2P7VB

Crystal structure of the escherichia coli regulator of sigma 70, rsd, in complex with sigma 70 domain 4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
68
structure length
68
Chain Sequence
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Escherichia coli regulator of sigma70, Rsd, in complex with sigma70 domain 4.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Regulator of sigma D
total genus 23
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7vB00
3GF2A 2FNAA 3L00A 4OIOF 1J7KA 2EFWA 3FMQA 4I0BA 1LQ1A 2FQ3A 4CYDA 4WXDA 2HQRA 3DKWA 4A2UA 4DNCA 3DP7A 1IUYA 4CICA 5D5VB 3IRRA 2XIGA 3WE2A 1DDNA 3B73A 5L3DA 5CVIA 2VONA 1KGSA 4HAMA 1NHAA 1T39A 4RB3C 1IXSB 3WTVC 3JSPA 5AIQA 1LNWA 4UHTA 2XAJA 3MQ0A 1J2XA 1Z1DA 4EJUA 4MTEA 3TO6A 3KETA 2MBFA 4L9NA 4IHSA 3I64A 3H3UA 3HTSB 4P96A 3ZN0A 1B6AA 4G9YA 1R5HA 1YIOA 3GFJA 1Y0UA 3G73A 3F8CA 3R61A 1BM9A 5J8FA 1RUOA 1QPMA 1K78B 2RVCA 1HW1A 3HHGA 4UXNA 4BAYA 2QUFA 1IW7F 3PFIA 3KCCA 2Y0MA 2D1VA 3CLOA 2G7UA 5LGNA 2OU2A 4UNOA 2XHKA 1CF7B 1F1ZA 4LG0B 3PQKA 3GFIA 4ENKA 3QU6A 4EM0B 4EQQA 1OPCA 1K78A 2IP2A 3F8BA 4RGUA 2XRNA 3KP6A 1HKTA 2FSWA 2V1DA 3P9CA 4L9VA 2W57A 4LMYA 4JBAA 4KN4X 4EVIA 1BI0A 2KIUA 4MHGA 2DPUA 1ZARA 1I27A 3V8LA 4UUVA 4HOBA 1YO5C 3NRVA 5LRSA 3FMSA 4WWCA 5DV5A 3P7NA 3LAJA 3ZMTA 2VE9A 3ZMUA 3BJ6A 4YIIA 2GQQA 5IT3A 2EV6A 3DPTA 1LDJA 4S04A 4EJTA 4ESBA 2W84A 3DXJF 3GYHX 3J81K 1J0RA 5LHHA 3F23A 1YG2A 2KIMA 2Z9OA 4TV7A 3OOPA 1TQIA 4KDPA 1JE8A 3FM3A 3K69A 3U2RA 3K1NA 3SQNA 3F21A 2CG4A 5DD8A 2FU4A 4RGRA 3F6VA 1F9NA 4NB5A 4UVBA 2VE8A 1V3FA 2KIFA 4ESFA 1IN5A 3E6MA 4IRHA 4UVCA 1YTYA 4BXUA 3EYYA 4QWQA 3R60A 2X0LA 2G7HA 1EH8A 2OAZA 3ISPA 3DQVC 5BS6A 1DP7P 1XGOA 2QENA 2CW0F 3I59A 4LJZF 4FX0A 2EB7A 4KIGA 4ENNA 3RPUA 1KQ9A 4OIQF 4XSZF 5JI6A 5LLQA 2X4HA 5LRRA 4HF2A 3HYIA 4A0YA 4PZJA 1R23A 1WQ2A 3MEXA 2Z99A 1XSDA 2CGPA 2DO7A 4XSXF 2CSOA 3GUDA 5D4SA 2PLYA 3FMRA 1ONVA 3WODF 1BIAA 2P7CB 2QM3A 3GFLA 4XLPF 3KP5A 4EJOA 2HS5A 1ZGAA 4LD5A 3HSEA 4IPAA 3LQQA 5DCFA 1V4RA 4LLGF 2EFPA 2M1BA 2L54A 3ECOA 2PBIA 4I98B 3RKWA 1O3SA 4ENMA 1MGTA 1HW2A 1TW3A 3GEZA 1GVJA 3KP4A 3CDHA 2CO5A 2JRTA 3WGGA 3M8EA 2JT1A 4E70A 2D1HA 4OMYA 2FXAA 4A12A 2QYOA 1F4KA 2O8XA 1JXSA 2K4BA 4HLYA 3RTRA 4HV5A 4AIJA 1YLFA 3C18A 1FZPB 3EUHA 1BOAA 2L02A 3CO7C 2MH9A 3K2ZA 3MAJA 4OOIA 1J75A 2Y75A 2QQAA 1PP8F 2QBYB 2OD5A 3E6BA 1IRGA 4IRIA 3ABUA 1KU9A 3QPTA 1J9IA 3DF8A 4L9JA 1MKMA 1OYIA 2IA2A 3M1EA 1WKMA 3LA7A 2HR3A 2PG4A 5FLXK 2GZWA 1J5YA 2HDCA 2JPBA 2NYXA 2ZKZA 5AIPA 2EFNA 4EGYA 2HQNA 2DAOA 4ZYEA 2O61A 4CDGA 1WRJA 2GAUA 2VOPA 2PFBA 4L18B 4GCVA 3HRTA 3W6JB 4UVAA 4BNCA 5E18F 4KYWA 2P6SA 1MJ9A 4CXFA 3DV8A 3BP8A 2KKOA 3CTAA 1TBXA 2IVMA 2BBYA 5E20A 3QU3A 4PGGA 3I4PA 1U2WA 3CUQC 2OBPA 1IN4A 1Q1HA 3RIRA 2R7FA 4AIKA 1IXCA 2STTA 2VT3A 2VBXA 5F6FA 4ENJA 3G3ZA 2A3SA 4BHBA 1O3RA 5D6EA 3TDZC 3VFZA 2GXGA 4GXOA 3GVAA 4B09A 1TNSA 5DEQA 3REOA 3H92A 4KICA 4AD9A 4UV8A 5D8KB 4XLNF 4FT8A 2QBYA 4R79A 1O7FA 1BC8C 2V9VA 4HA8A 2UZKA 2XAFA 3HSFA 3ZMSA 2LF7A 4N9IA 3BPXA 5KVRA 3QPHA 5ERIA 5BQTA 2BYVE 3W6KB 1JGSA 1W5TA 1HSJA 4Y15A 1FYKA 2HTSA 1R22A 1QBJA 1FWZA 4R8HA 1S3JA 3Q9SA 1R1UA 1L0OC 3JTGA 4JK1X 1P4XA 2F5CA 1G3WA 4U7BA 2V1XA 3GFMA 3QP6A 1TQMA 4CO8A 5JR3A 1USSA 2HYFA 1REPC 4WX9A 1KU2A 3GZ6A 3ECHA 1KU7A 4H0EA 5HS9A 4DQ2A 2HYGD 5ILVA 3MWMA 3ULQB 1RI7A 4HQMA 3NQOA 1T38A 5DD4A 1U6GA 3WTTC 4KN7X 3V8JA 1TNTA 1SFXA 5HVQC 5CVUA 1FPQA 3TOAA 3ELKA 1BJAA 1WI9A 1YW8A 3GW2A 4I02A 3L9FA 4P9FA 4RAZA 1Z7UA 5AONA 1FOKA 1YFHA 1E2XA 1L3LA 1W5SA 3QRFF 3C7JA 1D3YA 4Q4ZF 4YFKF 3K9TA 2F5DA 2ZMEB 3T5XA 2FBIA 2H6CA 2A6EF 3EETA 1KYZA 1XMKA 1MDMB 4XRFA 5L3GA 3F8NA 3BJOA 5HLHA 3I54A 1FYMA 3JAMK 3TGNA 1R1VA 4EM1A 3MFKA 3P9KA 3I58A 1ULYA 2OZUA 5FO5A 4GGGA 5L3EA 1ZHFA 3WTZA 1D8JA 5ILUA 2Z33A 1PP7U 2ACJA 3HOSA 5H6RA 3OV8A 1Z9CA 3IKTA 4CZZA 1YW9A 2M30A 2F2EA 5FGMA 2P7VB 5LHGA 2O03A 1XCBA 2FA5A 4Y13A 2VN2A 4IRGA 2NRAC 5F1RA 2GIVA 1DPUA 2E1CA 2ETHA 3ZN1A 1TQPA 2QZ8A 5IT9K 4HW0A 3N97A 4KFCA 1O3QA 1Z6RA 5HDNA 4Q47A 3E5UA 2GWRA 2ZMEA 1YS6A 3BWGA 1EV7A 2ISZA 2LDUA 4WK8F 4HDUA 3V8KA 1ZN2A 3LAPA 3KE2A 3VB2A 2E7XA 2A69F 2ESHA 4FHTA 5CVVA 5D5XB 3KZZA 1YQAA 5DUKA 3CUQA 2ZNZA 4I0AA 1I1GA 2STWA 3KP3A 1YYVA 1XCVA 1WSUA 1ZG5A 2PN6A 3EQLF 3WGIA 1DPRA 2XROA 2XAGA 1SD6A 3SZTA 2VOOA 3ROUA 4O6JA 3WTXC 3RKYA 3I53A 4MQVA 3WGHA 2XAHA 4MEYF 2P5LC 4ESJA 2BGCA 2LKPA 2Y48A 2ZCWA 4BQAA 1U5TB 1E17A 3RYPA 1AOYA 4LB6B 1XD7A 4LGWA 1USTA 4M9XA 2NNNA 2L4MA 3ZMDA 2GA2A 3E5QA 5BPIA 1XGSA 3F6OA 4QLCU 3K1PA 4G6QA 2F5EA 3GO5A 1MZBA 4A0ZA 3ML6A 1SMYF 3KZYA 3RPQA 2JTVA 3HRSA 1AWCA 1I1SA 2XV4S 2WTEA 4GO1A 4RB0A 2BV6A 1HQCA 1B9MA 5E1ZB 4JQFA 2RKHA 3ZMVA 4IVNA 2DW4A 1MJAA 3CO6C 3V7SA 3QP5A 3J80Z 3FF5A 3BJAA 3JTHA 3TKYA 3HSRA 5A2QK 4OMZA 4AVPA 3PQJA 2E7WA 4MQ9F 4M6XA 1S6LA 2EWNA 2DTRA 3K1MA 3WG9A 2FRHA 4GYIA 4EGZA 2O6GE 3I0TA 1HKQA 2YPRA 4MGRA 1SAXA 1CGPA 1KU3A 2M5WA 4EV0A 2LF8A 1GXQA 1BN5A 4KA4A 1UB9A 4HX4A 2DK5A 2KJBA 1LEBA 1KQ0A 3FHZA 1P2FA 2DQRA 5JVTA 5L3BA 2IW5A 5K5OA 4Q5SF 1ODDA 2OZ6A 5E1XA 3J81Z 6PAXA 3RYRA 5HDKA 2UXXA 2QQBA 2ZFWA 4KIBA 1LVAA 4OIRF 1PUEE 1IF1A 3F22A 5FFXA 3WE3A 1XDSA 5DCMA 1U5TC 2WV0A 2K7LA 4OINF 1C0WA 1OYYA 3WTUC 1QQIA 2XGXA 2JPCA 1ZG1A 4EMSA 2R3SA 1OYWA 1O57A 5CJ9A 1FNNA 2R7DA 2COMA 3HHHA 3E6CC 1IZ1A 4U0VA 5HDGA 3LQRA 5ED4A 1QZYA 2M45A 2IRFG 2XUBA 2W25A 4M9SA 5JFRA 3EYIA 3GLXA 1X3UA 4I09A 1ZH5A 3S2WA 4RB2C 3E3VA 4KIFA 4G7OF 1JHHA 3T8RA 2RQPA 3GWZA 2CYYA 1R5GA 3IWZA 1RZ4A 4PDKA 3R0JA 2P8TA 4HZFA 2VXZA 4EJVA 4RGSA 3WTSC 4WXHA 3GXOA 3V4GA 3COAC 1FSHA 1QZZA 2EK5A 3WTWC 5BOXA 2A68F 5HOOA 2RDPA 3IRQA 1DUXC 2BEOA 2DI3A 4IHTA 1KA8A 4M72A 4NHJA 2B0LA 1W7PD 1ZRDA 3B02A 1P6RA 1XB4A 3WU0A 4G7ZF 3VOEA 5D5UB 1FP2A 2P6TA 2Z3YA 5BMZA 3TOBA 1IAWA 2Q8KA 1K7AA 2JSCA 3Q9VA 3VODA 5D8LB 3P9IA 3SZPA 4K2EA 1STZA 3FX3A 1T6SA 3T1BA 2V6CA 4Z2YA 5F64A 1KYWA 3U9GA 2UXNA 2L4AA 3AAFA 2HEOA 1SMTA 1FX7A 2LNBA 1BIBA 1UCRA 1O3TA 1A04A 2Q0OA 1W4MA 4BHCA 1EH6A 2IJLA 3L7WA 3T8TA 1JHFA 4ZYHA 2DLLA 3IHUA 4LFUA 2DBBA 1PDNC 4I2OA 4M73A 4IJAA 2OA4A 3FXQA 1TTYA 3ABTA 1R36A 3RDIA 2IPQX 4O5VA 3RJPA 5TJJA 2DFIA 4AWXB 4IF4A 2EJRA 3Q5FA 3T0YA 1VTNC 4S05A 1F5TA 3F3XA 2QQ9A 2OQGA 2PMHA 4HYEA 4P5OA 3IWFA 5D5WB 1Z05A 2DU9A 2LSOA 3JSOA 1U78A 5E1WA 5BPDA 1FBQA 5E8GA 2P5VA 2Q2EA 4HDVA 2MA3A 2HZTA 2EA4A 1XSVA 3TDUC 3HRUA 5TRDA 5A2QZ 1LB2A 1QNTA 4RAYA 1BC7C 2K4JA 3E6DA 3I71A 2BE5F 2VBZA 4UV9A 2M87A 3JW4A 2WWYA 2M8EA 4CHUA 2XAQA 2YU3A 1W7PA 2XKPA 3I5UA 2H09A 4L0ZB 2VT2A 2ESNA 4CGZA 2PI0A 3FWEA 3H3ZA 3BPVA 1HW5A 2DQLA 1QO0D 3QOPA 2D2WA 4EJWA 4NQWA 2EV0A 2HOEA 5J6XA 2ZJ2A 2HKXA 3LA2A 4HX7A 2PJPA 5H6QA 2OQRA 3TO9A 2ZXJA 5K5RA 2YSRA 4YFNF 1G4DA 3GZ5A 2IA0A 4L5JA 2L3DA 3C3WA 3SXYA 5LEJA 2EV5A 2MH2A 4HV6A 2ISYA 3O6BB 2MD5A 1ZRCA 4RGXA 5DCMB 4A0XA 4L0YB 2CFXA 5E17F 2RC4A 4F7ZA 1ZLJA 4A6DA 2EFQA 3MCZA 3BOQA 1QGPA 5DYMA 2NAZA 2V79A 2MLKA 5LBQA 1P92A 2F5FA 2VBYA 1RNLA 2O3FA 2RN7A 4Q48A 2H94A 1T2KA 4HQEA 1LDKB 4YFXF 4D0PA 4I01A 4AIHA 3R4KA 1HBXG 3MZHA 5HLGA 2MC3A 2FE3A 2VBWA 3C1DA 1ZRFA 1XSXA 4I7HA 5CLSA 1K6OA 1SD7A 5LGUA 5LEKA 2FMYA 1R7JA 3NEUA 2PMUA 1FC3A 1TW2A 4OU0A 1BI1A 1LEAA 4M6YA 3LFKA 1U3EM 1FY7A 4MTDA 1Z6TA 5CYVA 2YR2A 2P5KA 3F8MA 3KFWX 1UHMA 1FBSA 3LWFA 4HBLA 1OR7A 1S8NA 3MZYA 3U1DA 5ICFA 3JAMZ 2DK8A 5K1YA 2L01A 4LK0F 1U5TA 2FNPA 4HLXA 4ON0A 3ZQ7A 2XKOA 3O2PE 1SFUA 2ELHA 2FEZA 3BY6A 3TO7A 1CF7A 4G7HF 3I59B 1O7LA 3V7CA 1Z91A 1S29A 1MJBA 2C6YA 1OKRA 2HTJA 2FOKA 2V1UA 1G3TA 1H9TA 4HF0A 1FBUA 2H6BA 4LB5A 1W7PB 1KQ8A 2JZYA 5FB2A 4FX4A 4G6DA 4BYYA 3CUQB 2WC2A 3KEOA 3HIFA 1ON2A 1S7AA 2K86A 1ZGJA 3O3KA 2FBHA 1BI2A 4P9UA 1EH7A 3KP2A 3HUGA 5FD5A 2A07F 4L5IA 4U0YA 2A61A 2QWWA 3DEUA 1SD5A 2NNYA 5ICCA 2GXBA 1IN6A 3HRMA 5FD6A 1MD0A 5D6FA 4LK1F 3FZVA 3D5LA 1G6NA 3TQNA 5EEHA 4LG0A 4M74A 2FF4A 2W24A 1ZREA 2DPDA 4YG2F 4KNYA 3IC7A 2RNJA 5E8IA 1BI3A 1OMIA 5HS8A 4YIFA 1BBYA 2K02A 2NS0A 1P4WA 4B8XA 2KJCA 3KP7A 3IL2A 4N0BA 2EFOA 3V7RA 1FT9A 1LJ9A 2YX4A 1UFMA 1XGMA 1I6XA 2K27A 2RGVA 3J80K 4ETSA 1ZYRF 2O0YA 5ICEA 1UHWA 2QLZA 4KMFA 2P4WA 3KLOA 5IT9Z 2XASA 3BZ6A 3ZPLA 1HKSA 1RIOH 5D4RA 5ICGA 1FLIA 4KT5C 4U0WA 3WU1B 4GYGA 4LLNA 3RKXA 5JHUA 3IKVA 1FSEA 1T98A 1G3SA 3DPLC 4MNUA 5ILSA 2PQ8A 1XGNA 3E5XA 3BDDA 4BHPA 1H9GA 3F8FA 4R1HA 1P4AA 3LSTA 3ZMZA 2D45A 3KLNA 2HKOA 1IN8A 3HTUA 3SFZA 4IXAA 5L3FA 3ERED 5FLXZ 3D0SA 2Z5UA 1IRFA 2IT0A 2XVCA 3F72A 1B59A 4BH9A 4PCQA 1SD4A 4RB1A 3VEPA 4U7DA 4M9ZA 2TDXA 4XBFA 4O3MA 3M8FA 1WWXA 1FYLA 2VC0A 2CQKA 5KK1A 5LHIA 2CWEA 1ZAOA 1D8KA 3FM5A 2ZNYA 5K5QA 2GA1A 4PGHA 2A6HF 4U88A 4A6EA 2AS5F 1B4AA 1B9NA 1LDDA 4N9HA 5DUIA 3LA3A 3L2CA 3DFGA 1I5ZA 3ZP5A 3BROA 2E1NA 1R00A 4LLLA 4M71A 3K0LA 5LGTA 4L9TA 3R6SA 2G9WA 1D5VA 4WF2A 3HOTA 4G8XA 4P55A 2J5OA 1H0MA 1B1BA 2MLGA 3FXRA 1S7OA 3CUOA 4ZZDA 2VC1A 3L09A 4ZZLA 1XDUA 1MDMA 1GHCA 3M7GA 4KMUX 4A5NA 2KRFA 1J59A 4MEXF 4WXCA 2AXLA 2FMLA 1SFEA 2VODA 3GX4X 2EA2A 5J8CA 4HX8A 1XN7A 1IXRC 2RV8A 2HWVA 2PEXA 1ZG3A 5CVJA 4ZYDA 5DDGA 3FXUA 5H20A 2A5YB 2DT5A 3WTYC 1FP1D 3J7AO 1XMAA 3RI4A 1ON1A 2IA1A 1YW7A 1HSTA 3KEQA 5L3CA 1RUNA 4G94A 1ZLKA 1R1TA 1G3YA 1HXDA 2HFHA 4ZYGA 4ASNA 3N4MA 1YS7A 1K79A 5CVRA 3EDPA 1U8RA 1TLHB 1T0FA 3SHFA 5EEGA 2QVOA 4Y17A 2HGCA 2J5PA 2H27A 5HS7A 2ZO4A 4EM2A 3CJNA 1GXPA 3QAHA 4ZH4F 4RS8A 5HLIA 3M9AA 4A5MA 3R0AA 2ADUA 4WCGA 5FFZA 2UWMA 1IN7A 2W85A 2YX7A 2FBKA 4HF1A 1R58A 2ZBKA 3E97A 4OIPF 4KUMA
chains in the Genus database with same CATH superfamily
3GF2A 3O8HA 2FNAA 3CCQI 3L00A 4QTRA 2WAQN 3PL8A 2EIKH 4OIOF 1J7KA 3LSHA 1TWAJ 2DA7A 2EFWA 3FMQA 4I0BA 2R7ZJ 4A93J 3C2GA 3EPZA 5J40A 5F1JA 4A3FJ 1LQ1A 1BJZA 2FQ3A 4CYDA 3CMMA 4WXDA 2HQRA 3DKWA 3QOEA 4A2UA 2EILH 2QQ8A 4DNCA 2ICWG 3DP7A 1A6QA 1IUYA 4CICA 1VFCA 5D5VB 3IRRA 2XIGA 4MO7A 3WE2A 4XLHA 1DDNA 2HI3A 1D5YA 3B73A 3K70C 5L3DA 5CVIA 2COBA 4PK4A 2VONA 1KGSA 1OCCH 2F5VA 2D5VA 4HAMA 1NHAA 3BC8A 5M5WJ 1T0FC 1T39A 4RB3C 5GP9A 5EG0B 4MIMA 4KT6A 2IGKA 2M34A 1IXSB 3WTVC 1LVKA 5AIQA 1LNWA 3VYRB 3JSPA 1QU3A 4UHTA 2ELJA 2F4MB 3LSGA 3P5JA 2XAJA 3MQ0A 5F0FA 1J2XA 4OAYA 1Z1DA 3LSMA 3HB9A 4EJUA 1RKWA 4MTEA 3TO6A 1VQNI 1ZR4A 3KETA 2MBFA 2K3FA 3S3OA 4L9NA 2DMPA 1PUFA 4LIUA 4GFBA 4IHSA 3I64A 3H3UA 3FISA 5IOYA 3HTSB 2CQ7A 3M1CA 4ZDPA 1VQOI 4P96A 5GPAA 1B6AA 2KL4A 3ZN0A 3L2QA 3CCJI 2R5YA 3H0DA 3UKGA 1FOWA 1T56A 4G9YA 1R5HA 3ZGKA 1HF0A 1UG0A 2KT0A 1YIOA 3GFJA 1Y0UA 3G73A 3F8CA 5K7FA 1E3HA 3R61A 1BM9A 2E1OA 3CP2A 4BS9A 5J8FA 3W3CA 1QPMA 1RUOA 1K78B 4P1WA 4IX7A 4CYCA 2WADA 2V1NA 3VYSB 3ZQFA 2A5WA 5EF6A 2RVCA 4D5CA 1YRNA 2CFOA 2LYCA 1EKEA 1HW1A 1R4NB 3HHGA 1B72B 3GTLJ 4UXNA 4BEHB 5K7HA 4BAYA 2QUFA 1IW7F 3PFIA 3KCCA 2Y0MA 2D1VA 3CLOA 4CCMA 2G7UA 2L9NA 2BVMA 2X1EA 5LGNA 2OU2A 3PFYA 5IP6A 2DA6A 4UNOA 1Y8RB 2XHKA 3G1LA 1CF7B 1QA6A 2PX9A 5JLXA 1N77A 2LY2A 1F1ZA 4LG0B 3PQKA 1QZEA 3GFIA 4ENKA 3QU6A 3S16J 4EM0B 4EQQA 1OPCA 1K78A 2IP2A 2LFBA 1B8IA 2V9PA 3F8BA 4NC8A 4RGUA 1V5EA 2XRNA 3KP6A 2ELKA 1HKTA 1X1AA 2Z1DA 2FSWA 2HNHA 2V1DA 4V19K 3A03A 4IHWA 1RC9A 3P9CA 2R7WA 4JOMA 1UELB 4L9VA 5FLVA 2W57A 2ZSHB 1JT6A 4RM3A 2HXOA 2IGMA 2W48A 4LMYA 5EGOA 1D1CA 2CJJA 4JBAA 2IXSA 4KN4X 2VPRA 4RM2A 3ZR8X 4EVIA 1BI0A 2KIUA 4MHGA 4AM3A 2DPUA 1ZARA 3GTGJ 1I27A 3M8JA 3V8LA 4D7NA 2P81A 4UUVA 4HOBA 2F6CA 2Y0SA 1YO5C 3NRVA 3GCMA 2IS6A 5LRSA 2PJRA 4PFOA 3FMSA 4WWCA 5DV5A 2Q2EB 3H9QA 2NOJB 3P7NA 3ZMTA 3LAJA 2VE9A 3ZMUA 3BJ6A 4YIIA 2NXNB 2GQQA 4LOCA 3KYDB 4RAGA 5IT3A 2EV6A 3DPTA 1LDJA 4S04A 2NOGA 4EJTA 2WBMA 4BQNA 4ESBA 2W84A 3DXJF 3GYHX 3J81K 1J0RA 2RAEA 5LHHA 3MKLA 3K4JA 3BG7A 3K4MA 3F23A 1YG2A 2KIMA 3S32A 4TV7A 2Z9OA 3OOPA 1TQIA 3WHBA 1R71A 4KDPA 1JE8A 3OL3A 3FM3A 1HDPA 1WJEA 