1IDZA

Structure of myb transforming protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idzA00
4A3DJ 3DEWA 1WI3A 1OCTC 2E19A 1I50J 1XC5A 4BY7J 2ID3A 2JA5J 1MBKA 1PUFB 2CQQA 2OPTA 1IGNA 3BR3A 3G1LA 2ME6A 1UMQA 3BT9A 4A3MJ 1HF0A 2K9SA 2DMQA 5EEAA 1LE8B 1IRZA 3JRBA 4XRSA 2M0CA 5IYBJ 5M5WJ 1Z77A 4IEJA 4M3DA 4C3IJ 4QIWN 3BQYA 3CDLA 5IOYA 5EF6A 4UUTA 1JUPA 1I3QJ 3BTLA 3G1OA 3RKQA 2DJNA 1VI0A 2H8RA 2XPUA 2DMPA 5F04A 2HXOA 1JJ8C 2XB0X 5IYCJ 1IUFA 3FIWA 2YU9J 4BY1J 3MKLA 3O8GA 2MGQA 3BG3A 2NS7A 1ETKA 2JJ7A 1WH5A 3LSJA 4QSHA 3TP3A 2DTZA 1ETXA 1FTZA 4M3GA 2WAQN 1GDTA 1H88C 4FISA 2R5YA 2TCTA 4A3GJ 1U8BA 1VF9A 4XIDA 5E3NA 4A3CJ 4CYCB 2E2HJ 2L0KA 4JX5A 3PM1A 4S0HB 1GV2A 5EG0B 9ANTA 5FKOA 3JRDA 4B1RA 2DA7A 3M4OJ 4DYQA 2ELKA 3FKIJ 2HOSA 2LR8A 4I76A 1YRNA 4A69C 1ORKA 2KDZA 2ID6A 5C3EJ 2EZIA 1GT0C 2EZKA 2M2EA 4XICA 2HXIA 4LOCA 5FKMA 2XGCA 2E2IJ 1TWAJ 3H3VK 4C3HJ 2DMNA 3HOWJ 5DTDA 2ECCA 1U9OA 2EQRA 3JRAA 2HDDA 4M3FA 2VI6A 5J1RA 3S17J 1F36A 1P7IA 2M34A 3BG9A 4V2FA 3S14J 2JA7J 2EH3A 5M5YJ 1WPKA 2G0EA 4DYCA 3Q0UA 5E3MA 1ENHA 3OSFA 1RESA 3BR2A 2JK3A 5HODA 2DA1A 1JUMA 1XG1A 2LP0A 3BR1A 1TWFJ 1QVTA 3SFIA 1P7JA 3MVPA 5F27A 3S1RJ 1GVDA 1B72B 2DA5A 1JKRC 2LK2A 1VFCA 1HDPA 5EZGA 4MFEA 5F0FA 2LVSA 1I6HJ 1MBGA 4XRMA 1ETQA 1NTCA 4MIMA 3OSGA 3GTPJ 1QRYA 1NK2P 4G12A 4Y7NJ 4IHWA 5GP9A 2O8KA 2O9LA 3RZOJ 5F08A 1IJWC 1BW5A 3RQIA 2K40A 1MBJA 2I10A 4FTHA 1ETWA 1ZKGA 4W97A 2D5VA 2MG4A 3BTCA 3MN2A 3LSGA 3BR5A 2MSYA 4M6VA 5IP7J 2HYJA 4JP0A 2COBA 2CQXA 1JKOC 4A3FJ 2DMTA 3A01B 2DMUA 1PUFA 5FLMJ 1MSFC 1ZR2A 5J3LA 4JYKA 3SDGA 5EZHA 4D7NA 1HCRA 2H1KA 1RETA 4EEFG 1H8AC 3IH2A 1QVUA 5GPCA 2M8GX 5F0CA 2LD5A 2K9NA 2DA2A 2HOAA 3GBGA 3O8HA 2NVQJ 1X58A 3CCYA 1XS9A 2P81A 5IOZA 2JA6J 4XRSG 2R5ZA 5C4XJ 5M5XJ 3L1PA 2R0QC 2FX0A 2RAEA 4AYBN 1AHDP 3S1MJ 1ZGWA 2XSDC 2DN0A 1U78A 4RBOA 1MH4A 3Q3SA 2NVYJ 1S7EA 3ZQLA 3E7LA 2R93J 4Y52J 2X6OA 2IAIA 1X2NA 4DYRA 1T56A 2LFBA 1ZR4A 4A3JJ 4B3AA 2R7ZJ 3CMYA 4W1UA 1ITYA 4A3EJ 1U9NA 2ECBA 1RR7A 1SANA 5IYDJ 1JGGA 2LKXA 2NVXJ 2AHQA 3DCFA 1LE8A 1ETYA 3ZQGA 2QCOA 3HGYA 3NARA 1JT6A 1JUSA 1ETOA 2O7OA 3S16J 4A3BJ 3JRFA 2R92J 5JLXA 3JRHA 4BKXA 3D1NI 4AC0A 5M3FJ 2ZB9A 3HM5A 4BXXJ 3HOUJ 1SFOJ 1HLVA 1Y1WJ 1G2HA 3QPSA 5E3LA 4C2MJ 3BQZA 2CJJA 5M3MJ 5F0HA 1B8IB 4XK4A 4DZPA 1IC8A 2Y31A 2E2JJ 1MBEA 4DW6A 1HDDC 3CQZJ 2EBIA 3GTOJ 4UUSB 2JWTA 1R9TJ 3LSRA 4IHXA 1RPWA 3HGGA 3I4NJ 1OJLA 4D5CA 1MBHA 3FISA 3F0CA 2L9RA 3JR9A 4BBRJ 3ZQCA 3ZQIA 2JN6A 1JTXA 2CU7A 4L5EA 3WHCA 3OOUA 1X2MA 2E1OA 5IP6A 1MSEC 2EZHA 1Q1VA 4D7MA 1CQTA 2N8GA 1E3OC 1GV5A 3S2DJ 3PO2J 2CUEA 3B6CA 3G1MA 1ZQ3P 1POGA 3BR6A 4A3IJ 4J19A 3S1QJ 4FE7A 3IV5A 3TW6A 3GTJJ 2FJ1A 1TC3C 5FLVA 4M3BA 1TWGJ 5FKNA 1BA5A 1AKHB 5J1YA 3HKZN 2XB5A 1LFUP 1B8IA 2GM4A 3S1NJ 2WB1N 5FKKA 1H89C 2HQ5A 2X9DA 1B72A 3K7AJ 3B6AA 3RZDJ 3JRCA 3LNQA 2Y0SN 3IH4A 1IDYA 3NAUA 1AU7A 2QF7A 5GPAA 1JT0A 3JREA 4ABZA 1APLC 4BBSJ 4DZJA 1HOMA 1OFCX 3PO3J 2XGEA 5C44J 4JX6A 4JX4A 2W48A 3BTIA 1EF4A 4V2GA 4CYCA 2XPWA 3Q0WA 1F43A 1QPIA 3VPRA 2L7MP 3LOCA 2EZLA 2X48A 5EYRA 3ZQHA 3K2AA 4RDUA 2DA6A 2FD5A 4M3EA 1LFBA 1O4XA 2R5ZB 4X1EA 2LY9A 1K83J 1GUUA 1Z0XA 1RKTA 3TP0A 1BW6A 5BNGA 2B63J 3I4MJ 2AO9A 2Y9ZA 3BG5A 3ZQFA 1DU0A 3A01A 2Y2ZA 4QTRA 2FQ4A 2ME0A 3HOVJ 2L7FP 4IHVA 2MW8A 2R5YB 1BJZA 2LTPA 4A3KJ 4IHYA 2DA4A 1OCPA 4FCYA 1K61A 1DU6A 2VUMJ 1W0TA 2JMWA 3HEFA 3S15J 2HOTA 1ZK8A 3FK7A 2KT0A 3JRGA 1A6IA 3OIOA 3WHBA 2XPVA 4D5FA 5K7HA 5K7ZA 2IEKA 4NDLA 3GTLJ 5K7FA 1WGXA 4MLOA 3SJMA 1TWHJ 5EGOA 2JA8J 3M3YJ 4UUSA 3HB9A 2NVTJ 4AUXA 3A02A 3ZOBA 2XRLA 1FIAA 3QQAA 5EGOB 3UKGA 3GTKJ 1ZTRA 1JTYA 1JJ6C 4A3LJ 2NOGA 1MBFA 1FEXA 3HOZJ 1IDZA 1JKQC 2DA3A 1NK3P 2WV1A 5IPAA 3QPLA 4I6ZA 1JKPC 3HDDA 3S2HJ 5EG0A 5FJ8J 1UG2A 2VKVA 4B4CA 3Q0VA 2PMZN 2K9QA 1BL0A 1FIPA 1ETVA 2L7ZA 5C4JJ 1IV6A 5DS9A 3HOYJ 1WH7A 1Y1VJ 4MFDA 4FE4A 3TW7A 2GLOA 2VPRA 5FKLA 1A5JA 2IBDA 4MO7A 5J1UA 1RKWA 2TRTA 2YS9A 3TEDA 1IG7A 1YRNB 2HI3A 5EDNA 3C2BA 3JRIA 3GTQJ 3FK6A 4HNVA 1FTTA 3BR0A 2M9HA 1TWCJ 1W0UA 2VKEA 2GBYA 2NS8A 2XGDA 4GFBA 3GTGJ 1T33A 5F1JA 2Y30A 2CRGA 2LLKA 1UHSA 1D5YA 2OF7A 3HOXJ 3LSPA 3IH3A 3H0GJ 1MH3A 4A93J 5E3OA 2Y9YA 1VNDA 3HBLA 1WCMJ 2YUSA 3BTJA 5IP9J 4C3JJ 5JLWA 3A03A 4X6AJ 2CUFA 1FJLA 3W6VA 3GTMJ 1AKHA 1MNMC
chains in the Genus database with same CATH superfamily
4XLPF 3DEWA 3H9QA 2CQKA 2PMHA 2E19A 4JK1X 1OCTC 1I50J 2XC7A 1HW1A 4NQWA 2GAUA 3GFIA 4NHJA 1IGNA 1ZLJA 5FLXK 3LFKA 1I1SA 2ME6A 3BT9A 1UELB 4A3MJ 5H2FC 1YI2I 1HF0A 1SFKA 1LE8B 2M4KA 1A04A 3C18A 1FOYA 1I5ZA 5E17F 1S3JA 3BLYA 3VOEA 1X4PA 3BJ6A 4BJTA 1Z77A 3OL3A 3RDIA 2O6GE 4C3IJ 3OYAA 2Y48A 3CCJI 2YSRA 4RB2C 2M3AA 3ECHA 4UUTA 2BY3A 4RLQA 3IHUA 1MDMA 1VI0A 2P5KA 3DU5A 2H6CA 2DMPA 3DBHB 3IUOA 5F04A 1N77A 1OCZH 1ZN2A 5IYCJ 4I98B 1IUFA 2YU9J 2KIMA 2WWYA 1ETKA 2BY0A 3E5QA 4A0YA 4EJVA 4RS8A 3D5LA 4QSHA 2GIZA 1Y0NA 3R0AA 1X19A 1ETXA 4LFUA 5BQTA 2XAHA 3DKWA 1GDTA 2LSOA 3VEPA 1H88C 1MMGA 2R5YA 4A3GJ 1Y8RB 4XIDA 3DBRB 2OV7A 1SFXA 4RLFA 4LLNA 1IRFA 1NH3A 2IW5A 3O3KA 5D5UB 1A35A 2VXDA 4A2UA 2HPIA 3FKIJ 2LR8A 1REPC 2KDZA 4BDYA 1ZRDA 1MJ9A 3ML6A 2EZIA 1GT0C 2VIXA 2M2EA 2W4SA 2Z2SB 5KCMA 4ON0A 5GTHC 2FSWA 5ILVA 4N0BA 1VQ9I 2HXIA 2BEOA 2G7HA 3P9CA 4F3QA 3IP4B 1YFHA 1YS7A 1TWAJ 3PIPF 2DT7B 3V8JA 2ECCA 5FRNA 3LQRA 1S7OA 1YOVB 2HDDA 4UB8C 2D2WA 3FMQA 1F36A 1YQAA 4HPQA 1HBXG 2D1HA 3EUAA 1D0XA 2M30A 5D6FA 1X1CA 2G0EA 3S3OA 4EMSA 4EM1A 2A5YB 2WAQA 2HFHA 1XMAA 3CO6C 4LG3A 2EV5A 4IQJA 1O7FA 1MNEA 3RKWA 5KK1A 3QODA 4DBQA 2L7KA 5HLGA 3CZ6A 4BACA 2QQ8A 1P7JA 4G94A 4CCNA 1B72B 3ABMH 2DA5A 2P5LC 3CLQA 4CO8A 1T6SA 2LVSA 4C9YA 1S8NA 1B6AA 4E7SA 1BR1A 1NTCA 4IHTA 1QRYA 4LB5A 4G12A 2EIKH 1YX5A 2HTJA 1HW2A 3EUKL 1FY7A 3EPZA 3PNYA 2JUCA 3E6MA 2TDXA 1RUNA 2VQLA 4ZYDA 3WU0A 1XCVA 1KU3A 2CQNA 3HPHA 5IT9Z 2F5CA 3BR5A 4M6VA 1MZBA 4CA0A 4HF0A 2JQ7A 4IKFA 2DMUA 2ZFUA 1R36A 3LAJA 3ABTA 1BM9A 3CJTB 1DDNA 2LOOA 4BDZA 4B09A 5LEKA 1D1AA 4D7NA 1P2FA 2F4MB 4YFXF 1HCRA 2LRDA 3WTSC 2K9NA 3ERMA 2CW8A 4A12A 4OAZA 3CCYA 1QNTA 1XS9A 1OCOH 4B47A 2VE9A 2JA6J 4AD9A 4BL0B 1MDMB 3GF2A 4AWXB 5GADJ 5C4XJ 1FT9A 1WJCA 3MZ8A 3GVAA 3O2PE 5M5XJ 3PUBA 5TJJA 4AYBN 5HLTA 1AHDP 3S1MJ 1MJBA 3EUHC 2L02A 2XSDC 2XIGA 1U78A 3W2AA 1FSEA 5BPIA 4IVNA 3F9KA 2KDOA 1BJAA 2R93J 2DXIA 1W7PD 1X2NA 1YX3A 4NC8A 4U0WA 3IKVA 4B3AA 3CMMA 4B3XA 2A69F 3GWZA 3CMYA 1T8IA 4A3EJ 3JAMZ 3ASOH 5ICEA 2RQPA 1WHUA 3TO7A 2MLGA 5J8CA 2ECBA 4XSZF 3F3XA 3OIPA 2EIJH 2YPRA 2HDCA 3L2UA 2QENA 4JOMA 1S6LA 4HX4A 3AL0B 2VXZA 4Y33A 1QZEA 5HNHA 4EM2A 1KQ9A 1DUXC 1ETYA 2F4OB 4P96A 1B59A 4Y15A 2RNGA 3NARA 1IF1A 4JBAA 2KPMA 3QP6A 1FBUA 3F8FA 2O7OA 2JZYA 5E79C 4A3BJ 3F21A 1O7LA 3JRHA 2C6YA 5FD6A 5J6XA 2IS6A 1I6XA 2ZB9A 3HM5A 4BXXJ 3SZTA 4GDFA 1HLVA 4MTEA 3MKWB 4LB6B 2EWNA 2HTSA 4L5IA 3RYRA 1SD7A 1YHQI 2HVRA 2CUJA 3OYKA 4PCQA 5TGTA 3U21A 2XVCA 4XK4A 1IC8A 1VQNI 1HDDC 2FUG2 1V54H 2EBIA 3DFGA 2D1VA 3VSLA 4CGZA 4KICA 4UUSB 2JWTA 3D5SC 4GGGA 1RPWA 4IHXA 2JPCA 2W00A 2QSGX 4RGSA 3KP6A 1U5TB 1ONVA 2L9RA 3JR9A 2OJED 1G3SA 2JRTA 2VE8A 3H9JA 4CCOA 4U7DA 2LH9A 3SZPA 5F6FA 1PVEA 3PUFA 5CVJA 3ERED 2OA4A 5DV5A 4OIQF 2DFEA 4E7IA 3HRSA 2IS1A 5JFRA 3IRQA 3E5UA 3F8BA 2NRAC 1E3OC 3RJPA 3PO2J 4ESFA 1J0RA 3G1MA 2KL4A 3E97A 3S1QJ 3TW6A 1TC3C 3LL7A 2IJLA 1FMWA 3H9GA 3S93A 4IPAA 2ZSIB 3S32A 2HS5A 2Q8KA 5HOOA 1B8IA 3OYEA 2VJJA 3S1NJ 2G7UA 3GLLA 4FASD 5DUKA 1HKSA 2RVCA 1R58A 3FBIB 3RZDJ 5BMZA 4JQFA 1IO2A 2W1OA 3LAPA 1IDYA 1HSTA 3KPHA 2QF7A 4XKBA 3GO5A 1JT0A 4BBSJ 2JA2A 2VT2A 1HOMA 1ZYRF 5GAGJ 3S2WA 2XGEA 2A6HF 2E34A 3TBIA 2P0WA 4HLXA 3PL8A 4M72A 3OYGA 5E1XA 2QLZA 2W48A 2FNPA 5JVTA 1KU9A 2VT3A 1TW2A 4PFPA 4CYCA 3H3UA 3EETA 5EYRA 3ZQHA 4HDUA 4YEJA 1T39A 2DYSH 4GO1A 4RGUA 4RB1A 4IF4A 2BGCA 3DLAA 1J2XA 1MIJA 3KYDB 4X1EA 3REOA 2R7VA 1I27A 1W1WE 2DTRA 1R1TA 2DOFA 3FXRA 2DU9A 1GUUA 1RKTA 1I3AA 3W3CA 1WJAA 2B63J 3I4MJ 1B1BA 3H92A 1X1PA 3BG5A 2GOMA 3A01A 3I3LA 2JRMA 3E1SA 4KITB 4KMFA 3KE2A 3H0DA 3K4JA 2ME0A 3IAS2 2L7FP 2HYGD 1T38A 1J7KA 1P4XA 1FSHA 3CMAI 2R7SA 2A07F 2R7QA 4PJLA 4YRVA 1D8JA 3G2BA 1K61A 1DU6A 2VUMJ 4Z6YA 1W0TA 3ZMSA 1R5ID 5LGNA 3HEFA 3S15J 4O3MA 2WY8Q 3DF8A 1ZK8A 2HOTA 5K7ZA 2IEKA 3DEEA 3JCUC 4BEHB 3GEZA 3KYLA 2EFPA 2ESNA 3SJMA 4ENMA 5D4SA 1FYKA 4UUSA 1T0FC 3T5XA 3ZMTA 3HJEA 3IL2A 3X2QH 2HQAA 3HB9A 1SMTA 1YYVA 4AUXA 4WWCA 5ED4A 1USTA 3A02A 3QP5A 1VQLI 2JSPA 2HKXA 3E5XA 3MQ0A 4L9JA 4XORA 5B5EC 2PI0A 4CCLA 3CCRI 2OC6A 1ON1A 1RUOA 3QPHA 1R4NB 4CICA 5DEQA 4A3LJ 3CCMI 3PJRA 3OYFA 2A6TA 2L4AA 3FHNA 2WV1A 4LITA 5IPAA 2F2EA 4LIVA 2HVSA 4AM3A 1R00A 4UB6C 4D1QA 1NG7A 3HHHA 5EG0A 2M7AA 1LVKA 1RIOH 3HL2A 4HSTA 3OWTA 5HVQC 2IP2A 2K9QA 3CMEI 2ZXHA 