1IDZA

Structure of myb transforming protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idzA00
1U78A 2CU7A 2X6OA 3IH3A 2IAIA 5IYDJ 1BL0A 3HOXJ 3FK6A 3G1MA 1JKPC 1ETYA 5FKMA 2IEKA 3Q3SA 2R5YA 2DMPA 1MNMC 5EF6A 1VF9A 1JUSA 1AKHB 2RAEA 1IDZA 5K7FA 2O8KA 2NOGA 4DYQA 4B3AA 3Q0UA 3BT9A 3FK7A 4BY1J 3CMYA 1XC5A 2O7OA 2JJ7A 3IV5A 1CQTA 1MSEC 4CYCA 3S17J 3GBGA 1ETQA 1T33A 1RKTA 3E7LA 1Y1WJ 4MLOA 3HGYA 1ETKA 1IGNA 5EG0B 1ITYA 1MBEA 2DA2A 2NS7A 3S16J 2FQ4A 3I4NJ 4UUTA 2O9LA 2KDZA 3BR0A 3GTGJ 3ZQIA 3GTQJ 1Z77A 2DMNA 2HOAA 4GFBA 3L1PA 2NVQJ 2E1OA 4UUSB 1D5YA 4FE4A 2VPRA 1ORKA 2CQQA 1FIPA 5GPAA 4Y7NJ 1HDPA 1H8AC 3BR6A 5IP6A 2D5VA 3LSPA 2X48A 3CDLA 3H0GJ 2CUFA 2HDDA 2NVXJ 5EZGA 3B6AA 2DJNA 2QCOA 3HM5A 2G0EA 2QF7A 1ZK8A 1YRNB 2R92J 2NVYJ 2PMZN 5IYCJ 3A01B 4M6VA 5JLXA 4L5EA 5GPCA 4XRMA 1IJWC 4JYKA 5K7HA 1ZGWA 4S0HB 2WB1N 2DMTA 1P7JA 2JA6J 3ZQFA 2HI3A 4A3EJ 3BTCA 3S14J 1OJLA 4V2FA 3SFIA 5J3LA 1IRZA 2X9DA 2EH3A 2M2EA 2Y2ZA 3GTJJ 2DA4A 1MH3A 5DTDA 2K40A 1LFBA 5F04A 4RDUA 2E19A 2MGQA 1HDDC 3M3YJ 3LSRA 4A93J 1TC3C 4A69C 4D7MA 4D7NA 1X2NA 2EZLA 1HCRA 3S2HJ 1VI0A 4XRSA 2HYJA 2JA5J 1Y1VJ 1WGXA 2GBYA 1QVTA 1JT0A 3PM1A 1GDTA 2HOSA 2DA7A 4M3BA 3SJMA 3ZQCA 5HODA 3UKGA 2MG4A 1S7EA 1O4XA 5C3EJ 3GTLJ 5F0HA 2DA6A 4A3DJ 3HB9A 5FKOA 4ABZA 2CUEA 3DCFA 4V2GA 2JA7J 3GTPJ 3NARA 2L7MP 1JUMA 3JRIA 3BG3A 1JTYA 4AUXA 1BJZA 1I6HJ 1F36A 1FTTA 3JRHA 4A3GJ 5F0FA 2R5YB 4A3LJ 2YUSA 3TW6A 3BTIA 4FTHA 2DA1A 1Q1VA 2W48A 2EQRA 3HOYJ 3BTLA 3QPLA 1A5JA 2DTZA 3WHBA 4QIWN 3BG9A 2YS9A 1TWGJ 2VI6A 5EGOA 2ME0A 5EZHA 4M3FA 4A3KJ 4M3GA 1PUFB 3BQZA 5E3LA 2ID3A 4NDLA 2DN0A 4X6AJ 3MVPA 3IH2A 4A3JJ 3Q0VA 1K61A 5M3FJ 4IHYA 3BG5A 1RPWA 2M34A 1WCMJ 1LFUP 1HOMA 4C3HJ 1NK3P 3ZQHA 1AU7A 1AKHA 2XPUA 1WI3A 2K9QA 2M8GX 4QTRA 5IYBJ 3JR9A 3M4OJ 1TWHJ 2AO9A 5FKNA 1TWFJ 2LR8A 1ZR4A 3LSGA 1I50J 1QRYA 2I10A 1XS9A 4FISA 1LE8B 4AC0A 1ZKGA 3DEWA 2R5ZB 3GTMJ 3HKZN 4FCYA 2XPWA 3F0CA 2DMQA 3NAUA 2ID6A 3K2AA 1TWCJ 2R93J 5E3MA 1GT0C 1IG7A 1XG1A 4DYCA 1POGA 3HOZJ 4I76A 2HXIA 4UUSA 1A6IA 3G1OA 3QQAA 3JRCA 3JRGA 4M3EA 2EZKA 4Y52J 2XGEA 1JKQC 3K7AJ 4BBRJ 4A3IJ 4A3BJ 1MBFA 4W1UA 3SDGA 1T56A 1P7IA 1OCTC 2Y9ZA 1WH5A 3HDDA 2VUMJ 4DYRA 1MBGA 2L7FP 1K83J 5FKKA 1GUUA 3RZDJ 3W6VA 2WV1A 1OFCX 1RKWA 1X2MA 4C2MJ 5IPAA 5J1YA 4W97A 5JLWA 5F08A 3A01A 1ZTRA 3G1LA 1UG2A 1UHSA 3BR5A 4EEFG 5M5YJ 1MH4A 2LK2A 2ECCA 3ZQGA 1H89C 5M5WJ 3FIWA 1B72A 2OPTA 2JWTA 4RBOA 4D5CA 1GV5A 2L9RA 3PO2J 1U9NA 2M9HA 1G2HA 1JT6A 1MBHA 4JP0A 3S1RJ 1ETVA 3HEFA 4XRSG 2Y30A 4A3FJ 5M5XJ 2LTPA 2VKEA 3Q0WA 4B4CA 2LP0A 9ANTA 2MW8A 3LNQA 2GM4A 3GTOJ 1FIAA 3OIOA 3TW7A 3TP0A 1JJ6C 5J1RA 3BQYA 2XPVA 2HQ5A 1BW5A 4IEJA 3FISA 4MFEA 1IC8A 1UMQA 3BTJA 1B8IA 5IP7J 1EF4A 2P81A 1GVDA 2LLKA 1JTXA 2VKVA 4G12A 4X1EA 3TEDA 4DW6A 4XIDA 5C4JJ 2XSDC 1ETWA 4DZJA 2MSYA 3MKLA 1JJ8C 4MIMA 4DZPA 2JA8J 3IH4A 5EGOB 2B63J 3RZOJ 5EDNA 1RR7A 5IP9J 3ZQLA 1FJLA 2K9SA 4CYCB 2E2IJ 2COBA 1H88C 2L0KA 5IOYA 5J1UA 2DA3A 2H1KA 2ZB9A 4JX6A 3ZOBA 3QPSA 1BW6A 4QSHA 1W0UA 3BR3A 2XGCA 4BKXA 2M0CA 1R9TJ 5FLMJ 2EZHA 2DMUA 1ETOA 3HGGA 2FJ1A 5F0CA 2IBDA 3O8GA 2ELKA 5FKLA 2KT0A 1QPIA 4BXXJ 1RETA 3BR2A 4JX5A 5IOZA 1PUFA 2K9NA 4IHVA 4XK4A 2JK3A 3RQIA 4D5FA 2HOTA 2XB5A 2WAQN 4C3JJ 3TP3A 4A3MJ 1IUFA 5F1JA 3H3VK 2JMWA 3OOUA 2JN6A 5EG0A 4XICA 5FJ8J 1W0TA 3D1NI 3GTKJ 3S1MJ 1HF0A 2LVSA 1JUPA 4C3IJ 1SANA 3O8HA 1E3OC 3HOVJ 1MBJA 1WPKA 3B6CA 3C2BA 5BNGA 3JRDA 5FLVA 2NVTJ 3HOUJ 3HOWJ 2EZIA 3I4MJ 4MO7A 3CQZJ 1GV2A 1F43A 5C4XJ 2TCTA 2LY9A 1MBKA 1LE8A 1NK2P 2R5ZA 5E3OA 2TRTA 1HLVA 4IHXA 1FTZA 2XB0X 3A02A 5E3NA 1Z0XA 3LSJA 3WHCA 2YU9J 1X58A 2LKXA 5GP9A 2ECBA 1DU6A 2Y9YA 3JREA 1I3QJ 1YRNA 5EEAA 2NS8A 1OCPA 2R7ZJ 4A3CJ 4LOCA 3JRBA 2E2HJ 1MSFC 3S15J 5F27A 1B72B 1IDYA 1JGGA 4I6ZA 2XRLA 5EYRA 1RESA 4B1RA 1BA5A 1ENHA 2FD5A 1AHDP 4AYBN 4BBSJ 5M3MJ 1DU0A 2FX0A 3S2DJ 1IV6A 2XGDA 4JX4A 3OSGA 1FEXA 3HBLA 1JKRC 1U9OA 3FKIJ 3LOCA 2DA5A 2AHQA 2E2JJ 2OF7A 3S1QJ 3VPRA 5C44J 3MN2A 2L7ZA 4BY7J 4FE7A 1B8IB 3PO3J 2CQXA 1TWAJ 3JRAA 1U8BA 1VFCA 2Y0SN 4MFDA 3BR1A 1APLC 2LD5A 2ME6A 2HXOA 4IHWA 3S1NJ 5K7ZA 2CJJA 1ETXA 1QVUA 2GLOA 1WH7A 2EBIA 1SFOJ 2LFBA 2H8RA 1VNDA 4J19A 3RKQA 1NTCA 2CRGA 3CCYA 3JRFA 4HNVA 5DS9A 1ZR2A 1JKOC 3OSFA 2Y31A 2R0QC 3A03A 4M3DA 1ZQ3P 2N8GA
chains in the Genus database with same CATH superfamily
1U78A 2VOPA 3RJPA 5IYDJ 2H6CA 2E5ZA 2M5WA 3G1MA 1JKPC 2NAZA 2IEKA 3PSFA 3MKZA 1MNMC 1R23A 1V54H 1AKHB 2XF6A 1O3SA 2IGNA 5AIQA 2NOGA 4KNYA 4PSXA 3IUOA 2Z9OA 1IN7A 1HW5A 5LRRA 3FXRA 2CSOA 3CJTB 1XC5A 2JJ7A 1D3YA 1CQTA 1IUYA 4CYCA 4G6QA 3HC7A 3KLOA 1VQOI 1T33A 5BPIA 2XAJA 1RKTA 2M7AA 2Z16A 4PSWA 5DM6F 3WTYC 3QYEA 3NRVA 4C2TA 4L5JA 3IC7A 2OZUA 4UV9A 4CCKA 2Q1ZB 3FXLA 4YELA 1FPQA 2HNHA 2LF7A 2OCCH 5ICEA 3GX4X 2CQKA 3B73A 1FOYA 1TT0A 3GTQJ 4GFBA 2HOAA 2K4JA 1K4TA 2NVQJ 4I98B 1DGWY 1D8JA 1TQMA 5CQEA 3GCMA 3K4KA 4FE4A 2HGCA 1R7JA 1IRFA 4HX4A 2CQQA 5CVVA 5BPDA 5KVRA 4WXDA 1H8AC 4RM2A 2FNPA 2QGUA 2D5VA 5CVRA 2OC6A 3CDLA 3H0GJ 3SXYA 1XN7A 3GEZA 2X0LA 4BUPA 5D5XB 3KYDB 4I0BA 5LHGA 1WJCA 3I59B 2XHKA 2QF7A 1WQ2A 3WTVC 4JQFA 2VE8A 2LNBA 3IL2A 5HLHA 1LPQA 3CO6C 5GTIC 3HYIA 3LL7A 2AXLA 3LFUA 5IYCJ 1WFXA 3QPTA 4WXCA 4L5EA 1WJFA 5CYVA 3OYHA 1YX3A 2KKOA 3VWBA 5ILSA 2JA6J 1FNNA 2HI3A 4KN4X 4A3EJ 1D5VA 3CESA 1F5TA 1T95A 1JXSA 1NG6A 4V2FA 4AU7A 3V7RA 3FHNA 4CZCA 1CGPA 1J2XA 1IRZA 2ADUA 2EH3A 3HPGA 3HXLA 3HKZA 2ISYA 2JVGA 2YR2A 1ZARA 3HHHA 2QZ8A 1MH3A 4H4KC 3OYJA 2KIMA 5DTDA 3CJNA 5DUKA 3EUHA 4BQOA 3GFIA 4YFKF 3LA3A 3CF5F 2MGQA 4LITA 4A0YA 4A69C 1D8KA 4CICA 4D7MA 3F6VA 4BE0A 4E7KA 3AKZA 1HCRA 3BOQA 3TOAA 4Z6YA 5K5OA 2MH2A 5LGUA 5BMZA 2HYJA 1BC7C 1Y1VJ 1S3JA 2A05A 3J80Z 1LB2A 1JT0A 1GDTA 2HOSA 4PJ0C 2F6CA 2EFOA 1P4WA 4CZZA 2O8XA 5HLTA 4IOCF 2FE3A 5D4SA 5ILUA 3UKGA 2Y69H 3KP5A 4L9VA 1O4XA 2EIKH 2VQLA 3GTLJ 2HQRA 4A3DJ 5FKOA 4ABZA 4R79A 3KX2A 2OAZA 1ERDA 3FDYA 3GTPJ 2XF5A 3NARA 1R4NB 3CJQB 4AUXA 5J4VA 2RGVA 2BW3A 2HS5A 3H1CA 1F36A 1FTTA 2FA5A 2L54A 1SFXA 5F0FA 3OYNA 3K4NA 2RQQA 1WHUA 5FFXA 2K7LA 3CUQA 3CTAA 4E6KG 5CVIA 2QSGX 2QUFA 3FBNB 2H1LA 4XLHA 3BTLA 4BXUA 2LKPA 1A5JA 2KJCA 3MWMA 1TWGJ 5EGOA 5EZHA 2Y48A 4RAFA 3T5XA 3V8JA 4ON0A 3BQZA 3RYPA 3I3LA 5E3LA 2DN0A 1VQ8I 1V5EA 2V9PA 4UV8A 3ERED 2CUJA 3ZMTA 2M34A 2BYVE 1HOMA 5DYMA 4C3HJ 1NK3P 1X4OA 1BJAA 3SQNA 1AKHA 5IT3A 3CDIA 3G4SI 4P1WA 4L0YB 3HRUA 2W57A 5IYBJ 3CC7I 4O3MA 4HBLA 1V5FA 3JR9A 1J75A 1REPC 3OL4A 5GADJ 2RREA 1PUEE 1OKRA 5KCMA 3SEZA 4PFPA 3LSGA 1IZ1A 3QOPA 1XS9A 3MKYB 3TMOA 1LE8B 2DYSH 3HKZN 3AG2H 4UUVA 4MQVA 2HZDA 2E5NA 5DM7F 1O3RA 1FZPB 3GWZA 2V9VA 3CLQA 3EQLF 3VYUB 4ZDLA 4PDKA 1ZH5A 4P55A 2F5FA 5GAEJ 1POGA 3RQ4A 4HA8A 5J4YA 5L3FA 3MMYB 3L2RA 1R1UA 1P2FA 1A6IA 3G1OA 1A31A 1U5TB 2VJ4A 4M3EA 3DPLC 3UR3C 5FGMA 1JKQC 2EWNA 4BBRJ 2P5VA 5CQGA 2M45A 2E34A 3L2VA 2A68F 3M8FA 4KMUX 5L3CA 3KP4A 3C1DA 3SDGA 1OCTC 1WH5A 3RCOA 3H9JA 3REOA 4BQNA 4DYRA 4ZZLA 2WAQA 3I59A 2V1XA 3K4JA 2IS1A 1GUUA 2YX4A 1Y0UA 3DV8A 4YIIA 5EEGA 1EKEA 1X2MA 4B43A 3N05A 5IPAA 2J5PA 3IWZA 1ZTRA 3G1LA 5ICCA 2ZBKA 4RGXA 1UHSA 2O5RA 4KN7X 3CP8A 2JWTA 2ZXJA 3PO2J 5JVGF 2M9HA 1G2HA 1LEAA 1MBHA 5DCMA 4IQJA 1ETVA 1E3PA 2Y30A 2FEZA 4B47A 2KIFA 4B4CA 1MJBA 2LP0A 4FX0A 4KITB 2JUCA 4RB1A 3WU0A 2DFEA 2LF8A 2NNNA 4LB6B 4MEYF 1FIAA 3OIOA 4L9NA 2FBIA 3TP0A 4N4NB 4BU2A 5J1RA 2XPVA 4BJTA 5J8CA 1OYYA 2RN7A 2Z5UA 2PBIA 4IHTA 2VJ5A 4MFEA 2HOEA 1IC8A 2VT2A 3OWTA 5K1YA 5IP7J 2PN6A 2HFHA 3HL2A 2P81A 5CJ9A 2LLKA 1MMSA 1OR7A 3RIRA 3O6BB 4OAZA 4DW6A 2WC2A 4IKFA 2VODA 4WK8F 3V8LA 3V7SA 5JHFA 4ZYHA 1JJ8C 2JA8J 2D1HA 3IH4A 3RZOJ 3QWLA 3KYLA 1RR7A 4EJTA 2R7VA 3OS2A 1SD7A 2M87A 2RQPA 2A69F 3F72A 1VQLI 5TRDA 4HLYA 5L3DA 2XV4S 5CKTA 5CVUA 5HDNA 2XAUA 2ZMEC 3H35A 2KL4A 2ZB9A 5LGNA 4ZDOA 2E60A 4FQGA 3J81K 1Y56A 4MTDA 4EJUA 3BR3A 4BKXA 1OCCH 1YS6A 1ETOA 3IWFA 1PVEA 2FJ1A 2Y75A 2KDOA 4DBQA 1S7AA 3IHUA 1RETA 3BR2A 1L3LA 4GXOA 5IOZA 1OYIA 4RAGA 4DBRA 4IHVA 1YFHA 2JK3A 1XDSA 4YRVA 1T0FC 2XKPA 4HDVA 4BQAA 1A6QA 4XLNF 1YHQI 4CCLA 2WAQN 3KP2A 4KIFA 2WY7Q 3BG7A 4EVIA 4A3MJ 3PQJA 2JMWA 5AONA 4M6YA 5A2QZ 4EM1A 2FXAA 2HWVA 3OYCA 2J5OA 3RTRA 4BJ6C 2LVSA 3I56I 2BXYA 5J6XA 2DXIA 5JFRA 4UB8C 4IX7A 1E3OC 4UVAA 1MBJA 5H20A 3H5RA 5BNGA 4BS9A 3L2UA 4C9YA 3HOWJ 1KQ0A 5DDGA 3VFZA 2BV6A 4IO9F 3QP5A 3WODF 3MD2A 4A6EA 1LE8A 3M9AA 4G94A 4XLFA 4IHXA 1FTZA 2DOEA 2EPFA 1T6SA 4E7IA 4CCJA 2YU9J 3WHCA 4M71A 1Z21A 3FMQA 4IOAF 3F8MA 2LKXA 1QZZA 2XAFA 3IAS2 2VOOA 1EH6A 3KCCA 3L9FA 1CF7A 2ELHA 2FF4A 1YRNA 5EEAA 3F22A 4Q4ZF 2NS8A 1YOVB 1OCPA 1U5TA 4XKBA 5CVJA 4A3CJ 2DK8A 1TNSA 3TKYA 3JAMK 1B72B 1IDYA 3JAMZ 2DU9A 1JGGA 2H6BA 3OYMA 1ENHA 4Y33A 2L4AA 1YTYA 1YIOA 1AHDP 1DU0A 