1T6SA

Crystal structure of a conserved hypothetical protein from chlorobium tepidum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ScpB from Chlorobium tepidum, a protein involved in chromosome partitioning.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA02
1ONVA 3E3VA 2P8TA 3BP8A 3PFIA 2MBFA 5FFXA 3WE2A 1RZ4A 2EWNA 2J5OA 4IRGA 1FWZA 1XGSA 2A07F 4HQMA 4IRIA 2W57A 2W25A 4LGWA 2DTRA 4CYDA 3GYHX 1B59A 1P4XA 5KVRA 3QOPA 1XGOA 4RGUA 1KU2A 1QO0D 2LF7A 4E70A 2FQ3A 4I0BA 3FM5A 3GFLA 4PGGA 2TDXA 4Z2YA 2QYOA 5JHUA 3HOTA 2ZMEA 2F2EA 5CLSA 2A3SA 4LMYA 2XAJA 5H20A 2FNPA 1ODDA 4YG2F 5JR3A 2KKOA 3O3KA 1R22A 3IHUA 1XSXA 4LK1F 1F9NA 3WTYC 3BOQA 5ERIA 1L3LA 1O3TA 2P7VB 5DEQA 5E1WA 1IZ1A 2GIVA 2PI0A 1S7AA 3LA2A 2V1XA 1BOAA 3GF2A 1HKSA 1FBSA 4XBFA 1J2XA 3QP6A 1W4MA 3FHZA 4IHSA 3IRRA 4P9UA 1BM9A 2H6BA 2Z99A 4ETSA 2XGXA 3W6JB 4I09A 5E1ZB 1FSEA 2QZ8A 1UFMA 2FRHA 1LB2A 1MZBA 2OA4A 4CGZA 5EEHA 4ZZLA 4S05A 1JGSA 2HYGD 3BPXA 4A6EA 3TOBA 3QAHA 1PP8F 4M9ZA 1F1ZA 2NNYA 2PBIA 4EM0B 4MEYF 2BBYA 4L0ZB 3D0SA 5ICGA 4P5OA 2V9VA 2WV0A 5LHHA 3ZMTA 4CXFA 2Z33A 4I0AA 3RYRA 2A68F 2GXGA 4GXOA 4ENJA 4RAZA 2D1VA 3DF8A 1TTYA 3KCCA 1YYVA 4HDVA 1L0OC 5HDKA 3DKWA 4M72A 5CJ9A 5K5OA 2CWEA 2H6CA 5E20A 1PDNC 2RQPA 4M73A 3DV8A 3I64A 4A2UA 3DEUA 5F6FA 5L3EA 3CDHA 1UHWA 2V1UA 3LAPA 2HZTA 5AIPA 4U0VA 4ENMA 1HW2A 3MWMA 2VT2A 5E1XA 3T0YA 3COAC 4HLXA 1SFXA 1P4WA 3CUQB 2R3SA 3Q5FA 5ICCA 1I1SA 4BYYA 2LKPA 4L9VA 3H3ZA 4LK0F 1U6GA 2DU9A 2JPCA 3KP3A 4Q5SF 1YFHA 2A5YB 2E7WA 1BBYA 1ZAOA 1QBJA 2XRNA 4OINF 2CO5A 1KYZA 1QPMA 3LQRA 4A5NA 4HZFA 2FMYA 4IRHA 2OQGA 5DCMA 1YS7A 2Z5UA 5JVTA 3EQLF 3F22A 3B73A 3CO7C 2ZMEB 2MLKA 3SHFA 5BPIA 3OOPA 2VBZA 5FGMA 3HSFA 1LDJA 3F23A 3ZP5A 2DT5A 2DQRA 4Q48A 4BAYA 4L18B 1ZGJA 5L3DA 3MAJA 3SXYA 3V7RA 1DP7P 1JXSA 3IWFA 2HWVA 5HDGA 2ZNYA 2H94A 1KU3A 3ROUA 3IKVA 1RNLA 3CJNA 2DK8A 4JQFA 3V8LA 5D8KB 2V6CA 1YTYA 3P9KA 2EA2A 1O7LA 2AXLA 2EB7A 1FBQA 2OBPA 1SD7A 1W5SA 3KETA 4L9NA 2AS5F 2FMLA 1VTNC 3TDZC 1XDSA 4FHTA 5DV5A 2FSWA 4RB2C 1ZHFA 4ZYGA 2JPBA 4HF0A 1OYWA 1U2WA 3G73A 1R7JA 4CHUA 1Z05A 4JBAA 3NRVA 2KIUA 1G3SA 1AOYA 3DPTA 4IPAA 4EJVA 1QZYA 1R5HA 2JTVA 4U88A 3I59B 4WX9A 2IA2A 2V1DA 1GVJA 2FA5A 3SZTA 3HOSA 1G4DA 3F8MA 5BPDA 2DLLA 2F5DA 2G9WA 1BIAA 4JK1X 1R1TA 1KYWA 1S7OA 4RB0A 4ZYHA 2EFWA 4G7ZF 4ZH4F 3DFGA 3RIRA 1QZZA 1C0WA 1R23A 2D2WA 2X4HA 5AONA 1G3TA 1V3FA 3DXJF 2CQKA 4MTEA 3M7GA 4KN4X 1W7PB 3E6CC 4XRFA 2QQBA 4U0YA 1SAXA 3B02A 4GYIA 2UXNA 3CUQA 3BJ6A 2QENA 1EH8A 1QQIA 4UVAA 2M1BA 1P92A 2VXZA 4U0WA 1WRJA 3ECOA 2IW5A 1O3RA 3RKWA 4EJOA 3GVAA 1G6NA 2IRFG 4I98B 4WXHA 1H0MA 1Z9CA 3U9GA 3W6KB 2Y75A 2RNJA 5HLGA 2P7CB 5TRDA 2JRTA 1IRFA 4HA8A 3PQKA 2VOOA 3BPVA 2MA3A 4HOBA 5HS7A 4UNOA 1KU9A 1XMAA 2O03A 2E1CA 1B9MA 2HS5A 1YG2A 2K4BA 3GW2A 3E5XA 1Q1HA 2HTJA 2OD5A 3JTHA 2QQAA 5K5RA 1Z6TA 1B4AA 1W7PA 3RPUA 5HLHA 1B1BA 5J6XA 3CUOA 3GLXA 1FX7A 1U8RA 2OQRA 4S04A 1S6LA 3TQNA 4Y17A 1GXPA 3V4GA 1LEAA 4BQAA 4EJTA 5FLXZ 4PDKA 5F1RA 2STTA 3FMRA 1MD0A 5CVUA 2H27A 2ELHA 2GA2A 1OPCA 3F72A 4FT8A 3F6VA 3K1NA 4HDUA 1BC8C 1YW8A 3CLOA 1XGNA 3E5QA 3REOA 2GZWA 4M6YA 2IA1A 1HKQA 1J7KA 2M45A 3R4KA 3KP5A 2HGCA 4XSZF 3WTWC 1FP1D 3KFWX 1MDMB 2HEOA 4IJAA 1WWXA 5JI6A 2Q2EA 3KZZA 2ETHA 5CVJA 3FXUA 3KP6A 4AIKA 2XIGA 2DO7A 1YLFA 5ILUA 2F5FA 2L01A 3E97A 3I59A 1RUNA 4A5MA 1D8KA 1P4AA 3HTUA 3HRSA 1F4KA 4KMUX 2RC4A 3HRTA 2KJCA 3I5UA 5E8IA 4WWCA 2Y0MA 2XV4S 3HYIA 5LGTA 4G7HF 3V7SA 1Z6RA 3FXRA 3OV8A 2KRFA 1U5TA 4I2OA 2KJBA 4MGRA 5L3BA 2QLZA 2PN6A 3ZMUA 2JZYA 4HV5A 3GFIA 2JSCA 4NHJA 2PMUA 1J0RA 4YFKF 1TNSA 3DQVC 3EYIA 2IVMA 1BN5A 1HXDA 1LQ1A 3FZVA 3JSOA 4RGXA 2PEXA 4OU0A 4HBLA 2ESNA 3K9TA 1T2KA 2YSRA 5ILSA 1XN7A 4AWXB 2EFOA 2A61A 4M9XA 2ZBKA 3MZYA 4RS8A 1ZLKA 3L9FA 1ZRCA 2VC0A 3HIFA 1SD6A 3F8NA 3WGGA 5F64A 2LDUA 2HQRA 1DDNA 1WKMA 1WQ2A 3P7NA 1TW3A 5TJJA 3V8KA 1MGTA 4M9SA 4HV6A 4TV7A 2C6YA 4GO1A 2ADUA 3MZHA 2FNAA 5HS8A 3KP7A 5FFZA 1SFEA 3J81K 2MD5A 4LD5A 1XSDA 1SD4A 3IWZA 3RKXA 2XAGA 2RN7A 1ZG5A 4KN7X 3I4PA 1HBXG 2P6SA 2ACJA 1RIOH 2L02A 4A0XA 1OYIA 2M8EA 2A6EF 1ZRDA 1UHMA 1ZG1A 3WTXC 2NS0A 3H92A 1WSUA 2ZCWA 4L9TA 1IXCA 2E7XA 3R6SA 3MFKA 2EV0A 3MCZA 1YIOA 1O57A 2E1NA 3GWZA 2HOEA 3HSRA 4LLNA 4OMZA 1XCBA 4LJZF 4UVCA 1LNWA 5FD5A 2CFXA 4LLLA 3KZYA 3IRQA 1KGSA 1S3JA 4OIOF 1D5VA 4UV9A 4KIBA 4R8HA 4O6JA 5ED4A 3ZN1A 1SMTA 2J5PA 5HDNA 2DPUA 1I27A 1TNTA 4L5IA 2LSOA 2MLGA 3RDIA 2QBYB 4MTDA 1J59A 1ZRFA 1J5YA 3R61A 3EYYA 2W84A 1O7FA 1HSJA 1FY7A 2W24A 2ZJ2A 2EJRA 2G7UA 5K5QA 1KQ8A 5L3FA 2P5VA 5D5XB 1BI3A 2GXBA 1ZG3A 2VC1A 3GFJA 5CVIA 2PG4A 3GFMA 4R79A 1MJBA 3HRMA 1FBUA 2HQNA 3L09A 4HX4A 3ISPA 1LJ9A 4ASNA 3CO6C 1YW7A 2FBIA 3HSEA 2HYFA 1TW2A 1OMIA 2FE3A 1O3SA 1EH6A 3ZN0A 1HSTA 3R60A 3Q9VA 4CO8A 3E6DA 3F8CA 4LLGF 3RYPA 3C7JA 3O6BB 1USTA 3ZMDA 5JFRA 5ICFA 2EV5A 4CZZA 2X0LA 2Q0OA 3EDPA 5BS6A 4ESJA 3NEUA 1IUYA 5E8GA 4EQQA 4LG0B 4UHTA 2RKHA 4MQVA 3WTVC 1RUOA 4K2EA 3F6OA 3BWGA 2P5KA 4KUMA 1IN4A 4A0ZA 1XB4A 4KIGA 4L9JA 3R0JA 4L5JA 1J9IA 3P9IA 4RGRA 5CYVA 2YX4A 3C3WA 1YQAA 4ZYEA 1H9GA 3T5XA 5DUKA 2IP2A 2O61A 2FEZA 4ZZDA 3V8JA 2Z9OA 3I54A 4GCVA 1JHHA 1FPQA 3ZPLA 4XLNF 3WE3A 1P6RA 1ZARA 2HFHA 4A12A 4LG0A 2XAHA 1F5TA 2GA1A 2VONA 4PZJA 5BMZA 1OKRA 3QPHA 4HYEA 4UV8A 5DDGA 3WTZA 1W7PD 3F3XA 5EEGA 2QBYA 2L54A 3BDDA 4G6QA 3FMSA 4Q4ZF 2NAZA 4R1HA 4IF4A 2F5CA 4P55A 4HW0A 5A2QK 4HF2A 3TO6A 2DI3A 1T98A 2OAZA 1IN8A 1J75A 3JW4A 1IN6A 4WXCA 2HDCA 2DAOA 1MKMA 1R58A 1E2XA 1OYYA 4ON0A 1Z91A 5J8CA 3BJOA 3SZPA 3NQOA 5DD8A 5IT9K 2VODA 2QM3A 4CDGA 1BI2A 3K1MA 1R5GA 4FX4A 3S2WA 3I53A 1R1UA 2ISZA 3LA3A 2EFQA 4LFUA 2DK5A 4MQ9F 1EV7A 4KIFA 5HLIA 2O6GE 4O3MA 4DNCA 4EGZA 4OIRF 4EVIA 3I71A 2K7LA 1RI7A 4EMSA 5L3GA 2BE5F 2OZUA 3FXQA 3QU6A 2QUFA 4G8XA 3KP2A 2G7HA 4AIJA 3FMQA 3F21A 2EFPA 1T39A 1AWCA 2OU2A 2K4JA 4RGSA 4GYGA 1BI0A 1BIBA 5D4SA 2B0LA 2M5WA 3E6MA 3F8BA 5D6FA 1U78A 2MH2A 2K27A 4LB6B 1S8NA 2CYYA 1R36A 1SD5A 1R00A 3EETA 2DBBA 1XSVA 1ON2A 3ZMZA 2FOKA 1T0FA 2FBHA 4EV0A 5LHIA 5L3CA 1QNTA 3N4MA 5DYMA 3U1DA 5FLXK 1FT9A 2PJPA 2QQ9A 4KMFA 1K78A 4MNUA 1Y0UA 3DPLC 2HTSA 1B9NA 4HX7A 4KYWA 4XSXF 1DPUA 3T8TA 3KP4A 4UVBA 3K2ZA 2WC2A 1BJAA 2W85A 2PLYA 2YU3A 1I5ZA 4RB3C 3JAMZ 3ELKA 3WTSC 4YFXF 4EM2A 2ZKZA 2LNBA 3C18A 2A69F 2CG4A 2BV6A 5D6EA 4EM1A 3BROA 3WU0A 2DW4A 1FC3A 3GZ5A 2QVOA 4EGYA 2PQ8A 1X3UA 3ECHA 5DD4A 5HS9A 2Q8KA 5BOXA 1ZYRF 4N9IA 2BEOA 2FBKA 5LRRA 4AVPA 1IN5A 4QWQA 2RGVA 5BQTA 2VBWA 5FO5A 5LGNA 1BI1A 2UWMA 1STZA 3HRUA 4HAMA 3J80Z 1K78B 4N0BA 1ZGAA 3MQ0A 1TLHB 4H0EA 2D45A 2HKOA 2P5LC 2IA0A 5D5WB 3I58A 2VBXA 1TBXA 4B8XA 5IT3A 2RDPA 1G3YA 1FSHA 2EFNA 3KEOA 5K1YA 4ZYDA 1ZLJA 3I0TA 5LBQA 1I1GA 1HQCA 2IJLA 2R7DA 1MDMA 3GEZA 3WU1B 2YX7A 3IKTA 2RV8A 3KEQA 5D5VB 1T38A 2ZNZA 3D5LA 4EJUA 3GUDA 5LLQA 2XKOA 1USSA 1XMKA 3ULQB 5AIQA 1KU7A 4BHBA 4I01A 2VOPA 3HHHA 3J7AO 4LB5A 2XAQA 1Z7UA 2WWYA 2MH9A 3MEXA 4KNYA 3J80K 1MJ9A 2EA4A 2MC3A 2L4MA 5CVVA 5E17F 3QP5A 1UB9A 2DQLA 4G7OF 1KQ9A 5FB2A 3IL2A 2FF4A 3GXOA 1YO5C 5D4RA 4BH9A 4U7BA 4NQWA 3ZMSA 4DQ2A 2R7FA 1CGPA 4WF2A 2XKPA 4IVNA 4FX0A 3L00A 1MJAA 2ISYA 4G94A 2HR3A 4AD9A 4P96A 5DCMB 3ML6A 5LEJA 2XVCA 3HTSB 4OMYA 3RTRA 2PFBA 6PAXA 1LDKB 4YIIA 3WGHA 4XLPF 4HLYA 1IW7F 3TKYA 3KLOA 3LWFA 4BXUA 3M1EA 2XASA 4UUVA 4KFCA 2VE8A 2M30A 4KA4A 3BZ6A 4A0YA 1K79A 1ULYA 4KDPA 2STWA 4AIHA 2RVCA 2IPQX 5J8FA 1I6XA 2ZO4A 3WODF 2GAUA 3FWEA 1K7AA 4YFNF 4L0YB 3TOAA 4UXNA 1KQ0A 4RAYA 3CUQC 3GX4X 1U5TC 4PGHA 2VN2A 2CSOA 2O8XA 3T1BA 1SMYF 2JT1A 4MHGA 5LRSA 2D1HA 1XDUA 1LEBA 4WCGA 2M87A 5HVQC 1ZH5A 3PQJA 2CW0F 3TO9A 3WG9A 4YIFA 4M6XA 3WGIA 1NHAA 2VBYA 4MEXF 3VB2A 3ZQ7A 3SFZA 3P9CA 3WTTC 4GGGA 2O0YA 1K6OA 4OOIA 1QGPA 3RI4A 1R1VA 3L2CA 4N9HA 2H09A 3TDUC 3N97A 3GO5A 3FM3A 4O5VA 2KIFA 3RPQA 1A04A 2L3DA 2UXXA 3JTGA 3HUGA 1KA8A 1GHCA 1ZREA 1T6SA 1DUXC 4ESFA 2PMHA 1IN7A 1XD7A 3DP7A 3ABUA 1ZN2A 2NYXA 1BC7C 5LEKA 4G6DA 2ZFWA 1H9TA 3U2RA 3M8EA 3RJPA 2BGCA 1GXQA 3VEPA 4ENNA 3LA7A 1IXSB 5KK1A 3G3ZA 2FU4A 4P9FA 4BHCA 2QWWA 2Y48A 4CICA 3H3UA 4PCQA 1FYKA 1FYMA 3J81Z 2XHKA 2K86A 1PUEE 2L4AA 3JSPA 2DFIA 1ON1A 1U5TB 1V4RA 2DPDA 3SQNA 2F5EA 2O3FA 1Z1DA 1CF7A 1YW9A 3QPTA 3RKYA 3Q9SA 3V7CA 3VOEA 4D0PA 2K02A 4U7DA 3AAFA 3F8FA 5CVRA 3EUHA 3IC7A 3M9AA 2CGPA 1TQMA 2ESHA 2Z3YA 4NB5A 2OZ6A 3K1PA 2NNNA 4BNCA 1OR7A 4A6DA 1TQIA 3VODA 3BJAA 4Q47A 3BY6A 1XGMA 4F7ZA 4M74A 1SFUA 2YR2A 4ESBA 3ABTA 1FLIA 1HKTA 3E6BA 1XCVA 3CTAA 3KLNA 3K69A 1O3QA 4HF1A 1REPC 4Y13A 3KE2A 3WTUC 2V79A 5DUIA 4RB1A 4QLCU 5FD6A 1HW5A 2P6TA 1WI9A 3E5UA 3FF5A 3R0AA 3LQQA 1CF7B 3M8FA 1D3YA 1FP2A 3VFZA 4I7HA 3ZMVA 3JAMK 1PP7U 1S29A 2WTEA 4Y15A 3TO7A 2XROA 3ERED 3L7WA 1LDDA 3T8RA 4OIPF 5ILVA 4BHPA 2BYVE 1IAWA 1FZPB 1DPRA 3LFKA 1G3WA 5E18F 5H6QA 1IF1A 1JE8A 1IRGA 4G9YA 3O2PE 3LSTA 3TGNA 2A6HF 4WK8F 2FXAA 1IXRC 5LHGA 5D8LB 1B6AA 4EJWA 4WXDA 2YPRA 5IT9Z 5H6RA 2EV6A 2VT3A 2NRAC 1U3EM 2VE9A 3LAJA 2GWRA 2P4WA 1UCRA 4I02A 4HQEA 1TQPA 5A2QZ 4HX8A 2XAFA 2HKXA 1EH7A 3QRFF 1D8JA 1W5TA 4KICA 1JHFA 3GZ6A 1LVAA 5D5UB 1E17A 4B09A 4M71A 5LGUA 4IHTA 2GQQA 2ZXJA 1FNNA 1YS6A 2COMA 3FX3A 2EK5A 2UZKA 4ENKA 2KIMA 3HHGA 1HW1A 4IXAA 1FYLA 3QU3A 2XUBA 2IT0A 3K0LA 4OIQF 2LF8A 5HOOA 1FOKA 5ICEA 1P2FA 4KT5C 5DCFA 3C1DA
chains in the Genus database with same CATH superfamily
2HVRA 1ONVA 1ENHA 3E3VA 2P8TA 3BP8A 4NNJA 2E2IJ 3PFIA 1UMQA 2MBFA 4RM2A 5FFXA 2VPRA 3WE2A 2VQCA 3GTGJ 1FMVA 2KRHA 1WJAA 3IUOA 2IGNA 2ID6A 1RZ4A 2EWNA 2PMZN 2HVQA 1SC7A 2OUMA 4JOMA 2HXIA 3OYMA 2J5OA 4IRGA 1FWZA 3VYRB 1XGSA 1YRNB 1Z21A 2A07F 1Y39A 1H8AC 4GFBA 4HQMA 4IRIA 2W57A 2W25A 3ZQHA 4LGWA 3VSLA 2DTRA 4CYDA 3GYHX 1B59A 1P4XA 3HC7A 2XGCA 3QOPA 5KVRA 1XGOA 1F43A 2Z16A 2NVYJ 2VJJA 5DS9A 2XSDC 2CUEA 1NG7A 4RGUA 3DCFA 1KU2A 4YELA 1QO0D 2I5UA 2LBFB 2LF7A 4E70A 2FQ3A 4XRSG 3A4CA 4B44A 1QPIA 4I0BA 3FM5A 3NARA 3GFLA 5FKMA 4PGGA 5GP9A 5IOYA 2TDXA 1R9TJ 2IBDA 2KFDA 4Z2YA 2QYOA 5JHUA 4D1QA 3CCSI 3FHNA 1VQ9I 2EBIA 3HOTA 2ZMEA 2F2EA 5CLSA 3BZCA 2ECCA 3VYUB 3W6VA 2A3SA 3W2WA 4HNTA 1TWHJ 4LMYA 1MBJA 2XAJA 3H0GJ 4RLQA 5H20A 3CMEI 1A5JA 2FNPA 1ODDA 4YG2F 5JR3A 2KKOA 4XN0A 2CQNA 4PFOA 4BEHA 3O3KA 1R22A 5IP6A 3IHUA 3C2BA 4LG3A 3TW6A 1XSXA 2BZTA 4LK1F 1JKPC 1F9NA 2XF5A 3BG9A 1GV5A 3WTYC 2K9QA 5GAHJ 3BOQA 5ERIA 2NVQJ 2P81A 4FETA 2VUMJ 1L3LA 2E2HJ 1O3TA 2P7VB 3CZ6A 5DEQA 2DA6A 5E1WA 1IZ1A 2W48A 4XK4A 4XLCA 2IS6A 2GIVA 2ZSHB 2PI0A 1S7AA 3FXMA 3LA2A 1X4PA 3MD2A 4BDYA 2E5NA 2V1XA 1BOAA 3GF2A 1HKSA 1D0YA 1FBSA 2JVHA 3DTIA 4ZTFA 4XBFA 1J2XA 3FBNB 2PJRA 4QTRA 3QP6A 1Y6IA 1W4MA 3FHZA 4IHSA 2GM4A 2OPTA 4FTHA 3IRRA 4P9UA 1BM9A 2H6BA 3CC4I 4F52A 2R5ZB 2Z99A 4ETSA 5DM7F 1RKTA 2XGXA 3W6JB 4Y4RA 4I09A 4F91B 5E1ZB 1FSEA 2QZ8A 1UFMA 2FRHA 2R7TA 1LB2A 1MZBA 2FD5A 4D7MA 2OA4A 2F4MB 4CGZA 4M3DA 5EEHA 4ZZLA 4S05A 1T0FC 3F0CA 1JGSA 2HYGD 3JR9A 3BPXA 1E3HA 1W5CC 4A6EA 5J1UA 3TOBA 1WJCA 4PJMA 3QAHA 1VNDA 1PP8F 3DEEA 4M9ZA 1F1ZA 2NNYA 2PBIA 4UY8I 4EM0B 4MEYF 1ETOA 2BBYA 4L0ZB 3D0SA 5ICGA 1JKOC 4P5OA 2V9VA 2WV0A 5LHHA 4FCYA 3ZMTA 2R7WA 4F3QA 4CXFA 2Z33A 1N25A 4I0AA 2N8GA 2HDDA 2BXZA 3RYRA 2A68F 2QSGX 4A3GJ 2GXGA 4GXOA 4ENJA 4RAZA 2D1VA 4ZC3A 3I56I 4PJLA 3DF8A 3DKXA 1TTYA 2KZVA 3KCCA 1YYVA 3PJRA 2AXTC 1ACIA 2PX9A 3CMYA 4HDVA 1L0OC 5HDKA 1FTZA 1RR8C 3DKWA 4M72A 5CJ9A 5K5OA 2CWEA 2H6CA 4XKBA 3U1KA 5E20A 4L5EA 2RQQA 4IQ4A 1PDNC 2RQPA 4C9YA 4M73A 4MLOA 2JA7J 2JA8J 3DV8A 3I64A 1I6HJ 4A2UA 4ZJZA 1JI8A 3DEUA 3KZIC 5F6FA 3CDHA 5L3EA 5C4JJ 1A6IA 1GV2A 1UHWA 2HZTA 4HNUA 5GTIC 3PNYA 5AIPA 4AYBA 3LAPA 3BG3A 4U0VA 5B5EC 5FKLA 2LKSA 4CA0A 4GDFA 1YX5A 4ENMA 4OAYA 1HW2A 1BR1A 2L7MP 2VT2A 3MWMA 5E1XA 3T0YA 5K7FA 1BA5A 2WAQN 3COAC 4HLXA 4C2TA 1SFXA 1P4WA 3CUQB 2AQEA 