2P7VB

Crystal structure of the escherichia coli regulator of sigma 70, rsd, in complex with sigma 70 domain 4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
68
structure length
68
Chain Sequence
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of sigma D
publication title Crystal structure of the Escherichia coli regulator of sigma70, Rsd, in complex with sigma70 domain 4.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 23
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7vB00
3CJNA 3P9IA 2CWEA 4TV7A 2J5OA 1V3FA 5LLQA 2O61A 1XSDA 5FLXZ 4GCVA 1CF7B 1LDKB 4OOIA 3RPUA 1ODDA 2QM3A 4ZYEA 3T8RA 1SD7A 5DYMA 3DPTA 4Q47A 2M45A 2P7CB 2P6TA 3BWGA 1B1BA 3M8FA 3HSEA 1R5HA 1YW7A 3T0YA 1BIBA 3GXOA 1FSHA 2KIUA 5CJ9A 2BE5F 3KFWX 2HTJA 2R7FA 4NHJA 4EJWA 2IA0A 2XVCA 3CUQC 1LEBA 3I4PA 2O0YA 3ERED 2STTA 3V7SA 1BI3A 1X3UA 3HOSA 3V8JA 5FLXK 5D5WB 2H6BA 1SFUA 1IN7A 2JPBA 1FBQA 2VONA 4PZJA 4OMYA 3DKWA 1S6LA 1MKMA 3DF8A 1P4AA 2DI3A 4EM2A 1ZLKA 3HYIA 3BROA 5D6EA 4A0ZA 2FQ3A 1B6AA 2VBZA 2Q0OA 5HS8A 1XDUA 2EV5A 4KMFA 2VOPA 1W4MA 1ZGJA 2A6HF 3JSOA 2HR3A 4MTEA 3GVAA 3LWFA 1D3YA 4Z2YA 4KYWA 4GXOA 3IKTA 4BH9A 4F7ZA 2BYVE 4LG0A 4B09A 1TNTA 1Z05A 5ICFA 3ELKA 3LQRA 4Q4ZF 6PAXA 3GZ5A 2Z99A 2IJLA 4P55A 1J59A 2ESNA 1W7PB 1XGSA 4M9ZA 2GWRA 3DXJF 1IW7F 4CZZA 5L3GA 3LA7A 2IRFG 2DTRA 3FZVA 1UHWA 4IJAA 4CICA 3W6KB 1W5TA 3HSRA 3F21A 4H0EA 4PGHA 4CO8A 2ZXJA 3TOBA 5E8GA 5CLSA 3O6BB 2VBWA 3L2CA 1ZLJA 4I0BA 3F8FA 1XDSA 3CTAA 1GXQA 1K78A 4LGWA 4LLNA 4LJZF 4E70A 1ZRDA 3D5LA 3E6MA 3J7AO 2W25A 4B8XA 2Z9OA 1USSA 2F5EA 3G73A 2QQAA 1KU7A 4BHCA 5JI6A 3WTTC 5HS9A 3V8KA 2RN7A 3ZMTA 1HXDA 1B9MA 1UCRA 1Z7UA 1AWCA 4G94A 5L3BA 5DEQA 1IZ1A 3KCCA 3GW2A 2OAZA 5LGNA 1LDJA 3NRVA 1FX7A 2Z3YA 2BV6A 2QUFA 4KMUX 1RZ4A 2GXBA 4U88A 1YS7A 2VBYA 1W5SA 1U3EM 1XD7A 5D5VB 1BM9A 1DDNA 4IHTA 4XSXF 2EWNA 2UXXA 3EETA 5ICEA 2D1VA 4OIRF 2Y75A 3E6DA 2GA2A 2ZMEB 4KDPA 4XLNF 5K5RA 3RIRA 3WU0A 5ICCA 1MDMB 3F8BA 2VC1A 5A2QZ 2DFIA 4ON0A 1Z9CA 4LLLA 2RV8A 4KA4A 3F23A 3K1PA 4KT5C 1FPQA 2KRFA 2C6YA 4R1HA 3IHUA 2O8XA 4Y13A 2QZ8A 2HKOA 4M74A 3K2ZA 2QENA 4I09A 3F8CA 5FB2A 3LAJA 1H9TA 1PUEE 4N9HA 2WWYA 2FA5A 4UHTA 3WTSC 1FBSA 4RGSA 3RKYA 2HGCA 1YIOA 1D8KA 1FBUA 3ZN0A 4EVIA 5A2QK 1Q1HA 1I27A 4Y17A 1W7PA 4GYGA 2XHKA 2HDCA 1EH7A 2FOKA 5BQTA 1OYIA 4RGUA 1J2XA 1I6XA 2EFPA 1L0OC 4FT8A 3DV8A 1SFEA 4ENMA 3V7CA 4JQFA 3I5UA 1IXSB 4CYDA 1HSJA 2OQGA 2A3SA 1O7LA 2W85A 3HRUA 3HTSB 3DPLC 1HBXG 3LAPA 4KNYA 3GFJA 2O3FA 4MHGA 3P9CA 2GXGA 2QVOA 1R1TA 2FBIA 2M87A 3L7WA 4A0YA 3BJ6A 3M8EA 4HZFA 4IRHA 4ENNA 2K27A 2A5YB 3HHGA 2QQ9A 4WXCA 1JXSA 3CDHA 1H0MA 3F3XA 2LSOA 4O5VA 4M72A 2V1UA 2HTSA 3FM5A 4I7HA 3GFMA 3CO7C 3JW4A 1P92A 3L09A 1P2FA 3SXYA 1IUYA 5J8FA 3IKVA 4IVNA 4MEYF 3WE3A 1IF1A 3I59A 5BPIA 1AOYA 1T6SA 5LEKA 4RS8A 1JE8A 2QQBA 2H94A 4LB6B 4XLPF 3C18A 1F5TA 2JTVA 4R8HA 4LB5A 4G6QA 1HKSA 3LA3A 2VT2A 2DK5A 2HOEA 2KKOA 4U0WA 3FF5A 3RYRA 1S3JA 1YFHA 1O57A 2DT5A 2DK8A 2K02A 4YFKF 4EMSA 1XCVA 4P5OA 2ZMEA 4G9YA 3ECHA 4Q48A 1R1UA 4LG0B 2YR2A 2PEXA 4EV0A 5JR3A 2NNNA 3HOTA 1QO0D 3C1DA 5LBQA 1IXRC 3CO6C 3I64A 1C0WA 3I53A 1G3YA 2COMA 2IVMA 2FBKA 4WF2A 1D5VA 3GEZA 2OBPA 5DUKA 4OIPF 2VE8A 3ZN1A 4HF2A 4BHBA 1LDDA 5L3CA 2FU4A 5CYVA 2NRAC 3HRTA 3CLOA 3E5QA 2CW0F 5EEHA 1K79A 1IN8A 4AWXB 1B9NA 2EFQA 4A5MA 3K69A 5H20A 4LD5A 4HV5A 5AIQA 5TJJA 2NS0A 1GVJA 4P96A 2YX7A 3RKWA 4LK0F 3ABTA 3PQKA 1NHAA 1FOKA 2OZUA 2VN2A 1LJ9A 2A61A 3QOPA 4UNOA 2R7DA 3S2WA 3HHHA 3TDUC 1KQ8A 2Z33A 5FD6A 1FNNA 1HW2A 3ML6A 1JHHA 2XKPA 1E17A 3M9AA 2F5CA 1XGMA 1ZRFA 2CQKA 2Q8KA 1SFXA 2LDUA 4HQEA 5CVJA 2MBFA 3MAJA 1Z1DA 1TW2A 2XAQA 4MQ9F 2YU3A 1FP2A 2DU9A 4A5NA 3K9TA 2DAOA 1BBYA 4HOBA 1BI2A 4RB0A 1T0FA 4A6DA 4M9XA 4MNUA 3WG9A 1HKQA 3KLNA 3QPHA 1RUNA 3MQ0A 1XGOA 1ZG1A 4P9FA 3WTVC 4HW0A 2RVCA 2ELHA 1TBXA 2MC3A 1ON2A 1WWXA 1O3SA 3SFZA 3WGHA 2IA2A 4WXDA 3PFIA 4G6DA 1I5ZA 3KETA 1KQ9A 3QRFF 2OU2A 4NB5A 4OU0A 3R60A 3BJAA 4A6EA 3U9GA 2DO7A 3KP5A 2FNPA 2W24A 2CG4A 3FM3A 3WODF 4EGYA 2VT3A 2RNJA 5ERIA 2Y48A 2EFNA 4ETSA 4RB2C 3HUGA 1KQ0A 2ZCWA 1KU2A 1YYVA 1SD6A 5FO5A 1YG2A 3HRMA 2PQ8A 4CHUA 2L01A 1S29A 2HZTA 1MJBA 2P7VB 2GAUA 1PDNC 3TQNA 1BI1A 4FHTA 2EA4A 2G7HA 5JVTA 2LF7A 2FE3A 3HIFA 5TRDA 4GGGA 4HX7A 3ZQ7A 5ILVA 2K7LA 5DUIA 2L4AA 3TO7A 2IW5A 5CVIA 2HQNA 3JSPA 2XGXA 5E20A 1EV7A 1YS6A 2VODA 4ESFA 1ZG3A 1TTYA 3V8LA 5BPDA 3AAFA 4U0VA 1ONVA 2HYGD 4RGXA 3GYHX 3GO5A 4R79A 3SZTA 3WE2A 5D4RA 1YQAA 5HLHA 4D0PA 1G3WA 1CGPA 2DPDA 5LEJA 4QLCU 1RNLA 1UB9A 4IF4A 1DP7P 4UXNA 2P6SA 1Z6RA 3FWEA 2RGVA 2FSWA 3T1BA 2LNBA 1ULYA 2FF4A 4I98B 1ZRCA 2OD5A 4EJTA 2EK5A 2YSRA 4ESBA 3K0LA 2GZWA 4WK8F 4JK1X 2D1HA 4ASNA 5FFZA 2H6CA 2NNYA 1T2KA 3EUHA 2XROA 3I59B 4MTDA 3WGIA 4HX4A 2Y0MA 1FLIA 2IA1A 3KP3A 3C3WA 1YO5C 4RB1A 1FWZA 2ESHA 1BC7C 1DPRA 2P5VA 4BAYA 3U2RA 5E1WA 3I54A 3KZYA 5E1XA 3C7JA 5IT3A 1XB4A 1WSUA 3CUQB 2XV4S 3MCZA 5H6QA 4YIIA 2QBYA 1KGSA 2NYXA 2M30A 2B0LA 2ZKZA 3IWZA 2RQPA 2KJCA 2XASA 3REOA 2UWMA 1BI0A 4KFCA 3J81Z 3NEUA 2EFWA 5BS6A 1WRJA 3F72A 2PJPA 4U7BA 1FYMA 4HF0A 4L9NA 2V1XA 4LK1F 1K6OA 2WC2A 2K4JA 1QGPA 4UUVA 3I58A 3FXUA 3TDZC 1J7KA 2PG4A 4L9JA 2ZFWA 1DUXC 2HKXA 1U5TC 3DEUA 4BQAA 1LNWA 4L0ZB 2MA3A 4ESJA 2E1NA 3SQNA 1BC8C 4G7ZF 1ZREA 5D5XB 4I01A 2P8TA 3J81K 1S7AA 3KP7A 4OIQF 2A07F 1KA8A 1WQ2A 3O2PE 2ACJA 3LA2A 2EJRA 3RTRA 1ON1A 1YW9A 3KZZA 1J9IA 3RPQA 4AIJA 1P4XA 5CVUA 5D5UB 2W57A 3D0SA 2XRNA 3G3ZA 1R1VA 5DV5A 3ZMVA 1F9NA 3GX4X 4ENJA 1EH6A 5K5QA 1WKMA 2AS5F 5HVQC 3RKXA 5E18F 4YFNF 3LSTA 2XAJA 1QZYA 3ECOA 2GQQA 4L0YB 5E1ZB 2A6EF 4IRGA 3EDPA 3R6SA 1G3SA 2A69F 4HDVA 2VC0A 1RUOA 2E1CA 1REPC 5LHGA 3VB2A 2ISZA 2JSCA 5BOXA 1WI9A 3ULQB 5HLGA 5LGTA 1OPCA 2M1BA 4O3MA 3ROUA 5HDNA 4KN7X 3KP4A 1FP1D 3VODA 1O3QA 3KP6A 4ZZDA 3H3UA 3I71A 3JAMZ 3OOPA 4BYYA 2OQRA 1IN4A 1MJ9A 3ZPLA 3WTWC 1U78A 3T5XA 1S7OA 1QZZA 3CUQA 2D2WA 2M8EA 4O6JA 2ZJ2A 1EH8A 3GLXA 2V1DA 3E6BA 5K1YA 4WWCA 3JTHA 4I0AA 1SD5A 2FNAA 4BNCA 4Q5SF 1JHFA 1R58A 4S04A 2QLZA 3M7GA 4MQVA 2DLLA 4KIGA 4M6XA 4A2UA 3K1MA 3R0JA 5F6FA 4I02A 2QWWA 3GWZA 2JPCA 4Y15A 4EJOA 3I0TA 3RYPA 5LRSA 4XRFA 4LFUA 1XMKA 4EM0B 1KYWA 3E3VA 3R4KA 1H9GA 1I1SA 3Q9SA 4EM1A 1I1GA 5H6RA 4ZYGA 3BPVA 3N97A 2H09A 2ETHA 1QPMA 3ZP5A 5KVRA 5D8LB 1U6GA 3RJPA 5LHIA 2G7UA 1TQPA 2DQLA 1USTA 3P9KA 3QPTA 1FY7A 4S05A 3VOEA 3E5XA 3F8MA 4G7HF 3J80Z 4HA8A 4CGZA 2VOOA 3MEXA 4AIKA 4OIOF 1Y0UA 4IRIA 2E7WA 1V4RA 2EB7A 3VFZA 5FFXA 1R5GA 1HSTA 2IP2A 3GFLA 5DDGA 2BBYA 5D8KB 2PLYA 3KEQA 1GHCA 1OYWA 1U8RA 1IAWA 3F6VA 3Q5FA 1D8JA 4KIFA 3WGGA 3GFIA 4U0YA 4WX9A 4UV8A 2P5KA 3J80K 3F8NA 2ZNZA 4PDKA 1GXPA 4HLXA 2CO5A 2V79A 3BY6A 2OZ6A 1ZYRF 2YPRA 2FXAA 1P4WA 1ZN2A 2PN6A 1HQCA 3QP6A 2L02A 3HTUA 3P7NA 3FMQA 4DQ2A 1BJAA 5CVVA 1U2WA 1T38A 3FMRA 2QBYB 3GF2A 4AVPA 1JGSA 3WTXC 3EYYA 1R00A 5LRRA 3MZHA 3SZPA 1A04A 1J0RA 4AIHA 2RDPA 2FMLA 1FZPB 4M9SA 2HS5A 5DCMB 4WXHA 2MLKA 1YTYA 3JTGA 4HX8A 2DQRA 3KP2A 3MFKA 2E7XA 3L00A 4A12A 5DD4A 2Z5UA 3TKYA 2XIGA 3Q9VA 3IC7A 4HAMA 2CGPA 5ED4A 2XUBA 3QU3A 1XSVA 3BDDA 5ICGA 2Q2EA 1ZARA 1OMIA 2BGCA 4LMYA 4N9IA 3KLOA 1ZG5A 4M6YA 4KUMA 4LLGF 3ZMSA 1O3RA 1XMAA 5KK1A 4CDGA 5LHHA 2ISYA 3L9FA 1XSXA 2W84A 2EA2A 1G6NA 3H92A 3IL2A 4L9VA 1UFMA 2IPQX 5J6XA 2KIFA 3COAC 1IRFA 3DP7A 3CUOA 4G7OF 5HOOA 1BIAA 1OYYA 5IT9Z 2MH2A 1Z6TA 1HW5A 3FHZA 2CYYA 2AXLA 1K7AA 1OR7A 2EFOA 4GYIA 1XCBA 1QQIA 1O7FA 2XAGA 1U5TA 2F2EA 5AONA 2BEOA 5HS7A 4DNCA 1BN5A 4KICA 1SD4A 1XGNA 2X4HA 5J8CA 1E2XA 1J75A 2KIMA 4M73A 2RC4A 1IN5A 4ZH4F 3R61A 4PGGA 2FMYA 2K86A 3QAHA 5IT9K 3V4GA 1CF7A 1FSEA 4EJUA 3M1EA 4A0XA 5FGMA 1IN6A 2WV0A 1T98A 2HQRA 5HDGA 4EGZA 4RGRA 2O03A 3F6OA 1LB2A 3WTZA 2MD5A 3BZ6A 4YG2F 2R3SA 3GUDA 4ENKA 3KE2A 4RAYA 1PP8F 1RI7A 3WU1B 4HF1A 2NAZA 4HQMA 3FXRA 1S8NA 4FX4A 2V9VA 4BXUA 2XKOA 2G9WA 4HLYA 1MJAA 2TDXA 5DD8A 3N4MA 3TO9A 4KIBA 4YFXF 2HEOA 1MD0A 1KU3A 3E5UA 1PP7U 5JFRA 4QWQA 3ZMDA 5DCMA 2EV6A 2L54A 2VBXA 4FX0A 3LFKA 2UZKA 3MWMA 4IHSA 2PMHA 3PQJA 1TW3A 2HWVA 1W7PD 4NQWA 2JRTA 2HYFA 2STWA 2FBHA 4HYEA 3V7RA 3EYIA 2LF8A 1P6RA 3TO6A 3R0AA 2CFXA 1MZBA 1ZGAA 1SMTA 2J5PA 3W6JB 3FX3A 4KN4X 1QBJA 1R22A 1L3LA 4CXFA 2X0LA 3FMSA 2FRHA 4XSZF 3U1DA 4WCGA 3H3ZA 2DBBA 2ZBKA 1XN7A 3ZMZA 4K2EA 1BOAA 4IPAA 4L5IA 5FD5A 4BHPA 3B73A 4EQQA 1HKTA 3KEOA 4YIFA 1IRGA 4G8XA 4MGRA 4HDUA 3WTUC 1IXCA 3O3KA 1TLHB 3E97A 2H27A 5F64A 3TOAA 1SMYF 2IT0A 5L3FA 5ILSA 3BOQA 1LVAA 1OKRA 1FYLA 5BMZA 2ZNYA 3DFGA 1R36A 1G4DA 3OV8A 1TQMA 3EQLF 2KJBA 3WTYC 3E6CC 2LKPA 3GZ6A 4HBLA 2GIVA 1SAXA 4L18B 3BPXA 2PBIA 5ILUA 3BP8A 2JT1A 2EV0A 1DPUA 5D6FA 2D45A 1ZHFA 3QP5A 4ZZLA 2JZYA 3MZYA 2VE9A 2L3DA 4IXAA 2VXZA 3RI4A 1R7JA 2GA1A 5L3DA 1T39A 4OMZA 2L4MA 4RAZA 2UXNA 4PCQA 1R23A 4L5JA 4ZYHA 4RB3C 4I2OA 4L9TA 3HRSA 3K1NA 5HLIA 3IRQA 4P9UA 4UV9A 4EJVA 3ABUA 1Z91A 3LQQA 3HSFA 2P4WA 1RIOH 4MEXF 2K4BA 3TGNA 1VTNC 3NQOA 5K5OA 2O6GE 1F4KA 1O3TA 2XAHA 3B02A 2MH9A 1UHMA 2DW4A 1TQIA 5JHUA 1B4AA 2ADUA 3JAMK 1LEAA 3RDIA 2HFHA 4GO1A 1HW1A 4AD9A 1MDMA 1ZH5A 3DQVC 4ZYDA 1G3TA 1MGTA 5EEGA 3SHFA 3QU6A 1KU9A 3VEPA 2M5WA 1LQ1A 1STZA 1B59A 1F1ZA 4UVCA 2PMUA 5E8IA 4JBAA 1FT9A 2FEZA 4HV6A 1J5YA 4U7DA 3BJOA 2P5LC 2PFBA 2OA4A 1YW8A 5CVRA 3T8TA 2XAFA 5LGUA 4UVAA 2F5DA 4XBFA 1ZAOA 2V6CA 2ZO4A 1FYKA 5DCFA 5E17F 4OINF 1TNSA 1YLFA 2F5FA 3FXQA 3F22A 3IWFA 5D4SA 2WTEA 5AIPA 1U5TB 2QYOA 1K78B 5HDKA 2CSOA 3ISPA 2PI0A 3IRRA 2MLGA 2DPUA 5F1RA 2A68F 1QNTA 4N0BA 2YX4A 5L3EA 1FC3A 3ZMUA 4UVBA 2RKHA 4M71A 1KYZA
chains in the Genus database with same CATH superfamily
3H0GJ 3CJNA 2OJED 2EIKH 3W2AA 1JI8A 3P9IA 4PUSA 2CWEA 4TV7A 2J5OA 2DFFA 1V3FA 5LLQA 2LKSA 2O61A 1XSDA 4NC6A 5FLXZ 4GCVA 3FXMA 2LBFB 1LDKB 1CF7B 2KPMA 4OOIA 3RPUA 3CCRI 3S2HJ 1ODDA 3BR5A 2QM3A 2DOFA 4ZYEA 4F55A 1VF9A 5EZGA 3T8RA 1SD7A 3HKZA 4ZJZA 1VQ5I 5DYMA 3DPTA 2MFZA 4Q47A 2M45A 2P7CB 2GM4A 2P6TA 2LR8A 2O7OA 3BWGA 1NG7A 4HG2A 4PJJA 3L2WA 1B1BA 3M8FA 2MD0A 3HSEA 1R5HA 1YW7A 3T0YA 2QQ8A 1BIBA 5H2FC 3AKZA 3GXOA 1LFUP 3HDDA 1FSHA 1FOWA 2KIUA 5CJ9A 2BE5F 3VSLA 3KFWX 1MMGA 2HTJA 2R7FA 4NHJA 4B3XA 4EJWA 2BVMA 2DT6A 2IA0A 1Y1VJ 1PUFA 1Y8QB 2XVCA 3CUQC 1LEBA 1N77A 2NOGA 3I4PA 2O0YA 4RAFA 1IV8A 3ERED 5B3SH 3V7SA 5F1JA 2STTA 5B66C 1BI3A 2XF5A 1RESA 3VYTB 1X3UA 3HOSA 2COBA 3V8JA 5FLXK 3G71I 3KEYA 5D5WB 2H6BA 1SFUA 1A6IA 1IN7A 5C4JJ 3D5SC 1SFOJ 1O4XA 3FXKA 2JPBA 1FBQA 2VONA 3H5AA 3OYDA 1OJLA 4PZJA 3AG2H 4CCNA 3DKWA 4OMYA 1S6LA 1GVDA 2DA5A 1MKMA 3DF8A 1X1DA 2XGCA 1SC7A 1P4AA 4XKBA 2DI3A 4EM2A 5FKOA 1ZLKA 3HYIA 1VQ6I 2E35A 3BROA 5D6EA 2JA5J 4A0ZA 2FQ3A 3BG7A 3TP3A 1B6AA 2GIZA 1V5FA 1SVMA 2KFDA 2VBZA 2Q0OA 3Q0UA 5HS8A 1XDUA 2R7OA 2EV5A 1TWHJ 4KMFA 2VOPA 2FX0A 1W4MA 4Y4RA 2PMZA 4HPQA 1ZGJA 3C2GA 5J47A 4LG3A 2A6HF 4NQWB 5GPCA 2HR3A 3JSOA 4RMNA 1HLVA 2LP0A 4NUBA 1SFKA 2LLKA 4MTEA 3JRDA 3GVAA 3LWFA 2ICWG 1D3YA 2M0MA 2ME0A 4Z2YA 4KYWA 3HGGA 4GXOA 3IKTA 2EH3A 1LE8A 4BH9A 3ABMH 4F7ZA 2BYVE 2DYSH 2E36A 4LG0A 4P1WA 4B09A 3K2AA 1IUFA 1TNTA 1Z05A 1YX5A 2A5WA 2G0EA 2M4GA 5ICFA 1QU3A 3ELKA 3LQRA 4Q4ZF 2EZHA 6PAXA 3GZ5A 1WZ2A 2Z99A 3ERMA 1QHHD 2XPUA 5F0HA 2IJLA 4AVZA 2GXAA 4PJNA 3HOZJ 2XDVA 1Y56A 3K4LA 4P55A 4D7NA 1J59A 2AXTC 2ESNA 4CUGA 4XOPA 1Y39A 1RRJA 3A2KA 1W7PB 1LVKA 1TWAJ 1XGSA 4XLHA 4M9ZA 3LFUA 2GWRA 5EGOA 1MMDA 4C2MJ 3DXJF 4CYCB 2R0QC 1IW7F 1MBEA 4RBOA 3LSMA 4CZZA 4KJZA 5L3GA 3LA7A 2IRFG 2DTRA 3OWTA 1VQ8I 2LMDA 3FZVA 1UHWA 3QQAA 4IJAA 4CICA 3W6KB 1W5TA 3HSRA 3HEFA 3F21A 4H0EA 3M8JA 3S1NJ 2DJIA 4PGHA 2HDWA 1AA7A 3V42A 4CO8A 3GTKJ 2ZXJA 3TOBA 5FJ8J 5E8GA 5CLSA 3O6BB 2VBWA 3HKZN 3A03A 3L2CA 1ZLJA 4I0BA 1G2HA 3F8FA 1ERDA 1XDSA 1T0FC 3CTAA 1GXQA 1OCPA 1K78A 4J00A 1LKXA 2VQHA 2DDBA 4LGWA 3GTGJ 4LLNA 4LJZF 4GRIA 3RKQA 4E70A 1ZRDA 