2KRCA

Solution structure of the n-terminal domain of bacillus subtilis delta subunit of rna polymerase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal domain of Bacillus subtilis delta subunit of RNA polymerase and its classification based on structural homologs
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit delta
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2krcA01
2M4KA 2KRCA 4NC8A 4NC7A
chains in the Genus database with same CATH superfamily
5ED4A 1IUYA 2PJPA 1OCTC 4O3MA 3TDUC 4HAMA 4UY8I 1UZCA 4FX0A 2H1LA 4UB6C 3VFZA 1UHWA 4XMYA 4M9ZA 1AKHA 3GTMJ 1FPQA 3HYIA 2LBFB 2BBYA 3HUGA 1O3SA 3OSFA 3A0BC 2KL4A 4IHWA 3A0HC 4BJTA 2RV8A 4YIIA 3HOUJ 2DI3A 4G9YA 3GTOJ 1REPC 1YRNB 3QOPA 2EZIA 4C2UA 2QKMB 4NB5A 2QBYB 3FHZA 1SD7A 2N8GA 4JYKA 1MGTA 3I53A 5IP7J 4ESFA 1GVDA 2NRAC 3F6OA 1VNDA 2OZ6A 4ZZLA 3HOWJ 2HZTA 2LF7A 4F55A 2AXLA 3HGGA 3QOEA 2X4HA 3IH4A 1MBKA 3HRTA 4NC8A 1VQ7I 1STZA 2IA0A 2CUFA 3G1OA 4XKBA 2R7ZJ 5LLQA 2XAUA 3TL4X 4Y13A 2Q0OA 2X6XA 5JVGF 3M4OJ 3RPUA 3SQNA 3BCBA 2L5QA 2XUBA 4AYBA 3P5JA 1JKPC 3ZR8X 3T1BA 3GTGJ 4MFEA 2M34A 4Y3OA 1F4KA 1KA8A 1IV6A 3M8EA 1KZHA 2FX0A 1BIAA 1PJRA 4ZZDA 3SXYA 1IC8A 4N0BA 2EFQA 2ZXHA 2DA7A 4ENNA 3MKLA 3PUBA 2A61A 3WG7H 2NVYJ 1J59A 5ILSA 4J00A 4BBRJ 5BOXA 4HX4A 3DBLB 3S93A 1K4TA 4NC7A 5B66C 1HA8A 1ULYA 3H0GJ 2M0MA 4UUTA 3EPZA 2Z9OA 1RKWA 2ZBKA 3ZQFA 2F5CA 1X3UA 3M7GA 5M3FJ 1U5TC 2K9NA 2K7LA 3FXQA 2L7MP 2QYOA 1G3WA 4M3BA 1X3WB 4HRIA 1AWCA 1JTXA 3I4MJ 4Q47A 1O7FA 1O3RA 4X0GA 4PJJA 2YU3A 2IGNA 5EZHA 3S1MJ 1Y56A 2DA6A 4KNYA 1EH7A 2P7VB 1E0EA 2FMYA 2GOXB 4QLCU 3N4MA 2XGDA 1ETWA 2CU7A 5IYCJ 4C2TA 2P4WA 2CJJA 3FX3A 3I55I 3TW7A 2BY1A 5FLVA 1WI3A 3NWTA 3GZ5A 2BHZA 2LY2A 1F5TA 5GPAA 1MDMA 2XPVA 3R6SA 2ZJ2A 2HNHA 3B6CA 3TO7A 2MLGA 4PCQA 4BHCA 4GDFA 2HDWA 2XDVA 2DT7B 3L2RA 2FUG2 2JSCA 4AU7A 2Z1DA 1SANA 1MNEA 2MW8A 2XHKA 2XAGA 3OYKA 2K9QA 1VQOI 2FU4A 4PJMA 2AO9A 5KK1A 2L4AA 3PIOF 1WHUA 1VQ8I 2CRGA 3DKYA 1AHDP 2JPBA 3HTUA 4OIQF 4I2OA 2ZMEB 2RC4A 3JRBA 3HBLA 3DV8A 5D8LB 2P5LC 5IOZA 1OQYA 3HOSA 4UV8A 4EJVA 4K2EA 4MHGA 3OSGA 1K78B 1P9QC 1W4MA 3MKYB 2YU9J 4IHTA 2D2WA 2F6CA 3O8HA 4KDPA 2DQLA 4CZCA 3ABLH 4OOIA 1FMVA 3U2RA 5CVUA 3E6MA 4BXXJ 1JUSA 3K4KA 3F8MA 3GCMA 4D1QA 4BQNA 3F9KA 2R7DA 3L09A 2VKEA 2ZMEA 5HLGA 2WADA 2WY7Q 4M72A 4LITA 3F72A 3JRCA 3H3VK 4ZJZA 2TCTA 2X6YA 3IH3A 4DGWB 1VQMI 3S1QJ 5EJCA 3QYBA 4EGYA 2OQRA 2NYXA 3F8FA 2ZXJA 3CLOA 3FMSA 3K0LA 2XROA 2BYVE 4DIQA 3S3NA 1ZR4A 4E7KA 2IS4A 2F4OB 4E7SA 2DFIA 4UV9A 3P7NA 5LD2C 3OYEA 3KEQA 5FKKA 3A01A 3ZQGA 3GBGA 2WB1N 3E7LA 2FQ3A 5KNLA 1TT0A 2Z2SB 4KIFA 3L7WA 2P7CB 2Q8KA 4IRHA 1IRZA 4B44A 4BJ5C 3WE2A 2XAFA 2HXOA 1FNNA 4I0BA 1ZREA 5F6FA 2M8EA 4RB1A 2LMDA 3GZ6A 1TNSA 4LLNA 5FB2A 1BN5A 3CCYA 2A5YB 2HQRA 2ZXWH 3HM5A 3OYDA 1Z0XA 3N97A 3LSTA 4BQAA 1OLTA 2VPRA 3CDIA 3HTSB 1NK3P 4LB5A 3BZCA 2CW0F 2DK5A 4KISA 1G4DA 5A2QK 5E79C 1RRJA 1TWAJ 4XRSA 3HC7A 4M73A 1K6OA 2A07F 1QU3A 2DJNA 3ML6A 5JFRA 5HDNA 3OV8A 3RI4A 2R3SA 3ZGKA 3ISPA 4Z6YA 3MCZA 1TQIA 2ZB9A 1GXPA 4G94A 1RC9A 4DZPA 5EEGA 4P96A 2ZSIB 4KFCA 3Q3SA 5HNFA 4KA4A 1U78A 3Q9SA 4LLGF 1Z6TA 4G12A 5LRSA 1G59A 4DYRA 2R5YB 2E7WA 3ZPLA 4O6JA 1SFEA 3RKXA 4HNVA 5D5VB 3CCVI 2QZ8A 2ZSHB 1TNTA 2WV1A 3DPTA 3ZQLA 2LLKA 2KKOA 4ABZA 3L9FA 4MEYF 4XICA 2COBA 1YS7A 1WPKA 2BY3A 1MBEA 2BY0A 1XD7A 4IRIA 4H4KC 3IRQA 3K70C 2FXAA 1JUMA 3F3XA 5ICEA 5EG0B 3X2QH 2EINH 2P6TA 1FWZA 3VSLA 1W36D 1OCCH 3GEZA 2WAQA 1PUFB 2M2EA 2ZNYA 2L54A 5CQGA 4AUXA 1SVMA 5KCMA 2PFBA 3E5UA 2O3FA 1NTCA 3BT9A 2VIXA 3JTHA 3TGNA 2W82A 3DQVC 2W1OA 3DLAA 3KEYA 3V7RA 1PP7U 2FQ4A 4A3EJ 1BOAA 2EB7A 4A5NA 3PIPF 1MSFC 1IRGA 4M3GA 2QEXI 3E1SA 1ON1A 5FFXA 4LB6B 3ZMVA 1IN7A 2R7RA 4EJUA 5JLWA 2VC1A 1VI0A 2MABA 3CMAI 2L7KA 2H6BA 4DW6A 2R7QA 1OFCX 2V1XA 3HEFA 2ZO4A 2AQFA 2Y69H 4UVCA 5IPAA 4BHPA 3FBNB 3VYRB 1RETA 4A3LJ 1IZ1A 3U21A 4XRMA 3DTEA 3HHGA 4XLHA 4B3AA 3LA7A 4RLFA 3HB9A 1B8IB 2ZFUA 1B72A 2YPRA 3T8TA 2E2HJ 3HSFA 2LOOA 1R23A 1HOMA 2DW4A 3S2WA 2FSWA 2DJIA 2QUFA 5JR3A 3L2QA 2RNGA 5FKLA 1YYVA 3KLOA 3BG7A 5AIPA 4RAYA 3P9IA 2ZCWA 1ZG5A 3ERED 3BR2A 5C4XJ 3J81K 1FP1D 5BS6A 1FOKA 5DCMA 1KU2A 1X1PA 5E3OA 2XAQA 2DMNA 2PBIA 1FTZA 2DFHA 3HZJA 4PGHA 2W4SA 1XGNA 3CDHA 2KDZA 1X1AA 1GHCA 1H9GA 3MZYA 1RPWA 2DOFA 3IWZA 1Y39A 1QZYA 4YIFA 4DBQA 5IP9J 4R79A 3Q5FA 3ELKA 4BUPA 3A2KA 4WXCA 2GA1A 5LBQA 1I6HJ 3BPVA 4KT6A 4BQQA 5IY5H 1N78A 2LF8A 1QVUA 1J9IA 1QHHD 1P7IA 3B02A 3IKTA 1FBSA 1T95A 3ZOBA 4A6DA 2E60A 1YRNA 1ETQA 4M9SA 2Y48A 4X6AJ 2NXNB 2G7HA 3KCCA 4AIKA 4IPAA 5GPCA 5FLMJ 2VQCA 1OCZH 3K9TA 4II2A 2HKXA 1KQ9A 4KIGA 1VFCA 1G3YA 1GV5A 3ZCOA 2UWMA 5TJJA 2E5NA 3HGYA 1R4NB 4CCKA 1O7LA 2L0KA 2WC2A 4XKCA 3J7ZI 3PQKA 1P4XA 3C2BA 4XIDA 1NH3A 1T6SA 3FBIB 4L9JA 4B8XA 1ORKA 5KAIC 3TQNA 2ZJPF 4CGZA 5E17F 2LY1A 5TISC 5IP6A 2DA2A 4XOPA 1I1GA 3HOVJ 1UG0A 3T5XA 2ZFWA 3R4KA 1WI9A 4OMZA 2DMQA 1PUEE 1QQIA 2LFBA 2WWYA 3GTLJ 4HX7A 3CCLI 2UV1A 1RR7A 4UUSB 2CMPA 3GO5A 1NK2P 2EA4A 4XN3A 2VBZA 2R5ZB 5LGUA 1YLFA 3K4BA 3IUOA 1TTYA 4ZYHA 2Q2EA 1TWGJ 1IO2A 2NOJB 3A4CA 4CUGA 1TP4A 2W24A 3BDDA 2B9SA 4AC0A 1C0WA 1TQMA 4I7HA 3WHCA 3DPUA 3NWSA 1H8AC 2PJRB 1DP3A 3Q0UA 3CUOA 1WGXA 3E6DA 2GM4A 2KISA 4HBLA 2GOMA 4V2GA 1X2MA 1LNWA 5J8FA 1IV8A 1OCRH 1W7PA 3EDPA 3M1EA 2O0YA 2PMHA 1KQ0A 1OR7C 3DTKA 5H6QA 2CUZA 2WAQN 2VOPA 4ZC3A 4I98B 1Z67A 2E19A 2DCEA 4QIWN 4BU2A 3GFIA 2Y0SA 2DODA 3OY9A 3PO2J 2YS9A 3ABMH 1VZ0A 4LK0F 3LNQA 3L2UA 3ZMDA 2V1NA 1YIOA 2XAHA 2AQEA 1GLNA 2DQRA 3G71I 1ETKA 4E70A 4NQWA 4NBQA 5BPIA 2QBYA 5DCMB 4UVBA 4HLXA 1KONA 1IG7A 1J2XA 2CUJA 4DJAA 3M3YJ 1MKMA 3BR5A 1DPUA 2M3AA 1LFBA 4I09A 5E1ZB 1T08B 2E2IJ 2EZKA 3K2ZA 1TQPA 1YX5A 2L3DA 4ENKA 4PSXA 1GT0C 1WWXA 5DD4A 2ECCA 1JJ6C 2STTA 3PO3J 1YOVB 2VJ4A 4AVZA 3AG3H 2YUSA 4HYEA 5CKTA 3E6CC 1B9NA 2VXDA 4B43A 3GUDA 4UUSA 1KGSA 4IJAA 3VYUB 3CC7I 2LH9A 3Q9VA 5L3DA 4C3HJ 3BJAA 4C30A 4YFXF 4HDUA 4A3CJ 5FD5A 3H1CA 4FASD 2V4JC 1ZELA 3CUQA 1FYKA 2V9PA 4A0YA 2XKOA 5BMZA 2E1CA 1V5EA 5FJ8J 4RB0A 3J7YJ 4RAZA 3CF5F 4GGGA 2Z16A 5IYDJ 4XLNF 2V79A 4I99C 2H6CA 2K3PA 3I54A 4NDLA 4FE7A 1TBXA 1H0MA 1WSUA 4G6DA 3RZDJ 4CZZA 3LL7A 3KYDB 2VT2A 5EDNA 2X1CA 1IF1A 4LIUA 2VLAA 1VQ4I 3KLNA 2CV2A 3OOPA 4MEXF 1MIJA 3OYLA 2GLOA 1ERDA 2E35A 1HKQA 3N05A 4BDYA 1ZHFA 3TW6A 4HSTA 2O6GE 5LHHA 2R7OA 3BP8A 5ILVA 1ONVA 3FMQA 1Z91A 4F3QA 1Z1DA 4A6EA 1DPRA 2PMZA 3K6GA 2BVMA 1O3TA 2VXZA 2RNJA 3CO7C 5D4RA 4BBSJ 3W2WA 2MYSA 4CCOA 1OISA 1S7EA 4QPQA 4BXUA 2FMLA 1MD0A 2B0LA 5FRNA 2GXGA 4HA8A 2RDPA 3S14J 1KU3A 4PZJA 2CWEA 2IBDA 4GFBA 1QNTA 1HBXG 4WXDA 3GYHX 1B6AA 3F8BA 2EBIA 1LE8A 2VI6A 3AL0B 1F36A 2VJJA 1Y8QB 3OYNA 2FA5A 2XRLA 1ZGJA 2DYRH 2EA2A 5F64A 5L3FA 2HTJA 1SAUA 3WGHA 1N77A 3EUHC 4Y4RA 2IA1A 1FLIA 4RGSA 1G6NA 2VKDA 1D1AA 2COMA 3CP8A 3IH2A 4DZJA 2BW3B 3EUHA 2WAFA 4A0ZA 3RDIA 3R0AA 2FE3A 2OJED 2KZGA 1IGNA 3ZQCA 3MKWB 4Q5SF 1UB9A 3S1RJ 5EYRA 1HSJA 4OWRB 3K4CA 2IT0A 3MZ8A 3I58A 2FBKA 2FNPA 1JJ8C 4I01A 1B59A 2CUEA 3F8CA 1S9HA 3J81Z 1IUFA 1FIPA 3ASOH 3GLXA 3SZPA 4B48A 5JHFA 1WJFA 4CYCA 3FK6A 2NS8A 4EM0B 2MC3A 1ZARA 3RIRA 4RMNA 1D3YA 1YW7A 2KZVA 5BQTA 2Y75A 4BACA 2DDAA 5DD8A 4C3IJ 1Y8RB 3QPTA 3JCUC 5K7FA 1FBUA 2LNBA 2LSOA 3LWFA 4AM3A 4EJTA 2W57A 5IYBJ 2Y9ZA 4RAFA 1T0FC 3V8JA 1U8BA 4EJWA 1ACIA 1YJNI 4WXHA 1DU0A 3BTLA 2HTSA 5LRRA 5GAEJ 2G0EA 2LYCA 2IEKA 2YSRA 1DUXC 1A04A 4KITB 2DPDA 3V42A 2MD5A 2P5VA 2P81A 3EYYA 2XIGA 1QHGA 4G8XA 3HIFA 4ESJA 1BIBA 5C4JJ 1PP8F 5IT3A 2EZHA 3K2AA 