1T6SA

Crystal structure of a conserved hypothetical protein from chlorobium tepidum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of ScpB from Chlorobium tepidum, a protein involved in chromosome partitioning.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA02
4CZZA 1XGSA 4LLGF 3ZN1A 2GXBA 2V1XA 3I0TA 2L4AA 3I71A 2XRNA 1ULYA 2JPBA 3DP7A 2OBPA 3T8TA 1FOKA 1MD0A 1J7KA 4XSZF 1ZARA 3HRMA 4UHTA 3LA3A 1LEBA 1BI1A 3V4GA 1G3TA 1ON2A 2P7VB 4OIRF 1HSJA 2HEOA 3I58A 1UHWA 2VN2A 5LGUA 4U7BA 5LHGA 3W6KB 4PDKA 3QU6A 2GQQA 4IXAA 4KNYA 1HSTA 1ODDA 4KIGA 3K69A 3MCZA 4Q4ZF 2PLYA 4I01A 3S2WA 4M9XA 5L3BA 2JTVA 1J5YA 3GO5A 3ZMSA 2P6TA 1B9NA 1BOAA 3FWEA 3OOPA 3GVAA 5ILSA 5H20A 2EV6A 2W24A 2K02A 3O2PE 4JQFA 3CDHA 4MQ9F 3KLOA 3G3ZA 3ERED 1AOYA 1FLIA 5BPIA 5DEQA 1G6NA 4MEYF 2HS5A 1BIAA 4HYEA 2WC2A 3DKWA 4L0YB 3IWFA 2KRFA 5D5WB 4M74A 2O0YA 2ELHA 3RYPA 3G73A 4M71A 5J8FA 2A5YB 3J81Z 2PBIA 4EGZA 1T98A 2P5VA 1IZ1A 2NRAC 3MZYA 3TOBA 1T6SA 5K5RA 2QENA 4ENJA 2O6GE 4NHJA 3BDDA 4HZFA 3LFKA 1IN8A 2G7HA 2L4MA 1YW9A 1XSVA 5LGNA 4RS8A 2NS0A 4HBLA 5ILVA 4U88A 1SMYF 5HS7A 2DPDA 1OMIA 2P4WA 4M6XA 1YW7A 3FM3A 3N4MA 5CVIA 2H6CA 2QUFA 2BBYA 3P7NA 2G7UA 4A0ZA 3F8MA 1W5TA 3TDUC 1T38A 4AVPA 4CYDA 1XGMA 3KFWX 4ZYGA 5JVTA 3HSEA 3SQNA 4FX4A 3L09A 4GYIA 4A6DA 1IRFA 4K2EA 2G9WA 2VBXA 2R7DA 1P4WA 4AIHA 3E5UA 4YIFA 1FYLA 5AIQA 1RUNA 3DF8A 4HF2A 3IL2A 4EGYA 1V3FA 4LLLA 4IJAA 5CLSA 3F8BA 2ZKZA 2Q0OA 4IHSA 2XUBA 2M8EA 3CJNA 4OMYA 4F7ZA 3ECHA 3HRUA 4OOIA 3K1PA 4R79A 1BI2A 2PFBA 3F8FA 4EM2A 4WCGA 3HUGA 3EYYA 2K4BA 2FNAA 2MBFA 3C3WA 2NNNA 1Z6RA 2EK5A 5HDGA 2ZNZA 5D5XB 5HS8A 4RB2C 2W84A 1IN5A 1T39A 1MJBA 3WGIA 2VT3A 3QPTA 3TO9A 1YS7A 2MC3A 3RPQA 2HDCA 2YX7A 3JTHA 4EJVA 1J9IA 2GA2A 4YFKF 1CGPA 4OIQF 2DK8A 1J0RA 2LNBA 4UVBA 4Q5SF 4ESFA 1JGSA 2ADUA 1QO0D 1ZN2A 4Z2YA 4CHUA 2DLLA 2F5EA 1LDDA 2Z33A 4EJWA 1W7PB 2F5DA 3WODF 1MDMB 2Y48A 1E2XA 2IA0A 1SAXA 2D1HA 4HDUA 1XB4A 2RV8A 4KIFA 3W6JB 5LBQA 3E5XA 2E7XA 5JHUA 4HF0A 3J81K 1IXRC 4L18B 3E6MA 1EH6A 1WI9A 3V8JA 1EH8A 3P9IA 2EFQA 2IP2A 4EMSA 3WTXC 4XSXF 4O3MA 2QYOA 2HOEA 4KA4A 1TQIA 4FHTA 3U2RA 3KP7A 3QU3A 3GX4X 3ROUA 2BYVE 3D0SA 3MAJA 1WSUA 1J75A 3CUOA 4RAZA 4WF2A 3BWGA 5ICEA 4IPAA 2NYXA 3ISPA 1UHMA 2HQNA 4U7DA 4QWQA 2OZ6A 1BC7C 2MH9A 1K78B 1R1TA 2Q2EA 5E8GA 3WTTC 4BQAA 4LFUA 4UVCA 2ESHA 1PP8F 1TW2A 4HX8A 1W7PA 3GFMA 4PGGA 1R7JA 3LQQA 2PJPA 1O3TA 1KQ9A 1W5SA 4G7HF 5A2QZ 3DFGA 2Q8KA 3PFIA 5LEKA 4BHCA 3IWZA 1PUEE 5FB2A 1IN6A 5D5UB 3RIRA 3EDPA 2YPRA 2CSOA 4ZYDA 2PQ8A 3BJ6A 3I4PA 3K2ZA 5D6EA 5HVQC 2H94A 4ZZDA 3ZMUA 5L3CA 1TQMA 1JHFA 3K9TA 2W25A 3M9AA 1A04A 2UXNA 2PG4A 1TTYA 1I1SA 1KU7A 2P5LC 2H27A 2QWWA 4HX4A 1ZGAA 2EFOA 2PEXA 2GAUA 2STTA 5EEHA 1KGSA 3IRRA 4OU0A 3KZYA 4RB1A 3M7GA 1G4DA 1U78A 1GXQA 1K78A 1DP7P 3NRVA 1K7AA 2JZYA 2GWRA 4HA8A 3FX3A 3GWZA 1OR7A 2IRFG 4YG2F 4EJOA 1TBXA 2JT1A 1XDUA 3HSFA 3WE2A 4ZZLA 3JSPA 2WTEA 3RJPA 1MJ9A 3FMQA 5DUIA 3BP8A 4LD5A 3SXYA 1B1BA 1BI0A 4MTEA 1WQ2A 3NEUA 4WXDA 1P4XA 5FD5A 1S8NA 1TLHB 3V8LA 4G94A 1HQCA 1PP7U 3VB2A 3MFKA 4RGUA 3HTSB 5AIPA 1XSDA 4A5NA 4EJTA 1IXCA 4JK1X 2HZTA 3V8KA 2DK5A 2YX4A 4L9NA 4BHBA 4Q47A 1S6LA 2HYGD 5DDGA 3JAMZ 3GEZA 2ETHA 2ZBKA 1KYZA 5BQTA 4I09A 1F1ZA 1ZG5A 5TRDA 1FBQA 1QQIA 4GO1A 1I6XA 4XBFA 3R6SA 4UVAA 4MQVA 1O57A 1P92A 2DBBA 3FHZA 2FE3A 3IC7A 4UUVA 4WK8F 3MZHA 2KIFA 1R5GA 2TDXA 1SFEA 3U9GA 2ZNYA 1L0OC 1YTYA 3MEXA 4HOBA 2HTSA 1MGTA 4QLCU 1ZLKA 3M8FA 2V9VA 4P5OA 1VTNC 3RKYA 3RKWA 2GXGA 1R00A 2MD5A 3TOAA 2IPQX 4WXHA 4FX0A 3WTUC 4KDPA 2VBWA 2OQGA 3IKTA 2D1VA 5BMZA 1YO5C 4L5JA 4CGZA 3B73A 1ZRCA 1FT9A 5A2QK 2CW0F 2O3FA 4AIKA 3E97A 2DFIA 3L2CA 2RNJA 1HW2A 1SD6A 2ZMEB 2DTRA 2P7CB 2VE9A 2C6YA 2ZO4A 1KQ8A 1W7PD 2COMA 4BH9A 4LGWA 4CXFA 2DU9A 2QZ8A 1IN4A 2A3SA 1QZYA 1IXSB 1FBUA 2JSCA 2FMLA 1BBYA 2RVCA 5FLXZ 2E7WA 1H9GA 2RQPA 1HBXG 5ERIA 4HF1A 3RPUA 2DT5A 5D4SA 2IW5A 2XASA 4XRFA 1B6AA 3CTAA 2W85A 3V7RA 2XVCA 2EWNA 5K1YA 2RC4A 2DAOA 1QZZA 3HHGA 4JBAA 2KKOA 2EJRA 1BI3A 2R7FA 1ZRDA 1B59A 5CVRA 4HX7A 1P4AA 4BHPA 1AWCA 1IF1A 5ICFA 2O03A 2VOOA 5D8KB 3ML6A 1U6GA 1ZRFA 3TGNA 1HXDA 1Z91A 1LDJA 2V1UA 1IN7A 1LEAA 4U0WA 2XAQA 2HTJA 3QAHA 1HKSA 4AIJA 2P8TA 4I7HA 4LMYA 1WRJA 3RDIA 2K7LA 2ZJ2A 5E20A 3LA7A 3JAMK 6PAXA 5DV5A 3ULQB 4L9TA 3E6DA 1SD7A 2KJBA 2DQRA 4CO8A 2XAFA 1ZAOA 1MZBA 2LKPA 1USSA 3ZN0A 2EFPA 3WTWC 4P9UA 2XGXA 2EFWA 3BPXA 3GUDA 2LDUA 2B0LA 4EM0B 2ISZA 1FP1D 2OA4A 3EQLF 3LSTA 3I59B 2R3SA 5BPDA 4G9YA 1LB2A 2XV4S 5FD6A 4MTDA 2LSOA 4HDVA 4KMFA 4LG0B 2O8XA 3BZ6A 1Q1HA 4GYGA 4RB3C 4L9VA 3EYIA 2ACJA 3KE2A 3VEPA 3ECOA 3BPVA 1ZYRF 3H92A 1KYWA 3LA2A 4ASNA 2L02A 1FX7A 5FFZA 3H3ZA 3LAPA 1TW3A 1Z7UA 4AWXB 1OKRA 4BAYA 3JTGA 3KP2A 1U8RA 4NB5A 2CQKA 4IRHA 2A6HF 1S7AA 2H6BA 3QPHA 3HHHA 4HQEA 4KN7X 3RKXA 2FRHA 1S3JA 4L0ZB 4GGGA 2XAJA 4KT5C 2AXLA 3GYHX 3BY6A 4YFXF 5IT3A 2A61A 3FXQA 2V1DA 2F2EA 4ENNA 5FLXK 1ZG3A 1XN7A 3LQRA 1ZHFA 3IRQA 1U5TC 3F8NA 2FMYA 4N9HA 2QBYB 1G3SA 1TNSA 5CYVA 4GCVA 1KQ0A 5F6FA 3GFLA 5ED4A 2F5CA 1FZPB 3F21A 5LGTA 1KA8A 1U5TB 3DXJF 2EFNA 4KICA 3D5LA 1LNWA 2AS5F 3ZMZA 4G6QA 4M9ZA 2OD5A 2XHKA 4OMZA 5LRRA 1JHHA 2QQAA 4R1HA 2QQ9A 3HTUA 1HW5A 4G6DA 2K4JA 2BE5F 2IJLA 4MHGA 2UZKA 4O5VA 3COAC 2PMHA 1O3QA 1TQPA 1RNLA 3GXOA 3P9CA 2VT2A 2P6SA 1EH7A 4ENMA 2ESNA 1I5ZA 1W4MA 3C7JA 1MDMA 1XDSA 1FP2A 4BNCA 4DQ2A 3FXUA 2Y0MA 4B8XA 3R61A 2K86A 2V6CA 4RGXA 1XCVA 4A5MA 4EV0A 4KUMA 1OYIA 1KU2A 1T0FA 2FBIA 3V7SA 2FA5A 4LK0F 5AONA 5L3DA 3FZVA 2CFXA 3T1BA 3I53A 1Z05A 4UV8A 4GXOA 4XLPF 1U5TA 3WGGA 2CO5A 1GVJA 1S7OA 4OIPF 3Q9VA 2FF4A 5E18F 5DYMA 3R60A 5ILUA 1IW7F 3KETA 3HRSA 1BN5A 4KMUX 3U1DA 3MWMA 1FY7A 3KP5A 3GFIA 1EV7A 5ICGA 4O6JA 1YYVA 2O61A 2VE8A 4IHTA 5LLQA 1K79A 3CUQB 1MJAA 5K5QA 3EUHA 2EV5A 5BOXA 1JE8A 2FEZA 4S04A 1YFHA 4A2UA 5CJ9A 5DCMB 1FYKA 2WV0A 2KIUA 1QNTA 2FNPA 2E1CA 1O7LA 5TJJA 1WKMA 3T5XA 3AAFA 4RGRA 4I0AA 1RIOH 2WWYA 3GW2A 1NHAA 5JI6A 1FC3A 5KK1A 3T0YA 4NQWA 2P5KA 1XSXA 5LHHA 2A07F 4HLYA 2CWEA 2YR2A 4OIOF 5LEJA 2Z99A 4IRIA 1XGNA 1FWZA 5E1XA 4EM1A 2QQBA 2Z3YA 2KIMA 2OU2A 1LVAA 3T8RA 4LJZF 3GZ5A 2XROA 2Z5UA 4ON0A 2HYFA 4YFNF 5E8IA 3R0JA 2EV0A 4S05A 4G7OF 2V79A 4A12A 3MQ0A 5DCFA 1USTA 1U3EM 2M87A 3O6BB 5KVRA 3ELKA 2VXZA 3QOPA 4P96A 3JSOA 2VODA 4EJUA 2MLKA 3KEQA 1BIBA 5D4RA 5DCMA 1RUOA 2FQ3A 1C0WA 1BJAA 4Y13A 2VBYA 2FOKA 2L01A 4U0VA 3OV8A 3PQJA 1STZA 2A6EF 3I54A 3RTRA 2H09A 3RI4A 4LB6B 3WTVC 5E1ZB 2RN7A 2ZCWA 3CO6C 3BOQA 3N97A 1IUYA 1UFMA 3NQOA 1MKMA 4UXNA 1V4RA 4XLNF 1TNTA 2CYYA 1K6OA 1UCRA 1L3LA 1DPRA 3I5UA 4KN4X 2UXXA 5IT9Z 3DQVC 4UNOA 4HV5A 3ZPLA 4IRGA 1RI7A 2BV6A 1ONVA 2GIVA 3IHUA 1ZG1A 2DI3A 1FSHA 2LF8A 5HDNA 1KU9A 4OINF 5DD8A 5F1RA 1XD7A 2VBZA 2VC0A 1YW8A 1UB9A 2J5PA 4L9JA 2X0LA 3VODA 2YU3A 3J80Z 2GZWA 4WWCA 3E5QA 5EEGA 1BC8C 2ISYA 2Y75A 3QP6A 1YLFA 2D2WA 1OYYA 3KLNA 5FFXA 2EA4A 4MGRA 1XGOA 5HS9A 1D8JA 4M73A 3Q5FA 3V7CA 2X4HA 2K27A 2QVOA 2J5OA 3M1EA 3DPLC 3F8CA 4B09A 4N9IA 2EB7A 3IKVA 3DV8A 5J6XA 1YG2A 2DQLA 5HLIA 1DUXC 2ZMEA 4CDGA 2XAGA 5HOOA 1IAWA 3GF2A 1R1UA 3KP4A 2VONA 3SFZA 2MH2A 2BGCA 2YSRA 4EVIA 3TKYA 1HW1A 1R1VA 2HGCA 2FU4A 1DPUA 2L3DA 3E6BA 1D3YA 3WTYC 4Y17A 1P2FA 1QBJA 1GHCA 3P9KA 5L3GA 3CO7C 1CF7B 3WU1B 2BEOA 3HIFA 3SHFA 3ZQ7A 1REPC 3LAJA 3FM5A 4M9SA 3H3UA 1KU3A 1ZREA 2VC1A 3FMSA 3ZMDA 2EA2A 3SZPA 4IF4A 3TQNA 4M6YA 2L54A 2NNYA 2QM3A 2ZXJA 4LB5A 1H0MA 2MLGA 1SFXA 1XMAA 1QPMA 1E17A 2LF7A 5LHIA 4I98B 1DDNA 1J2XA 3WE3A 4TV7A 3ZP5A 1G3YA 4KYWA 3ABUA 5J8CA 5D8LB 3L00A 4IVNA 1Y0UA 1R5HA 4L5IA 4RAYA 3ZMVA 4WX9A 1ZH5A 1Z1DA 5CVJA 3K1NA 3C18A 5BS6A 2XIGA 4M72A 2IA1A 2OZUA 4FT8A 5IT9K 3HOSA 3GFJA 5E1WA 2DPUA 3TO7A 3JW4A 4HAMA 1FYMA 2M30A 3R4KA 1CF7A 2ZFWA 1Z6TA 1F9NA 1R23A 3KP3A 1D5VA 4YIIA 2W57A 3K0LA 1Z9CA 4LLNA 3KCCA 2STWA 2OQRA 3I59A 1YQAA 2A69F 3BJAA 4Q48A 1T2KA 1G3WA 4KFCA 1LJ9A 4ZYEA 2HFHA 3DPTA 4LG0A 3QRFF 3J80K 2FBKA 1OPCA 1RZ4A 3CLOA 4MEXF 3KP6A 1XMKA 3ABTA 2PMUA 4HQMA 1R36A 3K1MA 1JXSA 1B4AA 4HV6A 5H6QA 3F72A 3WTSC 4P9FA 4AD9A 1LQ1A 2FSWA 4BYYA 1BM9A 3O3KA 2M45A 4R8HA 3VFZA 1PDNC 2XKPA 1J59A 1SD5A 4BXUA 4ESBA 5HDKA 3WG9A 4PCQA 2DO7A 3HRTA 2CG4A 3HYIA 3J7AO 1X3UA 3TO6A 2RDPA 2XKOA 5FO5A 4HLXA 1QGPA 4WXCA 3F22A 2KJCA 4ETSA 3F6VA 3FMRA 5JR3A 3EETA 4H0EA 3TDZC 4P55A 5JFRA 1O3RA 2PI0A 3WTZA 3ZMTA 3HOTA 4A6EA 3QP5A 4PGHA 2M5WA 3WU0A 4U0YA 4PZJA 2QBYA 2NAZA 3GLXA 1D8KA 4I2OA 3BJOA 2Z9OA 5HLGA 1I27A 4G8XA 4E70A 4A0YA 5HLHA 2HWVA 1O3SA 2E1NA 2JRTA 1ZGJA 3E6CC 1YS6A 1FBSA 1YIOA 4N0BA 2HQRA 1FNNA 5CVUA 4A0XA 3L9FA 4I02A 2HKOA 5E17F 1ON1A 2IT0A 3CUQC 3R0AA 4D0PA 5K5OA 3WGHA 3M8EA 1S29A 2IVMA 1WWXA 3F6OA 1R22A 3GZ6A 3FXRA 4LK1F 4HW0A 5ICCA 1F5TA 4ZH4F 1GXPA 4ESJA 5DUKA 3HSRA 5DD4A 5H6RA 2HR3A 5F64A 3BROA 1OYWA 1LDKB 3LWFA 5D5VB 1F4KA 3SZTA 2DW4A 5D6FA 1IRGA 2QLZA 2M1BA 3PQKA 4ENKA 1SMTA 2RGVA 3B02A 4MNUA 1HKTA 2OAZA 1B9MA 3KZZA 3F3XA 2FBHA 1I1GA 3DEUA 1FSEA 2F5FA 2JPCA 1H9TA 3Q9SA 2UWMA 4G7ZF 4UV9A 1U2WA 2FXAA 4ZYHA 3RYRA 1SD4A 2RKHA 5L3EA 2CGPA 2D45A 4RGSA 1XCBA 3E3VA 1FPQA 5FGMA 5LRSA 2GA1A 4EQQA 2IA2A 2MA3A 2PN6A 1O7FA 1SFUA 1HKQA 2VOPA 2A68F 1ZLJA 4CICA 1R58A 4KIBA 3VOEA 4DNCA 3L7WA 3F23A 3REOA 3C1DA 3I64A 5L3FA 1P6RA 3CUQA 5CVVA 2HKXA 4RB0A 2XAHA 3FF5A 4Y15A 3KEOA 4I0BA
chains in the Genus database with same CATH superfamily
4CZZA 1AU7A 3BTIA 3KEYA 1XGSA 1Y1WJ 4LLGF 5F0FA 3SDBA 3ZN1A 3CMYA 3BZCA 2GXBA 3TW6A 2V1XA 3I0TA 3SEQA 2L4AA 1HOMA 3VSKA 3K2AA 3GMEA 4BQNA 2DA5A 3TMOA 3I71A 2ME6A 2XRNA 1SVOA 2QQ8A 1ULYA 2P81A 2JPBA 3DP7A 3A01A 5FRMA 2OBPA 3T8TA 4BQQA 1FOKA 1MD0A 1J7KA 1WZ2A 4XSZF 3DU6A 1ZARA 3HRMA 4UHTA 3LA3A 3UR3C 1LEBA 1BI1A 3I3LA 2IGKA 4XONA 1G3TA 3FK7A 3V4GA 1ON2A 2P7VB 5EEAA 4OIRF 1HSJA 4LG3A 3L1PA 2HEOA 1RPWA 3I58A 1UHWA 2VN2A 4BU2A 5LGUA 4U7BA 4BQOA 3S3NA 4IL6C 5LHGA 3W6KB 4PDKA 5TGTA 3QU6A 3H0DA 3QWLA 2GQQA 4IXAA 4KNYA 2QF7A 3DEWA 1HSTA 1ODDA 4BJ6C 4KIGA 3K69A 3MCZA 4Q4ZF 4XR6A 4I01A 2PLYA 1VQ6I 3NARA 1OJLA 3S2WA 4M9XA 4FISA 4E7SA 5L3BA 2OCEA 2FJ1A 2JTVA 3S1NJ 1J5YA 1DU0A 3GO5A 2E2IJ 3OOUA 2YS9A 3ZMSA 2V9KA 2WY8Q 2EILH 1MMSA 1RC9A 2P6TA 3JRHA 1TWFJ 1MMDA 3K4NA 1B9NA 1BOAA 2MSYA 2XSJC 3QPSA 2L9NA 2L7ZA 4I99C 3FWEA 3OOPA 3GVAA 5E3LA 5ILSA 3QQAA 1XPXA 5H20A 2EV6A 2W24A 1IJWC 4A3JJ 2K02A 3RSNA 2HZDA 1R5ID 3O2PE 4JQFA 3CCVI 3GTPJ 3BTCA 3CDHA 4MQ9F 2DTZA 3KLOA 3G3ZA 3ERED 3CF5F 2HVSA 1AOYA 1N25A 1FLIA 1M1EB 5BPIA 3IUOA 5DEQA 1G6NA 4MEYF 2HS5A 1WJ5A 1BIAA 4HYEA 2WC2A 3DKWA 4L0YB 3IWFA 2KRFA 3OL4A 5M5XJ 5D5WB 1MH3A 4M74A 1X1PA 2O0YA 2K9QA 2ELHA 2L9RA 3RYPA 3G73A 4M71A 3EUAA 5J8FA 2A5YB 3J81Z 1ETVA 2PBIA 3OSFA 4EGZA 1T98A 2VLAA 2P5VA 1IZ1A 4BEHA 2NRAC 5FKKA 2LP0A 1DGWY 2KP6A 3MZ8A 4F55A 3MZYA 3K4MA 3TOBA 1UG0A 2V7FA 4RM2A 1QVUA 1T6SA 5K5RA 4XRSA 3HZJA 2QENA 1LPQA 4ENJA 2O6GE 4NHJA 2M3AA 2DDAA 3BDDA 4HZFA 5J1UA 3LFKA 1IN8A 2G7HA 2L4MA 1YW9A 3S32A 2K3FA 1XSVA 3K4LA 3HUGB 5LGNA 2XGDA 2WBMA 4RS8A 2F6CA 4GFBA 5EDNA 3CMMA 3HOZJ 1D0XA 2NS0A 4HBLA 5ILVA 4CSWA 4U88A 1SMYF 3MKLA 5HS7A 1OMIA 2P4WA 2DPDA 4IQJA 3PO2J 2L9SA 4M6XA 1WI3A 4PSXA 1YW7A 2HNHA 3UNGC 3H9QA 4HRIA 4C9YA 3FM3A 3N4MA 5CVIA 2VQGA 5EG0B 1YHQI 3TP0A 2H6CA 3G1LA 2QUFA 2BBYA 3P7NA 3DPUA 1FJLA 3U1KA 2W7NA 2IS1A 2G7UA 4A0ZA 1K83J 3QODA 1D0YA 3F8MA 1W5TA 4AC0A 1UAAA 3TDUC 1T38A 5M5YJ 4AVPA 4CYDA 1EJ9A 2ME0A 1XGMA 3KFWX 4ZYGA 5JVTA 3PNVA 3HSEA 3SQNA 4FX4A 3L09A 2X1CA 2R5ZB 2AO9A 2X6WA 4GYIA 4A6DA 1IRFA 1XG1A 2G9WA 4K2EA 4V2FA 1ACIA 2VBXA 2R7DA 4C2MJ 1P4WA 3HG9A 4AIHA 3E5UA 4YIFA 1FYLA 5AIQA 2HU9A 1RUNA 3DF8A 2RQQA 4HF2A 3VSLA 4Z6YA 3IL2A 4EGYA 4J19A 1V3FA 4LLLA 4NC8A 4IJAA 3TEDA 1WJCA 4A3FJ 5CLSA 3F8BA 2ZKZA 3QYFA 2Q0OA 3GTLJ 4IHSA 2XUBA 1IDZA 2M8EA 2DA7A 2HOTA 2HXOA 