NA 3RDIA 1L3LA 3SHFA 5FROA 3PQKA 3T1BA 3CMEI 1R4NB 3DP7A 2CW7A 3FK7A 2JJ7A 3FMSA 5BS6A 2FOWA 1TL8A 5ICCA 1KU7A 3PUFA 3ZMUA 1K4SA 4BS9A 4A3IJ 2HZTA 5J47A 4G8XA 3VB2A 5KVRA 3OV8A 5CVJA 1MBFA 5F1RA 2LC2A 3F72A 4E70A 1HKTA 4XSZF 4XKCA 1SD5A 1WPKA 1IUFA 2G0EA 1T39A 4PFOA 5FB2A 3TGNA 1OCTC 3Q5FA 4JK1X 3QRFF 5FLXZ 4Y52J 5B66C 1O3RA 2HQAA 3FXKA 2GA1A 4BHBA 1DQUA 3G1MA 4FE7A 1ZAOA 4CUGA 2EQRA 3OR1C 2GM4A 4A3FJ 1K78B 2F5DA 3K1PA 5TGTA 1KA8A 2X48A 1HDDC 1ZRCA 4A0YA 1O3TA 3RSNA 5FKLA 1P4AA 1TW2A 2G7UA 1T0FA 4PGGA 2KZVA 4ENJA 5D5VB 3EUHC 5J8CA 4RB1A 1K7AA 2ETHA 3DFGA 1XSDA 3LSGA 4RB0A 5FGMA 2XV4S 1JJ6C 4U88A 3T8TA 3Q9VA 2B7EA 1POGA 2BVLA 2EA2A 2MW8A 3FBIB 4LGWA 2OD5A 5HLTA 3HDDA 1LNWA 3LSKA 2DA6A 2OV7A 1SVLA 2M87A 5E3OA 1YLFA 3HL2A 2H94A 3A01B 3S1QJ 1UG2A 4L0ZB 3E5QA 3GTOJ 2LVSA 1A31A 3J7YJ 4EV0A 4MHGA 4XL9A 3BLYA 1Z9CA 2I5UA 1I6HJ 3GW2A 1KGSA 2XUBA 1DUXC 1ACIA 3MZHA 2OU2A 1I27A 4OMZA 4R8HA 4DYCA 2HTSA 1G2HA 2QQ8A 3CC4I 1IN6A 5ICGA 3I9V2 2W84A 4N4NB 1V55H 1TWAJ 3K70D 3I4MJ 3IRQA 2AO9A 3PJRA 4ENKA 2XAHA 2H1KA 1RC9A 1N77A 5GP9A 1OCZH 3CUQA 5F27A 3GTKJ 2EZKA 3DWLE 4Y15A 2K9QA 2KIFA 2DTZA 2O7OA 5BPDA 5C4JJ 4YIFA 5GAEJ 1JUPA 2VKHA 1MBHA 2KISA 2V1UA 4DIQA 1VQ5I 3PM1A 4FE4A 2L3DA 2A5WA 1WFXA 1R58A 3RYRA 2X1EA 2OTJI 2QCOA 2H8WA 3M7GA 2XAUA 4GXOA 3CCUI 3LNQA 5IPAA 3ZQ7A 4UVBA 1WI9A 2E19A 4IHYA 4WK8F 5HLHA 3E6DA 2ZC2A 3K4MA 2Q2EA 4ZDPA 1I5ZA 4FT8A 2VKVA 1Z05A 3OYFA 1AWCA 1QA6A 2YX4A 3WE3A 4KN4X 1T0FC 3S1RJ 5IOZA 3OYKA 2F5VA 2L0KA 2L9RA 1BR4A 2KIQA 1S7OA 3HOWJ 1ZREA 4MTDA 5E20A 1OMIA 1XSXA 3HIFA 4NC6A 1HSJA 3KP7A 3MZ8A 4CICA 2RNJA 3KP4A 4WF2A 3H9JA 1X3WB 2IPQX 2F5FA 2Y48A 1XGSA 3ZGKA 2IA2A 1ETXA 3IAM2 4RLFA 4AVPA 4F91B 1FTZA 1XPXA 2QENA 1AU7A 2UWMA 3A0HC 2Y2ZA 3ERMA 2DQRA 4L5JA 3TL4X 2L9SA 2KFDA 1FJLA 1RZ4A 4I0AA 2HPMA 2HFHA 1B9MA 4PJLA 3S15J 1FPQA 2HS5A 4LG3A 4A3BJ 2DJIA 4I01A 1FC3A 1TQIA 5D8LB 2LOOA 2B9SA 1MNMC 2R93J 2M8GX 3HKZA 1YITI 2XAQA 4L9TA 4C3JJ 4XRFA 4XORA 4NC7A 3QODA 2K4BA 1DPUA 1MD0A 2QM3A 2EV0A 5FD6A 2VBYA 3DKWA 1IF1A 1UAAA 2DXIA 3ZQQA 3Q0VA 4PSXA 1ZKGA 4V19K 2RV8A 5FFZA 3E0JB 4IXAA 5ILVA 1MMGA 2L7MP 3CO6C 1G4DA 4WCGA 4XOTA 1ZGWA 1ZTRA 3H5NA 3BOQA 3BQZA 1VQOI 3H3VK 2O0YA 3MZYA 1I3AA 2M34A 3EYYA 3TW6A 1H0MA 3WTYC 5CJ9A 2H27A 1TT0A 2BY1A 3I59B 4EGZA 1WSUA 3JRCA 2HNHA 3KE2A 3VYSB 2K9SA 2JRTA 2KL4A 2HYFA 4OIOF 1VF9A 1XMXA 2CU7A 4BXXJ 4AC0A 4A3MJ 3ZXSA 2R7FA 1YS7A 2VT2A 4LG0B 4L9NA 3CCSI 2VE8A 4BJTA 4LITA 2R7UA 5C44J 3HEFA 3TKYA 5BMZA 2LTPA 1B72A 2B63J 1ZG3A 5DM7F 1PP8F 1B6AA 1BJZA 3I55I 3LSPA 3QYFA 4UB6C 1QU3A 2HQRA 1YOVB 1E3HA 1FLIA 5L3BA 5H6QA 2CUJA 3ASOH 3Q3SA 3I56I 4KIFA 3I0TA 3HRMA 2WY8Q 3OOUA 5LGNA 1G3TA 2IS2A 1QNTA 3F6OA 1QZEA 2Z2SB 2JWTA 2QGUA 2NS8A 5J4YA 1FYKA 4AYBA 4ZYGA 2F48A 1XDUA 1GUUA 1U5TA 3ZMZA 1BL0A 3M8FA 2X4HA 1FP2A 2EBIA 2Y0SN 4L5IA 3JSPA 2NVQJ 1ZR2A 1FZPB 3DBRB 3MCZA 2KDOA 5D5WB 3HRSA 4ZTFA 3QPSA 3CZ6A 1GLNA 3B02A 1P6RA 4A3EJ 4K2EA 3WHBA 1P2FA 1MJ9A 3KYLA 2GZWA 3CC7I 1AKHA 2XHKA 3K4CA 2XRNA 4OAZA 3OYLA 1ON2A 3H3UA 2HPIA 3BC8A 2DYRH 3L2QA 5DUIA 3BTCA 3M07A 3HJEA 4EM2A 2DA5A 4OIPF 2BE5F 4X6AJ 1TQMA 4LK0F 3JAMK 3H9GA 1Z6RA 2NNYA 2IS1A 1YG2A 5BOXA 3KEQA 4HX4A 2R0QC 4BE2A 1ZQ3P 1KYZA 3T8RA 3W2AA 2PX9A 2PJRB 3OS0A 1Z6TA 4XN3A 4BY7J 1TP4A 5TRDA 4ZDOA 4P1WA 3CJTB 4XKBA 5E18F 4BY1J 2BZTA 2MD5A 3F0CA 1UHSA 1V3FA 1E2XA 5C3EJ 1WZ2A 1MGTA 3E7LA 1QQIA 5LGTA 4A3JJ 1J59A 2QBYA 1FOXA 1JJ8C 1BR1A 1G6NA 3BG7A 4YELA 4WWCA 4MFDA 1XG1A 2PJRA 3RPUD 1IDYA 3KP2A 3OYHA 3RZDJ 2NRAC 1BA5A 4HZFA 3ECOA 2QQAA 5JHUA 5B1BH 3TEDA 1VTNC 2WA0A 4QLCU 1E17A 2HYJA 1TNSA 3K4NA 1ZG1A 1HQCA 2DMTA 4C3HJ 1YJNI 3D0SA 4BE0A 1J75A 1IN5A 4XQFA 3DF8A 2VQGA 2DK5A 3BR2A 4EJVA 3IL2A 3WODF 5D6EA 3HTSB 1S8NA 3KLOA 1WJEA 3GXOA 3WHCA 3CCEI 3GTMJ 2K5CA 4UNOA 3WG9A 1G3SA 1SFKA 3HHGA 1WHUA 3BG3A 5FKNA 3BR3A 3HRTA 3WTUC 4A3KJ 1RESA 2P7VB 2X9DA 4IHVA 2R7ZJ 5D6FA 1P4WA 3N97A 1IG7A 2BVMA 4UXNA 4F55A 3QP6A 4YIIA 5EGOB 3A03A 5CVUA 4HYEA 1XGMA 1YJ9I 4ZYDA 1DPRA 1HLVA 1HKSA 2XDVA 4MIMA 3I58A 2GOMA 5HS9A 1ETKA 2EV6A 2GOXB 3WTZA 2QSFX 2VIXA 4LK1F 1NH3A 1I1SA 3BR5A 3H1CA 3KIOA 1S7EA 3OYGA 4MEXF 1KQ8A 5FO5A 5LBQA 3GX4X 4XLEA 3V42A 2FRHA 1I39A 4E7LA 2YX7A 2FSWA 4XIDA 3NQOA 1OYWA 1NK2P 5GTHC 3RQIA 4HAMA 2CQKA 2DTRA 3HTUA 1YX5A 4G94A 5AONA 2L9NA 1UJ8A 4ETSA 4GCVA 3DU6A 1BW6A 2H1LA 1IW7F 2JA7J 4B09A 2MYSA 4WXDA 4XSXF 2DDBA 2CGPA 3QYBA 1IO2A 2DMUA 2D1HA 2IVMA 1WGXA 3S3MA 3A1YA 2X6YA 4RDUA 3NEUA 1K78A 3HOXJ 1DGRM 4BUPA 3TOAA 1IN8A 2K9NA 4A3LJ 4PJ0C 2XB0X 2VQHA 3TO6A 2DA3A 4BYYA 3TBIA 1FIAA 2E35A 4HNUA 3QP5A 5HODA 1FT9A 2V4JC 1NG7A 3F21A 3WGGA 3H5AA 2GA2A 2JPCA 4EM0B 4CZCA 2YPRA 3D1NI 3BJ6A 3K4JA 2HZDA 1G3YA 4KNYA 3OSGA 5FFXA 4DNCA 4B4CA 3H35A 3JRDA 2DT5A 3GEZA 4E7SA 1XCVA 4HF2A 1J5YA 1AKHB 2LFBA 2Q0OA 2E1NA 2E7XA 1U0JA 1AA7A 3VYTB 1X1DA 2HOAA 3VODA 2VPLA 3E6MA 4MNUA 2IEKA 3WU0A 2FD5A 1K61A 1X4OA 2MFZA 2VKDA 2W4SA 3QU6A 5JLWA 2VLAA 1GXPA 3WGIA 1LKXA 2FF4A 3CUOA 3PNVA 2RNGA 3ERED 2K3FA 1NK3P 5L3EA 4PCQA 3RKWA 4CYCA 3HBLA 1XC5A 2PQ8A 3ZMSA 5A2QK 5E3LA 1A36A 2HXIA 2E1MC 5E1WA 1IXRC 2O03A 4KDPA 3MD2A 3IAS2 2ISZA 4GYGA 2JVHA 5D4SA 5CQEA 3G3ZA 2XASA 3ASNH 3K6GA 5DTDA 1OYIA 1Y0NA 2I10A 1ZELA 2TCTA 2XAGA 2RREA 1R49A 4BDYA 1J9IA 1LQ1A 2RKHA 2ZB9A 4LB5A 1QZZA 4XN0A 2HGCA 3E6BA 3HG9A 2VJ5A 4BHPA 4OU0A 4JX5A 1KQ9A 2X0LA 3FX3A 5GAHJ 2XGDA 4CZZA 5J1YA 4M9ZA 3SEZA 3HOUJ 4BBSJ 1IGNA 2OUMA 5CPRB 4CCNA 2Z9OA 2IGOA 3DPTA 1I50J 2RN7A 3OYJA 5FRMA 1MBEA 4FX0A 3O2PE 2VJIA 1SMYF 1S5LC 3H92A 4BDZA 3AG3H 3E1SA 2W00A 5HLIA 5AIPA 1U2WA 1T8IA 1VQ8I 3L2UA 1Z67A 1ZGJA 1ZG5A 1X4PA 2V26A 1FP1D 4GDFA 2VOPA 1NG6A 5EF6A 3OIPA 2LG4A 1LFPA 4AYBN 4P55A 3LSMA 3ZOBA 3DPLC 3VEPA 4RGXA 3PO2J 5L3DA 5LD2C 3S2WA 4BKXA 2F6CA 1SD6A 3OIOA 3DTIA 2M8EA 2UUZA 3EPZA 2GQQA 2A61A 2O9LA 3S93A 3Q0UA 1U78A 3S14J 1W0TA 1MZBA 1JE8A 3IUOA 3EDPA 4C2UA 1LDJA 2IA0A 3CP8A 3GZ5A 5BQTA 1JI8A 1EKEA 3LFKA 4HNTA 1ONVA 4Y17A 5EYRA 4S0HB 4UUTA 1Q1VA 4AIDA 4XLCA 