5HS7A 1LUJB 1MW7A 2FMYA 3T1BA 4XRFA 1IV6A 3CUQA 4MFDA 5HDKA 2V1XA 2GLOA 1Z6RA 1FMVA 3C2GA 4MO7A 4ZYHA 3IAM2 2PLYA 2HPMA 1MJAA 2VOPA 3H3ZA 2J5OA 4NBQA 1FZPB 3G4SI 3GTQJ 5CKTA 3FK6A 3I54A 5FFZA 1T95A 1E0EA 3ISPA 3KEOA 3VODA 5K1YA 4E7HA 1Z3XA 4ENKA 2E5ZA 2GBYA 2XGDA 3GTGJ 1TZLA 4CCJA 5A2QK 2ICWG 4RGRA 1WVRA 2QSFX 3ZXSA 2CRGA 2Y30A 4RMNA 1UHSA 1D1CA 1D5YA 2OF7A 4XN0A 1SAUA 3L2CA 1IXCA 2KJCA 2VPLA 3I56I 1VNDA 1D8KA 3COAC 2V9KA 2A61A 4B8XA 1VQPI 1TL8A 1LDDA 5F1RA 4X6AJ 1LVAA 4B43A 1SVLA 1KONA 1VTNC 2KIUA 2LKSA 3AG3H 1Y39A 2LBFB 3JW4A 2A05A 1IXRC 4KYWA 3G3ZA 1Z21A 2ACJA 3GFMA 3K1PA 3BCAA 1FX7A 1XC5A 1M1EB 4GCVA 4BY7J 2ID3A 5E8GA 4MTDA 3JSOA 3BR3A 1P92A 1ZG1A 2V1NA 2O3FA 2DMQA 3NRVA 2Y69H 3W6KB 2DI3A 3PNVA 4RB0A 2RQQA 2ZXJA 1IRZA 4HAMA 1S5LC 3J7YJ 4HLYA 1WSUA 4O6JA 1SVOA 4QIWN 2ZO4A 2LYCA 1TQPA 5EF6A 1JUPA 4PDKA 2H8RA 2XPUA 2HXOA 4AVZA 2FMLA 3FIWA 4U88A 2DBBA 2H8WA 2P8TA 3MKLA 3O8GA 2MGQA 1EA3A 2NS7A 3L00A 2BW3B 1WH5A 2JJ7A 2VBWA 5D5XB 5JR3A 1QU3A 2MBFA 2EFOA 5CVVA 1FTZA 2R4GA 2DW4A 2WAQN 1X1BA 3A4CA 1ZGAA 2FXAA 2MD0A 2VQCA 3U1DA 4BQNA 2FE3A 3DV8A 3CCVI 3GXOA 3S8PA 1MD0A 3BWGA 3FDYA 3MFKA 4A6EA 2TCTA 1WI9A 4AYBA 2CW0F 5E3NA 4XLAA 2E2HJ 3LMMA 4Y17A 1MMDA 4BXUA 3VFZA 5D6EA 4S0HB 4OMYA 1GV2A 1HSJA 2KKOA 2XASA 2Y0SA 2ESHA 3PFYA 1QO0D 1OYIA 5LRRA 4B1RA 3M4OJ 4KDPA 4DYQA 1WWXA 5D8LB 3JTGA 3A1YA 2G9WA 3MD2A 5D8KB 1CF7A 2L5QA 2PN6A 4OWRB 3V8LA 1PJRA 3KFWX 2E1MB 3KETA 4DJAA 3ZCOA 4P9FA 4KA4A 1JHHA 3KP2A 5JHFA 3CC4I 3K9TA 3L9FA 3H3VK 2QQ9A 2NOJB 1BI0A 4CSWA 3HOWJ 5DTDA 4E7LA 1GXQA 1UAAA 4LIUA 1JXSA 1FC3A 1ZAOA 2KISA 4M3FA 2LC2A 1FYMA 4XR6A 2M34A 2QGUA 2QYOA 2VASA 4MHGA 5LHHA 4M9XA 2JA7J 1YW9A 3OS0A 2AXLA 2EH3A 4ZYAA 1WPKA 3CUQC 3W2WA 4PZJA 3EUHA 4DYCA 5E18F 3Q0UA 5E3MA 3IKTA 3K4MA 1RESA 1K6YA 3RQ4A 3KCCA 5CVRA 2DA1A 3IRRA 3K6GA 2LP0A 3H5RA 1K4TA 1TWFJ 2O0YA 3SDBA 3SFIA 3J81Z 3MVPA 5F27A 1F5TA 1DP7P 2X51A 2QUFA 2E1MC 2FA5A 2F48A 2LK2A 2P4WA 2PEXA 1WZ2A 4HX8A 4XRMA 2LF8A 3OSGA 3GTPJ 4IRGA 4Y7NJ 5GP9A 4XNFA 3FM5A 1ZRFA 5F08A 1IJWC 1WKMA 4KISA 2MFZA 3RZOJ 1BW5A 3ZR8X 4M9ZA 3RQIA 4M74A 4RAGA 2I10A 1ZKGA 4L9VA 3HHGA 1L3LA 1G3TA 5HDGA 2D5VA 2MG4A 3MN2A 3LSGA 3R60A 4QPOA 2MSYA 4XM3A 3MMYB 2VQGA 2HYJA 1UJ8A 5H20A 4AIKA 4A3FJ 5DM7F 3A2KA 4LD5A 1WRJA 3F8CA 4G7OF 2Y75A 5FLMJ 3DKXA 1MSFC 2HKOA 1YIJI 1ZR2A 3UR3C 5J3LA 4R79A 3TO6A 5GAEJ 1XN7A 1V55H 2MA3A 3DP7A 2Q1ZB 2L9VA 4JYKA 1LQ1A 1X4OA 2H1KA 2X0LA 4BGDA 1RETA 2PG4A 4BQQA 4EEFG 5LEJA 1H8AC 1UHWA 4CHUA 5B1BH 3IH2A 3LA3A 3W6JB 5GPCA 3R0JA 1PDNC 2GXGA 2HOAA 3GBGA 4I7HA 2VODA 2HZTA 1VQ4I 2P81A 5IOZA 4KMUX 2YU3A 1G6NA 4XRSG 4BE0A 2HOEA 2ZMEB 2HQRA 4CCMA 2W25A 4Z2YA 3CC7I 2O8XA 2IRFG 1VZ0A 3J80K 2XF6A 1AA7A 1Z7LA 3H35A 2W84A 2DDBA 4XOPA 1XDUA 3JSPA 2JVGA 2BW3A 4HZFA 3Q3SA 2NVYJ 3ZQLA 3S3NA 1Z6TA 2X6OA 2L3DA 2E5NA 2IAIA 1Z05A 2LREA 2R7ZJ 2K9LA 1RC9A 3OY9A 4ZDPA 2VONA 3RKYA 1D0YA 1U9NA 4B48A 5CQEA 2WB1A 1OQYA 2E7WA 2XF7A 2E60A 2UXNA 3F22A 1G3WA 1ON2A 2IPQX 1HQCA 3H1CA 1T2KA 4HSRA 2V1UA 3BPXA 1X3ZB 3LA7A 1FP1D 2LG4A 2DODA 2Z3YA 1XSVA 5KHDA 3CUOA 2KIFA 4F55A 1LE8A 4KIBA 2QCOA 3HGYA 3FKJA 2FU4A 2P7VB 3MZYA 4KIGA 1SFUA 2FBIA 1HKTA 1ACIA 2BXYA 2R92J 3OYIA 4BKXA 3BOQA 4PSWA 3ZPLA 5M3FJ 1IAWA 3DPLC 2JTVA 4XONA 1SFEA 1ODDA 1SFOJ 1QHGA 3ULQB 1OCRH 1VQ7I 2DCEA 1L0OC 3BROA 3HG9A 1JGSA 2VQHA 3FXMA 2MLKA 4A0ZA 1GXPA 3I59A 5CQGA 2WV0A 5F0HA 3OYJA 5LHIA 1B8IB 2E2JJ 2Y31A 2CV2A 3LQQA 3OR2C 1MNDA 3QYBA 2CQ7A 4CUGA 3WGIA 3OS2A 2EFWA 4BQAA 3FISA 3RIRA 3F0CA 4AU7A 3J7AY 4XMYA 2DT5A 3HSFA 2ADUA 5FROA 2X6YA 4N4NB 5L3DA 3CJQB 3OOUA 1X2MA 3UNGC 2E1OA 2EZHA 2Q2EA 4HW0A 4EJTA 3JAMK 2CUEA 3CJRB 2H1LA 3D5RC 3C3WA 1POGA 1R7JA 2K5CA 2ZFWA 3BR6A 3RPUA 4IO9F 1ZHFA 4FE7A 3BZCA 4ANJA 3AG4H 2ZMEA 1MMAA 5FLVA 5E1ZB 3I71A 4ZTFA 4KT6A 5FKNA 4Q5SF 1AKHB 2FF4A 2QSHX 3ZN0A 1E3PA 2GM4A 5FGMA 2CS3A 4AVPA 1B72A 3B6AA 4HRIA 3HRUA 2ZJQF 1X3WB 4OMZA 3IH4A 5GPAA 3JREA 2EFQA 3N97A 2XGXA 2VB6A 1W36D 4BS9A 3PO3J 5C44J 3C1DA 3P7NA 4HV5A 1RRJA 4AIJA 1TQIA 3BTIA 2OQRA 4FETA 3I0TA 2L7MP 4XSXF 4Y4RA 1FPQA 4F52A 4YIFA 3K2AA 3OYBA 3CCLI 1W7PA 4QLCU 2DA6A 4M3EA 1FOKA 1XSXA 3L2WA 1LFBA 1O4XA 1FBQA 2A5WA 4NC6A 4BXFA 2AQEA 1OYYA 2E1NA 1G4DA 1VQKI 1EV7A 2WADA 2X6WA 1GVJA 1BW6A 3E6BA 3W2VA 3M1EA 2DPDA 2OBPA 2Y2ZA 1ZELA 2FQ4A 3KLNA 4WK8F 4OAYA 4L0ZB 4IHVA 4IRIA 1W5SA 2DLLA 2MW8A 2GXBA 4HOBA 2NVUB 4WX9A 4XL9A 3F72A 1Z9CA 2DK8A 4N9IA 2DFHA 1SD6A 2DA4A 2VOOA 4HNTA 5FO5A 1IUYA 4P5OA 1V5EA 2FBKA 3KP5A 3MCZA 1A6IA 5K7HA 3WHBA 4D5FA 1DPUA 4NDLA 2NYXA 3SFZA 5JI6A 5EGOA 2JA8J 1BOAA 3RKXA 4L0YB 1X1AA 4BHPA 3VYTB 1TQMA 3RCOA 1VQ6I 3ZOBA 1FIAA 3QQAA 2OZUA 4RAFA 3L7WA 2E7XA 2OCCH 2QEXI 2X85A 4IL6C 4PJJA 3TOBA 2NOGA 1MBFA 3WG7H 3M7GA 3Q5FA 1KQ8A 4K2EA 1NK3P 3F6VA 3LSIA 3OS1A 1EKEA 1BC8C 2VC1A 5D5VB 3FXJA 3RPQA 2RC4A 3HDDA 2R7UA 5FJ8J 3WTZA 1BI3A 3NQOA 2R7DA 2H94A 1BI1A 3WTWC 2FOWA 3V7SA 3LA2A 4A0XA 5LRSA 3HTSB 3WU1B 2L7ZA 2QZ8A 2ISYA 5DS9A 3EYIA 3HOYJ 4FQGA 3TW7A 4H0EA 2VPRA 1OISA 3V8KA 2IBDA 1YLFA 3ZMVA 1Y6IA 5HDNA 4EJOA 2YS9A 3TEDA 1IG7A 1XPXA 2EA2A 3J7AO 2FBHA 2Q2EB 2HI3A 5EDNA 5EJCA 1D1BA 4ENNA 1FTTA 2M4GA 1T08B 4XKVA 4PJNA 4XOTA 3DPUA 2K85A 2NS8A 4GFBA 4BYYA 1T33A 5F1JA 4LK0F 1K6OA 4P1WA 4LLLA 3QU6A 5TRDA 3OR1C 1IRGA 1AWCA 3WTUC 3LSPA 3IH3A 2ELHA 1KU2A 1X3UA 1F9NA 2ZXIA 3ZMDA 3HBLA 2CFXA 1F4KA 4II3A 3ZMZA 3BTJA 3KP7A 1EH7A 3LFUA 2XSJC 2WTEA 2CMPA 3A03A 4E70A 3FHZA 2CUFA 3I9V2 3E6DA 1FJLA 2FQ3A 1S72I 3N05A 3DU6A 3HSRA 2L9NA 1MNMC 4UNOA 1YJNI 3OYCA 1WI3A 1QQIA 4EVIA 3F8NA 4OIRF 3N4MA 2RNJA 1R22A 1O3SA 3OYNA 1R1VA 1OLTA 2BE5F 3VDXA 4CZCA 2JA5J 1PUFB 2OPTA 3SYTA 2E35A 2MH9A 2CYYA 4Q48A 4G6TB 2CFOA 5EEAA 1KZHA 2MH2A 4UV8A 4XRSA 2L4MA 1IN5A 2M0CA 1K78B 5IYBJ 1D3YA 4IEJA 3CLOA 4L5JA 3FXKA 2WY7Q 3BQYA 5DUIA 2A3SA 3CDLA 5IOYA 3TKYA 3BTLA 3G1OA 3RKQA 2DJNA 3KX2A 3GZNB 4KT5C 3T0YA 4HG2A 3CP8A 3TDUC 1DQUA 1JJ8C 4MEXF 3ABLH 2ZJRF 3QRFF 1QBJA 2XKPA 2DPUA 5KAIC 3LSTA 3R61A 3IWFA 1BOBA 3BZKA 3LSJA 2Z1DA 5BPDA 5JHUA 2DTZA 1J9IA 1JI8A 2GIVA 4LMYA 4M3GA 3OIQA 4FISA 5B66C 2VKHA 3AAFA 4XLNF 4NNJA 1VF9A 2GZWA 2KRCA 3JTHA 4CYCB 2L0KA 2PJRA 4HEA2 3OL4A 4UVAA 4EATA 3VYRB 2W7NA 3FX3A 4ZDLA 2OTJI 5ERIA 5EG0B 1B9NA 2DQRA 3BZ6A 5L3FA 3K10A 2KRHA 3P9KA 1YJ9I 2ELKA 2HOSA 2OU2A 4PFOA 2K9MA 4I76A 5CJ9A 1YRNA 1ORKA 3G73A 2VKDA 2ZSHB 2ID6A 5C3EJ 2EZKA 3MKYB 5B3SH 4CCKA 1DP3A 4LOCA 2XGCA 3K70D 3BDDA 5CVIA 3WTVC 2DMNA 2V79A 4KN4X 1U9OA 2EQRA 3FXOA 3JRAA 4WCGA 4L9NA 3U9GA 2OTLI 2CGPA 2ZKZA 3FM3A 2WAFA 4M73A 4BAYA 4OIOF 1UZCA 4MEYF 3BG9A 4IXAA 4FT8A 5M5YJ 4G6QA 2CG4A 2STWA 4IX7A 1R49A 5H6QA 2WBMA 2HR3A 3OSFA 2EJRA 2WC2A 3BR2A 2JK3A 5HODA 3FZVA 1JUMA 1XG1A 1YE9A 2IS2A 4QPQA 3BR1A 2Z33A 3KP4A 1XSDA 3S1RJ 4EJUA 2ZJ2A 1CF7B 3QAHA 1EJ9A 4V19K 1I6HJ 1MBGA 4BHCA 1ETQA 2COMA 3EQLF 3CCUI 1YG2A 2HQNA 4C2UA 4EQQA 4HQEA 1HXDA 1WJEA 2IA0A 3ZGKA 1NK2P 4IHWA 1FNNA 2DJIA 3ZRGA 2O9LA 5IT3A 1T98A 2HVQA 5LGUA 2K40A 3OYLA 4ETSA 1MBJA 3HRMA 5L3CA 4J01A 2M1BA 4BNCA 1ETWA 3PSFA 4I02A 4W97A 2R7WA 2A68F 3BTCA 3ELKA 5J47A 3DLLF 5AONA 4EGYA 4YELA 2MYSA 5IP7J 2QKMB 4JP0A 4WXCA 2CQXA 4Y3OA 3SHFA 3K2ZA 2DMTA 3SQNA 1PUFA 4I0BA 2XAUA 2WA0A 1Z91A 3G71I 1VQOI 2VL8A 1QZZA 1BC7C 3SEZA 2LY1A 3M9AA 5AIPA 3FXLA 1VQ8I 3CP2A 2NNYA 3KIOA 2M87A 2LDUA 5ICFA 3AL0C 3SDGA 5EZHA 1V5FA 3CUQB 4G9YA 2M8GX 5F0CA 4UY8I 2DA2A 3O8HA 3HUGA 5EEGA 1FP2A 1QHHD 4R1HA 4IHSA 3GCMA 3TMOA 3L1PA 2R0QC 1ZARA 2FX0A 3GYHX 2I8DA 3AFHA 3KZIC 5HS9A 3MEXA 4RBOA 2KLOA 4Y13A 1MH4A 1S7EA 3E7LA 2BVMA 2R7OA 5J8FA 2CO5A 4NUBA 5DDGA 4DYRA 3ZQQA 1T56A 2LFBA 4MNUA 4A3JJ 1XGMA 3HUGB 2Z5UA 1ITYA 1JE8A 2PJPA 4EM0B 1E3HA 1N78A 1R6RA 2X1CA 1LDJA 1G8XA 2X6XA 3CD6I 3WGGA 3CF2A 3CJNA 4NC7A 4XLFA 4HV6A 5CPRB 2NVXJ 4PGGA 5FB2A 3T8TA 3L09A 3DCFA 2GA1A 4XLEA 5ICGA 2K02A 5CLSA 4AIHA 2A6EF 3R4KA 1JT6A 4UVCA 1ETOA 4S04A 1I1GA 3AG1H 5ILSA 3F8MA 3DBLB 3D1NI 5GAHJ 1BI2A 1XGNA 1FOXA 1Q1HA 2AXTC 4X0GA 1ZG5A 3HOUJ 1FBSA 2AS5F 3RYPA 1YIOA 3OYMA 5BOXA 1G2HA 3QPSA 1V3FA 1O3TA 2KJBA 3DPTA 3HXLA 2DAOA 2KQRA 4C2MJ 2HDWA 4ZC3A 2HYFA 3TO9A 4OINF 2VBYA 5DM6F 4DZPA 1KU7A 3NEUA 4G7HF 1MBEA 4DW6A 3CQZJ 2V26A 2H6BA 3GTOJ 4G8XA 5TISC 3V4GA 3HOTA 1R9TJ 1U0JA 4DIQA 2Z16A 1B4AA 1OJLA 2FEZA 4D5CA 2YX4A 3MWMA 1MBHA 5IT9K 3B73A 2IT0A 5DD8A 1BIBA 3V42A 1TP4A 1QPMA 1UHMA 1ZLKA 1JTXA 2CU7A 3WHCA 1SMYF 5IP6A 1LKXA 1MSEC 1Q1VA 3WG9A 4D7MA 1CQTA 3S2DJ 1GV5A 2CWEA 3AG2H 4UV9A 3B6CA 2HU9A 4P9UA 2RKHA 2JT1A 3LSKA 1ZQ3P 1JHFA 4DQ2A 4J19A 4L18B 3IV5A 3TOAA 2BZTA 3CTAA 2FJ1A 2Q0OA 4M3BA 3NWSA 2CW7A 1BA5A 2IGNA 1WJDA 3V7CA 3HKZN 1LFUP 2VBZA 5K5QA 5FKKA 2HQ5A 2IA1A 2X9DA 2MD5A 1K78A 1A36A 1FOWA 2EILH 4DOZA 1IZ1A 3LNQA 