3CJNA 2L0KA 4OMYA 4F7ZA 2KFDA 3ECHA 2GBYA 3HRUA 4OOIA 4ANJA 3OYEA 3K1PA 4R79A 4BUPA 1BI2A 2PFBA 3F8FA 2LKXA 4EM2A 4WCGA 3HUGA 3EYYA 5J1YA 2K4BA 2WB1N 2FNAA 2LOOA 2MBFA 3CESA 3DKYA 4H4KC 3C3WA 2IAIA 2NNNA 1Z6RA 2EK5A 5HDGA 2ZNZA 5D5XB 5HS8A 4RB2C 5IOYA 1GDTA 3AG1H 1VF9A 2W84A 1IN5A 4RMNA 3OYBA 2V9PA 1T39A 1MJBA 3CCMI 4CCOA 3WGIA 1BR4A 2DT7B 4XKCA 2VT3A 3QPTA 3O8GA 3PJRA 1GVDA 3TO9A 1YS7A 2MC3A 2FUG2 4DYCA 5IYCJ 3ASOH 4C3JJ 1V5EA 5C3EJ 4JX4A 3RPQA 3K70D 2DYSH 2HDCA 2YX7A 1LE8B 1SVMA 2R7VA 2VL8A 3JTHA 3CF2A 4EJVA 1J9IA 1MMAA 2V1NA 1PUFB 2GA2A 4YFKF 1CGPA 4OIQF 2DK8A 1J0RA 2LNBA 2XPWA 2IXSA 4XQFA 3H5RA 1R9TJ 4UVBA 4Q5SF 4ESFA 1JGSA 1ITYA 2ADUA 1QO0D 1ZN2A 2IBDA 4Z2YA 4CHUA 4BXFA 4IEJA 4B3AA 3AL0C 2DLLA 3M4OJ 2AQFA 2F5EA 3HPGA 4IKFA 2W00A 2Q2EB 3BR0A 2IS4A 5JHFA 3A02A 1LDDA 2WAEA 2Z33A 4EJWA 4XN0A 2ZJPF 1W7PB 4CH7A 4YIRX 3A2KA 5M3MJ 2F5DA 3BQYA 1LFPA 3WODF 1MNMC 4DZPA 1U0JA 1MDMB 2Y48A 3A4CA 1ZR4A 1OCPA 4FQGA 2Z16A 1E2XA 1ETXA 2IA0A 2JSPA 4XORA 1SAXA 2XAUA 2I10A 4CCJA 2D1HA 3AL0B 4HDUA 1XB4A 2RV8A 4KIFA 3AG4H 3CLQA 3W6JB 5LBQA 3E5XA 1S5LC 3MN2A 4RBOA 2E7XA 5JHUA 3KIOA 5IP7J 4HF0A 2LY1A 3J81K 4A3MJ 1HC8A 1IXRC 4L18B 3E6MA 1GUUA 2MABA 1EH6A 1WI9A 3V8JA 1EH8A 4CZCA 1Y1VJ 2JQ7A 2NVTJ 3P9IA 4UB6C 5DS9A 4I6ZA 1MH4A 1EA3A 2CS3A 2EFQA 3OYGA 5FKLA 4BL0B 2G0EA 2IP2A 4EMSA 3CC2I 3WTXC 1QU3A 4XSXF 4O3MA 3JRDA 2E5NA 2HOEA 2QYOA 4CCNA 4UB8C 3CCUI 4KA4A 1TQIA 4FHTA 4GRIA 3U2RA 2NOJB 3KP7A 3LMMA 2QSGX 3QU3A 2CQ7A 2VPRA 3GX4X 3ROUA 2BYVE 1Z21A 3D0SA 3MAJA 4D7MA 1WSUA 2LMDA 3CCQI 1J75A 3RZDJ 5B1BH 3CUOA 4RAZA 4WF2A 1VQ9I 3BWGA 2KHMA 2JMWA 5ICEA 5IOZA 4IPAA 5J3LA 3DLAA 2NYXA 1IO2A 3ISPA 5GAHJ 1PUFA 3OIPA 3JRIA 3SEZA 1UHMA 2HQNA 4U7DA 3OL3A 2KISA 4QWQA 1OR7C 3WG7H 2RAEA 1VQ5I 4ZTJA 5E79C 3G71I 2OZ6A 2VJ4A 1BC7C 1XMXA 1QHGA 2MH9A 3ZOBA 1K78B 2HOSA 1R1TA 4B1RA 2Q2EA 5E8GA 3WTTC 4BQAA 4LFUA 2QKMB 1A6IA 2KDOA 2XC7A 4UVCA 3Q0UA 2ESHA 1PP8F 4M3GA 1TW2A 2IGOA 3PNYA 4HX8A 1KZHA 3CC7I 1W7PA 3GFMA 4PGGA 3I4MJ 1R7JA 3LQQA 3GTOJ 2Y30A 2PJPA 2R93J 3ESWB 3PM1A 2YUSA 1O3TA 1KQ9A 1W5SA 1VQKI 1J09A 4E6KG 4ABZA 4G7HF 3HC7A 3JRGA 3BR6A 2JK3A 1D1CA 2XPUA 5A2QZ 3DFGA 5KAIC 1OCRH 2LVSA 2Q8KA 1RRJA 3PFIA 5LEKA 4BHCA 3IWZA 4F92B 1ETWA 4XNFA 5FB2A 1PUEE 3S16J 5EJCA 2I5UA 1IN6A 5D5UB 3QOEA 3FXOA 1V55H 3RIRA 3EDPA 2YPRA 4ZDPA 2OC6A 2CSOA 4ZYDA 2F48A 1SC7A 3E7LA 2PQ8A 3BJ6A 3I4PA 2P0WA 4A3IJ 4II3A 3K2ZA 4NQWB 5D6EA 1RETA 5HVQC 2H94A 4PJJA 4ZZDA 2EZHA 3ZMUA 3WU2C 5L3CA 2CQQA 1TQMA 1JHFA 3K9TA 2W25A 3M9AA 5GADJ 1A04A 5HNHA 2VI6A 4XRMA 3HJEA 1WJFA 1LFBA 2UXNA 2PG4A 1TTYA 1WJDA 4A3BJ 1YJ9I 4X1EA 1I1SA 1KU7A 2R7UA 2P5LC 2KMUA 2H27A 2QWWA 4HX4A 1ZGAA 2EFOA 2PEXA 3ZRGA 2GAUA 1B8IA 2STTA 5EEHA 1KGSA 3FIWA 2B9SA 3S1QJ 4YELA 3IRRA 4A69C 4OU0A 3KZYA 2GOXB 4RB1A 2VXDA 3D5RC 5GPCA 3M7GA 3J7AY 3CZ6A 1G4DA 1G2HA 1U78A 1GXQA 4RLQA 4B48A 1K78A 2VJ5A 1DP7P 3TBIA 1N78A 4M3BA 2V26A 3NRVA 1K7AA 2JZYA 2HQAA 2GWRA 2WAQA 5C44J 3BTJA 4HA8A 3FX3A 3BG9A 3GWZA 1OR7A 4CCMA 2IRFG 3W2AA 1HDDC 3U21A 4YG2F 4EJOA 1TBXA 2JT1A 1XDUA 4XN3A 2RNGA 3HSFA 3WE2A 4IHVA 4ZZLA 4D5FA 3JSPA 1MBHA 1X4OA 2BVMA 9ANTA 2KLOA 4MIMA 2WTEA 3RJPA 1MJ9A 3FMQA 1SFKA 3BP8A 5DUIA 4LD5A 3SXYA 1B1BA 1BI0A 1R4MB 4MTEA 4XICA 2CW8A 2ECBA 1WQ2A 3NEUA 4WXDA 1P4XA 5FD5A 3A1YA 1R49A 1S8NA 1TLHB 3Q0VA 3V8LA 4G94A 3NWSA 1HQCA 1PP7U 1MBKA 3VB2A 1P7IA 3MFKA 4RGUA 3DTIA 5AIPA 3HTSB 1O4XA 2LD5A 5FJ8J 1XSDA 1T08B 2E35A 2L7FP 4A5NA 4EJTA 1IXCA 4Y7NJ 4JK1X 2HZTA 3V8KA 2DK5A 1LUJB 2YX4A 2PJRB 4L9NA 4BHBA 3H36A 4Q47A 5C4XJ 2CRGA 3A03A 2CH0A 1S6LA 2HVQA 3K4BA 2HYGD 5DDGA 3JAMZ 3GEZA 2E36A 2ETHA 1Y8RB 2M0MA 1KYZA 2ZBKA 5FROA 3S2DJ 2JUGA 4PUSA 4I09A 5BQTA 4F91B 1WPKA 3PSIA 2M9HA 1F1ZA 1ZG5A 3CP8A 3L2UA 5TRDA 1FBQA 1QQIA 3K6GA 4B44A 4ZDOA 1Z77A 4GO1A 1I6XA 4G6TB 4XBFA 3R6SA 4BJTA 2A5WA 2DMQA 1LKXA 4UVAA 4MQVA 1O57A 1P92A 2XF7A 2DBBA 3FHZA 3DCFA 2FE3A 3IC7A 4UUVA 4WK8F 3MZHA 3GLLA 2KIFA 5BNGA 1R5GA 2TDXA 4JX5A 4A3GJ 1SFEA 2OF7A 3FXJA 2ZNYA 3U9GA 1L0OC 2IGMA 3S1RJ 3UKGA 1YTYA 3HOVJ 1ZK8A 3MEXA 4HOBA 2R7QA 2HTSA 1LFUP 1IRXA 1MGTA 4QLCU 1ZLKA 4XKBA 2H1LA 3LFUA 3M8FA 2LK2A 2V9VA 3PUFA 1ZELA 4AYBA 4P5OA 3DTKA 4PJMA 1VTNC 2NS7A 3RKYA 3RKWA 4DGWB 2GXGA 1YIJI 3L2VA 3OMYA 1R00A 2MD5A 1DGRM 2WY7Q 3BG3A 3TOAA 4ZTFA 2IPQX 4WXHA 4FX0A 3WTUC 2HQ5A 3SZGA 2E19A 3FK6A 1GV2A 2QCOA 3FXKA 3OYAA 4HNVA 4KDPA 2VBWA 2JA7J 2OQGA 3IKTA 2D1VA 3FISA 5BMZA 1YO5C 2GIZA 4L5JA 4CGZA 4XK4A 3VPRA 3B73A 1ZRCA 2M4GA 2MYSA 1R6RA 2E60A 2X1EA 4CUGA 3PUBA 1FT9A 1IV8A 5A2QK 4XIDA 2CUZA 2PJRA 2CW0F 2R7SA 2O3FA 3HB9A 3OS2A 4AIKA 3E97A 2X1DA 1K61A 1E0EA 2DFIA 3AG2H 3LSHA 1UJ8A 3L2CA 5J4VA 2ELKA 2K9NA 2RNJA 1HW2A 1SD6A 2FQ4A 2ZMEB 2DTRA 2P7CB 1NK2P 1QRYA 2K9LA 4AU7A 5J4YA 2VE9A 1S72I 2C6YA 1JUMA 2ZO4A 2ZXWH 3WHCA 1MBEA 1KQ8A 1W7PD 2A05A 4Y3OA 2COMA 4BH9A 4LGWA 3CDIA 4CXFA 2LKSA 2XGCA 2DU9A 2QZ8A 2XGEA 1IN4A 2E34A 2LC2A 2A3SA 1IDYA 1X3ZB 2K5CA 1QZYA 1IXSB 1OCOH 1FBUA 2JSCA 2CV1A 2FMLA 4AVZA 1BBYA 2FOWA 3OR2C 2E1MB 2FD5A 2HPMA 3VYSB 2Q1ZB 2RVCA 5FLXZ 3G1MA 3G1OA 2E7WA 1H9GA 2RQPA 1HBXG 5ERIA 4HF1A 3K4KA 4E7JA 1R71A 4QPQA 3RPUA 3HDDA 1WVRA 2NVYJ 3CDLA 2DT5A 1IGNA 3IAM2 5D4SA 3SYTA 2IW5A 1XTAA 2XASA 2VQHA 1FMVA 4XRFA 3LSKA 1BL0A 3NAUA 1VQNI 1B6AA 3CTAA 4ZDLA 2W85A 3JCUC 5IPAA 3V7RA 2XVCA 2EWNA 1ZTRA 2HDWA 1ETQA 2RC4A 5K1YA 2DAOA 1QZZA 3HHGA 4A3CJ 2JRMA 2BY2A 4JBAA 2KKOA 5CKTA 2EJRA 1BI3A 2R7FA 1ZRDA 1B59A 1P9QC 2EH3A 2R4GA 5CVRA 4HX7A 1P4AA 4BHPA 1AWCA 1IF1A 4FE4A 5ICFA 1ETKA 2JVHA 2F4OB 2X85A 2O03A 1G59A 1I39A 1TWGJ 2GLOA 2VOOA 3K7AJ 4ZYAA 4PSWA 5D8KB 2VKDA 4AUXA 3ML6A 1U6GA 4LOCA 4Y4RA 4RLFA 5H2FC 1ZRFA 4A93J 2V4JC 3O8HA 3TGNA 1ENHA 1HXDA 1Q1VA 1Z91A 1OISA 1LDJA 3M1CA 2V1UA 2AQEA 5DM6F 3KYDB 1IN7A 4RAGA 3JRCA 1LEAA 4UY8I 2CQNA 4U0WA 2XAQA 2NVUB 2DOFA 2HTJA 3IP4B 2VB6A 1MBJA 3QAHA 1HKSA 4AIJA 2P8TA 4I7HA 4EEFG 4LMYA 3OY9A 1W0UA 1WRJA 4B4CA 3RDIA 2HXIA 2GXAA 1NTCA 2K7LA 2ZJ2A 5E20A 3LA7A 3JAMK 4MFEA 2Y2ZA 6PAXA 1V54H 2B63J 1YI2I 5DV5A 2XB5A 3ULQB 3CJRB 3DBHB 4MO7A 4L9TA 3LSIA 3E6DA 2QSFX 1SD7A 1KONA 2KJBA 2DQRA 3BCAA 4ZJZA 4CO8A 2XAFA 1ZAOA 1MZBA 4Y52J 3SDGA 2LKPA 1RKTA 2X6OA 3L2QA 1BW5A 1USSA 3ZN0A 4QPOA 2JVGA 1MBFA 2EFPA 3HL2A 3WTWC 4P9UA 2QKLB 2XGXA 3LSJA 4IHYA 3OYCA 3BLYA 1SANA 1I3QJ 2EFWA 3BPXA 4IOAF 3GUDA 2LDUA 2B0LA 4EM0B 2ISZA 1FP1D 3E1SA 3W6VA 1ZQ3P 3D5SC 4BE0A 2OA4A 3HOYJ 1DQUA 3CJTB 3EQLF 2VKVA 3LSTA 3I59B 2R3SA 4MLOA 2X48A 5HNFA 5BPDA 4G9YA 2VJIA 4W1UA 1LB2A 2XV4S 5FD6A 4MTDA 3S1MJ 3LOCA 1UELB 2KPMA 2LSOA 4HDVA 4IO9F 4KMFA 4LG0B 2O8XA 1JTXA 2JA8J 3BZ6A 1PJRA 1Q1HA 4GYGA 2BXYA 4RB3C 4L9VA 3S8PA 2V6EA 5F04A 1U8BA 3EYIA 2ACJA 3KE2A 1ZR2A 3VEPA 1Y6IA 3ECOA 3BPVA 1ZYRF 2ZXIA 3H92A 1KYWA 1JJ8C 3LA2A 3I55I 1D5YA 2WADA 2CV2A 2W82A 4ASNA 2L02A 2CW7A 1FX7A 5FFZA 3H3ZA 3LAPA 1TW3A 4XLCA 1Z7UA 4AWXB 1OKRA 4DBRA 4BAYA 2BY3A 3DEEA 3JTGA 3KP2A 1IV6A 1U8RA 4NB5A 1OCTC 2VUMJ 2CQKA 1XC5A 4JOMA 4L5EA 5GTHC 5EG0A 4IRHA 2A6HF 2KL4A 3GTKJ 1S7AA 3S3MA 2ZB9A 2H6BA 2X9DA 3OWTA 3QPHA 3HHHA 1WCMJ 4PJLA 1VQ4I 4HQEA 3DWLE 4KN7X 3RKXA 2FRHA 5KCMA 4A3DJ 2VIXA 3OYDA 2M8GX 3BR5A 3FXMA 3NWTA 1S3JA 4L0ZB 1GLNA 2O8KA 4GGGA 2PMZA 3BG5A 4IZZA 2FX0A 1VZ0A 2XAJA 4KT5C 2AXLA 1MSFC 2R5ZA 4HNTA 2K9MA 3D1NI 3GYHX 2JWTA 2WAQN 2M2EA 2CUJA 4CCLA 3BY6A 4EATA 3C2HA 3RQIA 4YFXF 5IT3A 2XSDC 2XRLA 2A61A 3FXQA 3ZQLA 2V1DA 2F2EA 2XF5A 1T0FC 3BG6A 1AKHB 3QPLA 1VI0A 4ENNA 5FLXK 1ZG3A 1XN7A 1S9HA 3OIQA 3LQRA 3RQ4A 1ZHFA 3PFYA 3IRQA 1U5TC 3F8NA 2FMYA 4N9HA 3ZQCA 2M7AA 2Y9YA 4B43A 1EKEA 2QBYB 1G3SA 1TNSA 5CYVA 1GV5A 4GCVA 3JR9A 1KQ0A 5F6FA 2LY9A 2DA6A 3GFLA 5ED4A 1EF4A 2H1KA 2F5CA 4DYQA 1FZPB 3F21A 5LGTA 2NVXJ 4QTRA 1GT0C 1KA8A 1U5TB 3DXJF 2O5RA 2EFNA 5CQEA 1QPIA 4KICA 1QHHD 3D5LA 1LNWA 2AS5F 5GPAA 3ZMZA 4BGDA 4G6QA 2D5VA 4M9ZA 2OD5A 3EPZA 2XHKA 2HYJA 4OMZA 3K4JA 3ASNH 5LRRA 1NH3A 1JHHA 2QQAA 4C2TA 3PL8A 3A0HC 4R1HA 1W5CC 2QQ9A 5B66C 4BACA 1LE8A 3MD2A 3RPUD 1YRNB 4GDFA 3HTUA 1HW5A 4G6DA 2L2OA 5K7ZA 2K4JA 2BE5F 5KAFC 4HSRA 2IJLA 1TC3C 1A6QA 4MHGA 2UZKA 5JLXA 2R7RA 4CYCB 4O5VA 3COAC 2PMHA 3EUHC 1O3QA 1TQPA 1RNLA 4F3QA 2EZIA 4ITVA 1A5JA 3GXOA 3J7ZI 2VJJA 3F0CA 3P9CA 2VT2A 4PK4A 1X19A 3LSGA 5M5WJ 1D0ZA 2P6SA 1FTTA 5EGOB 1EH7A 2ZC2A 2UV1A 4ENMA 2ESNA 2CQXA 1I5ZA 4P1WA 1VQ8I 4M3FA 1W4MA 3C7JA 1MDMA 4AYBN 3OYNA 1XDSA 1FP2A 4BNCA 1AKHA 4DQ2A 3FXUA 2Y0MA 4NC7A 1RKWA 4B8XA 3FBNB 3MMYB 2KRCA 2DJIA 3R61A 4XM3A 1FOYA 4RA2A 2K86A 3PNTA 2V6CA 4RGXA 1VNDA 1UMQA 1XCVA 2DFEA 1OFCX 4A5MA 4EV0A 4KUMA 3I56I 1NK3P 4OAYA 1CQTA 3HOWJ 1OYIA 1P7JA 1X2MA 5J47A 2Z2SB 1KU2A 3TP3A 1T0FA 2ELJA 2FBIA 2DN0A 2DCEA 3V7SA 4XOTA 1HLVA 2FA5A 4LK0F 5AONA 3AKZA 3HGGA 4FASD 4C3IJ 5L3DA 3FZVA 2CFXA 3T1BA 3I53A 3BG7A 4DZJA 1BW6A 1Z05A 1ZKGA 2R92J 5C4JJ 1JI8A 1NG6A 4UV8A 4GXOA 4XLPF 3CC4I 1U5TA 4BKXA 3OYKA 4BY7J 2YU9J 3WGGA 2CO5A 1GVJA 1S7OA 1E3HA 4OIPF 2KT0A 3Q9VA 4M3EA 2FF4A 2WB1A 5E18F 5DYMA 3R60A 5ILUA 1IW7F 3HKZA 3FKJA 5J40A 3KPHA 3OIOA 3KETA 3HRSA 1YRNA 1BN5A 4KMUX 3CCYA 2LREA 3U1DA 5FKOA 3MWMA 1H89C 1SVLA 1I3AA 4CYCA 1FY7A 2OPTA 3KP5A 3GFIA 2W1OA 4D1QA 2WV1A 2KQRA 1EV7A 1TT5B 1UG2A 3M8JA 5ICGA 2ECCA 1WJBA 3S2HJ 1XX5A 3BZKA 3KYCB 1X2NA 4O6JA 2TCTA 1YYVA 2O61A 2E1OA 3LL7A 4A3KJ 2VE8A 4IHTA 5LLQA 1K79A 3CUQB 1MJAA 5K5QA 3OYHA 5DM7F 5EF6A 2EIMH 1FEXA 3EUHA 2DJNA 2EV5A 3ABKH 5BOXA 2FEZA 4S04A 3CCEI 1JE8A 2VKHA 4A2UA 5CJ9A 1YFHA 5DCMB 1FYKA 2AXTC 3GTGJ 3Q3SA 2ZXHA 2WV0A 2KIUA 5JLWA 3LSPA 1QNTA 1RR7A 3C2BA 3FXLA 2FNPA 2E1CA 1O7LA 3H9JA 1YX3A 5TJJA 1WKMA 3T5XA 1TWHJ 3AAFA 3GCMA 4RGRA 4I0AA 1RIOH 5K7HA 2WWYA 3GW2A 1NHAA 2DOEA 3G2BA 5F27A 5JI6A 3JRAA 1FC3A 5KK1A 3T0YA 1R4NB 4XL9A 1YOVB 5GAEJ 4NQWA 2Y0SA 1SEUA 1HDPA 3S14J 2P5KA 1XSXA 3PSFA 3DKXA 5LHHA 2A07F 4HLYA 2CWEA 2YR2A 4OIOF 4NNJA 4Y33A 4D7NA 2KDZA 1N75A 5LEJA 2Z99A 3ZR8X 1XGNA 3P5JA 4IRIA 1JUPA 2JA6J 2K85A 1X4PA 1FWZA 5E1XA 4EM1A 3KX2A 2QQBA 3DLLF 2Z3YA 2KIMA 1E3PA 1BR1A 1Z3YA 5F08A 2OU2A 3L2RA 1LVAA 2NVQJ 2W48A 3IH2A 3T8RA 3MKYB 1PVEA 4LJZF 3GZ5A 4C2UA 2XROA 2A6TA 2Z5UA 4F93B 5FLMJ 4ON0A 2HYFA 1PYVA 4KT6A 4YFNF 3MKZA 3CJQB 5IP9J 2X6YA 1ETYA 3R0JA 2EV0A 5E8IA 4S05A 4YRVA 4G7OF 2O9LA 5TISC 3MKWB 2V79A 4A12A 3W2WA 2CUFA 3MQ0A 5DCFA 1USTA 3CCRI 1U3EM 4XLAA 2M87A 3O6BB 1H88C 5KVRA 3ELKA 2VXZA 3QOPA 4FCYA 5E3NA 3CCJI 4P96A 2DT6A 4F52A 1Y0NA 5B5EC 3JSOA 2VODA 2ICWG 4EJUA 2MLKA 3KEQA 4U87A 4XLEA 1BIBA 3DBRB 5D4RA 5DCMA 4IHXA 1RUOA 2FQ3A 1C0WA 1BJAA 5DTDA 2XB0X 4Y13A 2VBYA 2FOKA 2L01A 2E5ZA 2DMUA 4U0VA 2JUCA 3OV8A 3PQJA 1BR2A 1STZA 2A6EF 3I54A 3RTRA 3IH3A 3N05A 4BEHB 3BC8A 3EUKL 4LIVA 2LYCA 2OTLI 2H09A 3RI4A 2Y31A 4LB6B 1APLC 2ZMEC 3DTEA 2OJED 1MMNA 4N4NB 3WTVC 3AFHA 5E1ZB 2MC4A 2RN7A 2ZCWA 2L7MP 2LRDA 2PX9A 4II2A 3CO6C 3BOQA 3N97A 1IUYA 1UFMA 4KISA 3NQOA 2LTPA 1MKMA 4UXNA 1AHDP 1V4RA 4XLNF 3CP2A 1TNTA 4LITA 2CUEA 2CYYA 4XLFA 1K6OA 1UCRA 1L3LA 1DPRA 2E1MC 3I5UA 4KN4X 2UXXA 4QIWN 5IT9Z 4XLHA 1IG7A 3DQVC 4UNOA 4HV5A 3ZPLA 1MMGA 2DFHA 4IRGA 4XOPA 4NC6A 1RI7A 1ZGWA 2BV6A 4DYRA 1ONVA 2GIVA 3IHUA 4DW6A 2DI3A 2KRHA 1ZG1A 1H8AC 1MIJA 1FSHA 2LF8A 3S93A 4IHWA 3ZQHA 2TRTA 1T33A 1TP4A 4ZC3A 5HDNA 1KU9A 4OINF 5DD8A 5F1RA 1XD7A 2VBZA 2VC0A 1YW8A 2ID6A 1UB9A 2J5PA 4M3DA 4E4HA 5B3SH 2PMZN 2HDDA 4L9JA 3ZGKA 2X0LA 4JX6A 4OAZA 3VODA 2YU3A 1YX5A 3J80Z 2GZWA 1Z0XA 4WWCA 1A36A 3L2WA 3E5QA 5EEGA 3QYBA 1BC8C 1WHUA 3CCSI 2ISYA 2Y75A 3QP6A 2R7ZJ 1YLFA 2D2WA 1OYYA 1WGXA 3KLNA 2VKEA 1IC8A 5FFXA 3FDYA 4AM3A 4QSHA 2EA4A 2OUMA 4MGRA 1XGOA 5LFAA 5HS9A 2I8DA 1D8JA 4M73A 3Q5FA 1WJAA 2K3PA 2COBA 2NOGA 3V7CA 1W36D 2X4HA 2K27A 2QVOA 4HPQA 2J5OA 3M1EA 4S0HB 3DPLC 4IOCF 4B47A 2CV0A 3F8CA 5E3OA 3MVPA 4B09A 3OYFA 4N9IA 