1IDZA

Structure of myb transforming protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idzA00
4GFBA 3B6AA 4FE4A 4DZJA 4AC0A 3GTJJ 2OF7A 2G0EA 4A3FJ 5IP7J 2E2IJ 3O8HA 1AKHB 1QVUA 3LSJA 5EF6A 2RAEA 1R9TJ 2EZKA 1JT0A 4D5CA 2HOAA 2LVSA 4CYCB 4B1RA 2HI3A 3HKZN 1NK3P 1JUPA 4Y7NJ 2R93J 1EF4A 2NS7A 1QPIA 4C3HJ 2YUSA 1IRZA 3CDLA 1HDPA 5K7ZA 9ANTA 1F43A 5HODA 3CCYA 5FLMJ 3S16J 2CRGA 2K9NA 3A01A 3GTLJ 2L7FP 1LFBA 2OPTA 1RETA 1ZTRA 2XPUA 2E1OA 1T33A 3BR2A 2EBIA 4B3AA 3BG5A 1VFCA 2O8KA 2YU9J 3BTJA 2WB1N 2VKEA 4M3GA 4HNVA 2JJ7A 3L1PA 3JREA 3DCFA 3HOYJ 2HQ5A 3QPSA 4I76A 2WV1A 4FTHA 2DA2A 5FKMA 2ME6A 2HXOA 3MVPA 2KDZA 3GTPJ 2R7ZJ 2L9RA 2JA8J 4BKXA 5C4XJ 1JUMA 3BR0A 3S15J 5J3LA 3OOUA 1JTXA 2XGCA 4XK4A 1RR7A 4IHYA 1JGGA 2XGDA 3BR3A 3BTIA 2ECBA 2KT0A 2EQRA 1GVDA 1WPKA 3MKLA 3K7AJ 5FKOA 3JRAA 4UUTA 1BW5A 2LD5A 4DYRA 1JKRC 5IYCJ 2R92J 3HGYA 1IDZA 3VPRA 5C3EJ 1XS9A 1RKTA 2WAQN 3JRHA 2QF7A 3G1LA 1ZGWA 1Z77A 1GDTA 1PUFB 1JT6A 2NVQJ 1HOMA 1ETQA 5GPCA 2XSDC 1FIAA 2MG4A 5EG0B 3RZDJ 1S7EA 3F0CA 2ECCA 2R0QC 4DZPA 2O7OA 2XPWA 3BQYA 5EG0A 4S0HB 2E2JJ 4A3CJ 2FQ4A 1P7IA 5K7HA 1WH7A 1OCPA 3H0GJ 3M3YJ 5IP6A 3PO2J 3S2HJ 3TW6A 3ZQIA 3G1MA 1OCTC 3HB9A 1WH5A 2DA6A 5IOZA 1OJLA 1HLVA 5JLXA 3BTCA 4JP0A 3BTLA 3S1QJ 1VF9A 3JRFA 3JRGA 1IGNA 3CQZJ 2XB0X 4ABZA 2NVTJ 3A03A 4A3IJ 2O9LA 3HEFA 3FK6A 3GBGA 1YRNA 3GTKJ 1T56A 5J1YA 3JRIA 3SJMA 3A02A 5FJ8J 4W97A 4A3MJ 2LFBA 4X6AJ 3BG9A 1Q1VA 1YRNB 2CQXA 1ZR2A 2DA5A 2CUEA 1B72B 2ZB9A 2EZLA 2DA4A 2K9QA 4AYBN 4BY1J 2XGEA 3QPLA 1AU7A 2R5ZB 4J19A 1QRYA 1E3OC 1Z0XA 2HDDA 1FTTA 5F04A 2EZHA 2LTPA 3E7LA 2DA7A 2LY9A 1I6HJ 1P7JA 1DU6A 5GP9A 2CJJA 4MFEA 4C2MJ 3S1NJ 1MSFC 1HDDC 5F08A 5E3LA 3I4NJ 1MNMC 2JWTA 4B4CA 2Y31A 2R5YA 5C4JJ 2DMUA 1ORKA 2Y9YA 2GLOA 3Q0UA 2Y30A 5IYBJ 1ZQ3P 3TW7A 2CQQA 5EEAA 2MSYA 3TEDA 2QCOA 3QQAA 3ZQLA 2E19A 4AUXA 4IHVA 2JA7J 1JUSA 1ZK8A 4A3DJ 4MLOA 1TWAJ 1I3QJ 5BNGA 3OIOA 3I4MJ 5M5YJ 4D5FA 3PM1A 2DMPA 1IUFA 3JRCA 3SDGA 2TRTA 3C2BA 1ETYA 1K83J 3BR6A 3BR1A 2R5ZA 1IJWC 1AKHA 2M8GX 5J1UA 1MBGA 4RBOA 3S17J 4I6ZA 1JJ6C 5EGOB 5EDNA 3BQZA 5M5WJ 3JRBA 4D7MA 2VPRA 5EZHA 2JA6J 3K2AA 1D5YA 1MBFA 5E3NA 5E3OA 5E3MA 3D1NI 1FIPA 4IHWA 4XICA 2LR8A 1BA5A 1BW6A 3NARA 3ZQGA 5M3MJ 1G2HA 2HYJA 4NDLA 3IH3A 5DS9A 5M5XJ 2LK2A 2D5VA 1BJZA 2DMNA 1K61A 2XPVA 4FCYA 4DW6A 2AO9A 2DJNA 2FD5A 3HOZJ 1IV6A 1LFUP 1JKPC 4UUSA 3IH4A 3HGGA 3S1MJ 1U9NA 1UG2A 3H3VK 1TWFJ 2I10A 1ZR4A 1F36A 1MBHA 1DU0A 1B8IA 1SANA 5K7FA 2NVYJ 2PMZN 5IPAA 4DYCA 2K40A 3JRDA 2HOTA 2X48A 2H1KA 1XG1A 3Q0WA 1MSEC 4V2GA 4C3IJ 1QVTA 2M2EA 3MN2A 1ETWA 2CU7A 4JYKA 1OFCX 2M0CA 2EH3A 1H8AC 2W48A 4RDUA 1SFOJ 1ETXA 4CYCA 2E2HJ 1WGXA 2JN6A 1LE8A 1U78A 3HOUJ 1IG7A 2NVXJ 3FISA 2DN0A 2H8RA 2GM4A 2IEKA 3B6CA 3GTOJ 1MBKA 2HOSA 5IOYA 4IHXA 3ZOBA 1ETVA 1I50J 1H88C 3OSFA 3Q3SA 3A01B 1BL0A 1ETKA 4BY7J 2TCTA 3IH2A 1TWGJ 2X9DA 3LOCA 1ITYA 1FEXA 1TWHJ 2L0KA 2AHQA 1AHDP 3GTMJ 4QIWN 2LP0A 1XC5A 4D7NA 1O4XA 5FLVA 3LSRA 2DA3A 1MBJA 3S14J 4A3BJ 4A3KJ 3LNQA 4BBSJ 3O8GA 2COBA 5EGOA 4EEFG 2B63J 3CMYA 1H89C 3TP3A 3NAUA 3HOWJ 4QSHA 3OSGA 4M3FA 4XRMA 2JMWA 3ZQFA 1IDYA 2P81A 2ID6A 5IP9J 4X1EA 5C44J 3HOXJ 4BXXJ 2MW8A 2XB5A 5F0HA 2DMTA 3GTGJ 1ENHA 3PO3J 1MH3A 3BG3A 4QTRA 4L5EA 4XRSG 3WHBA 1APLC 3RZOJ 1GV2A 1GV5A 2DA1A 2GBYA 4M3BA 3RKQA 2LLKA 4MIMA 4UUSB 2R5YB 1JKQC 2ELKA 1X2MA 1MBEA 2N8GA 3BR5A 5JLWA 4A3JJ 2VKVA 1JTYA 1X58A 4XIDA 1IC8A 2DMQA 1CQTA 1WCMJ 4A69C 1X2NA 4JX4A 2VI6A 3JR9A 1MH4A 5F0FA 1W0TA 3LSPA 1B8IB 3UKGA 3HDDA 5FKKA 1VNDA 1GT0C 2ID3A 4A3EJ 3IV5A 3SFIA 1ZKGA 1RPWA 1VI0A 1FTZA 4A93J 3W6VA 2M34A 3S1RJ 1A6IA 4A3LJ 3RQIA 2VUMJ 5F0CA 1LE8B 1UMQA 3FKIJ 1Y1WJ 1FJLA 1ETOA 3HBLA 4M3DA 2DTZA 5J1RA 1A5JA 2L7ZA 2M9HA 1UHSA 4JX5A 2CUFA 1JKOC 5GPAA 1Y1VJ 3M4OJ 4LOCA 3DEWA 2MGQA 4M3EA 5EZGA 5FKNA 4G12A 5EYRA 4DYQA 2XRLA 3FIWA 1POGA 2Y0SN 3WHCA 3Q0VA 1B72A 3S2DJ 3HOVJ 5FKLA 3LSGA 1NK2P 4XRSA 2K9SA 4FE7A 4V2FA 5F1JA 2ME0A 2JK3A 5M3FJ 4BBRJ 3FK7A 2HXIA 2YS9A 3BT9A 2Y9ZA 1HF0A 2IAIA 1RKWA 2IBDA 4W1UA 2LKXA 2JA5J 3G1OA 4JX6A 3ZQHA 1TWCJ 2NS8A 4IEJA 2FJ1A 1TC3C 3HM5A 1W0UA 5DTDA 1GUUA 1PUFA 2L7MP 4MFDA 3TP0A 2FX0A 2NOGA 5F27A 1HCRA 2Y2ZA 4A3GJ 2X6OA 1U8BA 1WI3A 5IYDJ 4Y52J 1NTCA 2EZIA 1RESA 3ZQCA 3GTQJ 4MO7A 1JJ8C 1U9OA 4FISA 4M6VA 4C3JJ
chains in the Genus database with same CATH superfamily
4GFBA 1R22A 1Y8RB 4R8HA 4XLAA 4AC0A 2W85A 2YSRA 2JUCA 3RSNA 3GTJJ 2QUFA 1MDMB 5IP7J 4XBFA 3GF2A 3WE3A 3VODA 4RAYA 4D5CA 4CYCB 1TT5B 4NQWB 3J81Z 1JUPA 2R93J 2NS7A 3FDYA 2V4JC 5BPIA 1FX7A 3I9V2 2YUSA 3HOSA 1WJDA 3CDLA 3CMAI 3U1KA 3AL0B 1T95A 4HV6A 2BY1A 2A5WA 1MGTA 2OCCH 1TQPA 3KZZA 5FLMJ 3S16J 3A01A 4AVZA 4B8XA 3H0DA 3GTLJ 1J7KA 1LFBA 1WHUA 4HV5A 1J0RA 3DPLC 2R7XA 1RETA 2DQLA 2RREA 3VFZA 3ABKH 2E35A 2WWYA 2RKHA 2CYYA 2NS0A 2LF8A 3BG5A 4OINF 4B3AA 2YU9J 3WE2A 2VKEA 4HNVA 4IQ4A 2K85A 5LLQA 3CF2A 2JJ7A 1HW5A 5D8KB 2LSOA 1BOAA 4GYIA 3F9KA 3I71A 1T6SA 5FKMA 3I64A 2ME6A 1DPUA 3HHHA 1EH8A 1TW2A 5HOOA 1QU3A 1D8KA 2OQRA 2JRTA 2R7RA 2OU2A 5C4XJ 1JUMA 3S15J 4BJ5C 5J3LA 4XK4A 1MMNA 1RR7A 5H2FC 3K4JA 1IXRC 2KT0A 1SC7A 4CCJA 4I0BA 4CXFA 2R7OA 1WPKA 2WV0A 4CA0A 2QQBA 4PFPA 5FKOA 1VQ6I 2QQ8A 1VQNI 5DV5A 2J5OA 1JKRC 1W7PB 1G6NA 3BWGA 4HW0A 3V7CA 5K1YA 5C3EJ 1XS9A 2VPLA 3K70C 2QGUA 4XONA 1XGMA 1B4AA 1SD4A 3TQNA 1W4MA 3MQ0A 3FMSA 2NVQJ 3ZMSA 1ETQA 5GPCA 2MG4A 2M1BA 1BC8C 2XF7A 3K2ZA 3F0CA 2QSHX 3CJNA 2V1NA 1B9NA 3FXJA 2F4OB 4YELA 3CCLI 5EG0A 2FBKA 3DXJF 2ISYA 3O6BB 2E2JJ 4N4NB 3DV8A 4XL9A 2F4IA 4KITB 3WTXC 3I5UA 3WTTC 3H0GJ 3OYEA 1L0OC 5L3DA 5LHGA 1U0JA 3TW6A 1D0YA 2AS5F 4F93B 2ESHA 5JHFA 4N9HA 2HR3A 1OJLA 3DWLE 2X6WA 5JLXA 3H92A 4JP0A 2XHKA 1DPRA 3CDHA 1RR8C 1I27A 4U87A 1ZRCA 3JRFA 3K1MA 3JRGA 5FB2A 1OYIA 4ABZA 2NVTJ 1YW7A 3A03A 2OAZA 1X19A 1VQ9I 3FK6A 3GBGA 4DGWB 4II3A 2P5LC 1EH7A 2E36A 3CLQA 3KETA 4II2A 1RI7A 1YRNB 3KEOA 3I53A 4ENJA 2CUEA 4XLNF 1JI8A 4A6DA 1PP8F 2HQRA 2JPCA 2AXTC 2EZLA 4G6QA 4S05A 4XKCA 3ZR8X 3F6OA 1FLIA 1I3AA 4O5VA 3K4MA 2Z33A 2XGEA 2COMA 1AU7A 1FSEA 5GAGJ 1QRYA 2O03A 2A07F 1Z0XA 3L7WA 1T2KA 2BY3A 3H3UA 2LY9A 3WG9A 1P7JA 3FMQA 2V9KA 1YS6A 3WTSC 1ZG1A 1X3WB 1YG2A 4KISA 3W6JB 2A69F 2QWWA 2KIFA 2RQQA 4MFEA 2DFEA 5E3LA 3I4NJ 4AD9A 4B4CA 2NAZA 2X85A 3KZIC 3ZQQA 1XGSA 2BZTA 2DMUA 4TV7A 5C4JJ 1R49A 4RGRA 1IW7F 2JRMA 4NC6A 1YW9A 3WU2C 2OD5A 2Y30A 5IYBJ 5HLTA 3AKZA 5ICCA 4RMNA 2CQQA 2JSPA 5EEAA 2W25A 2QYOA 4E7HA 4LLNA 4NHJA 3B73A 3LSHA 1KA8A 3QU3A 2IPQX 3F21A 2PJRA 2FNAA 3ZQLA 2QM3A 4BQNA 1QZEA 5JVGF 5D4SA 1OQYA 2E19A 2BW3B 3JTHA 3OWTA 4CYDA 3HSEA 4WX9A 3IKTA 3VYSB 1TNSA 4A3DJ 1S9HA 5CVJA 4MLOA 4Z6YA 5JR3A 4ESJA 1TWAJ 1X3UA 1I3QJ 3K10A 5M5YJ 2HKOA 3AG3H 3PM1A 3FXRA 4AIJA 1X1DA 1FYMA 3E0JB 2IT0A 1E2XA 1NG7A 3JTGA 1VQ7I 2K4JA 3C2BA 2W82A 3L2RA 4BXUA 3F3XA 2W24A 2DFFA 3BR6A 1OCRH 1AKHA 2VJ5A 2P4WA 1KU9A 4F52A 1MBGA 4J00A 3S17J 2V9VA 4I6ZA 4E7LA 1JJ6C 2QKLB 5EGOB 1HSJA 2WB1A 1FOXA 5EZHA 2JA6J 3H36A 1MBFA 5E3NA 3D1NI 4IHWA 1XMKA 2LR8A 1BW6A 2R7QA 1V5GA 4GDFA 2V1XA 4WXDA 2HYJA 3F8NA 2EK5A 3IH3A 4BYYA 2LK2A 5M5XJ 3F22A 1FY7A 1X4PA 5CQGA 1YJ9I 1VQ5I 2XPVA 1VQOI 2DO7A 4ZDLA 1STZA 3V7RA 5FROA 1C0WA 1SVMA 2LNBA 2IS2A 3IH4A 3HGGA 2ACJA 4IHSA 2YPRA 4I01A 4EV0A 1ULYA 3PJRA 3S3OA 2KIMA 1ZR4A 1QBJA 4L5JA 5E8GA 1SMYF 1SANA 2NVYJ 2RV8A 2DYSH 2NVUB 4DYCA 1OYWA 5IY5H 2JT1A 2H1KA 3D5SC 1XG1A 3Q0WA 4V2GA 1SD5A 2CH0A 3MN2A 3FWEA 3OV8A 2CU7A 4OU0A 4BGDA 1MDMA 3ZN0A 2M0CA 3BJ6A 4WK8F 3FMRA 3QWLA 4MEXF 4K2EA 5CVVA 1PDNC 4RDUA 3CDIA 1LVAA 1V4RA 1WGXA 2V79A 1IG7A 3QPTA 3QODA 3W2VA 2STWA 1KU3A 3VYUB 3GTOJ 4DBQA 1A36A 3HYIA 3A2KA 2JZYA 2E1NA 2IVMA 5HLIA 1Z7LA 4A0YA 2FE3A 1P6RA 3TMOA 2DJIA 1UHWA 3OSFA 2JA2A 2PQ8A 5LGUA 3A01B 1D0ZA 1UHMA 1LJ9A 3R61A 4BY7J 3IH2A 5LHHA 4JK1X 4FX4A 3WGGA 1TWHJ 3MAJA 3JCUC 4QIWN 2P5VA 4DOZA 1SD7A 3PIPF 4BNCA 2PG4A 2W7NA 4PSWA 2LH9A 2COBA 3BROA 3E5UA 4UVAA 5H6RA 2IJLA 5H20A 3S32A 3CMYA 2GWRA 2GOXB 3MZYA 3HOWJ 3OSGA 4M3FA 1O3QA 1EH6A 2DDBA 4OWRB 1K4SA 1IDYA 1E17A 3VB2A 4X1EA 3HOXJ 2WTEA 3CJQB 3MZHA 4A0ZA 3KP5A 1R1UA 1H9TA 2FEZA 3BG3A 1XGOA 4ZJZA 3X2QH 2UWMA 4L0ZB 1AOYA 3LA2A 1GV2A 2IGMA 2LY1A 4M3BA 2FA5A 2HWVA 4HBLA 2LLKA 3TDUC 2R7FA 4MIMA 4UXNA 4UUSB 1WFXA 5FFZA 3HPHA 2N8GA 3DPUA 2E7XA 2PMUA 2VKVA 3Q9SA 1JTYA 1FYKA 2R7UA 1CQTA 2M0MA 1WCMJ 4RGSA 4M72A 5E1WA 1Q1HA 5ERIA 1LDDA 4YRVA 4I99C 2XAUA 2DPUA 5HLHA 1W0TA 3FHNA 4NUBA 1DQUA 5KHDA 2A5YB 3WTZA 3SYTA 3UKGA 3AG1H 2ZXIA 1JHHA 3ELKA 4HG2A 4A3EJ 4AU7A 1ZKGA 3WTWC 4Q5SF 1RPWA 4HEA2 3ZMVA 3G4SI 2QSGX 4PCQA 5J4VA 1FTZA 4ZH4F 2CO5A 2HPMA 4A3LJ 4NC8A 2G7HA 3M1CA 3RQIA 3ML6A 5AONA 4LLGF 2L9SA 2Q2EA 3G3ZA 3G2BA 2VXDA 5J8CA 3DEUA 1FWZA 1YIOA 3OYGA 5J1RA 2K86A 1PYVA 