1T6SA

Crystal structure of a conserved hypothetical protein from chlorobium tepidum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
b'MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of ScpB from Chlorobium tepidum, a protein involved in chromosome partitioning.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA02
3I64A 4NHJA 1QNTA 1ZRFA 3S2WA 1Q1HA 2XASA 3WGHA 2FE3A 1UHMA 3WU1B 4XSXF 4YFXF 3WTSC 4UV9A 3C3WA 2XAHA 3LFKA 2ISZA 1C0WA 5E20A 4KN4X 4O5VA 3IWFA 4P9UA 3M1EA 4MTDA 3RPQA 3IRRA 1U6GA 2NYXA 3V8KA 2RKHA 4G7HF 5ICFA 4ENNA 2M1BA 3QU6A 4R1HA 4BHBA 2FSWA 5H6QA 1U3EM 1R23A 1MGTA 2H6CA 4AVPA 2PQ8A 3N4MA 2V6CA 5CJ9A 2GA1A 3TO7A 3KEQA 2VT2A 1MJAA 3IHUA 1B1BA 5HVQC 4UVAA 2M45A 1K79A 3I4PA 1IXCA 3FHZA 5JR3A 3OOPA 3KP6A 3L2CA 1DDNA 5LEJA 1Z6TA 2XRNA 1U78A 4MNUA 2V1XA 5J8CA 1S7OA 2VOOA 4EM0B 2ZCWA 4LFUA 2F2EA 1YW9A 5LBQA 1T98A 2PMUA 3BZ6A 3WTTC 4ENKA 4DQ2A 2RN7A 3M9AA 3JSOA 5TJJA 1I5ZA 3Q9VA 3VFZA 4P5OA 5FGMA 2K86A 4BNCA 1T38A 1A04A 4EJVA 5IT9Z 1P6RA 3REOA 1K78A 2QWWA 2KJCA 4GYGA 4EM1A 3SQNA 2IPQX 2O03A 3C1DA 5AIPA 4IRIA 5ED4A 3B02A 1JE8A 2EFOA 1R58A 3EUHA 3WTWC 3LQRA 1ULYA 2OD5A 1R36A 2HR3A 1FNNA 1YS7A 4U0YA 4HBLA 3I71A 3SZPA 5DD8A 4AWXB 2A6HF 3J81K 4N9HA 2QBYB 2JPBA 3HSFA 1Z6RA 4WXCA 4JK1X 3ECHA 2L54A 2CWEA 3CTAA 4RGUA 5CVJA 5DCMB 5H6RA 4HYEA 2A61A 2GIVA 3HRSA 1YO5C 4Q4ZF 1P92A 1MDMA 3F21A 2DU9A 2XVCA 3ZN0A 4ZYGA 4WX9A 1CF7B 5D6FA 5E1XA 2LF7A 3FF5A 2XKPA 1XSVA 5KVRA 2OQGA 3R6SA 3W6JB 4A0ZA 3E6CC 3T5XA 3IWZA 1P4XA 3CUOA 1SFUA 2RVCA 4M71A 4L0ZB 2Y75A 1SMTA 3I59A 1PUEE 1XGSA 5FFZA 4Z2YA 2K02A 2BBYA 1GXQA 3NQOA 2M8EA 4RGSA 3BJ6A 3IL2A 1ZLKA 2HDCA 4RB3C 5HDNA 4EVIA 3FXRA 1R1UA 4YFNF 1P4WA 4KUMA 3K9TA 3F6VA 3GW2A 5BS6A 4CXFA 1KU9A 1S29A 1J7KA 1P2FA 4M72A 1K6OA 2V1UA 2EFPA 5CLSA 2WC2A 4BQAA 4D0PA 1SD5A 2VE8A 2L01A 1ZGJA 1B59A 5J6XA 4RGRA 1O3QA 4RAYA 3W6KB 2V9VA 1FPQA 4KMUX 1OYWA 1KYWA 4BHCA 3ZMSA 2D45A 3BWGA 5FO5A 4KICA 1XSXA 1IN7A 1HKSA 5E18F 1LDDA 4BAYA 3GX4X 3VB2A 1LNWA 1Y0UA 4ZYDA 5E1WA 1R5HA 4G8XA 3PQJA 4OU0A 1ON1A 1ONVA 2PBIA 1TTYA 3B73A 1H0MA 4L0YB 3HYIA 1QBJA 2CFXA 5L3BA 4BXUA 2P7CB 3WGGA 1I1SA 1KU3A 4WWCA 4S05A 2PJPA 1MJBA 2HQNA 4N9IA 1RUNA 3MQ0A 3ISPA 2COMA 3GEZA 1TW2A 1J75A 4UXNA 2O3FA 1AWCA 4FHTA 1TW3A 2GAUA 2FQ3A 4I09A 2K4BA 3GFMA 4EJOA 3GYHX 5HLIA 2J5PA 3HHHA 1UCRA 2IJLA 2AS5F 1YIOA 1IXRC 2ZNZA 2ZMEB 4MHGA 4ON0A 1S7AA 5TRDA 2OZUA 5LGNA 1LDKB 2NRAC 2EFWA 4HF2A 3I53A 2KIFA 3DEUA 4WXDA 3I58A 3RYRA 2M5WA 4I02A 2EWNA 2JTVA 3V7SA 2NNNA 2DW4A 5HDGA 1IRGA 2EJRA 3V4GA 1ZG5A 2VONA 3P9KA 1JGSA 4OMZA 3QOPA 2VE9A 1EV7A 1HBXG 4M6XA 3T8RA 1IRFA 4HF0A 1DP7P 2R7FA 3BOQA 1GHCA 1HKTA 3QP6A 5K5RA 3GVAA 1LEBA 1QQIA 1SD6A 1F9NA 4HDUA 4S04A 1SAXA 1IF1A 3E6MA 3MAJA 3KE2A 3SFZA 4IPAA 4XRFA 4PDKA 3HRUA 5ICEA 4FX0A 3WE2A 1Z1DA 2G7UA 4XLPF 1R5GA 2A3SA 3BROA 2P6TA 2AXLA 3H3ZA 4G7ZF 3IC7A 3J81Z 2HS5A 2PEXA 1G3YA 4IF4A 1PP8F 2IP2A 1IUYA 4R8HA 4LG0A 3V8LA 1IW7F 3RIRA 3U1DA 2XKOA 1F1ZA 4CYDA 4UVCA 3F22A 1QZZA 3WTUC 4EGZA 4UV8A 1BM9A 2EK5A 1DPRA 3P9IA 2HFHA 2KKOA 3L7WA 5LLQA 2O8XA 2QVOA 4N0BA 2CG4A 4WF2A 4RB0A 4EQQA 2XV4S 5E17F 1AOYA 2CQKA 1R00A 1BC8C 2RNJA 1KA8A 2GA2A 1UHWA 2Y48A 2PG4A 2UXNA 3O3KA 3LQQA 3CO6C 1XMKA 3HTSB 3GWZA 5HLGA 1W5SA 3DV8A 3ROUA 3D0SA 2L4MA 2Z99A 2RQPA 1YW7A 2YX7A 4HF1A 1Z7UA 1TNSA 2X4HA 5AIQA 4LLGF 1FP2A 1ZREA 1FP1D 1FSHA 4RGXA 4IHSA 3I0TA 4LD5A 2GQQA 4XLNF 3WG9A 5FLXK 3K1PA 3N97A 3C7JA 2GWRA 4AIKA 2ZKZA 2VT3A 4P96A 3H92A 2NS0A 5LGTA 4H0EA 4RS8A 2OQRA 2VC1A 3ERED 2YR2A 1L3LA 4IHTA 3CLOA 1OKRA 2P5KA 5DV5A 2MH2A 4Y15A 1UB9A 1O57A 2PFBA 4HW0A 2C6YA 2HKXA 2QM3A 3GZ5A 4Y17A 2DK5A 1ZN2A 3QP5A 1MKMA 3KP7A 2B0LA 5HOOA 1R22A 2W25A 2EV0A 1J0RA 5ILUA 3J80K 5D4SA 1G3WA 5E8IA 2H09A 1B4AA 1ZYRF 4MGRA 1KQ8A 1W7PA 2YSRA 1UFMA 5ICGA 5A2QK 5D5UB 4KIBA 1FWZA 3DPLC 4A0YA 4A5NA 3RPUA 3E3VA 3R0JA 3IKVA 2WV0A 2QLZA 2V79A 3KZYA 2DK8A 4BH9A 4U7BA 3K69A 2QBYA 3HSRA 2MC3A 4KNYA 5EEHA 2QENA 1O7LA 2QQAA 3E6DA 4HX4A 4L9NA 1XSDA 3T0YA 2H94A 1XGMA 4A6DA 1FC3A 3IRQA 2UWMA 1FT9A 2VBWA 2XHKA 3LAJA 3ZP5A 2VC0A 1VTNC 2XAQA 4JBAA 3E5XA 3PFIA 2F5EA 3ULQB 3WU0A 1W5TA 2ZFWA 3R60A 1XCVA 4U0WA 4KIFA 3DKWA 4WXHA 3BP8A 4Q47A 4RB1A 3QRFF 1BIBA 1R1VA 1OYYA 4HA8A 3FMSA 1K78B 2JZYA 1KU2A 2Q8KA 3K1MA 3E97A 3F8CA 3G3ZA 2PLYA 5CVIA 1DPUA 4ASNA 2GXBA 1LQ1A 2A5YB 3HHGA 1FSEA 1ZG1A 1SD7A 5JHUA 1SD4A 3O6BB 2FA5A 1G4DA 4MEXF 1BJAA 1XB4A 1ZRCA 4B8XA 4I98B 4UHTA 4ENMA 2Z33A 1Z91A 2BEOA 3ABTA 4MTEA 2WWYA 2ESNA 2EV6A 3FM3A 2NNYA 3R4KA 2HGCA 1MDMB 3ZMZA 2FMLA 1D8JA 2R3SA 4I7HA 3WE3A 2FEZA 4AIJA 1MZBA 4OIQF 1T0FA 1RI7A 4BHPA 5JFRA 2BYVE 3P9CA 1O7FA 3ZPLA 4R79A 3CUQB 3MZHA 1SMYF 2P6SA 2VN2A 4LK1F 2W85A 4FX4A 4HQEA 1WSUA 3ZN1A 1YG2A 4HLYA 1TQPA 2HYGD 2FNPA 4PGHA 1IXSB 1HQCA 4PCQA 5JI6A 2RV8A 4OIRF 3WTXC 4M9ZA 1YQAA 1BN5A 1B9MA 2QQ9A 4OIPF 1ZHFA 3HOTA 2EA4A 4U0VA 1W4MA 3LA3A 4CZZA 2K4JA 3QAHA 1WRJA 1G3TA 2Z3YA 3GUDA 3ZQ7A 3TGNA 2UZKA 5BPIA 4P55A 3DFGA 4M9XA 1TLHB 3ABUA 2FOKA 3KP3A 1FLIA 2F5DA 3DP7A 5CVRA 2OAZA 2BE5F 2ZMEA 2QQBA 4EJTA 4ZH4F 3BDDA 4XSZF 5L3EA 1YFHA 1IAWA 2P4WA 2ADUA 2EFQA 2LF8A 3ECOA 1KU7A 2DQLA 3IKTA 5HLHA 2EB7A 5L3CA 2CW0F 2OU2A 1O3TA 3BY6A 5L3FA 3F23A 4BYYA 1TNTA 5BPDA 3PQKA 4Y13A 1ZGAA 3V7RA 5IT9K 3Q9SA 3KCCA 5FB2A 3F8NA 1BOAA 3OV8A 3KEOA 3BPXA 2BV6A 2KIMA 3V8JA 3VEPA 3D5LA 2PN6A 4MQ9F 1QGPA 4OOIA 1WKMA 4EM2A 2LNBA 4RB2C 5F64A 2V1DA 1FYKA 1BBYA 4I0AA 4YIIA 2IW5A 2IA2A 1GVJA 1RNLA 5LHGA 4XBFA 1XD7A 1USSA 5D5WB 3RJPA 5HS8A 1USTA 1IN8A 2A68F 2G7HA 3RTRA 4LJZF 2FMYA 5E1ZB 1V3FA 3U2RA 4YIFA 4ETSA 1OYIA 2O6GE 2DBBA 2O0YA 3GFJA 4UNOA 1L0OC 2XAJA 1GXPA 4HOBA 2HOEA 1T39A 2E7WA 1HW5A 2DT5A 2HTSA 1MD0A 1WI9A 5DUIA 1YW8A 2IT0A 1YTYA 3H3UA 2YX4A 3JTHA 3CO7C 2TDXA 1YS6A 2P8TA 4OIOF 4HX8A 2DAOA 2BGCA 4U88A 3I54A 3RKXA 2A07F 1TQIA 4HZFA 2IRFG 4G7OF 2XROA 2DFIA 4G6DA 2P5LC 2Q0OA 3GLXA 2HKOA 2VBYA 3QPHA 1I6XA 1BIAA 4IXAA 1SFEA 5D5VB 4I2OA 3BPVA 3KETA 3TKYA 4GGGA 3KLNA 1LVAA 5DYMA 3F8BA 3CJNA 4A5MA 3TO6A 2HWVA 4DNCA 1SFXA 2LSOA 1ZH5A 3ZMDA 3TOAA 4OINF 2M87A 4TV7A 1H9TA 5DDGA 1RZ4A 3MFKA 2QZ8A 4IJAA 2L3DA 1V4RA 1JHFA 2JT1A 3JSPA 1FZPB 1I1GA 4HX7A 4A12A 1BI2A 1OR7A 3GFIA 4HQMA 1FBSA 1WQ2A 2IA1A 1IZ1A 2ESHA 1U5TB 4GCVA 4GYIA 1ZAOA 3CUQC 3QPTA 5AONA 2OZ6A 1R1TA 6PAXA 3FM5A 3HTUA 1OMIA 2E1NA 3KP4A 4CGZA 1JXSA 2ETHA 3KP2A 3VOEA 3T1BA 2DQRA 1TBXA 4HLXA 1LDJA 5IT3A 3F3XA 3FX3A 2EV5A 2IA0A 1D5VA 4M9SA 4YFKF 2FRHA 1HW2A 4GXOA 5F6FA 2K27A 3K2ZA 4ZZLA 3SZTA 4LLLA 4LK0F 5H20A 1O3RA 2L02A 2ISYA 2PMHA 2A69F 2KRFA 1E2XA 2Z9OA 3TDUC 2HQRA 1R7JA 3L00A 1BI0A 2W24A 4CO8A 3COAC 1G3SA 1E17A 2HYFA 5ILVA 2XGXA 1KYZA 1J2XA 1HW1A 4PGGA 2X0LA 4L5JA 1PP7U 2VBXA 1ODDA 4G6QA 1FYLA 2STWA 1JHHA 4LLNA 1QZYA 1IN4A 4HDVA 2MH9A 2XIGA 2ELHA 2VXZA 1U8RA 5FD6A 3SHFA 2UXXA 5K5QA 5CVVA 1HKQA 2XAFA 4LB5A 3RKWA 1W7PD 4L9TA 5DCMA 3MZYA 5ERIA 4KYWA 1F4KA 2ZXJA 3WGIA 4IRHA 1W7PB 3F8MA 1CF7A 4HAMA 1X3UA 2RC4A 1HXDA 5DUKA 2FBKA 3LAPA 2FBIA 2R7DA 3J7AO 3JAMK 1FYMA 3WTYC 4G9YA 4M74A 4B09A 2ZBKA 3WODF 5LRRA 2D1VA 2XAGA 3RDIA 2KJBA 5E8GA 1ZG3A 3M8FA 4EGYA 2D2WA 2WTEA 1HSJA 1QPMA 3FXUA 4KN7X 5HS7A 3KZZA 2F5FA 4G94A 5BQTA 2Q2EA 4M6YA 3E5UA 4QLCU 3HRTA 5LEKA 1MJ9A 1XGOA 3KP5A 1T6SA 3RI4A 4L9JA 3Q5FA 3TO9A 2G9WA 1STZA 3GO5A 3TQNA 1J9IA 3M7GA 3HSEA 4UVBA 3P7NA 4E70A 3BJOA 2A6EF 1S6LA 2MA3A 1BI3A 2STTA 3F8FA 3DF8A 2VOPA 2XUBA 3K0LA 3MWMA 5DCFA 4U7DA 3CUQA 3BJAA 2CYYA 2MLGA 2D1HA 2LKPA 2ACJA 1QO0D 1XGNA 3G73A 1S3JA 3ZMUA 4HV6A 2DTRA 3CDHA 2LDUA 2FNAA 3EYYA 4PZJA 5FD5A 4KFCA 1BC7C 5D6EA 4AIHA 2P7VB 5D5XB 5J8FA 4FT8A 3EDPA 3FXQA 2HZTA 3QU3A 1ZLJA 4O6JA 4EJUA 3ZMVA 3WTVC 3JTGA 2FXAA 1NHAA 2H27A 2W57A 5D8LB 5D4RA 3I59B 2HEOA 4A2UA 4NQWA 4ZYHA 3ZMTA 2JPCA 1EH6A 4I0BA 2OA4A 4IVNA 1KQ9A 1G6NA 5LHIA 3V7CA 2EA2A 1FOKA 2CSOA 4L5IA 1DUXC 3U9GA 3GXOA 4L9VA 1U5TC 2MBFA 5HDKA 3LA7A 2JRTA 5JVTA 1REPC 3DPTA 4ESJA 2L4AA 1YYVA 1XN7A 3MCZA 3R0AA 1LEAA 3K1NA 4WCGA 5BMZA 4KMFA 1XMAA 3R61A 1CGPA 4AD9A 5FLXZ 1LJ9A 2H6BA 4LMYA 1ON2A 5L3GA 2K7LA 2ZNYA 3RKYA 5F1RA 1KGSA 4NB5A 5L3DA 1XDSA 3F72A 4CHUA 1YLFA 1IN6A 3HOSA 1S8NA 3L9FA 2QYOA 5CVUA 4KIGA 4LB6B 4ESFA 4Q48A 4CICA 4HV5A 2FBHA 1LB2A 1XDUA 2JSCA 2M30A 2W84A 2J5OA 2ZJ2A 3ML6A 4Q5SF 2GXGA 3DQVC 2OBPA 2MLKA 5EEGA 4QWQA 2FF4A 4EMSA 1D8KA 4O3MA 4RAZA 2RDPA 2RGVA 5K5OA 2YU3A 3J80Z 1ZRDA 4ENJA 4P9FA 3VODA 3GF2A 2CGPA 2KIUA 5BOXA 3EQLF 3I5UA 2PI0A 1I27A 3O2PE 4ZZDA 4L18B 5A2QZ 2O61A 1J5YA 1OPCA 5ICCA 3DXJF 3M8EA 1FBQA 5K1YA 1O3SA 3GZ6A 2E7XA 1FY7A 2DI3A 1D3YA 3LA2A 3AAFA 3HIFA 4WK8F 2CO5A 2MD5A 4KDPA 5KK1A 1H9GA 3WTZA 2VBZA 4MQVA 5FFXA 1RIOH 5LGUA 3T8TA 3TDZC 4UUVA 3HUGA 1Z05A 1F5TA 3NRVA 3EYIA 4KA4A 3FWEA 2DO7A 2DPDA 2Y0MA 3L09A 4ZYEA 1U2WA 3KFWX 1FBUA 2HTJA 3TOBA 1FX7A 4I01A 1K7AA 1XCBA 5LHHA 3JAMZ 2ZO4A 3C18A 1EH8A 4KT5C 1ZARA 4F7ZA 5D8KB 2F5CA 2DPUA 1Z9CA 1T2KA 2E1CA 3NEUA 3MEXA 1IN5A 2DLLA 5ILSA 3GFLA 2IVMA 4YG2F 2QUFA 3ELKA 3JW4A 2GZWA 4K2EA 3E6BA 3KLOA 1P4AA 3LSTA 1KQ0A 4LGWA 2FU4A 2VODA 4IRGA 2NAZA 5LRSA 3E5QA 5HS9A 1U5TA 2Z5UA 3SXYA 1TQMA 3EETA 4MEYF 4CDGA 4EJWA 1WWXA 1J59A 4A6EA 1BI1A 4LG0B 4GO1A 1B6AA 5DEQA 4A0XA 2P5VA 1B9NA 3LWFA 2YPRA 3FZVA 1HSTA 3F6OA 1PDNC 3FMQA 4M73A 4OMYA 4EV0A 1RUOA 1EH7A 2EFNA 3FMRA 5CYVA 3RYPA 4ESBA 5DD4A 3HRMA 4JQFA
chains in the Genus database with same CATH superfamily
1GLNA 1MH4A 3I64A 4BGDA 4NHJA 1MBGA 1QNTA 2ME0A 2HXOA 3S2WA 1ZRFA 1Q1HA 2XASA 4C2TA 3WGHA 3HPHA 2FE3A 1JI8A 2I10A 1H89C 1UHMA 3WU1B 4XSXF 3MD2A 4YFXF 2I8DA 2R7ZJ 3WTSC 1IV6A 3PUFA 2IBDA 4UV9A 1SC7A 3C3WA 2XAHA 1P7JA 4G6TB 3VWBA 3LFKA 2ISZA 1XTAA 1N75A 2W7NA 1U9OA 1C0WA 3C2BA 3MKWB 5E20A 1LUJB 4KN4X 2Z1DA 4O5VA 3H9QA 3IWFA 3PNTA 4XRSG 4P9UA 2NVQJ 3M1EA 1TWFJ 4MTDA 3KX2A 4HSRA 1VQ4I 3BG3A 5GPAA 3CJTB 1P7IA 3BR3A 3RPQA 3JCUC 3IRRA 2W1OA 1U6GA 1WJBA 1K4TA 2NYXA 3V8KA 1BW5A 2RKHA 5J1UA 3UR3C 3CP2A 4G7HF 5ICFA 2DYRH 4ENNA 2M1BA 3QU6A 1YHQI 4R1HA 2WAQA 1ZR4A 3EUAA 2FSWA 2V26A 5H6QA 4AUXA 4BHBA 1U3EM 2WBMA 4ZC3A 1R23A 2ELJA 1XPXA 1MGTA 4HNUA 2H6CA 2KDZA 4AVPA 2PQ8A 3N4MA 1X4OA 2V6CA 3ERMA 5CJ9A 3PIPF 2JQ7A 2JA8J 2GA1A 3TO7A 3KEQA 3S2DJ 2VT2A 1MJAA 3GCMA 3IHUA 4XKBA 5EF6A 1VQLI 1B1BA 5HVQC 4C30A 4UVAA 4A3MJ 2M45A 3ZOBA 2DMPA 1K79A 3I4PA 1IXCA 3PUBA 2CW7A 3FHZA 5JR3A 3OOPA 3BZKA 3KP6A 3L2CA 3IUOA 3KZIC 1DDNA 1QVTA 1IC8A 5LEJA 1Z6TA 1NG6A 2XRNA 1U78A 3GMEA 4CSWA 1WFXA 1WHUA 4MNUA 2V1XA 2VJIA 5J8CA 1S7OA 3HEFA 2VOOA 3BG9A 4EM0B 4A3LJ 1HA8A 1MNDA 5C44J 3J7AY 2ZCWA 4LFUA 4BQNA 3CCEI 2CFOA 2F2EA 5B1AH 1KONA 1YW9A 5LBQA 3BC8A 1DU0A 1T98A 2PMUA 3BZ6A 2VPLA 1Y1VJ 3WTTC 4ENKA 2JWTA 4DQ2A 5C4JJ 1X4PA 2KDOA 3ASOH 4J19A 2RN7A 3M9AA 4FE7A 4PJJA 2W00A 3JRGA 2F4MB 4ZJZA 3JSOA 3A0HC 5TJJA 3ZQQA 1I5ZA 3Q9VA 2DODA 3MKLA 4YELA 3VFZA 4P5OA 3AL0B 4JYKA 4OWRB 5C4XJ 5FGMA 3FHNA 2K86A 2NVXJ 4BNCA 3JRFA 1T38A 1YJNI 1A04A 4EJVA 5KAFC 5IT9Z 5HODA 3VYSB 3SDGA 4A3IJ 4QPOA 3HOUJ 1P6RA 3REOA 1K78A 2QWWA 1H8AC 2KJCA 2JRMA 4GYGA 4D5CA 4EM1A 3S3MA 3SQNA 3DU5A 2IPQX 1POGA 2O03A 3ONQA 1SAUA 1XMXA 2E71A 3C1DA 5AIPA 3Q3SA 4UUSA 2VUMJ 4IRIA 5ED4A 3B02A 1WJDA 1JE8A 2EFOA 1D0YA 1R58A 3EUHA 4NUBA 1VQKI 1A6QA 3WTWC 3LQRA 1ULYA 2OD5A 4XK4A 1I3AA 1R36A 2HR3A 5M5XJ 2K9QA 1JKQC 1FNNA 1YS7A 4U0YA 4HBLA 2M7AA 3I71A 2CS3A 5DD8A 2O5RA 3SZPA 4AWXB 2A6HF 3J81K 4N9HA 2ME6A 4FTHA 3BR0A 2QBYB 2M3AA 4QPQA 2JPBA 3HSFA 3VYRB 1Z6RA 4WXCA 4JK1X 3ZQGA 5EG0B 3ZQHA 3ECHA 1B8IB 2L54A 1OJLA 2CWEA 3CTAA 4RGUA 2IS6A 5CVJA 5DCMB 5H6RA 4HYEA 5F08A 2A61A 2GIVA 2VJJA 3NWTA 3HRSA 1YO5C 4Q4ZF 1P92A 1MDMA 2WB1A 3OIPA 3F21A 2DU9A 3RCOA 3ZXSA 3JRCA 2XVCA 3GZNB 4BY1J 2R5ZB 2OJED 3ZN0A 3UNGC 4ZYGA 2D5VA 1MMSA 2QSHX 4WX9A 4II2A 4XM3A 5D6FA 