2P7VB

Crystal structure of the escherichia coli regulator of sigma 70, rsd, in complex with sigma 70 domain 4
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
68
structure length
68
Chain Sequence
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Regulator of sigma D
publication title Crystal structure of the Escherichia coli regulator of sigma70, Rsd, in complex with sigma70 domain 4.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p7vB00
1SD5A 2EWNA 4YFNF 4MEYF 2NRAC 4O5VA 2IA2A 5LRSA 3T1BA 1ONVA 2ZXJA 5CVVA 1H9TA 2FBKA 3MQ0A 1Z6RA 2B0LA 2XAFA 3FXUA 1SFEA 2JTVA 2EA4A 3V8JA 1XSXA 2G7HA 3ZP5A 1LEBA 1Z6TA 2HGCA 4AIJA 2RN7A 4HOBA 2HFHA 1ZLJA 3K9TA 2DK8A 1O3SA 5FFZA 1XMKA 5DEQA 1W7PD 4WCGA 2EA2A 1UCRA 2M8EA 3TDUC 1J0RA 5FLXZ 2OD5A 4CDGA 1R00A 1IXRC 2P7VB 3CO6C 4IRGA 1PP8F 1D8JA 5ILVA 3WTZA 1S7OA 5FGMA 3I71A 1B9MA 4G6QA 3WTXC 1FSEA 4FHTA 4IF4A 4L0ZB 2PN6A 1U5TC 4H0EA 1O57A 2ZBKA 4EJOA 1YIOA 1U8RA 2Q0OA 1QZZA 2Y0MA 2MC3A 4NB5A 3I64A 2ETHA 2ZO4A 4ZYGA 2YR2A 4GYIA 3SXYA 4YG2F 1SFUA 2PFBA 3C3WA 5CJ9A 4O6JA 4FX4A 1D8KA 4HZFA 4UVAA 3EUHA 5ICEA 3U1DA 4U7BA 3BWGA 4P96A 5DCFA 4HF2A 2OQGA 1UHWA 2GZWA 1X3UA 3BPVA 1YFHA 5TJJA 3MZHA 2QENA 3WTUC 5L3EA 3LA3A 3GEZA 2KIMA 1XMAA 2Z99A 2HOEA 3T0YA 4ENJA 4S05A 1LJ9A 3P7NA 1BI2A 2JT1A 5FD6A 4G8XA 3R61A 1LDJA 2ZJ2A 4XRFA 3K1MA 2OQRA 2QBYA 2DPDA 5D4SA 2VN2A 1J7KA 3W6JB 2Z9OA 2K86A 3GVAA 4YIFA 2P5KA 2Z5UA 3L09A 1FX7A 3ELKA 5D4RA 1FPQA 2MA3A 1SFXA 3E6MA 4N9IA 3DPTA 3COAC 2L4AA 4HYEA 4RGUA 3GF2A 4M6YA 4HQEA 1K79A 3FM5A 4LFUA 4WXCA 2FEZA 1BC7C 3MCZA 4GO1A 3SHFA 4MQ9F 1BIBA 5FB2A 1Z9CA 4OMYA 3JTGA 3V8KA 4XSZF 4MTDA 3BOQA 4IRIA 4EV0A 3I53A 3KZYA 4KN4X 2FF4A 1D3YA 1E2XA 2A6EF 3QU6A 1G3SA 2K4BA 2KRFA 5D6FA 1XCVA 4XLNF 2F2EA 2STTA 4I09A 4ZZDA 3F22A 2F5FA 1IW7F 3KE2A 2DW4A 1KYZA 1YS6A 3PQKA 2EK5A 4EJTA 3GZ5A 2XVCA 4IRHA 1RI7A 4UVBA 1L3LA 4YFXF 4I98B 3KP5A 1EH7A 1QQIA 2DI3A 1LQ1A 3ISPA 2HQRA 2W85A 3LA2A 5E18F 3WTSC 2YPRA 1LB2A 4P9FA 3GW2A 1IRGA 3REOA 1G3TA 2CG4A 2STWA 2GQQA 2FU4A 4LLLA 5K1YA 2PI0A 2HZTA 5DD4A 1KQ8A 1ZG3A 2GWRA 1USTA 2CW0F 2ADUA 2EFWA 4BNCA 2KKOA 5JR3A 2V1XA 3LAPA 2F5CA 1XSVA 1P4AA 2Z3YA 3H3ZA 5FFXA 3N4MA 4O3MA 3E5QA 1DDNA 1J2XA 4LGWA 4EJWA 5DDGA 1HKSA 1DPRA 2UWMA 3RI4A 1G3YA 3E5UA 1UHMA 1HXDA 2GAUA 1PUEE 4WWCA 4KYWA 5IT3A 3TOBA 2KJCA 4U7DA 2VBWA 1ON2A 2ZMEB 2D1HA 4G7ZF 1T0FA 3D0SA 3ECHA 4AVPA 2VBXA 1JGSA 2AS5F 1F1ZA 2EFNA 3QOPA 4ESFA 2XROA 3L7WA 2Z33A 3HYIA 4I02A 4IPAA 4ZYEA 1XDUA 3DFGA 2ZMEA 1O7LA 2H6CA 3FWEA 2P5LC 5D5WB 2GIVA 3RDIA 3HSFA 2EV0A 3HSRA 5E17F 1S7AA 3WE3A 4RS8A 5BS6A 2WV0A 3H92A 4HX8A 1R36A 1U78A 4EJUA 3F6VA 3U9GA 3AAFA 4ENKA 3G73A 3RTRA 1MJ9A 4IXAA 4B09A 1YG2A 1ZN2A 4U0WA 4HF1A 1S8NA 2A61A 2FE3A 2FBIA 3I5UA 1BI1A 2MLKA 2K7LA 4HBLA 2CSOA 4LB5A 5DD8A 4YFKF 5HS7A 3ERED 1R7JA 2G9WA 4Q47A 3F23A 2HKOA 5F1RA 4WXDA 2A68F 2HR3A 3EYIA 3P9IA 1FP2A 4LJZF 5LEJA 4IHTA 1IN6A 2DPUA 4L5IA 1CGPA 5CLSA 3KP7A 2FQ3A 4Y13A 2DBBA 2NYXA 4A5NA 2L02A 3J81K 4QLCU 1IUYA 3F8BA 3HSEA 3SQNA 2VONA 3RKWA 1J75A 4KIGA 3T8RA 5D5VB 1HSTA 2RDPA 5HS8A 4ON0A 3HRUA 3T5XA 1I27A 4MGRA 1PDNC 2JPBA 3CLOA 4ZYDA 2R7DA 3JSPA 3NEUA 4CYDA 2NAZA 1WQ2A 3HRSA 1TNTA 4A6EA 2R3SA 2ACJA 3FM3A 4HF0A 3P9CA 4FT8A 5D6EA 1HW1A 1RIOH 3R4KA 1W5SA 3KLOA 1EV7A 4KICA 2H94A 4AIHA 2DFIA 2XAJA 1KGSA 4KUMA 3FHZA 3B02A 2L4MA 3I0TA 1XD7A 4OIPF 4Q5SF 2FSWA 4AWXB 3WTTC 3ROUA 3LAJA 1ZRCA 3I54A 1USSA 3GFIA 3ABTA 2KJBA 3JAMZ 3D5LA 4JBAA 1RUOA 3N97A 3F8FA 2MLGA 2BV6A 1U3EM 3DP7A 3ZQ7A 5JFRA 3R6SA 3VODA 2IA0A 4M9XA 1G4DA 3L00A 1STZA 2IT0A 2XIGA 5L3DA 4Q48A 4G94A 3F8NA 4WK8F 1HBXG 1IF1A 4L9TA 2XRNA 3VB2A 3QPHA 2ISYA 3V8LA 3RYPA 1H0MA 1OYIA 3BPXA 3ZMUA 1KA8A 2QQAA 3WGGA 1KU3A 2O3FA 1CF7A 3K1NA 4OIQF 4PDKA 2XHKA 4P5OA 3FX3A 3E6DA 3FXRA 1PP7U 4JQFA 5AIPA 2DQLA 3GLXA 1HW5A 3K0LA 2DAOA 1WI9A 1YLFA 1G6NA 5H6QA 1XCBA 5EEHA 3GX4X 4QWQA 5F64A 4EMSA 3BJOA 3HOTA 2FOKA 1V4RA 4U88A 5E20A 5LHGA 1K78B 2FRHA 2W24A 3WGIA 3DV8A 1FLIA 5IT9Z 3J80K 3QU3A 3F8CA 3FF5A 1TLHB 1TW3A 5A2QK 1ON1A 2PLYA 4WXHA 5DUKA 4WX9A 4RB2C 1K78A 5J8FA 3C1DA 3K1PA 2JZYA 2X0LA 4M6XA 1BN5A 2W25A 4HX7A 1QZYA 1I1GA 4UV8A 1YTYA 1I1SA 1ULYA 3B73A 4HA8A 1ZGAA 1UFMA 4RB3C 1OPCA 3GWZA 1FBSA 3BP8A 1ZAOA 4PCQA 2V79A 1RNLA 4XBFA 3V4GA 4M9SA 2QBYB 4P9UA 3E3VA 3LA7A 2PQ8A 2NNNA 2KIUA 3ZMDA 1J5YA 1TQMA 3TKYA 3IL2A 5CVRA 1UB9A 3CDHA 2EFQA 2HYGD 2XASA 2FNPA 2DLLA 3TQNA 1HSJA 3S2WA 1K7AA 4A6DA 4RGRA 5BOXA 5LEKA 5L3FA 4M74A 4RB1A 1A04A 3JTHA 2IP2A 2XUBA 1JHFA 3VEPA 5H6RA 2VE8A 2NS0A 3HRMA 1OMIA 3CTAA 3V7SA 1U5TB 2HTJA 3HHGA 1RUNA 3R0JA 1XGNA 3F21A 3JSOA 5CVUA 4ENNA 2MD5A 3GFMA 1E17A 1FYMA 1ZH5A 2YX7A 5ERIA 1R1UA 4EM2A 4HAMA 1IXCA 4MHGA 1U5TA 4M73A 1KU2A 2HKXA 5K5OA 3L9FA 5CVIA 2Y75A 1O3RA 3ZN0A 3QRFF 4L9VA 4OU0A 4M9ZA 4A0ZA 2XAGA 1J9IA 1KQ9A 1MKMA 3WU1B 4KMUX 2JSCA 3O2PE 2DU9A 5BMZA 3U2RA 5K5QA 4GXOA 3F6OA 2A5YB 2A3SA 2UZKA 5D5UB 3FMSA 3WU0A 2CO5A 3GYHX 2HYFA 1SMTA 4P55A 1P4XA 1I6XA 3DPLC 1MJAA 3NRVA 1FP1D 1DUXC 3GO5A 4KIFA 1DP7P 2HQNA 3C18A 3HHHA 3ECOA 4RB0A 4M72A 1JE8A 4L9JA 2FMLA 3RPUA 5E1ZB 2UXXA 3WODF 1FC3A 3WTVC 3WGHA 3EDPA 3GFJA 2ESNA 2M30A 5LGNA 1XN7A 3EQLF 1FNNA 4U0VA 2GA1A 3KP4A 2C6YA 4UV9A 5ILSA 1GXQA 3FMQA 3E5XA 4LK0F 3DF8A 3MWMA 1S29A 1FSHA 3TO6A 2Q8KA 5D5XB 2P6TA 1MJBA 1BC8C 2OBPA 3KEOA 3GFLA 3FXQA 3RKXA 3QPTA 5J8CA 1B59A 1GHCA 3SZTA 1OYWA 1XSDA 4RAYA 3KCCA 1U6GA 5TRDA 4L18B 4WF2A 1T6SA 1KU7A 1QO0D 2LKPA 4BH9A 3QP5A 3BZ6A 2HDCA 5EEGA 1J59A 2ZNZA 1KU9A 2P5VA 3MZYA 4N0BA 2UXNA 3V7RA 1BI0A 2MBFA 4G7HF 1Z7UA 4HV6A 4LB6B 4OINF 3GZ6A 4LLGF 3TOAA 4B8XA 4RGXA 5LGTA 2K02A 3M9AA 5ICFA 1W4MA 2XAQA 2EV5A 2QZ8A 1HKQA 1BM9A 2EFOA 2IPQX 2O8XA 4G7OF 2MH2A 1YS7A 5HLHA 4CHUA 2D45A 1YYVA 4FX0A 3KP6A 1QPMA 1YW7A 5JVTA 4KNYA 4LLNA 2J5OA 1IRFA 1KYWA 3CUQC 1EH6A 5E8IA 2PBIA 1SD4A 5DV5A 2HWVA 2V1UA 1O3QA 3IRQA 1QBJA 4EVIA 3VFZA 4LG0B 2QLZA 5HDKA 4HDVA 3TO9A 1HQCA 3RPQA 1JXSA 1R22A 1BI3A 5HLIA 1R5HA 2PJPA 2IJLA 3E6BA 3ZMZA 2XKOA 4LG0A 3K69A 2OAZA 1W7PA 3H3UA 3CO7C 3FZVA 5FLXK 2FMYA 2KIFA 1TW2A 4ZYHA 5HOOA 4BQAA 5DUIA 2DQRA 4R1HA 1XGMA 1YW9A 1AWCA 1LNWA 2FXAA 1FT9A 4BHPA 3Q9SA 1G3WA 4R79A 2EV6A 2BEOA 1T2KA 1YQAA 1OYYA 3IKVA 5F6FA 1ZHFA 1P92A 1BJAA 1JHHA 4CO8A 2O6GE 2LNBA 2K4JA 1P2FA 2DK5A 2HEOA 2AXLA 1TTYA 4MTEA 5FO5A 2H27A 2K27A 1FBUA 2O0YA 2R7FA 1DPUA 4UHTA 5ILUA 2ZNYA 1FY7A 2WTEA 1IN5A 2OZUA 1P4WA 2RGVA 1T38A 2DO7A 2VBZA 4LD5A 1SD6A 1ZG5A 3CUQA 1XGOA 1LDDA 4AIKA 3KP3A 4A2UA 4CXFA 1S6LA 5ICCA 3PQJA 1LEAA 1BBYA 4GGGA 4ZH4F 5JI6A 3FMRA 1OKRA 5J6XA 3R60A 2QQ9A 2VT2A 4I01A 1CF7B 3HTUA 4BXUA 3LSTA 2PG4A 1ODDA 4EGYA 2L3DA 4N9HA 4TV7A 2QYOA 4CICA 2IA1A 3ZMSA 2RC4A 3F8MA 2P6SA 4KT5C 2L01A 3DEUA 1TQIA 1HW2A 4UUVA 4HLXA 3LQRA 2ZKZA 2E1NA 3O6BB 3J81Z 3ULQB 4ETSA 3HIFA 1C0WA 1W5TA 2W57A 5HDGA 4ASNA 1R1VA 3V7CA 3F3XA 4GYGA 4A0YA 4RAZA 1K6OA 1B1BA 4UNOA 3MFKA 1H9GA 2ZFWA 3RIRA 4LMYA 2TDXA 4Q4ZF 3BY6A 3IWZA 1S3JA 2QQBA 4OIRF 2P7CB 4BHCA 2EFPA 2VOPA 4MNUA 2G7UA 4S04A 1MGTA 3HTSB 1ZREA 5LGUA 5AIQA 4IJAA 1RZ4A 2LSOA 2P8TA 4BYYA 2QM3A 2EB7A 2RQPA 2CGPA 1EH8A 1LDKB 3RKYA 5E1XA 2WC2A 4EM0B 3HUGA 4OOIA 1FWZA 1B9NA 3K2ZA 5L3CA 4L0YB 4BAYA 5JHUA 5D8LB 2GXBA 2F5EA 4A12A 4M71A 1R1TA 3IKTA 2YX4A 3KETA 5HVQC 2CFXA 4K2EA 5LHIA 3M7GA 3F72A 3DKWA 4ESJA 5D8KB 2RV8A 2A6HF 3R0AA 2XAHA 4U0YA 3PFIA 4UVCA 2VC0A 2M1BA 4BHBA 2VXZA 5KVRA 3WTWC 1YW8A 2PMHA 4XLPF 3BROA 4YIIA 2FNAA 2JRTA 5CVJA 3SFZA 3I58A 3ML6A 1AOYA 3EYYA 2QUFA 3BJ6A 2Y48A 3M1EA 2YSRA 4KDPA 3IC7A 4L5JA 4GCVA 5LLQA 2XV4S 2FA5A 1ZG1A 2O61A 2DTRA 1R5GA 2DT5A 1REPC 1MDMB 4G6DA 1QNTA 4Z2YA 4F7ZA 1SD7A 1SMYF 2QVOA 2OZ6A 4KN7X 2LF8A 2PMUA 1IAWA 2P4WA 4IVNA 4ZZLA 3Q5FA 2MH9A 2OA4A 5DCMB 1T98A 1MDMA 1F5TA 3KLNA 4A5MA 3KZZA 2BGCA 1FZPB 3JW4A 3J80Z 3EETA 1YO5C 1FYKA 3L2CA 1XDSA 4L9NA 5A2QZ 4A0XA 5DCMA 2HS5A 1WSUA 2F5DA 2V9VA 1TNSA 1HKTA 3SZPA 3Q9VA 2BE5F 5L3BA 2IW5A 5FD5A 2EJRA 4MQVA 2E7WA 1P6RA 3M8EA 1Z91A 3OV8A 5BQTA 2H09A 1XGSA 2H6BA 4RGSA 4MEXF 3DQVC 2VC1A 3W6KB 1LVAA 2CQKA 2QWWA 1ZLKA 4HW0A 3T8TA 4HDUA 2LDUA 4I2OA 1V3FA 2CWEA 2M5WA 5BPIA 4KMFA 3DXJF 3ZPLA 5BPDA 1Y0UA 2M87A 2BYVE 2L54A 1TQPA 2RKHA 4KIBA 2M45A 4KFCA 4DQ2A 4IHSA 2COMA 3IRRA 1XB4A 5HS9A 2VODA 1MD0A 3GXOA 1BOAA 5ICGA 4Y15A 4I0BA 2BBYA 5E1WA 3KEQA 1T39A 5LBQA 1ZRDA 2V1DA 2RNJA 1O7FA 2PEXA 4OIOF 4OMZA 2RVCA 5ED4A 4HLYA 1ZYRF 1ZGJA 1BIAA 3HRTA 1F4KA 2LF7A 1IZ1A 4PGGA 5KK1A 5LHHA 2VBYA 2D2WA 1R58A 2O03A 3NQOA 1ZRFA 4D0PA 1Z05A 4CZZA 2E7XA 3MAJA 1WKMA 4R8HA 5K5RA 2NNYA 1FOKA 3QAHA 4CGZA 2X4HA 1ZARA 3JAMK 2Q2EA 3RJPA 4EQQA 1WWXA 4Y17A 2A07F 3J7AO 1FYLA 3KFWX 3CUOA 1GXPA 3TO7A 5H20A 5L3GA 4LK1F 3IHUA 4EGZA 1IXSB 2ISZA 4HV5A 4JK1X 4PZJA 3TDZC 4AD9A 1NHAA 1W7PB 3RYRA 1Q1HA 4NHJA 3WE2A 1WRJA 2V6CA 2D1VA 1MZBA 4UXNA 2ELHA 1IN8A 1B6AA 5E8GA 4E70A 3QP6A 5LRRA 2IRFG 2A69F 4G9YA 2ESHA 1Z1DA 4KA4A 5CYVA 1VTNC 1U2WA 1I5ZA 4ENMA 3WG9A 2GA2A 4EJVA 3I4PA 4EM1A 6PAXA 3WTYC 2XGXA 2WWYA 1FBQA 3TGNA 2YU3A 3LFKA 3LWFA 2J5PA 4NQWA 1IN4A 3G3ZA 4HX4A 5IT9K 2HTSA 2VT3A 1O3TA 3ABUA 2ZCWA 2OU2A 3BJAA 3CJNA 3KP2A 3I59B 3P9KA 2VE9A 3ZMTA 3HOSA 3E97A 1D5VA 4PGHA 2XKPA 1R23A 1GVJA 3M8FA 2FBHA 2VOOA 4HQMA 1OR7A 1IN7A 3LQQA 3I59A 1L0OC 5DYMA 5HLGA 1TBXA 3CUQB 3O3KA 1KQ0A 1F9NA 2JPCA 4I0AA 3VOEA 2W84A 1SAXA 3ZMVA 3ZN1A 2IVMA 5AONA 1QGPA 4ESBA 2E1CA 4XSXF 4DNCA 4I7HA 3E6CC 2CYYA 3C7JA 3MEXA 1B4AA 2GXGA 3GUDA 3BDDA 3IWFA 3OOPA 5HDNA
chains in the Genus database with same CATH superfamily
3BTJA 1SD5A 4JYKA 2EWNA 4YFNF 4MEYF 2E5NA 1UZCA 1Z3XA 4BE1A 4V19K 2NRAC 4AU7A 4PFPA 2KT0A 2IA2A 3GZNB 3O8HA 4O5VA 2EIKH 2IEKA 5LRSA 3T1BA 4BXFA 5K7ZA 1ONVA 2NOJB 2ZXJA 5CVVA 2FBKA 1H9TA 3MQ0A 3ZQQA 2XGEA 1Z6RA 1I3AA 2B0LA 3S1MJ 2XAFA 3FXUA 1SFEA 2JWTA 2JTVA 2EA4A 2QSHX 4IX7A 3V8JA 2O8KA 1XSXA 4BBSJ 1S5LC 2G7HA 4CA0A 1WFXA 3HM5A 3ZP5A 1LEBA 1Z6TA 2HGCA 4M3FA 3PNVA 2EZLA 5IYCJ 4AIJA 2VJJA 2RN7A 4HOBA 4DYRA 1Q1VA 3CCQI 2HFHA 1ZLJA 3K9TA 2L7KA 2DK8A 4XQFA 2GLOA 3VSKA 3KYCB 5EGOB 1O3SA 5KCMA 5FFZA 1XMKA 5DEQA 1W7PD 4WCGA 2EA2A 4C30A 1UCRA 4CCJA 2M8EA 1YIJI 3TDUC 1J0RA 3HPGA 5FLXZ 2OD5A 2GOXB 3OYFA 1X4PA 4CDGA 1OISA 2L7FP 4AC0A 3TW7A 1R00A 4A3CJ 1IXRC 2BZTA 4XRSA 3M1CA 1PVEA 2P7VB 3CO6C 4IRGA 1PP8F 1X1PA 1D8JA 3H9QA 5ILVA 3FXLA 3WTZA 1MNEA 2PJRA 1S7OA 5FGMA 1JJ6C 4J19A 3HJEA 3I71A 1I6HJ 1B9MA 2MGQA 3K2AA 5B66C 3SFIA 1N78A 1Y8QB 2WY8Q 5EZHA 4G6QA 3DTEA 3WTXC 1FSEA 1WJBA 4ZJZA 4FHTA 4IF4A 4B3XA 2PN6A 4L0ZB 1JT6A 2DN0A 1U5TC 1XS9A 4H0EA 1O57A 2ZBKA 5E3LA 1IUFA 3CCEI 3FHNA 4EJOA 1YIOA 1W36D 4Y7NJ 2CFOA 1U8RA 2Q0OA 1QZZA 1A36A 2Y0MA 2MC3A 4NB5A 3I64A 2R7XA 2ETHA 1I3QJ 2K9QA 2ZO4A 2K3PA 4ZYGA 3CCMI 4JX5A 2YR2A 3PFYA 3BTCA 4GYIA 5IP6A 1XPXA 3SXYA 4YG2F 1SFUA 4D5FA 3L1PA 3PSFA 2PFBA 3C3WA 5CJ9A 4D5CA 4ZDOA 4O6JA 4FX4A 1D8KA 3CJRB 4HZFA 4UVAA 4ITVA 3QYBA 4HRIA 2MYSA 3EUHA 1E3OC 1TT5B 5ICEA 3HBLA 3U1DA 1TZLA 1OCCH 5E79C 2YU9J 4U7BA 3SJMA 3BWGA 4P96A 5DCFA 4B1RA 1TWFJ 4HF2A 2OQGA 5DM7F 1B8IB 1UHWA 2GZWA 4CCNA 4CCOA 1X3UA 3BPVA 1ZQ3P 1MNDA 3HXLA 4RM3A 1JTYA 1YFHA 3BG9A 3PO3J 5TJJA 3MZHA 2QENA 1LVKA 5L3EA 3WTUC 3LA3A 3GEZA 2KIMA 1Z21A 1XMAA 3Q3SA 1Y39A 4YELA 1RESA 2Z99A 1JJ8C 1HLVA 2M7BA 2BHZA 1OCOH 2HOEA 3T0YA 4ENJA 2MFZA 4S05A 1LJ9A 3P7NA 1B8IA 1BI2A 2JT1A 5FD6A 1IGNA 4G8XA 4XKCA 3OYJA 2GOMA 1EKEA 1IDYA 3R61A 1UAAA 4OAYA 1LDJA 2ZJ2A 4XRFA 3BTIA 1VQOI 3K1MA 2OQRA 3W2AA 1X1DA 2QBYA 4YRVA 3FDYA 2DPDA 5FLVA 5D4SA 2VN2A 1J7KA 2IGNA 3BLYA 3W6JB 3Q0VA 1NK3P 2K86A 3H36A 3BG7A 2Z9OA 3GVAA 4YIFA 2P5KA 3LSPA 2Z5UA 3L09A 1ACIA 1WJ5A 3W3CA 4FCYA 1FX7A 3ELKA 5GP9A 4HSTA 5D4RA 3PJRA 1FPQA 2DMUA 3ZQIA 2MA3A 1SFXA 1YITI 2HNHA 1R5ID 1IV8A 3LSMA 2Y30A 5FKOA 3E6MA 4N9IA 3DPTA 