1IDZA

Structure of myb transforming protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idzA00
2LFBA 2JA7J 2E2JJ 2GBYA 1MH4A 1MH3A 2PMZN 3DEWA 3WHCA 1GV2A 5EZGA 4IHYA 3S14J 5IP9J 1IUFA 2CUFA 3H0GJ 3K7AJ 2FD5A 3FK7A 3Q0UA 2EBIA 2AHQA 4D7MA 3TEDA 3QQAA 4MFEA 1UG2A 2DTZA 2HOAA 2GLOA 2G0EA 2LP0A 5DS9A 5J1YA 3K2AA 4DYCA 1T33A 4EEFG 1APLC 1MSFC 5C4XJ 3G1LA 1LE8A 4A3FJ 3PM1A 1OJLA 1XS9A 1D5YA 5FKMA 2OF7A 3S1NJ 5M3MJ 1YRNB 1TWFJ 2LY9A 1JT6A 4BBSJ 2HI3A 2EQRA 2RAEA 2HXIA 2DN0A 2AO9A 3OIOA 1ZR2A 4S0HB 4DZPA 3W6VA 2WAQN 5FLMJ 3BR3A 2ME0A 5EGOA 1IC8A 3LOCA 1FTTA 4DW6A 2ECCA 1WPKA 1MBKA 3M4OJ 2ECBA 1POGA 1QVUA 2CUEA 1JTYA 3JRCA 3HB9A 1JKOC 1ZK8A 2R5YB 2DMNA 5FKOA 3RKQA 3IH4A 3C2BA 5GPAA 2FX0A 3BR2A 4A93J 3NARA 4QSHA 3MN2A 1VF9A 5F0FA 3I4MJ 1RETA 4AYBN 4B3AA 1U8BA 1AKHA 4G12A 5F04A 2L7FP 2XPWA 4L5EA 3CMYA 3BQZA 2LKXA 1DU0A 1TC3C 5HODA 3S15J 3IH3A 5EGOB 2XB5A 4QTRA 3GTPJ 3S1RJ 1ZR4A 4FTHA 2JN6A 3JRIA 2LVSA 5IPAA 4XICA 2VKEA 2DMQA 2NS7A 5EDNA 3G1OA 2FQ4A 2EZHA 3FISA 3RZDJ 1MBJA 4A3DJ 2CQXA 4JX5A 2IAIA 2K40A 2E2IJ 1BJZA 2L7MP 2ID6A 1A6IA 1GDTA 2DMPA 3HOZJ 1ETYA 3BG3A 4M3DA 1Q1VA 4BKXA 2NOGA 4C2MJ 2NS8A 4BY7J 1X2MA 1B72A 3OSGA 1FTZA 3QPSA 3ZQCA 2TRTA 4MIMA 4A3LJ 1IV6A 3Q0VA 2HDDA 1BA5A 2DA1A 5EF6A 1JTXA 1AU7A 2DJNA 5M3FJ 2M34A 2Y9YA 3GBGA 4MO7A 2R93J 4D5FA 4I6ZA 4A3JJ 3LSRA 4W1UA 1WCMJ 2ZB9A 1VNDA 4D7NA 4HNVA 2M0CA 2JWTA 3HOWJ 2O9LA 2NVQJ 1ZGWA 3HOUJ 2JK3A 2HOSA 2N8GA 1U78A 1CQTA 2YS9A 3L1PA 3FK6A 4AC0A 5IYDJ 1NK2P 4J19A 1FJLA 1ZKGA 3HM5A 2EZIA 1JUPA 1P7IA 5E3MA 4JYKA 1RR7A 4BY1J 2R5ZA 3MKLA 5IP7J 3A02A 1VFCA 4FE4A 2JA8J 1GV5A 3BR1A 2OPTA 4A3IJ 5J1RA 1HLVA 1ZQ3P 1F43A 4B1RA 1GT0C 1B8IB 4GFBA 3M3YJ 2CQQA 3SDGA 3BR5A 2K9NA 3O8GA 5EZHA 4BBRJ 1NTCA 2YU9J 3HDDA 1AHDP 5E3LA 4UUSA 5F08A 1HDPA 3ZQFA 1F36A 2VI6A 2XPUA 3S17J 2DA6A 2LR8A 4CYCB 3A01A 3LSGA 3GTKJ 1ZTRA 9ANTA 4V2GA 5JLWA 2KT0A 1H89C 2M8GX 2TCTA 4MFDA 1OCTC 5EG0B 2DA5A 5FJ8J 3BT9A 4A3BJ 3HGGA 5F0CA 1K61A 1ETOA 3ZOBA 5M5YJ 5E3NA 2MGQA 1Z77A 2Y30A 1XC5A 4Y52J 2K9SA 2DA7A 1RKWA 1ITYA 3ZQGA 2XRLA 3BTLA 3JR9A 2K9QA 5F1JA 1QPIA 3BR0A 3Q0WA 5FKNA 1TWHJ 1HCRA 2Y0SN 3S1MJ 3F0CA 3JRBA 1MBGA 2XGEA 2HOTA 2KDZA 3BG5A 3QPLA 1MNMC 3JRHA 1Y1WJ 4M6VA 3B6CA 1IGNA 1JUMA 1JKQC 3RZOJ 1GVDA 3HOXJ 2M2EA 4C3JJ 2MSYA 4A3KJ 1NK3P 3GTMJ 4NDLA 5IYCJ 3UKGA 4C3IJ 5F0HA 2ME6A 1X2NA 1W0UA 3ZQLA 2ELKA 2D5VA 5F27A 1W0TA 1ETWA 1OCPA 1LE8B 1BW5A 2X6OA 2MW8A 3DCFA 1I50J 1MBFA 3GTGJ 4IHXA 1WH5A 4BXXJ 2ID3A 3GTJJ 3FIWA 4XRSA 1S7EA 2L9RA 4I76A 2NVXJ 2XGCA 5FKKA 3I4NJ 2IEKA 2XGDA 4UUSB 1I6HJ 3BG9A 2H1KA 3H3VK 4A3MJ 4B4CA 1HOMA 2JA6J 2EZLA 2HYJA 1SANA 2WV1A 2W48A 3O8HA 3HBLA 3S1QJ 2B63J 3JRDA 1JUSA 2MG4A 3IH2A 5IYBJ 3RQIA 2L7ZA 2XPVA 5K7FA 4IEJA 3HEFA 1QVTA 3A01B 1JJ8C 2JJ7A 3OOUA 3PO3J 2LK2A 2X9DA 4D5CA 4A3CJ 1B8IA 3WHBA 4JX6A 4XRMA 4X6AJ 1K83J 3OSFA 5GPCA 3D1NI 3LSPA 3IV5A 4AUXA 2VPRA 1H8AC 1BW6A 2EH3A 2DMTA 1JT0A 4M3EA 1PUFA 4JP0A 1ETQA 3GTOJ 4RBOA 1RPWA 1XG1A 3HOVJ 4M3GA 3GTLJ 4W97A 4V2FA 1JGGA 2CJJA 2EZKA 1TWGJ 1LFBA 2IBDA 3E7LA 2DA3A 5K7HA 2CU7A 3BR6A 4IHVA 2R92J 5M5XJ 1IDYA 2X48A 1IDZA 1ETXA 1ETKA 4RDUA 2Y31A 1HF0A 2NVTJ 1O4XA 1YRNA 2E19A 3Q3SA 4IHWA 3S2DJ 1SFOJ 1H88C 1GUUA 2R5YA 2M9HA 1WH7A 3CDLA 3TP0A 2E2HJ 5J3LA 5DTDA 2NVYJ 3VPRA 1MSEC 1WGXA 1ETVA 2O8KA 2Y2ZA 2COBA 1ORKA 3LNQA 1RKTA 5EEAA 5E3OA 1LFUP 1HDDC 2GM4A 5C3EJ 2P81A 3JRFA 1B72B 3TW7A 2L0KA 1TWCJ 5EYRA 3TW6A 4A69C 1AKHB 1QRYA 2VKVA 3SJMA 3CCYA 1MBHA 2XB0X 1DU6A 4DYQA 2R7ZJ 2DA2A 1IJWC 2DA4A 5IOYA 4Y7NJ 3BTJA 5IOZA 2FJ1A 5FLVA 4M3BA 4FCYA 4DZJA 3SFIA 4CYCA 4ABZA 1P7JA 2HQ5A 2VUMJ 3ZQIA 4QIWN 1IG7A 3A03A 2WB1N 3JRAA 2E1OA 5M5WJ 3ZQHA 2LTPA 1JKRC 3HOYJ 5IP6A 1TWAJ 2YUSA 3G1MA 4DYRA 4LOCA 5C44J 1MBEA 4FE7A 1T56A 1UHSA 3TP3A 3JRGA 1PUFB 1IRZA 1R9TJ 2H8RA 2R0QC 4A3GJ 1ENHA 2Y9ZA 1JKPC 1G2HA 2HXOA 2O7OA 1E3OC 3PO2J 1EF4A 3JREA 2JMWA 2QF7A 3NAUA 5GP9A 1VI0A 4X1EA 5C4JJ 1I3QJ 1FIPA 3FKIJ 3BQYA 5BNGA 1RESA 2QCOA 1FIAA 4C3HJ 2R5ZB 3B6AA 4JX4A 1U9OA 3BTIA 2CRGA 3LSJA 1JJ6C 5JLXA 4XIDA 2JA5J 4MLOA 4FISA 1WI3A 3HGYA 1Y1VJ 1UMQA 1OFCX 1FEXA 2LD5A 3S2HJ 4UUTA 5K7ZA 4A3EJ 1X58A 3S16J 4XK4A 4XRSG 1A5JA 3BTCA 3GTQJ 5J1UA 1BL0A 3CQZJ 1U9NA 3HKZN 2XSDC 2I10A 1Z0XA 5EG0A 4M3FA 2DMUA 3MVPA 2LLKA 5FKLA
chains in the Genus database with same CATH superfamily
2CW7A 2QEXI 1UFMA 4Y4RA 3OYFA 2DPDA 4V19K 2HFHA 2V79A 3H92A 4U7BA 3RYPA 3FK7A 4MQVA 3RKXA 2G9WA 3LQRA 5DM6F 2OQRA 3REOA 4AU7A 1WRJA 2G0EA 2J5OA 2LP0A 3E1SA 3GF2A 5J1YA 1Z21A 5HDKA 2IJLA 4KICA 4A6DA 4LMYA 2F4OB 3ELKA 3PM1A 1FP1D 5F64A 3FWEA 3KEOA 4BXFA 1XS9A 5CYVA 3ISPA 1FP2A 3HSFA 4R79A 3RIRA 4BJ5C 2BY2A 1FC3A 1TWFJ 4LG0B 1FX7A 5KNLA 1D8KA 4EM2A 1MMGA 1YG2A 5LD2C 1BC7C 5KK1A 2ELJA 2ESNA 2RAEA 1A36A 1SFKA 3IKVA 2BHYA 2AO9A 1ZR2A 2VBWA 5FLXZ 1FLIA 3GFJA 3F3XA 3W6VA 3ZCOA 1IC8A 2ME0A 4U87A 4DW6A 3DTKA 4HDVA 1WJAA 2ECCA 1MBKA 2CV2A 3M4OJ 3V8LA 3E5XA 2FE3A 3W3CA 2CUEA 4RAZA 3CJQB 3EQLF 4JBAA 3SHFA 2KMUA 3ZMVA 3R0AA 1ZK8A 2IS2A 2V1NA 5FKOA 3CJTB 2MC3A 3RKQA 3IH4A 2V9PA 1BIAA 2VB6A 5H6QA 3EETA 3W2WA 2BBYA 2DLLA 3JAMK 2WY7Q 4IQ4A 5F0FA 3I4MJ 1RETA 1FBQA 1TZLA 3F8NA 2DYRH 2BE5F 5F04A 1E17A 2L7FP 4L5EA 1DU0A 3C18A 2V1DA 4XN3A 1X4PA 3S2WA 3KEQA 2F5FA 3DKYA 3WU2C 2XB5A 1R58A 3NQOA 1IF1A 4GDFA 2CSOA 4XICA 2GIVA 2QQBA 1BM9A 1X3ZB 5CJ9A 2NS7A 1G3WA 4M72A 3U9GA 3QYBA 5EDNA 2BEOA 3LWFA 3M8FA 3VSKA 4YFXF 3TL4X 3AL0B 2EPFA 1MBJA 5GAGJ 2VJJA 4A3DJ 1KU9A 1BOBA 4JX5A 3HC7A 1PJRA 1I3AA 1BJZA 3S3NA 1A6IA 3RTRA 1KQ9A 2DMPA 4GRIA 1IW7F 2H1LA 1RRJA 1N77A 4EM0B 1X2MA 3VWBA 4G8XA 1IRGA 1FTZA 3MZHA 3ZQCA 4MIMA 2KISA 1RZ4A 5J40A 3T1BA 4KITB 1F5TA 4NNJA 4UVAA 3PSFA 4DBRA 5EF6A 1L0OC 1AU7A 2DJNA 1BOAA 2M34A 3AAFA 2Y9YA 3GBGA 3KPHA 4WXDA 3FHZA 4OOIA 4CH7A 4I6ZA 1R4MB 2VOOA 3PIOF 3LSRA 2YX7A 2LF7A 2VN2A 2XRNA 1IN6A 3OL4A 5HS7A 3NWSA 1J75A 3BG6A 3UR3C 3G71I 4NC6A 2O9LA 2JSPA 1MMSA 1ZGWA 3HOUJ 3FM5A 2GOMA 2LOOA 5CPRB 1YS6A 4BEHA 1MJAA 4RB3C 3WTUC 2YS9A 3WG9A 3KP2A 3CC7I 5LHHA 1NK2P 3WTSC 3KZYA 5K5RA 3AG4H 3MAJA 4J19A 2XF7A 3BZCA 3HM5A 1FJLA 2ZKZA 1TQIA 3GLXA 2RVCA 2F5EA 2KJBA 1JUPA 5E3MA 2Y0MA 4BY1J 3MKLA 2KHMA 5GTHC 2LKSA 3RPQA 2DBBA 1QU3A 3H35A 1T0FA 1Y8RB 4HSRA 4LITA 4XONA 1GV5A 3IP4B 4A5NA 4KT6A 3KETA 4E7HA 1YJ9I 5B1BH 3P9KA 5J1RA 1PP8F 1F43A 1GT0C 2X85A 4XLEA 1R1UA 2LG4A 3E6CC 2AS5F 4GFBA 4XOPA 1U8RA 2IS4A 3BR5A 4G6TB 2XIGA 3E3VA 2K9NA 4WF2A 3VODA 3AG2H 3GX4X 4MHGA 2HPMA 2LNBA 4AIKA 2YU9J 3HJEA 4UVCA 1EKEA 1IN5A 4UUSA 1I27A 2VL8A 2L3DA 3ZQFA 2DA6A 1UELB 4F55A 3PQKA 4CYCB 2CQKA 3GTKJ 9ANTA 2KT0A 3FHNA 4UV9A 5JFRA 1Y0UA 2CMPA 2TCTA 3CTAA 4MFDA 5EG0B 4DGWB 1J59A 3DQVC 1BIBA 5FJ8J 4BS9A 5L3CA 2DXIA 3ROUA 5J6XA 4ZDPA 1N78A 4BH9A 1DGRM 3CCQI 1ETOA 2E34A 2ZNZA 3ZOBA 5M5YJ 3HSRA 4LK1F 1Z77A 4M71A 2R7VA 1XGNA 1XC5A 2BW3B 3V42A 4ZZLA 3JR9A 1HQCA 2KIMA 1QPIA 4FQGA 1BR2A 5FKNA 1D5VA 1OCOH 5L3GA 2A69F 1SAUA 3OYMA 3S1MJ 3F0CA 4C30A 2A5YB 2HKOA 2HOTA 3BOQA 4YFKF 3B6CA 3IWFA 2K85A 1B6AA 1JUMA 2IA1A 2VOPA 5CKTA 5FD5A 4ASNA 3GFMA 3HPGA 5HLIA 3DKWA 3CMAI 1KQ8A 3H3ZA 3D5SC 2HR3A 2O03A 4EATA 4UB8C 1VQ8I 2P6TA 4ESJA 1X2NA 3FM3A 3ZQLA 2FNPA 1TNTA 4KFCA 1ETWA 5D5WB 3H1CA 3RDIA 2AQFA 3GMEA 4ESFA 4RLFA 1LE8B 4EMSA 2R7WA 1MBFA 3GTGJ 1WH5A 4LK0F 4UY8I 2ZFUA 5DDGA 1S7EA 5LEKA 4HLXA 4I76A 3W6KB 2BW3A 3HRTA 4HOBA 5L3DA 3IAM2 3BG9A 2ISZA 3DBHB 4A3MJ 3BLYA 2JA6J 3A4CA 3HZJA 4M6XA 4OIPF 4HDUA 4QPQA 2DT7B 3KP6A 4GO1A 4DIQA 3O8HA 1OLTA 3DXJF 1K4SA 3JRDA 5ICEA 4IQJA 1QBJA 2K02A 1QPMA 4IHTA 4EV0A 5BOXA 4PJNA 4XRFA 2IA0A 5JVGF 4IEJA 3HEFA 4PJLA 4Z6YA 2IGNA 2LDUA 3K4KA 2FUG2 2JJ7A 3OOUA 2UZKA 5HDGA 5CVVA 1M1EB 1ZLJA 2X9DA 4P96A 1ERDA 3PUFA 4D5CA 1B8IA 1BR4A 3WHBA 4XRMA 4OWRB 1XD7A 3TDZC 2HZDA 3D1NI 4YFNF 2DK8A 4AUXA 3IV5A 2LF8A 4A2UA 4LLGF 2A07F 1BW6A 1SC7A 5K5QA 1XMXA 2VBXA 4KA4A 4B3XA 3SDBA 4RB0A 4BL0B 3G6EI 2M4KA 3CCSI 4L0YB 3GTOJ 2HYGD 3K4NA 1FPQA 2P5VA 3LSKA 3CMMA 2L9SA 3SZPA 2ICWG 2V1UA 3CO6C 3VSLA 3R4KA 1X1DA 1TWGJ 1LFBA 2IW5A 3CC2I 1VZ0A 1R1VA 2F5DA 2QQ8A 4IHVA 2X48A 2K7LA 4E7KA 1ETXA 2HQNA 1CF7B 2NVTJ 1HF0A 2Y31A 2J5PA 2NNNA 1O4XA 2E19A 1DGWY 1SVMA 2VBYA 3HUGB 3S2DJ 1MMAA 1XDSA 4XN0A 2OTJI 1GUUA 1WVRA 1WH7A 3TP0A 3F8FA 1V5GA 2A6EF 3CP8A 2FA5A 1HW5A 2E2HJ 2Z33A 3IHUA 3VPRA 2NVYJ 2H09A 2D2WA 1MJ9A 2QVOA 2Y2ZA 4P5OA 5J47A 3FXQA 2CYYA 2X1EA 2M7BA 3K1MA 1D3YA 3B73A 5E1XA 3SEZA 3OYCA 3CCJI 5J8CA 1YTYA 1OCCH 1B72B 4D1QA 1RUOA 4RB2C 1TWCJ 4A69C 1AKHB 2IPQX 3ABUA 1MBHA 2Z16A 4DYQA 2M87A 3OMYA 1FMVA 1LVKA 5IOYA 3K70D 4CSWA 2E1MB 3MQ0A 3Q9VA 1W36D 2GQQA 3I54A 2QQAA 3ONQA 3GZ5A 3KYLA 5LEJA 1YW8A 4QWQA 3TO6A 2OV7A 5M5WJ 2G7UA 2LTPA 4DYRA 1HKSA 5C44J 2H94A 1UHSA 2VC0A 