1CF7B 1Y1WJ 4XN0A 5K7HA 2W4SA 4MIMA 5E1XA 3A02A 1VQPI 2NOJB 2LF7A 1N78A 1R4MB 3DTKA 3FF5A 4XR6A 2XKPA 1XSVA 4Y52J 5KVRA 2OQGA 4UY8I 3R6SA 4RM3A 3W6JB 1OCZH 2XC7A 4A0ZA 3E6CC 3KIOA 3T5XA 2Y30A 5KNLA 3IWZA 1P4XA 3CUOA 2L9SA 3IH3A 3ZGKA 1SFUA 2GIZA 2RVCA 3I9V2 1QRYA 5EEAA 2DA6A 3WG7H 4M71A 5B5EC 2FD5A 4PJ0C 1IV8A 2VQHA 3L2RA 5LD2C 3PJRA 2JUGA 4L0ZB 2Y75A 1YJWI 1MBKA 1SMTA 3I59A 1TWGJ 1PUEE 1Z77A 1XGSA 2Q2EB 4II3A 5FFZA 4Z2YA 2K02A 1SEUA 1V55H 2BBYA 1GXQA 3NQOA 3HL2A 2M8EA 4RGSA 1ITYA 4EATA 3BJ6A 1LVKA 3IL2A 1X1BA 1GDTA 4XORA 1ZLKA 2XSJC 4RB3C 5F27A 2HDCA 5HDNA 2LK2A 2LKSA 4EVIA 3J7YJ 2HPIA 3FXRA 1R1UA 1WGXA 1VQ7I 5GTIC 4YFNF 1P4WA 1RR8C 2HNHA 4KUMA 3CC7I 3K9TA 3F6VA 2JSPA 3GW2A 5BS6A 4CXFA 3MN2A 3S93A 1KU9A 1S29A 5M5WJ 3ZQLA 1J7KA 5FRNA 2EZLA 2ZB9A 4CCKA 3CCSI 1P2FA 2KISA 4M72A 1K6OA 3HJEA 2V1UA 2EFPA 5CLSA 2FUG2 2WC2A 4BQAA 3G1LA 4D0PA 2VE8A 1SD5A 1PUFA 4M6VA 1FIPA 2L01A 4CYCB 2JA5J 2K40A 4DYQA 3G2BA 3VYTB 1ZGJA 3JR9A 3RSNA 1B59A 3H0DA 5J6XA 4RGRA 3HB9A 1O3QA 4XIDA 4RAYA 4E7LA 3W6KB 1B72A 2V9VA 1FPQA 2M8GX 3TEDA 4KMUX 3C2HA 4A3GJ 2BY1A 1I50J 1OYWA 2VKVA 1KYWA 1PJRA 1VZ0A 4DZJA 4BHCA 5EZHA 3ZMSA 2D45A 3BWGA 5FO5A 4KICA 1XSXA 1IN7A 3A2KA 1HKSA 3H35A 5E18F 3B6AA 1LDDA 4RAFA 4BAYA 4F52A 3GX4X 5F0HA 1X1DA 4BY7J 2WB1N 4CCLA 4E7IA 3VB2A 1LNWA 5IOYA 1Y0UA 4ZYDA 2NS7A 4LITA 5E1WA 4IQ4A 2HXIA 1R5HA 4G8XA 3PQJA 4OU0A 1ON1A 1ONVA 2PBIA 1TTYA 2IGNA 3B73A 1ETVA 1H0MA 3DLAA 4L0YB 2L2OA 2XF6A 2BY3A 3HYIA 1QBJA 2CFXA 5L3BA 2QGUA 4DYCA 2HZDA 5CPRB 4BXUA 4M3GA 3E0JB 2P7CB 2LREA 2CU7A 1LFBA 2E34A 3WGGA 1QPIA 4B47A 1VQ5I 5DM6F 2K3PA 5IYDJ 1I1SA 1KU3A 3HPGA 4WWCA 4S05A 2PJPA 1LE8A 1MJBA 4A3BJ 2HQNA 4HNVA 5J1YA 4N9IA 4JP0A 1RUNA 3MQ0A 5EYRA 3ISPA 3QYFA 1IUFA 2COMA 3GEZA 1TW2A 1J75A 3NWSA 4UXNA 2O3FA 3M1CA 1AWCA 4FHTA 2E2IJ 1TW3A 2GAUA 5M3MJ 2FQ3A 4I09A 1DGWY 2LBFB 2K4BA 3GFMA 4EJOA 3GYHX 5HLIA 3BG5A 2J5PA 2YUSA 1X3WB 3CF5F 3HHHA 2AHQA 1UCRA 4BE2A 2NVUB 2GBYA 2IJLA 2AS5F 4IHWA 1YIOA 3TW6A 4KJZA 1IXRC 2AQEA 2PMZN 3E1SA 2ZNZA 4D5FA 3V42A 2N8GA 4A3CJ 2X1CA 3BG6A 4XN3A 2ZMEB 4MHGA 4C9YA 4ON0A 1HLVA 2PJRA 1S7AA 5TRDA 3BCBA 1OCCH 2OZUA 5LGNA 5EGOA 1LDKB 1WJCA 2NRAC 2EFWA 1RC9A 4HF2A 3K4CA 2GXAA 3I53A 2KIFA 3DEUA 4UUTA 4WXDA 5E3LA 3K4LA 2RAEA 3I58A 4HG2A 2MC4A 2WV1A 3RYRA 2OPTA 1PYVA 2IXSA 2M5WA 4I02A 1Z0XA 2EWNA 1OQYA 2JTVA 3V7SA 4XRSA 3DWLE 2NNNA 3X2QH 1FEXA 2DW4A 5HDGA 4F55A 1IRGA 1WPKA 2EJRA 3FK7A 3V4GA 1R9TJ 1ZG5A 1GT0C 2VONA 3P9KA 1JGSA 4OMZA 3QOPA 2VE9A 1V54H 1EV7A 2K5CA 1HBXG 4X6AJ 3ABLH 3OR1C 3HG9A 4M6XA 3T8RA 1IRFA 2DYSH 2XF5A 4HF0A 2CQQA 1K83J 1DP7P 2R7FA 3BOQA 4QTRA 1GHCA 1HKTA 3K6GA 4BQQA 3QP6A 3S1QJ 1MMGA 2BVLA 5K5RA 3GVAA 4PSWA 4CH7A 1LEBA 2EZHA 3H5NA 1QQIA 2E1OA 4ZDLA 1SD6A 1ENHA 1F9NA 3OIQA 3TP0A 4HDUA 3DBLB 3DLLF 4S04A 1SAXA 3FBNB 1IF1A 3GTMJ 1ETQA 3E6MA 3MAJA 3KE2A 2VJ4A 2OCCH 3SFZA 2KHMA 2XDVA 3M4OJ 4IPAA 4XRFA 1TWHJ 2WA0A 4PDKA 3HRUA 5ICEA 4PJNA 3LSHA 2PX9A 1YIJI 2CUJA 2VB6A 3OOUA 1Z3YA 2JK3A 1Z1DA 4FX0A 3WE2A 2G7UA 1HOMA 1JUSA 4V2FA 2X1DA 3JRBA 4XLPF 3SYTA 1R5GA 2A3SA 3BROA 4XOPA 2P6TA 3OYHA 2XPUA 2AXLA 3H3ZA 4BEHA 4G7ZF 3IC7A 1VFCA 3J81Z 1JGGA 2HS5A 5K7FA 1JUMA 5IOZA 2CQNA 1FMVA 2PEXA 1VQ6I 1G3YA 1AKHA 1U9NA 4IF4A 3BTLA 1PP8F 2IP2A 1IUYA 1JT0A 2F48A 3L2UA 1I39A 4R8HA 4LG0A 5GTHC 3V8LA 1IW7F 3RIRA 3U1DA 2XKOA 2ZSHB 3D5SC 1F1ZA 4FASD 1JJ6C 4CYDA 2DN0A 2CRGA 3HUGB 4UVCA 1QZZA 3E7LA 3WTUC 3F22A 4EGZA 4UV8A 2R5YB 3CZ6A 1BM9A 2EK5A 1DPRA 2DOFA 3P9IA 3GTLJ 1ETOA 2HFHA 2KKOA 3L7WA 2L9VA 4PJLA 2VQGA 3DBRB 1X58A 5LLQA 4E6KG 5KCMA 2O8XA 5F1JA 5J3LA 2QVOA 1XG1A 1SANA 3GTJJ 1RESA 4N0BA 4ZTJA 2CG4A 4WF2A 4RB0A 4EQQA 2XV4S 4HNTA 5E17F 2CQKA 1AOYA 1R00A 1BC8C 2RNJA 1KA8A 1XC5A 2GA2A 1D1CA 4NBQA 1UHWA 2Y48A 5FRMA 3HGGA 1TP4A 4JOMA 3OR2C 3JRAA 3W3CA 2YU9J 2X48A 1F36A 2PG4A 2UXNA 3O3KA 3LQQA 4NC6A 2F4IA 2CUEA 4HEA2 2Y69H 3CO6C 2HVQA 4RAGA 1XMKA 3HTSB 3GWZA 5HLGA 1W5SA 3OS2A 1T08B 1QU3A 3DV8A 4IHYA 3ROUA 3D0SA 5GAEJ 2E2HJ 4CCMA 3L2WA 2L4MA 2Z99A 3JREA 4AVZA 2RQPA 2AXTC 1YW7A 2XGCA 1DP3A 2YX7A 4HF1A 1Z7UA 1TNSA 2X4HA 5IPAA 3CCQI 2EILH 4FQGA 5AIQA 4LLGF 1FP2A 1MSFC 2M7BA 2BHZA 1FP1D 1ZREA 1KZHA 5B3SH 1FSHA 2EZIA 1QA6A 4RGXA 4IHSA 1APLC 3I0TA 3NAUA 4LD5A 2GQQA 2ECBA 2L5QA 1QHGA 4XLNF 3WG9A 4LIUA 5FLXK 3CCVI 3K1PA 3N97A 3C7JA 4Y33A 2GWRA 1X1CA 2HYJA 4AIKA 2ZKZA 1ETXA 2L7MP 2VT3A 4P96A 1AHDP 1UJ8A 1TC3C 3H92A 5HNFA 4E7JA 1D1AA 4PFPA 2NS0A 5LGTA 4H0EA 3DKXA 2DT6A 5CKTA 4RS8A 2OQRA 1RPWA 3HOYJ 1W1WE 2V9KA 2VC1A 4J01A 3ERED 4MFEA 3H5AA 2YR2A 4IL6C 1L3LA 3M3YJ 1OLTA 4IHTA 3FKIJ 3CLOA 1OKRA 2X6XA 1R5ID 2P5KA 5DV5A 2MH2A 4Y15A 1UB9A 3QODA 1P9QC 1O57A 4M3DA 3A01A 2KRHA 3Q0WA 1IO2A 2PFBA 4HW0A 4XOTA 2KPMA 4F92B 2C6YA 4BJ6C 2HKXA 2QM3A 3GZ5A 4Y17A 3OYGA 2DK5A 3K70D 3PSIA 1ZN2A 3PFYA 3FXOA 2VLAA 1IDYA 4XICA 1ZR2A 3QP5A 1MKMA 4A3JJ 4IO9F 3KP7A 2VXDA 4Z6YA 2B0LA 3KYDB 5HOOA 2V6EA 2KP6A 3PO2J 5LFAA 1R22A 2BZTA 3CJRB 1NK3P 1S72I 2W25A 2EV0A 1J0RA 3G71I 5ILUA 3J80K 5D4SA 1G3WA 5E8IA 4CCJA 2KZGA 2H09A 1B4AA 3LSRA 1ZYRF 2L0KA 1YOVB 3OSFA 4MGRA 1KQ8A 1W7PA 2H8WA 1UAAA 2ZC2A 2YSRA 5FKLA 4IQJA 1UFMA 1YE9A 2COBA 5ICGA 4JX6A 3CESA 5A2QK 5D5UB 2DMTA 2M9HA 4KIBA 1FWZA 2L9RA 3K4MA 2HQAA 3DPLC 4A0YA 4A5NA 1LPQA 3RPUA 3E3VA 3R0JA 3IKVA 2EPFA 2WV0A 2QLZA 3DU6A 2UV1A 2V79A 4B44A 4E7ZA 3KZYA 2DK8A 4BH9A 4U7BA 4KITB 3K69A 2QBYA 3GLLA 3FXLA 3HSRA 2MC3A 4KNYA 5EEHA 1W36D 2QENA 1O7LA 2HQ5A 2QQAA 3E6DA 4HX4A 5IP9J 5EG0A 4RMNA 4L9NA 2R93J 1XSDA 3T0YA 2H94A 3BR6A 4C2MJ 2E1MB 1VI0A 1XGMA 2DTZA 2MYSA 1FC3A 4A6DA 4AC0A 4F3QA 3IRQA 1SFKA 2UWMA 1FT9A 2P81A 2VBWA 2XHKA 3I4NJ 2O9LA 3LAJA 2XPWA 3ZP5A 2VC0A 1VTNC 2XAQA 2MSYA 1T56A 2LY9A 3A1YA 5JHFA 4A3DJ 3IP4B 2JVHA 4JBAA 3E5XA 3PFIA 4A3KJ 2F5EA 3ULQB 1TZLA 3ABMH 3FIWA 2DXIA 4FISA 1TWCJ 3WU0A 2R7VA 1W5TA 2ZFWA 3DBHB 3R60A 4LOCA 4BKXA 1XCVA 1GV5A 3F9KA 4U0WA 2HOSA 3FKJA 4RDUA 3A4CA 4KIFA 2JJ7A 4J00A 3DKWA 2EZKA 4JX4A 4DW6A 3K4NA 4XLAA 4WXHA 3BP8A 4DZPA 4Q47A 4RB1A 3RKQA 3QRFF 1BIBA 2LP0A 1R1VA 1OYYA 2R4GA 2R7XA 4HA8A 3FMSA 1K78B 2JZYA 4HPQA 1KU2A 2Q8KA 3K1MA 1FTTA 4I76A 3E97A 2DA2A 2HDWA 4FETA 3F8CA 3G3ZA 2PLYA 4UUSB 5M5YJ 1WJEA 2OV7A 3Q0VA 4E7HA 5CVIA 3C2GA 1DPUA 4ASNA 2GXBA 2G0EA 1MH3A 3L2QA 1LQ1A 2IS2A 2KMUA 2A5YB 1IRZA 3HHGA 1Y39A 3RZOJ 1FSEA 4KT6A 1ZG1A 1SD7A 2LH9A 5JHUA 4BU2A 1TL8A 1G59A 1DGRM 2JN6A 2VASA 1SD4A 1A35A 3O6BB 2CW8A 4ZYAA 2FA5A 1G4DA 3ZQFA 3IAM2 1BJAA 1XB4A 4IX7A 4MEXF 1ZRCA 2LVSA 4I98B 4ITVA 4B8XA 4UHTA 2LTPA 4ENMA 2Z33A 3QOEA 4YIRX 1X1PA 2KIQA 5M3FJ 2X51A 1Z91A 2BEOA 3ABTA 4MTEA 2WWYA 2ESNA 2EV6A 3FM3A 3K4BA 2NNYA 1XX5A 2Q1ZB 1WH5A 2DMQA 1ORKA 2XPVA 3H9JA 3R4KA 5F0FA 2HGCA 1MDMB 3J7ZI 2PMZA 4CYCA 2IGOA 2BXZA 3ZMZA 4X0GA 2FMLA 1D8JA 3K4KA 5H2FC 1BOBA 2R3SA 4I7HA 2TRTA 3WE3A 2BOLA 4B3AA 1BR4A 1ZTRA 2FEZA 3DCFA 4PSXA 4AIJA 1MZBA 2YS9A 1QHHD 5J4VA 3ABKH 1VQOI 4OIQF 1ZQ3P 1T0FA 2WY7Q 3LSPA 1RI7A 4BHPA 5JFRA 1GV2A 2BYVE 2R7WA 2RNGA 3P9CA 3CLQA 1O7FA 3H36A 3HGYA 3ZPLA 4R79A 1DQUA 2ELKA 3CUQB 1MMDA 3MZHA 1SMYF 2P6SA 2XAUA 2I5UA 2VN2A 4LK1F 2W85A 2VKHA 5FKKA 4FX4A 1R6RA 4HQEA 1WSUA 3ZN1A 1YG2A 4HLYA 1TQPA 1ERDA 5DS9A 2QSGX 1WH7A 2HYGD 2FNPA 1MMNA 5E3OA 2OF7A 4PGHA 4BBSJ 1IXSB 1HQCA 4PCQA 5JI6A 2RV8A 4OIRF 3WTXC 4M9ZA 1YQAA 1BN5A 3H3VK 4CZCA 4IOCF 4CA0A 1B9MA 2QQ9A 3HM5A 1ZHFA 4OIPF 4E7KA 1JKPC 3HOTA 2EA4A 2M4KA 4U0VA 1W4MA 3LA3A 1Z7LA 4CZZA 3K2AA 2WADA 1PVEA 2K4JA 5B1BH 3WHBA 4FE4A 3JRDA 4V19K 3QAHA 1WRJA 4ZDPA 3S15J 1G3TA 2Z3YA 1E3OC 1YRNA 3GUDA 2QQ8A 3ZQ7A 3S16J 2V9PA 3TGNA 3I55I 2UZKA 4S0HB 2M4GA 2DFHA 2LBFA 5BPIA 2ZJRF 1Y0NA 4P55A 3DFGA 4M9XA 1TLHB 2W82A 4NQWB 2EIKH 3ABUA 4OAYA 5K7ZA 2FOKA 2BY0A 2W48A 3KP3A 1FLIA 2F5DA 3AG2H 3TBIA 1OR7C 3LSJA 2GLOA 3DP7A 1UZCA 2K85A 5CVRA 2CUZA 2O8KA 2OAZA 3S14J 2BE5F 1JTYA 3EUKL 2ZMEA 2QQBA 3LNQA 4IHXA 4EJTA 4ZH4F 3VYUB 3BDDA 4MFDA 4XSZF 3FXJA 5L3EA 3DPUA 2E36A 2KT0A 1YFHA 3P5JA 1JKOC 1IAWA 2P4WA 2QF7A 2ADUA 2LYCA 2DT7B 1GUUA 2EFQA 2LF8A 3ECOA 1KU7A 2HDDA 2DQLA 1ZKGA 3IKTA 5HLHA 2ZXIA 2QSFX 2EB7A 4XKWA 5L3CA 2CW0F 2OU2A 1O3TA 3BY6A 5KHDA 4PK4A 2MFZA 5L3FA 3IH2A 3W2AA 3F23A 4BYYA 2FX0A 4IKFA 1TNTA 5BPDA 3LSIA 3PQKA 4Y13A 2M34A 1EKEA 3G1OA 1A5JA 1ZELA 1ZGAA 2EIMH 4BS9A 3V7RA 3CCMI 5IT9K 3DEWA 3Q9SA 3KCCA 5FB2A 5CQGA 3BTIA 3F8NA 1BOAA 2V4JC 3OV8A 5DTDA 5GADJ 3KEOA 3WU2C 3BPXA 3ZRGA 2BV6A 2KIMA 1ETWA 3V8JA 1UG2A 4EEFG 3VEPA 1WZ2A 3D5LA 2PN6A 4MQ9F 1QGPA 4OOIA 1HDPA 1LE8B 1WJFA 1WKMA 4EM2A 2LNBA 3H5RA 4XLFA 4RB2C 2H1LA 5F64A 2BW3B 3LMMA 2BY2A 2XGDA 2V1DA 2Y9YA 3S1RJ 1NG7A 5DM7F 1FYKA 2K3FA 1BBYA 4I0AA 1MSEC 3AL0C 4YIIA 3FBIB 4RLQA 1IJWC 4IHVA 2IW5A 2IA2A 1GVJA 3BG7A 1I3QJ 2ZJPF 1RNLA 1U0JA 5LHGA 4XBFA 2L7FP 1XD7A 1USSA 5D5WB 2ZXWH 4RLFA 3AG1H 3RJPA 5HS8A 2L7ZA 1NTCA 1USTA 1CQTA 2FJ1A 1IN8A 2PJRB 4RBOA 2A68F 2G7HA 2M0MA 4BL0B 3RTRA 2E1MC 4LJZF 1AU7A 2FMYA 3F0CA 5E1ZB 2Y9ZA 1RRJA 1V3FA 3U1KA 3ZR8X 3BR2A 2DOAA 5GAGJ 3U2RA 5JLWA 1AA7A 3EPZA 2ECCA 4YIFA 4ETSA 1OYIA 2O6GE 2DBBA 2O0YA 2UUZA 5EDNA 3GFJA 4UNOA 1L0OC 2XAJA 1GXPA 2XGEA 1SVLA 2HOEA 4HOBA 1T39A 2IS1A 2E7WA 2R5YA 1HW5A 2X85A 4XLHA 3UKGA 2DT5A 2HTSA 1MD0A 1WI9A 1U8BA 1EA3A 5DUIA 1YW8A 2CV2A 1JUPA 4NDLA 4D1QA 2Y31A 2IT0A 1YTYA 3H3UA 1MMAA 2YX4A 2GOXB 2R7RA 3JTHA 1FOWA 3G1MA 2O7OA 3RQ4A 3CO7C 2TDXA 1YS6A 4DBQA 2P8TA 3BQZA 2R7SA 1ETKA 2RREA 4OIOF 2E2JJ 2Y0SN 4HX8A 1VQNI 3VPRA 2DAOA 3VSKA 2CMPA 3QWLA 2OTLI 2OUMA 2BGCA 4U88A 3I54A 2DDBA 3S8PA 3RKXA 2A07F 1TQIA 4HZFA 2IRFG 5JVGF 4G7OF 2XROA 2L9NA 1M1EB 2JA7J 3SJMA 2DFIA 4G6DA 1T8IA 2P5LC 2Q0OA 3GLXA 2HKOA 2VBYA 3QPHA 1I6XA 1MNEA 1BIAA 4IXAA 1SFEA 5D5VB 3D1NI 4I2OA 2V7FA 3BPVA 4E4HA 1W0TA 3KYCB 3PL8A 4BXXJ 3KETA 3TKYA 4GGGA 1X19A 1UELB 3KLNA 2ZSIB 1LVAA 3KEYA 4XONA 4BACA 5EJCA 5DYMA 3F8BA 4G12A 4BEHB 3CJNA 2QEXI 1JJ8C 4A5MA 2LD5A 3TO6A 4HRIA 2HWVA 2XF7A 1SFXA 4PFOA 4DNCA 3HXLA 1W0UA 2LSOA 5BNGA 1ZH5A 1MBJA 2VL8A 3ZMDA 3AKZA 3TOAA 4OINF 2M87A 2AO9A 4TV7A 1H9TA 5DDGA 4OAZA 1RZ4A 3MFKA 2QZ8A 3B6CA 5C3EJ 2R7OA 2VKEA 4IJAA 4X1EA 5GPCA 3DTIA 2L3DA 1V4RA 1JHFA 2JT1A 3JSPA 1FZPB 3OY9A 2EQRA 1I1GA 3PM1A 2DDAA 1MBFA 3M8JA 4HX7A 1BI2A 4A12A 1OR7A 2HOAA 2XB5A 1Z67A 3GFIA 4HQMA 2M2EA 1FBSA 1WQ2A 2DCEA 2IA1A 3OYJA 2F4OB 1V5FA 1IZ1A 2ESHA 3FXKA 1RETA 1U5TB 4GCVA 4GYIA 2JA2A 2CH0A 3I4MJ 1ZAOA 2QKLB 3BCAA 3CUQC 2XRLA 3QPTA 4RA2A 5E79C 5GAHJ 5AONA 1GVDA 4Y4RA 2OZ6A 1D0XA 1R1TA 6PAXA 2MABA 2LG4A 2JUCA 3FM5A 2ZXHA 3HTUA 1BR2A 1OMIA 2E1NA 4CCNA 5FJ8J 3MKYB 3KP4A 5HNHA 4CGZA 1JXSA 4W97A 2ID3A 1EJ9A 1Q1VA 2ETHA 1LKXA 3Q0UA 1T0FC 3KP2A 3VOEA 2H8RA 2HU9A 2KQRA 2R7QA 1XS9A 3T1BA 1UHSA 3JRHA 2DQRA 1VQMI 1TBXA 3RQIA 4HLXA 1LDJA 5IT3A 5HLTA 3F3XA 3FX3A 2EV5A 2IA0A 4D7NA 2DA4A 1Y8RB 3OYKA 3S32A 3OYNA 4B43A 1D5VA 2IAIA 4M9SA 4YFKF 2FRHA 1HW2A 4GXOA 5FKNA 1OCOH 3CCLI 5F6FA 2K27A 3K2ZA 3OL3A 3OWTA 2QCOA 4ZZLA 2VKDA 3MMYB 3SZTA 3CMAI 4DGWB 3ASNH 3NARA 3OSGA 4LLLA 1X2MA 4LK0F 1UG0A 5H20A 4QSHA 1O3RA 2R92J 1HC8A 4A3FJ 2L02A 3BR5A 2ISYA 2CUFA 2PMHA 3S1MJ 4AYBA 2A69F 3U21A 4LG3A 4MO7A 1MBHA 2Y2ZA 2HI3A 2KRFA 1E2XA 1JTXA 2Z9OA 3OYCA 2MGQA 1OCPA 3TDUC 2HQRA 3ZQCA 2WAFA 1HCRA 2K9MA 1R7JA 3L00A 2VIXA 4B1RA 1BI0A 2W24A 3QQAA 4AM3A 5IYBJ 2X9DA 5IP7J 4CO8A 3COAC 4DBRA 1G3SA 1BL0A 1E17A 1Z21A 2HYFA 2WY8Q 3S3OA 5ILVA 2XGXA 1KYZA 3GTKJ 1J2XA 1HW1A 3TL4X 4PGGA 2X0LA 4NC7A 4L5JA 4D7MA 1PP7U 2VBXA 3A01B 2R7TA 1ODDA 4G6QA 5B66C 1FYLA 4DOZA 2STWA 4ZDOA 2MW8A 1JHHA 2LOOA 3PSFA 4LLNA 1QVUA 1QZYA 1WCMJ 4N4NB 1IN4A 3CP8A 2X6YA 2ZMEC 4HDVA 1K4SA 1FOYA 1RKTA 2MH9A 4XQFA 2P0WA 3ZQIA 2VJ5A 2XIGA 2ELHA 2VXZA 2DJIA 2DFEA 3CCRI 1U8RA 5FD6A 3SHFA 2GM4A 2UXXA 4P1WA 5K5QA 5CVVA 1HKQA 2XAFA 1B8IA 4LB5A 3RKWA 5FKOA 