2FX0A 2RKHA 1IV6A 1ZLJA 2XGDA 1X4PA 4E7LA 4J01A 3OSGA 4EJVA 1DP7P 2F5EA 1Z9CA 4ENMA 3SYTA 2DA5A 2XAQA 2PX9A 2A6HF 2W85A 5K5RA 4HPQA 4CCOA 4BY7J 4QPQA 1ULYA 1J59A 1B8IB 3ZPLA 5DD8A 2PMZA 5LHHA 4ZDPA 3S3NA 3H5NA 1APLC 1SD5A 2DDBA 2FBHA 2HXOA 3FM5A 2ME6A 4OMYA 3LWFA 2WB1A 2VBYA 1ETXA 1MJ9A 2VKDA 2X6YA 4MQ9F 2GLOA 1BI3A 1W7PA 3T8TA 1D0XA 3LMMA 3CMMA 4J19A 1OYWA 3AG1H 1YG2A 2KJBA 1ODDA 2LRDA 1N77A 3CCYA 1J7KA 1KA8A 1WVRA 3JRFA 1ZHFA 4NC7A 3A03A 4KYWA 2FOWA 3K70D 4M3DA 2CV0A 3GXOA 4E7SA 2HEOA 3VEPA 1ZQ3P 2PJRB 2CU7A 2W24A 1SD4A 5FD5A 3IH3A 1W36D 4HSRA 1BL0A 1I3AA 3HOXJ 1MJAA 3L2CA 4RS8A 3Q3SA 4KMFA 2DMPA 5EF6A 1JUSA 2R7QA 2O8KA 1ACIA 1KU9A 3HHGA 2HYFA 1RZ4A 4B3AA 2QBYB 1IRXA 5J40A 1ZN2A 4OU0A 4XN0A 2ZXWH 3IV5A 4BACA 3AG4H 5JVTA 3GBGA 1ETQA 1EJ9A 4FASD 1X3UA 3WTUC 4F55A 2F2EA 4YEJA 3BJ6A 3HGYA 1ETKA 2L9NA 5DUIA 3LSMA 2DA2A 1LDDA 4EQQA 2FQ4A 2Z33A 3S16J 3F23A 3F9KA 4UUTA 2D1VA 1XSDA 2O9LA 3J7AY 3BR0A 3U21A 4IJAA 1Z77A 2IVMA 3DLAA 3R0JA 2LMDA 5JR3A 2DOAA 3ASOH 1UELB 1D5YA 2DI3A 2IGMA 2V9KA 1X1CA 3OS0A 1LVKA 4CHUA 4BEHB 3OOPA 2EK5A 4K2EA 4RMNA 2CV1A 3LA7A 3OR2C 1Q1HA 2X48A 3LSPA 1SVLA 3HTSB 1XB4A 2ZJRF 5JHUA 2HDDA 3KP3A 2NVXJ 3KEOA 2VC0A 2DJNA 3LSKA 1KQ9A 1QU3A 2L9SA 4P9FA 1ZK8A 3WGHA 4BDZA 2EJRA 2A6TA 2R92J 3PNVA 2PMZN 2KRCA 5JLXA 2IGKA 4XRMA 4ENKA 1VQPI 4L9TA 4JYKA 1UAAA 2QSHX 2WB1N 1K78B 2MABA 3BTCA 3CMAI 3S14J 3ABMH 1MZBA 4EM0B 1FYKA 1OJLA 1G6NA 2E1MB 3K0LA 3ULQB 4XR6A 1MDMB 3SFIA 3ABUA 5J3LA 4CO8A 2EFNA 2M2EA 1SMYF 2CW8A 2ZKZA 2DA4A 4P96A 3W6JB 2CFXA 2VE9A 2VN2A 3WE2A 4RGUA 3OYFA 5FLXK 1V5GA 3QYBA 3SEQA 4RDUA 4F52A 3QYFA 5FLXZ 1HDDC 4IHSA 1TC3C 2KRFA 3EETA 3S2HJ 4XRSA 1USTA 1PJRA 3SFZA 1SAUA 1DPRA 1PP7U 4BJ5C 1UCRA 4IRGA 4MGRA 1PP8F 1GHCA 2L7KA 1YIJI 1OPCA 5L3BA 3SJMA 4IRHA 1HW2A 3QU3A 5HODA 1OCZH 1BIAA 2V7FA 4UHTA 1NH3A 5FB2A 2MG4A 1S7EA 1Z6TA 4XLEA 1J9IA 2EV0A 2OQRA 2CUEA 3FMSA 4V2GA 1H9GA 2JA7J 1JHFA 1JUMA 2L7MP 2LC2A 2QLZA 1TW3A 3BG3A 1JTYA 1BJZA 2ZSHB 3TBIA 2BZTA 1OCRH 4LG0B 5ICFA 1F9NA 4RB0A 2RDPA 3BJOA 1UHMA 4A5MA 3TO9A 2R5YB 2VXZA 3FM3A 2JSPA 4RAZA 1N25A 1VZ0A 2W48A 3HOYJ 1YLFA 2OCEA 4QIWN 4V19K 2YS9A 4AIKA 3HRMA 2ME0A 2K9MA 4A3KJ 4M3GA 1PUFB 3BPVA 1U8RA 1XGOA 4ESBA 3U1KA 2L02A 3ZGKA 4X6AJ 4LK1F 3ZMZA 3MVPA 4RGRA 4G7OF 4A3JJ 3CCVI 3Q0VA 1K61A 4CUGA 1XCBA 1VQ7I 4IHYA 1PDNC 5B3SH 2FMLA 1JGSA 3EDPA 1WCMJ 4GCVA 3CC2I 3EYIA 1ZREA 3ZQHA 4CCNA 1ON1A 3E5QA 1YJ9I 3Q5FA 2JSCA 2XPUA 2JVHA 1DP3A 2D2WA 2Y0MA 2ZCWA 1KU7A 3GF2A 2IXSA 1HQCA 2OU2A 3RYRA 3E1SA 2E7WA 3C2GA 2QBYA 1S8NA 4E70A 2K3PA 5FRMA 3K6GA 3IAM2 1NHAA 1QZYA 3G6EI 3SHFA 2LR8A 1ZR4A 1RIOH 2I10A 2BBYA 2R4GA 3HSFA 3K4LA 4NQWB 3CP2A 4PJLA 1ZKGA 3GTMJ 4FCYA 2XPWA 2ID6A 3K2AA 2R93J 5E3MA 1GT0C 2RVCA 1IG7A 3KETA 1R5HA 1XG1A 2OJED 3P9CA 4B48A 4PK4A 1B59A 4RLQA 1K79A 3V42A 4ESJA 3KYCB 1T2KA 3QQAA 3E6BA 4HSTA 1FBSA 2EZKA 2XGEA 5HS9A 3K7AJ 4GO1A 3ROUA 1PYVA 3PIPF 4A3BJ 2ACJA 1JI8A 4BEHA 2H09A 1MBFA 5J8FA 2CG4A 2L4MA 4IL6C 1XMAA 3CCMI 1IXCA 1GVJA 3F8NA 4W1UA 2IA1A 1T56A 2G7UA 2B9SA 2Y9ZA 2JRMA 3SZPA 4ZTFA 2ZSIB 1BR2A 2FBKA 5IT9K 4FHTA 4UNOA 2CFOA 3EUHC 3A0BC 3X2QH 5IT9Z 2L7FP 1K83J 1FC3A 3W6VA 2BGCA 2HTJA 2QKMB 2WBMA 3R6SA 1I27A 2HU9A 2HQAA 1EV7A 5J1YA 5JLWA 1UZCA 5F08A 2GQQA 1MKMA 3BCAA 2OBPA 3G2BA 4KT5C 4B44A 1X1PA 3MFKA 2KIUA 5D8KB 1MH4A 2LK2A 5D5VB 1SFUA 2IRFG 3I0TA 1F4KA 3NWSA 3J7AO 5M5WJ 1QBJA 1G3TA 4RBOA 4D5CA 3DPUA 3L7WA 4JP0A 2I8DA 2ZJQF 3HJEA 2KIQA 5HLIA 1R49A 3FHZA 4Q48A 4XRSG 2JPBA 4KISA 1JE8A 4PGGA 2LTPA 3F8CA 3BP8A 1VQMI 4HF2A 3P9IA 3V8KA 2GM4A 2V1UA 2LBFB 3M1EA 3VSKA 4N0BA 3TW7A 4I09A 1R58A 4IPAA 1YJNI 1YO5C 4KJZA 3BQYA 1J5YA 1HKTA 2HTSA 2HKXA 4DNCA 3CUQC 1UMQA 3I54A 1GVDA 4G12A 2QQ9A 3TEDA 2XSDC 5EEHA 1T38A 1IXRC 1YYVA 1ETWA 1QGPA 4CA0A 2K3FA 2MSYA 3P9KA 3WU2C 1Y39A 4RLFA 1R22A 1UB9A 3GLLA 2HVRA 2IW5A 5EDNA 3FXJA 2EV6A 1A35A 1HKSA 5IP9J 3D5LA 3ZCOA 2C6YA 3ZQLA 2Z3YA 3OYDA 2DBBA 1LQ1A 2MA3A 3EYYA 1DPUA 1MNDA 2WA0A 4YIFA 3T1BA 1H88C 1USSA 3R0AA 3WTSC 2CW7A 4U0WA 2O03A 5IOYA 2IT0A 3TOBA 4HDUA 2R7OA 1QHGA 4LG0A 4CCMA 2H1KA 4JX6A 2ESHA 1EA3A 4QSHA 2DQLA 4KT6A 1FSEA 2UUZA 2ZMEB 3DBHB 5FLMJ 1W5SA 5LHIA 1MMAA 3CJRB 3HGGA 4F92B 1U3EM 2KMUA 2P8TA 5F0CA 2DLLA 3ASNH 2ZNYA 1IN6A 2ELKA 1QPIA 4BXXJ 4E7JA 4GYIA 2M7BA 1PUFA 3M07A 3B02A 3KEYA 2X6XA 3O2PE 3DP7A 3S2WA 2W7NA 5E8GA 1QZEA 2XB5A 3DPTA 4MHGA 2BXZA 5JI6A 4S04A 3BPXA 4HX7A 5B1AH 4XL9A 2XSJC 5F1JA 1RR8C 1FOWA 5FJ8J 1W0TA 4HLXA 1LJ9A 1JUPA 1XGMA 3JSPA 2EFQA 6PAXA 4Q5SF 3B6CA 2FNAA 3C2BA 2TDXA 3L2WA 5DEQA 5FLVA 1DUXC 3HOUJ 4NBQA 1KU2A 2RNJA 1ZGJA 2QA4I 2DODA 3PUFA 4NQWA 5E1ZB 4L9JA 1MBKA 1YITI 4DQ2A 4YFNF 5E3OA 2TRTA 4BAYA 1HLVA 4ZYDA 5DD4A 1FY7A 3A02A 5E3NA 1ZG5A 3TQNA 2W00A 1WI9A 1Z0XA 4LGWA 2E1CA 3H5AA 3S3MA 1X19A 2ECBA 1OLTA 3RKYA 4XN3A 3JREA 2KQRA 4ETSA 1OCOH 1WJDA 4NUBA 1S5LC 4LOCA 3DBRB 3JRBA 2CW0F 1FOXA 2V4JC 3DKWA 4KFCA 5FFZA 1BI1A 2GXGA 4HQMA 4CDGA 3T8RA 4N9HA 1FOKA 4OWRB 3VSLA 1BA5A 2FD5A 1HA8A 1K6OA 2DT6A 1Z7UA 1Z67A 4UVBA 3K1PA 5M3MJ 4CYDA 2B0LA 2JA2A 5LLQA 3ZXSA 1P4XA 3UNGC 2IS2A 2CMPA 2F5CA 4MEXF 1FEXA 2BY2A 5TGTA 1FT9A 3LOCA 4BHPA 3BCBA 4HX8A 4RB3C 2AHQA 2E2JJ 3GLXA 2LREA 4G7ZF 2VQCA 1AA7A 2KRHA 1OR7C 2WADA 2K02A 3MN2A 5C44J 4ESFA 3CZ6A 3VYRB 4JOMA 2HDCA 3JRAA 1YI2I 1IW7F 3C7JA 3TGNA 3JTHA 3KIOA 1SVMA 4A0ZA 5ICGA 5E79C 4RGSA 2GXAA 2MYSA 4BHBA 1HBXG 5HDGA 3CCSI 1WH7A 1LUJB 1ZELA 1XPXA 1SFOJ 5D5WB 3P7NA 3RKQA 5GTHC 4O6JA 1UFMA 1NTCA 2JTVA 2LBFA 2A6EF 4ANJA 2H94A 1ZR2A 2Y31A 3C2HA 4CXFA 2Q2EB 4GYGA 2KPMA 1G8XA 2D45A 2IAIA 2GIVA 2GXBA 3HRTA 3HSRA 5FKMA 4ZYEA 1HC8A 2HDWA 4IRIA 2H8WA 3J81Z 2RAEA 1IDZA 3LQQA 3MQ0A 5K7FA 5HS8A 3E3VA 1SFKA 1KQ8A 4UY8I 4DYQA 3Q0UA 3BT9A 5FD6A 2M30A 3FK7A 1HSJA 2ISZA 1I1SA 1I39A 2O7OA 4QPOA 5E18F 3S17J 2DCEA 4II3A 3H9GA 3ZMDA 4CH7A 4GRIA 4XOTA 1LDKB 2PJPA 2ESNA 1Y1WJ 4MLOA 5F6FA 4RB2C 3F21A 2EFWA 1W1WE 3HZJA 5DV5A 2GOXB 3BY6A 5EG0B 2EINH 4F7ZA 3I55I 1ITYA 3CUOA 2NS7A 2FMYA 3I4NJ 1G3YA 2ICWG 4Y17A 1WRJA 1T39A 2KDZA 4I01A 1QNTA 2Z99A 5D8LB 3GZNB 4G8XA 3L1PA 2E1OA 2A61A 4UUSB 1EH7A 2MH9A 2A3SA 3DU6A 3I64A 1E0EA 3SZGA 2VPRA 1ORKA 5GPAA 4Y7NJ 1RNLA 1N78A 2WV0A 3K4CA 2UZKA 1KYWA 1MD0A 3F3XA 1I1GA 5EZGA 3B6AA 2HPIA 3GFJA 1U5TC 3AL0B 1VQ4I 1ZRFA 2G0EA 2V1DA 3ZMVA 3HTUA 5H2FC 2VQHA 3MKWB 1WJAA 2G9WA 3IP4B 2VLAA 2M0MA 2VQGA 3A1YA 5GPCA 3OYLA 4B09A 2VBZA 1IJWC 4KIGA 4NNJA 4XSZF 2DMTA 1P7JA 3ZQFA 4UXNA 3G73A 3LQRA 2EA4A 1LEBA 1FMVA 2MC4A 2X1EA 3EUAA 2CV2A 4QWQA 2Y2ZA 3GTJJ 2XF7A 3KP6A 3QAHA 1ZYRF 2OD5A 2ZFWA 3FZVA 1LFBA 2LYCA 2VPLA 5F04A 3M3YJ 3FKJA 3FXOA 1J0RA 2XVCA 1X2NA 4D7NA 1AWCA 4PJJA 1VI0A 3TO7A 1Y6IA 2DFHA 2P0WA 3W2WA 4MNUA 2MD5A 3ECHA 1RI7A 1WGXA 3U2RA 2ZJPF 1QVTA 1ONVA 3H36A 2OQGA 1X1DA 4M3BA 2GZWA 3ZQCA 4FT8A 4BH9A 1H0MA 1UHWA 5C3EJ 1WJEA 1BBYA 3TO6A 5F0HA 2DA6A 1U2WA 2YX7A 4BXFA 1M1EB 3DCFA 4F3QA 3FMRA 1IO2A 1FYLA 4D1QA 3HOSA 3KZIC 1KONA 2CGPA 2MLKA 3TDZC 4LK0F 3QU6A 1QPMA 5B5EC 4CSWA 1KGSA 3JRHA 2HR3A 2EFPA 3TW6A 2HVQA 3OYAA 3BTIA 4FTHA 3U1DA 2DDAA 2GA2A 2DTZA 1B9NA 3WHBA 3NWTA 2VI6A 5LGTA 3KE2A 2VONA 2IP2A 2NXNB 3GFMA 1NG7A 3QPHA 4ZYGA 2O6GE 3ZMSA 3FXKA 4KIBA 1X1BA 2FQ3A 3IH2A 4ZYAA 3FWEA 3BG5A 5E1WA 4Y3OA 1LFUP 2WAFA 5D5UB 1QHHD 1Z05A 4QLCU 3VB2A 5J47A 3OR1C 1WI3A 3OYIA 2M8GX 1WKMA 2LOOA 4QTRA 2IS6A 2F4OB 2QQ8A 1TWHJ 3M1CA 1XTAA 1TWFJ 3W3CA 3IRQA 1I50J 2CQNA 3BG6A 2E71A 2IJLA 4AC0A 1YW8A 2R5ZB 1YS7A 1G59A 2G7HA 1FBUA 1SC7A 1WZ2A 5L3GA 1FP2A 2K85A 1B1BA 3CMEI 4XSXF 4GDFA 4OINF 4ZC3A 4UB6C 3HOZJ 2V6CA 4I76A 4U88A 4G6DA 2VKHA 3PIOF 4HAMA 3JTGA 3JRCA 4UUSA 1MNEA 4Y4RA 2MD0A 3JRGA 2FUG2 4Y52J 4H0EA 1T08B 4A3IJ 3NEUA 4XKWA 1P6RA 3QRFF 1C0WA 2GAUA 3ABTA 4AIHA 4A12A 3GZ5A 4RAYA 1AOYA 4XORA 2DOFA 1FLIA 3PFIA 2DO7A 3SDBA 3I58A 1BR1A 1WJBA 2VUMJ 4HF1A 2R7SA 1MBGA 1YW7A 1Z6RA 2P4WA 3C3WA 5FKKA 3OIPA 2WV1A 1OFCX 2IS4A 2K5CA 5TISC 1QA6A 1O3TA 3FXMA 2A5YB 4W97A 2CQ7A 4NHJA 1S7OA 4PUSA 1UG2A 4X0GA 2GWRA 2ECCA 1H89C 2X6WA 3CCQI 3RPQA 3FIWA 5KAFC 2ZC2A 2RNGA 1B72A 2OPTA 3WTWC 2PG4A 3WTZA 2A5WA 3CD6I 1U9NA 3K2ZA 3K4MA 3DKXA 1X1AA 3RI4A 1WSUA 2L01A 3CCEI 4XRFA 3WG7H 3WG9A 2KFDA 2VKEA 3Q0WA 3JCUC 4YG2F 1SAXA 9ANTA 2MW8A 2YSRA 2NNYA 3GTOJ 3PNTA 1S9HA 3I53A 1VQ9I 3CCLI 3GYHX 1JJ6C 4EJOA 4R8HA 2DW4A 2AXTC 2P6SA 2BW3B 1B8IA 2DT7B 2YPRA 5E8IA 2KZVA 1TW2A 5GAHJ 1XX5A 1JTXA 2VKVA 2VL8A 5AIPA 5B66C 3ERMA 3N4MA 3CCRI 5C4JJ 1BIBA 3PSIA 4DJAA 3DQVC 3MKLA 3KPHA 4MIMA 2OTLI 1D1CA 4DZPA 5EGOB 1WWXA 3GZ6A 2F5VA 3HG9A 1D0ZA 4BYYA 2PMHA 1FJLA 3GVAA 2K9SA 2MBFA 5LFAA 4L0ZB 2E2IJ 3LSIA 2OZ6A 1FYMA 2PFBA 4S05A 2PJRA 2FRHA 2ZJ2A 1EH8A 3A2KA 4EATA 1Z3XA 3IKTA 1VQKI 3PJRA 2Z2SB 3ZOBA 2STTA 1BM9A 