4BY7J

Elongating rna polymerase ii-bye1 tld complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4by7J00
2M9HA 1RKTA 2M34A 1PUFB 1JTYA 2L7MP 3JREA 2Y9YA 4XRSG 1SANA 2HOAA 2JK3A 2R5YB 3HOYJ 2CRGA 2R93J 2H1KA 2VKEA 4IHVA 3FK7A 2EZIA 1U8BA 5M5XJ 1IDYA 1WH5A 1TWAJ 4FCYA 2HXIA 5EYRA 2MSYA 3LSPA 1HLVA 4JX6A 1U78A 1RKWA 4DYRA 5JLXA 3SJMA 4FTHA 4C3IJ 2ID3A 4XRSA 3HM5A 2XB5A 1UHSA 1BW5A 1JKQC 2GBYA 4A3JJ 3A02A 1I6HJ 5IOZA 2IBDA 3BQZA 3B6AA 3Q0VA 4C2MJ 3LNQA 2XGDA 4BBRJ 4XIDA 2IEKA 1ETKA 2NVXJ 1VF9A 5EGOA 3S15J 1LE8A 3FISA 1TWFJ 4A3IJ 1QVTA 2L7ZA 3LSRA 2HI3A 3GTJJ 1ZGWA 1MNMC 2X6OA 3CCYA 1U9OA 1HF0A 2HDDA 1B8IB 3UKGA 3S1NJ 2GLOA 3HOUJ 3JRDA 2Y30A 1QPIA 2LFBA 3S1RJ 3RZDJ 1TWHJ 1H8AC 2Y9ZA 1BW6A 2E2JJ 1XC5A 4G12A 2R0QC 2EZKA 2DJNA 4RDUA 1MBEA 3WHBA 3S1QJ 4IHXA 2HOTA 4BY1J 5BNGA 5C4JJ 1OJLA 4CYCA 5DS9A 1OCTC 4AUXA 4EEFG 2YU9J 2L9RA 1IC8A 3RKQA 1IV6A 1ZR2A 1FIAA 3I4NJ 1FJLA 5IP9J 5HODA 1I50J 4DW6A 5IOYA 2X9DA 4ABZA 3HOVJ 3HOZJ 3HEFA 4FE4A 4M3GA 3GTQJ 2VKVA 1WI3A 1CQTA 1AKHB 2MGQA 4D5CA 1JKPC 1RPWA 5IP6A 3K2AA 5EZGA 2L0KA 2CJJA 5M3FJ 1O4XA 2CQQA 4B3AA 3JR9A 5F1JA 5K7HA 3TP0A 4A3BJ 2PMZN 3HGYA 3MVPA 3QQAA 3TW6A 1IG7A 2O8KA 3BG3A 4UUTA 1ITYA 3BT9A 2N8GA 1W0UA 1LE8B 4M3BA 1Y1WJ 1JT0A 2JA8J 2YUSA 3ZQIA 1JKRC 1W0TA 2FX0A 2AO9A 1WCMJ 5FLMJ 4LOCA 3H3VK 3TEDA 2QCOA 3G1OA 1JJ6C 2Y0SN 2Y2ZA 3C2BA 3IH3A 3LSGA 1P7JA 3VPRA 2NVTJ 3O8HA 3K7AJ 1ETWA 5E3OA 2DA4A 2DA6A 5FLVA 4A3MJ 4UUSB 4X1EA 4GFBA 1VNDA 2NS8A 5FKOA 3CMYA 3GTMJ 2ME6A 3LOCA 1GV2A 1AU7A 2DA1A 1MH4A 5EG0A 1EF4A 1F36A 2FJ1A 1P7IA 2K40A 3QPSA 3ZOBA 4HNVA 1FTTA 2KT0A 1WPKA 1XS9A 2ME0A 1QRYA 4QIWN 5GPAA 5DTDA 3GTGJ 3O8GA 1UG2A 4I76A 2VI6A 4MO7A 3E7LA 5IYBJ 2E19A 3HKZN 3S17J 1LFBA 3WHCA 1QVUA 3L1PA 4A3FJ 1S7EA 2NVYJ 4L5EA 4Y52J 3FIWA 5J1YA 3S1MJ 2CUFA 2TCTA 1LFUP 2XGCA 4D7MA 3NAUA 3PO3J 4BXXJ 2W48A 3RZOJ 3S2HJ 1JJ8C 4IHYA 1WH7A 4A3EJ 1E3OC 1VFCA 5F04A 1K61A 1RR7A 1UMQA 1BL0A 3TP3A 1A6IA 1ZR4A 4BY7J 4AC0A 2R5ZA 3DCFA 3OIOA 4MFEA 4RBOA 5C4XJ 3MKLA 3JRHA 3BTIA 5FJ8J 1ZKGA 2JJ7A 1U9NA 1ZQ3P 5C3EJ 2ECBA 3MN2A 1YRNA 2TRTA 3BR1A 1F43A 2FQ4A 3HOXJ 1JUPA 1OFCX 2OPTA 3NARA 1TC3C 2E1OA 3D1NI 2NVQJ 2LLKA 3ZQHA 2EBIA 3IV5A 3ZQGA 3G1LA 1HOMA 1RETA 2L7FP 5IYDJ 3BR5A 1HCRA 2GM4A 2DMNA 2KDZA 2DA5A 1H89C 1JUMA 4M3EA 3BG5A 2EH3A 4A3GJ 5EEAA 2JN6A 4A93J 1TWGJ 2CQXA 4D5FA 2HOSA 1GDTA 1Y1VJ 5GPCA 5FKLA 1NK2P 1ETQA 5F0HA 1MSEC 1PUFA 3HOWJ 1NK3P 1WGXA 2EZLA 1MBKA 4DZPA 2DA7A 2R5YA 1BJZA 5EDNA 3BG9A 3GTLJ 2DMQA 2DA3A 2AHQA 1MBGA 2P81A 1JTXA 5F08A 3BR6A 1RESA 1Z77A 3SDGA 2M0CA 2HYJA 4DYQA 5JLWA 4A3DJ 5EGOB 2XB0X 1HDPA 2B63J 1D5YA 1Z0XA 2LP0A 2LVSA 5J1UA 2XGEA 3BR0A 2DMUA 4M6VA 2LR8A 4D7NA 4M3FA 2HXOA 5EZHA 2FD5A 2MG4A 3GTKJ 1IUFA 5E3MA 4A3KJ 2M8GX 2JWTA 3LSJA 4B4CA 2ZB9A 1NTCA 2CU7A 2LKXA 1JUSA 2R92J 1Q1VA 1MH3A 4MLOA 1OCPA 4Y7NJ 5FKMA 4QSHA 3BTLA 3BQYA 3ZQLA 2YS9A 3HBLA 1SFOJ 5E3LA 1ETOA 4JX4A 5FKKA 5K7FA 2XPVA 1B8IA 4CYCB 2O7OA 5F0FA 3ZQFA 3Q3SA 3G1MA 3JRBA 3JRAA 2LY9A 2WV1A 1IDZA 2ECCA 2XPWA 5E3NA 1ENHA 3BR3A 4MIMA 2G0EA 9ANTA 2X48A 1MBFA 2H8RA 4XK4A 3HDDA 4X6AJ 1JT6A 3S16J 3OOUA 4DZJA 4FE7A 3SFIA 3A01A 1JKOC 2XPUA 1ETVA 2JA7J 1MBJA 1AHDP 3IH2A 4IHWA 1BA5A 2OF7A 4W97A 1DU6A 4J19A 2DN0A 5IP7J 4C3JJ 1ZK8A 1GVDA 4C3HJ 3TW7A 1TWCJ 2VUMJ 3BTJA 3Q0UA 2JA6J 2WAQN 4V2GA 1AKHA 3BR2A 1B72A 1XG1A 4DYCA 3CQZJ 1MBHA 3H0GJ 4W1UA 1ORKA 2LD5A 1MSFC 3DEWA 2XRLA 1IJWC 2JMWA 3FKIJ 1ETYA 3HB9A 2ELKA 3JRIA 2EZHA 5EG0B 1I3QJ 5F0CA 2LTPA 1X58A 3QPLA 4BKXA 1X2MA 2R7ZJ 2LK2A 4NDLA 2E2IJ 3S2DJ 5M5WJ 2D5VA 2VPRA 3IH4A 2Y31A 1T33A 2I10A 4UUSA 3I4MJ 3PM1A 1ETXA 4FISA 1FTZA 2RAEA 1GT0C 2EQRA 3FK6A 3Q0WA 4S0HB 1H88C 1POGA 3F0CA 5K7ZA 2CUEA 2K9SA 2JA5J 2DMTA 3A01B 5GP9A 1A5JA 1ZTRA 3ZQCA 1APLC 5IPAA 3A03A 2IAIA 3M3YJ 4JX5A 1T56A 1R9TJ 1IRZA 2QF7A 2NS7A 4XRMA 3OSGA 4A3LJ 2WB1N 3GBGA 2M2EA 2R5ZB 2K9NA 4AYBN 4I6ZA 3B6CA 4A69C 2XSDC 3BTCA 3JRCA 1IGNA 1B72B 2ID6A 5J1RA 5EF6A 5F27A 2COBA 3S14J 1DU0A 2HQ5A 1YRNB 1VI0A 2DTZA 1GV5A 3HGGA 4IEJA 4QTRA 3GTPJ 4XICA 1HDDC 4V2FA 1JGGA 5IYCJ 3W6VA 2DMPA 4A3CJ 4MFDA 4JYKA 2K9QA 1G2HA 5M3MJ 5M5YJ 3JRFA 2O9LA 3GTOJ 4B1RA 2DA2A 5C44J 3OSFA 1FIPA 3M4OJ 2NOGA 3CDLA 3PO2J 1FEXA 4JP0A 5J3LA 1K83J 3RQIA 2E2HJ 5FKNA 4M3DA 2MW8A 4BBSJ 1GUUA 1X2NA 3JRGA
chains in the Genus database with same CATH superfamily
2M9HA 4KJZA 3U1KA 1TQIA 2E1NA 1PUFB 5DV5A 3DU6A 3LQRA 3U2RA 3QYEA 3CTAA 2Y9YA 1X19A 4XRSG 5E18F 2HOAA 3CCRI 1IW7F 1D0XA 1SVMA 1V54H 3H9QA 3JCUC 2VKEA 2M87A 3MZ8A 3GW2A 5KCMA 1IN8A 1MMNA 2GOMA 1U8BA 1G3SA 3IAS2 5M5XJ 1IDYA 4NNJA 1WH5A 3VYRB 2BY3A 2IA1A 2XGXA 4A5NA 2HXIA 5EYRA 2MSYA 1HLVA 1YJ9I 5JLXA 3CUQB 3LMMA 6PAXA 2EV6A 2W00A 2W4SA 3LFUA 2EFOA 2RNGA 3X2QH 2KP6A 4F52A 4HBLA 2VBWA 1FSEA 1BR1A 1OR7C 2C6YA 4ZTFA 1I6HJ 3BQZA 3C2HA 4C2MJ 4WWCA 1X1AA 4XL9A 3KYCB 2IPQX 5DCMA 1FPQA 1BIBA 2IS1A 3RTRA 2NVXJ 1VF9A 4CO8A 3S15J 4KIGA 3BCBA 2PFBA 2L7ZA 4BE2A 1EH8A 1ZGWA 1W4MA 1YX3A 1Z21A 3CCYA 3T5XA 2HQAA 4Y33A 1B8IB 1T2KA 4F3QA 1LNWA 1AA7A 3S1NJ 2F4MB 4G6TB 3RZDJ 1TWHJ 4MTEA 3P9CA 2MYSA 2Y9ZA 2CMPA 3MQ0A 2NS0A 3P7NA 1XC5A 4O6JA 4G12A 2NRAC 4UV9A 4BHPA 2EZKA 2X0LA 3ZMVA 2DJNA 4V19K 1Z6TA 3OR1C 3I9V2 2CV1A 2H1LA 4GCVA 2HOTA 1OJLA 2K3FA 1SFEA 4AUXA 2TDXA 1A04A 2YU9J 2L9RA 4PSXA 4XLFA 5CVUA 4BAYA 1V5EA 1WJAA 1IV6A 1FIAA 4XOPA 5J40A 3VFZA 1LPQA 3I4NJ 1MMAA 3ZMSA 4R1HA 5HODA 4UUVA 2GIZA 4NQWA 1IAWA 3FXMA 3HOVJ 3HOZJ 5DDGA 4M3GA 4FASD 4YFKF 2H09A 1XDSA 3F21A 1QGPA 4RB0A 1J75A 1JKPC 1EH7A 3I55I 3OYDA 2L0KA 4IRGA 3WTYC 3RCOA 2XRNA 2DQLA 3R61A 3K1NA 2CQQA 4AD9A 3JR9A 3DLAA 2KL4A 2DOEA 5DCMB 3QQAA 3HGYA 1VQMI 1IG7A 4WXHA 4NB5A 3BG3A 4OIRF 2HVSA 2N8GA 1TL8A 4M3BA 1Y1WJ 2EIMH 2CFXA 3I5UA 4KT6A 1M1EB 2YUSA 4G8XA 4PJLA 4HF1A 2BHZA 3SQNA 3KE2A 1NHAA 3LAPA 1WZ2A 2VC0A 2QCOA 3G1OA 3TEDA 4LLNA 3CO7C 4O3MA 4XKCA 2Y2ZA 4PZJA 5J4VA 4H0EA 1P7JA 3D5RC 3O8HA 4KNYA 1ETWA 1USTA 5TGTA 3R0AA 2Z33A 3BCAA 5FLVA 3M9AA 1W7PA 4PJJA 2EFWA 4ZDLA 4X1EA 3MKYB 3FKJA 3F8MA 4LMYA 3EQLF 4HNTA 3QOPA 3WE2A 2DFFA 5BOXA 4Q47A 2DA1A 1MH4A 4WXDA 3PIOF 3UNGC 4NC7A 1P7IA 3LA7A 2W25A 1KQ9A 3M8FA 3QPSA 5DCFA 3HIFA 1K4SA 4KMUX 4FETA 1UCRA 4NUBA 1FTTA 2W24A 2IGKA 1P2FA 2HU9A 1R4MB 3CF5F 1QRYA 4I02A 4E7SA 3DF8A 1QA6A 3SZTA 1KU9A 3O8GA 3GTGJ 1UG2A 2M7AA 2IA2A 2Z3YA 2FF4A 2MH2A 3S17J 2PEXA 3EUHA 1S7EA 3I0TA 2O6GE 2FBKA 2H27A 2LBFA 3S1MJ 4BH9A 2CUFA 2TCTA 4KA4A 4XLCA 2E1CA 1LDKB 3MMYB 5K5OA 2JQ7A 2OQRA 2ZC2A 4L5IA 4BXXJ 1Y6IA 2W48A 1HSJA 3RZOJ 4M9XA 2E36A 3EDPA 2ZSHB 4ENNA 2BYVE 1RR7A 2GOXB 3P9KA 2BXYA 2IVMA 4GO1A 2XIGA 1LEBA 1A6IA 1YW7A 2A61A 3HPGA 1KQ8A 2R5ZA 3RYPA 3DCFA 1TBXA 4PDKA 2QQBA 2FUG2 2JPBA 2Y69H 3KZYA 3RPUD 1U9NA 3OYIA 3IKTA 3CCSI 3A2KA 2R7WA 4XLAA 1S7AA 3FHZA 1UFMA 5HDGA 1MGTA 2TRTA 1YOVB 1F43A 4D9JA 1Z05A 3HOXJ 1QPMA 4N0BA 2HVQA 5B66C 2VQLA 3CCMI 1TC3C 2DOFA 1D5VA 2VASA 3DTEA 3PQJA 2R7VA 4G94A 2R7DA 3U21A 3ZQHA 3JAMZ 1RETA 3S32A 5IYDJ 2Z99A 1OCZH 5J47A 4FQGA 2DA5A 1H89C 1JUMA 3WGGA 2V26A 4F7ZA 3BG5A 2HKXA 4A3GJ 2J5PA 2KKOA 3VYTB 5EEAA 4B09A 2HOSA 2GA2A 1YIJI 3L09A 5F0HA 2RQQA 2DODA 1MSEC 4EQQA 3HOWJ 2DFEA 3DV8A 1DP3A 1G6NA 4E4HA 1QZEA 1HW2A 4EM0B 3FF5A 2L5QA 4L0YB 3ABUA 4L5JA 3V8KA 3CUQC 3GX4X 3GTLJ 2E1MC 2QQ8A 1X4PA 1MBGA 2P81A 4P55A 2XAFA 2V6CA 5HS8A 2EFQA 3K1PA 3SDGA 1QO0D 4ZZDA 5HDKA 2W57A 1TW3A 3FXJA 3MZYA 1FT9A 4ZZLA 2DK5A 2DQRA 3HG9A 4D7NA 4M3FA 2P4WA 2QKMB 4X0GA 3GYHX 2KQRA 2MG4A 5E3MA 2M8GX 1N75A 1R23A 3E5XA 5CQGA 3F8CA 3LSJA 3T1BA 2VT2A 4BJ6C 2CU7A 4DNCA 1ON1A 3ZRGA 1LFPA 3WTVC 1KYWA 2XASA 3O2PE 1LUJB 3JSPA 1VTNC 1I1GA 3GUDA 1QQIA 4HLXA 1FZPB 2HS5A 1D1CA 4PGHA 3SHFA 2XPVA 3GEZA 4CYCB 2FSWA 2O7OA 4KN7X 4A5MA 1HA8A 2LY9A 5KNLA 2QSFX 1DUXC 1WI9A 3M07A 1P4AA 3R4KA 4M72A 2CUJA 3V4GA 3G6EI 3M8EA 4MIMA 2IGMA 3BZ6A 3CCUI 2DPDA 4I98B 1T6SA 3D0SA 2CW0F 4RAYA 2H8RA 3HDDA 1KONA 4AM3A 4A0YA 1Y0NA 4HAMA 1OQYA 4IOCF 4KN4X 2VQCA 1PVEA 2P5LC 3QP6A 4WK8F 3VYSB 1O3TA 3OYLA 4MEXF 3SFIA 4Q48A 2XPUA 4L9JA 3QU3A 3E1SA 2P0WA 1AHDP 4ESJA 2B9SA 2AXTC 3BOQA 3IH2A 2ISZA 4IHWA 1XGOA 2LKPA 2M8EA 4XLHA 4J19A 2DN0A 5IP7J 2Z16A 3ELKA 3ESWB 2GA1A 3HXLA 2CG4A 1GVDA 2DO7A 5DD4A 4ANJA 4ZH4F 2KJBA 2VUMJ 4HX7A 2YSRA 4HQMA 1IUYA 3QYBA 4V2GA 1AKHA 5FROA 4CDGA 4F93B 4XNFA 4DYCA 3CQZJ 4B43A 5J6XA 4ZYHA 4IHSA 2FQ3A 2DT6A 2LD5A 2HPIA 2VL8A 3BJOA 4OAZA 2ZKZA 2MD5A 3FKIJ 5L3BA 5FLXZ 2IRFG 4XBFA 2R3SA 3BC8A 3N97A 3J80K 1T0FA 1JI8A 3GF2A 3PFIA 3E5UA 1STZA 2DTRA 1B59A 1ZHFA 2BV6A 5EG0B 3I56I 1I3QJ 1OR7A 3ZGKA 2CYYA 1X58A 3CMMA 2KPMA 2R7ZJ 3V8JA 4NDLA 3W2AA 2XF5A 4UVAA 1A31A 2Q8KA 1KU2A 4J00A 4FT8A 4AVZA 3IH4A 2STWA 1JHHA 1MNDA 3JTHA 2I10A 4UUSA 3PM1A 2ZMEC 1FOXA 3BPXA 1QHGA 