2P7VB

Crystal structure of the escherichia coli regulator of sigma 70, rsd, in complex with sigma 70 domain 4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
68
structure length
68
Chain Sequence
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Escherichia coli regulator of sigma70, Rsd, in complex with sigma70 domain 4.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Regulator of sigma D
total genus 23
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7vB00
4L9JA 2QQBA 2X0LA 3NEUA 3L09A 1IN7A 1YQAA 2MBFA 4O3MA 1LB2A 4ZYHA 4S05A 5KK1A 1B9MA 2ZO4A 1ZGAA 3GVAA 1OMIA 2HQNA 4HBLA 1IF1A 3QPHA 2R7DA 5LGUA 4UXNA 2CG4A 3T8RA 3LQQA 5D8LB 1USSA 3K1PA 2EV0A 4BHCA 4DNCA 1RZ4A 4Y15A 2EA4A 2PMUA 2ESNA 4KN7X 4DQ2A 4G94A 1BI3A 2XHKA 3KEOA 2H6BA 2VXZA 2X4HA 4RB0A 1B1BA 2MC3A 1ZLJA 1ON2A 1Z6TA 1RI7A 3NQOA 1B4AA 3IKTA 4ZZLA 1BC7C 5BOXA 3GW2A 3IWFA 3I0TA 3CDHA 3L9FA 1IN5A 5LRRA 3EQLF 5IT9K 2PG4A 3COAC 4L9NA 3M7GA 3HTUA 1WI9A 3CUOA 3JSOA 5E8IA 4Q47A 2BYVE 3TO7A 3HRTA 1RUOA 2EV6A 1BM9A 3F22A 2E1CA 4CO8A 5DUIA 3M8EA 3WODF 1DUXC 5HLHA 1C0WA 3EYIA 3BZ6A 2IP2A 4HF2A 5D5UB 1MGTA 2XVCA 5D5WB 3KETA 4EM2A 2EV5A 4G8XA 1XGOA 2XAHA 5J8CA 1JHFA 2DPDA 3B73A 1EV7A 3CUQB 3H3ZA 3V7RA 1S7OA 1SD7A 3J80K 2PI0A 3K2ZA 5L3GA 1Y0UA 5K5OA 1QZZA 3F6OA 2WC2A 5F6FA 2IJLA 1YYVA 3BPVA 3WTZA 3ZPLA 2V79A 2QLZA 2E7XA 1V4RA 3E6CC 3JAMZ 3T5XA 1UHWA 1O3TA 1BOAA 2L54A 1FLIA 1KQ9A 3IL2A 2HDCA 5BPDA 2MD5A 3KLNA 2Z33A 2YU3A 4LK0F 3FHZA 2M87A 2UWMA 2DW4A 1RIOH 4A2UA 2DQRA 1IN4A 2FE3A 2XAGA 3I71A 3W6KB 3JTHA 2O3FA 4UUVA 4U88A 1IN6A 2PLYA 2P7VB 1IUYA 1U5TB 1DPRA 4Q4ZF 1OPCA 1G4DA 2NNNA 4ENJA 1FZPB 3SHFA 1XSDA 4L5IA 1WQ2A 2H27A 1OKRA 1O7LA 2ZXJA 2QQAA 3C1DA 1SMTA 4G9YA 4I09A 4RB2C 3TDZC 3DFGA 3LA2A 2F5FA 5HS9A 4RAYA 3FMSA 3GUDA 1HQCA 2GA1A 1YG2A 3P7NA 3WTSC 4A5NA 1ZREA 2XASA 2EFNA 4F7ZA 1L3LA 1LEBA 3I4PA 4LFUA 2YPRA 4JQFA 2R7FA 3E5QA 2VBWA 4XBFA 3ZMVA 3RYPA 3KP3A 3SQNA 5D6FA 2ELHA 1R5HA 2FF4A 3TOAA 2JTVA 3WTVC 1KYZA 1SFEA 4RAZA 5H6QA 4QLCU 3I5UA 4CDGA 1F5TA 1HBXG 2ZNZA 1SD6A 3LA3A 3KEQA 4IRGA 1K6OA 4U7DA 3RPQA 5JVTA 1R1UA 3JAMK 1XCBA 2Z99A 2O61A 3WU1B 2BE5F 1JE8A 5E8GA 2PMHA 4ENKA 1BI2A 3GLXA 1QPMA 1SD5A 2D1VA 4LD5A 2O8XA 1J59A 2IPQX 2ZBKA 1HKSA 1H9GA 3HSFA 4XLPF 3O3KA 3BWGA 3R0AA 3TQNA 5DCMB 1MJ9A 4EJWA 5K5RA 4KYWA 2EFPA 5ILUA 4RGXA 1J2XA 1K7AA 1T38A 2O0YA 3WTYC 4L9TA 3K1NA 5DD8A 2HTSA 4G6DA 4HF0A 2UZKA 1LDDA 4YG2F 2A6HF 2K27A 4GGGA 1WRJA 3DEUA 2PFBA 5TRDA 3CO7C 1FWZA 3F8BA 1YLFA 3WU0A 1FNNA 1UCRA 1S7AA 2H6CA 3ZMSA 1S29A 4CZZA 3F8CA 1KU3A 4IRIA 4HQEA 3TOBA 5HS7A 4YFKF 3GYHX 1FSEA 2HYGD 2DU9A 1TW3A 3EUHA 1T2KA 1TQIA 5L3DA 3QPTA 4G6QA 1Z91A 4HX4A 2Y0MA 3U9GA 2FA5A 3HYIA 3BJOA 1P4WA 2L3DA 4UVAA 3T8TA 3GWZA 2EJRA 3F8NA 4WF2A 3GX4X 4EVIA 1FP2A 2NYXA 2P5LC 2HYFA 2YSRA 2F5EA 2O03A 4YFXF 2FRHA 2CO5A 4BQAA 4RGSA 2M1BA 1IRFA 1GXQA 3K0LA 1CF7A 3RKWA 2VC0A 2HGCA 3CUQA 4A12A 3KP6A 2Q0OA 4ASNA 1Z6RA 2IW5A 1BJAA 2M8EA 4P9FA 2RV8A 5DCMA 4PGGA 2CGPA 3MCZA 1IW7F 3QP6A 4AVPA 1RNLA 3DPTA 4XLNF 4S04A 3E6DA 1KA8A 5BQTA 3CLOA 3I54A 2WTEA 3ECOA 3J81Z 5EEGA 1YW8A 2C6YA 2H94A 2CSOA 1OYWA 1KGSA 5CVVA 2QVOA 1ZGJA 1ZAOA 4XRFA 3HSRA 5LHHA 4EJTA 1T0FA 1ZRCA 1SMYF 4UV8A 4HX8A 2W85A 2ADUA 1ZARA 4A0YA 3QOPA 1KU7A 4LLNA 2JPBA 4KUMA 4A6DA 3I58A 2QWWA 3E5UA 2IVMA 4FHTA 4BYYA 4HF1A 3DKWA 2P6SA 1ODDA 1IRGA 1DDNA 2ISZA 3HIFA 1YO5C 2Z5UA 3ZN1A 3N4MA 2FMYA 3ERED 1FSHA 2RC4A 1FBQA 3WTXC 3V4GA 2OQGA 1IAWA 5FLXK 4NQWA 1STZA 5FB2A 2YX7A 5ICGA 5HS8A 1QO0D 2K4BA 2XRNA 5D4RA 4YIIA 1J9IA 1LEAA 1HW1A 3BJ6A 4B09A 3FM3A 4KN4X 1TTYA 4HA8A 1I6XA 2GXGA 5HLGA 2EFWA 3VB2A 1D8KA 1FYLA 1QZYA 1R1VA 3RTRA 1U5TA 2VT2A 2M30A 2JT1A 1SAXA 3FX3A 4BXUA 4RB3C 4KT5C 1EH8A 1B6AA 4I01A 2HQRA 1TQPA 3PQKA 3REOA 5L3FA 4WWCA 3KP4A 5LGTA 3FM5A 2XIGA 6PAXA 2STTA 5A2QK 2P6TA 3R6SA 3ML6A 3DQVC 5HOOA 3DV8A 4RS8A 2JRTA 1XSVA 3GFMA 2PJPA 4EGYA 2MLGA 4I02A 1ZG1A 2BV6A 5FD5A 1R36A 3ABUA 1E17A 2DO7A 2OD5A 4OMZA 5CYVA 5FD6A 2FXAA 3C3WA 4CYDA 3IRRA 4LB5A 1IXCA 1E2XA 3K69A 3M1EA 4BH9A 3N97A 3DF8A 3HRMA 4EMSA 2NRAC 5DDGA 2DTRA 3QP5A 2BEOA 2JPCA 2ZNYA 2XAQA 4P9UA 5FO5A 4KIFA 4U0VA 4XSXF 5ILVA 4OMYA 4LG0A 5K1YA 2K02A 4M9SA 2QM3A 4P96A 2GAUA 3HHHA 3VFZA 2W25A 4IJAA 3RDIA 1KYWA 5AIQA 4P55A 4PZJA 2RQPA 3P9IA 1ONVA 5E20A 3KZYA 2PQ8A 1XDSA 3F23A 5L3CA 3T0YA 4OIOF 1W7PA 2L4MA 3CUQC 1G3WA 1R00A 1LJ9A 3V8JA 1Z1DA 2E1NA 3H92A 1OYYA 1XCVA 3Q9SA 3I59B 4ESBA 1TNSA 1PP7U 4EQQA 5DUKA 2M45A 4ZYEA 1I27A 1ZG3A 1YS7A 4NHJA 5JHUA 4KMUX 2FSWA 1P4XA 2Y75A 3KE2A 4BHBA 1DPUA 3KP7A 2HTJA 2MLKA 2FQ3A 1OR7A 1FPQA 1IN8A 2EFQA 3D0SA 2XV4S 1XSXA 1H0MA 2EK5A 2QBYB 3G3ZA 1WWXA 4HX7A 3L00A 4MHGA 3QU3A 1FX7A 5BPIA 4BAYA 3KCCA 4ON0A 1DP7P 1R22A 2D45A 3MEXA 2IRFG 3LSTA 1EH6A 2FOKA 2M5WA 1KQ8A 2OAZA 1U6GA 3GFJA 2D2WA 1BN5A 5ED4A 1HW5A 4YIFA 1BIBA 2QBYA 1I1GA 3RYRA 2DAOA 2ISYA 5D5VB 3EDPA 2VN2A 1XN7A 2RN7A 1K78B 5HLIA 2A68F 1BC8C 3PFIA 2BBYA 3K1MA 4HLXA 2KIUA 4A0ZA 3B02A 3LAJA 3MAJA 4HQMA 2DK8A 3GEZA 4HYEA 4OIPF 4A6EA 1P2FA 4MQVA 2D1HA 4ZZDA 4LLLA 4HLYA 2GIVA 2HOEA 1U78A 3ISPA 4M9XA 4G7ZF 3ZMUA 2DBBA 4KICA 5CVJA 2G7HA 2STWA 1G3YA 5ICEA 1IXSB 4ENMA 3WG9A 1WKMA 4I2OA 2ZCWA 1MD0A 2XKPA 2L02A 4HAMA 3F21A 2IA1A 1YS6A 4HDUA 2NS0A 2RKHA 1UB9A 2J5PA 3QAHA 2H09A 2K4JA 4K2EA 2CQKA 4A0XA 4B8XA 1JHHA 4MQ9F 4EJVA 2F5CA 3MQ0A 5FFZA 1IXRC 3IKVA 1ULYA 3R60A 4EJUA 4GYIA 3ABTA 1BI0A 1D8JA 2KKOA 1IZ1A 4EV0A 1XMAA 1FP1D 1HKTA 2V1UA 3V7SA 1ZH5A 3T1BA 1ZRFA 4L0YB 3E5XA 3WGGA 5D8KB 2CW0F 2ESHA 4AIHA 4MTEA 5CVUA 2QYOA 1R23A 2A07F 2LSOA 2CYYA 1R7JA 1YW9A 4QWQA 1PDNC 1FYKA 4AD9A 2LF8A 4WXCA 4U0YA 1ZLKA 1XGSA 1TLHB 5LEKA 2QZ8A 5D4SA 1S3JA 2TDXA 4MEYF 1SD4A 3IC7A 2DI3A 4WK8F 4P5OA 2VONA 1W5SA 3ZP5A 4ZH4F 1T98A 5L3EA 1XGMA 3BY6A 1HSJA 1OYIA 4E70A 3KLOA 3RPUA 2QUFA 3G73A 4EGZA 2OQRA 3M8FA 5FFXA 3I64A 2G7UA 4U7BA 1W4MA 3FWEA 3FMRA 2B0LA 5ERIA 4OU0A 2DLLA 1TNTA 3U2RA 2HKXA 2KJCA 3IRQA 3R0JA 2F5DA 2LF7A 2EA2A 4HDVA 5CVIA 3M9AA 1SFXA 3KP5A 1R1TA 2Z3YA 2MH9A 1NHAA 2XAFA 1P4AA 1GXPA 1MKMA 2VOPA 2YX4A 2GWRA 4EJOA 5AIPA 5J6XA 2RVCA 1ZRDA 4XSZF 4KDPA 2CFXA 3J7AO 2LDUA 3J81K 3ZMTA 2RNJA 4RGUA 2IT0A 1GVJA 2BGCA 4AIKA 3VEPA 2XGXA 5E1ZB 5BS6A 4I7HA 2Y48A 4L0ZB 4ZYGA 5IT3A 2VOOA 4L18B 1G6NA 2GQQA 3L2CA 2MA3A 1U3EM 3F72A 2IA0A 4R1HA 3RKXA 5ICFA 2VBXA 2DFIA 4CICA 2W84A 2HZTA 1T39A 1WSUA 1HSTA 2WV0A 2DK5A 1V3FA 5JR3A 1UFMA 4PDKA 2FEZA 1QGPA 4LLGF 3E97A 4UNOA 3WGHA 2HR3A 3DP7A 4HV5A 1MJAA 2AXLA 4AIJA 3E6MA 3RKYA 3I59A 4O5VA 3Q5FA 4R79A 4M72A 2A61A 1FYMA 2ZJ2A 3BROA 2Q2EA 1T6SA 2UXNA 2PBIA 4KMFA 3CO6C 4UV9A 3WGIA 3O6BB 2RGVA 4KNYA 4LJZF 2XAJA 5CJ9A 3WTUC 3GZ6A 4A5MA 4LK1F 1P92A 1BIAA 3J80Z 1SFUA 1J5YA 3L7WA 4WX9A 1YFHA 1CGPA 2KIFA 4M71A 1U2WA 5ILSA 2A69F 2PEXA 3LQRA 4FT8A 3TGNA 3H3UA 3WTTC 1KU2A 2KJBA 1Z7UA 3HHGA 3R4KA 2JZYA 5D5XB 3D5LA 1TBXA 4KA4A 1ZG5A 2ZKZA 1U8RA 4Q48A 1AOYA 1BI1A 4IPAA 1X3UA 4R8HA 5F64A 3Q9VA 3NRVA 5H6RA 4G7HF 1CF7B 4GCVA 5CVRA 3V8LA 3S2WA 4HZFA 3BDDA 4RGRA 3JSPA 5E1WA 2GXBA 3U1DA 1YW7A 1FOKA 4FX0A 2IA2A 2NAZA 4I0BA 3ROUA 1YIOA 3AAFA 4M6XA 5DYMA 5E17F 3ECHA 2OZUA 3DXJF 3P9KA 5LGNA 2OA4A 4ESJA 3GF2A 5TJJA 2AS5F 1J7KA 5DD4A 4HOBA 3FXRA 3W6JB 4N9HA 2EB7A 1VTNC 3GZ5A 5BMZA 3V7CA 5LHIA 2COMA 2FBIA 3VOEA 1KU9A 1LQ1A 2P8TA 2A3SA 1RUNA 1G3TA 1S6LA 4KIBA 3FMQA 5HDGA 4LGWA 4G7OF 3F8MA 1P6RA 2J5OA 3RI4A 3KFWX 1W7PD 4H0EA 3BP8A 2ACJA 3GFLA 1I1SA 5E18F 1H9TA 5LBQA 4HV6A 3FF5A 1QBJA 3CJNA 2K86A 5H20A 2VT3A 4PGHA 2OBPA 2P5VA 3HOTA 5LRSA 2HS5A 3HOSA 3E6BA 3FXQA 1D5VA 1FBUA 1R58A 4Y17A 3OOPA 1USTA 4RB1A 4GXOA 1XGNA 2HEOA 3GO5A 1LVAA 5LLQA 4LB6B 4TV7A 4OINF 4L5JA 1MDMA 4KFCA 3TO6A 3GFIA 1Z05A 3PQJA 3QRFF 3ZQ7A 1J0RA 4JBAA 3ZMZA 4WCGA 5F1RA 5DCFA 4GO1A 2LNBA 3C18A 2VBYA 1U5TC 1YTYA 1XMKA 2VE9A 3KZZA 2KRFA 3MZHA 3P9CA 5LHGA 2Z9OA 2GA2A 1FC3A 5ICCA 4OIRF 3SFZA 1JGSA 4M9ZA 2XKOA 5E1XA 2VC1A 4MNUA 3HRUA 4BHPA 4HW0A 4CXFA 2EFOA 1ON1A 1B9NA 1TQMA 4L9VA 3ULQB 3I53A 4LMYA 2A5YB 1I5ZA 4N9IA 2L4AA 2V1DA 3E3VA 1FT9A 3EYYA 4IF4A 3WE2A 2UXXA 4OIQF 4IHSA 1F1ZA 2DQLA 1PP8F 5HDKA 1REPC 1FBSA 3BPXA 2HWVA 2P5KA 1BBYA 4I0AA 1R5GA 2ZFWA 3SZPA 5HDNA 4Q5SF 1F4KA 4PCQA 5A2QZ 5J8FA 2XUBA 2L01A 3FZVA 3MWMA 2V9VA 2K7LA 1O3QA 4ESFA 3GXOA 1XB4A 3IHUA 2FNPA 1O57A 1HW2A 1Z9CA 2W57A 1O3SA 4O6JA 3VODA 4UVBA 4YFNF 1PUEE 1MZBA 1D3YA 5DEQA 1ZYRF 1W5TA 4M74A 4IHTA 4MTDA 2ETHA 2DT5A 3BJAA 2FMLA 4OOIA 3IWZA 2VODA 1LDJA 3HTSB 5JFRA 4IVNA 4KIGA 2VBZA 2QQ9A 4D0PA 4JK1X 1L0OC 3JTGA 1B59A 4M6YA 3LFKA 1GHCA 4U0WA 4ENNA 1G3SA 3WE3A 4LG0B 1S8NA 3SXYA 1UHMA 1AWCA 3LAPA 3V8KA 3HUGA 4ETSA 1QQIA 4Z2YA 4EM0B 3ZMDA 2LKPA 4NB5A 1JXSA 5JI6A 3LWFA 3MFKA 1KQ0A 4MGRA 1LNWA 4IRHA 4WXDA 2FBKA 1TW2A 3BOQA 5AONA 1HXDA 3RIRA 3MZYA 4AWXB 2OZ6A 4CHUA 2PN6A 3RJPA 5EEHA 1A04A 5K5QA 2QENA 4N0BA 2EWNA 1EH7A 2KIMA 1ZHFA 4UHTA 3C7JA 4EM1A 2E7WA 2RDPA 2F2EA 3TO9A 3ZN0A 3WTWC 4MEXF 3FXUA 3F6VA 3JW4A 2ZMEB 4CGZA 1Q1HA 2V6CA 1FY7A 3O2PE 3F8FA 1QNTA 2ZMEA 1XDUA 2MH2A 4FX4A 2CWEA 3R61A 2G9WA 3TDUC 2R3SA 5HVQC 2Q8KA 2FBHA 2HFHA 1O7FA 3EETA 5DV5A 5LEJA 2W24A 5IT9Z 4M73A 2NNYA 3TKYA 2P7CB 3ELKA 2O6GE 4IXAA 3K9TA 3CTAA 1K78A 3LA7A 4WXHA 5L3BA 4GYGA 1ZN2A 2P4WA 1K79A 1F9NA 4Y13A 2DPUA 1XD7A 2OU2A 3OV8A 1MJBA 5KVRA 5CLSA 3HRSA 2FNAA 4BNCA 1W7PB 2YR2A 2GZWA 1HKQA 3KP2A 2FU4A 2A6EF 3SZTA 5FLXZ 5D6EA 3QU6A 5FGMA 2WWYA 2HKOA 4I98B 3DPLC 1J75A 3F3XA 4UVCA 4ZYDA 1O3RA 2JSCA 2XROA 3HSEA 2V1XA 2VE8A 1MDMB 1LDKB
chains in the Genus database with same CATH superfamily
4L9JA 2QQBA 2E71A 2X0LA 3NEUA 3L09A 4XICA 1IN7A 1YQAA 2MBFA 4O3MA 1LB2A 4ZYHA 4S05A 5KK1A 1MNDA 1B9MA 3IH4A 2ZO4A 1ZGAA 1NG6A 5M5YJ 3GVAA 1TWCJ 5GTIC 1OMIA 4E7KA 2HU9A 1RR8C 2LD5A 2HQNA 4HBLA 1IF1A 3FXJA 3HXLA 3NWTA 3QPHA 2R7DA 3GTLJ 5LGUA 4UXNA 1FJLA 1ZTRA 1U8BA 2CG4A 4E7HA 4XMYA 3T8RA 4IHXA 3LQQA 3W6VA 5D8LB 1USSA 3K1PA 2K9SA 1T33A 2EV0A 1E0EA 4BHCA 4NBQA 4C2UA 5E3OA 3DTKA 4DNCA 1RZ4A 3S17J 3RPUD 4A3JJ 3CCLI 4Y15A 2EA4A 2PMUA 2ESNA 4FCYA 4KN7X 4DQ2A 4G94A 2E34A 1BI3A 2DYRH 2XHKA 3KEOA 1Z0XA 5FKOA 2H6BA 2VXZA 2X4HA 4RB0A 1B1BA 2MC3A 1WJAA 2X48A 3DWLE 3AL0B 3CDLA 1ZLJA 1ON2A 1Z6TA 3K4CA 2VQLA 1RI7A 3NQOA 4HNVA 1B4AA 3IKTA 2VJIA 4ZZLA 2TRTA 3QOEA 1BC7C 5BOXA 3AFHA 3HPHA 1VQNI 1R49A 1JT0A 5B3SH 3GW2A 3EPZA 1MBJA 3IWFA 3RSNA 4X0GA 9ANTA 3ASNH 3I0TA 3CDHA 3DBLB 4RAFA 3L9FA 2LBFB 4XKBA 4A3EJ 1IN5A 5LRRA 4YIRX 3EQLF 3BG9A 4XLFA 3LSGA 2L0KA 4RM2A 5IT9K 3VYSB 2PG4A 3COAC 4L9NA 3M7GA 3BZCA 3MKWB 3HTUA 1WI9A 3AG4H 3CUOA 3JSOA 3A0HC 5E8IA 4Y3OA 1D1BA 4Q47A 1U0JA 2BYVE 5F0FA 3TO7A 4PK4A 3DBRB 4ZTJA 3ZOBA 2HXOA 2FQ4A 1WGXA 1WJEA 1WI3A 4AUXA 3HRTA 4XRSG 4BEHB 1RUOA 2EV6A 1BM9A 3F22A 2E1CA 4C3JJ 4CO8A 3G1LA 2K3FA 1OCRH 3M8EA 5DUIA 5J1YA 3G4SI 2R7SA 4XQFA 3VYRB 3WODF 1DUXC 5HLHA 2CUFA 2F4MB 3CP2A 4II2A 1C0WA 3EYIA 3BZ6A 2IP2A 4HF2A 4BBRJ 5D5UB 2HYJA 1MGTA 3PNVA 2XVCA 5D5WB 3KETA 4XN3A 4EM2A 2EV5A 4G8XA 1XGOA 2XAHA 5J8CA 1JHFA 2DPDA 5E3LA 5F27A 3B73A 2JVGA 1EV7A 1D0ZA 3S14J 3CUQB 3H3ZA 3V7RA 1S7OA 1SD7A 1PUFB 2LYCA 5EG0A 3J80K 2PI0A 3K2ZA 5L3GA 1Y0UA 3WHBA 1P9QC 5K5OA 3Q0WA 4IHWA 1HC8A 5IYBJ 1QZZA 3F6OA 3L2VA 4DIQA 3OYMA 4XL9A 4B47A 2R5YB 2WC2A 5F6FA 2IJLA 1LE8B 1YYVA 2PMZA 3BPVA 3OYIA 3WTZA 3CMYA 3ZPLA 2V79A 2X51A 2CQNA 1TWHJ 3BCAA 4XN0A 2QLZA 2E7XA 1V4RA 2KQRA 2LBFA 3E6CC 1PYVA 3JAMZ 2VQGA 3T5XA 1UHWA 1O3TA 5KHDA 2L9RA 2CS3A 3K70C 2Y9ZA 1BOAA 2L54A 2RQQA 1FLIA 1KQ9A 3UNGC 1TWGJ 3IL2A 2HDCA 2CQ7A 1LPQA 5B1BH 5BPDA 3KYDB 4ANJA 2MD5A 3J7ZI 3KLNA 4XRMA 2Z33A 2YU3A 2CMPA 2VJJA 4LK0F 2BY1A 3FHZA 4EATA 2M87A 3GBGA 2UWMA 3ZXSA 2VL8A 3K4KA 3L2WA 5J4VA 2DW4A 5C4JJ 1LKXA 1RIOH 2F5VA 2DQRA 4A2UA 1I3QJ 3ABMH 4CH7A 3UKGA 1YRNA 2QGUA 1IN4A 1QHHD 5BNGA 