3GVAA 4E6KG 3L2QA 3D0SA 2M9HA 4HNUA 1N25A 1UHSA 2XF5A 1QPMA 4JX5A 2LY2A 1Y1VJ 4KIBA 2HYGD 3DQVC 3DEWA 1LFPA 3QP6A 1EV7A 2KIUA 1X1CA 5L3EA 3LWFA 5GTIC 3GFIA 2VT3A 3F6VA 1WRJA 1XDSA 5L3GA 2E71A 3WGIA 4RGXA 1UFMA 3ZP5A 1NK2P 3E5XA 4OAYA 4F55A 4WWCA 4BE0A 3I58A 5F1JA 2KQRA 1S8NA 2EA2A 4N4OB 4BBRJ 4PJMA 1Z3XA 5DCMB 1LEAA 1E3HA 2F5CA 2KZGA 2ZSIB 1IZ1A 2LKXA 2PBIA 1TWCJ 1U5TC 3GEZA 1I1GA 1TC3C 1XMXA 5DTDA 5E18F 1LDKB 1PUFA 4L5IA 5K5OA 4GRIA 5KAIC 2DT7B 5F27A 3TP0A 1DUXC 4A3GJ 2X6OA 3M8EA 1WI3A 2IW5A 3FXQA 3BC8A 4E7JA 1U5TB 2ZNZA 1RESA 3BCAA 3GZNB 4OMYA 1BR4A 4IL6C 2JQ7A 3C1DA 1U9OA 4FISA 4LOCA 4GYGA 4E7IA 1D5VA 5LHIA 3B6AA 4DZJA 2R7WA 4A12A 2HPIA 3H35A 3MWMA 1K79A 5EEGA 4A3FJ 5CLSA 2E2IJ 3O8HA 1AKHB 3CCRI 3PIOF 4KN7X 4EJTA 5EF6A 1T0FC 4Q47A 2EZKA 2GZWA 1JT0A 5FLXK 3ABTA 2LVSA 2NYXA 3DF8A 1S29A 2VBYA 1MKMA 4KMFA 3DTEA 4Y7NJ 3HTUA 1QPIA 3U1DA 2IGNA 1IRZA 3IL2A 5E17F 2LYCA 2VOPA 5K7ZA 3P9IA 5HS8A 3KZYA 3WU1B 2HQNA 5DD4A 1OLTA 1W1WE 1MNEA 3K6GA 2L7FP 4XOPA 2DK5A 4B43A 2EV6A 4B44A 1FZPB 2HTJA 2VBZA 2BVMA 2XGXA 2PMHA 5L3BA 5JHUA 1XSDA 5FD6A 2BHZA 3BR2A 1FOWA 2EBIA 2X6XA 2WB1N 3SQNA 3LSTA 1J59A 2Z3YA 2J5PA 4XSXF 3DCFA 1EKEA 3IWZA 5LD2C 3HOYJ 3QPSA 4I76A 1ZREA 2WA0A 2DA2A 3W6KB 2P6TA 1KU2A 2KPMA 3GCMA 3OS1A 3QYFA 3PNTA 3GTPJ 2R7ZJ 3DBLB 4C2TA 4CICA 2CW7A 4U0YA 3L2WA 2XGCA 2LMDA 3QP5A 1SFUA 3DBHB 2Y75A 4FETA 5DM6F 3BTIA 2VQLA 1A6QA 2E7WA 4A6EA 2QA4I 3MKLA 4JBAA 3K7AJ 4A2UA 1GVJA 1IN6A 2DOAA 4DYRA 2CMPA 5DUKA 1UB9A 1KYWA 1IDZA 4MQ9F 3R6SA 1RKTA 3EUAA 5ICGA 2STTA 1FP1D 2CQNA 2FMLA 1R4MB 2DLLA 5DYMA 4ON0A 1HXDA 3JRHA 4UNOA 2EFNA 1Z77A 3CUQB 2XVCA 1PUFB 1LDJA 1HOMA 1ZARA 1Y56A 3BPVA 4OAZA 3RYPA 3ECHA 3RKWA 3KYDB 3LMMA 5EG0B 3HOTA 2VKDA 1BR2A 3RZDJ 2O5RA 4A0XA 1YTYA 2XAHA 3KLNA 3F23A 3ECOA 1VQKI 1WJFA 2KP6A 2R0QC 4DZPA 2O7OA 1Z9CA 3PNYA 1XN7A 1AWCA 2H09A 1WJBA 1R00A 1YX3A 2XRNA 3HJEA 3V8JA 1LUJB 1KQ0A 3M3YJ 1TW3A 4YG2F 5DUIA 3PO2J 3TDZC 2WY7Q 4RB0A 3ISPA 1O7LA 2BGCA 1S7AA 3G1MA 4XMYA 2DFHA 3NRVA 4P1WA 4FASD 1OCTC 5IOZA 5CPRB 1VZ0A 3A4CA 3WG7H 4XOTA 2XSJC 1J9IA 2HTSA 4HX7A 2ZC2A 3KFWX 1DDNA 1VF9A 4NQWA 3OYDA 1PP7U 3FHZA 4F92B 2BXYA 3KLOA 1KGSA 4P5OA 4A3IJ 3QAHA 5HLGA 3GTKJ 4LITA 3SJMA 1CF7A 3A02A 3QYBA 5FJ8J 1W5TA 2LFBA 2K02A 1T98A 3BG9A 3RIRA 2ELJA 1LEBA 4PDKA 2CQXA 3DFGA 2R7DA 3ERED 3GW2A 2Y48A 2DA4A 2OCEA 3BZKA 3I0TA 4IF4A 1QNTA 4BY1J 2R7TA 2QENA 3ZPLA 2M7AA 3QPLA 1H0MA 1B6AA 3RTRA 1BBYA 1GXQA 3VSLA 1FTTA 3AL0C 3RPUD 5F64A 4P9UA 1IUYA 4CCKA 1XMAA 4LMYA 2VONA 2F5DA 1HBXG 4FHTA 3KP2A 4C2MJ 3K1PA 3S1NJ 2EV5A 4OIQF 3UNGC 5F08A 4EJOA 4YFNF 1HDDC 2B9SA 4LG0B 3WGHA 2OA4A 2NNYA 1G3TA 4MTDA 2VASA 4EGZA 2XROA 3OS2A 3QRFF 2GLOA 2EIJH 2DK8A 3WU0A 2MLGA 1T38A 3S3NA 3GXOA 1XTAA 1VQMI 3J7AO 4A5NA 1HW1A 2M4KA 3J81K 2IS1A 3H5RA 2ZJRF 4L9NA 1YHQI 2ZBKA 3IAS2 2VBWA 3Q5FA 1WKMA 4LB6B 2X0LA 2JVGA 1TLHB 4HRIA 2VQHA 2VL8A 2LC2A 1QZZA 1IUFA 1YJWI 1BI3A 4BUPA 3TOBA 1L3LA 2BEOA 3I59B 4IRGA 1SFEA 1ETYA 4QLCU 4XNFA 1BC7C 1IN7A 1YFHA 4WXHA 3CZ6A 4C2UA 2A68F 3BR1A 3N4MA 1IJWC 3K4KA 2YX7A 4BHBA 4LG3A 4RBOA 2EWNA 3OYFA 4D7MA 4ESFA 1R36A 3K2AA 1D5YA 3KX2A 5B5EC 5E3MA 1FIPA 2ZO4A 4U0VA 1BA5A 3NARA 4Y15A 4PK4A 3E5QA 2D5VA 5J6XA 2VT2A 4HAMA 1BJZA 2RDPA 3J80Z 2M3AA 1R58A 4UV9A 4DW6A 4FCYA 2W1OA 1HKTA 4E4HA 2AO9A 1QA6A 1P2FA 2QBYA 1ZRFA 4G6TB 5LBQA 3CUOA 4HOBA 1JKPC 4UUSA 4YFXF 4RLFA 4R1HA 1T39A 1LVKA 2D1VA 3P5JA 1PJRA 1FP2A 1X1BA 3S1MJ 3CD6I 3MCZA 3IRQA 1UG2A 3H3VK 2P7CB 2HVSA 2I10A 1MBHA 5KCMA 1F4KA 3BP8A 4JOMA 1B8IA 3KEQA 2XC7A 1SVLA 2BW3A 2PMZN 2UXNA 5IPAA 2XV4S 4OIRF 4KN4X 3K0LA 1ZLKA 4C3IJ 2M2EA 3L2CA 1ETWA 3GFMA 3GFLA 1IRGA 4MTEA 1I1SA 3SHFA 4DQ2A 1IF1A 3AAFA 1J75A 1YS7A 1ETXA 2VN2A 1FMWA 2EINH 1XCVA 4LIVA 2E2HJ 1F1ZA 3CTAA 4HF2A 2E5ZA 2CG4A 2NVXJ 3FISA 2DN0A 2H8RA 4I2OA 1MBKA 3HRMA 4IHXA 3ZOBA 1I50J 2K27A 2QZ8A 3ZMTA 2DI3A 1H88C 2W4SA 2RGVA 1M1EB 1ETKA 2TCTA 3T5XA 1Z3YA 1TWGJ 1WQ2A 1J2XA 1YYVA 3LOCA 1ITYA 1FEXA 2BOLA 1LKXA 1GLNA 2AHQA 3OL3A 3GTMJ 2LP0A 2Y0SA 1XC5A 3LSKA 4HX8A 2IS6A 5ICEA 2DA3A 4XRFA 3LSRA 2RVCA 2QBYB 3S14J 4A3BJ 1I5ZA 3DU5A 1YIJI 3F72A 3LNQA 2K9MA 2K3PA 3O8GA 5KVRA 2K7LA 1LNWA 2D2WA 5EGOA 2VJ4A 6PAXA 3TOAA 1H89C 3BLYA 3FXMA 3NAUA 2Y69H 4PZJA 4A5MA 2JMWA 4CSWA 5JI6A 3FKJA 1H9GA 1YOVB 1QGPA 5KNLA 3IAM2 1FPQA 3OYAA 4DIQA 4UB6C 1R1TA 5HDKA 3GTGJ 3ERMA 3L09A 4EVIA 3GZ6A 4QTRA 3WHBA 1APLC 1YJNI 3OYMA 2HZTA 3RKQA 5FRNA 1R5GA 3U9GA 4B47A 3D5RC 2WC2A 3HRUA 2R5YB 2ELKA 3P7NA 1MBEA 4A3JJ 3DKYA 1X58A 3S93A 3OYHA 2EIKH 4G8XA 4G9YA 5FFXA 4JX4A 3JR9A 2VI6A 1S72I 2OTLI 5FRMA 4BU2A 1P4WA 2ETHA 3HDDA 5FKKA 4ETSA 4F7ZA 3IV5A 3SFIA 2V1DA 1N77A 1KQ9A 2W84A 4M9XA 5DEQA 1OYYA 3QOPA 2LG4A 2PN6A 4FQGA 1UMQA 2CGPA 5F6FA 1BIBA 2KDOA 1USSA 2VQGA 3V4GA 3FM5A 4M3DA 5FGMA 3ABLH 2VC1A 1A5JA 3W2AA 1T08B 2EFPA 3VSKA 2CUFA 1MMAA 1BM9A 3MEXA 2V6CA 3PNVA 5FD5A 5TGTA 3ZQ7A 1FOKA 2DPDA 4G12A 4OIPF 2L2OA 3K4NA 2H94A 4DYQA 2XRLA 1JHFA 2Y0SN 3WHCA 3E6CC 3CMMA 3MKWB 3SZTA 3BG6A 4XRSA 1YI2I 3DLAA 2P0WA 2QSFX 1E3PA 2ME0A 1UJ8A 3M8JA 2WY8Q 4Y3OA 4I0AA 2IS4A 2WBMA 3KE2A 1HF0A 3TO9A 1RKWA 2IBDA 3I55I 1TL8A 3EYYA 1RZ4A 2JA5J 2CSOA 2EFOA 4JX6A 3ZQHA 1ZG3A 3HM5A 2GA2A 3OL4A 1OCCH 3WODF 3MZ8A 2M30A 2KL4A 2HQAA 2LKPA 3S2WA 3E6DA 1Z05A 5IYDJ 4EM1A 1MD0A 1V5FA 1K7AA 3P9CA 2EZIA 3GTQJ 2VE9A 4MO7A 2P5KA 1JJ8C 3ABUA 3C2HA 4Y17A 4FE4A 1MZBA 3O3KA 4ZYAA 4KIFA 4DBRA 3LSMA 1G3SA 2G0EA 1LQ1A 2BY0A 3LAJA 1YQAA 4IPAA 3LSJA 3DTIA 4YFKF 4OOIA 2RAEA 3TL4X 3VYRB 4DNCA 2RQPA 2Y0MA 3FBIB 3K4CA 4B1RA 1G59A 5ILSA 4KFCA 3HKZN 2UXXA 3BG7A 4RB3C 5GAEJ 1MMDA 2BE5F 3DP7A 1NK3P 3CCSI 1EF4A 4C9YA 2H27A 2LDUA 4PJNA 4C3HJ 3GX4X 2HFHA 4G94A 3ZMZA 2V9PA 5LRSA 2Z1DA 3HIFA 3I56I 1Y6IA 9ANTA 1F43A 5HODA 2NRAC 4KYWA 3QOEA 3CCYA 3JSPA 4CHUA 2VC0A 2K9NA 4EQQA 2Z99A 4J01A 2BYVE 1D1BA 2OPTA 4XLHA 3T8RA 1W36C 3DLLF 1ZTRA 2VOOA 2E1OA 4CH7A 1T33A 4CCMA 1VFCA 1OR7C 4M3GA 2L54A 3BCBA 3GUDA 4ZDPA 2XAFA 1AA7A 4QWQA 3L1PA 1ZAOA 3R0AA 3JREA 4RAGA 3K1NA 4RA2A 2HQ5A 4FTHA 3CC7I 4CGZA 3M9AA 2HXOA 3MVPA 4AVPA 4Z2YA 2KDZA 2JA8J 2KIQA 1O57A 2ADUA 4XN3A 4M73A 1JGGA 2XGDA 1SVOA 2EQRA 1GVDA 5KK1A 3RPUA 1TQIA 3MMYB 3JRAA 3BJAA 3C18A 5JVTA 3EQLF 3R4KA 1LB2A 2A05A 1BN5A 2DOEA 2DDAA 4BQOA 2WAQN 4HDUA 1XPXA 3G1LA 4RB1A 1TT0A 1ZG5A 1I39A 1GDTA 1QHGA 1BI2A 5D6EA 1JT6A 2Q1ZB 2XSDC 4BE1A 3RCOA 4HNTA 1T0FA 4ZYGA 2ZSHB 4UV8A 3CJRB 2L4AA 3RYRA 3H9GA 1S7EA 5GADJ 5TJJA 2ECCA 2KFDA 1WJAA 1T8IA 4GGGA 3CCJI 2FQ4A 1ONVA 4HQMA 5K7HA 2GXAA 2HOEA 4WCGA 1WH7A 2EV0A 1OCPA 4XLEA 2HVQA 2VJIA 3TBIA 4ASNA 5ILVA 1YE9A 4U0WA 5A2QK 3RJPA 4IOAF 2DA6A 3LSIA 3BTCA 2PJRB 3S1QJ 4D1QA 4IJAA 3TGNA 3FXKA 1Z21A 3R60A 3ONQA 3WTYC 2O9LA 2FMYA 3HEFA 4M9ZA 3OYBA 5BQTA 1T56A 2QQAA 5J1YA 2FXAA 3EDPA 1R1VA 3H1CA 3GZ5A 2ISZA 4W97A 2AQFA 4A3MJ 4CDGA 4NBQA 4PSXA 1ZR2A 3NEUA 1BI0A 2H6CA 2DA5A 2X1DA 1G8XA 2A6HF 2DBBA 2K9QA 1HSTA 3H5AA 4AYBN 5CVUA 2D1HA 2R5ZB 4J19A 1U3EM 3CCMI 1DP3A 2DA7A 1I6HJ 1DU6A 2RNJA 2JVHA 2K5CA 4Y33A 4HA8A 1MSFC 4HF1A 4BHCA 4ZZLA 4OMZA 2JWTA 1QQIA 1Z6TA 2Y31A 5BS6A 2F5VA 3H3ZA 3CCVI 2R5YA 4H0EA 1VQ4I 1WJEA 1KU7A 3W2WA 2IA0A 1ORKA 1ODDA 1RIOH 3RKYA 4EJWA 2MA3A 2MC3A 3AFHA 2BBYA 2V26A 1J5YA 1RNLA 2R4GA 4ZZDA 4YEJA 3P9KA 5F1RA 4NC7A 2EFQA 3VEPA 1Z1DA 1W7PA 2GOMA 4RM3A 4FX0A 2BXZA 2EPFA 5HDGA 3TEDA 2QCOA 1F9NA 4AYBA 4OIOF 3IUOA 2L02A 4AWXB 3G6EI 4AUXA 2ZMEA 4UY8I 2Z5UA 1DP7P 4IHVA 1JUSA 2WAEA 4IKFA 2O61A 3F8CA 3ZMUA 2CV2A 4Y4RA 1S6LA 2ZJQF 3I4MJ 4D5FA 1O3RA 4F3QA 4O6JA 2DMPA 2Q2EB 2ZNYA 2IA2A 1FC3A 1MJBA 3DU6A 4XN0A 2GIZA 2TRTA 5LEJA 2IGKA 3QU6A 4BHPA 2RNGA 4CZCA 1P9QC 4XM3A 4QPQA 2R5ZA 2X51A 5J1UA 3CCUI 3M7GA 4IOCF 3OYJA 3CCQI 3BQZA 4PJJA 4WF2A 3JRBA 5M5WJ 1HA8A 4ZDOA 3M8FA 2VPRA 3MFKA 5E3OA 1S3JA 4XICA 1CF7B 2V6EA 3ZQGA 5M3MJ 2CS3A 1IAWA 4P9FA 3FBNB 2K3FA 3ROUA 4WXCA 1K61A 4BDYA 2KZVA 3VOEA 3E3VA 2CUZA 3CMEI 2DJNA 2FD5A 2ZXHA 3HOZJ 1IV6A 2LRDA 2A61A 1V55H 3GLXA 4X0GA 4UVCA 5LFAA 2KMUA 1SFXA 1U9NA 4XR6A 3SZGA 1TWFJ 2VIXA 5K5RA 2DODA 2UZKA 3KP7A 2QKMB 3AG2H 1DU0A 4RAZA 3J7ZI 4CCNA 2M87A 4M9SA 2HOTA 3A0HC 2X48A 5GAHJ 2PJPA 1DGRM 4XLCA 1MSEC 5H6QA 2CW0F 2HEOA 1FBUA 3HHGA 3PFIA 4CCOA 3LQRA 4RGUA 3I59A 1Z67A 1OFCX 4EJVA 3LAPA 2ZMEC 2ICWG 3I54A 1Y39A 1SFOJ 1IO2A 2DYRH 1EJ9A 4AIHA 1D8JA 2PEXA 1A35A 2WAQA 1U78A 3O2PE 3HOUJ 3PQJA 2A6TA 2IEKA 1S7OA 2NXNB 3B6CA 3OYKA 2HOSA 5IOYA 2X1CA 2XDVA 4KJZA 1Y8QB 1ETVA 2MLKA 1ON2A 3Q3SA 2OUMA 2KKOA 3HRTA 4KT6A 2F48A 4HZFA 2ESNA 2X9DA 4YIRX 1MMSA 5A2QZ 1FBSA 3ASNH 3ULQB 4D7NA 4MNUA 2HDWA 1FSHA 1MBJA 1J09A 2MFZA 2VXZA 3BPXA 4A3KJ 1XDUA 4P96A 1KQ8A 4XKBA 4ZTJA 4BBSJ 2H1LA 2MD0A 5D5XB 1BI1A 2M45A 1WWXA 3OYCA 1ZRDA 1UELB 3ABMH 4EEFG 