2IGMA 4K2EA 5BQTA 1PUFB 4HG2A 4JK1X 2V7FA 1ENHA 3BP8A 2DOEA 3WE3A 3M8JA 1LDDA 1JKPC 3DU5A 2HXOA 3CCLI 3R60A 4IXAA 1X1AA 3F72A 3NAUA 2QF7A 4FETA 4XLCA 4L5IA 2E1CA 5LGNA 1J09A 3BJ6A 1QHGA 1P9QC 1KU7A 4BU2A 5HVQC 1V4RA 4ZJZA 1FIPA 3C3WA 3E5UA 2QCOA 3KYDB 4C3HJ 2L4MA 4EJWA 3MMYB 4A0XA 2CRGA 3W6JB 3LSJA 1R6RA 2JA5J 1R4NB 2KQRA 1V3FA 1Y1VJ 2P8TA 1UMQA 2VPLA 4CCOA 3NWTA 5FB2A 2DT5A 5K7ZA 4A3EJ 2PEXA 2LSOA 5HLGA 4ENKA 2V26A 2BZTA 3VYTB 4XRSG 1A6QA 2Z99A 2IXSA 4BHBA 2CV0A 2MBFA 4JOMA 4YEJA 5HNFA 2WAFA 4O6JA 1LJ9A 4L9NA 2ZXJA 3LSIA 1JE8A 1UAAA 2E2JJ 2NRAC 5FFZA 2PMZN 3VEPA 4A0ZA 3DEUA 2KJCA 4DOZA 5EZGA 2EFNA 3CDHA 3HHGA 4CDGA 3E5QA 2E1NA 1UB9A 1D1AA 2X0LA 3GEZA 2CUFA 3K7AJ 3Q0UA 1FY7A 3HHHA 4RM3A 5FRMA 2VE9A 2DTZA 3K2AA 1O3TA 1GHCA 2FQ3A 1MSFC 4IVNA 1SVLA 3ASOH 4YRVA 1OYWA 1LVAA 4P1WA 5BMZA 2OF7A 2WC2A 2K4BA 2PBIA 2L54A 3LSTA 4RB1A 3MKZA 2V9VA 4MGRA 1O3SA 1HXDA 1JT6A 3LFKA 2GA1A 4DJAA 1I39A 3HTUA 4WX9A 2EQRA 3FBIB 2HQRA 3F6VA 1SD4A 2R4GA 2R7OA 2DN0A 3CF2A 2R7RA 4S0HB 2WAQN 2XKOA 5FRNA 3BR3A 1BR1A 2VLAA 5BPDA 1FTTA 3DPTA 2HVRA 5DD8A 4LJZF 3SQNA 3TDUC 3R61A 4CCMA 4KJZA 4S04A 1MMDA 1JTYA 4IX7A 3L9FA 5ILUA 1JKOC 4M9XA 2BVLA 2DFHA 2RDPA 1GXPA 5LBQA 3BJAA 4F93B 4ON0A 3BR2A 4A93J 4QPOA 3ZR8X 2TDXA 3GYHX 3LFUA 2JT1A 1VF9A 4KISA 1Z6RA 2QA4I 4IRGA 1E3PA 2OZ6A 1U8BA 2BHZA 1XX5A 5AONA 4P55A 5JI6A 4XORA 2D1VA 2XPWA 3ZN1A 2D45A 4KIBA 2OTLI 5HODA 2R7QA 1HSJA 2P5KA 4MEXF 4FX0A 3K4BA 3ZMDA 1K78A 2CV1A 4UUVA 3GWZA 1ZR4A 2Q2EB 2JN6A 2LBFA 1Z05A 5IPAA 2COMA 3HSEA 2DMQA 5KVRA 3S32A 2FQ4A 1B1BA 5CVRA 2JTVA 4ESBA 3Q9SA 1OISA 3P9CA 2PI0A 3EYIA 3E6DA 1XGMA 2E2IJ 3A0BC 4XKBA 2ID6A 3GW2A 2OD5A 3I53A 2HZTA 4DBQA 1CF7A 1FYLA 4M3DA 5DCFA 4F52A 1DDNA 1Q1VA 4BKXA 2NOGA 1WJFA 2HYFA 4BY7J 4CICA 4ZYEA 4ENJA 4N9IA 3QPSA 3CJNA 1XDUA 1BI0A 3IL2A 2GIZA 4BJTA 3VYRB 3OY9A 1VQ5I 1MKMA 2HDDA 1BA5A 3O3KA 1DUXC 1YW7A 1JTXA 2DQLA 3WE2A 2P7CB 4BHCA 4EM1A 2QENA 4HF0A 1R7JA 1MJBA 3DPUA 2HEOA 4NC8A 6PAXA 4KUMA 4A3JJ 4KMUX 1WCMJ 1IV8A 1RIOH 3OYKA 1VNDA 1A31A 2M0CA 2STTA 2BVMA 3HOWJ 4IOAF 5KAIC 3SFZA 2NVQJ 2JK3A 2HOSA 4P9UA 1ON2A 2P6SA 2W57A 4HV5A 3QU6A 1WQ2A 2EZIA 2KIQA 1P7IA 5JR3A 3DEEA 1O7LA 2H6CA 2R5ZA 3G73A 2OAZA 4I0BA 5IP7J 4BNCA 5GADJ 1H0MA 2BY1A 1EH8A 2ELHA 4HQEA 2XC7A 3CCMI 1TW2A 2Y69H 5DYMA 2XROA 2BXYA 1HLVA 1PDNC 4B1RA 3DBLB 3LA2A 1U6GA 1G4DA 4CYDA 3H5NA 2UUZA 1KA8A 4A12A 3E97A 3CUQA 3L09A 3N97A 1AHDP 4BE1A 1MIJA 1HKQA 5D8KB 4AVPA 1TQMA 5E3LA 1RI7A 1S29A 1KU3A 3HRUA 3HRMA 4OIQF 5BPIA 2EIMH 4UNOA 1F36A 3S17J 2VKDA 4BQNA 4HNUA 3ABLH 2K27A 2M8GX 2VJIA 1OCTC 1IN7A 4ZTFA 5TISC 2DA5A 4B09A 1HBXG 2MA3A 4LG0A 2H8WA 4A3BJ 4FASD 1QO0D 3T8TA 1K61A 4R1HA 3J81K 2I8DA 1UZCA 3CUOA 4U0WA 2Y30A 4Y52J 4CA0A 1QHHD 2DA7A 2FBHA 2CG4A 4G6DA 2W4SA 3BTLA 1ITYA 4MEYF 3MZ8A 3BWGA 2PFBA 5E79C 3OYGA 5CVJA 1I5ZA 1QZYA 4Q47A 2X6XA 3JRBA 1MBGA 1CGPA 2KDZA 1K4TA 5A2QZ 2QQ9A 2XAUA 2O3FA 4PFPA 3JRHA 1Y1WJ 4XLHA 5B1AH 3SYTA 1LUJB 1JKQC 1H9GA 4RAFA 2XAJA 1NG7A 1GVDA 4UVBA 5DEQA 1W5CC 3FXUA 3I56I 3BC8A 4J01A 3F23A 1IUYA 4U0VA 2EV0A 4Y3OA 3GZ6A 3CO7C 5FFXA 5IYCJ 1Z91A 2WA0A 3I58A 4C3IJ 5F0HA 3DLLF 1W0UA 3HUGA 4I02A 4PFOA 1MDMA 3RKYA 3F8MA 4Y13A 1W0TA 2G7HA 4I01A 4YIIA 1I1SA 1MD0A 2L7KA 4LLLA 3FBNB 3BROA 4HX8A 3IRQA 2PMZA 1USSA 3DCFA 3V4GA 3H0DA 4IHXA 1F1ZA 1WJCA 2ZJ2A 2EV5A 3V7RA 3K4MA 1BN5A 2W82A 2L9RA 3M1EA 2NVXJ 2XGCA 5FKKA 3I4NJ 3ZMUA 1J7KA 1I6HJ 4B4CA 3OS1A 3TO9A 3HG9A 4OINF 2A05A 2HYJA 2VJ5A 1RNLA 1SANA 2WV1A 1OYYA 3EYYA 2HWVA 2W48A 3HBLA 2F5CA 3FXJA 2EA4A 4HYEA 2B63J 3TOBA 1X1CA 1T98A 3AL0C 5DUKA 3S3OA 2L7ZA 2DCEA 2XPVA 3MCZA 5J8FA 4LIUA 3RKWA 1D0XA 4L18B 2QBYB 3SEQA 2V9KA 3TGNA 1F4KA 2EILH 3A0HC 2CUJA 3OYEA 4JX6A 3ABMH 1WJ5A 3QPTA 2F48A 5IT3A 3LSPA 2IP2A 1U0JA 3L2UA 2KRFA 4OU0A 2YPRA 2EH3A 3TOAA 3TBIA 1FOKA 1D0ZA 1PUFA 1ETQA 1ODDA 1RPWA 4GYIA 4M3GA 1S3JA 3GTLJ 2VKHA 3BDDA 4V2FA 3RSNA 4PGHA 1W5SA 2CJJA 3OYHA 4ZYHA 3E7LA 3CCUI 2DA3A 2CU7A 4N4OB 1Q1HA 5FROA 1WZ2A 1S6LA 1IDYA 5LHIA 1IDZA 3WTTC 2A6HF 1LKXA 2V1XA 2W25A 4HNTA 2FNAA 3CESA 4NHJA 2EV6A 3OS0A 1U5TB 1ZN2A 2HDCA 2EB7A 2LKPA 3M7GA 4H4KC 5CLSA 2R5YA 4ZTJA 4IOCF 2P7VB 2L02A 2C6YA 1FSHA 4L9TA 4F92B 3L00A 1YQAA 4II3A 4ZZDA 2O8KA 5J4VA 3R6SA 4ZYGA 2E7XA 3WGIA 1ZAOA 3LNQA 1RC9A 4I7HA 1RKTA 4RGRA 2ZSIB 1R36A 4BHPA 1LFUP 3B02A 1XSXA 5K5OA 5C3EJ 2GM4A 1O57A 4LG3A 3JRFA 1K6OA 2FF4A 2L0KA 5HDNA 2HGCA 1TNSA 2EIJH 1N25A 3T5XA 1FOYA 2R7ZJ 2ISYA 3IWZA 2Y0SA 4BAYA 2RKHA 4X0GA 1QGPA 2FJ1A 4M3BA 4FCYA 4CYCA 1T0FC 4ABZA 1SD7A 3OYJA 1HC8A 4UB6C 2E60A 3PFYA 4QIWN 5D5UB 1IG7A 2WB1N 3JRAA 3BY6A 5L3EA 4BQAA 4LOCA 1MBEA 1T56A 3DTEA 1O3QA 3GO5A 4XLNF 3CUQC 1HA8A 2H8RA 4RGSA 2L5QA 4GYGA 2UWMA 2R0QC 3IRRA 1K79A 1Z3YA 3LSMA 2Y9ZA 3S8PA 2X6YA 1EF4A 1UHMA 1IRXA 1ULYA 3OL3A 1LDJA 3HL2A 1U5TA 3ZMZA 1SVOA 5GP9A 2MH9A 3KYCB 4N4NB 5KHDA 4L9VA 1EH7A 3H3UA 1G8XA 3ZP5A 3BZ6A 2NXNB 2JPCA 4QLCU 2FRHA 3OYIA 3ZGKA 1KZHA 1BJAA 2XAHA 2O6GE 1NG6A 3DWLE 1JJ6C 4FISA 2KL4A 5A2QK 1ZG1A 1WI3A 2DQRA 1LFPA 2OBPA 2RQPA 1MNEA 3P7NA 5HOOA 1STZA 5DCMA 1ZG3A 2KZGA 3QOEA 1V5EA 2WTEA 2M3AA 3K2ZA 2DMUA 3MVPA 1WI9A 3K4LA 2JA7J 2GBYA 2ZJRF 1MH3A 3DEWA 3WHCA 1GV2A 2PQ8A 2YR2A 2KDOA 3S14J 4EGZA 2CGPA 4YIFA 2F5VA 4I2OA 3H0GJ 3CLQA 3QPHA 2FD5A 2EBIA 3EUHC 1WWXA 2AHQA 4D7MA 3TEDA 3QQAA 4HV6A 4MFEA 3CF5F 2DOFA 5LRRA 1ACIA 1I6XA 3QP6A 2GLOA 1QA6A 4D9JA 5DS9A 3C2HA 1JHFA 2XAFA 2DOAA 4B43A 2X51A 3I3LA 2HVSA 2BGCA 2ZSHB 3L2QA 1LE8A 4A3FJ 2FXAA 1Z7UA 1D5YA 2ZXHA 1JXSA 1GVJA 5FKMA 1YRNB 1XN7A 4OIOF 4P9FA 1ZHFA 1ZRCA 1UHWA 4UV8A 2EFPA 3IKTA 3DU6A 2JUGA 2E36A 3PIPF 4IJAA 2R7UA 3OIOA 5F1RA 1IN8A 5FLMJ 1ZELA 2OCEA 5EGOA 3LOCA 1DP3A 2VXDA 3D5LA 1T39A 2PLYA 1WPKA 2LRDA 1KU2A 1QVUA 4YIRX 2A5WA 3GFIA 1R22A 1E0EA 1YYVA 3A2KA 3H9QA 1IRFA 3M1CA 4XKWA 4KIFA 3VDXA 4GCVA 2FX0A 2HTSA 5GPAA 3NARA 3U2RA 1WSUA 3MN2A 1QZZA 4HA8A 1Y8QB 4AYBN 2MFZA 3T0YA 2ZC2A 4G12A 3V8KA 3KEYA 3WG7H 3BQZA 2LKXA 3S15J 3IH3A 1OPCA 5DV5A 1TP4A 1YOVB 5EGOB 2L2OA 2OUMA 4CO8A 3BJOA 2Z9OA 4BGDA 1S7OA 1PYVA 3MEXA 4FTHA 1HW1A 4XNFA 2FMYA 2RV8A 3JSPA 1DQUA 3I9V2 2VKEA 4E6KG 1X19A 3AG1H 2HU9A 2W24A 3KE2A 3G1OA 2M1BA 3FISA 3RZDJ 4MNUA 3PFIA 3GVAA 2CQXA 2ZO4A 2L7MP 1ONVA 2IVMA 2FU4A 2ZCWA 3HOZJ 3CDIA 3K69A 4BDZA 1P6RA 5L3BA 2O0YA 2NS8A 1B72A 2DPUA 3OSGA 2PMHA 3MFKA 1RUNA 3IUOA 4A3LJ 3TO7A 1IV6A 1OR7C 3Q0VA 3ZQQA 2D1HA 3ZMTA 2WADA 3MWMA 2DA1A 3H5AA 1IO2A 3OV8A 1SEUA 5M3FJ 1FYKA 2Z2SB 1G3SA 3JCUC 2R93J 4BQOA 4I0AA 4Y17A 3ZMSA 4LD5A 5J4YA 4XKVA 3FZVA 4HNVA 4UHTA 2JWTA 2PJPA 2CH0A 2CS3A 3L1PA 1MMNA 3FK6A 4AC0A 5IYDJ 3WTYC 2QWWA 2QBYA 4KYWA 3G3ZA 1G59A 4YELA 2QYOA 2KIFA 2Y75A 2VT2A 4R8HA 2W00A 5E17F 3F21A 4IRHA 3A02A 4B8XA 3SZTA 2DYSH 1OCZH 2JA8J 2A61A 1WJEA 3BR1A 1XMAA 4WK8F 3HOTA 2XUBA 4IPAA 2OA4A 1T38A 1VQKI 3CLOA 4EJTA 1ZQ3P 3QU3A 1YW9A 2BV6A 4ZYAA 1B8IB 3M3YJ 3SDGA 3N4MA 4ITVA 5EZHA 4BBRJ 4D0PA 1O3RA 2LY1A 1BI2A 5F08A 1YE9A 2K9LA 4E7JA 1G6NA 1HDPA 2EK5A 4RAYA 1LEBA 1FBSA 3RCOA 1DPRA 3HIFA 4PZJA 4TV7A 3FMSA 3LSGA 2RNGA 5JLWA 3TMOA 3J7YJ 5AIQA 1A04A 2DJIA 3ZQ7A 5GAHJ 4LGWA 3CCEI 2IS6A 3BCBA 1MDMB 3FX3A 3BT9A 1UG0A 4M6YA 5F0CA 3GXOA 5E3NA 2MGQA 4HSTA 2DO7A 3KZIC 3RJPA 4WXCA 1YS7A 2F2EA 2OJED 4PJMA 2K9SA 1RKWA 1IZ1A 4E4HA 1W5TA 3ZQGA 2Y48A 3BR0A 3PNYA 1K78B 1YFHA 4M74A 2LBFB 1KGSA 4AIDA 3QPLA 4AWXB 1TTYA 2E35A 3OYAA 3NRVA 4M6VA 1XPXA 2QLZA 1R5GA 5B3SH 1U5TC 3OYNA 3RI4A 4FX4A 3HYIA 3RZOJ 1Y39A 1FZPB 4KMFA 1W1WE 2MSYA 2V4JC 4BE2A 1NK3P 5KCMA 3GTMJ 2VQGA 4EJUA 3UKGA 2IGOA 3V7CA 4HX7A 5E8IA 2OC6A 3J81Z 1XCBA 1USTA 1J9IA 3C1DA 3KX2A 2DU9A 1OCPA 2H27A 1ZRDA 4BYYA 2HKXA 3H5RA 1ZLKA 3F9KA 2GZWA 2MW8A 3LSHA 5D5XB 3GTJJ 4XR6A 2QKLB 4PGGA 4XRSA 3IC7A 1GLNA 3FMRA 1XGOA 2IEKA 2XGDA 4HF1A 1TQPA 3I64A 3H3VK 1P4WA 3DPLC 1V5FA 3K0LA 2PJRB 4C9YA 2PJRA 3SXYA 4LFUA 3JW4A 4A6EA 1S5LC 3H36A 2IA2A 4C2UA 5ILVA 4A0YA 4IRIA 3S1QJ 2AQEA 2ZMEA 1LNWA 1JUSA 5BS6A 3IH2A 4LB6B 5IYBJ 3MKYB 3KIOA 2VASA 4RS8A 3J80K 1YX3A 3PUBA 1YIJI 1X1PA 1X3UA 2JUCA 1REPC 2OZUA 2FSWA 3PO3J 3F8BA 1X4OA 2DFEA 2JVHA 2LK2A 5ERIA 4A3CJ 1EA3A 4GXOA 4FHTA 1S8NA 4X6AJ 2KZVA 1K83J 3OSFA 5GPCA 1Y6IA 1IXCA 1VTNC 2JRMA 2UXXA 4B47A 2L9NA 2WAQA 3FXLA 1H8AC 2KKOA 4XMYA 5ED4A 3W2AA 2WB1A 4WWCA 4M3EA 2KP6A 2B7EA 1TT0A 2DODA 2JRTA 3PSIA 2LC2A 4JP0A 3H9JA 3C7JA 1F9NA 3HOVJ 4W97A 3QRFF 2M45A 1TBXA 4PUSA 2BY3A 1LQ1A 2EZKA 3OOPA 1EJ9A 4MQ9F 2MLGA 4Y33A 2IBDA 4BEHB 4L0ZB 2F4IA 3BR6A 3UNGC 3VYUB 1LDKB 2HNHA 3FXKA 2M5WA 5M5XJ 1L3LA 2KRCA 4ZH4F 2GA2A 3JSOA 1ETKA 3I0TA 4RDUA 5FGMA 5CQEA 1WFXA 4MTEA 3I4PA 4UXNA 4IHWA 1MNDA 4AIHA 1SFOJ 2R7DA 2K5CA 2XF5A 4ZYDA 1H88C 1TT5B 1SFEA 4XSXF 3MZYA 2M9HA 1FBUA 1IAWA 2DAOA 1MGTA 