3QPSA 3VYTB 1BW6A 1W0UA 2OUMA 4M6XA 2EB7A 1SMTA 4Y15A 2NRAC 1R9TJ 3VYSB 3GUDA 2EZHA 2DMUA 2PEXA 4NC8A 4A6DA 1G4DA 4L18B 3BC8A 1S72I 4U7DA 1F1ZA 2IBDA 3O8GA 4JK1X 1BR4A 1I6XA 2K9LA 4OOIA 5E17F 4JX5A 4XLPF 2K9NA 3FF5A 2M1BA 3AAFA 4EGYA 3RQIA 3G3ZA 3DTKA 2KZGA 2L2OA 4BHCA 1RUNA 5LEKA 2GIZA 2QKLB 1IUFA 3H3ZA 3WGGA 2BVMA 3OOUA 3LSTA 3I71A 3GMEA 2WWYA 3LAJA 3D1NI 3GTKJ 2AQEA 5EJCA 2LKSA 2LG4A 3HUGB 5L3EA 2NOJB 2ELJA 4R1HA 3DU5A 4C3IJ 2X51A 1BOBA 1SEUA 2IPQX 1WPKA 3K10A 2XAGA 4OIQF 2NVTJ 4IQ4A 4XOPA 3I4MJ 4N9IA 2BHZA 1R36A 3CQZJ 3K70C 4E7ZA 1GV2A 1E2XA 2TCTA 2DAOA 2LY9A 4JBAA 1W36C 1P9QC 1ZRDA 1R1TA 2R5ZA 2JRTA 3RSNA 3KLNA 4AVZA 3LSJA 3PQKA 2DTRA 3QOEA 3S8PA 1FX7A 3PUBA 1X58A 5GP9A 3HSEA 5IY5H 1DU6A 1KU3A 3D0SA 1HKQA 2Y9YA 4AVPA 2F4IA 1B9MA 2OV7A 4KICA 1ZAOA 2Q8KA 3J7YJ 1GXQA 3OIQA 2DT5A 2FOKA 2I5UA 3LFKA 2HVSA 2GA1A 3BROA 5D6EA 3S15J 2E1MC 5F27A 1IV8A 3W2AA 2BE5F 2WY8Q 1RUOA 2E7XA 2XRLA 1K78A 1FWZA 1RESA 1TT5B 3OMYA 3RPUD 3KZYA 1Y8QB 5DCMB 1IN8A 3RKWA 4LLLA 1O57A 1MDMA 5KNLA 3GFLA 3MZHA 2VJJA 2NVUB 3HBLA 5D4RA 3M8EA 1JKRC 3S1QJ 2OF7A 1TTYA 3VPRA 4IXAA 2R3SA 4FE7A 2V79A 3PO3J 4HOBA 2P5KA 1TWAJ 1U8BA 5CPRB 3J80K 1X3WB 4MFDA 3RKXA 3L09A 3MAJA 3N97A 3JW4A 2F48A 1XMXA 4A5NA 4IHWA 5K7ZA 2CJJA 5K5QA 1D0YA 1QVUA 1BOAA 2EBIA 2VASA 2LFBA 2H8RA 3KP7A 3W2VA 3E97A 1E3HA 4BNCA 4U7BA 2NYXA 4GGGA 3E6DA 1K4SA 4I02A 2QSFX 5DS9A 3OSFA 2R0QC 2O61A 1MMNA 1LDJA 1GLNA 3TL4X 3WTTC 2N8GA 5ILVA 2X6OA 5LBQA 3ZR8X 3CLOA 3FXUA 2V6EA 2ETHA 3FK6A 1U0JA 2IA2A 2ZXIA 1ETYA 3O3KA 4PFOA 2R5YA 1VF9A 2QWWA 3BJAA 4ZJZA 3BLYA 3ABLH 3BWGA 4EGZA 2HKOA 4XLAA 3NQOA 4BY1J 3CMYA 1Y0NA 1MSEC 4M9ZA 4XBFA 5F1RA 2M4KA 3ELKA 1BN5A 4C30A 3CCJI 3S32A 3E7LA 4U0VA 1IGNA 4N4OB 1DGRM 3BZKA 2DJIA 1KZHA 1MBEA 5KHDA 3H92A 1R5ID 2XROA 4C2UA 4XNFA 1D1BA 2IGOA 3IRRA 2R7WA 1TNTA 3GTGJ 3ZQIA 2XAHA 2DMNA 2KP6A 4WWCA 2GOMA 1B6AA 1SVOA 2BY1A 2DYRH 2XUBA 4HEA2 4II2A 1Z1DA 5FRNA 2EV5A 2JZYA 1FSHA 4HQEA 1FIPA 2FU4A 1HDPA 3DXJF 1W7PD 3BR6A 2HPMA 5IP6A 2LY1A 2CUFA 1Y8RB 2DPDA 1LFPA 2QCOA 1FMWA 3HM5A 4NC6A 3VOEA 3V4GA 2VIXA 3DFGA 2Q0OA 1CF7B 3HUGA 1XCVA 4YIRX 2X1CA 3U9GA 1YRNB 3R60A 4D9JA 4M9SA 2A07F 3IKVA 1V55H 2NVYJ 1S29A 3DEEA 5D6FA 3A01B 3OS1A 4F91B 4BE2A 4M6VA 2X85A 3G71I 4XLCA 3C18A 1TQPA 5K7HA 2V1NA 1ZGWA 4S0HB 2XGXA 4I99C 1TZLA 4BE1A 3SZTA 3WU1B 4RA2A 2HZTA 4E7HA 3GW2A 5FROA 2JPCA 4AD9A 4D0PA 2EILH 2E35A 4FETA 4KA4A 1K7AA 2VBXA 4G9YA 2VXDA 2X9DA 4HRIA 3WTXC 2YU3A 4M72A 5HVQC 4OIPF 5LRSA 4ENNA 4F93B 3PFYA 4HNTA 2K40A 1MW7A 3WGIA 4XONA 1R6RA 1OISA 3DWLE 2E19A 4AM3A 3LSRA 4A93J 1YQAA 1LNWA 2R7DA 2EZLA 5HLGA 2PI0A 2O0YA 2JA5J 4PCQA 4LLNA 5TJJA 1U6GA 3K1NA 1XGNA 4WX9A 2K86A 2GBYA 2KISA 3OV8A 1VQ5I 2VBWA 3PM1A 1W7PB 2DA7A 1R4MB 2LSOA 3ML6A 2NS0A 2H27A 2QVOA 4U0YA 4CGZA 2CH0A 1HSTA 2Z1DA 3HB9A 1LVAA 2ZO4A 3CO7C 2R7FA 2EA2A 4O5VA 4LIUA 4OAYA 3P5JA 4ZTJA 3JRIA 3KFWX 1XSXA 2PQ8A 1I6HJ 4HZFA 4RM3A 1IAWA 4AIDA 4A3GJ 4A3LJ 2YUSA 1I5ZA 4WXHA 4B8XA 5ED4A 3OYGA 3CCUI 1OMIA 4Y13A 4OIOF 2DA1A 1Q1VA 1T98A 2F4MB 2EQRA 1VQNI 2F5DA 3QPLA 5LEJA 3DTEA 3BG9A 2QM3A 2BHYA 4M3FA 4Q47A 1UJ8A 4FX4A 4P5OA 3BZ6A 2QYOA 2ID3A 4NDLA 4U87A 3ZQQA 2OTJI 2L3DA 1IXSB 4KDPA 2EIJH 2CS3A 3ZQ7A 5M3FJ 2LY2A 2M4GA 3DBLB 4WCGA 5HS7A 2L5QA 1RPWA 2E36A 3RDIA 2QENA 3ECOA 1W5TA 1HW1A 2W84A 3ESWB 1AU7A 3Q9SA 2ZMEA 3CDHA 1YX5A 3RPUA 2K9QA 3BDDA 2E1NA 2VB6A 5KK1A 3AG3H 1QO0D 2W25A 3M4OJ 4HYEA 2OA4A 3DEUA 2XASA 2M3AA 4EJWA 3OYBA 2AO9A 5FKNA 2XDVA 2B7EA 2VJIA 1QRYA 3I5UA 4FISA 2P6TA 3MCZA 1BC8C 3DEWA 5A2QK 4G7HF 3F0CA 2DMQA 3NAUA 3F6OA 1XD7A 1T0FA 1TWCJ 2P5LC 1P92A 2W82A 3E6MA 2ZNZA 2XC7A 2HYGD 3J7ZI 3I4PA 2BEOA 4DYCA 4A0XA 2UXNA 4IVNA 4LLGF 2MFZA 2HXIA 3PNYA 2CO5A 2O3FA 1FP1D 3M7GA 4XM3A 2DFFA 3MEXA 1MIJA 3COAC 5HNHA 3ZMUA 4HF0A 2CUZA 4DOZA 2COMA 4HV5A 1G3WA 3OY9A 2X4HA 1P7IA 1MMDA 3DKYA 1SD6A 3QP6A 2JUGA 3OYKA 4PGHA 1N75A 3HIFA 4DGWB 3HDDA 1ZG1A 3MZYA 4IF4A 1E17A 4BDYA 3H9QA 3RZDJ 1B4AA 5FO5A 4OIRF 4ASNA 4HW0A 3KZZA 4BL0B 2ZFUA 4EM2A 1RKWA 1G3SA 4C2MJ 3OYEA 4AIJA 3A01A 3T0YA 1W4MA 1HXDA 2UXXA 4L5IA 3BR5A 5M5YJ 4EEFG 2PMUA 4HV6A 3ZQGA 3FXQA 3OL3A 4I7HA 1UG0A 4P9UA 1K6YA 1GV5A 2L9RA 1JT6A 3H0DA 3S1RJ 2MLGA 3D5SC 2R7RA 1LKXA 2MC3A 4KUMA 1H9TA 3HEFA 3QODA 4A3FJ 5M5XJ 5BOXA 1STZA 4J00A 2BOLA 2V26A 3ZRGA 5LD2C 3LNQA 1J09A 3A0HC 3LAPA 1O7LA 1Z7LA 2DQRA 3D5RC 4LJZF 4Z2YA 4YFXF 1TQIA 2HQ5A 3CC4I 5DCFA 1BW5A 4IEJA 3FISA 3FX3A 3BTJA 1WJ5A 1EF4A 4I0AA 2XKOA 5KAIC 3PL8A 3S93A 4X1EA 1YJWI 4XIDA 2ZXHA 3HRSA 1W5CC 2BVLA 4DZJA 1R71A 3LSHA 3HPHA 2L9VA 4ZZDA 1BI0A 3FBIB 1RC9A 2B63J 3BZCA 4ITVA 4LG3A 3DLLF 2LH9A 5H6QA 4AWXB 4AYBA 4NB5A 3M8JA 1IN5A 4XKCA 1L0OC 1QQIA 4OMZA 2VT3A 4LIVA 1ZRCA 1TLHB 2XIGA 3H3UA 4XQFA 4CYCB 1O7FA 1YE9A 2COBA 2Q2EA 1OQYA 1XGSA 2HQNA 2L0KA 2STWA 5E20A 5J1UA 4LFUA 2DA3A 5GAGJ 1FBQA 1S6LA 3V7CA 1XDUA 3DTIA 5BS6A 3I9V2 5HDKA 1Z91A 4M73A 1ON2A 2XGCA 4M9XA 2M0CA 3ZN0A 4HG2A 4MTEA 4ZH4F 3K4BA 2JT1A 1V4RA 2Y0SA 5F64A 2UV1A 2VC1A 1SFEA 1KYZA 5FKLA 2KT0A 4XKVA 4E4HA 2PLYA 2P7VB 4BGDA 2CWEA 3ABKH 1VQ6I 4XK4A 1TL8A 4D5FA 2RV8A 2HOTA 2EIMH 2W4SA 1O3QA 4A2UA 4XMYA 3K9TA 4C3JJ 1YW9A 3TP3A 5HOOA 3H3VK 2K27A 2WAEA 4IZZA 4ENJA 4LB5A 1MGTA 2JN6A 5EG0A 4XICA 3S1MJ 1IN4A 3K69A 1HF0A 4HNUA 5BQTA 3CF2A 1V3FA 1SANA 3O8HA 1ZG3A 3HOVJ 3E5XA 1TP4A 1R00A 2K4BA 3MZ8A 4DIQA 3JRDA 2X1DA 4LMYA 2EZIA 4MO7A 3R4KA 3R61A 1X3ZB 2W1OA 2IA0A 2QQAA 5C4XJ 3ZN1A 2DPUA 1F43A 2WTEA 3L00A 3AL0C 1RRJA 1D1AA 1NK2P 4EMSA 2AQFA 3GO5A 2XB0X 2KHMA 3F8BA 1BI2A 3VDXA 1A36A 3JSOA 3WE3A 5E1XA 2JQ7A 1VTNC 3EUKL 3TDUC 1I3QJ 3L2QA 1GXPA 2P7CB 3K1MA 2BY0A 3LA2A 2R7ZJ 4PJNA 3Q9VA 2E2HJ 3ONQA 3KEQA 3HOTA 5B1BH 1MSFC 1IF1A 4WF2A 2CYYA 3DF8A 1JHHA 4I6ZA 5EYRA 2BY3A 2UWMA 4LD5A 4B1RA 3E6CC 4I2OA 2R7XA 2M8EA 4PJMA 4BBSJ 4AYBN 5H6RA 3S2DJ 3E5UA 1XMKA 4JX4A 2QQBA 1P4AA 1T8IA 4UVCA 1Z3YA 1U9OA 3FKIJ 1A04A 2R7TA 1ZGAA 2DFIA 3VODA 3S3OA 1IRGA 4G6TB 4BQQA 5CLSA 2LDUA 2L7ZA 2QEXI 4M74A 2CQXA 3F8FA 3W6KB 1DQUA 2DK5A 1VFCA 2AS5F 4EV0A 2Y0SN 2RC4A 1TBXA 1R1VA 3ISPA 3BR1A 2LD5A 1MMGA 3S1NJ 1XSVA 3CUQB 1DDNA 4TV7A 4B3XA 1R5GA 2XRNA 1VNDA 2KLOA 2FSWA 5HNFA 2CRGA 3ZP5A 3A4CA 5ERIA 3E0JB 4HNVA 1ZLKA 1JKOC 4PZJA 2R7UA 3AFHA 3EPZA
chains in the Genus database with same CATH topology
1U78A 2CU7A 2X6OA 3IH3A 2IAIA 5IYDJ 1BL0A 3HOXJ 3FK6A 3G1MA 1JKPC 1ETYA 5FKMA 2IEKA 3Q3SA 2R5YA 2DMPA 1MNMC 5EF6A 1VF9A 1JUSA 1AKHB 2RAEA 1IDZA 5K7FA 2O8KA 2NOGA 4DYQA 4B3AA 3Q0UA 3BT9A 3FK7A 4BY1J 3CMYA 1XC5A 2O7OA 2JJ7A 3IV5A 1CQTA 1MSEC 4CYCA 3S17J 3GBGA 1ETQA 1T33A 1RKTA 3E7LA 1Y1WJ 4MLOA 3HGYA 1ETKA 1IGNA 5EG0B 1ITYA 1MBEA 2DA2A 2NS7A 3S16J 2FQ4A 3I4NJ 4UUTA 2O9LA 2KDZA 3BR0A 3GTGJ 3ZQIA 3GTQJ 1Z77A 2DMNA 2HOAA 4GFBA 3L1PA 2NVQJ 2E1OA 4UUSB 1D5YA 4FE4A 2VPRA 1ORKA 2CQQA 1FIPA 5GPAA 4Y7NJ 1HDPA 1H8AC 3BR6A 5IP6A 2D5VA 3LSPA 2X48A 3CDLA 3H0GJ 2CUFA 2HDDA 2NVXJ 5EZGA 3B6AA 2DJNA 2QCOA 3HM5A 2G0EA 2QF7A 1ZK8A 1YRNB 2R92J 2NVYJ 2PMZN 5IYCJ 3A01B 4M6VA 5JLXA 4L5EA 5GPCA 4XRMA 1IJWC 4JYKA 5K7HA 1ZGWA 4S0HB 2WB1N 2DMTA 1P7JA 2JA6J 3ZQFA 2HI3A 4A3EJ 3BTCA 3S14J 1OJLA 4V2FA 3SFIA 5J3LA 1IRZA 2X9DA 2EH3A 2M2EA 2Y2ZA 3GTJJ 2DA4A 1MH3A 5DTDA 2K40A 1LFBA 5F04A 4RDUA 2E19A 2MGQA 1HDDC 3M3YJ 3LSRA 4A93J 1TC3C 4A69C 4D7MA 4D7NA 1X2NA 2EZLA 1HCRA 3S2HJ 1VI0A 4XRSA 2HYJA 2JA5J 1Y1VJ 1WGXA 2GBYA 1QVTA 1JT0A 3PM1A 1GDTA 2HOSA 2DA7A 4M3BA 3SJMA 3ZQCA 5HODA 3UKGA 2MG4A 1S7EA 1O4XA 5C3EJ 3GTLJ 5F0HA 2DA6A 4A3DJ 3HB9A 5FKOA 4ABZA 2CUEA 3DCFA 4V2GA 2JA7J 3GTPJ 3NARA 2L7MP 1JUMA 3JRIA 3BG3A 1JTYA 4AUXA 1BJZA 1I6HJ 1F36A 1FTTA 3JRHA 4A3GJ 5F0FA 2R5YB 4A3LJ 2YUSA 3TW6A 3BTIA 4FTHA 2DA1A 1Q1VA 2W48A 2EQRA 3HOYJ 3BTLA 3QPLA 1A5JA 2DTZA 3WHBA 4QIWN 3BG9A 2YS9A 1TWGJ 2VI6A 5EGOA 2ME0A 5EZHA 4M3FA 4A3KJ 4M3GA 1PUFB 3BQZA 5E3LA 2ID3A 4NDLA 2DN0A 4X6AJ 3MVPA 3IH2A 4A3JJ 3Q0VA 1K61A 5M3FJ 4IHYA 3BG5A 1RPWA 2M34A 1WCMJ 1LFUP 1HOMA 4C3HJ 1NK3P 3ZQHA 1AU7A 1AKHA 2XPUA 1WI3A 2K9QA 2M8GX 4QTRA 5IYBJ 3JR9A 3M4OJ 1TWHJ 2AO9A 5FKNA 1TWFJ 2LR8A 1ZR4A 3LSGA 1I50J 1QRYA 2I10A 1XS9A 4FISA 1LE8B 4AC0A 1ZKGA 3DEWA 2R5ZB 3GTMJ 3HKZN 4FCYA 2XPWA 3F0CA 2DMQA 3NAUA 2ID6A 3K2AA 1TWCJ 2R93J 5E3MA 1GT0C 1IG7A 1XG1A 4DYCA 1POGA 3HOZJ 4I76A 2HXIA 4UUSA 1A6IA 3G1OA 3QQAA 3JRCA 3JRGA 4M3EA 2EZKA 4Y52J 2XGEA 1JKQC 3K7AJ 4BBRJ 4A3IJ 4A3BJ 1MBFA 4W1UA 3SDGA 1T56A 1P7IA 1OCTC 2Y9ZA 1WH5A 3HDDA 2VUMJ 4DYRA 1MBGA 2L7FP 1K83J 5FKKA 1GUUA 3RZDJ 3W6VA 2WV1A 1OFCX 1RKWA 1X2MA 4C2MJ 5IPAA 5J1YA 4W97A 5JLWA 5F08A 3A01A 1ZTRA 3G1LA 1UG2A 1UHSA 3BR5A 4EEFG 5M5YJ 1MH4A 2LK2A 2ECCA 3ZQGA 1H89C 5M5WJ 3FIWA 1B72A 2OPTA 2JWTA 4RBOA 4D5CA 1GV5A 2L9RA 3PO2J 1U9NA 2M9HA 1G2HA 1JT6A 