1YIJI

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yijI00
3CCLI 3G6EI 3G71I 5GAHJ 2H8WA 1VQ6I 1VQMI 5GADJ 1HC8A 3CCEI 4IOAF 5JVGF 1QA6A 1YI2I 1FOXA 1VQPI 5GAEJ 1VQ9I 3J7YJ 3CJTB 5GAGJ 3PIOF 3CCMI 3CCJI 2QEXI 3CCUI 3CC2I 2K3FA 1S72I 2ZJPF 3CMEI 1YJNI 1VQ5I 2E34A 2FOWA 3CCRI 2QA4I 3CC7I 3CF5F 1VQOI 1YHQI 3G4SI 3PIPF 3CD6I 1VQ7I 5DM6F 2JQ7A 2OTLI 1FOYA 2ZJRF 3CCQI 1ACIA 4UY8I 1VQLI 3J7ZI 5DM7F 4V19K 3CCVI 1YJWI 1VQNI 2OTJI 3CC4I 1FOWA 1Y39A 1MMSA 1YIJI 1YJ9I 1VQ4I 2E36A 4IOCF 3I55I 1YITI 2NXNB 1VQKI 3CMAI 3I56I 1VQ8I 3DLLF 4IO9F 2E35A 2ZJQF 3CCSI
chains in the Genus database with same CATH superfamily
2JTVA 2J5PA 3G1MA 2CQXA 5DTDA 1V5EA 4A3CJ 3R0JA 5AIQA 4RAYA 1OYIA 2FA5A 3ZMSA 5D5WB 3K4LA 2P5LC 1X3ZB 1XS9A 1H0MA 1WCMJ 3RPUA 3P5JA 1CGPA 2BXZA 2L7MP 3LFUA 3ZMZA 1T38A 1D8JA 3LSKA 1T6SA 1Z1DA 2NAZA 4QWQA 3QU6A 3V8KA 3PIOF 2FQ4A 3U1DA 4FTHA 5IPAA 2BHZA 1HKTA 3DTIA 5ICCA 2XHKA 2KDOA 4P5OA 1R71A 3W2WA 4UVAA 4OMYA 1IO2A 4PDKA 1W36C 4LK0F 4X1EA 4YIFA 4Q48A 1R6RA 3UR3C 2MC4A 1LVKA 2ZBKA 3GFIA 2JA7J 1ENHA 4KIBA 3L00A 3CP8A 2PMZN 2XRLA 4HPQA 4KT5C 1IRGA 1XD7A 3F21A 2X6WA 3CF5F 1B1BA 1VQOI 1Z3YA 1JHHA 4MO7A 2R7ZJ 4CH7A 1P6RA 2VQCA 1ZGJA 1FX7A 2GXBA 4M9XA 3HOTA 4LG0B 2I5UA 1DGRM 1IN8A 3FMSA 3BR1A 1ETQA 3K4KA 5EEHA 4KIGA 3AG4H 1BI1A 3BJAA 5C4JJ 3M1CA 4MHGA 3L2UA 1J2XA 1NG6A 1IV8A 3IL2A 2W24A 2VOPA 1MJBA 1ZELA 2HKOA 3ASOH 3ISPA 4M72A 2X48A 4AUXA 5C3EJ 3RKQA 1WJBA 2LKSA 2KIFA 2OJED 1FMWA 1SVMA 3ESWB 5J4VA 2DA7A 2EZKA 1Z21A 1YIJI 4YFKF 2DK5A 3GTMJ 2GAUA 2MSYA 3CZ6A 1G3SA 3V4GA 3K69A 2CRGA 1ETWA 1WGXA 4XOTA 2P81A 1JJ6C 2WA0A 2DA4A 4A3DJ 2BHYA 3O6BB 4XSZF 3GO5A 1T39A 5J47A 1RUOA 4PUSA 4CXFA 3GFMA 3R60A 2MA3A 3CMAI 1E3OC 4WXDA 4A3IJ 1BA5A 5CJ9A 3JAMZ 3OYEA 3DLLF 2DPUA 1X1DA 2ZXJA 3EQLF 1REPC 3PFYA 4HG2A 3CCSI 1V55H 4ZZLA 1MDMB 3U1KA 3CCLI 2X6XA 2DTZA 1USTA 3VYTB 2UXXA 2UV1A 2IBDA 1HSJA 3CMMA 3HRSA 1AKHB 4XLEA 1EF4A 3GVAA 1T33A 4MTEA 3OS0A 2Q1ZB 2BW3B 3OWTA 1NTCA 2VB6A 5ICEA 3TKYA 3ZMTA 1BI0A 3GWZA 5EEGA 3Q3SA 1U8RA 2MLKA 3PSFA 3F6OA 3G1OA 3OYAA 3MEXA 4BJ5C 1Y8RB 5J6XA 2R5YB 2EV5A 4ZYHA 2HYJA 4I98B 4XKBA 4XRFA 4P55A 3S3OA 3BG7A 5FLVA 3EUKL 2LBFB 5F04A 5HLTA 2WV0A 2IRFG 2QSFX 3IHUA 3IRRA 4U87A 3OIQA 1DUXC 2PMZA 5FKNA 4EVIA 2VPRA 2D5VA 3R0AA 1SFKA 3E6MA 4C3JJ 2DOAA 2EFQA 4GRIA 3JSPA 2M0CA 2X85A 2NS7A 2FJ1A 1K79A 2GIZA 1FWZA 4XLPF 2QQAA 3FXRA 3KETA 4L5IA 2IT0A 1WVRA 1A6QA 3H35A 3N97A 1T95A 2JN6A 3WGIA 2P6TA 4M3FA 3M07A 1UFMA 1AKHA 4CCLA 1RZ4A 1ZN2A 2K9QA 2Y0SA 4RAFA 3G1LA 2IVMA 1FOYA 2ZJRF 3IUOA 4M74A 5KK1A 3DP7A 1ACIA 3A0BC 2BW3A 2CW8A 2BE5F 3ECOA 1WKMA 4OIQF 1FIPA 1FYMA 1S29A 1YJWI 3WHCA 1WI3A 4IJAA 1VQNI 2R5YA 3FXLA 1W0TA 2O9LA 2ELKA 2XGXA 3A4CA 3FM5A 4JX6A 3FXJA 1TW2A 2L54A 3QPHA 4HNVA 1IUYA 1WH7A 2ECCA 4HW0A 1IJWC 3GTKJ 4ZTJA 2X51A 3OV8A 3P9IA 1G59A 2HXIA 3QPTA 2ZXIA 2EFPA 1TWAJ 2E60A 1DPUA 1S6LA 2DT6A 3ULQB 4E7HA 2JA2A 5BNGA 4CHUA 3IH2A 3OYMA 3MZYA 4BXXJ 3WTWC 4I01A 2JVHA 3C3WA 3BG5A 1FNNA 2CYYA 1WPKA 4UUTA 4QIWN 2MLGA 4P9FA 5JR3A 1LQ1A 2L9NA 3JRCA 4KDPA 3HOVJ 4XR6A 3KP2A 4ESFA 4RBOA 3OYGA 4FHTA 1VTNC 3PNYA 3KZZA 4JYKA 5IY5H 5HODA 5BPDA 1NG7A 2LREA 4ITVA 4DYCA 1V5GA 3JRIA 2KDZA 2NS8A 3TDUC 2VE8A 4AVZA 4IHSA 5TGTA 2YR2A 5FD6A 3DEWA 2OQRA 2KRHA 2FBKA 2LKXA 2LY2A 3KYLA 4OOIA 2DW4A 1IRXA 2WADA 3UNGC 3ZQ7A 3ZQQA 5BPIA 1RUNA 4IHVA 4HEA2 1FOKA 5KAFC 3OOUA 2UXNA 3FHNA 3NWSA 1UCRA 3DTKA 3HYIA 1ETXA 3KYDB 1WJFA 3DBRB 3SZPA 1EA3A 2ME0A 5F08A 5E79C 5DUIA 4HF2A 3CC2I 4XICA 3BCBA 4A6EA 1LB2A 4M6XA 5HDGA 3WGGA 3BR5A 2VBWA 5EJCA 3CMEI 2JRMA 2DDAA 1VQ5I 2CMPA 2M1BA 2X1CA 1JUPA 3E5UA 2H8RA 3FK6A 1ZG3A 3P9CA 3ZQFA 4OU0A 4B1RA 4CZCA 4D1QA 2COBA 2HR3A 3PFIA 2R5ZB 5DM6F 1LDKB 3REOA 4KITB 1X4OA 3OR2C 3RZOJ 2LK2A 2L7ZA 3KEYA 3S1MJ 1T2KA 1U9OA 1MJ9A 3F8FA 2VONA 2M9HA 3LSJA 4G7OF 3HG9A 1JI8A 3W6VA 4XSXF 2VC0A 4UV9A 3CO7C 2CH0A 2TRTA 3FMRA 4OAZA 1K6YA 2X1EA 3L9FA 3MQ0A 2PG4A 3OYDA 2QKLB 1P4WA 1OYYA 1YX5A 2PX9A 4PFPA 3F3XA 5LFAA 1R1UA 2EB7A 1YITI 2IW5A 2LH9A 1Z3XA 1SFUA 1O4XA 4EJWA 2O5RA 3BTLA 3FMQA 3MKYB 1VQKI 2DQLA 4MFEA 2JUGA 1Q1HA 1H9TA 4RB1A 2VKVA 2F5EA 4M3BA 2CWEA 4IX7A 2VQHA 3CDIA 1UG2A 4LIUA 1JT6A 2KLOA 3PNTA 1U9NA 2AQEA 4ZZDA 2HEOA 6PAXA 4BJ6C 3O8HA 1GV5A 2V4JC 1DP3A 4BXFA 1I1SA 2HTSA 2Z99A 4U0VA 4B3AA 2MGQA 1LNWA 2R5ZA 2AXLA 1SANA 2Y30A 3OYNA 1IXSB 4C3HJ 1UELB 3TW6A 4EGZA 3NEUA 3GLLA 4XNFA 3JAMK 2V6EA 3S16J 5LD2C 4EGYA 2H1KA 2L3DA 2JSPA 2XAQA 4HA8A 4BS9A 1X58A 2HGCA 1BW5A 3OY9A 2R93J 3F22A 1MBEA 4A5NA 2DA3A 4HLYA 2ELJA 2DAOA 4DJAA 2VIXA 1BBYA 3CF2A 1XGSA 3RYPA 5KHDA 4R79A 3RTRA 2XAJA 2K4JA 2LP0A 3H5NA 9ANTA 4LMYA 3KEQA 4H0EA 3FKJA 1Z7LA 4UUSB 3DXJF 2X6YA 3CDHA 4I02A 4R1HA 1M1EB 4KT6A 1X3WB 3VEPA 3QAHA 2O03A 3H0DA 3GZNB 4HX7A 3FXOA 2PQ8A 3M8JA 4HF0A 3OS2A 1A35A 3B73A 2HWVA 4HOBA 3L2WA 3CC7I 4HAMA 3H9GA 3KP5A 1PDNC 2NYXA 4IF4A 2MD5A 4A69C 3VODA 1XX5A 2P0WA 2KL4A 2E5NA 1RR8C 3Q0UA 2JJ7A 1YW7A 1U5TB 2HDDA 2PFBA 4ESBA 2GM4A 4NUBA 2JRTA 3MKWB 1CQTA 5FKLA 2PEXA 3GMEA 1AA7A 2D2WA 3IKTA 1E3HA 4BYYA 2HXOA 1E3PA 2QGUA 2E7WA 3FBIB 3FDYA 3ZCOA 1HBXG 3SQNA 2HOTA 3TP0A 2DT5A 2I10A 2FXAA 1K6OA 2ECBA 3MCZA 1TWHJ 2KJCA 3KCCA 2PJRB 4L18B 4MLOA 4JX4A 5H6QA 4A3KJ 2IP2A 3BG9A 5EDNA 1LDJA 3HL2A 4DBRA 2W84A 4P96A 1OMIA 2LY9A 5B5EC 4UUSA 4B44A 1DDNA 4ABZA 1Y6IA 3M4OJ 3BP8A 3HBLA 5M5WJ 4XIDA 4D5CA 3I59A 2M7AA 1R9TJ 4XLAA 1JKOC 4B43A 4OIRF 2OZ6A 1DPRA 2F4OB 2FNPA 3M7GA 5K5RA 2QBYB 4LLLA 2BZTA 2HKXA 2QLZA 4BKXA 2QZ8A 3NQOA 3ZQLA 1QRYA 3CUQB 3TO7A 5JLWA 1MBKA 2DT7B 2DMUA 3K6GA 4XK4A 3BTIA 4UVCA 5J1UA 4WCGA 4RA2A 1ZKGA 3WG9A 1VQ6I 5D5UB 2ESNA 4BAYA 1YW8A 2FBIA 1G2HA 2WC2A 4NQWB 4ASNA 4CDGA 5L3FA 1V54H 1XG1A 4AWXB 1B8IB 4EM2A 3DV8A 2K86A 1QA6A 4A3MJ 4L9NA 2UUZA 1BIBA 4XN0A 2EIMH 3TOBA 5KNLA 4BEHA 1RETA 3NAUA 1B4AA 1WI9A 1WRJA 2O3FA 1XN7A 4GYIA 2Q8KA 4FE4A 2HS5A 5GAGJ 2E19A 4CUGA 2PJRA 1FP1D 1VF9A 4A3BJ 3CCYA 1W5SA 4TV7A 1HW1A 1GXPA 2R7OA 1DU6A 4ZDLA 3UKGA 3JTHA 2KP6A 1QVUA 2ZSHB 1GV2A 3FISA 3SYTA 3CCJI 1X1AA 4PK4A 3RPQA 4ESJA 5DYMA 4BU2A 1FSEA 1XCVA 4RS8A 3MN2A 2BY0A 2Y75A 2PN6A 2ZJPF 3A1YA 1P2FA 5GPAA 5ILSA 2PMHA 1X4PA 2XVCA 4YIRX 2VN2A 1QPIA 1D0ZA 4MTDA 1HLVA 2QA4I 3BR3A 2KFDA 2P5KA 3JREA 3CUQA 3ELKA 2R7SA 2K4BA 2XSDC 1TW3A 4BQOA 5K7ZA 4HF1A 1QNTA 3X2QH 1OCOH 2LD5A 3J7AY 4IXAA 1U5TC 3LQRA 4NQWA 2TDXA 3D1NI 3BR2A 3BZCA 2LDUA 2A5WA 1CF7B 2W00A 