2VQCA 3D5LA 4BL0B 3E6MA 3J7AO 2W25A 4B8XA 2Z9OA 1USSA 2F5EA 4MLOA 3G73A 2QQAA 1AKHB 1KU7A 4BHCA 5JI6A 1TT0A 3HGYA 3OMYA 5HS9A 2DN0A 3V8KA 2RN7A 3BCAA 4XLEA 3ZMTA 1HXDA 1B9MA 1UCRA 4QSHA 1Z7UA 1AWCA 2VJIA 4G94A 3JCUC 5L3BA 2RNGA 1JKQC 4IO9F 5DEQA 4BQQA 4ZTFA 1U9OA 5IPAA 1TL8A 1IZ1A 3KCCA 3W6VA 2NVXJ 4IX7A 3GW2A 2OAZA 5LGNA 3PIPF 1LDJA 2GBYA 3X2QH 1JKOC 5IP6A 3NRVA 3SEZA 3JRGA 1FX7A 5FRMA 2Z3YA 1W0UA 2BV6A 4XORA 2XB5A 4ZTJA 2R5YA 2BW3B 2HZDA 2QUFA 3O8HA 4KMUX 1RZ4A 3UNGC 2GXBA 3HPGA 4N4OB 3RQ4A 4G6TB 4U88A 1YS7A 1X3WB 2YS9A 2X1EA 2VBYA 4BEHA 5M5XJ 1W5SA 2I5UA 3GTMJ 3LSGA 3DU5A 3WTTC 3HOXJ 2H8WA 1U3EM 2MC4A 3DLLF 3BR1A 2VXDA 1RR8C 4QIWN 1XD7A 3ESWB 5D5VB 1BM9A 4ABZA 2PMZN 1DDNA 3A4CA 4IHTA 2E5ZA 5K7FA 5M5WJ 2HXIA 4XSXF 2GLOA 2EWNA 2EZIA 4RM3A 2UXXA 5IOZA 3S8PA 3EETA 3PSFA 5ICEA 1FOXA 2D1VA 3OYIA 4OIRF 2Y75A 3E6DA 1SAUA 2GA2A 2Z16A 3H0DA 5KAFC 2ZMEB 3MVPA 3BR6A 5F27A 1VQ4I 1F43A 4KDPA 3B6AA 3E7LA 3IP4B 4XLNF 4XK4A 5K5RA 3S2DJ 3RIRA 4HSTA 5F0FA 2O9LA 3RZDJ 1K83J 3WU0A 5ICCA 1MDMB 2IGMA 2WBMA 2ZXWH 3FXLA 1S7EA 3GTPJ 3F8BA 3S93A 2VC1A 5A2QZ 1IG7A 2DFIA 4ON0A 1Z9CA 2WAQA 4G12A 1FMVA 2RV8A 4LLLA 4HNVA 2MSYA 4KA4A 3F23A 3H1CA 3K1PA 4KT5C 1FPQA 1VZ0A 2KRFA 4ZYAA 5F0CA 3DEEA 2C6YA 4R1HA 3IHUA 3CMYA 3OYJA 1X1BA 4BBRJ 1Z3YA 2O8XA 4Y13A 3DBHB 2QZ8A 2HKOA 1FIAA 4M74A 4XR6A 3CJQB 1ETKA 3K2ZA 3HOUJ 2QKLB 2QENA 4I09A 3F8CA 4II2A 5FB2A 3LAJA 1H9TA 1PUEE 4N9HA 2WWYA 2FA5A 4UHTA 2R7RA 3UKGA 4PJMA 4XICA 3WTSC 1FBSA 4L5EA 1A5JA 4RGSA 5C3EJ 4IKFA 2F5VA 3RKYA 3I3LA 2HGCA 4BQNA 3FIWA 1YIOA 3H9QA 3ZRGA 4DZJA 1D8KA 3PL8A 4IHXA 5DM6F 1FBUA 3ZN0A 4EVIA 5A2QK 1Q1HA 2Y30A 5DM7F 1JKPC 1I27A 2K9LA 4Y17A 4NC7A 1W7PA 4GYGA 2XHKA 2HDCA 3G1LA 1EH7A 2FOKA 5BQTA 1OYIA 4RGUA 3DCFA 4CYCA 1J2XA 2F48A 1I6XA 2EFPA 1OCTC 3OYAA 1L0OC 1YE9A 4FT8A 4B47A 3DV8A 1SFEA 4ENMA 3V7CA 2VLAA 4JQFA 3I5UA 2OTJI 1IXSB 4CYDA 1HSJA 2HOAA 3FBNB 3ZXSA 3EUHC 2OQGA 2A3SA 1O7LA 4UUSB 2W85A 3HRUA 2FJ1A 3HTSB 3IAM2 3DPLC 1HBXG 2RAEA 1YJNI 4FASD 4IOAF 3LAPA 3FDYA 4KNYA 4II3A 1X19A 2CV0A 3GFJA 1IDYA 2O3FA 4MHGA 3P9CA 4YELA 2GXGA 2QVOA 1R1TA 3SEQA 4D1QA 2ECCA 2FBIA 3CCUI 3FK7A 3UR3C 2L7FP 2M87A 3L7WA 5E3OA 4E6KG 3BTJA 3CP8A 3SDBA 4XMYA 4A0YA 3BJ6A 3M8EA 4HZFA 4IRHA 4ENNA 1PUFB 2K27A 4FISA 2A5YB 4XRSG 1Z67A 2DMQA 1IGNA 3HHGA 2QQ9A 4WXCA 4B43A 2XGDA 3S3NA 1JXSA 3AG3H 3CDHA 1H0MA 4DBRA 1UAAA 3F3XA 2EPFA 2LSOA 4DW6A 4O5VA 4M72A 2V1UA 2HTSA 3FM5A 4I7HA 3PUFA 3GFMA 2KL4A 3CO7C 3JW4A 1WHUA 1P92A 4MO7A 3L09A 1P2FA 5IYBJ 3SXYA 1N75A 2CU7A 2F4OB 1IUYA 5J8FA 2WV1A 1JUPA 2VKEA 3CCJI 4ZDPA 3IKVA 4IVNA 4MEYF 3WE3A 1IF1A 1JT6A 3I59A 5BPIA 4BACA 1AOYA 4HNUA 4E7HA 1T6SA 4CCOA 5LEKA 2YUSA 1ZQ3P 3FBIB 4RS8A 1JE8A 2QQBA 2VKVA 2H94A 4LB6B 4RDUA 4XLPF 3C18A 1F5TA 2JTVA 1BR4A 4R8HA 4LB5A 1BOBA 4G6QA 1HKSA 2ZXHA 3LA3A 2WAQN 4YRVA 4IOCF 2XF6A 2VT2A 2DK5A 2HOEA 2KKOA 2ME6A 1ACIA 4U0WA 2B63J 3FF5A 3LSKA 1R6RA 1S3JA 3RYRA 4C2TA 5K7HA 4C3HJ 4HNTA 3EPZA 1YFHA 3LSRA 3A02A 1O57A 1D1BA 2DT5A 2CUZA 2DK8A 3S32A 3S14J 2K02A 4YFKF 1VQLI 4EMSA 2DA7A 4A3IJ 1XCVA 4P5OA 1FIPA 4NBQA 2AHQA 2DA4A 2L7KA 2ZMEA 1UELB 4G9YA 2KDOA 1LE8B 3ECHA 4Q48A 1R1UA 4LG0B 5E79C 5GADJ 5KCMA 4ZDOA 2YR2A 1UMQA 3OL4A 1V55H 2PEXA 4EV0A 5JR3A 4FE7A 2NNNA 4PK4A 1JKRC 1YRNB 3HOTA 1DU6A 1VQOI 1QO0D 2IAIA 3C1DA 2D5VA 3OS2A 5LBQA 2VI6A 1VQPI 1IXRC 3FXJA 3I64A 3CO6C 1C0WA 4M3GA 3I53A 1G3YA 1MNEA 2COMA 2FBKA 2IVMA 4WF2A 3MKWB 1D5VA 4LITA 3G6EI 1CQTA 2DYRH 4A3JJ 3GEZA 1TWFJ 2OBPA 5DUKA 2DT7B 3I4NJ 5DTDA 5FLMJ 4OIPF 2VE8A 3ZN1A 5EGOB 4HF2A 2M0CA 1ETOA 4UB6C 4BHBA 1LDDA 4BGDA 5L3CA 1A35A 2FU4A 2K3PA 4XLFA 5CYVA 3CC4I 4PFPA 3L2VA 2NRAC 3HRTA 3CZ6A 3CLOA 3Q0WA 3E5QA 2CW0F 4BE0A 5E3LA 4BE2A 5EEHA 1K79A 1IN8A 4AWXB 1B9NA 2EFQA 1D1CA 4A5MA 4AUXA 2I8DA 3L2QA 2R4GA 1F36A 3K69A 3OR1C 5H20A 3A01B 4LD5A 5GAEJ 5IP7J 4HV5A 5AIQA 5LFAA 5TJJA 2L7MP 2JVHA 2NS0A 3GMEA 3H9GA 1GVJA 2JMWA 4P96A 3CP2A 2YX7A 2JVGA 1G8XA 3RKWA 2BY3A 2Y2ZA 4LK0F 3ABTA 3PNVA 3PQKA 1NHAA 1FOKA 3OIQA 2OZUA 2VN2A 2RQQA 2ZJQF 2NOJB 1LJ9A 3DBLB 3JREA 2A61A 3QOPA 4UNOA 2R7DA 1RPWA 3DWLE 1ENHA 3S2WA 4X6AJ 3CLQA 3HHHA 3LSHA 3TDUC 4UUSA 2Z33A 5FD6A 1KQ8A 2LYCA 1RR7A 1YIJI 1FNNA 3CF2A 1HW2A 3ML6A 1JHHA 2XKPA 1E17A 3M9AA 4CA0A 2F5CA 1XGMA 1ZRFA 2CQKA 4EATA 2FUG2 2Q8KA 3J7AY 2KIQA 1UG0A 1SFXA 2LDUA 1WJDA 4HQEA 3ZQCA 5CVJA 2R5YB 2MBFA 3MAJA 2ID3A 2DODA 1Z1DA 4C3JJ 1TW2A 2XAQA 2JJ7A 2XPVA 4MQ9F 2YU3A 1FP2A 4IEJA 1QPIA 4BEHB 2B9SA 1HA8A 1WH5A 1OCCH 2DU9A 2L5QA 4A5NA 3K9TA 2DAOA 3B6CA 1BBYA 3HB9A 3HBLA 4IL6C 1KZHA 1X1PA 4F52A 4HOBA 1BI2A 1WJFA 4RB0A 1T0FA 1W36C 4A6DA 4M9XA 2ZSHB 1YITI 4MNUA 3SJMA 1RKTA 3WG9A 3A0BC 1HKQA 3KLNA 3QPHA 1RUNA 4S0HB 3MQ0A 1XGOA 2OPTA 3KX2A 4XKVA 5HODA 1DGWY 1ZG1A 4P9FA 5GAGJ 3WTVC 4HW0A 1BL0A 2RVCA 2ELHA 2DOAA 1TBXA 2MC3A 3GTJJ 3ZCOA 4ANJA 1ON2A 3GBGA 1WWXA 1O3SA 3DU6A 2M34A 3SFZA 3WGHA 2IA2A 2I10A 5CQGA 1POGA 3JRCA 2OF7A 4WXDA 3G1OA 1MH3A 3PFIA 3BR0A 4G6DA 4BJ6C 2BHYA 1I5ZA 2LD5A 2K3FA 1R9TJ 3KETA 3OYBA 4A3LJ 1KQ9A 3QRFF 2OU2A 2JA2A 4NB5A 4OU0A 3R60A 4NC8A 3BJAA 3ZQGA 4A6EA 2BOLA 2R5ZA 3U9GA 3K7AJ 2DO7A 3D5RC 3KP5A 2FNPA 2JN6A 3WHCA 1HDDC 2W24A 3PSIA 2CG4A 3FM3A 4BU2A 1JUSA 3WODF 2BY1A 4EGYA 5DS9A 2VT3A 2RNJA 2M4KA 3E0JB 5ERIA 4DZPA 2Y48A 5GAHJ 3SFIA 2EFNA 4ETSA 1ETQA 4LIUA 4RB2C 2ZJPF 1H89C 3HUGA 2L2OA 3ABLH 1EKEA 4AU7A 1KQ0A 2A6TA 4I76A 4F91B 2ZCWA 1Y0NA 1KU2A 3CC7I 4XL9A 1YYVA 1YRNA 1XG1A 3RZOJ 4E4HA 1SD6A 1UZCA 5FO5A 1YG2A 3HRMA 3J7YJ 2PQ8A 3HOYJ 3S16J 4CHUA 2OTLI 2L01A 3IV5A 1S29A 2HZTA 1MJBA 2P7VB 5J1UA 1JTYA 2GAUA 1PDNC 3TQNA 3IAS2 2L9NA 2PX9A 2LVSA 4C3IJ 1BI1A 4FHTA 2DFHA 2EA4A 2G7HA 1APLC 2LY1A 2VUMJ 1P7JA 3NARA 5JVTA 2LF7A 2FE3A 3NAUA 3HIFA 2CV1A 3G1MA 5TRDA 4GGGA 2DDAA 4HX7A 3ZQ7A 5ILVA 2K7LA 2L4AA 3TO7A 5DUIA 2IW5A 2Q1ZB 5CVIA 3OYHA 1B72B 2HQNA 1FTZA 3JSPA 2XGXA 1FJLA 5E20A 2FOWA 3AL0C 4E7JA 1EV7A 1YS6A 3OYEA 2VODA 4ESFA 4MFDA 5FROA 2L9VA 3A01A 1ZG3A 1TTYA 3V8LA 5BPDA 1NK3P 3KIOA 3AAFA 1MSEC 3AFHA 4BJTA 4U0VA 1K4SA 1ONVA 2HYGD 1ZKGA 4RGXA 3GYHX 2JRMA 2K9NA 1IDZA 3GO5A 4H4KC 3SZTA 3WE2A 4R79A 5D4RA 3QOEA 1YQAA 5HLHA 2VPLA 4UY8I 4D0PA 1Z77A 1OFCX 2W00A 3DLAA 1G3WA 1XPXA 1CGPA 2DPDA 5LEJA 4QLCU 1RNLA 4CH7A 1UB9A 1OLTA 4IF4A 1DP7P 4UXNA 3DKYA 2P6SA 1Z6RA 3A1YA 4QTRA 2TCTA 3JRHA 3FWEA 2RGVA 2FSWA 2ZSIB 3T1BA 5IY5H 4YIRX 1V54H 3HOWJ 2LK2A 2DMTA 2LNBA 3KYCB 1ULYA 4AYBA 2R7UA 1LPQA 2FF4A 4M3FA 4I98B 1ZRCA 1D1AA 4Y33A 1QHGA 3OS1A 2OD5A 4XKCA 2KT0A 3NWTA 2CFOA 3FHNA 4V19K 2HOTA 4EJTA 3CF5F 2X6OA 2EK5A 5EZHA 2YSRA 3VYSB 1X2MA 4ESBA 4DJAA 5K7ZA 3K0LA 2GZWA 5GPAA 2VKHA 4JK1X 2D1HA 1ETYA 4ASNA 3RCOA 4WK8F 4XOTA 5FFZA 4FTHA 1YJ9I 2H6CA 2NNYA 1I6HJ 4EEFG 2JA8J 3BQYA 1T2KA 3EUHA 2XROA 1A36A 1TWGJ 3I59B 3G4SI 1QVTA 4MTDA 3WGIA 4BXXJ 4HX4A 2Y0MA 3GCMA 1FLIA 1RETA 3JR9A 2IA1A 3KP3A 3HOVJ 3SYTA 2EZLA 1QRYA 2F6CA 3C3WA 1YO5C 4RB1A 1FWZA 2ESHA 1VI0A 4OWRB 2E1MC 1BC7C 1DPRA 5KHDA 2PJRA 2P5VA 4BAYA 3I55I 3H3VK 9ANTA 3U2RA 1TP4A 5E1WA 5B1AH 4F93B 3I54A 3KZYA 2R7WA 3K4NA 1Z0XA 5E1XA 2VJJA 2KDZA 3C7JA 4XKWA 5IT3A 1GUUA 2VASA 5IYDJ 3CC2I 3JRBA 3W2WA 5IP9J 4BQOA 1V5GA 1XB4A 2CUJA 1WSUA 3CUQB 5E3NA 1MBFA 2XV4S 3PO3J 3MCZA 5H6QA 4YIIA 2QBYA 2CQQA 1KGSA 1SVLA 4JX4A 2NYXA 2M30A 1HF0A 2R93J 3SDGA 2B0LA 2JA6J 2ZKZA 3IWZA 2RQPA 2KJCA 1YHQI 3QODA 3QYEA 1GV2A 2XASA 1BW6A 2LREA 1OCOH 2E19A 2FQ4A 4D5CA 3JRIA 3TEDA 3REOA 2WY8Q 3BTCA 2UWMA 1BI0A 2XGEA 2F4IA 4E7SA 4KFCA 2XC7A 4C30A 2OV7A 1ZGWA 1TZLA 3J81Z 2QGUA 3NEUA 2EFWA 4MIMA 5BS6A 1WRJA 2HQ5A 3F72A 2QA4I 1QVUA 2PJPA 3E1SA 4U7BA 1FYMA 5HLTA 4HF0A 4L9NA 2V1XA 4LK1F 4MFEA 3QWLA 1K6OA 2K40A 2WC2A 2K4JA 1OR7C 1QGPA 2EZKA 3I58A 2CS3A 3FXUA 4BY7J 3TDZC 4UUVA 1J7KA 2PG4A 4L9JA 2QCOA 2ZFWA 1DUXC 2HKXA 1U5TC 3NWSA 3DBRB 2IGOA 3DEUA 1MMSA 4BQAA 4XLCA 2HPIA 1LNWA 3HC7A 4L0ZB 4V2GA 2MA3A 4ESJA 1ZTRA 2NVQJ 4E7IA 2E1NA 3SQNA 3S3OA 1BC8C 4G7ZF 3OYCA 2X1DA 4HSRA 1ZREA 1WI3A 2LY9A 3K4CA 5D5XB 4I01A 4AYBN 1B72A 3W3CA 5KAIC 2P8TA 2VIXA 3J81K 2WB1A 2QSFX 1S7AA 3KP7A 2X48A 3I4MJ 2DMNA 4M6VA 2OCEA 1K61A 4OIQF 2A07F 1KA8A 1VQKI 1WQ2A 5JLWA 3O2PE 3VYUB 2ACJA 3LA2A 3ZQLA 2XB0X 1IJWC 1I50J 2EJRA 1Y6IA 3RTRA 4E7KA 2IGKA 2E34A 2X85A 4RA2A 1ON1A 1YW9A 2MGQA 5EG0A 1T8IA 3KZZA 1J9IA 4LOCA 5J3LA 2K9SA 1Z7LA 3RPQA 4AIJA 3OYNA 1P4XA 1WJ5A 3BC8A 2W48A 4GFBA 5CVUA 5D5UB 2W57A 1MW7A 2MABA 3D0SA 1R49A 2XRNA 3G3ZA 1R1VA 5DV5A 3ZMVA 1F9NA 3GX4X 4ENJA 2Z2SB 1EH6A 4IHVA 3OYGA 4Z6YA 2DA3A 2KP6A 3F9KA 5JLXA 3CDLA 3DPUA 5K5QA 2NXNB 1WKMA 2AS5F 2MG4A 2NVYJ 5HVQC 5HNHA 3RKXA 3CDIA 5FKLA 3FXOA 5E18F 1R5ID 4YFNF 3LSTA 2XAJA 1QZYA 3ECOA 2GQQA 1ZR2A 4L0YB 1FOYA 1WCMJ 5E1ZB 2OC6A 4M3EA 3C2HA 2CJJA 2A6EF 4IRGA 4I99C 3EDPA 3R6SA 1G3SA 3QYFA 2A69F 1MBKA 2E2HJ 3MKYB 1FEXA 1XMXA 4HDVA 3VDXA 2A05A 3BZKA 2VC0A 1RUOA 3L2RA 2Y9ZA 1B8IB 2E1CA 2K85A 1K6YA 3I56I 1REPC 2W82A 3K4KA 1W36D 3TBIA 2HNHA 4JYKA 4FE4A 5LHGA 4DYRA 5F08A 3VB2A 3FK6A 2O5RA 1G59A 2ISZA 2JSCA 5BOXA 1WI9A 1MSFC 2DA2A 3ULQB 5HLGA 2EQRA 2Y31A 5LGTA 4AM3A 1RC9A 1OPCA 2M1BA 2CMPA 4O3MA 3ROUA 5HDNA 4X1EA 4KN7X 4W1UA 4C2UA 3KP4A 1FP1D 2E2JJ 5F04A 5TISC 3VODA 1O3QA 1R71A 3KP6A 4ZZDA 1MMAA 3H3UA 3I71A 3JAMZ 2IS4A 3OOPA 4BYYA 2R5ZB 2Y0SA 2OQRA 1IN4A 1ETXA 1MJ9A 1BR1A 1X2NA 2DMUA 3ZQQA 3ZPLA 1EF4A 2BVLA 3WTWC 3OIOA 1M1EB 1U78A 3TW6A 2M8GX 3CCYA 3T5XA 2UUZA 4Y7NJ 1S7OA 1QZZA 1U0JA 3CMAI 2EILH 2CV2A 3CUQA 2D2WA 2M8EA 4O6JA 2X6XA 2LY2A 3CESA 3HUGB 2ZJ2A 3PM1A 4XN3A 1YX3A 3PIOF 4UB8C 1EH8A 5GTHC 3GLXA 5J1YA 4A3CJ 2V1DA 4I6ZA 2HI3A 3E6BA 2IS2A 1ZK8A 2ZJRF 5K1YA 4WWCA 3JTHA 4YEJA 1T08B 1E3OC 2O8KA 4I0AA 1SD5A 2FNAA 4BNCA 2L0KA 4Q5SF 1JHFA 2Q2EB 3ASNH 1MMNA 1R58A 3H5RA 3K10A 4S04A 5FRNA 2QLZA 2ZFUA 1I3AA 2EINH 3M7GA 3OYFA 4KISA 4MQVA 2LKXA 2L7ZA 5GP9A 2IEKA 4X0GA 2DLLA 4KIGA 4M6XA 4A2UA 3K1MA 3R0JA 5F6FA 2R7ZJ 1SVOA 3S15J 4I02A 2WB1N 1OCRH 2QWWA 4PJ0C 2M7AA 3GWZA 4N4NB 4E7LA 4DOZA 2JPCA 4Y15A 4EJOA 3I0TA 1X4PA 1PYVA 3RYPA 5LRSA 2HVRA 4XRFA 4LFUA 1XMKA 3ZQFA 4EM0B 1KYWA 4A3FJ 1HC8A 4CCJA 4J01A 3E3VA 4M3BA 3R4KA 1H9GA 1I1SA 2XPWA 2JUGA 3Q9SA 4EM1A 5M5YJ 1I1GA 5H6RA 3OSFA 4ZYGA 4XNFA 3BPVA 3N97A 3CJRB 2H09A 1T95A 2ETHA 5B1BH 1QPMA 3ZP5A 1DQUA 3RQIA 1MBJA 3IH2A 5KVRA 3OS0A 2KHMA 2NVUB 5D8LB 2CUFA 4Y3OA 1U6GA 4DYQA 3RJPA 2JQ7A 3BZCA 5LHIA 2G7UA 3S1MJ 3CQZJ 1TQPA 3ABKH 3FKJA 2DQLA 1USTA 1JTXA 1TC3C 5EEAA 3P9KA 3QPTA 1FY7A 4S05A 2IS6A 3VOEA 3E5XA 1SEUA 3RPUD 3F8MA 2TRTA 4G7HF 2XAUA 1BJZA 3J80Z 2HOSA 3IUOA 1X1CA 2RREA 1DU0A 4HA8A 2XSDC 1GDTA 3GTOJ 4CGZA 2VOOA 3MEXA 4QPOA 1YI2I 3BTIA 4AIKA 4OIOF 1R4NB 1Y0UA 1AU7A 1UJ8A 3BQZA 2X1CA 3LSIA 4IRIA 2E7WA 1V4RA 3ZGKA 2EIMH 3KYLA 2EB7A 2OCCH 3VFZA 3DKXA 2M2EA 1GV5A 2ELKA 1VQ9I 2FD5A 5FFXA 1R5GA 1HSTA 2IP2A 3GFLA 5J1RA 3OY9A 3S3MA 3G2BA 4HRIA 1SANA 2HDDA 3CCQI 5DDGA 2BBYA 5D8KB 3J7ZI 2PLYA 3KEQA 3KZIC 4FCYA 1GHCA 4XQFA 2V4JC 1OYWA 3OYKA 1U8RA 1IAWA 3PNYA 1QZEA 3F6VA 2X6WA 3Q5FA 2X6YA 1H8AC 1I3QJ 1D8JA 2DFEA 4KIFA 3WGGA 3GFIA 1Y1WJ 4U0YA 4A3BJ 4WX9A 1W5CC 1A31A 3S1QJ 4UV8A 2DCEA 1HCRA 2LOOA 2P5KA 4PSWA 3F8NA 3J80K 2ZC2A 2ZNZA 4PDKA 1GXPA 4HLXA 2HVSA 2CO5A 2V79A 5BNGA 2DA1A 3BY6A 3HXLA 2OZ6A 1ZYRF 2YPRA 5M3FJ 3K70D 2FXAA 1P4WA 1ZN2A 2PN6A 2Y0SN 1HQCA 3QP6A 2PJRB 2L02A 3HTUA 3P7NA 3EUAA 3AG1H 3FMQA 3OR2C 3CCMI 2ZMEC 1VQNI 2HXOA 4DQ2A 4JP0A 2QF7A 1XTAA 3H9JA 1V5EA 1BJAA 2IGNA 3PO2J 1B8IA 2WAFA 1S72I 5CVVA 4BUPA 1U8BA 3LMMA 3RSNA 2E71A 4A3EJ 1PJRA 1U2WA 1N78A 1ZR4A 1T38A 3FMRA 2QBYB 3GF2A 4OAZA 2CQ7A 4AVPA 1JGSA 3CMEI 3WTXC 3EYYA 1IO2A 2Z1DA 1R00A 5LRRA 3L1PA 3MZHA 3SZPA 1A04A 1S5LC 1J0RA 4AIHA 2RDPA 2FMLA 4Y52J 5CKTA 4BDYA 1EA3A 1XC5A 1FZPB 4M9SA 2VQLA 3ZR8X 4BE1A 2QSHX 1IRXA 3LSPA 1NG6A 2HS5A 1D0YA 4V2FA 5DCMB 