5JVGF 3IUOA 2FE3A 5CQEA 1VQOI 2XAGA 3I71A 3W6KB 4E7JA 3JTHA 3FXOA 2O3FA 4D1QA 4UUVA 4U88A 1IN6A 2KZGA 2P7VB 2PLYA 1IUYA 1U5TB 1DPRA 2CW7A 4Q4ZF 1OPCA 1G4DA 1T8IA 2NNNA 4ENJA 2DT6A 3NARA 3HG9A 1RC9A 1EA3A 3OOUA 1FZPB 3SHFA 1A35A 2ZJQF 4L5IA 4QTRA 1XSDA 2VQHA 3OYKA 1WQ2A 1LVKA 3IAM2 1PJRA 2EH3A 2H27A 1OKRA 1O7LA 5IYCJ 2IGOA 2ZXJA 2QQAA 2K85A 3C1DA 2ZJPF 1JUSA 2DA3A 3FXLA 4HSTA 5CKTA 3S8PA 1SMTA 3BZKA 4J01A 4G9YA 5C44J 1SVMA 3E0JB 3LSIA 4I09A 4XLAA 4RB2C 3TDZC 2DMPA 3DFGA 2OTLI 3LA2A 2F5FA 5HS9A 1QVTA 4BQNA 2N8GA 4F52A 3DLLF 4RAYA 3FMSA 3GUDA 1HCRA 1HQCA 4BY7J 3DU5A 2GA1A 1YG2A 5IP7J 3BR3A 4BJ5C 1K61A 3P7NA 3JR9A 3WTSC 4A5NA 1ZREA 2XASA 4XLHA 2EFNA 1YITI 1ETWA 4F7ZA 1L3LA 2F4OB 2L7ZA 1LEBA 2EZLA 4Z6YA 3I4PA 3OYFA 4HEA2 4LFUA 4NQWB 1I6HJ 1QHGA 2YPRA 1JJ6C 2VPRA 4JQFA 4X6AJ 3RQIA 2R7FA 2BY0A 3E5QA 2VBWA 3PSIA 4XBFA 2ZXIA 3ZMVA 5HNFA 3RYPA 3OS1A 3A03A 3KP3A 2AXTC 3HGYA 3SQNA 4UUSA 5D6FA 2ELHA 3MKYB 1R5HA 2FF4A 3TOAA 3FK7A 2JTVA 3WTVC 1KYZA 1SFEA 2BVMA 4RAZA 3HZJA 2L9NA 5H6QA 4QLCU 1R9TJ 1HDPA 3I5UA 4CDGA 1F5TA 1HBXG 1ZKGA 2OTJI 2ZNZA 1HOMA 1GV5A 3K10A 1SD6A 3LA3A 1OCPA 3KEQA 5FKKA 2LTPA 5F0HA 4IRGA 2ZB9A 1K6OA 2VASA 3FKJA 3ERMA 3RPQA 5B5EC 4U7DA 2R7TA 1VQ4I 3TMOA 5JVTA 1JKPC 1R1UA 3BG6A 2V9PA 3LOCA 3RCOA 3JAMK 3JRIA 4A3LJ 1XCBA 2Z99A 2CRGA 2O61A 3WU1B 2FX0A 3A4CA 4FISA 2R7QA 2BE5F 1JE8A 1VQ9I 4CCOA 3B6CA 5E8GA 3S1RJ 2PMHA 2QCOA 4ENKA 2QF7A 1BI2A 3GLXA 1K4TA 1QPMA 1SD5A 2D1VA 1ZGWA 2X6XA 4LD5A 2XPWA 2O8XA 2Q2EB 3OL3A 4V2GA 1J59A 1ZQ3P 2IPQX 2ZBKA 1HKSA 4BXFA 2IS6A 1H9GA 3HSFA 3CP8A 2CFOA 3O3KA 3BWGA 4ZJZA 4XLPF 2DMNA 3R0AA 4PSWA 1Z3XA 2HDWA 3TQNA 5DCMB 1MJ9A 2BOLA 2LC2A 4PJMA 5EGOB 1I50J 2FOWA 2R5YA 4EJWA 5HODA 5K5RA 4RBOA 5TGTA 4KYWA 3CC7I 2EFPA 5ILUA 5LD2C 1YJ9I 4RGXA 1J2XA 1K7AA 1T38A 1VQ5I 3BTJA 2F4IA 2O0YA 3WTYC 2HOSA 1XC5A 4L9TA 3K1NA 1X2MA 2V9KA 5DD8A 4AYBN 2HTSA 4G6DA 4HF0A 2UZKA 1LDDA 2RNGA 4II3A 2K3PA 4BQOA 4C3HJ 2HOAA 1JJ8C 1O4XA 2GXAA 5DM6F 4YG2F 2A6HF 2K27A 3HOYJ 1HF0A 4GGGA 1WRJA 3DEUA 2PFBA 5TRDA 3CO7C 3W2AA 1FWZA 1VI0A 3F8BA 1QPIA 1W36C 3WG7H 1X1DA 1YLFA 3WU0A 1FNNA 3CJTB 3DKXA 3HDDA 1UCRA 1S7AA 2H6CA 2FJ1A 3ZMSA 4BGDA 1TT0A 1WHUA 1S29A 2DTZA 4CZZA 3F8CA 1KU3A 2R93J 4IRIA 5EJCA 4BL0B 4HQEA 1H8AC 3TOBA 1YOVB 2Y30A 3S1MJ 2Y0SA 2A05A 3DLAA 5HS7A 4YFKF 3GYHX 1FSEA 2HYGD 2DU9A 1TW3A 3QODA 2MD0A 4FE7A 3RZOJ 1ACIA 3BTCA 3OYLA 3EUHA 5DS9A 3ZQLA 2O8KA 1T2KA 1TQIA 3G1OA 5L3DA 1X19A 5HLTA 2QKLB 3QPTA 3PUBA 5GP9A 4G6QA 3IV5A 1Z91A 4HX4A 2NOJB 2Y0MA 3CMMA 3U9GA 1IC8A 3VWBA 2FA5A 3BQZA 3PFYA 3SEZA 4IOAF 1YJNI 4BEHA 1W0TA 4Y7NJ 3HYIA 3BJOA 1P4WA 2L3DA 4UVAA 3T8TA 3GWZA 3OYHA 1K4SA 4I6ZA 2EJRA 5M3FJ 3F8NA 1X1CA 4WF2A 3GX4X 4A3IJ 1TWFJ 1GUUA 4EVIA 1FP2A 2NYXA 2P5LC 2HYFA 2YSRA 5TISC 2WB1N 3DBHB 1N75A 2F5EA 4DYCA 2O03A 3ZRGA 3I56I 3HOXJ 4YFXF 2DJIA 1IGNA 2FRHA 2E2HJ 2CO5A 4BQAA 4RGSA 2M1BA 3OR1C 1UHSA 2VJ5A 1IRFA 1GXQA 3K0LA 1CF7A 4IQ4A 3CD6I 2IAIA 2JA8J 3H36A 3RKWA 4B3XA 4CCKA 2VC0A 5JLWA 2HGCA 1T08B 1TP4A 2HXIA 3CUQA 3QPLA 4EEFG 1FOWA 3LSPA 4A12A 1W5CC 3KP6A 2Q0OA 1RETA 4ASNA 1Z6RA 2IW5A 1BJAA 2M8EA 4P9FA 2IGMA 3BG3A 3GCMA 4PUSA 3GTMJ 2RV8A 5DCMA 2JMWA 2BVLA 1S9HA 4PGGA 4B4CA 3HL2A 2CGPA 3MCZA 1IW7F 2KISA 3QP6A 4P1WA 4BE1A 1VZ0A 4AVPA 1RNLA 4CYCB 3DPTA 4XLNF 4S04A 3E6DA 4A3MJ 1OCCH 3HOZJ 1KA8A 2XSDC 5BQTA 2Y31A 2WY7Q 3CLOA 4A3CJ 2NOGA 3I54A 4D5CA 2WTEA 1T56A 4CSWA 3ECOA 3H35A 3J81Z 5EEGA 1YW8A 2C6YA 2H94A 2CSOA 1W0UA 1OYWA 4XLEA 1KGSA 4IOCF 1I39A 5CVVA 2QVOA 1ZGJA 1ZAOA 3NAUA 4XRFA 5GTHC 3DEEA 3A1YA 2JUCA 3HSRA 4JX5A 5LHHA 5GPAA 4EJTA 1T0FA 1ZRCA 2Y2ZA 1T0FC 1SMYF 4UV8A 4HX8A 4Y52J 1V5FA 3PIPF 2W85A 2ADUA 4OAYA 1ZARA 4A0YA 3QOPA 1KU7A 4LLNA 2JPBA 4KUMA 4A6DA 3A01B 3I58A 2QWWA 2MGQA 3E5UA 5LFAA 1A31A 2IVMA 2OC6A 4FHTA 4BYYA 1ORKA 4HF1A 2ELJA 3DKWA 2LY9A 1V55H 2EIJH 3U21A 3H9QA 4B43A 2P6SA 4XOTA 1ODDA 2B7EA 1IRGA 1RKTA 1DDNA 3OIOA 2ISZA 1BR4A 2R5ZA 4QPOA 3K4JA 3HIFA 2R7WA 1YO5C 2Z5UA 3ZN1A 1R5ID 5IYDJ 3N4MA 3AG3H 2FMYA 4ZC3A 3CQZJ 3ERED 1FSHA 2RC4A 1FBQA 3ZQQA 3WTXC 3V4GA 2OQGA 1X1BA 1IAWA 1YE9A 4ZDPA 4KITB 5FLXK 4NQWA 1STZA 2L2OA 5FB2A 2YX7A 4M3EA 5ICGA 5HS8A 1IV8A 1QO0D 2H1LA 2K4BA 2XRNA 4YIIA 5D4RA 1J9IA 1LEAA 1HW1A 1MBHA 3FK6A 4F55A 3BJ6A 5KCMA 4B09A 1YRNB 3FM3A 5FLMJ 4KN4X 1TTYA 4LIUA 3EUHC 4HA8A 1I6XA 1A6IA 2GXGA 5HLGA 2EFWA 4XRSA 1SFKA 3TW7A 3VB2A 1D8KA 1FYLA 3NWSA 3FBNB 2TCTA 2DMQA 1QZYA 1R1VA 3RTRA 4NC7A 1U5TA 5IP6A 1QZEA 2NS7A 2VT2A 2M30A 1UAAA 4DYRA 2RAEA 2VXDA 3H0DA 3DU6A 2JT1A 4A69C 3PNYA 3Q0VA 2GOXB 2JQ7A 2DA7A 3TL4X 3UR3C 3SFIA 1SAXA 4IHVA 3FX3A 1DGWY 3QPSA 4BQQA 2LY2A 2W1OA 4BXUA 1OQYA 1ZELA 4RB3C 3G1MA 1U9NA 2QA4I 2V1NA 4KT5C 1EH8A 1B6AA 3SDGA 1UELB 4E4HA 4Y33A 4XM3A 3RKQA 4J00A 4I01A 2HQRA 2LR8A 4PJJA 1IV6A 3WU2C 1TQPA 3PQKA 3REOA 2JA7J 3BR5A 5L3FA 4WWCA 3KP4A 1N77A 5LGTA 3FM5A 2XIGA 6PAXA 3D5SC 2CV2A 3SEQA 2STTA 5A2QK 2P6TA 3R6SA 1E3HA 3ML6A 1IUFA 3DQVC 5HOOA 3DV8A 4IEJA 2Z2SB 4LIVA 4RS8A 2JRTA 3C2HA 1BR2A 1K83J 1XSVA 2VJ4A 3GFMA 2PJPA 4EGYA 2MLGA 4I02A 1ZG1A 2R7XA 2BV6A 5FD5A 1R36A 3ABUA 3H9GA 3J7AY 1E17A 2DO7A 2ELKA 1D0XA 2OD5A 4OMZA 5CYVA 2FXAA 3HBLA 5FD6A 3OYEA 1JTXA 2Y0SN 3C3WA 5DTDA 4CYDA 3IRRA 2XF6A 4LB5A 1IXCA 3H3VK 1E2XA 2Y69H 3K69A 4PFPA 2ICWG 3M1EA 3PO3J 5IPAA 4BH9A 4HNUA 4JX6A 3QYEA 4HPQA 3DF8A 3N97A 3HRMA 2DA5A 4EMSA 4KT6A 1Y8QB 2NRAC 5DDGA 3IH3A 1JKRC 2DTRA 2CQQA 3QP5A 1OISA 3C2BA 3Q3SA 1JT6A 2BEOA 2VUMJ 2JPCA 2ZNYA 2XAQA 1Z67A 4XKCA 3JRGA 1BW6A 2E35A 4P9UA 1G8XA 1UZCA 5FO5A 3BR0A 3HB9A 2HZDA 4KIFA 4U0VA 4S0HB 3J7YJ 4CUGA 2X6WA 3MN2A 4XSXF 4D9JA 5ILVA 1WJDA 4OMYA 4NNJA 4LG0A 1ZK8A 3SDBA 2F6CA 2VQCA 2K02A 5K1YA 4M9SA 2JJ7A 2MSYA 2EILH 2QM3A 4P96A 4BY1J 1OCTC 3MZ8A 4LOCA 3ZQHA 2GAUA 3HHHA 3HM5A 2WA0A 3VFZA 2W25A 4IJAA 3RDIA 1KYWA 5F1JA 2HDDA 1RKWA 1K6YA 2X6YA 1JKQC 5AIQA 3I9V2 4P55A 4BACA 4PZJA 2RQPA 3P9IA 1ONVA 2HVQA 5E20A 3KZYA 2DT7B 5FKMA 2PQ8A 5J1RA 1XDSA 4E7LA 3BTLA 3F23A 4BKXA 5JLXA 5L3CA 3T0YA 3D5RC 4OIOF 1W7PA 2L4MA 3CUQC 1F43A 1G3WA 2QQ8A 1R00A 1E3PA 1LJ9A 3V8JA 1WPKA 4IZZA 4B48A 1Y1WJ 1Z1DA 1IG7A 2E1NA 3H92A 1OYYA 1XCVA 3H1CA 2LMDA 3Q9SA 1APLC 3I59B 4ESBA 1TNSA 1GDTA 1PP7U 2KRCA 3CMAI 4IHYA 1Z21A 4EQQA 5DUKA 3CCJI 2NS8A 5FKNA 2M45A 3OWTA 4ZYEA 1I27A 1ZG3A 2F48A 1YS7A 4C2MJ 1Y39A 1ERDA 4NHJA 1YHQI 1MBKA 3S1NJ 5JHUA 2M3AA 2VPLA 2GOMA 2R7UA 2VKVA 4KMUX 2FSWA 3M3YJ 3OY9A 2ZXHA 1WH5A 1DGRM 1P4XA 2Y75A 3KE2A 4BHBA 1DPUA 3K4NA 3KP7A 2HTJA 3PNTA 4CCLA 1Z3YA 2MLKA 1OJLA 2FQ3A 4HG2A 1JGGA 1OR7A 1FPQA 2VB6A 1IN8A 3V42A 5EF6A 5M5WJ 2EFQA 4L5EA 3OR2C 3K4BA 3D0SA 3HJEA 1N78A 2H8WA 3G71I 2MW8A 2XV4S 4PJLA 3OSFA 2IS4A 1GV2A 3W3CA 2ECCA 1XSXA 3O8HA 4DGWB 2K9LA 1H0MA 3E1SA 2EK5A 5DM7F 2QBYB 3G3ZA 1WWXA 4HX7A 4F3QA 2OF7A 2DOFA 3L00A 4MHGA 3HEFA 3BR1A 5GAEJ 2XPVA 5F0CA 1CQTA 3P5JA 3EUKL 3QU3A 1FX7A 2KLOA 2W48A 3A0BC 3JCUC 5KAFC 5BPIA 4BAYA 2K9QA 3KCCA 3O8GA 1GT0C 3LSHA 4ON0A 2I8DA 1DP7P 1R22A 4NUBA 1OLTA 2D45A 5HNHA 3MEXA 1S5LC 2IRFG 5B66C 3CCQI 3LSTA 2ZXWH 2Z16A 1EH6A 2FOKA 2M5WA 3VSKA 1KQ8A 2OAZA 1U6GA 3TP0A 4QIWN 3GFJA 2D2WA 4V19K 1BN5A 5H2FC 2VI6A 5ED4A 2HNHA 3FIWA 1HW5A 3OIQA 1B8IA 2R7VA 4YIFA 1BIBA 1MBGA 1I1GA 2QBYA 3RYRA 2DAOA 4C2TA 2IGNA 2X6OA 2NVTJ 2ISYA 5D5VB 3S3NA 3EDPA 2VN2A 1XN7A 1BL0A 2RN7A 3DTEA 5HLIA 2A68F 2BY2A 4OWRB 1K78B 5K7ZA 1KZHA 1BC8C 3CCYA 2BXZA 3PFIA 2BBYA 3K1MA 5IP9J 2A6TA 3KZIC 2Z1DA 2HPMA 5E3MA 2KIUA 4HLXA 4A0ZA 3HGGA 4XKVA 1AKHA 3B02A 3LAJA 1ETOA 2XRLA 3MAJA 2CJJA 4HQMA 2DK8A 2ZSIB 2DDAA 2I5UA 3LNQA 3GEZA 4HYEA 1MSEC 4OIPF 3ZQGA 4A6EA 1Y8RB 3FHNA 1P2FA 4MQVA 2D1HA 4ZZDA 5J47A 3JRFA 3OIPA 1VQKI 4LLLA 4HLYA 3IP4B 2ID6A 4NC6A 2P0WA 2GIVA 1NK3P 2HOEA 2WAQN 4MFDA 1U78A 2CU7A 2BXYA 3ISPA 3LL7A 4M9XA 1TL8A 2QSGX 1XG1A 4G7ZF 2NVUB 3ZMUA 2H1KA 2DBBA 1OCOH 2O5RA 3M8JA 2VKHA 1OR7C 4KICA 5CVJA 1QRYA 3VSLA 2L9VA 2G7HA 1IJWC 5K7HA 2STWA 1G3YA 5ICEA 1IXSB 4ENMA 3WG9A 1WKMA 2DOAA 2R0QC 5FJ8J 5CQGA 4RMNA 2W7NA 4I2OA 2ZCWA 1MD0A 2XKPA 2L02A 4HAMA 3F21A 4DZPA 2IA1A 1YS6A 4HDUA 5M5XJ 2NS0A 2RKHA 1UB9A 2J5PA 3QAHA 4BUPA 2H09A 5E79C 5KAIC 2K4JA 3RQ4A 4K2EA 2DOEA 2E5NA 1DU0A 3BG5A 3TP3A 4E7ZA 3CCRI 4GRIA 2CQKA 4A0XA 4B8XA 2GM4A 2LK2A 2IS2A 1JHHA 4MQ9F 2LVSA 4N4OB 4EJVA 3GMEA 3FXMA 2F5CA 2LLKA 3HOWJ 3BR6A 4YEJA 3U1KA 3MQ0A 2LKXA 2ME0A 5FFZA 3GTQJ 1X3WB 1IXRC 4YRVA 4BXXJ 3IKVA 1IO2A 1ULYA 1R4MB 3MMYB 3R60A 4EJUA 2E1OA 4LITA 5F08A 4GYIA 2DMTA 1OFCX 3ABTA 3JRDA 1ETYA 2KFDA 1BI0A 2E60A 1D8JA 3PO2J 3BTIA 2KKOA 4UY8I 2NVXJ 4HSRA 1IZ1A 4EV0A 1XMAA 1FP1D 5IOYA 4RDUA 1HKTA 2V1UA 3V7SA 3OS0A 1ZH5A 3Q0UA 3T1BA 1ZRFA 4IX7A 1VQ8I 4L0YB 1SAUA 3E5XA 3WGGA 5D8KB 1S7EA 1XMXA 4ZDOA 2CW0F 2ESHA 2MC4A 4X1EA 3I4MJ 3QYFA 4AIHA 3G6EI 2HI3A 1T95A 1FMWA 4MTEA 3K7AJ 2X85A 5CVUA 1EF4A 1FOYA 2QYOA 4G6TB 1R23A 1JTYA 2XGEA 2A07F 2LSOA 1AA7A 2CYYA 1R7JA 1YW9A 3CLQA 4QWQA 1AHDP 1PDNC 4M3DA 1E3OC 3JRHA 2E1MB 4CA0A 4BDZA 1FYKA 1YX5A 1W36D 2QKMB 2KZVA 4AD9A 2LF8A 2A5WA 3HC7A 2KT0A 4WXCA 4U0YA 1ZLKA 1XGSA 3L1PA 2O9LA 1TLHB 4BE2A 2M7AA 5LEKA 2QZ8A 5D4SA 1S3JA 2TDXA 4AU7A 2XC7A 1YJWI 5FRNA 4MEYF 2BY3A 1D5YA 4FQGA 2JA6J 1SD4A 1VQLI 2JK3A 3IC7A 2DI3A 4WK8F 4BS9A 4P5OA 5C4XJ 2VONA 1W5SA 3ZP5A 4RM3A 4ZH4F 1T98A 3PUFA 5L3EA 2KL4A 1G2HA 1XGMA 3BY6A 3S1QJ 1HSJA 1OYIA 4UUSB 2GIZA 4E70A 1W1WE 3OMYA 1R6RA 3KLOA 3RPUA 1GLNA 2M4GA 3ZQFA 4AM3A 1NG7A 2Q1ZB 4AIDA 2QUFA 2ECBA 1V5EA 3N05A 3G73A 4EGZA 2OQRA 1SVOA 3M8FA 2FD5A 3D1NI 5FFXA 3I64A 4AYBA 2G7UA 4U7BA 2DYSH 1W4MA 2ZC2A 3FWEA 3FMRA 3LFUA 3PIOF 4A93J 3S3MA 2B0LA 3JREA 5ERIA 1HA8A 1DP3A 4OU0A 1POGA 2DLLA 1TNTA 1FMVA 2XGDA 4YELA 1VFCA 3OYJA 1S72I 3U2RA 1RRJA 2HKXA 2KJCA 3IRQA 3R0JA 2F5DA 2LF7A 1JI8A 2EA2A 4HDVA 3PJRA 3MVPA 3I4NJ 5CVIA 1Y6IA 2RREA 3M9AA 1SFXA 4FASD 3DKYA 1BW5A 4V2FA 3KP5A 4JOMA 1R1TA 1YX3A 2Z3YA 2MH9A 1NHAA 2AQEA 2JN6A 2XAFA 1IRXA 1P4AA 1GXPA 1MKMA 2VOPA 2V7FA 4D5FA 2G0EA 2E36A 2GWRA 2YX4A 4EJOA 5AIPA 5J6XA 2RVCA 2EINH 1ZRDA 2X1CA 4XSZF 4KDPA 2H8RA 1QA6A 2LKSA 2CFXA 3K6GA 2LDUA 3J7AO 3J81K 3ZMTA 2K9MA 2RNJA 3RZDJ 4RGUA 2IT0A 3H5NA 1NK2P 1GVJA 1WCMJ 2BGCA 3QWLA 4AIKA 3VEPA 2DFFA 3X2QH 2XGXA 3CCUI 5E1ZB 5BS6A 1Z77A 4I7HA 2LOOA 2Y48A 4C30A 4D7MA 4ZYGA 5IT3A 4L0ZB 2VOOA 4L18B 4NC8A 2JVHA 4B1RA 1G6NA 1Q1VA 3WHCA 2GQQA 3S32A 1IDZA 3L2CA 2MA3A 1Z7LA 1U3EM 3F72A 2KMUA 3CC4I 2IA0A 4R1HA 3RKXA 5ICFA 2VBXA 2DFIA 2VKEA 4CICA 4BBSJ 4BJ6C 2DXIA 2W84A 2XPUA 2XGCA 1B72A 2XSJC 3IH2A 2HZTA 1TWAJ 1T39A 1WSUA 1HSTA 1WJCA 2WV0A 2DK5A 3GTGJ 1MBEA 5FLVA 4MIMA 4BU2A 1UG0A 1V3FA 5J1UA 5JR3A 2LG4A 2JRMA 1UFMA 3FBIB 4PDKA 2EQRA 2FEZA 1QGPA 3I3LA 4LLGF 1NTCA 3BT9A 3A01A 2X1DA 1VNDA 3E97A 4UNOA 1FTTA 3WGHA 1YI2I 2HR3A 3DP7A 4XORA 2DA6A 3VPRA 3A2KA 2MABA 4HV5A 1MJAA 2AXLA 4AIJA 1XS9A 3E6MA 3RKYA 3I59A 1P7JA 2CUEA 4O5VA 4QSHA 3Q5FA 4R79A 2EBIA 2MG4A 1IDYA 4M72A 2W4SA 2A61A 1MNEA 1FYMA 2ZJ2A 3BROA 2Q2EA 2UV1A 1T6SA 3KEYA 4IL6C 1QU3A 2UXNA 2PBIA 3OYGA 1V5GA 1BJZA 4KMFA 1MW7A 3ZGKA 1U9OA 3MD2A 3CO6C 4UV9A 3WGIA 3O6BB 2RGVA 4KNYA 2WADA 1I3AA 4LJZF 4BE0A 4PJNA 2DCEA 3ABKH 3QQAA 2V26A 2XAJA 5CJ9A 4HNTA 3WTUC 3GZ6A 4A5MA 4LK1F 1P92A 1KONA 1BIAA 2MYSA 3J80Z 2E2IJ 1SFUA 1J5YA 3L7WA 3K4LA 4WX9A 1YFHA 1CGPA 1UG2A 2KIFA 2NVYJ 4M71A 4E6KG 2L7MP 1U2WA 5ILSA 4XR6A 2EIKH 2M8GX 4XKWA 3LMMA 3SYTA 4ZYAA 2A69F 2O7OA 2PEXA 3LQRA 4FT8A 3TGNA 3H3UA 3WTTC 1MMGA 4ITVA 2IXSA 1KU2A 2LFBA 1X1PA 2KJBA 3AKZA 1X1AA 1PVEA 1Z7UA 3HHGA 5J4YA 3OYCA 3S3OA 3R4KA 2JZYA 1V54H 5D5XB 3OYNA 3BCBA 2EPFA 1TBXA 3D5LA 2JUGA 3CZ6A 4KA4A 1ZG5A 2CH0A 2ZKZA 1U8RA 1VQ7I 4B44A 4Q48A 1MIJA 1AOYA 1BI1A 3GTPJ 4IPAA 1X3UA 4DOZA 4R8HA 1DQUA 1BA5A 5F64A 4A3BJ 3Q9VA 3NRVA 5H6RA 1ITYA 4G7HF 1CF7B 3F9KA 4Y4RA 2DA1A 2ID3A 4C3IJ 1B72B 