1T6SA

Crystal structure of a conserved hypothetical protein from chlorobium tepidum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ScpB from Chlorobium tepidum, a protein involved in chromosome partitioning.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA02
1P4XA 4O3MA 2Q2EA 2PLYA 1T2KA 2QQ9A 2W25A 1JGSA 3GZ6A 4ENMA 4O6JA 3T1BA 3HRSA 2IW5A 3LA2A 1STZA 1LQ1A 3LA7A 3GFJA 3E6MA 3FX3A 1KU2A 5CVRA 2XUBA 2VBXA 1FNNA 4KIGA 2GWRA 5AIPA 3I53A 3MZYA 1QNTA 3KZZA 2Z5UA 1AOYA 4HX4A 3ZQ7A 3E6DA 4ZZLA 1S3JA 1IRGA 1U5TC 3F3XA 2MC3A 4KN7X 4M9SA 3J80Z 3TO7A 4BNCA 4P9UA 4NHJA 1G4DA 1W7PB 2NAZA 3GZ5A 5HS8A 5LEKA 3KLOA 1SD7A 2E7XA 3LFKA 4MQ9F 1H9TA 2FXAA 1LDJA 4P55A 4LGWA 2CQKA 2Z3YA 1YLFA 1USTA 2HGCA 3R4KA 2KRFA 4YG2F 2OQRA 2DK5A 3I4PA 1U78A 4LJZF 3WTUC 2XROA 3F21A 1YO5C 1UHWA 1JHHA 5TJJA 3JTGA 1FT9A 1ON2A 4M6YA 2EA4A 2D45A 2BE5F 1TQMA 1MKMA 3ABTA 3ERED 4M9XA 4N9IA 5HLGA 1KQ9A 5IT9K 1QO0D 4L9NA 2G7UA 3QRFF 4WXHA 2FA5A 3K1NA 5LGTA 5JVTA 4IRHA 3MFKA 2P6TA 3PQJA 1XSDA 4KYWA 2IA2A 4MHGA 1K7AA 1P92A 1CF7B 1LEBA 1IXRC 2F5CA 4MTDA 3F8NA 2DO7A 4JBAA 1QZZA 3M7GA 1X3UA 1R7JA 4G7OF 3Q9VA 3J81K 2OU2A 3GYHX 1MDMA 3ZMSA 4EJTA 3WTVC 1BI1A 1MJBA 3L7WA 4P96A 2EB7A 3EDPA 3WODF 5HS9A 5LRRA 5JHUA 3K9TA 5DUKA 2HDCA 3GX4X 4RB3C 2DU9A 1IXCA 2KIUA 4L5IA 1SD6A 2AXLA 4MEYF 4Q4ZF 1ODDA 4G8XA 2EV6A 4UVBA 4UXNA 1QBJA 2EA2A 3ZPLA 4JQFA 1YYVA 2Z99A 2IVMA 4RB2C 1T38A 3DP7A 1J7KA 2FSWA 5E8GA 3EQLF 2M87A 4BAYA 5D5XB 1LDKB 2P5VA 3RKYA 3JSOA 5LGNA 4LB6B 4HLYA 3NEUA 3OV8A 3IL2A 3O6BB 5FLXZ 1R1UA 2F5DA 3CJNA 4LG0B 1ZARA 3BOQA 4A5MA 3IWZA 2EV5A 2FQ3A 1RZ4A 3RI4A 3F22A 1ZREA 2YX4A 1J59A 2NNNA 1XMKA 4WXDA 2ZNYA 1LNWA 1FOKA 3QPHA 3F6OA 4XSZF 4L9JA 2VC0A 2M5WA 5DCMB 1MJ9A 1IN7A 1BC7C 3REOA 3FF5A 1P6RA 1YS7A 4UNOA 4A0YA 4ESFA 2FE3A 1A04A 3F8BA 3DV8A 5LLQA 3LA3A 4ETSA 3C18A 1GXQA 1XD7A 2L02A 1YQAA 4GYGA 2GA1A 5HDNA 1DP7P 1BI3A 2XAJA 2DFIA 5E1WA 2ISZA 4U0VA 2D2WA 5AIQA 4UVAA 1ZGJA 1FC3A 1FBUA 4OIPF 3ULQB 2QWWA 2Z33A 2LF7A 4UHTA 5F64A 1PP7U 4WX9A 4A6EA 5BOXA 2ZCWA 5ICFA 4ESJA 4TV7A 2HEOA 1KU3A 3V8LA 1ZRCA 4RGUA 5ILUA 3JTHA 3ELKA 3WE2A 5DCMA 2HYGD 2VBYA 4BHCA 3I5UA 1S6LA 3R0AA 4EM2A 4ZYDA 1I27A 3CO7C 3RDIA 3W6KB 1HKTA 4IHSA 3HRUA 1WKMA 4NB5A 3K69A 4G7HF 1I6XA 1W7PD 4LK1F 2W57A 1BJAA 1B9NA 1TQPA 1WI9A 2JRTA 5DV5A 2FBHA 1T0FA 4CO8A 3DXJF 3WU1B 2OQGA 3W6JB 4FHTA 3G3ZA 2O03A 2LF8A 4IRIA 3H92A 3KZYA 4PDKA 3WG9A 1BN5A 2GIVA 3GO5A 4HV5A 2RNJA 1KA8A 1YW8A 5D8LB 4DNCA 5BPDA 3GLXA 1RUOA 4S04A 3P9IA 1L3LA 1Z05A 4I7HA 5FFZA 4EJOA 1FPQA 1W5SA 4BXUA 1GXPA 1FLIA 2M8EA 2MH9A 2EFNA 3M1EA 2J5OA 3WTWC 1WRJA 4CGZA 1QQIA 4YFNF 2WTEA 2TDXA 3KCCA 1P2FA 5EEHA 1WWXA 3ZN1A 2VC1A 4CDGA 2WC2A 1PP8F 2GZWA 2DAOA 3FXRA 4XRFA 4U88A 4WK8F 2CO5A 2UXXA 1FY7A 3E5XA 1CF7A 2HZTA 3SZTA 4HDVA 1USSA 4AIJA 1TW2A 4AIHA 1S7OA 4RAZA 1HKSA 4R8HA 4HOBA 2XAQA 3CUOA 3CTAA 1XGOA 3JAMZ 1D8JA 3C7JA 4KFCA 1XN7A 1R36A 5BMZA 3ABUA 4DQ2A 2F5EA 4F7ZA 4WWCA 4IHTA 3GFLA 4LFUA 3BWGA 4RGRA 1B6AA 3MCZA 1Y0UA 3DPTA 5ERIA 3EETA 4MTEA 2BYVE 2JZYA 4IVNA 2PJPA 5L3EA 2HQNA 4WCGA 1BI2A 3WGIA 1O7LA 3CUQB 5K5QA 3O2PE 3JAMK 4ENKA 1R5GA 2MH2A 5KK1A 4L5JA 2HYFA 2CW0F 2LNBA 3LAPA 5IT3A 6PAXA 2JT1A 1LDDA 3WE3A 1Z9CA 2XKPA 1D8KA 3F72A 1HW2A 4XLPF 1B4AA 5HS7A 3RKXA 3ZP5A 1T98A 3VODA 1BIAA 5E1ZB 4RGXA 3PFIA 3O3KA 4QWQA 5CVIA 4AIKA 3DQVC 4QLCU 1IN4A 3L00A 4L0YB 2EV0A 3COAC 1IUYA 2EJRA 3MQ0A 4CICA 5E17F 4CYDA 1S7AA 1F4KA 2XV4S 3ZMUA 2HWVA 5CYVA 5LHHA 2JPCA 1HKQA 2P8TA 1E2XA 2HR3A 2ACJA 3ZN0A 2O6GE 4HF1A 4HYEA 2EK5A 1FZPB 3TQNA 4YFXF 1XSXA 3C3WA 2UZKA 3L2CA 1OR7A 1HW1A 1U6GA 3KP2A 2WWYA 2ZNZA 1YG2A 5L3FA 2MLKA 2MD5A 4YIIA 3GVAA 2L01A 4ZH4F 3K1PA 1ZYRF 1ZLKA 2CYYA 2R3SA 1K6OA 2W84A 5F1RA 1PUEE 2H6BA 1HW5A 2KJBA 3JW4A 3NQOA 2H27A 2ESHA 5ILSA 5ILVA 1B59A 3IKTA 3BJ6A 1Z6TA 2XAFA 1Z7UA 4I09A 3ECOA 3K0LA 1JHFA 1SFEA 4GYIA 3MAJA 1FWZA 4EMSA 1SD5A 4EGZA 1ZGAA 4CXFA 3L09A 2BGCA 3E6BA 1FSHA 2K4BA 1J9IA 2PN6A 2B0LA 1U5TA 1HSJA 4M71A 3NRVA 3QU3A 5FD5A 1R22A 4A2UA 1IXSB 4I0AA 4EQQA 4LMYA 2HOEA 3RPUA 1LVAA 1YTYA 5AONA 5D5WB 4HF2A 2ESNA 2VODA 1R5HA 2VT2A 1WSUA 3OOPA 4M6XA 2EFPA 3I58A 4KNYA 3R6SA 1XSVA 3BZ6A 4R79A 4UV9A 3BPVA 4BHPA 1R58A 3P7NA 3ZMVA 4HV6A 1FP2A 3I71A 4ZYGA 2Y75A 3P9KA 2VE9A 2R7DA 5A2QZ 5LRSA 4IF4A 2QBYA 2Y0MA 2G7HA 3IRRA 1EH8A 2FEZA 3HUGA 2M1BA 1EV7A 2OZ6A 1SFUA 5D8KB 5K1YA 3S2WA 1DUXC 1Q1HA 4KIFA 3QOPA 3SQNA 5FO5A 1U5TB 2HS5A 2C6YA 3V7CA 4KDPA 3IHUA 2W85A 1JXSA 4M74A 1MZBA 4RB0A 1LJ9A 4MEXF 3DEUA 5ICEA 2K86A 3K1MA 4WF2A 4LB5A 2FOKA 4BHBA 4KUMA 2ETHA 2A5YB 2LSOA 2XGXA 4ZYHA 1R1VA 1L0OC 4LLGF 2PBIA 4EVIA 1GHCA 2P5LC 4M72A 4Q48A 1H0MA 4WXCA 2NNYA 2O3FA 1UHMA 4KT5C 1SMYF 2FBIA 2ZJ2A 3SZPA 1G3TA 5D5UB 2O61A 2F5FA 5HDGA 1KGSA 1DDNA 4KMFA 4LK0F 2RV8A 1XCVA 2UXNA 3VEPA 2NYXA 5L3DA 2QUFA 2Z9OA 3TOBA 5EEGA 3B02A 4OINF 4IJAA 1ZN2A 3EUHA 1FBSA 3FHZA 2H6CA 3WTSC 2AS5F 5A2QK 2YPRA 3HOTA 2M45A 4LLNA 2HKOA 4AVPA 4JK1X 5CVUA 1BM9A 1FYMA 3EYIA 1QPMA 4Q47A 4HAMA 3IC7A 2PMHA 1NHAA 3WGGA 1I1SA 2Q8KA 5DD4A 1B9MA 2RKHA 1KU7A 1QGPA 5DYMA 4U0YA 1OYYA 4CZZA 4HLXA 4LD5A 2YX7A 2QQAA 4KIBA 1XMAA 4P5OA 2GAUA 2VN2A 3T5XA 5BQTA 5K5OA 1YIOA 2F2EA 1G3YA 1KYWA 2K27A 2W24A 3FWEA 4OU0A 3E97A 2X4HA 4EGYA 2MA3A 1TNSA 3ML6A 2BBYA 3HRTA 2XAGA 3VB2A 4N9HA 3B73A 3J80K 3J81Z 3KE2A 5L3GA 1DPUA 3CLOA 3TDUC 3M8EA 2QVOA 2GA2A 3CUQC 2XKOA 2A07F 1REPC 2Q0OA 2DLLA 3F8FA 1J5YA 1TLHB 1O3RA 5ICGA 2A61A 2XIGA 3HSRA 2H09A 3DPLC 2VE8A 1RI7A 3T8TA 4PCQA 4G6QA 1FBQA 1V3FA 4HQMA 3F8MA 1KU9A 3RJPA 2PEXA 3V4GA 4Y15A 1S8NA 4G7ZF 5IT9Z 5D5VB 4U7DA 5L3BA 1J75A 2QBYB 3FMSA 4MGRA 1HQCA 5HVQC 2XVCA 3VFZA 2K4JA 3MWMA 1ZG5A 4FX0A 3FM5A 3JSPA 3M8FA 4IPAA 1ZH5A 3HOSA 1BC8C 2STTA 1FYLA 1VTNC 4D0PA 5JR3A 2MBFA 2DQLA 3IWFA 2R7FA 3ZMZA 1IRFA 4S05A 4LG0A 4OMYA 2V1XA 2D1VA 2FF4A 2XHKA 4RS8A 1TNTA 1OMIA 1XB4A 2DT5A 2STWA 3KP7A 2QZ8A 2IT0A 4H0EA 2JPBA 4A5NA 5J8FA 4B8XA 2RDPA 3I59B 3Q9SA 3K2ZA 2EFQA 3HHGA 5ICCA 1JE8A 4EJWA 2V6CA 1I5ZA 4G6DA 2KJCA 3HSFA 1MJAA 3QU6A 1OYWA 3I0TA 3ZMTA 4L18B 1DPRA 1MD0A 1ZLJA 3H3ZA 1TQIA 3BROA 4GGGA 2XASA 1BIBA 2CG4A 5FB2A 2ISYA 1F1ZA 2EFWA 1P4AA 3QPTA 4I0BA 2O0YA 3C1DA 5CJ9A 4AWXB 1LB2A 4PGHA 3F23A 2ZFWA 5H6RA 3HRMA 4BQAA 2O8XA 3GUDA 1SAXA 2HFHA 4HW0A 1XGNA 2COMA 5H20A 2V1UA 2DBBA 2DTRA 3EYYA 3J7AO 3KP6A 4PZJA 1XGMA 2FMYA 1TW3A 1Z1DA 3KP5A 3CDHA 2IRFG 2DPUA 1K78B 2BEOA 5FD6A 4HQEA 1AWCA 2V79A 2VT3A 3LSTA 3F6VA 3QP6A 4ON0A 5KVRA 2YR2A 4XSXF 4YIFA 3RPQA 3U2RA 1O57A 4EJVA 3FMRA 4AD9A 1KQ8A 4HX8A 2PI0A 2PMUA 1ZRFA 1J0RA 3LAJA 2DK8A 2A6HF 2IA1A 4ESBA 1BBYA 2VXZA 2VBZA 3BY6A 3WTYC 5E20A 3BPXA 2ZBKA 1UCRA 5LBQA 2OBPA 3TKYA 4OIQF 4EV0A 2VBWA 3BP8A 1Z91A 3I54A 2YSRA 1U3EM 2X0LA 4M73A 3GFMA 1ZAOA 4KN4X 1FYKA 1XDSA 2DQRA 2DPDA 4MNUA 5BPIA 5HLIA 2RC4A 1IN6A 1OPCA 2CFXA 2ZXJA 2IJLA 4I98B 2OD5A 2QQBA 1FP1D 1SMTA 1IF1A 4L9VA 2CGPA 2HTSA 4XBFA 4A0ZA 3VOEA 5DD8A 1XGSA 4ZYEA 4Q5SF 2K7LA 3KEOA 2EWNA 4GXOA 3V7SA 1HBXG 3BJOA 3HTUA 3GXOA 3G73A 5JI6A 5LGUA 2ELHA 3TO6A 2P7CB 1KYZA 2PG4A 2E7WA 3BJAA 5DEQA 2GXBA 2VOOA 3TOAA 4ASNA 3GEZA 3GFIA 1ULYA 4HF0A 3HYIA 1F5TA 2H94A 1RUNA 4KMUX 5FGMA 4KICA 3MZHA 1U8RA 2RGVA 3V8JA 3I59A 1BI0A 3H3UA 2ZMEB 4HDUA 3KLNA 3FZVA 4HBLA 4U7BA 1F9NA 1T39A 4I01A 3TO9A 5LHIA 4ZZDA 3KETA 2KKOA 2L4AA 4NQWA 1ZHFA 2QENA 2KIFA 2K02A 2HKXA 5FLXK 1YW7A 5JFRA 2CWEA 2EFOA 5FFXA 5D4RA 4CHUA 1TBXA 2FBKA 2Y48A 4U0WA 2GXGA 3CUQA 5HDKA 3WU0A 3KFWX 5LHGA 2A69F 1H9GA 3DF8A 5CVJA 5TRDA 1LEAA 1XCBA 2HQRA 2A68F 1J2XA 2QLZA 5E8IA 3L9FA 3LQQA 4MQVA 2IP2A 2ZO4A 4EJUA 1OKRA 2IPQX 2FU4A 4RGSA 1ZG3A 4K2EA 2GQQA 4YFKF 3E3VA 2ADUA 2FMLA 2E1CA 4G94A 2QM3A 2NS0A 1D3YA 3FXUA 4ENJA 3KEQA 1O3SA 3R0JA 3FMQA 1G3SA 4OIOF 1S29A 1IW7F 5D6EA 5K5RA 2CSOA 4M9ZA 1O7FA 4FX4A 1R23A 3SFZA 1R1TA 2FNAA 2L54A 5L3CA 3PQKA 2RQPA 2FRHA 2WV0A 3I64A 4I02A 3HSEA 3DKWA 2PQ8A 4FT8A 1W4MA 3FXQA 1B1BA 2L4MA 4XLNF 1UB9A 4HZFA 3E5UA 5E1XA 2M30A 3R61A 3R60A 4GCVA 3RKWA 2UWMA 3KP3A 1ZG1A 3MEXA 4LLLA 2NRAC 3M9AA 1TTYA 3U9GA 3RYPA 4P9FA 4A12A 4Z2YA 1BOAA 5DCFA 1SD4A 3HIFA 2A3SA 2LDUA 4RAYA 1RNLA 4Y17A 2J5PA 3RYRA 2PFBA 5F6FA 3N97A 3ROUA 4A0XA 3HHHA 1IZ1A 2V9VA 1V4RA 2ZMEA 1IAWA 3V7RA 5J8CA 1ON1A 4RB1A 5HLHA 5HOOA 1YS6A 2QYOA 4Y13A 1K79A 1SFXA 2JTVA 3GW2A 3GF2A 4OIRF 3QAHA 2OA4A 3WTZA 3FM3A 3KP4A 3E6CC 4UV8A 5DDGA 2DI3A 4ENNA 1O3QA 1UFMA 3AAFA 1T6SA 3IRQA 3HTSB 2V1DA 2RN7A 4OOIA 1I1GA 2P5KA 4OMZA 4A6DA 1G3WA 5H6QA 1HSTA 2JSCA 3RIRA 5BS6A 3IKVA 1GVJA 1G6NA 1Z6RA 1W5TA 1U2WA 4E70A 4O5VA 3Q5FA 2VOPA 3TGNA 3D5LA 3SXYA 3V8KA 2HTJA 3GWZA 3DFGA 1ZRDA 1K78A 3BDDA 2XAHA 1E17A 4UUVA 1EH7A 2ZKZA 3CO6C 1R00A 2YU3A 4PGGA 3RTRA 5LEJA 3WTXC 3ZMDA 1HXDA 3N4MA 4BYYA 2FNPA 2G9WA 3T8RA 2RVCA 2OZUA 5D6FA 1FX7A 1YFHA 2P6SA 4UVCA 2D1HA 3SHFA 3TDZC 4HX7A 1ONVA 3E5QA 1D5VA 1YW9A 3ECHA 3WGHA 2XRNA 2IA0A 4IXAA 2VONA 1O3TA 4KA4A 4HA8A 3U1DA 4L0ZB 2L3DA 1QZYA 2A6EF 3F8CA 3LQRA 3LWFA 4N0BA 4EM1A 1IN5A 1EH6A 4I2OA 4B09A 1OYIA 3T0YA 4GO1A 2MLGA 3QP5A 4IRGA 1C0WA 1MDMB 1P4WA 2BV6A 2KIMA 3P9CA 2P4WA 5CLSA 5DUIA 1PDNC 3ISPA 1XDUA 1KQ0A 1MGTA 2P7VB 1CGPA 1RIOH 4G9YA 1IN8A 1WQ2A 3D0SA 2OAZA 2E1NA 5D4SA 5J6XA 5E18F 4EM0B 1FSEA 2DW4A 3WTTC 1W7PA 2LKPA 5ED4A 5CVVA 4R1HA 4L9TA 4BH9A
chains in the Genus database with same CATH superfamily
3CF5F 3GMEA 3FK6A 1P4XA 4O3MA 2Q2EA 2E2JJ 2PLYA 1MMNA 2Y0SN 3ASNH 1T2KA 1IUFA 3SZGA 2QQ9A 4XM3A 2W25A 1JGSA 3GZ6A 3DBLB 4ENMA 2ECBA 3ZQLA 3F9KA 4O6JA 3T1BA 3HRSA 2IW5A 3LA2A 3ABKH 2LBFB 1STZA 1LQ1A 2EPFA 5IP7J 5F0FA 3RPUD 3LA7A 4S0HB 3GFJA 2LYCA 1RKTA 3E6MA 3FX3A 1KU2A 2KT0A 3VSLA 5CVRA 2HPMA 1QA6A 2XUBA 2DT6A 2VBXA 2WY8Q 3HBLA 1JTYA 2NVQJ 1FNNA 4KIGA 2W7NA 2VQHA 2GWRA 5AIPA 3I53A 3PIOF 3HPHA 3MKWB 3MZYA 5FRMA 1QNTA 1IDYA 3OYJA 4G6TB 3KZZA 2OPTA 3S3NA 2Z5UA 1AOYA 4NNJA 5DTDA 2ZXWH 4HX4A 3ZQ7A 3E6DA 4ZZLA 2Y69H 1LKXA 3MKLA 4HG2A 1S3JA 1IRGA 1U5TC 5TGTA 3F3XA 2MC3A 2JA6J 4DBQA 3I55I 4KN7X 4M9SA 3J80Z 3TO7A 2F5VA 4D5CA 3OYCA 2VQCA 2XB0X 2JA2A 4C3JJ 5F04A 4BNCA 4P9UA 1ZR2A 3ABMH 4NHJA 2L2OA 3CCLI 2ME0A 3K10A 2IS6A 4BS9A 4RMNA 1G4DA 5J4VA 1W7PB 2NAZA 3GZ5A 2DFEA 3WG7H 1X1AA 5HS8A 4L5EA 5LEKA 1S9HA 3KLOA 4FTHA 1IDZA 1SD7A 3I3LA 2M0CA 2R5ZA 2E7XA 3LFKA 4Y52J 4MQ9F 1VFCA 5GPAA 1H9TA 3G1MA 2FXAA 3PL8A 2PMZN 4CYCB 3HG9A 1LDJA 1I3QJ 4P55A 4IQ4A 3CCUI 4LGWA 2CQKA 4KJZA 4IOAF 2Z3YA 1YLFA 1USTA 3LSPA 2HGCA 3R4KA 3ZOBA 2KRFA 4YG2F 1GVDA 2X85A 2OQRA 2DK5A 3I4PA 1U78A 4LJZF 3FKJA 2VJIA 3WTUC 2XROA 3F21A 5DS9A 1YO5C 1UHWA 1JHHA 2WB1N 5TJJA 4CA0A 4I76A 2PJRA 3JTGA 1WJDA 1FT9A 1ON2A 1ZGWA 3D5SC 4AVZA 4M6YA 2EA4A 4YELA 2D45A 1SVLA 1TQMA 2BE5F 2VKDA 1MKMA 2V9PA 3A01B 1FIAA 2LG4A 3ABTA 3ERED 4M9XA 3BTJA 4N9IA 1KQ9A 5HLGA 5IT9K 1QO0D 4D1QA 4L9NA 2G7UA 3QRFF 4WXHA 2FA5A 3K1NA 5E3LA 5LGTA 5JVTA 4IRHA 3MFKA 2P6TA 3PQJA 3HGYA 5B3SH 1X2MA 1UMQA 5E79C 1QHHD 1FMWA 1XSDA 3K4KA 5F08A 2DMNA 2EZLA 4UB8C 3SJMA 4KYWA 1O4XA 4X0GA 1OCCH 2IA2A 4MHGA 1K7AA 2QSGX 2R4GA 1P92A 4CCMA 1CF7B 2ZXHA 2OCCH 2L0KA 2HNHA 1IXRC 2F5CA 3TBIA 2BY2A 3F8NA 2EIKH 4MTDA 4D9JA 1LEBA 2A6TA 4DYRA 2W48A 2X6OA 2DO7A 5CPRB 4EEFG 4JBAA 2CRGA 2JVHA 1DU0A 1K4TA 1QZZA 3OR1C 3M7GA 1X3UA 3PO2J 1H8AC 1R7JA 1K6YA 4G7OF 1EKEA 3Q9VA 5EJCA 3J81K 2OU2A 2E5NA 3GYHX 1MDMA 3ZMSA 2O8KA 4EJTA 3WTVC 1BI1A 1MJBA 4XORA 3L7WA 2CUJA 2MC4A 4P96A 1K4SA 2EB7A 4LITA 3EDPA 3WODF 5HS9A 5LRRA 5JHUA 3K9TA 3OYKA 5DUKA 1NTCA 4XLCA 3CJTB 1QHGA 2HDCA 3A03A 3GX4X 3AL0B 4RB3C 2FUG2 2DU9A 1IXCA 2KIUA 4L5IA 2XPWA 2ZFUA 1OCTC 1SD6A 5CQGA 2AXLA 4MEYF 2D5VA 4Q4ZF 1E3OC 4PUSA 1ODDA 4G8XA 2BW3A 2EV6A 4UVBA 4UXNA 3IH2A 1T56A 1BL0A 2CW8A 1QBJA 2EA2A 2CW7A 3HJEA 3PUBA 3ZPLA 1G8XA 4JQFA 4M3FA 1YYVA 5GAGJ 4QTRA 2Z99A 