1FOWA 3C18A 4B09A 1B1BA 4CCNA 1JT6A 1HF0A 5D6EA 3QWLA 2HOSA 2Q2EB 3BR6A 2W48A 3RYPA 3PNYA 1ZTRA 2QQAA 2FD5A 2DDBA 1TLHB 4PJLA 5K5RA 2JVHA 3CZ6A 4BY7J 1VQPI 1DP7P 3BLYA 2K5CA 1A6QA 1SAXA 1HXDA 1XCVA 5ERIA 2R0QC 1YJ9I 5DV5A 3L2CA 5H20A 1MW7A 2HYFA 2CW7A 1O3QA 5F0FA 1HKTA 1ZKGA 2K9LA 1LDJA 3H35A 3H36A 3FXRA 4J19A 1LFPA 5KVRA 1WCMJ 2JPCA 1IW7F 2Y0MA 4KT5C 1YE9A 2ZNZA 4XK4A 2DMTA 3TOAA 3KYLA 1Y6IA 2VOOA 3D5RC 4HQMA 3RQIA 4RGRA 3VEPA 5CVJA 2O7OA 3TEDA 5J1YA 5GAGJ 3CMEI 4LMYA 3D5SC 1Z9CA 1YG2A 2QQ8A 4E7IA 3SJMA 2R7UA 4U0WA 1J75A 2XAJA 2D1HA 5HVQC 4M6YA 2BXYA 1WJ5A 3VYSB 3NQOA 1U9NA 2LVSA 3C7JA 4XRSG 3EETA 1IAWA 2IGMA 4RS8A 4F91B 3QQAA 2VODA 1MMSA 4O5VA 5DM6F 2V7FA 3WODF 4PGGA 2ID6A 5D5XB 4A3JJ 1JGSA 1I3QJ 2O8KA 3PNTA 4LK1F 2R93J 3ABKH 1LEBA 5J1RA 5F04A 1ZR2A 3EQLF 3VB2A 1FEXA 5D8KB 1MBJA 5D6FA 2DU9A 2LG4A 5E8IA 1X58A 3F23A 2WB1A 2X1EA 5F0CA 1KQ8A 4JK1X 3GMEA 5HNHA 2CG4A 1QVTA 1YIJI 2EJRA 1HW1A 3CTAA 5E3NA 5B5EC 2YR2A 2MC4A 1S5LC 3RKYA 3I56I 1ETXA 3W6JB 4OIOF 2KPMA 3OR2C 4CHUA 3S2HJ 4BAYA 4X1EA 2EFWA 2ECBA 4EEFG 1WH7A 1POGA 2LTPA 1HDDC 3S16J 4U87A 5CPRB 1S6LA 1U2WA 5TRDA 2NOGA 3IAM2 3J7AY 1BI1A 3I71A 5A2QZ 2VE9A 4FT8A 3TMOA 2Z5UA 2NVTJ 2IS1A 1X4PA 3BROA 3I59B 4U88A 2ZMEC 1DQUA 4IXAA 3FK7A 1XG1A 1W7PD 3G1LA 1TW2A 4FHTA 5E1XA 2V1DA 3OYHA 1K61A 2HR3A 2PN6A 1R4MB 5L3CA 1OKRA 1GVJA 4N4OB 3RQ4A 3WE3A 1IRXA 4CA0A 1X1BA 5E3MA 3D1NI 1FJLA 2MH2A 5FO5A 2XGEA 4AIHA 1SFOJ 2CSOA 4M3DA 2DMPA 4IHYA 1V4RA 1G8XA 4YELA 1QO0D 2LRDA 1YS6A 2HQNA 2MBFA 4HNUA 3DBHB 2W00A 2ZKZA 5DEQA 2J5PA 2OC6A 3G1MA 2L02A 1BR1A 3HOYJ 4RM3A 3CLQA 3WU2C 3FIWA 4FCYA 1MH4A 4KN7X 3QAHA 3CCJI 3BPXA 2BVLA 2QQBA 4YFKF 1SC7A 1W0UA 2D5VA 3BJOA 2BXZA 1BL0A 1BR2A 2ICWG 2F5VA 2VQGA 3HL2A 3RPQA 4EV0A 2DFEA 4NHJA 2QM3A 1M1EB 2FBIA 5J6XA 3PM1A 3CMYA 1QPMA 3KX2A 4MLOA 4QSHA 4BEHB 3KP3A 1D8KA 4P9UA 1T38A 4BDZA 3RTRA 3HJEA 2E1MB 3LSGA 2HYGD 1FP2A 5HS9A 3SFIA 2WBMA 4AWXB 4EQQA 1F9NA 3DU6A 5DCFA 4D9JA 2LDUA 1UFMA 3G6EI 3FKIJ 2CV1A 3MMYB 1Z3XA 2A3SA 4JX5A 1OYIA 3OS1A 3C2GA 2WY8Q 3DF8A 3PFIA 2HOEA 4DBRA 4L5IA 3KZIC 2VC0A 1CF7A 2O03A 2OU2A 1Z7LA 1XGMA 3ZN0A 2OZUA 3O6BB 1W5CC 3OYAA 3HG9A 1FX7A 1OJLA 3KEOA 3SZGA 1RR8C 2F5FA 3I5UA 2W84A 2O8XA 4LJZF 4L5JA 4LG0B 3H5AA 2FBHA 2R4GA 5EEHA 2R7TA 1XMXA 4XLEA 1ZN2A 4ZYDA 3CCUI 1U5TB 1VQKI 4L0YB 3H5NA 2EZLA 1XDUA 2GWRA 2VBWA 3BWGA 3H9JA 2ESHA 1R7JA 1HDPA 2PX9A 2L01A 2VKHA 4AIDA 1OYWA 3BZKA 2M0CA 3CJNA 3WTVC 4PK4A 1SFUA 4RB3C 1JE8A 2L4MA 3AFHA 1A31A 3FM5A 4ASNA 2CQXA 2KQRA 3IWFA 2DPUA 4KMFA 1APLC 3QP5A 5EEAA 3JSPA 2OV7A 1KYWA 2E2JJ 4ITVA 3H9QA 2V1UA 1QRYA 3IHUA 1FBQA 2UXXA 2XASA 2IVMA 2P6SA 2W25A 4A2UA 1YX3A 1FOXA 2M7AA 4M3FA 4CXFA 4WCGA 3A02A 2A68F 4D5CA 5GADJ 2STWA 3E97A 2R92J 2IS6A 2BZTA 3TBIA 3SYTA 3LOCA 1F43A 5BNGA 2ME0A 2CFXA 4BE1A 2LK2A 2NVUB 5ICCA 1ZG1A 1UMQA 1W1WE 1Z05A 3J80Z 3G73A 3LAPA 2I8DA 2GBYA 1OCPA 1X1CA 1Y1VJ 3ABTA 3WTWC 5J4VA 3L1PA 3GLLA 2HQ5A 1WH5A 3PFYA 1VQ5I 3CDLA 1RZ4A 3GX4X 3F21A 1YJWI 4E6KG 2A6HF 2EH3A 1CGPA 3L00A 4A3DJ 2M9HA 1FSEA 1MMNA 2EQRA 3VPRA 1PYVA 1HCRA 4L5EA 1USSA 2HWVA 5F1RA 3FXOA 3G3ZA 2TRTA 1WVRA 5FLXZ 3OYGA 1SEUA 3RCOA 4IZZA 5LGTA 5FKOA 1MDMB 4OU0A 2L2OA 3I3LA 3CC4I 2K9MA 1YITI 2QLZA 3ZQQA 3E3VA 2ADUA 2HZDA 2RVCA 4A0XA 4GXOA 2MLKA 3TKYA 3PL8A 1YI2I 3L2VA 1CF7B 1Y0UA 3HPGA 2XC7A 3D0SA 1JKRC 5EGOA 1OYYA 4R1HA 1XTAA 3WTZA 4EM2A 2VT3A 2EFPA 4CYCB 2OD5A 2AHQA 3GF2A 1LVAA 4YEJA 3UR3C 4C9YA 3GWZA 3GW2A 2HQAA 2D1VA 2OA4A 3KZYA 3LFKA 2FF4A 1UJ8A 5BPDA 3JRFA 3WTSC 3IKVA 5FGMA 3E5QA 1P4WA 1U6GA 2ISZA 3HDDA 2K4JA 4GCVA 3MAJA 3BTIA 2P5KA 3J80K 4OAYA 3RYRA 2Y0SN 1VQNI 1Q1VA 2XRNA 1SMTA 3W2VA 1QZEA 1Z7UA 3CD6I 3K1NA 4MFDA 1YW9A 2WA0A 3Q0VA 2IP2A 1BW6A 3CC2I 4KMUX 1LKXA 3SZTA 1S3JA 1TWCJ 1J09A 4MO7A 1D0ZA 4FETA 1ITYA 2EV6A 4ENMA 3QPHA 2B7EA 2QCOA 2NNNA 3C1DA 1S8NA 4AYBN 3K70D 4HV5A 1LE8B 3CJTB 4V19K 1P4AA 4ETSA 3V7SA 4BYYA 2KRHA 2DFFA 3HRUA 4F93B 2CQNA 3KZZA 1IXCA 2EIMH 3HSRA 4OINF 5EGOB 4PDKA 1FSHA 3PUFA 5J47A 5FLXK 2VKVA 2EFNA 1R00A 2CYYA 1SFKA 4HLYA 1AU7A 3FF5A 4GRIA 1BC7C 3GTPJ 4IOCF 2FOWA 1IDZA 1GV2A 4G7ZF 1W0TA 3F0CA 2HPIA 3SEQA 1KYZA 4N9IA 4EJOA 2X6WA 5JVTA 1WJBA 2DO7A 2OTLI 2A6TA 2M8GX 2IJLA 2HDCA 1WFXA 3LFUA 3ZMTA 2X6OA 3O8GA 1OR7A 4HF0A 2KJBA 5ILUA 3GTQJ 4JOMA 4B3XA 3AG4H 1J7KA 2M45A 4A3IJ 1MNDA 3COAC 4Y33A 2G7UA 3V4GA 2X51A 1U5TA 5M5XJ 4A3KJ 2Z3YA 2JWTA 3NAUA 4RGUA 1EH8A 2ZC2A 5E1WA 3M1CA 4R8HA 3DP7A 2RAEA 3I9V2 1CQTA 2B63J 2LKSA 3BQYA 4M71A 3BG5A 1NG6A 2F2EA 1KU7A 3LSIA 4ZYEA 3VWBA 2OTJI 4BY1J 2QF7A 1Z6RA 3PSFA 1JHHA 1MBFA 5CQEA 4A3MJ 1A35A 3S17J 4LD5A 3ZXSA 2X0LA 1N75A 3CCEI 2VJ5A 2YX4A 4A69C 5D4SA 2H27A 3DU5A 1LUJB 2FNAA 5LHGA 2QGUA 3RKWA 1OMIA 3JRDA 4MTDA 1K4SA 2XF7A 2ZJRF 2W7NA 4UNOA 2HOTA 1FIAA 2UXNA 2FEZA 4JBAA 4QTRA 3NARA 3F6VA 1U3EM 1V54H 4IHXA 1B4AA 5IT9Z 2QKLB 2XSDC 3FISA 5B1BH 4U7BA 1E3PA 1R1TA 4L9VA 3EUAA 3CJRB 4OIRF 1R5GA 2EPFA 1S7OA 5K5QA 3HHHA 2E1NA 2RN7A 5EG0A 1QZZA 5HLHA 3PJRA 1D0XA 4M6VA 3T8RA 2MH9A 3ERMA 2UUZA 1TZLA 4WF2A 5E3LA 2MD0A 3TOBA 3W6VA 2HOAA 2L9SA 1G3SA 3DKWA 1YTYA 2QVOA 2NVXJ 4ZYAA 3BG6A 4XKVA 2M1BA 5HODA 4OAZA 3ECOA 2LP0A 2KRCA 4UXNA 4Q4ZF 3JAMK 4DOZA 4BS9A 2VPLA 2V9VA 4GYGA 4KIBA 1SD5A 4BE0A 1E3HA 4PSWA 4GO1A 2HVSA 2P8TA 2L7FP 2WV0A 1LPQA 1XN7A 1ZK8A 3DTIA 4HZFA 5E20A 2E36A 2PMZN 1BR4A 4XL9A 1W7PB 3IRRA 1WJCA 5LEKA 3R60A 3HSEA 1WRJA 4XLPF 3WGGA 4XN0A 4HV6A 1T39A 2EWNA 3E5XA 4OMYA 1MMDA 1TT5B 1E3OC 2YX7A 2IPQX 3LMMA 1UHSA 2LKXA 3LSJA 3BCAA 1PVEA 1Q1HA 2CW8A 3TDZC 3Q0WA 4Y52J 2HI3A 2OBPA 5E18F 1B72B 4LGWA 3SFZA 2VN2A 4XLCA 3MFKA 4KN4X 1U0JA 3ZMSA 2K4BA 2R5ZA 5KAFC 3LSPA 2KIMA 5C3EJ 3PSIA 2OUMA 4U0VA 2M30A 2UZKA 1R1VA 3B73A 3JW4A 3FXLA 2BV6A 1DGWY 3BTJA 3CJQB 2JMWA 3RJPA 5KHDA 5CVVA 5B3SH 4P9FA 5M3MJ 1TWHJ 1XCBA 1I6XA 2KP6A 3REOA 4IHVA 1SVLA 4XOTA 3CQZJ 3AL0C 2JRMA 2HVRA 2R7XA 3GZNB 4PJNA 4CH7A 1X4OA 5B1AH 1ENHA 4C3JJ 5FKMA 3DWLE 2QSHX 4HW0A 3CCRI 4LOCA 1I3AA 3BG3A 2CFOA 4OIPF 3IL2A 2CQ7A 4I76A 3HOXJ 1ZAOA 1R49A 1Y0NA 3K4LA 3ABUA 3OR1C 4M6XA 4EMSA 2R7VA 3OS2A 2QSFX 2A6EF 3DFGA 2H1KA 3RZOJ 4ON0A 1EA3A 3DXJF 2A69F 2DA5A 3OYCA 1LFUP 1RESA 1EF4A 1JUPA 4E4HA 4PJ0C 4IVNA 2V6EA 1RI7A 1BBYA 2JVGA 2DXIA 4XM3A 1ZG3A 3I0TA 4YFNF 3UKGA 1FZPB 5F0HA 2WTEA 4HNTA 4EATA 4HSRA 2VBXA 3BOQA 4II3A 2HGCA 3QYFA 5J4YA 5LFAA 4B1RA 2DA3A 4A3GJ 4BNCA 2IA2A 3HOTA 3FWEA 3CCSI 2LREA 4PFOA 2IGKA 5J40A 3BC8A 3DCFA 3HRMA 2F4IA 3OIPA 1FMWA 2X85A 4Y17A 2JUCA 2JRTA 2GA2A 1GUUA 3LQRA 2MFZA 4F92B 4I0AA 2DTZA 1FYMA 1EH6A 2VQLA 4KYWA 3HOZJ 2ZXIA 1ZLKA 3WTUC 5CVIA 4RLQA 4CCMA 4HPQA 3CUQB 1P2FA 1X19A 5LEJA 1D1BA 4KICA 1ZH5A 2K86A 3H92A 2IRFG 2CS3A 3DPLC 4HOBA 1R58A 1R22A 2MSYA 4A3BJ 3LQQA 1QBJA 3AKZA 1LDKB 2TDXA 2I5UA 2RQPA 3OYBA 2EFOA 3DKXA 5C44J 2OCEA 5FFZA 1K6YA 4EGZA 1SFXA 2IGOA 4L18B 4AVPA 2EILH 1FY7A 1XX5A 1K79A 3S2DJ 4UB8C 3DEWA 3O3KA 5FKNA 2CH0A 2H09A 4AIJA 4CCJA 5CLSA 4LG0A 5DYMA 1HC8A 1VF9A 2HEOA 1ZRFA 5L3GA 5K7ZA 2HU9A 2HVQA 3HUGB 2GIVA 3NEUA 2E34A 4P55A 5HDKA 1S72I 2O61A 1BOBA 4M3EA 2BW3A 3FXMA 3K4MA 3C3WA 3GVAA 2QENA 1LJ9A 2F48A 2Z99A 3OYIA 2GQQA 9ANTA 3ZRGA 2EIKH 4RM2A 4XR6A 3T0YA 2F5DA 1D5YA 2DOEA 4BGDA 2KMUA 4ZTFA 4LFUA 4XQFA 2DBBA 1E17A 1MJ9A 5GTHC 5K5OA 1X3ZB 5LHIA 1YQAA 4N9HA 4GYIA 2JSPA 1GXQA 4U7DA 1MJAA 4FE4A 5CYVA 1LEAA 1FC3A 2O5RA 3K1PA 5DS9A 1H9TA 1ON2A 3W2AA 3R61A 3OYFA 2LY9A 3ZN1A 4L9NA 1UHMA 4F7ZA 1XS9A 4HF1A 3ECHA 3M8JA 1B8IA 3LAJA 4FTHA 1MBGA 2RQQA 1GDTA 3WTTC 5D5WB 