4GCVA 1FOXA 4DJAA 5CVRA 3V8LA 4CCMA 2E2JJ 2LRDA 3S2WA 4HZFA 3VYTB 2ZFUA 3BDDA 4RGRA 3JSPA 4NDLA 5E1WA 2GXBA 5E3NA 3U1DA 1YW7A 1FOKA 4FX0A 3CJRB 4MFEA 3JRAA 2CUZA 2R7ZJ 3K2AA 1N25A 2IA2A 3KPHA 1A5JA 2NAZA 4I0BA 3ROUA 1YIOA 3AAFA 2K9NA 2WAFA 1VQPI 1H88C 2CV1A 4M6XA 5DYMA 5E17F 3ECHA 2BHYA 2OZUA 3DXJF 3P9KA 2HQAA 5LGNA 3M4OJ 2EIMH 2WY8Q 5F04A 2OA4A 4I76A 4ESJA 4XLCA 3GF2A 2XF5A 1AKHB 5TJJA 4RA2A 2AS5F 2XF7A 2ZJRF 1J7KA 5DD4A 4A3GJ 1SANA 1X4PA 3DEWA 1MMSA 3L2UA 4IO9F 1IRZA 4HOBA 1X2NA 3FXRA 3W6JB 4XOPA 3BR2A 4N9HA 2EB7A 1VTNC 3GZ5A 2CQXA 5BMZA 3V7CA 3CDIA 5FKLA 2WBMA 5LHIA 2COMA 2FBIA 2HVSA 5EG0B 1ENHA 2VKDA 1YIJI 3VYUB 2WV1A 4GDFA 1WFXA 3VOEA 1KU9A 1LQ1A 2P8TA 3AG1H 2A3SA 2OUMA 3JRCA 3GTKJ 1RUNA 1G3TA 5C3EJ 2KDZA 5B1AH 1S6LA 2X9DA 4KIBA 3FMQA 5K7FA 4C9YA 2P81A 5HDGA 4LGWA 4G7OF 5FRMA 3F8MA 3M1CA 1P6RA 2J5OA 3RI4A 2I10A 3KFWX 5GADJ 1W7PD 1XPXA 4M3FA 4H0EA 3BP8A 2ACJA 3GFLA 1VQMI 3LSJA 1I1SA 5E18F 1H9TA 4DBQA 2R7OA 2CW8A 1B8IB 4M6VA 3CCVI 4E7SA 5LBQA 2GBYA 5KNLA 1FEXA 1PUFA 4G12A 4HV6A 3CCSI 3FF5A 4DZJA 5EGOA 3CESA 5JHFA 1QBJA 3CJNA 2K86A 3TEDA 5H20A 2VT3A 5EYRA 3K70D 4PGHA 2OBPA 2P5VA 3HOTA 2XB5A 1OCZH 5LRSA 2HS5A 3HOSA 3LSKA 5EDNA 1R71A 3E6BA 2LH9A 3FXQA 3K4MA 1D5VA 1ZR4A 1FBUA 4XONA 1R58A 4Y17A 3OOPA 1USTA 3ASOH 4RB1A 4GXOA 1XGNA 2NVQJ 2HEOA 5IOZA 1ZR2A 1WJ5A 3GO5A 4F93B 3OSGA 1EKEA 1LVAA 5LLQA 2YU9J 4LB6B 2L7FP 2ZMEC 4TV7A 2PX9A 2M0CA 4OINF 1EJ9A 2JA5J 4L5JA 1MDMA 1SVLA 3A02A 2M9HA 2B9SA 3FDYA 3BQYA 2QSFX 1BR1A 3BC8A 4KFCA 3TO6A 1HLVA 3GFIA 3B6AA 5EZHA 4XIDA 4AVZA 1Z05A 3PQJA 3QRFF 2D5VA 3ZQ7A 1J0RA 3LSMA 1FIPA 4JBAA 4RLQA 3ZMZA 4WCGA 5F1RA 3MKZA 5DCFA 5J40A 4GO1A 4ZTFA 2LNBA 3AG2H 4F92B 1X3ZB 2KDOA 3C18A 2VBYA 1U5TC 4MO7A 1YTYA 3S15J 2HVRA 3E7LA 4HRIA 2IBDA 1M1EB 1XMKA 2LP0A 2UUZA 2VE9A 3KZZA 2OV7A 2OJED 2KRFA 3CF2A 4U87A 3MZHA 2QSHX 1Y1VJ 1MBFA 3GLLA 3P9CA 4N4NB 2BW3B 5LHGA 4M3GA 2Z9OA 1FTZA 2GA2A 3VDXA 1FC3A 1SC7A 5GAHJ 1TZLA 5ICCA 4OIRF 3SFZA 1JGSA 4M9ZA 4J19A 3W2VA 2XKOA 5E1XA 3IAS2 2V6EA 2VC1A 4MNUA 3HRUA 4BHPA 4HW0A 4CXFA 3H5AA 2EFOA 1D1CA 1ON1A 1B9NA 1D1AA 4KJZA 1TQMA 4L9VA 1JKOC 4PFOA 3I53A 3ULQB 1SFOJ 4LMYA 1A36A 2L7KA 2A5YB 1MMNA 1I5ZA 4N9IA 4RLFA 1ETVA 3FKIJ 2R92J 1ETQA 2L4AA 2V1DA 3E3VA 1FT9A 3EYYA 4IF4A 3WE2A 1MH4A 3BLYA 4CCJA 2UXXA 1RR7A 1X58A 4OIQF 3HPGA 3ZCOA 1GVDA 4IHSA 2IS1A 1F1ZA 1VQ6I 4DW6A 3FISA 3CJQB 2PMZN 1QVUA 2BW3A 2LREA 2DQLA 1PP8F 4JYKA 5HDKA 2DA4A 2VIXA 1REPC 1FBSA 3BPXA 2ZSHB 2HWVA 4GFBA 1HDDC 2AHQA 2Y9YA 2LY1A 2P5KA 1BBYA 2ME6A 4I0AA 1R5GA 2ZFWA 3SZPA 3ZR8X 5HDNA 4A3DJ 3AL0C 4Q5SF 3CCMI 1F4KA 4PCQA 4JX4A 2GLOA 5A2QZ 2QEXI 2XDVA 3HKZN 5J8FA 1X4OA 2EZKA 2YS9A 2OPTA 3GTOJ 4PSXA 2XUBA 3G2BA 2PJRB 2L01A 3FZVA 3MWMA 2V9VA 2K7LA 4FE4A 1O3QA 2L5QA 4ESFA 3GXOA 3DCFA 3H0GJ 1LFPA 1XB4A 3IHUA 2FNPA 2B63J 1O57A 1HW2A 1Z9CA 2W57A 1MMDA 1O3SA 4O6JA 3SZGA 3QYBA 3VODA 4A3KJ 4UVBA 4YFNF 1PUEE 3DPUA 1MZBA 1XX5A 1D3YA 5DEQA 3S16J 1ZYRF 1JUPA 1W5TA 4M74A 1NH3A 4IHTA 4MTDA 2ETHA 2DT5A 3BJAA 1ETXA 2FMLA 2IGKA 4OOIA 3IWZA 2VODA 1LDJA 2M34A 4UB8C 4W1UA 2DFHA 3LSRA 2JSPA 1LE8A 3HTSB 4CCNA 4CZCA 3KIOA 2WB1A 3FXKA 5JFRA 4IVNA 4KIGA 3OL4A 2AQFA 4I99C 3S2DJ 2VBZA 2QQ9A 2W00A 4D0PA 4JK1X 1L0OC 3JTGA 2MFZA 2R4GA 1DU6A 1B59A 4M6YA 3S2HJ 3LFKA 4LG3A 1GHCA 4M3BA 4U0WA 4ENNA 1G3SA 3ABLH 3WE3A 1R4NB 4LG0B 1S8NA 3KX2A 1UHMA 3SXYA 1AWCA 3LAPA 3C2GA 3V8KA 3BG7A 4PJ0C 2DMUA 3HUGA 4FETA 1WJFA 4ETSA 2JWTA 4QPQA 1QQIA 4Z2YA 2M0MA 3ZMDA 2LKPA 4EM0B 4NB5A 2V4JC 1UJ8A 1JXSA 5GAGJ 5JI6A 4OAZA 1WH7A 3LWFA 2OCCH 4H4KC 3MFKA 4B3AA 2M7BA 2E19A 2KHMA 1XTAA 3OYBA 1KQ0A 4MGRA 2KRHA 4DYQA 1MH3A 1H89C 1LNWA 4IRHA 4WXDA 3I55I 1D0YA 1WJBA 2FBKA 5GPCA 3SJMA 1TC3C 2WAEA 1FIAA 1TW2A 3BOQA 2WAQA 1MSFC 5AONA 2KP6A 1HXDA 4UUTA 3RIRA 3MZYA 2DFEA 2E5ZA 4AWXB 2E1MC 2M4KA 2OZ6A 4XK4A 2FUG2 4CHUA 2PN6A 3RJPA 5EEHA 3ZQIA 5IY5H 1UMQA 3EUAA 1A04A 2HQ5A 2K5CA 5K5QA 1JUMA 2DODA 3HUGB 2QENA 3JRBA 4N0BA 3KYCB 3L2QA 4ZDLA 3CF5F 2EWNA 2K40A 1EH7A 2KIMA 1ZHFA 4KISA 2PJRA 1A6QA 3CC2I 4UHTA 5M3MJ 4D7NA 5EZGA 3C7JA 3KYLA 4EM1A 2JA2A 2E7WA 2HOTA 2RDPA 2F2EA 1VF9A 3TO9A 3ZN0A 2KIQA 3WTWC 2DDBA 2R5ZB 4FTHA 4MEXF 3FXUA 3F6VA 3JW4A 2ZMEB 2X1EA 4CGZA 3TBIA 2IEKA 4E7IA 1Q1HA 3M07A 2V6CA 3PSFA 3W2WA 1FY7A 3O2PE 3F8FA 1QNTA 2AO9A 2ZMEA 1SEUA 2DA2A 1XDUA 2NXNB 2COBA 4MLOA 1G59A 1Y0NA 2MH2A 4DBRA 4FX4A 1F36A 3GTJJ 2CWEA 3R61A 3ESWB 2G9WA 2XB0X 3TDUC 2DN0A 1MMAA 2VLAA 3PL8A 2EZIA 2R3SA 5HVQC 2M2EA 3CCEI 4IKFA 5CPRB 2Q8KA 3H9JA 1ETKA 2XAUA 3HOUJ 4BDYA 2FBHA 2R7RA 2HFHA 1LFUP 1O7FA 3EETA 5DV5A 5LEJA 4JP0A 4UB6C 2W24A 5IT9Z 2DJNA 2OCEA 5J3LA 3F0CA 4M73A 2NNYA 1MNMC 3ONQA 3TKYA 3H5RA 1J09A 4IQJA 1WZ2A 1LUJB 2P7CB 3ELKA 1RESA 3OS2A 1LFBA 2O6GE 4ABZA 4IXAA 3K9TA 1WVRA 3HOVJ 3CTAA 3HKZA 4F91B 4BJTA 1K78A 2YUSA 1TT5B 2CV0A 3LA7A 4WXHA 3ZQCA 5L3BA 2HPIA 4GYGA 1ZN2A 2P4WA 1K79A 1F9NA 4RAGA 2L9SA 2BHZA 4W97A 4XNFA 4Y13A 2DPUA 1XD7A 3PM1A 3DTIA 1RPWA 2OU2A 3OV8A 1MJBA 4AC0A 2KPMA 5KVRA 5CLSA 3HRSA 1P7IA 2FNAA 1AU7A 4BNCA 2W82A 1Y56A 5EEAA 1W7PB 2YR2A 2GZWA 1HKQA 3KP2A 3L2RA 2FU4A 2A6EF 3SZTA 3OYAA 3TW6A 5FLXZ 5D6EA 2CUJA 3QU6A 5FGMA 2BZTA 3MKLA 4CYCA 3OYDA 3GZNB 2WWYA 3S93A 2HKOA 4I98B 3DPLC 3F3XA 4UVCA 4ZYDA 2XROA 2JSCA 2EZHA 4A3FJ 1O3RA 3HSEA 1J75A 2V1XA 2VE8A 1BOBA 1MDMB 5FROA 1LDKB 3CMEI
chains in the Genus database with same CATH topology
4L9JA 2QQBA 2X0LA 3NEUA 3L09A 1IN7A 1YQAA 2MBFA 4O3MA 1LB2A 4ZYHA 4S05A 5KK1A 1B9MA 2ZO4A 1ZGAA 3GVAA 1OMIA 2HQNA 4HBLA 1IF1A 3QPHA 2R7DA 5LGUA 4UXNA 2CG4A 3T8RA 3LQQA 5D8LB 1USSA 3K1PA 2EV0A 4BHCA 4DNCA 1RZ4A 4Y15A 2EA4A 2PMUA 2ESNA 4KN7X 4DQ2A 4G94A 1BI3A 2XHKA 3KEOA 2H6BA 2VXZA 2X4HA 4RB0A 1B1BA 2MC3A 1ZLJA 1ON2A 1Z6TA 1RI7A 3NQOA 1B4AA 3IKTA 4ZZLA 1BC7C 5BOXA 3GW2A 3IWFA 3I0TA 3CDHA 3L9FA 1IN5A 5LRRA 3EQLF 5IT9K 2PG4A 3COAC 4L9NA 3M7GA 3HTUA 1WI9A 3CUOA 3JSOA 5E8IA 4Q47A 2BYVE 3TO7A 3HRTA 1RUOA 2EV6A 1BM9A 3F22A 2E1CA 4CO8A 5DUIA 3M8EA 3WODF 1DUXC 5HLHA 1C0WA 3EYIA 3BZ6A 2IP2A 4HF2A 5D5UB 1MGTA 2XVCA 5D5WB 3KETA 4EM2A 2EV5A 4G8XA 1XGOA 2XAHA 5J8CA 1JHFA 2DPDA 3B73A 1EV7A 3CUQB 3H3ZA 3V7RA 1S7OA 1SD7A 3J80K 2PI0A 3K2ZA 5L3GA 1Y0UA 5K5OA 1QZZA 3F6OA 2WC2A 5F6FA 2IJLA 1YYVA 3BPVA 3WTZA 3ZPLA 2V79A 2QLZA 2E7XA 1V4RA 3E6CC 3JAMZ 3T5XA 1UHWA 1O3TA 1BOAA 2L54A 1FLIA 1KQ9A 3IL2A 2HDCA 5BPDA 2MD5A 3KLNA 2Z33A 2YU3A 4LK0F 3FHZA 2M87A 2UWMA 2DW4A 1RIOH 4A2UA 2DQRA 1IN4A 2FE3A 2XAGA 3I71A 3W6KB 3JTHA 2O3FA 4UUVA 4U88A 1IN6A 2PLYA 2P7VB 1IUYA 1U5TB 1DPRA 4Q4ZF 1OPCA 1G4DA 2NNNA 4ENJA 1FZPB 3SHFA 1XSDA 4L5IA 1WQ2A 2H27A 1OKRA 1O7LA 2ZXJA 2QQAA 3C1DA 1SMTA 4G9YA 4I09A 4RB2C 3TDZC 3DFGA 3LA2A 2F5FA 5HS9A 4RAYA 3FMSA 3GUDA 1HQCA 2GA1A 1YG2A 3P7NA 3WTSC 4A5NA 1ZREA 2XASA 2EFNA 4F7ZA 1L3LA 1LEBA 3I4PA 4LFUA 2YPRA 4JQFA 2R7FA 3E5QA 2VBWA 4XBFA 3ZMVA 3RYPA 3KP3A 3SQNA 5D6FA 2ELHA 1R5HA 2FF4A 3TOAA 2JTVA 3WTVC 1KYZA 1SFEA 4RAZA 5H6QA 4QLCU 3I5UA 4CDGA 1F5TA 1HBXG 2ZNZA 1SD6A 3LA3A 3KEQA 4IRGA 1K6OA 4U7DA 3RPQA 5JVTA 1R1UA 3JAMK 1XCBA 2Z99A 2O61A 3WU1B 2BE5F 1JE8A 5E8GA 2PMHA 4ENKA 1BI2A 3GLXA 1QPMA 1SD5A 2D1VA 4LD5A 2O8XA 1J59A 2IPQX 2ZBKA 1HKSA 1H9GA 3HSFA 4XLPF 3O3KA 3BWGA 3R0AA 3TQNA 5DCMB 1MJ9A 4EJWA 5K5RA 4KYWA 2EFPA 5ILUA 4RGXA 1J2XA 1K7AA 1T38A 2O0YA 3WTYC 4L9TA 3K1NA 5DD8A 2HTSA 4G6DA 4HF0A 2UZKA 1LDDA 4YG2F 2A6HF 2K27A 4GGGA 1WRJA 3DEUA 2PFBA 5TRDA 3CO7C 1FWZA 3F8BA 1YLFA 3WU0A 1FNNA 1UCRA 1S7AA 2H6CA 3ZMSA 1S29A 4CZZA 3F8CA 1KU3A 4IRIA 4HQEA 3TOBA 5HS7A 4YFKF 3GYHX 1FSEA 2HYGD 2DU9A 1TW3A 3EUHA 1T2KA 1TQIA 5L3DA 3QPTA 4G6QA 1Z91A 4HX4A 2Y0MA 3U9GA 2FA5A 3HYIA 3BJOA 1P4WA 2L3DA 4UVAA 3T8TA 3GWZA 2EJRA 3F8NA 4WF2A 3GX4X 4EVIA 1FP2A 2NYXA 2P5LC 2HYFA 2YSRA 2F5EA 2O03A 4YFXF 2FRHA 2CO5A 4BQAA 4RGSA 2M1BA 1IRFA 1GXQA 3K0LA 1CF7A 3RKWA 2VC0A 2HGCA 3CUQA 4A12A 3KP6A 2Q0OA 4ASNA 1Z6RA 2IW5A 1BJAA 2M8EA 4P9FA 2RV8A 5DCMA 4PGGA 2CGPA 3MCZA 1IW7F 3QP6A 4AVPA 1RNLA 3DPTA 4XLNF 4S04A 3E6DA 1KA8A 5BQTA 3CLOA 3I54A 2WTEA 3ECOA 3J81Z 5EEGA 1YW8A 2C6YA 2H94A 2CSOA 1OYWA 1KGSA 5CVVA 2QVOA 1ZGJA 1ZAOA 4XRFA 3HSRA 5LHHA 4EJTA 1T0FA 1ZRCA 1SMYF 4UV8A 4HX8A 2W85A 2ADUA 1ZARA 4A0YA 3QOPA 1KU7A 4LLNA 2JPBA 4KUMA 4A6DA 3I58A 2QWWA 3E5UA 2IVMA 4FHTA 4BYYA 4HF1A 3DKWA 2P6SA 1ODDA 1IRGA 1DDNA 2ISZA 3HIFA 1YO5C 2Z5UA 3ZN1A 3N4MA 2FMYA 3ERED 1FSHA 2RC4A 1FBQA 3WTXC 3V4GA 2OQGA 1IAWA 5FLXK 4NQWA 1STZA 5FB2A 2YX7A 5ICGA 5HS8A 1QO0D 2K4BA 2XRNA 5D4RA 4YIIA 1J9IA 1LEAA 1HW1A 3BJ6A 4B09A 3FM3A 4KN4X 1TTYA 4HA8A 1I6XA 2GXGA 5HLGA 2EFWA 3VB2A 1D8KA 1FYLA 1QZYA 1R1VA 3RTRA 1U5TA 2VT2A 2M30A 2JT1A 1SAXA 3FX3A 4BXUA 4RB3C 4KT5C 1EH8A 1B6AA 4I01A 2HQRA 1TQPA 3PQKA 3REOA 5L3FA 4WWCA 3KP4A 5LGTA 3FM5A 2XIGA 6PAXA 2STTA 5A2QK 2P6TA 3R6SA 3ML6A 3DQVC 5HOOA 3DV8A 4RS8A 2JRTA 1XSVA 3GFMA 2PJPA 4EGYA 2MLGA 4I02A 1ZG1A 2BV6A 5FD5A 1R36A 3ABUA 1E17A 2DO7A 2OD5A 4OMZA 5CYVA 5FD6A 2FXAA 3C3WA 4CYDA 3IRRA 4LB5A 1IXCA 1E2XA 3K69A 3M1EA 4BH9A 3N97A 3DF8A 3HRMA 4EMSA 2NRAC 5DDGA 2DTRA 3QP5A 2BEOA 2JPCA 2ZNYA 2XAQA 4P9UA 5FO5A 4KIFA 4U0VA 4XSXF 5ILVA 4OMYA 4LG0A 5K1YA 2K02A 4M9SA 2QM3A 4P96A 2GAUA 3HHHA 3VFZA 2W25A 4IJAA 3RDIA 1KYWA 5AIQA 4P55A 4PZJA 2RQPA 3P9IA 1ONVA 5E20A 3KZYA 2PQ8A 1XDSA 3F23A 5L3CA 3T0YA 4OIOF 1W7PA 2L4MA 3CUQC 1G3WA 1R00A 1LJ9A 3V8JA 1Z1DA 2E1NA 3H92A 1OYYA 1XCVA 3Q9SA 3I59B 4ESBA 1TNSA 1PP7U 4EQQA 5DUKA 2M45A 4ZYEA 1I27A 1ZG3A 1YS7A 4NHJA 5JHUA 4KMUX 2FSWA 1P4XA 2Y75A 3KE2A 4BHBA 1DPUA 3KP7A 2HTJA 2MLKA 2FQ3A 1OR7A 1FPQA 1IN8A 2EFQA 3D0SA 2XV4S 1XSXA 1H0MA 2EK5A 2QBYB 3G3ZA 1WWXA 4HX7A 3L00A 4MHGA 3QU3A 1FX7A 5BPIA 4BAYA 3KCCA 4ON0A 1DP7P 1R22A 2D45A 3MEXA 2IRFG 3LSTA 1EH6A 2FOKA 2M5WA 1KQ8A 2OAZA 1U6GA 3GFJA 2D2WA 1BN5A 5ED4A 1HW5A 4YIFA 1BIBA 2QBYA 1I1GA 3RYRA 2DAOA 2ISYA 5D5VB 3EDPA 2VN2A 1XN7A 2RN7A 1K78B 5HLIA 2A68F 1BC8C 3PFIA 2BBYA 3K1MA 4HLXA 2KIUA 4A0ZA 3B02A 3LAJA 3MAJA 4HQMA 2DK8A 3GEZA 4HYEA 4OIPF 4A6EA 1P2FA 4MQVA 2D1HA 4ZZDA 4LLLA 4HLYA 2GIVA 2HOEA 1U78A 3ISPA 4M9XA 4G7ZF 3ZMUA 2DBBA 4KICA 5CVJA 2G7HA 2STWA 1G3YA 5ICEA 1IXSB 4ENMA 3WG9A 1WKMA 4I2OA 2ZCWA 1MD0A 2XKPA 2L02A 4HAMA 3F21A 2IA1A 1YS6A 4HDUA 2NS0A 2RKHA 1UB9A 2J5PA 3QAHA 2H09A 2K4JA 4K2EA 2CQKA 4A0XA 4B8XA 1JHHA 4MQ9F 4EJVA 2F5CA 3MQ0A 5FFZA 1IXRC 3IKVA 1ULYA 3R60A 4EJUA 4GYIA 3ABTA 1BI0A 1D8JA 2KKOA 1IZ1A 4EV0A 1XMAA 1FP1D 1HKTA 2V1UA 3V7SA 1ZH5A 3T1BA 1ZRFA 4L0YB 3E5XA 3WGGA 5D8KB 2CW0F 2ESHA 4AIHA 4MTEA 5CVUA 2QYOA 1R23A 2A07F 2LSOA 2CYYA 1R7JA 1YW9A 4QWQA 1PDNC 1FYKA 4AD9A 2LF8A 4WXCA 4U0YA 1ZLKA 1XGSA 1TLHB 5LEKA 2QZ8A 5D4SA 1S3JA 2TDXA 4MEYF 1SD4A 3IC7A 2DI3A 4WK8F 4P5OA 2VONA 1W5SA 3ZP5A 4ZH4F 1T98A 5L3EA 1XGMA 3BY6A 1HSJA 1OYIA 4E70A 3KLOA 3RPUA 2QUFA 3G73A 4EGZA 2OQRA 3M8FA 5FFXA 3I64A 2G7UA 4U7BA 1W4MA 3FWEA 3FMRA 2B0LA 5ERIA 4OU0A 2DLLA 1TNTA 3U2RA 2HKXA 2KJCA 3IRQA 3R0JA 2F5DA 2LF7A 2EA2A 4HDVA 5CVIA 3M9AA 1SFXA 3KP5A 1R1TA 2Z3YA 2MH9A 1NHAA 2XAFA 1P4AA 1GXPA 1MKMA 2VOPA 2YX4A 2GWRA 4EJOA 5AIPA 5J6XA 2RVCA 1ZRDA 4XSZF 4KDPA 2CFXA 3J7AO 2LDUA 3J81K 3ZMTA 2RNJA 4RGUA 2IT0A 1GVJA 2BGCA 4AIKA 3VEPA 2XGXA 5E1ZB 5BS6A 4I7HA 2Y48A 4L0ZB 4ZYGA 5IT3A 2VOOA 4L18B 1G6NA 2GQQA 3L2CA 2MA3A 1U3EM 3F72A 2IA0A 4R1HA 3RKXA 5ICFA 2VBXA 2DFIA 4CICA 2W84A 2HZTA 1T39A 1WSUA 1HSTA 2WV0A 2DK5A 1V3FA 5JR3A 1UFMA 4PDKA 2FEZA 1QGPA 4LLGF 3E97A 4UNOA 3WGHA 2HR3A 3DP7A 4HV5A 1MJAA 2AXLA 4AIJA 3E6MA 3RKYA 3I59A 4O5VA 3Q5FA 4R79A 4M72A 2A61A 1FYMA 2ZJ2A 3BROA 2Q2EA 1T6SA 2UXNA 2PBIA 4KMFA 3CO6C 4UV9A 3WGIA 3O6BB 2RGVA 4KNYA 4LJZF 2XAJA 5CJ9A 3WTUC 3GZ6A 4A5MA 4LK1F 1P92A 1BIAA 3J80Z 1SFUA 1J5YA 3L7WA 4WX9A 1YFHA 1CGPA 2KIFA 4M71A 1U2WA 5ILSA 2A69F 2PEXA 3LQRA 4FT8A 3TGNA 3H3UA 3WTTC 1KU2A 2KJBA 1Z7UA 