2EB7A 2MG4A 3IKVA 2DXIA 3DV8A 3GZNB 1Z7LA 1VFCA 4B3XA 5J6XA 4M6VA 1YG2A 2DQLA 1W1WE 5HLIA 1RR8C 1DUXC 2ZMEA 2W4SA 4CDGA 5JVGF 2XAGA 2HPIA 3B6AA 3SFIA 5HOOA 2X6XA 1IAWA 4E7IA 2DODA 3GF2A 1X1CA 4IX7A 5IY5H 2K40A 2JN6A 1R1UA 2AHQA 4JP0A 1FIPA 3KP4A 4PJ0C 1VQ7I 3ZQIA 2VONA 1V5GA 3FBIB 3BR2A 2E2JJ 3SFZA 2MH2A 1SFOJ 1BJZA 1X3WB 4XMYA 3VWBA 2BGCA 4KJZA 2YSRA 4EVIA 1DU6A 1YJNI 3TKYA 1WH7A 2DA3A 3LSMA 1HW1A 4J01A 1JKPC 1Y8QB 3ZQGA 1R1VA 2HGCA 4DOZA 2FU4A 5M3FJ 1JTYA 2L3DA 3LSRA 1DPUA 3E6BA 4XRSG 1S7EA 1D3YA 3WTYC 2BVLA 4Y17A 3BQZA 3BTLA 2M0CA 1P2FA 1QBJA 3E0JB 1GHCA 3P9KA 1VQPI 5F0CA 1IRZA 3VYRB 5L3GA 5EYRA 2F5VA 3CO7C 1CF7B 3WU1B 1X58A 2BEOA 4NDLA 4RM3A 2MD0A 1SAUA 2IEKA 2M4KA 3HIFA 3SHFA 3H9GA 1MBGA 4DIQA 2BHYA 3IH4A 3ZQ7A 5HODA 1REPC 3LAJA 1HA8A 3FM5A 1FMWA 3AG3H 4M9SA 1W0TA 3H3UA 3K4CA 1KU3A 1ZREA 2VC1A 3FMSA 1T95A 2EA2A 4HEA2 3SZPA 3ZMDA 1BOBA 5GP9A 2O7OA 2QSHX 4IF4A 3M3YJ 3CD6I 3TQNA 2DMTA 2L54A 4M6YA 1JUSA 2NNYA 2BOLA 1QVTA 2BHZA 2DA2A 2QM3A 4UUSB 1MSEC 2ZXJA 4LB5A 1H0MA 2MLGA 1SFXA 2KZGA 2CMPA 1XMAA 2EIKH 2E2HJ 1D1AA 1QPMA 4BE2A 1E17A 1JT6A 2LF7A 3S15J 1U9NA 3HOUJ 2RREA 4I98B 5LHIA 3DU5A 2DA4A 4NUBA 4OWRB 1DDNA 5IYBJ 1FOXA 5F0HA 5GAGJ 2GM4A 1J2XA 3WE3A 4TV7A 3ZP5A 1G3YA 4KYWA 2VPLA 3ABUA 5J8CA 3IAS2 3WHBA 3IV5A 5FKMA 3HKZN 3VDXA 5D8LB 3CMAI 2CU7A 3L00A 4IVNA 3JRBA 1Y0UA 3OYIA 2R7WA 3KZIC 3W2VA 4CA0A 2XPVA 1OQYA 2DMNA 2M7BA 4J00A 2ZSIB 4X0GA 1R5HA 5J1RA 1X1DA 4L5IA 4RAYA 3ZMVA 4WX9A 3OYJA 2LLKA 1ZH5A 2WAFA 1Z1DA 5CVJA 3K1NA 3C18A 4V19K 2VASA 2XIGA 4M72A 5BS6A 4V2GA 3GTMJ 1FOWA 2IA1A 4C3HJ 2OZUA 4FT8A 5IT9K 3HOSA 3GFJA 5E1WA 3OYLA 1B72B 1I6HJ 2DPUA 3TO7A 1I50J 1A35A 3JW4A 3J7YJ 3H1CA 4HAMA 1BA5A 1FYMA 2M30A 3OR1C 3R4KA 2DA1A 5CQGA 1CF7A 3HEFA 3LNQA 1WFXA 2ZFWA 3H5AA 1Z6TA 4XKWA 1F9NA 3FHNA 1R23A 2XDVA 3KP3A 1D5VA 1MNEA 1Y39A 2F4IA 3F9KA 4YIIA 2W57A 3K0LA 2LG4A 3OYMA 1Z9CA 1MW7A 4LLNA 1RESA 1E3OC 3I4NJ 3KCCA 2STWA 2OQRA 3I59A 1TWAJ 1YQAA 2A69F 1G8XA 3X2QH 1FTZA 3BJAA 1QA6A 4Q48A 1T2KA 1G3WA 2DDBA 4KFCA 1LJ9A 3V42A 2HFHA 2LBFB 3DPTA 3VYTB 4ZYEA 5FLVA 4DBQA 4BDZA 2DOAA 2WA0A 1UZCA 1DP3A 3H5NA 4LG0A 3QRFF 4I76A 3J80K 3CCLI 3DBLB 2BY0A 2R0QC 2FBKA 4UUSA 2EQRA 1OPCA 1K4TA 1RZ4A 3CLOA 4MEXF 2LH9A 1XMKA 3KP6A 3ABTA 3B6CA 2Y0SN 4RDUA 2PMUA 4HQMA 3PIPF 2ZFUA 1W36C 4HNUA 1R36A 3G4SI 2ZSHB 3OSGA 1MNDA 2KIQA 3K1MA 1JXSA 1B4AA 1JKOC 4HV6A 5H6QA 5FKNA 3F72A 1XS9A 3WTSC 4P9FA 1QZEA 4AD9A 2LR8A 5KHDA 1LQ1A 2IGNA 2FSWA 3S3OA 2GOMA 4BYYA 1BM9A 1FIAA 2MFZA 3O3KA 2M45A 4R8HA 5LD2C 2EZKA 3VFZA 1WJEA 3GBGA 3HBLA 2EZLA 4X6AJ 2XF6A 1PDNC 2XKPA 4G12A 5CPRB 1HCRA 2M34A 3CMEI 1J59A 1SD5A 4BXUA 4ESBA 2OCCH 1X1AA 5HDKA 3WG9A 4PCQA 1VQLI 2BW3B 2DO7A 2LY2A 4A3EJ 3HRTA 2CG4A 3ERMA 4CCKA 2MW8A 3HYIA 1T8IA 3J7AO 1X3UA 2IS2A 3TO6A 2RDPA 4XKVA 2XKOA 2E71A 5FO5A 1OLTA 4HLXA 1QGPA 1B72A 1B8IB 2L7KA 3BR3A 4WXCA 2NXNB 3F22A 2KJCA 4ETSA 3F6VA 4N4OB 2N8GA 4BS9A 3JREA 2DYRH 1POGA 3FMRA 1JJ6C 1Z67A 4RAFA 3H3VK 2CFOA 3GTJJ 4LIUA 5EZHA 5JR3A 3EETA 3H35A 3W3CA 4H0EA 4BDYA 2QA4I 4BXXJ 3TDZC 2QGUA 4P55A 5JFRA 2EIJH 1U9OA 1O3RA 2PI0A 5K7FA 3WTZA 3ZMTA 3HOTA 4A6EA 3QP5A 4PGHA 2R5YB 2M5WA 3WU0A 2BZTA 4PZJA 4U0YA 2QBYA 3TW7A 1TT0A 2NAZA 3GLXA 4BE1A 2Y69H 2ZJRF 2LBFA 1D8KA 1TL8A 4I2OA 2VQCA 3BJOA 2JA5J 4E7HA 2Z9OA 3BCBA 2EBIA 5HLGA 1I27A 4G8XA 4E70A 4A0YA 1JKQC 1NG7A 5HLHA 1Z3XA 5GTIC 2HWVA 1O3SA 1UHSA 2E1NA 2R7OA 4HG2A 2JRTA 3HXLA 1ZGJA 3E6CC 1VQMI 1YS6A 1JGGA 1FBSA 1YIOA 3ONQA 1F36A 1YE9A 4IQ4A 4N0BA 5IYDJ 1T56A 2HQRA 1YJWI 1FNNA 4BJ5C 5CVUA 3G6EI 4A0XA 3L9FA 5KNLA 4FTHA 1V5FA 3C2GA 2ZJQF 4I02A 1HF0A 3HM5A 2HKOA 5E17F 4A3LJ 1ON1A 2IT0A 3CUQC 4PFOA 3R0AA 3PO3J 4D0PA 2MGQA 5K5OA 3WGHA 2F4MB 3M8EA 2BXZA 4KITB 2BW3A 1S29A 2IVMA 4AIDA 3I9V2 1TZLA 1WWXA 3F6OA 1R22A 3OS1A 4HSTA 3GZ6A 3FXRA 4LK1F 4HW0A 5ICCA 1F5TA 3VYUB 4ZH4F 3K10A 4DJAA 1K4SA 4ESJA 1GXPA 3TL4X 2X51A 3Q0WA 1ETOA 2LFBA 3HSRA 5DD4A 2HR3A 2L5QA 5DUKA 5F64A 5H6RA 4BBRJ 5EGOA 1JT0A 3BROA 1OYWA 1LDKB 2IS6A 3LWFA 5D5VB 3K70C 1F4KA 2DFFA 3SZTA 2DW4A 1ORKA 5D6FA 1IRGA 3ABMH 1X1BA 2QLZA 3HGYA 2M1BA 1IUFA 3PQKA 5EZGA 4ENKA 1YITI 1SMTA 2RGVA 3B02A 4MNUA 3JRFA 1HKTA 2UUZA 2OAZA 3ZXSA 1B9MA 5F1JA 1OCZH 2EPFA 3KZZA 3F3XA 3ZQQA 2FBHA 3A0BC 1I1GA 4UUTA 2KZVA 3OS0A 2BY1A 3BT9A 5E3MA 2L9VA 3DEUA 1FSEA 2R5YA 2F5FA 2H8RA 1AA7A 4E7ZA 4C30A 2Y9ZA 3BR1A 2JPCA 1H9TA 3Q9SA 3A01B 4FETA 2UWMA 2R7XA 4G7ZF 1WH5A 2HOAA 4UV9A 2OTJI 1U2WA 1VQOI 2EINH 1JKRC 2CJJA 3RKQA 1ERDA 2JJ7A 2VQLA 2NS8A 2JA2A 4D9JA 1OCCH 3HOXJ 1Y56A 1F43A 2FXAA 3M07A 4ZYHA 3RYRA 3PIOF 1SD4A 2RKHA 5L3EA 1N77A 1A31A 3HPHA 4PJNA 2DMPA 2CGPA 2HI3A 4YEJA 2D45A 1TWCJ 3RZOJ 4FE7A 4RGSA 3CQZJ 1XCBA 5FRNA 3E3VA 1FPQA 5FGMA 4BBSJ 5LRSA 3S17J 2R7TA 4W97A 2GA1A 4MFDA 4EQQA 1D1BA 2IA2A 2MA3A 2Z1DA 4JYKA 2PN6A 1O7FA 1SFUA 1HKQA 4NBQA 2VOPA 3QYEA 2A68F 1ZLJA 3RCOA 2H8WA 4CICA 1R58A 4KIBA 4D5CA 3VOEA 1K6YA 4DNCA 4BY1J 4E7KA 3ZQFA 2QEXI 2OV7A 3ABLH 5HLTA 3L7WA 3GTQJ 3F23A 3REOA 3SJMA 4PFPA 2HVRA 2ID3A 3C1DA 3I64A 5IP6A 5L3FA 1LVKA 4E7LA 1P6RA 3CUQA 5B1AH 2B7EA 5CVVA 2HKXA 2K9SA 3KYLA 4RB0A 3ZCOA 2XAHA 3FF5A 3H0GJ 4Y15A 3FKIJ 3KEOA 4I0BA
chains in the Genus database with same CATH topology
4CZZA 1XGSA 4LLGF 3ZN1A 2GXBA 2V1XA 3I0TA 2L4AA 3I71A 2XRNA 1ULYA 2JPBA 3DP7A 2OBPA 3T8TA 1FOKA 1MD0A 1J7KA 4XSZF 1ZARA 3HRMA 4UHTA 3LA3A 1LEBA 1BI1A 3V4GA 1G3TA 1ON2A 2P7VB 4OIRF 1HSJA 2HEOA 3I58A 1UHWA 2VN2A 5LGUA 4U7BA 5LHGA 3W6KB 4PDKA 3QU6A 2GQQA 4IXAA 4KNYA 1HSTA 1ODDA 4KIGA 3K69A 3MCZA 4Q4ZF 2PLYA 4I01A 3S2WA 4M9XA 5L3BA 2JTVA 1J5YA 3GO5A 3ZMSA 2P6TA 1B9NA 1BOAA 3FWEA 3OOPA 3GVAA 5ILSA 5H20A 2EV6A 2W24A 2K02A 3O2PE 4JQFA 3CDHA 4MQ9F 3KLOA 3G3ZA 3ERED 1AOYA 1FLIA 5BPIA 5DEQA 1G6NA 4MEYF 2HS5A 1BIAA 4HYEA 2WC2A 3DKWA 4L0YB 3IWFA 2KRFA 5D5WB 4M74A 2O0YA 2ELHA 3RYPA 3G73A 4M71A 5J8FA 2A5YB 3J81Z 2PBIA 4EGZA 1T98A 2P5VA 1IZ1A 2NRAC 3MZYA 3TOBA 1T6SA 5K5RA 2QENA 4ENJA 2O6GE 4NHJA 3BDDA 4HZFA 3LFKA 1IN8A 2G7HA 2L4MA 1YW9A 1XSVA 5LGNA 4RS8A 2NS0A 4HBLA 5ILVA 4U88A 1SMYF 5HS7A 2DPDA 1OMIA 2P4WA 4M6XA 1YW7A 3FM3A 3N4MA 5CVIA 2H6CA 2QUFA 2BBYA 3P7NA 2G7UA 4A0ZA 3F8MA 1W5TA 3TDUC 1T38A 4AVPA 4CYDA 1XGMA 3KFWX 4ZYGA 5JVTA 3HSEA 3SQNA 4FX4A 3L09A 4GYIA 4A6DA 1IRFA 4K2EA 2G9WA 2VBXA 2R7DA 1P4WA 4AIHA 3E5UA 4YIFA 1FYLA 5AIQA 1RUNA 3DF8A 4HF2A 3IL2A 4EGYA 1V3FA 4LLLA 4IJAA 5CLSA 3F8BA 2ZKZA 2Q0OA 4IHSA 2XUBA 2M8EA 3CJNA 4OMYA 4F7ZA 3ECHA 3HRUA 4OOIA 3K1PA 4R79A 1BI2A 2PFBA 3F8FA 4EM2A 4WCGA 3HUGA 3EYYA 2K4BA 2FNAA 2MBFA 3C3WA 2NNNA 1Z6RA 2EK5A 5HDGA 2ZNZA 5D5XB 5HS8A 4RB2C 2W84A 1IN5A 1T39A 1MJBA 3WGIA 2VT3A 3QPTA 3TO9A 1YS7A 2MC3A 3RPQA 2HDCA 2YX7A 3JTHA 4EJVA 1J9IA 2GA2A 4YFKF 1CGPA 4OIQF 2DK8A 1J0RA 2LNBA 4UVBA 4Q5SF 4ESFA 1JGSA 2ADUA 1QO0D 1ZN2A 4Z2YA 4CHUA 2DLLA 2F5EA 1LDDA 2Z33A 4EJWA 1W7PB 2F5DA 3WODF 1MDMB 2Y48A 1E2XA 2IA0A 1SAXA 2D1HA 4HDUA 1XB4A 2RV8A 4KIFA 3W6JB 5LBQA 3E5XA 2E7XA 5JHUA 4HF0A 3J81K 1IXRC 4L18B 3E6MA 1EH6A 1WI9A 3V8JA 1EH8A 3P9IA 2EFQA 2IP2A 4EMSA 3WTXC 4XSXF 4O3MA 2QYOA 2HOEA 4KA4A 1TQIA 4FHTA 3U2RA 3KP7A 3QU3A 3GX4X 3ROUA 2BYVE 3D0SA 3MAJA 1WSUA 1J75A 3CUOA 4RAZA 4WF2A 3BWGA 5ICEA 4IPAA 2NYXA 3ISPA 1UHMA 2HQNA 4U7DA 4QWQA 2OZ6A 1BC7C 2MH9A 1K78B 1R1TA 2Q2EA 5E8GA 3WTTC 4BQAA 4LFUA 4UVCA 2ESHA 1PP8F 1TW2A 4HX8A 1W7PA 3GFMA 4PGGA 1R7JA 3LQQA 2PJPA 1O3TA 1KQ9A 1W5SA 4G7HF 5A2QZ 3DFGA 2Q8KA 3PFIA 5LEKA 4BHCA 3IWZA 1PUEE 5FB2A 1IN6A 5D5UB 3RIRA 3EDPA 2YPRA 2CSOA 4ZYDA 2PQ8A 3BJ6A 3I4PA 3K2ZA 5D6EA 5HVQC 2H94A 4ZZDA 3ZMUA 5L3CA 1TQMA 1JHFA 3K9TA 2W25A 3M9AA 1A04A 2UXNA 2PG4A 1TTYA 1I1SA 1KU7A 2P5LC 2H27A 2QWWA 4HX4A 1ZGAA 2EFOA 2PEXA 2GAUA 2STTA 5EEHA 1KGSA 3IRRA 4OU0A 3KZYA 4RB1A 3M7GA 1G4DA 1U78A 1GXQA 1K78A 1DP7P 3NRVA 1K7AA 2JZYA 2GWRA 4HA8A 3FX3A 3GWZA 1OR7A 2IRFG 4YG2F 4EJOA 1TBXA 2JT1A 1XDUA 3HSFA 3WE2A 4ZZLA 3JSPA 2WTEA 3RJPA 1MJ9A 3FMQA 5DUIA 3BP8A 4LD5A 3SXYA 1B1BA 1BI0A 4MTEA 1WQ2A 3NEUA 4WXDA 1P4XA 5FD5A 1S8NA 1TLHB 3V8LA 4G94A 1HQCA 1PP7U 3VB2A 3MFKA 4RGUA 3HTSB 5AIPA 1XSDA 4A5NA 4EJTA 1IXCA 4JK1X 2HZTA 3V8KA 2DK5A 2YX4A 4L9NA 4BHBA 4Q47A 1S6LA 2HYGD 5DDGA 3JAMZ 3GEZA 2ETHA 2ZBKA 1KYZA 5BQTA 4I09A 1F1ZA 1ZG5A 5TRDA 1FBQA 1QQIA 4GO1A 1I6XA 4XBFA 3R6SA 4UVAA 4MQVA 1O57A 1P92A 2DBBA 3FHZA 2FE3A 3IC7A 4UUVA 4WK8F 3MZHA 2KIFA 1R5GA 2TDXA 1SFEA 3U9GA 2ZNYA 1L0OC 1YTYA 3MEXA 4HOBA 2HTSA 1MGTA 4QLCU 1ZLKA 3M8FA 2V9VA 4P5OA 1VTNC 3RKYA 3RKWA 2GXGA 1R00A 2MD5A 3TOAA 2IPQX 4WXHA 4FX0A 3WTUC 4KDPA 2VBWA 2OQGA 3IKTA 2D1VA 5BMZA 1YO5C 4L5JA 4CGZA 3B73A 1ZRCA 1FT9A 5A2QK 2CW0F 2O3FA 4AIKA 3E97A 2DFIA 3L2CA 2RNJA 1HW2A 1SD6A 2ZMEB 2DTRA 2P7CB 2VE9A 2C6YA 2ZO4A 1KQ8A 1W7PD 2COMA 4BH9A 4LGWA 4CXFA 2DU9A 2QZ8A 1IN4A 2A3SA 1QZYA 1IXSB 1FBUA 2JSCA 2FMLA 1BBYA 2RVCA 5FLXZ 2E7WA 1H9GA 2RQPA 1HBXG 5ERIA 4HF1A 3RPUA 2DT5A 5D4SA 2IW5A 2XASA 4XRFA 1B6AA 3CTAA 2W85A 3V7RA 2XVCA 2EWNA 5K1YA 2RC4A 2DAOA 1QZZA 3HHGA 4JBAA 2KKOA 2EJRA 1BI3A 2R7FA 1ZRDA 1B59A 5CVRA 4HX7A 1P4AA 4BHPA 1AWCA 1IF1A 5ICFA 2O03A 2VOOA 5D8KB 3ML6A 1U6GA 1ZRFA 3TGNA 1HXDA 1Z91A 1LDJA 2V1UA 1IN7A 1LEAA 4U0WA 2XAQA 2HTJA 3QAHA 1HKSA 4AIJA 2P8TA 4I7HA 4LMYA 1WRJA 3RDIA 2K7LA 2ZJ2A 5E20A 3LA7A 3JAMK 6PAXA 5DV5A 3ULQB 4L9TA 3E6DA 1SD7A 2KJBA 2DQRA 4CO8A 2XAFA 1ZAOA 1MZBA 2LKPA 1USSA 3ZN0A 2EFPA 3WTWC 4P9UA 2XGXA 2EFWA 3BPXA 3GUDA 2LDUA 2B0LA 4EM0B 2ISZA 1FP1D 2OA4A 3EQLF 3LSTA 3I59B 2R3SA 5BPDA 4G9YA 1LB2A 2XV4S 5FD6A 4MTDA 2LSOA 4HDVA 4KMFA 4LG0B 2O8XA 3BZ6A 1Q1HA 4GYGA 4RB3C 4L9VA 3EYIA 2ACJA 3KE2A 3VEPA 3ECOA 3BPVA 1ZYRF 3H92A 1KYWA 3LA2A 4ASNA 2L02A 1FX7A 5FFZA 3H3ZA 3LAPA 1TW3A 1Z7UA 4AWXB 1OKRA 4BAYA 3JTGA 3KP2A 1U8RA 4NB5A 2CQKA 4IRHA 2A6HF 1S7AA 2H6BA 3QPHA 3HHHA 4HQEA 4KN7X 3RKXA 2FRHA 1S3JA 4L0ZB 4GGGA 2XAJA 4KT5C 2AXLA 3GYHX 3BY6A 4YFXF 5IT3A 2A61A 3FXQA 2V1DA 2F2EA 4ENNA 5FLXK 1ZG3A 1XN7A 3LQRA 1ZHFA 3IRQA 1U5TC 3F8NA 2FMYA 4N9HA 2QBYB 1G3SA 1TNSA 5CYVA 4GCVA 1KQ0A 5F6FA 3GFLA 5ED4A 2F5CA 1FZPB 3F21A 5LGTA 1KA8A 1U5TB 3DXJF 2EFNA 4KICA 3D5LA 1LNWA 2AS5F 3ZMZA 4G6QA 4M9ZA 2OD5A 2XHKA 4OMZA 5LRRA 1JHHA 2QQAA 4R1HA 2QQ9A 3HTUA 1HW5A 4G6DA 2K4JA 2BE5F 2IJLA 4MHGA 2UZKA 4O5VA 3COAC 2PMHA 1O3QA 1TQPA 1RNLA 3GXOA 3P9CA 2VT2A 2P6SA 1EH7A 4ENMA 2ESNA 1I5ZA 1W4MA 3C7JA 1MDMA 1XDSA 1FP2A 4BNCA 4DQ2A 3FXUA 2Y0MA 4B8XA 3R61A 2K86A 2V6CA 4RGXA 1XCVA 4A5MA 4EV0A 4KUMA 1OYIA 1KU2A 1T0FA 2FBIA 3V7SA 2FA5A 4LK0F 5AONA 5L3DA 3FZVA 2CFXA 3T1BA 3I53A 1Z05A 4UV8A 4GXOA 4XLPF 1U5TA 3WGGA 2CO5A 1GVJA 1S7OA 4OIPF 3Q9VA 2FF4A 5E18F 5DYMA 3R60A 5ILUA 1IW7F 3KETA 3HRSA 1BN5A 4KMUX 3U1DA 3MWMA 1FY7A 3KP5A 3GFIA 1EV7A 5ICGA 4O6JA 1YYVA 2O61A 2VE8A 4IHTA 5LLQA 1K79A 3CUQB 1MJAA 5K5QA 3EUHA 2EV5A 5BOXA 1JE8A 2FEZA 4S04A 1YFHA 4A2UA 5CJ9A 5DCMB 1FYKA 2WV0A 2KIUA 1QNTA 2FNPA 2E1CA 1O7LA 5TJJA 1WKMA 3T5XA 3AAFA 4RGRA 4I0AA 1RIOH 2WWYA 3GW2A 1NHAA 5JI6A 1FC3A 5KK1A 3T0YA 4NQWA 2P5KA 1XSXA 5LHHA 2A07F 4HLYA 2CWEA 2YR2A 4OIOF 5LEJA 2Z99A 4IRIA 1XGNA 1FWZA 5E1XA 4EM1A 2QQBA 2Z3YA 2KIMA 2OU2A 1LVAA 3T8RA 4LJZF 3GZ5A 2XROA 2Z5UA 4ON0A 2HYFA 4YFNF 5E8IA 3R0JA 2EV0A 4S05A 4G7OF 2V79A 4A12A 3MQ0A 5DCFA 1USTA 1U3EM 2M87A 3O6BB 5KVRA 3ELKA 2VXZA 3QOPA 4P96A 3JSOA 2VODA 4EJUA 2MLKA 3KEQA 1BIBA 5D4RA 5DCMA 1RUOA 2FQ3A 1C0WA 1BJAA 4Y13A 2VBYA 2FOKA 2L01A 4U0VA 3OV8A 3PQJA 1STZA 2A6EF 3I54A 3RTRA 2H09A 3RI4A 4LB6B 3WTVC 5E1ZB 2RN7A 2ZCWA 3CO6C 3BOQA 3N97A 1IUYA 1UFMA 3NQOA 1MKMA 4UXNA 1V4RA 4XLNF 1TNTA 2CYYA 1K6OA 1UCRA 1L3LA 1DPRA 3I5UA 4KN4X 2UXXA 5IT9Z 3DQVC 4UNOA 4HV5A 3ZPLA 4IRGA 1RI7A 2BV6A 1ONVA 2GIVA 3IHUA 1ZG1A 2DI3A 1FSHA 2LF8A 5HDNA 1KU9A 4OINF 5DD8A 5F1RA 1XD7A 2VBZA 2VC0A 1YW8A 1UB9A 2J5PA 4L9JA 2X0LA 