4W97A 3OR1C 3COAC 2FJ1A 2L4AA 4HYEA 3K4BA 1MIJA 3IUOA 4RGUA 2AHQA 2KQRA 1T0FC 3GF2A 4M6YA 4HQEA 1K79A 2CUEA 5EZGA 3FM5A 4LFUA 4WXCA 2FEZA 3D1NI 1BC7C 2VB6A 3MCZA 4GO1A 3A2KA 3SHFA 4MQ9F 1BIBA 3H9GA 5J40A 1ERDA 1YJWI 5FB2A 1Z9CA 4OMYA 3JTGA 2LP0A 5F0CA 2IS4A 3V8KA 2DFFA 4XSZF 4MTDA 2ZJRF 3BOQA 4IRIA 4EV0A 1OJLA 2L7MP 3I53A 4BE0A 3KZYA 4KN4X 3M3YJ 1UMQA 2FF4A 1D3YA 5M5XJ 2JA8J 3BR6A 1E2XA 3PIOF 2A6EF 3QU6A 5JVGF 1G3SA 2K4BA 2KRFA 4P1WA 1XCVA 5D6FA 4XLNF 1VF9A 2F2EA 1VQ7I 4UB6C 2STTA 4I09A 4ZZDA 3OYBA 2DA7A 3F22A 2F5FA 1IW7F 1ZKGA 5FKMA 3MKWB 3CC7I 4CCKA 3KE2A 1SFOJ 2DW4A 1KYZA 1YS6A 3PQKA 2EK5A 4RLQA 3GZ5A 4EJTA 2VLAA 2JA6J 2E1MB 3OYGA 5CPRB 1QHGA 2XVCA 2ECCA 3AL0B 4IRHA 1RI7A 3ZCOA 5M5WJ 4UVBA 1L3LA 1QZEA 2IXSA 4YFXF 3JRIA 5EYRA 4DBQA 2A5WA 4I98B 3KP5A 1EH7A 4XM3A 1H88C 3JCUC 1QQIA 2NVQJ 2DI3A 4BJTA 1VQPI 1LQ1A 3ISPA 1D5YA 2HQRA 2K9SA 2W85A 3LA2A 5JLXA 5E18F 3WTSC 4CSWA 2DT7B 2R0QC 2Z2SB 2YPRA 1LB2A 4P9FA 3GW2A 2JN6A 1IRGA 2NVXJ 3REOA 1FOXA 3QYEA 4E7SA 1G3TA 2CG4A 2RQQA 4XNFA 2STWA 2GQQA 2FU4A 4LLLA 5K1YA 2PI0A 3HOYJ 1NG6A 2HZTA 2EIJH 5DD4A 3W2VA 1D1CA 1KQ8A 1ZG3A 2DMPA 1VQMI 1BR2A 2GWRA 5J4YA 1USTA 3TP3A 2CW0F 2ADUA 1IO2A 3BR0A 4XR6A 2EFWA 3CC4I 4RA2A 4BNCA 2QKMB 4FASD 1WJAA 1X2MA 3D5RC 3JRDA 2KKOA 5JR3A 3B6AA 2V1XA 4I99C 3LAPA 2F5CA 1XSVA 2KHMA 1P4AA 2Z3YA 3H3ZA 5FFXA 3N4MA 3VYUB 4O3MA 2QKLB 3E5QA 1DDNA 4RBOA 3VWBA 4JP0A 1J2XA 3CF2A 4LGWA 4EJWA 5DDGA 3PSIA 3OIPA 5EEAA 4C3JJ 1QU3A 1HKSA 1DPRA 2UWMA 3RI4A 1Z0XA 3FKJA 2JK3A 1TWCJ 4XRSG 5HODA 1G3YA 3E5UA 2DDAA 2WBMA 1UHMA 2VPRA 1HXDA 2GAUA 3LSGA 1JI8A 1PUEE 4Y33A 4WWCA 4KYWA 5IT3A 2XF6A 2NS7A 2UUZA 3TOBA 1VQ9I 2KJCA 1I39A 4F92B 3HGYA 4U7DA 2VBWA 2M8GX 1HC8A 1ON2A 5E3NA 4BQOA 2ZMEB 2D1HA 4G7ZF 1T0FA 4XLCA 3D0SA 3ECHA 4AVPA 2VBXA 3ESWB 1JGSA 2F4MB 2AS5F 1F1ZA 3OYNA 3VYTB 2RNGA 2EFNA 3QOPA 4ESFA 2XROA 3L7WA 1PJRA 3BZCA 2Z33A 3HYIA 4I02A 1XDUA 4IPAA 1V5FA 3EPZA 4ZYEA 2HOSA 1MMNA 3DFGA 4OWRB 2ZMEA 1O7LA 2H6CA 2M4KA 3FWEA 3IP4B 2P5LC 5D5WB 2HPMA 2GIVA 3RDIA 3HSFA 2JSPA 2LY9A 4HG2A 4UUTA 4QPQA 2I8DA 2EV0A 3HSRA 5E17F 1IRXA 1S7AA 3WE3A 4KT6A 4RS8A 3HGGA 5BS6A 2WV0A 3H92A 4XRMA 3DCFA 1BR1A 4HX8A 1R36A 2ICWG 1U78A 4HPQA 4M3EA 4EJUA 3KYLA 3VYRB 4J01A 2JQ7A 3F6VA 3OR2C 3U9GA 1N25A 3AAFA 2IGKA 2VASA 4ENKA 4GFBA 3G73A 1A6IA 1MJ9A 3I3LA 4IXAA 3RTRA 4B09A 1NG7A 1K83J 1YG2A 3GTQJ 1ZN2A 4U0WA 2DOAA 4DYQA 4HF1A 1S8NA 1LE8B 2V9PA 3TBIA 2A61A 2GXAA 1H89C 3S15J 2FE3A 2FBIA 2Q1ZB 3I5UA 1BI1A 2MLKA 2K7LA 4HBLA 4BJ5C 4PJ0C 2X6XA 1JUSA 3LSHA 4A3KJ 1WZ2A 2CSOA 3BC8A 2KISA 2RREA 4FE7A 3S93A 5F0FA 4LB5A 1LE8A 5DD8A 4YFKF 5HS7A 3OOUA 3MKYB 4A3FJ 2XRLA 3ERED 4JX6A 1R7JA 2G9WA 4Q47A 3WU2C 5EG0B 3F23A 1HF0A 2HKOA 5F1RA 3GTOJ 2BXYA 4C2TA 3I9V2 4WXDA 2A68F 2XB0X 1W5CC 2HR3A 3EYIA 3P9IA 1FP2A 4LJZF 3S8PA 5LEJA 4FTHA 5C4XJ 2IAIA 1X19A 2DOEA 5E3OA 3TEDA 1AU7A 1A6QA 4IHTA 1IN6A 1WJEA 3EUAA 2DPUA 3FXKA 4L5IA 5EG0A 1CGPA 4AYBN 2IBDA 5CLSA 4DZJA 3KP7A 2FQ3A 4Y13A 2DBBA 2NYXA 3PUBA 4A5NA 1JKQC 3H5RA 2WAQA 2L02A 3J81K 2LC2A 4QLCU 1IUYA 3QOEA 3F8BA 2JVHA 2WV1A 4NQWB 1HDPA 3HSEA 3SQNA 2VONA 3RKWA 3DU6A 3G1LA 1J75A 4KIGA 3T8RA 4CYCA 5KNLA 2KMUA 2YS9A 1E3PA 1LFBA 4DIQA 4IHVA 2BVLA 5D5VB 2I5UA 5M3FJ 1HSTA 2RDPA 1MW7A 5HS8A 2DOFA 4YEJA 4ON0A 3HRUA 3T5XA 1I27A 2ZB9A 1Y1WJ 3AFHA 4XKVA 4MGRA 1IV6A 1PDNC 2JPBA 1TL8A 3CMAI 3CLOA 4ZYDA 4UUSB 4D1QA 2R7DA 2K3FA 3JSPA 4NNJA 3NEUA 2AQEA 4CYDA 5IOZA 2MABA 5EDNA 2NAZA 1WQ2A 5C3EJ 3HRSA 2DYSH 3LFUA 3OYDA 1TNTA 4A6EA 3S16J 2R3SA 4F3QA 2ACJA 3FM3A 3S14J 1SC7A 4HF0A 2X6WA 2BY2A 3P9CA 5FLMJ 1TC3C 2BY1A 4FT8A 5D6EA 3CCJI 1HW1A 1RIOH 3R4KA 1W5SA 3KLOA 5B1AH 2X1EA 1EV7A 3RQIA 4KICA 1N75A 2H94A 3RSNA 1EJ9A 3L2VA 4AIHA 2CU7A 2OV7A 3RCOA 2CW8A 1UHSA 2DFIA 4XN3A 2XAJA 4QPOA 1KGSA 5GAHJ 4KUMA 3FHZA 2VJ4A 3CCRI 4A3DJ 1DU6A 1LFUP 2MG4A 1VQKI 2COBA 3B02A 5IY5H 3B6CA 2L4MA 1SANA 3I0TA 2F48A 1XD7A 4OIPF 1P7JA 4Q5SF 2FSWA 3CCLI 2M4GA 4AWXB 2ME6A 3WTTC 2LG4A 3ROUA 4NUBA 5M5YJ 2Y9ZA 3LAJA 1ZRCA 2MSYA 1V54H 2R7WA 3I54A 1USSA 3GFIA 3ABTA 1RRJA 2KJBA 3L2QA 3JAMZ 3D5LA 4JBAA 1RUOA 3N97A 3F8FA 2MLGA 2BV6A 1U3EM 3DP7A 4BY7J 4BEHB 5F0HA 1WVRA 3ZQ7A 5GADJ 5JFRA 3R6SA 3VODA 2IA0A 4NC7A 4M9XA 4X0GA 1G4DA 2HVQA 3L00A 1STZA 2IT0A 2XIGA 5L3DA 1WH5A 3LOCA 4XKWA 2PMZA 4Q48A 4G94A 2IS2A 1YX3A 3F8NA 2X51A 4D7NA 3DLLF 3CESA 2GIZA 3TW6A 4WK8F 2R5ZB 1VQLI 1HBXG 1IF1A 1XX5A 5FKNA 2D5VA 4L9TA 2XRNA 3S32A 1YE9A 4BEHA 3RZDJ 3GTLJ 3BR5A 1WGXA 3VB2A 4F52A 3QPHA 1VZ0A 5FKLA 4B3AA 1G59A 3DKXA 2B63J 3JRGA 2ISYA 3V8LA 3RYPA 3KZIC 1H0MA 2E2JJ 1OYIA 3OY9A 3BPXA 3DTKA 3ZMUA 1KA8A 2QQAA 2PJRB 3WGGA 1KU3A 4DBRA 2O3FA 1CF7A 2HXIA 1U9NA 5J1RA 5FRNA 3JRFA 3K1NA 2XSDC 2V7FA 4OIQF 3QPSA 4PDKA 2R5ZA 2XHKA 4AUXA 4P5OA 3FX3A 4M6VA 3ZOBA 3FXMA 3E6DA 3VDXA 1FEXA 3FXRA 1PP7U 4JQFA 4B47A 2XF7A 3A0HC 5CKTA 5AIPA 2DQLA 3GLXA 5C4JJ 2R7TA 3I4NJ 1HW5A 3K0LA 2DAOA 4NBQA 2AO9A 2TCTA 2OJED 1WI9A 2BW3B 1YLFA 3EUKL 1G6NA 2AXTC 5H6QA 4AYBA 2R92J 3DBLB 1GLNA 1XCBA 5EEHA 3GX4X 4QWQA 3V42A 5F64A 4A93J 4EMSA 3BJOA 3HOTA 2FOKA 1V4RA 4U88A 5E20A 3HC7A 1CQTA 3LMMA 5LHGA 1K78B 2FRHA 2W24A 2E34A 2WADA 4BXXJ 3OYEA 3MZ8A 1H8AC 4XLEA 2LR8A 3WGIA 3DV8A 1GUUA 4HEA2 1FLIA 3F0CA 3X2QH 2DMNA 4PJLA 2NXNB 5IT9Z 2M9HA 3J80K 1MBGA 3QU3A 1W0TA 3F8CA 3OYKA 2DCEA 2BW3A 3BCBA 4RDUA 3U21A 3FF5A 1JUMA 5LFAA 2VKHA 1TLHB 1TW3A 5A2QK 2R7ZJ 3A02A 1ON1A 1ETVA 2PLYA 2ME0A 3MMYB 4WXHA 5DUKA 4WX9A 4RB2C 1K78A 1YJNI 5J8FA 3C1DA 3HKZA 5J1YA 2LVSA 3BR3A 3K1PA 1ENHA 2JZYA 2X0LA 4M6XA 1PUFB 1BN5A 2W25A 3BG3A 2WAEA 2XSJC 4HX7A 5J3LA 1QZYA 2ECBA 1I1GA 2EH3A 4UV8A 1YTYA 1I1SA 3G2BA 3K4MA 1ULYA 3B73A 4HA8A 1ZGAA 1BW5A 1UFMA 4RB3C 1OPCA 4ZDLA 1FMWA 3FXOA 2MW8A 3GWZA 1FBSA 4BQQA 2PX9A 1RETA 3BP8A 2HVRA 2B7EA 1ZAOA 4PCQA 3PO2J 2V79A 2A05A 1RNLA 1PUFA 4XBFA 2NOGA 1R4MB 3V4GA 2WY7Q 4M9SA 2QBYB 2VPLA 4P9UA 1OFCX 2DT6A 3E3VA 4CUGA 2FX0A 3G4SI 2VI6A 3LA7A 2PQ8A 4ZC3A 2NNNA 2KIUA 3ZMDA 1J5YA 1TQMA 3TKYA 2I10A 3IL2A 3ABLH 3AL0C 5CVRA 1UB9A 3RKQA 1UELB 1IC8A 3CDHA 3G6EI 2EFQA 1FOWA 2HYGD 3ZGKA 2XASA 2FNPA 2DLLA 4M3BA 3TQNA 4BDYA 1HSJA 3S2WA 4II2A 1K7AA 4A6DA 2VKEA 4C2UA 3ASOH 4RGRA 2LYCA 2JRMA 2VKVA 5C44J 5BOXA 5LEKA 5L3FA 4M74A 4RLFA 4RB1A 1A04A 5FRMA 3JTHA 1YOVB 2IP2A 2XUBA 3SZGA 1JHFA 3VEPA 1YJ9I 1Z77A 2LTPA 2KPMA 3IAS2 2CQNA 1VFCA 1FMVA 5H6RA 4MFEA 2DA6A 4S0HB 3S17J 1VQ6I 2VE8A 2NS0A 5H2FC 3KPHA 3HRMA 2ELJA 1OMIA 3CTAA 3V7SA 3OYLA 1U5TB 2HTJA 3HHGA 1RUNA 5EF6A 3R0JA 1XGNA 3F21A 2CQXA 3JSOA 4LOCA 3MD2A 5CVUA 1ITYA 1R71A 4ENNA 2MD5A 4IQJA 3GFMA 1E17A 2A6TA 1FYMA 4ZTFA 1MBFA 1ZH5A 3CCUI 1FIPA 2YX7A 5ERIA 1R1UA 4EM2A 2HPIA 4HAMA 4PSXA 1Z67A 1IXCA 5GTHC 4MHGA 3CCSI 2X48A 3MN2A 1U5TA 4M73A 1KU2A 2HKXA 3HG9A 5K5OA 2LBFB 3L9FA 5DM6F 3FK7A 5CVIA 2Y75A 1O3RA 2QSGX 4LIUA 3ZN0A 2L9NA 4B48A 3QRFF 4L9VA 4OU0A 4BDZA 2EZKA 2EZIA 4M9ZA 4A0ZA 3MVPA 1VI0A 1AA7A 3J7YJ 1D0ZA 2XAGA 1WPKA 1Z3YA 1J9IA 4CCLA 2QA4I 5KAIC 4G12A 1KQ9A 1MKMA 2CUZA 2X9DA 3WU1B 4KMUX 4XL9A 1S9HA 1V55H 2JSCA 2LBFA 3O2PE 3SYTA 2DU9A 1KZHA 2JUCA 5BMZA 3U2RA 5K5QA 2IS6A 4GXOA 2N8GA 3F6OA 2JA5J 2A5YB 3K10A 2A3SA 3IAM2 2EQRA 3QODA 3VPRA 2UZKA 2LKXA 5D5UB 2E36A 3FMSA 3WU0A 2CO5A 2M34A 1S7EA 2BOLA 4DOZA 3JREA 3K70D 2NVYJ 3GYHX 2HYFA 2K9MA 4FE4A 3WHBA 1SMTA 4P55A 3SDGA 1P4XA 1I6XA 3DPLC 2HOTA 1MJAA 3NRVA 1FP1D 1DUXC 1OCPA 3GO5A 4KIFA 1DP7P 2HQNA 1QRYA 3C18A 2R7VA 3HHHA 3ECOA 2KRHA 1G2HA 1D0YA 4RB0A 2JA7J 4BUPA 4M72A 1JE8A 3HEFA 4L9JA 3HOUJ 2FMLA 3AG2H 1TT0A 3RPUA 1WJDA 5B1BH 3DEEA 2EZHA 3O8GA 2UXXA 5E1ZB 3WODF 1FC3A 3WTVC 3WGHA 3NAUA 3EDPA 5J1UA 4BU2A 3GFJA 1ZR2A 2ESNA 2M30A 1K4SA 3OYHA 5LGNA 2OTLI 1XN7A 2WAFA 1FTZA 2CJJA 3EQLF 1FNNA 4U0VA 2GA1A 1MMDA 1IRZA 2E60A 3KP4A 2C6YA 4UV9A 4E6KG 5LD2C 1MBEA 5ILSA 1GXQA 2VXDA 3FMQA 3E5XA 4LK0F 1A5JA 3DF8A 3MWMA 2HQAA 4KJZA 1VQ4I 5J4VA 1S29A 1FSHA 1D0XA 2Q8KA 3TO6A 2X6YA 5D5XB 2FOWA 4GDFA 2L5QA 2R7UA 2P6TA 1MJBA 3C2BA 1MMSA 1BC8C 1SFKA 2OBPA 3KEOA 3GFLA 3FXQA 2CUFA 3GTGJ 4PUSA 3RKXA 3QPTA 1UJ8A 5J8CA 1B59A 4AVZA 2O7OA 4HNUA 3AG3H 1GHCA 3SZTA 3KIOA 3CDLA 3TL4X 3FK6A 1OYWA 1XSDA 3PNTA 4RAYA 3KCCA 5FJ8J 2Y0SN 1U6GA 3F9KA 5TRDA 4L18B 4WF2A 5TGTA 1T6SA 2HU9A 1KU7A 1QO0D 2LKPA 1ZR4A 1SAUA 3A03A 4BH9A 3HB9A 5IYDJ 3QP5A 3BZ6A 3OYIA 3HOXJ 2HDCA 5EEGA 2HVSA 1J59A 1Y56A 2DYRH 1D1AA 2EILH 2LH9A 1KU9A 2ZNZA 4CCMA 3FKIJ 2LFBA 2P5VA 4PSWA 3MZYA 4N0BA 2UXNA 3V7RA 1BI0A 5JHFA 2MBFA 3G71I 3ZQGA 4G7HF 2AQFA 4A3JJ 2M7AA 1W36C 1Z7UA 4HV6A 4LB6B 2XDVA 5EJCA 3OSGA 4OINF 1AKHB 1ETWA 2QQ8A 3GZ6A 4LLGF 4IHYA 3TOAA 4B8XA 4RGXA 3K4KA 1OR7C 4X6AJ 5LGTA 2K02A 5GPCA 2BVMA 3M9AA 5ICFA 2FUG2 1W4MA 2CH0A 2XAQA 1E3HA 3M07A 4A3LJ 1ZELA 2VQHA 2EV5A 2DA5A 2QZ8A 3ZQLA 1MNMC 4IHWA 1HKQA 3RZOJ 1BM9A 4C3IJ 4EATA 2E1OA 2EFOA 2VQLA 2IPQX 2O8XA 3C2HA 4G7OF 4Y52J 1WH7A 1HDDC 1AKHA 2MH2A 5HNHA 2O5RA 1YS7A 2MD0A 5HLHA 4CHUA 1IDZA 2X1CA 1QVTA 2D45A 3DTIA 1YYVA 3H5AA 4FX0A 3KP6A 1QPMA 3KX2A 1YW7A 2ZC2A 2ZXIA 3J7ZI 2W7NA 1BA5A 5JVTA 4KNYA 4LLNA 2J5OA 2LK2A 1X1AA 1IRFA 3HL2A 3FISA 1KYWA 5B5EC 1XG1A 3CUQC 1EH6A 1RR8C 1HA8A 3RQ4A 5E8IA 1ZK8A 2PBIA 2L9VA 2NVUB 4CYCB 1SD4A 1S72I 5DV5A 2HWVA 2V1UA 3LSIA 1O3QA 1ETOA 3S3OA 1V5EA 3IRQA 2VIXA 3DEWA 4RAFA 1QBJA 4EVIA 3VFZA 4JOMA 4LG0B 2QLZA 2DMQA 5HDKA 3CMYA 4HDVA 3QYFA 4E7LA 3H3VK 3ZQFA 4A3MJ 1X4OA 2X1DA 3TO9A 4F91B 3BQYA 3BT9A 1HQCA 3RPQA 1JXSA 1R22A 1APLC 2HYJA 2YUSA 2NS8A 2X85A 1BI3A 2WB1N 5HLIA 1R5HA 2PJPA 1K61A 2K5CA 1JTXA 4IOCF 4IZZA 1UG0A 5F04A 5K7FA 2IJLA 3E6BA 2BY3A 1R6RA 3ZMZA 1TWAJ 4E4HA 2ZXWH 2XKOA 4LG0A 3K69A 4DZPA 4XOTA 2HXOA 2OAZA 3FIWA 1W7PA 3CCYA 3H3UA 3CO7C 3OMYA 3FZVA 2JUGA 1ZGWA 5FLXK 2FMYA 1RR7A 2KIFA 2LLKA 1TW2A 4ZYHA 5HOOA 3L2UA 1R9TJ 4BQAA 2IS1A 5DUIA 3CD6I 4MLOA 2DQRA 1POGA 3CQZJ 3K4LA 3QPLA 4R1HA 1XGMA 1YW9A 3CP2A 3Q0UA 3DBRB 3UR3C 2EBIA 1AWCA 1LNWA 2KDZA 2FXAA 1FT9A 1R4NB 3U1KA 4BHPA 3Q9SA 3S1QJ 1G3WA 4R79A 2H1KA 3HOZJ 2EV6A 3K7AJ 5JLWA 2BEOA 1T2KA 2CV2A 1YHQI 2DTZA 1YQAA 1OYYA 3IKVA 5F6FA 3WG7H 1ZHFA 3S1NJ 1P92A 3AKZA 5IOYA 1BJAA 1JHHA 1MBKA 1U0JA 2M0CA 4CO8A 2O6GE 3UNGC 3L2RA 2LNBA 1BJZA 1P2FA 2K4JA 2DK5A 2HEOA 2AXLA 3LSKA 1TTYA 3A1YA 3CF5F 4MTEA 3PM1A 2E2HJ 1U9OA 3D5SC 3H9JA 2ZSHB 5FO5A 3DU5A 2H27A 2K27A 1FBUA 4DW6A 2O0YA 1N77A 2ZSIB 3ERMA 4MFDA 3ZRGA 2R7OA 2R7FA 1DPUA 4UHTA 4BGDA 2CRGA 2E5ZA 5ILUA 3FBIB 1FJLA 1BOBA 2ZNYA 1JKOC 1FTTA 2Y0SA 4XORA 1FY7A 2WTEA 1IN5A 2DXIA 2OZUA 1GT0C 1P4WA 3ASNH 4XLAA 2KFDA 4HSRA 4CZCA 4KISA 3FBNB 2RGVA 3PUFA 1T38A 2DO7A 3BTLA 3CMMA 2VBZA 4LD5A 2OPTA 1SD6A 1ZG5A 1OQYA 1YX5A 3BZKA 3VYSB 3CUQA 1XGOA 1LDDA 4AIKA 2CV0A 3OYAA 3GBGA 2E71A 3ABMH 3KP3A 4A2UA 4CXFA 1RKWA 1WCMJ 3OYCA 1S6LA 3GCMA 5ICCA 3BR2A 3PQJA 2F4OB 2XB5A 1T56A 1LEAA 2KDOA 2V6EA 1BBYA 4GGGA 5IP7J 4ZH4F 1T33A 2L2OA 5JI6A 3FMRA 1OKRA 2OCCH 3R60A 2QQ9A 2VT2A 4I01A 1I50J 4XONA 3HTUA 5J6XA 5DS9A 4PJNA 1CF7B 4BXUA 4BS9A 3LSTA 4ZTJA 2Z1DA 3OS1A 2PG4A 1Z7LA 3A0BC 1ODDA 4XMYA 3GTJJ 4EGYA 3I4MJ 2L3DA 4N9HA 4TV7A 2QYOA 4CICA 2IA1A 1BR4A 1GDTA 3PNYA 3ZMSA 2RC4A 2P81A 3F8MA 2P6SA 4KT5C 1GV2A 4E7IA 2L01A 3DEUA 2XPWA 4FETA 1TQIA 1K6YA 1HW2A 4UUVA 1B72B 1ETXA 3GTKJ 4HLXA 3LQRA 3QQAA 2W4SA 4IHXA 2VQCA 1BW6A 2ZKZA 4A3EJ 2E1NA 2M0MA 4V2GA 3O6BB 2V9KA 3OS2A 3J81Z 4NC8A 3ULQB 4ETSA 3HIFA 1C0WA 1W5TA 1OCZH 5IP9J 2W57A 2X6OA 1SVMA 3AG4H 5KAFC 2UV1A 1Y0NA 3OL4A 4YIRX 3JRHA 2QEXI 2CUJA 5HDGA 4ASNA 1R1VA 3V7CA 4F55A 4D9JA 3F3XA 1B72A 4GYGA 5M3MJ 3W2WA 4A0YA 2CQ7A 4RAZA 1K6OA 1B1BA 2F4IA 2LMDA 1O4XA 4DGWB 3BR1A 4UNOA 1H9GA 3MFKA 4PJMA 2QGUA 2ZFWA 3RIRA 2F6CA 2WB1A 2CMPA 3AG1H 1FOYA 1A31A 1NTCA 3ONQA 4LMYA 2JA2A 2TDXA 4RMNA 1X3ZB 4Q4ZF 3BY6A 5EGOA 1MSEC 1QA6A 2DJIA 3IWZA 2GM4A 1S3JA 2QQBA 2KRCA 4OIRF 