3K69A 3U2RA 2PJRB 3IUOA 3K1NA 4H4KC 3TEDA 3SQNA 1E3PA 1SAUA 3F21A 2CG4A 5DD8A 3FKIJ 2FU4A 1KZHA 3VYTB 4RGRA 5LFAA 2ME0A 3F6VA 1F9NA 4NB5A 1HDDC 3A1YA 3HDDA 3DPUA 1WH5A 4UVBA 3TBIA 2VE8A 1LFUP 1MBKA 1WJBA 1D1AA 1V3FA 2KIFA 4ESFA 1IN5A 3E6MA 4IRHA 4UVCA 1OISA 1YTYA 3HOXJ 2FX0A 2O5RA 3X2QH 4M3FA 5J4YA 4BXUA 2OF7A 3EYYA 1ETYA 4QWQA 3CF5F 2NVUB 4ZTJA 3R60A 1TT5B 2X0LA 1YJWI 2G7HA 2BXYA 4RA2A 1EH8A 3ABKH 3BTJA 2OAZA 4FQGA 3LMMA 3ISPA 3DQVC 5BS6A 1DP7P 3AG2H 2CUEA 1QPIA 1XGOA 2QENA 4UUSB 2PMZN 1F36A 2CW0F 2G0EA 3I59A 4LJZF 1T33A 2DTZA 4FX0A 2EB7A 4KIGA 4ENNA 3RPUA 1KQ9A 1Z3YA 4OIQF 4XSZF 2E71A 2XC7A 2F4IA 5JI6A 3SEQA 5LLQA 1DGWY 2X4HA 5LRRA 1VF9A 3BR2A 4HF2A 3HYIA 1T8IA 3S3NA 2K3PA 4A0YA 2XSDC 4PZJA 1R23A 1EJ9A 2V6EA 2MW8A 1AKHA 1WQ2A 2DCEA 3MEXA 2Z99A 2MG4A 3OS0A 1XSDA 1OJLA 3DEEA 3EUHC 3S17J 2CGPA 2DO7A 4XSXF 2K9SA 3QWLA 4NC6A 1XX5A 2CSOA 3GUDA 2CS3A 1MMDA 5D4SA 2PLYA 3FMRA 1R5ID 1ONVA 1ZELA 4CYCB 1H88C 2QKLB 2NVYJ 2YS9A 3DCFA 3EUAA 2JA8J 3WODF 1BIAA 3SFIA 3OSFA 2ZXWH 2P7CB 2OJED 3HM5A 2QM3A 4GRIA 2JVGA 2YU9J 3GFLA 4XLPF 2MSYA 3KP5A 4EJOA 2HS5A 3PNYA 2ID6A 1O4XA 1ZGAA 2DYSH 4LD5A 3K10A 3S8PA 3A4CA 2MD0A 3HSEA 4IPAA 2M0MA 3OWTA 3V42A 3LQQA 5DCFA 5E3NA 1V4RA 1XC5A 2DA1A 3RPUD 4LLGF 2EFPA 3S93A 4PJLA 1MSFC 2CMPA 2VIXA 4CSWA 5M3MJ 4NUBA 2E2JJ 3G1MA 1UHSA 1NH3A 2OUMA 2M1BA 5GTIC 1ITYA 2L54A 5CKTA 3BR1A 4A3CJ 3K4CA 2VL8A 2X6XA 2DJNA 3ECOA 2PBIA 3G4SI 2EZHA 4I98B 5J3LA 1TWGJ 3RKWA 1SVMA 1O3SA 4ENMA 1MGTA 3H0GJ 3MKYB 1HW2A 3EUKL 1TW3A 1VQ7I 2LTPA 3I4NJ 3GEZA 1GVJA 3KP4A 1FOXA 2F4OB 3FIWA 3LSRA 2VJJA 4BQQA 3CDHA 2CO5A 2JRTA 3WGGA 2JA7J 3M8EA 2JT1A 5JHFA 2VKHA 3CMEI 4E70A 1ETKA 2D1HA 3TP3A 4D1QA 4OMYA 2FXAA 4A12A 2R7VA 2KRHA 2EIJH 2QYOA 1F4KA 2O8XA 3LSKA 3KPHA 1JXSA 3DEWA 2K4BA 1UMQA 4UB6C 2BZTA 4BKXA 2QEXI 4HLYA 3RTRA 4HV5A 1IRXA 4AIJA 2HDDA 1XG1A 1YLFA 1YJNI 1FTTA 4B43A 2ZFUA 3C18A 2E1MC 1FZPB 3EUHA 1BOAA 2L02A 3CO7C 2GOMA 2O7OA 2MH9A 3K2ZA 1Z0XA 1YIJI 3MAJA 3QODA 3ASOH 4OOIA 2NVTJ 2K40A 1J75A 3AKZA 2Y75A 2QQAA 1PP8F 1VQKI 2XPVA 3BR5A 2BOLA 3DTEA 2PMZA 2QBYB 2LMDA 2OD5A 3E6BA 1IRGA 4IRIA 3ABUA 1BR2A 1KU9A 2M0CA 3QPTA 1J9IA 3DF8A 4L9JA 1MKMA 4DYQA 1OYIA 2IA2A 3DWLE 3M1EA 1ZKGA 3BQZA 1WKMA 1IRZA 5EDNA 3KZIC 2VKVA 3LA7A 2CRGA 2HR3A 2PG4A 4ZTFA 3L2VA 5FLXK 3VSKA 2FJ1A 2GZWA 5KHDA 1J5YA 5DM7F 2HDCA 2JPBA 3WHCA 2NYXA 2ZKZA 5AIPA 1T08B 4HEA2 3CCUI 2EFNA 4EGYA 2DOAA 1MBEA 2HQNA 2DAOA 2ZXHA 4ZYEA 5JLWA 3IH3A 2O61A 4CDGA 1WRJA 5C4JJ 2GAUA 3KIOA 2FD5A 2PFBA 4L18B 2VOPA 4GCVA 3HRTA 3BG3A 1AHDP 4E7SA 3W6JB 4UVAA 1Y1WJ 4BNCA 5E18F 4KYWA 2OC6A 2P6SA 3NARA 3AG3H 4JX5A 1MJ9A 3CF2A 4CXFA 2NS7A 3DV8A 3BP8A 2E2IJ 2KKOA 2QF7A 3G1OA 3CTAA 3O8GA 3JRDA 1W0TA 1TBXA 1BL0A 1D0XA 2IVMA 2BBYA 3B6AA 5E20A 3QU3A 4PGGA 5J1YA 4AU7A 3I4PA 1U2WA 4IO9F 3CUQC 2OBPA 1IN4A 1Q1HA 3BTLA 3RIRA 5HNHA 3W6VA 1OCOH 3ZQGA 2R7FA 3DBRB 4C2TA 2TCTA 4M3DA 3K70D 4A3EJ 3PIOF 4AIKA 4CCKA 2L7KA 1GT0C 1IXCA 2STTA 2VT3A 1S5LC 2VBXA 4BACA 3BG5A 5F6FA 3G3ZA 2A3SA 4BHBA 3L1PA 4ENJA 3BR6A 1O3RA 4UY8I 5GAEJ 5D6EA 3OYDA 3TDZC 4N4OB 3DTIA 3VFZA 1TWCJ 2GXGA 1TT0A 4F52A 4GXOA 3GVAA 4B09A 3KYLA 1TNSA 1J09A 2DMTA 5DEQA 3REOA 4ITVA 3H92A 4KICA 1NTCA 4ANJA 3OS2A 4NDLA 4AD9A 3FXLA 4UV8A 1PVEA 5D8KB 4A3IJ 4XLNF 3K2AA 4FT8A 3GTOJ 2QBYA 2MABA 3OYGA 4HRIA 2R7TA 4R79A 3ZCOA 1Y8QB 1FIPA 1FMWA 1O7FA 3ZQLA 1BC8C 4BJ5C 1JUSA 2M9HA 2X48A 2K85A 2V9VA 1R4MB 3I4MJ 1VQ5I 4HA8A 2UZKA 5HNFA 1JTXA 2VJ5A 3BZCA 2E36A 2XAFA 3HSFA 1A31A 3TMOA 3OSGA 4IHVA 3DU6A 3QPSA 4FASD 3ZMSA 2LF7A 4N9IA 3BPXA 5KVRA 3S14J 3QPHA 2E5NA 4G6TB 5ERIA 5BQTA 2BYVE 2V7FA 1JI8A 3IH4A 3W6KB 5IY5H 3HEFA 1JGSA 1D0YA 1HSJA 1W5TA 4Y15A 1FYKA 5FRMA 1DP3A 2HTSA 1R22A 2ZB9A 3W2AA 4IEJA 1AKHB 1IG7A 4Y33A 1OLTA 1QBJA 1FWZA 3CJQB 4R8HA 4RLQA 1S3JA 5B3SH 2Y30A 2M7AA 3Q9SA 4MLOA 1R1UA 4LG3A 2R7SA 1L0OC 2E60A 3JTGA 4JK1X 1MNEA 3S15J 1P4XA 2Y31A 2F5CA 3OYMA 3DTKA 3ZRGA 1G3WA 2ZSIB 2DXIA 1QVTA 4U7BA 5JVGF 1OQYA 2ZJRF 2V1XA 3GFMA 4CH7A 3QP6A 4AC0A 1TQMA 1MIJA 1ACIA 4CO8A 5JR3A 3CDIA 1USSA 2HYFA 1REPC 4BBSJ 5B1BH 4WX9A 1KU2A 5HODA 3GZ6A 3ECHA 1KU7A 3GTJJ 4H0EA 5HS9A 4DQ2A 2HYGD 5ILVA 2CUZA 2KDOA 3MWMA 3JRCA 2JSPA 3FK6A 2DYRH 3ULQB 1RI7A 4BJTA 3CCVI 1JUMA 4HQMA 2X6OA 3NQOA 1T38A 2VQHA 5DD4A 1U6GA 3WTTC 4KN7X 2FOWA 3V8JA 1TNTA 1SFXA 5HVQC 1YITI 5CVUA 5B66C 1ETWA 2JJ7A 1E0EA 3WG7H 1FPQA 3HOWJ 3TOAA 1BR4A 3Q0WA 3C2HA 3ELKA 1Y0NA 1APLC 1BJAA 1WI9A 1OCPA 1YW8A 3GW2A 4I02A 3L9FA 3HBLA 2Z16A 4E7KA 3B6CA 2BHYA 4P9FA 4RAZA 1Z7UA 5AONA 3DU5A 1FOKA 1FEXA 1YFHA 1E2XA 3H5RA 1L3LA 1W5SA 3QRFF 2ZXIA 3S2HJ 5EZHA 3C7JA 5J1RA 2E35A 1D3YA 4BE1A 4Q4ZF 4YFKF 3K9TA 5J1UA 2F5DA 2XPUA 2ZMEB 3T5XA 4XKVA 2FBIA 2H6CA 1BW6A 2A6EF 3EETA 2IS1A 1WJFA 2DJIA 4RMNA 2M4GA 1KYZA 4C2UA 3G71I 1VQPI 1XMKA 4B47A 2L2OA 4NBQA 1MDMB 5IYBJ 4DBQA 2LK2A 4XRFA 5L3GA 3F8NA 3BJOA 5HLHA 3I54A 1FYMA 3JAMK 4BBRJ 3TGNA 1R1VA 2QCOA 2LOOA 4EM1A 3MFKA 3AL0B 3P9KA 5IP7J 1FJLA 3I58A 1ULYA 2OZUA 5FO5A 4GGGA 2AQFA 5KAFC 1ZQ3P 5L3EA 1ZHFA 3RCOA 3WTZA 4DOZA 1D8JA 5ILUA 2Z33A 1QHGA 1YX3A 1PP7U 2JK3A 2ACJA 3HOSA 5H6RA 3OV8A 1Z9CA 4XN3A 3IKTA 4CZZA 1YW9A 2M30A 1WHUA 3A0BC 2R92J 2F2EA 5FGMA 2P7VB 5LHGA 5F04A 4JX6A 9ANTA 2O03A 5FKKA 1XCBA 2FA5A 4Y13A 4IHYA 2VN2A 3BT9A 1IC8A 4IRGA 2KIQA 3K4LA 3NWSA 2NRAC 1WJ5A 4DYRA 2XSJC 3CJTB 5F1RA 2GIVA 1DPUA 2HPIA 2V9KA 2E1CA 2ETHA 2JUGA 4A3KJ 3PUBA 3ZN1A 1V5GA 4HNTA 1TQPA 3H3VK 1GLNA 2DDAA 2QZ8A 3I3LA 3SZGA 5IT9K 4HW0A 3GBGA 3N97A 2X9DA 5EYRA 4KFCA 2WAEA 4OWRB 1A5JA 4D9JA 1O3QA 1Z6RA 3HZJA 5HDNA 1IJWC 4Q47A 2N8GA 3E5UA 2GWRA 2ZMEA 1IDZA 1YS6A 3BWGA 1EV7A 2ISZA 2LDUA 2I10A 2L7MP 4WK8F 1MMGA 4HDUA 2HOTA 3V8KA 4LIVA 2WB1A 2KP6A 2LG4A 1ZN2A 3LAPA 3KE2A 1N75A 4PSWA 2E7XA 3D5RC 3VB2A 4II3A 2A69F 2ZJPF 1BR1A 2ESHA 2JUCA 4FHTA 5CVVA 3HG9A 2M2EA 5D5XB 3KZZA 5C3EJ 1YQAA 3K4NA 4OAZA 5DUKA 3HPGA 2XGCA 3CZ6A 2CU7A 1CQTA 3CUQA 4A3JJ 2ZNZA 4I0AA 1I1GA 2DFFA 1K61A 2STWA 3KP3A 2R5YB 1YYVA 1XCVA 2Y9ZA 3CC4I 5C44J 1JUPA 1WSUA 2XF5A 2WA0A 1ZG5A 1X2NA 3HGYA 2PN6A 1Y39A 2I5UA 3EQLF 3WGIA 1DPRA 1Z67A 1HA8A 3OIOA 2XROA 2XAGA 2K9QA 3SDGA 1SD6A 3SZTA 1E3OC 2VOOA 3ROUA 2GLOA 3A02A 2X6YA 4O6JA 3WTXC 3HC7A 1ZTRA 3RKYA 3I53A 4MQVA 4XRSG 3OYJA 4E7JA 1X4OA 3HOZJ 3WGHA 2XAHA 1AU7A 2L9RA 1FOYA 2MYSA 4MEYF 2BW3B 1B8IB 2P5LC 4ESJA 2BGCA 2LKPA 1NG6A 2Y48A 2ZCWA 4BQAA 3KX2A 1U5TB 1E17A 3PM1A 5GAHJ 5FRNA 1SFOJ 1T95A 3RYPA 1AOYA 4LB6B 1XD7A 4LGWA 1MMNA 2X6WA 1USTA 4M9XA 2NNNA 1PYVA 2L4MA 1S7EA 3ZMDA 2GA2A 4XKBA 3E5QA 5E3MA 1WJCA 2EIMH 2QSHX 5BPIA 5F27A 3K6GA 1A36A 1XGSA 3F6OA 4QLCU 3K1PA 3S1NJ 4G6QA 2DMNA 2F5EA 3FXKA 5IYCJ 3OY9A 3GO5A 1MZBA 4A0ZA 3ML6A 1TC3C 1SMYF 2LREA 3CCYA 2LLKA 3KZYA 3RPQA 2JTVA 3HRSA 1IV6A 5KCMA 1MBJA 1AWCA 3MZ8A 4XK4A 1JKQC 1I1SA 3H36A 3MMYB 2XV4S 1W1WE 2WTEA 4GO1A 4RB0A 2BV6A 1HQCA 2MFZA 1B9MA 5E1ZB 4JQFA 2RKHA 3ZMVA 2JQ7A 2I8DA 1QRYA 3CQZJ 4IVNA 4CUGA 2JMWA 2IS4A 2DW4A 4XMYA 3OYNA 3FKJA 1MJAA 2M7BA 2XGEA 3CO6C 2WAQA 3NAUA 3QP5A 3V7SA 4B3AA 3J80Z 3HJEA 5GAGJ 4M3GA 3FF5A 4E7HA 3BJAA 3JTHA 5EG0A 3TKYA 3HSRA 2OV7A 5A2QK 3TW6A 5DM6F 2K9MA 4OMZA 2JA5J 4AVPA 4W97A 2VKDA 3PQJA 2E7WA 2MC4A 2AO9A 1EF4A 4MQ9F 3AG4H 1Z21A 2LD5A 4M6XA 1S6LA 2Y9YA 2EWNA 5TISC 2DTRA 2BXZA 3K1MA 2IAIA 4KISA 3BR3A 3WG9A 2DT6A 3OYHA 5F08A 2FRHA 2OTJI 4ZC3A 1JKPC 4GYIA 4EGZA 2DA3A 2B9SA 1N25A 2A05A 3QQAA 2O6GE 4BU2A 3I0TA 5GTHC 1HKQA 2YPRA 1Z3XA 4MGRA 1SAXA 1CGPA 1KU3A 2M5WA 4EV0A 3OYEA 5IPAA 3OL4A 2IBDA 2LF8A 4RLFA 4KITB 1GXQA 4QSHA 1BN5A 4KA4A 4A3LJ 1U0JA 1TL8A 3CCEI 1UB9A 4HX4A 2DK5A 2KJBA 3M3YJ 1LEBA 1KQ0A 1VZ0A 4XICA 3FHZA 1TWFJ 1DQUA 1GVDA 1P2FA 4FETA 4IOAF 2DQRA 5JVTA 1LKXA 5L3BA 2IW5A 2GBYA 2RREA 1ODDA 2OZ6A 5E1XA 3ZQQA 5K5OA 3J81Z 2ZJQF 4Q5SF 6PAXA 3RYRA 5HDKA 1OR7C 2W82A 2UXXA 3OYIA 3Q0UA 2QQBA 2ZFWA 2R0QC 2VLAA 4BDYA 4PJMA 5EGOB 2L0KA 4KIBA 5FKLA 3L2RA 1LVAA 2KRCA 1Q1VA 4OIRF 1MMAA 1QHHD 5K7ZA 4CCLA 1PUEE 4JX4A 1IF1A 3F22A 5FFXA 4CCJA 4JP0A 3WE3A 4Y52J 1XDSA 5DCMA 1U5TC 4BDZA 2E19A 2WV0A 5EEAA 2K7LA 4OINF 2P0WA 1C0WA 1OYYA 3WTUC 1QQIA 2XGXA 2JPCA 1ZG1A 3OYKA 3LNQA 4EMSA 2R3SA 4BUPA 1OYWA 1MBGA 1O57A 5CJ9A 1FNNA 2R7DA 2COMA 3S2DJ 3HHHA 3E6CC 1IZ1A 3HPHA 4F55A 4U0VA 1HCRA 5HDGA 4A69C 5M3FJ 3LQRA 5ED4A 1QZYA 2KZGA 2M45A 3LSJA 4BEHA 2IRFG 2XUBA 3TL4X 2W25A 4DGWB 3HOVJ 4M9SA 5JFRA 3GTMJ 3EYIA 3GLXA 1X3UA 2LP0A 2DOEA 2ZMEC 2K9NA 3VPRA 2LC2A 3CMYA 4I09A 1DU0A 1ZH5A 3S2WA 3ZQHA 3FBIB 4RB2C 3E3VA 4KIFA 3HOUJ 4G7OF 1JHHA 1MBHA 3HXLA 3T8RA 2RQPA 3GWZA 3FHNA 2CYYA 3PNVA 1R5GA 2E5ZA 2R93J 3IWZA 5IYDJ 5H2FC 1RZ4A 1U8BA 3FXJA 4PDKA 3R0JA 4IHXA 3A01B 2P8TA 4HZFA 2VXZA 2CUJA 2XF7A 4DW6A 4EJVA 3S3MA 3CMAI 4RGSA 3WTSC 3I56I 1HLVA 4WXHA 3GXOA 4EATA 3V4GA 2R7XA 3COAC 1FSHA 1QZZA 2H1LA 2XGDA 1BW5A 2EK5A 4B1RA 3WTWC 2DFHA 5BOXA 1LFPA 1U9NA 2BY0A 5FROA 3KEYA 2MGQA 2Y69H 2A68F 2E2HJ 1XMXA 5HOOA 2RDPA 4D7MA 3IRQA 3GTPJ 1ZR2A 1DUXC 3U21A 2BEOA 3S1RJ 3CCLI 2DI3A 4IZZA 4IHTA 1KA8A 2LRDA 4M72A 4NHJA 2B0LA 1W7PD 1ZRDA 1G8XA 3B02A 5B1AH 1P6RA 1XB4A 2O8KA 1ERDA 3WU0A 4C3JJ 3PIPF 5FKNA 3A01A 3IV5A 4HPQA 4G7ZF 3VOEA 1WFXA 5D5UB 1FP2A 1RPWA 3M07A 2HOAA 2P6TA 1GDTA 2M8GX 2KLOA 2Z3YA 5BMZA 2M3AA 2HVRA 1NK2P 3TOBA 2QGUA 3GTQJ 3CP8A 1IAWA 1PJRA 2Q8KA 2R7OA 2JSCA 1K7AA 3Q9VA 3VODA 5D8LB 1I50J 5CQGA 4RBOA 4KJZA 1OCTC 2GOXB 3SJMA 3P9IA 2M4KA 3SZPA 3N05A 1GV5A 1STZA 3FX3A 4K2EA 3ZQIA 1T6SA 1LPQA 4PJ0C 3PO2J 3T1BA 2V6CA 2A6TA 4E7IA 4Z2YA 3OYCA 2BY1A 5F64A 1KYWA 4F3QA 2NS8A 3LSPA 1HC8A 3OR1C 3U9GA 5DTDA 2UXNA 2KDZA 2L4AA 3E7LA 3AAFA 2HEOA 1SMTA 3MKZA 1FX7A 4XOTA 1SFKA 2DMQA 2EPFA 3DKXA 2XDVA 2LNBA 1BIBA 3MVPA 3ASNH 1UCRA 2CUFA 1A04A 2Q0OA 2TRTA 1O3TA 1W4MA 2HOSA 4BHCA 1EH6A 1SC7A 2DA4A 2IJLA 3L7WA 4HSTA 3T8TA 1JHFA 2DDBA 4ZYHA 2DLLA 3IHUA 3A0HC 4LFUA 2DBBA 1PDNC 4IOCF 4M73A 4I2OA 4IJAA 5M5YJ 2L9VA 1YJ9I 2BHZA 3F9KA 1MH3A 2JVHA 2OA4A 1NK3P 1N78A 3FXQA 1POGA 1TTYA 4PFPA 3CDLA 3ABTA 1R36A 2UUZA 4M6VA 4FE7A 2XF6A 3RDIA 2IPQX 3JRFA 4O5VA 4YELA 2HQAA 3RJPA 5TJJA 2VI6A 2DFIA 3PSIA 4AWXB 2JWTA 4IF4A 2DA5A 2EJRA 1P9QC 3Q5FA 3T0YA 1VTNC 4S05A 1F5TA 3RQ4A 2Y0SN 3F3XA 2QQ9A 2OQGA 5IOZA 2PMHA 4HYEA 4P5OA 3IWFA 5D5WB 1G59A 2UV1A 5F0HA 1Z05A 2QSGX 2DU9A 2LSOA 4NC7A 3JSOA 1U9OA 1U78A 5E1WA 1P7JA 1MSEC 2BVLA 1JGGA 2KPMA 3FK7A 2JN6A 5BPDA 2VXDA 1FBQA 5E8GA 2P5VA 2Q2EA 3E0JB 2MA3A 4HDVA 2K9LA 2HZTA 2EA4A 1ETXA 1X19A 1XSVA 3TDUC 3HRUA 3H5AA 3RZDJ 5TRDA 5A2QZ 1LB2A 5DS9A 2HQ5A 1QNTA 3H5NA 1R6RA 4RAYA 1BC7C 2Y2ZA 4MFEA 2K4JA 1SANA 3UR3C 2RQQA 2B63J 3L2WA 2EZLA 3E6DA 3I71A 4Y4RA 2BE5F 2VBZA 4UV9A 4BXFA 1D0ZA 2M87A 4CA0A 4YRVA 2WAFA 3JW4A 1VQ4I 2WWYA 2M8EA 3A2KA 4CHUA 4F93B 2XAQA 4XLAA 3K7AJ 2XAUA 2YU3A 4XN0A 2QKMB 1W7PA 3Q3SA 5C4XJ 2L5QA 1WPKA 4ZDOA 2XKPA 3I5UA 2H09A 2OTLI 4L0ZB 2VT2A 3Q0VA 2ESNA 4MFDA 4F92B 4CGZA 2PI0A 2X51A 2IEKA 3FWEA 3H3ZA 4BXXJ 3BPVA 1HW5A 3NWTA 2DQLA 2E1MB 3D5SC 1QO0D 3QOPA 2D2WA 4EJWA 1R9TJ 4NQWA 2EV0A 2HOEA 2XRLA 4BQOA 2ZJ2A 2HKXA 4ZDLA 5J6XA 3LA2A 4HX7A 2DN0A 2PJPA 1WVRA 5H6QA 3CCRI 4DJAA 3JR9A 2OQRA 3TO9A 3RKQA 2ZXJA 4I76A 5K5RA 4II2A 4BE2A 2YSRA 4YFNF 1G4DA 3GZ5A 3IH2A 2GXAA 2IA0A 4L5JA 2L3DA 3C3WA 3LSIA 3SXYA 2EINH 4B3XA 5LEJA 2EV5A 2W00A 4BY7J 2NVXJ 2MH2A 4HV6A 5E79C 2ISYA 2Z2SB 3O6BB 1K83J 2MD5A 4ZYAA 1MH4A 2DT7B 4RGXA 3J7YJ 1ZRCA 5DCMB 4A0XA 4L0YB 2CV2A 2CFXA 5E17F 4AIDA 1W36D 1YHQI 4E6KG 2RC4A 4F7ZA 1ZLJA 3FXOA 4A6DA 2EFQA 3MCZA 2VUMJ 3BOQA 1QGPA 5DYMA 2NAZA 4AYBN 3DBLB 2V79A 1UAAA 1UG2A 2MLKA 2X1DA 1IGNA 5LBQA 1EA3A 1R49A 3PJRA 1P92A 2F5FA 3H35A 1YRNB 2VBYA 1RNLA 2O3FA 2CQQA 3C2BA 2RN7A 3SDBA 4Q48A 2H94A 1T2KA 4W1UA 4CZCA 1IO2A 4HQEA 3GTKJ 3G6EI 3OYLA 1LDKB 2HPMA 2IGNA 4YFXF 4BJ6C 4D0PA 4I01A 4AIHA 3R4KA 3CC7I 3DLAA 1HBXG 