2GAUA 1R1TA 3BDDA 1D1CA 3S17J 4IRHA 4CO8A 1R00A 3PUBA 1N75A 2HKOA 2ZMEA 3L9FA 3QYEA 4R79A 2GLOA 2ACJA 4PDKA 4BU2A 1T33A 3RCOA 1IDZA 4ZYAA 4IZZA 1EA3A 2LH9A 1W7PA 3SQNA 4XNFA 2DT7B 2PJPA 1B59A 4WXHA 4M6VA 3FXQA 3FZVA 3MFKA 3PO3J 2IS6A 1A6IA 4V2GA 5KHDA 3WU1B 2Y0MA 2LY9A 3VYRB 4A93J 2DPDA 2Y75A 1V4RA 3E97A 2PMUA 5DYMA 2M7AA 2L7FP 4CCLA 2NYXA 4AU7A 1ZR4A 4RB2C 1TNTA 4H4KC 3IV5A 3RYPA 4DGWB 3HKZN 3S1MJ 4Q5SF 4G6TB 1W0UA 4A3GJ 2RQPA 4II2A 3GTQJ 2X85A 2B0LA 5DS9A 3ZQCA 3BROA 3CD6I 3VSLA 1GXQA 5BNGA 1TWCJ 4UB8C 5HS8A 2H8RA 2X1CA 1Z91A 5E8GA 1U5TC 5LHIA 4F92B 2VXZA 2ZFWA 4J19A 4E7ZA 2DFEA 2L01A 4AIJA 2M0CA 1H88C 1IV8A 1OCCH 1OCOH 1QO0D 1IV6A 2JK3A 3DQVC 2A05A 1JHFA 3GZ6A 4IJAA 4YFKF 2A68F 2OZUA 4BQNA 5M5YJ 2YR2A 4LB6B 3S2HJ 4M3FA 2PEXA 3BQYA 2E36A 3K69A 1EH7A 1Y56A 1NTCA 4LMYA 1O57A 3ZCOA 5CLSA 2VJ4A 3M4OJ 4IX7A 4CDGA 4EATA 3CCRI 2DJNA 1FTTA 1FOWA 2QF7A 3KETA 1IRXA 4I09A 4KT5C 4HDVA 4RS8A 2CO5A 3TP0A 2XAFA 3HUGA 1ZK8A 2VONA 3X2QH 4CCJA 1X1BA 3LSRA 3P9IA 3H36A 2BXYA 2W1OA 4XRSG 3WTTC 2IGMA 3F8CA 3LAJA 3CTAA 3RI4A 4MO7A 3EYIA 4HBLA 4Q4ZF 4X1EA 2R5YB 3WTXC 3QOEA 1QZYA 1A35A 2Z3YA 2XROA 4OAYA 2FBHA 2NVYJ 1E3PA 3IP4B 1J09A 2KHMA 4FX4A 2O5RA 4CYCB 2E34A 2HTJA 2VBWA 3W2WA 1H8AC 1RETA 3HOSA 1Z3YA 1F1ZA 1X2NA 4M3EA 2JSPA 2LKSA 1IAWA 4RAZA 3MEXA 1MBJA 2NVUB 4QIWN 2K85A 2PMZN 2QLZA 3AG4H 3FBNB 3Q0WA 3D5SC 1UHWA 2P6TA 4FCYA 4EVIA 2QUFA 5E1XA 4ZTJA 4JYKA 1MJAA 2HR3A 4XLPF 1DDNA 2STWA 3H3ZA 3ZMVA 3LOCA 5HS7A 2DPUA 2QSHX 5FJ8J 4D1QA 4IHWA 4HNVA 1Y6IA 2DO7A 2LR8A 1XX5A 5JVTA 1HW1A 4G7OF 1J2XA 5KAIC 2HQ5A 1OQYA 3G2BA 4GRIA 2HU9A 1FYMA 1W4MA 1Y8QB 2J5OA 3A4CA 1SFUA 1XN7A 1RIOH 2BBYA 5M3MJ 1DU6A 4HG2A 1YW7A 1N25A 4W1UA 3W6VA 4BL0B 2GBYA 1V54H 3QPLA 3RKQA 3J7ZI 2NVXJ 2ZSHB 3EUAA 2XF6A 4QSHA 3GCMA 4C2TA 1SVOA 3TO9A 2MC4A 3U1KA 3J81K 4DBQA 1ODDA 2ZJ2A 3ABLH 3F9KA 3FF5A 1BI3A 1OLTA 5IT9K 3FM5A 2WADA 2KKOA 4B43A 1HA8A 2X6OA 5LFAA 2JN6A 4IRGA 3JW4A 4BGDA 4KT6A 2MH9A 2VQLA 3ZMTA 1HC8A 2P4WA 1LUJB 2RGVA 2CSOA 3T5XA 4O3MA 3O3KA 4G6DA 2DFHA 2BW3B 2DFIA 3CCLI 3OYIA 3V7CA 4B3AA 3MN2A 4IRIA 5HDKA 3HC7A 2HOSA 3LL7A 3K0LA 1ZYRF 2R7QA 3HZJA 1OCPA 1U9NA 4L9VA 4EJTA 4BAYA 2GWRA 3W6JB 5IYDJ 1K83J 2QQBA 5F64A 3E3VA 1R1UA 1QVUA 4CHUA 3SXYA 5LHGA 1UMQA 1IRFA 2MABA 3JCUC 1K6YA 2ECBA 4ZH4F 2M2EA 3ECHA 1W36C 3HSFA 1Z1DA 2LKPA 1CQTA 2ME6A 3SFIA 4M72A 2LDUA 4NDLA 1RKTA 3BCBA 3QU3A 4HLXA 1WJCA 4NBQA 2DOEA 3SDBA 5HOOA 1BW5A 3F3XA 4HOBA 4ZJZA 2FXAA 2UV1A 2Y9YA 3EUHA 3KX2A 1YQAA 3PQJA 2BY2A 2EIJH 4EM1A 1ON1A 1VZ0A 2FNPA 3PIPF 5FKOA 3EQLF 4FASD 1LDKB 1XGNA 1FOYA 2P5VA 2KIUA 2P5KA 3A01A 4F7ZA 2IS4A 2UXNA 2FUG2 1UELB 3V4GA 4U7BA 2LREA 4UVAA 2OPTA 1YW8A 2PN6A 1JTYA 3C2GA 2MSYA 1S7AA 3LSJA 4KYWA 4ESJA 5IP9J 4BJ5C 5J6XA 3ELKA 5HLGA 1KU9A 3PL8A 3IKVA 2M7BA 2WB1A 2CV1A 1VQKI 4IEJA 1K6OA 3OYMA 2K02A 1X1CA 1BIAA 2CQXA 1WJAA 2E2HJ 1YIJI 2MD0A 1HW5A 1GVDA 4I02A 1X19A 5LEKA 3GFIA 4LLGF 2L02A 3N05A 2M9HA 3IH2A 3LAPA 4ZDLA 3CDIA 3F6VA 2KLOA 1P4XA 4M3GA 4AIHA 5CVIA 3CJQB 3K4BA 4ABZA 3CF2A 1MJBA 1BI0A 1KONA 1IRGA 4YIRX 4M9SA 2P6SA 3HOZJ 1TT5B 1VFCA 2DYSH 2XIGA 1S9HA 4CYDA 5EDNA 1WCMJ 4I7HA 3BG5A 2NVTJ 2VB6A 4HX7A 4TV7A 2R7WA 4YFNF 1ZRDA 4KFCA 1W5CC 2H6CA 1F36A 4DZPA 3OYBA 2XF5A 1HSTA 2V1XA 2ZXJA 4AIKA 5D4RA 4HA8A 3WTVC 2DMQA 3K2ZA 1RI7A 2EZHA 1MMNA 2XPWA 1F9NA 3HOYJ 2QKLB 1LB2A 5EJCA 3CDHA 2JUGA 4CCKA 3T0YA 1V5FA 3N4MA 3GTPJ 5F04A 4YEJA 4O5VA 4KISA 3BTIA 3QWLA 3L1PA 4OOIA 4P9UA 1G8XA 3FXMA 1VQ9I 3OYEA 5M5XJ 4BNCA 4JX4A 1W1WE 2V1DA 2FJ1A 2ZBKA 2Z99A 1Z21A 1WWXA 1P7JA 2QZ8A 2UXXA 4NB5A 4C30A 4EMSA 2R5ZA 1D8KA 2ME0A 3O8GA 5GPCA 2UZKA 4ITVA 2CRGA 1RUOA 5E8IA 4PUSA 3VYUB 2CUFA 4YG2F 3DTKA 2OJED 5EG0A 4OIQF 1TC3C 2AQFA 2EV5A 4AD9A 3WTWC 1H9TA 5J4VA 2A07F 1QPIA 1VI0A 2DMPA 2VL8A 1U5TB 3UNGC 5A2QZ 1PUEE 2Z33A 4IHSA 4D7NA 4QTRA 2JT1A 3AG1H 3AFHA 4RAGA 1I6XA 2HVRA 4LD5A 3VWBA 2OZ6A 2H6BA 2XSDC 2HDWA 4A0ZA 5IYCJ 2GXBA 3CLOA 4AWXB 2WBMA 3G1OA 1ZARA 4V2FA 3R61A 4BEHA 1JGGA 5L3FA 2OQRA 2ZXWH 3HM5A 2DOAA 2KP6A 3KLNA 4LFUA 1RNLA 1OR7A 4XLAA 1JGSA 2Z5UA 1XB4A 1G59A 4XRSA 4RMNA 3G6EI 1D8JA 1UZCA 5FKMA 2P5LC 1ZLKA 3PSIA 5J3LA 3HRUA 3H9QA 2MGQA 3ZQIA 3JRHA 5M3FJ 1MSEC 2AHQA 2WV0A 5K5QA 1FBSA 1T38A 3ZQLA 1JKOC 2OBPA 4PJNA 2Y30A 4F93B 2DA4A 3HPHA 2DA7A 2BHYA 3MMYB 5K7ZA 1P92A 1AHDP 1TBXA 2BXZA 3B6AA 2EK5A 4OIRF 3V8LA 1QBJA 1FSEA 2Z1DA 1TTYA 2BW3A 3CMYA 2ID3A 4ANJA 2ELJA 2F5EA 3MKYB 2DA2A 4LIVA 2FOKA 2HKXA 1P9QC 5DCFA 1R1VA 2QBYB 1LFBA 5JVGF 1FOKA 4N0BA 4U0VA 3HOVJ 3KP3A 4U87A 4NQWB 5GPAA 4CCOA 1AOYA 3S32A 2JVGA 4Y7NJ 2IGKA 2K9LA 1YJWI 2HVSA 3FXJA 1JT6A 5ERIA 2GIZA 1W5SA 2LMDA 1RR8C 2Q2EB 3E5XA 5HDGA 3TO7A 3ULQB 1WVRA 1MH3A 1WI3A 3EUKL 1X58A 2EFNA 5FD5A 5DEQA 2ZCWA 4B48A 5DM6F 2JRMA 1OFCX 4HQEA 3F8BA 4M6XA 2DDAA 1JUSA 2KJCA 2V6CA 3CJNA 1H9GA 3KCCA 3DKXA 1B8IB 1U8BA 3GYHX 4M71A 3HSRA 3I5UA 4M6YA 4D0PA 3U1DA 1FBUA 3BZ6A 3VOEA 1YYVA 4EQQA 2VI6A 4XK4A 4BQAA 1I3QJ 3A02A 1MBKA 5E1ZB 3F8FA 3PNTA 2NS7A 2QQ9A 4F3QA 5EGOA 1PDNC 1LE8A 3J7AY 2G9WA 1FWZA 4RGSA 4U0WA 3CO7C 4FHTA 3QPHA 1MMDA 1WKMA 5DCMB 3BP8A 4ON0A 5DV5A 3F23A 2IAIA 2TDXA 2JSCA 1JKQC 2VN2A 2IP2A 3M8JA 1JXSA 2P8TA 4XR6A 2KIMA 2P7CB 4BJ6C 4DQ2A 3AKZA 1MNEA 4IPAA 3AL0C 2X6XA 4G7ZF 5LRRA 2OAZA 3REOA 3UKGA 1T95A 2OA4A 4HQMA 4IQ4A 2O6GE 2XPUA 2IGNA 2W48A 2TRTA 2CW0F 4XICA 1ETWA 4RAYA 4KJZA 4ASNA 3KZZA 4CH7A 2OCCH 2LBFB 1TLHB 2VQCA 2FE3A 2M0MA 3IH4A 2CG4A 3B6CA 4XLHA 3LSIA 4LOCA 4PJMA 1HF0A 3ZQGA 3BWGA 4AUXA 2R7SA 2L54A 1Z7UA 1HW2A 4I99C 1IN4A 2IA1A 1V5GA 4JQFA 5E3NA 1HOMA 2IRFG 4MLOA 2NOGA 1USSA 2HEOA 3RPQA 1BC8C 3W2VA 2MC3A 3LA2A 3BG6A 3ML6A 3OL3A 3BPXA 1Z77A 5FLXK 2V9KA 4M3DA 4QWQA 2YU3A 1R5GA 2D5VA 3JRGA 1W7PB 1UB9A 2I8DA 4B3XA 3CCQI 1T08B 5D5XB 5B5EC 5F08A 5H20A 1IN7A 3IKTA 5C4XJ 1TWFJ 2DFFA 2WV1A 4HW0A 4A2UA 1Y8RB 2LNBA 1VQ4I 3LA3A 2LYCA 1YIOA 4Y4RA 3BJOA 5DD8A 2RQQA 4M9XA 2LRDA 2W25A 3GWZA 1WJ5A 3BR1A 2RVCA 5F0CA 4C9YA 3GUDA 2M4KA 4G9YA 5KCMA 3TDZC 2VBXA 3C3WA 