1MBHA 4JP0A 3S1RJ 1ETVA 3HEFA 4XRSG 2Y30A 4A3FJ 5M5XJ 2LTPA 2VKEA 3Q0WA 4B4CA 2LP0A 9ANTA 2MW8A 3LNQA 2GM4A 3GTOJ 1FIAA 3OIOA 3TW7A 3TP0A 1JJ6C 5J1RA 3BQYA 2XPVA 2HQ5A 1BW5A 4IEJA 3FISA 4MFEA 1IC8A 1UMQA 3BTJA 1B8IA 5IP7J 1EF4A 2P81A 1GVDA 2LLKA 1JTXA 2VKVA 4G12A 4X1EA 3TEDA 4DW6A 4XIDA 5C4JJ 2XSDC 1ETWA 4DZJA 2MSYA 3MKLA 1JJ8C 4MIMA 4DZPA 2JA8J 3IH4A 5EGOB 2B63J 3RZOJ 5EDNA 1RR7A 5IP9J 3ZQLA 1FJLA 2K9SA 4CYCB 2E2IJ 2COBA 1H88C 2L0KA 5IOYA 5J1UA 2DA3A 2H1KA 2ZB9A 4JX6A 3ZOBA 3QPSA 1BW6A 4QSHA 1W0UA 3BR3A 2XGCA 4BKXA 2M0CA 1R9TJ 5FLMJ 2EZHA 2DMUA 1ETOA 3HGGA 2FJ1A 5F0CA 2IBDA 3O8GA 2ELKA 5FKLA 2KT0A 1QPIA 4BXXJ 1RETA 3BR2A 4JX5A 5IOZA 1PUFA 2K9NA 4IHVA 4XK4A 2JK3A 3RQIA 4D5FA 2HOTA 2XB5A 2WAQN 4C3JJ 3TP3A 4A3MJ 1IUFA 5F1JA 3H3VK 2JMWA 3OOUA 2JN6A 5EG0A 4XICA 5FJ8J 1W0TA 3D1NI 3GTKJ 3S1MJ 1HF0A 2LVSA 1JUPA 4C3IJ 1SANA 3O8HA 1E3OC 3HOVJ 1MBJA 1WPKA 3B6CA 3C2BA 5BNGA 3JRDA 5FLVA 2NVTJ 3HOUJ 3HOWJ 2EZIA 3I4MJ 4MO7A 3CQZJ 1GV2A 1F43A 5C4XJ 2TCTA 2LY9A 1MBKA 1LE8A 1NK2P 2R5ZA 5E3OA 2TRTA 1HLVA 4IHXA 1FTZA 2XB0X 3A02A 5E3NA 1Z0XA 3LSJA 3WHCA 2YU9J 1X58A 2LKXA 5GP9A 2ECBA 1DU6A 2Y9YA 3JREA 1I3QJ 1YRNA 5EEAA 2NS8A 1OCPA 2R7ZJ 4A3CJ 4LOCA 3JRBA 2E2HJ 1MSFC 3S15J 5F27A 1B72B 1IDYA 1JGGA 4I6ZA 2XRLA 5EYRA 1RESA 4B1RA 1BA5A 1ENHA 2FD5A 1AHDP 4AYBN 4BBSJ 5M3MJ 1DU0A 2FX0A 3S2DJ 1IV6A 2XGDA 4JX4A 3OSGA 1FEXA 3HBLA 1JKRC 1U9OA 3FKIJ 3LOCA 2DA5A 2AHQA 2E2JJ 2OF7A 3S1QJ 3VPRA 5C44J 3MN2A 2L7ZA 4BY7J 4FE7A 1B8IB 3PO3J 2CQXA 1TWAJ 3JRAA 1U8BA 1VFCA 2Y0SN 4MFDA 3BR1A 1APLC 2LD5A 2ME6A 2HXOA 4IHWA 3S1NJ 5K7ZA 2CJJA 1ETXA 1QVUA 2GLOA 1WH7A 2EBIA 1SFOJ 2LFBA 2H8RA 1VNDA 4J19A 3RKQA 1NTCA 2CRGA 3CCYA 3JRFA 4HNVA 5DS9A 1ZR2A 1JKOC 3OSFA 2Y31A 2R0QC 3A03A 4M3DA 1ZQ3P 2N8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U78 A;  2CU7 A;  2X6O A;  3IH3 A;  2IAI A;  5IYD J;  1BL0 A;  3HOX J;  3FK6 A;  3G1M A;  1JKP C;  1ETY A;  5FKM A;  2IEK A;  3Q3S A;  2R5Y A;  2DMP A;  1MNM C;  5EF6 A;  1VF9 A;  1JUS A;  1AKH B;  2RAE A;  1IDZ A;  5K7F A;  2O8K A;  2NOG A;  4DYQ A;  4B3A A;  3Q0U A;  3BT9 A;  3FK7 A;  4BY1 J;  3CMY A;  1XC5 A;  2O7O A;  2JJ7 A;  3IV5 A;  1CQT A;  1MSE C;  4CYC A;  3S17 J;  3GBG A;  1ETQ A;  1T33 A;  1RKT A;  3E7L A;  1Y1W J;  4MLO A;  3HGY A;  1ETK A;  1IGN A;  5EG0 B;  1ITY A;  1MBE A;  2DA2 A;  2NS7 A;  3S16 J;  2FQ4 A;  3I4N J;  4UUT A;  2O9L A;  2KDZ A;  3BR0 A;  3GTG J;  3ZQI A;  3GTQ J;  1Z77 A;  2DMN A;  2HOA A;  4GFB A;  3L1P A;  2NVQ J;  2E1O A;  4UUS B;  1D5Y A;  4FE4 A;  2VPR A;  1ORK A;  2CQQ A;  1FIP A;  5GPA A;  4Y7N J;  1HDP A;  1H8A C;  3BR6 A;  5IP6 A;  2D5V A;  3LSP A;  2X48 A;  3CDL A;  3H0G J;  2CUF A;  2HDD A;  2NVX J;  5EZG A;  3B6A A;  2DJN A;  2QCO A;  3HM5 A;  2G0E A;  2QF7 A;  1ZK8 A;  1YRN B;  2R92 J;  2NVY J;  2PMZ N;  5IYC J;  3A01 B;  4M6V A;  5JLX A;  4L5E A;  5GPC A;  4XRM A;  1IJW C;  4JYK A;  5K7H A;  1ZGW A;  4S0H B;  2WB1 N;  2DMT A;  1P7J A;  2JA6 J;  3ZQF A;  2HI3 A;  4A3E J;  3BTC A;  3S14 J;  1OJL A;  4V2F A;  3SFI A;  5J3L A;  1IRZ A;  2X9D A;  2EH3 A;  2M2E A;  2Y2Z A;  3GTJ J;  2DA4 A;  1MH3 A;  5DTD A;  2K40 A;  1LFB A;  5F04 A;  4RDU A;  2E19 A;  2MGQ A;  1HDD C;  3M3Y J;  3LSR A;  4A93 J;  1TC3 C;  4A69 C;  4D7M A;  4D7N A;  1X2N A;  2EZL A;  1HCR A;  3S2H J;  1VI0 A;  4XRS A;  2HYJ A;  2JA5 J;  1Y1V J;  1WGX A;  2GBY A;  1QVT A;  1JT0 A;  3PM1 A;  1GDT A;  2HOS A;  2DA7 A;  4M3B A;  3SJM A;  3ZQC A;  5HOD A;  3UKG A;  2MG4 A;  1S7E A;  1O4X A;  5C3E J;  3GTL J;  5F0H A;  2DA6 A;  4A3D J;  3HB9 A;  5FKO A;  4ABZ A;  2CUE A;  3DCF A;  4V2G A;  2JA7 J;  3GTP J;  3NAR A;  2L7M P;  1JUM A;  3JRI A;  3BG3 A;  1JTY A;  4AUX A;  1BJZ A;  1I6H J;  1F36 A;  1FTT A;  3JRH A;  4A3G J;  5F0F A;  2R5Y B;  4A3L J;  2YUS A;  3TW6 A;  3BTI A;  4FTH A;  2DA1 A;  1Q1V A;  2W48 A;  2EQR A;  3HOY J;  3BTL A;  3QPL A;  1A5J A;  2DTZ A;  3WHB A;  4QIW N;  3BG9 A;  2YS9 A;  1TWG J;  2VI6 A;  5EGO A;  2ME0 A;  5EZH A;  4M3F A;  4A3K J;  4M3G A;  1PUF B;  3BQZ A;  5E3L A;  2ID3 A;  4NDL A;  2DN0 A;  4X6A J;  3MVP A;  3IH2 A;  4A3J J;  3Q0V A;  1K61 A;  5M3F J;  4IHY A;  3BG5 A;  1RPW A;  2M34 A;  1WCM J;  1LFU P;  1HOM A;  4C3H J;  1NK3 P;  3ZQH A;  1AU7 A;  1AKH A;  2XPU A;  1WI3 A;  2K9Q A;  2M8G X;  4QTR A;  5IYB J;  3JR9 A;  3M4O J;  1TWH J;  2AO9 A;  5FKN A;  1TWF J;  2LR8 A;  1ZR4 A;  3LSG A;  1I50 J;  1QRY A;  2I10 A;  1XS9 A;  4FIS A;  1LE8 B;  4AC0 A;  1ZKG A;  3DEW A;  2R5Z B;  3GTM J;  3HKZ N;  4FCY A;  2XPW A;  3F0C A;  2DMQ A;  3NAU A;  2ID6 A;  3K2A A;  1TWC J;  2R93 J;  5E3M A;  1GT0 C;  1IG7 A;  1XG1 A;  4DYC A;  1POG A;  3HOZ J;  4I76 A;  2HXI A;  4UUS A;  1A6I A;  3G1O A;  3QQA A;  3JRC A;  3JRG A;  4M3E A;  2EZK A;  4Y52 J;  2XGE A;  1JKQ C;  3K7A J;  4BBR J;  4A3I J;  4A3B J;  1MBF A;  4W1U A;  3SDG A;  1T56 A;  1P7I A;  1OCT C;  2Y9Z A;  1WH5 A;  3HDD A;  2VUM J;  4DYR A;  1MBG A;  2L7F P;  1K83 J;  5FKK A;  1GUU A;  3RZD J;  3W6V A;  2WV1 A;  1OFC X;  1RKW A;  1X2M A;  4C2M J;  5IPA A;  5J1Y A;  4W97 A;  5JLW A;  5F08 A;  3A01 A;  1ZTR A;  3G1L A;  1UG2 A;  1UHS A;  3BR5 A;  4EEF G;  5M5Y J;  1MH4 A;  2LK2 A;  2ECC A;  3ZQG A;  1H89 C;  5M5W J;  3FIW A;  1B72 A;  2OPT A;  2JWT A;  4RBO A;  4D5C A;  1GV5 A;  2L9R A;  3PO2 J;  1U9N A;  2M9H A;  1G2H A;  1JT6 A;  1MBH A;  4JP0 A;  3S1R J;  1ETV A;  3HEF A;  4XRS G;  2Y30 A;  4A3F J;  5M5X J;  2LTP A;  2VKE A;  3Q0W A;  4B4C A;  2LP0 A;  9ANT A;  2MW8 A;  3LNQ A;  2GM4 A;  3GTO J;  1FIA A;  3OIO A;  3TW7 A;  3TP0 A;  1JJ6 C;  5J1R A;  3BQY A;  2XPV A;  2HQ5 A;  1BW5 A;  4IEJ A;  3FIS A;  4MFE A;  1IC8 A;  1UMQ A;  3BTJ A;  1B8I A;  5IP7 J;  1EF4 A;  2P81 A;  1GVD A;  2LLK A;  1JTX A;  2VKV A;  4G12 A;  4X1E A;  3TED A;  4DW6 A;  4XID A;  5C4J J;  2XSD C;  1ETW A;  4DZJ A;  2MSY A;  3MKL A;  1JJ8 C;  4MIM A;  4DZP A;  2JA8 J;  3IH4 A;  5EGO B;  2B63 J;  3RZO J;  5EDN A;  1RR7 A;  5IP9 J;  3ZQL A;  1FJL A;  2K9S A;  4CYC B;  2E2I J;  2COB A;  1H88 C;  2L0K A;  5IOY A;  5J1U A;  2DA3 A;  2H1K A;  2ZB9 A;  4JX6 A;  3ZOB A;  3QPS A;  1BW6 A;  4QSH A;  1W0U A;  3BR3 A;  2XGC A;  4BKX A;  2M0C A;  1R9T J;  5FLM J;  2EZH A;  2DMU A;  1ETO A;  3HGG A;  2FJ1 A;  5F0C A;  2IBD A;  3O8G A;  2ELK A;  5FKL A;  2KT0 A;  1QPI A;  4BXX J;  1RET A;  3BR2 A;  4JX5 A;  5IOZ A;  1PUF A;  2K9N A;  4IHV A;  4XK4 A;  2JK3 A;  3RQI A;  4D5F A;  2HOT A;  2XB5 A;  2WAQ N;  4C3J J;  3TP3 A;  4A3M J;  1IUF A;  5F1J A;  3H3V K;  2JMW A;  3OOU A;  2JN6 A;  5EG0 A;  4XIC A;  5FJ8 J;  1W0T A;  3D1N I;  3GTK J;  3S1M J;  1HF0 A;  2LVS A;  1JUP A;  4C3I J;  1SAN A;  3O8H A;  1E3O C;  3HOV J;  1MBJ A;  1WPK A;  3B6C A;  3C2B A;  5BNG A;  3JRD A;  5FLV A;  2NVT J;  3HOU J;  3HOW J;  2EZI A;  3I4M J;  4MO7 A;  3CQZ J;  1GV2 A;  1F43 A;  5C4X J;  2TCT A;  2LY9 A;  1MBK A;  1LE8 A;  1NK2 P;  2R5Z A;  5E3O A;  2TRT A;  1HLV A;  4IHX A;  1FTZ A;  2XB0 X;  3A02 A;  5E3N A;  1Z0X A;  3LSJ A;  3WHC A;  2YU9 J;  1X58 A;  2LKX A;  5GP9 A;  2ECB A;  1DU6 A;  2Y9Y A;  3JRE A;  1I3Q J;  1YRN A;  5EEA A;  2NS8 A;  1OCP A;  2R7Z J;  4A3C J;  4LOC A;  3JRB A;  2E2H J;  1MSF C;  3S15 J;  5F27 A;  1B72 B;  1IDY A;  1JGG A;  4I6Z A;  2XRL A;  5EYR A;  1RES A;  4B1R A;  1BA5 A;  1ENH A;  2FD5 A;  1AHD P;  4AYB N;  4BBS J;  5M3M J;  1DU0 A;  2FX0 A;  3S2D J;  1IV6 A;  2XGD A;  4JX4 A;  3OSG A;  1FEX A;  3HBL A;  1JKR C;  1U9O A;  3FKI J;  3LOC A;  2DA5 A;  2AHQ A;  2E2J J;  2OF7 A;  3S1Q J;  3VPR A;  5C44 J;  3MN2 A;  2L7Z A;  4BY7 J;  4FE7 A;  1B8I B;  3PO3 J;  2CQX A;  1TWA J;  3JRA A;  1U8B A;  1VFC A;  2Y0S N;  4MFD A;  3BR1 A;  1APL C;  2LD5 A;  2ME6 A;  2HXO A;  4IHW A;  3S1N J;  5K7Z A;  2CJJ A;  1ETX A;  1QVU A;  2GLO A;  1WH7 A;  2EBI A;  1SFO J;  2LFB A;  2H8R A;  1VND A;  4J19 A;  3RKQ A;  1NTC A;  2CRG A;  3CCY A;  3JRF A;  4HNV A;  5DS9 A;  1ZR2 A;  1JKO C;  3OSF A;  2Y31 A;  2R0Q C;  3A03 A;  4M3D A;  1ZQ3 P;  2N8G A; 
#chains in the Genus database with same CATH topology