2L7MP 2IVMA 4RB2C 1OQYA 1T38A 3DP7A 1J7KA 3HOZJ 2FSWA 3BG5A 4M3DA 5E8GA 3EQLF 4XIDA 2OC6A 2M87A 4BAYA 5D5XB 1LDKB 2DA6A 2P5VA 2ZJRF 1YJWI 3ESWB 2JA7J 3RKYA 3JSOA 5LGNA 4LB6B 5F0HA 4HLYA 1WZ2A 3NEUA 3CC7I 3PSIA 3OV8A 4CH7A 2DJNA 4HPQA 1AHDP 4CCOA 3EUAA 2O5RA 3IL2A 3O6BB 5FLXZ 1R1UA 2F5DA 3DCFA 3CJNA 4LG0B 1ZARA 3BOQA 3J7ZI 4A5MA 3IWZA 2IS4A 3VDXA 1ITYA 3VWBA 1MBJA 1POGA 4AM3A 1UG2A 5H2FC 2EV5A 2FQ3A 3QPSA 1SFOJ 1RZ4A 2KZVA 4XONA 3RI4A 1TZLA 3BQZA 1Z77A 2XB5A 4H4KC 3F22A 1ZREA 2YX4A 2DOEA 1J59A 2NNNA 1XMKA 4WXDA 1OCZH 2ZNYA 3S93A 3OL4A 3PUFA 4A93J 1LNWA 2WY7Q 5FKOA 3CCJI 1FOKA 3QPHA 3FIWA 3OYHA 2R7QA 2X1EA 3F6OA 4XSZF 2JQ7A 2BY3A 2CQ7A 3OSGA 3OYEA 2LY1A 2VC0A 4L9JA 2M5WA 5DCMB 2L9SA 1MJ9A 4BQQA 2Y31A 1IN7A 3A0BC 1BC7C 1RR8C 3REOA 3OSFA 1G59A 3FF5A 1P6RA 1YS7A 2CUFA 1ZR4A 4UNOA 4A0YA 4ESFA 3I56I 2FE3A 1A04A 3F8BA 1VQOI 1JKRC 1I3AA 3DV8A 5LLQA 2CUEA 2KLOA 4XICA 1ETQA 3LA3A 4BE1A 4ETSA 3C18A 1GXQA 1XD7A 3CJQB 2QEXI 2L02A 1MH4A 1YQAA 4BU2A 2YU9J 3ZCOA 4GYGA 2GA1A 5HDNA 2HOSA 3K2AA 1DP7P 1BI3A 5E3OA 2IGMA 5M5XJ 1MH3A 2OF7A 2XAJA 4MO7A 2DFIA 5E1WA 2ISZA 4U0VA 2DFHA 3A4CA 2D2WA 5AIQA 2WAFA 4UVAA 1ZGJA 4IKFA 1FC3A 3FBIB 1TWCJ 1FBUA 4N4NB 4NUBA 2QWWA 3ULQB 2Z33A 2LF7A 4OIPF 4UHTA 1FTZA 3BC8A 5F64A 3IH4A 1PP7U 4WX9A 4A6EA 5BOXA 3Q0VA 1X1DA 2ZCWA 3BG6A 5ICFA 4ESJA 4TV7A 2HEOA 1KU3A 3SDGA 3OY9A 1LE8B 3JRCA 3S17J 4BQOA 3S1MJ 3CP8A 3V8LA 1OFCX 1ZRCA 1TC3C 4RGUA 5ILUA 3JTHA 3ELKA 2DXIA 1JI8A 3HOWJ 5HNFA 3A01A 3WE2A 5DCMA 2HYGD 1A6IA 1FIPA 4M3GA 2VBYA 4BHCA 2V7FA 3I5UA 4IZZA 1S6LA 2XPUA 4XLFA 3R0AA 4EM2A 4ZYDA 3PO3J 1I27A 3CLQA 3DLAA 2AHQA 4A3MJ 1WJCA 2XF7A 3CO7C 2DA7A 2ZSHB 3RDIA 1X4OA 3W6KB 2DJIA 4RLFA 1YITI 2E2IJ 3DTEA 1ETWA 3D5RC 1HKTA 4A3BJ 4IHSA 3HRUA 1WKMA 5IPAA 4NB5A 2R5YA 2GLOA 3K69A 1TWFJ 3QODA 4G7HF 1WJFA 1I6XA 3RSNA 1R4MB 1W7PD 4LK1F 2W57A 3ONQA 1BJAA 1B9NA 1TQPA 1WI9A 2JRTA 5DV5A 3MKZA 2FBHA 2M3AA 1T0FA 3ASOH 4CO8A 1ZTRA 2CQQA 1Y6IA 3DXJF 3QPLA 3WU1B 2OQGA 4IL6C 1TP4A 4FHTA 3W6JB 4FASD 4XLHA 3BR0A 3G3ZA 1S5LC 3G71I 2O03A 2LF8A 2DMQA 4IRIA 3JRGA 5FRNA 2JJ7A 3JR9A 3H92A 3KZYA 4PDKA 4DIQA 3VYUB 1JGGA 2RAEA 1BN5A 3WG9A 2B9SA 1ZQ3P 4RM2A 1SC7A 3ZQIA 2GIVA 3GO5A 4HV5A 4RAGA 3LSRA 3H0GJ 3MKYB 2R0QC 5M3FJ 2RNJA 3BZCA 1KA8A 1YW8A 3FDYA 4XKBA 5D8LB 4DNCA 3CC2I 5BPDA 3GLXA 1A6QA 1RUOA 1V5EA 4S04A 2LLKA 3P9IA 1L3LA 2LRDA 3H5AA 1Z05A 3OYNA 3JRFA 4I7HA 5FFZA 4EJOA 1D0XA 1FPQA 1W5SA 2E36A 4BXUA 3BG9A 2E71A 1NG6A 1GXPA 4XOTA 1FLIA 1T33A 4XLAA 2M8EA 2MH9A 2EFNA 3M1EA 2J5OA 3WTWC 1WRJA 4CGZA 2H8WA 1QQIA 4E7HA 1WHUA 2PJRB 4RLQA 2WAQN 4YFNF 1TWGJ 4EATA 2WTEA 2MYSA 4M6VA 3HB9A 2TDXA 3KCCA 1P2FA 5EEHA 4B3XA 4QPOA 4A3IJ 2VL8A 3W2AA 3O8HA 1WWXA 3ZN1A 4HNTA 4B3AA 2VC1A 4CDGA 2WC2A 1UG0A 1PP8F 2GZWA 2AXTC 3GCMA 2DAOA 2KQRA 3FXRA 2QCOA 3HOVJ 3AG3H 1GUUA 1MBGA 4XRFA 4U88A 4HRIA 4WK8F 3OL3A 2CO5A 3ZQGA 4XRSA 2WAEA 1DP3A 4XNFA 5E3MA 2UXXA 5EGOA 1FY7A 3E5XA 4PFPA 3I4MJ 1CF7A 2HZTA 4RBOA 3LSGA 3SZTA 5KAIC 3PNTA 1USSA 4HDVA 4AIJA 1TW2A 4AIHA 1S7OA 2VPRA 1SANA 1TWHJ 1WJBA 4RAZA 4UB6C 5EZGA 1HKSA 4R8HA 2COBA 4HOBA 2E19A 2X1CA 2XAQA 2E35A 3CUOA 5C44J 3CTAA 1XGOA 2WAQA 3JAMZ 1PYVA 1D8JA 1N78A 1MBEA 1D1BA 3C7JA 4KFCA 2Z1DA 2VPLA 1HOMA 2NOGA 1XN7A 2BHZA 2GIZA 1R36A 2R7TA 1NK3P 5FJ8J 5BMZA 4OAYA 3EUHC 3ABUA 3AKZA 1JTXA 4DQ2A 2F5EA 4F7ZA 4WWCA 4IHTA 3GFLA 1BR4A 3HKZN 3BWGA 4LFUA 4RGRA 1B6AA 3MCZA 1Y0UA 1X3ZB 2CFOA 4XOPA 1VQKI 3DPTA 3GTMJ 5ERIA 2LK2A 3EETA 4MTEA 2L7KA 5GP9A 1IRXA 4ITVA 2FOWA 4JP0A 2BYVE 2JZYA 4IVNA 2PJPA 4AIDA 5L3EA 1RRJA 2HQNA 1TWAJ 1OCOH 1LUJB 4WCGA 1BI2A 1A36A 3WGIA 1B8IA 1MW7A 1O7LA 2IGKA 3CUQB 2CQXA 3GTGJ 3OYDA 5K5QA 4A3LJ 3O2PE 3JAMK 4ENKA 2F4MB 3K4CA 3S3MA 1R5GA 2MH2A 5KK1A 2VUMJ 4L5JA 2HYFA 3S8PA 3S1RJ 2CW0F 2LNBA 2QF7A 5GADJ 3LAPA 1V54H 2FJ1A 5IT3A 6PAXA 2JT1A 1LDDA 3H9GA 3ABLH 3WE3A 5IOZA 1Z9CA 2XKPA 5B66C 1FOYA 3BCAA 1D8KA 3K7AJ 3F72A 1B72A 2K9NA 1HW2A 1UAAA 4XLPF 2JA5J 5IYBJ 5EEAA 1B4AA 5HS7A 3RKXA 3ZP5A 1T98A 2YUSA 3VODA 1BIAA 3KIOA 1PUFA 5E1ZB 3H35A 3CJRB 4RGXA 4HNVA 3PFIA 3O3KA 4QWQA 5CVIA 4AIKA 4QSHA 3DQVC 4QLCU 1ETXA 1IN4A 3L00A 4L0YB 2EV0A 3Q0UA 3COAC 4F3QA 1IUYA 2NVTJ 2EJRA 2VB6A 2VKEA 5EF6A 3MQ0A 2DFFA 1HA8A 4FE4A 2E1MB 4CICA 5E17F 4CYDA 1S7AA 2BXYA 4C2MJ 1F4KA 2B7EA 2XV4S 3ZMUA 2HWVA 5CYVA 2EQRA 4ZYAA 2X1DA 5LHHA 2ECCA 2JPCA 2HPIA 2JUCA 1HKQA 2P8TA 1E2XA 2JA8J 3PNVA 1YX3A 2M7AA 3UKGA 2HR3A 2ACJA 3ZN0A 3JRIA 2AQEA 2O6GE 2CV0A 2V1NA 4HF1A 4HYEA 2EK5A 1FZPB 3TQNA 4YFXF 1X3WB 3FBNB 4YIRX 1XSXA 3GZNB 2MABA 3C3WA 2WV1A 3PIPF 2UZKA 3CCQI 1Y1WJ 3L2CA 3W2WA 5LFAA 2VKHA 1A5JA 4XL9A 1OR7A 1HW1A 1U6GA 3A2KA 3KP2A 4XK4A 2WWYA 2ZNZA 1APLC 1YG2A 5L3FA 2MLKA 2MD5A 2L5QA 3I9V2 4YIIA 1IJWC 1VF9A 3GVAA 2L01A 5JLXA 3LSIA 4ZH4F 2TRTA 2OTJI 5B1BH 1R6RA 1W5CC 4B47A 1Z21A 2LR8A 3K1PA 4J01A 3OMYA 3OYBA 2XRLA 1ZYRF 2VQGA 3CCSI 2WA0A 1ZLKA 2CYYA 2R3SA 1K6OA 2W84A 2K40A 4UUTA 5F1JA 5F1RA 1AU7A 1PUEE 2H6BA 1HW5A 2KJBA 3JW4A 1LVKA 3NQOA 2H27A 2ESHA 2LKXA 1MSEC 5ILSA 5ILVA 3HC7A 1B59A 2K9QA 3IKTA 4V19K 1YE9A 5F27A 3BJ6A 1Z6TA 2XAFA 1Z7UA 3C2GA 3JRDA 4I09A 3ECOA 3K0LA 3TW7A 3IAS2 1JHFA 1SFEA 5HNHA 3S1NJ 4GYIA 5IP9J 1R5ID 3MAJA 3ZQFA 1FWZA 4EMSA 1SD5A 3QYFA 2F4OB 4EGZA 1ZGAA 5IP6A 1IC8A 3QWLA 2EZKA 4CXFA 5FLVA 3L09A 2HVQA 2HXOA 2BGCA 3E6BA 2JUGA 1YHQI 1YI2I 2LKSA 2CU7A 3DU5A 1FSHA 5LD2C 4BUPA 3BLYA 5J40A 1M1EB 2K4BA 3SYTA 4QPQA 3HUGB 1J9IA 2PN6A 1JT6A 4OAZA 1BW6A 5GAEJ 2XC7A 3S2HJ 2B0LA 4F92B 1U5TA 3K4JA 1HSJA 4M71A 2M9HA 3NRVA 1GDTA 3QU3A 5FD5A 1R22A 4A2UA 3EPZA 2WADA 3E1SA 3K4NA 1IXSB 4I0AA 4EQQA 1E0EA 4LMYA 2HOEA 3RPUA 1LVAA 1YTYA 5AONA 5D5WB 2TCTA 3HDDA 2R7RA 4HF2A 2ESNA 2VODA 4XQFA 3FXOA 1UHSA 1JJ6C 4RDUA 1R5HA 4DGWB 1BR1A 2QGUA 2VT2A 3JRHA 1WSUA 2FQ4A 3OOPA 4M6XA 2EFPA 3I58A 3LL7A 2Z2SB 4KNYA 3R6SA 1XSVA 3BZ6A 4R79A 3CMMA 4UV9A 3CZ6A 4BL0B 5DM6F 5FKKA 2KISA 3BPVA 4BHPA 3RKQA 2L9NA 1R58A 3P7NA 2NXNB 3ZMVA 4RM3A 4HV6A 1FP2A 3S2DJ 2PX9A 1E3PA 3I71A 4ZYGA 4FQGA 2Y75A 2OUMA 1VQNI 4KT6A 2DA4A 4RAFA 3MMYB 4A3FJ 1OISA 3P9KA 2EINH 2R7DA 5EG0B 5A2QZ 2VE9A 5LRSA 4Y3OA 4IF4A 2QBYA 3K70C 2Y0MA 2HQ5A 2XSDC 4UY8I 2G7HA 3IRRA 1EH8A 2FEZA 3HUGA 4CCJA 2M1BA 2Y30A 1EV7A 2CUZA 1LPQA 2OZ6A 1SFUA 5D8KB 5K1YA 3S2WA 4J19A 1DUXC 1Q1HA 2M2EA 4KIFA 3QOPA 3SQNA 1HF0A 2JWTA 1U5TB 5FO5A 2HS5A 2C6YA 3G2BA 3JCUC 3V7CA 2LP0A 4KDPA 3BZKA 3IHUA 5M3MJ 2DN0A 4CSWA 2BOLA 2W85A 2X6XA 1JXSA 4XMYA 4M74A 2QSHX 1MZBA 4RB0A 1LJ9A 3DEUA 5GTHC 2KL4A 5ICEA 2VJJA 1WJEA 2K86A 4MEXF 3K1MA 4WF2A 2V6EA 4LB5A 3NWSA 2I5UA 2FOKA 2LREA 1V5GA 2VQLA 4BHBA 1I50J 4KUMA 2ETHA 1P7IA 2A5YB 2LSOA 3CQZJ 2XGXA 4ZYHA 2BY0A 1R1VA 1L0OC 2NVYJ 2W82A 4MFEA 4GDFA 1V5FA 2ME6A 4LLGF 4NQWB 2Y9ZA 2PBIA 4EVIA 2ZMEC 3MVPA 3HOUJ 3B6AA 4OWRB 3SEQA 2DDAA 1GHCA 2P5LC 4M72A 4Q48A 4ANJA 1H0MA 4WXCA 2NNYA 2K85A 2O3FA 1WJAA 1UHMA 4KT5C 3K6GA 1AA7A 1N77A 4JYKA 1U9NA 3HXLA 5DM7F 1SMYF 2FBIA 2ZJ2A 5F0CA 1G3TA 3SZPA 3KZIC 5D5UB 2O61A 2F5FA 4XLEA 5HDGA 2QSFX 1KGSA 1DDNA 1VNDA 3S14J 2R7VA 4KMFA 3VSKA 4A3JJ 4LK0F 2RV8A 4NBQA 1XCVA 2A5WA 2OCEA 2UXNA 3VEPA 4E4HA 2NYXA 3RZDJ 1FOWA 5L3DA 2QUFA 2KP6A 2Z9OA 1MNEA 3TOBA 4XR6A 2JN6A 3B02A 5EEGA 4JOMA 4BY7J 1WJ5A 4OINF 4BKXA 4IJAA 3WHCA 2XF5A 1D1AA 1JUMA 2E5ZA 1ZN2A 4II2A 5C4JJ 3EUHA 1FBSA 1YIJI 1HDPA 3FHZA 4FE7A 2H6CA 1J09A 1NK2P 3WTSC 3CC4I 1GV2A 2AS5F 4B48A 5A2QK 3M07A 2YPRA 4M3BA 5KAFC 3HOTA 3SDBA 2M45A 4Y4RA 2Q2EB 4LLNA 2HKOA 4LIVA 4AVPA 3LSHA 1YRNB 4JK1X 5CVUA 2L7FP 1BM9A 3F0CA 1FYMA 3CESA 3EYIA 1IO2A 1OCPA 1QPMA 2E60A 4C2UA 4Q47A 5FKLA 4UUSB 1ETKA 4HAMA 4A69C 1SFKA 3IC7A 2KDZA 2PMHA 1NHAA 2O7OA 2QKMB 1VI0A 3WGGA 1OLTA 5M5WJ 3CD6I 3BQYA 3ZXSA 3W6VA 4GFBA 1I1SA 4PJJA 2Q8KA 5DD4A 1B9MA 2QKLB 3GTQJ 3K70D 3S32A 3KEYA 4IHYA 2RKHA 1KU7A 1D0YA 1QGPA 5DYMA 4BJ5C 4U0YA 1OYYA 4CZZA 3QYEA 4HLXA 4LD5A 2YX7A 2QQAA 4KIBA 1K61A 1XMAA 4P5OA 3BR1A 2GAUA 3OWTA 2VN2A 3A02A 3KYLA 3T5XA 5BQTA 1IG7A 5K5OA 1H88C 1YIOA 2IS2A 2F2EA 1Z0XA 1G3YA 2F4IA 2CH0A 3H5RA 5KHDA 1KYWA 2K27A 2OJED 2W24A 3FWEA 4OU0A 3E97A 2X4HA 4N4OB 4EGYA 2MA3A 1VQ7I 2HI3A 1TNSA 4JX6A 4BACA 4BDYA 3ML6A 2BBYA 3HRTA 2XAGA 3DBHB 3VB2A 1JJ8C 3S16J 2DMTA 4N9HA 3B73A 4BXFA 3CCVI 3J80K 1PVEA 3J81Z 2XGEA 3KE2A 5L3GA 1DPUA 1ZK8A 3CLOA 4AC0A 1VQ8I 5IOYA 3TDUC 3L2VA 3OR2C 4CYCA 5J4YA 3LSKA 4BJ6C 5IYDJ 4C30A 1BA5A 3M8EA 2QVOA 2GA2A 3PM1A 3CUQC 2XKOA 4MIMA 1X4PA 4NC6A 5HLTA 5FLMJ 2F6CA 2A07F 2M34A 1UJ8A 1REPC 2Q0OA 3LFUA 2DLLA 3F8FA 1J5YA 3C2HA 4ZC3A 5FROA 2HOAA 2DT7B 1F43A 1TLHB 2FX0A 5B5EC 2A05A 4C3HJ 1O3RA 2DMUA 2IBDA 5ICGA 3E7LA 1QRYA 1K83J 3FHNA 2A61A 2XIGA 3HSRA 2H09A 4M3EA 3DPLC 2VE8A 1RI7A 1X58A 2DMPA 5M5YJ 3T8TA 2LBFA 4G6QA 2LY9A 4PCQA 1EF4A 4LG3A 1FBQA 3CMYA 4YRVA 1JT0A 2ZJPF 3N05A 1AKHA 2B63J 1SAUA 2KPMA 3C2BA 1ENHA 3VYTB 4F93B 1V3FA 4HQMA 3FXMA 3F8MA 2ID3A 5EYRA 1KU9A 3RJPA 2PEXA 1T08B 3V4GA 3LMMA 1GLNA 1QVTA 4Y15A 1TL8A 2MFZA 3FXLA 4NC7A 3RQIA 1S8NA 3JREA 4G7ZF 5IT9Z 4CCNA 2VIXA 2Y0SA 5D5VB 4U7DA 3IUOA 5L3BA 1BJZA 2RQQA 2UUZA 1J75A 2QBYB 3FMSA 1OR7C 4MGRA 1HQCA 5HVQC 2XVCA 2M0MA 3VFZA 2LY2A 1DU6A 2K4JA 3MWMA 1ZG5A 1GV5A 1QVUA 4FX0A 3FM5A 1VQ9I 3JSPA 2EH3A 3M8FA 2VJ4A 3BR3A 4IPAA 2GXAA 1ZH5A 3B6CA 3HOSA 1BC8C 1RPWA 4FISA 3M8JA 2STTA 1RETA 1FYLA 2X6YA 3LOCA 1VTNC 2KRCA 2DA1A 4JX4A 4D0PA 5JR3A 2CMPA 3HOXJ 2MBFA 2R7ZJ 2DQLA 3IWFA 4II3A 1MMDA 2H1KA 1Z67A 2R7FA 1WH5A 1XG1A 2IAIA 1IRFA 3ZMZA 2DOAA 4S05A 9ANTA 4LG0A 4OMYA 4Y33A 2V1XA 3G4SI 2KMUA 2D1VA 4GRIA 2FF4A 2XHKA 4RS8A 1TNTA 1OMIA 1UZCA 1RC9A 4B4CA 3CMAI 4E7JA 1XB4A 1WGXA 2DT5A 2STWA 3KP7A 2QZ8A 2IT0A 4H0EA 3FISA 2QA4I 1T95A 2BZTA 2JPBA 4A5NA 5J8FA 4B8XA 2RDPA 3I59B 3Q9SA 1WCMJ 2EFQA 3HHGA 3K2ZA 5ICCA 3BR2A 1JE8A 3Q0WA 4EJWA 2V6CA 2VLAA 1I5ZA 4G6DA 3ZGKA 2KJCA 3HSFA 1G2HA 5FKMA 1MJAA 3OS0A 3QU6A 1VQLI 1OYWA 3GLLA 2HU9A 3I0TA 5J47A 2GOMA 3ZMTA 4L18B 2GOXB 1D0ZA 2EBIA 3DTIA 2G0EA 1DPRA 4AUXA 1MD0A 2N8GA 2VKVA 3QQAA 3CP2A 3GTOJ 2JVGA 4ABZA 1ZLJA 3H3ZA 1TQIA 3BROA 4GGGA 4CCKA 5EG0A 4J00A 4G12A 1VQ4I 2ZSIB 2XASA 1BIBA 2CG4A 5FB2A 2ISYA 1F1ZA 2EFWA 2HVRA 4BH9A 3G6EI 1P4AA 2L7ZA 1RKWA 3HKZA 1IGNA 3QPTA 4I0BA 2O0YA 3MN2A 3C1DA 5CJ9A 3TW6A 4AWXB 2DCEA 4PGHA 3F23A 1LB2A 1MSFC 3J7AY 3CDLA 2QQ8A 1A35A 2ZFWA 4BGDA 1VQPI 5H6RA 4BE0A 3HRMA 4BQAA 4Y7NJ 2O8XA 3M1CA 5FKNA 3GUDA 4RA2A 1SAXA 4D7NA 2HFHA 5GPCA 4A3EJ 3BR5A 2JRMA 1Y39A 4HW0A 1XGNA 4B1RA 5TISC 5C3EJ 1MBKA 1BW5A 1YJNI 2COMA 5H20A 4FETA 1Q1VA 4DJAA 5J1RA 2V1UA 3QOEA 2DBBA 2DTRA 3EYYA 2RREA 3J7AO 3KP6A 4PZJA 4XKCA 4PSWA 2HYJA 1XGMA 2FMYA 1Y56A 1TW3A 4ZTFA 1Z1DA 3KP5A 3CDHA 2IRFG 2DPUA 3CCMI 1Z3XA 1UELB 1K78B 2CV2A 2BEOA 2VJ5A 2X51A 3H3VK 5FD6A 3H5NA 3HL2A 4HQEA 1AWCA 2V79A 2VT3A 1X1PA 2IXSA 3LSTA 3S3OA 3F6VA 3QP6A 4XN0A 4ON0A 5KVRA 3M3YJ 1QU3A 1R49A 1N25A 4E7SA 2YR2A 3G1OA 4XSXF 2EILH 4YIFA 4BJTA 3RPQA 1WPKA 4AYBN 1JKOC 3U2RA 1O57A 4EJVA 2DYRH 3OIPA 3FMRA 4AD9A 1KQ8A 1VQ6I 1OJLA 4HX8A 2PI0A 2PMUA 1ZRFA 1J0RA 3LAJA 4PJLA 4Z6YA 2DK8A 2ID6A 2A6HF 2IA1A 2HQAA 3DU6A 4BXXJ 3HPGA 4ESBA 4IOCF 3TL4X 1BBYA 2VXZA 2VBZA 2DOFA 2K3FA 2X6WA 3BY6A 1P7JA 3WTYC 5CQEA 1V55H 5E20A 3GBGA 3BPXA 2ZBKA 1UCRA 2R93J 5LBQA 2OBPA 4E7ZA 2K5CA 3TKYA 4OIQF 2NS7A 4BE2A 3IP4B 2MG4A 4QIWN 1DGRM 4EV0A 4E7LA 2VBWA 3VYRB 3BP8A 3DLLF 1Z91A 3I54A 2HVSA 1R4NB 4IX7A 2YSRA 3OS2A 2M8GX 1U3EM 2X0LA 2K9LA 4M73A 4BDZA 1MNDA 3GFMA 1ZAOA 1MIJA 4AYBA 1NH3A 2HDDA 1FJLA 3HEFA 4KN4X 1FYKA 4B43A 1XDSA 3WU2C 3DEWA 4P1WA 2CQNA 2OV7A 3A1YA 5E3NA 2DQRA 2DPDA 4MNUA 4IO9F 3HGGA 5BPIA 5HLIA 2ICWG 4PJNA 1LFUP 2HZDA 2JMWA 2RC4A 1IN6A 2ZC2A 1OPCA 1VZ0A 4MFDA 2CFXA 4IHXA 2ZXJA 2R5YB 1PJRA 2IJLA 1JUSA 4CUGA 4I98B 2YS9A 2OD5A 2QQBA 2NVUB 1FP1D 1SMTA 1IF1A 