1T6SA

Crystal structure of a conserved hypothetical protein from chlorobium tepidum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ScpB from Chlorobium tepidum, a protein involved in chromosome partitioning.
pubmed doi rcsb
source organism Chlorobium tepidum tls
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t6sA02
3QU3A 4KDPA 2NYXA 4OIRF 4Q47A 4RB1A 1HW5A 3TGNA 1BIBA 3M8EA 2HZTA 2STTA 1B6AA 1A04A 3E6BA 3LFKA 3WGIA 4KT5C 3GFIA 5A2QZ 4EJWA 4IRHA 2ISZA 2EV0A 3PQKA 1W7PB 4IPAA 3LSTA 4WXCA 4BH9A 1K78B 3KETA 1BJAA 4O5VA 4RB0A 2JTVA 4FT8A 2CGPA 3R60A 4JQFA 1R22A 2DBBA 3HYIA 5BQTA 1OMIA 1NHAA 1YS7A 2EFQA 5HLIA 4HLYA 3FMRA 3DPLC 1YIOA 2RN7A 4A6EA 5LRSA 5DV5A 2EFWA 2PBIA 4L9NA 5HLHA 2XASA 2H6CA 2JPBA 2OU2A 3BOQA 3I71A 1P4WA 2FOKA 2K4BA 4EMSA 1SMYF 4FX4A 3HTSB 2RGVA 1MZBA 3M8FA 3OOPA 2BV6A 2IJLA 1LVAA 5HVQC 2R7FA 4NHJA 3FM3A 3KCCA 2MH2A 4L9TA 4LB5A 2QBYA 1IXSB 1SD7A 1XCBA 1R58A 5EEGA 1F4KA 3WGHA 3T0YA 1XGSA 3RJPA 3QRFF 3DF8A 5K5QA 4KUMA 3VODA 3F3XA 4ENMA 4EGYA 1TLHB 3KLNA 3M9AA 3R4KA 3FMSA 2Z33A 5DUKA 4OIOF 1GXQA 1I1SA 1RUOA 3I64A 2HTJA 4ESBA 4PCQA 3FM5A 5ED4A 2EV5A 5EEHA 4LG0A 2TDXA 4IRGA 3L9FA 4G7HF 3GFMA 3BP8A 4EVIA 3KEQA 1XGOA 1UCRA 3MQ0A 1JXSA 1BC7C 4O6JA 2DW4A 4M6XA 2DQRA 2IA0A 1IZ1A 3V8KA 2ZMEA 5CVVA 4RAYA 4UV8A 1O3QA 4LLNA 2PI0A 1CGPA 3FXQA 2F5DA 5H6QA 3SZPA 3V4GA 4OINF 1J7KA 5L3CA 1QNTA 1L3LA 2K86A 4I2OA 2GWRA 5DCMB 3I4PA 4PGHA 4M73A 5CYVA 4EM0B 2DU9A 1Z6RA 1J5YA 3E5UA 1ON1A 3Q9SA 1SMTA 2F2EA 3RKXA 4AD9A 1T2KA 1W7PD 4U0VA 5ICFA 3ERED 4BQAA 3KP5A 1BI0A 2X0LA 1MDMA 1ZGAA 1P4XA 5KVRA 1U2WA 3G3ZA 5ERIA 3LAPA 5E8IA 1XDUA 3CTAA 1PP8F 2XKPA 4BHCA 2A69F 2V1UA 3HSEA 4RAZA 2W84A 3ULQB 2Z3YA 1G3WA 2GAUA 2GQQA 1ZH5A 4A12A 1P92A 2EB7A 4M9SA 2JZYA 3LWFA 2UXXA 1V3FA 1KQ8A 2OZ6A 5FO5A 1MKMA 2DK8A 1TNTA 1R36A 1USTA 3ABUA 2ZXJA 3GUDA 1G4DA 5BS6A 1R7JA 3OV8A 3F21A 2HKXA 3H3UA 3P9IA 3RYPA 3ZP5A 2QLZA 5E1WA 2COMA 2KKOA 3E6DA 2IA2A 4HV5A 2PN6A 4ZH4F 5LRRA 1O3RA 5K5OA 3QAHA 4G6DA 2JRTA 1O7FA 3J81Z 2DQLA 2ZMEB 2PQ8A 1KU9A 3GFJA 2KJBA 3CUQA 3V7SA 1FPQA 2XUBA 3RPQA 2O6GE 2PMHA 3I5UA 3BJOA 2M5WA 2HYGD 3NEUA 2M1BA 5FLXK 1QO0D 3WTXC 3E5XA 4AIHA 4M74A 4YIFA 3HRTA 2QQAA 1QBJA 1IW7F 4I98B 2K02A 2VC1A 2QM3A 4HF2A 2X4HA 2A6EF 3LA7A 3WG9A 1K79A 2DLLA 2HDCA 4EM1A 4LFUA 5HOOA 4MEYF 1D5VA 4BXUA 4KN7X 1S6LA 2KJCA 4K2EA 2HS5A 5HS9A 3KEOA 1FYMA 1VTNC 5CJ9A 4WK8F 3V7RA 3SXYA 3ISPA 4A0YA 1F1ZA 1L0OC 1R1VA 5DD4A 3K1PA 1WRJA 3JTGA 1SAXA 4I0AA 1HQCA 4KN4X 2AS5F 2R3SA 3WODF 3S2WA 3E6CC 1RNLA 4KIBA 2A6HF 4ESJA 3SQNA 2XAJA 2YX4A 2P8TA 3GWZA 1KU2A 5DCMA 3DQVC 3QP6A 3R61A 2ACJA 3ZMTA 3ZPLA 1IXRC 4M6YA 3C3WA 4UUVA 4I09A 1FSHA 4GYGA 3RIRA 1XB4A 5K1YA 5CVIA 3KP7A 1TW3A 1MD0A 2L54A 2FEZA 2HTSA 3L7WA 1YW9A 1IXCA 4YFKF 2ZFWA 1KU7A 5D8KB 3MCZA 2FNAA 1LEBA 2ESNA 1YG2A 1K78A 1MJBA 1XGNA 3SZTA 1ONVA 1FLIA 1RIOH 2CYYA 1ON2A 1FNNA 1G3TA 1RZ4A 1K6OA 1WSUA 4Y13A 1R00A 2FBIA 3HHGA 3KZYA 2K27A 4MHGA 1F9NA 2H94A 4AIJA 4ZYEA 5TRDA 5IT9K 2MD5A 5ICEA 3HHHA 2YU3A 4CO8A 4I0BA 2ZJ2A 1ZRCA 4FX0A 1S8NA 3I58A 5LHHA 2KIUA 4HX4A 4Z2YA 2GXBA 1HSJA 5D5UB 5CVRA 1G3YA 4WXDA 5D5XB 4A5MA 1GVJA 3F8BA 3J7AO 4Y17A 2CFXA 3H92A 4UHTA 4ZZDA 4AVPA 4HBLA 4ASNA 4MTDA 1K7AA 2G7HA 2VOPA 2BBYA 3RKWA 3WE2A 4IHSA 5HDKA 4AIKA 1OKRA 2Y0MA 3JSOA 3WTYC 2KIFA 5HS7A 1FY7A 3L2CA 1TQPA 1YW8A 2VBWA 4HQMA 4NQWA 2EWNA 3EUHA 1DP7P 3GX4X 1S3JA 4U88A 2VT2A 2EFPA 1IN4A 3O2PE 2HGCA 3BPVA 3H3ZA 5LLQA 2CSOA 2E7XA 2PEXA 2ZNYA 4PDKA 2VE9A 3FZVA 1YW7A 2VODA 3EDPA 4N9HA 5FD5A 1STZA 2FSWA 1H0MA 1FOKA 5E1ZB 3TDUC 1B59A 1C0WA 1YS6A 3ZMZA 5L3BA 3C18A 2BEOA 1OR7A 1ZG5A 4LD5A 3TO7A 3T8TA 2W24A 1HW2A 4KIFA 2ZNZA 2NNNA 2DPUA 3CJNA 3ABTA 4XLNF 2G7UA 3BDDA 5BPIA 1J2XA 2L01A 1AWCA 2L4MA 1FP2A 6PAXA 1ZGJA 1I27A 3F8MA 4HX7A 1LEAA 1TNSA 2F5EA 1H9TA 4EM2A 3BZ6A 1B4AA 3RDIA 3RTRA 5FLXZ 5D6EA 3Q5FA 3CUOA 2LF8A 4M9XA 4ZYHA 2MH9A 2VE8A 2XGXA 2EK5A 5ILVA 5JHUA 2RVCA 4KA4A 5ILUA 1MJAA 4P96A 2MLKA 5J8CA 2P5KA 5F6FA 1FBSA 3FHZA 5L3GA 4ZYDA 2ETHA 4OIPF 2O3FA 2M87A 2HR3A 2MBFA 1FP1D 3F72A 5FD6A 1I5ZA 2OAZA 3P9KA 1QZZA 2PMUA 3U9GA 3CLOA 4LK1F 4IRIA 3IWFA 4HLXA 1YFHA 1I6XA 5D4SA 2CW0F 2KRFA 1XGMA 4A0ZA 3L09A 2YR2A 3KFWX 4L9JA 5L3EA 4L18B 1PUEE 5E18F 1HXDA 4KNYA 3LQRA 4BHPA 3ZN1A 2UXNA 4DQ2A 2RKHA 2L02A 1PDNC 3U1DA 4RGUA 1DUXC 5AIPA 3RPUA 4KIGA 4QLCU 5LGNA 4CZZA 3DEUA 4RGXA 2KIMA 4M72A 1Z91A 3RKYA 4GXOA 4L5JA 5K5RA 2IVMA 4N9IA 1W7PA 3O3KA 4RB2C 2YPRA 4LGWA 1QQIA 3C7JA 2GXGA 3BJAA 2IW5A 1EH8A 3GXOA 4CXFA 4HZFA 3HRMA 2FNPA 2XRNA 2DI3A 5LEKA 1ZYRF 2ELHA 1IUYA 2GA2A 1KYWA 4KMFA 1HKTA 2OD5A 2V79A 4KMUX 4ETSA 3ZMUA 2QVOA 4R8HA 3VEPA 2HWVA 3TO6A 1WQ2A 2VN2A 2RC4A 2HOEA 3CO6C 2EJRA 5LHIA 4CHUA 3GFLA 2BYVE 1UFMA 3I54A 3GYHX 5JI6A 2YSRA 1OYIA 5TJJA 3N97A 2QENA 1UHMA 3REOA 1T98A 3K1NA 3WTUC 2QBYB 1LNWA 3KP6A 1AOYA 2FA5A 5FFXA 3IRRA 5JFRA 1R23A 4MQ9F 4OIQF 4IVNA 4OU0A 1TTYA 3WTZA 1S7AA 1SD6A 1DPRA 3VB2A 1HW1A 3ML6A 2FXAA 4WCGA 2G9WA 2P6TA 1MJ9A 4EJUA 2D1HA 4EJTA 1LDKB 3F22A 3E5QA 2Q0OA 4G6QA 3KP3A 2XVCA 5KK1A 2L3DA 3MZYA 1T6SA 4I7HA 4B8XA 3IC7A 3Q9VA 1GHCA 2HQNA 2E7WA 2ZKZA 1BIAA 1R5GA 5HLGA 3WTWC 1WI9A 1IN5A 2QQ9A 3K9TA 2DPDA 4RGRA 4MGRA 3JAMK 3LAJA 3P9CA 3R0JA 1ZN2A 4BYYA 1OYWA 3L00A 1J0RA 3GVAA 4U7BA 1WWXA 3CUQC 5D8LB 5J6XA 5CVJA 2A3SA 3GEZA 3HTUA 1P6RA 2GIVA 2IPQX 3J80K 3IL2A 3KP2A 2F5FA 1XDSA 1J59A 2HQRA 1Z9CA 5DDGA 1RI7A 2VT3A 1W4MA 2DO7A 1ZG3A 1HKSA 2A61A 1Y0UA 5DD8A 2W57A 2LF7A 2OA4A 2O8XA 3B02A 3IWZA 3NRVA 5BOXA 4G7ZF 3LA2A 5BMZA 5F64A 3TOAA 3TO9A 4L0ZB 2EV6A 4RB3C 4P5OA 1I1GA 3FXUA 1Z6TA 3HIFA 4L5IA 2MLGA 3N4MA 5A2QK 2PJPA 2STWA 4O3MA 2LNBA 2GA1A 3CO7C 4HAMA 1KQ9A 1B9NA 3CDHA 3T8RA 3V8LA 1UB9A 1FX7A 5D6FA 3K1MA 2ISYA 2JT1A 1CF7A 5F1RA 5LBQA 1BBYA 3I59A 4UXNA 2HYFA 4MEXF 1FC3A 4RS8A 4YIIA 4IXAA 1REPC 2P5LC 2K7LA 3FMQA 3WU1B 2ESHA 4XSXF 3I59B 5D5WB 1BI1A 2QYOA 4ENKA 3D5LA 2OQRA 1ZHFA 4XBFA 2P7VB 5ILSA 3BROA 3FWEA 3M7GA 3P7NA 2NAZA 1OPCA 2VBXA 4MQVA 3DV8A 1EV7A 4L0YB 2FMYA 3KP4A 1ZLKA 2QWWA 3GW2A 5FFZA 1IRGA 3DKWA 3PFIA 3WE3A 4LLLA 4A0XA 1R1TA 5DYMA 3LQQA 2H6BA 2IP2A 3KZZA 5IT9Z 3DFGA 1U5TC 3V7CA 3BY6A 1LDDA 3F8FA 4MNUA 1R1UA 2BGCA 4D0PA 5L3DA 5FGMA 3F23A 2ADUA 4R1HA 1Q1HA 4FHTA 1UHWA 2P7CB 2QQBA 4HF1A 3HRUA 1JGSA 3MFKA 2XAGA 2EFNA 3GO5A 4BNCA 5E17F 2M45A 3NQOA 3F6VA 1EH6A 1SFXA 3PQJA 2OBPA 5HDNA 1MDMB 5D5VB 1E2XA 1FZPB 2J5OA 2DTRA 5E8GA 4WWCA 3DP7A 4HX8A 4G9YA 3F8CA 1FBUA 1WKMA 1SFUA 3I53A 2FMLA 4A5NA 4DNCA 1XD7A 2CG4A 5HDGA 2NRAC 2M30A 3KE2A 2V6CA 1BM9A 2R7DA 1U5TB 4OOIA 4M9ZA 1G3SA 1V4RA 1D3YA 2VXZA 2VOOA 4HW0A 1Z1DA 2FRHA 1E17A 3HOTA 3M1EA 3I0TA 3E6MA 1IAWA 1W5TA 4EGZA 1F5TA 1HBXG 2C6YA 2PG4A 3F6OA 3SFZA 2A07F 1O57A 3EQLF 5JVTA 2RQPA 1YO5C 3AAFA 2H27A 1B1BA 2W85A 4L9VA 4IJAA 3K2ZA 4CYDA 4KFCA 1FYKA 5LGUA 3ROUA 3HSFA 2VC0A 4BAYA 3IKTA 4LMYA 3V8JA 2O61A 1IN7A 3WTVC 1D8KA 1Z7UA 2JPCA 2RNJA 1O7LA 2XAFA 1P2FA 2LDUA 3E97A 4S05A 3FF5A 4EV0A 3JSPA 3FXRA 4HV6A 4LB6B 2W25A 1J75A 3MEXA 4G8XA 2CQKA 2OZUA 1B9MA 4JK1X 2GZWA 3IRQA 1FSEA 1S29A 1XMKA 4LK0F 2D1VA 2V1XA 4LG0B 2IA1A 3J81K 2V9VA 1SD4A 1HKQA 1TQIA 2EA2A 4LLGF 1R5HA 1TW2A 1KQ0A 1U6GA 3TOBA 4I02A 2FU4A 2Z99A 4GCVA 4WF2A 5AIQA 5D4RA 3BWGA 2BE5F 5CVUA 5HS8A 1U8RA 3BJ6A 1BI2A 3CUQB 3LA3A 3BPXA 4UV9A 2XROA 2PFBA 4ON0A 4PGGA 2Q8KA 1ZLJA 3K69A 3E3VA 1JHHA 2IT0A 1D8JA 4UNOA 2HKOA 3DXJF 1GXPA 2DT5A 4E70A 3D0SA 5H6RA 5J8FA 3ZN0A 2EA4A 4MTEA 2ZBKA 4I01A 4EQQA 1FT9A 2XIGA 2Z5UA 4P55A 2FE3A 1YTYA 4HYEA 1BI3A 2XKOA 3ZMSA 3RYRA 4EJVA 1QZYA 3ELKA 2NS0A 3J80Z 1ODDA 4HOBA 1IN6A 3W6KB 4CICA 3EETA 5H20A 3RI4A 3TQNA 3IHUA 4GYIA 2Z9OA 3O6BB 2P6SA 3HRSA 4H0EA 2VBZA 1H9GA 1Z05A 1T38A 4Q4ZF 3WGGA 3KLOA 2OQGA 4B09A 1KYZA 4KYWA 4Y15A 5BPDA 1G6NA 3TKYA 3HSRA 3SHFA 3T1BA 2Y48A 3QU6A 4IF4A 3T5XA 1XMAA 1FWZA 3GZ6A 4ENJA 2A5YB 2VONA 2LKPA 4UVAA 4XSZF 4G7OF 2JSCA 2XHKA 4OMZA 2K4JA 2DK5A 4Q48A 1TQMA 2XV4S 1DDNA 2B0LA 4U0WA 1U78A 5DCFA 3G73A 2UZKA 3U2RA 1XN7A 4A6DA 1ZRDA 1LDJA 3QOPA 4XLPF 5FB2A 1O3SA 3MAJA 4N0BA 4R79A 2A68F 1XSXA 4HF0A 4QWQA 3F8NA 4A2UA 2D45A 3GLXA 2M8EA 1OYYA 3JAMZ 3QPTA 1BN5A 4GO1A 1DPUA 4UVCA 1YLFA 2QUFA 2UWMA 2J5PA 3FX3A 1U5TA 4GGGA 3WTSC 1XSDA 5E1XA 1PP7U 4HQEA 2MA3A 3COAC 1ZRFA 1IRFA 2P4WA 1BOAA 4U0YA 3QP5A 3K0LA 5DEQA 2E1CA 1X3UA 2FQ3A 1YQAA 1ZG1A 4RGSA 3ZQ7A 5ICCA 2HEOA 4ZZLA 2EFOA 2O0YA 2RV8A 4KICA 5AONA 3DPTA 3B73A 3GF2A 1BC8C 1ZARA 2XAQA 1XCVA 1LB2A 4Q5SF 2H09A 2XAHA 2YX7A 3WU0A 5IT3A 5CLSA 3HOSA 2V1DA 4WXHA 2WC2A 4ENNA 3EYIA 4S04A 1KGSA 4G94A 3ECHA 2RDPA 1P4AA 3QPHA 4U7DA 1O3TA 2E1NA 1IN8A 1MGTA 4F7ZA 2PLYA 4JBAA 3VOEA 2NNYA 1KU3A 4HA8A 1EH7A 1ZAOA 3MZHA 4EJOA 2WTEA 5ICGA 1FYLA 3VFZA 3JTHA 4CDGA 4P9FA 4ZYGA 3ZMVA 1LJ9A 2FBHA 1FBQA 4P9UA 1TBXA 1JHFA 3R0AA 2CO5A 2FF4A 4M71A 3WTTC 2VBYA 1QGPA 2O03A 4YG2F 5LGTA 5L3FA 3R6SA 5JR3A 3C1DA 3TDZC 1KA8A 5DUIA 1J9IA 2DAOA 2ZCWA 4ESFA 3HUGA 2F5CA 2L4AA 1HSTA 2LSOA 4CGZA 1RUNA 3EYYA 4WX9A 1CF7B 3JW4A 1IF1A 2ZO4A 4BHBA 1T39A 1T0FA 4YFXF 4LJZF 5LEJA 2WWYA 5LHGA 3W6JB 1U3EM 4OMYA 1ULYA 3MWMA 2Y75A 4HDVA 1XSVA 2HFHA 2WV0A 2AXLA 1JE8A 1QPMA 1SD5A 2QZ8A 4TV7A 3IKVA 2FBKA 2D2WA 5E20A 1S7OA 4UVBA 3ECOA 4NB5A 2IRFG 2Q2EA 3ZMDA 1SFEA 2P5VA 3GZ5A 4YFNF 1YYVA 1USSA 4XRFA 1W5SA 2MC3A 4PZJA 4AWXB 2DFIA 1ZREA 4IHTA 1LQ1A 2CWEA 4HDUA
chains in the Genus database with same CATH superfamily
3QU3A 4KDPA 2NYXA 4OIRF 4Q47A 4RB1A 1HW5A 4FETA 1BIBA 3TGNA 4D5FA 3M8EA 2HZTA 2STTA 1B6AA 2OCEA 1A04A 3E6BA 3LFKA 2L9RA 3WGIA 1RETA 5TISC 4KT5C 3LSHA 3GFIA 3MKLA 3HKZN 2DMQA 1MSEC 3PM1A 5A2QZ 1NK2P 4EJWA 1UELB 4IRHA 2ISZA 1SANA 2EV0A 3PQKA 1W7PB 2HDDA 1APLC 4IPAA 5F08A 1TWCJ 3LSTA 2DOEA 4WXCA 4BH9A 4IKFA 1K78B 4IL6C 1VFCA 5GADJ 3VDXA 4XMYA 1BJAA 2ME0A 4HNTA 3KETA 4O5VA 1ENHA 1OLTA 3PNTA 4RB0A 4IOAF 2JTVA 2O7OA 4FT8A 2CGPA 3R60A 4F52A 1YX3A 4PFOA 4JQFA 1R22A 2CV0A 4C2UA 2DBBA 2NOGA 3HYIA 5BQTA 1OMIA 1IDYA 2V9KA 1NHAA 1QVTA 1YS7A 2EFQA 5HLIA 1MMSA 4LIUA 1QU3A 1GV5A 2W7NA 2VASA 2EH3A 3CJQB 3FMRA 5EG0A 3DPLC 4HLYA 3AKZA 1YIOA 1OCRH 1LVKA 2RN7A 4A6EA 3L1PA 5LRSA 5DV5A 2VIXA 5HNHA 1WJBA 2EFWA 1IRXA 1JJ8C 2PBIA 4L9NA 1VQ5I 4BL0B 3K2AA 2IXSA 1E3PA 1WPKA 3A1YA 3OR1C 4GFBA 5HLHA 5J1RA 2BVMA 5JLXA 2XASA 2H6CA 5B1AH 2JPBA 1FTTA 2OU2A 3BOQA 3I71A 1P4WA 2FOKA 2K4BA 4EMSA 1SMYF 4C3JJ 2K3FA 4FX4A 5FLMJ 3HTSB 3QYBA 2RGVA 2VKVA 3CCRI 1MZBA 3BG6A 3M8FA 3OOPA 2BV6A 1MBEA 4QTRA 2IJLA 3H5AA 1LVAA 5HVQC 2R7FA 4NHJA 2RAEA 3FM3A 3KCCA 2E36A 4A93J 4V2GA 1VI0A 2MH2A 4L9TA 3WHCA 4LB5A 4QPQA 1YJ9I 2QBYA 5M5YJ 1IXSB 3OYIA 1SD7A 1XCBA 1R58A 5EEGA 1F4KA 3WGHA 3KPHA 3T0YA 1XGSA 3RJPA 1DQUA 2Y9ZA 2HOAA 3QRFF 2M4GA 3C2BA 3DF8A 2QKLB 3CCQI 5GAEJ 4KUMA 4IEJA 5K5QA 2JA6J 1ZTRA 3VODA 3F3XA 4ENMA 3VWBA 1IC8A 4D7MA 3GMEA 4EGYA 1TLHB 2KZVA 3KLNA 3M9AA 3R4KA 3CCUI 2HVQA 3FMSA 2Z33A 2G0EA 5DUKA 1PYVA 4OIOF 3KZIC 1BR1A 3G6EI 1MNEA 1Y39A 1GXQA 1I1SA 2JSPA 1RUOA 3SEQA 5GTIC 3I64A 1ZKGA 2E60A 1VNDA 2HTJA 4XNFA 4PCQA 2DMNA 4ESBA 3W2WA 3FM5A 5ED4A 2CUJA 5DM7F 2EV5A 5EEHA 4LG0A 1MMGA 5C3EJ 3LSMA 4NUBA 2TDXA 4BQOA 4XLCA 2H8RA 4E7SA 4XORA 3K70D 4IRGA 1D1BA 1P7JA 3L9FA 2KLOA 4HEA2 4G7HF 3GFMA 1K6YA 3OYJA 2KRHA 1AU7A 3BP8A 4BEHA 3UKGA 4RA2A 3KEQA 4EVIA 3KYCB 1XGOA 2JN6A 1UCRA 3MQ0A 1JXSA 1BC7C 2ICWG 4O6JA 2DW4A 4M6XA 2DQRA 2ECCA 1IZ1A 2IA0A 2BXYA 2ZMEA 4XONA 3V8KA 1X58A 3ZGKA 5CVVA 1NH3A 4RAYA 1S9HA 2X1EA 2PJRB 1QVUA 4UV8A 4C2MJ 3CMEI 2R93J 3BR6A 1O3QA 1TC3C 4LLNA 2PI0A 1CGPA 3FXQA 2F5DA 5H6QA 3BCAA 3SZPA 3KYLA 2WAQA 3CJRB 2DA3A 3V4GA 5B5EC 3HB9A 2LKSA 4CSWA 4OINF 3OR2C 1J7KA 2E2IJ 3PUBA 3D5RC 5L3CA 3PO2J 4OAYA 2F5VA 2KZGA 1RC9A 1QNTA 1L3LA 3HM5A 5DM6F 2K86A 4I2OA 2GWRA 5DCMB 3I4PA 4PGHA 3FXKA 4M73A 5CYVA 