1D1BA 1W7PD 1WI3A 4L9TA 3CDIA 1IDZA 4GFBA 4HSTA 5DCMA 3HZJA 3MZYA 2LY2A 4AU7A 5ERIA 5EZGA 3CDLA 9ANTA 4KYWA 2CQ7A 4GDFA 2ICWG 1F4KA 2ZXJA 2TCTA 4Y3OA 3DKYA 3WGIA 4IRHA 2R5ZA 4BE0A 3W2VA 1W7PB 3F8MA 4BQOA 1CF7A 3LSKA 1X3UA 4HAMA 3RPUD 2RC4A 1HXDA 1A6IA 1Y8QB 5DUKA 2FBKA 3H0GJ 2DMNA 3LAPA 1N25A 3LSMA 1ZK8A 2FBIA 2R7DA 3CCYA 4XRMA 2JMWA 3J7AO 1X2NA 2M0CA 3JAMK 1FYMA 3WTYC 3GTOJ 5GP9A 2MG4A 3CD6I 2Z16A 2LFBA 4G9YA 4M74A 4B09A 3LSGA 2QA4I 2ZBKA 3WODF 5LRRA 4UB8C 3OYBA 3VSLA 2D1VA 2XAGA 3K7AJ 3RDIA 5KAIC 1HDDC 1LFPA 2KJBA 5E8GA 1ZG3A 3M8FA 4EGYA 1BJZA 4I6ZA 2D2WA 2WTEA 2LC2A 2LKXA 1HSJA 1QPMA 3FXUA 2CV1A 4KN7X 5HS7A 2F5VA 1WJAA 3KZZA 2IEKA 1ETYA 2F5FA 4G94A 2Q2EA 5BQTA 5IY5H 4M6YA 3E5UA 1O4XA 2V1NA 4QLCU 3HRTA 3GTQJ 5LEKA 1MJ9A 2E5ZA 2WAQN 1XGOA 3KP5A 1T6SA 2DJNA 2NOGA 3QPLA 4L9JA 4PUSA 3RI4A 3Q5FA 3TO9A 2G9WA 1STZA 1TWAJ 3GO5A 3TQNA 1BA5A 1J9IA 4AYBN 3ZCOA 2K9LA 3CC4I 3M7GA 3HSEA 1S7EA 3QYBA 4UVBA 3P7NA 3OYDA 2VQLA 3H1CA 4DYRA 2X6OA 4E70A 1N77A 1A31A 2B63J 3BJOA 4AIDA 2A6EF 1UMQA 2H1KA 1S6LA 1DU6A 3SFIA 2MA3A 1TT5B 4C3JJ 1BI3A 2STTA 3OYIA 1WJ5A 3F8FA 3ESWB 3BTCA 3DF8A 2VOPA 3MZ8A 4E7SA 3K10A 2XUBA 3K0LA 3MWMA 5DCFA 4U7DA 3CUQA 1YX5A 3BJAA 4NC8A 1RKWA 2CYYA 2MLGA 5JLXA 3O8HA 2D1HA 2LKPA 2ACJA 1QO0D 3N05A 2XSDC 3D5RC 1XGNA 3G73A 1S3JA 3ZMUA 3HOWJ 4HV6A 1X1AA 2DTRA 4A69C 3CDHA 2LDUA 2FNAA 3EYYA 3LL7A 4PZJA 5FD5A 1Y56A 4BJ5C 1R49A 1BC7C 1NK2P 4KFCA 4BDYA 1Y6IA 1VQ9I 3WHCA 4I99C 5D6EA 4AIHA 2DA5A 2P7VB 5D5XB 4DJAA 5J8FA 2CQXA 5J40A 3RZDJ 4FT8A 1V5EA 3PIOF 3EDPA 3FXQA 2HZTA 3QU3A 1ZLJA 4O6JA 5TISC 1I6HJ 4EJUA 5E3MA 2F6CA 3ZMVA 3HC7A 3WTVC 3JRIA 3IH4A 3JTGA 2OCEA 2FXAA 2A5WA 1YX3A 1V5GA 1NHAA 2H27A 3OYAA 4N4OB 2W57A 1FIAA 5D8LB 3BZCA 5D4RA 2EINH 1FTZA 2NVYJ 2E19A 4BE1A 2IS4A 4IEJA 3I59B 2HEOA 3S1NJ 4GRIA 3QPSA 4A2UA 2CJJA 3OYLA 4NQWA 4ZYHA 3ZMTA 2JPCA 1EH6A 4I0BA 2OA4A 1RR7A 1KQ9A 3KPHA 4IVNA 1G6NA 1S9HA 1YJ9I 4U87A 5LHIA 2K9NA 1SVOA 1JKRC 3V7CA 2EA2A 1FOKA 2CSOA 3CMYA 4L5IA 1DUXC 1EF4A 3U9GA 2X6WA 3GXOA 4L9VA 1U5TC 4BXFA 2MBFA 5HDKA 3LA7A 2JRTA 5JVTA 1REPC 3DPTA 4ESJA 3HOVJ 3OYEA 2L4AA 1YYVA 1XN7A 2L7KA 3MCZA 3R0AA 1LEAA 3PNYA 3K1NA 4M3EA 4WCGA 1HF0A 4KISA 4ANJA 3OMYA 4W1UA 3G6EI 3S2HJ 4BJTA 3W6VA 1R4NB 5BMZA 4F93B 4KMFA 1XMAA 3R61A 2WAEA 3SEZA 4B4CA 2R0QC 1PUFB 3OL4A 1CGPA 2LMDA 4XLEA 4AD9A 5FLXZ 5IYCJ 5J1RA 1LJ9A 2H6BA 4LMYA 2FQ4A 1ON2A 3CJQB 5L3GA 2K7LA 1VF9A 1Z3XA 1G8XA 2ZNYA 4M3BA 3RKYA 1R71A 1VNDA 5F1RA 1F43A 1TT0A 2XB0X 1KGSA 2DA1A 4NB5A 4NNJA 3HOXJ 5L3DA 3I56I 1NH3A 1XDSA 3CC2I 3OS1A 3F72A 3HDDA 4BBRJ 1B72B 4CHUA 5F04A 1YLFA 4YRVA 1IN6A 3I3LA 4A3EJ 2EH3A 3HOSA 5J47A 1W5CC 1S8NA 3OYFA 2Y0SA 3L9FA 3CQZJ 2QYOA 5CVUA 5FKMA 3TMOA 4BDZA 4KIGA 4LB6B 4XMYA 3FISA 1MW7A 3LOCA 4ESFA 2B9SA 4B48A 4Q48A 4CICA 4HV5A 2FBHA 1LB2A 1XDUA 4RM2A 2JSCA 2M30A 2EBIA 2BW3A 1T95A 2W84A 4CUGA 2J5OA 1YRNB 3SEQA 2ZJ2A 2DMUA 3OIOA 3ML6A 1IGNA 3S3NA 4Q5SF 2GXGA 3BT9A 3DQVC 3S17J 2IGMA 2AQFA 3K70C 2OBPA 2KRCA 2MLKA 5EEGA 2BVMA 4QWQA 2FF4A 1BR1A 4EMSA 2CV0A 4CCOA 1D8KA 4O3MA 3A03A 4RAZA 2Z2SB 3CMMA 5TGTA 2RDPA 2RGVA 5K5OA 2YU3A 5F0CA 3J80Z 1ZRDA 4C3HJ 4P9FA 4ENJA 3VODA 3GF2A 4H4KC 2CGPA 1QZEA 2KIUA 1FOXA 1A36A 5BOXA 3EQLF 3CMEI 3I5UA 4MLOA 2PI0A 1I27A 2JA6J 1H88C 3DEEA 2ZJQF 3HOZJ 3O2PE 2MD0A 4ZZDA 4L18B 1LFUP 5A2QZ 2O61A 1J5YA 1OPCA 2OC6A 5ICCA 3DXJF 3DTEA 3M8EA 3AFHA 4PJMA 1WVRA 1T33A 1FBQA 5K1YA 1O3SA 4ABZA 3GZ6A 1FMWA 2E7XA 3MVPA 2VI6A 1FY7A 2DI3A 1D3YA 3LA2A 2R7UA 4D9JA 1FJLA 5FLMJ 2ZFUA 4V2GA 3AAFA 2DOEA 3HIFA 2BXYA 3HKZA 4WK8F 2CO5A 2MD5A 5EGOB 4KDPA 4XLCA 3IV5A 5KK1A 3G4SI 1W36C 5FROA 1H9GA 4LIVA 1OFCX 2FOWA 3WTZA 3HBLA 2VBZA 3AG4H 5IP6A 2VPRA 4MQVA 5FFXA 4XNFA 1JT6A 3OS0A 1RIOH 5LGUA 3T8TA 3TDZC 4UUVA 1IG7A 1K61A 3HUGA 2KZVA 1Z05A 1F5TA 3NRVA 1S5LC 3EYIA 4ZTFA 4KA4A 3FWEA 2DO7A 1X3ZB 2DPDA 3GTGJ 4XKVA 1MNMC 2Y0MA 3L1PA 4A93J 3L09A 2LR8A 4ZYEA 4XL9A 1OCTC 1U2WA 3KFWX 1FBUA 2HTJA 3O8GA 3TOBA 1FX7A 4I01A 1E3HA 1K7AA 2VQCA 1XCBA 3VDXA 5LHHA 2QKMB 3BR1A 3GBGA 3JAMZ 2ZO4A 3C18A 1EH8A 3LFUA 4KT5C 1ZARA 4F7ZA 5D8KB 4FCYA 1G2HA 1MIJA 2LLKA 3TP3A 3FK6A 2F5CA 1ZGWA 2NVTJ 1J09A 3AG3H 2DPUA 1VQ8I 4L5EA 1Z9CA 1T2KA 2E1CA 1K6YA 3NEUA 3MEXA 1IN5A 3PO3J 3PNVA 3MKZA 2DLLA 4B3XA 5ILSA 1YITI 3BLYA 3SZGA 3GFLA 4QIWN 2DA7A 2IVMA 4YG2F 2QUFA 3ELKA 3H9GA 3JW4A 5J4YA 2OTJI 3EUHC 2GZWA 3BTJA 4K2EA 3E6BA 2JVGA 3KLOA 1P4AA 3CCJI 2EIJH 1OISA 3LSTA 1MBEA 2ID6A 1KQ0A 3GTPJ 5CQEA 1SFOJ 4LGWA 2FU4A 2KLOA 2LY1A 2VODA 3OYMA 2RQQA 2B7EA 4IRGA 2NAZA 5LRSA 2HPMA 2E60A 4JX5A 3E5QA 4C3IJ 5HS9A 1E0EA 3FXMA 3SDBA 1U5TA 2Z5UA 3KYLA 3SXYA 1TQMA 3EETA 3M07A 4MEYF 1AKHB 3FDYA 3BQYA 2KFDA 4CDGA 4Y7NJ 3IAS2 4EJWA 1WWXA 1J59A 4UB6C 4IZZA 3A0BC 4A6EA 1IRXA 1BI1A 4LG0B 4GO1A 1B6AA 4XKCA 5DEQA 2GOMA 4A0XA 2HVRA 2X1EA 2P5VA 2A05A 2HVSA 4IOAF 2E5NA 4F91B 5E3NA 2IGKA 2LRDA 4DIQA 1B9NA 2A6TA 3LWFA 1SVMA 3CF2A 3K4JA 4C2UA 2YPRA 3FZVA 1HSTA 3F6OA 1PDNC 2NXNB 3FMQA 4BUPA 4M3FA 4YEJA 4M73A 2NS8A 4OMYA 2DA3A 4EV0A 1RUOA 1OCRH 2HOTA 1D0ZA 3CCUI 2DFFA 3HKZN 1EH7A 2K9SA 1BW6A 2EFNA 3FMRA 5CYVA 5FLVA 3RYPA 1YI2I 4ESBA 3W2WA 1E3PA 2E35A 3QYEA 3HRMA 2BHYA 5DD4A 3TW7A 1D5YA 2KL4A 4JQFA 3L2VA 1ACIA
chains in the Genus database with same CATH topology
3I64A 4NHJA 1QNTA 1ZRFA 3S2WA 1Q1HA 2XASA 3WGHA 2FE3A 1UHMA 3WU1B 4XSXF 4YFXF 3WTSC 4UV9A 3C3WA 2XAHA 3LFKA 2ISZA 1C0WA 5E20A 4KN4X 4O5VA 3IWFA 4P9UA 3M1EA 4MTDA 3RPQA 3IRRA 1U6GA 2NYXA 3V8KA 2RKHA 4G7HF 5ICFA 4ENNA 2M1BA 3QU6A 4R1HA 4BHBA 2FSWA 5H6QA 1U3EM 1R23A 1MGTA 2H6CA 4AVPA 2PQ8A 3N4MA 2V6CA 5CJ9A 2GA1A 3TO7A 3KEQA 2VT2A 1MJAA 3IHUA 1B1BA 5HVQC 4UVAA 2M45A 1K79A 3I4PA 1IXCA 3FHZA 5JR3A 3OOPA 3KP6A 3L2CA 1DDNA 5LEJA 1Z6TA 2XRNA 1U78A 4MNUA 2V1XA 5J8CA 1S7OA 2VOOA 4EM0B 2ZCWA 4LFUA 2F2EA 1YW9A 5LBQA 1T98A 2PMUA 3BZ6A 3WTTC 4ENKA 4DQ2A 2RN7A 3M9AA 3JSOA 5TJJA 1I5ZA 3Q9VA 3VFZA 4P5OA 5FGMA 2K86A 4BNCA 1T38A 1A04A 4EJVA 5IT9Z 1P6RA 3REOA 1K78A 2QWWA 2KJCA 4GYGA 4EM1A 3SQNA 2IPQX 2O03A 3C1DA 5AIPA 4IRIA 5ED4A 3B02A 1JE8A 2EFOA 1R58A 3EUHA 3WTWC 3LQRA 1ULYA 2OD5A 1R36A 2HR3A 1FNNA 1YS7A 4U0YA 4HBLA 3I71A 3SZPA 5DD8A 4AWXB 2A6HF 3J81K 4N9HA 2QBYB 2JPBA 3HSFA 1Z6RA 4WXCA 4JK1X 3ECHA 2L54A 2CWEA 3CTAA 4RGUA 5CVJA 5DCMB 5H6RA 4HYEA 2A61A 2GIVA 3HRSA 1YO5C 4Q4ZF 1P92A 1MDMA 3F21A 2DU9A 2XVCA 3ZN0A 4ZYGA 4WX9A 1CF7B 5D6FA 5E1XA 2LF7A 3FF5A 2XKPA 1XSVA 5KVRA 2OQGA 3R6SA 3W6JB 4A0ZA 3E6CC 3T5XA 3IWZA 1P4XA 3CUOA 1SFUA 2RVCA 4M71A 4L0ZB 2Y75A 1SMTA 3I59A 1PUEE 1XGSA 5FFZA 4Z2YA 2K02A 2BBYA 1GXQA 3NQOA 2M8EA 4RGSA 3BJ6A 3IL2A 1ZLKA 2HDCA 4RB3C 5HDNA 4EVIA 3FXRA 1R1UA 4YFNF 1P4WA 4KUMA 3K9TA 3F6VA 3GW2A 5BS6A 4CXFA 1KU9A 1S29A 1J7KA 1P2FA 4M72A 1K6OA 2V1UA 2EFPA 5CLSA 2WC2A 4BQAA 4D0PA 1SD5A 2VE8A 2L01A 1ZGJA 1B59A 5J6XA 4RGRA 1O3QA 4RAYA 3W6KB 2V9VA 1FPQA 4KMUX 1OYWA 1KYWA 4BHCA 3ZMSA 2D45A 3BWGA 5FO5A 4KICA 1XSXA 1IN7A 1HKSA 5E18F 1LDDA 4BAYA 3GX4X 3VB2A 1LNWA 1Y0UA 4ZYDA 5E1WA 1R5HA 4G8XA 3PQJA 4OU0A 1ON1A 1ONVA 2PBIA 1TTYA 3B73A 1H0MA 4L0YB 3HYIA 1QBJA 2CFXA 5L3BA 4BXUA 2P7CB 3WGGA 1I1SA 1KU3A 4WWCA 4S05A 2PJPA 1MJBA 2HQNA 4N9IA 1RUNA 3MQ0A 3ISPA 2COMA 3GEZA 1TW2A 1J75A 4UXNA 2O3FA 1AWCA 4FHTA 1TW3A 2GAUA 2FQ3A 4I09A 2K4BA 3GFMA 4EJOA 3GYHX 5HLIA 2J5PA 3HHHA 1UCRA 2IJLA 2AS5F 1YIOA 1IXRC 2ZNZA 2ZMEB 4MHGA 4ON0A 1S7AA 5TRDA 2OZUA 5LGNA 1LDKB 2NRAC 2EFWA 4HF2A 3I53A 2KIFA 3DEUA 4WXDA 3I58A 3RYRA 2M5WA 4I02A 2EWNA 2JTVA 3V7SA 2NNNA 2DW4A 5HDGA 1IRGA 2EJRA 3V4GA 1ZG5A 2VONA 3P9KA 1JGSA 4OMZA 3QOPA 2VE9A 1EV7A 1HBXG 4M6XA 3T8RA 1IRFA 4HF0A 1DP7P 2R7FA 3BOQA 1GHCA 1HKTA 3QP6A 5K5RA 3GVAA 1LEBA 1QQIA 1SD6A 1F9NA 4HDUA 4S04A 1SAXA 1IF1A 3E6MA 3MAJA 3KE2A 3SFZA 4IPAA 4XRFA 4PDKA 3HRUA 5ICEA 4FX0A 3WE2A 1Z1DA 2G7UA 4XLPF 1R5GA 2A3SA 3BROA 2P6TA 2AXLA 3H3ZA 4G7ZF 3IC7A 3J81Z 2HS5A 2PEXA 1G3YA 4IF4A 1PP8F 2IP2A 1IUYA 4R8HA 4LG0A 3V8LA 1IW7F 3RIRA 3U1DA 2XKOA 1F1ZA 4CYDA 4UVCA 3F22A 1QZZA 3WTUC 4EGZA 4UV8A 1BM9A 2EK5A 1DPRA 3P9IA 2HFHA 2KKOA 3L7WA 5LLQA 2O8XA 2QVOA 4N0BA 2CG4A 4WF2A 4RB0A 4EQQA 2XV4S 5E17F 1AOYA 2CQKA 1R00A 1BC8C 2RNJA 1KA8A 2GA2A 1UHWA 2Y48A 2PG4A 2UXNA 3O3KA 3LQQA 3CO6C 1XMKA 3HTSB 3GWZA 5HLGA 1W5SA 3DV8A 3ROUA 3D0SA 2L4MA 2Z99A 2RQPA 1YW7A 2YX7A 4HF1A 1Z7UA 1TNSA 2X4HA 5AIQA 4LLGF 1FP2A 1ZREA 1FP1D 1FSHA 4RGXA 4IHSA 3I0TA 4LD5A 2GQQA 4XLNF 3WG9A 5FLXK 3K1PA 3N97A 3C7JA 2GWRA 4AIKA 2ZKZA 2VT3A 4P96A 3H92A 2NS0A 5LGTA 4H0EA 4RS8A 2OQRA 2VC1A 3ERED 2YR2A 1L3LA 4IHTA 3CLOA 1OKRA 2P5KA 5DV5A 2MH2A 4Y15A 1UB9A 1O57A 2PFBA 4HW0A 2C6YA 2HKXA 2QM3A 3GZ5A 4Y17A 2DK5A 1ZN2A 3QP5A 1MKMA 3KP7A 2B0LA 5HOOA 1R22A 2W25A 2EV0A 1J0RA 5ILUA 3J80K 5D4SA 1G3WA 5E8IA 2H09A 1B4AA 1ZYRF 4MGRA 1KQ8A 1W7PA 2YSRA 1UFMA 5ICGA 5A2QK 5D5UB 4KIBA 1FWZA 3DPLC 4A0YA 4A5NA 3RPUA 3E3VA 3R0JA 3IKVA 2WV0A 2QLZA 2V79A 3KZYA 2DK8A 4BH9A 4U7BA 3K69A 2QBYA 3HSRA 2MC3A 4KNYA 5EEHA 2QENA 1O7LA 2QQAA 3E6DA 4HX4A 4L9NA 1XSDA 3T0YA 2H94A 1XGMA 4A6DA 1FC3A 3IRQA 2UWMA 1FT9A 2VBWA 2XHKA 3LAJA 3ZP5A 2VC0A 1VTNC 2XAQA 4JBAA 3E5XA 3PFIA 2F5EA 3ULQB 3WU0A 1W5TA 2ZFWA 3R60A 1XCVA 4U0WA 4KIFA 3DKWA 4WXHA 3BP8A 4Q47A 4RB1A 3QRFF 1BIBA 1R1VA 1OYYA 4HA8A 3FMSA 1K78B 2JZYA 1KU2A 2Q8KA 3K1MA 3E97A 3F8CA 3G3ZA 2PLYA 5CVIA 1DPUA 4ASNA 2GXBA 1LQ1A 2A5YB 3HHGA 1FSEA 1ZG1A 1SD7A 5JHUA 1SD4A 3O6BB 2FA5A 1G4DA 4MEXF 1BJAA 1XB4A 1ZRCA 4B8XA 4I98B 4UHTA 4ENMA 2Z33A 1Z91A 2BEOA 3ABTA 4MTEA 2WWYA 2ESNA 2EV6A 3FM3A 2NNYA 3R4KA 2HGCA 1MDMB 3ZMZA 2FMLA 1D8JA 2R3SA 4I7HA 3WE3A 2FEZA 4AIJA 1MZBA 4OIQF 1T0FA 1RI7A 4BHPA 5JFRA 2BYVE 3P9CA 1O7FA 3ZPLA 4R79A 3CUQB 3MZHA 1SMYF 2P6SA 2VN2A 4LK1F 2W85A 4FX4A 4HQEA 1WSUA 3ZN1A 1YG2A 4HLYA 1TQPA 2HYGD 2FNPA 4PGHA 1IXSB 1HQCA 4PCQA 5JI6A 2RV8A 4OIRF 3WTXC 4M9ZA 1YQAA 1BN5A 1B9MA 2QQ9A 4OIPF 1ZHFA 3HOTA 2EA4A 4U0VA 1W4MA 3LA3A 4CZZA 2K4JA 3QAHA 1WRJA 1G3TA 2Z3YA 3GUDA 3ZQ7A 3TGNA 2UZKA 5BPIA 4P55A 3DFGA 4M9XA 1TLHB 3ABUA 2FOKA 3KP3A 1FLIA 2F5DA 3DP7A 5CVRA 2OAZA 2BE5F 2ZMEA 2QQBA 4EJTA 4ZH4F 3BDDA 4XSZF 5L3EA 1YFHA 1IAWA 2P4WA 2ADUA 2EFQA 2LF8A 3ECOA 1KU7A 2DQLA 3IKTA 5HLHA 2EB7A 5L3CA 2CW0F 2OU2A 1O3TA 3BY6A 5L3FA 3F23A 4BYYA 1TNTA 5BPDA 3PQKA 4Y13A 1ZGAA 3V7RA 5IT9K 3Q9SA 3KCCA 5FB2A 3F8NA 1BOAA 3OV8A 3KEOA 3BPXA 2BV6A 2KIMA 3V8JA 3VEPA 3D5LA 2PN6A 4MQ9F 1QGPA 4OOIA 1WKMA 4EM2A 2LNBA 4RB2C 5F64A 2V1DA 1FYKA 1BBYA 4I0AA 4YIIA 2IW5A 2IA2A 1GVJA 1RNLA 5LHGA 4XBFA 1XD7A 1USSA 5D5WB 3RJPA 5HS8A 1USTA 1IN8A 2A68F 2G7HA 3RTRA 4LJZF 2FMYA 5E1ZB 1V3FA 3U2RA 4YIFA 4ETSA 1OYIA 2O6GE 2DBBA 2O0YA 3GFJA 4UNOA 1L0OC 2XAJA 1GXPA 4HOBA 2HOEA 1T39A 2E7WA 1HW5A 2DT5A 2HTSA 1MD0A 1WI9A 5DUIA 1YW8A 2IT0A 1YTYA 3H3UA 2YX4A 3JTHA 3CO7C 2TDXA 1YS6A 2P8TA 4OIOF 4HX8A 2DAOA 2BGCA 4U88A 3I54A 3RKXA 2A07F 1TQIA 4HZFA 2IRFG 4G7OF 2XROA 2DFIA 4G6DA 2P5LC 2Q0OA 3GLXA 2HKOA 2VBYA 3QPHA 1I6XA 1BIAA 4IXAA 1SFEA 5D5VB 4I2OA 3BPVA 3KETA 3TKYA 4GGGA 3KLNA 1LVAA 5DYMA 3F8BA 3CJNA 4A5MA 3TO6A 2HWVA 4DNCA 1SFXA 2LSOA 1ZH5A 3ZMDA 3TOAA 4OINF 2M87A 4TV7A 1H9TA 5DDGA 1RZ4A 3MFKA 2QZ8A 4IJAA 2L3DA 1V4RA 1JHFA 2JT1A 3JSPA 1FZPB 1I1GA 4HX7A 4A12A 1BI2A 1OR7A 3GFIA 4HQMA 1FBSA 1WQ2A 2IA1A 1IZ1A 2ESHA 1U5TB 4GCVA 4GYIA 1ZAOA 3CUQC 3QPTA 5AONA 2OZ6A 1R1TA 6PAXA 3FM5A 3HTUA 1OMIA 2E1NA 3KP4A 4CGZA 1JXSA 2ETHA 3KP2A 3VOEA 3T1BA 2DQRA 1TBXA 4HLXA 1LDJA 5IT3A 3F3XA 3FX3A 2EV5A 2IA0A 1D5VA 4M9SA 4YFKF 2FRHA 1HW2A 4GXOA 5F6FA 2K27A 3K2ZA 4ZZLA 3SZTA 4LLLA 4LK0F 5H20A 1O3RA 2L02A 2ISYA 2PMHA 2A69F 2KRFA 1E2XA 2Z9OA 3TDUC 2HQRA 1R7JA 3L00A 1BI0A 2W24A 4CO8A 3COAC 1G3SA 1E17A 2HYFA 5ILVA 2XGXA 1KYZA 1J2XA 1HW1A 4PGGA 2X0LA 4L5JA 1PP7U 2VBXA 1ODDA 4G6QA 1FYLA 2STWA 1JHHA 4LLNA 1QZYA 1IN4A 4HDVA 