1IDZA

Structure of myb transforming protein, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idzA00
1MBKA 1SANA 1BA5A 5EG0A 5E3OA 2XPWA 3TP3A 3ZQFA 2CQQA 4MFDA 2YUSA 1ZQ3P 5GPCA 5FLMJ 4DYCA 3HOUJ 2DA7A 2DMUA 3BTJA 4V2GA 2X6OA 4JX5A 3ZOBA 1T56A 2CU7A 3FKIJ 1MNMC 5M5XJ 4IHVA 2ZB9A 2E1OA 1IRZA 1LE8A 1HOMA 4V2FA 2W48A 5J3LA 4BY7J 4D5CA 1IDZA 3M3YJ 5F08A 4A3BJ 1G2HA 1B72A 4IHYA 2R93J 3O8GA 3L1PA 2LK2A 2H8RA 3A01B 5IYDJ 1SFOJ 3HOWJ 2DA3A 1B8IB 3GTMJ 4C3JJ 3FISA 1JT0A 1JGGA 2GBYA 2G0EA 2L7MP 4MO7A 3BR3A 2LP0A 4M3FA 3S16J 3B6CA 1Y1WJ 2RAEA 3H0GJ 3GTJJ 5EGOA 1WPKA 1P7JA 3NARA 1IG7A 2FQ4A 3JRDA 2TCTA 4MIMA 1JTYA 1RR7A 3HM5A 2MSYA 2WB1N 5BNGA 3S1NJ 2HOTA 3TW6A 3HOZJ 3PM1A 4M3GA 1LFUP 1HDDC 5IP9J 3PO2J 1PUFA 1ZK8A 5F04A 3G1LA 4XIDA 2DA6A 3S1RJ 3GTPJ 1QRYA 4XRSG 3RKQA 1Z0XA 3BQZA 2HOAA 4NDLA 1ZGWA 3HB9A 2DA2A 1LFBA 2K9NA 3GTKJ 2NVYJ 1X2NA 3SDGA 1MSFC 3BG5A 1ZKGA 4LOCA 5IP6A 3Q0UA 3JR9A 3TEDA 1ENHA 2R5YB 4DYQA 3NAUA 2AO9A 1MBFA 5IYBJ 5F0CA 1Y1VJ 1QPIA 4ABZA 1VF9A 1B8IA 1DU6A 1MBGA 1OJLA 5E3LA 3ZQIA 1BL0A 3IH2A 1AKHB 2LVSA 1WH7A 3BG9A 3LSGA 1K83J 1UMQA 3HOYJ 3QQAA 1WI3A 1JKOC 1JKPC 1YRNB 1IDYA 3VPRA 1U78A 4C3HJ 3LSRA 4QTRA 4MFEA 5FKLA 5C3EJ 4MLOA 1UHSA 5F0FA 3JRAA 1JUSA 2L0KA 2Y2ZA 3M4OJ 5K7HA 1U9NA 5E3MA 4RDUA 5M5WJ 3S1MJ 1MBEA 2NVXJ 5K7FA 3A02A 3OSGA 2YS9A 4M3EA 1ETOA 1Q1VA 1ETVA 4D7MA 4J19A 1GDTA 1JKRC 4A69C 5F1JA 4XRSA 5IYCJ 2O8KA 3BTCA 4B4CA 3JRCA 2I10A 3S2HJ 2Y9ZA 2LD5A 1F43A 1FTZA 4B3AA 2VKVA 5J1YA 4GFBA 2IBDA 2XSDC 2WAQN 5FLVA 3PO3J 1HF0A 3CDLA 4A3MJ 2NVTJ 3LOCA 2P81A 2NS7A 2VI6A 3HGGA 4CYCB 3HGYA 3K2AA 2VPRA 1TWAJ 1MBHA 5EZHA 2XGEA 1VFCA 3SFIA 1FIPA 1JTXA 1U9OA 3Q3SA 1TC3C 4QIWN 1YRNA 1W0UA 1IV6A 4FCYA 4UUSA 2KT0A 2DMNA 4A3IJ 2VUMJ 2M9HA 3BR5A 5F0HA 4AUXA 1O4XA 4RBOA 2LLKA 2K9QA 3HBLA 1RKTA 1NTCA 1BW5A 4DZPA 1S7EA 2JJ7A 4IEJA 1P7IA 3GBGA 3LNQA 4XICA 4BY1J 4QSHA 2DTZA 4AYBN 5M5YJ 3JRIA 1FJLA 2R7ZJ 4A3DJ 1H8AC 3TP0A 3G1MA 3UKGA 2XPVA 1GUUA 2DA5A 2HOSA 5C4JJ 1IJWC 1XG1A 2JA6J 2OPTA 3HKZN 2O7OA 5IPAA 4B1RA 3I4MJ 2HDDA 5GPAA 3GTQJ 4BXXJ 1ZR2A 5E3NA 1QVTA 3MKLA 3I4NJ 3QPSA 2XB0X 1HDPA 1ZR4A 3CQZJ 2NVQJ 3LSPA 3LSJA 4DW6A 2LKXA 2D5VA 5C44J 2JA7J 1WGXA 3HOXJ 1AU7A 1W0TA 4IHWA 5FJ8J 3A01A 1I50J 3IH4A 2YU9J 2Y0SN 5EEAA 1XS9A 2HQ5A 2R0QC 2E2JJ 5K7ZA 4M3BA 1JJ6C 4G12A 3BR2A 5GP9A 3S17J 3W6VA 1GVDA 1VNDA 1OCTC 3JRHA 2DMTA 1FEXA 1ORKA 5JLXA 4XK4A 2X9DA 3C2BA 1ETKA 1RETA 2XB5A 3JRGA 1QVUA 1IUFA 5DS9A 3H3VK 1WH5A 2Y31A 1LE8B 1JKQC 2LTPA 3WHCA 1FIAA 4EEFG 2ID6A 1GV2A 1A5JA 2LY9A 3HEFA 2IEKA 1RESA 1B72B 1TWFJ 1OCPA 2IAIA 1UG2A 4JYKA 4A3FJ 1ETWA 3WHBA 2JA8J 4X1EA 4D5FA 5FKMA 3DEWA 2JWTA 1RPWA 1ZTRA 3GTLJ 3JRFA 4M6VA 1GT0C 5FKKA 4IHXA 1Z77A 3SJMA 2R5YA 2E2IJ 2CUFA 2ME6A 2ECCA 4A3GJ 5J1RA 2QCOA 2DMQA 1EF4A 4Y7NJ 2JK3A 2ECBA 2HI3A 5EGOB 2Y9YA 2COBA 2EZIA 3S14J 5J1UA 4A3LJ 1OFCX 5F27A 1GV5A 1T33A 2DJNA 1BW6A 2NOGA 3FK6A 3IV5A 1MBJA 5HODA 1K61A 4FISA 3FK7A 1D5YA 3S15J 1AKHA 4Y52J 3F0CA 4FTHA 1U8BA 3Q0WA 2OF7A 1TWCJ 2EH3A 3MVPA 4BBSJ 1PUFB 5EYRA 1WCMJ 2JA5J 3HOVJ 2R92J 3Q0VA 3RQIA 1AHDP 4JP0A 2XRLA 5DTDA 2PMZN 2MW8A 2AHQA 2E2HJ 2B63J 4DZJA 5IOZA 2XPUA 2ME0A 5C4XJ 2EBIA 2VKEA 2DN0A 2DA1A 2H1KA 1FTTA 3O8HA 1TWHJ 3ZQCA 3QPLA 1CQTA 1I3QJ 4A3JJ 1TWGJ 4W97A 5EZGA 4C3IJ 2CRGA 3BTLA 4I76A 1POGA 3K7AJ 5IP7J 2Y30A 2CJJA 2TRTA 4BBRJ 5IOYA 2M34A 4UUTA 2NS8A 2K9SA 3OIOA 5EF6A 2HYJA 1MSEC 1RKWA 2M8GX 2O9LA 3ZQLA 2L7ZA 2K40A 1E3OC 2R5ZB 3OOUA 1ETQA 1R9TJ 2L7FP 5FKNA 3DCFA 2L9RA 1X2MA 4X6AJ 3BTIA 1MH3A 2DMPA 2JMWA 1HLVA 1IC8A 4A3CJ 3BR1A 1H89C 1ETXA 2MGQA 4S0HB 4CYCA 2KDZA 4BKXA 2EZKA 3OSFA 2XGCA 3S2DJ 3E7LA 3FIWA 2M0CA 1IGNA 2FD5A 3ZQHA 3RZDJ 2X48A 2EQRA 4L5EA 1JUPA 3CCYA 4FE4A 4M3DA 4A3KJ 3BQYA 5EG0B 2QF7A 5M3FJ 4C2MJ 2ID3A 3HDDA 4HNVA 2FX0A 3JRBA 1JJ8C 4XRMA 1JT6A 1F36A 1A6IA 3B6AA 1BJZA 2CQXA 4FE7A 2EZLA 1ETYA 1HCRA 2GM4A 3GTGJ 3BR0A 9ANTA 3G1OA 3TW7A 4I6ZA 4AC0A 2HXOA 3RZOJ 1X58A 2ELKA 2M2EA 4A93J 1JUMA 1VI0A 4JX6A 2HXIA 2LR8A 3CMYA 2R5ZA 1APLC 1DU0A 3BG3A 3BR6A 1NK2P 3ZQGA 2GLOA 4UUSB 1H88C 1I6HJ 4D7NA 2N8GA 3S1QJ 2EZHA 2JN6A 5M3MJ 3GTOJ 1MH4A 2MG4A 2WV1A 3MN2A 1XC5A 3A03A 3BT9A 4W1UA 5JLWA 5FKOA 4JX4A 2CUEA 2LFBA 3IH3A 3D1NI 2DA4A 2E19A 5EDNA 2FJ1A 2XGDA 1NK3P 1ITYA 3JREA 4DYRA 4A3EJ
chains in the Genus database with same CATH superfamily
1MBKA 1TLHB 2W85A 3ZMTA 1XX5A 4XKBA 4G6DA 3KZIC 2IS6A 4RA2A 1HA8A 3TDUC 1SD7A 1RUNA 3ZRGA 3BG7A 1LFPA 3HZJA 1FWZA 2HPIA 4KDPA 1G3TA 2FUG2 2BY2A 1MD0A 2X6XA 2KRCA 3ZOBA 5D5UB 2Z9OA 1KGSA 4GYGA 4F7ZA 1MNMC 3J7AY 3HSFA 2E1OA 3BROA 2RVCA 1YS6A 3FBNB 3F3XA 3H1CA 4ESFA 2WY8Q 3MKYB 2PLYA 3ABKH 1KYWA 1ZRFA 2J5OA 3K2ZA 4P5OA 4WK8F 2IPQX 2R93J 3O8GA 1SFUA 4NUBA 4JK1X 3L1PA 1X1CA 2VOOA 2VBXA 2DA3A 5H6RA 3GTMJ 2GAUA 1B9MA 1XSVA 2LH9A 3K70C 1I1SA 5DEQA 2HS5A 2G0EA 2L7MP 4KUMA 1GXQA 3M8JA 2RNJA 4N9HA 2QENA 3B6CA 3I9V2 3JSPA 1Y1WJ 2O0YA 3WTUC 3H0GJ 4G9YA 1Z67A 3ZXSA 4IRHA 2HZTA 1V4RA 3A4CA 1XGOA 3B73A 3HM5A 1LFUP 3I58A 3OYMA 3TBIA 1SVMA 1XN7A 4RGRA 1PUFA 3ULQB 4Y13A 3KCCA 4XIDA 3GZ6A 4AVPA 1QRYA 3MCZA 3KETA 4XRSG 1AA7A 2HZDA 1F1ZA 1ZGWA 4BXFA 3IAS2 3CP8A 4RB0A 4IQJA 3ELKA 1L0OC 2M5WA 3GTKJ 2KJCA 1MSFC 1FOKA 3PIOF 3JR9A 3TEDA 2R5YB 4M9SA 4KIFA 4HF0A 4ENNA 3AG4H 2ZO4A 1RZ4A 4DBRA 3IAM2 3ECOA 4Y15A 1MBFA 2HQRA 5JHFA 4FQGA 5F0CA 2ZXIA 4I2OA 1B8IA 1YS7A 2D1HA 2CSOA 3E6BA 1IO2A 3RDIA 2BBYA 5LD2C 3IH2A 4ZDOA 3M07A 4G7HF 1KU9A 4E7SA 4IX7A 2RNGA 1JKOC 1YRNB 2MD0A 1U78A 2OAZA 2W1OA 2M7AA 3DEEA 3DLAA 4EJWA 1BM9A 3E0JB 3CC7I 1T95A 4MTEA 4DJAA 4LIVA 3K9TA 2F5DA 3CC4I 1TZLA 2X1DA 5L3GA 4MLOA 4AIHA 2UXNA 5LGTA 2NNNA 3GLXA 2FOKA 5AIQA 3M4OJ 4JQFA 1H9GA 5M5WJ 4RDUA 1IN8A 1MBEA 2V7FA 2NVXJ 2EIJH 1UG0A 1LVAA 1MKMA 3GVAA 4BQNA 2IGMA 1XPXA 3VSLA 1S6LA 1ETOA 3LL7A 4C30A 3RPUD 4BHCA 5K5QA 1R5GA 2JPCA 3OYBA 4CCOA 2D45A 1P4XA 3CMEI 2KIUA 2FBIA 4HSRA 3KLNA 4NBQA 5J1YA 3DFGA 2KRFA 2IBDA 5HNHA 4XBFA 2MD5A 1W7PD 1Y0NA 5FLVA 3H3UA 2VKDA 2VE8A 3I59B 4DGWB 4BACA 4KITB 4A3MJ 4ZZLA 2EFQA 2NS7A 3HGYA 1TWAJ 1MBHA 2ISYA 3CCQI 3LWFA 3CDHA 1FIPA 1U9OA 2KIFA 3Q3SA 3RYRA 2DPDA 3CCRI 1W0UA 3PQJA 3HL2A 2KT0A 4A3IJ 4HDVA 2M9HA 3H9QA 3HTSB 3JAMK 1O4XA 2PFBA 2V1XA 4RBOA 2LLKA 1JI8A 2PQ8A 2DFEA 2K9QA 3EUHC 3P9IA 5LFAA 1B6AA 3O6BB 1NTCA 1WRJA 4DZPA 2KPMA 3KEOA 1Y8RB 3LNQA 1KQ9A 1O57A 1ZAOA 4EGYA 3K1PA 3H36A 4XICA 4QSHA 3FZVA 1D8JA 2R7ZJ 1FOYA 3MZHA 2ZJRF 3IRRA 1YJNI 3G1MA 2DODA 4FT8A 4EMSA 2LKSA 2O6GE 4B09A 5DM7F 3DKXA 1QZEA 1U5TC 2LDUA 3TO6A 1MMGA 4ZYDA 3FWEA 4N4NB 2EWNA 5J40A 3OIQA 4Y33A 3ONQA 1I5ZA 4WF2A 4B1RA 3I4MJ 1C0WA 4QWQA 4U0YA 1FOWA 1ZR2A 3T8RA 2GXBA 2V26A 3OYIA 1D8KA 1HDPA 1YG2A 1ZR4A 5CVRA 4L9VA 3PNYA 2W7NA 2L3DA 2HYGD 1LQ1A 5DUKA 3FBIB 3L2CA 1S8NA 1F5TA 3HHHA 3PSIA 5IT9Z 3GFJA 3KYDB 1R36A 2BHYA 4EVIA 3EYYA 1FX7A 5KK1A 4NQWB 2IRFG 2QVOA 2F5VA 2MLKA 3QYBA 2YU9J 2FMYA 5H6QA 1BI1A 2Y0SN 2XRNA 3ZMVA 1V5GA 1LDDA 3TO7A 5LHGA 4X0GA 2O03A 2IGOA 4IO9F 2K7LA 1XS9A 2E2JJ 2DYSH 1JJ6C 3BR2A 2IGNA 4ENMA 1HKSA 1VNDA 5FB2A 2DMTA 3O2PE 4DIQA 4BXUA 1ORKA 1X1BA 4CCMA 1A04A 2X9DA 2HYFA 3DBRB 3C2BA 2FOWA 1XB4A 3JRGA 1SFEA 1GXPA 3N05A 1K6YA 5FLXK 2Y31A 1LE8B 2LTPA 1MMAA 4I7HA 1FIAA 1Z7LA 2H1LA 1A5JA 4CZCA 3BG6A 3HEFA 2IEKA 1V5FA 4TV7A 5ILVA 3OS1A 5KAFC 2HGCA 4JYKA 2L02A 1T08B 2QYOA 1ZG5A 2QBYA 3H92A 2HQNA 4X1EA 4EATA 1RIOH 4CUGA 4D5FA 2GOMA 5TGTA 1K79A 4ZYHA 1D1BA 3A2KA 3DLLF 4HEA2 4LLLA 1EH7A 2DJIA 4IHXA 4CO8A 1IW7F 2OTLI 1MW7A 2NOJB 2R5YA 2E2IJ 4KISA 2XIGA 2P7VB 1X4OA 2QCOA 3PUFA 1IXRC 4IHWA 5J8CA 3L2RA 2COBA 4F93B 3S14J 1Z3YA 3GEZA 1F9NA 3HXLA 3FXOA 2KHMA 3HHGA 4ENJA 1APLC 2NOGA 1K61A 3S15J 3IV5A 1XD7A 5HODA 1VQNI 2VJJA 3QYFA 1S3JA 1TWCJ 3MVPA 4UB6C 3KP2A 5E8IA 4XKWA 5GTHC 3HOVJ 3IWZA 3Q0VA 3RQIA 4YEJA 1NH3A 4EV0A 4UVAA 4JP0A 5DTDA 2MW8A 2AHQA 4Y4RA 2E2HJ 2OQGA 3Q9SA 4HV6A 5IOZA 2ME0A 2ZCWA 3AL0B 2EBIA 4ZYGA 2VKEA 4M73A 5D5WB 4IZZA 3O8HA 1CQTA 2RQQA 1I3QJ 2CMPA 1VQ8I 4I76A 1POGA 2EV5A 3K7AJ 2VQGA 1XDUA 2BW3B 2ESNA 4KN4X 1BC7C 3OL3A 4F91B 3OYAA 3OIOA 3I64A 5CJ9A 3ZQLA 1Z3XA 3FF5A 1R9TJ 1K78B 3MKZA 5FKNA 1V54H 2L9RA 3IRQA 4X6AJ 3KYLA 2DMPA 2XAGA 3WGIA 1CF7B 4GGGA 4IRGA 4CICA 1ETXA 4BJ6C 2K3FA 1YW7A 1X1AA 1HSTA 4BKXA 1O3QA 2E71A 5KNLA 1ONVA 2ZSIB 3S2DJ 2R7TA 5E20A 4C9YA 4A2UA 1OYYA 2FD5A 3ZQHA 1MZBA 3QP5A 4UVCA 3F8FA 3HRSA 1Z9CA 1JUPA 2BY3A 2ELHA 4P55A 1XMKA 4II3A 5HDGA 1E17A 3BQYA 2UZKA 2JZYA 3JAMZ 1WI9A 2QF7A 1AOYA 4C2MJ 3HDDA 4HNVA 3AG2H 3LSIA 2XKPA 1LNWA 2F5FA 2FU4A 5EEHA 1BJZA 1EH8A 5DCMB 1TT0A 1O7FA 2DK8A 3IP4B 2CQXA 4CH7A 5LGNA 2HTSA 2IW5A 2GIZA 2BVLA 2EZLA 3ZMSA 2B0LA 1HCRA 2GM4A 2A07F 3GTGJ 1T39A 2DT5A 1ZYRF 2HXOA 1PUEE 2CH0A 3VYSB 4GO1A 1I39A 1VI0A 