2KRCA

Solution structure of the n-terminal domain of bacillus subtilis delta subunit of rna polymerase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit delta
publication title Solution structure of the N-terminal domain of Bacillus subtilis delta subunit of RNA polymerase and its classification based on structural homologs
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2krcA01
2KRCA 4NC7A 2M4KA 4NC8A
chains in the Genus database with same CATH superfamily
2FBKA 2ZMEB 2V4JC 1NK3P 4BQQA 2DMTA 1G6NA 3VWBA 2VXZA 1D3YA 2QSFX 1W0UA 2L54A 5HDNA 3MKWB 4B44A 2W7NA 1ITYA 4RB0A 1R1VA 3E6MA 1VZ0A 1FIPA 4A3BJ 1D8JA 2HZTA 3QP6A 2VXDA 2O03A 3RQIA 4GYIA 2Y75A 5ICGA 1U5TB 2RQQA 1KA8A 3OMYA 2M7AA 3PQJA 2P7CB 1OYYA 1FTTA 2MFZA 3HTUA 3R60A 2ZNZA 3ZP5A 4NUBA 3O8HA 2B0LA 5CYVA 4BAYA 1W5TA 3W6VA 4HZFA 3VDXA 1I6HJ 4KISA 2ZXWH 3K4JA 3HKZA 3EUKL 3HGYA 4JOMA 4D7NA 2NS8A 2K9NA 2VT3A 1UJ8A 4A3GJ 1FC3A 1K6OA 2XKOA 3ABKH 3K1PA 3BC8A 4M73A 1YJ9I 5LGNA 5HLTA 2V6CA 3K10A 1MD0A 3I55I 4M9ZA 3S2HJ 2BBYA 2Q0OA 4G9YA 5FLMJ 1TQPA 2COMA 2ECBA 1LPQA 1G3TA 3QWLA 3CDHA 1J0RA 1QO0D 4NC6A 1X3UA 5C3EJ 1RPWA 4V19K 2FOKA 2EWNA 4JK1X 5DUIA 3PIPF 4BACA 5AONA 5DM7F 1HSTA 1BIBA 2VBZA 4LJZF 4D5CA 2FSWA 4KICA 4R79A 2FMYA 2K9LA 4XONA 4CCKA 1RUOA 2L4MA 1QU3A 1MKMA 1TZLA 3H5AA 3MN2A 4I01A 1HF0A 2PG4A 4P1WA 2HTSA 1F9NA 1HW5A 1RR8C 4ZDOA 2Y30A 3KEOA 1R7JA 4AD9A 3CCEI 4F93B 1G2HA 2K7LA 4BDZA 3GW2A 1XS9A 2ICWG 4F55A 2OZUA 4C30A 3G1LA 1SFUA 2L02A 5ED4A 1VQ5I 1VTNC 5E3MA 4F52A 2IT0A 2OA4A 1X4PA 4NQWB 3E5XA 4UVAA 1I50J 4CSWA 4RB1A 1MBGA 4A2UA 3I9V2 2W84A 1DGWY 2DFHA 2R3SA 3WGHA 1T2KA 1IGNA 1RUNA 3SDGA 1AA7A 3L2QA 4H0EA 2IP2A 3IWZA 4MLOA 3FHNA 4KUMA 4KDPA 2XAJA 1QA6A 4E6KG 2O7OA 2W4SA 4WXCA 4CCJA 4ZYHA 1HKTA 4PJJA 4NNJA 2HZDA 2XPVA 3C2BA 4EQQA 3B6AA 2Y0SA 4ZZLA 1X1DA 3BCAA 1IN8A 3TDUC 4ESFA 4A69C 2MABA 4G7HF 2XGXA 3LFKA 2IA0A 2WTEA 5H6RA 3F8CA 3F6OA 4ENNA 2HQ5A 5J40A 5BQTA 3Q0UA 3BR3A 4JX4A 4ZTJA 4ON0A 4Y13A 3S14J 5HODA 1G4DA 3AL0B 2GLOA 2ELHA 1XSDA 3CMAI 4RBOA 3LA2A 3DU5A 1IN6A 3L7WA 3EQLF 3CZ6A 1KU2A 1OCZH 2R7FA 4NC8A 1QPMA 4FE7A 1TWHJ 2YR2A 4F3QA 3HBLA 4IRIA 1DP7P 3HUGB 1ZR4A 4WXHA 1ETKA 1T0FA 4CZCA 2CO5A 2IS6A 3KFWX 5H20A 3I58A 2O6GE 1QRYA 3KE2A 5F0CA 4WCGA 1LE8B 2G9WA 2I8DA 1GXQA 5FRMA 1X2NA 2L9VA 3G4SI 1K61A 5E3NA 1BIAA 4Y3OA 3K2ZA 5GP9A 4CYCB 3OS0A 2HYGD 2QKLB 2KIFA 4HX7A 2ADUA 3ISPA 2RNGA 1I27A 2EFWA 3K4MA 3FWEA 1BOBA 4C3IJ 1M1EB 2LFBA 4PSWA 4M71A 2FD5A 4LG0B 3VPRA 5LD2C 3IKTA 1IDZA 4ZYGA 5ERIA 4W97A 3DQVC 1RNLA 1T39A 3TQNA 3C2GA 2VOPA 1YQAA 3BPVA 1CGPA 3OYEA 4DW6A 2OF7A 5EDNA 1FOYA 1S8NA 2QWWA 1A6QA 4IL6C 4GXOA 1X1PA 3WTWC 3QOEA 3RZDJ 2CH0A 1OR7A 2DO7A 2GXGA 4LOCA 4AIKA 5IYDJ 2VL8A 5LRRA 1LDKB 3KYLA 1JUSA 2VJIA 1YRNB 3HB9A 1F43A 2X6YA 2XB5A 5GADJ 2LOOA 4BS9A 3VFZA 1LKXA 2UUZA 4XM3A 2D2WA 2Z3YA 4WX9A 1OR7C 1SFKA 2DXIA 1FNNA 2DDAA 2KT0A 2X6XA 