4WXHA 4RAGA 2MLKA 1YTYA 1BW5A 3JTGA 3DTEA 4JOMA 4HX8A 1Z21A 4D9JA 2DQRA 3HJEA 3OOUA 4DYCA 3KP2A 1LUJB 1N25A 3TP0A 3MFKA 2E7XA 3L00A 4A12A 5DD4A 2OUMA 1FMWA 1A6QA 2Z5UA 3LOCA 3TKYA 3CJTB 2V9PA 2ID6A 2H1KA 2XIGA 3Q9VA 3IC7A 4HAMA 2CGPA 5ED4A 2XUBA 3QU3A 3S17J 1XSVA 2HYJA 3BDDA 2Q2EA 4XONA 5ICGA 1ZARA 4BKXA 1OMIA 2BGCA 4BBSJ 4LMYA 4XM3A 1JUMA 4N9IA 4ZDLA 2Y9YA 1OCZH 3KLOA 1ZG5A 4M6YA 4KUMA 4LLGF 3ZMSA 1UG2A 2M9HA 1O3RA 1XMAA 1MNMC 5KK1A 4CDGA 5FKNA 5LHHA 3FKIJ 2ISYA 3WG7H 3ZQHA 3L9FA 1XSXA 4IZZA 3GLLA 3ZQIA 2R7SA 2W84A 4HEA2 2EA2A 2R7QA 4RLQA 3ASOH 5FKKA 1G6NA 3H92A 3IL2A 4L9VA 2VL8A 1UFMA 2KLOA 4CCMA 2IPQX 3BG6A 5J6XA 2KIFA 3I9V2 3COAC 2KMUA 2V1NA 1IRFA 3DP7A 2L9RA 5EG0B 3OYMA 3CUOA 4G7OF 5HOOA 3OIPA 1BIAA 2V26A 3ZOBA 1OYYA 5IT9Z 2MH2A 1Z6TA 1OISA 1HW5A 3FHZA 4LIVA 1VFCA 2CYYA 2VPRA 4F3QA 3K6GA 2AXLA 1K7AA 1OR7A 1K4TA 2EFOA 4GYIA 1VNDA 1XCBA 1QQIA 1O7FA 4B44A 2XAGA 3JRFA 1U5TA 5J4YA 2F2EA 5GTIC 1NK2P 5CQEA 5AONA 2ECBA 3HM5A 3ONQA 3BR2A 1T56A 2BEOA 5B5EC 1ZELA 5HS7A 4IQJA 1KONA 3LNQA 1JGGA 4DNCA 1BN5A 4KICA 4AIDA 3BG5A 3JRAA 2B7EA 4XRSA 4A69C 1WJBA 2GOXB 1SD4A 1XGNA 1P7IA 2X4HA 3K70C 3PFYA 5J8CA 3W2VA 1E2XA 1J75A 2KIMA 2LFBA 4M73A 2RC4A 1IN5A 4ZH4F 3R61A 3TMOA 4PGGA 4XRMA 2V9KA 2FMYA 1W1WE 2K86A 3QAHA 3VYRB 4BDZA 4GDFA 4IHWA 2M7BA 5IT9K 1BA5A 3V4GA 3MKLA 2LBFA 1FSEA 5J4VA 1CF7A 4XIDA 4EJUA 3CD6I 1VQMI 3M1EA 1MBGA 3M1CA 4A0XA 2DMPA 5FLVA 5FGMA 1IN6A 2EIJH 2WV0A 4IQ4A 1WGXA 1T98A 2HQRA 4J19A 2CUEA 3BLYA 2E60A 4XN0A 2CQXA 2XF7A 5FKMA 5HDGA 2HVQA 4EGZA 4RGRA 2O03A 3H35A 3F6OA 4A3MJ 1LB2A 1EJ9A 3WTZA 1HOMA 2QKMB 2MD5A 3OL3A 3BZ6A 4KT6A 2JA7J 1HDPA 2R3SA 2KQRA 3GUDA 4YG2F 5KNLA 4ENKA 2MYSA 3KPHA 3KE2A 4RAYA 1PP8F 1RI7A 4ZC3A 3WU1B 2DTZA 2P0WA 4HF1A 2NAZA 4BJ5C 4HQMA 3VPRA 2VB6A 3FXRA 2DJNA 2X9DA 1S8NA 5C44J 3MKZA 4FX4A 2V9VA 2KZVA 4BXUA 5E3MA 2XKOA 3QPSA 3IH4A 2G9WA 4JX6A 4HLYA 3N05A 3GZNB 3O8GA 1MJAA 2M3AA 2TDXA 1J09A 5DD8A 3WU2C 3N4MA 4A3KJ 3TO9A 2CQNA 4KIBA 2CH0A 4YFXF 2F4MB 2HEOA 1E3HA 1MD0A 1KU3A 2KRHA 2WA0A 3E5UA 3H5NA 2JK3A 3AG4H 1PP7U 1R4MB 5JFRA 1IRZA 4QWQA 3MZ8A 2AQFA 4CSWA 3ZMDA 3CMMA 5DCMA 4ITVA 2EV6A 1ORKA 2L54A 5JHFA 2VBXA 1Y8RB 3LFKA 2ZB9A 4FX0A 2UZKA 2HPMA 4AC0A 1X3ZB 4U87A 3MD2A 3MWMA 4IHSA 5IOYA 2PMHA 2ZXIA 3PQJA 1TW3A 3EUKL 3L2UA 2HWVA 1W7PD 4NQWA 2BZTA 2JRTA 3LSJA 1XX5A 2HYFA 2STWA 3SZGA 1WPKA 2FBHA 4HYEA 3V7RA 5CPRB 3EYIA 1MIJA 2LF8A 1P6RA 1IV6A 3HZJA 4CCLA 4CCKA 3TO6A 3HL2A 1H88C 2W7NA 1TWCJ 3R0AA 3CCLI 2CFXA 1MZBA 1ZGAA 3U21A 1SMTA 3A0HC 2J5PA 3W6JB 3FX3A 4PFOA 4KN4X 2R7VA 2NS7A 1QBJA 3M4OJ 1R22A 2XRLA 2NS8A 4FQGA 1L3LA 4CXFA 2X0LA 3FMSA 2FRHA 4XSZF 3U1DA 3PJRA 2BY0A 1X58A 4WCGA 3H3ZA 1YOVB 4BS9A 2DBBA 2ZBKA 1XN7A 3ZMZA 4K2EA 3BR3A 1BOAA 4IPAA 4L5IA 4D5FA 3KYDB 4BXFA 5FD5A 4BHPA 3GTLJ 3M3YJ 3B73A 5TGTA 4EQQA 1HKTA 3KEOA 2VKDA 4B48A 4YIFA 2DA6A 3VSKA 1AHDP 1D0ZA 3VWBA 1IRGA 4G8XA 4MGRA 4HDUA 3WTUC 3BCBA 2IBDA 1IXCA 3O3KA 1TLHB 3E97A 2H27A 3OSGA 1E0EA 1RKWA 5F64A 3MN2A 2BXZA 3TOAA 1SMYF 2E1OA 2VQGA 2IT0A 3BG3A 1TT5B 3PUBA 5L3FA 5ILSA 1T33A 3AL0B 3BOQA 2L9SA 2JWTA 1QA6A 4A3DJ 1W0TA 1LVAA 1OKRA 1FYLA 3PNTA 4OAYA 5BMZA 2H1LA 2ZNYA 3DFGA 4IHYA 1WH7A 1R36A 1G4DA 4M3DA 3OV8A 2CW7A 2W1OA 1ETVA 4B4CA 1TQMA 1E3PA 3EQLF 3FISA 5EJCA 2ELJA 2KJBA 1XS9A 3WTYC 2LTPA 3E6CC 2LKPA 3GZ6A 4HBLA 4W97A 5HNFA 2GIVA 2K5CA 1SAXA 4L18B 3BTLA 4E7ZA 3BPXA 3BT9A 2PBIA 5ILUA 1AKHA 3BP8A 2JT1A 2EV0A 1DPUA 1MNDA 5D6FA 2WAEA 2VJ5A 2D45A 2X51A 2LRDA 2KRCA 1ZHFA 5C4XJ 3QP5A 2BY2A 4RLFA 4D7MA 4ZZLA 2JZYA 2BXYA 2CRGA 2NVTJ 3MZYA 2VE9A 3DEWA 5LD2C 1ETWA 1IC8A 2HU9A 2QEXI 1Z3XA 2L3DA 4IXAA 3M07A 2VXZA 3RI4A 2BW3A 4NDLA 1GLNA 1LFPA 5EF6A 1R7JA 2GA1A 1PVEA 3Q3SA 5L3DA 1T39A 1ITYA 4A93J 4OMZA 4NNJA 2K9MA 3U1KA 4F92B 2L4MA 2H8RA 4RAZA 1MH4A 1U9NA 2W4SA 2K9QA 1UHSA 4PJLA 2DOEA 2UXNA 4PCQA 1R23A 3OYLA 1YJWI 5J40A 4L5JA 4ZYHA 4RB3C 3H36A 4I2OA 4L9TA 3HRSA 3K1NA 2QSGX 3K4JA 5HLIA 4P9UA 3IRQA 4UV9A 3C2BA 4EJVA 3ABUA 1Z91A 3LQQA 3HSFA 1BR2A 3GTQJ 1DGRM 2P4WA 2E1MB 1RIOH 1NH3A 4MEXF 3IH3A 2K4BA 2LC2A 3TGNA 1VTNC 3NQOA 5K5OA 2O6GE 1F4KA 1LFBA 4JX5A 2JSPA 1MBHA 1NTCA 2CW8A 1O3TA 2R92J 1D0XA 2XAHA 2UV1A 4KITB 3B02A 2MH9A 1UHMA 2DW4A 1TQIA 2EBIA 4B1RA 5JHUA 1B4AA 3P5JA 2ADUA 3JAMK 1LEAA 3RDIA 3HPHA 2AQEA 2HFHA 2BHZA 4GO1A 3K4MA 2LH9A 1HW1A 4AD9A 1DP3A 5JVGF 1MDMA 1ZH5A 3Q0VA 4B3AA 3HG9A 3DQVC 4XLAA 4QPQA 5IYCJ 5EEGA 1G3TA 1MGTA 3SHFA 4ZYDA 1WJCA 2IS1A 3TL4X 1P9QC 3QU6A 1KU9A 3VEPA 1JT0A 1JJ8C 4PSXA 1FTTA 2M5WA 1LQ1A 1STZA 2KZGA 1B59A 3F0CA 1F1ZA 2IXSA 2E2IJ 3QYBA 1GT0C 3DTKA 4FETA 2MW8A 5M3MJ 3CCEI 2LG4A 2Y69H 4UVCA 2R7XA 1WJEA 2PMUA 5E8IA 4UUTA 3TW7A 3LL7A 4BY1J 4JBAA 1FT9A 1WVRA 2V6EA 3BG9A 2FEZA 4HV6A 2HQAA 4DIQA 1J5YA 5EDNA 4RM2A 4U7DA 1WJAA 3BJOA 3CCVI 2PFBA 2P5LC 3S1RJ 2OA4A 1YW8A 5CVRA 3T8TA 2JUCA 2XAFA 5LGUA 4UVAA 4DBQA 2F5DA 4XBFA 1ZAOA 2V6CA 2ZO4A 3K4BA 1FYKA 5DCFA 3WHBA 2DXIA 5E17F 3CCSI 4OINF 1TNSA 1YLFA 2VJ4A 2F5FA 3FXQA 3F22A 3IWFA 1Q1VA 2P81A 5D4SA 2WTEA 5AIPA 1U5TB 2QYOA 4CZCA 1K78B 5HDKA 2CSOA 2GOMA 2WY7Q 2R7TA 2AO9A 2YU9J 4A3GJ 3ISPA 2PI0A 3DTIA 2V7FA 4C9YA 2KISA 3IRRA 1JJ6C 2WADA 2MLGA 5EYRA 1X4OA 5F1RA 2DPUA 2A68F 1QNTA 2E5NA 4DGWB 1D5YA 4N0BA 2N8GA 1VQ7I 2XSJC 2YX4A 1X1AA 5L3EA 1FC3A 3MMYB 4UVBA 1I39A 3ZMUA 2RKHA 1S9HA 3D1NI 1WFXA 3QPLA 1KYZA 4M71A 1OQYA
chains in the Genus database with same CATH topology
3CJNA 3P9IA 2CWEA 4TV7A 2J5OA 1V3FA 5LLQA 2O61A 1XSDA 5FLXZ 4GCVA 1CF7B 1LDKB 4OOIA 3RPUA 1ODDA 2QM3A 4ZYEA 3T8RA 1SD7A 5DYMA 3DPTA 4Q47A 2M45A 2P7CB 2P6TA 3BWGA 1B1BA 3M8FA 3HSEA 1R5HA 1YW7A 3T0YA 1BIBA 3GXOA 1FSHA 2KIUA 5CJ9A 2BE5F 3KFWX 2HTJA 2R7FA 4NHJA 4EJWA 2IA0A 2XVCA 3CUQC 1LEBA 3I4PA 2O0YA 3ERED 2STTA 3V7SA 1BI3A 1X3UA 3HOSA 3V8JA 5FLXK 5D5WB 2H6BA 1SFUA 1IN7A 2JPBA 1FBQA 2VONA 4PZJA 4OMYA 3DKWA 1S6LA 1MKMA 3DF8A 1P4AA 2DI3A 4EM2A 1ZLKA 3HYIA 3BROA 5D6EA 4A0ZA 2FQ3A 1B6AA 2VBZA 2Q0OA 5HS8A 1XDUA 2EV5A 4KMFA 2VOPA 1W4MA 1ZGJA 2A6HF 3JSOA 2HR3A 4MTEA 3GVAA 3LWFA 1D3YA 4Z2YA 4KYWA 4GXOA 3IKTA 4BH9A 4F7ZA 2BYVE 4LG0A 4B09A 1TNTA 1Z05A 5ICFA 3ELKA 3LQRA 4Q4ZF 6PAXA 3GZ5A 2Z99A 2IJLA 4P55A 1J59A 2ESNA 1W7PB 1XGSA 4M9ZA 2GWRA 3DXJF 1IW7F 4CZZA 5L3GA 3LA7A 2IRFG 2DTRA 3FZVA 1UHWA 4IJAA 4CICA 3W6KB 1W5TA 3HSRA 3F21A 4H0EA 4PGHA 4CO8A 2ZXJA 3TOBA 5E8GA 5CLSA 3O6BB 2VBWA 3L2CA 1ZLJA 4I0BA 3F8FA 1XDSA 3CTAA 1GXQA 1K78A 4LGWA 4LLNA 4LJZF 4E70A 1ZRDA 3D5LA 3E6MA 3J7AO 2W25A 4B8XA 2Z9OA 1USSA 2F5EA 3G73A 2QQAA 1KU7A 4BHCA 5JI6A 3WTTC 5HS9A 3V8KA 2RN7A 3ZMTA 1HXDA 1B9MA 1UCRA 1Z7UA 1AWCA 4G94A 5L3BA 5DEQA 1IZ1A 3KCCA 3GW2A 2OAZA 5LGNA 1LDJA 3NRVA 1FX7A 2Z3YA 2BV6A 2QUFA 4KMUX 1RZ4A 2GXBA 4U88A 1YS7A 2VBYA 1W5SA 1U3EM 1XD7A 5D5VB 1BM9A 1DDNA 4IHTA 4XSXF 2EWNA 2UXXA 3EETA 5ICEA 2D1VA 4OIRF 2Y75A 3E6DA 2GA2A 2ZMEB 4KDPA 4XLNF 5K5RA 3RIRA 3WU0A 5ICCA 1MDMB 3F8BA 2VC1A 5A2QZ 2DFIA 4ON0A 1Z9CA 4LLLA 2RV8A 4KA4A 3F23A 3K1PA 4KT5C 1FPQA 2KRFA 2C6YA 4R1HA 3IHUA 2O8XA 4Y13A 2QZ8A 2HKOA 4M74A 3K2ZA 2QENA 4I09A 3F8CA 5FB2A 3LAJA 1H9TA 1PUEE 4N9HA 2WWYA 2FA5A 4UHTA 3WTSC 1FBSA 4RGSA 3RKYA 2HGCA 1YIOA 1D8KA 1FBUA 3ZN0A 4EVIA 5A2QK 1Q1HA 1I27A 4Y17A 1W7PA 4GYGA 2XHKA 2HDCA 1EH7A 2FOKA 5BQTA 1OYIA 4RGUA 1J2XA 1I6XA 2EFPA 1L0OC 4FT8A 3DV8A 1SFEA 4ENMA 3V7CA 4JQFA 3I5UA 1IXSB 4CYDA 1HSJA 2OQGA 2A3SA 1O7LA 2W85A 3HRUA 3HTSB 3DPLC 1HBXG 3LAPA 4KNYA 3GFJA 2O3FA 4MHGA 3P9CA 2GXGA 2QVOA 1R1TA 2FBIA 2M87A 3L7WA 4A0YA 3BJ6A 3M8EA 4HZFA 4IRHA 4ENNA 2K27A 2A5YB 3HHGA 2QQ9A 4WXCA 1JXSA 3CDHA 1H0MA 3F3XA 2LSOA 4O5VA 4M72A 2V1UA 2HTSA 3FM5A 4I7HA 3GFMA 3CO7C 3JW4A 1P92A 3L09A 1P2FA 3SXYA 1IUYA 5J8FA 3IKVA 4IVNA 4MEYF 3WE3A 1IF1A 3I59A 5BPIA 1AOYA 1T6SA 5LEKA 4RS8A 1JE8A 2QQBA 2H94A 4LB6B 4XLPF 3C18A 1F5TA 2JTVA 4R8HA 4LB5A 4G6QA 1HKSA 3LA3A 2VT2A 2DK5A 2HOEA 2KKOA 4U0WA 3FF5A 3RYRA 1S3JA 1YFHA 1O57A 2DT5A 2DK8A 2K02A 4YFKF 4EMSA 1XCVA 4P5OA 2ZMEA 4G9YA 3ECHA 4Q48A 1R1UA 4LG0B 2YR2A 2PEXA 4EV0A 5JR3A 2NNNA 3HOTA 1QO0D 3C1DA 5LBQA 1IXRC 3CO6C 3I64A 1C0WA 3I53A 1G3YA 2COMA 2IVMA 2FBKA 4WF2A 1D5VA 3GEZA 2OBPA 5DUKA 4OIPF 2VE8A 3ZN1A 4HF2A 4BHBA 1LDDA 5L3CA 2FU4A 5CYVA 2NRAC 3HRTA 3CLOA 3E5QA 2CW0F 5EEHA 1K79A 1IN8A 4AWXB 1B9NA 2EFQA 4A5MA 3K69A 5H20A 4LD5A 4HV5A 5AIQA 5TJJA 2NS0A 1GVJA 4P96A 2YX7A 3RKWA 4LK0F 3ABTA 3PQKA 1NHAA 1FOKA 2OZUA 2VN2A 1LJ9A 2A61A 3QOPA 4UNOA 2R7DA 3S2WA 3HHHA 3TDUC 1KQ8A 2Z33A 5FD6A 1FNNA 1HW2A 3ML6A 1JHHA 2XKPA 1E17A 3M9AA 2F5CA 1XGMA 1ZRFA 2CQKA 2Q8KA 1SFXA 2LDUA 4HQEA 5CVJA 2MBFA 3MAJA 1Z1DA 1TW2A 2XAQA 4MQ9F 2YU3A 1FP2A 2DU9A 4A5NA 3K9TA 2DAOA 1BBYA 4HOBA 1BI2A 4RB0A 1T0FA 4A6DA 4M9XA 4MNUA 3WG9A 1HKQA 3KLNA 3QPHA 1RUNA 3MQ0A 1XGOA 1ZG1A 4P9FA 3WTVC 4HW0A 2RVCA 2ELHA 1TBXA 2MC3A 1ON2A 1WWXA 1O3SA 3SFZA 3WGHA 2IA2A 4WXDA 3PFIA 4G6DA 1I5ZA 3KETA 1KQ9A 3QRFF 2OU2A 4NB5A 4OU0A 3R60A 3BJAA 4A6EA 3U9GA 2DO7A 3KP5A 2FNPA 2W24A 2CG4A 3FM3A 3WODF 4EGYA 2VT3A 2RNJA 5ERIA 2Y48A 2EFNA 4ETSA 4RB2C 3HUGA 1KQ0A 2ZCWA 1KU2A 1YYVA 1SD6A 5FO5A 1YG2A 3HRMA 2PQ8A 4CHUA 2L01A 1S29A 2HZTA 1MJBA 2P7VB 2GAUA 1PDNC 3TQNA 1BI1A 4FHTA 2EA4A 2G7HA 5JVTA 2LF7A 2FE3A 3HIFA 5TRDA 4GGGA 4HX7A 3ZQ7A 5ILVA 2K7LA 5DUIA 2L4AA 3TO7A 2IW5A 5CVIA 2HQNA 3JSPA 2XGXA 5E20A 1EV7A 1YS6A 2VODA 4ESFA 1ZG3A 1TTYA 3V8LA 5BPDA 3AAFA 4U0VA 1ONVA 2HYGD 4RGXA 3GYHX 3GO5A 4R79A 3SZTA 3WE2A 5D4RA 1YQAA 5HLHA 4D0PA 1G3WA 1CGPA 2DPDA 5LEJA 4QLCU 1RNLA 1UB9A 4IF4A 1DP7P 4UXNA 2P6SA 1Z6RA 3FWEA 2RGVA 2FSWA 3T1BA 2LNBA 1ULYA 2FF4A 4I98B 1ZRCA 2OD5A 4EJTA 2EK5A 2YSRA 4ESBA 3K0LA 2GZWA 4WK8F 4JK1X 2D1HA 4ASNA 5FFZA 2H6CA 2NNYA 1T2KA 3EUHA 2XROA 3I59B 4MTDA 3WGIA 4HX4A 2Y0MA 1FLIA 2IA1A 3KP3A 3C3WA 1YO5C 4RB1A 1FWZA 2ESHA 1BC7C 1DPRA 2P5VA 4BAYA 3U2RA 5E1WA 3I54A 3KZYA 5E1XA 3C7JA 5IT3A 1XB4A 1WSUA 3CUQB 2XV4S 3MCZA 5H6QA 4YIIA 2QBYA 1KGSA 2NYXA 2M30A 2B0LA 2ZKZA 3IWZA 2RQPA 2KJCA 2XASA 3REOA 2UWMA 1BI0A 4KFCA 3J81Z 3NEUA 2EFWA 5BS6A 1WRJA 3F72A 2PJPA 4U7BA 1FYMA 4HF0A 4L9NA 2V1XA 4LK1F 1K6OA 2WC2A 2K4JA 1QGPA 4UUVA 3I58A 3FXUA 3TDZC 1J7KA 2PG4A 4L9JA 2ZFWA 1DUXC 2HKXA 1U5TC 3DEUA 4BQAA 1LNWA 4L0ZB 2MA3A 4ESJA 2E1NA 3SQNA 1BC8C 4G7ZF 1ZREA 5D5XB 4I01A 2P8TA 3J81K 1S7AA 3KP7A 4OIQF 2A07F 1KA8A 1WQ2A 3O2PE 2ACJA 3LA2A 2EJRA 3RTRA 1ON1A 1YW9A 3KZZA 1J9IA 3RPQA 4AIJA 1P4XA 5CVUA 5D5UB 2W57A 3D0SA 2XRNA 3G3ZA 1R1VA 5DV5A 3ZMVA 1F9NA 3GX4X 4ENJA 1EH6A 5K5QA 1WKMA 2AS5F 5HVQC 3RKXA 5E18F 4YFNF 3LSTA 2XAJA 1QZYA 3ECOA 2GQQA 4L0YB 5E1ZB 2A6EF 4IRGA 3EDPA 3R6SA 1G3SA 2A69F 4HDVA 2VC0A 1RUOA 2E1CA 1REPC 5LHGA 3VB2A 2ISZA 2JSCA 5BOXA 1WI9A 3ULQB 5HLGA 5LGTA 1OPCA 2M1BA 4O3MA 3ROUA 5HDNA 4KN7X 3KP4A 1FP1D 3VODA 1O3QA 3KP6A 4ZZDA 3H3UA 3I71A 3JAMZ 3OOPA 4BYYA 2OQRA 1IN4A 1MJ9A 3ZPLA 3WTWC 1U78A 3T5XA 1S7OA 1QZZA 3CUQA 2D2WA 2M8EA 4O6JA 2ZJ2A 1EH8A 3GLXA 2V1DA 3E6BA 5K1YA 4WWCA 3JTHA 4I0AA 1SD5A 2FNAA 4BNCA 4Q5SF 1JHFA 1R58A 4S04A 2QLZA 3M7GA 4MQVA 2DLLA 4KIGA 4M6XA 4A2UA 3K1MA 3R0JA 5F6FA 4I02A 2QWWA 3GWZA 2JPCA 4Y15A 4EJOA 3I0TA 3RYPA 5LRSA 4XRFA 4LFUA 1XMKA 4EM0B 1KYWA 3E3VA 3R4KA 1H9GA 1I1SA 3Q9SA 4EM1A 1I1GA 5H6RA 4ZYGA 3BPVA 3N97A 2H09A 2ETHA 1QPMA 3ZP5A 5KVRA 5D8LB 1U6GA 3RJPA 5LHIA 2G7UA 1TQPA 2DQLA 1USTA 3P9KA 3QPTA 1FY7A 4S05A 3VOEA 3E5XA 3F8MA 4G7HF 3J80Z 4HA8A 4CGZA 2VOOA 3MEXA 4AIKA 4OIOF 1Y0UA 4IRIA 2E7WA 1V4RA 2EB7A 3VFZA 5FFXA 1R5GA 1HSTA 2IP2A 3GFLA 5DDGA 2BBYA 5D8KB 2PLYA 3KEQA 1GHCA 1OYWA 1U8RA 1IAWA 3F6VA 3Q5FA 1D8JA 4KIFA 3WGGA 3GFIA 4U0YA 4WX9A 4UV8A 2P5KA 3J80K 3F8NA 2ZNZA 4PDKA 1GXPA 4HLXA 2CO5A 2V79A 3BY6A 2OZ6A 1ZYRF 2YPRA 2FXAA 1P4WA 1ZN2A 2PN6A 1HQCA 3QP6A 2L02A 3HTUA 3P7NA 3FMQA 4DQ2A 1BJAA 5CVVA 1U2WA 1T38A 3FMRA 2QBYB 3GF2A 4AVPA 1JGSA 3WTXC 3EYYA 1R00A 