5B5EC 2RNGA 4A3GJ 1M1EB 3QYEA 3ZQCA 1IDYA 3MZHA 1VNDA 3JRAA 2L7FP 5HLGA 2MC3A 1V54H 2FE3A 4NNJA 2VBWA 3C1DA 1RESA 4HSRA 1ZRFA 3K4KA 2ECCA 1TZLA 1XSXA 1X1CA 5LD2C 4BGDA 4I7HA 3LL7A 2H1KA 5CLSA 1K6OA 4E7LA 1SD7A 4A3MJ 3MD2A 5LGUA 2B7EA 2KHMA 1FIAA 2KQRA 1X1PA 5LEKA 2FMYA 1R7JA 3NEUA 4AVZA 1MNDA 4HNVA 2GIZA 2PMUA 2OCEA 1V55H 1FC3A 1TW2A 4OU0A 2L7ZA 2VASA 1BI1A 1LEAA 4FCYA 4M6YA 1FMVA 3HOYJ 3LFKA 1U3EM 1FY7A 4MTDA 4PJNA 1Z6TA 2F48A 5CYVA 2YR2A 3AL0C 2P5KA 3F8MA 4N4NB 4QPOA 2JRMA 3S1MJ 3KFWX 1JT0A 2ID3A 1UHMA 4A3DJ 1FBSA 4DZPA 3LWFA 5HLTA 3LOCA 4I6ZA 1OR7A 4HBLA 5M5XJ 3G2BA 2R5ZB 1WH7A 1S8NA 3MZYA 2HZDA 3OIPA 5GADJ 3U1DA 2BY3A 5ICFA 3JAMZ 2W7NA 3BLYA 1VQMI 3M4OJ 5IP9J 2DK8A 4DYCA 5K1YA 2L01A 3GLLA 4LK0F 1U5TA 2FNPA 3ZXSA 4HLXA 1I6HJ 2DFEA 4AUXA 2EZIA 1X1DA 4RDUA 4ON0A 3ZQ7A 4B4CA 2XKOA 3O2PE 4UB8C 1SFUA 3ERMA 3QYFA 2ELHA 2FEZA 3BY6A 3TO7A 3FBNB 2XB5A 1CF7A 4G7HF 3I59B 2VB6A 1O7LA 3V7CA 2CW7A 1Z91A 2HXIA 1S29A 1DGRM 1MJBA 3CJRB 3HUGB 2LY1A 4YEJA 3OIQA 1OKRA 3I55I 2C6YA 1OFCX 3IAS2 4FE4A 2HTJA 2AHQA 2E34A 2FOKA 2X85A 4C3IJ 4XLEA 4B44A 2V1UA 1X3WB 1XS9A 1G3TA 1H9TA 4Y3OA 4QPQA 4XR6A 3BTCA 3SYTA 4HF0A 1FBUA 1LE8A 2H6BA 3OR2C 4A3BJ 4LB5A 2VQGA 1W7PB 4LITA 4E4HA 1KQ8A 2ME6A 3VDXA 2JZYA 5FB2A 4FX4A 4J01A 4G6DA 4Y7NJ 4IL6C 4AYBA 1Y1VJ 1HOMA 4BYYA 1MBFA 1VQ8I 3CUQB 1PUFB 2WC2A 3KEOA 3HIFA 4XQFA 1ON2A 1S7AA 3UNGC 2K86A 1ZGJA 3O3KA 2R7QA 3JRGA 2FBHA 3H1CA 1BI2A 2H8WA 1EH7A 4P9UA 3KP2A 3HUGA 5FD5A 2A07F 1WCMJ 2KMUA 4L5IA 2O9LA 4U0YA 2L9SA 4C30A 2A61A 2QWWA 4XKCA 3DEUA 1SD5A 1XPXA 5FLMJ 2NNYA 1IUFA 5ICCA 1K4SA 2GXBA 1OCZH 3H9JA 1IN6A 2DMUA 1X1BA 3HRMA 3PUFA 3W2VA 5KAIC 5FD6A 1MD0A 5D6FA 4UUTA 1JKOC 1W5CC 2CV0A 4LK1F 3FZVA 3D5LA 1G6NA 3PNTA 1RRJA 3TQNA 1Y56A 4XRSA 5EEHA 4DIQA 3H9GA 4LG0A 4M74A 2DA2A 2CW8A 2FF4A 2W24A 4J00A 1ZREA 2DPDA 4YG2F 4KNYA 3IC7A 2HYJA 1VQ6I 2RNJA 1A6IA 4X1EA 5E8IA 1I39A 1BI3A 2R5ZA 4DZJA 1OMIA 1RR8C 5HS8A 1B72A 1NG7A 1WJDA 2W4SA 4YIFA 1BBYA 2K02A 2NS0A 3D1NI 3S1QJ 3L2UA 3FXMA 5KNLA 1P4WA 4B8XA 5TGTA 1A35A 3OMYA 5CPRB 2KJCA 3KP7A 1BOBA 1JTYA 3IL2A 4N0BA 2EFOA 3V7RA 1WZ2A 1FT9A 3GZNB 2KISA 3JREA 1LJ9A 3W2WA 2YX4A 3LFUA 1G2HA 1UFMA 1W0UA 1XGMA 1I6XA 3CESA 2K27A 3QPLA 1AA7A 2RGVA 3J80K 4ETSA 1ZYRF 3BZKA 2O0YA 3MN2A 1P7IA 5ICEA 1UHWA 2QLZA 2QA4I 3KYCB 4KMFA 2OCCH 2DOFA 4C9YA 3RZOJ 1SVOA 2JA2A 1Z77A 2P4WA 3KLOA 3CCMI 2EZKA 5IT9Z 2XASA 3BZ6A 3ZPLA 5J47A 1H8AC 1HKSA 1RIOH 5D4RA 5ICGA 1FLIA 4KT5C 2AXTC 4U0WA 3WU1B 2LBFB 3TP0A 4GYGA 4LLNA 3PO3J 3RKXA 3CD6I 5JHUA 4C3HJ 1LUJB 3IKVA 2LKXA 1FSEA 2EBIA 1X3ZB 1T98A 1V5FA 1G3SA 3DPLC 4MNUA 3OYFA 5ILSA 2PQ8A 1RR7A 1XGNA 3E5XA 2IGOA 2Q1ZB 2CQXA 2IS2A 3BDDA 4BHPA 1H9GA 3F8FA 1W36C 2LH9A 3HKZA 3PSFA 4M3BA 4R1HA 2GM4A 4L5EA 1GUUA 2WB1N 5FKOA 5CQEA 1P4AA 3LSTA 5EJCA 3VSLA 3ZMZA 2D45A 4XKWA 1QVUA 4HG2A 3KLNA 2HKOA 1IN8A 3OYBA 1GV2A 1ZGWA 2H8RA 3HTUA 3SFZA 4IXAA 5L3FA 3OOUA 2CH0A 5FLXZ 3HL2A 3ERED 2EH3A 3D0SA 3SEZA 2BY2A 4C2MJ 2Z5UA 1IRFA 5E3LA 2IT0A 2XVCA 3F72A 1B59A 4BH9A 4PCQA 1SD4A 3CC2I 4RB1A 3GMEA 2V26A 3VEPA 5F0CA 3ABLH 2R7UA 1FTZA 3K4BA 1X4PA 4U7DA 4M9ZA 3DLLF 1WGXA 4J19A 3ESWB 4S0HB 2TDXA 4XBFA 1TWHJ 4G12A 4EEFG 1ETQA 4NQWB 4ZJZA 4O3MA 2K5CA 1YE9A 3MKWB 1UJ8A 3M8FA 1WWXA 1VQLI 1FYLA 2VC0A 2CQKA 5KK1A 5LHIA 2VQCA 2CWEA 1ZAOA 1D8KA 3FM5A 2ZNYA 3BR0A 4XOPA 5K5QA 2GA1A 2QSFX 3ZOBA 4PGHA 1MNMC 2A6HF 1YOVB 4U88A 4V2FA 4A6EA 2AS5F 1F43A 4XIDA 4BL0B 4QIWN 1TP4A 2HVQA 1B4AA 1BA5A 1B9NA 1LDDA 3FDYA 4N9HA 3RQIA 5DUIA 4Z6YA 3JRHA 3LA3A 4D5FA 5EZGA 3L2CA 2VQLA 2CV1A 3DFGA 2DODA 4IQ4A 1I5ZA 2FUG2 2R4GA 2JA6J 3CLQA 4IKFA 5J4VA 2LR8A 1DU6A 2HDWA 3ZP5A 1SVLA 3BROA 2E1NA 3IAM2 2VJIA 4RAFA 2NVQJ 1R00A 4LLLA 3J7AY 4FTHA 1LFBA 4M71A 3K0LA 2XB0X 3RSNA 5LGTA 4L9TA 3R6SA 2G9WA 2ZC2A 4PUSA 1D5VA 2KZVA 4CCNA 2VPLA 2VKEA 1X58A 1JJ8C 4XORA 5FKMA 4I99C 4WF2A 3BCBA 3HOTA 4G8XA 4P55A 2J5OA 1VI0A 3IP4B 1ORKA 1B1BA 1H0MA 2MLGA 3FXRA 1S7OA 3CUOA 3E1SA 4XLFA 4ZZDA 2VC1A 3L09A 3OS1A 4ZZLA 1XDUA 1UZCA 1YX5A 3BQYA 1YI2I 1MDMA 1GHCA 3M7GA 2V4JC 4KMUX 2X1CA 3ONQA 3VWBA 3DBHB 4A5NA 1Z7LA 4IQJA 4JYKA 1IV8A 2KRFA 1J59A 4MEXF 4XL9A 4WXCA 2AXLA 2LY9A 4ABZA 1RKTA 5BNGA 2FMLA 1XTAA 4XLCA 1SFEA 2VODA 3GX4X 2EA2A 5J8CA 5GPCA 2WY7Q 4HX8A 1JKRC 2ECBA 1XN7A 1IXRC 2RV8A 1D1BA 2HWVA 2PEXA 3JRBA 1WJAA 1ZG3A 1MW7A 4PSXA 3HGGA 5CVJA 2R7RA 3U1KA 1RETA 4ZYDA 4DBRA 4U87A 4XONA 5DDGA 2YUSA 3BTIA 3FXUA 5H20A 2A5YB 2DT5A 3WTYC 1FP1D 3J7AO 4X6AJ 1XMAA 2WY8Q 1ON1A 4F91B 3RI4A 2IA1A 1YW7A 1WI3A 1KONA 1HSTA 2WV1A 4PJJA 3KEQA 5L3CA 2HU9A 3JCUC 1ENHA 1SEUA 2LKSA 4BE0A 1RUNA 3HKZN 3BCAA 4G94A 2HVSA 1ZLKA 1R1TA 1G3YA 1Y6IA 3TW7A 4B48A 1HXDA 3ABMH 2HFHA 3OYAA 1I3AA 1OCRH 4ZYGA 4ASNA 1JJ6C 1I3QJ 2VJ4A 4XRMA 4GDFA 3N4MA 1YS7A 1K79A 5CVRA 3EDPA 3BG6A 1ETVA 1U8RA 1TLHB 2OPTA 4XNFA 1VQ9I 1T0FA 3SHFA 5EEGA 2XPWA 2QVOA 2W1OA 4Y17A 4YIRX 2HGCA 2LBFA 2J5PA 4M3EA 4HNUA 3AG1H 1K6YA 2H27A 1X2MA 3J7ZI 5HS7A 3F0CA 1LE8B 2ZO4A 3QYBA 4EM2A 3CJNA 2LVSA 3CCSI 4FISA 1GXPA 1H89C 3JRIA 1MMSA 1S9HA 3QAHA 4ZH4F 4RS8A 4V2GA 1K4TA 5HLIA 1S72I 3M9AA 4A5MA 3R0AA 2ADUA 2FQ4A 4X0GA 1ETOA 2AQEA 3VYUB 3AFHA 5FFZA 4WCGA 2UWMA 5E3OA 2CQNA 4XM3A 1IN7A 4BY1J 2EQRA 2W85A 2YX7A 2FBKA 2KFDA 4E7ZA 3WU2C 2BW3A 3I9V2 4HF1A 1ZK8A 3BG9A 1R58A 2ZBKA 3E97A 4OIPF 3DKYA 5FJ8J 4UUSA 4KUMA 4CCOA
chains in the Genus database with same CATH topology
3GF2A 2FNAA 3L00A 4OIOF 1J7KA 2EFWA 3FMQA 4I0BA 1LQ1A 2FQ3A 4CYDA 4WXDA 2HQRA 3DKWA 4A2UA 4DNCA 3DP7A 1IUYA 4CICA 5D5VB 3IRRA 2XIGA 3WE2A 1DDNA 3B73A 5L3DA 5CVIA 2VONA 1KGSA 4HAMA 1NHAA 1T39A 4RB3C 1IXSB 3WTVC 3JSPA 5AIQA 1LNWA 4UHTA 2XAJA 3MQ0A 1J2XA 1Z1DA 4EJUA 4MTEA 3TO6A 3KETA 2MBFA 4L9NA 4IHSA 3I64A 3H3UA 3HTSB 4P96A 3ZN0A 1B6AA 4G9YA 1R5HA 1YIOA 3GFJA 1Y0UA 3G73A 3F8CA 3R61A 1BM9A 5J8FA 1RUOA 1QPMA 1K78B 2RVCA 1HW1A 3HHGA 4UXNA 4BAYA 2QUFA 1IW7F 3PFIA 3KCCA 2Y0MA 2D1VA 3CLOA 2G7UA 5LGNA 2OU2A 4UNOA 2XHKA 1CF7B 1F1ZA 4LG0B 3PQKA 3GFIA 4ENKA 3QU6A 4EM0B 4EQQA 1OPCA 1K78A 2IP2A 3F8BA 4RGUA 2XRNA 3KP6A 1HKTA 2FSWA 2V1DA 3P9CA 4L9VA 2W57A 4LMYA 4JBAA 4KN4X 4EVIA 1BI0A 2KIUA 4MHGA 2DPUA 1ZARA 1I27A 3V8LA 4UUVA 4HOBA 1YO5C 3NRVA 5LRSA 3FMSA 4WWCA 5DV5A 3P7NA 3LAJA 3ZMTA 2VE9A 3ZMUA 3BJ6A 4YIIA 2GQQA 5IT3A 2EV6A 3DPTA 1LDJA 4S04A 4EJTA 4ESBA 2W84A 3DXJF 3GYHX 3J81K 1J0RA 5LHHA 3F23A 1YG2A 2KIMA 2Z9OA 4TV7A 3OOPA 1TQIA 4KDPA 1JE8A 3FM3A 3K69A 3U2RA 3K1NA 3SQNA 3F21A 2CG4A 5DD8A 2FU4A 4RGRA 3F6VA 1F9NA 4NB5A 4UVBA 2VE8A 1V3FA 2KIFA 4ESFA 1IN5A 3E6MA 4IRHA 4UVCA 1YTYA 4BXUA 3EYYA 4QWQA 3R60A 2X0LA 2G7HA 1EH8A 2OAZA 3ISPA 3DQVC 5BS6A 1DP7P 1XGOA 2QENA 2CW0F 3I59A 4LJZF 4FX0A 2EB7A 4KIGA 4ENNA 3RPUA 1KQ9A 4OIQF 4XSZF 5JI6A 5LLQA 2X4HA 5LRRA 4HF2A 3HYIA 4A0YA 4PZJA 1R23A 1WQ2A 3MEXA 2Z99A 1XSDA 2CGPA 2DO7A 4XSXF 2CSOA 3GUDA 5D4SA 2PLYA 3FMRA 1ONVA 3WODF 1BIAA 2P7CB 2QM3A 3GFLA 4XLPF 3KP5A 4EJOA 2HS5A 1ZGAA 4LD5A 3HSEA 4IPAA 3LQQA 5DCFA 1V4RA 4LLGF 2EFPA 2M1BA 2L54A 3ECOA 2PBIA 4I98B 3RKWA 1O3SA 4ENMA 1MGTA 1HW2A 1TW3A 3GEZA 1GVJA 3KP4A 3CDHA 2CO5A 2JRTA 3WGGA 3M8EA 2JT1A 4E70A 2D1HA 4OMYA 2FXAA 4A12A 2QYOA 1F4KA 2O8XA 1JXSA 2K4BA 4HLYA 3RTRA 4HV5A 4AIJA 1YLFA 3C18A 1FZPB 3EUHA 1BOAA 2L02A 3CO7C 2MH9A 3K2ZA 3MAJA 4OOIA 1J75A 2Y75A 2QQAA 1PP8F 2QBYB 2OD5A 3E6BA 1IRGA 4IRIA 3ABUA 1KU9A 3QPTA 1J9IA 3DF8A 4L9JA 1MKMA 1OYIA 2IA2A 3M1EA 1WKMA 3LA7A 2HR3A 2PG4A 5FLXK 2GZWA 1J5YA 2HDCA 2JPBA 2NYXA 2ZKZA 5AIPA 2EFNA 4EGYA 2HQNA 2DAOA 4ZYEA 2O61A 4CDGA 1WRJA 2GAUA 2VOPA 2PFBA 4L18B 4GCVA 3HRTA 3W6JB 4UVAA 4BNCA 5E18F 4KYWA 2P6SA 1MJ9A 4CXFA 3DV8A 3BP8A 2KKOA 3CTAA 1TBXA 2IVMA 2BBYA 5E20A 3QU3A 4PGGA 3I4PA 1U2WA 3CUQC 2OBPA 1IN4A 1Q1HA 3RIRA 2R7FA 4AIKA 1IXCA 2STTA 2VT3A 2VBXA 5F6FA 4ENJA 3G3ZA 2A3SA 4BHBA 1O3RA 5D6EA 3TDZC 3VFZA 2GXGA 4GXOA 3GVAA 4B09A 1TNSA 5DEQA 3REOA 3H92A 4KICA 4AD9A 4UV8A 5D8KB 4XLNF 4FT8A 2QBYA 4R79A 1O7FA 1BC8C 2V9VA 4HA8A 2UZKA 2XAFA 3HSFA 3ZMSA 2LF7A 4N9IA 3BPXA 5KVRA 3QPHA 5ERIA 5BQTA 2BYVE 3W6KB 1JGSA 1W5TA 1HSJA 4Y15A 1FYKA 2HTSA 1R22A 1QBJA 1FWZA 4R8HA 1S3JA 3Q9SA 1R1UA 1L0OC 3JTGA 4JK1X 1P4XA 2F5CA 1G3WA 4U7BA 2V1XA 3GFMA 3QP6A 1TQMA 4CO8A 5JR3A 1USSA 2HYFA 1REPC 4WX9A 1KU2A 3GZ6A 3ECHA 1KU7A 4H0EA 5HS9A 4DQ2A 2HYGD 5ILVA 3MWMA 3ULQB 1RI7A 4HQMA 3NQOA 1T38A 5DD4A 1U6GA 3WTTC 4KN7X 3V8JA 1TNTA 1SFXA 5HVQC 5CVUA 1FPQA 3TOAA 3ELKA 1BJAA 1WI9A 1YW8A 3GW2A 4I02A 3L9FA 4P9FA 4RAZA 1Z7UA 5AONA 1FOKA 1YFHA 1E2XA 1L3LA 1W5SA 3QRFF 3C7JA 1D3YA 4Q4ZF 4YFKF 3K9TA 2F5DA 2ZMEB 3T5XA 2FBIA 2H6CA 2A6EF 3EETA 1KYZA 1XMKA 1MDMB 4XRFA 5L3GA 3F8NA 3BJOA 5HLHA 3I54A 1FYMA 3JAMK 3TGNA 1R1VA 4EM1A 3MFKA 3P9KA 3I58A 1ULYA 2OZUA 5FO5A 4GGGA 5L3EA 1ZHFA 3WTZA 1D8JA 5ILUA 2Z33A 1PP7U 2ACJA 3HOSA 5H6RA 3OV8A 1Z9CA 3IKTA 4CZZA 1YW9A 2M30A 2F2EA 5FGMA 2P7VB 5LHGA 2O03A 1XCBA 2FA5A 4Y13A 2VN2A 4IRGA 2NRAC 5F1RA 2GIVA 1DPUA 2E1CA 2ETHA 3ZN1A 1TQPA 2QZ8A 5IT9K 4HW0A 3N97A 4KFCA 1O3QA 1Z6RA 5HDNA 4Q47A 3E5UA 2GWRA 2ZMEA 1YS6A 3BWGA 1EV7A 2ISZA 2LDUA 4WK8F 4HDUA 3V8KA 1ZN2A 3LAPA 3KE2A 3VB2A 2E7XA 2A69F 2ESHA 4FHTA 5CVVA 5D5XB 3KZZA 1YQAA 5DUKA 3CUQA 2ZNZA 4I0AA 1I1GA 2STWA 3KP3A 1YYVA 1XCVA 1WSUA 1ZG5A 2PN6A 3EQLF 3WGIA 1DPRA 2XROA 2XAGA 1SD6A 3SZTA 2VOOA 3ROUA 4O6JA 3WTXC 3RKYA 3I53A 4MQVA 3WGHA 2XAHA 4MEYF 2P5LC 4ESJA 2BGCA 2LKPA 2Y48A 2ZCWA 4BQAA 1U5TB 1E17A 3RYPA 1AOYA 4LB6B 1XD7A 4LGWA 1USTA 4M9XA 2NNNA 2L4MA 3ZMDA 2GA2A 3E5QA 5BPIA 1XGSA 3F6OA 4QLCU 3K1PA 4G6QA 2F5EA 3GO5A 1MZBA 4A0ZA 3ML6A 1SMYF 3KZYA 3RPQA 2JTVA 3HRSA 1AWCA 1I1SA 2XV4S 2WTEA 4GO1A 4RB0A 2BV6A 1HQCA 1B9MA 5E1ZB 4JQFA 2RKHA 3ZMVA 4IVNA 2DW4A 1MJAA 3CO6C 3V7SA 3QP5A 3J80Z 3FF5A 3BJAA 3JTHA 3TKYA 3HSRA 5A2QK 4OMZA 4AVPA 3PQJA 2E7WA 4MQ9F 4M6XA 1S6LA 2EWNA 2DTRA 3K1MA 3WG9A 2FRHA 4GYIA 4EGZA 2O6GE 3I0TA 1HKQA 2YPRA 4MGRA 1SAXA 1CGPA 1KU3A 2M5WA 4EV0A 2LF8A 1GXQA 1BN5A 4KA4A 1UB9A 4HX4A 2DK5A 2KJBA 1LEBA 1KQ0A 3FHZA 1P2FA 2DQRA 5JVTA 5L3BA 2IW5A 5K5OA 4Q5SF 1ODDA 2OZ6A 5E1XA 3J81Z 6PAXA 3RYRA 5HDKA 2UXXA 2QQBA 2ZFWA 4KIBA 1LVAA 4OIRF 1PUEE 1IF1A 3F22A 5FFXA 3WE3A 1XDSA 5DCMA 1U5TC 2WV0A 2K7LA 4OINF 1C0WA 1OYYA 3WTUC 1QQIA 2XGXA 2JPCA 1ZG1A 4EMSA 2R3SA 1OYWA 1O57A 5CJ9A 1FNNA 2R7DA 2COMA 3HHHA 3E6CC 1IZ1A 4U0VA 5HDGA 3LQRA 5ED4A 1QZYA 2M45A 2IRFG 2XUBA 2W25A 4M9SA 5JFRA 3EYIA 3GLXA 1X3UA 4I09A 1ZH5A 3S2WA 4RB2C 3E3VA 4KIFA 4G7OF 1JHHA 3T8RA 2RQPA 3GWZA 2CYYA 1R5GA 3IWZA 1RZ4A 4PDKA 3R0JA 2P8TA 4HZFA 2VXZA 4EJVA 4RGSA 3WTSC 4WXHA 3GXOA 3V4GA 3COAC 1FSHA 1QZZA 2EK5A 3WTWC 5BOXA 2A68F 5HOOA 2RDPA 3IRQA 1DUXC 2BEOA 2DI3A 4IHTA 1KA8A 4M72A 4NHJA 2B0LA 1W7PD 1ZRDA 3B02A 1P6RA 1XB4A 3WU0A 4G7ZF 3VOEA 5D5UB 1FP2A 2P6TA 2Z3YA 5BMZA 3TOBA 1IAWA 2Q8KA 1K7AA 2JSCA 3Q9VA 3VODA 5D8LB 3P9IA 3SZPA 4K2EA 1STZA 3FX3A 1T6SA 3T1BA 2V6CA 4Z2YA 5F64A 1KYWA 3U9GA 2UXNA 2L4AA 3AAFA 2HEOA 1SMTA 1FX7A 2LNBA 1BIBA 1UCRA 1O3TA 1A04A 2Q0OA 1W4MA 4BHCA 1EH6A 2IJLA 3L7WA 3T8TA 1JHFA 4ZYHA 2DLLA 3IHUA 4LFUA 2DBBA 1PDNC 4I2OA 4M73A 4IJAA 2OA4A 3FXQA 1TTYA 3ABTA 1R36A 3RDIA 2IPQX 4O5VA 3RJPA 5TJJA 2DFIA 4AWXB 4IF4A 2EJRA 3Q5FA 3T0YA 1VTNC 4S05A 1F5TA 3F3XA 2QQ9A 2OQGA 2PMHA 4HYEA 4P5OA 3IWFA 5D5WB 1Z05A 2DU9A 2LSOA 3JSOA 1U78A 5E1WA 5BPDA 1FBQA 5E8GA 2P5VA 2Q2EA 4HDVA 2MA3A 2HZTA 2EA4A 1XSVA 3TDUC 3HRUA 5TRDA 5A2QZ 1LB2A 1QNTA 4RAYA 1BC7C 2K4JA 3E6DA 3I71A 2BE5F 2VBZA 4UV9A 2M87A 3JW4A 2WWYA 2M8EA 4CHUA 2XAQA 2YU3A 1W7PA 2XKPA 3I5UA 2H09A 4L0ZB 2VT2A 2ESNA 4CGZA 2PI0A 3FWEA 3H3ZA 3BPVA 1HW5A 2DQLA 1QO0D 3QOPA 2D2WA 4EJWA 4NQWA 2EV0A 2HOEA 5J6XA 2ZJ2A 2HKXA 3LA2A 4HX7A 2PJPA 5H6QA 2OQRA 3TO9A 2ZXJA 5K5RA 2YSRA 4YFNF 1G4DA 3GZ5A 2IA0A 4L5JA 2L3DA 3C3WA 3SXYA 5LEJA 2EV5A 2MH2A 4HV6A 2ISYA 3O6BB 2MD5A 1ZRCA 