4M74A 3FHZA 4YFNF 4BHBA 2LD5A 3WTVC 3F23A 1MGTA 3KP2A 2FA5A 2E5NA 3BPXA 1PYVA 1YE9A 3GTOJ 3IRQA 2LC2A 4V2FA 2GAUA 4PGGA 1O3TA 2VQGA 3FX3A 1CF7A 1A6IA 4ZDPA 2CQNA 3DPTA 3I59B 3K6GA 3FMSA 3PIOF 1RIOH 2HEOA 4FETA 4QWQA 2Y31A 3SHFA 2VN2A 3SEZA 3JREA 3M8EA 3F9KA 1WJFA 1UFMA 2EIMH 1SD4A 2DMUA 4IRHA 2DOFA 1IW7F 5CQGA 2P81A 5CKTA 3TO6A 1K79A 1B72A 1NHAA 1UELB 3PM1A 2HPIA 3AFHA 4RAGA 4A3IJ 1FSEA 2R5YA 2QEXI 1GHCA 5EEAA 4HX4A 2PJRA 2W57A 2GIVA 2FQ4A 4BU2A 1F5TA 2E7WA 3TBIA 2OTLI 3H5NA 1IRXA 4LIUA 1V54H 2L4AA 2ELKA 2PBIA 4EM1A 2ISZA 1WCMJ 2DU9A 3HSFA 2CW8A 1GUUA 2DBBA 1JUMA 1L0OC 4G6DA 3ZXSA 3O3KA 3EPZA 3CJNA 4HOBA 4CUGA 2D1VA 5BMZA 4C9YA 1KGSA 4RLFA 2XRNA 3BDDA 2XAGA 2BVLA 4Y15A 2R5ZB 1IG7A 3ZQLA 2DPUA 2ESNA 1VQ9I 4GDFA 3WGIA 2BW3B 1UHMA 1JTYA 3LQQA 2V79A 2LDUA 3I56I 4KYWA 1OLTA 3LL7A 3ABMH 3LWFA 1KZHA 1IUFA 2KIMA 1TL8A 2RNJA 2DI3A 3JTHA 1U9NA 2X9DA 2VIXA 5CVIA 4CCOA 2CGPA 5ILVA 3T1BA 2OAZA 2DYRH 3K4CA 1KYZA 1ZRCA 3WHBA 2K9MA 2VC0A 5IOYA 5DCFA 3ULQB 2LBFB 4A5MA 1EJ9A 3TOAA 2UXXA 4N9HA 1U8RA 5HNFA 2RC4A 3MVPA 2XGCA 3DEEA 4NC7A 4E7LA 1Z7LA 1SFOJ 2OTJI 1FWZA 2EH3A 3PL8A 4D0PA 4XLPF 2MSYA 1A35A 3DPLC 3ZQCA 1B6AA 2OQGA 3J80K 2IJLA 5IP6A 4L5JA 3MEXA 4Y7NJ 1ETXA 2BY3A 2Q2EA 1XTAA 3BQZA 3CO6C 1BI1A 1W1WE 3EETA 3HPHA 4RAFA 1G3SA 2FBHA 2GOMA 3BJAA 4RGUA 3H36A 1YW8A 2RREA 3DKXA 3KZYA 4HPQA 4EM0B 2AS5F 3CCRI 2R7XA 4L9NA 1ETQA 2G7UA 4J19A 3BTIA 4M6YA 3VEPA 1O57A 1DP3A 3CC4I 4IRGA 1ZGWA 4RGRA 3OSFA 3DXJF 2EZLA 2LKPA 4ENMA 1IDYA 2W1OA 3MCZA 4XKVA 1RKTA 2J5PA 2KJCA 2LSOA 1VI0A 1TC3C 2L3DA 3JRFA 3MAJA 1FTZA 1Z67A 3ERED 2ZMEC 3QQAA 1V55H 3K70C 3RI4A 2M30A 3ASOH 1JGGA 1U5TA 5HLGA 1BJAA 3T0YA 2DPDA 4IJAA 3I64A 2UV1A 2X51A 1JGSA 2HVSA 2CU7A 3V42A 2KQRA 1Y8QB 4F92B 2DOEA 2LH9A 3FBNB 3UR3C 2H6BA 3HRUA 1D0YA 5JVTA 3DEWA 1R36A 5CVJA 2F5DA 3ZOBA 2ZXHA 3IWFA 1O7LA 2W00A 4A6DA 2Q8KA 5IYBJ 1RC9A 4II2A 4U7BA 4MFEA 1PDNC 2E60A 3BOQA 2LY1A 3NARA 3ZQ7A 3HG9A 3J7AY 4FASD 3ZQHA 1UG2A 3W2WA 4KT5C 3PUBA 3HSRA 2JRTA 4GO1A 2TDXA 5IP9J 2A6TA 3DCFA 3JSPA 5IT9K 1ODDA 3LA7A 1B1BA 1LFUP 5K1YA 2F2EA 4ASNA 3ZQFA 3V7RA 3JAMK 1J75A 2LK2A 3N97A 1OCPA 3DTKA 4XKWA 3CMMA 1H8AC 2DA2A 3LOCA 3IH3A 3GO5A 1FMWA 1U6GA 3C1DA 1YTYA 2IRFG 2JA2A 3GFMA 1ZG3A 1OQYA 2CG4A 4XLCA 4XORA 1FP1D 1MZBA 4HV5A 2PMUA 3CD6I 1JUPA 1MMNA 2WADA 1XMAA 5C44J 2X6OA 1OYWA 4CYDA 1YG2A 1FYLA 2H09A 4M9SA 4HDUA 1YI2I 1JJ8C 2ZJ2A 1P92A 3CF5F 1Z91A 3D5RC 5KNLA 5HNHA 4XKBA 5DS9A 4NQWA 2IS1A 3AG1H 3QPSA 2FQ3A 4AU7A 5EGOB 3E1SA 3E6CC 5E17F 5FFXA 3F8NA 3COAC 1OCCH 2NVTJ 1B4AA 1P7IA 2E71A 1FSHA 2CSOA 1X2MA 4G12A 4A3DJ 2Z99A 3DEUA 4EGZA 2K02A 1BC7C 4HSTA 1SVMA 3TDZC 3IL2A 1G3WA 3ZMTA 3U9GA 4YFKF 3VYTB 3H0DA 3FZVA 1IUYA 1FEXA 5AIPA 4FX4A 2V1UA 3MZ8A 2EZIA 1ZELA 1VQKI 2CQ7A 3VSKA 1ETVA 1WJBA 1WQ2A 3OS1A 4BUPA 2DT7B 3P9CA 4IXAA 4LITA 1NG6A 4PJMA 3CCQI 1PUEE 4PJLA 3I4MJ 2BY1A 4MHGA 4I98B 1TNTA 3NQOA 1X3WB 