2KRCA

Solution structure of the n-terminal domain of bacillus subtilis delta subunit of rna polymerase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal domain of Bacillus subtilis delta subunit of RNA polymerase and its classification based on structural homologs
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit delta
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2krcA01
2M4KA 4NC7A 4NC8A 2KRCA
chains in the Genus database with same CATH superfamily
2V6EA 2DI3A 3BTJA 1B59A 2JVGA 1PUFA 2AS5F 1N25A 2E35A 4KNYA 2DMNA 2AQEA 4BXFA 1K78B 3M8JA 4F92B 4D7MA 2HYGD 3HUGA 1QRYA 2V4JC 2X6XA 5BNGA 3IAS2 4N4OB 1P9QC 5E79C 2PX9A 5KAIC 5CVIA 3EUHA 2BE5F 4NDLA 2CYYA 5HLGA 2QSHX 3MEXA 1S5LC 3OOPA 1OFCX 1ON2A 4G9YA 3IH3A 3PL8A 4NNJA 3J80K 3CCUI 1IJWC 1G8XA 4BBSJ 5FD5A 2MBFA 1QZEA 2COBA 3A03A 2H8RA 3VDXA 4XIDA 2X1CA 5EEAA 4EM1A 2HQRA 3DU6A 1UJ8A 4KDPA 1H9TA 2EZIA 4U0WA 3PIPF 5BQTA 3GTOJ 4DYQA 2M8GX 3WU2C 1GV2A 2IAIA 1SVOA 1Q1VA 5HLHA 3HSEA 3JRBA 1XSDA 2VC1A 1JT0A 4XRFA 1XGOA 2OF7A 4C9YA 2A61A 2DMUA 4S05A 2E2IJ 2ZMEC 4RBOA 4GFBA 4Q48A 1APLC 3KZIC 2O03A 5J40A 3TBIA 2RREA 3I3LA 2KDOA 4MIMA 3O8HA 2HOTA 1TT0A 3SZGA 4BQQA 3JRIA 3CO7C 2KJCA 2DW4A 4YRVA 2DDAA 1DPUA 2VIXA 4L5EA 4MTEA 2WWYA 3COAC 3GLXA 1R1TA 4N9IA 1N75A 1XGSA 3CC4I 3TOBA 3EUHC 3IP4B 1GVJA 2Y0MA 1WKMA 1OMIA 2CQNA 3DPUA 2HKXA 5HODA 2YSRA 4ZZLA 1HSJA 4IQ4A 2HNHA 4A3BJ 2FNAA 4ETSA 4RGXA 1V55H 2P5KA 1MBJA 3CUOA 1CF7B 5J1UA 2QM3A 3BCAA 2V1XA 3TEDA 4RB2C 1BJAA 2MC3A 3FXUA 3GFMA 3V8KA 1ETKA 4RB3C 1RZ4A 2BY0A 1H9GA 1TZLA 3DKWA 3ESWB 4LIVA 4DQ2A 2EINH 4UV9A 3HJEA 3OYAA 2R7DA 2KISA 2MC4A 2WAQN 2BBYA 4BEHB 2M1BA 1WJ5A 1FEXA 1YI2I 4O6JA 2DPDA 3FHNA 4KFCA 1ETWA 1FJLA 2W48A 1WRJA 5GPAA 4DGWB 4UUSB 1XMXA 5L3CA 5J8CA 2NS8A 4IF4A 2Z33A 1H88C 2JRTA 1SANA 5ILVA 4MO7A 2YU9J 4EV0A 2IP2A 4GYIA 5E3LA 1W7PB 3OS1A 2R7WA 3MCZA 3K7AJ 1I3QJ 2O8KA 1NK3P 3BTCA 2XRLA 2CQKA 3OS0A 4AIKA 2G0EA 2LVSA 3KP3A 3TW7A 3ZMSA 3WTWC 5BPDA 3OIQA 4Y15A 2DODA 5D6FA 3AG3H 4NQWB 5JLWA 2PJRB 3BJOA 4CGZA 3S2DJ 5E20A 4E7LA 1F43A 4GDFA 2VT3A 4F7ZA 2YX7A 3GTKJ 4DZJA 1VI0A 1S7AA 1D1BA 3FXQA 2DT7B 3HOTA 1U8RA 1R5HA 4OAYA 2ZMEB 5IPAA 2X1DA 4XK4A 2VONA 4DBRA 4BJ5C 4GGGA 4HPQA 5CVRA 1WJEA 1TTYA 2LF8A 1Y39A 3L2UA 3RZDJ 4LMYA 2OZ6A 5CVUA 1ZARA 1TWGJ 1R36A 2OPTA 3WG9A 4KMFA 2PFBA 2DK5A 1SMYF 2KIQA 2L7FP 3H3ZA 3V42A 4TV7A 2EIMH 3HTSB 4BS9A 1FP2A 3BJ6A 3S2HJ 3CLQA 1I1GA 4D5CA 1BW5A 2MFZA 1E2XA 2W25A 4DW6A 5M5YJ 2E1MC 2OQRA 3QYEA 1D1CA 1OR7A 2ECBA 4JQFA 5CQEA 5B5EC 1ZLKA 3GTPJ 2KRFA 3FWEA 4XLNF 4Y17A 1W36C 1WJFA 4RB0A 1Y0UA 3D5LA 4M6XA 4LGWA 1LVAA 2V26A 4AWXB 1X3UA 2KP6A 1U5TC 3LFKA 1MSEC 4HF0A 2VJ5A 2MGQA 4A0ZA 1MJAA 3OYLA 2NXNB 2HI3A 2ZSIB 5M5XJ 4Y3OA 3U9GA 4D1QA 2VLAA 2VBWA 5E17F 1VQ9I 4ESBA 3UKGA 2NVYJ 4MEYF 2Z9OA 4HF2A 1P4AA 1W5TA 2EZLA 4RGUA 2HDDA 3M8EA 5FJ8J 3JAMK 3VODA 2A07F 2BY1A 5J1RA 3IRQA 3K4NA 2K9LA 1JKRC 2NOJB 2BY2A 2EPFA 3QP6A 4LITA 4LG0A 4BE1A 2GA2A 3DXJF 1MH3A 2DMPA 5F04A 1SD7A 1SFKA 3O6BB 4S0HB 4UNOA 3HHGA 2ZKZA 4IKFA 3MKLA 1W7PA 2BW3A 4RMNA 5LEKA 3W6JB 2GAUA 2EK5A 3ECHA 4NB5A 3WGHA 2L7MP 4E7ZA 3I59A 3SFIA 3GWZA 1HKQA 1SMTA 3BY6A 3E5XA 3KP7A 2FJ1A 2EFOA 5E3MA 2QENA 4P1WA 2QEXI 1YHQI 2GXAA 2CQXA 3CCEI 1X2MA 3WTZA 3WE3A 4CZCA 3ECOA 2ACJA 2VQCA 2LK2A 3HOSA 4G7HF 2CW0F 4GYGA 2F48A 4ZDPA 2LKPA 2E71A 3CUQB 3LA7A 3HEFA 3BQZA 3QPLA 1XCBA 3DEWA 2QUFA 3QYFA 1XD7A 2A05A 1MD0A 2OJED 4M3BA 4XM3A 1G3TA 3TL4X 3OMYA 3KP4A 2P5LC 1ETQA 3FXMA 4BAYA 1P2FA 4W1UA 1ZKGA 2UV1A 3JTGA 3S16J 4B47A 4BY1J 3SHFA 2K9QA 1IXCA 3VYSB 3PSIA 5IT9K 1RUOA 3HBLA 2XDVA 5F64A 2H94A 3F23A 2M45A 5JR3A 4B09A 2LDUA 5LRSA 4IO9F 4UY8I 1IO2A 2FA5A 4XSXF 5GAHJ 4JX5A 5CPRB 2V9PA 4BQNA 2AO9A 2HDCA 4IQJA 4FX4A 1W4MA 2H09A 3ML6A 1R9TJ 4A3GJ 4CICA 5FLMJ 4FE4A 5CVVA 1SFUA 1V54H 1ZAOA 3T1BA 1ZG5A 4A0XA 1MH4A 5B66C 2VBZA 4XOTA 1VQ5I 4CA0A 2EZKA 2IT0A 2Y48A 1YX3A 4CZZA 5M3MJ 1FWZA 4ZC3A 1W7PD 3P9CA 3R6SA 2E2HJ 2FBKA 2PLYA 4E7KA 4EJOA 1BC7C 1E3PA 1D8JA 1JUMA 1MMSA 2CH0A 4KICA 3K4KA 3DTKA 4XL9A 4CO8A 2DT6A 1E0EA 1GDTA 4OINF 2HU9A 2O3FA 3P7NA 2JPBA 2G7UA 3I71A 3GEZA 4EJWA 2QLZA 4B8XA 3G1MA 3HOYJ 2DA1A 3AKZA 3MKWB 2LTPA 3H9JA 2P6SA 3VB2A 4LLLA 3WGIA 4HV6A 4Y52J 2M0MA 1G4DA 3HZJA 1LUJB 3KLNA 3V7SA 5IP9J 2DFFA 1K4SA 3I59B 3SQNA 4AU7A 4Q4ZF 2E1CA 2A5YB 2EV6A 3WTUC 3AFHA 4AUXA 5FRMA 4XKVA 1PUFB 6PAXA 1E17A 5DCMA 5EEGA 2L9RA 3HYIA 4PSXA 4F52A 5B3SH 2F5CA 1LVKA 1KA8A 2VT2A 4IOCF 1K78A 3AL0B 2K40A 1HF0A 3KE2A 4AIHA 4LLGF 1P4WA 1W36D 1WZ2A 2DLLA 2HPMA 3NRVA 2VKVA 1I39A 1Z3YA 5FKNA 3OSGA 1U6GA 3D5SC 1GUUA 1LDKB 3HKZN 2DFIA 1FIPA 1FPQA 2KJBA 3QRFF 2EFQA 3BPXA 1AWCA 4UVCA 1PJRA 1JE8A 4YFKF 4FE7A 3BTIA 3TOAA 3ERED 3L1PA 3ZMTA 4IX7A 3BLYA 4HRIA 5DEQA 4ENKA 5DCMB 5HVQC 3BG3A 2R7RA 1IN8A 2L9VA 3HTUA 5C44J 2HGCA 3CCQI 4EJTA 3CCSI 2NVXJ 3IWFA 4FQGA 2M4KA 1ORKA 2XGDA 3H35A 4M6VA 2V1DA 5GAGJ 2V1UA 3ZGKA 1MNEA 1A04A 2DMTA 3CZ6A 5FKOA 2Z5UA 2X6OA 1BOBA 3Q9SA 4YIRX 3M3YJ 1EA3A 3E3VA 5KAFC 2VPRA 1ZYRF 3T0YA 3ZQFA 5J47A 3W6VA 1D8KA 2LNBA 2W85A 1VQOI 5CVJA 2B7EA 2EV0A 2HYFA 2STTA 2RVCA 1R23A 2GIVA 3R0AA 4HA8A 3DLAA 4M3FA 4Y33A 3Q5FA 4UB8C 4YEJA 1X4OA 1WH5A 3LQRA 3I58A 4G7OF 3W2AA 3HRSA 4HF1A 1GXQA 2R7UA 1RR8C 2IA0A 2OU2A 4WXCA 3KETA 2HXIA 3DP7A 3FM3A 3G2BA 4IOAF 1UAAA 3A02A 4M9XA 3DKXA 3W3CA 2JN6A 1UMQA 2L4AA 5GTHC 2A5WA 3D0SA 1YS7A 1X1AA 3DTEA 3QP5A 4NC6A 1ZQ3P 3E1SA 2EQRA 5TRDA 3L2VA 3RCOA 4F91B 5DDGA 1KQ0A 1IRXA 3NWSA 4CYCB 4EJUA 3CJRB 3K69A 4P55A 4ZJZA 3Q0UA 1GVDA 2ICWG 5EF6A 5ILSA 2R7ZJ 4RM2A 3GUDA 3OWTA 3H9QA 3MKYB 4A3KJ 3JR9A 5F0HA 1EKEA 2FEZA 3VYRB 2DA4A 4YIIA 4CYDA 1B1BA 4AIDA 2R7XA 2HVQA 3OYDA 2LC2A 5HLIA 1FTZA 2X0LA 2ZFWA 5M5WJ 3FK7A 2NOGA 2Y31A 2VJIA 5LGUA 4B44A 1W0TA 3JRDA 1T0FC 3PO3J 3C2GA 1T0FA 3FBIB 3TDUC 4M3GA 4ZZDA 5GPCA 1PDNC 2R7VA 5KK1A 2TRTA 3KYCB 4Z6YA 2LH9A 3ZPLA 4ASNA 1TW3A 4YIFA 4XQFA 3TW6A 5EGOA 4HLYA 1FTTA 5L3BA 2RDPA 2HR3A 3IAM2 1OISA 1DDNA 2P4WA 2F4MB 1A36A 3UR3C 5IOYA 4FT8A 2R5YB 1MBGA 4O3MA 1K83J 1VZ0A 1X1PA 3LWFA 3KEQA 1P6RA 5BOXA 2M87A 4HYEA 1ZH5A 3EUKL 3Q0VA 1JT6A 2FQ4A 2V9VA 1IN6A 1Z67A 3SYTA 1RKTA 4PK4A 3VWBA 3WTSC 5HDGA 2F2EA 1L3LA 4JOMA 1VNDA 3OR1C 1IW7F 4KMUX 2IA2A 1SFEA 1MZBA 3OYFA 3A01A 3CP8A 4L9VA 2DFEA 2R92J 2L54A 3ULQB 5D4SA 2IW5A 2CS3A 2WB1N 3KP6A 3JREA 4IVNA 3FHZA 2NRAC 4L18B 1NHAA 3H5AA 4HDUA 3DU5A 3WHBA 2PMHA 3QPHA 3WODF 1KGSA 2EIJH 4BQOA 2DMQA 3CCMI 1UHMA 1KU2A 1TQPA 2ZBKA 4CUGA 4MGRA 1TWCJ 2XPVA 3HIFA 1XS9A 1ZRCA 3RKWA 1X3WB 2HQNA 3PNVA 2R7SA 3O8GA 1WVRA 4RA2A 4P9FA 2CG4A 1CGPA 5LHIA 4G7ZF 4AM3A 5IYDJ 5FRNA 1O3RA 1S29A 1ONVA 3FKJA 2JQ7A 1T98A 1R7JA 2OD5A 3WTXC 2K3PA 4ZYGA 1G59A 1B9NA 4XRSG 4B43A 1G6NA 4BGDA 3BG5A 2HKOA 1WJBA 3OY9A 2XHKA 4XLEA 1LDDA 3ELKA 4BNCA 3L7WA 4J01A 2HOSA 4XKCA 3BZKA 3W2WA 4RGRA 1D3YA 2VQHA 1HC8A 5A2QK 1QU3A 1PUEE 4L0YB 3A2KA 1R71A 3PM1A 2PMZN 4V2GA 1GXPA 1ON1A 4MNUA 4I09A 3K4CA 1WJAA 3VFZA 1XSXA 2QYOA 2W7NA 1TNTA 2LYCA 1I5ZA 3FXOA 4MTDA 4WX9A 3I56I 3H36A 2CU7A 4RGSA 1Z77A 1X1BA 1ZRFA 3LL7A 3HXLA 3RKQA 3HUGB 3TO9A 3VYUB 3HC7A 5J4VA 1RI7A 1EH7A 2ID6A 1OCCH 3GTGJ 3U1DA 2LR8A 2NVTJ 1W5SA 2HZTA 2F5EA 3PNYA 2HTJA 2EFWA 1AA7A 4M73A 3B6AA 2BV6A 4OU0A 2VUMJ 4ZYDA 1JUPA 2RN7A 2IA1A 2W24A 2QSGX 2ISYA 3IUOA 4XNFA 3TMOA 4IHSA 4NBQA 3F21A 3IKTA 2WY8Q 4IXAA 4EJVA 3RQIA 1H89C 2IXSA 2Y30A 5IYBJ 1KU9A 2CW8A 3C7JA 3GVAA 1HW1A 3SZPA 2M3AA 1DP3A 4B1RA 2Z1DA 2MABA 1S72I 1BA5A 2OUMA 3LSIA 1UFMA 4CCLA 4E7HA 