3DU5A 3FHNA 1J2XA 2KIUA 2UUZA 3KEQA 3G4SI 2FEZA 4B47A 2LDUA 3AL0B 4AVPA 1XD7A 3F0CA 1D1BA 4XR6A 5K7ZA 4BE1A 2LY1A 3S3OA 5L3FA 2D2WA 3M3YJ 1Y8QB 2IAIA 3QWLA 2FOWA 2AQFA 3OYCA 1XPXA 1R9TJ 2CFOA 1T38A 2WB1A 3RPQA 4XSXF 5JHFA 2NS7A 2YX7A 3OSGA 1KU3A 2WB1N 3GBGA 2OBPA 3KIOA 1SAXA 3F23A 1OKRA 2X1EA 1RIOH 2XSDC 2GIVA 4KMFA 3JRCA 2XAHA 2ID6A 5CVVA 5EF6A 4RS8A 4B48A 2COBA 2ESNA 4XKVA 4YIIA 4IEJA 1YRNB 2CH0A 3HGGA 4II2A 5GAHJ 4V2FA 2XDVA 1JGGA 1KQ0A 1UAAA 3CC7I 1YIOA 3W6VA 2L9NA 2DMPA 4AIDA 4IZZA 1G2HA 5M3MJ 2O9LA 1BIAA 4B1RA 2DA2A 3OSFA 3HPHA 4C30A 3TOBA 3AKZA 2FMYA 4JP0A 5L3DA 1V4RA 2MW8A 2K9MA 2KLOA 3FXOA 3GZ5A 1IN4A 1R71A 2F5VA 1X2NA 1XB4A 3V7SA 1U0JA 1ZLJA 3I59A 1RKTA 3H3UA 1U6GA 4QPQA 3JREA 2QM3A 2L2OA 5CVRA 3IHUA 2R5YB 5H2FC 5K5RA 2CO5A 2CRGA 4P5OA 2I8DA 2H1KA 1QU3A 4QPOA 2UXNA 1LVKA 4IHVA 4CA0A 2YU3A 1JGSA 3FK7A 2EZIA 3GCMA 4PJ0C 4IOAF 2JVHA 2K4JA 1TZLA 5J4YA 2RVCA 2ZNZA 3KP4A 4CCLA 4RGXA 3LSPA 4BJTA 4FTHA 4C3IJ 4XOTA 3IWZA 2OD5A 1S5LC 4H4KC 2IA0A 2XB5A 5LLQA 2M45A 4C2UA 1YQAA 1BW5A 2IP2A 3TO6A 1B4AA 1UZCA 3MFKA 1RZ4A 5BS6A 4DJAA 2ETHA 2XGDA 2LNBA 1SC7A 4ZYGA 4XQFA 3GLXA 2IEKA 3DFGA 1YI2I 3F8BA 1LEAA 2P6SA 2D45A 1X3UA 4O5VA 1X3WB 4A3IJ 1MDMA 4I09A 1UJ8A 1TW2A 2VJ5A 3CJTB 1MNMC 4BE0A 4BHCA 2Z9OA 1XSDA 1D1AA 4KIFA 2O3FA 3JRDA 2Y30A 1QPIA 2DFIA 3D5LA 3CP2A 1OYIA 2BVMA 4BQNA 4CCOA 3VSKA 1H8AC 2WTEA 2CV2A 4G6QA 3VEPA 3AG3H 2E2JJ 5EJCA 1O57A 2XV4S 2R7OA 5FFXA 1ZELA 1W36C 1DP7P 3FMSA 2E7XA 2FBHA 3H36A 3WHBA 2V79A 2F5EA 3HTUA 3S1QJ 1REPC 1ZRCA 5C4JJ 2ELHA 5DS9A 2ISYA 1OCTC 1V5GA 3VODA 4M6YA 1IC8A 3WTXC 1SVLA 3RKQA 1N78A 5ILVA 1H9TA 1LVAA 4GXOA 4ABZA 3MZHA 4HQEA 3CLQA 1WI3A 2VXDA 1CQTA 3EYYA 5D5UB 5FB2A 2XAUA 2EA2A 5EEHA 3I53A 2RREA 3CJNA 4B3AA 2MABA 3H5NA 4E7JA 3S3MA 1YS7A 5K7HA 1R00A 4OIPF 1T8IA 3MVPA 2O8KA 3PIPF 4MGRA 1W36D 3TDUC 2HDCA 1MDMB 2A6TA 3ZQIA 2RN7A 2NOJB 2FX0A 2AO9A 1W0TA 3GTKJ 3ISPA 4BYYA 4M74A 1V3FA 2PJRB 1JJ6C 3QYFA 4WCGA 2EPFA 4Y4RA 3C2BA 5ICFA 4XRFA 2DPUA 2AXLA 2DA4A 1BC8C 3MWMA 3NRVA 3CJQB 3EUAA 5LFAA 3M7GA 4GFBA 2WAFA 3FXUA 1PJRA 1CF7A 1PDNC 4HV6A 3CMYA 1AU7A 1IZ1A 4IX7A 1U5TA 2XAJA 3RIRA 1ULYA 1LQ1A 3ZOBA 4HNVA 2Y48A 2KT0A 5IY5H 1VQ6I 4U0WA 2IW5A 2ME0A 1DGRM 1XCBA 4QIWN 1UHMA 1FNNA 4MO7A 3J7ZI 1K6OA 5IYBJ 1TT5B 3FZVA 2E19A 2FNPA 2CW7A 2LYCA 3GMEA 4YEJA 2OTJI 5CLSA 1LFBA 3WHCA 3QAHA 3L1PA 2BY2A 2F5CA 4L5EA 4Y52J 3PUBA 1RR8C 1ZG5A 3I71A 3VB2A 1XN7A 5B1AH 1LJ9A 2XGCA 3HUGA 4AIJA 1U8RA 3J7YJ 3PO3J 5D4SA 4L9NA 3GWZA 2DLLA 2E35A 4IHYA 2A5WA 5B1BH 4A3EJ 1H0MA 2MLGA 2P5VA 2EV5A 3K4MA 4ZYAA 1IXCA 3OS2A 3G2BA 1X3ZB 3LFKA 1YLFA 1ZRFA 4AC0A 3A0BC 3PFYA 5C4XJ 3CCEI 3WU2C 5LHHA 5H20A 4P9FA 5FJ8J 5TRDA 3MCZA 2A68F 2W84A 1ZQ3P 5C3EJ 4G7OF 1OCRH 3OR2C 2XROA 3LA2A 2FQ4A 4BNCA 3NARA 4M71A 1OISA 1IN6A 3CUOA 1EA3A 3O6BB 2E71A 2NVQJ 2EBIA 3D5SC 3LAJA 2OA4A 1K4TA 2GXGA 2L7FP 3BR5A 2OAZA 4GGGA 3SEQA 2DMNA 2KDZA 2COMA 4ESFA 1FWZA 2H6BA 4CCJA 2FRHA 3F9KA 2ZXJA 4L0ZB 4A93J 2OV7A 4CYDA 4HPQA 3ZQ7A 2E34A 4BS9A 3OV8A 2ZJRF 2STTA 3J7AY 2OJED 4L9TA 1BI2A 1NK2P 3DBRB 2PX9A 2MC3A 4BEHA 1G8XA 3TGNA 3ZXSA 4IRIA 1WGXA 2D1VA 3H3ZA 2X4HA 4DIQA 1Z9CA 3N4MA 1BJAA 1W5SA 3L2QA 1BJZA 1BN5A 1OMIA 1G3TA 2PLYA 4OIOF 3BG9A 5A2QZ 2AHQA 5DM7F 3DEUA 1JTXA 1OYYA 3BR6A 3DPUA 2JTVA 3WG9A 2QEXI 4HRIA 1Y0UA 2XHKA 2UXXA 2M0CA 5A2QK 3ABMH 1R5ID 2HDWA 4DYQA 5LGUA 1KZHA 1YE9A 1SFKA 1O3QA 2XB0X 1WHUA 2LSOA 1Z0XA 2LVSA 3OYJA 3K1MA 5J1UA 2O0YA 2EK5A 3BR0A 3CP8A 2DMUA 2EFNA 1DGWY 4ZDOA 2FD5A 4EVIA 2ADUA 3L9FA 2V4JC 3LSMA 1XDUA 3F8NA 2LRDA 1S7OA 4B4CA 2ZB9A 4OMYA 1JUSA 2R92J 4HDVA 2MH9A 5FD5A 1QZZA 5F1RA 4A0XA 1QZYA 3QPTA 3ZQLA 5ICCA 3SZPA 1SFOJ 5E3LA 2JPCA 1ETOA 2NNNA 3GFMA 1VQNI 2HR3A 4YIRX 1ODDA 1GXPA 3ZQFA 1XSVA 3G1MA 3KZIC 3BJ6A 5K5QA 3JRBA 2M4GA 3IUOA 2WV1A 5E3NA 3KYLA 1ENHA 3GVAA 2BBYA 2F5FA 3QU6A 3V7CA 3ZP5A 2G0EA 1J5YA 9ANTA 1FX7A 1MBFA 4C9YA 3K4LA 4XK4A 4NQWB 1D8JA 3DKXA 3AG2H 3DKYA 4UVBA 4X6AJ 3AFHA 2CQ7A 4FE7A 1O7LA 1Z1DA 4DBQA 5BQTA 4XLEA 1JKOC 4G9YA 1WFXA 4EMSA 3ABLH 5GAGJ 1X1CA 4QWQA 3VYUB 2OF7A 5E8IA 1BA5A 1OCCH 1MW7A 4C3JJ 2ZJPF 4C3HJ 4EJTA 2VB6A 5GAEJ 1BI3A 2F2EA 1W1WE 3BR2A 1B72A 1S8NA 2ZFWA 2KIFA 1WWXA 4YG2F 1ZLKA 3R0JA 3HRUA 2F4OB 3S2WA 2O5RA 5HNHA 4W1UA 5JFRA 4CUGA 1FYLA 1A6QA 2H94A 5DUKA 5KAIC 2VJIA 1W7PB 1A36A 3J7AO 1IJWC 3ROUA 3RSNA 3AG1H 1ETYA 4MHGA 2DK8A 3HB9A 4ZYEA 2OU2A 3KEYA 2ZCWA 4P9UA 2ELKA 1GHCA 1BOAA 2EZHA 3RQ4A 5F0CA 2QGUA 3CMAI 5KHDA 3WODF 3K0LA 1PUEE 1R1VA 1X2MA 2LK2A 2LF8A 3H5AA 5M5WJ 1HBXG 4CXFA 4G7ZF 2R7XA 3PJRA 5JI6A 3V42A 2HWVA 5D8KB 1T33A 4WXCA 2VLAA 3I4MJ 1U2WA 5ILUA 2RAEA 1GT0C 3WGHA 4YIFA 2XUBA 1F4KA 4KISA 1E0EA 3FMRA 3K70C 1I6XA 2LBFB 4PUSA 1I27A 4S0HB 1POGA 2QBYA 5CJ9A 4LG3A 3VWBA 2KDOA 1YITI 1YW8A 1YHQI 1S3JA 1FOKA 4IJAA 5GP9A 3FM5A 2VJ4A 3GZNB 1ZTRA 3ZQCA 5D4RA 2FA5A 3A03A 4JX5A 1YG2A 4M73A 1IRZA 3DKWA 2JSPA 2QF7A 1T08B 3K2ZA 3F3XA 5JHUA 5LGTA 2R5ZB 3MAJA 2X85A 4I6ZA 1N77A 2XKPA 1HC8A 3BDDA 1X1BA 3K4KA 3A0HC 1IN5A 1NG7A 1B72B 4L9VA 5J1RA 2FMLA 2V6EA 3S14J 1DU0A 2DTZA 4ZDPA 2KRHA 4UV8A 2X6XA 3RJPA 2G7HA 4XICA 1R58A 1VQ5I 3ASOH 2CQNA 5D5VB 2AS5F 3JW4A 2DXIA 3QOEA 4AWXB 2O03A 3K70D 1SFXA 2WV0A 3JRFA 3M4OJ 3CF2A 1FIPA 3OS1A 3BP8A 2DT7B 4EJOA 1TT0A 2XKOA 4IL6C 5J3LA 1K83J 3RQIA 2E2HJ 5FKNA 3K6GA 4PJMA 1ERDA 4M3DA 4AIHA 1G3YA 3V8LA 3E0JB 3S8PA 3AG4H 3MEXA 1JHFA 3EYIA 1PYVA 1XCVA 3TKYA 4A6EA 2BEOA 4BXFA 4XSZF 1S9HA 1JTYA 3WGIA 1FLIA 4IPAA 3K4JA 1SANA 1XTAA 2JK3A 3C1DA 2CSOA 3HOYJ 3CMEI 2ELJA 2ACJA 1ZH5A 4L18B 1YJWI 5F64A 2W82A 4JOMA 1YO5C 1TTYA 2A6HF 4Q4ZF 4RAFA 4JX6A 1U78A 2WY7Q 1IO2A 4NC6A 4DYRA 3MKWB 2LREA 3Q5FA 1MMSA 3SJMA 2LF7A 2ID3A 2QENA 2VBXA 5LEJA 3HM5A 1H9GA 1WJFA 2WY8Q 4HF0A 3HOTA 3K10A 2PG4A 3SDBA 1JKQC 3PQKA 1WJBA 4A3JJ 3A02A 3KPHA 2IBDA 2PMUA 2W85A 2K85A 3GO5A 3J80Z 1BC7C 1MMGA 4XIDA 4XLNF 3T8TA 5JR3A 2CGPA 3QODA 4HV5A 4PGGA 5EGOA 1LE8A 3FISA 1TWFJ 2OUMA 1QVTA 2HI3A 2Z5UA 3GTJJ 4E7KA 4RLFA 2EFPA 1T95A 5E1XA 4JBAA 1R49A 1HF0A 4N4NB 2HDDA 3UKGA 2FE3A 2KIMA 3F6VA 2Q0OA 1YFHA 2A07F 1Q1HA 2X6YA 2VXZA 3G71I 1BW6A 2JUGA 1NH3A 5DUIA 1B9NA 3H1CA 5E1ZB 2R0QC 5BPDA 1JE8A 4MTDA 4A0ZA 4JQFA 3PNTA 2BW3A 3FMQA 4HDUA 4BY1J 5BNGA 3I4PA 2HTJA 1BM9A 4LIUA 1R6RA 3RKXA 3M1EA 4CHUA 2RGVA 3RDIA 1ZR2A 1Z6RA 3NWSA 3GZ6A 1KU7A 4HW0A 4E7ZA 4FE4A 5HNFA 4Y13A 3GTQJ 3ZMUA 1IN7A 4LB6B 1AKHB 3BY6A 2MGQA 3KZZA 5IP6A 4BDZA 3K2AA 2IJLA 2CJJA 3A4CA 3GXOA 3BG7A 1LDJA 2GXAA 4BQQA 2PMZA 1O3SA 5F1JA 3TP0A 4A3BJ 2PMZN 3TW6A 1U3EM 1E3PA 4UUTA 3ZMDA 1LE8B 4IKFA 2JA8J 1Z7LA 3HZJA 1JXSA 1RC9A 2VKHA 4HG2A 5FLMJ 2HNHA 3E97A 4LOCA 2XF7A 1W5CC 2YX4A 4FX0A 1D0ZA 4G7HF 2Y0SN 2IGOA 2ZXHA 3LSGA 5HVQC 2NVTJ 5LBQA 4LG0A 3K7AJ 5AONA 3CZ6A 5E3OA 2K7LA 2XVCA 4A3MJ 2VBZA 3COAC 3CCQI 4UUSB 3V7RA 1HSTA 1Z7UA 1VNDA 2V1DA 5GTIC 1RRJA 5FFZA 2F48A 2NS8A 3FBNB 4XMYA 5FKOA 3GTMJ 3ZMZA 2ME6A 1J7KA 3W2WA 2V9VA 5AIPA 4ZC3A 4BL0B 3PUFA 2FJ1A 2LY2A 1YTYA 3H92A 2L54A 3EUHC 1FMWA 5ICGA 1XGSA 3OYGA 1P4WA 2VBYA 3IRQA 1R4NB 1FYKA 1WPKA 2H6CA 1XS9A 1Y39A 2IT0A 2KISA 5H6RA 2HPMA 5GPAA 2A5YB 3DP7A 1XGMA 2HGCA 3HKZA 3E7LA 1W7PD 1TP4A 3HKZN 2IS4A 3RPUA 2NVYJ 4RB1A 3CCJI 3I64A 5J1YA 1WKMA 3L2WA 1OCOH 1TQMA 5HLHA 5JVTA 1IXSB 4HZFA 1LFUP 3KP2A 4XONA 2UWMA 5CPRB 2ZFUA 1KGSA 1WH7A 5FRNA 2QUFA 4B8XA 2BGCA 1J0RA 2M1BA 2UV1A 3OYAA 2EJRA 3QPHA 1D0YA 2JA2A 3HL2A 1VFCA 5F04A 5L3EA 1UMQA 4ZTJA 1K78A 1BL0A 2MA3A 3FXQA 1SMYF 4LIVA 2EIKH 3TP3A 4A6DA 5IT9K 4MNUA 3KLNA 4GYIA 3BZKA 3Q9SA 3IWFA 3JRHA 2M30A 3GFIA 3H9GA 3K4BA 1DPRA 4U0VA 4KICA 2WWYA 4LGWA 3MN2A 3OOPA 3BR1A 4LG0B 5KAFC 2DW4A 2OPTA 4PK4A 1YJNI 2XSJC 5LHGA 2E1OA 3D1NI 2RQPA 4D0PA 1Z91A 2LC2A 3I59B 4KT5C 3IV5A 3G3ZA 3PNVA 2CWEA 1L3LA 3G1LA 1HOMA 5B3SH 2OTLI 2KZGA 3PSIA 5FO5A 3BROA 1DQUA 3OYFA 1HCRA 2JRTA 2GM4A 1FBSA 2EH3A 1F9NA 1I5ZA 1UG0A 1UHWA 1TWGJ 2CQXA 5LD2C 4RMNA 2MBFA 1Y1VJ 5FKLA 3MD2A 2HTSA 2HZTA 1PUFA 2R7RA 1NK3P 1IRXA 3IAM2 3NQOA 4EJVA 2X1DA 1EV7A 3PNYA 2VQGA 4LB5A 1MBKA 3KP6A 3RKWA 4HX4A 2IXSA 3WU1B 2DMQA 2DA3A 3KP7A 3OYHA 3L00A 1IV8A 1RESA 2EIJH 2PQ8A 3R6SA 1Z77A 4M9SA 4BUPA 5GADJ 1T39A 2DFHA 4KITB 1K78B 1OLTA 4ENKA 5JLWA 4A3DJ 3SEZA 2L3DA 4R8HA 3W3CA 2B63J 3CUQA 2Q2EA 3OL4A 1D5YA 3F6OA 1VQKI 4ITVA 1EH6A 2EWNA 2MD0A 2LR8A 5LRSA 2JT1A 3KEOA 4RM3A 5L3CA 3DXJF 5FRMA 1IUFA 3B73A 4A3KJ 2DI3A 1YW9A 3PSFA 4LITA 4C2TA 2DU9A 1NTCA 2LKXA 2LOOA 3K4CA 5D8LB 1MMDA 1MH3A 4GDFA 1OPCA 2X6WA 1SD5A 4IRHA 2YS9A 2A3SA 3HBLA 2BY1A 4ETSA 3J81Z 4CGZA 5K7FA 3DEEA 3I54A 4DBRA 1B8IA 5F0FA 3TO7A 4HLYA 2AQEA 3LA3A 4ZJZA 3AL0C 1MNEA 3J81K 1RI7A 1R1TA 2XPWA 4RA2A 3BR3A 2CUZA 2Y75A 2K27A 3HSFA 2JZYA 3GFJA 3FBIB 2H8WA 3DBLB 2VT3A 4EGZA 3NEUA 3U9GA 