2VI6A 4M6VA 3A01A 1NG6A 3HOWJ 1MBJA 2XGEA 2DDAA 4EM0B 1IJWC 1DU0A 5FROA 1X1CA 2EPFA 2DU9A 1Z6RA 4AUXA 1ZGWA 1S72I 3TW7A 2IGKA 1LE8A 1J5YA 3E5UA 1ON1A 3Q9SA 1KZHA 1UG0A 1SMTA 2F2EA 3K4JA 4HSRA 3RKXA 4AD9A 1T2KA 1W7PD 4U0VA 2FQ4A 3CCMI 1RKWA 2HXOA 5ICFA 3MN2A 3K4NA 1BA5A 2CH0A 3ERED 4BQAA 2LMDA 3KP5A 3DBHB 1Y1WJ 1BI0A 2X0LA 2A6TA 4NBQA 1MDMA 1ZGAA 1JUPA 1MMAA 5LD2C 2IGMA 1YJNI 2E1MC 2PX9A 1P4XA 5KVRA 1U2WA 3G3ZA 3GCMA 5ERIA 3LAPA 4NC8A 5E8IA 1XDUA 4MFDA 4PK4A 3CTAA 4CH7A 1PP8F 2XKPA 4BHCA 3JRGA 1MBKA 2A69F 2CS3A 1A36A 2V1UA 3S93A 3HSEA 4RAZA 2W84A 4I76A 3LSKA 3TL4X 3ULQB 4DYRA 2Z3YA 3CP8A 5BNGA 2VQGA 1G3WA 2GAUA 1K83J 2GQQA 2DFFA 1ZH5A 2EIJH 4A12A 1P92A 2HDWA 2EB7A 4M9SA 5B66C 2JZYA 3LWFA 4RAFA 1T8IA 2UXXA 1V3FA 1T33A 2LP0A 2OZ6A 1KQ8A 5FO5A 1WCMJ 1RR8C 1JI8A 1DU6A 1MKMA 5KNLA 2IS1A 3SEZA 3OYBA 2DK8A 1TNTA 2HPIA 2DN0A 1R36A 1USTA 3ABUA 3MVPA 4PJJA 2ZXJA 2DOFA 1X1PA 3GUDA 1G4DA 5BS6A 1R7JA 4DYQA 4A3IJ 3CDIA 3OV8A 2XF7A 3F21A 1WJAA 2A05A 2HKXA 4N4NB 4F92B 3H3UA 3P9IA 2D5VA 1AKHB 3RYPA 4RAGA 3ZP5A 3PNVA 2DFHA 2QLZA 3HOVJ 1Z67A 2E1MB 1SVOA 5E1WA 2COMA 4BACA 4YIRX 3HZJA 2KKOA 4CA0A 3H5RA 2RQQA 3E6DA 2IA2A 4HV5A 1Y0NA 1T08B 1WFXA 1OCTC 3OSFA 2PN6A 4F93B 1X3WB 4BEHB 4ZH4F 5LRRA 1O3RA 5K5OA 2QQ8A 2FUG2 2WAQN 2L7MP 3QAHA 2CMPA 4G6DA 2JRTA 1O7FA 3J81Z 2DQLA 2ZMEB 2PQ8A 1KU9A 2OTJI 3GFJA 2KJBA 3FK6A 2DA2A 1X2NA 3HOZJ 5C4XJ 2E34A 4B3XA 3CUQA 3V7SA 1FPQA 2XUBA 3RPQA 3CCSI 4E7ZA 1A6IA 2PMHA 2O6GE 1TWAJ 3S16J 3I5UA 1G8XA 3BJOA 2M5WA 2HVRA 2HYGD 4A3JJ 3NEUA 2M1BA 5FLXK 1QO0D 4V2FA 3WTXC 4B4CA 1FOWA 1X4OA 3E5XA 4HPQA 4BBRJ 4AIHA 5CPRB 5EJCA 4M74A 1Z7LA 3HRTA 4YIFA 4II3A 3QODA 2QQAA 3PSIA 1QBJA 2VKEA 1IW7F 3S1QJ 2LC2A 2BY0A 1QA6A 5LFAA 2L2OA 4I98B 2BZTA 3HXLA 2XSJC 5J1YA 3H36A 2K02A 2VC1A 2HI3A 2R7UA 2QM3A 4HF2A 2X4HA 2TCTA 1IRZA 2A6EF 2N8GA 3LA7A 3WG9A 2R7TA 1K79A 1BL0A 4B1RA 3Q3SA 2E1OA 2DLLA 2M3AA 1D1CA 3M4OJ 2HDCA 2XF6A 1WJ5A 4XRMA 3GTOJ 4EM1A 4LFUA 5HOOA 2IS6A 3AG4H 4MEYF 1LPQA 1D5VA 4BXUA 3HKZA 1BW6A 3OS2A 4KN7X 1S6LA 2KJCA 3JRIA 4BJ6C 4M3DA 4K2EA 2HS5A 2NOJB 1D5YA 5HS9A 3KEOA 2RREA 1Z77A 1FYMA 2VPRA 4A3CJ 3CJTB 3GLLA 3L2QA 1VTNC 4XRSA 4E7IA 5CJ9A 4WK8F 4A3FJ 2CQNA 3V7RA 3SXYA 3ISPA 1LUJB 4CUGA 4A0YA 1F1ZA 1L0OC 1R1VA 5DD4A 3K1PA 1WRJA 3JTGA 3OYNA 1SAXA 5DS9A 4EEFG 1VQOI 3FBNB 2E2HJ 2LKXA 3DEWA 4I0AA 1HQCA 2UV1A 4KN4X 3OYEA 2R3SA 2AS5F 3WODF 3S2WA 2H1KA 3E6CC 4AC0A 4OWRB 3S2DJ 1MW7A 1FMWA 1RNLA 4KIBA 2ZJRF 2A6HF 1LE8B 3L2UA 4ESJA 1ETOA 3SQNA 2HU9A 4S0HB 3SYTA 1N77A 2XAJA 2YX4A 2P8TA 1ETVA 3GWZA 2ME6A 1KU2A 2W4SA 3X2QH 2ZXIA 3DQVC 3QP6A 5DCMA 3R61A 2ACJA 2PMZA 4ITVA 4J01A 1XC5A 3ZMTA 3ZPLA 4DW6A 1YE9A 3KEYA 2X48A 1IXRC 4M6YA 2FJ1A 2WY8Q 4LOCA 1JKPC 3C3WA 3SJMA 1F43A 3JRBA 4UUVA 4I09A 1FSHA 3C2GA 2DA4A 4GYGA 3RIRA 1XB4A 5K1YA 3BC8A 3RQ4A 5CVIA 3KP7A 1TW3A 2OC6A 2VXDA 1MMDA 1MD0A 4FE4A 9ANTA 3BLYA 2L54A 4CYCB 3HDDA 2FEZA 4MFEA 2HTSA 3L7WA 1YW9A 5H2FC 3JR9A 1IXCA 4YFKF 2ELJA 3EUKL 2ZFWA 1KU7A 5D8KB 3MCZA 4ZDPA 3HG9A 2FNAA 1LEBA 2ESNA 1YG2A 4L5EA 2Z2SB 1K78A 3QYEA 1MJBA 1XGNA 3SZTA 1ONVA 1FLIA 2XPWA 1RIOH 2CYYA 1ON2A 1FNNA 1G3TA 2DOAA 3CC2I 3I4NJ 3FDYA 2EILH 5F04A 1RZ4A 3HEFA 1K6OA 2XC7A 1YI2I 1WSUA 2WAFA 4FE7A 4W97A 1PJRA 4BY1J 4Y13A 4E6KG 1R00A 1MBHA 2X6WA 2FBIA 3HHGA 3KZYA 4XKWA 2K27A 4MHGA 4DZJA 1Y56A 1F9NA 2H94A 3KYDB 2Y2ZA 2MGQA 4AIJA 4MIMA 4ZYEA 5FJ8J 5TRDA 2GOXB 4XIDA 2XGCA 5FRNA 2JA2A 5IT9K 1ETWA 2MD5A 3CMMA 5ICEA 4LG3A 3HHHA 2YU3A 4CO8A 4I0BA 4DBRA 1GT0C 2ZJ2A 1ZRCA 2E5ZA 2AQEA 2DMUA 1GV2A 4AIDA 4FX0A 2K40A 1S8NA 4JP0A 1MNDA 4BXXJ 2IGOA 3I58A 2B9SA 2Y30A 5LHHA 3BZCA 1ACIA 1S5LC 2LR8A 2KIUA 4HX4A 4Z2YA 2WY7Q 2Y0SA 2GXAA 4CCNA 1R9TJ 1SVLA 2GXBA 1HSJA 5D5UB 5CVRA 1G3YA 4WXDA 5D5XB 3CLQA 3DTKA 2IEKA 4A5MA 2KISA 1WH7A 1T56A 1GVJA 3F8BA 1SFOJ 1Y1VJ 2CUZA 3J7AO 3K4CA 1IV6A 3H9JA 4Y17A 4XN0A 2CFXA 3H92A 4UHTA 4C30A 2K9LA 4ZZDA 4AVPA 2HNHA 4HBLA 4E7JA 4ASNA 3DLLF 4XR6A 3VPRA 2R7QA 4IZZA 3G1OA 5F0FA 5HLTA 5E3NA 2V6EA 4MTDA 1BOBA 2BY3A 2JVGA 1K7AA 1EA3A 3PJRA 3BQZA 2G7HA 2VOPA 2BBYA 3RKWA 1VQPI 3CCVI 4BKXA 3WE2A 4IHSA 5HDKA 2WV1A 4AIKA 2LBFB 2GIZA 2JRMA 1FTZA 1W5CC 2JJ7A 4BE2A 4A3GJ 1OKRA 2Y0MA 3HJEA 3WTYC 2KIFA 5HS7A 3JSOA 1A35A 1FY7A 3DBRB 1B72B 3L2CA 1TQPA 3OIPA 1YW8A 1ZK8A 2VBWA 4HQMA 1RRJA 1POGA 1T95A 2OCCH 4BU2A 4KJZA 3ZR8X 4NQWA 4UUSA 4X1EA 3S14J 2EWNA 3EUHA 1DP7P 3GX4X 1S3JA 1ETKA 4U88A 2XGDA 3OIOA 2VT2A 3ABKH 2EFPA 2E5NA 1R5ID 1IN4A 3O2PE 2HGCA 3BPVA 3A0BC 3OL3A 2R92J 2ZXWH 5GAGJ 1ETYA 3H3ZA 3RQIA 5LLQA 5HODA 2CSOA 1VQKI 2E7XA 2PEXA 2ZNYA 4PDKA 2VE9A 3ZRGA 3FZVA 2DA6A 1YW7A 4J00A 2LYCA 2VODA 3AG3H 3ZXSA 2FOWA 3EDPA 2LY1A 4N9HA 2MYSA 5FD5A 1STZA 2FSWA 1H0MA 1FOKA 5E1ZB 2X85A 1V54H 3BTCA 2XB5A 2VQLA 3TDUC 1FJLA 5GAHJ 4IQ4A 1B59A 1C0WA 3GBGA 1YS6A 4A3KJ 2EQRA 3ZMZA 5L3BA 1EKEA 3C18A 2BEOA 1OR7A 4Y33A 1ZG5A 3H3VK 4LD5A 3TO7A 3T8TA 2W24A 1HW2A 4KIFA 4AVZA 2ZNZA 2NNNA 1ITYA 2DPUA 4NC7A 1B8IB 5M5WJ 2BHYA 3CJNA 3ABTA 1JT0A 3NWTA 4HG2A 4XLNF 2G7UA 3ABMH 4QSHA 3BDDA 5BPIA 5C44J 1J2XA 2FX0A 2L7ZA 2L01A 1AWCA 2LREA 4XKVA 2MD0A 3OYLA 2QKMB 2L4MA 1FP2A 3ZQIA 6PAXA 2O5RA 1SVMA 4B3AA 3W6VA 3AL0C 2W48A 5E3LA 3M07A 2ZFUA 1SC7A 4JYKA 1ZGJA 5E3OA 1I27A 4A3BJ 3F8MA 2XPUA 4HX7A 3PL8A 1LEAA 1TNSA 1ETXA 2F5EA 2CW8A 3I55I 1H9TA 3GZNB 2BXZA 4EM2A 3BZ6A 1B4AA 3RDIA 3RTRA 1PVEA 3F0CA 4XK4A 5D6EA 5FLXZ 3Q5FA 2MSYA 4BE0A 3CUOA 4JX4A 2LF8A 4M9XA 4ZYHA 3ZQFA 2MH9A 3S17J 2VE8A 2OUMA 2XGXA 3HOYJ 2EK5A 1MBFA 3SDBA 5ILVA 2F6CA 5JHUA 4D5CA 2X1DA 3EUAA 1JKRC 1PUFA 2VQHA 2CQQA 3MKYB 2EZIA 2RVCA 3CCEI 3OOUA 2CFOA 4KA4A 5ILUA 2GLOA 2VQCA 4C9YA 2LLKA 4PJNA 1MJAA 4P96A 2VLAA 2HOTA 2KPMA 2DT6A 5E79C 2MLKA 5J8CA 1I3QJ 2P5KA 3IAM2 1CQTA 2E2JJ 5EYRA 1FBSA 5F6FA 4B43A 5J47A 3A03A 3FHZA 2P81A 1R4MB 5L3GA 4ZYDA 2ETHA 2X51A 4OIPF 3CCJI 2O3FA 2M87A 2HR3A 2KRCA 2K9QA 3LMMA 2KMUA 1U9OA 2VJ4A 2MBFA 2NVYJ 2H8WA 3ASOH 3FKIJ 1FP1D 3F72A 1WVRA 5FD6A 1I5ZA 5GTHC 2CQXA 3HOXJ 2OAZA 4IHWA 1R71A 3P9KA 1QZZA 1WJCA 2H1LA 2KQRA 2PMUA 4A69C 3U9GA 2MG4A 2NVXJ 3CLOA 4LK1F 4IRIA 1A31A 3BTIA 5GPCA 3IWFA 4A3MJ 3BG9A 4HLXA 1YFHA 2EZHA 1I6XA 5D4SA 2VPLA 2CW0F 2KRFA 2K9SA 1XGMA 4A0ZA 3L09A 2ZSHB 3CMYA 2YR2A 3KFWX 4L9JA 2EIMH 2P0WA 5L3EA 4L18B 1YRNB 4ZTJA 1QHHD 1PUEE 5E18F 1HXDA 4KNYA 3LQRA 4BHPA 2CUFA 3ZN1A 2UXNA 2Y9YA 4BS9A 4DQ2A 2RKHA 2L02A 2QF7A 3K4MA 4A3EJ 2HZDA 4D9JA 1PDNC 4M3EA 3U1DA 2QSHX 4RGUA 2LOOA 5AIPA 1DUXC 1XG1A 3RPUA 4KIGA 1N78A 3UNGC 4QLCU 5LGNA 3H0GJ 2K9MA 4CZZA 3DEUA 3VYUB 3RZOJ 4RGXA 1A5JA 1IUFA 2KIMA 4M72A 1Z91A 3RKYA 4GXOA 4L5JA 5IPAA 5K5RA 2IVMA 4N9IA 1W7PA 3O3KA 4RB2C 2YPRA 4LGWA 3A2KA 1I50J 5EZHA 1QQIA 3C7JA 2WB1N 4F3QA 3S8PA 1T0FC 2GXGA 3BJAA 2IW5A 1EH8A 5EGOA 3GXOA 1I3AA 4CXFA 4KT6A 4HZFA 3HRMA 1H88C 1DGRM 2FNPA 4XLFA 2R7RA 2XRNA 2DI3A 5LEKA 2ZXHA 1UHSA 5HNFA 1ZYRF 2ELHA 2L7KA 4XLHA 1IUYA 2GA2A 1KYWA 4KMFA 1HKTA 3JRAA 2OD5A 2VJIA 2DA7A 4XOPA 2V79A 1WJEA 4KMUX 4ETSA 3ZMUA 2ZJQF 2QVOA 2CJJA 4R8HA 1NK3P 2HWVA 3TO6A 2VN2A 1WQ2A 3SDGA 3VEPA 3OYCA 2RC4A 3HBLA 2R7OA 3G71I 2HOEA 3QPLA 5J40A 2VL8A 1EF4A 3CO6C 1IO2A 2EJRA 2W00A 2JQ7A 5LHIA 4CHUA 3GFLA 2BYVE 5KHDA 1UFMA 3I54A 1I6HJ 4OAZA 3GTKJ 3DBLB 2LD5A 3GYHX 5JI6A 2YSRA 3Q0VA 1OYIA 3FXMA 5TJJA 3N97A 2QENA 1UHMA 3REOA 1T98A 3K1NA 3WTUC 2QBYB 1LNWA 1OJLA 1G59A 3KP6A 1AOYA 2AQFA 2FA5A 4EATA 5FFXA 3IRRA 1E3OC 5JFRA 1R23A 2KDZA 4MQ9F 2BW3B 1AA7A 3AG2H 4OIQF 4IVNA 1VZ0A 1LKXA 3LOCA 4IHVA 4OU0A 1TTYA 3WTZA 3WG7H 1S7AA 2CW7A 1SD6A 2IS2A 2PMZN 1BW5A 1DPRA 4MO7A 3VB2A 2IAIA 1HW1A 3BZKA 3S3OA 3H0DA 3ML6A 2FXAA 4WCGA 4E7HA 2G9WA 1QHGA 2P6TA 2CU7A 1UAAA 1MJ9A 4RM2A 4EJUA 2D1HA 4EJTA 4B44A 3H9QA 1LDKB 1XPXA 3F22A 3E5QA 2Q0OA 2Q1ZB 4G6QA 4RM3A 1TWHJ 3DU5A 3KP3A 2XVCA 2VUMJ 5KK1A 2L3DA 1EJ9A 3MZYA 1T6SA 3J7AY 1HDPA 2R5ZB 1V5FA 1NG7A 4I7HA 1OFCX 4B8XA 3IC7A 3Q9VA 1GHCA 4U87A 2HQNA 2E7WA 4XLEA 1O4XA 2ZKZA 1BIAA 1R5GA 5HLGA 2OF7A 1W0UA 3A01B 2DT7B 3WTWC 2XPVA 1WI9A 2R7SA 2DODA 1IN5A 4Z6YA 3QWLA 2QQ9A 2Z1DA 1YIJI 5J1UA 2NS8A 3K9TA 2DPDA 4RGRA 4JOMA 5JHFA 4MGRA 3JAMK 5IY5H 3LAJA 3P9CA 1OR7C 3HGYA 3MKZA 3VYTB 3R0JA 3ZCOA 2ZJPF 1ZN2A 5TGTA 4BYYA 2ZC2A 1OYWA 2A5WA 3L00A 1JTYA 1XS9A 3G4SI 1J0RA 2M0MA 3LNQA 4ZYAA 5F27A 3GVAA 4U7BA 1WWXA 3CUQC 4D1QA 3M8JA 4YELA 5D8LB 3M1CA 5J6XA 5CVJA 1HLVA 4IQJA 2A3SA 2JMWA 3GEZA 1DGWY 3HTUA 1P6RA 3ZQCA 2GIVA 1OCPA 2IPQX 3DWLE 3J80K 3IL2A 3CCLI 3KP2A 2F5FA 1XDSA 1J59A 2HQRA 3OL4A 4PFPA 1X1DA 1Z9CA 1RKTA 1K61A 3H35A 5DDGA 1RI7A 4HNVA 2RNGA 4RDUA 2VT3A 1W4MA 2DO7A 5B1BH 2GOMA 1ZQ3P 3AFHA 5JLWA 1XTAA 5KAFC 1K4SA 1VQ6I 5DTDA 1ZG3A 1HKSA 1Y0UA 2A61A 5DD8A 2W57A 4FISA 2LF7A 3WHBA 5IP7J 2OA4A 2HOSA 4KITB 3S3NA 2O8XA 1LFUP 3RSNA 3B02A 3IWZA 3K7AJ 3NRVA 5BOXA 4G7ZF 1Q1VA 3LA2A 5BMZA 3LL7A 5F64A 3TOAA 3TO9A 4KISA 3BR3A 4L0ZB 2EV6A 4RB3C 3N05A 1MH3A 3L2VA 1Z3XA 4ANJA 4P5OA 4PJLA 3A4CA 1I1GA 1N25A 3SZGA 5M5XJ 3FXUA 2QSFX 1Z6TA 3HIFA 3VSKA 1VQ8I 4L5IA 2MLGA 3OYDA 3D5SC 3JCUC 3S15J 2FD5A 3N4MA 5A2QK 2OTLI 2PJPA 4D7NA 2STWA 4O3MA 3W2AA 5EGOB 2L9VA 2GA1A 2LNBA 3CO7C 4HAMA 1KQ9A 4PSWA 1X1BA 1B9NA 3CDHA 1QRYA 3IH2A 3T8RA 3V8LA 1R49A 1UB9A 4M3FA 1FX7A 1BR2A 2VB6A 5D6FA 3K1MA 2ISYA 1E3HA 2JT1A 1CF7A 5F1RA 5LBQA 1BBYA 3I59A 1NTCA 4RLFA 2BY2A 4UXNA 3HC7A 2CV2A 2NVQJ 2HYFA 4MEXF 5FKOA 1FC3A 3M3YJ 3BR1A 4RS8A 2HPMA 4YIIA 4IXAA 1REPC 3TW6A 3OS1A 2P5LC 2JK3A 3GTQJ 2K7LA 3FMQA 3A0HC 4CYCA 3WU1B 2ESHA 1D0ZA 4XSXF 2XAUA 3I59B 5D5WB 4XRSG 1BI1A 2QYOA 4ENKA 1WGXA 3D5LA 2OQRA 4ZDLA 1ZHFA 2DDBA 3KX2A 4F91B 4XBFA 2KL4A 1RR7A 2P7VB 3NARA 4XKBA 3BROA 3FWEA 3M7GA 3P7NA 5ILSA 2NAZA 5IYDJ 2YUSA 1OPCA 2VBXA 4AU7A 4AYBA 4XQFA 4MQVA 3DV8A 3IP4B 1EV7A 4L0YB 3E0JB 1IV8A 4FQGA 3JRCA 4Y7NJ 2FMYA 3KP4A 4C3HJ 1ZLKA 3BTJA 2V9PA 2JUCA 2QWWA 3GW2A 5FFZA 1IRGA 3DKWA 1D0YA 3OYKA 4IHXA 3DEEA 3PFIA 3WE3A 3CD6I 1Y8RB 4LLLA 1HOMA 1MH4A 4A0XA 2E35A 1R1TA 4I99C 5DYMA 3LQQA 4XM3A 2H6BA 3I9V2 2IP2A 3CDLA 3KZZA 1WZ2A 5IT9Z 3DFGA 1U5TC 1X2MA 2E19A 3V7CA 1KONA 3CZ6A 1WHUA 3BY6A 1LDDA 3F8FA 3GTJJ 3W2VA 4MNUA 1R1UA 2BGCA 4CCKA 5FKMA 4YRVA 3JRFA 4D0PA 5L3DA 5FGMA 1U8BA 3F23A 2COBA 2R4GA 4BDZA 2F48A 2EZLA 2ADUA 4XKCA 2ID6A 5M3MJ 4E7LA 5K7HA 4BDYA 4R1HA 1YRNA 1IG7A 1Q1HA 2ID3A 4FHTA 1UHWA 1JT6A 2QQBA 2P7CB 1H8AC 1K4TA 4HF1A 3HRUA 1JGSA 3MFKA 2XAGA 2EFNA 2F4OB 3GO5A 4BNCA 5E17F 4XL9A 2M45A 3NQOA 4XN3A 3PIOF 3F6VA 1EH6A 1SFXA 3OYMA 3DLAA 3PQJA 4GDFA 1Y8QB 2OBPA 5HDNA 1MDMB 3JRDA 5D5VB 1E2XA 3OSGA 1FZPB 4DIQA 3HGGA 2J5OA 2DTRA 5E8GA 4WWCA 3DP7A 4HX8A 4YEJA 1ZR2A 4G9YA 2R7VA 3F8CA 2LY2A 3PNYA 4RBOA 1FBUA 1WKMA 3Q0WA 1SFUA 3LFUA 3I53A 2FMLA 4A5NA 4DNCA 3QYFA 1XD7A 1U0JA 2CG4A 5HDGA 3I56I 2NRAC 2M30A 3DKYA 3KE2A 2V6CA 1BM9A 1ETQA 2L0KA 3ASNH 3BR0A 5KCMA 2R7DA 1U5TB 2DA1A 4M9ZA 4OOIA 1G3SA 1V4RA 2M34A 4FCYA 3S1NJ 1FOXA 1D3YA 2VXZA 5M3FJ 2VOOA 4HW0A 2M0CA 1Z1DA 2FRHA 1E17A 3HOTA 2KHMA 4W1UA 3VSLA 3M1EA 4DBQA 4XICA 3I0TA 3E6MA 3K4KA 2NS7A 1IAWA 2EZKA 2AXTC 1OISA 1JUMA 1W5TA 4ZC3A 4EGZA 1HBXG 1F5TA 2C6YA 3P5JA 2KFDA 2JA7J 2PJRA 2PG4A 3F6OA 3SFZA 2A07F 1BJZA 2DJNA 3FK7A 1RPWA 1O57A 3EQLF 2XF5A 5JVTA 1W36C 4UY8I 1YX5A 2RQPA 3V42A 3DCFA 1YO5C 2R7WA 2AO9A 3BCBA 4C3IJ 3AAFA 2V4JC 2LK2A 2NXNB 3O8HA 4RLQA 1UJ8A 3ESWB 3K4LA 2HVSA 3ZQLA 2H27A 1B1BA 2W85A 3F9KA 2EIKH 4IO9F 4L9VA 4IJAA 2OV7A 3PFYA 1W1WE 3K2ZA 4PUSA 4BE1A 5J4VA 2R7XA 2XSDC 3BR2A 4E7KA 1E0EA 4CYDA 4UB6C 3IAS2 5E3MA 4KFCA 1FYKA 2CQ7A 3IUOA 5LGUA 2NVTJ 3FXLA 3ROUA 3HSFA 1JTXA 4M3GA 3LSIA 3DU6A 3QQAA 2YS9A 2VJJA 2CUEA 2DMTA 2ZSIB 2VC0A 4AYBN 5IYCJ 1B72A 4BAYA 1FEXA 4PJ0C 3IKTA 3S1RJ 4A3DJ 4LMYA 4B48A 5B3SH 2HXIA 2ZMEC 2Y31A 2KT0A 2M7AA 1OCCH 4NQWB 3V8JA 2O61A 4BXFA 1IN7A 3OYGA 3WTVC 3GTMJ 1D8KA 