1T6SA

Crystal structure of a conserved hypothetical protein from chlorobium tepidum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of ScpB from Chlorobium tepidum, a protein involved in chromosome partitioning.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA02
2M8EA 1IN7A 3V4GA 3ULQB 4RAYA 3RIRA 4G9YA 2V9VA 2DW4A 4A5NA 2KIUA 3K1MA 3JAMZ 3WTZA 2P5KA 1YYVA 4U88A 5CJ9A 3JTGA 3I64A 4R1HA 1BI0A 4AD9A 2QQBA 2GA1A 1FBSA 1FP1D 2IPQX 4EGYA 2AS5F 2L02A 3QAHA 1W4MA 1G3WA 1UFMA 4HF2A 4Q5SF 2EB7A 4GYGA 1FSEA 3F23A 4LK0F 2HDCA 1KQ9A 4DNCA 2XAJA 3V7CA 3GFIA 2VODA 4IRIA 3LQRA 2PMHA 1F5TA 4UVAA 1FC3A 5CVIA 3QP5A 2HWVA 4OMZA 3G73A 2IT0A 4RGXA 1IN5A 2MD5A 2ESHA 3MQ0A 4N0BA 1TQIA 3OOPA 1OMIA 4KNYA 1XGNA 3J81K 2K86A 1EH6A 3WE3A 4LG0B 1DPUA 5FFXA 2HOEA 4XLNF 4I0BA 1XSDA 2BEOA 3BJAA 3V8JA 3GYHX 3ERED 2IVMA 4IPAA 3EQLF 2ADUA 5JFRA 1P6RA 2F5FA 1PUEE 3JSPA 1R58A 3P9IA 3I71A 2PI0A 4ZH4F 2VT3A 1J7KA 1FNNA 4ZYHA 2YX4A 4G7ZF 3HHHA 4EGZA 2WTEA 5D5VB 5HDNA 3CJNA 4UV9A 1XD7A 5BS6A 1SD7A 4ESJA 4YFNF 3F8CA 3IHUA 4KDPA 3ZN0A 1OYWA 2AXLA 2FMLA 3I59B 4A5MA 1XCVA 1IXCA 2H09A 3KP6A 1TQPA 2A69F 4OOIA 1TLHB 3LA7A 2LSOA 1I27A 2VT2A 4JBAA 2GA2A 3WTUC 4HDVA 3REOA 1MGTA 1WSUA 3IWZA 4EM2A 1R22A 3U9GA 3F8BA 2M87A 1T0FA 3FXRA 2FU4A 3LFKA 1H0MA 3N4MA 2QWWA 5L3DA 3FM5A 3KP4A 3VOEA 4OMYA 1RZ4A 1KU7A 3R0AA 3J81Z 2VOPA 2RKHA 4YIIA 2NRAC 2VBZA 1S29A 1KU2A 4IVNA 2LKPA 1L0OC 5D6FA 2UZKA 1LB2A 2QQ9A 4U0YA 5KK1A 4ESFA 1O3QA 2VBYA 2UWMA 4CHUA 3WODF 3CDHA 1U5TC 2V1DA 3E6DA 2CQKA 3BPXA 2H27A 3F72A 2GAUA 4O6JA 5D4RA 2PBIA 2OQRA 3GLXA 1T6SA 1O3RA 1BIAA 5E8IA 3J7AO 1R5HA 3IRRA 1USTA 2XAGA 2XRNA 4AIJA 5JI6A 2FMYA 2QBYB 4ZYEA 3O6BB 3PQJA 1MJAA 2RDPA 5FLXK 1BM9A 4KIBA 3SFZA 1W7PA 4MEYF 2EA4A 1IZ1A 2EFWA 1XCBA 2P6TA 4LB6B 3U1DA 3TDZC 2X0LA 4F7ZA 4ZZDA 3HSFA 4EJOA 2ZCWA 3IKTA 4EJTA 4RGUA 2MC3A 4BXUA 4CDGA 2VC1A 1W7PD 1RUOA 2E1CA 2QM3A 5DCFA 1Q1HA 1SD5A 2ZBKA 2GZWA 2LNBA 3KLOA 5LBQA 4O5VA 2OA4A 1ULYA 2CG4A 2DLLA 3E97A 5E8GA 3ZMSA 5BQTA 2JPBA 2YSRA 5ICCA 2Z5UA 2D1HA 1QGPA 1EH7A 3K2ZA 2NS0A 3NRVA 3KE2A 3FMQA 1VTNC 4UVBA 1HW1A 1SD4A 3LAPA 4IJAA 4LLLA 5FD5A 4LMYA 5BPIA 4M74A 2ZXJA 3R4KA 3MFKA 5BOXA 5FLXZ 3TKYA 3T8RA 3RJPA 3QP6A 1LEAA 3FM3A 4IRHA 5ICEA 3GO5A 5D8LB 3BZ6A 1WI9A 3P9KA 3I0TA 4KN4X 1R36A 4BHBA 3RDIA 2FE3A 3ECOA 4AWXB 4M9ZA 3HTSB 3LA2A 4KMFA 3R61A 2GQQA 1FP2A 1FY7A 2QQAA 2FNAA 4HAMA 2A61A 4EQQA 4QWQA 1BI2A 2BBYA 2Y75A 1DUXC 5HS9A 2EK5A 2W57A 4I0AA 2FXAA 2O3FA 3WTXC 1J5YA 3OV8A 2ISZA 4OIPF 3ZP5A 5E1XA 3T0YA 2RV8A 2VN2A 1QZZA 1EV7A 2G7HA 4K2EA 1XGSA 3E6CC 2K02A 3CO7C 3V7SA 3QPTA 2NAZA 1G3TA 2DTRA 1ZAOA 4M9SA 1TNSA 3L7WA 1P92A 1H9TA 5ILUA 2KRFA 2XAHA 5AONA 2O6GE 1O57A 4G7OF 1HKQA 5JR3A 3GX4X 3F6VA 3BDDA 5JVTA 2ZNZA 1AWCA 3HUGA 1PP7U 4XRFA 4L9VA 4D0PA 2FQ3A 2BYVE 1RNLA 3E5UA 1MD0A 4HBLA 2VBXA 4WF2A 2P5LC 4EM0B 3PQKA 5IT3A 2JPCA 4KT5C 3K0LA 5F6FA 4HQMA 3ABUA 2G7UA 4MQVA 5FGMA 3ZPLA 4KUMA 4AIHA 2VE8A 4HLXA 2DK8A 1BN5A 3BP8A 2Z99A 2A6HF 3E6BA 4GO1A 1RIOH 1KU9A 1XDSA 1FLIA 5LGTA 3WU1B 2CSOA 4KFCA 1UHWA 3MZYA 4IHSA 2RN7A 1R5GA 3SZTA 4ENJA 2OZ6A 2KJCA 1U2WA 2D2WA 1IUYA 1YS6A 2XGXA 4R79A 3NEUA 1LNWA 4RS8A 4B09A 4ZZLA 5DUIA 2GXGA 2PG4A 3FXUA 4EJWA 1F4KA 3WGGA 1SMTA 1K6OA 2PLYA 3ZN1A 2V1XA 5J6XA 3F8NA 3BROA 1Z6RA 4ETSA 3I5UA 4CXFA 1ZREA 1SFXA 3KP2A 4R8HA 4U0WA 1XB4A 3O3KA 4L18B 1SFUA 2COMA 2M30A 3RPUA 1OKRA 3Q5FA 4Y13A 3HHGA 5K1YA 3HOSA 1ZLKA 1GHCA 3RKYA 5H20A 4GGGA 2WV0A 5EEHA 1FX7A 2KKOA 1REPC 4U0VA 3ISPA 3FMRA 4FT8A 4GCVA 3BWGA 3ELKA 3BOQA 2BE5F 1LVAA 3MEXA 4NHJA 4G6QA 2QYOA 2EV5A 4QLCU 2NNYA 3B02A 1RI7A 4HQEA 2A5YB 3ML6A 1U78A 2KIFA 3CUQA 1WQ2A 4EV0A 1T98A 1ZARA 2ZNYA 4KIFA 5ED4A 4OU0A 2VXZA 3KZYA 5HVQC 1E2XA 4O3MA 3I53A 2HR3A 1X3UA 1O7LA 2K27A 2L4AA 2YU3A 3M8FA 5FFZA 2O0YA 3U2RA 5HLGA 2ZKZA 1YIOA 3C7JA 4I2OA 1LDKB 3SZPA 5LLQA 1ZRDA 2O03A 1KQ8A 4I01A 2EV6A 5IT9K 1F9NA 1S8NA 4ESBA 3IC7A 5CLSA 1UCRA 2W25A 3WTTC 3IWFA 5DEQA 4M71A 1NHAA 5DCMA 4MGRA 1AOYA 3V7RA 4L9NA 5E17F 5LHGA 3FXQA 1SAXA 2RGVA 4MHGA 1XDUA 1DP7P 1FYLA 3KP7A 1BOAA 2IW5A 4EJUA 3HSRA 5CVVA 4Q48A 5HLHA 5BPDA 1P4XA 2IA2A 2L54A 1B4AA 1BBYA 2DBBA 4ENKA 3L00A 4HLYA 3PFIA 5D6EA 1D5VA 3DQVC 3BY6A 1HXDA 3LAJA 1Z6TA 1QNTA 3DKWA 3M1EA 3NQOA 2HTSA 4MQ9F 4ZYGA 4XSZF 2HKXA 4A0XA 3RYRA 5HS8A 2RNJA 2MBFA 4NQWA 4EVIA 1QO0D 1J75A 3FWEA 1UB9A 2XKPA 5E1WA 2DPUA 5IT9Z 2Z3YA 1U3EM 1T2KA 3TOBA 2R3SA 2ZMEA 3M9AA 5CVJA 1KQ0A 1FPQA 5H6RA 1L3LA 3HIFA 4L0YB 2J5PA 2L4MA 5AIPA 1ZYRF 1W7PB 3KP3A 4S05A 4P55A 4BHPA 5EEGA 1T39A 5HDGA 3EYIA 2EFOA 3EYYA 2WWYA 1YG2A 4HA8A 2DK5A 2OAZA 2A6EF 2PMUA 2G9WA 2EFNA 3QPHA 2HKOA 1FBQA 4ENMA 3VODA 4HYEA 2IA1A 1ON1A 4I09A 1YO5C 3GXOA 1WRJA 2P5VA 3DPTA 4CICA 2JTVA 2J5OA 2UXNA 2JRTA 1LJ9A 2F5DA 2XVCA 2FBKA 2TDXA 4BHCA 2MH2A 2EWNA 3DXJF 1V3FA 2E1NA 4M72A 3R6SA 2YPRA 2DI3A 3CUQC 1USSA 2OBPA 3FMSA 4LD5A 2VBWA 2GWRA 4IRGA 1MJ9A 5L3EA 1TW2A 1T38A 2W85A 3VB2A 1IN8A 1IXSB 1WWXA 3WE2A 3SXYA 2P4WA 5ICFA 2V6CA 2XUBA 2QLZA 3GEZA 2K7LA 2FSWA 1S3JA 5F1RA 1PP8F 2VONA 2Q8KA 4ON0A 3LSTA 2P6SA 3ZMZA 5D4SA 2HS5A 5D5UB 4FX4A 2CO5A 4Z2YA 3DEUA 5TRDA 5J8CA 1G6NA 4IXAA 1TW3A 4ENNA 3HRMA 2STWA 2H6BA 2EFPA 3JSOA 3FF5A 3KFWX 2HQRA 3Q9SA 4I02A 2A68F 3F6OA 3F21A 3KLNA 2UXXA 4PZJA 5D5XB 1ZGJA 3DF8A 1R00A 4NB5A 4CO8A 5FO5A 2DQRA 4FHTA 3GZ5A 1ZG5A 2CWEA 5E1ZB 3V8LA 4HDUA 5ILVA 4L9JA 3H3UA 3KEOA 1YQAA 3DFGA 1FYMA 2HYFA 5LEKA 3ZQ7A 1KA8A 5ERIA 2Y48A 3FX3A 2RC4A 3HSEA 2QUFA 4KN7X 4KYWA 1ZG3A 1JHFA 2DQLA 5CVRA 1QBJA 1KYWA 2JZYA 4HV6A 3ZMTA 5D5WB 1IXRC 3F8MA 3BPVA 2A3SA 4LLNA 1GXPA 1YW8A 1LDDA 1R1VA 1DDNA 4ZYDA 3K1PA 1LDJA 1HBXG 6PAXA 1ZHFA 1J2XA 1E17A 1B9NA 2L3DA 2QENA 1D3YA 1YLFA 4DQ2A 1HW5A 1Z9CA 2MA3A 1FYKA 2FBHA 2HFHA 4FX0A 3AAFA 3KEQA 3LA3A 1Z05A 3FZVA 4LLGF 4BAYA 2OQGA 4PCQA 3HYIA 1A04A 4HF0A 1B9MA 1SMYF 4JK1X 1G3YA 2HZTA 5DV5A 2Z33A 4L5IA 2PEXA 4E70A 1B6AA 3JW4A 4YFKF 3WGHA 4WXDA 2OZUA 1W5SA 3LWFA 3KCCA 1MDMA 1HQCA 3LQQA 1K79A 2HYGD 1ZGAA 1I5ZA 2DPDA 3QU3A 4ASNA 5L3GA 4M6XA 4MTDA 1U5TB 1YTYA 1HKTA 4WX9A 5LEJA 3WGIA 2IJLA 1KYZA 2JSCA 5AIQA 3GF2A 2M45A 2STTA 3GFMA 4XLPF 4WXCA 4Q4ZF 2DO7A 1MJBA 2D45A 4G8XA 3D0SA 3IL2A 4OIQF 4XSXF 4HZFA 3I4PA 3TO7A 4A6EA 1H9GA 1BIBA 2VE9A 3T8TA 2XAFA 3K1NA 2NNNA 2PN6A 4P9UA 2HEOA 2MLGA 1CF7A 3CUQB 5DYMA 2IP2A 3R60A 1FZPB 3RYPA 4RB1A 3I58A 2B0LA 4LGWA 3SQNA 3L9FA 3P9CA 3W6JB 4UNOA 4L5JA 2PQ8A 4P5OA 2Q0OA 1C0WA 3QOPA 4I7HA 1HSTA 2M5WA 3WTSC 2W24A 2YX7A 4YIFA 3GFLA 3TDUC 5L3FA 3S2WA 5J8FA 4A12A 2DAOA 1XMKA 3C18A 2H94A 1S7OA 2FA5A 3TOAA 3SHFA 3HRSA 2VC0A 3C1DA 1K78A 2PJPA 3ZMUA 1D8KA 2F2EA 3E5QA 1R23A 4CYDA 2P7VB 5DCMB 1XSXA 1MKMA 2FRHA 5LHIA 4HX4A 4WK8F 2GXBA 2EA2A 1G4DA 2OD5A 3COAC 4WWCA 2RQPA 1V4RA 4N9IA 3CO6C 4HX8A 2JT1A 4GXOA 3O2PE 1P4AA 5E20A 4RAZA 4HF1A 4Y15A 3E5XA 3F22A 1J9IA 1KGSA 2ISYA 2P7CB 4G6DA 3ZMVA 2P8TA 5H6QA 3R0JA 3M8EA 2HTJA 4N9HA 2K4JA 2EV0A 4LJZF 1ONVA 2DU9A 1STZA 4HW0A 4BH9A 2XHKA 4MTEA 2EJRA 1Z7UA 3VFZA 3C3WA 1FWZA 3Q9VA 4UHTA 4UVCA 2O61A 3P7NA 1FOKA 4L0ZB 5KVRA 3WU0A 4Y17A 3IKVA 2QZ8A 5LGUA 1FT9A 1IRGA 2ELHA 4KIGA 1YS7A 1ODDA 1S7AA 4UV8A 4YG2F 5K5RA 3L09A 3JTHA 4EJVA 4KICA 1IRFA 4OIOF 2VOOA 5BMZA 2ZMEB 2LF7A 5K5OA 3M7GA 1TTYA 1TQMA 2RVCA 3QRFF 3KZZA 3G3ZA 4RGSA 4LG0A 3H92A 3RKXA 1ZLJA 4U7DA 3BJOA 3GZ6A 1PDNC 4HOBA 4PDKA 4H0EA 1FBUA 3HTUA 2ZO4A 4U7BA 3MCZA 3E3VA 4OINF 5DD4A 3RTRA 1U8RA 3CLOA 2BGCA 1B59A 4RB3C 3WTVC 3J80K 3ABTA 1GXQA 3I59A 5JHUA 3E6MA 1JXSA 1XGOA 1TBXA 1BC8C 5LGNA 4XBFA 4A2UA 1MZBA 1TNTA 3DV8A 2HGCA 1HW2A 2A07F 5FB2A 1RUNA 1P2FA 5CVUA 1GVJA 4S04A 4UXNA 3I54A 4I98B 2ACJA 1OYIA 4BYYA 4A0ZA 1XGMA 2CGPA 3GWZA 2CFXA 4M6YA 2FF4A 5L3BA 2PFBA 2IA0A 3F8FA 3VEPA 4M73A 5TJJA 5DD8A 5LRRA 5ICGA 1G3SA 2C6YA 4AVPA 1BJAA 4WCGA 1FSHA 3B73A 1ZN2A 4WXHA 2W84A 5FD6A 1R1TA 2M1BA 2H6CA 1ZH5A 3J80Z 4P96A 4A6DA 2LF8A 1LEBA 1YFHA 1IW7F 1U6GA 3WTWC 4UUVA 3ROUA 1O3TA 1BI1A 1R1UA 2LDUA 2ZFWA 2FNPA 5HOOA 1W5TA 1EH8A 3T1BA 4YFXF 2V1UA 1XMAA 2QBYA 3V8KA 1OR7A 4RGRA 2MH9A 4Q47A 1YW7A 1BI3A 1DPRA 1Y0UA 1SFEA 3RI4A 5HS7A 4P9FA 3CUOA 3WG9A 1ZRFA 4EM1A 2Z9OA 2XASA 1XSVA 1S6LA 2ESNA 1CGPA 3F3XA 4G94A 3FHZA 2FOKA 4AIKA 4IF4A 2L01A 2QVOA 4RB0A 3IRQA 2R7FA 3KETA 3TGNA 5LRSA 1ZRCA 4GYIA 1B1BA 5HLIA 3HRTA 5A2QK 1OYYA 1J0RA 5CYVA 2XV4S 2ZJ2A 2XAQA 2FBIA 4LK1F 3N97A 4CGZA 3EUHA 4A0YA 3GVAA 4MNUA 3RPQA 1K7AA 1IN4A 4IHTA 3D5LA 4LFUA 1SD6A 1P4WA 1IAWA 4TV7A 3GW2A 4JQFA 4PGHA 3BJ6A 2WC2A 1I6XA 2F5EA 2O8XA 4HX7A 3HRUA 4L9TA 1HSJA 1HKSA 2X4HA 4BQAA 2YR2A 4M9XA 3DP7A 4OIRF 3TQNA 2R7DA 3MAJA 1MDMB 2E7XA 1LQ1A 5LHHA 3GFJA 1D8JA 1IF1A 1UHMA 4CZZA 3TO6A 3L2CA 1JE8A 3W6KB 4RB2C 3MZHA 4LB5A 4HV5A 1BC7C 4MEXF 4KA4A 2V79A 1Z1DA 2CYYA 5A2QZ 3EDPA 2KJBA 2HQNA 1QPMA 4EMSA 1YW9A 2NYXA 3WTYC 4B8XA 1IN6A 3ZMDA 2FEZA 2Y0MA 1OPCA 5E18F 5D8KB 2XROA 1O3SA 2IRFG 3KP5A 2GIVA 3H3ZA 3JAMK 1JGSA 3CTAA 3MWMA 2Q2EA 4PGGA 1ZG1A 1CF7B 2BV6A 2EFQA 1Z91A 5DDGA 2DT5A 5F64A 2OU2A 4BNCA 2ETHA 1ON2A 3K69A 5HDKA 3DPLC 1WKMA 1XN7A 5DUKA 2E7WA 2KIMA 3QU6A 3GUDA 5ILSA 2K4BA 1JHHA 3ECHA 2D1VA 3T5XA 5L3CA 3EETA 3RKWA 2CW0F 1O7FA 3HOTA 2DFIA 2XKOA 3TO9A 1R7JA 1KU3A 1F1ZA 4KMUX 2F5CA 1I1SA 1I1GA 5K5QA 2XIGA 1K78B 1QQIA 2MLKA 1J59A 3K9TA 1QZYA 1U5TA 4G7HF
chains in the Genus database with same CATH superfamily
4HNVA 2M8EA 1IN7A 2F6CA 2B63J 2DMTA 2GIZA 1KONA 3V4GA 2R7QA 1WHUA 2V9KA 3ULQB 2QSGX 1VZ0A 4RAYA 3RIRA 4G9YA 4YEJA 1VFCA 4A3BJ 3H9GA 5E3LA 2V9VA 3F0CA 3OSGA 2DW4A 4JX6A 1KZHA 4A5NA 4IOAF 2KIUA 3K1MA 2NOJB 3JAMZ 3WTZA 2P5KA 2QF7A 1YYVA 4U88A 1Y6IA 2CUFA 2ECBA 2KRHA 1QVUA 2JWTA 1QPIA 5CJ9A 3JTGA 3MKLA 3I64A 4R1HA 1BI0A 4AD9A 2QQBA 2GA1A 3CP8A 3EUHC 2DXIA 4NC7A 1FBSA 1FP1D 2IPQX 4FISA 4EGYA 2AS5F 2L02A 3QAHA 1W4MA 1NK3P 1G3WA 3FIWA 3U21A 1UFMA 4HF2A 2QKLB 2EB7A 2VPRA 4Q5SF 4GYGA 1FSEA 2LOOA 3F23A 4DYCA 1H89C 4LK0F 1ZQ3P 4E7JA 5TGTA 2HDCA 1KQ9A 1UELB 3BCBA 4D5FA 4N4OB 1MW7A 1MNMC 4DNCA 2XAJA 4GDFA 3ONQA 5FLMJ 3V7CA 2E1MB 3ZQGA 2W4SA 3GFIA 2VODA 3OSFA 1OFCX 2L7MP 2HU9A 4IRIA 3LQRA 2PMHA 4IHWA 1F5TA 3D5RC 4UVAA 1FC3A 2XSJC 5CVIA 3TEDA 3QP5A 5B1AH 1HLVA 4A3GJ 2HWVA 4OMZA 3G73A 3H0DA 1YIJI 2IT0A 1JKRC 4UY8I 4RGXA 3ABKH 1XS9A 5DTDA 1EA3A 1IN5A 2N8GA 2ME6A 2MD5A 3HL2A 2ESHA 3MQ0A 4N0BA 1H8AC 3QPLA 4PSWA 3DTKA 4CCLA 1TQIA 3OOPA 1OMIA 4KNYA 2Y9YA 1XGNA 3J81K 2R5YA 3BQZA 4M3EA 2K86A 1EH6A 3PSFA 3WE3A 5LFAA 4LG0B 4C2UA 1DPUA 5FFXA 2HOEA 4XLNF 4I0BA 1XSDA 2BEOA 3BJAA 3V8JA 3GYHX 3ERED 4F3QA 2IVMA 4IPAA 4NBQA 3EQLF 1S7EA 2DMUA 2CUEA 2ADUA 5JFRA 3JRCA 1P6RA 1R5ID 2DDBA 2F5FA 2KIQA 1PUEE 1MSFC 3JSPA 3RZOJ 4F55A 1R58A 3P9IA 3I71A 1ENHA 2XF7A 1WJAA 4NQWB 1R49A 3KYLA 2PI0A 4ZH4F 2VT3A 1J7KA 3B6AA 2HVSA 1FNNA 4ZYHA 2Y0SA 2YX4A 4G7ZF 1JUMA 3HHHA 2LTPA 3LL7A 4EGZA 4FE7A 2WTEA 3PNYA 5D5VB 3QQAA 4YRVA 5HDNA 3CJNA 9ANTA 4UV9A 2WA0A 1J09A 1XD7A 5BS6A 1SD7A 3U1KA 2MD0A 2WV1A 4YFNF 4ESJA 5F0FA 3F8CA 3IHUA 4KDPA 3ZN0A 1OYWA 2AXLA 2FMLA 3I59B 4XKCA 4A5MA 1XCVA 1IXCA 2CQXA 2H09A 3KP6A 1TQPA 2A69F 1TT0A 4OOIA 1TLHB 1MBHA 3UR3C 2XGEA 2LSOA 1R4NB 3LA7A 5F27A 1MBGA 1I27A 5E79C 5IP9J 5GAHJ 1ETQA 2VT2A 4JBAA 2GA2A 2XPVA 3WTUC 4HDVA 3REOA 1MGTA 2JUCA 1WSUA 3IWZA 2H1LA 1SC7A 2X6XA 2O9LA 2QCOA 4EM2A 2BY2A 5IYDJ 1R22A 1FOWA 1YE9A 2AXTC 4IKFA 3S1MJ 3U9GA 3F8BA 4LG3A 1OCPA 2M87A 2Y0SN 1T0FA 5J4VA 3FXRA 2FU4A 2EQRA 3LFKA 1H0MA 3N4MA 4B47A 1Y0NA 2Z2SB 2QWWA 3HGYA 3CCSI 3BZKA 1RPWA 5L3DA 1H88C 3S2HJ 3FM5A 3KP4A 3VOEA 4OMYA 1RZ4A 1KU7A 3HOZJ 3R0AA 4G6TB 3KPHA 3J81Z 2VOPA 1BW5A 2RKHA 4YIIA 1I3QJ 5C4XJ 3CJQB 4IQ4A 4II2A 2NRAC 2VBZA 1S29A 5KCMA 1KU2A 4IVNA 3PO3J 4BL0B 3CMMA 2LKPA 1L0OC 4E7SA 3QOEA 5D6FA 2UZKA 3W2WA 1LB2A 4ZJZA 2WAFA 2QQ9A 3UKGA 4U0YA 