4DZJA 5DM6F 2VOOA 2KFDA 3WU0A 3PL8A 4RB3C 3A01A 3T8RA 1ETVA 3ZN0A 2KRFA 1J59A 1IF1A 4EM1A 4B3XA 4P1WA 3LQQA 2P7VB 2EINH 2KRCA 2L9VA 4HSRA 5FD6A 3ZPLA 4Y17A 4EATA 5E20A 4CCKA 1S6LA 1ZGJA 3HRSA 1FBQA 2Q2EB 3TW7A 2E1MB 1TWCJ 1D3YA 4Y3OA 1T0FC 1XG1A 2HZDA 3N05A 2NYXA 4Q5SF 5K1YA 4KYWA 3H0GJ 1WVRA 2RDPA 1MSFC 1Z3XA 2GZWA 3P9IA 3DEWA 3AAFA 2JUCA 3WE3A 1EKEA 1PP8F 2FNAA 1CF7B 1SAUA 2ZO4A 3K4NA 1U5TB 4RGSA 1GLNA 2K86A 4PFOA 1LB2A 2LTPA 1XX5A 5CVIA 4D1QA 2DT5A 2EB7A 3KP3A 2QLZA 1FP2A 2VPRA 1V55H 3OWTA 1HKQA 1ZN2A 2Y31A 3Q9VA 3T0YA 3WTZA 4BJ5C 3S3NA 4F55A 2E7WA 1ETXA 1B1BA 2PN6A 3GLLA 3ECOA 5H6QA 2HEOA 5CQEA 3TMOA 5HOOA 3OYEA 2V9KA 2L01A 1BI0A 1BBYA 1FOWA 3ZN1A 5J8CA 4ESBA 3HUGB 1H88C 2GAUA 1X1DA 1SD7A 2K9SA 3LSHA 2JA5J 1FY7A 3DQVC 3A01B 4CSWA 3FDYA 5J8FA 3HHHA 3KX2A 4UHTA 1S29A 2WC2A 2ZMEA 4XLPF 1A5JA 2ZBKA 4N9IA 2M4KA 1T56A 4XM3A 2WADA 4CZCA 4HNUA 2F5DA 2YR2A 3H0DA 4XRMA 1G59A 2K3PA 3DTKA 1I1SA 4A69C 3HRMA 4NC8A 1TLHB 1IGNA 4ENJA 1UB9A 1X1PA 4J01A 4LK1F 1VI0A 2JVGA 3UR3C 4QTRA 1E17A 3TOAA 4WX9A 1HDDC 5F6FA 1WJCA 1FC3A 5IYCJ 2ZNYA 2DDBA 3W6KB 2UZKA 2PJPA 4HSTA 4ASNA 1FOYA 3C7JA 1SFUA 2QWWA 1ZG3A 2OC6A 4RM2A 5E79C 1EJ9A 4OAYA 2K9QA 5LEKA 4FX4A 5C44J 4RGRA 5ILSA 2NOGA 2CV0A 3VSLA 1WJ5A 4EM2A 1FEXA 1VQPI 1Z3YA 4I7HA 3FWEA 2V1UA 1O7FA 2BY0A 1R1UA 1MD0A 4ENMA 1GUUA 4HOBA 2KJCA 3L2UA 2V1XA 5CVJA 1FJLA 2M34A 2X51A 3HJEA 4BEHB 3CDHA 5LGNA 4LJZF 2NNYA 2L7MP 2P8TA 3HRTA 2F4IA 3F72A 1B6AA 1B9MA 2R93J 4G6DA 4OU0A 2MFZA 4KUMA 3EETA 2M0MA 3DBHB 4YELA 1R22A 2YPRA 2ZMEB 3O3KA 3H35A 2CS3A 1ZREA 3EPZA 1TWAJ 2HYFA 4FCYA 4M9ZA 2ZSIB 5DD8A 3ABKH 4U88A 1RKWA 3TO9A 4F91B 2K9LA 5DYMA 3ZR8X 3DWLE 2ZXWH 2R7FA 2VKDA 3ABTA 5TISC 4XRSA 3FM3A 3L2CA 2FU4A 3REOA 4LLGF 4E7IA 1WQ2A 1UHSA 3JTGA 3DLLF 2R7TA 3B02A 2GBYA 1TNSA 3KFWX 4BHBA 2NAZA 3CLOA 2WBMA 3B6AA 3Q0VA 5LRRA 5IOZA 1X4OA 3LNQA 4KFCA 3SZGA 4BBRJ 3OIQA 2NVUB 2B0LA 2KIQA 4YRVA 2KZVA 5E17F 1ETKA 2E5NA 4LD5A 1FP1D 5ERIA 3OL3A 3BJAA 3WTTC 2BOLA 1NG6A 3C3WA 4Y15A 3SYTA 3LSRA 5D6FA 4CH7A 2VIXA 1S72I 2X6OA 2OQGA 2HFHA 2JRMA 3E6BA 4UB6C 4DGWB 4IO9F 1U9OA 4MQVA 2GLOA 3HOUJ 1BOBA 2LFBA 3S1RJ 1J9IA 4UNOA 2OCEA 1KYZA 3C2GA 2BZTA 4WF2A 2L4AA 3LSIA 3CD6I 2ICWG 1ACIA 3P5JA 4RAZA 2ESHA 5CKTA 4RDUA 1MBEA 2HQNA 1DPUA 3JAMK 4IHXA 1I39A 1XMKA 3HTSB 1E2XA 4DOZA 4CYCA 3OYNA 2PMHA 4EEFG 2DJIA 3HSEA 3ML6A 3CCVI 2E5ZA 2XAGA 2QSGX 1GXQA 3E6MA 5IP9J 1I50J 4DW6A 3HOSA 1K6YA 5IOYA 2X9DA 3LSTA 3HEFA 2KHMA 2P6TA 2V9PA 3L2VA 2VKVA 2XF6A 4RGUA 4U7BA 4P96A 4D5CA 1HW5A 1RPWA 4EV0A 3FXKA 5EZGA 5M3FJ 4YFXF 1O4XA 1O3RA 3ZCOA 1C0WA 2XAQA 3SXYA 3ASNH 3MKZA 3DTIA 3ECHA 3BG6A 3E3VA 4UXNA 3U1DA 1ITYA 3BT9A 1W0UA 5E8GA 4UY8I 1JT0A 4BXUA 4U0YA 5CYVA 3F8FA 1JKRC 2O61A 1WCMJ 1PP7U 3RI4A 1XMAA 2DDAA 3H3VK 3HYIA 1U5TC 4TV7A 3IH3A 3OYMA 2VONA 3VPRA 1XGNA 1F1ZA 3TL4X 3R60A 2VPLA 1LKXA 2G7UA 2DA6A 2DOAA 1QHHD 2PBIA 2A05A 1VQ7I 1MZBA 3A1YA 4GYGA 3LOCA 1GV2A 2WA0A 5EG0A 1EF4A 3BWGA 1F36A 4U87A 2K40A 2HKOA 4CCMA 3ERED 4E7HA 1VQ8I 2FBIA 3WTWC 4IQ4A 1Y8RB 2BVLA 3ZMTA 3IL2A 2QBYB 4AU7A 2JSCA 2EA4A 2V7FA 4I0AA 2QQ9A 3CC2I 4RLQA 3E5QA 2IS2A 1HXDA 3OS0A 1W5TA 5DTDA 4CZZA 1P92A 2VI6A 4I76A 2VE9A 1XSXA 1IRFA 1QVUA 4A3FJ 3CESA 3CO6C 1AOYA 3FIWA 3C18A 2G9WA 3VOEA 1USSA 3W6JB 4D7MA 3NAUA 3OY9A 5E1WA 2IGNA 3ZQQA 3S2HJ 4LK0F 1MIJA 5HLGA 1JJ8C 1GVJA 1E3OC 5D5XB 2QKLB 4AIKA 1K61A 4QLCU 2HYGD 3OIPA 1BR4A 1ZR4A 4BY7J 2DAOA 4RAGA 4BQOA 4OIQF 4IXAA 3OIOA 4MFEA 4RBOA 3MKLA 3BTIA 2QQAA 2CQKA 1ZKGA 3FX3A 5LHIA 4EJUA 2JJ7A 4ON0A 5HLTA 3L2RA 1VZ0A 4OMZA 4IHTA 2VN2A 2ECBA 2PI0A 1WJDA 4Z2YA 1YRNA 2F6CA 5IT3A 3IRRA 3HSRA 1JUPA 1OFCX 4N9HA 2RC4A 4MQ9F 2CW8A 3FXLA 2WAEA 2LLKA 2V1NA 3ZQGA 1Y56A 2W7NA 2XC7A 1WJEA 5FLXK 4LFUA 2E60A 5ED4A 4I2OA 1G3WA 4M3EA 1HW1A 1ZAOA 2JN6A 4ZYDA 1T98A 4EGYA 1R5HA 4D5FA 1A35A 3VDXA 2A6EF 4S05A 1RUOA 1GDTA 5GPCA 3JSOA 3WTUC 3RYRA 2FOKA 2KMUA 1ETQA 1G4DA 4BACA 4NHJA 2LH9A 4CCNA 1ZARA 2EZLA 4DZPA 2DA7A 2HOEA 2BHYA 5HDNA 2R5YA 4IQJA 5EDNA 3KP5A 5HS7A 1P9QC 2RV8A 3H5RA 2OZUA 2ZJQF 2BXZA 2R7QA 1YX5A 1QNTA 5F08A 4II3A 4M6XA 2J5OA 4E6KG 5DEQA 1MJAA 2HYJA 1P6RA 2I5UA 1YS6A 5D6EA 1MJBA 5AIQA 5EGOB 2DBBA 1HDPA 5FGMA 4R79A 1QBJA 2LP0A 2Q1ZB 3WG7H 2VE8A 1BI1A 2XGEA 3KETA 4M6VA 3K9TA 3WTSC 2R7SA 2BE5F 2Y0SA 1VQOI 2VJJA 2HXOA 2P5KA 1UELB 5EZHA 1SEUA 4XKBA 2GQQA 3QRFF 4FHTA 1ZG1A 2VODA 3BLYA 1TNTA 2JWTA 3ERMA 4XKWA 1R36A 4HF2A 1Q1VA 2MLKA 1AWCA 4MLOA 1OCPA 4Y7NJ 4MEYF 5FKMA 4YFNF 2FXAA 1J09A 3HC7A 3OMYA 3BTLA 1FMVA 3BQYA 4OOIA 4UVCA 4QSHA 1K7AA 1RUNA 3LWFA 1VQ4I 1RNLA 4HYEA 4JX4A 2ZJ2A 3CJRB 1MKMA 3LL7A 2BW3B 5FKKA 2R7UA 1SMTA 2RNJA 4A2UA 1LDDA 2B7EA 3Q3SA 1HKTA 3GFLA 3JRAA 3TDZC 3DPLC 1IDZA 2VC1A 2ECCA 1DDNA 1TQPA 1FSHA 2A69F 4GRIA 4KIBA 4HEA2 1ZGAA 4Z6YA 1SVOA 3OYBA 2R4GA 2X48A 2HQRA 2K02A 1WSUA 4XN3A 4IF4A 4E7LA 5EEGA 1L0OC 1VQLI 1JT6A 3S16J 3OOUA 4I0BA 2MC4A 4U7DA 3KCCA 1R7JA 2JA7J 1MBJA 2LMDA 5IT9Z 4W97A 1DU6A 3G73A 4CICA 2X1CA 3QP5A 4NBQA 1ZK8A 4N4OB 5JVGF 4BU2A 2WAQA 4PFPA 3LSKA 3TQNA 1IXRC 3BTJA 3Q0UA 5D5WB 2WAQN 4RB2C 2JA6J 3H9JA 3IC7A 4XORA 2Z2SB 1WRJA 1SD4A 1MBHA 1P4XA 1ORKA 3ULQB 4BQAA 4I99C 2GXBA 1OYWA 1ZYRF 2XRLA 4LLLA 2O8XA 2JMWA 5L3GA 4A12A 2VOPA 3KYDB 3M8JA 1SD6A 4PSWA 3JRIA 4F92B 1KA8A 2EILH 1CGPA 5HLIA 2QZ8A 2W1OA 5BMZA 1YYVA 3CDIA 3QPLA 2DCEA 4BKXA 1F5TA 4I01A 2PJRA 3NWTA 3OYKA 1N25A 4HA8A 2E2IJ 3S2DJ 3E6DA 3HHGA 2D5VA 3S93A 1ONVA 1D8KA 3I58A 3BPVA 3IP4B 4JK1X 2M3AA 2GWRA 2OCCH 4UB8C 4E70A 4EJWA 2L7KA 4FISA 1FTZA 3E6CC 1I3AA 2D1HA 3W2VA 1ZRDA 2EQRA 3FK6A 3Q0WA 5KK1A 3F22A 4B44A 3CC4I 1FBUA 2QSHX 5B5EC 3I3LA 1Z67A 2L02A 2CUEA 2DMTA 2NXNB 1MJ9A 2Y0MA 2L9SA 1HKSA 4BDYA 3L7WA 1APLC 5IPAA 2K4BA 2VQHA 1XMXA 2M5WA 4HX8A 3CCLI 5GTHC 1VQ9I 3FXRA 2DYRH 4AYBA 4S04A 4IVNA 3K69A 4A3LJ 2M2EA 2K9NA 4AYBN 4DQ2A 2K5CA 3B6CA 1K79A 2L4MA 1HQCA 1IRGA 3BTCA 4OWRB 2LG4A 3SFZA 3M1CA 5KVRA 5F27A 3RKYA 4XN0A 2HQ5A 3ONQA 1GV5A 2EV0A 2HVRA 4KDPA 5BPIA 1ON2A 3GTPJ 3BZCA 2RKHA 2OZ6A 1FYMA 2QA4I 4BGDA 4PCQA 4K2EA 4OINF 5ICEA 3DPTA 4A3CJ 4MFDA 1V5FA 2M7BA 4JYKA 5M5YJ 1E3HA 3EUKL 3GTOJ 2LKSA 4PJNA 5HS9A 3CDLA 2QYOA 3PO2J 2QVOA 3IKVA 3TBIA 1BR2A 5TJJA 2Z1DA 2P7CB 4BBSJ 1R5GA 3KLOA 2DYSH 2ZXIA 3JRGA 2IS6A
chains in the Genus database with same CATH topology
2M9HA 1RKTA 2M34A 1PUFB 1JTYA 2L7MP 3JREA 2Y9YA 4XRSG 1SANA 2HOAA 2JK3A 2R5YB 3HOYJ 2CRGA 2R93J 2H1KA 2VKEA 4IHVA 3FK7A 2EZIA 1U8BA 5M5XJ 1IDYA 1WH5A 1TWAJ 4FCYA 2HXIA 5EYRA 2MSYA 3LSPA 1HLVA 4JX6A 1U78A 1RKWA 4DYRA 5JLXA 3SJMA 4FTHA 4C3IJ 2ID3A 4XRSA 3HM5A 2XB5A 1UHSA 1BW5A 1JKQC 2GBYA 4A3JJ 3A02A 1I6HJ 5IOZA 2IBDA 3BQZA 3B6AA 3Q0VA 4C2MJ 3LNQA 2XGDA 4BBRJ 4XIDA 2IEKA 1ETKA 2NVXJ 1VF9A 5EGOA 3S15J 1LE8A 3FISA 1TWFJ 4A3IJ 1QVTA 2L7ZA 3LSRA 2HI3A 3GTJJ 1ZGWA 1MNMC 2X6OA 3CCYA 1U9OA 1HF0A 2HDDA 1B8IB 3UKGA 3S1NJ 2GLOA 3HOUJ 3JRDA 2Y30A 1QPIA 2LFBA 3S1RJ 3RZDJ 1TWHJ 1H8AC 2Y9ZA 1BW6A 2E2JJ 1XC5A 4G12A 2R0QC 2EZKA 2DJNA 4RDUA 1MBEA 3WHBA 3S1QJ 4IHXA 2HOTA 4BY1J 5BNGA 5C4JJ 1OJLA 4CYCA 5DS9A 1OCTC 4AUXA 4EEFG 2YU9J 2L9RA 1IC8A 3RKQA 1IV6A 1ZR2A 1FIAA 3I4NJ 1FJLA 5IP9J 5HODA 1I50J 4DW6A 5IOYA 2X9DA 4ABZA 3HOVJ 3HOZJ 3HEFA 4FE4A 4M3GA 3GTQJ 2VKVA 1WI3A 1CQTA 1AKHB 2MGQA 4D5CA 1JKPC 1RPWA 5IP6A 3K2AA 5EZGA 2L0KA 2CJJA 5M3FJ 1O4XA 2CQQA 4B3AA 3JR9A 5F1JA 5K7HA 3TP0A 4A3BJ 2PMZN 3HGYA 3MVPA 3QQAA 3TW6A 1IG7A 2O8KA 3BG3A 4UUTA 1ITYA 3BT9A 2N8GA 1W0UA 1LE8B 4M3BA 1Y1WJ 1JT0A 2JA8J 2YUSA 3ZQIA 1JKRC 1W0TA 2FX0A 2AO9A 1WCMJ 5FLMJ 4LOCA 3H3VK 3TEDA 2QCOA 3G1OA 1JJ6C 2Y0SN 2Y2ZA 3C2BA 3IH3A 3LSGA 1P7JA 3VPRA 2NVTJ 3O8HA 3K7AJ 1ETWA 5E3OA 2DA4A 2DA6A 5FLVA 4A3MJ 4UUSB 4X1EA 4GFBA 1VNDA 2NS8A 5FKOA 3CMYA 3GTMJ 2ME6A 3LOCA 1GV2A 1AU7A 2DA1A 1MH4A 5EG0A 1EF4A 1F36A 2FJ1A 1P7IA 2K40A 3QPSA 3ZOBA 4HNVA 1FTTA 2KT0A 1WPKA 1XS9A 2ME0A 1QRYA 4QIWN 5GPAA 5DTDA 3GTGJ 3O8GA 1UG2A 4I76A 2VI6A 4MO7A 3E7LA 5IYBJ 2E19A 3HKZN 3S17J 1LFBA 3WHCA 1QVUA 3L1PA 4A3FJ 1S7EA 2NVYJ 4L5EA 4Y52J 3FIWA 5J1YA 3S1MJ 2CUFA 2TCTA 1LFUP 2XGCA 4D7MA 3NAUA 3PO3J 4BXXJ 2W48A 3RZOJ 3S2HJ 1JJ8C 4IHYA 1WH7A 4A3EJ 1E3OC 1VFCA 5F04A 1K61A 1RR7A 1UMQA 1BL0A 3TP3A 1A6IA 1ZR4A 4BY7J 4AC0A 2R5ZA 3DCFA 3OIOA 4MFEA 4RBOA 5C4XJ 3MKLA 3JRHA 3BTIA 5FJ8J 1ZKGA 2JJ7A 1U9NA 1ZQ3P 5C3EJ 2ECBA 3MN2A 1YRNA 2TRTA 3BR1A 1F43A 2FQ4A 3HOXJ 1JUPA 1OFCX 2OPTA 3NARA 1TC3C 2E1OA 3D1NI 2NVQJ 2LLKA 3ZQHA 2EBIA 3IV5A 3ZQGA 3G1LA 1HOMA 1RETA 2L7FP 5IYDJ 3BR5A 1HCRA 2GM4A 2DMNA 2KDZA 2DA5A 1H89C 1JUMA 4M3EA 3BG5A 2EH3A 4A3GJ 5EEAA 2JN6A 4A93J 1TWGJ 2CQXA 4D5FA 2HOSA 1GDTA 1Y1VJ 5GPCA 5FKLA 1NK2P 1ETQA 5F0HA 1MSEC 1PUFA 3HOWJ 1NK3P 1WGXA 2EZLA 1MBKA 4DZPA 2DA7A 2R5YA 1BJZA 5EDNA 3BG9A 