4L9VA 2CGPA 3DBRB 2HTSA 1S72I 5J1UA 2VI6A 4XBFA 4A0ZA 2HXIA 3VOEA 1IV6A 5DD8A 3LNQA 2XSJC 3GTKJ 1XGSA 2XAUA 4BBSJ 1T0FC 4ZYEA 3OYAA 4Q5SF 2K7LA 3KEOA 2EWNA 1BR2A 4GXOA 3V7SA 5K7HA 2HDWA 1HBXG 4W97A 3BJOA 3HTUA 3GXOA 3NARA 3G73A 1P9QC 5JI6A 1RR7A 5LGUA 4E7KA 1MBFA 2EZHA 1S7EA 2ELHA 3TO6A 2P7CB 1KYZA 2PG4A 2E7WA 3BJAA 5DEQA 2GXBA 4U87A 2VOOA 2R7UA 3TOAA 3IV5A 1B72B 3HOYJ 3U1KA 4ASNA 2W1OA 3GEZA 3GFIA 1ULYA 1YOVB 3FXJA 4B44A 1HC8A 4HF0A 2E1MC 3BG7A 1FTTA 2LMDA 3HYIA 1F5TA 2H94A 1RUNA 3BR6A 4X1EA 4KMUX 5FGMA 4KICA 1JUPA 2DTZA 3TMOA 3MZHA 1U8RA 1GT0C 4XKVA 4A3CJ 3HZJA 2RGVA 3H1CA 1ETVA 3MZ8A 3V8JA 3I59A 1BI0A 4D7MA 3H3UA 4UUSA 1DGWY 1FOXA 4PJMA 2I8DA 2H8RA 3OYFA 1T8IA 2ZMEB 4HDUA 5CKTA 3KLNA 3FZVA 2DODA 4HBLA 4U7BA 1ACIA 1F9NA 1T39A 2GM4A 2MSYA 4I01A 3TO9A 5LHIA 2BHYA 4ZZDA 3KETA 2NS8A 2KKOA 2L4AA 4NQWA 1ZHFA 2BXZA 2QENA 2KIFA 2KZGA 4IQJA 1XMXA 2K02A 2HKXA 3FK7A 2IS1A 4HSRA 5FLXK 1YW7A 5JFRA 2CWEA 3DTKA 3LSMA 4A3DJ 1ZELA 2EFOA 3H9QA 3KX2A 5FFXA 1VQMI 3RCOA 2KFDA 2VXDA 3AG4H 5D4RA 1WVRA 2JK3A 3BTIA 3BCBA 3DKXA 4CHUA 3OS1A 1IRZA 3GTLJ 4DOZA 1TBXA 2FBKA 3S1QJ 1JKPC 4XRMA 2Y48A 4U0WA 2NVXJ 2ELKA 1RESA 2GXGA 1WI3A 2CJJA 1MMSA 3OIQA 1X1CA 3CUQA 3KPHA 4BQNA 5HDKA 3TP0A 3WU0A 3KFWX 3CDIA 2RNGA 4DZPA 2Z16A 3GTJJ 5LHGA 2A69F 1H9GA 2KDOA 3DF8A 5CVJA 2L9VA 5TRDA 1XX5A 5EZHA 1LEAA 1XCBA 2HQRA 2A68F 1J2XA 4DYQA 2QLZA 5E8IA 4IHVA 3L9FA 3LQQA 2NOJB 3CMEI 4MQVA 1MMGA 2IP2A 2V9KA 3LSJA 2ZO4A 4EJUA 1OKRA 2IPQX 2WB1A 2FU4A 4RGSA 5KCMA 2K9MA 1ZG3A 1HCRA 4K2EA 3ZQHA 2GQQA 4YFKF 3TP3A 3E3VA 2ADUA 5GTIC 2FMLA 2E1CA 2DA5A 2W4SA 4G94A 3L2QA 2QM3A 1JKQC 2NS0A 3FXKA 4BEHA 1D3YA 3FXUA 4ENJA 3VPRA 1QPIA 3KEQA 1O3SA 2V4JC 2KRHA 1I6HJ 3R0JA 2JSPA 3FMQA 2M4KA 2LD5A 1G3SA 4OIOF 1ETOA 3PFYA 1PUFB 1S29A 1IW7F 2MGQA 1TT0A 1QZEA 3UR3C 4JX5A 5D6EA 5K5RA 4NC8A 2CSOA 4M9ZA 1O7FA 1XTAA 3OYIA 4FX4A 2LFBA 1R23A 3SFZA 1R1TA 1DQUA 2FNAA 2BW3B 4D5FA 2L54A 4XN3A 5L3CA 3V42A 5J3LA 4C3IJ 3PQKA 1MMAA 2HOTA 4YEJA 2LH9A 2RQPA 2FRHA 3S15J 3QYBA 2WV0A 3I64A 1EA3A 4I6ZA 3K4LA 4I02A 4I99C 3HSEA 1ORKA 3DKWA 3AG2H 2PQ8A 4FT8A 1W4MA 2AQFA 1SEUA 2M7BA 3FXQA 1FEXA 1B1BA 2L4MA 4XLNF 1UB9A 4HZFA 3K4MA 1U9OA 3ERMA 4PJ0C 4FCYA 3E5UA 3L2WA 3KYDB 3SEZA 3BT9A 1ZKGA 3OOUA 1NG7A 1W1WE 4NDLA 5E1XA 2M30A 4BBRJ 1W36D 3R61A 1FMVA 2DA2A 3R60A 4GCVA 4PFOA 3RKWA 2XPVA 3KP3A 3H0DA 2E2HJ 2UWMA 4BY1J 3RZOJ 1ZG1A 1HLVA 2IEKA 2XDVA 2R5ZB 2R7XA 3MEXA 2BVLA 1YJ9I 3PSFA 4LLLA 2NRAC 4IHWA 4CCLA 3M9AA 4V2GA 3DEEA 3L2RA 2MW8A 1TTYA 3U9GA 3RYPA 1R71A 4P9FA 3OYMA 4A12A 1W36C 3PJRA 4KISA 1U0JA 2EIJH 1SVMA 2LVSA 4Z2YA 2KIQA 1BOAA 5KNLA 1Z7LA 5DCFA 4C9YA 5JHFA 1SD4A 3HIFA 3JRAA 2A3SA 3OYLA 2LDUA 4RAYA 2Y9YA 1RNLA 3M4OJ 3DWLE 4Y17A 4PSXA 2J5PA 3J7YJ 3RYRA 2PFBA 2M4GA 1F36A 2UV1A 5F6FA 1ERDA 3W2VA 3N97A 3ROUA 3H36A 3HHHA 1IZ1A 4A0XA 3CF2A 1WH7A 1V4RA 2V9VA 2ZMEA 3U21A 1IAWA 3V7RA 5J8CA 1ON1A 1XC5A 3ZQQA 3CCYA 1N75A 3CCRI 4RB1A 1Y1VJ 1D1CA 5HLHA 5HOOA 3IH3A 1YS6A 5BNGA 4HSTA 3OIOA 4F55A 3G1LA 2VASA 3ZR8X 2QYOA 4Y13A 1K79A 1SFXA 4DYCA 2JTVA 1EJ9A 2ZJQF 2LTPA 3GW2A 3GF2A 4OIRF 3L1PA 3QAHA 2OA4A 3A0HC 3FM3A 3WTZA 3KP4A 4W1UA 3E6CC 4A3GJ 2R7OA 3Q3SA 4UV8A 5DDGA 1YX5A 2DI3A 4ENNA 1W0UA 2F48A 1O3QA 1UFMA 3AAFA 1T6SA 4C2TA 3IRQA 3HTSB 2V1DA 5EGOB 2RN7A 4OOIA 1I1GA 2P5KA 4OMZA 4DZJA 4A6DA 1MNMC 1G3WA 5H6QA 1HSTA 2JSCA 1Y8QB 1WFXA 3RIRA 1Y8RB 1BOBA 3IKVA 3K4BA 3P5JA 5BS6A 5JVGF 3ZRGA 1XPXA 1GVJA 2AO9A 3L2UA 1G6NA 3SFIA 2OTLI 1Z6RA 1W5TA 4IEJA 5HODA 3PNYA 1U2WA 4E70A 4O5VA 3Q5FA 2VOPA 3TGNA 4X6AJ 4ZTJA 2X9DA 2LC2A 2Q1ZB 3D5LA 3SXYA 3V8KA 2HTJA 2PMZA 1I39A 3GWZA 2DA3A 2XGCA 1KZHA 1XS9A 1VQ5I 3DFGA 4A3KJ 1A31A 1ZRDA 4F52A 5JLWA 4ZDLA 4F91B 1K78A 3CCEI 1W0TA 3BDDA 2XAHA 3WHBA 4BEHB 1E17A 1AKHB 2ZB9A 3I4NJ 2IGNA 4UUVA 1EH7A 2ZKZA 3BTCA 3CO6C 1R00A 2YU3A 4DW6A 4E7IA 3MD2A 4PGGA 3RTRA 3H9JA 5LEJA 3WTXC 3ZMDA 2R7WA 1HXDA 3N4MA 3DPUA 2CS3A 4BYYA 2FNPA 2G9WA 3T8RA 3X2QH 2X48A 2RVCA 4XRSG 2OZUA 2P0WA 4PK4A 1H89C 5D6FA 4KITB 1X2NA 4E6KG 1Y0NA 1FX7A 2DDBA 1LFPA 1IV8A 1YFHA 2P6SA 4UVCA 2I10A 2D1HA 2KHMA 3SHFA 3TDZC 2WBMA 4HX7A 3VYSB 1ONVA 1YRNA 2P81A 3E5QA 4DBRA 1D5VA 4XKWA 4ZDOA 1YW9A 3ECHA 3WGHA 3TEDA 4ZDPA 2XRNA 2GBYA 5EDNA 1TT5B 2IA0A 4IXAA 2VONA 2IGOA 1O3TA 3DKYA 3IAM2 5C4XJ 3O8GA 4KA4A 4HA8A 3U1DA 4CZCA 4L0ZB 2K3PA 3BTLA 2L3DA 3NWTA 3AG1H 1QZYA 3OYGA 1R9TJ 2Y2ZA 2A6EF 4V2FA 4HNUA 1LE8A 3F8CA 1D5YA 3LQRA 3LWFA 2LOOA 2XGDA 3AL0C 4N0BA 4ZJZA 4EM1A 2ELJA 4LIUA 1IN5A 1EH6A 4I2OA 3RQ4A 3ZQCA 4B09A 1OYIA 2O9LA 3T0YA 4GO1A 2MLGA 3QP5A 4IRGA 4AU7A 1C0WA 3FKIJ 2E34A 3D1NI 1MDMB 1P4WA 2V26A 2BV6A 4LOCA 2KIMA 1U8BA 1OCRH 1X19A 1SVOA 3P9CA 3GTPJ 1HDDC 5J1YA 2E1OA 2P4WA 5CLSA 1CQTA 5IYCJ 5DUIA 1PDNC 2EZIA 3ISPA 1XDUA 1KQ0A 1MGTA 2P7VB 5GAHJ 2CV1A 5K7FA 2W00A 2K9SA 2MD0A 2DYSH 2L9RA 4HEA2 5B1AH 2R7SA 1Z3YA 1CGPA 3UNGC 3E0JB 3BG3A 1RIOH 4G9YA 1IN8A 1WQ2A 3D0SA 4MLOA 5K7ZA 2H1LA 3NAUA 2FD5A 2OAZA 2ZXIA 2E1NA 5D4SA 5J6XA 2BY1A 5E18F 1KONA 3JRBA 1ETYA 2EIMH 4EM0B 1FSEA 2DW4A 3W3CA 3WTTC 2R92J 5IY5H 1W7PA 1B8IB 3EUKL 2LKPA 5ED4A 5CVVA 1E3HA 1X1BA 1MBHA 3AFHA 4R1HA 3KYCB 2XF6A 1LFBA 3HM5A 4L9TA 2BVMA
chains in the Genus database with same CATH topology
1P4XA 4O3MA 2Q2EA 2PLYA 1T2KA 2QQ9A 2W25A 1JGSA 3GZ6A 4ENMA 4O6JA 3T1BA 3HRSA 2IW5A 3LA2A 1STZA 1LQ1A 3LA7A 3GFJA 3E6MA 3FX3A 1KU2A 5CVRA 2XUBA 2VBXA 1FNNA 4KIGA 2GWRA 5AIPA 3I53A 3MZYA 1QNTA 3KZZA 2Z5UA 1AOYA 4HX4A 3ZQ7A 3E6DA 4ZZLA 1S3JA 1IRGA 1U5TC 3F3XA 2MC3A 4KN7X 4M9SA 3J80Z 3TO7A 4BNCA 4P9UA 4NHJA 1G4DA 1W7PB 2NAZA 3GZ5A 5HS8A 5LEKA 3KLOA 1SD7A 2E7XA 3LFKA 4MQ9F 1H9TA 2FXAA 1LDJA 4P55A 4LGWA 2CQKA 2Z3YA 1YLFA 1USTA 2HGCA 3R4KA 2KRFA 4YG2F 2OQRA 2DK5A 3I4PA 1U78A 4LJZF 3WTUC 2XROA 3F21A 1YO5C 1UHWA 1JHHA 5TJJA 3JTGA 1FT9A 1ON2A 4M6YA 2EA4A 2D45A 2BE5F 1TQMA 1MKMA 3ABTA 3ERED 4M9XA 4N9IA 5HLGA 1KQ9A 5IT9K 1QO0D 4L9NA 2G7UA 3QRFF 4WXHA 2FA5A 3K1NA 5LGTA 5JVTA 4IRHA 3MFKA 2P6TA 3PQJA 1XSDA 4KYWA 2IA2A 4MHGA 1K7AA 1P92A 1CF7B 1LEBA 1IXRC 2F5CA 4MTDA 3F8NA 2DO7A 4JBAA 1QZZA 3M7GA 1X3UA 1R7JA 4G7OF 3Q9VA 3J81K 2OU2A 3GYHX 1MDMA 3ZMSA 4EJTA 3WTVC 1BI1A 1MJBA 3L7WA 4P96A 2EB7A 3EDPA 3WODF 5HS9A 5LRRA 5JHUA 3K9TA 5DUKA 2HDCA 3GX4X 4RB3C 2DU9A 1IXCA 2KIUA 4L5IA 1SD6A 2AXLA 4MEYF 4Q4ZF 1ODDA 4G8XA 2EV6A 4UVBA 4UXNA 1QBJA 2EA2A 3ZPLA 4JQFA 1YYVA 2Z99A 2IVMA 4RB2C 1T38A 3DP7A 1J7KA 2FSWA 5E8GA 3EQLF 2M87A 4BAYA 5D5XB 1LDKB 2P5VA 3RKYA 3JSOA 5LGNA 4LB6B 4HLYA 3NEUA 3OV8A 3IL2A 3O6BB 5FLXZ 1R1UA 2F5DA 3CJNA 4LG0B 1ZARA 3BOQA 4A5MA 3IWZA 2EV5A 2FQ3A 1RZ4A 3RI4A 3F22A 1ZREA 2YX4A 1J59A 2NNNA 1XMKA 4WXDA 2ZNYA 1LNWA 1FOKA 3QPHA 3F6OA 4XSZF 4L9JA 2VC0A 2M5WA 5DCMB 1MJ9A 1IN7A 1BC7C 3REOA 3FF5A 1P6RA 1YS7A 4UNOA 4A0YA 4ESFA 2FE3A 1A04A 3F8BA 3DV8A 5LLQA 3LA3A 4ETSA 3C18A 1GXQA 1XD7A 2L02A 1YQAA 4GYGA 2GA1A 5HDNA 1DP7P 1BI3A 2XAJA 2DFIA 5E1WA 2ISZA 4U0VA 2D2WA 5AIQA 4UVAA 1ZGJA 1FC3A 1FBUA 4OIPF 3ULQB 2QWWA 2Z33A 2LF7A 4UHTA 5F64A 1PP7U 4WX9A 4A6EA 5BOXA 2ZCWA 5ICFA 4ESJA 4TV7A 2HEOA 1KU3A 3V8LA 1ZRCA 4RGUA 5ILUA 3JTHA 3ELKA 3WE2A 5DCMA 2HYGD 2VBYA 4BHCA 3I5UA 1S6LA 3R0AA 4EM2A 4ZYDA 1I27A 3CO7C 3RDIA 3W6KB 1HKTA 4IHSA 3HRUA 1WKMA 4NB5A 3K69A 4G7HF 1I6XA 1W7PD 4LK1F 2W57A 1BJAA 1B9NA 1TQPA 1WI9A 2JRTA 5DV5A 2FBHA 1T0FA 4CO8A 3DXJF 3WU1B 2OQGA 3W6JB 4FHTA 3G3ZA 2O03A 2LF8A 4IRIA 3H92A 3KZYA 4PDKA 3WG9A 1BN5A 2GIVA 3GO5A 4HV5A 2RNJA 1KA8A 1YW8A 5D8LB 4DNCA 5BPDA 3GLXA 1RUOA 4S04A 3P9IA 1L3LA 1Z05A 4I7HA 5FFZA 4EJOA 1FPQA 1W5SA 4BXUA 1GXPA 1FLIA 2M8EA 2MH9A 2EFNA 3M1EA 2J5OA 3WTWC 1WRJA 4CGZA 1QQIA 4YFNF 2WTEA 2TDXA 3KCCA 1P2FA 5EEHA 1WWXA 3ZN1A 2VC1A 4CDGA 2WC2A 1PP8F 2GZWA 2DAOA 3FXRA 4XRFA 4U88A 4WK8F 2CO5A 2UXXA 1FY7A 3E5XA 1CF7A 2HZTA 3SZTA 4HDVA 1USSA 4AIJA 1TW2A 4AIHA 1S7OA 4RAZA 1HKSA 4R8HA 4HOBA 2XAQA 3CUOA 3CTAA 1XGOA 3JAMZ 1D8JA 3C7JA 4KFCA 1XN7A 1R36A 5BMZA 3ABUA 4DQ2A 2F5EA 4F7ZA 4WWCA 4IHTA 3GFLA 4LFUA 3BWGA 4RGRA 1B6AA 3MCZA 1Y0UA 3DPTA 5ERIA 3EETA 4MTEA 2BYVE 2JZYA 4IVNA 2PJPA 5L3EA 2HQNA 4WCGA 1BI2A 3WGIA 1O7LA 3CUQB 5K5QA 3O2PE 3JAMK 4ENKA 1R5GA 2MH2A 5KK1A 4L5JA 2HYFA 2CW0F 2LNBA 3LAPA 5IT3A 6PAXA 2JT1A 1LDDA 3WE3A 1Z9CA 2XKPA 1D8KA 3F72A 1HW2A 4XLPF 1B4AA 5HS7A 3RKXA 3ZP5A 1T98A 3VODA 1BIAA 5E1ZB 4RGXA 3PFIA 3O3KA 4QWQA 5CVIA 4AIKA 3DQVC 4QLCU 1IN4A 3L00A 4L0YB 2EV0A 3COAC 1IUYA 2EJRA 3MQ0A 4CICA 5E17F 4CYDA 1S7AA 1F4KA 2XV4S 3ZMUA 2HWVA 5CYVA 5LHHA 2JPCA 1HKQA 2P8TA 1E2XA 2HR3A 2ACJA 3ZN0A 2O6GE 4HF1A 4HYEA 2EK5A 1FZPB 3TQNA 4YFXF 1XSXA 3C3WA 2UZKA 3L2CA 1OR7A 1HW1A 1U6GA 3KP2A 2WWYA 2ZNZA 1YG2A 5L3FA 2MLKA 2MD5A 4YIIA 3GVAA 2L01A 4ZH4F 3K1PA 1ZYRF 1ZLKA 2CYYA 2R3SA 1K6OA 2W84A 5F1RA 1PUEE 2H6BA 1HW5A 2KJBA 3JW4A 3NQOA 2H27A 2ESHA 5ILSA 5ILVA 1B59A 3IKTA 3BJ6A 1Z6TA 2XAFA 1Z7UA 4I09A 3ECOA 3K0LA 1JHFA 1SFEA 4GYIA 3MAJA 1FWZA 4EMSA 1SD5A 4EGZA 1ZGAA 4CXFA 3L09A 2BGCA 3E6BA 1FSHA 2K4BA 1J9IA 2PN6A 2B0LA 1U5TA 1HSJA 4M71A 3NRVA 3QU3A 5FD5A 1R22A 4A2UA 1IXSB 4I0AA 4EQQA 4LMYA 2HOEA 3RPUA 1LVAA 1YTYA 5AONA 5D5WB 4HF2A 2ESNA 2VODA 1R5HA 2VT2A 1WSUA 3OOPA 4M6XA 2EFPA 3I58A 4KNYA 3R6SA 1XSVA 3BZ6A 4R79A 4UV9A 3BPVA 4BHPA 1R58A 3P7NA 3ZMVA 4HV6A 1FP2A 3I71A 4ZYGA 2Y75A 3P9KA 2VE9A 2R7DA 5A2QZ 5LRSA 4IF4A 2QBYA 2Y0MA 2G7HA 3IRRA 1EH8A 2FEZA 3HUGA 2M1BA 1EV7A 2OZ6A 1SFUA 5D8KB 5K1YA 3S2WA 1DUXC 1Q1HA 4KIFA 3QOPA 3SQNA 5FO5A 1U5TB 2HS5A 2C6YA 3V7CA 4KDPA 3IHUA 2W85A 1JXSA 4M74A 1MZBA 4RB0A 1LJ9A 4MEXF 3DEUA 5ICEA 2K86A 3K1MA 4WF2A 4LB5A 2FOKA 4BHBA 4KUMA 2ETHA 2A5YB 2LSOA 2XGXA 4ZYHA 1R1VA 1L0OC 4LLGF 2PBIA 4EVIA 1GHCA 2P5LC 4M72A 4Q48A 1H0MA 4WXCA 2NNYA 2O3FA 1UHMA 4KT5C 1SMYF 2FBIA 2ZJ2A 3SZPA 1G3TA 5D5UB 2O61A 2F5FA 5HDGA 1KGSA 1DDNA 4KMFA 4LK0F 2RV8A 1XCVA 2UXNA 3VEPA 2NYXA 5L3DA 2QUFA 2Z9OA 3TOBA 5EEGA 3B02A 4OINF 4IJAA 1ZN2A 3EUHA 1FBSA 3FHZA 2H6CA 3WTSC 2AS5F 5A2QK 2YPRA 3HOTA 2M45A 4LLNA 2HKOA 4AVPA 4JK1X 5CVUA 1BM9A 1FYMA 3EYIA 1QPMA 4Q47A 4HAMA 3IC7A 2PMHA 1NHAA 3WGGA 1I1SA 2Q8KA 5DD4A 1B9MA 2RKHA 1KU7A 1QGPA 5DYMA 4U0YA 1OYYA 4CZZA 4HLXA 4LD5A 2YX7A 2QQAA 4KIBA 1XMAA 4P5OA 2GAUA 2VN2A 3T5XA 5BQTA 5K5OA 1YIOA 2F2EA 1G3YA 1KYWA 2K27A 2W24A 3FWEA 4OU0A 3E97A 2X4HA 4EGYA 2MA3A 1TNSA 3ML6A 2BBYA 3HRTA 2XAGA 3VB2A 4N9HA 3B73A 3J80K 3J81Z 3KE2A 5L3GA 1DPUA 3CLOA 3TDUC 3M8EA 2QVOA 2GA2A 3CUQC 2XKOA 2A07F 1REPC 2Q0OA 2DLLA 3F8FA 1J5YA 1TLHB 1O3RA 5ICGA 2A61A 2XIGA 3HSRA 2H09A 3DPLC 2VE8A 1RI7A 3T8TA 4PCQA 4G6QA 1FBQA 1V3FA 4HQMA 3F8MA 1KU9A 3RJPA 2PEXA 3V4GA 4Y15A 1S8NA 4G7ZF 5IT9Z 5D5VB 4U7DA 5L3BA 1J75A 2QBYB 3FMSA 4MGRA 1HQCA 5HVQC 2XVCA 3VFZA 2K4JA 3MWMA 1ZG5A 4FX0A 3FM5A 3JSPA 3M8FA 4IPAA 1ZH5A 3HOSA 1BC8C 2STTA 1FYLA 1VTNC 4D0PA 5JR3A 2MBFA 2DQLA 3IWFA 2R7FA 3ZMZA 1IRFA 4S05A 4LG0A 4OMYA 2V1XA 2D1VA 2FF4A 2XHKA 4RS8A 1TNTA 1OMIA 1XB4A 2DT5A 2STWA 3KP7A 2QZ8A 2IT0A 4H0EA 2JPBA 4A5NA 5J8FA 4B8XA 2RDPA 3I59B 3Q9SA 3K2ZA 2EFQA 3HHGA 5ICCA 1JE8A 4EJWA 2V6CA 1I5ZA 4G6DA 2KJCA 3HSFA 1MJAA 3QU6A 1OYWA 3I0TA 3ZMTA 4L18B 1DPRA 1MD0A 1ZLJA 3H3ZA 1TQIA 3BROA 4GGGA 2XASA 1BIBA 2CG4A 5FB2A 2ISYA 1F1ZA 2EFWA 1P4AA 3QPTA 4I0BA 2O0YA 3C1DA 5CJ9A 4AWXB 1LB2A 4PGHA 3F23A 2ZFWA 5H6RA 3HRMA 4BQAA 2O8XA 3GUDA 1SAXA 2HFHA 4HW0A 1XGNA 2COMA 5H20A 2V1UA 2DBBA 2DTRA 3EYYA 3J7AO 3KP6A 4PZJA 1XGMA 2FMYA 1TW3A 1Z1DA 3KP5A 3CDHA 2IRFG 2DPUA 1K78B 2BEOA 5FD6A 4HQEA 1AWCA 2V79A 2VT3A 3LSTA 3F6VA 3QP6A 4ON0A 5KVRA 2YR2A 4XSXF 4YIFA 3RPQA 3U2RA 1O57A 4EJVA 3FMRA 4AD9A 1KQ8A 4HX8A 2PI0A 2PMUA 1ZRFA 1J0RA 3LAJA 2DK8A 2A6HF 2IA1A 4ESBA 1BBYA 2VXZA 2VBZA 3BY6A 3WTYC 5E20A 3BPXA 2ZBKA 1UCRA 5LBQA 2OBPA 3TKYA 4OIQF 4EV0A 2VBWA 3BP8A 1Z91A 3I54A 2YSRA 1U3EM 2X0LA 4M73A 3GFMA 1ZAOA 4KN4X 