2BHZA 3W3CA 5KK1A 5C4JJ 1VQNI 4ESFA 4J19A 1R71A 4IOCF 1O3QA 1BA5A 2BVMA 2VBYA 2UWMA 3BCAA 4CHUA 3WODF 3D1NI 3CDHA 1U5TC 2V1DA 1YHQI 3E6DA 3LSIA 2CQKA 3MVPA 2Y30A 2AO9A 3BPXA 2MG4A 2FOWA 1NK2P 2H27A 3CCEI 3F72A 5JHFA 2GAUA 4O6JA 3I9V2 1Z3YA 5D4RA 3K4NA 2PBIA 1LFPA 2OQRA 3Q0UA 3GLXA 1T6SA 2CRGA 1K61A 1BIAA 1O3RA 5E8IA 3J7AO 1R5HA 2PMZA 3IRRA 3L2UA 1USTA 2VLAA 4LIUA 2XAGA 3OYHA 2XRNA 1D1CA 2Y2ZA 3BG6A 1WJFA 4P1WA 4AIJA 2HQAA 5JI6A 2FMYA 3ZR8X 2QBYB 4ZYEA 3O6BB 2XF6A 1MJAA 3PQJA 2RDPA 4V2GA 2KHMA 5FLXK 1BM9A 4KIBA 5EZHA 3SFZA 2R7UA 1W7PA 1X19A 4MEYF 2EA4A 1IZ1A 2EFWA 3OMYA 1XCBA 4XK4A 2P6TA 4LB6B 1VF9A 3U1DA 3PNTA 4A3CJ 2OF7A 3TDZC 4XIDA 1X4PA 3BG7A 3KEYA 2X0LA 3CQZJ 3A0HC 4F7ZA 4ZZDA 3HSFA 4EJOA 2O7OA 4BJTA 1UHSA 1X2MA 2I8DA 3HGGA 2ZCWA 2LBFA 5IOYA 1DGWY 2E71A 3CCYA 3IKTA 4M3BA 1IJWC 3W6VA 4EJTA 1HDPA 4RGUA 2IBDA 2W00A 4MO7A 4HPQA 2MC3A 3FBNB 2IGMA 4BXUA 4BDYA 4CDGA 2VC1A 1W7PD 5HLTA 1RUOA 1YRNB 2E1CA 2QM3A 2DT6A 3BR2A 5IP6A 5DCFA 1Q1HA 1SD5A 2ZBKA 1Y39A 1RC9A 2E34A 2MFZA 3CDLA 2GZWA 2LNBA 3KLOA 3BG9A 5LBQA 1B72A 2M0MA 4Y52J 1SAUA 3BQYA 3S3MA 4O5VA 4BY7J 2OA4A 1ULYA 2CG4A 2DLLA 2OCEA 3E97A 5E8GA 2K9MA 3X2QH 2VKDA 3ZMSA 1IUFA 2JPBA 5BQTA 5HODA 2YSRA 1BJZA 2VJ4A 5ICCA 2Z5UA 4CYCA 2D1HA 2H1KA 1QGPA 3LSKA 1EH7A 1U9OA 3K2ZA 2NS0A 3NRVA 4J01A 3Q0WA 3KE2A 2LFBA 3FK7A 3FMQA 1V5FA 1VTNC 4OAZA 1JJ6C 4UVBA 2CU7A 1HW1A 4LITA 1SD4A 4LLLA 4IJAA 3LAPA 5FD5A 4LMYA 3L2VA 4M74A 2ZXJA 3R4KA 3MFKA 1FTTA 3RCOA 5BOXA 4XMYA 1V55H 5FLXZ 3J7ZI 4XOTA 3TKYA 4ZTJA 1I6HJ 2KP6A 3OYKA 3DEWA 3T8RA 3HB9A 4PJNA 3RJPA 3QP6A 2A6TA 1LEAA 3FM3A 3QYBA 4IRHA 4QPQA 5ICEA 2K9QA 2WB1A 2KMUA 4ZDPA 1T08B 3ERMA 3GO5A 3K6GA 4J00A 3PUFA 1FOXA 1B8IA 3DCFA 1VQ6I 3LSPA 5D8LB 5C3EJ 3BZ6A 4XR6A 3G2BA 1WI9A 3P9KA 3OY9A 3I0TA 4ABZA 2HYJA 4KN4X 1R36A 4BHBA 4RM2A 3RDIA 3DWLE 5B1BH 2IS1A 2FE3A 5FKKA 3ECOA 4AWXB 4L5EA 1W36C 3LNQA 4M9ZA 5B66C 3SDBA 1JT0A 4IZZA 3HTSB 3LA2A 5F1JA 2F4OB 1T0FC 4E6KG 4S0HB 3CF5F 4KMFA 3R61A 4MIMA 2VB6A 2VL8A 3S15J 2GQQA 4BE0A 4X0GA 1N77A 2DODA 4FCYA 2R93J 1FP2A 1FY7A 3HEFA 1X1AA 3CC4I 2QQAA 1XPXA 2FNAA 2OTLI 3VYUB 4IX7A 2KLOA 4HAMA 2A61A 4QWQA 4EQQA 1BI2A 1OLTA 1Z21A 2BBYA 2Y75A 3CMYA 2WB1N 1Z67A 2CV2A 1DUXC 4UUSB 1E3PA 5HS9A 2EK5A 2W57A 4I0AA 4W1UA 2FXAA 2O3FA 3WTXC 1J5YA 2QA4I 3OV8A 2ISZA 4M3GA 4OIPF 2L5QA 5EYRA 3ZP5A 1AKHB 5E1XA 3W2AA 2CW7A 3T0YA 2P0WA 1BL0A 2HVQA 5GAEJ 3E7LA 2RV8A 2VN2A 1I39A 1R6RA 4XLAA 1QZZA 2BVLA 1EV7A 2G7HA 4IQJA 3BT9A 2Q2EB 4K2EA 1XGSA 3LSMA 3E6CC 2K02A 2R0QC 3CO7C 1IDZA 3FISA 3V7SA 3QPTA 3FHNA 3DEEA 3DTEA 2L9NA 2NAZA 1G3TA 2HQ5A 2DTRA 1ZAOA 4M9SA 1TNSA 3L7WA 3K4CA 1P92A 1H9TA 5ILUA 2B9SA 2KRFA 2XAHA 5AONA 2O6GE 1SVMA 2CJJA 2K9LA 5E3NA 1ETXA 3ZXSA 1O57A 3FXKA 4G7OF 1IG7A 1HKQA 5JR3A 3GX4X 3F6VA 3HC7A 3BDDA 5JVTA 4NDLA 2ZNZA 5E3OA 3HUGA 1Y8RB 1AWCA 1PP7U 4XRFA 3ZQHA 4L9VA 4FQGA 2L7FP 4D0PA 4BGDA 2FQ3A 3PJRA 2X6WA 2BYVE 1RNLA 3E5UA 1MD0A 1MMNA 4HBLA 2KDOA 2VBXA 4WF2A 2P5LC 4EM0B 4NC8A 2P81A 3PQKA 5IT3A 2JPCA 3ZQFA 4KT5C 2VIXA 2VJ5A 1RRJA 3GTKJ 2A05A 1IRXA 3K0LA 1ETVA 5F6FA 4HQMA 3DBRB 3ABUA 3VYTB 2G7UA 2VQHA 4MQVA 5FGMA 5BPIA 3ZPLA 2PX9A 4LIVA 4KUMA 4AIHA 2VE8A 4HLXA 2DK8A 3KZIC 1BN5A 3AKZA 3BP8A 2Z99A 1E3HA 2A6HF 3E6BA 4GO1A 1RIOH 1KU9A 1XDSA 1X1PA 1FLIA 5LGTA 1IO2A 3WU1B 3O8GA 2HVRA 2CSOA 4KFCA 1WH7A 1UHWA 2ZSHB 3ZQQA 2BY3A 3H5AA 4HNTA 1VQPI 4DYQA 3P5JA 2R7XA 3MZYA 4IHSA 2RN7A 2EINH 3Q0VA 1R5GA 3SZTA 4JP0A 4Y4RA 1WJ5A 4PFOA 2LYCA 4ENJA 2OZ6A 2MW8A 3ZQCA 1MMSA 2KJCA 2ME0A 3GBGA 5J3LA 3GTJJ 1U2WA 2D2WA 5J1UA 1IUYA 1YS6A 2XGXA 4R79A 3NEUA 1LNWA 3PO2J 4RS8A 4B09A 4ZZLA 2VPLA 2DN0A 2GXGA 2Y31A 5DUIA 3G71I 3G1LA 2PG4A 3FXUA 2XDVA 3VPRA 2O5RA 4EJWA 1F4KA 1T56A 3WGGA 2L9SA 1SMTA 4BQNA 3S3NA 3L2RA 1R4MB 1K6OA 2PLYA 3ZN1A 2V1XA 4E7ZA 4M3DA 1AA7A 5J6XA 4QTRA 3F8NA 3I4NJ 2E5ZA 1Z6RA 3BROA 4ETSA 2OUMA 3O8HA 1N75A 3I5UA 4BBRJ 4CXFA 3S17J 2F5VA 1ZREA 3ZCOA 1SFXA 2Y69H 5HNHA 3KP2A 4R8HA 4U0WA 1ZKGA 3VDXA 5J1RA 1XB4A 3O3KA 4L18B 1SFUA 2COMA 4B3XA 1UG2A 3L2QA 2BW3A 2YS9A 4CCKA 2M30A 1FMVA 3RPUA 1OKRA 3BR0A 4A93J 3Q5FA 2DFFA 4XLHA 4Y13A 1WJBA 4B1RA 1UZCA 1OCRH 3HHGA 2M9HA 2L9VA 5K1YA 5EGOA 3SEZA 3HOSA 1ZLKA 1G2HA 1GHCA 1V5GA 3E0JB 4DBQA 3ZRGA 3RKYA 5H20A 2DJIA 4GGGA 2WV0A 3FKJA 5EEHA 1FX7A 2KKOA 1REPC 4U0VA 3ISPA 2ZXIA 3FMRA 4FT8A 4GCVA 3BWGA 2RQQA 3ELKA 3BOQA 2BE5F 1LVAA 3HXLA 3MEXA 4AIDA 4CSWA 1DU0A 2LP0A 4F92B 2R5YB 4NHJA 2DFHA 3GCMA 4G6QA 2QYOA 4LOCA 2EV5A 4QLCU 2NNYA 3B02A 3H0GJ 1RI7A 1S5LC 2A5YB 4HQEA 3S3OA 4B44A 4ANJA 2K3PA 3TMOA 3ML6A 1U78A 3BTJA 2KIFA 3CUQA 1WQ2A 4EV0A 3LFUA 3OL3A 1K4TA 1T98A 1ZARA 2ZNYA 4KIFA 1D5YA 4RLQA 1NG6A 5ED4A 2LK2A 1WI3A 1K4SA 2RAEA 3B6CA 1X1BA 3OR2C 4OU0A 2VXZA 3KZYA 5HVQC 1DU6A 1E2XA 4O3MA 1AHDP 3I53A 2KZVA 2HR3A 1OCZH 1X3UA 1O7LA 2K27A 2L4AA 2R7OA 3CJRB 1JKPC 2YU3A 1ACIA 1W5CC 3M8FA 5FFZA 3HOUJ 3HOYJ 2LG4A 2O0YA 3U2RA 4RAGA 4N4NB 2ZKZA 5HLGA 2CV0A 1YIOA 2XRLA 1HF0A 2X85A 5GAGJ 3C7JA 4I2OA 3PNVA 1LDKB 3SZPA 5LLQA 2R7RA 1ZRDA 1OISA 3OYIA 2O03A 3W2VA 1KQ8A 4I01A 2EV6A 5F0HA 2Z16A 1IDYA 2ZJRF 5IT9K 2LKSA 1F9NA 4U87A 2JA5J 1Y1VJ 2CQNA 2OJED 1S8NA 4ESBA 1Y56A 3IC7A 5CLSA 1U0JA 1UCRA 2W25A 1MIJA 3WTTC 3ESWB 3IWFA 5DEQA 4M71A 5H2FC 3HG9A 2DA3A 1NHAA 5DCMA 4B4CA 4F93B 1F43A 4MGRA 1AOYA 4CA0A 3V7RA 2LD5A 3RSNA 3CD6I 1D0XA 4L9NA 5E17F 3GMEA 3LSHA 5LHGA 3FXQA 1SAXA 2MC4A 2RGVA 4OWRB 3OYCA 3HPHA 4MHGA 1CQTA 1XDUA 1DP7P 1FYLA 3KP7A 1BOAA 2IW5A 4EJUA 3HSRA 5CVVA 4Q48A 5HLHA 2HNHA 4PJJA 2KFDA 3DLLF 5K7FA 3K10A 2DTZA 5BPDA 1P4XA 2WY7Q 3GTPJ 2IA2A 1RESA 2L54A 4UB8C 4BEHA 1B4AA 1ZGWA 5GPAA 1BBYA 2DBBA 5EJCA 3L00A 4HLYA 4ENKA 3N05A 3PFIA 5M5XJ 4MFEA 1SFKA 5D6EA 4BY1J 1D5VA 3DQVC 3BY6A 3FKIJ 1RETA 1HXDA 3CCUI 4E7LA 2NVQJ 2AHQA 2VJIA 1VNDA 3A1YA 3K4JA 1ZR2A 3LAJA 1Z6TA 4BACA 5FKOA 2M3AA 1QNTA 3DKWA 3M1EA 3KX2A 2V4JC 3NQOA 2HDDA 1FOYA 2HTSA 4MQ9F 4ZYGA 3ABLH 2R7WA 4XSZF 2HKXA 4A0XA 2R7ZJ 3RYRA 5TISC 1UG0A 4F91B 5HS8A 2E19A 2RNJA 5GP9A 1QRYA 4OAYA 2MBFA 4NQWA 4EVIA 1QO0D 3LMMA 5CPRB 2CUJA 1J75A 5J4YA 3FWEA 3JRAA 1UB9A 1ETKA 2JVHA 2XKPA 5E1WA 1W36D 2DPUA 2Z3YA 5IT9Z 1U3EM 1T2KA 2HOTA 3TOBA 3CCJI 2R3SA 5EZGA 1WZ2A 2ZMEA 4E7IA 4XORA 3PUBA 3M9AA 1ETOA 5CVJA 3TW6A 1Z3XA 3VSKA 3JRFA 2BHYA 2M7AA 1KQ0A 1FPQA 5H6RA 4BKXA 1U8BA 1L3LA 3HIFA 3HBLA 4L0YB 2J5PA 3GTQJ 3A01A 3CCMI 4BU2A 2L4MA 5AIPA 1ZYRF 2QEXI 1W7PB 4HNUA 2WAEA 3KP3A 4A3EJ 4S05A 4P55A 4E7KA 4BHPA 5EEGA 4BQQA 1T39A 2LC2A 2HOSA 5HDGA 3EYIA 4D5CA 2EFOA 2CH0A 3EYYA 2WWYA 1YG2A 4HA8A 1MH4A 2KL4A 2DK5A 2OAZA 4G12A 5EG0B 1LFBA 3M07A 2A6EF 2PMUA 2G9WA 2XAUA 2EFNA 2QSFX 3NWSA 3KYCB 3QPHA 3PIPF 2HKOA 2LBFB 1VQ8I 3SEQA 1PYVA 1FBQA 2UV1A 3I56I 4ENMA 3VODA 4HYEA 4CCOA 2IA1A 1ON1A 2DA4A 2XPWA 4I09A 4YELA 1YO5C 3GXOA 2X1CA 2IS6A 3C2GA 4ITVA 1WRJA 2E5NA 1D1AA 2MGQA 2P5VA 4HEA2 3FXMA 1G8XA 4XRSA 3DPTA 1X1CA 4CICA 2JTVA 1EF4A 3CCVI 1A6IA 2J5OA 3OIPA 2UXNA 2JRTA 1LJ9A 2F5DA 2XVCA 3QYFA 3A03A 1UJ8A 1X3ZB 2FBKA 1YX3A 2TDXA 4BHCA 4XICA 4H4KC 3PSIA 2MH2A 2EWNA 1P7JA 1YX5A 3DXJF 1ZR4A 1B72B 1W0TA 5JVGF 1V3FA 2E1NA 2IGNA 4M72A 3R6SA 2YPRA 3H35A 2GOMA 2DI3A 3CUQC 4QIWN 4CYCB 1USSA 3C2BA 5IYCJ 2MYSA 1BW6A 2OBPA 3FMSA 2R5ZA 4LD5A 2VBWA 2GWRA 3HZJA 4IRGA 1Q1VA 1MJ9A 2NS8A 3CJTB 5L3EA 3CCQI 1TW2A 1T38A 5GTIC 2ID6A 4Y3OA 2W85A 3OYAA 1WJCA 3VB2A 2TCTA 1IN8A 1IXSB 2DDAA 1WWXA 3WE2A 3SXYA 2P4WA 4BJ5C 5ICFA 2V6CA 4FETA 2XUBA 1OQYA 2IXSA 4KT6A 1IGNA 3DU5A 1R9TJ 2QLZA 3GEZA 2LY9A 3E1SA 2K7LA 5FRMA 2KDZA 2FSWA 3QPSA 1S3JA 5F1RA 1PP8F 2VONA 3K70D 2X51A 2Q8KA 4ON0A 3LSTA 2P6SA 3ZMZA 5D4SA 2HS5A 2Y9ZA 5D5UB 4FX4A 3OL4A 2VKVA 1B8IB 2CO5A 2LMDA 3HKZN 2M4GA 4Z2YA 5B5EC 1Y1WJ 3DEUA 5TRDA 2B7EA 3IH4A 3OWTA 3OYGA 5J8CA 1G6NA 1XG1A 3H5NA 1SEUA 1JUPA 4IXAA 1IV8A 3GZNB 1TW3A 2ICWG 3OYNA 3JRDA 4ENNA 1JJ8C 3HRMA 2X6YA 3AFHA 4M6VA 2STWA 2H6BA 4NNJA 4XKVA 1P9QC 2EFPA 3MD2A 3JSOA 3FF5A 2E1MC 3KFWX 1VQ5I 2HQRA 3Q9SA 2YUSA 4I02A 2A68F 3F6OA 3F21A 3KLNA 2UXXA 2ZC2A 4PZJA 4E4HA 3OYLA 2EZLA 4XN3A 5D5XB 1ZGJA 3G4SI 3FK6A 3DF8A 5IPAA 2KT0A 4D1QA 1R00A 2LLKA 4I99C 2Z1DA 4NB5A 4CO8A 5FO5A 2JA8J 2VUMJ 1TWGJ 1N78A 2DQRA 4FHTA 4IEJA 4Z6YA 1MSEC 4GRIA 3GZ5A 1ZG5A 1HA8A 3V42A 2CWEA 5E1ZB 1XC5A 3V8LA 2OTJI 4HSRA 4HDUA 5ILVA 4L9JA 2EZIA 1ITYA 3BR1A 3H3UA 2GOXB 3BLYA 1TC3C 3KEOA 1YQAA 3DFGA 1FYMA 2HPIA 2HYFA 5LEKA 1SVLA 3OIQA 3LSJA 3BZCA 3VYSB 1ZTRA 3NAUA 3ZQ7A 5FRNA 1KA8A 5ERIA 2HOAA 2Y48A 3FX3A 1IRZA 2RC4A 3HSEA 2QUFA 4KN7X 4KYWA 1ZG3A 1JHFA 4CCJA 2DQLA 5CVRA 3PM1A 1N25A 2F48A 1QBJA 5IP7J 1KYWA 5E3MA 3OYFA 2JZYA 1ETYA 4HV6A 3ZMTA 2L0KA 2R92J 5D5WB 2JSPA 2JK3A 3PFYA 2H8WA 1IXRC 2EH3A 3F8MA 3BPVA 4IL6C 4A3DJ 3DU6A 2A3SA 4LLNA 3S2DJ 2KQRA 1GXPA 1GV5A 1OCCH 1YW8A 2QSHX 1PUFA 1LDDA 1R1VA 2CS3A 2ZMEC 3L1PA 1DDNA 4ZYDA 3K1PA 1LDJA 3GTLJ 1HBXG 3HUGB 6PAXA 1ZHFA 2G0EA 1FTZA 4GFBA 1J2XA 4II3A 1E17A 3NWTA 4XKWA 2FUG2 1B9NA 2E35A 2L3DA 2NOGA 5F08A 1MNEA 2QENA 2X6OA 3H9JA 2ID3A 1D3YA 2COBA 1YLFA 4DW6A 4DQ2A 5GPCA 1HW5A 2JUGA 1Z9CA 2MA3A 2V1NA 2LY2A 2PJRA 1FYKA 4NC6A 2FBHA 3BR5A 1P7IA 3C2HA 3CC2I 2HFHA 4AYBN 2MSYA 4FX0A 3AAFA 2K5CA 5K7ZA 3KEQA 1SVOA 3LA3A 3MZ8A 1Z05A 3FZVA 4LLGF 4BAYA 3I4MJ 2DOAA 3TBIA 2OQGA 4PCQA 3MMYB 3HYIA 1A04A 3S93A 5C44J 1XMXA 1TWAJ 1TT5B 4HF0A 1B9MA 1Z77A 1SMYF 2L7ZA 4JK1X 1G3YA 2HZTA 3DBHB 5DV5A 3EUKL 2OV7A 4PJLA 5KHDA 2Z33A 4L5IA 2PEXA 4E70A 1B6AA 3OOUA 2JJ7A 5KAIC 3EUAA 3L2WA 2CFOA 1D1BA 3JW4A 4YFKF 5KAFC 3WGHA 4WXDA 2OZUA 4EATA 1W5SA 3LWFA 4F52A 3HOWJ 2GBYA 3KCCA 1OCOH 1MDMA 1HQCA 3SYTA 2FX0A 3LQQA 1G59A 1JT6A 3QWLA 1K79A 2DFEA 3K70C 1JI8A 4V2FA 2HYGD 4XRSG 1ZGAA 2VQCA 2DCEA 2DOFA 1I5ZA 2DPDA 1K6YA 3QU3A 4ASNA 5L3GA 3S14J 4X1EA 2V26A 4M6XA 2BOLA 4MTDA 1U5TB 4RA2A 4A3MJ 1HOMA 3KYDB 1GT0C 5DS9A 2DJNA 1PJRA 1YTYA 4D7NA 1UMQA 2I10A 1HKTA 2CW8A 3WHCA 4WX9A 5LEJA 2M7BA 3CLQA 3WGIA 2IJLA 1D0YA 1KYZA 2JSCA 2JRMA 4FASD 4XM3A 2X9DA 5AIQA 1D0ZA 2BW3B 1UAAA 1X4OA 1NG7A 3GF2A 5DM7F 1QU3A 1MBEA 4KJZA 1T33A 2M45A 2STTA 1GVDA 3GFMA 4D9JA 1TWCJ 4WXCA 4XLPF 1HC8A 4Q4ZF 4BQOA 2A5WA 3AG3H 2DO7A 5EGOB 1MJBA 2D45A 2EIMH 4BXFA 4G8XA 3D0SA 4XONA 3IL2A 1GV2A 3G6EI 4OIQF 4XSXF 4UUTA 4HZFA 3VYRB 3I4PA 3TO7A 4A6EA 1H9GA 1BIBA 1F36A 3OYJA 2VE9A 4BJ6C 3LOCA 4HG2A 4IHXA 3T8TA 3OS0A 2IS4A 2QQ8A 2XGDA 2XAFA 3K1NA 3K4MA 1BR2A 2NNNA 2PN6A 4XQFA 3IH2A 5IY5H 4P9UA 2HEOA 2MLGA 1MMAA 1CF7A 2DA2A 3OYMA 3CUQB 2OPTA 5DYMA 4JX4A 2IP2A 3R60A 1FZPB 2K3FA 4CUGA 3RYPA 4AC0A 4RB1A 2CMPA 3I58A 4XLEA 2B0LA 4LGWA 3SQNA 4A3LJ 3L9FA 1OJLA 2LY1A 3P9CA 3W6JB 4UNOA 3LSGA 4A3JJ 1T95A 2PQ8A 2VKEA 4L5JA 4P5OA 2Q0OA 1C0WA 3PIOF 3QOPA 4I7HA 1VQ4I 1ORKA 1HSTA 2ZXWH 4BBSJ 2IGKA 1NTCA 1LE8A 2M5WA 2L2OA 2W82A 3WTSC 2EIKH 2K9NA 4BE1A 4E7HA 2W24A 2YX7A 4YIFA 3GFLA 1MNDA 3DKYA 3TDUC 5L3FA 2BY1A 3S2WA 4RAFA 5J8FA 3RPUD 4A12A 2DAOA 4DBRA 3ZGKA 1XMKA 3C18A 2H94A 2I5UA 2UUZA 3GTMJ 1S7OA 3AL0C 2FA5A 3TOAA 2E60A 1JTYA 3DBLB 3HRSA 3SHFA 1FJLA 2VC0A 3CZ6A 3C1DA 3DTIA 2ECCA 4A69C 4CCMA 1K78A 3HJEA 2JN6A 3AG1H 3ZMUA 2PJPA 1D8KA 3FXJA 1LFUP 3D5SC 2BXYA 2F2EA 3E5QA 1R23A 4CYDA 2P7VB 5DCMB 1FEXA 1XSXA 5EDNA 2F4MB 1MKMA 2DA7A 2FRHA 5LHIA 4HX4A 4WK8F 2GXBA 2EA2A 1G4DA 2Q1ZB 5M5YJ 2H8RA 2OD5A 3COAC 4WWCA 2EPFA 2KRCA 2RQPA 3OS2A 3FDYA 3LSRA 1V4RA 4N9IA 3CO6C 2NVYJ 5FKMA 3BTLA 2JA7J 4FE4A 1EJ9A 1A36A 4HX8A 1K83J 2JT1A 3O2PE 1P4AA 4GXOA 4ZYAA 5E20A 4RDUA 4RAZA 3OYDA 3ZQIA 4HF1A 4Y15A 3E5XA 4BEHB 1BR4A 1NH3A 1I50J 2XGCA 3F22A 2GM4A 3I3LA 1J9IA 5F04A 1KGSA 3BTCA 2ISYA 2ELKA 3CCLI 2P7CB 4B48A 4Y33A 2DA6A 4G6DA 2P8TA 3ZMVA 1TL8A 5H6QA 3R0JA 3IAM2 3M8EA 2IS2A 3H3VK 4C3JJ 1ZELA 2HTJA 2XB0X 3AG4H 4N9HA 3DPUA 2NVTJ 2K4JA 3CESA 3WHBA 2EV0A 4LJZF 4XLFA 1ONVA 2M8GX 