4E6KG 2UV1A 4WF2A 2Y0SN 1UB9A 3NAUA 3CF5F 2PMZA 1R5HA 1BR2A 3OOPA 2XDVA 4CDGA 1WJBA 4JX6A 2ZJPF 2E1CA 5KAFC 1TNTA 5FD5A 1EF4A 4V2GA 3GFLA 2XPWA 3Q0WA 2O61A 2DOAA 1NHAA 3E3VA 3LOCA 2EZLA 3VPRA 2UWMA 2KFDA 5A2QZ 4RDUA 4HF2A 2PFBA 3K4NA 4PUSA 1RR8C 3K1MA 2B9SA 3HRTA 4AIDA 2RV8A 4UUVA 2QWWA 1Z0XA 3TP0A 1S29A 2AO9A 2RREA 4HNUA 2KRFA 3ZQFA 5ILUA 4QTRA 3I64A 3HSEA 4YG2F 3HOVJ 3MAJA 2R5YB 1J75A 2PQ8A 2W85A 4RA2A 2LTPA 4M9SA 4IQ4A 1G59A 3L2RA 4N9HA 4UXNA 3FXUA 3RPUD 1YS6A 4U87A 1USSA 1SD5A 1OCPA 2JMWA 4LJZF 3FK7A 2KT0A 4RM2A 3JRGA 3P9IA 5K7FA 3ZN1A 5GTIC 4MLOA 5HS8A 3F23A 3M3YJ 2F5FA 2RN7A 2NVTJ 4CXFA 1OKRA 3S3MA 1HKQA 3D0SA 4PJ0C 4YIRX 1LNWA 2OAZA 5EGOB 3UKGA 3M1CA 2O03A 1ZTRA 3J81K 1RZ4A 5LHGA 3HC7A 1FEXA 3VSKA 1IDZA 4BE1A 1TBXA 2J5PA 2E36A 4ZYEA 2BV6A 2KP6A 1Z3YA 3C2HA 2F5EA 1XDSA 3HIFA 4DBRA 4MGRA 2W24A 3QPLA 1JKPC 1R71A 5FLXZ 2Z99A 2M45A 1BN5A 1UG2A 4RAYA 2V6EA 1IN6A 1KYWA 2NAZA 2V1DA 2VKVA 4B4CA 1LEBA 3Q0VA 2PMZN 5L3EA 1GLNA 1FIPA 4D9JA 5DYMA 3QOEA 1ETVA 4EGZA 2VLAA 2VJ5A 3I59B 1Y1VJ 5BS6A 4FE4A 4LGWA 3M07A 2KMUA 1RKWA 4G7ZF 1MMSA 4DGWB 5LFAA 2ZXWH 2HZDA 3PIOF 1NG6A 3LSHA 2IVMA 3C2BA 1H9GA 3J7ZI 1DPRA 1P6RA 5KVRA 1TWCJ 1W0UA 1XD7A 5DD4A 1U5TC 2K86A 1UCRA 6PAXA 4LK1F 2VC0A 1H0MA 1A31A 2LLKA 4U0YA 3SXYA 3K4LA 1YJWI 2KZVA 3I4PA 3KP3A 2K3PA 3LSMA 1MH3A 4HA8A 4UVBA 3CCQI 4A93J 4PGHA 2MABA 3ZMUA 2Y9YA 1P9QC 2DK5A 3CO7C 1O3QA 2F5DA 5HLHA 4C3JJ 5JLWA 2IGMA 2EFNA 2R7TA 2BXZA 3CDIA 5IY5H 5B1AH 4L9TA 1AKHA 3GTMJ 4LLGF 2QM3A 2F4IA 3EYYA 1J59A 4A3DJ 5EEHA 3A0HC 2UXXA 2BBYA 2P6SA 2X4HA 3ESWB 1MBKA 4RM3A 2CQQA 1XB4A 3QU3A 1IRXA 2H09A 1LB2A 3G1LA 5KNLA 4PJMA 1UMQA 1RI7A 2M8EA 2ELJA 2K9SA 3A0BC 3BJOA 4BHBA 4ZZLA 3JRBA 3MKZA 4I0AA 1D5VA 5M5WJ 1LFPA 4M3DA 1HA8A 1K79A 1WFXA 4B44A 3ASNH 1I3QJ 1ZREA 5E20A 3LWFA 2XB0X 2V7FA 3IC7A 4ESBA 1Z1DA 4M71A 2MC3A 1XX5A 3VB2A 4BY1J 4XN3A 3BG3A 3CC2I 1PP8F 3ECOA 3F6OA 2VN2A 1PUEE 3BG6A 3SEQA 2HWVA 2ISZA 4GRIA 2EIMH 3TP3A 3PSIA 1Z7UA 1Y8QB 1R5GA 4KN7X 2BOLA 2ZNYA 2QQAA 2QKLB 3KLOA 1N25A 1W4MA 4M6YA 2XKOA 2L9SA 2X1EA 4D0PA 3T8RA 5K5RA 1U8BA 1FLIA 4A3CJ 2OZ6A 1FWZA 4Q4ZF 4HYEA 1O3RA 5K5OA 4JX5A 2XUBA 3PM1A 3QPTA 1IN8A 9ANTA 5FKOA 1UG0A 1LDKB 2IGKA 3JRDA 1YITI 3PNTA 3M8EA 2K27A 2DA7A 2O5RA 3PQJA 2EV6A 2NXNB 1XGOA 4FX4A 2AQFA 4FX0A 4A69C 1QZYA 4HDVA 1YTYA 4XICA 2OD5A 3BC8A 3U2RA 2CV1A 1R4MB 1VQ5I 5FKMA 2Z9OA 2ZBKA 4U7BA 1IN7A 4UHTA 2K4BA 2EB7A 2E2IJ 1Z67A 2JVHA 2WAEA 3K4CA 1E17A 4KUMA 4C3HJ 4A5NA 2LF7A 3O6BB 4BUPA 3M8FA 2VI6A 3TDZC 3CCSI 2QBYA 5J1RA 3S17J 1P7IA 3OYDA 5D4RA 4P55A 1U8RA 5CVUA 4V2FA 1CGPA 1J09A 3S14J 1MGTA 4RAZA 3C7JA 3WTYC 1K7AA 4KJZA 1ENHA 3GFJA 4GYIA 5ICCA 2OCEA 4HF1A 1Y0UA 4E7KA 2QA4I 1QVTA 1C0WA 1UFMA 1GVDA 2B7EA 1JKRC 3FWEA 1VFCA 1HDPA 1W36C 5EZGA 4MFEA 5F0FA 2CV0A 2P6TA 4MIMA 1KA8A 2XHKA 5DCFA 4Q47A 3RI4A 2VJ4A 2IXSA 3NWTA 2R7FA 3WU2C 2O8KA 2V9PA 3BPVA 1WJ5A 3OMYA 2P5VA 2EPFA 2DFIA 1QGPA 1FYLA 4MQ9F 4FTHA 3DQVC 2H27A 4BEHA 2LNBA 1E2XA 2F6CA 1T0FA 1SAXA 3B02A 1MKMA 2COBA 3CESA 4A6DA 1V5GA 3I53A 1JKOC 1H9TA 2VBXA 3A01B 2BHZA 4I2OA 3GUDA 4OIPF 4E7JA 3WODF 2XAFA 3I55I 4I99C 1PP7U 4BE2A 4RGXA 3WGHA 1QVUA 1KGSA 3RSNA 2LD5A 4DNCA 1LPQA 2PX9A 1XMKA 1X58A 2NVQJ 1KQ0A 2HGCA 2DOEA 2DDAA 2STTA 4BJ5C 2R5ZA 3RTRA 3HTUA 2BY2A 2XROA 3Q9VA 2BVLA 4C2TA 5HLIA 2RAEA 5J4YA 3K0LA 3HOSA 3QWLA 1ZGWA 4XKCA 3KZYA 2DN0A 1U3EM 3EDPA 4ZJZA 5LD2C 2V6CA 2BYVE 4PK4A 2D45A 2R7XA 4Y52J 3BY6A 3I58A 1W5CC 1VQMI 2K3FA 1ZR4A 1PYVA 2QBYB 1GHCA 4BQOA 4W1UA 3OV8A 3FMSA 2XAQA 3VYSB 1N75A 3TGNA 1XCBA 5FFXA 3HZJA 1J5YA 2CSOA 1RR7A 1X1DA 4IZZA 1SANA 2FOKA 4OU0A 3KEYA 4ZZDA 3KEQA 5IYDJ 1JGGA 2JPBA 2LKXA 2AHQA 1SC7A 3ZQGA 4EV0A 1SEUA 1B9MA 3QOPA 4IRHA 4J00A 1JUSA 3S16J 1DGWY 4G6DA 2L2OA 2DFFA 2ZMEC 4WXDA 3JRFA 3I5UA 5JLXA 3TQNA 1ULYA 4A5MA 5D5WB 4AC0A 1R1UA 2W57A 2L01A 4R8HA 2KZGA 3H36A 4EJWA 3GZ5A 5L3BA 1Y1WJ 2ETHA 3ABKH 5E3LA 1WJFA 4LG0B 2W82A 4TV7A 2DQLA 3BQZA 4BU2A 5E1WA 2CJJA 4IJAA 5M3MJ 1SVMA 3R6SA 2IS4A 1XGSA 4F92B 4ASNA 3H5AA 1RNLA 2RDPA 5LBQA 2NS0A 2GWRA 5CYVA 4FHTA 2GQQA 3ZQ7A 3LSRA 3DTIA 3HGGA 1LEAA 1U2WA 3I4NJ 2VJIA 1OCCH 4BJ6C 3WTTC 5J40A 1F1ZA 1ZH5A 1A6QA 3QYFA 4WXHA 3V7RA 4I09A 3OYHA 4BBRJ 3WE3A 2K4JA 2CUZA 2JSCA 4F7ZA 1ERDA 3ZQCA 3DKYA 3GLXA 3ZQIA 1P4AA 2PJRB 2JN6A 2ZC2A 4L5EA 3L2QA 1U6GA 3PFIA 4C30A 2N8GA 1S9HA 2V9VA 3QYEA 4KNYA 2LKPA 4A3IJ 5DCMB 1OPCA 2DT6A 3E0JB 3ONQA 3GTJJ 4U0VA 1TWGJ 4ZDOA 2R3SA 2NNNA 1IW7F 5J1YA 2RGVA 1YW8A 2XB5A 4ESJA 2WB1N 1H89C 4XLHA 2QQBA 3K7AJ 4ZYGA 2E71A 3JRCA 1W5TA 5JVGF 3GZ6A 1SD4A 1AU7A 2K7LA 3J80Z 4N4OB 1APLC 3KYCB 4ABZA 1IXSB 2GA2A 4DZJA 3G6EI 1OFCX 4XLCA 1U5TA 4GYGA 5LGTA 3VWBA 2ZCWA 3L2VA 4JX4A 4CYDA 2XAJA 2UZKA 1BR4A 2V4JC 1STZA 1K4SA 1F43A 2L54A 1S7AA 5H6RA 1QPIA 4PSXA 2X48A 3FBNB 3CDHA 3DTEA 2FD5A 1D0ZA 4HX7A 4E4HA 1LJ9A 3GW2A 3HPGA 2R5ZB 2HNHA 3FF5A 3K4KA 5AIQA 2LY9A 1EH8A 2JUGA 3E6CC 4I01A 1K83J 5L3GA 1G3YA 1AOYA 1OYWA 5BNGA 1ZG3A 4YFNF 2Y9ZA 1XTAA 3P5JA 1DU0A 2F5VA 3PQKA 2DYRH 4ENJA 4GXOA 1HC8A 1BJZA 3BJAA 5E8IA 4H4KC 1IV8A 3DXJF 4A3KJ 4IHYA 1TW3A 3DTKA 3TL4X 4FCYA 2YR2A 4QWQA 2IGOA 1I39A 3OIOA 1EH6A 2EK5A 2XPVA 3H5NA 1TLHB 3GTLJ 2I5UA 2IA2A 2HEOA 2BHYA 1WGXA 5J4VA 2EV0A 4IOAF 4RB3C 4CH7A 1TWHJ 4OOIA 5FRMA 2EA4A 4HQMA 4ZH4F 2ZNZA 4NB5A 3ZP5A 1OR7A 2XF5A 3HKZA 2XAGA 2XRLA 1HW5A 1TNSA 4II2A 2R7RA 1BIAA 3GTKJ 2M0MA 3GMEA 2OUMA 2Y0MA 1JTYA 1JJ6C 2GXAA 3CCEI 1TT5B 3HOZJ 3BCBA 3K1NA 3WE2A 1O57A 1JKQC 2DA3A 2B0LA 2BY1A 4LG0A 4KFCA 3M8JA 4ITVA 4KIFA 5DCMA 1ZGJA 2QVOA 4I6ZA 2DO7A 3S2HJ 4F93B 2LY2A 3HYIA 2KIQA 3K70C 1QA6A 4IOCF 2MC4A 4S05A 1BL0A 1OR7C 2PBIA 4MQVA 3SZGA 1OMIA 2LMDA 1YO5C 5F64A 1P4WA 5C4JJ 1TT0A 2FNAA 5HNFA 1WH7A 1BBYA 3VYUB 4YIIA 2FRHA 5FKLA 1A5JA 5J1UA 3U1KA 1KYZA 4CZZA 3DEUA 3IWZA 2TRTA 2XRNA 4ZTJA 2OQGA 3ABUA 1YRNB 2PMUA 4E7ZA 4F91B 3JRIA 1WQ2A 3WTXC 1ZRCA 3K69A 2M7BA 4HNVA 3FMRA 4XKWA 3BR0A 1V4RA 2M9HA 4YFKF 3BG7A 1DGRM 4BH9A 4O5VA 1YW7A 2VKEA 5LLQA 3GX4X 1MMNA 3DWLE 2KHMA 2M5WA 1IN4A 1W7PB 1R23A 3Q9SA 3ROUA 3BP8A 2EINH 3HOXJ 3H0GJ 1Y56A 2CH0A 2YX7A 2P7CB 4NQWB 3AKZA 4HBLA 5E3OA 4M6XA 2X1DA 2LBFA 3MZHA 1WCMJ 4XQFA 2YUSA 5IP9J 2XV4S 2UUZA 4XBFA 3K4BA 1TTYA 3KZZA 3W6VA 2GOXB 3FXQA 1XMXA
chains in the Genus database with same CATH topology
4A3DJ 3DEWA 1WI3A 1OCTC 2E19A 1I50J 1XC5A 4BY7J 2ID3A 2JA5J 1MBKA 1PUFB 2CQQA 2OPTA 1IGNA 3BR3A 3G1LA 2ME6A 1UMQA 3BT9A 4A3MJ 1HF0A 2K9SA 2DMQA 5EEAA 1LE8B 1IRZA 3JRBA 4XRSA 2M0CA 5IYBJ 5M5WJ 1Z77A 4IEJA 4M3DA 4C3IJ 4QIWN 3BQYA 3CDLA 5IOYA 5EF6A 4UUTA 1JUPA 1I3QJ 3BTLA 3G1OA 3RKQA 2DJNA 1VI0A 2H8RA 2XPUA 2DMPA 5F04A 2HXOA 1JJ8C 2XB0X 5IYCJ 1IUFA 3FIWA 2YU9J 4BY1J 3MKLA 3O8GA 2MGQA 3BG3A 2NS7A 1ETKA 2JJ7A 1WH5A 3LSJA 4QSHA 3TP3A 2DTZA 1ETXA 1FTZA 4M3GA 2WAQN 1GDTA 1H88C 4FISA 2R5YA 2TCTA 4A3GJ 1U8BA 1VF9A 4XIDA 5E3NA 4A3CJ 4CYCB 2E2HJ 2L0KA 4JX5A 3PM1A 4S0HB 1GV2A 5EG0B 9ANTA 5FKOA 3JRDA 4B1RA 2DA7A 3M4OJ 4DYQA 2ELKA 3FKIJ 2HOSA 2LR8A 4I76A 1YRNA 4A69C 1ORKA 2KDZA 2ID6A 5C3EJ 2EZIA 1GT0C 2EZKA 2M2EA 4XICA 2HXIA 4LOCA 5FKMA 2XGCA 2E2IJ 1TWAJ 3H3VK 4C3HJ 2DMNA 3HOWJ 5DTDA 2ECCA 1U9OA 2EQRA 3JRAA 2HDDA 4M3FA 2VI6A 5J1RA 3S17J 1F36A 1P7IA 2M34A 3BG9A 4V2FA 3S14J 2JA7J 2EH3A 5M5YJ 1WPKA 2G0EA 4DYCA 3Q0UA 5E3MA 1ENHA 3OSFA 1RESA 3BR2A 2JK3A 5HODA 2DA1A 1JUMA 1XG1A 2LP0A 3BR1A 1TWFJ 1QVTA 3SFIA 1P7JA 3MVPA 5F27A 3S1RJ 1GVDA 1B72B 2DA5A 1JKRC 2LK2A 1VFCA 1HDPA 5EZGA 4MFEA 5F0FA 2LVSA 1I6HJ 1MBGA 4XRMA 1ETQA 1NTCA 4MIMA 3OSGA 3GTPJ 1QRYA 1NK2P 4G12A 4Y7NJ 4IHWA 5GP9A 2O8KA 2O9LA 3RZOJ 5F08A 1IJWC 1BW5A 3RQIA 2K40A 1MBJA 2I10A 4FTHA 1ETWA 1ZKGA 4W97A 2D5VA 2MG4A 3BTCA 3MN2A 3LSGA 3BR5A 2MSYA 4M6VA 5IP7J 2HYJA 4JP0A 2COBA 2CQXA 1JKOC 4A3FJ 2DMTA 3A01B 2DMUA 1PUFA 5FLMJ 1MSFC 1ZR2A 5J3LA 4JYKA 3SDGA 5EZHA 4D7NA 1HCRA 2H1KA 1RETA 4EEFG 1H8AC 3IH2A 1QVUA 5GPCA 2M8GX 5F0CA 2LD5A 2K9NA 2DA2A 2HOAA 3GBGA 3O8HA 2NVQJ 1X58A 3CCYA 1XS9A 2P81A 5IOZA 2JA6J 4XRSG 2R5ZA 5C4XJ 5M5XJ 3L1PA 2R0QC 2FX0A 2RAEA 4AYBN 1AHDP 3S1MJ 1ZGWA 2XSDC 2DN0A 1U78A 4RBOA 1MH4A 3Q3SA 2NVYJ 1S7EA 3ZQLA 3E7LA 2R93J 4Y52J 2X6OA 2IAIA 1X2NA 4DYRA 1T56A 2LFBA 1ZR4A 4A3JJ 4B3AA 2R7ZJ 3CMYA 4W1UA 1ITYA 4A3EJ 1U9NA 2ECBA 1RR7A 1SANA 5IYDJ 1JGGA 2LKXA 2NVXJ 2AHQA 3DCFA 1LE8A 1ETYA 3ZQGA 2QCOA 3HGYA 3NARA 1JT6A 1JUSA 1ETOA 2O7OA 3S16J 4A3BJ 3JRFA 2R92J 5JLXA 3JRHA 4BKXA 3D1NI 4AC0A 5M3FJ 2ZB9A 3HM5A 4BXXJ 3HOUJ 1SFOJ 1HLVA 1Y1WJ 1G2HA 3QPSA 5E3LA 4C2MJ 3BQZA 2CJJA 5M3MJ 5F0HA 1B8IB 4XK4A 4DZPA 1IC8A 2Y31A 2E2JJ 1MBEA 4DW6A 1HDDC 3CQZJ 2EBIA 3GTOJ 4UUSB 2JWTA 1R9TJ 3LSRA 4IHXA 1RPWA 3HGGA 3I4NJ 1OJLA 4D5CA 1MBHA 3FISA 3F0CA 2L9RA 3JR9A 4BBRJ 3ZQCA 3ZQIA 2JN6A 1JTXA 