2MH9A 2XIGA 2ELHA 2VXZA 1U8RA 5FD6A 3SHFA 2UXXA 5K5QA 5CVVA 1HKQA 2XAFA 4LB5A 3RKWA 1W7PD 4L9TA 5DCMA 3MZYA 5ERIA 4KYWA 1F4KA 2ZXJA 3WGIA 4IRHA 1W7PB 3F8MA 1CF7A 4HAMA 1X3UA 2RC4A 1HXDA 5DUKA 2FBKA 3LAPA 2FBIA 2R7DA 3J7AO 3JAMK 1FYMA 3WTYC 4G9YA 4M74A 4B09A 2ZBKA 3WODF 5LRRA 2D1VA 2XAGA 3RDIA 2KJBA 5E8GA 1ZG3A 3M8FA 4EGYA 2D2WA 2WTEA 1HSJA 1QPMA 3FXUA 4KN7X 5HS7A 3KZZA 2F5FA 4G94A 5BQTA 2Q2EA 4M6YA 3E5UA 4QLCU 3HRTA 5LEKA 1MJ9A 1XGOA 3KP5A 1T6SA 3RI4A 4L9JA 3Q5FA 3TO9A 2G9WA 1STZA 3GO5A 3TQNA 1J9IA 3M7GA 3HSEA 4UVBA 3P7NA 4E70A 3BJOA 2A6EF 1S6LA 2MA3A 1BI3A 2STTA 3F8FA 3DF8A 2VOPA 2XUBA 3K0LA 3MWMA 5DCFA 4U7DA 3CUQA 3BJAA 2CYYA 2MLGA 2D1HA 2LKPA 2ACJA 1QO0D 1XGNA 3G73A 1S3JA 3ZMUA 4HV6A 2DTRA 3CDHA 2LDUA 2FNAA 3EYYA 4PZJA 5FD5A 4KFCA 1BC7C 5D6EA 4AIHA 2P7VB 5D5XB 5J8FA 4FT8A 3EDPA 3FXQA 2HZTA 3QU3A 1ZLJA 4O6JA 4EJUA 3ZMVA 3WTVC 3JTGA 2FXAA 1NHAA 2H27A 2W57A 5D8LB 5D4RA 3I59B 2HEOA 4A2UA 4NQWA 4ZYHA 3ZMTA 2JPCA 1EH6A 4I0BA 2OA4A 4IVNA 1KQ9A 1G6NA 5LHIA 3V7CA 2EA2A 1FOKA 2CSOA 4L5IA 1DUXC 3U9GA 3GXOA 4L9VA 1U5TC 2MBFA 5HDKA 3LA7A 2JRTA 5JVTA 1REPC 3DPTA 4ESJA 2L4AA 1YYVA 1XN7A 3MCZA 3R0AA 1LEAA 3K1NA 4WCGA 5BMZA 4KMFA 1XMAA 3R61A 1CGPA 4AD9A 5FLXZ 1LJ9A 2H6BA 4LMYA 1ON2A 5L3GA 2K7LA 2ZNYA 3RKYA 5F1RA 1KGSA 4NB5A 5L3DA 1XDSA 3F72A 4CHUA 1YLFA 1IN6A 3HOSA 1S8NA 3L9FA 2QYOA 5CVUA 4KIGA 4LB6B 4ESFA 4Q48A 4CICA 4HV5A 2FBHA 1LB2A 1XDUA 2JSCA 2M30A 2W84A 2J5OA 2ZJ2A 3ML6A 4Q5SF 2GXGA 3DQVC 2OBPA 2MLKA 5EEGA 4QWQA 2FF4A 4EMSA 1D8KA 4O3MA 4RAZA 2RDPA 2RGVA 5K5OA 2YU3A 3J80Z 1ZRDA 4ENJA 4P9FA 3VODA 3GF2A 2CGPA 2KIUA 5BOXA 3EQLF 3I5UA 2PI0A 1I27A 3O2PE 4ZZDA 4L18B 5A2QZ 2O61A 1J5YA 1OPCA 5ICCA 3DXJF 3M8EA 1FBQA 5K1YA 1O3SA 3GZ6A 2E7XA 1FY7A 2DI3A 1D3YA 3LA2A 3AAFA 3HIFA 4WK8F 2CO5A 2MD5A 4KDPA 5KK1A 1H9GA 3WTZA 2VBZA 4MQVA 5FFXA 1RIOH 5LGUA 3T8TA 3TDZC 4UUVA 3HUGA 1Z05A 1F5TA 3NRVA 3EYIA 4KA4A 3FWEA 2DO7A 2DPDA 2Y0MA 3L09A 4ZYEA 1U2WA 3KFWX 1FBUA 2HTJA 3TOBA 1FX7A 4I01A 1K7AA 1XCBA 5LHHA 3JAMZ 2ZO4A 3C18A 1EH8A 4KT5C 1ZARA 4F7ZA 5D8KB 2F5CA 2DPUA 1Z9CA 1T2KA 2E1CA 3NEUA 3MEXA 1IN5A 2DLLA 5ILSA 3GFLA 2IVMA 4YG2F 2QUFA 3ELKA 3JW4A 2GZWA 4K2EA 3E6BA 3KLOA 1P4AA 3LSTA 1KQ0A 4LGWA 2FU4A 2VODA 4IRGA 2NAZA 5LRSA 3E5QA 5HS9A 1U5TA 2Z5UA 3SXYA 1TQMA 3EETA 4MEYF 4CDGA 4EJWA 1WWXA 1J59A 4A6EA 1BI1A 4LG0B 4GO1A 1B6AA 5DEQA 4A0XA 2P5VA 1B9NA 3LWFA 2YPRA 3FZVA 1HSTA 3F6OA 1PDNC 3FMQA 4M73A 4OMYA 4EV0A 1RUOA 1EH7A 2EFNA 3FMRA 5CYVA 3RYPA 4ESBA 5DD4A 3HRMA 4JQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I64 A;  4NHJ A;  1QNT A;  1ZRF A;  3S2W A;  1Q1H A;  2XAS A;  3WGH A;  2FE3 A;  1UHM A;  3WU1 B;  4XSX F;  4YFX F;  3WTS C;  4UV9 A;  3C3W A;  2XAH A;  3LFK A;  2ISZ A;  1C0W A;  5E20 A;  4KN4 X;  4O5V A;  3IWF A;  4P9U A;  3M1E A;  4MTD A;  3RPQ A;  3IRR A;  1U6G A;  2NYX A;  3V8K A;  2RKH A;  4G7H F;  5ICF A;  4ENN A;  2M1B A;  3QU6 A;  4R1H A;  4BHB A;  2FSW A;  5H6Q A;  1U3E M;  1R23 A;  1MGT A;  2H6C A;  4AVP A;  2PQ8 A;  3N4M A;  2V6C A;  5CJ9 A;  2GA1 A;  3TO7 A;  3KEQ A;  2VT2 A;  1MJA A;  3IHU A;  1B1B A;  5HVQ C;  4UVA A;  2M45 A;  1K79 A;  3I4P A;  1IXC A;  3FHZ A;  5JR3 A;  3OOP A;  3KP6 A;  3L2C A;  1DDN A;  5LEJ A;  1Z6T A;  2XRN A;  1U78 A;  4MNU A;  2V1X A;  5J8C A;  1S7O A;  2VOO A;  4EM0 B;  2ZCW A;  4LFU A;  2F2E A;  1YW9 A;  5LBQ A;  1T98 A;  2PMU A;  3BZ6 A;  3WTT C;  4ENK A;  4DQ2 A;  2RN7 A;  3M9A A;  3JSO A;  5TJJ A;  1I5Z A;  3Q9V A;  3VFZ A;  4P5O A;  5FGM A;  2K86 A;  4BNC A;  1T38 A;  1A04 A;  4EJV A;  5IT9 Z;  1P6R A;  3REO A;  1K78 A;  2QWW A;  2KJC A;  4GYG A;  4EM1 A;  3SQN A;  2IPQ X;  2O03 A;  3C1D A;  5AIP A;  4IRI A;  5ED4 A;  3B02 A;  1JE8 A;  2EFO A;  1R58 A;  3EUH A;  3WTW C;  3LQR A;  1ULY A;  2OD5 A;  1R36 A;  2HR3 A;  1FNN A;  1YS7 A;  4U0Y A;  4HBL A;  3I71 A;  3SZP A;  5DD8 A;  4AWX B;  2A6H F;  3J81 K;  4N9H A;  2QBY B;  2JPB A;  3HSF A;  1Z6R A;  4WXC A;  4JK1 X;  3ECH A;  2L54 A;  2CWE A;  3CTA A;  4RGU A;  5CVJ A;  5DCM B;  5H6R A;  4HYE A;  2A61 A;  2GIV A;  3HRS A;  1YO5 C;  4Q4Z F;  1P92 A;  1MDM A;  3F21 A;  2DU9 A;  2XVC A;  3ZN0 A;  4ZYG A;  4WX9 A;  1CF7 B;  5D6F A;  5E1X A;  2LF7 A;  3FF5 A;  2XKP A;  1XSV A;  5KVR A;  2OQG A;  3R6S A;  3W6J B;  4A0Z A;  3E6C C;  3T5X A;  3IWZ A;  1P4X A;  3CUO A;  1SFU A;  2RVC A;  4M71 A;  4L0Z B;  2Y75 A;  1SMT A;  3I59 A;  1PUE E;  1XGS A;  5FFZ A;  4Z2Y A;  2K02 A;  2BBY A;  1GXQ A;  3NQO A;  2M8E A;  4RGS A;  3BJ6 A;  3IL2 A;  1ZLK A;  2HDC A;  4RB3 C;  5HDN A;  4EVI A;  3FXR A;  1R1U A;  4YFN F;  1P4W A;  4KUM A;  3K9T A;  3F6V A;  3GW2 A;  5BS6 A;  4CXF A;  1KU9 A;  1S29 A;  1J7K A;  1P2F A;  4M72 A;  1K6O A;  2V1U A;  2EFP A;  5CLS A;  2WC2 A;  4BQA A;  4D0P A;  1SD5 A;  2VE8 A;  2L01 A;  1ZGJ A;  1B59 A;  5J6X A;  4RGR A;  1O3Q A;  4RAY A;  3W6K B;  2V9V A;  1FPQ A;  4KMU X;  1OYW A;  1KYW A;  4BHC A;  3ZMS A;  2D45 A;  3BWG A;  5FO5 A;  4KIC A;  1XSX A;  1IN7 A;  1HKS A;  5E18 F;  1LDD A;  4BAY A;  3GX4 X;  3VB2 A;  1LNW A;  1Y0U A;  4ZYD A;  5E1W A;  1R5H A;  4G8X A;  3PQJ A;  4OU0 A;  1ON1 A;  1ONV A;  2PBI A;  1TTY A;  3B73 A;  1H0M A;  4L0Y B;  3HYI A;  1QBJ A;  2CFX A;  5L3B A;  4BXU A;  2P7C B;  3WGG A;  1I1S A;  1KU3 A;  4WWC A;  4S05 A;  2PJP A;  1MJB A;  2HQN A;  4N9I A;  1RUN A;  3MQ0 A;  3ISP A;  2COM A;  3GEZ A;  1TW2 A;  1J75 A;  4UXN A;  2O3F A;  1AWC A;  4FHT A;  1TW3 A;  2GAU A;  2FQ3 A;  4I09 A;  2K4B A;  3GFM A;  4EJO A;  3GYH X;  5HLI A;  2J5P A;  3HHH A;  1UCR A;  2IJL A;  2AS5 F;  1YIO A;  1IXR C;  2ZNZ A;  2ZME B;  4MHG A;  4ON0 A;  1S7A A;  5TRD A;  2OZU A;  5LGN A;  1LDK B;  2NRA C;  2EFW A;  4HF2 A;  3I53 A;  2KIF A;  3DEU A;  4WXD A;  3I58 A;  3RYR A;  2M5W A;  4I02 A;  2EWN A;  2JTV A;  3V7S A;  2NNN A;  2DW4 A;  5HDG A;  1IRG A;  2EJR A;  3V4G A;  1ZG5 A;  2VON A;  3P9K A;  1JGS A;  4OMZ A;  3QOP A;  2VE9 A;  1EV7 A;  1HBX G;  4M6X A;  3T8R A;  1IRF A;  4HF0 A;  1DP7 P;  2R7F A;  3BOQ A;  1GHC A;  1HKT A;  3QP6 A;  5K5R A;  3GVA A;  1LEB A;  1QQI A;  1SD6 A;  1F9N A;  4HDU A;  4S04 A;  1SAX A;  1IF1 A;  3E6M A;  3MAJ A;  3KE2 A;  3SFZ A;  4IPA A;  4XRF A;  4PDK A;  3HRU A;  5ICE A;  4FX0 A;  3WE2 A;  1Z1D A;  2G7U A;  4XLP F;  1R5G A;  2A3S A;  3BRO A;  2P6T A;  2AXL A;  3H3Z A;  4G7Z F;  3IC7 A;  3J81 Z;  2HS5 A;  2PEX A;  1G3Y A;  4IF4 A;  1PP8 F;  2IP2 A;  1IUY A;  4R8H A;  4LG0 A;  3V8L A;  1IW7 F;  3RIR A;  3U1D A;  2XKO A;  1F1Z A;  4CYD A;  4UVC A;  3F22 A;  1QZZ A;  3WTU C;  4EGZ A;  4UV8 A;  1BM9 A;  2EK5 A;  1DPR A;  3P9I A;  2HFH A;  2KKO A;  3L7W A;  5LLQ A;  2O8X A;  2QVO A;  4N0B A;  2CG4 A;  4WF2 A;  4RB0 A;  4EQQ A;  2XV4 S;  5E17 F;  1AOY A;  2CQK A;  1R00 A;  1BC8 C;  2RNJ A;  1KA8 A;  2GA2 A;  1UHW A;  2Y48 A;  2PG4 A;  2UXN A;  3O3K A;  3LQQ A;  3CO6 C;  1XMK A;  3HTS B;  3GWZ A;  5HLG A;  1W5S A;  3DV8 A;  3ROU A;  3D0S A;  2L4M A;  2Z99 A;  2RQP A;  1YW7 A;  2YX7 A;  4HF1 A;  1Z7U A;  1TNS A;  2X4H A;  5AIQ A;  4LLG F;  1FP2 A;  1ZRE A;  1FP1 D;  1FSH A;  4RGX A;  4IHS A;  3I0T A;  4LD5 A;  2GQQ A;  4XLN F;  3WG9 A;  5FLX K;  3K1P A;  3N97 A;  3C7J A;  2GWR A;  4AIK A;  2ZKZ A;  2VT3 A;  4P96 A;  3H92 A;  2NS0 A;  5LGT A;  4H0E A;  4RS8 A;  2OQR A;  2VC1 A;  3ERE D;  2YR2 A;  1L3L A;  4IHT A;  3CLO A;  1OKR A;  2P5K A;  5DV5 A;  2MH2 A;  4Y15 A;  1UB9 A;  1O57 A;  2PFB A;  4HW0 A;  2C6Y A;  2HKX A;  2QM3 A;  3GZ5 A;  4Y17 A;  2DK5 A;  1ZN2 A;  3QP5 A;  1MKM A;  3KP7 A;  2B0L A;  5HOO A;  1R22 A;  2W25 A;  2EV0 A;  1J0R A;  5ILU A;  3J80 K;  5D4S A;  1G3W A;  5E8I A;  2H09 A;  1B4A A;  1ZYR F;  4MGR A;  1KQ8 A;  1W7P A;  2YSR A;  1UFM A;  5ICG A;  5A2Q K;  5D5U B;  4KIB A;  1FWZ A;  3DPL C;  4A0Y A;  4A5N A;  3RPU A;  3E3V A;  3R0J A;  3IKV A;  2WV0 A;  2QLZ A;  2V79 A;  3KZY A;  2DK8 A;  4BH9 A;  4U7B A;  3K69 A;  2QBY A;  3HSR A;  2MC3 A;  4KNY A;  5EEH A;  2QEN A;  1O7L A;  2QQA A;  3E6D A;  4HX4 A;  4L9N A;  1XSD A;  3T0Y A;  2H94 A;  1XGM A;  4A6D A;  1FC3 A;  3IRQ A;  2UWM A;  1FT9 A;  2VBW A;  2XHK A;  3LAJ A;  3ZP5 A;  2VC0 A;  1VTN C;  2XAQ A;  4JBA A;  3E5X A;  3PFI A;  2F5E A;  3ULQ B;  3WU0 A;  1W5T A;  2ZFW A;  3R60 A;  1XCV A;  4U0W A;  4KIF A;  3DKW A;  4WXH A;  3BP8 A;  4Q47 A;  4RB1 A;  3QRF F;  1BIB A;  1R1V A;  1OYY A;  4HA8 A;  3FMS A;  1K78 B;  2JZY A;  1KU2 A;  2Q8K A;  3K1M A;  3E97 A;  3F8C A;  3G3Z A;  2PLY A;  5CVI A;  1DPU A;  4ASN A;  2GXB A;  1LQ1 A;  2A5Y B;  3HHG A;  1FSE A;  1ZG1 A;  1SD7 A;  5JHU A;  1SD4 A;  3O6B B;  2FA5 A;  1G4D A;  4MEX F;  1BJA A;  1XB4 A;  1ZRC A;  4B8X A;  4I98 B;  4UHT A;  4ENM A;  2Z33 A;  1Z91 A;  2BEO A;  3ABT A;  4MTE A;  2WWY A;  2ESN A;  2EV6 A;  3FM3 A;  2NNY A;  3R4K A;  2HGC A;  1MDM B;  3ZMZ A;  2FML A;  1D8J A;  2R3S A;  4I7H A;  3WE3 A;  2FEZ A;  4AIJ A;  1MZB A;  4OIQ F;  1T0F A;  1RI7 A;  4BHP A;  5JFR A;  2BYV E;  3P9C A;  1O7F A;  3ZPL A;  4R79 A;  3CUQ B;  3MZH A;  1SMY F;  2P6S A;  2VN2 A;  4LK1 F;  2W85 A;  4FX4 A;  4HQE A;  1WSU A;  3ZN1 A;  1YG2 A;  4HLY A;  1TQP A;  2HYG D;  2FNP A;  4PGH A;  1IXS B;  1HQC A;  4PCQ A;  5JI6 A;  2RV8 A;  4OIR F;  3WTX C;  4M9Z A;  1YQA A;  1BN5 A;  1B9M A;  2QQ9 A;  4OIP F;  1ZHF A;  3HOT A;  2EA4 A;  4U0V A;  1W4M A;  3LA3 A;  4CZZ A;  2K4J A;  3QAH A;  1WRJ A;  1G3T A;  2Z3Y A;  3GUD A;  3ZQ7 A;  3TGN A;  2UZK A;  5BPI A;  4P55 A;  3DFG A;  4M9X A;  1TLH B;  3ABU A;  2FOK A;  3KP3 A;  1FLI A;  2F5D A;  3DP7 A;  5CVR A;  2OAZ A;  2BE5 F;  2ZME A;  2QQB A;  4EJT A;  4ZH4 F;  3BDD A;  4XSZ F;  5L3E A;  1YFH A;  1IAW A;  2P4W A;  2ADU A;  2EFQ A;  2LF8 A;  3ECO A;  1KU7 A;  2DQL A;  3IKT A;  5HLH A;  2EB7 A;  5L3C A;  2CW0 F;  2OU2 A;  1O3T A;  3BY6 A;  5L3F A;  3F23 A;  4BYY A;  1TNT A;  5BPD A;  3PQK A;  4Y13 A;  1ZGA A;  3V7R A;  5IT9 K;  3Q9S A;  3KCC A;  5FB2 A;  3F8N A;  1BOA A;  3OV8 A;  3KEO A;  3BPX A;  2BV6 A;  2KIM A;  3V8J A;  3VEP A;  3D5L A;  2PN6 A;  4MQ9 F;  1QGP A;  4OOI A;  1WKM A;  4EM2 A;  2LNB A;  4RB2 C;  5F64 A;  2V1D A;  1FYK A;  1BBY A;  4I0A A;  4YII A;  2IW5 A;  2IA2 A;  1GVJ A;  1RNL A;  5LHG A;  4XBF A;  1XD7 A;  1USS A;  5D5W B;  3RJP A;  5HS8 A;  1UST A;  1IN8 A;  2A68 F;  2G7H A;  3RTR A;  4LJZ F;  2FMY A;  5E1Z B;  1V3F A;  3U2R A;  4YIF A;  4ETS A;  1OYI A;  2O6G E;  2DBB A;  2O0Y A;  3GFJ A;  4UNO A;  1L0O C;  2XAJ A;  1GXP A;  4HOB A;  2HOE A;  1T39 A;  2E7W A;  1HW5 A;  2DT5 A;  2HTS A;  1MD0 A;  1WI9 A;  5DUI A;  1YW8 A;  2IT0 A;  1YTY A;  3H3U A;  2YX4 A;  3JTH A;  3CO7 C;  2TDX A;  1YS6 A;  2P8T A;  4OIO F;  4HX8 A;  2DAO A;  2BGC A;  4U88 A;  3I54 A;  3RKX A;  2A07 F;  1TQI A;  4HZF A;  2IRF G;  4G7O F;  2XRO A;  2DFI A;  4G6D A;  2P5L C;  2Q0O A;  3GLX A;  2HKO A;  2VBY A;  3QPH A;  1I6X A;  1BIA A;  4IXA A;  1SFE A;  5D5V B;  4I2O A;  3BPV A;  3KET A;  3TKY A;  4GGG A;  3KLN A;  1LVA A;  5DYM A;  3F8B A;  3CJN A;  4A5M A;  3TO6 A;  2HWV A;  4DNC A;  1SFX A;  2LSO A;  1ZH5 A;  3ZMD A;  3TOA A;  4OIN F;  2M87 A;  4TV7 A;  1H9T A;  5DDG A;  1RZ4 A;  3MFK A;  2QZ8 A;  4IJA A;  2L3D A;  1V4R A;  1JHF A;  2JT1 A;  3JSP A;  1FZP B;  1I1G A;  4HX7 A;  4A12 A;  1BI2 A;  1OR7 A;  3GFI A;  4HQM A;  1FBS A;  1WQ2 A;  2IA1 A;  1IZ1 A;  2ESH A;  1U5T B;  4GCV A;  4GYI A;  1ZAO A;  3CUQ C;  3QPT A;  5AON A;  2OZ6 A;  1R1T A;  6PAX A;  3FM5 A;  3HTU A;  1OMI A;  2E1N A;  3KP4 A;  4CGZ A;  1JXS A;  2ETH A;  3KP2 A;  3VOE A;  3T1B A;  2DQR A;  1TBX A;  4HLX A;  1LDJ A;  5IT3 A;  3F3X A;  3FX3 A;  2EV5 