 1U78 A;  2VOP A;  3RJP A;  5IYD J;  2H6C A;  2E5Z A;  2M5W A;  3G1M A;  1JKP C;  2NAZ A;  2IEK A;  3PSF A;  3MKZ A;  1MNM C;  1R23 A;  1V54 H;  1AKH B;  2XF6 A;  1O3S A;  2IGN A;  5AIQ A;  2NOG A;  4KNY A;  4PSX A;  3IUO A;  2Z9O A;  1IN7 A;  1HW5 A;  5LRR A;  3FXR A;  2CSO A;  3CJT B;  1XC5 A;  2JJ7 A;  1D3Y A;  1CQT A;  1IUY A;  4CYC A;  4G6Q A;  3HC7 A;  3KLO A;  1VQO I;  1T33 A;  5BPI A;  2XAJ A;  1RKT A;  2M7A A;  2Z16 A;  4PSW A;  5DM6 F;  3WTY C;  3QYE A;  3NRV A;  4C2T A;  4L5J A;  3IC7 A;  2OZU A;  4UV9 A;  4CCK A;  2Q1Z B;  3FXL A;  4YEL A;  1FPQ A;  2HNH A;  2LF7 A;  2OCC H;  5ICE A;  3GX4 X;  2CQK A;  3B73 A;  1FOY A;  1TT0 A;  3GTQ J;  4GFB A;  2HOA A;  2K4J A;  1K4T A;  2NVQ J;  4I98 B;  1DGW Y;  1D8J A;  1TQM A;  5CQE A;  3GCM A;  3K4K A;  4FE4 A;  2HGC A;  1R7J A;  1IRF A;  4HX4 A;  2CQQ A;  5CVV A;  5BPD A;  5KVR A;  4WXD A;  1H8A C;  4RM2 A;  2FNP A;  2QGU A;  2D5V A;  5CVR A;  2OC6 A;  3CDL A;  3H0G J;  3SXY A;  1XN7 A;  3GEZ A;  2X0L A;  4BUP A;  5D5X B;  3KYD B;  4I0B A;  5LHG A;  1WJC A;  3I59 B;  2XHK A;  2QF7 A;  1WQ2 A;  3WTV C;  4JQF A;  2VE8 A;  2LNB A;  3IL2 A;  5HLH A;  1LPQ A;  3CO6 C;  5GTI C;  3HYI A;  3LL7 A;  2AXL A;  3LFU A;  5IYC J;  1WFX A;  3QPT A;  4WXC A;  4L5E A;  1WJF A;  5CYV A;  3OYH A;  1YX3 A;  2KKO A;  3VWB A;  5ILS A;  2JA6 J;  1FNN A;  2HI3 A;  4KN4 X;  4A3E J;  1D5V A;  3CES A;  1F5T A;  1T95 A;  1JXS A;  1NG6 A;  4V2F A;  4AU7 A;  3V7R A;  3FHN A;  4CZC A;  1CGP A;  1J2X A;  1IRZ A;  2ADU A;  2EH3 A;  3HPG A;  3HXL A;  3HKZ A;  2ISY A;  2JVG A;  2YR2 A;  1ZAR A;  3HHH A;  2QZ8 A;  1MH3 A;  4H4K C;  3OYJ A;  2KIM A;  5DTD A;  3CJN A;  5DUK A;  3EUH A;  4BQO A;  3GFI A;  4YFK F;  3LA3 A;  3CF5 F;  2MGQ A;  4LIT A;  4A0Y A;  4A69 C;  1D8K A;  4CIC A;  4D7M A;  3F6V A;  4BE0 A;  4E7K A;  3AKZ A;  1HCR A;  3BOQ A;  3TOA A;  4Z6Y A;  5K5O A;  2MH2 A;  5LGU A;  5BMZ A;  2HYJ A;  1BC7 C;  1Y1V J;  1S3J A;  2A05 A;  3J80 Z;  1LB2 A;  1JT0 A;  1GDT A;  2HOS A;  4PJ0 C;  2F6C A;  2EFO A;  1P4W A;  4CZZ A;  2O8X A;  5HLT A;  4IOC F;  2FE3 A;  5D4S A;  5ILU A;  3UKG A;  2Y69 H;  3KP5 A;  4L9V A;  1O4X A;  2EIK H;  2VQL A;  3GTL J;  2HQR A;  4A3D J;  5FKO A;  4ABZ A;  4R79 A;  3KX2 A;  2OAZ A;  1ERD A;  3FDY A;  3GTP J;  2XF5 A;  3NAR A;  1R4N B;  3CJQ B;  4AUX A;  5J4V A;  2RGV A;  2BW3 A;  2HS5 A;  3H1C A;  1F36 A;  1FTT A;  2FA5 A;  2L54 A;  1SFX A;  5F0F A;  3OYN A;  3K4N A;  2RQQ A;  1WHU A;  5FFX A;  2K7L A;  3CUQ A;  3CTA A;  4E6K G;  5CVI A;  2QSG X;  2QUF A;  3FBN B;  2H1L A;  4XLH A;  3BTL A;  4BXU A;  2LKP A;  1A5J A;  2KJC A;  3MWM A;  1TWG J;  5EGO A;  5EZH A;  2Y48 A;  4RAF A;  3T5X A;  3V8J A;  4ON0 A;  3BQZ A;  3RYP A;  3I3L A;  5E3L A;  2DN0 A;  1VQ8 I;  1V5E A;  2V9P A;  4UV8 A;  3ERE D;  2CUJ A;  3ZMT A;  2M34 A;  2BYV E;  1HOM A;  5DYM A;  4C3H J;  1NK3 P;  1X4O A;  1BJA A;  3SQN A;  1AKH A;  5IT3 A;  3CDI A;  3G4S I;  4P1W A;  4L0Y B;  3HRU A;  2W57 A;  5IYB J;  3CC7 I;  4O3M A;  4HBL A;  1V5F A;  3JR9 A;  1J75 A;  1REP C;  3OL4 A;  5GAD J;  2RRE A;  1PUE E;  1OKR A;  5KCM A;  3SEZ A;  4PFP A;  3LSG A;  1IZ1 A;  3QOP A;  1XS9 A;  3MKY B;  3TMO A;  1LE8 B;  2DYS H;  3HKZ N;  3AG2 H;  4UUV A;  4MQV A;  2HZD A;  2E5N A;  5DM7 F;  1O3R A;  1FZP B;  3GWZ A;  2V9V A;  3CLQ A;  3EQL F;  3VYU B;  4ZDL A;  4PDK A;  1ZH5 A;  4P55 A;  2F5F A;  5GAE J;  1POG A;  3RQ4 A;  4HA8 A;  5J4Y A;  5L3F A;  3MMY B;  3L2R A;  1R1U A;  1P2F A;  1A6I A;  3G1O A;  1A31 A;  1U5T B;  2VJ4 A;  4M3E A;  3DPL C;  3UR3 C;  5FGM A;  1JKQ C;  2EWN A;  4BBR J;  2P5V A;  5CQG A;  2M45 A;  2E34 A;  3L2V A;  2A68 F;  3M8F A;  4KMU X;  5L3C A;  3KP4 A;  3C1D A;  3SDG A;  1OCT C;  1WH5 A;  3RCO A;  3H9J A;  3REO A;  4BQN A;  4DYR A;  4ZZL A;  2WAQ A;  3I59 A;  2V1X A;  3K4J A;  2IS1 A;  1GUU A;  2YX4 A;  1Y0U A;  3DV8 A;  4YII A;  5EEG A;  1EKE A;  1X2M A;  4B43 A;  3N05 A;  5IPA A;  2J5P A;  3IWZ A;  1ZTR A;  3G1L A;  5ICC A;  2ZBK A;  4RGX A;  1UHS A;  2O5R A;  4KN7 X;  3CP8 A;  2JWT A;  2ZXJ A;  3PO2 J;  5JVG F;  2M9H A;  1G2H A;  1LEA A;  1MBH A;  5DCM A;  4IQJ A;  1ETV A;  1E3P A;  2Y30 A;  2FEZ A;  4B47 A;  2KIF A;  4B4C A;  1MJB A;  2LP0 A;  4FX0 A;  4KIT B;  2JUC A;  4RB1 A;  3WU0 A;  2DFE A;  2LF8 A;  2NNN A;  4LB6 B;  4MEY F;  1FIA A;  3OIO A;  4L9N A;  2FBI A;  3TP0 A;  4N4N B;  4BU2 A;  5J1R A;  2XPV A;  4BJT A;  5J8C A;  1OYY A;  2RN7 A;  2Z5U A;  2PBI A;  4IHT A;  2VJ5 A;  4MFE A;  2HOE A;  1IC8 A;  2VT2 A;  3OWT A;  5K1Y A;  5IP7 J;  2PN6 A;  2HFH A;  3HL2 A;  2P81 A;  5CJ9 A;  2LLK A;  1MMS A;  1OR7 A;  3RIR A;  3O6B B;  4OAZ A;  4DW6 A;  2WC2 A;  4IKF A;  2VOD A;  4WK8 F;  3V8L A;  3V7S A;  5JHF A;  4ZYH A;  1JJ8 C;  2JA8 J;  2D1H A;  3IH4 A;  3RZO J;  3QWL A;  3KYL A;  1RR7 A;  4EJT A;  2R7V A;  3OS2 A;  1SD7 A;  2M87 A;  2RQP A;  2A69 F;  3F72 A;  1VQL I;  5TRD A;  4HLY A;  5L3D A;  2XV4 S;  5CKT A;  5CVU A;  5HDN A;  2XAU A;  2ZME C;  3H35 A;  2KL4 A;  2ZB9 A;  5LGN A;  4ZDO A;  2E60 A;  4FQG A;  3J81 K;  1Y56 A;  4MTD A;  4EJU A;  3BR3 A;  4BKX A;  1OCC H;  1YS6 A;  1ETO A;  3IWF A;  1PVE A;  2FJ1 A;  2Y75 A;  2KDO A;  4DBQ A;  1S7A A;  3IHU A;  1RET A;  3BR2 A;  1L3L A;  4GXO A;  5IOZ A;  1OYI A;  4RAG A;  4DBR A;  4IHV A;  1YFH A;  2JK3 A;  1XDS A;  4YRV A;  1T0F C;  2XKP A;  4HDV A;  4BQA A;  1A6Q A;  4XLN F;  1YHQ I;  4CCL A;  2WAQ N;  3KP2 A;  4KIF A;  2WY7 Q;  3BG7 A;  4EVI A;  4A3M J;  3PQJ A;  2JMW A;  5AON A;  4M6Y A;  5A2Q Z;  4EM1 A;  2FXA A;  2HWV A;  3OYC A;  2J5O A;  3RTR A;  4BJ6 C;  2LVS A;  3I56 I;  2BXY A;  5J6X A;  2DXI A;  5JFR A;  4UB8 C;  4IX7 A;  1E3O C;  4UVA A;  1MBJ A;  5H20 A;  3H5R A;  5BNG A;  4BS9 A;  3L2U A;  4C9Y A;  3HOW J;  1KQ0 A;  5DDG A;  3VFZ A;  2BV6 A;  4IO9 F;  3QP5 A;  3WOD F;  3MD2 A;  4A6E A;  1LE8 A;  3M9A A;  4G94 A;  4XLF A;  4IHX A;  1FTZ A;  2DOE A;  2EPF A;  1T6S A;  4E7I A;  4CCJ A;  2YU9 J;  3WHC A;  4M71 A;  1Z21 A;  3FMQ A;  4IOA F;  3F8M A;  2LKX A;  1QZZ A;  2XAF A;  3IAS 2;  2VOO A;  1EH6 A;  3KCC A;  3L9F A;  1CF7 A;  2ELH A;  2FF4 A;  1YRN A;  5EEA A;  3F22 A;  4Q4Z F;  2NS8 A;  1YOV B;  1OCP A;  1U5T A;  4XKB A;  5CVJ A;  4A3C J;  2DK8 A;  1TNS A;  3TKY A;  3JAM K;  1B72 B;  1IDY A;  3JAM Z;  2DU9 A;  1JGG A;  2H6B A;  3OYM A;  1ENH A;  4Y33 A;  2L4A A;  1YTY A;  1YIO A;  1AHD P;  1DU0 A;  2FX0 A;  2RKH A;  1IV6 A;  1ZLJ A;  2XGD A;  1X4P A;  4E7L A;  4J01 A;  3OSG A;  4EJV A;  1DP7 P;  2F5E A;  1Z9C A;  4ENM A;  3SYT A;  2DA5 A;  2XAQ A;  2PX9 A;  2A6H F;  2W85 A;  5K5R A;  4HPQ A;  4CCO A;  4BY7 J;  4QPQ A;  1ULY A;  1J59 A;  1B8I B;  3ZPL A;  5DD8 A;  2PMZ A;  5LHH A;  4ZDP A;  3S3N A;  3H5N A;  1APL C;  1SD5 A;  2DDB A;  2FBH A;  2HXO A;  3FM5 A;  2ME6 A;  4OMY A;  3LWF A;  2WB1 A;  2VBY A;  1ETX A;  1MJ9 A;  2VKD A;  2X6Y A;  4MQ9 F;  2GLO A;  1BI3 A;  1W7P A;  3T8T A;  1D0X A;  3LMM A;  3CMM A;  4J19 A;  1OYW A;  3AG1 H;  1YG2 A;  2KJB A;  1ODD A;  2LRD A;  1N77 A;  3CCY A;  1J7K A;  1KA8 A;  1WVR A;  3JRF A;  1ZHF A;  4NC7 A;  3A03 A;  4KYW A;  2FOW A;  3K70 D;  4M3D A;  2CV0 A;  3GXO A;  4E7S A;  2HEO A;  3VEP A;  1ZQ3 P;  2PJR B;  2CU7 A;  2W24 A;  1SD4 A;  5FD5 A;  3IH3 A;  1W36 D;  4HSR A;  1BL0 A;  1I3A A;  3HOX J;  1MJA A;  3L2C A;  4RS8 A;  3Q3S A;  4KMF A;  2DMP A;  5EF6 A;  1JUS A;  2R7Q A;  2O8K A;  1ACI A;  1KU9 A;  3HHG A;  2HYF A;  1RZ4 A;  4B3A A;  2QBY B;  1IRX A;  5J40 A;  1ZN2 A;  4OU0 A;  4XN0 A;  2ZXW H;  3IV5 A;  4BAC A;  3AG4 H;  5JVT A;  3GBG A;  1ETQ A;  1EJ9 A;  4FAS D;  1X3U A;  3WTU C;  4F55 A;  2F2E A;  4YEJ A;  3BJ6 A;  3HGY A;  1ETK A;  2L9N A;  5DUI A;  3LSM A;  2DA2 A;  1LDD A;  4EQQ A;  2FQ4 A;  2Z33 A;  3S16 J;  3F23 A;  3F9K A;  4UUT A;  2D1V A;  1XSD A;  2O9L A;  3J7A Y;  3BR0 A;  3U21 A;  4IJA A;  1Z77 A;  2IVM A;  3DLA A;  3R0J A;  2LMD A;  5JR3 A;  2DOA A;  3ASO H;  1UEL B;  1D5Y A;  2DI3 A;  2IGM A;  2V9K A;  1X1C A;  3OS0 A;  1LVK A;  4CHU A;  4BEH B;  3OOP A;  2EK5 A;  4K2E A;  4RMN A;  2CV1 A;  3LA7 A;  3OR2 C;  1Q1H A;  2X48 A;  3LSP A;  1SVL A;  3HTS B;  1XB4 A;  2ZJR F;  5JHU A;  2HDD A;  3KP3 A;  2NVX J;  3KEO A;  2VC0 A;  2DJN A;  3LSK A;  1KQ9 A;  1QU3 A;  2L9S A;  4P9F A;  1ZK8 A;  3WGH A;  4BDZ A;  2EJR A;  2A6T A;  2R92 J;  3PNV A;  2PMZ N;  2KRC A;  5JLX A;  2IGK A;  4XRM A;  4ENK A;  1VQP I;  4L9T A;  4JYK A;  1UAA A;  2QSH X;  2WB1 N;  1K78 B;  2MAB A;  3BTC A;  3CMA I;  3S14 J;  3ABM H;  1MZB A;  4EM0 B;  1FYK A;  1OJL A;  1G6N A;  2E1M B;  3K0L A;  3ULQ B;  4XR6 A;  1MDM B;  3SFI A;  3ABU A;  5J3L A;  4CO8 A;  2EFN A;  2M2E A;  1SMY F;  2CW8 A;  2ZKZ A;  2DA4 A;  4P96 A;  3W6J B;  2CFX A;  2VE9 A;  2VN2 A;  3WE2 A;  4RGU A;  3OYF A;  5FLX K;  1V5G A;  3QYB A;  3SEQ A;  4RDU A;  4F52 A;  3QYF A;  5FLX Z;  1HDD C;  4IHS A;  1TC3 C;  2KRF A;  3EET A;  3S2H J;  4XRS A;  1UST A;  1PJR A;  3SFZ A;  1SAU A;  1DPR A;  1PP7 U;  4BJ5 C;  1UCR A;  4IRG A;  4MGR A;  1PP8 F;  1GHC A;  2L7K A;  1YIJ I;  1OPC A;  5L3B A;  3SJM