1FOWA 1D1AA 3M07A 2GA1A 3HJEA 1OCTC 3S3OA 3F8FA 4MQVA 1B59A 4N9IA 3TW6A 1DU6A 4RA2A 4RMNA 2H8WA 1SFXA 3OR2C 4I09A 2PMHA 1MNEA 1W0TA 4BJ5C 2L7FP 1ZAOA 3HUGA 1N77A 1BW5A 4KITB 2DLLA 4XSZF 4XLEA 2HR3A 3P9KA 2V6EA 1YIJI 3GTGJ 1KU3A 4L9TA 3MZHA 3CCSI 1XGMA 2K9QA 2MC3A 2IS4A 1LE8A 4A3EJ 3LSGA 2ELJA 2K40A 2COBA 1JHFA 2JWTA 2V1NA 4DOZA 3R0JA 4HA8A 2DFEA 1TWCJ 1HDDC 5CVRA 1K4TA 1XC5A 3MWMA 1UCRA 2ZJRF 3JRGA 2YU9J 3SFIA 2IGKA 5FFZA 5E20A 1RRJA 4A0ZA 4OIQF 3KCCA 1E17A 4LG0A 2EIJH 4A5NA 5LGUA 2XPUA 1TWAJ 5CJ9A 4NHJA 1RR7A 2PX9A 2VLAA 1KQ0A 1FX7A 3H92A 4M9XA 3F22A 1J09A 4QTRA 1T38A 1XN7A 2X85A 2GM4A 3H3VK 2HYFA 2QENA 2M4GA 1E0EA 2CS3A 3WU0A 3AG2H 1TLHB 4EJOA 4RAZA 4I2OA 3OYAA 1MBFA 4WK8F 3IHUA 3MKZA 1VQ4I 4U87A 2ISYA 2V1XA 5J4VA 3QPTA 1YRNA 4E7HA 3A4CA 1WH5A 3BG5A 4LLLA 2BXYA 1WJAA 3VOEA 3JRIA 1GDTA 2DMNA 3M7GA 2QZ8A 1EV7A 2M4KA 4U0YA 3R6SA 3E6DA 3FDYA 4LFUA 2G7HA 3Q9VA 4UVCA 3O2PE 1NG7A 3WG7H 4RM2A 3A0HC 5DCMB 3WTSC 4FCYA 1Z0XA 1A04A 4KFCA 2MGQA 1Z7UA 3H9GA 5KVRA 3IH4A 3B02A 1KYWA 2ID6A 4EJWA 5L3FA 3CMEI 3I59A 2F6CA 3AKZA 5J47A 3S3MA 5BS6A 2YX7A 3ZPLA 4A3JJ 3D0SA 1TQIA 3OS2A 2P6TA 2Q1ZB 2RKHA 4ABZA 1ZYRF 2DQRA 3BWGA 1I39A 3DPUA 4N4OB 4RB3C 2XAHA 2ZFWA 4EGYA 1HA8A 4HLXA 2FX0A 2BYVE 5E1XA 1BR4A 1ETYA 2X0LA 3QU6A 4NB5A 3H1CA 5K7HA 3BR5A 2QCOA 3PUFA 1YHQI 3KPHA 3ZMUA 2ZO4A 3J81K 2E5ZA 3LAJA 4KMFA 2MH9A 4GFBA 3NWSA 2JA8J 2BW3A 2R7SA 1AOYA 2B7EA 2OQRA 4BJTA 1ONVA 1G8XA 2LF8A 3HSEA 3S2WA 2BY0A 4FHTA 3E7LA 2PN6A 3L1PA 1KU7A 5J8FA 4YEJA 2XASA 1EH6A 4RGXA 1HOMA 1ZLKA 3CP8A 2XKPA 4L9JA 2Y9ZA 5LBQA 3CDIA 4XNFA 3BROA 4DYCA 2OJED 5EG0B 4OIPF 4UHTA 3GXOA 2V26A 3G73A 2UZKA 4C2TA 4XRMA 3C3WA 4HNTA 2LBFA 3EDPA 3M8FA 1REPC 1Z3YA 2XAUA 3NRVA 2VKHA 3PFYA 2E36A 5KAFC 3HL2A 3MKLA 4AM3A 1YJNI 2CQXA 2O3FA 1FZPB 1Z9CA 4CDGA 2H8RA 4PGHA 2ZB9A 5E18F 3I3LA 1WI9A 3FISA 1IAWA 3RKQA 3S16J 1H0MA 4FE4A 4DIQA 5M3MJ 3G1MA 1YS6A 2HDWA 3ROUA 5HVQC 3CO7C 2NNYA 1BI0A 5M3FJ 5HDKA 2QQAA 3KYDB 5M5WJ 2R7ZJ 4MEYF 2R7OA 3KP6A 2KRHA 3V8LA 2CFXA 1FPQA 2L2OA 2DJIA 2KZVA 3DFGA 1MSEC 2EFPA 5FKMA 3BCBA 4IQ4A 3BJ6A 5JHUA 3BG9A 3O8GA 1X1BA 2Y2ZA 3E5UA 2OU2A 3QP5A 5EEGA 2DTRA 3SEQA 1ZG1A 2QBYB 1YX5A 1I1SA 3LSKA 3H5RA 3W6JB 4D5FA 4IHXA 3ZN0A 2M9HA 4MIMA 3RKXA 2CW0F 3WTXC 5B66C 3GTLJ 2HOAA 2XF7A 4YELA 3ZMDA 1OCRH 4JQFA 2XIGA 1H89C 1KU9A 2E1NA 2EV6A 3M4OJ 1JKOC 5FB2A 3HIFA 4U0VA 1N25A 3OYLA 1D1BA 3GLLA 2ZBKA 3WU1B 3FXRA 1Y8RB 4QPQA 2JZYA 3WTYC 5GPCA 1ZGJA 2AQFA 5CVUA 1VQLI 1MMDA 1SVOA 4WXDA 1K83J 3JRAA 1JXSA 4HYEA 5DDGA 5C4XJ 1F1ZA 3RPUA 4LB5A 3REOA 5L3BA 1T56A 5EEHA 1OFCX 4II3A 3S8PA 4G7ZF 4KIGA 1Z21A 1XGOA 3HOVJ 3BJOA 4BE1A 3W6KB 1QVUA 4BKXA 4HF0A 3ONQA 2OCCH 2WA0A 1KQ8A 3HTSB 5D8KB 1TP4A 2FNPA 2VE9A 3ELKA 4OMYA 1YIOA 4LLGF 1ZR2A 4PZJA 3HYIA 2VUMJ 2H6CA 2MLGA 3LSHA 5DD4A 5GAGJ 4XL9A 2JSCA 5KAIC 4UUSB 4FX0A 2O5RA 2FU4A 3K70D 2LTPA 1K78B 4C3HJ 4IQJA 3K1MA 1MH4A 1XPXA 2MLKA 