2B63J 2KRCA 2MD5A 5AIPA 5HVQC 2KHMA 3TP3A 4M71A 1O7FA 4G7OF 3PSIA 2F2EA 3K9TA 2NNNA 3FX3A 1SD6A 2XAGA 2ZCWA 1MIJA 3CF5F 2C6YA 4BXXJ 3DEEA 3N97A 2GXGA 5IT9Z 2DMTA 3MKYB 1ENHA 3GYHX 2DQRA 4PJ0C 2QVOA 3PO3J 4L5EA 2OTJI 1BJAA 4MHGA 4BJTA 1U8RA 1GV5A 2DA1A 2GBYA 4YIIA 2O0YA 2FSWA 3GWZA 2PMZA 5K5QA 5FLXZ 3E1SA 3TKYA 1JKQC 3V7SA 2FOKA 2QLZA 3B02A 5L3CA 2EFWA 2LOOA 1IC8A 2DMQA 1VQPI 4A69C 2YR2A 2KISA 3BJOA 4UUVA 3L2UA 1MH4A 1TNTA 3SXYA 1U2WA 1REPC 5CYVA 4RS8A 1B8IB 2L9NA 3HSRA 4IRIA 3JAMK 1Y0NA 2ID3A 2DTRA 4U88A 2HDCA 4N0BA 2R7VA 3HL2A 2OZ6A 1W7PD 2BHYA 1IRXA 4A93J 1GXPA 2M34A 3S1RJ 1A6IA 3W6VA 2V1UA 1FOYA 5J47A 4ENKA 2E34A 1YX5A 2GQQA 3ASOH 2O6GE 2A6EF 3CO7C 3CUQC 3FKIJ 4JQFA 2Q0OA 1Y1WJ 2MH9A 1FJLA 1ETOA 1K6YA 3HBLA 1PUEE 2K9LA 4I7HA 3HUGA 2XKPA 4L18B 5GPAA 4UVBA 4E70A 2E1MB 2P6SA 1GHCA 4HPQA 5DDGA 5EZGA 3V8LA 4EJUA 1U6GA 2L7KA 5FKNA 5EYRA 1JGSA 3M1EA 3T0YA 1UAAA 5L3FA 2CFXA 3FIWA 1B72A 2IGOA 1YLFA 3LSGA 1JE8A 5J8FA 5LGTA 4V2FA 2A3SA 3G73A 4XORA 5M3FJ 2JK3A 4NB5A 5IT9K 2MH2A 3FK7A 2HNHA 3SFZA 3SEQA 3EUHA 1ZELA 2ZXJA 2JPBA 3F8BA 4U7BA 2G7UA 2P8TA 1F5TA 2IAIA 4W1UA 4HQEA 2NS8A 4IEJA 3CP8A 1W0UA 3HG9A 3BOQA 2EIMH 2M5WA 5EEHA 3KP6A 5TISC 1K6OA 2FX0A 2NOGA 4MGRA 4ENNA 2L01A 1ZYRF 3KYCB 2I8DA 3VYTB 1TZLA 4Y52J 4XSZF 2M4GA 1ON1A 1R7JA 3CC2I 5B66C 3IRRA 4U7DA 2EB7A 2EJRA 5E20A 3PUFA 2X6YA 2XF6A 3OMYA 1UCRA 3ZXSA 4L9TA 2OJED 2OBPA 3PUBA 2OC6A 3RPQA 2OF7A 4BH9A 5B1AH 2ZJPF 2YU3A 1QVUA 1HKSA 2YX4A 3K4LA 3JAMZ 3OIQA 1R9TJ 2FU4A 3HUGB 1ZGJA 1OR7A 2HOAA 3L9FA 1MJ9A 1ACIA 4UB8C 4RM2A 2HI3A 4HLXA 2VBXA 3ZGKA 2HYFA 2MABA 3HSFA 4LLLA 1HDPA 4G7ZF 4AIDA 3MD2A 3L00A 3LA3A 1Z91A 1OISA 2W57A 4PUSA 5J4YA 2CRGA 4KDPA 5CVRA 4HYEA 4PGGA 2LF7A 1W5CC 3FZVA 4BQQA 1UG0A 3DBRB 4Q48A 2XPUA 3UR3C 5HDNA 1OCOH 2O8KA 3A0BC 3BTJA 1MJAA 3NQOA 4XKWA 1ZLJA 3H5NA 4BACA 3DKXA 2KLOA 2ZFUA 1XSVA 2E5NA 3IHUA 2WV1A 1V3FA 4PJLA 5AIQA 3WTUC 2LREA 3EUHC 3ZCOA 4E7SA 2L9RA 2XIGA 2FF4A 2JUGA 2LBFB 2X1EA 3QPHA 4BKXA 4FT8A 3BR0A 1OKRA 1JTXA 3OOUA 3ZRGA 3J7YJ 2CV0A 4IHYA 4BJ6C 3CO6C 1G3YA 1G3WA 2DU9A 5IT3A 4IXAA 2OQGA 3BR3A 4KMUX 4M6XA 2EILH 1CGPA 2ECBA 3CLOA 1P4XA 2HU9A 3A1YA 2RN7A 1IRFA 1R23A 1QHHD 1TP4A 4UUTA 1BW5A 3SEZA 2LD5A 1X4OA 3LFUA 5CKTA 5IYCJ 2R92J 3HGYA 3J80K 3V8KA 3VPRA 4BAYA 4MQVA 2TDXA 4DJAA 2QF7A 2HZDA 2GA1A 1ZGWA 3IC7A 4BL0B 3OYIA 5E79C 3PSFA 4IHTA 1FIAA 3C7JA 2KJCA 1WI9A 1BOBA 1X1PA 4RLQA 1E0EA 1SEUA 2RC4A 4RB2C 2R7SA 3FF5A 2XPWA 3BQYA 4XKVA 4S0HB 1WJ5A 4A3CJ 4LG0A 4LJZF 2GXBA 1P7IA 1FBQA 2CQ7A 2G9WA 4IRHA 2PX9A 5IP6A 1USTA 4G7HF 3S2HJ 3ZQIA 2JTVA 4E7ZA 3HB9A 1WH5A 3FM3A 3FXUA 5HNFA 1TQMA 2IA1A 2DT6A 1HLVA 2MBFA 3BTLA 3M07A 2VQCA 2ZKZA 2LKSA 3OYLA 4GXOA 4GCVA 3BZ6A 1IGNA 3CQZJ 2XB0X 4IQJA 3WTVC 1IXCA 2W00A 1B9MA 1WJCA 1YRNA 2ZJ2A 1WZ2A 4KUMA 3MKZA 4HLYA 3LA7A 3JRIA 2M7BA 5KAFC 1HQCA 3I4PA 4X6AJ 1V5EA 3BZCA 1Q1VA 3REOA 2PI0A 3CESA 2OZUA 1B72B 1ERDA 3C2GA 2ZB9A 1SFKA 1VTNC 5ED4A 3JSOA 5E1XA 1B59A 3H9JA 4CO8A 3IWFA 4XQFA 2AXLA 3KP4A 2FOWA 3TO6A 1E3OC 2KRFA 2HDDA 1WSUA 1G4DA 5F04A 4BDZA 2EZHA 2LTPA 3E7LA 5BMZA 1O3SA 5GP9A 3COAC 1X1AA 2CJJA 5TRDA 2L5QA 2DT5A 2QQ9A 4G6DA 1XCBA 2Z16A 1MNMC 1XX5A 1IXSB 2H6BA 1NH3A 3E6BA 2Y9YA 2X4HA 2E60A 2VB6A 3Q0UA 2ZFWA 1NHAA 1FNNA 1ZQ3P 3TW7A 2MSYA 1K4TA 1OPCA 4L9JA 2O8XA 4HSTA 2IP2A 4QPOA 4MEYF 3FXOA 1PVEA 3QQAA 3U2RA 3JW4A 4B09A 4ESBA 4IVNA 5HS9A 3RI4A 3N05A 4ENMA 2I5UA 4HSRA 3RQ4A 5D8LB 1R71A 1QZYA 5JFRA 2JA7J 2F5FA 5LRRA 1ZK8A 5HNHA 1R5ID 4KICA 2VKHA 5BNGA 1NG6A 3OIOA 4LK1F 3S3MA 2FQ3A 3JRCA 3SDGA 4XLFA 5DCMA 2DCEA 2HS5A 2WADA 1IN5A 1IV8A 4N9IA 2ELHA 1RUOA 4E7KA 1K83J 3I3LA 3DKWA 5D5VB 2MC4A 2M8GX 2R3SA 4EM0B 3GLLA 2XASA 5HS7A 1D0XA 3H9QA 3LQQA 4I98B 4KIGA 2CFOA 1YW8A 5EDNA 5GTHC 3VWBA 5CVIA 1Z6RA 2BY2A 1MW7A 3EPZA 1G2HA 4NDLA 5DS9A 3E6MA 2LBFA 2Z2SB 1B1BA 2DMNA 3OR1C 5BPDA 4IO9F 5CJ9A 1A04A 3QYEA 1HKQA 3C3WA 1SAUA 1LPQA 1LFUP 2E1MC 3BY6A 4B3XA 4HF0A 2JSCA 3LL7A 3D5LA 4IX7A 3CC4I 5BOXA 2L9VA 3K4BA 4LIUA 1OCZH 3DPTA 1F36A 5J40A 5B1BH 3VDXA 5K7FA 4EGYA 1BIAA 2K4BA 2K40A 3JRDA 4F91B 1S5LC 3EUKL 3HPGA 1I6XA 3L2VA 3PFYA 4I02A 2VODA 2IXSA 4ZC3A 5EJCA 4AIKA 1SMTA 3EYIA 2NOJB 1QVTA 2HGCA 4M6VA 1SAXA 1K78A 1KONA 4JYKA 2BV6A 1KZHA 3R0JA 1IN4A 5DCFA 2EH3A 3KYLA 1H8AC 2W48A 1R6RA 2MYSA 1ZH5A 5LEKA 4CYCA 1WVRA 2BVLA 3K70D 4O3MA 2GAUA 2JN6A 1LE8A 2FBHA 4LB5A 3AG4H 1ZGAA 4BS9A 2GM4A 3KEYA 3PL8A 1JXSA 1KYZA 4EM2A 3GFJA 3HZJA 1P4AA 2XKOA 2QEXI 4CCLA 5ICFA 2VE8A 2KJBA 1FYLA 2XAJA 3K69A 2ZMEB 1RRJA 4BEHB 4BQAA 1BL0A 1X3ZB 5CQEA 3U21A 2DOFA 3LFKA 2DAOA 2M8EA 2P7VB 2UUZA 4CUGA 2WAFA 1EA3A 3OY9A 2L0KA 1HW2A 1AHDP 1HC8A 2VLAA 5B3SH 1O4XA 5FLVA 1XB4A 1OMIA 3T8TA 3HKZA 2V7FA 4D0PA 4UHTA 2E1CA 2DXIA 3OIPA 2CUJA 4C30A 1W36D 4H4KC 2XUBA 1RC9A 1YO5C 4AM3A 2FRHA 4QSHA 3NWSA 4XRMA 2L3DA 1YITI 2DW4A 3E97A 3ZQFA 3ZN1A 4HDVA 4V19K 5FO5A 2P81A 3IP4B 2ID6A 3CP2A 5IP9J 5C44J 4D9JA 2D45A 4EMSA 2MW8A 5LGNA 1A31A 3RKXA 2XB5A 2F5EA 5F0HA 4S04A 1UZCA 1XSXA 1MH3A 2DFIA 2Z9OA 1K78B 2ZXWH 4XRSG 3DTKA 4KT5C 3RZOJ 3W3CA 3HC7A 4L9VA 1N78A 1IN8A 4NNJA 1BR1A 1X2MA 3CJTB 3RDIA 4L0YB 3BR5A 5JLWA 3GO5A 3BDDA 3F8FA 4XIDA 4RAFA 1N75A 2H8WA 3CUQA 2F6CA 5D5UB 2PLYA 3ZMDA 1MMGA 2KRHA 1X2NA 3ESWB 2L4MA 5E1ZB 1D1AA 4GO1A 3SDBA 1O3TA 5F0FA 3GMEA 3SZPA 3LSPA 4M74A 4PFOA 1P92A 4YIFA 5E8IA 4BEHA 1VNDA 1GT0C 1FMVA 3J7AY 4LGWA 4M6YA 1U5TA 1XD7A 4P55A 5D6FA 4XLPF 1VI0A 4PGHA 2PFBA 3F8MA 3KP3A 5DM7F 2VUMJ 4BXFA 4ZYDA 2F4MB 1QO0D 5F0CA 2EA4A 1VQLI 3KCCA 1LE8B 1D1CA 1W5SA 1ZHFA 4BE2A 2AQEA 3S8PA 3FXLA 3CCEI 2DTZA 2HVRA 2L7ZA 4LK0F 4Q4ZF 2HKXA 3PQKA 3V42A 1JKOC 4LD5A 1RUNA 2FBIA 4Y13A 4B48A 4ANJA 3M4OJ 2MGQA 4M3EA 2B7EA 2GIVA 1D3YA 1MNDA 1POGA 2VJJA 2O3FA 1V54H 3Q0VA 3S2DJ 3HOVJ 2B0LA 3Q9VA 1Z7UA 5FKLA 4R79A 3HTSB 2CW8A 2K9SA 5D5WB 4FE7A 1Y0UA 3TO7A 4ZTFA 4KNYA 3OR2C 5DD8A 2IRFG 2HXIA 1TTYA 2YS9A 4CZZA 3OS0A 1ZN2A 3OOPA 3BT9A 5D4RA 3KIOA 4I09A 2Y9ZA 1FT9A 4HX4A 1R4NB 1R5HA 2UV1A 4IZZA 2FUG2 4EATA 3T1BA 3G1OA 4ITVA 2FJ1A 2Q8KA 1XGNA 5ILUA 2CV1A 4LFUA 4KA4A 1GUUA 3EETA 2L7MP 2CWEA 3NWTA 1TBXA 4MFDA 4ZYHA 3OYNA 1HCRA 2Y2ZA 2CQKA 3HXLA 3G71I 1U8BA 1VQ8I 1NTCA 3ZQCA 2FNPA 3KPHA 1DGWY 2XAQA 4ZYEA 3HRSA 3IKVA 2OV7A 4C3JJ
chains in the Genus database with same CATH topology
4GFBA 3B6AA 4FE4A 4DZJA 4AC0A 3GTJJ 2OF7A 2G0EA 4A3FJ 5IP7J 2E2IJ 3O8HA 1AKHB 1QVUA 3LSJA 5EF6A 2RAEA 1R9TJ 2EZKA 1JT0A 4D5CA 2HOAA 2LVSA 4CYCB 4B1RA 2HI3A 3HKZN 1NK3P 1JUPA 4Y7NJ 2R93J 1EF4A 2NS7A 1QPIA 4C3HJ 2YUSA 1IRZA 3CDLA 1HDPA 5K7ZA 9ANTA 1F43A 5HODA 3CCYA 5FLMJ 3S16J 2CRGA 2K9NA 3A01A 3GTLJ 2L7FP 1LFBA 2OPTA 1RETA 1ZTRA 2XPUA 2E1OA 1T33A 3BR2A 2EBIA 4B3AA 3BG5A 1VFCA 2O8KA 2YU9J 3BTJA 2WB1N 2VKEA 4M3GA 4HNVA 2JJ7A 3L1PA 3JREA 3DCFA 3HOYJ 2HQ5A 3QPSA 4I76A 2WV1A 4FTHA 2DA2A 5FKMA 2ME6A 2HXOA 3MVPA 2KDZA 3GTPJ 2R7ZJ 2L9RA 2JA8J 4BKXA 5C4XJ 1JUMA 3BR0A 3S15J 5J3LA 3OOUA 1JTXA 2XGCA 4XK4A 1RR7A 4IHYA 1JGGA 2XGDA 3BR3A 3BTIA 2ECBA 2KT0A 2EQRA 1GVDA 1WPKA 3MKLA 3K7AJ 5FKOA 3JRAA 4UUTA 1BW5A 2LD5A 4DYRA 1JKRC 5IYCJ 2R92J 3HGYA 1IDZA 3VPRA 5C3EJ 1XS9A 1RKTA 2WAQN 3JRHA 2QF7A 3G1LA 1ZGWA 1Z77A 1GDTA 1PUFB 1JT6A 2NVQJ 1HOMA 1ETQA 5GPCA 2XSDC 1FIAA 2MG4A 5EG0B 3RZDJ 1S7EA 3F0CA 2ECCA 2R0QC 4DZPA 2O7OA 2XPWA 3BQYA 5EG0A 4S0HB 2E2JJ 4A3CJ 2FQ4A 1P7IA 5K7HA 1WH7A 1OCPA 3H0GJ 3M3YJ 5IP6A 3PO2J 3S2HJ 3TW6A 3ZQIA 3G1MA 1OCTC 3HB9A 1WH5A 2DA6A 5IOZA 1OJLA 1HLVA 5JLXA 3BTCA 4JP0A 3BTLA 3S1QJ 1VF9A 3JRFA 3JRGA 1IGNA 3CQZJ 2XB0X 4ABZA 2NVTJ 3A03A 4A3IJ 2O9LA 3HEFA 3FK6A 3GBGA 1YRNA 3GTKJ 1T56A 5J1YA 3JRIA 3SJMA 3A02A 5FJ8J 4W97A 4A3MJ 2LFBA 4X6AJ 3BG9A 1Q1VA 1YRNB 2CQXA 1ZR2A 2DA5A 2CUEA 1B72B 2ZB9A 2EZLA 2DA4A 2K9QA 4AYBN 4BY1J 2XGEA 3QPLA 1AU7A 2R5ZB 4J19A 1QRYA 1E3OC 1Z0XA 2HDDA 1FTTA 5F04A 2EZHA 2LTPA 3E7LA 2DA7A 2LY9A 1I6HJ 1P7JA 1DU6A 5GP9A 2CJJA 4MFEA 4C2MJ 3S1NJ 1MSFC 1HDDC 5F08A 5E3LA 3I4NJ 1MNMC 2JWTA 4B4CA 2Y31A 2R5YA 5C4JJ 2DMUA 1ORKA 2Y9YA 2GLOA 3Q0UA 2Y30A 5IYBJ 1ZQ3P 3TW7A 2CQQA 5EEAA 2MSYA 3TEDA 2QCOA 3QQAA 3ZQLA 2E19A 4AUXA 4IHVA 2JA7J 1JUSA 1ZK8A 4A3DJ 4MLOA 1TWAJ 1I3QJ 5BNGA 3OIOA 3I4MJ 5M5YJ 4D5FA 3PM1A 2DMPA 1IUFA 3JRCA 3SDGA 2TRTA 3C2BA 1ETYA 1K83J 3BR6A 3BR1A 2R5ZA 1IJWC 1AKHA 2M8GX 5J1UA 1MBGA 4RBOA 3S17J 4I6ZA 1JJ6C 5EGOB 5EDNA 3BQZA 5M5WJ 3JRBA 4D7MA 2VPRA 5EZHA 2JA6J 3K2AA 1D5YA 1MBFA 5E3NA 5E3OA 5E3MA 3D1NI 1FIPA 4IHWA 4XICA 2LR8A 1BA5A 1BW6A 3NARA 3ZQGA 5M3MJ 1G2HA 2HYJA 4NDLA 3IH3A 5DS9A 5M5XJ 2LK2A 2D5VA 1BJZA 2DMNA 1K61A 2XPVA 4FCYA 4DW6A 2AO9A 2DJNA 2FD5A 3HOZJ 1IV6A 1LFUP 1JKPC 4UUSA 3IH4A 3HGGA 3S1MJ 1U9NA 1UG2A 3H3VK 1TWFJ 2I10A 1ZR4A 1F36A 1MBHA 1DU0A 1B8IA 1SANA 5K7FA 2NVYJ 2PMZN 5IPAA 