2CU7A 4L5EA 3WHCA 3OOUA 1X2MA 2E1OA 5IP6A 1MSEC 2EZHA 1Q1VA 4D7MA 1CQTA 2N8GA 1E3OC 1GV5A 3S2DJ 3PO2J 2CUEA 3B6CA 3G1MA 1ZQ3P 1POGA 3BR6A 4A3IJ 4J19A 3S1QJ 4FE7A 3IV5A 3TW6A 3GTJJ 2FJ1A 1TC3C 5FLVA 4M3BA 1TWGJ 5FKNA 1BA5A 1AKHB 5J1YA 3HKZN 2XB5A 1LFUP 1B8IA 2GM4A 3S1NJ 2WB1N 5FKKA 1H89C 2HQ5A 2X9DA 1B72A 3K7AJ 3B6AA 3RZDJ 3JRCA 3LNQA 2Y0SN 3IH4A 1IDYA 3NAUA 1AU7A 2QF7A 5GPAA 1JT0A 3JREA 4ABZA 1APLC 4BBSJ 4DZJA 1HOMA 1OFCX 3PO3J 2XGEA 5C44J 4JX6A 4JX4A 2W48A 3BTIA 1EF4A 4V2GA 4CYCA 2XPWA 3Q0WA 1F43A 1QPIA 3VPRA 2L7MP 3LOCA 2EZLA 2X48A 5EYRA 3ZQHA 3K2AA 4RDUA 2DA6A 2FD5A 4M3EA 1LFBA 1O4XA 2R5ZB 4X1EA 2LY9A 1K83J 1GUUA 1Z0XA 1RKTA 3TP0A 1BW6A 5BNGA 2B63J 3I4MJ 2AO9A 2Y9ZA 3BG5A 3ZQFA 1DU0A 3A01A 2Y2ZA 4QTRA 2FQ4A 2ME0A 3HOVJ 2L7FP 4IHVA 2MW8A 2R5YB 1BJZA 2LTPA 4A3KJ 4IHYA 2DA4A 1OCPA 4FCYA 1K61A 1DU6A 2VUMJ 1W0TA 2JMWA 3HEFA 3S15J 2HOTA 1ZK8A 3FK7A 2KT0A 3JRGA 1A6IA 3OIOA 3WHBA 2XPVA 4D5FA 5K7HA 5K7ZA 2IEKA 4NDLA 3GTLJ 5K7FA 1WGXA 4MLOA 3SJMA 1TWHJ 5EGOA 2JA8J 3M3YJ 4UUSA 3HB9A 2NVTJ 4AUXA 3A02A 3ZOBA 2XRLA 1FIAA 3QQAA 5EGOB 3UKGA 3GTKJ 1ZTRA 1JTYA 1JJ6C 4A3LJ 2NOGA 1MBFA 1FEXA 3HOZJ 1IDZA 1JKQC 2DA3A 1NK3P 2WV1A 5IPAA 3QPLA 4I6ZA 1JKPC 3HDDA 3S2HJ 5EG0A 5FJ8J 1UG2A 2VKVA 4B4CA 3Q0VA 2PMZN 2K9QA 1BL0A 1FIPA 1ETVA 2L7ZA 5C4JJ 1IV6A 5DS9A 3HOYJ 1WH7A 1Y1VJ 4MFDA 4FE4A 3TW7A 2GLOA 2VPRA 5FKLA 1A5JA 2IBDA 4MO7A 5J1UA 1RKWA 2TRTA 2YS9A 3TEDA 1IG7A 1YRNB 2HI3A 5EDNA 3C2BA 3JRIA 3GTQJ 3FK6A 4HNVA 1FTTA 3BR0A 2M9HA 1TWCJ 1W0UA 2VKEA 2GBYA 2NS8A 2XGDA 4GFBA 3GTGJ 1T33A 5F1JA 2Y30A 2CRGA 2LLKA 1UHSA 1D5YA 2OF7A 3HOXJ 3LSPA 3IH3A 3H0GJ 1MH3A 4A93J 5E3OA 2Y9YA 1VNDA 3HBLA 1WCMJ 2YUSA 3BTJA 5IP9J 4C3JJ 5JLWA 3A03A 4X6AJ 2CUFA 1FJLA 3W6VA 3GTMJ 1AKHA 1MNMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3D J;  3DEW A;  1WI3 A;  1OCT C;  2E19 A;  1I50 J;  1XC5 A;  4BY7 J;  2ID3 A;  2JA5 J;  1MBK A;  1PUF B;  2CQQ A;  2OPT A;  1IGN A;  3BR3 A;  3G1L A;  2ME6 A;  1UMQ A;  3BT9 A;  4A3M J;  1HF0 A;  2K9S A;  2DMQ A;  5EEA A;  1LE8 B;  1IRZ A;  3JRB A;  4XRS A;  2M0C A;  5IYB J;  5M5W J;  1Z77 A;  4IEJ A;  4M3D A;  4C3I J;  4QIW N;  3BQY A;  3CDL A;  5IOY A;  5EF6 A;  4UUT A;  1JUP A;  1I3Q J;  3BTL A;  3G1O A;  3RKQ A;  2DJN A;  1VI0 A;  2H8R A;  2XPU A;  2DMP A;  5F04 A;  2HXO A;  1JJ8 C;  2XB0 X;  5IYC J;  1IUF A;  3FIW A;  2YU9 J;  4BY1 J;  3MKL A;  3O8G A;  2MGQ A;  3BG3 A;  2NS7 A;  1ETK A;  2JJ7 A;  1WH5 A;  3LSJ A;  4QSH A;  3TP3 A;  2DTZ A;  1ETX A;  1FTZ A;  4M3G A;  2WAQ N;  1GDT A;  1H88 C;  4FIS A;  2R5Y A;  2TCT A;  4A3G J;  1U8B A;  1VF9 A;  4XID A;  5E3N A;  4A3C J;  4CYC B;  2E2H J;  2L0K A;  4JX5 A;  3PM1 A;  4S0H B;  1GV2 A;  5EG0 B;  9ANT A;  5FKO A;  3JRD A;  4B1R A;  2DA7 A;  3M4O J;  4DYQ A;  2ELK A;  3FKI J;  2HOS A;  2LR8 A;  4I76 A;  1YRN A;  4A69 C;  1ORK A;  2KDZ A;  2ID6 A;  5C3E J;  2EZI A;  1GT0 C;  2EZK A;  2M2E A;  4XIC A;  2HXI A;  4LOC A;  5FKM A;  2XGC A;  2E2I J;  1TWA J;  3H3V K;  4C3H J;  2DMN A;  3HOW J;  5DTD A;  2ECC A;  1U9O A;  2EQR A;  3JRA A;  2HDD A;  4M3F A;  2VI6 A;  5J1R A;  3S17 J;  1F36 A;  1P7I A;  2M34 A;  3BG9 A;  4V2F A;  3S14 J;  2JA7 J;  2EH3 A;  5M5Y J;  1WPK A;  2G0E A;  4DYC A;  3Q0U A;  5E3M A;  1ENH A;  3OSF A;  1RES A;  3BR2 A;  2JK3 A;  5HOD A;  2DA1 A;  1JUM A;  1XG1 A;  2LP0 A;  3BR1 A;  1TWF J;  1QVT A;  3SFI A;  1P7J A;  3MVP A;  5F27 A;  3S1R J;  1GVD A;  1B72 B;  2DA5 A;  1JKR C;  2LK2 A;  1VFC A;  1HDP A;  5EZG A;  4MFE A;  5F0F A;  2LVS A;  1I6H J;  1MBG A;  4XRM A;  1ETQ A;  1NTC A;  4MIM A;  3OSG A;  3GTP J;  1QRY A;  1NK2 P;  4G12 A;  4Y7N J;  4IHW A;  5GP9 A;  2O8K A;  2O9L A;  3RZO J;  5F08 A;  1IJW C;  1BW5 A;  3RQI A;  2K40 A;  1MBJ A;  2I10 A;  4FTH A;  1ETW A;  1ZKG A;  4W97 A;  2D5V A;  2MG4 A;  3BTC A;  3MN2 A;  3LSG A;  3BR5 A;  2MSY A;  4M6V A;  5IP7 J;  2HYJ A;  4JP0 A;  2COB A;  2CQX A;  1JKO C;  4A3F J;  2DMT A;  3A01 B;  2DMU A;  1PUF A;  5FLM J;  1MSF C;  1ZR2 A;  5J3L A;  4JYK A;  3SDG A;  5EZH A;  4D7N A;  1HCR A;  2H1K A;  1RET A;  4EEF G;  1H8A C;  3IH2 A;  1QVU A;  5GPC A;  2M8G X;  5F0C A;  2LD5 A;  2K9N A;  2DA2 A;  2HOA A;  3GBG A;  3O8H A;  2NVQ J;  1X58 A;  3CCY A;  1XS9 A;  2P81 A;  5IOZ A;  2JA6 J;  4XRS G;  2R5Z A;  5C4X J;  5M5X J;  3L1P A;  2R0Q C;  2FX0 A;  2RAE A;  4AYB N;  1AHD P;  3S1M J;  1ZGW A;  2XSD C;  2DN0 A;  1U78 A;  4RBO A;  1MH4 A;  3Q3S A;  2NVY J;  1S7E A;  3ZQL A;  3E7L A;  2R93 J;  4Y52 J;  2X6O A;  2IAI A;  1X2N A;  4DYR A;  1T56 A;  2LFB A;  1ZR4 A;  4A3J J;  4B3A A;  2R7Z J;  3CMY A;  4W1U A;  1ITY A;  4A3E J;  1U9N A;  2ECB A;  1RR7 A;  1SAN A;  5IYD J;  1JGG A;  2LKX A;  2NVX J;  2AHQ A;  3DCF A;  1LE8 A;  1ETY A;  3ZQG A;  2QCO A;  3HGY A;  3NAR A;  1JT6 A;  1JUS A;  1ETO A;  2O7O A;  3S16 J;  4A3B J;  3JRF A;  2R92 J;  5JLX A;  3JRH A;  4BKX A;  3D1N I;  4AC0 A;  5M3F J;  2ZB9 A;  3HM5 A;  4BXX J;  3HOU J;  1SFO J;  1HLV A;  1Y1W J;  1G2H A;  3QPS A;  5E3L A;  4C2M J;  3BQZ A;  2CJJ A;  5M3M J;  5F0H A;  1B8I B;  4XK4 A;  4DZP A;  1IC8 A;  2Y31 A;  2E2J J;  1MBE A;  4DW6 A;  1HDD C;  3CQZ J;  2EBI A;  3GTO J;  4UUS B;  2JWT A;  1R9T J;  3LSR A;  4IHX A;  1RPW A;  3HGG A;  3I4N J;  1OJL A;  4D5C A;  1MBH A;  3FIS A;  3F0C A;  2L9R A;  3JR9 A;  4BBR J;  3ZQC A;  3ZQI A;  2JN6 A;  1JTX A;  2CU7 A;  4L5E A;  3WHC A;  3OOU A;  1X2M A;  2E1O A;  5IP6 A;  1MSE C;  2EZH A;  1Q1V A;  4D7M A;  1CQT A;  2N8G A;  1E3O C;  1GV5 A;  3S2D J;  3PO2 J;  2CUE A;  3B6C A;  3G1M A;  1ZQ3 P;  1POG A;  3BR6 A;  4A3I J;  4J19 A;  3S1Q J;  4FE7 A;  3IV5 A;  3TW6 A;  3GTJ J;  2FJ1 A;  1TC3 C;  5FLV A;  4M3B A;  1TWG J;  5FKN A;  1BA5 A;  1AKH B;  5J1Y A;  3HKZ N;  2XB5 A;  1LFU P;  1B8I A;  2GM4 A;  3S1N J;  2WB1 N;  5FKK A;  1H89 C;  2HQ5 A;  2X9D A;  1B72 A;  3K7A J;  3B6A A;  3RZD J;  3JRC A;  3LNQ A;  2Y0S N;  3IH4 A;  1IDY A;  3NAU A;  1AU7 A;  2QF7 A;  5GPA A;  1JT0 A;  3JRE A;  4ABZ A;  1APL C;  4BBS J;  4DZJ A;  1HOM A;  1OFC X;  3PO3 J;  2XGE A;  5C44 J;  4JX6 A;  4JX4 A;  2W48 A;  3BTI A;  1EF4 A;  4V2G A;  4CYC A;  2XPW A;  3Q0W A;  1F43 A;  1QPI A;  3VPR A;  2L7M P;  3LOC A;  2EZL A;  2X48 A;  5EYR A;  3ZQH A;  3K2A A;  4RDU A;  2DA6 A;  2FD5 A;  4M3E A;  1LFB A;  1O4X A;  2R5Z B;  4X1E A;  2LY9 A;  1K83 J;  1GUU A;  1Z0X A;  1RKT A;  3TP0 A;  1BW6 A;  5BNG A;  2B63 J;  3I4M J;  2AO9 A;  2Y9Z A;  3BG5 A;  3ZQF A;  1DU0 A;  3A01 A;  2Y2Z A;  4QTR A;  2FQ4 A;  2ME0 A;  3HOV J;  2L7F P;  4IHV A;  2MW8 A;  2R5Y B;  1BJZ A;  2LTP A;  4A3K J;  4IHY A;  2DA4 A;  1OCP A;  4FCY A;  1K61 A;  1DU6 A;  2VUM J;  1W0T A;  2JMW A;  3HEF A;  3S15 J;  2HOT A;  1ZK8 A;  3FK7 A;  2KT0 A;  3JRG A;  1A6I A;  3OIO A;  3WHB A;  2XPV A;  4D5F A;  5K7H A;  5K7Z A;  2IEK A;  4NDL A;  3GTL J;  5K7F A;  1WGX A;  4MLO A;  3SJM A;  1TWH J;  5EGO A;  2JA8 J;  3M3Y J;  4UUS A;  3HB9 A;  2NVT J;  4AUX A;  3A02 A;  3ZOB A;  2XRL A;  1FIA A;  3QQA A;  5EGO B;  3UKG A;  3GTK J;  1ZTR A;  1JTY A;  1JJ6 C;  4A3L J;  2NOG A;  1MBF A;  1FEX A;  3HOZ J;  1IDZ A;  1JKQ C;  2DA3 A;  1NK3 P;  2WV1 A;  5IPA A;  3QPL A;  4I6Z A;  1JKP C;  3HDD A;  3S2H J;  5EG0 A;  5FJ8 J;  1UG2 A;  2VKV A;  4B4C A;  3Q0V A;  2PMZ N;  2K9Q A;  1BL0 A;  1FIP A;  1ETV A;  2L7Z A;  5C4J J;  1IV6 A;  5DS9 A;  3HOY J;  1WH7 A;  1Y1V J;  4MFD A;  4FE4 A;  3TW7 A;  2GLO A;  2VPR A;  5FKL A;  1A5J A;  2IBD A;  4MO7 A;  5J1U A;  1RKW A;  2TRT A;  2YS9 A;  3TED A;  1IG7 A;  1YRN B;  2HI3 A;  5EDN A;  3C2B A;  3JRI A;  3GTQ J;  3FK6 A;  4HNV A;  1FTT A;  3BR0 A;  2M9H A;  1TWC J;  1W0U A;  2VKE A;  2GBY A;  2NS8 A;  2XGD A;  4GFB A;  3GTG J;  1T33 A;  5F1J A;  2Y30 A;  2CRG A;  2LLK A;  1UHS A;  1D5Y A;  2OF7 A;  3HOX J;  3LSP A;  3IH3 A;  3H0G J;  1MH3 A;  4A93 J;  5E3O A;  2Y9Y A;  1VND A;  3HBL A;  1WCM J;  2YUS A;  3BTJ A;  5IP9 J;  4C3J J;  5JLW A;  3A03 A;  4X6A J;  2CUF A;  1FJL A;  3W6V A;  3GTM J;  1AKH A;  1MNM C; 
#chains in the Genus database with same CATH topology