4RGXA 5DCMB 4A0XA 4L0YB 2CFXA 5E17F 2RC4A 4F7ZA 1ZLJA 4A6DA 2EFQA 3MCZA 3BOQA 1QGPA 5DYMA 2NAZA 2V79A 2MLKA 5LBQA 1P92A 2F5FA 2VBYA 1RNLA 2O3FA 2RN7A 4Q48A 2H94A 1T2KA 4HQEA 1LDKB 4YFXF 4D0PA 4I01A 4AIHA 3R4KA 1HBXG 3MZHA 5HLGA 2MC3A 2FE3A 2VBWA 3C1DA 1ZRFA 1XSXA 4I7HA 5CLSA 1K6OA 1SD7A 5LGUA 5LEKA 2FMYA 1R7JA 3NEUA 2PMUA 1FC3A 1TW2A 4OU0A 1BI1A 1LEAA 4M6YA 3LFKA 1U3EM 1FY7A 4MTDA 1Z6TA 5CYVA 2YR2A 2P5KA 3F8MA 3KFWX 1UHMA 1FBSA 3LWFA 4HBLA 1OR7A 1S8NA 3MZYA 3U1DA 5ICFA 3JAMZ 2DK8A 5K1YA 2L01A 4LK0F 1U5TA 2FNPA 4HLXA 4ON0A 3ZQ7A 2XKOA 3O2PE 1SFUA 2ELHA 2FEZA 3BY6A 3TO7A 1CF7A 4G7HF 3I59B 1O7LA 3V7CA 1Z91A 1S29A 1MJBA 2C6YA 1OKRA 2HTJA 2FOKA 2V1UA 1G3TA 1H9TA 4HF0A 1FBUA 2H6BA 4LB5A 1W7PB 1KQ8A 2JZYA 5FB2A 4FX4A 4G6DA 4BYYA 3CUQB 2WC2A 3KEOA 3HIFA 1ON2A 1S7AA 2K86A 1ZGJA 3O3KA 2FBHA 1BI2A 4P9UA 1EH7A 3KP2A 3HUGA 5FD5A 2A07F 4L5IA 4U0YA 2A61A 2QWWA 3DEUA 1SD5A 2NNYA 5ICCA 2GXBA 1IN6A 3HRMA 5FD6A 1MD0A 5D6FA 4LK1F 3FZVA 3D5LA 1G6NA 3TQNA 5EEHA 4LG0A 4M74A 2FF4A 2W24A 1ZREA 2DPDA 4YG2F 4KNYA 3IC7A 2RNJA 5E8IA 1BI3A 1OMIA 5HS8A 4YIFA 1BBYA 2K02A 2NS0A 1P4WA 4B8XA 2KJCA 3KP7A 3IL2A 4N0BA 2EFOA 3V7RA 1FT9A 1LJ9A 2YX4A 1UFMA 1XGMA 1I6XA 2K27A 2RGVA 3J80K 4ETSA 1ZYRF 2O0YA 5ICEA 1UHWA 2QLZA 4KMFA 2P4WA 3KLOA 5IT9Z 2XASA 3BZ6A 3ZPLA 1HKSA 1RIOH 5D4RA 5ICGA 1FLIA 4KT5C 4U0WA 3WU1B 4GYGA 4LLNA 3RKXA 5JHUA 3IKVA 1FSEA 1T98A 1G3SA 3DPLC 4MNUA 5ILSA 2PQ8A 1XGNA 3E5XA 3BDDA 4BHPA 1H9GA 3F8FA 4R1HA 1P4AA 3LSTA 3ZMZA 2D45A 3KLNA 2HKOA 1IN8A 3HTUA 3SFZA 4IXAA 5L3FA 3ERED 5FLXZ 3D0SA 2Z5UA 1IRFA 2IT0A 2XVCA 3F72A 1B59A 4BH9A 4PCQA 1SD4A 4RB1A 3VEPA 4U7DA 4M9ZA 2TDXA 4XBFA 4O3MA 3M8FA 1WWXA 1FYLA 2VC0A 2CQKA 5KK1A 5LHIA 2CWEA 1ZAOA 1D8KA 3FM5A 2ZNYA 5K5QA 2GA1A 4PGHA 2A6HF 4U88A 4A6EA 2AS5F 1B4AA 1B9NA 1LDDA 4N9HA 5DUIA 3LA3A 3L2CA 3DFGA 1I5ZA 3ZP5A 3BROA 2E1NA 1R00A 4LLLA 4M71A 3K0LA 5LGTA 4L9TA 3R6SA 2G9WA 1D5VA 4WF2A 3HOTA 4G8XA 4P55A 2J5OA 1H0MA 1B1BA 2MLGA 3FXRA 1S7OA 3CUOA 4ZZDA 2VC1A 3L09A 4ZZLA 1XDUA 1MDMA 1GHCA 3M7GA 4KMUX 4A5NA 2KRFA 1J59A 4MEXF 4WXCA 2AXLA 2FMLA 1SFEA 2VODA 3GX4X 2EA2A 5J8CA 4HX8A 1XN7A 1IXRC 2RV8A 2HWVA 2PEXA 1ZG3A 5CVJA 4ZYDA 5DDGA 3FXUA 5H20A 2A5YB 2DT5A 3WTYC 1FP1D 3J7AO 1XMAA 3RI4A 1ON1A 2IA1A 1YW7A 1HSTA 3KEQA 5L3CA 1RUNA 4G94A 1ZLKA 1R1TA 1G3YA 1HXDA 2HFHA 4ZYGA 4ASNA 3N4MA 1YS7A 1K79A 5CVRA 3EDPA 1U8RA 1TLHB 1T0FA 3SHFA 5EEGA 2QVOA 4Y17A 2HGCA 2J5PA 2H27A 5HS7A 2ZO4A 4EM2A 3CJNA 1GXPA 3QAHA 4ZH4F 4RS8A 5HLIA 3M9AA 4A5MA 3R0AA 2ADUA 4WCGA 5FFZA 2UWMA 1IN7A 2W85A 2YX7A 2FBKA 4HF1A 1R58A 2ZBKA 3E97A 4OIPF 4KUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GF2 A;  2FNA A;  3L00 A;  4OIO F;  1J7K A;  2EFW A;  3FMQ A;  4I0B A;  1LQ1 A;  2FQ3 A;  4CYD A;  4WXD A;  2HQR A;  3DKW A;  4A2U A;  4DNC A;  3DP7 A;  1IUY A;  4CIC A;  5D5V B;  3IRR A;  2XIG A;  3WE2 A;  1DDN A;  3B73 A;  5L3D A;  5CVI A;  2VON A;  1KGS A;  4HAM A;  1NHA A;  1T39 A;  4RB3 C;  1IXS B;  3WTV C;  3JSP A;  5AIQ A;  1LNW A;  4UHT A;  2XAJ A;  3MQ0 A;  1J2X A;  1Z1D A;  4EJU A;  4MTE A;  3TO6 A;  3KET A;  2MBF A;  4L9N A;  4IHS A;  3I64 A;  3H3U A;  3HTS B;  4P96 A;  3ZN0 A;  1B6A A;  4G9Y A;  1R5H A;  1YIO A;  3GFJ A;  1Y0U A;  3G73 A;  3F8C A;  3R61 A;  1BM9 A;  5J8F A;  1RUO A;  1QPM A;  1K78 B;  2RVC A;  1HW1 A;  3HHG A;  4UXN A;  4BAY A;  2QUF A;  1IW7 F;  3PFI A;  3KCC A;  2Y0M A;  2D1V A;  3CLO A;  2G7U A;  5LGN A;  2OU2 A;  4UNO A;  2XHK A;  1CF7 B;  1F1Z A;  4LG0 B;  3PQK A;  3GFI A;  4ENK A;  3QU6 A;  4EM0 B;  4EQQ A;  1OPC A;  1K78 A;  2IP2 A;  3F8B A;  4RGU A;  2XRN A;  3KP6 A;  1HKT A;  2FSW A;  2V1D A;  3P9C A;  4L9V A;  2W57 A;  4LMY A;  4JBA A;  4KN4 X;  4EVI A;  1BI0 A;  2KIU A;  4MHG A;  2DPU A;  1ZAR A;  1I27 A;  3V8L A;  4UUV A;  4HOB A;  1YO5 C;  3NRV A;  5LRS A;  3FMS A;  4WWC A;  5DV5 A;  3P7N A;  3LAJ A;  3ZMT A;  2VE9 A;  3ZMU A;  3BJ6 A;  4YII A;  2GQQ A;  5IT3 A;  2EV6 A;  3DPT A;  1LDJ A;  4S04 A;  4EJT A;  4ESB A;  2W84 A;  3DXJ F;  3GYH X;  3J81 K;  1J0R A;  5LHH A;  3F23 A;  1YG2 A;  2KIM A;  2Z9O A;  4TV7 A;  3OOP A;  1TQI A;  4KDP A;  1JE8 A;  3FM3 A;  3K69 A;  3U2R A;  3K1N A;  3SQN A;  3F21 A;  2CG4 A;  5DD8 A;  2FU4 A;  4RGR A;  3F6V A;  1F9N A;  4NB5 A;  4UVB A;  2VE8 A;  1V3F A;  2KIF A;  4ESF A;  1IN5 A;  3E6M A;  4IRH A;  4UVC A;  1YTY A;  4BXU A;  3EYY A;  4QWQ A;  3R60 A;  2X0L A;  2G7H A;  1EH8 A;  2OAZ A;  3ISP A;  3DQV C;  5BS6 A;  1DP7 P;  1XGO A;  2QEN A;  2CW0 F;  3I59 A;  4LJZ F;  4FX0 A;  2EB7 A;  4KIG A;  4ENN A;  3RPU A;  1KQ9 A;  4OIQ F;  4XSZ F;  5JI6 A;  5LLQ A;  2X4H A;  5LRR A;  4HF2 A;  3HYI A;  4A0Y A;  4PZJ A;  1R23 A;  1WQ2 A;  3MEX A;  2Z99 A;  1XSD A;  2CGP A;  2DO7 A;  4XSX F;  2CSO A;  3GUD A;  5D4S A;  2PLY A;  3FMR A;  1ONV A;  3WOD F;  1BIA A;  2P7C B;  2QM3 A;  3GFL A;  4XLP F;  3KP5 A;  4EJO A;  2HS5 A;  1ZGA A;  4LD5 A;  3HSE A;  4IPA A;  3LQQ A;  5DCF A;  1V4R A;  4LLG F;  2EFP A;  2M1B A;  2L54 A;  3ECO A;  2PBI A;  4I98 B;  3RKW A;  1O3S A;  4ENM A;  1MGT A;  1HW2 A;  1TW3 A;  3GEZ A;  1GVJ A;  3KP4 A;  3CDH A;  2CO5 A;  2JRT A;  3WGG A;  3M8E A;  2JT1 A;  4E70 A;  2D1H A;  4OMY A;  2FXA A;  4A12 A;  2QYO A;  1F4K A;  2O8X A;  1JXS A;  2K4B A;  4HLY A;  3RTR A;  4HV5 A;  4AIJ A;  1YLF A;  3C18 A;  1FZP B;  3EUH A;  1BOA A;  2L02 A;  3CO7 C;  2MH9 A;  3K2Z A;  3MAJ A;  4OOI A;  1J75 A;  2Y75 A;  2QQA A;  1PP8 F;  2QBY B;  2OD5 A;  3E6B A;  1IRG A;  4IRI A;  3ABU A;  1KU9 A;  3QPT A;  1J9I A;  3DF8 A;  4L9J A;  1MKM A;  1OYI A;  2IA2 A;  3M1E A;  1WKM A;  3LA7 A;  2HR3 A;  2PG4 A;  5FLX K;  2GZW A;  1J5Y A;  2HDC A;  2JPB A;  2NYX A;  2ZKZ A;  5AIP A;  2EFN A;  4EGY A;  2HQN A;  2DAO A;  4ZYE A;  2O61 A;  4CDG A;  1WRJ A;  2GAU A;  2VOP A;  2PFB A;  4L18 B;  4GCV A;  3HRT A;  3W6J B;  4UVA A;  4BNC A;  5E18 F;  4KYW A;  2P6S A;  1MJ9 A;  4CXF A;  3DV8 A;  3BP8 A;  2KKO A;  3CTA A;  1TBX A;  2IVM A;  2BBY A;  5E20 A;  3QU3 A;  4PGG A;  3I4P A;  1U2W A;  3CUQ C;  2OBP A;  1IN4 A;  1Q1H A;  3RIR A;  2R7F A;  4AIK A;  1IXC A;  2STT A;  2VT3 A;  2VBX A;  5F6F A;  4ENJ A;  3G3Z A;  2A3S A;  4BHB A;  1O3R A;  5D6E A;  3TDZ C;  3VFZ A;  2GXG A;  4GXO A;  3GVA A;  4B09 A;  1TNS A;  5DEQ A;  3REO A;  3H92 A;  4KIC A;  4AD9 A;  4UV8 A;  5D8K B;  4XLN F;  4FT8 A;  2QBY A;  4R79 A;  1O7F A;  1BC8 C;  2V9V A;  4HA8 A;  2UZK A;  2XAF A;  3HSF A;  3ZMS A;  2LF7 A;  4N9I A;  3BPX A;  5KVR A;  3QPH A;  5ERI A;  5BQT A;  2BYV E;  3W6K B;  1JGS A;  1W5T A;  1HSJ A;  4Y15 A;  1FYK A;  2HTS A;  1R22 A;  1QBJ A;  1FWZ A;  4R8H A;  1S3J A;  3Q9S A;  1R1U A;  1L0O C;  3JTG A;  4JK1 X;  1P4X A;  2F5C A;  1G3W A;  4U7B A;  2V1X A;  3GFM A;  3QP6 A;  1TQM A;  4CO8 A;  5JR3 A;  1USS A;  2HYF A;  1REP C;  4WX9 A;  1KU2 A;  3GZ6 A;  3ECH A;  1KU7 A;  4H0E A;  5HS9 A;  4DQ2 A;  2HYG D;  5ILV A;  3MWM A;  3ULQ B;  1RI7 A;  4HQM A;  3NQO A;  1T38 A;  5DD4 A;  1U6G A;  3WTT C;  4KN7 X;  3V8J A;  1TNT A;  1SFX A;  5HVQ C;  5CVU A;  1FPQ A;  3TOA A;  3ELK A;  1BJA A;  1WI9 A;  1YW8 A;  3GW2 A;  4I02 A;  3L9F A;  4P9F A;  4RAZ A;  1Z7U A;  5AON A;  1FOK A;  1YFH A;  1E2X A;  1L3L A;  1W5S A;  3QRF F;  3C7J A;  1D3Y A;  4Q4Z F;  4YFK F;  3K9T A;  2F5D A;  2ZME B;  3T5X A;  2FBI A;  2H6C A;  2A6E F;  3EET A;  1KYZ A;  1XMK A;  1MDM B;  4XRF A;  5L3G A;  3F8N A;  3BJO A;  5HLH A;  3I54 A;  1FYM A;  3JAM K;  3TGN A;  1R1V A;  4EM1 A;  3MFK A;  3P9K A;  3I58 A;  1ULY A;  2OZU A;  5FO5 A;  4GGG A;  5L3E A;  1ZHF A;  3WTZ A;  1D8J A;  5ILU A;  2Z33 A;  1PP7 U;  2ACJ A;  3HOS A;  5H6R A;  3OV8 A;  1Z9C A;  3IKT A;  4CZZ A;  1YW9 A;  2M30 A;  2F2E A;  5FGM A;  2P7V B;  5LHG A;  2O03 A;  1XCB A;  2FA5 A;  4Y13 A;  2VN2 A;  4IRG A;  2NRA C;  5F1R A;  2GIV A;  1DPU A;  2E1C A;  2ETH A;  3ZN1 A;  1TQP A;  2QZ8 A;  5IT9 K;  4HW0 A;  3N97 A;  4KFC A;  1O3Q A;  1Z6R A;  5HDN A;  4Q47 A;  3E5U A;  2GWR A;  2ZME A;  1YS6 A;  3BWG A;  1EV7 A;  2ISZ A;  2LDU A;  4WK8 F;  4HDU A;  3V8K A;  1ZN2 A;  3LAP A;  3KE2 A;  3VB2 A;  2E7X A;  2A69 F;  2ESH A;  4FHT A;  5CVV A;  5D5X B;  3KZZ A;  1YQA A;  5DUK A;  3CUQ A;  2ZNZ A;  4I0A A;  1I1G A;  2STW A;  3KP3 A;  1YYV A;  1XCV A;  1WSU A;  1ZG5 A;  2PN6 A;  3EQL F;  3WGI A;  1DPR A;  2XRO A;  2XAG A;  1SD6 A;  3SZT A;  2VOO A;  3ROU A;  4O6J A;  3WTX C;  3RKY A;  3I53 A;  4MQV A;  3WGH A;  2XAH A;  4MEY F;  2P5L C;  4ESJ A;  2BGC A;  2LKP A;  2Y48 A;  2ZCW A;  4BQA A;  1U5T B;  1E17 A;  3RYP A;  1AOY A;  4LB6 B;  1XD7 A;  4LGW A;  1UST A;  4M9X A;  2NNN A;  2L4M A;  3ZMD A;  2GA2 A;  3E5Q A;  5BPI A;  1XGS A;  3F6O A;  4QLC U;  3K1P A;  4G6Q A;  2F5E A;  3GO5 A;  1MZB A;  4A0Z A;  3ML6 A;  1SMY F;  3KZY A;  3RPQ A;  2JTV A;  3HRS A;  1AWC A;  1I1S A;  2XV4 S;  2WTE A;  4GO1 A;  4RB0 A;  2BV6 A;  1HQC A;  1B9M A;  5E1Z B;  4JQF A;  2RKH A;  3ZMV A;  4IVN A;  2DW4 A;  1MJA A;  3CO6 C;  3V7S A;  3QP5 A;  3J80 Z;  3FF5 A;  3BJA A;  3JTH A;  3TKY A;  3HSR A;  5A2Q K;  4OMZ A;  4AVP A;  3PQJ A;  2E7W A;  4MQ9 F;  4M6X A;  1S6L A;  2EWN A;  2DTR A;  3K1M A;  3WG9 A;  2FRH A;  4GYI A;  4EGZ A;  2O6G E;  3I0T A;  1HKQ A;  2YPR A;  4MGR A;  1SAX A;  1CGP A;  1KU3 A;  2M5W A;  4EV0 A;  2LF8 A;  1GXQ A;  1BN5 A;  4KA4 A;  1UB9 A;  4HX4 A;  2DK5 A;  2KJB A;  1LEB A;  1KQ0 A;  3FHZ A;  1P2F A;  2DQR A;  5JVT A;  5L3B A;  2IW5 A;  5K5O A;  4Q5S F;  1ODD A;  2OZ6 A;  5E1X A;  3J81 Z;  6PAX A;  3RYR A;  5HDK A;  2UXX A;  2QQB A;  2ZFW A;  4KIB A;  1LVA A;  4OIR F;  1PUE E;  1IF1 A;  3F22 A;  5FFX A;  3WE3 A;  1XDS A;  5DCM A;  1U5T C;  2WV0 A;  2K7L A;  4OIN F;  1C0W A;  1OYY A;  3WTU C;  1QQI A;  2XGX A;  2JPC A;  1ZG1 A;  4EMS A;  2R3S A;  1OYW A;  1O57 A;  5CJ9 A;  1FNN A;  2R7D A;  2COM A;  3HHH A;  3E6C C;  1IZ1 A;  4U0V A;  5HDG A;  3LQR A;  5ED4 A;  1QZY A;  2M45 A;  2IRF G;  2XUB A;  2W25 A;  4M9S A;  5JFR A;  3EYI A;  3GLX A;  1X3U A;  4I09 A;  1ZH5 A;  3S2W A;  4RB2 C;  3E3V A;  4KIF A;  4G7O F;  1JHH A;  3T8R A;  2RQP A;  3GWZ A;  2CYY A;  1R5G A;  3IWZ A;  1RZ4 A;  4PDK A;  3R0J A;  2P8T A;  4HZF A;  2VXZ A;  4EJV A;  4RGS A;  3WTS C;  4WXH A;  3GXO A;  3V4G A;  3COA C;  1FSH A;  1QZZ A;  2EK5 A;  3WTW C;  5BOX A;  2A68 F;  5HOO A;  2RDP A;  3IRQ A;  1DUX C;  2BEO A;  2DI3 A;  4IHT A;  1KA8 A;  4M72 A;  4NHJ A;  2B0L A;  1W7P D;  1ZRD A;  3B02 A;  1P6R A;  1XB4 A;  3WU0 A;  4G7Z F;  3VOE A;  5D5U B;  1FP2 A;  2P6T A;  2Z3Y A;  5BMZ A;  3TOB A;  1IAW A;  2Q8K A;  1K7A A;  2JSC A;  3Q9V A;  3VOD A;  5D8L B;  3P9I A;  3SZP A;  4K2E A;  1STZ A;  3FX3 A;  1T6S A;  3T1B A;  2V6C A;  4Z2Y A;  5F64 A;  1KYW A;  3U9G A;  2UXN A;  2L4A A;  3AAF A;  2HEO A;  1SMT A;  1FX7 A;  2LNB A;  1BIB A;  1UCR A;  1O3T A;  1A04 A;  2Q0O A;  1W4M A;  4BHC A;  1EH6 A;  2IJL A;  3L7W A;  3T8T A;  1JHF A;  4ZYH A;  2DLL A;  3IHU A;  4LFU A;  2DBB A;  1PDN C;  4I2O A;  4M73 A;  4IJA A;  2OA4 A;  3FXQ A;  1TTY A;  3ABT A;  1R36 A;  3RDI A;  2IPQ X;  4O5V A;  3RJP A;  5TJJ A;  2DFI A;  4AWX B;  4IF4 A;  2EJR A;  3Q5F A;  3T0Y A;  1VTN C;  4S05 A;  1F5T A;  3F3X A;  2QQ9 A;  2OQG A;  2PMH A;  4HYE A;  4P5O A;  3IWF A;  5D5W B;  1Z05 A;  2DU9 A;  2LSO A;  3JSO A;  1U78 A;  5E1W A;  5BPD A;  1FBQ A;  5E8G A;  2P5V A;  2Q2E A;  4HDV A;  2MA3 A;  2HZT A;  2EA4 A;  1XSV A;  3TDU C;  3HRU A;  5TRD A;  5A2Q Z;  1LB2 A;  1QNT A;  4RAY A;  1BC7 C;  2K4J A;  3E6D A;  3I71 A;  2BE5 F;  2VBZ A;  4UV9 A;  2M87 A;  3JW4 A;  2WWY A;  2M8E A;  4CHU A;  2XAQ A;  2YU3 A;  1W7P A;  2XKP A;  