1ZGJA 3BG9A 4C2TA 1G2HA 4IHVA 2VN2A 3ZMZA 1SC7A 3DEUA 2EIKH 3QPSA 2LOOA 3L9FA 1MMNA 3E6MA 1YJWI 2Y0SN 3E7LA 3IRRA 3K70D 1YRNB 3EYIA 4HV5A 5FKKA 4C2MJ 1Z6TA 4KUMA 4YG2F 2IGKA 3HB9A 2GIZA 4WK8F 1T95A 2GQQA 3EETA 4FTHA 2JRMA 3BZ6A 5CYVA 3GZ5A 2R7FA 5FKLA 2JT1A 4A5NA 3ZQQA 2DT5A 2QQ9A 1ZLJA 2H1LA 2XRNA 2D5VA 1LE8B 3HRMA 1XSVA 4RB1A 2E7XA 2KMUA 3RPUA 2XAQA 3JTHA 4A5MA 4HQEA 3K10A 2X85A 2GXBA 2AHQA 2DO7A 3ASOH 3CC7I 3HL2A 1N77A 1IV6A 4G6QA 3P9IA 2X9DA 1IUFA 2LFBA 5TJJA 3ROUA 1YYVA 2WC2A 4BACA 5KHDA 3BOQA 3S14J 3RPUD 1JJ8C 3HOXJ 2LD5A 5IOZA 2DYSH 3F8MA 3GBGA 1IXRC 2CSOA 2I5UA 1X1DA 3B02A 5AIQA 3DPTA 1P92A 4DZPA 3L09A 2PMZA 4PFOA 5DM7F 4J19A 5D5WB 1T8IA 2DOAA 3FMQA 1VF9A 2G9WA 3A0BC 1IV8A 4UB6C 1HDDC 1MBEA 1XX5A 2ZB9A 3TQNA 1BC8C 1JUSA 4GRIA 3PSFA 4BQAA 1T2KA 2QQAA 3H5RA 4I98B 1ZREA 2CMPA 1MMGA 4YFXF 1A31A 1D5VA 3QPTA 2Z99A 3D5RC 2MSYA 3E0JB 4L5JA 1V5GA 3ABLH 2M7BA 2WAQA 4LD5A 3JRGA 2D45A 1OYIA 3AAFA 2YPRA 3J7AO 1IN4A 2ZNZA 1Q1HA 3CQZJ 1H0MA 4ABZA 2RGVA 1I6XA 4XKBA 1ZTRA 3GW2A 1TL8A 2KRCA 1Y0NA 2DXIA 3GLLA 4PSWA 3GTMJ 3OOUA 2ESNA 3QU3A 1K61A 3JRFA 1DP7P 3KCCA 3ABUA 3TGNA 2R7OA 3CTAA 4UVBA 2WB1A 2ZXWH 1VQNI 3HDDA 3N4MA 3KEYA 3FXLA 2LREA 4XN0A 3DWLE 3FX3A 4H0EA 2Y0SA 3I4PA 4D9JA 3ZXSA 3IH4A 1QNTA 4R1HA 4IRGA 3PO2J 2JA2A 1JGSA 1UCRA 4II2A 2DOFA 2A68F 3MFKA 2W1OA 1OKRA 2B0LA 1Y8QB 3CDIA 4EM0B 2ISZA 1HQCA 3K2ZA 3DTIA 4PGHA 3PIOF 1AKHA 3ZQLA 1EH6A 2R0QC 4L9JA 2QKMB 1A5JA 3K1MA 1TW2A 3ERMA 2DTZA 1BIAA 2FE3A 1IDZA 4HLXA 3F22A 1YFHA 1LEAA 3VSKA 4JX4A 2JSCA 3SZTA 1YJ9I 1JKPC 4XOPA 5KNLA 3HOUJ 3I4NJ 1Z9CA 1D1AA 4C3IJ 3I5UA 1JKOC 4A69C 1JKQC 2IS1A 3QU6A 2KZGA 1DUXC 2RKHA 3J7ZI 2JPCA 3BJAA 5E3OA 2PQ8A 4LLNA 5F6FA 1X2NA 5FD6A 5GP9A 1DU6A 5J3LA 1LFBA 2XAGA 3TKYA 5E18F 2E36A 3LSHA 2PJPA 4DYCA 3G71I 2CW7A 2XF6A 5EZHA 4IHXA 3GF2A 2MYSA 4G94A 4KYWA 2J5OA 3F72A 3ASNH 1YX5A 5F08A 5LD2C 4FETA 4IHYA 3OYCA 1I6HJ 1AOYA 3R0JA 2K85A 1J0RA 3GZNB 1WJCA 3OL4A 1NTCA 2AXTC 4XLHA 2HVRA 2V9KA 1FNNA 5K7ZA 3HOVJ 2Z16A 1OPCA 1XDUA 3PFYA 2CWEA 1I50J 1OCPA 3O2PE 5J6XA 1ETXA 4JK1X 3S1QJ 1MMDA 5F1JA 2XROA 1P7JA 4AVZA 2VXDA 3WU0A 4L9TA 3FXRA 2VBYA 1VQMI 1FYMA 1V5FA 1MDMB 3GFJA 3MQ0A 4L0ZB 2F6CA 3LFUA 2M30A 1T33A 4PJNA 4LG0B 2DA3A 2VKEA 1MBKA 5D5XB 4II3A 4XICA 4E7JA 4N0BA 3CC2I 3EDPA 3K1PA 1WHUA 2KKOA 1L0OC 4HNTA 4EATA 2KHMA 4OIPF 3F3XA 1ZELA 3CMEI 2ELJA 3OSFA 1FBSA 1XB4A 1YIOA 2IGMA 2N8GA 2ZXHA 2BHZA 3H1CA 4G12A 4HW0A 1HA8A 2OA4A 5H6RA 5TISC 1YITI 3F9KA 3PFIA 5B1AH 4LFUA 4GCVA 4E70A 4B3XA 4A3CJ 4A3FJ 3LAJA 4MFEA 2EH3A 2M9HA 3EQLF 2A3SA 5LBQA 2F5DA 4EEFG 3F0CA 5FFXA 3ZMVA 1FC3A 1SFOJ 3GX4X 2LP0A 3G6EI 3B6CA 3ZQHA 1YW7A 3LOCA 1S6LA 3G4SI 1Z3XA 4OAZA 2GXGA 1JTXA 3FXKA 3RI4A 2L7KA 2BVMA 4BBRJ 2WBMA 3FKIJ 3KYDB 1TQMA 3SDBA 4NQWA 3ZMUA 4OIOF 1QVTA 3CCLI 3ZOBA 2LY2A 1X19A 4HG2A 2K4JA 3P5JA 1X3ZB 1IG7A 1QBJA 4M9ZA 2I8DA 1OCZH 1IC8A 1T56A 4PFPA 1ZGAA 2PBIA 1YOVB 2JVHA 1R4MB 2KQRA 1T08B 5ILUA 4RAGA 4Y7NJ 1JJ6C 1YLFA 3IH2A 1Y1VJ 3QODA 3GCMA 1BI3A 5L3FA 1WI9A 3WHCA 5J4YA 3BR3A 3RDIA 3N97A 4I2OA 3SEZA 4DYRA 4FX0A 1REPC 5ED4A 2RAEA 4HAMA 2LLKA 2E2JJ 2HPIA 2UZKA 3CMYA 3OYBA 1FBQA 3BR2A 1KONA 5LGNA 2FBIA 3SEQA 3LNQA 2WV1A 3E5QA 2RQPA 4ZDLA 3SXYA 2GBYA 1BW6A 3CLOA 4CSWA 2JUGA 3A01B 2E1NA 4ZTFA 3CCVI 1WH7A 2CO5A 4WCGA 5HDNA 2XASA 4AVPA 5HS7A 5DUIA 4A3EJ 2FNPA 5IP7J 2ZJ2A 2V6CA 2STWA 4CYCA 1CQTA 1KQ8A 2LY1A 4N4NB 4QIWN 3J81Z 2OCCH 2KIUA 3CDLA 3DFGA 2JZYA 1I27A 2EB7A 2Y9ZA 3HG9A 4BE0A 1HBXG 3REOA 3I55I 3A4CA 5F27A 2CV1A 4KT6A 2Z2SB 2VB6A 4UVAA 1G3YA 1O57A 3CP2A 2ZSHB 1J9IA 1JXSA 3K1NA 2V79A 2PEXA 3OYKA 1QQIA 1XC5A 1OCOH 1OYWA 2E7WA 2XVCA 2IJLA 2JUCA 2KRHA 4CH7A 5E8IA 3JSOA 2IRFG 3QAHA 1QVUA 2ELHA 2UXNA 4EQQA 1XG1A 4D5FA 1KZHA 4A12A 4LJZF 2W82A 3MN2A 4RAYA 1IRGA 2IEKA 4EM2A 3CCRI 2HQAA 2A6TA 2EV5A 2DN0A 2NAZA 1D5YA 2OTLI 2M8EA 3LSMA 5E1WA 5D5VB 5LLQA 4ZYHA 4CCMA 1TP4A 4A93J 3CCYA 3RKXA 4BXUA 1RNLA 2OV7A 2E5NA 3PQKA 4M74A 4EGZA 2HZDA 4C2UA 4BE2A 1B72B 2FF4A 5L3GA 2F5VA 5IT9Z 4KITB 1HW5A 2CQQA 3CUQA 1U78A 2YX4A 3GTQJ 4I76A 3ZMDA 4I0BA 4KIGA 1ACIA 2DA2A 3WE2A 3IL2A 3MVPA 3U1KA 1ETOA 3W6KB 3CJQB 3L2RA 3LSTA 5EEHA 2X1EA 2VODA 1WGXA 1TNSA 1OYYA 3J7AY 3ABKH 4QWQA 4OOIA 3E6CC 1QO0D 3T5XA 3S2WA 2VJ4A 1LE8A 3CMMA 1S3JA 2XKPA 4V2FA 1U3EM 1SD5A 3QOEA 3BG7A 4EVIA 3AG2H 3RIRA 3F6VA 1QPMA 1YW9A 4CCOA 2O61A 4ENJA 4IL6C 1XGNA 1IZ1A 2YR2A 1X1CA 4BJ6C 1C0WA 2L3DA 5K5RA 2CUFA 2KL4A 2NS7A 4CCNA 4ZYEA 4I02A 3LQQA 4RLFA 2DOEA 3FZVA 3DBHB 1ODDA 2XAJA 3TO6A 3BG6A 4B4CA 3V7RA 3H0DA 4WF2A 3IC7A 1DQUA 1FIAA 1YS6A 3BP8A 3HSRA 2PG4A 3A0HC 1Z0XA 1U8BA 2ETHA 2X4HA 3AG4H 4DJAA 4HSRA 3L2CA 3R61A 4R79A 4HQMA 1UG0A 4EMSA 1WSUA 2XAUA 5BPIA 4KT5C 4A3JJ 3GFIA 3MAJA 2NVQJ 3ZQGA 4A3DJ 3HSFA 1WCMJ 3W2VA 3S3MA 1MW7A 1KYZA 1NH3A 5D4RA 3R60A 2UWMA 1R00A 3E6DA 1RRJA 3PQJA 2OCEA 2L0KA 3M1CA 1SEUA 1R58A 3WTVC 1ZG1A 2F4OB 2P7CB 2CUZA 1OCTC 1TQIA 2D2WA 2LKXA 2CV2A 1OLTA 1B8IA 1R6RA 2O9LA 1V5EA 3S93A 4B3AA 2CFOA 5CKTA 1BR2A 4E7SA 2ZJRF 1RUNA 4LB5A 2VOPA 1HSTA 4Z2YA 5K7FA 2HVSA 5JVGF 4ZTJA 2M7AA 2VL8A 1MGTA 3HKZA 4R8HA 5ICGA 1UELB 2DBBA 1I1SA 1YW8A 2CUJA 3ABTA 4AYBN 1MIJA 1J59A 1IF1A 4U88A 1ZN2A 3S1MJ 2O6GE 1F36A 5LEJA 4XRMA 2KIFA 1DU0A 1XDSA 4RAFA 1JHHA 3CUQC 2KLOA 4PGGA 5E1XA 1YIJI 2D1HA 1R1VA 1U5TB 1YO5C 3DEEA 1ITYA 4FHTA 3TDZC 5M3FJ 1WI3A 3ZRGA 5FLVA 2OBPA 2FQ3A 1TWFJ 5FB2A 1YRNA 1GHCA 2VE9A 4AIJA 3KP5A 4MQVA 1HLVA 4YELA 4E4HA 4BEHA 3NAUA 4IRIA 3Q3SA 1RC9A 1H8AC 3K2AA 2KDZA 4XRSA 2MG4A 3CMAI 1BI1A 2FBHA 4ESFA 5IYCJ 2Z3YA 2IVMA 4M6YA 3BWGA 1W0UA 2KIMA 2ZO4A 1J5YA 2QSFX 3S15J 4Q5SF 2EA4A 2Y2ZA 3M7GA 1EJ9A 2ID3A 5AONA 2LG4A 2H6BA 4X0GA 2H1KA 2BHYA 1LPQA 2D1VA 4IPAA 5ICCA 2LBFB 3TP0A 1HCRA 4U7DA 2RQQA 4IZZA 4U0VA 2R7TA 3C3WA 2GOXB 1RESA 3HGYA 1IGNA 2H27A 1ZG3A 2TCTA 4BDYA 1A6IA 5JHUA 1TC3C 2QWWA 5HNHA 4L9NA 1J7KA 5DCFA 1Z05A 1EF4A 4DIQA 1QPIA 1A6QA 3BROA 3S1RJ 1D0YA 2BYVE 3DBLB 1YTYA 2VKDA 5GTIC 4AD9A 2L9NA 1LFUP 2WTEA 1W5CC 4E7IA 5DS9A 3RZOJ 2DK8A 3FK6A 2KFDA 1IRZA 2AXLA 1QGPA 1UZCA 4J00A 2L7ZA 5ERIA 4HNUA 2ADUA 5HOOA 1R49A 1HKTA 3S32A 1VQ6I 3SDGA 4GXOA 2H6CA 1J09A 1D0XA 1LKXA 2WV0A 2JJ7A 5LRRA 3CJNA 5H2FC 1JHFA 2BW3B 1XN7A 3I0TA 5BMZA 5JLXA 2MLGA 3QOPA 1DGWY 5DUKA 2UXXA 1RKWA 4RDUA 4JX6A 4BUPA 2IPQX 4CCJA 3E5UA 4I6ZA 1YJNI 5TGTA 1SAUA 1RETA 2XGXA 4F93B 4I01A 2QBYA 2NVUB 4NHJA 3OL3A 5DV5A 2M2EA 4L5IA 4ESJA 2OTJI 1MJ9A 2JA5J 3PNTA 5D6EA 4I0AA 3LSKA 1N78A 1RR7A 4QPQA 4P5OA 3BR0A 1UHSA 3CO6C 1LJ9A 1NG6A 2EILH 3MZHA 4IJAA 3OS2A 4BHBA 4LK0F 4A6EA 2QKLB 3JW4A 3S3NA 5EG0A 1OCRH 4D0PA 1XCVA 4IEJA 2DPUA 3LA2A 2XUBA 1AKHB 3SJMA 5E1ZB 2Y75A 2NNNA 3EPZA 3RKYA 3LSRA 2DJNA 1KU3A 2DQLA 2CQ7A 2DDBA 2K86A 1Z6RA 3M07A 3M8FA 1BOAA 3ZQCA 4H4KC 1SVMA 2DYRH 3BCBA 3BR5A 3LSJA 2HOEA 1Z91A 3E6BA 2PN6A 2L02A 4CXFA 1AU7A 2MH2A 3VEPA 4LIUA 2XF7A 4E6KG 3JRCA 5GADJ 1MSFC 1ETVA 1PP7U 4PUSA 3J80Z 3AG1H 2XIGA 2WAEA 2Y9YA 3HOWJ 4DBQA 1U2WA 4OMYA 2JMWA 1F4KA 3OYGA 2ME6A 3BC8A 4ENMA 2ZXJA 2ME0A 4F55A 3DF8A 5HDKA 3ZN0A 2JA8J 2K9SA 4CHUA 2FOKA 3ZN1A 3L00A 4ITVA 2LSOA 2I10A 4UHTA 5DD4A 3OYIA 2BY3A 4KN7X 5FFZA 2P7VB 3FM5A 4WXHA 3A1YA 3KPHA 3ZP5A 4IRHA 3Q9VA 4WWCA 2GWRA 2A6EF 2ZFUA 3OIPA 1VQ8I 4HDVA 5KVRA 4RLQA 3HPGA 3HOZJ 3QQAA 3OIOA 4HSTA 4G6TB 4I99C 1YE9A 2P5VA 2XAHA 1FSHA 3PUFA 3GTLJ 2DU9A 1BR1A 2WA0A 2F4IA 4UUTA 3F8BA 3F8NA 1ULYA 3GTJJ 3WTTC 1IUYA 3MMYB 1FY7A 5FO5A 5JI6A 4XORA 2NNYA 4A0YA 4BU2A 4XKWA 2AQFA 2J5PA 2MLKA 3WU1B 1Y56A 2KPMA 