2DU9A 2E2JJ 4MLOA 3TP0A 1STZA 4HW0A 4BH9A 2XHKA 1I3AA 5GTHC 4MTEA 2EJRA 1Z7UA 3M4OJ 3VFZA 3C3WA 1MBJA 3ASOH 4RBOA 2XC7A 1FWZA 3Q9VA 4UHTA 1WH5A 1WJEA 4UVCA 5KNLA 2O61A 3P7NA 3WU2C 1IV6A 4C30A 1FOKA 4L0ZB 4RM3A 2VJJA 3EPZA 5KVRA 3WU0A 1V5EA 3IKVA 4Y17A 2QZ8A 2EZKA 3HPGA 1E0EA 5LGUA 1FT9A 2ZB9A 1IRGA 2ELHA 2M2EA 4KIGA 1YS7A 3S32A 1ODDA 1S7AA 2HDWA 1APLC 2EIJH 4UV8A 4YG2F 1M1EB 5K5RA 3GTGJ 3L09A 3JTHA 4EJVA 4KICA 1IRFA 4OIOF 1WJDA 2VOOA 1A5JA 5BMZA 2ZMEB 2DMNA 3TP3A 4AU7A 1U9NA 2ZFUA 2LF7A 5K5OA 3M7GA 1WPKA 3S1QJ 1TTYA 1TQMA 2RVCA 2ZXHA 3QRFF 1FMWA 3G3ZA 2L7KA 3KZZA 4RGSA 3A01B 4LG0A 2FD5A 3H92A 3RKXA 3SFIA 3SDGA 1ZLJA 2VXDA 2VI6A 4U7DA 3BJOA 2WAQA 3QYEA 3GZ6A 1A6QA 1PDNC 4I6ZA 4HOBA 5K7HA 4PDKA 5J47A 1FIPA 4H0EA 1JKOC 4X6AJ 3TL4X 1FBUA 3HTUA 2ZO4A 4U7BA 2BZTA 1VQMI 3MCZA 3CMAI 4M3FA 3E3VA 5EF6A 1PVEA 3CDIA 3A0BC 4OINF 3RQIA 3FXOA 3IP4B 1W0UA 5DD4A 3RTRA 1U8RA 1OCTC 4Y7NJ 2TRTA 3CLOA 5FJ8J 4AM3A 3A4CA 1RKTA 2BGCA 2BY0A 2DMPA 1B59A 1POGA 1LUJB 4RB3C 2ZJQF 3A02A 3M3YJ 3WTVC 3Q3SA 3J80K 2WY8Q 4IO9F 2VQLA 3ABTA 1GXQA 3I59A 5JHUA 3ABMH 3E6MA 4AVZA 2ELJA 1JXSA 2WAQN 1XGOA 1WCMJ 3MKZA 1TBXA 2WBMA 3HOVJ 4DJAA 1A35A 2EZHA 2JMWA 1VQ9I 1BC8C 4JYKA 5LGNA 1WVRA 3AG2H 1QHGA 4XBFA 4A2UA 1YJNI 1MZBA 1TNTA 2W48A 4IHVA 3DV8A 2HGCA 4XNFA 4ZDLA 1GUUA 2R5ZB 1HW2A 2DA5A 3IH3A 2AQEA 2JQ7A 4FTHA 2A07F 1MMDA 3HOXJ 3VWBA 5F0CA 5FB2A 1RUNA 2KPMA 4XRMA 1P2FA 4BXXJ 2K85A 5CVUA 1GVJA 4S04A 4UXNA 1GDTA 4DOZA 3MKWB 3I54A 3HM5A 4I98B 2ACJA 5CQEA 1OYIA 4BYYA 4A0ZA 1XGMA 5EEAA 2CGPA 1HCRA 3GWZA 2CFXA 1RR7A 4M6YA 2FF4A 3UNGC 2ZJPF 5L3BA 1MBFA 2D5VA 2DYSH 1JKQC 3CF2A 2W7NA 2PFBA 2IA0A 2NXNB 3F8FA 3VEPA 1X1DA 2R7TA 4PJ0C 4M73A 1O4XA 2QGUA 5TJJA 5DD8A 5LRRA 1DGRM 1Y8QB 1VQ7I 4AUXA 4KITB 3OYEA 3ZOBA 4DIQA 3A2KA 3ASNH 5ICGA 2NS7A 3HKZA 3H5RA 3S1NJ 3DKXA 4KISA 1G3SA 4XN0A 2C6YA 4AVPA 1BJAA 2HZDA 4WCGA 3MKYB 3ZQLA 3MN2A 1TWHJ 1FSHA 2M4KA 3B73A 2XSDC 3F9KA 1MBKA 1VQLI 1QZEA 1ZN2A 4WXHA 5JLWA 4CZCA 2W84A 3J7YJ 5FD6A 4DZJA 5M5WJ 2FJ1A 1R1TA 5IYBJ 2M1BA 2H6CA 1ZH5A 4PSXA 3J80Z 4P96A 3FBIB 4A3FJ 1ERDA 4A6DA 2LF8A 3M1CA 1LEBA 5EG0A 1YFHA 4D7MA 1IW7F 1E3OC 1U6GA 3WTWC 4UUVA 3ROUA 1Z7LA 1VI0A 1X2NA 1ZK8A 1BI1A 1O3TA 1R1UA 4UB6C 2PMZN 5DM6F 4PK4A 2LDUA 2ZFWA 2FNPA 4BUPA 2FQ4A 3JRBA 5HOOA 4I76A 2DOEA 4XKBA 2V9PA 3FXLA 3K4LA 1W5TA 2E2HJ 1EH8A 3T1BA 4YFXF 3M8JA 1AU7A 2V1UA 1XMAA 2QBYA 1S9HA 2XB5A 3V8KA 1OR7A 4RGRA 2L9RA 2MH9A 4Q47A 3CCRI 1YW7A 2IEKA 2R4GA 1BI3A 1DPRA 1Y0UA 1SFEA 2OCCH 3RI4A 3RKQA 5HS7A 4P9FA 3CUOA 3WG9A 2O8KA 1ZRFA 4EM1A 2Z9OA 4C2TA 3NARA 2XASA 4RLFA 1XSVA 4PUSA 1S6LA 2ESNA 2DT7B 3OR1C 3AL0B 1MH3A 2K40A 3JCUC 1CGPA 3F3XA 4G94A 3S8PA 1DQUA 3FHZA 2FOKA 4AIKA 4IF4A 2L01A 2QVOA 4RB0A 3IRQA 2DMQA 2R7FA 3S1RJ 3KETA 2LVSA 3OYBA 2JA6J 4DYRA 3TGNA 5LRSA 1ZRCA 1XTAA 2V6EA 4GYIA 1PUFB 1YRNA 1B1BA 3PL8A 3RQ4A 2VQGA 5HLIA 1V54H 2EILH 3HRTA 5A2QK 2CUZA 1SANA 1OYYA 4XOPA 3JRIA 1Z0XA 4ZTFA 1DP3A 1J0RA 5CYVA 2XV4S 2ZJ2A 3OIOA 5IOZA 3G1MA 2XAQA 1QA6A 2FBIA 4LK1F 4ZDOA 2PJRB 5JLXA 3JRGA 3N97A 3H9QA 2RNGA 3EUHA 4CGZA 4A0YA 3GVAA 4MNUA 2HPMA 3RPQA 2E1OA 1K7AA 1IN4A 4IHTA 3D5LA 1TZLA 4LFUA 3OS1A 1SD6A 4AYBA 1P4WA 1IAWA 4W97A 5BNGA 2X1DA 2NVXJ 2KISA 4TV7A 3GW2A 3KIOA 4JQFA 1YI2I 4PGHA 1HDDC 1XX5A 3BJ6A 4BDZA 1WGXA 1YJ9I 4BS9A 2WC2A 1I6XA 2F5EA 5FKLA 4RMNA 4DGWB 2O8XA 4HX7A 3WG7H 3HRUA 1ETWA 1YITI 4L9TA 1HSJA 1HKSA 3TW7A 3K4KA 3S16J 3K2AA 2LRDA 3H1CA 1RR8C 2HXOA 3QODA 3BG5A 2X4HA 4BQAA 2YR2A 4M9XA 1LPQA 2XF5A 2M0CA 1SFOJ 1GLNA 3BR6A 3DP7A 3IUOA 4OIRF 3TQNA 1MMGA 2R7DA 4QPOA 3MAJA 1MDMB 2E7XA 5CKTA 1LQ1A 5LHHA 4V19K 4EEFG 2VKHA 3GFJA 4C9YA 4CCNA 1D8JA 4HRIA 2AQFA 2V7FA 1IF1A 1UHMA 2OC6A 3HDDA 4CZZA 3TO6A 3L2CA 1JE8A 3W6KB 1RKWA 4RB2C 4NUBA 1WFXA 3MZHA 4JX5A 4LB5A 3CP2A 4HV5A 5FLVA 4QSHA 1BC7C 4MEXF 3DLAA 5FKNA 4KA4A 3JREA 2V79A 3BC8A 1BOBA 4BE2A 1Z1DA 2CYYA 3K4BA 5A2QZ 3J7AY 1T8IA 3EDPA 2KJBA 2E2IJ 1TP4A 1YOVB 2HQNA 3CMEI 2RREA 3H36A 4YIRX 2MABA 3I55I 4UUSA 3VSLA 1QPMA 4EMSA 1YW9A 2R7VA 2BXZA 4C3HJ 1YJWI 4IHYA 2NYXA 3WTYC 3G1OA 2LREA 1VQOI 4B8XA 1IN6A 3ZMDA 1AKHA 2FEZA 2F4IA 2R7SA 2Y0MA 1OPCA 5E18F 1QVTA 2KZGA 5D8KB 4B43A 2XROA 2LH9A 1VQKI 2DYRH 1O3SA 3GTOJ 2GLOA 1LVKA 3KP5A 2IRFG 4XL9A 2W1OA 2GIVA 3H3ZA 2CV1A 1JTXA 3JAMK 1JGSA 3CTAA 3MWMA 5CQGA 2Q2EA 4PGGA 5LD2C 1ZG1A 1A31A 4DZPA 3IAS2 1EKEA 5GADJ 2JA2A 5J40A 1CF7B 2ZSIB 2BV6A 3IV5A 1BR1A 3SJMA 2EFQA 1Z91A 5DDGA 4MFDA 2DT5A 5M3FJ 2IGOA 5F64A 1W1WE 2OU2A 4C3IJ 5J1YA 5HNFA 3CC7I 4BNCA 5FROA 2ETHA 2NVUB 1ON2A 3K69A 5HDKA 3K7AJ 3DPLC 2IAIA 1WKMA 3JR9A 4CH7A 2XPUA 1XN7A 5DUKA 2E7WA 2KIMA 3BG3A 2GXAA 2M34A 1JGGA 3QU6A 3GUDA 5ILSA 2LR8A 1QHHD 2HXIA 2X48A 2K4BA 1JHHA 2WADA 3ECHA 2D1VA 3BTIA 1X58A 3T5XA 5M3MJ 5L3CA 4C2MJ 1LE8B 4XLCA 1OR7C 4PFPA 3EETA 3RKWA 2CW0F 4ZC3A 1O7FA 3HOTA 2DFIA 4PJMA 2XKOA 1FIAA 3TO9A 1R7JA 1S72I 2HI3A 2K9SA 1LKXA 1KU3A 1F1ZA 1TWFJ 4KMUX 2LKXA 4HSTA 4A3IJ 3BR3A 3JRHA 2YU9J 3RZDJ 2QKMB 2F5CA 2VASA 4B3AA 1IC8A 1I1SA 1I1GA 1JUSA 5K5QA 2XIGA 1K78B 1QQIA 2MLKA 1J59A 2DA1A 3SZGA 3K9TA 1QZYA 1U5TA 1X3WB 3GLLA 4G7HF 5B3SH 4A3KJ 2CQ7A 2CQQA 2EBIA 2X1EA 2JVGA 4JOMA 2E36A
chains in the Genus database with same CATH topology
2M8EA 1IN7A 3V4GA 3ULQB 4RAYA 3RIRA 4G9YA 2V9VA 2DW4A 4A5NA 2KIUA 3K1MA 3JAMZ 3WTZA 2P5KA 1YYVA 4U88A 5CJ9A 3JTGA 3I64A 4R1HA 1BI0A 4AD9A 2QQBA 2GA1A 1FBSA 1FP1D 2IPQX 4EGYA 2AS5F 2L02A 3QAHA 1W4MA 1G3WA 1UFMA 4HF2A 4Q5SF 2EB7A 4GYGA 1FSEA 3F23A 4LK0F 2HDCA 1KQ9A 4DNCA 2XAJA 3V7CA 3GFIA 2VODA 4IRIA 3LQRA 2PMHA 1F5TA 4UVAA 1FC3A 5CVIA 3QP5A 2HWVA 4OMZA 3G73A 2IT0A 4RGXA 1IN5A 2MD5A 2ESHA 3MQ0A 4N0BA 1TQIA 3OOPA 1OMIA 4KNYA 1XGNA 3J81K 2K86A 1EH6A 3WE3A 4LG0B 1DPUA 5FFXA 2HOEA 4XLNF 4I0BA 1XSDA 2BEOA 3BJAA 3V8JA 3GYHX 3ERED 2IVMA 4IPAA 3EQLF 2ADUA 5JFRA 1P6RA 2F5FA 1PUEE 3JSPA 1R58A 3P9IA 3I71A 2PI0A 4ZH4F 2VT3A 1J7KA 1FNNA 4ZYHA 2YX4A 4G7ZF 3HHHA 4EGZA 2WTEA 5D5VB 5HDNA 3CJNA 4UV9A 1XD7A 5BS6A 1SD7A 4ESJA 4YFNF 3F8CA 3IHUA 4KDPA 3ZN0A 1OYWA 2AXLA 2FMLA 3I59B 4A5MA 1XCVA 1IXCA 2H09A 3KP6A 1TQPA 2A69F 4OOIA 1TLHB 3LA7A 2LSOA 1I27A 2VT2A 4JBAA 2GA2A 3WTUC 4HDVA 3REOA 1MGTA 1WSUA 3IWZA 4EM2A 1R22A 3U9GA 3F8BA 2M87A 1T0FA 3FXRA 2FU4A 3LFKA 1H0MA 3N4MA 2QWWA 5L3DA 3FM5A 3KP4A 3VOEA 4OMYA 1RZ4A 1KU7A 3R0AA 3J81Z 2VOPA 2RKHA 4YIIA 2NRAC 2VBZA 1S29A 1KU2A 4IVNA 2LKPA 1L0OC 5D6FA 2UZKA 1LB2A 2QQ9A 4U0YA 5KK1A 4ESFA 1O3QA 2VBYA 2UWMA 4CHUA 3WODF 3CDHA 1U5TC 2V1DA 3E6DA 2CQKA 3BPXA 2H27A 3F72A 2GAUA 4O6JA 5D4RA 2PBIA 2OQRA 3GLXA 1T6SA 1O3RA 1BIAA 5E8IA 3J7AO 1R5HA 3IRRA 1USTA 2XAGA 2XRNA 4AIJA 5JI6A 2FMYA 2QBYB 4ZYEA 3O6BB 3PQJA 1MJAA 2RDPA 5FLXK 1BM9A 4KIBA 3SFZA 1W7PA 4MEYF 2EA4A 1IZ1A 2EFWA 1XCBA 2P6TA 4LB6B 3U1DA 3TDZC 2X0LA 4F7ZA 4ZZDA 3HSFA 4EJOA 2ZCWA 3IKTA 4EJTA 4RGUA 2MC3A 4BXUA 4CDGA 2VC1A 1W7PD 1RUOA 2E1CA 2QM3A 5DCFA 1Q1HA 1SD5A 2ZBKA 2GZWA 2LNBA 3KLOA 5LBQA 4O5VA 2OA4A 1ULYA 2CG4A 2DLLA 3E97A 5E8GA 3ZMSA 5BQTA 2JPBA 2YSRA 5ICCA 2Z5UA 2D1HA 1QGPA 1EH7A 3K2ZA 2NS0A 3NRVA 3KE2A 3FMQA 1VTNC 4UVBA 1HW1A 1SD4A 3LAPA 4IJAA 4LLLA 5FD5A 4LMYA 5BPIA 4M74A 2ZXJA 3R4KA 3MFKA 5BOXA 5FLXZ 3TKYA 3T8RA 3RJPA 3QP6A 1LEAA 3FM3A 4IRHA 5ICEA 3GO5A 5D8LB 3BZ6A 1WI9A 3P9KA 3I0TA 4KN4X 1R36A 4BHBA 3RDIA 2FE3A 3ECOA 4AWXB 4M9ZA 3HTSB 3LA2A 4KMFA 3R61A 2GQQA 1FP2A 1FY7A 2QQAA 2FNAA 4HAMA 2A61A 4EQQA 4QWQA 1BI2A 2BBYA 2Y75A 1DUXC 5HS9A 2EK5A 2W57A 4I0AA 2FXAA 2O3FA 3WTXC 1J5YA 3OV8A 2ISZA 4OIPF 3ZP5A 5E1XA 3T0YA 2RV8A 2VN2A 1QZZA 1EV7A 2G7HA 4K2EA 1XGSA 3E6CC 2K02A 3CO7C 3V7SA 3QPTA 2NAZA 1G3TA 2DTRA 1ZAOA 4M9SA 1TNSA 3L7WA 1P92A 1H9TA 5ILUA 2KRFA 2XAHA 5AONA 2O6GE 1O57A 4G7OF 1HKQA 5JR3A 3GX4X 3F6VA 3BDDA 5JVTA 2ZNZA 1AWCA 3HUGA 1PP7U 4XRFA 4L9VA 4D0PA 2FQ3A 2BYVE 1RNLA 3E5UA 1MD0A 4HBLA 2VBXA 4WF2A 2P5LC 4EM0B 3PQKA 5IT3A 2JPCA 4KT5C 3K0LA 5F6FA 4HQMA 3ABUA 2G7UA 4MQVA 5FGMA 3ZPLA 4KUMA 4AIHA 2VE8A 4HLXA 2DK8A 1BN5A 3BP8A 2Z99A 2A6HF 3E6BA 4GO1A 1RIOH 1KU9A 1XDSA 1FLIA 5LGTA 3WU1B 2CSOA 4KFCA 1UHWA 3MZYA 4IHSA 2RN7A 1R5GA 3SZTA 4ENJA 2OZ6A 2KJCA 1U2WA 2D2WA 1IUYA 1YS6A 2XGXA 4R79A 3NEUA 1LNWA 4RS8A 4B09A 4ZZLA 5DUIA 2GXGA 2PG4A 3FXUA 4EJWA 1F4KA 3WGGA 1SMTA 1K6OA 2PLYA 3ZN1A 2V1XA 5J6XA 3F8NA 3BROA 1Z6RA 4ETSA 3I5UA 4CXFA 1ZREA 1SFXA 3KP2A 4R8HA 4U0WA 1XB4A 3O3KA 4L18B 1SFUA 2COMA 2M30A 3RPUA 1OKRA 3Q5FA 4Y13A 3HHGA 5K1YA 3HOSA 1ZLKA 1GHCA 3RKYA 5H20A 4GGGA 2WV0A 5EEHA 1FX7A 2KKOA 1REPC 4U0VA 3ISPA 3FMRA 4FT8A 4GCVA 3BWGA 3ELKA 3BOQA 2BE5F 1LVAA 3MEXA 4NHJA 4G6QA 2QYOA 2EV5A 4QLCU 2NNYA 3B02A 1RI7A 4HQEA 2A5YB 3ML6A 1U78A 2KIFA 3CUQA 1WQ2A 4EV0A 1T98A 1ZARA 2ZNYA 4KIFA 5ED4A 4OU0A 2VXZA 3KZYA 5HVQC 1E2XA 4O3MA 3I53A 2HR3A 1X3UA 1O7LA 2K27A 2L4AA 2YU3A 3M8FA 5FFZA 2O0YA 3U2RA 5HLGA 2ZKZA 1YIOA 3C7JA 4I2OA 1LDKB 3SZPA 5LLQA 1ZRDA 2O03A 1KQ8A 4I01A 2EV6A 5IT9K 1F9NA 1S8NA 4ESBA 3IC7A 5CLSA 1UCRA 2W25A 3WTTC 3IWFA 5DEQA 4M71A 1NHAA 5DCMA 4MGRA 1AOYA 3V7RA 4L9NA 5E17F 5LHGA 3FXQA 1SAXA 2RGVA 4MHGA 1XDUA 1DP7P 1FYLA 3KP7A 1BOAA 2IW5A 4EJUA 3HSRA 5CVVA 4Q48A 5HLHA 5BPDA 1P4XA 2IA2A 2L54A 1B4AA 1BBYA 2DBBA 4ENKA 3L00A 4HLYA 3PFIA 5D6EA 1D5VA 3DQVC 3BY6A 1HXDA 3LAJA 1Z6TA 1QNTA 3DKWA 3M1EA 3NQOA 2HTSA 4MQ9F 4ZYGA 4XSZF 2HKXA 4A0XA 3RYRA 5HS8A 2RNJA 2MBFA 4NQWA 4EVIA 1QO0D 1J75A 3FWEA 1UB9A 2XKPA 5E1WA 2DPUA 5IT9Z 2Z3YA 1U3EM 1T2KA 3TOBA 2R3SA 2ZMEA 3M9AA 5CVJA 1KQ0A 1FPQA 5H6RA 1L3LA 3HIFA 4L0YB 2J5PA 2L4MA 5AIPA 1ZYRF 1W7PB 3KP3A 4S05A 4P55A 4BHPA 5EEGA 1T39A 5HDGA 3EYIA 2EFOA 3EYYA 2WWYA 1YG2A 4HA8A 2DK5A 2OAZA 2A6EF 2PMUA 2G9WA 2EFNA 3QPHA 2HKOA 1FBQA 4ENMA 3VODA 4HYEA 2IA1A 1ON1A 4I09A 1YO5C 3GXOA 1WRJA 2P5VA 3DPTA 4CICA 2JTVA 2J5OA 2UXNA 2JRTA 1LJ9A 2F5DA 2XVCA 2FBKA 2TDXA 4BHCA 2MH2A 2EWNA 3DXJF 1V3FA 2E1NA 4M72A 3R6SA 2YPRA 2DI3A 3CUQC 1USSA 2OBPA 3FMSA 4LD5A 2VBWA 2GWRA 4IRGA 1MJ9A 5L3EA 1TW2A 1T38A 2W85A 3VB2A 1IN8A 1IXSB 1WWXA 3WE2A 3SXYA 2P4WA 5ICFA 2V6CA 2XUBA 2QLZA 3GEZA 2K7LA 2FSWA 1S3JA 5F1RA 1PP8F 2VONA 2Q8KA 4ON0A 3LSTA 2P6SA 3ZMZA 5D4SA 2HS5A 5D5UB 4FX4A 2CO5A 4Z2YA 3DEUA 5TRDA 5J8CA 1G6NA 4IXAA 1TW3A 4ENNA 3HRMA 2STWA 2H6BA 2EFPA 3JSOA 3FF5A 3KFWX 2HQRA 3Q9SA 4I02A 2A68F 3F6OA 3F21A 3KLNA 2UXXA 4PZJA 5D5XB 1ZGJA 3DF8A 1R00A 4NB5A 4CO8A 5FO5A 2DQRA 4FHTA 3GZ5A 1ZG5A 2CWEA 5E1ZB 3V8LA 4HDUA 5ILVA 4L9JA 3H3UA 3KEOA 1YQAA 3DFGA 1FYMA 2HYFA 5LEKA 3ZQ7A 1KA8A 5ERIA 2Y48A 3FX3A 2RC4A 3HSEA 2QUFA 4KN7X 4KYWA 1ZG3A 1JHFA 2DQLA 5CVRA 1QBJA 1KYWA 2JZYA 4HV6A 3ZMTA 5D5WB 1IXRC 3F8MA 3BPVA 2A3SA 4LLNA 1GXPA 1YW8A 1LDDA 1R1VA 1DDNA 4ZYDA 3K1PA 1LDJA 1HBXG 6PAXA 1ZHFA 1J2XA 1E17A 1B9NA 2L3DA 2QENA 1D3YA 1YLFA 4DQ2A 1HW5A 1Z9CA 2MA3A 1FYKA 2FBHA 2HFHA 4FX0A 3AAFA 3KEQA 3LA3A 1Z05A 3FZVA 4LLGF 4BAYA 2OQGA 4PCQA 3HYIA 1A04A 4HF0A 1B9MA 1SMYF 4JK1X 1G3YA 2HZTA 5DV5A 2Z33A 4L5IA 2PEXA 4E70A 1B6AA 3JW4A 4YFKF 3WGHA 4WXDA 2OZUA 1W5SA 3LWFA 3KCCA 1MDMA 1HQCA 3LQQA 1K79A 2HYGD 1ZGAA 1I5ZA 2DPDA 3QU3A 4ASNA 5L3GA 4M6XA 4MTDA 1U5TB 1YTYA 1HKTA 4WX9A 5LEJA 3WGIA 2IJLA 1KYZA 2JSCA 5AIQA 3GF2A 2M45A 2STTA 3GFMA 4XLPF 4WXCA 4Q4ZF 2DO7A 1MJBA 2D45A 4G8XA 3D0SA 3IL2A 4OIQF 4XSXF 4HZFA 3I4PA 3TO7A 4A6EA 1H9GA 1BIBA 2VE9A 3T8TA 2XAFA 3K1NA 2NNNA 2PN6A 4P9UA 2HEOA 2MLGA 1CF7A 3CUQB 5DYMA 2IP2A 3R60A 1FZPB 3RYPA 4RB1A 3I58A 2B0LA 4LGWA 3SQNA 3L9FA 3P9CA 3W6JB 4UNOA 4L5JA 2PQ8A 4P5OA 2Q0OA 1C0WA 3QOPA 4I7HA 1HSTA 2M5WA 3WTSC 2W24A 2YX7A 4YIFA 3GFLA 3TDUC 5L3FA 3S2WA 5J8FA 4A12A 2DAOA 1XMKA 3C18A 2H94A 1S7OA 2FA5A 3TOAA 3SHFA 3HRSA 2VC0A 3C1DA 1K78A 2PJPA 3ZMUA 1D8KA 2F2EA 3E5QA 1R23A 4CYDA 2P7VB 5DCMB 1XSXA 1MKMA 2FRHA 5LHIA 4HX4A 4WK8F 2GXBA 2EA2A 1G4DA 2OD5A 3COAC 4WWCA 2RQPA 1V4RA 4N9IA 