3MKWB 2KIUA 3OIPA 1H9TA 5DTDA 1MSEC 3I59A 3HPHA 3IAS2 4MTDA 1ETVA 2K86A 5JHFA 4E70A 2COBA 2YU3A 2GOXB 5EEGA 5LLQA 4IHSA 1Y0NA 2CWEA 1BI3A 1UCRA 2FMLA 2QKMB 5EEAA 3G4SI 1QZEA 2HPIA 3ML6A 3WTZA 2KFDA 2VIXA 3TW7A 1Z3XA 1R5ID 2R7SA 2PX9A 2IRFG 2CQ7A 5EEHA 1QRYA 1MZBA 5HNHA 2VKVA 3SJMA 2MABA 2HDWA 5FO5A 1DU6A 4AD9A 5D8LB 2DA2A 4XLFA 1T8IA 1IJWC 1XTAA 3EUKL 4IKFA 3BTJA 2XVCA 3ZXSA 4BJ6C 4BDYA 4XLAA 1IN4A 5CVUA 5IOZA 3QODA 4CZZA 4J00A 4DZJA 3LA3A 3SFIA 4CCLA 3GCMA 2HQ5A 3CC4I 2EWNA 2V6EA 5IT9K 4HLYA 3ZQIA 4G7ZF 3GFLA 3FKJA 1EV7A 2E1OA 3ZQHA 1JKRC 2FBKA 2HQAA 1S9HA 2YUSA 4ENNA 3HRSA 3CMEI 2VJ4A 4EVIA 3JRGA 1AOYA 1T08B 2X6WA 4CGZA 4E7SA 2ZJPF 1IRZA 2XGXA 1R9TJ 1WJBA 3ULQB 5TGTA 4A3GJ 2O8XA 4Z2YA 1OQYA 2FOKA 3K10A 3I59B 4E7ZA 1HSTA 3E6BA 1SFUA 2O7OA 1E3OC 2ESHA 3PO2J 4F7ZA 3JREA 2JMWA 4E7IA 1Z1DA 2VE8A 2PN6A 1J0RA 1AA7A 1VI0A 5C4JJ 3FKIJ 5D6FA 3I55I 3BQYA 1D8JA 4DNCA 3A1YA 1FIAA 2R5ZB 3B6AA 3K4JA 4JX4A 2VQLA 3DLAA 4PJJA 3CCVI 3BZKA 3U1KA 4XIDA 5JHUA 1YX5A 3HGYA 2AXTC 1E3HA 1NHAA 1Z7LA 4RMNA 2LD5A 3S2HJ 4UUTA 2ETHA 2M30A 3DTIA 1X58A 3U1DA 3S16J 4XK4A 5HLTA 2RQQA 1D1CA 3CQZJ 1U9NA 5C4XJ 2K3PA 2XSDC 1LB2A 2A68F 4GGGA 3EDPA 1Z0XA 3O6BB 3OIQA 1S7AA 1IXSB 2FOWA 1R00A 2LFBA 3DV8A 2DW4A 4IZZA 1MH4A 3I5UA 2MYSA 4IHYA 5FLXK 4G6QA 5IP9J 1IUFA 3W2VA 2LYCA 5F6FA 5LGUA 1T6SA 4ZDOA 1UG2A 2HOAA 2V6CA 1W7PA 3OR2C 1V54H 5ICGA 2XSJC 3ESWB 1SFXA 4L5JA 4DYCA 3HKZA 1T33A 4EEFG 5ICFA 1APLC 1SMYF 3G1LA 3P5JA 5TJJA 2RREA 1OJLA 2Z1DA 1YJNI 3S1NJ 1Z67A 3AFHA 5M3MJ 2Q0OA 4RAGA 4ANJA 2JZYA 2LY9A 3OYDA 5E18F 2DTRA 2EFOA 3R0JA 1XCVA 1KONA 2LREA 2HI3A 1YHQI 4BBSJ 2EINH 5AIPA 2HXIA 2EA2A 1OCRH 4DZPA 1G3YA 1ZGAA 5TRDA 4WXHA 4BQQA 4L9JA 4DQ2A 2JVGA 3EPZA 2YSRA 2ECBA 3I71A 4JQFA 2VONA 3KZZA 1POGA 3F22A 5JVTA 1MW7A 3V8JA 3JRCA 3HB9A 2R5YB 1T2KA 3N05A 2DMNA 1S72I 1C0WA 1VQMI 3ZRGA 2OCCH 4U88A 3JTGA 4ZC3A 2W85A 3C2BA 4AVZA 1E2XA 1VQ9I 4QSHA 4AYBA 1U3EM 1W4MA 3Q5FA 3DP7A 3WTXC 1VQLI 2M0MA 3QOPA 1LEAA 4B3AA 4E7LA 1KQ0A 2VXZA 1AKHA 1ZH5A 3AG3H 3M9AA 5CQGA 1IXRC 3HXLA 3NEUA 3CMYA 4KN4X 3DKXA 4Q4ZF 1TC3C 2M8EA 2NOJB 2RGVA 4NBQA 5LGTA 4HW0A 5LRSA 3E6MA 4HEA2 1U2WA 4QTRA 3GTPJ 2STWA 1A35A 2XHKA 3S1RJ 2UV1A 3S3MA 4Q5SF 3JRIA 1OR7A 3FXMA 2LVSA 4AIJA 3CUQB 5D6EA 5H6RA 2XAGA 5FD6A 3DBRB 2BOLA 2EZHA 2Q1ZB 2DFIA 2AXLA 3LL7A 2F6CA 3WGGA 2O5RA 2R7FA 1Z9CA 1HW2A 1HKTA 2CW8A 2BY0A 3EUAA 2QSHX 2IAIA 3D0SA 2K40A 1VQOI 5CVIA 2P0WA 4EJOA 1B4AA 4AM3A 2MD5A 1GDTA 1ETYA 4XOTA 3BG3A 4I99C 5LHGA 3K1NA 4C2MJ 1YO5C 4M9SA 3BG7A 2ZJQF 2BYVE 4PCQA 2JQ7A 3K70C 2TRTA 2CW0F 1FMWA 2CUZA 2X1DA 2ADUA 2GXBA 1JI8A 1P4XA 1TLHB 1SD6A 2IGKA 2EFQA 2LMDA 4BACA 4MO7A 5GTIC 3L2WA 1XSVA 2HS5A 2MD0A 4ENMA 4D5FA 1VQ6I 4M73A 5DUIA 4RM2A 1XSDA 2DK5A 2K4JA 4W1UA 2ZB9A 3PNVA 4D7NA 3ZPLA 2QM3A 1K6YA 4ETSA 3DFGA 2A6TA 4XM3A 2N8GA 1U78A 1CQTA 2X4HA 2ZFWA 3OYLA 4Y15A 1ZKGA 3TKYA 4XSZF 2H6BA 5IT9Z 3CZ6A 4XLPF 1ZGJA 2WWYA 4B48A 2M7AA 4EGYA 1YJWI 4JYKA 1RR7A 1JHHA 3BCAA 4HPQA 2E5NA 3FXOA 1K7AA 2CO5A 1VFCA 2XV4S 2Q8KA 1BI1A 4BUPA 4FE4A 3P9IA 5H2FC 2EFWA 3F8CA 4NQWB 4A3IJ 2OPTA 3QYFA 2HOEA 3HTSB 2CFOA 3WGHA 3ECHA 2GXAA 1VQPI 1OKRA 2NYXA 1N75A 1UJ8A 2CQQA 2GWRA 3S93A 2KLOA 3O8GA 1NTCA 5B66C 3HDDA 1SMTA 2L4AA 4BE0A 2RNJA 2E1MC 4NC7A 2ACJA 2KPMA 3RPUA 3CP2A 2VI6A 1R5HA 2XPUA 2LR8A 4OAYA 3A01A 4G9YA 4I09A 1ZTRA 4V2GA 3PQJA 1H89C 4RGXA 5E1WA 4OMZA 2XDVA 3EUHA 1JGSA 3HGGA 4FT8A 2P5LC 4KDPA 2VQCA 4EJVA 2NNYA 4YG2F 3RQ4A 1KYWA 3OS2A 3COAC 2XRLA 4LLNA 2B0LA 2K9QA 5F1JA 3Q0WA 1FNNA 1P4AA 1TWHJ 1HCRA 2Y0SN 4HBLA 1W7PD 3GLLA 4G7OF 2XGEA 3BG5A 1MNMC 2E71A 1W36C 1ON1A 2DT6A 3DF8A 3QAHA 4N9HA 1IGNA 1PUEE 1PP7U 2IT0A 2GAUA 2JA2A 3HOXJ 4HF2A 2DDBA 2M2EA 5B5EC 1PVEA 4C3JJ 2YX4A 1DPUA 4CCNA 2ZMEC 3TQNA 1R71A 2X1CA 1YIOA 4A3KJ 4NDLA 3WODF 3FF5A 4WCGA 3O2PE 2ME6A 1QNTA 2XKPA 3CCRI 2ELKA 2ZXIA 4OIRF 2D5VA 5F27A 3ASNH 4PSXA 2EIKH 2QGUA 2MLKA 5K1YA 2OU2A 1BW5A 2R7TA 2GXGA 1FSEA 2X6OA 3QWLA 3HOSA 2WBMA 2NS0A 1ZYRF 1I50J 1NH3A 3GZNB 4BXXJ 4HRIA 1W7PB 2ID3A 2UXNA 2VT3A 3FIWA 1G3TA 2HVQA 3PJRA 3BPVA 1R23A 1X3WB 4UUSB 2XASA 2H1KA 1B9NA 2E5ZA 3ZN0A 1HOMA 2EZLA 2KRHA 3CD6I 2K3FA 3KP7A 1D1BA 4RGUA 1XMKA 1FYMA 3VYSB 4KN7X 5D4SA 1VQ7I 3V7SA 4B44A 4CCJA 2MG4A 1R1TA 2W84A 3H9GA 3D5RC 2QZ8A 4KIGA 4LIVA 2A3SA 3RQIA 3ERED 2OQGA 2F4MB 2B9SA 2NAZA 3FXRA 2L01A 5K7FA 1ZRFA 5GAEJ 1SAXA 2PMUA 1QVTA 3A01B 1JJ8C 2IS1A 3ABKH 4C2TA 2QUFA 1J5YA 1GXQA 2XF6A 3K6GA 5LFAA 4N0BA 1B9MA 2JSCA 1OMIA 3G2BA 4CCKA 4CZCA 2R7XA 3SZGA 1EH6A 1OYIA 3L7WA 5ICCA 2VPRA 2DFFA 3K1PA 1AWCA 3CJRB 2DI3A 3M07A 3LAPA 3JAMZ 1QQIA 2Z3YA 2DMTA 1D0YA 1ZG5A 1JT0A 2ZBKA 2Q2EA 5D5VB 5DCMB 3J7AY 2LH9A 2WY8Q 4CUGA 1DP7P 4PDKA 1WJDA 4O5VA 1XG1A 4RBOA 3PL8A 1O7FA 2HTJA 3ECOA 3QP5A 4I98B 1Y56A 4F3QA 1ZREA 3J80Z 1JGGA 5HS9A 5IY5H 4G94A 1SD5A 5K7HA 3KP3A 3MD2A 2R92J 1KYZA 4CHUA 1TW3A 4BXUA 4U7DA 1YRNA 3Q3SA 5H20A 2FBIA 4Q48A 4EQQA 3CDLA 4PJ0C 3KLNA 5E20A 3PNTA 1R49A 3KP4A 2VODA 5J3LA 3VOEA 3X2QH 2W1OA 2XAQA 5E8GA 1WGXA 4OMYA 5D4RA 1BC8C 1ORKA 3VB2A 3AKZA 5DD4A 2EJRA 1YITI 5DM7F 3WU1B 2BXZA 4IF4A 3KLOA 2MH2A 5E3OA 4II2A 2QSFX 4F91B 2CFXA 1HDDC 2W7NA 2P81A 2VQHA 1XGSA 3LQQA 3RYRA 3U21A 3OWTA 4XKCA 2QSGX 5E1ZB 1T95A 5EYRA 3TW6A 1WHUA 4A5MA 4HAMA 5ILSA 4XL9A 1J2XA 3CCYA 1YLFA 4O3MA 2XB0X 3OYBA 3L2VA 3K9TA 5HLHA 4G7HF 4LB5A 3L2CA 5HS8A 2PG4A 3KFWX 4RLQA 1FWZA 4KT5C 1RR8C 1V55H 2DA4A 2Z5UA 3BPXA 3WTWC 1VQ4I 4Y7NJ 3K4CA 1FT9A 2MC4A 1YI2I 1I1GA 1LPQA 5FLVA 3E0JB 2R3SA 1P7JA 4NQWA 2VUMJ 4KNYA 4M9ZA 1WKMA 3A03A 3KP5A 2RN7A 1X1BA 3C2GA 3KCCA 3HOYJ 4RA2A 3M8EA 4OAZA 5IP6A 5KAFC 1TWAJ 3J7ZI 3G1MA 4FE7A 3J7AO 4HZFA 3TP3A 2E7WA 1TL8A 2LY2A 2FEZA 3LMMA 4S05A 4U0YA 1G2HA 4PSWA 3JTHA 2NVUB 1FOWA 4NUBA 2L9VA 4ZDLA 2ZNYA 3ERMA 4IO9F 4X1EA 1I3QJ 2VC1A 3LA7A 2JPBA 5BNGA 3ABTA 3WTVC 4XBFA 1RESA 3FMQA 3FDYA 2DDAA 3LAJA 3L2RA 4HX4A 5L3FA 2P4WA 4CXFA 2ZXWH 1U9OA 1VQNI 4H0EA 4PK4A 2WAEA 2WV0A 3BTIA 4HQMA 2CQNA 5JLXA 1BBYA 4MLOA 4XQFA 2VBZA 1OFCX 1ZARA 1FEXA 1P92A 3WU0A 3QYEA 2O61A 1P2FA 3OR1C 3RPUD 1Z6TA 2K9MA 3VFZA 3GUDA 3T8RA 4IL6C 1A5JA 3BTCA 1FOXA 3GTQJ 5J1UA 1BL0A 2I5UA 3HKZN 5EJCA 2I10A 2ZMEB 3F6OA 1XB4A 1B59A 5EG0A 4M3FA 2RC4A 4NB5A 2LLKA 5FKLA 2M4GA
chains in the Genus database with same CATH topology
2LFBA 2JA7J 2E2JJ 2GBYA 1MH4A 1MH3A 2PMZN 3DEWA 3WHCA 1GV2A 5EZGA 4IHYA 3S14J 5IP9J 1IUFA 2CUFA 3H0GJ 3K7AJ 2FD5A 3FK7A 3Q0UA 2EBIA 2AHQA 4D7MA 3TEDA 3QQAA 4MFEA 1UG2A 2DTZA 2HOAA 2GLOA 2G0EA 2LP0A 5DS9A 5J1YA 3K2AA 4DYCA 1T33A 4EEFG 1APLC 1MSFC 5C4XJ 3G1LA 1LE8A 4A3FJ 3PM1A 1OJLA 1XS9A 1D5YA 5FKMA 2OF7A 3S1NJ 5M3MJ 1YRNB 1TWFJ 2LY9A 1JT6A 4BBSJ 2HI3A 2EQRA 2RAEA 2HXIA 2DN0A 2AO9A 3OIOA 1ZR2A 4S0HB 4DZPA 3W6VA 2WAQN 5FLMJ 3BR3A 2ME0A 5EGOA 1IC8A 3LOCA 1FTTA 4DW6A 2ECCA 1WPKA 1MBKA 3M4OJ 2ECBA 1POGA 1QVUA 2CUEA 1JTYA 3JRCA 3HB9A 1JKOC 1ZK8A 2R5YB 2DMNA 5FKOA 3RKQA 3IH4A 3C2BA 5GPAA 2FX0A 3BR2A 4A93J 3NARA 4QSHA 3MN2A 1VF9A 5F0FA 3I4MJ 1RETA 4AYBN 4B3AA 1U8BA 1AKHA 4G12A 5F04A 2L7FP 2XPWA 4L5EA 3CMYA 3BQZA 2LKXA 1DU0A 1TC3C 5HODA 3S15J 3IH3A 5EGOB 2XB5A 4QTRA 3GTPJ 3S1RJ 1ZR4A 4FTHA 2JN6A 3JRIA 2LVSA 5IPAA 4XICA 2VKEA 2DMQA 2NS7A 5EDNA 3G1OA 2FQ4A 2EZHA 3FISA 3RZDJ 1MBJA 4A3DJ 2CQXA 4JX5A 2IAIA 2K40A 2E2IJ 1BJZA 2L7MP 2ID6A 1A6IA 1GDTA 2DMPA 3HOZJ 1ETYA 3BG3A 4M3DA 1Q1VA 4BKXA 2NOGA 4C2MJ 2NS8A 4BY7J 1X2MA 1B72A 3OSGA 1FTZA 3QPSA 3ZQCA 2TRTA 4MIMA 4A3LJ 1IV6A 3Q0VA 2HDDA 1BA5A 2DA1A 5EF6A 1JTXA 1AU7A 2DJNA 5M3FJ 2M34A 2Y9YA 3GBGA 4MO7A 2R93J 4D5FA 4I6ZA 4A3JJ 3LSRA 4W1UA 1WCMJ 2ZB9A 1VNDA 4D7NA 4HNVA 2M0CA 2JWTA 3HOWJ 2O9LA 2NVQJ 1ZGWA 3HOUJ 2JK3A 2HOSA 2N8GA 1U78A 1CQTA 2YS9A 3L1PA 3FK6A 4AC0A 5IYDJ 1NK2P 4J19A 1FJLA 1ZKGA 3HM5A 2EZIA 1JUPA 1P7IA 5E3MA 4JYKA 1RR7A 4BY1J 2R5ZA 3MKLA 5IP7J 3A02A 1VFCA 4FE4A 2JA8J 1GV5A 3BR1A 2OPTA 4A3IJ 5J1RA 1HLVA 1ZQ3P 1F43A 4B1RA 1GT0C 1B8IB 4GFBA 3M3YJ 2CQQA 3SDGA 3BR5A 2K9NA 3O8GA 5EZHA 4BBRJ 1NTCA 2YU9J 3HDDA 1AHDP 5E3LA 4UUSA 5F08A 1HDPA 3ZQFA 1F36A 2VI6A 2XPUA 3S17J 2DA6A 2LR8A 4CYCB 3A01A 3LSGA 3GTKJ 1ZTRA 9ANTA 4V2GA 5JLWA 2KT0A 1H89C 2M8GX 2TCTA 4MFDA 1OCTC 5EG0B 2DA5A 5FJ8J 3BT9A 4A3BJ 3HGGA 5F0CA 1K61A 1ETOA 3ZOBA 5M5YJ 5E3NA 2MGQA 1Z77A 2Y30A 1XC5A 4Y52J 2K9SA 2DA7A 1RKWA 1ITYA 3ZQGA 2XRLA 3BTLA 3JR9A 2K9QA 5F1JA 1QPIA 3BR0A 3Q0WA 5FKNA 1TWHJ 1HCRA 2Y0SN 3S1MJ 3F0CA 3JRBA 1MBGA 2XGEA 2HOTA 2KDZA 3BG5A 3QPLA 1MNMC 3JRHA 1Y1WJ 4M6VA 3B6CA 1IGNA 1JUMA 1JKQC 3RZOJ 1GVDA 3HOXJ 2M2EA 4C3JJ 2MSYA 4A3KJ 1NK3P 3GTMJ 4NDLA 5IYCJ 3UKGA 4C3IJ 5F0HA 2ME6A 1X2NA 1W0UA 3ZQLA 2ELKA 2D5VA 5F27A 1W0TA 1ETWA 1OCPA 1LE8B 1BW5A 2X6OA 2MW8A 3DCFA 1I50J 1MBFA 3GTGJ 4IHXA 1WH5A 4BXXJ 