2JA7J 2E19A 3FF5A 5FGMA 3U21A 2HOAA 2BVLA 3PUBA 5GAEJ 5DTDA 3FIWA 2B9SA 5FLXK 1S8NA 2R5ZA 2QA4I 4G8XA 5EJCA 3LA3A 3GMEA 4UUSA 1PVEA 3RQ4A 3Q0WA 4HBLA 1USSA 2QBYB 5IP6A 1WPKA 4A6DA 4LG3A 3LSPA 4JBAA 1VFCA 1FSEA 2MW8A 1MKMA 2OQGA 3S1NJ 5L3DA 1UB9A 2Q8KA 1BIBA 4PJLA 4IHWA 4XLAA 1TWHJ 3IKVA 3MD2A 2QF7A 4FASD 1YQAA 2XPWA 1HOMA 1Z1DA 3TO7A 3S8PA 1ZRDA 1FOWA 3K9TA 1VTNC 4AC0A 1Y8RB 2MA3A 3JRAA 1FX7A 1OR7C 4ZH4F 2HTSA 3VYTB 2XAFA 1E3HA 1U9NA 1S7EA 4YFNF 1A35A 1ZR2A 4HX4A 4M72A 2ZXIA 4OIRF 4HOBA 4X1EA 2Q0OA 2IGOA 2IS2A 2FU4A 3WTYC 2BXYA 2RV8A 4AYBA 1F9NA 2L2OA 3I9V2 2EWNA 3C2HA 3V8LA 4X6AJ 5JFRA 2HDWA 1EH8A 2HFHA 2R3SA 1O3SA 2QCOA 3O3KA 4LB6B 2PJRA 3M4OJ 3DQVC 1ZGWA 3BTLA 3CF2A 1BL0A 1XTAA 1MMAA 1ETYA 3RSNA 1Z7LA 3KIOA 1F1ZA 3DBRB 1Z7UA 5IY5H 3WG7H 3FMSA 4C3HJ 3B73A 4GO1A 1UHWA 1ZHFA 3V4GA 9ANTA 1HKSA 4XBFA 1KYWA 3E97A 1U9OA 3BT9A 4A3LJ 1T6SA 1SFXA 5DYMA 4XMYA 3H3VK 3HRUA 3IV5A 2QGUA 2X6WA 3WGGA 2IS6A 3T8RA 3K4MA 1MDMA 4G6DA 5H20A 5LHHA 2XC7A 3LAPA 1OQYA 3QWLA 5J8FA 2HEOA 3OV8A 3HPHA 2EFNA 2CJJA 2VBXA 5HLTA 2MH9A 2B63J 1O7FA 5DM6F 2QVOA 1O3QA 2V1NA 3GXOA 5C4JJ 3J81K 1ZR4A 1R5ID 4HZFA 2R4GA 4KIBA 1F5TA 4PDKA 3GFLA 3H0GJ 3RYRA 2K9MA 5JHFA 4JP0A 3KZZA 2FX0A 2OZUA 2DQRA 4OWRB 2IBDA 2HWVA 1XGMA 3FBNB 3D1NI 2VPLA 2YU3A 3I4MJ 2EJRA 5D5UB 1X58A 2QQ8A 2H8WA 2E60A 4MLOA 1V4RA 4OMZA 4RS8A 5FKMA 2R93J 2A6HF 2VASA 2O5RA 1FP1D 3I54A 1PP8F 1QZZA 2ECCA 3BDDA 2ESHA 3S3OA 1CF7A 3JRHA 5J1YA 4FISA 1LQ1A 2HS5A 1WJDA 2ZMEA 5K7HA 1V3FA 1T39A 2R7QA 2DA7A 4O5VA 4W97A 5CJ9A 1QA6A 2VOOA 1ERDA 2IGNA 3JAMZ 2X51A 4DOZA 1YG2A 3KZYA 5HS8A 2KZVA 5EGOB 3H92A 4NUBA 1R22A 4XLPF 4U7BA 3G1OA 2E5ZA 3KEOA 1MBFA 4HNVA 2A69F 5FROA 5HNFA 1QHGA 2K4BA 4M3EA 3I64A 1Y1WJ 3M1EA 4ZDOA 3K0LA 1B9MA 1WWXA 3K4JA 3I53A 1LEBA 4PJ0C 4A2UA 1FOXA 4BKXA 2XB5A 1M1EB 2P0WA 4MEXF 4BY7J 2JTVA 2WAFA 1IAWA 1P7IA 3HM5A 2L9SA 4KN4X 3DLLF 1U5TA 2LRDA 1BJZA 3M9AA 1VQKI 1BM9A 1O4XA 1MNMC 1BN5A 2LMDA 3ZCOA 5B1BH 1FYLA 3DKYA 1BBYA 5EG0B 3ZQ7A 3OYEA 2K02A 5L3EA 4ON0A 3VOEA 4C30A 1LNWA 4HX7A 4M3DA 3F8CA 4CDGA 5E3NA 2X48A 2ZCWA 3S17J 1FMWA 3NARA 2M0CA 3C2BA 1T38A 2HQ5A 1O7LA 2FD5A 1VQ7I 2CRGA 2E34A 3HRTA 5EYRA 4XN3A 4MHGA 4UUVA 5DD8A 3RPQA 4OIQF 2DCEA 2E1OA 1R1UA 1R4NB 2BGCA 2EFPA 3V7CA 3JSPA 3IHUA 1J2XA 3EYYA 2W57A 2K7LA 3FMRA 4MFDA 4Y4RA 3L2WA 3GZ6A 2M5WA 3G1LA 3CESA 5BS6A 2V7FA 4KIFA 1K7AA 1O3TA 3H5NA 4LOCA 2WADA 2Q2EB 3OYNA 4P9UA 4ENNA 2VKHA 4XR6A 3KYLA 2GZWA 2TDXA 1STZA 3CD6I 1SD6A 2FUG2 4HX8A 2RC4A 3NWTA 2DTRA 2LF7A 3ZR8X 3OYHA 1B4AA 5C4XJ 2XKOA 1S7OA 1USTA 4U0YA 3OR2C 1KU7A 1IRFA 1BI2A 2BEOA 4MQ9F 2W4SA 1RPWA 2XF5A 2W00A 3FDYA 2G7HA 2C6YA 5D8LB 4BDZA 1VQPI 2VJJA 1MBHA 1S9HA 3KFWX 5ICEA 3MZYA 2DAOA 2XPUA 2BZTA 1VQLI 4B48A 1B6AA 1SVLA 2Q2EA 1ZK8A 2PI0A 3U2RA 4U87A 3MZ8A 3MWMA 1J75A 1FLIA 3BR6A 2GLOA 2COMA 2ZNYA 4WXDA 5F1RA 1ENHA 1LB2A 1X4PA 3FXJA 2L5QA 2GM4A 2XV4S 1K6YA 2LKSA 1HDPA 1IN5A 1E3OC 3VSLA 4ZYAA 2VE8A 2KT0A 5F0FA 4M9SA 1FT9A 4BJTA 4CCKA 5FLXZ 5LGTA 4QPOA 2Q1ZB 1TLHB 2CFXA 2NS0A 2OC6A 3HHHA 2DA6A 2VQGA 4UV8A 3JCUC 1W1WE 4KA4A 1I3AA 2VQLA 3LMMA 4Q47A 2DA5A 2LBFA 3FISA 3IWZA 3RTRA 3L2QA 3H9GA 3X2QH 1XMKA 1IN7A 4A3MJ 1QZYA 3VPRA 3K70C 3SFZA 1GT0C 2BXZA 1JGGA 5E8GA 4V19K 2R5YA 1Y6IA 3HGGA 4NC8A 2M4GA 1EV7A 1G3WA 2M34A 3LSGA 2RNGA 4BHCA 3AL0C 2EZHA 2ZJQF 2FMLA 1DPRA 2O8XA 4I7HA 4BL0B 2EBIA 1BR4A 1FMVA 3ONQA 4BHPA 4PZJA 2WY7Q 3BZCA 5K5OA 5ICFA 1TWAJ 4C3JJ 1NK2P 3K4LA 4F3QA 4K2EA 2NYXA 3RJPA 3K6GA 1RIOH 2DJIA 2UUZA 4BYYA 1U0JA 2P81A 3CF5F 1B72A 4ANJA 1DGRM 2OAZA 2JA6J 4S04A 3EUAA 3J7YJ 2MD5A 2VXZA 1D0ZA 1IXSB 2XGEA 3C18A 3RYPA 1JI8A 1Z21A 5C3EJ 1TBXA 4PCQA 4KJZA 4DNCA 5K1YA 5CLSA 3PJRA 1GV5A 1WQ2A 2XGCA 3ISPA 5CQGA 4M71A 2FXAA 5F0CA 3OYJA 2L01A 4XSZF 1WFXA 2HXOA 2QZ8A 2ZC2A 4A3IJ 4XONA 3CCJI 1UG2A 3F6OA 2BOLA 1MNDA 4FCYA 5A2QZ 5EDNA 1MJBA 1KQ9A 4HEA2 2P6TA 1FBUA 4NC7A 4XLCA 2K9NA 2GOMA 2O0YA 5K5QA 2JWTA 2YUSA 3NEUA 1TT5B 2XSJC 1B8IB 2O7OA 3C1DA 5AIPA 1BI0A 3NQOA 3OYMA 2JSPA 2ELKA 5EZGA 2HYJA 2LY9A 4JYKA 1P4XA 1JTYA 3KLOA 1NG7A 3GYHX 4XLFA 2CGPA 3T8TA 3TP3A 3QYBA 5D8KB 1OJLA 1LFPA 2EA2A 3DV8A 3DCFA 1POGA 2K27A 1K4TA 5H6QA 1VQ4I 1FZPB 4BH9A 3GO5A 2IS4A 4P96A 3F8FA 2K3FA 2E1MB 1K6OA 4PJJA 3KP2A 4LK1F 3KX2A 3BQYA 5IT3A 2FRHA 5JVTA 3N05A 2X6YA 1AHDP 4D7NA 3ZQIA 3BR1A 1K79A 1FYKA 1IDYA 3CDHA 2P8TA 3R4KA 4BXXJ 1SD4A 4RM3A 4N9HA 3DPLC 4KISA 3K4BA 4QLCU 2L4MA 1LDJA 2F5FA 3V8JA 1PYVA 2R5ZB 1G3SA 3UNGC 2XB0X 5KCMA 2GA1A 2RNJA 2XSDC 2YS9A 3MKZA 2PMUA 1GLNA 4QTRA 1XPXA 3ABMH 2W84A 3H3UA 2FMYA 1FOKA 5LHGA 1QHHD 2Y69H 3BPVA 3G3ZA 1XMAA 4EGYA 2JK3A 2DFHA 5HS9A 4UXNA 2MD0A 5LFAA 4IHTA 2ZJPF 2FSWA 2VC0A 3P9KA 4Y13A 1HXDA 2FOWA 2VI6A 3CJTB 4RAZA 2CUEA 2QQBA 1SAXA 4PJMA 3G73A 1FOYA 4QSHA 2K5CA 1HW2A 1R5GA 2CV0A
chains in the Genus database with same CATH topology
3DKXA 3W3CA 2V6EA 3F9KA 4RLQA 2A5WA 3HPGA 2JVGA 1X1AA 4B3XA 3DTEA 4G6TB 4HSTA 1YE9A 2AQEA 4BXFA 3E1SA 3M8JA 4F92B 3L2VA 3RCOA 4F91B 1BR1A 2WA0A 2F4IA 1IRXA 2V4JC 2X6XA 3NWSA 3IAS2 4N4OB 1P9QC 3CJRB 4ZJZA 3MMYB 4XORA 4RM2A 1Z3XA 4OAZA 4BU2A 3OWTA 4XKWA 2L7KA 2AQFA 3H9QA 3MKYB 1Y56A 2BVMA 2KPMA 2WBMA 3U21A 4NNJA 3PL8A 2BVLA 1G8XA 3SDBA 3PUBA 3VYRB 2LY2A 1X19A 2HVQA 3VDXA 3OYDA 2LC2A 4HG2A 2X1CA 2R7XA 3DU6A 3RQ4A 2VJIA 2I8DA 4B44A 1T0FC 4PFPA 3C2GA 3FBIB 2R7VA 4LG3A 2JVHA 2KQRA 2LH9A 3QODA 4XQFA 3IAM2 4C9YA 3UR3C 4PJLA 4XLAA 1VZ0A 3MD2A 3SEZA 4FASD 3TBIA 2RREA 3I3LA 2KDOA 3S8PA 3EUKL 1TT0A 3SZGA 1OR7C 4BQQA 3SYTA 4PK4A 3VWBA 3VYTB 2HPIA 4YRVA 2VIXA 4JOMA 3OYBA 1N75A 3OR1C 2ZXIA 3EUHC 1KONA 2IGOA 3IP4B 2IS2A 3SEQA 4AYBA 3OYFA 4ZDLA 3CP8A 2L2OA 3I9V2 3C2HA 4CSWA 3DPUA 2JUGA 4ZTFA 2HDWA 2CS3A 4IQ4A 2HNHA 2PJRA 3DQVC 3H5AA 3DU5A 3CF2A 4BQOA 3BCAA 1MMAA 3RSNA 1Z7LA 2LY1A 4N4NB 4CUGA 3HG9A 4LIVA 4BE0A 1TZLA 3A4CA 4XMYA 3PNVA 3OYAA 2R7SA 2CV1A 4KT6A 2MC4A 2Z2SB 2VB6A 2X6WA 3CP2A 2IS6A 2ZSHB 4BEHB 5FRNA 3OYKA 1WJ5A 3K4MA 2XC7A 3FKJA 3FHNA 2K3PA 4DGWB 1G59A 3HPHA 2KRHA 5HLTA 4B43A 4CH7A 4BGDA 1WJBA 3OY9A 2W82A 2V1NA 4XLEA 4J01A 2HQAA 3OS1A 2R7WA 2R4GA 4XKCA 2A6TA 5JHFA 3W2WA 2K9MA 2VQHA 1QU3A 3LSMA 4OWRB 3A2KA 3OS0A 3FBNB 4CCMA 2VPLA 3K4CA 1WJAA 3OIQA 2W7NA 2OV7A 2LYCA 2E60A 2E5NA 4MLOA 4NQWB 2HZDA 2PJRB 2VASA 2O5RA 4C2UA 4BE2A 4E7LA 3S3OA 2F5VA 4KITB 1WJDA 1X1BA 3LL7A 3HXLA 2R7QA 3HUGB 1D1BA 3HOTA 2DT7B 3VYUB 3HC7A 4OAYA 2X1DA 1ERDA 2IGNA 4DBRA 4BJ5C 2K5CA 2X51A 4DOZA 4HPQA 1WJEA 2KZVA 4NUBA 3CJQB 3PNYA 3L2RA 3L2UA 1AA7A 2X1EA 4U7BA 2E5ZA 3J7AY 5FROA 5HNFA 3IUOA 1QHGA 4XNFA 3TMOA 2VJ4A 3CMMA 4ZDOA 2WY8Q 3QOEA 3V42A 3K4JA 3BG7A 4BS9A 1UAAA 2P0WA 2WAFA 2IXSA 4CCOA 2CW8A 2MFZA 2L9SA 2M3AA 1X1CA 2E1MC 2LRDA 3QYEA 4BJ6C 1D1CA 1DP3A 2Z1DA 4JQFA 5CQEA 2MABA 2KL4A 2OUMA 3ZCOA 4CCNA 3DKYA 1WJFA 1W36C 3D5LA 3LSIA 4RLFA 3OYEA 2V26A 4CCLA 4E7HA 3BG6A 2KP6A 4C30A 4C2TA 3H0DA 1DQUA 2VJ5A 3OYLA 1FMWA 2LOOA 2ZSIB 4Y3OA 4D1QA 4DJAA 4HSRA 1MMNA 2VLAA 4R79A 1UG0A 2XAUA 4XN3A 3K70D 3W2VA 2DCEA 2IGKA 1T95A 1MW7A 3S3MA 3K4NA 2K9LA 2UWMA 2NOJB 3M1CA 4Y4RA 4LITA 3ZQQA 3L2WA 4BE1A 3CESA 2CUZA 2CV2A 2V7FA 1OLTA 1R6RA 3H5NA 1V5EA 2KMUA 3S93A 2CFOA 5CKTA 1BR2A 1SFKA 4E7SA 2WADA 2HVSA 4IKFA 2Q2EB 3OYNA 2BW3A 4ZTJA 2VKHA 4RMNA 4XR6A 3KYLA 3K10A 2X85A 2FUG2 3HL2A 1N77A 4E7ZA 2M7AA 2VL8A 3HKZA 3NWTA 1UELB 2CUJA 3ZR8X 3OYHA 4BACA 5KHDA 4P1WA 3OR2C 3RPUD 4CZCA 2W4SA 2XF5A 2VQCA 2W00A 3FDYA 3HOSA 3GBGA 1X1DA 3DPTA 4BDZA 2VJJA 1S9HA 2PMZA 2KLOA 4PFOA 4ZDPA 2DOAA 