5LRRA 3MZHA 3SZPA 1A04A 1J0RA 4AIHA 2RDPA 2FMLA 1FZPB 4M9SA 2HS5A 5DCMB 4WXHA 2MLKA 1YTYA 3JTGA 4HX8A 2DQRA 3KP2A 3MFKA 2E7XA 3L00A 4A12A 5DD4A 2Z5UA 3TKYA 2XIGA 3Q9VA 3IC7A 4HAMA 2CGPA 5ED4A 2XUBA 3QU3A 1XSVA 3BDDA 5ICGA 2Q2EA 1ZARA 1OMIA 2BGCA 4LMYA 4N9IA 3KLOA 1ZG5A 4M6YA 4KUMA 4LLGF 3ZMSA 1O3RA 1XMAA 5KK1A 4CDGA 5LHHA 2ISYA 3L9FA 1XSXA 2W84A 2EA2A 1G6NA 3H92A 3IL2A 4L9VA 1UFMA 2IPQX 5J6XA 2KIFA 3COAC 1IRFA 3DP7A 3CUOA 4G7OF 5HOOA 1BIAA 1OYYA 5IT9Z 2MH2A 1Z6TA 1HW5A 3FHZA 2CYYA 2AXLA 1K7AA 1OR7A 2EFOA 4GYIA 1XCBA 1QQIA 1O7FA 2XAGA 1U5TA 2F2EA 5AONA 2BEOA 5HS7A 4DNCA 1BN5A 4KICA 1SD4A 1XGNA 2X4HA 5J8CA 1E2XA 1J75A 2KIMA 4M73A 2RC4A 1IN5A 4ZH4F 3R61A 4PGGA 2FMYA 2K86A 3QAHA 5IT9K 3V4GA 1CF7A 1FSEA 4EJUA 3M1EA 4A0XA 5FGMA 1IN6A 2WV0A 1T98A 2HQRA 5HDGA 4EGZA 4RGRA 2O03A 3F6OA 1LB2A 3WTZA 2MD5A 3BZ6A 4YG2F 2R3SA 3GUDA 4ENKA 3KE2A 4RAYA 1PP8F 1RI7A 3WU1B 4HF1A 2NAZA 4HQMA 3FXRA 1S8NA 4FX4A 2V9VA 4BXUA 2XKOA 2G9WA 4HLYA 1MJAA 2TDXA 5DD8A 3N4MA 3TO9A 4KIBA 4YFXF 2HEOA 1MD0A 1KU3A 3E5UA 1PP7U 5JFRA 4QWQA 3ZMDA 5DCMA 2EV6A 2L54A 2VBXA 4FX0A 3LFKA 2UZKA 3MWMA 4IHSA 2PMHA 3PQJA 1TW3A 2HWVA 1W7PD 4NQWA 2JRTA 2HYFA 2STWA 2FBHA 4HYEA 3V7RA 3EYIA 2LF8A 1P6RA 3TO6A 3R0AA 2CFXA 1MZBA 1ZGAA 1SMTA 2J5PA 3W6JB 3FX3A 4KN4X 1QBJA 1R22A 1L3LA 4CXFA 2X0LA 3FMSA 2FRHA 4XSZF 3U1DA 4WCGA 3H3ZA 2DBBA 2ZBKA 1XN7A 3ZMZA 4K2EA 1BOAA 4IPAA 4L5IA 5FD5A 4BHPA 3B73A 4EQQA 1HKTA 3KEOA 4YIFA 1IRGA 4G8XA 4MGRA 4HDUA 3WTUC 1IXCA 3O3KA 1TLHB 3E97A 2H27A 5F64A 3TOAA 1SMYF 2IT0A 5L3FA 5ILSA 3BOQA 1LVAA 1OKRA 1FYLA 5BMZA 2ZNYA 3DFGA 1R36A 1G4DA 3OV8A 1TQMA 3EQLF 2KJBA 3WTYC 3E6CC 2LKPA 3GZ6A 4HBLA 2GIVA 1SAXA 4L18B 3BPXA 2PBIA 5ILUA 3BP8A 2JT1A 2EV0A 1DPUA 5D6FA 2D45A 1ZHFA 3QP5A 4ZZLA 2JZYA 3MZYA 2VE9A 2L3DA 4IXAA 2VXZA 3RI4A 1R7JA 2GA1A 5L3DA 1T39A 4OMZA 2L4MA 4RAZA 2UXNA 4PCQA 1R23A 4L5JA 4ZYHA 4RB3C 4I2OA 4L9TA 3HRSA 3K1NA 5HLIA 3IRQA 4P9UA 4UV9A 4EJVA 3ABUA 1Z91A 3LQQA 3HSFA 2P4WA 1RIOH 4MEXF 2K4BA 3TGNA 1VTNC 3NQOA 5K5OA 2O6GE 1F4KA 1O3TA 2XAHA 3B02A 2MH9A 1UHMA 2DW4A 1TQIA 5JHUA 1B4AA 2ADUA 3JAMK 1LEAA 3RDIA 2HFHA 4GO1A 1HW1A 4AD9A 1MDMA 1ZH5A 3DQVC 4ZYDA 1G3TA 1MGTA 5EEGA 3SHFA 3QU6A 1KU9A 3VEPA 2M5WA 1LQ1A 1STZA 1B59A 1F1ZA 4UVCA 2PMUA 5E8IA 4JBAA 1FT9A 2FEZA 4HV6A 1J5YA 4U7DA 3BJOA 2P5LC 2PFBA 2OA4A 1YW8A 5CVRA 3T8TA 2XAFA 5LGUA 4UVAA 2F5DA 4XBFA 1ZAOA 2V6CA 2ZO4A 1FYKA 5DCFA 5E17F 4OINF 1TNSA 1YLFA 2F5FA 3FXQA 3F22A 3IWFA 5D4SA 2WTEA 5AIPA 1U5TB 2QYOA 1K78B 5HDKA 2CSOA 3ISPA 2PI0A 3IRRA 2MLGA 2DPUA 5F1RA 2A68F 1QNTA 4N0BA 2YX4A 5L3EA 1FC3A 3ZMUA 4UVBA 2RKHA 4M71A 1KYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJN A;  3P9I A;  2CWE A;  4TV7 A;  2J5O A;  1V3F A;  5LLQ A;  2O61 A;  1XSD A;  5FLX Z;  4GCV A;  1CF7 B;  1LDK B;  4OOI A;  3RPU A;  1ODD A;  2QM3 A;  4ZYE A;  3T8R A;  1SD7 A;  5DYM A;  3DPT A;  4Q47 A;  2M45 A;  2P7C B;  2P6T A;  3BWG A;  1B1B A;  3M8F A;  3HSE A;  1R5H A;  1YW7 A;  3T0Y A;  1BIB A;  3GXO A;  1FSH A;  2KIU A;  5CJ9 A;  2BE5 F;  3KFW X;  2HTJ A;  2R7F A;  4NHJ A;  4EJW A;  2IA0 A;  2XVC A;  3CUQ C;  1LEB A;  3I4P A;  2O0Y A;  3ERE D;  2STT A;  3V7S A;  1BI3 A;  1X3U A;  3HOS A;  3V8J A;  5FLX K;  5D5W B;  2H6B A;  1SFU A;  1IN7 A;  2JPB A;  1FBQ A;  2VON A;  4PZJ A;  4OMY A;  3DKW A;  1S6L A;  1MKM A;  3DF8 A;  1P4A A;  2DI3 A;  4EM2 A;  1ZLK A;  3HYI A;  3BRO A;  5D6E A;  4A0Z A;  2FQ3 A;  1B6A A;  2VBZ A;  2Q0O A;  5HS8 A;  1XDU A;  2EV5 A;  4KMF A;  2VOP A;  1W4M A;  1ZGJ A;  2A6H F;  3JSO A;  2HR3 A;  4MTE A;  3GVA A;  3LWF A;  1D3Y A;  4Z2Y A;  4KYW A;  4GXO A;  3IKT A;  4BH9 A;  4F7Z A;  2BYV E;  4LG0 A;  4B09 A;  1TNT A;  1Z05 A;  5ICF A;  3ELK A;  3LQR A;  4Q4Z F;  6PAX A;  3GZ5 A;  2Z99 A;  2IJL A;  4P55 A;  1J59 A;  2ESN A;  1W7P B;  1XGS A;  4M9Z A;  2GWR A;  3DXJ F;  1IW7 F;  4CZZ A;  5L3G A;  3LA7 A;  2IRF G;  2DTR A;  3FZV A;  1UHW A;  4IJA A;  4CIC A;  3W6K B;  1W5T A;  3HSR A;  3F21 A;  4H0E A;  4PGH A;  4CO8 A;  2ZXJ A;  3TOB A;  5E8G A;  5CLS A;  3O6B B;  2VBW A;  3L2C A;  1ZLJ A;  4I0B A;  3F8F A;  1XDS A;  3CTA A;  1GXQ A;  1K78 A;  4LGW A;  4LLN A;  4LJZ F;  4E70 A;  1ZRD A;  3D5L A;  3E6M A;  3J7A O;  2W25 A;  4B8X A;  2Z9O A;  1USS A;  2F5E A;  3G73 A;  2QQA A;  1KU7 A;  4BHC A;  5JI6 A;  3WTT C;  5HS9 A;  3V8K A;  2RN7 A;  3ZMT A;  1HXD A;  1B9M A;  1UCR A;  1Z7U A;  1AWC A;  4G94 A;  5L3B A;  5DEQ A;  1IZ1 A;  3KCC A;  3GW2 A;  2OAZ A;  5LGN A;  1LDJ A;  3NRV A;  1FX7 A;  2Z3Y A;  2BV6 A;  2QUF A;  4KMU X;  1RZ4 A;  2GXB A;  4U88 A;  1YS7 A;  2VBY A;  1W5S A;  1U3E M;  1XD7 A;  5D5V B;  1BM9 A;  1DDN A;  4IHT A;  4XSX F;  2EWN A;  2UXX A;  3EET A;  5ICE A;  2D1V A;  4OIR F;  2Y75 A;  3E6D A;  2GA2 A;  2ZME B;  4KDP A;  4XLN F;  5K5R A;  3RIR A;  3WU0 A;  5ICC A;  1MDM B;  3F8B A;  2VC1 A;  5A2Q Z;  2DFI A;  4ON0 A;  1Z9C A;  4LLL A;  2RV8 A;  4KA4 A;  3F23 A;  3K1P A;  4KT5 C;  1FPQ A;  2KRF A;  2C6Y A;  4R1H A;  3IHU A;  2O8X A;  4Y13 A;  2QZ8 A;  2HKO A;  4M74 A;  3K2Z A;  2QEN A;  4I09 A;  3F8C A;  5FB2 A;  3LAJ A;  1H9T A;  1PUE E;  4N9H A;  2WWY A;  2FA5 A;  4UHT A;  3WTS C;  1FBS A;  4RGS A;  3RKY A;  2HGC A;  1YIO A;  1D8K A;  1FBU A;  3ZN0 A;  4EVI A;  5A2Q K;  1Q1H A;  1I27 A;  4Y17 A;  1W7P A;  4GYG A;  2XHK A;  2HDC A;  1EH7 A;  2FOK A;  5BQT A;  1OYI A;  4RGU A;  1J2X A;  1I6X A;  2EFP A;  1L0O C;  4FT8 A;  3DV8 A;  1SFE A;  4ENM A;  3V7C A;  4JQF A;  3I5U A;  1IXS B;  4CYD A;  1HSJ A;  2OQG A;  2A3S A;  1O7L A;  2W85 A;  3HRU A;  3HTS B;  3DPL C;  1HBX G;  3LAP A;  4KNY A;  3GFJ A;  2O3F A;  4MHG A;  3P9C A;  2GXG A;  2QVO A;  1R1T A;  2FBI A;  2M87 A;  3L7W A;  4A0Y A;  3BJ6 A;  3M8E A;  4HZF A;  4IRH A;  4ENN A;  2K27 A;  2A5Y B;  3HHG A;  2QQ9 A;  4WXC A;  1JXS A;  3CDH A;  1H0M A;  3F3X A;  2LSO A;  4O5V A;  4M72 A;  2V1U A;  2HTS A;  3FM5 A;  4I7H A;  3GFM A;  3CO7 C;  3JW4 A;  1P92 A;  3L09 A;  1P2F A;  3SXY A;  1IUY A;  5J8F A;  3IKV A;  4IVN A;  4MEY F;  3WE3 A;  1IF1 A;  3I59 A;  5BPI A;  1AOY A;  1T6S A;  5LEK A;  4RS8 A;  1JE8 A;  2QQB A;  2H94 A;  4LB6 B;  4XLP F;  3C18 A;  1F5T A;  2JTV A;  4R8H A;  4LB5 A;  4G6Q A;  1HKS A;  3LA3 A;  2VT2 A;  2DK5 A;  2HOE A;  2KKO A;  4U0W A;  3FF5 A;  3RYR A;  1S3J A;  1YFH A;  1O57 A;  2DT5 A;  2DK8 A;  2K02 A;  4YFK F;  4EMS A;  1XCV A;  4P5O A;  2ZME A;  4G9Y A;  3ECH A;  4Q48 A;  1R1U A;  4LG0 B;  2YR2 A;  2PEX A;  4EV0 A;  5JR3 A;  2NNN A;  3HOT A;  1QO0 D;  3C1D A;  5LBQ A;  1IXR C;  3CO6 C;  3I64 A;  1C0W A;  3I53 A;  1G3Y A;  2COM A;  2IVM A;  2FBK A;  4WF2 A;  1D5V A;  3GEZ A;  2OBP A;  5DUK A;  4OIP F;  2VE8 A;  3ZN1 A;  4HF2 A;  4BHB A;  1LDD A;  5L3C A;  2FU4 A;  5CYV A;  2NRA C;  3HRT A;  3CLO A;  3E5Q A;  2CW0 F;  5EEH A;  1K79 A;  1IN8 A;  4AWX B;  1B9N A;  2EFQ A;  4A5M A;  3K69 A;  5H20 A;  4LD5 A;  4HV5 A;  5AIQ A;  5TJJ A;  2NS0 A;  1GVJ A;  4P96 A;  2YX7 A;  3RKW A;  4LK0 F;  3ABT A;  3PQK A;  1NHA A;  1FOK A;  2OZU A;  2VN2 A;  1LJ9 A;  2A61 A;  3QOP A;  4UNO A;  2R7D A;  3S2W A;  3HHH A;  3TDU C;  1KQ8 A;  2Z33 A;  5FD6 A;  1FNN A;  1HW2 A;  3ML6 A;  1JHH A;  2XKP A;  1E17 A;  3M9A A;  2F5C A;  1XGM A;  1ZRF A;  2CQK A;  2Q8K A;  1SFX A;  2LDU A;  4HQE A;  5CVJ A;  2MBF A;  3MAJ A;  1Z1D A;  1TW2 A;  2XAQ A;  4MQ9 F;  2YU3 A;  1FP2 A;  2DU9 A;  4A5N A;  3K9T A;  2DAO A;  1BBY A;  4HOB A;  1BI2 A;  4RB0 A;  1T0F A;  4A6D A;  4M9X A;  4MNU A;  3WG9 A;  1HKQ A;  3KLN A;  3QPH A;  1RUN A;  3MQ0 A;  1XGO A;  1ZG1 A;  4P9F A;  3WTV C;  4HW0 A;  2RVC A;  2ELH A;  1TBX A;  2MC3 A;  1ON2 A;  1WWX A;  1O3S A;  3SFZ A;  3WGH A;  2IA2 A;  4WXD A;  3PFI A;  4G6D A;  1I5Z A;  3KET A;  1KQ9 A;  3QRF F;  2OU2 A;  4NB5 A;  4OU0 A;  3R60 A;  3BJA A;  4A6E A;  3U9G A;  2DO7 A;  3KP5 A;  2FNP A;  2W24 A;  2CG4 A;  3FM3 A;  3WOD F;  4EGY A;  2VT3 A;  2RNJ A;  5ERI A;  2Y48 A;  2EFN A;  4ETS A;  4RB2 C;  3HUG A;  1KQ0 A;  2ZCW A;  1KU2 A;  1YYV A;  1SD6 A;  5FO5 A;  1YG2 A;  3HRM A;  2PQ8 A;  4CHU A;  2L01 A;  1S29 A;  2HZT A;  1MJB A;  2P7V B;  2GAU A;  1PDN C;  3TQN A;  1BI1 A;  4FHT A;  2EA4 A;  2G7H A;  5JVT A;  2LF7 A;  2FE3 A;  3HIF A;  5TRD A;  4GGG A;  4HX7 A;  3ZQ7 A;  5ILV A;  2K7L A;  5DUI A;  2L4A A;  3TO7 A;  2IW5 A;  5CVI A;  2HQN A;  3JSP A;  2XGX A;  5E20 A;  1EV7 A;  1YS6 A;  2VOD A;  4ESF A;  1ZG3 A;  1TTY A;  3V8L A;  5BPD A;  3AAF A;  4U0V A;  1ONV A;  2HYG D;  4RGX A;  3GYH X;  3GO5 A;  4R79 A;  3SZT A;  3WE2 A;  5D4R A;  1YQA A;  5HLH A;  4D0P A;  1G3W A;  1CGP A;  2DPD A;  5LEJ A;  4QLC U;  1RNL A;  1UB9 A;  4IF4 A;  1DP7 P;  4UXN A;  2P6S A;  1Z6R A;  3FWE A;  2RGV A;  2FSW A;  3T1B A;  2LNB A;  1ULY A;  2FF4 A;  4I98 B;  1ZRC A;  2OD5 A;  4EJT A;  2EK5 A;  2YSR A;  4ESB A;  3K0L A;  2GZW A;  4WK8 F;  4JK1 X;  2D1H A;  4ASN A;  5FFZ A;  2H6C A;  2NNY A;  1T2K A;  3EUH A;  2XRO A;  3I59 B;  4MTD A;  3WGI A;  4HX4 A;  2Y0M A;  1FLI A;  2IA1 A;  3KP3 A;  3C3W A;  1YO5 C;  4RB1 A;  1FWZ A;  2ESH A;  1BC7 C;  1DPR A;  2P5V A;  4BAY A;  3U2R A;  5E1W A;  3I54 A;  3KZY A;  5E1X A;  3C7J A;  5IT3 A;  1XB4 A;  1WSU A;  3CUQ B;  2XV4 S;  3MCZ A;  5H6Q A;  4YII A;  2QBY A;  1KGS A;  2NYX A;  2M30 A;  2B0L A;  2ZKZ A;  3IWZ A;  2RQP A;  2KJC A;  2XAS A;  3REO A;  2UWM A;  1BI0 A;  4KFC A;  3J81 Z;  3NEU A;  2EFW A;  5BS6 A;  1WRJ A;  3F72 A;  2PJP A;  4U7B A;  1FYM A;  4HF0 A;  4L9N A;  2V1X A;  4LK1 F;  1K6O A;  2WC2 A;  2K4J A;  1QGP A;  4UUV A;  3I58 A;  3FXU A;  3TDZ C;  1J7K A;  2PG4 A;  4L9J A;  2ZFW A;  1DUX C;  2HKX A;  1U5T C;  3DEU A;  4BQA A;  1LNW A;  4L0Z B;  2MA3 A;  4ESJ A;  2E1N A;  3SQN A;  1BC8 C;  4G7Z F;  1ZRE A;  5D5X B;  4I01 A;  2P8T A;  3J81 K;  1S7A A;  3KP7 A;  4OIQ F;  2A07 F;  1KA8 A;  1WQ2 A;  3O2P E;  2ACJ A;  3LA2 A;  2EJR A;  3RTR A;  1ON1 A;  1YW9 A;  3KZZ A;  1J9I A;  3RPQ A;  4AIJ A;  1P4X A;  5CVU A;  5D5U B;  2W57 A;  3D0S A;  2XRN A;  3G3Z A;  1R1V A;  5DV5 A;  3ZMV A;  1F9N A;  3GX4 X;  4ENJ A;  1EH6 A;  5K5Q A;  1WKM A;  2AS5 F;  5HVQ C;  3RKX A;  5E18 F;  4YFN F;  3LST A;  2XAJ A;  1QZY A;  3ECO A;  2GQQ A;  4L0Y B;  5E1Z B;  2A6E F;  4IRG A;  3EDP A;  3R6S A;  1G3S A;  2A69 F;  4HDV A;  2VC0 A;  1RUO A;  2E1C A;  1REP C;  5LHG A;  3VB2 A;  2ISZ A;  2JSC A;  5BOX A;  1WI9 A;  3ULQ B;  5HLG A;  5LGT A;  1OPC A;  2M1B A;  4O3M A;  3ROU A;  5HDN A;  4KN7 X;  3KP4 A;  1FP1 D;  3VOD A;  1O3Q A;  3KP6 A;  4ZZD A;  3H3U A;  3I71 A;  3JAM Z;  3OOP A;  4BYY A;  2OQR A;  1IN4 A;  1MJ9 A;  3ZPL A;  3WTW C;  1U78 A;  3T5X A;  1S7O A;  1QZZ A;  3CUQ A;  2D2W A;  2M8E A;  4O6J A;  2ZJ2 A;  1EH8 A;  3GLX A;  2V1D A;  3E6B A;  5K1Y A;  4WWC A;  3JTH A;  4I0A A;  1SD5 A;  2FNA A;  4BNC A;  4Q5S F;  1JHF A;  1R58 A;  4S04 A;  2QLZ A;  3M7G A;  4MQV A;  2DLL A;  4KIG A;  4M6X A;  4A2U A;  3K1M A;  3R0J A;  5F6F A;  4I02 A;  2QWW A;  3GWZ A;  2JPC A;  4Y15 A;  4EJO A;  3I0T A;  3RYP A;  5LRS A;  4XRF A;  4LFU A;  1XMK A;  4EM0 B;  1KYW A;  3E3V A;  3R4K A;  1H9G A;  1I1S A;  3Q9S A;  4EM1 A;  1I1G A;  5H6R A;  4ZYG A;  3BPV A;  3N97 A;  2H09 A;  2ETH A;  1QPM A;  3ZP5 A;  5KVR A;  5D8L B;  1U6G A;  3RJP A;  5LHI A;  2G7U A;  1TQP A;  2DQL A;  1UST A;  3P9K A;  3QPT A;  1FY7 A;  4S05 A;  3VOE A;  3E5X A;  3F8M A;  4G7H F;  3J80 Z;  4HA8 A;  4CGZ A;  2VOO A;  3MEX A;  4AIK A;  4OIO F;  1Y0U A;  4IRI A;  2E7W A;  1V4R A;  2EB7 A;  3VFZ A;  5FFX A;  1R5G A;  1HST A;  2IP2 A;  3GFL A;  5DDG A;  2BBY A;  5D8K B;  2PLY A;  3KEQ A;  1GHC A;  1OYW A;  1U8R A;  1IAW A;  