5B66C 1DU0A 4CXFA 1BC8C 3BG3A 2YR2A 3H5AA 3ZQGA 2GLOA 1H88C 3HIFA 2RGVA 2FNAA 3KEYA 1TW3A 4LGWA 3K4CA 3WTTC 3UR3C 3BZKA 4IJAA 3GTOJ 4Q48A 2G7HA 2OZUA 4BJ5C 3QOPA 4W1UA 5JLWA 2DU9A 1SD6A 2CUEA 2LFBA 1SFKA 3IH3A 3PQKA 4NQWA 2DA4A 2E19A 3DKYA 1OKRA 3U1DA 3M1EA 1AU7A 1QHHD 2PJRB 5EG0A 2IS2A 2XPWA 4PFOA 2DT7B 2XAUA 4OIRF 1Z7UA 4NC8A 1VQ5I 2DA7A 2GOXB 3BTJA 2FBHA 4UXNA 1AWCA 3EUKL 3VB2A 3IHUA 1BR1A 4RS8A 3RCOA 4MQ9F 4RB1A 2VN2A 1BR4A 1XGSA 2DFFA 3MD2A 1Y39A 1KONA 3GO5A 3MZYA 1IRZA 5TISC 2W57A 5K1YA 1LE8A 4BHBA 1U2WA 1N75A 2NRAC 2LREA 1IZ1A 4D5CA 4Q4ZF 2PI0A 1RNLA 5F08A 1G2HA 1WJFA 1YX5A 1WJAA 5IYDJ 1B8IB 1W7PA 2PG4A 3T5XA 3IC7A 1JGGA 3HOTA 2IXSA 3TMOA 4MO7A 2JTVA 3ERMA 2XC7A 3SZPA 2AS5F 2LP0A 1ODDA 2CQ7A 3VYRB 3KLOA 3S16J 3VYUB 2RAEA 4LK1F 5J6XA 3GTJJ 3K6GA 2ELJA 1WPKA 4PJMA 1P7JA 2CG4A 3NARA 4HDUA 3J7ZI 1DQUA 2FQ4A 2XF7A 1FBQA 2CV2A 2E5NA 2TCTA 2F4IA 4M72A 4I09A 2MSYA 2WB1N 5BNGA 4A0XA 4F3QA 5DUIA 3PM1A 4M3GA 3G2BA 3LAJA 3QPHA 4A5MA 5IP9J 1TBXA 4XMYA 1O3TA 3KP5A 2Q2EA 3G1LA 3S1RJ 3F6VA 3GTPJ 3W2VA 3K70D 1Z0XA 3BQZA 5BPDA 3C18A 5BMZA 2DA2A 3LA3A 1RR8C 3RPQA 1QA6A 3FHNA 1REPC 4RMNA 2NVYJ 1Y8QB 1FZPB 3SDGA 3PNVA 1G3YA 1ZKGA 3FXUA 4LOCA 5BOXA 2JT1A 3CDIA 1LEBA 5ED4A 3NAUA 2AO9A 4MEYF 4QLCU 2ZJPF 4BE1A 1JXSA 3ABMH 1ZHFA 5LEKA 5F1RA 4CSWA 3AKZA 1Y1VJ 3V7RA 3AG3H 1QPIA 4LIUA 4AD9A 3WG9A 2CW8A 2ZMEC 2BW3A 4KFCA 3E5XA 1OISA 4B48A 4UV9A 4HF2A 1WJBA 1WH7A 3LSGA 4I98B 4ASNA 1UMQA 4LB6B 3HOYJ 3QQAA 4UNOA 4XOPA 1T2KA 1JKPC 4MHGA 1ZG1A 4KIBA 4C3HJ 4LB5A 2CO5A 5E79C 2IS1A 3KP3A 3QWLA 2P7CB 4ESBA 5FKLA 3WU2C 2JPBA 3OR1C 3KP6A 2QZ8A 1P6RA 3DPTA 3KIOA 1BI3A 1CF7A 1STZA 1OCRH 2L0KA 2F4OB 4BDZA 3S1MJ 2DOFA 2BGCA 2VC1A 2VIXA 4G6QA 4S04A 3I53A 4AM3A 2LF7A 3A02A 1UJ8A 3OSGA 2OV7A 1QHGA 2WY7Q 3W3CA 3JTGA 4IF4A 2PBIA 3TQNA 1HC8A 4U7BA 4J19A 1SAXA 3L2WA 3IKVA 2FMLA 2NNYA 3JRCA 2HNHA 4L5IA 1B9NA 1DDNA 1DP3A 2EIKH 2VB6A 1Z1DA 1TT5B 2ZXHA 4N0BA 1UB9A 4KA4A 4QPOA 1SEUA 3VSKA 3MKWB 5DCMA 1IN4A 3JTHA 1FOXA 1HSJA 3ZQQA 3OYFA 4ETSA 1EKEA 2XSDC 4OAZA 2XASA 3DTKA 1TTYA 3OYCA 3ZPLA 5JFRA 3PO3J 1U0JA 2PMUA 1YYVA 2OCEA 4C2UA 2LG4A 2CFOA 2IA0A 2YX4A 1G3WA 4WXHA 4HLYA 3CLOA 3HGGA 5IT9K 3SFZA 4UHTA 1YJWI 4ANJA 5EZHA 2XGEA 3HTUA 4O5VA 3SFIA 1JTXA 3KX2A 3KP4A 1D1AA 5TJJA 2LC2A 4QIWN 3S8PA 4BYYA 1YHQI 4L9NA 2DMNA 2DAOA 2VUMJ 2L7KA 2FBKA 4AUXA 3CCSI 3ERED 2VXZA 4BE2A 1W5TA 1CGPA 2WBMA 4AIJA 3IUOA 1NG7A 2E60A 1FSEA 4UVBA 3V7SA 1I27A 4XSZF 3PIPF 4IEJA 3GBGA 4UV8A 1YIOA 1OYWA 2DTZA 2GIVA 4G8XA 4AYBN 2XVCA 3W6KB 2ZNZA 1W1WE 2KRHA 1E0EA 4A3DJ 2LBFB 4YFXF 1H8AC 3TP0A 5EEGA 1FPQA 3MEXA 4KT6A 2W24A 2VQCA 3UKGA 2XPVA 2PJRA 1BJAA 5FFZA 2DA5A 1ERDA 2HOSA 2G7UA 1VQ6I 4BL0B 1XG1A 3TOAA 2JA6J 5DM6F 3GYHX 2LY1A 1J2XA 2OPTA 3PNTA 4RGXA 5D5XB 2O7OA 4MEXF 2QBYB 2HDDA 5GPAA 3GX4X 2VQHA 2EFOA 4U7DA 3MKLA 2ZXJA 1ZREA 4LJZF 3LSJA 4RAFA 4EQQA 4DW6A 2D5VA 5K5OA 5LHIA 3HOXJ 2OZ6A 3DXJF 1W0TA 1TW2A 3TGNA 5FJ8J 1I50J 1LPQA 4J01A 2M1BA 3CJQB 5JVTA 2MFZA 2R0QC 2STWA 1OR7C 4M3BA 4G12A 5GP9A 1FC3A 1HKQA 3S17J 4HAMA 1D0YA 2QSFX 2M0MA 4XRFA 4XLNF 4HX4A 3JRHA 3CCLI 5DYMA 1DP7P 3L2VA 2QSHX 3BC8A 3V8LA 2KL4A 2OUMA 1ETKA 2XB5A 3H3VK 3E6DA 1D1CA 2BHZA 3Q5FA 1WWXA 3CF5F 3Q9VA 4EEFG 3OYHA 4XLHA 2X6WA 2E5ZA 4ZYAA 3H35A 4IHTA 1TWFJ 4XQFA 2DOEA 2M30A 2A05A 1OCPA 2F6CA 1ZGJA 3GFIA 4A3FJ 2ICWG 2KJBA 4L5JA 3W2WA 3WHBA 2QA4I 1OPCA 3K4BA 5FKMA 3DEWA 2JWTA 4E7JA 1TQMA 2K27A 3WGHA 1RPWA 3JRFA 4PJNA 4M6VA 1P9QC 4ZJZA 1JGSA 2YPRA 3BJOA 1Z77A 4XONA 3SJMA 4P1WA 4U87A 2R7UA 3HYIA 3NWSA 2ECCA 2XGXA 2DMQA 2FSWA 2JK3A 2MC4A 2PN6A 5EGOB 2ADUA 2A6HF 3AFHA 1UAAA 2Y9YA 2EZIA 5HLGA 2CQNA 4A3LJ 5D4SA 4UY8I 1T0FA 5B1AH 3FK6A 1T38A 3FXLA 1D5YA 1MBJA 1X3ZB 2GXGA 4Y52J 3BCAA 2HKXA 3LSHA 3IWFA 3GZ5A 1U8BA 3HSRA 4PK4A 2EH3A 1MMNA 2HDWA 3U1KA 2JA5J 3BP8A 4S05A 5J47A 2PMZN 3J81K 2B63J 3E97A 4DZJA 1SFXA 2XPUA 4OOIA 5CVJA 2DN0A 2DA1A 2DDBA 2CW7A 2YX7A 3LSTA 1J9IA 5H2FC 3ASNH 2Y69H 3QPLA 2NYXA 3H0DA 2P6TA 3ZQCA 1TWGJ 1ZG3A 4R1HA 5EZGA 3RI4A 2GA1A 1HQCA 3OOPA 4R79A 3GXOA 3U2RA 2CRGA 1LVKA 2WV0A 2LSOA 4OIQF 2TRTA 5IOYA 4DQ2A 2A3SA 2M34A 3BWGA 1J7KA 3CUQB 2EV6A 4ZTFA 4PJLA 4V19K 5EF6A 2HYJA 2R7VA 2M8GX 2O9LA 1OCZH 4GXOA 3LSMA 2QSGX 2XF6A 1ETQA 3MMYB 2HTJA 2L7FP 4HZFA 3DCFA 1X2MA 4BHPA 2O61A 2QKMB 1MH3A 3BTIA 1U5TB 1W36C 2JMWA 5CQGA 3F9KA 4E7KA 3WTVC 3SHFA 3OY9A 2R7QA 5D5VB 4FHTA 3KYCB 4A3CJ 4U0WA 4KMUX 1OCCH 2L9NA 4S0HB 2FQ3A 1FSHA 2KDZA 2EZKA 2GXAA 3SEQA 3FXKA 3OSFA 2Z16A 4DBQA 2QQ9A 4K2EA 3N4MA 4D0PA 2H6CA 2ZC2A 3QOEA 2R7WA 1BN5A 4OAYA 2EQRA 2C6YA 4L5EA 4I0BA 4XORA 1UHWA 5EG0B 4KICA 4BEHB 2IA2A 2ID3A 2P5KA 3FXQA 4L0YB 5E1ZB 1VQMI 2VE9A 1F36A 1HW1A 1KYZA 5FD6A 3I55I 2KQRA 1K4TA 1WKMA 4M71A 1XTAA 3CJTB 2M87A 3V7CA 4OMZA 1SAUA 4E7IA 2LBFA 2XSJC 2GWRA 1P2FA 4PZJA 3LAPA 4G7ZF 3L09A 5E17F 3ECHA 4YIRX 9ANTA 4FASD 3TW7A 4RLFA 3RZOJ 3K4MA 4E6KG 2ELKA 2EIMH 3VWBA 1JUMA 4N4OB 4JX6A 3ASOH 5BQTA 1PYVA 2EB7A 3OYLA 2R5ZA 3DBHB 4UUVA 4D7NA 2D2WA 5K5RA 2N8GA 1W7PB 4L9TA 4M9XA 1IAWA 2JN6A 3WU0A 3OYEA 1FP2A 1D0XA 1MH4A 1Y56A 4HYEA 4XLFA 3A1YA 1ULYA 1WJCA 3MN2A 5CVIA 5E8GA 3E3VA 5FKOA 4JX4A 4U0VA 2H6BA 5B1BH 4BS9A 2CS3A 3R0AA 1ITYA 1NK3P 1VQKI 3JREA 1EJ9A 1SANA 1BA5A 2CGPA 5E3OA 4BNCA 3TP3A 5L3CA 1HXDA 2CUZA 2CQQA 4MFDA 3OYDA 1WFXA 2B7EA 2BY1A 1ZQ3P 1BBYA 5GPCA 1G8XA 2Q2EB 4DYCA 4PJJA 2IT0A 3MFKA 3HOUJ 2DMUA 3EQLF 2X6OA 3A0HC 4JX5A 2DBBA 3NWTA 2Z3YA 2CU7A 4IHVA 2ZB9A 1A35A 3HRUA 1T8IA 3BPXA 4V2FA 2W48A 2R7RA 1ZRDA 2CWEA 3KZYA 4O3MA 5JHUA 1BOAA 4XLPF 4BY7J 3KFWX 1IDZA 4RAGA 3M3YJ 3AL0C 5EJCA 2RKHA 2V6CA 1YJ9I 2L4AA 5CPRB 3RYPA 5KVRA 1OLTA 3ISPA 1F4KA 1D3YA 2LK2A 2K9MA 2O5RA 2H8RA 4PGHA 3CO7C 1SFOJ 4RAZA 4KT5C 5L3DA 1J75A 1QGPA 4OIOF 1D0ZA 4KMFA 1JT0A 1LJ9A 2MH9A 2WADA 2NVUB 3JSOA 3IL2A 1LKXA 3BR3A 2BV6A 4M3FA 1S7OA 5HDNA 4HSTA 5L3EA 2KIQA 2NAZA 2VL8A 3CJNA 4WXCA 4E7ZA 5EGOA 3CCJI 4YRVA 5B5EC 4CCKA 2HPMA 2L9VA 3JRDA 1SMYF 1QZZA 2JUGA 3FDYA 4MIMA 5GADJ 1YW9A 3J80Z 3S1NJ 1WQ2A 2FNPA 4PUSA 3TW6A 2DLLA 3D0SA 4CYDA 1ZK8A 2DA6A 3ZGKA 2FE3A 3RKQA 1JE8A 2EK5A 2HOAA 3I0TA 4NDLA 1QPMA 2K85A 2V9VA 2Z5UA 1LFBA 3HPGA 4QPQA 5HLIA 2DDAA 2K9NA 1S5LC 3J81Z 4MNUA 1X2NA 3GF2A 3WU1B 1QNTA 1ENHA 4RLQA 3S3MA 4DYQA 3VFZA 2CW0F 4A6EA 3C2GA 2V1DA 4J00A 6PAXA 4UB8C 1K7AA 3U21A 5IYBJ 1YTYA 1IUYA 1TNSA 2V9PA 3PJRA 4ABZA 1WHUA 1VF9A 3EUHA 5H20A 5HS7A 3FM3A 2W4SA 4NNJA 1MBGA 3I5UA 1U8RA 1R4NB 4G94A 3K69A 1OJLA 5E3LA 3ZQIA 1RC9A 3CUQA 4LK0F 3CC2I 1PP8F 4CCLA 4HX8A 4M6XA 1K83J 1FMVA 4A5NA 3CMAI 2MA3A 1IDYA 3MQ0A 3CO6C 4FX4A 2E1MB 4KJZA 1B4AA 2DW4A 4MFEA 4Y3OA 1R1TA 2H27A 1U5TA 3V4GA 4BUPA 5J4VA 1UHSA 1ON1A 3D5SC 3RKYA 1JUSA 3JRAA 3FMRA 2V9KA 3H9JA 1KU2A 2HR3A 2Y2ZA 5K7HA 1U9NA 3S93A 1DPRA 3P9KA 4AVZA 4E4HA 2YSRA 3K1MA 4EJUA 1R22A 2QQBA 2YS9A 3WTXC 1BIAA 1Q1VA 1XSXA 5HS9A 4D7MA 4XSXF 1JKRC 1X3UA 1J0RA 4A69C 3EUAA 5F1JA 5IYCJ 3GZNB 3BTCA 1A36A 5FO5A 2I5UA 4BEHA 1MMSA 1MNEA 1E3HA 3LMMA 2VXDA 2ZNYA 3V8KA 4EM2A 2ZKZA 3GFLA 3NRVA 4G7OF 2LD5A 5FRMA 1FTZA 2VBYA 4I02A 3RPUA 4LMYA 5DV5A 3BJAA 1K6OA 2WAEA 2XDVA 3L7WA 1DGWY 2Q1ZB 4RGSA 4A0YA 1VQLI 3OYKA 2WAQN 1BI2A 4RB3C 1YX3A 3KP7A 1HF0A 2KFDA 5HVQC 1R5HA 2QKLB 3LOCA 1P4AA 2DCEA 2VPRA 1MJ9A 5FFXA 2X6YA 2IA1A 2LY2A 4H0EA 1KU7A 2KZGA 4HX7A 1B59A 3BR5A 3HRMA 4KN7X 2DI3A 1YO5C 1J59A 3COAC 3ZMZA 1EV7A 3HSEA 3VDXA 3HBLA 1WVRA 3FHZA 2Z99A 4XNFA 2LYCA 3DQVC 1HKTA 1BW5A 4XLCA 4HW0A 3CCEI 1S7EA 2JJ7A 3NQOA 2R7SA 1P7IA 4P96A 2MYSA 2Z1DA 4IOAF 5M5YJ 1W4MA 2G9WA 2VT3A 5CKTA 3D5LA 2WTEA 1A6QA 4U88A 2HQAA 5C4JJ 2RC4A 1IJWC 2IVMA 2AQEA 2ETHA 3HJEA 1VQOI 3HKZN 1KU3A 3MWMA 5IPAA 3L00A 2JSCA 3DPLC 4EM1A 3GTQJ 4BXXJ 1NHAA 5DDGA 3F8BA 1QVTA 2JQ7A 3QPSA 3E6MA 1PDNC 1XDSA 3RIRA 3LSPA 1MJBA 3W2AA 3KZZA 4LLNA 2JA7J 3VODA 1R4MB 3K4KA 3WTWC 4CGZA 3KEQA 1YITI 1R1VA 4NC6A 5EEAA 1GLNA 3DU5A 2E35A 1QQIA 3HG9A 3RTRA 4BQAA 5GAEJ 2K4JA 4MTDA 1MIJA 1IF1A 4EJTA 1B1BA 3DF8A 3W6VA 4XN0A 3T0YA 3K10A 2BE5F 1OCTC 2TDXA 1FEXA 4YIFA 5JLXA 1WZ2A 4XK4A 4IHSA 4KNYA 1NG6A 4XN3A 2ZMEB 1RETA 4D9JA 5CVUA 1T6SA 1QVUA 1IUFA 4LD5A 5DS9A 3QYEA 2CV0A 3R0JA 1JKQC 4HLXA 1UCRA 3VYTB 3WHCA 1S9HA 2ID6A 1GV2A 1O3SA 2LY9A 4OINF 2PMHA 1T98A 3F8CA 1RESA 1B72B 2DOAA 3GWZA 4RGUA 1MNDA 4XR6A 4YFKF 3CZ6A 2VC0A 4M74A 1ETWA 2FA5A 2JA8J 3CD6I 1V5EA 2XAHA 3GUDA 1XCBA 3PUBA 2VJ4A 4E70A 2ZJ2A 4B8XA 3GTLJ 1S7AA 4FX0A 5FRNA 1GT0C 1Q1HA 5KCMA 2DFHA 1K4SA 4L0ZB 1R6RA 1SMTA 3M8EA 4DNCA 5J1RA 2XHKA 1EF4A 3CJRB 4HNTA 2ECBA 1IRFA 3SQNA 3TOBA 4AWXB 1ZLKA 3H9GA 5F27A 1GV5A 2DJNA 1BW6A 2A68F 5J8FA 2XAQA 3OYGA 2A5YB 3FK7A 2OU2A 3I3LA 3F0CA 4FTHA 1USSA 2B9SA 4C2TA 3C3WA 1WCMJ 1IXCA 2R92J 3ABTA 1WJ5A 2KMUA 2P6SA 3CCMI 