3DEEA 4B48A 3ZRGA 3QYFA 4U87A 4GRIA 3PSFA 4XM3A 3H5RA 4YELA 3TL4X 2CMPA 1X4PA 4BEHA 3OMYA 1MMGA 2L5QA 4E4HA 1K6YA 3D5RC 2UV1A 3VSLA 4ZYAA 4B47A 3E0JB 4CCKA 4BJTA 1V5GA 2M7BA 4QPOA 2Q1ZB 3VYSB 2WAQA 3PSIA 2OC6A 2XDVA 2VQGA 2LG4A 4X0GA 2VQLA 3LMMA 4XKBA 2LBFA 3L2QA 2KRCA 3RTRA 3H9GA 5CPRB 2DXIA 4PSWA 2LBFB 3K70C 3OOUA 2RQQA 4BQNA 4IQJA 4IZZA 1Y6IA 2R7TA 4NC8A 2M4GA 2R7OA 2GOXB 3LSGA 2WB1A 4BDYA 2RNGA 3AL0C 5HNHA 3KEYA 2LREA 4XN0A 3DWLE 4XOTA 4CA0A 4BL0B 1YX3A 2Y0SA 4D9JA 4DIQA 3ZXSA 1BR4A 1FMVA 3ONQA 4ZC3A 1D0YA 2WY7Q 2JA2A 4II2A 2VKDA 2L9NA 3K4LA 2W1OA 4E7IA 4F3QA 4E7KA 3K6GA 2DJIA 3DTIA 2UUZA 2CH0A 1E0EA 3K4KA 3DTKA 4XL9A 2DT6A 2QKMB 1U0JA 2HU9A 4ANJA 4J00A 1DGRM 4HNUA 3EUAA 5HOOA 2VXZA 1D0ZA 3VSKA 3S32A 4XOPA 3AKZA 5KNLA 1Z21A 3MKWB 1JI8A 1J09A 4KJZA 1D0XA 1LKXA 1D1AA 3H9JA 3PJRA 5CQGA 3OYJA 2IS1A 2BW3B 1WFXA 2M0MA 1DGWY 4XONA 4BUPA 4CCJA 2BOLA 4AU7A 1MNDA 5TGTA 1SAUA 4HEA2 4F93B 3AFHA 4NC7A 4XLCA 5FRMA 2GOMA 4XKVA 4PSXA 4F52A 3OL3A 1LVKA 3LSHA 2XSJC 3AL0B 3PNTA 1W36D 3LSKA 2CW7A 2XF6A 2HPMA 3OYMA 1N78A 2MYSA 2JSPA 4QPQA 4P5OA 1YX5A 5LD2C 4FETA 3OYCA 1NG6A 3OS2A 2QKLB 1Z3YA 3S3NA 1NG7A 1WJCA 4XLFA 3OL4A 4XLHA 3D5SC 1LDKB 2HVRA 2V9KA 3QYBA 1LFPA 1PJRA 2Z16A 2IS4A 3PFYA 3EPZA 4IX7A 3BLYA 2E1MB 4HRIA 4PJJA 5HVQC 3KX2A 2R7RA 4H4KC 3BCBA 1MMDA 3N05A 2X6YA 4AVZA 2VXDA 4LIUA 2XF7A 2M4KA 4E6KG 3H35A 4PUSA 3ZGKA 1MNEA 3CZ6A 1V5FA 1BOBA 4RM3A 1EA3A 2WAEA 3DPLC 4DBQA 4KISA 3K4BA 2F6CA 3LFUA 1PYVA 3OYGA 4PJNA 3BC8A 3UNGC 5KCMA 3MKZA 4F55A 4II3A 1GLNA 4E7JA 4ITVA 3DLAA 1QHHD 4Y33A 3OYIA 4YEJA 4HNTA 1X4OA 2MD0A 4EATA 5LFAA 2KHMA 3W2AA 1ZELA 3A1YA 2R7UA 2ELJA 4PJMA 2IGMA 2ZXHA 2ZFUA 3OIPA 3G2BA 1HA8A 2CV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4K A;  4NC7 A;  4NC8 A;  2KRC A; 
#chains in the Genus database with same CATH topology
 2V6E A;  2DI3 A;  3BTJ A;  1B59 A;  2JVG A;  1PUF A;  2AS5 F;  1N25 A;  2E35 A;  4KNY A;  2DMN A;  2AQE A;  4BXF A;  1K78 B;  3M8J A;  4F92 B;  4D7M A;  2HYG D;  3HUG A;  1QRY A;  2V4J C;  2X6X A;  5BNG A;  3IAS 2;  4N4O B;  1P9Q C;  5E79 C;  2PX9 A;  5KAI C;  5CVI A;  3EUH A;  2BE5 F;  4NDL A;  2CYY A;  5HLG A;  2QSH X;  3MEX A;  1S5L C;  3OOP A;  1OFC X;  1ON2 A;  4G9Y A;  3IH3 A;  3PL8 A;  4NNJ A;  3J80 K;  3CCU I;  1IJW C;  1G8X A;  4BBS J;  5FD5 A;  2MBF A;  1QZE A;  2COB A;  3A03 A;  2H8R A;  3VDX A;  4XID A;  2X1C A;  5EEA A;  4EM1 A;  2HQR A;  3DU6 A;  1UJ8 A;  4KDP A;  1H9T A;  2EZI A;  4U0W A;  3PIP F;  5BQT A;  3GTO J;  4DYQ A;  2M8G X;  3WU2 C;  1GV2 A;  2IAI A;  1SVO A;  1Q1V A;  5HLH A;  3HSE A;  3JRB A;  1XSD A;  2VC1 A;  1JT0 A;  4XRF A;  1XGO A;  2OF7 A;  4C9Y A;  2A61 A;  2DMU A;  4S05 A;  2E2I J;  2ZME C;  4RBO A;  4GFB A;  4Q48 A;  1APL C;  3KZI C;  2O03 A;  5J40 A;  3TBI A;  2RRE A;  3I3L A;  2KDO A;  4MIM A;  3O8H A;  2HOT A;  1TT0 A;  3SZG A;  4BQQ A;  3JRI A;  3CO7 C;  2KJC A;  2DW4 A;  4YRV A;  2DDA A;  1DPU A;  2VIX A;  4L5E A;  4MTE A;  2WWY A;  3COA C;  3GLX A;  1R1T A;  4N9I A;  1N75 A;  1XGS A;  3CC4 I;  3TOB A;  3EUH C;  3IP4 B;  1GVJ A;  2Y0M A;  1WKM A;  1OMI A;  2CQN A;  3DPU A;  2HKX A;  5HOD A;  2YSR A;  4ZZL A;  1HSJ A;  4IQ4 A;  2HNH A;  4A3B J;  2FNA A;  4ETS A;  4RGX A;  1V55 H;  2P5K A;  1MBJ A;  3CUO A;  1CF7 B;  5J1U A;  2QM3 A;  3BCA A;  2V1X A;  3TED A;  4RB2 C;  1BJA A;  2MC3 A;  3FXU A;  3GFM A;  3V8K A;  1ETK A;  4RB3 C;  1RZ4 A;  2BY0 A;  1H9G A;  1TZL A;  3DKW A;  3ESW B;  4LIV A;  4DQ2 A;  2EIN H;  4UV9 A;  3HJE A;  3OYA A;  2R7D A;  2KIS A;  2MC4 A;  2WAQ N;  2BBY A;  4BEH B;  2M1B A;  1WJ5 A;  1FEX A;  1YI2 I;  4O6J A;  2DPD A;  3FHN A;  4KFC A;  1ETW A;  1FJL A;  2W48 A;  1WRJ A;  5GPA A;  4DGW B;  4UUS B;  1XMX A;  5L3C A;  5J8C A;  2NS8 A;  4IF4 A;  2Z33 A;  1H88 C;  2JRT A;  1SAN A;  5ILV A;  4MO7 A;  2YU9 J;  4EV0 A;  2IP2 A;  4GYI A;  5E3L A;  1W7P B;  3OS1 A;  2R7W A;  3MCZ A;  3K7A J;  1I3Q J;  2O8K A;  1NK3 P;  3BTC A;  2XRL A;  2CQK A;  3OS0 A;  4AIK A;  2G0E A;  2LVS A;  3KP3 A;  3TW7 A;  3ZMS A;  3WTW C;  5BPD A;  3OIQ A;  4Y15 A;  2DOD A;  5D6F A;  3AG3 H;  4NQW B;  5JLW A;  2PJR B;  3BJO A;  4CGZ A;  3S2D J;  5E20 A;  4E7L A;  1F43 A;  4GDF A;  2VT3 A;  4F7Z A;  2YX7 A;  3GTK J;  4DZJ A;  1VI0 A;  1S7A A;  1D1B A;  3FXQ A;  2DT7 B;  3HOT A;  1U8R A;  1R5H A;  4OAY A;  2ZME B;  5IPA A;  2X1D A;  4XK4 A;  2VON A;  4DBR A;  4BJ5 C;  4GGG A;  4HPQ A;  5CVR A;  1WJE A;  1TTY A;  2LF8 A;  1Y39 A;  3L2U A;  3RZD J;  4LMY A;  2OZ6 A;  5CVU A;  1ZAR A;  1TWG J;  1R36 A;  2OPT A;  3WG9 A;  4KMF A;  2PFB A;  2DK5 A;  1SMY F;  2KIQ A;  2L7F P;  3H3Z A;  3V42 A;  4TV7 A;  2EIM H;  3HTS B;  4BS9 A;  1FP2 A;  3BJ6 A;  3S2H J;  3CLQ A;  1I1G A;  4D5C A;  1BW5 A;  2MFZ A;  1E2X A;  2W25 A;  4DW6 A;  5M5Y J;  2E1M C;  2OQR A;  3QYE A;  1D1C A;  1OR7 A;  2ECB A;  4JQF A;  5CQE A;  5B5E C;  1ZLK A;  3GTP J;  2KRF A;  3FWE A;  4XLN F;  4Y17 A;  1W36 C;  1WJF A;  4RB0 A;  1Y0U A;  3D5L A;  4M6X A;  4LGW A;  1LVA A;  2V26 A;  4AWX B;  1X3U A;  2KP6 A;  1U5T C;  3LFK A;  1MSE C;  4HF0 A;  2VJ5 A;  2MGQ A;  4A0Z A;  1MJA A;  3OYL A;  2NXN B;  2HI3 A;  2ZSI B;  5M5X J;  4Y3O A;  3U9G A;  4D1Q A;  2VLA A;  2VBW A;  5E17 F;  1VQ9 I;  4ESB A;  3UKG A;  2NVY J;  4MEY F;  2Z9O A;  4HF2 A;  1P4A A;  1W5T A;  2EZL A;  4RGU A;  2HDD A;  3M8E A;  5FJ8 J;  3JAM K;  3VOD A;  2A07 F;  2BY1 A;  5J1R A;  3IRQ A;  3K4N A;  2K9L A;  1JKR C;  2NOJ B;  2BY2 A;  2EPF A;  3QP6 A;  4LIT A;  4LG0 A;  4BE1 A;  2GA2 A;  3DXJ F;  1MH3 A;  2DMP A;  5F04 A;  1SD7 A;  1SFK A;  3O6B B;  4S0H B;  4UNO A;  3HHG A;  2ZKZ A;  4IKF A;  3MKL A;  1W7P A;  2BW3 A;  4RMN A;  5LEK A;  3W6J B;  2GAU A;  2EK5 A;  3ECH A;  4NB5 A;  3WGH A;  2L7M P;  4E7Z A;  3I59 A;  3SFI A;  3GWZ A;  1HKQ A;  1SMT A;  3BY6 A;  3E5X A;  3KP7 A;  2FJ1 A;  2EFO A;  5E3M A;  2QEN A;  4P1W A;  2QEX I;  1YHQ I;  2GXA A;  2CQX A;  3CCE I;  1X2M A;  3WTZ A;  3WE3 A;  4CZC A;  3ECO A;  2ACJ A;  2VQC A;  2LK2 A;  3HOS A;  4G7H F;  2CW0 F;  4GYG A;  2F48 A;  4ZDP A;  2LKP A;  2E71 A;  3CUQ B;  3LA7 A;  3HEF A;  3BQZ A;  3QPL A;  1XCB A;  3DEW A;  2QUF A;  3QYF A;  1XD7 A;  2A05 A;  1MD0 A;  2OJE D;  4M3B A;  4XM3 A;  1G3T A;  3TL4 X;  3OMY A;  3KP4 A;  2P5L C;  1ETQ A;  3FXM A;  4BAY A;  1P2F A;  4W1U A;  1ZKG A;  2UV1 A;  3JTG A;  3S16 J;  4B47 A;  4BY1 J;  3SHF A;  2K9Q A;  1IXC A;  3VYS B;  3PSI A;  5IT9 K;  1RUO A;  3HBL A;  2XDV A;  5F64 A;  2H94 A;  3F23 A;  2M45 A;  5JR3 A;  4B09 A;  2LDU A;  5LRS A;  4IO9 F;  4UY8 I;  1IO2 A;  2FA5 A;  4XSX F;  5GAH J;  4JX5 A;  5CPR B;  2V9P A;  4BQN A;  2AO9 A;  2HDC A;  4IQJ A;  4FX4 A;  1W4M A;  2H09 A;  3ML6 A;  1R9T J;  4A3G J;  4CIC A;  5FLM J;  4FE4 A;  5CVV A;  1SFU A;  1V54 H;  1ZAO A;  3T1B A;  1ZG5 A;  4A0X A;  1MH4 A;  5B66 C;  2VBZ A;  4XOT A;  1VQ5 I;  4CA0 A;  2EZK A;  2IT0 A;  2Y48 A;  1YX3 A;  4CZZ A;  5M3M J;  1FWZ A;  4ZC3 A;  1W7P D;  3P9C A;  3R6S A;  2E2H J;  2FBK A;  2PLY A;  4E7K A;  4EJO A;  1BC7 C;  1E3P A;  1D8J A;  1JUM A;  1MMS A;  2CH0 A;  4KIC A;  3K4K A;  3DTK A;  4XL9 A;  4CO8 A;  2DT6 A;  1E0E A;  1GDT A;  4OIN F;  2HU9 A;  2O3F A;  3P7N A;  2JPB A;  2G7U A;  3I71 A;  3GEZ A;  4EJW A;  2QLZ A;  4B8X A;  3G1M A;  3HOY J;  2DA1 A;  3AKZ A;  3MKW B;  2LTP A;  3H9J A;  2P6S A;  3VB2 A;  4LLL A;  3WGI A;  4HV6 