3CO6C 4HX8A 2JT1A 4GXOA 3O2PE 1P4AA 5E20A 4RAZA 4HF1A 4Y15A 3E5XA 3F22A 1J9IA 1KGSA 2ISYA 2P7CB 4G6DA 3ZMVA 2P8TA 5H6QA 3R0JA 3M8EA 2HTJA 4N9HA 2K4JA 2EV0A 4LJZF 1ONVA 2DU9A 1STZA 4HW0A 4BH9A 2XHKA 4MTEA 2EJRA 1Z7UA 3VFZA 3C3WA 1FWZA 3Q9VA 4UHTA 4UVCA 2O61A 3P7NA 1FOKA 4L0ZB 5KVRA 3WU0A 4Y17A 3IKVA 2QZ8A 5LGUA 1FT9A 1IRGA 2ELHA 4KIGA 1YS7A 1ODDA 1S7AA 4UV8A 4YG2F 5K5RA 3L09A 3JTHA 4EJVA 4KICA 1IRFA 4OIOF 2VOOA 5BMZA 2ZMEB 2LF7A 5K5OA 3M7GA 1TTYA 1TQMA 2RVCA 3QRFF 3KZZA 3G3ZA 4RGSA 4LG0A 3H92A 3RKXA 1ZLJA 4U7DA 3BJOA 3GZ6A 1PDNC 4HOBA 4PDKA 4H0EA 1FBUA 3HTUA 2ZO4A 4U7BA 3MCZA 3E3VA 4OINF 5DD4A 3RTRA 1U8RA 3CLOA 2BGCA 1B59A 4RB3C 3WTVC 3J80K 3ABTA 1GXQA 3I59A 5JHUA 3E6MA 1JXSA 1XGOA 1TBXA 1BC8C 5LGNA 4XBFA 4A2UA 1MZBA 1TNTA 3DV8A 2HGCA 1HW2A 2A07F 5FB2A 1RUNA 1P2FA 5CVUA 1GVJA 4S04A 4UXNA 3I54A 4I98B 2ACJA 1OYIA 4BYYA 4A0ZA 1XGMA 2CGPA 3GWZA 2CFXA 4M6YA 2FF4A 5L3BA 2PFBA 2IA0A 3F8FA 3VEPA 4M73A 5TJJA 5DD8A 5LRRA 5ICGA 1G3SA 2C6YA 4AVPA 1BJAA 4WCGA 1FSHA 3B73A 1ZN2A 4WXHA 2W84A 5FD6A 1R1TA 2M1BA 2H6CA 1ZH5A 3J80Z 4P96A 4A6DA 2LF8A 1LEBA 1YFHA 1IW7F 1U6GA 3WTWC 4UUVA 3ROUA 1O3TA 1BI1A 1R1UA 2LDUA 2ZFWA 2FNPA 5HOOA 1W5TA 1EH8A 3T1BA 4YFXF 2V1UA 1XMAA 2QBYA 3V8KA 1OR7A 4RGRA 2MH9A 4Q47A 1YW7A 1BI3A 1DPRA 1Y0UA 1SFEA 3RI4A 5HS7A 4P9FA 3CUOA 3WG9A 1ZRFA 4EM1A 2Z9OA 2XASA 1XSVA 1S6LA 2ESNA 1CGPA 3F3XA 4G94A 3FHZA 2FOKA 4AIKA 4IF4A 2L01A 2QVOA 4RB0A 3IRQA 2R7FA 3KETA 3TGNA 5LRSA 1ZRCA 4GYIA 1B1BA 5HLIA 3HRTA 5A2QK 1OYYA 1J0RA 5CYVA 2XV4S 2ZJ2A 2XAQA 2FBIA 4LK1F 3N97A 4CGZA 3EUHA 4A0YA 3GVAA 4MNUA 3RPQA 1K7AA 1IN4A 4IHTA 3D5LA 4LFUA 1SD6A 1P4WA 1IAWA 4TV7A 3GW2A 4JQFA 4PGHA 3BJ6A 2WC2A 1I6XA 2F5EA 2O8XA 4HX7A 3HRUA 4L9TA 1HSJA 1HKSA 2X4HA 4BQAA 2YR2A 4M9XA 3DP7A 4OIRF 3TQNA 2R7DA 3MAJA 1MDMB 2E7XA 1LQ1A 5LHHA 3GFJA 1D8JA 1IF1A 1UHMA 4CZZA 3TO6A 3L2CA 1JE8A 3W6KB 4RB2C 3MZHA 4LB5A 4HV5A 1BC7C 4MEXF 4KA4A 2V79A 1Z1DA 2CYYA 5A2QZ 3EDPA 2KJBA 2HQNA 1QPMA 4EMSA 1YW9A 2NYXA 3WTYC 4B8XA 1IN6A 3ZMDA 2FEZA 2Y0MA 1OPCA 5E18F 5D8KB 2XROA 1O3SA 2IRFG 3KP5A 2GIVA 3H3ZA 3JAMK 1JGSA 3CTAA 3MWMA 2Q2EA 4PGGA 1ZG1A 1CF7B 2BV6A 2EFQA 1Z91A 5DDGA 2DT5A 5F64A 2OU2A 4BNCA 2ETHA 1ON2A 3K69A 5HDKA 3DPLC 1WKMA 1XN7A 5DUKA 2E7WA 2KIMA 3QU6A 3GUDA 5ILSA 2K4BA 1JHHA 3ECHA 2D1VA 3T5XA 5L3CA 3EETA 3RKWA 2CW0F 1O7FA 3HOTA 2DFIA 2XKOA 3TO9A 1R7JA 1KU3A 1F1ZA 4KMUX 2F5CA 1I1SA 1I1GA 5K5QA 2XIGA 1K78B 1QQIA 2MLKA 1J59A 3K9TA 1QZYA 1U5TA 4G7HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8E A;  1IN7 A;  3V4G A;  3ULQ B;  4RAY A;  3RIR A;  4G9Y A;  2V9V A;  2DW4 A;  4A5N A;  2KIU A;  3K1M A;  3JAM Z;  3WTZ A;  2P5K A;  1YYV A;  4U88 A;  5CJ9 A;  3JTG A;  3I64 A;  4R1H A;  1BI0 A;  4AD9 A;  2QQB A;  2GA1 A;  1FBS A;  1FP1 D;  2IPQ X;  4EGY A;  2AS5 F;  2L02 A;  3QAH A;  1W4M A;  1G3W A;  1UFM A;  4HF2 A;  4Q5S F;  2EB7 A;  4GYG A;  1FSE A;  3F23 A;  4LK0 F;  2HDC A;  1KQ9 A;  4DNC A;  2XAJ A;  3V7C A;  3GFI A;  2VOD A;  4IRI A;  3LQR A;  2PMH A;  1F5T A;  4UVA A;  1FC3 A;  5CVI A;  3QP5 A;  2HWV A;  4OMZ A;  3G73 A;  2IT0 A;  4RGX A;  1IN5 A;  2MD5 A;  2ESH A;  3MQ0 A;  4N0B A;  1TQI A;  3OOP A;  1OMI A;  4KNY A;  1XGN A;  3J81 K;  2K86 A;  1EH6 A;  3WE3 A;  4LG0 B;  1DPU A;  5FFX A;  2HOE A;  4XLN F;  4I0B A;  1XSD A;  2BEO A;  3BJA A;  3V8J A;  3GYH X;  3ERE D;  2IVM A;  4IPA A;  3EQL F;  2ADU A;  5JFR A;  1P6R A;  2F5F A;  1PUE E;  3JSP A;  1R58 A;  3P9I A;  3I71 A;  2PI0 A;  4ZH4 F;  2VT3 A;  1J7K A;  1FNN A;  4ZYH A;  2YX4 A;  4G7Z F;  3HHH A;  4EGZ A;  2WTE A;  5D5V B;  5HDN A;  3CJN A;  4UV9 A;  1XD7 A;  5BS6 A;  1SD7 A;  4ESJ A;  4YFN F;  3F8C A;  3IHU A;  4KDP A;  3ZN0 A;  1OYW A;  2AXL A;  2FML A;  3I59 B;  4A5M A;  1XCV A;  1IXC A;  2H09 A;  3KP6 A;  1TQP A;  2A69 F;  4OOI A;  1TLH B;  3LA7 A;  2LSO A;  1I27 A;  2VT2 A;  4JBA A;  2GA2 A;  3WTU C;  4HDV A;  3REO A;  1MGT A;  1WSU A;  3IWZ A;  4EM2 A;  1R22 A;  3U9G A;  3F8B A;  2M87 A;  1T0F A;  3FXR A;  2FU4 A;  3LFK A;  1H0M A;  3N4M A;  2QWW A;  5L3D A;  3FM5 A;  3KP4 A;  3VOE A;  4OMY A;  1RZ4 A;  1KU7 A;  3R0A A;  3J81 Z;  2VOP A;  2RKH A;  4YII A;  2NRA C;  2VBZ A;  1S29 A;  1KU2 A;  4IVN A;  2LKP A;  1L0O C;  5D6F A;  2UZK A;  1LB2 A;  2QQ9 A;  4U0Y A;  5KK1 A;  4ESF A;  1O3Q A;  2VBY A;  2UWM A;  4CHU A;  3WOD F;  3CDH A;  1U5T C;  2V1D A;  3E6D A;  2CQK A;  3BPX A;  2H27 A;  3F72 A;  2GAU A;  4O6J A;  5D4R A;  2PBI A;  2OQR A;  3GLX A;  1T6S A;  1O3R A;  1BIA A;  5E8I A;  3J7A O;  1R5H A;  3IRR A;  1UST A;  2XAG A;  2XRN A;  4AIJ A;  5JI6 A;  2FMY A;  2QBY B;  4ZYE A;  3O6B B;  3PQJ A;  1MJA A;  2RDP A;  5FLX K;  1BM9 A;  4KIB A;  3SFZ A;  1W7P A;  4MEY F;  2EA4 A;  1IZ1 A;  2EFW A;  1XCB A;  2P6T A;  4LB6 B;  3U1D A;  3TDZ C;  2X0L A;  4F7Z A;  4ZZD A;  3HSF A;  4EJO A;  2ZCW A;  3IKT A;  4EJT A;  4RGU A;  2MC3 A;  4BXU A;  4CDG A;  2VC1 A;  1W7P D;  1RUO A;  2E1C A;  2QM3 A;  5DCF A;  1Q1H A;  1SD5 A;  2ZBK A;  2GZW A;  2LNB A;  3KLO A;  5LBQ A;  4O5V A;  2OA4 A;  1ULY A;  2CG4 A;  2DLL A;  3E97 A;  5E8G A;  3ZMS A;  5BQT A;  2JPB A;  2YSR A;  5ICC A;  2Z5U A;  2D1H A;  1QGP A;  1EH7 A;  3K2Z A;  2NS0 A;  3NRV A;  3KE2 A;  3FMQ A;  1VTN C;  4UVB A;  1HW1 A;  1SD4 A;  3LAP A;  4IJA A;  4LLL A;  5FD5 A;  4LMY A;  5BPI A;  4M74 A;  2ZXJ A;  3R4K A;  3MFK A;  5BOX A;  5FLX Z;  3TKY A;  3T8R A;  3RJP A;  3QP6 A;  1LEA A;  3FM3 A;  4IRH A;  5ICE A;  3GO5 A;  5D8L B;  3BZ6 A;  1WI9 A;  3P9K A;  3I0T A;  4KN4 X;  1R36 A;  4BHB A;  3RDI A;  2FE3 A;  3ECO A;  4AWX B;  4M9Z A;  3HTS B;  3LA2 A;  4KMF A;  3R61 A;  2GQQ A;  1FP2 A;  1FY7 A;  2QQA A;  2FNA A;  4HAM A;  2A61 A;  4EQQ A;  4QWQ A;  1BI2 A;  2BBY A;  2Y75 A;  1DUX C;  5HS9 A;  2EK5 A;  2W57 A;  4I0A A;  2FXA A;  2O3F A;  3WTX C;  1J5Y A;  3OV8 A;  2ISZ A;  4OIP F;  3ZP5 A;  5E1X A;  3T0Y A;  2RV8 A;  2VN2 A;  1QZZ A;  1EV7 A;  2G7H A;  4K2E A;  1XGS A;  3E6C C;  2K02 A;  3CO7 C;  3V7S A;  3QPT A;  2NAZ A;  1G3T A;  2DTR A;  1ZAO A;  4M9S A;  1TNS A;  3L7W A;  1P92 A;  1H9T A;  5ILU A;  2KRF A;  2XAH A;  5AON A;  2O6G E;  1O57 A;  4G7O F;  1HKQ A;  5JR3 A;  3GX4 X;  3F6V A;  3BDD A;  5JVT A;  2ZNZ A;  1AWC A;  3HUG A;  1PP7 U;  4XRF A;  4L9V A;  4D0P A;  2FQ3 A;  2BYV E;  1RNL A;  3E5U A;  1MD0 A;  4HBL A;  2VBX A;  4WF2 A;  2P5L C;  4EM0 B;  3PQK A;  5IT3 A;  2JPC A;  4KT5 C;  3K0L A;  5F6F A;  4HQM A;  3ABU A;  2G7U A;  4MQV A;  5FGM A;  3ZPL A;  4KUM A;  4AIH A;  2VE8 A;  4HLX A;  2DK8 A;  1BN5 A;  3BP8 A;  2Z99 A;  2A6H F;  3E6B A;  4GO1 A;  1RIO H;  1KU9 A;  1XDS A;  1FLI A;  5LGT A;  3WU1 B;  2CSO A;  4KFC A;  1UHW A;  3MZY A;  4IHS A;  2RN7 A;  1R5G A;  3SZT A;  4ENJ A;  2OZ6 A;  2KJC A;  1U2W A;  2D2W A;  1IUY A;  1YS6 A;  2XGX A;  4R79 A;  3NEU A;  1LNW A;  4RS8 A;  4B09 A;  4ZZL A;  5DUI A;  2GXG A;  2PG4 A;  3FXU A;  4EJW A;  1F4K A;  3WGG A;  1SMT A;  1K6O A;  2PLY A;  3ZN1 A;  2V1X A;  5J6X A;  3F8N A;  3BRO A;  1Z6R A;  4ETS A;  3I5U A;  4CXF A;  1ZRE A;  1SFX A;  3KP2 A;  4R8H A;  4U0W A;  1XB4 A;  3O3K A;  4L18 B;  1SFU A;  2COM A;  2M30 A;  3RPU A;  1OKR A;  3Q5F A;  4Y13 A;  3HHG A;  5K1Y A;  3HOS A;  1ZLK A;  1GHC A;  3RKY A;  5H20 A;  4GGG A;  2WV0 A;  5EEH A;  1FX7 A;  2KKO A;  1REP C;  4U0V A;  3ISP A;  3FMR A;  4FT8 A;  4GCV A;  3BWG A;  3ELK A;  3BOQ A;  2BE5 F;  1LVA A;  3MEX A;  4NHJ A;  4G6Q A;  2QYO A;  2EV5 A;  4QLC U;  2NNY A;  3B02 A;  1RI7 A;  4HQE A;  2A5Y B;  3ML6 A;  1U78 A;  2KIF A;  3CUQ A;  1WQ2 A;  4EV0 A;  1T98 A;  1ZAR A;  2ZNY A;  4KIF A;  5ED4 A;  4OU0 A;  2VXZ A;  3KZY A;  5HVQ C;  1E2X A;  4O3M A;  3I53 A;  2HR3 A;  1X3U A;  1O7L A;  2K27 A;  2L4A A;  2YU3 A;  3M8F A;  5FFZ A;  2O0Y A;  3U2R A;  5HLG A;  2ZKZ A;  1YIO A;  3C7J A;  4I2O A;  1LDK B;  3SZP A;  5LLQ A;  1ZRD A;  2O03 A;  1KQ8 A;  4I01 A;  2EV6 A;  5IT9 K;  1F9N A;  1S8N A;  4ESB A;  3IC7 A;  5CLS A;  1UCR A;  2W25 A;  3WTT C;  3IWF A;  5DEQ A;  4M71 A;  1NHA A;  5DCM A;  4MGR A;  1AOY A;  3V7R A;  4L9N A;  5E17 F;  5LHG A;  3FXQ A;  1SAX A;  2RGV A;  4MHG A;  1XDU A;  1DP7 P;  1FYL A;  3KP7 A;  1BOA A;  2IW5 A;  4EJU A;  3HSR A;  5CVV A;  4Q48 A;  5HLH A;  5BPD A;  1P4X A;  2IA2 A;  2L54 A;  1B4A A;  1BBY A;  2DBB A;  4ENK A;  3L00 A;  4HLY A;  3PFI A;  5D6E A;  1D5V A;  3DQV C;  3BY6 A;  1HXD A;  3LAJ A;  1Z6T A;  1QNT A;  3DKW A;  3M1E A;  3NQO A;  2HTS A;  4MQ9 F;  4ZYG A;  4XSZ F;  2HKX A;  4A0X A;  3RYR A;  5HS8 A;  2RNJ A;  2MBF A;  4NQW A;  4EVI A;  1QO0 D;  1J75 A;  3FWE A;  1UB9 A;  2XKP A;  5E1W A;  2DPU A;  5IT9 Z;  2Z3Y A;  1U3E M;  1T2K A;  3TOB A;  2R3S A;  2ZME A;  3M9A A;  5CVJ A;  1KQ0 A;  1FPQ A;  5H6R A;  1L3L A;  3HIF A;  4L0Y B;  2J5P A;  2L4M A;  5AIP A;  1ZYR F;  1W7P B;  3KP3 A;  4S05 A;  4P55 A;  4BHP A;  5EEG A;  1T39 A;  5HDG A;  3EYI A;  2EFO A;  3EYY A;  2WWY A;  1YG2 A;  4HA8 A;  2DK5 A;  2OAZ A;  2A6E F;  2PMU A;  2G9W A;  2EFN A;  3QPH A;  2HKO A;  1FBQ A;  4ENM A;  3VOD A;  4HYE A;  2IA1 A;  1ON1 A;  4I09 A;  1YO5 C;  3GXO A;  1WRJ A;  2P5V A;  3DPT A;  4CIC A;  2JTV A;  2J5O A;  2UXN A;  2JRT A;  1LJ9 A;  2F5D A;  2XVC A;  2FBK A;  2TDX A;  4BHC A;  2MH2 A;  2EWN A;  3DXJ F;  1V3F A;  2E1N A;  4M72 A;  3R6S A;  2YPR A;  2DI3 A;  3CUQ C;  1USS A;  2OBP A;  3FMS A;  4LD5 A;  2VBW A;  2GWR A;  4IRG A;  1MJ9 A;  5L3E A;  1TW2 A;  1T38 A;  2W85 A;  3VB2 A;  1IN8 A;  1IXS B;  1WWX A;  3WE2 A;  3SXY A;  2P4W A;  5ICF A;  2V6C A;  2XUB A;  2QLZ A;  3GEZ A;  2K7L A;  2FSW A;  1S3J A;  5F1R A;  1PP8 F;  2VON A;  2Q8K A;  4ON0 A;  3LST A;  2P6S A;  3ZMZ A;  5D4S A;  2HS5 A;  5D5U B;  4FX4 A;  2CO5 A;  4Z2Y A;  3DEU A;  5TRD A;  5J8C A;  1G6N A;  4IXA A;  1TW3 A;  4ENN A;  3HRM A;  2STW A;  2H6B A;  2EFP A;  3JSO A;  3FF5 A;  3KFW X;  2HQR A;  3Q9S A;  4I02 A;  2A68 F;  3F6O A;  3F21 A;  3KLN A;  2UXX A;  4PZJ A;  5D5X B;  1ZGJ A;  3DF8 A;  1R00 A;  4NB5 A;  4CO8 A;  5FO5 A;  2DQR A;  4FHT A;  3GZ5 A;  1ZG5 A;  2CWE A;  5E1Z B;  3V8L A;  4HDU A;  5ILV A;  4L9J A;  3H3U A;  3KEO A;  1YQA A;  3DFG A;  1FYM A;  2HYF A;  5LEK A;  3ZQ7 A;  1KA8 A;  5ERI A;  2Y48 A;  3FX3 A;  2RC4 A;  3HSE A;  2QUF A;  4KN7 X;  4KYW A;  1ZG3 A;  1JHF A;  2DQL A;  5CVR A;  1QBJ A;  1KYW A;  2JZY A;  4HV6 A;  3ZMT A;  5D5W B;  1IXR C;  3F8M A;  3BPV A;  2A3S A;  4LLN A;  1GXP A;  1YW8 A;  1LDD A;  1R1V A;  1DDN A;  4ZYD A;  3K1P A;  1LDJ A;  1HBX G;  6PAX A;  1ZHF A;  1J2X A;  1E17 A;  1B9N A;  2L3D A;  2QEN A;  1D3Y A;  1YLF A;  4DQ2 A;  1HW5 A;  1Z9C A;  2MA3 A;  1FYK A;  2FBH A;  2HFH A;  4FX0 A;  3AAF A;  3KEQ A;  3LA3 A;  1Z05 A;  3FZV A;  4LLG F;  4BAY A;  2OQG A;  4PCQ A;  3HYI A;  1A04 A;  4HF0 A;  1B9M A;  1SMY F;  4JK1 X;  1G3Y A;  2HZT A;  5DV5 A;  2Z33 A;  4L5I A;  2PEX A;  4E70 A;  1B6A A;  3JW4 A;  4YFK F;  3WGH A;  4WXD A;  2OZU A;  1W5S A;  3LWF A;  3KCC A;  1MDM A;  1HQC A;  3LQQ A;  1K79 A;  2HYG D;  1ZGA A;  1I5Z A;  2DPD A;  3QU3 A;  4ASN A;  5L3G A;  4M6X A;  4MTD A;  1U5T B;  1YTY A;  1HKT A;  4WX9 A;  5LEJ A;  3WGI A;  2IJL A;  1KYZ A;  2JSC A;  5AIQ A;  3GF2 A;  2M45 A;  2STT A;  3GFM A;  4XLP F;  4WXC A;  4Q4Z F;  2DO7 A;  1MJB A;  2D45 A;  4G8X A;  3D0S A;  3IL2 A;  4OIQ F;  4XSX F;  4HZF A;  3I4P A;  3TO7 A;  4A6E A;  1H9G A;  1BIB A;  2VE9 A;  3T8T A;  2XAF A;  3K1N A;  2NNN A;  2PN6 A;  4P9U A;  2HEO A;  2MLG A;  1CF7 A;  3CUQ B;  5DYM A;  2IP2 A;  3R60 A;  1FZP B;  3RYP A;  4RB1 A;  3I58 A;  2B0L A;  4LGW A;  3SQN A;  3L9F A;  3P9C A;  3W6J B;  