 4XLP F;  3DEW A;  3H9Q A;  2CQK A;  2PMH A;  2E19 A;  4JK1 X;  1OCT C;  1I50 J;  2XC7 A;  1HW1 A;  4NQW A;  2GAU A;  3GFI A;  4NHJ A;  1IGN A;  1ZLJ A;  5FLX K;  3LFK A;  1I1S A;  2ME6 A;  3BT9 A;  1UEL B;  4A3M J;  5H2F C;  1YI2 I;  1HF0 A;  1SFK A;  1LE8 B;  2M4K A;  1A04 A;  3C18 A;  1FOY A;  1I5Z A;  5E17 F;  1S3J A;  3BLY A;  3VOE A;  1X4P A;  3BJ6 A;  4BJT A;  1Z77 A;  3OL3 A;  3RDI A;  2O6G E;  4C3I J;  3OYA A;  2Y48 A;  3CCJ I;  2YSR A;  4RB2 C;  2M3A A;  3ECH A;  4UUT A;  2BY3 A;  4RLQ A;  3IHU A;  1MDM A;  1VI0 A;  2P5K A;  3DU5 A;  2H6C A;  2DMP A;  3DBH B;  3IUO A;  5F04 A;  1N77 A;  1OCZ H;  1ZN2 A;  5IYC J;  4I98 B;  1IUF A;  2YU9 J;  2KIM A;  2WWY A;  1ETK A;  2BY0 A;  3E5Q A;  4A0Y A;  4EJV A;  4RS8 A;  3D5L A;  4QSH A;  2GIZ A;  1Y0N A;  3R0A A;  1X19 A;  1ETX A;  4LFU A;  5BQT A;  2XAH A;  3DKW A;  1GDT A;  2LSO A;  3VEP A;  1H88 C;  1MMG A;  2R5Y A;  4A3G J;  1Y8R B;  4XID A;  3DBR B;  2OV7 A;  1SFX A;  4RLF A;  4LLN A;  1IRF A;  1NH3 A;  2IW5 A;  3O3K A;  5D5U B;  1A35 A;  2VXD A;  4A2U A;  2HPI A;  3FKI J;  2LR8 A;  1REP C;  2KDZ A;  4BDY A;  1ZRD A;  1MJ9 A;  3ML6 A;  2EZI A;  1GT0 C;  2VIX A;  2M2E A;  2W4S A;  2Z2S B;  5KCM A;  4ON0 A;  5GTH C;  2FSW A;  5ILV A;  4N0B A;  1VQ9 I;  2HXI A;  2BEO A;  2G7H A;  3P9C A;  4F3Q A;  3IP4 B;  1YFH A;  1YS7 A;  1TWA J;  3PIP F;  2DT7 B;  3V8J A;  2ECC A;  5FRN A;  3LQR A;  1S7O A;  1YOV B;  2HDD A;  4UB8 C;  2D2W A;  3FMQ A;  1F36 A;  1YQA A;  4HPQ A;  1HBX G;  2D1H A;  3EUA A;  1D0X A;  2M30 A;  5D6F A;  1X1C A;  2G0E A;  3S3O A;  4EMS A;  4EM1 A;  2A5Y B;  2WAQ A;  2HFH A;  1XMA A;  3CO6 C;  4LG3 A;  2EV5 A;  4IQJ A;  1O7F A;  1MNE A;  3RKW A;  5KK1 A;  3QOD A;  4DBQ A;  2L7K A;  5HLG A;  3CZ6 A;  4BAC A;  2QQ8 A;  1P7J A;  4G94 A;  4CCN A;  1B72 B;  3ABM H;  2DA5 A;  2P5L C;  3CLQ A;  4CO8 A;  1T6S A;  2LVS A;  4C9Y A;  1S8N A;  1B6A A;  4E7S A;  1BR1 A;  1NTC A;  4IHT A;  1QRY A;  4LB5 A;  4G12 A;  2EIK H;  1YX5 A;  2HTJ A;  1HW2 A;  3EUK L;  1FY7 A;  3EPZ A;  3PNY A;  2JUC A;  3E6M A;  2TDX A;  1RUN A;  2VQL A;  4ZYD A;  3WU0 A;  1XCV A;  1KU3 A;  2CQN A;  3HPH A;  5IT9 Z;  2F5C A;  3BR5 A;  4M6V A;  1MZB A;  4CA0 A;  4HF0 A;  2JQ7 A;  4IKF A;  2DMU A;  2ZFU A;  1R36 A;  3LAJ A;  3ABT A;  1BM9 A;  3CJT B;  1DDN A;  2LOO A;  4BDZ A;  4B09 A;  5LEK A;  1D1A A;  4D7N A;  1P2F A;  2F4M B;  4YFX F;  1HCR A;  2LRD A;  3WTS C;  2K9N A;  3ERM A;  2CW8 A;  4A12 A;  4OAZ A;  3CCY A;  1QNT A;  1XS9 A;  1OCO H;  4B47 A;  2VE9 A;  2JA6 J;  4AD9 A;  4BL0 B;  1MDM B;  3GF2 A;  4AWX B;  5GAD J;  5C4X J;  1FT9 A;  1WJC A;  3MZ8 A;  3GVA A;  3O2P E;  5M5X J;  3PUB A;  5TJJ A;  4AYB N;  5HLT A;  1AHD P;  3S1M J;  1MJB A;  3EUH C;  2L02 A;  2XSD C;  2XIG A;  1U78 A;  3W2A A;  1FSE A;  5BPI A;  4IVN A;  3F9K A;  2KDO A;  1BJA A;  2R93 J;  2DXI A;  1W7P D;  1X2N A;  1YX3 A;  4NC8 A;  4U0W A;  3IKV A;  4B3A A;  3CMM A;  4B3X A;  2A69 F;  3GWZ A;  3CMY A;  1T8I A;  4A3E J;  3JAM Z;  3ASO H;  5ICE A;  2RQP A;  1WHU A;  3TO7 A;  2MLG A;  5J8C A;  2ECB A;  4XSZ F;  3F3X A;  3OIP A;  2EIJ H;  2YPR A;  2HDC A;  3L2U A;  2QEN A;  4JOM A;  1S6L A;  4HX4 A;  3AL0 B;  2VXZ A;  4Y33 A;  1QZE A;  5HNH A;  4EM2 A;  1KQ9 A;  1DUX C;  1ETY A;  2F4O B;  4P96 A;  1B59 A;  4Y15 A;  2RNG A;  3NAR A;  1IF1 A;  4JBA A;  2KPM A;  3QP6 A;  1FBU A;  3F8F A;  2O7O A;  2JZY A;  5E79 C;  4A3B J;  3F21 A;  1O7L A;  3JRH A;  2C6Y A;  5FD6 A;  5J6X A;  2IS6 A;  1I6X A;  2ZB9 A;  3HM5 A;  4BXX J;  3SZT A;  4GDF A;  1HLV A;  4MTE A;  3MKW B;  4LB6 B;  2EWN A;  2HTS A;  4L5I A;  3RYR A;  1SD7 A;  1YHQ I;  2HVR A;  2CUJ A;  3OYK A;  4PCQ A;  5TGT A;  3U21 A;  2XVC A;  4XK4 A;  1IC8 A;  1VQN I;  1HDD C;  2FUG 2;  1V54 H;  2EBI A;  3DFG A;  2D1V A;  3VSL A;  4CGZ A;  4KIC A;  4UUS B;  2JWT A;  3D5S C;  4GGG A;  1RPW A;  4IHX A;  2JPC A;  2W00 A;  2QSG X;  4RGS A;  3KP6 A;  1U5T B;  1ONV A;  2L9R A;  3JR9 A;  2OJE D;  1G3S A;  2JRT A;  2VE8 A;  3H9J A;  4CCO A;  4U7D A;  2LH9 A;  3SZP A;  5F6F A;  1PVE A;  3PUF A;  5CVJ A;  3ERE D;  2OA4 A;  5DV5 A;  4OIQ F;  2DFE A;  4E7I A;  3HRS A;  2IS1 A;  5JFR A;  3IRQ A;  3E5U A;  3F8B A;  2NRA C;  1E3O C;  3RJP A;  3PO2 J;  4ESF A;  1J0R A;  3G1M A;  2KL4 A;  3E97 A;  3S1Q J;  3TW6 A;  1TC3 C;  3LL7 A;  2IJL A;  1FMW A;  3H9G A;  3S93 A;  4IPA A;  2ZSI B;  3S32 A;  2HS5 A;  2Q8K A;  5HOO A;  1B8I A;  3OYE A;  2VJJ A;  3S1N J;  2G7U A;  3GLL A;  4FAS D;  5DUK A;  1HKS A;  2RVC A;  1R58 A;  3FBI B;  3RZD J;  5BMZ A;  4JQF A;  1IO2 A;  2W1O A;  3LAP A;  1IDY A;  1HST A;  3KPH A;  2QF7 A;  4XKB A;  3GO5 A;  1JT0 A;  4BBS J;  2JA2 A;  2VT2 A;  1HOM A;  1ZYR F;  5GAG J;  3S2W A;  2XGE A;  2A6H F;  2E34 A;  3TBI A;  2P0W A;  4HLX A;  3PL8 A;  4M72 A;  3OYG A;  5E1X A;  2QLZ A;  2W48 A;  2FNP A;  5JVT A;  1KU9 A;  2VT3 A;  1TW2 A;  4PFP A;  4CYC A;  3H3U A;  3EET A;  5EYR A;  3ZQH A;  4HDU A;  4YEJ A;  1T39 A;  2DYS H;  4GO1 A;  4RGU A;  4RB1 A;  4IF4 A;  2BGC A;  3DLA A;  1J2X A;  1MIJ A;  3KYD B;  4X1E A;  3REO A;  2R7V A;  1I27 A;  1W1W E;  2DTR A;  1R1T A;  2DOF A;  3FXR A;  2DU9 A;  1GUU A;  1RKT A;  1I3A A;  3W3C A;  1WJA A;  2B63 J;  3I4M J;  1B1B A;  3H92 A;  1X1P A;  3BG5 A;  2GOM A;  3A01 A;  3I3L A;  2JRM A;  3E1S A;  4KIT B;  4KMF A;  3KE2 A;  3H0D A;  3K4J A;  2ME0 A;  3IAS 2;  2L7F P;  2HYG D;  1T38 A;  1J7K A;  1P4X A;  1FSH A;  3CMA I;  2R7S A;  2A07 F;  2R7Q A;  4PJL A;  4YRV A;  1D8J A;  3G2B A;  1K61 A;  1DU6 A;  2VUM J;  4Z6Y A;  1W0T A;  3ZMS A;  1R5I D;  5LGN A;  3HEF A;  3S15 J;  4O3M A;  2WY8 Q;  3DF8 A;  1ZK8 A;  2HOT A;  5K7Z A;  2IEK A;  3DEE A;  3JCU C;  4BEH B;  3GEZ A;  3KYL A;  2EFP A;  2ESN A;  3SJM A;  4ENM A;  5D4S A;  1FYK A;  4UUS A;  1T0F C;  3T5X A;  3ZMT A;  3HJE A;  3IL2 A;  3X2Q H;  2HQA A;  3HB9 A;  1SMT A;  1YYV A;  4AUX A;  4WWC A;  5ED4 A;  1UST A;  3A02 A;  3QP5 A;  1VQL I;  2JSP A;  2HKX A;  3E5X A;  3MQ0 A;  4L9J A;  4XOR A;  5B5E C;  2PI0 A;  4CCL A;  3CCR I;  2OC6 A;  1ON1 A;  1RUO A;  3QPH A;  1R4N B;  4CIC A;  5DEQ A;  4A3L J;  3CCM I;  3PJR A;  3OYF A;  2A6T A;  2L4A A;  3FHN A;  2WV1 A;  4LIT A;  5IPA A;  2F2E A;  4LIV A;  2HVS A;  4AM3 A;  1R00 A;  4UB6 C;  4D1Q A;  1NG7 A;  3HHH A;  5EG0 A;  2M7A A;  1LVK A;  1RIO H;  3HL2 A;  4HST A;  3OWT A;  5HVQ C;  2IP2 A;  2K9Q A;  3CME I;  2ZXH A;  5HS7 A;  1LUJ B;  1MW7 A;  2FMY A;  3T1B A;  4XRF A;  1IV6 A;  3CUQ A;  4MFD A;  5HDK A;  2V1X A;  2GLO A;  1Z6R A;  1FMV A;  3C2G A;  4MO7 A;  4ZYH A;  3IAM 2;  2PLY A;  2HPM A;  1MJA A;  2VOP A;  3H3Z A;  2J5O A;  4NBQ A;  1FZP B;  3G4S I;  3GTQ J;  5CKT A;  3FK6 A;  3I54 A;  5FFZ A;  1T95 A;  1E0E A;  3ISP A;  3KEO A;  3VOD A;  5K1Y A;  4E7H A;  1Z3X A;  4ENK A;  2E5Z A;  2GBY A;  2XGD A;  3GTG J;  1TZL A;  4CCJ A;  5A2Q K;  2ICW G;  4RGR A;  1WVR A;  2QSF X;  3ZXS A;  2CRG A;  2Y30 A;  4RMN A;  1UHS A;  1D1C A;  1D5Y A;  2OF7 A;  4XN0 A;  1SAU A;  3L2C A;  1IXC A;  2KJC A;  2VPL A;  3I56 I;  1VND A;  1D8K A;  3COA C;  2V9K A;  2A61 A;  4B8X A;  1VQP I;  1TL8 A;  1LDD A;  5F1R A;  4X6A J;  1LVA A;  4B43 A;  1SVL A;  1KON A;  1VTN C;  2KIU A;  2LKS A;  3AG3 H;  1Y39 A;  2LBF B;  3JW4 A;  2A05 A;  1IXR C;  4KYW A;  3G3Z A;  1Z21 A;  2ACJ A;  3GFM A;  3K1P A;  3BCA A;  1FX7 A;  1XC5 A;  1M1E B;  4GCV A;  4BY7 J;  2ID3 A;  5E8G A;  4MTD A;  3JSO A;  3BR3 A;  1P92 A;  1ZG1 A;  2V1N A;  2O3F A;  2DMQ A;  3NRV A;  2Y69 H;  3W6K B;  2DI3 A;  3PNV A;  4RB0 A;  2RQQ A;  2ZXJ A;  1IRZ A;  4HAM A;  1S5L C;  3J7Y J;  4HLY A;  1WSU A;  4O6J A;  1SVO A;  4QIW N;  2ZO4 A;  2LYC A;  1TQP A;  5EF6 A;  1JUP A;  4PDK A;  2H8R A;  2XPU A;  2HXO A;  4AVZ A;  2FML A;  3FIW A;  4U88 A;  2DBB A;  2H8W A;  2P8T A;  3MKL A;  3O8G A;  2MGQ A;  1EA3 A;  2NS7 A;  3L00 A;  2BW3 B;  1WH5 A;  2JJ7 A;  2VBW A;  5D5X B;  5JR3 A;  1QU3 A;  2MBF A;  2EFO A;  5CVV A;  1FTZ A;  2R4G A;  2DW4 A;  2WAQ N;  1X1B A;  3A4C A;  1ZGA A;  2FXA A;  2MD0 A;  2VQC A;  3U1D A;  4BQN A;  2FE3 A;  3DV8 A;  3CCV I;  3GXO A;  3S8P A;  1MD0 A;  3BWG A;  3FDY A;  3MFK A;  4A6E A;  2TCT A;  1WI9 A;  4AYB A;  2CW0 F;  5E3N A;  4XLA A;  2E2H J;  3LMM A;  4Y17 A;  1MMD A;  4BXU A;  3VFZ A;  5D6E A;  4S0H B;  4OMY A;  1GV2 A;  1HSJ A;  2KKO A;  2XAS A;  2Y0S A;  2ESH A;  3PFY A;  1QO0 D;  1OYI A;  5LRR A;  4B1R A;  3M4O J;  4KDP A;  4DYQ A;  1WWX A;  5D8L B;  3JTG A;  3A1Y A;  2G9W A;  3MD2 A;  5D8K B;  1CF7 A;  2L5Q A;  2PN6 A;  4OWR B;  3V8L A;  1PJR A;  3KFW X;  2E1M B;  3KET A;  4DJA A;  3ZCO A;  4P9F A;  4KA4 A;  1JHH A;  3KP2 A;  5JHF A;  3CC4 I;  3K9T A;  3L9F A;  3H3V K;  2QQ9 A;  2NOJ B;  1BI0 A;  4CSW A;  3HOW J;  5DTD A;  4E7L A;  1GXQ A;  1UAA A;  4LIU A;  1JXS A;  1FC3 A;  1ZAO A;  2KIS A;  4M3F A;  2LC2 A;  1FYM A;  4XR6 A;  2M34 A;  2QGU A;  2QYO A;  2VAS A;  4MHG A;  5LHH A;  4M9X A;  2JA7 J;  1YW9 A;  3OS0 A;  2AXL A;  2EH3 A;  4ZYA A;  1WPK A;  3CUQ C;  3W2W A;  4PZJ A;  3EUH A;  4DYC A;  5E18 F;  3Q0U A;  5E3M A;  3IKT A;  3K4M