2P7CB 1RKTA 2WA0A 2EFPA 4BHCA 1E0EA 1ETYA 1UG2A 2VOPA 2Z16A 2VQGA 4MNUA 2DMTA 2G7UA 1WHUA 4EEFG 2DDBA 4S04A 3HUGB 1J09A 4XK4A 4AIDA 1MGTA 3HTSB 1ZREA 3H0GJ 4A3BJ 3LSJA 5LGUA 5AIQA 3HZJA 4IJAA 1RZ4A 2LSOA 3DWLE 2P8TA 3CJTB 4BYYA 2QM3A 2DA1A 2EB7A 2P0WA 4B43A 5J47A 2RQPA 1T8IA 1EH8A 1LDKB 4DYCA 2CGPA 3RKYA 5E1XA 3DPUA 1FIAA 2WC2A 2FQ4A 4W1UA 4EM0B 3HUGA 4OOIA 4RM2A 1FWZA 1TWGJ 2DJNA 4II3A 1B9NA 3TP0A 2EINH 1VQ5I 3K2ZA 5L3CA 3UKGA 4L0YB 3A4CA 2CQQA 4BAYA 3JRAA 5JHUA 1EF4A 3PL8A 5DTDA 5D8LB 2H8RA 2GXBA 3Q0WA 1T08B 1X1CA 2V4JC 2F5EA 4A12A 4M71A 4OAZA 1JT0A 2E1MC 1R1TA 3IKTA 2H1LA 2XPVA 3CLQA 2YX4A 3KETA 4I6ZA 5HVQC 1MH3A 2CFXA 4K2EA 2R5YB 5LHIA 3M7GA 3F72A 3H1CA 3DKWA 2KZGA 4ESJA 4LG3A 2VKDA 1WJFA 5D8KB 2RV8A 2CS3A 2V26A 2A6HF 4E7JA 3FXJA 3R0AA 2QF7A 2XAHA 2HDWA 4U0YA 3PFIA 4UVCA 2LY2A 4Z6YA 2VC0A 4PK4A 2M1BA 1OCTC 3WHCA 2OUMA 4BHBA 2VXZA 5KVRA 1JKPC 3WTWC 1YW8A 5GTIC 2XC7A 2PMHA 1XMXA 2R5YA 4XLPF 3BROA 2DFEA 4YIIA 4D7MA 2E19A 2L0KA 3H35A 2EPFA 2FNAA 2HQ5A 2JRTA 3IH3A 5CVJA 3SFZA 5GAGJ 3MKZA 1AHDP 3I58A 3ML6A 1AOYA 3EYYA 2QUFA 3BJ6A 2Y48A 2Y31A 4L5EA 3ZR8X 4RAGA 3M1EA 4C3HJ 2YSRA 4KDPA 3ABKH 3IC7A 4L5JA 2W00A 3CCVI 3LSRA 1Y1VJ 1OCRH 2ZJQF 3SEQA 1HCRA 4GCVA 3DKYA 2ID3A 4A69C 1JKRC 1X58A 5LLQA 1P9QC 2XV4S 2FA5A 1ZG1A 2O61A 4BACA 2DTRA 1R5GA 2OF7A 4XIDA 2DT5A 3HOVJ 1REPC 4ABZA 4HNVA 3SDBA 3S3NA 1MDMB 4G6DA 1QNTA 1GVDA 4Y3OA 1KONA 4Z2YA 4PFOA 5HLTA 4F7ZA 2LY1A 1SD7A 2RAEA 2XF5A 2CW7A 1SMYF 1U8BA 2TRTA 4I76A 2K40A 2HOAA 2QVOA 2HDDA 3I55I 1DP3A 4BQNA 2ZMEC 1MSFC 2OZ6A 4KN7X 2LF8A 2PMUA 1IAWA 2P4WA 4IVNA 4ZZLA 3Q5FA 4B4CA 2MH9A 2OA4A 1XTAA 5DCMB 2KL4A 3HPHA 4F93B 1T98A 1XC5A 1MDMA 1DU0A 1F5TA 3E7LA 3KLNA 1VNDA 2L9SA 4A5MA 2BY0A 3KZZA 2DA4A 3QWLA 2BGCA 1FZPB 3JW4A 3NWSA 4XKBA 3J80Z 1V5GA 2W82A 3EETA 4IQ4A 4J00A 1YO5C 1FYKA 3L2CA 3ZXSA 1XDSA 4L9NA 2ELKA 5A2QZ 4A0XA 5DCMA 5KHDA 2HS5A 3A01B 1WSUA 2F5DA 2V9VA 1TNSA 1X2NA 4KITB 3GTMJ 3ZQCA 4G6TB 2K85A 1HKTA 2O9LA 3SZPA 2WAQN 3Q9VA 3J7AY 2BE5F 5L3BA 2IW5A 2XPUA 2M3AA 2BXZA 5FD5A 1F36A 2KIQA 3BQZA 4C2MJ 2G0EA 1QPIA 2EJRA 1BL0A 4MQVA 2E7WA 2OTJI 1P6RA 2LD5A 1NH3A 3A01A 1QHHD 3M8EA 1DGRM 2R7SA 4XICA 2LOOA 1Z91A 1DGWY 3OV8A 4QSHA 5BQTA 4N4OB 3E0JB 4E7KA 3G1OA 2H09A 1XGSA 2H6BA 4RGSA 3PIPF 3DQVC 4MEXF 2NVTJ 2VC1A 4XLFA 3W6KB 1ETKA 1LVAA 5B3SH 3KEYA 2CQKA 1RPWA 2QWWA 1ZLKA 4HW0A 3T8TA 4E7HA 4HDUA 1MBJA 2LDUA 1A35A 1EA3A 1X1BA 5GAEJ 4BL0B 3S1RJ 4I2OA 1V3FA 2OCEA 2CWEA 4MO7A 2M5WA 5BPIA 4KMFA 3DXJF 5HNFA 3ZPLA 4M3DA 1JUPA 2HI3A 3S3MA 1ORKA 3HDDA 3CJQB 5BPDA 1MH4A 3OSFA 4B44A 1Y0UA 1VQNI 2HZDA 2M87A 5FKKA 2BYVE 1X3WB 2VUMJ 2L54A 1TQPA 4C9YA 5IYBJ 2RKHA 4KIBA 1P7IA 2Y2ZA 2M45A 3H5NA 3K6GA 4KFCA 4DQ2A 3CP8A 2ID6A 3OYMA 4IHSA 4X1EA 3L2WA 2COMA 3IRRA 2LRDA 1XB4A 4GRIA 5HS9A 4BE2A 2K9LA 2H8WA 2VODA 2E35A 2JVGA 4A3GJ 1MD0A 3GXOA 1YI2I 2JMWA 2E2IJ 1BOAA 5ICGA 4BBRJ 4Y15A 4I0BA 2BBYA 1VQ8I 3M4OJ 2W48A 5E1WA 3KEQA 4A3IJ 4MIMA 1T39A 2M2EA 1R49A 4JX4A 3LNQA 5LBQA 3TMOA 1ZRDA 1SEUA 2QSFX 2W1OA 2V1DA 5CQGA 2RNJA 1O7FA 2PEXA 3OL3A 4PJJA 4OIOF 3JRCA 9ANTA 2DA2A 4OMZA 1MMGA 2L7ZA 2RVCA 4QIWN 5ED4A 4HLYA 5F27A 2XGDA 1ZYRF 1WI3A 5CQEA 1M1EB 1ZGJA 1BIAA 2Q2EB 3HRTA 1F4KA 2LF7A 3E1SA 1IZ1A 4PGGA 5KK1A 4NDLA 5LHHA 2VBYA 2D2WA 2KLOA 1R58A 2Y9YA 2O03A 3NQOA 1IG7A 1ZRFA 4D0PA 5BNGA 4IO9F 1Z05A 2FD5A 2E7XA 3BCAA 3NWTA 4CZZA 5F1JA 3H0DA 2DA3A 3MAJA 1WKMA 1Y6IA 3KYDB 4R8HA 5K5RA 3K4JA 3N05A 1TWHJ 2NNYA 3IH4A 2PMZN 1FOKA 3QAHA 4CGZA 1LUJB 3DLAA 4LITA 2X4HA 1ZARA 3BG6A 4ANJA 3JAMK 2Q2EA 3RJPA 1W0UA 4EQQA 2DODA 4BKXA 3CC2I 1WWXA 4Y17A 2A07F 2MC4A 3J7AO 2B9SA 4BJ6C 1FYLA 1W1WE 3KFWX 3CUOA 2IGMA 1GXPA 3TO7A 4H4KC 1RC9A 5H20A 5L3GA 2DFHA 2QCOA 1DQUA 3SEZA 4LK1F 3IHUA 4EGZA 4CH7A 2LKSA 2OC6A 1IXSB 1IJWC 2ISZA 3HOWJ 5GPAA 4HV5A 4JK1X 4PZJA 3TDZC 3JR9A 3ZQHA 4AD9A 4DJAA 1NHAA 1W7PB 3RYRA 1Q1HA 4NHJA 4E7ZA 3WE2A 4IEJA 1WRJA 1TP4A 1LPQA 3S2DJ 2V6CA 2D1VA 1MZBA 4UXNA 3DBHB 2ELHA 1IN8A 1B6AA 3RPUD 5E8GA 1YRNB 4E70A 3QP6A 2VL8A 2KP6A 2V1NA 5LRRA 2IRFG 1HOMA 2A69F 2GBYA 3C2GA 3K4NA 3VSLA 4G9YA 2ESHA 4V2FA 1Z1DA 4KA4A 5TISC 3I56I 5CYVA 1ZTRA 1VTNC 1I5ZA 1U2WA 4ENMA 3WG9A 1QVUA 4FISA 3JRBA 1PYVA 2L9RA 2GA2A 2KZVA 1D1BA 1YRNA 2R7QA 4UY8I 4EJVA 3I4PA 4XLHA 1SVLA 4IL6C 4LIVA 5IPAA 4EM1A 3S2HJ 6PAXA 1ETQA 4N4NB 4XOPA 3M8JA 3WTYC 2XGCA 1GV5A 3GLLA 2XGXA 2WWYA 1FBQA 2BHYA 3TGNA 2YU3A 3LFKA 3LWFA 2J5PA 3HKZN 4NQWA 1IN4A 3G3ZA 4AM3A 4NC6A 2JJ7A 4HX4A 5IT9K 2HTSA 2VJ5A 2VT3A 1O3TA 3ABUA 2ZCWA 2OU2A 3BJAA 3CJNA 3K4CA 3I59B 3KP2A 2R4GA 3P9KA 3OS0A 3CZ6A 2VE9A 3ZMTA 3HOSA 1Y8RB 3E97A 3GTPJ 1D5VA 4PGHA 1LFPA 2XKPA 3NARA 4Y4RA 1R23A 1GVJA 1SVOA 3M8FA 3CMEI 2LREA 1F43A 2FBHA 5F08A 1K4TA 1MMAA 2VOOA 4HQMA 3GMEA 2XAUA 1OR7A 4UB8C 4UUSA 2F5VA 3MKLA 4IKFA 4M3GA 2IGOA 1IN7A 2R93J 3BG5A 3LQQA 3I59A 2CV1A 1L0OC 4FQGA 5DYMA 5HLGA 1TBXA 5E3MA 3CUQB 3O3KA 4IOAF 1LKXA 1KQ0A 1JGGA 3W6VA 2VJIA 1F9NA 2JPCA 2Y69H 4I0AA 3OIOA 2ZFUA 3VOEA 4HNTA 2W84A 1SAXA 3ZMVA 1OLTA 4U87A 3K70C 3ZN1A 2IVMA 5AONA 1QGPA 2ZJPF 4ESBA 2ZXHA 4ZDPA 1MBHA 2E1CA 4XSXF 2EIMH 4DNCA 3OWTA 4I7HA 3E6CC 5K7HA 2CYYA 1NK2P 5FROA 3IH2A 3C7JA 3MEXA 3OIQA 3P5JA 3EUHC 3LL7A 1B4AA 2GXGA 4QTRA 2R7RA 3CDIA 3G1MA 3GUDA 4XN0A 3BDDA 1T95A 3IWFA 4ZYAA 3OOPA 5HDNA 1G8XA 4BY1J 2K9NA 3IV5A 1WJCA
chains in the Genus database with same CATH topology
1SD5A 2EWNA 4YFNF 4MEYF 2NRAC 4O5VA 2IA2A 5LRSA 3T1BA 1ONVA 2ZXJA 5CVVA 1H9TA 2FBKA 3MQ0A 1Z6RA 2B0LA 2XAFA 3FXUA 1SFEA 2JTVA 2EA4A 3V8JA 1XSXA 2G7HA 3ZP5A 1LEBA 1Z6TA 2HGCA 4AIJA 2RN7A 4HOBA 2HFHA 1ZLJA 3K9TA 2DK8A 1O3SA 5FFZA 1XMKA 5DEQA 1W7PD 4WCGA 2EA2A 1UCRA 2M8EA 3TDUC 1J0RA 5FLXZ 2OD5A 4CDGA 1R00A 1IXRC 2P7VB 3CO6C 4IRGA 1PP8F 1D8JA 5ILVA 3WTZA 1S7OA 5FGMA 3I71A 1B9MA 4G6QA 3WTXC 1FSEA 4FHTA 4IF4A 4L0ZB 2PN6A 1U5TC 4H0EA 1O57A 2ZBKA 4EJOA 1YIOA 1U8RA 2Q0OA 1QZZA 2Y0MA 2MC3A 4NB5A 3I64A 2ETHA 2ZO4A 4ZYGA 2YR2A 4GYIA 3SXYA 4YG2F 1SFUA 2PFBA 3C3WA 5CJ9A 4O6JA 4FX4A 1D8KA 4HZFA 4UVAA 3EUHA 5ICEA 3U1DA 4U7BA 3BWGA 4P96A 5DCFA 4HF2A 2OQGA 1UHWA 2GZWA 1X3UA 3BPVA 1YFHA 5TJJA 3MZHA 2QENA 3WTUC 5L3EA 3LA3A 3GEZA 2KIMA 1XMAA 2Z99A 2HOEA 3T0YA 4ENJA 4S05A 1LJ9A 3P7NA 1BI2A 2JT1A 5FD6A 4G8XA 3R61A 1LDJA 2ZJ2A 4XRFA 3K1MA 2OQRA 2QBYA 2DPDA 5D4SA 2VN2A 1J7KA 3W6JB 2Z9OA 2K86A 3GVAA 4YIFA 2P5KA 2Z5UA 3L09A 1FX7A 3ELKA 5D4RA 1FPQA 2MA3A 1SFXA 3E6MA 4N9IA 3DPTA 3COAC 2L4AA 4HYEA 4RGUA 3GF2A 4M6YA 4HQEA 1K79A 3FM5A 4LFUA 4WXCA 2FEZA 1BC7C 3MCZA 4GO1A 3SHFA 4MQ9F 1BIBA 5FB2A 1Z9CA 4OMYA 3JTGA 3V8KA 4XSZF 4MTDA 3BOQA 4IRIA 4EV0A 3I53A 3KZYA 4KN4X 2FF4A 1D3YA 1E2XA 2A6EF 3QU6A 1G3SA 2K4BA 2KRFA 5D6FA 1XCVA 4XLNF 2F2EA 2STTA 4I09A 4ZZDA 3F22A 2F5FA 1IW7F 3KE2A 2DW4A 1KYZA 1YS6A 3PQKA 2EK5A 4EJTA 3GZ5A 2XVCA 4IRHA 1RI7A 4UVBA 1L3LA 4YFXF 4I98B 3KP5A 1EH7A 1QQIA 2DI3A 1LQ1A 3ISPA 2HQRA 2W85A 3LA2A 5E18F 3WTSC 2YPRA 1LB2A 4P9FA 3GW2A 1IRGA 3REOA 1G3TA 2CG4A 2STWA 2GQQA 2FU4A 4LLLA 5K1YA 2PI0A 2HZTA 5DD4A 1KQ8A 1ZG3A 2GWRA 1USTA 2CW0F 2ADUA 2EFWA 4BNCA 2KKOA 5JR3A 2V1XA 3LAPA 2F5CA 1XSVA 1P4AA 2Z3YA 3H3ZA 5FFXA 3N4MA 4O3MA 3E5QA 1DDNA 1J2XA 4LGWA 4EJWA 5DDGA 1HKSA 1DPRA 2UWMA 3RI4A 1G3YA 3E5UA 1UHMA 1HXDA 2GAUA 1PUEE 4WWCA 4KYWA 5IT3A 3TOBA 2KJCA 4U7DA 2VBWA 1ON2A 2ZMEB 2D1HA 4G7ZF 1T0FA 3D0SA 3ECHA 4AVPA 2VBXA 1JGSA 2AS5F 1F1ZA 2EFNA 3QOPA 4ESFA 2XROA 3L7WA 2Z33A 3HYIA 4I02A 4IPAA 4ZYEA 1XDUA 3DFGA 2ZMEA 1O7LA 2H6CA 3FWEA 2P5LC 5D5WB 2GIVA 3RDIA 3HSFA 2EV0A 3HSRA 5E17F 1S7AA 3WE3A 4RS8A 5BS6A 2WV0A 3H92A 4HX8A 1R36A 1U78A 4EJUA 3F6VA 3U9GA 3AAFA 4ENKA 3G73A 3RTRA 1MJ9A 4IXAA 4B09A 1YG2A 1ZN2A 4U0WA 4HF1A 1S8NA 2A61A 2FE3A 2FBIA 3I5UA 1BI1A 2MLKA 2K7LA 4HBLA 2CSOA 4LB5A 5DD8A 4YFKF 5HS7A 3ERED 1R7JA 2G9WA 4Q47A 3F23A 2HKOA 5F1RA 4WXDA 2A68F 2HR3A 3EYIA 3P9IA 1FP2A 4LJZF 5LEJA 4IHTA 1IN6A 2DPUA 4L5IA 1CGPA 5CLSA 3KP7A 2FQ3A 4Y13A 2DBBA 2NYXA 4A5NA 2L02A 3J81K 4QLCU 1IUYA 3F8BA 3HSEA 3SQNA 2VONA 3RKWA 1J75A 4KIGA 3T8RA 5D5VB 1HSTA 2RDPA 5HS8A 4ON0A 3HRUA 3T5XA 1I27A 4MGRA 1PDNC 2JPBA 3CLOA 4ZYDA 2R7DA 3JSPA 3NEUA 4CYDA 2NAZA 1WQ2A 3HRSA 1TNTA 4A6EA 2R3SA 2ACJA 3FM3A 4HF0A 3P9CA 4FT8A 5D6EA 1HW1A 1RIOH 3R4KA 1W5SA 3KLOA 1EV7A 4KICA 2H94A 4AIHA 2DFIA 2XAJA 1KGSA 4KUMA 3FHZA 3B02A 2L4MA 3I0TA 1XD7A 4OIPF 4Q5SF 2FSWA 4AWXB 3WTTC 3ROUA 3LAJA 1ZRCA 3I54A 1USSA 3GFIA 3ABTA 2KJBA 3JAMZ 3D5LA 4JBAA 1RUOA 3N97A 3F8FA 2MLGA 2BV6A 1U3EM 3DP7A 3ZQ7A 5JFRA 3R6SA 3VODA 2IA0A 4M9XA 1G4DA 3L00A 1STZA 2IT0A 2XIGA 5L3DA 4Q48A 4G94A 3F8NA 4WK8F 1HBXG 1IF1A 4L9TA 2XRNA 3VB2A 3QPHA 2ISYA 3V8LA 3RYPA 1H0MA 1OYIA 3BPXA 3ZMUA 1KA8A 2QQAA 3WGGA 1KU3A 2O3FA 1CF7A 3K1NA 4OIQF 4PDKA 2XHKA 4P5OA 3FX3A 3E6DA 3FXRA 1PP7U 4JQFA 5AIPA 2DQLA 3GLXA 1HW5A 3K0LA 2DAOA 1WI9A 1YLFA 1G6NA 5H6QA 1XCBA 5EEHA 3GX4X 4QWQA 5F64A 4EMSA 3BJOA 3HOTA 2FOKA 1V4RA 4U88A 5E20A 5LHGA 1K78B 2FRHA 2W24A 3WGIA 3DV8A 1FLIA 5IT9Z 3J80K 3QU3A 3F8CA 3FF5A 1TLHB 1TW3A 5A2QK 1ON1A 2PLYA 4WXHA 5DUKA 4WX9A 4RB2C 1K78A 5J8FA 3C1DA 3K1PA 2JZYA 2X0LA 4M6XA 1BN5A 2W25A 4HX7A 1QZYA 1I1GA 4UV8A 1YTYA 1I1SA 1ULYA 3B73A 4HA8A 1ZGAA 1UFMA 4RB3C 1OPCA 3GWZA 1FBSA 3BP8A 1ZAOA 4PCQA 2V79A 1RNLA 4XBFA 3V4GA 4M9SA 2QBYB 4P9UA 3E3VA 3LA7A 2PQ8A 2NNNA 2KIUA 3ZMDA 1J5YA 1TQMA 3TKYA 3IL2A 5CVRA 1UB9A 3CDHA 2EFQA 2HYGD 2XASA 2FNPA 2DLLA 3TQNA 1HSJA 3S2WA 1K7AA 4A6DA 4RGRA 5BOXA 5LEKA 5L3FA 4M74A 4RB1A 1A04A 3JTHA 2IP2A 2XUBA 1JHFA 3VEPA 5H6RA 2VE8A 2NS0A 3HRMA 1OMIA 3CTAA 3V7SA 1U5TB 2HTJA 3HHGA 1RUNA 3R0JA 1XGNA 3F21A 3JSOA 5CVUA 4ENNA 2MD5A 3GFMA 1E17A 1FYMA 1ZH5A 2YX7A 5ERIA 1R1UA 4EM2A 4HAMA 1IXCA 4MHGA 1U5TA 4M73A 1KU2A 2HKXA 5K5OA 3L9FA 5CVIA 2Y75A 1O3RA 3ZN0A 3QRFF 4L9VA 4OU0A 4M9ZA 4A0ZA 2XAGA 1J9IA 1KQ9A 1MKMA 3WU1B 4KMUX 2JSCA 3O2PE 2DU9A 5BMZA 3U2RA 5K5QA 4GXOA 3F6OA 2A5YB 2A3SA 2UZKA 5D5UB 3FMSA 3WU0A 2CO5A 3GYHX 2HYFA 1SMTA 4P55A 1P4XA 1I6XA 3DPLC 1MJAA 3NRVA 1FP1D 1DUXC 3GO5A 4KIFA 1DP7P 2HQNA 3C18A 3HHHA 3ECOA 4RB0A 4M72A 1JE8A 4L9JA 2FMLA 3RPUA 5E1ZB 2UXXA 3WODF 1FC3A 3WTVC 3WGHA 3EDPA 3GFJA 2ESNA 2M30A 5LGNA 1XN7A 3EQLF 1FNNA 4U0VA 2GA1A 3KP4A 2C6YA 4UV9A 5ILSA 1GXQA 3FMQA 3E5XA 4LK0F 3DF8A 3MWMA 1S29A 1FSHA 3TO6A 2Q8KA 5D5XB 2P6TA 1MJBA 1BC8C 2OBPA 3KEOA 3GFLA 3FXQA 3RKXA 3QPTA 5J8CA 1B59A 1GHCA 3SZTA 1OYWA 1XSDA 4RAYA 3KCCA 1U6GA 5TRDA 4L18B 4WF2A 1T6SA 1KU7A 1QO0D 2LKPA 4BH9A 3QP5A 3BZ6A 2HDCA 5EEGA 1J59A 2ZNZA 1KU9A 2P5VA 3MZYA 4N0BA 2UXNA 3V7RA 1BI0A 2MBFA 4G7HF 1Z7UA 4HV6A 4LB6B 4OINF 3GZ6A 4LLGF 3TOAA 4B8XA 4RGXA 5LGTA 2K02A 3M9AA 5ICFA 1W4MA 2XAQA 2EV5A 2QZ8A 1HKQA 1BM9A 2EFOA 2IPQX 2O8XA 4G7OF 2MH2A 1YS7A 5HLHA 4CHUA 2D45A 1YYVA 4FX0A 3KP6A 1QPMA 1YW7A 5JVTA 4KNYA 4LLNA 2J5OA 1IRFA 1KYWA 3CUQC 1EH6A 5E8IA 2PBIA 1SD4A 5DV5A 2HWVA 2V1UA 1O3QA 3IRQA 1QBJA 4EVIA 3VFZA 4LG0B 2QLZA 5HDKA 4HDVA 3TO9A 1HQCA 3RPQA 1JXSA 1R22A 1BI3A 5HLIA 1R5HA 2PJPA 2IJLA 3E6BA 3ZMZA 2XKOA 4LG0A 3K69A 2OAZA 1W7PA 3H3UA 3CO7C 3FZVA 5FLXK 2FMYA 2KIFA 1TW2A 4ZYHA 5HOOA 4BQAA 5DUIA 2DQRA 4R1HA 1XGMA 1YW9A 1AWCA 1LNWA 2FXAA 1FT9A 4BHPA 3Q9SA 1G3WA 4R79A 2EV6A 2BEOA 1T2KA 1YQAA 1OYYA 3IKVA 5F6FA 1ZHFA 1P92A 1BJAA 1JHHA 4CO8A 2O6GE 2LNBA 2K4JA 1P2FA 2DK5A 2HEOA 2AXLA 1TTYA 4MTEA 5FO5A 2H27A 2K27A 1FBUA 2O0YA 2R7FA 1DPUA 4UHTA 5ILUA 2ZNYA 1FY7A 2WTEA 1IN5A 2OZUA 1P4WA 2RGVA 1T38A 2DO7A 2VBZA 4LD5A 1SD6A 1ZG5A 3CUQA 1XGOA 1LDDA 4AIKA 3KP3A 4A2UA 4CXFA 1S6LA 5ICCA 3PQJA 1LEAA 1BBYA 4GGGA 4ZH4F 5JI6A 3FMRA 1OKRA 5J6XA 3R60A 2QQ9A 2VT2A 4I01A 1CF7B 3HTUA 4BXUA 3LSTA 2PG4A 1ODDA 4EGYA 2L3DA 4N9HA 4TV7A 2QYOA 4CICA 2IA1A 3ZMSA 2RC4A 3F8MA 2P6SA 4KT5C 2L01A 3DEUA 1TQIA 1HW2A 4UUVA 4HLXA 3LQRA 2ZKZA 2E1NA 3O6BB 3J81Z 3ULQB 4ETSA 3HIFA 1C0WA 1W5TA 