3HHGA 3R4KA 2JZYA 5D5XB 3D5LA 1TBXA 4KA4A 1ZG5A 2ZKZA 1U8RA 4Q48A 1AOYA 1BI1A 4IPAA 1X3UA 4R8HA 5F64A 3Q9VA 3NRVA 5H6RA 4G7HF 1CF7B 4GCVA 5CVRA 3V8LA 3S2WA 4HZFA 3BDDA 4RGRA 3JSPA 5E1WA 2GXBA 3U1DA 1YW7A 1FOKA 4FX0A 2IA2A 2NAZA 4I0BA 3ROUA 1YIOA 3AAFA 4M6XA 5DYMA 5E17F 3ECHA 2OZUA 3DXJF 3P9KA 5LGNA 2OA4A 4ESJA 3GF2A 5TJJA 2AS5F 1J7KA 5DD4A 4HOBA 3FXRA 3W6JB 4N9HA 2EB7A 1VTNC 3GZ5A 5BMZA 3V7CA 5LHIA 2COMA 2FBIA 3VOEA 1KU9A 1LQ1A 2P8TA 2A3SA 1RUNA 1G3TA 1S6LA 4KIBA 3FMQA 5HDGA 4LGWA 4G7OF 3F8MA 1P6RA 2J5OA 3RI4A 3KFWX 1W7PD 4H0EA 3BP8A 2ACJA 3GFLA 1I1SA 5E18F 1H9TA 5LBQA 4HV6A 3FF5A 1QBJA 3CJNA 2K86A 5H20A 2VT3A 4PGHA 2OBPA 2P5VA 3HOTA 5LRSA 2HS5A 3HOSA 3E6BA 3FXQA 1D5VA 1FBUA 1R58A 4Y17A 3OOPA 1USTA 4RB1A 4GXOA 1XGNA 2HEOA 3GO5A 1LVAA 5LLQA 4LB6B 4TV7A 4OINF 4L5JA 1MDMA 4KFCA 3TO6A 3GFIA 1Z05A 3PQJA 3QRFF 3ZQ7A 1J0RA 4JBAA 3ZMZA 4WCGA 5F1RA 5DCFA 4GO1A 2LNBA 3C18A 2VBYA 1U5TC 1YTYA 1XMKA 2VE9A 3KZZA 2KRFA 3MZHA 3P9CA 5LHGA 2Z9OA 2GA2A 1FC3A 5ICCA 4OIRF 3SFZA 1JGSA 4M9ZA 2XKOA 5E1XA 2VC1A 4MNUA 3HRUA 4BHPA 4HW0A 4CXFA 2EFOA 1ON1A 1B9NA 1TQMA 4L9VA 3ULQB 3I53A 4LMYA 2A5YB 1I5ZA 4N9IA 2L4AA 2V1DA 3E3VA 1FT9A 3EYYA 4IF4A 3WE2A 2UXXA 4OIQF 4IHSA 1F1ZA 2DQLA 1PP8F 5HDKA 1REPC 1FBSA 3BPXA 2HWVA 2P5KA 1BBYA 4I0AA 1R5GA 2ZFWA 3SZPA 5HDNA 4Q5SF 1F4KA 4PCQA 5A2QZ 5J8FA 2XUBA 2L01A 3FZVA 3MWMA 2V9VA 2K7LA 1O3QA 4ESFA 3GXOA 1XB4A 3IHUA 2FNPA 1O57A 1HW2A 1Z9CA 2W57A 1O3SA 4O6JA 3VODA 4UVBA 4YFNF 1PUEE 1MZBA 1D3YA 5DEQA 1ZYRF 1W5TA 4M74A 4IHTA 4MTDA 2ETHA 2DT5A 3BJAA 2FMLA 4OOIA 3IWZA 2VODA 1LDJA 3HTSB 5JFRA 4IVNA 4KIGA 2VBZA 2QQ9A 4D0PA 4JK1X 1L0OC 3JTGA 1B59A 4M6YA 3LFKA 1GHCA 4U0WA 4ENNA 1G3SA 3WE3A 4LG0B 1S8NA 3SXYA 1UHMA 1AWCA 3LAPA 3V8KA 3HUGA 4ETSA 1QQIA 4Z2YA 4EM0B 3ZMDA 2LKPA 4NB5A 1JXSA 5JI6A 3LWFA 3MFKA 1KQ0A 4MGRA 1LNWA 4IRHA 4WXDA 2FBKA 1TW2A 3BOQA 5AONA 1HXDA 3RIRA 3MZYA 4AWXB 2OZ6A 4CHUA 2PN6A 3RJPA 5EEHA 1A04A 5K5QA 2QENA 4N0BA 2EWNA 1EH7A 2KIMA 1ZHFA 4UHTA 3C7JA 4EM1A 2E7WA 2RDPA 2F2EA 3TO9A 3ZN0A 3WTWC 4MEXF 3FXUA 3F6VA 3JW4A 2ZMEB 4CGZA 1Q1HA 2V6CA 1FY7A 3O2PE 3F8FA 1QNTA 2ZMEA 1XDUA 2MH2A 4FX4A 2CWEA 3R61A 2G9WA 3TDUC 2R3SA 5HVQC 2Q8KA 2FBHA 2HFHA 1O7FA 3EETA 5DV5A 5LEJA 2W24A 5IT9Z 4M73A 2NNYA 3TKYA 2P7CB 3ELKA 2O6GE 4IXAA 3K9TA 3CTAA 1K78A 3LA7A 4WXHA 5L3BA 4GYGA 1ZN2A 2P4WA 1K79A 1F9NA 4Y13A 2DPUA 1XD7A 2OU2A 3OV8A 1MJBA 5KVRA 5CLSA 3HRSA 2FNAA 4BNCA 1W7PB 2YR2A 2GZWA 1HKQA 3KP2A 2FU4A 2A6EF 3SZTA 5FLXZ 5D6EA 3QU6A 5FGMA 2WWYA 2HKOA 4I98B 3DPLC 1J75A 3F3XA 4UVCA 4ZYDA 1O3RA 2JSCA 2XROA 3HSEA 2V1XA 2VE8A 1MDMB 1LDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9J A;  2QQB A;  2X0L A;  3NEU A;  3L09 A;  1IN7 A;  1YQA A;  2MBF A;  4O3M A;  1LB2 A;  4ZYH A;  4S05 A;  5KK1 A;  1B9M A;  2ZO4 A;  1ZGA A;  3GVA A;  1OMI A;  2HQN A;  4HBL A;  1IF1 A;  3QPH A;  2R7D A;  5LGU A;  4UXN A;  2CG4 A;  3T8R A;  3LQQ A;  5D8L B;  1USS A;  3K1P A;  2EV0 A;  4BHC A;  4DNC A;  1RZ4 A;  4Y15 A;  2EA4 A;  2PMU A;  2ESN A;  4KN7 X;  4DQ2 A;  4G94 A;  1BI3 A;  2XHK A;  3KEO A;  2H6B A;  2VXZ A;  2X4H A;  4RB0 A;  1B1B A;  2MC3 A;  1ZLJ A;  1ON2 A;  1Z6T A;  1RI7 A;  3NQO A;  1B4A A;  3IKT A;  4ZZL A;  1BC7 C;  5BOX A;  3GW2 A;  3IWF A;  3I0T A;  3CDH A;  3L9F A;  1IN5 A;  5LRR A;  3EQL F;  5IT9 K;  2PG4 A;  3COA C;  4L9N A;  3M7G A;  3HTU A;  1WI9 A;  3CUO A;  3JSO A;  5E8I A;  4Q47 A;  2BYV E;  3TO7 A;  3HRT A;  1RUO A;  2EV6 A;  1BM9 A;  3F22 A;  2E1C A;  4CO8 A;  5DUI A;  3M8E A;  3WOD F;  1DUX C;  5HLH A;  1C0W A;  3EYI A;  3BZ6 A;  2IP2 A;  4HF2 A;  5D5U B;  1MGT A;  2XVC A;  5D5W B;  3KET A;  4EM2 A;  2EV5 A;  4G8X A;  1XGO A;  2XAH A;  5J8C A;  1JHF A;  2DPD A;  3B73 A;  1EV7 A;  3CUQ B;  3H3Z A;  3V7R A;  1S7O A;  1SD7 A;  3J80 K;  2PI0 A;  3K2Z A;  5L3G A;  1Y0U A;  5K5O A;  1QZZ A;  3F6O A;  2WC2 A;  5F6F A;  2IJL A;  1YYV A;  3BPV A;  3WTZ A;  3ZPL A;  2V79 A;  2QLZ A;  2E7X A;  1V4R A;  3E6C C;  3JAM Z;  3T5X A;  1UHW A;  1O3T A;  1BOA A;  2L54 A;  1FLI A;  1KQ9 A;  3IL2 A;  2HDC A;  5BPD A;  2MD5 A;  3KLN A;  2Z33 A;  2YU3 A;  4LK0 F;  3FHZ A;  2M87 A;  2UWM A;  2DW4 A;  1RIO H;  4A2U A;  2DQR A;  1IN4 A;  2FE3 A;  2XAG A;  3I71 A;  3W6K B;  3JTH A;  2O3F A;  4UUV A;  4U88 A;  1IN6 A;  2PLY A;  2P7V B;  1IUY A;  1U5T B;  1DPR A;  4Q4Z F;  1OPC A;  1G4D A;  2NNN A;  4ENJ A;  1FZP B;  3SHF A;  1XSD A;  4L5I A;  1WQ2 A;  2H27 A;  1OKR A;  1O7L A;  2ZXJ A;  2QQA A;  3C1D A;  1SMT A;  4G9Y A;  4I09 A;  4RB2 C;  3TDZ C;  3DFG A;  3LA2 A;  2F5F A;  5HS9 A;  4RAY A;  3FMS A;  3GUD A;  1HQC A;  2GA1 A;  1YG2 A;  3P7N A;  3WTS C;  4A5N A;  1ZRE A;  2XAS A;  2EFN A;  4F7Z A;  1L3L A;  1LEB A;  3I4P A;  4LFU A;  2YPR A;  4JQF A;  2R7F A;  3E5Q A;  2VBW A;  4XBF A;  3ZMV A;  3RYP A;  3KP3 A;  3SQN A;  5D6F A;  2ELH A;  1R5H A;  2FF4 A;  3TOA A;  2JTV A;  3WTV C;  1KYZ A;  1SFE A;  4RAZ A;  5H6Q A;  4QLC U;  3I5U A;  4CDG A;  1F5T A;  1HBX G;  2ZNZ A;  1SD6 A;  3LA3 A;  3KEQ A;  4IRG A;  1K6O A;  4U7D A;  3RPQ A;  5JVT A;  1R1U A;  3JAM K;  1XCB A;  2Z99 A;  2O61 A;  3WU1 B;  2BE5 F;  1JE8 A;  5E8G A;  2PMH A;  4ENK A;  1BI2 A;  3GLX A;  1QPM A;  1SD5 A;  2D1V A;  4LD5 A;  2O8X A;  1J59 A;  2IPQ X;  2ZBK A;  1HKS A;  1H9G A;  3HSF A;  4XLP F;  3O3K A;  3BWG A;  3R0A A;  3TQN A;  5DCM B;  1MJ9 A;  4EJW A;  5K5R A;  4KYW A;  2EFP A;  5ILU A;  4RGX A;  1J2X A;  1K7A A;  1T38 A;  2O0Y A;  3WTY C;  4L9T A;  3K1N A;  5DD8 A;  2HTS A;  4G6D A;  4HF0 A;  2UZK A;  1LDD A;  4YG2 F;  2A6H F;  2K27 A;  4GGG A;  1WRJ A;  3DEU A;  2PFB A;  5TRD A;  3CO7 C;  1FWZ A;  3F8B A;  1YLF A;  3WU0 A;  1FNN A;  1UCR A;  1S7A A;  2H6C A;  3ZMS A;  1S29 A;  4CZZ A;  3F8C A;  1KU3 A;  4IRI A;  4HQE A;  3TOB A;  5HS7 A;  4YFK F;  3GYH X;  1FSE A;  2HYG D;  2DU9 A;  1TW3 A;  3EUH A;  1T2K A;  1TQI A;  5L3D A;  3QPT A;  4G6Q A;  1Z91 A;  4HX4 A;  2Y0M A;  3U9G A;  2FA5 A;  3HYI A;  3BJO A;  1P4W A;  2L3D A;  4UVA A;  3T8T A;  3GWZ A;  2EJR A;  3F8N A;  4WF2 A;  3GX4 X;  4EVI A;  1FP2 A;  2NYX A;  2P5L C;  2HYF A;  2YSR A;  2F5E A;  2O03 A;  4YFX F;  2FRH A;  2CO5 A;  4BQA A;  4RGS A;  2M1B A;  1IRF A;  1GXQ A;  3K0L A;  1CF7 A;  3RKW A;  2VC0 A;  2HGC A;  3CUQ A;  4A12 A;  3KP6 A;  2Q0O A;  4ASN A;  1Z6R A;  2IW5 A;  1BJA A;  2M8E A;  4P9F A;  2RV8 A;  5DCM A;  4PGG A;  2CGP A;  3MCZ A;  1IW7 F;  3QP6 A;  4AVP A;  1RNL A;  3DPT A;  4XLN F;  4S04 A;  3E6D A;  1KA8 A;  5BQT A;  3CLO A;  3I54 A;  2WTE A;  3ECO A;  3J81 Z;  5EEG A;  1YW8 A;  2C6Y A;  2H94 A;  2CSO A;  1OYW A;  1KGS A;  5CVV A;  2QVO A;  1ZGJ A;  1ZAO A;  4XRF A;  3HSR A;  5LHH A;  4EJT A;  1T0F A;  1ZRC A;  1SMY F;  4UV8 A;  4HX8 A;  2W85 A;  2ADU A;  1ZAR A;  4A0Y A;  3QOP A;  1KU7 A;  4LLN A;  2JPB A;  4KUM A;  4A6D A;  3I58 A;  2QWW A;  3E5U A;  2IVM A;  4FHT A;  4BYY A;  4HF1 A;  3DKW A;  2P6S A;  1ODD A;  1IRG A;  1DDN A;  2ISZ A;  3HIF A;  1YO5 C;  2Z5U A;  3ZN1 A;  3N4M A;  2FMY A;  3ERE D;  1FSH A;  2RC4 A;  1FBQ A;  3WTX C;  3V4G A;  2OQG A;  1IAW A;  5FLX K;  4NQW A;  1STZ A;  5FB2 A;  2YX7 A;  5ICG A;  5HS8 A;  1QO0 D;  2K4B A;  2XRN A;  5D4R A;  4YII A;  1J9I A;  1LEA A;  1HW1 A;  3BJ6 A;  4B09 A;  3FM3 A;  4KN4 X;  1TTY A;  4HA8 A;  1I6X A;  2GXG A;  5HLG A;  2EFW A;  3VB2 A;  1D8K A;  1FYL A;  1QZY A;  1R1V A;  3RTR A;  1U5T A;  2VT2 A;  2M30 A;  2JT1 A;  1SAX A;  3FX3 A;  4BXU A;  4RB3 C;  4KT5 C;  1EH8 A;  1B6A A;  4I01 A;  2HQR A;  1TQP A;  3PQK A;  3REO A;  5L3F A;  4WWC A;  3KP4 A;  5LGT A;  3FM5 A;  2XIG A;  6PAX A;  2STT A;  5A2Q K;  2P6T A;  3R6S A;  3ML6 A;  3DQV C;  5HOO A;  3DV8 A;  4RS8 A;  2JRT A;  1XSV A;  3GFM A;  2PJP A;  4EGY A;  2MLG A;  4I02 A;  1ZG1 A;  2BV6 A;  5FD5 A;  1R36 A;  3ABU A;  1E17 A;  2DO7 A;  2OD5 A;  4OMZ A;  5CYV A;  5FD6 A;  2FXA A;  3C3W A;  4CYD A;  3IRR A;  4LB5 A;  1IXC A;  1E2X A;  3K69 A;  3M1E A;  4BH9 A;  3N97 A;  3DF8 A;  3HRM A;  4EMS A;  2NRA C;  5DDG A;  2DTR A;  3QP5 A;  2BEO A;  2JPC A;  2ZNY A;  2XAQ A;  4P9U A;  5FO5 A;  4KIF A;  4U0V A;  4XSX F;  5ILV A;  4OMY A;  4LG0 A;  5K1Y A;  2K02 A;  4M9S A;  2QM3 A;  4P96 A;  2GAU A;  3HHH A;  3VFZ A;  2W25 A;  4IJA A;  3RDI A;  1KYW A;  5AIQ A;  4P55 A;  4PZJ A;  2RQP A;  3P9I A;  1ONV A;  5E20 A;  3KZY A;  2PQ8 A;  1XDS A;  3F23 A;  5L3C A;  3T0Y A;  4OIO F;  1W7P A;  2L4M A;  3CUQ C;  1G3W A;  1R00 A;  1LJ9 A;  3V8J A;  1Z1D A;  2E1N A;  3H92 A;  1OYY A;  1XCV A;  3Q9S A;  3I59 B;  4ESB A;  1TNS A;  1PP7 U;  4EQQ A;  5DUK A;  2M45 A;  4ZYE A;  1I27 A;  1ZG3 A;  1YS7 A;  4NHJ A;  5JHU A;  4KMU X;  2FSW A;  1P4X A;  2Y75 A;  3KE2 A;  4BHB A;  1DPU A;  3KP7 A;  2HTJ A;  2MLK A;  2FQ3 A;  1OR7 A;  1FPQ A;  1IN8 A;  2EFQ A;  3D0S A;  2XV4 S;  1XSX A;  1H0M A;  2EK5 A;  2QBY B;  3G3Z A;  1WWX A;  4HX7 A;  3L00 A;  4MHG A;  3QU3 A;  1FX7 A;  5BPI A;  4BAY A;  3KCC A;  4ON0 A;  1DP7 P;  1R22 A;  2D45 A;  3MEX A;  2IRF G;  3LST A;  1EH6 A;  2FOK A;  2M5W A;  1KQ8 A;  2OAZ A;  1U6G A;  3GFJ A;  2D2W A;  1BN5 A;  5ED4 A;  1HW5 A;  4YIF A;  1BIB A;  2QBY A;  1I1G A;  3RYR A;  2DAO A;  2ISY A;  5D5V B;  3EDP A;  2VN2 A;  1XN7 A;  2RN7 A;  1K78 B;  5HLI A;  2A68 F;  1BC8 C;  3PFI A;  2BBY A;  3K1M A;  4HLX A;  2KIU A;  4A0Z A;  3B02 A;  3LAJ A;  3MAJ A;  4HQM A;  2DK8 A;  3GEZ A;  4HYE A;  4OIP F;  4A6E A;  1P2F A;  4MQV A;  2D1H A;  4ZZD A;  4LLL A;  4HLY A;  2GIV A;  2HOE A;  1U78 A;  3ISP A;  4M9X A;  4G7Z F;  3ZMU A;  2DBB A;  4KIC A;  5CVJ A;  2G7H A;  2STW A;  1G3Y A;  5ICE A;  1IXS B;  4ENM A;  3WG9 A;  1WKM A;  4I2O A;  2ZCW A;  1MD0 A;  2XKP A;  2L02 A;  4HAM A;  3F21 A;  2IA1 A;  1YS6 A;  4HDU A;  2NS0 A;  2RKH A;  1UB9 A;  2J5P A;  3QAH A;  2H09 A;  2K4J A;  4K2E A;  2CQK A;  4A0X A;  4B8X A;  1JHH A;  4MQ9 F;  4EJV A;  2F5C A;  3MQ0 A;  5FFZ A;  1IXR C;  3IKV A;  1ULY A;  3R60 A;  4EJU A;  4GYI A;  3ABT A;  1BI0 A;  1D8J A;  2KKO A;  1IZ1 A;  4EV0 A;  1XMA A;  1FP1 D;  1HKT A;  2V1U A;  3V7S A;  1ZH5 A;  3T1B A;  1ZRF A;  4L0Y B;  3E5X A;  3WGG A;  5D8K B;  2CW0 F;  2ESH A;  4AIH A;  4MTE A;  5CVU A;  2QYO A;  1R23 A;  2A07 F;  2LSO A;  2CYY A;  1R7J A;  1YW9 A;  4QWQ A;  1PDN C;  1FYK A;  4AD9 A;  2LF8 A;  4WXC A;  4U0Y A;  1ZLK A;  1XGS A;  1TLH B;  5LEK A;  2QZ8 A;  5D4S A;  1S3J A;  2TDX A;  4MEY F;  1SD4 A;  3IC7 A;  2DI3 A;  4WK8 F;  4P5O A;  2VON A;  1W5S A;  3ZP5 A;  4ZH4 F;  1T98 A;  5L3E A;  1XGM A;  3BY6 A;  1HSJ A;  1OYI A;  4E70 A;  3KLO A;  3RPU A;  2QUF A;  3G73 A;  4EGZ A;  2OQR A;  3M8F A;  5FFX A;  3I64 A;  2G7U A;  4U7B A;  1W4M A;  3FWE A;  3FMR A;  2B0L A;  5ERI A;  4OU0 A;  2DLL A;  1TNT A;  3U2R A;  2HKX A;  2KJC A;  3IRQ A;  3R0J A;  2F5D A;  2LF7 A;  2EA2 A;  4HDV A;  5CVI A;  3M9A A;  1SFX A;  3KP5 A;  1R1T A;  2Z3Y A;  2MH9 A;  1NHA A;  2XAF A;  1P4A A;  1GXP A;  1MKM A;  2VOP A;  2YX4 A;  2GWR A;  4EJO A;  5AIP A;  5J6X A;  2RVC A;  1ZRD A;  4XSZ F;  4KDP A;  2CFX A;  3J7A O;  2LDU A;  3J81 K;  3ZMT A;  2RNJ A;  4RGU A;  2IT0 A;  1GVJ A;  2BGC A;  4AIK A;  3VEP A;  2XGX A;  5E1Z B;  5BS6 A;  4I7H A;  2Y48 A;  4L0Z B;  4ZYG A;  5IT3 A;  2VOO A;  4L18 B;  1G6N A;  2GQQ A;  3L2C A;  2MA3 A;  1U3E M;  3F72 A;  2IA0 A;  4R1H A;  3RKX A;  5ICF A;  2VBX A;  2DFI A;  4CIC A;  2W84 A;  2HZT A;  1T39 A;  1WSU A;  1HST A;  2WV0 A;  2DK5 A;  1V3F A;  5JR3 A;  1UFM A;  4PDK A;  2FEZ A;  1QGP A;  4LLG F;  3E97 A;  4UNO A;  3WGH A;  2HR3 A;  3DP7 A;  4HV5 A;  1MJA A;  2AXL A;  4AIJ A;  3E6M A;  3RKY A;  3I59 A;  4O5V A;  3Q5F A;  4R79 