1FYKA 1XDSA 2DQRA 2DPDA 4MNUA 5BPIA 5HLIA 2RC4A 1IN6A 1OPCA 2CFXA 2ZXJA 2IJLA 4I98B 2OD5A 2QQBA 1FP1D 1SMTA 1IF1A 4L9VA 2CGPA 2HTSA 4XBFA 4A0ZA 3VOEA 5DD8A 1XGSA 4ZYEA 4Q5SF 2K7LA 3KEOA 2EWNA 4GXOA 3V7SA 1HBXG 3BJOA 3HTUA 3GXOA 3G73A 5JI6A 5LGUA 2ELHA 3TO6A 2P7CB 1KYZA 2PG4A 2E7WA 3BJAA 5DEQA 2GXBA 2VOOA 3TOAA 4ASNA 3GEZA 3GFIA 1ULYA 4HF0A 3HYIA 1F5TA 2H94A 1RUNA 4KMUX 5FGMA 4KICA 3MZHA 1U8RA 2RGVA 3V8JA 3I59A 1BI0A 3H3UA 2ZMEB 4HDUA 3KLNA 3FZVA 4HBLA 4U7BA 1F9NA 1T39A 4I01A 3TO9A 5LHIA 4ZZDA 3KETA 2KKOA 2L4AA 4NQWA 1ZHFA 2QENA 2KIFA 2K02A 2HKXA 5FLXK 1YW7A 5JFRA 2CWEA 2EFOA 5FFXA 5D4RA 4CHUA 1TBXA 2FBKA 2Y48A 4U0WA 2GXGA 3CUQA 5HDKA 3WU0A 3KFWX 5LHGA 2A69F 1H9GA 3DF8A 5CVJA 5TRDA 1LEAA 1XCBA 2HQRA 2A68F 1J2XA 2QLZA 5E8IA 3L9FA 3LQQA 4MQVA 2IP2A 2ZO4A 4EJUA 1OKRA 2IPQX 2FU4A 4RGSA 1ZG3A 4K2EA 2GQQA 4YFKF 3E3VA 2ADUA 2FMLA 2E1CA 4G94A 2QM3A 2NS0A 1D3YA 3FXUA 4ENJA 3KEQA 1O3SA 3R0JA 3FMQA 1G3SA 4OIOF 1S29A 1IW7F 5D6EA 5K5RA 2CSOA 4M9ZA 1O7FA 4FX4A 1R23A 3SFZA 1R1TA 2FNAA 2L54A 5L3CA 3PQKA 2RQPA 2FRHA 2WV0A 3I64A 4I02A 3HSEA 3DKWA 2PQ8A 4FT8A 1W4MA 3FXQA 1B1BA 2L4MA 4XLNF 1UB9A 4HZFA 3E5UA 5E1XA 2M30A 3R61A 3R60A 4GCVA 3RKWA 2UWMA 3KP3A 1ZG1A 3MEXA 4LLLA 2NRAC 3M9AA 1TTYA 3U9GA 3RYPA 4P9FA 4A12A 4Z2YA 1BOAA 5DCFA 1SD4A 3HIFA 2A3SA 2LDUA 4RAYA 1RNLA 4Y17A 2J5PA 3RYRA 2PFBA 5F6FA 3N97A 3ROUA 4A0XA 3HHHA 1IZ1A 2V9VA 1V4RA 2ZMEA 1IAWA 3V7RA 5J8CA 1ON1A 4RB1A 5HLHA 5HOOA 1YS6A 2QYOA 4Y13A 1K79A 1SFXA 2JTVA 3GW2A 3GF2A 4OIRF 3QAHA 2OA4A 3WTZA 3FM3A 3KP4A 3E6CC 4UV8A 5DDGA 2DI3A 4ENNA 1O3QA 1UFMA 3AAFA 1T6SA 3IRQA 3HTSB 2V1DA 2RN7A 4OOIA 1I1GA 2P5KA 4OMZA 4A6DA 1G3WA 5H6QA 1HSTA 2JSCA 3RIRA 5BS6A 3IKVA 1GVJA 1G6NA 1Z6RA 1W5TA 1U2WA 4E70A 4O5VA 3Q5FA 2VOPA 3TGNA 3D5LA 3SXYA 3V8KA 2HTJA 3GWZA 3DFGA 1ZRDA 1K78A 3BDDA 2XAHA 1E17A 4UUVA 1EH7A 2ZKZA 3CO6C 1R00A 2YU3A 4PGGA 3RTRA 5LEJA 3WTXC 3ZMDA 1HXDA 3N4MA 4BYYA 2FNPA 2G9WA 3T8RA 2RVCA 2OZUA 5D6FA 1FX7A 1YFHA 2P6SA 4UVCA 2D1HA 3SHFA 3TDZC 4HX7A 1ONVA 3E5QA 1D5VA 1YW9A 3ECHA 3WGHA 2XRNA 2IA0A 4IXAA 2VONA 1O3TA 4KA4A 4HA8A 3U1DA 4L0ZB 2L3DA 1QZYA 2A6EF 3F8CA 3LQRA 3LWFA 4N0BA 4EM1A 1IN5A 1EH6A 4I2OA 4B09A 1OYIA 3T0YA 4GO1A 2MLGA 3QP5A 4IRGA 1C0WA 1MDMB 1P4WA 2BV6A 2KIMA 3P9CA 2P4WA 5CLSA 5DUIA 1PDNC 3ISPA 1XDUA 1KQ0A 1MGTA 2P7VB 1CGPA 1RIOH 4G9YA 1IN8A 1WQ2A 3D0SA 2OAZA 2E1NA 5D4SA 5J6XA 5E18F 4EM0B 1FSEA 2DW4A 3WTTC 1W7PA 2LKPA 5ED4A 5CVVA 4R1HA 4L9TA 4BH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4X A;  4O3M A;  2Q2E A;  2PLY A;  1T2K A;  2QQ9 A;  2W25 A;  1JGS A;  3GZ6 A;  4ENM A;  4O6J A;  3T1B A;  3HRS A;  2IW5 A;  3LA2 A;  1STZ A;  1LQ1 A;  3LA7 A;  3GFJ A;  3E6M A;  3FX3 A;  1KU2 A;  5CVR A;  2XUB A;  2VBX A;  1FNN A;  4KIG A;  2GWR A;  5AIP A;  3I53 A;  3MZY A;  1QNT A;  3KZZ A;  2Z5U A;  1AOY A;  4HX4 A;  3ZQ7 A;  3E6D A;  4ZZL A;  1S3J A;  1IRG A;  1U5T C;  3F3X A;  2MC3 A;  4KN7 X;  4M9S A;  3J80 Z;  3TO7 A;  4BNC A;  4P9U A;  4NHJ A;  1G4D A;  1W7P B;  2NAZ A;  3GZ5 A;  5HS8 A;  5LEK A;  3KLO A;  1SD7 A;  2E7X A;  3LFK A;  4MQ9 F;  1H9T A;  2FXA A;  1LDJ A;  4P55 A;  4LGW A;  2CQK A;  2Z3Y A;  1YLF A;  1UST A;  2HGC A;  3R4K A;  2KRF A;  4YG2 F;  2OQR A;  2DK5 A;  3I4P A;  1U78 A;  4LJZ F;  3WTU C;  2XRO A;  3F21 A;  1YO5 C;  1UHW A;  1JHH A;  5TJJ A;  3JTG A;  1FT9 A;  1ON2 A;  4M6Y A;  2EA4 A;  2D45 A;  2BE5 F;  1TQM A;  1MKM A;  3ABT A;  3ERE D;  4M9X A;  4N9I A;  5HLG A;  1KQ9 A;  5IT9 K;  1QO0 D;  4L9N A;  2G7U A;  3QRF F;  4WXH A;  2FA5 A;  3K1N A;  5LGT A;  5JVT A;  4IRH A;  3MFK A;  2P6T A;  3PQJ A;  1XSD A;  4KYW A;  2IA2 A;  4MHG A;  1K7A A;  1P92 A;  1CF7 B;  1LEB A;  1IXR C;  2F5C A;  4MTD A;  3F8N A;  2DO7 A;  4JBA A;  1QZZ A;  3M7G A;  1X3U A;  1R7J A;  4G7O F;  3Q9V A;  3J81 K;  2OU2 A;  3GYH X;  1MDM A;  3ZMS A;  4EJT A;  3WTV C;  1BI1 A;  1MJB A;  3L7W A;  4P96 A;  2EB7 A;  3EDP A;  3WOD F;  5HS9 A;  5LRR A;  5JHU A;  3K9T A;  5DUK A;  2HDC A;  3GX4 X;  4RB3 C;  2DU9 A;  1IXC A;  2KIU A;  4L5I A;  1SD6 A;  2AXL A;  4MEY F;  4Q4Z F;  1ODD A;  4G8X A;  2EV6 A;  4UVB A;  4UXN A;  1QBJ A;  2EA2 A;  3ZPL A;  4JQF A;  1YYV A;  2Z99 A;  2IVM A;  4RB2 C;  1T38 A;  3DP7 A;  1J7K A;  2FSW A;  5E8G A;  3EQL F;  2M87 A;  4BAY A;  5D5X B;  1LDK B;  2P5V A;  3RKY A;  3JSO A;  5LGN A;  4LB6 B;  4HLY A;  3NEU A;  3OV8 A;  3IL2 A;  3O6B B;  5FLX Z;  1R1U A;  2F5D A;  3CJN A;  4LG0 B;  1ZAR A;  3BOQ A;  4A5M A;  3IWZ A;  2EV5 A;  2FQ3 A;  1RZ4 A;  3RI4 A;  3F22 A;  1ZRE A;  2YX4 A;  1J59 A;  2NNN A;  1XMK A;  4WXD A;  2ZNY A;  1LNW A;  1FOK A;  3QPH A;  3F6O A;  4XSZ F;  4L9J A;  2VC0 A;  2M5W A;  5DCM B;  1MJ9 A;  1IN7 A;  1BC7 C;  3REO A;  3FF5 A;  1P6R A;  1YS7 A;  4UNO A;  4A0Y A;  4ESF A;  2FE3 A;  1A04 A;  3F8B A;  3DV8 A;  5LLQ A;  3LA3 A;  4ETS A;  3C18 A;  1GXQ A;  1XD7 A;  2L02 A;  1YQA A;  4GYG A;  2GA1 A;  5HDN A;  1DP7 P;  1BI3 A;  2XAJ A;  2DFI A;  5E1W A;  2ISZ A;  4U0V A;  2D2W A;  5AIQ A;  4UVA A;  1ZGJ A;  1FC3 A;  1FBU A;  4OIP F;  3ULQ B;  2QWW A;  2Z33 A;  2LF7 A;  4UHT A;  5F64 A;  1PP7 U;  4WX9 A;  4A6E A;  5BOX A;  2ZCW A;  5ICF A;  4ESJ A;  4TV7 A;  2HEO A;  1KU3 A;  3V8L A;  1ZRC A;  4RGU A;  5ILU A;  3JTH A;  3ELK A;  3WE2 A;  5DCM A;  2HYG D;  2VBY A;  4BHC A;  3I5U A;  1S6L A;  3R0A A;  4EM2 A;  4ZYD A;  1I27 A;  3CO7 C;  3RDI A;  3W6K B;  1HKT A;  4IHS A;  3HRU A;  1WKM A;  4NB5 A;  3K69 A;  4G7H F;  1I6X A;  1W7P D;  4LK1 F;  2W57 A;  1BJA A;  1B9N A;  1TQP A;  1WI9 A;  2JRT A;  5DV5 A;  2FBH A;  1T0F A;  4CO8 A;  3DXJ F;  3WU1 B;  2OQG A;  3W6J B;  4FHT A;  3G3Z A;  2O03 A;  2LF8 A;  4IRI A;  3H92 A;  3KZY A;  4PDK A;  3WG9 A;  1BN5 A;  2GIV A;  3GO5 A;  4HV5 A;  2RNJ A;  1KA8 A;  1YW8 A;  5D8L B;  4DNC A;  5BPD A;  3GLX A;  1RUO A;  4S04 A;  3P9I A;  1L3L A;  1Z05 A;  4I7H A;  5FFZ A;  4EJO A;  1FPQ A;  1W5S A;  4BXU A;  1GXP A;  1FLI A;  2M8E A;  2MH9 A;  2EFN A;  3M1E A;  2J5O A;  3WTW C;  1WRJ A;  4CGZ A;  1QQI A;  4YFN F;  2WTE A;  2TDX A;  3KCC A;  1P2F A;  5EEH A;  1WWX A;  3ZN1 A;  2VC1 A;  4CDG A;  2WC2 A;  1PP8 F;  2GZW A;  2DAO A;  3FXR A;  4XRF A;  4U88 A;  4WK8 F;  2CO5 A;  2UXX A;  1FY7 A;  3E5X A;  1CF7 A;  2HZT A;  3SZT A;  4HDV A;  1USS A;  4AIJ A;  1TW2 A;  4AIH A;  1S7O A;  4RAZ A;  1HKS A;  4R8H A;  4HOB A;  2XAQ A;  3CUO A;  3CTA A;  1XGO A;  3JAM Z;  1D8J A;  3C7J A;  4KFC A;  1XN7 A;  1R36 A;  5BMZ A;  3ABU A;  4DQ2 A;  2F5E A;  4F7Z A;  4WWC A;  4IHT A;  3GFL A;  4LFU A;  3BWG A;  4RGR A;  1B6A A;  3MCZ A;  1Y0U A;  3DPT A;  5ERI A;  3EET A;  4MTE A;  2BYV E;  2JZY A;  4IVN A;  2PJP A;  5L3E A;  2HQN A;  4WCG A;  1BI2 A;  3WGI A;  1O7L A;  3CUQ B;  5K5Q A;  3O2P E;  3JAM K;  4ENK A;  1R5G A;  2MH2 A;  5KK1 A;  4L5J A;  2HYF A;  2CW0 F;  2LNB A;  3LAP A;  5IT3 A;  6PAX A;  2JT1 A;  1LDD A;  3WE3 A;  1Z9C A;  2XKP A;  1D8K A;  3F72 A;  1HW2 A;  4XLP F;  1B4A A;  5HS7 A;  3RKX A;  3ZP5 A;  1T98 A;  3VOD A;  1BIA A;  5E1Z B;  4RGX A;  3PFI A;  3O3K A;  4QWQ A;  5CVI A;  4AIK A;  3DQV C;  4QLC U;  1IN4 A;  3L00 A;  4L0Y B;  2EV0 A;  3COA C;  1IUY A;  2EJR A;  3MQ0 A;  4CIC A;  5E17 F;  4CYD A;  1S7A A;  1F4K A;  2XV4 S;  3ZMU A;  2HWV A;  5CYV A;  5LHH A;  2JPC A;  1HKQ A;  2P8T A;  1E2X A;  2HR3 A;  2ACJ A;  3ZN0 A;  2O6G E;  4HF1 A;  4HYE A;  2EK5 A;  1FZP B;  3TQN A;  4YFX F;  1XSX A;  3C3W A;  2UZK A;  3L2C A;  1OR7 A;  1HW1 A;  1U6G A;  3KP2 A;  2WWY A;  2ZNZ A;  1YG2 A;  5L3F A;  2MLK A;  2MD5 A;  4YII A;  3GVA A;  2L01 A;  4ZH4 F;  3K1P A;  1ZYR F;  1ZLK A;  2CYY A;  2R3S A;  1K6O A;  2W84 A;  5F1R A;  1PUE E;  2H6B A;  1HW5 A;  2KJB A;  3JW4 A;  3NQO A;  2H27 A;  2ESH A;  5ILS A;  5ILV A;  1B59 A;  3IKT A;  3BJ6 A;  1Z6T A;  2XAF A;  1Z7U A;  4I09 A;  3ECO A;  3K0L A;  1JHF A;  1SFE A;  4GYI A;  3MAJ A;  1FWZ A;  4EMS A;  1SD5 A;  4EGZ A;  1ZGA A;  4CXF A;  3L09 A;  2BGC A;  3E6B A;  1FSH A;  2K4B A;  1J9I A;  2PN6 A;  2B0L A;  1U5T A;  1HSJ A;  4M71 A;  3NRV A;  3QU3 A;  5FD5 A;  1R22 A;  4A2U A;  1IXS B;  4I0A A;  4EQQ A;  4LMY A;  2HOE A;  3RPU A;  1LVA A;  1YTY A;  5AON A;  5D5W B;  4HF2 A;  2ESN A;  2VOD A;  1R5H A;  2VT2 A;  1WSU A;  3OOP A;  4M6X A;  2EFP A;  3I58 A;  4KNY A;  3R6S A;  1XSV A;  3BZ6 A;  4R79 A;  4UV9 A;  3BPV A;  4BHP A;  1R58 A;  3P7N A;  3ZMV A;  4HV6 A;  1FP2 A;  3I71 A;  4ZYG A;  2Y75 A;  3P9K A;  2VE9 A;  2R7D A;  5A2Q Z;  5LRS A;  4IF4 A;  2QBY A;  2Y0M A;  2G7H A;  3IRR A;  1EH8 A;  2FEZ A;  3HUG A;  2M1B A;  1EV7 A;  2OZ6 A;  1SFU A;  5D8K B;  5K1Y A;  3S2W A;  1DUX C;  1Q1H A;  4KIF A;  3QOP A;  3SQN A;  5FO5 A;  1U5T B;  2HS5 A;  2C6Y A;  3V7C A;  4KDP A;  3IHU A;  2W85 A;  1JXS A;  4M74 A;  1MZB A;  4RB0 A;  1LJ9 A;  4MEX F;  3DEU A;  5ICE A;  2K86 A;  3K1M A;  4WF2 A;  4LB5 A;  2FOK A;  4BHB A;  4KUM A;  2ETH A;  2A5Y B;  2LSO A;  2XGX A;  4ZYH A;  1R1V A;  1L0O C;  4LLG F;  2PBI A;  4EVI A;  1GHC A;  2P5L C;  4M72 A;  4Q48 A;  1H0M A;  4WXC A;  2NNY A;  2O3F A;  1UHM A;  4KT5 C;  1SMY F;  2FBI A;  2ZJ2 A;  3SZP A;  1G3T A;  5D5U B;  2O61 A;  2F5F A;  5HDG A;  1KGS A;  1DDN A;  4KMF A;  4LK0 F;  2RV8 A;  1XCV A;  2UXN A;  3VEP A;  2NYX A;  5L3D A;  2QUF A;  2Z9O A;  3TOB A;  5EEG A;  3B02 A;  4OIN F;  4IJA A;  1ZN2 A;  3EUH A;  1FBS A;  3FHZ A;  2H6C A;  3WTS C;  2AS5 F;  5A2Q K;  2YPR A;  3HOT A;  2M45 A;  4LLN A;  2HKO A;  4AVP A;  4JK1 X;  5CVU A;  1BM9 A;  1FYM A;  3EYI A;  1QPM A;  4Q47 A;  4HAM A;  3IC7 A;  2PMH A;  1NHA A;  3WGG A;  1I1S A;  2Q8K A;  5DD4 A;  1B9M A;  2RKH A;  1KU7 A;  1QGP A;  5DYM A;  4U0Y A;  1OYY A;  4CZZ A;  4HLX A;  4LD5 A;  2YX7 A;  2QQA A;  4KIB A;  1XMA A;  4P5O A;  2GAU A;  2VN2 A;  3T5X A;  5BQT A;  5K5O A;  1YIO A;  2F2E A;  1G3Y A;  1KYW A;  2K27 A;  2W24 A;  3FWE A;  4OU0 A;  3E97 A;  2X4H A;  4EGY A;  2MA3 A;  1TNS A;  3ML6 A;  2BBY A;  3HRT A;  2XAG A;  3VB2 A;  4N9H A;  3B73 A;  3J80 K;  3J81 Z;  3KE2 A;  5L3G A;  1DPU A;  3CLO A;  3TDU C;  3M8E A;  2QVO A;  2GA2 A;  3CUQ C;  2XKO A;  2A07 F;  1REP C;  2Q0O A;  2DLL A;  3F8F A;  1J5Y A;  1TLH B;  1O3R A;  5ICG A;  2A61 A;  2XIG A;  3HSR A;  2H09 A;  3DPL C;  2VE8 A;  1RI7 A;  3T8T A;  4PCQ A;  4G6Q A;  1FBQ A;  1V3F A;  4HQM A;  3F8M A;  1KU9 A;  3RJP A;  2PEX A;  3V4G A;  4Y15 A;  1S8N A;  4G7Z F;  5IT9 Z;  5D5V B;  4U7D A;  5L3B A;  1J75 A;  2QBY B;  3FMS A;  4MGR A;  1HQC A;  5HVQ C;  2XVC A;  3VFZ A;  2K4J A;  3MWM A;  1ZG5 A;  4FX0 A;  3FM5 A;  3JSP A;  3M8F A;  4IPA A;  1ZH5 A;  3HOS A;  1BC8 C;  2STT A;  1FYL A;  1VTN C;  4D0P A;  5JR3 A;  2MBF A;  2DQL A;  3IWF A;  2R7F A;  3ZMZ A;  1IRF A;  4S05 A;  4LG0 A;  4OMY A;  2V1X A;  2D1V A;  2FF4 A;  2XHK A;  4RS8 A;  1TNT A;  1OMI A;  1XB4 A;  2DT5 A;  2STW A;  3KP7 A;  2QZ8 A;  2IT0 A;  4H0E A;  2JPB A;  4A5N A;  5J8F A;  4B8X A;  2RDP A;  3I59 B;  3Q9S A;  3K2Z A;  2EFQ A;  3HHG A;  5ICC A;  1JE8 A;  4EJW A;  2V6C A;  1I5Z A;  4G6D A;  2KJC A;  3HSF A;  1MJA A;  3QU6 A;  1OYW A;  3I0T A;  3ZMT A;  4L18 B;  1DPR A;  1MD0 A;  1ZLJ A;  3H3Z A;  1TQI A;  3BRO A;  4GGG A;  2XAS A;  1BIB A;  2CG4 A;  5FB2 A;  2ISY A;  1F1Z A;  2EFW A;  1P4A A;  3QPT A;  4I0B A;  2O0Y A;  3C1D A;  5CJ9 A;  4AWX B;  1LB2 A;  4PGH A;  3F23 A;  2ZFW A;  5H6R A;  3HRM A;  4BQA A;  2O8X A;  3GUD A;  1SAX A;  2HFH A;  4HW0 A;  1XGN A;  2COM A;  5H20 A;  2V1U A;  2DBB A;  2DTR A;  3EYY A;  3J7A O;  3KP6 A;  4PZJ A;  1XGM A;  2FMY A;  1TW3 A;  1Z1D A;  3KP5 A;  3CDH A;  2IRF G;  2DPU A;  