A;  4IRH A;  1HW2 A;  3QU3 A;  5HOD A;  1OCZ H;  1BIA A;  2V7F A;  4UHT A;  1NH3 A;  5FB2 A;  2MG4 A;  1S7E A;  1Z6T A;  4XLE A;  1J9I A;  2EV0 A;  2OQR A;  2CUE A;  3FMS A;  4V2G A;  1H9G A;  2JA7 J;  1JHF A;  1JUM A;  2L7M P;  2LC2 A;  2QLZ A;  1TW3 A;  3BG3 A;  1JTY A;  1BJZ A;  2ZSH B;  3TBI A;  2BZT A;  1OCR H;  4LG0 B;  5ICF A;  1F9N A;  4RB0 A;  2RDP A;  3BJO A;  1UHM A;  4A5M A;  3TO9 A;  2R5Y B;  2VXZ A;  3FM3 A;  2JSP A;  4RAZ A;  1N25 A;  1VZ0 A;  2W48 A;  3HOY J;  1YLF A;  2OCE A;  4QIW N;  4V19 K;  2YS9 A;  4AIK A;  3HRM A;  2ME0 A;  2K9M A;  4A3K J;  4M3G A;  1PUF B;  3BPV A;  1U8R A;  1XGO A;  4ESB A;  3U1K A;  2L02 A;  3ZGK A;  4X6A J;  4LK1 F;  3ZMZ A;  3MVP A;  4RGR A;  4G7O F;  4A3J J;  3CCV I;  3Q0V A;  1K61 A;  4CUG A;  1XCB A;  1VQ7 I;  4IHY A;  1PDN C;  5B3S H;  2FML A;  1JGS A;  3EDP A;  1WCM J;  4GCV A;  3CC2 I;  3EYI A;  1ZRE A;  3ZQH A;  4CCN A;  1ON1 A;  3E5Q A;  1YJ9 I;  3Q5F A;  2JSC A;  2XPU A;  2JVH A;  1DP3 A;  2D2W A;  2Y0M A;  2ZCW A;  1KU7 A;  3GF2 A;  2IXS A;  1HQC A;  2OU2 A;  3RYR A;  3E1S A;  2E7W A;  3C2G A;  2QBY A;  1S8N A;  4E70 A;  2K3P A;  5FRM A;  3K6G A;  3IAM 2;  1NHA A;  1QZY A;  3G6E I;  3SHF A;  2LR8 A;  1ZR4 A;  1RIO H;  2I10 A;  2BBY A;  2R4G A;  3HSF A;  3K4L A;  4NQW B;  3CP2 A;  4PJL A;  1ZKG A;  3GTM J;  4FCY A;  2XPW A;  2ID6 A;  3K2A A;  2R93 J;  5E3M A;  1GT0 C;  2RVC A;  1IG7 A;  3KET A;  1R5H A;  1XG1 A;  2OJE D;  3P9C A;  4B48 A;  4PK4 A;  1B59 A;  4RLQ A;  1K79 A;  3V42 A;  4ESJ A;  3KYC B;  1T2K A;  3QQA A;  3E6B A;  4HST A;  1FBS A;  2EZK A;  2XGE A;  5HS9 A;  3K7A J;  4GO1 A;  3ROU A;  1PYV A;  3PIP F;  4A3B J;  2ACJ A;  1JI8 A;  4BEH A;  2H09 A;  1MBF A;  5J8F A;  2CG4 A;  2L4M A;  4IL6 C;  1XMA A;  3CCM I;  1IXC A;  1GVJ A;  3F8N A;  4W1U A;  2IA1 A;  1T56 A;  2G7U A;  2B9S A;  2Y9Z A;  2JRM A;  3SZP A;  4ZTF A;  2ZSI B;  1BR2 A;  2FBK A;  5IT9 K;  4FHT A;  4UNO A;  2CFO A;  3EUH C;  3A0B C;  3X2Q H;  5IT9 Z;  2L7F P;  1K83 J;  1FC3 A;  3W6V A;  2BGC A;  2HTJ A;  2QKM B;  2WBM A;  3R6S A;  1I27 A;  2HU9 A;  2HQA A;  1EV7 A;  5J1Y A;  5JLW A;  1UZC A;  5F08 A;  2GQQ A;  1MKM A;  3BCA A;  2OBP A;  3G2B A;  4KT5 C;  4B44 A;  1X1P A;  3MFK A;  2KIU A;  5D8K B;  1MH4 A;  2LK2 A;  5D5V B;  1SFU A;  2IRF G;  3I0T A;  1F4K A;  3NWS A;  3J7A O;  5M5W J;  1QBJ A;  1G3T A;  4RBO A;  4D5C A;  3DPU A;  3L7W A;  4JP0 A;  2I8D A;  2ZJQ F;  3HJE A;  2KIQ A;  5HLI A;  1R49 A;  3FHZ A;  4Q48 A;  4XRS G;  2JPB A;  4KIS A;  1JE8 A;  4PGG A;  2LTP A;  3F8C A;  3BP8 A;  1VQM I;  4HF2 A;  3P9I A;  3V8K A;  2GM4 A;  2V1U A;  2LBF B;  3M1E A;  3VSK A;  4N0B A;  3TW7 A;  4I09 A;  1R58 A;  4IPA A;  1YJN I;  1YO5 C;  4KJZ A;  3BQY A;  1J5Y A;  1HKT A;  2HTS A;  2HKX A;  4DNC A;  3CUQ C;  1UMQ A;  3I54 A;  1GVD A;  4G12 A;  2QQ9 A;  3TED A;  2XSD C;  5EEH A;  1T38 A;  1IXR C;  1YYV A;  1ETW A;  1QGP A;  4CA0 A;  2K3F A;  2MSY A;  3P9K A;  3WU2 C;  1Y39 A;  4RLF A;  1R22 A;  1UB9 A;  3GLL A;  2HVR A;  2IW5 A;  5EDN A;  3FXJ A;  2EV6 A;  1A35 A;  1HKS A;  5IP9 J;  3D5L A;  3ZCO A;  2C6Y A;  3ZQL A;  2Z3Y A;  3OYD A;  2DBB A;  1LQ1 A;  2MA3 A;  3EYY A;  1DPU A;  1MND A;  2WA0 A;  4YIF A;  3T1B A;  1H88 C;  1USS A;  3R0A A;  3WTS C;  2CW7 A;  4U0W A;  2O03 A;  5IOY A;  2IT0 A;  3TOB A;  4HDU A;  2R7O A;  1QHG A;  4LG0 A;  4CCM A;  2H1K A;  4JX6 A;  2ESH A;  1EA3 A;  4QSH A;  2DQL A;  4KT6 A;  1FSE A;  2UUZ A;  2ZME B;  3DBH B;  5FLM J;  1W5S A;  5LHI A;  1MMA A;  3CJR B;  3HGG A;  4F92 B;  1U3E M;  2KMU A;  2P8T A;  5F0C A;  2DLL A;  3ASN H;  2ZNY A;  1IN6 A;  2ELK A;  1QPI A;  4BXX J;  4E7J A;  4GYI A;  2M7B A;  1PUF A;  3M07 A;  3B02 A;  3KEY A;  2X6X A;  3O2P E;  3DP7 A;  3S2W A;  2W7N A;  5E8G A;  1QZE A;  2XB5 A;  3DPT A;  4MHG A;  2BXZ A;  5JI6 A;  4S04 A;  3BPX A;  4HX7 A;  5B1A H;  4XL9 A;  2XSJ C;  5F1J A;  1RR8 C;  1FOW A;  5FJ8 J;  1W0T A;  4HLX A;  1LJ9 A;  1JUP A;  1XGM A;  3JSP A;  2EFQ A;  6PAX A;  4Q5S F;  3B6C A;  2FNA A;  3C2B A;  2TDX A;  3L2W A;  5DEQ A;  5FLV A;  1DUX C;  3HOU J;  4NBQ A;  1KU2 A;  2RNJ A;  1ZGJ A;  2QA4 I;  2DOD A;  3PUF A;  4NQW A;  5E1Z B;  4L9J A;  1MBK A;  1YIT I;  4DQ2 A;  4YFN F;  5E3O A;  2TRT A;  4BAY A;  1HLV A;  4ZYD A;  5DD4 A;  1FY7 A;  3A02 A;  5E3N A;  1ZG5 A;  3TQN A;  2W00 A;  1WI9 A;  1Z0X A;  4LGW A;  2E1C A;  3H5A A;  3S3M A;  1X19 A;  2ECB A;  1OLT A;  3RKY A;  4XN3 A;  3JRE A;  2KQR A;  4ETS A;  1OCO H;  1WJD A;  4NUB A;  1S5L C;  4LOC A;  3DBR B;  3JRB A;  2CW0 F;  1FOX A;  2V4J C;  3DKW A;  4KFC A;  5FFZ A;  1BI1 A;  2GXG A;  4HQM A;  4CDG A;  3T8R A;  4N9H A;  1FOK A;  4OWR B;  3VSL A;  1BA5 A;  2FD5 A;  1HA8 A;  1K6O A;  2DT6 A;  1Z7U A;  1Z67 A;  4UVB A;  3K1P A;  5M3M J;  4CYD A;  2B0L A;  2JA2 A;  5LLQ A;  3ZXS A;  1P4X A;  3UNG C;  2IS2 A;  2CMP A;  2F5C A;  4MEX F;  1FEX A;  2BY2 A;  5TGT A;  1FT9 A;  3LOC A;  4BHP A;  3BCB A;  4HX8 A;  4RB3 C;  2AHQ A;  2E2J J;  3GLX A;  2LRE A;  4G7Z F;  2VQC A;  1AA7 A;  2KRH A;  1OR7 C;  2WAD A;  2K02 A;  3MN2 A;  5C44 J;  4ESF A;  3CZ6 A;  3VYR B;  4JOM A;  2HDC A;  3JRA A;  1YI2 I;  1IW7 F;  3C7J A;  3TGN A;  3JTH A;  3KIO A;  1SVM A;  4A0Z A;  5ICG A;  5E79 C;  4RGS A;  2GXA A;  2MYS A;  4BHB A;  1HBX G;  5HDG A;  3CCS I;  1WH7 A;  1LUJ B;  1ZEL A;  1XPX A;  1SFO J;  5D5W B;  3P7N A;  3RKQ A;  5GTH C;  4O6J A;  1UFM A;  1NTC A;  2JTV A;  2LBF A;  2A6E F;  4ANJ A;  2H94 A;  1ZR2 A;  2Y31 A;  3C2H A;  4CXF A;  2Q2E B;  4GYG A;  2KPM A;  1G8X A;  2D45 A;  2IAI A;  2GIV A;  2GXB A;  3HRT A;  3HSR A;  5FKM A;  4ZYE A;  1HC8 A;  2HDW A;  4IRI A;  2H8W A;  3J81 Z;  2RAE A;  1IDZ A;  3LQQ A;  3MQ0 A;  5K7F A;  5HS8 A;  3E3V A;  1SFK A;  1KQ8 A;  4UY8 I;  4DYQ A;  3Q0U A;  3BT9 A;  5FD6 A;  2M30 A;  3FK7 A;  1HSJ A;  2ISZ A;  1I1S A;  1I39 A;  2O7O A;  4QPO A;  5E18 F;  3S17 J;  2DCE A;  4II3 A;  3H9G A;  3ZMD A;  4CH7 A;  4GRI A;  4XOT A;  1LDK B;  2PJP A;  2ESN A;  1Y1W J;  4MLO A;  5F6F A;  4RB2 C;  3F21 A;  2EFW A;  1W1W E;  3HZJ A;  5DV5 A;  2GOX B;  3BY6 A;  5EG0 B;  2EIN H;  4F7Z A;  3I55 I;  1ITY A;  3CUO A;  2NS7 A;  2FMY A;  3I4N J;  1G3Y A;  2ICW G;  4Y17 A;  1WRJ A;  1T39 A;  2KDZ A;  4I01 A;  1QNT A;  2Z99 A;  5D8L B;  3GZN B;  4G8X A;  3L1P A;  2E1O A;  2A61 A;  4UUS B;  1EH7 A;  2MH9 A;  2A3S A;  3DU6 A;  3I64 A;  1E0E A;  3SZG A;  2VPR A;  1ORK A;  5GPA A;  4Y7N J;  1RNL A;  1N78 A;  2WV0 A;  3K4C A;  2UZK A;  1KYW A;  1MD0 A;  3F3X A;  1I1G A;  5EZG A;  3B6A A;  2HPI A;  3GFJ A;  1U5T C;  3AL0 B;  1VQ4 I;  1ZRF A;  2G0E A;  2V1D A;  3ZMV A;  3HTU A;  5H2F C;  2VQH A;  3MKW B;  1WJA A;  2G9W A;  3IP4 B;  2VLA A;  2M0M A;  2VQG A;  3A1Y A;  5GPC A;  3OYL A;  4B09 A;  2VBZ A;  1IJW C;  4KIG A;  4NNJ A;  4XSZ F;  2DMT A;  1P7J A;  3ZQF A;  4UXN A;  3G73 A;  3LQR A;  2EA4 A;  1LEB A;  1FMV A;  2MC4 A;  2X1E A;  3EUA A;  2CV2 A;  4QWQ A;  2Y2Z A;  3GTJ J;  2XF7 A;  3KP6 A;  3QAH A;  1ZYR F;  2OD5 A;  2ZFW A;  3FZV A;  1LFB A;  2LYC A;  2VPL A;  5F04 A;  3M3Y J;  3FKJ A;  3FXO A;  1J0R A;  2XVC A;  1X2N A;  4D7N A;  1AWC A;  4PJJ A;  1VI0 A;  3TO7 A;  1Y6I A;  2DFH A;  2P0W A;  3W2W A;  4MNU A;  2MD5 A;  3ECH A;  1RI7 A;  1WGX A;  3U2R A;  2ZJP F;  1QVT A;  1ONV A;  3H36 A;  2OQG A;  1X1D A;  4M3B A;  2GZW A;  3ZQC A;  4FT8 A;  4BH9 A;  1H0M A;  1UHW A;  5C3E J;  1WJE A;  1BBY A;  3TO6 A;  5F0H A;  2DA6 A;  1U2W A;  2YX7 A;  4BXF A;  1M1E B;  3DCF A;  4F3Q A;  3FMR A;  1IO2 A;  1FYL A;  4D1Q A;  3HOS A;  3KZI C;  1KON A;  2CGP A;  2MLK A;  3TDZ C;  4LK0 F;  3QU6 A;  1QPM A;  5B5E C;  4CSW A;  1KGS A;  3JRH A;  2HR3 A;  2EFP A;  3TW6 A;  2HVQ A;  3OYA A;  3BTI A;  4FTH A;  3U1D A;  2DDA A;  2GA2 A;  2DTZ A;  1B9N A;  3WHB A;  3NWT A;  2VI6 A;  5LGT A;  3KE2 A;  2VON A;  2IP2 A;  2NXN B;  3GFM A;  1NG7 A;  3QPH A;  4ZYG A;  2O6G E;  3ZMS A;  3FXK A;  4KIB A;  1X1B A;  2FQ3 A;  3IH2 A;  4ZYA A;  3FWE A;  3BG5 A;  5E1W A;  4Y3O A;  1LFU P;  2WAF A;  5D5U B;  1QHH D;  1Z05 A;  4QLC U;  3VB2 A;  5J47 A;  3OR1 C;  1WI3 A;  3OYI A;  2M8G X;  1WKM A;  2LOO A;  4QTR A;  2IS6 A;  2F4O B;  2QQ8 A;  1TWH J;  3M1C A;  1XTA A;  1TWF J;  3W3C A;  3IRQ A;  1I50 J;  2CQN A;  3BG6 A;  2E71 A;  2IJL A;  4AC0 A;  1YW8 A;  2R5Z B;  1YS7 A;  1G59 A;  2G7H A;  1FBU A;  1SC7 A;  1WZ2 A;  5L3G A;  1FP2 A;  2K85 A;  1B1B A;  3CME I;  4XSX F;  4GDF A;  4OIN F;  4ZC3 A;  4UB6 C;  3HOZ J;  2V6C A;  4I76 A;  4U88 A;  4G6D A;  2VKH A;  3PIO F;  4HAM A;  3JTG A;  3JRC A;  