3F6V A;  3Q5F A;  1D8J A;  4KIF A;  3WGG A;  3GFI A;  4U0Y A;  4WX9 A;  4UV8 A;  2P5K A;  3J80 K;  3F8N A;  2ZNZ A;  4PDK A;  1GXP A;  4HLX A;  2CO5 A;  2V79 A;  3BY6 A;  2OZ6 A;  1ZYR F;  2YPR A;  2FXA A;  1P4W A;  1ZN2 A;  2PN6 A;  1HQC A;  3QP6 A;  2L02 A;  3HTU A;  3P7N A;  3FMQ A;  4DQ2 A;  1BJA A;  5CVV A;  1U2W A;  1T38 A;  3FMR A;  2QBY B;  3GF2 A;  4AVP A;  1JGS A;  3WTX C;  3EYY A;  1R00 A;  5LRR A;  3MZH A;  3SZP A;  1A04 A;  1J0R A;  4AIH A;  2RDP A;  2FML A;  1FZP B;  4M9S A;  2HS5 A;  5DCM B;  4WXH A;  2MLK A;  1YTY A;  3JTG A;  4HX8 A;  2DQR A;  3KP2 A;  3MFK A;  2E7X A;  3L00 A;  4A12 A;  5DD4 A;  2Z5U A;  3TKY A;  2XIG A;  3Q9V A;  3IC7 A;  4HAM A;  2CGP A;  5ED4 A;  2XUB A;  3QU3 A;  1XSV A;  3BDD A;  5ICG A;  2Q2E A;  1ZAR A;  1OMI A;  2BGC A;  4LMY A;  4N9I A;  3KLO A;  1ZG5 A;  4M6Y A;  4KUM A;  4LLG F;  3ZMS A;  1O3R A;  1XMA A;  5KK1 A;  4CDG A;  5LHH A;  2ISY A;  3L9F A;  1XSX A;  2W84 A;  2EA2 A;  1G6N A;  3H92 A;  3IL2 A;  4L9V A;  1UFM A;  2IPQ X;  5J6X A;  2KIF A;  3COA C;  1IRF A;  3DP7 A;  3CUO A;  4G7O F;  5HOO A;  1BIA A;  1OYY A;  5IT9 Z;  2MH2 A;  1Z6T A;  1HW5 A;  3FHZ A;  2CYY A;  2AXL A;  1K7A A;  1OR7 A;  2EFO A;  4GYI A;  1XCB A;  1QQI A;  1O7F A;  2XAG A;  1U5T A;  2F2E A;  5AON A;  2BEO A;  5HS7 A;  4DNC A;  1BN5 A;  4KIC A;  1SD4 A;  1XGN A;  2X4H A;  5J8C A;  1E2X A;  1J75 A;  2KIM A;  4M73 A;  2RC4 A;  1IN5 A;  4ZH4 F;  3R61 A;  4PGG A;  2FMY A;  2K86 A;  3QAH A;  5IT9 K;  3V4G A;  1CF7 A;  1FSE A;  4EJU A;  3M1E A;  4A0X A;  5FGM A;  1IN6 A;  2WV0 A;  1T98 A;  2HQR A;  5HDG A;  4EGZ A;  4RGR A;  2O03 A;  3F6O A;  1LB2 A;  3WTZ A;  2MD5 A;  3BZ6 A;  4YG2 F;  2R3S A;  3GUD A;  4ENK A;  3KE2 A;  4RAY A;  1PP8 F;  1RI7 A;  3WU1 B;  4HF1 A;  2NAZ A;  4HQM A;  3FXR A;  1S8N A;  4FX4 A;  2V9V A;  4BXU A;  2XKO A;  2G9W A;  4HLY A;  1MJA A;  2TDX A;  5DD8 A;  3N4M A;  3TO9 A;  4KIB A;  4YFX F;  2HEO A;  1MD0 A;  1KU3 A;  3E5U A;  1PP7 U;  5JFR A;  4QWQ A;  3ZMD A;  5DCM A;  2EV6 A;  2L54 A;  2VBX A;  4FX0 A;  3LFK A;  2UZK A;  3MWM A;  4IHS A;  2PMH A;  3PQJ A;  1TW3 A;  2HWV A;  1W7P D;  4NQW A;  2JRT A;  2HYF A;  2STW A;  2FBH A;  4HYE A;  3V7R A;  3EYI A;  2LF8 A;  1P6R A;  3TO6 A;  3R0A A;  2CFX A;  1MZB A;  1ZGA A;  1SMT A;  2J5P A;  3W6J B;  3FX3 A;  4KN4 X;  1QBJ A;  1R22 A;  1L3L A;  4CXF A;  2X0L A;  3FMS A;  2FRH A;  4XSZ F;  3U1D A;  4WCG A;  3H3Z A;  2DBB A;  2ZBK A;  1XN7 A;  3ZMZ A;  4K2E A;  1BOA A;  4IPA A;  4L5I A;  5FD5 A;  4BHP A;  3B73 A;  4EQQ A;  1HKT A;  3KEO A;  4YIF A;  1IRG A;  4G8X A;  4MGR A;  4HDU A;  3WTU C;  1IXC A;  3O3K A;  1TLH B;  3E97 A;  2H27 A;  5F64 A;  3TOA A;  1SMY F;  2IT0 A;  5L3F A;  5ILS A;  3BOQ A;  1LVA A;  1OKR A;  1FYL A;  5BMZ A;  2ZNY A;  3DFG A;  1R36 A;  1G4D A;  3OV8 A;  1TQM A;  3EQL F;  2KJB A;  3WTY C;  3E6C C;  2LKP A;  3GZ6 A;  4HBL A;  2GIV A;  1SAX A;  4L18 B;  3BPX A;  2PBI A;  5ILU A;  3BP8 A;  2JT1 A;  2EV0 A;  1DPU A;  5D6F A;  2D45 A;  1ZHF A;  3QP5 A;  4ZZL A;  2JZY A;  3MZY A;  2VE9 A;  2L3D A;  4IXA A;  2VXZ A;  3RI4 A;  1R7J A;  2GA1 A;  5L3D A;  1T39 A;  4OMZ A;  2L4M A;  4RAZ A;  2UXN A;  4PCQ A;  1R23 A;  4L5J A;  4ZYH A;  4RB3 C;  4I2O A;  4L9T A;  3HRS A;  3K1N A;  5HLI A;  3IRQ A;  4P9U A;  4UV9 A;  4EJV A;  3ABU A;  1Z91 A;  3LQQ A;  3HSF A;  2P4W A;  1RIO H;  4MEX F;  2K4B A;  3TGN A;  1VTN C;  3NQO A;  5K5O A;  2O6G E;  1F4K A;  1O3T A;  2XAH A;  3B02 A;  2MH9 A;  1UHM A;  2DW4 A;  1TQI A;  5JHU A;  1B4A A;  2ADU A;  3JAM K;  1LEA A;  3RDI A;  2HFH A;  4GO1 A;  1HW1 A;  4AD9 A;  1MDM A;  1ZH5 A;  3DQV C;  4ZYD A;  1G3T A;  1MGT A;  5EEG A;  3SHF A;  3QU6 A;  1KU9 A;  3VEP A;  2M5W A;  1LQ1 A;  1STZ A;  1B59 A;  1F1Z A;  4UVC A;  2PMU A;  5E8I A;  4JBA A;  1FT9 A;  2FEZ A;  4HV6 A;  1J5Y A;  4U7D A;  3BJO A;  2P5L C;  2PFB A;  2OA4 A;  1YW8 A;  5CVR A;  3T8T A;  2XAF A;  5LGU A;  4UVA A;  2F5D A;  4XBF A;  1ZAO A;  2V6C A;  2ZO4 A;  1FYK A;  5DCF A;  5E17 F;  4OIN F;  1TNS A;  1YLF A;  2F5F A;  3FXQ A;  3F22 A;  3IWF A;  5D4S A;  2WTE A;  5AIP A;  1U5T B;  2QYO A;  1K78 B;  5HDK A;  2CSO A;  3ISP A;  2PI0 A;  3IRR A;  2MLG A;  2DPU A;  5F1R A;  2A68 F;  1QNT A;  4N0B A;  2YX4 A;  5L3E A;  1FC3 A;  3ZMU A;  4UVB A;  2RKH A;  4M71 A;  1KYZ A; 
#chains in the Genus database with same CATH topology
 3H0G J;  3CJN A;  2OJE D;  2EIK H;  3W2A A;  1JI8 A;  3P9I A;  4PUS A;  2CWE A;  4TV7 A;  2J5O A;  2DFF A;  1V3F A;  5LLQ A;  2LKS A;  2O61 A;  1XSD A;  4NC6 A;  5FLX Z;  4GCV A;  3FXM A;  2LBF B;  1LDK B;  1CF7 B;  2KPM A;  4OOI A;  3RPU A;  3CCR I;  3S2H J;  1ODD A;  3BR5 A;  2QM3 A;  2DOF A;  4ZYE A;  4F55 A;  1VF9 A;  5EZG A;  3T8R A;  1SD7 A;  3HKZ A;  4ZJZ A;  1VQ5 I;  5DYM A;  3DPT A;  2MFZ A;  4Q47 A;  2M45 A;  2P7C B;  2GM4 A;  2P6T A;  2LR8 A;  2O7O A;  3BWG A;  1NG7 A;  4HG2 A;  4PJJ A;  3L2W A;  1B1B A;  3M8F A;  2MD0 A;  3HSE A;  1R5H A;  1YW7 A;  3T0Y A;  2QQ8 A;  1BIB A;  5H2F C;  3AKZ A;  3GXO A;  1LFU P;  3HDD A;  1FSH A;  1FOW A;  2KIU A;  5CJ9 A;  2BE5 F;  3VSL A;  3KFW X;  1MMG A;  2HTJ A;  2R7F A;  4NHJ A;  4B3X A;  4EJW A;  2BVM A;  2DT6 A;  2IA0 A;  1Y1V J;  1PUF A;  1Y8Q B;  2XVC A;  3CUQ C;  1LEB A;  1N77 A;  2NOG A;  3I4P A;  2O0Y A;  4RAF A;  1IV8 A;  3ERE D;  5B3S H;  3V7S A;  5F1J A;  2STT A;  5B66 C;  1BI3 A;  2XF5 A;  1RES A;  3VYT B;  1X3U A;  3HOS A;  2COB A;  3V8J A;  5FLX K;  3G71 I;  3KEY A;  5D5W B;  2H6B A;  1SFU A;  1A6I A;  1IN7 A;  5C4J J;  3D5S C;  1SFO J;  1O4X A;  3FXK A;  2JPB A;  1FBQ A;  2VON A;  3H5A A;  3OYD A;  1OJL A;  4PZJ A;  3AG2 H;  4CCN A;  3DKW A;  4OMY A;  1S6L A;  1GVD A;  2DA5 A;  1MKM A;  3DF8 A;  1X1D A;  2XGC A;  1SC7 A;  1P4A A;  4XKB A;  2DI3 A;  4EM2 A;  5FKO A;  1ZLK A;  3HYI A;  1VQ6 I;  2E35 A;  3BRO A;  5D6E A;  2JA5 J;  4A0Z A;  2FQ3 A;  3BG7 A;  3TP3 A;  1B6A A;  2GIZ A;  1V5F A;  1SVM A;  2KFD A;  2VBZ A;  2Q0O A;  3Q0U A;  5HS8 A;  1XDU A;  2R7O A;  2EV5 A;  1TWH J;  4KMF A;  2VOP A;  2FX0 A;  1W4M A;  4Y4R A;  2PMZ A;  4HPQ A;  1ZGJ A;  3C2G A;  5J47 A;  4LG3 A;  2A6H F;  4NQW B;  5GPC A;  2HR3 A;  3JSO A;  4RMN A;  1HLV A;  2LP0 A;  4NUB A;  1SFK A;  2LLK A;  4MTE A;  3JRD A;  3GVA A;  3LWF A;  2ICW G;  1D3Y A;  2M0M A;  2ME0 A;  4Z2Y A;  4KYW A;  3HGG A;  4GXO A;  3IKT A;  2EH3 A;  1LE8 A;  4BH9 A;  3ABM H;  4F7Z A;  2BYV E;  2DYS H;  2E36 A;  4LG0 A;  4P1W A;  4B09 A;  3K2A A;  1IUF A;  1TNT A;  1Z05 A;  1YX5 A;  2A5W A;  2G0E A;  2M4G A;  5ICF A;  1QU3 A;  3ELK A;  3LQR A;  4Q4Z F;  2EZH A;  6PAX A;  3GZ5 A;  1WZ2 A;  2Z99 A;  3ERM A;  1QHH D;  2XPU A;  5F0H A;  2IJL A;  4AVZ A;  2GXA A;  4PJN A;  3HOZ J;  2XDV A;  1Y56 A;  3K4L A;  4P55 A;  4D7N A;  1J59 A;  2AXT C;  2ESN A;  4CUG A;  4XOP A;  1Y39 A;  1RRJ A;  3A2K A;  1W7P B;  1LVK A;  1TWA J;  1XGS A;  4XLH A;  4M9Z A;  3LFU A;  2GWR A;  5EGO A;  1MMD A;  4C2M J;  3DXJ F;  4CYC B;  2R0Q C;  1IW7 F;  1MBE A;  4RBO A;  3LSM A;  4CZZ A;  4KJZ A;  5L3G A;  3LA7 A;  2IRF G;  2DTR A;  3OWT A;  1VQ8 I;  2LMD A;  3FZV A;  1UHW A;  3QQA A;  4IJA A;  4CIC A;  3W6K B;  1W5T A;  3HSR A;  3HEF A;  3F21 A;  4H0E A;  3M8J A;  3S1N J;  2DJI A;  4PGH A;  2HDW A;  1AA7 A;  3V42 A;  4CO8 A;  3GTK J;  2ZXJ A;  3TOB A;  5FJ8 J;  5E8G A;  5CLS A;  3O6B B;  2VBW A;  3HKZ N;  3A03 A;  3L2C A;  1ZLJ A;  4I0B A;  1G2H A;  3F8F A;  1ERD A;  1XDS A;  1T0F C;  3CTA A;  1GXQ A;  1OCP A;  1K78 A;  4J00 A;  1LKX A;  2VQH A;  2DDB A;  4LGW A;  3GTG J;  4LLN A;  4LJZ F;  4GRI A;  3RKQ A;  4E70 A;  1ZRD A;  2VQC A;  3D5L A;  4BL0 B;  3E6M A;  3J7A O;  2W25 A;  4B8X A;  2Z9O A;  1USS A;  2F5E A;  4MLO A;  3G73 A;  2QQA A;  1AKH B;  1KU7 A;  4BHC A;  5JI6 A;  1TT0 A;  3HGY A;  3OMY A;  5HS9 A;  2DN0 A;  3V8K A;  2RN7 A;  3BCA A;  4XLE A;  3ZMT A;  1HXD A;  1B9M A;  1UCR A;  4QSH A;  1Z7U A;  1AWC A;  2VJI A;  4G94 A;  3JCU C;  5L3B A;  2RNG A;  1JKQ C;  4IO9 F;  5DEQ A;  4BQQ A;  4ZTF A;  1U9O A;  5IPA A;  1TL8 A;  1IZ1 A;  3KCC A;  3W6V A;  2NVX J;  4IX7 A;  3GW2 A;  2OAZ A;  5LGN A;  3PIP F;  1LDJ A;  2GBY A;  3X2Q H;  1JKO C;  5IP6 A;  3NRV A;  3SEZ A;  3JRG A;  1FX7 A;  5FRM A;  2Z3Y A;  1W0U A;  2BV6 A;  4XOR A;  2XB5 A;  4ZTJ A;  2R5Y A;  2BW3 B;  2HZD A;  2QUF A;  3O8H A;  4KMU X;  1RZ4 A;  3UNG C;  2GXB A;  3HPG A;  4N4O B;  3RQ4 A;  4G6T B;  4U88 A;  1YS7 A;  1X3W B;  2YS9 A;  2X1E A;  2VBY A;  4BEH A;  5M5X J;  1W5S A;  2I5U A;  3GTM J;  3LSG A;  3DU5 A;  3WTT C;  3HOX J;  2H8W A;  1U3E M;  2MC4 A;  3DLL F;  3BR1 A;  2VXD A;  1RR8 C;  4QIW N;  1XD7 A;  3ESW B;  5D5V B;  1BM9 A;  4ABZ A;  2PMZ N;  1DDN A;  3A4C A;  4IHT A;  2E5Z A;  5K7F A;  5M5W J;  2HXI A;  4XSX F;  2GLO A;  2EWN A;  2EZI A;  4RM3 A;  2UXX A;  5IOZ A;  3S8P A;  3EET A;  3PSF A;  5ICE A;  1FOX A;  2D1V A;  3OYI A;  4OIR F;  2Y75 A;  3E6D A;  1SAU A;  2GA2 A;  2Z16 A;  3H0D A;  5KAF C;  2ZME B;  3MVP A;  3BR6 A;  5F27 A;  1VQ4 I;  1F43 A;  4KDP A;  3B6A A;  3E7L A;  3IP4 B;  4XLN F;  4XK4 A;  5K5R A;  3S2D J;  3RIR A;  4HST A;  5F0F A;  2O9L A;  3RZD J;  1K83 J;  3WU0 A;  5ICC A;  1MDM B;  2IGM A;  2WBM A;  2ZXW H;  3FXL A;  1S7E A;  3GTP J;  3F8B A;  3S93 A;  2VC1 A;  5A2Q Z;  1IG7 A;  2DFI A;  4ON0 A;  1Z9C A;  2WAQ A;  4G12 A;  1FMV A;  2RV8 A;  4LLL A;  4HNV A;  2MSY A;  4KA4 A;  3F23 A;  3H1C A;  3K1P A;  4KT5 C;  1FPQ A;  1VZ0 A;  2KRF A;  4ZYA A;  5F0C A;  3DEE A;  2C6Y A;  4R1H A;  3IHU A;  3CMY A;  3OYJ A;  1X1B A;  4BBR J;  1Z3Y A;  2O8X A;  4Y13 A;  3DBH B;  2QZ8 A;  2HKO A;  1FIA A;  4M74 A;  4XR6 A;  3CJQ B;  1ETK A;  3K2Z A;  3HOU J;  2QKL B;  2QEN A;  4I09 A;  3F8C A;  4II2 A;  5FB2 A;  3LAJ A;  1H9T A;  1PUE E;  4N9H A;  2WWY A;  2FA5 A;  4UHT A;  2R7R A;  3UKG A;  4PJM A;  4XIC A;  3WTS C;  1FBS A;  4L5E A;  1A5J A;  4RGS A;  5C3E J;  4IKF A;  2F5V A;  3RKY A;  3I3L A;  2HGC A;  4BQN A;  3FIW A;  1YIO A;  3H9Q A;  3ZRG A;  4DZJ A;  1D8K A;  3PL8 A;  4IHX A;  5DM6 F;  1FBU A;  3ZN0 A;  4EVI A;  5A2Q K;  1Q1H A;  2Y30 A;  5DM7 F;  1JKP C;  1I27 A;  2K9L A;  4Y17 A;  4NC7 A;  1W7P A;  4GYG A;  2XHK A;  2HDC A;  3G1L A;  1EH7 A;  2FOK A;  5BQT A;  1OYI A;  4RGU A;  3DCF A;  4CYC A;  1J2X A;  2F48 A;  1I6X A;  2EFP A;  1OCT C;  3OYA A;  1L0O C;  1YE9 A;  4FT8 A;  4B47 A;  3DV8 A;  1SFE A;  4ENM A;  3V7C A;  2VLA A;  4JQF A;  3I5U A;  2OTJ I;  1IXS B;  4CYD A;  1HSJ A;  2HOA A;  3FBN B;  3ZXS A;  3EUH C;  2OQG A;  2A3S A;  1O7L A;  4UUS B;  2W85 A;  3HRU A;  2FJ1 A;  3HTS B;  3IAM 2;  3DPL C;  1HBX G;  2RAE A;  1YJN I;  4FAS D;  4IOA F;  3LAP A;  3FDY A;  4KNY A;  4II3 A;  1X19 A;  2CV0 A;  3GFJ A;  1IDY A;  2O3F A;  4MHG A;  3P9C A;  4YEL A;  2GXG A;  2QVO A;  1R1T A;  3SEQ A;  4D1Q A;  2ECC A;  2FBI A;  3CCU I;  3FK7 A;  3UR3 C;  2L7F P;  2M87 A;  3L7W A;  5E3O A;  4E6K G;  3BTJ A;  3CP8 A;  3SDB A;  4XMY A;  4A0Y A;  3BJ6 A;  3M8E A;  4HZF A;  4IRH A;  4ENN A;  1PUF B;  2K27 A;  4FIS A;  2A5Y B;  4XRS G;  1Z67 A;  2DMQ A;  1IGN A;  3HHG A;  2QQ9 A;  4WXC A;  4B43 A;  2XGD A;  3S3N A;  1JXS A;  3AG3 H;  3CDH A;  1H0M A;  4DBR A;  1UAA A;  3F3X A;  2EPF A;  2LSO A;  4DW6 A;  4O5V A;  4M72 A;  2V1U A;  2HTS A;  3FM5 A;  4I7H A;  3PUF A;  3GFM A;  2KL4 A;  3CO7 C;  3JW4 A;  1WHU A;  1P92 A;  4MO7 A;  3L09 A;  1P2F A;  5IYB J;  3SXY A;  1N75 A;  2CU7 A;  2F4O B;  1IUY A;  5J8F A;  2WV1 A;  1JUP A;  2VKE A;  3CCJ I;  4ZDP A;  3IKV A;  4IVN A;  4MEY F;  3WE3 A;  1IF1 A;  1JT6 A;  3I59 A;  5BPI A;  