A;  4M72 A;  2A61 A;  1FYM A;  2ZJ2 A;  3BRO A;  2Q2E A;  1T6S A;  2UXN A;  2PBI A;  4KMF A;  3CO6 C;  4UV9 A;  3WGI A;  3O6B B;  2RGV A;  4KNY A;  4LJZ F;  2XAJ A;  5CJ9 A;  3WTU C;  3GZ6 A;  4A5M A;  4LK1 F;  1P92 A;  1BIA A;  3J80 Z;  1SFU A;  1J5Y A;  3L7W A;  4WX9 A;  1YFH A;  1CGP A;  2KIF A;  4M71 A;  1U2W A;  5ILS A;  2A69 F;  2PEX A;  3LQR A;  4FT8 A;  3TGN A;  3H3U A;  3WTT C;  1KU2 A;  2KJB A;  1Z7U A;  3HHG A;  3R4K A;  2JZY A;  5D5X B;  3D5L A;  1TBX A;  4KA4 A;  1ZG5 A;  2ZKZ A;  1U8R A;  4Q48 A;  1AOY A;  1BI1 A;  4IPA A;  1X3U A;  4R8H A;  5F64 A;  3Q9V A;  3NRV A;  5H6R A;  4G7H F;  1CF7 B;  4GCV A;  5CVR A;  3V8L A;  3S2W A;  4HZF A;  3BDD A;  4RGR A;  3JSP A;  5E1W A;  2GXB A;  3U1D A;  1YW7 A;  1FOK A;  4FX0 A;  2IA2 A;  2NAZ A;  4I0B A;  3ROU A;  1YIO A;  3AAF A;  4M6X A;  5DYM A;  5E17 F;  3ECH A;  2OZU A;  3DXJ F;  3P9K A;  5LGN A;  2OA4 A;  4ESJ A;  3GF2 A;  5TJJ A;  2AS5 F;  1J7K A;  5DD4 A;  4HOB A;  3FXR A;  3W6J B;  4N9H A;  2EB7 A;  1VTN C;  3GZ5 A;  5BMZ A;  3V7C A;  5LHI A;  2COM A;  2FBI A;  3VOE A;  1KU9 A;  1LQ1 A;  2P8T A;  2A3S A;  1RUN A;  1G3T A;  1S6L A;  4KIB A;  3FMQ A;  5HDG A;  4LGW A;  4G7O F;  3F8M A;  1P6R A;  2J5O A;  3RI4 A;  3KFW X;  1W7P D;  4H0E A;  3BP8 A;  2ACJ A;  3GFL A;  1I1S A;  5E18 F;  1H9T A;  5LBQ A;  4HV6 A;  3FF5 A;  1QBJ A;  3CJN A;  2K86 A;  5H20 A;  2VT3 A;  4PGH A;  2OBP A;  2P5V A;  3HOT A;  5LRS A;  2HS5 A;  3HOS A;  3E6B A;  3FXQ A;  1D5V A;  1FBU A;  1R58 A;  4Y17 A;  3OOP A;  1UST A;  4RB1 A;  4GXO A;  1XGN A;  2HEO A;  3GO5 A;  1LVA A;  5LLQ A;  4LB6 B;  4TV7 A;  4OIN F;  4L5J A;  1MDM A;  4KFC A;  3TO6 A;  3GFI A;  1Z05 A;  3PQJ A;  3QRF F;  3ZQ7 A;  1J0R A;  4JBA A;  3ZMZ A;  4WCG A;  5F1R A;  5DCF A;  4GO1 A;  2LNB A;  3C18 A;  2VBY A;  1U5T C;  1YTY A;  1XMK A;  2VE9 A;  3KZZ A;  2KRF A;  3MZH A;  3P9C A;  5LHG A;  2Z9O A;  2GA2 A;  1FC3 A;  5ICC A;  4OIR F;  3SFZ A;  1JGS A;  4M9Z A;  2XKO A;  5E1X A;  2VC1 A;  4MNU A;  3HRU A;  4BHP A;  4HW0 A;  4CXF A;  2EFO A;  1ON1 A;  1B9N A;  1TQM A;  4L9V A;  3ULQ B;  3I53 A;  4LMY A;  2A5Y B;  1I5Z A;  4N9I A;  2L4A A;  2V1D A;  3E3V A;  1FT9 A;  3EYY A;  4IF4 A;  3WE2 A;  2UXX A;  4OIQ F;  4IHS A;  1F1Z A;  2DQL A;  1PP8 F;  5HDK A;  1REP C;  1FBS A;  3BPX A;  2HWV A;  2P5K A;  1BBY A;  4I0A A;  1R5G A;  2ZFW A;  3SZP A;  5HDN A;  4Q5S F;  1F4K A;  4PCQ A;  5A2Q Z;  5J8F A;  2XUB A;  2L01 A;  3FZV A;  3MWM A;  2V9V A;  2K7L A;  1O3Q A;  4ESF A;  3GXO A;  1XB4 A;  3IHU A;  2FNP A;  1O57 A;  1HW2 A;  1Z9C A;  2W57 A;  1O3S A;  4O6J A;  3VOD A;  4UVB A;  4YFN F;  1PUE E;  1MZB A;  1D3Y A;  5DEQ A;  1ZYR F;  1W5T A;  4M74 A;  4IHT A;  4MTD A;  2ETH A;  2DT5 A;  3BJA A;  2FML A;  4OOI A;  3IWZ A;  2VOD A;  1LDJ A;  3HTS B;  5JFR A;  4IVN A;  4KIG A;  2VBZ A;  2QQ9 A;  4D0P A;  4JK1 X;  1L0O C;  3JTG A;  1B59 A;  4M6Y A;  3LFK A;  1GHC A;  4U0W A;  4ENN A;  1G3S A;  3WE3 A;  4LG0 B;  1S8N A;  3SXY A;  1UHM A;  1AWC A;  3LAP A;  3V8K A;  3HUG A;  4ETS A;  1QQI A;  4Z2Y A;  4EM0 B;  3ZMD A;  2LKP A;  4NB5 A;  1JXS A;  5JI6 A;  3LWF A;  3MFK A;  1KQ0 A;  4MGR A;  1LNW A;  4IRH A;  4WXD A;  2FBK A;  1TW2 A;  3BOQ A;  5AON A;  1HXD A;  3RIR A;  3MZY A;  4AWX B;  2OZ6 A;  4CHU A;  2PN6 A;  3RJP A;  5EEH A;  1A04 A;  5K5Q A;  2QEN A;  4N0B A;  2EWN A;  1EH7 A;  2KIM A;  1ZHF A;  4UHT A;  3C7J A;  4EM1 A;  2E7W A;  2RDP A;  2F2E A;  3TO9 A;  3ZN0 A;  3WTW C;  4MEX F;  3FXU A;  3F6V A;  3JW4 A;  2ZME B;  4CGZ A;  1Q1H A;  2V6C A;  1FY7 A;  3O2P E;  3F8F A;  1QNT A;  2ZME A;  1XDU A;  2MH2 A;  4FX4 A;  2CWE A;  3R61 A;  2G9W A;  3TDU C;  2R3S A;  5HVQ C;  2Q8K A;  2FBH A;  2HFH A;  1O7F A;  3EET A;  5DV5 A;  5LEJ A;  2W24 A;  5IT9 Z;  4M73 A;  2NNY A;  3TKY A;  2P7C B;  3ELK A;  2O6G E;  4IXA A;  3K9T A;  3CTA A;  1K78 A;  3LA7 A;  4WXH A;  5L3B A;  4GYG A;  1ZN2 A;  2P4W A;  1K79 A;  1F9N A;  4Y13 A;  2DPU A;  1XD7 A;  2OU2 A;  3OV8 A;  1MJB A;  5KVR A;  5CLS A;  3HRS A;  2FNA A;  4BNC A;  1W7P B;  2YR2 A;  2GZW A;  1HKQ A;  3KP2 A;  2FU4 A;  2A6E F;  3SZT A;  5FLX Z;  5D6E A;  3QU6 A;  5FGM A;  2WWY A;  2HKO A;  4I98 B;  3DPL C;  1J75 A;  3F3X A;  4UVC A;  4ZYD A;  1O3R A;  2JSC A;  2XRO A;  3HSE A;  2V1X A;  2VE8 A;  1MDM B;  1LDK B; 
#chains in the Genus database with same CATH topology
 4L9J A;  2QQB A;  2E71 A;  2X0L A;  3NEU A;  3L09 A;  4XIC A;  1IN7 A;  1YQA A;  2MBF A;  4O3M A;  1LB2 A;  4ZYH A;  4S05 A;  5KK1 A;  1MND A;  1B9M A;  3IH4 A;  2ZO4 A;  1ZGA A;  1NG6 A;  5M5Y J;  3GVA A;  1TWC J;  5GTI C;  1OMI A;  4E7K A;  2HU9 A;  1RR8 C;  2LD5 A;  2HQN A;  4HBL A;  1IF1 A;  3FXJ A;  3HXL A;  3NWT A;  3QPH A;  2R7D A;  3GTL J;  5LGU A;  4UXN A;  1FJL A;  1ZTR A;  1U8B A;  2CG4 A;  4E7H A;  4XMY A;  3T8R A;  4IHX A;  3LQQ A;  3W6V A;  5D8L B;  1USS A;  3K1P A;  2K9S A;  1T33 A;  2EV0 A;  1E0E A;  4BHC A;  4NBQ A;  4C2U A;  5E3O A;  3DTK A;  4DNC A;  1RZ4 A;  3S17 J;  3RPU D;  4A3J J;  3CCL I;  4Y15 A;  2EA4 A;  2PMU A;  2ESN A;  4FCY A;  4KN7 X;  4DQ2 A;  4G94 A;  2E34 A;  1BI3 A;  2DYR H;  2XHK A;  3KEO A;  1Z0X A;  5FKO A;  2H6B A;  2VXZ A;  2X4H A;  4RB0 A;  1B1B A;  2MC3 A;  1WJA A;  2X48 A;  3DWL E;  3AL0 B;  3CDL A;  1ZLJ A;  1ON2 A;  1Z6T A;  3K4C A;  2VQL A;  1RI7 A;  3NQO A;  4HNV A;  1B4A A;  3IKT A;  2VJI A;  4ZZL A;  2TRT A;  3QOE A;  1BC7 C;  5BOX A;  3AFH A;  3HPH A;  1VQN I;  1R49 A;  1JT0 A;  5B3S H;  3GW2 A;  3EPZ A;  1MBJ A;  3IWF A;  3RSN A;  4X0G A;  9ANT A;  3ASN H;  3I0T A;  3CDH A;  3DBL B;  4RAF A;  3L9F A;  2LBF B;  4XKB A;  4A3E J;  1IN5 A;  5LRR A;  4YIR X;  3EQL F;  3BG9 A;  4XLF A;  3LSG A;  2L0K A;  4RM2 A;  5IT9 K;  3VYS B;  2PG4 A;  3COA C;  4L9N A;  3M7G A;  3BZC A;  3MKW B;  3HTU A;  1WI9 A;  3AG4 H;  3CUO A;  3JSO A;  3A0H C;  5E8I A;  4Y3O A;  1D1B A;  4Q47 A;  1U0J A;  2BYV E;  5F0F A;  3TO7 A;  4PK4 A;  3DBR B;  4ZTJ A;  3ZOB A;  2HXO A;  2FQ4 A;  1WGX A;  1WJE A;  1WI3 A;  4AUX A;  3HRT A;  4XRS G;  4BEH B;  1RUO A;  2EV6 A;  1BM9 A;  3F22 A;  2E1C A;  4C3J J;  4CO8 A;  3G1L A;  2K3F A;  1OCR H;  3M8E A;  5DUI A;  5J1Y A;  3G4S I;  2R7S A;  4XQF A;  3VYR B;  3WOD F;  1DUX C;  5HLH A;  2CUF A;  2F4M B;  3CP2 A;  4II2 A;  1C0W A;  3EYI A;  3BZ6 A;  2IP2 A;  4HF2 A;  4BBR J;  5D5U B;  2HYJ A;  1MGT A;  3PNV A;  2XVC A;  5D5W B;  3KET A;  4XN3 A;  4EM2 A;  2EV5 A;  4G8X A;  1XGO A;  2XAH A;  5J8C A;  1JHF A;  2DPD A;  5E3L A;  5F27 A;  3B73 A;  2JVG A;  1EV7 A;  1D0Z A;  3S14 J;  3CUQ B;  3H3Z A;  3V7R A;  1S7O A;  1SD7 A;  1PUF B;  2LYC A;  5EG0 A;  3J80 K;  2PI0 A;  3K2Z A;  5L3G A;  1Y0U A;  3WHB A;  1P9Q C;  5K5O A;  3Q0W A;  4IHW A;  1HC8 A;  5IYB J;  1QZZ A;  3F6O A;  3L2V A;  4DIQ A;  3OYM A;  4XL9 A;  4B47 A;  2R5Y B;  2WC2 A;  5F6F A;  2IJL A;  1LE8 B;  1YYV A;  2PMZ A;  3BPV A;  3OYI A;  3WTZ A;  3CMY A;  3ZPL A;  2V79 A;  2X51 A;  2CQN A;  1TWH J;  3BCA A;  4XN0 A;  2QLZ A;  2E7X A;  1V4R A;  2KQR A;  2LBF A;  3E6C C;  1PYV A;  3JAM Z;  2VQG A;  3T5X A;  1UHW A;  1O3T A;  5KHD A;  2L9R A;  2CS3 A;  3K70 C;  2Y9Z A;  1BOA A;  2L54 A;  2RQQ A;  1FLI A;  1KQ9 A;  3UNG C;  1TWG J;  3IL2 A;  2HDC A;  2CQ7 A;  1LPQ A;  5B1B H;  5BPD A;  3KYD B;  4ANJ A;  2MD5 A;  3J7Z I;  3KLN A;  4XRM A;  2Z33 A;  2YU3 A;  2CMP A;  2VJJ A;  4LK0 F;  2BY1 A;  3FHZ A;  4EAT A;  2M87 A;  3GBG A;  2UWM A;  3ZXS A;  2VL8 A;  3K4K A;  3L2W A;  5J4V A;  2DW4 A;  5C4J J;  1LKX A;  1RIO H;  2F5V A;  2DQR A;  4A2U A;  1I3Q J;  3ABM H;  4CH7 A;  3UKG A;  1YRN A;  2QGU A;  1IN4 A;  1QHH D;  5BNG A;  5JVG F;  3IUO A;  2FE3 A;  5CQE A;  1VQO I;  2XAG A;  3I71 A;  3W6K B;  4E7J A;  3JTH A;  3FXO A;  2O3F A;  4D1Q A;  4UUV A;  4U88 A;  1IN6 A;  2KZG A;  2P7V B;  2PLY A;  1IUY A;  1U5T B;  1DPR A;  2CW7 A;  4Q4Z F;  1OPC A;  1G4D A;  1T8I A;  2NNN A;  4ENJ A;  2DT6 A;  3NAR A;  3HG9 A;  1RC9 A;  1EA3 A;  3OOU A;  1FZP B;  3SHF A;  1A35 A;  2ZJQ F;  4L5I A;  4QTR A;  1XSD A;  2VQH A;  3OYK A;  1WQ2 A;  1LVK A;  3IAM 2;  1PJR A;  2EH3 A;  2H27 A;  1OKR A;  1O7L A;  5IYC J;  2IGO A;  2ZXJ A;  2QQA A;  2K85 A;  3C1D A;  2ZJP F;  1JUS A;  2DA3 A;  3FXL A;  4HST A;  5CKT A;  3S8P A;  1SMT A;  3BZK A;  4J01 A;  4G9Y A;  5C44 J;  1SVM A;  3E0J B;  3LSI A;  4I09 A;  4XLA A;  4RB2 C;  3TDZ C;  2DMP A;  3DFG A;  2OTL I;  3LA2 A;  2F5F A;  5HS9 A;  1QVT A;  4BQN A;  2N8G A;  4F52 A;  3DLL F;  4RAY A;  3FMS A;  3GUD A;  1HCR A;  1HQC A;  4BY7 J;  3DU5 A;  2GA1 A;  1YG2 A;  5IP7 J;  3BR3 A;  4BJ5 C;  1K61 A;  3P7N A;  3JR9 A;  3WTS C;  4A5N A;  1ZRE A;  2XAS A;  4XLH A;  2EFN A;  1YIT I;  1ETW A;  4F7Z A;  1L3L A;  2F4O B;  2L7Z A;  1LEB A;  2EZL A;  4Z6Y A;  3I4P A;  3OYF A;  4HEA 2;  4LFU A;  4NQW B;  1I6H J;  1QHG A;  2YPR A;  1JJ6 C;  2VPR A;  4JQF A;  4X6A J;  3RQI A;  2R7F A;  2BY0 A;  3E5Q A;  2VBW A;  3PSI A;  4XBF A;  2ZXI A;  3ZMV A;  5HNF A;  3RYP A;  3OS1 A;  3A03 A;  3KP3 A;  2AXT C;  3HGY A;  3SQN A;  4UUS A;  5D6F A;  2ELH A;  3MKY B;  1R5H A;  2FF4 A;  3TOA A;  3FK7 A;  2JTV A;  3WTV C;  1KYZ A;  1SFE A;  2BVM A;  4RAZ A;  3HZJ A;  2L9N A;  5H6Q A;  4QLC U;  1R9T J;  1HDP A;  3I5U A;  4CDG A;  1F5T A;  1HBX G;  1ZKG A;  2OTJ I;  2ZNZ A;  1HOM A;  1GV5 A;  3K10 A;  1SD6 A;  3LA3 A;  1OCP A;  3KEQ A;  5FKK A;  2LTP A;  5F0H A;  4IRG A;  2ZB9 A;  1K6O A;  2VAS A;  3FKJ A;  3ERM A;  3RPQ A;  5B5E C;  4U7D A;  2R7T A;  1VQ4 I;  3TMO A;  5JVT A;  1JKP C;  1R1U A;  3BG6 A;  2V9P A;  3LOC A;  3RCO A;  3JAM K;  3JRI A;  4A3L J;  1XCB A;  2Z99 A;  2CRG A;  2O61 A;  3WU1 B;  2FX0 A;  3A4C A;  4FIS A;  2R7Q A;  2BE5 F;  1JE8 A;  1VQ9 I;  4CCO A;  3B6C A;  5E8G A;  3S1R J;  2PMH A;  2QCO A;  4ENK A;  2QF7 A;  1BI2 A;  3GLX A;  1K4T A;  1QPM A;  1SD5 A;  2D1V A;  1ZGW A;  2X6X A;  4LD5 A;  2XPW A;  2O8X A;  2Q2E B;  3OL3 A;  4V2G A;  1J59 A;  1ZQ3 P;  2IPQ X;  2ZBK A;  1HKS A;  4BXF A;  2IS6 A;  1H9G A;  3HSF A;  3CP8 A;  2CFO A;  3O3K A;  3BWG A;  4ZJZ A;  4XLP F;  2DMN A;  3R0A A;  4PSW A;  1Z3X A;  2HDW A;  3TQN A;  5DCM B;  1MJ9 A;  2BOL A;  2LC2 A;  4PJM A;  5EGO B;  1I50 J;  2FOW A;  2R5Y A;  4EJW A;  5HOD A;  5K5R A;  4RBO A;  5TGT A;  4KYW A;  3CC7 I;  2EFP A;  5ILU A;  5LD2 C;  1YJ9 I;  4RGX A;  1J2X A;  1K7A A;  1T38 A;  1VQ5 I;  3BTJ A;  2F4I A;  2O0Y A;  3WTY C;  2HOS A;  1XC5 A;  4L9T A;  3K1N A;  1X2M A;  2V9K A;  5DD8 A;  4AYB N;  2HTS A;  4G6D A;  4HF0 A;  2UZK A;  1LDD A;  2RNG A;  4II3 A;  2K3P A;  4BQO A;  4C3H J;  2HOA A;  1JJ8 C;  1O4X A;  2GXA A;  5DM6 F;  4YG2 F;  2A6H F;  2K27 A;  3HOY J;  1HF0 A;  4GGG A;  1WRJ A;  3DEU A;  2PFB A;  5TRD A;  3CO7 C;  3W2A A;  1FWZ A;  1VI0 A;  3F8B A;  1QPI A;  1W36 C;  3WG7 H;  1X1D A;  1YLF A;  3WU0 A;  1FNN A;  3CJT B;  3DKX A;  3HDD A;  1UCR A;  1S7A A;  2H6C A;  2FJ1 A;  3ZMS A;  4BGD A;  1TT0 A;  1WHU A;  1S29 A;  2DTZ A;  4CZZ A;  3F8C A;  1KU3 A;  2R93 J;  4IRI A;  5EJC A;  4BL0 B;  4HQE A;  1H8A C;  3TOB A;  1YOV B;  2Y30 A;  3S1M J;  2Y0S A;  2A05 A;  3DLA A;  5HS7 A;  4YFK F;  3GYH X;  1FSE A;  2HYG D;  2DU9 A;  1TW3 A;  3QOD A;  2MD0 A;  4FE7 A;  3RZO J;  1ACI A;  3BTC A;  3OYL A;  3EUH A;  5DS9 A;  3ZQL A;  2O8K A;  1T2K A;  1TQI A;  3G1O A;  5L3D A;  1X19 A;  5HLT A;  2QKL B;  3QPT A;  3PUB A;  5GP9 A;  4G6Q A;  3IV5 A;  1Z91 A;  4HX4 A;  2NOJ B;  2Y0M A;  3CMM A;  3U9G A;  1IC8 A;  3VWB A;  2FA5 A;  3BQZ A;  3PFY A;  3SEZ A;  4IOA F;  1YJN I;  4BEH A;  1W0T A;  4Y7N J;  3HYI A;  3BJO A;  1P4W A;  