3VODA 2YU3A 3J80Z 2GZWA 4WWCA 3E5QA 5EEGA 1BC8C 2ISYA 2Y75A 3QP6A 1YLFA 2D2WA 1OYYA 3KLNA 5FFXA 2EA4A 4MGRA 1XGOA 5HS9A 1D8JA 4M73A 3Q5FA 3V7CA 2X4HA 2K27A 2QVOA 2J5OA 3M1EA 3DPLC 3F8CA 4B09A 4N9IA 2EB7A 3IKVA 3DV8A 5J6XA 1YG2A 2DQLA 5HLIA 1DUXC 2ZMEA 4CDGA 2XAGA 5HOOA 1IAWA 3GF2A 1R1UA 3KP4A 2VONA 3SFZA 2MH2A 2BGCA 2YSRA 4EVIA 3TKYA 1HW1A 1R1VA 2HGCA 2FU4A 1DPUA 2L3DA 3E6BA 1D3YA 3WTYC 4Y17A 1P2FA 1QBJA 1GHCA 3P9KA 5L3GA 3CO7C 1CF7B 3WU1B 2BEOA 3HIFA 3SHFA 3ZQ7A 1REPC 3LAJA 3FM5A 4M9SA 3H3UA 1KU3A 1ZREA 2VC1A 3FMSA 3ZMDA 2EA2A 3SZPA 4IF4A 3TQNA 4M6YA 2L54A 2NNYA 2QM3A 2ZXJA 4LB5A 1H0MA 2MLGA 1SFXA 1XMAA 1QPMA 1E17A 2LF7A 5LHIA 4I98B 1DDNA 1J2XA 3WE3A 4TV7A 3ZP5A 1G3YA 4KYWA 3ABUA 5J8CA 5D8LB 3L00A 4IVNA 1Y0UA 1R5HA 4L5IA 4RAYA 3ZMVA 4WX9A 1ZH5A 1Z1DA 5CVJA 3K1NA 3C18A 5BS6A 2XIGA 4M72A 2IA1A 2OZUA 4FT8A 5IT9K 3HOSA 3GFJA 5E1WA 2DPUA 3TO7A 3JW4A 4HAMA 1FYMA 2M30A 3R4KA 1CF7A 2ZFWA 1Z6TA 1F9NA 1R23A 3KP3A 1D5VA 4YIIA 2W57A 3K0LA 1Z9CA 4LLNA 3KCCA 2STWA 2OQRA 3I59A 1YQAA 2A69F 3BJAA 4Q48A 1T2KA 1G3WA 4KFCA 1LJ9A 4ZYEA 2HFHA 3DPTA 4LG0A 3QRFF 3J80K 2FBKA 1OPCA 1RZ4A 3CLOA 4MEXF 3KP6A 1XMKA 3ABTA 2PMUA 4HQMA 1R36A 3K1MA 1JXSA 1B4AA 4HV6A 5H6QA 3F72A 3WTSC 4P9FA 4AD9A 1LQ1A 2FSWA 4BYYA 1BM9A 3O3KA 2M45A 4R8HA 3VFZA 1PDNC 2XKPA 1J59A 1SD5A 4BXUA 4ESBA 5HDKA 3WG9A 4PCQA 2DO7A 3HRTA 2CG4A 3HYIA 3J7AO 1X3UA 3TO6A 2RDPA 2XKOA 5FO5A 4HLXA 1QGPA 4WXCA 3F22A 2KJCA 4ETSA 3F6VA 3FMRA 5JR3A 3EETA 4H0EA 3TDZC 4P55A 5JFRA 1O3RA 2PI0A 3WTZA 3ZMTA 3HOTA 4A6EA 3QP5A 4PGHA 2M5WA 3WU0A 4U0YA 4PZJA 2QBYA 2NAZA 3GLXA 1D8KA 4I2OA 3BJOA 2Z9OA 5HLGA 1I27A 4G8XA 4E70A 4A0YA 5HLHA 2HWVA 1O3SA 2E1NA 2JRTA 1ZGJA 3E6CC 1YS6A 1FBSA 1YIOA 4N0BA 2HQRA 1FNNA 5CVUA 4A0XA 3L9FA 4I02A 2HKOA 5E17F 1ON1A 2IT0A 3CUQC 3R0AA 4D0PA 5K5OA 3WGHA 3M8EA 1S29A 2IVMA 1WWXA 3F6OA 1R22A 3GZ6A 3FXRA 4LK1F 4HW0A 5ICCA 1F5TA 4ZH4F 1GXPA 4ESJA 5DUKA 3HSRA 5DD4A 5H6RA 2HR3A 5F64A 3BROA 1OYWA 1LDKB 3LWFA 5D5VB 1F4KA 3SZTA 2DW4A 5D6FA 1IRGA 2QLZA 2M1BA 3PQKA 4ENKA 1SMTA 2RGVA 3B02A 4MNUA 1HKTA 2OAZA 1B9MA 3KZZA 3F3XA 2FBHA 1I1GA 3DEUA 1FSEA 2F5FA 2JPCA 1H9TA 3Q9SA 2UWMA 4G7ZF 4UV9A 1U2WA 2FXAA 4ZYHA 3RYRA 1SD4A 2RKHA 5L3EA 2CGPA 2D45A 4RGSA 1XCBA 3E3VA 1FPQA 5FGMA 5LRSA 2GA1A 4EQQA 2IA2A 2MA3A 2PN6A 1O7FA 1SFUA 1HKQA 2VOPA 2A68F 1ZLJA 4CICA 1R58A 4KIBA 3VOEA 4DNCA 3L7WA 3F23A 3REOA 3C1DA 3I64A 5L3FA 1P6RA 3CUQA 5CVVA 2HKXA 4RB0A 2XAHA 3FF5A 4Y15A 3KEOA 4I0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZZ A;  1XGS A;  4LLG F;  3ZN1 A;  2GXB A;  2V1X A;  3I0T A;  2L4A A;  3I71 A;  2XRN A;  1ULY A;  2JPB A;  3DP7 A;  2OBP A;  3T8T A;  1FOK A;  1MD0 A;  1J7K A;  4XSZ F;  1ZAR A;  3HRM A;  4UHT A;  3LA3 A;  1LEB A;  1BI1 A;  3V4G A;  1G3T A;  1ON2 A;  2P7V B;  4OIR F;  1HSJ A;  2HEO A;  3I58 A;  1UHW A;  2VN2 A;  5LGU A;  4U7B A;  5LHG A;  3W6K B;  4PDK A;  3QU6 A;  2GQQ A;  4IXA A;  4KNY A;  1HST A;  1ODD A;  4KIG A;  3K69 A;  3MCZ A;  4Q4Z F;  2PLY A;  4I01 A;  3S2W A;  4M9X A;  5L3B A;  2JTV A;  1J5Y A;  3GO5 A;  3ZMS A;  2P6T A;  1B9N A;  1BOA A;  3FWE A;  3OOP A;  3GVA A;  5ILS A;  5H20 A;  2EV6 A;  2W24 A;  2K02 A;  3O2P E;  4JQF A;  3CDH A;  4MQ9 F;  3KLO A;  3G3Z A;  3ERE D;  1AOY A;  1FLI A;  5BPI A;  5DEQ A;  1G6N A;  4MEY F;  2HS5 A;  1BIA A;  4HYE A;  2WC2 A;  3DKW A;  4L0Y B;  3IWF A;  2KRF A;  5D5W B;  4M74 A;  2O0Y A;  2ELH A;  3RYP A;  3G73 A;  4M71 A;  5J8F A;  2A5Y B;  3J81 Z;  2PBI A;  4EGZ A;  1T98 A;  2P5V A;  1IZ1 A;  2NRA C;  3MZY A;  3TOB A;  1T6S A;  5K5R A;  2QEN A;  4ENJ A;  2O6G E;  4NHJ A;  3BDD A;  4HZF A;  3LFK A;  1IN8 A;  2G7H A;  2L4M A;  1YW9 A;  1XSV A;  5LGN A;  4RS8 A;  2NS0 A;  4HBL A;  5ILV A;  4U88 A;  1SMY F;  5HS7 A;  2DPD A;  1OMI A;  2P4W A;  4M6X A;  1YW7 A;  3FM3 A;  3N4M A;  5CVI A;  2H6C A;  2QUF A;  2BBY A;  3P7N A;  2G7U A;  4A0Z A;  3F8M A;  1W5T A;  3TDU C;  1T38 A;  4AVP A;  4CYD A;  1XGM A;  3KFW X;  4ZYG A;  5JVT A;  3HSE A;  3SQN A;  4FX4 A;  3L09 A;  4GYI A;  4A6D A;  1IRF A;  4K2E A;  2G9W A;  2VBX A;  2R7D A;  1P4W A;  4AIH A;  3E5U A;  4YIF A;  1FYL A;  5AIQ A;  1RUN A;  3DF8 A;  4HF2 A;  3IL2 A;  4EGY A;  1V3F A;  4LLL A;  4IJA A;  5CLS A;  3F8B A;  2ZKZ A;  2Q0O A;  4IHS A;  2XUB A;  2M8E A;  3CJN A;  4OMY A;  4F7Z A;  3ECH A;  3HRU A;  4OOI A;  3K1P A;  4R79 A;  1BI2 A;  2PFB A;  3F8F A;  4EM2 A;  4WCG A;  3HUG A;  3EYY A;  2K4B A;  2FNA A;  2MBF A;  3C3W A;  2NNN A;  1Z6R A;  2EK5 A;  5HDG A;  2ZNZ A;  5D5X B;  5HS8 A;  4RB2 C;  2W84 A;  1IN5 A;  1T39 A;  1MJB A;  3WGI A;  2VT3 A;  3QPT A;  3TO9 A;  1YS7 A;  2MC3 A;  3RPQ A;  2HDC A;  2YX7 A;  3JTH A;  4EJV A;  1J9I A;  2GA2 A;  4YFK F;  1CGP A;  4OIQ F;  2DK8 A;  1J0R A;  2LNB A;  4UVB A;  4Q5S F;  4ESF A;  1JGS A;  2ADU A;  1QO0 D;  1ZN2 A;  4Z2Y A;  4CHU A;  2DLL A;  2F5E A;  1LDD A;  2Z33 A;  4EJW A;  1W7P B;  2F5D A;  3WOD F;  1MDM B;  2Y48 A;  1E2X A;  2IA0 A;  1SAX A;  2D1H A;  4HDU A;  1XB4 A;  2RV8 A;  4KIF A;  3W6J B;  5LBQ A;  3E5X A;  2E7X A;  5JHU A;  4HF0 A;  3J81 K;  1IXR C;  4L18 B;  3E6M A;  1EH6 A;  1WI9 A;  3V8J A;  1EH8 A;  3P9I A;  2EFQ A;  2IP2 A;  4EMS A;  3WTX C;  4XSX F;  4O3M A;  2QYO A;  2HOE A;  4KA4 A;  1TQI A;  4FHT A;  3U2R A;  3KP7 A;  3QU3 A;  3GX4 X;  3ROU A;  2BYV E;  3D0S A;  3MAJ A;  1WSU A;  1J75 A;  3CUO A;  4RAZ A;  4WF2 A;  3BWG A;  5ICE A;  4IPA A;  2NYX A;  3ISP A;  1UHM A;  2HQN A;  4U7D A;  4QWQ A;  2OZ6 A;  1BC7 C;  2MH9 A;  1K78 B;  1R1T A;  2Q2E A;  5E8G A;  3WTT C;  4BQA A;  4LFU A;  4UVC A;  2ESH A;  1PP8 F;  1TW2 A;  4HX8 A;  1W7P A;  3GFM A;  4PGG A;  1R7J A;  3LQQ A;  2PJP A;  1O3T A;  1KQ9 A;  1W5S A;  4G7H F;  5A2Q Z;  3DFG A;  2Q8K A;  3PFI A;  5LEK A;  4BHC A;  3IWZ A;  1PUE E;  5FB2 A;  1IN6 A;  5D5U B;  3RIR A;  3EDP A;  2YPR A;  2CSO A;  4ZYD A;  2PQ8 A;  3BJ6 A;  3I4P A;  3K2Z A;  5D6E A;  5HVQ C;  2H94 A;  4ZZD A;  3ZMU A;  5L3C A;  1TQM A;  1JHF A;  3K9T A;  2W25 A;  3M9A A;  1A04 A;  2UXN A;  2PG4 A;  1TTY A;  1I1S A;  1KU7 A;  2P5L C;  2H27 A;  2QWW A;  4HX4 A;  1ZGA A;  2EFO A;  2PEX A;  2GAU A;  2STT A;  5EEH A;  1KGS A;  3IRR A;  4OU0 A;  3KZY A;  4RB1 A;  3M7G A;  1G4D A;  1U78 A;  1GXQ A;  1K78 A;  1DP7 P;  3NRV A;  1K7A A;  2JZY A;  2GWR A;  4HA8 A;  3FX3 A;  3GWZ A;  1OR7 A;  2IRF G;  4YG2 F;  4EJO A;  1TBX A;  2JT1 A;  1XDU A;  3HSF A;  3WE2 A;  4ZZL A;  3JSP A;  2WTE A;  3RJP A;  1MJ9 A;  3FMQ A;  5DUI A;  3BP8 A;  4LD5 A;  3SXY A;  1B1B A;  1BI0 A;  4MTE A;  1WQ2 A;  3NEU A;  4WXD A;  1P4X A;  5FD5 A;  1S8N A;  1TLH B;  3V8L A;  4G94 A;  1HQC A;  1PP7 U;  3VB2 A;  3MFK A;  4RGU A;  3HTS B;  5AIP A;  1XSD A;  4A5N A;  4EJT A;  1IXC A;  4JK1 X;  2HZT A;  3V8K A;  2DK5 A;  2YX4 A;  4L9N A;  4BHB A;  4Q47 A;  1S6L A;  2HYG D;  5DDG A;  3JAM Z;  3GEZ A;  2ETH A;  2ZBK A;  1KYZ A;  5BQT A;  4I09 A;  1F1Z A;  1ZG5 A;  5TRD A;  1FBQ A;  1QQI A;  4GO1 A;  1I6X A;  4XBF A;  3R6S A;  4UVA A;  4MQV A;  1O57 A;  1P92 A;  2DBB A;  3FHZ A;  2FE3 A;  3IC7 A;  4UUV A;  4WK8 F;  3MZH A;  2KIF A;  1R5G A;  2TDX A;  1SFE A;  3U9G A;  2ZNY A;  1L0O C;  1YTY A;  3MEX A;  4HOB A;  2HTS A;  1MGT A;  4QLC U;  1ZLK A;  3M8F A;  2V9V A;  4P5O A;  1VTN C;  3RKY A;  3RKW A;  2GXG A;  1R00 A;  2MD5 A;  3TOA A;  2IPQ X;  4WXH A;  4FX0 A;  3WTU C;  4KDP A;  2VBW A;  2OQG A;  3IKT A;  2D1V A;  5BMZ A;  1YO5 C;  4L5J A;  4CGZ A;  3B73 A;  1ZRC A;  1FT9 A;  5A2Q K;  2CW0 F;  2O3F A;  4AIK A;  3E97 A;  2DFI A;  3L2C A;  2RNJ A;  1HW2 A;  1SD6 A;  2ZME B;  2DTR A;  2P7C B;  2VE9 A;  2C6Y A;  2ZO4 A;  1KQ8 A;  1W7P D;  2COM A;  4BH9 A;  4LGW A;  4CXF A;  2DU9 A;  2QZ8 A;  1IN4 A;  2A3S A;  1QZY A;  1IXS B;  1FBU A;  2JSC A;  2FML A;  1BBY A;  2RVC A;  5FLX Z;  2E7W A;  1H9G A;  2RQP A;  1HBX G;  5ERI A;  4HF1 A;  3RPU A;  2DT5 A;  5D4S A;  2IW5 A;  2XAS A;  4XRF A;  1B6A A;  3CTA A;  2W85 A;  3V7R A;  2XVC A;  2EWN A;  5K1Y A;  2RC4 A;  2DAO A;  1QZZ A;  3HHG A;  4JBA A;  2KKO A;  2EJR A;  1BI3 A;  2R7F A;  1ZRD A;  1B59 A;  5CVR A;  4HX7 A;  1P4A A;  4BHP A;  1AWC A;  1IF1 A;  5ICF A;  2O03 A;  2VOO A;  5D8K B;  3ML6 A;  1U6G A;  1ZRF A;  3TGN A;  1HXD A;  1Z91 A;  1LDJ A;  2V1U A;  1IN7 A;  1LEA A;  4U0W A;  2XAQ A;  2HTJ A;  3QAH A;  1HKS A;  4AIJ A;  2P8T A;  4I7H A;  4LMY A;  1WRJ A;  3RDI A;  2K7L A;  2ZJ2 A;  5E20 A;  3LA7 A;  3JAM K;  6PAX A;  5DV5 A;  3ULQ B;  4L9T A;  3E6D A;  1SD7 A;  2KJB A;  2DQR A;  4CO8 A;  2XAF A;  1ZAO A;  1MZB A;  2LKP A;  1USS A;  3ZN0 A;  2EFP A;  3WTW C;  4P9U A;  2XGX A;  2EFW A;  3BPX A;  3GUD A;  2LDU A;  2B0L A;  4EM0 B;  2ISZ A;  1FP1 D;  2OA4 A;  3EQL F;  3LST A;  3I59 B;  2R3S A;  5BPD A;  4G9Y A;  1LB2 A;  2XV4 S;  5FD6 A;  4MTD A;  2LSO A;  4HDV A;  4KMF A;  4LG0 B;  2O8X A;  3BZ6 A;  1Q1H A;  4GYG A;  4RB3 C;  4L9V A;  3EYI A;  2ACJ A;  3KE2 A;  3VEP A;  3ECO A;  3BPV A;  1ZYR F;  3H92 A;  1KYW A;  3LA2 A;  4ASN A;  2L02 A;  1FX7 A;  5FFZ A;  3H3Z A;  3LAP A;  1TW3 A;  1Z7U A;  4AWX B;  1OKR A;  4BAY A;  3JTG A;  3KP2 A;  1U8R A;  4NB5 A;  2CQK A;  4IRH A;  2A6H F;  1S7A A;  2H6B A;  3QPH A;  3HHH A;  4HQE A;  4KN7 X;  3RKX A;  2FRH A;  1S3J A;  4L0Z B;  4GGG A;  2XAJ A;  4KT5 C;  2AXL A;  3GYH X;  3BY6 A;  4YFX F;  5IT3 A;  2A61 A;  3FXQ A;  2V1D A;  2F2E A;  4ENN A;  5FLX K;  1ZG3 A;  1XN7 A;  3LQR A;  1ZHF A;  3IRQ A;  1U5T C;  3F8N A;  2FMY A;  4N9H A;  2QBY B;  1G3S A;  1TNS A;  5CYV A;  4GCV A;  1KQ0 A;  5F6F A;  3GFL A;  5ED4 A;  2F5C A;  1FZP B;  3F21 A;  5LGT A;  1KA8 A;  1U5T B;  3DXJ F;  2EFN A;  4KIC A;  3D5L A;  1LNW A;  2AS5 F;  3ZMZ A;  4G6Q A;  4M9Z A;  2OD5 A;  2XHK A;  4OMZ A;  5LRR A;  1JHH A;  2QQA A;  4R1H A;  2QQ9 A;  3HTU A;  1HW5 A;  4G6D A;  2K4J A;  2BE5 F;  2IJL A;  4MHG A;  2UZK A;  4O5V A;  3COA C;  2PMH A;  1O3Q A;  1TQP A;  1RNL A;  3GXO A;  3P9C A;  2VT2 A;  2P6S A;  1EH7 A;  4ENM A;  2ESN A;  1I5Z A;  1W4M A;  3C7J A;  1MDM A;  1XDS A;  1FP2 A;  4BNC A;  4DQ2 A;  3FXU A;  2Y0M A;  4B8X A;  3R61 A;  2K86 A;  2V6C A;  4RGX A;  1XCV A;  4A5M A;  4EV0 A;  4KUM A;  1OYI A;  1KU2 A;  1T0F A;  2FBI A;  3V7S A;  2FA5 A;  4LK0 F;  5AON A;  5L3D A;  3FZV A;  2CFX A;  3T1B A;  3I53 A;  1Z05 A;  4UV8 A;  4GXO A;  4XLP F;  1U5T A;  3WGG A;  2CO5 A;  1GVJ A;  1S7O A;  4OIP F;  3Q9V A;  2FF4 A;  5E18 F;  5DYM A;  3R60 A;  5ILU A;  1IW7 F;  3KET A;  3HRS A;  1BN5 A;  4KMU X;  3U1D A;  3MWM A;  1FY7 A;  3KP5 A;  3GFI A;  1EV7 A;  5ICG A;  4O6J A;  1YYV A;  2O61 A;  2VE8 A;  4IHT A;  5LLQ A;  1K79 A;  3CUQ B;  1MJA A;  5K5Q A;  3EUH A;  2EV5 A;  5BOX A;  1JE8 A;  2FEZ A;  4S04 A;  1YFH A;  4A2U A;  5CJ9 A;  5DCM B;  1FYK A;  2WV0 A;  2KIU A;  1QNT A;  2FNP A;  2E1C A;  1O7L A;  5TJJ A;  1WKM A;  3T5X A;  3AAF A;  4RGR A;  4I0A A;  1RIO H;  2WWY A;  3GW2 A;  1NHA A;  5JI6 A;  1FC3 A;  5KK1 A;  3T0Y A;  4NQW A;  2P5K A;  1XSX A;  5LHH A;  2A07 F;  4HLY A;  2CWE A;  2YR2 A;  4OIO F;  5LEJ A;  2Z99 A;  4IRI A;  1XGN A;  1FWZ A;  5E1X A;  4EM1 A;  2QQB A;  2Z3Y A;  2KIM A;  2OU2 A;  1LVA A;  3T8R A;  4LJZ F;  3GZ5 A;  2XRO A;  2Z5U A;  4ON0 A;  2HYF A;  4YFN F;  5E8I A;  3R0J A;  2EV0 A;  4S05 A;  4G7O F;  2V79 A;  4A12 A;  3MQ0 A;  5DCF A;  1UST A;  1U3E M;  2M87 A;  3O6B B;  5KVR A;  3ELK A;  2VXZ A;  3QOP A;  4P96 A;  3JSO A;  2VOD A;  4EJU A;  2MLK A;  3KEQ A;  1BIB A;  5D4R A;  5DCM A;  1RUO A;  2FQ3 A;  1C0W A;  1BJA A;  4Y13 A;  2VBY A;  2FOK A;  2L01 A;  4U0V A;  3OV8 A;  3PQJ A;  1STZ A;  2A6E F;  