2W57A 5HDGA 4ASNA 1R1VA 3V7CA 3F3XA 4GYGA 4A0YA 4RAZA 1K6OA 1B1BA 4UNOA 3MFKA 1H9GA 2ZFWA 3RIRA 4LMYA 2TDXA 4Q4ZF 3BY6A 3IWZA 1S3JA 2QQBA 4OIRF 2P7CB 4BHCA 2EFPA 2VOPA 4MNUA 2G7UA 4S04A 1MGTA 3HTSB 1ZREA 5LGUA 5AIQA 4IJAA 1RZ4A 2LSOA 2P8TA 4BYYA 2QM3A 2EB7A 2RQPA 2CGPA 1EH8A 1LDKB 3RKYA 5E1XA 2WC2A 4EM0B 3HUGA 4OOIA 1FWZA 1B9NA 3K2ZA 5L3CA 4L0YB 4BAYA 5JHUA 5D8LB 2GXBA 2F5EA 4A12A 4M71A 1R1TA 3IKTA 2YX4A 3KETA 5HVQC 2CFXA 4K2EA 5LHIA 3M7GA 3F72A 3DKWA 4ESJA 5D8KB 2RV8A 2A6HF 3R0AA 2XAHA 4U0YA 3PFIA 4UVCA 2VC0A 2M1BA 4BHBA 2VXZA 5KVRA 3WTWC 1YW8A 2PMHA 4XLPF 3BROA 4YIIA 2FNAA 2JRTA 5CVJA 3SFZA 3I58A 3ML6A 1AOYA 3EYYA 2QUFA 3BJ6A 2Y48A 3M1EA 2YSRA 4KDPA 3IC7A 4L5JA 4GCVA 5LLQA 2XV4S 2FA5A 1ZG1A 2O61A 2DTRA 1R5GA 2DT5A 1REPC 1MDMB 4G6DA 1QNTA 4Z2YA 4F7ZA 1SD7A 1SMYF 2QVOA 2OZ6A 4KN7X 2LF8A 2PMUA 1IAWA 2P4WA 4IVNA 4ZZLA 3Q5FA 2MH9A 2OA4A 5DCMB 1T98A 1MDMA 1F5TA 3KLNA 4A5MA 3KZZA 2BGCA 1FZPB 3JW4A 3J80Z 3EETA 1YO5C 1FYKA 3L2CA 1XDSA 4L9NA 5A2QZ 4A0XA 5DCMA 2HS5A 1WSUA 2F5DA 2V9VA 1TNSA 1HKTA 3SZPA 3Q9VA 2BE5F 5L3BA 2IW5A 5FD5A 2EJRA 4MQVA 2E7WA 1P6RA 3M8EA 1Z91A 3OV8A 5BQTA 2H09A 1XGSA 2H6BA 4RGSA 4MEXF 3DQVC 2VC1A 3W6KB 1LVAA 2CQKA 2QWWA 1ZLKA 4HW0A 3T8TA 4HDUA 2LDUA 4I2OA 1V3FA 2CWEA 2M5WA 5BPIA 4KMFA 3DXJF 3ZPLA 5BPDA 1Y0UA 2M87A 2BYVE 2L54A 1TQPA 2RKHA 4KIBA 2M45A 4KFCA 4DQ2A 4IHSA 2COMA 3IRRA 1XB4A 5HS9A 2VODA 1MD0A 3GXOA 1BOAA 5ICGA 4Y15A 4I0BA 2BBYA 5E1WA 3KEQA 1T39A 5LBQA 1ZRDA 2V1DA 2RNJA 1O7FA 2PEXA 4OIOF 4OMZA 2RVCA 5ED4A 4HLYA 1ZYRF 1ZGJA 1BIAA 3HRTA 1F4KA 2LF7A 1IZ1A 4PGGA 5KK1A 5LHHA 2VBYA 2D2WA 1R58A 2O03A 3NQOA 1ZRFA 4D0PA 1Z05A 4CZZA 2E7XA 3MAJA 1WKMA 4R8HA 5K5RA 2NNYA 1FOKA 3QAHA 4CGZA 2X4HA 1ZARA 3JAMK 2Q2EA 3RJPA 4EQQA 1WWXA 4Y17A 2A07F 3J7AO 1FYLA 3KFWX 3CUOA 1GXPA 3TO7A 5H20A 5L3GA 4LK1F 3IHUA 4EGZA 1IXSB 2ISZA 4HV5A 4JK1X 4PZJA 3TDZC 4AD9A 1NHAA 1W7PB 3RYRA 1Q1HA 4NHJA 3WE2A 1WRJA 2V6CA 2D1VA 1MZBA 4UXNA 2ELHA 1IN8A 1B6AA 5E8GA 4E70A 3QP6A 5LRRA 2IRFG 2A69F 4G9YA 2ESHA 1Z1DA 4KA4A 5CYVA 1VTNC 1U2WA 1I5ZA 4ENMA 3WG9A 2GA2A 4EJVA 3I4PA 4EM1A 6PAXA 3WTYC 2XGXA 2WWYA 1FBQA 3TGNA 2YU3A 3LFKA 3LWFA 2J5PA 4NQWA 1IN4A 3G3ZA 4HX4A 5IT9K 2HTSA 2VT3A 1O3TA 3ABUA 2ZCWA 2OU2A 3BJAA 3CJNA 3KP2A 3I59B 3P9KA 2VE9A 3ZMTA 3HOSA 3E97A 1D5VA 4PGHA 2XKPA 1R23A 1GVJA 3M8FA 2FBHA 2VOOA 4HQMA 1OR7A 1IN7A 3LQQA 3I59A 1L0OC 5DYMA 5HLGA 1TBXA 3CUQB 3O3KA 1KQ0A 1F9NA 2JPCA 4I0AA 3VOEA 2W84A 1SAXA 3ZMVA 3ZN1A 2IVMA 5AONA 1QGPA 4ESBA 2E1CA 4XSXF 4DNCA 4I7HA 3E6CC 2CYYA 3C7JA 3MEXA 1B4AA 2GXGA 3GUDA 3BDDA 3IWFA 3OOPA 5HDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD5 A;  2EWN A;  4YFN F;  4MEY F;  2NRA C;  4O5V A;  2IA2 A;  5LRS A;  3T1B A;  1ONV A;  2ZXJ A;  5CVV A;  1H9T A;  2FBK A;  3MQ0 A;  1Z6R A;  2B0L A;  2XAF A;  3FXU A;  1SFE A;  2JTV A;  2EA4 A;  3V8J A;  1XSX A;  2G7H A;  3ZP5 A;  1LEB A;  1Z6T A;  2HGC A;  4AIJ A;  2RN7 A;  4HOB A;  2HFH A;  1ZLJ A;  3K9T A;  2DK8 A;  1O3S A;  5FFZ A;  1XMK A;  5DEQ A;  1W7P D;  4WCG A;  2EA2 A;  1UCR A;  2M8E A;  3TDU C;  1J0R A;  5FLX Z;  2OD5 A;  4CDG A;  1R00 A;  1IXR C;  2P7V B;  3CO6 C;  4IRG A;  1PP8 F;  1D8J A;  5ILV A;  3WTZ A;  1S7O A;  5FGM A;  3I71 A;  1B9M A;  4G6Q A;  3WTX C;  1FSE A;  4FHT A;  4IF4 A;  4L0Z B;  2PN6 A;  1U5T C;  4H0E A;  1O57 A;  2ZBK A;  4EJO A;  1YIO A;  1U8R A;  2Q0O A;  1QZZ A;  2Y0M A;  2MC3 A;  4NB5 A;  3I64 A;  2ETH A;  2ZO4 A;  4ZYG A;  2YR2 A;  4GYI A;  3SXY A;  4YG2 F;  1SFU A;  2PFB A;  3C3W A;  5CJ9 A;  4O6J A;  4FX4 A;  1D8K A;  4HZF A;  4UVA A;  3EUH A;  5ICE A;  3U1D A;  4U7B A;  3BWG A;  4P96 A;  5DCF A;  4HF2 A;  2OQG A;  1UHW A;  2GZW A;  1X3U A;  3BPV A;  1YFH A;  5TJJ A;  3MZH A;  2QEN A;  3WTU C;  5L3E A;  3LA3 A;  3GEZ A;  2KIM A;  1XMA A;  2Z99 A;  2HOE A;  3T0Y A;  4ENJ A;  4S05 A;  1LJ9 A;  3P7N A;  1BI2 A;  2JT1 A;  5FD6 A;  4G8X A;  3R61 A;  1LDJ A;  2ZJ2 A;  4XRF A;  3K1M A;  2OQR A;  2QBY A;  2DPD A;  5D4S A;  2VN2 A;  1J7K A;  3W6J B;  2Z9O A;  2K86 A;  3GVA A;  4YIF A;  2P5K A;  2Z5U A;  3L09 A;  1FX7 A;  3ELK A;  5D4R A;  1FPQ A;  2MA3 A;  1SFX A;  3E6M A;  4N9I A;  3DPT A;  3COA C;  2L4A A;  4HYE A;  4RGU A;  3GF2 A;  4M6Y A;  4HQE A;  1K79 A;  3FM5 A;  4LFU A;  4WXC A;  2FEZ A;  1BC7 C;  3MCZ A;  4GO1 A;  3SHF A;  4MQ9 F;  1BIB A;  5FB2 A;  1Z9C A;  4OMY A;  3JTG A;  3V8K A;  4XSZ F;  4MTD A;  3BOQ A;  4IRI A;  4EV0 A;  3I53 A;  3KZY A;  4KN4 X;  2FF4 A;  1D3Y A;  1E2X A;  2A6E F;  3QU6 A;  1G3S A;  2K4B A;  2KRF A;  5D6F A;  1XCV A;  4XLN F;  2F2E A;  2STT A;  4I09 A;  4ZZD A;  3F22 A;  2F5F A;  1IW7 F;  3KE2 A;  2DW4 A;  1KYZ A;  1YS6 A;  3PQK A;  2EK5 A;  4EJT A;  3GZ5 A;  2XVC A;  4IRH A;  1RI7 A;  4UVB A;  1L3L A;  4YFX F;  4I98 B;  3KP5 A;  1EH7 A;  1QQI A;  2DI3 A;  1LQ1 A;  3ISP A;  2HQR A;  2W85 A;  3LA2 A;  5E18 F;  3WTS C;  2YPR A;  1LB2 A;  4P9F A;  3GW2 A;  1IRG A;  3REO A;  1G3T A;  2CG4 A;  2STW A;  2GQQ A;  2FU4 A;  4LLL A;  5K1Y A;  2PI0 A;  2HZT A;  5DD4 A;  1KQ8 A;  1ZG3 A;  2GWR A;  1UST A;  2CW0 F;  2ADU A;  2EFW A;  4BNC A;  2KKO A;  5JR3 A;  2V1X A;  3LAP A;  2F5C A;  1XSV A;  1P4A A;  2Z3Y A;  3H3Z A;  5FFX A;  3N4M A;  4O3M A;  3E5Q A;  1DDN A;  1J2X A;  4LGW A;  4EJW A;  5DDG A;  1HKS A;  1DPR A;  2UWM A;  3RI4 A;  1G3Y A;  3E5U A;  1UHM A;  1HXD A;  2GAU A;  1PUE E;  4WWC A;  4KYW A;  5IT3 A;  3TOB A;  2KJC A;  4U7D A;  2VBW A;  1ON2 A;  2ZME B;  2D1H A;  4G7Z F;  1T0F A;  3D0S A;  3ECH A;  4AVP A;  2VBX A;  1JGS A;  2AS5 F;  1F1Z A;  2EFN A;  3QOP A;  4ESF A;  2XRO A;  3L7W A;  2Z33 A;  3HYI A;  4I02 A;  4IPA A;  4ZYE A;  1XDU A;  3DFG A;  2ZME A;  1O7L A;  2H6C A;  3FWE A;  2P5L C;  5D5W B;  2GIV A;  3RDI A;  3HSF A;  2EV0 A;  3HSR A;  5E17 F;  1S7A A;  3WE3 A;  4RS8 A;  5BS6 A;  2WV0 A;  3H92 A;  4HX8 A;  1R36 A;  1U78 A;  4EJU A;  3F6V A;  3U9G A;  3AAF A;  4ENK A;  3G73 A;  3RTR A;  1MJ9 A;  4IXA A;  4B09 A;  1YG2 A;  1ZN2 A;  4U0W A;  4HF1 A;  1S8N A;  2A61 A;  2FE3 A;  2FBI A;  3I5U A;  1BI1 A;  2MLK A;  2K7L A;  4HBL A;  2CSO A;  4LB5 A;  5DD8 A;  4YFK F;  5HS7 A;  3ERE D;  1R7J A;  2G9W A;  4Q47 A;  3F23 A;  2HKO A;  5F1R A;  4WXD A;  2A68 F;  2HR3 A;  3EYI A;  3P9I A;  1FP2 A;  4LJZ F;  5LEJ A;  4IHT A;  1IN6 A;  2DPU A;  4L5I A;  1CGP A;  5CLS A;  3KP7 A;  2FQ3 A;  4Y13 A;  2DBB A;  2NYX A;  4A5N A;  2L02 A;  3J81 K;  4QLC U;  1IUY A;  3F8B A;  3HSE A;  3SQN A;  2VON A;  3RKW A;  1J75 A;  4KIG A;  3T8R A;  5D5V B;  1HST A;  2RDP A;  5HS8 A;  4ON0 A;  3HRU A;  3T5X A;  1I27 A;  4MGR A;  1PDN C;  2JPB A;  3CLO A;  4ZYD A;  2R7D A;  3JSP A;  3NEU A;  4CYD A;  2NAZ A;  1WQ2 A;  3HRS A;  1TNT A;  4A6E A;  2R3S A;  2ACJ A;  3FM3 A;  4HF0 A;  3P9C A;  4FT8 A;  5D6E A;  1HW1 A;  1RIO H;  3R4K A;  1W5S A;  3KLO A;  1EV7 A;  4KIC A;  2H94 A;  4AIH A;  2DFI A;  2XAJ A;  1KGS A;  4KUM A;  3FHZ A;  3B02 A;  2L4M A;  3I0T A;  1XD7 A;  4OIP F;  4Q5S F;  2FSW A;  4AWX B;  3WTT C;  3ROU A;  3LAJ A;  1ZRC A;  3I54 A;  1USS A;  3GFI A;  3ABT A;  2KJB A;  3JAM Z;  3D5L A;  4JBA A;  1RUO A;  3N97 A;  3F8F A;  2MLG A;  2BV6 A;  1U3E M;  3DP7 A;  3ZQ7 A;  5JFR A;  3R6S A;  3VOD A;  2IA0 A;  4M9X A;  1G4D A;  3L00 A;  1STZ A;  2IT0 A;  2XIG A;  5L3D A;  4Q48 A;  4G94 A;  3F8N A;  4WK8 F;  1HBX G;  1IF1 A;  4L9T A;  2XRN A;  3VB2 A;  3QPH A;  2ISY A;  3V8L A;  3RYP A;  1H0M A;  1OYI A;  3BPX A;  3ZMU A;  1KA8 A;  2QQA A;  3WGG A;  1KU3 A;  2O3F A;  1CF7 A;  3K1N A;  4OIQ F;  4PDK A;  2XHK A;  4P5O A;  3FX3 A;  3E6D A;  3FXR A;  1PP7 U;  4JQF A;  5AIP A;  2DQL A;  3GLX A;  1HW5 A;  3K0L A;  2DAO A;  1WI9 A;  1YLF A;  1G6N A;  5H6Q A;  1XCB A;  5EEH A;  3GX4 X;  4QWQ A;  5F64 A;  4EMS A;  3BJO A;  3HOT A;  2FOK A;  1V4R A;  4U88 A;  5E20 A;  5LHG A;  1K78 B;  2FRH A;  2W24 A;  3WGI A;  3DV8 A;  1FLI A;  5IT9 Z;  3J80 K;  3QU3 A;  3F8C A;  3FF5 A;  1TLH B;  1TW3 A;  5A2Q K;  1ON1 A;  2PLY A;  4WXH A;  5DUK A;  4WX9 A;  4RB2 C;  1K78 A;  5J8F A;  3C1D A;  3K1P A;  2JZY A;  2X0L A;  4M6X A;  1BN5 A;  2W25 A;  4HX7 A;  1QZY A;  1I1G A;  4UV8 A;  1YTY A;  1I1S A;  1ULY A;  3B73 A;  4HA8 A;  1ZGA A;  1UFM A;  4RB3 C;  1OPC A;  3GWZ A;  1FBS A;  3BP8 A;  1ZAO A;  4PCQ A;  2V79 A;  1RNL A;  4XBF A;  3V4G A;  4M9S A;  2QBY B;  4P9U A;  3E3V A;  3LA7 A;  2PQ8 A;  2NNN A;  2KIU A;  3ZMD A;  1J5Y A;  1TQM A;  3TKY A;  3IL2 A;  5CVR A;  1UB9 A;  3CDH A;  2EFQ A;  2HYG D;  2XAS A;  2FNP A;  2DLL A;  3TQN A;  1HSJ A;  3S2W A;  1K7A A;  4A6D A;  4RGR A;  5BOX A;  5LEK A;  5L3F A;  4M74 A;  4RB1 A;  1A04 A;  3JTH A;  2IP2 A;  2XUB A;  1JHF A;  3VEP A;  5H6R A;  2VE8 A;  2NS0 A;  3HRM A;  1OMI A;  3CTA A;  3V7S A;  1U5T B;  2HTJ A;  3HHG A;  1RUN A;  3R0J A;  1XGN A;  3F21 A;  3JSO A;  5CVU A;  4ENN A;  2MD5 A;  3GFM A;  1E17 A;  1FYM A;  1ZH5 A;  2YX7 A;  5ERI A;  1R1U A;  4EM2 A;  4HAM A;  1IXC A;  4MHG A;  1U5T A;  4M73 A;  1KU2 A;  2HKX A;  5K5O A;  3L9F A;  5CVI A;  2Y75 A;  1O3R A;  3ZN0 A;  3QRF F;  4L9V A;  4OU0 A;  4M9Z A;  4A0Z A;  2XAG A;  1J9I A;  1KQ9 A;  1MKM A;  3WU1 B;  4KMU X;  2JSC A;  3O2P E;  2DU9 A;  5BMZ A;  3U2R A;  5K5Q A;  4GXO A;  3F6O A;  2A5Y B;  2A3S A;  2UZK A;  5D5U B;  3FMS A;  3WU0 A;  2CO5 A;  3GYH X;  2HYF A;  1SMT A;  4P55 A;  1P4X A;  1I6X A;  3DPL C;  1MJA A;  3NRV A;  1FP1 D;  1DUX C;  3GO5 A;  4KIF A;  1DP7 P;  2HQN A;  3C18 A;  3HHH A;  3ECO A;  4RB0 A;  4M72 A;  1JE8 A;  4L9J A;  2FML A;  3RPU A;  5E1Z B;  2UXX A;  3WOD F;  1FC3 A;  3WTV C;  3WGH A;  3EDP A;  3GFJ A;  2ESN A;  2M30 A;  5LGN A;  1XN7 A;  3EQL F;  1FNN A;  4U0V A;  2GA1 A;  3KP4 A;  2C6Y A;  4UV9 A;  5ILS A;  1GXQ A;  3FMQ A;  3E5X A;  4LK0 F;  3DF8 A;  3MWM A;  1S29 A;  1FSH A;  3TO6 A;  2Q8K A;  5D5X B;  2P6T A;  1MJB A;  1BC8 C;  2OBP A;  3KEO A;  3GFL A;  3FXQ A;  3RKX A;  3QPT A;  5J8C A;  1B59 A;  1GHC A;  3SZT A;  1OYW A;  1XSD A;  4RAY A;  3KCC A;  1U6G A;  5TRD A;  4L18 B;  4WF2 A;  1T6S A;  1KU7 A;  1QO0 D;  2LKP A;  4BH9 A;  3QP5 A;  3BZ6 A;  2HDC A;  5EEG A;  1J59 A;  2ZNZ A;  1KU9 A;  2P5V A;  3MZY A;  4N0B A;  2UXN A;  3V7R A;  1BI0 A;  2MBF A;  4G7H F;  1Z7U A;  4HV6 A;  4LB6 B;  4OIN F;  3GZ6 A;  4LLG F;  3TOA A;  4B8X A;  4RGX A;  5LGT A;  2K02 A;  3M9A A;  5ICF A;  1W4M A;  2XAQ A;  2EV5 A;  2QZ8 A;  1HKQ A;  1BM9 A;  2EFO A;  2IPQ X;  2O8X A;  4G7O F;  2MH2 A;  1YS7 A;  5HLH A;  4CHU A;  2D45 A;  1YYV A;  4FX0 A;  3KP6 A;  1QPM A;  1YW7 A;  5JVT A;  4KNY A;  4LLN A;  2J5O A;  1IRF A;  1KYW A;  3CUQ C;  1EH6 A;  5E8I A;  2PBI A;  1SD4 A;  5DV5 A;  2HWV A;  2V1U A;  1O3Q A;  3IRQ A;  1QBJ A;  4EVI A;  3VFZ A;  4LG0 B;  2QLZ A;  5HDK A;  4HDV A;  3TO9 A;  1HQC A;  3RPQ A;  1JXS A;  1R22 A;  1BI3 A;  5HLI A;  1R5H A;  2PJP A;  2IJL A;  3E6B A;  3ZMZ A;  2XKO A;  4LG0 A;  3K69 A;  2OAZ A;  1W7P A;  3H3U A;  3CO7 C;  3FZV A;  5FLX K;  2FMY A;  2KIF A;  1TW2 A;  4ZYH A;  5HOO A;  4BQA A;  5DUI A;  2DQR A;  4R1H A;  1XGM A;  1YW9 A;  1AWC A;  1LNW A;  2FXA A;  1FT9 A;  4BHP A;  3Q9S A;  1G3W A;  4R79 A;  2EV6 A;  2BEO A;  1T2K A;  1YQA A;  1OYY A;  3IKV A;  5F6F A;  1ZHF A;  1P92 A;  1BJA A;  1JHH A;  4CO8 A;  2O6G E;  2LNB A;  2K4J A;  1P2F A;  2DK5 A;  2HEO A;  2AXL A;  1TTY A;  4MTE A;  5FO5 A;  2H27 A;  2K27 A;  1FBU A;  2O0Y A;  2R7F A;  1DPU A;  4UHT A;  5ILU A;  2ZNY A;  1FY7 A;  2WTE A;  1IN5 A;  2OZU A;  1P4W A;  2RGV A;  1T38 A;  2DO7 A;  2VBZ A;  4LD5 A;  1SD6 A;  1ZG5 A;  3CUQ A;  1XGO A;  1LDD A;  4AIK A;  3KP3 A;  4A2U A;  4CXF A;  1S6L A;  5ICC