2L3D A;  4UVA A;  3T8T A;  3GWZ A;  3OYH A;  1K4S A;  4I6Z A;  2EJR A;  5M3F J;  3F8N A;  1X1C A;  4WF2 A;  3GX4 X;  4A3I J;  1TWF J;  1GUU A;  4EVI A;  1FP2 A;  2NYX A;  2P5L C;  2HYF A;  2YSR A;  5TIS C;  2WB1 N;  3DBH B;  1N75 A;  2F5E A;  4DYC A;  2O03 A;  3ZRG A;  3I56 I;  3HOX J;  4YFX F;  2DJI A;  1IGN A;  2FRH A;  2E2H J;  2CO5 A;  4BQA A;  4RGS A;  2M1B A;  3OR1 C;  1UHS A;  2VJ5 A;  1IRF A;  1GXQ A;  3K0L A;  1CF7 A;  4IQ4 A;  3CD6 I;  2IAI A;  2JA8 J;  3H36 A;  3RKW A;  4B3X A;  4CCK A;  2VC0 A;  5JLW A;  2HGC A;  1T08 B;  1TP4 A;  2HXI A;  3CUQ A;  3QPL A;  4EEF G;  1FOW A;  3LSP A;  4A12 A;  1W5C C;  3KP6 A;  2Q0O A;  1RET A;  4ASN A;  1Z6R A;  2IW5 A;  1BJA A;  2M8E A;  4P9F A;  2IGM A;  3BG3 A;  3GCM A;  4PUS A;  3GTM J;  2RV8 A;  5DCM A;  2JMW A;  2BVL A;  1S9H A;  4PGG A;  4B4C A;  3HL2 A;  2CGP A;  3MCZ A;  1IW7 F;  2KIS A;  3QP6 A;  4P1W A;  4BE1 A;  1VZ0 A;  4AVP A;  1RNL A;  4CYC B;  3DPT A;  4XLN F;  4S04 A;  3E6D A;  4A3M J;  1OCC H;  3HOZ J;  1KA8 A;  2XSD C;  5BQT A;  2Y31 A;  2WY7 Q;  3CLO A;  4A3C J;  2NOG A;  3I54 A;  4D5C A;  2WTE A;  1T56 A;  4CSW A;  3ECO A;  3H35 A;  3J81 Z;  5EEG A;  1YW8 A;  2C6Y A;  2H94 A;  2CSO A;  1W0U A;  1OYW A;  4XLE A;  1KGS A;  4IOC F;  1I39 A;  5CVV A;  2QVO A;  1ZGJ A;  1ZAO A;  3NAU A;  4XRF A;  5GTH C;  3DEE A;  3A1Y A;  2JUC A;  3HSR A;  4JX5 A;  5LHH A;  5GPA A;  4EJT A;  1T0F A;  1ZRC A;  2Y2Z A;  1T0F C;  1SMY F;  4UV8 A;  4HX8 A;  4Y52 J;  1V5F A;  3PIP F;  2W85 A;  2ADU A;  4OAY A;  1ZAR A;  4A0Y A;  3QOP A;  1KU7 A;  4LLN A;  2JPB A;  4KUM A;  4A6D A;  3A01 B;  3I58 A;  2QWW A;  2MGQ A;  3E5U A;  5LFA A;  1A31 A;  2IVM A;  2OC6 A;  4FHT A;  4BYY A;  1ORK A;  4HF1 A;  2ELJ A;  3DKW A;  2LY9 A;  1V55 H;  2EIJ H;  3U21 A;  3H9Q A;  4B43 A;  2P6S A;  4XOT A;  1ODD A;  2B7E A;  1IRG A;  1RKT A;  1DDN A;  3OIO A;  2ISZ A;  1BR4 A;  2R5Z A;  4QPO A;  3K4J A;  3HIF A;  2R7W A;  1YO5 C;  2Z5U A;  3ZN1 A;  1R5I D;  5IYD J;  3N4M A;  3AG3 H;  2FMY A;  4ZC3 A;  3CQZ J;  3ERE D;  1FSH A;  2RC4 A;  1FBQ A;  3ZQQ A;  3WTX C;  3V4G A;  2OQG A;  1X1B A;  1IAW A;  1YE9 A;  4ZDP A;  4KIT B;  5FLX K;  4NQW A;  1STZ A;  2L2O A;  5FB2 A;  2YX7 A;  4M3E A;  5ICG A;  5HS8 A;  1IV8 A;  1QO0 D;  2H1L A;  2K4B A;  2XRN A;  4YII A;  5D4R A;  1J9I A;  1LEA A;  1HW1 A;  1MBH A;  3FK6 A;  4F55 A;  3BJ6 A;  5KCM A;  4B09 A;  1YRN B;  3FM3 A;  5FLM J;  4KN4 X;  1TTY A;  4LIU A;  3EUH C;  4HA8 A;  1I6X A;  1A6I A;  2GXG A;  5HLG A;  2EFW A;  4XRS A;  1SFK A;  3TW7 A;  3VB2 A;  1D8K A;  1FYL A;  3NWS A;  3FBN B;  2TCT A;  2DMQ A;  1QZY A;  1R1V A;  3RTR A;  4NC7 A;  1U5T A;  5IP6 A;  1QZE A;  2NS7 A;  2VT2 A;  2M30 A;  1UAA A;  4DYR A;  2RAE A;  2VXD A;  3H0D A;  3DU6 A;  2JT1 A;  4A69 C;  3PNY A;  3Q0V A;  2GOX B;  2JQ7 A;  2DA7 A;  3TL4 X;  3UR3 C;  3SFI A;  1SAX A;  4IHV A;  3FX3 A;  1DGW Y;  3QPS A;  4BQQ A;  2LY2 A;  2W1O A;  4BXU A;  1OQY A;  1ZEL A;  4RB3 C;  3G1M A;  1U9N A;  2QA4 I;  2V1N A;  4KT5 C;  1EH8 A;  1B6A A;  3SDG A;  1UEL B;  4E4H A;  4Y33 A;  4XM3 A;  3RKQ A;  4J00 A;  4I01 A;  2HQR A;  2LR8 A;  4PJJ A;  1IV6 A;  3WU2 C;  1TQP A;  3PQK A;  3REO A;  2JA7 J;  3BR5 A;  5L3F A;  4WWC A;  3KP4 A;  1N77 A;  5LGT A;  3FM5 A;  2XIG A;  6PAX A;  3D5S C;  2CV2 A;  3SEQ A;  2STT A;  5A2Q K;  2P6T A;  3R6S A;  1E3H A;  3ML6 A;  1IUF A;  3DQV C;  5HOO A;  3DV8 A;  4IEJ A;  2Z2S B;  4LIV A;  4RS8 A;  2JRT A;  3C2H A;  1BR2 A;  1K83 J;  1XSV A;  2VJ4 A;  3GFM A;  2PJP A;  4EGY A;  2MLG A;  4I02 A;  1ZG1 A;  2R7X A;  2BV6 A;  5FD5 A;  1R36 A;  3ABU A;  3H9G A;  3J7A Y;  1E17 A;  2DO7 A;  2ELK A;  1D0X A;  2OD5 A;  4OMZ A;  5CYV A;  2FXA A;  3HBL A;  5FD6 A;  3OYE A;  1JTX A;  2Y0S N;  3C3W A;  5DTD A;  4CYD A;  3IRR A;  2XF6 A;  4LB5 A;  1IXC A;  3H3V K;  1E2X A;  2Y69 H;  3K69 A;  4PFP A;  2ICW G;  3M1E A;  3PO3 J;  5IPA A;  4BH9 A;  4HNU A;  4JX6 A;  3QYE A;  4HPQ A;  3DF8 A;  3N97 A;  3HRM A;  2DA5 A;  4EMS A;  4KT6 A;  1Y8Q B;  2NRA C;  5DDG A;  3IH3 A;  1JKR C;  2DTR A;  2CQQ A;  3QP5 A;  1OIS A;  3C2B A;  3Q3S A;  1JT6 A;  2BEO A;  2VUM J;  2JPC A;  2ZNY A;  2XAQ A;  1Z67 A;  4XKC A;  3JRG A;  1BW6 A;  2E35 A;  4P9U A;  1G8X A;  1UZC A;  5FO5 A;  3BR0 A;  3HB9 A;  2HZD A;  4KIF A;  4U0V A;  4S0H B;  3J7Y J;  4CUG A;  2X6W A;  3MN2 A;  4XSX F;  4D9J A;  5ILV A;  1WJD A;  4OMY A;  4NNJ A;  4LG0 A;  1ZK8 A;  3SDB A;  2F6C A;  2VQC A;  2K02 A;  5K1Y A;  4M9S A;  2JJ7 A;  2MSY A;  2EIL H;  2QM3 A;  4P96 A;  4BY1 J;  1OCT C;  3MZ8 A;  4LOC A;  3ZQH A;  2GAU A;  3HHH A;  3HM5 A;  2WA0 A;  3VFZ A;  2W25 A;  4IJA A;  3RDI A;  1KYW A;  5F1J A;  2HDD A;  1RKW A;  1K6Y A;  2X6Y A;  1JKQ C;  5AIQ A;  3I9V 2;  4P55 A;  4BAC A;  4PZJ A;  2RQP A;  3P9I A;  1ONV A;  2HVQ A;  5E20 A;  3KZY A;  2DT7 B;  5FKM A;  2PQ8 A;  5J1R A;  1XDS A;  4E7L A;  3BTL A;  3F23 A;  4BKX A;  5JLX A;  5L3C A;  3T0Y A;  3D5R C;  4OIO F;  1W7P A;  2L4M A;  3CUQ C;  1F43 A;  1G3W A;  2QQ8 A;  1R00 A;  1E3P A;  1LJ9 A;  3V8J A;  1WPK A;  4IZZ A;  4B48 A;  1Y1W J;  1Z1D A;  1IG7 A;  2E1N A;  3H92 A;  1OYY A;  1XCV A;  3H1C A;  2LMD A;  3Q9S A;  1APL C;  3I59 B;  4ESB A;  1TNS A;  1GDT A;  1PP7 U;  2KRC A;  3CMA I;  4IHY A;  1Z21 A;  4EQQ A;  5DUK A;  3CCJ I;  2NS8 A;  5FKN A;  2M45 A;  3OWT A;  4ZYE A;  1I27 A;  1ZG3 A;  2F48 A;  1YS7 A;  4C2M J;  1Y39 A;  1ERD A;  4NHJ A;  1YHQ I;  1MBK A;  3S1N J;  5JHU A;  2M3A A;  2VPL A;  2GOM A;  2R7U A;  2VKV A;  4KMU X;  2FSW A;  3M3Y J;  3OY9 A;  2ZXH A;  1WH5 A;  1DGR M;  1P4X A;  2Y75 A;  3KE2 A;  4BHB A;  1DPU A;  3K4N A;  3KP7 A;  2HTJ A;  3PNT A;  4CCL A;  1Z3Y A;  2MLK A;  1OJL A;  2FQ3 A;  4HG2 A;  1JGG A;  1OR7 A;  1FPQ A;  2VB6 A;  1IN8 A;  3V42 A;  5EF6 A;  5M5W J;  2EFQ A;  4L5E A;  3OR2 C;  3K4B A;  3D0S A;  3HJE A;  1N78 A;  2H8W A;  3G71 I;  2MW8 A;  2XV4 S;  4PJL A;  3OSF A;  2IS4 A;  1GV2 A;  3W3C A;  2ECC A;  1XSX A;  3O8H A;  4DGW B;  2K9L A;  1H0M A;  3E1S A;  2EK5 A;  5DM7 F;  2QBY B;  3G3Z A;  1WWX A;  4HX7 A;  4F3Q A;  2OF7 A;  2DOF A;  3L00 A;  4MHG A;  3HEF A;  3BR1 A;  5GAE J;  2XPV A;  5F0C A;  1CQT A;  3P5J A;  3EUK L;  3QU3 A;  1FX7 A;  2KLO A;  2W48 A;  3A0B C;  3JCU C;  5KAF C;  5BPI A;  4BAY A;  2K9Q A;  3KCC A;  3O8G A;  1GT0 C;  3LSH A;  4ON0 A;  2I8D A;  1DP7 P;  1R22 A;  4NUB A;  1OLT A;  2D45 A;  5HNH A;  3MEX A;  1S5L C;  2IRF G;  5B66 C;  3CCQ I;  3LST A;  2ZXW H;  2Z16 A;  1EH6 A;  2FOK A;  2M5W A;  3VSK A;  1KQ8 A;  2OAZ A;  1U6G A;  3TP0 A;  4QIW N;  3GFJ A;  2D2W A;  4V19 K;  1BN5 A;  5H2F C;  2VI6 A;  5ED4 A;  2HNH A;  3FIW A;  1HW5 A;  3OIQ A;  1B8I A;  2R7V A;  4YIF A;  1BIB A;  1MBG A;  1I1G A;  2QBY A;  3RYR A;  2DAO A;  4C2T A;  2IGN A;  2X6O A;  2NVT J;  2ISY A;  5D5V B;  3S3N A;  3EDP A;  2VN2 A;  1XN7 A;  1BL0 A;  2RN7 A;  3DTE A;  5HLI A;  2A68 F;  2BY2 A;  4OWR B;  1K78 B;  5K7Z A;  1KZH A;  1BC8 C;  3CCY A;  2BXZ A;  3PFI A;  2BBY A;  3K1M A;  5IP9 J;  2A6T A;  3KZI C;  2Z1D A;  2HPM A;  5E3M A;  2KIU A;  4HLX A;  4A0Z A;  3HGG A;  4XKV A;  1AKH A;  3B02 A;  3LAJ A;  1ETO A;  2XRL A;  3MAJ A;  2CJJ A;  4HQM A;  2DK8 A;  2ZSI B;  2DDA A;  2I5U A;  3LNQ A;  3GEZ A;  4HYE A;  1MSE C;  4OIP F;  3ZQG A;  4A6E A;  1Y8R B;  3FHN A;  1P2F A;  4MQV A;  2D1H A;  4ZZD A;  5J47 A;  3JRF A;  3OIP A;  1VQK I;  4LLL A;  4HLY A;  3IP4 B;  2ID6 A;  4NC6 A;  2P0W A;  2GIV A;  1NK3 P;  2HOE A;  2WAQ N;  4MFD A;  1U78 A;  2CU7 A;  2BXY A;  3ISP A;  3LL7 A;  4M9X A;  1TL8 A;  2QSG X;  1XG1 A;  4G7Z F;  2NVU B;  3ZMU A;  2H1K A;  2DBB A;  1OCO H;  2O5R A;  3M8J A;  2VKH A;  1OR7 C;  4KIC A;  5CVJ A;  1QRY A;  3VSL A;  2L9V A;  2G7H A;  1IJW C;  5K7H A;  2STW A;  1G3Y A;  5ICE A;  1IXS B;  4ENM A;  3WG9 A;  1WKM A;  2DOA A;  2R0Q C;  5FJ8 J;  5CQG A;  4RMN A;  2W7N A;  4I2O A;  2ZCW A;  1MD0 A;  2XKP A;  2L02 A;  4HAM A;  3F21 A;  4DZP A;  2IA1 A;  1YS6 A;  4HDU A;  5M5X J;  2NS0 A;  2RKH A;  1UB9 A;  2J5P A;  3QAH A;  4BUP A;  2H09 A;  5E79 C;  5KAI C;  2K4J A;  3RQ4 A;  4K2E A;  2DOE A;  2E5N A;  1DU0 A;  3BG5 A;  3TP3 A;  4E7Z A;  3CCR I;  4GRI A;  2CQK A;  4A0X A;  4B8X A;  2GM4 A;  2LK2 A;  2IS2 A;  1JHH A;  4MQ9 F;  2LVS A;  4N4O B;  4EJV A;  3GME A;  3FXM A;  2F5C A;  2LLK A;  3HOW J;  3BR6 A;  4YEJ A;  3U1K A;  3MQ0 A;  2LKX A;  2ME0 A;  5FFZ A;  3GTQ J;  1X3W B;  1IXR C;  4YRV A;  4BXX J;  3IKV A;  1IO2 A;  1ULY A;  1R4M B;  3MMY B;  3R60 A;  4EJU A;  2E1O A;  4LIT A;  5F08 A;  4GYI A;  2DMT A;  1OFC X;  3ABT A;  3JRD A;  1ETY A;  2KFD A;  1BI0 A;  2E60 A;  1D8J A;  3PO2 J;  3BTI A;  2KKO A;  4UY8 I;  2NVX J;  4HSR A;  1IZ1 A;  4EV0 A;  1XMA A;  1FP1 D;  5IOY A;  4RDU A;  1HKT A;  2V1U A;  3V7S A;  3OS0 A;  1ZH5 A;  3Q0U A;  3T1B A;  1ZRF A;  4IX7 A;  1VQ8 I;  4L0Y B;  1SAU A;  3E5X A;  3WGG A;  5D8K B;  1S7E A;  1XMX A;  4ZDO A;  2CW0 F;  2ESH A;  2MC4 A;  4X1E A;  3I4M J;  3QYF A;  4AIH A;  3G6E I;  2HI3 A;  1T95 A;  1FMW A;  4MTE A;  3K7A J;  2X85 A;  5CVU A;  1EF4 A;  1FOY A;  2QYO A;  4G6T B;  1R23 A;  1JTY A;  2XGE A;  2A07 F;  2LSO A;  1AA7 A;  2CYY A;  1R7J A;  1YW9 A;  3CLQ A;  4QWQ A;  1AHD P;  1PDN C;  4M3D A;  1E3O C;  3JRH A;  2E1M B;  4CA0 A;  4BDZ A;  1FYK A;  1YX5 A;  1W36 D;  2QKM B;  2KZV A;  4AD9 A;  2LF8 A;  2A5W A;  3HC7 A;  2KT0 A;  4WXC A;  4U0Y A;  1ZLK A;  1XGS A;  3L1P A;  2O9L A;  1TLH B;  4BE2 A;  2M7A A;  5LEK A;  2QZ8 A;  5D4S A;  1S3J A;  2TDX A;  4AU7 A;  2XC7 A;  1YJW I;  5FRN A;  4MEY F;  2BY3 A;  1D5Y A;  4FQG A;  2JA6 J;  1SD4 A;  1VQL I;  2JK3 A;  3IC7 A;  2DI3 A;  4WK8 F;  4BS9 A;  4P5O A;  5C4X J;  2VON A;  1W5S A;  3ZP5 A;  4RM3 A;  4ZH4 F;  1T98 A;  3PUF A;  5L3E A;  2KL4 A;  1G2H A;  1XGM A;  3BY6 A;  3S1Q J;  1HSJ A;  1OYI A;  4UUS B;  2GIZ A;  4E70 A;  1W1W E;  3OMY A;  1R6R A;  3KLO A;  3RPU A;  1GLN A;  2M4G A;  3ZQF A;  4AM3 A;  1NG7 A;  2Q1Z B;  4AID A;  2QUF A;  2ECB A;  1V5E A;  3N05 A;  3G73 A;  4EGZ A;  2OQR A;  1SVO A;  3M8F A;  2FD5 A;  3D1N I;  5FFX A;  3I64 A;  4AYB A;  2G7U A;  4U7B A;  2DYS H;  1W4M A;  2ZC2 A;  3FWE A;  3FMR A;  3LFU A;  3PIO F;  4A93 J;  3S3M A;  2B0L A;  3JRE A;  5ERI A;  1HA8 A;  1DP3 A;  4OU0 A;  1POG A;  2DLL A;  1TNT A;  1FMV A;  2XGD A;  4YEL A;  1VFC A;  3OYJ A;  1S72 I;  3U2R A;  1RRJ A;  2HKX A;  2KJC A;  3IRQ A;  3R0J A;  2F5D A;  2LF7 A;  1JI8 A;  2EA2 A;  4HDV A;  3PJR A;  3MVP A;  3I4N J;  5CVI A;  1Y6I A;  2RRE A;  3M9A A;  1SFX A;  4FAS D;  3DKY A;  1BW5 A;  4V2F A;  3KP5 A;  4JOM A;  1R1T A;  1YX3 A;  2Z3Y A;  2MH9 A;  1NHA A;  2AQE A;  2JN6 A;  2XAF A;  1IRX A;  1P4A A;  1GXP A;  1MKM A;  2VOP A;  2V7F A;  4D5F A;  2G0E A;  2E36 A;  2GWR A;  2YX4 A;  4EJO A;  5AIP A;  5J6X A;  2RVC A;  2EIN H;  1ZRD A;  2X1C A;  4XSZ F;  4KDP A;  2H8R A;  1QA6 A;  2LKS A;  2CFX A;  3K6G A;  2LDU A;  3J7A O;  3J81 K;  3ZMT A;  2K9M A;  2RNJ A;  3RZD J;  4RGU A;  2IT0 A;  3H5N A;  1NK2 P;  1GVJ A;  1WCM J;  2BGC A;  3QWL A;  4AIK A;  3VEP A;  2DFF A;  3X2Q H;  2XGX A;  3CCU I;  5E1Z B;  5BS6 A;  1Z77 A;  4I7H A;  2LOO A;  2Y48 A;  4C30 A;  4D7M A;  4ZYG A;  5IT3 A;  4L0Z B;  2VOO A;  4L18 B;  4NC8 A;  2JVH A;  4B1R A;  1G6N A;  1Q1V A;  3WHC A;  2GQQ A;  3S32 A;  1IDZ A;  3L2C A;  2MA3 A;  1Z7L A;  1U3E M;  3F72 A;  2KMU A;  3CC4 I;  2IA0 A;  4R1H A;  3RKX A;  5ICF A;  2VBX A;  2DFI A;  2VKE A;  4CIC A;  4BBS J;  4BJ6 C;  2DXI A;  2W84 A;  2XPU A;  2XGC A;  1B72 A;  2XSJ C;  3IH2 A;  2HZT A;  1TWA J;  1T39 A;  1WSU A;  