3I54 A;  3RTR A;  2H09 A;  3RI4 A;  4LB6 B;  3WTV C;  5E1Z B;  2RN7 A;  2ZCW A;  3CO6 C;  3BOQ A;  3N97 A;  1IUY A;  1UFM A;  3NQO A;  1MKM A;  4UXN A;  1V4R A;  4XLN F;  1TNT A;  2CYY A;  1K6O A;  1UCR A;  1L3L A;  1DPR A;  3I5U A;  4KN4 X;  2UXX A;  5IT9 Z;  3DQV C;  4UNO A;  4HV5 A;  3ZPL A;  4IRG A;  1RI7 A;  2BV6 A;  1ONV A;  2GIV A;  3IHU A;  1ZG1 A;  2DI3 A;  1FSH A;  2LF8 A;  5HDN A;  1KU9 A;  4OIN F;  5DD8 A;  5F1R A;  1XD7 A;  2VBZ A;  2VC0 A;  1YW8 A;  1UB9 A;  2J5P A;  4L9J A;  2X0L A;  3VOD A;  2YU3 A;  3J80 Z;  2GZW A;  4WWC A;  3E5Q A;  5EEG A;  1BC8 C;  2ISY A;  2Y75 A;  3QP6 A;  1YLF A;  2D2W A;  1OYY A;  3KLN A;  5FFX A;  2EA4 A;  4MGR A;  1XGO A;  5HS9 A;  1D8J A;  4M73 A;  3Q5F A;  3V7C A;  2X4H A;  2K27 A;  2QVO A;  2J5O A;  3M1E A;  3DPL C;  3F8C A;  4B09 A;  4N9I A;  2EB7 A;  3IKV A;  3DV8 A;  5J6X A;  1YG2 A;  2DQL A;  5HLI A;  1DUX C;  2ZME A;  4CDG A;  2XAG A;  5HOO A;  1IAW A;  3GF2 A;  1R1U A;  3KP4 A;  2VON A;  3SFZ A;  2MH2 A;  2BGC A;  2YSR A;  4EVI A;  3TKY A;  1HW1 A;  1R1V A;  2HGC A;  2FU4 A;  1DPU A;  2L3D A;  3E6B A;  1D3Y A;  3WTY C;  4Y17 A;  1P2F A;  1QBJ A;  1GHC A;  3P9K A;  5L3G A;  3CO7 C;  1CF7 B;  3WU1 B;  2BEO A;  3HIF A;  3SHF A;  3ZQ7 A;  1REP C;  3LAJ A;  3FM5 A;  4M9S A;  3H3U A;  1KU3 A;  1ZRE A;  2VC1 A;  3FMS A;  3ZMD A;  2EA2 A;  3SZP A;  4IF4 A;  3TQN A;  4M6Y A;  2L54 A;  2NNY A;  2QM3 A;  2ZXJ A;  4LB5 A;  1H0M A;  2MLG A;  1SFX A;  1XMA A;  1QPM A;  1E17 A;  2LF7 A;  5LHI A;  4I98 B;  1DDN A;  1J2X A;  3WE3 A;  4TV7 A;  3ZP5 A;  1G3Y A;  4KYW A;  3ABU A;  5J8C A;  5D8L B;  3L00 A;  4IVN A;  1Y0U A;  1R5H A;  4L5I A;  4RAY A;  3ZMV A;  4WX9 A;  1ZH5 A;  1Z1D A;  5CVJ A;  3K1N A;  3C18 A;  5BS6 A;  2XIG A;  4M72 A;  2IA1 A;  2OZU A;  4FT8 A;  5IT9 K;  3HOS A;  3GFJ A;  5E1W A;  2DPU A;  3TO7 A;  3JW4 A;  4HAM A;  1FYM A;  2M30 A;  3R4K A;  1CF7 A;  2ZFW A;  1Z6T A;  1F9N A;  1R23 A;  3KP3 A;  1D5V A;  4YII A;  2W57 A;  3K0L A;  1Z9C A;  4LLN A;  3KCC A;  2STW A;  2OQR A;  3I59 A;  1YQA A;  2A69 F;  3BJA A;  4Q48 A;  1T2K A;  1G3W A;  4KFC A;  1LJ9 A;  4ZYE A;  2HFH A;  3DPT A;  4LG0 A;  3QRF F;  3J80 K;  2FBK A;  1OPC A;  1RZ4 A;  3CLO A;  4MEX F;  3KP6 A;  1XMK A;  3ABT A;  2PMU A;  4HQM A;  1R36 A;  3K1M A;  1JXS A;  1B4A A;  4HV6 A;  5H6Q A;  3F72 A;  3WTS C;  4P9F A;  4AD9 A;  1LQ1 A;  2FSW A;  4BYY A;  1BM9 A;  3O3K A;  2M45 A;  4R8H A;  3VFZ A;  1PDN C;  2XKP A;  1J59 A;  1SD5 A;  4BXU A;  4ESB A;  5HDK A;  3WG9 A;  4PCQ A;  2DO7 A;  3HRT A;  2CG4 A;  3HYI A;  3J7A O;  1X3U A;  3TO6 A;  2RDP A;  2XKO A;  5FO5 A;  4HLX A;  1QGP A;  4WXC A;  3F22 A;  2KJC A;  4ETS A;  3F6V A;  3FMR A;  5JR3 A;  3EET A;  4H0E A;  3TDZ C;  4P55 A;  5JFR A;  1O3R A;  2PI0 A;  3WTZ A;  3ZMT A;  3HOT A;  4A6E A;  3QP5 A;  4PGH A;  2M5W A;  3WU0 A;  4U0Y A;  4PZJ A;  2QBY A;  2NAZ A;  3GLX A;  1D8K A;  4I2O A;  3BJO A;  2Z9O A;  5HLG A;  1I27 A;  4G8X A;  4E70 A;  4A0Y A;  5HLH A;  2HWV A;  1O3S A;  2E1N A;  2JRT A;  1ZGJ A;  3E6C C;  1YS6 A;  1FBS A;  1YIO A;  4N0B A;  2HQR A;  1FNN A;  5CVU A;  4A0X A;  3L9F A;  4I02 A;  2HKO A;  5E17 F;  1ON1 A;  2IT0 A;  3CUQ C;  3R0A A;  4D0P A;  5K5O A;  3WGH A;  3M8E A;  1S29 A;  2IVM A;  1WWX A;  3F6O A;  1R22 A;  3GZ6 A;  3FXR A;  4LK1 F;  4HW0 A;  5ICC A;  1F5T A;  4ZH4 F;  1GXP A;  4ESJ A;  5DUK A;  3HSR A;  5DD4 A;  5H6R A;  2HR3 A;  5F64 A;  3BRO A;  1OYW A;  1LDK B;  3LWF A;  5D5V B;  1F4K A;  3SZT A;  2DW4 A;  5D6F A;  1IRG A;  2QLZ A;  2M1B A;  3PQK A;  4ENK A;  1SMT A;  2RGV A;  3B02 A;  4MNU A;  1HKT A;  2OAZ A;  1B9M A;  3KZZ A;  3F3X A;  2FBH A;  1I1G A;  3DEU A;  1FSE A;  2F5F A;  2JPC A;  1H9T A;  3Q9S A;  2UWM A;  4G7Z F;  4UV9 A;  1U2W A;  2FXA A;  4ZYH A;  3RYR A;  1SD4 A;  2RKH A;  5L3E A;  2CGP A;  2D45 A;  4RGS A;  1XCB A;  3E3V A;  1FPQ A;  5FGM A;  5LRS A;  2GA1 A;  4EQQ A;  2IA2 A;  2MA3 A;  2PN6 A;  1O7F A;  1SFU A;  1HKQ A;  2VOP A;  2A68 F;  1ZLJ A;  4CIC A;  1R58 A;  4KIB A;  3VOE A;  4DNC A;  3L7W A;  3F23 A;  3REO A;  3C1D A;  3I64 A;  5L3F A;  1P6R A;  3CUQ A;  5CVV A;  2HKX A;  4RB0 A;  2XAH A;  3FF5 A;  4Y15 A;  3KEO A;  4I0B A; 
#chains in the Genus database with same CATH topology
 4CZZ A;  1AU7 A;  3BTI A;  3KEY A;  1XGS A;  1Y1W J;  4LLG F;  5F0F A;  3SDB A;  3ZN1 A;  3CMY A;  3BZC A;  2GXB A;  3TW6 A;  2V1X A;  3I0T A;  3SEQ A;  2L4A A;  1HOM A;  3VSK A;  3K2A A;  3GME A;  4BQN A;  2DA5 A;  3TMO A;  3I71 A;  2ME6 A;  2XRN A;  1SVO A;  2QQ8 A;  1ULY A;  2P81 A;  2JPB A;  3DP7 A;  3A01 A;  5FRM A;  2OBP A;  3T8T A;  4BQQ A;  1FOK A;  1MD0 A;  1J7K A;  1WZ2 A;  4XSZ F;  3DU6 A;  1ZAR A;  3HRM A;  4UHT A;  3LA3 A;  3UR3 C;  1LEB A;  1BI1 A;  3I3L A;  2IGK A;  4XON A;  1G3T A;  3FK7 A;  3V4G A;  1ON2 A;  2P7V B;  5EEA A;  4OIR F;  1HSJ A;  4LG3 A;  3L1P A;  2HEO A;  1RPW A;  3I58 A;  1UHW A;  2VN2 A;  4BU2 A;  5LGU A;  4U7B A;  4BQO A;  3S3N A;  4IL6 C;  5LHG A;  3W6K B;  4PDK A;  5TGT A;  3QU6 A;  3H0D A;  3QWL A;  2GQQ A;  4IXA A;  4KNY A;  2QF7 A;  3DEW A;  1HST A;  1ODD A;  4BJ6 C;  4KIG A;  3K69 A;  3MCZ A;  4Q4Z F;  4XR6 A;  4I01 A;  2PLY A;  1VQ6 I;  3NAR A;  1OJL A;  3S2W A;  4M9X A;  4FIS A;  4E7S A;  5L3B A;  2OCE A;  2FJ1 A;  2JTV A;  3S1N J;  1J5Y A;  1DU0 A;  3GO5 A;  2E2I J;  3OOU A;  2YS9 A;  3ZMS A;  2V9K A;  2WY8 Q;  2EIL H;  1MMS A;  1RC9 A;  2P6T A;  3JRH A;  1TWF J;  1MMD A;  3K4N A;  1B9N A;  1BOA A;  2MSY A;  2XSJ C;  3QPS A;  2L9N A;  2L7Z A;  4I99 C;  3FWE A;  3OOP A;  3GVA A;  5E3L A;  5ILS A;  3QQA A;  1XPX A;  5H20 A;  2EV6 A;  2W24 A;  1IJW C;  4A3J J;  2K02 A;  3RSN A;  2HZD A;  1R5I D;  3O2P E;  4JQF A;  3CCV I;  3GTP J;  3BTC A;  3CDH A;  4MQ9 F;  2DTZ A;  3KLO A;  3G3Z A;  3ERE D;  3CF5 F;  2HVS A;  1AOY A;  1N25 A;  1FLI A;  1M1E B;  5BPI A;  3IUO A;  5DEQ A;  1G6N A;  4MEY F;  2HS5 A;  1WJ5 A;  1BIA A;  4HYE A;  2WC2 A;  3DKW A;  4L0Y B;  3IWF A;  2KRF A;  3OL4 A;  5M5X J;  5D5W B;  1MH3 A;  4M74 A;  1X1P A;  2O0Y A;  2K9Q A;  2ELH A;  2L9R A;  3RYP A;  3G73 A;  4M71 A;  3EUA A;  5J8F A;  2A5Y B;  3J81 Z;  1ETV A;  2PBI A;  3OSF A;  4EGZ A;  1T98 A;  2VLA A;  2P5V A;  1IZ1 A;  4BEH A;  2NRA C;  5FKK A;  2LP0 A;  1DGW Y;  2KP6 A;  3MZ8 A;  4F55 A;  3MZY A;  3K4M A;  3TOB A;  1UG0 A;  2V7F A;  4RM2 A;  1QVU A;  1T6S A;  5K5R A;  4XRS A;  3HZJ A;  2QEN A;  1LPQ A;  4ENJ A;  2O6G E;  4NHJ A;  2M3A A;  2DDA A;  3BDD A;  4HZF A;  5J1U A;  3LFK A;  1IN8 A;  2G7H A;  2L4M A;  1YW9 A;  3S32 A;  2K3F A;  1XSV A;  3K4L A;  3HUG B;  5LGN A;  2XGD A;  2WBM A;  4RS8 A;  2F6C A;  4GFB A;  5EDN A;  3CMM A;  3HOZ J;  1D0X A;  2NS0 A;  4HBL A;  5ILV A;  4CSW A;  4U88 A;  1SMY F;  3MKL A;  5HS7 A;  1OMI A;  2P4W A;  2DPD A;  4IQJ A;  3PO2 J;  2L9S A;  4M6X A;  1WI3 A;  4PSX A;  1YW7 A;  2HNH A;  3UNG C;  3H9Q A;  4HRI A;  4C9Y A;  3FM3 A;  3N4M A;  5CVI A;  2VQG A;  5EG0 B;  1YHQ I;  3TP0 A;  2H6C A;  3G1L A;  2QUF A;  2BBY A;  3P7N A;  3DPU A;  1FJL A;  3U1K A;  2W7N A;  2IS1 A;  2G7U A;  4A0Z A;  1K83 J;  3QOD A;  1D0Y A;  3F8M A;  1W5T A;  4AC0 A;  1UAA A;  3TDU C;  1T38 A;  5M5Y J;  4AVP A;  4CYD A;  1EJ9 A;  2ME0 A;  1XGM A;  3KFW X;  4ZYG A;  5JVT A;  3PNV A;  3HSE A;  3SQN A;  4FX4 A;  3L09 A;  2X1C A;  2R5Z B;  2AO9 A;  2X6W A;  4GYI A;  4A6D A;  1IRF A;  1XG1 A;  2G9W A;  4K2E A;  4V2F A;  1ACI A;  2VBX A;  2R7D A;  4C2M J;  1P4W A;  3HG9 A;  4AIH A;  3E5U A;  4YIF A;  1FYL A;  5AIQ A;  2HU9 A;  1RUN A;  3DF8 A;  2RQQ A;  4HF2 A;  3VSL A;  4Z6Y A;  3IL2 A;  4EGY A;  4J19 A;  1V3F A;  4LLL A;  4NC8 A;  4IJA A;  3TED A;  1WJC A;  4A3F J;  5CLS A;  3F8B A;  2ZKZ A;  3QYF A;  2Q0O A;  3GTL J;  4IHS A;  2XUB A;  1IDZ A;  2M8E A;  2DA7 A;  2HOT A;  2HXO A;  3CJN A;  2L0K A;  4OMY A;  4F7Z A;  2KFD A;  3ECH A;  2GBY A;  3HRU A;  4OOI A;  4ANJ A;  3OYE A;  3K1P A;  4R79 A;  4BUP A;  1BI2 A;  2PFB A;  3F8F A;  2LKX A;  4EM2 A;  4WCG A;  3HUG A;  3EYY A;  5J1Y A;  2K4B A;  2WB1 N;  2FNA A;  2LOO A;  2MBF A;  3CES A;  3DKY A;  4H4K C;  3C3W A;  2IAI A;  2NNN A;  1Z6R A;  2EK5 A;  5HDG A;  2ZNZ A;  5D5X B;  5HS8 A;  4RB2 C;  5IOY A;  1GDT A;  3AG1 H;  1VF9 A;  2W84 A;  1IN5 A;  4RMN A;  3OYB A;  2V9P A;  1T39 A;  1MJB A;  3CCM I;  4CCO A;  3WGI A;  1BR4 A;  2DT7 B;  4XKC A;  2VT3 A;  3QPT A;  3O8G A;  3PJR A;  1GVD A;  3TO9 A;  1YS7 A;  2MC3 A;  2FUG 2;  4DYC A;  5IYC J;  3ASO H;  4C3J J;  1V5E A;  5C3E J;  4JX4 A;  3RPQ A;  3K70 D;  2DYS H;  2HDC A;  2YX7 A;  1LE8 B;  1SVM A;  2R7V A;  2VL8 A;  3JTH A;  3CF2 A;  4EJV A;  1J9I A;  1MMA A;  2V1N A;  1PUF B;  2GA2 A;  4YFK F;  1CGP A;  4OIQ F;  2DK8 A;  1J0R A;  2LNB A;  2XPW A;  2IXS A;  4XQF A;  3H5R A;  1R9T J;  4UVB A;  4Q5S F;  4ESF A;  1JGS A;  1ITY A;  2ADU A;  1QO0 D;  1ZN2 A;  2IBD A;  4Z2Y A;  4CHU A;  4BXF A;  4IEJ A;  4B3A A;  3AL0 C;  2DLL A;  3M4O J;  2AQF A;  2F5E A;  3HPG A;  4IKF A;  2W00 A;  2Q2E B;  3BR0 A;  2IS4 A;  5JHF A;  3A02 A;  1LDD A;  2WAE A;  2Z33 A;  4EJW A;  4XN0 A;  2ZJP F;  1W7P B;  4CH7 A;  4YIR X;  3A2K A;  5M3M J;  2F5D A;  3BQY A;  1LFP A;  3WOD F;  1MNM C;  4DZP A;  1U0J A;  1MDM B;  2Y48 A;  3A4C A;  1ZR4 A;  1OCP A;  4FQG A;  2Z16 A;  1E2X A;  1ETX A;  2IA0 A;  2JSP A;  4XOR A;  1SAX A;  2XAU A;  2I10 A;  4CCJ A;  2D1H A;  3AL0 B;  4HDU A;  1XB4 A;  2RV8 A;  4KIF A;  3AG4 H;  3CLQ A;  3W6J B;  5LBQ A;  3E5X A;  1S5L C;  3MN2 A;  4RBO A;  2E7X A;  5JHU A;  3KIO A;  5IP7 J;  4HF0 A;  2LY1 A;  3J81 K;  4A3M J;  1HC8 A;  1IXR C;  4L18 B;  3E6M A;  1GUU A;  2MAB A;  1EH6 A;  1WI9 A;  3V8J A;  1EH8 A;  4CZC A;  1Y1V J;  2JQ7 A;  2NVT J;  3P9I A;  4UB6 C;  5DS9 A;  4I6Z A;  1MH4 A;  1EA3 A;  2CS3 A;  2EFQ A;  3OYG A;  5FKL A;  4BL0 B;  2G0E A;  2IP2 A;  4EMS A;  3CC2 I;  3WTX C;  1QU3 A;  4XSX F;  4O3M A;  3JRD A;  2E5N A;  2HOE A;  2QYO A;  4CCN A;  4UB8 C;  3CCU I;  4KA4 A;  1TQI A;  4FHT A;  4GRI A;  3U2R A;  2NOJ B;  3KP7 A;  3LMM A;  2QSG X;  3QU3 A;  2CQ7 A;  2VPR A;  3GX4 X;  3ROU A;  2BYV E;  1Z21 A;  3D0S A;  3MAJ A;  4D7M A;  1WSU A;  2LMD A;  3CCQ I;  1J75 A;  3RZD J;  5B1B H;  3CUO A;  4RAZ A;  4WF2 A;  1VQ9 I;  3BWG A;  2KHM A;  2JMW A;  5ICE A;  5IOZ A;  4IPA A;  5J3L A;  3DLA A;  2NYX A;  1IO2 A;  3ISP A;  5GAH J;  1PUF A;  3OIP A;  3JRI A;  3SEZ A;  1UHM A;  2HQN A;  4U7D A;  3OL3 A;  2KIS A;  4QWQ A;  1OR7 C;  3WG7 H;  2RAE A;  1VQ5 I;  4ZTJ A;  5E79 C;  3G71 I;  2OZ6 A;  2VJ4 A;  1BC7 C;  1XMX A;  1QHG A;  2MH9 A;  3ZOB A;  1K78 B;  2HOS A;  1R1T A;  4B1R A;  2Q2E A;  5E8G A;  3WTT C;  4BQA A;  4LFU A;  2QKM B;  1A6I A;  2KDO A;  2XC7 A;  4UVC A;  3Q0U A;  2ESH A;  1PP8 F;  4M3G A;  1TW2 A;  2IGO A;  3PNY A;  4HX8 A;  1KZH A;  3CC7 I;  1W7P A;  3GFM A;  4PGG A;  3I4M J;  1R7J A;  3LQQ A;  3GTO J;  2Y30 A;  2PJP A;  2R93 J;  3ESW B;  3PM1 A;  2YUS A;  1O3T A;  1KQ9 A;  1W5S A;  1VQK I;  1J09 A;  4E6K G;  4ABZ A;  4G7H F;  3HC7 A;  3JRG A;  3BR6 A;  2JK3 A;  1D1C A;  2XPU A;  5A2Q Z;  3DFG A;  5KAI C;  1OCR H;  2LVS A;  2Q8K A;  1RRJ A;  3PFI A;  5LEK A;  4BHC A;  3IWZ A;  4F92 B;  1ETW A;  4XNF A;  5FB2 A;  1PUE E;  3S16 J;  5EJC A;  2I5U A;  1IN6 A;  5D5U B;  3QOE A;  3FXO A;  1V55 H;  3RIR A;  3EDP A;  2YPR A;  4ZDP A;  2OC6 A;  2CSO A;  4ZYD A;  2F48 A;  1SC7 A;  3E7L A;  2PQ8 A;  3BJ6 A;  3I4P A;  2P0W A;  4A3I J;  4II3 A;  3K2Z A;  4NQW B;  5D6E A;  1RET A;  5HVQ C;  2H94 A;  4PJJ A;  4ZZD A;  2EZH A;  3ZMU A;  3WU2 C;  5L3C