2R3SA 3Q5FA 2ZXWH 5ICCA 2GBYA 1IGNA 1WJEA 3LNQA 3BR5A 1I1SA 2CU7A 4BYYA 2LKPA 4L9VA 3H3ZA 1IJWC 2TCTA 2XF6A 4LK0F 1U6GA 2DU9A 2JPCA 1K4TA 1FJLA 3KP3A 3H0DA 1TWCJ 2QSHX 1IRZA 4Q5SF 2E1OA 2WAEA 5JVGF 1YFHA 1H89C 2FUG2 1X58A 3FDYA 4D9JA 1VQ4I 1X2MA 2A5YB 2V1UA 2E7WA 3CJQB 1BBYA 1ZAOA 2K9SA 3DLAA 1QBJA 3HG9A 4CZCA 4A3FJ 2XRNA 4OINF 2CO5A 1KYZA 1QPMA 3LQRA 5GTHC 4A5NA 3A02A 4HZFA 3SJMA 2FMYA 4IRHA 2OQGA 5DCMA 3ABMH 4XKWA 1YS7A 2LY9A 2XB5A 2Z5UA 4M3EA 5JVTA 3EQLF 5J4VA 1H88C 5B1AH 4IO9F 1DP3A 2HOSA 2ELJA 1N78A 3F22A 3F9KA 4X1EA 3B73A 3UR3C 3CO7C 2ZMEB 2MLKA 4E7HA 3SHFA 5BPIA 2V1NA 3GBGA 3OOPA 2VBZA 5FGMA 3HSFA 3CCRI 1LDJA 2V9KA 3F23A 3ZP5A 2DT5A 2YUSA 2DQRA 4Q48A 4BAYA 4NC8A 2Y9ZA 1T95A 1V5FA 4L18B 2M9HA 2WA0A 1MMGA 1ZGJA 2YS9A 5L3DA 4BXFA 1AKHB 1RC9A 3MAJA 3SXYA 2WY8Q 3GTOJ 3V7RA 2NOGA 1DP7P 1JXSA 3IWFA 4H4KC 1I3AA 2HWVA 5HDGA 4XONA 2ZNYA 2H94A 1KU3A 3PIPF 4HG2A 3ROUA 3IKVA 1RNLA 2EZHA 2X85A 2KP6A 3CJNA 2DK8A 4JQFA 3V8LA 1M1EB 5D8KB 4DIQA 2M34A 2V6CA 4XLFA 1YE9A 2FX0A 3AG4H 3CF2A 1YTYA 4PK4A 3P9KA 2EA2A 1O7LA 2AXLA 2D5VA 3JRHA 5K7ZA 1AU7A 3A01A 2EB7A 3DTEA 1FBQA 2OBPA 5E3LA 1SD7A 2V26A 1W5SA 3KETA 3L2VA 4L9NA 1WGXA 2AS5F 3OIOA 2FMLA 1VTNC 3TDZC 1XDSA 2GOXB 3CC2I 4FHTA 5DV5A 2BY1A 3BTCA 3CDIA 4LIUA 4JX5A 2FSWA 4RB2C 1E3PA 1SVMA 1WH5A 2K9NA 1ZHFA 4ZYGA 2JPBA 4HF0A 1OYWA 5TGTA 2COBA 1U2WA 1TC3C 3G73A 1R7JA 4RM3A 1AKHA 4CHUA 3HOUJ 1T56A 1Z05A 4JBAA 3NRVA 5B1BH 3OYDA 3K70D 2HQAA 3JRBA 2KIUA 1G3SA 1AOYA 3DPTA 4IPAA 1Z3YA 4I2OA 4EJVA 2MFZA 1QZYA 3JCUC 1R5HA 2NXNB 3D5SC 4B3XA 2JTVA 4U88A 3I59B 4WX9A 3Q0UA 2IA2A 2V1DA 3WHBA 1VZ0A 2FJ1A 1GVJA 1RRJA 2FA5A 3SZTA 3HOSA 1G4DA 3CF5F 1IRXA 3ASNH 1WJDA 5CPRB 3S8PA 3F8MA 4A3MJ 5BPDA 1BJZA 1TWFJ 2DLLA 2F5DA 2G9WA 4MIMA 2LRDA 4DW6A 1BIAA 2ZJPF 4JK1X 1R1TA 1KYWA 3O8GA 1K6YA 1S7OA 4RB0A 4ZYHA 2EFWA 4G7ZF 3S1QJ 4ZH4F 3DFGA 1QZEA 3RIRA 1QZZA 1HDPA 3HPHA 2F4OB 1C0WA 3OR2C 3VDXA 1R23A 2D2WA 1VI0A 2DMUA 2X4HA 3H1CA 5AONA 4DJAA 3KIOA 1XMXA 1G3TA 3DU6A 3ONQA 1V3FA 3DXJF 2CQKA 4MTEA 3M7GA 4KN4X 1MH3A 3BZKA 1W7PB 3E6CC 4XRFA 2QQBA 4U0YA 1SAXA 2Y69H 3B02A 3BLYA 3OIQA 1SVLA 4HNVA 2JN6A 4GYIA 1Y0NA 3HKZA 2UXNA 3CUQA 3BJ6A 2QENA 1Y8QB 3I55I 2ME6A 1EH8A 1OFCX 1QQIA 4UVAA 3PSFA 1S7EA 2BY2A 2M1BA 3PIOF 3B6CA 5EF6A 2VI6A 2CV2A 1P92A 2VXZA 4U0WA 2HDWA 2QA4I 1WRJA 3ECOA 1KZHA 2IW5A 1O3RA 3RKWA 4AVZA 5M5WJ 3SEQA 4EJOA 2DFFA 3GVAA 1G6NA 4MO7A 3J7ZI 2IRFG 4I98B 4WXHA 4OWRB 1H0MA 1Z9CA 1WH7A 3U9GA 3W6KB 2Y75A 4IL6C 3S17J 2RNJA 3HOWJ 4NC6A 1B8IB 4ZDOA 5HLGA 2FQ4A 2IS1A 2JQ7A 3M8JA 2P7CB 3MKLA 4IKFA 1RETA 5TRDA 2JRTA 1IRFA 3DEWA 4HA8A 5H2FC 3PQKA 1IC8A 3FXJA 2VOOA 3BPVA 5J1YA 2MA3A 3IH3A 5FRNA 4HOBA 5HS7A 4UNOA 2BHYA 1KU9A 1XMAA 2FOWA 2O03A 2E1CA 2L9VA 3FK7A 1B9MA 4E7KA 1P7IA 2HS5A 1YG2A 2K4BA 5FJ8J 3GW2A 3E5XA 1Q1HA 3SEZA 2HTJA 2MC4A 2OD5A 3JTHA 1VQ8I 4A3IJ 2QQAA 2LYCA 4DYCA 5K5RA 2HYJA 2DA3A 2E34A 3HJEA 5KAIC 5FROA 2DFEA 1Z6TA 1B4AA 2Z1DA 3QYFA 1W7PA 1ZR4A 2LC2A 3RPUA 4RDUA 3ZCOA 2OTLI 3EPZA 2AO9A 1HC8A 3Q3SA 5HLHA 1B1BA 2MYSA 5J6XA 1MMDA 3H5NA 2DA1A 1PYVA 3LSHA 3CUOA 3GLXA 1FX7A 4A3JJ 1U8RA 2OQRA 2X1DA 1LPQA 2EIJH 3WHCA 4S04A 2F6CA 1S6LA 1LUJB 2HU9A 1JTXA 4Y17A 3TQNA 3HOYJ 1GXPA 3LFUA 1ETQA 3TP3A 3AKZA 5EJCA 3V4GA 1LEAA 4ANJA 4BQAA 3H5RA 4EJTA 5FLXZ 4PDKA 5F1RA 2STTA 1TT5B 3CMMA 5FLMJ 3FMRA 1MD0A 4NDLA 5CVUA 4ZYAA 2H27A 2IXSA 2ELHA 2GA2A 1OPCA 2DODA 3F72A 4FT8A 1WJFA 4KITB 3F6VA 4QIWN 2ID3A 3K1NA 1W0TA 4YIRX 4HDUA 4GRIA 1BC8C 1D0XA 5E3OA 3ESWB 1YW8A 2EILH 3RPUD 3BR6A 3CLOA 1HLVA 1XGNA 2QKMB 3E5QA 3DPUA 3REOA 2DFHA 2GZWA 3K4CA 3OYEA 4M6YA 1G2HA 2Y0SA 2IA1A 1HKQA 2VQLA 1J7KA 2NVXJ 2M45A 2DYRH 3R4KA 3KP5A 2OF7A 2RREA 3HXLA 1JJ8C 2HGCA 4XSZF 4N4OB 4XOTA 3WTWC 1FP1D 3KFWX 1MDMB 2HEOA 4CYCA 4IJAA 2KL4A 1WWXA 4Y33A 5JI6A 1B72A 2Q2EA 3KZZA 1HA8A 2ETHA 2VKDA 5CVJA 3FXUA 3KP6A 4AIKA 2XIGA 3KYLA 2R5YB 1LFUP 2DO7A 1YLFA 1UZCA 4Y52J 4BACA 4CH7A 5ILUA 1FOYA 2F5FA 2L01A 5EGOB 3E97A 4KT6A 2WV1A 2ZFUA 3I59A 3MMYB 4PSWA 4N4NB 2DOFA 1RUNA 3DWLE 1ETVA 1POGA 4A5MA 1D8KA 1P4AA 4RAGA 2KT0A 3HTUA 3HRSA 3QODA 3QPSA 1F4KA 4AIDA 3OYBA 4DZPA 2LVSA 3E0JB 2CMPA 4KMUX 3DBHB 2RC4A 3HRTA 2KJCA 3I5UA 5E8IA 4WWCA 2LOOA 4PUSA 5FLVA 2Y0MA 3LL7A 2L2OA 2XV4S 3HYIA 5LGTA 4G7HF 3CCUI 2L9RA 1R71A 2WY7Q 3V7SA 2MSYA 2CQQA 1Z6RA 2CS3A 3FXRA 2KZGA 2KRFA 1U5TA 2E35A 3CDLA 3OV8A 2JMWA 2KJBA 3K7AJ 1T8IA 4MGRA 5L3BA 2QLZA 2PN6A 2M3AA 5EEAA 3ZMUA 2JZYA 4HV5A 2UV1A 3GFIA 2JSCA 3LSIA 1HF0A 4NHJA 2PMUA 1DU6A 5C4XJ 1J0RA 4BY1J 4YFKF 1TNSA 3DQVC 1SEUA 3GMEA 2Y9YA 3EYIA 5F08A 2IVMA 1A6QA 1D1CA 1FIPA 1BN5A 1HXDA 1LQ1A 1JGGA 3FZVA 4DYQA 2R5YA 5B3SH 3JSOA 4RGXA 2PEXA 4OU0A 4HBLA 3MVPA 2ESNA 2DT6A 3AG1H 1MNDA 1OQYA 2LFBA 3K9TA 1T2KA 2YSRA 5ILSA 2TRTA 3PM1A 3KYCB 1XN7A 4AWXB 2EFOA 2XC7A 1BOBA 1X1BA 3E7LA 2CV1A 2X1EA 2A61A 2VJIA 2DOEA 4M9XA 5CKTA 5M5YJ 3K10A 3S3OA 3W2VA 2ZBKA 3HUGB 2JJ7A 3MZYA 3CCMI 4RS8A 1FIAA 1ZLKA 3L9FA 1NH3A 1ZRCA 1VQ5I 2KQRA 2VC0A 3HIFA 2KDOA 4DBRA 2DJNA 1QRYA 1SD6A 3F8NA 2RNGA 5F64A 3WGGA 2LDUA 2HQRA 3LSRA 4DGWB 3PO3J 1DDNA 1WKMA 1WQ2A 3P7NA 5EZGA 1TW3A 2E19A 3OYLA 1XG1A 4CUGA 4AM3A 5TJJA 2EIKH 2L9SA 2JVGA 2XRLA 5F27A 1JKQC 3V8KA 1V54H 2WADA 1Y8RB 1MGTA 4M9SA 4HV6A 4TV7A 2C6YA 4GO1A 3G1MA 2ADUA 3MZHA 2FNAA 5HS8A 1DGWY 3KP7A 2NS8A 5FFZA 1SFEA 1F36A 3J81K 2DA2A 4XQFA 2MD5A 3AFHA 2JA2A 3K4JA 4LD5A 5JLWA 1XSDA 1SD4A 3X2QH 4BE1A 3CC7I 4BY7J 1VQMI 3FISA 2LG4A 4ZDPA 2OTJI 2B63J 2K9MA 3IWZA 2E2JJ 4NBQA 2R7ZJ 3RKXA 2XAGA 1S5LC 2RN7A 1OJLA 1ZG5A 4KN7X 3I4PA 3OYJA 2E36A 3MN2A 5E3MA 2P6SA 3HEFA 3G71I 1HBXG 1WVRA 2ACJA 2LREA 1RIOH 3QOEA 2L02A 4A0XA 1OYIA 3PNVA 4BDZA 2M8EA 2A6EF 1K4SA 1ZRDA 1UHMA 1ZG1A 1A35A 3WTXC 2NS0A 3H92A 3SFIA 1WSUA 4A3CJ 2HPIA 4M3BA 2ZCWA 4L9TA 1UG0A 2GIZA 5IP9J 1U0JA 1IXCA 2E7XA 3R6SA 1SFKA 2X6WA 5J40A 1FOWA 4E7ZA 3MFKA 3CCVI 3S1NJ 1E0EA 5EG0B 3MZ8A 5EDNA 3GTKJ 2HZDA 2EV0A 3MCZA 1YIOA 1O57A 1MMNA 2E1NA 1P9QC 2HOEA 3GWZA 1XTAA 3HSRA 3FXOA 4E7LA 4C2UA 4LLNA 2KDZA 4OMZA 1XCBA 4LJZF 4UVCA 1LNWA 5FD5A 2CFXA 2M7AA 4LLLA 2Q2EB 2HQ5A 3KZYA 3IRQA 3HOZJ 1KGSA 1GVDA 5FRMA 5IYBJ 2LTPA 1S3JA 4OIOF 2H8RA 2LH9A 1HOMA 1D5VA 4UV9A 4KIBA 4U87A 5EGOA 2EPFA 4R8HA 4V2GA 1YIJI 3CCYA 4O6JA 5ED4A 3ZN1A 1SMTA 2J5PA 5HDNA 3CQZJ 1MW7A 2DPUA 5HNHA 1IV8A 1I27A 1TNTA 4L5IA 5KCMA 3IAM2 3SZGA 2LSOA 2MLGA 3RDIA 2CW7A 2X9DA 4MTDA 2QBYB 1J59A 2IGMA 1ZRFA 4IHWA 1J5YA 1SFOJ 2DDBA 2KMUA 3KYDB 3ZQFA 3R61A 2ZXHA 3EYYA 4IOAF 2BY3A 2W84A 1O7FA 3LSPA 1KONA 1HSJA 2AHQA 4B1RA 2M0MA 1FY7A 4JX4A 2Y2ZA 2W24A 5EG0A 4HSTA 2ZJ2A 4J19A 2Y31A 2E5ZA 2X6OA 4CCKA 3H5AA 2EJRA 2G7UA 5K5QA 4A93J 3H36A 1S9HA 2DMPA 2VB6A 2B9SA 2QF7A 3HZJA 1KQ8A 5L3FA 1MH4A 1OCRH 2P5VA 1EA3A 2QKLB 1EF4A 2V4JC 5D5XB 1BI3A 2GXBA 1ZG3A 2VC1A 2XPVA 3GFJA 5CVIA 2PG4A 3GFMA 1LFBA 3TL4X 2BXYA 4R79A 1MJBA 3HRMA 5J1RA 4NC7A 1FBUA 2HQNA 3L09A 3DLLF 4HX4A 3BG7A 3ISPA 4IQJA 3RCOA 3W3CA 1LJ9A 4ASNA 3CO6C 1YW7A 4JX6A 2FBIA 3SDBA 3OYGA 3SYTA 4BQQA 3OS2A 4E6KG 3HSEA 3S1MJ 2K85A 2HYFA 2O5RA 1TW2A 4E7SA 2Y0SN 1OMIA 2FE3A 1O3SA 5KNLA 1EH6A 1X2NA 3ZN0A 1HSTA 3OS1A 1R49A 3R60A 3Q9VA 4XICA 3BR1A 4CO8A 1LE8B 3ZGKA 3E6DA 3F8CA 4LLGF 2R4GA 4PJJA 3RYPA 3C7JA 3O6BB 3G4SI 4QSHA 1MBGA 1USTA 2CW8A 3JRAA 3ZMDA 5JFRA 1MNEA 1WPKA 5ICFA 2EV5A 1NTCA 4CZZA 2XSJC 2V6EA 1SANA 2X0LA 2Q0OA 2ZJRF 1IUFA 5J3LA 5F0HA 3EDPA 5BS6A 4ESJA 5F0CA 2JA5J 3VSKA 1ORKA 1VQNI 3NEUA 1PJRA 2GOMA 3HB9A 3OYHA 3PL8A 1XX5A 2BVMA 1AHDP 3A2KA 3L1PA 1IUYA 5K7HA 3OY9A 1DGRM 5E8GA 4EQQA 4LG0B 1RKWA 4UHTA 4HEA2 2A6TA 1TWGJ 2RKHA 3ABKH 4MQVA 3WTVC 2BW3A 3MKYB 1RUOA 1X19A 2BVLA 4K2EA 3F6OA 5GAEJ 4IHVA 3BWGA 3GLLA 3QYBA 4II3A 3J7YJ 2P5KA 1ERDA 3BTIA 1W36D 4KUMA 1IN4A 3PNTA 1ZR2A 4A0ZA 3WG7H 1XB4A 3K6GA 4XRMA 2MGQA 2WBMA 3A0BC 3C2GA 3M3YJ 3HOXJ 5C44J 4KIGA 2DOAA 4YEJA 1S72I 4L9JA 2LMDA 3TMOA 4IHXA 3R0JA 4F93B 4L5JA 4UB8C 1J9IA 3E1SA 3P9IA 1MMSA 5F0FA 4RMNA 4RGRA 4KJZA 2OC6A 5CYVA 3KX2A 2NVTJ 2JWTA 2YX4A 2R7OA 3C3WA 1YQAA 3LSGA 4ZYEA 1H9GA 3T5XA 1N75A 5DUKA 1X3ZB 3CESA 3FK6A 2IP2A 2O61A 1T08B 3IV5A 2FEZA 1PUFA 2CUZA 2PMZA 4ZZDA 4E7IA 4UB6C 3V8JA 3S16J 4RA2A 3RSNA 2Z9OA 5CQEA 2WAFA 2ECBA 3I54A 1VQ6I 4GCVA 1FEXA 1JHHA 1EKEA 3TW7A 1FPQA 3ZPLA 4XLNF 2DXIA 4XLHA 3OR1C 3WE3A 1P6RA 1UG2A 1ZARA 2HFHA 3RQIA 3ZQIA 2QEXI 4A12A 1VQ7I 3DBLB 4LG0A 3H9JA 3BTJA 2VLAA 2LK2A 4RBOA 4LIVA 2BW3B 2XAHA 1F5TA 2LD5A 2GA1A 2VONA 4PZJA 3I9V2 2R92J 4F55A 4QPQA 2BY0A 5BMZA 4X0GA 1OKRA 3QPHA 1VQKI 3HKZN 4HYEA 4UV8A 2E1MC 3A0HC 2A5WA 2W7NA 5DDGA 1VQOI 3WTZA 4CCJA 3L2QA 3CMAI 3QYEA 1QA6A 1W7PD 2HI3A 2DTZA 1AA7A 3LSKA 3S1RJ 4BQNA 3F3XA 5EEGA 2QBYA 2L54A 3BDDA 4EATA 1WZ2A 4G6QA 3FMSA 1JTYA 4Q4ZF 5BNGA 1MIJA 2KISA 3C2HA 2NAZA 4R1HA 4IF4A 2F5CA 4P55A 4BE0A 1TT0A 1OCOH 1WCMJ 4FISA 4HW0A 5A2QK 4HF2A 3TO6A 3JRDA 2DI3A 1T98A 3BT9A 4C2MJ 2OAZA 1IN8A 3OL4A 1J75A 3JW4A 2R7XA 1IN6A 1X3WB 4WXCA 2HDCA 4P1WA 2DAOA 2ICWG 1MKMA 3KEYA 1R58A 1E2XA 5E79C 1ZELA 1OYYA 4ON0A 1Z91A 3BR2A 5J8CA 3BJOA 2E1MB 3K2AA 5KHDA 4D5FA 3DTKA 3K4MA 3SZPA 3NQOA 2DA7A 2LY1A 4BEHB 5DD8A 2EZKA 2O9LA 2DT7B 5IT9K 2VODA 2QM3A 4CDGA 1BI2A 3K1MA 1R5GA 4FX4A 3S2WA 3I53A 1R1UA 2ISZA 4F92B 3CCLI 2DJIA 4BJTA 2X48A 3LA3A 1WHUA 2EFQA 5CQGA 4LFUA 4DBQA 2DK5A 4MQ9F 1EV7A 3K4NA 4KIFA 3N05A 5HLIA 2O6GE 4C3JJ 4O3MA 4DNCA 2IGOA 4EGZA 4FE7A 4OIRF 4EVIA 1FOXA 3I71A 2K7LA 4BJ6C 5F1JA 3ZQGA 1RI7A 4EMSA 5GADJ 4BXXJ 5L3GA 2MW8A 2PJRB 4C3IJ 2BE5F 2OZUA 1OISA 5IYDJ 3H35A 3FXQA 3QU6A 1BR4A 2QUFA 4G8XA 2VQGA 3EUKL 3KP2A 3PUFA 4B3AA 2G7HA 2R5ZA 3A03A 4AIJA 1OCPA 3FMQA 3QWLA 3F21A 2EFPA 1QVUA 5C3EJ 3HBLA 5FKNA 3H3VK 3OL3A 4YRVA 2XDVA 1T39A 3OYCA 5IPAA 1AWCA 5DM6F 2P0WA 1Z3XA 3IAS2 2R7RA 1OCCH 2M4GA 3AL0B 2OU2A 1TZLA 3J7AY 2CQXA 4XR6A 2K4JA 4RGSA 3FXLA 4GYGA 3K4LA 2CUFA 4FQGA 1BI0A 1BIBA 2CFOA 2H1KA 4A3LJ 5D4SA 3PO2J 2B0LA 2M5WA 2L7FP 2R7VA 4UUSA 3E6MA 3I4NJ 3F8BA 5D6FA 1U78A 2MH2A 2K27A 1RESA 4LB6B 4A3BJ 1S8NA 2CYYA 1R36A 1SD5A 1A31A 1R00A 3EETA 2L0KA 3G1LA 2DBBA 1XSVA 1ON2A 3ZMZA 2FOKA 3QPLA 1T0FA 4XKCA 2FBHA 4EV0A 5LHIA 3HDDA 5L3CA 1QNTA 4A3EJ 3GCMA 2JSPA 5HNFA 4PJ0C 3SDGA 4IZZA 3B6AA 4DOZA 1OLTA 2Y30A 5DYMA 4PFPA 3U1DA 3N4MA 5FLXK 3CJRB 3S3MA 1FT9A 1SVOA 4IOCF 2PJPA 3M4OJ 2QQ9A 5TISC 4KMFA 1K78A 4MNUA 1Y0UA 3DPLC 2HTSA 3AG3H 1B9NA 4HX7A 4KYWA 4XSXF 5IY5H 2UUZA 1DPUA 3T8TA 3KP4A 4UVBA 4JYKA 3K2ZA 2WC2A 1W0UA 3A01B 1BJAA 4J00A 3MKWB 2W85A 2PLYA 2YU3A 1I5ZA 3I3LA 4RB3C 2W1OA 2X6YA 1JT0A 3JAMZ 3GTJJ 1HDDC 3ELKA 2G0EA 3IH2A 5FKOA 5JLXA 4I6ZA 3WTSC 3L2WA 4YFXF 2LP0A 4EM2A 4M3GA 3RZOJ 2IAIA 2K5CA 2ZKZA 2LNBA 1Y1WJ 3C18A 2A69F 2CG4A 2BV6A 5D6EA 4EM1A 5GPCA 3BROA 3WU0A 2DW4A 3JRFA 1R4NB 1FC3A 3GZ5A 2QVOA 4EGYA 2PQ8A 1BL0A 4ITVA 1X3UA 3M1CA 2E71A 2K3FA 3OYNA 3HGGA 3ECHA 5DD4A 5HS9A 2Q8KA 5BOXA 1ZYRF 4N9IA 1P7JA 2BEOA 2FBKA 5LRRA 4AVPA 1IN5A 4QWQA 2ZMEC 2RGVA 2WAQA 2X6XA 5BQTA 4XKVA 3S93A 2RAEA 2VBWA 1X1CA 5FO5A 3UNGC 1TP4A 5LGNA 4ZDLA 1BI1A 2UWMA 2CRGA 1STZA 4CSWA 3HRUA 4AUXA 4AYBN 4HAMA 3J80Z 1K78B 3JRIA 4N0BA 2IEKA 3PUBA 2R7QA 3PSIA 1ZGAA 3MQ0A 4XMYA 1TLHB 4CCLA 4H0EA 4A3DJ 3K70C 2D45A 2HKOA 2P5LC 1BW5A 2IA0A 3BR3A 1NG6A 3LMMA 5D5WB 5J47A 2XF7A 3I58A 1CQTA 3H9GA 2VBXA 4B43A 1TBXA 4B8XA 5IT3A 1W1WE 2RDPA 1G3YA 3RQ4A 1FSHA 2EFNA 2IS2A 3KEOA 2HOAA 5K1YA 3RZDJ 1UJ8A 4ZYDA 1ZLJA 1GDTA 3I0TA 5LBQA 1K83J 2L9NA 4NUBA 5KAFC 1I1GA 1HQCA 2QSFX 1YOVB 2IJLA 4HSRA 2R7DA 1MDMA 1W36C 4BBSJ 2JK3A 3GEZA 3WU1B 3S15J 2YX7A 1YI2I 1K61A 4I99C 3IKTA 3IP4B 1X1AA 2RV8A 3BG6A 3M07A 2EZIA 3KEQA 2DCEA 2KRCA 2B7EA 5D5VB 2M2EA 4NQWB 1T38A 2ZNZA 3D5LA 2XAUA 4EJUA 1T33A 3GUDA 4XN3A 1I39A 2F4IA 1JUSA 2X1CA 5LLQA 1B8IA 2XKOA 1USSA 1XMKA 3ULQB 3D1NI 2ZB9A 2QGUA 3A1YA 