3I5U A;  2H09 A;  4L0Z B;  2VT2 A;  2ESN A;  4CGZ A;  2PI0 A;  3FWE A;  3H3Z A;  3BPV A;  1HW5 A;  2DQL A;  1QO0 D;  3QOP A;  2D2W A;  4EJW A;  4NQW A;  2EV0 A;  2HOE A;  5J6X A;  2ZJ2 A;  2HKX A;  3LA2 A;  4HX7 A;  2PJP A;  5H6Q A;  2OQR A;  3TO9 A;  2ZXJ A;  5K5R A;  2YSR A;  4YFN F;  1G4D A;  3GZ5 A;  2IA0 A;  4L5J A;  2L3D A;  3C3W A;  3SXY A;  5LEJ A;  2EV5 A;  2MH2 A;  4HV6 A;  2ISY A;  3O6B B;  2MD5 A;  1ZRC A;  4RGX A;  5DCM B;  4A0X A;  4L0Y B;  2CFX A;  5E17 F;  2RC4 A;  4F7Z A;  1ZLJ A;  4A6D A;  2EFQ A;  3MCZ A;  3BOQ A;  1QGP A;  5DYM A;  2NAZ A;  2V79 A;  2MLK A;  5LBQ A;  1P92 A;  2F5F A;  2VBY A;  1RNL A;  2O3F A;  2RN7 A;  4Q48 A;  2H94 A;  1T2K A;  4HQE A;  1LDK B;  4YFX F;  4D0P A;  4I01 A;  4AIH A;  3R4K A;  1HBX G;  3MZH A;  5HLG A;  2MC3 A;  2FE3 A;  2VBW A;  3C1D A;  1ZRF A;  1XSX A;  4I7H A;  5CLS A;  1K6O A;  1SD7 A;  5LGU A;  5LEK A;  2FMY A;  1R7J A;  3NEU A;  2PMU A;  1FC3 A;  1TW2 A;  4OU0 A;  1BI1 A;  1LEA A;  4M6Y A;  3LFK A;  1U3E M;  1FY7 A;  4MTD A;  1Z6T A;  5CYV A;  2YR2 A;  2P5K A;  3F8M A;  3KFW X;  1UHM A;  1FBS A;  3LWF A;  4HBL A;  1OR7 A;  1S8N A;  3MZY A;  3U1D A;  5ICF A;  3JAM Z;  2DK8 A;  5K1Y A;  2L01 A;  4LK0 F;  1U5T A;  2FNP A;  4HLX A;  4ON0 A;  3ZQ7 A;  2XKO A;  3O2P E;  1SFU A;  2ELH A;  2FEZ A;  3BY6 A;  3TO7 A;  1CF7 A;  4G7H F;  3I59 B;  1O7L A;  3V7C A;  1Z91 A;  1S29 A;  1MJB A;  2C6Y A;  1OKR A;  2HTJ A;  2FOK A;  2V1U A;  1G3T A;  1H9T A;  4HF0 A;  1FBU A;  2H6B A;  4LB5 A;  1W7P B;  1KQ8 A;  2JZY A;  5FB2 A;  4FX4 A;  4G6D A;  4BYY A;  3CUQ B;  2WC2 A;  3KEO A;  3HIF A;  1ON2 A;  1S7A A;  2K86 A;  1ZGJ A;  3O3K A;  2FBH A;  1BI2 A;  4P9U A;  1EH7 A;  3KP2 A;  3HUG A;  5FD5 A;  2A07 F;  4L5I A;  4U0Y A;  2A61 A;  2QWW A;  3DEU A;  1SD5 A;  2NNY A;  5ICC A;  2GXB A;  1IN6 A;  3HRM A;  5FD6 A;  1MD0 A;  5D6F A;  4LK1 F;  3FZV A;  3D5L A;  1G6N A;  3TQN A;  5EEH A;  4LG0 A;  4M74 A;  2FF4 A;  2W24 A;  1ZRE A;  2DPD A;  4YG2 F;  4KNY A;  3IC7 A;  2RNJ A;  5E8I A;  1BI3 A;  1OMI A;  5HS8 A;  4YIF A;  1BBY A;  2K02 A;  2NS0 A;  1P4W A;  4B8X A;  2KJC A;  3KP7 A;  3IL2 A;  4N0B A;  2EFO A;  3V7R A;  1FT9 A;  1LJ9 A;  2YX4 A;  1UFM A;  1XGM A;  1I6X A;  2K27 A;  2RGV A;  3J80 K;  4ETS A;  1ZYR F;  2O0Y A;  5ICE A;  1UHW A;  2QLZ A;  4KMF A;  2P4W A;  3KLO A;  5IT9 Z;  2XAS A;  3BZ6 A;  3ZPL A;  1HKS A;  1RIO H;  5D4R A;  5ICG A;  1FLI A;  4KT5 C;  4U0W A;  3WU1 B;  4GYG A;  4LLN A;  3RKX A;  5JHU A;  3IKV A;  1FSE A;  1T98 A;  1G3S A;  3DPL C;  4MNU A;  5ILS A;  2PQ8 A;  1XGN A;  3E5X A;  3BDD A;  4BHP A;  1H9G A;  3F8F A;  4R1H A;  1P4A A;  3LST A;  3ZMZ A;  2D45 A;  3KLN A;  2HKO A;  1IN8 A;  3HTU A;  3SFZ A;  4IXA A;  5L3F A;  3ERE D;  5FLX Z;  3D0S A;  2Z5U A;  1IRF A;  2IT0 A;  2XVC A;  3F72 A;  1B59 A;  4BH9 A;  4PCQ A;  1SD4 A;  4RB1 A;  3VEP A;  4U7D A;  4M9Z A;  2TDX A;  4XBF A;  4O3M A;  3M8F A;  1WWX A;  1FYL A;  2VC0 A;  2CQK A;  5KK1 A;  5LHI A;  2CWE A;  1ZAO A;  1D8K A;  3FM5 A;  2ZNY A;  5K5Q A;  2GA1 A;  4PGH A;  2A6H F;  4U88 A;  4A6E A;  2AS5 F;  1B4A A;  1B9N A;  1LDD A;  4N9H A;  5DUI A;  3LA3 A;  3L2C A;  3DFG A;  1I5Z A;  3ZP5 A;  3BRO A;  2E1N A;  1R00 A;  4LLL A;  4M71 A;  3K0L A;  5LGT A;  4L9T A;  3R6S A;  2G9W A;  1D5V A;  4WF2 A;  3HOT A;  4G8X A;  4P55 A;  2J5O A;  1H0M A;  1B1B A;  2MLG A;  3FXR A;  1S7O A;  3CUO A;  4ZZD A;  2VC1 A;  3L09 A;  4ZZL A;  1XDU A;  1MDM A;  1GHC A;  3M7G A;  4KMU X;  4A5N A;  2KRF A;  1J59 A;  4MEX F;  4WXC A;  2AXL A;  2FML A;  1SFE A;  2VOD A;  3GX4 X;  2EA2 A;  5J8C A;  4HX8 A;  1XN7 A;  1IXR C;  2RV8 A;  2HWV A;  2PEX A;  1ZG3 A;  5CVJ A;  4ZYD A;  5DDG A;  3FXU A;  5H20 A;  2A5Y B;  2DT5 A;  3WTY C;  1FP1 D;  3J7A O;  1XMA A;  3RI4 A;  1ON1 A;  2IA1 A;  1YW7 A;  1HST A;  3KEQ A;  5L3C A;  1RUN A;  4G94 A;  1ZLK A;  1R1T A;  1G3Y A;  1HXD A;  2HFH A;  4ZYG A;  4ASN A;  3N4M A;  1YS7 A;  1K79 A;  5CVR A;  3EDP A;  1U8R A;  1TLH B;  1T0F A;  3SHF A;  5EEG A;  2QVO A;  4Y17 A;  2HGC A;  2J5P A;  2H27 A;  5HS7 A;  2ZO4 A;  4EM2 A;  3CJN A;  1GXP A;  3QAH A;  4ZH4 F;  4RS8 A;  5HLI A;  3M9A A;  4A5M A;  3R0A A;  2ADU A;  4WCG A;  5FFZ A;  2UWM A;  1IN7 A;  2W85 A;  2YX7 A;  2FBK A;  4HF1 A;  1R58 A;  2ZBK A;  3E97 A;  4OIP F;  4KUM A; 
#chains in the Genus database with same CATH topology
 3GF2 A;  3O8H A;  2FNA A;  3CCQ I;  3L00 A;  4QTR A;  2WAQ N;  3PL8 A;  2EIK H;  4OIO F;  1J7K A;  3LSH A;  1TWA J;  2DA7 A;  2EFW A;  3FMQ A;  4I0B A;  2R7Z J;  4A93 J;  3C2G A;  3EPZ A;  5J40 A;  5F1J A;  4A3F J;  1LQ1 A;  1BJZ A;  2FQ3 A;  4CYD A;  3CMM A;  4WXD A;  2HQR A;  3DKW A;  3QOE A;  4A2U A;  2EIL H;  2QQ8 A;  4DNC A;  2ICW G;  3DP7 A;  1A6Q A;  1IUY A;  4CIC A;  1VFC A;  5D5V B;  3IRR A;  2XIG A;  4MO7 A;  3WE2 A;  4XLH A;  1DDN A;  2HI3 A;  1D5Y A;  3B73 A;  3K70 C;  5L3D A;  5CVI A;  2COB A;  4PK4 A;  2VON A;  1KGS A;  1OCC H;  2F5V A;  2D5V A;  4HAM A;  1NHA A;  3BC8 A;  5M5W J;  1T0F C;  1T39 A;  4RB3 C;  5GP9 A;  5EG0 B;  4MIM A;  4KT6 A;  2IGK A;  2M34 A;  1IXS B;  3WTV C;  1LVK A;  5AIQ A;  1LNW A;  3VYR B;  3JSP A;  1QU3 A;  4UHT A;  2ELJ A;  2F4M B;  3LSG A;  3P5J A;  2XAJ A;  3MQ0 A;  5F0F A;  1J2X A;  4OAY A;  1Z1D A;  3LSM A;  3HB9 A;  4EJU A;  1RKW A;  4MTE A;  3TO6 A;  1VQN I;  1ZR4 A;  3KET A;  2MBF A;  2K3F A;  3S3O A;  4L9N A;  2DMP A;  1PUF A;  4LIU A;  4GFB A;  4IHS A;  3I64 A;  3H3U A;  3FIS A;  5IOY A;  3HTS B;  2CQ7 A;  3M1C A;  4ZDP A;  1VQO I;  4P96 A;  5GPA A;  1B6A A;  2KL4 A;  3ZN0 A;  3L2Q A;  3CCJ I;  2R5Y A;  3H0D A;  3UKG A;  1FOW A;  1T56 A;  4G9Y A;  1R5H A;  3ZGK A;  1HF0 A;  1UG0 A;  2KT0 A;  1YIO A;  3GFJ A;  1Y0U A;  3G73 A;  3F8C A;  5K7F A;  1E3H A;  3R61 A;  1BM9 A;  2E1O A;  3CP2 A;  4BS9 A;  5J8F A;  3W3C A;  1QPM A;  1RUO A;  1K78 B;  4P1W A;  4IX7 A;  4CYC A;  2WAD A;  2V1N A;  3VYS B;  3ZQF A;  2A5W A;  5EF6 A;  2RVC A;  4D5C A;  1YRN A;  2CFO A;  2LYC A;  1EKE A;  1HW1 A;  1R4N B;  3HHG A;  1B72 B;  3GTL J;  4UXN A;  4BEH B;  5K7H A;  4BAY A;  2QUF A;  1IW7 F;  3PFI A;  3KCC A;  2Y0M A;  2D1V A;  3CLO A;  4CCM A;  2G7U A;  2L9N A;  2BVM A;  2X1E A;  5LGN A;  2OU2 A;  3PFY A;  5IP6 A;  2DA6 A;  4UNO A;  1Y8R B;  2XHK A;  3G1L A;  1CF7 B;  1QA6 A;  2PX9 A;  5JLX A;  1N77 A;  2LY2 A;  1F1Z A;  4LG0 B;  3PQK A;  1QZE A;  3GFI A;  4ENK A;  3QU6 A;  3S16 J;  4EM0 B;  4EQQ A;  1OPC A;  1K78 A;  2IP2 A;  2LFB A;  1B8I A;  2V9P A;  3F8B A;  4NC8 A;  4RGU A;  1V5E A;  2XRN A;  3KP6 A;  2ELK A;  1HKT A;  1X1A A;  2Z1D A;  2FSW A;  2HNH A;  2V1D A;  4V19 K;  3A03 A;  4IHW A;  1RC9 A;  3P9C A;  2R7W A;  4JOM A;  1UEL B;  4L9V A;  5FLV A;  2W57 A;  2ZSH B;  1JT6 A;  4RM3 A;  2HXO A;  2IGM A;  2W48 A;  4LMY A;  5EGO A;  1D1C A;  2CJJ A;  4JBA A;  2IXS A;  4KN4 X;  2VPR A;  4RM2 A;  3ZR8 X;  4EVI A;  1BI0 A;  2KIU A;  4MHG A;  4AM3 A;  2DPU A;  1ZAR A;  3GTG J;  1I27 A;  3M8J A;  3V8L A;  4D7N A;  2P81 A;  4UUV A;  4HOB A;  2F6C A;  2Y0S A;  1YO5 C;  3NRV A;  3GCM A;  2IS6 A;  5LRS A;  2PJR A;  4PFO A;  3FMS A;  4WWC A;  5DV5 A;  2Q2E B;  3H9Q A;  2NOJ B;  3P7N A;  3ZMT A;  3LAJ A;  2VE9 A;  3ZMU A;  3BJ6 A;  4YII A;  2NXN B;  2GQQ A;  4LOC A;  3KYD B;  4RAG A;  5IT3 A;  2EV6 A;  3DPT A;  1LDJ A;  4S04 A;  2NOG A;  4EJT A;  2WBM A;  4BQN A;  4ESB A;  2W84 A;  3DXJ F;  3GYH X;  3J81 K;  1J0R A;  2RAE A;  5LHH A;  3MKL A;  3K4J A;  3BG7 A;  3K4M A;  3F23 A;  1YG2 A;  2KIM A;  3S32 A;  4TV7 A;  2Z9O A;  3OOP A;  1TQI A;  3WHB A;  1R71 A;  4KDP A;  1JE8 A;  3OL3 A;  3FM3 A;  1HDP A;  1WJE A;  3K69 A;  3U2R A;  2PJR B;  3IUO A;  3K1N A;  4H4K C;  3TED A;  3SQN A;  1E3P A;  1SAU A;  3F21 A;  2CG4 A;  5DD8 A;  3FKI J;  2FU4 A;  1KZH A;  3VYT B;  4RGR A;  5LFA A;  2ME0 A;  3F6V A;  1F9N A;  4NB5 A;  1HDD C;  3A1Y A;  3HDD A;  3DPU A;  1WH5 A;  4UVB A;  3TBI A;  2VE8 A;  1LFU P;  1MBK A;  1WJB A;  1D1A A;  1V3F A;  2KIF A;  4ESF A;  1IN5 A;  3E6M A;  4IRH A;  4UVC A;  1OIS A;  1YTY A;  3HOX J;  2FX0 A;  2O5R A;  3X2Q H;  4M3F A;  5J4Y A;  4BXU A;  2OF7 A;  3EYY A;  1ETY A;  4QWQ A;  3CF5 F;  2NVU B;  4ZTJ A;  3R60 A;  1TT5 B;  2X0L A;  1YJW I;  2G7H A;  2BXY A;  4RA2 A;  1EH8 A;  3ABK H;  3BTJ A;  2OAZ A;  4FQG A;  3LMM A;  3ISP A;  3DQV C;  5BS6 A;  1DP7 P;  3AG2 H;  2CUE A;  1QPI A;  1XGO A;  2QEN A;  4UUS B;  2PMZ N;  1F36 A;  2CW0 F;  2G0E A;  3I59 A;  4LJZ F;  1T33 A;  2DTZ A;  4FX0 A;  2EB7 A;  4KIG A;  4ENN A;  3RPU A;  1KQ9 A;  1Z3Y A;  4OIQ F;  4XSZ F;  2E71 A;  2XC7 A;  2F4I A;  5JI6 A;  3SEQ A;  5LLQ A;  1DGW Y;  2X4H A;  5LRR A;  1VF9 A;  3BR2 A;  4HF2 A;  3HYI A;  1T8I A;  3S3N A;  2K3P A;  4A0Y A;  2XSD C;  4PZJ A;  1R23 A;  1EJ9 A;  2V6E A;  2MW8 A;  1AKH A;  1WQ2 A;  2DCE A;  3MEX A;  2Z99 A;  2MG4 A;  3OS0 A;  1XSD A;  1OJL A;  3DEE A;  3EUH C;  3S17 J;  2CGP A;  2DO7 A;  4XSX F;  2K9S A;  3QWL A;  4NC6 A;  1XX5 A;  2CSO A;  3GUD A;  2CS3 A;  1MMD A;  5D4S A;  2PLY A;  3FMR A;  1R5I D;  1ONV A;  1ZEL A;  4CYC B;  1H88 C;  2QKL B;  2NVY J;  2YS9 A;  3DCF A;  3EUA A;  2JA8 J;  3WOD F;  1BIA A;  3SFI A;  3OSF A;  2ZXW H;  2P7C B;  2OJE D;  3HM5 A;  2QM3 A;  4GRI A;  2JVG A;  2YU9 J;  3GFL A;  4XLP F;  2MSY A;  3KP5 A;  4EJO A;  2HS5 A;  3PNY A;  2ID6 A;  1O4X A;  1ZGA A;  2DYS H;  4LD5 A;  3K10 A;  3S8P A;  3A4C A;  2MD0 A;  3HSE A;  4IPA A;  2M0M A;  3OWT A;  3V42 A;  3LQQ A;  5DCF A;  5E3N A;  1V4R A;  1XC5 A;  2DA1 A;  3RPU D;  4LLG F;  2EFP A;  3S93 A;  4PJL A;  1MSF C;  2CMP A;  2VIX A;  4CSW A;  5M3M J;  4NUB A;  2E2J J;  3G1M A;  1UHS A;  1NH3 A;  2OUM A;  2M1B A;  5GTI C;  1ITY A;  2L54 A;  5CKT A;  3BR1 A;  4A3C J;  3K4C A;  2VL8 A;  2X6X A;  2DJN A;  3ECO A;  2PBI A;  3G4S I;  2EZH A;  4I98 B;  5J3L A;  1TWG J;  3RKW A;  1SVM A;  1O3S A;  4ENM A;  1MGT A;  3H0G J;  3MKY B;  1HW2 A;  3EUK L;  1TW3 A;  1VQ7 I;  2LTP A;  3I4N J;  3GEZ A;  1GVJ A;  3KP4 A;  1FOX A;  2F4O B;  3FIW A;  3LSR A;  2VJJ A;  4BQQ A;  3CDH A;  2CO5 A;  2JRT A;  3WGG A;  2JA7 J;  3M8E A;  2JT1 A;  5JHF A;  2VKH A;  3CME I;  4E70 A;  1ETK A;  2D1H A;  3TP3 A;  4D1Q A;  4OMY A;  2FXA A;  4A12 A;  2R7V A;  2KRH A;  2EIJ H;  2QYO A;  1F4K A;  2O8X A;  3LSK A;  3KPH A;  1JXS A;  3DEW A;  2K4B A;  1UMQ A;  4UB6 C;  2BZT A;  4BKX A;  2QEX I;  4HLY A;  3RTR A;  4HV5 A;  1IRX A;  4AIJ A;  2HDD A;  1XG1 A;  1YLF A;  1YJN I;  1FTT A;  4B43 A;  2ZFU A;  3C18 A;  2E1M C;  1FZP B;  3EUH A;  1BOA A;  2L02 A;  3CO7 C;  2GOM A;  2O7O A;  2MH9 A;  3K2Z A;  1Z0X A;  1YIJ I;  3MAJ A;  3QOD A;  3ASO H;  4OOI A;  2NVT J;  2K40 A;  1J75 A;  3AKZ A;  2Y75 A;  2QQA A;  1PP8 F;  1VQK I;  2XPV A;  3BR5 A;  2BOL A;  3DTE A;  2PMZ A;  2QBY B;  2LMD A;  2OD5 A;  3E6B A;  1IRG A;  4IRI A;  3ABU A;  1BR2 A;  1KU9 A;  2M0C A;  3QPT A;  1J9I A;  3DF8 A;  4L9J A;  1MKM A;  4DYQ A;  1OYI A;  2IA2 A;  3DWL E;  3M1E A;  1ZKG A;  3BQZ A;  1WKM A;  1IRZ A;  5EDN A;  3KZI C;  2VKV A;  3LA7 A;  2CRG A;  2HR3 A;  2PG4 A;  4ZTF A;  3L2V A;  5FLX K;  3VSK A;  2FJ1 A;  2GZW A;  5KHD A;  1J5Y A;  5DM7 F;  2HDC A;  2JPB A;  3WHC A;  2NYX A;  2ZKZ A;  5AIP A;  1T08 B;  4HEA 2;  3CCU I;  2EFN A;  4EGY A;  2DOA A;  1MBE A;  2HQN A;  2DAO A;  2ZXH A;  4ZYE A;  5JLW A;  3IH3 A;  2O61 A;  4CDG A;  1WRJ A;  5C4J J;  2GAU A;  3KIO A;  2FD5 A;  2PFB A;  4L18 B;  2VOP A;  4GCV A;  3HRT A;  3BG3 A;  1AHD P;  4E7S A;  3W6J B;  4UVA A;  1Y1W J;  4BNC A;  5E18 F;  4KYW A;  2OC6 A;  2P6S A;  3NAR A;  3AG3 H;  4JX5 A;  