2ID3A 3GTJJ 3FIWA 4XRSA 1S7EA 2L9RA 4I76A 2NVXJ 2XGCA 5FKKA 3I4NJ 2IEKA 2XGDA 4UUSB 1I6HJ 3BG9A 2H1KA 3H3VK 4A3MJ 4B4CA 1HOMA 2JA6J 2EZLA 2HYJA 1SANA 2WV1A 2W48A 3O8HA 3HBLA 3S1QJ 2B63J 3JRDA 1JUSA 2MG4A 3IH2A 5IYBJ 3RQIA 2L7ZA 2XPVA 5K7FA 4IEJA 3HEFA 1QVTA 3A01B 1JJ8C 2JJ7A 3OOUA 3PO3J 2LK2A 2X9DA 4D5CA 4A3CJ 1B8IA 3WHBA 4JX6A 4XRMA 4X6AJ 1K83J 3OSFA 5GPCA 3D1NI 3LSPA 3IV5A 4AUXA 2VPRA 1H8AC 1BW6A 2EH3A 2DMTA 1JT0A 4M3EA 1PUFA 4JP0A 1ETQA 3GTOJ 4RBOA 1RPWA 1XG1A 3HOVJ 4M3GA 3GTLJ 4W97A 4V2FA 1JGGA 2CJJA 2EZKA 1TWGJ 1LFBA 2IBDA 3E7LA 2DA3A 5K7HA 2CU7A 3BR6A 4IHVA 2R92J 5M5XJ 1IDYA 2X48A 1IDZA 1ETXA 1ETKA 4RDUA 2Y31A 1HF0A 2NVTJ 1O4XA 1YRNA 2E19A 3Q3SA 4IHWA 3S2DJ 1SFOJ 1H88C 1GUUA 2R5YA 2M9HA 1WH7A 3CDLA 3TP0A 2E2HJ 5J3LA 5DTDA 2NVYJ 3VPRA 1MSEC 1WGXA 1ETVA 2O8KA 2Y2ZA 2COBA 1ORKA 3LNQA 1RKTA 5EEAA 5E3OA 1LFUP 1HDDC 2GM4A 5C3EJ 2P81A 3JRFA 1B72B 3TW7A 2L0KA 1TWCJ 5EYRA 3TW6A 4A69C 1AKHB 1QRYA 2VKVA 3SJMA 3CCYA 1MBHA 2XB0X 1DU6A 4DYQA 2R7ZJ 2DA2A 1IJWC 2DA4A 5IOYA 4Y7NJ 3BTJA 5IOZA 2FJ1A 5FLVA 4M3BA 4FCYA 4DZJA 3SFIA 4CYCA 4ABZA 1P7JA 2HQ5A 2VUMJ 3ZQIA 4QIWN 1IG7A 3A03A 2WB1N 3JRAA 2E1OA 5M5WJ 3ZQHA 2LTPA 1JKRC 3HOYJ 5IP6A 1TWAJ 2YUSA 3G1MA 4DYRA 4LOCA 5C44J 1MBEA 4FE7A 1T56A 1UHSA 3TP3A 3JRGA 1PUFB 1IRZA 1R9TJ 2H8RA 2R0QC 4A3GJ 1ENHA 2Y9ZA 1JKPC 1G2HA 2HXOA 2O7OA 1E3OC 3PO2J 1EF4A 3JREA 2JMWA 2QF7A 3NAUA 5GP9A 1VI0A 4X1EA 5C4JJ 1I3QJ 1FIPA 3FKIJ 3BQYA 5BNGA 1RESA 2QCOA 1FIAA 4C3HJ 2R5ZB 3B6AA 4JX4A 1U9OA 3BTIA 2CRGA 3LSJA 1JJ6C 5JLXA 4XIDA 2JA5J 4MLOA 4FISA 1WI3A 3HGYA 1Y1VJ 1UMQA 1OFCX 1FEXA 2LD5A 3S2HJ 4UUTA 5K7ZA 4A3EJ 1X58A 3S16J 4XK4A 4XRSG 1A5JA 3BTCA 3GTQJ 5J1UA 1BL0A 3CQZJ 1U9NA 3HKZN 2XSDC 2I10A 1Z0XA 5EG0A 4M3FA 2DMUA 3MVPA 2LLKA 5FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFB A;  2JA7 J;  2E2J J;  2GBY A;  1MH4 A;  1MH3 A;  2PMZ N;  3DEW A;  3WHC A;  1GV2 A;  5EZG A;  4IHY A;  3S14 J;  5IP9 J;  1IUF A;  2CUF A;  3H0G J;  3K7A J;  2FD5 A;  3FK7 A;  3Q0U A;  2EBI A;  2AHQ A;  4D7M A;  3TED A;  3QQA A;  4MFE A;  1UG2 A;  2DTZ A;  2HOA A;  2GLO A;  2G0E A;  2LP0 A;  5DS9 A;  5J1Y A;  3K2A A;  4DYC A;  1T33 A;  4EEF G;  1APL C;  1MSF C;  5C4X J;  3G1L A;  1LE8 A;  4A3F J;  3PM1 A;  1OJL A;  1XS9 A;  1D5Y A;  5FKM A;  2OF7 A;  3S1N J;  5M3M J;  1YRN B;  1TWF J;  2LY9 A;  1JT6 A;  4BBS J;  2HI3 A;  2EQR A;  2RAE A;  2HXI A;  2DN0 A;  2AO9 A;  3OIO A;  1ZR2 A;  4S0H B;  4DZP A;  3W6V A;  2WAQ N;  5FLM J;  3BR3 A;  2ME0 A;  5EGO A;  1IC8 A;  3LOC A;  1FTT A;  4DW6 A;  2ECC A;  1WPK A;  1MBK A;  3M4O J;  2ECB A;  1POG A;  1QVU A;  2CUE A;  1JTY A;  3JRC A;  3HB9 A;  1JKO C;  1ZK8 A;  2R5Y B;  2DMN A;  5FKO A;  3RKQ A;  3IH4 A;  3C2B A;  5GPA A;  2FX0 A;  3BR2 A;  4A93 J;  3NAR A;  4QSH A;  3MN2 A;  1VF9 A;  5F0F A;  3I4M J;  1RET A;  4AYB N;  4B3A A;  1U8B A;  1AKH A;  4G12 A;  5F04 A;  2L7F P;  2XPW A;  4L5E A;  3CMY A;  3BQZ A;  2LKX A;  1DU0 A;  1TC3 C;  5HOD A;  3S15 J;  3IH3 A;  5EGO B;  2XB5 A;  4QTR A;  3GTP J;  3S1R J;  1ZR4 A;  4FTH A;  2JN6 A;  3JRI A;  2LVS A;  5IPA A;  4XIC A;  2VKE A;  2DMQ A;  2NS7 A;  5EDN A;  3G1O A;  2FQ4 A;  2EZH A;  3FIS A;  3RZD J;  1MBJ A;  4A3D J;  2CQX A;  4JX5 A;  2IAI A;  2K40 A;  2E2I J;  1BJZ A;  2L7M P;  2ID6 A;  1A6I A;  1GDT A;  2DMP A;  3HOZ J;  1ETY A;  3BG3 A;  4M3D A;  1Q1V A;  4BKX A;  2NOG A;  4C2M J;  2NS8 A;  4BY7 J;  1X2M A;  1B72 A;  3OSG A;  1FTZ A;  3QPS A;  3ZQC A;  2TRT A;  4MIM A;  4A3L J;  1IV6 A;  3Q0V A;  2HDD A;  1BA5 A;  2DA1 A;  5EF6 A;  1JTX A;  1AU7 A;  2DJN A;  5M3F J;  2M34 A;  2Y9Y A;  3GBG A;  4MO7 A;  2R93 J;  4D5F A;  4I6Z A;  4A3J J;  3LSR A;  4W1U A;  1WCM J;  2ZB9 A;  1VND A;  4D7N A;  4HNV A;  2M0C A;  2JWT A;  3HOW J;  2O9L A;  2NVQ J;  1ZGW A;  3HOU J;  2JK3 A;  2HOS A;  2N8G A;  1U78 A;  1CQT A;  2YS9 A;  3L1P A;  3FK6 A;  4AC0 A;  5IYD J;  1NK2 P;  4J19 A;  1FJL A;  1ZKG A;  3HM5 A;  2EZI A;  1JUP A;  1P7I A;  5E3M A;  4JYK A;  1RR7 A;  4BY1 J;  2R5Z A;  3MKL A;  5IP7 J;  3A02 A;  1VFC A;  4FE4 A;  2JA8 J;  1GV5 A;  3BR1 A;  2OPT A;  4A3I J;  5J1R A;  1HLV A;  1ZQ3 P;  1F43 A;  4B1R A;  1GT0 C;  1B8I B;  4GFB A;  3M3Y J;  2CQQ A;  3SDG A;  3BR5 A;  2K9N A;  3O8G A;  5EZH A;  4BBR J;  1NTC A;  2YU9 J;  3HDD A;  1AHD P;  5E3L A;  4UUS A;  5F08 A;  1HDP A;  3ZQF A;  1F36 A;  2VI6 A;  2XPU A;  3S17 J;  2DA6 A;  2LR8 A;  4CYC B;  3A01 A;  3LSG A;  3GTK J;  1ZTR A;  9ANT A;  4V2G A;  5JLW A;  2KT0 A;  1H89 C;  2M8G X;  2TCT A;  4MFD A;  1OCT C;  5EG0 B;  2DA5 A;  5FJ8 J;  3BT9 A;  4A3B J;  3HGG A;  5F0C A;  1K61 A;  1ETO A;  3ZOB A;  5M5Y J;  5E3N A;  2MGQ A;  1Z77 A;  2Y30 A;  1XC5 A;  4Y52 J;  2K9S A;  2DA7 A;  1RKW A;  1ITY A;  3ZQG A;  2XRL A;  3BTL A;  3JR9 A;  2K9Q A;  5F1J A;  1QPI A;  3BR0 A;  3Q0W A;  5FKN A;  1TWH J;  1HCR A;  2Y0S N;  3S1M J;  3F0C A;  3JRB A;  1MBG A;  2XGE A;  2HOT A;  2KDZ A;  3BG5 A;  3QPL A;  1MNM C;  3JRH A;  1Y1W J;  4M6V A;  3B6C A;  1IGN A;  1JUM A;  1JKQ C;  3RZO J;  1GVD A;  3HOX J;  2M2E A;  4C3J J;  2MSY A;  4A3K J;  1NK3 P;  3GTM J;  4NDL A;  5IYC J;  3UKG A;  4C3I J;  5F0H A;  2ME6 A;  1X2N A;  1W0U A;  3ZQL A;  2ELK A;  2D5V A;  5F27 A;  1W0T A;  1ETW A;  1OCP A;  1LE8 B;  1BW5 A;  2X6O A;  2MW8 A;  3DCF A;  1I50 J;  1MBF A;  3GTG J;  4IHX A;  1WH5 A;  4BXX J;  2ID3 A;  3GTJ J;  3FIW A;  4XRS A;  1S7E A;  2L9R A;  4I76 A;  2NVX J;  2XGC A;  5FKK A;  3I4N J;  2IEK A;  2XGD A;  4UUS B;  1I6H J;  3BG9 A;  2H1K A;  3H3V K;  4A3M J;  4B4C A;  1HOM A;  2JA6 J;  2EZL A;  2HYJ A;  1SAN A;  2WV1 A;  2W48 A;  3O8H A;  3HBL A;  3S1Q J;  2B63 J;  3JRD A;  1JUS A;  2MG4 A;  3IH2 A;  5IYB J;  3RQI A;  2L7Z A;  2XPV A;  5K7F A;  4IEJ A;  3HEF A;  1QVT A;  3A01 B;  1JJ8 C;  2JJ7 A;  3OOU A;  3PO3 J;  2LK2 A;  2X9D A;  4D5C A;  4A3C J;  1B8I A;  3WHB A;  4JX6 A;  4XRM A;  4X6A J;  1K83 J;  3OSF A;  5GPC A;  3D1N I;  3LSP A;  3IV5 A;  4AUX A;  2VPR A;  1H8A C;  1BW6 A;  2EH3 A;  2DMT A;  1JT0 A;  4M3E A;  1PUF A;  4JP0 A;  1ETQ A;  3GTO J;  4RBO A;  1RPW A;  1XG1 A;  3HOV J;  4M3G A;  3GTL J;  4W97 A;  4V2F A;  1JGG A;  2CJJ A;  2EZK A;  1TWG J;  1LFB A;  2IBD A;  3E7L A;  2DA3 A;  5K7H A;  2CU7 A;  3BR6 A;  4IHV A;  2R92 J;  5M5X J;  1IDY A;  2X48 A;  1IDZ A;  1ETX A;  1ETK A;  4RDU A;  2Y31 A;  1HF0 A;  2NVT J;  1O4X A;  1YRN A;  2E19 A;  3Q3S A;  4IHW A;  3S2D J;  1SFO J;  1H88 C;  1GUU A;  2R5Y A;  2M9H A;  1WH7 A;  3CDL A;  3TP0 A;  2E2H J;  5J3L A;  5DTD A;  2NVY J;  3VPR A;  1MSE C;  1WGX A;  1ETV A;  2O8K A;  2Y2Z A;  2COB A;  1ORK A;  3LNQ A;  1RKT A;  5EEA A;  5E3O A;  1LFU P;  1HDD C;  2GM4 A;  5C3E J;  2P81 A;  3JRF A;  1B72 B;  3TW7 A;  2L0K A;  1TWC J;  5EYR A;  3TW6 A;  4A69 C;  1AKH B;  1QRY A;  2VKV A;  3SJM A;  3CCY A;  1MBH A;  2XB0 X;  1DU6 A;  4DYQ A;  2R7Z J;  2DA2 A;  1IJW C;  2DA4 A;  5IOY A;  4Y7N J;  3BTJ A;  5IOZ A;  2FJ1 A;  5FLV A;  4M3B A;  4FCY A;  4DZJ A;  3SFI A;  4CYC A;  4ABZ A;  1P7J A;  2HQ5 A;  2VUM J;  3ZQI A;  4QIW N;  1IG7 A;  3A03 A;  2WB1 N;  3JRA A;  2E1O A;  5M5W J;  3ZQH A;  2LTP A;  1JKR C;  3HOY J;  5IP6 A;  1TWA J;  2YUS A;  3G1M A;  4DYR A;  4LOC A;  5C44 J;  1MBE A;  4FE7 A;  1T56 A;  1UHS A;  3TP3 A;  3JRG A;  1PUF B;  1IRZ A;  1R9T J;  2H8R A;  2R0Q C;  4A3G J;  1ENH A;  2Y9Z A;  1JKP C;  1G2H A;  2HXO A;  2O7O A;  1E3O C;  3PO2 J;  1EF4 A;  3JRE A;  2JMW A;  2QF7 A;  3NAU A;  5GP9 A;  1VI0 A;  4X1E A;  5C4J J;  1I3Q J;  1FIP A;  3FKI J;  3BQY A;  5BNG A;  1RES A;  2QCO A;  1FIA A;  4C3H J;  2R5Z B;  3B6A A;  4JX4 A;  1U9O A;  3BTI A;  2CRG A;  3LSJ A;  1JJ6 C;  5JLX A;  4XID A;  2JA5 J;  4MLO A;  4FIS A;  1WI3 A;  3HGY A;  1Y1V J;  1UMQ A;  1OFC X;  1FEX A;  2LD5 A;  3S2H J;  4UUT A;  5K7Z A;  4A3E J;  1X58 A;  3S16 J;  4XK4 A;  4XRS G;  1A5J A;  3BTC A;  3GTQ J;  5J1U A;  1BL0 A;  3CQZ J;  1U9N A;  3HKZ N;  2XSD C;  2I10 A;  1Z0X A;  5EG0 A;  4M3F A;  2DMU A;  3MVP A;  2LLK A;  5FKL A; 
#chains in the Genus database with same CATH topology
