4BY7J

Elongating rna polymerase ii-bye1 tld complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4by7J00
4XRSG 3A03A 5EDNA 4B1RA 2L7MP 2GBYA 3WHBA 3HDDA 1UMQA 1U8BA 1R9TJ 3S16J 2R5YB 2XGDA 2DTZA 3DEWA 5K7FA 4JX6A 5GP9A 1B72B 5IPAA 4ABZA 5DS9A 3TW7A 3ZQHA 3TEDA 5EZHA 5F0FA 4M3GA 3OSGA 2DMPA 4DYRA 4AC0A 5IYDJ 2TCTA 3BTLA 4FTHA 3S14J 2JMWA 2R92J 2NVYJ 1GVDA 1IDYA 1ETWA 1IUFA 5M3FJ 2K9NA 5EEAA 2FQ4A 3QPLA 3BR3A 4FE7A 4D5CA 1MH3A 4C2MJ 3BQYA 3HKZN 3WHCA 1QPIA 1OCTC 3GTKJ 2CUEA 3VPRA 3GTJJ 3GTOJ 1A5JA 2DA7A 5E3OA 4MLOA 3HGGA 3A02A 4UUSB 4DZJA 3S2DJ 1U78A 3S17J 3ZQCA 1E3OC 4UUTA 2LLKA 3CCYA 1H8AC 1NK3P 4IHWA 2HI3A 3HBLA 3BG5A 2M34A 1VNDA 2HDDA 5F1JA 2O9LA 3SJMA 3HM5A 5E3NA 3OIOA 1W0UA 5EF6A 4A3MJ 1IJWC 3W6VA 1IDZA 5FKMA 1JTXA 1QVTA 3HOYJ 1I50J 3QPSA 1IV6A 3HOVJ 3LOCA 3GTGJ 3S2HJ 2M9HA 1ETKA 4JP0A 2JA6J 3BR1A 1AKHB 2ECCA 2YU9J 2Y31A 2DA6A 3HB9A 5EGOA 1MBJA 2JK3A 2VI6A 4A69C 1QRYA 2HOTA 1PUFB 1B8IB 4A3LJ 4CYCB 1RKWA 2AO9A 2EQRA 3A01B 1HF0A 3BR6A 2LP0A 3ZOBA 1MNMC 1XC5A 2EZIA 3SFIA 1HOMA 2R5ZB 3I4MJ 1ZQ3P 3NAUA 1VI0A 5EZGA 1Y1VJ 3Q0VA 3SDGA 5E3LA 1MSFC 1YRNB 2IBDA 3MVPA 5FKNA 5FLVA 1K83J 4QTRA 3TW6A 4A3IJ 5C4XJ 5IYCJ 4XIDA 4D7MA 2E2JJ 3GTMJ 5BNGA 2WV1A 2G0EA 2MG4A 1ZR4A 1POGA 4W1UA 2E2IJ 1RESA 2YS9A 2NVQJ 2K9QA 2E19A 4M3FA 1VF9A 3NARA 3C2BA 2Y9YA 4FISA 3G1OA 1TWHJ 1ENHA 2DJNA 2L9RA 3FISA 2R0QC 1H88C 5IP6A 2NS7A 1ORKA 2WAQN 3TP3A 5IOZA 2EZKA 2P81A 1GDTA 1IGNA 2K9SA 2R93J 3RKQA 4NDLA 5M3MJ 2VKVA 5JLXA 1O4XA 1TWCJ 2JA8J 4IHVA 4X1EA 1JKOC 3BG3A 4DW6A 1P7JA 1LFBA 1WPKA 2EZHA 1ZTRA 5FKLA 1RPWA 2R7ZJ 5M5WJ 1GV2A 2KT0A 4G12A 4I76A 1JKPC 1RR7A 2RAEA 2LKXA 3GBGA 4A3DJ 4GFBA 2E2HJ 2EBIA 4MFEA 3OSFA 1GT0C 2NVTJ 1NK2P 5FJ8J 1WH7A 2LVSA 3E7LA 3FIWA 1ZKGA 2FD5A 3LSGA 3PM1A 1WI3A 3B6CA 3BR5A 3M3YJ 3JR9A 4FCYA 3S1RJ 1FIPA 1A6IA 1U9OA 3S1NJ 2IEKA 3MKLA 3F0CA 4C3JJ 2FX0A 2M0CA 3TP0A 3ZQLA 2COBA 4RDUA 4BBSJ 1JGGA 3ZQFA 1JUSA 1D5YA 5JLWA 2XSDC 1MBKA 5FKOA 3BTIA 2XPUA 1MBEA 3B6AA 2DA5A 3PO2J 2D5VA 3H0GJ 4Y52J 1U9NA 3FKIJ 5J1YA 2X9DA 4M3DA 3S15J 3FK7A 3BTJA 1H89C 4V2GA 3HGYA 3ZQIA 5C4JJ 4M3BA 1NTCA 5FKKA 4FE4A 2DA2A 1MBHA 2W48A 2VUMJ 2VKEA 4BBRJ 5DTDA 1IC8A 4MIMA 3Q0UA 1GV5A 2NVXJ 1ITYA 2HOSA 3BTCA 3GTLJ 2CUFA 3BT9A 4Y7NJ 1Y1WJ 4IHYA 1HCRA 4EEFG 3GTPJ 2YUSA 2L7FP 5J3LA 2N8GA 2QCOA 1X58A 2L0KA 1OCPA 1BW5A 5EGOB 1Z0XA 1JJ6C 2E1OA 1UG2A 5EYRA 5EG0A 5M5XJ 1Q1VA 1VFCA 1LE8A 2ID6A 4AYBN 4BY7J 3JRFA 5C44J 4DYQA 1TWAJ 3HOUJ 1TWGJ 1JKQC 5J1UA 1RKTA 3K2AA 1X2NA 2CQQA 2LR8A 1WH5A 2DA1A 1K61A 3O8HA 2HXIA 3Q3SA 4IHXA 1HDPA 2B63J 1ETYA 2ME6A 3BQZA 1ETQA 1W0TA 4JYKA 2CQXA 2NS8A 2XPWA 3O8GA 2R5YA 1JKRC 3JREA 2QF7A 1B72A 3IH2A 4JX4A 3LNQA 1SFOJ 3RZOJ 3RQIA 4A93J 5E3MA 2MW8A 2DMUA 3G1LA 1UHSA 2JA7J 2DMNA 2DN0A 4C3IJ 3I4NJ 5F0CA 1OJLA 1F36A 1JUPA 5IYBJ 2AHQA 2XB5A 1QVUA 1WGXA 4XRSA 3FK6A 3G1MA 1JTYA 2I10A 3IV5A 2O7OA 4S0HB 4I6ZA 3JRDA 1JJ8C 3JRIA 4BKXA 4A3CJ 4BXXJ 2CJJA 5F0HA 4A3BJ 1OFCX 1Z77A 3BR2A 2XRLA 1T56A 4A3JJ 2ZB9A 3JRAA 3PO3J 3CQZJ 4UUSA 4M3EA 3BR0A 3JRBA 2TRTA 1RETA 1HLVA 2LY9A 3QQAA 2DA3A 3LSJA 3BG9A 5C3EJ 1GUUA 1FEXA 3IH3A 1ETXA 1G2HA 2O8KA 1IRZA 2LD5A 1TWFJ 5IP7J 3H3VK 1P7IA 2WB1N 2M2EA 4MFDA 3OOUA 5K7HA 1MH4A 1MBFA 2K40A 2IAIA 5IP9J 1SANA 4HNVA 3L1PA 2MSYA 1AKHA 4C3HJ 2Y30A 4RBOA 1BJZA 2X48A 2HOAA 3Q0WA 1CQTA 1ZR2A 3LSRA 1ETVA 1ZK8A 3CMYA 1TC3C 1BA5A 1EF4A 1F43A 1AHDP 5HODA 2GM4A 3GTQJ 3JRGA 4W97A 1AU7A 1PUFA 2JN6A 1B8IA 1APLC 4CYCA 1XS9A 2H8RA 1I3QJ 2XB0X 2VPRA 3A01A 2KDZA 2DA4A 3MN2A 2DMQA 4V2FA 1S7EA 2R5ZA 2DMTA 4D5FA 2L7ZA 1JUMA 2XPVA 2HQ5A 2ME0A 2XGEA 1MSEC 2HXOA 2OPTA 4A3GJ 1YRNA 2FJ1A 1X2MA 3DCFA 4D7NA 4XK4A 3IH4A 2Y9ZA 2X6OA 2XGCA 3HOXJ 3S1MJ 3D1NI 2MGQA 1LFUP 1IG7A 2LTPA 3JRCA 4A3KJ 2ECBA 1I6HJ 2OF7A 3CDLA 5F08A 1XG1A 1HDDC 1DU6A 5F04A 2NOGA 1FJLA 3S1QJ 1ZGWA 2JJ7A 4DYCA 1T33A 4AUXA 1JT6A 1WCMJ 2Y0SN 3HOWJ 2LK2A 4B3AA 5IOYA 4J19A 3ZQGA 4L5EA 4MO7A 2CRGA 2Y2ZA 1DU0A 1BW6A 5F27A 4M6VA 4QIWN 5J1RA 2HYJA 1FIAA 4XRMA 4DZPA 2ID3A 4IEJA 3LSPA 1ETOA 2ELKA 2H1KA 2PMZN 5GPAA 3RZDJ 3JRHA 2JWTA 4A3FJ 5FLMJ 2GLOA 3HOZJ 4X6AJ 4XICA 1FTZA 4JX5A 3HEFA 5EG0B 2JA5J 4BY1J 3UKGA 1LE8B 4A3EJ 2EZLA 4B4CA 9ANTA 3K7AJ 1JT0A 2M8GX 5K7ZA 4LOCA 5M5YJ 4QSHA 2EH3A 2CU7A 2LFBA 1FTTA 5GPCA 3M4OJ 1MBGA 1BL0A
chains in the Genus database with same CATH superfamily
4CHUA 5EDNA 3BCBA 3HSRA 4M9ZA 3HDDA 2FNAA 4GCVA 1PVEA 4RGSA 4A0ZA 4V19K 1U5TC 3S93A 2I8DA 2XGDA 2DTZA 3DEWA 2ELHA 3HTUA 3OIQA 1TNTA 4JX6A 4LIVA 4ZYEA 5GP9A 5DS9A 3TW7A 3GFMA 3ZQHA 2HTSA 5EZHA 5F0FA 2STWA 2PJPA 1R36A 2EV0A 3K70D 2TCTA 2ZMEC 4Y33A 2JMWA 1GVDA 1ETWA 1K6OA 4JK1X 5HDNA 4HV6A 2GIZA 2K9NA 5EEAA 4XSXF 3CP8A 3E6DA 3BR3A 3CJRB 2VBYA 3PQJA 4D5CA 4F92B 2D1VA 4BACA 2E71A 1DPRA 2GOMA 2AQEA 1Z9CA 3HKZN 1ZGAA 2WAFA 2DFEA 4HX8A 3RKYA 2YSRA 1RC9A 5KAIC 2CUEA 1TBXA 1MJBA 1SFXA 2O8XA 3GTJJ 2DA7A 3BJ6A 2JTVA 4UUSB 2A6HF 1N75A 3F3XA 2H27A 4C2TA 1NK3P 3A0HC 2OU2A 4HEA2 4IHWA 2E34A 2HI3A 3QU3A 3BG5A 3ABMH 3L9FA 3IRQA 2HPIA 1W0UA 1MGTA 2K7LA 4BQOA 1IDZA 4S04A 2FOKA 1QVTA 4HNUA 1LDKB 5FLXZ 3Q9SA 4CCJA 2V1XA 1V5GA 4UVBA 3CUOA 3S2WA 2M9HA 1SEUA 2JA6J 4CGZA 4XLPF 4BE0A 1BBYA 1HQCA 3HB9A 4UXNA 1BC8C 1T0FA 2HGCA 2XUBA 2R7WA 1D0YA 3LA2A 2VI6A 1LJ9A 1D8KA 4IX7A 3A2KA 3RPQA 2HOTA 5DCMA 2RNJA 3U9GA 3ROUA 1XGOA 3DXJF 4N0BA 2HR3A 1LEBA 1D3YA 1EH7A 3AG3H 3MAJA 1HF0A 4UV8A 3RTRA 4WCGA 3JCUC 2KISA 4PJJA 3I4MJ 3NAUA 4KJZA 3Q0VA 3FXUA 1MSFC 3QYBA 3ZMUA 3H3ZA 1TP4A 5FKNA 4IZZA 2PJRB 3HRSA 4KYWA 3HZJA 5DCFA 2FBIA 2JSPA 4XIDA 2HDWA 3G2BA 2RDPA 4M9XA 4BJ6C 2E2JJ 3DEEA 1EV7A 4R79A 3GTMJ 3J7AY 3C2GA 1U5TB 3I5UA 3I59B 3ZMSA 2VIXA 2MG4A 2DBBA 4F91B 4L9VA 1RESA 3RPUD 3P7NA 2NVQJ 2K9QA 3CCVI 4UV9A 3KX2A 1LKXA 3N05A 4XKVA 3NARA 2ZMEB 3KIOA 3P9CA 2X0LA 2Y9YA 1DP3A 4GO1A 4ZYHA 3G1OA 2DJNA 2PFBA 1WWXA 4IJAA 1OR7C 3GWZA 2UZKA 4OIPF 5BOXA 4R1HA 2DT7B 2L01A 4KISA 5B66C 2P81A 3QYEA 2K9SA 3RKQA 2BEOA 3LSMA 4NDLA 1G4DA 3L2CA 2VKVA 5JLXA 2NVUB 1KU7A 2LG4A 2Y0MA 2BOLA 2GA2A 1RR8C 3V7SA 5H2FC 1TWCJ 1WJDA 3KYLA 2HOEA 3CCRI 1ON2A 2W24A 2EJRA 1WPKA 2VQCA 4MTEA 1RUOA 1WFXA 3TDZC 2V1NA 4KUMA 3KZIC 3E6MA 4G12A 2XAGA 2KHMA 4CA0A 3ZN1A 1JKPC 1RR7A 3CLOA 4IO9F 1S6LA 2MD5A 3WTZA 2CV1A 4GFBA 1QPMA 2Z1DA 3D0SA 1C0WA 4L9JA 3MKWB 2DQRA 1Z3XA 2IS2A 1T6SA 5B1BH 2QBYB 1ULYA 5JR3A 2IGMA 3VODA 1LPQA 3M8FA 4I0AA 3CMAI 2DPUA 3PM1A 5J40A 1WI3A 2L9VA 3QOEA 1WVRA 3FBNB 1E3PA 1FIPA 2PMHA 4LIUA 1SVLA 2AQFA 3D5SC 1ZGJA 4RAFA 5J4YA 5J8FA 2KP6A 3QRFF 3MKLA 1D1CA 2HYFA 2QENA 3KETA 4Q4ZF 2M0CA 4O3MA 1TQIA 2COBA 1KU9A 4RDUA 4XKCA 1JGGA 4XKBA 2EINH 3U2RA 5GAEJ 3IKTA 2ZJRF 5JLWA 1D5YA 4XM3A 2XSDC 5LGNA 3FWEA 5L3FA 3PNVA 3TMOA 3RQ4A 1BR4A 2DA5A 4Q5SF 2O61A 2ETHA 4EJUA 4UVAA 1GXQA 3H0GJ 4KT5C 2L4AA 3FKIJ 4PUSA 5LGTA 2VT2A 3DKWA 1FSHA 1Y6IA 4M3DA 3FK7A 2ZXIA 3TL4X 5DD8A 4M3BA 3R6SA 4QPOA 3DU6A 2L5QA 1I3AA 2IGNA 3KLNA 3K4KA 3HTSB 3EDPA 4HF2A 1IC8A 3FF5A 3U21A 4HF0A 2A5YB 2HS5A 2CQKA 2NVXJ 4EM0B 3GFLA 1BN5A 1BR2A 4O6JA 4MTDA 3OL4A 1J09A 4Y7NJ 3Q5FA 1Y1WJ 2YUSA 4P1WA 1SMYF 5J3LA 5HLIA 2L0KA 4OU0A 1LNWA 2DPDA 3FM5A 2XAUA 5DEQA 3E5QA 3ML6A 4IXAA 3KZZA 5L3DA 2X1DA 5EGOB 3MFKA 2E1OA 2Q1ZB 3NWTA 3R0AA 1WSUA 5EG0A 5DDGA 5M5XJ 4BDYA 1ODDA 5C44J 1E0EA 5EEGA 2HU9A 2CQQA 1Z6TA 2EIKH 1IN6A 2ZSIB 3CCJI 2E36A 3KZYA 2IVMA 2QQAA 3VYSB 2BY3A 4ZC3A 2B63J 1HDPA 1ETYA 2EFNA 3D5RC 2VBXA 2LSOA 5AONA 2EWNA 4OINF 2ME6A 5HDKA 3KEYA 4F3QA 5A2QK 2Z9OA 1W0TA 4OAYA 4JYKA 4ZDOA 2CQXA 3OL3A 3SEQA 1Z21A 4L9NA 1BM9A 3U1DA 3OYCA 2R5YA 1UCRA 3SZGA 4KMFA 1D0ZA 1B72A 4JX4A 5L3BA 3LNQA 1SFOJ 2WADA 3V8KA 2I5UA 5E3MA 2GZWA 3GMEA 2E5NA 2HEOA 1XN7A 2CFOA 2DN0A 3AL0C 2L9NA 3I4NJ 2KMUA 1D1AA 2HTJA 5F0CA 1JHHA 1JUPA 5IYBJ 3HKZA 3VYTB 3BZ6A 1UJ8A 1WJFA 2XB5A 1WGXA 2FBKA 3K1MA 1S3JA 1XMXA 3KP6A 3JSOA 3G1MA 3CC2I 2XROA 2V4JC 1ZHFA 2PBIA 2DT6A 4AM3A 3HJEA 4NUBA 3VEPA 2LMDA 1HW2A 3JRIA 3EUHA 1WJAA 4G94A 2VJ5A 2L54A 1W5SA 1S29A 3IWZA 1HA8A 2MH2A 2RC4A 4EGZA 4BXXJ 2Q0OA 4ZJZA 3LFKA 2W85A 2OQGA 5KNLA 4A3JJ 1X1AA 2OCEA 5JVGF 3VSKA 1TTYA 3BR0A 3ONQA 2E7WA 2P8TA 5LEKA 3W2WA 2LY9A 3HC7A 1TQPA 5C3EJ 3WTUC 3EPZA 1SVMA 3S8PA 4HV5A 3OYNA 2A07F 2DYSH 3H3VK 3OYKA 2K5CA 1MW7A 2FMYA 2IGKA 5K7HA 2CSOA 2IA2A 3EYYA 4I98B 4HLXA 2ZJPF 2MSYA 2R7RA 1AKHA 3JW4A 3AFHA 4AU7A 4B44A 4P5OA 2CW8A 1ZR2A 1EF4A 1ZK8A 2WWYA 2ZBKA 1BR1A 2MFZA 5HVQC 3HUGB 3GTQJ 3ZQ7A 2WC2A 4W97A 1AU7A 1XS9A 1QNTA 2BHZA 2LBFA 1I3QJ 2XB0X 2VPRA 3W3CA 3A01A 2CWEA 2BHYA 2W1OA 4XRFA 1S7EA 4BE2A 3DTKA 2XPVA 1L0OC 2F5EA 3PFYA 1MMSA 2HXOA 2OPTA 1IV8A 4H4KC 2IGOA 3S3OA 3BDDA 1TW3A 4D7NA 5L3EA 4AYBA 4MEXF 2OC6A 3A1YA 2Y9ZA 4RA2A 2IA1A 4EJWA 3REOA 5K5OA 1MMGA 1B59A 1A04A 3R4KA 2BV6A 