1MJ9 A;  3CF2 A;  4CXF A;  2NS7 A;  3DV8 A;  3BP8 A;  2E2I J;  2KKO A;  2QF7 A;  3G1O A;  3CTA A;  3O8G A;  3JRD A;  1W0T A;  1TBX A;  1BL0 A;  1D0X A;  2IVM A;  2BBY A;  3B6A A;  5E20 A;  3QU3 A;  4PGG A;  5J1Y A;  4AU7 A;  3I4P A;  1U2W A;  4IO9 F;  3CUQ C;  2OBP A;  1IN4 A;  1Q1H A;  3BTL A;  3RIR A;  5HNH A;  3W6V A;  1OCO H;  3ZQG A;  2R7F A;  3DBR B;  4C2T A;  2TCT A;  4M3D A;  3K70 D;  4A3E J;  3PIO F;  4AIK A;  4CCK A;  2L7K A;  1GT0 C;  1IXC A;  2STT A;  2VT3 A;  1S5L C;  2VBX A;  4BAC A;  3BG5 A;  5F6F A;  3G3Z A;  2A3S A;  4BHB A;  3L1P A;  4ENJ A;  3BR6 A;  1O3R A;  4UY8 I;  5GAE J;  5D6E A;  3OYD A;  3TDZ C;  4N4O B;  3DTI A;  3VFZ A;  1TWC J;  2GXG A;  1TT0 A;  4F52 A;  4GXO A;  3GVA A;  4B09 A;  3KYL A;  1TNS A;  1J09 A;  2DMT A;  5DEQ A;  3REO A;  4ITV A;  3H92 A;  4KIC A;  1NTC A;  4ANJ A;  3OS2 A;  4NDL A;  4AD9 A;  3FXL A;  4UV8 A;  1PVE A;  5D8K B;  4A3I J;  4XLN F;  3K2A A;  4FT8 A;  3GTO J;  2QBY A;  2MAB A;  3OYG A;  4HRI A;  2R7T A;  4R79 A;  3ZCO A;  1Y8Q B;  1FIP A;  1FMW A;  1O7F A;  3ZQL A;  1BC8 C;  4BJ5 C;  1JUS A;  2M9H A;  2X48 A;  2K85 A;  2V9V A;  1R4M B;  3I4M J;  1VQ5 I;  4HA8 A;  2UZK A;  5HNF A;  1JTX A;  2VJ5 A;  3BZC A;  2E36 A;  2XAF A;  3HSF A;  1A31 A;  3TMO A;  3OSG A;  4IHV A;  3DU6 A;  3QPS A;  4FAS D;  3ZMS A;  2LF7 A;  4N9I A;  3BPX A;  5KVR A;  3S14 J;  3QPH A;  2E5N A;  4G6T B;  5ERI A;  5BQT A;  2BYV E;  2V7F A;  1JI8 A;  3IH4 A;  3W6K B;  5IY5 H;  3HEF A;  1JGS A;  1D0Y A;  1HSJ A;  1W5T A;  4Y15 A;  1FYK A;  5FRM A;  1DP3 A;  2HTS A;  1R22 A;  2ZB9 A;  3W2A A;  4IEJ A;  1AKH B;  1IG7 A;  4Y33 A;  1OLT A;  1QBJ A;  1FWZ A;  3CJQ B;  4R8H A;  4RLQ A;  1S3J A;  5B3S H;  2Y30 A;  2M7A A;  3Q9S A;  4MLO A;  1R1U A;  4LG3 A;  2R7S A;  1L0O C;  2E60 A;  3JTG A;  4JK1 X;  1MNE A;  3S15 J;  1P4X A;  2Y31 A;  2F5C A;  3OYM A;  3DTK A;  3ZRG A;  1G3W A;  2ZSI B;  2DXI A;  1QVT A;  4U7B A;  5JVG F;  1OQY A;  2ZJR F;  2V1X A;  3GFM A;  4CH7 A;  3QP6 A;  4AC0 A;  1TQM A;  1MIJ A;  1ACI A;  4CO8 A;  5JR3 A;  3CDI A;  1USS A;  2HYF A;  1REP C;  4BBS J;  5B1B H;  4WX9 A;  1KU2 A;  5HOD A;  3GZ6 A;  3ECH A;  1KU7 A;  3GTJ J;  4H0E A;  5HS9 A;  4DQ2 A;  2HYG D;  5ILV A;  2CUZ A;  2KDO A;  3MWM A;  3JRC A;  2JSP A;  3FK6 A;  2DYR H;  3ULQ B;  1RI7 A;  4BJT A;  3CCV I;  1JUM A;  4HQM A;  2X6O A;  3NQO A;  1T38 A;  2VQH A;  5DD4 A;  1U6G A;  3WTT C;  4KN7 X;  2FOW A;  3V8J A;  1TNT A;  1SFX A;  5HVQ C;  1YIT I;  5CVU A;  5B66 C;  1ETW A;  2JJ7 A;  1E0E A;  3WG7 H;  1FPQ A;  3HOW J;  3TOA A;  1BR4 A;  3Q0W A;  3C2H A;  3ELK A;  1Y0N A;  1APL C;  1BJA A;  1WI9 A;  1OCP A;  1YW8 A;  3GW2 A;  4I02 A;  3L9F A;  3HBL A;  2Z16 A;  4E7K A;  3B6C A;  2BHY A;  4P9F A;  4RAZ A;  1Z7U A;  5AON A;  3DU5 A;  1FOK A;  1FEX A;  1YFH A;  1E2X A;  3H5R A;  1L3L A;  1W5S A;  3QRF F;  2ZXI A;  3S2H J;  5EZH A;  3C7J A;  5J1R A;  2E35 A;  1D3Y A;  4BE1 A;  4Q4Z F;  4YFK F;  3K9T A;  5J1U A;  2F5D A;  2XPU A;  2ZME B;  3T5X A;  4XKV A;  2FBI A;  2H6C A;  1BW6 A;  2A6E F;  3EET A;  2IS1 A;  1WJF A;  2DJI A;  4RMN A;  2M4G A;  1KYZ A;  4C2U A;  3G71 I;  1VQP I;  1XMK A;  4B47 A;  2L2O A;  4NBQ A;  1MDM B;  5IYB J;  4DBQ A;  2LK2 A;  4XRF A;  5L3G A;  3F8N A;  3BJO A;  5HLH A;  3I54 A;  1FYM A;  3JAM K;  4BBR J;  3TGN A;  1R1V A;  2QCO A;  2LOO A;  4EM1 A;  3MFK A;  3AL0 B;  3P9K A;  5IP7 J;  1FJL A;  3I58 A;  1ULY A;  2OZU A;  5FO5 A;  4GGG A;  2AQF A;  5KAF C;  1ZQ3 P;  5L3E A;  1ZHF A;  3RCO A;  3WTZ A;  4DOZ A;  1D8J A;  5ILU A;  2Z33 A;  1QHG A;  1YX3 A;  1PP7 U;  2JK3 A;  2ACJ A;  3HOS A;  5H6R A;  3OV8 A;  1Z9C A;  4XN3 A;  3IKT A;  4CZZ A;  1YW9 A;  2M30 A;  1WHU A;  3A0B C;  2R92 J;  2F2E A;  5FGM A;  2P7V B;  5LHG A;  5F04 A;  4JX6 A;  9ANT A;  2O03 A;  5FKK A;  1XCB A;  2FA5 A;  4Y13 A;  4IHY A;  2VN2 A;  3BT9 A;  1IC8 A;  4IRG A;  2KIQ A;  3K4L A;  3NWS A;  2NRA C;  1WJ5 A;  4DYR A;  2XSJ C;  3CJT B;  5F1R A;  2GIV A;  1DPU A;  2HPI A;  2V9K A;  2E1C A;  2ETH A;  2JUG A;  4A3K J;  3PUB A;  3ZN1 A;  1V5G A;  4HNT A;  1TQP A;  3H3V K;  1GLN A;  2DDA A;  2QZ8 A;  3I3L A;  3SZG A;  5IT9 K;  4HW0 A;  3GBG A;  3N97 A;  2X9D A;  5EYR A;  4KFC A;  2WAE A;  4OWR B;  1A5J A;  4D9J A;  1O3Q A;  1Z6R A;  3HZJ A;  5HDN A;  1IJW C;  4Q47 A;  2N8G A;  3E5U A;  2GWR A;  2ZME A;  1IDZ A;  1YS6 A;  3BWG A;  1EV7 A;  2ISZ A;  2LDU A;  2I10 A;  2L7M P;  4WK8 F;  1MMG A;  4HDU A;  2HOT A;  3V8K A;  4LIV A;  2WB1 A;  2KP6 A;  2LG4 A;  1ZN2 A;  3LAP A;  3KE2 A;  1N75 A;  4PSW A;  2E7X A;  3D5R C;  3VB2 A;  4II3 A;  2A69 F;  2ZJP F;  1BR1 A;  2ESH A;  2JUC A;  4FHT A;  5CVV A;  3HG9 A;  2M2E A;  5D5X B;  3KZZ A;  5C3E J;  1YQA A;  3K4N A;  4OAZ A;  5DUK A;  3HPG A;  2XGC A;  3CZ6 A;  2CU7 A;  1CQT A;  3CUQ A;  4A3J J;  2ZNZ A;  4I0A A;  1I1G A;  2DFF A;  1K61 A;  2STW A;  3KP3 A;  2R5Y B;  1YYV A;  1XCV A;  2Y9Z A;  3CC4 I;  5C44 J;  1JUP A;  1WSU A;  2XF5 A;  2WA0 A;  1ZG5 A;  1X2N A;  3HGY A;  2PN6 A;  1Y39 A;  2I5U A;  3EQL F;  3WGI A;  1DPR A;  1Z67 A;  1HA8 A;  3OIO A;  2XRO A;  2XAG A;  2K9Q A;  3SDG A;  1SD6 A;  3SZT A;  1E3O C;  2VOO A;  3ROU A;  2GLO A;  3A02 A;  2X6Y A;  4O6J A;  3WTX C;  3HC7 A;  1ZTR A;  3RKY A;  3I53 A;  4MQV A;  4XRS G;  3OYJ A;  4E7J A;  1X4O A;  3HOZ J;  3WGH A;  2XAH A;  1AU7 A;  2L9R A;  1FOY A;  2MYS A;  4MEY F;  2BW3 B;  1B8I B;  2P5L C;  4ESJ A;  2BGC A;  2LKP A;  1NG6 A;  2Y48 A;  2ZCW A;  4BQA A;  3KX2 A;  1U5T B;  1E17 A;  3PM1 A;  5GAH J;  5FRN A;  1SFO J;  1T95 A;  3RYP A;  1AOY A;  4LB6 B;  1XD7 A;  4LGW A;  1MMN A;  2X6W A;  1UST A;  4M9X A;  2NNN A;  1PYV A;  2L4M A;  1S7E A;  3ZMD A;  2GA2 A;  4XKB A;  3E5Q A;  5E3M A;  1WJC A;  2EIM H;  2QSH X;  5BPI A;  5F27 A;  3K6G A;  1A36 A;  1XGS A;  3F6O A;  4QLC U;  3K1P A;  3S1N J;  4G6Q A;  2DMN A;  2F5E A;  3FXK A;  5IYC J;  3OY9 A;  3GO5 A;  1MZB A;  4A0Z A;  3ML6 A;  1TC3 C;  1SMY F;  2LRE A;  3CCY A;  2LLK A;  3KZY A;  3RPQ A;  2JTV A;  3HRS A;  1IV6 A;  5KCM A;  1MBJ A;  1AWC A;  3MZ8 A;  4XK4 A;  1JKQ C;  1I1S A;  3H36 A;  3MMY B;  2XV4 S;  1W1W E;  2WTE A;  4GO1 A;  4RB0 A;  2BV6 A;  1HQC A;  2MFZ A;  1B9M A;  5E1Z B;  4JQF A;  2RKH A;  3ZMV A;  2JQ7 A;  2I8D A;  1QRY A;  3CQZ J;  4IVN A;  4CUG A;  2JMW A;  2IS4 A;  2DW4 A;  4XMY A;  3OYN A;  3FKJ A;  1MJA A;  2M7B A;  2XGE A;  3CO6 C;  2WAQ A;  3NAU A;  3QP5 A;  3V7S A;  4B3A A;  3J80 Z;  3HJE A;  5GAG J;  4M3G A;  3FF5 A;  4E7H A;  3BJA A;  3JTH A;  5EG0 A;  3TKY A;  3HSR A;  2OV7 A;  5A2Q K;  3TW6 A;  5DM6 F;  2K9M A;  4OMZ A;  2JA5 J;  4AVP A;  4W97 A;  2VKD A;  3PQJ A;  2E7W A;  2MC4 A;  2AO9 A;  1EF4 A;  4MQ9 F;  3AG4 H;  1Z21 A;  2LD5 A;  4M6X A;  1S6L A;  2Y9Y A;  2EWN A;  5TIS C;  2DTR A;  2BXZ A;  3K1M A;  2IAI A;  4KIS A;  3BR3 A;  3WG9 A;  2DT6 A;  3OYH A;  5F08 A;  2FRH A;  2OTJ I;  4ZC3 A;  1JKP C;  4GYI A;  4EGZ A;  2DA3 A;  2B9S A;  1N25 A;  2A05 A;  3QQA A;  2O6G E;  4BU2 A;  3I0T A;  5GTH C;  1HKQ A;  2YPR A;  1Z3X A;  4MGR A;  1SAX A;  1CGP A;  1KU3 A;  2M5W A;  4EV0 A;  3OYE A;  5IPA A;  3OL4 A;  2IBD A;  2LF8 A;  4RLF A;  4KIT B;  1GXQ A;  4QSH A;  1BN5 A;  4KA4 A;  4A3L J;  1U0J A;  1TL8 A;  3CCE I;  1UB9 A;  4HX4 A;  2DK5 A;  2KJB A;  3M3Y J;  1LEB A;  1KQ0 A;  1VZ0 A;  4XIC A;  3FHZ A;  1TWF J;  1DQU A;  1GVD A;  1P2F A;  4FET A;  4IOA F;  2DQR A;  5JVT A;  1LKX A;  5L3B A;  2IW5 A;  2GBY A;  2RRE A;  1ODD A;  2OZ6 A;  5E1X A;  3ZQQ A;  5K5O A;  3J81 Z;  2ZJQ F;  4Q5S F;  6PAX A;  3RYR A;  5HDK A;  1OR7 C;  2W82 A;  2UXX A;  3OYI A;  3Q0U A;  2QQB A;  2ZFW A;  2R0Q C;  2VLA A;  4BDY A;  4PJM A;  5EGO B;  2L0K A;  4KIB A;  5FKL A;  3L2R A;  1LVA A;  2KRC A;  1Q1V A;  4OIR F;  1MMA A;  1QHH D;  5K7Z A;  4CCL A;  1PUE E;  4JX4 A;  1IF1 A;  3F22 A;  5FFX A;  4CCJ A;  4JP0 A;  3WE3 A;  4Y52 J;  1XDS A;  5DCM A;  1U5T C;  4BDZ A;  2E19 A;  2WV0 A;  5EEA A;  2K7L A;  4OIN F;  2P0W A;  1C0W A;  1OYY A;  3WTU C;  1QQI A;  2XGX A;  2JPC A;  1ZG1 A;  3OYK A;  3LNQ A;  4EMS A;  2R3S A;  4BUP A;  1OYW A;  1MBG A;  1O57 A;  5CJ9 A;  1FNN A;  2R7D A;  2COM A;  3S2D J;  3HHH A;  3E6C C;  1IZ1 A;  3HPH A;  4F55 A;  4U0V A;  1HCR A;  5HDG A;  4A69 C;  5M3F J;  3LQR A;  5ED4 A;  1QZY A;  2KZG A;  2M45 A;  3LSJ A;  4BEH A;  2IRF G;  2XUB A;  3TL4 X;  2W25 A;  4DGW B;  3HOV J;  4M9S A;  5JFR A;  3GTM J;  3EYI A;  3GLX A;  1X3U A;  2LP0 A;  2DOE A;  2ZME C;  2K9N A;  3VPR A;  2LC2 A;  3CMY A;  4I09 A;  1DU0 A;  1ZH5 A;  3S2W A;  3ZQH A;  3FBI B;  4RB2 C;  3E3V A;  4KIF A;  3HOU J;  4G7O F;  1JHH A;  1MBH A;  3HXL A;  3T8R A;  2RQP A;  3GWZ A;  3FHN A;  2CYY A;  3PNV A;  1R5G A;  2E5Z A;  2R93 J;  3IWZ A;  5IYD J;  5H2F C;  1RZ4 A;  1U8B A;  3FXJ A;  4PDK A;  3R0J A;  4IHX A;  3A01 B;  2P8T A;  4HZF A;  2VXZ A;  2CUJ A;  2XF7 A;  4DW6 A;  4EJV A;  3S3M A;  3CMA I;  4RGS A;  3WTS C;  3I56 I;  1HLV A;  4WXH A;  3GXO A;  4EAT A;  3V4G A;  2R7X A;  3COA C;  1FSH A;  1QZZ A;  2H1L A;  2XGD A;  1BW5 A;  2EK5 A;  4B1R A;  3WTW C;  2DFH A;  5BOX A;  1LFP A;  1U9N A;  2BY0 A;  5FRO A;  3KEY A;  2MGQ A;  2Y69 H;  2A68 F;  2E2H J;  1XMX A;  5HOO A;  2RDP A;  4D7M A;  3IRQ A;  3GTP J;  1ZR2 A;  1DUX C;  3U21 A;  2BEO A;  3S1R J;  3CCL I;  2DI3 A;  4IZZ A;  4IHT A;  1KA8 A;  2LRD A;  4M72 A;  4NHJ A;  2B0L A;  1W7P D;  1ZRD A;  1G8X A;  3B02 A;  5B1A H;  1P6R A;  1XB4 A;  2O8K A;  1ERD A;  3WU0 A;  4C3J J;  3PIP F;  5FKN A;  3A01 A;  3IV5 A;  4HPQ A;  4G7Z F;  3VOE A;  1WFX A;  5D5U B;  1FP2 A;  1RPW A;  3M07 A;  2HOA A;  2P6T A;  1GDT A;  2M8G X;  2KLO A;  2Z3Y A;  5BMZ A;  2M3A A;  2HVR A;  1NK2 P;  3TOB A;  2QGU A;  3GTQ J;  3CP8 A;  1IAW A;  1PJR A;  2Q8K A;  2R7O A;  2JSC A;  1K7A A;  3Q9V A;  3VOD A;  5D8L B;  1I50 J;  5CQG A;  4RBO A;  4KJZ A;  1OCT C;  2GOX B;  3SJM A;  3P9I A;  2M4K A;  3SZP A;  3N05 A;  1GV5 A;  1STZ A;  3FX3 A;  4K2E A;  3ZQI A;  1T6S A;  1LPQ A;  4PJ0 C;  3PO2 J;  3T1B A;  2V6C A;  2A6T A;  4E7I A;  4Z2Y A;  3OYC A;  2BY1 A;  5F64 A;  1KYW A;  4F3Q A;  2NS8 A;  3LSP A;  1HC8 A;  3OR1 C;  3U9G A;  5DTD A;  2UXN A;  2KDZ A;  2L4A A;  3E7L A;  3AAF A;  2HEO A;  1SMT A;  3MKZ A;  1FX7 A;  4XOT A;  1SFK A;  2DMQ A;  2EPF A;  3DKX A;  2XDV A;  2LNB A;  1BIB A;  3MVP A;  3ASN H;  1UCR A;  2CUF A;  1A04 A;  2Q0O A;  2TRT A;  1O3T A;  1W4M A;  2HOS A;  4BHC A;  1EH6 A;  1SC7 A;  2DA4 A;  2IJL A;  3L7W A;  4HST A;  3T8T A;  1JHF A;  2DDB A;  4ZYH A;  2DLL A;  3IHU A;  3A0H C;  4LFU A;  2DBB A;  1PDN C;  4IOC F;  4M73 A;  4I2O A;  4IJA A;  5M5Y J;  2L9V A;  1YJ9 I;  2BHZ A;  3F9K A;  1MH3 A;  2JVH A;  2OA4 A;  1NK3 P;  1N78 A;  3FXQ A;  1POG A;  1TTY A;  4PFP A;  3CDL A;  3ABT A;  1R36 A;  2UUZ A;  4M6V A;  4FE7 A;  2XF6 A;  3RDI A;  2IPQ X;  3JRF A;  4O5V A;  4YEL A;  2HQA A;  3RJP A;  5TJJ A;  2VI6 A;  2DFI A;  3PSI A;  4AWX B;  2JWT A;  4IF4 A;  2DA5 A;  2EJR A;  1P9Q C;  3Q5F A;  3T0Y A;  1VTN C;  4S05 A;  1F5T A;  3RQ4 A;  2Y0S N;  3F3X A;  2QQ9 A;  2OQG A;  5IOZ A;  2PMH A;  4HYE A;  4P5O A;  3IWF A;  5D5W B;  1G59 A;  2UV1 A;  5F0H A;  1Z05 A;  2QSG X;  2DU9 A;  2LSO A;  4NC7 A;  3JSO A;  1U9O A;  1U78 A;  5E1W A;  1P7J A;  1MSE C;  2BVL A;  1JGG A;  2KPM A;  3FK7 A;  2JN6 A;  5BPD A;  2VXD A;  1FBQ A;  5E8G A;  2P5V A;  2Q2E A;  3E0J B;  2MA3 A;  4HDV A;  2K9L A;  2HZT A;  2EA4 A;  1ETX A;  1X19 A;  1XSV A;  3TDU C;  3HRU A;  3H5A A;  3RZD J;  5TRD A;  5A2Q Z;  1LB2 A;  5DS9 A;  2HQ5 A;  1QNT A;  3H5N A;  1R6R A;  4RAY A;  