5AIQA 1KU7A 4BHBA 4I01A 2VOPA 3HHHA 1YJWI 3OWTA 1MNMC 3UKGA 3J7AO 1APLC 4LB5A 4X6AJ 2XAQA 2MABA 4BKXA 1Z7UA 3G1OA 2H8WA 2WWYA 3CCJI 2MH9A 1UHSA 3U21A 3L2RA 3DBRB 1LVKA 2VL8A 1ZK8A 3MEXA 3P5JA 4KNYA 3J80K 1MJ9A 2CH0A 3OYAA 1D5YA 2M4KA 2EA4A 1XS9A 1GT0C 4XIDA 2MC3A 1WJBA 4RAFA 2L4MA 2DN0A 3ASOH 5CVVA 4UUSB 3S14J 2AQFA 4DYRA 1SAUA 3OSGA 5E17F 3QP5A 1UB9A 3BR0A 2DQLA 4EEFG 2VIXA 4G7OF 1KQ9A 2XPWA 5FB2A 3IL2A 2FF4A 3GXOA 1YO5C 3OSFA 2NOJB 4BH9A 5D4RA 3OYFA 3W2AA 4E7JA 1YHQI 4U7BA 4NQWA 3ZMSA 4DQ2A 2R7FA 4II2A 1CGPA 3OMYA 3G2BA 4HPQA 3AL0C 2BHZA 4WF2A 2XKPA 3S2HJ 4IVNA 4FX0A 3L00A 1MJAA 2ISYA 1EJ9A 4G94A 2HR3A 3EUHC 4B4CA 4AD9A 4P96A 3NWTA 5DCMB 2E60A 3ML6A 4S0HB 5LEJA 2XVCA 3OYIA 3HTSB 4OMYA 3RTRA 2PFBA 6PAXA 1LDKB 2K3PA 3FXKA 1ZGWA 2F48A 4YIIA 3ERMA 2R0QC 3WGHA 4XRSA 4XLPF 1OR7C 1U9NA 1ETKA 2OCCH 4HLYA 4C3HJ 1IW7F 2M7BA 4QPOA 3TKYA 5DTDA 3KLOA 3LWFA 3JRCA 4BXUA 4BJ5C 2ZSIB 3M1EA 2XASA 4MFDA 4G12A 4UUVA 1DU0A 1ZQ3P 2QQ8A 4KFCA 2VE8A 4HRIA 2M30A 4KA4A 3TEDA 3BZ6A 4A0YA 1K79A 1ULYA 4KDPA 4MFEA 4CYCB 2STWA 4BUPA 2BOLA 4IX7A 1B72B 4AIHA 2RVCA 4DZJA 2IPQX 3OYKA 5J8FA 1I6XA 2DMNA 2ZO4A 3WODF 2GAUA 4AC0A 5M5XJ 3FWEA 3JREA 1K7AA 3K4BA 1E3OC 1ZTRA 4YFNF 4L0YB 2MG4A 3TOAA 1NK3P 2LLKA 2X51A 3G6EI 4UXNA 1KQ0A 3ZOBA 2KHMA 4RAYA 3CUQC 3GX4X 3K4KA 1U5TC 2Q1ZB 4E4HA 1MBEA 4PGHA 3DU5A 2VN2A 2CSOA 3ZXSA 2O8XA 3T1BA 1ETWA 1SMYF 2JT1A 4MHGA 2M8GX 2K9LA 3GTPJ 2HNHA 5LRSA 2D1HA 1U9OA 1MBKA 2ELKA 4FASD 3VYSB 1G8XA 4BBRJ 5E3NA 1QHGA 1XDUA 5JHFA 1LEBA 1J09A 4RLFA 2VXDA 4WCGA 2M87A 5HVQC 1ZH5A 5EYRA 3PQJA 4G6TB 3ZQQA 2CW0F 3TO9A 2W82A 3WG9A 4YIFA 4M6XA 5GPAA 3WGIA 1V5EA 1ETYA 1R5ID 1Y56A 1NHAA 2VBYA 2XGEA 4MEXF 3VB2A 3ZQ7A 3SFZA 1TL8A 3FIWA 3P9CA 1PVEA 5GAGJ 1R4MB 2VKHA 3OS0A 3WTTC 4GGGA 3D5RC 1JUMA 2O0YA 1IDZA 2I10A 1K6OA 2HVSA 5B66C 1IV6A 4OOIA 1ETXA 1QGPA 2DMTA 1I50J 2L5QA 4BQOA 2JUGA 1LKXA 3RI4A 2NVUB 2K40A 5M3FJ 4LOCA 1YITI 1R1VA 4Y7NJ 2F5VA 3L2CA 4D5CA 3BCAA 1HCRA 2KLOA 2H09A 4N9HA 2GLOA 3TDUC 4W1UA 1I3QJ 3N97A 3GO5A 2WB1A 3FM3A 4UUTA 4O5VA 2KIFA 3RPQA 3CP8A 3S32A 1A04A 4V19K 2L3DA 2UXXA 4Y3OA 3JTGA 1GUUA 2KPMA 3HUGA 2R7UA 1KA8A 2EH3A 3HL2A 1MSFC 1VQLI 4BS9A 1GHCA 4A69C 3NWSA 1JKRC 1ZREA 1T6SA 1DUXC 2HXOA 2LR8A 3H9QA 5M3MJ 4ESFA 5F04A 2PMHA 4PJNA 1IN7A 1XD7A 3DP7A 1IO2A 2EQRA 3ABUA 3HGYA 4XORA 1ZN2A 4LITA 1IG7A 3VYTB 2NYXA 2QCOA 1BC7C 2KIQA 2I8DA 5LEKA 3HPGA 4G6DA 1ZKGA 2ZFWA 1H9TA 3S3NA 3U2RA 3M8EA 3RJPA 2BGCA 2IGKA 2V9PA 1XC5A 1WJ5A 1GXQA 3VEPA 4ENNA 2VJ5A 1QVTA 1Z7LA 3LA7A 2XB0X 1IXSB 5KK1A 3G3ZA 2EIMH 2CV0A 3S2DJ 3DKYA 2FU4A 4P9FA 2JUCA 5LD2C 4BHCA 2QWWA 2Y48A 4CICA 3H3UA 4PCQA 4ABZA 3ZQCA 1FYKA 1D1AA 1FYMA 2VPLA 3J81Z 2XHKA 2DDAA 2W00A 3CLQA 1Y1VJ 2K86A 1MMAA 1PUEE 2L4AA 4ZTJA 3VWBA 3JSPA 2DFIA 1WFXA 1ON1A 1U5TB 1V4RA 2DPDA 3SQNA 3GTQJ 2F5EA 2O3FA 1OCZH 1Z1DA 1QHHD 4OAZA 1CF7A 1YW9A 3QPTA 3RKYA 3Q9SA 3V7CA 3VOEA 3CCEI 4BU2A 4D0PA 4AU7A 2K02A 1VFCA 4XLAA 1LFPA 4V2FA 3CCQI 2OJED 4U7DA 3AAFA 1QU3A 3F8FA 2VQHA 5CVRA 3OOUA 2O8KA 3EUHA 3IC7A 3M9AA 2CGPA 2OV7A 3GTMJ 1VF9A 5EZHA 1TQMA 2R7SA 2ESHA 1MBHA 2Z3YA 2OZ6A 4NB5A 3K1PA 3VPRA 2H1LA 5IOZA 2R93J 2NNNA 4BNCA 1OR7A 4A6DA 1TQIA 3VODA 3BJAA 4Q47A 3BY6A 3GZNB 1XGMA 4F7ZA 4W97A 4C30A 4M74A 1SFUA 1MBFA 3O8HA 2YR2A 4ESBA 3ABTA 1FLIA 1HKTA 1WI3A 2JRMA 3E6BA 1XCVA 4BL0B 3CTAA 3KLNA 4XOPA 1R6RA 3K69A 1O3QA 4HF1A 2W4SA 4PSXA 1REPC 1UELB 4Y13A 3KE2A 3WU2C 4CCNA 3WTUC 2V79A 2EZLA 1V55H 5DUIA 4RB1A 3FKJA 1A36A 3FKIJ 4QLCU 5FD6A 1HW5A 1TWAJ 2P6TA 2EINH 1WI9A 1D0ZA 1MSEC 3E5UA 3FF5A 5IYCJ 3R0AA 1Z77A 3LQQA 2OCEA 1CF7B 3M8FA 3BQZA 4IEJA 1D3YA 1FP2A 3VFZA 5HODA 4I76A 4I7HA 3ZMVA 3JAMK 4FE4A 3ZR8X 4BE2A 3V42A 3AG2H 1S29A 2WTEA 1YX3A 1PP7U 4Y15A 3TO7A 1BR2A 2XROA 3ERED 3L7WA 1RPWA 1LDDA 1RR7A 3T8RA 2L7KA 4OIPF 4BGDA 5ILVA 1UAAA 2NS7A 2XPUA 3BC8A 2BYVE 4BHPA 1IAWA 2M0CA 1FZPB 3CD6I 3KPHA 3I4MJ 1JT6A 4J01A 2ZC2A 2ZXIA 1DPRA 1YJNI 3LFKA 3JRGA 1G3WA 2CQ7A 4M3FA 5E18F 1U8BA 2A05A 2CJJA 2VASA 3IH4A 5H6QA 1G59A 1IF1A 3GTLJ 3CP2A 3HM5A 4M6VA 1JE8A 1IRGA 1Z67A 1LE8A 4G9YA 2V7FA 4XLEA 3ABLH 3O2PE 1X1DA 2L7ZA 3LSTA 3TGNA 9ANTA 3Q0WA 5LFAA 4B48A 2A6HF 1V5GA 4WK8F 2DMQA 4Z6YA 5IP7J 2DYSH 2FXAA 1IXRC 5LHGA 5D8LB 4XNFA 1B6AA 4D7NA 4EJWA 4WXDA 1FMWA 2LY2A 2YPRA 5IT9Z 3Q0VA 3LOCA 5H6RA 2EV6A 3OIPA 2WB1N 2VT3A 3ZRGA 3BTLA 2NRAC 2JA6J 2MD0A 1U3EM 3RKQA 2VE9A 3LAJA 2GWRA 2YU9J 1OCTC 4XM3A 4IHYA 2VKEA 1Q1VA 2P4WA 1UCRA 4I02A 1NK2P 3EUAA 1X1PA 4HQEA 1TQPA 3LSMA 5A2QZ 4HX8A 3TBIA 2XAFA 2IS4A 2HKXA 1ITYA 1VQPI 3PFYA 1EH7A 1JJ6C 4A3KJ 3QRFF 1YRNA 3HOVJ 4XL9A 1FTTA 2ME0A 1D8JA 1X4OA 2DA5A 1W5TA 3BQYA 3ZQLA 4KICA 1JHFA 3CJTB 3GZ6A 1LVAA 4KISA 1DQUA 5D5UB 1E17A 4B09A 1N77A 5FKKA 3L2UA 4M71A 5LGUA 3MKZA 4IHTA 1JUPA 2GQQA 2ZXJA 2VKVA 1FNNA 1YS6A 1IDYA 2COMA 3FX3A 2O7OA 4CCMA 3BCBA 2EK5A 4B47A 1BW6A 2UZKA 2ZJQF 1YJ9I 5HLTA 1Z0XA 2LBFA 1D1BA 2KIMA 3BG5A 4ENKA 3HHGA 4JP0A 2LKXA 2GXAA 1HW1A 4IXAA 1FYLA 3QU3A 3FBIB 2Z2SB 2CUJA 2VJ4A 2XUBA 2HOTA 2IT0A 3NAUA 3K0LA 4CCOA 2DA4A 1PUFB 2HPMA 3QQAA 1XPXA 4OIQF 1GLNA 2LF8A 5HOOA 3LSJA 1FOKA 2XGDA 5ICEA 1O4XA 5J4YA 1P2FA 4KT5C 5DCFA 3TP0A 3C1DA
chains in the Genus database with same CATH topology
1ONVA 3E3VA 2P8TA 3BP8A 3PFIA 2MBFA 5FFXA 3WE2A 1RZ4A 2EWNA 2J5OA 4IRGA 1FWZA 1XGSA 2A07F 4HQMA 4IRIA 2W57A 2W25A 4LGWA 2DTRA 4CYDA 3GYHX 1B59A 1P4XA 5KVRA 3QOPA 1XGOA 4RGUA 1KU2A 1QO0D 2LF7A 4E70A 2FQ3A 4I0BA 3FM5A 3GFLA 4PGGA 2TDXA 4Z2YA 2QYOA 5JHUA 3HOTA 2ZMEA 2F2EA 5CLSA 2A3SA 4LMYA 2XAJA 5H20A 2FNPA 1ODDA 4YG2F 5JR3A 2KKOA 3O3KA 1R22A 3IHUA 1XSXA 4LK1F 1F9NA 3WTYC 3BOQA 5ERIA 1L3LA 1O3TA 2P7VB 5DEQA 5E1WA 1IZ1A 2GIVA 2PI0A 1S7AA 3LA2A 2V1XA 1BOAA 3GF2A 1HKSA 1FBSA 4XBFA 1J2XA 3QP6A 1W4MA 3FHZA 4IHSA 3IRRA 4P9UA 1BM9A 2H6BA 2Z99A 4ETSA 2XGXA 3W6JB 4I09A 5E1ZB 1FSEA 2QZ8A 1UFMA 2FRHA 1LB2A 1MZBA 2OA4A 4CGZA 5EEHA 4ZZLA 4S05A 1JGSA 2HYGD 3BPXA 4A6EA 3TOBA 3QAHA 1PP8F 4M9ZA 1F1ZA 2NNYA 2PBIA 4EM0B 4MEYF 2BBYA 4L0ZB 3D0SA 5ICGA 4P5OA 2V9VA 2WV0A 5LHHA 3ZMTA 4CXFA 2Z33A 4I0AA 3RYRA 2A68F 2GXGA 4GXOA 4ENJA 4RAZA 2D1VA 3DF8A 1TTYA 3KCCA 1YYVA 4HDVA 1L0OC 5HDKA 3DKWA 4M72A 5CJ9A 5K5OA 2CWEA 2H6CA 5E20A 1PDNC 2RQPA 4M73A 3DV8A 3I64A 4A2UA 3DEUA 5F6FA 5L3EA 3CDHA 1UHWA 2V1UA 3LAPA 2HZTA 5AIPA 4U0VA 4ENMA 1HW2A 3MWMA 2VT2A 5E1XA 3T0YA 3COAC 4HLXA 1SFXA 1P4WA 3CUQB 2R3SA 3Q5FA 5ICCA 1I1SA 4BYYA 2LKPA 4L9VA 3H3ZA 4LK0F 1U6GA 2DU9A 2JPCA 3KP3A 4Q5SF 1YFHA 2A5YB 2E7WA 1BBYA 1ZAOA 1QBJA 2XRNA 4OINF 2CO5A 1KYZA 1QPMA 3LQRA 4A5NA 4HZFA 2FMYA 4IRHA 2OQGA 5DCMA 1YS7A 2Z5UA 5JVTA 3EQLF 3F22A 3B73A 3CO7C 2ZMEB 2MLKA 3SHFA 5BPIA 3OOPA 2VBZA 5FGMA 3HSFA 1LDJA 3F23A 3ZP5A 2DT5A 2DQRA 4Q48A 4BAYA 4L18B 1ZGJA 5L3DA 3MAJA 3SXYA 3V7RA 1DP7P 1JXSA 3IWFA 2HWVA 5HDGA 2ZNYA 2H94A 1KU3A 3ROUA 3IKVA 1RNLA 3CJNA 2DK8A 4JQFA 3V8LA 5D8KB 2V6CA 1YTYA 3P9KA 2EA2A 1O7LA 2AXLA 2EB7A 1FBQA 2OBPA 1SD7A 1W5SA 3KETA 4L9NA 2AS5F 2FMLA 1VTNC 3TDZC 1XDSA 4FHTA 5DV5A 2FSWA 4RB2C 1ZHFA 4ZYGA 2JPBA 4HF0A 1OYWA 1U2WA 3G73A 1R7JA 4CHUA 1Z05A 4JBAA 3NRVA 2KIUA 1G3SA 1AOYA 3DPTA 4IPAA 4EJVA 1QZYA 1R5HA 2JTVA 4U88A 3I59B 4WX9A 2IA2A 2V1DA 1GVJA 2FA5A 3SZTA 3HOSA 1G4DA 3F8MA 5BPDA 2DLLA 2F5DA 2G9WA 1BIAA 4JK1X 1R1TA 1KYWA 1S7OA 4RB0A 4ZYHA 2EFWA 4G7ZF 4ZH4F 3DFGA 3RIRA 1QZZA 1C0WA 1R23A 2D2WA 2X4HA 5AONA 1G3TA 1V3FA 3DXJF 2CQKA 4MTEA 3M7GA 4KN4X 1W7PB 3E6CC 4XRFA 2QQBA 4U0YA 1SAXA 3B02A 4GYIA 2UXNA 3CUQA 3BJ6A 2QENA 1EH8A 1QQIA 4UVAA 2M1BA 1P92A 2VXZA 4U0WA 1WRJA 3ECOA 2IW5A 1O3RA 3RKWA 4EJOA 3GVAA 1G6NA 2IRFG 4I98B 4WXHA 1H0MA 1Z9CA 3U9GA 3W6KB 2Y75A 2RNJA 5HLGA 2P7CB 5TRDA 2JRTA 1IRFA 4HA8A 3PQKA 2VOOA 3BPVA 2MA3A 4HOBA 5HS7A 4UNOA 1KU9A 1XMAA 2O03A 2E1CA 1B9MA 2HS5A 1YG2A 2K4BA 3GW2A 3E5XA 1Q1HA 2HTJA 2OD5A 3JTHA 2QQAA 5K5RA 1Z6TA 1B4AA 1W7PA 3RPUA 5HLHA 1B1BA 5J6XA 3CUOA 3GLXA 1FX7A 1U8RA 2OQRA 4S04A 1S6LA 3TQNA 4Y17A 1GXPA 3V4GA 1LEAA 4BQAA 4EJTA 5FLXZ 4PDKA 5F1RA 2STTA 3FMRA 1MD0A 5CVUA 2H27A 2ELHA 2GA2A 1OPCA 3F72A 4FT8A 3F6VA 3K1NA 4HDUA 1BC8C 1YW8A 3CLOA 1XGNA 3E5QA 3REOA 2GZWA 4M6YA 2IA1A 1HKQA 1J7KA 2M45A 3R4KA 3KP5A 2HGCA 4XSZF 3WTWC 1FP1D 3KFWX 1MDMB 2HEOA 4IJAA 1WWXA 5JI6A 2Q2EA 3KZZA 2ETHA 5CVJA 3FXUA 3KP6A 4AIKA 2XIGA 2DO7A 1YLFA 5ILUA 2F5FA 2L01A 3E97A 3I59A 1RUNA 4A5MA 1D8KA 1P4AA 3HTUA 3HRSA 1F4KA 4KMUX 2RC4A 3HRTA 2KJCA 3I5UA 5E8IA 4WWCA 2Y0MA 2XV4S 3HYIA 5LGTA 4G7HF 3V7SA 1Z6RA 3FXRA 3OV8A 2KRFA 1U5TA 4I2OA 2KJBA 4MGRA 5L3BA 2QLZA 2PN6A 3ZMUA 2JZYA 4HV5A 3GFIA 2JSCA 4NHJA 2PMUA 1J0RA 4YFKF 1TNSA 3DQVC 3EYIA 2IVMA 1BN5A 1HXDA 1LQ1A 3FZVA 3JSOA 4RGXA 2PEXA 4OU0A 4HBLA 2ESNA 3K9TA 1T2KA 2YSRA 5ILSA 1XN7A 4AWXB 2EFOA 2A61A 4M9XA 2ZBKA 3MZYA 4RS8A 1ZLKA 3L9FA 1ZRCA 2VC0A 3HIFA 1SD6A 3F8NA 3WGGA 5F64A 2LDUA 2HQRA 1DDNA 1WKMA 1WQ2A 3P7NA 1TW3A 5TJJA 3V8KA 1MGTA 4M9SA 4HV6A 4TV7A 2C6YA 4GO1A 2ADUA 3MZHA 2FNAA 5HS8A 3KP7A 5FFZA 1SFEA 3J81K 2MD5A 4LD5A 1XSDA 1SD4A 3IWZA 3RKXA 2XAGA 2RN7A 1ZG5A 4KN7X 3I4PA 1HBXG 2P6SA 2ACJA 1RIOH 2L02A 4A0XA 1OYIA 2M8EA 2A6EF 1ZRDA 1UHMA 1ZG1A 3WTXC 2NS0A 3H92A 1WSUA 2ZCWA 4L9TA 1IXCA 2E7XA 3R6SA 3MFKA 2EV0A 3MCZA 1YIOA 1O57A 2E1NA 3GWZA 2HOEA 3HSRA 4LLNA 4OMZA 1XCBA 4LJZF 4UVCA 1LNWA 5FD5A 2CFXA 4LLLA 3KZYA 3IRQA 1KGSA 1S3JA 4OIOF 1D5VA 4UV9A 4KIBA 4R8HA 4O6JA 5ED4A 3ZN1A 1SMTA 2J5PA 5HDNA 2DPUA 1I27A 1TNTA 4L5IA 2LSOA 2MLGA 3RDIA 2QBYB 4MTDA 1J59A 1ZRFA 1J5YA 3R61A 3EYYA 2W84A 1O7FA 1HSJA 1FY7A 2W24A 2ZJ2A 2EJRA 2G7UA 5K5QA 1KQ8A 5L3FA 2P5VA 5D5XB 1BI3A 2GXBA 1ZG3A 2VC1A 3GFJA 5CVIA 2PG4A 3GFMA 4R79A 1MJBA 3HRMA 1FBUA 2HQNA 3L09A 4HX4A 3ISPA 1LJ9A 4ASNA 3CO6C 1YW7A 2FBIA 3HSEA 2HYFA 1TW2A 1OMIA 2FE3A 1O3SA 1EH6A 3ZN0A 1HSTA 3R60A 3Q9VA 4CO8A 3E6DA 3F8CA 4LLGF 3RYPA 3C7JA 3O6BB 1USTA 3ZMDA 5JFRA 5ICFA 2EV5A 4CZZA 2X0LA 2Q0OA 3EDPA 5BS6A 4ESJA 3NEUA 1IUYA 5E8GA 4EQQA 4LG0B 4UHTA 2RKHA 4MQVA 3WTVC 1RUOA 4K2EA 3F6OA 3BWGA 2P5KA 4KUMA 1IN4A 4A0ZA 1XB4A 4KIGA 4L9JA 3R0JA 4L5JA 1J9IA 3P9IA 4RGRA 5CYVA 2YX4A 3C3WA 1YQAA 4ZYEA 1H9GA 3T5XA 5DUKA 2IP2A 2O61A 2FEZA 4ZZDA 3V8JA 2Z9OA 3I54A 4GCVA 1JHHA 1FPQA 3ZPLA 4XLNF 3WE3A 1P6RA 1ZARA 2HFHA 4A12A 4LG0A 2XAHA 1F5TA 2GA1A 2VONA 4PZJA 5BMZA 1OKRA 3QPHA 4HYEA 4UV8A 5DDGA 3WTZA 1W7PD 3F3XA 5EEGA 2QBYA 2L54A 3BDDA 4G6QA 3FMSA 4Q4ZF 2NAZA 4R1HA 4IF4A 2F5CA 4P55A 4HW0A 5A2QK 4HF2A 3TO6A 2DI3A 1T98A 2OAZA 1IN8A 1J75A 3JW4A 1IN6A 4WXCA 2HDCA 2DAOA 1MKMA 1R58A 1E2XA 1OYYA 4ON0A 1Z91A 5J8CA 3BJOA 3SZPA 3NQOA 5DD8A 5IT9K 2VODA 2QM3A 4CDGA 1BI2A 3K1MA 1R5GA 4FX4A 3S2WA 3I53A 1R1UA 2ISZA 3LA3A 2EFQA 4LFUA 2DK5A 4MQ9F 1EV7A 4KIFA 5HLIA 2O6GE 4O3MA 4DNCA 4EGZA 4OIRF 4EVIA 3I71A 2K7LA 1RI7A 4EMSA 5L3GA 2BE5F 2OZUA 3FXQA 3QU6A 2QUFA 4G8XA 3KP2A 2G7HA 4AIJA 3FMQA 3F21A 2EFPA 1T39A 1AWCA 2OU2A 2K4JA 4RGSA 4GYGA 1BI0A 1BIBA 5D4SA 2B0LA 2M5WA 3E6MA 3F8BA 5D6FA 1U78A 2MH2A 2K27A 4LB6B 1S8NA 2CYYA 1R36A 1SD5A 1R00A 3EETA 2DBBA 1XSVA 1ON2A 3ZMZA 2FOKA 1T0FA 2FBHA 4EV0A 5LHIA 5L3CA 1QNTA 3N4MA 5DYMA 3U1DA 5FLXK 1FT9A 2PJPA 2QQ9A 4KMFA 1K78A 4MNUA 1Y0UA 3DPLC 2HTSA 1B9NA 4HX7A 4KYWA 4XSXF 1DPUA 3T8TA 3KP4A 4UVBA 3K2ZA 2WC2A 1BJAA 2W85A 2PLYA 2YU3A 1I5ZA 4RB3C 3JAMZ 3ELKA 3WTSC 4YFXF 4EM2A 2ZKZA 2LNBA 3C18A 2A69F 2CG4A 2BV6A 5D6EA 4EM1A 3BROA 3WU0A 2DW4A 1FC3A 3GZ5A 2QVOA 4EGYA 2PQ8A 1X3UA 3ECHA 5DD4A 5HS9A 2Q8KA 5BOXA 1ZYRF 4N9IA 2BEOA 2FBKA 5LRRA 4AVPA 1IN5A 4QWQA 2RGVA 5BQTA 2VBWA 5FO5A 5LGNA 1BI1A 2UWMA 1STZA 3HRUA 4HAMA 3J80Z 1K78B 4N0BA 1ZGAA 3MQ0A 1TLHB 4H0EA 2D45A 2HKOA 2P5LC 2IA0A 5D5WB 3I58A 2VBXA 1TBXA 4B8XA 5IT3A 2RDPA 1G3YA 1FSHA 2EFNA 3KEOA 5K1YA 4ZYDA 1ZLJA 3I0TA 5LBQA 1I1GA 1HQCA 2IJLA 2R7DA 1MDMA 3GEZA 3WU1B 2YX7A 3IKTA 2RV8A 