5E1ZB 1B8IA 1RIOH 3A03A 2VKDA 5ICGA 2DJNA 3TGNA 1K4TA 5LRSA 4AIKA 3HRTA 4CCJA 4S05A 2F5CA 1OYWA 4B4CA 1MNMC 1SD6A 4CICA 4NBQA 2E7XA 1X1BA 2KIMA 2QUFA 1U0JA 3WTVC 3I4PA 2RVCA 3FKIJ 4D7NA 3VYRB 2IGOA 2XB0X 2C6YA 2YX4A 2BGCA 1LDDA 1FZPB 1GDTA 3CTAA 1EJ9A 4N4OB 3V7CA 1EH8A 3DPTA 5E8IA 4LB5A 1I6XA 4PSWA 1P92A 2A6TA 1QZYA 4LLGF 4N4NB 3S1QJ 3GXOA 1X2MA 1Z67A 2XASA 2FF4A 2KPMA 2OU2A 2EZLA 3BZKA 4A6DA 1BJZA 2OZUA 1UHSA 4IO9F 2AHQA 2M4GA 4YG2F 2STTA 2IA1A 2JK3A 4D0PA 3F8MA 2B0LA 3CUQC 1L0OC 3HOWJ 1X2NA 5CVUA 3K9TA 4M9ZA 3ZQCA 3RKYA 1RKTA 1UMQA 1XMXA 2Y48A 1H89C 2E1CA 5EZGA 1R1VA 5DEQA 5GADJ 1MSEC 1JTXA 1HC8A 3PJRA 2VT2A 3QPSA 1CF7A 3BG3A 2ZFWA 1IDYA 3LL7A 2R92J 3RI4A 4LFUA 4Y15A 4GO1A 2WWYA 4I76A 3K70C 1XGOA 1N75A 3ZQHA 5EGOB 2LG4A 4YIIA 1QZEA 2IXSA 1K4SA 5FLXZ 1JGSA 2DFFA 4BHPA 5DD4A 2NOJB 3S2DJ 1VQPI 3DU6A 2VASA 4ENNA 1PVEA 4HV5A 4UB6C 4WXHA 1ZR4A 3R61A 1ZAOA 3PM1A 5M3MJ 3ZR8X 3OYFA 1O3RA 4RM3A 3C18A 5D5XB 4BQNA 1L3LA 4ZC3A 1XCBA 2AQFA 3IKVA 3RSNA 5BS6A 2VE9A 3BLYA 1YYVA 3FWEA 2XF5A 1ON2A 3VOEA 1USSA 2FSWA 2XDVA 2K9SA 1D1BA 4MEYF 1R1TA 3FF5A 3GZ5A 1FMVA 5EEAA 4C30A 2JPCA 1LVAA 2XAUA 3CLOA 4II2A 3PO3J 2XIGA 3ZOBA 2CQ7A 4LB6B 1YRNA 2XKOA 2CJJA 4HBLA 4F91B 4ETSA 2VJ4A 3QOPA 5D4SA 3BC8A 4JQFA 4A0YA 1TT0A 2M87A 2M8EA 3ZP5A 5J4YA 2VBYA 2K02A 5E18F 5DCFA 4HDUA 1Z91A 1PP7U 5E3LA 1JUSA 3Q9SA 4R8HA 5DCMB 3U2RA 5DUKA 4A0ZA 2X6OA 3DBLB 3P9KA 3LNQA 4B3XA 5EGOA 3MKZA 3F72A 1OCTC 1YLFA 3AG2H 3BR6A 3FXQA 4DOZA 2EZHA 3JRDA 5JHUA 2JWTA 2W57A 2DK8A 1XSXA 3M1EA 4KA4A 2CU7A 3ABMH 1D0XA 3QRFF 2FMLA 3ABLH 2M2EA 4F7ZA 3SEQA 5ILUA 1LKXA 4BHBA 3OMYA 1D1AA 2R0QC 2PI0A 2CV0A 1AWCA 2GOXB 3CESA 3DF8A 2WB1A 3W3CA 4RGUA 4EATA 2HDCA 1BOBA 3HM5A 1JKPC 2L7FP 2Y69H 1BI3A 1RESA 5FROA 3O8GA 1MBJA 2TCTA 3JRBA 3W6KB 1IN6A 1UAAA 4I2OA 2KT0A 1XGMA 2DFHA 2EILH 1OPCA 5K7HA 4ON0A 4M6VA 2X1DA 1O3SA 4OAYA 1I5ZA 4PSXA 2DOFA 5IP6A 3R4KA 5J1RA 2L9VA 5KCMA 5DCMA 1IGNA 3IRQA 3W2AA 4WK8F 4DNCA 1KQ9A 1QVTA 3BY6A 3T0YA 1XMKA 2ZO4A 1IN7A 3A01A 3DTEA 5D8KB 2Z33A 2XPWA 4XRSA 4XOPA 5D8LB 2P7CB 3TP3A 5FD5A 1R5GA 4D9JA 3J7YJ 3CJTB 4PFOA 3FHZA 3HOUJ 3ONQA 4BQAA 1GT0C 3L1PA 4JK1X 4GFBA 1PP8F 1R49A 5D6FA 2L7KA 2FX0A 2E2IJ 2CV1A 1MMNA 1NK2P 3QQAA 3JR9A 1OR7A 3H9QA 1MBGA 3L09A 4E7ZA 3OIPA 1KZHA 4IPAA 3SZTA 1BC7C 3H9JA 2E1MB 2DI3A 2OV7A 4BE2A 1IRFA 2LY1A 1APLC 4AVPA 4OIPF 1QHGA 2KRCA 1YJNI 4JOMA 1K7AA 4MQVA 3G4SI 2DMQA 4FE7A 2FEZA 2CS3A 2H1LA 2QENA 2M45A 2WBMA 4JX5A 4AD9A 5B66C 2VQLA 3V7RA 3I54A 4U88A 5FRNA 3ZGKA 5IYCJ 2GA2A 4IQJA 1FTZA 5B1BH 4RLQA 1BR2A 4E70A 4XLCA 1PUEE 2DO7A 5IP7J 4N9HA 3K0LA 1MZBA 3RQIA 1N78A 3SZGA 5F1RA 1BW6A 3CC4I 2DA2A 1J5YA 2KQRA 3DFGA 3DKWA 4EJOA 2L2OA 3AG3H 5LGNA 2WTEA 5F1JA 2F4MB 1B72B 2HTJA 3WE3A 2HQNA 2DOEA 2VBZA 3EUHA 2JPBA 2M34A 2RNGA 1OR7C 3DPLC 4Y33A 1VFCA 2LFBA 3S1NJ 4IZZA 3G2BA 1U78A 5LHIA 4U0YA 1QGPA 1V3FA 4U0WA 2VI6A 3CDLA 2HDWA 3TMOA 2VLAA 1J75A 2CFXA 2DMPA 4OMZA 3WTTC 1O3QA 1RRJA 5IT3A 3OYIA 1G3YA 1S7OA 3HGGA 4DBQA 1XMAA 4XORA 2XPVA 2OUMA 2XKPA 1J7KA 2MW8A 4G6QA 2OAZA 3RCOA 3Q5FA 1WJAA 1BL0A 3L7WA 3OYKA 4L0YB 2IGNA 4CA0A 3H36A 1QZZA 4E7LA 4Y7NJ 1SAXA 2H6CA 2ACJA 3HGYA 2IGKA 2CV2A 2EFNA 1DQUA 2H6BA 1VNDA 2IJLA 4FQGA 2CGPA 2NVQJ 1JKQC 1ERDA 2LLKA 1SMYF 3I53A 3S2WA 4BDZA 2XB5A 2Y9ZA 1IG7A 4I7HA 1DP7P 1B72A 4BUPA 1SVOA 3CO6C 3S14J 1LJ9A 5HNHA 2NVYJ 3EUHC 4JP0A 2HYGD 1ONVA 1HA8A 3SHFA 2VXZA 4JBAA 4Z6YA 4N0BA 2DFEA 2DN0A 1W7PD 2K40A 1HCRA 4F92B 3RDIA 3GTOJ 5FLXK 2YU3A 4HNUA 2R7VA 3LA2A 2MD0A 2JA8J 4IRIA 4Y52J 2H09A 4ZDPA 4IRGA 3AFHA 3TW7A 1KYZA 4AIJA 1VI0A 2NVUB 1MBHA 4CCNA 1TT5B 2A6HF 1FPQA 3RKXA 1YHQI 5LEJA 3S3MA 4C9YA 3ZMVA 5HDKA 3BTCA 3PUFA 4Y3OA 2EBIA 4L9JA 3WG7H 3B02A 4WX9A 3BTJA 3JRAA 3HOXJ 5E1WA 2YS9A 2HOSA 2IS2A 2GWRA 5HS7A 2YPRA 5GTIC 3KFWX 1B9MA 2VJJA 2V1DA 1I27A 3MWMA 4V19K 1SAUA 2RGVA 5LRRA 2PMUA 5CPRB 2DXIA 3AKZA 4I09A 2YX7A 4BL0B 4BE1A 5GP9A 3S15J 2KZVA 5HNFA 2XGCA 1SD4A 3HSEA 1EV7A 4NNJA 2VKHA 4UV8A 4A3JJ 2MG4A 4IHXA 2DTRA 1IDZA 2G7HA 3ECHA 1RI7A 5E17F 4HQEA 1WHUA 3LSRA 2E2HJ 4ZYAA 1GLNA 3KPHA 4UUVA 2M3AA 5FKKA 4F52A 1Z6TA 5AONA 5E20A 4ZDOA 3ML6A 3GYHX 1GHCA 3IH4A 3L2VA 2QQBA 4E4HA 4B47A 2OC6A 2A69F 4IQ4A 3V42A 5CVVA 3T1BA 2E35A 2ZJQF 4BE0A 2X4HA 4YFNF 4L5JA 4M9SA 1ZRDA 2O6GE 1ITYA 2DYRH 2ISYA 2PBIA 1WH5A 1FBSA 2QWWA 3C2HA 3MKLA 4XKCA 4XRMA 4P1WA 3S93A 2A05A 4XQFA 3K1NA 3BQZA 5E3MA 1C0WA 3SFZA 3NRVA 3WTZA 2QSGX 5K5OA 2M30A 2FD5A 4RB2C 3TQNA 1BM9A 2Z9OA 3RKWA 1JT0A 3LSIA 3T5XA 3F9KA 5IOYA 5DD8A 5L3GA 5GAEJ 1DU0A 1EKEA 2LTPA 3I5UA 4CCMA 2IS4A 3ZN1A 2BVLA 4HX8A 3LSTA 2R3SA 3WTXC 4E7IA 3KLOA 1I3QJ 2JA5J 5FLMJ 4PJMA 4AIDA 1YW9A 4CGZA 3DWLE 1QHHD 1XDUA 4F55A 3IV5A 4MFDA 2RREA 3JRFA 3PQJA 4Y4RA 2VT3A 2K9MA 1R4NB 2HZDA 4KYWA 4G6DA 3A02A 3U9GA 3B6AA 5KVRA 3ERMA 2FOWA 2FNAA 2F5FA 3E0JB 3WHBA 1IN5A 1ETOA 1ZGAA 2ZXHA 3PO2J 2BEOA 3FX3A 1Q1VA 3HIFA 5K7FA 2OCCH 5H20A 1F1ZA 3V8LA 1XDSA 1MJAA 2ZXWH 2V79A 3FXMA 3HPGA 3M8EA 1WJCA 2ISZA 3DCFA 2OTLI 3WODF 1Z77A 2ETHA 1FBUA 1PJRA 3ZMUA 5E3OA 2RKHA 5L3EA 1VQLI 4FX0A 3J7ZI 1A36A 3I59B 3K2ZA 4BQQA 2DQRA 2L9RA 3GUDA 3OYLA 3QYEA 2XROA 5H6RA 3FK7A 3E6CC 2KZGA 2OTJI 4IHWA 1FOWA 1V5FA 1MMSA 5J40A 2E1OA 1B9NA 3BROA 3F8BA 5GTHC 3JRHA 3M8FA 2B63J 1YG2A 5M5XJ 3BPXA 1YIOA 2R4GA 2O8XA 4G6TB 4WWCA 2Y0MA 1LE8A 4KUMA 3HHHA 2R7TA 2YUSA 3K4CA 4EJVA 1HXDA 2A3SA 3RJPA 4RB3C 5CVIA 3SDGA 4Y13A 3DLAA 4CCOA 5B1AH 2GLOA 1FY7A 3J80Z 5F64A 4EJTA 3RIRA 4BEHB 4UXNA 3HRUA 1TWGJ 5J8FA 2HI3A 1T8IA 4IHYA 1KU7A 4IKFA 5FKOA 5GAHJ 3C7JA 3LWFA 1N77A 1ODDA 2W82A 3BDDA 4KMUX 1KU9A 2KRFA 3HUGB 5FKMA 3ZN0A 4FCYA 1MSFC 3C2GA 4CYCA 1RC9A 3QODA 2D1HA 4ENMA 1JUMA 2UWMA 3QP6A 1SMTA 3GF2A 4YELA 2QQ9A 3IWFA 4HV6A 4W1UA 2LOOA 3S32A 1FOXA 3DQVC 3TO9A 1LFBA 2RV8A 2H94A 3M3YJ 1KQ8A 1TQPA 1ULYA 1GXQA 1HDPA 3HHGA 5TJJA 5D4RA 4YRVA 3BT9A 2LNBA 1OCRH 4N9IA 1HOMA 2EV6A 4HZFA 4D5FA 1R23A 2CW7A 1MMDA 3MMYB 4YEJA 1JGGA 2BBYA 4E7KA 1FYKA 2F2EA 2KJBA 4P9UA 1WJ5A 5L3BA 1OKRA 2EK5A 5GPCA 4A0XA 2X9DA 2XF6A 3GW2A 4XKWA 4YFXF 2L02A 3Q0VA 3I58A 1U6GA 4RLFA 4KISA 3HOZJ 1KU2A 3ZQGA 2JZYA 3KP7A 3E6BA 4M73A 1S7AA 1IXRC 3SXYA 4MGRA 3PIPF 1IXCA 4B48A 1ZRFA 4Z2YA 2FMYA 2CG4A 3HUGA 2DU9A 3G3ZA 4NHJA 2EINH 2ZFUA 1TQIA 1OCZH 2MH2A 2A07F 1POGA 4HRIA 5D6EA 2HQRA 1Y1VJ 2XUBA 2A61A 4HSTA 3SJMA 5DM7F 1KONA 3L2CA 1LPQA 4HYEA 3DEUA 2N8GA 1NK3P 3F23A 4GXOA 3LAPA 3L2QA 