A;  1RES A;  1K6Y A;  3RQ4 A;  3KCC A;  5CVR A;  2DA1 A;  3IRR A;  3K6G A;  2LP0 A;  3H5R A;  1K4T A;  1TWF J;  2O0Y A;  3SDB A;  3SFI A;  3J81 Z;  3MVP A;  5F27 A;  1F5T A;  1DP7 P;  2X51 A;  2QUF A;  2E1M C;  2FA5 A;  2F48 A;  2LK2 A;  2P4W A;  2PEX A;  1WZ2 A;  4HX8 A;  4XRM A;  2LF8 A;  3OSG A;  3GTP J;  4IRG A;  4Y7N J;  5GP9 A;  4XNF A;  3FM5 A;  1ZRF A;  5F08 A;  1IJW C;  1WKM A;  4KIS A;  2MFZ A;  3RZO J;  1BW5 A;  3ZR8 X;  4M9Z A;  3RQI A;  4M74 A;  4RAG A;  2I10 A;  1ZKG A;  4L9V A;  3HHG A;  1L3L A;  1G3T A;  5HDG A;  2D5V A;  2MG4 A;  3MN2 A;  3LSG A;  3R60 A;  4QPO A;  2MSY A;  4XM3 A;  3MMY B;  2VQG A;  2HYJ A;  1UJ8 A;  5H20 A;  4AIK A;  4A3F J;  5DM7 F;  3A2K A;  4LD5 A;  1WRJ A;  3F8C A;  4G7O F;  2Y75 A;  5FLM J;  3DKX A;  1MSF C;  2HKO A;  1YIJ I;  1ZR2 A;  3UR3 C;  5J3L A;  4R79 A;  3TO6 A;  5GAE J;  1XN7 A;  1V55 H;  2MA3 A;  3DP7 A;  2Q1Z B;  2L9V A;  4JYK A;  1LQ1 A;  1X4O A;  2H1K A;  2X0L A;  4BGD A;  1RET A;  2PG4 A;  4BQQ A;  4EEF G;  5LEJ A;  1H8A C;  1UHW A;  4CHU A;  5B1B H;  3IH2 A;  3LA3 A;  3W6J B;  5GPC A;  3R0J A;  1PDN C;  2GXG A;  2HOA A;  3GBG A;  4I7H A;  2VOD A;  2HZT A;  1VQ4 I;  2P81 A;  5IOZ A;  4KMU X;  2YU3 A;  1G6N A;  4XRS G;  4BE0 A;  2HOE A;  2ZME B;  2HQR A;  4CCM A;  2W25 A;  4Z2Y A;  3CC7 I;  2O8X A;  2IRF G;  1VZ0 A;  3J80 K;  2XF6 A;  1AA7 A;  1Z7L A;  3H35 A;  2W84 A;  2DDB A;  4XOP A;  1XDU A;  3JSP A;  2JVG A;  2BW3 A;  4HZF A;  3Q3S A;  2NVY J;  3ZQL A;  3S3N A;  1Z6T A;  2X6O A;  2L3D A;  2E5N A;  2IAI A;  1Z05 A;  2LRE A;  2R7Z J;  2K9L A;  1RC9 A;  3OY9 A;  4ZDP A;  2VON A;  3RKY A;  1D0Y A;  1U9N A;  4B48 A;  5CQE A;  2WB1 A;  1OQY A;  2E7W A;  2XF7 A;  2E60 A;  2UXN A;  3F22 A;  1G3W A;  1ON2 A;  2IPQ X;  1HQC A;  3H1C A;  1T2K A;  4HSR A;  2V1U A;  3BPX A;  1X3Z B;  3LA7 A;  1FP1 D;  2LG4 A;  2DOD A;  2Z3Y A;  1XSV A;  5KHD A;  3CUO A;  2KIF A;  4F55 A;  1LE8 A;  4KIB A;  2QCO A;  3HGY A;  3FKJ A;  2FU4 A;  2P7V B;  3MZY A;  4KIG A;  1SFU A;  2FBI A;  1HKT A;  1ACI A;  2BXY A;  2R92 J;  3OYI A;  4BKX A;  3BOQ A;  4PSW A;  3ZPL A;  5M3F J;  1IAW A;  3DPL C;  2JTV A;  4XON A;  1SFE A;  1ODD A;  1SFO J;  1QHG A;  3ULQ B;  1OCR H;  1VQ7 I;  2DCE A;  1L0O C;  3BRO A;  3HG9 A;  1JGS A;  2VQH A;  3FXM A;  2MLK A;  4A0Z A;  1GXP A;  3I59 A;  5CQG A;  2WV0 A;  5F0H A;  3OYJ A;  5LHI A;  1B8I B;  2E2J J;  2Y31 A;  2CV2 A;  3LQQ A;  3OR2 C;  1MND A;  3QYB A;  2CQ7 A;  4CUG A;  3WGI A;  3OS2 A;  2EFW A;  4BQA A;  3FIS A;  3RIR A;  3F0C A;  4AU7 A;  3J7A Y;  4XMY A;  2DT5 A;  3HSF A;  2ADU A;  5FRO A;  2X6Y A;  4N4N B;  5L3D A;  3CJQ B;  3OOU A;  1X2M A;  3UNG C;  2E1O A;  2EZH A;  2Q2E A;  4HW0 A;  4EJT A;  3JAM K;  2CUE A;  3CJR B;  2H1L A;  3D5R C;  3C3W A;  1POG A;  1R7J A;  2K5C A;  2ZFW A;  3BR6 A;  3RPU A;  4IO9 F;  1ZHF A;  4FE7 A;  3BZC A;  4ANJ A;  3AG4 H;  2ZME A;  1MMA A;  5FLV A;  5E1Z B;  3I71 A;  4ZTF A;  4KT6 A;  5FKN A;  4Q5S F;  1AKH B;  2FF4 A;  2QSH X;  3ZN0 A;  1E3P A;  2GM4 A;  5FGM A;  2CS3 A;  4AVP A;  1B72 A;  3B6A A;  4HRI A;  3HRU A;  2ZJQ F;  1X3W B;  4OMZ A;  3IH4 A;  5GPA A;  3JRE A;  2EFQ A;  3N97 A;  2XGX A;  2VB6 A;  1W36 D;  4BS9 A;  3PO3 J;  5C44 J;  3C1D A;  3P7N A;  4HV5 A;  1RRJ A;  4AIJ A;  1TQI A;  3BTI A;  2OQR A;  4FET A;  3I0T A;  2L7M P;  4XSX F;  4Y4R A;  1FPQ A;  4F52 A;  4YIF A;  3K2A A;  3OYB A;  3CCL I;  1W7P A;  4QLC U;  2DA6 A;  4M3E A;  1FOK A;  1XSX A;  3L2W A;  1LFB A;  1O4X A;  1FBQ A;  2A5W A;  4NC6 A;  4BXF A;  2AQE A;  1OYY A;  2E1N A;  1G4D A;  1VQK I;  1EV7 A;  2WAD A;  2X6W A;  1GVJ A;  1BW6 A;  3E6B A;  3W2V A;  3M1E A;  2DPD A;  2OBP A;  2Y2Z A;  1ZEL A;  2FQ4 A;  3KLN A;  4WK8 F;  4OAY A;  4L0Z B;  4IHV A;  4IRI A;  1W5S A;  2DLL A;  2MW8 A;  2GXB A;  4HOB A;  2NVU B;  4WX9 A;  4XL9 A;  3F72 A;  1Z9C A;  2DK8 A;  4N9I A;  2DFH A;  1SD6 A;  2DA4 A;  2VOO A;  4HNT A;  5FO5 A;  1IUY A;  4P5O A;  1V5E A;  2FBK A;  3KP5 A;  3MCZ A;  1A6I A;  5K7H A;  3WHB A;  4D5F A;  1DPU A;  4NDL A;  2NYX A;  3SFZ A;  5JI6 A;  5EGO A;  2JA8 J;  1BOA A;  3RKX A;  4L0Y B;  1X1A A;  4BHP A;  3VYT B;  1TQM A;  3RCO A;  1VQ6 I;  3ZOB A;  1FIA A;  3QQA A;  2OZU A;  4RAF A;  3L7W A;  2E7X A;  2OCC H;  2QEX I;  2X85 A;  4IL6 C;  4PJJ A;  3TOB A;  2NOG A;  1MBF A;  3WG7 H;  3M7G A;  3Q5F A;  1KQ8 A;  4K2E A;  1NK3 P;  3F6V A;  3LSI A;  3OS1 A;  1EKE A;  1BC8 C;  2VC1 A;  5D5V B;  3FXJ A;  3RPQ A;  2RC4 A;  3HDD A;  2R7U A;  5FJ8 J;  3WTZ A;  1BI3 A;  3NQO A;  2R7D A;  2H94 A;  1BI1 A;  3WTW C;  2FOW A;  3V7S A;  3LA2 A;  4A0X A;  5LRS A;  3HTS B;  3WU1 B;  2L7Z A;  2QZ8 A;  2ISY A;  5DS9 A;  3EYI A;  3HOY J;  4FQG A;  3TW7 A;  4H0E A;  2VPR A;  1OIS A;  3V8K A;  2IBD A;  1YLF A;  3ZMV A;  1Y6I A;  5HDN A;  4EJO A;  2YS9 A;  3TED A;  1IG7 A;  1XPX A;  2EA2 A;  3J7A O;  2FBH A;  2Q2E B;  2HI3 A;  5EDN A;  5EJC A;  1D1B A;  4ENN A;  1FTT A;  2M4G A;  1T08 B;  4XKV A;  4PJN A;  4XOT A;  3DPU A;  2K85 A;  2NS8 A;  4GFB A;  4BYY A;  1T33 A;  5F1J A;  4LK0 F;  1K6O A;  4P1W A;  4LLL A;  3QU6 A;  5TRD A;  3OR1 C;  1IRG A;  1AWC A;  3WTU C;  3LSP A;  3IH3 A;  2ELH A;  1KU2 A;  1X3U A;  1F9N A;  2ZXI A;  3ZMD A;  3HBL A;  2CFX A;  1F4K A;  4II3 A;  3ZMZ A;  3BTJ A;  3KP7 A;  1EH7 A;  3LFU A;  2XSJ C;  2WTE A;  2CMP A;  3A03 A;  4E70 A;  3FHZ A;  2CUF A;  3I9V 2;  3E6D A;  1FJL A;  2FQ3 A;  1S72 I;  3N05 A;  3DU6 A;  3HSR A;  2L9N A;  1MNM C;  4UNO A;  1YJN I;  3OYC A;  1WI3 A;  1QQI A;  4EVI A;  3F8N A;  4OIR F;  3N4M A;  2RNJ A;  1R22 A;  1O3S A;  3OYN A;  1R1V A;  1OLT A;  2BE5 F;  3VDX A;  4CZC A;  2JA5 J;  1PUF B;  2OPT A;  3SYT A;  2E35 A;  2MH9 A;  2CYY A;  4Q48 A;  4G6T B;  2CFO A;  5EEA A;  1KZH A;  2MH2 A;  4UV8 A;  4XRS A;  2L4M A;  1IN5 A;  2M0C A;  1K78 B;  5IYB J;  1D3Y A;  4IEJ A;  3CLO A;  4L5J A;  3FXK A;  2WY7 Q;  3BQY A;  5DUI A;  2A3S A;  3CDL A;  5IOY A;  3TKY A;  3BTL A;  3G1O A;  3RKQ A;  2DJN A;  3KX2 A;  3GZN B;  4KT5 C;  3T0Y A;  4HG2 A;  3CP8 A;  3TDU C;  1DQU A;  1JJ8 C;  4MEX F;  3ABL H;  2ZJR F;  3QRF F;  1QBJ A;  2XKP A;  2DPU A;  5KAI C;  3LST A;  3R61 A;  3IWF A;  1BOB A;  3BZK A;  3LSJ A;  2Z1D A;  5BPD A;  5JHU A;  2DTZ A;  1J9I A;  1JI8 A;  2GIV A;  4LMY A;  4M3G A;  3OIQ A;  4FIS A;  5B66 C;  2VKH A;  3AAF A;  4XLN F;  4NNJ A;  1VF9 A;  2GZW A;  2KRC A;  3JTH A;  4CYC B;  2L0K A;  2PJR A;  4HEA 2;  3OL4 A;  4UVA A;  4EAT A;  3VYR B;  2W7N A;  3FX3 A;  4ZDL A;  2OTJ I;  5ERI A;  5EG0 B;  1B9N A;  2DQR A;  3BZ6 A;  5L3F A;  3K10 A;  2KRH A;  3P9K A;  1YJ9 I;  2ELK A;  2HOS A;  2OU2 A;  4PFO A;  2K9M A;  4I76 A;  5CJ9 A;  1YRN A;  1ORK A;  3G73 A;  2VKD A;  2ZSH B;  2ID6 A;  5C3E J;  2EZK A;  3MKY B;  5B3S H;  4CCK A;  1DP3 A;  4LOC A;  2XGC A;  3K70 D;  3BDD A;  5CVI A;  3WTV C;  2DMN A;  2V79 A;  4KN4 X;  1U9O A;  2EQR A;  3FXO A;  3JRA A;  4WCG A;  4L9N A;  3U9G A;  2OTL I;  2CGP A;  2ZKZ A;  3FM3 A;  2WAF A;  4M73 A;  4BAY A;  4OIO F;  1UZC A;  4MEY F;  3BG9 A;  4IXA A;  4FT8 A;  5M5Y J;  4G6Q A;  2CG4 A;  2STW A;  4IX7 A;  1R49 A;  5H6Q A;  2WBM A;  2HR3 A;  3OSF A;  2EJR A;  2WC2 A;  3BR2 A;  2JK3 A;  5HOD A;  3FZV A;  1JUM A;  1XG1 A;  1YE9 A;  2IS2 A;  4QPQ A;  3BR1 A;  2Z33 A;  3KP4 A;  1XSD A;  3S1R J;  4EJU A;  2ZJ2 A;  1CF7 B;  3QAH A;  1EJ9 A;  4V19 K;  1I6H J;  1MBG A;  4BHC A;  1ETQ A;  2COM A;  3EQL F;  3CCU I;  1YG2 A;  2HQN A;  4C2U A;  4EQQ A;  4HQE A;  1HXD A;  1WJE A;  2IA0 A;  3ZGK A;  1NK2 P;  4IHW A;  1FNN A;  2DJI A;  3ZRG A;  2O9L A;  5IT3 A;  1T98 A;  2HVQ A;  5LGU A;  2K40 A;  3OYL A;  4ETS A;  1MBJ A;  3HRM A;  5L3C A;  4J01 A;  2M1B A;  4BNC A;  1ETW A;  3PSF A;  4I02 A;  4W97 A;  2R7W A;  2A68 F;  3BTC A;  3ELK A;  5J47 A;  3DLL F;  5AON A;  4EGY A;  4YEL A;  2MYS A;  5IP7 J;  2QKM B;  4JP0 A;  4WXC A;  2CQX A;  4Y3O A;  3SHF A;  3K2Z A;  2DMT A;  3SQN A;  1PUF A;  4I0B A;  2XAU A;  2WA0 A;  1Z91 A;  3G71 I;  1VQO I;  2VL8 A;  1QZZ A;  1BC7 C;  3SEZ A;  2LY1 A;  3M9A A;  5AIP A;  3FXL A;  1VQ8 I;  3CP2 A;  2NNY A;  3KIO A;  2M87 A;  2LDU A;  5ICF A;  3AL0 C;  3SDG A;  5EZH A;  1V5F A;  3CUQ B;  4G9Y A;  2M8G X;  5F0C A;  4UY8 I;  2DA2 A;  3O8H A;  3HUG A;  5EEG A;  1FP2 A;  1QHH D;  4R1H A;  4IHS A;  3GCM A;  3TMO A;  3L1P A;  2R0Q C;  1ZAR A;  2FX0 A;  3GYH X;  2I8D A;  3AFH A;  3KZI C;  5HS9 A;  3MEX A;  4RBO A;  2KLO A;  4Y13 A;  1MH4 A;  1S7E A;  3E7L A;  2BVM A;  2R7O A;  5J8F A;  2CO5 A;  4NUB A;  5DDG A;  4DYR A;  3ZQQ A;  1T56 A;  2LFB A;  