2BBYA 2DDBA 1U3EM 1LFUP 2ECBA 4G7HF 2OF7A 2NNYA 2DFFA 3CDLA 2F5DA 2R7OA 4LG0B 2AXTC 3WTVC 1UFMA 3S1QJ 2VQHA 3AL0B 4DYCA 3GZ5A 5FLXK 2QQ8A 1A31A 3PL8A 4AUXA 5ILUA 5CKTA 4I7HA 1Q1HA 2Y0SN 3CZ6A 3WGIA 2LK2A 3CMMA 4N9HA 4Z2YA 1Y0NA 4MO7A 1DU0A 3WE3A 2JUCA 2RVCA 1GXPA 1SVOA 1IRFA 3H9GA 4DZPA 5CVRA 2MD0A 2ELKA 4DIQA 5E8GA 2H1KA 5GPAA 3RZDJ 2JWTA 4A3FJ 3HPGA 2GLOA 5TISC 5KVRA 1FTZA 5D5XB 2D1HA 2LRDA 3F8MA 5IT3A 3BPVA 5LGUA 4BY1J 3UKGA 4A3EJ 3BOQA 3K7AJ 2WA0A 3ELKA 2M8GX 2M3AA 2P6TA 4XLHA 3ERMA 4LOCA 1WQ2A 5M5YJ 2Q2EB 4QSHA 2CU7A 2JRMA 5HOOA 3CJTB 2EB7A 2FU4A 3T1BA 5D8KB 3BJAA 3KEQA 3KYDB 4RM3A 1VQOI 2E1NA 1U8BA 2X1EA 4E7JA 3DKXA 4B3XA 3HRUA 3BG7A 2LY1A 3HHHA 1FP2A 2OZUA 2QLZA 4PFPA 4XR6A 5EEHA 3ABTA 3M8JA 3K9TA 4DYRA 2EPFA 1NH3A 2ZC2A 2Y48A 3GX4X 3CC7I 4AC0A 5IYDJ 3LSKA 2V1DA 1DGRM 2NVYJ 2OUMA 2VPLA 1I27A 4IRGA 3J81K 2GXAA 5D6EA 2FQ4A 2R7DA 2F2EA 1ZARA 4FE7A 4G7ZF 1MH3A 3FBIB 2FEZA 2VOOA 4HNTA 3WG9A 4HW0A 1QPIA 2V6EA 3ZR8X 4ASNA 3MMYB 2QKLB 3WU0A 2UWMA 2VONA 3FXLA 1W7PB 3GTOJ 1A5JA 3E1SA 2CYYA 4M73A 2R4GA 1HKQA 3A02A 1V4RA 3GO5A 1O3SA 5FFZA 5FB2A 3S2DJ 3CCUI 3S17J 4DNCA 1GVJA 4R8HA 3RDIA 1E3OC 4UUTA 2LLKA 2LKSA 1YI2I 2R7UA 4RM2A 2HDDA 2DCEA 1GLNA 3CESA 5EF6A 1IJWC 1QGPA 4M72A 4ESFA 3TO9A 1S72I 1K4SA 1U8RA 4PSWA 3L09A 1IV6A 3OYIA 2IT0A 1ZH5A 2A3SA 3LOCA 4RGUA 3DBLB 2ZXHA 4BU2A 2BW3B 1IF1A 3BR1A 2PG4A 2VKDA 2YU9J 4FX4A 2KJBA 4F93B 4A69C 1QRYA 4YEJA 1PUFB 4A3LJ 3WU1B 3PIPF 1RZ4A 2FRHA 4CCNA 3LA7A 1Y56A 3CC4I 4KN4X 4ENKA 1R5HA 1ZQ3P 4I09A 3PNTA 2DYRH 1BI2A 2LYCA 3M1CA 5CQGA 5E3LA 2VXDA 2P7VB 3MVPA 4I2OA 5JVTA 3VYUB 2XAHA 3QPTA 3QPHA 5FLVA 1K83J 1CF7B 1QA6A 3F23A 3TW6A 3IWFA 5C4XJ 1UELB 1IN5A 1WI9A 5IYCJ 2XAFA 4PJNA 4IOAF 1XPXA 1AWCA 1YG2A 5FGMA 1R22A 4NB5A 5BNGA 2WV1A 2G0EA 1MMDA 3IC7A 4YFNF 3OY9A 2YS9A 2HVSA 3M7GA 4LLLA 1MD0A 2P5KA 4M3FA 4DJAA 3KP5A 1FNNA 3FMSA 3HRMA 3MZHA 4HSTA 5LFAA 5CLSA 2X1CA 5HNHA 4CDGA 3F6VA 3G3ZA 3LQQA 2R0QC 2HNHA 5D5UB 3FMQA 1HW1A 2R7XA 3TP3A 4F55A 5GTHC 5IOZA 1GDTA 5M3MJ 4NNJA 2JA2A 2EIMH 5L3GA 4RS8A 2DTRA 1YE9A 3TGNA 4AD9A 2JA8J 1T38A 1K78A 1JKOC 2O0YA 4DW6A 4BHCA 3IHUA 2CW7A 1WJBA 1LFBA 1IXSB 2R3SA 3BC8A 4LITA 1RPWA 5FKLA 1GV2A 3WE2A 4CZCA 2Z33A 2KIQA 4HX4A 3N97A 4M6YA 2ISYA 4XL9A 3JAMK 3CJNA 2XAQA 4LFUA 3SHFA 2M87A 4ZYAA 1MMNA 4BQNA 3H9JA 4RAGA 3RPUA 1SMTA 2JT1A 4KMUX 2DOEA 2L2OA 3F22A 2HVRA 5FJ8J 3W2AA 1V54H 3OYJA 1MIJA 4ETSA 4F7ZA 2PX9A 3LSGA 4RLQA 3BR5A 2P5LC 3OYBA 2BY0A 3BY6A 1QHHD 1VQ9I 5CVIA 1CGPA 1W4MA 3L00A 1HW5A 2VODA 1YJNI 2IEKA 2O3FA 3T8RA 2QGUA 2F6CA 4C3JJ 3MKYB 1XGMA 3ZQLA 2CW0F 4C30A 2Z2SB 4BQAA 3HPHA 4L9TA 2RNGA 1MBKA 2CV0A 3BTIA 4WXHA 4B09A 5BPDA 1ACIA 1X4OA 3RKWA 1LVKA 2CUJA 3FDYA 1U9NA 4G9YA 3FXJA 1USTA 3GZNB 1J5YA 4WXCA 3OV8A 2JVHA 2MYSA 4ZTFA 1R1VA 2IRFG 1T08B 5FD6A 3WODF 4ZZLA 4KFCA 2Y0SA 2YX7A 3ZQIA 3U1KA 5FKKA 3DBHB 3H0DA 1VQNI 4FE4A 2OJED 4JQFA 5ICEA 1MBHA 4FETA 2VKEA 1WJ5A 4BBRJ 2VL8A 2CFXA 4KA4A 1MJAA 4BDZA 1MKMA 3CUQC 3OR1C 1R23A 4MIMA 4HG2A 4XLAA 2X6XA 4IHTA 4P96A 2M1BA 1I1GA 1HCRA 1A36A 5LHHA 2L7FP 1I6XA 4EJTA 4IL6C 1YYVA 1VQ7I 4WK8F 1KQ8A 3AAFA 3PJRA 1N77A 3T8TA 5EYRA 5J47A 3ZP5A 1Q1VA 2NNNA 2V79A 2JZYA 1W1WE 5J8CA 1VFCA 1LE8A 2ID6A 3LSHA 3KCCA 4AYBN 3JRFA 5FROA 1EH6A 4DYQA 1TWAJ 1AOYA 1E2XA 3HOUJ 3SQNA 2CG4A 5J1UA 4Z6YA 4NC8A 2KRFA 1WH5A 2DA1A 4BS9A 3DP7A 3JTGA 2KZGA 5AIQA 1W7PD 1VQKI 3DWLE 4KN7X 3V4GA 3PSFA 1ZG3A 4XBFA 3BQZA 5GAHJ 2NS8A 2XPWA 3NRVA 2IW5A 3O8GA 4EQQA 4AIJA 1JKRC 2GXGA 1VQ5I 4CCKA 4LK1F 4CH7A 4EGYA 1UHSA 1UG0A 4DBRA 4MQVA 5DV5A 1H0MA 4U7DA 3QODA 4BE1A 1XDSA 1JGSA 3L2RA 2R7TA 1YX3A 1LDDA 2AHQA 4ZDLA 3IUOA 2R7VA 3EUAA 2E7XA 3P9IA 4AIDA 3LSTA 3NQOA 3KP2A 4ZH4F 2UUZA 4KITB 3IV5A 4S0HB 3JRDA 1D1BA 2ELJA 4Y4RA 2CH0A 2LREA 3H5NA 5K5RA 3K1NA 4WWCA 2M0MA 4A3CJ 2K3PA 3V7RA 3QOPA 3S3MA 4E4HA 2CJJA 4HZFA 4A3BJ 4EATA 1Z77A 3BR2A 4XKWA 4HBLA 5JHUA 3PO3J 2EV5A 5BQTA 1K79A 4UUSA 4M3EA 2TRTA 4AVZA 1S5LC 2XV4S 1HLVA 2CS3A 1BJAA 3OIPA 3ABUA 5IT9Z 3BG9A 3KFWX 1V5FA 5H20A 5JFRA 3I54A 1VQMI 3FHZA 1IRZA 3I0TA 1RNLA 3KEOA 3TKYA 1WKMA 2WB1N 3CUQB 4YFKF 2NS0A 3F8NA 2A05A 4G6TB 3CD6I 1MBFA 4NC6A 2FBHA 4U88A 1YLFA 5IP9J 1D5VA 5HS9A 1W5TA 2XASA 3L1PA 4OIQF 1OCRH 1G8XA 2DOFA 2X48A 1DP7P 3DTIA 1S7OA 1XMAA 1EKEA 2GOXB 3GLXA 3Q0WA 3LSRA 2JPBA 2QEXI 1CQTA 4ESJA 2HVQA 1F43A 4EJOA 4RB0A 2PLYA 2QYOA 2MLGA 3F8CA 3JRGA 2X51A 2JN6A 2C6YA 4CICA 3GLLA 1FOXA 4BEHB 1KGSA 2KDZA 4ANJA 2DA4A 2D2WA 3MN2A 4LG3A 4V2FA 1X3ZB 2FNPA 3VSLA 1JUMA 2ME0A 3CO6C 2HKXA 4RAYA 1XSXA 3CCMI 3DCFA 1T2KA 1R00A 2V6CA 4JOMA 3W2VA 2PJRA 1G3SA 4FASD 1D0XA 1PP8F 4BGDA 3F21A 3WTXC 4QWQA 3D1NI 1VQ6I 4P9UA 5HS7A 3P5JA 1SD7A 1W5CC 2KLOA 2ISZA 5JI6A 2O5RA 1HXDA 3M9AA 1U5TA 1N25A 2EIJH 3I59A 3G6EI 1YJWI 1MNEA 1I6HJ 1IRXA 4E70A 4B43A 4CUGA 3IAM2 2NOGA 5LRRA 4BYYA 1J0RA 1TW2A 2EA2A 5ERIA 2CMPA 4IRHA 1ZGWA 2JJ7A 2JUGA 2XDVA 3BZKA 1T33A 2F48A 2ZMEA 1MDMB 1WCMJ 3HOWJ 3GZ6A 2NXNB 3ZQGA 3HRTA 1MNDA 2UXNA 5F27A 4QIWN 1OYYA 3WGGA 2KFDA 3CLQA 1ETOA 3JTHA 3FXRA 3I3LA 1R49A 2MABA 1LQ1A 5E1XA 1YJ9I 3F72A 2KL4A 5FLMJ 1FZPB 1O7FA 3DBRB 4XICA 2QKMB 2G9WA 2QUFA 4M74A 1ZRDA 3GUDA 1J9IA 2IA0A 1OCZH 2EZLA 1TLHB 9ANTA 3F9KA 4E7IA 1ZRFA 2ZSHB 4WX9A 2XHKA 4YG2F 3I53A 1WZ2A 1NG7A 2DU9A 3CJQB 5L3CA 3FKJA 3DTEA 2LFBA 3H35A 3T0YA 1FTTA 3M4OJ 5GADJ 4BNCA 1DUXC 4XRSG 3JSPA 2B9SA 2QBYA 2GBYA 1UMQA 2F5FA 2XKOA 2KIFA 3S16J 2Y75A 2FQ3A 2DT5A 5IPAA 3N4MA 1FYLA 1XCBA 3PSIA 4GYIA 4AVPA 3OSGA 2EFQA 2DMPA 4G6DA 2XC7A 1ZRCA 2LOOA 3H5AA 2IS4A 5E79C 5ICCA 3S14J 2VJJA 2R92J 2COMA 2EK5A 5M3FJ 5LHGA 4PSXA 3QPLA 4A0YA 2BYVE 4II2A 3I64A 4ENNA 2DODA 4LLGF 1ZG5A 3WHCA 3J80Z 1I5ZA 4XNFA 3GTKJ 4I01A 3VPRA 5E8IA 3DLLF 1REPC 3VOEA 4P9FA 5E3OA 3WTTC 4HSRA 4MLOA 3HGGA 2L02A 4EMSA 5F6FA 1U78A 4ZTJA 3ZQCA 3PQKA 3ULQB 1G3TA 1H8AC 2VQLA 4IOCF 3MD2A 3GFIA 3OWTA 3HBLA 2M34A 1VNDA 4M9SA 3E0JB 3SJMA 3HM5A 5E3NA 3OIOA 2E5ZA 4A3MJ 1TL8A 4UUVA 1XCVA 1DPUA 5FKMA 1UB9A 5BPIA 4XQFA 1P9QC 3W6JB 2P5VA 3MEXA 1I50J 1U0JA 4HAMA 2LDUA 3HOVJ 5D4SA 3GTGJ 5KHDA 3W6KB 1UZCA 1ZYRF 4JP0A 4M71A 1OR7A 2Y31A 3AG1H 2L9SA 3K0LA 3SZPA 4B8XA 1Y8QB 1FY7A 2DA6A 1MBJA 1MZBA 1OCOH 1U2WA 5EGOA 2JK3A 4NC7A 1YS6A 3CTAA 3KE2A 5CVVA 5J6XA 1B8IB 4CYCB 5HDGA 1RKWA 2EQRA 1BI0A 1P6RA 1EA3A 3OMYA 2LP0A 2EZIA 3DF8A 2QSGX 1HOMA 2R5ZB 3I58A 3OOPA 4HPQA 2ZO4A 3ZRGA 1KU3A 2FSWA 2BVLA 4HF1A 2E35A 1YRNB 2H1LA 3V8JA 1X1BA 1XGSA 2RN7A 3CO7C 2LNBA 2ZXWH 5DD4A 2FOWA 2IPQX 3OYMA 2J5OA 4A3IJ 4ZDPA 1PDNC 1LVAA 2OQRA 4RGXA 2HZDA 3BCAA 1IN7A 3ZPLA 1XGNA 3FXQA 3M8EA 1G6NA 1PJRA 3J7AO 1ZR4A 1POGA 2F4MB 2E2IJ 3QU6A 4E7LA 1QU3A 3ZN0A 4YIRX 5IY5H 2E19A 1EH8A 1VF9A 2VT3A 1SD6A 4S05A 3ECOA 1IN4A 1V3FA 3C2BA 1K6YA 3I71A 1ZELA 1ENHA 2L9RA 3GEZA 3VWBA 2DDAA 5DYMA 3G71I 1Z1DA 2K4JA 3BP8A 1IRGA 2KDOA 2WAQN 3C3WA 3BLYA 3A0BC 1T0FC 1J59A 1KU2A 3HG9A 4L0ZB 1FBSA 1OKRA 1O4XA 3LMMA 1F4KA 4IHVA 2WB1A 3IP4B 4NQWB 4X1EA 2QQBA 3BG3A 4PCQA 4GDFA 1P7JA 2PQ8A 4OOIA 1ZTRA 3MZ8A 2O6GE 1W36C 3OYGA 2DJIA 2GA1A 2VOPA 4LGWA 2TDXA 1KZHA 3I9V2 5H6QA 1E17A 1TT5B 3C1DA 5K5QA 4RMNA 4X0GA 2RQPA 1Z7LA 2RAEA 1S7AA 2VBWA 1J75A 2MA3A 2E2HJ 2DQLA 5E18F 2UXXA 3BG6A 5ILVA 1VQLI 3BZCA 4DBQA 3ZMZA 3CCSI 4AIKA 1FLIA 2EBIA 2CO5A 2H94A 2LY2A 3MWMA 2OBPA 1NK2P 2NVTJ 1WH7A 3E7LA 1USSA 3CCLI 4QLCU 2A61A 1ZKGA 2FD5A 5TRDA 1JKQC 1FBUA 2HWVA 1BIBA 2G7HA 3M3YJ 2M7AA 2QM3A 3HUGA 4FCYA 3S1RJ 1R5ID 4XONA 1A6IA 2DXIA 2HQRA 5CJ9A 3S3NA 5ED4A 2VB6A 1SAUA 4UVCA 1KA8A 4NHJA 1EJ9A 1TT0A 4N4OB 3F0CA 3E97A 1UHWA 2P4WA 3ZQFA 4KNYA 3H9QA 2XPUA 4PGHA 4PDKA 3B6AA 3PO2J 3KP7A 3CDHA 2VLAA 5D5WB 2OTJI 4UB6C 1MJ9A 4HYEA 3V8LA 3H3UA 3S15J 2HKOA 2JQ7A 1F9NA 1X1CA 3ZQQA 2VASA 3HGYA 5C4JJ 3ASOH 1NTCA 3K4CA 3FM3A 3EETA 4LG0A 4EM2A 3J7YJ 2DA2A 3H1CA 1X1DA 2M5WA 2D45A 1YOVB 1IN8A 2KPMA 5DTDA 3QAHA 1FYMA 5TGTA 2FMLA 1GV5A 1G3WA 4K2EA 4OMYA 2HOSA 4OIRF 4LLNA 2CUFA 3BT9A 2VE9A 4IHYA 4EEFG 3ABKH 1OYIA 4GXOA 4IHSA 2E1MC 2QCOA 2A69F 3CDIA 1O7LA 5A2QZ 2M45A 1B9NA 1OCPA 2GWRA 3DU5A 1OQYA 2DK5A 4KICA 1BW5A 4H0EA 1Z0XA 3ABLH 2DK8A 1JJ6C 1I1SA 1UG2A 4XLEA 4U7BA 4HA8A 4O5VA 2KIUA 5DCMB 3RI4A 6PAXA 2CQNA 4LD5A 1XMKA 3SYTA 2VN2A 4A5NA 1RKTA 3K2AA 2F4IA 4EJVA 2IJLA 2LR8A 1O3TA 1L3LA 1FPQA 2HQAA 2Q2EA 3O8HA 1K61A 2OA4A 2HXIA 3Q3SA 4XOPA 3RKXA 4IHXA 3B73A 4XMYA 4RAZA 2V7FA 1QBJA 2X6WA 3L2UA 3MKZA 2YR2A 3GYHX 4PJMA 2Z99A 1YS7A 3LWFA 2QF7A 3IH2A 3RYPA 4ITVA 2MLKA 3RZOJ 3EYIA 3RQIA 4A93J 2R7FA 2OTLI 1LDJA 3T5XA 2DMNA 3TO7A 4L5JA 3TOAA 3BROA 3E5XA 1OJLA 1F36A 4A6EA 1KONA 4HLYA 2ZNZA 1QVUA 1FX7A 2XKPA 3WGHA 2BY2A 1DDNA 1XSVA 1OPCA 4CXFA 2I10A 2R7QA 3VB2A 5CVJA 4ENMA 4XORA 3M07A 4I99C 1I39A 5HS8A 2MBFA 4BKXA 1JI8A 