3GTLJ 2DMQA 2DA3A 2AHQA 1MBGA 2P81A 1JTXA 5F08A 3BR6A 1RESA 1Z77A 3SDGA 2M0CA 2HYJA 4DYQA 5JLWA 4A3DJ 5EGOB 2XB0X 1HDPA 2B63J 1D5YA 1Z0XA 2LP0A 2LVSA 5J1UA 2XGEA 3BR0A 2DMUA 4M6VA 2LR8A 4D7NA 4M3FA 2HXOA 5EZHA 2FD5A 2MG4A 3GTKJ 1IUFA 5E3MA 4A3KJ 2M8GX 2JWTA 3LSJA 4B4CA 2ZB9A 1NTCA 2CU7A 2LKXA 1JUSA 2R92J 1Q1VA 1MH3A 4MLOA 1OCPA 4Y7NJ 5FKMA 4QSHA 3BTLA 3BQYA 3ZQLA 2YS9A 3HBLA 1SFOJ 5E3LA 1ETOA 4JX4A 5FKKA 5K7FA 2XPVA 1B8IA 4CYCB 2O7OA 5F0FA 3ZQFA 3Q3SA 3G1MA 3JRBA 3JRAA 2LY9A 2WV1A 1IDZA 2ECCA 2XPWA 5E3NA 1ENHA 3BR3A 4MIMA 2G0EA 9ANTA 2X48A 1MBFA 2H8RA 4XK4A 3HDDA 4X6AJ 1JT6A 3S16J 3OOUA 4DZJA 4FE7A 3SFIA 3A01A 1JKOC 2XPUA 1ETVA 2JA7J 1MBJA 1AHDP 3IH2A 4IHWA 1BA5A 2OF7A 4W97A 1DU6A 4J19A 2DN0A 5IP7J 4C3JJ 1ZK8A 1GVDA 4C3HJ 3TW7A 1TWCJ 2VUMJ 3BTJA 3Q0UA 2JA6J 2WAQN 4V2GA 1AKHA 3BR2A 1B72A 1XG1A 4DYCA 3CQZJ 1MBHA 3H0GJ 4W1UA 1ORKA 2LD5A 1MSFC 3DEWA 2XRLA 1IJWC 2JMWA 3FKIJ 1ETYA 3HB9A 2ELKA 3JRIA 2EZHA 5EG0B 1I3QJ 5F0CA 2LTPA 1X58A 3QPLA 4BKXA 1X2MA 2R7ZJ 2LK2A 4NDLA 2E2IJ 3S2DJ 5M5WJ 2D5VA 2VPRA 3IH4A 2Y31A 1T33A 2I10A 4UUSA 3I4MJ 3PM1A 1ETXA 4FISA 1FTZA 2RAEA 1GT0C 2EQRA 3FK6A 3Q0WA 4S0HB 1H88C 1POGA 3F0CA 5K7ZA 2CUEA 2K9SA 2JA5J 2DMTA 3A01B 5GP9A 1A5JA 1ZTRA 3ZQCA 1APLC 5IPAA 3A03A 2IAIA 3M3YJ 4JX5A 1T56A 1R9TJ 1IRZA 2QF7A 2NS7A 4XRMA 3OSGA 4A3LJ 2WB1N 3GBGA 2M2EA 2R5ZB 2K9NA 4AYBN 4I6ZA 3B6CA 4A69C 2XSDC 3BTCA 3JRCA 1IGNA 1B72B 2ID6A 5J1RA 5EF6A 5F27A 2COBA 3S14J 1DU0A 2HQ5A 1YRNB 1VI0A 2DTZA 1GV5A 3HGGA 4IEJA 4QTRA 3GTPJ 4XICA 1HDDC 4V2FA 1JGGA 5IYCJ 3W6VA 2DMPA 4A3CJ 4MFDA 4JYKA 2K9QA 1G2HA 5M3MJ 5M5YJ 3JRFA 2O9LA 3GTOJ 4B1RA 2DA2A 5C44J 3OSFA 1FIPA 3M4OJ 2NOGA 3CDLA 3PO2J 1FEXA 4JP0A 5J3LA 1K83J 3RQIA 2E2HJ 5FKNA 4M3DA 2MW8A 4BBSJ 1GUUA 1X2NA 3JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9H A;  1RKT A;  2M34 A;  1PUF B;  1JTY A;  2L7M P;  3JRE A;  2Y9Y A;  4XRS G;  1SAN A;  2HOA A;  2JK3 A;  2R5Y B;  3HOY J;  2CRG A;  2R93 J;  2H1K A;  2VKE A;  4IHV A;  3FK7 A;  2EZI A;  1U8B A;  5M5X J;  1IDY A;  1WH5 A;  1TWA J;  4FCY A;  2HXI A;  5EYR A;  2MSY A;  3LSP A;  1HLV A;  4JX6 A;  1U78 A;  1RKW A;  4DYR A;  5JLX A;  3SJM A;  4FTH A;  4C3I J;  2ID3 A;  4XRS A;  3HM5 A;  2XB5 A;  1UHS A;  1BW5 A;  1JKQ C;  2GBY A;  4A3J J;  3A02 A;  1I6H J;  5IOZ A;  2IBD A;  3BQZ A;  3B6A A;  3Q0V A;  4C2M J;  3LNQ A;  2XGD A;  4BBR J;  4XID A;  2IEK A;  1ETK A;  2NVX J;  1VF9 A;  5EGO A;  3S15 J;  1LE8 A;  3FIS A;  1TWF J;  4A3I J;  1QVT A;  2L7Z A;  3LSR A;  2HI3 A;  3GTJ J;  1ZGW A;  1MNM C;  2X6O A;  3CCY A;  1U9O A;  1HF0 A;  2HDD A;  1B8I B;  3UKG A;  3S1N J;  2GLO A;  3HOU J;  3JRD A;  2Y30 A;  1QPI A;  2LFB A;  3S1R J;  3RZD J;  1TWH J;  1H8A C;  2Y9Z A;  1BW6 A;  2E2J J;  1XC5 A;  4G12 A;  2R0Q C;  2EZK A;  2DJN A;  4RDU A;  1MBE A;  3WHB A;  3S1Q J;  4IHX A;  2HOT A;  4BY1 J;  5BNG A;  5C4J J;  1OJL A;  4CYC A;  5DS9 A;  1OCT C;  4AUX A;  4EEF G;  2YU9 J;  2L9R A;  1IC8 A;  3RKQ A;  1IV6 A;  1ZR2 A;  1FIA A;  3I4N J;  1FJL A;  5IP9 J;  5HOD A;  1I50 J;  4DW6 A;  5IOY A;  2X9D A;  4ABZ A;  3HOV J;  3HOZ J;  3HEF A;  4FE4 A;  4M3G A;  3GTQ J;  2VKV A;  1WI3 A;  1CQT A;  1AKH B;  2MGQ A;  4D5C A;  1JKP C;  1RPW A;  5IP6 A;  3K2A A;  5EZG A;  2L0K A;  2CJJ A;  5M3F J;  1O4X A;  2CQQ A;  4B3A A;  3JR9 A;  5F1J A;  5K7H A;  3TP0 A;  4A3B J;  2PMZ N;  3HGY A;  3MVP A;  3QQA A;  3TW6 A;  1IG7 A;  2O8K A;  3BG3 A;  4UUT A;  1ITY A;  3BT9 A;  2N8G A;  1W0U A;  1LE8 B;  4M3B A;  1Y1W J;  1JT0 A;  2JA8 J;  2YUS A;  3ZQI A;  1JKR C;  1W0T A;  2FX0 A;  2AO9 A;  1WCM J;  5FLM J;  4LOC A;  3H3V K;  3TED A;  2QCO A;  3G1O A;  1JJ6 C;  2Y0S N;  2Y2Z A;  3C2B A;  3IH3 A;  3LSG A;  1P7J A;  3VPR A;  2NVT J;  3O8H A;  3K7A J;  1ETW A;  5E3O A;  2DA4 A;  2DA6 A;  5FLV A;  4A3M J;  4UUS B;  4X1E A;  4GFB A;  1VND A;  2NS8 A;  5FKO A;  3CMY A;  3GTM J;  2ME6 A;  3LOC A;  1GV2 A;  1AU7 A;  2DA1 A;  1MH4 A;  5EG0 A;  1EF4 A;  1F36 A;  2FJ1 A;  1P7I A;  2K40 A;  3QPS A;  3ZOB A;  4HNV A;  1FTT A;  2KT0 A;  1WPK A;  1XS9 A;  2ME0 A;  1QRY A;  4QIW N;  5GPA A;  5DTD A;  3GTG J;  3O8G A;  1UG2 A;  4I76 A;  2VI6 A;  4MO7 A;  3E7L A;  5IYB J;  2E19 A;  3HKZ N;  3S17 J;  1LFB A;  3WHC A;  1QVU A;  3L1P A;  4A3F J;  1S7E A;  2NVY J;  4L5E A;  4Y52 J;  3FIW A;  5J1Y A;  3S1M J;  2CUF A;  2TCT A;  1LFU P;  2XGC A;  4D7M A;  3NAU A;  3PO3 J;  4BXX J;  2W48 A;  3RZO J;  3S2H J;  1JJ8 C;  4IHY A;  1WH7 A;  4A3E J;  1E3O C;  1VFC A;  5F04 A;  1K61 A;  1RR7 A;  1UMQ A;  1BL0 A;  3TP3 A;  1A6I A;  1ZR4 A;  4BY7 J;  4AC0 A;  2R5Z A;  3DCF A;  3OIO A;  4MFE A;  4RBO A;  5C4X J;  3MKL A;  3JRH A;  3BTI A;  5FJ8 J;  1ZKG A;  2JJ7 A;  1U9N A;  1ZQ3 P;  5C3E J;  2ECB A;  3MN2 A;  1YRN A;  2TRT A;  3BR1 A;  1F43 A;  2FQ4 A;  3HOX J;  1JUP A;  1OFC X;  2OPT A;  3NAR A;  1TC3 C;  2E1O A;  3D1N I;  2NVQ J;  2LLK A;  3ZQH A;  2EBI A;  3IV5 A;  3ZQG A;  3G1L A;  1HOM A;  1RET A;  2L7F P;  5IYD J;  3BR5 A;  1HCR A;  2GM4 A;  2DMN A;  2KDZ A;  2DA5 A;  1H89 C;  1JUM A;  4M3E A;  3BG5 A;  2EH3 A;  4A3G J;  5EEA A;  2JN6 A;  4A93 J;  1TWG J;  2CQX A;  4D5F A;  2HOS A;  1GDT A;  1Y1V J;  5GPC A;  5FKL A;  1NK2 P;  1ETQ A;  5F0H A;  1MSE C;  1PUF A;  3HOW J;  1NK3 P;  1WGX A;  2EZL A;  1MBK A;  4DZP A;  2DA7 A;  2R5Y A;  1BJZ A;  5EDN A;  3BG9 A;  3GTL J;  2DMQ A;  2DA3 A;  2AHQ A;  1MBG A;  2P81 A;  1JTX A;  5F08 A;  3BR6 A;  1RES A;  1Z77 A;  3SDG A;  2M0C A;  2HYJ A;  4DYQ A;  5JLW A;  4A3D J;  5EGO B;  2XB0 X;  1HDP A;  2B63 J;  1D5Y A;  1Z0X A;  2LP0 A;  2LVS A;  5J1U A;  2XGE A;  3BR0 A;  2DMU A;  4M6V A;  2LR8 A;  4D7N A;  4M3F A;  2HXO A;  5EZH A;  2FD5 A;  2MG4 A;  3GTK J;  1IUF A;  5E3M A;  4A3K J;  2M8G X;  2JWT A;  3LSJ A;  4B4C A;  2ZB9 A;  1NTC A;  2CU7 A;  2LKX A;  1JUS A;  2R92 J;  1Q1V A;  1MH3 A;  4MLO A;  1OCP A;  4Y7N J;  5FKM A;  4QSH A;  3BTL A;  3BQY A;  3ZQL A;  2YS9 A;  3HBL A;  1SFO J;  5E3L A;  1ETO A;  4JX4 A;  5FKK A;  5K7F A;  2XPV A;  1B8I A;  4CYC B;  2O7O A;  5F0F A;  3ZQF A;  3Q3S A;  3G1M A;  3JRB A;  3JRA A;  2LY9 A;  2WV1 A;  1IDZ A;  2ECC A;  2XPW A;  5E3N A;  1ENH A;  3BR3 A;  4MIM A;  2G0E A;  9ANT A;  2X48 A;  1MBF A;  2H8R A;  4XK4 A;  3HDD A;  4X6A J;  1JT6 A;  3S16 J;  3OOU A;  4DZJ A;  4FE7 A;  3SFI A;  3A01 A;  1JKO C;  2XPU A;  1ETV A;  2JA7 J;  1MBJ A;  1AHD P;  3IH2 A;  4IHW A;  1BA5 A;  2OF7 A;  4W97 A;  1DU6 A;  4J19 A;  2DN0 A;  5IP7 J;  4C3J J;  1ZK8 A;  1GVD A;  4C3H J;  3TW7 A;  1TWC J;  2VUM J;  3BTJ A;  3Q0U A;  2JA6 J;  2WAQ N;  4V2G A;  1AKH A;  3BR2 A;  1B72 A;  1XG1 A;  4DYC A;  3CQZ J;  1MBH A;  3H0G J;  4W1U A;  1ORK A;  2LD5 A;  1MSF C;  3DEW A;  2XRL A;  1IJW C;  2JMW A;  3FKI J;  1ETY A;  3HB9 A;  2ELK A;  3JRI A;  2EZH A;  5EG0 B;  1I3Q J;  5F0C A;  2LTP A;  1X58 A;  3QPL A;  4BKX A;  1X2M A;  2R7Z J;  2LK2 A;  4NDL A;  2E2I J;  3S2D J;  5M5W J;  2D5V A;  2VPR A;  3IH4 A;  2Y31 A;  1T33 A;  2I10 A;  4UUS A;  3I4M J;  3PM1 A;  1ETX A;  4FIS A;  1FTZ A;  2RAE A;  1GT0 C;  2EQR A;  3FK6 A;  3Q0W A;  4S0H B;  1H88 C;  1POG A;  3F0C A;  5K7Z A;  2CUE A;  2K9S A;  2JA5 J;  2DMT A;  3A01 B;  5GP9 A;  1A5J A;  1ZTR A;  3ZQC A;  1APL C;  5IPA A;  3A03 A;  2IAI A;  3M3Y J;  4JX5 A;  1T56 A;  1R9T J;  1IRZ A;  2QF7 A;  2NS7 A;  4XRM A;  3OSG A;  4A3L J;  2WB1 N;  3GBG A;  2M2E A;  2R5Z B;  2K9N A;  4AYB N;  4I6Z A;  3B6C A;  4A69 C;  2XSD C;  3BTC A;  3JRC A;  1IGN A;  1B72 B;  2ID6 A;  5J1R A;  5EF6 A;  5F27 A;  2COB A;  3S14 J;  1DU0 A;  2HQ5 A;  1YRN B;  1VI0 A;  2DTZ A;  1GV5 A;  3HGG A;  4IEJ A;  4QTR A;  3GTP J;  4XIC A;  1HDD C;  4V2F A;  1JGG A;  5IYC J;  3W6V A;  2DMP A;  4A3C J;  4MFD A;  4JYK A;  2K9Q A;  1G2H A;  5M3M J;  5M5Y J;  3JRF A;  2O9L A;  3GTO J;  4B1R A;  2DA2 A;  5C44 J;  3OSF A;  1FIP A;  3M4O J;  2NOG A;  3CDL A;  3PO2 J;  1FEX A;  4JP0 A;  5J3L A;  1K83 J;  3RQI A;  2E2H J;  5FKN A;  4M3D A;  2MW8 A;  4BBS J;  1GUU A;  1X2N A;  3JRG A; 
#chains in the Genus database with same CATH topology