4DYCA 2K40A 3JRDA 2HOTA 2X48A 2H1KA 1XG1A 3Q0WA 1MSEC 4V2GA 4C3IJ 1QVTA 2M2EA 3MN2A 1ETWA 2CU7A 4JYKA 1OFCX 2M0CA 2EH3A 1H8AC 2W48A 4RDUA 1SFOJ 1ETXA 4CYCA 2E2HJ 1WGXA 2JN6A 1LE8A 1U78A 3HOUJ 1IG7A 2NVXJ 3FISA 2DN0A 2H8RA 2GM4A 2IEKA 3B6CA 3GTOJ 1MBKA 2HOSA 5IOYA 4IHXA 3ZOBA 1ETVA 1I50J 1H88C 3OSFA 3Q3SA 3A01B 1BL0A 1ETKA 4BY7J 2TCTA 3IH2A 1TWGJ 2X9DA 3LOCA 1ITYA 1FEXA 1TWHJ 2L0KA 2AHQA 1AHDP 3GTMJ 4QIWN 2LP0A 1XC5A 4D7NA 1O4XA 5FLVA 3LSRA 2DA3A 1MBJA 3S14J 4A3BJ 4A3KJ 3LNQA 4BBSJ 3O8GA 2COBA 5EGOA 4EEFG 2B63J 3CMYA 1H89C 3TP3A 3NAUA 3HOWJ 4QSHA 3OSGA 4M3FA 4XRMA 2JMWA 3ZQFA 1IDYA 2P81A 2ID6A 5IP9J 4X1EA 5C44J 3HOXJ 4BXXJ 2MW8A 2XB5A 5F0HA 2DMTA 3GTGJ 1ENHA 3PO3J 1MH3A 3BG3A 4QTRA 4L5EA 4XRSG 3WHBA 1APLC 3RZOJ 1GV2A 1GV5A 2DA1A 2GBYA 4M3BA 3RKQA 2LLKA 4MIMA 4UUSB 2R5YB 1JKQC 2ELKA 1X2MA 1MBEA 2N8GA 3BR5A 5JLWA 4A3JJ 2VKVA 1JTYA 1X58A 4XIDA 1IC8A 2DMQA 1CQTA 1WCMJ 4A69C 1X2NA 4JX4A 2VI6A 3JR9A 1MH4A 5F0FA 1W0TA 3LSPA 1B8IB 3UKGA 3HDDA 5FKKA 1VNDA 1GT0C 2ID3A 4A3EJ 3IV5A 3SFIA 1ZKGA 1RPWA 1VI0A 1FTZA 4A93J 3W6VA 2M34A 3S1RJ 1A6IA 4A3LJ 3RQIA 2VUMJ 5F0CA 1LE8B 1UMQA 3FKIJ 1Y1WJ 1FJLA 1ETOA 3HBLA 4M3DA 2DTZA 5J1RA 1A5JA 2L7ZA 2M9HA 1UHSA 4JX5A 2CUFA 1JKOC 5GPAA 1Y1VJ 3M4OJ 4LOCA 3DEWA 2MGQA 4M3EA 5EZGA 5FKNA 4G12A 5EYRA 4DYQA 2XRLA 3FIWA 1POGA 2Y0SN 3WHCA 3Q0VA 1B72A 3S2DJ 3HOVJ 5FKLA 3LSGA 1NK2P 4XRSA 2K9SA 4FE7A 4V2FA 5F1JA 2ME0A 2JK3A 5M3FJ 4BBRJ 3FK7A 2HXIA 2YS9A 3BT9A 2Y9ZA 1HF0A 2IAIA 1RKWA 2IBDA 4W1UA 2LKXA 2JA5J 3G1OA 4JX6A 3ZQHA 1TWCJ 2NS8A 4IEJA 2FJ1A 1TC3C 3HM5A 1W0UA 5DTDA 1GUUA 1PUFA 2L7MP 4MFDA 3TP0A 2FX0A 2NOGA 5F27A 1HCRA 2Y2ZA 4A3GJ 2X6OA 1U8BA 1WI3A 5IYDJ 4Y52J 1NTCA 2EZIA 1RESA 3ZQCA 3GTQJ 4MO7A 1JJ8C 1U9OA 4FISA 4M6VA 4C3JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFB A;  3B6A A;  4FE4 A;  4DZJ A;  4AC0 A;  3GTJ J;  2OF7 A;  2G0E A;  4A3F J;  5IP7 J;  2E2I J;  3O8H A;  1AKH B;  1QVU A;  3LSJ A;  5EF6 A;  2RAE A;  1R9T J;  2EZK A;  1JT0 A;  4D5C A;  2HOA A;  2LVS A;  4CYC B;  4B1R A;  2HI3 A;  3HKZ N;  1NK3 P;  1JUP A;  4Y7N J;  2R93 J;  1EF4 A;  2NS7 A;  1QPI A;  4C3H J;  2YUS A;  1IRZ A;  3CDL A;  1HDP A;  5K7Z A;  9ANT A;  1F43 A;  5HOD A;  3CCY A;  5FLM J;  3S16 J;  2CRG A;  2K9N A;  3A01 A;  3GTL J;  2L7F P;  1LFB A;  2OPT A;  1RET A;  1ZTR A;  2XPU A;  2E1O A;  1T33 A;  3BR2 A;  2EBI A;  4B3A A;  3BG5 A;  1VFC A;  2O8K A;  2YU9 J;  3BTJ A;  2WB1 N;  2VKE A;  4M3G A;  4HNV A;  2JJ7 A;  3L1P A;  3JRE A;  3DCF A;  3HOY J;  2HQ5 A;  3QPS A;  4I76 A;  2WV1 A;  4FTH A;  2DA2 A;  5FKM A;  2ME6 A;  2HXO A;  3MVP A;  2KDZ A;  3GTP J;  2R7Z J;  2L9R A;  2JA8 J;  4BKX A;  5C4X J;  1JUM A;  3BR0 A;  3S15 J;  5J3L A;  3OOU A;  1JTX A;  2XGC A;  4XK4 A;  1RR7 A;  4IHY A;  1JGG A;  2XGD A;  3BR3 A;  3BTI A;  2ECB A;  2KT0 A;  2EQR A;  1GVD A;  1WPK A;  3MKL A;  3K7A J;  5FKO A;  3JRA A;  4UUT A;  1BW5 A;  2LD5 A;  4DYR A;  1JKR C;  5IYC J;  2R92 J;  3HGY A;  1IDZ A;  3VPR A;  5C3E J;  1XS9 A;  1RKT A;  2WAQ N;  3JRH A;  2QF7 A;  3G1L A;  1ZGW A;  1Z77 A;  1GDT A;  1PUF B;  1JT6 A;  2NVQ J;  1HOM A;  1ETQ A;  5GPC A;  2XSD C;  1FIA A;  2MG4 A;  5EG0 B;  3RZD J;  1S7E A;  3F0C A;  2ECC A;  2R0Q C;  4DZP A;  2O7O A;  2XPW A;  3BQY A;  5EG0 A;  4S0H B;  2E2J J;  4A3C J;  2FQ4 A;  1P7I A;  5K7H A;  1WH7 A;  1OCP A;  3H0G J;  3M3Y J;  5IP6 A;  3PO2 J;  3S2H J;  3TW6 A;  3ZQI A;  3G1M A;  1OCT C;  3HB9 A;  1WH5 A;  2DA6 A;  5IOZ A;  1OJL A;  1HLV A;  5JLX A;  3BTC A;  4JP0 A;  3BTL A;  3S1Q J;  1VF9 A;  3JRF A;  3JRG A;  1IGN A;  3CQZ J;  2XB0 X;  4ABZ A;  2NVT J;  3A03 A;  4A3I J;  2O9L A;  3HEF A;  3FK6 A;  3GBG A;  1YRN A;  3GTK J;  1T56 A;  5J1Y A;  3JRI A;  3SJM A;  3A02 A;  5FJ8 J;  4W97 A;  4A3M J;  2LFB A;  4X6A J;  3BG9 A;  1Q1V A;  1YRN B;  2CQX A;  1ZR2 A;  2DA5 A;  2CUE A;  1B72 B;  2ZB9 A;  2EZL A;  2DA4 A;  2K9Q A;  4AYB N;  4BY1 J;  2XGE A;  3QPL A;  1AU7 A;  2R5Z B;  4J19 A;  1QRY A;  1E3O C;  1Z0X A;  2HDD A;  1FTT A;  5F04 A;  2EZH A;  2LTP A;  3E7L A;  2DA7 A;  2LY9 A;  1I6H J;  1P7J A;  1DU6 A;  5GP9 A;  2CJJ A;  4MFE A;  4C2M J;  3S1N J;  1MSF C;  1HDD C;  5F08 A;  5E3L A;  3I4N J;  1MNM C;  2JWT A;  4B4C A;  2Y31 A;  2R5Y A;  5C4J J;  2DMU A;  1ORK A;  2Y9Y A;  2GLO A;  3Q0U A;  2Y30 A;  5IYB J;  1ZQ3 P;  3TW7 A;  2CQQ A;  5EEA A;  2MSY A;  3TED A;  2QCO A;  3QQA A;  3ZQL A;  2E19 A;  4AUX A;  4IHV A;  2JA7 J;  1JUS A;  1ZK8 A;  4A3D J;  4MLO A;  1TWA J;  1I3Q J;  5BNG A;  3OIO A;  3I4M J;  5M5Y J;  4D5F A;  3PM1 A;  2DMP A;  1IUF A;  3JRC A;  3SDG A;  2TRT A;  3C2B A;  1ETY A;  1K83 J;  3BR6 A;  3BR1 A;  2R5Z A;  1IJW C;  1AKH A;  2M8G X;  5J1U A;  1MBG A;  4RBO A;  3S17 J;  4I6Z A;  1JJ6 C;  5EGO B;  5EDN A;  3BQZ A;  5M5W J;  3JRB A;  4D7M A;  2VPR A;  5EZH A;  2JA6 J;  3K2A A;  1D5Y A;  1MBF A;  5E3N A;  5E3O A;  5E3M A;  3D1N I;  1FIP A;  4IHW A;  4XIC A;  2LR8 A;  1BA5 A;  1BW6 A;  3NAR A;  3ZQG A;  5M3M J;  1G2H A;  2HYJ A;  4NDL A;  3IH3 A;  5DS9 A;  5M5X J;  2LK2 A;  2D5V A;  1BJZ A;  2DMN A;  1K61 A;  2XPV A;  4FCY A;  4DW6 A;  2AO9 A;  2DJN A;  2FD5 A;  3HOZ J;  1IV6 A;  1LFU P;  1JKP C;  4UUS A;  3IH4 A;  3HGG A;  3S1M J;  1U9N A;  1UG2 A;  3H3V K;  1TWF J;  2I10 A;  1ZR4 A;  1F36 A;  1MBH A;  1DU0 A;  1B8I A;  1SAN A;  5K7F A;  2NVY J;  2PMZ N;  5IPA A;  4DYC A;  2K40 A;  3JRD A;  2HOT A;  2X48 A;  2H1K A;  1XG1 A;  3Q0W A;  1MSE C;  4V2G A;  4C3I J;  1QVT A;  2M2E A;  3MN2 A;  1ETW A;  2CU7 A;  4JYK A;  1OFC X;  2M0C A;  2EH3 A;  1H8A C;  2W48 A;  4RDU A;  1SFO J;  1ETX A;  4CYC A;  2E2H J;  1WGX A;  2JN6 A;  1LE8 A;  1U78 A;  3HOU J;  1IG7 A;  2NVX J;  3FIS A;  2DN0 A;  2H8R A;  2GM4 A;  2IEK A;  3B6C A;  3GTO J;  1MBK A;  2HOS A;  5IOY A;  4IHX A;  3ZOB A;  1ETV A;  1I50 J;  1H88 C;  3OSF A;  3Q3S A;  3A01 B;  1BL0 A;  1ETK A;  4BY7 J;  2TCT A;  3IH2 A;  1TWG J;  2X9D A;  3LOC A;  1ITY A;  1FEX A;  1TWH J;  2L0K A;  2AHQ A;  1AHD P;  3GTM J;  4QIW N;  2LP0 A;  1XC5 A;  4D7N A;  1O4X A;  5FLV A;  3LSR A;  2DA3 A;  1MBJ A;  3S14 J;  4A3B J;  4A3K J;  3LNQ A;  4BBS J;  3O8G A;  2COB A;  5EGO A;  4EEF G;  2B63 J;  3CMY A;  1H89 C;  3TP3 A;  3NAU A;  3HOW J;  4QSH A;  3OSG A;  4M3F A;  4XRM A;  2JMW A;  3ZQF A;  1IDY A;  2P81 A;  2ID6 A;  5IP9 J;  4X1E A;  5C44 J;  3HOX J;  4BXX J;  2MW8 A;  2XB5 A;  5F0H A;  2DMT A;  3GTG J;  1ENH A;  3PO3 J;  1MH3 A;  3BG3 A;  4QTR A;  4L5E A;  4XRS G;  3WHB A;  1APL C;  3RZO J;  1GV2 A;  1GV5 A;  2DA1 A;  2GBY A;  4M3B A;  3RKQ A;  2LLK A;  4MIM A;  4UUS B;  2R5Y B;  1JKQ C;  2ELK A;  1X2M A;  1MBE A;  2N8G A;  3BR5 A;  5JLW A;  4A3J J;  2VKV A;  1JTY A;  1X58 A;  4XID A;  1IC8 A;  2DMQ A;  1CQT A;  1WCM J;  4A69 C;  1X2N A;  4JX4 A;  2VI6 A;  3JR9 A;  1MH4 A;  5F0F A;  1W0T A;  3LSP A;  1B8I B;  3UKG A;  3HDD A;  5FKK A;  1VND A;  1GT0 C;  2ID3 A;  4A3E J;  3IV5 A;  3SFI A;  1ZKG A;  1RPW A;  1VI0 A;  1FTZ A;  4A93 J;  3W6V A;  2M34 A;  3S1R J;  1A6I A;  4A3L J;  3RQI A;  2VUM J;  5F0C A;  1LE8 B;  1UMQ A;  3FKI J;  1Y1W J;  1FJL A;  1ETO A;  3HBL A;  4M3D A;  2DTZ A;  5J1R A;  1A5J A;  2L7Z A;  2M9H A;  1UHS A;  4JX5 A;  2CUF A;  1JKO C;  5GPA A;  1Y1V J;  3M4O J;  4LOC A;  3DEW A;  2MGQ A;  4M3E A;  5EZG A;  5FKN A;  4G12 A;  5EYR A;  4DYQ A;  2XRL A;  3FIW A;  1POG A;  2Y0S N;  3WHC A;  3Q0V A;  1B72 A;  3S2D J;  3HOV J;  5FKL A;  3LSG A;  1NK2 P;  4XRS A;  2K9S A;  4FE7 A;  4V2F A;  5F1J A;  2ME0 A;  2JK3 A;  5M3F J;  4BBR J;  3FK7 A;  2HXI A;  2YS9 A;  3BT9 A;  2Y9Z A;  1HF0 A;  2IAI A;  1RKW A;  2IBD A;  4W1U A;  2LKX A;  2JA5 J;  3G1O A;  4JX6 A;  3ZQH A;  1TWC J;  2NS8 A;  4IEJ A;  2FJ1 A;  1TC3 C;  3HM5 A;  1W0U A;  5DTD A;  1GUU A;  1PUF A;  2L7M P;  4MFD A;  3TP0 A;  2FX0 A;  2NOG A;  5F27 A;  1HCR A;  2Y2Z A;  4A3G J;  2X6O A;  1U8B A;  1WI3 A;  5IYD J;  4Y52 J;  1NTC A;  2EZI A;  1RES A;  3ZQC A;  3GTQ J;  4MO7 A;  1JJ8 C;  1U9O A;  4FIS A;  4M6V A;  4C3J J; 
#chains in the Genus database with same CATH topology