2Y69H 3K10A 3ECHA 4KIFA 3G4SI 5F0HA 1W7PA 1ON1A 2LF8A 1OFCX 2VXZA 2XRLA 5DUKA 5F64A 1QQIA 1T56A 4YFXF 4UNOA 3PIOF 2ZB9A 3JRAA 1MMAA 2QQ9A 2QWWA 1VQ4I 4E7SA 2BY1A 3CQZJ 3FX3A 3JRBA 1PP7U 3HXLA 2IP2A 1Y8RB 2KIMA 4AIHA 3OYDA 1FEXA 3IH3A 1ETXA 2X85A 2O8KA 1TWFJ 3RCOA 1IW7F 2M2EA 2G7UA 3BJOA 4MFDA 5CVUA 3K4BA 2E1CA 3OR2C 2MH9A 2K02A 1MH4A 2WTEA 5H6RA 2YX4A 4CCMA 2K40A 4BH9A 3E5UA 2IAIA 2K9LA 2BW3A 4C3HJ 2Y30A 4U87A 1BJZA 5LLQA 2PI0A 1XTAA 2E1MB 3V7CA 5JHFA 1XSDA 3ZGKA 3CMYA 1TC3C 4LB6B 2KZVA 1BA5A 3NWSA 4D9JA 5HODA 2GM4A 2KJCA 4F52A 1OLTA 1X3WB 1ZLJA 4XSZF 1PUFA 2H8RA 2WV0A 1IXRC 5ICGA 3AG2H 2VJ4A 2X6YA 3SFZA 3LA3A 2DMTA 3J80K 2HQ5A 1MSEC 2XGEA 1KQ0A 4CO8A 2DO7A 2VBZA 4LJZF 4WF2A 1R71A 3EUHC 1IUYA 3IH4A 3AKZA 2IXSA 1LUJB 2X6OA 1CF7A 2XGCA 3HOXJ 3TQNA 4EM1A 1WHUA 2AS5F 2DI3A 4BXUA 5LHIA 2YPRA 2L4MA 1TZLA 1IG7A 2LTPA 4A3KJ 1FMVA 2ZCWA 4P55A 5LD2C 1ERDA 3R61A 2V9KA 1HDDC 1DU6A 1FJLA 3B02A 4Y17A 3UR3C 2WAQA 2RV8A 4HX7A 2CUZA 3FXOA 1JT6A 2ESNA 3HOSA 5IOYA 3OS0A 4L5EA 2CRGA 2Y2ZA 3H5RA 5GAGJ 1Z67A 3CCQI 4E7HA 5J1RA 2P0WA 1P2FA 2QSFX 3O2PE 1U6GA 3LAPA 2GXBA 2ID3A 3C18A 4IEJA 3LSPA 3L2WA 3FXKA 1RIOH 2PMZN 2A5WA 2STTA 1DGWY 3JRHA 1XD7A 2GAUA 3GW2A 4IQJA 1OYWA 4MEYF 1FBQA 3GCMA 1NHAA 2ZXJA 3K4LA 4JX5A 4MHGA 5EG0B 4MNUA 3HL2A 4BJ5C 5FFXA 3HHGA 5J4VA 1O57A 3WTWC 4KIGA 1QHGA 1XX5A 2CQ7A 3WTSC 2DFIA 2XGXA 2P6SA 2DW4A 4QPQA 1R1UA 1B9MA 2H8WA 1YIOA 1MBGA 3DLAA 5ILSA 5DM7F 4Q48A 1BOAA 5LRSA 3J81Z 1BL0A 2F4OB 1LFPA 3A03A 1FP1D 4B1RA 2XF7A 4MQ9F 4UHTA 2L7MP 3TOBA 3WHBA 2NOJB 1ZAOA 3ZXSA 2HPMA 1H9TA 3CF2A 4C2UA 1STZA 2Z3YA 4ZYDA 1R9TJ 4XN0A 2LKPA 2V9VA 3ZMDA 2R5YB 5K7FA 5LEJA 1B72B 4OIOF 4ABZA 2IS1A 2H09A 3I55I 2NRAC 2VC0A 3TEDA 3F6OA 4M3GA 4Q47A 1YX5A 2ADUA 2KQRA 1YIJI 2W25A 3SDBA 1FC3A 2DFHA 5D5VB 3BTLA 1P4AA 4FTHA 2W57A 3K4NA 1IDYA 2M30A 1IUFA 3KPHA 2RKHA 2WAEA 3HIFA 3DPTA 1BC7C 2KRCA 3MQ0A 3KLOA 1OISA 2JVGA 3ZMTA 3HYIA 4C2MJ 1UHMA 5BS6A 3DFGA 3BQYA 1HBXG 4CZZA 1IO2A 3HSEA 2W84A 4PGGA 1OCTC 1QZYA 2ZFWA 4GRIA 1K4TA 2VE8A 3LAJA 1W36D 2JRTA 4Y15A 3HSFA 1T98A 2ICWG 2MC3A 4DZJA 1TQMA 1FMWA 4AWXB 2VJIA 5CQEA 4YIIA 3CCYA 4RB3C 3GXOA 3RJPA 3F8FA 1JHFA 3SZTA 1WJCA 5F1JA 5FO5A 3L2VA 2O9LA 3S32A 3OYEA 5HLGA 5KCMA 5FRNA 3W6VA 1B4AA 4LB5A 1P4WA 1JTXA 1FSEA 2LF7A 4FHTA 3QPSA 3HOYJ 2O03A 1BI3A 3FZVA 3L7WA 3S2HJ 3VFZA 3I56I 1A6QA 1ETKA 4HQEA 3EUKL 1AKHB 2ECCA 1VZ0A 5D6FA 4OWRB 2B7EA 1AA7A 2R7SA 1PYVA 1FOWA 1R4MB 3AG4H 2XAJA 2LBFB 4HRIA 2AO9A 3A01B 1B6AA 3DPLC 3BR6A 4OMZA 4OAZA 3ZOBA 1MNMC 1XC5A 3SFIA 3SEZA 3CMEI 1FYKA 1VI0A 2LH9A 3K1PA 1RRJA 5EZGA 1VQPI 1Y1VJ 5E20A 1IAWA 4DGWB 3SDGA 2WY7Q 4FT8A 3CCEI 2K4BA 1R6RA 2DAOA 1T8IA 2IBDA 4IF4A 2V9PA 5E1WA 2PMUA 4KDPA 1QZZA 2ZKZA 1Z6RA 1WRJA 4II3A 2W4SA 1YTYA 4QTRA 3O3KA 2OV7A 1ZN2A 4D7MA 1VTNC 1YHQI 3LFUA 5HLHA 1R5GA 3H92A 3TBIA 5CYVA 4W1UA 1V5EA 2XSJC 2BGCA 5B1AH 3KP3A 3TDUC 3K4MA 3PUBA 2H6BA 1P92A 1BIAA 2Q8KA 4FISA 4LMYA 3ISPA 1TWHJ 3K70C 1Z7UA 3FISA 2ZFUA 3MZYA 1J2XA 1KYWA 1H88C 4I02A 3RSNA 2PEXA 3PNYA 2NS7A 1ORKA 5IP6A 3JAMZ 4NBQA 3R60A 4TV7A 2EZKA 1IGNA 2L3DA 2R93J 4D1QA 1QO0D 4FQGA 3GF2A 4HDUA 2E60A 3DEUA 4IRIA 4CCOA 2K86A 2R7ZJ 2EZHA 3OYFA 5M5WJ 2KT0A 3K69A 3QWLA 1O3QA 4RLFA 1XDUA 4I76A 2F5CA 4EV0A 4C9YA 2AXLA 1GHCA 2M8EA 2LKXA 3GBGA 4A3DJ 3MCZA 1FT9A 1OMIA 1Z05A 2HQNA 4HDVA 2XF6A 2V26A 3CUQA 2EV6A 5BMZA 3OSFA 2RGVA 2H6CA 3PFIA 4MFEA 2CV2A 1GT0C 1FOKA 3H36A 2LVSA 3FIWA 1HKTA 1T95A 1E3HA 1B1BA 2QA4I 3B6CA 3LSIA 4ON0A 3JR9A 1KYZA 3IRRA 4MGRA 2JSCA 2W7NA 4BXFA 3V42A 1U9OA 2J5PA 4XOTA 3ZMVA 4BEHA 2LC2A 3S1NJ 3QP5A 4BAYA 3C7JA 2ZJ2A 2XIGA 2EILH 1YW9A 2FX0A 4U0WA 3TP0A 5HLTA 2X4HA 4BBSJ 3DV8A 1NG6A 1JUSA 2VQGA 4RGRA 1QZEA 5FKOA 1MBEA 2M4GA 3FMRA 3I4PA 4N9IA 1J7KA 3ZCOA 2XRNA 2D5VA 5F1RA 1KQ9A 4Y52J 3K2ZA 3VYRB 5J1YA 2X9DA 4BJTA 4GGGA 1G59A 5E1ZB 4YELA 4PZJA 4EVIA 2OZ6A 3BTJA 4CSWA 3E6BA 5B5EC 1H89C 4J01A 4V2GA 5B3SH 1SD5A 3E3VA 4KT6A 2FF4A 2EFOA 1R58A 2WY8Q 4ENJA 3SXYA 5GTIC 2EA4A 2OAZA 4RB2C 2W48A 4KIBA 2FE3A 2VUMJ 2HYGD 1HKSA 4XLCA 2PMZA 1MDMA 1ZLKA 2RREA 3Q0UA 2W82A 1ITYA 4CCLA 3BTCA 3GTLJ 2K85A 1RUNA 1LEAA 4A12A 3GTPJ 2N8GA 4IPAA 1TNSA 4YRVA 1X58A 2QVOA 2VKHA 1X4PA 1SD4A 3PUFA 3J7ZI 2IS6A 2PN6A 5DUIA 2WBMA 3RYRA 4L5IA 1ZG1A 4N4NB 2DOAA 2ESHA 4BY7J 4ESBA 1TWGJ 2XVCA 1HC8A 1H9GA 1X2NA 3BWGA 4ZYGA 2L7KA 2Z16A 2V1UA 2XF5A 4BUPA 1HSJA 3R0JA 3O6BB 3WU2C 2BXZA 3X2QH 2EFWA 1F5TA 2NYXA 4G8XA 1JE8A 4D0PA 2KRHA 3OS2A 3IAS2 1ETQA 3OYLA 1R4NB 4FX0A 1F1ZA 1RI7A 4E7KA 4JBAA 3DKYA 3KP4A 1G3YA 4PK4A 5D4RA 3JREA 4UY8I 1IZ1A 3IL2A 2K9MA 3G73A 4RB1A 2MW8A 1YQAA 2DMUA 3G1LA 3BPXA 4YIFA 2JA7J 1YW7A 3OS1A 4C3IJ 2HDCA 2M7BA 1SC7A 1ZREA 4L0YB 2K27A 4BQQA 1X3UA 3RIRA 4B47A 3CP2A 2KKOA 1A35A 3ERED 1T39A 2HZTA 4XRSA 3COAC 3FK6A 1JTYA 2ZJQF 2GQQA 5DM6F 2O7OA 3F8BA 2B0LA 4I6ZA 1JXSA 3OYAA 1JJ8C 2JPCA 4DOZA 2P7CB 3Q9VA 2NAZA 1Y39A 4XLFA 5D8LB 2K3FA 4G6QA 1SFEA 4Y3OA 5HNFA 2A6EF 1D8JA 1P4XA 5KK1A 1K78B 5TJJA 1HSTA 3NEUA 3E6CC 1RETA 3FXMA 1UAAA 3QQAA 2DA3A 3LSJA 2DLLA 1GUUA 2A68F 3ESWB 3VDXA 1OCCH 1X1PA 4XLNF 4E7ZA 1K7AA 1PUEE 1G2HA 4GYGA 1Z91A 2OD5A 5AIPA 1YW8A 2LD5A 4A2UA 4UB8C 3GFJA 2W00A 1P7IA 1X19A 5IP7J 4PJ0C 5E17F 5ICFA 3OOUA 1FOYA 4M6XA 1YO5C 2FXAA 3QYFA 3WTYC 4XN3A 4BHBA 1SANA 3A4CA 4HNVA 1DQUA 1S8NA 4RBOA 5EJCA 2QZ8A 5CPRB 4G7OF 2HOAA 4ZZDA 3LQRA 5KAFC 3KYCB 1ETVA 4PJLA 2MC4A 4Y13A 3L2QA 1S9HA 1AHDP 5IT9K 2A6TA 4I0BA 4L18B 2EFPA 1APLC 4CYDA 1B8IA 4PFOA 4CYCA 2FUG2 3GVAA 3K4JA 5FRMA 3M1EA 2DMQA 2R5ZA 1V55H 4HOBA 4A5MA 4D5FA 2L7ZA 2FA5A 5K1YA 1VQ8I 4WXDA 3WG7H 4A3GJ 3DPUA 1YRNA 4IVNA 2FJ1A 1X2MA 3HOTA 2RQQA 2ACJA 3K6GA 3UNGC 4XK4A 1LB2A 2Z5UA 3TO6A 4U0VA 1N78A 3S1MJ 2MGQA 4E6KG 1ONVA 3ASNH 3LL7A 4A0XA 3JRCA 1R7JA 2F5VA 1XB4A 1IXCA 4A6DA 2OCCH 3D5LA 1O3RA 1FWZA 2ZNYA 5F08A 1XG1A 5LBQA 5F04A 2GIVA 2VC1A 1YITI 3CF5F 2HFHA 4IQ4A 2BE5F 1YFHA 1BOBA 2YU3A 3DQVC 4J19A 4B3AA 1SAXA 4B48A 2M4KA 1BI1A 1BW6A 4M6VA 1WJEA 2HYJA 4J00A 1FIAA 4XRMA 3OYHA 2BVMA 1M1EB 4IKFA 3IKVA 5FD5A 2UV1A 3HOZJ 4X6AJ 3C2HA 3FHNA 1SFUA 3P9KA 2BZTA 4U0YA 3HEFA 1R1TA 2JA5J 1SFKA 4DQ2A 4NQWA 2QSHX 1LE8B 4B4CA 1JT0A 4BL0B 2BXYA 5K7ZA 3EQLF 1Z3YA 2EH3A 4HQMA 1Y0UA 5GPCA 2CGPA 3QP6A 4LK0F 4BHPA
chains in the Genus database with same CATH topology
4XRSG 3A03A 5EDNA 4B1RA 2L7MP 2GBYA 3WHBA 3HDDA 1UMQA 1U8BA 1R9TJ 3S16J 2R5YB 2XGDA 2DTZA 3DEWA 5K7FA 4JX6A 5GP9A 1B72B 5IPAA 4ABZA 5DS9A 3TW7A 3ZQHA 3TEDA 5EZHA 5F0FA 4M3GA 3OSGA 2DMPA 4DYRA 4AC0A 5IYDJ 2TCTA 3BTLA 4FTHA 3S14J 2JMWA 2R92J 2NVYJ 1GVDA 1IDYA 1ETWA 1IUFA 5M3FJ 2K9NA 5EEAA 2FQ4A 3QPLA 3BR3A 4FE7A 4D5CA 1MH3A 4C2MJ 3BQYA 3HKZN 3WHCA 1QPIA 1OCTC 3GTKJ 2CUEA 3VPRA 3GTJJ 3GTOJ 1A5JA 2DA7A 5E3OA 4MLOA 3HGGA 3A02A 4UUSB 4DZJA 3S2DJ 1U78A 3S17J 3ZQCA 1E3OC 4UUTA 2LLKA 3CCYA 1H8AC 1NK3P 4IHWA 2HI3A 3HBLA 3BG5A 2M34A 1VNDA 2HDDA 5F1JA 2O9LA 3SJMA 3HM5A 5E3NA 3OIOA 1W0UA 5EF6A 4A3MJ 1IJWC 3W6VA 1IDZA 5FKMA 1JTXA 1QVTA 3HOYJ 1I50J 3QPSA 1IV6A 3HOVJ 3LOCA 3GTGJ 3S2HJ 2M9HA 1ETKA 4JP0A 2JA6J 3BR1A 1AKHB 2ECCA 2YU9J 2Y31A 2DA6A 3HB9A 5EGOA 1MBJA 2JK3A 2VI6A 4A69C 1QRYA 2HOTA 1PUFB 1B8IB 4A3LJ 4CYCB 1RKWA 2AO9A 2EQRA 3A01B 1HF0A 3BR6A 2LP0A 3ZOBA 1MNMC 1XC5A 2EZIA 3SFIA 1HOMA 2R5ZB 3I4MJ 1ZQ3P 3NAUA 1VI0A 5EZGA 1Y1VJ 3Q0VA 3SDGA 5E3LA 1MSFC 1YRNB 2IBDA 3MVPA 5FKNA 5FLVA 1K83J 4QTRA 3TW6A 4A3IJ 5C4XJ 5IYCJ 4XIDA 4D7MA 2E2JJ 3GTMJ 5BNGA 2WV1A 2G0EA 2MG4A 1ZR4A 1POGA 4W1UA 2E2IJ 1RESA 2YS9A 2NVQJ 2K9QA 2E19A 4M3FA 1VF9A 3NARA 3C2BA 2Y9YA 4FISA 3G1OA 1TWHJ 1ENHA 2DJNA 2L9RA 3FISA 2R0QC 1H88C 5IP6A 2NS7A 1ORKA 2WAQN 3TP3A 5IOZA 2EZKA 2P81A 1GDTA 1IGNA 2K9SA 2R93J 3RKQA 4NDLA 5M3MJ 2VKVA 5JLXA 1O4XA 1TWCJ 2JA8J 4IHVA 4X1EA 1JKOC 3BG3A 4DW6A 1P7JA 1LFBA 1WPKA 2EZHA 1ZTRA 5FKLA 1RPWA 2R7ZJ 5M5WJ 1GV2A 2KT0A 4G12A 4I76A 1JKPC 1RR7A 2RAEA 2LKXA 3GBGA 4A3DJ 4GFBA 2E2HJ 2EBIA 4MFEA 3OSFA 1GT0C 2NVTJ 1NK2P 5FJ8J 1WH7A 2LVSA 3E7LA 3FIWA 1ZKGA 2FD5A 3LSGA 3PM1A 1WI3A 3B6CA 3BR5A 3M3YJ 3JR9A 4FCYA 3S1RJ 1FIPA 1A6IA 1U9OA 3S1NJ 2IEKA 3MKLA 3F0CA 4C3JJ 2FX0A 2M0CA 3TP0A 3ZQLA 2COBA 4RDUA 4BBSJ 1JGGA 3ZQFA 1JUSA 1D5YA 5JLWA 2XSDC 1MBKA 5FKOA 3BTIA 2XPUA 1MBEA 3B6AA 2DA5A 3PO2J 2D5VA 3H0GJ 4Y52J 1U9NA 3FKIJ 5J1YA 2X9DA 4M3DA 3S15J 3FK7A 3BTJA 1H89C 4V2GA 3HGYA 3ZQIA 5C4JJ 4M3BA 1NTCA 5FKKA 4FE4A 2DA2A 1MBHA 2W48A 2VUMJ 2VKEA 4BBRJ 5DTDA 1IC8A 4MIMA 3Q0UA 1GV5A 2NVXJ 1ITYA 2HOSA 3BTCA 3GTLJ 2CUFA 3BT9A 4Y7NJ 1Y1WJ 4IHYA 1HCRA 4EEFG 3GTPJ 2YUSA 2L7FP 5J3LA 2N8GA 2QCOA 1X58A 2L0KA 1OCPA 1BW5A 5EGOB 1Z0XA 1JJ6C 2E1OA 1UG2A 5EYRA 5EG0A 5M5XJ 1Q1VA 1VFCA 1LE8A 2ID6A 4AYBN 4BY7J 3JRFA 5C44J 4DYQA 1TWAJ 3HOUJ 1TWGJ 1JKQC 5J1UA 