A;  2IA0 A;  1D5V A;  4M9S A;  4YFK F;  2FRH A;  1HW2 A;  4GXO A;  5F6F A;  2K27 A;  3K2Z A;  4ZZL A;  3SZT A;  4LLL A;  4LK0 F;  5H20 A;  1O3R A;  2L02 A;  2ISY A;  2PMH A;  2A69 F;  2KRF A;  1E2X A;  2Z9O A;  3TDU C;  2HQR A;  1R7J A;  3L00 A;  1BI0 A;  2W24 A;  4CO8 A;  3COA C;  1G3S A;  1E17 A;  2HYF A;  5ILV A;  2XGX A;  1KYZ A;  1J2X A;  1HW1 A;  4PGG A;  2X0L A;  4L5J A;  1PP7 U;  2VBX A;  1ODD A;  4G6Q A;  1FYL A;  2STW A;  1JHH A;  4LLN A;  1QZY A;  1IN4 A;  4HDV A;  2MH9 A;  2XIG A;  2ELH A;  2VXZ A;  1U8R A;  5FD6 A;  3SHF A;  2UXX A;  5K5Q A;  5CVV A;  1HKQ A;  2XAF A;  4LB5 A;  3RKW A;  1W7P D;  4L9T A;  5DCM A;  3MZY A;  5ERI A;  4KYW A;  1F4K A;  2ZXJ A;  3WGI A;  4IRH A;  1W7P B;  3F8M A;  1CF7 A;  4HAM A;  1X3U A;  2RC4 A;  1HXD A;  5DUK A;  2FBK A;  3LAP A;  2FBI A;  2R7D A;  3J7A O;  3JAM K;  1FYM A;  3WTY C;  4G9Y A;  4M74 A;  4B09 A;  2ZBK A;  3WOD F;  5LRR A;  2D1V A;  2XAG A;  3RDI A;  2KJB A;  5E8G A;  1ZG3 A;  3M8F A;  4EGY A;  2D2W A;  2WTE A;  1HSJ A;  1QPM A;  3FXU A;  4KN7 X;  5HS7 A;  3KZZ A;  2F5F A;  4G94 A;  5BQT A;  2Q2E A;  4M6Y A;  3E5U A;  4QLC U;  3HRT A;  5LEK A;  1MJ9 A;  1XGO A;  3KP5 A;  1T6S A;  3RI4 A;  4L9J A;  3Q5F A;  3TO9 A;  2G9W A;  1STZ A;  3GO5 A;  3TQN A;  1J9I A;  3M7G A;  3HSE A;  4UVB A;  3P7N A;  4E70 A;  3BJO A;  2A6E F;  1S6L A;  2MA3 A;  1BI3 A;  2STT A;  3F8F A;  3DF8 A;  2VOP A;  2XUB A;  3K0L A;  3MWM A;  5DCF A;  4U7D A;  3CUQ A;  3BJA A;  2CYY A;  2MLG A;  2D1H A;  2LKP A;  2ACJ A;  1QO0 D;  1XGN A;  3G73 A;  1S3J A;  3ZMU A;  4HV6 A;  2DTR A;  3CDH A;  2LDU A;  2FNA A;  3EYY A;  4PZJ A;  5FD5 A;  4KFC A;  1BC7 C;  5D6E A;  4AIH A;  2P7V B;  5D5X B;  5J8F A;  4FT8 A;  3EDP A;  3FXQ A;  2HZT A;  3QU3 A;  1ZLJ A;  4O6J A;  4EJU A;  3ZMV A;  3WTV C;  3JTG A;  2FXA A;  1NHA A;  2H27 A;  2W57 A;  5D8L B;  5D4R A;  3I59 B;  2HEO A;  4A2U A;  4NQW A;  4ZYH A;  3ZMT A;  2JPC A;  1EH6 A;  4I0B A;  2OA4 A;  4IVN A;  1KQ9 A;  1G6N A;  5LHI A;  3V7C A;  2EA2 A;  1FOK A;  2CSO A;  4L5I A;  1DUX C;  3U9G A;  3GXO A;  4L9V A;  1U5T C;  2MBF A;  5HDK A;  3LA7 A;  2JRT A;  5JVT A;  1REP C;  3DPT A;  4ESJ A;  2L4A A;  1YYV A;  1XN7 A;  3MCZ A;  3R0A A;  1LEA A;  3K1N A;  4WCG A;  5BMZ A;  4KMF A;  1XMA A;  3R61 A;  1CGP A;  4AD9 A;  5FLX Z;  1LJ9 A;  2H6B A;  4LMY A;  1ON2 A;  5L3G A;  2K7L A;  2ZNY A;  3RKY A;  5F1R A;  1KGS A;  4NB5 A;  5L3D A;  1XDS A;  3F72 A;  4CHU A;  1YLF A;  1IN6 A;  3HOS A;  1S8N A;  3L9F A;  2QYO A;  5CVU A;  4KIG A;  4LB6 B;  4ESF A;  4Q48 A;  4CIC A;  4HV5 A;  2FBH A;  1LB2 A;  1XDU A;  2JSC A;  2M30 A;  2W84 A;  2J5O A;  2ZJ2 A;  3ML6 A;  4Q5S F;  2GXG A;  3DQV C;  2OBP A;  2MLK A;  5EEG A;  4QWQ A;  2FF4 A;  4EMS A;  1D8K A;  4O3M A;  4RAZ A;  2RDP A;  2RGV A;  5K5O A;  2YU3 A;  3J80 Z;  1ZRD A;  4ENJ A;  4P9F A;  3VOD A;  3GF2 A;  2CGP A;  2KIU A;  5BOX A;  3EQL F;  3I5U A;  2PI0 A;  1I27 A;  3O2P E;  4ZZD A;  4L18 B;  5A2Q Z;  2O61 A;  1J5Y A;  1OPC A;  5ICC A;  3DXJ F;  3M8E A;  1FBQ A;  5K1Y A;  1O3S A;  3GZ6 A;  2E7X A;  1FY7 A;  2DI3 A;  1D3Y A;  3LA2 A;  3AAF A;  3HIF A;  4WK8 F;  2CO5 A;  2MD5 A;  4KDP A;  5KK1 A;  1H9G A;  3WTZ A;  2VBZ A;  4MQV A;  5FFX A;  1RIO H;  5LGU A;  3T8T A;  3TDZ C;  4UUV A;  3HUG A;  1Z05 A;  1F5T A;  3NRV A;  3EYI A;  4KA4 A;  3FWE A;  2DO7 A;  2DPD A;  2Y0M A;  3L09 A;  4ZYE A;  1U2W A;  3KFW X;  1FBU A;  2HTJ A;  3TOB A;  1FX7 A;  4I01 A;  1K7A A;  1XCB A;  5LHH A;  3JAM Z;  2ZO4 A;  3C18 A;  1EH8 A;  4KT5 C;  1ZAR A;  4F7Z A;  5D8K B;  2F5C A;  2DPU A;  1Z9C A;  1T2K A;  2E1C A;  3NEU A;  3MEX A;  1IN5 A;  2DLL A;  5ILS A;  3GFL A;  2IVM A;  4YG2 F;  2QUF A;  3ELK A;  3JW4 A;  2GZW A;  4K2E A;  3E6B A;  3KLO A;  1P4A A;  3LST A;  1KQ0 A;  4LGW A;  2FU4 A;  2VOD A;  4IRG A;  2NAZ A;  5LRS A;  3E5Q A;  5HS9 A;  1U5T A;  2Z5U A;  3SXY A;  1TQM A;  3EET A;  4MEY F;  4CDG A;  4EJW A;  1WWX A;  1J59 A;  4A6E A;  1BI1 A;  4LG0 B;  4GO1 A;  1B6A A;  5DEQ A;  4A0X A;  2P5V A;  1B9N A;  3LWF A;  2YPR A;  3FZV A;  1HST A;  3F6O A;  1PDN C;  3FMQ A;  4M73 A;  4OMY A;  4EV0 A;  1RUO A;  1EH7 A;  2EFN A;  3FMR A;  5CYV A;  3RYP A;  4ESB A;  5DD4 A;  3HRM A;  4JQF A; 
#chains in the Genus database with same CATH topology
 1GLN A;  1MH4 A;  3I64 A;  4BGD A;  4NHJ A;  1MBG A;  1QNT A;  2ME0 A;  2HXO A;  3S2W A;  1ZRF A;  1Q1H A;  2XAS A;  4C2T A;  3WGH A;  3HPH A;  2FE3 A;  1JI8 A;  2I10 A;  1H89 C;  1UHM A;  3WU1 B;  4XSX F;  3MD2 A;  4YFX F;  2I8D A;  2R7Z J;  3WTS C;  1IV6 A;  3PUF A;  2IBD A;  4UV9 A;  1SC7 A;  3C3W A;  2XAH A;  1P7J A;  4G6T B;  3VWB A;  3LFK A;  2ISZ A;  1XTA A;  1N75 A;  2W7N A;  1U9O A;  1C0W A;  3C2B A;  3MKW B;  5E20 A;  1LUJ B;  4KN4 X;  2Z1D A;  4O5V A;  3H9Q A;  3IWF A;  3PNT A;  4XRS G;  4P9U A;  2NVQ J;  3M1E A;  1TWF J;  4MTD A;  3KX2 A;  4HSR A;  1VQ4 I;  3BG3 A;  5GPA A;  3CJT B;  1P7I A;  3BR3 A;  3RPQ A;  3JCU C;  3IRR A;  2W1O A;  1U6G A;  1WJB A;  1K4T A;  2NYX A;  3V8K A;  1BW5 A;  2RKH A;  5J1U A;  3UR3 C;  3CP2 A;  4G7H F;  5ICF A;  2DYR H;  4ENN A;  2M1B A;  3QU6 A;  1YHQ I;  4R1H A;  2WAQ A;  1ZR4 A;  3EUA A;  2FSW A;  2V26 A;  5H6Q A;  4AUX A;  4BHB A;  1U3E M;  2WBM A;  4ZC3 A;  1R23 A;  2ELJ A;  1XPX A;  1MGT A;  4HNU A;  2H6C A;  2KDZ A;  4AVP A;  2PQ8 A;  3N4M A;  1X4O A;  2V6C A;  3ERM A;  5CJ9 A;  3PIP F;  2JQ7 A;  2JA8 J;  2GA1 A;  3TO7 A;  3KEQ A;  3S2D J;  2VT2 A;  1MJA A;  3GCM A;  3IHU A;  4XKB A;  5EF6 A;  1VQL I;  1B1B A;  5HVQ C;  4C30 A;  4UVA A;  4A3M J;  2M45 A;  3ZOB A;  2DMP A;  1K79 A;  3I4P A;  1IXC A;  3PUB A;  2CW7 A;  3FHZ A;  5JR3 A;  3OOP A;  3BZK A;  3KP6 A;  3L2C A;  3IUO A;  3KZI C;  1DDN A;  1QVT A;  1IC8 A;  5LEJ A;  1Z6T A;  1NG6 A;  2XRN A;  1U78 A;  3GME A;  4CSW A;  1WFX A;  1WHU A;  4MNU A;  2V1X A;  2VJI A;  5J8C A;  1S7O A;  3HEF A;  2VOO A;  3BG9 A;  4EM0 B;  4A3L J;  1HA8 A;  1MND A;  5C44 J;  3J7A Y;  2ZCW A;  4LFU A;  4BQN A;  3CCE I;  2CFO A;  2F2E A;  5B1A H;  1KON A;  1YW9 A;  5LBQ A;  3BC8 A;  1DU0 A;  1T98 A;  2PMU A;  3BZ6 A;  2VPL A;  1Y1V J;  3WTT C;  4ENK A;  2JWT A;  4DQ2 A;  5C4J J;  1X4P A;  2KDO A;  3ASO H;  4J19 A;  2RN7 A;  3M9A A;  4FE7 A;  4PJJ A;  2W00 A;  3JRG A;  2F4M B;  4ZJZ A;  3JSO A;  3A0H C;  5TJJ A;  3ZQQ A;  1I5Z A;  3Q9V A;  2DOD A;  3MKL A;  4YEL A;  3VFZ A;  4P5O A;  3AL0 B;  4JYK A;  4OWR B;  5C4X J;  5FGM A;  3FHN A;  2K86 A;  2NVX J;  4BNC A;  3JRF A;  1T38 A;  1YJN I;  1A04 A;  4EJV A;  5KAF C;  5IT9 Z;  5HOD A;  3VYS B;  3SDG A;  4A3I J;  4QPO A;  3HOU J;  1P6R A;  3REO A;  1K78 A;  2QWW A;  1H8A C;  2KJC A;  2JRM A;  4GYG A;  4D5C A;  4EM1 A;  3S3M A;  3SQN A;  3DU5 A;  2IPQ X;  1POG A;  2O03 A;  3ONQ A;  1SAU A;  1XMX A;  2E71 A;  3C1D A;  5AIP A;  3Q3S A;  4UUS A;  2VUM J;  4IRI A;  5ED4 A;  3B02 A;  1WJD A;  1JE8 A;  2EFO A;  1D0Y A;  1R58 A;  3EUH A;  4NUB A;  1VQK I;  1A6Q A;  3WTW C;  3LQR A;  1ULY A;  2OD5 A;  4XK4 A;  1I3A A;  1R36 A;  2HR3 A;  5M5X J;  2K9Q A;  1JKQ C;  1FNN A;  1YS7 A;  4U0Y A;  4HBL A;  2M7A A;  3I71 A;  2CS3 A;  5DD8 A;  2O5R A;  3SZP A;  4AWX B;  2A6H F;  3J81 K;  4N9H A;  2ME6 A;  4FTH A;  3BR0 A;  2QBY B;  2M3A A;  4QPQ A;  2JPB A;  3HSF A;  3VYR B;  1Z6R A;  4WXC A;  4JK1 X;  3ZQG A;  5EG0 B;  3ZQH A;  3ECH A;  1B8I B;  2L54 A;  1OJL A;  2CWE A;  3CTA A;  4RGU A;  2IS6 A;  5CVJ A;  5DCM B;  5H6R A;  4HYE A;  5F08 A;  2A61 A;  2GIV A;  2VJJ A;  3NWT A;  3HRS A;  1YO5 C;  4Q4Z F;  1P92 A;  1MDM A;  2WB1 A;  3OIP A;  3F21 A;  2DU9 A;  3RCO A;  3ZXS A;  3JRC A;  2XVC A;  3GZN B;  4BY1 J;  2R5Z B;  2OJE D;  3ZN0 A;  3UNG C;  4ZYG A;  2D5V A;  1MMS A;  2QSH X;  4WX9 A;  4II2 A;  4XM3 A;  5D6F A;  1CF7 B;  1Y1W J;  4XN0 A;  5K7H A;  2W4S A;  4MIM A;  5E1X A;  3A02 A;  1VQP I;  2NOJ B;  2LF7 A;  1N78 A;  1R4M B;  3DTK A;  3FF5 A;  4XR6 A;  2XKP A;  1XSV A;  4Y52 J;  5KVR A;  2OQG A;  4UY8 I;  3R6S A;  4RM3 A;  3W6J B;  1OCZ H;  2XC7 A;  4A0Z A;  3E6C C;  3KIO A;  3T5X A;  2Y30 A;  5KNL A;  3IWZ A;  1P4X A;  3CUO A;  2L9S A;  3IH3 A;  3ZGK A;  1SFU A;  2GIZ A;  2RVC A;  3I9V 2;  1QRY A;  5EEA A;  2DA6 A;  3WG7 H;  4M71 A;  5B5E C;  2FD5 A;  4PJ0 C;  1IV8 A;  2VQH A;  3L2R A;  5LD2 C;  3PJR A;  2JUG A;  4L0Z B;  2Y75 A;  1YJW I;  1MBK A;  1SMT A;  3I59 A;  1TWG J;  1PUE E;  1Z77 A;  1XGS A;  2Q2E B;  4II3 A;  5FFZ A;  4Z2Y A;  2K02 A;  1SEU A;  1V55 H;  2BBY A;  1GXQ A;  3NQO A;  3HL2 A;  2M8E A;  4RGS A;  1ITY A;  4EAT A;  3BJ6 A;  1LVK A;  3IL2 A;  1X1B A;  1GDT A;  4XOR A;  1ZLK A;  2XSJ C;  4RB3 C;  5F27 A;  2HDC A;  5HDN A;  2LK2 A;  2LKS A;  4EVI A;  3J7Y J;  2HPI A;  3FXR A;  1R1U A;  1WGX A;  1VQ7 I;  5GTI C;  4YFN F;  1P4W A;  1RR8 C;  2HNH A;  4KUM A;  3CC7 I;  3K9T A;  3F6V A;  2JSP A;  3GW2 A;  5BS6 A;  4CXF A;  3MN2 A;  3S93 A;  1KU9 A;  1S29 A;  5M5W J;  3ZQL A;  1J7K A;  5FRN A;  2EZL A;  2ZB9 A;  4CCK A;  3CCS I;  1P2F A;  2KIS A;  4M72 A;  1K6O A;  3HJE A;  2V1U A;  2EFP A;  5CLS A;  2FUG 2;  2WC2 A;  4BQA A;  3G1L A;  4D0P A;  2VE8 A;  1SD5 A;  1PUF A;  4M6V A;  1FIP A;  2L01 A;  4CYC B;  2JA5 J;  2K40 A;  4DYQ A;  3G2B A;  3VYT B;  1ZGJ A;  3JR9 A;  3RSN A;  1B59 A;  3H0D A;  5J6X A;  4RGR A;  3HB9 A;  1O3Q A;  4XID A;  4RAY A;  4E7L A;  3W6K B;  1B72 A;  2V9V A;  1FPQ A;  2M8G X;  3TED A;  4KMU X;  3C2H A;  4A3G J;  2BY1 A;  1I50 J;  1OYW A;  2VKV A;  1KYW A;  1PJR A;  1VZ0 A;  4DZJ A;  4BHC A;  5EZH A;  3ZMS A;  2D45 A;  3BWG A;  5FO5 A;  4KIC A;  1XSX A;  1IN7 A;  3A2K A;  1HKS A;  3H35 A;  5E18 F;  3B6A A;  1LDD A;  4RAF A;  4BAY A;  4F52 A;  3GX4 X;  5F0H A;  1X1D A;  4BY7 J;  2WB1 N;  4CCL A;  4E7I A;  3VB2 A;  1LNW A;  5IOY A;  1Y0U A;  4ZYD A;  2NS7 A;  4LIT A;  5E1W A;  4IQ4 A;  2HXI A;  1R5H A;  4G8X A;  3PQJ A;  4OU0 A;  1ON1 A;  1ONV A;  2PBI A;  1TTY A;  2IGN A;  3B73 A;  1ETV A;  1H0M A;  3DLA A;  4L0Y B;  2L2O A;  2XF6 A;  2BY3 A;  3HYI A;  1QBJ A;  2CFX A;  5L3B A;  2QGU A;  4DYC A;  2HZD A;  5CPR B;  4BXU A;  4M3G A;  3E0J B;  2P7C B;  2LRE A;  2CU7 A;  1LFB A;  2E34 A;  3WGG A;  1QPI A;  4B47 A;  1VQ5 I;  5DM6 F;  2K3P A;  5IYD J;  1I1S A;  1KU3 A;  3HPG A;  4WWC A;  4S05 A;  2PJP A;  1LE8 A;  1MJB A;  4A3B J;  2HQN A;  4HNV A;  5J1Y A;  4N9I A;  4JP0 A;  1RUN A;  3MQ0 A;  5EYR A;  3ISP A;  3QYF A;  1IUF A;  2COM A;  3GEZ A;  1TW2 A;  1J75 A;  3NWS A;  4UXN A;  2O3F A;  3M1C A;  1AWC A;  4FHT A;  2E2I J;  1TW3 A;  2GAU A;  5M3M J;  2FQ3 A;  4I09 A;  1DGW Y;  2LBF B;  2K4B A;  3GFM A;  4EJO A;  3GYH X;  5HLI A;  3BG5 A;  2J5P A;  2YUS A;  1X3W B;  3CF5 F;  3HHH A;  2AHQ A;  1UCR A;  4BE2 A;  2NVU B;  2GBY A;  2IJL A;  2AS5 F;  4IHW A;  1YIO A;  3TW6 A;  4KJZ A;  1IXR C;  2AQE A;  2PMZ N;  3E1S A;  2ZNZ A;  4D5F A;  3V42 A;  2N8G A;  4A3C J;  2X1C A;  3BG6 A;  4XN3 A;  2ZME B;  4MHG A;  4C9Y A;  4ON0 A;  1HLV A;  2PJR A;  1S7A A;  5TRD A;  3BCB A;  1OCC H;  2OZU A;  5LGN A;  5EGO A;  1LDK B;  1WJC A;  2NRA C;  2EFW A;  1RC9 A;  4HF2 A;  3K4C A;  2GXA A;  3I53 A;  2KIF A;  3DEU A;  4UUT A;  4WXD A;  5E3L A;  3K4L A;  2RAE A;  3I58 A;  4HG2 A;  2MC4 A;  2WV1 A;  3RYR A;  2OPT A;  1PYV A;  2IXS A;  2M5W A;  4I02 A;  1Z0X A;  2EWN A;  1OQY A;  2JTV A;  3V7S A;  4XRS A;  3DWL E;  2NNN A;  3X2Q H;  1FEX A;  2DW4 A;  5HDG A;  4F55 A;  1IRG A;  1WPK A;  2EJR A;  3FK7 A;  3V4G A;  1R9T J;  1ZG5 A;  1GT0 C;  2VON A;  3P9K A;  1JGS A;  4OMZ A;  3QOP A;  2VE9 A;  1V54 H;  1EV7 A;  2K5C A;  1HBX