1K78 B;  2BEO A;  5FD6 A;  4HQE A;  1AWC A;  2V79 A;  2VT3 A;  3LST A;  3F6V A;  3QP6 A;  4ON0 A;  5KVR A;  2YR2 A;  4XSX F;  4YIF A;  3RPQ A;  3U2R A;  1O57 A;  4EJV A;  3FMR A;  4AD9 A;  1KQ8 A;  4HX8 A;  2PI0 A;  2PMU A;  1ZRF A;  1J0R A;  3LAJ A;  2DK8 A;  2A6H F;  2IA1 A;  4ESB A;  1BBY A;  2VXZ A;  2VBZ A;  3BY6 A;  3WTY C;  5E20 A;  3BPX A;  2ZBK A;  1UCR A;  5LBQ A;  2OBP A;  3TKY A;  4OIQ F;  4EV0 A;  2VBW A;  3BP8 A;  1Z91 A;  3I54 A;  2YSR A;  1U3E M;  2X0L A;  4M73 A;  3GFM A;  1ZAO A;  4KN4 X;  1FYK A;  1XDS A;  2DQR A;  2DPD A;  4MNU A;  5BPI A;  5HLI A;  2RC4 A;  1IN6 A;  1OPC A;  2CFX A;  2ZXJ A;  2IJL A;  4I98 B;  2OD5 A;  2QQB A;  1FP1 D;  1SMT A;  1IF1 A;  4L9V A;  2CGP A;  2HTS A;  4XBF A;  4A0Z A;  3VOE A;  5DD8 A;  1XGS A;  4ZYE A;  4Q5S F;  2K7L A;  3KEO A;  2EWN A;  4GXO A;  3V7S A;  1HBX G;  3BJO A;  3HTU A;  3GXO A;  3G73 A;  5JI6 A;  5LGU A;  2ELH A;  3TO6 A;  2P7C B;  1KYZ A;  2PG4 A;  2E7W A;  3BJA A;  5DEQ A;  2GXB A;  2VOO A;  3TOA A;  4ASN A;  3GEZ A;  3GFI A;  1ULY A;  4HF0 A;  3HYI A;  1F5T A;  2H94 A;  1RUN A;  4KMU X;  5FGM A;  4KIC A;  3MZH A;  1U8R A;  2RGV A;  3V8J A;  3I59 A;  1BI0 A;  3H3U A;  2ZME B;  4HDU A;  3KLN A;  3FZV A;  4HBL A;  4U7B A;  1F9N A;  1T39 A;  4I01 A;  3TO9 A;  5LHI A;  4ZZD A;  3KET A;  2KKO A;  2L4A A;  4NQW A;  1ZHF A;  2QEN A;  2KIF A;  2K02 A;  2HKX A;  5FLX K;  1YW7 A;  5JFR A;  2CWE A;  2EFO A;  5FFX A;  5D4R A;  4CHU A;  1TBX A;  2FBK A;  2Y48 A;  4U0W A;  2GXG A;  3CUQ A;  5HDK A;  3WU0 A;  3KFW X;  5LHG A;  2A69 F;  1H9G A;  3DF8 A;  5CVJ A;  5TRD A;  1LEA A;  1XCB A;  2HQR A;  2A68 F;  1J2X A;  2QLZ A;  5E8I A;  3L9F A;  3LQQ A;  4MQV A;  2IP2 A;  2ZO4 A;  4EJU A;  1OKR A;  2IPQ X;  2FU4 A;  4RGS A;  1ZG3 A;  4K2E A;  2GQQ A;  4YFK F;  3E3V A;  2ADU A;  2FML A;  2E1C A;  4G94 A;  2QM3 A;  2NS0 A;  1D3Y A;  3FXU A;  4ENJ A;  3KEQ A;  1O3S A;  3R0J A;  3FMQ A;  1G3S A;  4OIO F;  1S29 A;  1IW7 F;  5D6E A;  5K5R A;  2CSO A;  4M9Z A;  1O7F A;  4FX4 A;  1R23 A;  3SFZ A;  1R1T A;  2FNA A;  2L54 A;  5L3C A;  3PQK A;  2RQP A;  2FRH A;  2WV0 A;  3I64 A;  4I02 A;  3HSE A;  3DKW A;  2PQ8 A;  4FT8 A;  1W4M A;  3FXQ A;  1B1B A;  2L4M A;  4XLN F;  1UB9 A;  4HZF A;  3E5U A;  5E1X A;  2M30 A;  3R61 A;  3R60 A;  4GCV A;  3RKW A;  2UWM A;  3KP3 A;  1ZG1 A;  3MEX A;  4LLL A;  2NRA C;  3M9A A;  1TTY A;  3U9G A;  3RYP A;  4P9F A;  4A12 A;  4Z2Y A;  1BOA A;  5DCF A;  1SD4 A;  3HIF A;  2A3S A;  2LDU A;  4RAY A;  1RNL A;  4Y17 A;  2J5P A;  3RYR A;  2PFB A;  5F6F A;  3N97 A;  3ROU A;  4A0X A;  3HHH A;  1IZ1 A;  2V9V A;  1V4R A;  2ZME A;  1IAW A;  3V7R A;  5J8C A;  1ON1 A;  4RB1 A;  5HLH A;  5HOO A;  1YS6 A;  2QYO A;  4Y13 A;  1K79 A;  1SFX A;  2JTV A;  3GW2 A;  3GF2 A;  4OIR F;  3QAH A;  2OA4 A;  3WTZ A;  3FM3 A;  3KP4 A;  3E6C C;  4UV8 A;  5DDG A;  2DI3 A;  4ENN A;  1O3Q A;  1UFM A;  3AAF A;  1T6S A;  3IRQ A;  3HTS B;  2V1D A;  2RN7 A;  4OOI A;  1I1G A;  2P5K A;  4OMZ A;  4A6D A;  1G3W A;  5H6Q A;  1HST A;  2JSC A;  3RIR A;  5BS6 A;  3IKV A;  1GVJ A;  1G6N A;  1Z6R A;  1W5T A;  1U2W A;  4E70 A;  4O5V A;  3Q5F A;  2VOP A;  3TGN A;  3D5L A;  3SXY A;  3V8K A;  2HTJ A;  3GWZ A;  3DFG A;  1ZRD A;  1K78 A;  3BDD A;  2XAH A;  1E17 A;  4UUV A;  1EH7 A;  2ZKZ A;  3CO6 C;  1R00 A;  2YU3 A;  4PGG A;  3RTR A;  5LEJ A;  3WTX C;  3ZMD A;  1HXD A;  3N4M A;  4BYY A;  2FNP A;  2G9W A;  3T8R A;  2RVC A;  2OZU A;  5D6F A;  1FX7 A;  1YFH A;  2P6S A;  4UVC A;  2D1H A;  3SHF A;  3TDZ C;  4HX7 A;  1ONV A;  3E5Q A;  1D5V A;  1YW9 A;  3ECH A;  3WGH A;  2XRN A;  2IA0 A;  4IXA A;  2VON A;  1O3T A;  4KA4 A;  4HA8 A;  3U1D A;  4L0Z B;  2L3D A;  1QZY A;  2A6E F;  3F8C A;  3LQR A;  3LWF A;  4N0B A;  4EM1 A;  1IN5 A;  1EH6 A;  4I2O A;  4B09 A;  1OYI A;  3T0Y A;  4GO1 A;  2MLG A;  3QP5 A;  4IRG A;  1C0W A;  1MDM B;  1P4W A;  2BV6 A;  2KIM A;  3P9C A;  2P4W A;  5CLS A;  5DUI A;  1PDN C;  3ISP A;  1XDU A;  1KQ0 A;  1MGT A;  2P7V B;  1CGP A;  1RIO H;  4G9Y A;  1IN8 A;  1WQ2 A;  3D0S A;  2OAZ A;  2E1N A;  5D4S A;  5J6X A;  5E18 F;  4EM0 B;  1FSE A;  2DW4 A;  3WTT C;  1W7P A;  2LKP A;  5ED4 A;  5CVV A;  4R1H A;  4L9T A;  4BH9 A; 
#chains in the Genus database with same CATH topology
 3CF5 F;  3GME A;  3FK6 A;  1P4X A;  4O3M A;  2Q2E A;  2E2J J;  2PLY A;  1MMN A;  2Y0S N;  3ASN H;  1T2K A;  1IUF A;  3SZG A;  2QQ9 A;  4XM3 A;  2W25 A;  1JGS A;  3GZ6 A;  3DBL B;  4ENM A;  2ECB A;  3ZQL A;  3F9K A;  4O6J A;  3T1B A;  3HRS A;  2IW5 A;  3LA2 A;  3ABK H;  2LBF B;  1STZ A;  1LQ1 A;  2EPF A;  5IP7 J;  5F0F A;  3RPU D;  3LA7 A;  4S0H B;  3GFJ A;  2LYC A;  1RKT A;  3E6M A;  3FX3 A;  1KU2 A;  2KT0 A;  3VSL A;  5CVR A;  2HPM A;  1QA6 A;  2XUB A;  2DT6 A;  2VBX A;  2WY8 Q;  3HBL A;  1JTY A;  2NVQ J;  1FNN A;  4KIG A;  2W7N A;  2VQH A;  2GWR A;  5AIP A;  3I53 A;  3PIO F;  3HPH A;  3MKW B;  3MZY A;  5FRM A;  1QNT A;  1IDY A;  3OYJ A;  4G6T B;  3KZZ A;  2OPT A;  3S3N A;  2Z5U A;  1AOY A;  4NNJ A;  5DTD A;  2ZXW H;  4HX4 A;  3ZQ7 A;  3E6D A;  4ZZL A;  2Y69 H;  1LKX A;  3MKL A;  4HG2 A;  1S3J A;  1IRG A;  1U5T C;  5TGT A;  3F3X A;  2MC3 A;  2JA6 J;  4DBQ A;  3I55 I;  4KN7 X;  4M9S A;  3J80 Z;  3TO7 A;  2F5V A;  4D5C A;  3OYC A;  2VQC A;  2XB0 X;  2JA2 A;  4C3J J;  5F04 A;  4BNC A;  4P9U A;  1ZR2 A;  3ABM H;  4NHJ A;  2L2O A;  3CCL I;  2ME0 A;  3K10 A;  2IS6 A;  4BS9 A;  4RMN A;  1G4D A;  5J4V A;  1W7P B;  2NAZ A;  3GZ5 A;  2DFE A;  3WG7 H;  1X1A A;  5HS8 A;  4L5E A;  5LEK A;  1S9H A;  3KLO A;  4FTH A;  1IDZ A;  1SD7 A;  3I3L A;  2M0C A;  2R5Z A;  2E7X A;  3LFK A;  4Y52 J;  4MQ9 F;  1VFC A;  5GPA A;  1H9T A;  3G1M A;  2FXA A;  3PL8 A;  2PMZ N;  4CYC B;  3HG9 A;  1LDJ A;  1I3Q J;  4P55 A;  4IQ4 A;  3CCU I;  4LGW A;  2CQK A;  4KJZ A;  4IOA F;  2Z3Y A;  1YLF A;  1UST A;  3LSP A;  2HGC A;  3R4K A;  3ZOB A;  2KRF A;  4YG2 F;  1GVD A;  2X85 A;  2OQR A;  2DK5 A;  3I4P A;  1U78 A;  4LJZ F;  3FKJ A;  2VJI A;  3WTU C;  2XRO A;  3F21 A;  5DS9 A;  1YO5 C;  1UHW A;  1JHH A;  2WB1 N;  5TJJ A;  4CA0 A;  4I76 A;  2PJR A;  3JTG A;  1WJD A;  1FT9 A;  1ON2 A;  1ZGW A;  3D5S C;  4AVZ A;  4M6Y A;  2EA4 A;  4YEL A;  2D45 A;  1SVL A;  1TQM A;  2BE5 F;  2VKD A;  1MKM A;  2V9P A;  3A01 B;  1FIA A;  2LG4 A;  3ABT A;  3ERE D;  4M9X A;  3BTJ A;  4N9I A;  1KQ9 A;  5HLG A;  5IT9 K;  1QO0 D;  4D1Q A;  4L9N A;  2G7U A;  3QRF F;  4WXH A;  2FA5 A;  3K1N A;  5E3L A;  5LGT A;  5JVT A;  4IRH A;  3MFK A;  2P6T A;  3PQJ A;  3HGY A;  5B3S H;  1X2M A;  1UMQ A;  5E79 C;  1QHH D;  1FMW A;  1XSD A;  3K4K A;  5F08 A;  2DMN A;  2EZL A;  4UB8 C;  3SJM A;  4KYW A;  1O4X A;  4X0G A;  1OCC H;  2IA2 A;  4MHG A;  1K7A A;  2QSG X;  2R4G A;  1P92 A;  4CCM A;  1CF7 B;  2ZXH A;  2OCC H;  2L0K A;  2HNH A;  1IXR C;  2F5C A;  3TBI A;  2BY2 A;  3F8N A;  2EIK H;  4MTD A;  4D9J A;  1LEB A;  2A6T A;  4DYR A;  2W48 A;  2X6O A;  2DO7 A;  5CPR B;  4EEF G;  4JBA A;  2CRG A;  2JVH A;  1DU0 A;  1K4T A;  1QZZ A;  3OR1 C;  3M7G A;  1X3U A;  3PO2 J;  1H8A C;  1R7J A;  1K6Y A;  4G7O F;  1EKE A;  3Q9V A;  5EJC A;  3J81 K;  2OU2 A;  2E5N A;  3GYH X;  1MDM A;  3ZMS A;  2O8K A;  4EJT A;  3WTV C;  1BI1 A;  1MJB A;  4XOR A;  3L7W A;  2CUJ A;  2MC4 A;  4P96 A;  1K4S A;  2EB7 A;  4LIT A;  3EDP A;  3WOD F;  5HS9 A;  5LRR A;  5JHU A;  3K9T A;  3OYK A;  5DUK A;  1NTC A;  4XLC A;  3CJT B;  1QHG A;  2HDC A;  3A03 A;  3GX4 X;  3AL0 B;  4RB3 C;  2FUG 2;  2DU9 A;  1IXC A;  2KIU A;  4L5I A;  2XPW A;  2ZFU A;  1OCT C;  1SD6 A;  5CQG A;  2AXL A;  4MEY F;  2D5V A;  4Q4Z F;  1E3O C;  4PUS A;  1ODD A;  4G8X A;  2BW3 A;  2EV6 A;  4UVB A;  4UXN A;  3IH2 A;  1T56 A;  1BL0 A;  2CW8 A;  1QBJ A;  2EA2 A;  2CW7 A;  3HJE A;  3PUB A;  3ZPL A;  1G8X A;  4JQF A;  4M3F A;  1YYV A;  5GAG J;  4QTR A;  2Z99 A;  2L7M P;  2IVM A;  4RB2 C;  1OQY A;  1T38 A;  3DP7 A;  1J7K A;  3HOZ J;  2FSW A;  3BG5 A;  4M3D A;  5E8G A;  3EQL F;  4XID A;  2OC6 A;  2M87 A;  4BAY A;  5D5X B;  1LDK B;  2DA6 A;  2P5V A;  2ZJR F;  1YJW I;  3ESW B;  2JA7 J;  3RKY A;  3JSO A;  5LGN A;  4LB6 B;  5F0H A;  4HLY A;  1WZ2 A;  3NEU A;  3CC7 I;  3PSI A;  3OV8 A;  4CH7 A;  2DJN A;  4HPQ A;  1AHD P;  4CCO A;  3EUA A;  2O5R A;  3IL2 A;  3O6B B;  5FLX Z;  1R1U A;  2F5D A;  3DCF A;  3CJN A;  4LG0 B;  1ZAR A;  3BOQ A;  3J7Z I;  4A5M A;  3IWZ A;  2IS4 A;  3VDX A;  1ITY A;  3VWB A;  1MBJ A;  1POG A;  4AM3 A;  1UG2 A;  5H2F C;  2EV5 A;  2FQ3 A;  3QPS A;  1SFO J;  1RZ4 A;  2KZV A;  4XON A;  3RI4 A;  1TZL A;  3BQZ A;  1Z77 A;  2XB5 A;  4H4K C;  3F22 A;  1ZRE A;  2YX4 A;  2DOE A;  1J59 A;  2NNN A;  1XMK A;  4WXD A;  1OCZ H;  2ZNY A;  3S93 A;  3OL4 A;  3PUF A;  4A93 J;  1LNW A;  2WY7 Q;  5FKO A;  3CCJ I;  1FOK A;  3QPH A;  3FIW A;  3OYH A;  2R7Q A;  2X1E A;  3F6O A;  4XSZ F;  2JQ7 A;  2BY3 A;  2CQ7 A;  3OSG A;  3OYE A;  2LY1 A;  2VC0 A;  4L9J A;  2M5W A;  5DCM B;  2L9S A;  1MJ9 A;  4BQQ A;  2Y31 A;  1IN7 A;  3A0B C;  1BC7 C;  1RR8 C;  3REO A;  3OSF A;  1G59 A;  3FF5 A;  1P6R A;  1YS7 A;  2CUF A;  1ZR4 A;  4UNO A;  4A0Y A;  4ESF A;  3I56 I;  2FE3 A;  1A04 A;  3F8B A;  1VQO I;  1JKR C;  1I3A A;  3DV8 A;  5LLQ A;  2CUE A;  2KLO A;  4XIC A;  1ETQ A;  3LA3 A;  4BE1 A;  4ETS A;  3C18 A;  1GXQ A;  1XD7 A;  3CJQ B;  2QEX I;  2L02 A;  1MH4 A;  1YQA A;  4BU2 A;  2YU9 J;  3ZCO A;  4GYG A;  2GA1 A;  5HDN A;  2HOS A;  3K2A A;  1DP7 P;  1BI3 A;  5E3O A;  2IGM A;  5M5X J;  1MH3 A;  2OF7 A;  2XAJ A;  4MO7 A;  2DFI A;  5E1W A;  2ISZ A;  4U0V A;  2DFH A;  3A4C A;  2D2W A;  5AIQ A;  2WAF A;  4UVA A;  1ZGJ A;  4IKF A;  1FC3 A;  3FBI B;  1TWC J;  1FBU A;  4N4N B;  4NUB A;  2QWW A;  3ULQ B;  2Z33 A;  2LF7 A;  4OIP F;  4UHT A;  1FTZ A;  3BC8 A;  5F64 A;  3IH4 A;  1PP7 U;  4WX9 A;  4A6E A;  5BOX A;  3Q0V A;  1X1D A;  2ZCW A;  3BG6 A;  5ICF A;  4ESJ A;  4TV7 A;  2HEO A;  1KU3 A;  3SDG A;  3OY9 A;  1LE8 B;  3JRC A;  3S17 J;  4BQO A;  3S1M J;  3CP8 A;  3V8L A;  1OFC X;  1ZRC A;  1TC3 C;  4RGU A;  5ILU A;  3JTH A;  3ELK A;  2DXI A;  1JI8 A;  3HOW J;  5HNF A;  3A01 A;  3WE2 A;  5DCM A;  2HYG D;  1A6I A;  1FIP A;  4M3G A;  2VBY A;  4BHC A;  2V7F A;  3I5U A;  4IZZ A;  1S6L A;  2XPU A;  4XLF A;  3R0A A;  4EM2 A;  4ZYD A;  3PO3 J;  1I27 A;  3CLQ A;  3DLA A;  2AHQ A;  4A3M J;  1WJC A;  2XF7 A;  3CO7 C;  2DA7 A;  2ZSH B;  3RDI A;  1X4O A;  3W6K B;  2DJI A;  4RLF A;  1YIT I;  2E2I J;  3DTE A;  1ETW A;  3D5R C;  1HKT A;  4A3B J;  4IHS A;  3HRU A;  1WKM A;  5IPA A;  4NB5 A;  2R5Y A;  2GLO A;  3K69 A;  1TWF J;  3QOD A;  4G7H F;  1WJF A;  1I6X A;  3RSN A;  1R4M B;  1W7P D;  4LK1 F;  2W57 A;  3ONQ A;  1BJA A;  1B9N A;  1TQP A;  1WI9 A;  2JRT A;  5DV5 A;  3MKZ A;  2FBH A;  2M3A A;  1T0F A;  3ASO H;  4CO8 A;  1ZTR A;  2CQQ A;  1Y6I A;  3DXJ F;  3QPL A;  3WU1 B;  2OQG A;  4IL6 C;  1TP4 A;  4FHT A;  3W6J B;  4FAS D;  4XLH A;  3BR0 A;  3G3Z A;  1S5L C;  3G71 I;  2O03 A;  2LF8 A;  2DMQ A;  4IRI A;  3JRG A;  5FRN A;  2JJ7 A;  3JR9 A;  3H92 A;  3KZY A;  4PDK A;  4DIQ A;  3VYU B;  1JGG A;  2RAE A;  1BN5 A;  3WG9 A;  2B9S A;  1ZQ3 P;  4RM2 A;  1SC7 A;  3ZQI A;  2GIV A;  3GO5 A;  4HV5 A;  4RAG A;  3LSR A;  3H0G J;  3MKY B;  2R0Q C;  5M3F J;  2RNJ A;  3BZC A;  1KA8 A;  1YW8 A;  3FDY A;  4XKB A;  5D8L B;  4DNC A;  3CC2 I;  5BPD A;  3GLX A;  1A6Q A;  1RUO A;  1V5E A;  4S04 A;  2LLK A;  3P9I A;  1L3L A;  2LRD A;  3H5A A;  1Z05 A;  3OYN A;  3JRF A;  4I7H A;  5FFZ A;  4EJO A;  1D0X A;  1FPQ A;  1W5S A;  2E36 A;  4BXU A;  3BG9 A;  2E71 A;  1NG6 A;  1GXP A;  4XOT A;  1FLI A;  