5K1YA 4JX4A 2H8WA 2XB5A 3GFLA 3LA2A 2K02A 1X2NA 4JX6A 4ESBA 1V3FA 3ZP5A 1R9TJ 2DOAA 2FJ1A 5JI6A 1JGGA 1O57A 1EJ9A 2W85A 3BJ6A 2HXIA 4XSZF 2DTRA 2ISYA 4LG3A 2DT6A 1MSEC 2BHYA 4I6ZA 1I27A 1LB2A 1JI8A 3MN2A 2XPUA 5HLTA 2FRHA 5J1UA 3MVPA 4JP0A 2VBYA 1I39A 1ODDA 3H3UA 2JQ7A 1MMGA 1XC5A 3AG2H 2JN6A 4WX9A 2H94A 5DTDA 3L2WA 5M5WJ 1ZRDA 4FQGA 2ID3A 4NC6A 5TGTA 5H2FC 3S3OA 2V9KA 2BGCA 3HKZA 3VYTB 2C6YA 1FYLA 3MEXA 3OIQA 3W6KB 4D5FA 5IT9K 5HLIA 3QPSA 1U9OA 4AD9A 1FTTA 1K7AA 4BEHA 1JKQC 2PMUA 2ZJQF 1ETVA 4IQJA 2ELHA 3MZHA 3EUKL 3K69A 1T0FA 5F1JA 1L3LA 4XKWA 4CDGA 4IOAF 2Z33A 3SDBA 3VOEA 2ELJA 2EIJH 3KFWX 3H9GA 4IL6C 5ICGA 1NG7A 2R7FA 2IXSA 3ZQ7A 1R5HA 4G6TB 2JA5J 4EM1A 3MD2A 4MQVA 3IV5A 1HLVA 1UAAA 3TO9A 1ZRCA 3S32A 2LR8A 1BA5A 1V55H 4ZDPA 2PG4A 1I5ZA 3JRAA 1DU6A 2F5EA 2MG4A 3FXKA 5E8GA 1BI0A 2VL8A 4IF4A 4XLFA 3U1DA 2JT1A 3JRIA 2ETHA 1K78A 4RGXA 2PEXA 3OS0A 1JXSA 4RAGA 3MQ0A 4XSXF 1JHFA 2E1MC 3TP3A 2IS2A 4YRVA 3ASNH 2L7ZA 2Y30A 4A93J 2QA4I 2EK5A 2L9VA 4QPOA 3FXUA 3BZ6A 2XF5A 4E7JA 2I10A 2DA1A 2E5ZA 1RKTA 3QODA 2XKPA 1I1SA 3CESA 1J5YA 1T56A 5HDGA 3FZVA 4BJ6C 1S29A 2L9RA 1UCRA 4XNFA 3K1MA 2OPTA 1IN8A 1L0OC 3QU3A 5D5UB 3JREA 3I4PA 2R5YA 3BQZA 1QPIA 1ZYRF 5HOOA 1V5GA 1DGRM 1BM9A 5AIQA 1XSXA 2VJIA 1F1ZA 3DLLF 1QA6A 2JA8J 2JTVA 3MWMA 1O4XA 1JT0A 2LBFA 1P7JA 2DN0A 5J3LA 4C2MJ 1W36C 2KT0A 4EVIA 2JJ7A 1BJZA 1W5SA 2DK8A 3G2BA 1MH3A 4P5OA 2XSJC 3HKZN 2DYSH 2K3FA 2X48A 1R1UA 3ZMUA 5GP9A 4U0YA 1BI2A 1QGPA 4NUBA 3JRHA 3HPHA 4ZH4F 3OOUA 3UNGC 3QPLA 1R6RA 3P9CA 4IHSA 1K83J 2IW5A 3V8KA 2AS5F 4Y15A 2VONA 4PUSA 4ANJA 4FISA 3A03A 4WK8F 4S0HB 2Q1ZB 1IXRC 3ZQHA 1AOYA 1B9MA 4CYDA 2K40A 1YO5C 3P9KA 5J8CA 4RA2A 3F8NA 2VB6A 3OIOA 3JR9A 3F22A 2V6CA 1HQCA 4MQ9F 5DM7F 2KJCA 2DA4A 3ROUA 1BC8C 3H3ZA 1A36A 2Y31A 1MMAA 3I4NJ 4IEJA 1BJAA 3M8FA 2P0WA 4FX4A 1RIOH 3JAMZ 5LGNA 1WJEA 3OYMA 1RUOA 2RKHA 5GTIC 2KFDA 2JK3A 4B47A 4E7LA 2DT5A 3QP6A 3WU0A 1ETOA 2CGPA 2LC2A 3SEZA 1Z77A 4HX8A 4MIMA 4ZYGA 4RDUA 3A1YA 3PQJA 2BY2A 3VDXA 5IOYA 4ZDOA 1TWFJ 4HQEA 1KU9A 1D8JA 3HRSA 4DYCA 4WWCA 2XB0X 3BR0A 1XPXA 1IN4A 1IDYA 4UHTA 1R71A 2QSGX 3FM3A 3SHFA 2V26A 2Y2ZA 2JA6J 2HFHA 4MNUA 1R5ID 2K9SA 1T98A 5EF6A 4E7HA 1U8RA 3U1KA 4TV7A 4W97A 4XLAA 3LSRA 2XPWA 1NHAA 3E0JB 3K10A 2PQ8A 3SDGA 4F52A 4ZTJA 1YW8A 1RNLA 3K4NA 2JZYA 3A01B 2VUMJ 2PJRA 1AA7A 5ICFA 3CP2A 1PDNC 3GFMA 4CO8A 3BR1A 5L3BA 1BW5A 2X9DA 4BHBA 4ZDLA 3ONQA 3BG9A 3AG1H 2ME6A 1TC3C 4KUMA 3LA3A 1SD4A 2XVCA 4L9TA 1XMKA 1R36A 3S1NJ 2CQQA 3FMRA 3U9GA 5L3EA 1J0RA 1E2XA 4G6QA 1IJWC 3HXLA 1LVKA 2A05A 3WTXC 3ULQB 1XSDA 1H88C 1T33A 4B4CA 1H89C 4H0EA 4J01A 1UG2A 3S8PA 4S05A 1ZQ3P 1BI3A 4XONA 3H0DA 4BE2A 3O2PE 3CCMI 1OCOH 2XGCA 1G2HA 2KHMA 3OYJA 4IO9F 2GAUA 2XF6A 2J5OA 5H6RA 3WG9A 1WJAA 3ZMZA 2IAIA 4D0PA 4W1UA 3KP7A 4L0ZB 2VE8A 3VSKA 4ENJA 1WJDA 3OL4A 3M07A 1VTNC 1P6RA 2GXBA 3OMYA 5K7HA 3VODA 1PUFA 1XGOA 3DEEA 4HDVA 3TO6A 2EV0A 2Y9YA 3H5RA 4XORA 3GXOA 1HKSA 3I59A 3QRFF 5HS7A 1WZ2A 2A5WA 2KIUA 3LSKA 3KP5A 4LLLA 1T8IA 2ACJA 3J7AO 2M4GA 3MKZA 4E7ZA 3C2HA 4JQFA 2NS0A 1ETYA 5FROA 3CO6C 3K4JA 3CMMA 1V5FA 2DAOA 3FDYA 5FD6A 1EV7A 2FOKA 4HEA2 3BTCA 4A3FJ 3WGIA 2NVQJ 5FRMA 4Y7NJ 4I02A 1XDSA 3KP2A 3KE2A 4G7HF 1DDNA 3FKJA 2VQHA 2QWWA 2M7BA 4IRGA 3M9AA 1XSVA 4RB2C 1G3TA 2DLLA 2KDOA 3B6AA 4LIVA 4A12A 5DUIA 1RUNA 2GIZA 3I64A 4BKXA 1HW2A 3EYIA 3S3MA 4UVAA 1EKEA 2G9WA 2D45A 2OF7A 2RREA 3FXJA 3KYCB 1A5JA 1XMAA 2QQ9A 5AONA 3GTKJ 1UELB 3WHBA 3BY6A 3DEUA 4DQ2A 3KETA 2CQKA 2XGXA 3CF2A 2HS5A 1P92A 3OL3A 4P1WA 1IN6A 3OWTA 1SVOA 2HPMA 5CJ9A 3RPUD 1ZGWA 4UUVA 1N25A 2MGQA 4S04A 1MBHA 2HYJA 2AXTC 3KIOA 4DYQA 3JSOA 1JTYA 3W3CA 2PI0A 1T2KA 3G4SI 3QU6A 4CCLA 4D7MA 2F4MB 1MZBA 1Z21A 4IQ4A 1WKMA 3KPHA 4V2FA 1IXSB 4M9XA 3FHNA 1Z3YA 2ELKA 3DBRB 2EV5A 1TW3A 3R0JA 2XV4S 1AKHB 3KP6A 1ZGAA 3D5LA 4XRFA 4CICA 3V7CA 3LSMA 3S15J 1D0YA 2KIQA 1HW5A 4NQWB 2OQGA 1A6IA 1X1DA 2JA7J 4QWQA 1IRFA 4HF2A 1FT9A 5HS8A 4NNJA 1YHQI 4BQOA 4BL0B 5F27A 2CO5A 4M74A 1I50J 2H8RA 2PLYA 1SMYF 1D5VA 3PNVA 2L9NA 5GAHJ 5DDGA 2JUGA 1IN5A 2KIFA 2M5WA 3AAFA 2RGVA 5DUKA 5M5YJ 2E1OA 2K85A 2JA2A 1MNMC 1JKOC 2HKOA 4Q48A 1FOYA 5CVRA 2BOLA 2DMUA 2OCCH 4XBFA 3RKQA 2BEOA 4HG2A 1HSTA 2E7XA 1VQ6I 3E6BA 3K7AJ 1WQ2A 4IX7A 1S7AA 1USTA 4Z2YA 1YFHA 2GXAA 4G7OF 3CCQI 2M87A 3NRVA 3GTJJ 3JTGA 3IC7A 2M4KA 1VQLI 3ZQIA 2K27A 2OAZA 4KJZA 2R7WA 1Y1WJ 4BXFA 6PAXA 1MJBA 3LSHA 1VQ9I 2LKPA 2MA3A 2VASA 2LD5A 2O9LA 2NS7A 3BR3A 4D7NA 1LDDA 4DNCA 4N4NB 4MTEA 2BE5F 3RSNA 4YIRX 3JRGA 2CV0A 4PFPA 4A5MA 2KLOA 1OPCA 3V8LA 2KRFA 3ESWB 3QYEA 2R7SA 3IAS2 3IP4B 2NAZA 3GFJA 2GZWA 2X1DA 3KP4A 2HDDA 4IKFA 2NNYA 3TP0A 1TL8A 1XB4A 1W5TA 5EZGA 5JLXA 4CSWA 4YG2F 3WU1B 2ESNA 3WTYC 1SD6A 1ZLJA 1LQ1A 2WAEA 4MGRA 1D1CA 5F08A 3CUQC 4RBOA 1XGSA 2E71A 4BH9A 5JHUA
chains in the Genus database with same CATH topology
1VZ0A 2VKHA 2RQQA 3L2UA 4PK4A 3AFHA 4XMYA 2V1NA 2LBFB 2AQEA 2KQRA 1GLNA 2KL4A 2DOAA 2OV7A 4BJTA 4ITVA 3H9QA 1KONA 1YX3A 4C2UA 2QKMB 2M7AA 4LG3A 2CUJA 2DT6A 4DJAA 2IS6A 2M3AA 3TBIA 3SYTA 1JI8A 5HLTA 1YX5A 4PSXA 4BE1A 4F55A 3QOEA 4NC8A 1MMGA 2I8DA 2VJ4A 3L2WA 1X1CA 4AVZA 5CKTA 4XKBA 5TGTA 2VXDA 4B43A 2V9KA 3HKZA 3VYTB 3S3OA 3PFYA 2XAUA 3TL4X 3OIQA 4E6KG 3VYUB 2LH9A 2X6XA 4BEHA 4C30A 3BCBA 2L5QA 1MMNA 4AYBA 4IQJA 1PYVA 3EUKL 4FASD 2V4JC 3ZR8X 4XKWA 1ZELA 4Y3OA 1V5EA 3SDBA 2ELJA 3OYGA 3RCOA 4IZZA 1PJRA 2Z16A 2L2OA 3I3LA 2K9MA 3H9GA 3ZQQA 2HZDA 2K3PA 2ZXHA 1NG7A 3PUBA 2IXSA 3PL8A 3L2VA 4G6TB 4J00A 3HPGA 2XC7A 3LL7A 3MD2A 3S93A 4NC7A 1HA8A 1UAAA 2M0MA 2X1CA 4LIUA 3S32A 2VLAA 4C9YA 4YEJA 3UR3C 2CV2A 3EPZA 3OYLA 4ZDPA 1ERDA 2HQAA 3N05A 4BDYA 4HSTA 2VL8A 4HRIA 2R7OA 4XLFA 4F3QA 3OS0A 4X0GA 4PJJA 2IGNA 2E1MC 2PMZA 3K6GA 1Y56A 4OAYA 2IS2A 4YRVA 2BVMA 2VXZA 3W2VA 1E0EA 2GOXB 2MYSA 3W2WA 4CCOA 2WA0A 4QPOA 4QPQA 2XF5A 4E7JA 1LKXA 4C2TA 5FRNA 2E5ZA 1J09A 3QODA 1D0ZA 3CESA 3NWTA 4FETA 2LY2A 4BJ6C 3K70D 2HNHA 4XNFA 2HDWA 2XDVA 2KRHA 2DT7B 3L2RA 3AL0B 2FUG2 4F93B 4AU7A 2Z1DA 2VJJA 1MNEA 3OYNA 3OYKA 5HOOA 4PJMA 1V5GA 1SAUA 1N77A 3EUHC 4Y4RA 1DGRM 1SFKA 3DKYA 4GRIA 2VJIA 2VKDA 1D1AA 3CP8A 2BW3B 2LBFA 2HPIA 2WAFA 3SEQA 1W36C 2X6WA 3HOSA 1WJBA 2A6TA 1WFXA 3G2BA 3LFUA 3MKWB 1P9QC 4P5OA 4OWRB 2XSJC 3MKYB 3K4CA 4NUBA 3HPHA 3OOUA 2F6CA 4JOMA 3UNGC 4B3XA 1R6RA 1S9HA 4CZCA 1MNDA 4Y33A 1FMVA 2X51A 4PUSA 4B48A 4ANJA 5JHFA 1WJFA 3K4KA 2Q1ZB 4D1QA 4RMNA 4BQNA 3F9KA 2KZVA 2WADA 2WY7Q 4LITA 3M1CA 2VB6A 3I9V2 4ZJZA 4BACA 1NG6A 2X6YA 4DGWB 1MMAA 3LSIA 3VWBA 3QYBA 1T0FC 2P0WA 3PSFA 4DIQA 5CQEA 3S3NA 4E7KA 2IS4A 3ZXSA 2LYCA 4E7SA 1WJEA 3OYMA 5LD2C 4KITB 1N75A 2VJ5A 4B47A 3OYEA 3V42A 4E7LA 3DU5A 3GBGA 5KNLA 1TT0A 2Z2SB 2LC2A 3SEZA 1QHGA 4B44A 2XF7A 4BJ5C 3A1YA 3VDXA 4ZDOA 2W7NA 2QKLB 3OYDA 4U7BA 2V26A 4CCNA 3CJRB 1OLTA 3EUAA 4E7HA 3PJRA 4XLAA 2Q2EB 4KISA 1D0XA 3PNYA 3E0JB 3K10A 4F52A 4PJLA 2JVHA 2UUZA 3CZ6A 4ZTJA 1TZLA 3HC7A 3BLYA 2K5CA 2MD0A 3K4NA 1QU3A 2L9SA 2PJRA 3ZGKA 1AA7A 3CP2A 4ZYAA 3BG6A 4XKVA 4OAZA 4ZDLA 2KRCA 1MW7A 3ONQA 2CW7A 2ZSIB 4DOZA 4BS9A 2VPLA 5HNFA 2K9LA 3H35A 1G59A 1LFPA 4BE0A 1YE9A 2ZSHB 3KYLA 3HXLA 3DPTA 1LVKA 4PSWA 2HVSA 1Y6IA 3D5RC 3DTIA 4J01A 3S8PA 1BR4A 4XL9A 4XONA 3H0DA 4BE2A 1WJCA 2KHMA 3OYJA 2XF6A 1WJAA 3D5SC 4H4KC 3K70C 4XN0A 4E7IA 2R7UA 3VSKA 1WJDA 3OL4A 3VSLA 1MMDA 5HVQC 1W36D 3OMYA 2WAQA 1WJ5A 3LMMA 3VYSB 3BCAA 5CQGA 2CW8A 5KCMA 3DEEA 2IGMA 4F91B 4XLCA 3H5RA 4XORA 2V7FA 2VIXA 1U0JA 2W82A 3DQVC 2A5WA 2W1OA 3DLAA 3KEYA 3LSKA 