 4GFB A;  1R22 A;  1Y8R B;  4R8H A;  4XLA A;  4AC0 A;  2W85 A;  2YSR A;  2JUC A;  3RSN A;  3GTJ J;  2QUF A;  1MDM B;  5IP7 J;  4XBF A;  3GF2 A;  3WE3 A;  3VOD A;  4RAY A;  4D5C A;  4CYC B;  1TT5 B;  4NQW B;  3J81 Z;  1JUP A;  2R93 J;  2NS7 A;  3FDY A;  2V4J C;  5BPI A;  1FX7 A;  3I9V 2;  2YUS A;  3HOS A;  1WJD A;  3CDL A;  3CMA I;  3U1K A;  3AL0 B;  1T95 A;  4HV6 A;  2BY1 A;  2A5W A;  1MGT A;  2OCC H;  1TQP A;  3KZZ A;  5FLM J;  3S16 J;  3A01 A;  4AVZ A;  4B8X A;  3H0D A;  3GTL J;  1J7K A;  1LFB A;  1WHU A;  4HV5 A;  1J0R A;  3DPL C;  2R7X A;  1RET A;  2DQL A;  2RRE A;  3VFZ A;  3ABK H;  2E35 A;  2WWY A;  2RKH A;  2CYY A;  2NS0 A;  2LF8 A;  3BG5 A;  4OIN F;  4B3A A;  2YU9 J;  3WE2 A;  2VKE A;  4HNV A;  4IQ4 A;  2K85 A;  5LLQ A;  3CF2 A;  2JJ7 A;  1HW5 A;  5D8K B;  2LSO A;  1BOA A;  4GYI A;  3F9K A;  3I71 A;  1T6S A;  5FKM A;  3I64 A;  2ME6 A;  1DPU A;  3HHH A;  1EH8 A;  1TW2 A;  5HOO A;  1QU3 A;  1D8K A;  2OQR A;  2JRT A;  2R7R A;  2OU2 A;  5C4X J;  1JUM A;  3S15 J;  4BJ5 C;  5J3L A;  4XK4 A;  1MMN A;  1RR7 A;  5H2F C;  3K4J A;  1IXR C;  2KT0 A;  1SC7 A;  4CCJ A;  4I0B A;  4CXF A;  2R7O A;  1WPK A;  2WV0 A;  4CA0 A;  2QQB A;  4PFP A;  5FKO A;  1VQ6 I;  2QQ8 A;  1VQN I;  5DV5 A;  2J5O A;  1JKR C;  1W7P B;  1G6N A;  3BWG A;  4HW0 A;  3V7C A;  5K1Y A;  5C3E J;  1XS9 A;  2VPL A;  3K70 C;  2QGU A;  4XON A;  1XGM A;  1B4A A;  1SD4 A;  3TQN A;  1W4M A;  3MQ0 A;  3FMS A;  2NVQ J;  3ZMS A;  1ETQ A;  5GPC A;  2MG4 A;  2M1B A;  1BC8 C;  2XF7 A;  3K2Z A;  3F0C A;  2QSH X;  3CJN A;  2V1N A;  1B9N A;  3FXJ A;  2F4O B;  4YEL A;  3CCL I;  5EG0 A;  2FBK A;  3DXJ F;  2ISY A;  3O6B B;  2E2J J;  4N4N B;  3DV8 A;  4XL9 A;  2F4I A;  4KIT B;  3WTX C;  3I5U A;  3WTT C;  3H0G J;  3OYE A;  1L0O C;  5L3D A;  5LHG A;  1U0J A;  3TW6 A;  1D0Y A;  2AS5 F;  4F93 B;  2ESH A;  5JHF A;  4N9H A;  2HR3 A;  1OJL A;  3DWL E;  2X6W A;  5JLX A;  3H92 A;  4JP0 A;  2XHK A;  1DPR A;  3CDH A;  1RR8 C;  1I27 A;  4U87 A;  1ZRC A;  3JRF A;  3K1M A;  3JRG A;  5FB2 A;  1OYI A;  4ABZ A;  2NVT J;  1YW7 A;  3A03 A;  2OAZ A;  1X19 A;  1VQ9 I;  3FK6 A;  3GBG A;  4DGW B;  4II3 A;  2P5L C;  1EH7 A;  2E36 A;  3CLQ A;  3KET A;  4II2 A;  1RI7 A;  1YRN B;  3KEO A;  3I53 A;  4ENJ A;  2CUE A;  4XLN F;  1JI8 A;  4A6D A;  1PP8 F;  2HQR A;  2JPC A;  2AXT C;  2EZL A;  4G6Q A;  4S05 A;  4XKC A;  3ZR8 X;  3F6O A;  1FLI A;  1I3A A;  4O5V A;  3K4M A;  2Z33 A;  2XGE A;  2COM A;  1AU7 A;  1FSE A;  5GAG J;  1QRY A;  2O03 A;  2A07 F;  1Z0X A;  3L7W A;  1T2K A;  2BY3 A;  3H3U A;  2LY9 A;  3WG9 A;  1P7J A;  3FMQ A;  2V9K A;  1YS6 A;  3WTS C;  1ZG1 A;  1X3W B;  1YG2 A;  4KIS A;  3W6J B;  2A69 F;  2QWW A;  2KIF A;  2RQQ A;  4MFE A;  2DFE A;  5E3L A;  3I4N J;  4AD9 A;  4B4C A;  2NAZ A;  2X85 A;  3KZI C;  3ZQQ A;  1XGS A;  2BZT A;  2DMU A;  4TV7 A;  5C4J J;  1R49 A;  4RGR A;  1IW7 F;  2JRM A;  4NC6 A;  1YW9 A;  3WU2 C;  2OD5 A;  2Y30 A;  5IYB J;  5HLT A;  3AKZ A;  5ICC A;  4RMN A;  2CQQ A;  2JSP A;  5EEA A;  2W25 A;  2QYO A;  4E7H A;  4LLN A;  4NHJ A;  3B73 A;  3LSH A;  1KA8 A;  3QU3 A;  2IPQ X;  3F21 A;  2PJR A;  2FNA A;  3ZQL A;  2QM3 A;  4BQN A;  1QZE A;  5JVG F;  5D4S A;  1OQY A;  2E19 A;  2BW3 B;  3JTH A;  3OWT A;  4CYD A;  3HSE A;  4WX9 A;  3IKT A;  3VYS B;  1TNS A;  4A3D J;  1S9H A;  5CVJ A;  4MLO A;  4Z6Y A;  5JR3 A;  4ESJ A;  1TWA J;  1X3U A;  1I3Q J;  3K10 A;  5M5Y J;  2HKO A;  3AG3 H;  3PM1 A;  3FXR A;  4AIJ A;  1X1D A;  1FYM A;  3E0J B;  2IT0 A;  1E2X A;  1NG7 A;  3JTG A;  1VQ7 I;  2K4J A;  3C2B A;  2W82 A;  3L2R A;  4BXU A;  3F3X A;  2W24 A;  2DFF A;  3BR6 A;  1OCR H;  1AKH A;  2VJ5 A;  2P4W A;  1KU9 A;  4F52 A;  1MBG A;  4J00 A;  3S17 J;  2V9V A;  4I6Z A;  4E7L A;  1JJ6 C;  2QKL B;  5EGO B;  1HSJ A;  2WB1 A;  1FOX A;  5EZH A;  2JA6 J;  3H36 A;  1MBF A;  5E3N A;  3D1N I;  4IHW A;  1XMK A;  2LR8 A;  1BW6 A;  2R7Q A;  1V5G A;  4GDF A;  2V1X A;  4WXD A;  2HYJ A;  3F8N A;  2EK5 A;  3IH3 A;  4BYY A;  2LK2 A;  5M5X J;  3F22 A;  1FY7 A;  1X4P A;  5CQG A;  1YJ9 I;  1VQ5 I;  2XPV A;  1VQO I;  2DO7 A;  4ZDL A;  1STZ A;  3V7R A;  5FRO A;  1C0W A;  1SVM A;  2LNB A;  2IS2 A;  3IH4 A;  3HGG A;  2ACJ A;  4IHS A;  2YPR A;  4I01 A;  4EV0 A;  1ULY A;  3PJR A;  3S3O A;  2KIM A;  1ZR4 A;  1QBJ A;  4L5J A;  5E8G A;  1SMY F;  1SAN A;  2NVY J;  2RV8 A;  2DYS H;  2NVU B;  4DYC A;  1OYW A;  5IY5 H;  2JT1 A;  2H1K A;  3D5S C;  1XG1 A;  3Q0W A;  4V2G A;  1SD5 A;  2CH0 A;  3MN2 A;  3FWE A;  3OV8 A;  2CU7 A;  4OU0 A;  4BGD A;  1MDM A;  3ZN0 A;  2M0C A;  3BJ6 A;  4WK8 F;  3FMR A;  3QWL A;  4MEX F;  4K2E A;  5CVV A;  1PDN C;  4RDU A;  3CDI A;  1LVA A;  1V4R A;  1WGX A;  2V79 A;  1IG7 A;  3QPT A;  3QOD A;  3W2V A;  2STW A;  1KU3 A;  3VYU B;  3GTO J;  4DBQ A;  1A36 A;  3HYI A;  3A2K A;  2JZY A;  2E1N A;  2IVM A;  5HLI A;  1Z7L A;  4A0Y A;  2FE3 A;  1P6R A;  3TMO A;  2DJI A;  1UHW A;  3OSF A;  2JA2 A;  2PQ8 A;  5LGU A;  3A01 B;  1D0Z A;  1UHM A;  1LJ9 A;  3R61 A;  4BY7 J;  3IH2 A;  5LHH A;  4JK1 X;  4FX4 A;  3WGG A;  1TWH J;  3MAJ A;  3JCU C;  4QIW N;  2P5V A;  4DOZ A;  1SD7 A;  3PIP F;  4BNC A;  2PG4 A;  2W7N A;  4PSW A;  2LH9 A;  2COB A;  3BRO A;  3E5U A;  4UVA A;  5H6R A;  2IJL A;  5H20 A;  3S32 A;  3CMY A;  2GWR A;  2GOX B;  3MZY A;  3HOW J;  3OSG A;  4M3F A;  1O3Q A;  1EH6 A;  2DDB A;  4OWR B;  1K4S A;  1IDY A;  1E17 A;  3VB2 A;  4X1E A;  3HOX J;  2WTE A;  3CJQ B;  3MZH A;  4A0Z A;  3KP5 A;  1R1U A;  1H9T A;  2FEZ A;  3BG3 A;  1XGO A;  4ZJZ A;  3X2Q H;  2UWM A;  4L0Z B;  1AOY A;  3LA2 A;  1GV2 A;  2IGM A;  2LY1 A;  4M3B A;  2FA5 A;  2HWV A;  4HBL A;  2LLK A;  3TDU C;  2R7F A;  4MIM A;  4UXN A;  4UUS B;  1WFX A;  5FFZ A;  3HPH A;  2N8G A;  3DPU A;  2E7X A;  2PMU A;  2VKV A;  3Q9S A;  1JTY A;  1FYK A;  2R7U A;  1CQT A;  2M0M A;  1WCM J;  4RGS A;  4M72 A;  5E1W A;  1Q1H A;  5ERI A;  1LDD A;  4YRV A;  4I99 C;  2XAU A;  2DPU A;  5HLH A;  1W0T A;  3FHN A;  4NUB A;  1DQU A;  5KHD A;  2A5Y B;  3WTZ A;  3SYT A;  3UKG A;  3AG1 H;  2ZXI A;  1JHH A;  3ELK A;  4HG2 A;  4A3E J;  4AU7 A;  1ZKG A;  3WTW C;  4Q5S F;  1RPW A;  4HEA 2;  3ZMV A;  3G4S I;  2QSG X;  4PCQ A;  5J4V A;  1FTZ A;  4ZH4 F;  2CO5 A;  2HPM A;  4A3L J;  4NC8 A;  2G7H A;  3M1C A;  3RQI A;  3ML6 A;  5AON A;  4LLG F;  2L9S A;  2Q2E A;  3G3Z A;  3G2B A;  2VXD A;  5J8C A;  3DEU A;  1FWZ A;  1YIO A;  3OYG A;  5J1R A;  2K86 A;  1PYV A;  3GVA A;  4E6K G;  3L2Q A;  3D0S A;  2M9H A;  4HNU A;  1N25 A;  1UHS A;  2XF5 A;  1QPM A;  4JX5 A;  2LY2 A;  1Y1V J;  4KIB A;  2HYG D;  3DQV C;  3DEW A;  1LFP A;  3QP6 A;  1EV7 A;  2KIU A;  1X1C A;  5L3E A;  3LWF A;  5GTI C;  3GFI A;  2VT3 A;  3F6V A;  1WRJ A;  1XDS A;  5L3G A;  2E71 A;  3WGI A;  4RGX A;  1UFM A;  3ZP5 A;  1NK2 P;  3E5X A;  4OAY A;  4F55 A;  4WWC A;  4BE0 A;  3I58 A;  5F1J A;  2KQR A;  1S8N A;  2EA2 A;  4N4O B;  4BBR J;  4PJM A;  1Z3X A;  5DCM B;  1LEA A;  1E3H A;  2F5C A;  2KZG A;  2ZSI B;  1IZ1 A;  2LKX A;  2PBI A;  1TWC J;  1U5T C;  3GEZ A;  1I1G A;  1TC3 C;  1XMX A;  5DTD A;  5E18 F;  1LDK B;  1PUF A;  4L5I A;  5K5O A;  4GRI A;  5KAI C;  2DT7 B;  5F27 A;  3TP0 A;  1DUX C;  4A3G J;  2X6O A;  3M8E A;  1WI3 A;  2IW5 A;  3FXQ A;  3BC8 A;  4E7J A;  1U5T B;  2ZNZ A;  1RES A;  3BCA A;  3GZN B;  4OMY A;  1BR4 A;  4IL6 C;  2JQ7 A;  3C1D A;  1U9O A;  4FIS A;  4LOC A;  4GYG A;  4E7I A;  1D5V A;  5LHI A;  3B6A A;  4DZJ A;  2R7W A;  4A12 A;  2HPI A;  3H35 A;  3MWM A;  1K79 A;  5EEG A;  4A3F J;  5CLS A;  2E2I J;  3O8H A;  1AKH B;  3CCR I;  3PIO F;  4KN7 X;  4EJT A;  5EF6 A;  1T0F C;  4Q47 A;  2EZK A;  2GZW A;  1JT0 A;  5FLX K;  3ABT A;  2LVS A;  2NYX A;  3DF8 A;  1S29 A;  2VBY A;  1MKM A;  4KMF A;  3DTE A;  4Y7N J;  3HTU A;  1QPI A;  3U1D A;  2IGN A;  1IRZ A;  3IL2 A;  5E17 F;  2LYC A;  2VOP A;  5K7Z A;  3P9I A;  5HS8 A;  3KZY A;  3WU1 B;  2HQN A;  5DD4 A;  1OLT A;  1W1W E;  1MNE A;  3K6G A;  2L7F P;  4XOP A;  2DK5 A;  4B43 A;  2EV6 A;  4B44 A;  1FZP B;  2HTJ A;  2VBZ A;  2BVM A;  2XGX A;  2PMH A;  5L3B A;  5JHU A;  1XSD A;  5FD6 A;  2BHZ A;  3BR2 A;  1FOW A;  2EBI A;  2X6X A;  2WB1 N;  3SQN A;  3LST A;  1J59 A;  2Z3Y A;  2J5P A;  4XSX F;  3DCF A;  1EKE A;  3IWZ A;  5LD2 C;  3HOY J;  3QPS A;  4I76 A;  1ZRE A;  2WA0 A;  2DA2 A;  3W6K B;  2P6T A;  1KU2 A;  2KPM A;  3GCM A;  3OS1 A;  3QYF A;  3PNT A;  3GTP J;  2R7Z J;  3DBL B;  4C2T A;  4CIC A;  2CW7 A;  4U0Y A;  3L2W A;  2XGC A;  2LMD A;  3QP5 A;  1SFU A;  3DBH B;  2Y75 A;  4FET A;  5DM6 F;  3BTI A;  2VQL A;  1A6Q A;  2E7W A;  4A6E A;  2QA4 I;  3MKL A;  4JBA A;  3K7A J;  4A2U A;  1GVJ A;  1IN6 A;  2DOA A;  4DYR A;  2CMP A;  5DUK A;  1UB9 A;  1KYW A;  1IDZ A;  4MQ9 F;  3R6S A;  1RKT A;  3EUA A;  5ICG A;  2STT A;  1FP1 D;  2CQN A;  2FML A;  1R4M B;  2DLL A;  5DYM A;  4ON0 A;  1HXD A;  3JRH A;  4UNO A;  2EFN A;  1Z77 A;  3CUQ B;  2XVC A;  1PUF B;  1LDJ A;  1HOM A;  1ZAR A;  1Y56 A;  3BPV A;  4OAZ A;  3RYP A;  3ECH A;  3RKW A;  3KYD B;  3LMM A;  5EG0 B;  3HOT A;  2VKD A;  1BR2 A;  3RZD J;  2O5R A;  4A0X A;  1YTY A;  2XAH A;  3KLN A;  3F23 