1BC7 C;  2Y2Z A;  4MFE A;  2K4J A;  1SAN A;  3UR3 C;  2RQQ A;  2B63 J;  3L2W A;  2EZL A;  3E6D A;  3I71 A;  4Y4R A;  2BE5 F;  2VBZ A;  4UV9 A;  4BXF A;  1D0Z A;  2M87 A;  4CA0 A;  4YRV A;  2WAF A;  3JW4 A;  1VQ4 I;  2WWY A;  2M8E A;  3A2K A;  4CHU A;  4F93 B;  2XAQ A;  4XLA A;  3K7A J;  2XAU A;  2YU3 A;  4XN0 A;  2QKM B;  1W7P A;  3Q3S A;  5C4X J;  2L5Q A;  1WPK A;  4ZDO A;  2XKP A;  3I5U A;  2H09 A;  2OTL I;  4L0Z B;  2VT2 A;  3Q0V A;  2ESN A;  4MFD A;  4F92 B;  4CGZ A;  2PI0 A;  2X51 A;  2IEK A;  3FWE A;  3H3Z A;  4BXX J;  3BPV A;  1HW5 A;  3NWT A;  2DQL A;  2E1M B;  3D5S C;  1QO0 D;  3QOP A;  2D2W A;  4EJW A;  1R9T J;  4NQW A;  2EV0 A;  2HOE A;  2XRL A;  4BQO A;  2ZJ2 A;  2HKX A;  4ZDL A;  5J6X A;  3LA2 A;  4HX7 A;  2DN0 A;  2PJP A;  1WVR A;  5H6Q A;  3CCR I;  4DJA A;  3JR9 A;  2OQR A;  3TO9 A;  3RKQ A;  2ZXJ A;  4I76 A;  5K5R A;  4II2 A;  4BE2 A;  2YSR A;  4YFN F;  1G4D A;  3GZ5 A;  3IH2 A;  2GXA A;  2IA0 A;  4L5J A;  2L3D A;  3C3W A;  3LSI A;  3SXY A;  2EIN H;  4B3X A;  5LEJ A;  2EV5 A;  2W00 A;  4BY7 J;  2NVX J;  2MH2 A;  4HV6 A;  5E79 C;  2ISY A;  2Z2S B;  3O6B B;  1K83 J;  2MD5 A;  4ZYA A;  1MH4 A;  2DT7 B;  4RGX A;  3J7Y J;  1ZRC A;  5DCM B;  4A0X A;  4L0Y B;  2CV2 A;  2CFX A;  5E17 F;  4AID A;  1W36 D;  1YHQ I;  4E6K G;  2RC4 A;  4F7Z A;  1ZLJ A;  3FXO A;  4A6D A;  2EFQ A;  3MCZ A;  2VUM J;  3BOQ A;  1QGP A;  5DYM A;  2NAZ A;  4AYB N;  3DBL B;  2V79 A;  1UAA A;  1UG2 A;  2MLK A;  2X1D A;  1IGN A;  5LBQ A;  1EA3 A;  1R49 A;  3PJR A;  1P92 A;  2F5F A;  3H35 A;  1YRN B;  2VBY A;  1RNL A;  2O3F A;  2CQQ A;  3C2B A;  2RN7 A;  3SDB A;  4Q48 A;  2H94 A;  1T2K A;  4W1U A;  4CZC A;  1IO2 A;  4HQE A;  3GTK J;  3G6E I;  3OYL A;  1LDK B;  2HPM A;  2IGN A;  4YFX F;  4BJ6 C;  4D0P A;  4I01 A;  4AIH A;  3R4K A;  3CC7 I;  3DLA A;  1HBX G;  5B5E C;  2RNG A;  4A3G J;  1M1E B;  3QYE A;  3ZQC A;  1IDY A;  3MZH A;  1VND A;  3JRA A;  2L7F P;  5HLG A;  2MC3 A;  1V54 H;  2FE3 A;  4NNJ A;  2VBW A;  3C1D A;  1RES A;  4HSR A;  1ZRF A;  3K4K A;  2ECC A;  1TZL A;  1XSX A;  1X1C A;  5LD2 C;  4BGD A;  4I7H A;  3LL7 A;  2H1K A;  5CLS A;  1K6O A;  4E7L A;  1SD7 A;  4A3M J;  3MD2 A;  5LGU A;  2B7E A;  2KHM A;  1FIA A;  2KQR A;  1X1P A;  5LEK A;  2FMY A;  1R7J A;  3NEU A;  4AVZ A;  1MND A;  4HNV A;  2GIZ A;  2PMU A;  2OCE A;  1V55 H;  1FC3 A;  1TW2 A;  4OU0 A;  2L7Z A;  2VAS A;  1BI1 A;  1LEA A;  4FCY A;  4M6Y A;  1FMV A;  3HOY J;  3LFK A;  1U3E M;  1FY7 A;  4MTD A;  4PJN A;  1Z6T A;  2F48 A;  5CYV A;  2YR2 A;  3AL0 C;  2P5K A;  3F8M A;  4N4N B;  4QPO A;  2JRM A;  3S1M J;  3KFW X;  1JT0 A;  2ID3 A;  1UHM A;  4A3D J;  1FBS A;  4DZP A;  3LWF A;  5HLT A;  3LOC A;  4I6Z A;  1OR7 A;  4HBL A;  5M5X J;  3G2B A;  2R5Z B;  1WH7 A;  1S8N A;  3MZY A;  2HZD A;  3OIP A;  5GAD J;  3U1D A;  2BY3 A;  5ICF A;  3JAM Z;  2W7N A;  3BLY A;  1VQM I;  3M4O J;  5IP9 J;  2DK8 A;  4DYC A;  5K1Y A;  2L01 A;  3GLL A;  4LK0 F;  1U5T A;  2FNP A;  3ZXS A;  4HLX A;  1I6H J;  2DFE A;  4AUX A;  2EZI A;  1X1D A;  4RDU A;  4ON0 A;  3ZQ7 A;  4B4C A;  2XKO A;  3O2P E;  4UB8 C;  1SFU A;  3ERM A;  3QYF A;  2ELH A;  2FEZ A;  3BY6 A;  3TO7 A;  3FBN B;  2XB5 A;  1CF7 A;  4G7H F;  3I59 B;  2VB6 A;  1O7L A;  3V7C A;  2CW7 A;  1Z91 A;  2HXI A;  1S29 A;  1DGR M;  1MJB A;  3CJR B;  3HUG B;  2LY1 A;  4YEJ A;  3OIQ A;  1OKR A;  3I55 I;  2C6Y A;  1OFC X;  3IAS 2;  4FE4 A;  2HTJ A;  2AHQ A;  2E34 A;  2FOK A;  2X85 A;  4C3I J;  4XLE A;  4B44 A;  2V1U A;  1X3W B;  1XS9 A;  1G3T A;  1H9T A;  4Y3O A;  4QPQ A;  4XR6 A;  3BTC A;  3SYT A;  4HF0 A;  1FBU A;  1LE8 A;  2H6B A;  3OR2 C;  4A3B J;  4LB5 A;  2VQG A;  1W7P B;  4LIT A;  4E4H A;  1KQ8 A;  2ME6 A;  3VDX A;  2JZY A;  5FB2 A;  4FX4 A;  4J01 A;  4G6D A;  4Y7N J;  4IL6 C;  4AYB A;  1Y1V J;  1HOM A;  4BYY A;  1MBF A;  1VQ8 I;  3CUQ B;  1PUF B;  2WC2 A;  3KEO A;  3HIF A;  4XQF A;  1ON2 A;  1S7A A;  3UNG C;  2K86 A;  1ZGJ A;  3O3K A;  2R7Q A;  3JRG A;  2FBH A;  3H1C A;  1BI2 A;  2H8W A;  1EH7 A;  4P9U A;  3KP2 A;  3HUG A;  5FD5 A;  2A07 F;  1WCM J;  2KMU A;  4L5I A;  2O9L A;  4U0Y A;  2L9S A;  4C30 A;  2A61 A;  2QWW A;  4XKC A;  3DEU A;  1SD5 A;  1XPX A;  5FLM J;  2NNY A;  1IUF A;  5ICC A;  1K4S A;  2GXB A;  1OCZ H;  3H9J A;  1IN6 A;  2DMU A;  1X1B A;  3HRM A;  3PUF A;  3W2V A;  5KAI C;  5FD6 A;  1MD0 A;  5D6F A;  4UUT A;  1JKO C;  1W5C C;  2CV0 A;  4LK1 F;  3FZV A;  3D5L A;  1G6N A;  3PNT A;  1RRJ A;  3TQN A;  1Y56 A;  4XRS A;  5EEH A;  4DIQ A;  3H9G A;  4LG0 A;  4M74 A;  2DA2 A;  2CW8 A;  2FF4 A;  2W24 A;  4J00 A;  1ZRE A;  2DPD A;  4YG2 F;  4KNY A;  3IC7 A;  2HYJ A;  1VQ6 I;  2RNJ A;  1A6I A;  4X1E A;  5E8I A;  1I39 A;  1BI3 A;  2R5Z A;  4DZJ A;  1OMI A;  1RR8 C;  5HS8 A;  1B72 A;  1NG7 A;  1WJD A;  2W4S A;  4YIF A;  1BBY A;  2K02 A;  2NS0 A;  3D1N I;  3S1Q J;  3L2U A;  3FXM A;  5KNL A;  1P4W A;  4B8X A;  5TGT A;  1A35 A;  3OMY A;  5CPR B;  2KJC A;  3KP7 A;  1BOB A;  1JTY A;  3IL2 A;  4N0B A;  2EFO A;  3V7R A;  1WZ2 A;  1FT9 A;  3GZN B;  2KIS A;  3JRE A;  1LJ9 A;  3W2W A;  2YX4 A;  3LFU A;  1G2H A;  1UFM A;  1W0U A;  1XGM A;  1I6X A;  3CES A;  2K27 A;  3QPL A;  1AA7 A;  2RGV A;  3J80 K;  4ETS A;  1ZYR F;  3BZK A;  2O0Y A;  3MN2 A;  1P7I A;  5ICE A;  1UHW A;  2QLZ A;  2QA4 I;  3KYC B;  4KMF A;  2OCC H;  2DOF A;  4C9Y A;  3RZO J;  1SVO A;  2JA2 A;  1Z77 A;  2P4W A;  3KLO A;  3CCM I;  2EZK A;  5IT9 Z;  2XAS A;  3BZ6 A;  3ZPL A;  5J47 A;  1H8A C;  1HKS A;  1RIO H;  5D4R A;  5ICG A;  1FLI A;  4KT5 C;  2AXT C;  4U0W A;  3WU1 B;  2LBF B;  3TP0 A;  4GYG A;  4LLN A;  3PO3 J;  3RKX A;  3CD6 I;  5JHU A;  4C3H J;  1LUJ B;  3IKV A;  2LKX A;  1FSE A;  2EBI A;  1X3Z B;  1T98 A;  1V5F A;  1G3S A;  3DPL C;  4MNU A;  3OYF A;  5ILS A;  2PQ8 A;  1RR7 A;  1XGN A;  3E5X A;  2IGO A;  2Q1Z B;  2CQX A;  2IS2 A;  3BDD A;  4BHP A;  1H9G A;  3F8F A;  1W36 C;  2LH9 A;  3HKZ A;  3PSF A;  4M3B A;  4R1H A;  2GM4 A;  4L5E A;  1GUU A;  2WB1 N;  5FKO A;  5CQE A;  1P4A A;  3LST A;  5EJC A;  3VSL A;  3ZMZ A;  2D45 A;  4XKW A;  1QVU A;  4HG2 A;  3KLN A;  2HKO A;  1IN8 A;  3OYB A;  1GV2 A;  1ZGW A;  2H8R A;  3HTU A;  3SFZ A;  4IXA A;  5L3F A;  3OOU A;  2CH0 A;  5FLX Z;  3HL2 A;  3ERE D;  2EH3 A;  3D0S A;  3SEZ A;  2BY2 A;  4C2M J;  2Z5U A;  1IRF A;  5E3L A;  2IT0 A;  2XVC A;  3F72 A;  1B59 A;  4BH9 A;  4PCQ A;  1SD4 A;  3CC2 I;  4RB1 A;  3GME A;  2V26 A;  3VEP A;  5F0C A;  3ABL H;  2R7U A;  1FTZ A;  3K4B A;  1X4P A;  4U7D A;  4M9Z A;  3DLL F;  1WGX A;  4J19 A;  3ESW B;  4S0H B;  2TDX A;  4XBF A;  1TWH J;  4G12 A;  4EEF G;  1ETQ A;  4NQW B;  4ZJZ A;  4O3M A;  2K5C A;  1YE9 A;  3MKW B;  1UJ8 A;  3M8F A;  1WWX A;  1VQL I;  1FYL A;  2VC0 A;  2CQK A;  5KK1 A;  5LHI A;  2VQC A;  2CWE A;  1ZAO A;  1D8K A;  3FM5 A;  2ZNY A;  3BR0 A;  4XOP A;  5K5Q A;  2GA1 A;  2QSF X;  3ZOB A;  4PGH A;  1MNM C;  2A6H F;  1YOV B;  4U88 A;  4V2F A;  4A6E A;  2AS5 F;  1F43 A;  4XID A;  4BL0 B;  4QIW N;  1TP4 A;  2HVQ A;  1B4A A;  1BA5 A;  1B9N A;  1LDD A;  3FDY A;  4N9H A;  3RQI A;  5DUI A;  4Z6Y A;  3JRH A;  3LA3 A;  4D5F A;  5EZG A;  3L2C A;  2VQL A;  2CV1 A;  3DFG A;  2DOD A;  4IQ4 A;  1I5Z A;  2FUG 2;  2R4G A;  2JA6 J;  3CLQ A;  4IKF A;  5J4V A;  2LR8 A;  1DU6 A;  2HDW A;  3ZP5 A;  1SVL A;  3BRO A;  2E1N A;  3IAM 2;  2VJI A;  4RAF A;  2NVQ J;  1R00 A;  4LLL A;  3J7A Y;  4FTH A;  1LFB A;  4M71 A;  3K0L A;  2XB0 X;  3RSN A;  5LGT A;  4L9T A;  3R6S A;  2G9W A;  2ZC2 A;  4PUS A;  1D5V A;  2KZV A;  4CCN A;  2VPL A;  2VKE A;  1X58 A;  1JJ8 C;  4XOR A;  5FKM A;  4I99 C;  4WF2 A;  3BCB A;  3HOT A;  4G8X A;  4P55 A;  2J5O A;  1VI0 A;  3IP4 B;  1ORK A;  1B1B A;  1H0M A;  2MLG A;  3FXR A;  1S7O A;  3CUO A;  3E1S A;  4XLF A;  4ZZD A;  2VC1 A;  3L09 A;  3OS1 A;  4ZZL A;  1XDU A;  1UZC A;  1YX5 A;  3BQY A;  1YI2 I;  1MDM A;  1GHC A;  3M7G A;  2V4J C;  4KMU X;  2X1C A;  3ONQ A;  3VWB A;  3DBH B;  4A5N A;  1Z7L A;  4IQJ A;  4JYK A;  1IV8 A;  2KRF A;  1J59 A;  4MEX F;  4XL9 A;  4WXC A;  2AXL A;  2LY9 A;  4ABZ A;  1RKT A;  5BNG A;  2FML A;  1XTA A;  4XLC A;  1SFE A;  2VOD A;  3GX4 X;  2EA2 A;  5J8C A;  5GPC A;  2WY7 Q;  4HX8 A;  1JKR C;  2ECB A;  1XN7 A;  1IXR C;  2RV8 A;  1D1B A;  2HWV A;  2PEX A;  3JRB A;  1WJA A;  1ZG3 A;  1MW7 A;  4PSX A;  3HGG A;  5CVJ A;  2R7R A;  3U1K A;  1RET A;  4ZYD A;  4DBR A;  4U87 A;  4XON A;  5DDG A;  2YUS A;  3BTI A;  3FXU A;  5H20 A;  2A5Y B;  2DT5 A;  3WTY C;  1FP1 D;  3J7A O;  4X6A J;  1XMA A;  2WY8 Q;  1ON1 A;  4F91 B;  3RI4 A;  2IA1 A;  1YW7 A;  1WI3 A;  1KON A;  1HST A;  2WV1 A;  4PJJ A;  3KEQ A;  5L3C A;  2HU9 A;  3JCU C;  1ENH A;  1SEU A;  2LKS A;  4BE0 A;  1RUN A;  3HKZ N;  3BCA A;  4G94 A;  2HVS A;  1ZLK A;  1R1T A;  1G3Y A;  1Y6I A;  3TW7 A;  4B48 A;  1HXD A;  3ABM H;  2HFH A;  3OYA A;  1I3A A;  1OCR H;  4ZYG A;  4ASN A;  1JJ6 C;  1I3Q J;  2VJ4 A;  4XRM A;  4GDF A;  3N4M A;  1YS7 A;  1K79 A;  5CVR A;  3EDP A;  3BG6 A;  1ETV A;  1U8R A;  1TLH B;  2OPT A;  4XNF A;  1VQ9 I;  1T0F A;  3SHF A;  5EEG A;  2XPW A;  2QVO A;  2W1O A;  4Y17 A;  4YIR X;  2HGC A;  2LBF A;  2J5P A;  4M3E A;  4HNU A;  3AG1 H;  1K6Y A;  2H27 A;  1X2M A;  3J7Z I;  5HS7 A;  3F0C A;  1LE8 B;  2ZO4 A;  3QYB A;  4EM2 A;  3CJN A;  2LVS A;  3CCS I;  4FIS A;  1GXP A;  1H89 C;  3JRI A;  1MMS A;  1S9H A;  3QAH A;  4ZH4 F;  4RS8 A;  4V2G A;  1K4T A;  5HLI A;  1S72 I;  3M9A A;  4A5M A;  3R0A A;  2ADU A;  2FQ4 A;  4X0G A;  1ETO A;  2AQE A;  3VYU B;  3AFH A;  5FFZ A;  4WCG A;  2UWM A;  5E3O A;  2CQN A;  4XM3 A;  1IN7 A;  4BY1 J;  2EQR A;  2W85 A;  2YX7 A;  2FBK A;  2KFD A;  4E7Z A;  3WU2 C;  2BW3 A;  3I9V 2;  4HF1 A;  1ZK8 A;  3BG9 A;  1R58 A;  2ZBK A;  3E97 A;  4OIP F;  3DKY A;  5FJ8 J;  4UUS A;  4KUM A;  4CCO A; 
#chains in the Genus database with same CATH homology
 3GF2 A;  2FNA A;  3L00 A;  4OIO F;  1J7K A;  2EFW A;  3FMQ A;  4I0B A;  1LQ1 A;  2FQ3 A;  4CYD A;  4WXD A;  2HQR A;  3DKW A;  4A2U A;  4DNC A;  3DP7 A;  1IUY A;  4CIC A;  5D5V B;  3IRR A;  2XIG A;  3WE2 A;  1DDN A;  3B73 A;  5L3D A;  5CVI A;  2VON A;  1KGS A;  4HAM A;  1NHA A;  1T39 A;  4RB3 C;  1IXS B;  3WTV C;  3JSP A;  5AIQ A;  1LNW A;  4UHT A;  2XAJ A;  3MQ0 A;  1J2X A;  1Z1D A;  4EJU A;  4MTE A;  3TO6 A;  3KET A;  2MBF A;  4L9N A;  4IHS A;  3I64 A;  3H3U A;  3HTS B;  4P96 A;  3ZN0 A;  1B6A A;  4G9Y A;  1R5H A;  1YIO A;  3GFJ A;  1Y0U A;  3G73 A;  3F8C A;  3R61 A;  1BM9 A;  5J8F A;  1RUO A;  1QPM A;  1K78 B;  2RVC A;  1HW1 A;  3HHG A;  4UXN A;  4BAY A;  2QUF A;  1IW7 F;  3PFI A;  3KCC A;  2Y0M A;  2D1V A;  3CLO A;  2G7U A;  5LGN A;  2OU2 A;  4UNO A;  2XHK A;  1CF7 B;  1F1Z A;  4LG0 B;  3PQK A;  3GFI A;  4ENK A;  3QU6 A;  4EM0 B;  4EQQ A;  1OPC A;  1K78 A;  2IP2 A;  3F8B A;  4RGU A;  2XRN A;  3KP6 A;  1HKT A;  2FSW A;  2V1D A;  3P9C A;  4L9V A;  2W57 A;  4LMY A;  4JBA A;  4KN4 X;  4EVI A;  1BI0 A;  2KIU A;  4MHG A;  2DPU A;  1ZAR A;  1I27 A;  3V8L A;  4UUV A;  4HOB A;  1YO5 C;  3NRV A;  5LRS A;  3FMS A;  4WWC A;  5DV5 A;  3P7N A;  3LAJ A;  3ZMT A;  2VE9 A;  3ZMU A;  3BJ6 A;  4YII A;  2GQQ A;  5IT3 A;  2EV6 A;  3DPT A;  1LDJ A;  4S04 A;  4EJT A;  4ESB A;  2W84 A;  3DXJ F;  3GYH X;  3J81 K;  1J0R A;  5LHH A;  3F23 A;  1YG2 A;  2KIM A;  2Z9O A;  4TV7 A;  3OOP A;  1TQI A;  4KDP A;  1JE8 A;  3FM3 A;  3K69 A;  3U2R A;  3K1N A;  3SQN A;  3F21 A;  2CG4 A;  5DD8 A;  2FU4 A;  4RGR A;  3F6V A;  1F9N A;  4NB5 A;  4UVB A;  2VE8 A;  1V3F A;  2KIF A;  4ESF A;  1IN5 A;  3E6M A;  4IRH A;  4UVC A;  1YTY A;  4BXU A;  3EYY A;  4QWQ A;  3R60 