A;  3PQJ A;  1LEA A;  1BBY A;  4GGG A;  4ZH4 F;  5JI6 A;  3FMR A;  1OKR A;  5J6X A;  3R60 A;  2QQ9 A;  2VT2 A;  4I01 A;  1CF7 B;  3HTU A;  4BXU A;  3LST A;  2PG4 A;  1ODD A;  4EGY A;  2L3D A;  4N9H A;  4TV7 A;  2QYO A;  4CIC A;  2IA1 A;  3ZMS A;  2RC4 A;  3F8M A;  2P6S A;  4KT5 C;  2L01 A;  3DEU A;  1TQI A;  1HW2 A;  4UUV A;  4HLX A;  3LQR A;  2ZKZ A;  2E1N A;  3O6B B;  3J81 Z;  3ULQ B;  4ETS A;  3HIF A;  1C0W A;  1W5T A;  2W57 A;  5HDG A;  4ASN A;  1R1V A;  3V7C A;  3F3X A;  4GYG A;  4A0Y A;  4RAZ A;  1K6O A;  1B1B A;  4UNO A;  3MFK A;  1H9G A;  2ZFW A;  3RIR A;  4LMY A;  2TDX A;  4Q4Z F;  3BY6 A;  3IWZ A;  1S3J A;  2QQB A;  4OIR F;  2P7C B;  4BHC A;  2EFP A;  2VOP A;  4MNU A;  2G7U A;  4S04 A;  1MGT A;  3HTS B;  1ZRE A;  5LGU A;  5AIQ A;  4IJA A;  1RZ4 A;  2LSO A;  2P8T A;  4BYY A;  2QM3 A;  2EB7 A;  2RQP A;  2CGP A;  1EH8 A;  1LDK B;  3RKY A;  5E1X A;  2WC2 A;  4EM0 B;  3HUG A;  4OOI A;  1FWZ A;  1B9N A;  3K2Z A;  5L3C A;  4L0Y B;  4BAY A;  5JHU A;  5D8L B;  2GXB A;  2F5E A;  4A12 A;  4M71 A;  1R1T A;  3IKT A;  2YX4 A;  3KET A;  5HVQ C;  2CFX A;  4K2E A;  5LHI A;  3M7G A;  3F72 A;  3DKW A;  4ESJ A;  5D8K B;  2RV8 A;  2A6H F;  3R0A A;  2XAH A;  4U0Y A;  3PFI A;  4UVC A;  2VC0 A;  2M1B A;  4BHB A;  2VXZ A;  5KVR A;  3WTW C;  1YW8 A;  2PMH A;  4XLP F;  3BRO A;  4YII A;  2FNA A;  2JRT A;  5CVJ A;  3SFZ A;  3I58 A;  3ML6 A;  1AOY A;  3EYY A;  2QUF A;  3BJ6 A;  2Y48 A;  3M1E A;  2YSR A;  4KDP A;  3IC7 A;  4L5J A;  4GCV A;  5LLQ A;  2XV4 S;  2FA5 A;  1ZG1 A;  2O61 A;  2DTR A;  1R5G A;  2DT5 A;  1REP C;  1MDM B;  4G6D A;  1QNT A;  4Z2Y A;  4F7Z A;  1SD7 A;  1SMY F;  2QVO A;  2OZ6 A;  4KN7 X;  2LF8 A;  2PMU A;  1IAW A;  2P4W A;  4IVN A;  4ZZL A;  3Q5F A;  2MH9 A;  2OA4 A;  5DCM B;  1T98 A;  1MDM A;  1F5T A;  3KLN A;  4A5M A;  3KZZ A;  2BGC A;  1FZP B;  3JW4 A;  3J80 Z;  3EET A;  1YO5 C;  1FYK A;  3L2C A;  1XDS A;  4L9N A;  5A2Q Z;  4A0X A;  5DCM A;  2HS5 A;  1WSU A;  2F5D A;  2V9V A;  1TNS A;  1HKT A;  3SZP A;  3Q9V A;  2BE5 F;  5L3B A;  2IW5 A;  5FD5 A;  2EJR A;  4MQV A;  2E7W A;  1P6R A;  3M8E A;  1Z91 A;  3OV8 A;  5BQT A;  2H09 A;  1XGS A;  2H6B A;  4RGS A;  4MEX F;  3DQV C;  2VC1 A;  3W6K B;  1LVA A;  2CQK A;  2QWW A;  1ZLK A;  4HW0 A;  3T8T A;  4HDU A;  2LDU A;  4I2O A;  1V3F A;  2CWE A;  2M5W A;  5BPI A;  4KMF A;  3DXJ F;  3ZPL A;  5BPD A;  1Y0U A;  2M87 A;  2BYV E;  2L54 A;  1TQP A;  2RKH A;  4KIB A;  2M45 A;  4KFC A;  4DQ2 A;  4IHS A;  2COM A;  3IRR A;  1XB4 A;  5HS9 A;  2VOD A;  1MD0 A;  3GXO A;  1BOA A;  5ICG A;  4Y15 A;  4I0B A;  2BBY A;  5E1W A;  3KEQ A;  1T39 A;  5LBQ A;  1ZRD A;  2V1D A;  2RNJ A;  1O7F A;  2PEX A;  4OIO F;  4OMZ A;  2RVC A;  5ED4 A;  4HLY A;  1ZYR F;  1ZGJ A;  1BIA A;  3HRT A;  1F4K A;  2LF7 A;  1IZ1 A;  4PGG A;  5KK1 A;  5LHH A;  2VBY A;  2D2W A;  1R58 A;  2O03 A;  3NQO A;  1ZRF A;  4D0P A;  1Z05 A;  4CZZ A;  2E7X A;  3MAJ A;  1WKM A;  4R8H A;  5K5R A;  2NNY A;  1FOK A;  3QAH A;  4CGZ A;  2X4H A;  1ZAR A;  3JAM K;  2Q2E A;  3RJP A;  4EQQ A;  1WWX A;  4Y17 A;  2A07 F;  3J7A O;  1FYL A;  3KFW X;  3CUO A;  1GXP A;  3TO7 A;  5H20 A;  5L3G A;  4LK1 F;  3IHU A;  4EGZ A;  1IXS B;  2ISZ A;  4HV5 A;  4JK1 X;  4PZJ A;  3TDZ C;  4AD9 A;  1NHA A;  1W7P B;  3RYR A;  1Q1H A;  4NHJ A;  3WE2 A;  1WRJ A;  2V6C A;  2D1V A;  1MZB A;  4UXN A;  2ELH A;  1IN8 A;  1B6A A;  5E8G A;  4E70 A;  3QP6 A;  5LRR A;  2IRF G;  2A69 F;  4G9Y A;  2ESH A;  1Z1D A;  4KA4 A;  5CYV A;  1VTN C;  1U2W A;  1I5Z A;  4ENM A;  3WG9 A;  2GA2 A;  4EJV A;  3I4P A;  4EM1 A;  6PAX A;  3WTY C;  2XGX A;  2WWY A;  1FBQ A;  3TGN A;  2YU3 A;  3LFK A;  3LWF A;  2J5P A;  4NQW A;  1IN4 A;  3G3Z A;  4HX4 A;  5IT9 K;  2HTS A;  2VT3 A;  1O3T A;  3ABU A;  2ZCW A;  2OU2 A;  3BJA A;  3CJN A;  3KP2 A;  3I59 B;  3P9K A;  2VE9 A;  3ZMT A;  3HOS A;  3E97 A;  1D5V A;  4PGH A;  2XKP A;  1R23 A;  1GVJ A;  3M8F A;  2FBH A;  2VOO A;  4HQM A;  1OR7 A;  1IN7 A;  3LQQ A;  3I59 A;  1L0O C;  5DYM A;  5HLG A;  1TBX A;  3CUQ B;  3O3K A;  1KQ0 A;  1F9N A;  2JPC A;  4I0A A;  3VOE A;  2W84 A;  1SAX A;  3ZMV A;  3ZN1 A;  2IVM A;  5AON A;  1QGP A;  4ESB A;  2E1C A;  4XSX F;  4DNC A;  4I7H A;  3E6C C;  2CYY A;  3C7J A;  3MEX A;  1B4A A;  2GXG A;  3GUD A;  3BDD A;  3IWF A;  3OOP A;  5HDN A; 
#chains in the Genus database with same CATH topology
 3BTJ A;  1SD5 A;  4JYK A;  2EWN A;  4YFN F;  4MEY F;  2E5N A;  1UZC A;  1Z3X A;  4BE1 A;  4V19 K;  2NRA C;  4AU7 A;  4PFP A;  2KT0 A;  2IA2 A;  3GZN B;  3O8H A;  4O5V A;  2EIK H;  2IEK A;  5LRS A;  3T1B A;  4BXF A;  5K7Z A;  1ONV A;  2NOJ B;  2ZXJ A;  5CVV A;  2FBK A;  1H9T A;  3MQ0 A;  3ZQQ A;  2XGE A;  1Z6R A;  1I3A A;  2B0L A;  3S1M J;  2XAF A;  3FXU A;  1SFE A;  2JWT A;  2JTV A;  2EA4 A;  2QSH X;  4IX7 A;  3V8J A;  2O8K A;  1XSX A;  4BBS J;  1S5L C;  2G7H A;  4CA0 A;  1WFX A;  3HM5 A;  3ZP5 A;  1LEB A;  1Z6T A;  2HGC A;  4M3F A;  3PNV A;  2EZL A;  5IYC J;  4AIJ A;  2VJJ A;  2RN7 A;  4HOB A;  4DYR A;  1Q1V A;  3CCQ I;  2HFH A;  1ZLJ A;  3K9T A;  2L7K A;  2DK8 A;  4XQF A;  2GLO A;  3VSK A;  3KYC B;  5EGO B;  1O3S A;  5KCM A;  5FFZ A;  1XMK A;  5DEQ A;  1W7P D;  4WCG A;  2EA2 A;  4C30 A;  1UCR A;  4CCJ A;  2M8E A;  1YIJ I;  3TDU C;  1J0R A;  3HPG A;  5FLX Z;  2OD5 A;  2GOX B;  3OYF A;  1X4P A;  4CDG A;  1OIS A;  2L7F P;  4AC0 A;  3TW7 A;  1R00 A;  4A3C J;  1IXR C;  2BZT A;  4XRS A;  3M1C A;  1PVE A;  2P7V B;  3CO6 C;  4IRG A;  1PP8 F;  1X1P A;  1D8J A;  3H9Q A;  5ILV A;  3FXL A;  3WTZ A;  1MNE A;  2PJR A;  1S7O A;  5FGM A;  1JJ6 C;  4J19 A;  3HJE A;  3I71 A;  1I6H J;  1B9M A;  2MGQ A;  3K2A A;  5B66 C;  3SFI A;  1N78 A;  1Y8Q B;  2WY8 Q;  5EZH A;  4G6Q A;  3DTE A;  3WTX C;  1FSE A;  1WJB A;  4ZJZ A;  4FHT A;  4IF4 A;  4B3X A;  2PN6 A;  4L0Z B;  1JT6 A;  2DN0 A;  1U5T C;  1XS9 A;  4H0E A;  1O57 A;  2ZBK A;  5E3L A;  1IUF A;  3CCE I;  3FHN A;  4EJO A;  1YIO A;  1W36 D;  4Y7N J;  2CFO A;  1U8R A;  2Q0O A;  1QZZ A;  1A36 A;  2Y0M A;  2MC3 A;  4NB5 A;  3I64 A;  2R7X A;  2ETH A;  1I3Q J;  2K9Q A;  2ZO4 A;  2K3P A;  4ZYG A;  3CCM I;  4JX5 A;  2YR2 A;  3PFY A;  3BTC A;  4GYI A;  5IP6 A;  1XPX A;  3SXY A;  4YG2 F;  1SFU A;  4D5F A;  3L1P A;  3PSF A;  2PFB A;  3C3W A;  5CJ9 A;  4D5C A;  4ZDO A;  4O6J A;  4FX4 A;  1D8K A;  3CJR B;  4HZF A;  4UVA A;  4ITV A;  3QYB A;  4HRI A;  2MYS A;  3EUH A;  1E3O C;  1TT5 B;  5ICE A;  3HBL A;  3U1D A;  1TZL A;  1OCC H;  5E79 C;  2YU9 J;  4U7B A;  3SJM A;  3BWG A;  4P96 A;  5DCF A;  4B1R A;  1TWF J;  4HF2 A;  2OQG A;  5DM7 F;  1B8I B;  1UHW A;  2GZW A;  4CCN A;  4CCO A;  1X3U A;  3BPV A;  1ZQ3 P;  1MND A;  3HXL A;  4RM3 A;  1JTY A;  1YFH A;  3BG9 A;  3PO3 J;  5TJJ A;  3MZH A;  2QEN A;  1LVK A;  5L3E A;  3WTU C;  3LA3 A;  3GEZ A;  2KIM A;  1Z21 A;  1XMA A;  3Q3S A;  1Y39 A;  4YEL A;  1RES A;  2Z99 A;  1JJ8 C;  1HLV A;  2M7B A;  2BHZ A;  1OCO H;  2HOE A;  3T0Y A;  4ENJ A;  2MFZ A;  4S05 A;  1LJ9 A;  3P7N A;  1B8I A;  1BI2 A;  2JT1 A;  5FD6 A;  1IGN A;  4G8X A;  4XKC A;  3OYJ A;  2GOM A;  1EKE A;  1IDY A;  3R61 A;  1UAA A;  4OAY A;  1LDJ A;  2ZJ2 A;  4XRF A;  3BTI A;  1VQO I;  3K1M A;  2OQR A;  3W2A A;  1X1D A;  2QBY A;  4YRV A;  3FDY A;  2DPD A;  5FLV A;  5D4S A;  2VN2 A;  1J7K A;  2IGN A;  3BLY A;  3W6J B;  3Q0V A;  1NK3 P;  2K86 A;  3H36 A;  3BG7 A;  2Z9O A;  3GVA A;  4YIF A;  2P5K A;  3LSP A;  2Z5U A;  3L09 A;  1ACI A;  1WJ5 A;  3W3C A;  4FCY A;  1FX7 A;  3ELK A;  5GP9 A;  4HST A;  5D4R A;  3PJR A;  1FPQ A;  2DMU A;  3ZQI A;  2MA3 A;  1SFX A;  1YIT I;  2HNH A;  1R5I D;  1IV8 A;  3LSM A;  2Y30 A;  5FKO A;  3E6M A;  4N9I A;  3DPT A;  4W97 A;  3OR1 C;  3COA C;  2FJ1 A;  2L4A A;  4HYE A;  3K4B A;  1MIJ A;  3IUO A;  4RGU A;  2AHQ A;  2KQR A;  1T0F C;  3GF2 A;  4M6Y A;  4HQE A;  1K79 A;  2CUE A;  5EZG A;  3FM5 A;  4LFU A;  4WXC A;  2FEZ A;  3D1N I;  1BC7 C;  2VB6 A;  3MCZ A;  4GO1 A;  3A2K A;  3SHF A;  4MQ9 F;  1BIB A;  3H9G A;  5J40 A;  1ERD A;  1YJW I;  5FB2 A;  1Z9C A;  4OMY A;  3JTG A;  2LP0 A;  5F0C A;  2IS4 A;  3V8K A;  2DFF A;  4XSZ F;  4MTD A;  2ZJR F;  3BOQ A;  4IRI A;  4EV0 A;  1OJL A;  2L7M P;  3I53 A;  4BE0 A;  3KZY A;  4KN4 X;  3M3Y J;  1UMQ A;  2FF4 A;  1D3Y A;  5M5X J;  2JA8 J;  3BR6 A;  1E2X A;  3PIO F;  2A6E F;  3QU6 A;  5JVG F;  1G3S A;  2K4B A;  2KRF A;  4P1W A;  1XCV A;  5D6F A;  4XLN F;  1VF9 A;  2F2E A;  1VQ7 I;  4UB6 C;  2STT A;  4I09 A;  4ZZD A;  3OYB A;  2DA7 A;  3F22 A;  2F5F A;  1IW7 F;  1ZKG A;  5FKM A;  3MKW B;  3CC7 I;  4CCK A;  3KE2 A;  1SFO J;  2DW4 A;  1KYZ A;  1YS6 A;  3PQK A;  2EK5 A;  4RLQ A;  3GZ5 A;  4EJT A;  2VLA A;  2JA6 J;  2E1M B;  3OYG A;  5CPR B;  1QHG A;  2XVC A;  2ECC A;  3AL0 B;  4IRH A;  1RI7 A;  3ZCO A;  5M5W J;  4UVB A;  1L3L A;  1QZE A;  2IXS A;  4YFX F;  3JRI A;  5EYR A;  4DBQ A;  2A5W A;  4I98 B;  3KP5 A;  1EH7 A;  4XM3 A;  1H88 C;  3JCU C;  1QQI A;  2NVQ J;  2DI3 A;  4BJT A;  1VQP I;  1LQ1 A;  3ISP A;  1D5Y A;  2HQR A;  2K9S A;  2W85 A;  3LA2 A;  5JLX A;  5E18 F;  3WTS C;  4CSW A;  2DT7 B;  2R0Q C;  2Z2S B;  2YPR A;  1LB2 A;  4P9F A;  3GW2 A;  2JN6 A;  1IRG A;  2NVX J;  3REO A;  1FOX A;  3QYE A;  4E7S A;  1G3T A;  2CG4 A;  2RQQ A;  4XNF A;  2STW A;  2GQQ A;  2FU4 A;  4LLL A;  5K1Y A;  2PI0 A;  3HOY J;  1NG6 A;  2HZT A;  2EIJ H;  5DD4 A;  3W2V A;  1D1C A;  1KQ8 A;  1ZG3 A;  2DMP A;  1VQM I;  1BR2 A;  2GWR A;  5J4Y A;  1UST A;  3TP3 A;  2CW0 F;  2ADU A;  1IO2 A;  3BR0 A;  4XR6 A;  2EFW A;  3CC4 I;  4RA2 A;  4BNC A;  2QKM B;  4FAS D;  1WJA A;  1X2M A;  3D5R C;  3JRD A;  2KKO A;  5JR3 A;  3B6A A;  2V1X A;  4I99 C;  3LAP A;  2F5C A;  1XSV A;  2KHM A;  1P4A A;  2Z3Y A;  3H3Z A;  5FFX A;  3N4M A;  3VYU B;  4O3M A;  2QKL B;  3E5Q A;  1DDN A;  4RBO A;  3VWB A;  4JP0 A;  1J2X A;  3CF2 A;  4LGW A;  4EJW A;  5DDG A;  3PSI A;  3OIP A;  5EEA A;  4C3J J;  1QU3 A;  1HKS A;  1DPR A;  2UWM A;  3RI4 A;  1Z0X A;  3FKJ A;  2JK3 A;  1TWC J;  4XRS G;  5HOD A;  1G3Y A;  3E5U A;  2DDA A;  2WBM A;  1UHM A;  2VPR A;  1HXD A;  2GAU A;  3LSG A;  1JI8 A;  1PUE E;  4Y33 A;  4WWC A;  4KYW A;  5IT3 A;  2XF6 A;  2NS7 A;  2UUZ A;  3TOB A;  1VQ9 I;  2KJC A;  1I39 A;  4F92 B;  3HGY A;  4U7D A;  2VBW A;  2M8G X;  1HC8 A;  1ON2 A;  5E3N A;  4BQO A;  2ZME B;  2D1H A;  4G7Z F;  1T0F A;  4XLC A;  3D0S A;  3ECH A;  4AVP A;  2VBX A;  3ESW B;  1JGS A;  2F4M B;  2AS5 F;  1F1Z A;  3OYN A;  3VYT B;  2RNG A;  2EFN A;  3QOP A;  4ESF A;  2XRO A;  3L7W A;  1PJR A;  3BZC A;  2Z33 A;  3HYI A;  4I02 A;  1XDU A;  4IPA A;  1V5F A;  3EPZ A;  4ZYE A;  2HOS A;  1MMN A;  3DFG A;  4OWR B;  2ZME A;  1O7L A;  2H6C A;  2M4K A;  3FWE A;  3IP4 B;  2P5L C;  5D5W B;  2HPM A;  2GIV A;  3RDI A;  3HSF A;  2JSP A;  2LY9 A;  4HG2 A;  4UUT A;  4QPQ A;  2I8D A;  2EV0 A;  3HSR A;  5E17 F;  1IRX A;  1S7A A;  3WE3 A;  4KT6 A;  4RS8 A;  3HGG A;  5BS6 A;  2WV0 A;  3H92 A;  4XRM A;  3DCF A;  1BR1 A;  4HX8 A;  1R36 A;  2ICW G;  1U78 A;  4HPQ A;  4M3E A;  4EJU A;  3KYL A;  3VYR B;  4J01 A;  2JQ7 A;  3F6V A;  3OR2 C;  3U9G A;  1N25 A;  3AAF A;  2IGK A;  2VAS A;  4ENK A;  4GFB A;  3G73 A;  1A6I A;  1MJ9 A;  3I3L A;  4IXA A;  3RTR A;  4B09 A;  1NG7 A;  1K83 J;  1YG2 A;  3GTQ J;  1ZN2 A;  4U0W A;  2DOA A;  4DYQ A;  4HF1 A;  1S8N A;  1LE8 B;  2V9P A;  3TBI A;  2A61 A;  2GXA A;  1H89 C;  3S15 J;  2FE3 A;  2FBI A;  2Q1Z B;  3I5U A;  1BI1 A;  2MLK A;  2K7L A;  4HBL A;  4BJ5 C;  4PJ0 C;  2X6X A;  1JUS A;  3LSH A;  4A3K J;  1WZ2 A;  2CSO A;  3BC8 A;  2KIS A;  2RRE A;  4FE7 A;  3S93 A;  5F0F A;  4LB5 A;  1LE8 A;  