4MNU A;  4A3J J;  1XGM A;  3HUG B;  2Z5U A;  1ITY A;  1JE8 A;  2PJP A;  4EM0 B;  1E3H A;  1N78 A;  1R6R A;  2X1C A;  1LDJ A;  1G8X A;  2X6X A;  3CD6 I;  3WGG A;  3CF2 A;  3CJN A;  4NC7 A;  4XLF A;  4HV6 A;  5CPR B;  2NVX J;  4PGG A;  5FB2 A;  3T8T A;  3L09 A;  3DCF A;  2GA1 A;  4XLE A;  5ICG A;  2K02 A;  5CLS A;  4AIH A;  2A6E F;  3R4K A;  1JT6 A;  4UVC A;  1ETO A;  4S04 A;  1I1G A;  3AG1 H;  5ILS A;  3F8M A;  3DBL B;  3D1N I;  5GAH J;  1BI2 A;  1XGN A;  1FOX A;  1Q1H A;  2AXT C;  4X0G A;  1ZG5 A;  3HOU J;  1FBS A;  2AS5 F;  3RYP A;  1YIO A;  3OYM A;  5BOX A;  1G2H A;  3QPS A;  1V3F A;  1O3T A;  2KJB A;  3DPT A;  3HXL A;  2DAO A;  2KQR A;  4C2M J;  2HDW A;  4ZC3 A;  2HYF A;  3TO9 A;  4OIN F;  2VBY A;  5DM6 F;  4DZP A;  1KU7 A;  3NEU A;  4G7H F;  1MBE A;  4DW6 A;  3CQZ J;  2V26 A;  2H6B A;  3GTO J;  4G8X A;  5TIS C;  3V4G A;  3HOT A;  1R9T J;  1U0J A;  4DIQ A;  2Z16 A;  1B4A A;  1OJL A;  2FEZ A;  4D5C A;  2YX4 A;  3MWM A;  1MBH A;  5IT9 K;  3B73 A;  2IT0 A;  5DD8 A;  1BIB A;  3V42 A;  1TP4 A;  1QPM A;  1UHM A;  1ZLK A;  1JTX A;  2CU7 A;  3WHC A;  1SMY F;  5IP6 A;  1LKX A;  1MSE C;  1Q1V A;  3WG9 A;  4D7M A;  1CQT A;  3S2D J;  1GV5 A;  2CWE A;  3AG2 H;  4UV9 A;  3B6C A;  2HU9 A;  4P9U A;  2RKH A;  2JT1 A;  3LSK A;  1ZQ3 P;  1JHF A;  4DQ2 A;  4J19 A;  4L18 B;  3IV5 A;  3TOA A;  2BZT A;  3CTA A;  2FJ1 A;  2Q0O A;  4M3B A;  3NWS A;  2CW7 A;  1BA5 A;  2IGN A;  1WJD A;  3V7C A;  3HKZ N;  1LFU P;  2VBZ A;  5K5Q A;  5FKK A;  2HQ5 A;  2IA1 A;  2X9D A;  2MD5 A;  1K78 A;  1A36 A;  1FOW A;  2EIL H;  4DOZ A;  1IZ1 A;  3LNQ A;  4E6K G;  2UV1 A;  4WF2 A;  2Y0S N;  1UB9 A;  3NAU A;  3CF5 F;  2PMZ A;  1R5H A;  1BR2 A;  3OOP A;  2XDV A;  4CDG A;  1WJB A;  4JX6 A;  2ZJP F;  2E1C A;  5KAF C;  1TNT A;  5FD5 A;  1EF4 A;  4V2G A;  3GFL A;  2XPW A;  3Q0W A;  2O61 A;  2DOA A;  1NHA A;  3E3V A;  3LOC A;  2EZL A;  3VPR A;  2UWM A;  2KFD A;  5A2Q Z;  4RDU A;  4HF2 A;  2PFB A;  3K4N A;  4PUS A;  1RR8 C;  3K1M A;  2B9S A;  3HRT A;  4AID A;  2RV8 A;  4UUV A;  2QWW A;  1Z0X A;  3TP0 A;  1S29 A;  2AO9 A;  2RRE A;  4HNU A;  2KRF A;  3ZQF A;  5ILU A;  4QTR A;  3I64 A;  3HSE A;  4YG2 F;  3HOV J;  3MAJ A;  2R5Y B;  1J75 A;  2PQ8 A;  2W85 A;  4RA2 A;  2LTP A;  4M9S A;  4IQ4 A;  1G59 A;  3L2R A;  4N9H A;  4UXN A;  3FXU A;  3RPU D;  1YS6 A;  4U87 A;  1USS A;  1SD5 A;  1OCP A;  2JMW A;  4LJZ F;  3FK7 A;  2KT0 A;  4RM2 A;  3JRG A;  3P9I A;  5K7F A;  3ZN1 A;  5GTI C;  4MLO A;  5HS8 A;  3F23 A;  3M3Y J;  2F5F A;  2RN7 A;  2NVT J;  4CXF A;  1OKR A;  3S3M A;  1HKQ A;  3D0S A;  4PJ0 C;  4YIR X;  1LNW A;  2OAZ A;  5EGO B;  3UKG A;  3M1C A;  2O03 A;  1ZTR A;  3J81 K;  1RZ4 A;  5LHG A;  3HC7 A;  1FEX A;  3VSK A;  1IDZ A;  4BE1 A;  1TBX A;  2J5P A;  2E36 A;  4ZYE A;  2BV6 A;  2KP6 A;  1Z3Y A;  3C2H A;  2F5E A;  1XDS A;  3HIF A;  4DBR A;  4MGR A;  2W24 A;  3QPL A;  1JKP C;  1R71 A;  5FLX Z;  2Z99 A;  2M45 A;  1BN5 A;  1UG2 A;  4RAY A;  2V6E A;  1IN6 A;  1KYW A;  2NAZ A;  2V1D A;  2VKV A;  4B4C A;  1LEB A;  3Q0V A;  2PMZ N;  5L3E A;  1GLN A;  1FIP A;  4D9J A;  5DYM A;  3QOE A;  1ETV A;  4EGZ A;  2VLA A;  2VJ5 A;  3I59 B;  1Y1V J;  5BS6 A;  4FE4 A;  4LGW A;  3M07 A;  2KMU A;  1RKW A;  4G7Z F;  1MMS A;  4DGW B;  5LFA A;  2ZXW H;  2HZD A;  3PIO F;  1NG6 A;  3LSH A;  2IVM A;  3C2B A;  1H9G A;  3J7Z I;  1DPR A;  1P6R A;  5KVR A;  1TWC J;  1W0U A;  1XD7 A;  5DD4 A;  1U5T C;  2K86 A;  1UCR A;  6PAX A;  4LK1 F;  2VC0 A;  1H0M A;  1A31 A;  2LLK A;  4U0Y A;  3SXY A;  3K4L A;  1YJW I;  2KZV A;  3I4P A;  3KP3 A;  2K3P A;  3LSM A;  1MH3 A;  4HA8 A;  4UVB A;  3CCQ I;  4A93 J;  4PGH A;  2MAB A;  3ZMU A;  2Y9Y A;  1P9Q C;  2DK5 A;  3CO7 C;  1O3Q A;  2F5D A;  5HLH A;  4C3J J;  5JLW A;  2IGM A;  2EFN A;  2R7T A;  2BXZ A;  3CDI A;  5IY5 H;  5B1A H;  4L9T A;  1AKH A;  3GTM J;  4LLG F;  2QM3 A;  2F4I A;  3EYY A;  1J59 A;  4A3D J;  5EEH A;  3A0H C;  2UXX A;  2BBY A;  2P6S A;  2X4H A;  3ESW B;  1MBK A;  4RM3 A;  2CQQ A;  1XB4 A;  3QU3 A;  1IRX A;  2H09 A;  1LB2 A;  3G1L A;  5KNL A;  4PJM A;  1UMQ A;  1RI7 A;  2M8E A;  2ELJ A;  2K9S A;  3A0B C;  3BJO A;  4BHB A;  4ZZL A;  3JRB A;  3MKZ A;  4I0A A;  1D5V A;  5M5W J;  1LFP A;  4M3D A;  1HA8 A;  1K79 A;  1WFX A;  4B44 A;  3ASN H;  1I3Q J;  1ZRE A;  5E20 A;  3LWF A;  2XB0 X;  2V7F A;  3IC7 A;  4ESB A;  1Z1D A;  4M71 A;  2MC3 A;  1XX5 A;  3VB2 A;  4BY1 J;  4XN3 A;  3BG3 A;  3CC2 I;  1PP8 F;  3ECO A;  3F6O A;  2VN2 A;  1PUE E;  3BG6 A;  3SEQ A;  2HWV A;  2ISZ A;  4GRI A;  2EIM H;  3TP3 A;  3PSI A;  1Z7U A;  1Y8Q B;  1R5G A;  4KN7 X;  2BOL A;  2ZNY A;  2QQA A;  2QKL B;  3KLO A;  1N25 A;  1W4M A;  4M6Y A;  2XKO A;  2L9S A;  2X1E A;  4D0P A;  3T8R A;  5K5R A;  1U8B A;  1FLI A;  4A3C J;  2OZ6 A;  1FWZ A;  4Q4Z F;  4HYE A;  1O3R A;  5K5O A;  4JX5 A;  2XUB A;  3PM1 A;  3QPT A;  1IN8 A;  9ANT A;  5FKO A;  1UG0 A;  1LDK B;  2IGK A;  3JRD A;  1YIT I;  3PNT A;  3M8E A;  2K27 A;  2DA7 A;  2O5R A;  3PQJ A;  2EV6 A;  2NXN B;  1XGO A;  4FX4 A;  2AQF A;  4FX0 A;  4A69 C;  1QZY A;  4HDV A;  1YTY A;  4XIC A;  2OD5 A;  3BC8 A;  3U2R A;  2CV1 A;  1R4M B;  1VQ5 I;  5FKM A;  2Z9O A;  2ZBK A;  4U7B A;  1IN7 A;  4UHT A;  2K4B A;  2EB7 A;  2E2I J;  1Z67 A;  2JVH A;  2WAE A;  3K4C A;  1E17 A;  4KUM A;  4C3H J;  4A5N A;  2LF7 A;  3O6B B;  4BUP A;  3M8F A;  2VI6 A;  3TDZ C;  3CCS I;  2QBY A;  5J1R A;  3S17 J;  1P7I A;  3OYD A;  5D4R A;  4P55 A;  1U8R A;  5CVU A;  4V2F A;  1CGP A;  1J09 A;  3S14 J;  1MGT A;  4RAZ A;  3C7J A;  3WTY C;  1K7A A;  4KJZ A;  1ENH A;  3GFJ A;  4GYI A;  5ICC A;  2OCE A;  4HF1 A;  1Y0U A;  4E7K A;  2QA4 I;  1QVT A;  1C0W A;  1UFM A;  1GVD A;  2B7E A;  1JKR C;  3FWE A;  1VFC A;  1HDP A;  1W36 C;  5EZG A;  4MFE A;  5F0F A;  2CV0 A;  2P6T A;  4MIM A;  1KA8 A;  2XHK A;  5DCF A;  4Q47 A;  3RI4 A;  2VJ4 A;  2IXS A;  3NWT A;  2R7F A;  3WU2 C;  2O8K A;  2V9P A;  3BPV A;  1WJ5 A;  3OMY A;  2P5V A;  2EPF A;  2DFI A;  1QGP A;  1FYL A;  4MQ9 F;  4FTH A;  3DQV C;  2H27 A;  4BEH A;  2LNB A;  1E2X A;  2F6C A;  1T0F A;  1SAX A;  3B02 A;  1MKM A;  2COB A;  3CES A;  4A6D A;  1V5G A;  3I53 A;  1JKO C;  1H9T A;  2VBX A;  3A01 B;  2BHZ A;  4I2O A;  3GUD A;  4OIP F;  4E7J A;  3WOD F;  2XAF A;  3I55 I;  4I99 C;  1PP7 U;  4BE2 A;  4RGX A;  3WGH A;  1QVU A;  1KGS A;  3RSN A;  2LD5 A;  4DNC A;  1LPQ A;  2PX9 A;  1XMK A;  1X58 A;  2NVQ J;  1KQ0 A;  2HGC A;  2DOE A;  2DDA A;  2STT A;  4BJ5 C;  2R5Z A;  3RTR A;  3HTU A;  2BY2 A;  2XRO A;  3Q9V A;  2BVL A;  4C2T A;  5HLI A;  2RAE A;  5J4Y A;  3K0L A;  3HOS A;  3QWL A;  1ZGW A;  4XKC A;  3KZY A;  2DN0 A;  1U3E M;  3EDP A;  4ZJZ A;  5LD2 C;  2V6C A;  2BYV E;  4PK4 A;  2D45 A;  2R7X A;  4Y52 J;  3BY6 A;  3I58 A;  1W5C C;  1VQM I;  2K3F A;  1ZR4 A;  1PYV A;  2QBY B;  1GHC A;  4BQO A;  4W1U A;  3OV8 A;  3FMS A;  2XAQ A;  3VYS B;  1N75 A;  3TGN A;  1XCB A;  5FFX A;  3HZJ A;  1J5Y A;  2CSO A;  1RR7 A;  1X1D A;  4IZZ A;  1SAN A;  2FOK A;  4OU0 A;  3KEY A;  4ZZD A;  3KEQ A;  5IYD J;  1JGG A;  2JPB A;  2LKX A;  2AHQ A;  1SC7 A;  3ZQG A;  4EV0 A;  1SEU A;  1B9M A;  3QOP A;  4IRH A;  4J00 A;  1JUS A;  3S16 J;  1DGW Y;  4G6D A;  2L2O A;  2DFF A;  2ZME C;  4WXD A;  3JRF A;  3I5U A;  5JLX A;  3TQN A;  1ULY A;  4A5M A;  5D5W B;  4AC0 A;  1R1U A;  2W57 A;  2L01 A;  4R8H A;  2KZG A;  3H36 A;  4EJW A;  3GZ5 A;  5L3B A;  1Y1W J;  2ETH A;  3ABK H;  5E3L A;  1WJF A;  4LG0 B;  2W82 A;  4TV7 A;  2DQL A;  3BQZ A;  4BU2 A;  5E1W A;  2CJJ A;  4IJA A;  5M3M J;  1SVM A;  3R6S A;  2IS4 A;  1XGS A;  4F92 B;  4ASN A;  3H5A A;  1RNL A;  2RDP A;  5LBQ A;  2NS0 A;  2GWR A;  5CYV A;  4FHT A;  2GQQ A;  3ZQ7 A;  3LSR A;  3DTI A;  3HGG A;  1LEA A;  1U2W A;  3I4N J;  2VJI A;  1OCC H;  4BJ6 C;  3WTT C;  5J40 A;  1F1Z A;  1ZH5 A;  1A6Q A;  3QYF A;  4WXH A;  3V7R A;  4I09 A;  3OYH A;  4BBR J;  3WE3 A;  2K4J A;  2CUZ A;  2JSC A;  4F7Z A;  1ERD A;  3ZQC A;  3DKY A;  3GLX A;  3ZQI A;  1P4A A;  2PJR B;  2JN6 A;  2ZC2 A;  4L5E A;  3L2Q A;  1U6G A;  3PFI A;  4C30 A;  2N8G A;  1S9H A;  2V9V A;  3QYE A;  4KNY A;  2LKP A;  4A3I J;  5DCM B;  1OPC A;  2DT6 A;  3E0J B;  3ONQ A;  3GTJ J;  4U0V A;  1TWG J;  4ZDO A;  2R3S A;  2NNN A;  1IW7 F;  5J1Y A;  2RGV A;  1YW8 A;  2XB5 A;  4ESJ A;  2WB1 N;  1H89 C;  4XLH A;  2QQB A;  3K7A J;  4ZYG A;  2E71 A;  3JRC A;  1W5T A;  5JVG F;  3GZ6 A;  1SD4 A;  1AU7 A;  2K7L A;  3J80 Z;  4N4O B;  1APL C;  3KYC B;  4ABZ A;  1IXS B;  2GA2 A;  4DZJ A;  3G6E I;  1OFC X;  4XLC A;  1U5T A;  4GYG A;  5LGT A;  3VWB A;  2ZCW A;  3L2V A;  