5IT3A 3CQZJ 3O8HA 5LEJA 2K86A 1RR7A 2JTVA 3FHZA 1SFOJ 2EIMH 1XGOA 1PP7U 3K9TA 4RLQA 1HBXG 2R7DA 3R4KA 2VOOA 3A2KA 1BOBA 3RKYA 4E6KG 3WE2A 3FDYA 2CV2A 2WB1N 2R5ZB 1SAUA 2K40A 3KPHA 3H0GJ 1FNNA 2HOEA 4I98B 4XBFA 1ETVA 3IWZA 3RQ4A 2QKMB 2F4IA 4LJZF 4D5CA 2F5CA 1R7JA 2E1MB 2FMLA 3L7WA 1B72B 2F4OB 4D5FA 3M9AA 1WJFA 1B9NA 2VPRA 2K4JA 3DBLB 1ETYA 4RGRA 4NQWA 4B1RA 3SZTA 4UHTA 2PG4A 3DV8A 4P9FA 1TWHJ 5GAGJ 3KZIC 4PFPA 4S04A 3CUQB 2A6HF 3EETA 3GZNB 3HYIA 3S1NJ 1MIJA 5F0FA 1K79A 2KRFA 3GLXA 2CFOA 4M3BA 3FIWA 1N78A 1X1AA 2EB7A 2JMWA 5BPIA 5L3GA 1Y0UA 6PAXA 2JA2A 2KPMA 3VDXA 1NHAA 4FTHA 4E7IA 2ADUA 2CS3A 2WAEA 3RZOJ 2KRHA 2L7KA 3U9GA 5ED4A 1EF4A 1J0RA 1O3SA 4KITB 3ZP5A 5JI6A 4U0YA 2V9VA 3KZYA 1T98A 1R5HA 1WJDA 3O6BB 1FIPA 2IJLA 1MMSA 2PBIA 4JOMA 3RPUA 2HWVA 3B73A 2OF7A 3I54A 3DPUA 1W5TA 2R5YA 2ECCA 1IC8A 2EFQA 2EZIA 2HVQA 3D5RC 2BV6A 3LA7A 3NAUA 1RPWA 1U8RA 1SVMA 3K1NA 4PZJA 4DYQA 1GV5A 3HSEA 3LSHA 5FKKA 2ZXHA 4G7HF 3HGYA 4CGZA 2XVCA 3IHUA 1RKWA 1OCRH 5L3CA 4OINF 1GHCA 3DEWA 4G12A 2WAQN 4Q48A 1HXDA 3SJMA 2CUZA 2L4MA 2V6EA 3CP2A 3FK6A 1CF7B 3GFLA 3ZQHA 2CJJA 2LBFA 2ZNYA 3ESWB 4H0EA 1EH8A 4UY8I 4A5NA 3NWTA 1FMVA 2BHZA 4JP0A 2XRLA 1QHGA 3JRAA 5JLXA 1D1BA 4A3DJ 4YFXF 4L5EA 3W3CA 5DDGA 5EEGA 3GTGJ 3ZPLA 1LEBA 3MKLA 1HDPA 1BIBA 4FQGA 1GT0C 4MTEA 2JA5J 5J1UA 1ENHA 2ELHA 3V8KA 1L0OC 3I4PA 1ETOA 2EJRA 3M1EA 1MBGA 1LE8B 2XB5A 4KMUX 1STZA 2VT3A 3SFZA 1LDDA 5F0HA 5DCMA 3JTGA 5FLVA 4AM3A 2CQQA 4D9JA 2QVOA 2KDZA 3LMMA 2Y0SA 2GXGA 4A6EA 4X0GA 1XS9A 2CQNA 3RJPA 5AIQA 4XKWA 2LY2A 3G1LA 3K4KA 2NS0A 4Y3OA 2PLYA 3DXJF 2Y69H 4M73A 3DU5A 3BZCA 3JREA 3FXLA 1G3WA 3HGGA 4GGGA 4UV9A 2W24A 3S3NA 1X3ZB 3MVPA 2CH0A 2XF7A 1WH7A 3IH3A 3MAJA 4MFEA 4WX9A 4NUBA 2RDPA 2VODA 3L00A 4RM3A 3DEEA 3MQ0A 3FHNA 2MLKA 2ZFUA 1Z3XA 1D0YA 4XKVA 2LKXA 2KT0A 4IL6C 3FXRA 1D0ZA 2A5YB 3PFIA 1TQPA 3V7SA 1SMTA 1P7IA 2Q8KA 1YE9A 4IQJA 1V5EA 3BY6A 2VUMJ 2V9PA 3KFWX 4EJWA 1Q1HA 1VQMI 2OCEA 4Z6YA 3G73A 3WU2C 2AXTC 3WG7H 3HUGB 1JT0A 1UHMA 1VQLI 3ABKH 3TOBA 1OKRA 3L2RA 2QYOA 2VBZA 4DZJA 2YU9J 1PJRA 1TWGJ 2H09A 3OS2A 1RUNA 3MWMA 3OMYA 3W6KB 3K70C 2DLLA 3LWFA 1FEXA 5M5WJ 5CQGA 3SDGA 2M30A 3CCJI 1FSHA 1R36A 2DQLA 3WGHA 1WRJA 4KIGA 4I2OA 1QGPA 2W7NA 2CWEA 3VFZA 3KEOA 3OWTA 1B4AA 4AVZA 4BHCA 4UUSB 2O3FA 3IRRA 3OS1A 4PSWA 4XMYA 2NOJB 2M4GA 3U2RA 4A0XA 3JRFA 4M74A 2IBDA 3KYDB 5TISC 2FX0A 4OWRB 5ILSA 4I76A 4A12A 5KAFC 3DTEA 4XONA 4BQQA 2D1VA 2ID6A 4S05A 3LSTA 1BC7C 4UUSA 1ERDA 4UUVA 2CFXA 2XC7A 1S72I 3QQAA 2OTLI 2LF7A 2RC4A 4JBAA 2P0WA 3UR3C 2BOLA 1PUFB 2J5PA 1OYYA 1Y39A 2EH3A 3BT9A 1R6RA 3FMQA 4KA4A 2CW8A 3K10A 4BACA 1YI2I 3G71I 3NWSA 1D0XA 4XOPA 2DN0A 2DBBA 1YX3A 3M3YJ 1CGPA 4UVCA 4IHXA 2LF8A 3CCYA 3NARA 4BH9A 3RIRA 1DP7P 2XGEA 4ESFA 5LGUA 2ESNA 4Q47A 2X6WA 4BQOA 2EA4A 2O8XA 1VNDA 1IZ1A 4E4HA 5ILUA 3SZPA 3SYTA 2BY3A 2FBIA 2DT6A 5GTIC 1JKPC 2DW4A 1T56A 2W85A 5LRSA 1X3UA 3JTHA 1OPCA 4NNJA 2V79A 3CJRB 2D45A 1R5ID 1Z7LA 5KK1A 3CCVI 5CYVA 4XLFA 3GFJA 5IP6A 3Q9SA 2E60A 4HX8A 4KICA 3P5JA 3FWEA 4NC8A 2MG4A 3HXLA 3OSFA 3COAC 3D5LA 3HHHA 4MQVA 3BR0A 5K5OA 1ORKA 1R23A 4HSTA 5FLMJ 1BI1A 2ZMEC 5K5RA 1F43A 2CMPA 5J40A 2CUEA 1SFXA 4BBRJ 4CXFA 2BY0A 2A6TA 2WY7Q 3DBHB 4HPQA 1LEAA 3CF5F 4IO9F 1ITYA 3JAMZ 5IP7J 2BYVE 3ROUA 3AL0B 4I6ZA 4LIUA 4RGUA 1W36D 2HDDA 2COBA 1F4KA 3ABUA 2VJJA 5EEHA 4IOAF 3CMAI 4MGRA 3JRIA 2W57A 4IKFA 4L18B 5H2FC 3R0JA 2DODA 1J7KA 4HDUA 4I0BA 3FISA 3QOPA 3JSOA 3JR9A 1YHQI 1XDSA 2DA1A 3V8JA 3FKIJ 2L9VA 2BEOA 3BZKA 2K9MA 5F1JA 3L2CA 1JHHA 2K27A 2DCEA 2PMHA 2QEXI 3RTRA 2YS9A 1PVEA 4EEFG 2EFPA 2ICWG 1O7FA 1I1GA 1BBYA 1VQNI 3J80Z 4LG0A 1XCBA 2ZMEB 1B1BA 2IW5A 1HCRA 3LFUA 4Y13A 2HXOA 3PSFA 1SFEA 2R7OA 2WTEA 4ZC3A 1FX7A 1ZGAA 4Y33A 1D5YA 3PIOF 1MDMA 1USTA 1W7PD 5B3SH 4MEYF 4PJJA 3F22A 1BOAA 3U21A 3S3OA 1U6GA 2DOFA 2R7TA 2CYYA 2JUCA 4HF0A 5JFRA 5EZGA 2DI3A 4P5OA 1SANA 2LLKA 1D1AA 2EIKH 5LLQA 3L09A 4FISA 3CC2I 2X1DA 2PMZA 4XRMA 4HV6A 9ANTA 4EGYA 3J7AO 4GYIA 2GIVA 2LD5A 3GTJJ 4MQ9F 1S29A 3P7NA 5GADJ 2IXSA 2C6YA 2XGCA 3KP5A 1BI2A 1EH6A 2WWYA 2HDCA 2DMNA 2KRCA 2XGXA 1SAXA 2M45A 4ZZDA 3MKZA 1LVKA 1YRNA 2EWNA 1M1EB 2COMA 1F5TA 1KU2A 1X2MA 2CQ7A 4P96A 1OISA 4G6QA 1Y1WJ 1UFMA 2NAZA 1OR7C 1SC7A 2JPBA 4KIBA 2PI0A 3F8NA 5CVVA 1IRZA 1QRYA 3LQRA 4C2MJ 1JUMA 2AXLA 2ZJRF 4J00A 3GFMA 5K7FA 2MH2A 4OMYA 3R0AA 1MKMA 3TDUC 2CV0A 3DLAA 3KEYA 2E5NA 3HPGA 2Q1ZB 3ISPA 4B47A 4RBOA 2R7VA 4EJOA 1IJWC 2QWWA 1KU3A 3SEQA 3SZGA 1A6QA 4RB3C 1O7LA 1A04A 3GF2A 4WXCA 2WAQA 1YFHA 3I71A 4U7DA 4N4OB 4F52A 2E71A 2ZO4A 4PGHA 2NNNA 3K1MA 2V7FA 2WAFA 1O4XA 4II3A 1LVAA 3QPTA 1ZHFA 1Z0XA 4XM3A 2Z16A 1KZHA 3CESA 2FNAA 2FQ3A 2L2OA 2MLGA 3OYDA 2R3SA 3I64A 3L2WA 2NXNB 4DYRA 2PFBA
chains in the Genus database with same CATH topology
2E36A 3CC2I 5GAHJ 3G4SI 1YITI 4IOAF 3DLLF 2ZJPF 3CCJI 1VQNI 3CMAI 1MMSA 1VQ4I 3I56I 3CMEI 2JQ7A 1YJWI 1QA6A 2FOWA 2ZJRF 1S72I 3CCMI 2OTLI 1YJNI 5GADJ 3CCSI 3CC7I 1HC8A 3CCRI 2OTJI 3CJTB 3PIOF 3J7ZI 2E35A 5GAEJ 2ZJQF 1FOWA 3PIPF 4V19K 1YHQI 1VQKI 3J7YJ 1FOXA 4IOCF 4UY8I 1VQMI 1VQ5I 3G6EI 1FOYA 3CF5F 2K3FA 4IO9F 1YJ9I 1Y39A 1ACIA 1VQ6I 2E34A 1VQ9I 3CCLI 1VQOI 5DM7F 5DM6F 1VQPI 3CCVI 5GAGJ 2QA4I 1YIJI 1VQ8I 1YI2I 1VQLI 1VQ7I 3CD6I 2H8WA 3I55I 3CCEI 3G71I 5JVGF 3CCQI 3CCUI 2NXNB 2QEXI 3CC4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E36 A;  3CC2 I;  5GAH J;  3G4S I;  1YIT I;  4IOA F;  3DLL F;  2ZJP F;  3CCJ I;  1VQN I;  3CMA I;  1MMS A;  1VQ4 I;  3I56 I;  3CME I;  2JQ7 A;  1YJW I;  1QA6 A;  2FOW A;  2ZJR F;  1S72 I;  3CCM I;  2OTL I;  1YJN I;  5GAD J;  3CCS I;  3CC7 I;  1HC8 A;  3CCR I;  2OTJ I;  3CJT B;  3PIO F;  3J7Z I;  2E35 A;  5GAE J;  2ZJQ F;  1FOW A;  3PIP F;  4V19 K;  1YHQ I;  1VQK I;  3J7Y J;  1FOX A;  4IOC F;  4UY8 I;  1VQM I;  1VQ5 I;  3G6E I;  1FOY A;  3CF5 F;  2K3F A;  4IO9 F;  1YJ9 I;  1Y39 A;  1ACI A;  1VQ6 I;  2E34 A;  1VQ9 I;  3CCL I;  1VQO I;  5DM7 F;  5DM6 F;  1VQP I;  3CCV I;  5GAG J;  2QA4 I;  1YIJ I;  1VQ8 I;  1YI2 I;  1VQL I;  1VQ7 I;  3CD6 I;  2H8W A;  3I55 I;  3CCE I;  3G71 I;  5JVG F;  3CCQ I;  3CCU I;  2NXN B;  2QEX I;  3CC4 I; 