4ZC3A 3ML6A 4IXAA 3WTSC 3EPZA 1FYKA 5KAIC 2LF8A 2E7XA 2WA0A 1LDJA 2H1KA 1FTTA 3HC7A 1TWHJ 4B47A 2R7XA 2XROA 4A3JJ 3QPTA 4GCVA 4W97A 4BQOA 4C3IJ 3NEUA 2EA2A 1KQ0A 2Y48A 1IRGA 3FXMA 2GQQA 1VQ9I 2K9LA 5CLSA 4ZZDA 2HWVA 1LEAA 2Y30A 4BBRJ 2PMZA 5D4RA 1IXSB 3P7NA 1V3FA 3FXRA 1XCVA 2HOEA 3RKWA 4UUTA 2ZFUA 3EDPA 2NS8A 3WTYC 2K9SA 4P9UA 5E1WA 1HBXG 2L5QA 1MSEC 3R61A 5LHHA 5ILUA 1Z05A 2MABA 2R5ZB 3B02A 2H94A 3CP2A 2DFIA 1X1PA 5FD5A 2CFXA 2A6EF 1P4WA 2BYVE 1H89C 4RB2C 1FNNA 3CMMA 2HVRA 3HUGB 4LFUA 3CUOA 3D5RC 4HA8A 5HOOA 1QU3A 1W5SA 2P0WA 4OMYA 3G73A 3P9CA 4XM3A 1IV8A 2JA2A 5LRRA 2FRHA 4KYWA 2RQPA 2UXXA 4HNUA 3SXYA 3DKWA 4ENKA 2AXLA 4PDKA 4XL9A 4ESJA 4A3KJ 2LOOA 3EYIA 2ISZA 3G4SI 5M3FJ 5ICCA 4XKCA 3A0BC 2FX0A 5ICEA 1JJ8C 2WWYA 1MGTA 4XRMA 1R1UA 4BJTA 1A6IA 3BY6A 2P4WA 3ZR8X 1FP1D 3L2UA 2K02A 1W36D 4EJVA 2VJIA 2BVMA 3QAHA 2R7OA 3PL8A 3H3ZA 3G6EI 1WJEA 4FE7A 3F23A 1ETYA 2Z2SB 2OA4A 2Y0SA 2CV1A 2JRMA 2W84A 4LG0B 5LBQA 2E36A 1FY7A 2L54A 3G3ZA 4HG2A 4AC0A 1VQPI 2F5EA 4B44A 4LITA 2M2EA 3BJ6A 2QUFA 4FETA 3OR2C 1R49A 1A31A 2LR8A 3CMYA 2DQRA 1NK2P 2CYYA 2UV1A 5LLQA 4UUSB 2ZSHB 1I6HJ 3DPUA 4IL6C 2QWWA 4Q47A 3X2QH 2GZWA 3S1QJ 2M45A 2KKOA 5M3MJ 1ZGAA 5IY5H 3QP6A 1MMDA 5GAGJ 2JVHA 2CQKA 4B43A 4DOZA 2EINH 3BT9A 3BLYA 5E18F 4ZDLA 2STTA 5D6FA 3CESA 4NHJA 5ICGA 2H8WA 4CCJA 1O7LA 3J80K 4XKVA 5EDNA 2XGDA 4A12A 4DYRA 4A3EJ 2V1UA 4EJOA 4BDYA 1GHCA 2XAFA 1R7JA 1W5CC 2EFNA 3ZQFA 2O8XA 4KIGA 5L3FA 2YUSA 5LGUA 1RI7A 5FLMJ 3PSFA 2M3AA 2O3FA 3ESWB 2DPUA 2Y0MA 2KP6A 2EA4A 2GA2A 4V2GA 1VZ0A 2EJRA 1FBSA 2HVQA 1T56A 2ZMEA 1S29A 4R8HA 4CCNA 4CA0A 2Z33A 3OV8A 3FKIJ 2WAFA 5M5XJ 1O3RA 1YFHA 4XLAA 3ROUA 1WSUA 3H5RA 4HBLA 3F22A 1HOMA 2NS0A 4GYIA 5J3LA 2V6EA 4RAYA 4YFNF 2PX9A 5HLHA 5D8KB 4A3BJ 2QLZA 1B72A 4HV5A 5LEJA 4IOCF 1LUJB 4IHYA 1DGRM 2VLAA 3QODA 2JVGA 4I01A 5HNFA 2QGUA 3A01B 5DD8A 3HOWJ 3LA2A 4F55A 4C3JJ 3FISA 3OS2A 2GBYA 1H0MA 2LKPA 2X4HA 3KE2A 2NXNB 2EPFA 1YW8A 3QRFF 3CUQC 5LRSA 5GTIC 1IG7A 4A0ZA 2DTRA 2IP2A 3WODF 2PJPA 1JTYA 3M8FA 1WJDA 1RR7A 4PFPA 3TKYA 2HOTA 3HOZJ 3V42A 5JR3A 1HDDC 5TRDA 3QU6A 1M1EB 3PO2J 5KHDA 1KZHA 3DU6A 5F04A 2XAJA 4IPAA 1UFMA 4M6YA 4ZTJA 4PSWA 1X3WB 3SYTA 3LFKA 3HB9A 1H9TA 3UNGC 1KA8A 3SZTA 5D8LB 4WX9A 3F21A 1BI0A 3BG5A 2D1VA 5IP6A 3Q0UA 4PGGA 2MC3A 1RRJA 3OIPA 1P92A 4NB5A 5HS8A 2VONA 3BZCA 2AXTC 3WGGA 1HW2A 3C2HA 3SEZA 3BPVA 3S3OA 1UHMA 4OWRB 3CF2A 1DU6A 3C7JA 2XUBA 2JSPA 2K3PA 1BL0A 1AKHB 2LVSA 1PJRA 3CLQA 1MDMB 4GDFA 2OQRA 2VQLA 4II2A 4AIDA 2ACJA 1YE9A 2L4MA 3BG9A 4IRIA 1BR2A 4B3XA 1WI3A 2P5LC 3VPRA 1RUOA 3LSRA 2HVSA 5J4YA 4QTRA 3OS0A 3RSNA 3TO9A 3VEPA 5C3EJ 3M7GA 1N78A 2JUCA 5F0FA 1FMWA 2J5PA 1I6XA 2ESHA 1UELB 5D6EA 5E3MA 3HUGA 2BOLA 3F6OA 3MAJA 1IN5A 4CZZA 5K7FA 3HRTA 2JRTA 3CCUI 1LB2A 3H5NA 4M3EA 2QQAA 2P5VA 2E34A 1ETVA 1QZYA 1GDTA 2F4MB 1BIBA 4XRSA 2BXYA 2O8KA 4B4CA 3E5QA 2XKOA 2I10A 1XGMA 1U3EM 3S2HJ 2X1CA 4HRIA 2Y9ZA 1ACIA 5JI6A 4JBAA 1FYMA 2E1NA 3J7AO 4BGDA 3FKJA 4BH9A 4Z6YA 2HDCA 1F43A 1X4PA 1OYIA 4B3AA 3RKXA 3G71I 2K86A 2LMDA 3AG1H 2VKVA 3QU3A 3ZMDA 4GFBA 2A69F 1OR7A 4F92B 1G4DA 2DXIA 5CQEA 3GW2A 4LG0A 5BPIA 2HKOA 2LRDA 3CDLA 4GRIA 5BS6A 2NVTJ 2I8DA 1SVLA 1ZARA 3K4JA 2COMA 2P81A 4ON0A 4CYCB 2VI6A 4BU2A 2KDOA 1SD5A 3K2AA 4IQ4A 1FBUA 1VFCA 1TC3C 1YRNA 1IV6A 2QM3A 4FCYA 4UUSA 3R4KA 2XV4S 3ZMUA 2E1CA 1N77A 3M9AA 1DUXC 5F0HA 2VJ5A 3JCUC 5JVGF 2F2EA 2WAQA 4Y17A 3ZN1A 2Y75A 1SD4A 1G6NA 2RREA 2VT2A 5HLTA 4L18B 5ICFA 1RKTA 1XMXA 1X1DA 1X19A 5DD4A 4BY1J 1E2XA 2H09A 1TNTA 3K1NA 3JRIA 2RV8A 1FJLA 1XMAA 3I54A 4ITVA 2X51A 4MQVA 2A5WA 2V79A 4BE0A 3M1CA 1FLIA 2YU3A 4MGRA 1GUUA 2MBFA 5DCFA 3RJPA 3FX3A 1OMIA 1E3PA 2R7FA 2DYRH 2VASA 2DO7A 5FGMA 1YI2I 4ZH4F 2KLOA 1V55H 4HF1A 1YOVB 2X1EA 5E3NA 3I4NJ 1R00A 2XB0X 3I71A 4L9JA 2FXAA 3I59A 3AAFA 1FYLA 3CQZJ 2WB1A 2NVQJ 2HFHA 3S32A 2L2OA 2F48A 4PJ0C 2EV0A 2LKXA 5C44J 5A2QK 3OL4A 2Q8KA 2K4BA 1WGXA 4A6DA 1I1GA 4HQEA 1SC7A 3BDDA 2MH2A 3HKZA 3GMEA 3A01A 3IH4A 2X85A 3E6CC 4EGZA 3KPHA 4BAYA 2MLGA 3LFUA 2A6TA 4RM2A 2HQ5A 3TL4X 2R7DA 5K7ZA 2IGKA 3ABUA 2ZBKA 3DBLB 4CDGA 3O3KA 1GVDA 3CTAA 3BZ6A 4PCQA 3DTEA 2EFWA 4CHUA 3ABLH 3F72A 2W00A 1IN6A 2A61A 1Y0UA 3LSKA 3SZGA 1J09A 1TQPA 3I56I 1JHFA 1IRXA 1WH5A 4OIPF 2E1MC 2XF5A 3ZQ7A 4ZYEA 4BQQA 1G3SA 2AQFA 2F5CA 3ZN0A 3WTZA 1BOBA 2V4JC 4Z2YA 1SVOA 3WG7H 1KQ8A 5F6FA 2HEOA 3OMYA 3K0LA 2IAIA 4I99C 2ZJQF 1UG2A 3LQQA 2KZVA 1UZCA 3BCBA 4Q5SF 2L01A 2QQ8A 3ZCOA 1ZTRA 4WCGA 2FEZA 1HW5A 3J7YJ 4D1QA 5FKKA 2P8TA 2BZTA 4WXDA 1G59A 2KIMA 2CUFA 4XOTA 2WC2A 2ME6A 1ZN2A 5IT3A 4A3GJ 1JHHA 4Y7NJ 1XSDA 2OJED 3GFMA 2HI3A 5FROA 5J1UA 2OCCH 2UUZA 4H4KC 5AIPA 1R23A 2VODA 1OFCX 1T33A 2EFPA 4FISA 1AKHA 1MDMA 3F8NA 2RDPA 3Q0WA 1XGNA 2OF7A 4IVNA 2IS4A 4BBSJ 3U9GA 1MJAA 1PUFB 3FMSA 2M8EA 5ILSA 3K4LA 5EYRA 3S2WA 4O6JA 1PVEA 1TL8A 1AHDP 2XRLA 2R4GA 3R60A 3RQ4A 5C4XJ 1DPUA 1ZLJA 3HOSA 2X0LA 1Z6TA 3GLLA 3PFIA 3E1SA 1OCOH 3REOA 1ZH5A 2CUJA 5FLXZ 3MZ8A 3JW4A 2DK5A 4ZDPA 5F64A 4YELA 1ZELA 4PSXA 2W25A 3TDZC 1EA3A 4AIKA 1EH6A 4N9IA 3BTLA 3E5UA 2VOPA 5IP7J 1OQYA 3I4PA 2CJJA 3F8MA 3BOQA 4YIIA 1PP7U 1Z91A 3CCVI 1I3AA 4F52A 1R71A 1Y6IA 3DEUA 4EM0B 2VBWA 4LLGF 1RKWA 5HDKA 1TP4A 3WE2A 1R58A 2L7ZA 2K40A 3DP7A 4XLEA 1E3OC 1QBJA 2LNBA 4E7LA 3OOUA 3DWLE 3L9FA 4WWCA 4AYBA 2ZFWA 3LA7A 5L3BA 1QO0D 3C1DA 3T8TA 3WE3A 2EILH 3FXJA 1IC8A 1HLVA 1U6GA 2K5CA 4P9FA 3S3NA 3BR1A 5CVVA 2MGQA 3DV8A 5CYVA 4CYCA 2E7WA 2OTJI 2RN7A 1YIJI 3GCMA 4HOBA 1VQ4I 5AONA 3K4NA 3R6SA 2XGCA 3PFYA 3E7LA 3FIWA 2M0CA 3DTIA 3OWTA 1IGNA 2UWMA 1VTNC 1LDKB 5GAHJ 3RZDJ 2X48A 2OD5A 3CCYA 4HQMA 1D5VA 3OYNA 4FE4A 2HU9A 4M3DA 4NC7A 1VQ7I 2ZXWH 1N25A 1GVJA 3JRBA 3T1BA 1T0FC 3V8JA 3N97A 1USTA 4YG2F 1JT6A 2W82A 2KISA 3B6AA 3P5JA 4M9ZA 5B3SH 1FT9A 2M7BA 4OU0A 3VOEA 2Q0OA 1S72I 3BR0A 3G1OA 5ERIA 2FF4A 4I6ZA 3OYJA 2V1NA 1X58A 4G6TB 4A93J 2BXZA 1J5YA 3HPHA 2HXIA 2VBZA 2L9SA 2VKHA 3SDBA 2QEXI 1ZRCA 3BR6A 1R5ID 4E7HA 1K78A 2M4GA 2IJLA 2EZHA 2M4KA 2PEXA 1L3LA 4AU7A 3EETA 5E1XA 3FM5A 2DQLA 3L2QA 2BY0A 4JOMA 2R3SA 1Z6RA 1YLFA 2MG4A 4I0AA 1TQIA 2DT6A 2WV1A 1Z21A 1XC5A 1IN7A 2OBPA 2BEOA 3A03A 4RM3A 3W6JB 3IKTA 4HPQA 1YQAA 3D1NI 3LQRA 1ON2A 2OC6A 5A2QZ 4LG3A 3ZP5A 3FMQA 2VPLA 2FJ1A 4IKFA
chains in the Genus database with same CATH topology
1MBKA 1SANA 1BA5A 5EG0A 5E3OA 2XPWA 3TP3A 3ZQFA 2CQQA 4MFDA 2YUSA 1ZQ3P 5GPCA 5FLMJ 4DYCA 3HOUJ 2DA7A 2DMUA 3BTJA 4V2GA 2X6OA 4JX5A 3ZOBA 1T56A 2CU7A 3FKIJ 1MNMC 5M5XJ 4IHVA 2ZB9A 2E1OA 1IRZA 1LE8A 1HOMA 4V2FA 2W48A 5J3LA 4BY7J 4D5CA 1IDZA 3M3YJ 5F08A 4A3BJ 1G2HA 1B72A 4IHYA 2R93J 3O8GA 3L1PA 2LK2A 2H8RA 3A01B 5IYDJ 1SFOJ 3HOWJ 2DA3A 1B8IB 3GTMJ 4C3JJ 3FISA 1JT0A 1JGGA 2GBYA 2G0EA 2L7MP 4MO7A 3BR3A 2LP0A 4M3FA 3S16J 3B6CA 1Y1WJ 2RAEA 3H0GJ 3GTJJ 5EGOA 1WPKA 1P7JA 3NARA 1IG7A 2FQ4A 3JRDA 2TCTA 4MIMA 1JTYA 1RR7A 3HM5A 2MSYA 2WB1N 5BNGA 3S1NJ 2HOTA 3TW6A 3HOZJ 3PM1A 4M3GA 1LFUP 1HDDC 5IP9J 3PO2J 1PUFA 1ZK8A 5F04A 3G1LA 4XIDA 2DA6A 3S1RJ 3GTPJ 1QRYA 4XRSG 3RKQA 1Z0XA 3BQZA 2HOAA 4NDLA 1ZGWA 3HB9A 2DA2A 1LFBA 2K9NA 3GTKJ 2NVYJ 1X2NA 3SDGA 1MSFC 3BG5A 1ZKGA 4LOCA 5IP6A 3Q0UA 3JR9A 3TEDA 1ENHA 2R5YB 4DYQA 3NAUA 2AO9A 1MBFA 5IYBJ 5F0CA 1Y1VJ 1QPIA 4ABZA 1VF9A 1B8IA 1DU6A 1MBGA 1OJLA 5E3LA 3ZQIA 1BL0A 3IH2A 1AKHB 2LVSA 1WH7A 3BG9A 3LSGA 1K83J 1UMQA 3HOYJ 3QQAA 1WI3A 1JKOC 1JKPC 1YRNB 1IDYA 3VPRA 1U78A 4C3HJ 3LSRA 4QTRA 4MFEA 5FKLA 5C3EJ 4MLOA 1UHSA 5F0FA 3JRAA 1JUSA 2L0KA 2Y2ZA 3M4OJ 5K7HA 1U9NA 5E3MA 4RDUA 5M5WJ 3S1MJ 1MBEA 2NVXJ 5K7FA 3A02A 3OSGA 2YS9A 4M3EA 1ETOA 1Q1VA 1ETVA 4D7MA 4J19A 1GDTA 1JKRC 4A69C 5F1JA 4XRSA 5IYCJ 2O8KA 3BTCA 4B4CA 3JRCA 2I10A 3S2HJ 2Y9ZA 2LD5A 1F43A 1FTZA 4B3AA 2VKVA 5J1YA 4GFBA 2IBDA 2XSDC 2WAQN 5FLVA 3PO3J 1HF0A 3CDLA 4A3MJ 2NVTJ 3LOCA 2P81A 2NS7A 2VI6A 3HGGA 4CYCB 3HGYA 3K2AA 2VPRA 1TWAJ 1MBHA 5EZHA 2XGEA 1VFCA 3SFIA 1FIPA 1JTXA 1U9OA 3Q3SA 1TC3C 4QIWN 1YRNA 1W0UA 1IV6A 4FCYA 4UUSA 2KT0A 2DMNA 4A3IJ 2VUMJ 2M9HA 3BR5A 5F0HA 4AUXA 1O4XA 4RBOA 2LLKA 2K9QA 3HBLA 1RKTA 1NTCA 1BW5A 4DZPA 1S7EA 2JJ7A 4IEJA 1P7IA 3GBGA 3LNQA 4XICA 4BY1J 4QSHA 2DTZA 4AYBN 5M5YJ 3JRIA 1FJLA 2R7ZJ 4A3DJ 1H8AC 3TP0A 3G1MA 3UKGA 2XPVA 1GUUA 2DA5A 2HOSA 5C4JJ 1IJWC 1XG1A 2JA6J 2OPTA 3HKZN 2O7OA 5IPAA 4B1RA 3I4MJ 2HDDA 5GPAA 3GTQJ 4BXXJ 1ZR2A 5E3NA 1QVTA 3MKLA 3I4NJ 3QPSA 2XB0X 1HDPA 1ZR4A 3CQZJ 2NVQJ 3LSPA 3LSJA 4DW6A 2LKXA 2D5VA 5C44J 2JA7J 1WGXA 3HOXJ 1AU7A 1W0TA 4IHWA 5FJ8J 3A01A 1I50J 3IH4A 2YU9J 2Y0SN 5EEAA 1XS9A 2HQ5A 2R0QC 2E2JJ 5K7ZA 4M3BA 1JJ6C 4G12A 3BR2A 5GP9A 3S17J 3W6VA 1GVDA 1VNDA 1OCTC 3JRHA 2DMTA 1FEXA 1ORKA 5JLXA 4XK4A 2X9DA 3C2BA 1ETKA 1RETA 2XB5A 3JRGA 1QVUA 1IUFA 5DS9A 3H3VK 1WH5A 2Y31A 1LE8B 