1HST A;  1WJC A;  2WV0 A;  2DK5 A;  3GTG J;  1MBE A;  5FLV A;  4MIM A;  4BU2 A;  1UG0 A;  1V3F A;  5J1U A;  5JR3 A;  2LG4 A;  2JRM A;  1UFM A;  3FBI B;  4PDK A;  2EQR A;  2FEZ A;  1QGP A;  3I3L A;  4LLG F;  1NTC A;  3BT9 A;  3A01 A;  2X1D A;  1VND A;  3E97 A;  4UNO A;  1FTT A;  3WGH A;  1YI2 I;  2HR3 A;  3DP7 A;  4XOR A;  2DA6 A;  3VPR A;  3A2K A;  2MAB A;  4HV5 A;  1MJA A;  2AXL A;  4AIJ A;  1XS9 A;  3E6M A;  3RKY A;  3I59 A;  1P7J A;  2CUE A;  4O5V A;  4QSH A;  3Q5F A;  4R79 A;  2EBI A;  2MG4 A;  1IDY A;  4M72 A;  2W4S A;  2A61 A;  1MNE A;  1FYM A;  2ZJ2 A;  3BRO A;  2Q2E A;  2UV1 A;  1T6S A;  3KEY A;  4IL6 C;  1QU3 A;  2UXN A;  2PBI A;  3OYG A;  1V5G A;  1BJZ A;  4KMF A;  1MW7 A;  3ZGK A;  1U9O A;  3MD2 A;  3CO6 C;  4UV9 A;  3WGI A;  3O6B B;  2RGV A;  4KNY A;  2WAD A;  1I3A A;  4LJZ F;  4BE0 A;  4PJN A;  2DCE A;  3ABK H;  3QQA A;  2V26 A;  2XAJ A;  5CJ9 A;  4HNT A;  3WTU C;  3GZ6 A;  4A5M A;  4LK1 F;  1P92 A;  1KON A;  1BIA A;  2MYS A;  3J80 Z;  2E2I J;  1SFU A;  1J5Y A;  3L7W A;  3K4L A;  4WX9 A;  1YFH A;  1CGP A;  1UG2 A;  2KIF A;  2NVY J;  4M71 A;  4E6K G;  2L7M P;  1U2W A;  5ILS A;  4XR6 A;  2EIK H;  2M8G X;  4XKW A;  3LMM A;  3SYT A;  4ZYA A;  2A69 F;  2O7O A;  2PEX A;  3LQR A;  4FT8 A;  3TGN A;  3H3U A;  3WTT C;  1MMG A;  4ITV A;  2IXS A;  1KU2 A;  2LFB A;  1X1P A;  2KJB A;  3AKZ A;  1X1A A;  1PVE A;  1Z7U A;  3HHG A;  5J4Y A;  3OYC A;  3S3O A;  3R4K A;  2JZY A;  1V54 H;  5D5X B;  3OYN A;  3BCB A;  2EPF A;  1TBX A;  3D5L A;  2JUG A;  3CZ6 A;  4KA4 A;  1ZG5 A;  2CH0 A;  2ZKZ A;  1U8R A;  1VQ7 I;  4B44 A;  4Q48 A;  1MIJ A;  1AOY A;  1BI1 A;  3GTP J;  4IPA A;  1X3U A;  4DOZ A;  4R8H A;  1DQU A;  1BA5 A;  5F64 A;  4A3B J;  3Q9V A;  3NRV A;  5H6R A;  1ITY A;  4G7H F;  1CF7 B;  3F9K A;  4Y4R A;  2DA1 A;  2ID3 A;  4C3I J;  1B72 B;  4GCV A;  1FOX A;  4DJA A;  5CVR A;  3V8L A;  4CCM A;  2E2J J;  2LRD A;  3S2W A;  4HZF A;  3VYT B;  2ZFU A;  3BDD A;  4RGR A;  3JSP A;  4NDL A;  5E1W A;  2GXB A;  5E3N A;  3U1D A;  1YW7 A;  1FOK A;  4FX0 A;  3CJR B;  4MFE A;  3JRA A;  2CUZ A;  2R7Z J;  3K2A A;  1N25 A;  2IA2 A;  3KPH A;  1A5J A;  2NAZ A;  4I0B A;  3ROU A;  1YIO A;  3AAF A;  2K9N A;  2WAF A;  1VQP I;  1H88 C;  2CV1 A;  4M6X A;  5DYM A;  5E17 F;  3ECH A;  2BHY A;  2OZU A;  3DXJ F;  3P9K A;  2HQA A;  5LGN A;  3M4O J;  2EIM H;  2WY8 Q;  5F04 A;  2OA4 A;  4I76 A;  4ESJ A;  4XLC A;  3GF2 A;  2XF5 A;  1AKH B;  5TJJ A;  4RA2 A;  2AS5 F;  2XF7 A;  2ZJR F;  1J7K A;  5DD4 A;  4A3G J;  1SAN A;  1X4P A;  3DEW A;  1MMS A;  3L2U A;  4IO9 F;  1IRZ A;  4HOB A;  1X2N A;  3FXR A;  3W6J B;  4XOP A;  3BR2 A;  4N9H A;  2EB7 A;  1VTN C;  3GZ5 A;  2CQX A;  5BMZ A;  3V7C A;  3CDI A;  5FKL A;  2WBM A;  5LHI A;  2COM A;  2FBI A;  2HVS A;  5EG0 B;  1ENH A;  2VKD A;  1YIJ I;  3VYU B;  2WV1 A;  4GDF A;  1WFX A;  3VOE A;  1KU9 A;  1LQ1 A;  2P8T A;  3AG1 H;  2A3S A;  2OUM A;  3JRC A;  3GTK J;  1RUN A;  1G3T A;  5C3E J;  2KDZ A;  5B1A H;  1S6L A;  2X9D A;  4KIB A;  3FMQ A;  5K7F A;  4C9Y A;  2P81 A;  5HDG A;  4LGW A;  4G7O F;  5FRM A;  3F8M A;  3M1C A;  1P6R A;  2J5O A;  3RI4 A;  2I10 A;  3KFW X;  5GAD J;  1W7P D;  1XPX A;  4M3F A;  4H0E A;  3BP8 A;  2ACJ A;  3GFL A;  1VQM I;  3LSJ A;  1I1S A;  5E18 F;  1H9T A;  4DBQ A;  2R7O A;  2CW8 A;  1B8I B;  4M6V A;  3CCV I;  4E7S A;  5LBQ A;  2GBY A;  5KNL A;  1FEX A;  1PUF A;  4G12 A;  4HV6 A;  3CCS I;  3FF5 A;  4DZJ A;  5EGO A;  3CES A;  5JHF A;  1QBJ A;  3CJN A;  2K86 A;  3TED A;  5H20 A;  2VT3 A;  5EYR A;  3K70 D;  4PGH A;  2OBP A;  2P5V A;  3HOT A;  2XB5 A;  1OCZ H;  5LRS A;  2HS5 A;  3HOS A;  3LSK A;  5EDN A;  1R71 A;  3E6B A;  2LH9 A;  3FXQ A;  3K4M A;  1D5V A;  1ZR4 A;  1FBU A;  4XON A;  1R58 A;  4Y17 A;  3OOP A;  1UST A;  3ASO H;  4RB1 A;  4GXO A;  1XGN A;  2NVQ J;  2HEO A;  5IOZ A;  1ZR2 A;  1WJ5 A;  3GO5 A;  4F93 B;  3OSG A;  1EKE A;  1LVA A;  5LLQ A;  2YU9 J;  4LB6 B;  2L7F P;  2ZME C;  4TV7 A;  2PX9 A;  2M0C A;  4OIN F;  1EJ9 A;  2JA5 J;  4L5J A;  1MDM A;  1SVL A;  3A02 A;  2M9H A;  2B9S A;  3FDY A;  3BQY A;  2QSF X;  1BR1 A;  3BC8 A;  4KFC A;  3TO6 A;  1HLV A;  3GFI A;  3B6A A;  5EZH A;  4XID A;  4AVZ A;  1Z05 A;  3PQJ A;  3QRF F;  2D5V A;  3ZQ7 A;  1J0R A;  3LSM A;  1FIP A;  4JBA A;  4RLQ A;  3ZMZ A;  4WCG A;  5F1R A;  3MKZ A;  5DCF A;  5J40 A;  4GO1 A;  4ZTF A;  2LNB A;  3AG2 H;  4F92 B;  1X3Z B;  2KDO A;  3C18 A;  2VBY A;  1U5T C;  4MO7 A;  1YTY A;  3S15 J;  2HVR A;  3E7L A;  4HRI A;  2IBD A;  1M1E B;  1XMK A;  2LP0 A;  2UUZ A;  2VE9 A;  3KZZ A;  2OV7 A;  2OJE D;  2KRF A;  3CF2 A;  4U87 A;  3MZH A;  2QSH X;  1Y1V J;  1MBF A;  3GLL A;  3P9C A;  4N4N B;  2BW3 B;  5LHG A;  4M3G A;  2Z9O A;  1FTZ A;  2GA2 A;  3VDX A;  1FC3 A;  1SC7 A;  5GAH J;  1TZL A;  5ICC A;  4OIR F;  3SFZ A;  1JGS A;  4M9Z A;  4J19 A;  3W2V A;  2XKO A;  5E1X A;  3IAS 2;  2V6E A;  2VC1 A;  4MNU A;  3HRU A;  4BHP A;  4HW0 A;  4CXF A;  3H5A A;  2EFO A;  1D1C A;  1ON1 A;  1B9N A;  1D1A A;  4KJZ A;  1TQM A;  4L9V A;  1JKO C;  4PFO A;  3I53 A;  3ULQ B;  1SFO J;  4LMY A;  1A36 A;  2L7K A;  2A5Y B;  1MMN A;  1I5Z A;  4N9I A;  4RLF A;  1ETV A;  3FKI J;  2R92 J;  1ETQ A;  2L4A A;  2V1D A;  3E3V A;  1FT9 A;  3EYY A;  4IF4 A;  3WE2 A;  1MH4 A;  3BLY A;  4CCJ A;  2UXX A;  1RR7 A;  1X58 A;  4OIQ F;  3HPG A;  3ZCO A;  1GVD A;  4IHS A;  2IS1 A;  1F1Z A;  1VQ6 I;  4DW6 A;  3FIS A;  3CJQ B;  2PMZ N;  1QVU A;  2BW3 A;  2LRE A;  2DQL A;  1PP8 F;  4JYK A;  5HDK A;  2DA4 A;  2VIX A;  1REP C;  1FBS A;  3BPX A;  2ZSH B;  2HWV A;  4GFB A;  1HDD C;  2AHQ A;  2Y9Y A;  2LY1 A;  2P5K A;  1BBY A;  2ME6 A;  4I0A A;  1R5G A;  2ZFW A;  3SZP A;  3ZR8 X;  5HDN A;  4A3D J;  3AL0 C;  4Q5S F;  3CCM I;  1F4K A;  4PCQ A;  4JX4 A;  2GLO A;  5A2Q Z;  2QEX I;  2XDV A;  3HKZ N;  5J8F A;  1X4O A;  2EZK A;  2YS9 A;  2OPT A;  3GTO J;  4PSX A;  2XUB A;  3G2B A;  2PJR B;  2L01 A;  3FZV A;  3MWM A;  2V9V A;  2K7L A;  4FE4 A;  1O3Q A;  2L5Q A;  4ESF A;  3GXO A;  3DCF A;  3H0G J;  1LFP A;  1XB4 A;  3IHU A;  2FNP A;  2B63 J;  1O57 A;  1HW2 A;  1Z9C A;  2W57 A;  1MMD A;  1O3S A;  4O6J A;  3SZG A;  3QYB A;  3VOD A;  4A3K J;  4UVB A;  4YFN F;  1PUE E;  3DPU A;  1MZB A;  1XX5 A;  1D3Y A;  5DEQ A;  3S16 J;  1ZYR F;  1JUP A;  1W5T A;  4M74 A;  1NH3 A;  4IHT A;  4MTD A;  2ETH A;  2DT5 A;  3BJA A;  1ETX A;  2FML A;  2IGK A;  4OOI A;  3IWZ A;  2VOD A;  1LDJ A;  2M34 A;  4UB8 C;  4W1U A;  2DFH A;  3LSR A;  2JSP A;  1LE8 A;  3HTS B;  4CCN A;  4CZC A;  3KIO A;  2WB1 A;  3FXK A;  5JFR A;  4IVN A;  4KIG A;  3OL4 A;  2AQF A;  4I99 C;  3S2D J;  2VBZ A;  2QQ9 A;  2W00 A;  4D0P A;  4JK1 X;  1L0O C;  3JTG A;  2MFZ A;  2R4G A;  1DU6 A;  1B59 A;  4M6Y A;  3S2H J;  3LFK A;  4LG3 A;  1GHC A;  4M3B A;  4U0W A;  4ENN A;  1G3S A;  3ABL H;  3WE3 A;  1R4N B;  4LG0 B;  1S8N A;  3KX2 A;  1UHM A;  3SXY A;  1AWC A;  3LAP A;  3C2G A;  3V8K A;  3BG7 A;  4PJ0 C;  2DMU A;  3HUG A;  4FET A;  1WJF A;  4ETS A;  2JWT A;  4QPQ A;  1QQI A;  4Z2Y A;  2M0M A;  3ZMD A;  2LKP A;  4EM0 B;  4NB5 A;  2V4J C;  1UJ8 A;  1JXS A;  5GAG J;  5JI6 A;  4OAZ A;  1WH7 A;  3LWF A;  2OCC H;  4H4K C;  3MFK A;  4B3A A;  2M7B A;  2E19 A;  2KHM A;  1XTA A;  3OYB A;  1KQ0 A;  4MGR A;  2KRH A;  4DYQ A;  1MH3 A;  1H89 C;  1LNW A;  4IRH A;  4WXD A;  3I55 I;  1D0Y A;  1WJB A;  2FBK A;  5GPC A;  3SJM A;  1TC3 C;  2WAE A;  1FIA A;  1TW2 A;  3BOQ A;  2WAQ A;  1MSF C;  5AON A;  2KP6 A;  1HXD A;  4UUT A;  3RIR A;  3MZY A;  2DFE A;  2E5Z A;  4AWX B;  2E1M C;  2M4K A;  2OZ6 A;  4XK4 A;  2FUG 2;  4CHU A;  2PN6 A;  3RJP A;  5EEH A;  3ZQI A;  5IY5 H;  1UMQ A;  3EUA A;  1A04 A;  2HQ5 A;  2K5C A;  5K5Q A;  1JUM A;  2DOD A;  3HUG B;  2QEN A;  3JRB A;  4N0B A;  3KYC B;  3L2Q A;  4ZDL A;  3CF5 F;  2EWN A;  2K40 A;  1EH7 A;  2KIM A;  1ZHF A;  4KIS A;  2PJR A;  1A6Q A;  3CC2 I;  4UHT A;  5M3M J;  4D7N A;  5EZG A;  3C7J A;  3KYL A;  4EM1 A;  2JA2 A;  2E7W A;  2HOT A;  2RDP A;  2F2E A;  1VF9 A;  3TO9 A;  3ZN0 A;  2KIQ A;  3WTW C;  2DDB A;  2R5Z B;  4FTH A;  4MEX F;  3FXU A;  3F6V A;  3JW4 A;  2ZME B;  2X1E A;  4CGZ A;  3TBI A;  2IEK A;  4E7I A;  1Q1H A;  3M07 A;  2V6C A;  3PSF A;  3W2W A;  1FY7 A;  3O2P E;  3F8F A;  1QNT A;  2AO9 A;  2ZME A;  1SEU A;  2DA2 A;  1XDU A;  2NXN B;  2COB A;  4MLO A;  1G59 A;  1Y0N A;  2MH2 A;  4DBR A;  4FX4 A;  1F36 A;  3GTJ J;  2CWE A;  3R61 A;  3ESW B;  2G9W A;  2XB0 X;  3TDU C;  2DN0 A;  1MMA A;  2VLA A;  3PL8 A;  2EZI A;  2R3S A;  5HVQ C;  2M2E A;  3CCE I;  4IKF A;  5CPR B;  2Q8K A;  3H9J A;  1ETK A;  2XAU A;  3HOU J;  4BDY A;  2FBH A;  2R7R A;  2HFH A;  1LFU P;  1O7F A;  3EET A;  5DV5 A;  5LEJ A;  4JP0 A;  4UB6 C;  2W24 A;  5IT9 Z;  2DJN A;  2OCE A;  5J3L A;  3F0C A;  4M73 A;  2NNY A;  1MNM C;  3ONQ A;  3TKY A;  3H5R A;  1J09 A;  4IQJ A;  1WZ2 A;  1LUJ B;  2P7C B;  3ELK A;  1RES A;  3OS2 A;  1LFB A;  2O6G E;  4ABZ A;  4IXA A;  3K9T A;  1WVR A;  3HOV J;  3CTA A;  3HKZ A;  4F91 B;  4BJT A;  1K78 A;  2YUS A;  1TT5 B;  2CV0 A;  3LA7 A;  4WXH A;  3ZQC A;  5L3B A;  2HPI A;  4GYG A;  1ZN2 A;  2P4W A;  1K79 A;  1F9N A;  4RAG A;  2L9S A;  2BHZ A;  4W97 A;  4XNF A;  4Y13 A;  2DPU A;  1XD7 A;  3PM1 A;  3DTI A;  1RPW A;  2OU2 A;  3OV8 A;  1MJB A;  4AC0 A;  2KPM A;  5KVR A;  5CLS A;  3HRS A;  1P7I A;  2FNA A;  1AU7 A;  4BNC A;  2W82 A;  1Y56 A;  5EEA A;  1W7P B;  2YR2 A;  2GZW A;  1HKQ A;  3KP2 A;  3L2R A;  2FU4 A;  2A6E F;  3SZT A;  3OYA A;  3TW6 A;  5FLX Z;  5D6E A;  2CUJ A;  3QU6 A;  5FGM A;  2BZT A;  3MKL A;  4CYC A;  3OYD A;  3GZN B;  2WWY A;  3S93 A;  2HKO A;  4I98 B;  3DPL C;  3F3X A;  4UVC A;  4ZYD A;  2XRO A;  2JSC A;  2EZH A;  4A3F J;  1O3R A;  3HSE A;  1J75 A;  2V1X A;  2VE8 A;  1BOB A;  1MDM B;  5FRO A;  1LDK B;  3CME I; 
#chains in the Genus database with same CATH homology
 4L9J A;  2QQB A;  2X0L A;  3NEU A;  3L09 A;  1IN7 A;  1YQA A;  2MBF A;  4O3M A;  1LB2 A;  4ZYH A;  4S05 A;  5KK1 A;  1B9M A;  2ZO4 A;  1ZGA A;  3GVA A;  1OMI A;  2HQN A;  4HBL A;  1IF1 A;  3QPH A;  2R7D A;  5LGU A;  4UXN A;  2CG4 A;  3T8R A;  3LQQ A;  5D8L B;  1USS A;  3K1P A;  2EV0 A;  4BHC A;  4DNC A;  1RZ4 A;  4Y15 A;  2EA4 A;  2PMU A;  2ESN A;  4KN7 X;  4DQ2 A;  4G94 A;  1BI3 A;  2XHK A;  3KEO A;  2H6B A;  2VXZ A;  2X4H A;  4RB0 A;  1B1B A;  2MC3 A;  1ZLJ A;  1ON2 A;  1Z6T A;  1RI7 A;  3NQO A;  1B4A A;  3IKT A;  4ZZL A;  1BC7 C;  5BOX A;  3GW2 A;  3IWF A;  3I0T A;  3CDH A;  3L9F A;  1IN5 A;  5LRR A;  3EQL F;  5IT9 K;  2PG4 A;  3COA C;  4L9N A;  3M7G A;  3HTU A;  1WI9 A;  3CUO A;  3JSO A;  5E8I A;  4Q47 A;  2BYV E;  3TO7 A;  3HRT A;  1RUO A;  2EV6 A;  1BM9 A;  3F22 A;  2E1C A;  4CO8 A;  5DUI A;  3M8E A;  3WOD F;  1DUX C;  5HLH A;  1C0W A;  3EYI A;  3BZ6 A;  2IP2 A;  4HF2 A;  5D5U B;  1MGT A;  2XVC A;  5D5W B;  3KET A;  4EM2 A;  2EV5 A;  4G8X A;  1XGO A;  2XAH A;  5J8C A;  1JHF A;  2DPD A;  3B73 A;  1EV7 A;  3CUQ B;  3H3Z A;  3V7R A;  1S7O A;  1SD7 A;  3J80 K;  2PI0 A;  3K2Z A;  5L3G A;  1Y0U A;  5K5O A;  1QZZ A;  3F6O A;  2WC2 A;  5F6F A;  2IJL A;  1YYV A;  3BPV A;  3WTZ A;  3ZPL A;  2V79 A;  2QLZ A;  2E7X A;  1V4R A;  3E6C C;  3JAM Z;  3T5X A;  1UHW A;  1O3T A;  1BOA A;  2L54 A;  1FLI A;  1KQ9 A;  3IL2 A;  2HDC A;  5BPD A;  2MD5 A;  3KLN A;  2Z33 A;  2YU3 A;  4LK0 F;  3FHZ A;  2M87 A;  2UWM A;  2DW4 A;  1RIO H;  4A2U A;  2DQR A;  1IN4 A;  2FE3 A;  2XAG A;  3I71 A;  3W6K B;  3JTH A;  2O3F A;  4UUV A;  4U88 A;  1IN6 A;  2PLY A;  2P7V B;  1IUY A;  1U5T B;  1DPR A;  4Q4Z F;  1OPC A;  1G4D A;  2NNN A;  4ENJ A;  1FZP B;  3SHF