#chains in the Genus database with same CATH topology
 3I3L A;  2VC0 A;  3PFY A;  2EFW A;  2DAO A;  5IY5 H;  1UG0 A;  4QPQ A;  2ZJP F;  3DCF A;  1CF7 A;  3ZRG A;  4B44 A;  1XSV A;  2FEZ A;  3TP3 A;  5ICE A;  2XPV A;  2LSO A;  2MBF A;  4E7K A;  1FMW A;  1D5V A;  1JKR C;  2E2I J;  5B1A H;  5D8K B;  2XSJ C;  3A0B C;  2VXD A;  1KQ0 A;  2D2W A;  1Y1V J;  4UV8 A;  2LP0 A;  3ABM H;  4ENM A;  4ZZL A;  4FET A;  2VKE A;  3KYC B;  4A6D A;  1WH5 A;  3LQQ A;  5J8F A;  5DUK A;  3S2D J;  1QHH D;  3GME A;  5DD4 A;  1DP3 A;  1ZRF A;  2HYG D;  2DU9 A;  1X1P A;  2K3P A;  1MH4 A;  5IYB J;  1ZN2 A;  4J01 A;  2KZG A;  2RAE A;  3BTL A;  3C2H A;  2QSG X;  1BN5 A;  4PK4 A;  3CDL A;  4O6J A;  1MND A;  1QVT A;  4CCM A;  3OYC A;  3OIQ A;  3FM3 A;  2R92 J;  1FY7 A;  2R7X A;  2FQ4 A;  3C2B A;  5D5U B;  3GO5 A;  2OQG A;  4RM2 A;  5CVR A;  1BJA A;  1ETQ A;  1TZL A;  3IC7 A;  1VQ6 I;  4IF4 A;  3RKX A;  2XKP A;  4DW6 A;  4ENN A;  3K7A J;  3GLL A;  3I53 A;  2OC6 A;  1R22 A;  3ZQF A;  3J81 Z;  3R6S A;  1MDM B;  1RRJ A;  1IUY A;  3TQN A;  3F8M A;  1R71 A;  3I59 A;  3P9K A;  3OR2 C;  4C3I J;  3BJA A;  3QAH A;  5JR3 A;  2FBK A;  3BG9 A;  2E5Z A;  5JHF A;  3K4L A;  5EEA A;  3DEU A;  4BXF A;  2GXA A;  1XMA A;  1JTX A;  2ZJQ F;  3HB9 A;  3NRV A;  4KN7 X;  5TJJ A;  3CUQ C;  2L5Q A;  5CKT A;  1E3O C;  2JA6 J;  2K7L A;  3H5R A;  5K1Y A;  5E79 C;  4HRI A;  4HV5 A;  2JA8 J;  3J80 K;  5ICF A;  5LHH A;  2M3A A;  4ZYH A;  1EV7 A;  1GVJ A;  2STT A;  2O61 A;  2XKO A;  4E7J A;  3BCA A;  2YUS A;  3CMM A;  2EIL H;  2WC2 A;  2MA3 A;  2L7Z A;  1XD7 A;  3CCM I;  1HKQ A;  3C7J A;  3H0D A;  3TW7 A;  2Y9Z A;  3ZN0 A;  1T6S A;  1GV2 A;  3FXU A;  1E0E A;  1QPM A;  2FA5 A;  3JRB A;  5E17 F;  3M8E A;  4EJU A;  1SD7 A;  1VQP I;  4BEH B;  3L2V A;  4CSW A;  3OL4 A;  3HOT A;  2M5W A;  4JX6 A;  4ESB A;  1REP C;  1GDT A;  1PYV A;  2XAJ A;  4E7H A;  1WJB A;  4KMF A;  1ZH5 A;  4D7M A;  1B8I A;  2ZKZ A;  2A69 F;  2ELK A;  2W82 A;  2F4M B;  2KJB A;  3AAF A;  2ZSI B;  1K4T A;  4IHT A;  3FKJ A;  3ZMD A;  1U3E M;  4LLL A;  1MW7 A;  4A5M A;  1BR2 A;  1DGW Y;  3MKW B;  3ABT A;  1IXS B;  5K7H A;  3GVA A;  2ZNZ A;  2O8K A;  3OOP A;  3ZR8 X;  2N8G A;  1DU0 A;  4LLN A;  3GTL J;  4IVN A;  1VQ7 I;  3CLQ A;  2ZXI A;  1MMA A;  1C0W A;  4GO1 A;  4CA0 A;  5KNL A;  2ESH A;  3GBG A;  4BXU A;  1OJL A;  4KUM A;  3VPR A;  2F2E A;  3BPV A;  3DLL F;  3AG2 H;  5HNF A;  3C18 A;  2R4G A;  5J1R A;  2JQ7 A;  4HF1 A;  2LK2 A;  2FU4 A;  4RA2 A;  2JZY A;  3S8P A;  4NHJ A;  4A3C J;  2L4A A;  2HOT A;  1XTA A;  4A69 C;  4DJA A;  1YW9 A;  2KMU A;  1D3Y A;  3FXO A;  3DKY A;  5HVQ C;  3TMO A;  3V7R A;  1YO5 C;  1PUF A;  3VSK A;  1YTY A;  1YRN B;  4ZYE A;  4B8X A;  3BR6 A;  4R1H A;  1EJ9 A;  1S3J A;  4HSR A;  1LPQ A;  3WTS C;  4Z2Y A;  4BE1 A;  3C1D A;  1TW3 A;  2R7R A;  3M1C A;  1ZLJ A;  1WQ2 A;  2E1O A;  3G4S I;  5FRN A;  4GFB A;  3P9C A;  3OYA A;  3E6C C;  2HI3 A;  1LFU P;  1ULY A;  3I4N J;  2EZL A;  1MSF C;  2LY1 A;  4HLY A;  2EPF A;  5F6F A;  4RAF A;  2E1C A;  2Y31 A;  1FYL A;  1SD4 A;  2A3S A;  3E5U A;  1S6L A;  1UCR A;  3KP6 A;  1H89 C;  1YS6 A;  2KQR A;  4DOZ A;  5IOY A;  1T2K A;  2ISY A;  1R4M B;  4IOC F;  1FBQ A;  2AQE A;  3ONQ A;  2HQN A;  3BTJ A;  2YSR A;  2E7W A;  3PNY A;  3S16 J;  3ZN1 A;  3IWF A;  2IT0 A;  3OY9 A;  1R9T J;  2VAS A;  5HNH A;  4DBR A;  2G7H A;  2P81 A;  3R60 A;  4QPO A;  2AS5 F;  3OYN A;  1SEU A;  4HEA 2;  4W97 A;  1APL C;  1LJ9 A;  1IXC A;  2FMY A;  1BM9 A;  2M1B A;  2X51 A;  4N9I A;  2EFO A;  5EZH A;  2E2J J;  4YRV A;  5HDN A;  2VC1 A;  4L0Y B;  2A6E F;  2DK8 A;  3FMR A;  5H6R A;  4XLN F;  5IT9 Z;  5E3M A;  1A5J A;  1U9O A;  5EG0 B;  2QA4 I;  4L9J A;  1KYW A;  1O3Q A;  2EIN H;  4N9H A;  2VE9 A;  3K2A A;  1XMK A;  2BGC A;  2V1N A;  3RDI A;  1L3L A;  3SHF A;  5FRO A;  3PQK A;  3T1B A;  3CME I;  1R4N B;  3DP7 A;  2CW7 A;  3FK7 A;  2JJ7 A;  3FMS A;  5BS6 A;  2FOW A;  1TL8 A;  5ICC A;  1KU7 A;  3PUF A;  3ZMU A;  1K4S A;  4BS9 A;  4A3I J;  2HZT A;  5J47 A;  4G8X A;  3VB2 A;  5KVR A;  3OV8 A;  5CVJ A;  1MBF A;  5F1R A;  2LC2 A;  3F72 A;  4E70 A;  1HKT A;  4XSZ F;  4XKC A;  1SD5 A;  1WPK A;  1IUF A;  2G0E A;  1T39 A;  4PFO A;  5FB2 A;  3TGN A;  1OCT C;  3Q5F A;  4JK1 X;  3QRF F;  5FLX Z;  4Y52 J;  5B66 C;  1O3R A;  2HQA A;  3FXK A;  2GA1 A;  4BHB A;  1DQU A;  3G1M A;  4FE7 A;  1ZAO A;  4CUG A;  2EQR A;  3OR1 C;  2GM4 A;  4A3F J;  1K78 B;  2F5D A;  3K1P A;  5TGT A;  1KA8 A;  2X48 A;  1HDD C;  1ZRC A;  4A0Y A;  1O3T A;  3RSN A;  5FKL A;  1P4A A;  1TW2 A;  2G7U A;  1T0F A;  4PGG A;  2KZV A;  4ENJ A;  5D5V B;  3EUH C;  5J8C A;  4RB1 A;  1K7A A;  2ETH A;  3DFG A;  1XSD A;  3LSG A;  4RB0 A;  5FGM A;  2XV4 S;  1JJ6 C;  4U88 A;  3T8T A;  3Q9V A;  2B7E A;  1POG A;  2BVL A;  2EA2 A;  2MW8 A;  3FBI B;  4LGW A;  2OD5 A;  5HLT A;  3HDD A;  1LNW A;  3LSK A;  2DA6 A;  2OV7 A;  1SVL A;  2M87 A;  5E3O A;  1YLF A;  3HL2 A;  2H94 A;  3A01 B;  3S1Q J;  1UG2 A;  4L0Z B;  3E5Q A;  3GTO J;  2LVS A;  1A31 A;  3J7Y J;  4EV0 A;  4MHG A;  4XL9 A;  3BLY A;  1Z9C A;  2I5U A;  1I6H J;  3GW2 A;  1KGS A;  2XUB A;  1DUX C;  1ACI A;  3MZH A;  2OU2 A;  1I27 A;  4OMZ A;  4R8H A;  4DYC A;  2HTS A;  1G2H A;  2QQ8 A;  3CC4 I;  1IN6 A;  5ICG A;  3I9V 2;  2W84 A;  4N4N B;  1V55 H;  1TWA J;  3K70 D;  3I4M J;  3IRQ A;  2AO9 A;  3PJR A;  4ENK A;  2XAH A;  2H1K A;  1RC9 A;  1N77 A;  5GP9 A;  1OCZ H;  3CUQ A;  5F27 A;  3GTK J;  2EZK A;  3DWL E;  4Y15 A;  2K9Q A;  2KIF A;  2DTZ A;  2O7O A;  5BPD A;  5C4J J;  4YIF A;  5GAE J;  1JUP A;  2VKH A;  1MBH A;  2KIS A;  2V1U A;  4DIQ A;  1VQ5 I;  3PM1 A;  4FE4 A;  2L3D A;  2A5W A;  1WFX A;  1R58 A;  3RYR A;  2X1E A;  2OTJ I;  2QCO A;  2H8W A;  3M7G A;  2XAU A;  4GXO A;  