1JKQC 2LTPA 3WHCA 1FIAA 4EEFG 2ID6A 1GV2A 1A5JA 2LY9A 3HEFA 2IEKA 1RESA 1B72B 1TWFJ 1OCPA 2IAIA 1UG2A 4JYKA 4A3FJ 1ETWA 3WHBA 2JA8J 4X1EA 4D5FA 5FKMA 3DEWA 2JWTA 1RPWA 1ZTRA 3GTLJ 3JRFA 4M6VA 1GT0C 5FKKA 4IHXA 1Z77A 3SJMA 2R5YA 2E2IJ 2CUFA 2ME6A 2ECCA 4A3GJ 5J1RA 2QCOA 2DMQA 1EF4A 4Y7NJ 2JK3A 2ECBA 2HI3A 5EGOB 2Y9YA 2COBA 2EZIA 3S14J 5J1UA 4A3LJ 1OFCX 5F27A 1GV5A 1T33A 2DJNA 1BW6A 2NOGA 3FK6A 3IV5A 1MBJA 5HODA 1K61A 4FISA 3FK7A 1D5YA 3S15J 1AKHA 4Y52J 3F0CA 4FTHA 1U8BA 3Q0WA 2OF7A 1TWCJ 2EH3A 3MVPA 4BBSJ 1PUFB 5EYRA 1WCMJ 2JA5J 3HOVJ 2R92J 3Q0VA 3RQIA 1AHDP 4JP0A 2XRLA 5DTDA 2PMZN 2MW8A 2AHQA 2E2HJ 2B63J 4DZJA 5IOZA 2XPUA 2ME0A 5C4XJ 2EBIA 2VKEA 2DN0A 2DA1A 2H1KA 1FTTA 3O8HA 1TWHJ 3ZQCA 3QPLA 1CQTA 1I3QJ 4A3JJ 1TWGJ 4W97A 5EZGA 4C3IJ 2CRGA 3BTLA 4I76A 1POGA 3K7AJ 5IP7J 2Y30A 2CJJA 2TRTA 4BBRJ 5IOYA 2M34A 4UUTA 2NS8A 2K9SA 3OIOA 5EF6A 2HYJA 1MSEC 1RKWA 2M8GX 2O9LA 3ZQLA 2L7ZA 2K40A 1E3OC 2R5ZB 3OOUA 1ETQA 1R9TJ 2L7FP 5FKNA 3DCFA 2L9RA 1X2MA 4X6AJ 3BTIA 1MH3A 2DMPA 2JMWA 1HLVA 1IC8A 4A3CJ 3BR1A 1H89C 1ETXA 2MGQA 4S0HB 4CYCA 2KDZA 4BKXA 2EZKA 3OSFA 2XGCA 3S2DJ 3E7LA 3FIWA 2M0CA 1IGNA 2FD5A 3ZQHA 3RZDJ 2X48A 2EQRA 4L5EA 1JUPA 3CCYA 4FE4A 4M3DA 4A3KJ 3BQYA 5EG0B 2QF7A 5M3FJ 4C2MJ 2ID3A 3HDDA 4HNVA 2FX0A 3JRBA 1JJ8C 4XRMA 1JT6A 1F36A 1A6IA 3B6AA 1BJZA 2CQXA 4FE7A 2EZLA 1ETYA 1HCRA 2GM4A 3GTGJ 3BR0A 9ANTA 3G1OA 3TW7A 4I6ZA 4AC0A 2HXOA 3RZOJ 1X58A 2ELKA 2M2EA 4A93J 1JUMA 1VI0A 4JX6A 2HXIA 2LR8A 3CMYA 2R5ZA 1APLC 1DU0A 3BG3A 3BR6A 1NK2P 3ZQGA 2GLOA 4UUSB 1H88C 1I6HJ 4D7NA 2N8GA 3S1QJ 2EZHA 2JN6A 5M3MJ 3GTOJ 1MH4A 2MG4A 2WV1A 3MN2A 1XC5A 3A03A 3BT9A 4W1UA 5JLWA 5FKOA 4JX4A 2CUEA 2LFBA 3IH3A 3D1NI 2DA4A 2E19A 5EDNA 2FJ1A 2XGDA 1NK3P 1ITYA 3JREA 4DYRA 4A3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBK A;  1SAN A;  1BA5 A;  5EG0 A;  5E3O A;  2XPW A;  3TP3 A;  3ZQF A;  2CQQ A;  4MFD A;  2YUS A;  1ZQ3 P;  5GPC A;  5FLM J;  4DYC A;  3HOU J;  2DA7 A;  2DMU A;  3BTJ A;  4V2G A;  2X6O A;  4JX5 A;  3ZOB A;  1T56 A;  2CU7 A;  3FKI J;  1MNM C;  5M5X J;  4IHV A;  2ZB9 A;  2E1O A;  1IRZ A;  1LE8 A;  1HOM A;  4V2F A;  2W48 A;  5J3L A;  4BY7 J;  4D5C A;  1IDZ A;  3M3Y J;  5F08 A;  4A3B J;  1G2H A;  1B72 A;  4IHY A;  2R93 J;  3O8G A;  3L1P A;  2LK2 A;  2H8R A;  3A01 B;  5IYD J;  1SFO J;  3HOW J;  2DA3 A;  1B8I B;  3GTM J;  4C3J J;  3FIS A;  1JT0 A;  1JGG A;  2GBY A;  2G0E A;  2L7M P;  4MO7 A;  3BR3 A;  2LP0 A;  4M3F A;  3S16 J;  3B6C A;  1Y1W J;  2RAE A;  3H0G J;  3GTJ J;  5EGO A;  1WPK A;  1P7J A;  3NAR A;  1IG7 A;  2FQ4 A;  3JRD A;  2TCT A;  4MIM A;  1JTY A;  1RR7 A;  3HM5 A;  2MSY A;  2WB1 N;  5BNG A;  3S1N J;  2HOT A;  3TW6 A;  3HOZ J;  3PM1 A;  4M3G A;  1LFU P;  1HDD C;  5IP9 J;  3PO2 J;  1PUF A;  1ZK8 A;  5F04 A;  3G1L A;  4XID A;  2DA6 A;  3S1R J;  3GTP J;  1QRY A;  4XRS G;  3RKQ A;  1Z0X A;  3BQZ A;  2HOA A;  4NDL A;  1ZGW A;  3HB9 A;  2DA2 A;  1LFB A;  2K9N A;  3GTK J;  2NVY J;  1X2N A;  3SDG A;  1MSF C;  3BG5 A;  1ZKG A;  4LOC A;  5IP6 A;  3Q0U A;  3JR9 A;  3TED A;  1ENH A;  2R5Y B;  4DYQ A;  3NAU A;  2AO9 A;  1MBF A;  5IYB J;  5F0C A;  1Y1V J;  1QPI A;  4ABZ A;  1VF9 A;  1B8I A;  1DU6 A;  1MBG A;  1OJL A;  5E3L A;  3ZQI A;  1BL0 A;  3IH2 A;  1AKH B;  2LVS A;  1WH7 A;  3BG9 A;  3LSG A;  1K83 J;  1UMQ A;  3HOY J;  3QQA A;  1WI3 A;  1JKO C;  1JKP C;  1YRN B;  1IDY A;  3VPR A;  1U78 A;  4C3H J;  3LSR A;  4QTR A;  4MFE A;  5FKL A;  5C3E J;  4MLO A;  1UHS A;  5F0F A;  3JRA A;  1JUS A;  2L0K A;  2Y2Z A;  3M4O J;  5K7H A;  1U9N A;  5E3M A;  4RDU A;  5M5W J;  3S1M J;  1MBE A;  2NVX J;  5K7F A;  3A02 A;  3OSG A;  2YS9 A;  4M3E A;  1ETO A;  1Q1V A;  1ETV A;  4D7M A;  4J19 A;  1GDT A;  1JKR C;  4A69 C;  5F1J A;  4XRS A;  5IYC J;  2O8K A;  3BTC A;  4B4C A;  3JRC A;  2I10 A;  3S2H J;  2Y9Z A;  2LD5 A;  1F43 A;  1FTZ A;  4B3A A;  2VKV A;  5J1Y A;  4GFB A;  2IBD A;  2XSD C;  2WAQ N;  5FLV A;  3PO3 J;  1HF0 A;  3CDL A;  4A3M J;  2NVT J;  3LOC A;  2P81 A;  2NS7 A;  2VI6 A;  3HGG A;  4CYC B;  3HGY A;  3K2A A;  2VPR A;  1TWA J;  1MBH A;  5EZH A;  2XGE A;  1VFC A;  3SFI A;  1FIP A;  1JTX A;  1U9O A;  3Q3S A;  1TC3 C;  4QIW N;  1YRN A;  1W0U A;  1IV6 A;  4FCY A;  4UUS A;  2KT0 A;  2DMN A;  4A3I J;  2VUM J;  2M9H A;  3BR5 A;  5F0H A;  4AUX A;  1O4X A;  4RBO A;  2LLK A;  2K9Q A;  3HBL A;  1RKT A;  1NTC A;  1BW5 A;  4DZP A;  1S7E A;  2JJ7 A;  4IEJ A;  1P7I A;  3GBG A;  3LNQ A;  4XIC A;  4BY1 J;  4QSH A;  2DTZ A;  4AYB N;  5M5Y J;  3JRI A;  1FJL A;  2R7Z J;  4A3D J;  1H8A C;  3TP0 A;  3G1M A;  3UKG A;  2XPV A;  1GUU A;  2DA5 A;  2HOS A;  5C4J J;  1IJW C;  1XG1 A;  2JA6 J;  2OPT A;  3HKZ N;  2O7O A;  5IPA A;  4B1R A;  3I4M J;  2HDD A;  5GPA A;  3GTQ J;  4BXX J;  1ZR2 A;  5E3N A;  1QVT A;  3MKL A;  3I4N J;  3QPS A;  2XB0 X;  1HDP A;  1ZR4 A;  3CQZ J;  2NVQ J;  3LSP A;  3LSJ A;  4DW6 A;  2LKX A;  2D5V A;  5C44 J;  2JA7 J;  1WGX A;  3HOX J;  1AU7 A;  1W0T A;  4IHW A;  5FJ8 J;  3A01 A;  1I50 J;  3IH4 A;  2YU9 J;  2Y0S N;  5EEA A;  1XS9 A;  2HQ5 A;  2R0Q C;  2E2J J;  5K7Z A;  4M3B A;  1JJ6 C;  4G12 A;  3BR2 A;  5GP9 A;  3S17 J;  3W6V A;  1GVD A;  1VND A;  1OCT C;  3JRH A;  2DMT A;  1FEX A;  1ORK A;  5JLX A;  4XK4 A;  2X9D A;  3C2B A;  1ETK A;  1RET A;  2XB5 A;  3JRG A;  1QVU A;  1IUF A;  5DS9 A;  3H3V K;  1WH5 A;  2Y31 A;  1LE8 B;  1JKQ C;  2LTP A;  3WHC A;  1FIA A;  4EEF G;  2ID6 A;  1GV2 A;  1A5J A;  2LY9 A;  3HEF A;  2IEK A;  1RES A;  1B72 B;  1TWF J;  1OCP A;  2IAI A;  1UG2 A;  4JYK A;  4A3F J;  1ETW A;  3WHB A;  2JA8 J;  4X1E A;  4D5F A;  5FKM A;  3DEW A;  2JWT A;  1RPW A;  1ZTR A;  3GTL J;  3JRF A;  4M6V A;  1GT0 C;  5FKK A;  4IHX A;  1Z77 A;  3SJM A;  2R5Y A;  2E2I J;  2CUF A;  2ME6 A;  2ECC A;  4A3G J;  5J1R A;  2QCO A;  2DMQ A;  1EF4 A;  4Y7N J;  2JK3 A;  2ECB A;  2HI3 A;  5EGO B;  2Y9Y A;  2COB A;  2EZI A;  3S14 J;  5J1U A;  4A3L J;  1OFC X;  5F27 A;  1GV5 A;  1T33 A;  2DJN A;  1BW6 A;  2NOG A;  3FK6 A;  3IV5 A;  1MBJ A;  5HOD A;  1K61 A;  4FIS A;  3FK7 A;  1D5Y A;  3S15 J;  1AKH A;  4Y52 J;  3F0C A;  4FTH A;  1U8B A;  3Q0W A;  2OF7 A;  1TWC J;  2EH3 A;  3MVP A;  4BBS J;  1PUF B;  5EYR A;  1WCM J;  2JA5 J;  3HOV J;  2R92 J;  3Q0V A;  3RQI A;  1AHD P;  4JP0 A;  2XRL A;  5DTD A;  2PMZ N;  2MW8 A;  2AHQ A;  2E2H J;  2B63 J;  4DZJ A;  5IOZ A;  2XPU A;  2ME0 A;  5C4X J;  2EBI A;  2VKE A;  2DN0 A;  2DA1 A;  2H1K A;  1FTT A;  3O8H A;  1TWH J;  3ZQC A;  3QPL A;  1CQT A;  1I3Q J;  4A3J J;  1TWG J;  4W97 A;  5EZG A;  4C3I J;  2CRG A;  3BTL A;  4I76 A;  1POG A;  3K7A J;  5IP7 J;  2Y30 A;  2CJJ A;  2TRT A;  4BBR J;  5IOY A;  2M34 A;  4UUT A;  2NS8 A;  2K9S A;  3OIO A;  5EF6 A;  2HYJ A;  1MSE C;  1RKW A;  2M8G X;  2O9L A;  3ZQL A;  2L7Z A;  2K40 A;  1E3O C;  2R5Z B;  3OOU A;  1ETQ A;  1R9T J;  2L7F P;  5FKN A;  3DCF A;  2L9R A;  1X2M A;  4X6A J;  3BTI A;  1MH3 A;  2DMP A;  2JMW A;  1HLV A;  1IC8 A;  4A3C J;  3BR1 A;  1H89 C;  1ETX A;  2MGQ A;  4S0H B;  4CYC A;  2KDZ A;  4BKX A;  2EZK A;  3OSF A;  2XGC A;  3S2D J;  3E7L A;  3FIW A;  2M0C A;  1IGN A;  2FD5 A;  3ZQH A;  3RZD J;  2X48 A;  2EQR A;  4L5E A;  1JUP A;  3CCY A;  4FE4 A;  4M3D A;  4A3K J;  3BQY A;  5EG0 B;  2QF7 A;  5M3F J;  4C2M J;  2ID3 A;  3HDD A;  4HNV A;  2FX0 A;  3JRB A;  1JJ8 C;  4XRM A;  1JT6 A;  1F36 A;  1A6I A;  3B6A A;  1BJZ A;  2CQX A;  4FE7 A;  2EZL A;  1ETY A;  1HCR A;  2GM4 A;  3GTG J;  3BR0 A;  9ANT A;  3G1O A;  3TW7 A;  4I6Z A;  4AC0 A;  2HXO A;  3RZO J;  1X58 A;  2ELK A;  2M2E A;  4A93 J;  1JUM A;  1VI0 A;  4JX6 A;  2HXI A;  2LR8 A;  3CMY A;  2R5Z A;  1APL C;  1DU0 A;  3BG3 A;  3BR6 A;  1NK2 P;  3ZQG A;  2GLO A;  4UUS B;  1H88 C;  1I6H J;  4D7N A;  2N8G A;  3S1Q J;  2EZH A;  2JN6 A;  5M3M J;  3GTO J;  1MH4 A;  2MG4 A;  2WV1 A;  3MN2 A;  1XC5 A;  3A03 A;  3BT9 A;  4W1U A;  5JLW A;  5FKO A;  4JX4 A;  2CUE A;  2LFB A;  3IH3 A;  3D1N I;  2DA4 A;  2E19 A;  5EDN A;  2FJ1 A;  2XGD A;  1NK3 P;  1ITY A;  3JRE A;  4DYR A;  4A3E J; 
#chains in the Genus database with same CATH topology