1YYVA 2M1BA 4KNYA 3GUDA 2O61A 1IN7A 4XRSG 2VQHA 3FKJA 1HKQA 3KLNA 5JI6A 4FTHA 1B8IB 4Q47A 1EA3A 2A3SA 1ULYA 3DWLE 3S17J 1WWXA 3HRSA 2IA2A 1WH7A 4MQ9F 1WZ2A 2KP6A 3QAHA 4BY1J 5ICCA 4MTDA 3SDBA 2QVOA 2PQ8A 5B3SH 4MTEA 2IEKA 1S3JA 2YX4A 5GPAA 2R7RA 4FT8A 3HC7A 3TW7A 1PJRA 5LFAA 2FEZA 4FISA 1IF1A 1BBYA 2DA7A 3U2RA 5EGOA 2VBYA 1MBKA 2CQKA 5FLXK 5AIQA 2HVQA 2JVHA 3AG4H 5K5OA 4I02A 2W25A 3V7CA 4E7IA 2LNBA 1XX5A 2KJBA 2ZXJA 2MD5A 1Y39A 2KKOA 5D4RA 2CUFA 1QNTA 2JTVA 3CUQC 1JT6A 1TWFJ 2HYJA 2LYCA 2QSGX 5FJ8J 1MDMB 1IRFA 3S3NA 3WTZA 5HS7A 3LQRA 1ZK8A 2NYXA 1Z6TA 4OMZA 3Q5FA 2WB1N 1FYKA 4IHYA 4GYGA 1Y1WJ 3DTEA 3T8RA 2NOJB 3J7ZI 3OSGA 2XAQA 4M3BA 1RKWA 1IJWC 2BHZA 4A0YA 3KYCB 3SZGA 3JW4A 4D9JA 4LB6B 5D8LB 3JTGA 1QHHD 1Y1VJ 1J2XA 4BNCA 1WJCA 1QVTA 4JBAA 5K5RA 2FMLA 2MA3A 2JN6A 2BOLA 3CTAA 3DU6A 4IOCF 3M1EA 3L2WA 1OCOH 1V3FA 2BV6A 1LDDA 1SC7A 1EKEA 1X1CA 2CV0A 4PJ0C 1BR2A 3F6VA 1SD7A 1J7KA 2STTA 2EV5A 2N8GA 3KZZA 3VB2A 1XDUA 5LRSA 3FXLA 3SQNA 1PUFB 1QZZA 2HOSA 2A5YB 1W5SA 2LF7A 3BP8A 2MYSA 2DMPA 4RGSA 3BG6A 1L3LA 1ZRDA 2H1KA 1BW6A 1MNDA 4XK4A 1WSUA 1HC8A 4Z6YA 1OYIA 2NS7A 3CCYA 3GCMA 3HEFA 3WE3A 2I5UA 1ZRFA 1LB2A 1IRGA 4BEHA 5A2QZ 1P7JA 3MKYB 1SD5A 2X4HA 2M0MA 2VI6A 4IKFA 1XCVA 1UZCA 2F4MB 2NVXJ 2DA4A 1A36A 4QSHA 3WU2C 4U88A 3V7SA 2IBDA 1R49A 1USSA 4C2MJ 1D5VA 2KIQA 2VBXA 3KLOA 1XDSA 2ME0A 3BR6A 1TW3A 3EYYA 4U0WA 3ASNH 2CYYA 1TTYA 3OL4A 2YUSA 4UB6C 3U1KA 3UKGA 2RVCA 1AHDP 1YOVB 3H3ZA 3B73A 3VYUB 5F0HA 1V5EA 3TKYA 4OINF 2ACJA 2M8GX 2NOGA 2IS2A 3GTJJ 2QLZA 4ZYDA 2R7DA 1Y56A 2A5WA 3CJQB 1NK2P 1QZEA 5E3OA 4UY8I 2VT2A 3DLLF 1MBEA 3TOBA 4B48A 5D6FA 1VQ8I 2KRCA 1P9QC 2EK5A 4OIRF 1XMKA 3RPQA 4YG2F 3BLYA 2DFIA 2CJJA 5JHFA 1D8KA 4DBQA 1Z77A 2ZMEA 5DCMA 2F48A 3O6BB 2E2IJ 4BJ6C 3GFLA 2QQ9A 2YPRA 1GXPA 3D1NI 5DEQA 5TRDA 4LMYA 1B9MA 3W3CA 2F5VA 2Y69H 4OOIA 2STWA 5LEKA 2WY8Q 3GBGA 4G8XA 2JPBA 3WHCA 1O7FA 3GYHX 3OV8A 5E1ZB 2DW4A 5TISC 1E3OC 1LQ1A 4B43A 4XN0A 1YS7A 4EJUA 2WB1A 2CRGA 3GF2A 1K4SA 2H27A 1S7EA 1UMQA 2WAEA 3I54A 2EFQA 3ECOA 4ANJA 1A31A 3FXUA 3I0TA 1XCBA 2DA1A 1JJ6C 2EINH 2RDPA 1LNWA 3HHGA 1YO5C 3EYIA 2K86A 2V7FA 1MBHA 3ABTA 4AWXB 4KN7X 4M6XA 4JX5A 1BOAA 3DF8A 4EVIA 1IC8A 2WV0A 4UUTA 1U3EM 3GTPJ 1HBXG 3ABLH 5BNGA 1U0JA 3HPGA 4KMUX 3ZGKA 4CGZA 4F91B 5FKOA 4S0HB 4B3XA 1SD6A 2JUCA 5IYCJ 5D5XB 4M72A 3TL4X 3JRHA 2E7XA 1RI7A 1MMGA 2W24A 5KK1A 2KDZA 2DA6A 2WBMA 3IAM2 1D0XA 1WKMA 2QSHX 2K3PA 4ETSA 2IPQX 1WPKA 3GFJA 3Q3SA 2JA7J 1Z1DA 3OYFA 3A02A 3Q0WA 2X6WA 3I4PA 2A6HF 1G59A 3HOYJ 1GLNA 5L3GA 5EG0A 3GZ5A 3OYBA 1LFPA 3ZQGA 2R7VA 3FXQA 4XKCA 2KISA 3PSFA 5J1RA 5B1AH 1LFBA 2IXSA 5H6QA 3TGNA 5F0FA 3C7JA 1WHUA 3CCVI 1JE8A 4MGRA 1DU0A 4CA0A 3A01B 2VPLA 3FK6A 2Z33A 1R22A 2ZJQF 3J7AO 3ML6A 1LDJA 4PDKA 4BBSJ 4AVPA 2K85A 4HEA2 4LK1F 3HZJA 3GLXA 5E8GA 1PP7U 2LRDA 3UNGC 2A05A 2QUFA 2NAZA 2TCTA 1I6XA 2V1DA 3MZYA 3IC7A 3RSNA 1R00A 2YS9A 4XICA 