4UNO A;  4L5J A;  2PQ8 A;  4P5O A;  2Q0O A;  1C0W A;  3QOP A;  4I7H A;  1HST A;  2M5W A;  3WTS C;  2W24 A;  2YX7 A;  4YIF A;  3GFL A;  3TDU C;  5L3F A;  3S2W A;  5J8F A;  4A12 A;  2DAO A;  1XMK A;  3C18 A;  2H94 A;  1S7O A;  2FA5 A;  3TOA A;  3SHF A;  3HRS A;  2VC0 A;  3C1D A;  1K78 A;  2PJP A;  3ZMU A;  1D8K A;  2F2E A;  3E5Q A;  1R23 A;  4CYD A;  2P7V B;  5DCM B;  1XSX A;  1MKM A;  2FRH A;  5LHI A;  4HX4 A;  4WK8 F;  2GXB A;  2EA2 A;  1G4D A;  2OD5 A;  3COA C;  4WWC A;  2RQP A;  1V4R A;  4N9I A;  3CO6 C;  4HX8 A;  2JT1 A;  4GXO A;  3O2P E;  1P4A A;  5E20 A;  4RAZ A;  4HF1 A;  4Y15 A;  3E5X A;  3F22 A;  1J9I A;  1KGS A;  2ISY A;  2P7C B;  4G6D A;  3ZMV A;  2P8T A;  5H6Q A;  3R0J A;  3M8E A;  2HTJ A;  4N9H A;  2K4J A;  2EV0 A;  4LJZ F;  1ONV A;  2DU9 A;  1STZ A;  4HW0 A;  4BH9 A;  2XHK A;  4MTE A;  2EJR A;  1Z7U A;  3VFZ A;  3C3W A;  1FWZ A;  3Q9V A;  4UHT A;  4UVC A;  2O61 A;  3P7N A;  1FOK A;  4L0Z B;  5KVR A;  3WU0 A;  4Y17 A;  3IKV A;  2QZ8 A;  5LGU A;  1FT9 A;  1IRG A;  2ELH A;  4KIG A;  1YS7 A;  1ODD A;  1S7A A;  4UV8 A;  4YG2 F;  5K5R A;  3L09 A;  3JTH A;  4EJV A;  4KIC A;  1IRF A;  4OIO F;  2VOO A;  5BMZ A;  2ZME B;  2LF7 A;  5K5O A;  3M7G A;  1TTY A;  1TQM A;  2RVC A;  3QRF F;  3KZZ A;  3G3Z A;  4RGS A;  4LG0 A;  3H92 A;  3RKX A;  1ZLJ A;  4U7D A;  3BJO A;  3GZ6 A;  1PDN C;  4HOB A;  4PDK A;  4H0E A;  1FBU A;  3HTU A;  2ZO4 A;  4U7B A;  3MCZ A;  3E3V A;  4OIN F;  5DD4 A;  3RTR A;  1U8R A;  3CLO A;  2BGC A;  1B59 A;  4RB3 C;  3WTV C;  3J80 K;  3ABT A;  1GXQ A;  3I59 A;  5JHU A;  3E6M A;  1JXS A;  1XGO A;  1TBX A;  1BC8 C;  5LGN A;  4XBF A;  4A2U A;  1MZB A;  1TNT A;  3DV8 A;  2HGC A;  1HW2 A;  2A07 F;  5FB2 A;  1RUN A;  1P2F A;  5CVU A;  1GVJ A;  4S04 A;  4UXN A;  3I54 A;  4I98 B;  2ACJ A;  1OYI A;  4BYY A;  4A0Z A;  1XGM A;  2CGP A;  3GWZ A;  2CFX A;  4M6Y A;  2FF4 A;  5L3B A;  2PFB A;  2IA0 A;  3F8F A;  3VEP A;  4M73 A;  5TJJ A;  5DD8 A;  5LRR A;  5ICG A;  1G3S A;  2C6Y A;  4AVP A;  1BJA A;  4WCG A;  1FSH A;  3B73 A;  1ZN2 A;  4WXH A;  2W84 A;  5FD6 A;  1R1T A;  2M1B A;  2H6C A;  1ZH5 A;  3J80 Z;  4P96 A;  4A6D A;  2LF8 A;  1LEB A;  1YFH A;  1IW7 F;  1U6G A;  3WTW C;  4UUV A;  3ROU A;  1O3T A;  1BI1 A;  1R1U A;  2LDU A;  2ZFW A;  2FNP A;  5HOO A;  1W5T A;  1EH8 A;  3T1B A;  4YFX F;  2V1U A;  1XMA A;  2QBY A;  3V8K A;  1OR7 A;  4RGR A;  2MH9 A;  4Q47 A;  1YW7 A;  1BI3 A;  1DPR A;  1Y0U A;  1SFE A;  3RI4 A;  5HS7 A;  4P9F A;  3CUO A;  3WG9 A;  1ZRF A;  4EM1 A;  2Z9O A;  2XAS A;  1XSV A;  1S6L A;  2ESN A;  1CGP A;  3F3X A;  4G94 A;  3FHZ A;  2FOK A;  4AIK A;  4IF4 A;  2L01 A;  2QVO A;  4RB0 A;  3IRQ A;  2R7F A;  3KET A;  3TGN A;  5LRS A;  1ZRC A;  4GYI A;  1B1B A;  5HLI A;  3HRT A;  5A2Q K;  1OYY A;  1J0R A;  5CYV A;  2XV4 S;  2ZJ2 A;  2XAQ A;  2FBI A;  4LK1 F;  3N97 A;  4CGZ A;  3EUH A;  4A0Y A;  3GVA A;  4MNU A;  3RPQ A;  1K7A A;  1IN4 A;  4IHT A;  3D5L A;  4LFU A;  1SD6 A;  1P4W A;  1IAW A;  4TV7 A;  3GW2 A;  4JQF A;  4PGH A;  3BJ6 A;  2WC2 A;  1I6X A;  2F5E A;  2O8X A;  4HX7 A;  3HRU A;  4L9T A;  1HSJ A;  1HKS A;  2X4H A;  4BQA A;  2YR2 A;  4M9X A;  3DP7 A;  4OIR F;  3TQN A;  2R7D A;  3MAJ A;  1MDM B;  2E7X A;  1LQ1 A;  5LHH A;  3GFJ A;  1D8J A;  1IF1 A;  1UHM A;  4CZZ A;  3TO6 A;  3L2C A;  1JE8 A;  3W6K B;  4RB2 C;  3MZH A;  4LB5 A;  4HV5 A;  1BC7 C;  4MEX F;  4KA4 A;  2V79 A;  1Z1D A;  2CYY A;  5A2Q Z;  3EDP A;  2KJB A;  2HQN A;  1QPM A;  4EMS A;  1YW9 A;  2NYX A;  3WTY C;  4B8X A;  1IN6 A;  3ZMD A;  2FEZ A;  2Y0M A;  1OPC A;  5E18 F;  5D8K B;  2XRO A;  1O3S A;  2IRF G;  3KP5 A;  2GIV A;  3H3Z A;  3JAM K;  1JGS A;  3CTA A;  3MWM A;  2Q2E A;  4PGG A;  1ZG1 A;  1CF7 B;  2BV6 A;  2EFQ A;  1Z91 A;  5DDG A;  2DT5 A;  5F64 A;  2OU2 A;  4BNC A;  2ETH A;  1ON2 A;  3K69 A;  5HDK A;  3DPL C;  1WKM A;  1XN7 A;  5DUK A;  2E7W A;  2KIM A;  3QU6 A;  3GUD A;  5ILS A;  2K4B A;  1JHH A;  3ECH A;  2D1V A;  3T5X A;  5L3C A;  3EET A;  3RKW A;  2CW0 F;  1O7F A;  3HOT A;  2DFI A;  2XKO A;  3TO9 A;  1R7J A;  1KU3 A;  1F1Z A;  4KMU X;  2F5C A;  1I1S A;  1I1G A;  5K5Q A;  2XIG A;  1K78 B;  1QQI A;  2MLK A;  1J59 A;  3K9T A;  1QZY A;  1U5T A;  4G7H F; 
#chains in the Genus database with same CATH topology
 4HNV A;  2M8E A;  1IN7 A;  2F6C A;  2B63 J;  2DMT A;  2GIZ A;  1KON A;  3V4G A;  2R7Q A;  1WHU A;  2V9K A;  3ULQ B;  2QSG X;  1VZ0 A;  4RAY A;  3RIR A;  4G9Y A;  4YEJ A;  1VFC A;  4A3B J;  3H9G A;  5E3L A;  2V9V A;  3F0C A;  3OSG A;  2DW4 A;  4JX6 A;  1KZH A;  4A5N A;  4IOA F;  2KIU A;  3K1M A;  2NOJ B;  3JAM Z;  3WTZ A;  2P5K A;  2QF7 A;  1YYV A;  4U88 A;  1Y6I A;  2CUF A;  2ECB A;  2KRH A;  1QVU A;  2JWT A;  1QPI A;  5CJ9 A;  3JTG A;  3MKL A;  3I64 A;  4R1H A;  1BI0 A;  4AD9 A;  2QQB A;  2GA1 A;  3CP8 A;  3EUH C;  2DXI A;  4NC7 A;  1FBS A;  1FP1 D;  2IPQ X;  4FIS A;  4EGY A;  2AS5 F;  2L02 A;  3QAH A;  1W4M A;  1NK3 P;  1G3W A;  3FIW A;  3U21 A;  1UFM A;  4HF2 A;  2QKL B;  2EB7 A;  2VPR A;  4Q5S F;  4GYG A;  1FSE A;  2LOO A;  3F23 A;  4DYC A;  1H89 C;  4LK0 F;  1ZQ3 P;  4E7J A;  5TGT A;  2HDC A;  1KQ9 A;  1UEL B;  3BCB A;  4D5F A;  4N4O B;  1MW7 A;  1MNM C;  4DNC A;  2XAJ A;  4GDF A;  3ONQ A;  5FLM J;  3V7C A;  2E1M B;  3ZQG A;  2W4S A;  3GFI A;  2VOD A;  3OSF A;  1OFC X;  2L7M P;  2HU9 A;  4IRI A;  3LQR A;  2PMH A;  4IHW A;  1F5T A;  3D5R C;  4UVA A;  1FC3 A;  2XSJ C;  5CVI A;  3TED A;  3QP5 A;  5B1A H;  1HLV A;  4A3G J;  2HWV A;  4OMZ A;  3G73 A;  3H0D A;  1YIJ I;  2IT0 A;  1JKR C;  4UY8 I;  4RGX A;  3ABK H;  1XS9 A;  5DTD A;  1EA3 A;  1IN5 A;  2N8G A;  2ME6 A;  2MD5 A;  3HL2 A;  2ESH A;  3MQ0 A;  4N0B A;  1H8A C;  3QPL A;  4PSW A;  3DTK A;  4CCL A;  1TQI A;  3OOP A;  1OMI A;  4KNY A;  2Y9Y A;  1XGN A;  3J81 K;  2R5Y A;  3BQZ A;  4M3E A;  2K86 A;  1EH6 A;  3PSF A;  3WE3 A;  5LFA A;  4LG0 B;  4C2U A;  1DPU A;  5FFX A;  2HOE A;  4XLN F;  4I0B A;  1XSD A;  2BEO A;  3BJA A;  3V8J A;  3GYH X;  3ERE D;  4F3Q A;  2IVM A;  4IPA A;  4NBQ A;  3EQL F;  1S7E A;  2DMU A;  2CUE A;  2ADU A;  5JFR A;  3JRC A;  1P6R A;  1R5I D;  2DDB A;  2F5F A;  2KIQ A;  1PUE E;  1MSF C;  3JSP A;  3RZO J;  4F55 A;  1R58 A;  3P9I A;  3I71 A;  1ENH A;  2XF7 A;  1WJA A;  4NQW B;  1R49 A;  3KYL A;  2PI0 A;  4ZH4 F;  2VT3 A;  1J7K A;  3B6A A;  2HVS A;  1FNN A;  4ZYH A;  2Y0S A;  2YX4 A;  4G7Z F;  1JUM A;  3HHH A;  2LTP A;  3LL7 A;  4EGZ A;  4FE7 A;  2WTE A;  3PNY A;  5D5V B;  3QQA A;  4YRV A;  5HDN A;  3CJN A;  9ANT A;  4UV9 A;  2WA0 A;  1J09 A;  1XD7 A;  5BS6 A;  1SD7 A;  3U1K A;  2MD0 A;  2WV1 A;  4YFN F;  4ESJ A;  5F0F A;  3F8C A;  3IHU A;  4KDP A;  3ZN0 A;  1OYW A;  2AXL A;  2FML A;  3I59 B;  4XKC A;  4A5M A;  1XCV A;  1IXC A;  2CQX A;  2H09 A;  3KP6 A;  1TQP A;  2A69 F;  1TT0 A;  4OOI A;  1TLH B;  1MBH A;  3UR3 C;  2XGE A;  2LSO A;  1R4N B;  3LA7 A;  5F27 A;  1MBG A;  1I27 A;  5E79 C;  5IP9 J;  5GAH J;  1ETQ A;  2VT2 A;  4JBA A;  2GA2 A;  2XPV A;  3WTU C;  4HDV A;  3REO A;  1MGT A;  2JUC A;  1WSU A;  3IWZ A;  2H1L A;  1SC7 A;  2X6X A;  2O9L A;  2QCO A;  4EM2 A;  2BY2 A;  5IYD J;  1R22 A;  1FOW A;  1YE9 A;  2AXT C;  4IKF A;  3S1M J;  3U9G A;  3F8B A;  4LG3 A;  1OCP A;  2M87 A;  2Y0S N;  1T0F A;  5J4V A;  3FXR A;  2FU4 A;  2EQR A;  3LFK A;  1H0M A;  3N4M A;  4B47 A;  1Y0N A;  2Z2S B;  2QWW A;  3HGY A;  3CCS I;  3BZK A;  1RPW A;  5L3D A;  1H88 C;  3S2H J;  3FM5 A;  3KP4 A;  3VOE A;  4OMY A;  1RZ4 A;  1KU7 A;  3HOZ J;  3R0A A;  4G6T B;  3KPH A;  3J81 Z;  2VOP A;  1BW5 A;  2RKH A;  4YII A;  1I3Q J;  5C4X J;  3CJQ B;  4IQ4 A;  4II2 A;  2NRA C;  2VBZ A;  1S29 A;  5KCM A;  1KU2 A;  4IVN A;  3PO3 J;  4BL0 B;  3CMM A;  2LKP A;  1L0O C;  4E7S A;  3QOE A;  5D6F A;  2UZK A;  3W2W A;  1LB2 A;  4ZJZ A;  2WAF A;  2QQ9 A;  3UKG A;  4U0Y A;  2BHZ A;  3W3C A;  5KK1 A;  5C4J J;  1VQN I;  4ESF A;  4J19 A;  1R71 A;  4IOC F;  1O3Q A;  1BA5 A;  2BVM A;  2VBY A;  2UWM A;  3BCA A;  4CHU A;  3WOD F;  3D1N I;  3CDH A;  1U5T C;  2V1D A;  1YHQ I;  3E6D A;  3LSI A;  2CQK A;  3MVP A;  2Y30 A;  2AO9 A;  3BPX A;  2MG4 A;  2FOW A;  1NK2 P;  2H27 A;  3CCE I;  3F72 A;  5JHF A;  2GAU A;  4O6J A;  3I9V 2;  1Z3Y A;  5D4R A;  3K4N A;  2PBI A;  1LFP A;  2OQR A;  3Q0U A;  3GLX A;  1T6S A;  2CRG A;  1K61 A;  1BIA A;  1O3R A;  5E8I A;  3J7A O;  1R5H A;  2PMZ A;  3IRR A;  3L2U A;  1UST A;  2VLA A;  4LIU A;  2XAG A;  3OYH A;  2XRN A;  1D1C A;  2Y2Z A;  3BG6 A;  1WJF A;  4P1W A;  4AIJ A;  2HQA A;  5JI6 A;  2FMY A;  3ZR8 X;  2QBY B;  4ZYE A;  3O6B B;  2XF6 A;  1MJA A;  3PQJ A;  2RDP A;  4V2G A;  2KHM A;  5FLX K;  1BM9 A;  4KIB A;  5EZH A;  3SFZ A;  2R7U A;  1W7P A;  1X19 A;  4MEY F;  2EA4 A;  1IZ1 A;  2EFW A;  3OMY A;  1XCB A;  4XK4 A;  2P6T A;  4LB6 B;  1VF9 A;  3U1D A;  3PNT A;  4A3C J;  2OF7 A;  3TDZ C;  4XID A;  1X4P A;  3BG7 A;  3KEY A;  2X0L A;  3CQZ J;  3A0H C;  4F7Z A;  4ZZD A;  3HSF A;  4EJO A;  2O7O A;  4BJT A;  1UHS A;  1X2M A;  2I8D A;  3HGG A;  2ZCW A;  2LBF A;  5IOY A;  1DGW Y;  2E71 A;  3CCY A;  3IKT A;  4M3B A;  1IJW C;  3W6V A;  4EJT A;  1HDP A;  4RGU A;  2IBD A;  2W00 A;  4MO7 A;  4HPQ A;  2MC3 A;  3FBN B;  2IGM A;  4BXU A;  4BDY A;  4CDG A;  2VC1 A;  1W7P D;  5HLT A;  1RUO A;  1YRN B;  2E1C A;  2QM3 A;  2DT6 A;  3BR2 A;  5IP6 A;  5DCF A;  1Q1H A;  1SD5 A;  2ZBK A;  1Y39 A;  1RC9 A;  2E34 A;  2MFZ A;  3CDL A;  2GZW A;  2LNB A;  3KLO A;  3BG9 A;  5LBQ A;  1B72 A;  2M0M A;  4Y52 J;  1SAU A;  3BQY A;  3S3M A;  4O5V A;  4BY7 J;  2OA4 A;  1ULY A;  2CG4 A;  2DLL A;  2OCE A;  3E97 A;  5E8G A;  2K9M A;  3X2Q H;  2VKD A;  3ZMS A;  1IUF A;  2JPB A;  5BQT A;  5HOD A;  2YSR A;  1BJZ A;  2VJ4 A;  5ICC A;  2Z5U A;  4CYC A;  2D1H A;  2H1K A;  1QGP A;  3LSK A;  1EH7 A;  1U9O A;  3K2Z A;  2NS0 A;  3NRV A;  4J01 A;  3Q0W A;  3KE2 A;  2LFB A;  3FK7 A;  3FMQ A;  1V5F A;  1VTN C;  4OAZ A;  1JJ6 C;  4UVB A;  2CU7 A;  1HW1 A;  4LIT A;  1SD4 A;  4LLL A;  4IJA A;  3LAP A;  5FD5 A;  4LMY A;  3L2V A;  4M74 A;  2ZXJ A;  3R4K A;  3MFK A;  1FTT A;  3RCO A;  5BOX A;  4XMY A;  1V55 H;  5FLX Z;  3J7Z I;  4XOT A;  3TKY A;  4ZTJ A;  1I6H J;  2KP6 A;  3OYK A;  3DEW A;  3T8R A;  3HB9 A;  4PJN A;  3RJP A;  3QP6 A;  2A6T A;  1LEA A;  3FM3 A;  3QYB A;  4IRH A;  4QPQ A;  5ICE A;  2K9Q A;  2WB1 A;  2KMU A;  4ZDP A;  1T08 B;  3ERM A;  3GO5 A;  3K6G A;  4J00 A;  3PUF A;  1FOX A;  1B8I A;  3DCF A;  1VQ6 I;  3LSP A;  5D8L B;  5C3E J;  3BZ6 A;  4XR6 A;  3G2B A;  1WI9 A;  3P9K A;  3OY9 A;  3I0T A;  4ABZ A;  2HYJ A;  4KN4 X;  1R36 A;  4BHB A;  4RM2 A;  3RDI A;  3DWL E;  5B1B H;  2IS1 A;  2FE3 A;  5FKK A;  3ECO A;  4AWX B;  4L5E A;  1W36 C;  3LNQ A;  4M9Z A;  5B66 C;  3SDB A;  1JT0 A;  4IZZ A;  3HTS B;  3LA2 A;  5F1J A;  2F4O B;  1T0F C;  4E6K G;  4S0H B;  3CF5 F;  4KMF A;  3R61 A;  4MIM A;  2VB6 A;  2VL8 A;  3S15 J;  2GQQ A;  4BE0 A;  4X0G A;  1N77 A;  2DOD A;  4FCY A;  2R93 J;  1FP2 A;  1FY7 A;  3HEF A;  1X1A A;  3CC4 I;  2QQA A;  1XPX A;  2FNA A;  2OTL I;  3VYU B;  4IX7 A;  2KLO A;  4HAM A;  2A61 A;  4QWQ A;  4EQQ A;  1BI2 A;  1OLT A;  1Z21 A;  2BBY A;  2Y75 A;  3CMY A;  2WB1 N;  1Z67 A;  2CV2 A;  1DUX C;  4UUS B;  1E3P A;  5HS9 A;  2EK5 A;  2W57 A;  4I0A A;  4W1U A;  2FXA A;  2O3F A;  3WTX C;  1J5Y A;  2QA4 I;  3OV8 A;  2ISZ A;  4M3G A;  4OIP F;  2L5Q A;  5EYR A;  3ZP5 A;  1AKH B;  5E1X A;  3W2A A;  2CW7 A;  3T0Y A;  2P0W A;  1BL0 A;  2HVQ A;  5GAE J;  3E7L A;  2RV8 A;  2VN2 A;  1I39 A;  1R6R A;  4XLA A;  1QZZ A;  2BVL A;  1EV7 A;  2G7H A;  4IQJ A;  3BT9 A;  2Q2E