3PNTA 2M4GA 2OUMA 3PSIA 3MKZA 3E1SA 4E7ZA 3C2HA 4JQFA 1DGWY 5FROA 3CJQB 3K4JA 3CMMA 1V5FA 3FDYA 5KHDA 2R7RA 4HEA2 2MABA 2L7KA 2LG4A 5FRMA 2R7QA 2KP6A 2WB1A 2X1EA 4XOTA 2AQFA 3AL0C 2HVRA 3FBNB 2R7XA 3FKJA 4PJNA 3VYRB 1X4OA 4CH7A 2VQHA 5HNHA 2M7BA 3U21A 3DTEA 4XLHA 4RLFA 3DWLE 2MC4A 2ZFUA 2KDOA 4LIVA 2CFOA 2LOOA 2KPMA 3S3MA 3OR2C 2DJIA 3L2QA 2RNGA 3K4LA 3OR1C 3BG7A 2R7VA 2RREA 3OS2A 4U87A 5CPRB 1EA3A 3IAM2 3OYCA 3J7AY 1UELB 3TMOA 4E4HA 2IS1A 1X4PA 2V6EA 3CF2A 2JVGA 2DXIA 1DQUA 2W4SA 4XM3A 3OL3A 4P1WA 4HNTA 3OWTA 4EATA 4HSRA 1X1AA 2HPMA 4II3A 3RPUD 3QYFA 5LFAA 3OYHA 3HOTA 4N4OB 3RQ4A 4DBQA 1IRXA 4R79A 4CA0A 2LREA 4PFOA 4BUPA 2IGKA 1X1BA 3A2KA 3BC8A 3OIPA 2F4IA 1FMWA 2X85A 4KT6A 3W3CA 4BQQA 1N78A 1QHHD 4CCLA 4F92B 2MFZA 1T95A 1Z21A 4IQ4A 1G8XA 4YELA 2E60A 2VQLA 3FHNA 2LRDA 1Z3YA 2ZXIA 4HNUA 2W00A 4RLQA 4CCMA 4HPQA 2VQCA 2OC6A 4II2A 1X19A 3D5LA 1D1BA 1BR1A 3ZCOA 2UWMA 3LSMA 4RM3A 2CS3A 1D0YA 2E5NA 3DPLC 4CCKA 4XKCA 4NQWB 3AKZA 1LDKB 1X1DA 2BVLA 3FBIB 1BR2A 3OYBA 3DKXA 4NNJA 4BQOA 4BL0B 2F5VA 2VQGA 3HL2A 1K6YA 2IGOA 2LY1A 4XOPA 3PNVA 2L9NA 2JUGA 1UG0A 3KX2A 4MLOA 4BEHB 4BDZA 3RTRA 2CH0A 2JA2A 4CCJA 2E1MB 3LSGA 2UV1A 2CMPA 2BOLA 2WBMA 4XN3A 4D9JA 3DU6A 2HU9A 2HVQA 3HUGB 3IUOA 3K4BA 4HG2A 2CV1A 3MMYB 1Z3XA 4IX7A 3OS1A 3C2GA 2NOJB 2WY8Q 3A4CA 4CUGA 4DBRA 1BOBA 2BW3A 3K4MA 2M4KA 1Z7LA 4KJZA 2R7WA 4BXFA 3LSHA 3OYIA 3DPUA 3NWSA 2PJRB 2VASA 3ZRGA 1DP3A 4RM2A 3OYAA 4XR6A 4BGDA 3HG9A 2KMUA 4N4NB 3SZGA 3RSNA 4ZTFA 2CV0A 4XQFA 2GOMA 4PFPA 2KLOA 3QYEA 2R7SA 3IAS2 3IP4B 3H5AA 2R4GA 2X1DA 1OR7C 2R7TA 3DTKA 4IKFA 2CUZA 2JSPA 4XLEA 4ZC3A 4CSWA 2O5RA 3W2AA 2DCEA 2WAEA 1D1CA 3H5NA 3OYFA 4BU2A 2Y0SA 3OY9A 3H9JA 3M8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4K A;  2KRC A;  4NC8 A;  4NC7 A; 
#chains in the Genus database with same CATH topology
 5ED4 A;  1IUY A;  2PJP A;  1OCT C;  4O3M A;  3TDU C;  4HAM A;  4UY8 I;  1UZC A;  4FX0 A;  2H1L A;  4UB6 C;  3VFZ A;  1UHW A;  4XMY A;  4M9Z A;  1AKH A;  3GTM J;  1FPQ A;  3HYI A;  2LBF B;  2BBY A;  3HUG A;  1O3S A;  3OSF A;  3A0B C;  2KL4 A;  4IHW A;  3A0H C;  4BJT A;  2RV8 A;  4YII A;  3HOU J;  2DI3 A;  4G9Y A;  3GTO J;  1REP C;  1YRN B;  3QOP A;  2EZI A;  4C2U A;  2QKM B;  4NB5 A;  2QBY B;  3FHZ A;  1SD7 A;  2N8G A;  4JYK A;  1MGT A;  3I53 A;  5IP7 J;  4ESF A;  1GVD A;  2NRA C;  3F6O A;  1VND A;  2OZ6 A;  4ZZL A;  3HOW J;  2HZT A;  2LF7 A;  4F55 A;  2AXL A;  3HGG A;  3QOE A;  2X4H A;  3IH4 A;  1MBK A;  3HRT A;  4NC8 A;  1VQ7 I;  1STZ A;  2IA0 A;  2CUF A;  3G1O A;  4XKB A;  2R7Z J;  5LLQ A;  2XAU A;  3TL4 X;  4Y13 A;  2Q0O A;  2X6X A;  5JVG F;  3M4O J;  3RPU A;  3SQN A;  3BCB A;  2L5Q A;  2XUB A;  4AYB A;  3P5J A;  1JKP C;  3ZR8 X;  3T1B A;  3GTG J;  4MFE A;  2M34 A;  4Y3O A;  1F4K A;  1KA8 A;  1IV6 A;  3M8E A;  1KZH A;  2FX0 A;  1BIA A;  1PJR A;  4ZZD A;  3SXY A;  1IC8 A;  4N0B A;  2EFQ A;  2ZXH A;  2DA7 A;  4ENN A;  3MKL A;  3PUB A;  2A61 A;  3WG7 H;  2NVY J;  1J59 A;  5ILS A;  4J00 A;  4BBR J;  5BOX A;  4HX4 A;  3DBL B;  3S93 A;  1K4T A;  4NC7 A;  5B66 C;  1HA8 A;  1ULY A;  3H0G J;  2M0M A;  4UUT A;  3EPZ A;  2Z9O A;  1RKW A;  2ZBK A;  3ZQF A;  2F5C A;  1X3U A;  3M7G A;  5M3F J;  1U5T C;  2K9N A;  2K7L A;  3FXQ A;  2L7M P;  2QYO A;  1G3W A;  4M3B A;  1X3W B;  4HRI A;  1AWC A;  1JTX A;  3I4M J;  4Q47 A;  1O7F A;  1O3R A;  4X0G A;  4PJJ A;  2YU3 A;  2IGN A;  5EZH A;  3S1M J;  1Y56 A;  2DA6 A;  4KNY A;  1EH7 A;  2P7V B;  1E0E A;  2FMY A;  2GOX B;  4QLC U;  3N4M A;  2XGD A;  1ETW A;  2CU7 A;  5IYC J;  4C2T A;  2P4W A;  2CJJ A;  3FX3 A;  3I55 I;  3TW7 A;  2BY1 A;  5FLV A;  1WI3 A;  3NWT A;  3GZ5 A;  2BHZ A;  2LY2 A;  1F5T A;  5GPA A;  1MDM A;  2XPV A;  3R6S A;  2ZJ2 A;  2HNH A;  3B6C A;  3TO7 A;  2MLG A;  4PCQ A;  4BHC A;  4GDF A;  2HDW A;  2XDV A;  2DT7 B;  3L2R A;  2FUG 2;  2JSC A;  4AU7 A;  2Z1D A;  1SAN A;  1MNE A;  2MW8 A;  2XHK A;  2XAG A;  3OYK A;  2K9Q A;  1VQO I;  2FU4 A;  4PJM A;  2AO9 A;  5KK1 A;  2L4A A;  3PIO F;  1WHU A;  1VQ8 I;  2CRG A;  3DKY A;  1AHD P;  2JPB A;  3HTU A;  4OIQ F;  4I2O A;  2ZME B;  2RC4 A;  3JRB A;  3HBL A;  3DV8 A;  5D8L B;  2P5L C;  5IOZ A;  1OQY A;  3HOS A;  4UV8 A;  4EJV A;  4K2E A;  4MHG A;  3OSG A;  1K78 B;  1P9Q C;  1W4M A;  3MKY B;  2YU9 J;  4IHT A;  2D2W A;  2F6C A;  3O8H A;  4KDP A;  2DQL A;  4CZC A;  3ABL H;  4OOI A;  1FMV A;  3U2R A;  5CVU A;  3E6M A;  4BXX J;  1JUS A;  3K4K A;  3F8M A;  3GCM A;  4D1Q A;  4BQN A;  3F9K A;  2R7D A;  3L09 A;  2VKE A;  2ZME A;  5HLG A;  2WAD A;  2WY7 Q;  4M72 A;  4LIT A;  3F72 A;  3JRC A;  3H3V K;  4ZJZ A;  2TCT A;  2X6Y A;  3IH3 A;  4DGW B;  1VQM I;  3S1Q J;  5EJC A;  3QYB A;  4EGY A;  2OQR A;  2NYX A;  3F8F A;  2ZXJ A;  3CLO A;  3FMS A;  3K0L A;  2XRO A;  2BYV E;  4DIQ A;  3S3N A;  1ZR4 A;  4E7K A;  2IS4 A;  2F4O B;  4E7S A;  2DFI A;  4UV9 A;  3P7N A;  5LD2 C;  3OYE A;  3KEQ A;  5FKK A;  3A01 A;  3ZQG A;  3GBG A;  2WB1 N;  3E7L A;  2FQ3 A;  5KNL A;  1TT0 A;  2Z2S B;  4KIF A;  3L7W A;  2P7C B;  2Q8K A;  4IRH A;  1IRZ A;  4B44 A;  4BJ5 C;  3WE2 A;  2XAF A;  2HXO A;  1FNN A;  4I0B A;  1ZRE A;  5F6F A;  2M8E A;  4RB1 A;  2LMD A;  3GZ6 A;  1TNS A;  4LLN A;  5FB2 A;  1BN5 A;  3CCY A;  2A5Y B;  2HQR A;  2ZXW H;  3HM5 A;  3OYD A;  1Z0X A;  3N97 A;  3LST A;  4BQA A;  1OLT A;  2VPR A;  3CDI A;  3HTS B;  1NK3 P;  4LB5 A;  3BZC A;  2CW0 F;  2DK5 A;  4KIS A;  1G4D A;  5A2Q K;  5E79 C;  1RRJ A;  1TWA J;  4XRS A;  3HC7 A;  4M73 A;  1K6O A;  2A07 F;  1QU3 A;  2DJN A;  3ML6 A;  5JFR A;  5HDN A;  3OV8 A;  3RI4 A;  2R3S A;  3ZGK A;  3ISP A;  4Z6Y A;  3MCZ A;  1TQI A;  2ZB9 A;  1GXP A;  4G94 A;  1RC9 A;  4DZP A;  5EEG A;  4P96 A;  2ZSI B;  4KFC A;  3Q3S A;  5HNF A;  4KA4 A;  1U78 A;  3Q9S A;  4LLG F;  1Z6T A;  4G12 A;  5LRS A;  1G59 A;  4DYR A;  2R5Y B;  2E7W A;  3ZPL A;  4O6J A;  1SFE A;  3RKX A;  4HNV A;  5D5V B;  3CCV I;  2QZ8 A;  2ZSH B;  1TNT A;  2WV1 A;  3DPT A;  3ZQL A;  2LLK A;  2KKO A;  4ABZ A;  3L9F A;  4MEY F;  4XIC A;  2COB A;  1YS7 A;  1WPK A;  2BY3 A;  1MBE A;  2BY0 A;  1XD7 A;  4IRI A;  4H4K C;  3IRQ A;  3K70 C;  2FXA A;  1JUM A;  3F3X A;  5ICE A;  5EG0 B;  3X2Q H;  2EIN H;  2P6T A;  1FWZ A;  3VSL A;  1W36 D;  1OCC H;  3GEZ A;  2WAQ A;  1PUF B;  2M2E A;  2ZNY A;  2L54 A;  5CQG A;  4AUX A;  1SVM A;  5KCM A;  2PFB A;  3E5U A;  2O3F A;  1NTC A;  3BT9 A;  2VIX A;  3JTH A;  3TGN A;  2W82 A;  3DQV C;  2W1O A;  3DLA A;  3KEY A;  3V7R A;  1PP7 U;  2FQ4 A;  4A3E J;  1BOA A;  2EB7 A;  4A5N A;  3PIP F;  1MSF C;  1IRG A;  4M3G A;  2QEX I;  3E1S A;  1ON1 A;  5FFX A;  4LB6 B;  3ZMV A;  1IN7 A;  2R7R A;  4EJU A;  5JLW A;  2VC1 A;  1VI0 A;  2MAB A;  3CMA I;  2L7K A;  2H6B A;  4DW6 A;  2R7Q A;  1OFC X;  2V1X A;  3HEF A;  2ZO4 A;  2AQF A;  2Y69 H;  4UVC A;  5IPA A;  4BHP A;  3FBN B;  3VYR B;  1RET A;  4A3L J;  1IZ1 A;  3U21 A;  4XRM A;  3DTE A;  3HHG A;  4XLH A;  4B3A A;  3LA7 A;  4RLF A;  3HB9 A;  1B8I B;  2ZFU A;  1B72 A;  2YPR A;  3T8T A;  2E2H J;  3HSF A;  2LOO A;  1R23 A;  1HOM A;  2DW4 A;  3S2W A;  2FSW A;  2DJI A;  2QUF A;  5JR3 A;  3L2Q A;  2RNG A;  5FKL A;  1YYV A;  3KLO A;  3BG7 A;  5AIP A;  4RAY A;  3P9I A;  2ZCW A;  1ZG5 A;  3ERE D;  3BR2 A;  5C4X J;  3J81 K;  1FP1 D;  5BS6 A;  1FOK A;  5DCM A;  1KU2 A;  1X1P A;  5E3O A;  2XAQ A;  2DMN A;  2PBI A;  1FTZ A;  2DFH A;  3HZJ A;  4PGH A;  2W4S