1RKTA 3K2AA 1X2NA 2CQQA 2LR8A 1WH5A 2DA1A 1K61A 3O8HA 2HXIA 3Q3SA 4IHXA 1HDPA 2B63J 1ETYA 2ME6A 3BQZA 1ETQA 1W0TA 4JYKA 2CQXA 2NS8A 2XPWA 3O8GA 2R5YA 1JKRC 3JREA 2QF7A 1B72A 3IH2A 4JX4A 3LNQA 1SFOJ 3RZOJ 3RQIA 4A93J 5E3MA 2MW8A 2DMUA 3G1LA 1UHSA 2JA7J 2DMNA 2DN0A 4C3IJ 3I4NJ 5F0CA 1OJLA 1F36A 1JUPA 5IYBJ 2AHQA 2XB5A 1QVUA 1WGXA 4XRSA 3FK6A 3G1MA 1JTYA 2I10A 3IV5A 2O7OA 4S0HB 4I6ZA 3JRDA 1JJ8C 3JRIA 4BKXA 4A3CJ 4BXXJ 2CJJA 5F0HA 4A3BJ 1OFCX 1Z77A 3BR2A 2XRLA 1T56A 4A3JJ 2ZB9A 3JRAA 3PO3J 3CQZJ 4UUSA 4M3EA 3BR0A 3JRBA 2TRTA 1RETA 1HLVA 2LY9A 3QQAA 2DA3A 3LSJA 3BG9A 5C3EJ 1GUUA 1FEXA 3IH3A 1ETXA 1G2HA 2O8KA 1IRZA 2LD5A 1TWFJ 5IP7J 3H3VK 1P7IA 2WB1N 2M2EA 4MFDA 3OOUA 5K7HA 1MH4A 1MBFA 2K40A 2IAIA 5IP9J 1SANA 4HNVA 3L1PA 2MSYA 1AKHA 4C3HJ 2Y30A 4RBOA 1BJZA 2X48A 2HOAA 3Q0WA 1CQTA 1ZR2A 3LSRA 1ETVA 1ZK8A 3CMYA 1TC3C 1BA5A 1EF4A 1F43A 1AHDP 5HODA 2GM4A 3GTQJ 3JRGA 4W97A 1AU7A 1PUFA 2JN6A 1B8IA 1APLC 4CYCA 1XS9A 2H8RA 1I3QJ 2XB0X 2VPRA 3A01A 2KDZA 2DA4A 3MN2A 2DMQA 4V2FA 1S7EA 2R5ZA 2DMTA 4D5FA 2L7ZA 1JUMA 2XPVA 2HQ5A 2ME0A 2XGEA 1MSEC 2HXOA 2OPTA 4A3GJ 1YRNA 2FJ1A 1X2MA 3DCFA 4D7NA 4XK4A 3IH4A 2Y9ZA 2X6OA 2XGCA 3HOXJ 3S1MJ 3D1NI 2MGQA 1LFUP 1IG7A 2LTPA 3JRCA 4A3KJ 2ECBA 1I6HJ 2OF7A 3CDLA 5F08A 1XG1A 1HDDC 1DU6A 5F04A 2NOGA 1FJLA 3S1QJ 1ZGWA 2JJ7A 4DYCA 1T33A 4AUXA 1JT6A 1WCMJ 2Y0SN 3HOWJ 2LK2A 4B3AA 5IOYA 4J19A 3ZQGA 4L5EA 4MO7A 2CRGA 2Y2ZA 1DU0A 1BW6A 5F27A 4M6VA 4QIWN 5J1RA 2HYJA 1FIAA 4XRMA 4DZPA 2ID3A 4IEJA 3LSPA 1ETOA 2ELKA 2H1KA 2PMZN 5GPAA 3RZDJ 3JRHA 2JWTA 4A3FJ 5FLMJ 2GLOA 3HOZJ 4X6AJ 4XICA 1FTZA 4JX5A 3HEFA 5EG0B 2JA5J 4BY1J 3UKGA 1LE8B 4A3EJ 2EZLA 4B4CA 9ANTA 3K7AJ 1JT0A 2M8GX 5K7ZA 4LOCA 5M5YJ 4QSHA 2EH3A 2CU7A 2LFBA 1FTTA 5GPCA 3M4OJ 1MBGA 1BL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRS G;  3A03 A;  5EDN A;  4B1R A;  2L7M P;  2GBY A;  3WHB A;  3HDD A;  1UMQ A;  1U8B A;  1R9T J;  3S16 J;  2R5Y B;  2XGD A;  2DTZ A;  3DEW A;  5K7F A;  4JX6 A;  5GP9 A;  1B72 B;  5IPA A;  4ABZ A;  5DS9 A;  3TW7 A;  3ZQH A;  3TED A;  5EZH A;  5F0F A;  4M3G A;  3OSG A;  2DMP A;  4DYR A;  4AC0 A;  5IYD J;  2TCT A;  3BTL A;  4FTH A;  3S14 J;  2JMW A;  2R92 J;  2NVY J;  1GVD A;  1IDY A;  1ETW A;  1IUF A;  5M3F J;  2K9N A;  5EEA A;  2FQ4 A;  3QPL A;  3BR3 A;  4FE7 A;  4D5C A;  1MH3 A;  4C2M J;  3BQY A;  3HKZ N;  3WHC A;  1QPI A;  1OCT C;  3GTK J;  2CUE A;  3VPR A;  3GTJ J;  3GTO J;  1A5J A;  2DA7 A;  5E3O A;  4MLO A;  3HGG A;  3A02 A;  4UUS B;  4DZJ A;  3S2D J;  1U78 A;  3S17 J;  3ZQC A;  1E3O C;  4UUT A;  2LLK A;  3CCY A;  1H8A C;  1NK3 P;  4IHW A;  2HI3 A;  3HBL A;  3BG5 A;  2M34 A;  1VND A;  2HDD A;  5F1J A;  2O9L A;  3SJM A;  3HM5 A;  5E3N A;  3OIO A;  1W0U A;  5EF6 A;  4A3M J;  1IJW C;  3W6V A;  1IDZ A;  5FKM A;  1JTX A;  1QVT A;  3HOY J;  1I50 J;  3QPS A;  1IV6 A;  3HOV J;  3LOC A;  3GTG J;  3S2H J;  2M9H A;  1ETK A;  4JP0 A;  2JA6 J;  3BR1 A;  1AKH B;  2ECC A;  2YU9 J;  2Y31 A;  2DA6 A;  3HB9 A;  5EGO A;  1MBJ A;  2JK3 A;  2VI6 A;  4A69 C;  1QRY A;  2HOT A;  1PUF B;  1B8I B;  4A3L J;  4CYC B;  1RKW A;  2AO9 A;  2EQR A;  3A01 B;  1HF0 A;  3BR6 A;  2LP0 A;  3ZOB A;  1MNM C;  1XC5 A;  2EZI A;  3SFI A;  1HOM A;  2R5Z B;  3I4M J;  1ZQ3 P;  3NAU A;  1VI0 A;  5EZG A;  1Y1V J;  3Q0V A;  3SDG A;  5E3L A;  1MSF C;  1YRN B;  2IBD A;  3MVP A;  5FKN A;  5FLV A;  1K83 J;  4QTR A;  3TW6 A;  4A3I J;  5C4X J;  5IYC J;  4XID A;  4D7M A;  2E2J J;  3GTM J;  5BNG A;  2WV1 A;  2G0E A;  2MG4 A;  1ZR4 A;  1POG A;  4W1U A;  2E2I J;  1RES A;  2YS9 A;  2NVQ J;  2K9Q A;  2E19 A;  4M3F A;  1VF9 A;  3NAR A;  3C2B A;  2Y9Y A;  4FIS A;  3G1O A;  1TWH J;  1ENH A;  2DJN A;  2L9R A;  3FIS A;  2R0Q C;  1H88 C;  5IP6 A;  2NS7 A;  1ORK A;  2WAQ N;  3TP3 A;  5IOZ A;  2EZK A;  2P81 A;  1GDT A;  1IGN A;  2K9S A;  2R93 J;  3RKQ A;  4NDL A;  5M3M J;  2VKV A;  5JLX A;  1O4X A;  1TWC J;  2JA8 J;  4IHV A;  4X1E A;  1JKO C;  3BG3 A;  4DW6 A;  1P7J A;  1LFB A;  1WPK A;  2EZH A;  1ZTR A;  5FKL A;  1RPW A;  2R7Z J;  5M5W J;  1GV2 A;  2KT0 A;  4G12 A;  4I76 A;  1JKP C;  1RR7 A;  2RAE A;  2LKX A;  3GBG A;  4A3D J;  4GFB A;  2E2H J;  2EBI A;  4MFE A;  3OSF A;  1GT0 C;  2NVT J;  1NK2 P;  5FJ8 J;  1WH7 A;  2LVS A;  3E7L A;  3FIW A;  1ZKG A;  2FD5 A;  3LSG A;  3PM1 A;  1WI3 A;  3B6C A;  3BR5 A;  3M3Y J;  3JR9 A;  4FCY A;  3S1R J;  1FIP A;  1A6I A;  1U9O A;  3S1N J;  2IEK A;  3MKL A;  3F0C A;  4C3J J;  2FX0 A;  2M0C A;  3TP0 A;  3ZQL A;  2COB A;  4RDU A;  4BBS J;  1JGG A;  3ZQF A;  1JUS A;  1D5Y A;  5JLW A;  2XSD C;  1MBK A;  5FKO A;  3BTI A;  2XPU A;  1MBE A;  3B6A A;  2DA5 A;  3PO2 J;  2D5V A;  3H0G J;  4Y52 J;  1U9N A;  3FKI J;  5J1Y A;  2X9D A;  4M3D A;  3S15 J;  3FK7 A;  3BTJ A;  1H89 C;  4V2G A;  3HGY A;  3ZQI A;  5C4J J;  4M3B A;  1NTC A;  5FKK A;  4FE4 A;  2DA2 A;  1MBH A;  2W48 A;  2VUM J;  2VKE A;  4BBR J;  5DTD A;  1IC8 A;  4MIM A;  3Q0U A;  1GV5 A;  2NVX J;  1ITY A;  2HOS A;  3BTC A;  3GTL J;  2CUF A;  3BT9 A;  4Y7N J;  1Y1W J;  4IHY A;  1HCR A;  4EEF G;  3GTP J;  2YUS A;  2L7F P;  5J3L A;  2N8G A;  2QCO A;  1X58 A;  2L0K A;  1OCP A;  1BW5 A;  5EGO B;  1Z0X A;  1JJ6 C;  2E1O A;  1UG2 A;  5EYR A;  5EG0 A;  5M5X J;  1Q1V A;  1VFC A;  1LE8 A;  2ID6 A;  4AYB N;  4BY7 J;  3JRF A;  5C44 J;  4DYQ A;  1TWA J;  3HOU J;  1TWG J;  1JKQ C;  5J1U A;  1RKT A;  3K2A A;  1X2N A;  2CQQ A;  2LR8 A;  1WH5 A;  2DA1 A;  1K61 A;  3O8H A;  2HXI A;  3Q3S A;  4IHX A;  1HDP A;  2B63 J;  1ETY A;  2ME6 A;  3BQZ A;  1ETQ A;  1W0T A;  4JYK A;  2CQX A;  2NS8 A;  2XPW A;  3O8G A;  2R5Y A;  1JKR C;  3JRE A;  2QF7 A;  1B72 A;  3IH2 A;  4JX4 A;  3LNQ A;  1SFO J;  3RZO J;  3RQI A;  4A93 J;  5E3M A;  2MW8 A;  2DMU A;  3G1L A;  1UHS A;  2JA7 J;  2DMN A;  2DN0 A;  4C3I J;  3I4N J;  5F0C A;  1OJL A;  1F36 A;  1JUP A;  5IYB J;  2AHQ A;  2XB5 A;  1QVU A;  1WGX A;  4XRS A;  3FK6 A;  3G1M A;  1JTY A;  2I10 A;  3IV5 A;  2O7O A;  4S0H B;  4I6Z A;  3JRD A;  1JJ8 C;  3JRI A;  4BKX A;  4A3C J;  4BXX J;  2CJJ A;  5F0H A;  4A3B J;  1OFC X;  1Z77 A;  3BR2 A;  2XRL A;  1T56 A;  4A3J J;  2ZB9 A;  3JRA A;  3PO3 J;  3CQZ J;  4UUS A;  4M3E A;  3BR0 A;  3JRB A;  2TRT A;  1RET A;  1HLV A;  2LY9 A;  3QQA A;  2DA3 A;  3LSJ A;  3BG9 A;  5C3E J;  1GUU A;  1FEX A;  3IH3 A;  1ETX A;  1G2H A;  2O8K A;  1IRZ A;  2LD5 A;  1TWF J;  5IP7 J;  3H3V K;  1P7I A;  2WB1 N;  2M2E A;  4MFD A;  3OOU A;  5K7H A;  1MH4 A;  1MBF A;  2K40 A;  2IAI A;  5IP9 J;  1SAN A;  4HNV A;  3L1P A;  2MSY A;  1AKH A;  4C3H J;  2Y30 A;  4RBO A;  1BJZ A;  2X48 A;  2HOA A;  3Q0W A;  1CQT A;  1ZR2 A;  3LSR A;  1ETV A;  1ZK8 A;  3CMY A;  1TC3 C;  1BA5 A;  1EF4 A;  1F43 A;  1AHD P;  5HOD A;  2GM4 A;  3GTQ J;  3JRG A;  4W97 A;  1AU7 A;  1PUF A;  2JN6 A;  1B8I A;  1APL C;  4CYC A;  1XS9 A;  2H8R A;  1I3Q J;  2XB0 X;  2VPR A;  3A01 A;  2KDZ A;  2DA4 A;  3MN2 A;  2DMQ A;  4V2F A;  1S7E A;  2R5Z A;  2DMT A;  4D5F A;  2L7Z A;  1JUM A;  2XPV A;  2HQ5 A;  2ME0 A;  2XGE A;  1MSE C;  2HXO A;  2OPT A;  4A3G J;  1YRN A;  2FJ1 A;  1X2M A;  3DCF A;  4D7N A;  4XK4 A;  3IH4 A;  2Y9Z A;  2X6O A;  2XGC A;  3HOX J;  3S1M J;  3D1N I;  2MGQ A;  1LFU P;  1IG7 A;  2LTP A;  3JRC A;  4A3K J;  2ECB A;  1I6H J;  2OF7 A;  3CDL A;  5F08 A;  1XG1 A;  1HDD C;  1DU6 A;  5F04 A;  2NOG A;  1FJL A;  3S1Q J;  1ZGW A;  2JJ7 A;  4DYC A;  1T33 A;  4AUX A;  1JT6 A;  1WCM J;  2Y0S N;  3HOW J;  2LK2 A;  4B3A A;  5IOY A;  4J19 A;  3ZQG A;  4L5E A;  4MO7 A;  2CRG A;  2Y2Z A;  1DU0 A;  1BW6 A;  5F27 A;  4M6V A;  4QIW N;  5J1R A;  2HYJ A;  1FIA A;  4XRM A;  4DZP A;  2ID3 A;  4IEJ A;  3LSP A;  1ETO A;  2ELK A;  2H1K A;  2PMZ N;  5GPA A;  3RZD J;  3JRH A;  2JWT A;  4A3F J;  5FLM J;  2GLO A;  3HOZ J;  4X6A J;  4XIC A;  1FTZ A;  4JX5 A;  3HEF A;  5EG0 B;  2JA5 J;  4BY1 J;  3UKG A;  1LE8 B;  4A3E J;  2EZL A;  4B4C A;  9ANT A;  3K7A J;  1JT0 A;  2M8G X;  5K7Z A;  4LOC A;  5M5Y J;  4QSH A;  2EH3 A;  2CU7 A;  2LFB A;  1FTT A;  5GPC A;  3M4O J;  1MBG A;  1BL0 A; 
#chains in the Genus database with same CATH topology