A;  1XSD A;  4L5I A;  1WQ2 A;  2H27 A;  1OKR A;  1O7L A;  2ZXJ A;  2QQA A;  3C1D A;  1SMT A;  4G9Y A;  4I09 A;  4RB2 C;  3TDZ C;  3DFG A;  3LA2 A;  2F5F A;  5HS9 A;  4RAY A;  3FMS A;  3GUD A;  1HQC A;  2GA1 A;  1YG2 A;  3P7N A;  3WTS C;  4A5N A;  1ZRE A;  2XAS A;  2EFN A;  4F7Z A;  1L3L A;  1LEB A;  3I4P A;  4LFU A;  2YPR A;  4JQF A;  2R7F A;  3E5Q A;  2VBW A;  4XBF A;  3ZMV A;  3RYP A;  3KP3 A;  3SQN A;  5D6F A;  2ELH A;  1R5H A;  2FF4 A;  3TOA A;  2JTV A;  3WTV C;  1KYZ A;  1SFE A;  4RAZ A;  5H6Q A;  4QLC U;  3I5U A;  4CDG A;  1F5T A;  1HBX G;  2ZNZ A;  1SD6 A;  3LA3 A;  3KEQ A;  4IRG A;  1K6O A;  4U7D A;  3RPQ A;  5JVT A;  1R1U A;  3JAM K;  1XCB A;  2Z99 A;  2O61 A;  3WU1 B;  2BE5 F;  1JE8 A;  5E8G A;  2PMH A;  4ENK A;  1BI2 A;  3GLX A;  1QPM A;  1SD5 A;  2D1V A;  4LD5 A;  2O8X A;  1J59 A;  2IPQ X;  2ZBK A;  1HKS A;  1H9G A;  3HSF A;  4XLP F;  3O3K A;  3BWG A;  3R0A A;  3TQN A;  5DCM B;  1MJ9 A;  4EJW A;  5K5R A;  4KYW A;  2EFP A;  5ILU A;  4RGX A;  1J2X A;  1K7A A;  1T38 A;  2O0Y A;  3WTY C;  4L9T A;  3K1N A;  5DD8 A;  2HTS A;  4G6D A;  4HF0 A;  2UZK A;  1LDD A;  4YG2 F;  2A6H F;  2K27 A;  4GGG A;  1WRJ A;  3DEU A;  2PFB A;  5TRD A;  3CO7 C;  1FWZ A;  3F8B A;  1YLF A;  3WU0 A;  1FNN A;  1UCR A;  1S7A A;  2H6C A;  3ZMS A;  1S29 A;  4CZZ A;  3F8C A;  1KU3 A;  4IRI A;  4HQE A;  3TOB A;  5HS7 A;  4YFK F;  3GYH X;  1FSE A;  2HYG D;  2DU9 A;  1TW3 A;  3EUH A;  1T2K A;  1TQI A;  5L3D A;  3QPT A;  4G6Q A;  1Z91 A;  4HX4 A;  2Y0M A;  3U9G A;  2FA5 A;  3HYI A;  3BJO A;  1P4W A;  2L3D A;  4UVA A;  3T8T A;  3GWZ A;  2EJR A;  3F8N A;  4WF2 A;  3GX4 X;  4EVI A;  1FP2 A;  2NYX A;  2P5L C;  2HYF A;  2YSR A;  2F5E A;  2O03 A;  4YFX F;  2FRH A;  2CO5 A;  4BQA A;  4RGS A;  2M1B A;  1IRF A;  1GXQ A;  3K0L A;  1CF7 A;  3RKW A;  2VC0 A;  2HGC A;  3CUQ A;  4A12 A;  3KP6 A;  2Q0O A;  4ASN A;  1Z6R A;  2IW5 A;  1BJA A;  2M8E A;  4P9F A;  2RV8 A;  5DCM A;  4PGG A;  2CGP A;  3MCZ A;  1IW7 F;  3QP6 A;  4AVP A;  1RNL A;  3DPT A;  4XLN F;  4S04 A;  3E6D A;  1KA8 A;  5BQT A;  3CLO A;  3I54 A;  2WTE A;  3ECO A;  3J81 Z;  5EEG A;  1YW8 A;  2C6Y A;  2H94 A;  2CSO A;  1OYW A;  1KGS A;  5CVV A;  2QVO A;  1ZGJ A;  1ZAO A;  4XRF A;  3HSR A;  5LHH A;  4EJT A;  1T0F A;  1ZRC A;  1SMY F;  4UV8 A;  4HX8 A;  2W85 A;  2ADU A;  1ZAR A;  4A0Y A;  3QOP A;  1KU7 A;  4LLN A;  2JPB A;  4KUM A;  4A6D A;  3I58 A;  2QWW A;  3E5U A;  2IVM A;  4FHT A;  4BYY A;  4HF1 A;  3DKW A;  2P6S A;  1ODD A;  1IRG A;  1DDN A;  2ISZ A;  3HIF A;  1YO5 C;  2Z5U A;  3ZN1 A;  3N4M A;  2FMY A;  3ERE D;  1FSH A;  2RC4 A;  1FBQ A;  3WTX C;  3V4G A;  2OQG A;  1IAW A;  5FLX K;  4NQW A;  1STZ A;  5FB2 A;  2YX7 A;  5ICG A;  5HS8 A;  1QO0 D;  2K4B A;  2XRN A;  5D4R A;  4YII A;  1J9I A;  1LEA A;  1HW1 A;  3BJ6 A;  4B09 A;  3FM3 A;  4KN4 X;  1TTY A;  4HA8 A;  1I6X A;  2GXG A;  5HLG A;  2EFW A;  3VB2 A;  1D8K A;  1FYL A;  1QZY A;  1R1V A;  3RTR A;  1U5T A;  2VT2 A;  2M30 A;  2JT1 A;  1SAX A;  3FX3 A;  4BXU A;  4RB3 C;  4KT5 C;  1EH8 A;  1B6A A;  4I01 A;  2HQR A;  1TQP A;  3PQK A;  3REO A;  5L3F A;  4WWC A;  3KP4 A;  5LGT A;  3FM5 A;  2XIG A;  6PAX A;  2STT A;  5A2Q K;  2P6T A;  3R6S A;  3ML6 A;  3DQV C;  5HOO A;  3DV8 A;  4RS8 A;  2JRT A;  1XSV A;  3GFM A;  2PJP A;  4EGY A;  2MLG A;  4I02 A;  1ZG1 A;  2BV6 A;  5FD5 A;  1R36 A;  3ABU A;  1E17 A;  2DO7 A;  2OD5 A;  4OMZ A;  5CYV A;  5FD6 A;  2FXA A;  3C3W A;  4CYD A;  3IRR A;  4LB5 A;  1IXC A;  1E2X A;  3K69 A;  3M1E A;  4BH9 A;  3N97 A;  3DF8 A;  3HRM A;  4EMS A;  2NRA C;  5DDG A;  2DTR A;  3QP5 A;  2BEO A;  2JPC A;  2ZNY A;  2XAQ A;  4P9U A;  5FO5 A;  4KIF A;  4U0V A;  4XSX F;  5ILV A;  4OMY A;  4LG0 A;  5K1Y A;  2K02 A;  4M9S A;  2QM3 A;  4P96 A;  2GAU A;  3HHH A;  3VFZ A;  2W25 A;  4IJA A;  3RDI A;  1KYW A;  5AIQ A;  4P55 A;  4PZJ A;  2RQP A;  3P9I A;  1ONV A;  5E20 A;  3KZY A;  2PQ8 A;  1XDS A;  3F23 A;  5L3C A;  3T0Y A;  4OIO F;  1W7P A;  2L4M A;  3CUQ C;  1G3W A;  1R00 A;  1LJ9 A;  3V8J A;  1Z1D A;  2E1N A;  3H92 A;  1OYY A;  1XCV A;  3Q9S A;  3I59 B;  4ESB A;  1TNS A;  1PP7 U;  4EQQ A;  5DUK A;  2M45 A;  4ZYE A;  1I27 A;  1ZG3 A;  1YS7 A;  4NHJ A;  5JHU A;  4KMU X;  2FSW A;  1P4X A;  2Y75 A;  3KE2 A;  4BHB A;  1DPU A;  3KP7 A;  2HTJ A;  2MLK A;  2FQ3 A;  1OR7 A;  1FPQ A;  1IN8 A;  2EFQ A;  3D0S A;  2XV4 S;  1XSX A;  1H0M A;  2EK5 A;  2QBY B;  3G3Z A;  1WWX A;  4HX7 A;  3L00 A;  4MHG A;  3QU3 A;  1FX7 A;  5BPI A;  4BAY A;  3KCC A;  4ON0 A;  1DP7 P;  1R22 A;  2D45 A;  3MEX A;  2IRF G;  3LST A;  1EH6 A;  2FOK A;  2M5W A;  1KQ8 A;  2OAZ A;  1U6G A;  3GFJ A;  2D2W A;  1BN5 A;  5ED4 A;  1HW5 A;  4YIF A;  1BIB A;  2QBY A;  1I1G A;  3RYR A;  2DAO A;  2ISY A;  5D5V B;  3EDP A;  2VN2 A;  1XN7 A;  2RN7 A;  1K78 B;  5HLI A;  2A68 F;  1BC8 C;  3PFI A;  2BBY A;  3K1M A;  4HLX A;  2KIU A;  4A0Z A;  3B02 A;  3LAJ A;  3MAJ A;  4HQM A;  2DK8 A;  3GEZ A;  4HYE A;  4OIP F;  4A6E A;  1P2F A;  4MQV A;  2D1H A;  4ZZD A;  4LLL A;  4HLY A;  2GIV A;  2HOE A;  1U78 A;  3ISP A;  4M9X A;  4G7Z F;  3ZMU A;  2DBB A;  4KIC A;  5CVJ A;  2G7H A;  2STW A;  1G3Y A;  5ICE A;  1IXS B;  4ENM A;  3WG9 A;  1WKM A;  4I2O A;  2ZCW A;  1MD0 A;  2XKP A;  2L02 A;  4HAM A;  3F21 A;  2IA1 A;  1YS6 A;  4HDU A;  2NS0 A;  2RKH A;  1UB9 A;  2J5P A;  3QAH A;  2H09 A;  2K4J A;  4K2E A;  2CQK A;  4A0X A;  4B8X A;  1JHH A;  4MQ9 F;  4EJV A;  2F5C A;  3MQ0 A;  5FFZ A;  1IXR C;  3IKV A;  1ULY A;  3R60 A;  4EJU A;  4GYI A;  3ABT A;  1BI0 A;  1D8J A;  2KKO A;  1IZ1 A;  4EV0 A;  1XMA A;  1FP1 D;  1HKT A;  2V1U A;  3V7S A;  1ZH5 A;  3T1B A;  1ZRF A;  4L0Y B;  3E5X A;  3WGG A;  5D8K B;  2CW0 F;  2ESH A;  4AIH A;  4MTE A;  5CVU A;  2QYO A;  1R23 A;  2A07 F;  2LSO A;  2CYY A;  1R7J A;  1YW9 A;  4QWQ A;  1PDN C;  1FYK A;  4AD9 A;  2LF8 A;  4WXC A;  4U0Y A;  1ZLK A;  1XGS A;  1TLH B;  5LEK A;  2QZ8 A;  5D4S A;  1S3J A;  2TDX A;  4MEY F;  1SD4 A;  3IC7 A;  2DI3 A;  4WK8 F;  4P5O A;  2VON A;  1W5S A;  3ZP5 A;  4ZH4 F;  1T98 A;  5L3E A;  1XGM A;  3BY6 A;  1HSJ A;  1OYI A;  4E70 A;  3KLO A;  3RPU A;  2QUF A;  3G73 A;  4EGZ A;  2OQR A;  3M8F A;  5FFX A;  3I64 A;  2G7U A;  4U7B A;  1W4M A;  3FWE A;  3FMR A;  2B0L A;  5ERI A;  4OU0 A;  2DLL A;  1TNT A;  3U2R A;  2HKX A;  2KJC A;  3IRQ A;  3R0J A;  2F5D A;  2LF7 A;  2EA2 A;  4HDV A;  5CVI A;  3M9A A;  1SFX A;  3KP5 A;  1R1T A;  2Z3Y A;  2MH9 A;  1NHA A;  2XAF A;  1P4A A;  1GXP A;  1MKM A;  2VOP A;  2YX4 A;  2GWR A;  4EJO A;  5AIP A;  5J6X A;  2RVC A;  1ZRD A;  4XSZ F;  4KDP A;  2CFX A;  3J7A O;  2LDU A;  3J81 K;  3ZMT A;  2RNJ A;  4RGU A;  2IT0 A;  1GVJ A;  2BGC A;  4AIK A;  3VEP A;  2XGX A;  5E1Z B;  5BS6 A;  4I7H A;  2Y48 A;  4L0Z B;  4ZYG A;  5IT3 A;  2VOO A;  4L18 B;  1G6N A;  2GQQ A;  3L2C A;  2MA3 A;  1U3E M;  3F72 A;  2IA0 A;  4R1H A;  3RKX A;  5ICF A;  2VBX A;  2DFI A;  4CIC A;  2W84 A;  2HZT A;  1T39 A;  1WSU A;  1HST A;  2WV0 A;  2DK5 A;  1V3F A;  5JR3 A;  1UFM A;  4PDK A;  2FEZ A;  1QGP A;  4LLG F;  3E97 A;  4UNO A;  3WGH A;  2HR3 A;  3DP7 A;  4HV5 A;  1MJA A;  2AXL A;  4AIJ A;  3E6M A;  3RKY A;  3I59 A;  4O5V A;  3Q5F A;  4R79 A;  4M72 A;  2A61 A;  1FYM A;  2ZJ2 A;  3BRO A;  2Q2E A;  1T6S A;  2UXN A;  2PBI A;  4KMF A;  3CO6 C;  4UV9 A;  3WGI A;  3O6B B;  2RGV A;  4KNY A;  4LJZ F;  2XAJ A;  5CJ9 A;  3WTU C;  3GZ6 A;  4A5M A;  4LK1 F;  1P92 A;  1BIA A;  3J80 Z;  1SFU A;  1J5Y A;  3L7W A;  4WX9 A;  1YFH A;  1CGP A;  2KIF A;  4M71 A;  1U2W A;  5ILS A;  2A69 F;  2PEX A;  3LQR A;  4FT8 A;  3TGN A;  3H3U A;  3WTT C;  1KU2 A;  2KJB A;  1Z7U A;  3HHG A;  3R4K A;  2JZY A;  5D5X B;  3D5L A;  1TBX A;  4KA4 A;  1ZG5 A;  2ZKZ A;  1U8R A;  4Q48 A;  1AOY A;  1BI1 A;  4IPA A;  1X3U A;  4R8H A;  5F64 A;  3Q9V A;  3NRV A;  5H6R A;  4G7H F;  1CF7 B;  4GCV A;  5CVR A;  3V8L A;  3S2W A;  4HZF A;  3BDD A;  4RGR A;  3JSP A;  5E1W A;  2GXB A;  3U1D A;  1YW7 A;  1FOK A;  4FX0 A;  2IA2 A;  2NAZ A;  4I0B A;  3ROU A;  1YIO A;  3AAF A;  4M6X A;  5DYM A;  5E17 F;  3ECH A;  2OZU A;  3DXJ F;  3P9K A;  5LGN A;  2OA4 A;  4ESJ A;  3GF2 A;  5TJJ A;  2AS5 F;  1J7K A;  5DD4 A;  4HOB A;  3FXR A;  3W6J B;  4N9H A;  2EB7 A;  1VTN C;  3GZ5 A;  5BMZ A;  3V7C A;  5LHI A;  2COM A;  2FBI A;  3VOE A;  1KU9 A;  1LQ1 A;  2P8T A;  2A3S A;  1RUN A;  1G3T A;  1S6L A;  4KIB A;  3FMQ A;  5HDG A;  4LGW A;  4G7O F;  3F8M A;  1P6R A;  2J5O A;  3RI4 A;  3KFW X;  1W7P D;  4H0E A;  3BP8 A;  2ACJ A;  3GFL A;  1I1S A;  5E18 F;  1H9T A;  5LBQ A;  4HV6 A;  3FF5 A;  1QBJ A;  3CJN A;  2K86 A;  5H20 A;  2VT3 A;  4PGH A;  2OBP A;  2P5V A;  3HOT A;  5LRS A;  2HS5 A;  3HOS A;  3E6B A;  3FXQ A;  1D5V A;  1FBU A;  1R58 A;  4Y17 A;  3OOP A;  1UST A;  4RB1 A;  4GXO A;  1XGN A;  2HEO A;  3GO5 A;  1LVA A;  5LLQ A;  4LB6 B;  4TV7 A;  4OIN F;  4L5J A;  1MDM A;  4KFC A;  3TO6 A;  3GFI A;  1Z05 A;  3PQJ A;  3QRF F;  3ZQ7 A;  1J0R A;  4JBA A;  3ZMZ A;  4WCG A;  5F1R A;  5DCF A;  4GO1 A;  2LNB A;  3C18 A;  2VBY A;  1U5T C;  1YTY A;  1XMK A;  2VE9 A;  3KZZ A;  2KRF A;  3MZH A;  3P9C A;  5LHG A;  2Z9O A;  2GA2 A;  1FC3 A;  5ICC A;  4OIR F;  3SFZ A;  1JGS A;  4M9Z A;  2XKO A;  5E1X A;  2VC1 A;  4MNU A;  3HRU A;  4BHP A;  4HW0 A;  4CXF A;  2EFO A;  1ON1 A;  1B9N A;  1TQM A;  4L9V A;  3ULQ B;  3I53 A;  4LMY A;  2A5Y B;  1I5Z A;  4N9I A;  2L4A A;  2V1D A;  3E3V A;  1FT9 A;  3EYY A;  4IF4 A;  3WE2 A;  2UXX A;  4OIQ F;  4IHS A;  1F1Z A;  2DQL A;  1PP8 F;  5HDK A;  1REP C;  1FBS A;  3BPX A;  2HWV A;  2P5K A;  1BBY A;  4I0A A;  1R5G A;  2ZFW A;  3SZP A;  5HDN A;  4Q5S F;  1F4K A;  4PCQ A;  5A2Q Z;  5J8F A;  2XUB A;  2L01 A;  3FZV A;  3MWM A;  2V9V A;  2K7L A;  1O3Q A;  4ESF A;  3GXO A;  1XB4 A;  3IHU A;  2FNP A;  1O57 A;  1HW2 A;  1Z9C A;  2W57 A;  1O3S A;  4O6J A;  3VOD A;  4UVB A;  4YFN F;  1PUE E;  1MZB A;  1D3Y A;  5DEQ A;  1ZYR F;  1W5T A;  4M74 A;  4IHT A;  4MTD A;  2ETH A;  2DT5 A;  3BJA A;  2FML A;  4OOI A;  3IWZ A;  2VOD A;  1LDJ A;  3HTS B;  5JFR A;  4IVN A;  4KIG A;  2VBZ A;  2QQ9 A;  4D0P A;  4JK1 X;  1L0O C;  3JTG A;  1B59 A;  4M6Y A;  3LFK A;  1GHC A;  4U0W A;  4ENN A;  1G3S A;  3WE3 A;  4LG0 B;  1S8N A;  3SXY A;  1UHM A;  1AWC A;  3LAP A;  3V8K A;  3HUG A;  4ETS A;  1QQI A;  4Z2Y A;  4EM0 B;  3ZMD A;  2LKP A;  4NB5 A;  1JXS A;  5JI6 A;  3LWF A;  3MFK A;  1KQ0 A;  4MGR A;  1LNW A;  4IRH A;  4WXD A;  2FBK A;  1TW2 A;  3BOQ A;  5AON A;  1HXD A;  3RIR A;  3MZY A;  4AWX B;  2OZ6 A;  4CHU A;  2PN6 A;  3RJP A;  5EEH A;  1A04 A;  5K5Q A;  2QEN A;  4N0B A;  2EWN A;  1EH7 A;  2KIM A;  1ZHF A;  4UHT A;  3C7J A;  4EM1 A;  2E7W A;  2RDP A;  2F2E A;  3TO9 A;  3ZN0 A;  3WTW C;  4MEX F;  3FXU A;  3F6V A;  3JW4 A;  2ZME B;  4CGZ A;  1Q1H A;  2V6C A;  1FY7 A;  3O2P E;  3F8F A;  1QNT A;  2ZME A;  1XDU A;  2MH2 A;  4FX4 A;  2CWE A;  3R61 A;  2G9W A;  3TDU C;  2R3S A;  5HVQ C;  2Q8K A;  2FBH A;  2HFH A;  1O7F A;  3EET A;  5DV5 A;  5LEJ A;  2W24 A;  5IT9 Z;  4M73 A;  2NNY A;  3TKY A;  2P7C B;  3ELK A;  2O6G E;  4IXA A;  3K9T A;  3CTA A;  1K78 A;  3LA7 A;  4WXH A;  5L3B A;  4GYG A;  1ZN2 A;  2P4W A;  1K79 A;  1F9N A;  4Y13 A;  2DPU A;  1XD7 A;  2OU2 A;  3OV8 A;  1MJB A;  5KVR A;  5CLS A;  3HRS A;  2FNA A;  4BNC A;  1W7P B;  2YR2 A;  2GZW A;  1HKQ A;  3KP2 A;  2FU4 A;  2A6E F;  3SZT A;  5FLX Z;  5D6E A;  3QU6 A;  5FGM A;  2WWY A;  2HKO A;  4I98 B;  3DPL C;  1J75 A;  3F3X A;  4UVC A;  4ZYD A;  1O3R A;  2JSC A;  2XRO A;  3HSE A;  2V1X A;  2VE8 A;  1MDM B;  1LDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...