5DD8 A;  4YFK F;  5HS7 A;  3OOU A;  3MKY B;  4A3F J;  2XRL A;  3ERE D;  4JX6 A;  1R7J A;  2G9W A;  4Q47 A;  3WU2 C;  5EG0 B;  3F23 A;  1HF0 A;  2HKO A;  5F1R A;  3GTO J;  2BXY A;  4C2T A;  3I9V 2;  4WXD A;  2A68 F;  2XB0 X;  1W5C C;  2HR3 A;  3EYI A;  3P9I A;  1FP2 A;  4LJZ F;  3S8P A;  5LEJ A;  4FTH A;  5C4X J;  2IAI A;  1X19 A;  2DOE A;  5E3O A;  3TED A;  1AU7 A;  1A6Q A;  4IHT A;  1IN6 A;  1WJE A;  3EUA A;  2DPU A;  3FXK A;  4L5I A;  5EG0 A;  1CGP A;  4AYB N;  2IBD A;  5CLS A;  4DZJ A;  3KP7 A;  2FQ3 A;  4Y13 A;  2DBB A;  2NYX A;  3PUB A;  4A5N A;  1JKQ C;  3H5R A;  2WAQ A;  2L02 A;  3J81 K;  2LC2 A;  4QLC U;  1IUY A;  3QOE A;  3F8B A;  2JVH A;  2WV1 A;  4NQW B;  1HDP A;  3HSE A;  3SQN A;  2VON A;  3RKW A;  3DU6 A;  3G1L A;  1J75 A;  4KIG A;  3T8R A;  4CYC A;  5KNL A;  2KMU A;  2YS9 A;  1E3P A;  1LFB A;  4DIQ A;  4IHV A;  2BVL A;  5D5V B;  2I5U A;  5M3F J;  1HST A;  2RDP A;  1MW7 A;  5HS8 A;  2DOF A;  4YEJ A;  4ON0 A;  3HRU A;  3T5X A;  1I27 A;  2ZB9 A;  1Y1W J;  3AFH A;  4XKV A;  4MGR A;  1IV6 A;  1PDN C;  2JPB A;  1TL8 A;  3CMA I;  3CLO A;  4ZYD A;  4UUS B;  4D1Q A;  2R7D A;  2K3F A;  3JSP A;  4NNJ A;  3NEU A;  2AQE A;  4CYD A;  5IOZ A;  2MAB A;  5EDN A;  2NAZ A;  1WQ2 A;  5C3E J;  3HRS A;  2DYS H;  3LFU A;  3OYD A;  1TNT A;  4A6E A;  3S16 J;  2R3S A;  4F3Q A;  2ACJ A;  3FM3 A;  3S14 J;  1SC7 A;  4HF0 A;  2X6W A;  2BY2 A;  3P9C A;  5FLM J;  1TC3 C;  2BY1 A;  4FT8 A;  5D6E A;  3CCJ I;  1HW1 A;  1RIO H;  3R4K A;  1W5S A;  3KLO A;  5B1A H;  2X1E A;  1EV7 A;  3RQI A;  4KIC A;  1N75 A;  2H94 A;  3RSN A;  1EJ9 A;  3L2V A;  4AIH A;  2CU7 A;  2OV7 A;  3RCO A;  2CW8 A;  1UHS A;  2DFI A;  4XN3 A;  2XAJ A;  4QPO A;  1KGS A;  5GAH J;  4KUM A;  3FHZ A;  2VJ4 A;  3CCR I;  4A3D J;  1DU6 A;  1LFU P;  2MG4 A;  1VQK I;  2COB A;  3B02 A;  5IY5 H;  3B6C A;  2L4M A;  1SAN A;  3I0T A;  2F48 A;  1XD7 A;  4OIP F;  1P7J A;  4Q5S F;  2FSW A;  3CCL I;  2M4G A;  4AWX B;  2ME6 A;  3WTT C;  2LG4 A;  3ROU A;  4NUB A;  5M5Y J;  2Y9Z A;  3LAJ A;  1ZRC A;  2MSY A;  1V54 H;  2R7W A;  3I54 A;  1USS A;  3GFI A;  3ABT A;  1RRJ A;  2KJB A;  3L2Q A;  3JAM Z;  3D5L A;  4JBA A;  1RUO A;  3N97 A;  3F8F A;  2MLG A;  2BV6 A;  1U3E M;  3DP7 A;  4BY7 J;  4BEH B;  5F0H A;  1WVR A;  3ZQ7 A;  5GAD J;  5JFR A;  3R6S A;  3VOD A;  2IA0 A;  4NC7 A;  4M9X A;  4X0G A;  1G4D A;  2HVQ A;  3L00 A;  1STZ A;  2IT0 A;  2XIG A;  5L3D A;  1WH5 A;  3LOC A;  4XKW A;  2PMZ A;  4Q48 A;  4G94 A;  2IS2 A;  1YX3 A;  3F8N A;  2X51 A;  4D7N A;  3DLL F;  3CES A;  2GIZ A;  3TW6 A;  4WK8 F;  2R5Z B;  1VQL I;  1HBX G;  1IF1 A;  1XX5 A;  5FKN A;  2D5V A;  4L9T A;  2XRN A;  3S32 A;  1YE9 A;  4BEH A;  3RZD J;  3GTL J;  3BR5 A;  1WGX A;  3VB2 A;  4F52 A;  3QPH A;  1VZ0 A;  5FKL A;  4B3A A;  1G59 A;  3DKX A;  2B63 J;  3JRG A;  2ISY A;  3V8L A;  3RYP A;  3KZI C;  1H0M A;  2E2J J;  1OYI A;  3OY9 A;  3BPX A;  3DTK A;  3ZMU A;  1KA8 A;  2QQA A;  2PJR B;  3WGG A;  1KU3 A;  4DBR A;  2O3F A;  1CF7 A;  2HXI A;  1U9N A;  5J1R A;  5FRN A;  3JRF A;  3K1N A;  2XSD C;  2V7F A;  4OIQ F;  3QPS A;  4PDK A;  2R5Z A;  2XHK A;  4AUX A;  4P5O A;  3FX3 A;  4M6V A;  3ZOB A;  3FXM A;  3E6D A;  3VDX A;  1FEX A;  3FXR A;  1PP7 U;  4JQF A;  4B47 A;  2XF7 A;  3A0H C;  5CKT A;  5AIP A;  2DQL A;  3GLX A;  5C4J J;  2R7T A;  3I4N J;  1HW5 A;  3K0L A;  2DAO A;  4NBQ A;  2AO9 A;  2TCT A;  2OJE D;  1WI9 A;  2BW3 B;  1YLF A;  3EUK L;  1G6N A;  2AXT C;  5H6Q A;  4AYB A;  2R92 J;  3DBL B;  1GLN A;  1XCB A;  5EEH A;  3GX4 X;  4QWQ A;  3V42 A;  5F64 A;  4A93 J;  4EMS A;  3BJO A;  3HOT A;  2FOK A;  1V4R A;  4U88 A;  5E20 A;  3HC7 A;  1CQT A;  3LMM A;  5LHG A;  1K78 B;  2FRH A;  2W24 A;  2E34 A;  2WAD A;  4BXX J;  3OYE A;  3MZ8 A;  1H8A C;  4XLE A;  2LR8 A;  3WGI A;  3DV8 A;  1GUU A;  4HEA 2;  1FLI A;  3F0C A;  3X2Q H;  2DMN A;  4PJL A;  2NXN B;  5IT9 Z;  2M9H A;  3J80 K;  1MBG A;  3QU3 A;  1W0T A;  3F8C A;  3OYK A;  2DCE A;  2BW3 A;  3BCB A;  4RDU A;  3U21 A;  3FF5 A;  1JUM A;  5LFA A;  2VKH A;  1TLH B;  1TW3 A;  5A2Q K;  2R7Z J;  3A02 A;  1ON1 A;  1ETV A;  2PLY A;  2ME0 A;  3MMY B;  4WXH A;  5DUK A;  4WX9 A;  4RB2 C;  1K78 A;  1YJN I;  5J8F A;  3C1D A;  3HKZ A;  5J1Y A;  2LVS A;  3BR3 A;  3K1P A;  1ENH A;  2JZY A;  2X0L A;  4M6X A;  1PUF B;  1BN5 A;  2W25 A;  3BG3 A;  2WAE A;  2XSJ C;  4HX7 A;  5J3L A;  1QZY A;  2ECB A;  1I1G A;  2EH3 A;  4UV8 A;  1YTY A;  1I1S A;  3G2B A;  3K4M A;  1ULY A;  3B73 A;  4HA8 A;  1ZGA A;  1BW5 A;  1UFM A;  4RB3 C;  1OPC A;  4ZDL A;  1FMW A;  3FXO A;  2MW8 A;  3GWZ A;  1FBS A;  4BQQ A;  2PX9 A;  1RET A;  3BP8 A;  2HVR A;  2B7E A;  1ZAO A;  4PCQ A;  3PO2 J;  2V79 A;  2A05 A;  1RNL A;  1PUF A;  4XBF A;  2NOG A;  1R4M B;  3V4G A;  2WY7 Q;  4M9S A;  2QBY B;  2VPL A;  4P9U A;  1OFC X;  2DT6 A;  3E3V A;  4CUG A;  2FX0 A;  3G4S I;  2VI6 A;  3LA7 A;  2PQ8 A;  4ZC3 A;  2NNN A;  2KIU A;  3ZMD A;  1J5Y A;  1TQM A;  3TKY A;  2I10 A;  3IL2 A;  3ABL H;  3AL0 C;  5CVR A;  1UB9 A;  3RKQ A;  1UEL B;  1IC8 A;  3CDH A;  3G6E I;  2EFQ A;  1FOW A;  2HYG D;  3ZGK A;  2XAS A;  2FNP A;  2DLL A;  4M3B A;  3TQN A;  4BDY A;  1HSJ A;  3S2W A;  4II2 A;  1K7A A;  4A6D A;  2VKE A;  4C2U A;  3ASO H;  4RGR A;  2LYC A;  2JRM A;  2VKV A;  5C44 J;  5BOX A;  5LEK A;  5L3F A;  4M74 A;  4RLF A;  4RB1 A;  1A04 A;  5FRM A;  3JTH A;  1YOV B;  2IP2 A;  2XUB A;  3SZG A;  1JHF A;  3VEP A;  1YJ9 I;  1Z77 A;  2LTP A;  2KPM A;  3IAS 2;  2CQN A;  1VFC A;  1FMV A;  5H6R A;  4MFE A;  2DA6 A;  4S0H B;  3S17 J;  1VQ6 I;  2VE8 A;  2NS0 A;  5H2F C;  3KPH A;  3HRM A;  2ELJ A;  1OMI A;  3CTA A;  3V7S A;  3OYL A;  1U5T B;  2HTJ A;  3HHG A;  1RUN A;  5EF6 A;  3R0J A;  1XGN A;  3F21 A;  2CQX A;  3JSO A;  4LOC A;  3MD2 A;  5CVU A;  1ITY A;  1R71 A;  4ENN A;  2MD5 A;  4IQJ A;  3GFM A;  1E17 A;  2A6T A;  1FYM A;  4ZTF A;  1MBF A;  1ZH5 A;  3CCU I;  1FIP A;  2YX7 A;  5ERI A;  1R1U A;  4EM2 A;  2HPI A;  4HAM A;  4PSX A;  1Z67 A;  1IXC A;  5GTH C;  4MHG A;  3CCS I;  2X48 A;  3MN2 A;  1U5T A;  4M73 A;  1KU2 A;  2HKX A;  3HG9 A;  5K5O A;  2LBF B;  3L9F A;  5DM6 F;  3FK7 A;  5CVI A;  2Y75 A;  1O3R A;  2QSG X;  4LIU A;  3ZN0 A;  2L9N A;  4B48 A;  3QRF F;  4L9V A;  4OU0 A;  4BDZ A;  2EZK A;  2EZI A;  4M9Z A;  4A0Z A;  3MVP A;  1VI0 A;  1AA7 A;  3J7Y J;  1D0Z A;  2XAG A;  1WPK A;  1Z3Y A;  1J9I A;  4CCL A;  2QA4 I;  5KAI C;  4G12 A;  1KQ9 A;  1MKM A;  2CUZ A;  2X9D A;  3WU1 B;  4KMU X;  4XL9 A;  1S9H A;  1V55 H;  2JSC A;  2LBF A;  3O2P E;  3SYT A;  2DU9 A;  1KZH A;  2JUC A;  5BMZ A;  3U2R A;  5K5Q A;  2IS6 A;  4GXO A;  2N8G A;  3F6O A;  2JA5 J;  2A5Y B;  3K10 A;  2A3S A;  3IAM 2;  2EQR A;  3QOD A;  3VPR A;  2UZK A;  2LKX A;  5D5U B;  2E36 A;  3FMS A;  3WU0 A;  2CO5 A;  2M34 A;  1S7E A;  2BOL A;  4DOZ A;  3JRE A;  3K70 D;  2NVY J;  3GYH X;  2HYF A;  2K9M A;  4FE4 A;  3WHB A;  1SMT A;  4P55 A;  3SDG A;  1P4X A;  1I6X A;  3DPL C;  2HOT A;  1MJA A;  3NRV A;  1FP1 D;  1DUX C;  1OCP A;  3GO5 A;  4KIF A;  1DP7 P;  2HQN A;  1QRY A;  3C18 A;  2R7V A;  3HHH A;  3ECO A;  2KRH A;  1G2H A;  1D0Y A;  4RB0 A;  2JA7 J;  4BUP A;  4M72 A;  1JE8 A;  3HEF A;  4L9J A;  3HOU J;  2FML A;  3AG2 H;  1TT0 A;  3RPU A;  1WJD A;  5B1B H;  3DEE A;  2EZH A;  3O8G A;  2UXX A;  5E1Z B;  3WOD F;  1FC3 A;  3WTV C;  3WGH A;  3NAU A;  3EDP A;  5J1U A;  4BU2 A;  3GFJ A;  1ZR2 A;  2ESN A;  2M30 A;  1K4S A;  3OYH A;  5LGN A;  2OTL I;  1XN7 A;  2WAF A;  1FTZ A;  2CJJ A;  3EQL F;  1FNN A;  4U0V A;  2GA1 A;  1MMD A;  1IRZ A;  2E60 A;  3KP4 A;  2C6Y A;  4UV9 A;  4E6K G;  5LD2 C;  1MBE A;  5ILS A;  1GXQ A;  2VXD A;  3FMQ A;  3E5X A;  4LK0 F;  1A5J A;  3DF8 A;  3MWM A;  2HQA A;  4KJZ A;  1VQ4 I;  5J4V A;  1S29 A;  1FSH A;  1D0X A;  2Q8K A;  3TO6 A;  2X6Y A;  5D5X B;  2FOW A;  4GDF A;  2L5Q A;  2R7U A;  2P6T A;  1MJB A;  3C2B A;  1MMS A;  1BC8 C;  1SFK A;  2OBP A;  3KEO A;  3GFL A;  3FXQ A;  2CUF A;  3GTG J;  4PUS A;  3RKX A;  3QPT A;  1UJ8 A;  5J8C A;  1B59 A;  4AVZ A;  2O7O A;  4HNU A;  3AG3 H;  1GHC A;  3SZT A;  3KIO A;  3CDL A;  3TL4 X;  3FK6 A;  1OYW A;  1XSD A;  3PNT A;  4RAY A;  3KCC A;  5FJ8 J;  2Y0S N;  1U6G A;  3F9K A;  5TRD A;  4L18 B;  4WF2 A;  5TGT A;  1T6S A;  2HU9 A;  1KU7 A;  1QO0 D;  2LKP A;  1ZR4 A;  1SAU A;  3A03 A;  4BH9 A;  3HB9 A;  5IYD J;  3QP5 A;  3BZ6 A;  3OYI A;  3HOX J;  2HDC A;  5EEG A;  2HVS A;  1J59 A;  1Y56 A;  2DYR H;  1D1A A;  2EIL H;  2LH9 A;  1KU9 A;  2ZNZ A;  4CCM A;  3FKI J;  2LFB A;  2P5V A;  4PSW A;  3MZY A;  4N0B A;  2UXN A;  3V7R A;  1BI0 A;  5JHF A;  2MBF A;  3G71 I;  3ZQG A;  4G7H F;  2AQF A;  4A3J J;  2M7A A;  1W36 C;  1Z7U A;  4HV6 A;  4LB6 B;  2XDV A;  5EJC A;  3OSG A;  4OIN F;  1AKH B;  1ETW A;  2QQ8 A;  3GZ6 A;  4LLG F;  4IHY A;  3TOA A;  4B8X A;  4RGX A;  3K4K A;  1OR7 C;  4X6A J;  5LGT A;  2K02 A;  5GPC A;  2BVM A;  3M9A A;  5ICF A;  2FUG 2;  1W4M A;  2CH0 A;  2XAQ A;  1E3H A;  3M07 A;  4A3L J;  1ZEL A;  2VQH A;  2EV5 A;  2DA5 A;  2QZ8 A;  3ZQL A;  1MNM C;  4IHW A;  1HKQ A;  3RZO J;  1BM9 A;  4C3I J;  4EAT A;  2E1O A;  2EFO A;  2VQL A;  2IPQ X;  2O8X A;  3C2H A;  4G7O F;  4Y52 J;  1WH7 A;  1HDD C;  1AKH A;  2MH2 A;  5HNH A;  2O5R A;  1YS7 A;  2MD0 A;  5HLH A;  4CHU A;  1IDZ A;  2X1C A;  1QVT A;  2D45 A;  3DTI A;  1YYV A;  3H5A A;  4FX0 A;  3KP6 A;  1QPM A;  3KX2 A;  1YW7 A;  2ZC2 A;  2ZXI A;  3J7Z I;  2W7N A;  1BA5 A;  5JVT A;  4KNY A;  4LLN A;  2J5O A;  2LK2 A;  1X1A A;  1IRF A;  3HL2 A;  3FIS A;  1KYW A;  5B5E C;  1XG1 A;  3CUQ C;  1EH6 A;  1RR8 C;  1HA8 A;  3RQ4 A;  5E8I A;  1ZK8 A;  2PBI A;  2L9V A;  2NVU B;  4CYC B;  1SD4 A;  1S72 I;  5DV5 A;  2HWV A;  2V1U A;  3LSI A;  1O3Q A;  1ETO A;  3S3O A;  1V5E A;  3IRQ A;  2VIX A;  3DEW A;  4RAF A;  1QBJ A;  4EVI A;  3VFZ A;  4JOM A;  4LG0 B;  2QLZ A;  2DMQ A;  5HDK A;  3CMY A;  4HDV A;  3QYF A;  4E7L A;  3H3V K;  3ZQF A;  4A3M J;  1X4O A;  2X1D A;  3TO9 A;  4F91 B;  3BQY A;  3BT9 A;  1HQC A;  3RPQ A;  1JXS A;  1R22 A;  1APL C;  2HYJ A;  2YUS A;  2NS8 A;  2X85 A;  1BI3 A;  2WB1 N;  5HLI A;  1R5H A;  2PJP A;  1K61 A;  2K5C A;  1JTX A;  4IOC F;  4IZZ A;  1UG0 A;  5F04 A;  5K7F A;  2IJL A;  3E6B A;  2BY3 A;  1R6R A;  3ZMZ A;  1TWA J;  4E4H A;  2ZXW H;  2XKO A;  4LG0 A;  3K69 A;  4DZP A;  4XOT A;  2HXO A;  2OAZ A;  3FIW A;  1W7P A;  3CCY A;  3H3U A;  3CO7 C;  3OMY A;  3FZV A;  2JUG A;  1ZGW A;  5FLX K;  2FMY A;  1RR7 A;  2KIF A;  2LLK A;  1TW2 A;  4ZYH A;  5HOO A;  3L2U A;  1R9T J;  4BQA A;  2IS1 A;  5DUI A;  3CD6 I;  4MLO A;  2DQR A;  1POG A;  3CQZ J;  3K4L A;  3QPL A;  4R1H A;  1XGM A;  1YW9 A;  3CP2 A;  3Q0U A;  3DBR B;  3UR3 C;  2EBI A;  1AWC A;  1LNW A;  2KDZ A;  2FXA A;  1FT9 A;  1R4N B;  3U1K A;  4BHP A;  3Q9S A;  3S1Q J;  1G3W A;  4R79 A;  2H1K A;  3HOZ J;  2EV6 A;  3K7A J;  5JLW A;  2BEO A;  1T2K A;  2CV2 A;  1YHQ I;  2DTZ A;  1YQA A;  1OYY A;  3IKV A;  5F6F A;  3WG7 H;  1ZHF A;  3S1N J;  1P92 A;  3AKZ A;  5IOY A;  1BJA A;  1JHH A;  1MBK A;  1U0J A;  2M0C A;  4CO8 A;  2O6G E;  3UNG C;  3L2R A;  2LNB A;  1BJZ A;  1P2F A;  2K4J A;  2DK5 A;  2HEO A;  2AXL A;  3LSK A;  1TTY A;  3A1Y A;  3CF5 F;  4MTE A;  3PM1 A;  2E2H J;  1U9O A;  3D5S C;  3H9J A;  2ZSH B;  5FO5 A;  3DU5 A;  2H27 A;  2K27 A;  1FBU A;  4DW6 A;  2O0Y A;  1N77 A;  2ZSI B;  3ERM A;  4MFD A;  3ZRG A;  2R7O A;  2R7F A;  1DPU A;  4UHT A;  4BGD A;  2CRG A;  2E5Z A;  5ILU A;  3FBI B;  1FJL A;  1BOB A;  2ZNY A;  1JKO C;  1FTT A;  2Y0S A;  4XOR A;  1FY7 A;  2WTE A;  1IN5 A;  2DXI A;  2OZU A;  1GT0 C;  1P4W A;  3ASN H;  4XLA