 2CW7 A;  2QEX I;  1UFM A;  4Y4R A;  3OYF A;  2DPD A;  4V19 K;  2HFH A;  2V79 A;  3H92 A;  4U7B A;  3RYP A;  3FK7 A;  4MQV A;  3RKX A;  2G9W A;  3LQR A;  5DM6 F;  2OQR A;  3REO A;  4AU7 A;  1WRJ A;  2G0E A;  2J5O A;  2LP0 A;  3E1S A;  3GF2 A;  5J1Y A;  1Z21 A;  5HDK A;  2IJL A;  4KIC A;  4A6D A;  4LMY A;  2F4O B;  3ELK A;  3PM1 A;  1FP1 D;  5F64 A;  3FWE A;  3KEO A;  4BXF A;  1XS9 A;  5CYV A;  3ISP A;  1FP2 A;  3HSF A;  4R79 A;  3RIR A;  4BJ5 C;  2BY2 A;  1FC3 A;  1TWF J;  4LG0 B;  1FX7 A;  5KNL A;  1D8K A;  4EM2 A;  1MMG A;  1YG2 A;  5LD2 C;  1BC7 C;  5KK1 A;  2ELJ A;  2ESN A;  2RAE A;  1A36 A;  1SFK A;  3IKV A;  2BHY A;  2AO9 A;  1ZR2 A;  2VBW A;  5FLX Z;  1FLI A;  3GFJ A;  3F3X A;  3W6V A;  3ZCO A;  1IC8 A;  2ME0 A;  4U87 A;  4DW6 A;  3DTK A;  4HDV A;  1WJA A;  2ECC A;  1MBK A;  2CV2 A;  3M4O J;  3V8L A;  3E5X A;  2FE3 A;  3W3C A;  2CUE A;  4RAZ A;  3CJQ B;  3EQL F;  4JBA A;  3SHF A;  2KMU A;  3ZMV A;  3R0A A;  1ZK8 A;  2IS2 A;  2V1N A;  5FKO A;  3CJT B;  2MC3 A;  3RKQ A;  3IH4 A;  2V9P A;  1BIA A;  2VB6 A;  5H6Q A;  3EET A;  3W2W A;  2BBY A;  2DLL A;  3JAM K;  2WY7 Q;  4IQ4 A;  5F0F A;  3I4M J;  1RET A;  1FBQ A;  1TZL A;  3F8N A;  2DYR H;  2BE5 F;  5F04 A;  1E17 A;  2L7F P;  4L5E A;  1DU0 A;  3C18 A;  2V1D A;  4XN3 A;  1X4P A;  3S2W A;  3KEQ A;  2F5F A;  3DKY A;  3WU2 C;  2XB5 A;  1R58 A;  3NQO A;  1IF1 A;  4GDF A;  2CSO A;  4XIC A;  2GIV A;  2QQB A;  1BM9 A;  1X3Z B;  5CJ9 A;  2NS7 A;  1G3W A;  4M72 A;  3U9G A;  3QYB A;  5EDN A;  2BEO A;  3LWF A;  3M8F A;  3VSK A;  4YFX F;  3TL4 X;  3AL0 B;  2EPF A;  1MBJ A;  5GAG J;  2VJJ A;  4A3D J;  1KU9 A;  1BOB A;  4JX5 A;  3HC7 A;  1PJR A;  1I3A A;  1BJZ A;  3S3N A;  1A6I A;  3RTR A;  1KQ9 A;  2DMP A;  4GRI A;  1IW7 F;  2H1L A;  1RRJ A;  1N77 A;  4EM0 B;  1X2M A;  3VWB A;  4G8X A;  1IRG A;  1FTZ A;  3MZH A;  3ZQC A;  4MIM A;  2KIS A;  1RZ4 A;  5J40 A;  3T1B A;  4KIT B;  1F5T A;  4NNJ A;  4UVA A;  3PSF A;  4DBR A;  5EF6 A;  1L0O C;  1AU7 A;  2DJN A;  1BOA A;  2M34 A;  3AAF A;  2Y9Y A;  3GBG A;  3KPH A;  4WXD A;  3FHZ A;  4OOI A;  4CH7 A;  4I6Z A;  1R4M B;  2VOO A;  3PIO F;  3LSR A;  2YX7 A;  2LF7 A;  2VN2 A;  2XRN A;  1IN6 A;  3OL4 A;  5HS7 A;  3NWS A;  1J75 A;  3BG6 A;  3UR3 C;  3G71 I;  4NC6 A;  2O9L A;  2JSP A;  1MMS A;  1ZGW A;  3HOU J;  3FM5 A;  2GOM A;  2LOO A;  5CPR B;  1YS6 A;  4BEH A;  1MJA A;  4RB3 C;  3WTU C;  2YS9 A;  3WG9 A;  3KP2 A;  3CC7 I;  5LHH A;  1NK2 P;  3WTS C;  3KZY A;  5K5R A;  3AG4 H;  3MAJ A;  4J19 A;  2XF7 A;  3BZC A;  3HM5 A;  1FJL A;  2ZKZ A;  1TQI A;  3GLX A;  2RVC A;  2F5E A;  2KJB A;  1JUP A;  5E3M A;  2Y0M A;  4BY1 J;  3MKL A;  2KHM A;  5GTH C;  2LKS A;  3RPQ A;  2DBB A;  1QU3 A;  3H35 A;  1T0F A;  1Y8R B;  4HSR A;  4LIT A;  4XON A;  1GV5 A;  3IP4 B;  4A5N A;  4KT6 A;  3KET A;  4E7H A;  1YJ9 I;  5B1B H;  3P9K A;  5J1R A;  1PP8 F;  1F43 A;  1GT0 C;  2X85 A;  4XLE A;  1R1U A;  2LG4 A;  3E6C C;  2AS5 F;  4GFB A;  4XOP A;  1U8R A;  2IS4 A;  3BR5 A;  4G6T B;  2XIG A;  3E3V A;  2K9N A;  4WF2 A;  3VOD A;  3AG2 H;  3GX4 X;  4MHG A;  2HPM A;  2LNB A;  4AIK A;  2YU9 J;  3HJE A;  4UVC A;  1EKE A;  1IN5 A;  4UUS A;  1I27 A;  2VL8 A;  2L3D A;  3ZQF A;  2DA6 A;  1UEL B;  4F55 A;  3PQK A;  4CYC B;  2CQK A;  3GTK J;  9ANT A;  2KT0 A;  3FHN A;  4UV9 A;  5JFR A;  1Y0U A;  2CMP A;  2TCT A;  3CTA A;  4MFD A;  5EG0 B;  4DGW B;  1J59 A;  3DQV C;  1BIB A;  5FJ8 J;  4BS9 A;  5L3C A;  2DXI A;  3ROU A;  5J6X A;  4ZDP A;  1N78 A;  4BH9 A;  1DGR M;  3CCQ I;  1ETO A;  2E34 A;  2ZNZ A;  3ZOB A;  5M5Y J;  3HSR A;  4LK1 F;  1Z77 A;  4M71 A;  2R7V A;  1XGN A;  1XC5 A;  2BW3 B;  3V42 A;  4ZZL A;  3JR9 A;  1HQC A;  2KIM A;  1QPI A;  4FQG A;  1BR2 A;  5FKN A;  1D5V A;  1OCO H;  5L3G A;  2A69 F;  1SAU A;  3OYM A;  3S1M J;  3F0C A;  4C30 A;  2A5Y B;  2HKO A;  2HOT A;  3BOQ A;  4YFK F;  3B6C A;  3IWF A;  2K85 A;  1B6A A;  1JUM A;  2IA1 A;  2VOP A;  5CKT A;  5FD5 A;  4ASN A;  3GFM A;  3HPG A;  5HLI A;  3DKW A;  3CMA I;  1KQ8 A;  3H3Z A;  3D5S C;  2HR3 A;  2O03 A;  4EAT A;  4UB8 C;  1VQ8 I;  2P6T A;  4ESJ A;  1X2N A;  3FM3 A;  3ZQL A;  2FNP A;  1TNT A;  4KFC A;  1ETW A;  5D5W B;  3H1C A;  3RDI A;  2AQF A;  3GME A;  4ESF A;  4RLF A;  1LE8 B;  4EMS A;  2R7W A;  1MBF A;  3GTG J;  1WH5 A;  4LK0 F;  4UY8 I;  2ZFU A;  5DDG A;  1S7E A;  5LEK A;  4HLX A;  4I76 A;  3W6K B;  2BW3 A;  3HRT A;  4HOB A;  5L3D A;  3IAM 2;  3BG9 A;  2ISZ A;  3DBH B;  4A3M J;  3BLY A;  2JA6 J;  3A4C A;  3HZJ A;  4M6X A;  4OIP F;  4HDU A;  4QPQ A;  2DT7 B;  3KP6 A;  4GO1 A;  4DIQ A;  3O8H A;  1OLT A;  3DXJ F;  1K4S A;  3JRD A;  5ICE A;  4IQJ A;  1QBJ A;  2K02 A;  1QPM A;  4IHT A;  4EV0 A;  5BOX A;  4PJN A;  4XRF A;  2IA0 A;  5JVG F;  4IEJ A;  3HEF A;  4PJL A;  4Z6Y A;  2IGN A;  2LDU A;  3K4K A;  2FUG 2;  2JJ7 A;  3OOU A;  2UZK A;  5HDG A;  5CVV A;  1M1E B;  1ZLJ A;  2X9D A;  4P96 A;  1ERD A;  3PUF A;  4D5C A;  1B8I A;  1BR4 A;  3WHB A;  4XRM A;  4OWR B;  1XD7 A;  3TDZ C;  2HZD A;  3D1N I;  4YFN F;  2DK8 A;  4AUX A;  3IV5 A;  2LF8 A;  4A2U A;  4LLG F;  2A07 F;  1BW6 A;  1SC7 A;  5K5Q A;  1XMX A;  2VBX A;  4KA4 A;  4B3X A;  3SDB A;  4RB0 A;  4BL0 B;  3G6E I;  2M4K A;  3CCS I;  4L0Y B;  3GTO J;  2HYG D;  3K4N A;  1FPQ A;  2P5V A;  3LSK A;  3CMM A;  2L9S A;  3SZP A;  2ICW G;  2V1U A;  3CO6 C;  3VSL A;  3R4K A;  1X1D A;  1TWG J;  1LFB A;  2IW5 A;  3CC2 I;  1VZ0 A;  1R1V A;  2F5D A;  2QQ8 A;  4IHV A;  2X48 A;  2K7L A;  4E7K A;  1ETX A;  2HQN A;  1CF7 B;  2NVT J;  1HF0 A;  2Y31 A;  2J5P A;  2NNN A;  1O4X A;  2E19 A;  1DGW Y;  1SVM A;  2VBY A;  3HUG B;  3S2D J;  1MMA A;  1XDS A;  4XN0 A;  2OTJ I;  1GUU A;  1WVR A;  1WH7 A;  3TP0 A;  3F8F A;  1V5G A;  2A6E F;  3CP8 A;  2FA5 A;  1HW5 A;  2E2H J;  2Z33 A;  3IHU A;  3VPR A;  2NVY J;  2H09 A;  2D2W A;  1MJ9 A;  2QVO A;  2Y2Z A;  4P5O A;  5J47 A;  3FXQ A;  2CYY A;  2X1E A;  2M7B A;  3K1M A;  1D3Y A;  3B73 A;  5E1X A;  3SEZ A;  3OYC A;  3CCJ I;  5J8C A;  1YTY A;  1OCC H;  1B72 B;  4D1Q A;  1RUO A;  4RB2 C;  1TWC J;  4A69 C;  1AKH B;  2IPQ X;  3ABU A;  1MBH A;  2Z16 A;  4DYQ A;  2M87 A;  3OMY A;  1FMV A;  1LVK A;  5IOY A;  3K70 D;  4CSW A;  2E1M B;  3MQ0 A;  3Q9V A;  1W36 D;  2GQQ A;  3I54 A;  2QQA A;  3ONQ A;  3GZ5 A;  3KYL A;  5LEJ A;  1YW8 A;  4QWQ A;  3TO6 A;  2OV7 A;  5M5W J;  2G7U A;  2LTP A;  4DYR A;  1HKS A;  5C44 J;  2H94 A;  1UHS A;  2VC0 A;  2IGM A;  4K2E A;  5BQT A;  1PUF B;  4HG2 A;  4JK1 X;  2V7F A;  1ENH A;  3BP8 A;  2DOE A;  3WE3 A;  3M8J A;  1LDD A;  1JKP C;  3DU5 A;  2HXO A;  3CCL I;  3R60 A;  4IXA A;  1X1A A;  3F72 A;  3NAU A;  2QF7 A;  4FET A;  4XLC A;  4L5I A;  2E1C A;  5LGN A;  1J09 A;  3BJ6 A;  1QHG A;  1P9Q C;  1KU7 A;  4BU2 A;  5HVQ C;  1V4R A;  4ZJZ A;  1FIP A;  3C3W A;  3E5U A;  2QCO A;  3KYD B;  4C3H J;  2L4M A;  4EJW A;  3MMY B;  4A0X A;  2CRG A;  3W6J B;  3LSJ A;  1R6R A;  2JA5 J;  1R4N B;  2KQR A;  1V3F A;  1Y1V J;  2P8T A;  1UMQ A;  2VPL A;  4CCO A;  3NWT A;  5FB2 A;  2DT5 A;  5K7Z A;  4A3E J;  2PEX A;  2LSO A;  5HLG A;  4ENK A;  2V26 A;  2BZT A;  3VYT B;  4XRS G;  1A6Q A;  2Z99 A;  2IXS A;  4BHB A;  2CV0 A;  2MBF A;  4JOM A;  4YEJ A;  5HNF A;  2WAF A;  4O6J A;  1LJ9 A;  4L9N A;  2ZXJ A;  3LSI A;  1JE8 A;  1UAA A;  2E2J J;  2NRA C;  5FFZ A;  2PMZ N;  3VEP A;  4A0Z A;  3DEU A;  2KJC A;  4DOZ A;  5EZG A;  2EFN A;  3CDH A;  3HHG A;  4CDG A;  3E5Q A;  2E1N A;  1UB9 A;  1D1A A;  2X0L A;  3GEZ A;  2CUF A;  3K7A J;  3Q0U A;  1FY7 A;  3HHH A;  4RM3 A;  5FRM A;  2VE9 A;  2DTZ A;  3K2A A;  1O3T A;  1GHC A;  2FQ3 A;  1MSF C;  4IVN A;  1SVL A;  3ASO H;  4YRV A;  1OYW A;  1LVA A;  4P1W A;  5BMZ A;  2OF7 A;  2WC2 A;  2K4B A;  2PBI A;  2L54 A;  3LST A;  4RB1 A;  3MKZ A;  2V9V A;  4MGR A;  1O3S A;  1HXD A;  1JT6 A;  3LFK A;  2GA1 A;  4DJA A;  1I39 A;  3HTU A;  4WX9 A;  2EQR A;  3FBI B;  2HQR A;  3F6V A;  1SD4 A;  2R4G A;  2R7O A;  2DN0 A;  3CF2 A;  2R7R A;  4S0H B;  2WAQ N;  2XKO A;  5FRN A;  3BR3 A;  1BR1 A;  2VLA A;  5BPD A;  1FTT A;  3DPT A;  2HVR A;  5DD8 A;  4LJZ F;  3SQN A;  3TDU C;  3R61 A;  4CCM A;  4KJZ A;  4S04 A;  1MMD A;  1JTY A;  4IX7 A;  3L9F A;  5ILU A;  1JKO C;  4M9X A;  2BVL A;  2DFH A;  2RDP A;  1GXP A;  5LBQ A;  3BJA A;  4F93 B;  4ON0 A;  3BR2 A;  4A93 J;  4QPO A;  3ZR8 X;  2TDX A;  3GYH X;  3LFU A;  2JT1 A;  1VF9 A;  4KIS A;  1Z6R A;  2QA4 I;  4IRG A;  1E3P A;  2OZ6 A;  1U8B A;  2BHZ A;  1XX5 A;  5AON A;  4P55 A;  5JI6 A;  4XOR A;  2D1V A;  2XPW A;  3ZN1 A;  2D45 A;  4KIB A;  2OTL I;  5HOD A;  2R7Q A;  1HSJ A;  2P5K A;  4MEX F;  4FX0 A;  3K4B A;  3ZMD A;  1K78 A;  2CV1 A;  4UUV A;  3GWZ A;  1ZR4 A;  2Q2E B;  2JN6 A;  2LBF A;  1Z05 A;  5IPA A;  2COM A;  3HSE A;  2DMQ A;  5KVR A;  3S32 A;  2FQ4 A;  1B1B A;  5CVR A;  2JTV A;  4ESB A;  3Q9S A;  1OIS A;  3P9C A;  2PI0 A;  3EYI A;  3E6D A;  1XGM A;  2E2I J;  3A0B C;  4XKB A;  2ID6 A;  3GW2 A;  2OD5 A;  3I53 A;  2HZT A;  4DBQ A;  1CF7 A;  1FYL A;  4M3D A;  5DCF A;  4F52 A;  1DDN A;  1Q1V A;  4BKX A;  2NOG A;  1WJF A;  2HYF A;  4BY7 J;  4CIC A;  4ZYE A;  4ENJ A;  4N9I A;  3QPS A;  3CJN A;  1XDU A;  1BI0 A;  3IL2 A;  2GIZ A;  4BJT A;  3VYR B;  3OY9 A;  1VQ5 I;  1MKM A;  2HDD A;  1BA5 A;  3O3K A;  1DUX C;  1YW7 A;  1JTX A;  2DQL A;  3WE2 A;  2P7C B;  4BHC A;  4EM1 A;  2QEN A;  4HF0 A;  1R7J A;  1MJB A;  3DPU A;  2HEO A;  4NC8 A;  6PAX A;  4KUM A;  4A3J J;  4KMU X;  1WCM J;  1IV8 A;  1RIO H;  3OYK A;  1VND A;  1A31 A;  2M0C A;  2STT A;  2BVM A;  3HOW J;  4IOA F;  5KAI C;  3SFZ A;  2NVQ J;  2JK3 A;  2HOS A;  4P9U A;  1ON2 A;  2P6S A;  2W57 A;  4HV5 A;  3QU6 A;  1WQ2 A;  2EZI A;  2KIQ A;  1P7I A;  5JR3 A;  3DEE A;  1O7L A;  2H6C A;  2R5Z A;  3G73 A;  2OAZ A;  4I0B A;  5IP7 J;  4BNC A;  5GAD J;  1H0M A;  2BY1 A;  1EH8 A;  2ELH A;  4HQE A;  2XC7 A;  3CCM I;  1TW2 A;  2Y69 H;  5DYM A;  2XRO A;  2BXY A;  1HLV A;  1PDN C;  4B1R A;  3DBL B;  3LA2 A;  1U6G A;  1G4D A;  4CYD A;  3H5N A;  2UUZ A;  1KA8 A;  4A12 A;  3E97 A;  3CUQ A;  3L09 A;  3N97 A;  1AHD P;  4BE1 A;  1MIJ A;  1HKQ A;  5D8K B;  4AVP A;  1TQM A;  5E3L A;  1RI7 A;  1S29 A;  1KU3 A;  3HRU A;  3HRM A;  4OIQ F;  5BPI A;  2EIM H;  4UNO A;  1F36 A;  3S17 J;  2VKD A;  4BQN A;  4HNU A;  3ABL H;  2K27 A;  2M8G X;  2VJI A;  1OCT C;  1IN7 A;  4ZTF A;  5TIS C;  2DA5 A;  4B09 A;  1HBX G;  2MA3 A;  4LG0 A;  2H8W A;  4A3B J;  4FAS D;  1QO0 D;  3T8T A;  1K61 A;  4R1H A;  3J81 K;  2I8D A;  1UZC A;  3CUO A;  4U0W A;  2Y30 A;  4Y52 J;  4CA0 A;  1QHH D;  2DA7 A;  2FBH A;  2CG4 A;  4G6D A;  2W4S A;  3BTL A;  1ITY A;  4MEY F;  3MZ8 A;  3BWG A;  2PFB A;  5E79 C;  3OYG A;  5CVJ A;  1I5Z A;  1QZY A;  4Q47 A;  2X6X A;  3JRB A;  1MBG A;  1CGP A;  2KDZ A;  1K4T A;  5A2Q Z;  2QQ9 A;  2XAU A;  2O3F A;  4PFP A;  3JRH A;  1Y1W J;  4XLH A;  5B1A H;  3SYT A;  1LUJ B;  1JKQ C;  1H9G A;  4RAF A;  2XAJ A;  1NG7 A;  1GVD A;  4UVB A;  5DEQ A;  1W5C C;  3FXU A;  3I56 I;  3BC8 A;  4J01 A;  3F23 A;  1IUY A;  4U0V A;  2EV0 A;  4Y3O A;  3GZ6 A;  3CO7 C;  5FFX A;  5IYC J;  1Z91 A;  2WA0 A;  3I58 A;  4C3I J;  5F0H A;  3DLL F;  1W0U A;  3HUG A;  4I02 A;  4PFO A;  1MDM A;  3RKY A;  3F8M A;  4Y13 A;  1W0T A;  2G7H A;  4I01 A;  4YII A;  1I1S A;  1MD0 A;  2L7K A;  4LLL A;  3FBN B;  3BRO A;  4HX8 A;  3IRQ A;  2PMZ A;  1USS A;  3DCF A;  3V4G A;  3H0D A;  4IHX A;  1F1Z A;  1WJC A;  2ZJ2 A;  2EV5 A;  3V7R A;  3K4M A;  1BN5 A;  2W82 A;  2L9R A;  3M1E A;  2NVX J;  2XGC A;  5FKK A;  3I4N J;  3ZMU A;  1J7K A;  1I6H J;  4B4C A;  3OS1 A;  3TO9 A;  3HG9 A;  4OIN F;  2A05 A;  2HYJ A;  2VJ5 A;  1RNL A;  1SAN A;  2WV1 A;  1OYY A;  3EYY A;  2HWV A;  2W48 A;  3HBL A;  2F5C A;  3FXJ A;  2EA4 A;  4HYE A;  2B63 J;  3TOB A;  1X1C A;  1T98 A;  3AL0 C;  5DUK A;  3S3O A;  2L7Z A;  2DCE A;  2XPV A;  3MCZ A;  5J8F A;  4LIU A;  3RKW A;  1D0X A;  4L18 B;  2QBY B;  3SEQ A;  2V9K A;  3TGN A;  1F4K A;  2EIL H;  3A0H C;  2CUJ A;  3OYE A;  4JX6 A;  3ABM H;  1WJ5 A;  3QPT A;  2F48 A;  5IT3 A;  3LSP A;  2IP2 A;  1U0J A;  3L2U A;  2KRF A;  4OU0 A;  2YPR A;  2EH3 A;  3TOA A;  3TBI A;  1FOK A;  1D0Z A;  1PUF A;  1ETQ A;  1ODD A;  1RPW A;  4GYI A;  4M3G A;  1S3J A;  3GTL J;  2VKH A;  3BDD A;  4V2F A;  3RSN A;  4PGH A;  1W5S A;  2CJJ A;  3OYH A;  4ZYH A;  3E7L A;  3CCU I;  2DA3 A;  2CU7 A;  4N4O B;  1Q1H A;  5FRO A;  1WZ2 A;  1S6L A;  1IDY A;  5LHI A;  1IDZ A;  3WTT C;  2A6H F;  1LKX A;  2V1X A;  2W25 A;  4HNT A;  2FNA A;  3CES A;  4NHJ A;  2EV6 A;  3OS0 A;  1U5T B;  1ZN2 A;  2HDC A;  2EB7 A;  2LKP A;  3M7G A;  4H4K C;  5CLS A;  2R5Y A;  4ZTJ A;  4IOC F;  2P7V B;  2L02 A;  2C6Y A;  1FSH A;  4L9T A;  4F92 B;  3L00 A;  1YQA A;  4II3 A;  4ZZD A;  2O8K A;  5J4V A;  3R6S A;  4ZYG A;  2E7X A;  3WGI A;  1ZAO A;  3LNQ A;  1RC9 A;  4I7H A;  1RKT A;  4RGR A;  2ZSI B;  1R36 A;  4BHP A;  1LFU P;  3B02 A;  1XSX A;  5K5O A;  5C3E J;  2GM4 A;  1O57 A;  4LG3 A;  3JRF A;  1K6O A;  2FF4 A;  2L0K A;  5HDN A;  2HGC A;  1TNS A;  2EIJ H;  1N25 A;  3T5X A;  1FOY A;  2R7Z J;  2ISY A;  3IWZ A;  2Y0S A;  4BAY A;  2RKH A;  4X0G A;  1QGP A;  2FJ1 A;  4M3B A;  4FCY A;  4CYC A;  1T0F C;  4ABZ A;  1SD7 A;  3OYJ A;  1HC8 A;  4UB6 C;  2E60 A;  3PFY A;  4QIW N;  5D5U B;  1IG7 A;  2WB1 N;  3JRA A;  3BY6 A;  5L3E A;  4BQA A;  4LOC A;  1MBE A;  1T56 A;  3DTE A;  1O3Q A;  3GO5 A;  4XLN F;  3CUQ C;  1HA8 A;  2H8R A;  4RGS A;  2L5Q A;  4GYG A;  2UWM A;  2R0Q C;  3IRR A;  1K79 A;  1Z3Y A;  3LSM A;  2Y9Z A;  3S8P A;  2X6Y A;  1EF4 A;  1UHM A;  1IRX A;  1ULY A;  3OL3 A;  1LDJ A;  3HL2 A;  1U5T A;  3ZMZ A;  1SVO A;  5GP9 A;  2MH9 A;  3KYC B;  4N4N B;  5KHD A;  4L9V A;  1EH7 A;  3H3U A;  1G8X A;  3ZP5 A;  3BZ6 A;  2NXN B;  2JPC A;  4QLC U;  2FRH A;  3OYI A;  3ZGK A;  1KZH A;  1BJA A;  2XAH A;  2O6G E;  1NG6 A;  3DWL E;  1JJ6 C;  4FIS A;  2KL4 A;  5A2Q K;  1ZG1 A;  1WI3 A;  2DQR A;  1LFP A;  2OBP A;  2RQP A;  1MNE A;  3P7N A;  5HOO A;  1STZ A;  5DCM A;  1ZG3 A;  2KZG A;  3QOE A;  1V5E A;  2WTE A;  2M3A A;  3K2Z A;  2DMU A;  3MVP A;  1WI9 A;  3K4L A;  2JA7 J;  2GBY A;  2ZJR F;  1MH3 A;  3DEW A;  3WHC A;  1GV2 A;  2PQ8 A;  2YR2 A;  2KDO A;  3S14 J;  4EGZ A;  2CGP A;  4YIF A;  2F5V A;  4I2O A;  3H0G J;  3CLQ A;  3QPH A;  2FD5 A;  2EBI A;  3EUH C;  1WWX A;  2AHQ A;  4D7M A;  3TED A;  3QQA A;  4HV6 A;  4MFE A;  3CF5 F;  2DOF A;  5LRR A;  1ACI A;  1I6X A;  3QP6 A;  2GLO A;  1QA6 A;  4D9J A;  5DS9 A;  3C2H A;  1JHF A;  2XAF A;  2DOA A;  4B43 A;  2X51 A;  3I3L A;  2HVS A;  2BGC A;  2ZSH B;  3L2Q A;  1LE8 A;  4A3F J;  2FXA A;  1Z7U A;  1D5Y A;  2ZXH A;  1JXS A;  1GVJ A;  5FKM A;  1YRN B;  1XN7 A;  4OIO F;  4P9F A;  1ZHF A;  1ZRC A;  1UHW A;  4UV8 A;  2EFP A;  3IKT A;  3DU6 A;  2JUG A;  2E36 A;  3PIP F;  4IJA A;  2R7U A;  3OIO A;  5F1R A;  1IN8 A;  5FLM J;  1ZEL A;  2OCE A;  5EGO A;  3LOC A;  1DP3 A;  2VXD A;  3D5L A;  1T39 A;  2PLY A;  1WPK A;  2LRD A;  1KU2 A;  1QVU A;  4YIR X;  2A5W A;  3GFI A;  1R22 A;  1E0E A;  1YYV A;  3A2K A;  3H9Q A;  1IRF A;  3M1C A;  4XKW A;  4KIF A;  3VDX A;  4GCV A;  2FX0 A;  2HTS A;  5GPA A;  3NAR A;  3U2R A;  1WSU A;  3MN2 A;  1QZZ A;  4HA8 A;  1Y8Q B;  4AYB N;  2MFZ A;  3T0Y A;  2ZC2 A;  4G12 A;  3V8K A;  3KEY A;  3WG7 H;  3BQZ A;  2LKX A;  3S15 J;  3IH3 A;  1OPC A;  5DV5 A;  1TP4 A;  1YOV B;  5EGO B;  2L2O A;  2OUM A;  4CO8 A;  3BJO A;  2Z9O A;  4BGD A;  1S7O A;  1PYV A;  3MEX A;  4FTH A;  1HW1 A;  4XNF A;  2FMY A;  2RV8 A;  3JSP A;  1DQU A;  3I9V 2;  2VKE A;  4E6K G;  1X19 A;  3AG1 H;  2HU9 A;  2W24 A;  3KE2 A;  3G1O A;  2M1B A;  3FIS A;  3RZD J;  4MNU A;  3PFI A;  3GVA A;  2CQX A;  2ZO4 A;  2L7M P;  1ONV A;  2IVM A;  2FU4 A;  2ZCW A;  3HOZ J;  3CDI A;  3K69 A;  4BDZ A;  1P6R A;  5L3B A;  2O0Y A;  2NS8 A;  1B72 A;  2DPU A;  3OSG A;  2PMH A;  3MFK A;  1RUN A;  3IUO A;  4A3L J;  3TO7 A;  1IV6 A;  1OR7 C;  3Q0V A;  3ZQQ A;  2D1H A;  3ZMT A;  2WAD A;  3MWM A;  2DA1 A;  3H5A A;  1IO2 A;  3OV8 A;  1SEU A;  5M3F J;  1FYK A;  2Z2S B;  1G3S A;  3JCU C;  2R93 J;  4BQO A;  4I0A A;  4Y17 A;  3ZMS A;  4LD5 A;  5J4Y A;  4XKV A;  3FZV A;  4HNV A;  4UHT A;  2JWT A;  2PJP A;  2CH0 A;  2CS3 A;  3L1P A;  1MMN A;  3FK6 A;  4AC0 A;  5IYD J;  3WTY C;  2QWW A;  2QBY A;  4KYW A;  3G3Z A;  1G59 A;  4YEL A;  2QYO A;  2KIF A;  2Y75 A;  2VT2 A;  4R8H A;  2W00 A;  5E17 F;  3F21 A;  4IRH A;  3A02 A;  4B8X A;  3SZT A;  2DYS H;  1OCZ H;  2JA8 J;  2A61 A;  1WJE A;  3BR1 A;  1XMA A;  4WK8 F;  3HOT A;  2XUB A;  4IPA A;  2OA4 A;  1T38 A;  1VQK I;  3CLO A;  4EJT A;  1ZQ3 P;  3QU3 A;  1YW9 A;  2BV6 A;  4ZYA A;  1B8I B;  3M3Y J;  3SDG A;  3N4M A;  4ITV A;  5EZH A;  4BBR J;  4D0P A;  1O3R A;  2LY1 A;  1BI2 A;  5F08 A;  1YE9 A;  2K9L A;  4E7J A;  1G6N A;  1HDP A;  2EK5 A;  4RAY A;  1LEB A;  1FBS A;  3RCO A;  1DPR A;  3HIF A;  4PZJ A;  4TV7 A;  3FMS A;  3LSG A;  2RNG A;  5JLW A;  3TMO A;  3J7Y J;  5AIQ A;  1A04 A;  2DJI A;  3ZQ7 A;  5GAH J;  4LGW A;  3CCE I;  2IS6 A;  3BCB A;  1MDM B;  3FX3 A;  3BT9 A;  1UG0 A;  4M6Y A;  5F0C A;  3GXO A;  5E3N A;  2MGQ A;  4HST A;  2DO7 A;  3KZI C;  3RJP A;  4WXC A;  1YS7 A;  2F2E A;  2OJE D;  4PJM A;  2K9S A;  1RKW A;  1IZ1 A;  4E4H A;  1W5T A;  3ZQG A;  2Y48 A;  3BR0 A;  3PNY A;  1K78 B;  1YFH A;  4M74 A;  2LBF B;  1KGS A;  4AID A;  3QPL A;  4AWX B;  1TTY A;  2E35 A;  3OYA A;  3NRV A;  4M6V A;  1XPX A;  2QLZ A;  1R5G A;  5B3S H;  1U5T C;  3OYN A;  3RI4 A;  4FX4 A;  3HYI A;  3RZO J;  1Y39 A;  1FZP B;  4KMF A;  1W1W E;  2MSY A;  2V4J C;  4BE2 A;  1NK3 P;  5KCM A;  3GTM J;  2VQG A;  4EJU A;  3UKG A;  2IGO A;  3V7C A;  4HX7 A;  5E8I A;  2OC6 A;  3J81 Z;  1XCB A;  1UST A;  1J9I A;  3C1D A;  3KX2 A;  2DU9 A;  