1R00A 2DBBA 4QTRA 3BPVA 1Z6RA 4EM1A 1BJAA 4FISA 4MNUA 3K4BA 1B6AA 1VZ0A 3HRMA 5IT9Z 1UHMA 1XGNA 1BIAA 2XGDA 2ZCWA 1KQ0A 1TL8A 4EEFG 2G9WA 1QU3A 1B59A 1X1PA 3GX4X 3VWBA 2KKOA 1TC3C 1D8KA 5HLIA 3KP6A 1FYLA 2BXYA 2LSOA 3PNVA 3MVPA 5ILVA 3E5XA 3ZPLA 4A5MA 2EIKH 2ID6A 1I39A 4KN7X 4BNCA 5DDGA 2K9LA 2STWA 3K70D 3LA7A 1YS6A 2FUG2 4OWRB 1JXSA 2KMUA 5L3CA 4ENJA 3VSLA 3IAM2 4G8XA 2MC3A 3S17J 4KN4X 4AU7A 5CLSA 1GUUA 2LRDA 4Q47A 2A68F 4E7SA 1PYVA 4XONA 5LGUA 5LLQA 4IL6C 1G8XA 3EPZA 3D5LA 4WXCA 1FEXA 2LVSA 2F5VA 2VUMJ 1R36A 4XRSG 1XB4A 1YRNB 4AM3A 3H1CA 3K1PA 3U21A 1S9HA 3KEOA 1IUFA 2JSCA 2QEXI 2PJPA 2VBXA 3HZJA 2L01A 2QCOA 3EUAA 3LA3A 5HLGA 4IVNA 5ED4A 1S72I 3CP2A 5AIPA 3GEZA 1QPMA 3LSMA 5FO5A 3S1RJ 4RGSA 5HS8A 1Z05A 1Z0XA 4LGWA 3BCAA 2V6CA 3B6CA 1XPXA 1HKSA 3OYJA 2P5VA 3HSFA 5FFZA 4A12A 4OIOF 1W36D 3AG1H 3LSGA 3CMYA 4RDUA 5CKTA 1IV6A 2HU9A 1O57A 1SC7A 1ETVA 4I6ZA 2F5DA 1TBXA 3WE2A 3LSPA 3E7LA 1LUJB 2LYCA 3KP4A 1ORKA 3VYUB 2KIQA 2XC7A 4XLHA 2VQGA 2BYVE 1XSVA 3H5AA 3KYCB 2HVQA 3J7AO 4AIHA 3HB9A 3DKXA 4BJTA 3KZIC 5CQGA 1J59A 1I50J 1ZH5A 2YSRA 2BV6A 1VQ4I 3RPUD 2E36A 4IOCF 1S3JA 1UB9A 3P7NA 1AOYA 3CQZJ 4UB8C 2ZC2A 5JHFA 3TL4X 2EFOA 1NH3A 5E3NA 2HVSA 4ZYGA 1G3WA 3AL0B 1V4RA 1QBJA 1MW7A 3A01B 2ME6A 4B09A 1UJ8A 2W85A 2LKPA 1F4KA 4QLCU 2P6SA 2G0EA 1W0UA 3JTGA 5LHHA 2E71A 3CJRB 2XRNA 3ZMDA 4O6JA 3K7AJ 4A3GJ 1G6NA 1W4MA 1RR7A 1ZG1A 3VPRA 1Y0NA 2K27A 4LJZF 3AAFA 1K61A 4S0HB 3J80K 1ZYRF 2L4AA 5CVRA 3I0TA 1D5YA 1MKMA 2J5OA 2V1XA 2HOAA 2XAFA 2JMWA 4FX4A 4LOCA 2GA1A 3LFKA 4V2FA 2BY3A 4V2GA 4W97A 4A2UA 1HDDC 5B3SH 2ICWG 4B8XA 1OLTA 4EMSA 1WJEA 3FXKA 1A6IA 5LHGA 4KJZA 1SFOJ 3CCUI 3Q9VA 1A5JA 2JA6J 2XF7A 3H3UA 4ZH4F 2IA2A 2P7VB 3MZHA 1T0FA 4Y17A 5JI6A 3HDDA 1SD5A 3BWGA 3FZVA 2E34A 4XM3A 4EJUA 2Y0SN 1FP2A 3F8CA 4MIMA 1S7EA 4M6YA 4CO8A 1FBQA 2IPQX 1ZTRA 4PCQA 1HF0A 2ZNYA 1YO5C 3RYRA 2I8DA 1W5TA 4DZJA 3L2RA 2JT1A 2UZKA 1O7FA 2DJIA 2EH3A 1HQCA 3H0GJ 2CUJA 3R6SA 1JTYA 5F0CA 4E6KG 3CCVI 2Z16A 2HFHA 1A31A 3KZYA 2DCEA 4HQMA 4I0BA 4C2MJ 1YS7A 5LGTA 3GTLJ 2FQ3A 2GOMA 3M9AA 4LG0A 2ZNZA 2IS6A 3K4JA 4LIVA 1TP4A 2COMA 3O3KA 2RN7A 3IWZA 3OYHA 2CSOA 1HW5A 2NXNB 3HEFA 2LR8A 1ZLKA 3OSGA 2DA5A 4DZPA 2O7OA 3HC7A 1QO0D 3FXUA 4ZYEA 2W1OA 4RM2A 3F8NA 2QVOA 4C2TA 1ZQ3P 1D1CA 2R7DA 1SEUA 1T0FC 3OOPA 4Q4ZF 3AL0C 2FRHA 2Z3YA 2B9SA 4PJJA 2LF8A 4PJ0C 1A04A 3A2KA 1ZG5A 5IT9K 4KICA 5J1YA 2NRAC 1E17A 3PUBA 3E6DA 4FASD 3G71I 2YU9J 2H8WA 3MD2A 3S2HJ 2A5YB 1W5CC 3QYFA 5IOZA 4RMNA 3OYCA 1R5HA 3PQKA 3HKZN 5K1YA 2L0KA 5HLHA 2JVGA 2AO9A 1X1CA 2DA6A 1J09A 2NNNA 5C44J 3CCEI 4IOAF 1P7JA 3Q0WA 2HOEA 1Y1WJ 3HJEA 3EETA 1F36A 3KIOA 3N4MA 4L9TA 3COAC 2EJRA 3WU0A 3F6VA 1MDMA 3QOEA 1T98A 2EIJH 2D45A 1W7PB 5F6FA 3BJOA 4DIQA 3WU2C 1D0YA 3KX2A 4M3GA 2OA4A 1T56A 2CFOA 4M3DA 3CUOA 3WTYC 1YFHA 1H8AC 2RDPA 3E97A 1O7LA 3ROUA 2CUZA 1SFXA 3I4NJ 5TISC 1K83J 3QP5A 1DGWY 2QF7A 1BC8C 2XAGA 2HPMA 2EA2A 4ANJA 3RQ4A 1Z9CA 3OL3A 3CCRI 5E8GA 3I3LA 4GGGA 4ZTFA 2LBFA 1PUFB 1ZREA 4C2UA 3ABKH 3W6JB 2EZIA 1TWFJ 2EQRA 3HPHA 2JQ7A 3K1MA 2V1UA 4GDFA 2VOOA 3GTGJ 4X6AJ 2B7EA 2ZB9A 3ZXSA 2IGMA 3BJ6A 3E3VA 3D0SA 1FC3A 1RPWA 1YOVB 3I71A 2GBYA 2VKEA 2VODA 4S04A 4EV0A 2BY1A 4GYGA 2VC1A 2E1MC 5KAIC 3VDXA 5BQTA 3EDPA 1UZCA 4BHCA 4G12A 1KGSA 3ZQIA 3W2VA 3PSIA 1D5VA 1R58A 1W7PA 2MYSA 2DA1A 3QWLA 2V9VA 4O5VA 1WWXA 3OIOA 1BI2A 2IS1A 2K5CA 3LMMA 5A2QZ 1BN5A 1LEAA 3K4MA 4XLNF 3S8PA 3BR0A 1FLIA 5L3DA 1HKQA 4G7HF 3S3NA 4LLNA 1KU3A 1OJLA 2BY2A 2RQPA 3DU5A 4HSRA 3WTSC 3H3ZA 2O0YA 2F4IA 5K5QA 2A6EF 2FOKA 1Y8QB 2P4WA 2QQ8A 3EYYA 3HXLA 2HQAA 3ABTA 3JCUC 4C3IJ 2MABA 5EF6A 1IC8A 3HKZA 3LQQA 2P8TA 2HZTA 5TRDA 1MMGA 1FJLA 3E5QA 3J81Z 2WAFA 2LMDA 1PUFA 3ABUA 4DYRA 2W25A 4I99C 1N25A 4M71A 2BVMA 1GVDA 1TLHB 1WQ2A 2K85A 1R4MB 2R7FA 2F6CA 1SFEA 3MFKA 2O61A 1E0EA 3K2AA 2R7XA 2L9SA 4A93J 2AS5F 2CO5A 4BH9A 2ZJ2A 3QPLA 1TWCJ 4WF2A 3SFIA 1ETYA 3D5SC 1Y56A 5FFXA 1TNSA 3GLXA 4OINF 4NC8A 4PZJA 4BGDA 4UHTA 1WJDA 2V7FA 2WV1A 3CJNA 5BMZA 4E7JA 3V8JA 2DMTA 3BG6A 3WGHA 1X19A 4H4KC 1U3EM 4UVBA 3JSOA 4QPOA 1J9IA 4LITA 1D3YA 1STZA 3BQYA 3FBNB 4KIFA 5DV5A 1MNEA 1S5LC 4AYBN 4HDVA 2RAEA 3V7SA 4NC7A 5FJ8J 3JRGA 3GTQJ 2L4MA 4DYQA 4UNOA 4ENKA 2HYFA 2RQQA 4BXUA 5IYDJ 2HQ5A 2PLYA 2R7UA 2CQQA 2MFZA 2WAEA 3DEEA 2QKMB 4K2EA 2W7NA 2KHMA 3DPUA 1JJ8C 4BDYA 2EA4A 1K78B 3NWTA 2Q2EB 5HVQC 1YX3A 2KISA 1F5TA 3HTUA 3LOCA 1ZLJA 2IA0A 2M4KA 2Y9YA 4HX4A 1MBFA 4XKVA 1LFPA 1WZ2A 2EWNA 2OQGA 2ZKZA 1LE8B 1WSUA 4UY8I 2M0MA 4BBSJ 2QSHX 5EYRA 3IAS2 4F3QA 5HOOA 3I9V2 3WTUC 1JKRC 4MEXF 2DFIA 4RAGA 4FT8A 4ZJZA 2ESHA 1T08B 2DLLA 2ZMEB 3KE2A 3TBIA 3MZ8A 1Y39A 4PGHA 1OCCH 4NB5A 3QYBA 3H3VK 3G73A 1TZLA 3NARA 3QU3A 4HLXA 2HNHA 5F27A 3H5RA 4L0ZB 1MH4A 2AXTC 3HOYJ 4CYCB 1YQAA 3IP4B 3RZDJ 1WFXA 1IF1A 4PJNA 2NVXJ 1AHDP 1I6HJ 3I56I 3VYSB 1VQ8I 2X0LA 3DKYA 3TO6A 2W48A 2VXDA 4DQ2A 5D5VB 1ZK8A 2D1VA 4CCKA 4G7ZF 2GXGA 2Z5UA 2DODA 1IAWA 5LEKA 5BOXA 1I1GA 1K78A 1BOAA 3JW4A 2Q2EA 4X0GA 2GXAA 1R7JA 4PGGA 1F43A 2OBPA 1HSTA 5H2FC 4DGWB 1ETKA 2XV4S 2IAIA 4D7MA 5CYVA 4QPQA 3TOAA 2G7UA 3T8RA 4IRHA 3ZRGA 5JVGF 4RGRA 2M7BA 1UHWA 1ON1A 4BY1J 1O3TA 4AYBA 2ZMEA 3BZ6A 1TTYA 4DW6A 2V1NA 1KA8A 4G9YA 4L9VA 1R22A 2VJIA 3GTJJ 1IZ1A 2DYSH 4EQQA 1RNLA 3E1SA 1FIAA 1YE9A 4BBRJ 1EH7A 4G94A 1P7IA 3OS1A 1P4AA 4IHTA 4F93B 2MBFA 2JUCA 4XLFA 3D5RC 2W4SA 2M8GX 1MIJA 5EG0B 3OYBA 4J00A 3HOSA 2XAHA 1W1WE 1LFUP 2HVRA 1BR1A 4FETA 3CD6I 5FGMA 1YTYA 4RAZA 2V9PA 5CQEA 2Y31A 3FIWA 5ICFA 5J3LA 3SDBA 4J01A 1E2XA 2CW0F 4A3EJ 2OPTA 5J8CA 3CJQB 1P9QC 1Y0UA 2ID3A 1U8BA 2DPDA 1FSHA 2K3PA 4RB0A 1G3TA 4KMFA 2GQQA 3FM3A 1OCPA 1OFCX 3OL4A 2ZMEC 4Q5SF 3H92A 1OISA 4LK1F 1BR4A 2VPLA 1ZHFA 2DMNA 2F48A 3N05A 2GZWA 1HW2A 1GVJA 5M3FJ 4A3LJ 4J19A 4M3EA 2Z2SB 3LSHA 3T8TA 4XL9A 1YJ9I 2EV0A 1U5TA 3I55I 2V9KA 5JLXA 5E1XA 4XBFA 4CZZA 3OR1C 1ZARA 4II3A 4PJLA 5HS9A 1UG0A 3F0CA 4KFCA 5JFRA 3WU1B 3VSKA 1IN4A 2XGEA 1X3UA 5EG0A 2FE3A 2IEKA 2O8KA 2WY7Q 3GFLA 5A2QK 1IRZA 3K4NA 3G6EI 3TEDA 4LD5A 5IP9J 2R7RA 1MD0A 4HNTA 3I4MJ 2CUFA 1R5ID 3DBHB 3GFJA 4QSHA 1Z7UA 3K10A 4RGXA 1MNDA 4U7DA 1VQMI 1TNTA 2WAQN 1MGTA 2K9NA 1SD7A 2H27A 1S8NA 3EYIA 1IW7F 1G4DA 1XC5A 1FT9A 1TQMA 1YI2I 1FTTA 3GBGA 4GCVA 2QBYA 1EH6A 1ZGWA 2RNJA 3KLNA 3J81K 2HPIA 5C4XJ 3VFZA 1QQIA 4AC0A 1VQ9I 5LBQA 3GTPJ 4L5EA 2CQNA 2WY8Q 4NDLA 3TDZC 3VB2A 4EM0B 4NC6A 3LAJA 2CQKA 3GZ6A 3CCMI 1P4XA 1JHFA 3C2BA 1J0RA 4CYDA 3I64A 1XSDA 2XSJC 3HSRA 4CSWA 2NS0A 2K3FA 2K7LA 2OCEA 4KNYA 2Z1DA 5F0FA 2VL8A 2GIVA 4MQ9F 1AU7A 1ZRCA 3ERED 3SEZA 3BOQA 4BY7J 3HTSB 2QM3A 5CVJA 4LG3A 2DDBA 2ELHA 1MH3A 2EFWA 4BACA 5JVTA 2NNYA 3CLQA 2FU4A 1ZR2A 1VQ7I 5FB2A 1XTAA 2XPUA 2NVTJ 3IH3A 2E1NA 2LC2A 3OSFA 1MMAA 4XMYA 5IYBJ 2EPFA 1JE8A 2KIUA 1U2WA 3CCQI 1KYWA 1H88C 5ERIA 1RKWA 2VJ5A 5DS9A 1OQYA 2ADUA 2RC4A 4IEJA 1I3AA 3GCMA 2E2JJ 2QYOA 2R7QA 4O3MA 2WB1N 4ZYDA 2LF7A 5EZHA 5HDNA 1LEBA 2V26A 2OF7A 4U7BA 3KP3A 3PL8A 2NOGA 3A0HC 3O2PE 2Y2ZA 2M5WA 1F9NA 2L5QA 3MAJA 5M5YJ 2FBHA 2E5ZA 3IC7A 2MH9A 2CUEA 2BOLA 4I0AA 1NHAA 3ASNH 5FRMA 2OD5A 2Q0OA 2R7WA 4A3FJ 1H9GA 3C1DA 5F0HA 4XN3A 1SVLA 2ZSIB 2WAQA