3CCU I;  3LNQ A;  5IPA A;  3ZQ7 A;  4UVB A;  1WI9 A;  2E19 A;  4IHY A;  4WK8 F;  5HLH A;  3E6D A;  2ZC2 A;  3K4M A;  2Q2E A;  4ZDP A;  1I5Z A;  4FT8 A;  2VKV A;  1Z05 A;  3OYF A;  1AWC A;  1QA6 A;  2YX4 A;  3WE3 A;  4KN4 X;  1T0F C;  3S1R J;  5IOZ A;  3OYK A;  2F5V A;  2L0K A;  2L9R A;  1BR4 A;  2KIQ A;  1S7O A;  3HOW J;  1ZRE A;  4MTD A;  5E20 A;  1OMI A;  1XSX A;  3HIF A;  4NC6 A;  1HSJ A;  3KP7 A;  3MZ8 A;  4CIC A;  2RNJ A;  3KP4 A;  4WF2 A;  3H9J A;  1X3W B;  2IPQ X;  2F5F A;  2Y48 A;  1XGS A;  3ZGK A;  2IA2 A;  1ETX A;  3IAM 2;  4RLF A;  4AVP A;  4F91 B;  1FTZ A;  1XPX A;  2QEN A;  1AU7 A;  2UWM A;  3A0H C;  2Y2Z A;  3ERM A;  2DQR A;  4L5J A;  3TL4 X;  2L9S A;  2KFD A;  1FJL A;  1RZ4 A;  4I0A A;  2HPM A;  2HFH A;  1B9M A;  4PJL A;  3S15 J;  1FPQ A;  2HS5 A;  4LG3 A;  4A3B J;  2DJI A;  4I01 A;  1FC3 A;  1TQI A;  5D8L B;  2LOO A;  2B9S A;  1MNM C;  2R93 J;  2M8G X;  3HKZ A;  1YIT I;  2XAQ A;  4L9T A;  4C3J J;  4XRF A;  4XOR A;  4NC7 A;  3QOD A;  2K4B A;  1DPU A;  1MD0 A;  2QM3 A;  2EV0 A;  5FD6 A;  2VBY A;  3DKW A;  1IF1 A;  1UAA A;  2DXI A;  3ZQQ A;  3Q0V A;  4PSX A;  1ZKG A;  4V19 K;  2RV8 A;  5FFZ A;  3E0J B;  4IXA A;  5ILV A;  1MMG A;  2L7M P;  3CO6 C;  1G4D A;  4WCG A;  4XOT A;  1ZGW A;  1ZTR A;  3H5N A;  3BOQ A;  3BQZ A;  1VQO I;  3H3V K;  2O0Y A;  3MZY A;  1I3A A;  2M34 A;  3EYY A;  3TW6 A;  1H0M A;  3WTY C;  5CJ9 A;  2H27 A;  1TT0 A;  2BY1 A;  3I59 B;  4EGZ A;  1WSU A;  3JRC A;  2HNH A;  3KE2 A;  3VYS B;  2K9S A;  2JRT A;  2KL4 A;  2HYF A;  4OIO F;  1VF9 A;  1XMX A;  2CU7 A;  4BXX J;  4AC0 A;  4A3M J;  3ZXS A;  2R7F A;  1YS7 A;  2VT2 A;  4LG0 B;  4L9N A;  3CCS I;  2VE8 A;  4BJT A;  4LIT A;  2R7U A;  5C44 J;  3HEF A;  3TKY A;  5BMZ A;  2LTP A;  1B72 A;  2B63 J;  1ZG3 A;  5DM7 F;  1PP8 F;  1B6A A;  1BJZ A;  3I55 I;  3LSP A;  3QYF A;  4UB6 C;  1QU3 A;  2HQR A;  1YOV B;  1E3H A;  1FLI A;  5L3B A;  5H6Q A;  2CUJ A;  3ASO H;  3Q3S A;  3I56 I;  4KIF A;  3I0T A;  3HRM A;  2WY8 Q;  3OOU A;  5LGN A;  1G3T A;  2IS2 A;  1QNT A;  3F6O A;  1QZE A;  2Z2S B;  2JWT A;  2QGU A;  2NS8 A;  5J4Y A;  1FYK A;  4AYB A;  4ZYG A;  2F48 A;  1XDU A;  1GUU A;  1U5T A;  3ZMZ A;  1BL0 A;  3M8F A;  2X4H A;  1FP2 A;  2EBI A;  2Y0S N;  4L5I A;  3JSP A;  2NVQ J;  1ZR2 A;  1FZP B;  3DBR B;  3MCZ A;  2KDO A;  5D5W B;  3HRS A;  4ZTF A;  3QPS A;  3CZ6 A;  1GLN A;  3B02 A;  1P6R A;  4A3E J;  4K2E A;  3WHB A;  1P2F A;  1MJ9 A;  3KYL A;  2GZW A;  3CC7 I;  1AKH A;  2XHK A;  3K4C A;  2XRN A;  4OAZ A;  3OYL A;  1ON2 A;  3H3U A;  2HPI A;  3BC8 A;  2DYR H;  3L2Q A;  5DUI A;  3BTC A;  3M07 A;  3HJE A;  4EM2 A;  2DA5 A;  4OIP F;  2BE5 F;  4X6A J;  1TQM A;  4LK0 F;  3JAM K;  3H9G A;  1Z6R A;  2NNY A;  2IS1 A;  1YG2 A;  5BOX A;  3KEQ A;  4HX4 A;  2R0Q C;  4BE2 A;  1ZQ3 P;  1KYZ A;  3T8R A;  3W2A A;  2PX9 A;  2PJR B;  3OS0 A;  1Z6T A;  4XN3 A;  4BY7 J;  1TP4 A;  5TRD A;  4ZDO A;  4P1W A;  3CJT B;  4XKB A;  5E18 F;  4BY1 J;  2BZT A;  2MD5 A;  3F0C A;  1UHS A;  1V3F A;  1E2X A;  5C3E J;  1WZ2 A;  1MGT A;  3E7L A;  1QQI A;  5LGT A;  4A3J J;  1J59 A;  2QBY A;  1FOX A;  1JJ8 C;  1BR1 A;  1G6N A;  3BG7 A;  4YEL A;  4WWC A;  4MFD A;  1XG1 A;  2PJR A;  3RPU D;  1IDY A;  3KP2 A;  3OYH A;  3RZD J;  2NRA C;  1BA5 A;  4HZF A;  3ECO A;  2QQA A;  5JHU A;  5B1B H;  3TED A;  1VTN C;  2WA0 A;  4QLC U;  1E17 A;  2HYJ A;  1TNS A;  3K4N A;  1ZG1 A;  1HQC A;  2DMT A;  4C3H J;  1YJN I;  3D0S A;  4BE0 A;  1J75 A;  1IN5 A;  4XQF A;  3DF8 A;  2VQG A;  2DK5 A;  3BR2 A;  4EJV A;  3IL2 A;  3WOD F;  5D6E A;  3HTS B;  1S8N A;  3KLO A;  1WJE A;  3GXO A;  3WHC A;  3CCE I;  3GTM J;  2K5C A;  4UNO A;  3WG9 A;  1G3S A;  1SFK A;  3HHG A;  1WHU A;  3BG3 A;  5FKN A;  3BR3 A;  3HRT A;  3WTU C;  4A3K J;  1RES A;  2P7V B;  2X9D A;  4IHV A;  2R7Z J;  5D6F A;  1P4W A;  3N97 A;  1IG7 A;  2BVM A;  4UXN A;  4F55 A;  3QP6 A;  4YII A;  5EGO B;  3A03 A;  5CVU A;  4HYE A;  1XGM A;  1YJ9 I;  4ZYD A;  1DPR A;  1HLV A;  1HKS A;  2XDV A;  4MIM A;  3I58 A;  2GOM A;  5HS9 A;  1ETK A;  2EV6 A;  2GOX B;  3WTZ A;  2QSF X;  2VIX A;  4LK1 F;  1NH3 A;  1I1S A;  3BR5 A;  3H1C A;  3KIO A;  1S7E A;  3OYG A;  4MEX F;  1KQ8 A;  5FO5 A;  5LBQ A;  3GX4 X;  4XLE A;  3V42 A;  2FRH A;  1I39 A;  4E7L A;  2YX7 A;  2FSW A;  4XID A;  3NQO A;  1OYW A;  1NK2 P;  5GTH C;  3RQI A;  4HAM A;  2CQK A;  2DTR A;  3HTU A;  1YX5 A;  4G94 A;  5AON A;  2L9N A;  1UJ8 A;  4ETS A;  4GCV A;  3DU6 A;  1BW6 A;  2H1L A;  1IW7 F;  2JA7 J;  4B09 A;  2MYS A;  4WXD A;  4XSX F;  2DDB A;  2CGP A;  3QYB A;  1IO2 A;  2DMU A;  2D1H A;  2IVM A;  1WGX A;  3S3M A;  3A1Y A;  2X6Y A;  4RDU A;  3NEU A;  1K78 A;  3HOX J;  1DGR M;  4BUP A;  3TOA A;  1IN8 A;  2K9N A;  4A3L J;  4PJ0 C;  2XB0 X;  2VQH A;  3TO6 A;  2DA3 A;  4BYY A;  3TBI A;  1FIA A;  2E35 A;  4HNU A;  3QP5 A;  5HOD A;  1FT9 A;  2V4J C;  1NG7 A;  3F21 A;  3WGG A;  3H5A A;  2GA2 A;  2JPC A;  4EM0 B;  4CZC A;  2YPR A;  3D1N I;  3BJ6 A;  3K4J A;  2HZD A;  1G3Y A;  4KNY A;  3OSG A;  5FFX A;  4DNC A;  4B4C A;  3H35 A;  3JRD A;  2DT5 A;  3GEZ A;  4E7S A;  1XCV A;  4HF2 A;  1J5Y A;  1AKH B;  2LFB A;  2Q0O A;  2E1N A;  2E7X A;  1U0J A;  1AA7 A;  3VYT B;  1X1D A;  2HOA A;  3VOD A;  2VPL A;  3E6M A;  4MNU A;  2IEK A;  3WU0 A;  2FD5 A;  1K61 A;  1X4O A;  2MFZ A;  2VKD A;  2W4S A;  3QU6 A;  5JLW A;  2VLA A;  1GXP A;  3WGI A;  1LKX A;  2FF4 A;  3CUO A;  3PNV A;  2RNG A;  3ERE D;  2K3F A;  1NK3 P;  5L3E A;  4PCQ A;  3RKW A;  4CYC A;  3HBL A;  1XC5 A;  2PQ8 A;  3ZMS A;  5A2Q K;  5E3L A;  1A36 A;  2HXI A;  2E1M C;  5E1W A;  1IXR C;  2O03 A;  4KDP A;  3MD2 A;  3IAS 2;  2ISZ A;  4GYG A;  2JVH A;  5D4S A;  5CQE A;  3G3Z A;  2XAS A;  3ASN H;  3K6G A;  5DTD A;  1OYI A;  1Y0N A;  2I10 A;  1ZEL A;  2TCT A;  2XAG A;  2RRE A;  1R49 A;  4BDY A;  1J9I A;  1LQ1 A;  2RKH A;  2ZB9 A;  4LB5 A;  1QZZ A;  4XN0 A;  2HGC A;  3E6B A;  3HG9 A;  