3KEQA 5D5VB 1T38A 2ZNZA 3D5LA 4EJUA 3GUDA 5LLQA 2XKOA 1USSA 1XMKA 3ULQB 5AIQA 1KU7A 4BHBA 4I01A 2VOPA 3HHHA 3J7AO 4LB5A 2XAQA 1Z7UA 2WWYA 2MH9A 3MEXA 4KNYA 3J80K 1MJ9A 2EA4A 2MC3A 2L4MA 5CVVA 5E17F 3QP5A 1UB9A 2DQLA 4G7OF 1KQ9A 5FB2A 3IL2A 2FF4A 3GXOA 1YO5C 5D4RA 4BH9A 4U7BA 4NQWA 3ZMSA 4DQ2A 2R7FA 1CGPA 4WF2A 2XKPA 4IVNA 4FX0A 3L00A 1MJAA 2ISYA 4G94A 2HR3A 4AD9A 4P96A 5DCMB 3ML6A 5LEJA 2XVCA 3HTSB 4OMYA 3RTRA 2PFBA 6PAXA 1LDKB 4YIIA 3WGHA 4XLPF 4HLYA 1IW7F 3TKYA 3KLOA 3LWFA 4BXUA 3M1EA 2XASA 4UUVA 4KFCA 2VE8A 2M30A 4KA4A 3BZ6A 4A0YA 1K79A 1ULYA 4KDPA 2STWA 4AIHA 2RVCA 2IPQX 5J8FA 1I6XA 2ZO4A 3WODF 2GAUA 3FWEA 1K7AA 4YFNF 4L0YB 3TOAA 4UXNA 1KQ0A 4RAYA 3CUQC 3GX4X 1U5TC 4PGHA 2VN2A 2CSOA 2O8XA 3T1BA 1SMYF 2JT1A 4MHGA 5LRSA 2D1HA 1XDUA 1LEBA 4WCGA 2M87A 5HVQC 1ZH5A 3PQJA 2CW0F 3TO9A 3WG9A 4YIFA 4M6XA 3WGIA 1NHAA 2VBYA 4MEXF 3VB2A 3ZQ7A 3SFZA 3P9CA 3WTTC 4GGGA 2O0YA 1K6OA 4OOIA 1QGPA 3RI4A 1R1VA 3L2CA 4N9HA 2H09A 3TDUC 3N97A 3GO5A 3FM3A 4O5VA 2KIFA 3RPQA 1A04A 2L3DA 2UXXA 3JTGA 3HUGA 1KA8A 1GHCA 1ZREA 1T6SA 1DUXC 4ESFA 2PMHA 1IN7A 1XD7A 3DP7A 3ABUA 1ZN2A 2NYXA 1BC7C 5LEKA 4G6DA 2ZFWA 1H9TA 3U2RA 3M8EA 3RJPA 2BGCA 1GXQA 3VEPA 4ENNA 3LA7A 1IXSB 5KK1A 3G3ZA 2FU4A 4P9FA 4BHCA 2QWWA 2Y48A 4CICA 3H3UA 4PCQA 1FYKA 1FYMA 3J81Z 2XHKA 2K86A 1PUEE 2L4AA 3JSPA 2DFIA 1ON1A 1U5TB 1V4RA 2DPDA 3SQNA 2F5EA 2O3FA 1Z1DA 1CF7A 1YW9A 3QPTA 3RKYA 3Q9SA 3V7CA 3VOEA 4D0PA 2K02A 4U7DA 3AAFA 3F8FA 5CVRA 3EUHA 3IC7A 3M9AA 2CGPA 1TQMA 2ESHA 2Z3YA 4NB5A 2OZ6A 3K1PA 2NNNA 4BNCA 1OR7A 4A6DA 1TQIA 3VODA 3BJAA 4Q47A 3BY6A 1XGMA 4F7ZA 4M74A 1SFUA 2YR2A 4ESBA 3ABTA 1FLIA 1HKTA 3E6BA 1XCVA 3CTAA 3KLNA 3K69A 1O3QA 4HF1A 1REPC 4Y13A 3KE2A 3WTUC 2V79A 5DUIA 4RB1A 4QLCU 5FD6A 1HW5A 2P6TA 1WI9A 3E5UA 3FF5A 3R0AA 3LQQA 1CF7B 3M8FA 1D3YA 1FP2A 3VFZA 4I7HA 3ZMVA 3JAMK 1PP7U 1S29A 2WTEA 4Y15A 3TO7A 2XROA 3ERED 3L7WA 1LDDA 3T8RA 4OIPF 5ILVA 4BHPA 2BYVE 1IAWA 1FZPB 1DPRA 3LFKA 1G3WA 5E18F 5H6QA 1IF1A 1JE8A 1IRGA 4G9YA 3O2PE 3LSTA 3TGNA 2A6HF 4WK8F 2FXAA 1IXRC 5LHGA 5D8LB 1B6AA 4EJWA 4WXDA 2YPRA 5IT9Z 5H6RA 2EV6A 2VT3A 2NRAC 1U3EM 2VE9A 3LAJA 2GWRA 2P4WA 1UCRA 4I02A 4HQEA 1TQPA 5A2QZ 4HX8A 2XAFA 2HKXA 1EH7A 3QRFF 1D8JA 1W5TA 4KICA 1JHFA 3GZ6A 1LVAA 5D5UB 1E17A 4B09A 4M71A 5LGUA 4IHTA 2GQQA 2ZXJA 1FNNA 1YS6A 2COMA 3FX3A 2EK5A 2UZKA 4ENKA 2KIMA 3HHGA 1HW1A 4IXAA 1FYLA 3QU3A 2XUBA 2IT0A 3K0LA 4OIQF 2LF8A 5HOOA 1FOKA 5ICEA 1P2FA 4KT5C 5DCFA 3C1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONV A;  3E3V A;  2P8T A;  3BP8 A;  3PFI A;  2MBF A;  5FFX A;  3WE2 A;  1RZ4 A;  2EWN A;  2J5O A;  4IRG A;  1FWZ A;  1XGS A;  2A07 F;  4HQM A;  4IRI A;  2W57 A;  2W25 A;  4LGW A;  2DTR A;  4CYD A;  3GYH X;  1B59 A;  1P4X A;  5KVR A;  3QOP A;  1XGO A;  4RGU A;  1KU2 A;  1QO0 D;  2LF7 A;  4E70 A;  2FQ3 A;  4I0B A;  3FM5 A;  3GFL A;  4PGG A;  2TDX A;  4Z2Y A;  2QYO A;  5JHU A;  3HOT A;  2ZME A;  2F2E A;  5CLS A;  2A3S A;  4LMY A;  2XAJ A;  5H20 A;  2FNP A;  1ODD A;  4YG2 F;  5JR3 A;  2KKO A;  3O3K A;  1R22 A;  3IHU A;  1XSX A;  4LK1 F;  1F9N A;  3WTY C;  3BOQ A;  5ERI A;  1L3L A;  1O3T A;  2P7V B;  5DEQ A;  5E1W A;  1IZ1 A;  2GIV A;  2PI0 A;  1S7A A;  3LA2 A;  2V1X A;  1BOA A;  3GF2 A;  1HKS A;  1FBS A;  4XBF A;  1J2X A;  3QP6 A;  1W4M A;  3FHZ A;  4IHS A;  3IRR A;  4P9U A;  1BM9 A;  2H6B A;  2Z99 A;  4ETS A;  2XGX A;  3W6J B;  4I09 A;  5E1Z B;  1FSE A;  2QZ8 A;  1UFM A;  2FRH A;  1LB2 A;  1MZB A;  2OA4 A;  4CGZ A;  5EEH A;  4ZZL A;  4S05 A;  1JGS A;  2HYG D;  3BPX A;  4A6E A;  3TOB A;  3QAH A;  1PP8 F;  4M9Z A;  1F1Z A;  2NNY A;  2PBI A;  4EM0 B;  4MEY F;  2BBY A;  4L0Z B;  3D0S A;  5ICG A;  4P5O A;  2V9V A;  2WV0 A;  5LHH A;  3ZMT A;  4CXF A;  2Z33 A;  4I0A A;  3RYR A;  2A68 F;  2GXG A;  4GXO A;  4ENJ A;  4RAZ A;  2D1V A;  3DF8 A;  1TTY A;  3KCC A;  1YYV A;  4HDV A;  1L0O C;  5HDK A;  3DKW A;  4M72 A;  5CJ9 A;  5K5O A;  2CWE A;  2H6C A;  5E20 A;  1PDN C;  2RQP A;  4M73 A;  3DV8 A;  3I64 A;  4A2U A;  3DEU A;  5F6F A;  5L3E A;  3CDH A;  1UHW A;  2V1U A;  3LAP A;  2HZT A;  5AIP A;  4U0V A;  4ENM A;  1HW2 A;  3MWM A;  2VT2 A;  5E1X A;  3T0Y A;  3COA C;  4HLX A;  1SFX A;  1P4W A;  3CUQ B;  2R3S A;  3Q5F A;  5ICC A;  1I1S A;  4BYY A;  2LKP A;  4L9V A;  3H3Z A;  4LK0 F;  1U6G A;  2DU9 A;  2JPC A;  3KP3 A;  4Q5S F;  1YFH A;  2A5Y B;  2E7W A;  1BBY A;  1ZAO A;  1QBJ A;  2XRN A;  4OIN F;  2CO5 A;  1KYZ A;  1QPM A;  3LQR A;  4A5N A;  4HZF A;  2FMY A;  4IRH A;  2OQG A;  5DCM A;  1YS7 A;  2Z5U A;  5JVT A;  3EQL F;  3F22 A;  3B73 A;  3CO7 C;  2ZME B;  2MLK A;  3SHF A;  5BPI A;  3OOP A;  2VBZ A;  5FGM A;  3HSF A;  1LDJ A;  3F23 A;  3ZP5 A;  2DT5 A;  2DQR A;  4Q48 A;  4BAY A;  4L18 B;  1ZGJ A;  5L3D A;  3MAJ A;  3SXY A;  3V7R A;  1DP7 P;  1JXS A;  3IWF A;  2HWV A;  5HDG A;  2ZNY A;  2H94 A;  1KU3 A;  3ROU A;  3IKV A;  1RNL A;  3CJN A;  2DK8 A;  4JQF A;  3V8L A;  5D8K B;  2V6C A;  1YTY A;  3P9K A;  2EA2 A;  1O7L A;  2AXL A;  2EB7 A;  1FBQ A;  2OBP A;  1SD7 A;  1W5S A;  3KET A;  4L9N A;  2AS5 F;  2FML A;  1VTN C;  3TDZ C;  1XDS A;  4FHT A;  5DV5 A;  2FSW A;  4RB2 C;  1ZHF A;  4ZYG A;  2JPB A;  4HF0 A;  1OYW A;  1U2W A;  3G73 A;  1R7J A;  4CHU A;  1Z05 A;  4JBA A;  3NRV A;  2KIU A;  1G3S A;  1AOY A;  3DPT A;  4IPA A;  4EJV A;  1QZY A;  1R5H A;  2JTV A;  4U88 A;  3I59 B;  4WX9 A;  2IA2 A;  2V1D A;  1GVJ A;  2FA5 A;  3SZT A;  3HOS A;  1G4D A;  3F8M A;  5BPD A;  2DLL A;  2F5D A;  2G9W A;  1BIA A;  4JK1 X;  1R1T A;  1KYW A;  1S7O A;  4RB0 A;  4ZYH A;  2EFW A;  4G7Z F;  4ZH4 F;  3DFG A;  3RIR A;  1QZZ A;  1C0W A;  1R23 A;  2D2W A;  2X4H A;  5AON A;  1G3T A;  1V3F A;  3DXJ F;  2CQK A;  4MTE A;  3M7G A;  4KN4 X;  1W7P B;  3E6C C;  4XRF A;  2QQB A;  4U0Y A;  1SAX A;  3B02 A;  4GYI A;  2UXN A;  3CUQ A;  3BJ6 A;  2QEN A;  1EH8 A;  1QQI A;  4UVA A;  2M1B A;  1P92 A;  2VXZ A;  4U0W A;  1WRJ A;  3ECO A;  2IW5 A;  1O3R A;  3RKW A;  4EJO A;  3GVA A;  1G6N A;  2IRF G;  4I98 B;  4WXH A;  1H0M A;  1Z9C A;  3U9G A;  3W6K B;  2Y75 A;  2RNJ A;  5HLG A;  2P7C B;  5TRD A;  2JRT A;  1IRF A;  4HA8 A;  3PQK A;  2VOO A;  3BPV A;  2MA3 A;  4HOB A;  5HS7 A;  4UNO A;  1KU9 A;  1XMA A;  2O03 A;  2E1C A;  1B9M A;  2HS5 A;  1YG2 A;  2K4B A;  3GW2 A;  3E5X A;  1Q1H A;  2HTJ A;  2OD5 A;  3JTH A;  2QQA A;  5K5R A;  1Z6T A;  1B4A A;  1W7P A;  3RPU A;  5HLH A;  1B1B A;  5J6X A;  3CUO A;  3GLX A;  1FX7 A;  1U8R A;  2OQR A;  4S04 A;  1S6L A;  3TQN A;  4Y17 A;  1GXP A;  3V4G A;  1LEA A;  4BQA A;  4EJT A;  5FLX Z;  4PDK A;  5F1R A;  2STT A;  3FMR A;  1MD0 A;  5CVU A;  2H27 A;  2ELH A;  2GA2 A;  1OPC A;  3F72 A;  4FT8 A;  3F6V A;  3K1N A;  4HDU A;  1BC8 C;  1YW8 A;  3CLO A;  1XGN A;  3E5Q A;  3REO A;  2GZW A;  4M6Y A;  2IA1 A;  1HKQ A;  1J7K A;  2M45 A;  3R4K A;  3KP5 A;  2HGC A;  4XSZ F;  3WTW C;  1FP1 D;  3KFW X;  1MDM B;  2HEO A;  4IJA A;  1WWX A;  5JI6 A;  2Q2E A;  3KZZ A;  2ETH A;  5CVJ A;  3FXU A;  3KP6 A;  4AIK A;  2XIG A;  2DO7 A;  1YLF A;  5ILU A;  2F5F A;  2L01 A;  3E97 A;  3I59 A;  1RUN A;  4A5M A;  1D8K A;  1P4A A;  3HTU A;  3HRS A;  1F4K A;  4KMU X;  2RC4 A;  3HRT A;  2KJC A;  3I5U A;  5E8I A;  4WWC A;  2Y0M A;  2XV4 S;  3HYI A;  5LGT A;  4G7H F;  3V7S A;  1Z6R A;  3FXR A;  3OV8 A;  2KRF A;  1U5T A;  4I2O A;  2KJB A;  4MGR A;  5L3B A;  2QLZ A;  2PN6 A;  3ZMU A;  2JZY A;  4HV5 A;  3GFI A;  2JSC A;  4NHJ A;  2PMU A;  1J0R A;  4YFK F;  1TNS A;  3DQV C;  3EYI A;  2IVM A;  1BN5 A;  1HXD A;  1LQ1 A;  3FZV A;  3JSO A;  4RGX A;  2PEX A;  4OU0 A;  4HBL A;  2ESN A;  3K9T A;  1T2K A;  2YSR A;  5ILS A;  1XN7 A;  4AWX B;  2EFO A;  2A61 A;  4M9X A;  2ZBK A;  3MZY A;  4RS8 A;  1ZLK A;  3L9F A;  1ZRC A;  2VC0 A;  3HIF A;  1SD6 A;  3F8N A;  3WGG A;  5F64 A;  2LDU A;  2HQR A;  1DDN A;  1WKM A;  1WQ2 A;  3P7N A;  1TW3 A;  5TJJ A;  3V8K A;  1MGT A;  4M9S A;  4HV6 A;  4TV7 A;  2C6Y A;  4GO1 A;  2ADU A;  3MZH A;  2FNA A;  5HS8 A;  3KP7 A;  5FFZ A;  1SFE A;  3J81 K;  2MD5 A;  4LD5 A;  1XSD A;  1SD4 A;  3IWZ A;  3RKX A;  2XAG A;  2RN7 A;  1ZG5 A;  4KN7 X;  3I4P A;  1HBX G;  2P6S A;  2ACJ A;  1RIO H;  2L02 A;  4A0X A;  1OYI A;  2M8E A;  2A6E F;  1ZRD A;  1UHM A;  1ZG1 A;  3WTX C;  2NS0 A;  3H92 A;  1WSU A;  2ZCW A;  4L9T A;  1IXC A;  2E7X A;  3R6S A;  3MFK A;  2EV0 A;  3MCZ A;  1YIO A;  1O57 A;  2E1N A;  3GWZ A;  2HOE A;  3HSR A;  4LLN A;  4OMZ A;  1XCB A;  4LJZ F;  4UVC A;  1LNW A;  5FD5 A;  2CFX A;  4LLL A;  3KZY A;  3IRQ A;  1KGS A;  1S3J A;  4OIO F;  1D5V A;  4UV9 A;  4KIB A;  4R8H A;  4O6J A;  5ED4 A;  3ZN1 A;  1SMT A;  2J5P A;  5HDN A;  2DPU A;  1I27 A;  1TNT A;  4L5I A;  2LSO A;  2MLG A;  3RDI A;  2QBY B;  4MTD A;  1J59 A;  1ZRF A;  1J5Y A;  3R61 A;  3EYY A;  2W84 A;  1O7F A;  1HSJ A;  1FY7 A;  2W24 A;  2ZJ2 A;  2EJR A;  2G7U A;  5K5Q A;  1KQ8 A;  5L3F A;  2P5V A;  5D5X B;  1BI3 A;  2GXB A;  1ZG3 A;  2VC1 A;  3GFJ A;  5CVI A;  2PG4 A;  3GFM A;  4R79 A;  1MJB A;  3HRM A;  1FBU A;  2HQN A;  3L09 A;  4HX4 A;  3ISP A;  1LJ9 A;  4ASN A;  3CO6 C;  1YW7 A;  2FBI A;  3HSE A;  2HYF A;  1TW2 A;  1OMI A;  2FE3 A;  1O3S A;  1EH6 A;  3ZN0 A;  1HST A;  3R60 A;  3Q9V A;  4CO8 A;  3E6D A;  3F8C A;  4LLG F;  3RYP A;  3C7J A;  3O6B B;  1UST A;  3ZMD A;  5JFR A;  5ICF A;  2EV5 A;  4CZZ A;  2X0L A;  2Q0O A;  3EDP A;  5BS6 A;  4ESJ A;  3NEU A;  1IUY A;  5E8G A;  4EQQ A;  4LG0 B;  4UHT A;  2RKH A;  4MQV A;  3WTV C;  1RUO A;  4K2E A;  3F6O A;  3BWG A;  2P5K A;  4KUM A;  1IN4 A;  4A0Z A;  1XB4 A;  4KIG A;  4L9J A;  3R0J A;  4L5J A;  1J9I A;  3P9I A;  4RGR A;  5CYV A;  2YX4 A;  3C3W A;  1YQA A;  4ZYE A;  1H9G A;  3T5X A;  5DUK A;  2IP2 A;  2O61 A;  2FEZ A;  4ZZD A;  3V8J A;  2Z9O A;  3I54 A;  4GCV A;  1JHH A;  1FPQ A;  3ZPL A;  4XLN F;  3WE3 A;  1P6R A;  1ZAR A;  2HFH A;  4A12 A;  4LG0 A;  2XAH A;  1F5T A;  2GA1 A;  2VON A;  4PZJ A;  5BMZ A;  1OKR A;  3QPH A;  4HYE A;  4UV8 A;  5DDG A;  3WTZ A;  1W7P D;  3F3X A;  5EEG A;  2QBY A;  2L54 A;  3BDD A;  4G6Q A;  3FMS A;  4Q4Z F;  2NAZ A;  4R1H A;  4IF4 A;  2F5C A;  4P55 A;  4HW0 A;  5A2Q K;  4HF2 A;  3TO6 A;  2DI3 A;  1T98 A;  2OAZ A;  1IN8 A;  1J75 A;  3JW4 A;  1IN6 A;  4WXC A;  2HDC A;  2DAO A;  1MKM A;  1R58 A;  1E2X A;  1OYY A;  4ON0 A;  1Z91 A;  5J8C A;  3BJO A;  3SZP A;  3NQO A;  5DD8 A;  5IT9 K;  2VOD A;  2QM3 A;  4CDG A;  1BI2 A;  3K1M A;  1R5G A;  4FX4 A;  3S2W A;  3I53 A;  1R1U A;  2ISZ A;  3LA3 A;  2EFQ A;  4LFU A;  2DK5 A;  4MQ9 F;  1EV7 A;  4KIF A;  5HLI A;  2O6G E;  4O3M A;  4DNC A;  4EGZ A;  4OIR F;  4EVI A;  3I71 A;  2K7L A;  1RI7 A;  4EMS A;  5L3G A;  2BE5 F;  2OZU A;  3FXQ A;  3QU6 A;  2QUF A;  4G8X A;  3KP2 A;  2G7H A;  4AIJ A;  3FMQ A;  3F21 A;  2EFP A;  1T39 A;  1AWC A;  2OU2 A;  2K4J A;  4RGS A;  4GYG A;  1BI0 A;  1BIB A;  5D4S A;  2B0L A;  2M5W A;  3E6M A;  3F8B A;  5D6F A;  1U78 A;  2MH2 A;  2K27 A;  4LB6 B;  1S8N A;  2CYY A;  1R36 A;  1SD5 A;  1R00 A;  3EET A;  2DBB A;  1XSV A;  1ON2 A;  3ZMZ A;  2FOK A;  1T0F A;  2FBH A;  4EV0 A;  5LHI A;  5L3C A;  1QNT A;  3N4M A;  5DYM A;  3U1D A;  5FLX K;  1FT9 A;  2PJP A;  2QQ9 A;  4KMF A;  1K78 A;  4MNU A;  1Y0U A;  3DPL C;  2HTS A;  1B9N A;  4HX7 A;  4KYW A;  4XSX F;  1DPU A;  3T8T A;  3KP4 A;  4UVB A;  3K2Z A;  2WC2 A;  1BJA A;  2W85 A;  2PLY A;  2YU3 A;  1I5Z A;  4RB3 C;  3JAM Z;  3ELK A;  3WTS C;  4YFX F;  4EM2 A;  2ZKZ A;  2LNB A;  3C18 A;  2A69 F;  2CG4 A;  2BV6 A;  5D6E A;  4EM1 A;  3BRO A;  3WU0 A;  2DW4 A;  1FC3 A;  3GZ5 A;  2QVO A;  4EGY A;  2PQ8 A;  1X3U A;  3ECH A;  5DD4 A;  5HS9 A;  