A;  2X0L A;  2G7H A;  1EH8 A;  2OAZ A;  3ISP A;  3DQV C;  5BS6 A;  1DP7 P;  1XGO A;  2QEN A;  2CW0 F;  3I59 A;  4LJZ F;  4FX0 A;  2EB7 A;  4KIG A;  4ENN A;  3RPU A;  1KQ9 A;  4OIQ F;  4XSZ F;  5JI6 A;  5LLQ A;  2X4H A;  5LRR A;  4HF2 A;  3HYI A;  4A0Y A;  4PZJ A;  1R23 A;  1WQ2 A;  3MEX A;  2Z99 A;  1XSD A;  2CGP A;  2DO7 A;  4XSX F;  2CSO A;  3GUD A;  5D4S A;  2PLY A;  3FMR A;  1ONV A;  3WOD F;  1BIA A;  2P7C B;  2QM3 A;  3GFL A;  4XLP F;  3KP5 A;  4EJO A;  2HS5 A;  1ZGA A;  4LD5 A;  3HSE A;  4IPA A;  3LQQ A;  5DCF A;  1V4R A;  4LLG F;  2EFP A;  2M1B A;  2L54 A;  3ECO A;  2PBI A;  4I98 B;  3RKW A;  1O3S A;  4ENM A;  1MGT A;  1HW2 A;  1TW3 A;  3GEZ A;  1GVJ A;  3KP4 A;  3CDH A;  2CO5 A;  2JRT A;  3WGG A;  3M8E A;  2JT1 A;  4E70 A;  2D1H A;  4OMY A;  2FXA A;  4A12 A;  2QYO A;  1F4K A;  2O8X A;  1JXS A;  2K4B A;  4HLY A;  3RTR A;  4HV5 A;  4AIJ A;  1YLF A;  3C18 A;  1FZP B;  3EUH A;  1BOA A;  2L02 A;  3CO7 C;  2MH9 A;  3K2Z A;  3MAJ A;  4OOI A;  1J75 A;  2Y75 A;  2QQA A;  1PP8 F;  2QBY B;  2OD5 A;  3E6B A;  1IRG A;  4IRI A;  3ABU A;  1KU9 A;  3QPT A;  1J9I A;  3DF8 A;  4L9J A;  1MKM A;  1OYI A;  2IA2 A;  3M1E A;  1WKM A;  3LA7 A;  2HR3 A;  2PG4 A;  5FLX K;  2GZW A;  1J5Y A;  2HDC A;  2JPB A;  2NYX A;  2ZKZ A;  5AIP A;  2EFN A;  4EGY A;  2HQN A;  2DAO A;  4ZYE A;  2O61 A;  4CDG A;  1WRJ A;  2GAU A;  2VOP A;  2PFB A;  4L18 B;  4GCV A;  3HRT A;  3W6J B;  4UVA A;  4BNC A;  5E18 F;  4KYW A;  2P6S A;  1MJ9 A;  4CXF A;  3DV8 A;  3BP8 A;  2KKO A;  3CTA A;  1TBX A;  2IVM A;  2BBY A;  5E20 A;  3QU3 A;  4PGG A;  3I4P A;  1U2W A;  3CUQ C;  2OBP A;  1IN4 A;  1Q1H A;  3RIR A;  2R7F A;  4AIK A;  1IXC A;  2STT A;  2VT3 A;  2VBX A;  5F6F A;  4ENJ A;  3G3Z A;  2A3S A;  4BHB A;  1O3R A;  5D6E A;  3TDZ C;  3VFZ A;  2GXG A;  4GXO A;  3GVA A;  4B09 A;  1TNS A;  5DEQ A;  3REO A;  3H92 A;  4KIC A;  4AD9 A;  4UV8 A;  5D8K B;  4XLN F;  4FT8 A;  2QBY A;  4R79 A;  1O7F A;  1BC8 C;  2V9V A;  4HA8 A;  2UZK A;  2XAF A;  3HSF A;  3ZMS A;  2LF7 A;  4N9I A;  3BPX A;  5KVR A;  3QPH A;  5ERI A;  5BQT A;  2BYV E;  3W6K B;  1JGS A;  1W5T A;  1HSJ A;  4Y15 A;  1FYK A;  2HTS A;  1R22 A;  1QBJ A;  1FWZ A;  4R8H A;  1S3J A;  3Q9S A;  1R1U A;  1L0O C;  3JTG A;  4JK1 X;  1P4X A;  2F5C A;  1G3W A;  4U7B A;  2V1X A;  3GFM A;  3QP6 A;  1TQM A;  4CO8 A;  5JR3 A;  1USS A;  2HYF A;  1REP C;  4WX9 A;  1KU2 A;  3GZ6 A;  3ECH A;  1KU7 A;  4H0E A;  5HS9 A;  4DQ2 A;  2HYG D;  5ILV A;  3MWM A;  3ULQ B;  1RI7 A;  4HQM A;  3NQO A;  1T38 A;  5DD4 A;  1U6G A;  3WTT C;  4KN7 X;  3V8J A;  1TNT A;  1SFX A;  5HVQ C;  5CVU A;  1FPQ A;  3TOA A;  3ELK A;  1BJA A;  1WI9 A;  1YW8 A;  3GW2 A;  4I02 A;  3L9F A;  4P9F A;  4RAZ A;  1Z7U A;  5AON A;  1FOK A;  1YFH A;  1E2X A;  1L3L A;  1W5S A;  3QRF F;  3C7J A;  1D3Y A;  4Q4Z F;  4YFK F;  3K9T A;  2F5D A;  2ZME B;  3T5X A;  2FBI A;  2H6C A;  2A6E F;  3EET A;  1KYZ A;  1XMK A;  1MDM B;  4XRF A;  5L3G A;  3F8N A;  3BJO A;  5HLH A;  3I54 A;  1FYM A;  3JAM K;  3TGN A;  1R1V A;  4EM1 A;  3MFK A;  3P9K A;  3I58 A;  1ULY A;  2OZU A;  5FO5 A;  4GGG A;  5L3E A;  1ZHF A;  3WTZ A;  1D8J A;  5ILU A;  2Z33 A;  1PP7 U;  2ACJ A;  3HOS A;  5H6R A;  3OV8 A;  1Z9C A;  3IKT A;  4CZZ A;  1YW9 A;  2M30 A;  2F2E A;  5FGM A;  2P7V B;  5LHG A;  2O03 A;  1XCB A;  2FA5 A;  4Y13 A;  2VN2 A;  4IRG A;  2NRA C;  5F1R A;  2GIV A;  1DPU A;  2E1C A;  2ETH A;  3ZN1 A;  1TQP A;  2QZ8 A;  5IT9 K;  4HW0 A;  3N97 A;  4KFC A;  1O3Q A;  1Z6R A;  5HDN A;  4Q47 A;  3E5U A;  2GWR A;  2ZME A;  1YS6 A;  3BWG A;  1EV7 A;  2ISZ A;  2LDU A;  4WK8 F;  4HDU A;  3V8K A;  1ZN2 A;  3LAP A;  3KE2 A;  3VB2 A;  2E7X A;  2A69 F;  2ESH A;  4FHT A;  5CVV A;  5D5X B;  3KZZ A;  1YQA A;  5DUK A;  3CUQ A;  2ZNZ A;  4I0A A;  1I1G A;  2STW A;  3KP3 A;  1YYV A;  1XCV A;  1WSU A;  1ZG5 A;  2PN6 A;  3EQL F;  3WGI A;  1DPR A;  2XRO A;  2XAG A;  1SD6 A;  3SZT A;  2VOO A;  3ROU A;  4O6J A;  3WTX C;  3RKY A;  3I53 A;  4MQV A;  3WGH A;  2XAH A;  4MEY F;  2P5L C;  4ESJ A;  2BGC A;  2LKP A;  2Y48 A;  2ZCW A;  4BQA A;  1U5T B;  1E17 A;  3RYP A;  1AOY A;  4LB6 B;  1XD7 A;  4LGW A;  1UST A;  4M9X A;  2NNN A;  2L4M A;  3ZMD A;  2GA2 A;  3E5Q A;  5BPI A;  1XGS A;  3F6O A;  4QLC U;  3K1P A;  4G6Q A;  2F5E A;  3GO5 A;  1MZB A;  4A0Z A;  3ML6 A;  1SMY F;  3KZY A;  3RPQ A;  2JTV A;  3HRS A;  1AWC A;  1I1S A;  2XV4 S;  2WTE A;  4GO1 A;  4RB0 A;  2BV6 A;  1HQC A;  1B9M A;  5E1Z B;  4JQF A;  2RKH A;  3ZMV A;  4IVN A;  2DW4 A;  1MJA A;  3CO6 C;  3V7S A;  3QP5 A;  3J80 Z;  3FF5 A;  3BJA A;  3JTH A;  3TKY A;  3HSR A;  5A2Q K;  4OMZ A;  4AVP A;  3PQJ A;  2E7W A;  4MQ9 F;  4M6X A;  1S6L A;  2EWN A;  2DTR A;  3K1M A;  3WG9 A;  2FRH A;  4GYI A;  4EGZ A;  2O6G E;  3I0T A;  1HKQ A;  2YPR A;  4MGR A;  1SAX A;  1CGP A;  1KU3 A;  2M5W A;  4EV0 A;  2LF8 A;  1GXQ A;  1BN5 A;  4KA4 A;  1UB9 A;  4HX4 A;  2DK5 A;  2KJB A;  1LEB A;  1KQ0 A;  3FHZ A;  1P2F A;  2DQR A;  5JVT A;  5L3B A;  2IW5 A;  5K5O A;  4Q5S F;  1ODD A;  2OZ6 A;  5E1X A;  3J81 Z;  6PAX A;  3RYR A;  5HDK A;  2UXX A;  2QQB A;  2ZFW A;  4KIB A;  1LVA A;  4OIR F;  1PUE E;  1IF1 A;  3F22 A;  5FFX A;  3WE3 A;  1XDS A;  5DCM A;  1U5T C;  2WV0 A;  2K7L A;  4OIN F;  1C0W A;  1OYY A;  3WTU C;  1QQI A;  2XGX A;  2JPC A;  1ZG1 A;  4EMS A;  2R3S A;  1OYW A;  1O57 A;  5CJ9 A;  1FNN A;  2R7D A;  2COM A;  3HHH A;  3E6C C;  1IZ1 A;  4U0V A;  5HDG A;  3LQR A;  5ED4 A;  1QZY A;  2M45 A;  2IRF G;  2XUB A;  2W25 A;  4M9S A;  5JFR A;  3EYI A;  3GLX A;  1X3U A;  4I09 A;  1ZH5 A;  3S2W A;  4RB2 C;  3E3V A;  4KIF A;  4G7O F;  1JHH A;  3T8R A;  2RQP A;  3GWZ A;  2CYY A;  1R5G A;  3IWZ A;  1RZ4 A;  4PDK A;  3R0J A;  2P8T A;  4HZF A;  2VXZ A;  4EJV A;  4RGS A;  3WTS C;  4WXH A;  3GXO A;  3V4G A;  3COA C;  1FSH A;  1QZZ A;  2EK5 A;  3WTW C;  5BOX A;  2A68 F;  5HOO A;  2RDP A;  3IRQ A;  1DUX C;  2BEO A;  2DI3 A;  4IHT A;  1KA8 A;  4M72 A;  4NHJ A;  2B0L A;  1W7P D;  1ZRD A;  3B02 A;  1P6R A;  1XB4 A;  3WU0 A;  4G7Z F;  3VOE A;  5D5U B;  1FP2 A;  2P6T A;  2Z3Y A;  5BMZ A;  3TOB A;  1IAW A;  2Q8K A;  1K7A A;  2JSC A;  3Q9V A;  3VOD A;  5D8L B;  3P9I A;  3SZP A;  4K2E A;  1STZ A;  3FX3 A;  1T6S A;  3T1B A;  2V6C A;  4Z2Y A;  5F64 A;  1KYW A;  3U9G A;  2UXN A;  2L4A A;  3AAF A;  2HEO A;  1SMT A;  1FX7 A;  2LNB A;  1BIB A;  1UCR A;  1O3T A;  1A04 A;  2Q0O A;  1W4M A;  4BHC A;  1EH6 A;  2IJL A;  3L7W A;  3T8T A;  1JHF A;  4ZYH A;  2DLL A;  3IHU A;  4LFU A;  2DBB A;  1PDN C;  4I2O A;  4M73 A;  4IJA A;  2OA4 A;  3FXQ A;  1TTY A;  3ABT A;  1R36 A;  3RDI A;  2IPQ X;  4O5V A;  3RJP A;  5TJJ A;  2DFI A;  4AWX B;  4IF4 A;  2EJR A;  3Q5F A;  3T0Y A;  1VTN C;  4S05 A;  1F5T A;  3F3X A;  2QQ9 A;  2OQG A;  2PMH A;  4HYE A;  4P5O A;  3IWF A;  5D5W B;  1Z05 A;  2DU9 A;  2LSO A;  3JSO A;  1U78 A;  5E1W A;  5BPD A;  1FBQ A;  5E8G A;  2P5V A;  2Q2E A;  4HDV A;  2MA3 A;  2HZT A;  2EA4 A;  1XSV A;  3TDU C;  3HRU A;  5TRD A;  5A2Q Z;  1LB2 A;  1QNT A;  4RAY A;  1BC7 C;  2K4J A;  3E6D A;  3I71 A;  2BE5 F;  2VBZ A;  4UV9 A;  2M87 A;  3JW4 A;  2WWY A;  2M8E A;  4CHU A;  2XAQ A;  2YU3 A;  1W7P A;  2XKP A;  3I5U A;  2H09 A;  4L0Z B;  2VT2 A;  2ESN A;  4CGZ A;  2PI0 A;  3FWE A;  3H3Z A;  3BPV A;  1HW5 A;  2DQL A;  1QO0 D;  3QOP A;  2D2W A;  4EJW A;  4NQW A;  2EV0 A;  2HOE A;  5J6X A;  2ZJ2 A;  2HKX A;  3LA2 A;  4HX7 A;  2PJP A;  5H6Q A;  2OQR A;  3TO9 A;  2ZXJ A;  5K5R A;  2YSR A;  4YFN F;  1G4D A;  3GZ5 A;  2IA0 A;  4L5J A;  2L3D A;  3C3W A;  3SXY A;  5LEJ A;  2EV5 A;  2MH2 A;  4HV6 A;  2ISY A;  3O6B B;  2MD5 A;  1ZRC A;  4RGX A;  5DCM B;  4A0X A;  4L0Y B;  2CFX A;  5E17 F;  2RC4 A;  4F7Z A;  1ZLJ A;  4A6D A;  2EFQ A;  3MCZ A;  3BOQ A;  1QGP A;  5DYM A;  2NAZ A;  2V79 A;  2MLK A;  5LBQ A;  1P92 A;  2F5F A;  2VBY A;  1RNL A;  2O3F A;  2RN7 A;  4Q48 A;  2H94 A;  1T2K A;  4HQE A;  1LDK B;  4YFX F;  4D0P A;  4I01 A;  4AIH A;  3R4K A;  1HBX G;  3MZH A;  5HLG A;  2MC3 A;  2FE3 A;  2VBW A;  3C1D A;  1ZRF A;  1XSX A;  4I7H A;  5CLS A;  1K6O A;  1SD7 A;  5LGU A;  5LEK A;  2FMY A;  1R7J A;  3NEU A;  2PMU A;  1FC3 A;  1TW2 A;  4OU0 A;  1BI1 A;  1LEA A;  4M6Y A;  3LFK A;  1U3E M;  1FY7 A;  4MTD A;  1Z6T A;  5CYV A;  2YR2 A;  2P5K A;  3F8M A;  3KFW X;  1UHM A;  1FBS A;  3LWF A;  4HBL A;  1OR7 A;  1S8N A;  3MZY A;  3U1D A;  5ICF A;  3JAM Z;  2DK8 A;  5K1Y A;  2L01 A;  4LK0 F;  1U5T A;  2FNP A;  4HLX A;  4ON0 A;  3ZQ7 A;  2XKO A;  3O2P E;  1SFU A;  2ELH A;  2FEZ A;  3BY6 A;  3TO7 A;  1CF7 A;  4G7H F;  3I59 B;  1O7L A;  3V7C A;  1Z91 A;  1S29 A;  1MJB A;  2C6Y A;  1OKR A;  2HTJ A;  2FOK A;  2V1U A;  1G3T A;  1H9T A;  4HF0 A;  1FBU A;  2H6B A;  4LB5 A;  1W7P B;  1KQ8 A;  2JZY A;  5FB2 A;  4FX4 A;  4G6D A;  4BYY A;  3CUQ B;  2WC2 A;  3KEO A;  3HIF A;  1ON2 A;  1S7A A;  2K86 A;  1ZGJ A;  3O3K A;  2FBH A;  1BI2 A;  4P9U A;  1EH7 A;  3KP2 A;  3HUG A;  5FD5 A;  2A07 F;  4L5I A;  4U0Y A;  2A61 A;  2QWW A;  3DEU A;  1SD5 A;  2NNY A;  5ICC A;  2GXB A;  1IN6 A;  3HRM A;  5FD6 A;  1MD0 A;  5D6F A;  4LK1 F;  3FZV A;  3D5L A;  1G6N A;  3TQN A;  5EEH A;  4LG0 A;  4M74 A;  2FF4 A;  2W24 A;  1ZRE A;  2DPD A;  4YG2 F;  4KNY A;  3IC7 A;  2RNJ A;  5E8I A;  1BI3 A;  1OMI A;  5HS8 A;  4YIF A;  1BBY A;  2K02 A;  2NS0 A;  1P4W A;  4B8X A;  2KJC A;  3KP7 A;  3IL2 A;  4N0B A;  2EFO A;  3V7R A;  1FT9 A;  1LJ9 A;  2YX4 A;  1UFM A;  1XGM A;  1I6X A;  2K27 A;  2RGV A;  3J80 K;  4ETS A;  1ZYR F;  2O0Y A;  5ICE A;  1UHW A;  2QLZ A;  4KMF A;  2P4W A;  3KLO A;  5IT9 Z;  2XAS A;  3BZ6 A;  3ZPL A;  1HKS A;  1RIO H;  5D4R A;  5ICG A;  1FLI A;  4KT5 C;  4U0W A;  3WU1 B;  4GYG A;  4LLN A;  3RKX A;  5JHU A;  3IKV A;  1FSE A;  1T98 A;  1G3S A;  3DPL C;  4MNU A;  5ILS A;  2PQ8 A;  1XGN A;  3E5X A;  3BDD A;  4BHP A;  1H9G A;  3F8F A;  4R1H A;  1P4A A;  3LST A;  3ZMZ A;  2D45 A;  3KLN A;  2HKO A;  1IN8 A;  3HTU A;  3SFZ A;  4IXA A;  5L3F A;  3ERE D;  5FLX Z;  3D0S A;  2Z5U A;  1IRF A;  2IT0 A;  2XVC A;  3F72 A;  1B59 A;  4BH9 A;  4PCQ A;  1SD4 A;  4RB1 A;  3VEP A;  4U7D A;  4M9Z A;  2TDX A;  4XBF A;  4O3M A;  3M8F A;  1WWX A;  1FYL A;  2VC0 A;  2CQK A;  5KK1 A;  5LHI A;  2CWE A;  1ZAO A;  1D8K A;  3FM5 A;  2ZNY A;  5K5Q A;  2GA1 A;  4PGH A;  2A6H F;  4U88 A;  4A6E A;  2AS5 F;  1B4A A;  1B9N A;  1LDD A;  4N9H A;  5DUI A;  3LA3 A;  3L2C A;  3DFG A;  1I5Z A;  3ZP5 A;  3BRO A;  2E1N A;  1R00 A;  4LLL A;  4M71 A;  3K0L A;  5LGT A;  4L9T A;  3R6S A;  2G9W A;  1D5V A;  4WF2 A;  3HOT A;  4G8X A;  4P55 A;  2J5O A;  1H0M A;  1B1B A;  2MLG A;  3FXR A;  1S7O A;  3CUO A;  4ZZD A;  2VC1 A;  3L09 A;  4ZZL A;  1XDU A;  1MDM A;  1GHC A;  3M7G A;  4KMU X;  4A5N A;  2KRF A;  1J59 A;  4MEX F;  4WXC A;  2AXL A;  2FML A;  1SFE A;  2VOD A;  3GX4 X;  2EA2 A;  5J8C A;  4HX8 A;  1XN7 A;  1IXR C;  2RV8 A;  2HWV A;  2PEX A;  1ZG3 A;  5CVJ A;  4ZYD A;  5DDG A;  3FXU A;  5H20 A;  2A5Y B;  2DT5 A;  3WTY C;  1FP1 D;  3J7A O;  1XMA A;  3RI4 A;  1ON1 A;  2IA1 A;  1YW7 A;  1HST A;  3KEQ A;  5L3C A;  1RUN A;  4G94 A;  1ZLK A;  1R1T A;  1G3Y A;  1HXD A;  2HFH A;  4ZYG A;  4ASN A;  3N4M A;  1YS7 A;  1K79 A;  5CVR A;  3EDP A;  1U8R A;  1TLH B;  1T0F A;  3SHF A;  5EEG A;  2QVO A;  4Y17 A;  2HGC A;  2J5P A;  2H27 A;  5HS7 A;  2ZO4 A;  4EM2 A;  3CJN A;  1GXP A;  3QAH A;  4ZH4 F;  4RS8 A;  5HLI A;  3M9A A;  4A5M A;  3R0A A;  2ADU A;  4WCG A;  5FFZ A;  2UWM A;  1IN7 A;  2W85 A;  2YX7 A;  2FBK A;  4HF1 A;  1R58 A;  2ZBK A;  3E97 A;  4OIP F;  4KUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...