A;  4Y52 J;  2M0M A;  1G4D A;  3HZJ A;  1LUJ B;  3KLN A;  3V7S A;  5IP9 J;  2DFF A;  1K4S A;  3I59 B;  3SQN A;  4AU7 A;  4Q4Z F;  2E1C A;  2A5Y B;  2EV6 A;  3WTU C;  3AFH A;  4AUX A;  5FRM A;  4XKV A;  1PUF B;  6PAX A;  1E17 A;  5DCM A;  5EEG A;  2L9R A;  3HYI A;  4PSX A;  4F52 A;  5B3S H;  2F5C A;  1LVK A;  1KA8 A;  2VT2 A;  4IOC F;  1K78 A;  3AL0 B;  2K40 A;  1HF0 A;  3KE2 A;  4AIH A;  4LLG F;  1P4W A;  1W36 D;  1WZ2 A;  2DLL A;  2HPM A;  3NRV A;  2VKV A;  1I39 A;  1Z3Y A;  5FKN A;  3OSG A;  1U6G A;  3D5S C;  1GUU A;  1LDK B;  3HKZ N;  2DFI A;  1FIP A;  1FPQ A;  2KJB A;  3QRF F;  2EFQ A;  3BPX A;  1AWC A;  4UVC A;  1PJR A;  1JE8 A;  4YFK F;  4FE7 A;  3BTI A;  3TOA A;  3ERE D;  3L1P A;  3ZMT A;  4IX7 A;  3BLY A;  4HRI A;  5DEQ A;  4ENK A;  5DCM B;  5HVQ C;  3BG3 A;  2R7R A;  1IN8 A;  2L9V A;  3HTU A;  5C44 J;  2HGC A;  3CCQ I;  4EJT A;  3CCS I;  2NVX J;  3IWF A;  4FQG A;  2M4K A;  1ORK A;  2XGD A;  3H35 A;  4M6V A;  2V1D A;  5GAG J;  2V1U A;  3ZGK A;  1MNE A;  1A04 A;  2DMT A;  3CZ6 A;  5FKO A;  2Z5U A;  2X6O A;  1BOB A;  3Q9S A;  4YIR X;  3M3Y J;  1EA3 A;  3E3V A;  5KAF C;  2VPR A;  1ZYR F;  3T0Y A;  3ZQF A;  5J47 A;  3W6V A;  1D8K A;  2LNB A;  2W85 A;  1VQO I;  5CVJ A;  2B7E A;  2EV0 A;  2HYF A;  2STT A;  2RVC A;  1R23 A;  2GIV A;  3R0A A;  4HA8 A;  3DLA A;  4M3F A;  4Y33 A;  3Q5F A;  4UB8 C;  4YEJ A;  1X4O A;  1WH5 A;  3LQR A;  3I58 A;  4G7O F;  3W2A A;  3HRS A;  4HF1 A;  1GXQ A;  2R7U A;  1RR8 C;  2IA0 A;  2OU2 A;  4WXC A;  3KET A;  2HXI A;  3DP7 A;  3FM3 A;  3G2B A;  4IOA F;  1UAA A;  3A02 A;  4M9X A;  3DKX A;  3W3C A;  2JN6 A;  1UMQ A;  2L4A A;  5GTH C;  2A5W A;  3D0S A;  1YS7 A;  1X1A A;  3DTE A;  3QP5 A;  4NC6 A;  1ZQ3 P;  3E1S A;  2EQR A;  5TRD A;  3L2V A;  3RCO A;  4F91 B;  5DDG A;  1KQ0 A;  1IRX A;  3NWS A;  4CYC B;  4EJU A;  3CJR B;  3K69 A;  4P55 A;  4ZJZ A;  3Q0U A;  1GVD A;  2ICW G;  5EF6 A;  5ILS A;  2R7Z J;  4RM2 A;  3GUD A;  3OWT A;  3H9Q A;  3MKY B;  4A3K J;  3JR9 A;  5F0H A;  1EKE A;  2FEZ A;  3VYR B;  2DA4 A;  4YII A;  4CYD A;  1B1B A;  4AID A;  2R7X A;  2HVQ A;  3OYD A;  2LC2 A;  5HLI A;  1FTZ A;  2X0L A;  2ZFW A;  5M5W J;  3FK7 A;  2NOG A;  2Y31 A;  2VJI A;  5LGU A;  4B44 A;  1W0T A;  3JRD A;  1T0F C;  3PO3 J;  3C2G A;  1T0F A;  3FBI B;  3TDU C;  4M3G A;  4ZZD A;  5GPC A;  1PDN C;  2R7V A;  5KK1 A;  2TRT A;  3KYC B;  4Z6Y A;  2LH9 A;  3ZPL A;  4ASN A;  1TW3 A;  4YIF A;  4XQF A;  3TW6 A;  5EGO A;  4HLY A;  1FTT A;  5L3B A;  2RDP A;  2HR3 A;  3IAM 2;  1OIS A;  1DDN A;  2P4W A;  2F4M B;  1A36 A;  3UR3 C;  5IOY A;  4FT8 A;  2R5Y B;  1MBG A;  4O3M A;  1K83 J;  1VZ0 A;  1X1P A;  3LWF A;  3KEQ A;  1P6R A;  5BOX A;  2M87 A;  4HYE A;  1ZH5 A;  3EUK L;  3Q0V A;  1JT6 A;  2FQ4 A;  2V9V A;  1IN6 A;  1Z67 A;  3SYT A;  1RKT A;  4PK4 A;  3VWB A;  3WTS C;  5HDG A;  2F2E A;  1L3L A;  4JOM A;  1VND A;  3OR1 C;  1IW7 F;  4KMU X;  2IA2 A;  1SFE A;  1MZB A;  3OYF A;  3A01 A;  3CP8 A;  4L9V A;  2DFE A;  2R92 J;  2L54 A;  3ULQ B;  5D4S A;  2IW5 A;  2CS3 A;  2WB1 N;  3KP6 A;  3JRE A;  4IVN A;  3FHZ A;  2NRA C;  4L18 B;  1NHA A;  3H5A A;  4HDU A;  3DU5 A;  3WHB A;  2PMH A;  3QPH A;  3WOD F;  1KGS A;  2EIJ H;  4BQO A;  2DMQ A;  3CCM I;  1UHM A;  1KU2 A;  1TQP A;  2ZBK A;  4CUG A;  4MGR A;  1TWC J;  2XPV A;  3HIF A;  1XS9 A;  1ZRC A;  3RKW A;  1X3W B;  2HQN A;  3PNV A;  2R7S A;  3O8G A;  1WVR A;  4RA2 A;  4P9F A;  2CG4 A;  1CGP A;  5LHI A;  4G7Z F;  4AM3 A;  5IYD J;  5FRN A;  1O3R A;  1S29 A;  1ONV A;  3FKJ A;  2JQ7 A;  1T98 A;  1R7J A;  2OD5 A;  3WTX C;  2K3P A;  4ZYG A;  1G59 A;  1B9N A;  4XRS G;  4B43 A;  1G6N A;  4BGD A;  3BG5 A;  2HKO A;  1WJB A;  3OY9 A;  2XHK A;  4XLE A;  1LDD A;  3ELK A;  4BNC A;  3L7W A;  4J01 A;  2HOS A;  4XKC A;  3BZK A;  3W2W A;  4RGR A;  1D3Y A;  2VQH A;  1HC8 A;  5A2Q K;  1QU3 A;  1PUE E;  4L0Y B;  3A2K A;  1R71 A;  3PM1 A;  2PMZ N;  4V2G A;  1GXP A;  1ON1 A;  4MNU A;  4I09 A;  3K4C A;  1WJA A;  3VFZ A;  1XSX A;  2QYO A;  2W7N A;  1TNT A;  2LYC A;  1I5Z A;  3FXO A;  4MTD A;  4WX9 A;  3I56 I;  3H36 A;  2CU7 A;  4RGS A;  1Z77 A;  1X1B A;  1ZRF A;  3LL7 A;  3HXL A;  3RKQ A;  3HUG B;  3TO9 A;  3VYU B;  3HC7 A;  5J4V A;  1RI7 A;  1EH7 A;  2ID6 A;  1OCC H;  3GTG J;  3U1D A;  2LR8 A;  2NVT J;  1W5S A;  2HZT A;  2F5E A;  3PNY A;  2HTJ A;  2EFW A;  1AA7 A;  4M73 A;  3B6A A;  2BV6 A;  4OU0 A;  2VUM J;  4ZYD A;  1JUP A;  2RN7 A;  2IA1 A;  2W24 A;  2QSG X;  2ISY A;  3IUO A;  4XNF A;  3TMO A;  4IHS A;  4NBQ A;  3F21 A;  3IKT A;  2WY8 Q;  4IXA A;  4EJV A;  3RQI A;  1H89 C;  2IXS A;  2Y30 A;  5IYB J;  1KU9 A;  2CW8 A;  3C7J A;  3GVA A;  1HW1 A;  3SZP A;  2M3A A;  1DP3 A;  4B1R A;  2Z1D A;  2MAB A;  1S72 I;  1BA5 A;  2OUM A;  3LSI A;  1UFM A;  4CCL A;  4E7H A;  1ZGJ A;  3BG9 A;  4C2T A;  1G2H A;  4IHV A;  2VN2 A;  3ZMZ A;  1SC7 A;  3DEU A;  2EIK H;  3QPS A;  2LOO A;  3L9F A;  1MMN A;  3E6M A;  1YJW I;  2Y0S N;  3E7L A;  3IRR A;  3K70 D;  1YRN B;  3EYI A;  4HV5 A;  5FKK A;  4C2M J;  1Z6T A;  4KUM A;  4YG2 F;  2IGK A;  3HB9 A;  2GIZ A;  4WK8 F;  1T95 A;  2GQQ A;  3EET A;  4FTH A;  2JRM A;  3BZ6 A;  5CYV A;  3GZ5 A;  2R7F A;  5FKL A;  2JT1 A;  4A5N A;  3ZQQ A;  2DT5 A;  2QQ9 A;  1ZLJ A;  2H1L A;  2XRN A;  2D5V A;  1LE8 B;  3HRM A;  1XSV A;  4RB1 A;  2E7X A;  2KMU A;  3RPU A;  2XAQ A;  3JTH A;  4A5M A;  4HQE A;  3K10 A;  2X85 A;  2GXB A;  2AHQ A;  2DO7 A;  3ASO H;  3CC7 I;  3HL2 A;  1N77 A;  1IV6 A;  4G6Q A;  3P9I A;  2X9D A;  1IUF A;  2LFB A;  5TJJ A;  3ROU A;  1YYV A;  2WC2 A;  4BAC A;  5KHD A;  3BOQ A;  3S14 J;  3RPU D;  1JJ8 C;  3HOX J;  2LD5 A;  5IOZ A;  2DYS H;  3F8M A;  3GBG A;  1IXR C;  2CSO A;  2I5U A;  1X1D A;  3B02 A;  5AIQ A;  3DPT A;  1P92 A;  4DZP A;  3L09 A;  2PMZ A;  4PFO A;  5DM7 F;  4J19 A;  5D5W B;  1T8I A;  2DOA A;  3FMQ A;  1VF9 A;  2G9W A;  3A0B C;  1IV8 A;  4UB6 C;  1HDD C;  1MBE A;  1XX5 A;  2ZB9 A;  3TQN A;  1BC8 C;  1JUS A;  4GRI A;  3PSF A;  4BQA A;  1T2K A;  2QQA A;  3H5R A;  4I98 B;  1ZRE A;  2CMP A;  1MMG A;  4YFX F;  1A31 A;  1D5V A;  3QPT A;  2Z99 A;  3D5R C;  2MSY A;  3E0J B;  4L5J A;  1V5G A;  3ABL H;  2M7B A;  2WAQ A;  4LD5 A;  3JRG A;  2D45 A;  1OYI A;  3AAF A;  2YPR A;  3J7A O;  1IN4 A;  2ZNZ A;  1Q1H A;  3CQZ J;  1H0M A;  4ABZ A;  2RGV A;  1I6X A;  4XKB A;  1ZTR A;  3GW2 A;  1TL8 A;  2KRC A;  1Y0N A;  2DXI A;  3GLL A;  4PSW A;  3GTM J;  3OOU A;  2ESN A;  3QU3 A;  1K61 A;  3JRF A;  1DP7 P;  3KCC A;  3ABU A;  3TGN A;  2R7O A;  3CTA A;  4UVB A;  2WB1 A;  2ZXW H;  1VQN I;  3HDD A;  3N4M A;  3KEY A;  3FXL A;  2LRE A;  4XN0 A;  3DWL E;  3FX3 A;  4H0E A;  2Y0S A;  3I4P A;  4D9J A;  3ZXS A;  3IH4 A;  1QNT A;  4R1H A;  4IRG A;  3PO2 J;  2JA2 A;  1JGS A;  1UCR A;  4II2 A;  2DOF A;  2A68 F;  3MFK A;  2W1O A;  1OKR A;  2B0L A;  1Y8Q B;  3CDI A;  4EM0 B;  2ISZ A;  1HQC A;  3K2Z A;  3DTI A;  4PGH A;  3PIO F;  1AKH A;  3ZQL A;  1EH6 A;  2R0Q C;  4L9J A;  2QKM B;  1A5J A;  3K1M A;  1TW2 A;  3ERM A;  2DTZ A;  1BIA A;  2FE3 A;  1IDZ A;  4HLX A;  3F22 A;  1YFH A;  1LEA A;  3VSK A;  4JX4 A;  2JSC A;  3SZT A;  1YJ9 I;  1JKP C;  4XOP A;  5KNL A;  3HOU J;  3I4N J;  1Z9C A;  1D1A A;  4C3I J;  3I5U A;  1JKO C;  4A69 C;  1JKQ C;  2IS1 A;  3QU6 A;  2KZG A;  1DUX C;  2RKH A;  3J7Z I;  2JPC A;  3BJA A;  5E3O A;  2PQ8 A;  4LLN A;  5F6F A;  1X2N A;  5FD6 A;  5GP9 A;  