2Q8K A;  5BOX A;  1ZYR F;  4N9I A;  2BEO A;  2FBK A;  5LRR A;  4AVP A;  1IN5 A;  4QWQ A;  2RGV A;  5BQT A;  2VBW A;  5FO5 A;  5LGN A;  1BI1 A;  2UWM A;  1STZ A;  3HRU A;  4HAM A;  3J80 Z;  1K78 B;  4N0B A;  1ZGA A;  3MQ0 A;  1TLH B;  4H0E A;  2D45 A;  2HKO A;  2P5L C;  2IA0 A;  5D5W B;  3I58 A;  2VBX A;  1TBX A;  4B8X A;  5IT3 A;  2RDP A;  1G3Y A;  1FSH A;  2EFN A;  3KEO A;  5K1Y A;  4ZYD A;  1ZLJ A;  3I0T A;  5LBQ A;  1I1G A;  1HQC A;  2IJL A;  2R7D A;  1MDM A;  3GEZ A;  3WU1 B;  2YX7 A;  3IKT A;  2RV8 A;  3KEQ A;  5D5V B;  1T38 A;  2ZNZ A;  3D5L A;  4EJU A;  3GUD A;  5LLQ A;  2XKO A;  1USS A;  1XMK A;  3ULQ B;  5AIQ A;  1KU7 A;  4BHB A;  4I01 A;  2VOP A;  3HHH A;  3J7A O;  4LB5 A;  2XAQ A;  1Z7U A;  2WWY A;  2MH9 A;  3MEX A;  4KNY A;  3J80 K;  1MJ9 A;  2EA4 A;  2MC3 A;  2L4M A;  5CVV A;  5E17 F;  3QP5 A;  1UB9 A;  2DQL A;  4G7O F;  1KQ9 A;  5FB2 A;  3IL2 A;  2FF4 A;  3GXO A;  1YO5 C;  5D4R A;  4BH9 A;  4U7B A;  4NQW A;  3ZMS A;  4DQ2 A;  2R7F A;  1CGP A;  4WF2 A;  2XKP A;  4IVN A;  4FX0 A;  3L00 A;  1MJA A;  2ISY A;  4G94 A;  2HR3 A;  4AD9 A;  4P96 A;  5DCM B;  3ML6 A;  5LEJ A;  2XVC A;  3HTS B;  4OMY A;  3RTR A;  2PFB A;  6PAX A;  1LDK B;  4YII A;  3WGH A;  4XLP F;  4HLY A;  1IW7 F;  3TKY A;  3KLO A;  3LWF A;  4BXU A;  3M1E A;  2XAS A;  4UUV A;  4KFC A;  2VE8 A;  2M30 A;  4KA4 A;  3BZ6 A;  4A0Y A;  1K79 A;  1ULY A;  4KDP A;  2STW A;  4AIH A;  2RVC A;  2IPQ X;  5J8F A;  1I6X A;  2ZO4 A;  3WOD F;  2GAU A;  3FWE A;  1K7A A;  4YFN F;  4L0Y B;  3TOA A;  4UXN A;  1KQ0 A;  4RAY A;  3CUQ C;  3GX4 X;  1U5T C;  4PGH A;  2VN2 A;  2CSO A;  2O8X A;  3T1B A;  1SMY F;  2JT1 A;  4MHG A;  5LRS A;  2D1H A;  1XDU A;  1LEB A;  4WCG A;  2M87 A;  5HVQ C;  1ZH5 A;  3PQJ A;  2CW0 F;  3TO9 A;  3WG9 A;  4YIF A;  4M6X A;  3WGI A;  1NHA A;  2VBY A;  4MEX F;  3VB2 A;  3ZQ7 A;  3SFZ A;  3P9C A;  3WTT C;  4GGG A;  2O0Y A;  1K6O A;  4OOI A;  1QGP A;  3RI4 A;  1R1V A;  3L2C A;  4N9H A;  2H09 A;  3TDU C;  3N97 A;  3GO5 A;  3FM3 A;  4O5V A;  2KIF A;  3RPQ A;  1A04 A;  2L3D A;  2UXX A;  3JTG A;  3HUG A;  1KA8 A;  1GHC A;  1ZRE A;  1T6S A;  1DUX C;  4ESF A;  2PMH A;  1IN7 A;  1XD7 A;  3DP7 A;  3ABU A;  1ZN2 A;  2NYX A;  1BC7 C;  5LEK A;  4G6D A;  2ZFW A;  1H9T A;  3U2R A;  3M8E A;  3RJP A;  2BGC A;  1GXQ A;  3VEP A;  4ENN A;  3LA7 A;  1IXS B;  5KK1 A;  3G3Z A;  2FU4 A;  4P9F A;  4BHC A;  2QWW A;  2Y48 A;  4CIC A;  3H3U A;  4PCQ A;  1FYK A;  1FYM A;  3J81 Z;  2XHK A;  2K86 A;  1PUE E;  2L4A A;  3JSP A;  2DFI A;  1ON1 A;  1U5T B;  1V4R A;  2DPD A;  3SQN A;  2F5E A;  2O3F A;  1Z1D A;  1CF7 A;  1YW9 A;  3QPT A;  3RKY A;  3Q9S A;  3V7C A;  3VOE A;  4D0P A;  2K02 A;  4U7D A;  3AAF A;  3F8F A;  5CVR A;  3EUH A;  3IC7 A;  3M9A A;  2CGP A;  1TQM A;  2ESH A;  2Z3Y A;  4NB5 A;  2OZ6 A;  3K1P A;  2NNN A;  4BNC A;  1OR7 A;  4A6D A;  1TQI A;  3VOD A;  3BJA A;  4Q47 A;  3BY6 A;  1XGM A;  4F7Z A;  4M74 A;  1SFU A;  2YR2 A;  4ESB A;  3ABT A;  1FLI A;  1HKT A;  3E6B A;  1XCV A;  3CTA A;  3KLN A;  3K69 A;  1O3Q A;  4HF1 A;  1REP C;  4Y13 A;  3KE2 A;  3WTU C;  2V79 A;  5DUI A;  4RB1 A;  4QLC U;  5FD6 A;  1HW5 A;  2P6T A;  1WI9 A;  3E5U A;  3FF5 A;  3R0A A;  3LQQ A;  1CF7 B;  3M8F A;  1D3Y A;  1FP2 A;  3VFZ A;  4I7H A;  3ZMV A;  3JAM K;  1PP7 U;  1S29 A;  2WTE A;  4Y15 A;  3TO7 A;  2XRO A;  3ERE D;  3L7W A;  1LDD A;  3T8R A;  4OIP F;  5ILV A;  4BHP A;  2BYV E;  1IAW A;  1FZP B;  1DPR A;  3LFK A;  1G3W A;  5E18 F;  5H6Q A;  1IF1 A;  1JE8 A;  1IRG A;  4G9Y A;  3O2P E;  3LST A;  3TGN A;  2A6H F;  4WK8 F;  2FXA A;  1IXR C;  5LHG A;  5D8L B;  1B6A A;  4EJW A;  4WXD A;  2YPR A;  5IT9 Z;  5H6R A;  2EV6 A;  2VT3 A;  2NRA C;  1U3E M;  2VE9 A;  3LAJ A;  2GWR A;  2P4W A;  1UCR A;  4I02 A;  4HQE A;  1TQP A;  5A2Q Z;  4HX8 A;  2XAF A;  2HKX A;  1EH7 A;  3QRF F;  1D8J A;  1W5T A;  4KIC A;  1JHF A;  3GZ6 A;  1LVA A;  5D5U B;  1E17 A;  4B09 A;  4M71 A;  5LGU A;  4IHT A;  2GQQ A;  2ZXJ A;  1FNN A;  1YS6 A;  2COM A;  3FX3 A;  2EK5 A;  2UZK A;  4ENK A;  2KIM A;  3HHG A;  1HW1 A;  4IXA A;  1FYL A;  3QU3 A;  2XUB A;  2IT0 A;  3K0L A;  4OIQ F;  2LF8 A;  5HOO A;  1FOK A;  5ICE A;  1P2F A;  4KT5 C;  5DCF A;  3C1D A; 
#chains in the Genus database with same CATH topology
 2HVR A;  1ONV A;  1ENH A;  3E3V A;  2P8T A;  3BP8 A;  4NNJ A;  2E2I J;  3PFI A;  1UMQ A;  2MBF A;  4RM2 A;  5FFX A;  2VPR A;  3WE2 A;  2VQC A;  3GTG J;  1FMV A;  2KRH A;  1WJA A;  3IUO A;  2IGN A;  2ID6 A;  1RZ4 A;  2EWN A;  2PMZ N;  2HVQ A;  1SC7 A;  2OUM A;  4JOM A;  2HXI A;  3OYM A;  2J5O A;  4IRG A;  1FWZ A;  3VYR B;  1XGS A;  1YRN B;  1Z21 A;  2A07 F;  1Y39 A;  1H8A C;  4GFB A;  4HQM A;  4IRI A;  2W57 A;  2W25 A;  3ZQH A;  4LGW A;  3VSL A;  2DTR A;  4CYD A;  3GYH X;  1B59 A;  1P4X A;  3HC7 A;  2XGC A;  3QOP A;  5KVR A;  1XGO A;  1F43 A;  2Z16 A;  2NVY J;  2VJJ A;  5DS9 A;  2XSD C;  2CUE A;  1NG7 A;  4RGU A;  3DCF A;  1KU2 A;  4YEL A;  1QO0 D;  2I5U A;  2LBF B;  2LF7 A;  4E70 A;  2FQ3 A;  4XRS G;  3A4C A;  4B44 A;  1QPI A;  4I0B A;  3FM5 A;  3NAR A;  3GFL A;  5FKM A;  4PGG A;  5GP9 A;  5IOY A;  2TDX A;  1R9T J;  2IBD A;  2KFD A;  4Z2Y A;  2QYO A;  5JHU A;  4D1Q A;  3CCS I;  3FHN A;  1VQ9 I;  2EBI A;  3HOT A;  2ZME A;  2F2E A;  5CLS A;  3BZC A;  2ECC A;  3VYU B;  3W6V A;  2A3S A;  3W2W A;  4HNT A;  1TWH J;  4LMY A;  1MBJ A;  2XAJ A;  3H0G J;  4RLQ A;  5H20 A;  3CME I;  1A5J A;  2FNP A;  1ODD A;  4YG2 F;  5JR3 A;  2KKO A;  4XN0 A;  2CQN A;  4PFO A;  4BEH A;  3O3K A;  1R22 A;  5IP6 A;  3IHU A;  3C2B A;  4LG3 A;  3TW6 A;  1XSX A;  2BZT A;  4LK1 F;  1JKP C;  1F9N A;  2XF5 A;  3BG9 A;  1GV5 A;  3WTY C;  2K9Q A;  5GAH J;  3BOQ A;  5ERI A;  2NVQ J;  2P81 A;  4FET A;  2VUM J;  1L3L A;  2E2H J;  1O3T A;  2P7V B;  3CZ6 A;  5DEQ A;  2DA6 A;  5E1W A;  1IZ1 A;  2W48 A;  4XK4 A;  4XLC A;  2IS6 A;  2GIV A;  2ZSH B;  2PI0 A;  1S7A A;  3FXM A;  3LA2 A;  1X4P A;  3MD2 A;  4BDY A;  2E5N A;  2V1X A;  1BOA A;  3GF2 A;  1HKS A;  1D0Y A;  1FBS A;  2JVH A;  3DTI A;  4ZTF A;  4XBF A;  1J2X A;  3FBN B;  2PJR A;  4QTR A;  3QP6 A;  1Y6I A;  1W4M A;  3FHZ A;  4IHS A;  2GM4 A;  2OPT A;  4FTH A;  3IRR A;  4P9U A;  1BM9 A;  2H6B A;  3CC4 I;  4F52 A;  2R5Z B;  2Z99 A;  4ETS A;  5DM7 F;  1RKT A;  2XGX A;  3W6J B;  4Y4R A;  4I09 A;  4F91 B;  5E1Z B;  1FSE A;  2QZ8 A;  1UFM A;  2FRH A;  2R7T A;  1LB2 A;  1MZB A;  2FD5 A;  4D7M A;  2OA4 A;  2F4M B;  4CGZ A;  4M3D A;  5EEH A;  4ZZL A;  4S05 A;  1T0F C;  3F0C A;  1JGS A;  2HYG D;  3JR9 A;  3BPX A;  1E3H A;  1W5C C;  4A6E A;  5J1U A;  3TOB A;  1WJC A;  4PJM A;  3QAH A;  1VND A;  1PP8 F;  3DEE A;  4M9Z A;  1F1Z A;  2NNY A;  2PBI A;  4UY8 I;  4EM0 B;  4MEY F;  1ETO A;  2BBY A;  4L0Z B;  3D0S A;  5ICG A;  1JKO C;  4P5O A;  2V9V A;  2WV0 A;  5LHH A;  4FCY A;  3ZMT A;  2R7W A;  4F3Q A;  4CXF A;  2Z33 A;  1N25 A;  4I0A A;  2N8G A;  2HDD A;  2BXZ A;  3RYR A;  2A68 F;  2QSG X;  4A3G J;  2GXG A;  4GXO A;  4ENJ A;  4RAZ A;  2D1V A;  4ZC3 A;  3I56 I;  4PJL A;  3DF8 A;  3DKX A;  1TTY A;  2KZV A;  3KCC A;  1YYV A;  3PJR A;  2AXT C;  1ACI A;  2PX9 A;  3CMY A;  4HDV A;  1L0O C;  5HDK A;  1FTZ A;  1RR8 C;  3DKW A;  4M72 A;  5CJ9 A;  5K5O A;  2CWE A;  2H6C A;  4XKB A;  3U1K A;  5E20 A;  4L5E A;  2RQQ A;  4IQ4 A;  1PDN C;  2RQP A;  4C9Y A;  4M73 A;  4MLO A;  2JA7 J;  2JA8 J;  3DV8 A;  3I64 A;  1I6H J;  4A2U A;  4ZJZ A;  1JI8 A;  3DEU A;  3KZI C;  5F6F A;  3CDH A;  5L3E A;  5C4J J;  1A6I A;  1GV2 A;  1UHW A;  2HZT A;  4HNU A;  5GTI C;  3PNY A;  5AIP A;  4AYB A;  3LAP A;  3BG3 A;  4U0V A;  5B5E C;  5FKL A;  2LKS A;  4CA0 A;  4GDF A;  1YX5 A;  4ENM A;  4OAY A;  1HW2 A;  1BR1 A;  2L7M P;  2VT2 A;  3MWM A;  5E1X A;  3T0Y A;  5K7F A;  1BA5 A;  2WAQ N;  3COA C;  4HLX A;  4C2T A;  1SFX A;  1P4W A;  3CUQ B;  2AQE A;  2R3S A;  3Q5F A;  2ZXW H;  5ICC A;  2GBY A;  1IGN A;  1WJE A;  3LNQ A;  3BR5 A;  1I1S A;  2CU7 A;  4BYY A;  2LKP A;  4L9V A;  3H3Z A;  1IJW C;  2TCT A;  2XF6 A;  4LK0 F;  1U6G A;  2DU9 A;  2JPC A;  1K4T A;  1FJL A;  3KP3 A;  3H0D A;  1TWC J;  2QSH X;  1IRZ A;  4Q5S F;  2E1O A;  2WAE A;  5JVG F;  1YFH A;  1H89 C;  2FUG 2;  1X58 A;  3FDY A;  4D9J A;  1VQ4 I;  1X2M A;  2A5Y B;  2V1U A;  2E7W A;  3CJQ B;  1BBY A;  1ZAO A;  2K9S A;  3DLA A;  1QBJ A;  3HG9 A;  4CZC A;  4A3F J;  2XRN A;  4OIN F;  2CO5 A;  1KYZ A;  1QPM A;  3LQR A;  5GTH C;  4A5N A;  3A02 A;  4HZF A;  3SJM A;  2FMY A;  4IRH A;  2OQG A;  5DCM A;  3ABM H;  4XKW A;  1YS7 A;  2LY9 A;  2XB5 A;  2Z5U A;  4M3E A;  5JVT A;  3EQL F;  5J4V A;  1H88 C;  5B1A H;  4IO9 F;  1DP3 A;  2HOS A;  2ELJ A;  1N78 A;  3F22 A;  3F9K A;  4X1E A;  3B73 A;  3UR3 C;  3CO7 C;  2ZME B;  2MLK A;  4E7H A;  3SHF A;  5BPI A;  2V1N A;  3GBG A;  3OOP A;  2VBZ A;  5FGM A;  3HSF A;  3CCR I;  1LDJ A;  2V9K A;  3F23 A;  3ZP5 A;  2DT5 A;  2YUS A;  2DQR A;  4Q48 A;  4BAY A;  4NC8 A;  2Y9Z A;  1T95 A;  1V5F A;  4L18 B;  2M9H A;  2WA0 A;  1MMG A;  1ZGJ A;  2YS9 A;  5L3D A;  4BXF A;  1AKH B;  1RC9 A;  3MAJ A;  3SXY A;  2WY8 Q;  3GTO J;  3V7R A;  2NOG A;  1DP7 P;  1JXS A;  3IWF A;  4H4K C;  1I3A A;  2HWV A;  5HDG A;  4XON A;  2ZNY A;  2H94 A;  1KU3 A;  3PIP F;  4HG2 A;  3ROU A;  3IKV A;  1RNL A;  2EZH A;  2X85 A;  2KP6 A;  3CJN A;  2DK8 A;  4JQF A;  3V8L A;  1M1E B;  5D8K B;  4DIQ A;  2M34 A;  2V6C A;  4XLF A;  1YE9 A;  2FX0 A;  3AG4 H;  3CF2 A;  1YTY A;  4PK4 A;  3P9K A;  2EA2 A;  1O7L A;  2AXL A;  2D5V A;  3JRH A;  5K7Z A;  1AU7 A;  3A01 A;  2EB7 A;  3DTE A;  1FBQ A;  2OBP A;  5E3L A;  1SD7 A;  2V26 A;  1W5S A;  3KET A;  3L2V A;  4L9N A;  1WGX A;  2AS5 F;  3OIO A;  2FML A;  1VTN C;  3TDZ C;  1XDS A;  2GOX B;  3CC2 I;  4FHT A;  5DV5 A;  2BY1 A;  3BTC A;  3CDI A;  4LIU A;  4JX5 A;  2FSW A;  4RB2 C;  1E3P A;  1SVM A;  1WH5 A;  2K9N A;  1ZHF A;  4ZYG A;  2JPB A;  4HF0 A;  1OYW A;  5TGT A;  2COB A;  1U2W A;  1TC3 C;  3G73 A;  1R7J A;  4RM3 A;  1AKH A;  4CHU A;  3HOU J;  1T56 A;  1Z05 A;  4JBA A;  3NRV A;  5B1B H;  3OYD A;  3K70 D;  2HQA A;  3JRB A;  2KIU A;  1G3S A;  1AOY A;  3DPT A;  4IPA A;  1Z3Y A;  4I2O A;  4EJV A;  2MFZ A;  1QZY A;  3JCU C;  1R5H A;  2NXN B;  3D5S C;  4B3X A;  2JTV A;  4U88 A;  3I59 B;  4WX9 A;  3Q0U A;  2IA2 A;  2V1D A;  3WHB A;  1VZ0 A;  2FJ1 A;  1GVJ A;  1RRJ A;  2FA5 A;  3SZT A;  3HOS A;  1G4D A;  3CF5 F;  1IRX A;  3ASN H;  1WJD A;  5CPR B;  3S8P A;  3F8M A;  4A3M J;  5BPD A;  1BJZ A;  1TWF J;  2DLL A;  2F5D A;  2G9W A;  4MIM A;  2LRD A;  4DW6 A;  1BIA A;  2ZJP F;  4JK1 X;  1R1T A;  1KYW A;  3O8G A;  1K6Y A;  1S7O A;  4RB0 A;  4ZYH A;  2EFW A;  4G7Z F;  3S1Q J;  4ZH4 F;  3DFG A;  1QZE A;  3RIR A;  1QZZ A;  1HDP A;  3HPH A;  2F4O B;  1C0W A;  3OR2 C;  3VDX A;  1R23 A;  2D2W A;  1VI0 A;  2DMU A;  2X4H A;  3H1C A;  5AON A;  4DJA A;  3KIO A;  1XMX A;  1G3T A;  3DU6 A;  3ONQ A;  1V3F A;  3DXJ F;  2CQK A;  4MTE A;  3M7G A;  4KN4 X;  1MH3 A;  3BZK A;  1W7P B;  3E6C C;  4XRF A;  2QQB A;  4U0Y A;  1SAX A;  2Y69 H;  3B02 A;  3BLY A;  3OIQ A;  1SVL A;  4HNV A;  2JN6 A;  4GYI A;  1Y0N A;  3HKZ A;  2UXN A;  3CUQ A;  3BJ6 A;  2QEN A;  1Y8Q B;  3I55 I;  2ME6 A;  1EH8 A;  1OFC X;  1QQI A;  4UVA A;  3PSF A;  1S7E A;  2BY2 A;  2M1B A;  3PIO F;  3B6C A;  5EF6 A;  2VI6 A;  2CV2 A;  1P92 A;  2VXZ A;  4U0W A;  2HDW A;  2QA4 I;  1WRJ A;  3ECO A;  1KZH A;  2IW5 A;  1O3R A;  3RKW A;  4AVZ A;  5M5W J;  3SEQ A;  4EJO A;  2DFF A;  3GVA A;  1G6N A;  4MO7 A;  3J7Z I;  2IRF G;  4I98 B;  4WXH A;  4OWR B;  1H0M A;  1Z9C A;  1WH7 A;  3U9G A;  3W6K B;  2Y75 A;  