G;  4X6A J;  3ABL H;  3OR1 C;  3HG9 A;  4M6X A;  3T8R A;  1IRF A;  2DYS H;  2XF5 A;  4HF0 A;  2CQQ A;  1K83 J;  1DP7 P;  2R7F A;  3BOQ A;  4QTR A;  1GHC A;  1HKT A;  3K6G A;  4BQQ A;  3QP6 A;  3S1Q J;  1MMG A;  2BVL A;  5K5R A;  3GVA A;  4PSW A;  4CH7 A;  1LEB A;  2EZH A;  3H5N A;  1QQI A;  2E1O A;  4ZDL A;  1SD6 A;  1ENH A;  1F9N A;  3OIQ A;  3TP0 A;  4HDU A;  3DBL B;  3DLL F;  4S04 A;  1SAX A;  3FBN B;  1IF1 A;  3GTM J;  1ETQ A;  3E6M A;  3MAJ A;  3KE2 A;  2VJ4 A;  2OCC H;  3SFZ A;  2KHM A;  2XDV A;  3M4O J;  4IPA A;  4XRF A;  1TWH J;  2WA0 A;  4PDK A;  3HRU A;  5ICE A;  4PJN A;  3LSH A;  2PX9 A;  1YIJ I;  2CUJ A;  2VB6 A;  3OOU A;  1Z3Y A;  2JK3 A;  1Z1D A;  4FX0 A;  3WE2 A;  2G7U A;  1HOM A;  1JUS A;  4V2F A;  2X1D A;  3JRB A;  4XLP F;  3SYT A;  1R5G A;  2A3S A;  3BRO A;  4XOP A;  2P6T A;  3OYH A;  2XPU A;  2AXL A;  3H3Z A;  4BEH A;  4G7Z F;  3IC7 A;  1VFC A;  3J81 Z;  1JGG A;  2HS5 A;  5K7F A;  1JUM A;  5IOZ A;  2CQN A;  1FMV A;  2PEX A;  1VQ6 I;  1G3Y A;  1AKH A;  1U9N A;  4IF4 A;  3BTL A;  1PP8 F;  2IP2 A;  1IUY A;  1JT0 A;  2F48 A;  3L2U A;  1I39 A;  4R8H A;  4LG0 A;  5GTH C;  3V8L A;  1IW7 F;  3RIR A;  3U1D A;  2XKO A;  2ZSH B;  3D5S C;  1F1Z A;  4FAS D;  1JJ6 C;  4CYD A;  2DN0 A;  2CRG A;  3HUG B;  4UVC A;  1QZZ A;  3E7L A;  3WTU C;  3F22 A;  4EGZ A;  4UV8 A;  2R5Y B;  3CZ6 A;  1BM9 A;  2EK5 A;  1DPR A;  2DOF A;  3P9I A;  3GTL J;  1ETO A;  2HFH A;  2KKO A;  3L7W A;  2L9V A;  4PJL A;  2VQG A;  3DBR B;  1X58 A;  5LLQ A;  4E6K G;  5KCM A;  2O8X A;  5F1J A;  5J3L A;  2QVO A;  1XG1 A;  1SAN A;  3GTJ J;  1RES A;  4N0B A;  4ZTJ A;  2CG4 A;  4WF2 A;  4RB0 A;  4EQQ A;  2XV4 S;  4HNT A;  5E17 F;  2CQK A;  1AOY A;  1R00 A;  1BC8 C;  2RNJ A;  1KA8 A;  1XC5 A;  2GA2 A;  1D1C A;  4NBQ A;  1UHW A;  2Y48 A;  5FRM A;  3HGG A;  1TP4 A;  4JOM A;  3OR2 C;  3JRA A;  3W3C A;  2YU9 J;  2X48 A;  1F36 A;  2PG4 A;  2UXN A;  3O3K A;  3LQQ A;  4NC6 A;  2F4I A;  2CUE A;  4HEA 2;  2Y69 H;  3CO6 C;  2HVQ A;  4RAG A;  1XMK A;  3HTS B;  3GWZ A;  5HLG A;  1W5S A;  3OS2 A;  1T08 B;  1QU3 A;  3DV8 A;  4IHY A;  3ROU A;  3D0S A;  5GAE J;  2E2H J;  4CCM A;  3L2W A;  2L4M A;  2Z99 A;  3JRE A;  4AVZ A;  2RQP A;  2AXT C;  1YW7 A;  2XGC A;  1DP3 A;  2YX7 A;  4HF1 A;  1Z7U A;  1TNS A;  2X4H A;  5IPA A;  3CCQ I;  2EIL H;  4FQG A;  5AIQ A;  4LLG F;  1FP2 A;  1MSF C;  2M7B A;  2BHZ A;  1FP1 D;  1ZRE A;  1KZH A;  5B3S H;  1FSH A;  2EZI A;  1QA6 A;  4RGX A;  4IHS A;  1APL C;  3I0T A;  3NAU A;  4LD5 A;  2GQQ A;  2ECB A;  2L5Q A;  1QHG A;  4XLN F;  3WG9 A;  4LIU A;  5FLX K;  3CCV I;  3K1P A;  3N97 A;  3C7J A;  4Y33 A;  2GWR A;  1X1C A;  2HYJ A;  4AIK A;  2ZKZ A;  1ETX A;  2L7M P;  2VT3 A;  4P96 A;  1AHD P;  1UJ8 A;  1TC3 C;  3H92 A;  5HNF A;  4E7J A;  1D1A A;  4PFP A;  2NS0 A;  5LGT A;  4H0E A;  3DKX A;  2DT6 A;  5CKT A;  4RS8 A;  2OQR A;  1RPW A;  3HOY J;  1W1W E;  2V9K A;  2VC1 A;  4J01 A;  3ERE D;  4MFE A;  3H5A A;  2YR2 A;  4IL6 C;  1L3L A;  3M3Y J;  1OLT A;  4IHT A;  3FKI J;  3CLO A;  1OKR A;  2X6X A;  1R5I D;  2P5K A;  5DV5 A;  2MH2 A;  4Y15 A;  1UB9 A;  3QOD A;  1P9Q C;  1O57 A;  4M3D A;  3A01 A;  2KRH A;  3Q0W A;  1IO2 A;  2PFB A;  4HW0 A;  4XOT A;  2KPM A;  4F92 B;  2C6Y A;  4BJ6 C;  2HKX A;  2QM3 A;  3GZ5 A;  4Y17 A;  3OYG A;  2DK5 A;  3K70 D;  3PSI A;  1ZN2 A;  3PFY A;  3FXO A;  2VLA A;  1IDY A;  4XIC A;  1ZR2 A;  3QP5 A;  1MKM A;  4A3J J;  4IO9 F;  3KP7 A;  2VXD A;  4Z6Y A;  2B0L A;  3KYD B;  5HOO A;  2V6E A;  2KP6 A;  3PO2 J;  5LFA A;  1R22 A;  2BZT A;  3CJR B;  1NK3 P;  1S72 I;  2W25 A;  2EV0 A;  1J0R A;  3G71 I;  5ILU A;  3J80 K;  5D4S A;  1G3W A;  5E8I A;  4CCJ A;  2KZG A;  2H09 A;  1B4A A;  3LSR A;  1ZYR F;  2L0K A;  1YOV B;  3OSF A;  4MGR A;  1KQ8 A;  1W7P A;  2H8W A;  1UAA A;  2ZC2 A;  2YSR A;  5FKL A;  4IQJ A;  1UFM A;  1YE9 A;  2COB A;  5ICG A;  4JX6 A;  3CES A;  5A2Q K;  5D5U B;  2DMT A;  2M9H A;  4KIB A;  1FWZ A;  2L9R A;  3K4M A;  2HQA A;  3DPL C;  4A0Y A;  4A5N A;  1LPQ A;  3RPU A;  3E3V A;  3R0J A;  3IKV A;  2EPF A;  2WV0 A;  2QLZ A;  3DU6 A;  2UV1 A;  2V79 A;  4B44 A;  4E7Z A;  3KZY A;  2DK8 A;  4BH9 A;  4U7B A;  4KIT B;  3K69 A;  2QBY A;  3GLL A;  3FXL A;  3HSR A;  2MC3 A;  4KNY A;  5EEH A;  1W36 D;  2QEN A;  1O7L A;  2HQ5 A;  2QQA A;  3E6D A;  4HX4 A;  5IP9 J;  5EG0 A;  4RMN A;  4L9N A;  2R93 J;  1XSD A;  3T0Y A;  2H94 A;  3BR6 A;  4C2M J;  2E1M B;  1VI0 A;  1XGM A;  2DTZ A;  2MYS A;  1FC3 A;  4A6D A;  4AC0 A;  4F3Q A;  3IRQ A;  1SFK A;  2UWM A;  1FT9 A;  2P81 A;  2VBW A;  2XHK A;  3I4N J;  2O9L A;  3LAJ A;  2XPW A;  3ZP5 A;  2VC0 A;  1VTN C;  2XAQ A;  2MSY A;  1T56 A;  2LY9 A;  3A1Y A;  5JHF A;  4A3D J;  3IP4 B;  2JVH A;  4JBA A;  3E5X A;  3PFI A;  4A3K J;  2F5E A;  3ULQ B;  1TZL A;  3ABM H;  3FIW A;  2DXI A;  4FIS A;  1TWC J;  3WU0 A;  2R7V A;  1W5T A;  2ZFW A;  3DBH B;  3R60 A;  4LOC A;  4BKX A;  1XCV A;  1GV5 A;  3F9K A;  4U0W A;  2HOS A;  3FKJ A;  4RDU A;  3A4C A;  4KIF A;  2JJ7 A;  4J00 A;  3DKW A;  2EZK A;  4JX4 A;  4DW6 A;  3K4N A;  4XLA A;  4WXH A;  3BP8 A;  4DZP A;  4Q47 A;  4RB1 A;  3RKQ A;  3QRF F;  1BIB A;  2LP0 A;  1R1V A;  1OYY A;  2R4G A;  2R7X A;  4HA8 A;  3FMS A;  1K78 B;  2JZY A;  4HPQ A;  1KU2 A;  2Q8K A;  3K1M A;  1FTT A;  4I76 A;  3E97 A;  2DA2 A;  2HDW A;  4FET A;  3F8C A;  3G3Z A;  2PLY A;  4UUS B;  5M5Y J;  1WJE A;  2OV7 A;  3Q0V A;  4E7H A;  5CVI A;  3C2G A;  1DPU A;  4ASN A;  2GXB A;  2G0E A;  1MH3 A;  3L2Q A;  1LQ1 A;  2IS2 A;  2KMU A;  2A5Y B;  1IRZ A;  3HHG A;  1Y39 A;  3RZO J;  1FSE A;  4KT6 A;  1ZG1 A;  1SD7 A;  2LH9 A;  5JHU A;  4BU2 A;  1TL8 A;  1G59 A;  1DGR M;  2JN6 A;  2VAS A;  1SD4 A;  1A35 A;  3O6B B;  2CW8 A;  4ZYA A;  2FA5 A;  1G4D A;  3ZQF A;  3IAM 2;  1BJA A;  1XB4 A;  4IX7 A;  4MEX F;  1ZRC A;  2LVS A;  4I98 B;  4ITV A;  4B8X A;  4UHT A;  2LTP A;  4ENM A;  2Z33 A;  3QOE A;  4YIR X;  1X1P A;  2KIQ A;  5M3F J;  2X51 A;  1Z91 A;  2BEO A;  3ABT A;  4MTE A;  2WWY A;  2ESN A;  2EV6 A;  3FM3 A;  3K4B A;  2NNY A;  1XX5 A;  2Q1Z B;  1WH5 A;  2DMQ A;  1ORK A;  2XPV A;  3H9J A;  3R4K A;  5F0F A;  2HGC A;  1MDM B;  3J7Z I;  2PMZ A;  4CYC A;  2IGO A;  2BXZ A;  3ZMZ A;  4X0G A;  2FML A;  1D8J A;  3K4K A;  5H2F C;  1BOB A;  2R3S A;  4I7H A;  2TRT A;  3WE3 A;  2BOL A;  4B3A A;  1BR4 A;  1ZTR A;  2FEZ A;  3DCF A;  4PSX A;  4AIJ A;  1MZB A;  2YS9 A;  1QHH D;  5J4V A;  3ABK H;  1VQO I;  4OIQ F;  1ZQ3 P;  1T0F A;  2WY7 Q;  3LSP A;  1RI7 A;  4BHP A;  5JFR A;  1GV2 A;  2BYV E;  2R7W A;  2RNG A;  3P9C A;  3CLQ A;  1O7F A;  3H36 A;  3HGY A;  3ZPL A;  4R79 A;  1DQU A;  2ELK A;  3CUQ B;  1MMD A;  3MZH A;  1SMY F;  2P6S A;  2XAU A;  2I5U A;  2VN2 A;  4LK1 F;  2W85 A;  2VKH A;  5FKK A;  4FX4 A;  1R6R A;  4HQE A;  1WSU A;  3ZN1 A;  1YG2 A;  4HLY A;  1TQP A;  1ERD A;  5DS9 A;  2QSG X;  1WH7 A;  2HYG D;  2FNP A;  1MMN A;  5E3O A;  2OF7 A;  4PGH A;  4BBS J;  1IXS B;  1HQC A;  4PCQ A;  5JI6 A;  2RV8 A;  4OIR F;  3WTX C;  4M9Z A;  1YQA A;  1BN5 A;  3H3V K;  4CZC A;  4IOC F;  4CA0 A;  1B9M A;  2QQ9 A;  3HM5 A;  1ZHF A;  4OIP F;  4E7K A;  1JKP C;  3HOT A;  2EA4 A;  2M4K A;  4U0V A;  1W4M A;  3LA3 A;  1Z7L A;  4CZZ A;  3K2A A;  2WAD A;  1PVE A;  2K4J A;  5B1B H;  3WHB A;  4FE4 A;  3JRD A;  4V19 K;  3QAH A;  1WRJ A;  4ZDP A;  3S15 J;  1G3T A;  2Z3Y A;  1E3O C;  1YRN A;  3GUD A;  2QQ8 A;  3ZQ7 A;  3S16 J;  2V9P A;  3TGN A;  3I55 I;  2UZK A;  4S0H B;  2M4G A;  2DFH A;  2LBF A;  5BPI A;  2ZJR F;  1Y0N A;  4P55 A;  3DFG A;  4M9X A;  1TLH B;  2W82 A;  4NQW B;  2EIK H;  3ABU A;  4OAY A;  5K7Z A;  2FOK A;  2BY0 A;  2W48 A;  3KP3 A;  1FLI A;  2F5D A;  3AG2 H;  3TBI A;  1OR7 C;  3LSJ A;  2GLO A;  3DP7 A;  1UZC A;  2K85 A;  5CVR A;  2CUZ A;  2O8K A;  2OAZ A;  3S14 J;  2BE5 F;  1JTY A;  3EUK L;  2ZME A;  2QQB A;  3LNQ A;  4IHX A;  4EJT A;  4ZH4 F;  3VYU B;  3BDD A;  4MFD A;  4XSZ F;  3FXJ A;  5L3E A;  3DPU A;  2E36 A;  2KT0 A;  1YFH A;  3P5J A;  1JKO C;  1IAW A;  2P4W A;  2QF7 A;  2ADU A;  2LYC A;  2DT7 B;  1GUU A;  2EFQ A;  2LF8 A;  3ECO A;  1KU7 A;  2HDD A;  2DQL A;  1ZKG A;  3IKT A;  5HLH A;  2ZXI A;  2QSF X;  2EB7 A;  4XKW A;  5L3C A;  2CW0 F;  2OU2 A;  1O3T A;  3BY6 A;  5KHD A;  4PK4 A;  2MFZ A;  5L3F A;  3IH2 A;  3W2A A;  3F23 A;  4BYY A;  2FX0 A;  4IKF A;  1TNT A;  5BPD A;  3LSI A;  3PQK A;  4Y13 A;  2M34 A;  1EKE A;  3G1O A;  1A5J A;  1ZEL A;  1ZGA A;  2EIM H;  4BS9 A;  3V7R A;  3CCM I;  5IT9 K;  3DEW A;  3Q9S A;  3KCC A;  5FB2 A;  5CQG A;  3BTI A;  3F8N A;  1BOA A;  2V4J C;  3OV8 A;  5DTD A;  5GAD J;  3KEO A;  3WU2 C;  3BPX A;  3ZRG A;  2BV6 A;  2KIM A;  1ETW A;  3V8J A;  1UG2 A;  4EEF G;  3VEP A;  1WZ2 A;  3D5L A;  2PN6 A;  4MQ9 F;  1QGP A;  4OOI A;  1HDP A;  1LE8 B;  1WJF A;  1WKM A;  4EM2 A;  2LNB A;  3H5R A;  4XLF A;  4RB2 C;  2H1L A;  5F64 A;  2BW3 B;  3LMM A;  2BY2 A;  2XGD A;  2V1D A;  2Y9Y A;  3S1R J;  1NG7 A;  5DM7 F;  1FYK A;  2K3F A;  1BBY A;  4I0A A;  1MSE C;  3AL0 C;  4YII A;  3FBI B;  4RLQ A;  1IJW C;  4IHV A;  2IW5 A;  2IA2 A;  1GVJ A;  3BG7 A;  1I3Q J;  2ZJP F;  1RNL A;  1U0J A;  5LHG A;  4XBF A;  2L7F P;  1XD7 A;  1USS A;  5D5W B;  2ZXW H;  4RLF A;  3AG1 H;  3RJP A;  5HS8 A;  2L7Z A;  1NTC A;  1UST A;  1CQT A;  2FJ1 A;  1IN8 A;  2PJR B;  4RBO A;  2A68 F;  2G7H A;  2M0M A;  4BL0 B;  3RTR A;  2E1M C;  4LJZ F;  1AU7 A;  2FMY A;  3F0C A;  5E1Z B;  2Y9Z A;  1RRJ A;  1V3F A;  3U1K A;  3ZR8 X;  3BR2 A;  2DOA A;  5GAG J;  3U2R A;  5JLW A;  1AA7 A;  3EPZ A;  2ECC A;  4YIF A;  4ETS A;  1OYI A;  2O6G E;  2DBB A;  2O0Y A;  2UUZ A;  5EDN A;  3GFJ A;  4UNO A;  1L0O C;  2XAJ A;  1GXP A;  2XGE A;  1SVL A;  2HOE A;  4HOB A;  1T39 A;  2IS1 A;  2E7W A;  2R5Y A;  1HW5 A;  2X85 A;  4XLH A;  3UKG A;  2DT5 A;  2HTS A;  1MD0 A;  1WI9 A;  1U8B A;  1EA3 A;  5DUI A;  1YW8 A;  2CV2 A;  1JUP A;  4NDL A;  4D1Q A;  2Y31 A;  2IT0 A;  1YTY A;  3H3U A;  1MMA A;  2YX4 A;  2GOX B;  2R7R A;  3JTH A;  1FOW A;  3G1M A;  2O7O A;  3RQ4 A;  3CO7 C;  2TDX A;  1YS6 A;  4DBQ A;  2P8T A;  3BQZ A;  2R7S A;  1ETK A;  2RRE A;  4OIO F;  2E2J J;  2Y0S N;  4HX8 A;  1VQN I;  3VPR A;  2DAO A;  3VSK A;  2CMP A;  3QWL A;  2OTL I;  2OUM A;  2BGC A;  4U88 A;  3I54 A;  2DDB A;  3S8P A;  3RKX A;  2A07 F;  1TQI A;  4HZF A;  2IRF G;  5JVG F;  4G7O F;  2XRO A;  2L9N A;  1M1E B;  2JA7 J;  3SJM A;  2DFI A;  4G6D A;  1T8I A;  2P5L C;  2Q0O A;  3GLX A;  2HKO A;  2VBY A;  3QPH A;  1I6X A;  1MNE A;  1BIA A;  4IXA A;  1SFE A;  5D5V B;  3D1N I;  4I2O A;  2V7F A;  3BPV A;  4E4H A;  1W0T A;  3KYC B;  3PL8 A;  4BXX J;  3KET A;  3TKY A;  4GGG A;  1X19 A;  1UEL B;  3KLN A;  2ZSI B;  1LVA A;  3KEY A;  4XON A;  4BAC A;  5EJC A;  5DYM A;  3F8B A;  4G12 A;  4BEH B;  3CJN A;  2QEX I;  1JJ8 C;  4A5M A;  2LD5 A;  3TO6 A;  4HRI A;  2HWV A;  2XF7 A;  1SFX A;  4PFO A;  4DNC A;  3HXL A;  1W0U A;  2LSO A;  5BNG A;  1ZH5 A;  1MBJ A;  2VL8 A;  3ZMD A;  3AKZ A;  3TOA A;  4OIN F;  2M87 A;  2AO9 A;  4TV7 A;  1H9T A;  5DDG A;  4OAZ A;  1RZ4 A;  3MFK A;  2QZ8 A;  3B6C A;  5C3E J;  2R7O A;  2VKE A;  4IJA A;  4X1E A;  5GPC A;  3DTI A;  2L3D A;  1V4R A;  1JHF A;  2JT1 A;  3JSP A;  1FZP B;  3OY9 A;  2EQR A;  1I1G A;  3PM1 A;  2DDA A;  1MBF A;  3M8J A;  4HX7 A;  1BI2 A;  4A12 A;  1OR7 A;  2HOA A;  2XB5 A;  1Z67 A;  3GFI A;  4HQM A;  2M2E A;  1FBS A;  1WQ2 A;  2DCE A;  2IA1 A;  3OYJ A;  2F4O B;  1V5F A;  1IZ1 A;  2ESH A;  3FXK A;  1RET A;  1U5T B;  4GCV A;  4GYI A;  2JA2 A;  2CH0 A;  3I4M J;  1ZAO A;  2QKL B;  3BCA A;  3CUQ C;  2XRL A;  3QPT A;  