1DU6 A;  5J3L A;  1LFB A;  2XAG A;  3TKY A;  5E18 F;  2E36 A;  3LSH A;  2PJP A;  4DYC A;  3G71 I;  2CW7 A;  2XF6 A;  5EZH A;  4IHX A;  3GF2 A;  2MYS A;  4G94 A;  4KYW A;  2J5O A;  3F72 A;  3ASN H;  1YX5 A;  5F08 A;  5LD2 C;  4FET A;  4IHY A;  3OYC A;  1I6H J;  1AOY A;  3R0J A;  2K85 A;  1J0R A;  3GZN B;  1WJC A;  3OL4 A;  1NTC A;  2AXT C;  4XLH A;  2HVR A;  2V9K A;  1FNN A;  5K7Z A;  3HOV J;  2Z16 A;  1OPC A;  1XDU A;  3PFY A;  2CWE A;  1I50 J;  1OCP A;  3O2P E;  5J6X A;  1ETX A;  4JK1 X;  3S1Q J;  1MMD A;  5F1J A;  2XRO A;  1P7J A;  4AVZ A;  2VXD A;  3WU0 A;  4L9T A;  3FXR A;  2VBY A;  1VQM I;  1FYM A;  1V5F A;  1MDM B;  3GFJ A;  3MQ0 A;  4L0Z B;  2F6C A;  3LFU A;  2M30 A;  1T33 A;  4PJN A;  4LG0 B;  2DA3 A;  2VKE A;  1MBK A;  5D5X B;  4II3 A;  4XIC A;  4E7J A;  4N0B A;  3CC2 I;  3EDP A;  3K1P A;  1WHU A;  2KKO A;  1L0O C;  4HNT A;  4EAT A;  2KHM A;  4OIP F;  3F3X A;  1ZEL A;  3CME I;  2ELJ A;  3OSF A;  1FBS A;  1XB4 A;  1YIO A;  2IGM A;  2N8G A;  2ZXH A;  2BHZ A;  3H1C A;  4G12 A;  4HW0 A;  1HA8 A;  2OA4 A;  5H6R A;  5TIS C;  1YIT I;  3F9K A;  3PFI A;  5B1A H;  4LFU A;  4GCV A;  4E70 A;  4B3X A;  4A3C J;  4A3F J;  3LAJ A;  4MFE A;  2EH3 A;  2M9H A;  3EQL F;  2A3S A;  5LBQ A;  2F5D A;  4EEF G;  3F0C A;  5FFX A;  3ZMV A;  1FC3 A;  1SFO J;  3GX4 X;  2LP0 A;  3G6E I;  3B6C A;  3ZQH A;  1YW7 A;  3LOC A;  1S6L A;  3G4S I;  1Z3X A;  4OAZ A;  2GXG A;  1JTX A;  3FXK A;  3RI4 A;  2L7K A;  2BVM A;  4BBR J;  2WBM A;  3FKI J;  3KYD B;  1TQM A;  3SDB A;  4NQW A;  3ZMU A;  4OIO F;  1QVT A;  3CCL I;  3ZOB A;  2LY2 A;  1X19 A;  4HG2 A;  2K4J A;  3P5J A;  1X3Z B;  1IG7 A;  1QBJ A;  4M9Z A;  2I8D A;  1OCZ H;  1IC8 A;  1T56 A;  4PFP A;  1ZGA A;  2PBI A;  1YOV B;  2JVH A;  1R4M B;  2KQR A;  1T08 B;  5ILU A;  4RAG A;  4Y7N J;  1JJ6 C;  1YLF A;  3IH2 A;  1Y1V J;  3QOD A;  3GCM A;  1BI3 A;  5L3F A;  1WI9 A;  3WHC A;  5J4Y A;  3BR3 A;  3RDI A;  3N97 A;  4I2O A;  3SEZ A;  4DYR A;  4FX0 A;  1REP C;  5ED4 A;  2RAE A;  4HAM A;  2LLK A;  2E2J J;  2HPI A;  2UZK A;  3CMY A;  3OYB A;  1FBQ A;  3BR2 A;  1KON A;  5LGN A;  2FBI A;  3SEQ A;  3LNQ A;  2WV1 A;  3E5Q A;  2RQP A;  4ZDL A;  3SXY A;  2GBY A;  1BW6 A;  3CLO A;  4CSW A;  2JUG A;  3A01 B;  2E1N A;  4ZTF A;  3CCV I;  1WH7 A;  2CO5 A;  4WCG A;  5HDN A;  2XAS A;  4AVP A;  5HS7 A;  5DUI A;  4A3E J;  2FNP A;  5IP7 J;  2ZJ2 A;  2V6C A;  2STW A;  4CYC A;  1CQT A;  1KQ8 A;  2LY1 A;  4N4N B;  4QIW N;  3J81 Z;  2OCC H;  2KIU A;  3CDL A;  3DFG A;  2JZY A;  1I27 A;  2EB7 A;  2Y9Z A;  3HG9 A;  4BE0 A;  1HBX G;  3REO A;  3I55 I;  3A4C A;  5F27 A;  2CV1 A;  4KT6 A;  2Z2S B;  2VB6 A;  4UVA A;  1G3Y A;  1O57 A;  3CP2 A;  2ZSH B;  1J9I A;  1JXS A;  3K1N A;  2V79 A;  2PEX A;  3OYK A;  1QQI A;  1XC5 A;  1OCO H;  1OYW A;  2E7W A;  2XVC A;  2IJL A;  2JUC A;  2KRH A;  4CH7 A;  5E8I A;  3JSO A;  2IRF G;  3QAH A;  1QVU A;  2ELH A;  2UXN A;  4EQQ A;  1XG1 A;  4D5F A;  1KZH A;  4A12 A;  4LJZ F;  2W82 A;  3MN2 A;  4RAY A;  1IRG A;  2IEK A;  4EM2 A;  3CCR I;  2HQA A;  2A6T A;  2EV5 A;  2DN0 A;  2NAZ A;  1D5Y A;  2OTL I;  2M8E A;  3LSM A;  5E1W A;  5D5V B;  5LLQ A;  4ZYH A;  4CCM A;  1TP4 A;  4A93 J;  3CCY A;  3RKX A;  4BXU A;  1RNL A;  2OV7 A;  2E5N A;  3PQK A;  4M74 A;  4EGZ A;  2HZD A;  4C2U A;  4BE2 A;  1B72 B;  2FF4 A;  5L3G A;  2F5V A;  5IT9 Z;  4KIT B;  1HW5 A;  2CQQ A;  3CUQ A;  1U78 A;  2YX4 A;  3GTQ J;  4I76 A;  3ZMD A;  4I0B A;  4KIG A;  1ACI A;  2DA2 A;  3WE2 A;  3IL2 A;  3MVP A;  3U1K A;  1ETO A;  3W6K B;  3CJQ B;  3L2R A;  3LST A;  5EEH A;  2X1E A;  2VOD A;  1WGX A;  1TNS A;  1OYY A;  3J7A Y;  3ABK H;  4QWQ A;  4OOI A;  3E6C C;  1QO0 D;  3T5X A;  3S2W A;  2VJ4 A;  1LE8 A;  3CMM A;  1S3J A;  2XKP A;  4V2F A;  1U3E M;  1SD5 A;  3QOE A;  3BG7 A;  4EVI A;  3AG2 H;  3RIR A;  3F6V A;  1QPM A;  1YW9 A;  4CCO A;  2O61 A;  4ENJ A;  4IL6 C;  1XGN A;  1IZ1 A;  2YR2 A;  1X1C A;  4BJ6 C;  1C0W A;  2L3D A;  5K5R A;  2CUF A;  2KL4 A;  2NS7 A;  4CCN A;  4ZYE A;  4I02 A;  3LQQ A;  4RLF A;  2DOE A;  3FZV A;  3DBH B;  1ODD A;  2XAJ A;  3TO6 A;  3BG6 A;  4B4C A;  3V7R A;  3H0D A;  4WF2 A;  3IC7 A;  1DQU A;  1FIA A;  1YS6 A;  3BP8 A;  3HSR A;  2PG4 A;  3A0H C;  1Z0X A;  1U8B A;  2ETH A;  2X4H A;  3AG4 H;  4DJA A;  4HSR A;  3L2C A;  3R61 A;  4R79 A;  4HQM A;  1UG0 A;  4EMS A;  1WSU A;  2XAU A;  5BPI A;  4KT5 C;  4A3J J;  3GFI A;  3MAJ A;  2NVQ J;  3ZQG A;  4A3D J;  3HSF A;  1WCM J;  3W2V A;  3S3M A;  1MW7 A;  1KYZ A;  1NH3 A;  5D4R A;  3R60 A;  2UWM A;  1R00 A;  3E6D A;  1RRJ A;  3PQJ A;  2OCE A;  2L0K A;  3M1C A;  1SEU A;  1R58 A;  3WTV C;  1ZG1 A;  2F4O B;  2P7C B;  2CUZ A;  1OCT C;  1TQI A;  2D2W A;  2LKX A;  2CV2 A;  1OLT A;  1B8I A;  1R6R A;  2O9L A;  1V5E A;  3S93 A;  4B3A A;  2CFO A;  5CKT A;  1BR2 A;  4E7S A;  2ZJR F;  1RUN A;  4LB5 A;  2VOP A;  1HST A;  4Z2Y A;  5K7F A;  2HVS A;  5JVG F;  4ZTJ A;  2M7A A;  2VL8 A;  1MGT A;  3HKZ A;  4R8H A;  5ICG A;  1UEL B;  2DBB A;  1I1S A;  1YW8 A;  2CUJ A;  3ABT A;  4AYB N;  1MIJ A;  1J59 A;  1IF1 A;  4U88 A;  1ZN2 A;  3S1M J;  2O6G E;  1F36 A;  5LEJ A;  4XRM A;  2KIF A;  1DU0 A;  1XDS A;  4RAF A;  1JHH A;  3CUQ C;  2KLO A;  4PGG A;  5E1X A;  1YIJ I;  2D1H A;  1R1V A;  1U5T B;  1YO5 C;  3DEE A;  1ITY A;  4FHT A;  3TDZ C;  5M3F J;  1WI3 A;  3ZRG A;  5FLV A;  2OBP A;  2FQ3 A;  1TWF J;  5FB2 A;  1YRN A;  1GHC A;  2VE9 A;  4AIJ A;  3KP5 A;  4MQV A;  1HLV A;  4YEL A;  4E4H A;  4BEH A;  3NAU A;  4IRI A;  3Q3S A;  1RC9 A;  1H8A C;  3K2A A;  2KDZ A;  4XRS A;  2MG4 A;  3CMA I;  1BI1 A;  2FBH A;  4ESF A;  5IYC J;  2Z3Y A;  2IVM A;  4M6Y A;  3BWG A;  1W0U A;  2KIM A;  2ZO4 A;  1J5Y A;  2QSF X;  3S15 J;  4Q5S F;  2EA4 A;  2Y2Z A;  3M7G A;  1EJ9 A;  2ID3 A;  5AON A;  2LG4 A;  2H6B A;  4X0G A;  2H1K A;  2BHY A;  1LPQ A;  2D1V A;  4IPA A;  5ICC A;  2LBF B;  3TP0 A;  1HCR A;  4U7D A;  2RQQ A;  4IZZ A;  4U0V A;  2R7T A;  3C3W A;  2GOX B;  1RES A;  3HGY A;  1IGN A;  2H27 A;  1ZG3 A;  2TCT A;  4BDY A;  1A6I A;  5JHU A;  1TC3 C;  2QWW A;  5HNH A;  4L9N A;  1J7K A;  5DCF A;  1Z05 A;  1EF4 A;  4DIQ A;  1QPI A;  1A6Q A;  3BRO A;  3S1R J;  1D0Y A;  2BYV E;  3DBL B;  1YTY A;  2VKD A;  5GTI C;  4AD9 A;  2L9N A;  1LFU P;  2WTE A;  1W5C C;  4E7I A;  5DS9 A;  3RZO J;  2DK8 A;  3FK6 A;  2KFD A;  1IRZ A;  2AXL A;  1QGP A;  1UZC A;  4J00 A;  2L7Z A;  5ERI A;  4HNU A;  2ADU A;  5HOO A;  1R49 A;  1HKT A;  3S32 A;  1VQ6 I;  3SDG A;  4GXO A;  2H6C A;  1J09 A;  1D0X A;  1LKX A;  2WV0 A;  2JJ7 A;  5LRR A;  3CJN A;  5H2F C;  1JHF A;  2BW3 B;  1XN7 A;  3I0T A;  5BMZ A;  5JLX A;  2MLG A;  3QOP A;  1DGW Y;  5DUK A;  2UXX A;  1RKW A;  4RDU A;  4JX6 A;  4BUP A;  2IPQ X;  4CCJ A;  3E5U A;  4I6Z A;  1YJN I;  5TGT A;  1SAU A;  1RET A;  2XGX A;  4F93 B;  4I01 A;  2QBY A;  2NVU B;  4NHJ A;  3OL3 A;  5DV5 A;  2M2E A;  4L5I A;  4ESJ A;  2OTJ I;  1MJ9 A;  2JA5 J;  3PNT A;  5D6E A;  4I0A A;  3LSK A;  1N78 A;  1RR7 A;  4QPQ A;  4P5O A;  3BR0 A;  1UHS A;  3CO6 C;  1LJ9 A;  1NG6 A;  2EIL H;  3MZH A;  4IJA A;  3OS2 A;  4BHB A;  4LK0 F;  4A6E A;  2QKL B;  3JW4 A;  3S3N A;  5EG0 A;  1OCR H;  4D0P A;  1XCV A;  4IEJ A;  2DPU A;  3LA2 A;  2XUB A;  1AKH B;  3SJM A;  5E1Z B;  2Y75 A;  2NNN A;  3EPZ A;  3RKY A;  3LSR A;  2DJN A;  1KU3 A;  2DQL A;  2CQ7 A;  2DDB A;  2K86 A;  1Z6R A;  3M07 A;  3M8F A;  1BOA A;  