1OCP A;  2H27 A;  1ZRD A;  4BYY A;  2HKX A;  3H5R A;  1ZLK A;  3F9K A;  2GZW A;  2MW8 A;  3LSH A;  5D5X B;  3GTJ J;  4XR6 A;  2QKL B;  4PGG A;  4XRS A;  3IC7 A;  1GLN A;  3FMR A;  1XGO A;  2IEK A;  2XGD A;  4HF1 A;  1TQP A;  3I64 A;  3H3V K;  1P4W A;  3DPL C;  1V5F A;  3K0L A;  2PJR B;  4C9Y A;  2PJR A;  3SXY A;  4LFU A;  3JW4 A;  4A6E A;  1S5L C;  3H36 A;  2IA2 A;  4C2U A;  5ILV A;  4A0Y A;  4IRI A;  3S1Q J;  2AQE A;  2ZME A;  1LNW A;  1JUS A;  5BS6 A;  3IH2 A;  4LB6 B;  5IYB J;  3MKY B;  3KIO A;  2VAS A;  4RS8 A;  3J80 K;  1YX3 A;  3PUB A;  1YIJ I;  1X1P A;  1X3U A;  2JUC A;  1REP C;  2OZU A;  2FSW A;  3PO3 J;  3F8B A;  1X4O A;  2DFE A;  2JVH A;  2LK2 A;  5ERI A;  4A3C J;  1EA3 A;  4GXO A;  4FHT A;  1S8N A;  4X6A J;  2KZV A;  1K83 J;  3OSF A;  5GPC A;  1Y6I A;  1IXC A;  1VTN C;  2JRM A;  2UXX A;  4B47 A;  2L9N A;  2WAQ A;  3FXL A;  1H8A C;  2KKO A;  4XMY A;  5ED4 A;  3W2A A;  2WB1 A;  4WWC A;  4M3E A;  2KP6 A;  2B7E A;  1TT0 A;  2DOD A;  2JRT A;  3PSI A;  2LC2 A;  4JP0 A;  3H9J A;  3C7J A;  1F9N A;  3HOV J;  4W97 A;  3QRF F;  2M45 A;  1TBX A;  4PUS A;  2BY3 A;  1LQ1 A;  2EZK A;  3OOP A;  1EJ9 A;  4MQ9 F;  2MLG A;  4Y33 A;  2IBD A;  4BEH B;  4L0Z B;  2F4I A;  3BR6 A;  3UNG C;  3VYU B;  1LDK B;  2HNH A;  3FXK A;  2M5W A;  5M5X J;  1L3L A;  2KRC A;  4ZH4 F;  2GA2 A;  3JSO A;  1ETK A;  3I0T A;  4RDU A;  5FGM A;  5CQE A;  1WFX A;  4MTE A;  3I4P A;  4UXN A;  4IHW A;  1MND A;  4AIH A;  1SFO J;  2R7D A;  2K5C A;  2XF5 A;  4ZYD A;  1H88 C;  1TT5 B;  1SFE A;  4XSX F;  3MZY A;  2M9H A;  1FBU A;  1IAW A;  2DAO A;  1MGT A;  3MKW B;  2KIU A;  3OIP A;  1H9T A;  5DTD A;  1MSE C;  3I59 A;  3HPH A;  3IAS 2;  4MTD A;  1ETV A;  2K86 A;  5JHF A;  4E70 A;  2COB A;  2YU3 A;  2GOX B;  5EEG A;  5LLQ A;  4IHS A;  1Y0N A;  2CWE A;  1BI3 A;  1UCR A;  2FML A;  2QKM B;  5EEA A;  3G4S I;  1QZE A;  2HPI A;  3ML6 A;  3WTZ A;  2KFD A;  2VIX A;  3TW7 A;  1Z3X A;  1R5I D;  2R7S A;  2PX9 A;  2IRF G;  2CQ7 A;  5EEH A;  1QRY A;  1MZB A;  5HNH A;  2VKV A;  3SJM A;  2MAB A;  2HDW A;  5FO5 A;  1DU6 A;  4AD9 A;  5D8L B;  2DA2 A;  4XLF A;  1T8I A;  1IJW C;  1XTA A;  3EUK L;  4IKF A;  3BTJ A;  2XVC A;  3ZXS A;  4BJ6 C;  4BDY A;  4XLA A;  1IN4 A;  5CVU A;  5IOZ A;  3QOD A;  4CZZ A;  4J00 A;  4DZJ A;  3LA3 A;  3SFI A;  4CCL A;  3GCM A;  2HQ5 A;  3CC4 I;  2EWN A;  2V6E A;  5IT9 K;  4HLY A;  3ZQI A;  4G7Z F;  3GFL A;  3FKJ A;  1EV7 A;  2E1O A;  3ZQH A;  1JKR C;  2FBK A;  2HQA A;  1S9H A;  2YUS A;  4ENN A;  3HRS A;  3CME I;  2VJ4 A;  4EVI A;  3JRG A;  1AOY A;  1T08 B;  2X6W A;  4CGZ A;  4E7S A;  2ZJP F;  1IRZ A;  2XGX A;  1R9T J;  1WJB A;  3ULQ B;  5TGT A;  4A3G J;  2O8X A;  4Z2Y A;  1OQY A;  2FOK A;  3K10 A;  3I59 B;  4E7Z A;  1HST A;  3E6B A;  1SFU A;  2O7O A;  1E3O C;  2ESH A;  3PO2 J;  4F7Z A;  3JRE A;  2JMW A;  4E7I A;  1Z1D A;  2VE8 A;  2PN6 A;  1J0R A;  1AA7 A;  1VI0 A;  5C4J J;  3FKI J;  5D6F A;  3I55 I;  3BQY A;  1D8J A;  4DNC A;  3A1Y A;  1FIA A;  2R5Z B;  3B6A A;  3K4J A;  4JX4 A;  2VQL A;  3DLA A;  4PJJ A;  3CCV I;  3BZK A;  3U1K A;  4XID A;  5JHU A;  1YX5 A;  3HGY A;  2AXT C;  1E3H A;  1NHA A;  1Z7L A;  4RMN A;  2LD5 A;  3S2H J;  4UUT A;  2ETH A;  2M30 A;  3DTI A;  1X58 A;  3U1D A;  3S16 J;  4XK4 A;  5HLT A;  2RQQ A;  1D1C A;  3CQZ J;  1U9N A;  5C4X J;  2K3P A;  2XSD C;  1LB2 A;  2A68 F;  4GGG A;  3EDP A;  1Z0X A;  3O6B B;  3OIQ A;  1S7A A;  1IXS B;  2FOW A;  1R00 A;  2LFB A;  3DV8 A;  2DW4 A;  4IZZ A;  1MH4 A;  3I5U A;  2MYS A;  4IHY A;  5FLX K;  4G6Q A;  5IP9 J;  1IUF A;  3W2V A;  2LYC A;  5F6F A;  5LGU A;  1T6S A;  4ZDO A;  1UG2 A;  2HOA A;  2V6C A;  1W7P A;  3OR2 C;  1V54 H;  5ICG A;  2XSJ C;  3ESW B;  1SFX A;  4L5J A;  4DYC A;  3HKZ A;  1T33 A;  4EEF G;  5ICF A;  1APL C;  1SMY F;  3G1L A;  3P5J A;  5TJJ A;  2RRE A;  1OJL A;  2Z1D A;  1YJN I;  3S1N J;  1Z67 A;  3AFH A;  5M3M J;  2Q0O A;  4RAG A;  4ANJ A;  2JZY A;  2LY9 A;  3OYD A;  5E18 F;  2DTR A;  2EFO A;  3R0J A;  1XCV A;  1KON A;  2LRE A;  2HI3 A;  1YHQ I;  4BBS J;  2EIN H;  5AIP A;  2HXI A;  2EA2 A;  1OCR H;  4DZP A;  1G3Y A;  1ZGA A;  5TRD A;  4WXH A;  4BQQ A;  4L9J A;  4DQ2 A;  2JVG A;  3EPZ A;  2YSR A;  2ECB A;  3I71 A;  4JQF A;  2VON A;  3KZZ A;  1POG A;  3F22 A;  5JVT A;  1MW7 A;  3V8J A;  3JRC A;  3HB9 A;  2R5Y B;  1T2K A;  3N05 A;  2DMN A;  1S72 I;  1C0W A;  1VQM I;  3ZRG A;  2OCC H;  4U88 A;  3JTG A;  4ZC3 A;  2W85 A;  3C2B A;  4AVZ A;  1E2X A;  1VQ9 I;  4QSH A;  4AYB A;  1U3E M;  1W4M A;  3Q5F A;  3DP7 A;  3WTX C;  1VQL I;  2M0M A;  3QOP A;  1LEA A;  4B3A A;  4E7L A;  1KQ0 A;  2VXZ A;  1AKH A;  1ZH5 A;  3AG3 H;  3M9A A;  5CQG A;  1IXR C;  3HXL A;  3NEU A;  3CMY A;  4KN4 X;  3DKX A;  4Q4Z F;  1TC3 C;  2M8E A;  2NOJ B;  2RGV A;  4NBQ A;  5LGT A;  4HW0 A;  5LRS A;  3E6M A;  4HEA 2;  1U2W A;  4QTR A;  3GTP J;  2STW A;  1A35 A;  2XHK A;  3S1R J;  2UV1 A;  3S3M A;  4Q5S F;  3JRI A;  1OR7 A;  3FXM A;  2LVS A;  4AIJ A;  3CUQ B;  5D6E A;  5H6R A;  2XAG A;  5FD6 A;  3DBR B;  2BOL A;  2EZH A;  2Q1Z B;  2DFI A;  2AXL A;  3LL7 A;  2F6C A;  3WGG A;  2O5R A;  2R7F A;  1Z9C A;  1HW2 A;  1HKT A;  2CW8 A;  2BY0 A;  3EUA A;  2QSH X;  2IAI A;  3D0S A;  2K40 A;  1VQO I;  5CVI A;  2P0W A;  4EJO A;  1B4A A;  4AM3 A;  2MD5 A;  1GDT A;  1ETY A;  4XOT A;  3BG3 A;  4I99 C;  5LHG A;  3K1N A;  4C2M J;  1YO5 C;  4M9S A;  3BG7 A;  2ZJQ F;  2BYV E;  4PCQ A;  2JQ7 A;  3K70 C;  2TRT A;  2CW0 F;  1FMW A;  2CUZ A;  2X1D A;  2ADU A;  2GXB A;  1JI8 A;  1P4X A;  1TLH B;  1SD6 A;  2IGK A;  2EFQ A;  2LMD A;  4BAC A;  4MO7 A;  5GTI C;  3L2W A;  1XSV A;  2HS5 A;  2MD0 A;  4ENM A;  4D5F A;  1VQ6 I;  4M73 A;  5DUI A;  4RM2 A;  1XSD A;  2DK5 A;  2K4J A;  4W1U A;  2ZB9 A;  3PNV A;  4D7N A;  3ZPL A;  2QM3 A;  1K6Y A;  4ETS A;  3DFG A;  2A6T A;  4XM3 A;  2N8G A;  1U78 A;  1CQT A;  2X4H A;  2ZFW A;  3OYL A;  4Y15 A;  1ZKG A;  3TKY A;  4XSZ F;  2H6B A;  5IT9 Z;  3CZ6 A;  4XLP F;  1ZGJ A;  2WWY A;  4B48 A;  2M7A A;  4EGY A;  1YJW I;  4JYK A;  1RR7 A;  1JHH A;  3BCA A;  4HPQ A;  2E5N A;  3FXO A;  1K7A A;  2CO5 A;  1VFC A;  2XV4 S;  2Q8K A;  1BI1 A;  4BUP A;  4FE4 A;  3P9I A;  5H2F C;  2EFW A;  3F8C A;  4NQW B;  4A3I J;  2OPT A;  3QYF A;  2HOE A;  3HTS B;  2CFO A;  3WGH A;  3ECH A;  2GXA A;  1VQP I;  1OKR A;  2NYX A;  1N75 A;  1UJ8 A;  2CQQ A;  2GWR A;  3S93 A;  2KLO A;  3O8G A;  1NTC A;  5B66 C;  3HDD A;  1SMT A;  2L4A A;  4BE0 A;  2RNJ A;  2E1M C;  4NC7 A;  2ACJ A;  2KPM A;  3RPU A;  3CP2 A;  2VI6 A;  1R5H A;  2XPU A;  2LR8 A;  4OAY A;  3A01 A;  4G9Y A;  4I09 A;  1ZTR A;  4V2G A;  3PQJ A;  1H89 C;  4RGX A;  5E1W A;  4OMZ A;  2XDV A;  3EUH A;  1JGS A;  3HGG A;  4FT8 A;  2P5L C;  4KDP A;  2VQC A;  4EJV A;  2NNY A;  4YG2 F;  3RQ4 A;  1KYW A;  3OS2 A;  3COA C;  2XRL A;  4LLN A;  2B0L A;  2K9Q A;  5F1J A;  3Q0W A;  1FNN A;  1P4A A;  1TWH J;  1HCR A;  2Y0S N;  4HBL A;  1W7P D;  3GLL A;  4G7O F;  2XGE A;  3BG5 A;  1MNM C;  2E71 A;  1W36 C;  1ON1 A;  2DT6 A;  3DF8 A;  3QAH A;  4N9H A;  1IGN A;  1PUE E;  1PP7 U;  2IT0 A;  2GAU A;  2JA2 A;  3HOX J;  4HF2 A;  2DDB A;  2M2E A;  5B5E C;  1PVE A;  4C3J J;  2YX4 A;  1DPU A;  4CCN A;  2ZME C;  3TQN A;  1R71 A;  2X1C A;  1YIO A;  4A3K J;  4NDL A;  3WOD F;  3FF5 A;  4WCG A;  3O2P E;  2ME6 A;  1QNT A;  2XKP A;  3CCR I;  2ELK A;  2ZXI A;  4OIR F;  2D5V A;  5F27 A;  3ASN H;  4PSX A;  2EIK H;  2QGU A;  2MLK A;  5K1Y A;  2OU2 A;  1BW5 A;  2R7T A;  2GXG A;  1FSE A;  2X6O A;  3QWL A;  3HOS A;  2WBM A;  2NS0 A;  1ZYR F;  1I50 J;  1NH3 A;  3GZN B;  4BXX J;  4HRI A;  1W7P B;  2ID3 A;  2UXN A;  2VT3 A;  3FIW A;  1G3T A;  2HVQ A;  3PJR A;  3BPV A;  1R23 A;  1X3W B;  4UUS B;  2XAS A;  2H1K A;  1B9N A;  2E5Z A;  3ZN0 A;  1HOM A;  2EZL A;  2KRH A;  3CD6 I;  2K3F A;  3KP7 A;  1D1B A;  4RGU A;  1XMK A;  1FYM A;  3VYS B;  4KN7 X;  5D4S A;  1VQ7 I;  3V7S A;  4B44 A;  4CCJ A;  2MG4 A;  1R1T A;  2W84 A;  3H9G A;  3D5R C;  2QZ8 A;  4KIG A;  4LIV A;  2A3S A;  3RQI A;  3ERE D;  2OQG A;  2F4M B;  2B9S A;  2NAZ A;  3FXR A;  2L01 A;  5K7F A;  1ZRF A;  5GAE J;  1SAX A;  2PMU A;  1QVT A;  3A01 B;  1JJ8 C;  2IS1 A;  3ABK H;  4C2T A;  2QUF A;  1J5Y A;  1GXQ A;  2XF6 A;  3K6G A;  5LFA A;  4N0B A;  1B9M A;  2JSC A;  1OMI A;  3G2B A;  4CCK A;  4CZC A;  2R7X A;  3SZG A;  1EH6 A;  1OYI A;  3L7W A;  5ICC A;  2VPR A;  2DFF A;  3K1P A;  1AWC A;  3CJR B;  2DI3 A;  3M07 A;  3LAP A;  3JAM Z;  1QQI A;  2Z3Y A;  2DMT A;  1D0Y A;  1ZG5 A;  1JT0 A;  2ZBK A;  2Q2E A;  5D5V B;  5DCM B;  3J7A Y;  2LH9 A;  2WY8 Q;  4CUG A;  