B;  4K2E A;  1XGS A;  3LSM A;  3E6C C;  2K02 A;  2R0Q C;  3CO7 C;  1IDZ A;  3FIS A;  3V7S A;  3QPT A;  3FHN A;  3DEE A;  3DTE A;  2L9N A;  2NAZ A;  1G3T A;  2HQ5 A;  2DTR A;  1ZAO A;  4M9S A;  1TNS A;  3L7W A;  3K4C A;  1P92 A;  1H9T A;  5ILU A;  2B9S A;  2KRF A;  2XAH A;  5AON A;  2O6G E;  1SVM A;  2CJJ A;  2K9L A;  5E3N A;  1ETX A;  3ZXS A;  1O57 A;  3FXK A;  4G7O F;  1IG7 A;  1HKQ A;  5JR3 A;  3GX4 X;  3F6V A;  3HC7 A;  3BDD A;  5JVT A;  4NDL A;  2ZNZ A;  5E3O A;  3HUG A;  1Y8R B;  1AWC A;  1PP7 U;  4XRF A;  3ZQH A;  4L9V A;  4FQG A;  2L7F P;  4D0P A;  4BGD A;  2FQ3 A;  3PJR A;  2X6W A;  2BYV E;  1RNL A;  3E5U A;  1MD0 A;  1MMN A;  4HBL A;  2KDO A;  2VBX A;  4WF2 A;  2P5L C;  4EM0 B;  4NC8 A;  2P81 A;  3PQK A;  5IT3 A;  2JPC A;  3ZQF A;  4KT5 C;  2VIX A;  2VJ5 A;  1RRJ A;  3GTK J;  2A05 A;  1IRX A;  3K0L A;  1ETV A;  5F6F A;  4HQM A;  3DBR B;  3ABU A;  3VYT B;  2G7U A;  2VQH A;  4MQV A;  5FGM A;  5BPI A;  3ZPL A;  2PX9 A;  4LIV A;  4KUM A;  4AIH A;  2VE8 A;  4HLX A;  2DK8 A;  3KZI C;  1BN5 A;  3AKZ A;  3BP8 A;  2Z99 A;  1E3H A;  2A6H F;  3E6B A;  4GO1 A;  1RIO H;  1KU9 A;  1XDS A;  1X1P A;  1FLI A;  5LGT A;  1IO2 A;  3WU1 B;  3O8G A;  2HVR A;  2CSO A;  4KFC A;  1WH7 A;  1UHW A;  2ZSH B;  3ZQQ A;  2BY3 A;  3H5A A;  4HNT A;  1VQP I;  4DYQ A;  3P5J A;  2R7X A;  3MZY A;  4IHS A;  2RN7 A;  2EIN H;  3Q0V A;  1R5G A;  3SZT A;  4JP0 A;  4Y4R A;  1WJ5 A;  4PFO A;  2LYC A;  4ENJ A;  2OZ6 A;  2MW8 A;  3ZQC A;  1MMS A;  2KJC A;  2ME0 A;  3GBG A;  5J3L A;  3GTJ J;  1U2W A;  2D2W A;  5J1U A;  1IUY A;  1YS6 A;  2XGX A;  4R79 A;  3NEU A;  1LNW A;  3PO2 J;  4RS8 A;  4B09 A;  4ZZL A;  2VPL A;  2DN0 A;  2GXG A;  2Y31 A;  5DUI A;  3G71 I;  3G1L A;  2PG4 A;  3FXU A;  2XDV A;  3VPR A;  2O5R A;  4EJW A;  1F4K A;  1T56 A;  3WGG A;  2L9S A;  1SMT A;  4BQN A;  3S3N A;  3L2R A;  1R4M B;  1K6O A;  2PLY A;  3ZN1 A;  2V1X A;  4E7Z A;  4M3D A;  1AA7 A;  5J6X A;  4QTR A;  3F8N A;  3I4N J;  2E5Z A;  1Z6R A;  3BRO A;  4ETS A;  2OUM A;  3O8H A;  1N75 A;  3I5U A;  4BBR J;  4CXF A;  3S17 J;  2F5V A;  1ZRE A;  3ZCO A;  1SFX A;  2Y69 H;  5HNH A;  3KP2 A;  4R8H A;  4U0W A;  1ZKG A;  3VDX A;  5J1R A;  1XB4 A;  3O3K A;  4L18 B;  1SFU A;  2COM A;  4B3X A;  1UG2 A;  3L2Q A;  2BW3 A;  2YS9 A;  4CCK A;  2M30 A;  1FMV A;  3RPU A;  1OKR A;  3BR0 A;  4A93 J;  3Q5F A;  2DFF A;  4XLH A;  4Y13 A;  1WJB A;  4B1R A;  1UZC A;  1OCR H;  3HHG A;  2M9H A;  2L9V A;  5K1Y A;  5EGO A;  3SEZ A;  3HOS A;  1ZLK A;  1G2H A;  1GHC A;  1V5G A;  3E0J B;  4DBQ A;  3ZRG A;  3RKY A;  5H20 A;  2DJI A;  4GGG A;  2WV0 A;  3FKJ A;  5EEH A;  1FX7 A;  2KKO A;  1REP C;  4U0V A;  3ISP A;  2ZXI A;  3FMR A;  4FT8 A;  4GCV A;  3BWG A;  2RQQ A;  3ELK A;  3BOQ A;  2BE5 F;  1LVA A;  3HXL A;  3MEX A;  4AID A;  4CSW A;  1DU0 A;  2LP0 A;  4F92 B;  2R5Y B;  4NHJ A;  2DFH A;  3GCM A;  4G6Q A;  2QYO A;  4LOC A;  2EV5 A;  4QLC U;  2NNY A;  3B02 A;  3H0G J;  1RI7 A;  1S5L C;  2A5Y B;  4HQE A;  3S3O A;  4B44 A;  4ANJ A;  2K3P A;  3TMO A;  3ML6 A;  1U78 A;  3BTJ A;  2KIF A;  3CUQ A;  1WQ2 A;  4EV0 A;  3LFU A;  3OL3 A;  1K4T A;  1T98 A;  1ZAR A;  2ZNY A;  4KIF A;  1D5Y A;  4RLQ A;  1NG6 A;  5ED4 A;  2LK2 A;  1WI3 A;  1K4S A;  2RAE A;  3B6C A;  1X1B A;  3OR2 C;  4OU0 A;  2VXZ A;  3KZY A;  5HVQ C;  1DU6 A;  1E2X A;  4O3M A;  1AHD P;  3I53 A;  2KZV A;  2HR3 A;  1OCZ H;  1X3U A;  1O7L A;  2K27 A;  2L4A A;  2R7O A;  3CJR B;  1JKP C;  2YU3 A;  1ACI A;  1W5C C;  3M8F A;  5FFZ A;  3HOU J;  3HOY J;  2LG4 A;  2O0Y A;  3U2R A;  4RAG A;  4N4N B;  2ZKZ A;  5HLG A;  2CV0 A;  1YIO A;  2XRL A;  1HF0 A;  2X85 A;  5GAG J;  3C7J A;  4I2O A;  3PNV A;  1LDK B;  3SZP A;  5LLQ A;  2R7R A;  1ZRD A;  1OIS A;  3OYI A;  2O03 A;  3W2V A;  1KQ8 A;  4I01 A;  2EV6 A;  5F0H A;  2Z16 A;  1IDY A;  2ZJR F;  5IT9 K;  2LKS A;  1F9N A;  4U87 A;  2JA5 J;  1Y1V J;  2CQN A;  2OJE D;  1S8N A;  4ESB A;  1Y56 A;  3IC7 A;  5CLS A;  1U0J A;  1UCR A;  2W25 A;  1MIJ A;  3WTT C;  3ESW B;  3IWF A;  5DEQ A;  4M71 A;  5H2F C;  3HG9 A;  2DA3 A;  1NHA A;  5DCM A;  4B4C A;  4F93 B;  1F43 A;  4MGR A;  1AOY A;  4CA0 A;  3V7R A;  2LD5 A;  3RSN A;  3CD6 I;  1D0X A;  4L9N A;  5E17 F;  3GME A;  3LSH A;  5LHG A;  3FXQ A;  1SAX A;  2MC4 A;  2RGV A;  4OWR B;  3OYC A;  3HPH A;  4MHG A;  1CQT A;  1XDU A;  1DP7 P;  1FYL A;  3KP7 A;  1BOA A;  2IW5 A;  4EJU A;  3HSR A;  5CVV A;  4Q48 A;  5HLH A;  2HNH A;  4PJJ A;  2KFD A;  3DLL F;  5K7F A;  3K10 A;  2DTZ A;  5BPD A;  1P4X A;  2WY7 Q;  3GTP J;  2IA2 A;  1RES A;  2L54 A;  4UB8 C;  4BEH A;  1B4A A;  1ZGW A;  5GPA A;  1BBY A;  2DBB A;  5EJC A;  3L00 A;  4HLY A;  4ENK A;  3N05 A;  3PFI A;  5M5X J;  4MFE A;  1SFK A;  5D6E A;  4BY1 J;  1D5V A;  3DQV C;  3BY6 A;  3FKI J;  1RET A;  1HXD A;  3CCU I;  4E7L A;  2NVQ J;  2AHQ A;  2VJI A;  1VND A;  3A1Y A;  3K4J A;  1ZR2 A;  3LAJ A;  1Z6T A;  4BAC A;  5FKO A;  2M3A A;  1QNT A;  3DKW A;  3M1E A;  3KX2 A;  2V4J C;  3NQO A;  2HDD A;  1FOY A;  2HTS A;  4MQ9 F;  4ZYG A;  3ABL H;  2R7W A;  4XSZ F;  2HKX A;  4A0X A;  2R7Z J;  3RYR A;  5TIS C;  1UG0 A;  4F91 B;  5HS8 A;  2E19 A;  2RNJ A;  5GP9 A;  1QRY A;  4OAY A;  2MBF A;  4NQW A;  4EVI A;  1QO0 D;  3LMM A;  5CPR B;  2CUJ A;  1J75 A;  5J4Y A;  3FWE A;  3JRA A;  1UB9 A;  1ETK A;  2JVH A;  2XKP A;  5E1W A;  1W36 D;  2DPU A;  2Z3Y A;  5IT9 Z;  1U3E M;  1T2K A;  2HOT A;  3TOB A;  3CCJ I;  2R3S A;  5EZG A;  1WZ2 A;  2ZME A;  4E7I A;  4XOR A;  3PUB A;  3M9A A;  1ETO A;  5CVJ A;  3TW6 A;  1Z3X A;  3VSK A;  3JRF A;  2BHY A;  2M7A A;  1KQ0 A;  1FPQ A;  5H6R A;  4BKX A;  1U8B A;  1L3L A;  3HIF A;  3HBL A;  4L0Y B;  2J5P A;  3GTQ J;  3A01 A;  3CCM I;  4BU2 A;  2L4M A;  5AIP A;  1ZYR F;  2QEX I;  1W7P B;  4HNU A;  2WAE A;  3KP3 A;  4A3E J;  4S05 A;  4P55 A;  4E7K A;  4BHP A;  5EEG A;  4BQQ A;  1T39 A;  2LC2 A;  2HOS A;  5HDG A;  3EYI A;  4D5C A;  2EFO A;  2CH0 A;  3EYY A;  2WWY A;  1YG2 A;  4HA8 A;  1MH4 A;  2KL4 A;  2DK5 A;  2OAZ A;  4G12 A;  5EG0 B;  1LFB A;  3M07 A;  2A6E F;  2PMU A;  2G9W A;  2XAU A;  2EFN A;  2QSF X;  3NWS A;  3KYC B;  3QPH A;  3PIP F;  2HKO A;  2LBF B;  1VQ8 I;  3SEQ A;  1PYV A;  1FBQ A;  2UV1 A;  3I56 I;  4ENM A;  3VOD A;  4HYE A;  4CCO A;  2IA1 A;  1ON1 A;  2DA4 A;  2XPW A;  4I09 A;  4YEL A;  1YO5 C;  3GXO A;  2X1C A;  2IS6 A;  3C2G A;  4ITV A;  1WRJ A;  2E5N A;  1D1A A;  2MGQ A;  2P5V A;  4HEA 2;  3FXM A;  1G8X A;  4XRS A;  3DPT A;  1X1C A;  4CIC A;  2JTV A;  1EF4 A;  3CCV I;  1A6I A;  2J5O A;  3OIP A;  2UXN A;  2JRT A;  1LJ9 A;  2F5D A;  2XVC A;  3QYF A;  3A03 A;  1UJ8 A;  1X3Z B;  2FBK A;  1YX3 A;  2TDX A;  4BHC A;  4XIC A;  4H4K C;  3PSI A;  2MH2 A;  2EWN A;  1P7J A;  1YX5 A;  3DXJ F;  1ZR4 A;  1B72 B;  1W0T A;  5JVG F;  1V3F A;  2E1N A;  2IGN A;  4M72 A;  3R6S A;  2YPR A;  3H35 A;  2GOM A;  2DI3 A;  3CUQ C;  4QIW N;  4CYC B;  1USS A;  3C2B A;  5IYC J;  2MYS A;  1BW6 A;  2OBP A;  3FMS A;  2R5Z A;  4LD5 A;  2VBW A;  2GWR A;  3HZJ A;  4IRG A;  1Q1V A;  1MJ9 A;  2NS8 A;  3CJT B;  5L3E A;  3CCQ I;  1TW2 A;  1T38 A;  5GTI C;  2ID6 A;  4Y3O A;  2W85 A;  3OYA A;  1WJC A;  3VB2 A;  2TCT A;  1IN8 A;  1IXS B;  2DDA A;  1WWX A;  3WE2 A;  3SXY A;  2P4W A;  4BJ5 C;  5ICF A;  2V6C A;  4FET A;  2XUB A;  1OQY A;  2IXS A;  4KT6 A;  1IGN A;  3DU5 A;  1R9T J;  2QLZ A;  3GEZ A;  2LY9 A;  3E1S A;  2K7L A;  5FRM A;  2KDZ A;  2FSW A;  3QPS A;  1S3J A;  5F1R A;  1PP8 F;  2VON A;  3K70 D;  2X51 A;  2Q8K A;  4ON0 A;  3LST A;  2P6S A;  3ZMZ A;  5D4S A;  2HS5 A;  2Y9Z A;  5D5U B;  4FX4 A;  3OL4 A;  2VKV A;  1B8I B;  2CO5 A;  2LMD A;  3HKZ N;  2M4G A;  4Z2Y A;  5B5E C;  1Y1W J;  3DEU A;  5TRD A;  2B7E A;  3IH4 A;  3OWT A;  3OYG A;  5J8C A;  1G6N A;  1XG1 A;  3H5N A;  1SEU A;  1JUP A;  4IXA A;  1IV8 A;  3GZN B;  1TW3 A;  2ICW G;  3OYN A;  3JRD A;  4ENN A;  1JJ8 C;  3HRM A;  2X6Y A;  3AFH A;  4M6V A;  2STW A;  2H6B A;  4NNJ A;  4XKV A;  1P9Q C;  2EFP A;  3MD2 A;  3JSO A;  3FF5 A;  2E1M C;  3KFW X;  1VQ5 I;  2HQR A;  3Q9S A;  2YUS A;  4I02 A;  2A68 F;  3F6O A;  3F21 A;  3KLN A;  2UXX A;  2ZC2 A;  4PZJ A;  4E4H A;  3OYL A;  2EZL A;  4XN3 A;  5D5X B;  1ZGJ A;  3G4S I;  3FK6 A;  3DF8 A;  5IPA A;  2KT0 A;  4D1Q A;  1R00 A;  2LLK A;  4I99 C;  2Z1D A;  4NB5 A;  4CO8 A;  5FO5 A;  2JA8 J;  2VUM J;  1TWG J;  1N78 A;  2DQR A;  4FHT A;  4IEJ A;  4Z6Y A;  1MSE C;  4GRI A;  3GZ5 A;  1ZG5 A;  1HA8 A;  3V42 A;  2CWE A;  5E1Z B;  1XC5 A;  3V8L A;  2OTJ I;  4HSR A;  4HDU A;  5ILV A;  4L9J A;  2EZI A;  1ITY A;  3BR1 A;  3H3U A;  2GOX B;  3BLY A;  1TC3 C;  3KEO A;  1YQA A;  3DFG A;  1FYM A;  2HPI A;  2HYF A;  5LEK A;  1SVL A;  3OIQ A;  3LSJ A;  3BZC A;  3VYS B;  1ZTR A;  3NAU A;  3ZQ7 A;  5FRN A;  1KA8 A;  5ERI A;  2HOA A;  2Y48 A;  3FX3 A;  1IRZ A;  2RC4 A;  3HSE A;  2QUF A;  4KN7 X;  4KYW A;  1ZG3 A;  1JHF A;  4CCJ A;  2DQL A;  5CVR A;  3PM1 A;  1N25 A;  2F48 A;  1QBJ A;  5IP7 J;  1KYW A;  5E3M A;  3OYF A;  2JZY A;  1ETY A;  4HV6 A;  3ZMT A;  2L0K A;  2R92 J;  5D5W B;  2JSP A;  2JK3 A;  3PFY A;  2H8W A;  1IXR C;  2EH3 A;  3F8M A;  3BPV A;  4IL6 C;  4A3D J;  3DU6 A;  2A3S A;  4LLN A;  3S2D J;  2KQR A;  1GXP A;  1GV5 A;  1OCC H;  1YW8 A;  2QSH X;  1PUF A;  1LDD A;  1R1V A;  2CS3 A;  2ZME C;  3L1P A;  1DDN A;  4ZYD A;  3K1P A;  1LDJ A;  3GTL J;  1HBX G;  3HUG B;  6PAX A;  1ZHF A;  2G0E A;  1FTZ A;  4GFB A;  1J2X A;  4II3 A;  1E17 A;  3NWT A;  4XKW A;  2FUG 2;  1B9N A;  2E35 A;  2L3D A;  2NOG A;  5F08 A;  1MNE A;  2QEN A;  2X6O A;  3H9J A;  2ID3 A;  1D3Y A;  2COB A;  1YLF A;  4DW6 A;  4DQ2 A;  5GPC A;  1HW5 A;  2JUG A;  1Z9C A;  2MA3 A;  2V1N A;  2LY2 A;  2PJR A;  1FYK A;  4NC6 A;  2FBH A;  3BR5 A;  1P7I A;  3C2H A;  3CC2 I;  2HFH A;  4AYB N;  2MSY A;  4FX0 A;  3AAF A;  2K5C A;  5K7Z A;  3KEQ A;  1SVO A;  3LA3 A;  3MZ8 A;  1Z05 A;  3FZV A;  4LLG F;  4BAY A;  3I4M J;  2DOA A;  3TBI A;  2OQG A;  4PCQ A;  3MMY B;  3HYI A;  1A04 A;  3S93 A;  5C44 J;  1XMX A;  1TWA J;  1TT5 B;  4HF0 A;  1B9M A;  1Z77 A;  1SMY F;  2L7Z A;  4JK1 X;  1G3Y A;  2HZT A;  3DBH B;  5DV5 A;  3EUK L;  2OV7 A;  4PJL A;  5KHD A;  2Z33 A;  4L5I A;  2PEX A;  4E70 A;  1B6A A;  3OOU A;  2JJ7 A;  5KAI C;  3EUA A;  3L2W A;  2CFO A;  1D1B A;  3JW4 A;  4YFK F;  5KAF C;  3WGH A;  4WXD A;  2OZU A;  4EAT A;  1W5S A;  3LWF A;  4F52 A;  3HOW J;  2GBY A;  3KCC A;  1OCO H;  1MDM A;  1HQC A;  3SYT A;  2FX0 A;  3LQQ A;  1G59 A;  1JT6 A;  3QWL A;  1K79 A;  2DFE A;  3K70 C;  1JI8 A;  4V2F A;  2HYG D;  4XRS G;  1ZGA A;  2VQC A;  2DCE A;  2DOF A;  1I5Z A;  2DPD A;  1K6Y A;  3QU3 A;  4ASN A;  5L3G A;  3S14 J;  4X1E A;  2V26 A;  4M6X A;  2BOL A;  4MTD A;  1U5T B;  4RA2 A;  4A3M J;  1HOM A;  3KYD B;  1GT0 C;  5DS9 A;  2DJN A;  1PJR A;  1YTY A;  4D7N A;  1UMQ A;  2I10 A;  1HKT A;  2CW8 A;  3WHC A;  4WX9 A;  5LEJ A;  2M7B A;  3CLQ A;  3WGI A;  2IJL A;  1D0Y A;  1KYZ A;  2JSC A;  2JRM A;  4FAS D;  4XM3 A;  2X9D A;  5AIQ A;  1D0Z A;  2BW3 B;  1UAA A;  1X4O A;  1NG7 A;  3GF2 A;  5DM7 F;  1QU3 A;  1MBE A;  4KJZ A;  1T33 A;  2M45 A;  2STT A;  1GVD A;  3GFM A;  4D9J A;  1TWC J;  4WXC A;  4XLP F;  1HC8 A;  4Q4Z F;  4BQO A;  2A5W A;  3AG3 H;  2DO7 A;  5EGO B;  1MJB A;  2D45 A;  2EIM H;  4BXF A;  4G8X A;  3D0S A;  4XON A;  3IL2 A;  1GV2 A;  3G6E I;  4OIQ F;  4XSX F;  4UUT A;  4HZF A;  3VYR B;  3I4P A;  3TO7 A;  4A6E A;  1H9G A;  1BIB A;  1F36 A;  3OYJ A;  2VE9 A;  4BJ6 C;  3LOC A;  4HG2 A;  4IHX A;  3T8T A;  3OS0 A;  2IS4 A;  2QQ8 A;  2XGD A;  2XAF A;  3K1N A;  3K4M A;  1BR2 A;  2NNN