3ZQC A;  4H4K C;  1SVM A;  2DYR H;  3BCB A;  3BR5 A;  3LSJ A;  2HOE A;  1Z91 A;  3E6B A;  2PN6 A;  2L02 A;  4CXF A;  1AU7 A;  2MH2 A;  3VEP A;  4LIU A;  2XF7 A;  4E6K G;  3JRC A;  5GAD J;  1MSF C;  1ETV A;  1PP7 U;  4PUS A;  3J80 Z;  3AG1 H;  2XIG A;  2WAE A;  2Y9Y A;  3HOW J;  4DBQ A;  1U2W A;  4OMY A;  2JMW A;  1F4K A;  3OYG A;  2ME6 A;  3BC8 A;  4ENM A;  2ZXJ A;  2ME0 A;  4F55 A;  3DF8 A;  5HDK A;  3ZN0 A;  2JA8 J;  2K9S A;  4CHU A;  2FOK A;  3ZN1 A;  3L00 A;  4ITV A;  2LSO A;  2I10 A;  4UHT A;  5DD4 A;  3OYI A;  2BY3 A;  4KN7 X;  5FFZ A;  2P7V B;  3FM5 A;  4WXH A;  3A1Y A;  3KPH A;  3ZP5 A;  4IRH A;  3Q9V A;  4WWC A;  2GWR A;  2A6E F;  2ZFU A;  3OIP A;  1VQ8 I;  4HDV A;  5KVR A;  4RLQ A;  3HPG A;  3HOZ J;  3QQA A;  3OIO A;  4HST A;  4G6T B;  4I99 C;  1YE9 A;  2P5V A;  2XAH A;  1FSH A;  3PUF A;  3GTL J;  2DU9 A;  1BR1 A;  2WA0 A;  2F4I A;  4UUT A;  3F8B A;  3F8N A;  1ULY A;  3GTJ J;  3WTT C;  1IUY A;  3MMY B;  1FY7 A;  5FO5 A;  5JI6 A;  4XOR A;  2NNY A;  4A0Y A;  4BU2 A;  4XKW A;  2AQF A;  2J5P A;  2MLK A;  3WU1 B;  1Y56 A;  2KPM A;  2JA7 J;  2E19 A;  3FF5 A;  5FGM A;  3U21 A;  2HOA A;  2BVL A;  3PUB A;  5GAE J;  5DTD A;  3FIW A;  2B9S A;  5FLX K;  1S8N A;  2R5Z A;  2QA4 I;  4G8X A;  5EJC A;  3LA3 A;  3GME A;  4UUS A;  1PVE A;  3RQ4 A;  3Q0W A;  4HBL A;  1USS A;  2QBY B;  5IP6 A;  1WPK A;  4A6D A;  4LG3 A;  3LSP A;  4JBA A;  1VFC A;  1FSE A;  2MW8 A;  1MKM A;  2OQG A;  3S1N J;  5L3D A;  1UB9 A;  2Q8K A;  1BIB A;  4PJL A;  4IHW A;  4XLA A;  1TWH J;  3IKV A;  3MD2 A;  2QF7 A;  4FAS D;  1YQA A;  2XPW A;  1HOM A;  1Z1D A;  3TO7 A;  3S8P A;  1ZRD A;  1FOW A;  3K9T A;  1VTN C;  4AC0 A;  1Y8R B;  2MA3 A;  3JRA A;  1FX7 A;  1OR7 C;  4ZH4 F;  2HTS A;  3VYT B;  2XAF A;  1E3H A;  1U9N A;  1S7E A;  4YFN F;  1A35 A;  1ZR2 A;  4HX4 A;  4M72 A;  2ZXI A;  4OIR F;  4HOB A;  4X1E A;  2Q0O A;  2IGO A;  2IS2 A;  2FU4 A;  3WTY C;  2BXY A;  2RV8 A;  4AYB A;  1F9N A;  2L2O A;  3I9V 2;  2EWN A;  3C2H A;  3V8L A;  4X6A J;  5JFR A;  2HDW A;  1EH8 A;  2HFH A;  2R3S A;  1O3S A;  2QCO A;  3O3K A;  4LB6 B;  2PJR A;  3M4O J;  3DQV C;  1ZGW A;  3BTL A;  3CF2 A;  1BL0 A;  1XTA A;  1MMA A;  1ETY A;  3RSN A;  1Z7L A;  3KIO A;  1F1Z A;  3DBR B;  1Z7U A;  5IY5 H;  3WG7 H;  3FMS A;  4C3H J;  3B73 A;  4GO1 A;  1UHW A;  1ZHF A;  3V4G A;  9ANT A;  1HKS A;  4XBF A;  1KYW A;  3E97 A;  1U9O A;  3BT9 A;  4A3L J;  1T6S A;  1SFX A;  5DYM A;  4XMY A;  3H3V K;  3HRU A;  3IV5 A;  2QGU A;  2X6W A;  3WGG A;  2IS6 A;  3T8R A;  3K4M A;  1MDM A;  4G6D A;  5H20 A;  5LHH A;  2XC7 A;  3LAP A;  1OQY A;  3QWL A;  5J8F A;  2HEO A;  3OV8 A;  3HPH A;  2EFN A;  2CJJ A;  2VBX A;  5HLT A;  2MH9 A;  2B63 J;  1O7F A;  5DM6 F;  2QVO A;  1O3Q A;  2V1N A;  3GXO A;  5C4J J;  3J81 K;  1ZR4 A;  1R5I D;  4HZF A;  2R4G A;  4KIB A;  1F5T A;  4PDK A;  3GFL A;  3H0G J;  3RYR A;  2K9M A;  5JHF A;  4JP0 A;  3KZZ A;  2FX0 A;  2OZU A;  2DQR A;  4OWR B;  2IBD A;  2HWV A;  1XGM A;  3FBN B;  3D1N I;  2VPL A;  2YU3 A;  3I4M J;  2EJR A;  5D5U B;  1X58 A;  2QQ8 A;  2H8W A;  2E60 A;  4MLO A;  1V4R A;  4OMZ A;  4RS8 A;  5FKM A;  2R93 J;  2A6H F;  2VAS A;  2O5R A;  1FP1 D;  3I54 A;  1PP8 F;  1QZZ A;  2ECC A;  3BDD A;  2ESH A;  3S3O A;  1CF7 A;  3JRH A;  5J1Y A;  4FIS A;  1LQ1 A;  2HS5 A;  1WJD A;  2ZME A;  5K7H A;  1V3F A;  1T39 A;  2R7Q A;  2DA7 A;  4O5V A;  4W97 A;  5CJ9 A;  1QA6 A;  2VOO A;  1ERD A;  2IGN A;  3JAM Z;  2X51 A;  4DOZ A;  1YG2 A;  3KZY A;  5HS8 A;  2KZV A;  5EGO B;  3H92 A;  4NUB A;  1R22 A;  4XLP F;  4U7B A;  3G1O A;  2E5Z A;  3KEO A;  1MBF A;  4HNV A;  2A69 F;  5FRO A;  5HNF A;  1QHG A;  2K4B A;  4M3E A;  3I64 A;  1Y1W J;  3M1E A;  4ZDO A;  3K0L A;  1B9M A;  1WWX A;  3K4J A;  3I53 A;  1LEB A;  4PJ0 C;  4A2U A;  1FOX A;  4BKX A;  2XB5 A;  1M1E B;  2P0W A;  4MEX F;  4BY7 J;  2JTV A;  2WAF A;  1IAW A;  1P7I A;  3HM5 A;  2L9S A;  4KN4 X;  3DLL F;  1U5T A;  2LRD A;  1BJZ A;  3M9A A;  1VQK I;  1BM9 A;  1O4X A;  1MNM C;  1BN5 A;  2LMD A;  3ZCO A;  5B1B H;  1FYL A;  3DKY A;  1BBY A;  5EG0 B;  3ZQ7 A;  3OYE A;  2K02 A;  5L3E A;  4ON0 A;  3VOE A;  4C30 A;  1LNW A;  4HX7 A;  4M3D A;  3F8C A;  4CDG A;  5E3N A;  2X48 A;  2ZCW A;  3S17 J;  1FMW A;  3NAR A;  2M0C A;  3C2B A;  1T38 A;  2HQ5 A;  1O7L A;  2FD5 A;  1VQ7 I;  2CRG A;  2E34 A;  3HRT A;  5EYR A;  4XN3 A;  4MHG A;  4UUV A;  5DD8 A;  3RPQ A;  4OIQ F;  2DCE A;  2E1O A;  1R1U A;  1R4N B;  2BGC A;  2EFP A;  3V7C A;  3JSP A;  3IHU A;  1J2X A;  3EYY A;  2W57 A;  2K7L A;  3FMR A;  4MFD A;  4Y4R A;  3L2W A;  3GZ6 A;  2M5W A;  3G1L A;  3CES A;  5BS6 A;  2V7F A;  4KIF A;  1K7A A;  1O3T A;  3H5N A;  4LOC A;  2WAD A;  2Q2E B;  3OYN A;  4P9U A;  4ENN A;  2VKH A;  4XR6 A;  3KYL A;  2GZW A;  2TDX A;  1STZ A;  3CD6 I;  1SD6 A;  2FUG 2;  4HX8 A;  2RC4 A;  3NWT A;  2DTR A;  2LF7 A;  3ZR8 X;  3OYH A;  1B4A A;  5C4X J;  2XKO A;  1S7O A;  1UST A;  4U0Y A;  3OR2 C;  1KU7 A;  1IRF A;  1BI2 A;  2BEO A;  4MQ9 F;  2W4S A;  1RPW A;  2XF5 A;  2W00 A;  3FDY A;  2G7H A;  2C6Y A;  5D8L B;  4BDZ A;  1VQP I;  2VJJ A;  1MBH A;  1S9H A;  3KFW X;  5ICE A;  3MZY A;  2DAO A;  2XPU A;  2BZT A;  1VQL I;  4B48 A;  1B6A A;  1SVL A;  2Q2E A;  1ZK8 A;  2PI0 A;  3U2R A;  4U87 A;  3MZ8 A;  3MWM A;  1J75 A;  1FLI A;  3BR6 A;  2GLO A;  2COM A;  2ZNY A;  4WXD A;  5F1R A;  1ENH A;  1LB2 A;  1X4P A;  3FXJ A;  2L5Q A;  2GM4 A;  2XV4 S;  1K6Y A;  2LKS A;  1HDP A;  1IN5 A;  1E3O C;  3VSL A;  4ZYA A;  2VE8 A;  2KT0 A;  5F0F A;  4M9S A;  1FT9 A;  4BJT A;  4CCK A;  5FLX Z;  5LGT A;  4QPO A;  2Q1Z B;  1TLH B;  2CFX A;  2NS0 A;  2OC6 A;  3HHH A;  2DA6 A;  2VQG A;  4UV8 A;  3JCU C;  1W1W E;  4KA4 A;  1I3A A;  2VQL A;  3LMM A;  4Q47 A;  2DA5 A;  2LBF A;  3FIS A;  3IWZ A;  3RTR A;  3L2Q A;  3H9G A;  3X2Q H;  1XMK A;  1IN7 A;  4A3M J;  1QZY A;  3VPR A;  3K70 C;  3SFZ A;  1GT0 C;  2BXZ A;  1JGG A;  5E8G A;  4V19 K;  2R5Y A;  1Y6I A;  3HGG A;  4NC8 A;  2M4G A;  1EV7 A;  1G3W A;  2M34 A;  3LSG A;  2RNG A;  4BHC A;  3AL0 C;  2EZH A;  2ZJQ F;  2FML A;  1DPR A;  2O8X A;  4I7H A;  4BL0 B;  2EBI A;  1BR4 A;  1FMV A;  3ONQ A;  4BHP A;  4PZJ A;  2WY7 Q;  3BZC A;  5K5O A;  5ICF A;  1TWA J;  4C3J J;  1NK2 P;  3K4L A;  4F3Q A;  4K2E A;  2NYX A;  3RJP A;  3K6G A;  1RIO H;  2DJI A;  2UUZ A;  4BYY A;  1U0J A;  2P81 A;  3CF5 F;  1B72 A;  4ANJ A;  1DGR M;  2OAZ A;  2JA6 J;  4S04 A;  3EUA A;  3J7Y J;  2MD5 A;  2VXZ A;  1D0Z A;  1IXS B;  2XGE A;  3C18 A;  3RYP A;  1JI8 A;  1Z21 A;  5C3E J;  1TBX A;  4PCQ A;  4KJZ A;  4DNC A;  5K1Y A;  5CLS A;  3PJR A;  1GV5 A;  1WQ2 A;  2XGC A;  3ISP A;  5CQG A;  4M71 A;  2FXA A;  5F0C A;  3OYJ A;  2L01 A;  4XSZ F;  1WFX A;  2HXO A;  2QZ8 A;  2ZC2 A;  4A3I J;  4XON A;  3CCJ I;  1UG2 A;  3F6O A;  2BOL A;  1MND A;  4FCY A;  5A2Q Z;  5EDN A;  1MJB A;  1KQ9 A;  4HEA 2;  2P6T A;  1FBU A;  4NC7 A;  4XLC A;  2K9N A;  2GOM A;  2O0Y A;  5K5Q A;  2JWT A;  2YUS A;  3NEU A;  1TT5 B;  2XSJ C;  1B8I B;  2O7O A;  3C1D A;  5AIP A;  1BI0 A;  3NQO A;  3OYM A;  2JSP A;  2ELK A;  5EZG A;  2HYJ A;  2LY9 A;  4JYK A;  1P4X A;  1JTY A;  3KLO A;  1NG7 A;  3GYH X;  4XLF A;  2CGP A;  3T8T A;  3TP3 A;  3QYB A;  5D8K B;  1OJL A;  1LFP A;  2EA2 A;  3DV8 A;  3DCF A;  1POG A;  2K27 A;  1K4T A;  5H6Q A;  1VQ4 I;  1FZP B;  4BH9 A;  3GO5 A;  2IS4 A;  4P96 A;  3F8F A;  2K3F A;  2E1M B;  1K6O A;  4PJJ A;  3KP2 A;  4LK1 F;  3KX2 A;  3BQY A;  5IT3 A;  2FRH A;  5JVT A;  3N05 A;  2X6Y A;  1AHD P;  4D7N A;  3ZQI A;  3BR1 A;  1K79 A;  1FYK A;  1IDY A;  3CDH A;  2P8T A;  3R4K A;  4BXX J;  1SD4 A;  4RM3 A;  4N9H A;  3DPL C;  4KIS A;  3K4B A;  4QLC U;  2L4M A;  1LDJ A;  2F5F A;  3V8J A;  1PYV A;  2R5Z B;  1G3S A;  3UNG C;  2XB0 X;  5KCM A;  2GA1 A;  2RNJ A;  2XSD C;  2YS9 A;  3MKZ A;  2PMU A;  1GLN A;  4QTR A;  1XPX A;  3ABM H;  2W84 A;  3H3U A;  2FMY A;  1FOK A;  5LHG A;  1QHH D;  2Y69 H;  3BPV A;  3G3Z A;  1XMA A;  4EGY A;  2JK3 A;  2DFH A;  5HS9 A;  4UXN A;  2MD0 A;  5LFA A;  4IHT A;  2ZJP F;  2FSW A;  2VC0 A;  3P9K A;  4Y13 A;  1HXD A;  2FOW A;  2VI6 A;  3CJT B;  4RAZ A;  2CUE A;  2QQB A;  1SAX A;  4PJM A;  3G73 A;  1FOY A;  4QSH A;  2K5C A;  1HW2 A;  1R5G A;  2CV0 A; 