A;  1XGN A;  3CDH A;  2KDZ A;  1X1A A;  1GHC A;  1H9G A;  3MZY A;  1RPW A;  2DOF A;  3IWZ A;  1Y39 A;  1QZY A;  4YIF A;  4DBQ A;  5IP9 J;  4R79 A;  3Q5F A;  3ELK A;  4BUP A;  3A2K A;  4WXC A;  2GA1 A;  5LBQ A;  1I6H J;  3BPV A;  4KT6 A;  4BQQ A;  5IY5 H;  1N78 A;  2LF8 A;  1QVU A;  1J9I A;  1QHH D;  1P7I A;  3B02 A;  3IKT A;  1FBS A;  1T95 A;  3ZOB A;  4A6D A;  2E60 A;  1YRN A;  1ETQ A;  4M9S A;  2Y48 A;  4X6A J;  2NXN B;  2G7H A;  3KCC A;  4AIK A;  4IPA A;  5GPC A;  5FLM J;  2VQC A;  1OCZ H;  3K9T A;  4II2 A;  2HKX A;  1KQ9 A;  4KIG A;  1VFC A;  1G3Y A;  1GV5 A;  3ZCO A;  2UWM A;  5TJJ A;  2E5N A;  3HGY A;  1R4N B;  4CCK A;  1O7L A;  2L0K A;  2WC2 A;  4XKC A;  3J7Z I;  3PQK A;  1P4X A;  3C2B A;  4XID A;  1NH3 A;  1T6S A;  3FBI B;  4L9J A;  4B8X A;  1ORK A;  5KAI C;  3TQN A;  2ZJP F;  4CGZ A;  5E17 F;  2LY1 A;  5TIS C;  5IP6 A;  2DA2 A;  4XOP A;  1I1G A;  3HOV J;  1UG0 A;  3T5X A;  2ZFW A;  3R4K A;  1WI9 A;  4OMZ A;  2DMQ A;  1PUE E;  1QQI A;  2LFB A;  2WWY A;  3GTL J;  4HX7 A;  3CCL I;  2UV1 A;  1RR7 A;  4UUS B;  2CMP A;  3GO5 A;  1NK2 P;  2EA4 A;  4XN3 A;  2VBZ A;  2R5Z B;  5LGU A;  1YLF A;  3K4B A;  3IUO A;  1TTY A;  4ZYH A;  2Q2E A;  1TWG J;  1IO2 A;  2NOJ B;  3A4C A;  4CUG A;  1TP4 A;  2W24 A;  3BDD A;  2B9S A;  4AC0 A;  1C0W A;  1TQM A;  4I7H A;  3WHC A;  3DPU A;  3NWS A;  1H8A C;  2PJR B;  1DP3 A;  3Q0U A;  3CUO A;  1WGX A;  3E6D A;  2GM4 A;  2KIS A;  4HBL A;  2GOM A;  4V2G A;  1X2M A;  1LNW A;  5J8F A;  1IV8 A;  1OCR H;  1W7P A;  3EDP A;  3M1E A;  2O0Y A;  2PMH A;  1KQ0 A;  1OR7 C;  3DTK A;  5H6Q A;  2CUZ A;  2WAQ N;  2VOP A;  4ZC3 A;  4I98 B;  1Z67 A;  2E19 A;  2DCE A;  4QIW N;  4BU2 A;  3GFI A;  2Y0S A;  2DOD A;  3OY9 A;  3PO2 J;  2YS9 A;  3ABM H;  1VZ0 A;  4LK0 F;  3LNQ A;  3L2U A;  3ZMD A;  2V1N A;  1YIO A;  2XAH A;  2AQE A;  1GLN A;  2DQR A;  3G71 I;  1ETK A;  4E70 A;  4NQW A;  4NBQ A;  5BPI A;  2QBY A;  5DCM B;  4UVB A;  4HLX A;  1KON A;  1IG7 A;  1J2X A;  2CUJ A;  4DJA A;  3M3Y J;  1MKM A;  3BR5 A;  1DPU A;  2M3A A;  1LFB A;  4I09 A;  5E1Z B;  1T08 B;  2E2I J;  2EZK A;  3K2Z A;  1TQP A;  1YX5 A;  2L3D A;  4ENK A;  4PSX A;  1GT0 C;  1WWX A;  5DD4 A;  2ECC A;  1JJ6 C;  2STT A;  3PO3 J;  1YOV B;  2VJ4 A;  4AVZ A;  3AG3 H;  2YUS A;  4HYE A;  5CKT A;  3E6C C;  1B9N A;  2VXD A;  4B43 A;  3GUD A;  4UUS A;  1KGS A;  4IJA A;  3VYU B;  3CC7 I;  2LH9 A;  3Q9V A;  5L3D A;  4C3H J;  3BJA A;  4C30 A;  4YFX F;  4HDU A;  4A3C J;  5FD5 A;  3H1C A;  4FAS D;  2V4J C;  1ZEL A;  3CUQ A;  1FYK A;  2V9P A;  4A0Y A;  2XKO A;  5BMZ A;  2E1C A;  1V5E A;  5FJ8 J;  4RB0 A;  3J7Y J;  4RAZ A;  3CF5 F;  4GGG A;  2Z16 A;  5IYD J;  4XLN F;  2V79 A;  4I99 C;  2H6C A;  2K3P A;  3I54 A;  4NDL A;  4FE7 A;  1TBX A;  1H0M A;  1WSU A;  4G6D A;  3RZD J;  4CZZ A;  3LL7 A;  3KYD B;  2VT2 A;  5EDN A;  2X1C A;  1IF1 A;  4LIU A;  2VLA A;  1VQ4 I;  3KLN A;  2CV2 A;  3OOP A;  4MEX F;  1MIJ A;  3OYL A;  2GLO A;  1ERD A;  2E35 A;  1HKQ A;  3N05 A;  4BDY A;  1ZHF A;  3TW6 A;  4HST A;  2O6G E;  5LHH A;  2R7O A;  3BP8 A;  5ILV A;  1ONV A;  3FMQ A;  1Z91 A;  4F3Q A;  1Z1D A;  4A6E A;  1DPR A;  2PMZ A;  3K6G A;  2BVM A;  1O3T A;  2VXZ A;  2RNJ A;  3CO7 C;  5D4R A;  4BBS J;  3W2W A;  2MYS A;  4CCO A;  1OIS A;  1S7E A;  4QPQ A;  4BXU A;  2FML A;  1MD0 A;  2B0L A;  5FRN A;  2GXG A;  4HA8 A;  2RDP A;  3S14 J;  1KU3 A;  4PZJ A;  2CWE A;  2IBD A;  4GFB A;  1QNT A;  1HBX G;  4WXD A;  3GYH X;  1B6A A;  3F8B A;  2EBI A;  1LE8 A;  2VI6 A;  3AL0 B;  1F36 A;  2VJJ A;  1Y8Q B;  3OYN A;  2FA5 A;  2XRL A;  1ZGJ A;  2DYR H;  2EA2 A;  5F64 A;  5L3F A;  2HTJ A;  1SAU A;  3WGH A;  1N77 A;  3EUH C;  4Y4R A;  2IA1 A;  1FLI A;  4RGS A;  1G6N A;  2VKD A;  1D1A A;  2COM A;  3CP8 A;  3IH2 A;  4DZJ A;  2BW3 B;  3EUH A;  2WAF A;  4A0Z A;  3RDI A;  3R0A A;  2FE3 A;  2OJE D;  2KZG A;  1IGN A;  3ZQC A;  3MKW B;  4Q5S F;  1UB9 A;  3S1R J;  5EYR A;  1HSJ A;  4OWR B;  3K4C A;  2IT0 A;  3MZ8 A;  3I58 A;  2FBK A;  2FNP A;  1JJ8 C;  4I01 A;  1B59 A;  2CUE A;  3F8C A;  1S9H A;  3J81 Z;  1IUF A;  1FIP A;  3ASO H;  3GLX A;  3SZP A;  4B48 A;  5JHF A;  1WJF A;  4CYC A;  3FK6 A;  2NS8 A;  4EM0 B;  2MC3 A;  1ZAR A;  3RIR A;  4RMN A;  1D3Y A;  1YW7 A;  2KZV A;  5BQT A;  2Y75 A;  4BAC A;  2DDA A;  5DD8 A;  4C3I J;  1Y8R B;  3QPT A;  3JCU C;  5K7F A;  1FBU A;  2LNB A;  2LSO A;  3LWF A;  4AM3 A;  4EJT A;  2W57 A;  5IYB J;  2Y9Z A;  4RAF A;  1T0F C;  3V8J A;  1U8B A;  4EJW A;  1ACI A;  1YJN I;  4WXH A;  1DU0 A;  3BTL A;  2HTS A;  5LRR A;  5GAE J;  2G0E A;  2LYC A;  2IEK A;  2YSR A;  1DUX C;  1A04 A;  4KIT B;  2DPD A;  3V42 A;  2MD5 A;  2P5V A;  2P81 A;  3EYY A;  2XIG A;  1QHG A;  4G8X A;  3HIF A;  4ESJ A;  1BIB A;  5C4J J;  1PP8 F;  5IT3 A;  2EZH A;  3K2A A;  1FOW A;  3C18 A;  4B09 A;  1B1B A;  4CCN A;  1JT6 A;  1HF0 A;  5D6E A;  3QWL A;  2HOS A;  2Q2E B;  3BR6 A;  2W48 A;  3RYP A;  3PNY A;  1ZTR A;  2QQA A;  2FD5 A;  2DDB A;  1TLH B;  4PJL A;  5K5R A;  2JVH A;  3CZ6 A;  4BY7 J;  1VQP I;  1DP7 P;  3BLY A;  2K5C A;  1A6Q A;  1SAX A;  1HXD A;  1XCV A;  5ERI A;  2R0Q C;  1YJ9 I;  5DV5 A;  3L2C A;  5H20 A;  1MW7 A;  2HYF A;  2CW7 A;  1O3Q A;  5F0F A;  1HKT A;  1ZKG A;  2K9L A;  1LDJ A;  3H35 A;  3H36 A;  3FXR A;  4J19 A;  1LFP A;  5KVR A;  1WCM J;  2JPC A;  1IW7 F;  2Y0M A;  4KT5 C;  1YE9 A;  2ZNZ A;  4XK4 A;  2DMT A;  3TOA A;  3KYL A;  1Y6I A;  2VOO A;  3D5R C;  4HQM A;  3RQI A;  4RGR A;  3VEP A;  5CVJ A;  2O7O A;  3TED A;  5J1Y A;  5GAG J;  3CME I;  4LMY A;  3D5S C;  1Z9C A;  1YG2 A;  2QQ8 A;  4E7I A;  3SJM A;  2R7U A;  4U0W A;  1J75 A;  2XAJ A;  2D1H A;  5HVQ C;  4M6Y A;  2BXY A;  1WJ5 A;  3VYS B;  3NQO A;  1U9N A;  2LVS A;  3C7J A;  4XRS G;  3EET A;  1IAW A;  2IGM A;  4RS8 A;  4F91 B;  3QQA A;  2VOD A;  1MMS A;  4O5V A;  5DM6 F;  2V7F A;  3WOD F;  4PGG A;  2ID6 A;  5D5X B;  4A3J J;  1JGS A;  1I3Q J;  2O8K A;  3PNT A;  4LK1 F;  2R93 J;  3ABK H;  1LEB A;  5J1R A;  5F04 A;  1ZR2 A;  3EQL F;  3VB2 A;  1FEX A;  5D8K B;  1MBJ A;  5D6F A;  2DU9 A;  2LG4 A;  5E8I A;  1X58 A;  3F23 A;  2WB1 A;  2X1E A;  5F0C A;  1KQ8 A;  4JK1 X;  3GME A;  5HNH A;  2CG4 A;  1QVT A;  1YIJ I;  2EJR A;  1HW1 A;  3CTA A;  5E3N A;  5B5E C;  2YR2 A;  2MC4 A;  1S5L C;  3RKY A;  3I56 I;  1ETX A;  3W6J B;  4OIO F;  2KPM A;  3OR2 C;  4CHU A;  3S2H J;  4BAY A;  4X1E A;  2EFW A;  2ECB A;  4EEF G;  1WH7 A;  1POG A;  2LTP A;  1HDD C;  3S16 J;  4U87 A;  5CPR B;  1S6L A;  1U2W A;  5TRD A;  2NOG A;  3IAM 2;  3J7A Y;  1BI1 A;  3I71 A;  5A2Q Z;  2VE9 A;  4FT8 A;  3TMO A;  2Z5U A;  2NVT J;  2IS1 A;  1X4P A;  3BRO A;  3I59 B;  4U88 A;  2ZME C;  1DQU A;  4IXA A;  3FK7 A;  1XG1 A;  1W7P D;  3G1L A;  1TW2 A;  4FHT A;  5E1X A;  2V1D A;  3OYH A;  1K61 A;  2HR3 A;  2PN6 A;  1R4M B;  5L3C A;  1OKR A;  1GVJ A;  4N4O B;  3RQ4 A;  3WE3 A;  1IRX A;  4CA0 A;  1X1B A;  5E3M A;  3D1N I;  1FJL A;  2MH2 A;  5FO5 A;  2XGE A;  4AIH A;  1SFO J;  2CSO A;  4M3D A;  2DMP A;  4IHY A;  1V4R A;  1G8X A;  4YEL A;  1QO0 D;  2LRD A;  1YS6 A;  2HQN A;  2MBF A;  4HNU A;  3DBH B;  2W00 A;  2ZKZ A;  5DEQ A;  2J5P A;  2OC6 A;  3G1M A;  2L02 A;  1BR1 A;  3HOY J;  4RM3 A;  3CLQ A;  3WU2 C;  3FIW A;  4FCY A;  1MH4 A;  4KN7 X;  3QAH A;  3CCJ I;  3BPX A;  2BVL A;  2QQB A;  4YFK F;  1SC7 A;  1W0U A;  2D5V A;  3BJO A;  2BXZ A;  1BL0 A;  1BR2 A;  2ICW G;  