4UUS A;  1MNE A;  4Y4R A;  2MD0 A;  3JRG A;  2FUG 2;  4Y52 J;  4H0E A;  1T08 B;  4A3I J;  3NEU A;  4XKW A;  1P6R A;  3QRF F;  1C0W A;  2GAU A;  3ABT A;  4AIH A;  4A12 A;  3GZ5 A;  4RAY A;  1AOY A;  4XOR A;  2DOF A;  1FLI A;  3PFI A;  2DO7 A;  3SDB A;  3I58 A;  1BR1 A;  1WJB A;  2VUM J;  4HF1 A;  2R7S A;  1MBG A;  1YW7 A;  1Z6R A;  2P4W A;  3C3W A;  5FKK A;  3OIP A;  2WV1 A;  1OFC X;  2IS4 A;  2K5C A;  5TIS C;  1QA6 A;  1O3T A;  3FXM A;  2A5Y B;  4W97 A;  2CQ7 A;  4NHJ A;  1S7O A;  4PUS A;  1UG2 A;  4X0G A;  2GWR A;  2ECC A;  1H89 C;  2X6W A;  3CCQ I;  3RPQ A;  3FIW A;  5KAF C;  2ZC2 A;  2RNG A;  1B72 A;  2OPT A;  3WTW C;  2PG4 A;  3WTZ A;  2A5W A;  3CD6 I;  1U9N A;  3K2Z A;  3K4M A;  3DKX A;  1X1A A;  3RI4 A;  1WSU A;  2L01 A;  3CCE I;  4XRF A;  3WG7 H;  3WG9 A;  2KFD A;  2VKE A;  3Q0W A;  3JCU C;  4YG2 F;  1SAX A;  9ANT A;  2MW8 A;  2YSR A;  2NNY A;  3GTO J;  3PNT A;  1S9H A;  3I53 A;  1VQ9 I;  3CCL I;  3GYH X;  1JJ6 C;  4EJO A;  4R8H A;  2DW4 A;  2AXT C;  2P6S A;  2BW3 B;  1B8I A;  2DT7 B;  2YPR A;  5E8I A;  2KZV A;  1TW2 A;  5GAH J;  1XX5 A;  1JTX A;  2VKV A;  2VL8 A;  5AIP A;  5B66 C;  3ERM A;  3N4M A;  3CCR I;  5C4J J;  1BIB A;  3PSI A;  4DJA A;  3DQV C;  3MKL A;  3KPH A;  4MIM A;  2OTL I;  1D1C A;  4DZP A;  5EGO B;  1WWX A;  3GZ6 A;  2F5V A;  3HG9 A;  1D0Z A;  4BYY A;  2PMH A;  1FJL A;  3GVA A;  2K9S A;  2MBF A;  5LFA A;  4L0Z B;  2E2I J;  3LSI A;  2OZ6 A;  1FYM A;  2PFB A;  4S05 A;  2PJR A;  2FRH A;  2ZJ2 A;  1EH8 A;  3A2K A;  4EAT A;  1Z3X A;  3IKT A;  1VQK I;  3PJR A;  2Z2S B;  3ZOB A;  2STT A;  1BM9 A;  3QPS A;  3VYT B;  1BW6 A;  1W0U A;  2OUM A;  4M6X A;  2EB7 A;  1SMT A;  4Y15 A;  2NRA C;  1R9T J;  3VYS B;  3GUD A;  2EZH A;  2DMU A;  2PEX A;  4NC8 A;  4A6D A;  1G4D A;  4L18 B;  3BC8 A;  1S72 I;  4U7D A;  1F1Z A;  2IBD A;  3O8G A;  4JK1 X;  1BR4 A;  1I6X A;  2K9L A;  4OOI A;  5E17 F;  4JX5 A;  4XLP F;  2K9N A;  3FF5 A;  2M1B A;  3AAF A;  4EGY A;  3RQI A;  3G3Z A;  3DTK A;  2KZG A;  2L2O A;  4BHC A;  1RUN A;  5LEK A;  2GIZ A;  2QKL B;  1IUF A;  3H3Z A;  3WGG A;  2BVM A;  3OOU A;  3LST A;  3I71 A;  3GME A;  2WWY A;  3LAJ A;  3D1N I;  3GTK J;  2AQE A;  5EJC A;  2LKS A;  2LG4 A;  3HUG B;  5L3E A;  2NOJ B;  2ELJ A;  4R1H A;  3DU5 A;  4C3I J;  2X51 A;  1BOB A;  1SEU A;  2IPQ X;  1WPK A;  3K10 A;  2XAG A;  4OIQ F;  2NVT J;  4IQ4 A;  4XOP A;  3I4M J;  4N9I A;  2BHZ A;  1R36 A;  3CQZ J;  3K70 C;  4E7Z A;  1GV2 A;  1E2X A;  2TCT A;  2DAO A;  2LY9 A;  4JBA A;  1W36 C;  1P9Q C;  1ZRD A;  1R1T A;  2R5Z A;  2JRT A;  3RSN A;  3KLN A;  4AVZ A;  3LSJ A;  3PQK A;  2DTR A;  3QOE A;  3S8P A;  1FX7 A;  3PUB A;  1X58 A;  5GP9 A;  3HSE A;  5IY5 H;  1DU6 A;  1KU3 A;  3D0S A;  1HKQ A;  2Y9Y A;  4AVP A;  2F4I A;  1B9M A;  2OV7 A;  4KIC A;  1ZAO A;  2Q8K A;  3J7Y J;  1GXQ A;  3OIQ A;  2DT5 A;  2FOK A;  2I5U A;  3LFK A;  2HVS A;  2GA1 A;  3BRO A;  5D6E A;  3S15 J;  2E1M C;  5F27 A;  1IV8 A;  3W2A A;  2BE5 F;  2WY8 Q;  1RUO A;  2E7X A;  2XRL A;  1K78 A;  1FWZ A;  1RES A;  1TT5 B;  3OMY A;  3RPU D;  3KZY A;  1Y8Q B;  5DCM B;  1IN8 A;  3RKW A;  4LLL A;  1O57 A;  1MDM A;  5KNL A;  3GFL A;  3MZH A;  2VJJ A;  2NVU B;  3HBL A;  5D4R A;  3M8E A;  1JKR C;  3S1Q J;  2OF7 A;  1TTY A;  3VPR A;  4IXA A;  2R3S A;  4FE7 A;  2V79 A;  3PO3 J;  4HOB A;  2P5K A;  1TWA J;  1U8B A;  5CPR B;  3J80 K;  1X3W B;  4MFD A;  3RKX A;  3L09 A;  3MAJ A;  3N97 A;  3JW4 A;  2F48 A;  1XMX A;  4A5N A;  4IHW A;  5K7Z A;  2CJJ A;  5K5Q A;  1D0Y A;  1QVU A;  1BOA A;  2EBI A;  2VAS A;  2LFB A;  2H8R A;  3KP7 A;  3W2V A;  3E97 A;  1E3H A;  4BNC A;  4U7B A;  2NYX A;  4GGG A;  3E6D A;  1K4S A;  4I02 A;  2QSF X;  5DS9 A;  3OSF A;  2R0Q C;  2O61 A;  1MMN A;  1LDJ A;  1GLN A;  3TL4 X;  3WTT C;  2N8G A;  5ILV A;  2X6O A;  5LBQ A;  3ZR8 X;  3CLO A;  3FXU A;  2V6E A;  2ETH A;  3FK6 A;  1U0J A;  2IA2 A;  2ZXI A;  1ETY A;  3O3K A;  4PFO A;  2R5Y A;  1VF9 A;  2QWW A;  3BJA A;  4ZJZ A;  3BLY A;  3ABL H;  3BWG A;  4EGZ A;  2HKO A;  4XLA A;  3NQO A;  4BY1 J;  3CMY A;  1Y0N A;  1MSE C;  4M9Z A;  4XBF A;  5F1R A;  2M4K A;  3ELK A;  1BN5 A;  4C30 A;  3CCJ I;  3S32 A;  3E7L A;  4U0V A;  1IGN A;  4N4O B;  1DGR M;  3BZK A;  2DJI A;  1KZH A;  1MBE A;  5KHD A;  3H92 A;  1R5I D;  2XRO A;  4C2U A;  4XNF A;  1D1B A;  2IGO A;  3IRR A;  2R7W A;  1TNT A;  3GTG J;  3ZQI A;  2XAH A;  2DMN A;  2KP6 A;  4WWC A;  2GOM A;  1B6A A;  1SVO A;  2BY1 A;  2DYR H;  2XUB A;  4HEA 2;  4II2 A;  1Z1D A;  5FRN A;  2EV5 A;  2JZY A;  1FSH A;  4HQE A;  1FIP A;  2FU4 A;  1HDP A;  3DXJ F;  1W7P D;  3BR6 A;  2HPM A;  5IP6 A;  2LY1 A;  2CUF A;  1Y8R B;  2DPD A;  1LFP A;  2QCO A;  1FMW A;  3HM5 A;  4NC6 A;  3VOE A;  3V4G A;  2VIX A;  3DFG A;  2Q0O A;  1CF7 B;  3HUG A;  1XCV A;  4YIR X;  2X1C A;  3U9G A;  1YRN B;  3R60 A;  4D9J A;  4M9S A;  2A07 F;  3IKV A;  1V55 H;  2NVY J;  1S29 A;  3DEE A;  5D6F A;  3A01 B;  3OS1 A;  4F91 B;  4BE2 A;  4M6V A;  2X85 A;  3G71 I;  4XLC A;  3C18 A;  1TQP A;  5K7H A;  2V1N A;  1ZGW A;  4S0H B;  2XGX A;  4I99 C;  1TZL A;  4BE1 A;  3SZT A;  3WU1 B;  4RA2 A;  2HZT A;  4E7H A;  3GW2 A;  5FRO A;  2JPC A;  4AD9 A;  4D0P A;  2EIL H;  2E35 A;  4FET A;  4KA4 A;  1K7A A;  2VBX A;  4G9Y A;  2VXD A;  2X9D A;  4HRI A;  3WTX C;  2YU3 A;  4M72 A;  5HVQ C;  4OIP F;  5LRS A;  4ENN A;  4F93 B;  3PFY A;  4HNT A;  2K40 A;  1MW7 A;  3WGI A;  4XON A;  1R6R A;  1OIS A;  3DWL E;  2E19 A;  4AM3 A;  3LSR A;  4A93 J;  1YQA A;  1LNW A;  2R7D A;  2EZL A;  5HLG A;  2PI0 A;  2O0Y A;  2JA5 J;  4PCQ A;  4LLN A;  5TJJ A;  1U6G A;  3K1N A;  1XGN A;  4WX9 A;  2K86 A;  2GBY A;  2KIS A;  3OV8 A;  1VQ5 I;  2VBW A;  3PM1 A;  1W7P B;  2DA7 A;  1R4M B;  2LSO A;  3ML6 A;  2NS0 A;  2H27 A;  2QVO A;  4U0Y A;  4CGZ A;  2CH0 A;  1HST A;  2Z1D A;  3HB9 A;  1LVA A;  2ZO4 A;  3CO7 C;  2R7F A;  2EA2 A;  4O5V A;  4LIU A;  4OAY A;  3P5J A;  4ZTJ A;  3JRI A;  3KFW X;  1XSX A;  2PQ8 A;  1I6H J;  4HZF A;  4RM3 A;  1IAW A;  4AID A;  4A3G J;  4A3L J;  2YUS A;  1I5Z A;  4WXH A;  4B8X A;  5ED4 A;  3OYG A;  3CCU I;  1OMI A;  4Y13 A;  4OIO F;  2DA1 A;  1Q1V A;  1T98 A;  2F4M B;  2EQR A;  1VQN I;  2F5D A;  3QPL A;  5LEJ A;  3DTE A;  3BG9 A;  2QM3 A;  2BHY A;  4M3F A;  4Q47 A;  1UJ8 A;  4FX4 A;  4P5O A;  3BZ6 A;  2QYO A;  2ID3 A;  4NDL A;  4U87 A;  3ZQQ A;  2OTJ I;  2L3D A;  1IXS B;  4KDP A;  2EIJ H;  2CS3 A;  3ZQ7 A;  5M3F J;  2LY2 A;  2M4G A;  3DBL B;  4WCG A;  5HS7 A;  2L5Q A;  1RPW A;  2E36 A;  3RDI A;  2QEN A;  3ECO A;  1W5T A;  1HW1 A;  2W84 A;  3ESW B;  1AU7 A;  3Q9S A;  2ZME A;  3CDH A;  1YX5 A;  3RPU A;  2K9Q A;  3BDD A;  2E1N A;  2VB6 A;  5KK1 A;  3AG3 H;  1QO0 D;  2W25 A;  3M4O J;  4HYE A;  2OA4 A;  3DEU A;  2XAS A;  2M3A A;  4EJW A;  3OYB A;  2AO9 A;  5FKN A;  2XDV A;  2B7E A;  2VJI A;  1QRY A;  3I5U A;  4FIS A;  2P6T A;  3MCZ A;  1BC8 C;  3DEW A;  5A2Q K;  4G7H F;  3F0C A;  2DMQ A;  3NAU A;  3F6O A;  1XD7 A;  1T0F A;  1TWC J;  2P5L C;  1P92 A;  2W82 A;  3E6M A;  2ZNZ A;  2XC7 A;  2HYG D;  3J7Z I;  3I4P A;  2BEO A;  4DYC A;  4A0X A;  2UXN A;  4IVN A;  4LLG F;  2MFZ A;  2HXI A;  3PNY A;  2CO5 A;  2O3F A;  1FP1 D;  3M7G A;  4XM3 A;  2DFF A;  3MEX A;  1MIJ A;  3COA C;  5HNH A;  3ZMU A;  4HF0 A;  2CUZ A;  4DOZ A;  2COM A;  4HV5 A;  1G3W A;  3OY9 A;  2X4H A;  1P7I A;  1MMD A;  3DKY A;  1SD6 A;  3QP6 A;  2JUG A;  3OYK A;  4PGH A;  1N75 A;  3HIF A;  4DGW B;  3HDD A;  1ZG1 A;  3MZY A;  4IF4 A;  1E17 A;  4BDY A;  3H9Q A;  3RZD J;  1B4A A;  5FO5 A;  4OIR F;  4ASN A;  4HW0 A;  3KZZ A;  4BL0 B;  2ZFU A;  4EM2 A;  1RKW A;  1G3S A;  4C2M J;  3OYE A;  4AIJ A;  3A01 A;  3T0Y A;  1W4M A;  1HXD A;  2UXX A;  4L5I A;  3BR5 A;  5M5Y J;  4EEF G;  2PMU A;  4HV6 A;  3ZQG A;  3FXQ A;  3OL3 A;  4I7H A;  1UG0 A;  4P9U A;  1K6Y A;  1GV5 A;  2L9R A;  1JT6 A;  3H0D A;  3S1R J;  2MLG A;  3D5S C;  2R7R A;  1LKX A;  2MC3 A;  4KUM A;  1H9T A;  3HEF A;  3QOD A;  4A3F J;  5M5X J;  5BOX A;  1STZ A;  4J00 A;  2BOL A;  2V26 A;  3ZRG A;  5LD2 C;  3LNQ A;  1J09 A;  3A0H C;  3LAP A;  1O7L A;  1Z7L A;  2DQR A;  3D5R C;  4LJZ F;  4Z2Y A;  4YFX F;  1TQI A;  2HQ5 A;  3CC4 I;  5DCF A;  1BW5 A;  4IEJ A;  3FIS A;  3FX3 A;  3BTJ A;  1WJ5 A;  1EF4 A;  4I0A A;  2XKO A;  5KAI C;  3PL8 A;  3S93 A;  4X1E A;  1YJW I;  4XID A;  2ZXH A;  3HRS A;  1W5C C;  2BVL A;  4DZJ A;  1R71 A;  3LSH A;  3HPH A;  2L9V A;  4ZZD A;  1BI0 A;  3FBI B;  1RC9 A;  2B63 J;  3BZC A;  4ITV A;  4LG3 A;  3DLL F;  2LH9 A;  5H6Q A;  4AWX B;  4AYB A;  4NB5 A;  3M8J A;  1IN5 A;  4XKC A;  1L0O C;  1QQI A;  