 1MBK A;  1TLH B;  2W85 A;  3ZMT A;  1XX5 A;  4XKB A;  4G6D A;  3KZI C;  2IS6 A;  4RA2 A;  1HA8 A;  3TDU C;  1SD7 A;  1RUN A;  3ZRG A;  3BG7 A;  1LFP A;  3HZJ A;  1FWZ A;  2HPI A;  4KDP A;  1G3T A;  2FUG 2;  2BY2 A;  1MD0 A;  2X6X A;  2KRC A;  3ZOB A;  5D5U B;  2Z9O A;  1KGS A;  4GYG A;  4F7Z A;  1MNM C;  3J7A Y;  3HSF A;  2E1O A;  3BRO A;  2RVC A;  1YS6 A;  3FBN B;  3F3X A;  3H1C A;  4ESF A;  2WY8 Q;  3MKY B;  2PLY A;  3ABK H;  1KYW A;  1ZRF A;  2J5O A;  3K2Z A;  4P5O A;  4WK8 F;  2IPQ X;  2R93 J;  3O8G A;  1SFU A;  4NUB A;  4JK1 X;  3L1P A;  1X1C A;  2VOO A;  2VBX A;  2DA3 A;  5H6R A;  3GTM J;  2GAU A;  1B9M A;  1XSV A;  2LH9 A;  3K70 C;  1I1S A;  5DEQ A;  2HS5 A;  2G0E A;  2L7M P;  4KUM A;  1GXQ A;  3M8J A;  2RNJ A;  4N9H A;  2QEN A;  3B6C A;  3I9V 2;  3JSP A;  1Y1W J;  2O0Y A;  3WTU C;  3H0G J;  4G9Y A;  1Z67 A;  3ZXS A;  4IRH A;  2HZT A;  1V4R A;  3A4C A;  1XGO A;  3B73 A;  3HM5 A;  1LFU P;  3I58 A;  3OYM A;  3TBI A;  1SVM A;  1XN7 A;  4RGR A;  1PUF A;  3ULQ B;  4Y13 A;  3KCC A;  4XID A;  3GZ6 A;  4AVP A;  1QRY A;  3MCZ A;  3KET A;  4XRS G;  1AA7 A;  2HZD A;  1F1Z A;  1ZGW A;  4BXF A;  3IAS 2;  3CP8 A;  4RB0 A;  4IQJ A;  3ELK A;  1L0O C;  2M5W A;  3GTK J;  2KJC A;  1MSF C;  1FOK A;  3PIO F;  3JR9 A;  3TED A;  2R5Y B;  4M9S A;  4KIF A;  4HF0 A;  4ENN A;  3AG4 H;  2ZO4 A;  1RZ4 A;  4DBR A;  3IAM 2;  3ECO A;  4Y15 A;  1MBF A;  2HQR A;  5JHF A;  4FQG A;  5F0C A;  2ZXI A;  4I2O A;  1B8I A;  1YS7 A;  2D1H A;  2CSO A;  3E6B A;  1IO2 A;  3RDI A;  2BBY A;  5LD2 C;  3IH2 A;  4ZDO A;  3M07 A;  4G7H F;  1KU9 A;  4E7S A;  4IX7 A;  2RNG A;  1JKO C;  1YRN B;  2MD0 A;  1U78 A;  2OAZ A;  2W1O A;  2M7A A;  3DEE A;  3DLA A;  4EJW A;  1BM9 A;  3E0J B;  3CC7 I;  1T95 A;  4MTE A;  4DJA A;  4LIV A;  3K9T A;  2F5D A;  3CC4 I;  1TZL A;  2X1D A;  5L3G A;  4MLO A;  4AIH A;  2UXN A;  5LGT A;  2NNN A;  3GLX A;  2FOK A;  5AIQ A;  3M4O J;  4JQF A;  1H9G A;  5M5W J;  4RDU A;  1IN8 A;  1MBE A;  2V7F A;  2NVX J;  2EIJ H;  1UG0 A;  1LVA A;  1MKM A;  3GVA A;  4BQN A;  2IGM A;  1XPX A;  3VSL A;  1S6L A;  1ETO A;  3LL7 A;  4C30 A;  3RPU D;  4BHC A;  5K5Q A;  1R5G A;  2JPC A;  3OYB A;  4CCO A;  2D45 A;  1P4X A;  3CME I;  2KIU A;  2FBI A;  4HSR A;  3KLN A;  4NBQ A;  5J1Y A;  3DFG A;  2KRF A;  2IBD A;  5HNH A;  4XBF A;  2MD5 A;  1W7P D;  1Y0N A;  5FLV A;  3H3U A;  2VKD A;  2VE8 A;  3I59 B;  4DGW B;  4BAC A;  4KIT B;  4A3M J;  4ZZL A;  2EFQ A;  2NS7 A;  3HGY A;  1TWA J;  1MBH A;  2ISY A;  3CCQ I;  3LWF A;  3CDH A;  1FIP A;  1U9O A;  2KIF A;  3Q3S A;  3RYR A;  2DPD A;  3CCR I;  1W0U A;  3PQJ A;  3HL2 A;  2KT0 A;  4A3I J;  4HDV A;  2M9H A;  3H9Q A;  3HTS B;  3JAM K;  1O4X A;  2PFB A;  2V1X A;  4RBO A;  2LLK A;  1JI8 A;  2PQ8 A;  2DFE A;  2K9Q A;  3EUH C;  3P9I A;  5LFA A;  1B6A A;  3O6B B;  1NTC A;  1WRJ A;  4DZP A;  2KPM A;  3KEO A;  1Y8R B;  3LNQ A;  1KQ9 A;  1O57 A;  1ZAO A;  4EGY A;  3K1P A;  3H36 A;  4XIC A;  4QSH A;  3FZV A;  1D8J A;  2R7Z J;  1FOY A;  3MZH A;  2ZJR F;  3IRR A;  1YJN I;  3G1M A;  2DOD A;  4FT8 A;  4EMS A;  2LKS A;  2O6G E;  4B09 A;  5DM7 F;  3DKX A;  1QZE A;  1U5T C;  2LDU A;  3TO6 A;  1MMG A;  4ZYD A;  3FWE A;  4N4N B;  2EWN A;  5J40 A;  3OIQ A;  4Y33 A;  3ONQ A;  1I5Z A;  4WF2 A;  4B1R A;  3I4M J;  1C0W A;  4QWQ A;  4U0Y A;  1FOW A;  1ZR2 A;  3T8R A;  2GXB A;  2V26 A;  3OYI A;  1D8K A;  1HDP A;  1YG2 A;  1ZR4 A;  5CVR A;  4L9V A;  3PNY A;  2W7N A;  2L3D A;  2HYG D;  1LQ1 A;  5DUK A;  3FBI B;  3L2C A;  1S8N A;  1F5T A;  3HHH A;  3PSI A;  5IT9 Z;  3GFJ A;  3KYD B;  1R36 A;  2BHY A;  4EVI A;  3EYY A;  1FX7 A;  5KK1 A;  4NQW B;  2IRF G;  2QVO A;  2F5V A;  2MLK A;  3QYB A;  2YU9 J;  2FMY A;  5H6Q A;  1BI1 A;  2Y0S N;  2XRN A;  3ZMV A;  1V5G A;  1LDD A;  3TO7 A;  5LHG A;  4X0G A;  2O03 A;  2IGO A;  4IO9 F;  2K7L A;  1XS9 A;  2E2J J;  2DYS H;  1JJ6 C;  3BR2 A;  2IGN A;  4ENM A;  1HKS A;  1VND A;  5FB2 A;  2DMT A;  3O2P E;  4DIQ A;  4BXU A;  1ORK A;  1X1B A;  4CCM A;  1A04 A;  2X9D A;  2HYF A;  3DBR B;  3C2B A;  2FOW A;  1XB4 A;  3JRG A;  1SFE A;  1GXP A;  3N05 A;  1K6Y A;  5FLX K;  2Y31 A;  1LE8 B;  2LTP A;  1MMA A;  4I7H A;  1FIA A;  1Z7L A;  2H1L A;  1A5J A;  4CZC A;  3BG6 A;  3HEF A;  2IEK A;  1V5F A;  4TV7 A;  5ILV A;  3OS1 A;  5KAF C;  2HGC A;  4JYK A;  2L02 A;  1T08 B;  2QYO A;  1ZG5 A;  2QBY A;  3H92 A;  2HQN A;  4X1E A;  4EAT A;  1RIO H;  4CUG A;  4D5F A;  2GOM A;  5TGT A;  1K79 A;  4ZYH A;  1D1B A;  3A2K A;  3DLL F;  4HEA 2;  4LLL A;  1EH7 A;  2DJI A;  4IHX A;  4CO8 A;  1IW7 F;  2OTL I;  1MW7 A;  2NOJ B;  2R5Y A;  2E2I J;  4KIS A;  2XIG A;  2P7V B;  1X4O A;  2QCO A;  3PUF A;  1IXR C;  4IHW A;  5J8C A;  3L2R A;  2COB A;  4F93 B;  3S14 J;  1Z3Y A;  3GEZ A;  1F9N A;  3HXL A;  3FXO A;  2KHM A;  3HHG A;  4ENJ A;  1APL C;  2NOG A;  1K61 A;  3S15 J;  3IV5 A;  1XD7 A;  5HOD A;  1VQN I;  2VJJ A;  3QYF A;  1S3J A;  1TWC J;  3MVP A;  4UB6 C;  3KP2 A;  5E8I A;  4XKW A;  5GTH C;  3HOV J;  3IWZ A;  3Q0V A;  3RQI A;  4YEJ A;  1NH3 A;  4EV0 A;  4UVA A;  4JP0 A;  5DTD A;  2MW8 A;  2AHQ A;  4Y4R A;  2E2H J;  2OQG A;  3Q9S A;  4HV6 A;  5IOZ A;  2ME0 A;  2ZCW A;  3AL0 B;  2EBI A;  4ZYG A;  2VKE A;  4M73 A;  5D5W B;  4IZZ A;  3O8H A;  1CQT A;  2RQQ A;  1I3Q J;  2CMP A;  1VQ8 I;  4I76 A;  1POG A;  2EV5 A;  3K7A J;  2VQG A;  1XDU A;  2BW3 B;  2ESN A;  4KN4 X;  1BC7 C;  3OL3 A;  4F91 B;  3OYA A;  3OIO A;  3I64 A;  5CJ9 A;  3ZQL A;  1Z3X A;  3FF5 A;  1R9T J;  1K78 B;  3MKZ A;  5FKN A;  1V54 H;  2L9R A;  3IRQ A;  4X6A J;  3KYL A;  2DMP A;  2XAG A;  3WGI A;  1CF7 B;  4GGG A;  4IRG A;  4CIC A;  1ETX A;  4BJ6 C;  2K3F A;  1YW7 A;  1X1A A;  1HST A;  4BKX A;  1O3Q A;  2E71 A;  5KNL A;  1ONV A;  2ZSI B;  3S2D J;  2R7T A;  5E20 A;  4C9Y A;  4A2U A;  1OYY A;  2FD5 A;  3ZQH A;  1MZB A;  3QP5 A;  4UVC A;  3F8F A;  3HRS A;  1Z9C A;  1JUP A;  2BY3 A;  2ELH A;  4P55 A;  1XMK A;  4II3 A;  5HDG A;  1E17 A;  3BQY A;  2UZK A;  2JZY A;  3JAM Z;  1WI9 A;  2QF7 A;  1AOY A;  4C2M J;  3HDD A;  4HNV A;  3AG2 H;  3LSI A;  2XKP A;  1LNW A;  2F5F A;  2FU4 A;  5EEH A;  1BJZ A;  1EH8 A;  5DCM B;  1TT0 A;  1O7F A;  2DK8 A;  3IP4 B;  2CQX A;  4CH7 A;  5LGN A;  2HTS A;  2IW5 A;  2GIZ A;  2BVL A;  2EZL A;  3ZMS A;  2B0L A;  1HCR A;  2GM4 A;  2A07 F;  3GTG J;  1T39 A;  2DT5 A;  1ZYR F;  2HXO A;  1PUE E;  2CH0 A;  3VYS B;  4GO1 A;  1I39 A;  1VI0 A;  5B66 C;  1DU0 A;  4CXF A;  1BC8 C;  3BG3 A;  2YR2 A;  3H5A A;  3ZQG A;  2GLO A;  1H88 C;  3HIF A;  2RGV A;  2FNA A;  3KEY A;  1TW3 A;  4LGW A;  3K4C A;  3WTT C;  3UR3 C;  3BZK A;  4IJA A;  3GTO J;  4Q48 A;  2G7H A;  2OZU A;  4BJ5 C;  3QOP A;  4W1U A;  5JLW A;  2DU9 A;  1SD6 A;  2CUE A;  2LFB A;  1SFK A;  3IH3 A;  3PQK A;  4NQW A;  2DA4 A;  2E19 A;  3DKY A;  1OKR A;  3U1D A;  3M1E A;  1AU7 A;  1QHH D;  2PJR B;  5EG0 A;  2IS2 A;  2XPW A;  4PFO A;  2DT7 B;  2XAU A;  4OIR F;  1Z7U A;  4NC8 A;  1VQ5 I;  2DA7 A;  2GOX B;  3BTJ A;  2FBH A;  4UXN A;  1AWC A;  3EUK L;  3VB2 A;  3IHU A;  1BR1 A;  4RS8 A;  3RCO A;  4MQ9 F;  4RB1 A;  2VN2 A;  1BR4 A;  1XGS A;  2DFF A;  3MD2 A;  1Y39 A;  1KON A;  3GO5 A;  3MZY A;  1IRZ A;  5TIS C;  2W57 A;  5K1Y A;  1LE8 A;  4BHB A;  1U2W A;  1N75 A;  2NRA C;  2LRE A;  1IZ1 A;  4D5C A;  4Q4Z F;  2PI0 A;  1RNL A;  5F08 A;  1G2H A;  1WJF A;  1YX5 A;  1WJA A;  5IYD J;  1B8I B;  1W7P A;  2PG4 A;  3T5X A;  3IC7 A;  1JGG A;  3HOT A;  2IXS A;  3TMO A;  4MO7 A;  2JTV A;  3ERM A;  2XC7 A;  3SZP A;  2AS5 F;  2LP0 A;  1ODD A;  2CQ7 A;  3VYR B;  3KLO A;  3S16 J;  3VYU B;  2RAE A;  4LK1 F;  5J6X A;  3GTJ J;  3K6G A;  2ELJ A;  1WPK A;  4PJM A;  1P7J A;  2CG4 A;  3NAR A;  4HDU A;  3J7Z I;  1DQU A;  2FQ4 A;  2XF7 A;  1FBQ A;  2CV2 A;  2E5N A;  2TCT A;  2F4I A;  4M72 A;  4I09 A;  2MSY A;  2WB1 N;  5BNG A;  4A0X A;  4F3Q A;  5DUI A;  3PM1 A;  4M3G A;  3G2B A;  3LAJ A;  3QPH A;  4A5M A;  5IP9 J;  1TBX A;  4XMY A;  1O3T A;  3KP5 A;  2Q2E A;  3G1L A;  3S1R J;  3F6V A;  3GTP J;  3W2V A;  3K70 D;  1Z0X A;  3BQZ A;  5BPD A;  3C18 A;  5BMZ A;  2DA2 A;  3LA3 A;  1RR8 C;  3RPQ A;  1QA6 A;  3FHN A;  1REP C;  4RMN A;  2NVY J;  1Y8Q B;  1FZP B;  3SDG A;  3PNV A;  1G3Y A;  1ZKG A;  3FXU A;  4LOC A;  5BOX A;  2JT1 A;  3CDI A;  1LEB A;  5ED4 A;  3NAU A;  2AO9 A;  4MEY F;  4QLC U;  2ZJP F;  4BE1 A;  1JXS A;  3ABM H;  1ZHF A;  5LEK A;  5F1R A;  4CSW A;  3AKZ A;  1Y1V J;  3V7R A;  3AG3 H;  1QPI A;  4LIU A;  4AD9 A;  3WG9 A;  2CW8 A;  2ZME C;  2BW3 A;  4KFC A;  3E5X A;  1OIS A;  4B48 A;  4UV9 A;  4HF2 A;  1WJB A;  1WH7 A;  3LSG A;  4I98 B;  4ASN A;  1UMQ A;  4LB6 B;  3HOY J;  3QQA A;  4UNO A;  4XOP A;  1T2K A;  1JKP C;  4MHG A;  1ZG1 A;  4KIB A;  4C3H J;  4LB5 A;  2CO5 A;  5E79 C;  2IS1 A;  3KP3 A;  3QWL A;  2P7C B;  4ESB A;  5FKL A;  3WU2 C;  2JPB A;  3OR1 C;  3KP6 A;  2QZ8 A;  1P6R A;  3DPT A;  3KIO A;  1BI3 A;  1CF7 A;  1STZ A;  1OCR H;  2L0K A;  2F4O B;  4BDZ A;  3S1M J;  2DOF A;  2BGC A;  2VC1 A;  2VIX A;  4G6Q A;  4S04 A;  3I53 A;  4AM3 A;  2LF7 A;  3A02 A;  1UJ8 A;  3OSG A;  2OV7 A;  1QHG A;  2WY7 Q;  