2F5V A;  2VQG A;  3HL2 A;  3RPQ A;  4EV0 A;  2DFE A;  4NHJ A;  2QM3 A;  1M1E B;  2FBI A;  5J6X A;  3PM1 A;  3CMY A;  1QPM A;  3KX2 A;  4MLO A;  4QSH A;  4BEH B;  3KP3 A;  1D8K A;  4P9U A;  1T38 A;  4BDZ A;  3RTR A;  3HJE A;  2E1M B;  3LSG A;  2HYG D;  1FP2 A;  5HS9 A;  3SFI A;  2WBM A;  4AWX B;  4EQQ A;  1F9N A;  3DU6 A;  5DCF A;  4D9J A;  2LDU A;  1UFM A;  3G6E I;  3FKI J;  2CV1 A;  3MMY B;  1Z3X A;  2A3S A;  4JX5 A;  1OYI A;  3OS1 A;  3C2G A;  2WY8 Q;  3DF8 A;  3PFI A;  2HOE A;  4DBR A;  4L5I A;  3KZI C;  2VC0 A;  1CF7 A;  2O03 A;  2OU2 A;  1Z7L A;  1XGM A;  3ZN0 A;  2OZU A;  3O6B B;  1W5C C;  3OYA A;  3HG9 A;  1FX7 A;  1OJL A;  3KEO A;  3SZG A;  1RR8 C;  2F5F A;  3I5U A;  2W84 A;  2O8X A;  4LJZ F;  4L5J A;  4LG0 B;  3H5A A;  2FBH A;  2R4G A;  5EEH A;  2R7T A;  1XMX A;  4XLE A;  1ZN2 A;  4ZYD A;  3CCU I;  1U5T B;  1VQK I;  4L0Y B;  3H5N A;  2EZL A;  1XDU A;  2GWR A;  2VBW A;  3BWG A;  3H9J A;  2ESH A;  1R7J A;  1HDP A;  2PX9 A;  2L01 A;  2VKH A;  4AID A;  1OYW A;  3BZK A;  2M0C A;  3CJN A;  3WTV C;  4PK4 A;  1SFU A;  4RB3 C;  1JE8 A;  2L4M A;  3AFH A;  1A31 A;  3FM5 A;  4ASN A;  2CQX A;  2KQR A;  3IWF A;  2DPU A;  4KMF A;  1APL C;  3QP5 A;  5EEA A;  3JSP A;  2OV7 A;  1KYW A;  2E2J J;  4ITV A;  3H9Q A;  2V1U A;  1QRY A;  3IHU A;  1FBQ A;  2UXX A;  2XAS A;  2IVM A;  2P6S A;  2W25 A;  4A2U A;  1YX3 A;  1FOX A;  2M7A A;  4M3F A;  4CXF A;  4WCG A;  3A02 A;  2A68 F;  4D5C A;  5GAD J;  2STW A;  3E97 A;  2R92 J;  2IS6 A;  2BZT A;  3TBI A;  3SYT A;  3LOC A;  1F43 A;  5BNG A;  2ME0 A;  2CFX A;  4BE1 A;  2LK2 A;  2NVU B;  5ICC A;  1ZG1 A;  1UMQ A;  1W1W E;  1Z05 A;  3J80 Z;  3G73 A;  3LAP A;  2I8D A;  2GBY A;  1OCP A;  1X1C A;  1Y1V J;  3ABT A;  3WTW C;  5J4V A;  3L1P A;  3GLL A;  2HQ5 A;  1WH5 A;  3PFY A;  1VQ5 I;  3CDL A;  1RZ4 A;  3GX4 X;  3F21 A;  1YJW I;  4E6K G;  2A6H F;  2EH3 A;  1CGP A;  3L00 A;  4A3D J;  2M9H A;  1FSE A;  1MMN A;  2EQR A;  3VPR A;  1PYV A;  1HCR A;  4L5E A;  1USS A;  2HWV A;  5F1R A;  3FXO A;  3G3Z A;  2TRT A;  1WVR A;  5FLX Z;  3OYG A;  1SEU A;  3RCO A;  4IZZ A;  5LGT A;  5FKO A;  1MDM B;  4OU0 A;  2L2O A;  3I3L A;  3CC4 I;  2K9M A;  1YIT I;  2QLZ A;  3ZQQ A;  3E3V A;  2ADU A;  2HZD A;  2RVC A;  4A0X A;  4GXO A;  2MLK A;  3TKY A;  3PL8 A;  1YI2 I;  3L2V A;  1CF7 B;  1Y0U A;  3HPG A;  2XC7 A;  3D0S A;  1JKR C;  5EGO A;  1OYY A;  4R1H A;  1XTA A;  3WTZ A;  4EM2 A;  2VT3 A;  2EFP A;  4CYC B;  2OD5 A;  2AHQ A;  3GF2 A;  1LVA A;  4YEJ A;  3UR3 C;  4C9Y A;  3GWZ A;  3GW2 A;  2HQA A;  2D1V A;  2OA4 A;  3KZY A;  3LFK A;  2FF4 A;  1UJ8 A;  5BPD A;  3JRF A;  3WTS C;  3IKV A;  5FGM A;  3E5Q A;  1P4W A;  1U6G A;  2ISZ A;  3HDD A;  2K4J A;  4GCV A;  3MAJ A;  3BTI A;  2P5K A;  3J80 K;  4OAY A;  3RYR A;  2Y0S N;  1VQN I;  1Q1V A;  2XRN A;  1SMT A;  3W2V A;  1QZE A;  1Z7U A;  3CD6 I;  3K1N A;  4MFD A;  1YW9 A;  2WA0 A;  3Q0V A;  2IP2 A;  1BW6 A;  3CC2 I;  4KMU X;  1LKX A;  3SZT A;  1S3J A;  1TWC J;  1J09 A;  4MO7 A;  1D0Z A;  4FET A;  1ITY A;  2EV6 A;  4ENM A;  3QPH A;  2B7E A;  2QCO A;  2NNN A;  3C1D A;  1S8N A;  4AYB N;  3K70 D;  4HV5 A;  1LE8 B;  3CJT B;  4V19 K;  1P4A A;  4ETS A;  3V7S A;  4BYY A;  2KRH A;  2DFF A;  3HRU A;  4F93 B;  2CQN A;  3KZZ A;  1IXC A;  2EIM H;  3HSR A;  4OIN F;  5EGO B;  4PDK A;  1FSH A;  3PUF A;  5J47 A;  5FLX K;  2VKV A;  2EFN A;  1R00 A;  2CYY A;  1SFK A;  4HLY A;  1AU7 A;  3FF5 A;  4GRI A;  1BC7 C;  3GTP J;  4IOC F;  2FOW A;  1IDZ A;  1GV2 A;  4G7Z F;  1W0T A;  3F0C A;  2HPI A;  3SEQ A;  1KYZ A;  4N9I A;  4EJO A;  2X6W A;  5JVT A;  1WJB A;  2DO7 A;  2OTL I;  2A6T A;  2M8G X;  2IJL A;  2HDC A;  1WFX A;  3LFU A;  3ZMT A;  2X6O A;  3O8G A;  1OR7 A;  4HF0 A;  2KJB A;  5ILU A;  3GTQ J;  4JOM A;  4B3X A;  3AG4 H;  1J7K A;  2M45 A;  4A3I J;  1MND A;  3COA C;  4Y33 A;  2G7U A;  3V4G A;  2X51 A;  1U5T A;  5M5X J;  4A3K J;  2Z3Y A;  2JWT A;  3NAU A;  4RGU A;  1EH8 A;  2ZC2 A;  5E1W A;  3M1C A;  4R8H A;  3DP7 A;  2RAE A;  3I9V 2;  1CQT A;  2B63 J;  2LKS A;  3BQY A;  4M71 A;  3BG5 A;  1NG6 A;  2F2E A;  1KU7 A;  3LSI A;  4ZYE A;  3VWB A;  2OTJ I;  4BY1 J;  2QF7 A;  1Z6R A;  3PSF A;  1JHH A;  1MBF A;  5CQE A;  4A3M J;  1A35 A;  3S17 J;  4LD5 A;  3ZXS A;  2X0L A;  1N75 A;  3CCE I;  2VJ5 A;  2YX4 A;  4A69 C;  5D4S A;  2H27 A;  3DU5 A;  1LUJ B;  2FNA A;  5LHG A;  2QGU A;  3RKW A;  1OMI A;  3JRD A;  4MTD A;  1K4S A;  2XF7 A;  2ZJR F;  2W7N A;  4UNO A;  2HOT A;  1FIA A;  2UXN A;  2FEZ A;  4JBA A;  4QTR A;  3NAR A;  3F6V A;  1U3E M;  1V54 H;  4IHX A;  1B4A A;  5IT9 Z;  2QKL B;  2XSD C;  3FIS A;  5B1B H;  4U7B A;  1E3P A;  1R1T A;  4L9V A;  3EUA A;  3CJR B;  4OIR F;  1R5G A;  2EPF A;  1S7O A;  5K5Q A;  3HHH A;  2E1N A;  2RN7 A;  5EG0 A;  1QZZ A;  5HLH A;  3PJR A;  1D0X A;  4M6V A;  3T8R A;  2MH9 A;  3ERM A;  2UUZ A;  1TZL A;  4WF2 A;  5E3L A;  2MD0 A;  3TOB A;  3W6V A;  2HOA A;  2L9S A;  1G3S A;  3DKW A;  1YTY A;  2QVO A;  2NVX J;  4ZYA A;  3BG6 A;  4XKV A;  2M1B A;  5HOD A;  4OAZ A;  3ECO A;  2LP0 A;  2KRC A;  4UXN A;  4Q4Z F;  3JAM K;  4DOZ A;  4BS9 A;  2VPL A;  2V9V A;  4GYG A;  4KIB A;  1SD5 A;  4BE0 A;  1E3H A;  4PSW A;  4GO1 A;  2HVS A;  2P8T A;  2L7F P;  2WV0 A;  1LPQ A;  1XN7 A;  1ZK8 A;  3DTI A;  4HZF A;  5E20 A;  2E36 A;  2PMZ N;  1BR4 A;  4XL9 A;  1W7P B;  3IRR A;  1WJC A;  5LEK A;  3R60 A;  3HSE A;  1WRJ A;  4XLP F;  3WGG A;  4XN0 A;  4HV6 A;  1T39 A;  2EWN A;  3E5X A;  4OMY A;  1MMD A;  1TT5 B;  1E3O C;  2YX7 A;  2IPQ X;  3LMM A;  1UHS A;  2LKX A;  3LSJ A;  3BCA A;  1PVE A;  1Q1H A;  2CW8 A;  3TDZ C;  3Q0W A;  4Y52 J;  2HI3 A;  2OBP A;  5E18 F;  1B72 B;  4LGW A;  3SFZ A;  2VN2 A;  4XLC A;  3MFK A;  4KN4 X;  1U0J A;  3ZMS A;  2K4B A;  2R5Z A;  5KAF C;  3LSP A;  2KIM A;  5C3E J;  3PSI A;  2OUM A;  4U0V A;  2M30 A;  2UZK A;  1R1V A;  3B73 A;  3JW4 A;  3FXL A;  2BV6 A;  1DGW Y;  3BTJ A;  3CJQ B;  2JMW A;  3RJP A;  5KHD A;  5CVV A;  5B3S H;  4P9F A;  5M3M J;  1TWH J;  1XCB A;  1I6X A;  2KP6 A;  3REO A;  4IHV A;  1SVL A;  4XOT A;  3CQZ J;  3AL0 C;  2JRM A;  2HVR A;  2R7X A;  3GZN B;  4PJN A;  4CH7 A;  1X4O A;  5B1A H;  1ENH A;  4C3J J;  5FKM A;  3DWL E;  2QSH X;  4HW0 A;  3CCR I;  4LOC A;  1I3A A;  3BG3 A;  2CFO A;  4OIP F;  3IL2 A;  2CQ7 A;  4I76 A;  3HOX J;  1ZAO A;  1R49 A;  1Y0N A;  3K4L A;  3ABU A;  3OR1 C;  4M6X A;  4EMS A;  2R7V A;  3OS2 A;  2QSF X;  2A6E F;  3DFG A;  2H1K A;  3RZO J;  4ON0 A;  1EA3 A;  3DXJ F;  2A69 F;  2DA5 A;  3OYC A;  1LFU P;  1RES A;  1EF4 A;  1JUP A;  4E4H A;  4PJ0 C;  4IVN A;  2V6E A;  1RI7 A;  1BBY A;  2JVG A;  2DXI A;  4XM3 A;  1ZG3 A;  3I0T A;  4YFN F;  3UKG A;  1FZP B;  5F0H A;  2WTE A;  4HNT A;  4EAT A;  4HSR A;  2VBX A;  3BOQ A;  4II3 A;  2HGC A;  3QYF A;  5J4Y A;  5LFA A;  4B1R A;  2DA3 A;  4A3G J;  4BNC A;  2IA2 A;  3HOT A;  3FWE A;  3CCS I;  2LRE A;  4PFO A;  2IGK A;  5J40 A;  3BC8 A;  3DCF A;  3HRM A;  2F4I A;  3OIP A;  1FMW A;  2X85 A;  4Y17 A;  2JUC A;  2JRT A;  2GA2 A;  1GUU A;  3LQR A;  2MFZ A;  4F92 B;  4I0A A;  2DTZ A;  1FYM A;  1EH6 A;  2VQL A;  4KYW A;  3HOZ J;  2ZXI A;  1ZLK A;  3WTU C;  5CVI A;  4RLQ A;  4CCM A;  4HPQ A;  3CUQ B;  1P2F A;  1X19 A;  5LEJ A;  1D1B A;  4KIC A;  1ZH5 A;  2K86 A;  3H92 A;  2IRF G;  2CS3 A;  3DPL C;  4HOB A;  1R58 A;  1R22 A;  2MSY A;  4A3B J;  3LQQ A;  1QBJ A;  3AKZ A;  1LDK B;  