1DP7 P;  4PDK A;  1WJD A;  4O5V A;  1XG1 A;  4RBO A;  3PL8 A;  1O7F A;  2HTJ A;  3ECO A;  3QP5 A;  4I98 B;  1Y56 A;  4F3Q A;  1ZRE A;  3J80 Z;  1JGG A;  5HS9 A;  5IY5 H;  4G94 A;  1SD5 A;  5K7H A;  3KP3 A;  3MD2 A;  2R92 J;  1KYZ A;  4CHU A;  1TW3 A;  4BXU A;  4U7D A;  1YRN A;  3Q3S A;  5H20 A;  2FBI A;  4Q48 A;  4EQQ A;  3CDL A;  4PJ0 C;  3KLN A;  5E20 A;  3PNT A;  1R49 A;  3KP4 A;  2VOD A;  5J3L A;  3VOE A;  3X2Q H;  2W1O A;  2XAQ A;  5E8G A;  1WGX A;  4OMY A;  5D4R A;  1BC8 C;  1ORK A;  3VB2 A;  3AKZ A;  5DD4 A;  2EJR A;  1YIT I;  5DM7 F;  3WU1 B;  2BXZ A;  4IF4 A;  3KLO A;  2MH2 A;  5E3O A;  4II2 A;  2QSF X;  4F91 B;  2CFX A;  1HDD C;  2W7N A;  2P81 A;  2VQH A;  1XGS A;  3LQQ A;  3RYR A;  3U21 A;  3OWT A;  4XKC A;  2QSG X;  5E1Z B;  1T95 A;  5EYR A;  3TW6 A;  1WHU A;  4A5M A;  4HAM A;  5ILS A;  4XL9 A;  1J2X A;  3CCY A;  1YLF A;  4O3M A;  2XB0 X;  3OYB A;  3L2V A;  3K9T A;  5HLH A;  4G7H F;  4LB5 A;  3L2C A;  5HS8 A;  2PG4 A;  3KFW X;  4RLQ A;  1FWZ A;  4KT5 C;  1RR8 C;  1V55 H;  2DA4 A;  2Z5U A;  3BPX A;  3WTW C;  1VQ4 I;  4Y7N J;  3K4C A;  1FT9 A;  2MC4 A;  1YI2 I;  1I1G A;  1LPQ A;  5FLV A;  3E0J B;  2R3S A;  1P7J A;  4NQW A;  2VUM J;  4KNY A;  4M9Z A;  1WKM A;  3A03 A;  3KP5 A;  2RN7 A;  1X1B A;  3C2G A;  3KCC A;  3HOY J;  4RA2 A;  3M8E A;  4OAZ A;  5IP6 A;  5KAF C;  1TWA J;  3J7Z I;  3G1M A;  4FE7 A;  3J7A O;  4HZF A;  3TP3 A;  2E7W A;  1TL8 A;  2LY2 A;  2FEZ A;  3LMM A;  4S05 A;  4U0Y A;  1G2H A;  4PSW A;  3JTH A;  2NVU B;  1FOW A;  4NUB A;  2L9V A;  4ZDL A;  2ZNY A;  3ERM A;  4IO9 F;  4X1E A;  1I3Q J;  2VC1 A;  3LA7 A;  2JPB A;  5BNG A;  3ABT A;  3WTV C;  4XBF A;  1RES A;  3FMQ A;  3FDY A;  2DDA A;  3LAJ A;  3L2R A;  4HX4 A;  5L3F A;  2P4W A;  4CXF A;  2ZXW H;  1U9O A;  1VQN I;  4H0E A;  4PK4 A;  2WAE A;  2WV0 A;  3BTI A;  4HQM A;  2CQN A;  5JLX A;  1BBY A;  4MLO A;  4XQF A;  2VBZ A;  1OFC X;  1ZAR A;  1FEX A;  1P92 A;  3WU0 A;  3QYE A;  2O61 A;  1P2F A;  3OR1 C;  3RPU D;  1Z6T A;  2K9M A;  3VFZ A;  3GUD A;  3T8R A;  4IL6 C;  1A5J A;  3BTC A;  1FOX A;  3GTQ J;  5J1U A;  1BL0 A;  2I5U A;  3HKZ N;  5EJC A;  2I10 A;  2ZME B;  3F6O A;  1XB4 A;  1B59 A;  5EG0 A;  4M3F A;  2RC4 A;  4NB5 A;  2LLK A;  5FKL A;  2M4G A; 
#chains in the Genus database with same CATH homology
 2LFB A;  2JA7 J;  2E2J J;  2GBY A;  1MH4 A;  1MH3 A;  2PMZ N;  3DEW A;  3WHC A;  1GV2 A;  5EZG A;  4IHY A;  3S14 J;  5IP9 J;  1IUF A;  2CUF A;  3H0G J;  3K7A J;  2FD5 A;  3FK7 A;  3Q0U A;  2EBI A;  2AHQ A;  4D7M A;  3TED A;  3QQA A;  4MFE A;  1UG2 A;  2DTZ A;  2HOA A;  2GLO A;  2G0E A;  2LP0 A;  5DS9 A;  5J1Y A;  3K2A A;  4DYC A;  1T33 A;  4EEF G;  1APL C;  1MSF C;  5C4X J;  3G1L A;  1LE8 A;  4A3F J;  3PM1 A;  1OJL A;  1XS9 A;  1D5Y A;  5FKM A;  2OF7 A;  3S1N J;  5M3M J;  1YRN B;  1TWF J;  2LY9 A;  1JT6 A;  4BBS J;  2HI3 A;  2EQR A;  2RAE A;  2HXI A;  2DN0 A;  2AO9 A;  3OIO A;  1ZR2 A;  4S0H B;  4DZP A;  3W6V A;  2WAQ N;  5FLM J;  3BR3 A;  2ME0 A;  5EGO A;  1IC8 A;  3LOC A;  1FTT A;  4DW6 A;  2ECC A;  1WPK A;  1MBK A;  3M4O J;  2ECB A;  1POG A;  1QVU A;  2CUE A;  1JTY A;  3JRC A;  3HB9 A;  1JKO C;  1ZK8 A;  2R5Y B;  2DMN A;  5FKO A;  3RKQ A;  3IH4 A;  3C2B A;  5GPA A;  2FX0 A;  3BR2 A;  4A93 J;  3NAR A;  4QSH A;  3MN2 A;  1VF9 A;  5F0F A;  3I4M J;  1RET A;  4AYB N;  4B3A A;  1U8B A;  1AKH A;  4G12 A;  5F04 A;  2L7F P;  2XPW A;  4L5E A;  3CMY A;  3BQZ A;  2LKX A;  1DU0 A;  1TC3 C;  5HOD A;  3S15 J;  3IH3 A;  5EGO B;  2XB5 A;  4QTR A;  3GTP J;  3S1R J;  1ZR4 A;  4FTH A;  2JN6 A;  3JRI A;  2LVS A;  5IPA A;  4XIC A;  2VKE A;  2DMQ A;  2NS7 A;  5EDN A;  3G1O A;  2FQ4 A;  2EZH A;  3FIS A;  3RZD J;  1MBJ A;  4A3D J;  2CQX A;  4JX5 A;  2IAI A;  2K40 A;  2E2I J;  1BJZ A;  2L7M P;  2ID6 A;  1A6I A;  1GDT A;  2DMP A;  3HOZ J;  1ETY A;  3BG3 A;  4M3D A;  1Q1V A;  4BKX A;  2NOG A;  4C2M J;  2NS8 A;  4BY7 J;  1X2M A;  1B72 A;  3OSG A;  1FTZ A;  3QPS A;  3ZQC A;  2TRT A;  4MIM A;  4A3L J;  1IV6 A;  3Q0V A;  2HDD A;  1BA5 A;  2DA1 A;  5EF6 A;  1JTX A;  1AU7 A;  2DJN A;  5M3F J;  2M34 A;  2Y9Y A;  3GBG A;  4MO7 A;  2R93 J;  4D5F A;  4I6Z A;  4A3J J;  3LSR A;  4W1U A;  1WCM J;  2ZB9 A;  1VND A;  4D7N A;  4HNV A;  2M0C A;  2JWT A;  3HOW J;  2O9L A;  2NVQ J;  1ZGW A;  3HOU J;  2JK3 A;  2HOS A;  2N8G A;  1U78 A;  1CQT A;  2YS9 A;  3L1P A;  3FK6 A;  4AC0 A;  5IYD J;  1NK2 P;  4J19 A;  1FJL A;  1ZKG A;  3HM5 A;  2EZI A;  1JUP A;  1P7I A;  5E3M A;  4JYK A;  1RR7 A;  4BY1 J;  2R5Z A;  3MKL A;  5IP7 J;  3A02 A;  1VFC A;  4FE4 A;  2JA8 J;  1GV5 A;  3BR1 A;  2OPT A;  4A3I J;  5J1R A;  1HLV A;  1ZQ3 P;  1F43 A;  4B1R A;  1GT0 C;  1B8I B;  4GFB A;  3M3Y J;  2CQQ A;  3SDG A;  3BR5 A;  2K9N A;  3O8G A;  5EZH A;  4BBR J;  1NTC A;  2YU9 J;  3HDD A;  1AHD P;  5E3L A;  4UUS A;  5F08 A;  1HDP A;  3ZQF A;  1F36 A;  2VI6 A;  2XPU A;  3S17 J;  2DA6 A;  2LR8 A;  4CYC B;  3A01 A;  3LSG A;  3GTK J;  1ZTR A;  9ANT A;  4V2G A;  5JLW A;  2KT0 A;  1H89 C;  2M8G X;  2TCT A;  4MFD A;  1OCT C;  5EG0 B;  2DA5 A;  5FJ8 J;  3BT9 A;  4A3B J;  3HGG A;  5F0C A;  1K61 A;  1ETO A;  3ZOB A;  5M5Y J;  5E3N A;  2MGQ A;  1Z77 A;  2Y30 A;  1XC5 A;  4Y52 J;  2K9S A;  2DA7 A;  1RKW A;  1ITY A;  3ZQG A;  2XRL A;  3BTL A;  3JR9 A;  2K9Q A;  5F1J A;  1QPI A;  3BR0 A;  3Q0W A;  5FKN A;  1TWH J;  1HCR A;  2Y0S N;  3S1M J;  3F0C A;  3JRB A;  1MBG A;  2XGE A;  2HOT A;  2KDZ A;  3BG5 A;  3QPL A;  1MNM C;  3JRH A;  1Y1W J;  4M6V A;  3B6C A;  1IGN A;  1JUM A;  1JKQ C;  3RZO J;  1GVD A;  3HOX J;  2M2E A;  4C3J J;  2MSY A;  4A3K J;  1NK3 P;  3GTM J;  4NDL A;  5IYC J;  3UKG A;  4C3I J;  5F0H A;  2ME6 A;  1X2N A;  1W0U A;  3ZQL A;  2ELK A;  2D5V A;  5F27 A;  1W0T A;  1ETW A;  1OCP A;  1LE8 B;  1BW5 A;  2X6O A;  2MW8 A;  3DCF A;  1I50 J;  1MBF A;  3GTG J;  4IHX A;  1WH5 A;  4BXX J;  2ID3 A;  3GTJ J;  3FIW A;  4XRS A;  1S7E A;  2L9R A;  4I76 A;  2NVX J;  2XGC A;  5FKK A;  3I4N J;  2IEK A;  2XGD A;  4UUS B;  1I6H J;  3BG9 A;  2H1K A;  3H3V K;  4A3M J;  4B4C A;  1HOM A;  2JA6 J;  2EZL A;  2HYJ A;  1SAN A;  2WV1 A;  2W48 A;  3O8H A;  3HBL A;  3S1Q J;  2B63 J;  3JRD A;  1JUS A;  2MG4 A;  3IH2 A;  5IYB J;  3RQI A;  2L7Z A;  2XPV A;  5K7F A;  4IEJ A;  3HEF A;  1QVT A;  3A01 B;  1JJ8 C;  2JJ7 A;  3OOU A;  3PO3 J;  2LK2 A;  2X9D A;  4D5C A;  4A3C J;  1B8I A;  3WHB A;  4JX6 A;  4XRM A;  4X6A J;  1K83 J;  3OSF A;  5GPC A;  3D1N I;  3LSP A;  3IV5 A;  4AUX A;  2VPR A;  1H8A C;  1BW6 A;  2EH3 A;  2DMT A;  1JT0 A;  4M3E A;  1PUF A;  4JP0 A;  1ETQ A;  3GTO J;  4RBO A;  1RPW A;  1XG1 A;  3HOV J;  4M3G A;  3GTL J;  4W97 A;  4V2F A;  1JGG A;  2CJJ A;  2EZK A;  1TWG J;  1LFB A;  2IBD A;  3E7L A;  2DA3 A;  5K7H A;  2CU7 A;  3BR6 A;  4IHV A;  2R92 J;  5M5X J;  1IDY A;  2X48 A;  1IDZ A;  1ETX A;  1ETK A;  4RDU A;  2Y31 A;  1HF0 A;  2NVT J;  1O4X A;  1YRN A;  2E19 A;  3Q3S A;  4IHW A;  3S2D J;  1SFO J;  1H88 C;  1GUU A;  2R5Y A;  2M9H A;  1WH7 A;  3CDL A;  3TP0 A;  2E2H J;  5J3L A;  5DTD A;  2NVY J;  3VPR A;  1MSE C;  1WGX A;  1ETV A;  2O8K A;  2Y2Z A;  2COB A;  1ORK A;  3LNQ A;  1RKT A;  5EEA A;  5E3O A;  1LFU P;  1HDD C;  2GM4 A;  5C3E J;  2P81 A;  3JRF A;  1B72 B;  3TW7 A;  2L0K A;  1TWC J;  5EYR A;  3TW6 A;  4A69 C;  1AKH B;  1QRY A;  2VKV A;  3SJM A;  3CCY A;  1MBH A;  2XB0 X;  1DU6 A;  4DYQ A;  2R7Z J;  2DA2 A;  1IJW C;  2DA4 A;  5IOY A;  4Y7N J;  3BTJ A;  5IOZ A;  2FJ1 A;  5FLV A;  4M3B A;  4FCY A;  4DZJ A;  3SFI A;  4CYC A;  4ABZ A;  1P7J A;  2HQ5 A;  2VUM J;  3ZQI A;  4QIW N;  1IG7 A;  3A03 A;  2WB1 N;  3JRA A;  2E1O A;  5M5W J;  3ZQH A;  2LTP A;  1JKR C;  3HOY J;  5IP6 A;  1TWA J;  2YUS A;  3G1M A;  4DYR A;  4LOC A;  5C44 J;  1MBE A;  4FE7 A;  1T56 A;  1UHS A;  3TP3 A;  3JRG A;  1PUF B;  1IRZ A;  1R9T J;  2H8R A;  2R0Q C;  4A3G J;  1ENH A;  2Y9Z A;  1JKP C;  1G2H A;  2HXO A;  2O7O A;  1E3O C;  3PO2 J;  1EF4 A;  3JRE A;  2JMW A;  2QF7 A;  3NAU A;  5GP9 A;  1VI0 A;  4X1E A;  5C4J J;  1I3Q J;  1FIP A;  3FKI J;  3BQY A;  5BNG A;  1RES A;  2QCO A;  1FIA A;  4C3H J;  2R5Z B;  3B6A A;  4JX4 A;  1U9O A;  3BTI A;  2CRG A;  3LSJ A;  1JJ6 C;  5JLX A;  4XID A;  2JA5 J;  4MLO A;  4FIS A;  1WI3 A;  3HGY A;  1Y1V J;  1UMQ A;  1OFC X;  1FEX A;  2LD5 A;  3S2H J;  4UUT A;  5K7Z A;  4A3E J;  1X58 A;  3S16 J;  4XK4 A;  4XRS G;  1A5J A;  3BTC A;  3GTQ J;  5J1U A;  1BL0 A;  3CQZ J;  1U9N A;  3HKZ N;  2XSD C;  2I10 A;  1Z0X A;  5EG0 A;  4M3F A;  2DMU A;  3MVP A;  2LLK A;  5FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...