#chains in the Genus database with same CATH homology
 3DKX A;  3W3C A;  2V6E A;  3F9K A;  4RLQ A;  2A5W A;  3HPG A;  2JVG A;  1X1A A;  4B3X A;  3DTE A;  4G6T B;  4HST A;  1YE9 A;  2AQE A;  4BXF A;  3E1S A;  3M8J A;  4F92 B;  3L2V A;  3RCO A;  4F91 B;  1BR1 A;  2WA0 A;  2F4I A;  1IRX A;  2V4J C;  2X6X A;  3NWS A;  3IAS 2;  4N4O B;  1P9Q C;  3CJR B;  4ZJZ A;  3MMY B;  4XOR A;  4RM2 A;  1Z3X A;  4OAZ A;  4BU2 A;  3OWT A;  4XKW A;  2L7K A;  2AQF A;  3H9Q A;  3MKY B;  1Y56 A;  2BVM A;  2KPM A;  2WBM A;  3U21 A;  4NNJ A;  3PL8 A;  2BVL A;  1G8X A;  3SDB A;  3PUB A;  3VYR B;  2LY2 A;  1X19 A;  2HVQ A;  3VDX A;  3OYD A;  2LC2 A;  4HG2 A;  2X1C A;  2R7X A;  3DU6 A;  3RQ4 A;  2VJI A;  2I8D A;  4B44 A;  1T0F C;  4PFP A;  3C2G A;  3FBI B;  2R7V A;  4LG3 A;  2JVH A;  2KQR A;  2LH9 A;  3QOD A;  4XQF A;  3IAM 2;  4C9Y A;  3UR3 C;  4PJL A;  4XLA A;  1VZ0 A;  3MD2 A;  3SEZ A;  4FAS D;  3TBI A;  2RRE A;  3I3L A;  2KDO A;  3S8P A;  3EUK L;  1TT0 A;  3SZG A;  1OR7 C;  4BQQ A;  3SYT A;  4PK4 A;  3VWB A;  3VYT B;  2HPI A;  4YRV A;  2VIX A;  4JOM A;  3OYB A;  1N75 A;  3OR1 C;  2ZXI A;  3EUH C;  1KON A;  2IGO A;  3IP4 B;  2IS2 A;  3SEQ A;  4AYB A;  3OYF A;  4ZDL A;  3CP8 A;  2L2O A;  3I9V 2;  3C2H A;  4CSW A;  3DPU A;  2JUG A;  4ZTF A;  2HDW A;  2CS3 A;  4IQ4 A;  2HNH A;  2PJR A;  3DQV C;  3H5A A;  3DU5 A;  3CF2 A;  4BQO A;  3BCA A;  1MMA A;  3RSN A;  1Z7L A;  2LY1 A;  4N4N B;  4CUG A;  3HG9 A;  4LIV A;  4BE0 A;  1TZL A;  3A4C A;  4XMY A;  3PNV A;  3OYA A;  2R7S A;  2CV1 A;  4KT6 A;  2MC4 A;  2Z2S B;  2VB6 A;  2X6W A;  3CP2 A;  2IS6 A;  2ZSH B;  4BEH B;  5FRN A;  3OYK A;  1WJ5 A;  3K4M A;  2XC7 A;  3FKJ A;  3FHN A;  2K3P A;  4DGW B;  1G59 A;  3HPH A;  2KRH A;  5HLT A;  4B43 A;  4CH7 A;  4BGD A;  1WJB A;  3OY9 A;  2W82 A;  2V1N A;  4XLE A;  4J01 A;  2HQA A;  3OS1 A;  2R7W A;  2R4G A;  4XKC A;  2A6T A;  5JHF A;  3W2W A;  2K9M A;  2VQH A;  1QU3 A;  3LSM A;  4OWR B;  3A2K A;  3OS0 A;  3FBN B;  4CCM A;  2VPL A;  3K4C A;  1WJA A;  3OIQ A;  2W7N A;  2OV7 A;  2LYC A;  2E60 A;  2E5N A;  4MLO A;  4NQW B;  2HZD A;  2PJR B;  2VAS A;  2O5R A;  4C2U A;  4BE2 A;  4E7L A;  3S3O A;  2F5V A;  4KIT B;  1WJD A;  1X1B A;  3LL7 A;  3HXL A;  2R7Q A;  3HUG B;  1D1B A;  3HOT A;  2DT7 B;  3VYU B;  3HC7 A;  4OAY A;  2X1D A;  1ERD A;  2IGN A;  4DBR A;  4BJ5 C;  2K5C A;  2X51 A;  4DOZ A;  4HPQ A;  1WJE A;  2KZV A;  4NUB A;  3CJQ B;  3PNY A;  3L2R A;  3L2U A;  1AA7 A;  2X1E A;  4U7B A;  2E5Z A;  3J7A Y;  5FRO A;  5HNF A;  3IUO A;  1QHG A;  4XNF A;  3TMO A;  2VJ4 A;  3CMM A;  4ZDO A;  2WY8 Q;  3QOE A;  3V42 A;  3K4J A;  3BG7 A;  4BS9 A;  1UAA A;  2P0W A;  2WAF A;  2IXS A;  4CCO A;  2CW8 A;  2MFZ A;  2L9S A;  2M3A A;  1X1C A;  2E1M C;  2LRD A;  3QYE A;  4BJ6 C;  1D1C A;  1DP3 A;  2Z1D A;  4JQF A;  5CQE A;  2MAB A;  2KL4 A;  2OUM A;  3ZCO A;  4CCN A;  3DKY A;  1WJF A;  1W36 C;  3D5L A;  3LSI A;  4RLF A;  3OYE A;  2V26 A;  4CCL A;  4E7H A;  3BG6 A;  2KP6 A;  4C30 A;  4C2T A;  3H0D A;  1DQU A;  2VJ5 A;  3OYL A;  1FMW A;  2LOO A;  2ZSI B;  4Y3O A;  4D1Q A;  4DJA A;  4HSR A;  1MMN A;  2VLA A;  4R79 A;  1UG0 A;  2XAU A;  4XN3 A;  3K70 D;  3W2V A;  2DCE A;  2IGK A;  1T95 A;  1MW7 A;  3S3M A;  3K4N A;  2K9L A;  2UWM A;  2NOJ B;  3M1C A;  4Y4R A;  4LIT A;  3ZQQ A;  3L2W A;  4BE1 A;  3CES A;  2CUZ A;  2CV2 A;  2V7F A;  1OLT A;  1R6R A;  3H5N A;  1V5E A;  2KMU A;  3S93 A;  2CFO A;  5CKT A;  1BR2 A;  1SFK A;  4E7S A;  2WAD A;  2HVS A;  4IKF A;  2Q2E B;  3OYN A;  2BW3 A;  4ZTJ A;  2VKH A;  4RMN A;  4XR6 A;  3KYL A;  3K10 A;  2X85 A;  2FUG 2;  3HL2 A;  1N77 A;  4E7Z A;  2M7A A;  2VL8 A;  3HKZ A;  3NWT A;  1UEL B;  2CUJ A;  3ZR8 X;  3OYH A;  4BAC A;  5KHD A;  4P1W A;  3OR2 C;  3RPU D;  4CZC A;  2W4S A;  2XF5 A;  2VQC A;  2W00 A;  3FDY A;  3HOS A;  3GBG A;  1X1D A;  3DPT A;  4BDZ A;  2VJJ A;  1S9H A;  2PMZ A;  2KLO A;  4PFO A;  4ZDP A;  2DOA A;  3DEE A;  4B48 A;  3ZRG A;  3QYF A;  4U87 A;  4GRI A;  3PSF A;  4XM3 A;  3H5R A;  4YEL A;  3TL4 X;  2CMP A;  1X4P A;  4BEH A;  3OMY A;  1MMG A;  2L5Q A;  4E4H A;  1K6Y A;  3D5R C;  2UV1 A;  3VSL A;  4ZYA A;  4B47 A;  3E0J B;  4CCK A;  4BJT A;  1V5G A;  2M7B A;  4QPO A;  2Q1Z B;  3VYS B;  2WAQ A;  3PSI A;  2OC6 A;  2XDV A;  2VQG A;  2LG4 A;  4X0G A;  2VQL A;  3LMM A;  4XKB A;  2LBF A;  3L2Q A;  2KRC A;  3RTR A;  3H9G A;  5CPR B;  2DXI A;  4PSW A;  2LBF B;  3K70 C;  3OOU A;  2RQQ A;  4BQN A;  4IQJ A;  4IZZ A;  1Y6I A;  2R7T A;  4NC8 A;  2M4G A;  2R7O A;  2GOX B;  3LSG A;  2WB1 A;  4BDY A;  2RNG A;  3AL0 C;  5HNH A;  3KEY A;  2LRE A;  4XN0 A;  3DWL E;  4XOT A;  4CA0 A;  4BL0 B;  1YX3 A;  2Y0S A;  4D9J A;  4DIQ A;  3ZXS A;  1BR4 A;  1FMV A;  3ONQ A;  4ZC3 A;  1D0Y A;  2WY7 Q;  2JA2 A;  4II2 A;  2VKD A;  2L9N A;  3K4L A;  2W1O A;  4E7I A;  4F3Q A;  4E7K A;  3K6G A;  2DJI A;  3DTI A;  2UUZ A;  2CH0 A;  1E0E A;  3K4K A;  3DTK A;  4XL9 A;  2DT6 A;  2QKM B;  1U0J A;  2HU9 A;  4ANJ A;  4J00 A;  1DGR M;  4HNU A;  3EUA A;  5HOO A;  2VXZ A;  1D0Z A;  3VSK A;  3S32 A;  4XOP A;  3AKZ A;  5KNL A;  1Z21 A;  3MKW B;  1JI8 A;  1J09 A;  4KJZ A;  1D0X A;  1LKX A;  1D1A A;  3H9J A;  3PJR A;  5CQG A;  3OYJ A;  2IS1 A;  2BW3 B;  1WFX A;  2M0M A;  1DGW Y;  4XON A;  4BUP A;  4CCJ A;  2BOL A;  4AU7 A;  1MND A;  5TGT A;  1SAU A;  4HEA 2;  4F93 B;  3AFH A;  4NC7 A;  4XLC A;  5FRM A;  2GOM A;  4XKV A;  4PSX A;  4F52 A;  3OL3 A;  1LVK A;  3LSH A;  2XSJ C;  3AL0 B;  3PNT A;  1W36 D;  3LSK A;  2CW7 A;  2XF6 A;  2HPM A;  3OYM A;  1N78 A;  2MYS A;  2JSP A;  4QPQ A;  4P5O A;  1YX5 A;  5LD2 C;  4FET A;  3OYC A;  1NG6 A;  3OS2 A;  2QKL B;  1Z3Y A;  3S3N A;  1NG7 A;  1WJC A;  4XLF A;  3OL4 A;  4XLH A;  3D5S C;  1LDK B;  2HVR A;  2V9K A;  3QYB A;  1LFP A;  1PJR A;  2Z16 A;  2IS4 A;  3PFY A;  3EPZ A;  4IX7 A;  3BLY A;  2E1M B;  4HRI A;  4PJJ A;  5HVQ C;  3KX2 A;  2R7R A;  4H4K C;  3BCB A;  1MMD A;  3N05 A;  2X6Y A;  4AVZ A;  2VXD A;  4LIU A;  2XF7 A;  2M4K A;  4E6K G;  3H35 A;  4PUS A;  3ZGK A;  1MNE A;  3CZ6 A;  1V5F A;  1BOB A;  4RM3 A;  1EA3 A;  2WAE A;  3DPL C;  4DBQ A;  4KIS A;  3K4B A;  2F6C A;  3LFU A;  1PYV A;  3OYG A;  4PJN A;  3BC8 A;  3UNG C;  5KCM A;  3MKZ A;  4F55 A;  4II3 A;  1GLN A;  4E7J A;  4ITV A;  3DLA A;  1QHH D;  4Y33 A;  3OYI A;  4YEJ A;  4HNT A;  1X4O A;  2MD0 A;  4EAT A;  5LFA A;  2KHM A;  3W2A A;  1ZEL A;  3A1Y A;  2R7U A;  2ELJ A;  4PJM A;  2IGM A;  2ZXH A;  2ZFU A;  3OIP A;  3G2B A;  1HA8 A;  2CV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...