2TDX A;  2I5U A;  2RQP A;  3OYB A;  2EFO A;  3DKX A;  5C44 J;  2OCE A;  5FFZ A;  1K6Y A;  4EGZ A;  1SFX A;  2IGO A;  4L18 B;  4AVP A;  2EIL H;  1FY7 A;  1XX5 A;  1K79 A;  3S2D J;  4UB8 C;  3DEW A;  3O3K A;  5FKN A;  2CH0 A;  2H09 A;  4AIJ A;  4CCJ A;  5CLS A;  4LG0 A;  5DYM A;  1HC8 A;  1VF9 A;  2HEO A;  1ZRF A;  5L3G A;  5K7Z A;  2HU9 A;  2HVQ A;  3HUG B;  2GIV A;  3NEU A;  2E34 A;  4P55 A;  5HDK A;  1S72 I;  2O61 A;  1BOB A;  4M3E A;  2BW3 A;  3FXM A;  3K4M A;  3C3W A;  3GVA A;  2QEN A;  1LJ9 A;  2F48 A;  2Z99 A;  3OYI A;  2GQQ A;  9ANT A;  3ZRG A;  2EIK H;  4RM2 A;  4XR6 A;  3T0Y A;  2F5D A;  1D5Y A;  2DOE A;  4BGD A;  2KMU A;  4ZTF A;  4LFU A;  4XQF A;  2DBB A;  1E17 A;  1MJ9 A;  5GTH C;  5K5O A;  1X3Z B;  5LHI A;  1YQA A;  4N9H A;  4GYI A;  2JSP A;  1GXQ A;  4U7D A;  1MJA A;  4FE4 A;  5CYV A;  1LEA A;  1FC3 A;  2O5R A;  3K1P A;  5DS9 A;  1H9T A;  1ON2 A;  3W2A A;  3R61 A;  3OYF A;  2LY9 A;  3ZN1 A;  4L9N A;  1UHM A;  4F7Z A;  1XS9 A;  4HF1 A;  3ECH A;  3M8J A;  1B8I A;  3LAJ A;  4FTH A;  1MBG A;  2RQQ A;  1GDT A;  3WTT C;  5D5W B;  5K1Y A;  4JX4 A;  2H8W A;  2XB5 A;  3GFL A;  3LA2 A;  2K02 A;  1X2N A;  4JX6 A;  4ESB A;  1V3F A;  3ZP5 A;  1R9T J;  2DOA A;  2FJ1 A;  5JI6 A;  1JGG A;  1O57 A;  1EJ9 A;  2W85 A;  3BJ6 A;  2HXI A;  4XSZ F;  2DTR A;  2ISY A;  4LG3 A;  2DT6 A;  1MSE C;  2BHY A;  4I6Z A;  1I27 A;  1LB2 A;  1JI8 A;  3MN2 A;  2XPU A;  5HLT A;  2FRH A;  5J1U A;  3MVP A;  4JP0 A;  2VBY A;  1I39 A;  1ODD A;  3H3U A;  2JQ7 A;  1MMG A;  1XC5 A;  3AG2 H;  2JN6 A;  4WX9 A;  2H94 A;  5DTD A;  3L2W A;  5M5W J;  1ZRD A;  4FQG A;  2ID3 A;  4NC6 A;  5TGT A;  5H2F C;  3S3O A;  2V9K A;  2BGC A;  3HKZ A;  3VYT B;  2C6Y A;  1FYL A;  3MEX A;  3OIQ A;  3W6K B;  4D5F A;  5IT9 K;  5HLI A;  3QPS A;  1U9O A;  4AD9 A;  1FTT A;  1K7A A;  4BEH A;  1JKQ C;  2PMU A;  2ZJQ F;  1ETV A;  4IQJ A;  2ELH A;  3MZH A;  3EUK L;  3K69 A;  1T0F A;  5F1J A;  1L3L A;  4XKW A;  4CDG A;  4IOA F;  2Z33 A;  3SDB A;  3VOE A;  2ELJ A;  2EIJ H;  3KFW X;  3H9G A;  4IL6 C;  5ICG A;  1NG7 A;  2R7F A;  2IXS A;  3ZQ7 A;  1R5H A;  4G6T B;  2JA5 J;  4EM1 A;  3MD2 A;  4MQV A;  3IV5 A;  1HLV A;  1UAA A;  3TO9 A;  1ZRC A;  3S32 A;  2LR8 A;  1BA5 A;  1V55 H;  4ZDP A;  2PG4 A;  1I5Z A;  3JRA A;  1DU6 A;  2F5E A;  2MG4 A;  3FXK A;  5E8G A;  1BI0 A;  2VL8 A;  4IF4 A;  4XLF A;  3U1D A;  2JT1 A;  3JRI A;  2ETH A;  1K78 A;  4RGX A;  2PEX A;  3OS0 A;  1JXS A;  4RAG A;  3MQ0 A;  4XSX F;  1JHF A;  2E1M C;  3TP3 A;  2IS2 A;  4YRV A;  3ASN H;  2L7Z A;  2Y30 A;  4A93 J;  2QA4 I;  2EK5 A;  2L9V A;  4QPO A;  3FXU A;  3BZ6 A;  2XF5 A;  4E7J A;  2I10 A;  2DA1 A;  2E5Z A;  1RKT A;  3QOD A;  2XKP A;  1I1S A;  3CES A;  1J5Y A;  1T56 A;  5HDG A;  3FZV A;  4BJ6 C;  1S29 A;  2L9R A;  1UCR A;  4XNF A;  3K1M A;  2OPT A;  1IN8 A;  1L0O C;  3QU3 A;  5D5U B;  3JRE A;  3I4P A;  2R5Y A;  3BQZ A;  1QPI A;  1ZYR F;  5HOO A;  1V5G A;  1DGR M;  1BM9 A;  5AIQ A;  1XSX A;  2VJI A;  1F1Z A;  3DLL F;  1QA6 A;  2JA8 J;  2JTV A;  3MWM A;  1O4X A;  1JT0 A;  2LBF A;  1P7J A;  2DN0 A;  5J3L A;  4C2M J;  1W36 C;  2KT0 A;  4EVI A;  2JJ7 A;  1BJZ A;  1W5S A;  2DK8 A;  3G2B A;  1MH3 A;  4P5O A;  2XSJ C;  3HKZ N;  2DYS H;  2K3F A;  2X48 A;  1R1U A;  3ZMU A;  5GP9 A;  4U0Y A;  1BI2 A;  1QGP A;  4NUB A;  3JRH A;  3HPH A;  4ZH4 F;  3OOU A;  3UNG C;  3QPL A;  1R6R A;  3P9C A;  4IHS A;  1K83 J;  2IW5 A;  3V8K A;  2AS5 F;  4Y15 A;  2VON A;  4PUS A;  4ANJ A;  4FIS A;  3A03 A;  4WK8 F;  4S0H B;  2Q1Z B;  1IXR C;  3ZQH A;  1AOY A;  1B9M A;  4CYD A;  2K40 A;  1YO5 C;  3P9K A;  5J8C A;  4RA2 A;  3F8N A;  2VB6 A;  3OIO A;  3JR9 A;  3F22 A;  2V6C A;  1HQC A;  4MQ9 F;  5DM7 F;  2KJC A;  2DA4 A;  3ROU A;  1BC8 C;  3H3Z A;  1A36 A;  2Y31 A;  1MMA A;  3I4N J;  4IEJ A;  1BJA A;  3M8F A;  2P0W A;  4FX4 A;  1RIO H;  3JAM Z;  5LGN A;  1WJE A;  3OYM A;  1RUO A;  2RKH A;  5GTI C;  2KFD A;  2JK3 A;  4B47 A;  4E7L A;  2DT5 A;  3QP6 A;  3WU0 A;  1ETO A;  2CGP A;  2LC2 A;  3SEZ A;  1Z77 A;  4HX8 A;  4MIM A;  4ZYG A;  4RDU A;  3A1Y A;  3PQJ A;  2BY2 A;  3VDX A;  5IOY A;  4ZDO A;  1TWF J;  4HQE A;  1KU9 A;  1D8J A;  3HRS A;  4DYC A;  4WWC A;  2XB0 X;  3BR0 A;  1XPX A;  1IN4 A;  1IDY A;  4UHT A;  1R71 A;  2QSG X;  3FM3 A;  3SHF A;  2V26 A;  2Y2Z A;  2JA6 J;  2HFH A;  4MNU A;  1R5I D;  2K9S A;  1T98 A;  5EF6 A;  4E7H A;  1U8R A;  3U1K A;  4TV7 A;  4W97 A;  4XLA A;  3LSR A;  2XPW A;  1NHA A;  3E0J B;  3K10 A;  2PQ8 A;  3SDG A;  4F52 A;  4ZTJ A;  1YW8 A;  1RNL A;  3K4N A;  2JZY A;  3A01 B;  2VUM J;  2PJR A;  1AA7 A;  5ICF A;  3CP2 A;  1PDN C;  3GFM A;  4CO8 A;  3BR1 A;  5L3B A;  1BW5 A;  2X9D A;  4BHB A;  4ZDL A;  3ONQ A;  3BG9 A;  3AG1 H;  2ME6 A;  1TC3 C;  4KUM A;  3LA3 A;  1SD4 A;  2XVC A;  4L9T A;  1XMK A;  1R36 A;  3S1N J;  2CQQ A;  3FMR A;  3U9G A;  5L3E A;  1J0R A;  1E2X A;  4G6Q A;  1IJW C;  3HXL A;  1LVK A;  2A05 A;  3WTX C;  3ULQ B;  1XSD A;  1H88 C;  1T33 A;  4B4C A;  1H89 C;  4H0E A;  4J01 A;  1UG2 A;  3S8P A;  4S05 A;  1ZQ3 P;  1BI3 A;  4XON A;  3H0D A;  4BE2 A;  3O2P E;  3CCM I;  1OCO H;  2XGC A;  1G2H A;  2KHM A;  3OYJ A;  4IO9 F;  2GAU A;  2XF6 A;  2J5O A;  5H6R A;  3WG9 A;  1WJA A;  3ZMZ A;  2IAI A;  4D0P A;  4W1U A;  3KP7 A;  4L0Z B;  2VE8 A;  3VSK A;  4ENJ A;  1WJD A;  3OL4 A;  3M07 A;  1VTN C;  1P6R A;  2GXB A;  3OMY A;  5K7H A;  3VOD A;  1PUF A;  1XGO A;  3DEE A;  4HDV A;  3TO6 A;  2EV0 A;  2Y9Y A;  3H5R A;  4XOR A;  3GXO A;  1HKS A;  3I59 A;  3QRF F;  5HS7 A;  1WZ2 A;  2A5W A;  2KIU A;  3LSK A;  3KP5 A;  4LLL A;  1T8I A;  2ACJ A;  3J7A O;  2M4G A;  3MKZ A;  4E7Z A;  3C2H A;  4JQF A;  2NS0 A;  1ETY A;  5FRO A;  3CO6 C;  3K4J A;  3CMM A;  1V5F A;  2DAO A;  3FDY A;  5FD6 A;  1EV7 A;  2FOK A;  4HEA 2;  3BTC A;  4A3F J;  3WGI A;  2NVQ J;  5FRM A;  4Y7N J;  4I02 A;  1XDS A;  3KP2 A;  3KE2 A;  4G7H F;  1DDN A;  3FKJ A;  2VQH A;  2QWW A;  2M7B A;  4IRG A;  3M9A A;  1XSV A;  4RB2 C;  1G3T A;  2DLL A;  2KDO A;  3B6A A;  4LIV A;  4A12 A;  5DUI A;  1RUN A;  2GIZ A;  3I64 A;  4BKX A;  1HW2 A;  3EYI A;  3S3M A;  4UVA A;  1EKE A;  2G9W A;  2D45 A;  2OF7 A;  2RRE A;  3FXJ A;  3KYC B;  1A5J A;  1XMA A;  2QQ9 A;  5AON A;  3GTK J;  1UEL B;  3WHB A;  3BY6 A;  3DEU A;  4DQ2 A;  3KET A;  2CQK A;  2XGX A;  3CF2 A;  2HS5 A;  1P92 A;  3OL3 A;  4P1W A;  1IN6 A;  3OWT A;  1SVO A;  2HPM A;  5CJ9 A;  3RPU D;  1ZGW A;  4UUV A;  1N25 A;  2MGQ A;  4S04 A;  1MBH A;  2HYJ A;  2AXT C;  3KIO A;  4DYQ A;  3JSO A;  1JTY A;  3W3C A;  2PI0 A;  1T2K A;  3G4S I;  3QU6 A;  4CCL A;  4D7M A;  2F4M B;  1MZB A;  1Z21 A;  4IQ4 A;  1WKM A;  3KPH A;  4V2F A;  1IXS B;  4M9X A;  3FHN A;  1Z3Y A;  2ELK A;  3DBR B;  2EV5 A;  1TW3 A;  3R0J A;  2XV4 S;  1AKH B;  3KP6 A;  1ZGA A;  3D5L A;  4XRF A;  4CIC A;  3V7C A;  3LSM A;  3S15 J;  1D0Y A;  2KIQ A;  1HW5 A;  4NQW B;  2OQG A;  1A6I A;  1X1D A;  2JA7 J;  4QWQ A;  1IRF A;  4HF2 A;  1FT9 A;  5HS8 A;  4NNJ A;  1YHQ I;  4BQO A;  4BL0 B;  5F27 A;  2CO5 A;  4M74 A;  1I50 J;  2H8R A;  2PLY A;  1SMY F;  1D5V A;  3PNV A;  2L9N A;  5GAH J;  5DDG A;  2JUG A;  1IN5 A;  2KIF A;  2M5W A;  3AAF A;  2RGV A;  5DUK A;  5M5Y J;  2E1O A;  2K85 A;  2JA2 A;  1MNM C;  1JKO C;  2HKO A;  4Q48 A;  1FOY A;  5CVR A;  2BOL A;  2DMU A;  2OCC H;  4XBF A;  3RKQ A;  2BEO A;  4HG2 A;  1HST A;  2E7X A;  1VQ6 I;  3E6B A;  3K7A J;  1WQ2 A;  4IX7 A;  1S7A A;  1UST A;  4Z2Y A;  1YFH A;  2GXA A;  4G7O F;  3CCQ I;  2M87 A;  3NRV A;  3GTJ J;  3JTG A;  3IC7 A;  2M4K A;  1VQL I;  3ZQI A;  2K27 A;  2OAZ A;  4KJZ A;  2R7W A;  1Y1W J;  4BXF A;  6PAX A;  1MJB A;  3LSH A;  1VQ9 I;  2LKP A;  2MA3 A;  2VAS A;  2LD5 A;  2O9L A;  2NS7 A;  3BR3 A;  4D7N A;  1LDD A;  4DNC A;  4N4N B;  4MTE A;  2BE5 F;  3RSN A;  4YIR X;  3JRG A;  2CV0 A;  4PFP A;  4A5M A;  2KLO A;  1OPC A;  3V8L A;  2KRF A;  3ESW B;  3QYE A;  2R7S A;  3IAS 2;  3IP4 B;  2NAZ A;  3GFJ A;  2GZW A;  2X1D A;  3KP4 A;  2HDD A;  4IKF A;  2NNY A;  3TP0 A;  1TL8 A;  1XB4 A;  1W5T A;  5EZG A;  5JLX A;  4CSW A;  4YG2 F;  3WU1 B;  2ESN A;  3WTY C;  1SD6 A;  1ZLJ A;  1LQ1 A;  2WAE A;  4MGR A;  1D1C A;  5F08 A;  3CUQ C;  4RBO A;  1XGS A;  2E71 A;  4BH9 A;  5JHU A; 