chains in the Genus database with same CATH topology
3CCLI 3G6EI 3G71I 5GAHJ 2H8WA 1VQ6I 1VQMI 5GADJ 1HC8A 3CCEI 4IOAF 5JVGF 1QA6A 1YI2I 1FOXA 1VQPI 5GAEJ 1VQ9I 3J7YJ 3CJTB 5GAGJ 3PIOF 3CCMI 3CCJI 2QEXI 3CCUI 3CC2I 2K3FA 1S72I 2ZJPF 3CMEI 1YJNI 1VQ5I 2E34A 2FOWA 3CCRI 2QA4I 3CC7I 3CF5F 1VQOI 1YHQI 3G4SI 3PIPF 3CD6I 1VQ7I 5DM6F 2JQ7A 2OTLI 1FOYA 2ZJRF 3CCQI 1ACIA 4UY8I 1VQLI 3J7ZI 5DM7F 4V19K 3CCVI 1YJWI 1VQNI 2OTJI 3CC4I 1FOWA 1Y39A 1MMSA 1YIJI 1YJ9I 1VQ4I 2E36A 4IOCF 3I55I 1YITI 2NXNB 1VQKI 3CMAI 3I56I 1VQ8I 3DLLF 4IO9F 2E35A 2ZJQF 3CCSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL I;  3G6E I;  3G71 I;  5GAH J;  2H8W A;  1VQ6 I;  1VQM I;  5GAD J;  1HC8 A;  3CCE I;  4IOA F;  5JVG F;  1QA6 A;  1YI2 I;  1FOX A;  1VQP I;  5GAE J;  1VQ9 I;  3J7Y J;  3CJT B;  5GAG J;  3PIO F;  3CCM I;  3CCJ I;  2QEX I;  3CCU I;  3CC2 I;  2K3F A;  1S72 I;  2ZJP F;  3CME I;  1YJN I;  1VQ5 I;  2E34 A;  2FOW A;  3CCR I;  2QA4 I;  3CC7 I;  3CF5 F;  1VQO I;  1YHQ I;  3G4S I;  3PIP F;  3CD6 I;  1VQ7 I;  5DM6 F;  2JQ7 A;  2OTL I;  1FOY A;  2ZJR F;  3CCQ I;  1ACI A;  4UY8 I;  1VQL I;  3J7Z I;  5DM7 F;  4V19 K;  3CCV I;  1YJW I;  1VQN I;  2OTJ I;  3CC4 I;  1FOW A;  1Y39 A;  1MMS A;  1YIJ I;  1YJ9 I;  1VQ4 I;  2E36 A;  4IOC F;  3I55 I;  1YIT I;  2NXN B;  1VQK I;  3CMA I;  3I56 I;  1VQ8 I;  3DLL F;  4IO9 F;  2E35 A;  2ZJQ F;  3CCS I; 
#chains in the Genus database with same CATH topology
 2JTV A;  2J5P A;  3G1M A;  2CQX A;  5DTD A;  1V5E A;  4A3C J;  3R0J A;  5AIQ A;  4RAY A;  1OYI A;  2FA5 A;  3ZMS A;  5D5W B;  3K4L A;  2P5L C;  1X3Z B;  1XS9 A;  1H0M A;  1WCM J;  3RPU A;  3P5J A;  1CGP A;  2BXZ A;  2L7M P;  3LFU A;  3ZMZ A;  1T38 A;  1D8J A;  3LSK A;  1T6S A;  1Z1D A;  2NAZ A;  4QWQ A;  3QU6 A;  3V8K A;  3PIO F;  2FQ4 A;  3U1D A;  4FTH A;  5IPA A;  2BHZ A;  1HKT A;  3DTI A;  5ICC A;  2XHK A;  2KDO A;  4P5O A;  1R71 A;  3W2W A;  4UVA A;  4OMY A;  1IO2 A;  4PDK A;  1W36 C;  4LK0 F;  4X1E A;  4YIF A;  4Q48 A;  1R6R A;  3UR3 C;  2MC4 A;  1LVK A;  2ZBK A;  3GFI A;  2JA7 J;  1ENH A;  4KIB A;  3L00 A;  3CP8 A;  2PMZ N;  2XRL A;  4HPQ A;  4KT5 C;  1IRG A;  1XD7 A;  3F21 A;  2X6W A;  3CF5 F;  1B1B A;  1VQO I;  1Z3Y A;  1JHH A;  4MO7 A;  2R7Z J;  4CH7 A;  1P6R A;  2VQC A;  1ZGJ A;  1FX7 A;  2GXB A;  4M9X A;  3HOT A;  4LG0 B;  2I5U A;  1DGR M;  1IN8 A;  3FMS A;  3BR1 A;  1ETQ A;  3K4K A;  5EEH A;  4KIG A;  3AG4 H;  1BI1 A;  3BJA A;  5C4J J;  3M1C A;  4MHG A;  3L2U A;  1J2X A;  1NG6 A;  1IV8 A;  3IL2 A;  2W24 A;  2VOP A;  1MJB A;  1ZEL A;  2HKO A;  3ASO H;  3ISP A;  4M72 A;  2X48 A;  4AUX A;  5C3E J;  3RKQ A;  1WJB A;  2LKS A;  2KIF A;  2OJE D;  1FMW A;  1SVM A;  3ESW B;  5J4V A;  2DA7 A;  2EZK A;  1Z21 A;  1YIJ I;  4YFK F;  2DK5 A;  3GTM J;  2GAU A;  2MSY A;  3CZ6 A;  1G3S A;  3V4G A;  3K69 A;  2CRG A;  1ETW A;  1WGX A;  4XOT A;  2P81 A;  1JJ6 C;  2WA0 A;  2DA4 A;  4A3D J;  2BHY A;  3O6B B;  4XSZ F;  3GO5 A;  1T39 A;  5J47 A;  1RUO A;  4PUS A;  4CXF A;  3GFM A;  3R60 A;  2MA3 A;  3CMA I;  1E3O C;  4WXD A;  4A3I J;  1BA5 A;  5CJ9 A;  3JAM Z;  3OYE A;  3DLL F;  2DPU A;  1X1D A;  2ZXJ A;  3EQL F;  1REP C;  3PFY A;  4HG2 A;  3CCS I;  1V55 H;  4ZZL A;  1MDM B;  3U1K A;  3CCL I;  2X6X A;  2DTZ A;  1UST A;  3VYT B;  2UXX A;  2UV1 A;  2IBD A;  1HSJ A;  3CMM A;  3HRS A;  1AKH B;  4XLE A;  1EF4 A;  3GVA A;  1T33 A;  4MTE A;  3OS0 A;  2Q1Z B;  2BW3 B;  3OWT A;  1NTC A;  2VB6 A;  5ICE A;  3TKY A;  3ZMT A;  1BI0 A;  3GWZ A;  5EEG A;  3Q3S A;  1U8R A;  2MLK A;  3PSF A;  3F6O A;  3G1O A;  3OYA A;  3MEX A;  4BJ5 C;  1Y8R B;  5J6X A;  2R5Y B;  2EV5 A;  4ZYH A;  2HYJ A;  4I98 B;  4XKB A;  4XRF A;  4P55 A;  3S3O A;  3BG7 A;  5FLV A;  3EUK L;  2LBF B;  5F04 A;  5HLT A;  2WV0 A;  2IRF G;  2QSF X;  3IHU A;  3IRR A;  4U87 A;  3OIQ A;  1DUX C;  2PMZ A;  5FKN A;  4EVI A;  2VPR A;  2D5V A;  3R0A A;  1SFK A;  3E6M A;  4C3J J;  2DOA A;  2EFQ A;  4GRI A;  3JSP A;  2M0C A;  2X85 A;  2NS7 A;  2FJ1 A;  1K79 A;  2GIZ A;  1FWZ A;  4XLP F;  2QQA A;  3FXR A;  3KET A;  4L5I A;  2IT0 A;  1WVR A;  1A6Q A;  3H35 A;  3N97 A;  1T95 A;  2JN6 A;  3WGI A;  2P6T A;  4M3F A;  3M07 A;  1UFM A;  1AKH A;  4CCL A;  1RZ4 A;  1ZN2 A;  2K9Q A;  2Y0S A;  4RAF A;  3G1L A;  2IVM A;  1FOY A;  2ZJR F;  3IUO A;  4M74 A;  5KK1 A;  3DP7 A;  1ACI A;  3A0B C;  2BW3 A;  2CW8 A;  2BE5 F;  3ECO A;  1WKM A;  4OIQ F;  1FIP A;  1FYM A;  1S29 A;  1YJW I;  3WHC A;  1WI3 A;  4IJA A;  1VQN I;  2R5Y A;  3FXL A;  1W0T A;  2O9L A;  2ELK A;  2XGX A;  3A4C A;  3FM5 A;  4JX6 A;  3FXJ A;  1TW2 A;  2L54 A;  3QPH A;  4HNV A;  1IUY A;  1WH7 A;  2ECC A;  4HW0 A;  1IJW C;  3GTK J;  4ZTJ A;  2X51 A;  3OV8 A;  3P9I A;  1G59 A;  2HXI A;  3QPT A;  2ZXI A;  2EFP A;  1TWA J;  2E60 A;  1DPU A;  1S6L A;  2DT6 A;  3ULQ B;  4E7H A;  2JA2 A;  5BNG A;  4CHU A;  3IH2 A;  3OYM A;  3MZY A;  4BXX J;  3WTW C;  4I01 A;  2JVH A;  3C3W A;  3BG5 A;  1FNN A;  2CYY A;  1WPK A;  4UUT A;  4QIW N;  2MLG A;  4P9F A;  5JR3 A;  1LQ1 A;  2L9N A;  3JRC A;  4KDP A;  3HOV J;  4XR6 A;  3KP2 A;  4ESF A;  4RBO A;  3OYG A;  4FHT A;  1VTN C;  3PNY A;  3KZZ A;  4JYK A;  5IY5 H;  5HOD A;  5BPD A;  1NG7 A;  2LRE A;  4ITV A;  4DYC A;  1V5G A;  3JRI A;  2KDZ A;  2NS8 A;  3TDU C;  2VE8 A;  4AVZ A;  4IHS A;  5TGT A;  2YR2 A;  5FD6 A;  3DEW A;  2OQR A;  2KRH A;  2FBK A;  2LKX A;  2LY2 A;  3KYL A;  4OOI A;  2DW4 A;  1IRX A;  2WAD A;  3UNG C;  3ZQ7 A;  3ZQQ A;  5BPI A;  1RUN A;  4IHV A;  4HEA 2;  1FOK A;  5KAF C;  3OOU A;  2UXN A;  3FHN A;  3NWS A;  1UCR A;  3DTK A;  3HYI A;  1ETX A;  3KYD B;  1WJF A;  3DBR B;  3SZP A;  1EA3 A;  2ME0 A;  5F08 A;  5E79 C;  5DUI A;  4HF2 A;  3CC2 I;  4XIC A;  3BCB A;  4A6E A;  1LB2 A;  4M6X A;  5HDG A;  3WGG A;  3BR5 A;  2VBW A;  5EJC A;  3CME I;  2JRM A;  2DDA A;  1VQ5 I;  2CMP A;  2M1B A;  2X1C A;  1JUP A;  3E5U A;  2H8R A;  3FK6 A;  1ZG3 A;  3P9C A;  3ZQF A;  4OU0 A;  4B1R A;  4CZC A;  4D1Q A;  2COB A;  2HR3 A;  3PFI A;  2R5Z B;  5DM6 F;  1LDK B;  3REO A;  4KIT B;  1X4O A;  3OR2 C;  3RZO J;  2LK2 A;  2L7Z A;  3KEY A;  3S1M J;  1T2K A;  1U9O A;  1MJ9 A;  3F8F A;  2VON A;  2M9H A;  3LSJ A;  4G7O F;  3HG9 A;  1JI8 A;  3W6V A;  4XSX F;  2VC0 A;  4UV9 A;  3CO7 C;  2CH0 A;  2TRT A;  3FMR A;  4OAZ A;  1K6Y A;  2X1E A;  3L9F A;  3MQ0 A;  2PG4 A;  3OYD A;  2QKL B;  1P4W A;  1OYY A;  1YX5 A;  2PX9 A;  4PFP A;  3F3X A;  5LFA A;  1R1U A;  2EB7 A;  1YIT I;  2IW5 A;  2LH9 A;  1Z3X A;  1SFU A;  1O4X A;  4EJW A;  2O5R A;  3BTL A;  3FMQ A;  3MKY B;  1VQK I;  2DQL A;  4MFE A;  2JUG A;  1Q1H A;  1H9T A;  4RB1 A;  2VKV A;  2F5E A;  4M3B A;  2CWE A;  4IX7 A;  2VQH A;  3CDI A;  1UG2 A;  4LIU A;  1JT6 A;  2KLO A;  3PNT A;  1U9N A;  2AQE A;  4ZZD A;  2HEO A;  6PAX A;  4BJ6 C;  3O8H A;  1GV5 A;  2V4J C;  1DP3 A;  4BXF A;  1I1S A;  2HTS A;  2Z99 A;  4U0V A;  4B3A A;  2MGQ A;  1LNW A;  2R5Z A;  2AXL A;  1SAN A;  2Y30 A;  3OYN A;  1IXS B;  4C3H J;  1UEL B;  3TW6 A;  4EGZ A;  3NEU A;  3GLL A;  4XNF A;  3JAM K;  2V6E A;  3S16 J;  5LD2 C;  4EGY A;  2H1K A;  2L3D A;  2JSP A;  2XAQ A;  4HA8 A;  4BS9 A;  1X58 A;  2HGC A;  1BW5 A;  3OY9 A;  2R93 J;  3F22 A;  1MBE A;  4A5N A;  2DA3 A;  4HLY A;  2ELJ A;  2DAO A;  4DJA A;  2VIX A;  1BBY A;  3CF2 A;  1XGS A;  3RYP A;  5KHD A;  4R79 A;  3RTR A;  2XAJ A;  2K4J A;  2LP0 A;  3H5N A;  9ANT A;  4LMY A;  3KEQ A;  4H0E A;  3FKJ A;  1Z7L A;  4UUS B;  3DXJ F;  2X6Y A;  3CDH A;  4I02 A;  4R1H A;  1M1E B;  4KT6 A;  1X3W B;  3VEP A;  3QAH A;  2O03 A;  3H0D A;  3GZN B;  4HX7 A;  3FXO A;  2PQ8 A;  3M8J A;  4HF0 A;  3OS2 A;  1A35 A;  3B73 A;  2HWV A;  4HOB A;  3L2W A;  3CC7 I;  4HAM A;  3H9G A;  3KP5 A;  1PDN C;  2NYX A;  4IF4 A;  2MD5 A;  4A69 C;  3VOD A;  1XX5 A;  2P0W A;  2KL4 A;  2E5N A;  1RR8 C;  3Q0U A;  2JJ7 A;  1YW7 A;  1U5T B;  2HDD A;  2PFB A;  4ESB A;  2GM4 A;  4NUB A;  2JRT A;  3MKW B;  1CQT A;  5FKL A;  2PEX A;  3GME A;  1AA7 A;  2D2W A;  3IKT A;  1E3H A;  4BYY A;  2HXO A;  1E3P A;  2QGU A;  2E7W A;  3FBI B;  3FDY A;  3ZCO A;  1HBX G;  3SQN A;  2HOT A;  3TP0 A;  2DT5 A;  2I10 A;  2FXA A;  1K6O A;  2ECB A;  3MCZ A;  1TWH J;  2KJC A;  3KCC A;  2PJR B;  4L18 B;  4MLO A;  4JX4 A;  5H6Q A;  4A3K J;  2IP2 A;  3BG9 A;  5EDN A;  1LDJ A;  3HL2 A;  4DBR A;  2W84 A;  4P96 A;  1OMI A;  2LY9 A;  5B5E C;  4UUS A;  4B44 A;  1DDN A;  4ABZ A;  1Y6I A;  3M4O J;  3BP8 A;  3HBL A;  5M5W J;  4XID A;  4D5C A;  3I59 A;  2M7A A;  1R9T J;  4XLA A;  1JKO C;  4B43 A;  4OIR F;  2OZ6 A;  1DPR A;  2F4O B;  2FNP A;  3M7G A;  5K5R A;  2QBY B;  4LLL A;  2BZT A;  2HKX A;  2QLZ A;  4BKX A;  2QZ8 A;  3NQO A;  3ZQL A;  1QRY A;  3CUQ B;  3TO7 A;  5JLW A;  1MBK A;  2DT7 B;  2DMU A;  3K6G A;  4XK4 A;  3BTI A;  4UVC A;  5J1U A;  4WCG A;  4RA2 A;  1ZKG A;  3WG9 A;  1VQ6 I;  5D5U B;  2ESN A;  4BAY A;  1YW8 A;  2FBI A;  1G2H A;  2WC2 A;  4NQW B;  4ASN A;  4CDG A;  5L3F A;  1V54 H;  1XG1 A;  4AWX B;  1B8I B;  4EM2 A;  3DV8 A;  2K86 A;  1QA6 A;  4A3M J;  4L9N A;  2UUZ A;  1BIB A;  4XN0 A;  2EIM H;  3TOB A;  5KNL A;  4BEH A;  1RET A;  3NAU A;  1B4A A;  1WI9 A;  1WRJ A;  2O3F A;  1XN7 A;  4GYI A;  2Q8K A;  4FE4 A;  2HS5 A;  5GAG J;  2E19 A;  4CUG A;  2PJR A;  1FP1 D;  1VF9 A;  4A3B J;  3CCY A;  1W5S A;  4TV7 A;  1HW1 A;  1GXP A;  2R7O A;  1DU6 A;  4ZDL A;  3UKG A;  3JTH A;  2KP6 A;  1QVU A;  2ZSH B;  1GV2 A;  3FIS A;  3SYT A;  3CCJ I;  1X1A A;  4PK4 A;  3RPQ A;  4ESJ A;  5DYM A;  4BU2 A;  1FSE A;  1XCV A;  4RS8 A;  3MN2 A;  2BY0 A;  2Y75 A;  2PN6 A;  2ZJP F;  3A1Y A;  1P2F A;  5GPA A;  5ILS A;  2PMH A;  1X4P A;  2XVC A;  4YIR X;  2VN2 A;  1QPI A;  1D0Z A;  4MTD A;  1HLV A;  2QA4 I;  3BR3 A;  2KFD A;  2P5K A;  3JRE A;  3CUQ A;  3ELK A;  2R7S A;  2K4B A;  2XSD C;  1TW3 A;  4BQO A;  5K7Z A;  4HF1 A;  1QNT A;  3X2Q H;  1OCO H;  2LD5 A;  3J7A Y;  4IXA A;  1U5T C;  3LQR A;  4NQW A;  2TDX A;  3D1N I;  3BR2 A;  3BZC A;  2LDU A;  2A5W A;  1CF7 B;  2W00 A;  5E1Z B;  1B8I A;  1RIO H;  3A03 A;  2VKD A;  5ICG A;  2DJN A;  3TGN A;  1K4T A;  5LRS A;  4AIK A;  3HRT A;  4CCJ A;  4S05 A;  2F5C A;  1OYW A;  4B4C A;  1MNM C;  1SD6 A;  4CIC A;  4NBQ A;  2E7X A;  1X1B A;  2KIM A;  2QUF A;  1U0J A;  3WTV C;  3I4P A;  2RVC A;  3FKI J;  4D7N A;  3VYR B;  2IGO A;  2XB0 X;  2C6Y A;  2YX4 A;  2BGC A;  1LDD A;  1FZP B;  1GDT A;  3CTA A;  1EJ9 A;  4N4O B;  3V7C A;  1EH8 A;  3DPT A;  5E8I A;  4LB5 A;  1I6X A;  4PSW A;  1P92 A;  2A6T A;  1QZY A;  4LLG F;  4N4N B;  3S1Q J;  3GXO A;  1X2M A;  1Z67 A;  2XAS A;  2FF4 A;  2KPM A;  2OU2 A;  2EZL A;  3BZK A;  4A6D A;  1BJZ A;  2OZU A;  1UHS A;  4IO9 F;  2AHQ A;  2M4G A;  4YG2 F;  2STT A;  2IA1 A;  2JK3 A;  4D0P A;  3F8M A;  2B0L A;  3CUQ C;  1L0O C;  3HOW J;  1X2N A;  5CVU A;  3K9T A;  4M9Z A;  3ZQC A;  3RKY A;  1RKT A;  1UMQ A;  1XMX A;  2Y48 A;  1H89 C;  2E1C A;  5EZG A;  1R1V A;  5DEQ A;  5GAD J;  1MSE C;  1JTX A;  1HC8 A;  3PJR A;  2VT2 A;  3QPS A;  1CF7 A;  3BG3 A;  2ZFW A;  1IDY A;  3LL7 A;  2R92 J;  3RI4 A;  4LFU A;  4Y15 A;  4GO1 A;  2WWY A;  4I76 A;  3K70 C;  1XGO A;  1N75 A;  3ZQH A;  5EGO B;  2LG4 A;  4YII A;  1QZE A;  2IXS A;  1K4S A;  5FLX Z;  1JGS A;  2DFF A;  4BHP A;  5DD4 A;  2NOJ B;  3S2D J;  1VQP I;  3DU6 A;  2VAS A;  4ENN A;  1PVE A;  4HV5 A;  4UB6 C;  4WXH A;  1ZR4 A;  3R61 A;  1ZAO A;  3PM1 A;  5M3M J;  3ZR8 X;  3OYF A;  1O3R A;  4RM3 A;  3C18 A;  5D5X B;  4BQN A;  1L3L A;  4ZC3 A;  1XCB A;  2AQF A;  3IKV A;  3RSN A;  5BS6 A;  2VE9 A;  3BLY A;  1YYV A;  3FWE A;  2XF5 A;  1ON2 A;  3VOE A;  1USS A;  2FSW A;  2XDV A;  2K9S A;  1D1B A;  4MEY F;  1R1T A;  3FF5 A;  3GZ5 A;  1FMV A;  5EEA A;  4C30 A;  2JPC A;  1LVA A;  2XAU A;  3CLO A;  4II2 A;  3PO3 J;  2XIG A;  3ZOB A;  2CQ7 A;  4LB6 B;  1YRN A;  2XKO A;  2CJJ A;  4HBL A;  4F91 B;  4ETS A;  2VJ4 A;  3QOP A;  5D4S A;  3BC8 A;  4JQF A;  4A0Y A;  1TT0 A;  2M87 A;  2M8E A;  3ZP5 A;  5J4Y A;  2VBY