 4CHU A;  5EDN A;  3BCB A;  3HSR A;  4M9Z A;  3HDD A;  2FNA A;  4GCV A;  1PVE A;  4RGS A;  4A0Z A;  4V19 K;  1U5T C;  3S93 A;  2I8D A;  2XGD A;  2DTZ A;  3DEW A;  2ELH A;  3HTU A;  3OIQ A;  1TNT A;  4JX6 A;  4LIV A;  4ZYE A;  5GP9 A;  5DS9 A;  3TW7 A;  3GFM A;  3ZQH A;  2HTS A;  5EZH A;  5F0F A;  2STW A;  2PJP A;  1R36 A;  2EV0 A;  3K70 D;  2TCT A;  2ZME C;  4Y33 A;  2JMW A;  1GVD A;  1ETW A;  1K6O A;  4JK1 X;  5HDN A;  4HV6 A;  2GIZ A;  2K9N A;  5EEA A;  4XSX F;  3CP8 A;  3E6D A;  3BR3 A;  3CJR B;  2VBY A;  3PQJ A;  4D5C A;  4F92 B;  2D1V A;  4BAC A;  2E71 A;  1DPR A;  2GOM A;  2AQE A;  1Z9C A;  3HKZ N;  1ZGA A;  2WAF A;  2DFE A;  4HX8 A;  3RKY A;  2YSR A;  1RC9 A;  5KAI C;  2CUE A;  1TBX A;  1MJB A;  1SFX A;  2O8X A;  3GTJ J;  2DA7 A;  3BJ6 A;  2JTV A;  4UUS B;  2A6H F;  1N75 A;  3F3X A;  2H27 A;  4C2T A;  1NK3 P;  3A0H C;  2OU2 A;  4HEA 2;  4IHW A;  2E34 A;  2HI3 A;  3QU3 A;  3BG5 A;  3ABM H;  3L9F A;  3IRQ A;  2HPI A;  1W0U A;  1MGT A;  2K7L A;  4BQO A;  1IDZ A;  4S04 A;  2FOK A;  1QVT A;  4HNU A;  1LDK B;  5FLX Z;  3Q9S A;  4CCJ A;  2V1X A;  1V5G A;  4UVB A;  3CUO A;  3S2W A;  2M9H A;  1SEU A;  2JA6 J;  4CGZ A;  4XLP F;  4BE0 A;  1BBY A;  1HQC A;  3HB9 A;  4UXN A;  1BC8 C;  1T0F A;  2HGC A;  2XUB A;  2R7W A;  1D0Y A;  3LA2 A;  2VI6 A;  1LJ9 A;  1D8K A;  4IX7 A;  3A2K A;  3RPQ A;  2HOT A;  5DCM A;  2RNJ A;  3U9G A;  3ROU A;  1XGO A;  3DXJ F;  4N0B A;  2HR3 A;  1LEB A;  1D3Y A;  1EH7 A;  3AG3 H;  3MAJ A;  1HF0 A;  4UV8 A;  3RTR A;  4WCG A;  3JCU C;  2KIS A;  4PJJ A;  3I4M J;  3NAU A;  4KJZ A;  3Q0V A;  3FXU A;  1MSF C;  3QYB A;  3ZMU A;  3H3Z A;  1TP4 A;  5FKN A;  4IZZ A;  2PJR B;  3HRS A;  4KYW A;  3HZJ A;  5DCF A;  2FBI A;  2JSP A;  4XID A;  2HDW A;  3G2B A;  2RDP A;  4M9X A;  4BJ6 C;  2E2J J;  3DEE A;  1EV7 A;  4R79 A;  3GTM J;  3J7A Y;  3C2G A;  1U5T B;  3I5U A;  3I59 B;  3ZMS A;  2VIX A;  2MG4 A;  2DBB A;  4F91 B;  4L9V A;  1RES A;  3RPU D;  3P7N A;  2NVQ J;  2K9Q A;  3CCV I;  4UV9 A;  3KX2 A;  1LKX A;  3N05 A;  4XKV A;  3NAR A;  2ZME B;  3KIO A;  3P9C A;  2X0L A;  2Y9Y A;  1DP3 A;  4GO1 A;  4ZYH A;  3G1O A;  2DJN A;  2PFB A;  1WWX A;  4IJA A;  1OR7 C;  3GWZ A;  2UZK A;  4OIP F;  5BOX A;  4R1H A;  2DT7 B;  2L01 A;  4KIS A;  5B66 C;  2P81 A;  3QYE A;  2K9S A;  3RKQ A;  2BEO A;  3LSM A;  4NDL A;  1G4D A;  3L2C A;  2VKV A;  5JLX A;  2NVU B;  1KU7 A;  2LG4 A;  2Y0M A;  2BOL A;  2GA2 A;  1RR8 C;  3V7S A;  5H2F C;  1TWC J;  1WJD A;  3KYL A;  2HOE A;  3CCR I;  1ON2 A;  2W24 A;  2EJR A;  1WPK A;  2VQC A;  4MTE A;  1RUO A;  1WFX A;  3TDZ C;  2V1N A;  4KUM A;  3KZI C;  3E6M A;  4G12 A;  2XAG A;  2KHM A;  4CA0 A;  3ZN1 A;  1JKP C;  1RR7 A;  3CLO A;  4IO9 F;  1S6L A;  2MD5 A;  3WTZ A;  2CV1 A;  4GFB A;  1QPM A;  2Z1D A;  3D0S A;  1C0W A;  4L9J A;  3MKW B;  2DQR A;  1Z3X A;  2IS2 A;  1T6S A;  5B1B H;  2QBY B;  1ULY A;  5JR3 A;  2IGM A;  3VOD A;  1LPQ A;  3M8F A;  4I0A A;  3CMA I;  2DPU A;  3PM1 A;  5J40 A;  1WI3 A;  2L9V A;  3QOE A;  1WVR A;  3FBN B;  1E3P A;  1FIP A;  2PMH A;  4LIU A;  1SVL A;  2AQF A;  3D5S C;  1ZGJ A;  4RAF A;  5J4Y A;  5J8F A;  2KP6 A;  3QRF F;  3MKL A;  1D1C A;  2HYF A;  2QEN A;  3KET A;  4Q4Z F;  2M0C A;  4O3M A;  1TQI A;  2COB A;  1KU9 A;  4RDU A;  4XKC A;  1JGG A;  4XKB A;  2EIN H;  3U2R A;  5GAE J;  3IKT A;  2ZJR F;  5JLW A;  1D5Y A;  4XM3 A;  2XSD C;  5LGN A;  3FWE A;  5L3F A;  3PNV A;  3TMO A;  3RQ4 A;  1BR4 A;  2DA5 A;  4Q5S F;  2O61 A;  2ETH A;  4EJU A;  4UVA A;  1GXQ A;  3H0G J;  4KT5 C;  2L4A A;  3FKI J;  4PUS A;  5LGT A;  2VT2 A;  3DKW A;  1FSH A;  1Y6I A;  4M3D A;  3FK7 A;  2ZXI A;  3TL4 X;  5DD8 A;  4M3B A;  3R6S A;  4QPO A;  3DU6 A;  2L5Q A;  1I3A A;  2IGN A;  3KLN A;  3K4K A;  3HTS B;  3EDP A;  4HF2 A;  1IC8 A;  3FF5 A;  3U21 A;  4HF0 A;  2A5Y B;  2HS5 A;  2CQK A;  2NVX J;  4EM0 B;  3GFL A;  1BN5 A;  1BR2 A;  4O6J A;  4MTD A;  3OL4 A;  1J09 A;  4Y7N J;  3Q5F A;  1Y1W J;  2YUS A;  4P1W A;  1SMY F;  5J3L A;  5HLI A;  2L0K A;  4OU0 A;  1LNW A;  2DPD A;  3FM5 A;  2XAU A;  5DEQ A;  3E5Q A;  3ML6 A;  4IXA A;  3KZZ A;  5L3D A;  2X1D A;  5EGO B;  3MFK A;  2E1O A;  2Q1Z B;  3NWT A;  3R0A A;  1WSU A;  5EG0 A;  5DDG A;  5M5X J;  4BDY A;  1ODD A;  5C44 J;  1E0E A;  5EEG A;  2HU9 A;  2CQQ A;  1Z6T A;  2EIK H;  1IN6 A;  2ZSI B;  3CCJ I;  2E36 A;  3KZY A;  2IVM A;  2QQA A;  3VYS B;  2BY3 A;  4ZC3 A;  2B63 J;  1HDP A;  1ETY A;  2EFN A;  3D5R C;  2VBX A;  2LSO A;  5AON A;  2EWN A;  4OIN F;  2ME6 A;  5HDK A;  3KEY A;  4F3Q A;  5A2Q K;  2Z9O A;  1W0T A;  4OAY A;  4JYK A;  4ZDO A;  2CQX A;  3OL3 A;  3SEQ A;  1Z21 A;  4L9N A;  1BM9 A;  3U1D A;  3OYC A;  2R5Y A;  1UCR A;  3SZG A;  4KMF A;  1D0Z A;  1B72 A;  4JX4 A;  5L3B A;  3LNQ A;  1SFO J;  2WAD A;  3V8K A;  2I5U A;  5E3M A;  2GZW A;  3GME A;  2E5N A;  2HEO A;  1XN7 A;  2CFO A;  2DN0 A;  3AL0 C;  2L9N A;  3I4N J;  2KMU A;  1D1A A;  2HTJ A;  5F0C A;  1JHH A;  1JUP A;  5IYB J;  3HKZ A;  3VYT B;  3BZ6 A;  1UJ8 A;  1WJF A;  2XB5 A;  1WGX A;  2FBK A;  3K1M A;  1S3J A;  1XMX A;  3KP6 A;  3JSO A;  3G1M A;  3CC2 I;  2XRO A;  2V4J C;  1ZHF A;  2PBI A;  2DT6 A;  4AM3 A;  3HJE A;  4NUB A;  3VEP A;  2LMD A;  1HW2 A;  3JRI A;  3EUH A;  1WJA A;  4G94 A;  2VJ5 A;  2L54 A;  1W5S A;  1S29 A;  3IWZ A;  1HA8 A;  2MH2 A;  2RC4 A;  4EGZ A;  4BXX J;  2Q0O A;  4ZJZ A;  3LFK A;  2W85 A;  2OQG A;  5KNL A;  4A3J J;  1X1A A;  2OCE A;  5JVG F;  3VSK A;  1TTY A;  3BR0 A;  3ONQ A;  2E7W A;  2P8T A;  5LEK A;  3W2W A;  2LY9 A;  3HC7 A;  1TQP A;  5C3E J;  3WTU C;  3EPZ A;  1SVM A;  3S8P A;  4HV5 A;  3OYN A;  2A07 F;  2DYS H;  3H3V K;  3OYK A;  2K5C A;  1MW7 A;  2FMY A;  2IGK A;  5K7H A;  2CSO A;  2IA2 A;  3EYY A;  4I98 B;  4HLX A;  2ZJP F;  2MSY A;  2R7R A;  1AKH A;  3JW4 A;  3AFH A;  4AU7 A;  4B44 A;  4P5O A;  2CW8 A;  1ZR2 A;  1EF4 A;  1ZK8 A;  2WWY A;  2ZBK A;  1BR1 A;  2MFZ A;  5HVQ C;  3HUG B;  3GTQ J;  3ZQ7 A;  2WC2 A;  4W97 A;  1AU7 A;  1XS9 A;  1QNT A;  2BHZ A;  2LBF A;  1I3Q J;  2XB0 X;  2VPR A;  3W3C A;  3A01 A;  2CWE A;  2BHY A;  2W1O A;  4XRF A;  1S7E A;  4BE2 A;  3DTK A;  2XPV A;  1L0O C;  2F5E A;  3PFY A;  1MMS A;  2HXO A;  2OPT A;  1IV8 A;  4H4K C;  2IGO A;  3S3O A;  3BDD A;  1TW3 A;  4D7N A;  5L3E A;  4AYB A;  4MEX F;  2OC6 A;  3A1Y A;  2Y9Z A;  4RA2 A;  2IA1 A;  4EJW A;  3REO A;  5K5O A;  1MMG A;  1B59 A;  1A04 A;  3R4K A;  2BV6 A;  2BBY A;  2DDB A;  1U3E M;  1LFU P;  2ECB A;  4G7H F;  2OF7 A;  2NNY A;  2DFF A;  3CDL A;  2F5D A;  2R7O A;  4LG0 B;  2AXT C;  3WTV C;  1UFM A;  3S1Q J;  2VQH A;  3AL0 B;  4DYC A;  3GZ5 A;  5FLX K;  2QQ8 A;  1A31 A;  3PL8 A;  4AUX A;  5ILU A;  5CKT A;  4I7H A;  1Q1H A;  2Y0S N;  3CZ6 A;  3WGI A;  2LK2 A;  3CMM A;  4N9H A;  4Z2Y A;  1Y0N A;  4MO7 A;  1DU0 A;  3WE3 A;  2JUC A;  2RVC A;  1GXP A;  1SVO A;  1IRF A;  3H9G A;  4DZP A;  5CVR A;  2MD0 A;  2ELK A;  4DIQ A;  5E8G A;  2H1K A;  5GPA A;  3RZD J;  2JWT A;  4A3F J;  3HPG A;  2GLO A;  5TIS C;  5KVR A;  1FTZ A;  5D5X B;  2D1H A;  2LRD A;  3F8M A;  5IT3 A;  3BPV A;  5LGU A;  4BY1 J;  3UKG A;  4A3E J;  3BOQ A;  3K7A J;  2WA0 A;  3ELK A;  2M8G X;  2M3A A;  2P6T A;  4XLH A;  3ERM A;  4LOC A;  1WQ2 A;  5M5Y J;  2Q2E B;  4QSH A;  2CU7 A;  2JRM A;  5HOO A;  3CJT B;  2EB7 A;  2FU4 A;  3T1B A;  5D8K B;  3BJA A;  3KEQ A;  3KYD B;  4RM3 A;  1VQO I;  2E1N A;  1U8B A;  2X1E A;  4E7J A;  3DKX A;  4B3X A;  3HRU A;  3BG7 A;  2LY1 A;  3HHH A;  1FP2 A;  2OZU A;  2QLZ A;  4PFP A;  4XR6 A;  5EEH A;  3ABT A;  3M8J A;  3K9T A;  4DYR A;  2EPF A;  1NH3 A;  2ZC2 A;  2Y48 A;  3GX4 X;  3CC7 I;  4AC0 A;  5IYD J;  3LSK A;  2V1D A;  1DGR M;  2NVY J;  2OUM A;  2VPL A;  1I27 A;  4IRG A;  3J81 K;  2GXA A;  5D6E A;  2FQ4 A;  2R7D A;  2F2E A;  1ZAR A;  4FE7 A;  4G7Z F;  1MH3 A;  3FBI B;  2FEZ A;  2VOO A;  4HNT A;  3WG9 A;  4HW0 A;  1QPI A;  2V6E A;  3ZR8 X;  4ASN A;  3MMY B;  2QKL B;  3WU0 A;  2UWM A;  2VON A;  3FXL A;  1W7P B;  3GTO J;  1A5J A;  3E1S A;  2CYY A;  4M73 A;  2R4G A;  1HKQ A;  3A02 A;  1V4R A;  3GO5 A;  1O3S A;  5FFZ A;  5FB2 A;  3S2D J;  3CCU I;  3S17 J;  4DNC A;  1GVJ A;  4R8H A;  3RDI A;  1E3O C;  4UUT A;  2LLK A;  2LKS A;  1YI2 I;  2R7U A;  4RM2 A;  2HDD A;  2DCE A;  1GLN A;  3CES A;  5EF6 A;  1IJW C;  1QGP A;  4M72 A;  4ESF A;  3TO9 A;  1S72 I;  1K4S A;  1U8R A;  4PSW A;  3L09 A;  1IV6 A;  3OYI A;  2IT0 A;  1ZH5 A;  2A3S A;  3LOC A;  4RGU A;  3DBL B;  2ZXH A;  4BU2 A;  2BW3 B;  1IF1 A;  3BR1 A;  2PG4 A;  2VKD A;  2YU9 J;  4FX4 A;  2KJB A;  4F93 B;  4A69 C;  1QRY A;  4YEJ A;  1PUF B;  4A3L J;  3WU1 B;  3PIP F;  1RZ4 A;  2FRH A;  4CCN A;  3LA7 A;  1Y56 A;  3CC4 I;  4KN4 X;  4ENK A;  1R5H A;  1ZQ3 P;  4I09 A;  3PNT A;  2DYR H;  1BI2 A;  2LYC A;  3M1C A;  5CQG A;  5E3L A;  2VXD A;  2P7V B;  3MVP A;  4I2O A;  5JVT A;  3VYU B;  2XAH A;  3QPT A;  3QPH A;  5FLV A;  1K83 J;  1CF7 B;  1QA6 A;  3F23 A;  3TW6 A;  3IWF A;  5C4X J;  1UEL B;  1IN5 A;  1WI9 A;  5IYC J;  2XAF A;  4PJN A;  4IOA F;  1XPX A;  1AWC A;  1YG2 A;  5FGM A;  1R22 A;  4NB5 A;  5BNG A;  2WV1 A;  2G0E A;  