#chains in the Genus database with same CATH homology
 1VZ0 A;  2VKH A;  2RQQ A;  3L2U A;  4PK4 A;  3AFH A;  4XMY A;  2V1N A;  2LBF B;  2AQE A;  2KQR A;  1GLN A;  2KL4 A;  2DOA A;  2OV7 A;  4BJT A;  4ITV A;  3H9Q A;  1KON A;  1YX3 A;  4C2U A;  2QKM B;  2M7A A;  4LG3 A;  2CUJ A;  2DT6 A;  4DJA A;  2IS6 A;  2M3A A;  3TBI A;  3SYT A;  1JI8 A;  5HLT A;  1YX5 A;  4PSX A;  4BE1 A;  4F55 A;  3QOE A;  4NC8 A;  1MMG A;  2I8D A;  2VJ4 A;  3L2W A;  1X1C A;  4AVZ A;  5CKT A;  4XKB A;  5TGT A;  2VXD A;  4B43 A;  2V9K A;  3HKZ A;  3VYT B;  3S3O A;  3PFY A;  2XAU A;  3TL4 X;  3OIQ A;  4E6K G;  3VYU B;  2LH9 A;  2X6X A;  4BEH A;  4C30 A;  3BCB A;  2L5Q A;  1MMN A;  4AYB A;  4IQJ A;  1PYV A;  3EUK L;  4FAS D;  2V4J C;  3ZR8 X;  4XKW A;  1ZEL A;  4Y3O A;  1V5E A;  3SDB A;  2ELJ A;  3OYG A;  3RCO A;  4IZZ A;  1PJR A;  2Z16 A;  2L2O A;  3I3L A;  2K9M A;  3H9G A;  3ZQQ A;  2HZD A;  2K3P A;  2ZXH A;  1NG7 A;  3PUB A;  2IXS A;  3PL8 A;  3L2V A;  4G6T B;  4J00 A;  3HPG A;  2XC7 A;  3LL7 A;  3MD2 A;  3S93 A;  4NC7 A;  1HA8 A;  1UAA A;  2M0M A;  2X1C A;  4LIU A;  3S32 A;  2VLA A;  4C9Y A;  4YEJ A;  3UR3 C;  2CV2 A;  3EPZ A;  3OYL A;  4ZDP A;  1ERD A;  2HQA A;  3N05 A;  4BDY A;  4HST A;  2VL8 A;  4HRI A;  2R7O A;  4XLF A;  4F3Q A;  3OS0 A;  4X0G A;  4PJJ A;  2IGN A;  2E1M C;  2PMZ A;  3K6G A;  1Y56 A;  4OAY A;  2IS2 A;  4YRV A;  2BVM A;  2VXZ A;  3W2V A;  1E0E A;  2GOX B;  2MYS A;  3W2W A;  4CCO A;  2WA0 A;  4QPO A;  4QPQ A;  2XF5 A;  4E7J A;  1LKX A;  4C2T A;  5FRN A;  2E5Z A;  1J09 A;  3QOD A;  1D0Z A;  3CES A;  3NWT A;  4FET A;  2LY2 A;  4BJ6 C;  3K70 D;  2HNH A;  4XNF A;  2HDW A;  2XDV A;  2KRH A;  2DT7 B;  3L2R A;  3AL0 B;  2FUG 2;  4F93 B;  4AU7 A;  2Z1D A;  2VJJ A;  1MNE A;  3OYN A;  3OYK A;  5HOO A;  4PJM A;  1V5G A;  1SAU A;  1N77 A;  3EUH C;  4Y4R A;  1DGR M;  1SFK A;  3DKY A;  4GRI A;  2VJI A;  2VKD A;  1D1A A;  3CP8 A;  2BW3 B;  2LBF A;  2HPI A;  2WAF A;  3SEQ A;  1W36 C;  2X6W A;  3HOS A;  1WJB A;  2A6T A;  1WFX A;  3G2B A;  3LFU A;  3MKW B;  1P9Q C;  4P5O A;  4OWR B;  2XSJ C;  3MKY B;  3K4C A;  4NUB A;  3HPH A;  3OOU A;  2F6C A;  4JOM A;  3UNG C;  4B3X A;  1R6R A;  1S9H A;  4CZC A;  1MND A;  4Y33 A;  1FMV A;  2X51 A;  4PUS A;  4B48 A;  4ANJ A;  5JHF A;  1WJF A;  3K4K A;  2Q1Z B;  4D1Q A;  4RMN A;  4BQN A;  3F9K A;  2KZV A;  2WAD A;  2WY7 Q;  4LIT A;  3M1C A;  2VB6 A;  3I9V 2;  4ZJZ A;  4BAC A;  1NG6 A;  2X6Y A;  4DGW B;  1MMA A;  3LSI A;  3VWB A;  3QYB A;  1T0F C;  2P0W A;  3PSF A;  4DIQ A;  5CQE A;  3S3N A;  4E7K A;  2IS4 A;  3ZXS A;  2LYC A;  4E7S A;  1WJE A;  3OYM A;  5LD2 C;  4KIT B;  1N75 A;  2VJ5 A;  4B47 A;  3OYE A;  3V42 A;  4E7L A;  3DU5 A;  3GBG A;  5KNL A;  1TT0 A;  2Z2S B;  2LC2 A;  3SEZ A;  1QHG A;  4B44 A;  2XF7 A;  4BJ5 C;  3A1Y A;  3VDX A;  4ZDO A;  2W7N A;  2QKL B;  3OYD A;  4U7B A;  2V26 A;  4CCN A;  3CJR B;  1OLT A;  3EUA A;  4E7H A;  3PJR A;  4XLA A;  2Q2E B;  4KIS A;  1D0X A;  3PNY A;  3E0J B;  3K10 A;  4F52 A;  4PJL A;  2JVH A;  2UUZ A;  3CZ6 A;  4ZTJ A;  1TZL A;  3HC7 A;  3BLY A;  2K5C A;  2MD0 A;  3K4N A;  1QU3 A;  2L9S A;  2PJR A;  3ZGK A;  1AA7 A;  3CP2 A;  4ZYA A;  3BG6 A;  4XKV A;  4OAZ A;  4ZDL A;  2KRC A;  1MW7 A;  3ONQ A;  2CW7 A;  2ZSI B;  4DOZ A;  4BS9 A;  2VPL A;  5HNF A;  2K9L A;  3H35 A;  1G59 A;  1LFP A;  4BE0 A;  1YE9 A;  2ZSH B;  3KYL A;  3HXL A;  3DPT A;  1LVK A;  4PSW A;  2HVS A;  1Y6I A;  3D5R C;  3DTI A;  4J01 A;  3S8P A;  1BR4 A;  4XL9 A;  4XON A;  3H0D A;  4BE2 A;  1WJC A;  2KHM A;  3OYJ A;  2XF6 A;  1WJA A;  3D5S C;  4H4K C;  3K70 C;  4XN0 A;  4E7I A;  2R7U A;  3VSK A;  1WJD A;  3OL4 A;  3VSL A;  1MMD A;  5HVQ C;  1W36 D;  3OMY A;  2WAQ A;  1WJ5 A;  3LMM A;  3VYS B;  3BCA A;  5CQG A;  2CW8 A;  5KCM A;  3DEE A;  2IGM A;  4F91 B;  4XLC A;  3H5R A;  4XOR A;  2V7F A;  2VIX A;  1U0J A;  2W82 A;  3DQV C;  2A5W A;  2W1O A;  3DLA A;  3KEY A;  3LSK A;  3PNT A;  2M4G A;  2OUM A;  3PSI A;  3MKZ A;  3E1S A;  4E7Z A;  3C2H A;  4JQF A;  1DGW Y;  5FRO A;  3CJQ B;  3K4J A;  3CMM A;  1V5F A;  3FDY A;  5KHD A;  2R7R A;  4HEA 2;  2MAB A;  2L7K A;  2LG4 A;  5FRM A;  2R7Q A;  2KP6 A;  2WB1 A;  2X1E A;  4XOT A;  2AQF A;  3AL0 C;  2HVR A;  3FBN B;  2R7X A;  3FKJ A;  4PJN A;  3VYR B;  1X4O A;  4CH7 A;  2VQH A;  5HNH A;  2M7B A;  3U21 A;  3DTE A;  4XLH A;  4RLF A;  3DWL E;  2MC4 A;  2ZFU A;  2KDO A;  4LIV A;  2CFO A;  2LOO A;  2KPM A;  3S3M A;  3OR2 C;  2DJI A;  3L2Q A;  2RNG A;  3K4L A;  3OR1 C;  3BG7 A;  2R7V A;  2RRE A;  3OS2 A;  4U87 A;  5CPR B;  1EA3 A;  3IAM 2;  3OYC A;  3J7A Y;  1UEL B;  3TMO A;  4E4H A;  2IS1 A;  1X4P A;  2V6E A;  3CF2 A;  2JVG A;  2DXI A;  1DQU A;  2W4S A;  4XM3 A;  3OL3 A;  4P1W A;  4HNT A;  3OWT A;  4EAT A;  4HSR A;  1X1A A;  2HPM A;  4II3 A;  3RPU D;  3QYF A;  5LFA A;  3OYH A;  3HOT A;  4N4O B;  3RQ4 A;  4DBQ A;  1IRX A;  4R79 A;  4CA0 A;  2LRE A;  4PFO A;  4BUP A;  2IGK A;  1X1B A;  3A2K A;  3BC8 A;  3OIP A;  2F4I A;  1FMW A;  2X85 A;  4KT6 A;  3W3C A;  4BQQ A;  1N78 A;  1QHH D;  4CCL A;  4F92 B;  2MFZ A;  1T95 A;  1Z21 A;  4IQ4 A;  1G8X A;  4YEL A;  2E60 A;  2VQL A;  3FHN A;  2LRD A;  1Z3Y A;  2ZXI A;  4HNU A;  2W00 A;  4RLQ A;  4CCM A;  4HPQ A;  2VQC A;  2OC6 A;  4II2 A;  1X19 A;  3D5L A;  1D1B A;  1BR1 A;  3ZCO A;  2UWM A;  3LSM A;  4RM3 A;  2CS3 A;  1D0Y A;  2E5N A;  3DPL C;  4CCK A;  4XKC A;  4NQW B;  3AKZ A;  1LDK B;  1X1D A;  2BVL A;  3FBI B;  1BR2 A;  3OYB A;  3DKX A;  4NNJ A;  4BQO A;  4BL0 B;  2F5V A;  2VQG A;  3HL2 A;  1K6Y A;  2IGO A;  2LY1 A;  4XOP A;  3PNV A;  2L9N A;  2JUG A;  1UG0 A;  3KX2 A;  4MLO A;  4BEH B;  4BDZ A;  3RTR A;  2CH0 A;  2JA2 A;  4CCJ A;  2E1M B;  3LSG A;  2UV1 A;  2CMP A;  2BOL A;  2WBM A;  4XN3 A;  4D9J A;  3DU6 A;  2HU9 A;  2HVQ A;  3HUG B;  3IUO A;  3K4B A;  4HG2 A;  2CV1 A;  3MMY B;  1Z3X A;  4IX7 A;  3OS1 A;  3C2G A;  2NOJ B;  2WY8 Q;  3A4C A;  4CUG A;  4DBR A;  1BOB A;  2BW3 A;  3K4M A;  2M4K A;  1Z7L A;  4KJZ A;  2R7W A;  4BXF A;  3LSH A;  3OYI A;  3DPU A;  3NWS A;  2PJR B;  2VAS A;  3ZRG A;  1DP3 A;  4RM2 A;  3OYA A;  4XR6 A;  4BGD A;  3HG9 A;  2KMU A;  4N4N B;  3SZG A;  3RSN A;  4ZTF A;  2CV0 A;  4XQF A;  2GOM A;  4PFP A;  2KLO A;  3QYE A;  2R7S A;  3IAS 2;  3IP4 B;  3H5A A;  2R4G A;  2X1D A;  1OR7 C;  2R7T A;  3DTK A;  4IKF A;  2CUZ A;  2JSP A;  4XLE A;  4ZC3 A;  4CSW A;  2O5R A;  3W2A A;  2DCE A;  2WAE A;  1D1C A;  3H5N A;  3OYF A;  4BU2 A;  2Y0S A;  3OY9 A;  3H9J A;  3M8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...