2BY2A 2GOXB 4ESBA 2OZ6A 3CUQB 2Z1DA 2F5FA 3ZCOA 3PFIA 4IPAA 2CWEA 2VODA 4PJNA 4XLHA 3P7NA 3HRMA 1S5LC 3RJPA 2XPWA 1ON1A 2NNNA 1W5CC 2EA4A 1FOKA 2GBYA 2EV0A 2B63J 2DOAA 3DBHB 2HOTA 1S7AA 2XGDA 3L09A 2Y0MA 2XROA 1ZQ3P 3K69A 4N4NB 4YIFA 3OYMA 4L18B 3CCMI 2FRHA 2X48A 2NS0A 3TO7A 2MW8A 4MEXF 1PVEA 4HRIA 2M45A 1O3SA 1MW7A 3IUOA 4HNVA 2CV1A 3HOUJ 1R1TA 4XOTA 1HW2A 4PSXA 2EZHA 2BEOA 3KEYA 2L0KA 2LP0A 3EUHC 1O4XA 2DT6A 3ABUA 4YRVA 5ICEA 3F21A 5EJCA 5D5UB 4B3AA 2L01A 3PJRA 4RDUA 2TRTA 1T95A 4BXFA 1XGNA 2E34A 4DGWB 2DFFA 4HNUA 3D5SC 1BJZA 3GX4X 3SXYA 3MFKA 1MBJA 2PJRB 2RN7A 2BVMA 2LY2A 2D5VA 2HDCA 3BTCA 2FXAA 2DQLA 2I10A 5FKNA 5B1BH 4X0GA 5DD8A 2E35A 2VKEA 2YU3A 2FE3A 2C6YA 2KRFA 1ORKA 1GVDA 4A93J 1S6LA 4BGDA 4CYCA 3AAFA 3FM5A 2B9SA 5FLVA 2GZWA 4BHCA 2MBFA 2AHQA 2X1CA 5CQEA 4OIOF 2IW5A 1DPUA 1NH3A 1IV6A 3NAUA 1EH8A 2PI0A 4G94A 3C2HA 2RGVA 1HQCA 1N78A 3RZOJ 1K78A 2F4IA 2R4GA 1VFCA 2FBIA 3OYGA 4ITVA 2ZSIB 5HLIA 4AIHA 2EA2A 2JSPA 4LG3A 4PCQA 5ICFA 3K4LA 3ZMVA 3OYNA 3X2QH 5TJJA 2HKOA 3LSIA 3W2VA 4RM3A 1HSJA 1BM9A 4O5VA 1B8IA 3G71I 5F1JA 4RS8A 4HW0A 1MMSA 2HFHA 3RTRA 5LHIA 3L00A 2L7ZA 2OUMA 4I99C 5D5WB 2E2HJ 4BL0B 4DNCA 1R4MB 1FMVA 2O8XA 3HOTA 3QRFF 3FMQA 1JT0A 2EILH 3E3VA 4A0XA 1FY7A 2OD5A 1AU7A 5B5EC 4B1RA 1DPRA 5FKKA 1STZA 2R0QC 3RPUD 1HDPA 4DYRA 3BY6A 5C4JJ 4ENKA 1F4KA 2PMZN 2DJNA 5F64A 3M3YJ 3CLQA 1WJEA 1WJDA 1J5YA 2QYOA 1I3QJ 4KT6A 3L2VA 3DKYA 4DYQA 1IO2A 1BL0A 2BHYA 2KL4A 2EJRA 3CMYA 1MSFC 2HXOA 1U9OA 3JCUC 5IP7J 4WWCA 2K4BA 3TMOA 1ACIA 2Z9OA 4ZJZA 3WGGA 2VQCA 2CQQA 5K7FA 2E1OA 4IHTA 4I6ZA 1JKRC 3OIPA 1WI3A 4UUVA 1H9GA 1Z6RA 4EATA 4XLFA 2M7BA 1MDMA 4CCMA 3IP4B 2E19A 3KP7A 4PK4A 5BPIA 3G6EI 3K4BA 4E7ZA 5J3LA 3L2RA 4V2GA 4E7JA 2ESHA 3W2AA 3PNTA 5IOZA 2VJ4A 2CUJA 4CO8A 2LVSA 3S93A 2JQ7A 2K3FA 2ZCWA 3RDIA 3CESA 2QGUA 1E3HA 2DT5A 3BTJA 4R8HA 2DDBA 4Y33A 3RYRA 2X1EA 4I7HA 1MNMC 3HOSA 1NTCA 4UV9A 5DUKA 1BA5A 4XIDA 3ECHA 1G3YA 2R5ZA 4HBLA 2EFOA 1J9IA 4HG2A 4Y52J 2F5EA 4AVZA 2JRMA 1VNDA 1B9NA 2XHKA 2GA2A 1PUFA 5M5YJ 4HQMA 2LY9A 2DK8A 2PFBA 3DLAA 1R5HA 4P9FA 4RAYA 2HDDA 4HQEA 5JR3A 2D1HA 3LA3A 5H2FC 5F04A 3RKWA 3KX2A 1DGRM 2HVRA 3J80Z 3MD2A 3FBIB 3U21A 5GAEJ 1UHWA 5JLWA 4RB2C 3TP0A 3ZMZA 4LGWA 3S32A 2KIUA 3OOUA 2M8EA 4BQAA 4K2EA 2DYSH 3H35A 4AIDA 1KQ9A 4LK0F 1YITI 4N0BA 3CC7I 1P4WA 4Y4RA 1W4MA 1JI8A 1T8IA 2LG4A 3JRCA 5FO5A 3QU3A 3OYKA 2KFDA 1LJ9A 3OYIA 2MG4A 2Z2SB 3GTQJ 4OU0A 3OY9A 3R4KA 4GGGA 2E1MC 4XN3A 3K2AA 3OWTA 4NBQA 1TT0A 2Y48A 3R0AA 3LMMA 2HU9A 1K7AA 4J00A 3DP7A 3I53A 5BOXA 4S04A 1D5YA 3PO3J 3NWTA 2Z16A 5ILUA 2EZKA 1E2XA 4HSRA 3KEQA 4CICA 5DYMA 1LEAA 3LSPA 4M6VA 1H88C 2A61A 4JX6A 4HLYA 2PMZA 3GWZA 3DBLB 3FXOA 3V8JA 3I71A 3JR9A 4E7KA 1SAXA 4MNUA 1MJBA 1BI3A 1OJLA 4XOPA 1KONA 3CCJI 2A69F 5HS9A 2WV1A 4IEJA 3DTIA 3KP4A 3KZIC 1UAAA 2R93J 2E1CA 4C2UA 4P9UA 5J1UA 2A6EF 3KP3A 4YFXF 3MMYB 2L7KA 3VODA 3OYHA 3QOPA 2K4JA 