A;  3ECO A;  1VQK I;  1WJF A;  2KP6 A;  2R0Q C;  4DZP A;  2O7O A;  1Z9C A;  3PNY A;  1XN7 A;  1AWC A;  2H09 A;  1WJB A;  1R00 A;  1YX3 A;  2XRN A;  3HJE A;  3V8J A;  1LUJ B;  1KQ0 A;  3M3Y J;  1TW3 A;  4YG2 F;  5DUI A;  3PO2 J;  3TDZ C;  2WY7 Q;  4RB0 A;  3ISP A;  1O7L A;  2BGC A;  1S7A A;  3G1M A;  4XMY A;  2DFH A;  3NRV A;  4P1W A;  4FAS D;  1OCT C;  5IOZ A;  5CPR B;  1VZ0 A;  3A4C A;  3WG7 H;  4XOT A;  2XSJ C;  1J9I A;  2HTS A;  4HX7 A;  2ZC2 A;  3KFW X;  1DDN A;  1VF9 A;  4NQW A;  3OYD A;  1PP7 U;  3FHZ A;  4F92 B;  2BXY A;  3KLO A;  1KGS A;  4P5O A;  4A3I J;  3QAH A;  5HLG A;  3GTK J;  4LIT A;  3SJM A;  1CF7 A;  3A02 A;  3QYB A;  5FJ8 J;  1W5T A;  2LFB A;  2K02 A;  1T98 A;  3BG9 A;  3RIR A;  2ELJ A;  1LEB A;  4PDK A;  2CQX A;  3DFG A;  2R7D A;  3ERE D;  3GW2 A;  2Y48 A;  2DA4 A;  2OCE A;  3BZK A;  3I0T A;  4IF4 A;  1QNT A;  4BY1 J;  2R7T A;  2QEN A;  3ZPL A;  2M7A A;  3QPL A;  1H0M A;  1B6A A;  3RTR A;  1BBY A;  1GXQ A;  3VSL A;  1FTT A;  3AL0 C;  3RPU D;  5F64 A;  4P9U A;  1IUY A;  4CCK A;  1XMA A;  4LMY A;  2VON A;  2F5D A;  1HBX G;  4FHT A;  3KP2 A;  4C2M J;  3K1P A;  3S1N J;  2EV5 A;  4OIQ F;  3UNG C;  5F08 A;  4EJO A;  4YFN F;  1HDD C;  2B9S A;  4LG0 B;  3WGH A;  2OA4 A;  2NNY A;  1G3T A;  4MTD A;  2VAS A;  4EGZ A;  2XRO A;  3OS2 A;  3QRF F;  2GLO A;  2EIJ H;  2DK8 A;  3WU0 A;  2MLG A;  1T38 A;  3S3N A;  3GXO A;  1XTA A;  1VQM I;  3J7A O;  4A5N A;  1HW1 A;  2M4K A;  3J81 K;  2IS1 A;  3H5R A;  2ZJR F;  4L9N A;  1YHQ I;  2ZBK A;  3IAS 2;  2VBW A;  3Q5F A;  1WKM A;  4LB6 B;  2X0L A;  2JVG A;  1TLH B;  4HRI A;  2VQH A;  2VL8 A;  2LC2 A;  1QZZ A;  1IUF A;  1YJW I;  1BI3 A;  4BUP A;  3TOB A;  1L3L A;  2BEO A;  3I59 B;  4IRG A;  1SFE A;  1ETY A;  4QLC U;  4XNF A;  1BC7 C;  1IN7 A;  1YFH A;  4WXH A;  3CZ6 A;  4C2U A;  2A68 F;  3BR1 A;  3N4M A;  1IJW C;  3K4K A;  2YX7 A;  4BHB A;  4LG3 A;  4RBO A;  2EWN A;  3OYF A;  4D7M A;  4ESF A;  1R36 A;  3K2A A;  1D5Y A;  3KX2 A;  5B5E C;  5E3M A;  1FIP A;  2ZO4 A;  4U0V A;  1BA5 A;  3NAR A;  4Y15 A;  4PK4 A;  3E5Q A;  2D5V A;  5J6X A;  2VT2 A;  4HAM A;  1BJZ A;  2RDP A;  3J80 Z;  2M3A A;  1R58 A;  4UV9 A;  4DW6 A;  4FCY A;  2W1O A;  1HKT A;  4E4H A;  2AO9 A;  1QA6 A;  1P2F A;  2QBY A;  1ZRF A;  4G6T B;  5LBQ A;  3CUO A;  4HOB A;  1JKP C;  4UUS A;  4YFX F;  4RLF A;  4R1H A;  1T39 A;  1LVK A;  2D1V A;  3P5J A;  1PJR A;  1FP2 A;  1X1B A;  3S1M J;  3CD6 I;  3MCZ A;  3IRQ A;  1UG2 A;  3H3V K;  2P7C B;  2HVS A;  2I10 A;  1MBH A;  5KCM A;  1F4K A;  3BP8 A;  4JOM A;  1B8I A;  3KEQ A;  2XC7 A;  1SVL A;  2BW3 A;  2PMZ N;  2UXN A;  5IPA A;  2XV4 S;  4OIR F;  4KN4 X;  3K0L A;  1ZLK A;  4C3I J;  2M2E A;  3L2C A;  1ETW A;  3GFM A;  3GFL A;  1IRG A;  4MTE A;  1I1S A;  3SHF A;  4DQ2 A;  1IF1 A;  3AAF A;  1J75 A;  1YS7 A;  1ETX A;  2VN2 A;  1FMW A;  2EIN H;  1XCV A;  4LIV A;  2E2H J;  1F1Z A;  3CTA A;  4HF2 A;  2E5Z A;  2CG4 A;  2NVX J;  3FIS A;  2DN0 A;  2H8R A;  4I2O A;  1MBK A;  3HRM A;  4IHX A;  3ZOB A;  1I50 J;  2K27 A;  2QZ8 A;  3ZMT A;  2DI3 A;  1H88 C;  2W4S A;  2RGV A;  1M1E B;  1ETK A;  2TCT A;  3T5X A;  1Z3Y A;  1TWG J;  1WQ2 A;  1J2X A;  1YYV A;  3LOC A;  1ITY A;  1FEX A;  2BOL A;  1LKX A;  1GLN A;  2AHQ A;  3OL3 A;  3GTM J;  2LP0 A;  2Y0S A;  1XC5 A;  3LSK A;  4HX8 A;  2IS6 A;  5ICE A;  2DA3 A;  4XRF A;  3LSR A;  2RVC A;  2QBY B;  3S14 J;  4A3B J;  1I5Z A;  3DU5 A;  1YIJ I;  3F72 A;  3LNQ A;  2K9M A;  2K3P A;  3O8G A;  5KVR A;  2K7L A;  1LNW A;  2D2W A;  5EGO A;  2VJ4 A;  6PAX A;  3TOA A;  1H89 C;  3BLY A;  3FXM A;  3NAU A;  2Y69 H;  4PZJ A;  4A5M A;  2JMW A;  4CSW A;  5JI6 A;  3FKJ A;  1H9G A;  1YOV B;  1QGP A;  5KNL A;  3IAM 2;  1FPQ A;  3OYA A;  4DIQ A;  4UB6 C;  1R1T A;  5HDK A;  3GTG J;  3ERM A;  3L09 A;  4EVI A;  3GZ6 A;  4QTR A;  3WHB A;  1APL C;  1YJN I;  3OYM A;  2HZT A;  3RKQ A;  5FRN A;  1R5G A;  3U9G A;  4B47 A;  3D5R C;  2WC2 A;  3HRU A;  2R5Y B;  2ELK A;  3P7N A;  1MBE A;  4A3J J;  3DKY A;  1X58 A;  3S93 A;  3OYH A;  2EIK H;  4G8X A;  4G9Y A;  5FFX A;  4JX4 A;  3JR9 A;  2VI6 A;  1S72 I;  2OTL I;  5FRM A;  4BU2 A;  1P4W A;  2ETH A;  3HDD A;  5FKK A;  4ETS A;  4F7Z A;  3IV5 A;  3SFI A;  2V1D A;  1N77 A;  1KQ9 A;  2W84 A;  4M9X A;  5DEQ A;  1OYY A;  3QOP A;  2LG4 A;  2PN6 A;  4FQG A;  1UMQ A;  2CGP A;  5F6F A;  1BIB A;  2KDO A;  1USS A;  2VQG A;  3V4G A;  3FM5 A;  4M3D A;  5FGM A;  3ABL H;  2VC1 A;  1A5J A;  3W2A A;  1T08 B;  2EFP A;  3VSK A;  2CUF A;  1MMA A;  1BM9 A;  3MEX A;  2V6C A;  3PNV A;  5FD5 A;  5TGT A;  3ZQ7 A;  1FOK A;  2DPD A;  4G12 A;  4OIP F;  2L2O A;  3K4N A;  2H94 A;  4DYQ A;  2XRL A;  1JHF A;  2Y0S N;  3WHC A;  3E6C C;  3CMM A;  3MKW B;  3SZT A;  3BG6 A;  4XRS A;  1YI2 I;  3DLA A;  2P0W A;  2QSF X;  1E3P A;  2ME0 A;  1UJ8 A;  3M8J A;  2WY8 Q;  4Y3O A;  4I0A A;  2IS4 A;  2WBM A;  3KE2 A;  1HF0 A;  3TO9 A;  1RKW A;  2IBD A;  3I55 I;  1TL8 A;  3EYY A;  1RZ4 A;  2JA5 J;  2CSO A;  2EFO A;  4JX6 A;  3ZQH A;  1ZG3 A;  3HM5 A;  2GA2 A;  3OL4 A;  1OCC H;  3WOD F;  3MZ8 A;  2M30 A;  2KL4 A;  2HQA A;  2LKP A;  3S2W A;  3E6D A;  1Z05 A;  5IYD J;  4EM1 A;  1MD0 A;  1V5F A;  1K7A A;  3P9C A;  2EZI A;  3GTQ J;  2VE9 A;  4MO7 A;  2P5K A;  1JJ8 C;  3ABU A;  3C2H A;  4Y17 A;  4FE4 A;  1MZB A;  3O3K A;  4ZYA A;  4KIF A;  4DBR A;  3LSM A;  1G3S A;  2G0E A;  1LQ1 A;  2BY0 A;  3LAJ A;  1YQA A;  4IPA A;  3LSJ A;  3DTI A;  4YFK F;  4OOI A;  2RAE A;  3TL4 X;  3VYR B;  4DNC A;  2RQP A;  2Y0M A;  3FBI B;  3K4C A;  4B1R A;  1G59 A;  5ILS A;  4KFC A;  3HKZ N;  2UXX A;  3BG7 A;  4RB3 C;  5GAE J;  1MMD A;  2BE5 F;  3DP7 A;  1NK3 P;  3CCS I;  1EF4 A;  4C9Y A;  2H27 A;  2LDU A;  4PJN A;  4C3H J;  3GX4 X;  2HFH A;  4G94 A;  3ZMZ A;  2V9P A;  5LRS A;  2Z1D A;  3HIF A;  3I56 I;  1Y6I A;  9ANT A;  1F43 A;  5HOD A;  2NRA C;  4KYW A;  3QOE A;  3CCY A;  3JSP A;  4CHU A;  2VC0 A;  2K9N A;  4EQQ A;  2Z99 A;  4J01 A;  2BYV E;  1D1B A;  2OPT A;  4XLH A;  3T8R A;  1W36 C;  3DLL F;  1ZTR A;  2VOO A;  2E1O A;  4CH7 A;  1T33 A;  4CCM A;  1VFC A;  1OR7 C;  4M3G A;  2L54 A;  3BCB A;  3GUD A;  4ZDP A;  2XAF A;  1AA7 A;  4QWQ A;  3L1P A;  1ZAO A;  3R0A A;  3JRE A;  4RAG A;  3K1N A;  4RA2 A;  2HQ5 A;  4FTH A;  3CC7 I;  4CGZ A;  3M9A A;  2HXO A;  3MVP A;  4AVP A;  4Z2Y A;  2KDZ A;  2JA8 J;  2KIQ A;  1O57 A;  2ADU A;  4XN3 A;  4M73 A;  1JGG A;  2XGD A;  1SVO A;  2EQR A;  1GVD A;  5KK1 A;  3RPU A;  1TQI A;  3MMY B;  3JRA A;  3BJA A;  3C18 A;  5JVT A;  3EQL F;  3R4K A;  1LB2 A;  2A05 A;  1BN5 A;  2DOE A;  2DDA A;  4BQO A;  2WAQ N;  4HDU A;  1XPX A;  3G1L A;  4RB1 A;  1TT0 A;  1ZG5 A;  1I39 A;  1GDT A;  1QHG A;  1BI2 A;  5D6E A;  1JT6 A;  2Q1Z B;  2XSD C;  4BE1 A;  3RCO A;  4HNT A;  1T0F A;  4ZYG A;  2ZSH B;  4UV8 A;  3CJR B;  2L4A A;  3RYR A;  3H9G A;  1S7E A;  5GAD J;  5TJJ A;  2ECC A;  2KFD A;  1WJA A;  1T8I A;  4GGG A;  3CCJ I;  2FQ4 A;  1ONV A;  4HQM A;  5K7H A;  2GXA A;  2HOE A;  4WCG A;  1WH7 A;  2EV0 A;  1OCP A;  4XLE A;  2HVQ A;  2VJI A;  3TBI A;  4ASN A;  5ILV A;  1YE9 A;  4U0W A;  5A2Q K;  3RJP A;  4IOA F;  2DA6 A;  3LSI A;  3BTC A;  2PJR B;  3S1Q J;  4D1Q A;  4IJA A;  3TGN A;  3FXK A;  1Z21 A;  3R60 A;  3ONQ A;  3WTY C;  2O9L A;  2FMY A;  3HEF A;  4M9Z A;  3OYB A;  5BQT A;  1T56 A;  2QQA A;  5J1Y A;  2FXA A;  3EDP A;  1R1V A;  3H1C A;  3GZ5 A;  2ISZ A;  4W97 A;  2AQF A;  4A3M J;  4CDG A;  4NBQ A;  4PSX A;  1ZR2 A;  3NEU A;  1BI0 A;  2H6C A;  2DA5 A;  2X1D A;  1G8X A;  2A6H F;  2DBB A;  2K9Q A;  1HST A;  3H5A A;  4AYB N;  5CVU A;  2D1H A;  2R5Z B;  4J19 A;  1U3E M;  3CCM I;  1DP3 A;  2DA7 A;  1I6H J;  1DU6 A;  2RNJ A;  2JVH A;  2K5C A;  4Y33 A;  4HA8 A;  1MSF C;  4HF1 A;  4BHC A;  4ZZL A;  4OMZ A;  2JWT A;  1QQI A;  1Z6T A;  2Y31 A;  5BS6 A;  2F5V A;  3H3Z A;  3CCV I;  2R5Y A;  4H0E A;  1VQ4 I;  1WJE A;  1KU7 A;  3W2W A;  2IA0 A;  1ORK A;  1ODD A;  1RIO H;  3RKY A;  4EJW A;  2MA3 A;  2MC3 A;  3AFH A;  2BBY A;  2V26 A;  1J5Y A;  1RNL A;  2R4G A;  4ZZD A;  4YEJ A;  3P9K A;  5F1R A;  4NC7 A;  2EFQ A;  3VEP A;  1Z1D A;  1W7P A;  2GOM A;  4RM3 A;  4FX0 A;  2BXZ A;  2EPF A;  5HDG A;  3TED A;  2QCO A;  1F9N A;  4AYB A;  4OIO F;  3IUO A;  2L02 A;  4AWX B;  3G6E I;  4AUX A;  2ZME A;  4UY8 I;  2Z5U A;  1DP7 P;  4IHV A;  1JUS A;  2WAE A;  4IKF A;  2O61 A;  3F8C A;  3ZMU A;  2CV2 A;  4Y4R A;  1S6L A;  2ZJQ F;  3I4M J;  4D5F A;  1O3R A;  4F3Q A;  4O6J A;  2DMP A;  2Q2E B;  2ZNY A;  2IA2 A;  1FC3 A;  1MJB A;  3DU6 A;  4XN0 A;  2GIZ A;  2TRT A;  5LEJ A;  2IGK A;  3QU6 A;  4BHP A;  