 2M9H A;  4KJZ A;  3U1K A;  1TQI A;  2E1N A;  1PUF B;  5DV5 A;  3DU6 A;  3LQR A;  3U2R A;  3QYE A;  3CTA A;  2Y9Y A;  1X19 A;  4XRS G;  5E18 F;  2HOA A;  3CCR I;  1IW7 F;  1D0X A;  1SVM A;  1V54 H;  3H9Q A;  3JCU C;  2VKE A;  2M87 A;  3MZ8 A;  3GW2 A;  5KCM A;  1IN8 A;  1MMN A;  2GOM A;  1U8B A;  1G3S A;  3IAS 2;  5M5X J;  1IDY A;  4NNJ A;  1WH5 A;  3VYR B;  2BY3 A;  2IA1 A;  2XGX A;  4A5N A;  2HXI A;  5EYR A;  2MSY A;  1HLV A;  1YJ9 I;  5JLX A;  3CUQ B;  3LMM A;  6PAX A;  2EV6 A;  2W00 A;  2W4S A;  3LFU A;  2EFO A;  2RNG A;  3X2Q H;  2KP6 A;  4F52 A;  4HBL A;  2VBW A;  1FSE A;  1BR1 A;  1OR7 C;  2C6Y A;  4ZTF A;  1I6H J;  3BQZ A;  3C2H A;  4C2M J;  4WWC A;  1X1A A;  4XL9 A;  3KYC B;  2IPQ X;  5DCM A;  1FPQ A;  1BIB A;  2IS1 A;  3RTR A;  2NVX J;  1VF9 A;  4CO8 A;  3S15 J;  4KIG A;  3BCB A;  2PFB A;  2L7Z A;  4BE2 A;  1EH8 A;  1ZGW A;  1W4M A;  1YX3 A;  1Z21 A;  3CCY A;  3T5X A;  2HQA A;  4Y33 A;  1B8I B;  1T2K A;  4F3Q A;  1LNW A;  1AA7 A;  3S1N J;  2F4M B;  4G6T B;  3RZD J;  1TWH J;  4MTE A;  3P9C A;  2MYS A;  2Y9Z A;  2CMP A;  3MQ0 A;  2NS0 A;  3P7N A;  1XC5 A;  4O6J A;  4G12 A;  2NRA C;  4UV9 A;  4BHP A;  2EZK A;  2X0L A;  3ZMV A;  2DJN A;  4V19 K;  1Z6T A;  3OR1 C;  3I9V 2;  2CV1 A;  2H1L A;  4GCV A;  2HOT A;  1OJL A;  2K3F A;  1SFE A;  4AUX A;  2TDX A;  1A04 A;  2YU9 J;  2L9R A;  4PSX A;  4XLF A;  5CVU A;  4BAY A;  1V5E A;  1WJA A;  1IV6 A;  1FIA A;  4XOP A;  5J40 A;  3VFZ A;  1LPQ A;  3I4N J;  1MMA A;  3ZMS A;  4R1H A;  5HOD A;  4UUV A;  2GIZ A;  4NQW A;  1IAW A;  3FXM A;  3HOV J;  3HOZ J;  5DDG A;  4M3G A;  4FAS D;  4YFK F;  2H09 A;  1XDS A;  3F21 A;  1QGP A;  4RB0 A;  1J75 A;  1JKP C;  1EH7 A;  3I55 I;  3OYD A;  2L0K A;  4IRG A;  3WTY C;  3RCO A;  2XRN A;  2DQL A;  3R61 A;  3K1N A;  2CQQ A;  4AD9 A;  3JR9 A;  3DLA A;  2KL4 A;  2DOE A;  5DCM B;  3QQA A;  3HGY A;  1VQM I;  1IG7 A;  4WXH A;  4NB5 A;  3BG3 A;  4OIR F;  2HVS A;  2N8G A;  1TL8 A;  4M3B A;  1Y1W J;  2EIM H;  2CFX A;  3I5U A;  4KT6 A;  1M1E B;  2YUS A;  4G8X A;  4PJL A;  4HF1 A;  2BHZ A;  3SQN A;  3KE2 A;  1NHA A;  3LAP A;  1WZ2 A;  2VC0 A;  2QCO A;  3G1O A;  3TED A;  4LLN A;  3CO7 C;  4O3M A;  4XKC A;  2Y2Z A;  4PZJ A;  5J4V A;  4H0E A;  1P7J A;  3D5R C;  3O8H A;  4KNY A;  1ETW A;  1UST A;  5TGT A;  3R0A A;  2Z33 A;  3BCA A;  5FLV A;  3M9A A;  1W7P A;  4PJJ A;  2EFW A;  4ZDL A;  4X1E A;  3MKY B;  3FKJ A;  3F8M A;  4LMY A;  3EQL F;  4HNT A;  3QOP A;  3WE2 A;  2DFF A;  5BOX A;  4Q47 A;  2DA1 A;  1MH4 A;  4WXD A;  3PIO F;  3UNG C;  4NC7 A;  1P7I A;  3LA7 A;  2W25 A;  1KQ9 A;  3M8F A;  3QPS A;  5DCF A;  3HIF A;  1K4S A;  4KMU X;  4FET A;  1UCR A;  4NUB A;  1FTT A;  2W24 A;  2IGK A;  1P2F A;  2HU9 A;  1R4M B;  3CF5 F;  1QRY A;  4I02 A;  4E7S A;  3DF8 A;  1QA6 A;  3SZT A;  1KU9 A;  3O8G A;  3GTG J;  1UG2 A;  2M7A A;  2IA2 A;  2Z3Y A;  2FF4 A;  2MH2 A;  3S17 J;  2PEX A;  3EUH A;  1S7E A;  3I0T A;  2O6G E;  2FBK A;  2H27 A;  2LBF A;  3S1M J;  4BH9 A;  2CUF A;  2TCT A;  4KA4 A;  4XLC A;  2E1C A;  1LDK B;  3MMY B;  5K5O A;  2JQ7 A;  2OQR A;  2ZC2 A;  4L5I A;  4BXX J;  1Y6I A;  2W48 A;  1HSJ A;  3RZO J;  4M9X A;  2E36 A;  3EDP A;  2ZSH B;  4ENN A;  2BYV E;  1RR7 A;  2GOX B;  3P9K A;  2BXY A;  2IVM A;  4GO1 A;  2XIG A;  1LEB A;  1A6I A;  1YW7 A;  2A61 A;  3HPG A;  1KQ8 A;  2R5Z A;  3RYP A;  3DCF A;  1TBX A;  4PDK A;  2QQB A;  2FUG 2;  2JPB A;  2Y69 H;  3KZY A;  3RPU D;  1U9N A;  3OYI A;  3IKT A;  3CCS I;  3A2K A;  2R7W A;  4XLA A;  1S7A A;  3FHZ A;  1UFM A;  5HDG A;  1MGT A;  2TRT A;  1YOV B;  1F43 A;  4D9J A;  1Z05 A;  3HOX J;  1QPM A;  4N0B A;  2HVQ A;  5B66 C;  2VQL A;  3CCM I;  1TC3 C;  2DOF A;  1D5V A;  2VAS A;  3DTE A;  3PQJ A;  2R7V A;  4G94 A;  2R7D A;  3U21 A;  3ZQH A;  3JAM Z;  1RET A;  3S32 A;  5IYD J;  2Z99 A;  1OCZ H;  5J47 A;  4FQG A;  2DA5 A;  1H89 C;  1JUM A;  3WGG A;  2V26 A;  4F7Z A;  3BG5 A;  2HKX A;  4A3G J;  2J5P A;  2KKO A;  3VYT B;  5EEA A;  4B09 A;  2HOS A;  2GA2 A;  1YIJ I;  3L09 A;  5F0H A;  2RQQ A;  2DOD A;  1MSE C;  4EQQ A;  3HOW J;  2DFE A;  3DV8 A;  1DP3 A;  1G6N A;  4E4H A;  1QZE A;  1HW2 A;  4EM0 B;  3FF5 A;  2L5Q A;  4L0Y B;  3ABU A;  4L5J A;  3V8K A;  3CUQ C;  3GX4 X;  3GTL J;  2E1M C;  2QQ8 A;  1X4P A;  1MBG A;  2P81 A;  4P55 A;  2XAF A;  2V6C A;  5HS8 A;  2EFQ A;  3K1P A;  3SDG A;  1QO0 D;  4ZZD A;  5HDK A;  2W57 A;  1TW3 A;  3FXJ A;  3MZY A;  1FT9 A;  4ZZL A;  2DK5 A;  2DQR A;  3HG9 A;  4D7N A;  4M3F A;  2P4W A;  2QKM B;  4X0G A;  3GYH X;  2KQR A;  2MG4 A;  5E3M A;  2M8G X;  1N75 A;  1R23 A;  3E5X A;  5CQG A;  3F8C A;  3LSJ A;  3T1B A;  2VT2 A;  4BJ6 C;  2CU7 A;  4DNC A;  1ON1 A;  3ZRG A;  1LFP A;  3WTV C;  1KYW A;  2XAS A;  3O2P E;  1LUJ B;  3JSP A;  1VTN C;  1I1G A;  3GUD A;  1QQI A;  4HLX A;  1FZP B;  2HS5 A;  1D1C A;  4PGH A;  3SHF A;  2XPV A;  3GEZ A;  4CYC B;  2FSW A;  2O7O A;  4KN7 X;  4A5M A;  1HA8 A;  2LY9 A;  5KNL A;  2QSF X;  1DUX C;  1WI9 A;  3M07 A;  1P4A A;  3R4K A;  4M72 A;  2CUJ A;  3V4G A;  3G6E I;  3M8E A;  4MIM A;  2IGM A;  3BZ6 A;  3CCU I;  2DPD A;  4I98 B;  1T6S A;  3D0S A;  2CW0 F;  4RAY A;  2H8R A;  3HDD A;  1KON A;  4AM3 A;  4A0Y A;  1Y0N A;  4HAM A;  1OQY A;  4IOC F;  4KN4 X;  2VQC A;  1PVE A;  2P5L C;  3QP6 A;  4WK8 F;  3VYS B;  1O3T A;  3OYL A;  4MEX F;  3SFI A;  4Q48 A;  2XPU A;  4L9J A;  3QU3 A;  3E1S A;  2P0W A;  1AHD P;  4ESJ A;  2B9S A;  2AXT C;  3BOQ A;  3IH2 A;  2ISZ A;  4IHW A;  1XGO A;  2LKP A;  2M8E A;  4XLH A;  4J19 A;  2DN0 A;  5IP7 J;  2Z16 A;  3ELK A;  3ESW B;  2GA1 A;  3HXL A;  2CG4 A;  1GVD A;  2DO7 A;  5DD4 A;  4ANJ A;  4ZH4 F;  2KJB A;  2VUM J;  4HX7 A;  2YSR A;  4HQM A;  1IUY A;  3QYB A;  4V2G A;  1AKH A;  5FRO A;  4CDG A;  4F93 B;  4XNF A;  4DYC A;  3CQZ J;  4B43 A;  5J6X A;  4ZYH A;  4IHS A;  2FQ3 A;  2DT6 A;  2LD5 A;  2HPI A;  2VL8 A;  3BJO A;  4OAZ A;  2ZKZ A;  2MD5 A;  3FKI J;  5L3B A;  5FLX Z;  2IRF G;  4XBF A;  2R3S A;  3BC8 A;  3N97 A;  3J80 K;  1T0F A;  1JI8 A;  3GF2 A;  3PFI A;  3E5U A;  1STZ A;  2DTR A;  1B59 A;  1ZHF A;  2BV6 A;  5EG0 B;  3I56 I;  1I3Q J;  1OR7 A;  3ZGK A;  2CYY A;  1X58 A;  3CMM A;  2KPM A;  2R7Z J;  3V8J A;  4NDL A;  3W2A A;  2XF5 A;  4UVA A;  1A31 A;  2Q8K A;  1KU2 A;  4J00 A;  4FT8 A;  4AVZ A;  3IH4 A;  2STW A;  1JHH A;  1MND A;  3JTH A;  2I10 A;  4UUS A;  3PM1 A;  2ZME C;  1FOX A;  3BPX A;  1QHG A;  3DU5 A;  3FHN A;  1J2X A;  2KIU A;  2UUZ A;  3KEQ A;  3G4S I;  2FEZ A;  4B47 A;  2LDU A;  3AL0 B;  4AVP A;  1XD7 A;  3F0C A;  1D1B A;  4XR6 A;  5K7Z A;  4BE1 A;  2LY1 A;  3S3O A;  5L3F A;  2D2W A;  3M3Y J;  1Y8Q B;  2IAI A;  3QWL A;  2FOW A;  2AQF A;  3OYC A;  1XPX A;  1R9T J;  2CFO A;  1T38 A;  2WB1 A;  3RPQ A;  4XSX F;  5JHF A;  2NS7 A;  2YX7 A;  3OSG A;  1KU3 A;  2WB1 N;  3GBG A;  2OBP A;  3KIO A;  1SAX A;  3F23 A;  1OKR A;  2X1E A;  1RIO H;  2XSD C;  2GIV A;  4KMF A;  3JRC A;  2XAH A;  2ID6 A;  5CVV A;  5EF6 A;  4RS8 A;  4B48 A;  2COB A;  2ESN A;  4XKV A;  4YII A;  4IEJ A;  1YRN B;  2CH0 A;  3HGG A;  4II2 A;  5GAH J;  4V2F A;  2XDV A;  1JGG A;  1KQ0 A;  1UAA A;  3CC7 I;  1YIO A;  3W6V A;  2L9N A;  2DMP A;  4AID A;  4IZZ A;  1G2H A;  5M3M J;  2O9L A;  1BIA A;  4B1R A;  2DA2 A;  3OSF A;  3HPH A;  4C30 A;  3TOB A;  3AKZ A;  2FMY A;  4JP0 A;  5L3D A;  1V4R A;  2MW8 A;  2K9M A;  2KLO A;  3FXO A;  3GZ5 A;  1IN4 A;  1R71 A;  2F5V A;  1X2N A;  1XB4 A;  3V7S A;  1U0J A;  1ZLJ A;  3I59 A;  1RKT A;  3H3U A;  1U6G A;  4QPQ A;  3JRE A;  2QM3 A;  2L2O A;  5CVR A;  3IHU A;  2R5Y B;  5H2F C;  5K5R A;  2CO5 A;  2CRG A;  4P5O A;  2I8D A;  2H1K A;  1QU3 A;  4QPO A;  2UXN A;  1LVK A;  4IHV A;  4CA0 A;  2YU3 A;  1JGS A;  3FK7 A;  2EZI A;  3GCM A;  4PJ0 C;  4IOA F;  2JVH A;  2K4J A;  1TZL A;  5J4Y A;  2RVC A;  2ZNZ A;  3KP4 A;  4CCL A;  4RGX A;  3LSP A;  4BJT A;  4FTH A;  4C3I J;  4XOT A;  3IWZ A;  2OD5 A;  1S5L C;  4H4K C;  2IA0 A;  2XB5 A;  5LLQ A;  2M45 A;  4C2U A;  1YQA A;  1BW5 A;  2IP2 A;  3TO6 A;  1B4A A;  1UZC A;  3MFK A;  1RZ4 A;  5BS6 A;  4DJA A;  2ETH A;  2XGD A;  2LNB A;  1SC7 A;  4ZYG A;  4XQF A;  3GLX A;  2IEK A;  3DFG A;  1YI2 I;  3F8B A;  1LEA A;  2P6S A;  2D45 A;  1X3U A;  4O5V A;  1X3W B;  4A3I J;  1MDM A;  4I09 A;  1UJ8 A;  1TW2 A;  2VJ5 A;  3CJT B;  1MNM C;  4BE0 A;  4BHC A;  2Z9O A;  1XSD A;  1D1A A;  4KIF A;  2O3F A;  3JRD A;  2Y30 A;  1QPI A;  2DFI A;  3D5L A;  3CP2 A;  1OYI A;  2BVM A;  4BQN A;  4CCO A;  3VSK A;  1H8A C;  2WTE A;  2CV2 A;  4G6Q A;  3VEP A;  3AG3 H;  2E2J J;  5EJC A;  1O57 A;  2XV4 S;  2R7O A;  5FFX A;  1ZEL A;  1W36 C;  1DP7 P;  3FMS A;  2E7X A;  2FBH A;  3H36 A;  3WHB A;  2V79 A;  2F5E A;  3HTU A;  3S1Q J;  1REP C;  1ZRC A;  5C4J J;  2ELH A;  5DS9 A;  2ISY A;  1OCT C;  1V5G A;  3VOD A;  4M6Y A;  1IC8 A;  3WTX C;  1SVL A;  3RKQ A;  1N78 A;  5ILV A;  1H9T A;  1LVA A;  4GXO A;  4ABZ A;  3MZH A;  4HQE A;  3CLQ A;  1WI3 A;  2VXD A;  1CQT A;  3EYY A;  5D5U B;  5FB2 A;  2XAU A;  2EA2 A;  5EEH A;  3I53 A;  2RRE A;  3CJN A;  4B3A A;  2MAB A;  3H5N A;  4E7J A;  3S3M A;  1YS7 A;  5K7H A;  