1S7OA 4IHSA 4YIIA 1VQOI 5TGTA 2ZJPF 1P4XA 1WVRA 2DK5A 3CJTB 4IX7A 1W7PB 2GQQA 4XSXF 1V5FA 3CF2A 3NEUA 5EZGA 1ZH5A 3CC2I 2P6SA 1QGPA 2P0WA 2L5QA 2VONA 1MJ9A 1R1UA 4KJZA 1USTA 2QQBA 4X6AJ 5IT9Z 2LLKA 2ZNYA 3SJMA 3PNVA 1SVLA 4IHVA 3JAMZ 2M3AA 5E1WA 1XGSA 5J6XA 1IRZA 4E7SA 1IZ1A 1PP8F 3RKYA 4BYYA 1RESA 2AXTC 3HOXJ 2XC7A 3DBRB 1W36C 2BZTA 9ANTA 4Q5SF 2JJ7A 2WAFA 3E97A 2FUG2 1LVAA 1J59A 2OCEA 4ZC3A 2DTZA 2M0CA 4L0ZB 1XSVA 2G0EA 2IGMA 4BE2A 3H9JA 1AKHB 3V8KA 2ZSHB 1BR1A 1T0FC 5E3LA 4FQGA 3M9AA 2BXZA 1FBUA 1Z3XA 1YLFA 1X1AA 3G2BA 1X4OA 1XSXA 4AUXA 2O0YA 2XRLA 2HQNA 4GCVA 2BE5F 2JK3A 2R7TA 3RIRA 1QBJA 3HHHA 3WTTC 3A01A 2RAEA 2M5WA 2OBPA 2CUZA 4XRFA 2WAQN 3S1RJ 1S29A 1U8BA 1FJLA 4IOAF 4HX8A 4U7DA 4KIBA 1UB9A 1YX3A 4B09A 5HOOA 4A3MJ 2DN0A 4WF2A 4BXUA 2KLOA 4E4HA 1FP2A 3CUQA 1ENHA 3AG3H 1IN4A 2EFNA 3GEZA 4D7MA 1GV2A 4PFOA 1FIAA 3H0GJ 1ZKGA 3S1QJ 2RV8A 4AC0A 3S1NJ 2OPTA 4XQFA 2P5KA 2MD0A 1IV8A 3OR1C 2DAOA 3A2KA 2R7WA 2LR8A 3I4NJ 3HRTA 4X1EA 2ECCA 2HXIA 2KPMA 5E79C 2LKXA 5M5XJ 3N4MA 4B8XA 1ZREA 3VYRB 2PJPA 1GV5A 1WRJA 2DA3A 4EJVA 3GZ6A 2OC6A 4LIVA 3ZN1A 1R4NB 5F1RA 2MH2A 1QHGA 1BN5A 1FLIA 2ZXIA 4DQ2A 4LD5A 1YW7A 2XGEA 4A3CJ 5EF6A 3S1MJ 3K7AJ 4G6TB 3TP3A 1XG1A 2WC2A 4XLNF 2ETHA 3H9QA 2AQEA 3HM5A 1IXSB 2XSDC 2IAIA 1TWGJ 2EBIA 2LMDA 3P9IA 1IXCA 1MIJA 4S05A 4CHUA 3IAS2 2VKDA 1JKQC 1P4AA 3L9FA 2P7VB 4HAMA 4BHPA 5DM6F 1R9TJ 3SYTA 3BR1A 5KHDA 3T5XA 1X19A 2JVGA 4QPOA 1P6RA 4C3JJ 3GFIA 2KMUA 3WG9A 3F0CA 3K1NA 2HGCA 5KCMA 3H3UA 2R92J 1T33A 5CLSA 3JRBA 1YJWI 1R71A 2M87A 1O3RA 2DCEA 5LHHA 1ERDA 4XMYA 2JMWA 1Y0UA 3FXJA 4DJAA 4A3FJ 3VSLA 1SEUA 1CQTA 2P4WA 5F08A 4M3DA 3PO2J 3F8BA 2DMQA 2XDVA 4B47A 3GTMJ 2K5CA 2KHMA 3QYBA 2XB0X 3F72A 5JFRA 4CH7A 2LREA 2EIKH 5CPRB 1ETOA 5HS8A 1TBXA 4M3GA 4O3MA 1WJ5A 2XV4S 3R61A 4G6QA 2E1MB 1R6RA 2L9RA 4I0BA 4QIWN 5K5QA 1APLC 3GZNB 3Q9SA 4DZJA 4Y17A 1VQNI 2JT1A 1I3AA 2EPFA 3FKIJ 1R5ID 2EQRA 1JTXA 5FKLA 3GTKJ 3OOPA 2V9PA 1QPIA 4BH9A 3ZR8X 4P55A 1XD7A 5L3DA 3CDLA 4L9VA 5FGMA 2AO9A 2IVMA 1TQMA 2V9KA 3BZKA 4XLAA 4ENJA 1RETA 3HDDA 1W7PD 2VQLA 3SFZA 4J01A 5D5VB 2P5VA 3OL3A 2VASA 4KN4X 2XSJC 2XVCA 3OIQA 3RQ4A 4BBRJ 1UHSA 3FF5A 5LLQA 2KZGA 3RCOA 1OPCA 2VE8A 3U1DA 2WAQA 4PFPA 5K7ZA 4BQOA 1E3PA 3IH2A 3VYSB 5J4YA 1TT5B 4BQNA 1DDNA 1JKPC 4L5EA 4W1UA 4LLNA 2NVQJ 3JRDA 4ZYAA 2Z5UA 3HXLA 3P5JA 4OAZA 1P2FA 5EYRA 4CZZA 1C0WA 2IGNA 4GRIA 2OV7A 4AYBN 2VJ5A 2X1DA 5D6EA 2L7MP 2V9VA 5IY5H 2VBWA 1XMXA 3C18A 4UVBA 2WWYA 1RZ4A 3J81Z 4HDVA 1HKSA 5GAHJ 2GXBA 1D1CA 2FOWA 3CUOA 4HV6A 2ME6A 3LSRA 4EV0A 1OKRA 2CUEA 3M8JA 4MO7A 2IGOA 1V4RA 2K27A 4UXNA 3LNQA 2KDOA 1HXDA 1Y0NA 4JP0A 4EMSA 2LKSA 1F36A 2GWRA 1JHHA 3FM3A 1T6SA 3CLOA 4CCLA 4ZZDA 2XF6A 2GIZA 2R7UA 2CMPA 4IVNA 1ZN2A 1ETWA 1T08B 2L9SA 1V5GA 3BZ6A 1Q1VA 3FMRA 3T8TA 3E6BA 1VQPI 2NRAC 1EF4A 5GTHC 4I0AA 4NDLA 1UG0A 1SFEA 1VQ6I 3SZPA 1U5TC 4P5OA 3FIWA 5HLHA 1O3QA 4HF1A 4M3EA 