4IL6 C;  3S17 J;  2RNJ A;  3HOW J;  4NC6 A;  1B8I B;  4ZDO A;  5HLG A;  2FQ4 A;  2IS1 A;  2JQ7 A;  3M8J A;  2P7C B;  3MKL A;  4IKF A;  1RET A;  5TRD A;  2JRT A;  1IRF A;  3DEW A;  4HA8 A;  5H2F C;  3PQK A;  1IC8 A;  3FXJ A;  2VOO A;  3BPV A;  5J1Y A;  2MA3 A;  3IH3 A;  5FRN A;  4HOB A;  5HS7 A;  4UNO A;  2BHY A;  1KU9 A;  1XMA A;  2FOW A;  2O03 A;  2E1C A;  2L9V A;  3FK7 A;  1B9M A;  4E7K A;  1P7I A;  2HS5 A;  1YG2 A;  2K4B A;  5FJ8 J;  3GW2 A;  3E5X A;  1Q1H A;  3SEZ A;  2HTJ A;  2MC4 A;  2OD5 A;  3JTH A;  1VQ8 I;  4A3I J;  2QQA A;  2LYC A;  4DYC A;  5K5R A;  2HYJ A;  2DA3 A;  2E34 A;  3HJE A;  5KAI C;  5FRO A;  2DFE A;  1Z6T A;  1B4A A;  2Z1D A;  3QYF A;  1W7P A;  1ZR4 A;  2LC2 A;  3RPU A;  4RDU A;  3ZCO A;  2OTL I;  3EPZ A;  2AO9 A;  1HC8 A;  3Q3S A;  5HLH A;  1B1B A;  2MYS A;  5J6X A;  1MMD A;  3H5N A;  2DA1 A;  1PYV A;  3LSH A;  3CUO A;  3GLX A;  1FX7 A;  4A3J J;  1U8R A;  2OQR A;  2X1D A;  1LPQ A;  2EIJ H;  3WHC A;  4S04 A;  2F6C A;  1S6L A;  1LUJ B;  2HU9 A;  1JTX A;  4Y17 A;  3TQN A;  3HOY J;  1GXP A;  3LFU A;  1ETQ A;  3TP3 A;  3AKZ A;  5EJC A;  3V4G A;  1LEA A;  4ANJ A;  4BQA A;  3H5R A;  4EJT A;  5FLX Z;  4PDK A;  5F1R A;  2STT A;  1TT5 B;  3CMM A;  5FLM J;  3FMR A;  1MD0 A;  4NDL A;  5CVU A;  4ZYA A;  2H27 A;  2IXS A;  2ELH A;  2GA2 A;  1OPC A;  2DOD A;  3F72 A;  4FT8 A;  1WJF A;  4KIT B;  3F6V A;  4QIW N;  2ID3 A;  3K1N A;  1W0T A;  4YIR X;  4HDU A;  4GRI A;  1BC8 C;  1D0X A;  5E3O A;  3ESW B;  1YW8 A;  2EIL H;  3RPU D;  3BR6 A;  3CLO A;  1HLV A;  1XGN A;  2QKM B;  3E5Q A;  3DPU A;  3REO A;  2DFH A;  2GZW A;  3K4C A;  3OYE A;  4M6Y A;  1G2H A;  2Y0S A;  2IA1 A;  1HKQ A;  2VQL A;  1J7K A;  2NVX J;  2M45 A;  2DYR H;  3R4K A;  3KP5 A;  2OF7 A;  2RRE A;  3HXL A;  1JJ8 C;  2HGC A;  4XSZ F;  4N4O B;  4XOT A;  3WTW C;  1FP1 D;  3KFW X;  1MDM B;  2HEO A;  4CYC A;  4IJA A;  2KL4 A;  1WWX A;  4Y33 A;  5JI6 A;  1B72 A;  2Q2E A;  3KZZ A;  1HA8 A;  2ETH A;  2VKD A;  5CVJ A;  3FXU A;  3KP6 A;  4AIK A;  2XIG A;  3KYL A;  2R5Y B;  1LFU P;  2DO7 A;  1YLF A;  1UZC A;  4Y52 J;  4BAC A;  4CH7 A;  5ILU A;  1FOY A;  2F5F A;  2L01 A;  5EGO B;  3E97 A;  4KT6 A;  2WV1 A;  2ZFU A;  3I59 A;  3MMY B;  4PSW A;  4N4N B;  2DOF A;  1RUN A;  3DWL E;  1ETV A;  1POG A;  4A5M A;  1D8K A;  1P4A A;  4RAG A;  2KT0 A;  3HTU A;  3HRS A;  3QOD A;  3QPS A;  1F4K A;  4AID A;  3OYB A;  4DZP A;  2LVS A;  3E0J B;  2CMP A;  4KMU X;  3DBH B;  2RC4 A;  3HRT A;  2KJC A;  3I5U A;  5E8I A;  4WWC A;  2LOO A;  4PUS A;  5FLV A;  2Y0M A;  3LL7 A;  2L2O A;  2XV4 S;  3HYI A;  5LGT A;  4G7H F;  3CCU I;  2L9R A;  1R71 A;  2WY7 Q;  3V7S A;  2MSY A;  2CQQ A;  1Z6R A;  2CS3 A;  3FXR A;  2KZG A;  2KRF A;  1U5T A;  2E35 A;  3CDL A;  3OV8 A;  2JMW A;  2KJB A;  3K7A J;  1T8I A;  4MGR A;  5L3B A;  2QLZ A;  2PN6 A;  2M3A A;  5EEA A;  3ZMU A;  2JZY A;  4HV5 A;  2UV1 A;  3GFI A;  2JSC A;  3LSI A;  1HF0 A;  4NHJ A;  2PMU A;  1DU6 A;  5C4X J;  1J0R A;  4BY1 J;  4YFK F;  1TNS A;  3DQV C;  1SEU A;  3GME A;  2Y9Y A;  3EYI A;  5F08 A;  2IVM A;  1A6Q A;  1D1C A;  1FIP A;  1BN5 A;  1HXD A;  1LQ1 A;  1JGG A;  3FZV A;  4DYQ A;  2R5Y A;  5B3S H;  3JSO A;  4RGX A;  2PEX A;  4OU0 A;  4HBL A;  3MVP A;  2ESN A;  2DT6 A;  3AG1 H;  1MND A;  1OQY A;  2LFB A;  3K9T A;  1T2K A;  2YSR A;  5ILS A;  2TRT A;  3PM1 A;  3KYC B;  1XN7 A;  4AWX B;  2EFO A;  2XC7 A;  1BOB A;  1X1B A;  3E7L A;  2CV1 A;  2X1E A;  2A61 A;  2VJI A;  2DOE A;  4M9X A;  5CKT A;  5M5Y J;  3K10 A;  3S3O A;  3W2V A;  2ZBK A;  3HUG B;  2JJ7 A;  3MZY A;  3CCM I;  4RS8 A;  1FIA A;  1ZLK A;  3L9F A;  1NH3 A;  1ZRC A;  1VQ5 I;  2KQR A;  2VC0 A;  3HIF A;  2KDO A;  4DBR A;  2DJN A;  1QRY A;  1SD6 A;  3F8N A;  2RNG A;  5F64 A;  3WGG A;  2LDU A;  2HQR A;  3LSR A;  4DGW B;  3PO3 J;  1DDN A;  1WKM A;  1WQ2 A;  3P7N A;  5EZG A;  1TW3 A;  2E19 A;  3OYL A;  1XG1 A;  4CUG A;  4AM3 A;  5TJJ A;  2EIK H;  2L9S A;  2JVG A;  2XRL A;  5F27 A;  1JKQ C;  3V8K A;  1V54 H;  2WAD A;  1Y8R B;  1MGT A;  4M9S A;  4HV6 A;  4TV7 A;  2C6Y A;  4GO1 A;  3G1M A;  2ADU A;  3MZH A;  2FNA A;  5HS8 A;  1DGW Y;  3KP7 A;  2NS8 A;  5FFZ A;  1SFE A;  1F36 A;  3J81 K;  2DA2 A;  4XQF A;  2MD5 A;  3AFH A;  2JA2 A;  3K4J A;  4LD5 A;  5JLW A;  1XSD A;  1SD4 A;  3X2Q H;  4BE1 A;  3CC7 I;  4BY7 J;  1VQM I;  3FIS A;  2LG4 A;  4ZDP A;  2OTJ I;  2B63 J;  2K9M A;  3IWZ A;  2E2J J;  4NBQ A;  2R7Z J;  3RKX A;  2XAG A;  1S5L C;  2RN7 A;  1OJL A;  1ZG5 A;  4KN7 X;  3I4P A;  3OYJ A;  2E36 A;  3MN2 A;  5E3M A;  2P6S A;  3HEF A;  3G71 I;  1HBX G;  1WVR A;  2ACJ A;  2LRE A;  1RIO H;  3QOE A;  2L02 A;  4A0X A;  1OYI A;  3PNV A;  4BDZ A;  2M8E A;  2A6E F;  1K4S A;  1ZRD A;  1UHM A;  1ZG1 A;  1A35 A;  3WTX C;  2NS0 A;  3H92 A;  3SFI A;  1WSU A;  4A3C J;  2HPI A;  4M3B A;  2ZCW A;  4L9T A;  1UG0 A;  2GIZ A;  5IP9 J;  1U0J A;  1IXC A;  2E7X A;  3R6S A;  1SFK A;  2X6W A;  5J40 A;  1FOW A;  4E7Z A;  3MFK A;  3CCV I;  3S1N J;  1E0E A;  5EG0 B;  3MZ8 A;  5EDN A;  3GTK J;  2HZD A;  2EV0 A;  3MCZ A;  1YIO A;  1O57 A;  1MMN A;  2E1N A;  1P9Q C;  2HOE A;  3GWZ A;  1XTA A;  3HSR A;  3FXO A;  4E7L A;  4C2U A;  4LLN A;  2KDZ A;  4OMZ A;  1XCB A;  4LJZ F;  4UVC A;  1LNW A;  5FD5 A;  2CFX A;  2M7A A;  4LLL A;  2Q2E B;  2HQ5 A;  3KZY A;  3IRQ A;  3HOZ J;  1KGS A;  1GVD A;  5FRM A;  5IYB J;  2LTP A;  1S3J A;  4OIO F;  2H8R A;  2LH9 A;  1HOM A;  1D5V A;  4UV9 A;  4KIB A;  4U87 A;  5EGO A;  2EPF A;  4R8H A;  4V2G A;  1YIJ I;  3CCY A;  4O6J A;  5ED4 A;  3ZN1 A;  1SMT A;  2J5P A;  5HDN A;  3CQZ J;  1MW7 A;  2DPU A;  5HNH A;  1IV8 A;  1I27 A;  1TNT A;  4L5I A;  5KCM A;  3IAM 2;  3SZG A;  2LSO A;  2MLG A;  3RDI A;  2CW7 A;  2X9D A;  4MTD A;  2QBY B;  1J59 A;  2IGM A;  1ZRF A;  4IHW A;  1J5Y A;  1SFO J;  2DDB A;  2KMU A;  3KYD B;  3ZQF A;  3R61 A;  2ZXH A;  3EYY A;  4IOA F;  2BY3 A;  2W84 A;  1O7F A;  3LSP A;  1KON A;  1HSJ A;  2AHQ A;  4B1R A;  2M0M A;  1FY7 A;  4JX4 A;  2Y2Z A;  2W24 A;  5EG0 A;  4HST A;  2ZJ2 A;  4J19 A;  2Y31 A;  2E5Z A;  2X6O A;  4CCK A;  3H5A A;  2EJR A;  2G7U A;  5K5Q A;  4A93 J;  3H36 A;  1S9H A;  2DMP A;  2VB6 A;  2B9S A;  2QF7 A;  3HZJ A;  1KQ8 A;  5L3F A;  1MH4 A;  1OCR H;  2P5V A;  1EA3 A;  2QKL B;  1EF4 A;  2V4J C;  5D5X B;  1BI3 A;  2GXB A;  1ZG3 A;  2VC1 A;  2XPV A;  3GFJ A;  5CVI A;  2PG4 A;  3GFM A;  1LFB A;  3TL4 X;  2BXY A;  4R79 A;  1MJB A;  3HRM A;  5J1R A;  4NC7 A;  1FBU A;  2HQN A;  3L09 A;  3DLL F;  4HX4 A;  3BG7 A;  3ISP A;  4IQJ A;  3RCO A;  3W3C A;  1LJ9 A;  4ASN A;  3CO6 C;  1YW7 A;  4JX6 A;  2FBI A;  3SDB A;  3OYG A;  3SYT A;  4BQQ A;  3OS2 A;  4E6K G;  3HSE A;  3S1M J;  2K85 A;  2HYF A;  2O5R A;  1TW2 A;  4E7S A;  2Y0S N;  1OMI A;  2FE3 A;  1O3S A;  5KNL A;  1EH6 A;  1X2N A;  3ZN0 A;  1HST A;  3OS1 A;  1R49 A;  3R60 A;  3Q9V A;  4XIC A;  3BR1 A;  4CO8 A;  1LE8 B;  3ZGK A;  3E6D A;  3F8C A;  4LLG F;  2R4G A;  4PJJ A;  3RYP A;  3C7J A;  3O6B B;  3G4S I;  4QSH A;  1MBG A;  1UST A;  2CW8 A;  3JRA A;  3ZMD A;  5JFR A;  1MNE A;  1WPK A;  5ICF A;  2EV5 A;  1NTC A;  4CZZ A;  2XSJ C;  2V6E A;  1SAN A;  2X0L A;  2Q0O A;  2ZJR F;  1IUF A;  5J3L A;  5F0H A;  3EDP A;  5BS6 A;  4ESJ A;  5F0C A;  2JA5 J;  3VSK A;  1ORK A;  1VQN I;  3NEU A;  1PJR A;  2GOM A;  3HB9 A;  3OYH A;  3PL8 A;  1XX5 A;  2BVM A;  1AHD P;  3A2K A;  3L1P A;  1IUY A;  5K7H A;  3OY9 A;  1DGR M;  5E8G A;  4EQQ A;  4LG0 B;  1RKW A;  4UHT A;  4HEA 2;  2A6T A;  1TWG J;  2RKH A;  3ABK H;  4MQV A;  3WTV C;  2BW3 A;  3MKY B;  1RUO A;  1X19 A;  2BVL A;  4K2E A;  3F6O A;  5GAE J;  4IHV A;  3BWG A;  3GLL A;  3QYB A;  4II3 A;  3J7Y J;  2P5K A;  1ERD A;  3BTI A;  1W36 D;  4KUM A;  1IN4 A;  3PNT A;  1ZR2 A;  4A0Z A;  3WG7 H;  1XB4 A;  3K6G A;  4XRM A;  2MGQ A;  2WBM A;  3A0B C;  3C2G A;  3M3Y J;  3HOX J;  5C44 J;  4KIG A;  2DOA A;  4YEJ A;  1S72 I;  4L9J A;  2LMD A;  3TMO A;  4IHX A;  3R0J A;  4F93 B;  4L5J A;  4UB8 C;  1J9I A;  3E1S A;  3P9I A;  1MMS A;  5F0F A;  4RMN A;  4RGR A;  4KJZ A;  2OC6 A;  5CYV A;  3KX2 A;  2NVT J;  2JWT A;  2YX4 A;  2R7O A;  3C3W A;  1YQA A;  3LSG A;  4ZYE A;  1H9G A;  3T5X A;  1N75 A;  5DUK A;  1X3Z B;  3CES A;  3FK6 A;  2IP2 A;  2O61 A;  1T08 B;  3IV5 A;  2FEZ A;  1PUF A;  2CUZ A;  2PMZ A;  4ZZD A;  4E7I A;  4UB6 C;  3V8J A;  3S16 J;  4RA2 A;  3RSN A;  2Z9O A;  5CQE A;  2WAF A;  2ECB A;  3I54 A;  1VQ6 I;  4GCV A;  1FEX A;  1JHH A;  1EKE A;  3TW7 A;  1FPQ A;  3ZPL A;  4XLN F;  2DXI A;  4XLH A;  3OR1 C;  3WE3 A;  1P6R A;  1UG2 A;  1ZAR A;  2HFH A;  3RQI A;  3ZQI A;  2QEX I;  4A12 A;  1VQ7 I;  3DBL B;  4LG0 A;  3H9J A;  3BTJ A;  2VLA A;  2LK2 A;  4RBO A;  4LIV A;  2BW3 B;  2XAH A;  1F5T A;  2LD5 A;  2GA1 A;  2VON A;  4PZJ A;  3I9V 2;  2R92 J;  4F55 A;  4QPQ A;  2BY0 A;  5BMZ A;  4X0G A;  1OKR A;  3QPH A;  1VQK I;  3HKZ N;  4HYE A;  4UV8 A;  2E1M C;  3A0H C;  2A5W A;  2W7N A;  5DDG A;  1VQO I;  3WTZ A;  4CCJ A;  3L2Q A;  3CMA I;  3QYE A;  1QA6 A;  1W7P D;  2HI3 A;  2DTZ A;  1AA7 A;  3LSK A;  3S1R J;  4BQN A;  3F3X A;  5EEG A;  2QBY A;  2L54 A;  3BDD A;  4EAT A;  1WZ2 A;  4G6Q A;  3FMS A;  1JTY A;  4Q4Z F;  5BNG A;  1MIJ A;  2KIS A;  3C2H A;  2NAZ A;  4R1H A;  4IF4 A;  2F5C A;  4P55 A;  4BE0 A;  1TT0 A;  1OCO H;  1WCM J;  4FIS A;  4HW0 A;  5A2Q K;  4HF2 A;  3TO6 A;  3JRD A;  2DI3 A;  1T98 A;  3BT9 A;  4C2M J;  2OAZ A;  1IN8 A;  3OL4 A;  1J75 A;  3JW4 A;  2R7X A;  1IN6 A;  1X3W B;  4WXC A;  2HDC A;  4P1W A;  2DAO A;  2ICW G;  1MKM A;  3KEY A;  1R58 A;  1E2X A;  5E79 C;  1ZEL A;  1OYY A;  4ON0 A;  1Z91 A;  3BR2 A;  5J8C A;  3BJO A;  2E1M B;  3K2A A;  5KHD A;  4D5F A;  3DTK A;  3K4M A;  3SZP A;  3NQO A;  2DA7 A;  2LY1 A;  4BEH B;  5DD8 A;  2EZK A;  2O9L A;  2DT7 B;  5IT9 K;  2VOD A;  2QM3 A;  4CDG A;  1BI2 A;  3K1M A;  1R5G A;  4FX4 A;  3S2W A;  3I53 A;  1R1U A;  2ISZ A;  4F92 B;  3CCL I;  2DJI A;  4BJT A;  2X48 A;  3LA3 A;  1WHU A;  2EFQ A;  5CQG A;  4LFU A;  4DBQ A;  2DK5 A;  4MQ9 F;  1EV7 A;  3K4N A;  4KIF A;  3N05 A;  5HLI A;  2O6G E;  4C3J J;  4O3M A;  4DNC A;  2IGO A;  4EGZ A;  4FE7 A;  4OIR F;  4EVI A;  1FOX A;  3I71 A;  2K7L A;  4BJ6 C;  5F1J A;  3ZQG A;  1RI7 A;  4EMS A;  5GAD J;  4BXX J;  5L3G A;  2MW8 A;  2PJR B;  4C3I J;  2BE5 F;  2OZU A;  1OIS A;  5IYD J;  3H35 A;  3FXQ A;  3QU6 A;  1BR4 A;  2QUF A;  4G8X A;  2VQG A;  3EUK L;  3KP2 A;  3PUF A;  4B3A A;  2G7H A;  2R5Z A;  3A03 A;  4AIJ A;  1OCP A;  3FMQ A;  3QWL A;  3F21 A;  2EFP A;  1QVU A;  5C3E J;  3HBL A;  5FKN A;  3H3V K;  3OL3 A;  4YRV A;  2XDV A;  1T39 A;  3OYC A;  5IPA A;  1AWC A;  5DM6 F;  2P0W A;  1Z3X A;  3IAS 2;  2R7R A;  1OCC H;  2M4G A;  3AL0 B;  2OU2 A;  1TZL A;  3J7A Y;  2CQX A;  4XR6 A;  2K4J A;  4RGS A;  3FXL A;  4GYG A;  3K4L A;  2CUF A;  4FQG A;  1BI0 A;  1BIB A;  2CFO A;  2H1K A;  4A3L J;  5D4S A;  3PO2 J;  2B0L A;  2M5W A;  2L7F P;  2R7V A;  4UUS A;  3E6M A;  3I4N J;  3F8B A;  5D6F A;  1U78 A;  2MH2 A;  2K27 A;  1RES A;  4LB6 B;  4A3B J;  1S8N A;  2CYY A;  1R36 A;  1SD5 A;  1A31 A;  1R00 A;  3EET A;  2L0K A;  3G1L A;  2DBB A;  1XSV A;  1ON2 A;  3ZMZ A;  2FOK A;  3QPL A;  1T0F A;  4XKC A;  2FBH A;  4EV0 A;  5LHI A;  3HDD A;  5L3C A;  1QNT A;  4A3E J;  3GCM A;  2JSP A;  5HNF A;  4PJ0 C;  3SDG A;  4IZZ A;  3B6A A;  4DOZ A;  1OLT A;  2Y30 A;  5DYM A;  4PFP A;  3U1D A;  3N4M A;  5FLX K;  3CJR B;  3S3M A;  1FT9 A;  1SVO A;  4IOC F;  2PJP A;  3M4O J;  2QQ9 A;  5TIS C;  4KMF A;  1K78 A;  4MNU A;  1Y0U A;  3DPL C;  2HTS A;  3AG3 H;  1B9N A;  4HX7 A;  4KYW A;  4XSX