2VJ5 A;  4BHP A;  4OU0 A;  4JX5 A;  1KQ9 A;  2X0L A;  3FX3 A;  5GAH J;  2XGD A;  4CZZ A;  5J1Y A;  4M9Z A;  3SEZ A;  3HOU J;  4BBS J;  1IGN A;  2OUM A;  5CPR B;  4CCN A;  2Z9O A;  2IGO A;  3DPT A;  1I50 J;  2RN7 A;  3OYJ A;  5FRM A;  1MBE A;  4FX0 A;  3O2P E;  2VJI A;  1SMY F;  1S5L C;  3H92 A;  4BDZ A;  3AG3 H;  3E1S A;  2W00 A;  5HLI A;  5AIP A;  1U2W A;  1T8I A;  1VQ8 I;  3L2U A;  1Z67 A;  1ZGJ A;  1ZG5 A;  1X4P A;  2V26 A;  1FP1 D;  4GDF A;  2VOP A;  1NG6 A;  5EF6 A;  3OIP A;  2LG4 A;  1LFP A;  4AYB N;  4P55 A;  3LSM A;  3ZOB A;  3DPL C;  3VEP A;  4RGX A;  3PO2 J;  5L3D A;  5LD2 C;  3S2W A;  4BKX A;  2F6C A;  1SD6 A;  3OIO A;  3DTI A;  2M8E A;  2UUZ A;  3EPZ A;  2GQQ A;  2A61 A;  2O9L A;  3S93 A;  3Q0U A;  1U78 A;  3S14 J;  1W0T A;  1MZB A;  1JE8 A;  3IUO A;  3EDP A;  4C2U A;  1LDJ A;  2IA0 A;  3CP8 A;  3GZ5 A;  5BQT A;  1JI8 A;  1EKE A;  3LFK A;  4HNT A;  1ONV A;  4Y17 A;  5EYR A;  4S0H B;  4UUT A;  1Q1V A;  4AID A;  4XLC A;  2GAU A;  1R1T A;  3BDD A;  1D1C A;  3S17 J;  4IRH A;  4CO8 A;  1R00 A;  3PUB A;  1N75 A;  2HKO A;  2ZME A;  3L9F A;  3QYE A;  4R79 A;  2GLO A;  2ACJ A;  4PDK A;  4BU2 A;  1T33 A;  3RCO A;  1IDZ A;  4ZYA A;  4IZZ A;  1EA3 A;  2LH9 A;  1W7P A;  3SQN A;  4XNF A;  2DT7 B;  2PJP A;  1B59 A;  4WXH A;  4M6V A;  3FXQ A;  3FZV A;  3MFK A;  3PO3 J;  2IS6 A;  1A6I A;  4V2G A;  5KHD A;  3WU1 B;  2Y0M A;  2LY9 A;  3VYR B;  4A93 J;  2DPD A;  2Y75 A;  1V4R A;  3E97 A;  2PMU A;  5DYM A;  2M7A A;  2L7F P;  4CCL A;  2NYX A;  4AU7 A;  1ZR4 A;  4RB2 C;  1TNT A;  4H4K C;  3IV5 A;  3RYP A;  4DGW B;  3HKZ N;  3S1M J;  4Q5S F;  4G6T B;  1W0U A;  4A3G J;  2RQP A;  4II2 A;  3GTQ J;  2X85 A;  2B0L A;  5DS9 A;  3ZQC A;  3BRO A;  3CD6 I;  3VSL A;  1GXQ A;  5BNG A;  1TWC J;  4UB8 C;  5HS8 A;  2H8R A;  2X1C A;  1Z91 A;  5E8G A;  1U5T C;  5LHI A;  4F92 B;  2VXZ A;  2ZFW A;  4J19 A;  4E7Z A;  2DFE A;  2L01 A;  4AIJ A;  2M0C A;  1H88 C;  1IV8 A;  1OCC H;  1OCO H;  1QO0 D;  1IV6 A;  2JK3 A;  3DQV C;  2A05 A;  1JHF A;  3GZ6 A;  4IJA A;  4YFK F;  2A68 F;  2OZU A;  4BQN A;  5M5Y J;  2YR2 A;  4LB6 B;  3S2H J;  4M3F A;  2PEX A;  3BQY A;  2E36 A;  3K69 A;  1EH7 A;  1Y56 A;  1NTC A;  4LMY A;  1O57 A;  3ZCO A;  5CLS A;  2VJ4 A;  3M4O J;  4IX7 A;  4CDG A;  4EAT A;  3CCR I;  2DJN A;  1FTT A;  1FOW A;  2QF7 A;  3KET A;  1IRX A;  4I09 A;  4KT5 C;  4HDV A;  4RS8 A;  2CO5 A;  3TP0 A;  2XAF A;  3HUG A;  1ZK8 A;  2VON A;  3X2Q H;  4CCJ A;  1X1B A;  3LSR A;  3P9I A;  3H36 A;  2BXY A;  2W1O A;  4XRS G;  3WTT C;  2IGM A;  3F8C A;  3LAJ A;  3CTA A;  3RI4 A;  4MO7 A;  3EYI A;  4HBL A;  4Q4Z F;  4X1E A;  2R5Y B;  3WTX C;  3QOE A;  1QZY A;  1A35 A;  2Z3Y A;  2XRO A;  4OAY A;  2FBH A;  2NVY J;  1E3P A;  3IP4 B;  1J09 A;  2KHM A;  4FX4 A;  2O5R A;  4CYC B;  2E34 A;  2HTJ A;  2VBW A;  3W2W A;  1H8A C;  1RET A;  3HOS A;  1Z3Y A;  1F1Z A;  1X2N A;  4M3E A;  2JSP A;  2LKS A;  1IAW A;  4RAZ A;  3MEX A;  1MBJ A;  2NVU B;  4QIW N;  2K85 A;  2PMZ N;  2QLZ A;  3AG4 H;  3FBN B;  3Q0W A;  3D5S C;  1UHW A;  2P6T A;  4FCY A;  4EVI A;  2QUF A;  5E1X A;  4ZTJ A;  4JYK A;  1MJA A;  2HR3 A;  4XLP F;  1DDN A;  2STW A;  3H3Z A;  3ZMV A;  3LOC A;  5HS7 A;  2DPU A;  2QSH X;  5FJ8 J;  4D1Q A;  4IHW A;  4HNV A;  1Y6I A;  2DO7 A;  2LR8 A;  1XX5 A;  5JVT A;  1HW1 A;  4G7O F;  1J2X A;  5KAI C;  2HQ5 A;  1OQY A;  3G2B A;  4GRI A;  2HU9 A;  1FYM A;  1W4M A;  1Y8Q B;  2J5O A;  3A4C A;  1SFU A;  1XN7 A;  1RIO H;  2BBY A;  5M3M J;  1DU6 A;  4HG2 A;  1YW7 A;  1N25 A;  4W1U A;  3W6V A;  4BL0 B;  2GBY A;  1V54 H;  3QPL A;  3RKQ A;  3J7Z I;  2NVX J;  2ZSH B;  3EUA A;  2XF6 A;  4QSH A;  3GCM A;  4C2T A;  1SVO A;  3TO9 A;  2MC4 A;  3U1K A;  3J81 K;  4DBQ A;  1ODD A;  2ZJ2 A;  3ABL H;  3F9K A;  3FF5 A;  1BI3 A;  1OLT A;  5IT9 K;  3FM5 A;  2WAD A;  2KKO A;  4B43 A;  1HA8 A;  2X6O A;  5LFA A;  2JN6 A;  4IRG A;  3JW4 A;  4BGD A;  4KT6 A;  2MH9 A;  2VQL A;  3ZMT A;  1HC8 A;  2P4W A;  1LUJ B;  2RGV A;  2CSO A;  3T5X A;  4O3M A;  3O3K A;  4G6D A;  2DFH A;  2BW3 B;  2DFI A;  3CCL I;  3OYI A;  3V7C A;  4B3A A;  3MN2 A;  4IRI A;  5HDK A;  3HC7 A;  2HOS A;  3LL7 A;  3K0L A;  1ZYR F;  2R7Q A;  3HZJ A;  1OCP A;  1U9N A;  4L9V A;  4EJT A;  4BAY A;  2GWR A;  3W6J B;  5IYD J;  1K83 J;  2QQB A;  5F64 A;  3E3V A;  1R1U A;  1QVU A;  4CHU A;  3SXY A;  5LHG A;  1UMQ A;  1IRF A;  2MAB A;  3JCU C;  1K6Y A;  2ECB A;  4ZH4 F;  2M2E A;  3ECH A;  1W36 C;  3HSF A;  1Z1D A;  2LKP A;  1CQT A;  2ME6 A;  3SFI A;  4M72 A;  2LDU A;  4NDL A;  1RKT A;  3BCB A;  3QU3 A;  4HLX A;  1WJC A;  4NBQ A;  2DOE A;  3SDB A;  5HOO A;  1BW5 A;  3F3X A;  4HOB A;  4ZJZ A;  2FXA A;  2UV1 A;  2Y9Y A;  3EUH A;  3KX2 A;  1YQA A;  3PQJ A;  2BY2 A;  2EIJ H;  4EM1 A;  1ON1 A;  1VZ0 A;  2FNP A;  3PIP F;  5FKO A;  3EQL F;  4FAS D;  1LDK B;  1XGN A;  1FOY A;  2P5V A;  2KIU A;  2P5K A;  3A01 A;  4F7Z A;  2IS4 A;  2UXN A;  2FUG 2;  1UEL B;  3V4G A;  4U7B A;  2LRE A;  4UVA A;  2OPT A;  1YW8 A;  2PN6 A;  1JTY A;  3C2G A;  2MSY A;  1S7A A;  3LSJ A;  4KYW A;  4ESJ A;  5IP9 J;  4BJ5 C;  5J6X A;  3ELK A;  5HLG A;  1KU9 A;  3PL8 A;  3IKV A;  2M7B A;  2WB1 A;  2CV1 A;  1VQK I;  4IEJ A;  1K6O A;  3OYM A;  2K02 A;  1X1C A;  1BIA A;  2CQX A;  1WJA A;  2E2H J;  1YIJ I;  2MD0 A;  1HW5 A;  1GVD A;  4I02 A;  1X19 A;  5LEK A;  3GFI A;  4LLG F;  2L02 A;  3N05 A;  2M9H A;  3IH2 A;  3LAP A;  4ZDL A;  3CDI A;  3F6V A;  2KLO A;  1P4X A;  4M3G A;  4AIH A;  5CVI A;  3CJQ B;  3K4B A;  4ABZ A;  3CF2 A;  1MJB A;  1BI0 A;  1KON A;  1IRG A;  4YIR X;  4M9S A;  2P6S A;  3HOZ J;  1TT5 B;  1VFC A;  2DYS H;  2XIG A;  1S9H A;  4CYD A;  5EDN A;  1WCM J;  4I7H A;  3BG5 A;  2NVT J;  2VB6 A;  4HX7 A;  4TV7 A;  2R7W A;  4YFN F;  1ZRD A;  4KFC A;  1W5C C;  2H6C A;  1F36 A;  4DZP A;  3OYB A;  2XF5 A;  1HST A;  2V1X A;  2ZXJ A;  4AIK A;  5D4R A;  4HA8 A;  3WTV C;  2DMQ A;  3K2Z A;  1RI7 A;  