3VYRB 3BG5A 1HF0A 1Z7UA 2JPCA 2RNJA 1O7LA 2XAFA 1P2FA 3RPUD 3CF5F 3BQYA 2IBDA 1R4NB 2LDUA 5EZGA 1R6RA 3E97A 4S05A 3FF5A 5GP9A 4EV0A 3JSPA 3FXRA 4HV6A 1M1EB 4LB6B 2W25A 1J75A 2EBIA 2L7FP 4Y4RA 3MEXA 4V19K 3PO3J 4G8XA 3ABLH 3TP3A 3FISA 3RKQA 2CQKA 2OZUA 1B9MA 4JK1X 2GZWA 3IRQA 1FSEA 2HQ5A 2DA5A 1S29A 1XMKA 2R5YA 4LK0F 3FXJA 2D1VA 4M3BA 1JKOC 2MC4A 2Z16A 2V1XA 1MBGA 1G2HA 4LG0B 4CCMA 3MMYB 2IA1A 2XRLA 1MNMC 2V9VA 1SD4A 3J81K 2OJED 5FKKA 3PSFA 1HKQA 4BGDA 3JREA 1TQIA 2EA2A 5JVGF 4LLGF 3K70C 1D1AA 4BJTA 1R5HA 2KP6A 2M4KA 1TW2A 1KQ0A 1U6GA 1XX5A 4IOCF 3TOBA 2BW3A 1MMNA 2X9DA 4I02A 2ECBA 4UB8C 4RMNA 2FU4A 2Z99A 5IYBJ 3G1LA 1RESA 4GCVA 4WF2A 2QSGX 4XOTA 4DZPA 2W82A 3CQZJ 5AIQA 1Y6IA 2V1NA 1ERDA 5D4RA 3BWGA 1SAUA 3K10A 3PUFA 2BE5F 3FHNA 3MD2A 5CVUA 5HS8A 2QGUA 2GM4A 4LITA 2R0QC 1U8RA 2CRGA 2NVUB 2XB0X 3BJ6A 1BI2A 1TWFJ 3AG1H 3E7LA 3QPSA 3OWTA 3OIQA 4E4HA 3CUQB 3LA3A 3BPXA 4UV9A 2XROA 4F55A 4IX7A 2PFBA 5CKTA 4ON0A 4NNJA 4LIVA 5FKNA 2LH9A 4PGGA 2Q8KA 2V7FA 1WI3A 2LVSA 1ZLJA 3K69A 4HSTA 3E3VA 1GUUA 5FKLA 1JHHA 1UMQA 2IT0A 1D8JA 4UNOA 2HKOA 3DXJF 2DCEA 1VQLI 1GXPA 1Z0XA 4P1WA 2DT5A 4E70A 3D0SA 5H6RA 3IH3A 5J8FA 3ZN0A 2EA4A 3HPGA 4MTEA 2ZBKA 2AHQA 2W1OA 4I01A 4BQQA 4EQQA 1FT9A 2XIGA 2Z5UA 2F4IA 2HQAA 4P55A 2FE3A 5FRMA 3RCOA 4J19A 1YTYA 2V26A 4HYEA 1BI3A 2XKOA 3ZMSA 1FMVA 1UG2A 3AL0B 2LY9A 3RYRA 3MKWB 4EJVA 1QZYA 3ELKA 2NS0A 1IGNA 3J80Z 1ODDA 4HOBA 3SFIA 3FIWA 3OY9A 1IN6A 3W6KB 4CICA 1HC8A 1VQ7I 3EETA 2K3PA 2MFZA 1JKQC 5H20A 3RI4A 3TQNA 4I6ZA 4ZJZA 1FOYA 2DYRH 3IHUA 4GYIA 2Z9OA 2LTPA 3DTIA 4BJ5C 3O6BB 3CC4I 3O8GA 2P6SA 1X1AA 3HRSA 2DFEA 2R5YB 4H0EA 4JX6A 2VBZA 1H9GA 1Z05A 1V5GA 2F4MB 2WB1A 3TEDA 3TBIA 1T38A 3ZQGA 3BG7A 4Q4ZF 3WGGA 3KLOA 2M7BA 5EEAA 5EDNA 2OQGA 2IGNA 2VJ5A 4B09A 1TL8A 3BTLA 3OYFA 1KYZA 3OMYA 1JJ6C 4KYWA 2O8KA 4Y15A 5BPDA 1G6NA 3TKYA 1A6QA 3HSRA 3SHFA 3OS0A 3DKXA 1YOVB 1S7EA 5F1JA 3T1BA 3U1KA 3ERMA 2Y48A 4DGWB 3QU6A 4ZTFA 4IF4A 4UUTA 2LBFA 3T5XA 1YJWI 4Y52J 3CCYA 1XMAA 3RZDJ 1FWZA 5KAIC 4X6AJ 3GZ6A 4QIWN 4ENJA 1VF9A 3CMAI 2A5YB 2DTZA 2VONA 2LKPA 2UUZA 5IP6A 4UVAA 4XSZF 4G7OF 2JSCA 2M2EA 2XHKA 5J4YA 2R5ZA 1LFPA 1BR4A 2K9NA 1TZLA 4OMZA 2K4JA 3NAUA 4QPOA 1F36A 4G6TB 2B7EA 2DK5A 3K4BA 4Q48A 1TQMA 2XV4S 1DDNA 2B0LA 4U0WA 1U78A 1VQ9I 5DCFA 3G73A 2VKHA 2UZKA 4PJMA 1MIJA 3U2RA 1XN7A 4IHYA 4A6DA 1ZRDA 1LDJA 3QOPA 4XLPF 3UR3C 4H4KC 5FB2A 1O3SA 1TT5B 3MAJA 3VYSB 4N0BA 1TT0A 4FASD 2WADA 4R79A 2EINH 1VQMI 2A68F 3A02A 1XSXA 4HF0A 4QWQA 3QOEA 4JX5A 2DJIA 3L2WA 3F8NA 1SFKA 4A2UA 3GLXA 2D45A 2M8EA 1OYYA 2X1CA 3JAMZ 2DXIA 2TRTA 1VQ4I 3CP2A 3QPTA 1BN5A 3GTPJ 4GO1A 2R7ZJ 1DPUA 4UVCA 3LSJA 3G1MA 1YLFA 4HRIA 2MW8A 2QUFA 3J7ZI 3NWSA 2UWMA 3BR5A 3FX3A 2J5PA 2QEXI 3HPHA 1U5TA 4GGGA 3WTSC 1XSDA 5E1XA 1PP7U 4HQEA 4NC6A 4GRIA 2MA3A 4HNUA 2B63J 5IOYA 2JVHA 3COAC 2IS4A 1ZRFA 3S3MA 2L9SA 1IRFA 2P4WA 4CCOA 1BOAA 4U0YA 4II2A 3QP5A 3K0LA 5DEQA 1P7IA 2E1CA 1X3UA 2FQ3A 3HOUJ 3E1SA 1WJFA 3L2RA 1MSFC 2HYJA 1YQAA 1ZG1A 4N4OB 4RGSA 2KDOA 3ZQ7A 5ICCA 2LRDA 2HEOA 4ZZLA 3HUGB 3OYAA 2EFOA 2VKDA 3FXOA 2O0YA 2RV8A 3BT9A 1H89C 4KICA 3I4MJ 5AONA 2OPTA 3DPTA 1OQYA 3B73A 5EF6A 3GF2A 1BC8C 3MZ8A 3IH4A 1DP3A 3ZOBA 1ZARA 2XAQA 1XCVA 4BQNA 4CCJA 1LB2A 1TWGJ 4CCLA 5K7ZA 4Q5SF 2X6XA 2H09A 3S32A 4PSXA 2I5UA 2XAHA 1FIAA 2YX7A 4MLOA 1V5EA 5IOZA 3WU0A 5IT3A 4CZCA 1YITI 5CLSA 3ZQHA 5IP9J 3HOSA 2Y0SN 2BY1A 1D0XA 1VQNI 3W3CA 4AM3A 2V1DA 4WXHA 2WC2A 4ENNA 3EYIA 3WU2C 3B6CA 4S04A 1KGSA 3U21A 5J3LA 1IDZA 4G94A 1X4PA 3CC7I 3ECHA 2RDPA 1P4AA 3QPHA 4U7DA 2Y69H 1O3TA 2E1NA 1YHQI 2I8DA 3DTEA 4UUSB 3LSRA 1IN8A 1MGTA 1N75A 1OCOH 4F7ZA 4DYCA 4BUPA 1W0TA 2PLYA 4JBAA 3VOEA 1GDTA 2NNYA 1X19A 2X6YA 3BG3A 1KU3A 1GLNA 4HA8A 1J09A 2O9LA 2MABA 3EUHC 3ONQA 1U9NA 1EH7A 3GTGJ 1ZAOA 3GTLJ 1HCRA 4NDLA 3MZHA 4EJOA 4FTHA 2WTEA 5ICGA 4ZDOA 1FYLA 4XLAA 5EG0B 1LFBA 3VFZA 1OCZH 3H9GA 1P9QC 1X3ZB 3CESA 1ORKA 3JTHA 4P9FA 4Y3OA 4CDGA 4ZYGA 3ZMVA 2K85A 1SEUA 1LJ9A 1WH5A 2FBHA 1FBQA 1QZEA 4BY7J 1XMXA 2X6OA 4P9UA 2KIQA 1TBXA 1UZCA 5CQEA 4BBSJ 2M8GX 1JHFA 4G12A 3H1CA 1JGGA 3R0AA 2CO5A 2FF4A 4M71A 3IV5A 3WTTC 1W36D 2VBYA 1AHDP 1WJDA 3I3LA 2BHZA 4C2TA 1V55H 3S2HJ 1QGPA 2O03A 2ZB9A 4YG2F 5LGTA 2E71A 2I10A 3R6SA 5L3FA 5JR3A 2DYSH 3C1DA 3TDZC 4ABZA 3B6AA 1KA8A 2GBYA 5DUIA 3S1MJ 1J9IA 2WA0A 3H5NA 3D1NI 2DAOA 2ZCWA 4ESFA 3HUGA 3Q0UA 2F5CA 2L4AA 3C2HA 1HSTA 5GPAA 2CV1A 1HDDC 4B47A 2LFBA 2JUGA 2ELKA 5C4JJ 3HL2A 2LSOA 4CGZA 3K6GA 1RUNA 3LSGA 1AKHA 2YU9J 3EYYA 4WX9A 1ZR4A 1CF7B 2JA5J 3JW4A 1IF1A 2ZO4A 4BHBA 1T39A 4DOZA 1T0FA 2M9HA 4YFXF 4LJZF 5LEJA 3PIPF 3OYHA 3J7YJ 2WWYA 5LHGA 3W6JB 1U3EM 4OMYA 2Q2EB 1ULYA 1QPIA 3MWMA 3TP0A 4A3LJ 2L9NA 2JWTA 2Y75A 1HA8A 5F0CA 4HDVA 3KIOA 1XSVA 2JA8J 2HFHA 2WV0A 2BOLA 2QA4I 2AXLA 4DJAA 1JUSA 1JE8A 1QPMA 1SD5A 2L5QA 2QZ8A 4TV7A 3FKJA 3IKVA 1PUFB 2FBKA 2D2WA 5E20A 1S7OA 2K5CA 3JRHA 1ZELA 4X0GA 4UVBA 2WBMA 3ECOA 4NB5A 3LSPA 2WAEA 2IRFG 2Q2EA 3ZMDA 3G2BA 2XDVA 5K7FA 5F0HA 2DMPA 1SFEA 1Z21A 2P5VA 2QCOA 3GZ5A 1Z3YA 4YFNF 3CF2A 3EPZA 1YYVA 1I39A 1USSA 4XRFA 3TMOA 1W5SA 2LG4A 2MC3A 4PZJA 3ZQQA 4AWXB 1FIPA 2DFIA 1ZREA 3FBIB 4IHTA 2BVLA 1TP4A 3DPUA 5CQGA 1LQ1A 2CWEA 1GVDA 5FLVA 1B8IA 4HDUA
chains in the Genus database with same CATH topology
3QU3A 4KDPA 2NYXA 4OIRF 4Q47A 4RB1A 1HW5A 3TGNA 1BIBA 3M8EA 2HZTA 2STTA 1B6AA 1A04A 3E6BA 3LFKA 3WGIA 4KT5C 3GFIA 5A2QZ 4EJWA 4IRHA 2ISZA 2EV0A 3PQKA 1W7PB 4IPAA 3LSTA 4WXCA 4BH9A 1K78B 3KETA 1BJAA 4O5VA 4RB0A 2JTVA 4FT8A 2CGPA 3R60A 4JQFA 1R22A 2DBBA 3HYIA 5BQTA 1OMIA 1NHAA 1YS7A 2EFQA 5HLIA 4HLYA 3FMRA 3DPLC 1YIOA 2RN7A 4A6EA 5LRSA 5DV5A 2EFWA 2PBIA 4L9NA 5HLHA 2XASA 2H6CA 2JPBA 2OU2A 3BOQA 3I71A 1P4WA 2FOKA 2K4BA 4EMSA 1SMYF 4FX4A 3HTSB 2RGVA 1MZBA 3M8FA 3OOPA 2BV6A 2IJLA 1LVAA 5HVQC 2R7FA 4NHJA 3FM3A 3KCCA 2MH2A 4L9TA 4LB5A 2QBYA 1IXSB 1SD7A 1XCBA 1R58A 5EEGA 1F4KA 3WGHA 3T0YA 1XGSA 3RJPA 3QRFF 3DF8A 5K5QA 4KUMA 3VODA 3F3XA 4ENMA 4EGYA 1TLHB 3KLNA 3M9AA 3R4KA 3FMSA 2Z33A 5DUKA 4OIOF 1GXQA 1I1SA 1RUOA 3I64A 2HTJA 4ESBA 4PCQA 3FM5A 5ED4A 2EV5A 5EEHA 4LG0A 2TDXA 4IRGA 3L9FA 4G7HF 3GFMA 3BP8A 4EVIA 3KEQA 1XGOA 1UCRA 3MQ0A 1JXSA 1BC7C 4O6JA 2DW4A 4M6XA 2DQRA 2IA0A 1IZ1A 3V8KA 2ZMEA 5CVVA 4RAYA 4UV8A 1O3QA 4LLNA 2PI0A 1CGPA 3FXQA 2F5DA 5H6QA 3SZPA 3V4GA 4OINF 1J7KA 5L3CA 1QNTA 1L3LA 2K86A 4I2OA 2GWRA 5DCMB 3I4PA 4PGHA 4M73A 5CYVA 4EM0B 2DU9A 1Z6RA 1J5YA 3E5UA 1ON1A 3Q9SA 1SMTA 2F2EA 3RKXA 4AD9A 1T2KA 1W7PD 4U0VA 5ICFA 3ERED 4BQAA 3KP5A 1BI0A 2X0LA 1MDMA 1ZGAA 1P4XA 5KVRA 1U2WA 3G3ZA 5ERIA 3LAPA 5E8IA 1XDUA 3CTAA 1PP8F 2XKPA 4BHCA 2A69F 2V1UA 3HSEA 4RAZA 2W84A 3ULQB 2Z3YA 1G3WA 2GAUA 2GQQA 1ZH5A 4A12A 1P92A 2EB7A 4M9SA 2JZYA 3LWFA 2UXXA 1V3FA 1KQ8A 2OZ6A 5FO5A 1MKMA 2DK8A 1TNTA 1R36A 1USTA 3ABUA 2ZXJA 3GUDA 1G4DA 5BS6A 1R7JA 3OV8A 3F21A 2HKXA 3H3UA 3P9IA 3RYPA 3ZP5A 2QLZA 5E1WA 2COMA 2KKOA 3E6DA 2IA2A 4HV5A 2PN6A 4ZH4F 5LRRA 1O3RA 5K5OA 3QAHA 4G6DA 2JRTA 1O7FA 3J81Z 2DQLA 2ZMEB 2PQ8A 1KU9A 3GFJA 2KJBA 3CUQA 3V7SA 1FPQA 2XUBA 3RPQA 2O6GE 2PMHA 3I5UA 3BJOA 2M5WA 2HYGD 3NEUA 2M1BA 5FLXK 1QO0D 3WTXC 3E5XA 4AIHA 4M74A 4YIFA 3HRTA 2QQAA 1QBJA 1IW7F 4I98B 2K02A 2VC1A 2QM3A 4HF2A 2X4HA 2A6EF 3LA7A 3WG9A 1K79A 2DLLA 2HDCA 4EM1A 4LFUA 5HOOA 4MEYF 1D5VA 4BXUA 4KN7X 1S6LA 2KJCA 4K2EA 2HS5A 5HS9A 3KEOA 1FYMA 1VTNC 5CJ9A 4WK8F 3V7RA 3SXYA 3ISPA 4A0YA 1F1ZA 1L0OC 1R1VA 5DD4A 3K1PA 1WRJA 3JTGA 1SAXA 4I0AA 1HQCA 4KN4X 2AS5F 2R3SA 3WODF 3S2WA 3E6CC 1RNLA 4KIBA 2A6HF 4ESJA 3SQNA 2XAJA 2YX4A 2P8TA 3GWZA 1KU2A 5DCMA 3DQVC 3QP6A 3R61A 2ACJA 3ZMTA 3ZPLA 1IXRC 4M6YA 3C3WA 4UUVA 4I09A 1FSHA 4GYGA 3RIRA 1XB4A 5K1YA 5CVIA 3KP7A 1TW3A 1MD0A 2L54A 2FEZA 2HTSA 3L7WA 1YW9A 1IXCA 4YFKF 2ZFWA 1KU7A 5D8KB 3MCZA 2FNAA 1LEBA 2ESNA 1YG2A 1K78A 1MJBA 1XGNA 3SZTA 1ONVA 1FLIA 1RIOH 2CYYA 1ON2A 1FNNA 1G3TA 1RZ4A 1K6OA 1WSUA 4Y13A 1R00A 2FBIA 3HHGA 3KZYA 2K27A 4MHGA 1F9NA 2H94A 4AIJA 4ZYEA 5TRDA 5IT9K 2MD5A 5ICEA 3HHHA 2YU3A 4CO8A 4I0BA 2ZJ2A 1ZRCA 4FX0A 1S8NA 3I58A 5LHHA 2KIUA 4HX4A 4Z2YA 2GXBA 1HSJA 5D5UB 5CVRA 1G3YA 4WXDA 5D5XB 4A5MA 1GVJA 3F8BA 3J7AO 4Y17A 2CFXA 3H92A 4UHTA 4ZZDA 4AVPA 4HBLA 4ASNA 4MTDA 1K7AA 2G7HA 2VOPA 2BBYA 3RKWA 3WE2A 4IHSA 5HDKA 4AIKA 1OKRA 2Y0MA 3JSOA 3WTYC 2KIFA 5HS7A 1FY7A 3L2CA 1TQPA 1YW8A 2VBWA 4HQMA 4NQWA 2EWNA 3EUHA 1DP7P 3GX4X 1S3JA 4U88A 2VT2A 2EFPA 1IN4A 3O2PE 2HGCA 3BPVA 3H3ZA 5LLQA 2CSOA 2E7XA 2PEXA 2ZNYA 4PDKA 2VE9A 3FZVA 1YW7A 2VODA 3EDPA 4N9HA 5FD5A 1STZA 2FSWA 1H0MA 1FOKA 5E1ZB 3TDUC 1B59A 1C0WA 1YS6A 3ZMZA 5L3BA 3C18A 2BEOA 1OR7A 1ZG5A 4LD5A 3TO7A 3T8TA 2W24A 1HW2A 4KIFA 2ZNZA 2NNNA 2DPUA 3CJNA 3ABTA 4XLNF 2G7UA 3BDDA 5BPIA 1J2XA 2L01A 1AWCA 2L4MA 1FP2A 6PAXA 1ZGJA 1I27A 3F8MA 4HX7A 1LEAA 1TNSA 2F5EA 1H9TA 4EM2A 3BZ6A 1B4AA 3RDIA 3RTRA 5FLXZ 5D6EA 3Q5FA 3CUOA 2LF8A 4M9XA 4ZYHA 2MH9A 2VE8A 2XGXA 2EK5A 5ILVA 5JHUA 2RVCA 4KA4A 5ILUA 1MJAA 4P96A 2MLKA 5J8CA 2P5KA 5F6FA 1FBSA 3FHZA 5L3GA 4ZYDA 2ETHA 4OIPF 2O3FA 2M87A 2HR3A 2MBFA 1FP1D 3F72A 5FD6A 1I5ZA 2OAZA 3P9KA 1QZZA 2PMUA 3U9GA 3CLOA 4LK1F 4IRIA 3IWFA 4HLXA 1YFHA 1I6XA 5D4SA 2CW0F 2KRFA 1XGMA 4A0ZA 3L09A 2YR2A 3KFWX 4L9JA 5L3EA 4L18B 1PUEE 5E18F 1HXDA 4KNYA 3LQRA 4BHPA 3ZN1A 2UXNA 4DQ2A 2RKHA 2L02A 1PDNC 3U1DA 4RGUA 1DUXC 5AIPA 3RPUA 4KIGA 4QLCU 5LGNA 4CZZA 3DEUA 4RGXA 2KIMA 4M72A 1Z91A 3RKYA 4GXOA 4L5JA 5K5RA 2IVMA 4N9IA 1W7PA 3O3KA 4RB2C 2YPRA 4LGWA 1QQIA 3C7JA 2GXGA 3BJAA 2IW5A 1EH8A 3GXOA 4CXFA 4HZFA 3HRMA 2FNPA 2XRNA 2DI3A 5LEKA 1ZYRF 2ELHA 1IUYA 2GA2A 1KYWA 4KMFA 1HKTA 2OD5A 2V79A 4KMUX 4ETSA 3ZMUA 2QVOA 4R8HA 3VEPA 2HWVA 3TO6A 1WQ2A 2VN2A 2RC4A 2HOEA 3CO6C 2EJRA 5LHIA 4CHUA 3GFLA 2BYVE 1UFMA 3I54A 3GYHX 5JI6A 2YSRA 1OYIA 5TJJA 3N97A 2QENA 1UHMA 3REOA 1T98A 3K1NA 3WTUC 2QBYB 1LNWA 3KP6A 1AOYA 2FA5A 5FFXA 3IRRA 5JFRA 1R23A 4MQ9F 4OIQF 4IVNA 4OU0A 1TTYA 3WTZA 1S7AA 1SD6A 1DPRA 3VB2A 1HW1A 3ML6A 2FXAA 4WCGA 2G9WA 2P6TA 1MJ9A 4EJUA 2D1HA 4EJTA 1LDKB 3F22A 3E5QA 2Q0OA 4G6QA 3KP3A 2XVCA 5KK1A 2L3DA 3MZYA 1T6SA 4I7HA 4B8XA 3IC7A 3Q9VA 1GHCA 2HQNA 2E7WA 2ZKZA 1BIAA 1R5GA 5HLGA 3WTWC 1WI9A 1IN5A 2QQ9A 3K9TA 2DPDA 4RGRA 4MGRA 3JAMK 3LAJA 3P9CA 3R0JA 1ZN2A 4BYYA 1OYWA 3L00A 1J0RA 3GVAA 4U7BA 1WWXA 3CUQC 5D8LB 5J6XA 5CVJA 2A3SA 3GEZA 3HTUA 1P6RA 2GIVA 2IPQX 3J80K 3IL2A 3KP2A 2F5FA 1XDSA 1J59A 2HQRA 1Z9CA 5DDGA 1RI7A 2VT3A 1W4MA 2DO7A 1ZG3A 1HKSA 2A61A 1Y0UA 5DD8A 2W57A 2LF7A 2OA4A 2O8XA 3B02A 3IWZA 3NRVA 5BOXA 4G7ZF 3LA2A 5BMZA 5F64A 3TOAA 3TO9A 4L0ZB 2EV6A 4RB3C 4P5OA 1I1GA 3FXUA 1Z6TA 3HIFA 4L5IA 2MLGA 3N4MA 5A2QK 2PJPA 2STWA 4O3MA 2LNBA 2GA1A 3CO7C 4HAMA 1KQ9A 1B9NA 3CDHA 3T8RA 3V8LA 1UB9A 1FX7A 5D6FA 3K1MA 2ISYA 2JT1A 1CF7A 5F1RA 5LBQA 1BBYA 3I59A 4UXNA 2HYFA 4MEXF 1FC3A 4RS8A 4YIIA 4IXAA 1REPC 2P5LC 2K7LA 3FMQA 3WU1B 2ESHA 4XSXF 3I59B 5D5WB 1BI1A 2QYOA 4ENKA 3D5LA 2OQRA 1ZHFA 4XBFA 2P7VB 5ILSA 3BROA 3FWEA 3M7GA 3P7NA 2NAZA 1OPCA 2VBXA 4MQVA 3DV8A 1EV7A 4L0YB 2FMYA 3KP4A 1ZLKA 2QWWA 3GW2A 5FFZA 1IRGA 3DKWA 3PFIA 3WE3A 4LLLA 4A0XA 1R1TA 5DYMA 3LQQA 2H6BA 2IP2A 3KZZA 5IT9Z 3DFGA 1U5TC 3V7CA 3BY6A 1LDDA 3F8FA 4MNUA 1R1UA 2BGCA 4D0PA 5L3DA 5FGMA 3F23A 2ADUA 4R1HA 1Q1HA 4FHTA 1UHWA 2P7CB 2QQBA 4HF1A 3HRUA 1JGSA 3MFKA 2XAGA 2EFNA 3GO5A 4BNCA 5E17F 2M45A 3NQOA 3F6VA 1EH6A 1SFXA 3PQJA 2OBPA 5HDNA 1MDMB 5D5VB 1E2XA 1FZPB 2J5OA 2DTRA 5E8GA 4WWCA 3DP7A 4HX8A 4G9YA 3F8CA 1FBUA 1WKMA 1SFUA 3I53A 2FMLA 4A5NA 4DNCA 1XD7A 2CG4A 5HDGA 2NRAC 2M30A 3KE2A 2V6CA 1BM9A 2R7DA 1U5TB 4OOIA 4M9ZA 1G3SA 1V4RA 1D3YA 2VXZA 2VOOA 4HW0A 1Z1DA 2FRHA 1E17A 3HOTA 3M1EA 3I0TA 3E6MA 1IAWA 1W5TA 4EGZA 1F5TA 1HBXG 2C6YA 2PG4A 3F6OA 3SFZA 2A07F 1O57A 3EQLF 5JVTA 2RQPA 1YO5C 3AAFA 2H27A 1B1BA 2W85A 