A;  2PN6 A;  4XQF A;  3IH2 A;  5IY5 H;  4P9U A;  2HEO A;  2MLG A;  1MMA A;  1CF7 A;  2DA2 A;  3OYM A;  3CUQ B;  2OPT A;  5DYM A;  4JX4 A;  2IP2 A;  3R60 A;  1FZP B;  2K3F A;  4CUG A;  3RYP A;  4AC0 A;  4RB1 A;  2CMP A;  3I58 A;  4XLE A;  2B0L A;  4LGW A;  3SQN A;  4A3L J;  3L9F A;  1OJL A;  2LY1 A;  3P9C A;  3W6J B;  4UNO A;  3LSG A;  4A3J J;  1T95 A;  2PQ8 A;  2VKE A;  4L5J A;  4P5O A;  2Q0O A;  1C0W A;  3PIO F;  3QOP A;  4I7H A;  1VQ4 I;  1ORK A;  1HST A;  2ZXW H;  4BBS J;  2IGK A;  1NTC A;  1LE8 A;  2M5W A;  2L2O A;  2W82 A;  3WTS C;  2EIK H;  2K9N A;  4BE1 A;  4E7H A;  2W24 A;  2YX7 A;  4YIF A;  3GFL A;  1MND A;  3DKY A;  3TDU C;  5L3F A;  2BY1 A;  3S2W A;  4RAF A;  5J8F A;  3RPU D;  4A12 A;  2DAO A;  4DBR A;  3ZGK A;  1XMK A;  3C18 A;  2H94 A;  2I5U A;  2UUZ A;  3GTM J;  1S7O A;  3AL0 C;  2FA5 A;  3TOA A;  2E60 A;  1JTY A;  3DBL B;  3HRS A;  3SHF A;  1FJL A;  2VC0 A;  3CZ6 A;  3C1D A;  3DTI A;  2ECC A;  4A69 C;  4CCM A;  1K78 A;  3HJE A;  2JN6 A;  3AG1 H;  3ZMU A;  2PJP A;  1D8K A;  3FXJ A;  1LFU P;  3D5S C;  2BXY A;  2F2E A;  3E5Q A;  1R23 A;  4CYD A;  2P7V B;  5DCM B;  1FEX A;  1XSX A;  5EDN A;  2F4M B;  1MKM A;  2DA7 A;  2FRH A;  5LHI A;  4HX4 A;  4WK8 F;  2GXB A;  2EA2 A;  1G4D A;  2Q1Z B;  5M5Y J;  2H8R A;  2OD5 A;  3COA C;  4WWC A;  2EPF A;  2KRC A;  2RQP A;  3OS2 A;  3FDY A;  3LSR A;  1V4R A;  4N9I A;  3CO6 C;  2NVY J;  5FKM A;  3BTL A;  2JA7 J;  4FE4 A;  1EJ9 A;  1A36 A;  4HX8 A;  1K83 J;  2JT1 A;  3O2P E;  1P4A A;  4GXO A;  4ZYA A;  5E20 A;  4RDU A;  4RAZ A;  3OYD A;  3ZQI A;  4HF1 A;  4Y15 A;  3E5X A;  4BEH B;  1BR4 A;  1NH3 A;  1I50 J;  2XGC A;  3F22 A;  2GM4 A;  3I3L A;  1J9I A;  5F04 A;  1KGS A;  3BTC A;  2ISY A;  2ELK A;  3CCL I;  2P7C B;  4B48 A;  4Y33 A;  2DA6 A;  4G6D A;  2P8T A;  3ZMV A;  1TL8 A;  5H6Q A;  3R0J A;  3IAM 2;  3M8E A;  2IS2 A;  3H3V K;  4C3J J;  1ZEL A;  2HTJ A;  2XB0 X;  3AG4 H;  4N9H A;  3DPU A;  2NVT J;  2K4J A;  3CES A;  3WHB A;  2EV0 A;  4LJZ F;  4XLF A;  1ONV A;  2M8G X;  2DU9 A;  2E2J J;  4MLO A;  3TP0 A;  1STZ A;  4HW0 A;  4BH9 A;  2XHK A;  1I3A A;  5GTH C;  4MTE A;  2EJR A;  1Z7U A;  3M4O J;  3VFZ A;  3C3W A;  1MBJ A;  3ASO H;  4RBO A;  2XC7 A;  1FWZ A;  3Q9V A;  4UHT A;  1WH5 A;  1WJE A;  4UVC A;  5KNL A;  2O61 A;  3P7N A;  3WU2 C;  1IV6 A;  4C30 A;  1FOK A;  4L0Z B;  4RM3 A;  2VJJ A;  3EPZ A;  5KVR A;  3WU0 A;  1V5E A;  3IKV A;  4Y17 A;  2QZ8 A;  2EZK A;  3HPG A;  1E0E A;  5LGU A;  1FT9 A;  2ZB9 A;  1IRG A;  2ELH A;  2M2E A;  4KIG A;  1YS7 A;  3S32 A;  1ODD A;  1S7A A;  2HDW A;  1APL C;  2EIJ H;  4UV8 A;  4YG2 F;  1M1E B;  5K5R A;  3GTG J;  3L09 A;  3JTH A;  4EJV A;  4KIC A;  1IRF A;  4OIO F;  1WJD A;  2VOO A;  1A5J A;  5BMZ A;  2ZME B;  2DMN A;  3TP3 A;  4AU7 A;  1U9N A;  2ZFU A;  2LF7 A;  5K5O A;  3M7G A;  1WPK A;  3S1Q J;  1TTY A;  1TQM A;  2RVC A;  2ZXH A;  3QRF F;  1FMW A;  3G3Z A;  2L7K A;  3KZZ A;  4RGS A;  3A01 B;  4LG0 A;  2FD5 A;  3H92 A;  3RKX A;  3SFI A;  3SDG A;  1ZLJ A;  2VXD A;  2VI6 A;  4U7D A;  3BJO A;  2WAQ A;  3QYE A;  3GZ6 A;  1A6Q A;  1PDN C;  4I6Z A;  4HOB A;  5K7H A;  4PDK A;  5J47 A;  1FIP A;  4H0E A;  1JKO C;  4X6A J;  3TL4 X;  1FBU A;  3HTU A;  2ZO4 A;  4U7B A;  2BZT A;  1VQM I;  3MCZ A;  3CMA I;  4M3F A;  3E3V A;  5EF6 A;  1PVE A;  3CDI A;  3A0B C;  4OIN F;  3RQI A;  3FXO A;  3IP4 B;  1W0U A;  5DD4 A;  3RTR A;  1U8R A;  1OCT C;  4Y7N J;  2TRT A;  3CLO A;  5FJ8 J;  4AM3 A;  3A4C A;  1RKT A;  2BGC A;  2BY0 A;  2DMP A;  1B59 A;  1POG A;  1LUJ B;  4RB3 C;  2ZJQ F;  3A02 A;  3M3Y J;  3WTV C;  3Q3S A;  3J80 K;  2WY8 Q;  4IO9 F;  2VQL A;  3ABT A;  1GXQ A;  3I59 A;  5JHU A;  3ABM H;  3E6M A;  4AVZ A;  2ELJ A;  1JXS A;  2WAQ N;  1XGO A;  1WCM J;  3MKZ A;  1TBX A;  2WBM A;  3HOV J;  4DJA A;  1A35 A;  2EZH A;  2JMW A;  1VQ9 I;  1BC8 C;  4JYK A;  5LGN A;  1WVR A;  3AG2 H;  1QHG A;  4XBF A;  4A2U A;  1YJN I;  1MZB A;  1TNT A;  2W48 A;  4IHV A;  3DV8 A;  2HGC A;  4XNF A;  4ZDL A;  1GUU A;  2R5Z B;  1HW2 A;  2DA5 A;  3IH3 A;  2AQE A;  2JQ7 A;  4FTH A;  2A07 F;  1MMD A;  3HOX J;  3VWB A;  5F0C A;  5FB2 A;  1RUN A;  2KPM A;  4XRM A;  1P2F A;  4BXX J;  2K85 A;  5CVU A;  1GVJ A;  4S04 A;  4UXN A;  1GDT A;  4DOZ A;  3MKW B;  3I54 A;  3HM5 A;  4I98 B;  2ACJ A;  5CQE A;  1OYI A;  4BYY A;  4A0Z A;  1XGM A;  5EEA A;  2CGP A;  1HCR A;  3GWZ A;  2CFX A;  1RR7 A;  4M6Y A;  2FF4 A;  3UNG C;  2ZJP F;  5L3B A;  1MBF A;  2D5V A;  2DYS H;  1JKQ C;  3CF2 A;  2W7N A;  2PFB A;  2IA0 A;  2NXN B;  3F8F A;  3VEP A;  1X1D A;  2R7T A;  4PJ0 C;  4M73 A;  1O4X A;  2QGU A;  5TJJ A;  5DD8 A;  5LRR A;  1DGR M;  1Y8Q B;  1VQ7 I;  4AUX A;  4KIT B;  3OYE A;  3ZOB A;  4DIQ A;  3A2K A;  3ASN H;  5ICG A;  2NS7 A;  3HKZ A;  3H5R A;  3S1N J;  3DKX A;  4KIS A;  1G3S A;  4XN0 A;  2C6Y A;  4AVP A;  1BJA A;  2HZD A;  4WCG A;  3MKY B;  3ZQL A;  3MN2 A;  1TWH J;  1FSH A;  2M4K A;  3B73 A;  2XSD C;  3F9K A;  1MBK A;  1VQL I;  1QZE A;  1ZN2 A;  4WXH A;  5JLW A;  4CZC A;  2W84 A;  3J7Y J;  5FD6 A;  4DZJ A;  5M5W J;  2FJ1 A;  1R1T A;  5IYB J;  2M1B A;  2H6C A;  1ZH5 A;  4PSX A;  3J80 Z;  4P96 A;  3FBI B;  4A3F J;  1ERD A;  4A6D A;  2LF8 A;  3M1C A;  1LEB A;  5EG0 A;  1YFH A;  4D7M A;  1IW7 F;  1E3O C;  1U6G A;  3WTW C;  4UUV A;  3ROU A;  1Z7L A;  1VI0 A;  1X2N A;  1ZK8 A;  1BI1 A;  1O3T A;  1R1U A;  4UB6 C;  2PMZ N;  5DM6 F;  4PK4 A;  2LDU A;  2ZFW A;  2FNP A;  4BUP A;  2FQ4 A;  3JRB A;  5HOO A;  4I76 A;  2DOE A;  4XKB A;  2V9P A;  3FXL A;  3K4L A;  1W5T A;  2E2H J;  1EH8 A;  3T1B A;  4YFX F;  3M8J A;  1AU7 A;  2V1U A;  1XMA A;  2QBY A;  1S9H A;  2XB5 A;  3V8K A;  1OR7 A;  4RGR A;  2L9R A;  2MH9 A;  4Q47 A;  3CCR I;  1YW7 A;  2IEK A;  2R4G A;  1BI3 A;  1DPR A;  1Y0U A;  1SFE A;  2OCC H;  3RI4 A;  3RKQ A;  5HS7 A;  4P9F A;  3CUO A;  3WG9 A;  2O8K A;  1ZRF A;  4EM1 A;  2Z9O A;  4C2T A;  3NAR A;  2XAS A;  4RLF A;  1XSV A;  4PUS A;  1S6L A;  2ESN A;  2DT7 B;  3OR1 C;  3AL0 B;  1MH3 A;  2K40 A;  3JCU C;  1CGP A;  3F3X A;  4G94 A;  3S8P A;  1DQU A;  3FHZ A;  2FOK A;  4AIK A;  4IF4 A;  2L01 A;  2QVO A;  4RB0 A;  3IRQ A;  2DMQ A;  2R7F A;  3S1R J;  3KET A;  2LVS A;  3OYB A;  2JA6 J;  4DYR A;  3TGN A;  5LRS A;  1ZRC A;  1XTA A;  2V6E A;  4GYI A;  1PUF B;  1YRN A;  1B1B A;  3PL8 A;  3RQ4 A;  2VQG A;  5HLI A;  1V54 H;  2EIL H;  3HRT A;  5A2Q K;  2CUZ A;  1SAN A;  1OYY A;  4XOP A;  3JRI A;  1Z0X A;  4ZTF A;  1DP3 A;  1J0R A;  5CYV A;  2XV4 S;  2ZJ2 A;  3OIO A;  5IOZ A;  3G1M A;  2XAQ A;  1QA6 A;  2FBI A;  4LK1 F;  4ZDO A;  2PJR B;  5JLX A;  3JRG A;  3N97 A;  3H9Q A;  2RNG A;  3EUH A;  4CGZ A;  4A0Y A;  3GVA A;  4MNU A;  2HPM A;  3RPQ A;  2E1O A;  1K7A A;  1IN4 A;  4IHT A;  3D5L A;  1TZL A;  4LFU A;  3OS1 A;  1SD6 A;  4AYB A;  1P4W A;  1IAW A;  4W97 A;  5BNG A;  2X1D A;  2NVX J;  2KIS A;  4TV7 A;  3GW2 A;  3KIO A;  4JQF A;  1YI2 I;  4PGH A;  1HDD C;  1XX5 A;  3BJ6 A;  4BDZ A;  1WGX A;  1YJ9 I;  4BS9 A;  2WC2 A;  1I6X A;  2F5E A;  5FKL A;  4RMN A;  4DGW B;  2O8X A;  4HX7 A;  3WG7 H;  3HRU A;  1ETW A;  1YIT I;  4L9T A;  1HSJ A;  1HKS A;  3TW7 A;  3K4K A;  3S16 J;  3K2A A;  2LRD A;  3H1C A;  1RR8 C;  2HXO A;  3QOD A;  3BG5 A;  2X4H A;  4BQA A;  2YR2 A;  4M9X A;  1LPQ A;  2XF5 A;  2M0C A;  1SFO J;  1GLN A;  3BR6 A;  3DP7 A;  3IUO A;  4OIR F;  3TQN A;  1MMG A;  2R7D A;  4QPO A;  3MAJ A;  1MDM B;  2E7X A;  5CKT A;  1LQ1 A;  5LHH A;  4V19 K;  4EEF G;  2VKH A;  3GFJ A;  4C9Y A;  4CCN A;  1D8J A;  4HRI A;  2AQF A;  2V7F A;  1IF1 A;  1UHM A;  2OC6 A;  3HDD A;  4CZZ A;  3TO6 A;  3L2C A;  1JE8 A;  3W6K B;  1RKW A;  4RB2 C;  4NUB A;  1WFX A;  3MZH A;  4JX5 A;  4LB5 A;  3CP2 A;  4HV5 A;  5FLV A;  4QSH A;  1BC7 C;  4MEX F;  3DLA A;  5FKN A;  4KA4 A;  3JRE A;  2V79 A;  3BC8 A;  1BOB A;  4BE2 A;  1Z1D A;  2CYY A;  3K4B A;  5A2Q Z;  3J7A Y;  1T8I A;  3EDP A;  2KJB A;  2E2I J;  1TP4 A;  1YOV B;  2HQN A;  3CME I;  2RRE A;  3H36 A;  4YIR X;  2MAB A;  3I55 I;  4UUS A;  3VSL A;  1QPM A;  4EMS A;  1YW9 A;  2R7V A;  2BXZ A;  4C3H J;  1YJW I;  4IHY A;  2NYX A;  3WTY C;  3G1O A;  2LRE A;  1VQO I;  4B8X A;  1IN6 A;  3ZMD A;  1AKH A;  2FEZ A;  2F4I A;  2R7S A;  2Y0M A;  1OPC A;  5E18 F;  1QVT A;  2KZG A;  5D8K B;  4B43 A;  2XRO A;  2LH9 A;  1VQK I;  2DYR H;  1O3S A;  3GTO J;  2GLO A;  1LVK A;  3KP5 A;  2IRF G;  4XL9 A;  2W1O A;  2GIV A;  3H3Z A;  2CV1 A;  1JTX A;  3JAM K;  1JGS A;  3CTA A;  3MWM A;  5CQG A;  2Q2E A;  4PGG A;  5LD2 C;  1ZG1 A;  1A31 A;  4DZP A;  3IAS 2;  1EKE A;  5GAD J;  2JA2 A;  5J40 A;  1CF7 B;  2ZSI B;  2BV6 A;  3IV5 A;  1BR1 A;  3SJM A;  2EFQ A;  1Z91 A;  5DDG A;  4MFD A;  2DT5 A;  5M3F J;  2IGO A;  5F64 A;  1W1W E;  2OU2 A;  4C3I J;  5J1Y A;  5HNF A;  3CC7 I;  4BNC A;  5FRO A;  2ETH A;  2NVU B;  1ON2 A;  3K69 A;  5HDK A;  3K7A J;  3DPL C;  2IAI A;  1WKM A;  3JR9 A;  4CH7 A;  2XPU A;  1XN7 A;  5DUK A;  2E7W A;  2KIM A;  3BG3 A;  2GXA A;  2M34 A;  1JGG A;  3QU6 A;  3GUD A;  5ILS A;  2LR8 A;  1QHH D;  2HXI A;  2X48 A;  2K4B A;  1JHH A;  2WAD A;  3ECH A;  2D1V A;  3BTI A;  1X58 A;  3T5X A;  5M3M J;  5L3C A;  4C2M J;  1LE8 B;  4XLC A;  1OR7 C;  4PFP A;  3EET A;  3RKW A;  2CW0 F;  4ZC3 A;  1O7F A;  3HOT A;  2DFI A;  4PJM A;  2XKO A;  1FIA A;  3TO9 A;  1R7J A;  1S72 I;  2HI3 A;  2K9S A;  1LKX A;  1KU3 A;  1F1Z A;  1TWF J;  4KMU X;  2LKX A;  4HST A;  4A3I J;  3BR3 A;  3JRH A;  2YU9 J;  3RZD J;  2QKM B;  2F5C A;  2VAS A;  4B3A A;  1IC8 A;  1I1S A;  1I1G A;  1JUS A;  5K5Q A;  2XIG A;  1K78 B;  1QQI A;  2MLK A;  1J59 A;  2DA1 A;  3SZG A;  3K9T A;  1QZY A;  1U5T A;  1X3W B;  3GLL A;  4G7H F;  5B3S H;  4A3K J;  2CQ7 A;  2CQQ A;  2EBI A;  2X1E A;  2JVG A;  4JOM A;  2E36 A; 
#chains in the Genus database with same CATH homology
 2M8E A;  1IN7 A;  3V4G A;  3ULQ B;  4RAY A;  3RIR A;  4G9Y A;  2V9V A;  2DW4 A;  4A5N A;  2KIU A;  3K1M A;  3JAM Z;  3WTZ A;  2P5K A;  1YYV A;  4U88 A;  5CJ9 A;  3JTG A;  3I64 A;  4R1H A;  1BI0 A;  4AD9 A;  2QQB A;  2GA1 A;  1FBS A;  1FP1 D;  2IPQ X;  4EGY A;  2AS5 F;  2L02 A;  3QAH A;  1W4M A;  1G3W A;  1UFM A;  4HF2 A;  4Q5S F;  2EB7 A;  4GYG A;  1FSE A;  3F23 A;  4LK0 F;  2HDC A;  1KQ9 A;  4DNC A;  2XAJ A;  3V7C A;  3GFI A;  2VOD A;  4IRI A;  3LQR A;  2PMH A;  1F5T A;  4UVA A;  1FC3 A;  5CVI A;  3QP5 A;  2HWV A;  4OMZ A;  3G73 A;  2IT0 A;  4RGX A;  1IN5 A;  2MD5 A;  2ESH A;  3MQ0 A;  4N0B A;  1TQI A;  3OOP A;  1OMI A;  4KNY A;  1XGN A;  3J81 K;  2K86 A;  1EH6 A;  3WE3 A;  4LG0 B;  1DPU A;  5FFX A;  2HOE A;  4XLN F;  4I0B A;  1XSD A;  2BEO A;  3BJA A;  3V8J A;  3GYH X;  3ERE D;  2IVM A;  4IPA A;  3EQL F;  2ADU A;  5JFR A;  1P6R A;  2F5F A;  1PUE E;  3JSP A;  1R58 A;  3P9I A;  3I71 A;  2PI0 A;  4ZH4 F;  2VT3 A;  1J7K A;  1FNN A;  4ZYH A;  2YX4 A;  4G7Z F;  3HHH A;  4EGZ A;  2WTE A;  5D5V B;  5HDN A;  3CJN A;  4UV9 A;  1XD7 A;  5BS6 A;  1SD7 A;  4ESJ A;  4YFN F;  3F8C A;  3IHU A;  4KDP A;  3ZN0 A;  1OYW A;  2AXL A;  2FML A;  3I59 B;  4A5M A;  1XCV A;  1IXC A;  2H09 A;  3KP6 A;  1TQP A;  2A69 F;  4OOI A;  1TLH B;  3LA7 A;  2LSO A;  1I27 A;  2VT2 A;  4JBA A;  2GA2 A;  3WTU C;  4HDV A;  3REO A;  1MGT A;  1WSU A;  3IWZ A;  4EM2 A;  1R22 A;  3U9G A;  3F8B A;  2M87 A;  1T0F A;  3FXR A;  2FU4 A;  3LFK A;  1H0M A;  3N4M A;  2QWW A;  5L3D A;  3FM5 A;  3KP4 A;  3VOE A;  4OMY A;  1RZ4 A;  1KU7 A;  3R0A A;  3J81 Z;  2VOP A;  2RKH A;  4YII A;  2NRA C;  2VBZ A;  1S29 A;  1KU2 A;  4IVN A;  2LKP A;  1L0O C;  5D6F A;  2UZK A;  1LB2 A;  2QQ9 A;  4U0Y A;  5KK1 A;  4ESF