1MMD A;  3IC7 A;  4YFN F;  3OY9 A;  2YS9 A;  2HVS A;  3M7G A;  4LLL A;  1MD0 A;  2P5K A;  4M3F A;  4DJA A;  3KP5 A;  1FNN A;  3FMS A;  3HRM A;  3MZH A;  4HST A;  5LFA A;  5CLS A;  2X1C A;  5HNH A;  4CDG A;  3F6V A;  3G3Z A;  3LQQ A;  2R0Q C;  2HNH A;  5D5U B;  3FMQ A;  1HW1 A;  2R7X A;  3TP3 A;  4F55 A;  5GTH C;  5IOZ A;  1GDT A;  5M3M J;  4NNJ A;  2JA2 A;  2EIM H;  5L3G A;  4RS8 A;  2DTR A;  1YE9 A;  3TGN A;  4AD9 A;  2JA8 J;  1T38 A;  1K78 A;  1JKO C;  2O0Y A;  4DW6 A;  4BHC A;  3IHU A;  2CW7 A;  1WJB A;  1LFB A;  1IXS B;  2R3S A;  3BC8 A;  4LIT A;  1RPW A;  5FKL A;  1GV2 A;  3WE2 A;  4CZC A;  2Z33 A;  2KIQ A;  4HX4 A;  3N97 A;  4M6Y A;  2ISY A;  4XL9 A;  3JAM K;  3CJN A;  2XAQ A;  4LFU A;  3SHF A;  2M87 A;  4ZYA A;  1MMN A;  4BQN A;  3H9J A;  4RAG A;  3RPU A;  1SMT A;  2JT1 A;  4KMU X;  2DOE A;  2L2O A;  3F22 A;  2HVR A;  5FJ8 J;  3W2A A;  1V54 H;  3OYJ A;  1MIJ A;  4ETS A;  4F7Z A;  2PX9 A;  3LSG A;  4RLQ A;  3BR5 A;  2P5L C;  3OYB A;  2BY0 A;  3BY6 A;  1QHH D;  1VQ9 I;  5CVI A;  1CGP A;  1W4M A;  3L00 A;  1HW5 A;  2VOD A;  1YJN I;  2IEK A;  2O3F A;  3T8R A;  2QGU A;  2F6C A;  4C3J J;  3MKY B;  1XGM A;  3ZQL A;  2CW0 F;  4C30 A;  2Z2S B;  4BQA A;  3HPH A;  4L9T A;  2RNG A;  1MBK A;  2CV0 A;  3BTI A;  4WXH A;  4B09 A;  5BPD A;  1ACI A;  1X4O A;  3RKW A;  1LVK A;  2CUJ A;  3FDY A;  1U9N A;  4G9Y A;  3FXJ A;  1UST A;  3GZN B;  1J5Y A;  4WXC A;  3OV8 A;  2JVH A;  2MYS A;  4ZTF A;  1R1V A;  2IRF G;  1T08 B;  5FD6 A;  3WOD F;  4ZZL A;  4KFC A;  2Y0S A;  2YX7 A;  3ZQI A;  3U1K A;  5FKK A;  3DBH B;  3H0D A;  1VQN I;  4FE4 A;  2OJE D;  4JQF A;  5ICE A;  1MBH A;  4FET A;  2VKE A;  1WJ5 A;  4BBR J;  2VL8 A;  2CFX A;  4KA4 A;  1MJA A;  4BDZ A;  1MKM A;  3CUQ C;  3OR1 C;  1R23 A;  4MIM A;  4HG2 A;  4XLA A;  2X6X A;  4IHT A;  4P96 A;  2M1B A;  1I1G A;  1HCR A;  1A36 A;  5LHH A;  2L7F P;  1I6X A;  4EJT A;  4IL6 C;  1YYV A;  1VQ7 I;  4WK8 F;  1KQ8 A;  3AAF A;  3PJR A;  1N77 A;  3T8T A;  5EYR A;  5J47 A;  3ZP5 A;  1Q1V A;  2NNN A;  2V79 A;  2JZY A;  1W1W E;  5J8C A;  1VFC A;  1LE8 A;  2ID6 A;  3LSH A;  3KCC A;  4AYB N;  3JRF A;  5FRO A;  1EH6 A;  4DYQ A;  1TWA J;  1AOY A;  1E2X A;  3HOU J;  3SQN A;  2CG4 A;  5J1U A;  4Z6Y A;  4NC8 A;  2KRF A;  1WH5 A;  2DA1 A;  4BS9 A;  3DP7 A;  3JTG A;  2KZG A;  5AIQ A;  1W7P D;  1VQK I;  3DWL E;  4KN7 X;  3V4G A;  3PSF A;  1ZG3 A;  4XBF A;  3BQZ A;  5GAH J;  2NS8 A;  2XPW A;  3NRV A;  2IW5 A;  3O8G A;  4EQQ A;  4AIJ A;  1JKR C;  2GXG A;  1VQ5 I;  4CCK A;  4LK1 F;  4CH7 A;  4EGY A;  1UHS A;  1UG0 A;  4DBR A;  4MQV A;  5DV5 A;  1H0M A;  4U7D A;  3QOD A;  4BE1 A;  1XDS A;  1JGS A;  3L2R A;  2R7T A;  1YX3 A;  1LDD A;  2AHQ A;  4ZDL A;  3IUO A;  2R7V A;  3EUA A;  2E7X A;  3P9I A;  4AID A;  3LST A;  3NQO A;  3KP2 A;  4ZH4 F;  2UUZ A;  4KIT B;  3IV5 A;  4S0H B;  3JRD A;  1D1B A;  2ELJ A;  4Y4R A;  2CH0 A;  2LRE A;  3H5N A;  5K5R A;  3K1N A;  4WWC A;  2M0M A;  4A3C J;  2K3P A;  3V7R A;  3QOP A;  3S3M A;  4E4H A;  2CJJ A;  4HZF A;  4A3B J;  4EAT A;  1Z77 A;  3BR2 A;  4XKW A;  4HBL A;  5JHU A;  3PO3 J;  2EV5 A;  5BQT A;  1K79 A;  4UUS A;  4M3E A;  2TRT A;  4AVZ A;  1S5L C;  2XV4 S;  1HLV A;  2CS3 A;  1BJA A;  3OIP A;  3ABU A;  5IT9 Z;  3BG9 A;  3KFW X;  1V5F A;  5H20 A;  5JFR A;  3I54 A;  1VQM I;  3FHZ A;  1IRZ A;  3I0T A;  1RNL A;  3KEO A;  3TKY A;  1WKM A;  2WB1 N;  3CUQ B;  4YFK F;  2NS0 A;  3F8N A;  2A05 A;  4G6T B;  3CD6 I;  1MBF A;  4NC6 A;  2FBH A;  4U88 A;  1YLF A;  5IP9 J;  1D5V A;  5HS9 A;  1W5T A;  2XAS A;  3L1P A;  4OIQ F;  1OCR H;  1G8X A;  2DOF A;  2X48 A;  1DP7 P;  3DTI A;  1S7O A;  1XMA A;  1EKE A;  2GOX B;  3GLX A;  3Q0W A;  3LSR A;  2JPB A;  2QEX I;  1CQT A;  4ESJ A;  2HVQ A;  1F43 A;  4EJO A;  4RB0 A;  2PLY A;  2QYO A;  2MLG A;  3F8C A;  3JRG A;  2X51 A;  2JN6 A;  2C6Y A;  4CIC A;  3GLL A;  1FOX A;  4BEH B;  1KGS A;  2KDZ A;  4ANJ A;  2DA4 A;  2D2W A;  3MN2 A;  4LG3 A;  4V2F A;  1X3Z B;  2FNP A;  3VSL A;  1JUM A;  2ME0 A;  3CO6 C;  2HKX A;  4RAY A;  1XSX A;  3CCM I;  3DCF A;  1T2K A;  1R00 A;  2V6C A;  4JOM A;  3W2V A;  2PJR A;  1G3S A;  4FAS D;  1D0X A;  1PP8 F;  4BGD A;  3F21 A;  3WTX C;  4QWQ A;  3D1N I;  1VQ6 I;  4P9U A;  5HS7 A;  3P5J A;  1SD7 A;  1W5C C;  2KLO A;  2ISZ A;  5JI6 A;  2O5R A;  1HXD A;  3M9A A;  1U5T A;  1N25 A;  2EIJ H;  3I59 A;  3G6E I;  1YJW I;  1MNE A;  1I6H J;  1IRX A;  4E70 A;  4B43 A;  4CUG A;  3IAM 2;  2NOG A;  5LRR A;  4BYY A;  1J0R A;  1TW2 A;  2EA2 A;  5ERI A;  2CMP A;  4IRH A;  1ZGW A;  2JJ7 A;  2JUG A;  2XDV A;  3BZK A;  1T33 A;  2F48 A;  2ZME A;  1MDM B;  1WCM J;  3HOW J;  3GZ6 A;  2NXN B;  3ZQG A;  3HRT A;  1MND A;  2UXN A;  5F27 A;  4QIW N;  1OYY A;  3WGG A;  2KFD A;  3CLQ A;  1ETO A;  3JTH A;  3FXR A;  3I3L A;  1R49 A;  2MAB A;  1LQ1 A;  5E1X A;  1YJ9 I;  3F72 A;  2KL4 A;  5FLM J;  1FZP B;  1O7F A;  3DBR B;  4XIC A;  2QKM B;  2G9W A;  2QUF A;  4M74 A;  1ZRD A;  3GUD A;  1J9I A;  2IA0 A;  1OCZ H;  2EZL A;  1TLH B;  9ANT A;  3F9K A;  4E7I A;  1ZRF A;  2ZSH B;  4WX9 A;  2XHK A;  4YG2 F;  3I53 A;  1WZ2 A;  1NG7 A;  2DU9 A;  3CJQ B;  5L3C A;  3FKJ A;  3DTE A;  2LFB A;  3H35 A;  3T0Y A;  1FTT A;  3M4O J;  5GAD J;  4BNC A;  1DUX C;  4XRS G;  3JSP A;  2B9S A;  2QBY A;  2GBY A;  1UMQ A;  2F5F A;  2XKO A;  2KIF A;  3S16 J;  2Y75 A;  2FQ3 A;  2DT5 A;  5IPA A;  3N4M A;  1FYL A;  1XCB A;  3PSI A;  4GYI A;  4AVP A;  3OSG A;  2EFQ A;  2DMP A;  4G6D A;  2XC7 A;  1ZRC A;  2LOO A;  3H5A A;  2IS4 A;  5E79 C;  5ICC A;  3S14 J;  2VJJ A;  2R92 J;  2COM A;  2EK5 A;  5M3F J;  5LHG A;  4PSX A;  3QPL A;  4A0Y A;  2BYV E;  4II2 A;  3I64 A;  4ENN A;  2DOD A;  4LLG F;  1ZG5 A;  3WHC A;  3J80 Z;  1I5Z A;  4XNF A;  3GTK J;  4I01 A;  3VPR A;  5E8I A;  3DLL F;  1REP C;  3VOE A;  4P9F A;  5E3O A;  3WTT C;  4HSR A;  4MLO A;  3HGG A;  2L02 A;  4EMS A;  5F6F A;  1U78 A;  4ZTJ A;  3ZQC A;  3PQK A;  3ULQ B;  1G3T A;  1H8A C;  2VQL A;  4IOC F;  3MD2 A;  3GFI A;  3OWT A;  3HBL A;  2M34 A;  1VND A;  4M9S A;  3E0J B;  3SJM A;  3HM5 A;  5E3N A;  3OIO A;  2E5Z A;  4A3M J;  1TL8 A;  4UUV A;  1XCV A;  1DPU A;  5FKM A;  1UB9 A;  5BPI A;  4XQF A;  1P9Q C;  3W6J B;  2P5V A;  3MEX A;  1I50 J;  1U0J A;  4HAM A;  2LDU A;  3HOV J;  5D4S A;  3GTG J;  5KHD A;  3W6K B;  1UZC A;  1ZYR F;  4JP0 A;  4M71 A;  1OR7 A;  2Y31 A;  3AG1 H;  2L9S A;  3K0L A;  3SZP A;  4B8X A;  1Y8Q B;  1FY7 A;  2DA6 A;  1MBJ A;  1MZB A;  1OCO H;  1U2W A;  5EGO A;  2JK3 A;  4NC7 A;  1YS6 A;  3CTA A;  3KE2 A;  5CVV A;  5J6X A;  1B8I B;  4CYC B;  5HDG A;  1RKW A;  2EQR A;  1BI0 A;  1P6R A;  1EA3 A;  3OMY A;  2LP0 A;  2EZI A;  3DF8 A;  2QSG X;  1HOM A;  2R5Z B;  3I58 A;  3OOP A;  4HPQ A;  2ZO4 A;  3ZRG A;  1KU3 A;  2FSW A;  2BVL A;  4HF1 A;  2E35 A;  1YRN B;  2H1L A;  3V8J A;  1X1B A;  1XGS A;  2RN7 A;  3CO7 C;  2LNB A;  2ZXW H;  5DD4 A;  2FOW A;  2IPQ X;  3OYM A;  2J5O A;  4A3I J;  4ZDP A;  1PDN C;  1LVA A;  2OQR A;  4RGX A;  2HZD A;  3BCA A;  1IN7 A;  3ZPL A;  1XGN A;  3FXQ A;  3M8E A;  1G6N A;  1PJR A;  3J7A O;  1ZR4 A;  1POG A;  2F4M B;  2E2I J;  3QU6 A;  4E7L A;  1QU3 A;  3ZN0 A;  4YIR X;  5IY5 H;  2E19 A;  1EH8 A;  1VF9 A;  2VT3 A;  1SD6 A;  4S05 A;  3ECO A;  1IN4 A;  1V3F A;  3C2B A;  1K6Y A;  3I71 A;  1ZEL A;  1ENH A;  2L9R A;  3GEZ A;  3VWB A;  2DDA A;  5DYM A;  3G71 I;  1Z1D A;  2K4J A;  3BP8 A;  1IRG A;  2KDO A;  2WAQ N;  3C3W A;  3BLY A;  3A0B C;  1T0F C;  1J59 A;  1KU2 A;  3HG9 A;  4L0Z B;  1FBS A;  1OKR A;  1O4X A;  3LMM A;  1F4K A;  4IHV A;  2WB1 A;  3IP4 B;  4NQW B;  4X1E A;  2QQB A;  3BG3 A;  4PCQ A;  4GDF A;  1P7J A;  2PQ8 A;  4OOI A;  1ZTR A;  3MZ8 A;  2O6G E;  1W36 C;  3OYG A;  2DJI A;  2GA1 A;  2VOP A;  4LGW A;  2TDX A;  1KZH A;  3I9V 2;  5H6Q A;  1E17 A;  1TT5 B;  3C1D A;  5K5Q A;  4RMN A;  4X0G A;  2RQP A;  1Z7L A;  2RAE A;  1S7A A;  2VBW A;  1J75 A;  2MA3 A;  2E2H J;  2DQL A;  5E18 F;  2UXX A;  3BG6 A;  5ILV A;  1VQL I;  3BZC A;  4DBQ A;  3ZMZ A;  3CCS I;  4AIK A;  1FLI A;  2EBI A;  2CO5 A;  2H94 A;  2LY2 A;  3MWM A;  2OBP A;  1NK2 P;  2NVT J;  1WH7 A;  3E7L A;  1USS A;  3CCL I;  4QLC U;  2A61 A;  1ZKG A;  2FD5 A;  5TRD A;  1JKQ C;  1FBU A;  2HWV A;  1BIB A;  2G7H A;  3M3Y J;  2M7A A;  2QM3 A;  3HUG A;  4FCY A;  3S1R J;  1R5I D;  4XON A;  1A6I A;  2DXI A;  2HQR A;  5CJ9 A;  3S3N A;  5ED4 A;  2VB6 A;  1SAU A;  4UVC A;  1KA8 A;  4NHJ A;  1EJ9 A;  1TT0 A;  4N4O B;  3F0C A;  3E97 A;  1UHW A;  2P4W A;  3ZQF A;  4KNY A;  3H9Q A;  2XPU A;  4PGH A;  4PDK A;  3B6A A;  3PO2 J;  3KP7 A;  3CDH A;  