1R00 A;  4OIP F;  1T8I A;  3MVP A;  2O8K A;  3PIP F;  4MGR A;  1W36 D;  3TDU C;  2HDC A;  1MDM B;  2A6T A;  3ZQI A;  2RN7 A;  2NOJ B;  2FX0 A;  2AO9 A;  1W0T A;  3GTK J;  3ISP A;  4BYY A;  4M74 A;  1V3F A;  2PJR B;  1JJ6 C;  3QYF A;  4WCG A;  2EPF A;  4Y4R A;  3C2B A;  5ICF A;  4XRF A;  2DPU A;  2AXL A;  2DA4 A;  1BC8 C;  3MWM A;  3NRV A;  3CJQ B;  3EUA A;  5LFA A;  3M7G A;  4GFB A;  2WAF A;  3FXU A;  1PJR A;  1CF7 A;  1PDN C;  4HV6 A;  3CMY A;  1AU7 A;  1IZ1 A;  4IX7 A;  1U5T A;  2XAJ A;  3RIR A;  1ULY A;  1LQ1 A;  3ZOB A;  4HNV A;  2Y48 A;  2KT0 A;  5IY5 H;  1VQ6 I;  4U0W A;  2IW5 A;  2ME0 A;  1DGR M;  1XCB A;  4QIW N;  1UHM A;  1FNN A;  4MO7 A;  3J7Z I;  1K6O A;  5IYB J;  1TT5 B;  3FZV A;  2E19 A;  2FNP A;  2CW7 A;  2LYC A;  3GME A;  4YEJ A;  2OTJ I;  5CLS A;  1LFB A;  3WHC A;  3QAH A;  3L1P A;  2BY2 A;  2F5C A;  4L5E A;  4Y52 J;  3PUB A;  1RR8 C;  1ZG5 A;  3I71 A;  3VB2 A;  1XN7 A;  5B1A H;  1LJ9 A;  2XGC A;  3HUG A;  4AIJ A;  1U8R A;  3J7Y J;  3PO3 J;  5D4S A;  4L9N A;  3GWZ A;  2DLL A;  2E35 A;  4IHY A;  2A5W A;  5B1B H;  4A3E J;  1H0M A;  2MLG A;  2P5V A;  2EV5 A;  3K4M A;  4ZYA A;  1IXC A;  3OS2 A;  3G2B A;  1X3Z B;  3LFK A;  1YLF A;  1ZRF A;  4AC0 A;  3A0B C;  3PFY A;  5C4X J;  3CCE I;  3WU2 C;  5LHH A;  5H20 A;  4P9F A;  5FJ8 J;  5TRD A;  3MCZ A;  2A68 F;  2W84 A;  1ZQ3 P;  5C3E J;  4G7O F;  1OCR H;  3OR2 C;  2XRO A;  3LA2 A;  2FQ4 A;  4BNC A;  3NAR A;  4M71 A;  1OIS A;  1IN6 A;  3CUO A;  1EA3 A;  3O6B B;  2E71 A;  2NVQ J;  2EBI A;  3D5S C;  3LAJ A;  2OA4 A;  1K4T A;  2GXG A;  2L7F P;  3BR5 A;  2OAZ A;  4GGG A;  3SEQ A;  2DMN A;  2KDZ A;  2COM A;  4ESF A;  1FWZ A;  2H6B A;  4CCJ A;  2FRH A;  3F9K A;  2ZXJ A;  4L0Z B;  4A93 J;  2OV7 A;  4CYD A;  4HPQ A;  3ZQ7 A;  2E34 A;  4BS9 A;  3OV8 A;  2ZJR F;  2STT A;  3J7A Y;  2OJE D;  4L9T A;  1BI2 A;  1NK2 P;  3DBR B;  2PX9 A;  2MC3 A;  4BEH A;  1G8X A;  3TGN A;  3ZXS A;  4IRI A;  1WGX A;  2D1V A;  3H3Z A;  2X4H A;  4DIQ A;  1Z9C A;  3N4M A;  1BJA A;  1W5S A;  3L2Q A;  1BJZ A;  1BN5 A;  1OMI A;  1G3T A;  2PLY A;  4OIO F;  3BG9 A;  5A2Q Z;  2AHQ A;  5DM7 F;  3DEU A;  1JTX A;  1OYY A;  3BR6 A;  3DPU A;  2JTV A;  3WG9 A;  2QEX I;  4HRI A;  1Y0U A;  2XHK A;  2UXX A;  2M0C A;  5A2Q K;  3ABM H;  1R5I D;  2HDW A;  4DYQ A;  5LGU A;  1KZH A;  1YE9 A;  1SFK A;  1O3Q A;  2XB0 X;  1WHU A;  2LSO A;  1Z0X A;  2LVS A;  3OYJ A;  3K1M A;  5J1U A;  2O0Y A;  2EK5 A;  3BR0 A;  3CP8 A;  2DMU A;  2EFN A;  1DGW Y;  4ZDO A;  2FD5 A;  4EVI A;  2ADU A;  3L9F A;  2V4J C;  3LSM A;  1XDU A;  3F8N A;  2LRD A;  1S7O A;  4B4C A;  2ZB9 A;  4OMY A;  1JUS A;  2R92 J;  4HDV A;  2MH9 A;  5FD5 A;  1QZZ A;  5F1R A;  4A0X A;  1QZY A;  3QPT A;  3ZQL A;  5ICC A;  3SZP A;  1SFO J;  5E3L A;  2JPC A;  1ETO A;  2NNN A;  3GFM A;  1VQN I;  2HR3 A;  4YIR X;  1ODD A;  1GXP A;  3ZQF A;  1XSV A;  3G1M A;  3KZI C;  3BJ6 A;  5K5Q A;  3JRB A;  2M4G A;  3IUO A;  2WV1 A;  5E3N A;  3KYL A;  1ENH A;  3GVA A;  2BBY A;  2F5F A;  3QU6 A;  3V7C A;  3ZP5 A;  2G0E A;  1J5Y A;  9ANT A;  1FX7 A;  1MBF A;  4C9Y A;  3K4L A;  4XK4 A;  4NQW B;  1D8J A;  3DKX A;  3AG2 H;  3DKY A;  4UVB A;  4X6A J;  3AFH A;  2CQ7 A;  4FE7 A;  1O7L A;  1Z1D A;  4DBQ A;  5BQT A;  4XLE A;  1JKO C;  4G9Y A;  1WFX A;  4EMS A;  3ABL H;  5GAG J;  1X1C A;  4QWQ A;  3VYU B;  2OF7 A;  5E8I A;  1BA5 A;  1OCC H;  1MW7 A;  4C3J J;  2ZJP F;  4C3H J;  4EJT A;  2VB6 A;  5GAE J;  1BI3 A;  2F2E A;  1W1W E;  3BR2 A;  1B72 A;  1S8N A;  2ZFW A;  2KIF A;  1WWX A;  4YG2 F;  1ZLK A;  3R0J A;  3HRU A;  2F4O B;  3S2W A;  2O5R A;  5HNH A;  4W1U A;  5JFR A;  4CUG A;  1FYL A;  1A6Q A;  2H94 A;  5DUK A;  5KAI C;  2VJI A;  1W7P B;  1A36 A;  3J7A O;  1IJW C;  3ROU A;  3RSN A;  3AG1 H;  1ETY A;  4MHG A;  2DK8 A;  3HB9 A;  4ZYE A;  2OU2 A;  3KEY A;  2ZCW A;  4P9U A;  2ELK A;  1GHC A;  1BOA A;  2EZH A;  3RQ4 A;  5F0C A;  2QGU A;  3CMA I;  5KHD A;  3WOD F;  3K0L A;  1PUE E;  1R1V A;  1X2M A;  2LK2 A;  2LF8 A;  3H5A A;  5M5W J;  1HBX G;  4CXF A;  4G7Z F;  2R7X A;  3PJR A;  5JI6 A;  3V42 A;  2HWV A;  5D8K B;  1T33 A;  4WXC A;  2VLA A;  3I4M J;  1U2W A;  5ILU A;  2RAE A;  1GT0 C;  3WGH A;  4YIF A;  2XUB A;  1F4K A;  4KIS A;  1E0E A;  3FMR A;  3K70 C;  1I6X A;  2LBF B;  4PUS A;  1I27 A;  4S0H B;  1POG A;  2QBY A;  5CJ9 A;  4LG3 A;  3VWB A;  2KDO A;  1YIT I;  1YW8 A;  1YHQ I;  1S3J A;  1FOK A;  4IJA A;  5GP9 A;  3FM5 A;  2VJ4 A;  3GZN B;  1ZTR A;  3ZQC A;  5D4R A;  2FA5 A;  3A03 A;  4JX5 A;  1YG2 A;  4M73 A;  1IRZ A;  3DKW A;  2JSP A;  2QF7 A;  1T08 B;  3K2Z A;  3F3X A;  5JHU A;  5LGT A;  2R5Z B;  3MAJ A;  2X85 A;  4I6Z A;  1N77 A;  2XKP A;  1HC8 A;  3BDD A;  1X1B A;  3K4K A;  3A0H C;  1IN5 A;  1NG7 A;  1B72 B;  4L9V A;  5J1R A;  2FML A;  2V6E A;  3S14 J;  1DU0 A;  2DTZ A;  4ZDP A;  2KRH A;  4UV8 A;  2X6X A;  3RJP A;  2G7H A;  4XIC A;  1R58 A;  1VQ5 I;  3ASO H;  2CQN A;  5D5V B;  2AS5 F;  3JW4 A;  2DXI A;  3QOE A;  4AWX B;  2O03 A;  3K70 D;  1SFX A;  2WV0 A;  3JRF A;  3M4O J;  3CF2 A;  1FIP A;  3OS1 A;  3BP8 A;  2DT7 B;  4EJO A;  1TT0 A;  2XKO A;  4IL6 C;  5J3L A;  1K83 J;  3RQI A;  2E2H J;  5FKN A;  3K6G A;  4PJM A;  1ERD A;  4M3D A;  4AIH A;  1G3Y A;  3V8L A;  3E0J B;  3S8P A;  3AG4 H;  3MEX A;  1JHF A;  3EYI A;  1PYV A;  1XCV A;  3TKY A;  4A6E A;  2BEO A;  4BXF A;  4XSZ F;  1S9H A;  1JTY A;  3WGI A;  1FLI A;  4IPA A;  3K4J A;  1SAN A;  1XTA A;  2JK3 A;  3C1D A;  2CSO A;  3HOY J;  3CME I;  2ELJ A;  2ACJ A;  1ZH5 A;  4L18 B;  1YJW I;  5F64 A;  2W82 A;  4JOM A;  1YO5 C;  1TTY A;  2A6H F;  4Q4Z F;  4RAF A;  4JX6 A;  1U78 A;  2WY7 Q;  1IO2 A;  4NC6 A;  4DYR A;  3MKW B;  2LRE A;  3Q5F A;  1MMS A;  3SJM A;  2LF7 A;  2ID3 A;  2QEN A;  2VBX A;  5LEJ A;  3HM5 A;  1H9G A;  1WJF A;  2WY8 Q;  4HF0 A;  3HOT A;  3K10 A;  2PG4 A;  3SDB A;  1JKQ C;  3PQK A;  1WJB A;  4A3J J;  3A02 A;  3KPH A;  2IBD A;  2PMU A;  2W85 A;  2K85 A;  3GO5 A;  3J80 Z;  1BC7 C;  1MMG A;  4XID A;  4XLN F;  3T8T A;  5JR3 A;  2CGP A;  3QOD A;  4HV5 A;  4PGG A;  5EGO A;  1LE8 A;  3FIS A;  1TWF J;  2OUM A;  1QVT A;  2HI3 A;  2Z5U A;  3GTJ J;  4E7K A;  4RLF A;  2EFP A;  1T95 A;  5E1X A;  4JBA A;  1R49 A;  1HF0 A;  4N4N B;  2HDD A;  3UKG A;  2FE3 A;  2KIM A;  3F6V A;  2Q0O A;  1YFH A;  2A07 F;  1Q1H A;  2X6Y A;  2VXZ A;  3G71 I;  1BW6 A;  2JUG A;  1NH3 A;  5DUI A;  1B9N A;  3H1C A;  5E1Z B;  2R0Q C;  5BPD A;  1JE8 A;  4MTD A;  4A0Z A;  4JQF A;  3PNT A;  2BW3 A;  3FMQ A;  4HDU A;  4BY1 J;  5BNG A;  3I4P A;  2HTJ A;  1BM9 A;  4LIU A;  1R6R A;  3RKX A;  3M1E A;  4CHU A;  2RGV A;  3RDI A;  1ZR2 A;  1Z6R A;  3NWS A;  3GZ6 A;  1KU7 A;  4HW0 A;  4E7Z A;  4FE4 A;  5HNF A;  4Y13 A;  3GTQ J;  3ZMU A;  1IN7 A;  4LB6 B;  1AKH B;  3BY6 A;  2MGQ A;  3KZZ A;  5IP6 A;  4BDZ A;  3K2A A;  2IJL A;  2CJJ A;  3A4C A;  3GXO A;  3BG7 A;  1LDJ A;  2GXA A;  4BQQ A;  2PMZ A;  1O3S A;  5F1J A;  3TP0 A;  4A3B J;  2PMZ N;  3TW6 A;  1U3E M;  1E3P A;  4UUT A;  3ZMD A;  1LE8 B;  4IKF A;  2JA8 J;  1Z7L A;  3HZJ A;  1JXS A;  1RC9 A;  2VKH A;  4HG2 A;  5FLM J;  2HNH A;  3E97 A;  4LOC A;  2XF7 A;  1W5C C;  2YX4 A;  4FX0 A;  1D0Z A;  4G7H F;  2Y0S N;  2IGO A;  2ZXH A;  3LSG A;  5HVQ C;  2NVT J;  5LBQ A;  4LG0 A;  3K7A J;  5AON A;  3CZ6 A;  5E3O A;  2K7L A;  2XVC A;  4A3M J;  2VBZ A;  3COA C;  3CCQ I;  4UUS B;  3V7R A;  1HST A;  1Z7U A;  1VND A;  2V1D A;  5GTI C;  1RRJ A;  5FFZ A;  2F48 A;  2NS8 A;  3FBN B;  4XMY A;  5FKO A;  3GTM J;  3ZMZ A;  2ME6 A;  1J7K A;  3W2W A;  2V9V A;  5AIP A;  4ZC3 A;  4BL0 B;  3PUF A;  2FJ1 A;  2LY2 A;  1YTY A;  3H92 A;  2L54 A;  3EUH C;  1FMW A;  5ICG A;  1XGS A;  3OYG A;  1P4W A;  2VBY A;  3IRQ A;  1R4N B;  1FYK A;  1WPK A;  2H6C A;  1XS9 A;  1Y39 A;  2IT0 A;  2KIS A;  5H6R A;  2HPM A;  5GPA A;  2A5Y B;  3DP7 A;  1XGM A;  2HGC A;  3HKZ A;  3E7L A;  1W7P D;  1TP4 A;  3HKZ N;  2IS4 A;  3RPU A;  2NVY J;  4RB1 A;  3CCJ I;  3I64 A;  5J1Y A;  1WKM A;  3L2W A;  1OCO H;  1TQM A;  5HLH A;  5JVT A;  1IXS B;  4HZF A;  1LFU P;  3KP2 A;  4XON A;  2UWM A;  5CPR B;  2ZFU A;  1KGS A;  1WH7 A;  5FRN A;  2QUF A;  4B8X A;  2BGC A;  1J0R A;  2M1B A;  2UV1 A;  3OYA A;  2EJR A;  3QPH A;  1D0Y A;  2JA2 A;  3HL2 A;  1VFC A;  5F04 A;  5L3E A;  1UMQ A;  4ZTJ A;  1K78 A;  1BL0 A;  2MA3 A;  3FXQ A;  1SMY F;  4LIV A;  2EIK H;  3TP3 A;  4A6D A;  5IT9 K;  4MNU A;  3KLN A;  4GYI A;  3BZK A;  3Q9S A;  3IWF A;  3JRH A;  2M30 A;  3GFI A;  3H9G A;  3K4B A;  1DPR A;  4U0V A;  4KIC A;  2WWY A;  4LGW A;  3MN2 A;  3OOP A;  3BR1 A;  4LG0 B;  5KAF C;  2DW4 A;  