4BAC A;  1AOY A;  4HNU A;  4E7H A;  1T6S A;  4CCO A;  5LEK A;  2YUS A;  1ZQ3 P;  3FBI B;  4RS8 A;  1JE8 A;  2QQB A;  2VKV A;  2H94 A;  4LB6 B;  4RDU A;  4XLP F;  3C18 A;  1F5T A;  2JTV A;  1BR4 A;  4R8H A;  4LB5 A;  1BOB A;  4G6Q A;  1HKS A;  2ZXH A;  3LA3 A;  2WAQ N;  4YRV A;  4IOC F;  2XF6 A;  2VT2 A;  2DK5 A;  2HOE A;  2KKO A;  2ME6 A;  1ACI A;  4U0W A;  2B63 J;  3FF5 A;  3LSK A;  1R6R A;  1S3J A;  3RYR A;  4C2T A;  5K7H A;  4C3H J;  4HNT A;  3EPZ A;  1YFH A;  3LSR A;  3A02 A;  1O57 A;  1D1B A;  2DT5 A;  2CUZ A;  2DK8 A;  3S32 A;  3S14 J;  2K02 A;  4YFK F;  1VQL I;  4EMS A;  2DA7 A;  4A3I J;  1XCV A;  4P5O A;  1FIP A;  4NBQ A;  2AHQ A;  2DA4 A;  2L7K A;  2ZME A;  1UEL B;  4G9Y A;  2KDO A;  1LE8 B;  3ECH A;  4Q48 A;  1R1U A;  4LG0 B;  5E79 C;  5GAD J;  5KCM A;  4ZDO A;  2YR2 A;  1UMQ A;  3OL4 A;  1V55 H;  2PEX A;  4EV0 A;  5JR3 A;  4FE7 A;  2NNN A;  4PK4 A;  1JKR C;  1YRN B;  3HOT A;  1DU6 A;  1VQO I;  1QO0 D;  2IAI A;  3C1D A;  2D5V A;  3OS2 A;  5LBQ A;  2VI6 A;  1VQP I;  1IXR C;  3FXJ A;  3I64 A;  3CO6 C;  1C0W A;  4M3G A;  3I53 A;  1G3Y A;  1MNE A;  2COM A;  2FBK A;  2IVM A;  4WF2 A;  3MKW B;  1D5V A;  4LIT A;  3G6E I;  1CQT A;  2DYR H;  4A3J J;  3GEZ A;  1TWF J;  2OBP A;  5DUK A;  2DT7 B;  3I4N J;  5DTD A;  5FLM J;  4OIP F;  2VE8 A;  3ZN1 A;  5EGO B;  4HF2 A;  2M0C A;  1ETO A;  4UB6 C;  4BHB A;  1LDD A;  4BGD A;  5L3C A;  1A35 A;  2FU4 A;  2K3P A;  4XLF A;  5CYV A;  3CC4 I;  4PFP A;  3L2V A;  2NRA C;  3HRT A;  3CZ6 A;  3CLO A;  3Q0W A;  3E5Q A;  2CW0 F;  4BE0 A;  5E3L A;  4BE2 A;  5EEH A;  1K79 A;  1IN8 A;  4AWX B;  1B9N A;  2EFQ A;  1D1C A;  4A5M A;  4AUX A;  2I8D A;  3L2Q A;  2R4G A;  1F36 A;  3K69 A;  3OR1 C;  5H20 A;  3A01 B;  4LD5 A;  5GAE J;  5IP7 J;  4HV5 A;  5AIQ A;  5LFA A;  5TJJ A;  2L7M P;  2JVH A;  2NS0 A;  3GME A;  3H9G A;  1GVJ A;  2JMW A;  4P96 A;  3CP2 A;  2YX7 A;  2JVG A;  1G8X A;  3RKW A;  2BY3 A;  2Y2Z A;  4LK0 F;  3ABT A;  3PNV A;  3PQK A;  1NHA A;  1FOK A;  3OIQ A;  2OZU A;  2VN2 A;  2RQQ A;  2ZJQ F;  2NOJ B;  1LJ9 A;  3DBL B;  3JRE A;  2A61 A;  3QOP A;  4UNO A;  2R7D A;  1RPW A;  3DWL E;  1ENH A;  3S2W A;  4X6A J;  3CLQ A;  3HHH A;  3LSH A;  3TDU C;  4UUS A;  2Z33 A;  5FD6 A;  1KQ8 A;  2LYC A;  1RR7 A;  1YIJ I;  1FNN A;  3CF2 A;  1HW2 A;  3ML6 A;  1JHH A;  2XKP A;  1E17 A;  3M9A A;  4CA0 A;  2F5C A;  1XGM A;  1ZRF A;  2CQK A;  4EAT A;  2FUG 2;  2Q8K A;  3J7A Y;  2KIQ A;  1UG0 A;  1SFX A;  2LDU A;  1WJD A;  4HQE A;  3ZQC A;  5CVJ A;  2R5Y B;  2MBF A;  3MAJ A;  2ID3 A;  2DOD A;  1Z1D A;  4C3J J;  1TW2 A;  2XAQ A;  2JJ7 A;  2XPV A;  4MQ9 F;  2YU3 A;  1FP2 A;  4IEJ A;  1QPI A;  4BEH B;  2B9S A;  1HA8 A;  1WH5 A;  1OCC H;  2DU9 A;  2L5Q A;  4A5N A;  3K9T A;  2DAO A;  3B6C A;  1BBY A;  3HB9 A;  3HBL A;  4IL6 C;  1KZH A;  1X1P A;  4F52 A;  4HOB A;  1BI2 A;  1WJF A;  4RB0 A;  1T0F A;  1W36 C;  4A6D A;  4M9X A;  2ZSH B;  1YIT I;  4MNU A;  3SJM A;  1RKT A;  3WG9 A;  3A0B C;  1HKQ A;  3KLN A;  3QPH A;  1RUN A;  4S0H B;  3MQ0 A;  1XGO A;  2OPT A;  3KX2 A;  4XKV A;  5HOD A;  1DGW Y;  1ZG1 A;  4P9F A;  5GAG J;  3WTV C;  4HW0 A;  1BL0 A;  2RVC A;  2ELH A;  2DOA A;  1TBX A;  2MC3 A;  3GTJ J;  3ZCO A;  4ANJ A;  1ON2 A;  3GBG A;  1WWX A;  1O3S A;  3DU6 A;  2M34 A;  3SFZ A;  3WGH A;  2IA2 A;  2I10 A;  5CQG A;  1POG A;  3JRC A;  2OF7 A;  4WXD A;  3G1O A;  1MH3 A;  3PFI A;  3BR0 A;  4G6D A;  4BJ6 C;  2BHY A;  1I5Z A;  2LD5 A;  2K3F A;  1R9T J;  3KET A;  3OYB A;  4A3L J;  1KQ9 A;  3QRF F;  2OU2 A;  2JA2 A;  4NB5 A;  4OU0 A;  3R60 A;  4NC8 A;  3BJA A;  3ZQG A;  4A6E A;  2BOL A;  2R5Z A;  3U9G A;  3K7A J;  2DO7 A;  3D5R C;  3KP5 A;  2FNP A;  2JN6 A;  3WHC A;  1HDD C;  2W24 A;  3PSI A;  2CG4 A;  3FM3 A;  4BU2 A;  1JUS A;  3WOD F;  2BY1 A;  4EGY A;  5DS9 A;  2VT3 A;  2RNJ A;  2M4K A;  3E0J B;  5ERI A;  4DZP A;  2Y48 A;  5GAH J;  3SFI A;  2EFN A;  4ETS A;  1ETQ A;  4LIU A;  4RB2 C;  2ZJP F;  1H89 C;  3HUG A;  2L2O A;  3ABL H;  1EKE A;  4AU7 A;  1KQ0 A;  2A6T A;  4I76 A;  4F91 B;  2ZCW A;  1Y0N A;  1KU2 A;  3CC7 I;  4XL9 A;  1YYV A;  1YRN A;  1XG1 A;  3RZO J;  4E4H A;  1SD6 A;  1UZC A;  5FO5 A;  1YG2 A;  3HRM A;  3J7Y J;  2PQ8 A;  3HOY J;  3S16 J;  4CHU A;  2OTL I;  2L01 A;  3IV5 A;  1S29 A;  2HZT A;  1MJB A;  2P7V B;  5J1U A;  1JTY A;  2GAU A;  1PDN C;  3TQN A;  3IAS 2;  2L9N A;  2PX9 A;  2LVS A;  4C3I J;  1BI1 A;  4FHT A;  2DFH A;  2EA4 A;  2G7H A;  1APL C;  2LY1 A;  2VUM J;  1P7J A;  3NAR A;  5JVT A;  2LF7 A;  2FE3 A;  3NAU A;  3HIF A;  2CV1 A;  3G1M A;  5TRD A;  4GGG A;  2DDA A;  4HX7 A;  3ZQ7 A;  5ILV A;  2K7L A;  2L4A A;  3TO7 A;  5DUI A;  2IW5 A;  2Q1Z B;  5CVI A;  3OYH A;  1B72 B;  2HQN A;  1FTZ A;  3JSP A;  2XGX A;  1FJL A;  5E20 A;  2FOW A;  3AL0 C;  4E7J A;  1EV7 A;  1YS6 A;  3OYE A;  2VOD A;  4ESF A;  4MFD A;  5FRO A;  2L9V A;  3A01 A;  1ZG3 A;  1TTY A;  3V8L A;  5BPD A;  1NK3 P;  3KIO A;  3AAF A;  1MSE C;  3AFH A;  4BJT A;  4U0V A;  1K4S A;  1ONV A;  2HYG D;  1ZKG A;  4RGX A;  3GYH X;  2JRM A;  2K9N A;  1IDZ A;  3GO5 A;  4H4K C;  3SZT A;  3WE2 A;  4R79 A;  5D4R A;  3QOE A;  1YQA A;  5HLH A;  2VPL A;  4UY8 I;  4D0P A;  1Z77 A;  1OFC X;  2W00 A;  3DLA A;  1G3W A;  1XPX A;  1CGP A;  2DPD A;  5LEJ A;  4QLC U;  1RNL A;  4CH7 A;  1UB9 A;  1OLT A;  4IF4 A;  1DP7 P;  4UXN A;  3DKY A;  2P6S A;  1Z6R A;  3A1Y A;  4QTR A;  2TCT A;  3JRH A;  3FWE A;  2RGV A;  2FSW A;  2ZSI B;  3T1B A;  5IY5 H;  4YIR X;  1V54 H;  3HOW J;  2LK2 A;  2DMT A;  2LNB A;  3KYC B;  1ULY A;  4AYB A;  2R7U A;  1LPQ A;  2FF4 A;  4M3F A;  4I98 B;  1ZRC A;  1D1A A;  4Y33 A;  1QHG A;  3OS1 A;  2OD5 A;  4XKC A;  2KT0 A;  3NWT A;  2CFO A;  3FHN A;  4V19 K;  2HOT A;  4EJT A;  3CF5 F;  2X6O A;  2EK5 A;  5EZH A;  2YSR A;  3VYS B;  1X2M A;  4ESB A;  4DJA A;  5K7Z A;  3K0L A;  2GZW A;  5GPA A;  2VKH A;  4JK1 X;  2D1H A;  1ETY A;  4ASN A;  3RCO A;  4WK8 F;  4XOT A;  5FFZ A;  4FTH A;  1YJ9 I;  2H6C A;  2NNY A;  1I6H J;  4EEF G;  2JA8 J;  3BQY A;  1T2K A;  3EUH A;  2XRO A;  1A36 A;  1TWG J;  3I59 B;  3G4S I;  1QVT A;  4MTD A;  3WGI A;  4BXX J;  4HX4 A;  2Y0M A;  3GCM A;  1FLI A;  1RET A;  3JR9 A;  2IA1 A;  3KP3 A;  3HOV J;  3SYT A;  2EZL A;  1QRY A;  2F6C A;  3C3W A;  1YO5 C;  4RB1 A;  1FWZ A;  2ESH A;  1VI0 A;  4OWR B;  2E1M C;  1BC7 C;  1DPR A;  5KHD A;  2PJR A;  2P5V A;  4BAY A;  3I55 I;  3H3V K;  9ANT A;  3U2R A;  1TP4 A;  5E1W A;  5B1A H;  4F93 B;  3I54 A;  3KZY A;  2R7W A;  3K4N A;  1Z0X A;  5E1X A;  2VJJ A;  2KDZ A;  3C7J A;  4XKW A;  5IT3 A;  1GUU A;  2VAS A;  5IYD J;  3CC2 I;  3JRB A;  3W2W A;  5IP9 J;  4BQO A;  1V5G A;  1XB4 A;  2CUJ A;  1WSU A;  3CUQ B;  5E3N A;  1MBF A;  2XV4 S;  3PO3 J;  3MCZ A;  5H6Q A;  4YII A;  2QBY A;  2CQQ A;  1KGS A;  1SVL A;  4JX4 A;  2NYX A;  2M30 A;  1HF0 A;  2R93 J;  3SDG A;  2B0L A;  2JA6 J;  2ZKZ A;  3IWZ A;  2RQP A;  2KJC A;  1YHQ I;  3QOD A;  3QYE A;  1GV2 A;  2XAS A;  1BW6 A;  2LRE A;  1OCO H;  2E19 A;  2FQ4 A;  4D5C A;  3JRI A;  3TED A;  3REO A;  2WY8 Q;  3BTC A;  2UWM A;  1BI0 A;  2XGE A;  2F4I A;  4E7S A;  4KFC A;  2XC7 A;  4C30 A;  2OV7 A;  1ZGW A;  1TZL A;  3J81 Z;  2QGU A;  3NEU A;  2EFW A;  4MIM A;  5BS6 A;  1WRJ A;  2HQ5 A;  3F72 A;  2QA4 I;  1QVU A;  2PJP A;  3E1S A;  4U7B A;  1FYM A;  5HLT A;  4HF0 A;  4L9N A;  2V1X A;  4LK1 F;  4MFE A;  3QWL A;  1K6O A;  2K40 A;  2WC2 A;  2K4J A;  1OR7 C;  1QGP A;  2EZK A;  3I58 A;  2CS3 A;  3FXU A;  4BY7 J;  3TDZ C;  4UUV A;  1J7K A;  2PG4 A;  4L9J A;  2QCO A;  2ZFW A;  1DUX C;  2HKX A;  1U5T C;  3NWS A;  3DBR B;  2IGO A;  3DEU A;  1MMS A;  4BQA A;  4XLC A;  2HPI A;  1LNW A;  3HC7 A;  4L0Z B;  4V2G A;  2MA3 A;  4ESJ A;  1ZTR A;  2NVQ J;  4E7I A;  2E1N A;  3SQN A;  3S3O A;  1BC8 C;  4G7Z F;  3OYC A;  2X1D A;  4HSR A;  1ZRE A;  1WI3 A;  2LY9 A;  3K4C A;  5D5X B;  4I01 A;  4AYB N;  1B72 A;  3W3C A;  5KAI C;  2P8T A;  2VIX A;  3J81 K;  2WB1 A;  2QSF X;  1S7A A;  3KP7 A;  2X48 A;  3I4M J;  2DMN A;  4M6V A;  2OCE A;  1K61 A;  4OIQ F;  2A07 F;  1KA8 A;  1VQK I;  1WQ2 A;  5JLW A;  3O2P E;  3VYU B;  2ACJ A;  3LA2 A;  3ZQL A;  2XB0 X;  1IJW C;  1I50 J;  2EJR A;  1Y6I A;  3RTR A;  4E7K A;  2IGK A;  2E34 A;  2X85 A;  4RA2 A;  1ON1 A;  1YW9 A;  2MGQ A;  5EG0 A;  1T8I A;  3KZZ A;  1J9I A;  4LOC A;  5J3L A;  2K9S A;  1Z7L A;  3RPQ A;  4AIJ A;  3OYN A;  1P4X A;  1WJ5 A;  3BC8 A;  2W48 A;  4GFB A;  5CVU A;  5D5U B;  2W57 A;  1MW7 A;  2MAB A;  3D0S A;  1R49 A;  2XRN A;  3G3Z A;  1R1V A;  5DV5 A;  3ZMV A;  1F9N A;  3GX4 X;  4ENJ A;  2Z2S B;  1EH6 A;  4IHV A;  3OYG A;  4Z6Y A;  2DA3 A;  2KP6 A;  3F9K A;  5JLX A;  3CDL A;  3DPU A;  5K5Q A;  2NXN B;  1WKM A;  2AS5 F;  2MG4 A;  2NVY J;  5HVQ C;  5HNH A;  3RKX A;  3CDI A;  5FKL A;  3FXO A;  5E18 F;  1R5I D;  4YFN F;  3LST A;  2XAJ A;  1QZY A;  3ECO A;  2GQQ A;  1ZR2 A;  4L0Y B;  1FOY A;  1WCM J;  5E1Z B;  2OC6 A;  4M3E A;  3C2H A;  2CJJ A;  2A6E F;  4IRG A;  4I99 C;  3EDP A;  3R6S A;  1G3S A;  3QYF A;  2A69 F;  1MBK A;  2E2H J;  3MKY B;  1FEX A;  1XMX A;  4HDV A;  3VDX A;  2A05 A;  3BZK A;  2VC0 A;  1RUO A;  3L2R A;  2Y9Z A;  1B8I B;  2E1C A;  2K85 A;  1K6Y A;  3I56 I;  1REP C;  2W82 A;  3K4K A;  1W36 D;  3TBI A;  2HNH A;  4JYK A;  4FE4 A;  5LHG A;  4DYR A;  5F08 A;  3VB2 A;  3FK6 A;  2O5R A;  1G59 A;  2ISZ A;  2JSC A;  5BOX A;  1WI9 A;  1MSF C;  2DA2 A;  3ULQ B;  5HLG A;  2EQR A;  2Y31 A;  5LGT A;  4AM3 A;  1RC9 A;  1OPC A;  2M1B A;  2CMP A;  4O3M A;  3ROU A;  5HDN A;  4X1E A;  4KN7 X;  4W1U A;  4C2U A;  3KP4 A;  1FP1 D;  2E2J J;  5F04 A;  5TIS C;  3VOD A;  1O3Q A;  1R71 A;  3KP6 A;  4ZZD A;  1MMA A;  3H3U A;  3I71 A;  3JAM Z;  2IS4 A;  3OOP A;  4BYY A;  2R5Z B;  2Y0S A;  2OQR A;  1IN4 A;  1ETX A;  1MJ9 A;  1BR1 A;  1X2N A;  2DMU A;  3ZQQ A;  3ZPL A;  1EF4 A;  2BVL A;  3WTW C;  3OIO A;  1M1E B;  1U78 A;  3TW6 A;  2M8G X;  3CCY A;  3T5X A;  2UUZ A;  4Y7N J;  1S7O A;  1QZZ A;  1U0J A;  3CMA I;  2EIL H;  2CV2 A;  3CUQ A;  2D2W A;  2M8E A;  4O6J A;  2X6X A;  2LY2 A;  3CES A;  3HUG B;  2ZJ2 A;  3PM1 A;  4XN3 A;  1YX3 A;  3PIO F;  4UB8 C;  1EH8 A;  5GTH C;  3GLX A;  5J1Y A;  4A3C J;  2V1D A;  4I6Z A;  2HI3 A;  3E6B A;  2IS2 A;  1ZK8 A;  2ZJR F;  5K1Y A;  4WWC A;  3JTH A;  4YEJ A;  1T08 B;  1E3O C;  2O8K A;  4I0A A;  1SD5 A;  2FNA A;  4BNC A;  2L0K A;  4Q5S F;  1JHF A;  2Q2E B;  3ASN H;  1MMN A;  1R58 A;  3H5R A;  3K10 A;  4S04 A;  5FRN A;  2QLZ A;  2ZFU A;  1I3A A;  2EIN H;  3M7G A;  3OYF A;  4KIS A;  4MQV A;  2LKX A;  2L7Z A;  5GP9 A;  2IEK A;  4X0G A;  2DLL A;  4KIG A;  4M6X A;  4A2U A;  3K1M A;  3R0J A;  5F6F A;  2R7Z J;  1SVO A;  3S15 J;  4I02 A;  2WB1 N;  1OCR H;  2QWW A;  4PJ0 C;  2M7A A;  3GWZ A;  4N4N B;  4E7L A;  4DOZ A;  2JPC A;  4Y15 A;  4EJO A;  3I0T A;  1X4P A;  1PYV A;  3RYP A;  5LRS A;  2HVR A;  4XRF A;  4LFU A;  1XMK A;  3ZQF A;  4EM0 B;  1KYW A;  4A3F J;  1HC8 A;  4CCJ A;  4J01 A;  3E3V A;  4M3B A;  3R4K A;  1H9G A;  1I1S A;  2XPW A;  2JUG A;  3Q9S A;  4EM1 A;  5M5Y J;  1I1G A;  5H6R A;  3OSF A;  4ZYG A;  4XNF A;  3BPV A;  3N97 A;  3CJR B;  2H09 A;  1T95 A;  2ETH A;  5B1B H;  1QPM A;  3ZP5 A;  1DQU A;  3RQI A;  1MBJ A;  3IH2 A;  5KVR A;  3OS0 A;  2KHM A;  2NVU B;  5D8L B;  2CUF A;  4Y3O A;  1U6G A;  4DYQ A;  3RJP A;  2JQ7 A;  3BZC A;  5LHI A;  2G7U A;  3S1M J;  3CQZ J;  1TQP A;  3ABK H;  3FKJ A;  2DQL A;  1UST A;  1JTX A;  1TC3 C;  5EEA A;  3P9K A;  3QPT A;  1FY7 A;  4S05 A;  2IS6 A;  3VOE A;  3E5X A;  1SEU A;  3RPU D;  3F8M A;  2TRT A;  4G7H F;  2XAU A;  1BJZ A;  3J80 Z;  2HOS A;  3IUO A;  1X1C A;  2RRE A;  1DU0 A;  4HA8 A;  2XSD C;  1GDT A;  3GTO J;  4CGZ A;  2VOO A;  3MEX A;  4QPO A;  1YI2 I;  3BTI A;  4AIK A;  4OIO F;  1R4N B;  1Y0U A;  1AU7 A;  1UJ8 A;  3BQZ A;  2X1C A;  3LSI A;  4IRI A;  2E7W A;  1V4R A;  3ZGK A;  2EIM H;  3KYL A;  2EB7 A;  2OCC H;  3VFZ A;  3DKX A;  2M2E A;  1GV5 A;  2ELK A;  1VQ9 I;  2FD5 A;  5FFX A;  1R5G A;  1HST A;  2IP2 A;  3GFL A;  5J1R A;  3OY9 A;  3S3M A;  3G2B A;  4HRI A;  1SAN A;  2HDD A;  3CCQ I;  5DDG A;  2BBY A;  5D8K B;  3J7Z I;  2PLY A;  3KEQ A;  3KZI C;  4FCY A;  1GHC A;  4XQF A;  2V4J C;  1OYW A;  3OYK A;  1U8R A;  1IAW A;  3PNY A;  1QZE A;  3F6V A;  2X6W A;  3Q5F A;  2X6Y A;  1H8A C;  1I3Q J;  1D8J A;  2DFE A;  4KIF A;  3WGG A;  3GFI A;  1Y1W J;  4U0Y A;  4A3B J;  4WX9 A;  1W5C C;  1A31 A;  3S1Q J;  4UV8 A;  2DCE A;  1HCR A;  2LOO A;  2P5K A;  4PSW A;  3F8N A;  3J80 K;  2ZC2 A;  2ZNZ A;  4PDK A;  1GXP A;  4HLX A;  2HVS A;  2CO5 A;  2V79 A;  5BNG A;  2DA1 A;  3BY6 A;  3HXL A;  2OZ6 A;  1ZYR F;  2YPR A;  5M3F J;  3K70 D;  2FXA A;  1P4W A;  1ZN2 A;  2PN6 A;  2Y0S N;  1HQC A;  3QP6 A;  2PJR B;  2L02 A;  3HTU A;  3P7N A;  3EUA A;  3AG1 H;  3FMQ A;  3OR2 C;  3CCM I;  2ZME C;  1VQN I;  2HXO A;  4DQ2 A;  4JP0 A;  2QF7 A;  1XTA A;  3H9J A;  1V5E A;  1BJA A;  2IGN A;  3PO2 J;  1B8I A;  2WAF A;  1S72 I;  5CVV A;  4BUP A;  1U8B A;  3LMM A;  3RSN A;  2E71 A;  4A3E J;  1PJR A;  1U2W A;  1N78 A;  1ZR4 A;  1T38 A;  3FMR A;  2QBY B;  3GF2 A;  4OAZ A;  2CQ7 A;  4AVP A;  1JGS A;  3CME I;  3WTX C;  3EYY A;  1IO2 A;  2Z1D A;  1R00 A;  5LRR A;  3L1P A;  3MZH A;  3SZP A;  1A04 A;  1S5L C;  1J0R A;  4AIH A;  2RDP A;  2FML A;  4Y52 J;  5CKT A;  4BDY A;  1EA3 A;  1XC5 A;  1FZP B;  4M9S A;  2VQL A;  3ZR8 X;  4BE1 A;  2QSH X;  1IRX A;  3LSP A;  1NG6 A;  2HS5 A;  1D0Y A;  4V2F A;  5DCM B;  4WXH A;  4RAG A;  2MLK A;  1YTY A;  1BW5 A;  3JTG A;  3DTE A;  4JOM A;  4HX8 A;  1Z21 A;  4D9J A;  2DQR A;  3HJE A;  3OOU A;  4DYC A;  3KP2 A;  1LUJ B;  1N25 A;  3TP0 A;  3MFK A;  2E7X A;  3L00 A;  4A12 A;  5DD4 A;  2OUM A;  1FMW A;  1A6Q A;  2Z5U A;  3LOC A;  3TKY A;  3CJT B;  2V9P A;  2ID6 A;  2H1K A;  2XIG A;  3Q9V A;  3IC7 A;  4HAM A;  2CGP A;  5ED4 A;  2XUB A;  3QU3 A;  3S17 J;  1XSV A;  2HYJ A;  3BDD A;  2Q2E A;  4XON A;  5ICG A;  1ZAR A;  4BKX A;  1OMI A;  2BGC A;  4BBS J;  4LMY A;  4XM3 A;  1JUM A;  4N9I A;  4ZDL A;  2Y9Y A;  1OCZ H;  3KLO A;  1ZG5 A;  4M6Y A;  4KUM A;  4LLG F;  3ZMS A;  1UG2 A;  2M9H A;  1O3R A;  1XMA A;  1MNM C;  5KK1 A;  4CDG A;  5FKN A;  5LHH A;  3FKI J;  2ISY A;  3WG7 H;  3ZQH A;  3L9F A;  1XSX A;  4IZZ A;  3GLL A;  3ZQI A;  2R7S A;  2W84 A;  4HEA 2;  2EA2 A;  2R7Q A;  4RLQ A;  3ASO H;  5FKK A;  1G6N A;  3H92 A;  3IL2 A;  4L9V A;  2VL8 A;  1UFM A;  2KLO A;  4CCM A;  2IPQ X;  3BG6 A;  5J6X A;  2KIF A;  3I9V 2;  3COA C;  2KMU A;  2V1N A;  1IRF A;  3DP7 A;  2L9R A;  5EG0 B;  3OYM A;  3CUO A;  4G7O F;  5HOO A;  3OIP A;  1BIA A;  2V26 A;  3ZOB A;  1OYY A;  5IT9 Z;  2MH2 A;  1Z6T A;  1OIS A;  1HW5 A;  3FHZ A;  4LIV A;  1VFC A;  2CYY A;  2VPR A;  4F3Q A;  3K6G A;  2AXL A;  1K7A A;  1OR7 A;  1K4T A;  2EFO A;  4GYI A;  1VND A;  1XCB A;  1QQI A;  1O7F A;  4B44 A;  2XAG A;  3JRF A;  1U5T A;  5J4Y A;  2F2E A;  5GTI C;  1NK2 P;  5CQE A;  5AON A;  2ECB A;  3HM5 A;  3ONQ A;  3BR2 A;  1T56 A;  2BEO A;  5B5E C;  1ZEL A;  5HS7 A;  4IQJ A;  1KON A;  3LNQ A;  1JGG A;  4DNC A;  1BN5 A;  4KIC A;  4AID A;  3BG5 A;  3JRA A;  2B7E A;  4XRS A;  4A69 C;  1WJB A;  2GOX B;  1SD4 A;  1XGN A;  1P7I A;  2X4H A;  3K70 C;  3PFY A;  5J8C A;  3W2V A;  1E2X A;  1J75 A;  2KIM A;  2LFB A;  4M73 A;  2RC4 A;  1IN5 A;  4ZH4 F;  3R61 A;  3TMO A;  4PGG A;  4XRM A;  2V9K A;  2FMY A;  1W1W E;  2K86 A;  3QAH A;  3VYR B;  4BDZ A;  4GDF A;  4IHW A;  2M7B A;  5IT9 K;  1BA5 A;  3V4G A;  3MKL A;  2LBF A;  1FSE A;  5J4V A;  1CF7 A;  4XID A;  4EJU A;  3CD6 I;  1VQM I;  3M1E A;  1MBG A;  3M1C A;  4A0X A;  2DMP A;  5FLV A;  5FGM A;  1IN6 A;  2EIJ H;  2WV0 A;  4IQ4 A;  1WGX A;  1T98 A;  2HQR A;  4J19 A;  2CUE A;  3BLY A;  2E60 A;  4XN0 A;  2CQX A;  2XF7 A;  5FKM A;  5HDG A;  2HVQ A;  4EGZ A;  4RGR A;  2O03 A;  3H35 A;  3F6O A;  4A3M J;  1LB2 A;  1EJ9 A;  3WTZ A;  1HOM A;  2QKM B;  2MD5 A;  3OL3 A;  3BZ6 A;  4KT6 A;  2JA7 J;  1HDP A;  2R3S A;  2KQR A;  3GUD A;  4YG2 F;  5KNL A;  4ENK A;  2MYS A;  3KPH A;  3KE2 A;  4RAY A;  1PP8 F;  1RI7 A;  4ZC3 A;  3WU1 B;  2DTZ A;  2P0W A;  4HF1 A;  2NAZ A;  4BJ5 C;  4HQM A;  3VPR A;  2VB6 A;  3FXR A;  2DJN A;  2X9D A;  1S8N A;  5C44 J;  3MKZ A;  4FX4 A;  2V9V A;  2KZV A;  4BXU A;  5E3M A;  2XKO A;  3QPS A;  3IH4 A;  2G9W A;  4JX6 A;  4HLY A;  3N05 A;  3GZN B;  3O8G A;  1MJA A;  2M3A A;  2TDX A;  1J09 A;  5DD8 A;  3WU2 C;  3N4M A;  4A3K J;  3TO9 A;  2CQN A;  4KIB A;  2CH0 A;  4YFX F;  2F4M B;  2HEO A;  1E3H A;  1MD0 A;  1KU3 A;  2KRH A;  2WA0 A;  3E5U A;  3H5N A;  2JK3 A;  3AG4 H;  1PP7 U;  1R4M B;  5JFR A;  1IRZ A;  4QWQ A;  3MZ8 A;  2AQF A;  4CSW A;  3ZMD A;  3CMM A;  5DCM A;  4ITV A;  2EV6 A;  1ORK A;  2L54 A;  5JHF A;  2VBX A;  1Y8R B;  3LFK A;  2ZB9 A;  4FX0 A;  2UZK A;  2HPM A;  4AC0 A;  1X3Z B;  4U87 A;  3MD2 A;  3MWM A;  4IHS A;  5IOY A;  2PMH A;  2ZXI A;  3PQJ A;  1TW3 A;  3EUK L;  3L2U A;  2HWV A;  1W7P D;  4NQW A;  2BZT A;  2JRT A;  3LSJ A;  1XX5 A;  2HYF A;  2STW A;  3SZG A;  1WPK A;  2FBH A;  4HYE A;  3V7R A;  5CPR B;  3EYI A;  1MIJ A;  2LF8 A;  1P6R A;  1IV6 A;  3HZJ A;  4CCL A;  4CCK A;  3TO6 A;  3HL2 A;  1H88 C;  2W7N A;  1TWC J;  3R0A A;  3CCL I;  2CFX A;  1MZB A;  1ZGA A;  3U21 A;  1SMT A;  3A0H C;  2J5P A;  3W6J B;  3FX3 A;  4PFO A;  4KN4 X;  2R7V A;  2NS7 A;  1QBJ A;  3M4O J;  1R22 A;  2XRL A;  2NS8 A;  4FQG A;  1L3L A;  4CXF A;  2X0L A;  3FMS A;  2FRH A;  4XSZ F;  3U1D A;  3PJR A;  2BY0 A;  1X58 A;  4WCG A;  3H3Z A;  1YOV B;  4BS9 A;  2DBB A;  2ZBK A;  1XN7 A;  3ZMZ A;  4K2E A;  3BR3 A;  1BOA A;  4IPA A;  4L5I A;  4D5F A;  3KYD B;  4BXF A;  5FD5 A;  4BHP A;  3GTL J;  3M3Y J;  3B73 A;  5TGT A;  4EQQ A;  1HKT A;  3KEO A;  2VKD A;  4B48 A;  4YIF A;  2DA6 A;  3VSK A;  1AHD P;  1D0Z A;  3VWB A;  1IRG A;  4G8X A;  4MGR A;  4HDU A;  3WTU C;  3BCB A;  2IBD A;  1IXC A;  3O3K A;  1TLH B;  3E97 A;  2H27 A;  3OSG A;  1E0E A;  1RKW A;  5F64 A;  3MN2 A;  2BXZ A;  3TOA A;  1SMY F;  2E1O A;  2VQG A;  2IT0 A;  3BG3 A;  1TT5 B;  3PUB A;  5L3F A;  5ILS A;  1T33 A;  3AL0 B;  3BOQ A;  2L9S A;  2JWT A;  1QA6 A;  4A3D J;  1W0T A;  1LVA A;  1OKR A;  1FYL A;  3PNT A;  4OAY A;  5BMZ A;  2H1L A;  2ZNY A;  3DFG A;  4IHY A;  1WH7 A;  1R36 A;  1G4D A;  4M3D A;  3OV8 A;  2CW7 A;  2W1O A;  1ETV A;  4B4C A;  1TQM A;  1E3P A;  3EQL F;  3FIS A;  5EJC A;  2ELJ A;  2KJB A;  1XS9 A;  3WTY C;  2LTP A;  3E6C C;  2LKP A;  3GZ6 A;  4HBL A;  4W97 A;  5HNF A;  2GIV A;  2K5C A;  1SAX A;  4L18 B;  3BTL A;  4E7Z A;  3BPX A;  3BT9 A;  2PBI A;  5ILU A;  1AKH A;  3BP8 A;  2JT1 A;  2EV0 A;  1DPU A;  1MND A;  5D6F A;  2WAE A;  2VJ5 A;  2D45 A;  2X51 A;  2LRD A;  2KRC A;  1ZHF A;  5C4X J;  3QP5 A;  2BY2 A;  4RLF A;  4D7M A;  4ZZL A;  2JZY A;  2BXY A;  2CRG A;  2NVT J;  3MZY A;  2VE9 A;  3DEW A;  5LD2 C;  1ETW A;  1IC8 A;  2HU9 A;  2QEX I;  1Z3X A;  2L3D A;  4IXA A;  3M07 A;  2VXZ A;  3RI4 A;  2BW3 A;  4NDL A;  1GLN A;  1LFP A;  5EF6 A;  1R7J A;  2GA1 A;  1PVE A;  3Q3S A;  5L3D A;  1T39 A;  1ITY A;  4A93 J;  4OMZ A;  4NNJ A;  2K9M A;  3U1K A;  4F92 B;  2L4M A;  2H8R A;  4RAZ A;  1MH4 A;  1U9N A;  2W4S A;  2K9Q A;  1UHS A;  4PJL A;  2DOE A;  2UXN A;  4PCQ A;  1R23 A;  3OYL A;  1YJW I;  5J40 A;  4L5J A;  4ZYH A;  4RB3 C;  3H36 A;  4I2O A;  4L9T A;  3HRS A;  3K1N A;  2QSG X;  3K4J A;  5HLI A;  4P9U A;  3IRQ A;  4UV9 A;  3C2B A;  4EJV A;  3ABU A;  1Z91 A;  3LQQ A;  3HSF A;  1BR2 A;  3GTQ J;  1DGR M;  2P4W A;  2E1M B;  1RIO H;  1NH3 A;  4MEX F;  3IH3 A;  2K4B A;  2LC2 A;  3TGN A;  1VTN C;  3NQO A;  5K5O A;  2O6G E;  1F4K A;  1LFB A;  4JX5 A;  2JSP A;  1MBH A;  1NTC A;  2CW8 A;  1O3T A;  2R92 J;  1D0X A;  2XAH A;  2UV1 A;  4KIT B;  3B02 A;  2MH9 A;  1UHM A;  2DW4 A;  1TQI A;  2EBI A;  4B1R A;  5JHU A;  1B4A A;  3P5J A;  2ADU A;  3JAM K;  1LEA A;  3RDI A;  3HPH A;  2AQE A;  2HFH A;  2BHZ A;  4GO1 A;  3K4M A;  2LH9 A;  1HW1 A;  4AD9 A;  1DP3 A;  5JVG F;  1MDM A;  1ZH5 A;  3Q0V A;  4B3A A;  3HG9 A;  3DQV C;  4XLA A;  4QPQ A;  5IYC J;  5EEG A;  1G3T A;  1MGT A;  3SHF A;  4ZYD A;  1WJC A;  2IS1 A;  3TL4 X;  1P9Q C;  3QU6 A;  1KU9 A;  3VEP A;  1JT0 A;  1JJ8 C;  4PSX A;  1FTT A;  2M5W A;  1LQ1 A;  1STZ A;  2KZG A;  1B59 A;  3F0C A;  1F1Z A;  2IXS A;  2E2I J;  3QYB A;  1GT0 C;  3DTK A;  4FET A;  2MW8 A;  5M3M J;  3CCE I;  2LG4 A;  2Y69 H;  4UVC A;  2R7X A;  1WJE A;  2PMU A;  5E8I A;  4UUT A;  3TW7 A;  3LL7 A;  4BY1 J;  4JBA A;  1FT9 A;  1WVR A;  2V6E A;  3BG9 A;  2FEZ A;  4HV6 A;  2HQA A;  4DIQ A;  1J5Y A;  5EDN A;  4RM2 A;  4U7D A;  1WJA A;  3BJO A;  3CCV I;  2PFB A;  2P5L C;  3S1R J;  2OA4 A;  1YW8 A;  5CVR A;  3T8T A;  2JUC A;  2XAF A;  5LGU A;  4UVA A;  4DBQ A;  2F5D A;  4XBF A;  1ZAO A;  2V6C A;  2ZO4 A;  3K4B A;  1FYK A;  5DCF A;  3WHB A;  2DXI A;  5E17 F;  3CCS I;  4OIN F;  1TNS A;  1YLF A;  2VJ4 A;  2F5F A;  3FXQ A;  3F22 A;  3IWF A;  1Q1V A;  2P81 A;  5D4S A;  2WTE A;  5AIP A;  1U5T B;  2QYO A;  4CZC A;  1K78 B;  5HDK A;  2CSO A;  2GOM A;  2WY7 Q;  2R7T A;  2AO9 A;  2YU9 J;  4A3G J;  3ISP A;  2PI0 A;  3DTI A;  2V7F A;  4C9Y A;  2KIS A;  3IRR A;  1JJ6 C;  2WAD A;  2MLG A;  5EYR A;  1X4O A;  5F1R A;  2DPU A;  2A68 F;  1QNT A;  2E5N A;  4DGW B;  1D5Y A;  4N0B A;  2N8G A;  1VQ7 I;  2XSJ C;  2YX4 A;  1X1A A;  5L3E A;  1FC3 A;  3MMY B;  4UVB A;  1I39 A;  3ZMU A;  2RKH A;  1S9H A;  3D1N I;  1WFX A;  3QPL A;  1KYZ A;  4M71 A;  1OQY A; 
#chains in the Genus database with same CATH homology
 3CJN A;  3P9I A;  2CWE A;  4TV7 A;  2J5O A;  1V3F A;  5LLQ A;  2O61 A;  1XSD A;  5FLX Z;  4GCV A;  1CF7 B;  1LDK B;  4OOI A;  3RPU A;  1ODD A;  2QM3 A;  4ZYE A;  3T8R A;  1SD7 A;  5DYM A;  3DPT A;  4Q47 A;  2M45 A;  2P7C B;  2P6T A;  3BWG A;  1B1B A;  3M8F A;  3HSE A;  1R5H A;  1YW7 A;  3T0Y A;  1BIB A;  3GXO A;  1FSH A;  2KIU A;  5CJ9 A;  2BE5 F;  3KFW X;  2HTJ A;  2R7F A;  4NHJ A;  4EJW A;  2IA0 A;  2XVC A;  3CUQ C;  1LEB A;  3I4P A;  2O0Y A;  3ERE D;  2STT A;  3V7S A;  1BI3 A;  1X3U A;  3HOS A;  3V8J A;  5FLX K;  5D5W B;  2H6B A;  1SFU A;  1IN7 A;  2JPB A;  1FBQ A;  2VON A;  4PZJ A;  4OMY A;  3DKW A;  1S6L A;  1MKM A;  3DF8 A;  1P4A A;  2DI3 A;  4EM2 A;  1ZLK A;  3HYI A;  3BRO A;  5D6E A;  4A0Z A;  2FQ3 A;  1B6A A;  2VBZ A;  2Q0O A;  5HS8 A;  1XDU A;  2EV5 A;  4KMF A;  2VOP A;  1W4M A;  1ZGJ A;  2A6H F;  3JSO A;  2HR3 A;  4MTE A;  3GVA A;  3LWF A;  1D3Y A;  4Z2Y A;  4KYW A;  4GXO A;  3IKT A;  4BH9 A;  4F7Z A;  2BYV E;  4LG0 A;  4B09 A;  1TNT A;  1Z05 A;  5ICF A;  3ELK A;  3LQR A;  4Q4Z F;  6PAX A;  3GZ5 A;  2Z99 A;  2IJL A;  4P55 A;  1J59 A;  2ESN A;  1W7P B;  1XGS A;  4M9Z A;  2GWR A;  3DXJ F;  1IW7 F;  4CZZ A;  5L3G A;  3LA7 A;  2IRF G;  2DTR A;  3FZV A;  1UHW A;  4IJA A;  4CIC A;  3W6K B;  1W5T A;  3HSR A;  3F21 A;  4H0E A;  4PGH A;  4CO8 A;  2ZXJ A;  3TOB A;  5E8G A;  5CLS A;  3O6B B;  2VBW A;  3L2C A;  1ZLJ A;  4I0B A;  3F8F A;  1XDS A;  3CTA A;  1GXQ A;  1K78 A;  4LGW A;  4LLN A;  4LJZ F;  4E70 A;  1ZRD A;  3D5L A;  3E6M A;  3J7A O;  2W25 A;  4B8X A;  2Z9O A;  1USS A;  2F5E A;  3G73 A;  2QQA A;  1KU7 A;  4BHC A;  5JI6 A;  3WTT C;  5HS9 A;  3V8K A;  2RN7 A;  3ZMT A;  1HXD A;  1B9M A;  1UCR A;  1Z7U A;  1AWC A;  4G94 