1T33 A;  4XLA A;  2M8E A;  2MH9 A;  2EFN A;  3M1E A;  2J5O A;  3WTW C;  1WRJ A;  4CGZ A;  2H8W A;  1QQI A;  4E7H A;  1WHU A;  2PJR B;  4RLQ A;  2WAQ N;  4YFN F;  1TWG J;  4EAT A;  2WTE A;  2MYS A;  4M6V A;  3HB9 A;  2TDX A;  3KCC A;  1P2F A;  5EEH A;  4B3X A;  4QPO A;  4A3I J;  2VL8 A;  3W2A A;  3O8H A;  1WWX A;  3ZN1 A;  4HNT A;  4B3A A;  2VC1 A;  4CDG A;  2WC2 A;  1UG0 A;  1PP8 F;  2GZW A;  2AXT C;  3GCM A;  2DAO A;  2KQR A;  3FXR A;  2QCO A;  3HOV J;  3AG3 H;  1GUU A;  1MBG A;  4XRF A;  4U88 A;  4HRI A;  4WK8 F;  3OL3 A;  2CO5 A;  3ZQG A;  4XRS A;  2WAE A;  1DP3 A;  4XNF A;  5E3M A;  2UXX A;  5EGO A;  1FY7 A;  3E5X A;  4PFP A;  3I4M J;  1CF7 A;  2HZT A;  4RBO A;  3LSG A;  3SZT A;  5KAI C;  3PNT A;  1USS A;  4HDV A;  4AIJ A;  1TW2 A;  4AIH A;  1S7O A;  2VPR A;  1SAN A;  1TWH J;  1WJB A;  4RAZ A;  4UB6 C;  5EZG A;  1HKS A;  4R8H A;  2COB A;  4HOB A;  2E19 A;  2X1C A;  2XAQ A;  2E35 A;  3CUO A;  5C44 J;  3CTA A;  1XGO A;  2WAQ A;  3JAM Z;  1PYV A;  1D8J A;  1N78 A;  1MBE A;  1D1B A;  3C7J A;  4KFC A;  2Z1D A;  2VPL A;  1HOM A;  2NOG A;  1XN7 A;  2BHZ A;  2GIZ A;  1R36 A;  2R7T A;  1NK3 P;  5FJ8 J;  5BMZ A;  4OAY A;  3EUH C;  3ABU A;  3AKZ A;  1JTX A;  4DQ2 A;  2F5E A;  4F7Z A;  4WWC A;  4IHT A;  3GFL A;  1BR4 A;  3HKZ N;  3BWG A;  4LFU A;  4RGR A;  1B6A A;  3MCZ A;  1Y0U A;  1X3Z B;  2CFO A;  4XOP A;  1VQK I;  3DPT A;  3GTM J;  5ERI A;  2LK2 A;  3EET A;  4MTE A;  2L7K A;  5GP9 A;  1IRX A;  4ITV A;  2FOW A;  4JP0 A;  2BYV E;  2JZY A;  4IVN A;  2PJP A;  4AID A;  5L3E A;  1RRJ A;  2HQN A;  1TWA J;  1OCO H;  1LUJ B;  4WCG A;  1BI2 A;  1A36 A;  3WGI A;  1B8I A;  1MW7 A;  1O7L A;  2IGK A;  3CUQ B;  2CQX A;  3GTG J;  3OYD A;  5K5Q A;  4A3L J;  3O2P E;  3JAM K;  4ENK A;  2F4M B;  3K4C A;  3S3M A;  1R5G A;  2MH2 A;  5KK1 A;  2VUM J;  4L5J A;  2HYF A;  3S8P A;  3S1R J;  2CW0 F;  2LNB A;  2QF7 A;  5GAD J;  3LAP A;  1V54 H;  2FJ1 A;  5IT3 A;  6PAX A;  2JT1 A;  1LDD A;  3H9G A;  3ABL H;  3WE3 A;  5IOZ A;  1Z9C A;  2XKP A;  5B66 C;  1FOY A;  3BCA A;  1D8K A;  3K7A J;  3F72 A;  1B72 A;  2K9N A;  1HW2 A;  1UAA A;  4XLP F;  2JA5 J;  5IYB J;  5EEA A;  1B4A A;  5HS7 A;  3RKX A;  3ZP5 A;  1T98 A;  2YUS A;  3VOD A;  1BIA A;  3KIO A;  1PUF A;  5E1Z B;  3H35 A;  3CJR B;  4RGX A;  4HNV A;  3PFI A;  3O3K A;  4QWQ A;  5CVI A;  4AIK A;  4QSH A;  3DQV C;  4QLC U;  1ETX A;  1IN4 A;  3L00 A;  4L0Y B;  2EV0 A;  3Q0U A;  3COA C;  4F3Q A;  1IUY A;  2NVT J;  2EJR A;  2VB6 A;  2VKE A;  5EF6 A;  3MQ0 A;  2DFF A;  1HA8 A;  4FE4 A;  2E1M B;  4CIC A;  5E17 F;  4CYD A;  1S7A A;  2BXY A;  4C2M J;  1F4K A;  2B7E A;  2XV4 S;  3ZMU A;  2HWV A;  5CYV A;  2EQR A;  4ZYA A;  2X1D A;  5LHH A;  2ECC A;  2JPC A;  2HPI A;  2JUC A;  1HKQ A;  2P8T A;  1E2X A;  2JA8 J;  3PNV A;  1YX3 A;  2M7A A;  3UKG A;  2HR3 A;  2ACJ A;  3ZN0 A;  3JRI A;  2AQE A;  2O6G E;  2CV0 A;  2V1N A;  4HF1 A;  4HYE A;  2EK5 A;  1FZP B;  3TQN A;  4YFX F;  1X3W B;  3FBN B;  4YIR X;  1XSX A;  3GZN B;  2MAB A;  3C3W A;  2WV1 A;  3PIP F;  2UZK A;  3CCQ I;  1Y1W J;  3L2C A;  3W2W A;  5LFA A;  2VKH A;  1A5J A;  4XL9 A;  1OR7 A;  1HW1 A;  1U6G A;  3A2K A;  3KP2 A;  4XK4 A;  2WWY A;  2ZNZ A;  1APL C;  1YG2 A;  5L3F A;  2MLK A;  2MD5 A;  2L5Q A;  3I9V 2;  4YII A;  1IJW C;  1VF9 A;  3GVA A;  2L01 A;  5JLX A;  3LSI A;  4ZH4 F;  2TRT A;  2OTJ I;  5B1B H;  1R6R A;  1W5C C;  4B47 A;  1Z21 A;  2LR8 A;  3K1P A;  4J01 A;  3OMY A;  3OYB A;  2XRL A;  1ZYR F;  2VQG A;  3CCS I;  2WA0 A;  1ZLK A;  2CYY A;  2R3S A;  1K6O A;  2W84 A;  2K40 A;  4UUT A;  5F1J A;  5F1R A;  1AU7 A;  1PUE E;  2H6B A;  1HW5 A;  2KJB A;  3JW4 A;  1LVK A;  3NQO A;  2H27 A;  2ESH A;  2LKX A;  1MSE C;  5ILS A;  5ILV A;  3HC7 A;  1B59 A;  2K9Q A;  3IKT A;  4V19 K;  1YE9 A;  5F27 A;  3BJ6 A;  1Z6T A;  2XAF A;  1Z7U A;  3C2G A;  3JRD A;  4I09 A;  3ECO A;  3K0L A;  3TW7 A;  3IAS 2;  1JHF A;  1SFE A;  5HNH A;  3S1N J;  4GYI A;  5IP9 J;  1R5I D;  3MAJ A;  3ZQF A;  1FWZ A;  4EMS A;  1SD5 A;  3QYF A;  2F4O B;  4EGZ A;  1ZGA A;  5IP6 A;  1IC8 A;  3QWL A;  2EZK A;  4CXF A;  5FLV A;  3L09 A;  2HVQ A;  2HXO A;  2BGC A;  3E6B A;  2JUG A;  1YHQ I;  1YI2 I;  2LKS A;  2CU7 A;  3DU5 A;  1FSH A;  5LD2 C;  4BUP A;  3BLY A;  5J40 A;  1M1E B;  2K4B A;  3SYT A;  4QPQ A;  3HUG B;  1J9I A;  2PN6 A;  1JT6 A;  4OAZ A;  1BW6 A;  5GAE J;  2XC7 A;  3S2H J;  2B0L A;  4F92 B;  1U5T A;  3K4J A;  1HSJ A;  4M71 A;  2M9H A;  3NRV A;  1GDT A;  3QU3 A;  5FD5 A;  1R22 A;  4A2U A;  3EPZ A;  2WAD A;  3E1S A;  3K4N A;  1IXS B;  4I0A A;  4EQQ A;  1E0E A;  4LMY A;  2HOE A;  3RPU A;  1LVA A;  1YTY A;  5AON A;  5D5W B;  2TCT A;  3HDD A;  2R7R A;  4HF2 A;  2ESN A;  2VOD A;  4XQF A;  3FXO A;  1UHS A;  1JJ6 C;  4RDU A;  1R5H A;  4DGW B;  1BR1 A;  2QGU A;  2VT2 A;  3JRH A;  1WSU A;  2FQ4 A;  3OOP A;  4M6X A;  2EFP A;  3I58 A;  3LL7 A;  2Z2S B;  4KNY A;  3R6S A;  1XSV A;  3BZ6 A;  4R79 A;  3CMM A;  4UV9 A;  3CZ6 A;  4BL0 B;  5DM6 F;  5FKK A;  2KIS A;  3BPV A;  4BHP A;  3RKQ A;  2L9N A;  1R58 A;  3P7N A;  2NXN B;  3ZMV A;  4RM3 A;  4HV6 A;  1FP2 A;  3S2D J;  2PX9 A;  1E3P A;  3I71 A;  4ZYG A;  4FQG A;  2Y75 A;  2OUM A;  1VQN I;  4KT6 A;  2DA4 A;  4RAF A;  3MMY B;  4A3F J;  1OIS A;  3P9K A;  2EIN H;  2R7D A;  5EG0 B;  5A2Q Z;  2VE9 A;  5LRS A;  4Y3O A;  4IF4 A;  2QBY A;  3K70 C;  2Y0M A;  2HQ5 A;  2XSD C;  4UY8 I;  2G7H A;  3IRR A;  1EH8 A;  2FEZ A;  3HUG A;  4CCJ A;  2M1B A;  2Y30 A;  1EV7 A;  2CUZ A;  1LPQ A;  2OZ6 A;  1SFU A;  5D8K B;  5K1Y A;  3S2W A;  4J19 A;  1DUX C;  1Q1H A;  2M2E A;  4KIF A;  3QOP A;  3SQN A;  1HF0 A;  2JWT A;  1U5T B;  5FO5 A;  2HS5 A;  2C6Y A;  3G2B A;  3JCU C;  3V7C A;  2LP0 A;  4KDP A;  3BZK A;  3IHU A;  5M3M J;  2DN0 A;  4CSW A;  2BOL A;  2W85 A;  2X6X A;  1JXS A;  4XMY A;  4M74 A;  2QSH X;  1MZB A;  4RB0 A;  1LJ9 A;  3DEU A;  5GTH C;  2KL4 A;  5ICE A;  2VJJ A;  1WJE A;  2K86 A;  4MEX F;  3K1M A;  4WF2 A;  2V6E A;  4LB5 A;  3NWS A;  2I5U A;  2FOK A;  2LRE A;  1V5G A;  2VQL A;  4BHB A;  1I50 J;  4KUM A;  2ETH A;  1P7I A;  2A5Y B;  2LSO A;  3CQZ J;  2XGX A;  4ZYH A;  2BY0 A;  1R1V A;  1L0O C;  2NVY J;  2W82 A;  4MFE A;  4GDF A;  1V5F A;  2ME6 A;  4LLG F;  4NQW B;  2Y9Z A;  2PBI A;  4EVI A;  2ZME C;  3MVP A;  3HOU J;  3B6A A;  4OWR B;  3SEQ A;  2DDA A;  1GHC A;  2P5L C;  4M72 A;  4Q48 A;  4ANJ A;  1H0M A;  4WXC A;  2NNY A;  2K85 A;  2O3F A;  1WJA A;  1UHM A;  4KT5 C;  3K6G A;  1AA7 A;  1N77 A;  4JYK A;  1U9N A;  3HXL A;  5DM7 F;  1SMY F;  2FBI A;  2ZJ2 A;  5F0C A;  1G3T A;  3SZP A;  3KZI C;  5D5U B;  2O61 A;  2F5F A;  4XLE A;  5HDG A;  2QSF X;  1KGS A;  1DDN A;  1VND A;  3S14 J;  2R7V A;  4KMF A;  3VSK A;  4A3J J;  4LK0 F;  2RV8 A;  4NBQ A;  1XCV A;  2A5W A;  2OCE A;  2UXN A;  3VEP A;  4E4H A;  2NYX A;  3RZD J;  1FOW A;  5L3D A;  2QUF A;  2KP6 A;  2Z9O A;  1MNE A;  3TOB A;  4XR6 A;  2JN6 A;  3B02 A;  5EEG A;  4JOM A;  4BY7 J;  1WJ5 A;  4OIN F;  4BKX A;  4IJA A;  3WHC A;  2XF5 A;  1D1A A;  1JUM A;  2E5Z A;  1ZN2 A;  4II2 A;  5C4J J;  3EUH A;  1FBS A;  1YIJ I;  1HDP A;  3FHZ A;  4FE7 A;  2H6C A;  1J09 A;  1NK2 P;  3WTS C;  3CC4 I;  1GV2 A;  2AS5 F;  4B48 A;  5A2Q K;  3M07 A;  2YPR A;  4M3B A;  5KAF C;  3HOT A;  3SDB A;  2M45 A;  4Y4R A;  2Q2E B;  4LLN A;  2HKO A;  4LIV A;  4AVP A;  3LSH A;  1YRN B;  4JK1 X;  5CVU A;  2L7F P;  1BM9 A;  3F0C A;  1FYM A;  3CES A;  3EYI A;  1IO2 A;  1OCP A;  1QPM A;  2E60 A;  4C2U A;  4Q47 A;  5FKL A;  4UUS B;  1ETK A;  4HAM A;  4A69 C;  1SFK A;  3IC7 A;  2KDZ A;  2PMH A;  1NHA A;  2O7O A;  2QKM B;  1VI0 A;  3WGG A;  1OLT A;  5M5W J;  3CD6 I;  3BQY A;  3ZXS A;  3W6V A;  4GFB A;  1I1S A;  4PJJ A;  2Q8K A;  5DD4 A;  1B9M A;  2QKL B;  3GTQ J;  3K70 D;  3S32 A;  3KEY A;  4IHY A;  2RKH A;  1KU7 A;  1D0Y A;  1QGP A;  5DYM A;  4BJ5 C;  4U0Y A;  1OYY A;  4CZZ A;  3QYE A;  4HLX A;  4LD5 A;  2YX7 A;  2QQA A;  4KIB A;  1K61 A;  1XMA A;  4P5O A;  3BR1 A;  2GAU A;  3OWT A;  2VN2 A;  3A02 A;  3KYL A;  3T5X A;  5BQT A;  1IG7 A;  5K5O A;  1H88 C;  1YIO A;  2IS2 A;  2F2E A;  1Z0X A;  1G3Y A;  2F4I A;  2CH0 A;  3H5R A;  5KHD A;  1KYW A;  2K27 A;  2OJE D;  2W24 A;  3FWE A;  4OU0 A;  3E97 A;  2X4H A;  4N4O B;  4EGY A;  2MA3 A;  1VQ7 I;  2HI3 A;  1TNS A;  4JX6 A;  4BAC A;  4BDY A;  3ML6 A;  2BBY A;  3HRT A;  2XAG A;  3DBH B;  3VB2 A;  1JJ8 C;  3S16 J;  2DMT A;  4N9H A;  3B73 A;  4BXF A;  3CCV I;  3J80 K;  1PVE A;  3J81 Z;  2XGE A;  3KE2 A;  5L3G A;  1DPU A;  1ZK8 A;  3CLO A;  4AC0 A;  1VQ8 I;  5IOY A;  3TDU C;  3L2V A;  3OR2 C;  4CYC A;  5J4Y A;  3LSK A;  4BJ6 C;  5IYD J;  4C30 A;  1BA5 A;  3M8E A;  2QVO A;  2GA2 A;  3PM1 A;  3CUQ C;  2XKO A;  4MIM A;  1X4P A;  4NC6 A;  5HLT A;  5FLM J;  2F6C A;  2A07 F;  2M34 A;  1UJ8 A;  1REP C;  2Q0O A;  3LFU A;  2DLL A;  3F8F A;  1J5Y A;  3C2H A;  4ZC3 A;  5FRO A;  2HOA A;  2DT7 B;  1F43 A;  1TLH B;  2FX0 A;  5B5E C;  2A05 A;  4C3H J;  1O3R A;  2DMU A;  2IBD A;  5ICG A;  3E7L A;  1QRY A;  1K83 J;  3FHN A;  2A61 A;  2XIG A;  3HSR A;  2H09 A;  4M3E A;  3DPL C;  2VE8 A;  1RI7 A;  1X58 A;  2DMP A;  5M5Y J;  3T8T A;  2LBF A;  4G6Q A;  2LY9 A;  4PCQ A;  1EF4 A;  4LG3 A;  1FBQ A;  3CMY A;  4YRV A;  1JT0 A;  2ZJP F;  3N05 A;  1AKH A;  2B63 J;  1SAU A;  2KPM A;  3C2B A;  1ENH A;  3VYT B;  4F93 B;  1V3F A;  4HQM A;  3FXM A;  3F8M A;  2ID3 A;  5EYR A;  1KU9 A;  3RJP A;  2PEX A;  1T08 B;  3V4G A;  3LMM A;  1GLN A;  1QVT A;  4Y15 A;  1TL8 A;  2MFZ A;  3FXL A;  4NC7 A;  3RQI A;  1S8N A;  3JRE A;  4G7Z F;  5IT9 Z;  4CCN A;  2VIX A;  2Y0S A;  5D5V B;  4U7D A;  3IUO A;  5L3B A;  1BJZ A;  2RQQ A;  2UUZ A;  1J75 A;  2QBY B;  3FMS A;  1OR7 C;  4MGR A;  1HQC A;  5HVQ C;  2XVC A;  2M0M A;  3VFZ A;  2LY2 A;  1DU6 A;  2K4J A;  3MWM A;  1ZG5 A;  1GV5 A;  1QVU A;  4FX0 A;  3FM5 A;  1VQ9 I;  3JSP A;  2EH3 A;  3M8F A;  2VJ4 A;  3BR3 A;  4IPA A;  2GXA A;  1ZH5 A;  3B6C A;  3HOS A;  1BC8 C;  1RPW A;  4FIS A;  3M8J A;  2STT A;  1RET A;  1FYL A;  2X6Y A;  3LOC A;  1VTN C;  2KRC A;  2DA1 A;  4JX4 A;  4D0P A;  5JR3 A;  2CMP A;  3HOX J;  2MBF A;  2R7Z J;  2DQL A;  3IWF A;  4II3 A;  1MMD A;  2H1K A;  1Z67 A;  2R7F A;  1WH5 A;  1XG1 A;  2IAI A;  1IRF A;  3ZMZ A;  2DOA A;  4S05 A;  9ANT A;  4LG0 A;  4OMY A;  4Y33 A;  2V1X A;  3G4S I;  2KMU A;  2D1V A;  4GRI A;  2FF4 A;  2XHK A;  4RS8 A;  1TNT A;  1OMI A;  1UZC A;  1RC9 A;  4B4C A;  3CMA I;  4E7J A;  1XB4 A;  1WGX A;  2DT5 A;  2STW A;  3KP7 A;  2QZ8 A;  2IT0 A;  4H0E A;  3FIS A;  2QA4 I;  1T95 A;  2BZT A;  2JPB A;  4A5N A;  5J8F A;  4B8X A;  2RDP A;  3I59 B;  3Q9S A;  1WCM J;  2EFQ A;  3HHG A;  3K2Z A;  5ICC A;  3BR2 A;  1JE8 A;  3Q0W A;  4EJW A;  2V6C A;  2VLA A;  1I5Z A;  4G6D A;  3ZGK A;  2KJC A;  3HSF A;  1G2H A;  5FKM A;  1MJA A;  3OS0 A;  3QU6 A;  1VQL I;  1OYW A;  3GLL A;  2HU9 A;  3I0T A;  5J47 A;  2GOM A;  3ZMT A;  4L18 B;  2GOX B;  1D0Z A;  2EBI A;  3DTI A;  2G0E A;  1DPR A;  4AUX A;  1MD0 A;  2N8G A;  2VKV A;  3QQA A;  3CP2 A;  3GTO J;  2JVG A;  4ABZ A;  1ZLJ A;  3H3Z A;  1TQI A;  3BRO A;  4GGG A;  4CCK A;  5EG0 A;  4J00 A;  4G12 A;  1VQ4 I;  2ZSI B;  2XAS A;  1BIB A;  2CG4 A;  5FB2 A;  2ISY A;  1F1Z A;  2EFW A;  2HVR A;  4BH9 A;  3G6E I;  1P4A A;  2L7Z A;  1RKW A;  3HKZ A;  1IGN A;  3QPT A;  4I0B A;  2O0Y A;  3MN2 A;  3C1D A;  5CJ9 A;  3TW6 A;  4AWX B;  2DCE A;  4PGH A;  3F23 A;  1LB2 A;  1MSF C;  3J7A Y;  3CDL A;  2QQ8 A;  1A35 A;  2ZFW A;  4BGD A;  1VQP I;  5H6R A;  4BE0 A;  3HRM A;  4BQA A;  4Y7N J;  2O8X A;  3M1C A;  5FKN A;  3GUD