4PUSA 5F27A 1WGXA 2O8KA 4G7OF 1QQIA 1XB4A 5GTIC 3K4NA 4M3FA 4DBRA 4I76A 2E2JJ 4A6EA 2P5LC 1WFXA 5J8CA 4EEFG 1K6YA 1R58A 2HWVA 3BTLA 3IRRA 2H94A 2JUGA 1ZARA 3TEDA 1SAUA 3DKWA 5LEJA 3G3ZA 2YSRA 1MJAA 3PQKA 1Z05A 1VQMI 4RLQA 3F8MA 1X3ZB 2F4OB 4O6JA 1AWCA 4BXXJ 2RQPA 3BZCA 4UV8A 1VF9A 3QYFA 3QPLA 4QLCU 4A3LJ 6PAXA 2HI3A 4Z2YA 3J7YJ 1FYMA 2M34A 5HDGA 1DUXC 1VQ7I 2AXLA 3I5UA 4IHWA 3ERMA 2FNAA 1IXRC 5F6FA 2BGCA 3FK7A 3D5LA 3HOWJ 1N75A 2QF7A 3ZRGA 5JVGF 2HPMA 2A07F 1D0ZA 2XAFA 3K4KA 4KIFA 1TNSA 2VPRA 3LSMA 4OWRB 2CV2A 1LUJB 3CJRB 3BR0A 1MMAA 5FROA 1ZG5A 1TW2A 3OYDA 3KETA 2QA4I 3WE2A 4XBFA 2H1LA 2NVUB 1A5JA 5IT3A 3BT9A 4ESJA 2VKVA 1Y6IA 2QBYA 2P8TA 1DQUA 5LHGA 1FT9A 4ZH4F 3K0LA 1LVKA 3EUAA 1ON2A 3CP2A 3QYEA 2FF4A 3EUHA 3Q0VA 3S2DJ 3HOZJ 2M2EA 1S72I 4ZYEA 4A12A 4F7ZA 3WTUC 2JPCA 1IN5A 3S15J 3LSTA 1CF7B 3ESWB 1BI2A 4BY7J 2ID3A 5FD6A 4AYBA 2PLYA 4L5IA 5EZHA 3SZTA 1W7PA 2DA5A 3BR2A 3JSOA 1FOXA 1HCRA 3N05A 1GT0C 1YFHA 5DV5A 3OYJA 1HLVA 4MFDA 5CVVA 3LSJA 3FXKA 3KIOA 1B72B 1OMIA 4CXFA 2QM3A 3BG7A 3GMEA 1HW1A 3OIOA 1POGA 3HGGA 4JYKA 2R5YB 4L0YB 3HKZN 1YW9A 1Q1HA 1R5GA 2HTJA 1EH7A 4EJTA 4UNOA 3LFUA 1LEBA 3MQ0A 2XF5A 4IZZA 2EB7A 4CCNA 4XRSA 3AL0C 2MC4A 1OISA 5FD5A 3ZMSA 4R1HA 3QODA 4DZPA 1ZLJA 2VC1A 3V4GA 2HQRA 2QKMB 3CCUI 4EM2A 2IA1A 2HQAA 4UUSA 4UB8C 3ZQQA 5LGTA 1BC8C 3GVAA 2HOEA 1R23A 2A68F 2QQ8A 3A1YA 5L3EA 4IO9F 4KA4A 5D4SA 1AKHA 4HF2A 4H4KC 2UWMA 2ZFUA 3K9TA 1MH3A 1U2WA 2FJ1A 3DV8A 2VOOA 2NVYJ 2WY7Q 2JA6J 2K9SA 4BDYA 3BG3A 3L2CA 5ILSA 5IPAA 3ZQIA 4YIRX 5E8IA 3B6CA 5FLXZ 1SMYF 3L2UA 4P96A 1I5ZA 3A03A 2Y9YA 4ZDLA 4BE0A 1H9TA 3OYCA 4BEHB 3M1CA 1X58A 4D1QA 3WODF 3KP5A 1ZHFA 2VJJA 2L9NA 2ZC2A 1QZYA 2F5CA 2W82A 4A3KJ 4E70A 4TV7A 2NXNB 1FBSA 5L3CA 2DODA 1U78A 1I1GA 2VB6A 3IKVA 3LAPA 1S9HA 4AIJA 1SANA 2R7QA 4ZTFA 3FXMA 3G1OA 3CQZJ 1ZTRA 3RYPA 1W36D 2CFOA 1FBQA 5FRNA 3QPHA 2CW7A 4B4CA 3IV5A 1T98A 2Q2EB 3PNYA 5JLXA 2JA5J 3BQYA 2W85A 2GXAA 4Q48A 2HS5A 5A2QK 4Q4ZF 1SMTA 2J5OA 2HKXA 4IF4A 3CCLI 2D45A 5J1YA 4OAYA 2Y0SN 3F3XA 3PSIA 2ZKZA 4XR6A 1GVJA 2XUBA 5BPDA 2PEXA 3A0BC 2W48A 2O9LA 1ZGAA 2UXNA 3E5QA 2HNHA 3E0JB 5DTDA 3TO9A
chains in the Genus database with same CATH topology
2V4JC 2M3AA 4XKBA 4BQQA 5HNHA 3VWBA 2VXZA 4BEHA 4E7SA 2IS1A 3MKYB 4AU7A 4B44A 2M0MA 3E1SA 3MKWB 2XC7A 2W7NA 4IKFA 1W36C 1VZ0A 2VXDA 2WAFA 2FUG2 2RQQA 3OMYA 4ZC3A 2M7AA 2IGMA 4BE2A 3H9JA 2MFZA 3OL4A 2ZSHB 1BR1A 4NUBA 4HSTA 3VYUB 1T0FC 1V5EA 2IS2A 3VDXA 3VYTB 3H0DA 1Z3XA 4KISA 1Y56A 2A5WA 3CJQB 3HKZA 3K4JA 3EUKL 4JOMA 4B48A 1ZELA 1X1AA 2KRCA 1P9QC 3G2BA 1X4OA 3VSKA 1WJBA 3OS1A 4BUPA 2DT7B 3BC8A 2R7TA 5HLTA 4LITA 1NG6A 4PJMA 3BLYA 4PJLA 3K10A 5JHFA 2CUZA 4DBQA 1D1AA 4BJ6C 1YX3A 5HOOA 3S3OA 4RMNA 3OR2C 4BACA 2KLOA 3W3CA 4E4HA 2F5VA 1MNEA 4BJ5C 4R79A 1N77A 4XONA 2K9LA 2WY8Q 3GBGA 4KITB 4CCKA 1QU3A 4XLEA 1TZLA 4PFOA 2V6EA 3H5AA 4B43A 2IS4A 4XN0A 4P1WA 2WB1A 