A;  2K02 A;  5E18 F;  5DCF A;  4HDU A;  1Z91 A;  1PP7 U;  5E3L A;  1JUS A;  3Q9S A;  4R8H A;  5DCM B;  3U2R A;  5DUK A;  4A0Z A;  2X6O A;  3DBL B;  3P9K A;  3LNQ A;  4B3X A;  5EGO A;  3MKZ A;  3F72 A;  1OCT C;  1YLF A;  3AG2 H;  3BR6 A;  3FXQ A;  4DOZ A;  2EZH A;  3JRD A;  5JHU A;  2JWT A;  2W57 A;  2DK8 A;  1XSX A;  3M1E A;  4KA4 A;  2CU7 A;  3ABM H;  1D0X A;  3QRF F;  2FML A;  3ABL H;  2M2E A;  4F7Z A;  3SEQ A;  5ILU A;  1LKX A;  4BHB A;  3OMY A;  1D1A A;  2R0Q C;  2PI0 A;  2CV0 A;  1AWC A;  2GOX B;  3CES A;  3DF8 A;  2WB1 A;  3W3C A;  4RGU A;  4EAT A;  2HDC A;  1BOB A;  3HM5 A;  1JKP C;  2L7F P;  2Y69 H;  1BI3 A;  1RES A;  5FRO A;  3O8G A;  1MBJ A;  2TCT A;  3JRB A;  3W6K B;  1IN6 A;  1UAA A;  4I2O A;  2KT0 A;  1XGM A;  2DFH A;  2EIL H;  1OPC A;  5K7H A;  4ON0 A;  4M6V A;  2X1D A;  1O3S A;  4OAY A;  1I5Z A;  4PSX A;  2DOF A;  5IP6 A;  3R4K A;  5J1R A;  2L9V A;  5KCM A;  5DCM A;  1IGN A;  3IRQ A;  3W2A A;  4WK8 F;  4DNC A;  1KQ9 A;  1QVT A;  3BY6 A;  3T0Y A;  1XMK A;  2ZO4 A;  1IN7 A;  3A01 A;  3DTE A;  5D8K B;  2Z33 A;  2XPW A;  4XRS A;  4XOP A;  5D8L B;  2P7C B;  3TP3 A;  5FD5 A;  1R5G A;  4D9J A;  3J7Y J;  3CJT B;  4PFO A;  3FHZ A;  3HOU J;  3ONQ A;  4BQA A;  1GT0 C;  3L1P A;  4JK1 X;  4GFB A;  1PP8 F;  1R49 A;  5D6F A;  2L7K A;  2FX0 A;  2E2I J;  2CV1 A;  1MMN A;  1NK2 P;  3QQA A;  3JR9 A;  1OR7 A;  3H9Q A;  1MBG A;  3L09 A;  4E7Z A;  3OIP A;  1KZH A;  4IPA A;  3SZT A;  1BC7 C;  3H9J A;  2E1M B;  2DI3 A;  2OV7 A;  4BE2 A;  1IRF A;  2LY1 A;  1APL C;  4AVP A;  4OIP F;  1QHG A;  2KRC A;  1YJN I;  4JOM A;  1K7A A;  4MQV A;  3G4S I;  2DMQ A;  4FE7 A;  2FEZ A;  2CS3 A;  2H1L A;  2QEN A;  2M45 A;  2WBM A;  4JX5 A;  4AD9 A;  5B66 C;  2VQL A;  3V7R A;  3I54 A;  4U88 A;  5FRN A;  3ZGK A;  5IYC J;  2GA2 A;  4IQJ A;  1FTZ A;  5B1B H;  4RLQ A;  1BR2 A;  4E70 A;  4XLC A;  1PUE E;  2DO7 A;  5IP7 J;  4N9H A;  3K0L A;  1MZB A;  3RQI A;  1N78 A;  3SZG A;  5F1R A;  1BW6 A;  3CC4 I;  2DA2 A;  1J5Y A;  2KQR A;  3DFG A;  3DKW A;  4EJO A;  2L2O A;  3AG3 H;  5LGN A;  2WTE A;  5F1J A;  2F4M B;  1B72 B;  2HTJ A;  3WE3 A;  2HQN A;  2DOE A;  2VBZ A;  3EUH A;  2JPB A;  2M34 A;  2RNG A;  1OR7 C;  3DPL C;  4Y33 A;  1VFC A;  2LFB A;  3S1N J;  4IZZ A;  3G2B A;  1U78 A;  5LHI A;  4U0Y A;  1QGP A;  1V3F A;  4U0W A;  2VI6 A;  3CDL A;  2HDW A;  3TMO A;  2VLA A;  1J75 A;  2CFX A;  2DMP A;  4OMZ A;  3WTT C;  1O3Q A;  1RRJ A;  5IT3 A;  3OYI A;  1G3Y A;  1S7O A;  3HGG A;  4DBQ A;  1XMA A;  4XOR A;  2XPV A;  2OUM A;  2XKP A;  1J7K A;  2MW8 A;  4G6Q A;  2OAZ A;  3RCO A;  3Q5F A;  1WJA A;  1BL0 A;  3L7W A;  3OYK A;  4L0Y B;  2IGN A;  4CA0 A;  3H36 A;  1QZZ A;  4E7L A;  4Y7N J;  1SAX A;  2H6C A;  2ACJ A;  3HGY A;  2IGK A;  2CV2 A;  2EFN A;  1DQU A;  2H6B A;  1VND A;  2IJL A;  4FQG A;  2CGP A;  2NVQ J;  1JKQ C;  1ERD A;  2LLK A;  1SMY F;  3I53 A;  3S2W A;  4BDZ A;  2XB5 A;  2Y9Z A;  1IG7 A;  4I7H A;  1DP7 P;  1B72 A;  4BUP A;  1SVO A;  3CO6 C;  3S14 J;  1LJ9 A;  5HNH A;  2NVY J;  3EUH C;  4JP0 A;  2HYG D;  1ONV A;  1HA8 A;  3SHF A;  2VXZ A;  4JBA A;  4Z6Y A;  4N0B A;  2DFE A;  2DN0 A;  1W7P D;  2K40 A;  1HCR A;  4F92 B;  3RDI A;  3GTO J;  5FLX K;  2YU3 A;  4HNU A;  2R7V A;  3LA2 A;  2MD0 A;  2JA8 J;  4IRI A;  4Y52 J;  2H09 A;  4ZDP A;  4IRG A;  3AFH A;  3TW7 A;  1KYZ A;  4AIJ A;  1VI0 A;  2NVU B;  1MBH A;  4CCN A;  1TT5 B;  2A6H F;  1FPQ A;  3RKX A;  1YHQ I;  5LEJ A;  3S3M A;  4C9Y A;  3ZMV A;  5HDK A;  3BTC A;  3PUF A;  4Y3O A;  2EBI A;  4L9J A;  3WG7 H;  3B02 A;  4WX9 A;  3BTJ A;  3JRA A;  3HOX J;  5E1W A;  2YS9 A;  2HOS A;  2IS2 A;  2GWR A;  5HS7 A;  2YPR A;  5GTI C;  3KFW X;  1B9M A;  2VJJ A;  2V1D A;  1I27 A;  3MWM A;  4V19 K;  1SAU A;  2RGV A;  5LRR A;  2PMU A;  5CPR B;  2DXI A;  3AKZ A;  4I09 A;  2YX7 A;  4BL0 B;  4BE1 A;  5GP9 A;  3S15 J;  2KZV A;  5HNF A;  2XGC A;  1SD4 A;  3HSE A;  1EV7 A;  4NNJ A;  2VKH A;  4UV8 A;  4A3J J;  2MG4 A;  4IHX A;  2DTR A;  1IDZ A;  2G7H A;  3ECH A;  1RI7 A;  5E17 F;  4HQE A;  1WHU A;  3LSR A;  2E2H J;  4ZYA A;  1GLN A;  3KPH A;  4UUV A;  2M3A A;  5FKK A;  4F52 A;  1Z6T A;  5AON A;  5E20 A;  4ZDO A;  3ML6 A;  3GYH X;  1GHC A;  3IH4 A;  3L2V A;  2QQB A;  4E4H A;  4B47 A;  2OC6 A;  2A69 F;  4IQ4 A;  3V42 A;  5CVV A;  3T1B A;  2E35 A;  2ZJQ F;  4BE0 A;  2X4H A;  4YFN F;  4L5J A;  4M9S A;  1ZRD A;  2O6G E;  1ITY A;  2DYR H;  2ISY A;  2PBI A;  1WH5 A;  1FBS A;  2QWW A;  3C2H A;  3MKL A;  4XKC A;  4XRM A;  4P1W A;  3S93 A;  2A05 A;  4XQF A;  3K1N A;  3BQZ A;  5E3M A;  1C0W A;  3SFZ A;  3NRV A;  3WTZ A;  2QSG X;  5K5O A;  2M30 A;  2FD5 A;  4RB2 C;  3TQN A;  1BM9 A;  2Z9O A;  3RKW A;  1JT0 A;  3LSI A;  3T5X A;  3F9K A;  5IOY A;  5DD8 A;  5L3G A;  5GAE J;  1DU0 A;  1EKE A;  2LTP A;  3I5U A;  4CCM A;  2IS4 A;  3ZN1 A;  2BVL A;  4HX8 A;  3LST A;  2R3S A;  3WTX C;  4E7I A;  3KLO A;  1I3Q J;  2JA5 J;  5FLM J;  4PJM A;  4AID A;  1YW9 A;  4CGZ A;  3DWL E;  1QHH D;  1XDU A;  4F55 A;  3IV5 A;  4MFD A;  2RRE A;  3JRF A;  3PQJ A;  4Y4R A;  2VT3 A;  2K9M A;  1R4N B;  2HZD A;  4KYW A;  4G6D A;  3A02 A;  3U9G A;  3B6A A;  5KVR A;  3ERM A;  2FOW A;  2FNA A;  2F5F A;  3E0J B;  3WHB A;  1IN5 A;  1ETO A;  1ZGA A;  2ZXH A;  3PO2 J;  2BEO A;  3FX3 A;  1Q1V A;  3HIF A;  5K7F A;  2OCC H;  5H20 A;  1F1Z A;  3V8L A;  1XDS A;  1MJA A;  2ZXW H;  2V79 A;  3FXM A;  3HPG A;  3M8E A;  1WJC A;  2ISZ A;  3DCF A;  2OTL I;  3WOD F;  1Z77 A;  2ETH A;  1FBU A;  1PJR A;  3ZMU A;  5E3O A;  2RKH A;  5L3E A;  1VQL I;  4FX0 A;  3J7Z I;  1A36 A;  3I59 B;  3K2Z A;  4BQQ A;  2DQR A;  2L9R A;  3GUD A;  3OYL A;  3QYE A;  2XRO A;  5H6R A;  3FK7 A;  3E6C C;  2KZG A;  2OTJ I;  4IHW A;  1FOW A;  1V5F A;  1MMS A;  5J40 A;  2E1O A;  1B9N A;  3BRO A;  3F8B A;  5GTH C;  3JRH A;  3M8F A;  2B63 J;  1YG2 A;  5M5X J;  3BPX A;  1YIO A;  2R4G A;  2O8X A;  4G6T B;  4WWC A;  2Y0M A;  1LE8 A;  4KUM A;  3HHH A;  2R7T A;  2YUS A;  3K4C A;  4EJV A;  1HXD A;  2A3S A;  3RJP A;  4RB3 C;  5CVI A;  3SDG A;  4Y13 A;  3DLA A;  4CCO A;  5B1A H;  2GLO A;  1FY7 A;  3J80 Z;  5F64 A;  4EJT A;  3RIR A;  4BEH B;  4UXN A;  3HRU A;  1TWG J;  5J8F A;  2HI3 A;  1T8I A;  4IHY A;  1KU7 A;  4IKF A;  5FKO A;  5GAH J;  3C7J A;  3LWF A;  1N77 A;  1ODD A;  2W82 A;  3BDD A;  4KMU X;  