3W3C A;  3JTG A;  4IF4 A;  2PBI A;  3TQN A;  1HC8 A;  4U7B A;  4J19 A;  1SAX A;  3L2W A;  3IKV A;  2FML A;  2NNY A;  3JRC A;  2HNH A;  4L5I A;  1B9N A;  1DDN A;  1DP3 A;  2EIK H;  2VB6 A;  1Z1D A;  1TT5 B;  2ZXH A;  4N0B A;  1UB9 A;  4KA4 A;  4QPO A;  1SEU A;  3VSK A;  3MKW B;  5DCM A;  1IN4 A;  3JTH A;  1FOX A;  1HSJ A;  3ZQQ A;  3OYF A;  4ETS A;  1EKE A;  2XSD C;  4OAZ A;  2XAS A;  3DTK A;  1TTY A;  3OYC A;  3ZPL A;  5JFR A;  3PO3 J;  1U0J A;  2PMU A;  1YYV A;  2OCE A;  4C2U A;  2LG4 A;  2CFO A;  2IA0 A;  2YX4 A;  1G3W A;  4WXH A;  4HLY A;  3CLO A;  3HGG A;  5IT9 K;  3SFZ A;  4UHT A;  1YJW I;  4ANJ A;  5EZH A;  2XGE A;  3HTU A;  4O5V A;  3SFI A;  1JTX A;  3KX2 A;  3KP4 A;  1D1A A;  5TJJ A;  2LC2 A;  4QIW N;  3S8P A;  4BYY A;  1YHQ I;  4L9N A;  2DMN A;  2DAO A;  2VUM J;  2L7K A;  2FBK A;  4AUX A;  3CCS I;  3ERE D;  2VXZ A;  4BE2 A;  1W5T A;  1CGP A;  2WBM A;  4AIJ A;  3IUO A;  1NG7 A;  2E60 A;  1FSE A;  4UVB A;  3V7S A;  1I27 A;  4XSZ F;  3PIP F;  4IEJ A;  3GBG A;  4UV8 A;  1YIO A;  1OYW A;  2DTZ A;  2GIV A;  4G8X A;  4AYB N;  2XVC A;  3W6K B;  2ZNZ A;  1W1W E;  2KRH A;  1E0E A;  4A3D J;  2LBF B;  4YFX F;  1H8A C;  3TP0 A;  5EEG A;  1FPQ A;  3MEX A;  4KT6 A;  2W24 A;  2VQC A;  3UKG A;  2XPV A;  2PJR A;  1BJA A;  5FFZ A;  2DA5 A;  1ERD A;  2HOS A;  2G7U A;  1VQ6 I;  4BL0 B;  1XG1 A;  3TOA A;  2JA6 J;  5DM6 F;  3GYH X;  2LY1 A;  1J2X A;  2OPT A;  3PNT A;  4RGX A;  5D5X B;  2O7O A;  4MEX F;  2QBY B;  2HDD A;  5GPA A;  3GX4 X;  2VQH A;  2EFO A;  4U7D A;  3MKL A;  2ZXJ A;  1ZRE A;  4LJZ F;  3LSJ A;  4RAF A;  4EQQ A;  4DW6 A;  2D5V A;  5K5O A;  5LHI A;  3HOX J;  2OZ6 A;  3DXJ F;  1W0T A;  1TW2 A;  3TGN A;  5FJ8 J;  1I50 J;  1LPQ A;  4J01 A;  2M1B A;  3CJQ B;  5JVT A;  2MFZ A;  2R0Q C;  2STW A;  1OR7 C;  4M3B A;  4G12 A;  5GP9 A;  1FC3 A;  1HKQ A;  3S17 J;  4HAM A;  1D0Y A;  2QSF X;  2M0M A;  4XRF A;  4XLN F;  4HX4 A;  3JRH A;  3CCL I;  5DYM A;  1DP7 P;  3L2V A;  2QSH X;  3BC8 A;  3V8L A;  2KL4 A;  2OUM A;  1ETK A;  2XB5 A;  3H3V K;  3E6D A;  1D1C A;  2BHZ A;  3Q5F A;  1WWX A;  3CF5 F;  3Q9V A;  4EEF G;  3OYH A;  4XLH A;  2X6W A;  2E5Z A;  4ZYA A;  3H35 A;  4IHT A;  1TWF J;  4XQF A;  2DOE A;  2M30 A;  2A05 A;  1OCP A;  2F6C A;  1ZGJ A;  3GFI A;  4A3F J;  2ICW G;  2KJB A;  4L5J A;  3W2W A;  3WHB A;  2QA4 I;  1OPC A;  3K4B A;  5FKM A;  3DEW A;  2JWT A;  4E7J A;  1TQM A;  2K27 A;  3WGH A;  1RPW A;  3JRF A;  4PJN A;  4M6V A;  1P9Q C;  4ZJZ A;  1JGS A;  2YPR A;  3BJO A;  1Z77 A;  4XON A;  3SJM A;  4P1W A;  4U87 A;  2R7U A;  3HYI A;  3NWS A;  2ECC A;  2XGX A;  2DMQ A;  2FSW A;  2JK3 A;  2MC4 A;  2PN6 A;  5EGO B;  2ADU A;  2A6H F;  3AFH A;  1UAA A;  2Y9Y A;  2EZI A;  5HLG A;  2CQN A;  4A3L J;  5D4S A;  4UY8 I;  1T0F A;  5B1A H;  3FK6 A;  1T38 A;  3FXL A;  1D5Y A;  1MBJ A;  1X3Z B;  2GXG A;  4Y52 J;  3BCA A;  2HKX A;  3LSH A;  3IWF A;  3GZ5 A;  1U8B A;  3HSR A;  4PK4 A;  2EH3 A;  1MMN A;  2HDW A;  3U1K A;  2JA5 J;  3BP8 A;  4S05 A;  5J47 A;  2PMZ N;  3J81 K;  2B63 J;  3E97 A;  4DZJ A;  1SFX A;  2XPU A;  4OOI A;  5CVJ A;  2DN0 A;  2DA1 A;  2DDB A;  2CW7 A;  2YX7 A;  3LST A;  1J9I A;  5H2F C;  3ASN H;  2Y69 H;  3QPL A;  2NYX A;  3H0D A;  2P6T A;  3ZQC A;  1TWG J;  1ZG3 A;  4R1H A;  5EZG A;  3RI4 A;  2GA1 A;  1HQC A;  3OOP A;  4R79 A;  3GXO A;  3U2R A;  2CRG A;  1LVK A;  2WV0 A;  2LSO A;  4OIQ F;  2TRT A;  5IOY A;  4DQ2 A;  2A3S A;  2M34 A;  3BWG A;  1J7K A;  3CUQ B;  2EV6 A;  4ZTF A;  4PJL A;  4V19 K;  5EF6 A;  2HYJ A;  2R7V A;  2M8G X;  2O9L A;  1OCZ H;  4GXO A;  3LSM A;  2QSG X;  2XF6 A;  1ETQ A;  3MMY B;  2HTJ A;  2L7F P;  4HZF A;  3DCF A;  1X2M A;  4BHP A;  2O61 A;  2QKM B;  1MH3 A;  3BTI A;  1U5T B;  1W36 C;  2JMW A;  5CQG A;  3F9K A;  4E7K A;  3WTV C;  3SHF A;  3OY9 A;  2R7Q A;  5D5V B;  4FHT A;  3KYC B;  4A3C J;  4U0W A;  4KMU X;  1OCC H;  2L9N A;  4S0H B;  2FQ3 A;  1FSH A;  2KDZ A;  2EZK A;  2GXA A;  3SEQ A;  3FXK A;  3OSF A;  2Z16 A;  4DBQ A;  2QQ9 A;  4K2E A;  3N4M A;  4D0P A;  2H6C A;  2ZC2 A;  3QOE A;  2R7W A;  1BN5 A;  4OAY A;  2EQR A;  2C6Y A;  4L5E A;  4I0B A;  4XOR A;  1UHW A;  5EG0 B;  4KIC A;  4BEH B;  2IA2 A;  2ID3 A;  2P5K A;  3FXQ A;  4L0Y B;  5E1Z B;  1VQM I;  2VE9 A;  1F36 A;  1HW1 A;  1KYZ A;  5FD6 A;  3I55 I;  2KQR A;  1K4T A;  1WKM A;  4M71 A;  1XTA A;  3CJT B;  2M87 A;  3V7C A;  4OMZ A;  1SAU A;  4E7I A;  2LBF A;  2XSJ C;  2GWR A;  1P2F A;  4PZJ A;  3LAP A;  4G7Z F;  3L09 A;  5E17 F;  3ECH A;  4YIR X;  9ANT A;  4FAS D;  3TW7 A;  4RLF A;  3RZO J;  3K4M A;  4E6K G;  2ELK A;  2EIM H;  3VWB A;  1JUM A;  4N4O B;  4JX6 A;  3ASO H;  5BQT A;  1PYV A;  2EB7 A;  3OYL A;  2R5Z A;  3DBH B;  4UUV A;  4D7N A;  2D2W A;  5K5R A;  2N8G A;  1W7P B;  4L9T A;  4M9X A;  1IAW A;  2JN6 A;  3WU0 A;  3OYE A;  1FP2 A;  1D0X A;  1MH4 A;  1Y56 A;  4HYE A;  4XLF A;  3A1Y A;  1ULY A;  1WJC A;  3MN2 A;  5CVI A;  5E8G A;  3E3V A;  5FKO A;  4JX4 A;  4U0V A;  2H6B A;  5B1B H;  4BS9 A;  2CS3 A;  3R0A A;  1ITY A;  1NK3 P;  1VQK I;  3JRE A;  1EJ9 A;  1SAN A;  1BA5 A;  2CGP A;  5E3O A;  4BNC A;  3TP3 A;  5L3C A;  1HXD A;  2CUZ A;  2CQQ A;  4MFD A;  3OYD A;  1WFX A;  2B7E A;  2BY1 A;  1ZQ3 P;  1BBY A;  5GPC A;  1G8X A;  2Q2E B;  4DYC A;  4PJJ A;  2IT0 A;  3MFK A;  3HOU J;  2DMU A;  3EQL F;  2X6O A;  3A0H C;  4JX5 A;  2DBB A;  3NWT A;  2Z3Y A;  2CU7 A;  4IHV A;  2ZB9 A;  1A35 A;  3HRU A;  1T8I A;  3BPX A;  4V2F A;  2W48 A;  2R7R A;  1ZRD A;  2CWE A;  3KZY A;  4O3M A;  5JHU A;  1BOA A;  4XLP F;  4BY7 J;  3KFW X;  1IDZ A;  4RAG A;  3M3Y J;  3AL0 C;  5EJC A;  2RKH A;  2V6C A;  1YJ9 I;  2L4A A;  5CPR B;  3RYP A;  5KVR A;  1OLT A;  3ISP A;  1F4K A;  1D3Y A;  2LK2 A;  2K9M A;  2O5R A;  2H8R A;  4PGH A;  3CO7 C;  1SFO J;  4RAZ A;  4KT5 C;  5L3D A;  1J75 A;  1QGP A;  4OIO F;  1D0Z A;  4KMF A;  1JT0 A;  1LJ9 A;  2MH9 A;  2WAD A;  2NVU B;  3JSO A;  3IL2 A;  1LKX A;  3BR3 A;  2BV6 A;  4M3F A;  1S7O A;  5HDN A;  4HST A;  5L3E A;  2KIQ A;  2NAZ A;  2VL8 A;  3CJN A;  4WXC A;  4E7Z A;  5EGO A;  3CCJ I;  4YRV A;  5B5E C;  4CCK A;  2HPM A;  2L9V A;  3JRD A;  1SMY F;  1QZZ A;  2JUG A;  3FDY A;  4MIM A;  5GAD J;  1YW9 A;  3J80 Z;  3S1N J;  1WQ2 A;  2FNP A;  4PUS A;  3TW6 A;  2DLL A;  3D0S A;  4CYD A;  1ZK8 A;  2DA6 A;  3ZGK A;  2FE3 A;  3RKQ A;  1JE8 A;  2EK5 A;  2HOA A;  3I0T A;  4NDL A;  1QPM A;  2K85 A;  2V9V A;  2Z5U A;  1LFB A;  3HPG A;  4QPQ A;  5HLI A;  2DDA A;  2K9N A;  1S5L C;  3J81 Z;  4MNU A;  1X2N A;  3GF2 A;  3WU1 B;  1QNT A;  1ENH A;  4RLQ A;  3S3M A;  4DYQ A;  3VFZ A;  2CW0 F;  4A6E A;  3C2G A;  2V1D A;  4J00 A;  6PAX A;  4UB8 C;  1K7A A;  3U21 A;  5IYB J;  1YTY A;  1IUY A;  1TNS A;  2V9P A;  3PJR A;  4ABZ A;  1WHU A;  1VF9 A;  3EUH A;  5H20 A;  5HS7 A;  3FM3 A;  2W4S A;  4NNJ A;  1MBG A;  3I5U A;  1U8R A;  1R4N B;  4G94 A;  3K69 A;  1OJL A;  5E3L A;  3ZQI A;  1RC9 A;  3CUQ A;  4LK0 F;  3CC2 I;  1PP8 F;  4CCL A;  4HX8 A;  4M6X A;  1K83 J;  1FMV A;  4A5N A;  3CMA I;  2MA3 A;  1IDY A;  3MQ0 A;  3CO6 C;  4FX4 A;  2E1M B;  4KJZ A;  1B4A A;  2DW4 A;  4MFE A;  4Y3O A;  1R1T A;  2H27 A;  1U5T A;  3V4G A;  4BUP A;  5J4V A;  1UHS A;  1ON1 A;  3D5S C;  3RKY A;  1JUS A;  3JRA A;  3FMR A;  2V9K A;  3H9J A;  1KU2 A;  2HR3 A;  2Y2Z A;  5K7H A;  1U9N A;  3S93 A;  1DPR A;  3P9K A;  4AVZ A;  4E4H A;  2YSR A;  3K1M A;  4EJU A;  1R22 A;  2QQB A;  2YS9 A;  3WTX C;  1BIA A;  1Q1V A;  1XSX A;  5HS9 A;  4D7M A;  4XSX F;  1JKR C;  1X3U A;  1J0R A;  4A69 C;  3EUA A;  5F1J A;  5IYC J;  3GZN B;  3BTC A;  1A36 A;  5FO5 A;  2I5U A;  4BEH A;  1MMS A;  1MNE A;  1E3H A;  3LMM A;  2VXD A;  2ZNY A;  3V8K A;  4EM2 A;  2ZKZ A;  3GFL A;  3NRV A;  4G7O F;  2LD5 A;  5FRM A;  1FTZ A;  2VBY A;  4I02 A;  3RPU A;  4LMY A;  5DV5 A;  3BJA A;  1K6O A;  2WAE A;  2XDV A;  3L7W A;  1DGW Y;  2Q1Z B;  4RGS A;  4A0Y A;  1VQL I;  3OYK A;  2WAQ N;  1BI2 A;  4RB3 C;  1YX3 A;  3KP7 A;  1HF0 A;  2KFD A;  5HVQ C;  1R5H A;  2QKL B;  3LOC A;  1P4A A;  2DCE A;  2VPR A;  1MJ9 A;  5FFX A;  2X6Y A;  2IA1 A;  2LY2 A;  4H0E A;  1KU7 A;  2KZG A;  4HX7 A;  1B59 A;  3BR5 A;  3HRM A;  4KN7 X;  2DI3 A;  1YO5 C;  1J59 A;  3COA C;  3ZMZ A;  1EV7 A;  3HSE A;  3VDX A;  3HBL A;  1WVR A;  3FHZ A;  2Z99 A;  4XNF A;  2LYC A;  3DQV C;  1HKT A;  1BW5 A;  4XLC A;  4HW0 A;  3CCE I;  1S7E A;  2JJ7 A;  3NQO A;  2R7S A;  1P7I A;  4P96 A;  2MYS A;  2Z1D A;  4IOA F;  5M5Y J;  1W4M A;  2G9W A;  2VT3 A;  5CKT A;  3D5L A;  2WTE A;  1A6Q A;  4U88 A;  2HQA A;  5C4J J;  2RC4 A;  1IJW C;  2IVM A;  2AQE A;  2ETH A;  