2VLA A;  5D5W B;  2OTJ I;  4UB6 C;  1MJ9 A;  4HYE A;  3V8L A;  3H3U A;  3S15 J;  2HKO A;  2JQ7 A;  1F9N A;  1X1C A;  3ZQQ A;  2VAS A;  3HGY A;  5C4J J;  3ASO H;  1NTC A;  3K4C A;  3FM3 A;  3EET A;  4LG0 A;  4EM2 A;  3J7Y J;  2DA2 A;  3H1C A;  1X1D A;  2M5W A;  2D45 A;  1YOV B;  1IN8 A;  2KPM A;  5DTD A;  3QAH A;  1FYM A;  5TGT A;  2FML A;  1GV5 A;  1G3W A;  4K2E A;  4OMY A;  2HOS A;  4OIR F;  4LLN A;  2CUF A;  3BT9 A;  2VE9 A;  4IHY A;  4EEF G;  3ABK H;  1OYI A;  4GXO A;  4IHS A;  2E1M C;  2QCO A;  2A69 F;  3CDI A;  1O7L A;  5A2Q Z;  2M45 A;  1B9N A;  1OCP A;  2GWR A;  3DU5 A;  1OQY A;  2DK5 A;  4KIC A;  1BW5 A;  4H0E A;  1Z0X A;  3ABL H;  2DK8 A;  1JJ6 C;  1I1S A;  1UG2 A;  4XLE A;  4U7B A;  4HA8 A;  4O5V A;  2KIU A;  5DCM B;  3RI4 A;  6PAX A;  2CQN A;  4LD5 A;  1XMK A;  3SYT A;  2VN2 A;  4A5N A;  1RKT A;  3K2A A;  2F4I A;  4EJV A;  2IJL A;  2LR8 A;  1O3T A;  1L3L A;  1FPQ A;  2HQA A;  2Q2E A;  3O8H A;  1K61 A;  2OA4 A;  2HXI A;  3Q3S A;  4XOP A;  3RKX A;  4IHX A;  3B73 A;  4XMY A;  4RAZ A;  2V7F A;  1QBJ A;  2X6W A;  3L2U A;  3MKZ A;  2YR2 A;  3GYH X;  4PJM A;  2Z99 A;  1YS7 A;  3LWF A;  2QF7 A;  3IH2 A;  3RYP A;  4ITV A;  2MLK A;  3RZO J;  3EYI A;  3RQI A;  4A93 J;  2R7F A;  2OTL I;  1LDJ A;  3T5X A;  2DMN A;  3TO7 A;  4L5J A;  3TOA A;  3BRO A;  3E5X A;  1OJL A;  1F36 A;  4A6E A;  1KON A;  4HLY A;  2ZNZ A;  1QVU A;  1FX7 A;  2XKP A;  3WGH A;  2BY2 A;  1DDN A;  1XSV A;  1OPC A;  4CXF A;  2I10 A;  2R7Q A;  3VB2 A;  5CVJ A;  4ENM A;  4XOR A;  3M07 A;  4I99 C;  1I39 A;  5HS8 A;  2MBF A;  4BKX A;  1JI8 A;  2Y69 H;  3K10 A;  3ECH A;  4KIF A;  3G4S I;  5F0H A;  1W7P A;  1ON1 A;  2LF8 A;  1OFC X;  2VXZ A;  2XRL A;  5DUK A;  5F64 A;  1QQI A;  1T56 A;  4YFX F;  4UNO A;  3PIO F;  2ZB9 A;  3JRA A;  1MMA A;  2QQ9 A;  2QWW A;  1VQ4 I;  4E7S A;  2BY1 A;  3CQZ J;  3FX3 A;  3JRB A;  1PP7 U;  3HXL A;  2IP2 A;  1Y8R B;  2KIM A;  4AIH A;  3OYD A;  1FEX A;  3IH3 A;  1ETX A;  2X85 A;  2O8K A;  1TWF J;  3RCO A;  1IW7 F;  2M2E A;  2G7U A;  3BJO A;  4MFD A;  5CVU A;  3K4B A;  2E1C A;  3OR2 C;  2MH9 A;  2K02 A;  1MH4 A;  2WTE A;  5H6R A;  2YX4 A;  4CCM A;  2K40 A;  4BH9 A;  3E5U A;  2IAI A;  2K9L A;  2BW3 A;  4C3H J;  2Y30 A;  4U87 A;  1BJZ A;  5LLQ A;  2PI0 A;  1XTA A;  2E1M B;  3V7C A;  5JHF A;  1XSD A;  3ZGK A;  3CMY A;  1TC3 C;  4LB6 B;  2KZV A;  1BA5 A;  3NWS A;  4D9J A;  5HOD A;  2GM4 A;  2KJC A;  4F52 A;  1OLT A;  1X3W B;  1ZLJ A;  4XSZ F;  1PUF A;  2H8R A;  2WV0 A;  1IXR C;  5ICG A;  3AG2 H;  2VJ4 A;  2X6Y A;  3SFZ A;  3LA3 A;  2DMT A;  3J80 K;  2HQ5 A;  1MSE C;  2XGE A;  1KQ0 A;  4CO8 A;  2DO7 A;  2VBZ A;  4LJZ F;  4WF2 A;  1R71 A;  3EUH C;  1IUY A;  3IH4 A;  3AKZ A;  2IXS A;  1LUJ B;  2X6O A;  1CF7 A;  2XGC A;  3HOX J;  3TQN A;  4EM1 A;  1WHU A;  2AS5 F;  2DI3 A;  4BXU A;  5LHI A;  2YPR A;  2L4M A;  1TZL A;  1IG7 A;  2LTP A;  4A3K J;  1FMV A;  2ZCW A;  4P55 A;  5LD2 C;  1ERD A;  3R61 A;  2V9K A;  1HDD C;  1DU6 A;  1FJL A;  3B02 A;  4Y17 A;  3UR3 C;  2WAQ A;  2RV8 A;  4HX7 A;  2CUZ A;  3FXO A;  1JT6 A;  2ESN A;  3HOS A;  5IOY A;  3OS0 A;  4L5E A;  2CRG A;  2Y2Z A;  3H5R A;  5GAG J;  1Z67 A;  3CCQ I;  4E7H A;  5J1R A;  2P0W A;  1P2F A;  2QSF X;  3O2P E;  1U6G A;  3LAP A;  2GXB A;  2ID3 A;  3C18 A;  4IEJ A;  3LSP A;  3L2W A;  3FXK A;  1RIO H;  2PMZ N;  2A5W A;  2STT A;  1DGW Y;  3JRH A;  1XD7 A;  2GAU A;  3GW2 A;  4IQJ A;  1OYW A;  4MEY F;  1FBQ A;  3GCM A;  1NHA A;  2ZXJ A;  3K4L A;  4JX5 A;  4MHG A;  5EG0 B;  4MNU A;  3HL2 A;  4BJ5 C;  5FFX A;  3HHG A;  5J4V A;  1O57 A;  3WTW C;  4KIG A;  1QHG A;  1XX5 A;  2CQ7 A;  3WTS C;  2DFI A;  2XGX A;  2P6S A;  2DW4 A;  4QPQ A;  1R1U A;  1B9M A;  2H8W A;  1YIO A;  1MBG A;  3DLA A;  5ILS A;  5DM7 F;  4Q48 A;  1BOA A;  5LRS A;  3J81 Z;  1BL0 A;  2F4O B;  1LFP A;  3A03 A;  1FP1 D;  4B1R A;  2XF7 A;  4MQ9 F;  4UHT A;  2L7M P;  3TOB A;  3WHB A;  2NOJ B;  1ZAO A;  3ZXS A;  2HPM A;  1H9T A;  3CF2 A;  4C2U A;  1STZ A;  2Z3Y A;  4ZYD A;  1R9T J;  4XN0 A;  2LKP A;  2V9V A;  3ZMD A;  2R5Y B;  5K7F A;  5LEJ A;  1B72 B;  4OIO F;  4ABZ A;  2IS1 A;  2H09 A;  3I55 I;  2NRA C;  2VC0 A;  3TED A;  3F6O A;  4M3G A;  4Q47 A;  1YX5 A;  2ADU A;  2KQR A;  1YIJ I;  2W25 A;  3SDB A;  1FC3 A;  2DFH A;  5D5V B;  3BTL A;  1P4A A;  4FTH A;  2W57 A;  3K4N A;  1IDY A;  2M30 A;  1IUF A;  3KPH A;  2RKH A;  2WAE A;  3HIF A;  3DPT A;  1BC7 C;  2KRC A;  3MQ0 A;  3KLO A;  1OIS A;  2JVG A;  3ZMT A;  3HYI A;  4C2M J;  1UHM A;  5BS6 A;  3DFG A;  3BQY A;  1HBX G;  4CZZ A;  1IO2 A;  3HSE A;  2W84 A;  4PGG A;  1OCT C;  1QZY A;  2ZFW A;  4GRI A;  1K4T A;  2VE8 A;  3LAJ A;  1W36 D;  2JRT A;  4Y15 A;  3HSF A;  1T98 A;  2ICW G;  2MC3 A;  4DZJ A;  1TQM A;  1FMW A;  4AWX B;  2VJI A;  5CQE A;  4YII A;  3CCY A;  4RB3 C;  3GXO A;  3RJP A;  3F8F A;  1JHF A;  3SZT A;  1WJC A;  5F1J A;  5FO5 A;  3L2V A;  2O9L A;  3S32 A;  3OYE A;  5HLG A;  5KCM A;  5FRN A;  3W6V A;  1B4A A;  4LB5 A;  1P4W A;  1JTX A;  1FSE A;  2LF7 A;  4FHT A;  3QPS A;  3HOY J;  2O03 A;  1BI3 A;  3FZV A;  3L7W A;  3S2H J;  3VFZ A;  3I56 I;  1A6Q A;  1ETK A;  4HQE A;  3EUK L;  1AKH B;  2ECC A;  1VZ0 A;  5D6F A;  4OWR B;  2B7E A;  1AA7 A;  2R7S A;  1PYV A;  1FOW A;  1R4M B;  3AG4 H;  2XAJ A;  2LBF B;  4HRI A;  2AO9 A;  3A01 B;  1B6A A;  3DPL C;  3BR6 A;  4OMZ A;  4OAZ A;  3ZOB A;  1MNM C;  1XC5 A;  3SFI A;  3SEZ A;  3CME I;  1FYK A;  1VI0 A;  2LH9 A;  3K1P A;  1RRJ A;  5EZG A;  1VQP I;  1Y1V J;  5E20 A;  1IAW A;  4DGW B;  3SDG A;  2WY7 Q;  4FT8 A;  3CCE I;  2K4B A;  1R6R A;  2DAO A;  1T8I A;  2IBD A;  4IF4 A;  2V9P A;  5E1W A;  2PMU A;  4KDP A;  1QZZ A;  2ZKZ A;  1Z6R A;  1WRJ A;  4II3 A;  2W4S A;  1YTY A;  4QTR A;  3O3K A;  2OV7 A;  1ZN2 A;  4D7M A;  1VTN C;  1YHQ I;  3LFU A;  5HLH A;  1R5G A;  3H92 A;  3TBI A;  5CYV A;  4W1U A;  1V5E A;  2XSJ C;  2BGC A;  5B1A H;  3KP3 A;  3TDU C;  3K4M A;  3PUB A;  2H6B A;  1P92 A;  1BIA A;  2Q8K A;  4FIS A;  4LMY A;  3ISP A;  1TWH J;  3K70 C;  1Z7U A;  3FIS A;  2ZFU A;  3MZY A;  1J2X A;  1KYW A;  1H88 C;  4I02 A;  3RSN A;  2PEX A;  3PNY A;  2NS7 A;  1ORK A;  5IP6 A;  3JAM Z;  4NBQ A;  3R60 A;  4TV7 A;  2EZK A;  1IGN A;  2L3D A;  2R93 J;  4D1Q A;  1QO0 D;  4FQG A;  3GF2 A;  4HDU A;  2E60 A;  3DEU A;  4IRI A;  4CCO A;  2K86 A;  2R7Z J;  2EZH A;  3OYF A;  5M5W J;  2KT0 A;  3K69 A;  3QWL A;  1O3Q A;  4RLF A;  1XDU A;  4I76 A;  2F5C A;  4EV0 A;  4C9Y A;  2AXL A;  1GHC A;  2M8E A;  2LKX A;  3GBG A;  4A3D J;  3MCZ A;  1FT9 A;  1OMI A;  1Z05 A;  2HQN A;  4HDV A;  2XF6 A;  2V26 A;  3CUQ A;  2EV6 A;  5BMZ A;  3OSF A;  2RGV A;  2H6C A;  3PFI A;  4MFE A;  2CV2 A;  1GT0 C;  1FOK A;  3H36 A;  2LVS A;  3FIW A;  1HKT A;  1T95 A;  1E3H A;  1B1B A;  2QA4 I;  3B6C A;  3LSI A;  4ON0 A;  3JR9 A;  1KYZ A;  3IRR A;  4MGR A;  2JSC A;  2W7N A;  4BXF A;  3V42 A;  1U9O A;  2J5P A;  4XOT A;  3ZMV A;  4BEH A;  2LC2 A;  3S1N J;  3QP5 A;  4BAY A;  3C7J A;  2ZJ2 A;  2XIG A;  2EIL H;  1YW9 A;  2FX0 A;  4U0W A;  3TP0 A;  5HLT A;  2X4H A;  4BBS J;  3DV8 A;  1NG6 A;  1JUS A;  2VQG A;  4RGR A;  1QZE A;  5FKO A;  1MBE A;  2M4G A;  3FMR A;  3I4P A;  4N9I A;  1J7K A;  3ZCO A;  2XRN A;  2D5V A;  5F1R A;  1KQ9 A;  4Y52 J;  3K2Z A;  3VYR B;  5J1Y A;  2X9D A;  4BJT A;  4GGG A;  1G59 A;  5E1Z B;  4YEL A;  4PZJ A;  4EVI A;  2OZ6 A;  3BTJ A;  4CSW A;  3E6B A;  5B5E C;  1H89 C;  4J01 A;  4V2G A;  5B3S H;  1SD5 A;  3E3V A;  4KT6 A;  2FF4 A;  2EFO A;  1R58 A;  2WY8 Q;  4ENJ A;  3SXY A;  5GTI C;  2EA4 A;  2OAZ A;  4RB2 C;  2W48 A;  4KIB A;  2FE3 A;  2VUM J;  2HYG D;  1HKS A;  4XLC A;  2PMZ A;  1MDM A;  1ZLK A;  2RRE A;  3Q0U A;  2W82 A;  1ITY A;  4CCL A;  3BTC A;  3GTL J;  2K85 A;  1RUN A;  1LEA A;  4A12 A;  3GTP J;  2N8G A;  4IPA A;  1TNS A;  4YRV A;  1X58 A;  2QVO A;  2VKH A;  1X4P A;  1SD4 A;  3PUF A;  3J7Z I;  2IS6 A;  2PN6 A;  5DUI A;  2WBM A;  3RYR A;  4L5I A;  1ZG1 A;  4N4N B;  2DOA A;  2ESH A;  4BY7 J;  4ESB A;  1TWG J;  2XVC A;  1HC8 A;  1H9G A;  1X2N A;  3BWG A;  4ZYG A;  2L7K A;  2Z16 A;  2V1U A;  2XF5 A;  4BUP A;  1HSJ A;  3R0J A;  3O6B B;  3WU2 C;  2BXZ A;  3X2Q H;  2EFW A;  1F5T A;  2NYX A;  4G8X A;  1JE8 A;  4D0P A;  2KRH A;  3OS2 A;  3IAS 2;  1ETQ A;  3OYL A;  1R4N B;  4FX0 A;  1F1Z A;  1RI7 A;  4E7K A;  4JBA A;  3DKY A;  3KP4 A;  1G3Y A;  4PK4 A;  5D4R A;  3JRE A;  4UY8 I;  1IZ1 A;  3IL2 A;  2K9M A;  3G73 A;  4RB1 A;  2MW8 A;  1YQA A;  2DMU A;  3G1L A;  3BPX A;  4YIF A;  2JA7 J;  1YW7 A;  3OS1 A;  4C3I J;  2HDC A;  2M7B A;  1SC7 A;  1ZRE A;  4L0Y