2RNG A;  4CZC A;  1P9Q C;  4XM3 A;  4QPQ A;  2R5Z A;  2X51 A;  5J1U A;  3CCU I;  3M7G A;  4IOC F;  3OYJ A;  3CCQ I;  3BQZ A;  4PJJ A;  4WF2 A;  3JRB A;  5M5W J;  1HA8 A;  4ZDO A;  3M8F A;  2VPR A;  3MFK A;  5E3O A;  1S3J A;  4XIC A;  1CF7 B;  2V6E A;  3ZQG A;  5M3M J;  2CS3 A;  1IAW A;  4P9F A;  3FBN B;  2K3F A;  3ROU A;  4WXC A;  1K61 A;  4BDY A;  2KZV A;  3VOE A;  3E3V A;  2CUZ A;  3CME I;  2DJN A;  2FD5 A;  2ZXH A;  3HOZ J;  1IV6 A;  2LRD A;  2A61 A;  1V55 H;  3GLX A;  4X0G A;  4UVC A;  5LFA A;  2KMU A;  1SFX A;  1U9N A;  4XR6 A;  3SZG A;  1TWF J;  2VIX A;  5K5R A;  2DOD A;  2UZK A;  3KP7 A;  2QKM B;  3AG2 H;  1DU0 A;  4RAZ A;  3J7Z I;  4CCN A;  2M87 A;  4M9S A;  2HOT A;  3A0H C;  2X48 A;  5GAH J;  2PJP A;  1DGR M;  4XLC A;  1MSE C;  5H6Q A;  2CW0 F;  2HEO A;  1FBU A;  3HHG A;  3PFI A;  4CCO A;  3LQR A;  4RGU A;  3I59 A;  1Z67 A;  1OFC X;  4EJV A;  3LAP A;  2ZME C;  2ICW G;  3I54 A;  1Y39 A;  1SFO J;  1IO2 A;  2DYR H;  1EJ9 A;  4AIH A;  1D8J A;  2PEX A;  1A35 A;  2WAQ A;  1U78 A;  3O2P E;  3HOU J;  3PQJ A;  2A6T A;  2IEK A;  1S7O A;  2NXN B;  3B6C A;  3OYK A;  2HOS A;  5IOY A;  2X1C A;  2XDV A;  4KJZ A;  1Y8Q B;  1ETV A;  2MLK A;  1ON2 A;  3Q3S A;  2OUM A;  2KKO A;  3HRT A;  4KT6 A;  2F48 A;  4HZF A;  2ESN A;  2X9D A;  4YIR X;  1MMS A;  5A2Q Z;  1FBS A;  3ASN H;  3ULQ B;  4D7N A;  4MNU A;  2HDW A;  1FSH A;  1MBJ A;  1J09 A;  2MFZ A;  2VXZ A;  3BPX A;  4A3K J;  1XDU A;  4P96 A;  1KQ8 A;  4XKB A;  4ZTJ A;  4BBS J;  2H1L A;  2MD0 A;  5D5X B;  1BI1 A;  2M45 A;  1WWX A;  3OYC A;  1ZRD A;  1UEL B;  3ABM H;  4EEF G;  2B63 J;  2KRC A;  2MD5 A;  5AIP A;  5HVQ C;  2KHM A;  3TP3 A;  4M71 A;  1O7F A;  4G7O F;  3PSI A;  2F2E A;  3K9T A;  2NNN A;  3FX3 A;  1SD6 A;  2XAG A;  2ZCW A;  1MIJ A;  3CF5 F;  2C6Y A;  4BXX J;  3DEE A;  3N97 A;  2GXG A;  5IT9 Z;  2DMT A;  3MKY B;  1ENH A;  3GYH X;  2DQR A;  4PJ0 C;  2QVO A;  3PO3 J;  4L5E A;  2OTJ I;  1BJA A;  4MHG A;  4BJT A;  1U8R A;  1GV5 A;  2DA1 A;  2GBY A;  4YII A;  2O0Y A;  2FSW A;  3GWZ A;  2PMZ A;  5K5Q A;  5FLX Z;  3E1S A;  3TKY A;  1JKQ C;  3V7S A;  2FOK A;  2QLZ A;  3B02 A;  5L3C A;  2EFW A;  2LOO A;  1IC8 A;  2DMQ A;  1VQP I;  4A69 C;  2YR2 A;  2KIS A;  3BJO A;  4UUV A;  3L2U A;  1MH4 A;  1TNT A;  3SXY A;  1U2W A;  1REP C;  5CYV A;  4RS8 A;  1B8I B;  2L9N A;  3HSR A;  4IRI A;  3JAM K;  1Y0N A;  2ID3 A;  2DTR A;  4U88 A;  2HDC A;  4N0B A;  2R7V A;  3HL2 A;  2OZ6 A;  1W7P D;  2BHY A;  1IRX A;  4A93 J;  1GXP A;  2M34 A;  3S1R J;  1A6I A;  3W6V A;  2V1U A;  1FOY A;  5J47 A;  4ENK A;  2E34 A;  1YX5 A;  2GQQ A;  3ASO H;  2O6G E;  2A6E F;  3CO7 C;  3CUQ C;  3FKI J;  4JQF A;  2Q0O A;  1Y1W J;  2MH9 A;  1FJL A;  1ETO A;  1K6Y A;  3HBL A;  1PUE E;  2K9L A;  4I7H A;  3HUG A;  2XKP A;  4L18 B;  5GPA A;  4UVB A;  4E70 A;  2E1M B;  2P6S A;  1GHC A;  4HPQ A;  5DDG A;  5EZG A;  3V8L A;  4EJU A;  1U6G A;  2L7K A;  5FKN A;  5EYR A;  1JGS A;  3M1E A;  3T0Y A;  1UAA A;  5L3F A;  2CFX A;  3FIW A;  1B72 A;  2IGO A;  1YLF A;  3LSG A;  1JE8 A;  5J8F A;  5LGT A;  4V2F A;  2A3S A;  3G73 A;  4XOR A;  5M3F J;  2JK3 A;  4NB5 A;  5IT9 K;  2MH2 A;  3FK7 A;  2HNH A;  3SFZ A;  3SEQ A;  3EUH A;  1ZEL A;  2ZXJ A;  2JPB A;  3F8B A;  4U7B A;  2G7U A;  2P8T A;  1F5T A;  2IAI A;  4W1U A;  4HQE A;  2NS8 A;  4IEJ A;  3CP8 A;  1W0U A;  3HG9 A;  3BOQ A;  2EIM H;  2M5W A;  5EEH A;  3KP6 A;  5TIS C;  1K6O A;  2FX0 A;  2NOG A;  4MGR A;  4ENN A;  2L01 A;  1ZYR F;  3KYC B;  2I8D A;  3VYT B;  1TZL A;  4Y52 J;  4XSZ F;  2M4G A;  1ON1 A;  1R7J A;  3CC2 I;  5B66 C;  3IRR A;  4U7D A;  2EB7 A;  2EJR A;  5E20 A;  3PUF A;  2X6Y A;  2XF6 A;  3OMY A;  1UCR A;  3ZXS A;  4L9T A;  2OJE D;  2OBP A;  3PUB A;  2OC6 A;  3RPQ A;  2OF7 A;  4BH9 A;  5B1A H;  2ZJP F;  2YU3 A;  1QVU A;  1HKS A;  2YX4 A;  3K4L A;  3JAM Z;  3OIQ A;  1R9T J;  2FU4 A;  3HUG B;  1ZGJ A;  1OR7 A;  2HOA A;  3L9F A;  1MJ9 A;  1ACI A;  4UB8 C;  4RM2 A;  2HI3 A;  4HLX A;  2VBX A;  3ZGK A;  2HYF A;  2MAB A;  3HSF A;  4LLL A;  1HDP A;  4G7Z F;  4AID A;  3MD2 A;  3L00 A;  3LA3 A;  1Z91 A;  1OIS A;  2W57 A;  4PUS A;  5J4Y A;  2CRG A;  4KDP A;  5CVR A;  4HYE A;  4PGG A;  2LF7 A;  1W5C C;  3FZV A;  4BQQ A;  1UG0 A;  3DBR B;  4Q48 A;  2XPU A;  3UR3 C;  5HDN A;  1OCO H;  2O8K A;  3A0B C;  3BTJ A;  1MJA A;  3NQO A;  4XKW A;  1ZLJ A;  3H5N A;  4BAC A;  3DKX A;  2KLO A;  2ZFU A;  1XSV A;  2E5N A;  3IHU A;  2WV1 A;  1V3F A;  4PJL A;  5AIQ A;  3WTU C;  2LRE A;  3EUH C;  3ZCO A;  4E7S A;  2L9R A;  2XIG A;  2FF4 A;  2JUG A;  2LBF B;  2X1E A;  3QPH A;  4BKX A;  4FT8 A;  3BR0 A;  1OKR A;  1JTX A;  3OOU A;  3ZRG A;  3J7Y J;  2CV0 A;  4IHY A;  4BJ6 C;  3CO6 C;  1G3Y A;  1G3W A;  2DU9 A;  5IT3 A;  4IXA A;  2OQG A;  3BR3 A;  4KMU X;  4M6X A;  2EIL H;  1CGP A;  2ECB A;  3CLO A;  1P4X A;  2HU9 A;  3A1Y A;  2RN7 A;  1IRF A;  1R23 A;  1QHH D;  1TP4 A;  4UUT A;  1BW5 A;  3SEZ A;  2LD5 A;  1X4O A;  3LFU A;  5CKT A;  5IYC J;  2R92 J;  3HGY A;  3J80 K;  3V8K A;  3VPR A;  4BAY A;  4MQV A;  2TDX A;  4DJA A;  2QF7 A;  2HZD A;  2GA1 A;  1ZGW A;  3IC7 A;  4BL0 B;  3OYI A;  5E79 C;  3PSF A;  4IHT A;  1FIA A;  3C7J A;  2KJC A;  1WI9 A;  1BOB A;  1X1P A;  4RLQ A;  1E0E A;  1SEU A;  2RC4 A;  4RB2 C;  2R7S A;  3FF5 A;  2XPW A;  3BQY A;  4XKV A;  4S0H B;  1WJ5 A;  4A3C J;  4LG0 A;  4LJZ F;  2GXB A;  1P7I A;  1FBQ A;  2CQ7 A;  2G9W A;  4IRH A;  2PX9 A;  5IP6 A;  1UST A;  4G7H F;  3S2H J;  3ZQI A;  2JTV A;  4E7Z A;  3HB9 A;  1WH5 A;  3FM3 A;  3FXU A;  5HNF A;  1TQM A;  2IA1 A;  2DT6 A;  1HLV A;  2MBF A;  3BTL A;  3M07 A;  2VQC A;  2ZKZ A;  2LKS A;  3OYL A;  4GXO A;  4GCV A;  3BZ6 A;  1IGN A;  3CQZ J;  2XB0 X;  4IQJ A;  3WTV C;  1IXC A;  2W00 A;  1B9M A;  1WJC A;  1YRN A;  2ZJ2 A;  1WZ2 A;  4KUM A;  3MKZ A;  4HLY A;  3LA7 A;  3JRI A;  2M7B A;  5KAF C;  1HQC A;  3I4P A;  4X6A J;  1V5E A;  3BZC A;  1Q1V A;  3REO A;  2PI0 A;  3CES A;  2OZU A;  1B72 B;  1ERD A;  3C2G A;  2ZB9 A;  1SFK A;  1VTN C;  5ED4 A;  3JSO A;  5E1X A;  1B59 A;  3H9J A;  4CO8 A;  3IWF A;  4XQF A;  2AXL A;  3KP4 A;  2FOW A;  3TO6 A;  1E3O C;  2KRF A;  2HDD A;  1WSU A;  1G4D A;  5F04 A;  4BDZ A;  2EZH A;  2LTP A;  3E7L A;  5BMZ A;  1O3S A;  5GP9 A;  3COA C;  1X1A A;  2CJJ A;  5TRD A;  2L5Q A;  2DT5 A;  2QQ9 A;  4G6D A;  1XCB A;  2Z16 A;  1MNM C;  1XX5 A;  1IXS B;  2H6B A;  1NH3 A;  3E6B A;  2Y9Y A;  2X4H A;  2E60 A;  2VB6 A;  3Q0U A;  2ZFW A;  1NHA A;  1FNN A;  1ZQ3 P;  3TW7 A;  2MSY A;  1K4T A;  1OPC A;  4L9J A;  2O8X A;  4HST A;  2IP2 A;  4QPO A;  4MEY F;  3FXO A;  1PVE A;  3QQA A;  3U2R A;  3JW4 A;  4B09 A;  4ESB A;  4IVN A;  5HS9 A;  3RI4 A;  3N05 A;  4ENM A;  2I5U A;  4HSR A;  3RQ4 A;  5D8L B;  1R71 A;  1QZY A;  5JFR A;  2JA7 J;  2F5F A;  5LRR A;  1ZK8 A;  5HNH A;  1R5I D;  4KIC A;  2VKH A;  5BNG A;  1NG6 A;  3OIO A;  4LK1 F;  3S3M A;  2FQ3 A;  3JRC A;  3SDG A;  4XLF A;  5DCM A;  2DCE A;  2HS5 A;  2WAD A;  1IN5 A;  1IV8 A;  4N9I A;  2ELH A;  1RUO A;  4E7K A;  1K83 J;  3I3L A;  3DKW A;  5D5V B;  2MC4 A;  2M8G X;  2R3S A;  4EM0 B;  3GLL A;  2XAS A;  5HS7 A;  1D0X A;  3H9Q A;  3LQQ A;  4I98 B;  4KIG A;  2CFO A;  1YW8 A;  5EDN A;  5GTH C;  3VWB A;  5CVI A;  1Z6R A;  2BY2 A;  1MW7 A;  3EPZ A;  1G2H A;  4NDL A;  5DS9 A;  3E6M A;  2LBF A;  2Z2S B;  1B1B A;  2DMN A;  3OR1 C;  5BPD A;  4IO9 F;  5CJ9 A;  1A04 A;  3QYE A;  1HKQ A;  3C3W A;  1SAU A;  1LPQ A;  1LFU P;  2E1M C;  3BY6 A;  4B3X A;  4HF0 A;  2JSC A;  3LL7 A;  3D5L A;  4IX7 A;  3CC4 I;  5BOX A;  2L9V A;  3K4B A;  4LIU A;  1OCZ H;  3DPT A;  1F36 A;  5J40 A;  5B1B H;  3VDX A;  5K7F A;  4EGY A;  1BIA A;  2K4B A;  2K40 A;  3JRD A;  4F91 B;  1S5L C;  3EUK L;  3HPG A;  1I6X A;  3L2V A;  3PFY A;  4I02 A;  2VOD A;  2IXS A;  4ZC3 A;  5EJC A;  4AIK A;  1SMT A;  3EYI A;  2NOJ B;  1QVT A;  2HGC A;  4M6V A;  1SAX A;  1K78 A;  1KON A;  4JYK A;  2BV6 A;  1KZH A;  3R0J A;  1IN4 A;  5DCF A;  2EH3 A;  3KYL A;  1H8A C;  2W48 A;  1R6R A;  2MYS A;  1ZH5 A;  5LEK A;  4CYC A;  1WVR A;  2BVL A;  3K70 D;  4O3M A;  2GAU A;  2JN6 A;  1LE8 A;  2FBH A;  4LB5 A;  3AG4 H;  1ZGA A;  4BS9 A;  2GM4 A;  3KEY A;  3PL8 A;  1JXS A;  1KYZ A;  4EM2 A;  3GFJ A;  3HZJ A;  1P4A A;  2XKO A;  2QEX I;  4CCL A;  5ICF A;  2VE8 A;  2KJB A;  1FYL A;  2XAJ A;  3K69 A;  2ZME B;  1RRJ A;  4BEH B;  4BQA A;  1BL0 A;  1X3Z B;  5CQE A;  3U21 A;  2DOF A;  3LFK A;  2DAO A;  2M8E A;  2P7V B;  2UUZ A;  4CUG A;  2WAF A;  1EA3 A;  3OY9 A;  2L0K A;  1HW2 A;  1AHD P;  1HC8 A;  2VLA A;  5B3S H;  1O4X A;  5FLV A;  1XB4 A;  1OMI A;  