A;  2CQQ A;  1TQM A;  1JHF A;  3K9T A;  2W25 A;  3M9A A;  5GAD J;  1A04 A;  5HNH A;  2VI6 A;  4XRM A;  3HJE A;  1WJF A;  1LFB A;  2UXN A;  2PG4 A;  1TTY A;  1WJD A;  4A3B J;  1YJ9 I;  4X1E A;  1I1S A;  1KU7 A;  2R7U A;  2P5L C;  2KMU A;  2H27 A;  2QWW A;  4HX4 A;  1ZGA A;  2EFO A;  2PEX A;  3ZRG A;  2GAU A;  1B8I A;  2STT A;  5EEH A;  1KGS A;  3FIW A;  2B9S A;  3S1Q J;  4YEL A;  3IRR A;  4A69 C;  4OU0 A;  3KZY A;  2GOX B;  4RB1 A;  2VXD A;  3D5R C;  5GPC A;  3M7G A;  3J7A Y;  3CZ6 A;  1G4D A;  1G2H A;  1U78 A;  1GXQ A;  4RLQ A;  4B48 A;  1K78 A;  2VJ5 A;  1DP7 P;  3TBI A;  1N78 A;  4M3B A;  2V26 A;  3NRV A;  1K7A A;  2JZY A;  2HQA A;  2GWR A;  2WAQ A;  5C44 J;  3BTJ A;  4HA8 A;  3FX3 A;  3BG9 A;  3GWZ A;  1OR7 A;  4CCM A;  2IRF G;  3W2A A;  1HDD C;  3U21 A;  4YG2 F;  4EJO A;  1TBX A;  2JT1 A;  1XDU A;  4XN3 A;  2RNG A;  3HSF A;  3WE2 A;  4IHV A;  4ZZL A;  4D5F A;  3JSP A;  1MBH A;  1X4O A;  2BVM A;  9ANT A;  2KLO A;  4MIM A;  2WTE A;  3RJP A;  1MJ9 A;  3FMQ A;  1SFK A;  3BP8 A;  5DUI A;  4LD5 A;  3SXY A;  1B1B A;  1BI0 A;  1R4M B;  4MTE A;  4XIC A;  2CW8 A;  2ECB A;  1WQ2 A;  3NEU A;  4WXD A;  1P4X A;  5FD5 A;  3A1Y A;  1R49 A;  1S8N A;  1TLH B;  3Q0V A;  3V8L A;  4G94 A;  3NWS A;  1HQC A;  1PP7 U;  1MBK A;  3VB2 A;  1P7I A;  3MFK A;  4RGU A;  3DTI A;  5AIP A;  3HTS B;  1O4X A;  2LD5 A;  5FJ8 J;  1XSD A;  1T08 B;  2E35 A;  2L7F P;  4A5N A;  4EJT A;  1IXC A;  4Y7N J;  4JK1 X;  2HZT A;  3V8K A;  2DK5 A;  1LUJ B;  2YX4 A;  2PJR B;  4L9N A;  4BHB A;  3H36 A;  4Q47 A;  5C4X J;  2CRG A;  3A03 A;  2CH0 A;  1S6L A;  2HVQ A;  3K4B A;  2HYG D;  5DDG A;  3JAM Z;  3GEZ A;  2E36 A;  2ETH A;  1Y8R B;  2M0M A;  1KYZ A;  2ZBK A;  5FRO A;  3S2D J;  2JUG A;  4PUS A;  4I09 A;  5BQT A;  4F91 B;  1WPK A;  3PSI A;  2M9H A;  1F1Z A;  1ZG5 A;  3CP8 A;  3L2U A;  5TRD A;  1FBQ A;  1QQI A;  3K6G A;  4B44 A;  4ZDO A;  1Z77 A;  4GO1 A;  1I6X A;  4G6T B;  4XBF A;  3R6S A;  4BJT A;  2A5W A;  2DMQ A;  1LKX A;  4UVA A;  4MQV A;  1O57 A;  1P92 A;  2XF7 A;  2DBB A;  3FHZ A;  3DCF A;  2FE3 A;  3IC7 A;  4UUV A;  4WK8 F;  3MZH A;  3GLL A;  2KIF A;  5BNG A;  1R5G A;  2TDX A;  4JX5 A;  4A3G J;  1SFE A;  2OF7 A;  3FXJ A;  2ZNY A;  3U9G A;  1L0O C;  2IGM A;  3S1R J;  3UKG A;  1YTY A;  3HOV J;  1ZK8 A;  3MEX A;  4HOB A;  2R7Q A;  2HTS A;  1LFU P;  1IRX A;  1MGT A;  4QLC U;  1ZLK A;  4XKB A;  2H1L A;  3LFU A;  3M8F A;  2LK2 A;  2V9V A;  3PUF A;  1ZEL A;  4AYB A;  4P5O A;  3DTK A;  4PJM A;  1VTN C;  2NS7 A;  3RKY A;  3RKW A;  4DGW B;  2GXG A;  1YIJ I;  3L2V A;  3OMY A;  1R00 A;  2MD5 A;  1DGR M;  2WY7 Q;  3BG3 A;  3TOA A;  4ZTF A;  2IPQ X;  4WXH A;  4FX0 A;  3WTU C;  2HQ5 A;  3SZG A;  2E19 A;  3FK6 A;  1GV2 A;  2QCO A;  3FXK A;  3OYA A;  4HNV A;  4KDP A;  2VBW A;  2JA7 J;  2OQG A;  3IKT A;  2D1V A;  3FIS A;  5BMZ A;  1YO5 C;  2GIZ A;  4L5J A;  4CGZ A;  4XK4 A;  3VPR A;  3B73 A;  1ZRC A;  2M4G A;  2MYS A;  1R6R A;  2E60 A;  2X1E A;  4CUG A;  3PUB A;  1FT9 A;  1IV8 A;  5A2Q K;  4XID A;  2CUZ A;  2PJR A;  2CW0 F;  2R7S A;  2O3F A;  3HB9 A;  3OS2 A;  4AIK A;  3E97 A;  2X1D A;  1K61 A;  1E0E A;  2DFI A;  3AG2 H;  3LSH A;  1UJ8 A;  3L2C A;  5J4V A;  2ELK A;  2K9N A;  2RNJ A;  1HW2 A;  1SD6 A;  2FQ4 A;  2ZME B;  2DTR A;  2P7C B;  1NK2 P;  1QRY A;  2K9L A;  4AU7 A;  5J4Y A;  2VE9 A;  1S72 I;  2C6Y A;  1JUM A;  2ZO4 A;  2ZXW H;  3WHC A;  1MBE A;  1KQ8 A;  1W7P D;  2A05 A;  4Y3O A;  2COM A;  4BH9 A;  4LGW A;  3CDI A;  4CXF A;  2LKS A;  2XGC A;  2DU9 A;  2QZ8 A;  2XGE A;  1IN4 A;  2E34 A;  2LC2 A;  2A3S A;  1IDY A;  1X3Z B;  2K5C A;  1QZY A;  1IXS B;  1OCO H;  1FBU A;  2JSC A;  2CV1 A;  2FML A;  4AVZ A;  1BBY A;  2FOW A;  3OR2 C;  2E1M B;  2FD5 A;  2HPM A;  3VYS B;  2Q1Z B;  2RVC A;  5FLX Z;  3G1M A;  3G1O A;  2E7W A;  1H9G A;  2RQP A;  1HBX G;  5ERI A;  4HF1 A;  3K4K A;  4E7J A;  1R71 A;  4QPQ A;  3RPU A;  3HDD A;  1WVR A;  2NVY J;  3CDL A;  2DT5 A;  1IGN A;  3IAM 2;  5D4S A;  3SYT A;  2IW5 A;  1XTA A;  2XAS A;  2VQH A;  1FMV A;  4XRF A;  3LSK A;  1BL0 A;  3NAU A;  1VQN I;  1B6A A;  3CTA A;  4ZDL A;  2W85 A;  3JCU C;  5IPA A;  3V7R A;  2XVC A;  2EWN A;  1ZTR A;  2HDW A;  1ETQ A;  2RC4 A;  5K1Y A;  2DAO A;  1QZZ A;  3HHG A;  4A3C J;  2JRM A;  2BY2 A;  4JBA A;  2KKO A;  5CKT A;  2EJR A;  1BI3 A;  2R7F A;  1ZRD A;  1B59 A;  1P9Q C;  2EH3 A;  2R4G A;  5CVR A;  4HX7 A;  1P4A A;  4BHP A;  1AWC A;  1IF1 A;  4FE4 A;  5ICF A;  1ETK A;  2JVH A;  2F4O B;  2X85 A;  2O03 A;  1G59 A;  1I39 A;  1TWG J;  2GLO A;  2VOO A;  3K7A J;  4ZYA A;  4PSW A;  5D8K B;  2VKD A;  4AUX A;  3ML6 A;  1U6G A;  4LOC A;  4Y4R A;  4RLF A;  5H2F C;  1ZRF A;  4A93 J;  2V4J C;  3O8H A;  3TGN A;  1ENH A;  1HXD A;  1Q1V A;  1Z91 A;  1OIS A;  1LDJ A;  3M1C A;  2V1U A;  2AQE A;  5DM6 F;  3KYD B;  1IN7 A;  4RAG A;  3JRC A;  1LEA A;  4UY8 I;  2CQN A;  4U0W A;  2XAQ A;  2NVU B;  2DOF A;  2HTJ A;  3IP4 B;  2VB6 A;  1MBJ A;  3QAH A;  1HKS A;  4AIJ A;  2P8T A;  4I7H A;  4EEF G;  4LMY A;  3OY9 A;  1W0U A;  1WRJ A;  4B4C A;  3RDI A;  2HXI A;  2GXA A;  1NTC A;  2K7L A;  2ZJ2 A;  5E20 A;  3LA7 A;  3JAM K;  4MFE A;  2Y2Z A;  6PAX A;  1V54 H;  2B63 J;  1YI2 I;  5DV5 A;  2XB5 A;  3ULQ B;  3CJR B;  3DBH B;  4MO7 A;  4L9T A;  3LSI A;  3E6D A;  2QSF X;  1SD7 A;  1KON A;  2KJB A;  2DQR A;  3BCA A;  4ZJZ A;  4CO8 A;  2XAF A;  1ZAO A;  1MZB A;  4Y52 J;  3SDG A;  2LKP A;  1RKT A;  2X6O A;  3L2Q A;  1BW5 A;  1USS A;  3ZN0 A;  4QPO A;  2JVG A;  1MBF A;  2EFP A;  3HL2 A;  3WTW C;  4P9U A;  2QKL B;  2XGX A;  3LSJ A;  4IHY A;  3OYC A;  3BLY A;  1SAN A;  1I3Q J;  2EFW A;  3BPX A;  4IOA F;  3GUD A;  2LDU A;  2B0L A;  4EM0 B;  2ISZ A;  1FP1 D;  3E1S A;  3W6V A;  1ZQ3 P;  3D5S C;  4BE0 A;  2OA4 A;  3HOY J;  1DQU A;  3CJT B;  3EQL F;  2VKV A;  3LST A;  3I59 B;  2R3S A;  4MLO A;  2X48 A;  5HNF A;  5BPD A;  4G9Y A;  2VJI A;  4W1U A;  1LB2 A;  2XV4 S;  5FD6 A;  4MTD A;  3S1M J;  3LOC A;  1UEL B;  2KPM A;  2LSO A;  4HDV A;  4IO9 F;  4KMF A;  4LG0 B;  2O8X A;  1JTX A;  2JA8 J;  3BZ6 A;  1PJR A;  1Q1H A;  4GYG A;  2BXY A;  4RB3 C;  4L9V A;  3S8P A;  2V6E A;  5F04 A;  1U8B A;  3EYI A;  2ACJ A;  3KE2 A;  1ZR2 A;  3VEP A;  1Y6I A;  3ECO A;  3BPV A;  1ZYR F;  2ZXI A;  3H92 A;  1KYW A;  1JJ8 C;  3LA2 A;  3I55 I;  1D5Y A;  2WAD A;  2CV2 A;  2W82 A;  4ASN A;  2L02 A;  2CW7 A;  1FX7 A;  5FFZ A;  3H3Z A;  3LAP A;  1TW3 A;  4XLC A;  1Z7U A;  4AWX B;  1OKR A;  4DBR A;  4BAY A;  2BY3 A;  3DEE A;  3JTG A;  3KP2 A;  1IV6 A;  1U8R A;  4NB5 A;  1OCT C;  2VUM J;  2CQK A;  1XC5 A;  4JOM A;  4L5E A;  5GTH C;  5EG0 A;  4IRH A;  2A6H F;  2KL4 A;  3GTK J;  1S7A A;  3S3M A;  2ZB9 A;  2H6B A;  2X9D A;  3OWT A;  3QPH A;  3HHH A;  1WCM J;  4PJL A;  1VQ4 I;  4HQE A;  3DWL E;  4KN7 X;  3RKX A;  2FRH A;  5KCM A;  4A3D J;  2VIX A;  3OYD A;  2M8G X;  3BR5 A;  3FXM A;  3NWT A;  1S3J A;  4L0Z B;  1GLN A;  2O8K A;  4GGG A;  2PMZ A;  3BG5 A;  4IZZ A;  2FX0 A;  1VZ0 A;  2XAJ A;  4KT5 C;  2AXL A;  1MSF C;  2R5Z A;  4HNT A;  2K9M A;  3D1N I;  3GYH X;  2JWT A;  2WAQ N;  2M2E A;  2CUJ A;  4CCL A;  3BY6 A;  4EAT A;  3C2H A;  3RQI A;  4YFX F;  5IT3 A;  2XSD C;  2XRL A;  2A61 A;  3FXQ A;  3ZQL A;  2V1D A;  2F2E A;  2XF5 A;  1T0F C;  3BG6 A;  1AKH B;  3QPL A;  1VI0 A;  4ENN A;  5FLX K;  1ZG3 A;  1XN7 A;  1S9H A;  3OIQ A;  3LQR A;  3RQ4 A;  1ZHF A;  3PFY A;  3IRQ A;  1U5T C;  3F8N A;  2FMY A;  4N9H A;  3ZQC A;  2M7A A;  2Y9Y A;  4B43 A;  1EKE A;  2QBY B;  1G3S A;  1TNS A;  5CYV A;  1GV5 A;  4GCV A;  3JR9 A;  1KQ0 A;  5F6F A;  2LY9 A;  2DA6 A;  3GFL A;  5ED4 A;  1EF4 A;  2H1K A;  2F5C A;  4DYQ A;  1FZP B;  3F21 A;  5LGT A;  2NVX J;  4QTR A;  1GT0 C;  1KA8 A;  1U5T B;  3DXJ F;  2O5R A;  2EFN A;  5CQE A;  1QPI A;  4KIC A;  1QHH D;  3D5L A;  1LNW A;  2AS5 F;  5GPA A;  3ZMZ A;  4BGD A;  4G6Q A;  2D5V A;  4M9Z A;  2OD5 A;  3EPZ A;  2XHK A;  2HYJ A;  4OMZ A;  3K4J A;  3ASN H;  5LRR A;  1NH3 A;  1JHH A;  2QQA A;  4C2T A;  3PL8 A;  3A0H C;  4R1H A;  1W5C C;  2QQ9 A;  5B66 C;  4BAC A;  1LE8 A;  3MD2 A;  3RPU D;  1YRN B;  4GDF A;  3HTU A;  1HW5 A;  4G6D A;  2L2O A;  5K7Z A;  2K4J A;  2BE5 F;  5KAF C;  4HSR A;  2IJL A;  1TC3 C;  1A6Q A;  4MHG A;  2UZK A;  5JLX A;  2R7R A;  4CYC B;  4O5V A;  3COA C;  2PMH A;  3EUH C;  1O3Q A;  1TQP A;  1RNL A;  4F3Q A;  2EZI A;  4ITV A;  1A5J A;  3GXO A;  3J7Z I;  2VJJ A;  3F0C A;  3P9C A;  2VT2 A;  4PK4 A;  1X19 A;  3LSG A;  5M5W J;  1D0Z A;  2P6S A;  1FTT A;  5EGO B;  1EH7 A;  2ZC2 A;  2UV1 A;  4ENM A;  2ESN A;  2CQX A;  1I5Z A;  4P1W A;  1VQ8 I;  4M3F A;  1W4M A;  3C7J A;  1MDM A;  4AYB N;  3OYN A;  1XDS A;  1FP2 A;  4BNC A;  1AKH A;  4DQ2 A;  3FXU A;  2Y0M A;  4NC7 A;  1RKW A;  4B8X A;  3FBN B;  3MMY B;  2KRC A;  2DJI A;  3R61 A;  4XM3 A;  1FOY A;  4RA2 A;  2K86 A;  3PNT A;  2V6C A;  4RGX A;  1VND A;  1UMQ A;  1XCV A;  2DFE A;  1OFC X;  4A5M A;  4EV0 A;  4KUM A;  3I56 I;  1NK3 P;  4OAY A;  1CQT A;  3HOW J;  1OYI A;  1P7J A;  1X2M A;  5J47 A;  2Z2S B;  1KU2 A;  3TP3 A;  1T0F A;  2ELJ A;  2FBI A;  2DN0 A;  2DCE A;  3V7S A;  4XOT A;  1HLV A;  2FA5 A;  4LK0 F;  5AON A;  3AKZ A;  3HGG A;  4FAS D;  4C3I J;  5L3D A;  3FZV A;  2CFX A;  3T1B A;  3I53 A;  3BG7 A;  4DZJ A;  1BW6 A;  1Z05 A;  1ZKG A;  2R92 J;  5C4J J;  1JI8 A;  1NG6 A;  4UV8 A;  4GXO A;  4XLP F;  3CC4 I;  1U5T A;  4BKX A;  3OYK A;  4BY7 J;  2YU9 J;  3WGG A;  2CO5 A;  1GVJ A;  1S7O A;  1E3H A;  4OIP F;  2KT0 A;  3Q9V A;  4M3E A;  2FF4 A;  2WB1 A;  5E18 F;  5DYM A;  3R60 A;  5ILU A;  1IW7 F;  3HKZ A;  3FKJ A;  5J40 A;  3KPH A;  3OIO A;  3KET A;  3HRS A;  1YRN A;  1BN5 A;  4KMU X;  3CCY A;  2LRE A;  3U1D A;  5FKO A;  3MWM A;  1H89 C;  1SVL A;  1I3A A;  4CYC A;  1FY7 A;  2OPT A;  3KP5 A;  3GFI A;  2W1O A;  4D1Q A;  2WV1 A;  2KQR A;  1EV7 A;  1TT5 B;  1UG2 A;  3M8J A;  5ICG A;  2ECC A;  1WJB A;  3S2H J;  1XX5 A;  3BZK A;  3KYC B;  1X2N A;  4O6J A;  2TCT A;  1YYV A;  2O61 A;  2E1O A;  3LL7 A;  4A3K J;  2VE8 A;  4IHT A;  5LLQ A;  1K79 A;  3CUQ B;  1MJA A;  5K5Q A;  3OYH A;  5DM7 F;  5EF6 A;  2EIM H;  1FEX A;  3EUH A;  2DJN A;  2EV5 A;  3ABK H;  5BOX A;  2FEZ A;  4S04 A;  3CCE I;  1JE8 A;  2VKH A;  4A2U A;  5CJ9 A;  1YFH A;  5DCM B;  1FYK A;  2AXT C;  3GTG J;  3Q3S A;  2ZXH A;  2WV0 A;  2KIU A;  5JLW A;  3LSP A;  1QNT A;  1RR7 A;  3C2B A;  3FXL A;  2FNP A;  2E1C A;  1O7L A;  3H9J A;  1YX3 A;  5TJJ A;  1WKM A;  3T5X A;  1TWH J;  3AAF A;  3GCM A;  4RGR A;  4I0A A;  1RIO H;  5K7H A;  2WWY A;  3GW2 A;  1NHA A;  2DOE A;  3G2B A;  5F27 A;  5JI6 A;  3JRA A;  1FC3 A;  5KK1 A;  3T0Y A;  1R4N B;  4XL9 A;  1YOV B;  5GAE J;  4NQW A;  2Y0S A;  1SEU A;  1HDP A;  3S14 J;  2P5K A;  1XSX A;  3PSF A;  3DKX A;  5LHH A;  2A07 F;  4HLY A;  2CWE A;  2YR2 A;  4OIO F;  4NNJ A;  4Y33 A;  4D7N A;  2KDZ A;  1N75 A;  5LEJ A;  2Z99 A;  3ZR8 X;  1XGN A;  3P5J A;  4IRI A;  1JUP A;  2JA6 J;  2K85 A;  1X4P A;  1FWZ A;  5E1X A;  4EM1 A;  3KX2 A;  2QQB A;  3DLL F;  2Z3Y A;  2KIM A;  1E3P A;  1BR1 A;  1Z3Y A;  5F08 A;  2OU2 A;  3L2R A;  1LVA A;  2NVQ J;  2W48 A;  3IH2 A;  3T8R A;  3MKY B;  1PVE A;  4LJZ F;  3GZ5 A;  4C2U A;  2XRO A;  2A6T A;  2Z5U A;  4F93 B;  5FLM J;  4ON0 A;  2HYF A;  1PYV A;  4KT6 A;  4YFN F;  3MKZ A;  3CJQ B;  5IP9 J;  2X6Y A;  1ETY A;  3R0J A;  2EV0 A;  5E8I A;  4S05 A;  4YRV A;  4G7O F;  2O9L A;  5TIS C;  3MKW B;  2V79 A;  4A12 A;  3W2W A;  2CUF A;  3MQ0 A;  5DCF A;  1UST A;  3CCR I;  1U3E M;  4XLA A;  2M87 A;  3O6B B;  1H88 C;  5KVR A;  3ELK A;  2VXZ A;  3QOP A;  4FCY