4L9VA 4IJAA 3K2ZA 4CYDA 4KFCA 1FYKA 5LGUA 3ROUA 3HSFA 2VC0A 4BAYA 3IKTA 4LMYA 3V8JA 2O61A 1IN7A 3WTVC 1D8KA 1Z7UA 2JPCA 2RNJA 1O7LA 2XAFA 1P2FA 2LDUA 3E97A 4S05A 3FF5A 4EV0A 3JSPA 3FXRA 4HV6A 4LB6B 2W25A 1J75A 3MEXA 4G8XA 2CQKA 2OZUA 1B9MA 4JK1X 2GZWA 3IRQA 1FSEA 1S29A 1XMKA 4LK0F 2D1VA 2V1XA 4LG0B 2IA1A 3J81K 2V9VA 1SD4A 1HKQA 1TQIA 2EA2A 4LLGF 1R5HA 1TW2A 1KQ0A 1U6GA 3TOBA 4I02A 2FU4A 2Z99A 4GCVA 4WF2A 5AIQA 5D4RA 3BWGA 2BE5F 5CVUA 5HS8A 1U8RA 3BJ6A 1BI2A 3CUQB 3LA3A 3BPXA 4UV9A 2XROA 2PFBA 4ON0A 4PGGA 2Q8KA 1ZLJA 3K69A 3E3VA 1JHHA 2IT0A 1D8JA 4UNOA 2HKOA 3DXJF 1GXPA 2DT5A 4E70A 3D0SA 5H6RA 5J8FA 3ZN0A 2EA4A 4MTEA 2ZBKA 4I01A 4EQQA 1FT9A 2XIGA 2Z5UA 4P55A 2FE3A 1YTYA 4HYEA 1BI3A 2XKOA 3ZMSA 3RYRA 4EJVA 1QZYA 3ELKA 2NS0A 3J80Z 1ODDA 4HOBA 1IN6A 3W6KB 4CICA 3EETA 5H20A 3RI4A 3TQNA 3IHUA 4GYIA 2Z9OA 3O6BB 2P6SA 3HRSA 4H0EA 2VBZA 1H9GA 1Z05A 1T38A 4Q4ZF 3WGGA 3KLOA 2OQGA 4B09A 1KYZA 4KYWA 4Y15A 5BPDA 1G6NA 3TKYA 3HSRA 3SHFA 3T1BA 2Y48A 3QU6A 4IF4A 3T5XA 1XMAA 1FWZA 3GZ6A 4ENJA 2A5YB 2VONA 2LKPA 4UVAA 4XSZF 4G7OF 2JSCA 2XHKA 4OMZA 2K4JA 2DK5A 4Q48A 1TQMA 2XV4S 1DDNA 2B0LA 4U0WA 1U78A 5DCFA 3G73A 2UZKA 3U2RA 1XN7A 4A6DA 1ZRDA 1LDJA 3QOPA 4XLPF 5FB2A 1O3SA 3MAJA 4N0BA 4R79A 2A68F 1XSXA 4HF0A 4QWQA 3F8NA 4A2UA 2D45A 3GLXA 2M8EA 1OYYA 3JAMZ 3QPTA 1BN5A 4GO1A 1DPUA 4UVCA 1YLFA 2QUFA 2UWMA 2J5PA 3FX3A 1U5TA 4GGGA 3WTSC 1XSDA 5E1XA 1PP7U 4HQEA 2MA3A 3COAC 1ZRFA 1IRFA 2P4WA 1BOAA 4U0YA 3QP5A 3K0LA 5DEQA 2E1CA 1X3UA 2FQ3A 1YQAA 1ZG1A 4RGSA 3ZQ7A 5ICCA 2HEOA 4ZZLA 2EFOA 2O0YA 2RV8A 4KICA 5AONA 3DPTA 3B73A 3GF2A 1BC8C 1ZARA 2XAQA 1XCVA 1LB2A 4Q5SF 2H09A 2XAHA 2YX7A 3WU0A 5IT3A 5CLSA 3HOSA 2V1DA 4WXHA 2WC2A 4ENNA 3EYIA 4S04A 1KGSA 4G94A 3ECHA 2RDPA 1P4AA 3QPHA 4U7DA 1O3TA 2E1NA 1IN8A 1MGTA 4F7ZA 2PLYA 4JBAA 3VOEA 2NNYA 1KU3A 4HA8A 1EH7A 1ZAOA 3MZHA 4EJOA 2WTEA 5ICGA 1FYLA 3VFZA 3JTHA 4CDGA 4P9FA 4ZYGA 3ZMVA 1LJ9A 2FBHA 1FBQA 4P9UA 1TBXA 1JHFA 3R0AA 2CO5A 2FF4A 4M71A 3WTTC 2VBYA 1QGPA 2O03A 4YG2F 5LGTA 5L3FA 3R6SA 5JR3A 3C1DA 3TDZC 1KA8A 5DUIA 1J9IA 2DAOA 2ZCWA 4ESFA 3HUGA 2F5CA 2L4AA 1HSTA 2LSOA 4CGZA 1RUNA 3EYYA 4WX9A 1CF7B 3JW4A 1IF1A 2ZO4A 4BHBA 1T39A 1T0FA 4YFXF 4LJZF 5LEJA 2WWYA 5LHGA 3W6JB 1U3EM 4OMYA 1ULYA 3MWMA 2Y75A 4HDVA 1XSVA 2HFHA 2WV0A 2AXLA 1JE8A 1QPMA 1SD5A 2QZ8A 4TV7A 3IKVA 2FBKA 2D2WA 5E20A 1S7OA 4UVBA 3ECOA 4NB5A 2IRFG 2Q2EA 3ZMDA 1SFEA 2P5VA 3GZ5A 4YFNF 1YYVA 1USSA 4XRFA 1W5SA 2MC3A 4PZJA 4AWXB 2DFIA 1ZREA 4IHTA 1LQ1A 2CWEA 4HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QU3 A;  4KDP A;  2NYX A;  4OIR F;  4Q47 A;  4RB1 A;  1HW5 A;  3TGN A;  1BIB A;  3M8E A;  2HZT A;  2STT A;  1B6A A;  1A04 A;  3E6B A;  3LFK A;  3WGI A;  4KT5 C;  3GFI A;  5A2Q Z;  4EJW A;  4IRH A;  2ISZ A;  2EV0 A;  3PQK A;  1W7P B;  4IPA A;  3LST A;  4WXC A;  4BH9 A;  1K78 B;  3KET A;  1BJA A;  4O5V A;  4RB0 A;  2JTV A;  4FT8 A;  2CGP A;  3R60 A;  4JQF A;  1R22 A;  2DBB A;  3HYI A;  5BQT A;  1OMI A;  1NHA A;  1YS7 A;  2EFQ A;  5HLI A;  4HLY A;  3FMR A;  3DPL C;  1YIO A;  2RN7 A;  4A6E A;  5LRS A;  5DV5 A;  2EFW A;  2PBI A;  4L9N A;  5HLH A;  2XAS A;  2H6C A;  2JPB A;  2OU2 A;  3BOQ A;  3I71 A;  1P4W A;  2FOK A;  2K4B A;  4EMS A;  1SMY F;  4FX4 A;  3HTS B;  2RGV A;  1MZB A;  3M8F A;  3OOP A;  2BV6 A;  2IJL A;  1LVA A;  5HVQ C;  2R7F A;  4NHJ A;  3FM3 A;  3KCC A;  2MH2 A;  4L9T A;  4LB5 A;  2QBY A;  1IXS B;  1SD7 A;  1XCB A;  1R58 A;  5EEG A;  1F4K A;  3WGH A;  3T0Y A;  1XGS A;  3RJP A;  3QRF F;  3DF8 A;  5K5Q A;  4KUM A;  3VOD A;  3F3X A;  4ENM A;  4EGY A;  1TLH B;  3KLN A;  3M9A A;  3R4K A;  3FMS A;  2Z33 A;  5DUK A;  4OIO F;  1GXQ A;  1I1S A;  1RUO A;  3I64 A;  2HTJ A;  4ESB A;  4PCQ A;  3FM5 A;  5ED4 A;  2EV5 A;  5EEH A;  4LG0 A;  2TDX A;  4IRG A;  3L9F A;  4G7H F;  3GFM A;  3BP8 A;  4EVI A;  3KEQ A;  1XGO A;  1UCR A;  3MQ0 A;  1JXS A;  1BC7 C;  4O6J A;  2DW4 A;  4M6X A;  2DQR A;  2IA0 A;  1IZ1 A;  3V8K A;  2ZME A;  5CVV A;  4RAY A;  4UV8 A;  1O3Q A;  4LLN A;  2PI0 A;  1CGP A;  3FXQ A;  2F5D A;  5H6Q A;  3SZP A;  3V4G A;  4OIN F;  1J7K A;  5L3C A;  1QNT A;  1L3L A;  2K86 A;  4I2O A;  2GWR A;  5DCM B;  3I4P A;  4PGH A;  4M73 A;  5CYV A;  4EM0 B;  2DU9 A;  1Z6R A;  1J5Y A;  3E5U A;  1ON1 A;  3Q9S A;  1SMT A;  2F2E A;  3RKX A;  4AD9 A;  1T2K A;  1W7P D;  4U0V A;  5ICF A;  3ERE D;  4BQA A;  3KP5 A;  1BI0 A;  2X0L A;  1MDM A;  1ZGA A;  1P4X A;  5KVR A;  1U2W A;  3G3Z A;  5ERI A;  3LAP A;  5E8I A;  1XDU A;  3CTA A;  1PP8 F;  2XKP A;  4BHC A;  2A69 F;  2V1U A;  3HSE A;  4RAZ A;  2W84 A;  3ULQ B;  2Z3Y A;  1G3W A;  2GAU A;  2GQQ A;  1ZH5 A;  4A12 A;  1P92 A;  2EB7 A;  4M9S A;  2JZY A;  3LWF A;  2UXX A;  1V3F A;  1KQ8 A;  2OZ6 A;  5FO5 A;  1MKM A;  2DK8 A;  1TNT A;  1R36 A;  1UST A;  3ABU A;  2ZXJ A;  3GUD A;  1G4D A;  5BS6 A;  1R7J A;  3OV8 A;  3F21 A;  2HKX A;  3H3U A;  3P9I A;  3RYP A;  3ZP5 A;  2QLZ A;  5E1W A;  2COM A;  2KKO A;  3E6D A;  2IA2 A;  4HV5 A;  2PN6 A;  4ZH4 F;  5LRR A;  1O3R A;  5K5O A;  3QAH A;  4G6D A;  2JRT A;  1O7F A;  3J81 Z;  2DQL A;  2ZME B;  2PQ8 A;  1KU9 A;  3GFJ A;  2KJB A;  3CUQ A;  3V7S A;  1FPQ A;  2XUB A;  3RPQ A;  2O6G E;  2PMH A;  3I5U A;  3BJO A;  2M5W A;  2HYG D;  3NEU A;  2M1B A;  5FLX K;  1QO0 D;  3WTX C;  3E5X A;  4AIH A;  4M74 A;  4YIF A;  3HRT A;  2QQA A;  1QBJ A;  1IW7 F;  4I98 B;  2K02 A;  2VC1 A;  2QM3 A;  4HF2 A;  2X4H A;  2A6E F;  3LA7 A;  3WG9 A;  1K79 A;  2DLL A;  2HDC A;  4EM1 A;  4LFU A;  5HOO A;  4MEY F;  1D5V A;  4BXU A;  4KN7 X;  1S6L A;  2KJC A;  4K2E A;  2HS5 A;  5HS9 A;  3KEO A;  1FYM A;  1VTN C;  5CJ9 A;  4WK8 F;  3V7R A;  3SXY A;  3ISP A;  4A0Y A;  1F1Z A;  1L0O C;  1R1V A;  5DD4 A;  3K1P A;  1WRJ A;  3JTG A;  1SAX A;  4I0A A;  1HQC A;  4KN4 X;  2AS5 F;  2R3S A;  3WOD F;  3S2W A;  3E6C C;  1RNL A;  4KIB A;  2A6H F;  4ESJ A;  3SQN A;  2XAJ A;  2YX4 A;  2P8T A;  3GWZ A;  1KU2 A;  5DCM A;  3DQV C;  3QP6 A;  3R61 A;  2ACJ A;  3ZMT A;  3ZPL A;  1IXR C;  4M6Y A;  3C3W A;  4UUV A;  4I09 A;  1FSH A;  4GYG A;  3RIR A;  1XB4 A;  5K1Y A;  5CVI A;  3KP7 A;  1TW3 A;  1MD0 A;  2L54 A;  2FEZ A;  2HTS A;  3L7W A;  1YW9 A;  1IXC A;  4YFK F;  2ZFW A;  1KU7 A;  5D8K B;  3MCZ A;  2FNA A;  1LEB A;  2ESN A;  1YG2 A;  1K78 A;  1MJB A;  1XGN A;  3SZT A;  1ONV A;  1FLI A;  1RIO H;  2CYY A;  1ON2 A;  1FNN A;  1G3T A;  1RZ4 A;  1K6O A;  1WSU A;  4Y13 A;  1R00 A;  2FBI A;  3HHG A;  3KZY A;  2K27 A;  4MHG A;  1F9N A;  2H94 A;  4AIJ A;  4ZYE A;  5TRD A;  5IT9 K;  2MD5 A;  5ICE A;  3HHH A;  2YU3 A;  4CO8 A;  4I0B A;  2ZJ2 A;  1ZRC A;  4FX0 A;  1S8N A;  3I58 A;  5LHH A;  2KIU A;  4HX4 A;  4Z2Y A;  2GXB A;  1HSJ A;  5D5U B;  5CVR A;  1G3Y A;  4WXD A;  5D5X B;  4A5M A;  1GVJ A;  3F8B A;  3J7A O;  4Y17 A;  2CFX A;  3H92 A;  4UHT A;  4ZZD A;  4AVP A;  4HBL A;  4ASN A;  4MTD A;  1K7A A;  2G7H A;  2VOP A;  2BBY A;  3RKW A;  3WE2 A;  4IHS A;  5HDK A;  4AIK A;  1OKR A;  2Y0M A;  3JSO A;  3WTY C;  2KIF A;  5HS7 A;  1FY7 A;  3L2C A;  1TQP A;  1YW8 A;  2VBW A;  4HQM A;  4NQW A;  2EWN A;  3EUH A;  1DP7 P;  3GX4 X;  1S3J A;  4U88 A;  2VT2 A;  2EFP A;  1IN4 A;  3O2P E;  2HGC A;  3BPV A;  3H3Z A;  5LLQ A;  2CSO A;  2E7X A;  2PEX A;  2ZNY A;  4PDK A;  2VE9 A;  3FZV A;  1YW7 A;  2VOD A;  3EDP A;  4N9H A;  5FD5 A;  1STZ A;  2FSW A;  1H0M A;  1FOK A;  5E1Z B;  3TDU C;  1B59 A;  1C0W A;  1YS6 A;  3ZMZ A;  5L3B A;  3C18 A;  2BEO A;  1OR7 A;  1ZG5 A;  4LD5 A;  3TO7 A;  3T8T A;  2W24 A;  1HW2 A;  4KIF A;  2ZNZ A;  2NNN A;  2DPU A;  3CJN A;  3ABT A;  4XLN F;  2G7U A;  3BDD A;  5BPI A;  1J2X A;  2L01 A;  1AWC A;  2L4M A;  1FP2 A;  6PAX A;  1ZGJ A;  1I27 A;  3F8M A;  4HX7 A;  1LEA A;  1TNS A;  2F5E A;  1H9T A;  4EM2 A;  3BZ6 A;  1B4A A;  3RDI A;  3RTR A;  5FLX Z;  5D6E A;  3Q5F A;  3CUO A;  2LF8 A;  4M9X A;  4ZYH A;  2MH9 A;  2VE8 A;  2XGX A;  2EK5 A;  5ILV A;  5JHU A;  2RVC A;  4KA4 A;  5ILU A;  1MJA A;  4P96 A;  2MLK A;  5J8C A;  2P5K A;  5F6F A;  1FBS A;  3FHZ A;  5L3G A;  4ZYD A;  2ETH A;  4OIP F;  2O3F A;  2M87 A;  2HR3 A;  2MBF A;  1FP1 D;  3F72 A;  5FD6 A;  1I5Z A;  2OAZ A;  3P9K A;  1QZZ A;  2PMU A;  3U9G A;  3CLO A;  4LK1 F;  4IRI A;  3IWF A;  4HLX A;  1YFH A;  1I6X A;  5D4S A;  2CW0 F;  2KRF A;  1XGM A;  4A0Z A;  3L09 A;  2YR2 A;  3KFW X;  4L9J A;  5L3E A;  4L18 B;  1PUE E;  5E18 F;  1HXD A;  4KNY A;  3LQR A;  4BHP A;  3ZN1 A;  2UXN A;  4DQ2 A;  2RKH A;  2L02 A;  1PDN C;  3U1D A;  4RGU A;  1DUX C;  5AIP A;  3RPU A;  4KIG A;  4QLC U;  5LGN A;  4CZZ A;  3DEU A;  4RGX A;  2KIM A;  4M72 A;  1Z91 A;  3RKY A;  4GXO A;  4L5J A;  5K5R A;  2IVM A;  4N9I A;  1W7P A;  3O3K A;  4RB2 C;  2YPR A;  4LGW A;  1QQI A;  3C7J A;  2GXG A;  3BJA A;  2IW5 A;  1EH8 A;  3GXO A;  4CXF A;  4HZF A;  3HRM A;  2FNP A;  2XRN A;  2DI3 A;  5LEK A;  1ZYR F;  2ELH A;  1IUY A;  2GA2 A;  1KYW A;  4KMF A;  1HKT A;  2OD5 A;  2V79 A;  4KMU X;  4ETS A;  3ZMU A;  2QVO A;  4R8H A;  3VEP A;  2HWV A;  3TO6 A;  1WQ2 A;  2VN2 A;  2RC4 A;  2HOE A;  3CO6 C;  2EJR A;  5LHI A;  4CHU A;  3GFL A;  2BYV E;  1UFM A;  3I54 A;  3GYH X;  5JI6 A;  2YSR A;  1OYI A;  5TJJ A;  3N97 A;  2QEN A;  1UHM A;  3REO A;  1T98 A;  3K1N A;  3WTU C;  2QBY B;  1LNW A;  3KP6 A;  1AOY A;  2FA5 A;  5FFX A;  3IRR A;  5JFR A;  1R23 A;  4MQ9 F;  4OIQ F;  4IVN A;  4OU0 A;  1TTY A;  3WTZ A;  1S7A A;  1SD6 A;  1DPR A;  3VB2 A;  1HW1 A;  3ML6 A;  2FXA A;  4WCG A;  2G9W A;  2P6T A;  1MJ9 A;  4EJU A;  2D1H A;  4EJT A;  1LDK B;  3F22 A;  3E5Q A;  2Q0O A;  4G6Q A;  3KP3 A;  2XVC A;  5KK1 A;  2L3D A;  3MZY A;  1T6S A;  4I7H A;  4B8X A;  3IC7 A;  3Q9V A;  1GHC A;  2HQN A;  2E7W A;  2ZKZ A;  1BIA A;  1R5G A;  5HLG A;  3WTW C;  1WI9 A;  1IN5 A;  2QQ9 A;  3K9T A;  2DPD A;  4RGR A;  4MGR A;  3JAM K;  3LAJ A;  3P9C A;  3R0J A;  1ZN2 A;  4BYY A;  1OYW A;  3L00 A;  1J0R A;  3GVA A;  4U7B A;  1WWX A;  3CUQ C;  5D8L B;  5J6X A;  5CVJ A;  2A3S A;  3GEZ A;  3HTU A;  1P6R A;  2GIV A;  2IPQ X;  3J80 K;  3IL2 A;  3KP2 A;  2F5F A;  1XDS A;  1J59 A;  2HQR A;  1Z9C A;  5DDG A;  1RI7 A;  2VT3 A;  1W4M A;  2DO7 A;  1ZG3 A;  1HKS A;  2A61 A;  1Y0U A;  5DD8 A;  2W57 A;  2LF7 A;  2OA4 A;  2O8X A;  3B02 A;  3IWZ A;  3NRV A;  5BOX A;  4G7Z F;  3LA2 A;  5BMZ A;  5F64 A;  3TOA A;  3TO9 A;  4L0Z B;  2EV6 A;  4RB3 C;  4P5O A;  1I1G A;  3FXU A;  1Z6T A;  3HIF A;  4L5I A;  2MLG A;  3N4M A;  5A2Q K;  2PJP A;  2STW A;  4O3M A;  2LNB A;  2GA1 A;  3CO7 C;  4HAM A;  1KQ9 A;  1B9N A;  3CDH A;  3T8R A;  3V8L A;  1UB9 A;  1FX7 A;  5D6F A;  3K1M A;  2ISY A;  2JT1 A;  1CF7 A;  5F1R A;  5LBQ A;  1BBY A;  3I59 A;  4UXN A;  2HYF A;  4MEX F;  1FC3 A;  4RS8 A;  4YII A;  4IXA A;  1REP C;  2P5L C;  2K7L A;  3FMQ A;  3WU1 B;  2ESH A;  4XSX F;  3I59 B;  5D5W B;  1BI1 A;  2QYO A;  4ENK A;  3D5L A;  2OQR A;  1ZHF A;  4XBF A;  2P7V B;  5ILS A;  3BRO A;  3FWE A;  3M7G A;  3P7N A;  2NAZ A;  1OPC A;  2VBX A;  4MQV A;  3DV8 A;  1EV7 A;  4L0Y B;  2FMY A;  3KP4 A;  1ZLK A;  2QWW A;  3GW2 A;  5FFZ A;  1IRG A;  3DKW A;  3PFI A;  3WE3 A;  4LLL A;  4A0X A;  1R1T A;  5DYM A;  3LQQ A;  2H6B A;  2IP2 A;  3KZZ A;  5IT9 Z;  3DFG A;  1U5T C;  3V7C A;  3BY6 A;  1LDD A;  3F8F A;  4MNU A;  1R1U A;  2BGC A;  4D0P A;  5L3D A;  5FGM A;  3F23 A;  2ADU A;  4R1H A;  1Q1H A;  4FHT A;  1UHW A;  2P7C B;  2QQB A;  4HF1 A;  3HRU A;  1JGS A;  3MFK A;  2XAG A;  2EFN A;  3GO5 A;  4BNC A;  5E17 F;  2M45 A;  3NQO A;  3F6V A;  1EH6 A;  1SFX A;  3PQJ A;  2OBP A;  5HDN A;  1MDM B;  5D5V B;  1E2X A;  1FZP B;  2J5O A;  2DTR A;  5E8G A;  4WWC A;  3DP7 A;  4HX8 