F;  5IY5 H;  2UUZ A;  1DPU A;  3T8T A;  3KP4 A;  4UVB A;  4JYK A;  3K2Z A;  2WC2 A;  1W0U A;  3A01 B;  1BJA A;  4J00 A;  3MKW B;  2W85 A;  2PLY A;  2YU3 A;  1I5Z A;  3I3L A;  4RB3 C;  2W1O A;  2X6Y A;  1JT0 A;  3JAM Z;  3GTJ J;  1HDD C;  3ELK A;  2G0E A;  3IH2 A;  5FKO A;  5JLX A;  4I6Z A;  3WTS C;  3L2W A;  4YFX F;  2LP0 A;  4EM2 A;  4M3G A;  3RZO J;  2IAI A;  2K5C A;  2ZKZ A;  2LNB A;  1Y1W J;  3C18 A;  2A69 F;  2CG4 A;  2BV6 A;  5D6E A;  4EM1 A;  5GPC A;  3BRO A;  3WU0 A;  2DW4 A;  3JRF A;  1R4N B;  1FC3 A;  3GZ5 A;  2QVO A;  4EGY A;  2PQ8 A;  1BL0 A;  4ITV A;  1X3U A;  3M1C A;  2E71 A;  2K3F A;  3OYN A;  3HGG A;  3ECH A;  5DD4 A;  5HS9 A;  2Q8K A;  5BOX A;  1ZYR F;  4N9I A;  1P7J A;  2BEO A;  2FBK A;  5LRR A;  4AVP A;  1IN5 A;  4QWQ A;  2ZME C;  2RGV A;  2WAQ A;  2X6X A;  5BQT A;  4XKV A;  3S93 A;  2RAE A;  2VBW A;  1X1C A;  5FO5 A;  3UNG C;  1TP4 A;  5LGN A;  4ZDL A;  1BI1 A;  2UWM A;  2CRG A;  1STZ A;  4CSW A;  3HRU A;  4AUX A;  4AYB N;  4HAM A;  3J80 Z;  1K78 B;  3JRI A;  4N0B A;  2IEK A;  3PUB A;  2R7Q A;  3PSI A;  1ZGA A;  3MQ0 A;  4XMY A;  1TLH B;  4CCL A;  4H0E A;  4A3D J;  3K70 C;  2D45 A;  2HKO A;  2P5L C;  1BW5 A;  2IA0 A;  3BR3 A;  1NG6 A;  3LMM A;  5D5W B;  5J47 A;  2XF7 A;  3I58 A;  1CQT A;  3H9G A;  2VBX A;  4B43 A;  1TBX A;  4B8X A;  5IT3 A;  1W1W E;  2RDP A;  1G3Y A;  3RQ4 A;  1FSH A;  2EFN A;  2IS2 A;  3KEO A;  2HOA A;  5K1Y A;  3RZD J;  1UJ8 A;  4ZYD A;  1ZLJ A;  1GDT A;  3I0T A;  5LBQ A;  1K83 J;  2L9N A;  4NUB A;  5KAF C;  1I1G A;  1HQC A;  2QSF X;  1YOV B;  2IJL A;  4HSR A;  2R7D A;  1MDM A;  1W36 C;  4BBS J;  2JK3 A;  3GEZ A;  3WU1 B;  3S15 J;  2YX7 A;  1YI2 I;  1K61 A;  4I99 C;  3IKT A;  3IP4 B;  1X1A A;  2RV8 A;  3BG6 A;  3M07 A;  2EZI A;  3KEQ A;  2DCE A;  2KRC A;  2B7E A;  5D5V B;  2M2E A;  4NQW B;  1T38 A;  2ZNZ A;  3D5L A;  2XAU A;  4EJU A;  1T33 A;  3GUD A;  4XN3 A;  1I39 A;  2F4I A;  1JUS A;  2X1C A;  5LLQ A;  1B8I A;  2XKO A;  1USS A;  1XMK A;  3ULQ B;  3D1N I;  2ZB9 A;  2QGU A;  3A1Y A;  5AIQ A;  1KU7 A;  4BHB A;  4I01 A;  2VOP A;  3HHH A;  1YJW I;  3OWT A;  1MNM C;  3UKG A;  3J7A O;  1APL C;  4LB5 A;  4X6A J;  2XAQ A;  2MAB A;  4BKX A;  1Z7U A;  3G1O A;  2H8W A;  2WWY A;  3CCJ I;  2MH9 A;  1UHS A;  3U21 A;  3L2R A;  3DBR B;  1LVK A;  2VL8 A;  1ZK8 A;  3MEX A;  3P5J A;  4KNY A;  3J80 K;  1MJ9 A;  2CH0 A;  3OYA A;  1D5Y A;  2M4K A;  2EA4 A;  1XS9 A;  1GT0 C;  4XID A;  2MC3 A;  1WJB A;  4RAF A;  2L4M A;  2DN0 A;  3ASO H;  5CVV A;  4UUS B;  3S14 J;  2AQF A;  4DYR A;  1SAU A;  3OSG A;  5E17 F;  3QP5 A;  1UB9 A;  3BR0 A;  2DQL A;  4EEF G;  2VIX A;  4G7O F;  1KQ9 A;  2XPW A;  5FB2 A;  3IL2 A;  2FF4 A;  3GXO A;  1YO5 C;  3OSF A;  2NOJ B;  4BH9 A;  5D4R A;  3OYF A;  3W2A A;  4E7J A;  1YHQ I;  4U7B A;  4NQW A;  3ZMS A;  4DQ2 A;  2R7F A;  4II2 A;  1CGP A;  3OMY A;  3G2B A;  4HPQ A;  3AL0 C;  2BHZ A;  4WF2 A;  2XKP A;  3S2H J;  4IVN A;  4FX0 A;  3L00 A;  1MJA A;  2ISY A;  1EJ9 A;  4G94 A;  2HR3 A;  3EUH C;  4B4C A;  4AD9 A;  4P96 A;  3NWT A;  5DCM B;  2E60 A;  3ML6 A;  4S0H B;  5LEJ A;  2XVC A;  3OYI A;  3HTS B;  4OMY A;  3RTR A;  2PFB A;  6PAX A;  1LDK B;  2K3P A;  3FXK A;  1ZGW A;  2F48 A;  4YII A;  3ERM A;  2R0Q C;  3WGH A;  4XRS A;  4XLP F;  1OR7 C;  1U9N A;  1ETK A;  2OCC H;  4HLY A;  4C3H J;  1IW7 F;  2M7B A;  4QPO A;  3TKY A;  5DTD A;  3KLO A;  3LWF A;  3JRC A;  4BXU A;  4BJ5 C;  2ZSI B;  3M1E A;  2XAS A;  4MFD A;  4G12 A;  4UUV A;  1DU0 A;  1ZQ3 P;  2QQ8 A;  4KFC A;  2VE8 A;  4HRI A;  2M30 A;  4KA4 A;  3TED A;  3BZ6 A;  4A0Y A;  1K79 A;  1ULY A;  4KDP A;  4MFE A;  4CYC B;  2STW A;  4BUP A;  2BOL A;  4IX7 A;  1B72 B;  4AIH A;  2RVC A;  4DZJ A;  2IPQ X;  3OYK A;  5J8F A;  1I6X A;  2DMN A;  2ZO4 A;  3WOD F;  2GAU A;  4AC0 A;  5M5X J;  3FWE A;  3JRE A;  1K7A A;  3K4B A;  1E3O C;  1ZTR A;  4YFN F;  4L0Y B;  2MG4 A;  3TOA A;  1NK3 P;  2LLK A;  2X51 A;  3G6E I;  4UXN A;  1KQ0 A;  3ZOB A;  2KHM A;  4RAY A;  3CUQ C;  3GX4 X;  3K4K A;  1U5T C;  2Q1Z B;  4E4H A;  1MBE A;  4PGH A;  3DU5 A;  2VN2 A;  2CSO A;  3ZXS A;  2O8X A;  3T1B A;  1ETW A;  1SMY F;  2JT1 A;  4MHG A;  2M8G X;  2K9L A;  3GTP J;  2HNH A;  5LRS A;  2D1H A;  1U9O A;  1MBK A;  2ELK A;  4FAS D;  3VYS B;  1G8X A;  4BBR J;  5E3N A;  1QHG A;  1XDU A;  5JHF A;  1LEB A;  1J09 A;  4RLF A;  2VXD A;  4WCG A;  2M87 A;  5HVQ C;  1ZH5 A;  5EYR A;  3PQJ A;  4G6T B;  3ZQQ A;  2CW0 F;  3TO9 A;  2W82 A;  3WG9 A;  4YIF A;  4M6X A;  5GPA A;  3WGI A;  1V5E A;  1ETY A;  1R5I D;  1Y56 A;  1NHA A;  2VBY A;  2XGE A;  4MEX F;  3VB2 A;  3ZQ7 A;  3SFZ A;  1TL8 A;  3FIW A;  3P9C A;  1PVE A;  5GAG J;  1R4M B;  2VKH A;  3OS0 A;  3WTT C;  4GGG A;  3D5R C;  1JUM A;  2O0Y A;  1IDZ A;  2I10 A;  1K6O A;  2HVS A;  5B66 C;  1IV6 A;  4OOI A;  1ETX A;  1QGP A;  2DMT A;  1I50 J;  2L5Q A;  4BQO A;  2JUG A;  1LKX A;  3RI4 A;  2NVU B;  2K40 A;  5M3F J;  4LOC A;  1YIT I;  1R1V A;  4Y7N J;  2F5V A;  3L2C A;  4D5C A;  3BCA A;  1HCR A;  2KLO A;  2H09 A;  4N9H A;  2GLO A;  3TDU C;  4W1U A;  1I3Q J;  3N97 A;  3GO5 A;  2WB1 A;  3FM3 A;  4UUT A;  4O5V A;  2KIF A;  3RPQ A;  3CP8 A;  3S32 A;  1A04 A;  4V19 K;  2L3D A;  2UXX A;  4Y3O A;  3JTG A;  1GUU A;  2KPM A;  3HUG A;  2R7U A;  1KA8 A;  2EH3 A;  3HL2 A;  1MSF C;  1VQL I;  4BS9 A;  1GHC A;  4A69 C;  3NWS A;  1JKR C;  1ZRE A;  1T6S A;  1DUX C;  2HXO A;  2LR8 A;  3H9Q A;  5M3M J;  4ESF A;  5F04 A;  2PMH A;  4PJN A;  1IN7 A;  1XD7 A;  3DP7 A;  1IO2 A;  2EQR A;  3ABU A;  3HGY A;  4XOR A;  1ZN2 A;  4LIT A;  1IG7 A;  3VYT B;  2NYX A;  2QCO A;  1BC7 C;  2KIQ A;  2I8D A;  5LEK A;  3HPG A;  4G6D A;  1ZKG A;  2ZFW A;  1H9T A;  3S3N A;  3U2R A;  3M8E A;  3RJP A;  2BGC A;  2IGK A;  2V9P A;  1XC5 A;  1WJ5 A;  1GXQ A;  3VEP A;  4ENN A;  2VJ5 A;  1QVT A;  1Z7L A;  3LA7 A;  2XB0 X;  1IXS B;  5KK1 A;  3G3Z A;  2EIM H;  2CV0 A;  3S2D J;  3DKY A;  2FU4 A;  4P9F A;  2JUC A;  5LD2 C;  4BHC A;  2QWW A;  2Y48 A;  4CIC A;  3H3U A;  4PCQ A;  4ABZ A;  3ZQC A;  1FYK A;  1D1A A;  1FYM A;  2VPL A;  3J81 Z;  2XHK A;  2DDA A;  2W00 A;  3CLQ A;  1Y1V J;  2K86 A;  1MMA A;  1PUE E;  2L4A A;  4ZTJ A;  3VWB A;  3JSP A;  2DFI A;  1WFX A;  1ON1 A;  1U5T B;  1V4R A;  2DPD A;  3SQN A;  3GTQ J;  2F5E A;  2O3F A;  1OCZ H;  1Z1D A;  1QHH D;  4OAZ A;  1CF7 A;  1YW9 A;  3QPT A;  3RKY A;  3Q9S A;  3V7C A;  3VOE A;  3CCE I;  4BU2 A;  4D0P A;  4AU7 A;  2K02 A;  1VFC A;  4XLA A;  1LFP A;  4V2F A;  3CCQ I;  2OJE D;  4U7D A;  3AAF A;  1QU3 A;  3F8F A;  2VQH A;  5CVR A;  3OOU A;  2O8K A;  3EUH A;  3IC7 A;  3M9A A;  2CGP A;  2OV7 A;  3GTM J;  1VF9 A;  5EZH A;  1TQM A;  2R7S A;  2ESH A;  1MBH A;  2Z3Y A;  2OZ6 A;  4NB5 A;  3K1P A;  3VPR A;  2H1L A;  5IOZ A;  2R93 J;  2NNN A;  4BNC A;  1OR7 A;  4A6D A;  1TQI A;  3VOD A;  3BJA A;  4Q47 A;  3BY6 A;  3GZN B;  1XGM A;  4F7Z A;  4W97 A;  4C30 A;  4M74 A;  1SFU A;  1MBF A;  3O8H A;  2YR2 A;  4ESB A;  3ABT A;  1FLI A;  1HKT A;  1WI3 A;  2JRM A;  3E6B A;  1XCV A;  4BL0 B;  3CTA A;  3KLN A;  4XOP A;  1R6R A;  3K69 A;  1O3Q A;  4HF1 A;  2W4S A;  4PSX A;  1REP C;  1UEL B;  4Y13 A;  3KE2 A;  3WU2 C;  4CCN A;  3WTU C;  2V79 A;  2EZL A;  1V55 H;  5DUI A;  4RB1 A;  3FKJ A;  1A36 A;  3FKI J;  4QLC U;  5FD6 A;  1HW5 A;  1TWA J;  2P6T A;  2EIN H;  1WI9 A;  1D0Z A;  1MSE C;  3E5U A;  3FF5 A;  5IYC J;  3R0A A;  1Z77 A;  3LQQ A;  2OCE A;  1CF7 B;  3M8F A;  3BQZ A;  4IEJ A;  1D3Y A;  1FP2 A;  3VFZ A;  5HOD A;  4I76 A;  4I7H A;  3ZMV A;  3JAM K;  4FE4 A;  3ZR8 X;  4BE2 A;  3V42 A;  3AG2 H;  1S29 A;  2WTE A;  1YX3 A;  1PP7 U;  4Y15 A;  3TO7 A;  1BR2 A;  2XRO A;  3ERE D;  3L7W A;  1RPW A;  1LDD A;  1RR7 A;  3T8R A;  2L7K A;  4OIP F;  4BGD A;  5ILV A;  1UAA A;  2NS7 A;  2XPU A;  3BC8 A;  2BYV E;  4BHP A;  1IAW A;  2M0C A;  1FZP B;  3CD6 I;  3KPH A;  3I4M J;  1JT6 A;  4J01 A;  2ZC2 A;  2ZXI A;  1DPR A;  1YJN I;  3LFK A;  3JRG A;  1G3W A;  2CQ7 A;  4M3F A;  5E18 F;  1U8B A;  2A05 A;  2CJJ A;  2VAS A;  3IH4 A;  5H6Q A;  1G59 A;  1IF1 A;  3GTL J;  3CP2 A;  3HM5 A;  4M6V A;  1JE8 A;  1IRG A;  1Z67 A;  1LE8 A;  4G9Y A;  2V7F A;  4XLE A;  3ABL H;  3O2P E;  1X1D A;  2L7Z A;  3LST A;  3TGN A;  9ANT A;  3Q0W A;  5LFA A;  4B48 A;  2A6H F;  1V5G A;  4WK8 F;  2DMQ A;  4Z6Y A;  5IP7 J;  2DYS H;  2FXA A;  1IXR C;  5LHG A;  5D8L B;  4XNF A;  1B6A A;  4D7N A;  4EJW A;  4WXD A;  1FMW A;  2LY2 A;  2YPR A;  5IT9 Z;  3Q0V A;  3LOC A;  5H6R A;  2EV6 A;  3OIP A;  2WB1 N;  2VT3 A;  3ZRG A;  3BTL A;  2NRA C;  2JA6 J;  2MD0 A;  1U3E M;  3RKQ A;  2VE9 A;  3LAJ A;  2GWR A;  2YU9 J;  1OCT C;  4XM3 A;  4IHY A;  2VKE A;  1Q1V A;  2P4W A;  1UCR A;  4I02 A;  1NK2 P;  3EUA A;  1X1P A;  4HQE A;  1TQP A;  3LSM A;  5A2Q Z;  4HX8 A;  3TBI A;  2XAF A;  2IS4 A;  2HKX A;  1ITY A;  1VQP I;  3PFY A;  1EH7 A;  1JJ6 C;  4A3K J;  3QRF F;  1YRN A;  3HOV J;  4XL9 A;  1FTT A;  2ME0 A;  1D8J A;  1X4O A;  2DA5 A;  1W5T A;  3BQY A;  3ZQL A;  4KIC A;  1JHF A;  3CJT B;  3GZ6 A;  1LVA A;  4KIS A;  1DQU A;  5D5U B;  1E17 A;  4B09 A;  1N77 A;  5FKK A;  3L2U A;  4M71 A;  5LGU A;  3MKZ A;  4IHT A;  1JUP A;  2GQQ A;  2ZXJ A;  2VKV A;  1FNN A;  1YS6 A;  1IDY A;  2COM A;  3FX3 A;  2O7O A;  4CCM A;  3BCB A;  2EK5 A;  4B47 A;  1BW6 A;  2UZK A;  2ZJQ F;  1YJ9 I;  5HLT A;  1Z0X A;  2LBF A;  1D1B A;  2KIM A;  3BG5 A;  4ENK A;  3HHG A;  4JP0 A;  2LKX A;  2GXA A;  1HW1 A;  4IXA A;  1FYL A;  3QU3 A;  3FBI B;  2Z2S B;  2CUJ A;  2VJ4 A;  2XUB A;  2HOT A;  2IT0 A;  3NAU A;  3K0L A;  4CCO A;  2DA4 A;  1PUF B;  2HPM A;  3QQA A;  1XPX A;  4OIQ F;  1GLN A;  2LF8 A;  5HOO A;  3LSJ A;  1FOK A;  2XGD A;  5ICE A;  1O4X A;  5J4Y A;  1P2F A;  4KT5 C;  5DCF A;  3TP0 A;  3C1D A; 
#chains in the Genus database with same CATH homology
 1ONV A;  3E3V A;  2P8T A;  3BP8 A;  3PFI A;  2MBF A;  5FFX A;  3WE2 A;  1RZ4 A;  2EWN A;  2J5O A;  4IRG A;  1FWZ A;  1XGS A;  2A07 F;  4HQM A;  4IRI A;  2W57 A;  2W25 A;  4LGW A;  2DTR A;  4CYD A;  3GYH X;  1B59 A;  1P4X A;  5KVR A;  3QOP A;  1XGO A;  4RGU A;  1KU2 A;  1QO0 D;  2LF7 A;  4E70 A;  2FQ3 A;  4I0B A;  3FM5 A;  3GFL A;  4PGG A;  2TDX A;  4Z2Y A;  2QYO A;  5JHU A;  3HOT A;  2ZME A;  2F2E A;  5CLS A;  2A3S A;  4LMY A;  2XAJ A;  5H20 A;  2FNP A;  1ODD A;  4YG2 F;  5JR3 A;  2KKO A;  3O3K A;  1R22 A;  3IHU A;  1XSX A;  4LK1 F;  1F9N A;  3WTY C;  3BOQ A;  5ERI A;  1L3L A;  1O3T A;  2P7V B;  5DEQ A;  5E1W A;  1IZ1 A;  2GIV A;  2PI0 A;  1S7A A;  3LA2 A;  2V1X A;  1BOA A;  3GF2 A;  1HKS A;  1FBS A;  4XBF A;  1J2X A;  3QP6 A;  1W4M A;  3FHZ A;  4IHS A;  3IRR A;  4P9U A;  1BM9 A;  2H6B A;  2Z99 A;  4ETS A;  2XGX A;  3W6J B;  4I09 A;  5E1Z B;  1FSE A;  2QZ8 A;  1UFM A;  2FRH A;  1LB2 A;  1MZB A;  2OA4 A;  4CGZ A;  5EEH A;  4ZZL A;  4S05 A;  1JGS A;  2HYG D;  3BPX A;  4A6E A;  3TOB A;  3QAH A;  1PP8 F;  4M9Z A;  1F1Z A;  2NNY A;  2PBI A;  4EM0 B;  4MEY F;  2BBY A;  4L0Z B;  3D0S A;  5ICG A;  4P5O A;  2V9V A;  2WV0 A;  5LHH A;  3ZMT A;  4CXF A;  2Z33 A;  4I0A A;  3RYR A;  2A68 F;  2GXG A;  4GXO A;  4ENJ A;  4RAZ A;  2D1V A;  3DF8 A;  1TTY A;  3KCC A;  1YYV A;  4HDV A;  1L0O C;  5HDK A;  3DKW A;  4M72 A;  5CJ9 A;  5K5O A;  2CWE A;  2H6C A;  5E20 A;  1PDN C;  2RQP A;  4M73 A;  3DV8 A;  3I64 A;  4A2U A;  3DEU A;  5F6F A;  5L3E A;  3CDH A;  1UHW A;  2V1U A;  3LAP A;  2HZT A;  5AIP A;  4U0V A;  4ENM A;  1HW2 A;  3MWM A;  2VT2 A;  5E1X A;  3T0Y A;  3COA C;  4HLX A;  1SFX A;  1P4W A;  3CUQ B;  2R3S A;  3Q5F A;  5ICC A;  1I1S A;  4BYY A;  2LKP A;  4L9V A;  3H3Z