3HJE A;  1VQO I;  3HKZ N;  1KU3 A;  3MWM A;  5IPA A;  3L00 A;  2JSC A;  3DPL C;  4EM1 A;  3GTQ J;  4BXX J;  1NHA A;  5DDG A;  3F8B A;  1QVT A;  2JQ7 A;  3QPS A;  3E6M A;  1PDN C;  1XDS A;  3RIR A;  3LSP A;  1MJB A;  3W2A A;  3KZZ A;  4LLN A;  2JA7 J;  3VOD A;  1R4M B;  3K4K A;  3WTW C;  4CGZ A;  3KEQ A;  1YIT I;  1R1V A;  4NC6 A;  5EEA A;  1GLN A;  3DU5 A;  2E35 A;  1QQI A;  3HG9 A;  3RTR A;  4BQA A;  5GAE J;  2K4J A;  4MTD A;  1MIJ A;  1IF1 A;  4EJT A;  1B1B A;  3DF8 A;  3W6V A;  4XN0 A;  3T0Y A;  3K10 A;  2BE5 F;  1OCT C;  2TDX A;  1FEX A;  4YIF A;  5JLX A;  1WZ2 A;  4XK4 A;  4IHS A;  4KNY A;  1NG6 A;  4XN3 A;  2ZME B;  1RET A;  4D9J A;  5CVU A;  1T6S A;  1QVU A;  1IUF A;  4LD5 A;  5DS9 A;  3QYE A;  2CV0 A;  3R0J A;  1JKQ C;  4HLX A;  1UCR A;  3VYT B;  3WHC A;  1S9H A;  2ID6 A;  1GV2 A;  1O3S A;  2LY9 A;  4OIN F;  2PMH A;  1T98 A;  3F8C A;  1RES A;  1B72 B;  2DOA A;  3GWZ A;  4RGU A;  1MND A;  4XR6 A;  4YFK F;  3CZ6 A;  2VC0 A;  4M74 A;  1ETW A;  2FA5 A;  2JA8 J;  3CD6 I;  1V5E A;  2XAH A;  3GUD A;  1XCB A;  3PUB A;  2VJ4 A;  4E70 A;  2ZJ2 A;  4B8X A;  3GTL J;  1S7A A;  4FX0 A;  5FRN A;  1GT0 C;  1Q1H A;  5KCM A;  2DFH A;  1K4S A;  4L0Z B;  1R6R A;  1SMT A;  3M8E A;  4DNC A;  5J1R A;  2XHK A;  1EF4 A;  3CJR B;  4HNT A;  2ECB A;  1IRF A;  3SQN A;  3TOB A;  4AWX B;  1ZLK A;  3H9G A;  5F27 A;  1GV5 A;  2DJN A;  1BW6 A;  2A68 F;  5J8F A;  2XAQ A;  3OYG A;  2A5Y B;  3FK7 A;  2OU2 A;  3I3L A;  3F0C A;  4FTH A;  1USS A;  2B9S A;  4C2T A;  3C3W A;  1WCM J;  1IXC A;  2R92 J;  3ABT A;  1WJ5 A;  2KMU A;  2P6S A;  3CCM I;  4ZC3 A;  3ML6 A;  4IXA A;  3WTS C;  3EPZ A;  1FYK A;  5KAI C;  2LF8 A;  2E7X A;  2WA0 A;  1LDJ A;  2H1K A;  1FTT A;  3HC7 A;  1TWH J;  4B47 A;  2R7X A;  2XRO A;  4A3J J;  3QPT A;  4GCV A;  4W97 A;  4BQO A;  4C3I J;  3NEU A;  2EA2 A;  1KQ0 A;  2Y48 A;  1IRG A;  3FXM A;  2GQQ A;  1VQ9 I;  2K9L A;  5CLS A;  4ZZD A;  2HWV A;  1LEA A;  2Y30 A;  4BBR J;  2PMZ A;  5D4R A;  1IXS B;  3P7N A;  1V3F A;  3FXR A;  1XCV A;  2HOE A;  3RKW A;  4UUT A;  2ZFU A;  3EDP A;  2NS8 A;  3WTY C;  2K9S A;  4P9U A;  5E1W A;  1HBX G;  2L5Q A;  1MSE C;  3R61 A;  5LHH A;  5ILU A;  1Z05 A;  2MAB A;  2R5Z B;  3B02 A;  2H94 A;  3CP2 A;  2DFI A;  1X1P A;  5FD5 A;  2CFX A;  2A6E F;  1P4W A;  2BYV E;  1H89 C;  4RB2 C;  1FNN A;  3CMM A;  2HVR A;  3HUG B;  4LFU A;  3CUO A;  3D5R C;  4HA8 A;  5HOO A;  1QU3 A;  1W5S A;  2P0W A;  4OMY A;  3G73 A;  3P9C A;  4XM3 A;  1IV8 A;  2JA2 A;  5LRR A;  2FRH A;  4KYW A;  2RQP A;  2UXX A;  4HNU A;  3SXY A;  3DKW A;  4ENK A;  2AXL A;  4PDK A;  4XL9 A;  4ESJ A;  4A3K J;  2LOO A;  3EYI A;  2ISZ A;  3G4S I;  5M3F J;  5ICC A;  4XKC A;  3A0B C;  2FX0 A;  5ICE A;  1JJ8 C;  2WWY A;  1MGT A;  4XRM A;  1R1U A;  4BJT A;  1A6I A;  3BY6 A;  2P4W A;  3ZR8 X;  1FP1 D;  3L2U A;  2K02 A;  1W36 D;  4EJV A;  2VJI A;  2BVM A;  3QAH A;  2R7O A;  3PL8 A;  3H3Z A;  3G6E I;  1WJE A;  4FE7 A;  3F23 A;  1ETY A;  2Z2S B;  2OA4 A;  2Y0S A;  2CV1 A;  2JRM A;  2W84 A;  4LG0 B;  5LBQ A;  2E36 A;  1FY7 A;  2L54 A;  3G3Z A;  4HG2 A;  4AC0 A;  1VQP I;  2F5E A;  4B44 A;  4LIT A;  2M2E A;  3BJ6 A;  2QUF A;  4FET A;  3OR2 C;  1R49 A;  1A31 A;  2LR8 A;  3CMY A;  2DQR A;  1NK2 P;  2CYY A;  2UV1 A;  5LLQ A;  4UUS B;  2ZSH B;  1I6H J;  3DPU A;  4IL6 C;  2QWW A;  4Q47 A;  3X2Q H;  2GZW A;  3S1Q J;  2M45 A;  2KKO A;  5M3M J;  1ZGA A;  5IY5 H;  3QP6 A;  1MMD A;  5GAG J;  2JVH A;  2CQK A;  4B43 A;  4DOZ A;  2EIN H;  3BT9 A;  3BLY A;  5E18 F;  4ZDL A;  2STT A;  5D6F A;  3CES A;  4NHJ A;  5ICG A;  2H8W A;  4CCJ A;  1O7L A;  3J80 K;  4XKV A;  5EDN A;  2XGD A;  4A12 A;  4DYR A;  4A3E J;  2V1U A;  4EJO A;  4BDY A;  1GHC A;  2XAF A;  1R7J A;  1W5C C;  2EFN A;  3ZQF A;  2O8X A;  4KIG A;  5L3F A;  2YUS A;  5LGU A;  1RI7 A;  5FLM J;  3PSF A;  2M3A A;  2O3F A;  3ESW B;  2DPU A;  2Y0M A;  2KP6 A;  2EA4 A;  2GA2 A;  4V2G A;  1VZ0 A;  2EJR A;  1FBS A;  2HVQ A;  1T56 A;  2ZME A;  1S29 A;  4R8H A;  4CCN A;  4CA0 A;  2Z33 A;  3OV8 A;  3FKI J;  2WAF A;  5M5X J;  1O3R A;  1YFH A;  4XLA A;  3ROU A;  1WSU A;  3H5R A;  4HBL A;  3F22 A;  1HOM A;  2NS0 A;  4GYI A;  5J3L A;  2V6E A;  4RAY A;  4YFN F;  2PX9 A;  5HLH A;  5D8K B;  4A3B J;  2QLZ A;  1B72 A;  4HV5 A;  5LEJ A;  4IOC F;  1LUJ B;  4IHY A;  1DGR M;  2VLA A;  3QOD A;  2JVG A;  4I01 A;  5HNF A;  2QGU A;  3A01 B;  5DD8 A;  3HOW J;  3LA2 A;  4F55 A;  4C3J J;  3FIS A;  3OS2 A;  2GBY A;  1H0M A;  2LKP A;  2X4H A;  3KE2 A;  2NXN B;  2EPF A;  1YW8 A;  3QRF F;  3CUQ C;  5LRS A;  5GTI C;  1IG7 A;  4A0Z A;  2DTR A;  2IP2 A;  3WOD F;  2PJP A;  1JTY A;  3M8F A;  1WJD A;  1RR7 A;  4PFP A;  3TKY A;  2HOT A;  3HOZ J;  3V42 A;  5JR3 A;  1HDD C;  5TRD A;  3QU6 A;  1M1E B;  3PO2 J;  5KHD A;  1KZH A;  3DU6 A;  5F04 A;  2XAJ A;  4IPA A;  1UFM A;  4M6Y A;  4ZTJ A;  4PSW A;  1X3W B;  3SYT A;  3LFK A;  3HB9 A;  1H9T A;  3UNG C;  1KA8 A;  3SZT A;  5D8L B;  4WX9 A;  3F21 A;  1BI0 A;  3BG5 A;  2D1V A;  5IP6 A;  3Q0U A;  4PGG A;  2MC3 A;  1RRJ A;  3OIP A;  1P92 A;  4NB5 A;  5HS8 A;  2VON A;  3BZC A;  2AXT C;  3WGG A;  1HW2 A;  3C2H A;  3SEZ A;  3BPV A;  3S3O A;  1UHM A;  4OWR B;  3CF2 A;  1DU6 A;  3C7J A;  2XUB A;  2JSP A;  2K3P A;  1BL0 A;  1AKH B;  2LVS A;  1PJR A;  3CLQ A;  1MDM B;  4GDF A;  2OQR A;  2VQL A;  4II2 A;  4AID A;  2ACJ A;  1YE9 A;  2L4M A;  3BG9 A;  4IRI A;  1BR2 A;  4B3X A;  1WI3 A;  2P5L C;  3VPR A;  1RUO A;  3LSR A;  2HVS A;  5J4Y A;  4QTR A;  3OS0 A;  3RSN A;  3TO9 A;  3VEP A;  5C3E J;  3M7G A;  1N78 A;  2JUC A;  5F0F A;  1FMW A;  2J5P A;  1I6X A;  2ESH A;  1UEL B;  5D6E A;  5E3M A;  3HUG A;  2BOL A;  3F6O A;  3MAJ A;  1IN5 A;  4CZZ A;  5K7F A;  3HRT A;  2JRT A;  3CCU I;  1LB2 A;  3H5N A;  4M3E A;  2QQA A;  2P5V A;  2E34 A;  1ETV A;  1QZY A;  1GDT A;  2F4M B;  1BIB A;  4XRS A;  2BXY A;  2O8K A;  4B4C A;  3E5Q A;  2XKO A;  2I10 A;  1XGM A;  1U3E M;  3S2H J;  2X1C A;  4HRI A;  2Y9Z A;  1ACI A;  5JI6 A;  4JBA A;  1FYM A;  2E1N A;  3J7A O;  4BGD A;  3FKJ A;  4BH9 A;  4Z6Y A;  2HDC A;  1F43 A;  1X4P A;  1OYI A;  4B3A A;  3RKX A;  3G71 I;  2K86 A;  2LMD A;  3AG1 H;  2VKV A;  3QU3 A;  3ZMD A;  4GFB A;  2A69 F;  1OR7 A;  4F92 B;  1G4D A;  2DXI A;  5CQE A;  3GW2 A;  4LG0 A;  5BPI A;  2HKO A;  2LRD A;  3CDL A;  4GRI A;  5BS6 A;  2NVT J;  2I8D A;  1SVL A;  1ZAR A;  3K4J A;  2COM A;  2P81 A;  4ON0 A;  4CYC B;  2VI6 A;  4BU2 A;  2KDO A;  1SD5 A;  3K2A A;  4IQ4 A;  1FBU A;  1VFC A;  1TC3 C;  1YRN A;  1IV6 A;  2QM3 A;  4FCY A;  4UUS A;  3R4K A;  2XV4 S;  3ZMU A;  2E1C A;  1N77 A;  3M9A A;  1DUX C;  5F0H A;  2VJ5 A;  3JCU C;  5JVG F;  2F2E A;  2WAQ A;  4Y17 A;  3ZN1 A;  2Y75 A;  1SD4 A;  1G6N A;  2RRE A;  2VT2 A;  5HLT A;  4L18 B;  5ICF A;  1RKT A;  1XMX A;  1X1D A;  1X19 A;  5DD4 A;  4BY1 J;  1E2X A;  2H09 A;  1TNT A;  3K1N A;  3JRI A;  2RV8 A;  1FJL A;  1XMA A;  3I54 A;  4ITV A;  2X51 A;  4MQV A;  2A5W A;  2V79 A;  4BE0 A;  3M1C A;  1FLI A;  2YU3 A;  4MGR A;  1GUU A;  2MBF A;  5DCF A;  3RJP A;  3FX3 A;  1OMI A;  1E3P A;  2R7F A;  2DYR H;  2VAS A;  2DO7 A;  5FGM A;  1YI2 I;  4ZH4 F;  2KLO A;  1V55 H;  4HF1 A;  1YOV B;  2X1E A;  5E3N A;  3I4N J;  1R00 A;  2XB0 X;  3I71 A;  4L9J A;  2FXA A;  3I59 A;  3AAF A;  1FYL A;  3CQZ J;  2WB1 A;  2NVQ J;  2HFH A;  3S32 A;  2L2O A;  2F48 A;  4PJ0 C;  2EV0 A;  2LKX A;  5C44 J;  5A2Q K;  3OL4 A;  2Q8K A;  2K4B A;  1WGX A;  4A6D A;  1I1G A;  4HQE A;  1SC7 A;  3BDD A;  2MH2 A;  3HKZ A;  3GME A;  3A01 A;  3IH4 A;  2X85 A;  3E6C C;  4EGZ A;  3KPH A;  4BAY A;  2MLG A;  3LFU A;  2A6T A;  4RM2 A;  2HQ5 A;  3TL4 X;  2R7D A;  5K7Z A;  2IGK A;  3ABU A;  2ZBK A;  3DBL B;  4CDG A;  3O3K A;  1GVD A;  3CTA A;  3BZ6 A;  4PCQ A;  3DTE A;  2EFW A;  4CHU A;  3ABL H;  3F72 A;  2W00 A;  1IN6 A;  2A61 A;  1Y0U A;  3LSK A;  3SZG A;  1J09 A;  1TQP A;  3I56 I;  1JHF A;  1IRX A;  1WH5 A;  4OIP F;  2E1M C;  2XF5 A;  3ZQ7 A;  4ZYE A;  4BQQ A;  1G3S A;  2AQF A;  2F5C A;  3ZN0 A;  3WTZ A;  1BOB A;  2V4J C;  4Z2Y A;  1SVO A;  3WG7 H;  1KQ8 A;  5F6F A;  2HEO A;  3OMY A;  3K0L A;  2IAI A;  4I99 C;  2ZJQ F;  1UG2 A;  3LQQ A;  2KZV A;  1UZC A;  3BCB A;  4Q5S F;  2L01 A;  2QQ8 A;  3ZCO A;  1ZTR A;  4WCG A;  2FEZ A;  1HW5 A;  3J7Y J;  4D1Q A;  5FKK A;  2P8T A;  2BZT A;  4WXD A;  1G59 A;  2KIM A;  2CUF A;  4XOT A;  2WC2 A;  2ME6 A;  1ZN2 A;  5IT3 A;  4A3G J;  1JHH A;  4Y7N J;  1XSD A;  2OJE D;  3GFM A;  2HI3 A;  5FRO A;  5J1U A;  2OCC H;  2UUZ A;  4H4K C;  5AIP A;  1R23 A;  2VOD A;  1OFC X;  1T33 A;  2EFP A;  4FIS A;  