A;  4G9Y A;  3F8C A;  1FBU A;  1WKM A;  1SFU A;  3I53 A;  2FML A;  4A5N A;  4DNC A;  1XD7 A;  2CG4 A;  5HDG A;  2NRA C;  2M30 A;  3KE2 A;  2V6C A;  1BM9 A;  2R7D A;  1U5T B;  4OOI A;  4M9Z A;  1G3S A;  1V4R A;  1D3Y A;  2VXZ A;  2VOO A;  4HW0 A;  1Z1D A;  2FRH A;  1E17 A;  3HOT A;  3M1E A;  3I0T A;  3E6M A;  1IAW A;  1W5T A;  4EGZ A;  1F5T A;  1HBX G;  2C6Y A;  2PG4 A;  3F6O A;  3SFZ A;  2A07 F;  1O57 A;  3EQL F;  5JVT A;  2RQP A;  1YO5 C;  3AAF A;  2H27 A;  1B1B A;  2W85 A;  4L9V A;  4IJA A;  3K2Z A;  4CYD A;  4KFC A;  1FYK A;  5LGU A;  3ROU A;  3HSF A;  2VC0 A;  4BAY A;  3IKT A;  4LMY A;  3V8J A;  2O61 A;  1IN7 A;  3WTV C;  1D8K A;  1Z7U A;  2JPC A;  2RNJ A;  1O7L A;  2XAF A;  1P2F A;  2LDU A;  3E97 A;  4S05 A;  3FF5 A;  4EV0 A;  3JSP A;  3FXR A;  4HV6 A;  4LB6 B;  2W25 A;  1J75 A;  3MEX A;  4G8X A;  2CQK A;  2OZU A;  1B9M A;  4JK1 X;  2GZW A;  3IRQ A;  1FSE A;  1S29 A;  1XMK A;  4LK0 F;  2D1V A;  2V1X A;  4LG0 B;  2IA1 A;  3J81 K;  2V9V A;  1SD4 A;  1HKQ A;  1TQI A;  2EA2 A;  4LLG F;  1R5H A;  1TW2 A;  1KQ0 A;  1U6G A;  3TOB A;  4I02 A;  2FU4 A;  2Z99 A;  4GCV A;  4WF2 A;  5AIQ A;  5D4R A;  3BWG A;  2BE5 F;  5CVU A;  5HS8 A;  1U8R A;  3BJ6 A;  1BI2 A;  3CUQ B;  3LA3 A;  3BPX A;  4UV9 A;  2XRO A;  2PFB A;  4ON0 A;  4PGG A;  2Q8K A;  1ZLJ A;  3K69 A;  3E3V A;  1JHH A;  2IT0 A;  1D8J A;  4UNO A;  2HKO A;  3DXJ F;  1GXP A;  2DT5 A;  4E70 A;  3D0S A;  5H6R A;  5J8F A;  3ZN0 A;  2EA4 A;  4MTE A;  2ZBK A;  4I01 A;  4EQQ A;  1FT9 A;  2XIG A;  2Z5U A;  4P55 A;  2FE3 A;  1YTY A;  4HYE A;  1BI3 A;  2XKO A;  3ZMS A;  3RYR A;  4EJV A;  1QZY A;  3ELK A;  2NS0 A;  3J80 Z;  1ODD A;  4HOB A;  1IN6 A;  3W6K B;  4CIC A;  3EET A;  5H20 A;  3RI4 A;  3TQN A;  3IHU A;  4GYI A;  2Z9O A;  3O6B B;  2P6S A;  3HRS A;  4H0E A;  2VBZ A;  1H9G A;  1Z05 A;  1T38 A;  4Q4Z F;  3WGG A;  3KLO A;  2OQG A;  4B09 A;  1KYZ A;  4KYW A;  4Y15 A;  5BPD A;  1G6N A;  3TKY A;  3HSR A;  3SHF A;  3T1B A;  2Y48 A;  3QU6 A;  4IF4 A;  3T5X A;  1XMA A;  1FWZ A;  3GZ6 A;  4ENJ A;  2A5Y B;  2VON A;  2LKP A;  4UVA A;  4XSZ F;  4G7O F;  2JSC A;  2XHK A;  4OMZ A;  2K4J A;  2DK5 A;  4Q48 A;  1TQM A;  2XV4 S;  1DDN A;  2B0L A;  4U0W A;  1U78 A;  5DCF A;  3G73 A;  2UZK A;  3U2R A;  1XN7 A;  4A6D A;  1ZRD A;  1LDJ A;  3QOP A;  4XLP F;  5FB2 A;  1O3S A;  3MAJ A;  4N0B A;  4R79 A;  2A68 F;  1XSX A;  4HF0 A;  4QWQ A;  3F8N A;  4A2U A;  2D45 A;  3GLX A;  2M8E A;  1OYY A;  3JAM Z;  3QPT A;  1BN5 A;  4GO1 A;  1DPU A;  4UVC A;  1YLF A;  2QUF A;  2UWM A;  2J5P A;  3FX3 A;  1U5T A;  4GGG A;  3WTS C;  1XSD A;  5E1X A;  1PP7 U;  4HQE A;  2MA3 A;  3COA C;  1ZRF A;  1IRF A;  2P4W A;  1BOA A;  4U0Y A;  3QP5 A;  3K0L A;  5DEQ A;  2E1C A;  1X3U A;  2FQ3 A;  1YQA A;  1ZG1 A;  4RGS A;  3ZQ7 A;  5ICC A;  2HEO A;  4ZZL A;  2EFO A;  2O0Y A;  2RV8 A;  4KIC A;  5AON A;  3DPT A;  3B73 A;  3GF2 A;  1BC8 C;  1ZAR A;  2XAQ A;  1XCV A;  1LB2 A;  4Q5S F;  2H09 A;  2XAH A;  2YX7 A;  3WU0 A;  5IT3 A;  5CLS A;  3HOS A;  2V1D A;  4WXH A;  2WC2 A;  4ENN A;  3EYI A;  4S04 A;  1KGS A;  4G94 A;  3ECH A;  2RDP A;  1P4A A;  3QPH A;  4U7D A;  1O3T A;  2E1N A;  1IN8 A;  1MGT A;  4F7Z A;  2PLY A;  4JBA A;  3VOE A;  2NNY A;  1KU3 A;  4HA8 A;  1EH7 A;  1ZAO A;  3MZH A;  4EJO A;  2WTE A;  5ICG A;  1FYL A;  3VFZ A;  3JTH A;  4CDG A;  4P9F A;  4ZYG A;  3ZMV A;  1LJ9 A;  2FBH A;  1FBQ A;  4P9U A;  1TBX A;  1JHF A;  3R0A A;  2CO5 A;  2FF4 A;  4M71 A;  3WTT C;  2VBY A;  1QGP A;  2O03 A;  4YG2 F;  5LGT A;  5L3F A;  3R6S A;  5JR3 A;  3C1D A;  3TDZ C;  1KA8 A;  5DUI A;  1J9I A;  2DAO A;  2ZCW A;  4ESF A;  3HUG A;  2F5C A;  2L4A A;  1HST A;  2LSO A;  4CGZ A;  1RUN A;  3EYY A;  4WX9 A;  1CF7 B;  3JW4 A;  1IF1 A;  2ZO4 A;  4BHB A;  1T39 A;  1T0F A;  4YFX F;  4LJZ F;  5LEJ A;  2WWY A;  5LHG A;  3W6J B;  1U3E M;  4OMY A;  1ULY A;  3MWM A;  2Y75 A;  4HDV A;  1XSV A;  2HFH A;  2WV0 A;  2AXL A;  1JE8 A;  1QPM A;  1SD5 A;  2QZ8 A;  4TV7 A;  3IKV A;  2FBK A;  2D2W A;  5E20 A;  1S7O A;  4UVB A;  3ECO A;  4NB5 A;  2IRF G;  2Q2E A;  3ZMD A;  1SFE A;  2P5V A;  3GZ5 A;  4YFN F;  1YYV A;  1USS A;  4XRF A;  1W5S A;  2MC3 A;  4PZJ A;  4AWX B;  2DFI A;  1ZRE A;  4IHT A;  1LQ1 A;  2CWE A;  4HDU A; 
#chains in the Genus database with same CATH topology
 3QU3 A;  4KDP A;  2NYX A;  4OIR F;  4Q47 A;  4RB1 A;  1HW5 A;  4FET A;  1BIB A;  3TGN A;  4D5F A;  3M8E A;  2HZT A;  2STT A;  1B6A A;  2OCE A;  1A04 A;  3E6B A;  3LFK A;  2L9R A;  3WGI A;  1RET A;  5TIS C;  4KT5 C;  3LSH A;  3GFI A;  3MKL A;  3HKZ N;  2DMQ A;  1MSE C;  3PM1 A;  5A2Q Z;  1NK2 P;  4EJW A;  1UEL B;  4IRH A;  2ISZ A;  1SAN A;  2EV0 A;  3PQK A;  1W7P B;  2HDD A;  1APL C;  4IPA A;  5F08 A;  1TWC J;  3LST A;  2DOE A;  4WXC A;  4BH9 A;  4IKF A;  1K78 B;  4IL6 C;  1VFC A;  5GAD J;  3VDX A;  4XMY A;  1BJA A;  2ME0 A;  4HNT A;  3KET A;  4O5V A;  1ENH A;  1OLT A;  3PNT A;  4RB0 A;  4IOA F;  2JTV A;  2O7O A;  4FT8 A;  2CGP A;  3R60 A;  4F52 A;  1YX3 A;  4PFO A;  4JQF A;  1R22 A;  2CV0 A;  4C2U A;  2DBB A;  2NOG A;  3HYI A;  5BQT A;  1OMI A;  1IDY A;  2V9K A;  1NHA A;  1QVT A;  1YS7 A;  2EFQ A;  5HLI A;  1MMS A;  4LIU A;  1QU3 A;  1GV5 A;  2W7N A;  2VAS A;  2EH3 A;  3CJQ B;  3FMR A;  5EG0 A;  3DPL C;  4HLY A;  3AKZ A;  1YIO A;  1OCR H;  1LVK A;  2RN7 A;  4A6E A;  3L1P A;  5LRS A;  5DV5 A;  2VIX A;  5HNH A;  1WJB A;  2EFW A;  1IRX A;  1JJ8 C;  2PBI A;  4L9N A;  1VQ5 I;  4BL0 B;  3K2A A;  2IXS A;  1E3P A;  1WPK A;  3A1Y A;  3OR1 C;  4GFB A;  5HLH A;  5J1R A;  2BVM A;  5JLX A;  2XAS A;  2H6C A;  5B1A H;  2JPB A;  1FTT A;  2OU2 A;  3BOQ A;  3I71 A;  1P4W A;  2FOK A;  2K4B A;  4EMS A;  1SMY F;  4C3J J;  2K3F A;  4FX4 A;  5FLM J;  3HTS B;  3QYB A;  2RGV A;  2VKV A;  3CCR I;  1MZB A;  3BG6 A;  3M8F A;  3OOP A;  2BV6 A;  1MBE A;  4QTR A;  2IJL A;  3H5A A;  1LVA A;  5HVQ C;  2R7F A;  4NHJ A;  2RAE A;  3FM3 A;  3KCC A;  2E36 A;  4A93 J;  4V2G A;  1VI0 A;  2MH2 A;  4L9T A;  3WHC A;  4LB5 A;  4QPQ A;  1YJ9 I;  2QBY A;  5M5Y J;  1IXS B;  3OYI A;  1SD7 A;  1XCB A;  1R58 A;  5EEG A;  1F4K A;  3WGH A;  3KPH A;  3T0Y A;  1XGS A;  3RJP A;  1DQU A;  2Y9Z A;  2HOA A;  3QRF F;  2M4G A;  3C2B A;  3DF8 A;  2QKL B;  3CCQ I;  5GAE J;  4KUM A;  4IEJ A;  5K5Q A;  2JA6 J;  1ZTR A;  3VOD A;  3F3X A;  4ENM A;  3VWB A;  1IC8 A;  4D7M A;  3GME A;  4EGY A;  1TLH B;  2KZV A;  3KLN A;  3M9A A;  3R4K A;  3CCU I;  2HVQ A;  3FMS A;  2Z33 A;  2G0E A;  5DUK A;  1PYV A;  4OIO F;  3KZI C;  1BR1 A;  3G6E I;  1MNE A;  1Y39 A;  1GXQ A;  1I1S A;  2JSP A;  1RUO A;  3SEQ A;  5GTI C;  3I64 A;  1ZKG A;  2E60 A;  1VND A;  2HTJ A;  4XNF A;  4PCQ A;  2DMN A;  4ESB A;  3W2W A;  3FM5 A;  5ED4 A;  2CUJ A;  5DM7 F;  2EV5 A;  5EEH A;  4LG0 A;  1MMG A;  5C3E J;  3LSM A;  4NUB A;  2TDX A;  4BQO A;  4XLC A;  2H8R A;  4E7S A;  4XOR A;  3K70 D;  4IRG A;  1D1B A;  1P7J A;  3L9F A;  2KLO A;  4HEA 2;  4G7H F;  3GFM A;  1K6Y A;  3OYJ A;  2KRH A;  1AU7 A;  3BP8 A;  4BEH A;  3UKG A;  4RA2 A;  3KEQ A;  4EVI A;  3KYC B;  1XGO A;  2JN6 A;  1UCR A;  3MQ0 A;  1JXS A;  1BC7 C;  2ICW G;  4O6J A;  2DW4 A;  4M6X A;  2DQR A;  2ECC A;  1IZ1 A;  2IA0 A;  2BXY A;  2ZME A;  4XON A;  3V8K A;  1X58 A;  3ZGK A;  5CVV A;  1NH3 A;  4RAY A;  1S9H A;  2X1E A;  2PJR B;  1QVU A;  4UV8 A;  4C2M J;  3CME I;  2R93 J;  3BR6 A;  1O3Q A;  1TC3 C;  4LLN A;  2PI0 A;  1CGP A;  3FXQ A;  2F5D A;  5H6Q A;  3BCA A;  3SZP A;  3KYL A;  2WAQ A;  3CJR B;  2DA3 A;  3V4G A;  5B5E C;  3HB9 A;  2LKS A;  4CSW A;  4OIN F;  3OR2 C;  1J7K A;  2E2I J;  3PUB A;  3D5R C;  5L3C A;  3PO2 J;  4OAY A;  2F5V A;  2KZG A;  1RC9 A;  1QNT A;  1L3L A;  3HM5 A;  5DM6 F;  2K86 A;  4I2O A;  2GWR A;  5DCM B;  3I4P A;  4PGH A;  3FXK A;  4M73 A;  5CYV A;  2VI6 A;  4M6V A;  3A01 A;  1NG6 A;  3HOW J;  1MBJ A;  2XGE A;  2DDA A;  4EM0 B;  1IJW C;  1DU0 A;  5FRO A;  1X1C A;  2EPF A;  2DU9 A;  1Z6R A;  4AUX A;  1ZGW A;  1S72 I;  3TW7 A;  2IGK A;  1LE8 A;  1J5Y A;  3E5U A;  1ON1 A;  3Q9S A;  1KZH A;  1UG0 A;  1SMT A;  2F2E A;  3K4J A;  4HSR A;  3RKX A;  4AD9 A;  1T2K A;  1W7P D;  4U0V A;  2FQ4 A;  3CCM I;  1RKW A;  2HXO A;  5ICF A;  3MN2 A;  3K4N A;  1BA5 A;  2CH0 A;  3ERE D;  4BQA A;  2LMD A;  3KP5 A;  3DBH B;  1Y1W J;  1BI0 A;  2X0L A;  2A6T A;  4NBQ A;  1MDM A;  1ZGA A;  1JUP A;  1MMA A;  5LD2 C;  2IGM A;  1YJN I;  2E1M C;  2PX9 A;  1P4X A;  5KVR A;  1U2W A;  3G3Z A;  3GCM A;  5ERI A;  3LAP A;  4NC8 A;  5E8I A;  1XDU A;  4MFD A;  4PK4 A;  3CTA A;  4CH7 A;  1PP8 F;  2XKP A;  4BHC A;  3JRG A;  1MBK A;  2A69 F;  2CS3 A;  1A36 A;  2V1U A;  3S93 A;  3HSE A;  4RAZ A;  2W84 A;  4I76 A;  3LSK A;  3TL4 X;  3ULQ B;  4DYR A;  2Z3Y A;  3CP8 A;  5BNG A;  2VQG A;  1G3W A;  2GAU A;  1K83 J;  2GQQ A;  2DFF A;  1ZH5 A;  2EIJ H;  4A12 A;  1P92 A;  2HDW A;  2EB7 A;  4M9S A;  5B66 C;  2JZY A;  3LWF A;  4RAF A;  1T8I A;  2UXX A;  1V3F A;  1T33 A;  2LP0 A;  2OZ6 A;  1KQ8 A;  5FO5 A;  1WCM J;  1RR8 C;  1JI8 A;  1DU6 A;  1MKM A;  5KNL A;  2IS1 A;  3SEZ A;  3OYB A;  2DK8 A;  1TNT A;  2HPI A;  2DN0 A;  1R36 A;  1UST A;  3ABU A;  3MVP A;  4PJJ A;  2ZXJ A;  2DOF A;  1X1P A;  3GUD A;  1G4D A;  5BS6 A;  1R7J A;  4DYQ A;  4A3I J;  3CDI A;  3OV8 A;  2XF7 A;  3F21 A;  1WJA A;  2A05 A;  2HKX A;  4N4N B;  4F92 B;  3H3U A;  3P9I A;  2D5V A;  1AKH B;  3RYP A;  4RAG A;  3ZP5 A;  3PNV A;  2DFH A;  2QLZ A;  3HOV J;  1Z67 A;  2E1M B;  1SVO A;  5E1W A;  2COM A;  4BAC A;  4YIR X;  3HZJ A;  2KKO A;  4CA0 A;  3H5R A;  2RQQ A;  3E6D A;  2IA2 A;  4HV5 A;  1Y0N A;  1T08 B;  1WFX A;  1OCT C;  3OSF A;  2PN6 A;  4F93 B;  1X3W B;  4BEH B;  4ZH4 F;  5LRR A;  1O3R A;  5K5O A;  2QQ8 A;  2FUG 2;  2WAQ N;  2L7M P;  3QAH A;  2CMP A;  4G6D A;  2JRT A;  1O7F A;  3J81 Z;  2DQL A;  2ZME B;  2PQ8 A;  1KU9 A;  2OTJ I;  3GFJ A;  2KJB A;  3FK6 A;  2DA2 A;  1X2N A;  3HOZ J;  5C4X J;  2E34 A;  4B3X A;  3CUQ A;  3V7S A;  1FPQ A;  2XUB A;  3RPQ A;  3CCS I;  4E7Z A;  1A6I A;  2PMH A;  2O6G E;  1TWA J;  3S16 J;  3I5U A;  1G8X A;  3BJO A;  2M5W A;  2HVR A;  2HYG D;  4A3J J;  3NEU A;  2M1B A;  5FLX K;  1QO0 D;  4V2F A;  3WTX C;  4B4C A;  1FOW A;  1X4O A;  3E5X A;  4HPQ A;  4BBR J;  4AIH A;  5CPR B;  5EJC A;  4M74 A;  1Z7L A;  3HRT A;  4YIF A;  4II3 A;  3QOD A;  2QQA A;  3PSI A;  1QBJ A;  2VKE A;  1IW7 F;  3S1Q J;  2LC2 A;  2BY0 A;  1QA6 A;  5LFA A;  2L2O A;  4I98 B;  2BZT A;  3HXL A;  2XSJ C;  5J1Y A;  3H36 A;  2K02 A;  2VC1 A;  2HI3 A;  2R7U A;  2QM3 A;  4HF2 A;  2X4H A;  2TCT A;  1IRZ A;  2A6E F;  2N8G A;  3LA7 A;  3WG9 A;  2R7T A;  1K79 A;  1BL0 A;  4B1R A;  3Q3S A;  2E1O A;  2DLL A;  2M3A A;  1D1C A;  3M4O J;  2HDC A;  2XF6 A;  1WJ5 A;  4XRM A;  3GTO J;  4EM1 A;  4LFU A;  5HOO A;  2IS6 A;  3AG4 H;  4MEY F;  1LPQ A;  1D5V A;  4BXU A;  3HKZ A;  1BW6 A;  3OS2 A;  4KN7 X;  1S6L A;  2KJC A;  3JRI A;  4BJ6 C;  4M3D A;  4K2E A;  2HS5 A;  2NOJ B;  1D5Y A;  5HS9 A;  3KEO A;  2RRE A;  1Z77 A;  1FYM A;  2VPR A;  4A3C J;  3CJT B;  3GLL A;  3L2Q A;  1VTN C;  4XRS A;  4E7I A;  5CJ9 A;  4WK8 F;  4A3F J;  2CQN A;  3V7R A;  3SXY A;  3ISP A;  1LUJ B;  4CUG A;  4A0Y A;  1F1Z A;  1L0O C;  1R1V A;  5DD4 A;  3K1P A;  1WRJ A;  3JTG A;  3OYN A;  1SAX A;  5DS9 A;  4EEF G;  1VQO I;  3FBN B;  2E2H J;  2LKX A;  3DEW A;  4I0A A;  1HQC A;  2UV1 A;  4KN4 X;  3OYE A;  2R3S A;  2AS5 F;  3WOD F;  3S2W A;  2H1K A;  3E6C C;  4AC0 A;  4OWR B;  3S2D J;  1MW7 A;  1FMW A;  1RNL A;  4KIB A;  2ZJR F;  2A6H F;  1LE8 B;  3L2U A;  4ESJ A;  1ETO A;  3SQN A;  2HU9 A;  4S0H B;  3SYT A;  1N77 