4RA2 A;  5E79 C;  5GAH J;  5AON A;  1GVD A;  4Y4R A;  2OZ6 A;  1D0X A;  1R1T A;  6PAX A;  2MAB A;  2LG4 A;  2JUC A;  3FM5 A;  2ZXH A;  3HTU A;  1BR2 A;  1OMI A;  2E1N A;  4CCN A;  5FJ8 J;  3MKY B;  3KP4 A;  5HNH A;  4CGZ A;  1JXS A;  4W97 A;  2ID3 A;  1EJ9 A;  1Q1V A;  2ETH A;  1LKX A;  3Q0U A;  1T0F C;  3KP2 A;  3VOE A;  2H8R A;  2HU9 A;  2KQR A;  2R7Q A;  1XS9 A;  3T1B A;  1UHS A;  3JRH A;  2DQR A;  1VQM I;  1TBX A;  3RQI A;  4HLX A;  1LDJ A;  5IT3 A;  5HLT A;  3F3X A;  3FX3 A;  2EV5 A;  2IA0 A;  4D7N A;  2DA4 A;  1Y8R B;  3OYK A;  3S32 A;  3OYN A;  4B43 A;  1D5V A;  2IAI A;  4M9S A;  4YFK F;  2FRH A;  1HW2 A;  4GXO A;  5FKN A;  1OCO H;  3CCL I;  5F6F A;  2K27 A;  3K2Z A;  3OL3 A;  3OWT A;  2QCO A;  4ZZL A;  2VKD A;  3MMY B;  3SZT A;  3CMA I;  4DGW B;  3ASN H;  3NAR A;  3OSG A;  4LLL A;  1X2M A;  4LK0 F;  1UG0 A;  5H20 A;  4QSH A;  1O3R A;  2R92 J;  1HC8 A;  4A3F J;  2L02 A;  3BR5 A;  2ISY A;  2CUF A;  2PMH A;  3S1M J;  4AYB A;  2A69 F;  3U21 A;  4LG3 A;  4MO7 A;  1MBH A;  2Y2Z A;  2HI3 A;  2KRF A;  1E2X A;  1JTX A;  2Z9O A;  3OYC A;  2MGQ A;  1OCP A;  3TDU C;  2HQR A;  3ZQC A;  2WAF A;  1HCR A;  2K9M A;  1R7J A;  3L00 A;  2VIX A;  4B1R A;  1BI0 A;  2W24 A;  3QQA A;  4AM3 A;  5IYB J;  2X9D A;  5IP7 J;  4CO8 A;  3COA C;  4DBR A;  1G3S A;  1BL0 A;  1E17 A;  1Z21 A;  2HYF A;  2WY8 Q;  3S3O A;  5ILV A;  2XGX A;  1KYZ A;  3GTK J;  1J2X A;  1HW1 A;  3TL4 X;  4PGG A;  2X0L A;  4NC7 A;  4L5J A;  4D7M A;  1PP7 U;  2VBX A;  3A01 B;  2R7T A;  1ODD A;  4G6Q A;  5B66 C;  1FYL A;  4DOZ A;  2STW A;  4ZDO A;  2MW8 A;  1JHH A;  2LOO A;  3PSF A;  4LLN A;  1QVU A;  1QZY A;  1WCM J;  4N4N B;  1IN4 A;  3CP8 A;  2X6Y A;  2ZME C;  4HDV A;  1K4S A;  1FOY A;  1RKT A;  2MH9 A;  4XQF A;  2P0W A;  3ZQI A;  2VJ5 A;  2XIG A;  2ELH A;  2VXZ A;  2DJI A;  2DFE A;  3CCR I;  1U8R A;  5FD6 A;  3SHF A;  2GM4 A;  2UXX A;  4P1W A;  5K5Q A;  5CVV A;  1HKQ A;  2XAF A;  1B8I A;  4LB5 A;  3RKW A;  5FKO A;  1D1B A;  1W7P D;  1WI3 A;  4L9T A;  3CDI A;  1IDZ A;  4GFB A;  4HST A;  5DCM A;  3HZJ A;  3MZY A;  2LY2 A;  4AU7 A;  5ERI A;  5EZG A;  3CDL A;  9ANT A;  4KYW A;  2CQ7 A;  4GDF A;  2ICW G;  1F4K A;  2ZXJ A;  2TCT A;  4Y3O A;  3DKY A;  3WGI A;  4IRH A;  2R5Z A;  4BE0 A;  3W2V A;  1W7P B;  3F8M A;  4BQO A;  1CF7 A;  3LSK A;  1X3U A;  4HAM A;  3RPU D;  2RC4 A;  1HXD A;  1A6I A;  1Y8Q B;  5DUK A;  2FBK A;  3H0G J;  2DMN A;  3LAP A;  1N25 A;  3LSM A;  1ZK8 A;  2FBI A;  2R7D A;  3CCY A;  4XRM A;  2JMW A;  3J7A O;  1X2N A;  2M0C A;  3JAM K;  1FYM A;  3WTY C;  3GTO J;  5GP9 A;  2MG4 A;  3CD6 I;  2Z16 A;  2LFB A;  4G9Y A;  4M74 A;  4B09 A;  3LSG A;  2QA4 I;  2ZBK A;  3WOD F;  5LRR A;  4UB8 C;  3OYB A;  3VSL A;  2D1V A;  2XAG A;  3K7A J;  3RDI A;  5KAI C;  1HDD C;  1LFP A;  2KJB A;  5E8G A;  1ZG3 A;  3M8F A;  4EGY A;  1BJZ A;  4I6Z A;  2D2W A;  2WTE A;  2LC2 A;  2LKX A;  1HSJ A;  1QPM A;  3FXU A;  2CV1 A;  4KN7 X;  5HS7 A;  2F5V A;  1WJA A;  3KZZ A;  2IEK A;  1ETY A;  2F5F A;  4G94 A;  2Q2E A;  5BQT A;  5IY5 H;  4M6Y A;  3E5U A;  1O4X A;  2V1N A;  4QLC U;  3HRT A;  3GTQ J;  5LEK A;  1MJ9 A;  2E5Z A;  2WAQ N;  1XGO A;  3KP5 A;  1T6S A;  2DJN A;  2NOG A;  3QPL A;  4L9J A;  4PUS A;  3RI4 A;  3Q5F A;  3TO9 A;  2G9W A;  1STZ A;  1TWA J;  3GO5 A;  3TQN A;  1BA5 A;  1J9I A;  4AYB N;  3ZCO A;  2K9L A;  3CC4 I;  3M7G A;  3HSE A;  1S7E A;  3QYB A;  4UVB A;  3P7N A;  3OYD A;  2VQL A;  3H1C A;  4DYR A;  2X6O A;  4E70 A;  1N77 A;  1A31 A;  2B63 J;  3BJO A;  4AID A;  2A6E F;  1UMQ A;  2H1K A;  1S6L A;  1DU6 A;  3SFI A;  2MA3 A;  1TT5 B;  4C3J J;  1BI3 A;  2STT A;  3OYI A;  1WJ5 A;  3F8F A;  3ESW B;  3BTC A;  3DF8 A;  2VOP A;  3MZ8 A;  4E7S A;  3K10 A;  2XUB A;  3K0L A;  3MWM A;  5DCF A;  4U7D A;  3CUQ A;  1YX5 A;  3BJA A;  4NC8 A;  1RKW A;  2CYY A;  2MLG A;  5JLX A;  3O8H A;  2D1H A;  2LKP A;  2ACJ A;  1QO0 D;  3N05 A;  2XSD C;  3D5R C;  1XGN A;  3G73 A;  1S3J A;  3ZMU A;  3HOW J;  4HV6 A;  1X1A A;  2DTR A;  4A69 C;  3CDH A;  2LDU A;  2FNA A;  3EYY A;  3LL7 A;  4PZJ A;  5FD5 A;  1Y56 A;  4BJ5 C;  1R49 A;  1BC7 C;  1NK2 P;  4KFC A;  4BDY A;  1Y6I A;  1VQ9 I;  3WHC A;  4I99 C;  5D6E A;  4AIH A;  2DA5 A;  2P7V B;  5D5X B;  4DJA A;  5J8F A;  2CQX A;  5J40 A;  3RZD J;  4FT8 A;  1V5E A;  3PIO F;  3EDP A;  3FXQ A;  2HZT A;  3QU3 A;  1ZLJ A;  4O6J A;  5TIS C;  1I6H J;  4EJU A;  5E3M A;  2F6C A;  3ZMV A;  3HC7 A;  3WTV C;  3JRI A;  3IH4 A;  3JTG A;  2OCE A;  2FXA A;  2A5W A;  1YX3 A;  1V5G A;  1NHA A;  2H27 A;  3OYA A;  4N4O B;  2W57 A;  1FIA A;  5D8L B;  3BZC A;  5D4R A;  2EIN H;  1FTZ A;  2NVY J;  2E19 A;  4BE1 A;  2IS4 A;  4IEJ A;  3I59 B;  2HEO A;  3S1N J;  4GRI A;  3QPS A;  4A2U A;  2CJJ A;  3OYL A;  4NQW A;  4ZYH A;  3ZMT A;  2JPC A;  1EH6 A;  4I0B A;  2OA4 A;  1RR7 A;  1KQ9 A;  3KPH A;  4IVN A;  1G6N A;  1S9H A;  1YJ9 I;  4U87 A;  5LHI A;  2K9N A;  1SVO A;  1JKR C;  3V7C A;  2EA2 A;  1FOK A;  2CSO A;  3CMY A;  4L5I A;  1DUX C;  1EF4 A;  3U9G A;  2X6W A;  3GXO A;  4L9V A;  1U5T C;  4BXF A;  2MBF A;  5HDK A;  3LA7 A;  2JRT A;  5JVT A;  1REP C;  3DPT A;  4ESJ A;  3HOV J;  3OYE A;  2L4A A;  1YYV A;  1XN7 A;  2L7K A;  3MCZ A;  3R0A A;  1LEA A;  3PNY A;  3K1N A;  4M3E A;  4WCG A;  1HF0 A;  4KIS A;  4ANJ A;  3OMY A;  4W1U A;  3G6E I;  3S2H J;  4BJT A;  3W6V A;  1R4N B;  5BMZ A;  4F93 B;  4KMF A;  1XMA A;  3R61 A;  2WAE A;  3SEZ A;  4B4C A;  2R0Q C;  1PUF B;  3OL4 A;  1CGP A;  2LMD A;  4XLE A;  4AD9 A;  5FLX Z;  5IYC J;  5J1R A;  1LJ9 A;  2H6B A;  4LMY A;  2FQ4 A;  1ON2 A;  3CJQ B;  5L3G A;  2K7L A;  1VF9 A;  1Z3X A;  1G8X A;  2ZNY A;  4M3B A;  3RKY A;  1R71 A;  1VND A;  5F1R A;  1F43 A;  1TT0 A;  2XB0 X;  1KGS A;  2DA1 A;  4NB5 A;  4NNJ A;  3HOX J;  5L3D A;  3I56 I;  1NH3 A;  1XDS A;  3CC2 I;  3OS1 A;  3F72 A;  3HDD A;  4BBR J;  1B72 B;  4CHU A;  5F04 A;  1YLF A;  4YRV A;  1IN6 A;  3I3L A;  4A3E J;  2EH3 A;  3HOS A;  5J47 A;  1W5C C;  1S8N A;  3OYF A;  2Y0S A;  3L9F A;  3CQZ J;  2QYO A;  5CVU A;  5FKM A;  3TMO A;  4BDZ A;  4KIG A;  4LB6 B;  4XMY A;  3FIS A;  1MW7 A;  3LOC A;  4ESF A;  2B9S A;  4B48 A;  4Q48 A;  4CIC A;  4HV5 A;  2FBH A;  1LB2 A;  1XDU A;  4RM2 A;  2JSC A;  2M30 A;  2EBI A;  2BW3 A;  1T95 A;  2W84 A;  4CUG A;  2J5O A;  1YRN B;  3SEQ A;  2ZJ2 A;  2DMU A;  3OIO A;  3ML6 A;  1IGN A;  3S3N A;  4Q5S F;  2GXG A;  3BT9 A;  3DQV C;  3S17 J;  2IGM A;  2AQF A;  3K70 C;  2OBP A;  2KRC A;  2MLK A;  5EEG A;  2BVM A;  4QWQ A;  2FF4 A;  1BR1 A;  4EMS A;  2CV0 A;  4CCO A;  1D8K A;  4O3M A;  3A03 A;  4RAZ A;  2Z2S B;  3CMM A;  5TGT A;  2RDP A;  2RGV A;  5K5O A;  2YU3 A;  5F0C A;  3J80 Z;  1ZRD A;  4C3H J;  4P9F A;  4ENJ A;  3VOD A;  3GF2 A;  4H4K C;  2CGP A;  1QZE A;  2KIU A;  1FOX A;  1A36 A;  5BOX A;  3EQL F;  3CME I;  3I5U A;  4MLO A;  2PI0 A;  1I27 A;  2JA6 J;  1H88 C;  3DEE A;  2ZJQ F;  3HOZ J;  3O2P E;  2MD0 A;  4ZZD A;  4L18 B;  1LFU P;  5A2Q Z;  2O61 A;  1J5Y A;  1OPC A;  2OC6 A;  5ICC A;  3DXJ F;  3DTE A;  3M8E A;  3AFH A;  4PJM A;  1WVR A;  1T33 A;  1FBQ A;  5K1Y A;  1O3S A;  4ABZ A;  3GZ6 A;  1FMW A;  2E7X A;  3MVP A;  2VI6 A;  1FY7 A;  2DI3 A;  1D3Y A;  3LA2 A;  2R7U A;  4D9J A;  1FJL A;  5FLM J;  2ZFU A;  4V2G A;  3AAF A;  2DOE A;  3HIF A;  2BXY A;  3HKZ A;  4WK8 F;  2CO5 A;  2MD5 A;  5EGO B;  4KDP A;  4XLC A;  3IV5 A;  5KK1 A;  3G4S I;  1W36 C;  5FRO A;  1H9G A;  4LIV A;  1OFC X;  2FOW A;  3WTZ A;  3HBL A;  2VBZ A;  3AG4 H;  5IP6 A;  2VPR A;  4MQV A;  5FFX A;  4XNF A;  1JT6 A;  3OS0 A;  1RIO H;  5LGU A;  3T8T A;  3TDZ C;  4UUV A;  1IG7 A;  1K61 A;  3HUG A;  2KZV A;  1Z05 A;  1F5T A;  3NRV A;  1S5L C;  3EYI A;  4ZTF A;  4KA4 A;  3FWE A;  2DO7 A;  1X3Z B;  2DPD A;  3GTG J;  4XKV A;  1MNM C;  2Y0M A;  3L1P A;  4A93 J;  3L09 A;  2LR8 A;  4ZYE A;  4XL9 A;  1OCT C;  1U2W A;  3KFW X;  1FBU A;  2HTJ A;  3O8G A;  3TOB A;  1FX7 A;  4I01 A;  1E3H A;  1K7A A;  2VQC A;  1XCB A;  3VDX A;  5LHH A;  2QKM B;  3BR1 A;  3GBG A;  3JAM Z;  2ZO4 A;  3C18 A;  1EH8 A;  3LFU A;  4KT5 C;  1ZAR A;  4F7Z A;  5D8K B;  4FCY A;  1G2H A;  1MIJ A;  2LLK A;  3TP3 A;  3FK6 A;  2F5C A;  1ZGW A;  2NVT J;  1J09 A;  3AG3 H;  2DPU A;  1VQ8 I;  4L5E A;  1Z9C A;  1T2K A;  2E1C A;  1K6Y A;  3NEU A;  3MEX A;  1IN5 A;  3PO3 J;  3PNV A;  3MKZ A;  2DLL A;  4B3X A;  5ILS A;  1YIT I;  3BLY A;  3SZG A;  3GFL A;  4QIW N;  2DA7 A;  2IVM A;  4YG2 F;  2QUF A;  3ELK A;  3H9G A;  3JW4 A;  5J4Y A;  2OTJ I;  3EUH C;  2GZW A;  3BTJ A;  4K2E A;  3E6B A;  2JVG A;  3KLO A;  1P4A A;  3CCJ I;  2EIJ H;  1OIS A;  3LST A;  1MBE A;  2ID6 A;  1KQ0 A;  3GTP J;  5CQE A;  1SFO J;  4LGW A;  2FU4 A;  2KLO A;  2LY1 A;  2VOD A;  3OYM A;  2RQQ A;  2B7E A;  4IRG A;  2NAZ A;  5LRS A;  2HPM A;  2E60 A;  4JX5 A;  3E5Q A;  4C3I J;  5HS9 A;  1E0E A;  3FXM A;  3SDB A;  1U5T A;  2Z5U A;  3KYL A;  3SXY A;  1TQM A;  3EET A;  3M07 A;  4MEY F;  1AKH B;  3FDY A;  3BQY A;  2KFD A;  4CDG A;  4Y7N J;  3IAS 2;  4EJW A;  1WWX A;  1J59 A;  4UB6 C;  4IZZ A;  3A0B C;  4A6E A;  1IRX A;  1BI1 A;  4LG0 B;  4GO1 A;  1B6A A;  4XKC A;  5DEQ A;  2GOM A;  4A0X A;  2HVR A;  2X1E A;  2P5V A;  2A05 A;  2HVS A;  4IOA F;  2E5N A;  4F91 B;  5E3N A;  2IGK A;  2LRD A;  4DIQ A;  1B9N A;  2A6T A;  3LWF A;  1SVM A;  3CF2 A;  3K4J A;  4C2U A;  2YPR A;  3FZV A;  1HST A;  3F6O A;  1PDN C;  2NXN B;  3FMQ A;  4BUP A;  4M3F A;  4YEJ A;  4M73 A;  2NS8 A;  4OMY A;  2DA3 A;  4EV0 A;  1RUO A;  1OCR H;  2HOT A;  1D0Z A;  3CCU I;  2DFF A;  3HKZ N;  1EH7 A;  2K9S A;  1BW6 A;  2EFN A;  3FMR A;  5CYV A;  5FLV A;  3RYP A;  1YI2 I;  4ESB A;  3W2W A;  1E3P A;  2E35 A;  3QYE A;  3HRM A;  2BHY A;  5DD4 A;  3TW7 A;  1D5Y A;  2KL4 A;  4JQF A;  3L2V A;  1ACI A; 
#chains in the Genus database with same CATH homology
 3I64 A;  4NHJ A;  1QNT A;  1ZRF A;  3S2W A;  1Q1H A;  2XAS A;  3WGH A;  2FE3 A;  1UHM A;  3WU1 B;  4XSX F;  4YFX F;  3WTS C;  4UV9 A;  3C3W A;  2XAH A;  3LFK A;  2ISZ A;  1C0W A;  5E20 A;  4KN4 X;  4O5V A;  3IWF A;  4P9U A;  3M1E A;  4MTD A;  3RPQ A;  3IRR A;  1U6G A;  2NYX A;  3V8K A;  2RKH A;  4G7H F;  5ICF A;  4ENN A;  2M1B A;  3QU6 A;  4R1H A;  4BHB A;  2FSW A;  5H6Q A;  1U3E M;  1R23 A;  1MGT A;  2H6C A;  4AVP A;  2PQ8 A;  3N4M A;  2V6C A;  5CJ9 A;  2GA1 A;  3TO7 A;  3KEQ A;  2VT2 A;  1MJA A;  3IHU A;  1B1B A;  5HVQ C;  4UVA A;  2M45 A;  1K79 A;  3I4P A;  1IXC A;  3FHZ A;  5JR3 A;  3OOP A;  3KP6 A;  3L2C A;  1DDN A;  5LEJ A;  1Z6T A;  2XRN A;  1U78 A;  4MNU A;  2V1X A;  5J8C A;  1S7O A;  2VOO A;  4EM0 B;  2ZCW A;  4LFU A;  2F2E A;  1YW9 A;  5LBQ A;  1T98 A;  2PMU A;  3BZ6 A;  3WTT C;  4ENK A;  4DQ2 A;  2RN7 A;  3M9A A;  3JSO A;  5TJJ A;  1I5Z A;  3Q9V A;  3VFZ A;  4P5O A;  5FGM A;  2K86 A;  4BNC A;  1T38 A;  1A04 A;  4EJV A;  5IT9 Z;  1P6R A;  3REO A;  1K78 A;  2QWW A;  2KJC A;  4GYG A;  4EM1 A;  3SQN A;  2IPQ X;  2O03 A;  3C1D A;  5AIP A;  4IRI A;  5ED4 A;  3B02 A;  1JE8 A;  2EFO A;  1R58 A;  3EUH A;  3WTW C;  3LQR A;  1ULY A;  2OD5 A;  1R36 A;  2HR3 A;  1FNN A;  1YS7 A;  4U0Y A;  4HBL A;  3I71 A;  3SZP A;  5DD8 A;  4AWX B;  2A6H F;  3J81 K;  4N9H A;  2QBY B;  2JPB A;  3HSF A;  1Z6R A;  4WXC A;  4JK1 X;  3ECH A;  2L54 A;  2CWE A;  3CTA A;  4RGU A;  5CVJ A;  5DCM B;  5H6R A;  4HYE A;  2A61 A;  2GIV A;  3HRS A;  1YO5 C;  4Q4Z F;  1P92 A;  1MDM A;  3F21 A;  2DU9 A;  2XVC A;  3ZN0 A;  4ZYG A;  4WX9 A;  1CF7 B;  5D6F A;  5E1X A;  2LF7 A;  3FF5 A;  2XKP A;  1XSV A;  5KVR A;  2OQG A;  3R6S A;  3W6J B;  4A0Z A;  3E6C C;  3T5X A;  3IWZ A;  1P4X