A;  5E3N A;  3CCJ I;  4P96 A;  2DT6 A;  4F52 A;  1Y0N A;  5B5E C;  3JSO A;  2VOD A;  2ICW G;  4EJU A;  2MLK A;  3KEQ A;  4U87 A;  4XLE A;  1BIB A;  3DBR B;  5D4R A;  5DCM A;  4IHX A;  1RUO A;  2FQ3 A;  1C0W A;  1BJA A;  5DTD A;  2XB0 X;  4Y13 A;  2VBY A;  2FOK A;  2L01 A;  2E5Z A;  2DMU A;  4U0V A;  2JUC A;  3OV8 A;  3PQJ A;  1BR2 A;  1STZ A;  2A6E F;  3I54 A;  3RTR A;  3IH3 A;  3N05 A;  4BEH B;  3BC8 A;  3EUK L;  4LIV A;  2LYC A;  2OTL I;  2H09 A;  3RI4 A;  2Y31 A;  4LB6 B;  1APL C;  2ZME C;  3DTE A;  2OJE D;  1MMN A;  4N4N B;  3WTV C;  3AFH A;  5E1Z B;  2MC4 A;  2RN7 A;  2ZCW A;  2L7M P;  2LRD A;  2PX9 A;  4II2 A;  3CO6 C;  3BOQ A;  3N97 A;  1IUY A;  1UFM A;  4KIS A;  3NQO A;  2LTP A;  1MKM A;  4UXN A;  1AHD P;  1V4R A;  4XLN F;  3CP2 A;  1TNT A;  4LIT A;  2CUE A;  2CYY A;  4XLF A;  1K6O A;  1UCR A;  1L3L A;  1DPR A;  2E1M C;  3I5U A;  4KN4 X;  2UXX A;  4QIW N;  5IT9 Z;  4XLH A;  1IG7 A;  3DQV C;  4UNO A;  4HV5 A;  3ZPL A;  1MMG A;  2DFH A;  4IRG A;  4XOP A;  4NC6 A;  1RI7 A;  1ZGW A;  2BV6 A;  4DYR A;  1ONV A;  2GIV A;  3IHU A;  4DW6 A;  2DI3 A;  2KRH A;  1ZG1 A;  1H8A C;  1MIJ A;  1FSH A;  2LF8 A;  3S93 A;  4IHW A;  3ZQH A;  2TRT A;  1T33 A;  1TP4 A;  4ZC3 A;  5HDN A;  1KU9 A;  4OIN F;  5DD8 A;  5F1R A;  1XD7 A;  2VBZ A;  2VC0 A;  1YW8 A;  2ID6 A;  1UB9 A;  2J5P A;  4M3D A;  4E4H A;  5B3S H;  2PMZ N;  2HDD A;  4L9J A;  3ZGK A;  2X0L A;  4JX6 A;  4OAZ A;  3VOD A;  2YU3 A;  1YX5 A;  3J80 Z;  2GZW A;  1Z0X A;  4WWC A;  1A36 A;  3L2W A;  3E5Q A;  5EEG A;  3QYB A;  1BC8 C;  1WHU A;  3CCS I;  2ISY A;  2Y75 A;  3QP6 A;  2R7Z J;  1YLF A;  2D2W A;  1OYY A;  1WGX A;  3KLN A;  2VKE A;  1IC8 A;  5FFX A;  3FDY A;  4AM3 A;  4QSH A;  2EA4 A;  2OUM A;  4MGR A;  1XGO A;  5LFA A;  5HS9 A;  2I8D A;  1D8J A;  4M73 A;  3Q5F A;  1WJA A;  2K3P A;  2COB A;  2NOG A;  3V7C A;  1W36 D;  2X4H A;  2K27 A;  2QVO A;  4HPQ A;  2J5O A;  3M1E A;  4S0H B;  3DPL C;  4IOC F;  4B47 A;  2CV0 A;  3F8C A;  5E3O A;  3MVP A;  4B09 A;  3OYF A;  4N9I A;  2EB7 A;  2MG4 A;  3IKV A;  2DXI A;  3DV8 A;  3GZN B;  1Z7L A;  1VFC A;  4B3X A;  5J6X A;  4M6V A;  1YG2 A;  2DQL A;  1W1W E;  5HLI A;  1RR8 C;  1DUX C;  2ZME A;  2W4S A;  4CDG A;  5JVG F;  2XAG A;  2HPI A;  3B6A A;  3SFI A;  5HOO A;  2X6X A;  1IAW A;  4E7I A;  2DOD A;  3GF2 A;  1X1C A;  4IX7 A;  5IY5 H;  2K40 A;  2JN6 A;  1R1U A;  2AHQ A;  4JP0 A;  1FIP A;  3KP4 A;  4PJ0 C;  1VQ7 I;  3ZQI A;  2VON A;  1V5G A;  3FBI B;  3BR2 A;  2E2J J;  3SFZ A;  2MH2 A;  1SFO J;  1BJZ A;  1X3W B;  4XMY A;  3VWB A;  2BGC A;  4KJZ A;  2YSR A;  4EVI A;  1DU6 A;  1YJN I;  3TKY A;  1WH7 A;  2DA3 A;  3LSM A;  1HW1 A;  4J01 A;  1JKP C;  1Y8Q B;  3ZQG A;  1R1V A;  2HGC A;  4DOZ A;  2FU4 A;  5M3F J;  1JTY A;  2L3D A;  3LSR A;  1DPU A;  3E6B A;  4XRS G;  1S7E A;  1D3Y A;  3WTY C;  2BVL A;  4Y17 A;  3BQZ A;  3BTL A;  2M0C A;  1P2F A;  1QBJ A;  3E0J B;  1GHC A;  3P9K A;  1VQP I;  5F0C A;  1IRZ A;  3VYR B;  5L3G A;  5EYR A;  2F5V A;  3CO7 C;  1CF7 B;  3WU1 B;  1X58 A;  2BEO A;  4NDL A;  4RM3 A;  2MD0 A;  1SAU A;  2IEK A;  2M4K A;  3HIF A;  3SHF A;  3H9G A;  1MBG A;  4DIQ A;  2BHY A;  3IH4 A;  3ZQ7 A;  5HOD A;  1REP C;  3LAJ A;  1HA8 A;  3FM5 A;  1FMW A;  3AG3 H;  4M9S A;  1W0T A;  3H3U A;  3K4C A;  1KU3 A;  1ZRE A;  2VC1 A;  3FMS A;  1T95 A;  2EA2 A;  4HEA 2;  3SZP A;  3ZMD A;  1BOB A;  5GP9 A;  2O7O A;  2QSH X;  4IF4 A;  3M3Y J;  3CD6 I;  3TQN A;  2DMT A;  2L54 A;  4M6Y A;  1JUS A;  2NNY A;  2BOL A;  1QVT A;  2BHZ A;  2DA2 A;  2QM3 A;  4UUS B;  1MSE C;  2ZXJ A;  4LB5 A;  1H0M A;  2MLG A;  1SFX A;  2KZG A;  2CMP A;  1XMA A;  2EIK H;  2E2H J;  1D1A A;  1QPM A;  4BE2 A;  1E17 A;  1JT6 A;  2LF7 A;  3S15 J;  1U9N A;  3HOU J;  2RRE A;  4I98 B;  5LHI A;  3DU5 A;  2DA4 A;  4NUB A;  4OWR B;  1DDN A;  5IYB J;  1FOX A;  5F0H A;  5GAG J;  2GM4 A;  1J2X A;  3WE3 A;  4TV7 A;  3ZP5 A;  1G3Y A;  4KYW A;  2VPL A;  3ABU A;  5J8C A;  3IAS 2;  3WHB A;  3IV5 A;  5FKM A;  3HKZ N;  3VDX A;  5D8L B;  3CMA I;  2CU7 A;  3L00 A;  4IVN A;  3JRB A;  1Y0U A;  3OYI A;  2R7W A;  3KZI C;  3W2V A;  4CA0 A;  2XPV A;  1OQY A;  2DMN A;  2M7B A;  4J00 A;  2ZSI B;  4X0G A;  1R5H A;  5J1R A;  1X1D A;  4L5I A;  4RAY A;  3ZMV A;  4WX9 A;  3OYJ A;  2LLK A;  1ZH5 A;  2WAF A;  1Z1D A;  5CVJ A;  3K1N A;  3C18 A;  4V19 K;  2VAS A;  2XIG A;  4M72 A;  5BS6 A;  4V2G A;  3GTM J;  1FOW A;  2IA1 A;  4C3H J;  2OZU A;  4FT8 A;  5IT9 K;  3HOS A;  3GFJ A;  5E1W A;  3OYL A;  1B72 B;  1I6H J;  2DPU A;  3TO7 A;  1I50 J;  1A35 A;  3JW4 A;  3J7Y J;  3H1C A;  4HAM A;  1BA5 A;  1FYM A;  2M30 A;  3OR1 C;  3R4K A;  2DA1 A;  5CQG A;  1CF7 A;  3HEF A;  3LNQ A;  1WFX A;  2ZFW A;  3H5A A;  1Z6T A;  4XKW A;  1F9N A;  3FHN A;  1R23 A;  2XDV A;  3KP3 A;  1D5V A;  1MNE A;  1Y39 A;  2F4I A;  3F9K A;  4YII A;  2W57 A;  3K0L A;  2LG4 A;  3OYM A;  1Z9C A;  1MW7 A;  4LLN A;  1RES A;  1E3O C;  3I4N J;  3KCC A;  2STW A;  2OQR A;  3I59 A;  1TWA J;  1YQA A;  2A69 F;  1G8X A;  3X2Q H;  1FTZ A;  3BJA A;  1QA6 A;  4Q48 A;  1T2K A;  1G3W A;  2DDB A;  4KFC A;  1LJ9 A;  3V42 A;  2HFH A;  2LBF B;  3DPT A;  3VYT B;  4ZYE A;  5FLV A;  4DBQ A;  4BDZ A;  2DOA A;  2WA0 A;  1UZC A;  1DP3 A;  3H5N A;  4LG0 A;  3QRF F;  4I76 A;  3J80 K;  3CCL I;  3DBL B;  2BY0 A;  2R0Q C;  2FBK A;  4UUS A;  2EQR A;  1OPC A;  1K4T A;  1RZ4 A;  3CLO A;  4MEX F;  2LH9 A;  1XMK A;  3KP6 A;  3ABT A;  3B6C A;  2Y0S N;  4RDU A;  2PMU A;  4HQM A;  3PIP F;  2ZFU A;  1W36 C;  4HNU A;  1R36 A;  3G4S I;  2ZSH B;  3OSG A;  1MND A;  2KIQ A;  3K1M A;  1JXS A;  1B4A A;  1JKO C;  4HV6 A;  5H6Q A;  5FKN A;  3F72 A;  1XS9 A;  3WTS C;  4P9F A;  1QZE A;  4AD9 A;  2LR8 A;  5KHD A;  1LQ1 A;  2IGN A;  2FSW A;  3S3O A;  2GOM A;  4BYY A;  1BM9 A;  1FIA A;  2MFZ A;  3O3K A;  2M45 A;  4R8H A;  5LD2 C;  2EZK A;  3VFZ A;  1WJE A;  3GBG A;  3HBL A;  2EZL A;  4X6A J;  2XF6 A;  1PDN C;  2XKP A;  4G12 A;  5CPR B;  1HCR A;  2M34 A;  3CME I;  1J59 A;  1SD5 A;  4BXU A;  4ESB A;  2OCC H;  1X1A A;  5HDK A;  3WG9 A;  4PCQ A;  1VQL I;  2BW3 B;  2DO7 A;  2LY2 A;  4A3E J;  3HRT A;  2CG4 A;  3ERM A;  4CCK A;  2MW8 A;  3HYI A;  1T8I A;  3J7A O;  1X3U A;  2IS2 A;  3TO6 A;  2RDP A;  4XKV A;  2XKO A;  2E71 A;  5FO5 A;  1OLT A;  4HLX A;  1QGP A;  1B72 A;  1B8I B;  2L7K A;  3BR3 A;  4WXC A;  2NXN B;  3F22 A;  2KJC A;  4ETS A;  3F6V A;  4N4O B;  2N8G A;  4BS9 A;  3JRE A;  2DYR H;  1POG A;  3FMR A;  1JJ6 C;  1Z67 A;  4RAF A;  3H3V K;  2CFO A;  3GTJ J;  4LIU A;  5EZH A;  5JR3 A;  3EET A;  3H35 A;  3W3C A;  4H0E A;  4BDY A;  2QA4 I;  4BXX J;  3TDZ C;  2QGU A;  4P55 A;  5JFR A;  2EIJ H;  1U9O A;  1O3R A;  2PI0 A;  5K7F A;  3WTZ A;  3ZMT A;  3HOT A;  4A6E A;  3QP5 A;  4PGH A;  2R5Y B;  2M5W A;  3WU0 A;  2BZT A;  4PZJ A;  4U0Y A;  2QBY A;  3TW7 A;  1TT0 A;  2NAZ A;  3GLX A;  4BE1 A;  2Y69 H;  2ZJR F;  2LBF A;  1D8K A;  1TL8 A;  4I2O A;  2VQC A;  3BJO A;  2JA5 J;  4E7H A;  2Z9O A;  3BCB A;  2EBI A;  5HLG A;  1I27 A;  4G8X A;  4E70 A;  4A0Y A;  1JKQ C;  1NG7 A;  5HLH A;  1Z3X A;  5GTI C;  2HWV A;  1O3S A;  1UHS A;  2E1N A;  2R7O A;  4HG2 A;  2JRT A;  3HXL A;  1ZGJ A;  3E6C C;  1VQM I;  1YS6 A;  1JGG A;  1FBS A;  1YIO A;  3ONQ A;  1F36 A;  1YE9 A;  4IQ4 A;  4N0B A;  5IYD J;  1T56 A;  2HQR A;  1YJW I;  1FNN A;  4BJ5 C;  5CVU A;  3G6E I;  4A0X A;  3L9F A;  5KNL A;  4FTH A;  1V5F A;  3C2G A;  2ZJQ F;  4I02 A;  1HF0 A;  3HM5 A;  2HKO A;  5E17 F;  4A3L J;  1ON1 A;  2IT0 A;  3CUQ C;  4PFO A;  3R0A A;  3PO3 J;  4D0P A;  2MGQ A;  5K5O A;  3WGH A;  2F4M B;  3M8E A;  2BXZ A;  4KIT B;  2BW3 A;  1S29 A;  2IVM A;  4AID A;  3I9V 2;  1TZL A;  1WWX A;  3F6O A;  1R22 A;  3OS1 A;  4HST A;  3GZ6 A;  3FXR A;  4LK1 F;  4HW0 A;  5ICC A;  1F5T A;  3VYU B;  4ZH4 F;  3K10 A;  4DJA A;  1K4S A;  4ESJ A;  1GXP A;  3TL4 X;  2X51 A;  3Q0W A;  1ETO A;  2LFB A;  3HSR A;  5DD4 A;  2HR3 A;  2L5Q A;  5DUK A;  5F64 A;  5H6R A;  4BBR J;  5EGO A;  1JT0 A;  3BRO A;  1OYW A;  1LDK B;  2IS6 A;  3LWF A;  5D5V B;  3K70 C;  1F4K A;  2DFF A;  3SZT A;  2DW4 A;  1ORK A;  5D6F A;  1IRG A;  3ABM H;  1X1B A;  2QLZ A;  3HGY A;  2M1B A;  1IUF A;  3PQK A;  5EZG A;  4ENK A;  1YIT I;  1SMT A;  2RGV A;  3B02 A;  4MNU A;  3JRF A;  1HKT A;  2UUZ A;  2OAZ A;  3ZXS A;  1B9M A;  5F1J A;  1OCZ H;  2EPF A;  3KZZ A;  3F3X A;  3ZQQ A;  2FBH A;  3A0B C;  1I1G A;  4UUT A;  2KZV A;  3OS0 A;  2BY1 A;  3BT9 A;  5E3M A;  2L9V A;  3DEU A;  1FSE A;  2R5Y A;  2F5F A;  2H8R A;  1AA7 A;  4E7Z A;  4C30 A;  2Y9Z A;  3BR1 A;  2JPC A;  1H9T A;  3Q9S A;  3A01 B;  4FET A;  2UWM A;  2R7X A;  4G7Z F;  1WH5 A;  2HOA A;  4UV9 A;  2OTJ I;  1U2W A;  1VQO I;  2EIN H;  1JKR C;  2CJJ A;  3RKQ A;  1ERD A;  2JJ7 A;  2VQL A;  2NS8 A;  2JA2 A;  4D9J A;  1OCC H;  3HOX J;  1Y56 A;  1F43 A;  2FXA A;  3M07 A;  4ZYH A;  3RYR A;  3PIO F;  1SD4 A;  2RKH A;  5L3E A;  1N77 A;  1A31 A;  3HPH A;  4PJN A;  2DMP A;  2CGP A;  2HI3 A;  4YEJ A;  2D45 A;  1TWC J;  3RZO J;  4FE7 A;  4RGS A;  3CQZ J;  1XCB A;  5FRN A;  3E3V A;  1FPQ A;  5FGM A;  4BBS J;  5LRS A;  3S17 J;  2R7T A;  4W97 A;  2GA1 A;  4MFD A;  4EQQ A;  1D1B A;  2IA2 A;  2MA3 A;  2Z1D A;  4JYK A;  2PN6 A;  1O7F A;  1SFU A;  1HKQ A;  4NBQ A;  2VOP A;  3QYE A;  2A68 F;  1ZLJ A;  3RCO A;  2H8W A;  4CIC A;  1R58 A;  4KIB A;  4D5C A;  3VOE A;  1K6Y A;  4DNC A;  4BY1 J;  4E7K A;  3ZQF A;  2QEX I;  2OV7 A;  3ABL H;  5HLT A;  3L7W A;  3GTQ J;  3F23 A;  3REO A;  3SJM A;  4PFP A;  2HVR A;  2ID3 A;  3C1D A;  3I64 A;  5IP6 A;  5L3F A;  1LVK A;  4E7L A;  1P6R A;  3CUQ A;  5B1A H;  2B7E A;  5CVV A;  2HKX A;  2K9S A;  3KYL A;  4RB0 A;  3ZCO A;  2XAH A;  3FF5 A;  3H0G J;  4Y15 A;  3FKI J;  3KEO A;  4I0B A; 
#chains in the Genus database with same CATH homology
 4CZZ A;  1XGS A;  4LLG F;  3ZN1 A;  2GXB A;  2V1X A;  3I0T A;  2L4A A;  3I71 A;  2XRN A;  1ULY A;  2JPB A;  3DP7 A;  2OBP A;  3T8T A;  1FOK A;  1MD0 A;  1J7K A;  4XSZ F;  1ZAR A;  3HRM A;  4UHT A;  3LA3 A;  1LEB A;  1BI1 A;  3V4G A;  1G3T A;  1ON2 A;  2P7V B;  4OIR F;  1HSJ A;  2HEO A;  3I58 A;  1UHW A;  2VN2 A;  5LGU A;  4U7B A;  5LHG A;  3W6K B;  4PDK A;  3QU6 A;  2GQQ A;  4IXA A;  4KNY A;  1HST A;  1ODD A;  4KIG A;  3K69 A;  3MCZ A;  4Q4Z F;  2PLY A;  4I01 A;  3S2W A;  4M9X A;  5L3B A;  2JTV A;  1J5Y A;  3GO5 A;  3ZMS A;  2P6T A;  1B9N A;  1BOA A;  3FWE A;  3OOP A;  3GVA A;  5ILS A;  5H20 A;  2EV6 A;  2W24 A;  2K02 A;  3O2P E;  4JQF A;  3CDH A;  4MQ9 F;  3KLO A;  3G3Z A;  3ERE D;  1AOY A;  1FLI A;  5BPI A;  5DEQ A;  1G6N A;  4MEY F;  2HS5 A;  1BIA A;  4HYE A;  2WC2 A;  3DKW A;  4L0Y B;  3IWF A;  2KRF A;  5D5W B;  4M74 A;  2O0Y A;  2ELH A;  3RYP A;  3G73 A;  4M71 A;  5J8F A;  2A5Y B;  3J81 Z;  2PBI A;  4EGZ A;  1T98 A;  2P5V A;  1IZ1 A;  2NRA C;  3MZY A;  3TOB A;  1T6S A;  5K5R A;  2QEN A;  4ENJ A;  2O6G E;  4NHJ A;  3BDD A;  4HZF A;  3LFK A;  1IN8 A;  2G7H A;  2L4M A;  1YW9 A;  1XSV A;  5LGN A;  4RS8 A;  2NS0 A;  4HBL A;  5ILV A;  4U88 A;  1SMY F;  5HS7 A;  2DPD A;  1OMI A;  2P4W A;  4M6X A;  1YW7 A;  3FM3 A;  3N4M A;  5CVI A;  2H6C A;  2QUF A;  2BBY A;  3P7N A;  2G7U A;  4A0Z A;  3F8M A;  1W5T A;  3TDU C;  1T38 A;  4AVP A;  4CYD A;  1XGM A;  3KFW X;  4ZYG A;  5JVT A;  3HSE A;  3SQN A;  4FX4 A;  3L09 A;  4GYI A;  4A6D A;  1IRF A;  4K2E A;  2G9W A;  2VBX A;  2R7D A;  1P4W A;  4AIH A;  3E5U A;  4YIF A;  1FYL A;  5AIQ A;  1RUN A;  3DF8 A;  4HF2 A;  3IL2 A;  4EGY A;  1V3F A;  4LLL A;  4IJA A;  5CLS A;  3F8B A;  2ZKZ A;  2Q0O A;  4IHS A;  2XUB A;  2M8E