A;  2KFD A;  4HSR A;  4CZC A;  4KIS A;  3FBN B;  2RGV A;  3PUF A;  1T38 A;  2DO7 A;  3BTL A;  3CMM A;  2VBZ A;  4LD5 A;  2OPT A;  1SD6 A;  1ZG5 A;  1OQY A;  1YX5 A;  3BZK A;  3VYS B;  3CUQ A;  1XGO A;  1LDD A;  4AIK A;  2CV0 A;  3OYA A;  3GBG A;  2E71 A;  3ABM H;  3KP3 A;  4A2U A;  4CXF A;  1RKW A;  1WCM J;  3OYC A;  1S6L A;  3GCM A;  5ICC A;  3BR2 A;  3PQJ A;  2F4O B;  2XB5 A;  1T56 A;  1LEA A;  2KDO A;  2V6E A;  1BBY A;  4GGG A;  5IP7 J;  4ZH4 F;  1T33 A;  2L2O A;  5JI6 A;  3FMR A;  1OKR A;  2OCC H;  3R60 A;  2QQ9 A;  2VT2 A;  4I01 A;  1I50 J;  4XON A;  3HTU A;  5J6X A;  5DS9 A;  4PJN A;  1CF7 B;  4BXU A;  4BS9 A;  3LST A;  4ZTJ A;  2Z1D A;  3OS1 A;  2PG4 A;  1Z7L A;  3A0B C;  1ODD A;  4XMY A;  3GTJ J;  4EGY A;  3I4M J;  2L3D A;  4N9H A;  4TV7 A;  2QYO A;  4CIC A;  2IA1 A;  1BR4 A;  1GDT A;  3PNY A;  3ZMS A;  2RC4 A;  2P81 A;  3F8M A;  2P6S A;  4KT5 C;  1GV2 A;  4E7I A;  2L01 A;  3DEU A;  2XPW A;  4FET A;  1TQI A;  1K6Y A;  1HW2 A;  4UUV A;  1B72 B;  1ETX A;  3GTK J;  4HLX A;  3LQR A;  3QQA A;  2W4S A;  4IHX A;  2VQC A;  1BW6 A;  2ZKZ A;  4A3E J;  2E1N A;  2M0M A;  4V2G A;  3O6B B;  2V9K A;  3OS2 A;  3J81 Z;  4NC8 A;  3ULQ B;  4ETS A;  3HIF A;  1C0W A;  1W5T A;  1OCZ H;  5IP9 J;  2W57 A;  2X6O A;  1SVM A;  3AG4 H;  5KAF C;  2UV1 A;  1Y0N A;  3OL4 A;  4YIR X;  3JRH A;  2QEX I;  2CUJ A;  5HDG A;  4ASN A;  1R1V A;  3V7C A;  4F55 A;  4D9J A;  3F3X A;  1B72 A;  4GYG A;  5M3M J;  3W2W A;  4A0Y A;  2CQ7 A;  4RAZ A;  1K6O A;  1B1B A;  2F4I A;  2LMD A;  1O4X A;  4DGW B;  3BR1 A;  4UNO A;  1H9G A;  3MFK A;  4PJM A;  2QGU A;  2ZFW A;  3RIR A;  2F6C A;  2WB1 A;  2CMP A;  3AG1 H;  1FOY A;  1A31 A;  1NTC A;  3ONQ A;  4LMY A;  2JA2 A;  2TDX A;  4RMN A;  1X3Z B;  4Q4Z F;  3BY6 A;  5EGO A;  1MSE C;  1QA6 A;  2DJI A;  3IWZ A;  2GM4 A;  1S3J A;  2QQB A;  2KRC A;  4OIR F;  2P7C B;  1RKT A;  2WA0 A;  2EFP A;  4BHC A;  1E0E A;  1ETY A;  1UG2 A;  2VOP A;  2Z16 A;  2VQG A;  4MNU A;  2DMT A;  2G7U A;  1WHU A;  4EEF G;  2DDB A;  4S04 A;  3HUG B;  1J09 A;  4XK4 A;  4AID A;  1MGT A;  3HTS B;  1ZRE A;  3H0G J;  4A3B J;  3LSJ A;  5LGU A;  5AIQ A;  3HZJ A;  4IJA A;  1RZ4 A;  2LSO A;  3DWL E;  2P8T A;  3CJT B;  4BYY A;  2QM3 A;  2DA1 A;  2EB7 A;  2P0W A;  4B43 A;  5J47 A;  2RQP A;  1T8I A;  1EH8 A;  1LDK B;  4DYC A;  2CGP A;  3RKY A;  5E1X A;  3DPU A;  1FIA A;  2WC2 A;  2FQ4 A;  4W1U A;  4EM0 B;  3HUG A;  4OOI A;  4RM2 A;  1FWZ A;  1TWG J;  2DJN A;  4II3 A;  1B9N A;  3TP0 A;  2EIN H;  1VQ5 I;  3K2Z A;  5L3C A;  3UKG A;  4L0Y B;  3A4C A;  2CQQ A;  4BAY A;  3JRA A;  5JHU A;  1EF4 A;  3PL8 A;  5DTD A;  5D8L B;  2H8R A;  2GXB A;  3Q0W A;  1T08 B;  1X1C A;  2V4J C;  2F5E A;  4A12 A;  4M71 A;  4OAZ A;  1JT0 A;  2E1M C;  1R1T A;  3IKT A;  2H1L A;  2XPV A;  3CLQ A;  2YX4 A;  3KET A;  4I6Z A;  5HVQ C;  1MH3 A;  2CFX A;  4K2E A;  2R5Y B;  5LHI A;  3M7G A;  3F72 A;  3H1C A;  3DKW A;  2KZG A;  4ESJ A;  4LG3 A;  2VKD A;  1WJF A;  5D8K B;  2RV8 A;  2CS3 A;  2V26 A;  2A6H F;  4E7J A;  3FXJ A;  3R0A A;  2QF7 A;  2XAH A;  2HDW A;  4U0Y A;  3PFI A;  4UVC A;  2LY2 A;  4Z6Y A;  2VC0 A;  4PK4 A;  2M1B A;  1OCT C;  3WHC A;  2OUM A;  4BHB A;  2VXZ A;  5KVR A;  1JKP C;  3WTW C;  1YW8 A;  5GTI C;  2XC7 A;  2PMH A;  1XMX A;  2R5Y A;  4XLP F;  3BRO A;  2DFE A;  4YII A;  4D7M A;  2E19 A;  2L0K A;  3H35 A;  2EPF A;  2FNA A;  2HQ5 A;  2JRT A;  3IH3 A;  5CVJ A;  3SFZ A;  5GAG J;  3MKZ A;  1AHD P;  3I58 A;  3ML6 A;  1AOY A;  3EYY A;  2QUF A;  3BJ6 A;  2Y48 A;  2Y31 A;  4L5E A;  3ZR8 X;  4RAG A;  3M1E A;  4C3H J;  2YSR A;  4KDP A;  3ABK H;  3IC7 A;  4L5J A;  2W00 A;  3CCV I;  3LSR A;  1Y1V J;  1OCR H;  2ZJQ F;  3SEQ A;  1HCR A;  4GCV A;  3DKY A;  2ID3 A;  4A69 C;  1JKR C;  1X58 A;  5LLQ A;  1P9Q C;  2XV4 S;  2FA5 A;  1ZG1 A;  2O61 A;  4BAC A;  2DTR A;  1R5G A;  2OF7 A;  4XID A;  2DT5 A;  3HOV J;  1REP C;  4ABZ A;  4HNV A;  3SDB A;  3S3N A;  1MDM B;  4G6D A;  1QNT A;  1GVD A;  4Y3O A;  1KON A;  4Z2Y A;  4PFO A;  5HLT A;  4F7Z A;  2LY1 A;  1SD7 A;  2RAE A;  2XF5 A;  2CW7 A;  1SMY F;  1U8B A;  2TRT A;  4I76 A;  2K40 A;  2HOA A;  2QVO A;  2HDD A;  3I55 I;  1DP3 A;  4BQN A;  2ZME C;  1MSF C;  2OZ6 A;  4KN7 X;  2LF8 A;  2PMU A;  1IAW A;  2P4W A;  4IVN A;  4ZZL A;  3Q5F A;  4B4C A;  2MH9 A;  2OA4 A;  1XTA A;  5DCM B;  2KL4 A;  3HPH A;  4F93 B;  1T98 A;  1XC5 A;  1MDM A;  1DU0 A;  1F5T A;  3E7L A;  3KLN A;  1VND A;  2L9S A;  4A5M A;  2BY0 A;  3KZZ A;  2DA4 A;  3QWL A;  2BGC A;  1FZP B;  3JW4 A;  3NWS A;  4XKB A;  3J80 Z;  1V5G A;  2W82 A;  3EET A;  4IQ4 A;  4J00 A;  1YO5 C;  1FYK A;  3L2C A;  3ZXS A;  1XDS A;  4L9N A;  2ELK A;  5A2Q Z;  4A0X A;  5DCM A;  5KHD A;  2HS5 A;  3A01 B;  1WSU A;  2F5D A;  2V9V A;  1TNS A;  1X2N A;  4KIT B;  3GTM J;  3ZQC A;  4G6T B;  2K85 A;  1HKT A;  2O9L A;  3SZP A;  2WAQ N;  3Q9V A;  3J7A Y;  2BE5 F;  5L3B A;  2IW5 A;  2XPU A;  2M3A A;  2BXZ A;  5FD5 A;  1F36 A;  2KIQ A;  3BQZ A;  4C2M J;  2G0E A;  1QPI A;  2EJR A;  1BL0 A;  4MQV A;  2E7W A;  2OTJ I;  1P6R A;  2LD5 A;  1NH3 A;  3A01 A;  1QHH D;  3M8E A;  1DGR M;  2R7S A;  4XIC A;  2LOO A;  1Z91 A;  1DGW Y;  3OV8 A;  4QSH A;  5BQT A;  4N4O B;  3E0J B;  4E7K A;  3G1O A;  2H09 A;  1XGS A;  2H6B A;  4RGS A;  3PIP F;  3DQV C;  4MEX F;  2NVT J;  2VC1 A;  4XLF A;  3W6K B;  1ETK A;  1LVA A;  5B3S H;  3KEY A;  2CQK A;  1RPW A;  2QWW A;  1ZLK A;  4HW0 A;  3T8T A;  4E7H A;  4HDU A;  1MBJ A;  2LDU A;  1A35 A;  1EA3 A;  1X1B A;  5GAE J;  4BL0 B;  3S1R J;  4I2O A;  1V3F A;  2OCE A;  2CWE A;  4MO7 A;  2M5W A;  5BPI A;  4KMF A;  3DXJ F;  5HNF A;  3ZPL A;  4M3D A;  1JUP A;  2HI3 A;  3S3M A;  1ORK A;  3HDD A;  3CJQ B;  5BPD A;  1MH4 A;  3OSF A;  4B44 A;  1Y0U A;  1VQN I;  2HZD A;  2M87 A;  5FKK A;  2BYV E;  1X3W B;  2VUM J;  2L54 A;  1TQP A;  4C9Y A;  5IYB J;  2RKH A;  4KIB A;  1P7I A;  2Y2Z A;  2M45 A;  3H5N A;  3K6G A;  4KFC A;  4DQ2 A;  3CP8 A;  2ID6 A;  3OYM A;  4IHS A;  4X1E A;  3L2W A;  2COM A;  3IRR A;  2LRD A;  1XB4 A;  4GRI A;  5HS9 A;  4BE2 A;  2K9L A;  2H8W A;  2VOD A;  2E35 A;  2JVG A;  4A3G J;  1MD0 A;  3GXO A;  1YI2 I;  2JMW A;  2E2I J;  1BOA A;  5ICG A;  4BBR J;  4Y15 A;  4I0B A;  2BBY A;  1VQ8 I;  3M4O J;  2W48 A;  5E1W A;  3KEQ A;  4A3I J;  4MIM A;  1T39 A;  2M2E A;  1R49 A;  4JX4 A;  3LNQ A;  5LBQ A;  3TMO A;  1ZRD A;  1SEU A;  2QSF X;  2W1O A;  2V1D A;  5CQG A;  2RNJ A;  1O7F A;  2PEX A;  3OL3 A;  4PJJ A;  4OIO F;  3JRC A;  9ANT A;  2DA2 A;  4OMZ A;  1MMG A;  2L7Z A;  2RVC A;  4QIW N;  5ED4 A;  4HLY A;  5F27 A;  2XGD A;  1ZYR F;  1WI3 A;  5CQE A;  1M1E B;  1ZGJ A;  1BIA A;  2Q2E B;  3HRT A;  1F4K A;  2LF7 A;  3E1S A;  1IZ1 A;  4PGG A;  5KK1 A;  4NDL A;  5LHH A;  2VBY A;  2D2W A;  2KLO A;  1R58 A;  2Y9Y A;  2O03 A;  3NQO A;  1IG7 A;  1ZRF A;  4D0P A;  5BNG A;  4IO9 F;  1Z05 A;  2FD5 A;  2E7X A;  3BCA A;  3NWT A;  4CZZ A;  5F1J A;  3H0D A;  2DA3 A;  3MAJ A;  1WKM A;  1Y6I A;  3KYD B;  4R8H A;  5K5R A;  3K4J A;  3N05 A;  1TWH J;  2NNY A;  3IH4 A;  2PMZ N;  1FOK A;  3QAH A;  4CGZ A;  1LUJ B;  3DLA A;  4LIT A;  2X4H A;  1ZAR A;  3BG6 A;  4ANJ A;  3JAM K;  2Q2E A;  3RJP A;  1W0U A;  4EQQ A;  2DOD A;  4BKX A;  3CC2 I;  1WWX A;  4Y17 A;  2A07 F;  2MC4 A;  3J7A O;  2B9S A;  4BJ6 C;  1FYL A;  1W1W E;  3KFW X;  3CUO A;  2IGM A;  1GXP A;  3TO7 A;  4H4K C;  1RC9 A;  5H20 A;  5L3G A;  2DFH A;  2QCO A;  1DQU A;  3SEZ A;  4LK1 F;  3IHU A;  4EGZ A;  4CH7 A;  2LKS A;  2OC6 A;  1IXS B;  1IJW C;  2ISZ A;  3HOW J;  5GPA A;  4HV5 A;  4JK1 X;  4PZJ A;  3TDZ C;  3JR9 A;  3ZQH A;  4AD9 A;  4DJA A;  1NHA A;  1W7P B;  3RYR A;  1Q1H A;  4NHJ A;  4E7Z A;  3WE2 A;  4IEJ A;  1WRJ A;  1TP4 A;  1LPQ A;  3S2D J;  2V6C A;  2D1V A;  1MZB A;  4UXN A;  3DBH B;  2ELH A;  1IN8 A;  1B6A A;  3RPU D;  5E8G A;  1YRN B;  4E70 A;  3QP6 A;  2VL8 A;  2KP6 A;  2V1N A;  5LRR A;  2IRF G;  1HOM A;  2A69 F;  2GBY A;  3C2G A;  3K4N A;  3VSL A;  4G9Y A;  2ESH A;  4V2F A;  1Z1D A;  4KA4 A;  5TIS C;  3I56 I;  5CYV A;  1ZTR A;  1VTN C;  1I5Z A;  1U2W A;  4ENM A;  3WG9 A;  1QVU A;  4FIS A;  3JRB A;  1PYV A;  2L9R A;  2GA2 A;  2KZV A;  1D1B A;  1YRN A;  2R7Q A;  4UY8 I;  4EJV A;  3I4P A;  4XLH A;  1SVL A;  4IL6 C;  4LIV A;  5IPA A;  4EM1 A;  3S2H J;  6PAX A;  1ETQ A;  4N4N B;  4XOP A;  3M8J A;  3WTY C;  2XGC A;  1GV5 A;  3GLL A;  2XGX A;  2WWY A;  1FBQ A;  2BHY A;  3TGN A;  2YU3 A;  3LFK A;  3LWF A;  2J5P A;  3HKZ N;  4NQW A;  1IN4 A;  3G3Z A;  4AM3 A;  4NC6 A;  2JJ7 A;  4HX4 A;  5IT9 K;  2HTS A;  2VJ5 A;  2VT3 A;  1O3T A;  3ABU A;  2ZCW A;  2OU2 A;  3BJA A;  3CJN A;  3K4C A;  3I59 B;  3KP2 A;  2R4G A;  3P9K A;  3OS0 A;  3CZ6 A;  2VE9 A;  3ZMT A;  3HOS A;  1Y8R B;  3E97 A;  3GTP J;  1D5V A;  4PGH A;  1LFP A;  2XKP A;  3NAR A;  4Y4R A;  1R23 A;  1GVJ A;  1SVO A;  3M8F A;  3CME I;  2LRE A;  1F43 A;  2FBH A;  5F08 A;  1K4T A;  1MMA A;  2VOO A;  4HQM A;  3GME A;  2XAU A;  1OR7 A;  4UB8 C;  4UUS A;  2F5V A;  3MKL A;  4IKF A;  4M3G A;  2IGO A;  1IN7 A;  2R93 J;  3BG5 A;  3LQQ A;  3I59 A;  2CV1 A;  1L0O C;  4FQG A;  5DYM A;  5HLG A;  1TBX A;  5E3M A;  3CUQ B;  3O3K A;  4IOA F;  1LKX A;  1KQ0 A;  1JGG A;  3W6V A;  2VJI A;  1F9N A;  2JPC A;  2Y69 H;  4I0A A;  3OIO A;  2ZFU A;  3VOE A;  4HNT A;  2W84 A;  1SAX A;  3ZMV A;  1OLT A;  4U87 A;  3K70 C;  3ZN1 A;  2IVM A;  5AON A;  1QGP A;  2ZJP F;  4ESB A;  2ZXH A;  4ZDP A;  1MBH A;  2E1C A;  4XSX F;  2EIM H;  4DNC A;  3OWT A;  4I7H A;  3E6C C;  5K7H A;  2CYY A;  1NK2 P;  5FRO A;  3IH2 A;  3C7J A;  3MEX A;  3OIQ A;  3P5J A;  3EUH C;  3LL7 A;  1B4A A;  2GXG A;  4QTR A;  2R7R A;  3CDI A;  3G1M A;  3GUD A;  4XN0 A;  3BDD A;  1T95 A;  3IWF A;  4ZYA A;  3OOP A;  5HDN A;  1G8X A;  4BY1 J;  2K9N A;  3IV5 A;  1WJC A; 
#chains in the Genus database with same CATH homology
 1SD5 A;  2EWN A;  4YFN F;  4MEY F;  2NRA C;  4O5V A;  2IA2 A;  5LRS A;  3T1B A;  1ONV A;  2ZXJ A;  5CVV A;  1H9T A;  2FBK A;  3MQ0 A;  1Z6R A;  2B0L A;  2XAF A;  3FXU A;  1SFE A;  2JTV A;  2EA4 A;  3V8J A;  1XSX A;  2G7H A;  3ZP5 A;  1LEB A;  1Z6T A;  2HGC A;  4AIJ A;  2RN7 A;  4HOB A;  2HFH A;  1ZLJ A;  3K9T A;  2DK8 A;  1O3S A;  5FFZ A;  1XMK A;  5DEQ A;  1W7P D;  4WCG A;  2EA2 A;  1UCR A;  2M8E A;  3TDU C;  1J0R A;  5FLX Z;  2OD5 A;  4CDG A;  1R00 A;  1IXR C;  2P7V B;  3CO6 C;  4IRG A;  1PP8 F;  1D8J A;  5ILV A;  3WTZ A;  1S7O A;  5FGM A;  3I71 A;  1B9M A;  4G6Q A;  3WTX C;  1FSE A;  4FHT A;  4IF4 A;  4L0Z B;  2PN6 A;  1U5T C;  4H0E A;  1O57 A;  2ZBK A;  4EJO A;  1YIO A;  1U8R A;  2Q0O A;  1QZZ A;  2Y0M A;  2MC3 A;  4NB5 A;  3I64 A;  2ETH A;  2ZO4 A;  4ZYG A;  2YR2 A;  4GYI A;  3SXY A;  4YG2 F;  1SFU A;  2PFB A;  3C3W A;  5CJ9 A;  4O6J A;  4FX4 A;  1D8K A;  4HZF A;  4UVA A;  3EUH A;  5ICE A;  3U1D A;  4U7B A;  3BWG A;  4P96 A;  5DCF A;  4HF2 A;  2OQG A;  1UHW A;  2GZW A;  1X3U A;  3BPV A;  1YFH A;  5TJJ A;  3MZH A;  2QEN A;  3WTU C;  5L3E A;  3LA3 A;  3GEZ A;  2KIM A;  1XMA A;  2Z99 A;  2HOE A;  3T0Y A;  4ENJ A;  4S05 A;  1LJ9 A;  3P7N A;  1BI2 A;  2JT1 A;  5FD6 A;  4G8X A;  3R61 A;  1LDJ A;  2ZJ2 A;  4XRF A;  3K1M A;  2OQR A;  2QBY A;  2DPD A;  5D4S A;  2VN2 A;  1J7K A;  3W6J B;  2Z9O A;  2K86 A;  3GVA A;  4YIF A;  2P5K A;  2Z5U A;  3L09 A;  1FX7 A;  3ELK A;  5D4R A;  1FPQ A;  2MA3 A;  1SFX A;  3E6M A;  4N9I A;  3DPT A;  3COA C;  2L4A A;  4HYE A;  4RGU A;  3GF2 A;  4M6Y A;  4HQE A;  1K79 A;  3FM5 A;  4LFU A;  4WXC A;  2FEZ A;  1BC7 C;  3MCZ A;  4GO1 A;  3SHF A;  4MQ9 F;  1BIB A;  5FB2 A;  1Z9C A;  4OMY A;  3JTG A;  3V8K A;  