A;  3CUO A;  1SFU A;  2RVC A;  4M71 A;  4L0Z B;  2Y75 A;  1SMT A;  3I59 A;  1PUE E;  1XGS A;  5FFZ A;  4Z2Y A;  2K02 A;  2BBY A;  1GXQ A;  3NQO A;  2M8E A;  4RGS A;  3BJ6 A;  3IL2 A;  1ZLK A;  2HDC A;  4RB3 C;  5HDN A;  4EVI A;  3FXR A;  1R1U A;  4YFN F;  1P4W A;  4KUM A;  3K9T A;  3F6V A;  3GW2 A;  5BS6 A;  4CXF A;  1KU9 A;  1S29 A;  1J7K A;  1P2F A;  4M72 A;  1K6O A;  2V1U A;  2EFP A;  5CLS A;  2WC2 A;  4BQA A;  4D0P A;  1SD5 A;  2VE8 A;  2L01 A;  1ZGJ A;  1B59 A;  5J6X A;  4RGR A;  1O3Q A;  4RAY A;  3W6K B;  2V9V A;  1FPQ A;  4KMU X;  1OYW A;  1KYW A;  4BHC A;  3ZMS A;  2D45 A;  3BWG A;  5FO5 A;  4KIC A;  1XSX A;  1IN7 A;  1HKS A;  5E18 F;  1LDD A;  4BAY A;  3GX4 X;  3VB2 A;  1LNW A;  1Y0U A;  4ZYD A;  5E1W A;  1R5H A;  4G8X A;  3PQJ A;  4OU0 A;  1ON1 A;  1ONV A;  2PBI A;  1TTY A;  3B73 A;  1H0M A;  4L0Y B;  3HYI A;  1QBJ A;  2CFX A;  5L3B A;  4BXU A;  2P7C B;  3WGG A;  1I1S A;  1KU3 A;  4WWC A;  4S05 A;  2PJP A;  1MJB A;  2HQN A;  4N9I A;  1RUN A;  3MQ0 A;  3ISP A;  2COM A;  3GEZ A;  1TW2 A;  1J75 A;  4UXN A;  2O3F A;  1AWC A;  4FHT A;  1TW3 A;  2GAU A;  2FQ3 A;  4I09 A;  2K4B A;  3GFM A;  4EJO A;  3GYH X;  5HLI A;  2J5P A;  3HHH A;  1UCR A;  2IJL A;  2AS5 F;  1YIO A;  1IXR C;  2ZNZ A;  2ZME B;  4MHG A;  4ON0 A;  1S7A A;  5TRD A;  2OZU A;  5LGN A;  1LDK B;  2NRA C;  2EFW A;  4HF2 A;  3I53 A;  2KIF A;  3DEU A;  4WXD A;  3I58 A;  3RYR A;  2M5W A;  4I02 A;  2EWN A;  2JTV A;  3V7S A;  2NNN A;  2DW4 A;  5HDG A;  1IRG A;  2EJR A;  3V4G A;  1ZG5 A;  2VON A;  3P9K A;  1JGS A;  4OMZ A;  3QOP A;  2VE9 A;  1EV7 A;  1HBX G;  4M6X A;  3T8R A;  1IRF A;  4HF0 A;  1DP7 P;  2R7F A;  3BOQ A;  1GHC A;  1HKT A;  3QP6 A;  5K5R A;  3GVA A;  1LEB A;  1QQI A;  1SD6 A;  1F9N A;  4HDU A;  4S04 A;  1SAX A;  1IF1 A;  3E6M A;  3MAJ A;  3KE2 A;  3SFZ A;  4IPA A;  4XRF A;  4PDK A;  3HRU A;  5ICE A;  4FX0 A;  3WE2 A;  1Z1D A;  2G7U A;  4XLP F;  1R5G A;  2A3S A;  3BRO A;  2P6T A;  2AXL A;  3H3Z A;  4G7Z F;  3IC7 A;  3J81 Z;  2HS5 A;  2PEX A;  1G3Y A;  4IF4 A;  1PP8 F;  2IP2 A;  1IUY A;  4R8H A;  4LG0 A;  3V8L A;  1IW7 F;  3RIR A;  3U1D A;  2XKO A;  1F1Z A;  4CYD A;  4UVC A;  3F22 A;  1QZZ A;  3WTU C;  4EGZ A;  4UV8 A;  1BM9 A;  2EK5 A;  1DPR A;  3P9I A;  2HFH A;  2KKO A;  3L7W A;  5LLQ A;  2O8X A;  2QVO A;  4N0B A;  2CG4 A;  4WF2 A;  4RB0 A;  4EQQ A;  2XV4 S;  5E17 F;  1AOY A;  2CQK A;  1R00 A;  1BC8 C;  2RNJ A;  1KA8 A;  2GA2 A;  1UHW A;  2Y48 A;  2PG4 A;  2UXN A;  3O3K A;  3LQQ A;  3CO6 C;  1XMK A;  3HTS B;  3GWZ A;  5HLG A;  1W5S A;  3DV8 A;  3ROU A;  3D0S A;  2L4M A;  2Z99 A;  2RQP A;  1YW7 A;  2YX7 A;  4HF1 A;  1Z7U A;  1TNS A;  2X4H A;  5AIQ A;  4LLG F;  1FP2 A;  1ZRE A;  1FP1 D;  1FSH A;  4RGX A;  4IHS A;  3I0T A;  4LD5 A;  2GQQ A;  4XLN F;  3WG9 A;  5FLX K;  3K1P A;  3N97 A;  3C7J A;  2GWR A;  4AIK A;  2ZKZ A;  2VT3 A;  4P96 A;  3H92 A;  2NS0 A;  5LGT A;  4H0E A;  4RS8 A;  2OQR A;  2VC1 A;  3ERE D;  2YR2 A;  1L3L A;  4IHT A;  3CLO A;  1OKR A;  2P5K A;  5DV5 A;  2MH2 A;  4Y15 A;  1UB9 A;  1O57 A;  2PFB A;  4HW0 A;  2C6Y A;  2HKX A;  2QM3 A;  3GZ5 A;  4Y17 A;  2DK5 A;  1ZN2 A;  3QP5 A;  1MKM A;  3KP7 A;  2B0L A;  5HOO A;  1R22 A;  2W25 A;  2EV0 A;  1J0R A;  5ILU A;  3J80 K;  5D4S A;  1G3W A;  5E8I A;  2H09 A;  1B4A A;  1ZYR F;  4MGR A;  1KQ8 A;  1W7P A;  2YSR A;  1UFM A;  5ICG A;  5A2Q K;  5D5U B;  4KIB A;  1FWZ A;  3DPL C;  4A0Y A;  4A5N A;  3RPU A;  3E3V A;  3R0J A;  3IKV A;  2WV0 A;  2QLZ A;  2V79 A;  3KZY A;  2DK8 A;  4BH9 A;  4U7B A;  3K69 A;  2QBY A;  3HSR A;  2MC3 A;  4KNY A;  5EEH A;  2QEN A;  1O7L A;  2QQA A;  3E6D A;  4HX4 A;  4L9N A;  1XSD A;  3T0Y A;  2H94 A;  1XGM A;  4A6D A;  1FC3 A;  3IRQ A;  2UWM A;  1FT9 A;  2VBW A;  2XHK A;  3LAJ A;  3ZP5 A;  2VC0 A;  1VTN C;  2XAQ A;  4JBA A;  3E5X A;  3PFI A;  2F5E A;  3ULQ B;  3WU0 A;  1W5T A;  2ZFW A;  3R60 A;  1XCV A;  4U0W A;  4KIF A;  3DKW A;  4WXH A;  3BP8 A;  4Q47 A;  4RB1 A;  3QRF F;  1BIB A;  1R1V A;  1OYY A;  4HA8 A;  3FMS A;  1K78 B;  2JZY A;  1KU2 A;  2Q8K A;  3K1M A;  3E97 A;  3F8C A;  3G3Z A;  2PLY A;  5CVI A;  1DPU A;  4ASN A;  2GXB A;  1LQ1 A;  2A5Y B;  3HHG A;  1FSE A;  1ZG1 A;  1SD7 A;  5JHU A;  1SD4 A;  3O6B B;  2FA5 A;  1G4D A;  4MEX F;  1BJA A;  1XB4 A;  1ZRC A;  4B8X A;  4I98 B;  4UHT A;  4ENM A;  2Z33 A;  1Z91 A;  2BEO A;  3ABT A;  4MTE A;  2WWY A;  2ESN A;  2EV6 A;  3FM3 A;  2NNY A;  3R4K A;  2HGC A;  1MDM B;  3ZMZ A;  2FML A;  1D8J A;  2R3S A;  4I7H A;  3WE3 A;  2FEZ A;  4AIJ A;  1MZB A;  4OIQ F;  1T0F A;  1RI7 A;  4BHP A;  5JFR A;  2BYV E;  3P9C A;  1O7F A;  3ZPL A;  4R79 A;  3CUQ B;  3MZH A;  1SMY F;  2P6S A;  2VN2 A;  4LK1 F;  2W85 A;  4FX4 A;  4HQE A;  1WSU A;  3ZN1 A;  1YG2 A;  4HLY A;  1TQP A;  2HYG D;  2FNP A;  4PGH A;  1IXS B;  1HQC A;  4PCQ A;  5JI6 A;  2RV8 A;  4OIR F;  3WTX C;  4M9Z A;  1YQA A;  1BN5 A;  1B9M A;  2QQ9 A;  4OIP F;  1ZHF A;  3HOT A;  2EA4 A;  4U0V A;  1W4M A;  3LA3 A;  4CZZ A;  2K4J A;  3QAH A;  1WRJ A;  1G3T A;  2Z3Y A;  3GUD A;  3ZQ7 A;  3TGN A;  2UZK A;  5BPI A;  4P55 A;  3DFG A;  4M9X A;  1TLH B;  3ABU A;  2FOK A;  3KP3 A;  1FLI A;  2F5D A;  3DP7 A;  5CVR A;  2OAZ A;  2BE5 F;  2ZME A;  2QQB A;  4EJT A;  4ZH4 F;  3BDD A;  4XSZ F;  5L3E A;  1YFH A;  1IAW A;  2P4W A;  2ADU A;  2EFQ A;  2LF8 A;  3ECO A;  1KU7 A;  2DQL A;  3IKT A;  5HLH A;  2EB7 A;  5L3C A;  2CW0 F;  2OU2 A;  1O3T A;  3BY6 A;  5L3F A;  3F23 A;  4BYY A;  1TNT A;  5BPD A;  3PQK A;  4Y13 A;  1ZGA A;  3V7R A;  5IT9 K;  3Q9S A;  3KCC A;  5FB2 A;  3F8N A;  1BOA A;  3OV8 A;  3KEO A;  3BPX A;  2BV6 A;  2KIM A;  3V8J A;  3VEP A;  3D5L A;  2PN6 A;  4MQ9 F;  1QGP A;  4OOI A;  1WKM A;  4EM2 A;  2LNB A;  4RB2 C;  5F64 A;  2V1D A;  1FYK A;  1BBY A;  4I0A A;  4YII A;  2IW5 A;  2IA2 A;  1GVJ A;  1RNL A;  5LHG A;  4XBF A;  1XD7 A;  1USS A;  5D5W B;  3RJP A;  5HS8 A;  1UST A;  1IN8 A;  2A68 F;  2G7H A;  3RTR A;  4LJZ F;  2FMY A;  5E1Z B;  1V3F A;  3U2R A;  4YIF A;  4ETS A;  1OYI A;  2O6G E;  2DBB A;  2O0Y A;  3GFJ A;  4UNO A;  1L0O C;  2XAJ A;  1GXP A;  4HOB A;  2HOE A;  1T39 A;  2E7W A;  1HW5 A;  2DT5 A;  2HTS A;  1MD0 A;  1WI9 A;  5DUI A;  1YW8 A;  2IT0 A;  1YTY A;  3H3U A;  2YX4 A;  3JTH A;  3CO7 C;  2TDX A;  1YS6 A;  2P8T A;  4OIO F;  4HX8 A;  2DAO A;  2BGC A;  4U88 A;  3I54 A;  3RKX A;  2A07 F;  1TQI A;  4HZF A;  2IRF G;  4G7O F;  2XRO A;  2DFI A;  4G6D A;  2P5L C;  2Q0O A;  3GLX A;  2HKO A;  2VBY A;  3QPH A;  1I6X A;  1BIA A;  4IXA A;  1SFE A;  5D5V B;  4I2O A;  3BPV A;  3KET A;  3TKY A;  4GGG A;  3KLN A;  1LVA A;  5DYM A;  3F8B A;  3CJN A;  4A5M A;  3TO6 A;  2HWV A;  4DNC A;  1SFX A;  2LSO A;  1ZH5 A;  3ZMD A;  3TOA A;  4OIN F;  2M87 A;  4TV7 A;  1H9T A;  5DDG A;  1RZ4 A;  3MFK A;  2QZ8 A;  4IJA A;  2L3D A;  1V4R A;  1JHF A;  2JT1 A;  3JSP A;  1FZP B;  1I1G A;  4HX7 A;  4A12 A;  1BI2 A;  1OR7 A;  3GFI A;  4HQM A;  1FBS A;  1WQ2 A;  2IA1 A;  1IZ1 A;  2ESH A;  1U5T B;  4GCV A;  4GYI A;  1ZAO A;  3CUQ C;  3QPT A;  5AON A;  2OZ6 A;  1R1T A;  6PAX A;  3FM5 A;  3HTU A;  1OMI A;  2E1N A;  3KP4 A;  4CGZ A;  1JXS A;  2ETH A;  3KP2 A;  3VOE A;  3T1B A;  2DQR A;  1TBX A;  4HLX A;  1LDJ A;  5IT3 A;  3F3X A;  3FX3 A;  2EV5 A;  2IA0 A;  1D5V A;  4M9S A;  4YFK F;  2FRH A;  1HW2 A;  4GXO A;  5F6F A;  2K27 A;  3K2Z A;  4ZZL A;  3SZT A;  4LLL A;  4LK0 F;  5H20 A;  1O3R A;  2L02 A;  2ISY A;  2PMH A;  2A69 F;  2KRF A;  1E2X A;  2Z9O A;  3TDU C;  2HQR A;  1R7J A;  3L00 A;  1BI0 A;  2W24 A;  4CO8 A;  3COA C;  1G3S A;  1E17 A;  2HYF A;  5ILV A;  2XGX A;  1KYZ A;  1J2X A;  1HW1 A;  4PGG A;  2X0L A;  4L5J A;  1PP7 U;  2VBX A;  1ODD A;  4G6Q A;  1FYL A;  2STW A;  1JHH A;  4LLN A;  1QZY A;  1IN4 A;  4HDV A;  2MH9 A;  2XIG A;  2ELH A;  2VXZ A;  1U8R A;  5FD6 A;  3SHF A;  2UXX A;  5K5Q A;  5CVV A;  1HKQ A;  2XAF A;  4LB5 A;  3RKW A;  1W7P D;  4L9T A;  5DCM A;  3MZY A;  5ERI A;  4KYW A;  1F4K A;  2ZXJ A;  3WGI A;  4IRH A;  1W7P B;  3F8M A;  1CF7 A;  4HAM A;  1X3U A;  2RC4 A;  1HXD A;  5DUK A;  2FBK A;  3LAP A;  2FBI A;  2R7D A;  3J7A O;  3JAM K;  1FYM A;  3WTY C;  4G9Y A;  4M74 A;  4B09 A;  2ZBK A;  3WOD F;  5LRR A;  2D1V A;  2XAG A;  3RDI A;  2KJB A;  5E8G A;  1ZG3 A;  3M8F A;  4EGY A;  2D2W A;  2WTE A;  1HSJ A;  1QPM A;  3FXU A;  4KN7 X;  5HS7 A;  3KZZ A;  2F5F A;  4G94 A;  5BQT A;  2Q2E A;  4M6Y A;  3E5U A;  4QLC U;  3HRT A;  5LEK A;  1MJ9 A;  1XGO A;  3KP5 A;  1T6S A;  3RI4 A;  4L9J A;  3Q5F A;  3TO9 A;  2G9W A;  1STZ A;  3GO5 A;  3TQN A;  1J9I A;  3M7G A;  3HSE A;  4UVB A;  3P7N A;  4E70 A;  3BJO A;  2A6E F;  1S6L A;  2MA3 A;  1BI3 A;  2STT A;  3F8F A;  3DF8 A;  2VOP A;  2XUB A;  3K0L A;  3MWM A;  5DCF A;  4U7D A;  3CUQ A;  3BJA A;  2CYY A;  2MLG A;  2D1H A;  2LKP A;  2ACJ A;  1QO0 D;  1XGN A;  3G73 A;  1S3J A;  3ZMU A;  4HV6 A;  2DTR A;  3CDH A;  2LDU A;  2FNA A;  3EYY A;  4PZJ A;  5FD5 A;  4KFC A;  1BC7 C;  5D6E A;  4AIH A;  2P7V B;  5D5X B;  5J8F A;  4FT8 A;  3EDP A;  3FXQ A;  2HZT A;  3QU3 A;  1ZLJ A;  4O6J A;  4EJU A;  3ZMV A;  3WTV C;  3JTG A;  2FXA A;  1NHA A;  2H27 A;  2W57 A;  5D8L B;  5D4R A;  3I59 B;  2HEO A;  4A2U A;  4NQW A;  4ZYH A;  3ZMT A;  2JPC A;  1EH6 A;  4I0B A;  2OA4 A;  4IVN A;  1KQ9 A;  1G6N A;  5LHI A;  3V7C A;  2EA2 A;  1FOK A;  2CSO A;  4L5I A;  1DUX C;  3U9G A;  3GXO A;  4L9V A;  1U5T C;  2MBF A;  5HDK A;  3LA7 A;  2JRT A;  5JVT A;  1REP C;  3DPT A;  4ESJ A;  2L4A A;  1YYV A;  1XN7 A;  3MCZ A;  3R0A A;  1LEA A;  3K1N A;  4WCG A;  5BMZ A;  4KMF A;  1XMA A;  3R61 A;  1CGP A;  4AD9 A;  5FLX Z;  1LJ9 A;  2H6B A;  4LMY A;  1ON2 A;  5L3G A;  2K7L A;  2ZNY A;  3RKY A;  5F1R A;  1KGS A;  4NB5 A;  5L3D A;  1XDS A;  3F72 A;  4CHU A;  1YLF A;  1IN6 A;  3HOS A;  1S8N A;  3L9F A;  2QYO A;  5CVU A;  4KIG A;  4LB6 B;  4ESF A;  4Q48 A;  4CIC A;  4HV5 A;  2FBH A;  1LB2 A;  1XDU A;  2JSC A;  2M30 A;  2W84 A;  2J5O A;  2ZJ2 A;  3ML6 A;  4Q5S F;  2GXG A;  3DQV C;  2OBP A;  2MLK A;  5EEG A;  4QWQ A;  2FF4 A;  4EMS A;  1D8K A;  4O3M A;  4RAZ A;  2RDP A;  2RGV A;  5K5O A;  2YU3 A;  3J80 Z;  1ZRD A;  4ENJ A;  4P9F A;  3VOD A;  3GF2 A;  2CGP A;  2KIU A;  5BOX A;  3EQL F;  3I5U A;  2PI0 A;  1I27 A;  3O2P E;  4ZZD A;  4L18 B;  5A2Q Z;  2O61 A;  1J5Y A;  1OPC A;  5ICC A;  3DXJ F;  3M8E A;  1FBQ A;  5K1Y A;  1O3S A;  3GZ6 A;  2E7X A;  1FY7 A;  2DI3 A;  1D3Y A;  3LA2 A;  3AAF A;  3HIF A;  4WK8 F;  2CO5 A;  2MD5 A;  4KDP A;  5KK1 A;  1H9G A;  3WTZ A;  2VBZ A;  4MQV A;  5FFX A;  1RIO H;  5LGU A;  3T8T A;  3TDZ C;  4UUV A;  3HUG A;  1Z05 A;  1F5T A;  3NRV A;  3EYI A;  4KA4 A;  3FWE A;  2DO7 A;  2DPD A;  2Y0M A;  3L09 A;  4ZYE A;  1U2W A;  3KFW X;  1FBU A;  2HTJ A;  3TOB A;  1FX7 A;  4I01 A;  1K7A A;  1XCB A;  5LHH A;  3JAM Z;  2ZO4 A;  3C18 A;  1EH8 A;  4KT5 C;  1ZAR A;  4F7Z A;  5D8K B;  2F5C A;  2DPU A;  1Z9C A;  1T2K A;  2E1C A;  3NEU A;  3MEX A;  1IN5 A;  2DLL A;  5ILS A;  3GFL A;  2IVM A;  4YG2 F;  2QUF A;  3ELK A;  3JW4 A;  2GZW A;  4K2E A;  3E6B A;  3KLO A;  1P4A A;  3LST A;  1KQ0 A;  4LGW A;  2FU4 A;  2VOD A;  4IRG A;  2NAZ A;  5LRS A;  3E5Q A;  5HS9 A;  1U5T A;  2Z5U A;  3SXY A;  1TQM A;  3EET A;  4MEY F;  4CDG A;  4EJW A;  1WWX A;  1J59 A;  4A6E A;  1BI1 A;  4LG0 B;  4GO1 A;  1B6A A;  5DEQ A;  4A0X A;  2P5V A;  1B9N A;  3LWF A;  2YPR A;  3FZV A;  1HST A;  3F6O A;  1PDN C;  3FMQ A;  4M73 A;  4OMY A;  4EV0 A;  1RUO A;  1EH7 A;  2EFN A;  3FMR A;  5CYV A;  3RYP A;  4ESB A;  5DD4 A;  3HRM A;  4JQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...