A;  2XAJ A;  2YX4 A;  2P8T A;  1ETV A;  3GWZ A;  2ME6 A;  1KU2 A;  2W4S A;  3X2Q H;  2ZXI A;  3DQV C;  3QP6 A;  5DCM A;  3R61 A;  2ACJ A;  2PMZ A;  4ITV A;  4J01 A;  1XC5 A;  3ZMT A;  3ZPL A;  4DW6 A;  1YE9 A;  3KEY A;  2X48 A;  1IXR C;  4M6Y A;  2FJ1 A;  2WY8 Q;  4LOC A;  1JKP C;  3C3W A;  3SJM A;  1F43 A;  3JRB A;  4UUV A;  4I09 A;  1FSH A;  3C2G A;  2DA4 A;  4GYG A;  3RIR A;  1XB4 A;  5K1Y A;  3BC8 A;  3RQ4 A;  5CVI A;  3KP7 A;  1TW3 A;  2OC6 A;  2VXD A;  1MMD A;  1MD0 A;  4FE4 A;  9ANT A;  3BLY A;  2L54 A;  4CYC B;  3HDD A;  2FEZ A;  4MFE A;  2HTS A;  3L7W A;  1YW9 A;  5H2F C;  3JR9 A;  1IXC A;  4YFK F;  2ELJ A;  3EUK L;  2ZFW A;  1KU7 A;  5D8K B;  3MCZ A;  4ZDP A;  3HG9 A;  2FNA A;  1LEB A;  2ESN A;  1YG2 A;  4L5E A;  2Z2S B;  1K78 A;  3QYE A;  1MJB A;  1XGN A;  3SZT A;  1ONV A;  1FLI A;  2XPW A;  1RIO H;  2CYY A;  1ON2 A;  1FNN A;  1G3T A;  2DOA A;  3CC2 I;  3I4N J;  3FDY A;  2EIL H;  5F04 A;  1RZ4 A;  3HEF A;  1K6O A;  2XC7 A;  1YI2 I;  1WSU A;  2WAF A;  4FE7 A;  4W97 A;  1PJR A;  4BY1 J;  4Y13 A;  4E6K G;  1R00 A;  1MBH A;  2X6W A;  2FBI A;  3HHG A;  3KZY A;  4XKW A;  2K27 A;  4MHG A;  4DZJ A;  1Y56 A;  1F9N A;  2H94 A;  3KYD B;  2Y2Z A;  2MGQ A;  4AIJ A;  4MIM A;  4ZYE A;  5FJ8 J;  5TRD A;  2GOX B;  4XID A;  2XGC A;  5FRN A;  2JA2 A;  5IT9 K;  1ETW A;  2MD5 A;  3CMM A;  5ICE A;  4LG3 A;  3HHH A;  2YU3 A;  4CO8 A;  4I0B A;  4DBR A;  1GT0 C;  2ZJ2 A;  1ZRC A;  2E5Z A;  2AQE A;  2DMU A;  1GV2 A;  4AID A;  4FX0 A;  2K40 A;  1S8N A;  4JP0 A;  1MND A;  4BXX J;  2IGO A;  3I58 A;  2B9S A;  2Y30 A;  5LHH A;  3BZC A;  1ACI A;  1S5L C;  2LR8 A;  2KIU A;  4HX4 A;  4Z2Y A;  2WY7 Q;  2Y0S A;  2GXA A;  4CCN A;  1R9T J;  1SVL A;  2GXB A;  1HSJ A;  5D5U B;  5CVR A;  1G3Y A;  4WXD A;  5D5X B;  3CLQ A;  3DTK A;  2IEK A;  4A5M A;  2KIS A;  1WH7 A;  1T56 A;  1GVJ A;  3F8B A;  1SFO J;  1Y1V J;  2CUZ A;  3J7A O;  3K4C A;  1IV6 A;  3H9J A;  4Y17 A;  4XN0 A;  2CFX A;  3H92 A;  4UHT A;  4C30 A;  2K9L A;  4ZZD A;  4AVP A;  2HNH A;  4HBL A;  4E7J A;  4ASN A;  3DLL F;  4XR6 A;  3VPR A;  2R7Q A;  4IZZ A;  3G1O A;  5F0F A;  5HLT A;  5E3N A;  2V6E A;  4MTD A;  1BOB A;  2BY3 A;  2JVG A;  1K7A A;  1EA3 A;  3PJR A;  3BQZ A;  2G7H A;  2VOP A;  2BBY A;  3RKW A;  1VQP I;  3CCV I;  4BKX A;  3WE2 A;  4IHS A;  5HDK A;  2WV1 A;  4AIK A;  2LBF B;  2GIZ A;  2JRM A;  1FTZ A;  1W5C C;  2JJ7 A;  4BE2 A;  4A3G J;  1OKR A;  2Y0M A;  3HJE A;  3WTY C;  2KIF A;  5HS7 A;  3JSO A;  1A35 A;  1FY7 A;  3DBR B;  1B72 B;  3L2C A;  1TQP A;  3OIP A;  1YW8 A;  1ZK8 A;  2VBW A;  4HQM A;  1RRJ A;  1POG A;  1T95 A;  2OCC H;  4BU2 A;  4KJZ A;  3ZR8 X;  4NQW A;  4UUS A;  4X1E A;  3S14 J;  2EWN A;  3EUH A;  1DP7 P;  3GX4 X;  1S3J A;  1ETK A;  4U88 A;  2XGD A;  3OIO A;  2VT2 A;  3ABK H;  2EFP A;  2E5N A;  1R5I D;  1IN4 A;  3O2P E;  2HGC A;  3BPV A;  3A0B C;  3OL3 A;  2R92 J;  2ZXW H;  5GAG J;  1ETY A;  3H3Z A;  3RQI A;  5LLQ A;  5HOD A;  2CSO A;  1VQK I;  2E7X A;  2PEX A;  2ZNY A;  4PDK A;  2VE9 A;  3ZRG A;  3FZV A;  2DA6 A;  1YW7 A;  4J00 A;  2LYC A;  2VOD A;  3AG3 H;  3ZXS A;  2FOW A;  3EDP A;  2LY1 A;  4N9H A;  2MYS A;  5FD5 A;  1STZ A;  2FSW A;  1H0M A;  1FOK A;  5E1Z B;  2X85 A;  1V54 H;  3BTC A;  2XB5 A;  2VQL A;  3TDU C;  1FJL A;  5GAH J;  4IQ4 A;  1B59 A;  1C0W A;  3GBG A;  1YS6 A;  4A3K J;  2EQR A;  3ZMZ A;  5L3B A;  1EKE A;  3C18 A;  2BEO A;  1OR7 A;  4Y33 A;  1ZG5 A;  3H3V K;  4LD5 A;  3TO7 A;  3T8T A;  2W24 A;  1HW2 A;  4KIF A;  4AVZ A;  2ZNZ A;  2NNN A;  1ITY A;  2DPU A;  4NC7 A;  1B8I B;  5M5W J;  2BHY A;  3CJN A;  3ABT A;  1JT0 A;  3NWT A;  4HG2 A;  4XLN F;  2G7U A;  3ABM H;  4QSH A;  3BDD A;  5BPI A;  5C44 J;  1J2X A;  2FX0 A;  2L7Z A;  2L01 A;  1AWC A;  2LRE A;  4XKV A;  2MD0 A;  3OYL A;  2QKM B;  2L4M A;  1FP2 A;  3ZQI A;  6PAX A;  2O5R A;  1SVM A;  4B3A A;  3W6V A;  3AL0 C;  2W48 A;  5E3L A;  3M07 A;  2ZFU A;  1SC7 A;  4JYK A;  1ZGJ A;  5E3O A;  1I27 A;  4A3B J;  3F8M A;  2XPU A;  4HX7 A;  3PL8 A;  1LEA A;  1TNS A;  1ETX A;  2F5E A;  2CW8 A;  3I55 I;  1H9T A;  3GZN B;  2BXZ A;  4EM2 A;  3BZ6 A;  1B4A A;  3RDI A;  3RTR A;  1PVE A;  3F0C A;  4XK4 A;  5D6E A;  5FLX Z;  3Q5F A;  2MSY A;  4BE0 A;  3CUO A;  4JX4 A;  2LF8 A;  4M9X A;  4ZYH A;  3ZQF A;  2MH9 A;  3S17 J;  2VE8 A;  2OUM A;  2XGX A;  3HOY J;  2EK5 A;  1MBF A;  3SDB A;  5ILV A;  2F6C A;  5JHU A;  4D5C A;  2X1D A;  3EUA A;  1JKR C;  1PUF A;  2VQH A;  2CQQ A;  3MKY B;  2EZI A;  2RVC A;  3CCE I;  3OOU A;  2CFO A;  4KA4 A;  5ILU A;  2GLO A;  2VQC A;  4C9Y A;  2LLK A;  4PJN A;  1MJA A;  4P96 A;  2VLA A;  2HOT A;  2KPM A;  2DT6 A;  5E79 C;  2MLK A;  5J8C A;  1I3Q J;  2P5K A;  3IAM 2;  1CQT A;  2E2J J;  5EYR A;  1FBS A;  5F6F A;  4B43 A;  5J47 A;  3A03 A;  3FHZ A;  2P81 A;  1R4M B;  5L3G A;  4ZYD A;  2ETH A;  2X51 A;  4OIP F;  3CCJ I;  2O3F A;  2M87 A;  2HR3 A;  2KRC A;  2K9Q A;  3LMM A;  2KMU A;  1U9O A;  2VJ4 A;  2MBF A;  2NVY J;  2H8W A;  3ASO H;  3FKI J;  1FP1 D;  3F72 A;  1WVR A;  5FD6 A;  1I5Z A;  5GTH C;  2CQX A;  3HOX J;  2OAZ A;  4IHW A;  1R71 A;  3P9K A;  1QZZ A;  1WJC A;  2H1L A;  2KQR A;  2PMU A;  4A69 C;  3U9G A;  2MG4 A;  2NVX J;  3CLO A;  4LK1 F;  4IRI A;  1A31 A;  3BTI A;  5GPC A;  3IWF A;  4A3M J;  3BG9 A;  4HLX A;  1YFH A;  2EZH A;  1I6X A;  5D4S A;  2VPL A;  2CW0 F;  2KRF A;  2K9S A;  1XGM A;  4A0Z A;  3L09 A;  2ZSH B;  3CMY A;  2YR2 A;  3KFW X;  4L9J A;  2EIM H;  2P0W A;  5L3E A;  4L18 B;  1YRN B;  4ZTJ A;  1QHH D;  1PUE E;  5E18 F;  1HXD A;  4KNY A;  3LQR A;  4BHP A;  2CUF A;  3ZN1 A;  2UXN A;  2Y9Y A;  4BS9 A;  4DQ2 A;  2RKH A;  2L02 A;  2QF7 A;  3K4M A;  4A3E J;  2HZD A;  4D9J A;  1PDN C;  4M3E A;  3U1D A;  2QSH X;  4RGU A;  2LOO A;  5AIP A;  1DUX C;  1XG1 A;  3RPU A;  4KIG A;  1N78 A;  3UNG C;  4QLC U;  5LGN A;  3H0G J;  2K9M A;  4CZZ A;  3DEU A;  3VYU B;  3RZO J;  4RGX A;  1A5J A;  1IUF A;  2KIM A;  4M72 A;  1Z91 A;  3RKY A;  4GXO A;  4L5J A;  5IPA A;  5K5R A;  2IVM A;  4N9I A;  1W7P A;  3O3K A;  4RB2 C;  2YPR A;  4LGW A;  3A2K A;  1I50 J;  5EZH A;  1QQI A;  3C7J A;  2WB1 N;  4F3Q A;  3S8P A;  1T0F C;  2GXG A;  3BJA A;  2IW5 A;  1EH8 A;  5EGO A;  3GXO A;  1I3A A;  4CXF A;  4KT6 A;  4HZF A;  3HRM A;  1H88 C;  1DGR M;  2FNP A;  4XLF A;  2R7R A;  2XRN A;  2DI3 A;  5LEK A;  2ZXH A;  1UHS A;  5HNF A;  1ZYR F;  2ELH A;  2L7K A;  4XLH A;  1IUY A;  2GA2 A;  1KYW A;  4KMF A;  1HKT A;  3JRA A;  2OD5 A;  2VJI A;  2DA7 A;  4XOP A;  2V79 A;  1WJE A;  4KMU X;  4ETS A;  3ZMU A;  2ZJQ F;  2QVO A;  2CJJ A;  4R8H A;  1NK3 P;  2HWV A;  3TO6 A;  2VN2 A;  1WQ2 A;  3SDG A;  3VEP A;  3OYC A;  2RC4 A;  3HBL A;  2R7O A;  3G71 I;  2HOE A;  3QPL A;  5J40 A;  2VL8 A;  1EF4 A;  3CO6 C;  1IO2 A;  2EJR A;  2W00 A;  2JQ7 A;  5LHI A;  4CHU A;  3GFL A;  2BYV E;  5KHD A;  1UFM A;  3I54 A;  1I6H J;  4OAZ A;  3GTK J;  3DBL B;  2LD5 A;  3GYH X;  5JI6 A;  2YSR A;  3Q0V A;  1OYI A;  3FXM A;  5TJJ A;  3N97 A;  2QEN A;  1UHM A;  3REO A;  1T98 A;  3K1N A;  3WTU C;  2QBY B;  1LNW A;  1OJL A;  1G59 A;  3KP6 A;  1AOY A;  2AQF A;  2FA5 A;  4EAT A;  5FFX A;  3IRR A;  1E3O C;  5JFR A;  1R23 A;  2KDZ A;  4MQ9 F;  2BW3 B;  1AA7 A;  3AG2 H;  4OIQ F;  4IVN A;  1VZ0 A;  1LKX A;  3LOC A;  4IHV A;  4OU0 A;  1TTY A;  3WTZ A;  3WG7 H;  1S7A A;  2CW7 A;  1SD6 A;  2IS2 A;  2PMZ N;  1BW5 A;  1DPR A;  4MO7 A;  3VB2 A;  2IAI A;  1HW1 A;  3BZK A;  3S3O A;  3H0D A;  3ML6 A;  2FXA A;  4WCG A;  4E7H A;  2G9W A;  1QHG A;  2P6T A;  2CU7 A;  1UAA A;  1MJ9 A;  4RM2 A;  4EJU A;  2D1H A;  4EJT A;  4B44 A;  3H9Q A;  1LDK B;  1XPX A;  3F22 A;  3E5Q A;  2Q0O A;  2Q1Z B;  4G6Q A;  4RM3 A;  1TWH J;  3DU5 A;  3KP3 A;  2XVC A;  2VUM J;  5KK1 A;  2L3D A;  1EJ9 A;  3MZY A;  1T6S A;  3J7A Y;  1HDP A;  2R5Z B;  1V5F A;  1NG7 A;  4I7H A;  1OFC X;  4B8X A;  3IC7 A;  3Q9V A;  1GHC A;  4U87 A;  2HQN A;  2E7W A;  4XLE A;  1O4X A;  2ZKZ A;  1BIA A;  1R5G A;  5HLG A;  2OF7 A;  1W0U A;  3A01 B;  2DT7 B;  3WTW C;  2XPV A;  1WI9 A;  2R7S A;  2DOD A;  1IN5 A;  4Z6Y A;  3QWL A;  2QQ9 A;  2Z1D A;  1YIJ I;  5J1U A;  2NS8 A;  3K9T A;  2DPD A;  4RGR A;  4JOM A;  5JHF A;  4MGR A;  3JAM K;  5IY5 H;  3LAJ A;  3P9C A;  1OR7 C;  3HGY A;  3MKZ A;  3VYT B;  3R0J A;  3ZCO A;  2ZJP F;  1ZN2 A;  5TGT A;  4BYY A;  2ZC2 A;  1OYW A;  2A5W A;  3L00 A;  1JTY A;  1XS9 A;  3G4S I;  1J0R A;  2M0M A;  3LNQ A;  4ZYA A;  5F27 A;  3GVA A;  4U7B A;  1WWX A;  3CUQ C;  4D1Q A;  3M8J A;  4YEL A;  5D8L B;  3M1C A;  5J6X A;  5CVJ A;  1HLV A;  4IQJ A;  2A3S A;  2JMW A;  3GEZ A;  1DGW Y;  3HTU A;  1P6R A;  3ZQC A;  2GIV A;  1OCP A;  2IPQ X;  3DWL E;  3J80 K;  3IL2 A;  3CCL I;  3KP2 A;  2F5F A;  1XDS A;  1J59 A;  2HQR A;  3OL4 A;  4PFP A;  1X1D A;  1Z9C A;  1RKT A;  1K61 A;  3H35 A;  5DDG A;  1RI7 A;  4HNV A;  2RNG A;  4RDU A;  2VT3 A;  1W4M A;  2DO7 A;  5B1B H;  2GOM A;  1ZQ3 P;  3AFH A;  5JLW A;  1XTA A;  5KAF C;  1K4S A;  1VQ6 I;  5DTD A;  1ZG3 A;  1HKS A;  1Y0U A;  2A61 A;  5DD8 A;  2W57 A;  4FIS A;  2LF7 A;  3WHB A;  5IP7 J;  2OA4 A;  2HOS A;  4KIT B;  3S3N A;  2O8X A;  1LFU P;  3RSN A;  3B02 A;  3IWZ A;  3K7A J;  3NRV A;  5BOX A;  4G7Z F;  1Q1V A;  3LA2 A;  5BMZ A;  3LL7 A;  5F64 A;  3TOA A;  3TO9 A;  4KIS A;  3BR3 A;  4L0Z B;  2EV6 A;  4RB3 C;  3N05 A;  1MH3 A;  3L2V A;  1Z3X A;  4ANJ A;  4P5O A;  4PJL A;  3A4C A;  1I1G A;  1N25 A;  3SZG A;  5M5X J;  3FXU A;  2QSF X;  1Z6T A;  3HIF A;  3VSK A;  1VQ8 I;  4L5I A;  2MLG A;  3OYD A;  3D5S C;  3JCU C;  3S15 J;  2FD5 A;  3N4M A;  5A2Q K;  2OTL I;  2PJP A;  4D7N A;  2STW A;  4O3M A;  3W2A A;  5EGO B;  2L9V A;  2GA1 A;  2LNB A;  3CO7 C;  4HAM A;  1KQ9 A;  4PSW A;  1X1B A;  1B9N A;  3CDH A;  1QRY A;  3IH2 A;  3T8R A;  3V8L A;  1R49 A;  1UB9 A;  4M3F A;  1FX7 A;  1BR2 A;  2VB6 A;  5D6F A;  3K1M A;  2ISY A;  1E3H A;  2JT1 A;  1CF7 A;  5F1R A;  5LBQ A;  1BBY A;  3I59 A;  1NTC A;  4RLF A;  2BY2 A;  4UXN A;  3HC7 A;  2CV2 A;  2NVQ J;  2HYF A;  4MEX F;  5FKO A;  1FC3 A;  3M3Y J;  3BR1 A;  4RS8 A;  2HPM A;  4YII A;  4IXA A;  1REP C;  3TW6 A;  3OS1 A;  2P5L C;  2JK3 A;  3GTQ J;  2K7L A;  3FMQ A;  3A0H C;  4CYC A;  3WU1 B;  2ESH A;  1D0Z A;  4XSX F;  2XAU A;  3I59 B;  5D5W B;  4XRS G;  1BI1 A;  2QYO A;  4ENK A;  1WGX A;  3D5L A;  2OQR A;  4ZDL A;  1ZHF A;  2DDB A;  3KX2 A;  4F91 B;  4XBF A;  2KL4 A;  1RR7 A;  2P7V B;  3NAR A;  4XKB A;  3BRO A;  3FWE A;  3M7G A;  3P7N A;  5ILS A;  2NAZ A;  5IYD J;  2YUS A;  1OPC A;  2VBX A;  4AU7 A;  4AYB A;  4XQF A;  4MQV A;  3DV8 A;  3IP4 B;  1EV7 A;  4L0Y B;  3E0J B;  1IV8 A;  4FQG A;  3JRC A;  4Y7N J;  2FMY A;  3KP4 A;  4C3H J;  1ZLK A;  3BTJ A;  2V9P A;  2JUC A;  2QWW A;  3GW2 A;  5FFZ A;  1IRG A;  3DKW A;  1D0Y A;  3OYK A;  4IHX A;  3DEE A;  3PFI A;  3WE3 A;  3CD6 I;  1Y8R B;  4LLL A;  1HOM A;  1MH4 A;  4A0X A;  2E35 A;  1R1T A;  4I99 C;  5DYM A;  3LQQ A;  4XM3 A;  2H6B A;  3I9V 2;  2IP2 A;  3CDL A;  3KZZ A;  1WZ2 A;  5IT9 Z;  3DFG A;  1U5T C;  1X2M A;  2E19 A;  3V7C A;  1KON A;  3CZ6 A;  1WHU A;  3BY6 A;  1LDD A;  3F8F A;  3GTJ J;  3W2V A;  4MNU A;  1R1U A;  2BGC A;  4CCK A;  5FKM A;  4YRV A;  3JRF A;  4D0P A;  5L3D A;  5FGM A;  1U8B A;  3F23 A;  2COB A;  2R4G A;  4BDZ A;  2F48 A;  2EZL A;  2ADU A;  4XKC A;  2ID6 A;  5M3M J;  4E7L A;  5K7H A;  4BDY A;  4R1H A;  1YRN A;  1IG7 A;  1Q1H A;  2ID3 A;  4FHT A;  1UHW A;  1JT6 A;  2QQB A;  2P7C B;  1H8A C;  1K4T A;  4HF1 A;  3HRU A;  1JGS A;  3MFK A;  2XAG A;  2EFN A;  2F4O B;  3GO5 A;  4BNC A;  5E17 F;  4XL9 A;  2M45 A;  3NQO A;  