4XSZ F;  4MTD A;  3BOQ A;  4IRI A;  4EV0 A;  3I53 A;  3KZY A;  4KN4 X;  2FF4 A;  1D3Y A;  1E2X A;  2A6E F;  3QU6 A;  1G3S A;  2K4B A;  2KRF A;  5D6F A;  1XCV A;  4XLN F;  2F2E A;  2STT A;  4I09 A;  4ZZD A;  3F22 A;  2F5F A;  1IW7 F;  3KE2 A;  2DW4 A;  1KYZ A;  1YS6 A;  3PQK A;  2EK5 A;  4EJT A;  3GZ5 A;  2XVC A;  4IRH A;  1RI7 A;  4UVB A;  1L3L A;  4YFX F;  4I98 B;  3KP5 A;  1EH7 A;  1QQI A;  2DI3 A;  1LQ1 A;  3ISP A;  2HQR A;  2W85 A;  3LA2 A;  5E18 F;  3WTS C;  2YPR A;  1LB2 A;  4P9F A;  3GW2 A;  1IRG A;  3REO A;  1G3T A;  2CG4 A;  2STW A;  2GQQ A;  2FU4 A;  4LLL A;  5K1Y A;  2PI0 A;  2HZT A;  5DD4 A;  1KQ8 A;  1ZG3 A;  2GWR A;  1UST A;  2CW0 F;  2ADU A;  2EFW A;  4BNC A;  2KKO A;  5JR3 A;  2V1X A;  3LAP A;  2F5C A;  1XSV A;  1P4A A;  2Z3Y A;  3H3Z A;  5FFX A;  3N4M A;  4O3M A;  3E5Q A;  1DDN A;  1J2X A;  4LGW A;  4EJW A;  5DDG A;  1HKS A;  1DPR A;  2UWM A;  3RI4 A;  1G3Y A;  3E5U A;  1UHM A;  1HXD A;  2GAU A;  1PUE E;  4WWC A;  4KYW A;  5IT3 A;  3TOB A;  2KJC A;  4U7D A;  2VBW A;  1ON2 A;  2ZME B;  2D1H A;  4G7Z F;  1T0F A;  3D0S A;  3ECH A;  4AVP A;  2VBX A;  1JGS A;  2AS5 F;  1F1Z A;  2EFN A;  3QOP A;  4ESF A;  2XRO A;  3L7W A;  2Z33 A;  3HYI A;  4I02 A;  4IPA A;  4ZYE A;  1XDU A;  3DFG A;  2ZME A;  1O7L A;  2H6C A;  3FWE A;  2P5L C;  5D5W B;  2GIV A;  3RDI A;  3HSF A;  2EV0 A;  3HSR A;  5E17 F;  1S7A A;  3WE3 A;  4RS8 A;  5BS6 A;  2WV0 A;  3H92 A;  4HX8 A;  1R36 A;  1U78 A;  4EJU A;  3F6V A;  3U9G A;  3AAF A;  4ENK A;  3G73 A;  3RTR A;  1MJ9 A;  4IXA A;  4B09 A;  1YG2 A;  1ZN2 A;  4U0W A;  4HF1 A;  1S8N A;  2A61 A;  2FE3 A;  2FBI A;  3I5U A;  1BI1 A;  2MLK A;  2K7L A;  4HBL A;  2CSO A;  4LB5 A;  5DD8 A;  4YFK F;  5HS7 A;  3ERE D;  1R7J A;  2G9W A;  4Q47 A;  3F23 A;  2HKO A;  5F1R A;  4WXD A;  2A68 F;  2HR3 A;  3EYI A;  3P9I A;  1FP2 A;  4LJZ F;  5LEJ A;  4IHT A;  1IN6 A;  2DPU A;  4L5I A;  1CGP A;  5CLS A;  3KP7 A;  2FQ3 A;  4Y13 A;  2DBB A;  2NYX A;  4A5N A;  2L02 A;  3J81 K;  4QLC U;  1IUY A;  3F8B A;  3HSE A;  3SQN A;  2VON A;  3RKW A;  1J75 A;  4KIG A;  3T8R A;  5D5V B;  1HST A;  2RDP A;  5HS8 A;  4ON0 A;  3HRU A;  3T5X A;  1I27 A;  4MGR A;  1PDN C;  2JPB A;  3CLO A;  4ZYD A;  2R7D A;  3JSP A;  3NEU A;  4CYD A;  2NAZ A;  1WQ2 A;  3HRS A;  1TNT A;  4A6E A;  2R3S A;  2ACJ A;  3FM3 A;  4HF0 A;  3P9C A;  4FT8 A;  5D6E A;  1HW1 A;  1RIO H;  3R4K A;  1W5S A;  3KLO A;  1EV7 A;  4KIC A;  2H94 A;  4AIH A;  2DFI A;  2XAJ A;  1KGS A;  4KUM A;  3FHZ A;  3B02 A;  2L4M A;  3I0T A;  1XD7 A;  4OIP F;  4Q5S F;  2FSW A;  4AWX B;  3WTT C;  3ROU A;  3LAJ A;  1ZRC A;  3I54 A;  1USS A;  3GFI A;  3ABT A;  2KJB A;  3JAM Z;  3D5L A;  4JBA A;  1RUO A;  3N97 A;  3F8F A;  2MLG A;  2BV6 A;  1U3E M;  3DP7 A;  3ZQ7 A;  5JFR A;  3R6S A;  3VOD A;  2IA0 A;  4M9X A;  1G4D A;  3L00 A;  1STZ A;  2IT0 A;  2XIG A;  5L3D A;  4Q48 A;  4G94 A;  3F8N A;  4WK8 F;  1HBX G;  1IF1 A;  4L9T A;  2XRN A;  3VB2 A;  3QPH A;  2ISY A;  3V8L A;  3RYP A;  1H0M A;  1OYI A;  3BPX A;  3ZMU A;  1KA8 A;  2QQA A;  3WGG A;  1KU3 A;  2O3F A;  1CF7 A;  3K1N A;  4OIQ F;  4PDK A;  2XHK A;  4P5O A;  3FX3 A;  3E6D A;  3FXR A;  1PP7 U;  4JQF A;  5AIP A;  2DQL A;  3GLX A;  1HW5 A;  3K0L A;  2DAO A;  1WI9 A;  1YLF A;  1G6N A;  5H6Q A;  1XCB A;  5EEH A;  3GX4 X;  4QWQ A;  5F64 A;  4EMS A;  3BJO A;  3HOT A;  2FOK A;  1V4R A;  4U88 A;  5E20 A;  5LHG A;  1K78 B;  2FRH A;  2W24 A;  3WGI A;  3DV8 A;  1FLI A;  5IT9 Z;  3J80 K;  3QU3 A;  3F8C A;  3FF5 A;  1TLH B;  1TW3 A;  5A2Q K;  1ON1 A;  2PLY A;  4WXH A;  5DUK A;  4WX9 A;  4RB2 C;  1K78 A;  5J8F A;  3C1D A;  3K1P A;  2JZY A;  2X0L A;  4M6X A;  1BN5 A;  2W25 A;  4HX7 A;  1QZY A;  1I1G A;  4UV8 A;  1YTY A;  1I1S A;  1ULY A;  3B73 A;  4HA8 A;  1ZGA A;  1UFM A;  4RB3 C;  1OPC A;  3GWZ A;  1FBS A;  3BP8 A;  1ZAO A;  4PCQ A;  2V79 A;  1RNL A;  4XBF A;  3V4G A;  4M9S A;  2QBY B;  4P9U A;  3E3V A;  3LA7 A;  2PQ8 A;  2NNN A;  2KIU A;  3ZMD A;  1J5Y A;  1TQM A;  3TKY A;  3IL2 A;  5CVR A;  1UB9 A;  3CDH A;  2EFQ A;  2HYG D;  2XAS A;  2FNP A;  2DLL A;  3TQN A;  1HSJ A;  3S2W A;  1K7A A;  4A6D A;  4RGR A;  5BOX A;  5LEK A;  5L3F A;  4M74 A;  4RB1 A;  1A04 A;  3JTH A;  2IP2 A;  2XUB A;  1JHF A;  3VEP A;  5H6R A;  2VE8 A;  2NS0 A;  3HRM A;  1OMI A;  3CTA A;  3V7S A;  1U5T B;  2HTJ A;  3HHG A;  1RUN A;  3R0J A;  1XGN A;  3F21 A;  3JSO A;  5CVU A;  4ENN A;  2MD5 A;  3GFM A;  1E17 A;  1FYM A;  1ZH5 A;  2YX7 A;  5ERI A;  1R1U A;  4EM2 A;  4HAM A;  1IXC A;  4MHG A;  1U5T A;  4M73 A;  1KU2 A;  2HKX A;  5K5O A;  3L9F A;  5CVI A;  2Y75 A;  1O3R A;  3ZN0 A;  3QRF F;  4L9V A;  4OU0 A;  4M9Z A;  4A0Z A;  2XAG A;  1J9I A;  1KQ9 A;  1MKM A;  3WU1 B;  4KMU X;  2JSC A;  3O2P E;  2DU9 A;  5BMZ A;  3U2R A;  5K5Q A;  4GXO A;  3F6O A;  2A5Y B;  2A3S A;  2UZK A;  5D5U B;  3FMS A;  3WU0 A;  2CO5 A;  3GYH X;  2HYF A;  1SMT A;  4P55 A;  1P4X A;  1I6X A;  3DPL C;  1MJA A;  3NRV A;  1FP1 D;  1DUX C;  3GO5 A;  4KIF A;  1DP7 P;  2HQN A;  3C18 A;  3HHH A;  3ECO A;  4RB0 A;  4M72 A;  1JE8 A;  4L9J A;  2FML A;  3RPU A;  5E1Z B;  2UXX A;  3WOD F;  1FC3 A;  3WTV C;  3WGH A;  3EDP A;  3GFJ A;  2ESN A;  2M30 A;  5LGN A;  1XN7 A;  3EQL F;  1FNN A;  4U0V A;  2GA1 A;  3KP4 A;  2C6Y A;  4UV9 A;  5ILS A;  1GXQ A;  3FMQ A;  3E5X A;  4LK0 F;  3DF8 A;  3MWM A;  1S29 A;  1FSH A;  3TO6 A;  2Q8K A;  5D5X B;  2P6T A;  1MJB A;  1BC8 C;  2OBP A;  3KEO A;  3GFL A;  3FXQ A;  3RKX A;  3QPT A;  5J8C A;  1B59 A;  1GHC A;  3SZT A;  1OYW A;  1XSD A;  4RAY A;  3KCC A;  1U6G A;  5TRD A;  4L18 B;  4WF2 A;  1T6S A;  1KU7 A;  1QO0 D;  2LKP A;  4BH9 A;  3QP5 A;  3BZ6 A;  2HDC A;  5EEG A;  1J59 A;  2ZNZ A;  1KU9 A;  2P5V A;  3MZY A;  4N0B A;  2UXN A;  3V7R A;  1BI0 A;  2MBF A;  4G7H F;  1Z7U A;  4HV6 A;  4LB6 B;  4OIN F;  3GZ6 A;  4LLG F;  3TOA A;  4B8X A;  4RGX A;  5LGT A;  2K02 A;  3M9A A;  5ICF A;  1W4M A;  2XAQ A;  2EV5 A;  2QZ8 A;  1HKQ A;  1BM9 A;  2EFO A;  2IPQ X;  2O8X A;  4G7O F;  2MH2 A;  1YS7 A;  5HLH A;  4CHU A;  2D45 A;  1YYV A;  4FX0 A;  3KP6 A;  1QPM A;  1YW7 A;  5JVT A;  4KNY A;  4LLN A;  2J5O A;  1IRF A;  1KYW A;  3CUQ C;  1EH6 A;  5E8I A;  2PBI A;  1SD4 A;  5DV5 A;  2HWV A;  2V1U A;  1O3Q A;  3IRQ A;  1QBJ A;  4EVI A;  3VFZ A;  4LG0 B;  2QLZ A;  5HDK A;  4HDV A;  3TO9 A;  1HQC A;  3RPQ A;  1JXS A;  1R22 A;  1BI3 A;  5HLI A;  1R5H A;  2PJP A;  2IJL A;  3E6B A;  3ZMZ A;  2XKO A;  4LG0 A;  3K69 A;  2OAZ A;  1W7P A;  3H3U A;  3CO7 C;  3FZV A;  5FLX K;  2FMY A;  2KIF A;  1TW2 A;  4ZYH A;  5HOO A;  4BQA A;  5DUI A;  2DQR A;  4R1H A;  1XGM A;  1YW9 A;  1AWC A;  1LNW A;  2FXA A;  1FT9 A;  4BHP A;  3Q9S A;  1G3W A;  4R79 A;  2EV6 A;  2BEO A;  1T2K A;  1YQA A;  1OYY A;  3IKV A;  5F6F A;  1ZHF A;  1P92 A;  1BJA A;  1JHH A;  4CO8 A;  2O6G E;  2LNB A;  2K4J A;  1P2F A;  2DK5 A;  2HEO A;  2AXL A;  1TTY A;  4MTE A;  5FO5 A;  2H27 A;  2K27 A;  1FBU A;  2O0Y A;  2R7F A;  1DPU A;  4UHT A;  5ILU A;  2ZNY A;  1FY7 A;  2WTE A;  1IN5 A;  2OZU A;  1P4W A;  2RGV A;  1T38 A;  2DO7 A;  2VBZ A;  4LD5 A;  1SD6 A;  1ZG5 A;  3CUQ A;  1XGO A;  1LDD A;  4AIK A;  3KP3 A;  4A2U A;  4CXF A;  1S6L A;  5ICC A;  3PQJ A;  1LEA A;  1BBY A;  4GGG A;  4ZH4 F;  5JI6 A;  3FMR A;  1OKR A;  5J6X A;  3R60 A;  2QQ9 A;  2VT2 A;  4I01 A;  1CF7 B;  3HTU A;  4BXU A;  3LST A;  2PG4 A;  1ODD A;  4EGY A;  2L3D A;  4N9H A;  4TV7 A;  2QYO A;  4CIC A;  2IA1 A;  3ZMS A;  2RC4 A;  3F8M A;  2P6S A;  4KT5 C;  2L01 A;  3DEU A;  1TQI A;  1HW2 A;  4UUV A;  4HLX A;  3LQR A;  2ZKZ A;  2E1N A;  3O6B B;  3J81 Z;  3ULQ B;  4ETS A;  3HIF A;  1C0W A;  1W5T A;  2W57 A;  5HDG A;  4ASN A;  1R1V A;  3V7C A;  3F3X A;  4GYG A;  4A0Y A;  4RAZ A;  1K6O A;  1B1B A;  4UNO A;  3MFK A;  1H9G A;  2ZFW A;  3RIR A;  4LMY A;  2TDX A;  4Q4Z F;  3BY6 A;  3IWZ A;  1S3J A;  2QQB A;  4OIR F;  2P7C B;  4BHC A;  2EFP A;  2VOP A;  4MNU A;  2G7U A;  4S04 A;  1MGT A;  3HTS B;  1ZRE A;  5LGU A;  5AIQ A;  4IJA A;  1RZ4 A;  2LSO A;  2P8T A;  4BYY A;  2QM3 A;  2EB7 A;  2RQP A;  2CGP A;  1EH8 A;  1LDK B;  3RKY A;  5E1X A;  2WC2 A;  4EM0 B;  3HUG A;  4OOI A;  1FWZ A;  1B9N A;  3K2Z A;  5L3C A;  4L0Y B;  4BAY A;  5JHU A;  5D8L B;  2GXB A;  2F5E A;  4A12 A;  4M71 A;  1R1T A;  3IKT A;  2YX4 A;  3KET A;  5HVQ C;  2CFX A;  4K2E A;  5LHI A;  3M7G A;  3F72 A;  3DKW A;  4ESJ A;  5D8K B;  2RV8 A;  2A6H F;  3R0A A;  2XAH A;  4U0Y A;  3PFI A;  4UVC A;  2VC0 A;  2M1B A;  4BHB A;  2VXZ A;  5KVR A;  3WTW C;  1YW8 A;  2PMH A;  4XLP F;  3BRO A;  4YII A;  2FNA A;  2JRT A;  5CVJ A;  3SFZ A;  3I58 A;  3ML6 A;  1AOY A;  3EYY A;  2QUF A;  3BJ6 A;  2Y48 A;  3M1E A;  2YSR A;  4KDP A;  3IC7 A;  4L5J A;  4GCV A;  5LLQ A;  2XV4 S;  2FA5 A;  1ZG1 A;  2O61 A;  2DTR A;  1R5G A;  2DT5 A;  1REP C;  1MDM B;  4G6D A;  1QNT A;  4Z2Y A;  4F7Z A;  1SD7 A;  1SMY F;  2QVO A;  2OZ6 A;  4KN7 X;  2LF8 A;  2PMU A;  1IAW A;  2P4W A;  4IVN A;  4ZZL A;  3Q5F A;  2MH9 A;  2OA4 A;  5DCM B;  1T98 A;  1MDM A;  1F5T A;  3KLN A;  4A5M A;  3KZZ A;  2BGC A;  1FZP B;  3JW4 A;  3J80 Z;  3EET A;  1YO5 C;  1FYK A;  3L2C A;  1XDS A;  4L9N A;  5A2Q Z;  4A0X A;  5DCM A;  2HS5 A;  1WSU A;  2F5D A;  2V9V A;  1TNS A;  1HKT A;  3SZP A;  3Q9V A;  2BE5 F;  5L3B A;  2IW5 A;  5FD5 A;  2EJR A;  4MQV A;  2E7W A;  1P6R A;  3M8E A;  1Z91 A;  3OV8 A;  5BQT A;  2H09 A;  1XGS A;  2H6B A;  4RGS A;  4MEX F;  3DQV C;  2VC1 A;  3W6K B;  1LVA A;  2CQK A;  2QWW A;  1ZLK A;  4HW0 A;  3T8T A;  4HDU A;  2LDU A;  4I2O A;  1V3F A;  2CWE A;  2M5W A;  5BPI A;  4KMF A;  3DXJ F;  3ZPL A;  5BPD A;  1Y0U A;  2M87 A;  2BYV E;  2L54 A;  1TQP A;  2RKH A;  4KIB A;  2M45 A;  4KFC A;  4DQ2 A;  4IHS A;  2COM A;  3IRR A;  1XB4 A;  5HS9 A;  2VOD A;  1MD0 A;  3GXO A;  1BOA A;  5ICG A;  4Y15 A;  4I0B A;  2BBY A;  5E1W A;  3KEQ A;  1T39 A;  5LBQ A;  1ZRD A;  2V1D A;  2RNJ A;  1O7F A;  2PEX A;  4OIO F;  4OMZ A;  2RVC A;  5ED4 A;  4HLY A;  1ZYR F;  1ZGJ A;  1BIA A;  3HRT A;  1F4K A;  2LF7 A;  1IZ1 A;  4PGG A;  5KK1 A;  5LHH A;  2VBY A;  2D2W A;  1R58 A;  2O03 A;  3NQO A;  1ZRF A;  4D0P A;  1Z05 A;  4CZZ A;  2E7X A;  3MAJ A;  1WKM A;  4R8H A;  5K5R A;  2NNY A;  1FOK A;  3QAH A;  4CGZ A;  2X4H A;  1ZAR A;  3JAM K;  2Q2E A;  3RJP A;  4EQQ A;  1WWX A;  4Y17 A;  2A07 F;  3J7A O;  1FYL A;  3KFW X;  3CUO A;  1GXP A;  3TO7 A;  5H20 A;  5L3G A;  4LK1 F;  3IHU A;  4EGZ A;  1IXS B;  2ISZ A;  4HV5 A;  4JK1 X;  4PZJ A;  3TDZ C;  4AD9 A;  1NHA A;  1W7P B;  3RYR A;  1Q1H A;  4NHJ A;  3WE2 A;  1WRJ A;  2V6C A;  2D1V A;  1MZB A;  4UXN A;  2ELH A;  1IN8 A;  1B6A A;  5E8G A;  4E70 A;  3QP6 A;  5LRR A;  2IRF G;  2A69 F;  4G9Y A;  2ESH A;  1Z1D A;  4KA4 A;  5CYV A;  1VTN C;  1U2W A;  1I5Z A;  4ENM A;  3WG9 A;  2GA2 A;  4EJV A;  3I4P A;  4EM1 A;  6PAX A;  3WTY C;  2XGX A;  2WWY A;  1FBQ A;  3TGN A;  2YU3 A;  3LFK A;  3LWF A;  2J5P A;  4NQW A;  1IN4 A;  3G3Z A;  4HX4 A;  5IT9 K;  2HTS A;  2VT3 A;  1O3T A;  3ABU A;  2ZCW A;  2OU2 A;  3BJA A;  3CJN A;  3KP2 A;  3I59 B;  3P9K A;  2VE9 A;  3ZMT A;  3HOS A;  3E97 A;  1D5V A;  4PGH A;  2XKP A;  1R23 A;  1GVJ A;  3M8F A;  2FBH A;  2VOO A;  4HQM A;  1OR7 A;  1IN7 A;  3LQQ A;  3I59 A;  1L0O C;  5DYM A;  5HLG A;  1TBX A;  3CUQ B;  3O3K A;  1KQ0 A;  1F9N A;  2JPC A;  4I0A A;  3VOE A;  2W84 A;  1SAX A;  3ZMV A;  3ZN1 A;  2IVM A;  5AON A;  1QGP A;  4ESB A;  2E1C A;  4XSX F;  4DNC A;  4I7H A;  3E6C C;  2CYY A;  3C7J A;  3MEX A;  1B4A A;  2GXG A;  3GUD A;  3BDD A;  3IWF A;  3OOP A;  5HDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...