4OMZ A;  2VT3 A;  4LIV A;  1ZRC A;  1TLH B;  2XIG A;  3H3U A;  4XQF A;  4CYC B;  1O7F A;  1YE9 A;  2COB A;  2Q2E A;  1OQY A;  1XGS A;  2HQN A;  2L0K A;  2STW A;  5E20 A;  5J1U A;  4LFU A;  2DA3 A;  5GAG J;  1FBQ A;  1S6L A;  3V7C A;  1XDU A;  3DTI A;  5BS6 A;  3I9V 2;  5HDK A;  1Z91 A;  4M73 A;  1ON2 A;  2XGC A;  4M9X A;  2M0C A;  3ZN0 A;  4HG2 A;  4MTE A;  4ZH4 F;  3K4B A;  2JT1 A;  1V4R A;  2Y0S A;  5F64 A;  2UV1 A;  2VC1 A;  1SFE A;  1KYZ A;  5FKL A;  2KT0 A;  4XKV A;  4E4H A;  2PLY A;  2P7V B;  4BGD A;  2CWE A;  3ABK H;  1VQ6 I;  4XK4 A;  1TL8 A;  4D5F A;  2RV8 A;  2HOT A;  2EIM H;  2W4S A;  1O3Q A;  4A2U A;  4XMY A;  3K9T A;  4C3J J;  1YW9 A;  3TP3 A;  5HOO A;  3H3V K;  2K27 A;  2WAE A;  4IZZ A;  4ENJ A;  4LB5 A;  1MGT A;  2JN6 A;  5EG0 A;  4XIC A;  3S1M J;  1IN4 A;  3K69 A;  1HF0 A;  4HNU A;  5BQT A;  3CF2 A;  1V3F A;  1SAN A;  3O8H A;  1ZG3 A;  3HOV J;  3E5X A;  1TP4 A;  1R00 A;  2K4B A;  3MZ8 A;  4DIQ A;  3JRD A;  2X1D A;  4LMY A;  2EZI A;  4MO7 A;  3R4K A;  3R61 A;  1X3Z B;  2W1O A;  2IA0 A;  2QQA A;  5C4X J;  3ZN1 A;  2DPU A;  1F43 A;  2WTE A;  3L00 A;  3AL0 C;  1RRJ A;  1D1A A;  1NK2 P;  4EMS A;  2AQF A;  3GO5 A;  2XB0 X;  2KHM A;  3F8B A;  1BI2 A;  3VDX A;  1A36 A;  3JSO A;  3WE3 A;  5E1X A;  2JQ7 A;  1VTN C;  3EUK L;  3TDU C;  1I3Q J;  3L2Q A;  1GXP A;  2P7C B;  3K1M A;  2BY0 A;  3LA2 A;  2R7Z J;  4PJN A;  3Q9V A;  2E2H J;  3ONQ A;  3KEQ A;  3HOT A;  5B1B H;  1MSF C;  1IF1 A;  4WF2 A;  2CYY A;  3DF8 A;  1JHH A;  4I6Z A;  5EYR A;  2BY3 A;  2UWM A;  4LD5 A;  4B1R A;  3E6C C;  4I2O A;  2R7X A;  2M8E A;  4PJM A;  4BBS J;  4AYB N;  5H6R A;  3S2D J;  3E5U A;  1XMK A;  4JX4 A;  2QQB A;  1P4A A;  1T8I A;  4UVC A;  1Z3Y A;  1U9O A;  3FKI J;  1A04 A;  2R7T A;  1ZGA A;  2DFI A;  3VOD A;  3S3O A;  1IRG A;  4G6T B;  4BQQ A;  5CLS A;  2LDU A;  2L7Z A;  2QEX I;  4M74 A;  2CQX A;  3F8F A;  3W6K B;  1DQU A;  2DK5 A;  1VFC A;  2AS5 F;  4EV0 A;  2Y0S N;  2RC4 A;  1TBX A;  1R1V A;  3ISP A;  3BR1 A;  2LD5 A;  1MMG A;  3S1N J;  1XSV A;  3CUQ B;  1DDN A;  4TV7 A;  4B3X A;  1R5G A;  2XRN A;  1VND A;  2KLO A;  2FSW A;  5HNF A;  2CRG A;  3ZP5 A;  3A4C A;  5ERI A;  3E0J B;  4HNV A;  1ZLK A;  1JKO C;  4PZJ A;  2R7U A;  3AFH A;  3EPZ A; 
#chains in the Genus database with same CATH homology
 1U78 A;  2CU7 A;  2X6O A;  3IH3 A;  2IAI A;  5IYD J;  1BL0 A;  3HOX J;  3FK6 A;  3G1M A;  1JKP C;  1ETY A;  5FKM A;  2IEK A;  3Q3S A;  2R5Y A;  2DMP A;  1MNM C;  5EF6 A;  1VF9 A;  1JUS A;  1AKH B;  2RAE A;  1IDZ A;  5K7F A;  2O8K A;  2NOG A;  4DYQ A;  4B3A A;  3Q0U A;  3BT9 A;  3FK7 A;  4BY1 J;  3CMY A;  1XC5 A;  2O7O A;  2JJ7 A;  3IV5 A;  1CQT A;  1MSE C;  4CYC A;  3S17 J;  3GBG A;  1ETQ A;  1T33 A;  1RKT A;  3E7L A;  1Y1W J;  4MLO A;  3HGY A;  1ETK A;  1IGN A;  5EG0 B;  1ITY A;  1MBE A;  2DA2 A;  2NS7 A;  3S16 J;  2FQ4 A;  3I4N J;  4UUT A;  2O9L A;  2KDZ A;  3BR0 A;  3GTG J;  3ZQI A;  3GTQ J;  1Z77 A;  2DMN A;  2HOA A;  4GFB A;  3L1P A;  2NVQ J;  2E1O A;  4UUS B;  1D5Y A;  4FE4 A;  2VPR A;  1ORK A;  2CQQ A;  1FIP A;  5GPA A;  4Y7N J;  1HDP A;  1H8A C;  3BR6 A;  5IP6 A;  2D5V A;  3LSP A;  2X48 A;  3CDL A;  3H0G J;  2CUF A;  2HDD A;  2NVX J;  5EZG A;  3B6A A;  2DJN A;  2QCO A;  3HM5 A;  2G0E A;  2QF7 A;  1ZK8 A;  1YRN B;  2R92 J;  2NVY J;  2PMZ N;  5IYC J;  3A01 B;  4M6V A;  5JLX A;  4L5E A;  5GPC A;  4XRM A;  1IJW C;  4JYK A;  5K7H A;  1ZGW A;  4S0H B;  2WB1 N;  2DMT A;  1P7J A;  2JA6 J;  3ZQF A;  2HI3 A;  4A3E J;  3BTC A;  3S14 J;  1OJL A;  4V2F A;  3SFI A;  5J3L A;  1IRZ A;  2X9D A;  2EH3 A;  2M2E A;  2Y2Z A;  3GTJ J;  2DA4 A;  1MH3 A;  5DTD A;  2K40 A;  1LFB A;  5F04 A;  4RDU A;  2E19 A;  2MGQ A;  1HDD C;  3M3Y J;  3LSR A;  4A93 J;  1TC3 C;  4A69 C;  4D7M A;  4D7N A;  1X2N A;  2EZL A;  1HCR A;  3S2H J;  1VI0 A;  4XRS A;  2HYJ A;  2JA5 J;  1Y1V J;  1WGX A;  2GBY A;  1QVT A;  1JT0 A;  3PM1 A;  1GDT A;  2HOS A;  2DA7 A;  4M3B A;  3SJM A;  3ZQC A;  5HOD A;  3UKG A;  2MG4 A;  1S7E A;  1O4X A;  5C3E J;  3GTL J;  5F0H A;  2DA6 A;  4A3D J;  3HB9 A;  5FKO A;  4ABZ A;  2CUE A;  3DCF A;  4V2G A;  2JA7 J;  3GTP J;  3NAR A;  2L7M P;  1JUM A;  3JRI A;  3BG3 A;  1JTY A;  4AUX A;  1BJZ A;  1I6H J;  1F36 A;  1FTT A;  3JRH A;  4A3G J;  5F0F A;  2R5Y B;  4A3L J;  2YUS A;  3TW6 A;  3BTI A;  4FTH A;  2DA1 A;  1Q1V A;  2W48 A;  2EQR A;  3HOY J;  3BTL A;  3QPL A;  1A5J A;  2DTZ A;  3WHB A;  4QIW N;  3BG9 A;  2YS9 A;  1TWG J;  2VI6 A;  5EGO A;  2ME0 A;  5EZH A;  4M3F A;  4A3K J;  4M3G A;  1PUF B;  3BQZ A;  5E3L A;  2ID3 A;  4NDL A;  2DN0 A;  4X6A J;  3MVP A;  3IH2 A;  4A3J J;  3Q0V A;  1K61 A;  5M3F J;  4IHY A;  3BG5 A;  1RPW A;  2M34 A;  1WCM J;  1LFU P;  1HOM A;  4C3H J;  1NK3 P;  3ZQH A;  1AU7 A;  1AKH A;  2XPU A;  1WI3 A;  2K9Q A;  2M8G X;  4QTR A;  5IYB J;  3JR9 A;  3M4O J;  1TWH J;  2AO9 A;  5FKN A;  1TWF J;  2LR8 A;  1ZR4 A;  3LSG A;  1I50 J;  1QRY A;  2I10 A;  1XS9 A;  4FIS A;  1LE8 B;  4AC0 A;  1ZKG A;  3DEW A;  2R5Z B;  3GTM J;  3HKZ N;  4FCY A;  2XPW A;  3F0C A;  2DMQ A;  3NAU A;  2ID6 A;  3K2A A;  1TWC J;  2R93 J;  5E3M A;  1GT0 C;  1IG7 A;  1XG1 A;  4DYC A;  1POG A;  3HOZ J;  4I76 A;  2HXI A;  4UUS A;  1A6I A;  3G1O A;  3QQA A;  3JRC A;  3JRG A;  4M3E A;  2EZK A;  4Y52 J;  2XGE A;  1JKQ C;  3K7A J;  4BBR J;  4A3I J;  4A3B J;  1MBF A;  4W1U A;  3SDG A;  1T56 A;  1P7I A;  1OCT C;  2Y9Z A;  1WH5 A;  3HDD A;  2VUM J;  4DYR A;  1MBG A;  2L7F P;  1K83 J;  5FKK A;  1GUU A;  3RZD J;  3W6V A;  2WV1 A;  1OFC X;  1RKW A;  1X2M A;  4C2M J;  5IPA A;  5J1Y A;  4W97 A;  5JLW A;  5F08 A;  3A01 A;  1ZTR A;  3G1L A;  1UG2 A;  1UHS A;  3BR5 A;  4EEF G;  5M5Y J;  1MH4 A;  2LK2 A;  2ECC A;  3ZQG A;  1H89 C;  5M5W J;  3FIW A;  1B72 A;  2OPT A;  2JWT A;  4RBO A;  4D5C A;  1GV5 A;  2L9R A;  3PO2 J;  1U9N A;  2M9H A;  1G2H A;  1JT6 A;  1MBH A;  4JP0 A;  3S1R J;  1ETV A;  3HEF A;  4XRS G;  2Y30 A;  4A3F J;  5M5X J;  2LTP A;  2VKE A;  3Q0W A;  4B4C A;  2LP0 A;  9ANT A;  2MW8 A;  3LNQ A;  2GM4 A;  3GTO J;  1FIA A;  3OIO A;  3TW7 A;  3TP0 A;  1JJ6 C;  5J1R A;  3BQY A;  2XPV A;  2HQ5 A;  1BW5 A;  4IEJ A;  3FIS A;  4MFE A;  1IC8 A;  1UMQ A;  3BTJ A;  1B8I A;  5IP7 J;  1EF4 A;  2P81 A;  1GVD A;  2LLK A;  1JTX A;  2VKV A;  4G12 A;  4X1E A;  3TED A;  4DW6 A;  4XID A;  5C4J J;  2XSD C;  1ETW A;  4DZJ A;  2MSY A;  3MKL A;  1JJ8 C;  4MIM A;  4DZP A;  2JA8 J;  3IH4 A;  5EGO B;  2B63 J;  3RZO J;  5EDN A;  1RR7 A;  5IP9 J;  3ZQL A;  1FJL A;  2K9S A;  4CYC B;  2E2I J;  2COB A;  1H88 C;  2L0K A;  5IOY A;  5J1U A;  2DA3 A;  2H1K A;  2ZB9 A;  4JX6 A;  3ZOB A;  3QPS A;  1BW6 A;  4QSH A;  1W0U A;  3BR3 A;  2XGC A;  4BKX A;  2M0C A;  1R9T J;  5FLM J;  2EZH A;  2DMU A;  1ETO A;  3HGG A;  2FJ1 A;  5F0C A;  2IBD A;  3O8G A;  2ELK A;  5FKL A;  2KT0 A;  1QPI A;  4BXX J;  1RET A;  3BR2 A;  4JX5 A;  5IOZ A;  1PUF A;  2K9N A;  4IHV A;  4XK4 A;  2JK3 A;  3RQI A;  4D5F A;  2HOT A;  2XB5 A;  2WAQ N;  4C3J J;  3TP3 A;  4A3M J;  1IUF A;  5F1J A;  3H3V K;  2JMW A;  3OOU A;  2JN6 A;  5EG0 A;  4XIC A;  5FJ8 J;  1W0T A;  3D1N I;  3GTK J;  3S1M J;  1HF0 A;  2LVS A;  1JUP A;  4C3I J;  1SAN A;  3O8H A;  1E3O C;  3HOV J;  1MBJ A;  1WPK A;  3B6C A;  3C2B A;  5BNG A;  3JRD A;  5FLV A;  2NVT J;  3HOU J;  3HOW J;  2EZI A;  3I4M J;  4MO7 A;  3CQZ J;  1GV2 A;  1F43 A;  5C4X J;  2TCT A;  2LY9 A;  1MBK A;  1LE8 A;  1NK2 P;  2R5Z A;  5E3O A;  2TRT A;  1HLV A;  4IHX A;  1FTZ A;  2XB0 X;  3A02 A;  5E3N A;  1Z0X A;  3LSJ A;  3WHC A;  2YU9 J;  1X58 A;  2LKX A;  5GP9 A;  2ECB A;  1DU6 A;  2Y9Y A;  3JRE A;  1I3Q J;  1YRN A;  5EEA A;  2NS8 A;  1OCP A;  2R7Z J;  4A3C J;  4LOC A;  3JRB A;  2E2H J;  1MSF C;  3S15 J;  5F27 A;  1B72 B;  1IDY A;  1JGG A;  4I6Z A;  2XRL A;  5EYR A;  1RES A;  4B1R A;  1BA5 A;  1ENH A;  2FD5 A;  1AHD P;  4AYB N;  4BBS J;  5M3M J;  1DU0 A;  2FX0 A;  3S2D J;  1IV6 A;  2XGD A;  4JX4 A;  3OSG A;  1FEX A;  3HBL A;  1JKR C;  1U9O A;  3FKI J;  3LOC A;  2DA5 A;  2AHQ A;  2E2J J;  2OF7 A;  3S1Q J;  3VPR A;  5C44 J;  3MN2 A;  2L7Z A;  4BY7 J;  4FE7 A;  1B8I B;  3PO3 J;  2CQX A;  1TWA J;  3JRA A;  1U8B A;  1VFC A;  2Y0S N;  4MFD A;  3BR1 A;  1APL C;  2LD5 A;  2ME6 A;  2HXO A;  4IHW A;  3S1N J;  5K7Z A;  2CJJ A;  1ETX A;  1QVU A;  2GLO A;  1WH7 A;  2EBI A;  1SFO J;  2LFB A;  2H8R A;  1VND A;  4J19 A;  3RKQ A;  1NTC A;  2CRG A;  3CCY A;  3JRF A;  4HNV A;  5DS9 A;  1ZR2 A;  1JKO C;  3OSF A;  2Y31 A;  2R0Q C;  3A03 A;  4M3D A;  1ZQ3 P;  2N8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...