A;  1O3Q A;  2VBY A;  2UWM A;  4CHU A;  3WOD F;  3CDH A;  1U5T C;  2V1D A;  3E6D A;  2CQK A;  3BPX A;  2H27 A;  3F72 A;  2GAU A;  4O6J A;  5D4R A;  2PBI A;  2OQR A;  3GLX A;  1T6S A;  1O3R A;  1BIA A;  5E8I A;  3J7A O;  1R5H A;  3IRR A;  1UST A;  2XAG A;  2XRN A;  4AIJ A;  5JI6 A;  2FMY A;  2QBY B;  4ZYE A;  3O6B B;  3PQJ A;  1MJA A;  2RDP A;  5FLX K;  1BM9 A;  4KIB A;  3SFZ A;  1W7P A;  4MEY F;  2EA4 A;  1IZ1 A;  2EFW A;  1XCB A;  2P6T A;  4LB6 B;  3U1D A;  3TDZ C;  2X0L A;  4F7Z A;  4ZZD A;  3HSF A;  4EJO A;  2ZCW A;  3IKT A;  4EJT A;  4RGU A;  2MC3 A;  4BXU A;  4CDG A;  2VC1 A;  1W7P D;  1RUO A;  2E1C A;  2QM3 A;  5DCF A;  1Q1H A;  1SD5 A;  2ZBK A;  2GZW A;  2LNB A;  3KLO A;  5LBQ A;  4O5V A;  2OA4 A;  1ULY A;  2CG4 A;  2DLL A;  3E97 A;  5E8G A;  3ZMS A;  5BQT A;  2JPB A;  2YSR A;  5ICC A;  2Z5U A;  2D1H A;  1QGP A;  1EH7 A;  3K2Z A;  2NS0 A;  3NRV A;  3KE2 A;  3FMQ A;  1VTN C;  4UVB A;  1HW1 A;  1SD4 A;  3LAP A;  4IJA A;  4LLL A;  5FD5 A;  4LMY A;  5BPI A;  4M74 A;  2ZXJ A;  3R4K A;  3MFK A;  5BOX A;  5FLX Z;  3TKY A;  3T8R A;  3RJP A;  3QP6 A;  1LEA A;  3FM3 A;  4IRH A;  5ICE A;  3GO5 A;  5D8L B;  3BZ6 A;  1WI9 A;  3P9K A;  3I0T A;  4KN4 X;  1R36 A;  4BHB A;  3RDI A;  2FE3 A;  3ECO A;  4AWX B;  4M9Z A;  3HTS B;  3LA2 A;  4KMF A;  3R61 A;  2GQQ A;  1FP2 A;  1FY7 A;  2QQA A;  2FNA A;  4HAM A;  2A61 A;  4EQQ A;  4QWQ A;  1BI2 A;  2BBY A;  2Y75 A;  1DUX C;  5HS9 A;  2EK5 A;  2W57 A;  4I0A A;  2FXA A;  2O3F A;  3WTX C;  1J5Y A;  3OV8 A;  2ISZ A;  4OIP F;  3ZP5 A;  5E1X A;  3T0Y A;  2RV8 A;  2VN2 A;  1QZZ A;  1EV7 A;  2G7H A;  4K2E A;  1XGS A;  3E6C C;  2K02 A;  3CO7 C;  3V7S A;  3QPT A;  2NAZ A;  1G3T A;  2DTR A;  1ZAO A;  4M9S A;  1TNS A;  3L7W A;  1P92 A;  1H9T A;  5ILU A;  2KRF A;  2XAH A;  5AON A;  2O6G E;  1O57 A;  4G7O F;  1HKQ A;  5JR3 A;  3GX4 X;  3F6V A;  3BDD A;  5JVT A;  2ZNZ A;  1AWC A;  3HUG A;  1PP7 U;  4XRF A;  4L9V A;  4D0P A;  2FQ3 A;  2BYV E;  1RNL A;  3E5U A;  1MD0 A;  4HBL A;  2VBX A;  4WF2 A;  2P5L C;  4EM0 B;  3PQK A;  5IT3 A;  2JPC A;  4KT5 C;  3K0L A;  5F6F A;  4HQM A;  3ABU A;  2G7U A;  4MQV A;  5FGM A;  3ZPL A;  4KUM A;  4AIH A;  2VE8 A;  4HLX A;  2DK8 A;  1BN5 A;  3BP8 A;  2Z99 A;  2A6H F;  3E6B A;  4GO1 A;  1RIO H;  1KU9 A;  1XDS A;  1FLI A;  5LGT A;  3WU1 B;  2CSO A;  4KFC A;  1UHW A;  3MZY A;  4IHS A;  2RN7 A;  1R5G A;  3SZT A;  4ENJ A;  2OZ6 A;  2KJC A;  1U2W A;  2D2W A;  1IUY A;  1YS6 A;  2XGX A;  4R79 A;  3NEU A;  1LNW A;  4RS8 A;  4B09 A;  4ZZL A;  5DUI A;  2GXG A;  2PG4 A;  3FXU A;  4EJW A;  1F4K A;  3WGG A;  1SMT A;  1K6O A;  2PLY A;  3ZN1 A;  2V1X A;  5J6X A;  3F8N A;  3BRO A;  1Z6R A;  4ETS A;  3I5U A;  4CXF A;  1ZRE A;  1SFX A;  3KP2 A;  4R8H A;  4U0W A;  1XB4 A;  3O3K A;  4L18 B;  1SFU A;  2COM A;  2M30 A;  3RPU A;  1OKR A;  3Q5F A;  4Y13 A;  3HHG A;  5K1Y A;  3HOS A;  1ZLK A;  1GHC A;  3RKY A;  5H20 A;  4GGG A;  2WV0 A;  5EEH A;  1FX7 A;  2KKO A;  1REP C;  4U0V A;  3ISP A;  3FMR A;  4FT8 A;  4GCV A;  3BWG A;  3ELK A;  3BOQ A;  2BE5 F;  1LVA A;  3MEX A;  4NHJ A;  4G6Q A;  2QYO A;  2EV5 A;  4QLC U;  2NNY A;  3B02 A;  1RI7 A;  4HQE A;  2A5Y B;  3ML6 A;  1U78 A;  2KIF A;  3CUQ A;  1WQ2 A;  4EV0 A;  1T98 A;  1ZAR A;  2ZNY A;  4KIF A;  5ED4 A;  4OU0 A;  2VXZ A;  3KZY A;  5HVQ C;  1E2X A;  4O3M A;  3I53 A;  2HR3 A;  1X3U A;  1O7L A;  2K27 A;  2L4A A;  2YU3 A;  3M8F A;  5FFZ A;  2O0Y A;  3U2R A;  5HLG A;  2ZKZ A;  1YIO A;  3C7J A;  4I2O A;  1LDK B;  3SZP A;  5LLQ A;  1ZRD A;  2O03 A;  1KQ8 A;  4I01 A;  2EV6 A;  5IT9 K;  1F9N A;  1S8N A;  4ESB A;  3IC7 A;  5CLS A;  1UCR A;  2W25 A;  3WTT C;  3IWF A;  5DEQ A;  4M71 A;  1NHA A;  5DCM A;  4MGR A;  1AOY A;  3V7R A;  4L9N A;  5E17 F;  5LHG A;  3FXQ A;  1SAX A;  2RGV A;  4MHG A;  1XDU A;  1DP7 P;  1FYL A;  3KP7 A;  1BOA A;  2IW5 A;  4EJU A;  3HSR A;  5CVV A;  4Q48 A;  5HLH A;  5BPD A;  1P4X A;  2IA2 A;  2L54 A;  1B4A A;  1BBY A;  2DBB A;  4ENK A;  3L00 A;  4HLY A;  3PFI A;  5D6E A;  1D5V A;  3DQV C;  3BY6 A;  1HXD A;  3LAJ A;  1Z6T A;  1QNT A;  3DKW A;  3M1E A;  3NQO A;  2HTS A;  4MQ9 F;  4ZYG A;  4XSZ F;  2HKX A;  4A0X A;  3RYR A;  5HS8 A;  2RNJ A;  2MBF A;  4NQW A;  4EVI A;  1QO0 D;  1J75 A;  3FWE A;  1UB9 A;  2XKP A;  5E1W A;  2DPU A;  5IT9 Z;  2Z3Y A;  1U3E M;  1T2K A;  3TOB A;  2R3S A;  2ZME A;  3M9A A;  5CVJ A;  1KQ0 A;  1FPQ A;  5H6R A;  1L3L A;  3HIF A;  4L0Y B;  2J5P A;  2L4M A;  5AIP A;  1ZYR F;  1W7P B;  3KP3 A;  4S05 A;  4P55 A;  4BHP A;  5EEG A;  1T39 A;  5HDG A;  3EYI A;  2EFO A;  3EYY A;  2WWY A;  1YG2 A;  4HA8 A;  2DK5 A;  2OAZ A;  2A6E F;  2PMU A;  2G9W A;  2EFN A;  3QPH A;  2HKO A;  1FBQ A;  4ENM A;  3VOD A;  4HYE A;  2IA1 A;  1ON1 A;  4I09 A;  1YO5 C;  3GXO A;  1WRJ A;  2P5V A;  3DPT A;  4CIC A;  2JTV A;  2J5O A;  2UXN A;  2JRT A;  1LJ9 A;  2F5D A;  2XVC A;  2FBK A;  2TDX A;  4BHC A;  2MH2 A;  2EWN A;  3DXJ F;  1V3F A;  2E1N A;  4M72 A;  3R6S A;  2YPR A;  2DI3 A;  3CUQ C;  1USS A;  2OBP A;  3FMS A;  4LD5 A;  2VBW A;  2GWR A;  4IRG A;  1MJ9 A;  5L3E A;  1TW2 A;  1T38 A;  2W85 A;  3VB2 A;  1IN8 A;  1IXS B;  1WWX A;  3WE2 A;  3SXY A;  2P4W A;  5ICF A;  2V6C A;  2XUB A;  2QLZ A;  3GEZ A;  2K7L A;  2FSW A;  1S3J A;  5F1R A;  1PP8 F;  2VON A;  2Q8K A;  4ON0 A;  3LST A;  2P6S A;  3ZMZ A;  5D4S A;  2HS5 A;  5D5U B;  4FX4 A;  2CO5 A;  4Z2Y A;  3DEU A;  5TRD A;  5J8C A;  1G6N A;  4IXA A;  1TW3 A;  4ENN A;  3HRM A;  2STW A;  2H6B A;  2EFP A;  3JSO A;  3FF5 A;  3KFW X;  2HQR A;  3Q9S A;  4I02 A;  2A68 F;  3F6O A;  3F21 A;  3KLN A;  2UXX A;  4PZJ A;  5D5X B;  1ZGJ A;  3DF8 A;  1R00 A;  4NB5 A;  4CO8 A;  5FO5 A;  2DQR A;  4FHT A;  3GZ5 A;  1ZG5 A;  2CWE A;  5E1Z B;  3V8L A;  4HDU A;  5ILV A;  4L9J A;  3H3U A;  3KEO A;  1YQA A;  3DFG A;  1FYM A;  2HYF A;  5LEK A;  3ZQ7 A;  1KA8 A;  5ERI A;  2Y48 A;  3FX3 A;  2RC4 A;  3HSE A;  2QUF A;  4KN7 X;  4KYW A;  1ZG3 A;  1JHF A;  2DQL A;  5CVR A;  1QBJ A;  1KYW A;  2JZY A;  4HV6 A;  3ZMT A;  5D5W B;  1IXR C;  3F8M A;  3BPV A;  2A3S A;  4LLN A;  1GXP A;  1YW8 A;  1LDD A;  1R1V A;  1DDN A;  4ZYD A;  3K1P A;  1LDJ A;  1HBX G;  6PAX A;  1ZHF A;  1J2X A;  1E17 A;  1B9N A;  2L3D A;  2QEN A;  1D3Y A;  1YLF A;  4DQ2 A;  1HW5 A;  1Z9C A;  2MA3 A;  1FYK A;  2FBH A;  2HFH A;  4FX0 A;  3AAF A;  3KEQ A;  3LA3 A;  1Z05 A;  3FZV A;  4LLG F;  4BAY A;  2OQG A;  4PCQ A;  3HYI A;  1A04 A;  4HF0 A;  1B9M A;  1SMY F;  4JK1 X;  1G3Y A;  2HZT A;  5DV5 A;  2Z33 A;  4L5I A;  2PEX A;  4E70 A;  1B6A A;  3JW4 A;  4YFK F;  3WGH A;  4WXD A;  2OZU A;  1W5S A;  3LWF A;  3KCC A;  1MDM A;  1HQC A;  3LQQ A;  1K79 A;  2HYG D;  1ZGA A;  1I5Z A;  2DPD A;  3QU3 A;  4ASN A;  5L3G A;  4M6X A;  4MTD A;  1U5T B;  1YTY A;  1HKT A;  4WX9 A;  5LEJ A;  3WGI A;  2IJL A;  1KYZ A;  2JSC A;  5AIQ A;  3GF2 A;  2M45 A;  2STT A;  3GFM A;  4XLP F;  4WXC A;  4Q4Z F;  2DO7 A;  1MJB A;  2D45 A;  4G8X A;  3D0S A;  3IL2 A;  4OIQ F;  4XSX F;  4HZF A;  3I4P A;  3TO7 A;  4A6E A;  1H9G A;  1BIB A;  2VE9 A;  3T8T A;  2XAF A;  3K1N A;  2NNN A;  2PN6 A;  4P9U A;  2HEO A;  2MLG A;  1CF7 A;  3CUQ B;  5DYM A;  2IP2 A;  3R60 A;  1FZP B;  3RYP A;  4RB1 A;  3I58 A;  2B0L A;  4LGW A;  3SQN A;  3L9F A;  3P9C A;  3W6J B;  4UNO A;  4L5J A;  2PQ8 A;  4P5O A;  2Q0O A;  1C0W A;  3QOP A;  4I7H A;  1HST A;  2M5W A;  3WTS C;  2W24 A;  2YX7 A;  4YIF A;  3GFL A;  3TDU C;  5L3F A;  3S2W A;  5J8F A;  4A12 A;  2DAO A;  1XMK A;  3C18 A;  2H94 A;  1S7O A;  2FA5 A;  3TOA A;  3SHF A;  3HRS A;  2VC0 A;  3C1D A;  1K78 A;  2PJP A;  3ZMU A;  1D8K A;  2F2E A;  3E5Q A;  1R23 A;  4CYD A;  2P7V B;  5DCM B;  1XSX A;  1MKM A;  2FRH A;  5LHI A;  4HX4 A;  4WK8 F;  2GXB A;  2EA2 A;  1G4D A;  2OD5 A;  3COA C;  4WWC A;  2RQP A;  1V4R A;  4N9I A;  3CO6 C;  4HX8 A;  2JT1 A;  4GXO A;  3O2P E;  1P4A A;  5E20 A;  4RAZ A;  4HF1 A;  4Y15 A;  3E5X A;  3F22 A;  1J9I A;  1KGS A;  2ISY A;  2P7C B;  4G6D A;  3ZMV A;  2P8T A;  5H6Q A;  3R0J A;  3M8E A;  2HTJ A;  4N9H A;  2K4J A;  2EV0 A;  4LJZ F;  1ONV A;  2DU9 A;  1STZ A;  4HW0 A;  4BH9 A;  2XHK A;  4MTE A;  2EJR A;  1Z7U A;  3VFZ A;  3C3W A;  1FWZ A;  3Q9V A;  4UHT A;  4UVC A;  2O61 A;  3P7N A;  1FOK A;  4L0Z B;  5KVR A;  3WU0 A;  4Y17 A;  3IKV A;  2QZ8 A;  5LGU A;  1FT9 A;  1IRG A;  2ELH A;  4KIG A;  1YS7 A;  1ODD A;  1S7A A;  4UV8 A;  4YG2 F;  5K5R A;  3L09 A;  3JTH A;  4EJV A;  4KIC A;  1IRF A;  4OIO F;  2VOO A;  5BMZ A;  2ZME B;  2LF7 A;  5K5O A;  3M7G A;  1TTY A;  1TQM A;  2RVC A;  3QRF F;  3KZZ A;  3G3Z A;  4RGS A;  4LG0 A;  3H92 A;  3RKX A;  1ZLJ A;  4U7D A;  3BJO A;  3GZ6 A;  1PDN C;  4HOB A;  4PDK A;  4H0E A;  1FBU A;  3HTU A;  2ZO4 A;  4U7B A;  3MCZ A;  3E3V A;  4OIN F;  5DD4 A;  3RTR A;  1U8R A;  3CLO A;  2BGC A;  1B59 A;  4RB3 C;  3WTV C;  3J80 K;  3ABT A;  1GXQ A;  3I59 A;  5JHU A;  3E6M A;  1JXS A;  1XGO A;  1TBX A;  1BC8 C;  5LGN A;  4XBF A;  4A2U A;  1MZB A;  1TNT A;  3DV8 A;  2HGC A;  1HW2 A;  2A07 F;  5FB2 A;  1RUN A;  1P2F A;  5CVU A;  1GVJ A;  4S04 A;  4UXN A;  3I54 A;  4I98 B;  2ACJ A;  1OYI A;  4BYY A;  4A0Z A;  1XGM A;  2CGP A;  3GWZ A;  2CFX A;  4M6Y A;  2FF4 A;  5L3B A;  2PFB A;  2IA0 A;  3F8F A;  3VEP A;  4M73 A;  5TJJ A;  5DD8 A;  5LRR A;  5ICG A;  1G3S A;  2C6Y A;  4AVP A;  1BJA A;  4WCG A;  1FSH A;  3B73 A;  1ZN2 A;  4WXH A;  2W84 A;  5FD6 A;  1R1T A;  2M1B A;  2H6C A;  1ZH5 A;  3J80 Z;  4P96 A;  4A6D A;  2LF8 A;  1LEB A;  1YFH A;  1IW7 F;  1U6G A;  3WTW C;  4UUV A;  3ROU A;  1O3T A;  1BI1 A;  1R1U A;  2LDU A;  2ZFW A;  2FNP A;  5HOO A;  1W5T A;  1EH8 A;  3T1B A;  4YFX F;  2V1U A;  1XMA A;  2QBY A;  3V8K A;  1OR7 A;  4RGR A;  2MH9 A;  4Q47 A;  1YW7 A;  1BI3 A;  1DPR A;  1Y0U A;  1SFE A;  3RI4 A;  5HS7 A;  4P9F A;  3CUO A;  3WG9 A;  1ZRF A;  4EM1 A;  2Z9O A;  2XAS A;  1XSV A;  1S6L A;  2ESN A;  1CGP A;  3F3X A;  4G94 A;  3FHZ A;  2FOK A;  4AIK A;  4IF4 A;  2L01 A;  2QVO A;  4RB0 A;  3IRQ A;  2R7F A;  3KET A;  3TGN A;  5LRS A;  1ZRC A;  4GYI A;  1B1B A;  5HLI A;  3HRT A;  5A2Q K;  1OYY A;  1J0R A;  5CYV A;  2XV4 S;  2ZJ2 A;  2XAQ A;  2FBI A;  4LK1 F;  3N97 A;  4CGZ A;  3EUH A;  4A0Y A;  3GVA A;  4MNU A;  3RPQ A;  1K7A A;  1IN4 A;  4IHT A;  3D5L A;  4LFU A;  1SD6 A;  1P4W A;  1IAW A;  4TV7 A;  3GW2 A;  4JQF A;  4PGH A;  3BJ6 A;  2WC2 A;  1I6X A;  2F5E A;  2O8X A;  4HX7 A;  3HRU A;  4L9T A;  1HSJ A;  1HKS A;  2X4H A;  4BQA A;  2YR2 A;  4M9X A;  3DP7 A;  4OIR F;  3TQN A;  2R7D A;  3MAJ A;  1MDM B;  2E7X A;  1LQ1 A;  5LHH A;  3GFJ A;  1D8J A;  1IF1 A;  1UHM A;  4CZZ A;  3TO6 A;  3L2C A;  1JE8 A;  3W6K B;  4RB2 C;  3MZH A;  4LB5 A;  4HV5 A;  1BC7 C;  4MEX F;  4KA4 A;  2V79 A;  1Z1D A;  2CYY A;  5A2Q Z;  3EDP A;  2KJB A;  2HQN A;  1QPM A;  4EMS A;  1YW9 A;  2NYX A;  3WTY C;  4B8X A;  1IN6 A;  3ZMD A;  2FEZ A;  2Y0M A;  1OPC A;  5E18 F;  5D8K B;  2XRO A;  1O3S A;  2IRF G;  3KP5 A;  2GIV A;  3H3Z A;  3JAM K;  1JGS A;  3CTA A;  3MWM A;  2Q2E A;  4PGG A;  1ZG1 A;  1CF7 B;  2BV6 A;  2EFQ A;  1Z91 A;  5DDG A;  2DT5 A;  5F64 A;  2OU2 A;  4BNC A;  2ETH A;  1ON2 A;  3K69 A;  5HDK A;  3DPL C;  1WKM A;  1XN7 A;  5DUK A;  2E7W A;  2KIM A;  3QU6 A;  3GUD A;  5ILS A;  2K4B A;  1JHH A;  3ECH A;  2D1V A;  3T5X A;  5L3C A;  3EET A;  3RKW A;  2CW0 F;  1O7F A;  3HOT A;  2DFI A;  2XKO A;  3TO9 A;  1R7J A;  1KU3 A;  1F1Z A;  4KMU X;  2F5C A;  1I1S A;  1I1G A;  5K5Q A;  2XIG A;  1K78 B;  1QQI A;  2MLK A;  1J59 A;  3K9T A;  1QZY A;  1U5T A;  4G7H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...