2EZH A;  1MMN A;  2XPW A;  1F9N A;  3HOY J;  2QKL B;  1LB2 A;  5EJC A;  3CDH A;  2JUG A;  4CCK A;  3T0Y A;  1V5F A;  3N4M A;  3GTP J;  5F04 A;  4YEJ A;  4O5V A;  4KIS A;  3BTI A;  3QWL A;  3L1P A;  4OOI A;  4P9U A;  1G8X A;  3FXM A;  1VQ9 I;  3OYE A;  5M5X J;  4BNC A;  4JX4 A;  1W1W E;  2V1D A;  2FJ1 A;  2ZBK A;  2Z99 A;  1Z21 A;  1WWX A;  1P7J A;  2QZ8 A;  2UXX A;  4NB5 A;  4C30 A;  4EMS A;  2R5Z A;  1D8K A;  2ME0 A;  3O8G A;  5GPC A;  2UZK A;  4ITV A;  2CRG A;  1RUO A;  5E8I A;  4PUS A;  3VYU B;  2CUF A;  4YG2 F;  3DTK A;  2OJE D;  5EG0 A;  4OIQ F;  1TC3 C;  2AQF A;  2EV5 A;  4AD9 A;  3WTW C;  1H9T A;  5J4V A;  2A07 F;  1QPI A;  1VI0 A;  2DMP A;  2VL8 A;  1U5T B;  3UNG C;  5A2Q Z;  1PUE E;  2Z33 A;  4IHS A;  4D7N A;  4QTR A;  2JT1 A;  3AG1 H;  3AFH A;  4RAG A;  1I6X A;  2HVR A;  4LD5 A;  3VWB A;  2OZ6 A;  2H6B A;  2XSD C;  2HDW A;  4A0Z A;  5IYC J;  2GXB A;  3CLO A;  4AWX B;  2WBM A;  3G1O A;  1ZAR A;  4V2F A;  3R61 A;  4BEH A;  1JGG A;  5L3F A;  2OQR A;  2ZXW H;  3HM5 A;  2DOA A;  2KP6 A;  3KLN A;  4LFU A;  1RNL A;  1OR7 A;  4XLA A;  1JGS A;  2Z5U A;  1XB4 A;  1G59 A;  4XRS A;  4RMN A;  3G6E I;  1D8J A;  1UZC A;  5FKM A;  2P5L C;  1ZLK A;  3PSI A;  5J3L A;  3HRU A;  3H9Q A;  2MGQ A;  3ZQI A;  3JRH A;  5M3F J;  1MSE C;  2AHQ A;  2WV0 A;  5K5Q A;  1FBS A;  1T38 A;  3ZQL A;  1JKO C;  2OBP A;  4PJN A;  2Y30 A;  4F93 B;  2DA4 A;  3HPH A;  2DA7 A;  2BHY A;  3MMY B;  5K7Z A;  1P92 A;  1AHD P;  1TBX A;  2BXZ A;  3B6A A;  2EK5 A;  4OIR F;  3V8L A;  1QBJ A;  1FSE A;  2Z1D A;  1TTY A;  2BW3 A;  3CMY A;  2ID3 A;  4ANJ A;  2ELJ A;  2F5E A;  3MKY B;  2DA2 A;  4LIV A;  2FOK A;  2HKX A;  1P9Q C;  5DCF A;  1R1V A;  2QBY B;  1LFB A;  5JVG F;  1FOK A;  4N0B A;  4U0V A;  3HOV J;  3KP3 A;  4U87 A;  4NQW B;  5GPA A;  4CCO A;  1AOY A;  3S32 A;  2JVG A;  4Y7N J;  2IGK A;  2K9L A;  1YJW I;  2HVS A;  3FXJ A;  1JT6 A;  5ERI A;  2GIZ A;  1W5S A;  2LMD A;  1RR8 C;  2Q2E B;  3E5X A;  5HDG A;  3TO7 A;  3ULQ B;  1WVR A;  1MH3 A;  1WI3 A;  3EUK L;  1X58 A;  2EFN A;  5FD5 A;  5DEQ A;  2ZCW A;  4B48 A;  5DM6 F;  2JRM A;  1OFC X;  4HQE A;  3F8B A;  4M6X A;  2DDA A;  1JUS A;  2KJC A;  2V6C A;  3CJN A;  1H9G A;  3KCC A;  3DKX A;  1B8I B;  1U8B A;  3GYH X;  4M71 A;  3HSR A;  3I5U A;  4M6Y A;  4D0P A;  3U1D A;  1FBU A;  3BZ6 A;  3VOE A;  1YYV A;  4EQQ A;  2VI6 A;  4XK4 A;  4BQA A;  1I3Q J;  3A02 A;  1MBK A;  5E1Z B;  3F8F A;  3PNT A;  2NS7 A;  2QQ9 A;  4F3Q A;  5EGO A;  1PDN C;  1LE8 A;  3J7A Y;  2G9W A;  1FWZ A;  4RGS A;  4U0W A;  3CO7 C;  4FHT A;  3QPH A;  1MMD A;  1WKM A;  5DCM B;  3BP8 A;  4ON0 A;  5DV5 A;  3F23 A;  2IAI A;  2TDX A;  2JSC A;  1JKQ C;  2VN2 A;  2IP2 A;  3M8J A;  1JXS A;  2P8T A;  4XR6 A;  2KIM A;  2P7C B;  4BJ6 C;  4DQ2 A;  3AKZ A;  1MNE A;  4IPA A;  3AL0 C;  2X6X A;  4G7Z F;  5LRR A;  2OAZ A;  3REO A;  3UKG A;  1T95 A;  2OA4 A;  4HQM A;  4IQ4 A;  2O6G E;  2XPU A;  2IGN A;  2W48 A;  2TRT A;  2CW0 F;  4XIC A;  1ETW A;  4RAY A;  4KJZ A;  4ASN A;  3KZZ A;  4CH7 A;  2OCC H;  2LBF B;  1TLH B;  2VQC A;  2FE3 A;  2M0M A;  3IH4 A;  2CG4 A;  3B6C A;  4XLH A;  3LSI A;  4LOC A;  4PJM A;  1HF0 A;  3ZQG A;  3BWG A;  4AUX A;  2R7S A;  2L54 A;  1Z7U A;  1HW2 A;  4I99 C;  1IN4 A;  2IA1 A;  1V5G A;  4JQF A;  5E3N A;  1HOM A;  2IRF G;  4MLO A;  2NOG A;  1USS A;  2HEO A;  3RPQ A;  1BC8 C;  3W2V A;  2MC3 A;  3LA2 A;  3BG6 A;  3ML6 A;  3OL3 A;  3BPX A;  1Z77 A;  5FLX K;  2V9K A;  4M3D A;  4QWQ A;  2YU3 A;  1R5G A;  2D5V A;  3JRG A;  1W7P B;  1UB9 A;  2I8D A;  4B3X A;  3CCQ I;  1T08 B;  5D5X B;  5B5E C;  5F08 A;  5H20 A;  1IN7 A;  3IKT A;  5C4X J;  1TWF J;  2DFF A;  2WV1 A;  4HW0 A;  4A2U A;  1Y8R B;  2LNB A;  1VQ4 I;  3LA3 A;  2LYC A;  1YIO A;  4Y4R A;  3BJO A;  5DD8 A;  2RQQ A;  4M9X A;  2LRD A;  2W25 A;  3GWZ A;  1WJ5 A;  3BR1 A;  2RVC A;  5F0C A;  4C9Y A;  3GUD A;  2M4K A;  4G9Y A;  5KCM A;  3TDZ C;  2VBX A;  3C3W A;  5IT3 A;  3CQZ J;  3O8H A;  5LEJ A;  2K86 A;  1RR7 A;  2JTV A;  3FHZ A;  1SFO J;  2EIM H;  1XGO A;  1PP7 U;  3K9T A;  4RLQ A;  1HBX G;  2R7D A;  3R4K A;  2VOO A;  3A2K A;  1BOB A;  3RKY A;  4E6K G;  3WE2 A;  3FDY A;  2CV2 A;  2WB1 N;  2R5Z B;  1SAU A;  2K40 A;  3KPH A;  3H0G J;  1FNN A;  2HOE A;  4I98 B;  4XBF A;  1ETV A;  3IWZ A;  3RQ4 A;  2QKM B;  2F4I A;  4LJZ F;  4D5C A;  2F5C A;  1R7J A;  2E1M B;  2FML A;  3L7W A;  1B72 B;  2F4O B;  4D5F A;  3M9A A;  1WJF A;  1B9N A;  2VPR A;  2K4J A;  3DBL B;  1ETY A;  4RGR A;  4NQW A;  4B1R A;  3SZT A;  4UHT A;  2PG4 A;  3DV8 A;  4P9F A;  1TWH J;  5GAG J;  3KZI C;  4PFP A;  4S04 A;  3CUQ B;  2A6H F;  3EET A;  3GZN B;  3HYI A;  3S1N J;  1MIJ A;  5F0F A;  1K79 A;  2KRF A;  3GLX A;  2CFO A;  4M3B A;  3FIW A;  1N78 A;  1X1A A;  2EB7 A;  2JMW A;  5BPI A;  5L3G A;  1Y0U A;  6PAX A;  2JA2 A;  2KPM A;  3VDX A;  1NHA A;  4FTH A;  4E7I A;  2ADU A;  2CS3 A;  2WAE A;  3RZO J;  2KRH A;  2L7K A;  3U9G A;  5ED4 A;  1EF4 A;  1J0R A;  1O3S A;  4KIT B;  3ZP5 A;  5JI6 A;  4U0Y A;  2V9V A;  3KZY A;  1T98 A;  1R5H A;  1WJD A;  3O6B B;  1FIP A;  2IJL A;  1MMS A;  2PBI A;  4JOM A;  3RPU A;  2HWV A;  3B73 A;  2OF7 A;  3I54 A;  3DPU A;  1W5T A;  2R5Y A;  2ECC A;  1IC8 A;  2EFQ A;  2EZI A;  2HVQ A;  3D5R C;  2BV6 A;  3LA7 A;  3NAU A;  1RPW A;  1U8R A;  1SVM A;  3K1N A;  4PZJ A;  4DYQ A;  1GV5 A;  3HSE A;  3LSH A;  5FKK A;  2ZXH A;  4G7H F;  3HGY A;  4CGZ A;  2XVC A;  3IHU A;  1RKW A;  1OCR H;  5L3C A;  4OIN F;  1GHC A;  3DEW A;  4G12 A;  2WAQ N;  4Q48 A;  1HXD A;  3SJM A;  2CUZ A;  2L4M A;  2V6E A;  3CP2 A;  3FK6 A;  1CF7 B;  3GFL A;  3ZQH A;  2CJJ A;  2LBF A;  2ZNY A;  3ESW B;  4H0E A;  1EH8 A;  4UY8 I;  4A5N A;  3NWT A;  1FMV A;  2BHZ A;  4JP0 A;  2XRL A;  1QHG A;  3JRA A;  5JLX A;  1D1B A;  4A3D J;  4YFX F;  4L5E A;  3W3C A;  5DDG A;  5EEG A;  3GTG J;  3ZPL A;  1LEB A;  3MKL A;  1HDP A;  1BIB A;  4FQG A;  1GT0 C;  4MTE A;  