A;  4LK0 F;  1U6G A;  2DU9 A;  2JPC A;  3KP3 A;  4Q5S F;  1YFH A;  2A5Y B;  2E7W A;  1BBY A;  1ZAO A;  1QBJ A;  2XRN A;  4OIN F;  2CO5 A;  1KYZ A;  1QPM A;  3LQR A;  4A5N A;  4HZF A;  2FMY A;  4IRH A;  2OQG A;  5DCM A;  1YS7 A;  2Z5U A;  5JVT A;  3EQL F;  3F22 A;  3B73 A;  3CO7 C;  2ZME B;  2MLK A;  3SHF A;  5BPI A;  3OOP A;  2VBZ A;  5FGM A;  3HSF A;  1LDJ A;  3F23 A;  3ZP5 A;  2DT5 A;  2DQR A;  4Q48 A;  4BAY A;  4L18 B;  1ZGJ A;  5L3D A;  3MAJ A;  3SXY A;  3V7R A;  1DP7 P;  1JXS A;  3IWF A;  2HWV A;  5HDG A;  2ZNY A;  2H94 A;  1KU3 A;  3ROU A;  3IKV A;  1RNL A;  3CJN A;  2DK8 A;  4JQF A;  3V8L A;  5D8K B;  2V6C A;  1YTY A;  3P9K A;  2EA2 A;  1O7L A;  2AXL A;  2EB7 A;  1FBQ A;  2OBP A;  1SD7 A;  1W5S A;  3KET A;  4L9N A;  2AS5 F;  2FML A;  1VTN C;  3TDZ C;  1XDS A;  4FHT A;  5DV5 A;  2FSW A;  4RB2 C;  1ZHF A;  4ZYG A;  2JPB A;  4HF0 A;  1OYW A;  1U2W A;  3G73 A;  1R7J A;  4CHU A;  1Z05 A;  4JBA A;  3NRV A;  2KIU A;  1G3S A;  1AOY A;  3DPT A;  4IPA A;  4EJV A;  1QZY A;  1R5H A;  2JTV A;  4U88 A;  3I59 B;  4WX9 A;  2IA2 A;  2V1D A;  1GVJ A;  2FA5 A;  3SZT A;  3HOS A;  1G4D A;  3F8M A;  5BPD A;  2DLL A;  2F5D A;  2G9W A;  1BIA A;  4JK1 X;  1R1T A;  1KYW A;  1S7O A;  4RB0 A;  4ZYH A;  2EFW A;  4G7Z F;  4ZH4 F;  3DFG A;  3RIR A;  1QZZ A;  1C0W A;  1R23 A;  2D2W A;  2X4H A;  5AON A;  1G3T A;  1V3F A;  3DXJ F;  2CQK A;  4MTE A;  3M7G A;  4KN4 X;  1W7P B;  3E6C C;  4XRF A;  2QQB A;  4U0Y A;  1SAX A;  3B02 A;  4GYI A;  2UXN A;  3CUQ A;  3BJ6 A;  2QEN A;  1EH8 A;  1QQI A;  4UVA A;  2M1B A;  1P92 A;  2VXZ A;  4U0W A;  1WRJ A;  3ECO A;  2IW5 A;  1O3R A;  3RKW A;  4EJO A;  3GVA A;  1G6N A;  2IRF G;  4I98 B;  4WXH A;  1H0M A;  1Z9C A;  3U9G A;  3W6K B;  2Y75 A;  2RNJ A;  5HLG A;  2P7C B;  5TRD A;  2JRT A;  1IRF A;  4HA8 A;  3PQK A;  2VOO A;  3BPV A;  2MA3 A;  4HOB A;  5HS7 A;  4UNO A;  1KU9 A;  1XMA A;  2O03 A;  2E1C A;  1B9M A;  2HS5 A;  1YG2 A;  2K4B A;  3GW2 A;  3E5X A;  1Q1H A;  2HTJ A;  2OD5 A;  3JTH A;  2QQA A;  5K5R A;  1Z6T A;  1B4A A;  1W7P A;  3RPU A;  5HLH A;  1B1B A;  5J6X A;  3CUO A;  3GLX A;  1FX7 A;  1U8R A;  2OQR A;  4S04 A;  1S6L A;  3TQN A;  4Y17 A;  1GXP A;  3V4G A;  1LEA A;  4BQA A;  4EJT A;  5FLX Z;  4PDK A;  5F1R A;  2STT A;  3FMR A;  1MD0 A;  5CVU A;  2H27 A;  2ELH A;  2GA2 A;  1OPC A;  3F72 A;  4FT8 A;  3F6V A;  3K1N A;  4HDU A;  1BC8 C;  1YW8 A;  3CLO A;  1XGN A;  3E5Q A;  3REO A;  2GZW A;  4M6Y A;  2IA1 A;  1HKQ A;  1J7K A;  2M45 A;  3R4K A;  3KP5 A;  2HGC A;  4XSZ F;  3WTW C;  1FP1 D;  3KFW X;  1MDM B;  2HEO A;  4IJA A;  1WWX A;  5JI6 A;  2Q2E A;  3KZZ A;  2ETH A;  5CVJ A;  3FXU A;  3KP6 A;  4AIK A;  2XIG A;  2DO7 A;  1YLF A;  5ILU A;  2F5F A;  2L01 A;  3E97 A;  3I59 A;  1RUN A;  4A5M A;  1D8K A;  1P4A A;  3HTU A;  3HRS A;  1F4K A;  4KMU X;  2RC4 A;  3HRT A;  2KJC A;  3I5U A;  5E8I A;  4WWC A;  2Y0M A;  2XV4 S;  3HYI A;  5LGT A;  4G7H F;  3V7S A;  1Z6R A;  3FXR A;  3OV8 A;  2KRF A;  1U5T A;  4I2O A;  2KJB A;  4MGR A;  5L3B A;  2QLZ A;  2PN6 A;  3ZMU A;  2JZY A;  4HV5 A;  3GFI A;  2JSC A;  4NHJ A;  2PMU A;  1J0R A;  4YFK F;  1TNS A;  3DQV C;  3EYI A;  2IVM A;  1BN5 A;  1HXD A;  1LQ1 A;  3FZV A;  3JSO A;  4RGX A;  2PEX A;  4OU0 A;  4HBL A;  2ESN A;  3K9T A;  1T2K A;  2YSR A;  5ILS A;  1XN7 A;  4AWX B;  2EFO A;  2A61 A;  4M9X A;  2ZBK A;  3MZY A;  4RS8 A;  1ZLK A;  3L9F A;  1ZRC A;  2VC0 A;  3HIF A;  1SD6 A;  3F8N A;  3WGG A;  5F64 A;  2LDU A;  2HQR A;  1DDN A;  1WKM A;  1WQ2 A;  3P7N A;  1TW3 A;  5TJJ A;  3V8K A;  1MGT A;  4M9S A;  4HV6 A;  4TV7 A;  2C6Y A;  4GO1 A;  2ADU A;  3MZH A;  2FNA A;  5HS8 A;  3KP7 A;  5FFZ A;  1SFE A;  3J81 K;  2MD5 A;  4LD5 A;  1XSD A;  1SD4 A;  3IWZ A;  3RKX A;  2XAG A;  2RN7 A;  1ZG5 A;  4KN7 X;  3I4P A;  1HBX G;  2P6S A;  2ACJ A;  1RIO H;  2L02 A;  4A0X A;  1OYI A;  2M8E A;  2A6E F;  1ZRD A;  1UHM A;  1ZG1 A;  3WTX C;  2NS0 A;  3H92 A;  1WSU A;  2ZCW A;  4L9T A;  1IXC A;  2E7X A;  3R6S A;  3MFK A;  2EV0 A;  3MCZ A;  1YIO A;  1O57 A;  2E1N A;  3GWZ A;  2HOE A;  3HSR A;  4LLN A;  4OMZ A;  1XCB A;  4LJZ F;  4UVC A;  1LNW A;  5FD5 A;  2CFX A;  4LLL A;  3KZY A;  3IRQ A;  1KGS A;  1S3J A;  4OIO F;  1D5V A;  4UV9 A;  4KIB A;  4R8H A;  4O6J A;  5ED4 A;  3ZN1 A;  1SMT A;  2J5P A;  5HDN A;  2DPU A;  1I27 A;  1TNT A;  4L5I A;  2LSO A;  2MLG A;  3RDI A;  2QBY B;  4MTD A;  1J59 A;  1ZRF A;  1J5Y A;  3R61 A;  3EYY A;  2W84 A;  1O7F A;  1HSJ A;  1FY7 A;  2W24 A;  2ZJ2 A;  2EJR A;  2G7U A;  5K5Q A;  1KQ8 A;  5L3F A;  2P5V A;  5D5X B;  1BI3 A;  2GXB A;  1ZG3 A;  2VC1 A;  3GFJ A;  5CVI A;  2PG4 A;  3GFM A;  4R79 A;  1MJB A;  3HRM A;  1FBU A;  2HQN A;  3L09 A;  4HX4 A;  3ISP A;  1LJ9 A;  4ASN A;  3CO6 C;  1YW7 A;  2FBI A;  3HSE A;  2HYF A;  1TW2 A;  1OMI A;  2FE3 A;  1O3S A;  1EH6 A;  3ZN0 A;  1HST A;  3R60 A;  3Q9V A;  4CO8 A;  3E6D A;  3F8C A;  4LLG F;  3RYP A;  3C7J A;  3O6B B;  1UST A;  3ZMD A;  5JFR A;  5ICF A;  2EV5 A;  4CZZ A;  2X0L A;  2Q0O A;  3EDP A;  5BS6 A;  4ESJ A;  3NEU A;  1IUY A;  5E8G A;  4EQQ A;  4LG0 B;  4UHT A;  2RKH A;  4MQV A;  3WTV C;  1RUO A;  4K2E A;  3F6O A;  3BWG A;  2P5K A;  4KUM A;  1IN4 A;  4A0Z A;  1XB4 A;  4KIG A;  4L9J A;  3R0J A;  4L5J A;  1J9I A;  3P9I A;  4RGR A;  5CYV A;  2YX4 A;  3C3W A;  1YQA A;  4ZYE A;  1H9G A;  3T5X A;  5DUK A;  2IP2 A;  2O61 A;  2FEZ A;  4ZZD A;  3V8J A;  2Z9O A;  3I54 A;  4GCV A;  1JHH A;  1FPQ A;  3ZPL A;  4XLN F;  3WE3 A;  1P6R A;  1ZAR A;  2HFH A;  4A12 A;  4LG0 A;  2XAH A;  1F5T A;  2GA1 A;  2VON A;  4PZJ A;  5BMZ A;  1OKR A;  3QPH A;  4HYE A;  4UV8 A;  5DDG A;  3WTZ A;  1W7P D;  3F3X A;  5EEG A;  2QBY A;  2L54 A;  3BDD A;  4G6Q A;  3FMS A;  4Q4Z F;  2NAZ A;  4R1H A;  4IF4 A;  2F5C A;  4P55 A;  4HW0 A;  5A2Q K;  4HF2 A;  3TO6 A;  2DI3 A;  1T98 A;  2OAZ A;  1IN8 A;  1J75 A;  3JW4 A;  1IN6 A;  4WXC A;  2HDC A;  2DAO A;  1MKM A;  1R58 A;  1E2X A;  1OYY A;  4ON0 A;  1Z91 A;  5J8C A;  3BJO A;  3SZP A;  3NQO A;  5DD8 A;  5IT9 K;  2VOD A;  2QM3 A;  4CDG A;  1BI2 A;  3K1M A;  1R5G A;  4FX4 A;  3S2W A;  3I53 A;  1R1U A;  2ISZ A;  3LA3 A;  2EFQ A;  4LFU A;  2DK5 A;  4MQ9 F;  1EV7 A;  4KIF A;  5HLI A;  2O6G E;  4O3M A;  4DNC A;  4EGZ A;  4OIR F;  4EVI A;  3I71 A;  2K7L A;  1RI7 A;  4EMS A;  5L3G A;  2BE5 F;  2OZU A;  3FXQ A;  3QU6 A;  2QUF A;  4G8X A;  3KP2 A;  2G7H A;  4AIJ A;  3FMQ A;  3F21 A;  2EFP A;  1T39 A;  1AWC A;  2OU2 A;  2K4J A;  4RGS A;  4GYG A;  1BI0 A;  1BIB A;  5D4S A;  2B0L A;  2M5W A;  3E6M A;  3F8B A;  5D6F A;  1U78 A;  2MH2 A;  2K27 A;  4LB6 B;  1S8N A;  2CYY A;  1R36 A;  1SD5 A;  1R00 A;  3EET A;  2DBB A;  1XSV A;  1ON2 A;  3ZMZ A;  2FOK A;  1T0F A;  2FBH A;  4EV0 A;  5LHI A;  5L3C A;  1QNT A;  3N4M A;  5DYM A;  3U1D A;  5FLX K;  1FT9 A;  2PJP A;  2QQ9 A;  4KMF A;  1K78 A;  4MNU A;  1Y0U A;  3DPL C;  2HTS A;  1B9N A;  4HX7 A;  4KYW A;  4XSX F;  1DPU A;  3T8T A;  3KP4 A;  4UVB A;  3K2Z A;  2WC2 A;  1BJA A;  2W85 A;  2PLY A;  2YU3 A;  1I5Z A;  4RB3 C;  3JAM Z;  3ELK A;  3WTS C;  4YFX F;  4EM2 A;  2ZKZ A;  2LNB A;  3C18 A;  2A69 F;  2CG4 A;  2BV6 A;  5D6E A;  4EM1 A;  3BRO A;  3WU0 A;  2DW4 A;  1FC3 A;  3GZ5 A;  2QVO A;  4EGY A;  2PQ8 A;  1X3U A;  3ECH A;  5DD4 A;  5HS9 A;  2Q8K A;  5BOX A;  1ZYR F;  4N9I A;  2BEO A;  2FBK A;  5LRR A;  4AVP A;  1IN5 A;  4QWQ A;  2RGV A;  5BQT A;  2VBW A;  5FO5 A;  5LGN A;  1BI1 A;  2UWM A;  1STZ A;  3HRU A;  4HAM A;  3J80 Z;  1K78 B;  4N0B A;  1ZGA A;  3MQ0 A;  1TLH B;  4H0E A;  2D45 A;  2HKO A;  2P5L C;  2IA0 A;  5D5W B;  3I58 A;  2VBX A;  1TBX A;  4B8X A;  5IT3 A;  2RDP A;  1G3Y A;  1FSH A;  2EFN A;  3KEO A;  5K1Y A;  4ZYD A;  1ZLJ A;  3I0T A;  5LBQ A;  1I1G A;  1HQC A;  2IJL A;  2R7D A;  1MDM A;  3GEZ A;  3WU1 B;  2YX7 A;  3IKT A;  2RV8 A;  3KEQ A;  5D5V B;  1T38 A;  2ZNZ A;  3D5L A;  4EJU A;  3GUD A;  5LLQ A;  2XKO A;  1USS A;  1XMK A;  3ULQ B;  5AIQ A;  1KU7 A;  4BHB A;  4I01 A;  2VOP A;  3HHH A;  3J7A O;  4LB5 A;  2XAQ A;  1Z7U A;  2WWY A;  2MH9 A;  3MEX A;  4KNY A;  3J80 K;  1MJ9 A;  2EA4 A;  2MC3 A;  2L4M A;  5CVV A;  5E17 F;  3QP5 A;  1UB9 A;  2DQL A;  4G7O F;  1KQ9 A;  5FB2 A;  3IL2 A;  2FF4 A;  3GXO A;  1YO5 C;  5D4R A;  4BH9 A;  4U7B A;  4NQW A;  3ZMS A;  4DQ2 A;  2R7F A;  1CGP A;  4WF2 A;  2XKP A;  4IVN A;  4FX0 A;  3L00 A;  1MJA A;  2ISY A;  4G94 A;  2HR3 A;  4AD9 A;  4P96 A;  5DCM B;  3ML6 A;  5LEJ A;  2XVC A;  3HTS B;  4OMY A;  3RTR A;  2PFB A;  6PAX A;  1LDK B;  4YII A;  3WGH A;  4XLP F;  4HLY A;  1IW7 F;  3TKY A;  3KLO A;  3LWF A;  4BXU A;  3M1E A;  2XAS A;  4UUV A;  4KFC A;  2VE8 A;  2M30 A;  4KA4 A;  3BZ6 A;  4A0Y A;  1K79 A;  1ULY A;  4KDP A;  2STW A;  4AIH A;  2RVC A;  2IPQ X;  5J8F A;  1I6X A;  2ZO4 A;  3WOD F;  2GAU A;  3FWE A;  1K7A A;  4YFN F;  4L0Y B;  3TOA A;  4UXN A;  1KQ0 A;  4RAY A;  3CUQ C;  3GX4 X;  1U5T C;  4PGH A;  2VN2 A;  2CSO A;  2O8X A;  3T1B A;  1SMY F;  2JT1 A;  4MHG A;  5LRS A;  2D1H A;  1XDU A;  1LEB A;  4WCG A;  2M87 A;  5HVQ C;  1ZH5 A;  3PQJ A;  2CW0 F;  3TO9 A;  3WG9 A;  4YIF A;  4M6X A;  3WGI A;  1NHA A;  2VBY A;  4MEX F;  3VB2 A;  3ZQ7 A;  3SFZ A;  3P9C A;  3WTT C;  4GGG A;  2O0Y A;  1K6O A;  4OOI A;  1QGP A;  3RI4 A;  1R1V A;  3L2C A;  4N9H A;  2H09 A;  3TDU C;  3N97 A;  3GO5 A;  3FM3 A;  4O5V A;  2KIF A;  3RPQ A;  1A04 A;  2L3D A;  2UXX A;  3JTG A;  3HUG A;  1KA8 A;  1GHC A;  1ZRE A;  1T6S A;  1DUX C;  4ESF A;  2PMH A;  1IN7 A;  1XD7 A;  3DP7 A;  3ABU A;  1ZN2 A;  2NYX A;  1BC7 C;  5LEK A;  4G6D A;  2ZFW A;  1H9T A;  3U2R A;  3M8E A;  3RJP A;  2BGC A;  1GXQ A;  3VEP A;  4ENN A;  3LA7 A;  1IXS B;  5KK1 A;  3G3Z A;  2FU4 A;  4P9F A;  4BHC A;  2QWW A;  2Y48 A;  4CIC A;  3H3U A;  4PCQ A;  1FYK A;  1FYM A;  3J81 Z;  2XHK A;  2K86 A;  1PUE E;  2L4A A;  3JSP A;  2DFI A;  1ON1 A;  1U5T B;  1V4R A;  2DPD A;  3SQN A;  2F5E A;  2O3F A;  1Z1D A;  1CF7 A;  1YW9 A;  3QPT A;  3RKY A;  3Q9S A;  3V7C A;  3VOE A;  4D0P A;  2K02 A;  4U7D A;  3AAF A;  3F8F A;  5CVR A;  3EUH A;  3IC7 A;  3M9A A;  2CGP A;  1TQM A;  2ESH A;  2Z3Y A;  4NB5 A;  2OZ6 A;  3K1P A;  2NNN A;  4BNC A;  1OR7 A;  4A6D A;  1TQI A;  3VOD A;  3BJA A;  4Q47 A;  3BY6 A;  1XGM A;  4F7Z A;  4M74 A;  1SFU A;  2YR2 A;  4ESB A;  3ABT A;  1FLI A;  1HKT A;  3E6B A;  1XCV A;  3CTA A;  3KLN A;  3K69 A;  1O3Q A;  4HF1 A;  1REP C;  4Y13 A;  3KE2 A;  3WTU C;  2V79 A;  5DUI A;  4RB1 A;  4QLC U;  5FD6 A;  1HW5 A;  2P6T A;  1WI9 A;  3E5U A;  3FF5 A;  3R0A A;  3LQQ A;  1CF7 B;  3M8F A;  1D3Y A;  1FP2 A;  3VFZ A;  4I7H A;  3ZMV A;  3JAM K;  1PP7 U;  1S29 A;  2WTE A;  4Y15 A;  3TO7 A;  2XRO A;  3ERE D;  3L7W A;  1LDD A;  3T8R A;  4OIP F;  5ILV A;  4BHP A;  2BYV E;  1IAW A;  1FZP B;  1DPR A;  3LFK A;  1G3W A;  5E18 F;  5H6Q A;  1IF1 A;  1JE8 A;  1IRG A;  4G9Y A;  3O2P E;  3LST A;  3TGN A;  2A6H F;  4WK8 F;  2FXA A;  1IXR C;  5LHG A;  5D8L B;  1B6A A;  4EJW A;  4WXD A;  2YPR A;  5IT9 Z;  5H6R A;  2EV6 A;  2VT3 A;  2NRA C;  1U3E M;  2VE9 A;  3LAJ A;  2GWR A;  2P4W A;  1UCR A;  4I02 A;  4HQE A;  1TQP A;  5A2Q Z;  4HX8 A;  2XAF A;  2HKX A;  1EH7 A;  3QRF F;  1D8J A;  1W5T A;  4KIC A;  1JHF A;  3GZ6 A;  1LVA A;  5D5U B;  1E17 A;  4B09 A;  4M71 A;  5LGU A;  4IHT A;  2GQQ A;  2ZXJ A;  1FNN A;  1YS6 A;  2COM A;  3FX3 A;  2EK5 A;  2UZK A;  4ENK A;  2KIM A;  3HHG A;  1HW1 A;  4IXA A;  1FYL A;  3QU3 A;  2XUB A;  2IT0 A;  3K0L A;  4OIQ F;  2LF8 A;  5HOO A;  1FOK A;  5ICE A;  1P2F A;  4KT5 C;  5DCF A;  3C1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...