3T8T A;  3HKZ A;  2V7F A;  4D0P A;  4UHT A;  2E1C A;  2DXI A;  3OIP A;  2CUJ A;  4C30 A;  1W36 D;  4H4K C;  2XUB A;  1RC9 A;  1YO5 C;  4AM3 A;  2FRH A;  4QSH A;  3NWS A;  4XRM A;  2L3D A;  1YIT I;  2DW4 A;  3E97 A;  3ZQF A;  3ZN1 A;  4HDV A;  4V19 K;  5FO5 A;  2P81 A;  3IP4 B;  2ID6 A;  3CP2 A;  5IP9 J;  5C44 J;  4D9J A;  2D45 A;  4EMS A;  2MW8 A;  5LGN A;  1A31 A;  3RKX A;  2XB5 A;  2F5E A;  5F0H A;  4S04 A;  1UZC A;  1XSX A;  1MH3 A;  2DFI A;  2Z9O A;  1K78 B;  2ZXW H;  4XRS G;  3DTK A;  4KT5 C;  3RZO J;  3W3C A;  3HC7 A;  4L9V A;  1N78 A;  1IN8 A;  4NNJ A;  1BR1 A;  1X2M A;  3CJT B;  3RDI A;  4L0Y B;  3BR5 A;  5JLW A;  3GO5 A;  3BDD A;  3F8F A;  4XID A;  4RAF A;  1N75 A;  2H8W A;  3CUQ A;  2F6C A;  5D5U B;  2PLY A;  3ZMD A;  1MMG A;  2KRH A;  1X2N A;  3ESW B;  2L4M A;  5E1Z B;  1D1A A;  4GO1 A;  3SDB A;  1O3T A;  5F0F A;  3GME A;  3SZP A;  3LSP A;  4M74 A;  4PFO A;  1P92 A;  4YIF A;  5E8I A;  4BEH A;  1VND A;  1GT0 C;  1FMV A;  3J7A Y;  4LGW A;  4M6Y A;  1U5T A;  1XD7 A;  4P55 A;  5D6F A;  4XLP F;  1VI0 A;  4PGH A;  2PFB A;  3F8M A;  3KP3 A;  5DM7 F;  2VUM J;  4BXF A;  4ZYD A;  2F4M B;  1QO0 D;  5F0C A;  2EA4 A;  1VQL I;  3KCC A;  1LE8 B;  1D1C A;  1W5S A;  1ZHF A;  4BE2 A;  2AQE A;  3S8P A;  3FXL A;  3CCE I;  2DTZ A;  2HVR A;  2L7Z A;  4LK0 F;  4Q4Z F;  2HKX A;  3PQK A;  3V42 A;  1JKO C;  4LD5 A;  1RUN A;  2FBI A;  4Y13 A;  4B48 A;  4ANJ A;  3M4O J;  2MGQ A;  4M3E A;  2B7E A;  2GIV A;  1D3Y A;  1MND A;  1POG A;  2VJJ A;  2O3F A;  1V54 H;  3Q0V A;  3S2D J;  3HOV J;  2B0L A;  3Q9V A;  1Z7U A;  5FKL A;  4R79 A;  3HTS B;  2CW8 A;  2K9S A;  5D5W B;  4FE7 A;  1Y0U A;  3TO7 A;  4ZTF A;  4KNY A;  3OR2 C;  5DD8 A;  2IRF G;  2HXI A;  1TTY A;  2YS9 A;  4CZZ A;  3OS0 A;  1ZN2 A;  3OOP A;  3BT9 A;  5D4R A;  3KIO A;  4I09 A;  2Y9Z A;  1FT9 A;  4HX4 A;  1R4N B;  1R5H A;  2UV1 A;  4IZZ A;  2FUG 2;  4EAT A;  3T1B A;  3G1O A;  4ITV A;  2FJ1 A;  2Q8K A;  1XGN A;  5ILU A;  2CV1 A;  4LFU A;  4KA4 A;  1GUU A;  3EET A;  2L7M P;  2CWE A;  3NWT A;  1TBX A;  4MFD A;  4ZYH A;  3OYN A;  1HCR A;  2Y2Z A;  2CQK A;  3HXL A;  3G71 I;  1U8B A;  1VQ8 I;  1NTC A;  3ZQC A;  2FNP A;  3KPH A;  1DGW Y;  2XAQ A;  4ZYE A;  3HRS A;  3IKV A;  2OV7 A;  4C3J J; 
#chains in the Genus database with same CATH homology
 4GFB A;  3B6A A;  4FE4 A;  4DZJ A;  4AC0 A;  3GTJ J;  2OF7 A;  2G0E A;  4A3F J;  5IP7 J;  2E2I J;  3O8H A;  1AKH B;  1QVU A;  3LSJ A;  5EF6 A;  2RAE A;  1R9T J;  2EZK A;  1JT0 A;  4D5C A;  2HOA A;  2LVS A;  4CYC B;  4B1R A;  2HI3 A;  3HKZ N;  1NK3 P;  1JUP A;  4Y7N J;  2R93 J;  1EF4 A;  2NS7 A;  1QPI A;  4C3H J;  2YUS A;  1IRZ A;  3CDL A;  1HDP A;  5K7Z A;  9ANT A;  1F43 A;  5HOD A;  3CCY A;  5FLM J;  3S16 J;  2CRG A;  2K9N A;  3A01 A;  3GTL J;  2L7F P;  1LFB A;  2OPT A;  1RET A;  1ZTR A;  2XPU A;  2E1O A;  1T33 A;  3BR2 A;  2EBI A;  4B3A A;  3BG5 A;  1VFC A;  2O8K A;  2YU9 J;  3BTJ A;  2WB1 N;  2VKE A;  4M3G A;  4HNV A;  2JJ7 A;  3L1P A;  3JRE A;  3DCF A;  3HOY J;  2HQ5 A;  3QPS A;  4I76 A;  2WV1 A;  4FTH A;  2DA2 A;  5FKM A;  2ME6 A;  2HXO A;  3MVP A;  2KDZ A;  3GTP J;  2R7Z J;  2L9R A;  2JA8 J;  4BKX A;  5C4X J;  1JUM A;  3BR0 A;  3S15 J;  5J3L A;  3OOU A;  1JTX A;  2XGC A;  4XK4 A;  1RR7 A;  4IHY A;  1JGG A;  2XGD A;  3BR3 A;  3BTI A;  2ECB A;  2KT0 A;  2EQR A;  1GVD A;  1WPK A;  3MKL A;  3K7A J;  5FKO A;  3JRA A;  4UUT A;  1BW5 A;  2LD5 A;  4DYR A;  1JKR C;  5IYC J;  2R92 J;  3HGY A;  1IDZ A;  3VPR A;  5C3E J;  1XS9 A;  1RKT A;  2WAQ N;  3JRH A;  2QF7 A;  3G1L A;  1ZGW A;  1Z77 A;  1GDT A;  1PUF B;  1JT6 A;  2NVQ J;  1HOM A;  1ETQ A;  5GPC A;  2XSD C;  1FIA A;  2MG4 A;  5EG0 B;  3RZD J;  1S7E A;  3F0C A;  2ECC A;  2R0Q C;  4DZP A;  2O7O A;  2XPW A;  3BQY A;  5EG0 A;  4S0H B;  2E2J J;  4A3C J;  2FQ4 A;  1P7I A;  5K7H A;  1WH7 A;  1OCP A;  3H0G J;  3M3Y J;  5IP6 A;  3PO2 J;  3S2H J;  3TW6 A;  3ZQI A;  3G1M A;  1OCT C;  3HB9 A;  1WH5 A;  2DA6 A;  5IOZ A;  1OJL A;  1HLV A;  5JLX A;  3BTC A;  4JP0 A;  3BTL A;  3S1Q J;  1VF9 A;  3JRF A;  3JRG A;  1IGN A;  3CQZ J;  2XB0 X;  4ABZ A;  2NVT J;  3A03 A;  4A3I J;  2O9L A;  3HEF A;  3FK6 A;  3GBG A;  1YRN A;  3GTK J;  1T56 A;  5J1Y A;  3JRI A;  3SJM A;  3A02 A;  5FJ8 J;  4W97 A;  4A3M J;  2LFB A;  4X6A J;  3BG9 A;  1Q1V A;  1YRN B;  2CQX A;  1ZR2 A;  2DA5 A;  2CUE A;  1B72 B;  2ZB9 A;  2EZL A;  2DA4 A;  2K9Q A;  4AYB N;  4BY1 J;  2XGE A;  3QPL A;  1AU7 A;  2R5Z B;  4J19 A;  1QRY A;  1E3O C;  1Z0X A;  2HDD A;  1FTT A;  5F04 A;  2EZH A;  2LTP A;  3E7L A;  2DA7 A;  2LY9 A;  1I6H J;  1P7J A;  1DU6 A;  5GP9 A;  2CJJ A;  4MFE A;  4C2M J;  3S1N J;  1MSF C;  1HDD C;  5F08 A;  5E3L A;  3I4N J;  1MNM C;  2JWT A;  4B4C A;  2Y31 A;  2R5Y A;  5C4J J;  2DMU A;  1ORK A;  2Y9Y A;  2GLO A;  3Q0U A;  2Y30 A;  5IYB J;  1ZQ3 P;  3TW7 A;  2CQQ A;  5EEA A;  2MSY A;  3TED A;  2QCO A;  3QQA A;  3ZQL A;  2E19 A;  4AUX A;  4IHV A;  2JA7 J;  1JUS A;  1ZK8 A;  4A3D J;  4MLO A;  1TWA J;  1I3Q J;  5BNG A;  3OIO A;  3I4M J;  5M5Y J;  4D5F A;  3PM1 A;  2DMP A;  1IUF A;  3JRC A;  3SDG A;  2TRT A;  3C2B A;  1ETY A;  1K83 J;  3BR6 A;  3BR1 A;  2R5Z A;  1IJW C;  1AKH A;  2M8G X;  5J1U A;  1MBG A;  4RBO A;  3S17 J;  4I6Z A;  1JJ6 C;  5EGO B;  5EDN A;  3BQZ A;  5M5W J;  3JRB A;  4D7M A;  2VPR A;  5EZH A;  2JA6 J;  3K2A A;  1D5Y A;  1MBF A;  5E3N A;  5E3O A;  5E3M A;  3D1N I;  1FIP A;  4IHW A;  4XIC A;  2LR8 A;  1BA5 A;  1BW6 A;  3NAR A;  3ZQG A;  5M3M J;  1G2H A;  2HYJ A;  4NDL A;  3IH3 A;  5DS9 A;  5M5X J;  2LK2 A;  2D5V A;  1BJZ A;  2DMN A;  1K61 A;  2XPV A;  4FCY A;  4DW6 A;  2AO9 A;  2DJN A;  2FD5 A;  3HOZ J;  1IV6 A;  1LFU P;  1JKP C;  4UUS A;  3IH4 A;  3HGG A;  3S1M J;  1U9N A;  1UG2 A;  3H3V K;  1TWF J;  2I10 A;  1ZR4 A;  1F36 A;  1MBH A;  1DU0 A;  1B8I A;  1SAN A;  5K7F A;  2NVY J;  2PMZ N;  5IPA A;  4DYC A;  2K40 A;  3JRD A;  2HOT A;  2X48 A;  2H1K A;  1XG1 A;  3Q0W A;  1MSE C;  4V2G A;  4C3I J;  1QVT A;  2M2E A;  3MN2 A;  1ETW A;  2CU7 A;  4JYK A;  1OFC X;  2M0C A;  2EH3 A;  1H8A C;  2W48 A;  4RDU A;  1SFO J;  1ETX A;  4CYC A;  2E2H J;  1WGX A;  2JN6 A;  1LE8 A;  1U78 A;  3HOU J;  1IG7 A;  2NVX J;  3FIS A;  2DN0 A;  2H8R A;  2GM4 A;  2IEK A;  3B6C A;  3GTO J;  1MBK A;  2HOS A;  5IOY A;  4IHX A;  3ZOB A;  1ETV A;  1I50 J;  1H88 C;  3OSF A;  3Q3S A;  3A01 B;  1BL0 A;  1ETK A;  4BY7 J;  2TCT A;  3IH2 A;  1TWG J;  2X9D A;  3LOC A;  1ITY A;  1FEX A;  1TWH J;  2L0K A;  2AHQ A;  1AHD P;  3GTM J;  4QIW N;  2LP0 A;  1XC5 A;  4D7N A;  1O4X A;  5FLV A;  3LSR A;  2DA3 A;  1MBJ A;  3S14 J;  4A3B J;  4A3K J;  3LNQ A;  4BBS J;  3O8G A;  2COB A;  5EGO A;  4EEF G;  2B63 J;  3CMY A;  1H89 C;  3TP3 A;  3NAU A;  3HOW J;  4QSH A;  3OSG A;  4M3F A;  4XRM A;  2JMW A;  3ZQF A;  1IDY A;  2P81 A;  2ID6 A;  5IP9 J;  4X1E A;  5C44 J;  3HOX J;  4BXX J;  2MW8 A;  2XB5 A;  5F0H A;  2DMT A;  3GTG J;  1ENH A;  3PO3 J;  1MH3 A;  3BG3 A;  4QTR A;  4L5E A;  4XRS G;  3WHB A;  1APL C;  3RZO J;  1GV2 A;  1GV5 A;  2DA1 A;  2GBY A;  4M3B A;  3RKQ A;  2LLK A;  4MIM A;  4UUS B;  2R5Y B;  1JKQ C;  2ELK A;  1X2M A;  1MBE A;  2N8G A;  3BR5 A;  5JLW A;  4A3J J;  2VKV A;  1JTY A;  1X58 A;  4XID A;  1IC8 A;  2DMQ A;  1CQT A;  1WCM J;  4A69 C;  1X2N A;  4JX4 A;  2VI6 A;  3JR9 A;  1MH4 A;  5F0F A;  1W0T A;  3LSP A;  1B8I B;  3UKG A;  3HDD A;  5FKK A;  1VND A;  1GT0 C;  2ID3 A;  4A3E J;  3IV5 A;  3SFI A;  1ZKG A;  1RPW A;  1VI0 A;  1FTZ A;  4A93 J;  3W6V A;  2M34 A;  3S1R J;  1A6I A;  4A3L J;  3RQI A;  2VUM J;  5F0C A;  1LE8 B;  1UMQ A;  3FKI J;  1Y1W J;  1FJL A;  1ETO A;  3HBL A;  4M3D A;  2DTZ A;  5J1R A;  1A5J A;  2L7Z A;  2M9H A;  1UHS A;  4JX5 A;  2CUF A;  1JKO C;  5GPA A;  1Y1V J;  3M4O J;  4LOC A;  3DEW A;  2MGQ A;  4M3E A;  5EZG A;  5FKN A;  4G12 A;  5EYR A;  4DYQ A;  2XRL A;  3FIW A;  1POG A;  2Y0S N;  3WHC A;  3Q0V A;  1B72 A;  3S2D J;  3HOV J;  5FKL A;  3LSG A;  1NK2 P;  4XRS A;  2K9S A;  4FE7 A;  4V2F A;  5F1J A;  2ME0 A;  2JK3 A;  5M3F J;  4BBR J;  3FK7 A;  2HXI A;  2YS9 A;  3BT9 A;  2Y9Z A;  1HF0 A;  2IAI A;  1RKW A;  2IBD A;  4W1U A;  2LKX A;  2JA5 J;  3G1O A;  4JX6 A;  3ZQH A;  1TWC J;  2NS8 A;  4IEJ A;  2FJ1 A;  1TC3 C;  3HM5 A;  1W0U A;  5DTD A;  1GUU A;  1PUF A;  2L7M P;  4MFD A;  3TP0 A;  2FX0 A;  2NOG A;  5F27 A;  1HCR A;  2Y2Z A;  4A3G J;  2X6O A;  1U8B A;  1WI3 A;  5IYD J;  4Y52 J;  1NTC A;  2EZI A;  1RES A;  3ZQC A;  3GTQ J;  4MO7 A;  1JJ8 C;  1U9O A;  4FIS A;  4M6V A;  4C3J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...