2JA5 J;  5J1U A;  1ENH A;  2ELH A;  3V8K A;  1L0O C;  3I4P A;  1ETO A;  2EJR A;  3M1E A;  1MBG A;  1LE8 B;  2XB5 A;  4KMU X;  1STZ A;  2VT3 A;  3SFZ A;  1LDD A;  5F0H A;  5DCM A;  3JTG A;  5FLV A;  4AM3 A;  2CQQ A;  4D9J A;  2QVO A;  2KDZ A;  3LMM A;  2Y0S A;  2GXG A;  4A6E A;  4X0G A;  1XS9 A;  2CQN A;  3RJP A;  5AIQ A;  4XKW A;  2LY2 A;  3G1L A;  3K4K A;  2NS0 A;  4Y3O A;  2PLY A;  3DXJ F;  2Y69 H;  4M73 A;  3DU5 A;  3BZC A;  3JRE A;  3FXL A;  1G3W A;  3HGG A;  4GGG A;  4UV9 A;  2W24 A;  3S3N A;  1X3Z B;  3MVP A;  2CH0 A;  2XF7 A;  1WH7 A;  3IH3 A;  3MAJ A;  4MFE A;  4WX9 A;  4NUB A;  2RDP A;  2VOD A;  3L00 A;  4RM3 A;  3DEE A;  3MQ0 A;  3FHN A;  2MLK A;  2ZFU A;  1Z3X A;  1D0Y A;  4XKV A;  2LKX A;  2KT0 A;  4IL6 C;  3FXR A;  1D0Z A;  2A5Y B;  3PFI A;  1TQP A;  3V7S A;  1SMT A;  1P7I A;  2Q8K A;  1YE9 A;  4IQJ A;  1V5E A;  3BY6 A;  2VUM J;  2V9P A;  3KFW X;  4EJW A;  1Q1H A;  1VQM I;  2OCE A;  4Z6Y A;  3G73 A;  3WU2 C;  2AXT C;  3WG7 H;  3HUG B;  1JT0 A;  1UHM A;  1VQL I;  3ABK H;  3TOB A;  1OKR A;  3L2R A;  2QYO A;  2VBZ A;  4DZJ A;  2YU9 J;  1PJR A;  1TWG J;  2H09 A;  3OS2 A;  1RUN A;  3MWM A;  3OMY A;  3W6K B;  3K70 C;  2DLL A;  3LWF A;  1FEX A;  5M5W J;  5CQG A;  3SDG A;  2M30 A;  3CCJ I;  1FSH A;  1R36 A;  2DQL A;  3WGH A;  1WRJ A;  4KIG A;  4I2O A;  1QGP A;  2W7N A;  2CWE A;  3VFZ A;  3KEO A;  3OWT A;  1B4A A;  4AVZ A;  4BHC A;  4UUS B;  2O3F A;  3IRR A;  3OS1 A;  4PSW A;  4XMY A;  2NOJ B;  2M4G A;  3U2R A;  4A0X A;  3JRF A;  4M74 A;  2IBD A;  3KYD B;  5TIS C;  2FX0 A;  4OWR B;  5ILS A;  4I76 A;  4A12 A;  5KAF C;  3DTE A;  4XON A;  4BQQ A;  2D1V A;  2ID6 A;  4S05 A;  3LST A;  1BC7 C;  4UUS A;  1ERD A;  4UUV A;  2CFX A;  2XC7 A;  1S72 I;  3QQA A;  2OTL I;  2LF7 A;  2RC4 A;  4JBA A;  2P0W A;  3UR3 C;  2BOL A;  1PUF B;  2J5P A;  1OYY A;  1Y39 A;  2EH3 A;  3BT9 A;  1R6R A;  3FMQ A;  4KA4 A;  2CW8 A;  3K10 A;  4BAC A;  1YI2 I;  3G71 I;  3NWS A;  1D0X A;  4XOP A;  2DN0 A;  2DBB A;  1YX3 A;  3M3Y J;  1CGP A;  4UVC A;  4IHX A;  2LF8 A;  3CCY A;  3NAR A;  4BH9 A;  3RIR A;  1DP7 P;  2XGE A;  4ESF A;  5LGU A;  2ESN A;  4Q47 A;  2X6W A;  4BQO A;  2EA4 A;  2O8X A;  1VND A;  1IZ1 A;  4E4H A;  5ILU A;  3SZP A;  3SYT A;  2BY3 A;  2FBI A;  2DT6 A;  5GTI C;  1JKP C;  2DW4 A;  1T56 A;  2W85 A;  5LRS A;  1X3U A;  3JTH A;  1OPC A;  4NNJ A;  2V79 A;  3CJR B;  2D45 A;  1R5I D;  1Z7L A;  5KK1 A;  3CCV I;  5CYV A;  4XLF A;  3GFJ A;  5IP6 A;  3Q9S A;  2E60 A;  4HX8 A;  4KIC A;  3P5J A;  3FWE A;  4NC8 A;  2MG4 A;  3HXL A;  3OSF A;  3COA C;  3D5L A;  3HHH A;  4MQV A;  3BR0 A;  5K5O A;  1ORK A;  1R23 A;  4HST A;  5FLM J;  1BI1 A;  2ZME C;  5K5R A;  1F43 A;  2CMP A;  5J40 A;  2CUE A;  1SFX A;  4BBR J;  4CXF A;  2BY0 A;  2A6T A;  2WY7 Q;  3DBH B;  4HPQ A;  1LEA A;  3CF5 F;  4IO9 F;  1ITY A;  3JAM Z;  5IP7 J;  2BYV E;  3ROU A;  3AL0 B;  4I6Z A;  4LIU A;  4RGU A;  1W36 D;  2HDD A;  2COB A;  1F4K A;  3ABU A;  2VJJ A;  5EEH A;  4IOA F;  3CMA I;  4MGR A;  3JRI A;  2W57 A;  4IKF A;  4L18 B;  5H2F C;  3R0J A;  2DOD A;  1J7K A;  4HDU A;  4I0B A;  3FIS A;  3QOP A;  3JSO A;  3JR9 A;  1YHQ I;  1XDS A;  2DA1 A;  3V8J A;  3FKI J;  2L9V A;  2BEO A;  3BZK A;  2K9M A;  5F1J A;  3L2C A;  1JHH A;  2K27 A;  2DCE A;  2PMH A;  2QEX I;  3RTR A;  2YS9 A;  1PVE A;  4EEF G;  2EFP A;  2ICW G;  1O7F A;  1I1G A;  1BBY A;  1VQN I;  3J80 Z;  4LG0 A;  1XCB A;  2ZME B;  1B1B A;  2IW5 A;  1HCR A;  3LFU A;  4Y13 A;  2HXO A;  3PSF A;  1SFE A;  2R7O A;  2WTE A;  4ZC3 A;  1FX7 A;  1ZGA A;  4Y33 A;  1D5Y A;  3PIO F;  1MDM A;  1UST A;  1W7P D;  5B3S H;  4MEY F;  4PJJ A;  3F22 A;  1BOA A;  3U21 A;  3S3O A;  1U6G A;  2DOF A;  2R7T A;  2CYY A;  2JUC A;  4HF0 A;  5JFR A;  5EZG A;  2DI3 A;  4P5O A;  1SAN A;  2LLK A;  1D1A A;  2EIK H;  5LLQ A;  3L09 A;  4FIS A;  3CC2 I;  2X1D A;  2PMZ A;  4XRM A;  4HV6 A;  9ANT A;  4EGY A;  3J7A O;  4GYI A;  2GIV A;  2LD5 A;  3GTJ J;  4MQ9 F;  1S29 A;  3P7N A;  5GAD J;  2IXS A;  2C6Y A;  2XGC A;  3KP5 A;  1BI2 A;  1EH6 A;  2WWY A;  2HDC A;  2DMN A;  2KRC A;  2XGX A;  1SAX A;  2M45 A;  4ZZD A;  3MKZ A;  1LVK A;  1YRN A;  2EWN A;  1M1E B;  2COM A;  1F5T A;  1KU2 A;  1X2M A;  2CQ7 A;  4P96 A;  1OIS A;  4G6Q A;  1Y1W J;  1UFM A;  2NAZ A;  1OR7 C;  1SC7 A;  2JPB A;  4KIB A;  2PI0 A;  3F8N A;  5CVV A;  1IRZ A;  1QRY A;  3LQR A;  4C2M J;  1JUM A;  2AXL A;  2ZJR F;  4J00 A;  3GFM A;  5K7F A;  2MH2 A;  4OMY A;  3R0A A;  1MKM A;  3TDU C;  2CV0 A;  3DLA A;  3KEY A;  2E5N A;  3HPG A;  2Q1Z B;  3ISP A;  4B47 A;  4RBO A;  2R7V A;  4EJO A;  1IJW C;  2QWW A;  1KU3 A;  3SEQ A;  3SZG A;  1A6Q A;  4RB3 C;  1O7L A;  1A04 A;  3GF2 A;  4WXC A;  2WAQ A;  1YFH A;  3I71 A;  4U7D A;  4N4O B;  4F52 A;  2E71 A;  2ZO4 A;  4PGH A;  2NNN A;  3K1M A;  2V7F A;  2WAF A;  1O4X A;  4II3 A;  1LVA A;  3QPT A;  1ZHF A;  1Z0X A;  4XM3 A;  2Z16 A;  1KZH A;  3CES A;  2FNA A;  2FQ3 A;  2L2O A;  2MLG A;  3OYD A;  2R3S A;  3I64 A;  3L2W A;  2NXN B;  4DYR A;  2PFB A; 
#chains in the Genus database with same CATH homology
 2E36 A;  3CC2 I;  5GAH J;  3G4S I;  1YIT I;  4IOA F;  3DLL F;  2ZJP F;  3CCJ I;  1VQN I;  3CMA I;  1MMS A;  1VQ4 I;  3I56 I;  3CME I;  2JQ7 A;  1YJW I;  1QA6 A;  2FOW A;  2ZJR F;  1S72 I;  3CCM I;  2OTL I;  1YJN I;  5GAD J;  3CCS I;  3CC7 I;  1HC8 A;  3CCR I;  2OTJ I;  3CJT B;  3PIO F;  3J7Z I;  2E35 A;  5GAE J;  2ZJQ F;  1FOW A;  3PIP F;  4V19 K;  1YHQ I;  1VQK I;  3J7Y J;  1FOX A;  4IOC F;  4UY8 I;  1VQM I;  1VQ5 I;  3G6E I;  1FOY A;  3CF5 F;  2K3F A;  4IO9 F;  1YJ9 I;  1Y39 A;  1ACI A;  1VQ6 I;  2E34 A;  1VQ9 I;  3CCL I;  1VQO I;  5DM7 F;  5DM6 F;  1VQP I;  3CCV I;  5GAG J;  2QA4 I;  1YIJ I;  1VQ8 I;  1YI2 I;  1VQL I;  1VQ7 I;  3CD6 I;  2H8W A;  3I55 I;  3CCE I;  3G71 I;  5JVG F;  3CCQ I;  3CCU I;  2NXN B;  2QEX I;  3CC4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...