A;  5L3B A;  5DEQ A;  1IZ1 A;  3KCC A;  3GW2 A;  2OAZ A;  5LGN A;  1LDJ A;  3NRV A;  1FX7 A;  2Z3Y A;  2BV6 A;  2QUF A;  4KMU X;  1RZ4 A;  2GXB A;  4U88 A;  1YS7 A;  2VBY A;  1W5S A;  1U3E M;  1XD7 A;  5D5V B;  1BM9 A;  1DDN A;  4IHT A;  4XSX F;  2EWN A;  2UXX A;  3EET A;  5ICE A;  2D1V A;  4OIR F;  2Y75 A;  3E6D A;  2GA2 A;  2ZME B;  4KDP A;  4XLN F;  5K5R A;  3RIR A;  3WU0 A;  5ICC A;  1MDM B;  3F8B A;  2VC1 A;  5A2Q Z;  2DFI A;  4ON0 A;  1Z9C A;  4LLL A;  2RV8 A;  4KA4 A;  3F23 A;  3K1P A;  4KT5 C;  1FPQ A;  2KRF A;  2C6Y A;  4R1H A;  3IHU A;  2O8X A;  4Y13 A;  2QZ8 A;  2HKO A;  4M74 A;  3K2Z A;  2QEN A;  4I09 A;  3F8C A;  5FB2 A;  3LAJ A;  1H9T A;  1PUE E;  4N9H A;  2WWY A;  2FA5 A;  4UHT A;  3WTS C;  1FBS A;  4RGS A;  3RKY A;  2HGC A;  1YIO A;  1D8K A;  1FBU A;  3ZN0 A;  4EVI A;  5A2Q K;  1Q1H A;  1I27 A;  4Y17 A;  1W7P A;  4GYG A;  2XHK A;  2HDC A;  1EH7 A;  2FOK A;  5BQT A;  1OYI A;  4RGU A;  1J2X A;  1I6X A;  2EFP A;  1L0O C;  4FT8 A;  3DV8 A;  1SFE A;  4ENM A;  3V7C A;  4JQF A;  3I5U A;  1IXS B;  4CYD A;  1HSJ A;  2OQG A;  2A3S A;  1O7L A;  2W85 A;  3HRU A;  3HTS B;  3DPL C;  1HBX G;  3LAP A;  4KNY A;  3GFJ A;  2O3F A;  4MHG A;  3P9C A;  2GXG A;  2QVO A;  1R1T A;  2FBI A;  2M87 A;  3L7W A;  4A0Y A;  3BJ6 A;  3M8E A;  4HZF A;  4IRH A;  4ENN A;  2K27 A;  2A5Y B;  3HHG A;  2QQ9 A;  4WXC A;  1JXS A;  3CDH A;  1H0M A;  3F3X A;  2LSO A;  4O5V A;  4M72 A;  2V1U A;  2HTS A;  3FM5 A;  4I7H A;  3GFM A;  3CO7 C;  3JW4 A;  1P92 A;  3L09 A;  1P2F A;  3SXY A;  1IUY A;  5J8F A;  3IKV A;  4IVN A;  4MEY F;  3WE3 A;  1IF1 A;  3I59 A;  5BPI A;  1AOY A;  1T6S A;  5LEK A;  4RS8 A;  1JE8 A;  2QQB A;  2H94 A;  4LB6 B;  4XLP F;  3C18 A;  1F5T A;  2JTV A;  4R8H A;  4LB5 A;  4G6Q A;  1HKS A;  3LA3 A;  2VT2 A;  2DK5 A;  2HOE A;  2KKO A;  4U0W A;  3FF5 A;  3RYR A;  1S3J A;  1YFH A;  1O57 A;  2DT5 A;  2DK8 A;  2K02 A;  4YFK F;  4EMS A;  1XCV A;  4P5O A;  2ZME A;  4G9Y A;  3ECH A;  4Q48 A;  1R1U A;  4LG0 B;  2YR2 A;  2PEX A;  4EV0 A;  5JR3 A;  2NNN A;  3HOT A;  1QO0 D;  3C1D A;  5LBQ A;  1IXR C;  3CO6 C;  3I64 A;  1C0W A;  3I53 A;  1G3Y A;  2COM A;  2IVM A;  2FBK A;  4WF2 A;  1D5V A;  3GEZ A;  2OBP A;  5DUK A;  4OIP F;  2VE8 A;  3ZN1 A;  4HF2 A;  4BHB A;  1LDD A;  5L3C A;  2FU4 A;  5CYV A;  2NRA C;  3HRT A;  3CLO A;  3E5Q A;  2CW0 F;  5EEH A;  1K79 A;  1IN8 A;  4AWX B;  1B9N A;  2EFQ A;  4A5M A;  3K69 A;  5H20 A;  4LD5 A;  4HV5 A;  5AIQ A;  5TJJ A;  2NS0 A;  1GVJ A;  4P96 A;  2YX7 A;  3RKW A;  4LK0 F;  3ABT A;  3PQK A;  1NHA A;  1FOK A;  2OZU A;  2VN2 A;  1LJ9 A;  2A61 A;  3QOP A;  4UNO A;  2R7D A;  3S2W A;  3HHH A;  3TDU C;  1KQ8 A;  2Z33 A;  5FD6 A;  1FNN A;  1HW2 A;  3ML6 A;  1JHH A;  2XKP A;  1E17 A;  3M9A A;  2F5C A;  1XGM A;  1ZRF A;  2CQK A;  2Q8K A;  1SFX A;  2LDU A;  4HQE A;  5CVJ A;  2MBF A;  3MAJ A;  1Z1D A;  1TW2 A;  2XAQ A;  4MQ9 F;  2YU3 A;  1FP2 A;  2DU9 A;  4A5N A;  3K9T A;  2DAO A;  1BBY A;  4HOB A;  1BI2 A;  4RB0 A;  1T0F A;  4A6D A;  4M9X A;  4MNU A;  3WG9 A;  1HKQ A;  3KLN A;  3QPH A;  1RUN A;  3MQ0 A;  1XGO A;  1ZG1 A;  4P9F A;  3WTV C;  4HW0 A;  2RVC A;  2ELH A;  1TBX A;  2MC3 A;  1ON2 A;  1WWX A;  1O3S A;  3SFZ A;  3WGH A;  2IA2 A;  4WXD A;  3PFI A;  4G6D A;  1I5Z A;  3KET A;  1KQ9 A;  3QRF F;  2OU2 A;  4NB5 A;  4OU0 A;  3R60 A;  3BJA A;  4A6E A;  3U9G A;  2DO7 A;  3KP5 A;  2FNP A;  2W24 A;  2CG4 A;  3FM3 A;  3WOD F;  4EGY A;  2VT3 A;  2RNJ A;  5ERI A;  2Y48 A;  2EFN A;  4ETS A;  4RB2 C;  3HUG A;  1KQ0 A;  2ZCW A;  1KU2 A;  1YYV A;  1SD6 A;  5FO5 A;  1YG2 A;  3HRM A;  2PQ8 A;  4CHU A;  2L01 A;  1S29 A;  2HZT A;  1MJB A;  2P7V B;  2GAU A;  1PDN C;  3TQN A;  1BI1 A;  4FHT A;  2EA4 A;  2G7H A;  5JVT A;  2LF7 A;  2FE3 A;  3HIF A;  5TRD A;  4GGG A;  4HX7 A;  3ZQ7 A;  5ILV A;  2K7L A;  5DUI A;  2L4A A;  3TO7 A;  2IW5 A;  5CVI A;  2HQN A;  3JSP A;  2XGX A;  5E20 A;  1EV7 A;  1YS6 A;  2VOD A;  4ESF A;  1ZG3 A;  1TTY A;  3V8L A;  5BPD A;  3AAF A;  4U0V A;  1ONV A;  2HYG D;  4RGX A;  3GYH X;  3GO5 A;  4R79 A;  3SZT A;  3WE2 A;  5D4R A;  1YQA A;  5HLH A;  4D0P A;  1G3W A;  1CGP A;  2DPD A;  5LEJ A;  4QLC U;  1RNL A;  1UB9 A;  4IF4 A;  1DP7 P;  4UXN A;  2P6S A;  1Z6R A;  3FWE A;  2RGV A;  2FSW A;  3T1B A;  2LNB A;  1ULY A;  2FF4 A;  4I98 B;  1ZRC A;  2OD5 A;  4EJT A;  2EK5 A;  2YSR A;  4ESB A;  3K0L A;  2GZW A;  4WK8 F;  4JK1 X;  2D1H A;  4ASN A;  5FFZ A;  2H6C A;  2NNY A;  1T2K A;  3EUH A;  2XRO A;  3I59 B;  4MTD A;  3WGI A;  4HX4 A;  2Y0M A;  1FLI A;  2IA1 A;  3KP3 A;  3C3W A;  1YO5 C;  4RB1 A;  1FWZ A;  2ESH A;  1BC7 C;  1DPR A;  2P5V A;  4BAY A;  3U2R A;  5E1W A;  3I54 A;  3KZY A;  5E1X A;  3C7J A;  5IT3 A;  1XB4 A;  1WSU A;  3CUQ B;  2XV4 S;  3MCZ A;  5H6Q A;  4YII A;  2QBY A;  1KGS A;  2NYX A;  2M30 A;  2B0L A;  2ZKZ A;  3IWZ A;  2RQP A;  2KJC A;  2XAS A;  3REO A;  2UWM A;  1BI0 A;  4KFC A;  3J81 Z;  3NEU A;  2EFW A;  5BS6 A;  1WRJ A;  3F72 A;  2PJP A;  4U7B A;  1FYM A;  4HF0 A;  4L9N A;  2V1X A;  4LK1 F;  1K6O A;  2WC2 A;  2K4J A;  1QGP A;  4UUV A;  3I58 A;  3FXU A;  3TDZ C;  1J7K A;  2PG4 A;  4L9J A;  2ZFW A;  1DUX C;  2HKX A;  1U5T C;  3DEU A;  4BQA A;  1LNW A;  4L0Z B;  2MA3 A;  4ESJ A;  2E1N A;  3SQN A;  1BC8 C;  4G7Z F;  1ZRE A;  5D5X B;  4I01 A;  2P8T A;  3J81 K;  1S7A A;  3KP7 A;  4OIQ F;  2A07 F;  1KA8 A;  1WQ2 A;  3O2P E;  2ACJ A;  3LA2 A;  2EJR A;  3RTR A;  1ON1 A;  1YW9 A;  3KZZ A;  1J9I A;  3RPQ A;  4AIJ A;  1P4X A;  5CVU A;  5D5U B;  2W57 A;  3D0S A;  2XRN A;  3G3Z A;  1R1V A;  5DV5 A;  3ZMV A;  1F9N A;  3GX4 X;  4ENJ A;  1EH6 A;  5K5Q A;  1WKM A;  2AS5 F;  5HVQ C;  3RKX A;  5E18 F;  4YFN F;  3LST A;  2XAJ A;  1QZY A;  3ECO A;  2GQQ A;  4L0Y B;  5E1Z B;  2A6E F;  4IRG A;  3EDP A;  3R6S A;  1G3S A;  2A69 F;  4HDV A;  2VC0 A;  1RUO A;  2E1C A;  1REP C;  5LHG A;  3VB2 A;  2ISZ A;  2JSC A;  5BOX A;  1WI9 A;  3ULQ B;  5HLG A;  5LGT A;  1OPC A;  2M1B A;  4O3M A;  3ROU A;  5HDN A;  4KN7 X;  3KP4 A;  1FP1 D;  3VOD A;  1O3Q A;  3KP6 A;  4ZZD A;  3H3U A;  3I71 A;  3JAM Z;  3OOP A;  4BYY A;  2OQR A;  1IN4 A;  1MJ9 A;  3ZPL A;  3WTW C;  1U78 A;  3T5X A;  1S7O A;  1QZZ A;  3CUQ A;  2D2W A;  2M8E A;  4O6J A;  2ZJ2 A;  1EH8 A;  3GLX A;  2V1D A;  3E6B A;  5K1Y A;  4WWC A;  3JTH A;  4I0A A;  1SD5 A;  2FNA A;  4BNC A;  4Q5S F;  1JHF A;  1R58 A;  4S04 A;  2QLZ A;  3M7G A;  4MQV A;  2DLL A;  4KIG A;  4M6X A;  4A2U A;  3K1M A;  3R0J A;  5F6F A;  4I02 A;  2QWW A;  3GWZ A;  2JPC A;  4Y15 A;  4EJO A;  3I0T A;  3RYP A;  5LRS A;  4XRF A;  4LFU A;  1XMK A;  4EM0 B;  1KYW A;  3E3V A;  3R4K A;  1H9G A;  1I1S A;  3Q9S A;  4EM1 A;  1I1G A;  5H6R A;  4ZYG A;  3BPV A;  3N97 A;  2H09 A;  2ETH A;  1QPM A;  3ZP5 A;  5KVR A;  5D8L B;  1U6G A;  3RJP A;  5LHI A;  2G7U A;  1TQP A;  2DQL A;  1UST A;  3P9K A;  3QPT A;  1FY7 A;  4S05 A;  3VOE A;  3E5X A;  3F8M A;  4G7H F;  3J80 Z;  4HA8 A;  4CGZ A;  2VOO A;  3MEX A;  4AIK A;  4OIO F;  1Y0U A;  4IRI A;  2E7W A;  1V4R A;  2EB7 A;  3VFZ A;  5FFX A;  1R5G A;  1HST A;  2IP2 A;  3GFL A;  5DDG A;  2BBY A;  5D8K B;  2PLY A;  3KEQ A;  1GHC A;  1OYW A;  1U8R A;  1IAW A;  3F6V A;  3Q5F A;  1D8J A;  4KIF A;  3WGG A;  3GFI A;  4U0Y A;  4WX9 A;  4UV8 A;  2P5K A;  3J80 K;  3F8N A;  2ZNZ A;  4PDK A;  1GXP A;  4HLX A;  2CO5 A;  2V79 A;  3BY6 A;  2OZ6 A;  1ZYR F;  2YPR A;  2FXA A;  1P4W A;  1ZN2 A;  2PN6 A;  1HQC A;  3QP6 A;  2L02 A;  3HTU A;  3P7N A;  3FMQ A;  4DQ2 A;  1BJA A;  5CVV A;  1U2W A;  1T38 A;  3FMR A;  2QBY B;  3GF2 A;  4AVP A;  1JGS A;  3WTX C;  3EYY A;  1R00 A;  5LRR A;  3MZH A;  3SZP A;  1A04 A;  1J0R A;  4AIH A;  2RDP A;  2FML A;  1FZP B;  4M9S A;  2HS5 A;  5DCM B;  4WXH A;  2MLK A;  1YTY A;  3JTG A;  4HX8 A;  2DQR A;  3KP2 A;  3MFK A;  2E7X A;  3L00 A;  4A12 A;  5DD4 A;  2Z5U A;  3TKY A;  2XIG A;  3Q9V A;  3IC7 A;  4HAM A;  2CGP A;  5ED4 A;  2XUB A;  3QU3 A;  1XSV A;  3BDD A;  5ICG A;  2Q2E A;  1ZAR A;  1OMI A;  2BGC A;  4LMY A;  4N9I A;  3KLO A;  1ZG5 A;  4M6Y A;  4KUM A;  4LLG F;  3ZMS A;  1O3R A;  1XMA A;  5KK1 A;  4CDG A;  5LHH A;  2ISY A;  3L9F A;  1XSX A;  2W84 A;  2EA2 A;  1G6N A;  3H92 A;  3IL2 A;  4L9V A;  1UFM A;  2IPQ X;  5J6X A;  2KIF A;  3COA C;  1IRF A;  3DP7 A;  3CUO A;  4G7O F;  5HOO A;  1BIA A;  1OYY A;  5IT9 Z;  2MH2 A;  1Z6T A;  1HW5 A;  3FHZ A;  2CYY A;  2AXL A;  1K7A A;  1OR7 A;  2EFO A;  4GYI A;  1XCB A;  1QQI A;  1O7F A;  2XAG A;  1U5T A;  2F2E A;  5AON A;  2BEO A;  5HS7 A;  4DNC A;  1BN5 A;  4KIC A;  1SD4 A;  1XGN A;  2X4H A;  5J8C A;  1E2X A;  1J75 A;  2KIM A;  4M73 A;  2RC4 A;  1IN5 A;  4ZH4 F;  3R61 A;  4PGG A;  2FMY A;  2K86 A;  3QAH A;  5IT9 K;  3V4G A;  1CF7 A;  1FSE A;  4EJU A;  3M1E A;  4A0X A;  5FGM A;  1IN6 A;  2WV0 A;  1T98 A;  2HQR A;  5HDG A;  4EGZ A;  4RGR A;  2O03 A;  3F6O A;  1LB2 A;  3WTZ A;  2MD5 A;  3BZ6 A;  4YG2 F;  2R3S A;  3GUD A;  4ENK A;  3KE2 A;  4RAY A;  1PP8 F;  1RI7 A;  3WU1 B;  4HF1 A;  2NAZ A;  4HQM A;  3FXR A;  1S8N A;  4FX4 A;  2V9V A;  4BXU A;  2XKO A;  2G9W A;  4HLY A;  1MJA A;  2TDX A;  5DD8 A;  3N4M A;  3TO9 A;  4KIB A;  4YFX F;  2HEO A;  1MD0 A;  1KU3 A;  3E5U A;  1PP7 U;  5JFR A;  4QWQ A;  3ZMD A;  5DCM A;  2EV6 A;  2L54 A;  2VBX A;  4FX0 A;  3LFK A;  2UZK A;  3MWM A;  4IHS A;  2PMH A;  3PQJ A;  1TW3 A;  2HWV A;  1W7P D;  4NQW A;  2JRT A;  2HYF A;  2STW A;  2FBH A;  4HYE A;  3V7R A;  3EYI A;  2LF8 A;  1P6R A;  3TO6 A;  3R0A A;  2CFX A;  1MZB A;  1ZGA A;  1SMT A;  2J5P A;  3W6J B;  3FX3 A;  4KN4 X;  1QBJ A;  1R22 A;  1L3L A;  4CXF A;  2X0L A;  3FMS A;  2FRH A;  4XSZ F;  3U1D A;  4WCG A;  3H3Z A;  2DBB A;  2ZBK A;  1XN7 A;  3ZMZ A;  4K2E A;  1BOA A;  4IPA A;  4L5I A;  5FD5 A;  4BHP A;  3B73 A;  4EQQ A;  1HKT A;  3KEO A;  4YIF A;  1IRG A;  4G8X A;  4MGR A;  4HDU A;  3WTU C;  1IXC A;  3O3K A;  1TLH B;  3E97 A;  2H27 A;  5F64 A;  3TOA A;  1SMY F;  2IT0 A;  5L3F A;  5ILS A;  3BOQ A;  1LVA A;  1OKR A;  1FYL A;  5BMZ A;  2ZNY A;  3DFG A;  1R36 A;  1G4D A;  3OV8 A;  1TQM A;  3EQL F;  2KJB A;  3WTY C;  3E6C C;  2LKP A;  3GZ6 A;  4HBL A;  2GIV A;  1SAX A;  4L18 B;  3BPX A;  2PBI A;  5ILU A;  3BP8 A;  2JT1 A;  2EV0 A;  1DPU A;  5D6F A;  2D45 A;  1ZHF A;  3QP5 A;  4ZZL A;  2JZY A;  3MZY A;  2VE9 A;  2L3D A;  4IXA A;  2VXZ A;  3RI4 A;  1R7J A;  2GA1 A;  5L3D A;  1T39 A;  4OMZ A;  2L4M A;  4RAZ A;  2UXN A;  4PCQ A;  1R23 A;  4L5J A;  4ZYH A;  4RB3 C;  4I2O A;  4L9T A;  3HRS A;  3K1N A;  5HLI A;  3IRQ A;  4P9U A;  4UV9 A;  4EJV A;  3ABU A;  1Z91 A;  3LQQ A;  3HSF A;  2P4W A;  1RIO H;  4MEX F;  2K4B A;  3TGN A;  1VTN C;  3NQO A;  5K5O A;  2O6G E;  1F4K A;  1O3T A;  2XAH A;  3B02 A;  2MH9 A;  1UHM A;  2DW4 A;  1TQI A;  5JHU A;  1B4A A;  2ADU A;  3JAM K;  1LEA A;  3RDI A;  2HFH A;  4GO1 A;  1HW1 A;  4AD9 A;  1MDM A;  1ZH5 A;  3DQV C;  4ZYD A;  1G3T A;  1MGT A;  5EEG A;  3SHF A;  3QU6 A;  1KU9 A;  3VEP A;  2M5W A;  1LQ1 A;  1STZ A;  1B59 A;  1F1Z A;  4UVC A;  2PMU A;  5E8I A;  4JBA A;  1FT9 A;  2FEZ A;  4HV6 A;  1J5Y A;  4U7D A;  3BJO A;  2P5L C;  2PFB A;  2OA4 A;  1YW8 A;  5CVR A;  3T8T A;  2XAF A;  5LGU A;  4UVA A;  2F5D A;  4XBF A;  1ZAO A;  2V6C A;  2ZO4 A;  1FYK A;  5DCF A;  5E17 F;  4OIN F;  1TNS A;  1YLF A;  2F5F A;  3FXQ A;  3F22 A;  3IWF A;  5D4S A;  2WTE A;  5AIP A;  1U5T B;  2QYO A;  1K78 B;  5HDK A;  2CSO A;  3ISP A;  2PI0 A;  3IRR A;  2MLG A;  2DPU A;  5F1R A;  2A68 F;  1QNT A;  4N0B A;  2YX4 A;  5L3E A;  1FC3 A;  3ZMU A;  4UVB A;  2RKH A;  4M71 A;  1KYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...