4JX4 A;  4CYD A;  2XAJ A;  2UZK A;  1BR4 A;  2V4J C;  1STZ A;  1K4S A;  1F43 A;  2L54 A;  1S7A A;  5H6R A;  1QPI A;  4PSX A;  2X48 A;  3FBN B;  3CDH A;  3DTE A;  2FD5 A;  1D0Z A;  4HX7 A;  4E4H A;  1LJ9 A;  3GW2 A;  3HPG A;  2R5Z B;  2HNH A;  3FF5 A;  3K4K A;  5AIQ A;  2LY9 A;  1EH8 A;  2JUG A;  3E6C C;  4I01 A;  1K83 J;  5L3G A;  1G3Y A;  1AOY A;  1OYW A;  5BNG A;  1ZG3 A;  4YFN F;  2Y9Z A;  1XTA A;  3P5J A;  1DU0 A;  2F5V A;  3PQK A;  2DYR H;  4ENJ A;  4GXO A;  1HC8 A;  1BJZ A;  3BJA A;  5E8I A;  4H4K C;  1IV8 A;  3DXJ F;  4A3K J;  4IHY A;  1TW3 A;  3DTK A;  3TL4 X;  4FCY A;  2YR2 A;  4QWQ A;  2IGO A;  1I39 A;  3OIO A;  1EH6 A;  2EK5 A;  2XPV A;  3H5N A;  1TLH B;  3GTL J;  2I5U A;  2IA2 A;  2HEO A;  2BHY A;  1WGX A;  5J4V A;  2EV0 A;  4IOA F;  4RB3 C;  4CH7 A;  1TWH J;  4OOI A;  5FRM A;  2EA4 A;  4HQM A;  4ZH4 F;  2ZNZ A;  4NB5 A;  3ZP5 A;  1OR7 A;  2XF5 A;  3HKZ A;  2XAG A;  2XRL A;  1HW5 A;  1TNS A;  4II2 A;  2R7R A;  1BIA A;  3GTK J;  2M0M A;  3GME A;  2OUM A;  2Y0M A;  1JTY A;  1JJ6 C;  2GXA A;  3CCE I;  1TT5 B;  3HOZ J;  3BCB A;  3K1N A;  3WE2 A;  1O57 A;  1JKQ C;  2DA3 A;  2B0L A;  2BY1 A;  4LG0 A;  4KFC A;  3M8J A;  4ITV A;  4KIF A;  5DCM A;  1ZGJ A;  2QVO A;  4I6Z A;  2DO7 A;  3S2H J;  4F93 B;  2LY2 A;  3HYI A;  2KIQ A;  3K70 C;  1QA6 A;  4IOC F;  2MC4 A;  4S05 A;  1BL0 A;  1OR7 C;  2PBI A;  4MQV A;  3SZG A;  1OMI A;  2LMD A;  1YO5 C;  5F64 A;  1P4W A;  5C4J J;  1TT0 A;  2FNA A;  5HNF A;  1WH7 A;  1BBY A;  3VYU B;  4YII A;  2FRH A;  5FKL A;  1A5J A;  5J1U A;  3U1K A;  1KYZ A;  4CZZ A;  3DEU A;  3IWZ A;  2TRT A;  2XRN A;  4ZTJ A;  2OQG A;  3ABU A;  1YRN B;  2PMU A;  4E7Z A;  4F91 B;  3JRI A;  1WQ2 A;  3WTX C;  1ZRC A;  3K69 A;  2M7B A;  4HNV A;  3FMR A;  4XKW A;  3BR0 A;  1V4R A;  2M9H A;  4YFK F;  3BG7 A;  1DGR M;  4BH9 A;  4O5V A;  1YW7 A;  2VKE A;  5LLQ A;  3GX4 X;  1MMN A;  3DWL E;  2KHM A;  2M5W A;  1IN4 A;  1W7P B;  1R23 A;  3Q9S A;  3ROU A;  3BP8 A;  2EIN H;  3HOX J;  3H0G J;  1Y56 A;  2CH0 A;  2YX7 A;  2P7C B;  4NQW B;  3AKZ A;  4HBL A;  5E3O A;  4M6X A;  2X1D A;  2LBF A;  3MZH A;  1WCM J;  4XQF A;  2YUS A;  5IP9 J;  2XV4 S;  2UUZ A;  4XBF A;  3K4B A;  1TTY A;  3KZZ A;  3W6V A;  2GOX B;  3FXQ A;  1XMX A; 
#chains in the Genus database with same CATH homology
 4A3D J;  3DEW A;  1WI3 A;  1OCT C;  2E19 A;  1I50 J;  1XC5 A;  4BY7 J;  2ID3 A;  2JA5 J;  1MBK A;  1PUF B;  2CQQ A;  2OPT A;  1IGN A;  3BR3 A;  3G1L A;  2ME6 A;  1UMQ A;  3BT9 A;  4A3M J;  1HF0 A;  2K9S A;  2DMQ A;  5EEA A;  1LE8 B;  1IRZ A;  3JRB A;  4XRS A;  2M0C A;  5IYB J;  5M5W J;  1Z77 A;  4IEJ A;  4M3D A;  4C3I J;  4QIW N;  3BQY A;  3CDL A;  5IOY A;  5EF6 A;  4UUT A;  1JUP A;  1I3Q J;  3BTL A;  3G1O A;  3RKQ A;  2DJN A;  1VI0 A;  2H8R A;  2XPU A;  2DMP A;  5F04 A;  2HXO A;  1JJ8 C;  2XB0 X;  5IYC J;  1IUF A;  3FIW A;  2YU9 J;  4BY1 J;  3MKL A;  3O8G A;  2MGQ A;  3BG3 A;  2NS7 A;  1ETK A;  2JJ7 A;  1WH5 A;  3LSJ A;  4QSH A;  3TP3 A;  2DTZ A;  1ETX A;  1FTZ A;  4M3G A;  2WAQ N;  1GDT A;  1H88 C;  4FIS A;  2R5Y A;  2TCT A;  4A3G J;  1U8B A;  1VF9 A;  4XID A;  5E3N A;  4A3C J;  4CYC B;  2E2H J;  2L0K A;  4JX5 A;  3PM1 A;  4S0H B;  1GV2 A;  5EG0 B;  9ANT A;  5FKO A;  3JRD A;  4B1R A;  2DA7 A;  3M4O J;  4DYQ A;  2ELK A;  3FKI J;  2HOS A;  2LR8 A;  4I76 A;  1YRN A;  4A69 C;  1ORK A;  2KDZ A;  2ID6 A;  5C3E J;  2EZI A;  1GT0 C;  2EZK A;  2M2E A;  4XIC A;  2HXI A;  4LOC A;  5FKM A;  2XGC A;  2E2I J;  1TWA J;  3H3V K;  4C3H J;  2DMN A;  3HOW J;  5DTD A;  2ECC A;  1U9O A;  2EQR A;  3JRA A;  2HDD A;  4M3F A;  2VI6 A;  5J1R A;  3S17 J;  1F36 A;  1P7I A;  2M34 A;  3BG9 A;  4V2F A;  3S14 J;  2JA7 J;  2EH3 A;  5M5Y J;  1WPK A;  2G0E A;  4DYC A;  3Q0U A;  5E3M A;  1ENH A;  3OSF A;  1RES A;  3BR2 A;  2JK3 A;  5HOD A;  2DA1 A;  1JUM A;  1XG1 A;  2LP0 A;  3BR1 A;  1TWF J;  1QVT A;  3SFI A;  1P7J A;  3MVP A;  5F27 A;  3S1R J;  1GVD A;  1B72 B;  2DA5 A;  1JKR C;  2LK2 A;  1VFC A;  1HDP A;  5EZG A;  4MFE A;  5F0F A;  2LVS A;  1I6H J;  1MBG A;  4XRM A;  1ETQ A;  1NTC A;  4MIM A;  3OSG A;  3GTP J;  1QRY A;  1NK2 P;  4G12 A;  4Y7N J;  4IHW A;  5GP9 A;  2O8K A;  2O9L A;  3RZO J;  5F08 A;  1IJW C;  1BW5 A;  3RQI A;  2K40 A;  1MBJ A;  2I10 A;  4FTH A;  1ETW A;  1ZKG A;  4W97 A;  2D5V A;  2MG4 A;  3BTC A;  3MN2 A;  3LSG A;  3BR5 A;  2MSY A;  4M6V A;  5IP7 J;  2HYJ A;  4JP0 A;  2COB A;  2CQX A;  1JKO C;  4A3F J;  2DMT A;  3A01 B;  2DMU A;  1PUF A;  5FLM J;  1MSF C;  1ZR2 A;  5J3L A;  4JYK A;  3SDG A;  5EZH A;  4D7N A;  1HCR A;  2H1K A;  1RET A;  4EEF G;  1H8A C;  3IH2 A;  1QVU A;  5GPC A;  2M8G X;  5F0C A;  2LD5 A;  2K9N A;  2DA2 A;  2HOA A;  3GBG A;  3O8H A;  2NVQ J;  1X58 A;  3CCY A;  1XS9 A;  2P81 A;  5IOZ A;  2JA6 J;  4XRS G;  2R5Z A;  5C4X J;  5M5X J;  3L1P A;  2R0Q C;  2FX0 A;  2RAE A;  4AYB N;  1AHD P;  3S1M J;  1ZGW A;  2XSD C;  2DN0 A;  1U78 A;  4RBO A;  1MH4 A;  3Q3S A;  2NVY J;  1S7E A;  3ZQL A;  3E7L A;  2R93 J;  4Y52 J;  2X6O A;  2IAI A;  1X2N A;  4DYR A;  1T56 A;  2LFB A;  1ZR4 A;  4A3J J;  4B3A A;  2R7Z J;  3CMY A;  4W1U A;  1ITY A;  4A3E J;  1U9N A;  2ECB A;  1RR7 A;  1SAN A;  5IYD J;  1JGG A;  2LKX A;  2NVX J;  2AHQ A;  3DCF A;  1LE8 A;  1ETY A;  3ZQG A;  2QCO A;  3HGY A;  3NAR A;  1JT6 A;  1JUS A;  1ETO A;  2O7O A;  3S16 J;  4A3B J;  3JRF A;  2R92 J;  5JLX A;  3JRH A;  4BKX A;  3D1N I;  4AC0 A;  5M3F J;  2ZB9 A;  3HM5 A;  4BXX J;  3HOU J;  1SFO J;  1HLV A;  1Y1W J;  1G2H A;  3QPS A;  5E3L A;  4C2M J;  3BQZ A;  2CJJ A;  5M3M J;  5F0H A;  1B8I B;  4XK4 A;  4DZP A;  1IC8 A;  2Y31 A;  2E2J J;  1MBE A;  4DW6 A;  1HDD C;  3CQZ J;  2EBI A;  3GTO J;  4UUS B;  2JWT A;  1R9T J;  3LSR A;  4IHX A;  1RPW A;  3HGG A;  3I4N J;  1OJL A;  4D5C A;  1MBH A;  3FIS A;  3F0C A;  2L9R A;  3JR9 A;  4BBR J;  3ZQC A;  3ZQI A;  2JN6 A;  1JTX A;  2CU7 A;  4L5E A;  3WHC A;  3OOU A;  1X2M A;  2E1O A;  5IP6 A;  1MSE C;  2EZH A;  1Q1V A;  4D7M A;  1CQT A;  2N8G A;  1E3O C;  1GV5 A;  3S2D J;  3PO2 J;  2CUE A;  3B6C A;  3G1M A;  1ZQ3 P;  1POG A;  3BR6 A;  4A3I J;  4J19 A;  3S1Q J;  4FE7 A;  3IV5 A;  3TW6 A;  3GTJ J;  2FJ1 A;  1TC3 C;  5FLV A;  4M3B A;  1TWG J;  5FKN A;  1BA5 A;  1AKH B;  5J1Y A;  3HKZ N;  2XB5 A;  1LFU P;  1B8I A;  2GM4 A;  3S1N J;  2WB1 N;  5FKK A;  1H89 C;  2HQ5 A;  2X9D A;  1B72 A;  3K7A J;  3B6A A;  3RZD J;  3JRC A;  3LNQ A;  2Y0S N;  3IH4 A;  1IDY A;  3NAU A;  1AU7 A;  2QF7 A;  5GPA A;  1JT0 A;  3JRE A;  4ABZ A;  1APL C;  4BBS J;  4DZJ A;  1HOM A;  1OFC X;  3PO3 J;  2XGE A;  5C44 J;  4JX6 A;  4JX4 A;  2W48 A;  3BTI A;  1EF4 A;  4V2G A;  4CYC A;  2XPW A;  3Q0W A;  1F43 A;  1QPI A;  3VPR A;  2L7M P;  3LOC A;  2EZL A;  2X48 A;  5EYR A;  3ZQH A;  3K2A A;  4RDU A;  2DA6 A;  2FD5 A;  4M3E A;  1LFB A;  1O4X A;  2R5Z B;  4X1E A;  2LY9 A;  1K83 J;  1GUU A;  1Z0X A;  1RKT A;  3TP0 A;  1BW6 A;  5BNG A;  2B63 J;  3I4M J;  2AO9 A;  2Y9Z A;  3BG5 A;  3ZQF A;  1DU0 A;  3A01 A;  2Y2Z A;  4QTR A;  2FQ4 A;  2ME0 A;  3HOV J;  2L7F P;  4IHV A;  2MW8 A;  2R5Y B;  1BJZ A;  2LTP A;  4A3K J;  4IHY A;  2DA4 A;  1OCP A;  4FCY A;  1K61 A;  1DU6 A;  2VUM J;  1W0T A;  2JMW A;  3HEF A;  3S15 J;  2HOT A;  1ZK8 A;  3FK7 A;  2KT0 A;  3JRG A;  1A6I A;  3OIO A;  3WHB A;  2XPV A;  4D5F A;  5K7H A;  5K7Z A;  2IEK A;  4NDL A;  3GTL J;  5K7F A;  1WGX A;  4MLO A;  3SJM A;  1TWH J;  5EGO A;  2JA8 J;  3M3Y J;  4UUS A;  3HB9 A;  2NVT J;  4AUX A;  3A02 A;  3ZOB A;  2XRL A;  1FIA A;  3QQA A;  5EGO B;  3UKG A;  3GTK J;  1ZTR A;  1JTY A;  1JJ6 C;  4A3L J;  2NOG A;  1MBF A;  1FEX A;  3HOZ J;  1IDZ A;  1JKQ C;  2DA3 A;  1NK3 P;  2WV1 A;  5IPA A;  3QPL A;  4I6Z A;  1JKP C;  3HDD A;  3S2H J;  5EG0 A;  5FJ8 J;  1UG2 A;  2VKV A;  4B4C A;  3Q0V A;  2PMZ N;  2K9Q A;  1BL0 A;  1FIP A;  1ETV A;  2L7Z A;  5C4J J;  1IV6 A;  5DS9 A;  3HOY J;  1WH7 A;  1Y1V J;  4MFD A;  4FE4 A;  3TW7 A;  2GLO A;  2VPR A;  5FKL A;  1A5J A;  2IBD A;  4MO7 A;  5J1U A;  1RKW A;  2TRT A;  2YS9 A;  3TED A;  1IG7 A;  1YRN B;  2HI3 A;  5EDN A;  3C2B A;  3JRI A;  3GTQ J;  3FK6 A;  4HNV A;  1FTT A;  3BR0 A;  2M9H A;  1TWC J;  1W0U A;  2VKE A;  2GBY A;  2NS8 A;  2XGD A;  4GFB A;  3GTG J;  1T33 A;  5F1J A;  2Y30 A;  2CRG A;  2LLK A;  1UHS A;  1D5Y A;  2OF7 A;  3HOX J;  3LSP A;  3IH3 A;  3H0G J;  1MH3 A;  4A93 J;  5E3O A;  2Y9Y A;  1VND A;  3HBL A;  1WCM J;  2YUS A;  3BTJ A;  5IP9 J;  4C3J J;  5JLW A;  3A03 A;  4X6A J;  2CUF A;  1FJL A;  3W6V A;  3GTM J;  1AKH A;  1MNM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...