A;  4RA2 A;  1SAX A;  4D7N A;  2HFH A;  5GPC A;  4A3E J;  3BR5 A;  2JRM A;  1Y39 A;  4HW0 A;  1XGN A;  4B1R A;  5TIS C;  5C3E J;  1MBK A;  1BW5 A;  1YJN I;  2COM A;  5H20 A;  4FET A;  1Q1V A;  4DJA A;  5J1R A;  2V1U A;  3QOE A;  2DBB A;  2DTR A;  3EYY A;  2RRE A;  3J7A O;  3KP6 A;  4PZJ A;  4XKC A;  4PSW A;  2HYJ A;  1XGM A;  2FMY A;  1Y56 A;  1TW3 A;  4ZTF A;  1Z1D A;  3KP5 A;  3CDH A;  2IRF G;  2DPU A;  3CCM I;  1Z3X A;  1UEL B;  1K78 B;  2CV2 A;  2BEO A;  2VJ5 A;  2X51 A;  3H3V K;  5FD6 A;  3H5N A;  3HL2 A;  4HQE A;  1AWC A;  2V79 A;  2VT3 A;  1X1P A;  2IXS A;  3LST A;  3S3O A;  3F6V A;  3QP6 A;  4XN0 A;  4ON0 A;  5KVR A;  3M3Y J;  1QU3 A;  1R49 A;  1N25 A;  4E7S A;  2YR2 A;  3G1O A;  4XSX F;  2EIL H;  4YIF A;  4BJT A;  3RPQ A;  1WPK A;  4AYB N;  1JKO C;  3U2R A;  1O57 A;  4EJV A;  2DYR H;  3OIP A;  3FMR A;  4AD9 A;  1KQ8 A;  1VQ6 I;  1OJL A;  4HX8 A;  2PI0 A;  2PMU A;  1ZRF A;  1J0R A;  3LAJ A;  4PJL A;  4Z6Y A;  2DK8 A;  2ID6 A;  2A6H F;  2IA1 A;  2HQA A;  3DU6 A;  4BXX J;  3HPG A;  4ESB A;  4IOC F;  3TL4 X;  1BBY A;  2VXZ A;  2VBZ A;  2DOF A;  2K3F A;  2X6W A;  3BY6 A;  1P7J A;  3WTY C;  5CQE A;  1V55 H;  5E20 A;  3GBG A;  3BPX A;  2ZBK A;  1UCR A;  2R93 J;  5LBQ A;  2OBP A;  4E7Z A;  2K5C A;  3TKY A;  4OIQ F;  2NS7 A;  4BE2 A;  3IP4 B;  2MG4 A;  4QIW N;  1DGR M;  4EV0 A;  4E7L A;  2VBW A;  3VYR B;  3BP8 A;  3DLL F;  1Z91 A;  3I54 A;  2HVS A;  1R4N B;  4IX7 A;  2YSR A;  3OS2 A;  2M8G X;  1U3E M;  2X0L A;  2K9L A;  4M73 A;  4BDZ A;  1MND A;  3GFM A;  1ZAO A;  1MIJ A;  4AYB A;  1NH3 A;  2HDD A;  1FJL A;  3HEF A;  4KN4 X;  1FYK A;  4B43 A;  1XDS A;  3WU2 C;  3DEW A;  4P1W A;  2CQN A;  2OV7 A;  3A1Y A;  5E3N A;  2DQR A;  2DPD A;  4MNU A;  4IO9 F;  3HGG A;  5BPI A;  5HLI A;  2ICW G;  4PJN A;  1LFU P;  2HZD A;  2JMW A;  2RC4 A;  1IN6 A;  2ZC2 A;  1OPC A;  1VZ0 A;  4MFD A;  2CFX A;  4IHX A;  2ZXJ A;  2R5Y B;  1PJR A;  2IJL A;  1JUS A;  4CUG A;  4I98 B;  2YS9 A;  2OD5 A;  2QQB A;  2NVU B;  1FP1 D;  1SMT A;  1IF1 A;  4L9V A;  2CGP A;  3DBR B;  2HTS A;  1S72 I;  5J1U A;  2VI6 A;  4XBF A;  4A0Z A;  2HXI A;  3VOE A;  1IV6 A;  5DD8 A;  3LNQ A;  2XSJ C;  3GTK J;  1XGS A;  2XAU A;  4BBS J;  1T0F C;  4ZYE A;  3OYA A;  4Q5S F;  2K7L A;  3KEO A;  2EWN A;  1BR2 A;  4GXO A;  3V7S A;  5K7H A;  2HDW A;  1HBX G;  4W97 A;  3BJO A;  3HTU A;  3GXO A;  3NAR A;  3G73 A;  1P9Q C;  5JI6 A;  1RR7 A;  5LGU A;  4E7K A;  1MBF A;  2EZH A;  1S7E A;  2ELH A;  3TO6 A;  2P7C B;  1KYZ A;  2PG4 A;  2E7W A;  3BJA A;  5DEQ A;  2GXB A;  4U87 A;  2VOO A;  2R7U A;  3TOA A;  3IV5 A;  1B72 B;  3HOY J;  3U1K A;  4ASN A;  2W1O A;  3GEZ A;  3GFI A;  1ULY A;  1YOV B;  3FXJ A;  4B44 A;  1HC8 A;  4HF0 A;  2E1M C;  3BG7 A;  1FTT A;  2LMD A;  3HYI A;  1F5T A;  2H94 A;  1RUN A;  3BR6 A;  4X1E A;  4KMU X;  5FGM A;  4KIC A;  1JUP A;  2DTZ A;  3TMO A;  3MZH A;  1U8R A;  1GT0 C;  4XKV A;  4A3C J;  3HZJ A;  2RGV A;  3H1C A;  1ETV A;  3MZ8 A;  3V8J A;  3I59 A;  1BI0 A;  4D7M A;  3H3U A;  4UUS A;  1DGW Y;  1FOX A;  4PJM A;  2I8D A;  2H8R A;  3OYF A;  1T8I A;  2ZME B;  4HDU A;  5CKT A;  3KLN A;  3FZV A;  2DOD A;  4HBL A;  4U7B A;  1ACI A;  1F9N A;  1T39 A;  2GM4 A;  2MSY A;  4I01 A;  3TO9 A;  5LHI A;  2BHY A;  4ZZD A;  3KET A;  2NS8 A;  2KKO A;  2L4A A;  4NQW A;  1ZHF A;  2BXZ A;  2QEN A;  2KIF A;  2KZG A;  4IQJ A;  1XMX A;  2K02 A;  2HKX A;  3FK7 A;  2IS1 A;  4HSR A;  5FLX K;  1YW7 A;  5JFR A;  2CWE A;  3DTK A;  3LSM A;  4A3D J;  1ZEL A;  2EFO A;  3H9Q A;  3KX2 A;  5FFX A;  1VQM I;  3RCO A;  2KFD A;  2VXD A;  3AG4 H;  5D4R A;  1WVR A;  2JK3 A;  3BTI A;  3BCB A;  3DKX A;  4CHU A;  3OS1 A;  1IRZ A;  3GTL J;  4DOZ A;  1TBX A;  2FBK A;  3S1Q J;  1JKP C;  4XRM A;  2Y48 A;  4U0W A;  2NVX J;  2ELK A;  1RES A;  2GXG A;  1WI3 A;  2CJJ A;  1MMS A;  3OIQ A;  1X1C A;  3CUQ A;  3KPH A;  4BQN A;  5HDK A;  3TP0 A;  3WU0 A;  3KFW X;  3CDI A;  2RNG A;  4DZP A;  2Z16 A;  3GTJ J;  5LHG A;  2A69 F;  1H9G A;  2KDO A;  3DF8 A;  5CVJ A;  2L9V A;  5TRD A;  1XX5 A;  5EZH A;  1LEA A;  1XCB A;  2HQR A;  2A68 F;  1J2X A;  4DYQ A;  2QLZ A;  5E8I A;  4IHV A;  3L9F A;  3LQQ A;  2NOJ B;  3CME I;  4MQV A;  1MMG A;  2IP2 A;  2V9K A;  3LSJ A;  2ZO4 A;  4EJU A;  1OKR A;  2IPQ X;  2WB1 A;  2FU4 A;  4RGS A;  5KCM A;  2K9M A;  1ZG3 A;  1HCR A;  4K2E A;  3ZQH A;  2GQQ A;  4YFK F;  3TP3 A;  3E3V A;  2ADU A;  5GTI C;  2FML A;  2E1C A;  2DA5 A;  2W4S A;  4G94 A;  3L2Q A;  2QM3 A;  1JKQ C;  2NS0 A;  3FXK A;  4BEH A;  1D3Y A;  3FXU A;  4ENJ A;  3VPR A;  1QPI A;  3KEQ A;  1O3S A;  2V4J C;  2KRH A;  1I6H J;  3R0J A;  2JSP A;  3FMQ A;  2M4K A;  2LD5 A;  1G3S A;  4OIO F;  1ETO A;  3PFY A;  1PUF B;  1S29 A;  1IW7 F;  2MGQ A;  1TT0 A;  1QZE A;  3UR3 C;  4JX5 A;  5D6E A;  5K5R A;  4NC8 A;  2CSO A;  4M9Z A;  1O7F A;  1XTA A;  3OYI A;  4FX4 A;  2LFB A;  1R23 A;  3SFZ A;  1R1T A;  1DQU A;  2FNA A;  2BW3 B;  4D5F A;  2L54 A;  4XN3 A;  5L3C A;  3V42 A;  5J3L A;  4C3I J;  3PQK A;  1MMA A;  2HOT A;  4YEJ A;  2LH9 A;  2RQP A;  2FRH A;  3S15 J;  3QYB A;  2WV0 A;  3I64 A;  1EA3 A;  4I6Z A;  3K4L A;  4I02 A;  4I99 C;  3HSE A;  1ORK A;  3DKW A;  3AG2 H;  2PQ8 A;  4FT8 A;  1W4M A;  2AQF A;  1SEU A;  2M7B A;  3FXQ A;  1FEX A;  1B1B A;  2L4M A;  4XLN F;  1UB9 A;  4HZF A;  3K4M A;  1U9O A;  3ERM A;  4PJ0 C;  4FCY A;  3E5U A;  3L2W A;  3KYD B;  3SEZ A;  3BT9 A;  1ZKG A;  3OOU A;  1NG7 A;  1W1W E;  4NDL A;  5E1X A;  2M30 A;  4BBR J;  1W36 D;  3R61 A;  1FMV A;  2DA2 A;  3R60 A;  4GCV A;  4PFO A;  3RKW A;  2XPV A;  3KP3 A;  3H0D A;  2E2H J;  2UWM A;  4BY1 J;  3RZO J;  1ZG1 A;  1HLV A;  2IEK A;  2XDV A;  2R5Z B;  2R7X A;  3MEX A;  2BVL A;  1YJ9 I;  3PSF A;  4LLL A;  2NRA C;  4IHW A;  4CCL A;  3M9A A;  4V2G A;  3DEE A;  3L2R A;  2MW8 A;  1TTY A;  3U9G A;  3RYP A;  1R71 A;  4P9F A;  3OYM A;  4A12 A;  1W36 C;  3PJR A;  4KIS A;  1U0J A;  2EIJ H;  1SVM A;  2LVS A;  4Z2Y A;  2KIQ A;  1BOA A;  5KNL A;  1Z7L A;  5DCF A;  4C9Y A;  5JHF A;  1SD4 A;  3HIF A;  3JRA A;  2A3S A;  3OYL A;  2LDU A;  4RAY A;  2Y9Y A;  1RNL A;  3M4O J;  3DWL E;  4Y17 A;  4PSX A;  2J5P A;  3J7Y J;  3RYR A;  2PFB A;  2M4G A;  1F36 A;  2UV1 A;  5F6F A;  1ERD A;  3W2V A;  3N97 A;  3ROU A;  3H36 A;  3HHH A;  1IZ1 A;  4A0X A;  3CF2 A;  1WH7 A;  1V4R A;  2V9V A;  2ZME A;  3U21 A;  1IAW A;  3V7R A;  5J8C A;  1ON1 A;  1XC5 A;  3ZQQ A;  3CCY A;  1N75 A;  3CCR I;  4RB1 A;  1Y1V J;  1D1C A;  5HLH A;  5HOO A;  3IH3 A;  1YS6 A;  5BNG A;  4HST A;  3OIO A;  4F55 A;  3G1L A;  2VAS A;  3ZR8 X;  2QYO A;  4Y13 A;  1K79 A;  1SFX A;  4DYC A;  2JTV A;  1EJ9 A;  2ZJQ F;  2LTP A;  3GW2 A;  3GF2 A;  4OIR F;  3L1P A;  3QAH A;  2OA4 A;  3A0H C;  3FM3 A;  3WTZ A;  3KP4 A;  4W1U A;  3E6C C;  4A3G J;  2R7O A;  3Q3S A;  4UV8 A;  5DDG A;  1YX5 A;  2DI3 A;  4ENN A;  1W0U A;  2F48 A;  1O3Q A;  1UFM A;  3AAF A;  1T6S A;  4C2T A;  3IRQ A;  3HTS B;  2V1D A;  5EGO B;  2RN7 A;  4OOI A;  1I1G A;  2P5K A;  4OMZ A;  4DZJ A;  4A6D A;  1MNM C;  1G3W A;  5H6Q A;  1HST A;  2JSC A;  1Y8Q B;  1WFX A;  3RIR A;  1Y8R B;  1BOB A;  3IKV A;  3K4B A;  3P5J A;  5BS6 A;  5JVG F;  3ZRG A;  1XPX A;  1GVJ A;  2AO9 A;  3L2U A;  1G6N A;  3SFI A;  2OTL I;  1Z6R A;  1W5T A;  4IEJ A;  5HOD A;  3PNY A;  1U2W A;  4E70 A;  4O5V A;  3Q5F A;  2VOP A;  3TGN A;  4X6A J;  4ZTJ A;  2X9D A;  2LC2 A;  2Q1Z B;  3D5L A;  3SXY A;  3V8K A;  2HTJ A;  2PMZ A;  1I39 A;  3GWZ A;  2DA3 A;  2XGC A;  1KZH A;  1XS9 A;  1VQ5 I;  3DFG A;  4A3K J;  1A31 A;  1ZRD A;  4F52 A;  5JLW A;  4ZDL A;  4F91 B;  1K78 A;  3CCE I;  1W0T A;  3BDD A;  2XAH A;  3WHB A;  4BEH B;  1E17 A;  1AKH B;  2ZB9 A;  3I4N J;  2IGN A;  4UUV A;  1EH7 A;  2ZKZ A;  3BTC A;  3CO6 C;  1R00 A;  2YU3 A;  4DW6 A;  4E7I A;  3MD2 A;  4PGG A;  3RTR A;  3H9J A;  5LEJ A;  3WTX C;  3ZMD A;  2R7W A;  1HXD A;  3N4M A;  3DPU A;  2CS3 A;  4BYY A;  2FNP A;  2G9W A;  3T8R A;  3X2Q H;  2X48 A;  2RVC A;  4XRS G;  2OZU A;  2P0W A;  4PK4 A;  1H89 C;  5D6F A;  4KIT B;  1X2N A;  4E6K G;  1Y0N A;  1FX7 A;  2DDB A;  1LFP A;  1IV8 A;  1YFH A;  2P6S A;  4UVC A;  2I10 A;  2D1H A;  2KHM A;  3SHF A;  3TDZ C;  2WBM A;  4HX7 A;  3VYS B;  1ONV A;  1YRN A;  2P81 A;  3E5Q A;  4DBR A;  1D5V A;  4XKW A;  4ZDO A;  1YW9 A;  3ECH A;  3WGH A;  3TED A;  4ZDP A;  2XRN A;  2GBY A;  5EDN A;  1TT5 B;  2IA0 A;  4IXA A;  2VON A;  2IGO A;  1O3T A;  3DKY A;  3IAM 2;  5C4X J;  3O8G A;  4KA4 A;  4HA8 A;  3U1D A;  4CZC A;  4L0Z B;  2K3P A;  3BTL A;  2L3D A;  3NWT A;  3AG1 H;  1QZY A;  3OYG A;  1R9T J;  2Y2Z A;  2A6E F;  4V2F A;  4HNU A;  1LE8 A;  3F8C A;  1D5Y A;  3LQR A;  3LWF A;  2LOO A;  2XGD A;  3AL0 C;  4N0B A;  4ZJZ A;  4EM1 A;  2ELJ A;  4LIU A;  1IN5 A;  1EH6 A;  4I2O A;  3RQ4 A;  3ZQC A;  4B09 A;  1OYI A;  2O9L A;  3T0Y A;  4GO1 A;  2MLG A;  3QP5 A;  4IRG A;  4AU7 A;  1C0W A;  3FKI J;  2E34 A;  3D1N I;  1MDM B;  1P4W A;  2V26 A;  2BV6 A;  4LOC A;  2KIM A;  1U8B A;  1OCR H;  1X19 A;  1SVO A;  3P9C A;  3GTP J;  1HDD C;  5J1Y A;  2E1O A;  2P4W A;  5CLS A;  1CQT A;  5IYC J;  5DUI A;  1PDN C;  2EZI A;  3ISP A;  1XDU A;  1KQ0 A;  1MGT A;  2P7V B;  5GAH J;  2CV1 A;  5K7F A;  2W00 A;  2K9S A;  2MD0 A;  2DYS H;  2L9R A;  4HEA 2;  5B1A H;  2R7S A;  1Z3Y A;  1CGP A;  3UNG C;  3E0J B;  3BG3 A;  1RIO H;  4G9Y A;  1IN8 A;  1WQ2 A;  3D0S A;  4MLO A;  5K7Z A;  2H1L A;  3NAU A;  2FD5 A;  2OAZ A;  2ZXI A;  2E1N A;  5D4S A;  5J6X A;  2BY1 A;  5E18 F;  1KON A;  3JRB A;  1ETY A;  2EIM H;  4EM0 B;  1FSE A;  2DW4 A;  3W3C A;  3WTT C;  2R92 J;  5IY5 H;  1W7P A;  1B8I B;  3EUK L;  2LKP A;  5ED4 A;  5CVV A;  1E3H A;  1X1B A;  1MBH A;  3AFH A;  4R1H A;  3KYC B;  2XF6 A;  1LFB A;  3HM5 A;  4L9T A;  2BVM A; 
#chains in the Genus database with same CATH homology
 1P4X A;  4O3M A;  2Q2E A;  2PLY A;  1T2K A;  2QQ9 A;  2W25 A;  1JGS A;  3GZ6 A;  4ENM A;  4O6J A;  3T1B A;  3HRS A;  2IW5 A;  3LA2 A;  1STZ A;  1LQ1 A;  3LA7 A;  3GFJ A;  3E6M A;  3FX3 A;  1KU2 A;  5CVR A;  2XUB A;  2VBX A;  1FNN A;  4KIG A;  2GWR A;  5AIP A;  3I53 A;  3MZY A;  1QNT A;  3KZZ A;  2Z5U A;  1AOY A;  4HX4 A;  3ZQ7 A;  3E6D A;  4ZZL A;  1S3J A;  1IRG A;  1U5T C;  3F3X A;  2MC3 A;  4KN7 X;  4M9S A;  3J80 Z;  3TO7 A;  4BNC A;  4P9U A;  4NHJ A;  1G4D A;  1W7P B;  2NAZ A;  3GZ5 A;  5HS8 A;  5LEK A;  3KLO A;  1SD7 A;  2E7X A;  3LFK A;  4MQ9 F;  1H9T A;  2FXA A;  1LDJ A;  4P55 A;  4LGW A;  2CQK A;  2Z3Y A;  1YLF A;  1UST A;  2HGC A;  3R4K A;  2KRF A;  4YG2 F;  2OQR A;  2DK5 A;  3I4P A;  1U78 A;  4LJZ F;  3WTU C;  2XRO A;  3F21 A;  1YO5 C;  1UHW A;  1JHH A;  5TJJ A;  3JTG A;  1FT9 A;  1ON2 A;  4M6Y A;  2EA4 A;  2D45 A;  2BE5 F;  1TQM A;  1MKM A;  3ABT A;  3ERE D;  4M9X A;  4N9I A;  5HLG A;  1KQ9 A;  5IT9 K;  1QO0 D;  4L9N A;  2G7U A;  3QRF F;  4WXH A;  2FA5 A;  3K1N A;  5LGT A;  5JVT A;  4IRH A;  3MFK A;  2P6T A;  3PQJ A;  1XSD A;  4KYW A;  2IA2 A;  4MHG A;  1K7A A;  1P92 A;  1CF7 B;  1LEB A;  1IXR C;  2F5C A;  4MTD A;  3F8N A;  2DO7 A;  4JBA A;  1QZZ A;  3M7G A;  1X3U A;  1R7J A;  4G7O F;  3Q9V A;  3J81 K;  2OU2 A;  3GYH X;  1MDM A;  3ZMS A;  4EJT A;  3WTV C;  1BI1 A;  1MJB A;  3L7W A;  4P96 A;  2EB7 A;  3EDP A;  3WOD F;  5HS9 A;  5LRR A;  5JHU A;  3K9T A;  5DUK A;  2HDC A;  3GX4 X;  4RB3 C;  2DU9 A;  1IXC A;  2KIU A;  4L5I A;  1SD6 A;  2AXL A;  4MEY F;  4Q4Z F;  1ODD A;  4G8X A;  2EV6 A;  4UVB A;  4UXN A;  1QBJ A;  2EA2 A;  3ZPL A;  4JQF A;  1YYV A;  2Z99 A;  2IVM A;  4RB2 C;  1T38 A;  3DP7 A;  1J7K A;  2FSW A;  5E8G A;  3EQL F;  2M87 A;  4BAY