2OPT A;  4PK4 A;  1YJN I;  2XSJ C;  5LHG A;  2E1O A;  3D1N I;  2RQP A;  4D0P A;  1Z91 A;  2LC2 A;  3I59 B;  4KT5 C;  3IV5 A;  3G3Z A;  3PNV A;  2CWE A;  1L3L A;  3G1L A;  1HOM A;  5B3S H;  2OTL I;  2KZG A;  3PSI A;  5FO5 A;  3BRO A;  1DQU A;  3OYF A;  1HCR A;  2JRT A;  2GM4 A;  1FBS A;  2EH3 A;  1F9N A;  1I5Z A;  1UG0 A;  1UHW A;  1TWG J;  2CQX A;  5LD2 C;  4RMN A;  2MBF A;  1Y1V J;  5FKL A;  3MD2 A;  2HTS A;  2HZT A;  1PUF A;  2R7R A;  1NK3 P;  1IRX A;  3IAM 2;  3NQO A;  4EJV A;  2X1D A;  1EV7 A;  3PNY A;  2VQG A;  4LB5 A;  1MBK A;  3KP6 A;  3RKW A;  4HX4 A;  2IXS A;  3WU1 B;  2DMQ A;  2DA3 A;  3KP7 A;  3OYH A;  3L00 A;  1IV8 A;  1RES A;  2EIJ H;  2PQ8 A;  3R6S A;  1Z77 A;  4M9S A;  4BUP A;  5GAD J;  1T39 A;  2DFH A;  4KIT B;  1K78 B;  1OLT A;  4ENK A;  5JLW A;  4A3D J;  3SEZ A;  2L3D A;  4R8H A;  3W3C A;  2B63 J;  3CUQ A;  2Q2E A;  3OL4 A;  1D5Y A;  3F6O A;  1VQK I;  4ITV A;  1EH6 A;  2EWN A;  2MD0 A;  2LR8 A;  5LRS A;  2JT1 A;  3KEO A;  4RM3 A;  5L3C A;  3DXJ F;  5FRM A;  1IUF A;  3B73 A;  4A3K J;  2DI3 A;  1YW9 A;  3PSF A;  4LIT A;  4C2T A;  2DU9 A;  1NTC A;  2LKX A;  2LOO A;  3K4C A;  5D8L B;  1MMD A;  1MH3 A;  4GDF A;  1OPC A;  2X6W A;  1SD5 A;  4IRH A;  2YS9 A;  2A3S A;  3HBL A;  2BY1 A;  4ETS A;  3J81 Z;  4CGZ A;  5K7F A;  3DEE A;  3I54 A;  4DBR A;  1B8I A;  5F0F A;  3TO7 A;  4HLY A;  2AQE A;  3LA3 A;  4ZJZ A;  3AL0 C;  1MNE A;  3J81 K;  1RI7 A;  1R1T A;  2XPW A;  4RA2 A;  3BR3 A;  2CUZ A;  2Y75 A;  2K27 A;  3HSF A;  2JZY A;  3GFJ A;  3FBI B;  2H8W A;  3DBL B;  2VT3 A;  4EGZ A;  3NEU A;  3U9G A;  4DZJ A;  5DM6 F;  2VOO A;  2KFD A;  3WU0 A;  3PL8 A;  4RB3 C;  3A01 A;  3T8R A;  1ETV A;  3ZN0 A;  2KRF A;  1J59 A;  1IF1 A;  4EM1 A;  4B3X A;  4P1W A;  3LQQ A;  2P7V B;  2EIN H;  2KRC A;  2L9V A;  4HSR A;  5FD6 A;  3ZPL A;  4Y17 A;  4EAT A;  5E20 A;  4CCK A;  1S6L A;  1ZGJ A;  3HRS A;  1FBQ A;  2Q2E B;  3TW7 A;  2E1M B;  1TWC J;  1D3Y A;  4Y3O A;  1T0F C;  1XG1 A;  2HZD A;  3N05 A;  2NYX A;  4Q5S F;  5K1Y A;  4KYW A;  3H0G J;  1WVR A;  2RDP A;  1MSF C;  1Z3X A;  2GZW A;  3P9I A;  3DEW A;  3AAF A;  2JUC A;  3WE3 A;  1EKE A;  1PP8 F;  2FNA A;  1CF7 B;  1SAU A;  2ZO4 A;  3K4N A;  1U5T B;  4RGS A;  1GLN A;  2K86 A;  4PFO A;  1LB2 A;  2LTP A;  1XX5 A;  5CVI A;  4D1Q A;  2DT5 A;  2EB7 A;  3KP3 A;  2QLZ A;  1FP2 A;  2VPR A;  1V55 H;  3OWT A;  1HKQ A;  1ZN2 A;  2Y31 A;  3Q9V A;  3T0Y A;  3WTZ A;  4BJ5 C;  3S3N A;  4F55 A;  2E7W A;  1ETX A;  1B1B A;  2PN6 A;  3GLL A;  3ECO A;  5H6Q A;  2HEO A;  5CQE A;  3TMO A;  5HOO A;  3OYE A;  2V9K A;  2L01 A;  1BI0 A;  1BBY A;  1FOW A;  3ZN1 A;  5J8C A;  4ESB A;  3HUG B;  1H88 C;  2GAU A;  1X1D A;  1SD7 A;  2K9S A;  3LSH A;  2JA5 J;  1FY7 A;  3DQV C;  3A01 B;  4CSW A;  3FDY A;  5J8F A;  3HHH A;  3KX2 A;  4UHT A;  1S29 A;  2WC2 A;  2ZME A;  4XLP F;  1A5J A;  2ZBK A;  4N9I A;  2M4K A;  1T56 A;  4XM3 A;  2WAD A;  4CZC A;  4HNU A;  2F5D A;  2YR2 A;  3H0D A;  4XRM A;  1G59 A;  2K3P A;  3DTK A;  1I1S A;  4A69 C;  3HRM A;  4NC8 A;  1TLH B;  1IGN A;  4ENJ A;  1UB9 A;  1X1P A;  4J01 A;  4LK1 F;  1VI0 A;  2JVG A;  3UR3 C;  4QTR A;  1E17 A;  3TOA A;  4WX9 A;  1HDD C;  5F6F A;  1WJC A;  1FC3 A;  5IYC J;  2ZNY A;  2DDB A;  3W6K B;  2UZK A;  2PJP A;  4HST A;  4ASN A;  1FOY A;  3C7J A;  1SFU A;  2QWW A;  1ZG3 A;  2OC6 A;  4RM2 A;  5E79 C;  1EJ9 A;  4OAY A;  2K9Q A;  5LEK A;  4FX4 A;  5C44 J;  4RGR A;  5ILS A;  2NOG A;  2CV0 A;  3VSL A;  1WJ5 A;  4EM2 A;  1FEX A;  1VQP I;  1Z3Y A;  4I7H A;  3FWE A;  2V1U A;  1O7F A;  2BY0 A;  1R1U A;  1MD0 A;  4ENM A;  1GUU A;  4HOB A;  2KJC A;  3L2U A;  2V1X A;  5CVJ A;  1FJL A;  2M34 A;  2X51 A;  3HJE A;  4BEH B;  3CDH A;  5LGN A;  4LJZ F;  2NNY A;  2L7M P;  2P8T A;  3HRT A;  2F4I A;  3F72 A;  1B6A A;  1B9M A;  2R93 J;  4G6D A;  4OU0 A;  2MFZ A;  4KUM A;  3EET A;  2M0M A;  3DBH B;  4YEL A;  1R22 A;  2YPR A;  2ZME B;  3O3K A;  3H35 A;  2CS3 A;  1ZRE A;  3EPZ A;  1TWA J;  2HYF A;  4FCY A;  4M9Z A;  2ZSI B;  5DD8 A;  3ABK H;  4U88 A;  1RKW A;  3TO9 A;  4F91 B;  2K9L A;  5DYM A;  3ZR8 X;  3DWL E;  2ZXW H;  2R7F A;  2VKD A;  3ABT A;  5TIS C;  4XRS A;  3FM3 A;  3L2C A;  2FU4 A;  3REO A;  4LLG F;  4E7I A;  1WQ2 A;  1UHS A;  3JTG A;  3DLL F;  2R7T A;  3B02 A;  2GBY A;  1TNS A;  3KFW X;  4BHB A;  2NAZ A;  3CLO A;  2WBM A;  3B6A A;  3Q0V A;  5LRR A;  5IOZ A;  1X4O A;  3LNQ A;  4KFC A;  3SZG A;  4BBR J;  3OIQ A;  2NVU B;  2B0L A;  2KIQ A;  4YRV A;  2KZV A;  5E17 F;  1ETK A;  2E5N A;  4LD5 A;  1FP1 D;  5ERI A;  3OL3 A;  3BJA A;  3WTT C;  2BOL A;  1NG6 A;  3C3W A;  4Y15 A;  3SYT A;  3LSR A;  5D6F A;  4CH7 A;  2VIX A;  1S72 I;  2X6O A;  2OQG A;  2HFH A;  2JRM A;  3E6B A;  4UB6 C;  4DGW B;  4IO9 F;  1U9O A;  4MQV A;  2GLO A;  3HOU J;  1BOB A;  2LFB A;  3S1R J;  1J9I A;  4UNO A;  2OCE A;  1KYZ A;  3C2G A;  2BZT A;  4WF2 A;  2L4A A;  3LSI A;  3CD6 I;  2ICW G;  1ACI A;  3P5J A;  4RAZ A;  2ESH A;  5CKT A;  4RDU A;  1MBE A;  2HQN A;  1DPU A;  3JAM K;  4IHX A;  1I39 A;  1XMK A;  3HTS B;  1E2X A;  4DOZ A;  4CYC A;  3OYN A;  2PMH A;  4EEF G;  2DJI A;  3HSE A;  3ML6 A;  3CCV I;  2E5Z A;  2XAG A;  2QSG X;  1GXQ A;  3E6M A;  5IP9 J;  1I50 J;  4DW6 A;  3HOS A;  1K6Y A;  5IOY A;  2X9D A;  3LST A;  3HEF A;  2KHM A;  2P6T A;  2V9P A;  3L2V A;  2VKV A;  2XF6 A;  4RGU A;  4U7B A;  4P96 A;  4D5C A;  1HW5 A;  1RPW A;  4EV0 A;  3FXK A;  5EZG A;  5M3F J;  4YFX F;  1O4X A;  1O3R A;  3ZCO A;  1C0W A;  2XAQ A;  3SXY A;  3ASN H;  3MKZ A;  3DTI A;  3ECH A;  3BG6 A;  3E3V A;  4UXN A;  3U1D A;  1ITY A;  3BT9 A;  1W0U A;  5E8G A;  4UY8 I;  1JT0 A;  4BXU A;  4U0Y A;  5CYV A;  3F8F A;  1JKR C;  2O61 A;  1WCM J;  1PP7 U;  3RI4 A;  1XMA A;  2DDA A;  3H3V K;  3HYI A;  1U5T C;  4TV7 A;  3IH3 A;  3OYM A;  2VON A;  3VPR A;  1XGN A;  1F1Z A;  3TL4 X;  3R60 A;  2VPL A;  1LKX A;  2G7U A;  2DA6 A;  2DOA A;  1QHH D;  2PBI A;  2A05 A;  1VQ7 I;  1MZB A;  3A1Y A;  4GYG A;  3LOC A;  1GV2 A;  2WA0 A;  5EG0 A;  1EF4 A;  3BWG A;  1F36 A;  4U87 A;  2K40 A;  2HKO A;  4CCM A;  3ERE D;  4E7H A;  1VQ8 I;  2FBI A;  3WTW C;  4IQ4 A;  1Y8R B;  2BVL A;  3ZMT A;  3IL2 A;  2QBY B;  4AU7 A;  2JSC A;  2EA4 A;  2V7F A;  4I0A A;  2QQ9 A;  3CC2 I;  4RLQ A;  3E5Q A;  2IS2 A;  1HXD A;  3OS0 A;  1W5T A;  5DTD A;  4CZZ A;  1P92 A;  2VI6 A;  4I76 A;  2VE9 A;  1XSX A;  1IRF A;  1QVU A;  4A3F J;  3CES A;  3CO6 C;  1AOY A;  3FIW A;  3C18 A;  2G9W A;  3VOE A;  1USS A;  3W6J B;  4D7M A;  3NAU A;  3OY9 A;  5E1W A;  2IGN A;  3ZQQ A;  3S2H J;  4LK0 F;  1MIJ A;  5HLG A;  1JJ8 C;  1GVJ A;  1E3O C;  5D5X B;  2QKL B;  4AIK A;  1K61 A;  4QLC U;  2HYG D;  3OIP A;  1BR4 A;  1ZR4 A;  4BY7 J;  2DAO A;  4RAG A;  4BQO A;  4OIQ F;  4IXA A;  3OIO A;  4MFE A;  4RBO A;  3MKL A;  3BTI A;  2QQA A;  2CQK A;  1ZKG A;  3FX3 A;  5LHI A;  4EJU A;  2JJ7 A;  4ON0 A;  5HLT A;  3L2R A;  1VZ0 A;  4OMZ A;  4IHT A;  2VN2 A;  2ECB A;  2PI0 A;  1WJD A;  4Z2Y A;  1YRN A;  2F6C A;  5IT3 A;  3IRR A;  3HSR A;  1JUP A;  1OFC X;  4N9H A;  2RC4 A;  4MQ9 F;  2CW8 A;  3FXL A;  2WAE A;  2LLK A;  2V1N A;  3ZQG A;  1Y56 A;  2W7N A;  2XC7 A;  1WJE A;  5FLX K;  4LFU A;  2E60 A;  5ED4 A;  4I2O A;  1G3W A;  4M3E A;  1HW1 A;  1ZAO A;  2JN6 A;  4ZYD A;  1T98 A;  4EGY A;  1R5H A;  4D5F A;  1A35 A;  3VDX A;  2A6E F;  4S05 A;  1RUO A;  1GDT A;  5GPC A;  3JSO A;  3WTU C;  3RYR A;  2FOK A;  2KMU A;  1ETQ A;  1G4D A;  4BAC A;  4NHJ A;  2LH9 A;  4CCN A;  1ZAR A;  2EZL A;  4DZP A;  2DA7 A;  2HOE A;  2BHY A;  5HDN A;  2R5Y A;  4IQJ A;  5EDN A;  3KP5 A;  5HS7 A;  1P9Q C;  2RV8 A;  3H5R A;  2OZU A;  2ZJQ F;  2BXZ A;  2R7Q A;  1YX5 A;  1QNT A;  5F08 A;  4II3 A;  4M6X A;  2J5O A;  4E6K G;  5DEQ A;  1MJA A;  2HYJ A;  1P6R A;  2I5U A;  1YS6 A;  5D6E A;  1MJB A;  5AIQ A;  5EGO B;  2DBB A;  1HDP A;  5FGM A;  4R79 A;  1QBJ A;  2LP0 A;  2Q1Z B;  3WG7 H;  2VE8 A;  1BI1 A;  2XGE A;  3KET A;  4M6V A;  3K9T A;  3WTS C;  2R7S A;  2BE5 F;  2Y0S A;  1VQO I;  2VJJ A;  2HXO A;  2P5K A;  1UEL B;  5EZH A;  1SEU A;  4XKB A;  2GQQ A;  3QRF F;  4FHT A;  1ZG1 A;  2VOD A;  3BLY A;  1TNT A;  2JWT A;  3ERM A;  4XKW A;  1R36 A;  4HF2 A;  1Q1V A;  2MLK A;  1AWC A;  4MLO A;  1OCP A;  4Y7N J;  4MEY F;  5FKM A;  4YFN F;  2FXA A;  1J09 A;  3HC7 A;  3OMY A;  3BTL A;  1FMV A;  3BQY A;  4OOI A;  4UVC A;  4QSH A;  1K7A A;  1RUN A;  3LWF A;  1VQ4 I;  1RNL A;  4HYE A;  4JX4 A;  2ZJ2 A;  3CJR B;  1MKM A;  3LL7 A;  2BW3 B;  5FKK A;  2R7U A;  1SMT A;  2RNJ A;  4A2U A;  1LDD A;  2B7E A;  3Q3S A;  1HKT A;  3GFL A;  3JRA A;  3TDZ C;  3DPL C;  1IDZ A;  2VC1 A;  2ECC A;  1DDN A;  1TQP A;  1FSH A;  2A69 F;  4GRI A;  4KIB A;  4HEA 2;  1ZGA A;  4Z6Y A;  1SVO A;  3OYB A;  2R4G A;  2X48 A;  2HQR A;  2K02 A;  1WSU A;  4XN3 A;  4IF4 A;  4E7L A;  5EEG A;  1L0O C;  1VQL I;  1JT6 A;  3S16 J;  3OOU A;  4I0B A;  2MC4 A;  4U7D A;  3KCC A;  1R7J A;  2JA7 J;  1MBJ A;  2LMD A;  5IT9 Z;  4W97 A;  1DU6 A;  3G73 A;  4CIC A;  2X1C A;  3QP5 A;  4NBQ A;  1ZK8 A;  4N4O B;  5JVG F;  4BU2 A;  2WAQ A;  4PFP A;  3LSK A;  3TQN A;  1IXR C;  3BTJ A;  3Q0U A;  5D5W B;  2WAQ N;  4RB2 C;  2JA6 J;  3H9J A;  3IC7 A;  4XOR A;  2Z2S B;  1WRJ A;  1SD4 A;  1MBH A;  1P4X A;  1ORK A;  3ULQ B;  4BQA A;  4I99 C;  2GXB A;  1OYW A;  1ZYR F;  2XRL A;  4LLL A;  2O8X A;  2JMW A;  5L3G A;  4A12 A;  2VOP A;  3KYD B;  3M8J A;  1SD6 A;  4PSW A;  3JRI A;  4F92 B;  1KA8 A;  2EIL H;  1CGP A;  5HLI A;  2QZ8 A;  2W1O A;  5BMZ A;  1YYV A;  3CDI A;  3QPL A;  2DCE A;  4BKX A;  1F5T A;  4I01 A;  2PJR A;  3NWT A;  3OYK A;  1N25 A;  4HA8 A;  2E2I J;  3S2D J;  3E6D A;  3HHG A;  2D5V A;  3S93 A;  1ONV A;  1D8K A;  3I58 A;  3BPV A;  3IP4 B;  4JK1 X;  2M3A A;  2GWR A;  2OCC H;  4UB8 C;  4E70 A;  4EJW A;  2L7K A;  4FIS A;  1FTZ A;  3E6C C;  1I3A A;  2D1H A;  3W2V A;  1ZRD A;  2EQR A;  3FK6 A;  3Q0W A;  5KK1 A;  3F22 A;  4B44 A;  3CC4 I;  1FBU A;  2QSH X;  5B5E C;  3I3L A;  1Z67 A;  2L02 A;  2CUE A;  2DMT A;  2NXN B;  1MJ9 A;  2Y0M A;  2L9S A;  1HKS A;  4BDY A;  3L7W A;  1APL C;  5IPA A;  2K4B A;  2VQH A;  1XMX A;  2M5W A;  4HX8 A;  3CCL I;  5GTH C;  1VQ9 I;  3FXR A;  2DYR H;  4AYB A;  4S04 A;  4IVN A;  3K69 A;  4A3L J;  2M2E A;  2K9N A;  4AYB N;  4DQ2 A;  2K5C A;  3B6C A;  1K79 A;  2L4M A;  1HQC A;  1IRG A;  3BTC A;  4OWR B;  2LG4 A;  3SFZ A;  3M1C A;  5KVR A;  5F27 A;  3RKY A;  4XN0 A;  2HQ5 A;  3ONQ A;  1GV5 A;  2EV0 A;  2HVR A;  4KDP A;  5BPI A;  1ON2 A;  3GTP J;  3BZC A;  2RKH A;  2OZ6 A;  1FYM A;  2QA4 I;  4BGD A;  4PCQ A;  4K2E A;  4OIN F;  5ICE A;  3DPT A;  4A3C J;  4MFD A;  1V5F A;  2M7B A;  4JYK A;  5M5Y J;  1E3H A;  3EUK L;  3GTO J;  2LKS A;  4PJN A;  5HS9 A;  3CDL A;  2QYO A;  3PO2 J;  2QVO A;  3IKV A;  3TBI A;  1BR2 A;  5TJJ A;  2Z1D A;  2P7C B;  4BBS J;  1R5G A;  3KLO A;  2DYS H;  2ZXI A;  3JRG A;  2IS6 A; 
#chains in the Genus database with same CATH homology
 2M9H A;  1RKT A;  2M34 A;  1PUF B;  1JTY A;  2L7M P;  3JRE A;  2Y9Y A;  4XRS G;  1SAN A;  2HOA A;  2JK3 A;  2R5Y B;  3HOY J;  2CRG A;  2R93 J;  2H1K A;  2VKE A;  4IHV A;  3FK7 A;  2EZI A;  1U8B A;  5M5X J;  1IDY A;  1WH5 A;  1TWA J;  4FCY A;  2HXI A;  5EYR A;  2MSY A;  3LSP A;  1HLV A;  4JX6 A;  1U78 A;  1RKW A;  4DYR A;  5JLX A;  3SJM A;  4FTH A;  4C3I J;  2ID3 A;  4XRS A;  3HM5 A;  2XB5 A;  1UHS A;  1BW5 A;  1JKQ C;  2GBY A;  4A3J J;  3A02 A;  1I6H J;  5IOZ A;  2IBD A;  3BQZ A;  3B6A A;  3Q0V A;  4C2M J;  3LNQ A;  2XGD A;  4BBR J;  4XID A;  2IEK A;  1ETK A;  2NVX J;  1VF9 A;  5EGO A;  3S15 J;  1LE8 A;  3FIS A;  1TWF J;  4A3I J;  1QVT A;  2L7Z A;  3LSR A;  2HI3 A;  3GTJ J;  1ZGW A;  1MNM C;  2X6O A;  3CCY A;  1U9O A;  1HF0 A;  2HDD A;  1B8I B;  3UKG A;  3S1N J;  2GLO A;  3HOU J;  3JRD A;  2Y30 A;  1QPI A;  2LFB A;  3S1R J;  3RZD J;  1TWH J;  1H8A C;  2Y9Z A;  1BW6 A;  2E2J J;  1XC5 A;  4G12 A;  2R0Q C;  2EZK A;  2DJN A;  4RDU A;  1MBE A;  3WHB A;  3S1Q J;  4IHX A;  2HOT A;  4BY1 J;  5BNG A;  5C4J J;  1OJL A;  4CYC A;  5DS9 A;  1OCT C;  4AUX A;  4EEF G;  2YU9 J;  2L9R A;  1IC8 A;  3RKQ A;  1IV6 A;  1ZR2 A;  1FIA A;  3I4N J;  1FJL A;  5IP9 J;  5HOD A;  1I50 J;  4DW6 A;  5IOY A;  2X9D A;  4ABZ A;  3HOV J;  3HOZ J;  3HEF A;  4FE4 A;  4M3G A;  3GTQ J;  2VKV A;  1WI3 A;  1CQT A;  1AKH B;  2MGQ A;  4D5C A;  1JKP C;  1RPW A;  5IP6 A;  3K2A A;  5EZG A;  2L0K A;  2CJJ A;  5M3F J;  1O4X A;  2CQQ A;  4B3A A;  3JR9 A;  5F1J A;  5K7H A;  3TP0 A;  4A3B J;  2PMZ N;  3HGY A;  3MVP A;  3QQA A;  3TW6 A;  1IG7 A;  2O8K A;  3BG3 A;  4UUT A;  1ITY A;  3BT9 A;  2N8G A;  1W0U A;  1LE8 B;  4M3B A;  1Y1W J;  1JT0 A;  2JA8 J;  2YUS A;  3ZQI A;  1JKR C;  1W0T A;  2FX0 A;  2AO9 A;  1WCM J;  5FLM J;  4LOC A;  3H3V K;  3TED A;  2QCO A;  3G1O A;  1JJ6 C;  2Y0S N;  2Y2Z A;  3C2B A;  3IH3 A;  3LSG A;  1P7J A;  3VPR A;  2NVT J;  3O8H A;  3K7A J;  1ETW A;  5E3O A;  2DA4 A;  2DA6 A;  5FLV A;  4A3M J;  4UUS B;  4X1E A;  4GFB A;  1VND A;  2NS8 A;  5FKO A;  3CMY A;  3GTM J;  2ME6 A;  3LOC A;  1GV2 A;  1AU7 A;  2DA1 A;  1MH4 A;  5EG0 A;  1EF4 A;  1F36 A;  2FJ1 A;  1P7I A;  2K40 A;  3QPS A;  3ZOB A;  4HNV A;  1FTT A;  2KT0 A;  1WPK A;  1XS9 A;  2ME0 A;  1QRY A;  4QIW N;  5GPA A;  5DTD A;  3GTG J;  3O8G A;  1UG2 A;  4I76 A;  2VI6 A;  4MO7 A;  3E7L A;  5IYB J;  2E19 A;  3HKZ N;  3S17 J;  1LFB A;  3WHC A;  1QVU A;  3L1P A;  4A3F J;  1S7E A;  2NVY J;  4L5E A;  4Y52 J;  3FIW A;  5J1Y A;  3S1M J;  2CUF A;  2TCT A;  1LFU P;  2XGC A;  4D7M A;  3NAU A;  3PO3 J;  4BXX J;  2W48 A;  3RZO J;  3S2H J;  1JJ8 C;  4IHY A;  1WH7 A;  4A3E J;  1E3O C;  1VFC A;  5F04 A;  1K61 A;  1RR7 A;  1UMQ A;  1BL0 A;  3TP3 A;  1A6I A;  1ZR4 A;  4BY7 J;  4AC0 A;  2R5Z A;  3DCF A;  3OIO A;  4MFE A;  4RBO A;  5C4X J;  3MKL A;  3JRH A;  3BTI A;  5FJ8 J;  1ZKG A;  2JJ7 A;  1U9N A;  1ZQ3 P;  5C3E J;  2ECB A;  3MN2 A;  1YRN A;  2TRT A;  3BR1 A;  1F43 A;  2FQ4 A;  3HOX J;  1JUP A;  1OFC X;  2OPT A;  3NAR A;  1TC3 C;  2E1O A;  3D1N I;  2NVQ J;  2LLK A;  3ZQH A;  2EBI A;  3IV5 A;  3ZQG A;  3G1L A;  1HOM A;  1RET A;  2L7F P;  5IYD J;  3BR5 A;  1HCR A;  2GM4 A;  2DMN A;  2KDZ A;  2DA5 A;  1H89 C;  1JUM A;  4M3E A;  3BG5 A;  2EH3 A;  4A3G J;  5EEA A;  2JN6 A;  4A93 J;  1TWG J;  2CQX A;  4D5F A;  2HOS A;  1GDT A;  1Y1V J;  5GPC A;  5FKL A;  1NK2 P;  1ETQ A;  5F0H A;  1MSE C;  1PUF A;  3HOW J;  1NK3 P;  1WGX A;  2EZL A;  1MBK A;  4DZP A;  2DA7 A;  2R5Y A;  1BJZ A;  5EDN A;  3BG9 A;  3GTL J;  2DMQ A;  2DA3 A;  2AHQ A;  1MBG A;  2P81 A;  1JTX A;  5F08 A;  3BR6 A;  1RES A;  1Z77 A;  3SDG A;  2M0C A;  2HYJ A;  4DYQ A;  5JLW A;  4A3D J;  5EGO B;  2XB0 X;  1HDP A;  2B63 J;  1D5Y A;  1Z0X A;  2LP0 A;  2LVS A;  5J1U A;  2XGE A;  3BR0 A;  2DMU A;  4M6V A;  2LR8 A;  4D7N A;  4M3F A;  2HXO A;  5EZH A;  2FD5 A;  2MG4 A;  3GTK J;  1IUF A;  5E3M A;  4A3K J;  2M8G X;  2JWT A;  3LSJ A;  4B4C A;  2ZB9 A;  1NTC A;  2CU7 A;  2LKX A;  1JUS A;  2R92 J;  1Q1V A;  1MH3 A;  4MLO A;  1OCP A;  4Y7N J;  5FKM A;  4QSH A;  3BTL A;  3BQY A;  3ZQL A;  2YS9 A;  3HBL A;  1SFO J;  5E3L A;  1ETO A;  4JX4 A;  5FKK A;  5K7F A;  2XPV A;  1B8I A;  4CYC B;  2O7O A;  5F0F A;  3ZQF A;  3Q3S A;  3G1M A;  3JRB A;  3JRA A;  2LY9 A;  2WV1 A;  1IDZ A;  2ECC A;  2XPW A;  5E3N A;  1ENH A;  3BR3 A;  4MIM A;  2G0E A;  9ANT A;  2X48 A;  1MBF A;  2H8R A;  4XK4 A;  3HDD A;  4X6A J;  1JT6 A;  3S16 J;  3OOU A;  4DZJ A;  4FE7 A;  3SFI A;  3A01 A;  1JKO C;  2XPU A;  1ETV A;  2JA7 J;  1MBJ A;  1AHD P;  3IH2 A;  4IHW A;  1BA5 A;  2OF7 A;  4W97 A;  1DU6 A;  4J19 A;  2DN0 A;  5IP7 J;  4C3J J;  1ZK8 A;  1GVD A;  4C3H J;  3TW7 A;  1TWC J;  2VUM J;  3BTJ A;  3Q0U A;  2JA6 J;  2WAQ N;  4V2G A;  1AKH A;  3BR2 A;  1B72 A;  1XG1 A;  4DYC A;  3CQZ J;  1MBH A;  3H0G J;  4W1U A;  1ORK A;  2LD5 A;  1MSF C;  3DEW A;  2XRL A;  1IJW C;  2JMW A;  3FKI J;  1ETY A;  3HB9 A;  2ELK A;  3JRI A;  2EZH A;  5EG0 B;  1I3Q J;  5F0C A;  2LTP A;  1X58 A;  3QPL A;  4BKX A;  1X2M A;  2R7Z J;  2LK2 A;  4NDL A;  2E2I J;  3S2D J;  5M5W J;  2D5V A;  2VPR A;  3IH4 A;  2Y31 A;  1T33 A;  2I10 A;  4UUS A;  3I4M J;  3PM1 A;  1ETX A;  4FIS A;  1FTZ A;  2RAE A;  1GT0 C;  2EQR A;  3FK6 A;  3Q0W A;  4S0H B;  1H88 C;  1POG A;  3F0C A;  5K7Z A;  2CUE A;  2K9S A;  2JA5 J;  2DMT A;  3A01 B;  5GP9 A;  1A5J A;  1ZTR A;  3ZQC A;  1APL C;  5IPA A;  3A03 A;  2IAI A;  3M3Y J;  4JX5 A;  1T56 A;  1R9T J;  1IRZ A;  2QF7 A;  2NS7 A;  4XRM A;  3OSG A;  4A3L J;  2WB1 N;  3GBG A;  2M2E A;  2R5Z B;  2K9N A;  4AYB N;  4I6Z A;  3B6C A;  4A69 C;  2XSD C;  3BTC A;  3JRC A;  1IGN A;  1B72 B;  2ID6 A;  5J1R A;  5EF6 A;  5F27 A;  2COB A;  3S14 J;  1DU0 A;  2HQ5 A;  1YRN B;  1VI0 A;  2DTZ A;  1GV5 A;  3HGG A;  4IEJ A;  4QTR A;  3GTP J;  4XIC A;  1HDD C;  4V2F A;  1JGG A;  5IYC J;  3W6V A;  2DMP A;  4A3C J;  4MFD A;  4JYK A;  2K9Q A;  1G2H A;  5M3M J;  5M5Y J;  3JRF A;  2O9L A;  3GTO J;  4B1R A;  2DA2 A;  5C44 J;  3OSF A;  1FIP A;  3M4O J;  2NOG A;  3CDL A;  3PO2 J;  1FEX A;  4JP0 A;  5J3L A;  1K83 J;  3RQI A;  2E2H J;  5FKN A;  4M3D A;  2MW8 A;  4BBS J;  1GUU A;  1X2N A;  3JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...