1KU9 A;  2KRF A;  3HUG B;  5FKM A;  3ZN0 A;  4FCY A;  1MSF C;  3C2G A;  4CYC A;  1RC9 A;  3QOD A;  2D1H A;  4ENM A;  1JUM A;  2UWM A;  3QP6 A;  1SMT A;  3GF2 A;  4YEL A;  2QQ9 A;  3IWF A;  4HV6 A;  4W1U A;  2LOO A;  3S32 A;  1FOX A;  3DQV C;  3TO9 A;  1LFB A;  2RV8 A;  2H94 A;  3M3Y J;  1KQ8 A;  1TQP A;  1ULY A;  1GXQ A;  1HDP A;  3HHG A;  5TJJ A;  5D4R A;  4YRV A;  3BT9 A;  2LNB A;  1OCR H;  4N9I A;  1HOM A;  2EV6 A;  4HZF A;  4D5F A;  1R23 A;  2CW7 A;  1MMD A;  3MMY B;  4YEJ A;  1JGG A;  2BBY A;  4E7K A;  1FYK A;  2F2E A;  2KJB A;  4P9U A;  1WJ5 A;  5L3B A;  1OKR A;  2EK5 A;  5GPC A;  4A0X A;  2X9D A;  2XF6 A;  3GW2 A;  4XKW A;  4YFX F;  2L02 A;  3Q0V A;  3I58 A;  1U6G A;  4RLF A;  4KIS A;  3HOZ J;  1KU2 A;  3ZQG A;  2JZY A;  3KP7 A;  3E6B A;  4M73 A;  1S7A A;  1IXR C;  3SXY A;  4MGR A;  3PIP F;  1IXC A;  4B48 A;  1ZRF A;  4Z2Y A;  2FMY A;  2CG4 A;  3HUG A;  2DU9 A;  3G3Z A;  4NHJ A;  2EIN H;  2ZFU A;  1TQI A;  1OCZ H;  2MH2 A;  2A07 F;  1POG A;  4HRI A;  5D6E A;  2HQR A;  1Y1V J;  2XUB A;  2A61 A;  4HST A;  3SJM A;  5DM7 F;  1KON A;  3L2C A;  1LPQ A;  4HYE A;  3DEU A;  2N8G A;  1NK3 P;  3F23 A;  4GXO A;  3LAP A;  3L2Q A;  1R00 A;  2DBB A;  4QTR A;  3BPV A;  1Z6R A;  4EM1 A;  1BJA A;  4FIS A;  4MNU A;  3K4B A;  1B6A A;  1VZ0 A;  3HRM A;  5IT9 Z;  1UHM A;  1XGN A;  1BIA A;  2XGD A;  2ZCW A;  1KQ0 A;  1TL8 A;  4EEF G;  2G9W A;  1QU3 A;  1B59 A;  1X1P A;  3GX4 X;  3VWB A;  2KKO A;  1TC3 C;  1D8K A;  5HLI A;  3KP6 A;  1FYL A;  2BXY A;  2LSO A;  3PNV A;  3MVP A;  5ILV A;  3E5X A;  3ZPL A;  4A5M A;  2EIK H;  2ID6 A;  1I39 A;  4KN7 X;  4BNC A;  5DDG A;  2K9L A;  2STW A;  3K70 D;  3LA7 A;  1YS6 A;  2FUG 2;  4OWR B;  1JXS A;  2KMU A;  5L3C A;  4ENJ A;  3VSL A;  3IAM 2;  4G8X A;  2MC3 A;  3S17 J;  4KN4 X;  4AU7 A;  5CLS A;  1GUU A;  2LRD A;  4Q47 A;  2A68 F;  4E7S A;  1PYV A;  4XON A;  5LGU A;  5LLQ A;  4IL6 C;  1G8X A;  3EPZ A;  3D5L A;  4WXC A;  1FEX A;  2LVS A;  2F5V A;  2VUM J;  1R36 A;  4XRS G;  1XB4 A;  1YRN B;  4AM3 A;  3H1C A;  3K1P A;  3U21 A;  1S9H A;  3KEO A;  1IUF A;  2JSC A;  2QEX I;  2PJP A;  2VBX A;  3HZJ A;  2L01 A;  2QCO A;  3EUA A;  3LA3 A;  5HLG A;  4IVN A;  5ED4 A;  1S72 I;  3CP2 A;  5AIP A;  3GEZ A;  1QPM A;  3LSM A;  5FO5 A;  3S1R J;  4RGS A;  5HS8 A;  1Z05 A;  1Z0X A;  4LGW A;  3BCA A;  2V6C A;  3B6C A;  1XPX A;  1HKS A;  3OYJ A;  2P5V A;  3HSF A;  5FFZ A;  4A12 A;  4OIO F;  1W36 D;  3AG1 H;  3LSG A;  3CMY A;  4RDU A;  5CKT A;  1IV6 A;  2HU9 A;  1O57 A;  1SC7 A;  1ETV A;  4I6Z A;  2F5D A;  1TBX A;  3WE2 A;  3LSP A;  3E7L A;  1LUJ B;  2LYC A;  3KP4 A;  1ORK A;  3VYU B;  2KIQ A;  2XC7 A;  4XLH A;  2VQG A;  2BYV E;  1XSV A;  3H5A A;  3KYC B;  2HVQ A;  3J7A O;  4AIH A;  3HB9 A;  3DKX A;  4BJT A;  3KZI C;  5CQG A;  1J59 A;  1I50 J;  1ZH5 A;  2YSR A;  2BV6 A;  1VQ4 I;  3RPU D;  2E36 A;  4IOC F;  1S3J A;  1UB9 A;  3P7N A;  1AOY A;  3CQZ J;  4UB8 C;  2ZC2 A;  5JHF A;  3TL4 X;  2EFO A;  1NH3 A;  5E3N A;  2HVS A;  4ZYG A;  1G3W A;  3AL0 B;  1V4R A;  1QBJ A;  1MW7 A;  3A01 B;  2ME6 A;  4B09 A;  1UJ8 A;  2W85 A;  2LKP A;  1F4K A;  4QLC U;  2P6S A;  2G0E A;  1W0U A;  3JTG A;  5LHH A;  2E71 A;  3CJR B;  2XRN A;  3ZMD A;  4O6J A;  3K7A J;  4A3G J;  1G6N A;  1W4M A;  1RR7 A;  1ZG1 A;  3VPR A;  1Y0N A;  2K27 A;  4LJZ F;  3AAF A;  1K61 A;  4S0H B;  3J80 K;  1ZYR F;  2L4A A;  5CVR A;  3I0T A;  1D5Y A;  1MKM A;  2J5O A;  2V1X A;  2HOA A;  2XAF A;  2JMW A;  4FX4 A;  4LOC A;  2GA1 A;  3LFK A;  4V2F A;  2BY3 A;  4V2G A;  4W97 A;  4A2U A;  1HDD C;  5B3S H;  2ICW G;  4B8X A;  1OLT A;  4EMS A;  1WJE A;  3FXK A;  1A6I A;  5LHG A;  4KJZ A;  1SFO J;  3CCU I;  3Q9V A;  1A5J A;  2JA6 J;  2XF7 A;  3H3U A;  4ZH4 F;  2IA2 A;  2P7V B;  3MZH A;  1T0F A;  4Y17 A;  5JI6 A;  3HDD A;  1SD5 A;  3BWG A;  3FZV A;  2E34 A;  4XM3 A;  4EJU A;  2Y0S N;  1FP2 A;  3F8C A;  4MIM A;  1S7E A;  4M6Y A;  4CO8 A;  1FBQ A;  2IPQ X;  1ZTR A;  4PCQ A;  1HF0 A;  2ZNY A;  1YO5 C;  3RYR A;  2I8D A;  1W5T A;  4DZJ A;  3L2R A;  2JT1 A;  2UZK A;  1O7F A;  2DJI A;  2EH3 A;  1HQC A;  3H0G J;  2CUJ A;  3R6S A;  1JTY A;  5F0C A;  4E6K G;  3CCV I;  2Z16 A;  2HFH A;  1A31 A;  3KZY A;  2DCE A;  4HQM A;  4I0B A;  4C2M J;  1YS7 A;  5LGT A;  3GTL J;  2FQ3 A;  2GOM A;  3M9A A;  4LG0 A;  2ZNZ A;  2IS6 A;  3K4J A;  4LIV A;  1TP4 A;  2COM A;  3O3K A;  2RN7 A;  3IWZ A;  3OYH A;  2CSO A;  1HW5 A;  2NXN B;  3HEF A;  2LR8 A;  1ZLK A;  3OSG A;  2DA5 A;  4DZP A;  2O7O A;  3HC7 A;  1QO0 D;  3FXU A;  4ZYE A;  2W1O A;  4RM2 A;  3F8N A;  2QVO A;  4C2T A;  1ZQ3 P;  1D1C A;  2R7D A;  1SEU A;  1T0F C;  3OOP A;  4Q4Z F;  3AL0 C;  2FRH A;  2Z3Y A;  2B9S A;  4PJJ A;  2LF8 A;  4PJ0 C;  1A04 A;  3A2K A;  1ZG5 A;  5IT9 K;  4KIC A;  5J1Y A;  2NRA C;  1E17 A;  3PUB A;  3E6D A;  4FAS D;  3G71 I;  2YU9 J;  2H8W A;  3MD2 A;  3S2H J;  2A5Y B;  1W5C C;  3QYF A;  5IOZ A;  4RMN A;  3OYC A;  1R5H A;  3PQK A;  3HKZ N;  5K1Y A;  2L0K A;  5HLH A;  2JVG A;  2AO9 A;  1X1C A;  2DA6 A;  1J09 A;  2NNN A;  5C44 J;  3CCE I;  4IOA F;  1P7J A;  3Q0W A;  2HOE A;  1Y1W J;  3HJE A;  3EET A;  1F36 A;  3KIO A;  3N4M A;  4L9T A;  3COA C;  2EJR A;  3WU0 A;  3F6V A;  1MDM A;  3QOE A;  1T98 A;  2EIJ H;  2D45 A;  1W7P B;  5F6F A;  3BJO A;  4DIQ A;  3WU2 C;  1D0Y A;  3KX2 A;  4M3G A;  2OA4 A;  1T56 A;  2CFO A;  4M3D A;  3CUO A;  3WTY C;  1YFH A;  1H8A C;  2RDP A;  3E97 A;  1O7L A;  3ROU A;  2CUZ A;  1SFX A;  3I4N J;  5TIS C;  1K83 J;  3QP5 A;  1DGW Y;  2QF7 A;  1BC8 C;  2XAG A;  2HPM A;  2EA2 A;  4ANJ A;  3RQ4 A;  1Z9C A;  3OL3 A;  3CCR I;  5E8G A;  3I3L A;  4GGG A;  4ZTF A;  2LBF A;  1PUF B;  1ZRE A;  4C2U A;  3ABK H;  3W6J B;  2EZI A;  1TWF J;  2EQR A;  3HPH A;  2JQ7 A;  3K1M A;  2V1U A;  4GDF A;  2VOO A;  3GTG J;  4X6A J;  2B7E A;  2ZB9 A;  3ZXS A;  2IGM A;  3BJ6 A;  3E3V A;  3D0S A;  1FC3 A;  1RPW A;  1YOV B;  3I71 A;  2GBY A;  2VKE A;  2VOD A;  4S04 A;  4EV0 A;  2BY1 A;  4GYG A;  2VC1 A;  2E1M C;  5KAI C;  3VDX A;  5BQT A;  3EDP A;  1UZC A;  4BHC A;  4G12 A;  1KGS A;  3ZQI A;  3W2V A;  3PSI A;  1D5V A;  1R58 A;  1W7P A;  2MYS A;  2DA1 A;  3QWL A;  2V9V A;  4O5V A;  1WWX A;  3OIO A;  1BI2 A;  2IS1 A;  2K5C A;  3LMM A;  5A2Q Z;  1BN5 A;  1LEA A;  3K4M A;  4XLN F;  3S8P A;  3BR0 A;  1FLI A;  5L3D