A;  5D5X B;  1LDK B;  2P5V A;  3RKY A;  3JSO A;  5LGN A;  4LB6 B;  4HLY A;  3NEU A;  3OV8 A;  3IL2 A;  3O6B B;  5FLX Z;  1R1U A;  2F5D A;  3CJN A;  4LG0 B;  1ZAR A;  3BOQ A;  4A5M A;  3IWZ A;  2EV5 A;  2FQ3 A;  1RZ4 A;  3RI4 A;  3F22 A;  1ZRE A;  2YX4 A;  1J59 A;  2NNN A;  1XMK A;  4WXD A;  2ZNY A;  1LNW A;  1FOK A;  3QPH A;  3F6O A;  4XSZ F;  4L9J A;  2VC0 A;  2M5W A;  5DCM B;  1MJ9 A;  1IN7 A;  1BC7 C;  3REO A;  3FF5 A;  1P6R A;  1YS7 A;  4UNO A;  4A0Y A;  4ESF A;  2FE3 A;  1A04 A;  3F8B A;  3DV8 A;  5LLQ A;  3LA3 A;  4ETS A;  3C18 A;  1GXQ A;  1XD7 A;  2L02 A;  1YQA A;  4GYG A;  2GA1 A;  5HDN A;  1DP7 P;  1BI3 A;  2XAJ A;  2DFI A;  5E1W A;  2ISZ A;  4U0V A;  2D2W A;  5AIQ A;  4UVA A;  1ZGJ A;  1FC3 A;  1FBU A;  4OIP F;  3ULQ B;  2QWW A;  2Z33 A;  2LF7 A;  4UHT A;  5F64 A;  1PP7 U;  4WX9 A;  4A6E A;  5BOX A;  2ZCW A;  5ICF A;  4ESJ A;  4TV7 A;  2HEO A;  1KU3 A;  3V8L A;  1ZRC A;  4RGU A;  5ILU A;  3JTH A;  3ELK A;  3WE2 A;  5DCM A;  2HYG D;  2VBY A;  4BHC A;  3I5U A;  1S6L A;  3R0A A;  4EM2 A;  4ZYD A;  1I27 A;  3CO7 C;  3RDI A;  3W6K B;  1HKT A;  4IHS A;  3HRU A;  1WKM A;  4NB5 A;  3K69 A;  4G7H F;  1I6X A;  1W7P D;  4LK1 F;  2W57 A;  1BJA A;  1B9N A;  1TQP A;  1WI9 A;  2JRT A;  5DV5 A;  2FBH A;  1T0F A;  4CO8 A;  3DXJ F;  3WU1 B;  2OQG A;  3W6J B;  4FHT A;  3G3Z A;  2O03 A;  2LF8 A;  4IRI A;  3H92 A;  3KZY A;  4PDK A;  3WG9 A;  1BN5 A;  2GIV A;  3GO5 A;  4HV5 A;  2RNJ A;  1KA8 A;  1YW8 A;  5D8L B;  4DNC A;  5BPD A;  3GLX A;  1RUO A;  4S04 A;  3P9I A;  1L3L A;  1Z05 A;  4I7H A;  5FFZ A;  4EJO A;  1FPQ A;  1W5S A;  4BXU A;  1GXP A;  1FLI A;  2M8E A;  2MH9 A;  2EFN A;  3M1E A;  2J5O A;  3WTW C;  1WRJ A;  4CGZ A;  1QQI A;  4YFN F;  2WTE A;  2TDX A;  3KCC A;  1P2F A;  5EEH A;  1WWX A;  3ZN1 A;  2VC1 A;  4CDG A;  2WC2 A;  1PP8 F;  2GZW A;  2DAO A;  3FXR A;  4XRF A;  4U88 A;  4WK8 F;  2CO5 A;  2UXX A;  1FY7 A;  3E5X A;  1CF7 A;  2HZT A;  3SZT A;  4HDV A;  1USS A;  4AIJ A;  1TW2 A;  4AIH A;  1S7O A;  4RAZ A;  1HKS A;  4R8H A;  4HOB A;  2XAQ A;  3CUO A;  3CTA A;  1XGO A;  3JAM Z;  1D8J A;  3C7J A;  4KFC A;  1XN7 A;  1R36 A;  5BMZ A;  3ABU A;  4DQ2 A;  2F5E A;  4F7Z A;  4WWC A;  4IHT A;  3GFL A;  4LFU A;  3BWG A;  4RGR A;  1B6A A;  3MCZ A;  1Y0U A;  3DPT A;  5ERI A;  3EET A;  4MTE A;  2BYV E;  2JZY A;  4IVN A;  2PJP A;  5L3E A;  2HQN A;  4WCG A;  1BI2 A;  3WGI A;  1O7L A;  3CUQ B;  5K5Q A;  3O2P E;  3JAM K;  4ENK A;  1R5G A;  2MH2 A;  5KK1 A;  4L5J A;  2HYF A;  2CW0 F;  2LNB A;  3LAP A;  5IT3 A;  6PAX A;  2JT1 A;  1LDD A;  3WE3 A;  1Z9C A;  2XKP A;  1D8K A;  3F72 A;  1HW2 A;  4XLP F;  1B4A A;  5HS7 A;  3RKX A;  3ZP5 A;  1T98 A;  3VOD A;  1BIA A;  5E1Z B;  4RGX A;  3PFI A;  3O3K A;  4QWQ A;  5CVI A;  4AIK A;  3DQV C;  4QLC U;  1IN4 A;  3L00 A;  4L0Y B;  2EV0 A;  3COA C;  1IUY A;  2EJR A;  3MQ0 A;  4CIC A;  5E17 F;  4CYD A;  1S7A A;  1F4K A;  2XV4 S;  3ZMU A;  2HWV A;  5CYV A;  5LHH A;  2JPC A;  1HKQ A;  2P8T A;  1E2X A;  2HR3 A;  2ACJ A;  3ZN0 A;  2O6G E;  4HF1 A;  4HYE A;  2EK5 A;  1FZP B;  3TQN A;  4YFX F;  1XSX A;  3C3W A;  2UZK A;  3L2C A;  1OR7 A;  1HW1 A;  1U6G A;  3KP2 A;  2WWY A;  2ZNZ A;  1YG2 A;  5L3F A;  2MLK A;  2MD5 A;  4YII A;  3GVA A;  2L01 A;  4ZH4 F;  3K1P A;  1ZYR F;  1ZLK A;  2CYY A;  2R3S A;  1K6O A;  2W84 A;  5F1R A;  1PUE E;  2H6B A;  1HW5 A;  2KJB A;  3JW4 A;  3NQO A;  2H27 A;  2ESH A;  5ILS A;  5ILV A;  1B59 A;  3IKT A;  3BJ6 A;  1Z6T A;  2XAF A;  1Z7U A;  4I09 A;  3ECO A;  3K0L A;  1JHF A;  1SFE A;  4GYI A;  3MAJ A;  1FWZ A;  4EMS A;  1SD5 A;  4EGZ A;  1ZGA A;  4CXF A;  3L09 A;  2BGC A;  3E6B A;  1FSH A;  2K4B A;  1J9I A;  2PN6 A;  2B0L A;  1U5T A;  1HSJ A;  4M71 A;  3NRV A;  3QU3 A;  5FD5 A;  1R22 A;  4A2U A;  1IXS B;  4I0A A;  4EQQ A;  4LMY A;  2HOE A;  3RPU A;  1LVA A;  1YTY A;  5AON A;  5D5W B;  4HF2 A;  2ESN A;  2VOD A;  1R5H A;  2VT2 A;  1WSU A;  3OOP A;  4M6X A;  2EFP A;  3I58 A;  4KNY A;  3R6S A;  1XSV A;  3BZ6 A;  4R79 A;  4UV9 A;  3BPV A;  4BHP A;  1R58 A;  3P7N A;  3ZMV A;  4HV6 A;  1FP2 A;  3I71 A;  4ZYG A;  2Y75 A;  3P9K A;  2VE9 A;  2R7D A;  5A2Q Z;  5LRS A;  4IF4 A;  2QBY A;  2Y0M A;  2G7H A;  3IRR A;  1EH8 A;  2FEZ A;  3HUG A;  2M1B A;  1EV7 A;  2OZ6 A;  1SFU A;  5D8K B;  5K1Y A;  3S2W A;  1DUX C;  1Q1H A;  4KIF A;  3QOP A;  3SQN A;  5FO5 A;  1U5T B;  2HS5 A;  2C6Y A;  3V7C A;  4KDP A;  3IHU A;  2W85 A;  1JXS A;  4M74 A;  1MZB A;  4RB0 A;  1LJ9 A;  4MEX F;  3DEU A;  5ICE A;  2K86 A;  3K1M A;  4WF2 A;  4LB5 A;  2FOK A;  4BHB A;  4KUM A;  2ETH A;  2A5Y B;  2LSO A;  2XGX A;  4ZYH A;  1R1V A;  1L0O C;  4LLG F;  2PBI A;  4EVI A;  1GHC A;  2P5L C;  4M72 A;  4Q48 A;  1H0M A;  4WXC A;  2NNY A;  2O3F A;  1UHM A;  4KT5 C;  1SMY F;  2FBI A;  2ZJ2 A;  3SZP A;  1G3T A;  5D5U B;  2O61 A;  2F5F A;  5HDG A;  1KGS A;  1DDN A;  4KMF A;  4LK0 F;  2RV8 A;  1XCV A;  2UXN A;  3VEP A;  2NYX A;  5L3D A;  2QUF A;  2Z9O A;  3TOB A;  5EEG A;  3B02 A;  4OIN F;  4IJA A;  1ZN2 A;  3EUH A;  1FBS A;  3FHZ A;  2H6C A;  3WTS C;  2AS5 F;  5A2Q K;  2YPR A;  3HOT A;  2M45 A;  4LLN A;  2HKO A;  4AVP A;  4JK1 X;  5CVU A;  1BM9 A;  1FYM A;  3EYI A;  1QPM A;  4Q47 A;  4HAM A;  3IC7 A;  2PMH A;  1NHA A;  3WGG A;  1I1S A;  2Q8K A;  5DD4 A;  1B9M A;  2RKH A;  1KU7 A;  1QGP A;  5DYM A;  4U0Y A;  1OYY A;  4CZZ A;  4HLX A;  4LD5 A;  2YX7 A;  2QQA A;  4KIB A;  1XMA A;  4P5O A;  2GAU A;  2VN2 A;  3T5X A;  5BQT A;  5K5O A;  1YIO A;  2F2E A;  1G3Y A;  1KYW A;  2K27 A;  2W24 A;  3FWE A;  4OU0 A;  3E97 A;  2X4H A;  4EGY A;  2MA3 A;  1TNS A;  3ML6 A;  2BBY A;  3HRT A;  2XAG A;  3VB2 A;  4N9H A;  3B73 A;  3J80 K;  3J81 Z;  3KE2 A;  5L3G A;  1DPU A;  3CLO A;  3TDU C;  3M8E A;  2QVO A;  2GA2 A;  3CUQ C;  2XKO A;  2A07 F;  1REP C;  2Q0O A;  2DLL A;  3F8F A;  1J5Y A;  1TLH B;  1O3R A;  5ICG A;  2A61 A;  2XIG A;  3HSR A;  2H09 A;  3DPL C;  2VE8 A;  1RI7 A;  3T8T A;  4PCQ A;  4G6Q A;  1FBQ A;  1V3F A;  4HQM A;  3F8M A;  1KU9 A;  3RJP A;  2PEX A;  3V4G A;  4Y15 A;  1S8N A;  4G7Z F;  5IT9 Z;  5D5V B;  4U7D A;  5L3B A;  1J75 A;  2QBY B;  3FMS A;  4MGR A;  1HQC A;  5HVQ C;  2XVC A;  3VFZ A;  2K4J A;  3MWM A;  1ZG5 A;  4FX0 A;  3FM5 A;  3JSP A;  3M8F A;  4IPA A;  1ZH5 A;  3HOS A;  1BC8 C;  2STT A;  1FYL A;  1VTN C;  4D0P A;  5JR3 A;  2MBF A;  2DQL A;  3IWF A;  2R7F A;  3ZMZ A;  1IRF A;  4S05 A;  4LG0 A;  4OMY A;  2V1X A;  2D1V A;  2FF4 A;  2XHK A;  4RS8 A;  1TNT A;  1OMI A;  1XB4 A;  2DT5 A;  2STW A;  3KP7 A;  2QZ8 A;  2IT0 A;  4H0E A;  2JPB A;  4A5N A;  5J8F A;  4B8X A;  2RDP A;  3I59 B;  3Q9S A;  3K2Z A;  2EFQ A;  3HHG A;  5ICC A;  1JE8 A;  4EJW A;  2V6C A;  1I5Z A;  4G6D A;  2KJC A;  3HSF A;  1MJA A;  3QU6 A;  1OYW A;  3I0T A;  3ZMT A;  4L18 B;  1DPR A;  1MD0 A;  1ZLJ A;  3H3Z A;  1TQI A;  3BRO A;  4GGG A;  2XAS A;  1BIB A;  2CG4 A;  5FB2 A;  2ISY A;  1F1Z A;  2EFW A;  1P4A A;  3QPT A;  4I0B A;  2O0Y A;  3C1D A;  5CJ9 A;  4AWX B;  1LB2 A;  4PGH A;  3F23 A;  2ZFW A;  5H6R A;  3HRM A;  4BQA A;  2O8X A;  3GUD A;  1SAX A;  2HFH A;  4HW0 A;  1XGN A;  2COM A;  5H20 A;  2V1U A;  2DBB A;  2DTR A;  3EYY A;  3J7A O;  3KP6 A;  4PZJ A;  1XGM A;  2FMY A;  1TW3 A;  1Z1D A;  3KP5 A;  3CDH A;  2IRF G;  2DPU A;  1K78 B;  2BEO A;  5FD6 A;  4HQE A;  1AWC A;  2V79 A;  2VT3 A;  3LST A;  3F6V A;  3QP6 A;  4ON0 A;  5KVR A;  2YR2 A;  4XSX F;  4YIF A;  3RPQ A;  3U2R A;  1O57 A;  4EJV A;  3FMR A;  4AD9 A;  1KQ8 A;  4HX8 A;  2PI0 A;  2PMU A;  1ZRF A;  1J0R A;  3LAJ A;  2DK8 A;  2A6H F;  2IA1 A;  4ESB A;  1BBY A;  2VXZ A;  2VBZ A;  3BY6 A;  3WTY C;  5E20 A;  3BPX A;  2ZBK A;  1UCR A;  5LBQ A;  2OBP A;  3TKY A;  4OIQ F;  4EV0 A;  2VBW A;  3BP8 A;  1Z91 A;  3I54 A;  2YSR A;  1U3E M;  2X0L A;  4M73 A;  3GFM A;  1ZAO A;  4KN4 X;  1FYK A;  1XDS A;  2DQR A;  2DPD A;  4MNU A;  5BPI A;  5HLI A;  2RC4 A;  1IN6 A;  1OPC A;  2CFX A;  2ZXJ A;  2IJL A;  4I98 B;  2OD5 A;  2QQB A;  1FP1 D;  1SMT A;  1IF1 A;  4L9V A;  2CGP A;  2HTS A;  4XBF A;  4A0Z A;  3VOE A;  5DD8 A;  1XGS A;  4ZYE A;  4Q5S F;  2K7L A;  3KEO A;  2EWN A;  4GXO A;  3V7S A;  1HBX G;  3BJO A;  3HTU A;  3GXO A;  3G73 A;  5JI6 A;  5LGU A;  2ELH A;  3TO6 A;  2P7C B;  1KYZ A;  2PG4 A;  2E7W A;  3BJA A;  5DEQ A;  2GXB A;  2VOO A;  3TOA A;  4ASN A;  3GEZ A;  3GFI A;  1ULY A;  4HF0 A;  3HYI A;  1F5T A;  2H94 A;  1RUN A;  4KMU X;  5FGM A;  4KIC A;  3MZH A;  1U8R A;  2RGV A;  3V8J A;  3I59 A;  1BI0 A;  3H3U A;  2ZME B;  4HDU A;  3KLN A;  3FZV A;  4HBL A;  4U7B A;  1F9N A;  1T39 A;  4I01 A;  3TO9 A;  5LHI A;  4ZZD A;  3KET A;  2KKO A;  2L4A A;  4NQW A;  1ZHF A;  2QEN A;  2KIF A;  2K02 A;  2HKX A;  5FLX K;  1YW7 A;  5JFR A;  2CWE A;  2EFO A;  5FFX A;  5D4R A;  4CHU A;  1TBX A;  2FBK A;  2Y48 A;  4U0W A;  2GXG A;  3CUQ A;  5HDK A;  3WU0 A;  3KFW X;  5LHG A;  2A69 F;  1H9G A;  3DF8 A;  5CVJ A;  5TRD A;  1LEA A;  1XCB A;  2HQR A;  2A68 F;  1J2X A;  2QLZ A;  5E8I A;  3L9F A;  3LQQ A;  4MQV A;  2IP2 A;  2ZO4 A;  4EJU A;  1OKR A;  2IPQ X;  2FU4 A;  4RGS A;  1ZG3 A;  4K2E A;  2GQQ A;  4YFK F;  3E3V A;  2ADU A;  2FML A;  2E1C A;  4G94 A;  2QM3 A;  2NS0 A;  1D3Y A;  3FXU A;  4ENJ A;  3KEQ A;  1O3S A;  3R0J A;  3FMQ A;  1G3S A;  4OIO F;  1S29 A;  1IW7 F;  5D6E A;  5K5R A;  2CSO A;  4M9Z A;  1O7F A;  4FX4 A;  1R23 A;  3SFZ A;  1R1T A;  2FNA A;  2L54 A;  5L3C A;  3PQK A;  2RQP A;  2FRH A;  2WV0 A;  3I64 A;  4I02 A;  3HSE A;  3DKW A;  2PQ8 A;  4FT8 A;  1W4M A;  3FXQ A;  1B1B A;  2L4M A;  4XLN F;  1UB9 A;  4HZF A;  3E5U A;  5E1X A;  2M30 A;  3R61 A;  3R60 A;  4GCV A;  3RKW A;  2UWM A;  3KP3 A;  1ZG1 A;  3MEX A;  4LLL A;  2NRA C;  3M9A A;  1TTY A;  3U9G A;  3RYP A;  4P9F A;  4A12 A;  4Z2Y A;  1BOA A;  5DCF A;  1SD4 A;  3HIF A;  2A3S A;  2LDU A;  4RAY A;  1RNL A;  4Y17 A;  2J5P A;  3RYR A;  2PFB A;  5F6F A;  3N97 A;  3ROU A;  4A0X A;  3HHH A;  1IZ1 A;  2V9V A;  1V4R A;  2ZME A;  1IAW A;  3V7R A;  5J8C A;  1ON1 A;  4RB1 A;  5HLH A;  5HOO A;  1YS6 A;  2QYO A;  4Y13 A;  1K79 A;  1SFX A;  2JTV A;  3GW2 A;  3GF2 A;  4OIR F;  3QAH A;  2OA4 A;  3WTZ A;  3FM3 A;  3KP4 A;  3E6C C;  4UV8 A;  5DDG A;  2DI3 A;  4ENN A;  1O3Q A;  1UFM A;  3AAF A;  1T6S A;  3IRQ A;  3HTS B;  2V1D A;  2RN7 A;  4OOI A;  1I1G A;  2P5K A;  4OMZ A;  4A6D A;  1G3W A;  5H6Q A;  1HST A;  2JSC A;  3RIR A;  5BS6 A;  3IKV A;  1GVJ A;  1G6N A;  1Z6R A;  1W5T A;  1U2W A;  4E70 A;  4O5V A;  3Q5F A;  2VOP A;  3TGN A;  3D5L A;  3SXY A;  3V8K A;  2HTJ A;  3GWZ A;  3DFG A;  1ZRD A;  1K78 A;  3BDD A;  2XAH A;  1E17 A;  4UUV A;  1EH7 A;  2ZKZ A;  3CO6 C;  1R00 A;  2YU3 A;  4PGG A;  3RTR A;  5LEJ A;  3WTX C;  3ZMD A;  1HXD A;  3N4M A;  4BYY A;  2FNP A;  2G9W A;  3T8R A;  2RVC A;  2OZU A;  5D6F A;  1FX7 A;  1YFH A;  2P6S A;  4UVC A;  2D1H A;  3SHF A;  3TDZ C;  4HX7 A;  1ONV A;  3E5Q A;  1D5V A;  1YW9 A;  3ECH A;  3WGH A;  2XRN A;  2IA0 A;  4IXA A;  2VON A;  1O3T A;  4KA4 A;  4HA8 A;  3U1D A;  4L0Z B;  2L3D A;  1QZY A;  2A6E F;  3F8C A;  3LQR A;  3LWF A;  4N0B A;  4EM1 A;  1IN5 A;  1EH6 A;  4I2O A;  4B09 A;  1OYI A;  3T0Y A;  4GO1 A;  2MLG A;  3QP5 A;  4IRG A;  1C0W A;  1MDM B;  1P4W A;  2BV6 A;  2KIM A;  3P9C A;  2P4W A;  5CLS A;  5DUI A;  1PDN C;  3ISP A;  1XDU A;  1KQ0 A;  1MGT A;  2P7V B;  1CGP A;  1RIO H;  4G9Y A;  1IN8 A;  1WQ2 A;  3D0S A;  2OAZ A;  2E1N A;  5D4S A;  5J6X A;  5E18 F;  4EM0 B;  1FSE A;  2DW4 A;  3WTT C;  1W7P A;  2LKP A;  5ED4 A;  5CVV A;  4R1H A;  4L9T A;  4BH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...