4XN3 A;  3PIO F;  3F6V A;  1EH6 A;  1SFX A;  3OYM A;  3DLA A;  3PQJ A;  4GDF A;  1Y8Q B;  2OBP A;  5HDN A;  1MDM B;  3JRD A;  5D5V B;  1E2X A;  3OSG A;  1FZP B;  4DIQ A;  3HGG A;  2J5O A;  2DTR A;  5E8G A;  4WWC A;  3DP7 A;  4HX8 A;  4YEJ A;  1ZR2 A;  4G9Y A;  2R7V A;  3F8C A;  2LY2 A;  3PNY A;  4RBO A;  1FBU A;  1WKM A;  3Q0W A;  1SFU A;  3LFU A;  3I53 A;  2FML A;  4A5N A;  4DNC A;  3QYF A;  1XD7 A;  1U0J A;  2CG4 A;  5HDG A;  3I56 I;  2NRA C;  2M30 A;  3DKY A;  3KE2 A;  2V6C A;  1BM9 A;  1ETQ A;  2L0K A;  3ASN H;  3BR0 A;  5KCM A;  2R7D A;  1U5T B;  2DA1 A;  4M9Z A;  4OOI A;  1G3S A;  1V4R A;  2M34 A;  4FCY A;  3S1N J;  1FOX A;  1D3Y A;  2VXZ A;  5M3F J;  2VOO A;  4HW0 A;  2M0C A;  1Z1D A;  2FRH A;  1E17 A;  3HOT A;  2KHM A;  4W1U A;  3VSL A;  3M1E A;  4DBQ A;  4XIC A;  3I0T A;  3E6M A;  3K4K A;  2NS7 A;  1IAW A;  2EZK A;  2AXT C;  1OIS A;  1JUM A;  1W5T A;  4ZC3 A;  4EGZ A;  1HBX G;  1F5T A;  2C6Y A;  3P5J A;  2KFD A;  2JA7 J;  2PJR A;  2PG4 A;  3F6O A;  3SFZ A;  2A07 F;  1BJZ A;  2DJN A;  3FK7 A;  1RPW A;  1O57 A;  3EQL F;  2XF5 A;  5JVT A;  1W36 C;  4UY8 I;  1YX5 A;  2RQP A;  3V42 A;  3DCF A;  1YO5 C;  2R7W A;  2AO9 A;  3BCB A;  4C3I J;  3AAF A;  2V4J C;  2LK2 A;  2NXN B;  3O8H A;  4RLQ A;  1UJ8 A;  3ESW B;  3K4L A;  2HVS A;  3ZQL A;  2H27 A;  1B1B A;  2W85 A;  3F9K A;  2EIK H;  4IO9 F;  4L9V A;  4IJA A;  2OV7 A;  3PFY A;  1W1W E;  3K2Z A;  4PUS A;  4BE1 A;  5J4V A;  2R7X A;  2XSD C;  3BR2 A;  4E7K A;  1E0E A;  4CYD A;  4UB6 C;  3IAS 2;  5E3M A;  4KFC A;  1FYK A;  2CQ7 A;  3IUO A;  5LGU A;  2NVT J;  3FXL A;  3ROU A;  3HSF A;  1JTX A;  4M3G A;  3LSI A;  3DU6 A;  3QQA A;  2YS9 A;  2VJJ A;  2CUE A;  2DMT A;  2ZSI B;  2VC0 A;  4AYB N;  5IYC J;  1B72 A;  4BAY A;  1FEX A;  4PJ0 C;  3IKT A;  3S1R J;  4A3D J;  4LMY A;  4B48 A;  5B3S H;  2HXI A;  2ZME C;  2Y31 A;  2KT0 A;  2M7A A;  1OCC H;  4NQW B;  3V8J A;  2O61 A;  4BXF A;  1IN7 A;  3OYG A;  3WTV C;  3GTM J;  1D8K A;  3VYR B;  3BG5 A;  1HF0 A;  1Z7U A;  2JPC A;  2RNJ A;  1O7L A;  2XAF A;  1P2F A;  3RPU D;  3CF5 F;  3BQY A;  2IBD A;  1R4N B;  2LDU A;  5EZG A;  1R6R A;  3E97 A;  4S05 A;  3FF5 A;  5GP9 A;  4EV0 A;  3JSP A;  3FXR A;  4HV6 A;  1M1E B;  4LB6 B;  2W25 A;  1J75 A;  2EBI A;  2L7F P;  4Y4R A;  3MEX A;  4V19 K;  3PO3 J;  4G8X A;  3ABL H;  3TP3 A;  3FIS A;  3RKQ A;  2CQK A;  2OZU A;  1B9M A;  4JK1 X;  2GZW A;  3IRQ A;  1FSE A;  2HQ5 A;  2DA5 A;  1S29 A;  1XMK A;  2R5Y A;  4LK0 F;  3FXJ A;  2D1V A;  4M3B A;  1JKO C;  2MC4 A;  2Z16 A;  2V1X A;  1MBG A;  1G2H A;  4LG0 B;  4CCM A;  3MMY B;  2IA1 A;  2XRL A;  1MNM C;  2V9V A;  1SD4 A;  3J81 K;  2OJE D;  5FKK A;  3PSF A;  1HKQ A;  4BGD A;  3JRE A;  1TQI A;  2EA2 A;  5JVG F;  4LLG F;  3K70 C;  1D1A A;  4BJT A;  1R5H A;  2KP6 A;  2M4K A;  1TW2 A;  1KQ0 A;  1U6G A;  1XX5 A;  4IOC F;  3TOB A;  2BW3 A;  1MMN A;  2X9D A;  4I02 A;  2ECB A;  4UB8 C;  4RMN A;  2FU4 A;  2Z99 A;  5IYB J;  3G1L A;  1RES A;  4GCV A;  4WF2 A;  2QSG X;  4XOT A;  4DZP A;  2W82 A;  3CQZ J;  5AIQ A;  1Y6I A;  2V1N A;  1ERD A;  5D4R A;  3BWG A;  1SAU A;  3K10 A;  3PUF A;  2BE5 F;  3FHN A;  3MD2 A;  5CVU A;  5HS8 A;  2QGU A;  2GM4 A;  4LIT A;  2R0Q C;  1U8R A;  2CRG A;  2NVU B;  2XB0 X;  3BJ6 A;  1BI2 A;  1TWF J;  3AG1 H;  3E7L A;  3QPS A;  3OWT A;  3OIQ A;  4E4H A;  3CUQ B;  3LA3 A;  3BPX A;  4UV9 A;  2XRO A;  4F55 A;  4IX7 A;  2PFB A;  5CKT A;  4ON0 A;  4NNJ A;  4LIV A;  5FKN A;  2LH9 A;  4PGG A;  2Q8K A;  2V7F A;  1WI3 A;  2LVS A;  1ZLJ A;  3K69 A;  4HST A;  3E3V A;  1GUU A;  5FKL A;  1JHH A;  1UMQ A;  2IT0 A;  1D8J A;  4UNO A;  2HKO A;  3DXJ F;  2DCE A;  1VQL I;  1GXP A;  1Z0X A;  4P1W A;  2DT5 A;  4E70 A;  3D0S A;  5H6R A;  3IH3 A;  5J8F A;  3ZN0 A;  2EA4 A;  3HPG A;  4MTE A;  2ZBK A;  2AHQ A;  2W1O A;  4I01 A;  4BQQ A;  4EQQ A;  1FT9 A;  2XIG A;  2Z5U A;  2F4I A;  2HQA A;  4P55 A;  2FE3 A;  5FRM A;  3RCO A;  4J19 A;  1YTY A;  2V26 A;  4HYE A;  1BI3 A;  2XKO A;  3ZMS A;  1FMV A;  1UG2 A;  3AL0 B;  2LY9 A;  3RYR A;  3MKW B;  4EJV A;  1QZY A;  3ELK A;  2NS0 A;  1IGN A;  3J80 Z;  1ODD A;  4HOB A;  3SFI A;  3FIW A;  3OY9 A;  1IN6 A;  3W6K B;  4CIC A;  1HC8 A;  1VQ7 I;  3EET A;  2K3P A;  2MFZ A;  1JKQ C;  5H20 A;  3RI4 A;  3TQN A;  4I6Z A;  4ZJZ A;  1FOY A;  2DYR H;  3IHU A;  4GYI A;  2Z9O A;  2LTP A;  3DTI A;  4BJ5 C;  3O6B B;  3CC4 I;  3O8G A;  2P6S A;  1X1A A;  3HRS A;  2DFE A;  2R5Y B;  4H0E A;  4JX6 A;  2VBZ A;  1H9G A;  1Z05 A;  1V5G A;  2F4M B;  2WB1 A;  3TED A;  3TBI A;  1T38 A;  3ZQG A;  3BG7 A;  4Q4Z F;  3WGG A;  3KLO A;  2M7B A;  5EEA A;  5EDN A;  2OQG A;  2IGN A;  2VJ5 A;  4B09 A;  1TL8 A;  3BTL A;  3OYF A;  1KYZ A;  3OMY A;  1JJ6 C;  4KYW A;  2O8K A;  4Y15 A;  5BPD A;  1G6N A;  3TKY A;  1A6Q A;  3HSR A;  3SHF A;  3OS0 A;  3DKX A;  1YOV B;  1S7E A;  5F1J A;  3T1B A;  3U1K A;  3ERM A;  2Y48 A;  4DGW B;  3QU6 A;  4ZTF A;  4IF4 A;  4UUT A;  2LBF A;  3T5X A;  1YJW I;  4Y52 J;  3CCY A;  1XMA A;  3RZD J;  1FWZ A;  5KAI C;  4X6A J;  3GZ6 A;  4QIW N;  4ENJ A;  1VF9 A;  3CMA I;  2A5Y B;  2DTZ A;  2VON A;  2LKP A;  2UUZ A;  5IP6 A;  4UVA A;  4XSZ F;  4G7O F;  2JSC A;  2M2E A;  2XHK A;  5J4Y A;  2R5Z A;  1LFP A;  1BR4 A;  2K9N A;  1TZL A;  4OMZ A;  2K4J A;  3NAU A;  4QPO A;  1F36 A;  4G6T B;  2B7E A;  2DK5 A;  3K4B A;  4Q48 A;  1TQM A;  2XV4 S;  1DDN A;  2B0L A;  4U0W A;  1U78 A;  1VQ9 I;  5DCF A;  3G73 A;  2VKH A;  2UZK A;  4PJM A;  1MIJ A;  3U2R A;  1XN7 A;  4IHY A;  4A6D A;  1ZRD A;  1LDJ A;  3QOP A;  4XLP F;  3UR3 C;  4H4K C;  5FB2 A;  1O3S A;  1TT5 B;  3MAJ A;  3VYS B;  4N0B A;  1TT0 A;  4FAS D;  2WAD A;  4R79 A;  2EIN H;  1VQM I;  2A68 F;  3A02 A;  1XSX A;  4HF0 A;  4QWQ A;  3QOE A;  4JX5 A;  2DJI A;  3L2W A;  3F8N A;  1SFK A;  4A2U A;  3GLX A;  2D45 A;  2M8E A;  1OYY A;  2X1C A;  3JAM Z;  2DXI A;  2TRT A;  1VQ4 I;  3CP2 A;  3QPT A;  1BN5 A;  3GTP J;  4GO1 A;  2R7Z J;  1DPU A;  4UVC A;  3LSJ A;  3G1M A;  1YLF A;  4HRI A;  2MW8 A;  2QUF A;  3J7Z I;  3NWS A;  2UWM A;  3BR5 A;  3FX3 A;  2J5P A;  2QEX I;  3HPH A;  1U5T A;  4GGG A;  3WTS C;  1XSD A;  5E1X A;  1PP7 U;  4HQE A;  4NC6 A;  4GRI A;  2MA3 A;  4HNU A;  2B63 J;  5IOY A;  2JVH A;  3COA C;  2IS4 A;  1ZRF A;  3S3M A;  2L9S A;  1IRF A;  2P4W A;  4CCO A;  1BOA A;  4U0Y A;  4II2 A;  3QP5 A;  3K0L A;  5DEQ A;  1P7I A;  2E1C A;  1X3U A;  2FQ3 A;  3HOU J;  3E1S A;  1WJF A;  3L2R A;  1MSF C;  2HYJ A;  1YQA A;  1ZG1 A;  4N4O B;  4RGS A;  2KDO A;  3ZQ7 A;  5ICC A;  2LRD A;  2HEO A;  4ZZL A;  3HUG B;  3OYA A;  2EFO A;  2VKD A;  3FXO A;  2O0Y A;  2RV8 A;  3BT9 A;  1H89 C;  4KIC A;  3I4M J;  5AON A;  2OPT A;  3DPT A;  1OQY A;  3B73 A;  5EF6 A;  3GF2 A;  1BC8 C;  3MZ8 A;  3IH4 A;  1DP3 A;  3ZOB A;  1ZAR A;  2XAQ A;  1XCV A;  4BQN A;  4CCJ A;  1LB2 A;  1TWG J;  4CCL A;  5K7Z A;  4Q5S F;  2X6X A;  2H09 A;  3S32 A;  4PSX A;  2I5U A;  2XAH A;  1FIA A;  2YX7 A;  4MLO A;  1V5E A;  5IOZ A;  3WU0 A;  5IT3 A;  4CZC A;  1YIT I;  5CLS A;  3ZQH A;  5IP9 J;  3HOS A;  2Y0S N;  2BY1 A;  1D0X A;  1VQN I;  3W3C A;  4AM3 A;  2V1D A;  4WXH A;  2WC2 A;  4ENN A;  3EYI A;  3WU2 C;  3B6C A;  4S04 A;  1KGS A;  3U21 A;  5J3L A;  1IDZ A;  4G94 A;  1X4P A;  3CC7 I;  3ECH A;  2RDP A;  1P4A A;  3QPH A;  4U7D A;  2Y69 H;  1O3T A;  2E1N A;  1YHQ I;  2I8D A;  3DTE A;  4UUS B;  3LSR A;  1IN8 A;  1MGT A;  1N75 A;  1OCO H;  4F7Z A;  4DYC A;  4BUP A;  1W0T A;  2PLY A;  4JBA A;  3VOE A;  1GDT A;  2NNY A;  1X19 A;  2X6Y A;  3BG3 A;  1KU3 A;  1GLN A;  4HA8 A;  1J09 A;  2O9L A;  2MAB A;  3EUH C;  3ONQ A;  1U9N A;  1EH7 A;  3GTG J;  1ZAO A;  3GTL J;  1HCR A;  4NDL A;  3MZH A;  4EJO A;  4FTH A;  2WTE A;  5ICG A;  4ZDO A;  1FYL A;  4XLA A;  5EG0 B;  1LFB A;  3VFZ A;  1OCZ H;  3H9G A;  1P9Q C;  1X3Z B;  3CES A;  1ORK A;  3JTH A;  4P9F A;  4Y3O A;  4CDG A;  4ZYG A;  3ZMV A;  2K85 A;  1SEU A;  1LJ9 A;  1WH5 A;  2FBH A;  1FBQ A;  1QZE A;  4BY7 J;  1XMX A;  2X6O A;  4P9U A;  2KIQ A;  1TBX A;  1UZC A;  5CQE A;  4BBS J;  2M8G X;  1JHF A;  4G12 A;  3H1C A;  1JGG A;  3R0A A;  2CO5 A;  2FF4 A;  4M71 A;  3IV5 A;  3WTT C;  1W36 D;  2VBY A;  1AHD P;  1WJD A;  3I3L A;  2BHZ A;  4C2T A;  1V55 H;  3S2H J;  1QGP A;  2O03 A;  2ZB9 A;  4YG2 F;  5LGT A;  2E71 A;  2I10 A;  3R6S A;  5L3F A;  5JR3 A;  2DYS H;  3C1D A;  3TDZ C;  4ABZ A;  3B6A A;  1KA8 A;  2GBY A;  5DUI A;  3S1M J;  1J9I A;  2WA0 A;  3H5N A;  3D1N I;  2DAO A;  2ZCW A;  4ESF A;  3HUG A;  3Q0U A;  2F5C A;  2L4A A;  3C2H A;  1HST A;  5GPA A;  2CV1 A;  1HDD C;  4B47 A;  2LFB A;  2JUG A;  2ELK A;  5C4J J;  3HL2 A;  2LSO A;  4CGZ A;  3K6G A;  1RUN A;  3LSG A;  1AKH A;  2YU9 J;  3EYY A;  4WX9 A;  1ZR4 A;  1CF7 B;  2JA5 J;  3JW4 A;  1IF1 A;  2ZO4 A;  4BHB A;  1T39 A;  4DOZ A;  1T0F A;  2M9H A;  4YFX F;  4LJZ F;  5LEJ A;  3PIP F;  3OYH A;  3J7Y J;  2WWY A;  5LHG A;  3W6J B;  1U3E M;  4OMY A;  2Q2E B;  1ULY A;  1QPI A;  3MWM A;  3TP0 A;  4A3L J;  2L9N A;  2JWT A;  2Y75 A;  1HA8 A;  5F0C A;  4HDV A;  3KIO A;  1XSV A;  2JA8 J;  2HFH A;  2WV0 A;  2BOL A;  2QA4 I;  2AXL A;  4DJA A;  1JUS A;  1JE8 A;  1QPM A;  1SD5 A;  2L5Q A;  2QZ8 A;  4TV7 A;  3FKJ A;  3IKV A;  1PUF B;  2FBK A;  2D2W A;  5E20 A;  1S7O A;  2K5C A;  3JRH A;  1ZEL A;  4X0G A;  4UVB A;  2WBM A;  3ECO A;  4NB5 A;  3LSP A;  2WAE A;  2IRF G;  2Q2E A;  3ZMD A;  3G2B A;  2XDV A;  5K7F A;  5F0H A;  2DMP A;  1SFE A;  1Z21 A;  2P5V A;  2QCO A;  3GZ5 A;  1Z3Y A;  4YFN F;  3CF2 A;  3EPZ A;  1YYV A;  1I39 A;  1USS A;  4XRF A;  3TMO A;  1W5S A;  2LG4 A;  2MC3 A;  4PZJ A;  3ZQQ A;  4AWX B;  1FIP A;  2DFI A;  1ZRE A;  3FBI B;  4IHT A;  2BVL A;  1TP4 A;  3DPU A;  5CQG A;  1LQ1 A;  2CWE A;  1GVD A;  5FLV A;  1B8I A;  4HDU A; 
#chains in the Genus database with same CATH homology
 3QU3 A;  4KDP A;  2NYX A;  4OIR F;  4Q47 A;  4RB1 A;  1HW5 A;  3TGN A;  1BIB A;  3M8E A;  2HZT A;  2STT A;  1B6A A;  1A04 A;  3E6B A;  3LFK A;  3WGI A;  4KT5 C;  3GFI A;  5A2Q Z;  4EJW A;  4IRH A;  2ISZ A;  2EV0 A;  3PQK A;  1W7P B;  4IPA A;  3LST A;  4WXC A;  4BH9 A;  1K78 B;  3KET A;  1BJA A;  4O5V A;  4RB0 A;  2JTV A;  4FT8 A;  2CGP A;  3R60 A;  4JQF A;  1R22 A;  2DBB A;  3HYI A;  5BQT A;  1OMI A;  1NHA A;  1YS7 A;  2EFQ A;  5HLI A;  4HLY A;  3FMR A;  3DPL C;  1YIO A;  2RN7 A;  4A6E A;  5LRS A;  5DV5 A;  2EFW A;  2PBI A;  4L9N A;  5HLH A;  2XAS A;  2H6C A;  2JPB A;  2OU2 A;  3BOQ A;  3I71 A;  1P4W A;  2FOK A;  2K4B A;  4EMS A;  1SMY F;  4FX4 A;  3HTS B;  2RGV A;  1MZB A;  3M8F A;  3OOP A;  2BV6 A;  2IJL A;  1LVA A;  5HVQ C;  2R7F A;  4NHJ A;  3FM3 A;  3KCC A;  2MH2 A;  4L9T A;  4LB5 A;  2QBY A;  1IXS B;  1SD7 A;  1XCB A;  1R58 A;  5EEG A;  1F4K A;  3WGH A;  3T0Y A;  1XGS A;  3RJP A;  3QRF F;  3DF8 A;  5K5Q A;  4KUM A;  3VOD A;  3F3X A;  4ENM A;  4EGY A;  1TLH B;  3KLN A;  3M9A A;  3R4K A;  3FMS A;  2Z33 A;  5DUK A;  4OIO F;  1GXQ A;  1I1S A;  1RUO A;  3I64 A;  2HTJ A;  4ESB A;  4PCQ A;  3FM5 A;  5ED4 A;  2EV5 A;  5EEH A;  4LG0 A;  2TDX A;  4IRG A;  3L9F A;  4G7H F;  3GFM A;  3BP8 A;  4EVI A;  3KEQ A;  1XGO A;  1UCR A;  3MQ0 A;  1JXS A;  1BC7 C;  4O6J A;  2DW4 A;  4M6X A;  2DQR A;  2IA0 A;  1IZ1 A;  3V8K A;  2ZME A;  5CVV A;  4RAY A;  4UV8 A;  1O3Q A;  4LLN A;  2PI0 A;  1CGP A;  3FXQ A;  2F5D A;  5H6Q A;  3SZP A;  3V4G A;  4OIN F;  1J7K A;  5L3C A;  1QNT A;  1L3L A;  2K86 A;  4I2O A;  2GWR A;  5DCM B;  3I4P A;  4PGH A;  4M73 A;  5CYV A;  4EM0 B;  2DU9 A;  1Z6R A;  1J5Y A;  3E5U A;  1ON1 A;  3Q9S A;  1SMT A;  2F2E A;  3RKX A;  4AD9 A;  1T2K