1AKH A;  1MDM A;  3F8N A;  2RDP A;  3Q0W A;  1XGN A;  2OF7 A;  4IVN A;  2IS4 A;  4BBS J;  3U9G A;  1MJA A;  1PUF B;  3FMS A;  2M8E A;  5ILS A;  3K4L A;  5EYR A;  3S2W A;  4O6J A;  1PVE A;  1TL8 A;  1AHD P;  2XRL A;  2R4G A;  3R60 A;  3RQ4 A;  5C4X J;  1DPU A;  1ZLJ A;  3HOS A;  2X0L A;  1Z6T A;  3GLL A;  3PFI A;  3E1S A;  1OCO H;  3REO A;  1ZH5 A;  2CUJ A;  5FLX Z;  3MZ8 A;  3JW4 A;  2DK5 A;  4ZDP A;  5F64 A;  4YEL A;  1ZEL A;  4PSX A;  2W25 A;  3TDZ C;  1EA3 A;  4AIK A;  1EH6 A;  4N9I A;  3BTL A;  3E5U A;  2VOP A;  5IP7 J;  1OQY A;  3I4P A;  2CJJ A;  3F8M A;  3BOQ A;  4YII A;  1PP7 U;  1Z91 A;  3CCV I;  1I3A A;  4F52 A;  1R71 A;  1Y6I A;  3DEU A;  4EM0 B;  2VBW A;  4LLG F;  1RKW A;  5HDK A;  1TP4 A;  3WE2 A;  1R58 A;  2L7Z A;  2K40 A;  3DP7 A;  4XLE A;  1E3O C;  1QBJ A;  2LNB A;  4E7L A;  3OOU A;  3DWL E;  3L9F A;  4WWC A;  4AYB A;  2ZFW A;  3LA7 A;  5L3B A;  1QO0 D;  3C1D A;  3T8T A;  3WE3 A;  2EIL H;  3FXJ A;  1IC8 A;  1HLV A;  1U6G A;  2K5C A;  4P9F A;  3S3N A;  3BR1 A;  5CVV A;  2MGQ A;  3DV8 A;  5CYV A;  4CYC A;  2E7W A;  2OTJ I;  2RN7 A;  1YIJ I;  3GCM A;  4HOB A;  1VQ4 I;  5AON A;  3K4N A;  3R6S A;  2XGC A;  3PFY A;  3E7L A;  3FIW A;  2M0C A;  3DTI A;  3OWT A;  1IGN A;  2UWM A;  1VTN C;  1LDK B;  5GAH J;  3RZD J;  2X48 A;  2OD5 A;  3CCY A;  4HQM A;  1D5V A;  3OYN A;  4FE4 A;  2HU9 A;  4M3D A;  4NC7 A;  1VQ7 I;  2ZXW H;  1N25 A;  1GVJ A;  3JRB A;  3T1B A;  1T0F C;  3V8J A;  3N97 A;  1UST A;  4YG2 F;  1JT6 A;  2W82 A;  2KIS A;  3B6A A;  3P5J A;  4M9Z A;  5B3S H;  1FT9 A;  2M7B A;  4OU0 A;  3VOE A;  2Q0O A;  1S72 I;  3BR0 A;  3G1O A;  5ERI A;  2FF4 A;  4I6Z A;  3OYJ A;  2V1N A;  1X58 A;  4G6T B;  4A93 J;  2BXZ A;  1J5Y A;  3HPH A;  2HXI A;  2VBZ A;  2L9S A;  2VKH A;  3SDB A;  2QEX I;  1ZRC A;  3BR6 A;  1R5I D;  4E7H A;  1K78 A;  2M4G A;  2IJL A;  2EZH A;  2M4K A;  2PEX A;  1L3L A;  4AU7 A;  3EET A;  5E1X A;  3FM5 A;  2DQL A;  3L2Q A;  2BY0 A;  4JOM A;  2R3S A;  1Z6R A;  1YLF A;  2MG4 A;  4I0A A;  1TQI A;  2DT6 A;  2WV1 A;  1Z21 A;  1XC5 A;  1IN7 A;  2OBP A;  2BEO A;  3A03 A;  4RM3 A;  3W6J B;  3IKT A;  4HPQ A;  1YQA A;  3D1N I;  3LQR A;  1ON2 A;  2OC6 A;  5A2Q Z;  4LG3 A;  3ZP5 A;  3FMQ A;  2VPL A;  2FJ1 A;  4IKF A; 
#chains in the Genus database with same CATH homology
 1MBK A;  1SAN A;  1BA5 A;  5EG0 A;  5E3O A;  2XPW A;  3TP3 A;  3ZQF A;  2CQQ A;  4MFD A;  2YUS A;  1ZQ3 P;  5GPC A;  5FLM J;  4DYC A;  3HOU J;  2DA7 A;  2DMU A;  3BTJ A;  4V2G A;  2X6O A;  4JX5 A;  3ZOB A;  1T56 A;  2CU7 A;  3FKI J;  1MNM C;  5M5X J;  4IHV A;  2ZB9 A;  2E1O A;  1IRZ A;  1LE8 A;  1HOM A;  4V2F A;  2W48 A;  5J3L A;  4BY7 J;  4D5C A;  1IDZ A;  3M3Y J;  5F08 A;  4A3B J;  1G2H A;  1B72 A;  4IHY A;  2R93 J;  3O8G A;  3L1P A;  2LK2 A;  2H8R A;  3A01 B;  5IYD J;  1SFO J;  3HOW J;  2DA3 A;  1B8I B;  3GTM J;  4C3J J;  3FIS A;  1JT0 A;  1JGG A;  2GBY A;  2G0E A;  2L7M P;  4MO7 A;  3BR3 A;  2LP0 A;  4M3F A;  3S16 J;  3B6C A;  1Y1W J;  2RAE A;  3H0G J;  3GTJ J;  5EGO A;  1WPK A;  1P7J A;  3NAR A;  1IG7 A;  2FQ4 A;  3JRD A;  2TCT A;  4MIM A;  1JTY A;  1RR7 A;  3HM5 A;  2MSY A;  2WB1 N;  5BNG A;  3S1N J;  2HOT A;  3TW6 A;  3HOZ J;  3PM1 A;  4M3G A;  1LFU P;  1HDD C;  5IP9 J;  3PO2 J;  1PUF A;  1ZK8 A;  5F04 A;  3G1L A;  4XID A;  2DA6 A;  3S1R J;  3GTP J;  1QRY A;  4XRS G;  3RKQ A;  1Z0X A;  3BQZ A;  2HOA A;  4NDL A;  1ZGW A;  3HB9 A;  2DA2 A;  1LFB A;  2K9N A;  3GTK J;  2NVY J;  1X2N A;  3SDG A;  1MSF C;  3BG5 A;  1ZKG A;  4LOC A;  5IP6 A;  3Q0U A;  3JR9 A;  3TED A;  1ENH A;  2R5Y B;  4DYQ A;  3NAU A;  2AO9 A;  1MBF A;  5IYB J;  5F0C A;  1Y1V J;  1QPI A;  4ABZ A;  1VF9 A;  1B8I A;  1DU6 A;  1MBG A;  1OJL A;  5E3L A;  3ZQI A;  1BL0 A;  3IH2 A;  1AKH B;  2LVS A;  1WH7 A;  3BG9 A;  3LSG A;  1K83 J;  1UMQ A;  3HOY J;  3QQA A;  1WI3 A;  1JKO C;  1JKP C;  1YRN B;  1IDY A;  3VPR A;  1U78 A;  4C3H J;  3LSR A;  4QTR A;  4MFE A;  5FKL A;  5C3E J;  4MLO A;  1UHS A;  5F0F A;  3JRA A;  1JUS A;  2L0K A;  2Y2Z A;  3M4O J;  5K7H A;  1U9N A;  5E3M A;  4RDU A;  5M5W J;  3S1M J;  1MBE A;  2NVX J;  5K7F A;  3A02 A;  3OSG A;  2YS9 A;  4M3E A;  1ETO A;  1Q1V A;  1ETV A;  4D7M A;  4J19 A;  1GDT A;  1JKR C;  4A69 C;  5F1J A;  4XRS A;  5IYC J;  2O8K A;  3BTC A;  4B4C A;  3JRC A;  2I10 A;  3S2H J;  2Y9Z A;  2LD5 A;  1F43 A;  1FTZ A;  4B3A A;  2VKV A;  5J1Y A;  4GFB A;  2IBD A;  2XSD C;  2WAQ N;  5FLV A;  3PO3 J;  1HF0 A;  3CDL A;  4A3M J;  2NVT J;  3LOC A;  2P81 A;  2NS7 A;  2VI6 A;  3HGG A;  4CYC B;  3HGY A;  3K2A A;  2VPR A;  1TWA J;  1MBH A;  5EZH A;  2XGE A;  1VFC A;  3SFI A;  1FIP A;  1JTX A;  1U9O A;  3Q3S A;  1TC3 C;  4QIW N;  1YRN A;  1W0U A;  1IV6 A;  4FCY A;  4UUS A;  2KT0 A;  2DMN A;  4A3I J;  2VUM J;  2M9H A;  3BR5 A;  5F0H A;  4AUX A;  1O4X A;  4RBO A;  2LLK A;  2K9Q A;  3HBL A;  1RKT A;  1NTC A;  1BW5 A;  4DZP A;  1S7E A;  2JJ7 A;  4IEJ A;  1P7I A;  3GBG A;  3LNQ A;  4XIC A;  4BY1 J;  4QSH A;  2DTZ A;  4AYB N;  5M5Y J;  3JRI A;  1FJL A;  2R7Z J;  4A3D J;  1H8A C;  3TP0 A;  3G1M A;  3UKG A;  2XPV A;  1GUU A;  2DA5 A;  2HOS A;  5C4J J;  1IJW C;  1XG1 A;  2JA6 J;  2OPT A;  3HKZ N;  2O7O A;  5IPA A;  4B1R A;  3I4M J;  2HDD A;  5GPA A;  3GTQ J;  4BXX J;  1ZR2 A;  5E3N A;  1QVT A;  3MKL A;  3I4N J;  3QPS A;  2XB0 X;  1HDP A;  1ZR4 A;  3CQZ J;  2NVQ J;  3LSP A;  3LSJ A;  4DW6 A;  2LKX A;  2D5V A;  5C44 J;  2JA7 J;  1WGX A;  3HOX J;  1AU7 A;  1W0T A;  4IHW A;  5FJ8 J;  3A01 A;  1I50 J;  3IH4 A;  2YU9 J;  2Y0S N;  5EEA A;  1XS9 A;  2HQ5 A;  2R0Q C;  2E2J J;  5K7Z A;  4M3B A;  1JJ6 C;  4G12 A;  3BR2 A;  5GP9 A;  3S17 J;  3W6V A;  1GVD A;  1VND A;  1OCT C;  3JRH A;  2DMT A;  1FEX A;  1ORK A;  5JLX A;  4XK4 A;  2X9D A;  3C2B A;  1ETK A;  1RET A;  2XB5 A;  3JRG A;  1QVU A;  1IUF A;  5DS9 A;  3H3V K;  1WH5 A;  2Y31 A;  1LE8 B;  1JKQ C;  2LTP A;  3WHC A;  1FIA A;  4EEF G;  2ID6 A;  1GV2 A;  1A5J A;  2LY9 A;  3HEF A;  2IEK A;  1RES A;  1B72 B;  1TWF J;  1OCP A;  2IAI A;  1UG2 A;  4JYK A;  4A3F J;  1ETW A;  3WHB A;  2JA8 J;  4X1E A;  4D5F A;  5FKM A;  3DEW A;  2JWT A;  1RPW A;  1ZTR A;  3GTL J;  3JRF A;  4M6V A;  1GT0 C;  5FKK A;  4IHX A;  1Z77 A;  3SJM A;  2R5Y A;  2E2I J;  2CUF A;  2ME6 A;  2ECC A;  4A3G J;  5J1R A;  2QCO A;  2DMQ A;  1EF4 A;  4Y7N J;  2JK3 A;  2ECB A;  2HI3 A;  5EGO B;  2Y9Y A;  2COB A;  2EZI A;  3S14 J;  5J1U A;  4A3L J;  1OFC X;  5F27 A;  1GV5 A;  1T33 A;  2DJN A;  1BW6 A;  2NOG A;  3FK6 A;  3IV5 A;  1MBJ A;  5HOD A;  1K61 A;  4FIS A;  3FK7 A;  1D5Y A;  3S15 J;  1AKH A;  4Y52 J;  3F0C A;  4FTH A;  1U8B A;  3Q0W A;  2OF7 A;  1TWC J;  2EH3 A;  3MVP A;  4BBS J;  1PUF B;  5EYR A;  1WCM J;  2JA5 J;  3HOV J;  2R92 J;  3Q0V A;  3RQI A;  1AHD P;  4JP0 A;  2XRL A;  5DTD A;  2PMZ N;  2MW8 A;  2AHQ A;  2E2H J;  2B63 J;  4DZJ A;  5IOZ A;  2XPU A;  2ME0 A;  5C4X J;  2EBI A;  2VKE A;  2DN0 A;  2DA1 A;  2H1K A;  1FTT A;  3O8H A;  1TWH J;  3ZQC A;  3QPL A;  1CQT A;  1I3Q J;  4A3J J;  1TWG J;  4W97 A;  5EZG A;  4C3I J;  2CRG A;  3BTL A;  4I76 A;  1POG A;  3K7A J;  5IP7 J;  2Y30 A;  2CJJ A;  2TRT A;  4BBR J;  5IOY A;  2M34 A;  4UUT A;  2NS8 A;  2K9S A;  3OIO A;  5EF6 A;  2HYJ A;  1MSE C;  1RKW A;  2M8G X;  2O9L A;  3ZQL A;  2L7Z A;  2K40 A;  1E3O C;  2R5Z B;  3OOU A;  1ETQ A;  1R9T J;  2L7F P;  5FKN A;  3DCF A;  2L9R A;  1X2M A;  4X6A J;  3BTI A;  1MH3 A;  2DMP A;  2JMW A;  1HLV A;  1IC8 A;  4A3C J;  3BR1 A;  1H89 C;  1ETX A;  2MGQ A;  4S0H B;  4CYC A;  2KDZ A;  4BKX A;  2EZK A;  3OSF A;  2XGC A;  3S2D J;  3E7L A;  3FIW A;  2M0C A;  1IGN A;  2FD5 A;  3ZQH A;  3RZD J;  2X48 A;  2EQR A;  4L5E A;  1JUP A;  3CCY A;  4FE4 A;  4M3D A;  4A3K J;  3BQY A;  5EG0 B;  2QF7 A;  5M3F J;  4C2M J;  2ID3 A;  3HDD A;  4HNV A;  2FX0 A;  3JRB A;  1JJ8 C;  4XRM A;  1JT6 A;  1F36 A;  1A6I A;  3B6A A;  1BJZ A;  2CQX A;  4FE7 A;  2EZL A;  1ETY A;  1HCR A;  2GM4 A;  3GTG J;  3BR0 A;  9ANT A;  3G1O A;  3TW7 A;  4I6Z A;  4AC0 A;  2HXO A;  3RZO J;  1X58 A;  2ELK A;  2M2E A;  4A93 J;  1JUM A;  1VI0 A;  4JX6 A;  2HXI A;  2LR8 A;  3CMY A;  2R5Z A;  1APL C;  1DU0 A;  3BG3 A;  3BR6 A;  1NK2 P;  3ZQG A;  2GLO A;  4UUS B;  1H88 C;  1I6H J;  4D7N A;  2N8G A;  3S1Q J;  2EZH A;  2JN6 A;  5M3M J;  3GTO J;  1MH4 A;  2MG4 A;  2WV1 A;  3MN2 A;  1XC5 A;  3A03 A;  3BT9 A;  4W1U A;  5JLW A;  5FKO A;  4JX4 A;  2CUE A;  2LFB A;  3IH3 A;  3D1N I;  2DA4 A;  2E19 A;  5EDN A;  2FJ1 A;  2XGD A;  1NK3 P;  1ITY A;  3JRE A;  4DYR A;  4A3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...