B;  2K27 A;  4BQQ A;  1X3U A;  3RIR A;  4B47 A;  3CP2 A;  2KKO A;  1A35 A;  3ERE D;  1T39 A;  2HZT A;  4XRS A;  3COA C;  3FK6 A;  1JTY A;  2ZJQ F;  2GQQ A;  5DM6 F;  2O7O A;  3F8B A;  2B0L A;  4I6Z A;  1JXS A;  3OYA A;  1JJ8 C;  2JPC A;  4DOZ A;  2P7C B;  3Q9V A;  2NAZ A;  1Y39 A;  4XLF A;  5D8L B;  2K3F A;  4G6Q A;  1SFE A;  4Y3O A;  5HNF A;  2A6E F;  1D8J A;  1P4X A;  5KK1 A;  1K78 B;  5TJJ A;  1HST A;  3NEU A;  3E6C C;  1RET A;  3FXM A;  1UAA A;  3QQA A;  2DA3 A;  3LSJ A;  2DLL A;  1GUU A;  2A68 F;  3ESW B;  3VDX A;  1OCC H;  1X1P A;  4XLN F;  4E7Z A;  1K7A A;  1PUE E;  1G2H A;  4GYG A;  1Z91 A;  2OD5 A;  5AIP A;  1YW8 A;  2LD5 A;  4A2U A;  4UB8 C;  3GFJ A;  2W00 A;  1P7I A;  1X19 A;  5IP7 J;  4PJ0 C;  5E17 F;  5ICF A;  3OOU A;  1FOY A;  4M6X A;  1YO5 C;  2FXA A;  3QYF A;  3WTY C;  4XN3 A;  4BHB A;  1SAN A;  3A4C A;  4HNV A;  1DQU A;  1S8N A;  4RBO A;  5EJC A;  2QZ8 A;  5CPR B;  4G7O F;  2HOA A;  4ZZD A;  3LQR A;  5KAF C;  3KYC B;  1ETV A;  4PJL A;  2MC4 A;  4Y13 A;  3L2Q A;  1S9H A;  1AHD P;  5IT9 K;  2A6T A;  4I0B A;  4L18 B;  2EFP A;  1APL C;  4CYD A;  1B8I A;  4PFO A;  4CYC A;  2FUG 2;  3GVA A;  3K4J A;  5FRM A;  3M1E A;  2DMQ A;  2R5Z A;  1V55 H;  4HOB A;  4A5M A;  4D5F A;  2L7Z A;  2FA5 A;  5K1Y A;  1VQ8 I;  4WXD A;  3WG7 H;  4A3G J;  3DPU A;  1YRN A;  4IVN A;  2FJ1 A;  1X2M A;  3HOT A;  2RQQ A;  2ACJ A;  3K6G A;  3UNG C;  4XK4 A;  1LB2 A;  2Z5U A;  3TO6 A;  4U0V A;  1N78 A;  3S1M J;  2MGQ A;  4E6K G;  1ONV A;  3ASN H;  3LL7 A;  4A0X A;  3JRC A;  1R7J A;  2F5V A;  1XB4 A;  1IXC A;  4A6D A;  2OCC H;  3D5L A;  1O3R A;  1FWZ A;  2ZNY A;  5F08 A;  1XG1 A;  5LBQ A;  5F04 A;  2GIV A;  2VC1 A;  1YIT I;  3CF5 F;  2HFH A;  4IQ4 A;  2BE5 F;  1YFH A;  1BOB A;  2YU3 A;  3DQV C;  4J19 A;  4B3A A;  1SAX A;  4B48 A;  2M4K A;  1BI1 A;  1BW6 A;  4M6V A;  1WJE A;  2HYJ A;  4J00 A;  1FIA A;  4XRM A;  3OYH A;  2BVM A;  1M1E B;  4IKF A;  3IKV A;  5FD5 A;  2UV1 A;  3HOZ J;  4X6A J;  3C2H A;  3FHN A;  1SFU A;  3P9K A;  2BZT A;  4U0Y A;  3HEF A;  1R1T A;  2JA5 J;  1SFK A;  4DQ2 A;  4NQW A;  2QSH X;  1LE8 B;  4B4C A;  1JT0 A;  4BL0 B;  2BXY A;  5K7Z A;  3EQL F;  1Z3Y A;  2EH3 A;  4HQM A;  1Y0U A;  5GPC A;  2CGP A;  3QP6 A;  4LK0 F;  4BHP A; 
#chains in the Genus database with same CATH homology
 4XRS G;  3A03 A;  5EDN A;  4B1R A;  2L7M P;  2GBY A;  3WHB A;  3HDD A;  1UMQ A;  1U8B A;  1R9T J;  3S16 J;  2R5Y B;  2XGD A;  2DTZ A;  3DEW A;  5K7F A;  4JX6 A;  5GP9 A;  1B72 B;  5IPA A;  4ABZ A;  5DS9 A;  3TW7 A;  3ZQH A;  3TED A;  5EZH A;  5F0F A;  4M3G A;  3OSG A;  2DMP A;  4DYR A;  4AC0 A;  5IYD J;  2TCT A;  3BTL A;  4FTH A;  3S14 J;  2JMW A;  2R92 J;  2NVY J;  1GVD A;  1IDY A;  1ETW A;  1IUF A;  5M3F J;  2K9N A;  5EEA A;  2FQ4 A;  3QPL A;  3BR3 A;  4FE7 A;  4D5C A;  1MH3 A;  4C2M J;  3BQY A;  3HKZ N;  3WHC A;  1QPI A;  1OCT C;  3GTK J;  2CUE A;  3VPR A;  3GTJ J;  3GTO J;  1A5J A;  2DA7 A;  5E3O A;  4MLO A;  3HGG A;  3A02 A;  4UUS B;  4DZJ A;  3S2D J;  1U78 A;  3S17 J;  3ZQC A;  1E3O C;  4UUT A;  2LLK A;  3CCY A;  1H8A C;  1NK3 P;  4IHW A;  2HI3 A;  3HBL A;  3BG5 A;  2M34 A;  1VND A;  2HDD A;  5F1J A;  2O9L A;  3SJM A;  3HM5 A;  5E3N A;  3OIO A;  1W0U A;  5EF6 A;  4A3M J;  1IJW C;  3W6V A;  1IDZ A;  5FKM A;  1JTX A;  1QVT A;  3HOY J;  1I50 J;  3QPS A;  1IV6 A;  3HOV J;  3LOC A;  3GTG J;  3S2H J;  2M9H A;  1ETK A;  4JP0 A;  2JA6 J;  3BR1 A;  1AKH B;  2ECC A;  2YU9 J;  2Y31 A;  2DA6 A;  3HB9 A;  5EGO A;  1MBJ A;  2JK3 A;  2VI6 A;  4A69 C;  1QRY A;  2HOT A;  1PUF B;  1B8I B;  4A3L J;  4CYC B;  1RKW A;  2AO9 A;  2EQR A;  3A01 B;  1HF0 A;  3BR6 A;  2LP0 A;  3ZOB A;  1MNM C;  1XC5 A;  2EZI A;  3SFI A;  1HOM A;  2R5Z B;  3I4M J;  1ZQ3 P;  3NAU A;  1VI0 A;  5EZG A;  1Y1V J;  3Q0V A;  3SDG A;  5E3L A;  1MSF C;  1YRN B;  2IBD A;  3MVP A;  5FKN A;  5FLV A;  1K83 J;  4QTR A;  3TW6 A;  4A3I J;  5C4X J;  5IYC J;  4XID A;  4D7M A;  2E2J J;  3GTM J;  5BNG A;  2WV1 A;  2G0E A;  2MG4 A;  1ZR4 A;  1POG A;  4W1U A;  2E2I J;  1RES A;  2YS9 A;  2NVQ J;  2K9Q A;  2E19 A;  4M3F A;  1VF9 A;  3NAR A;  3C2B A;  2Y9Y A;  4FIS A;  3G1O A;  1TWH J;  1ENH A;  2DJN A;  2L9R A;  3FIS A;  2R0Q C;  1H88 C;  5IP6 A;  2NS7 A;  1ORK A;  2WAQ N;  3TP3 A;  5IOZ A;  2EZK A;  2P81 A;  1GDT A;  1IGN A;  2K9S A;  2R93 J;  3RKQ A;  4NDL A;  5M3M J;  2VKV A;  5JLX A;  1O4X A;  1TWC J;  2JA8 J;  4IHV A;  4X1E A;  1JKO C;  3BG3 A;  4DW6 A;  1P7J A;  1LFB A;  1WPK A;  2EZH A;  1ZTR A;  5FKL A;  1RPW A;  2R7Z J;  5M5W J;  1GV2 A;  2KT0 A;  4G12 A;  4I76 A;  1JKP C;  1RR7 A;  2RAE A;  2LKX A;  3GBG A;  4A3D J;  4GFB A;  2E2H J;  2EBI A;  4MFE A;  3OSF A;  1GT0 C;  2NVT J;  1NK2 P;  5FJ8 J;  1WH7 A;  2LVS A;  3E7L A;  3FIW A;  1ZKG A;  2FD5 A;  3LSG A;  3PM1 A;  1WI3 A;  3B6C A;  3BR5 A;  3M3Y J;  3JR9 A;  4FCY A;  3S1R J;  1FIP A;  1A6I A;  1U9O A;  3S1N J;  2IEK A;  3MKL A;  3F0C A;  4C3J J;  2FX0 A;  2M0C A;  3TP0 A;  3ZQL A;  2COB A;  4RDU A;  4BBS J;  1JGG A;  3ZQF A;  1JUS A;  1D5Y A;  5JLW A;  2XSD C;  1MBK A;  5FKO A;  3BTI A;  2XPU A;  1MBE A;  3B6A A;  2DA5 A;  3PO2 J;  2D5V A;  3H0G J;  4Y52 J;  1U9N A;  3FKI J;  5J1Y A;  2X9D A;  4M3D A;  3S15 J;  3FK7 A;  3BTJ A;  1H89 C;  4V2G A;  3HGY A;  3ZQI A;  5C4J J;  4M3B A;  1NTC A;  5FKK A;  4FE4 A;  2DA2 A;  1MBH A;  2W48 A;  2VUM J;  2VKE A;  4BBR J;  5DTD A;  1IC8 A;  4MIM A;  3Q0U A;  1GV5 A;  2NVX J;  1ITY A;  2HOS A;  3BTC A;  3GTL J;  2CUF A;  3BT9 A;  4Y7N J;  1Y1W J;  4IHY A;  1HCR A;  4EEF G;  3GTP J;  2YUS A;  2L7F P;  5J3L A;  2N8G A;  2QCO A;  1X58 A;  2L0K A;  1OCP A;  1BW5 A;  5EGO B;  1Z0X A;  1JJ6 C;  2E1O A;  1UG2 A;  5EYR A;  5EG0 A;  5M5X J;  1Q1V A;  1VFC A;  1LE8 A;  2ID6 A;  4AYB N;  4BY7 J;  3JRF A;  5C44 J;  4DYQ A;  1TWA J;  3HOU J;  1TWG J;  1JKQ C;  5J1U A;  1RKT A;  3K2A A;  1X2N A;  2CQQ A;  2LR8 A;  1WH5 A;  2DA1 A;  1K61 A;  3O8H A;  2HXI A;  3Q3S A;  4IHX A;  1HDP A;  2B63 J;  1ETY A;  2ME6 A;  3BQZ A;  1ETQ A;  1W0T A;  4JYK A;  2CQX A;  2NS8 A;  2XPW A;  3O8G A;  2R5Y A;  1JKR C;  3JRE A;  2QF7 A;  1B72 A;  3IH2 A;  4JX4 A;  3LNQ A;  1SFO J;  3RZO J;  3RQI A;  4A93 J;  5E3M A;  2MW8 A;  2DMU A;  3G1L A;  1UHS A;  2JA7 J;  2DMN A;  2DN0 A;  4C3I J;  3I4N J;  5F0C A;  1OJL A;  1F36 A;  1JUP A;  5IYB J;  2AHQ A;  2XB5 A;  1QVU A;  1WGX A;  4XRS A;  3FK6 A;  3G1M A;  1JTY A;  2I10 A;  3IV5 A;  2O7O A;  4S0H B;  4I6Z A;  3JRD A;  1JJ8 C;  3JRI A;  4BKX A;  4A3C J;  4BXX J;  2CJJ A;  5F0H A;  4A3B J;  1OFC X;  1Z77 A;  3BR2 A;  2XRL A;  1T56 A;  4A3J J;  2ZB9 A;  3JRA A;  3PO3 J;  3CQZ J;  4UUS A;  4M3E A;  3BR0 A;  3JRB A;  2TRT A;  1RET A;  1HLV A;  2LY9 A;  3QQA A;  2DA3 A;  3LSJ A;  3BG9 A;  5C3E J;  1GUU A;  1FEX A;  3IH3 A;  1ETX A;  1G2H A;  2O8K A;  1IRZ A;  2LD5 A;  1TWF J;  5IP7 J;  3H3V K;  1P7I A;  2WB1 N;  2M2E A;  4MFD A;  3OOU A;  5K7H A;  1MH4 A;  1MBF A;  2K40 A;  2IAI A;  5IP9 J;  1SAN A;  4HNV A;  3L1P A;  2MSY A;  1AKH A;  4C3H J;  2Y30 A;  4RBO A;  1BJZ A;  2X48 A;  2HOA A;  3Q0W A;  1CQT A;  1ZR2 A;  3LSR A;  1ETV A;  1ZK8 A;  3CMY A;  1TC3 C;  1BA5 A;  1EF4 A;  1F43 A;  1AHD P;  5HOD A;  2GM4 A;  3GTQ J;  3JRG A;  4W97 A;  1AU7 A;  1PUF A;  2JN6 A;  1B8I A;  1APL C;  4CYC A;  1XS9 A;  2H8R A;  1I3Q J;  2XB0 X;  2VPR A;  3A01 A;  2KDZ A;  2DA4 A;  3MN2 A;  2DMQ A;  4V2F A;  1S7E A;  2R5Z A;  2DMT A;  4D5F A;  2L7Z A;  1JUM A;  2XPV A;  2HQ5 A;  2ME0 A;  2XGE A;  1MSE C;  2HXO A;  2OPT A;  4A3G J;  1YRN A;  2FJ1 A;  1X2M A;  3DCF A;  4D7N A;  4XK4 A;  3IH4 A;  2Y9Z A;  2X6O A;  2XGC A;  3HOX J;  3S1M J;  3D1N I;  2MGQ A;  1LFU P;  1IG7 A;  2LTP A;  3JRC A;  4A3K J;  2ECB A;  1I6H J;  2OF7 A;  3CDL A;  5F08 A;  1XG1 A;  1HDD C;  1DU6 A;  5F04 A;  2NOG A;  1FJL A;  3S1Q J;  1ZGW A;  2JJ7 A;  4DYC A;  1T33 A;  4AUX A;  1JT6 A;  1WCM J;  2Y0S N;  3HOW J;  2LK2 A;  4B3A A;  5IOY A;  4J19 A;  3ZQG A;  4L5E A;  4MO7 A;  2CRG A;  2Y2Z A;  1DU0 A;  1BW6 A;  5F27 A;  4M6V A;  4QIW N;  5J1R A;  2HYJ A;  1FIA A;  4XRM A;  4DZP A;  2ID3 A;  4IEJ A;  3LSP A;  1ETO A;  2ELK A;  2H1K A;  2PMZ N;  5GPA A;  3RZD J;  3JRH A;  2JWT A;  4A3F J;  5FLM J;  2GLO A;  3HOZ J;  4X6A J;  4XIC A;  1FTZ A;  4JX5 A;  3HEF A;  5EG0 B;  2JA5 J;  4BY1 J;  3UKG A;  1LE8 B;  4A3E J;  2EZL A;  4B4C A;  9ANT A;  3K7A J;  1JT0 A;  2M8G X;  5K7Z A;  4LOC A;  5M5Y J;  4QSH A;  2EH3 A;  2CU7 A;  2LFB A;  1FTT A;  5GPC A;  3M4O J;  1MBG A;  1BL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...