A;  1W7P D;  4U0V A;  5ICF A;  3ERE D;  4BQA A;  3KP5 A;  1BI0 A;  2X0L A;  1MDM A;  1ZGA A;  1P4X A;  5KVR A;  1U2W A;  3G3Z A;  5ERI A;  3LAP A;  5E8I A;  1XDU A;  3CTA A;  1PP8 F;  2XKP A;  4BHC A;  2A69 F;  2V1U A;  3HSE A;  4RAZ A;  2W84 A;  3ULQ B;  2Z3Y A;  1G3W A;  2GAU A;  2GQQ A;  1ZH5 A;  4A12 A;  1P92 A;  2EB7 A;  4M9S A;  2JZY A;  3LWF A;  2UXX A;  1V3F A;  1KQ8 A;  2OZ6 A;  5FO5 A;  1MKM A;  2DK8 A;  1TNT A;  1R36 A;  1UST A;  3ABU A;  2ZXJ A;  3GUD A;  1G4D A;  5BS6 A;  1R7J A;  3OV8 A;  3F21 A;  2HKX A;  3H3U A;  3P9I A;  3RYP A;  3ZP5 A;  2QLZ A;  5E1W A;  2COM A;  2KKO A;  3E6D A;  2IA2 A;  4HV5 A;  2PN6 A;  4ZH4 F;  5LRR A;  1O3R A;  5K5O A;  3QAH A;  4G6D A;  2JRT A;  1O7F A;  3J81 Z;  2DQL A;  2ZME B;  2PQ8 A;  1KU9 A;  3GFJ A;  2KJB A;  3CUQ A;  3V7S A;  1FPQ A;  2XUB A;  3RPQ A;  2O6G E;  2PMH A;  3I5U A;  3BJO A;  2M5W A;  2HYG D;  3NEU A;  2M1B A;  5FLX K;  1QO0 D;  3WTX C;  3E5X A;  4AIH A;  4M74 A;  4YIF A;  3HRT A;  2QQA A;  1QBJ A;  1IW7 F;  4I98 B;  2K02 A;  2VC1 A;  2QM3 A;  4HF2 A;  2X4H A;  2A6E F;  3LA7 A;  3WG9 A;  1K79 A;  2DLL A;  2HDC A;  4EM1 A;  4LFU A;  5HOO A;  4MEY F;  1D5V A;  4BXU A;  4KN7 X;  1S6L A;  2KJC A;  4K2E A;  2HS5 A;  5HS9 A;  3KEO A;  1FYM A;  1VTN C;  5CJ9 A;  4WK8 F;  3V7R A;  3SXY A;  3ISP A;  4A0Y A;  1F1Z A;  1L0O C;  1R1V A;  5DD4 A;  3K1P A;  1WRJ A;  3JTG A;  1SAX A;  4I0A A;  1HQC A;  4KN4 X;  2AS5 F;  2R3S A;  3WOD F;  3S2W A;  3E6C C;  1RNL A;  4KIB A;  2A6H F;  4ESJ A;  3SQN A;  2XAJ A;  2YX4 A;  2P8T A;  3GWZ A;  1KU2 A;  5DCM A;  3DQV C;  3QP6 A;  3R61 A;  2ACJ A;  3ZMT A;  3ZPL A;  1IXR C;  4M6Y A;  3C3W A;  4UUV A;  4I09 A;  1FSH A;  4GYG A;  3RIR A;  1XB4 A;  5K1Y A;  5CVI A;  3KP7 A;  1TW3 A;  1MD0 A;  2L54 A;  2FEZ A;  2HTS A;  3L7W A;  1YW9 A;  1IXC A;  4YFK F;  2ZFW A;  1KU7 A;  5D8K B;  3MCZ A;  2FNA A;  1LEB A;  2ESN A;  1YG2 A;  1K78 A;  1MJB A;  1XGN A;  3SZT A;  1ONV A;  1FLI A;  1RIO H;  2CYY A;  1ON2 A;  1FNN A;  1G3T A;  1RZ4 A;  1K6O A;  1WSU A;  4Y13 A;  1R00 A;  2FBI A;  3HHG A;  3KZY A;  2K27 A;  4MHG A;  1F9N A;  2H94 A;  4AIJ A;  4ZYE A;  5TRD A;  5IT9 K;  2MD5 A;  5ICE A;  3HHH A;  2YU3 A;  4CO8 A;  4I0B A;  2ZJ2 A;  1ZRC A;  4FX0 A;  1S8N A;  3I58 A;  5LHH A;  2KIU A;  4HX4 A;  4Z2Y A;  2GXB A;  1HSJ A;  5D5U B;  5CVR A;  1G3Y A;  4WXD A;  5D5X B;  4A5M A;  1GVJ A;  3F8B A;  3J7A O;  4Y17 A;  2CFX A;  3H92 A;  4UHT A;  4ZZD A;  4AVP A;  4HBL A;  4ASN A;  4MTD A;  1K7A A;  2G7H A;  2VOP A;  2BBY A;  3RKW A;  3WE2 A;  4IHS A;  5HDK A;  4AIK A;  1OKR A;  2Y0M A;  3JSO A;  3WTY C;  2KIF A;  5HS7 A;  1FY7 A;  3L2C A;  1TQP A;  1YW8 A;  2VBW A;  4HQM A;  4NQW A;  2EWN A;  3EUH A;  1DP7 P;  3GX4 X;  1S3J A;  4U88 A;  2VT2 A;  2EFP A;  1IN4 A;  3O2P E;  2HGC A;  3BPV A;  3H3Z A;  5LLQ A;  2CSO A;  2E7X A;  2PEX A;  2ZNY A;  4PDK A;  2VE9 A;  3FZV A;  1YW7 A;  2VOD A;  3EDP A;  4N9H A;  5FD5 A;  1STZ A;  2FSW A;  1H0M A;  1FOK A;  5E1Z B;  3TDU C;  1B59 A;  1C0W A;  1YS6 A;  3ZMZ A;  5L3B A;  3C18 A;  2BEO A;  1OR7 A;  1ZG5 A;  4LD5 A;  3TO7 A;  3T8T A;  2W24 A;  1HW2 A;  4KIF A;  2ZNZ A;  2NNN A;  2DPU A;  3CJN A;  3ABT A;  4XLN F;  2G7U A;  3BDD A;  5BPI A;  1J2X A;  2L01 A;  1AWC A;  2L4M A;  1FP2 A;  6PAX A;  1ZGJ A;  1I27 A;  3F8M A;  4HX7 A;  1LEA A;  1TNS A;  2F5E A;  1H9T A;  4EM2 A;  3BZ6 A;  1B4A A;  3RDI A;  3RTR A;  5FLX Z;  5D6E A;  3Q5F A;  3CUO A;  2LF8 A;  4M9X A;  4ZYH A;  2MH9 A;  2VE8 A;  2XGX A;  2EK5 A;  5ILV A;  5JHU A;  2RVC A;  4KA4 A;  5ILU A;  1MJA A;  4P96 A;  2MLK A;  5J8C A;  2P5K A;  5F6F A;  1FBS A;  3FHZ A;  5L3G A;  4ZYD A;  2ETH A;  4OIP F;  2O3F A;  2M87 A;  2HR3 A;  2MBF A;  1FP1 D;  3F72 A;  5FD6 A;  1I5Z A;  2OAZ A;  3P9K A;  1QZZ A;  2PMU A;  3U9G A;  3CLO A;  4LK1 F;  4IRI A;  3IWF A;  4HLX A;  1YFH A;  1I6X A;  5D4S A;  2CW0 F;  2KRF A;  1XGM A;  4A0Z A;  3L09 A;  2YR2 A;  3KFW X;  4L9J A;  5L3E A;  4L18 B;  1PUE E;  5E18 F;  1HXD A;  4KNY A;  3LQR A;  4BHP A;  3ZN1 A;  2UXN A;  4DQ2 A;  2RKH A;  2L02 A;  1PDN C;  3U1D A;  4RGU A;  1DUX C;  5AIP A;  3RPU A;  4KIG A;  4QLC U;  5LGN A;  4CZZ A;  3DEU A;  4RGX A;  2KIM A;  4M72 A;  1Z91 A;  3RKY A;  4GXO A;  4L5J A;  5K5R A;  2IVM A;  4N9I A;  1W7P A;  3O3K A;  4RB2 C;  2YPR A;  4LGW A;  1QQI A;  3C7J A;  2GXG A;  3BJA A;  2IW5 A;  1EH8 A;  3GXO A;  4CXF A;  4HZF A;  3HRM A;  2FNP A;  2XRN A;  2DI3 A;  5LEK A;  1ZYR F;  2ELH A;  1IUY A;  2GA2 A;  1KYW A;  4KMF A;  1HKT A;  2OD5 A;  2V79 A;  4KMU X;  4ETS A;  3ZMU A;  2QVO A;  4R8H A;  3VEP A;  2HWV A;  3TO6 A;  1WQ2 A;  2VN2 A;  2RC4 A;  2HOE A;  3CO6 C;  2EJR A;  5LHI A;  4CHU A;  3GFL A;  2BYV E;  1UFM A;  3I54 A;  3GYH X;  5JI6 A;  2YSR A;  1OYI A;  5TJJ A;  3N97 A;  2QEN A;  1UHM A;  3REO A;  1T98 A;  3K1N A;  3WTU C;  2QBY B;  1LNW A;  3KP6 A;  1AOY A;  2FA5 A;  5FFX A;  3IRR A;  5JFR A;  1R23 A;  4MQ9 F;  4OIQ F;  4IVN A;  4OU0 A;  1TTY A;  3WTZ A;  1S7A A;  1SD6 A;  1DPR A;  3VB2 A;  1HW1 A;  3ML6 A;  2FXA A;  4WCG A;  2G9W A;  2P6T A;  1MJ9 A;  4EJU A;  2D1H A;  4EJT A;  1LDK B;  3F22 A;  3E5Q A;  2Q0O A;  4G6Q A;  3KP3 A;  2XVC A;  5KK1 A;  2L3D A;  3MZY A;  1T6S A;  4I7H A;  4B8X A;  3IC7 A;  3Q9V A;  1GHC A;  2HQN A;  2E7W A;  2ZKZ A;  1BIA A;  1R5G A;  5HLG A;  3WTW C;  1WI9 A;  1IN5 A;  2QQ9 A;  3K9T A;  2DPD A;  4RGR A;  4MGR A;  3JAM K;  3LAJ A;  3P9C A;  3R0J A;  1ZN2 A;  4BYY A;  1OYW A;  3L00 A;  1J0R A;  3GVA A;  4U7B A;  1WWX A;  3CUQ C;  5D8L B;  5J6X A;  5CVJ A;  2A3S A;  3GEZ A;  3HTU A;  1P6R A;  2GIV A;  2IPQ X;  3J80 K;  3IL2 A;  3KP2 A;  2F5F A;  1XDS A;  1J59 A;  2HQR A;  1Z9C A;  5DDG A;  1RI7 A;  2VT3 A;  1W4M A;  2DO7 A;  1ZG3 A;  1HKS A;  2A61 A;  1Y0U A;  5DD8 A;  2W57 A;  2LF7 A;  2OA4 A;  2O8X A;  3B02 A;  3IWZ A;  3NRV A;  5BOX A;  4G7Z F;  3LA2 A;  5BMZ A;  5F64 A;  3TOA A;  3TO9 A;  4L0Z B;  2EV6 A;  4RB3 C;  4P5O A;  1I1G A;  3FXU A;  1Z6T A;  3HIF A;  4L5I A;  2MLG A;  3N4M A;  5A2Q K;  2PJP A;  2STW A;  4O3M A;  2LNB A;  2GA1 A;  3CO7 C;  4HAM A;  1KQ9 A;  1B9N A;  3CDH A;  3T8R A;  3V8L A;  1UB9 A;  1FX7 A;  5D6F A;  3K1M A;  2ISY A;  2JT1 A;  1CF7 A;  5F1R A;  5LBQ A;  1BBY A;  3I59 A;  4UXN A;  2HYF A;  4MEX F;  1FC3 A;  4RS8 A;  4YII A;  4IXA A;  1REP C;  2P5L C;  2K7L A;  3FMQ A;  3WU1 B;  2ESH A;  4XSX F;  3I59 B;  5D5W B;  1BI1 A;  2QYO A;  4ENK A;  3D5L A;  2OQR A;  1ZHF A;  4XBF A;  2P7V B;  5ILS A;  3BRO A;  3FWE A;  3M7G A;  3P7N A;  2NAZ A;  1OPC A;  2VBX A;  4MQV A;  3DV8 A;  1EV7 A;  4L0Y B;  2FMY A;  3KP4 A;  1ZLK A;  2QWW A;  3GW2 A;  5FFZ A;  1IRG A;  3DKW A;  3PFI A;  3WE3 A;  4LLL A;  4A0X A;  1R1T A;  5DYM A;  3LQQ A;  2H6B A;  2IP2 A;  3KZZ A;  5IT9 Z;  3DFG A;  1U5T C;  3V7C A;  3BY6 A;  1LDD A;  3F8F A;  4MNU A;  1R1U A;  2BGC A;  4D0P A;  5L3D A;  5FGM A;  3F23 A;  2ADU A;  4R1H A;  1Q1H A;  4FHT A;  1UHW A;  2P7C B;  2QQB A;  4HF1 A;  3HRU A;  1JGS A;  3MFK A;  2XAG A;  2EFN A;  3GO5 A;  4BNC A;  5E17 F;  2M45 A;  3NQO A;  3F6V A;  1EH6 A;  1SFX A;  3PQJ A;  2OBP A;  5HDN A;  1MDM B;  5D5V B;  1E2X A;  1FZP B;  2J5O A;  2DTR A;  5E8G A;  4WWC A;  3DP7 A;  4HX8 A;  4G9Y A;  3F8C A;  1FBU A;  1WKM A;  1SFU A;  3I53 A;  2FML A;  4A5N A;  4DNC A;  1XD7 A;  2CG4 A;  5HDG A;  2NRA C;  2M30 A;  3KE2 A;  2V6C A;  1BM9 A;  2R7D A;  1U5T B;  4OOI A;  4M9Z A;  1G3S A;  1V4R A;  1D3Y A;  2VXZ A;  2VOO A;  4HW0 A;  1Z1D A;  2FRH A;  1E17 A;  3HOT A;  3M1E A;  3I0T A;  3E6M A;  1IAW A;  1W5T A;  4EGZ A;  1F5T A;  1HBX G;  2C6Y A;  2PG4 A;  3F6O A;  3SFZ A;  2A07 F;  1O57 A;  3EQL F;  5JVT A;  2RQP A;  1YO5 C;  3AAF A;  2H27 A;  1B1B A;  2W85 A;  4L9V A;  4IJA A;  3K2Z A;  4CYD A;  4KFC A;  1FYK A;  5LGU A;  3ROU A;  3HSF A;  2VC0 A;  4BAY A;  3IKT A;  4LMY A;  3V8J A;  2O61 A;  1IN7 A;  3WTV C;  1D8K A;  1Z7U A;  2JPC A;  2RNJ A;  1O7L A;  2XAF A;  1P2F A;  2LDU A;  3E97 A;  4S05 A;  3FF5 A;  4EV0 A;  3JSP A;  3FXR A;  4HV6 A;  4LB6 B;  2W25 A;  1J75 A;  3MEX A;  4G8X A;  2CQK A;  2OZU A;  1B9M A;  4JK1 X;  2GZW A;  3IRQ A;  1FSE A;  1S29 A;  1XMK A;  4LK0 F;  2D1V A;  2V1X A;  4LG0 B;  2IA1 A;  3J81 K;  2V9V A;  1SD4 A;  1HKQ A;  1TQI A;  2EA2 A;  4LLG F;  1R5H A;  1TW2 A;  1KQ0 A;  1U6G A;  3TOB A;  4I02 A;  2FU4 A;  2Z99 A;  4GCV A;  4WF2 A;  5AIQ A;  5D4R A;  3BWG A;  2BE5 F;  5CVU A;  5HS8 A;  1U8R A;  3BJ6 A;  1BI2 A;  3CUQ B;  3LA3 A;  3BPX A;  4UV9 A;  2XRO A;  2PFB A;  4ON0 A;  4PGG A;  2Q8K A;  1ZLJ A;  3K69 A;  3E3V A;  1JHH A;  2IT0 A;  1D8J A;  4UNO A;  2HKO A;  3DXJ F;  1GXP A;  2DT5 A;  4E70 A;  3D0S A;  5H6R A;  5J8F A;  3ZN0 A;  2EA4 A;  4MTE A;  2ZBK A;  4I01 A;  4EQQ A;  1FT9 A;  2XIG A;  2Z5U A;  4P55 A;  2FE3 A;  1YTY A;  4HYE A;  1BI3 A;  2XKO A;  3ZMS A;  3RYR A;  4EJV A;  1QZY A;  3ELK A;  2NS0 A;  3J80 Z;  1ODD A;  4HOB A;  1IN6 A;  3W6K B;  4CIC A;  3EET A;  5H20 A;  3RI4 A;  3TQN A;  3IHU A;  4GYI A;  2Z9O A;  3O6B B;  2P6S A;  3HRS A;  4H0E A;  2VBZ A;  1H9G A;  1Z05 A;  1T38 A;  4Q4Z F;  3WGG A;  3KLO A;  2OQG A;  4B09 A;  1KYZ A;  4KYW A;  4Y15 A;  5BPD A;  1G6N A;  3TKY A;  3HSR A;  3SHF A;  3T1B A;  2Y48 A;  3QU6 A;  4IF4 A;  3T5X A;  1XMA A;  1FWZ A;  3GZ6 A;  4ENJ A;  2A5Y B;  2VON A;  2LKP A;  4UVA A;  4XSZ F;  4G7O F;  2JSC A;  2XHK A;  4OMZ A;  2K4J A;  2DK5 A;  4Q48 A;  1TQM A;  2XV4 S;  1DDN A;  2B0L A;  4U0W A;  1U78 A;  5DCF A;  3G73 A;  2UZK A;  3U2R A;  1XN7 A;  4A6D A;  1ZRD A;  1LDJ A;  3QOP A;  4XLP F;  5FB2 A;  1O3S A;  3MAJ A;  4N0B A;  4R79 A;  2A68 F;  1XSX A;  4HF0 A;  4QWQ A;  3F8N A;  4A2U A;  2D45 A;  3GLX A;  2M8E A;  1OYY A;  3JAM Z;  3QPT A;  1BN5 A;  4GO1 A;  1DPU A;  4UVC A;  1YLF A;  2QUF A;  2UWM A;  2J5P A;  3FX3 A;  1U5T A;  4GGG A;  3WTS C;  1XSD A;  5E1X A;  1PP7 U;  4HQE A;  2MA3 A;  3COA C;  1ZRF A;  1IRF A;  2P4W A;  1BOA A;  4U0Y A;  3QP5 A;  3K0L A;  5DEQ A;  2E1C A;  1X3U A;  2FQ3 A;  1YQA A;  1ZG1 A;  4RGS A;  3ZQ7 A;  5ICC A;  2HEO A;  4ZZL A;  2EFO A;  2O0Y A;  2RV8 A;  4KIC A;  5AON A;  3DPT A;  3B73 A;  3GF2 A;  1BC8 C;  1ZAR A;  2XAQ A;  1XCV A;  1LB2 A;  4Q5S F;  2H09 A;  2XAH A;  2YX7 A;  3WU0 A;  5IT3 A;  5CLS A;  3HOS A;  2V1D A;  4WXH A;  2WC2 A;  4ENN A;  3EYI A;  4S04 A;  1KGS A;  4G94 A;  3ECH A;  2RDP A;  1P4A A;  3QPH A;  4U7D A;  1O3T A;  2E1N A;  1IN8 A;  1MGT A;  4F7Z A;  2PLY A;  4JBA A;  3VOE A;  2NNY A;  1KU3 A;  4HA8 A;  1EH7 A;  1ZAO A;  3MZH A;  4EJO A;  2WTE A;  5ICG A;  1FYL A;  3VFZ A;  3JTH A;  4CDG A;  4P9F A;  4ZYG A;  3ZMV A;  1LJ9 A;  2FBH A;  1FBQ A;  4P9U A;  1TBX A;  1JHF A;  3R0A A;  2CO5 A;  2FF4 A;  4M71 A;  3WTT C;  2VBY A;  1QGP A;  2O03 A;  4YG2 F;  5LGT A;  5L3F A;  3R6S A;  5JR3 A;  3C1D A;  3TDZ C;  1KA8 A;  5DUI A;  1J9I A;  2DAO A;  2ZCW A;  4ESF A;  3HUG A;  2F5C A;  2L4A A;  1HST A;  2LSO A;  4CGZ A;  1RUN A;  3EYY A;  4WX9 A;  1CF7 B;  3JW4 A;  1IF1 A;  2ZO4 A;  4BHB A;  1T39 A;  1T0F A;  4YFX F;  4LJZ F;  5LEJ A;  2WWY A;  5LHG A;  3W6J B;  1U3E M;  4OMY A;  1ULY A;  3MWM A;  2Y75 A;  4HDV A;  1XSV A;  2HFH A;  2WV0 A;  2AXL A;  1JE8 A;  1QPM A;  1SD5 A;  2QZ8 A;  4TV7 A;  3IKV A;  2FBK A;  2D2W A;  5E20 A;  1S7O A;  4UVB A;  3ECO A;  4NB5 A;  2IRF G;  2Q2E A;  3ZMD A;  1SFE A;  2P5V A;  3GZ5 A;  4YFN F;  1YYV A;  1USS A;  4XRF A;  1W5S A;  2MC3 A;  4PZJ A;  4AWX B;  2DFI A;  1ZRE A;  4IHT A;  1LQ1 A;  2CWE A;  4HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...