A;  3CJN A;  4OMY A;  4F7Z A;  3ECH A;  3HRU A;  4OOI A;  3K1P A;  4R79 A;  1BI2 A;  2PFB A;  3F8F A;  4EM2 A;  4WCG A;  3HUG A;  3EYY A;  2K4B A;  2FNA A;  2MBF A;  3C3W A;  2NNN A;  1Z6R A;  2EK5 A;  5HDG A;  2ZNZ A;  5D5X B;  5HS8 A;  4RB2 C;  2W84 A;  1IN5 A;  1T39 A;  1MJB A;  3WGI A;  2VT3 A;  3QPT A;  3TO9 A;  1YS7 A;  2MC3 A;  3RPQ A;  2HDC A;  2YX7 A;  3JTH A;  4EJV A;  1J9I A;  2GA2 A;  4YFK F;  1CGP A;  4OIQ F;  2DK8 A;  1J0R A;  2LNB A;  4UVB A;  4Q5S F;  4ESF A;  1JGS A;  2ADU A;  1QO0 D;  1ZN2 A;  4Z2Y A;  4CHU A;  2DLL A;  2F5E A;  1LDD A;  2Z33 A;  4EJW A;  1W7P B;  2F5D A;  3WOD F;  1MDM B;  2Y48 A;  1E2X A;  2IA0 A;  1SAX A;  2D1H A;  4HDU A;  1XB4 A;  2RV8 A;  4KIF A;  3W6J B;  5LBQ A;  3E5X A;  2E7X A;  5JHU A;  4HF0 A;  3J81 K;  1IXR C;  4L18 B;  3E6M A;  1EH6 A;  1WI9 A;  3V8J A;  1EH8 A;  3P9I A;  2EFQ A;  2IP2 A;  4EMS A;  3WTX C;  4XSX F;  4O3M A;  2QYO A;  2HOE A;  4KA4 A;  1TQI A;  4FHT A;  3U2R A;  3KP7 A;  3QU3 A;  3GX4 X;  3ROU A;  2BYV E;  3D0S A;  3MAJ A;  1WSU A;  1J75 A;  3CUO A;  4RAZ A;  4WF2 A;  3BWG A;  5ICE A;  4IPA A;  2NYX A;  3ISP A;  1UHM A;  2HQN A;  4U7D A;  4QWQ A;  2OZ6 A;  1BC7 C;  2MH9 A;  1K78 B;  1R1T A;  2Q2E A;  5E8G A;  3WTT C;  4BQA A;  4LFU A;  4UVC A;  2ESH A;  1PP8 F;  1TW2 A;  4HX8 A;  1W7P A;  3GFM A;  4PGG A;  1R7J A;  3LQQ A;  2PJP A;  1O3T A;  1KQ9 A;  1W5S A;  4G7H F;  5A2Q Z;  3DFG A;  2Q8K A;  3PFI A;  5LEK A;  4BHC A;  3IWZ A;  1PUE E;  5FB2 A;  1IN6 A;  5D5U B;  3RIR A;  3EDP A;  2YPR A;  2CSO A;  4ZYD A;  2PQ8 A;  3BJ6 A;  3I4P A;  3K2Z A;  5D6E A;  5HVQ C;  2H94 A;  4ZZD A;  3ZMU A;  5L3C A;  1TQM A;  1JHF A;  3K9T A;  2W25 A;  3M9A A;  1A04 A;  2UXN A;  2PG4 A;  1TTY A;  1I1S A;  1KU7 A;  2P5L C;  2H27 A;  2QWW A;  4HX4 A;  1ZGA A;  2EFO A;  2PEX A;  2GAU A;  2STT A;  5EEH A;  1KGS A;  3IRR A;  4OU0 A;  3KZY A;  4RB1 A;  3M7G A;  1G4D A;  1U78 A;  1GXQ A;  1K78 A;  1DP7 P;  3NRV A;  1K7A A;  2JZY A;  2GWR A;  4HA8 A;  3FX3 A;  3GWZ A;  1OR7 A;  2IRF G;  4YG2 F;  4EJO A;  1TBX A;  2JT1 A;  1XDU A;  3HSF A;  3WE2 A;  4ZZL A;  3JSP A;  2WTE A;  3RJP A;  1MJ9 A;  3FMQ A;  5DUI A;  3BP8 A;  4LD5 A;  3SXY A;  1B1B A;  1BI0 A;  4MTE A;  1WQ2 A;  3NEU A;  4WXD A;  1P4X A;  5FD5 A;  1S8N A;  1TLH B;  3V8L A;  4G94 A;  1HQC A;  1PP7 U;  3VB2 A;  3MFK A;  4RGU A;  3HTS B;  5AIP A;  1XSD A;  4A5N A;  4EJT A;  1IXC A;  4JK1 X;  2HZT A;  3V8K A;  2DK5 A;  2YX4 A;  4L9N A;  4BHB A;  4Q47 A;  1S6L A;  2HYG D;  5DDG A;  3JAM Z;  3GEZ A;  2ETH A;  2ZBK A;  1KYZ A;  5BQT A;  4I09 A;  1F1Z A;  1ZG5 A;  5TRD A;  1FBQ A;  1QQI A;  4GO1 A;  1I6X A;  4XBF A;  3R6S A;  4UVA A;  4MQV A;  1O57 A;  1P92 A;  2DBB A;  3FHZ A;  2FE3 A;  3IC7 A;  4UUV A;  4WK8 F;  3MZH A;  2KIF A;  1R5G A;  2TDX A;  1SFE A;  3U9G A;  2ZNY A;  1L0O C;  1YTY A;  3MEX A;  4HOB A;  2HTS A;  1MGT A;  4QLC U;  1ZLK A;  3M8F A;  2V9V A;  4P5O A;  1VTN C;  3RKY A;  3RKW A;  2GXG A;  1R00 A;  2MD5 A;  3TOA A;  2IPQ X;  4WXH A;  4FX0 A;  3WTU C;  4KDP A;  2VBW A;  2OQG A;  3IKT A;  2D1V A;  5BMZ A;  1YO5 C;  4L5J A;  4CGZ A;  3B73 A;  1ZRC A;  1FT9 A;  5A2Q K;  2CW0 F;  2O3F A;  4AIK A;  3E97 A;  2DFI A;  3L2C A;  2RNJ A;  1HW2 A;  1SD6 A;  2ZME B;  2DTR A;  2P7C B;  2VE9 A;  2C6Y A;  2ZO4 A;  1KQ8 A;  1W7P D;  2COM A;  4BH9 A;  4LGW A;  4CXF A;  2DU9 A;  2QZ8 A;  1IN4 A;  2A3S A;  1QZY A;  1IXS B;  1FBU A;  2JSC A;  2FML A;  1BBY A;  2RVC A;  5FLX Z;  2E7W A;  1H9G A;  2RQP A;  1HBX G;  5ERI A;  4HF1 A;  3RPU A;  2DT5 A;  5D4S A;  2IW5 A;  2XAS A;  4XRF A;  1B6A A;  3CTA A;  2W85 A;  3V7R A;  2XVC A;  2EWN A;  5K1Y A;  2RC4 A;  2DAO A;  1QZZ A;  3HHG A;  4JBA A;  2KKO A;  2EJR A;  1BI3 A;  2R7F A;  1ZRD A;  1B59 A;  5CVR A;  4HX7 A;  1P4A A;  4BHP A;  1AWC A;  1IF1 A;  5ICF A;  2O03 A;  2VOO A;  5D8K B;  3ML6 A;  1U6G A;  1ZRF A;  3TGN A;  1HXD A;  1Z91 A;  1LDJ A;  2V1U A;  1IN7 A;  1LEA A;  4U0W A;  2XAQ A;  2HTJ A;  3QAH A;  1HKS A;  4AIJ A;  2P8T A;  4I7H A;  4LMY A;  1WRJ A;  3RDI A;  2K7L A;  2ZJ2 A;  5E20 A;  3LA7 A;  3JAM K;  6PAX A;  5DV5 A;  3ULQ B;  4L9T A;  3E6D A;  1SD7 A;  2KJB A;  2DQR A;  4CO8 A;  2XAF A;  1ZAO A;  1MZB A;  2LKP A;  1USS A;  3ZN0 A;  2EFP A;  3WTW C;  4P9U A;  2XGX A;  2EFW A;  3BPX A;  3GUD A;  2LDU A;  2B0L A;  4EM0 B;  2ISZ A;  1FP1 D;  2OA4 A;  3EQL F;  3LST A;  3I59 B;  2R3S A;  5BPD A;  4G9Y A;  1LB2 A;  2XV4 S;  5FD6 A;  4MTD A;  2LSO A;  4HDV A;  4KMF A;  4LG0 B;  2O8X A;  3BZ6 A;  1Q1H A;  4GYG A;  4RB3 C;  4L9V A;  3EYI A;  2ACJ A;  3KE2 A;  3VEP A;  3ECO A;  3BPV A;  1ZYR F;  3H92 A;  1KYW A;  3LA2 A;  4ASN A;  2L02 A;  1FX7 A;  5FFZ A;  3H3Z A;  3LAP A;  1TW3 A;  1Z7U A;  4AWX B;  1OKR A;  4BAY A;  3JTG A;  3KP2 A;  1U8R A;  4NB5 A;  2CQK A;  4IRH A;  2A6H F;  1S7A A;  2H6B A;  3QPH A;  3HHH A;  4HQE A;  4KN7 X;  3RKX A;  2FRH A;  1S3J A;  4L0Z B;  4GGG A;  2XAJ A;  4KT5 C;  2AXL A;  3GYH X;  3BY6 A;  4YFX F;  5IT3 A;  2A61 A;  3FXQ A;  2V1D A;  2F2E A;  4ENN A;  5FLX K;  1ZG3 A;  1XN7 A;  3LQR A;  1ZHF A;  3IRQ A;  1U5T C;  3F8N A;  2FMY A;  4N9H A;  2QBY B;  1G3S A;  1TNS A;  5CYV A;  4GCV A;  1KQ0 A;  5F6F A;  3GFL A;  5ED4 A;  2F5C A;  1FZP B;  3F21 A;  5LGT A;  1KA8 A;  1U5T B;  3DXJ F;  2EFN A;  4KIC A;  3D5L A;  1LNW A;  2AS5 F;  3ZMZ A;  4G6Q A;  4M9Z A;  2OD5 A;  2XHK A;  4OMZ A;  5LRR A;  1JHH A;  2QQA A;  4R1H A;  2QQ9 A;  3HTU A;  1HW5 A;  4G6D A;  2K4J A;  2BE5 F;  2IJL A;  4MHG A;  2UZK A;  4O5V A;  3COA C;  2PMH A;  1O3Q A;  1TQP A;  1RNL A;  3GXO A;  3P9C A;  2VT2 A;  2P6S A;  1EH7 A;  4ENM A;  2ESN A;  1I5Z A;  1W4M A;  3C7J A;  1MDM A;  1XDS A;  1FP2 A;  4BNC A;  4DQ2 A;  3FXU A;  2Y0M A;  4B8X A;  3R61 A;  2K86 A;  2V6C A;  4RGX A;  1XCV A;  4A5M A;  4EV0 A;  4KUM A;  1OYI A;  1KU2 A;  1T0F A;  2FBI A;  3V7S A;  2FA5 A;  4LK0 F;  5AON A;  5L3D A;  3FZV A;  2CFX A;  3T1B A;  3I53 A;  1Z05 A;  4UV8 A;  4GXO A;  4XLP F;  1U5T A;  3WGG A;  2CO5 A;  1GVJ A;  1S7O A;  4OIP F;  3Q9V A;  2FF4 A;  5E18 F;  5DYM A;  3R60 A;  5ILU A;  1IW7 F;  3KET A;  3HRS A;  1BN5 A;  4KMU X;  3U1D A;  3MWM A;  1FY7 A;  3KP5 A;  3GFI A;  1EV7 A;  5ICG A;  4O6J A;  1YYV A;  2O61 A;  2VE8 A;  4IHT A;  5LLQ A;  1K79 A;  3CUQ B;  1MJA A;  5K5Q A;  3EUH A;  2EV5 A;  5BOX A;  1JE8 A;  2FEZ A;  4S04 A;  1YFH A;  4A2U A;  5CJ9 A;  5DCM B;  1FYK A;  2WV0 A;  2KIU A;  1QNT A;  2FNP A;  2E1C A;  1O7L A;  5TJJ A;  1WKM A;  3T5X A;  3AAF A;  4RGR A;  4I0A A;  1RIO H;  2WWY A;  3GW2 A;  1NHA A;  5JI6 A;  1FC3 A;  5KK1 A;  3T0Y A;  4NQW A;  2P5K A;  1XSX A;  5LHH A;  2A07 F;  4HLY A;  2CWE A;  2YR2 A;  4OIO F;  5LEJ A;  2Z99 A;  4IRI A;  1XGN A;  1FWZ A;  5E1X A;  4EM1 A;  2QQB A;  2Z3Y A;  2KIM A;  2OU2 A;  1LVA A;  3T8R A;  4LJZ F;  3GZ5 A;  2XRO A;  2Z5U A;  4ON0 A;  2HYF A;  4YFN F;  5E8I A;  3R0J A;  2EV0 A;  4S05 A;  4G7O F;  2V79 A;  4A12 A;  3MQ0 A;  5DCF A;  1UST A;  1U3E M;  2M87 A;  3O6B B;  5KVR A;  3ELK A;  2VXZ A;  3QOP A;  4P96 A;  3JSO A;  2VOD A;  4EJU A;  2MLK A;  3KEQ A;  1BIB A;  5D4R A;  5DCM A;  1RUO A;  2FQ3 A;  1C0W A;  1BJA A;  4Y13 A;  2VBY A;  2FOK A;  2L01 A;  4U0V A;  3OV8 A;  3PQJ A;  1STZ A;  2A6E F;  3I54 A;  3RTR A;  2H09 A;  3RI4 A;  4LB6 B;  3WTV C;  5E1Z B;  2RN7 A;  2ZCW A;  3CO6 C;  3BOQ A;  3N97 A;  1IUY A;  1UFM A;  3NQO A;  1MKM A;  4UXN A;  1V4R A;  4XLN F;  1TNT A;  2CYY A;  1K6O A;  1UCR A;  1L3L A;  1DPR A;  3I5U A;  4KN4 X;  2UXX A;  5IT9 Z;  3DQV C;  4UNO A;  4HV5 A;  3ZPL A;  4IRG A;  1RI7 A;  2BV6 A;  1ONV A;  2GIV A;  3IHU A;  1ZG1 A;  2DI3 A;  1FSH A;  2LF8 A;  5HDN A;  1KU9 A;  4OIN F;  5DD8 A;  5F1R A;  1XD7 A;  2VBZ A;  2VC0 A;  1YW8 A;  1UB9 A;  2J5P A;  4L9J A;  2X0L A;  3VOD A;  2YU3 A;  3J80 Z;  2GZW A;  4WWC A;  3E5Q A;  5EEG A;  1BC8 C;  2ISY A;  2Y75 A;  3QP6 A;  1YLF A;  2D2W A;  1OYY A;  3KLN A;  5FFX A;  2EA4 A;  4MGR A;  1XGO A;  5HS9 A;  1D8J A;  4M73 A;  3Q5F A;  3V7C A;  2X4H A;  2K27 A;  2QVO A;  2J5O A;  3M1E A;  3DPL C;  3F8C A;  4B09 A;  4N9I A;  2EB7 A;  3IKV A;  3DV8 A;  5J6X A;  1YG2 A;  2DQL A;  5HLI A;  1DUX C;  2ZME A;  4CDG A;  2XAG A;  5HOO A;  1IAW A;  3GF2 A;  1R1U A;  3KP4 A;  2VON A;  3SFZ A;  2MH2 A;  2BGC A;  2YSR A;  4EVI A;  3TKY A;  1HW1 A;  1R1V A;  2HGC A;  2FU4 A;  1DPU A;  2L3D A;  3E6B A;  1D3Y A;  3WTY C;  4Y17 A;  1P2F A;  1QBJ A;  1GHC A;  3P9K A;  5L3G A;  3CO7 C;  1CF7 B;  3WU1 B;  2BEO A;  3HIF A;  3SHF A;  3ZQ7 A;  1REP C;  3LAJ A;  3FM5 A;  4M9S A;  3H3U A;  1KU3 A;  1ZRE A;  2VC1 A;  3FMS A;  3ZMD A;  2EA2 A;  3SZP A;  4IF4 A;  3TQN A;  4M6Y A;  2L54 A;  2NNY A;  2QM3 A;  2ZXJ A;  4LB5 A;  1H0M A;  2MLG A;  1SFX A;  1XMA A;  1QPM A;  1E17 A;  2LF7 A;  5LHI A;  4I98 B;  1DDN A;  1J2X A;  3WE3 A;  4TV7 A;  3ZP5 A;  1G3Y A;  4KYW A;  3ABU A;  5J8C A;  5D8L B;  3L00 A;  4IVN A;  1Y0U A;  1R5H A;  4L5I A;  4RAY A;  3ZMV A;  4WX9 A;  1ZH5 A;  1Z1D A;  5CVJ A;  3K1N A;  3C18 A;  5BS6 A;  2XIG A;  4M72 A;  2IA1 A;  2OZU A;  4FT8 A;  5IT9 K;  3HOS A;  3GFJ A;  5E1W A;  2DPU A;  3TO7 A;  3JW4 A;  4HAM A;  1FYM A;  2M30 A;  3R4K A;  1CF7 A;  2ZFW A;  1Z6T A;  1F9N A;  1R23 A;  3KP3 A;  1D5V A;  4YII A;  2W57 A;  3K0L A;  1Z9C A;  4LLN A;  3KCC A;  2STW A;  2OQR A;  3I59 A;  1YQA A;  2A69 F;  3BJA A;  4Q48 A;  1T2K A;  1G3W A;  4KFC A;  1LJ9 A;  4ZYE A;  2HFH A;  3DPT A;  4LG0 A;  3QRF F;  3J80 K;  2FBK A;  1OPC A;  1RZ4 A;  3CLO A;  4MEX F;  3KP6 A;  1XMK A;  3ABT A;  2PMU A;  4HQM A;  1R36 A;  3K1M A;  1JXS A;  1B4A A;  4HV6 A;  5H6Q A;  3F72 A;  3WTS C;  4P9F A;  4AD9 A;  1LQ1 A;  2FSW A;  4BYY A;  1BM9 A;  3O3K A;  2M45 A;  4R8H A;  3VFZ A;  1PDN C;  2XKP A;  1J59 A;  1SD5 A;  4BXU A;  4ESB A;  5HDK A;  3WG9 A;  4PCQ A;  2DO7 A;  3HRT A;  2CG4 A;  3HYI A;  3J7A O;  1X3U A;  3TO6 A;  2RDP A;  2XKO A;  5FO5 A;  4HLX A;  1QGP A;  4WXC A;  3F22 A;  2KJC A;  4ETS A;  3F6V A;  3FMR A;  5JR3 A;  3EET A;  4H0E A;  3TDZ C;  4P55 A;  5JFR A;  1O3R A;  2PI0 A;  3WTZ A;  3ZMT A;  3HOT A;  4A6E A;  3QP5 A;  4PGH A;  2M5W A;  3WU0 A;  4U0Y A;  4PZJ A;  2QBY A;  2NAZ A;  3GLX A;  1D8K A;  4I2O A;  3BJO A;  2Z9O A;  5HLG A;  1I27 A;  4G8X A;  4E70 A;  4A0Y A;  5HLH A;  2HWV A;  1O3S A;  2E1N A;  2JRT A;  1ZGJ A;  3E6C C;  1YS6 A;  1FBS A;  1YIO A;  4N0B A;  2HQR A;  1FNN A;  5CVU A;  4A0X A;  3L9F A;  4I02 A;  2HKO A;  5E17 F;  1ON1 A;  2IT0 A;  3CUQ C;  3R0A A;  4D0P A;  5K5O A;  3WGH A;  3M8E A;  1S29 A;  2IVM A;  1WWX A;  3F6O A;  1R22 A;  3GZ6 A;  3FXR A;  4LK1 F;  4HW0 A;  5ICC A;  1F5T A;  4ZH4 F;  1GXP A;  4ESJ A;  5DUK A;  3HSR A;  5DD4 A;  5H6R A;  2HR3 A;  5F64 A;  3BRO A;  1OYW A;  1LDK B;  3LWF A;  5D5V B;  1F4K A;  3SZT A;  2DW4 A;  5D6F A;  1IRG A;  2QLZ A;  2M1B A;  3PQK A;  4ENK A;  1SMT A;  2RGV A;  3B02 A;  4MNU A;  1HKT A;  2OAZ A;  1B9M A;  3KZZ A;  3F3X A;  2FBH A;  1I1G A;  3DEU A;  1FSE A;  2F5F A;  2JPC A;  1H9T A;  3Q9S A;  2UWM A;  4G7Z F;  4UV9 A;  1U2W A;  2FXA A;  4ZYH A;  3RYR A;  1SD4 A;  2RKH A;  5L3E A;  2CGP A;  2D45 A;  4RGS A;  1XCB A;  3E3V A;  1FPQ A;  5FGM A;  5LRS A;  2GA1 A;  4EQQ A;  2IA2 A;  2MA3 A;  2PN6 A;  1O7F A;  1SFU A;  1HKQ A;  2VOP A;  2A68 F;  1ZLJ A;  4CIC A;  1R58 A;  4KIB A;  3VOE A;  4DNC A;  3L7W A;  3F23 A;  3REO A;  3C1D A;  3I64 A;  5L3F A;  1P6R A;  3CUQ A;  5CVV A;  2HKX A;  4RB0 A;  2XAH A;  3FF5 A;  4Y15 A;  3KEO A;  4I0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...