A;  1HKQ A;  4G7H F;  3S3N A;  4LLN A;  1KU3 A;  1OJL A;  2BY2 A;  2RQP A;  3DU5 A;  4HSR A;  3WTS C;  3H3Z A;  2O0Y A;  2F4I A;  5K5Q A;  2A6E F;  2FOK A;  1Y8Q B;  2P4W A;  2QQ8 A;  3EYY A;  3HXL A;  2HQA A;  3ABT A;  3JCU C;  4C3I J;  2MAB A;  5EF6 A;  1IC8 A;  3HKZ A;  3LQQ A;  2P8T A;  2HZT A;  5TRD A;  1MMG A;  1FJL A;  3E5Q A;  3J81 Z;  2WAF A;  2LMD A;  1PUF A;  3ABU A;  4DYR A;  2W25 A;  4I99 C;  1N25 A;  4M71 A;  2BVM A;  1GVD A;  1TLH B;  1WQ2 A;  2K85 A;  1R4M B;  2R7F A;  2F6C A;  1SFE A;  3MFK A;  2O61 A;  1E0E A;  3K2A A;  2R7X A;  2L9S A;  4A93 J;  2AS5 F;  2CO5 A;  4BH9 A;  2ZJ2 A;  3QPL A;  1TWC J;  4WF2 A;  3SFI A;  1ETY A;  3D5S C;  1Y56 A;  5FFX A;  1TNS A;  3GLX A;  4OIN F;  4NC8 A;  4PZJ A;  4BGD A;  4UHT A;  1WJD A;  2V7F A;  2WV1 A;  3CJN A;  5BMZ A;  4E7J A;  3V8J A;  2DMT A;  3BG6 A;  3WGH A;  1X19 A;  4H4K C;  1U3E M;  4UVB A;  3JSO A;  4QPO A;  1J9I A;  4LIT A;  1D3Y A;  1STZ A;  3BQY A;  3FBN B;  4KIF A;  5DV5 A;  1MNE A;  1S5L C;  4AYB N;  4HDV A;  2RAE A;  3V7S A;  4NC7 A;  5FJ8 J;  3JRG A;  3GTQ J;  2L4M A;  4DYQ A;  4UNO A;  4ENK A;  2HYF A;  2RQQ A;  4BXU A;  5IYD J;  2HQ5 A;  2PLY A;  2R7U A;  2CQQ A;  2MFZ A;  2WAE A;  3DEE A;  2QKM B;  4K2E A;  2W7N A;  2KHM A;  3DPU A;  1JJ8 C;  4BDY A;  2EA4 A;  1K78 B;  3NWT A;  2Q2E B;  5HVQ C;  1YX3 A;  2KIS A;  1F5T A;  3HTU A;  3LOC A;  1ZLJ A;  2IA0 A;  2M4K A;  2Y9Y A;  4HX4 A;  1MBF A;  4XKV A;  1LFP A;  1WZ2 A;  2EWN A;  2OQG A;  2ZKZ A;  1LE8 B;  1WSU A;  4UY8 I;  2M0M A;  4BBS J;  2QSH X;  5EYR A;  3IAS 2;  4F3Q A;  5HOO A;  3I9V 2;  3WTU C;  1JKR C;  4MEX F;  2DFI A;  4RAG A;  4FT8 A;  4ZJZ A;  2ESH A;  1T08 B;  2DLL A;  2ZME B;  3KE2 A;  3TBI A;  3MZ8 A;  1Y39 A;  4PGH A;  1OCC H;  4NB5 A;  3QYB A;  3H3V K;  3G73 A;  1TZL A;  3NAR A;  3QU3 A;  4HLX A;  2HNH A;  5F27 A;  3H5R A;  4L0Z B;  1MH4 A;  2AXT C;  3HOY J;  4CYC B;  1YQA A;  3IP4 B;  3RZD J;  1WFX A;  1IF1 A;  4PJN A;  2NVX J;  1AHD P;  1I6H J;  3I56 I;  3VYS B;  1VQ8 I;  2X0L A;  3DKY A;  3TO6 A;  2W48 A;  2VXD A;  4DQ2 A;  5D5V B;  1ZK8 A;  2D1V A;  4CCK A;  4G7Z F;  2GXG A;  2Z5U A;  2DOD A;  1IAW A;  5LEK A;  5BOX A;  1I1G A;  1K78 A;  1BOA A;  3JW4 A;  2Q2E A;  4X0G A;  2GXA A;  1R7J A;  4PGG A;  1F43 A;  2OBP A;  1HST A;  5H2F C;  4DGW B;  1ETK A;  2XV4 S;  2IAI A;  4D7M A;  5CYV A;  4QPQ A;  3TOA A;  2G7U A;  3T8R A;  4IRH A;  3ZRG A;  5JVG F;  4RGR A;  2M7B A;  1UHW A;  1ON1 A;  4BY1 J;  1O3T A;  4AYB A;  2ZME A;  3BZ6 A;  1TTY A;  4DW6 A;  2V1N A;  1KA8 A;  4G9Y A;  4L9V A;  1R22 A;  2VJI A;  3GTJ J;  1IZ1 A;  2DYS H;  4EQQ A;  1RNL A;  3E1S A;  1FIA A;  1YE9 A;  4BBR J;  1EH7 A;  4G94 A;  1P7I A;  3OS1 A;  1P4A A;  4IHT A;  4F93 B;  2MBF A;  2JUC A;  4XLF A;  3D5R C;  2W4S A;  2M8G X;  1MIJ A;  5EG0 B;  3OYB A;  4J00 A;  3HOS A;  2XAH A;  1W1W E;  1LFU P;  2HVR A;  1BR1 A;  4FET A;  3CD6 I;  5FGM A;  1YTY A;  4RAZ A;  2V9P A;  5CQE A;  2Y31 A;  3FIW A;  5ICF A;  5J3L A;  3SDB A;  4J01 A;  1E2X A;  2CW0 F;  4A3E J;  2OPT A;  5J8C A;  3CJQ B;  1P9Q C;  1Y0U A;  2ID3 A;  1U8B A;  2DPD A;  1FSH A;  2K3P A;  4RB0 A;  1G3T A;  4KMF A;  2GQQ A;  3FM3 A;  1OCP A;  1OFC X;  3OL4 A;  2ZME C;  4Q5S F;  3H92 A;  1OIS A;  4LK1 F;  1BR4 A;  2VPL A;  1ZHF A;  2DMN A;  2F48 A;  3N05 A;  2GZW A;  1HW2 A;  1GVJ A;  5M3F J;  4A3L J;  4J19 A;  4M3E A;  2Z2S B;  3LSH A;  3T8T A;  4XL9 A;  1YJ9 I;  2EV0 A;  1U5T A;  3I55 I;  2V9K A;  5JLX A;  5E1X A;  4XBF A;  4CZZ A;  3OR1 C;  1ZAR A;  4II3 A;  4PJL A;  5HS9 A;  1UG0 A;  3F0C A;  4KFC A;  5JFR A;  3WU1 B;  3VSK A;  1IN4 A;  2XGE A;  1X3U A;  5EG0 A;  2FE3 A;  2IEK A;  2O8K A;  2WY7 Q;  3GFL A;  5A2Q K;  1IRZ A;  3K4N A;  3G6E I;  3TED A;  4LD5 A;  5IP9 J;  2R7R A;  1MD0 A;  4HNT A;  3I4M J;  2CUF A;  1R5I D;  3DBH B;  3GFJ A;  4QSH A;  1Z7U A;  3K10 A;  4RGX A;  1MND A;  4U7D A;  1VQM I;  1TNT A;  2WAQ N;  1MGT A;  2K9N A;  1SD7 A;  2H27 A;  1S8N A;  3EYI A;  1IW7 F;  1G4D A;  1XC5 A;  1FT9 A;  1TQM A;  1YI2 I;  1FTT A;  3GBG A;  4GCV A;  2QBY A;  1EH6 A;  1ZGW A;  2RNJ A;  3KLN A;  3J81 K;  2HPI A;  5C4X J;  3VFZ A;  1QQI A;  4AC0 A;  1VQ9 I;  5LBQ A;  3GTP J;  4L5E A;  2CQN A;  2WY8 Q;  4NDL A;  3TDZ C;  3VB2 A;  4EM0 B;  4NC6 A;  3LAJ A;  2CQK A;  3GZ6 A;  3CCM I;  1P4X A;  1JHF A;  3C2B A;  1J0R A;  4CYD A;  3I64 A;  1XSD A;  2XSJ C;  3HSR A;  4CSW A;  2NS0 A;  2K3F A;  2K7L A;  2OCE A;  4KNY A;  2Z1D A;  5F0F A;  2VL8 A;  2GIV A;  4MQ9 F;  1AU7 A;  1ZRC A;  3ERE D;  3SEZ A;  3BOQ A;  4BY7 J;  3HTS B;  2QM3 A;  5CVJ A;  4LG3 A;  2DDB A;  2ELH A;  1MH3 A;  2EFW A;  4BAC A;  5JVT A;  2NNY A;  3CLQ A;  2FU4 A;  1ZR2 A;  1VQ7 I;  5FB2 A;  1XTA A;  2XPU A;  2NVT J;  3IH3 A;  2E1N A;  2LC2 A;  3OSF A;  1MMA A;  4XMY A;  5IYB J;  2EPF A;  1JE8 A;  2KIU A;  1U2W A;  3CCQ I;  1KYW A;  1H88 C;  5ERI A;  1RKW A;  2VJ5 A;  5DS9 A;  1OQY A;  2ADU A;  2RC4 A;  4IEJ A;  1I3A A;  3GCM A;  2E2J J;  2QYO A;  2R7Q A;  4O3M A;  2WB1 N;  4ZYD A;  2LF7 A;  5EZH A;  5HDN A;  1LEB A;  2V26 A;  2OF7 A;  4U7B A;  3KP3 A;  3PL8 A;  2NOG A;  3A0H C;  3O2P E;  2Y2Z A;  2M5W A;  1F9N A;  2L5Q A;  3MAJ A;  5M5Y J;  2FBH A;  2E5Z A;  3IC7 A;  2MH9 A;  2CUE A;  2BOL A;  4I0A A;  1NHA A;  3ASN H;  5FRM A;  2OD5 A;  2Q0O A;  2R7W A;  4A3F J;  1H9G A;  3C1D A;  5F0H A;  4XN3 A;  1SVL A;  2ZSI B;  2WAQ A; 
#chains in the Genus database with same CATH homology
 3CCL I;  3G6E I;  3G71 I;  5GAH J;  2H8W A;  1VQ6 I;  1VQM I;  5GAD J;  1HC8 A;  3CCE I;  4IOA F;  5JVG F;  1QA6 A;  1YI2 I;  1FOX A;  1VQP I;  5GAE J;  1VQ9 I;  3J7Y J;  3CJT B;  5GAG J;  3PIO F;  3CCM I;  3CCJ I;  2QEX I;  3CCU I;  3CC2 I;  2K3F A;  1S72 I;  2ZJP F;  3CME I;  1YJN I;  1VQ5 I;  2E34 A;  2FOW A;  3CCR I;  2QA4 I;  3CC7 I;  3CF5 F;  1VQO I;  1YHQ I;  3G4S I;  3PIP F;  3CD6 I;  1VQ7 I;  5DM6 F;  2JQ7 A;  2OTL I;  1FOY A;  2ZJR F;  3CCQ I;  1ACI A;  4UY8 I;  1VQL I;  3J7Z I;  5DM7 F;  4V19 K;  3CCV I;  1YJW I;  1VQN I;  2OTJ I;  3CC4 I;  1FOW A;  1Y39 A;  1MMS A;  1YIJ I;  1YJ9 I;  1VQ4 I;  2E36 A;  4IOC F;  3I55 I;  1YIT I;  2NXN B;  1VQK I;  3CMA I;  3I56 I;  1VQ8 I;  3DLL F;  4IO9 F;  2E35 A;  2ZJQ F;  3CCS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...