3LSGA 4XQFA 2ELJA 4ZDOA 4DOZA 2V1NA 2WAEA 4F93B 2MD0A 4ANJA 3OR1C 3A2KA 2R7WA 4BDZA 2KPMA 4F55A 4C30A 2IGKA 2V7FA 3VYRB 4F52A 1X4PA 4NQWB 2OC6A 4LIVA 1U0JA 3HPGA 3ZGKA 4CSWA 4F91B 2VLAA 3I9V2 1DGWY 1QHGA 4B3XA 2ZXIA 3TL4X 1J09A 1MMGA 1AA7A 4G6TB 2X85A 3L2QA 2WBMA 2M4GA 4MLOA 1E0EA 2CS3A 3FHNA 3H9QA 3IAM2 2AQEA 1D0XA 4E6KG 2W4SA 2K3PA 4CCJA 4PJJA 3IAS2 2VKDA 4NNJA 3OYAA 2HZDA 3MKZA 3SYTA 2Y0SA 4U87A 5KHDA 1X1DA 3BCAA 3OYFA 1X19A 2JVGA 4QPOA 2MABA 2X6WA 2KMUA 1G59A 4E7HA 1GLNA 3A4CA 5KCMA 1WJAA 3OYBA 1LFPA 2R7VA 4XKCA 2DCEA 3PSFA 1ERDA 4XMYA 2IXSA 4DJAA 2M4KA 3VSLA 4ZTJA 3FDYA 3AL0B 4CA0A 2VPLA 4B47A 2XDVA 3DU5A 1NG7A 2K5CA 4RM2A 2KHMA 3CZ6A 3QYBA 4CH7A 2LREA 5CPRB 4HEA2 3H9GA 1WJ5A 4NC8A 2LRDA 3UNGC 2E1MB 1R6RA 2F6CA 3RSNA 3AKZA 3S3MA 2GOXB 4F3QA 3HUGB 2Z1DA 3ZCOA 3OS2A 2Q1ZB 4CZCA 4PJNA 4XLHA 2IS6A 3ZR8X 3DPUA 4N4OB 2V9KA 4XLAA 2I8DA 5FRMA 2VQLA 4J01A 1HA8A 2DOAA 4Y3OA 3OL3A 2VASA 2XSJC 3OS0A 2QKLB 1BR4A 3OIQA 3RQ4A 2RNGA 3K4MA 4N4NB 3RCOA 3OYMA 1BOBA 2WAQA 4PFPA 4HRIA 4PSWA 2E5ZA 4BQOA 1MW7A 3IUOA 2CV1A 5LD2C 3VYSB 4BQNA 3DQVC 3NWSA 4XOTA 3C2GA 2BW3A 4PSXA 2R7SA 3KEYA 3OYEA 4ZYAA 3EUHC 4BJTA 2DT6A 4YRVA 3HXLA 1G8XA 4OAZA 2IGNA 4GRIA 2OV7A 3PJRA 2VJ5A 2X1DA 1T95A 4YEJA 4BXFA 4DGWB 3QOEA 4HNUA 2CH0A 3D5SC 3CP8A 2VL8A 2PJRB 1LDKB 2BVMA 2LY2A 2VJIA 3KYLA 4XNFA 1D1CA 2X6YA 2LOOA 2V26A 4BS9A 4C2TA 3M8JA 1LKXA 2UUZA 4XM3A 4HNTA 2IGOA 1OR7C 4X0GA 2LBFA 1SFKA 2DXIA 2X6XA 4BGDA 2KDOA 1Z3YA 2XAUA 2X1CA 5CQEA 2VKHA 3PFYA 3HL2A 2E5NA 1PYVA 1YE9A 4CCLA 2XF6A 2R7UA 2CMPA 3C2HA 2L9SA 1V5GA 2LC2A 3I3LA 1N78A 2VQGA 2F4IA 2R4GA 4DIQA 1UG0A 3OYGA 4ITVA 5HVQC 2HDWA 2ZSIB 4ZDPA 3K6GA 3DPTA 4P5OA 2JSPA 4FETA 4LG3A 4PUSA 3K4LA 3OYNA 3SEZA 3F9KA 1WJFA 2R7OA 2KRHA 3LSIA 3W2VA 4RM3A 2L2OA 5CQGA 2DJIA 5CKTA 3RTRA 2KZVA 1UELB 2OUMA 2HPIA 3K4NA 3BCBA 3AFHA 4IQ4A 4DBRA 4BL0B 1FMVA 1X1BA 3HOTA 2PJRA 4BU2A 1WFXA 3TBIA 3H5NA 3SEQA 1IRXA 4LIUA 1K6YA 1YX5A 3LSKA 3RPUD 3H5RA 2JUGA 1SAUA 2CW8A 3ZXSA 3EPZA 4CUGA 1WJEA 1WJDA 4C9YA 4RLFA 2XF7A 4RLQA 4YELA 4KT6A 2BVLA 3L2VA 3DKYA 4JQFA 2KL4A 2BW3B 3QYFA 3OYLA 1D1BA 3TMOA 4QPQA 1OLTA 3LL7A 4ZJZA 2AQFA 2VQCA 1MMDA 3OIPA 3D5LA 4EATA 1N75A 2M7BA 4XLFA 3ZRGA 4CCMA 3IP4B 4PK4A 4CCOA 2VIXA 2HPMA 1D0ZA 3K4KA 3S8PA 3K4BA 4II3A 4E7ZA 3L2RA 3LSMA 4OWRB 1Z21A 4E7JA 2CV2A 3CJRB 3W2AA 3K4CA 1MMAA 3PNTA 5FROA 2VJ4A 2CUJA 4BE1A 3OYDA 3S93A 2K9MA 3ONQA 2WA0A 3CESA 2LBFB 1Y6IA 5HNFA 1DQUA 4Y33A 3DEEA 2X1EA 4NC7A 1LVKA 4E7LA 1Z7LA 3EUAA 3HOSA 3PL8A 3CP2A 3QYEA 3LSHA 3DPLC 4XL9A 2O5RA 3K70D 4HG2A 4IQJA 4AVZA 4AYBA 3HPHA 2GOMA 2RREA 3DKXA 4HPQA 2VQHA 3FKJA 3DLAA 3N05A 3OYJA 2R7XA 1EA3A 3DWLE 1DP3A 3BG7A 2KP6A 3KX2A 1DGRM 2HVRA 3SDBA 3MD2A 3FBIB 3U21A 3LFUA 2W1OA 2R7RA 2XF5A 3HC7A 4IZZA 4CCNA 1PJRA 4XKVA 3OOUA 3S32A 5LFAA 3AL0C 2MC4A 3H35A 3QODA 3K70C 4Y4RA 2HVQA 2JVHA 2QKMB 1JI8A 4E7IA 2LG4A 3OYKA 3OYIA 2HQAA 2Z2SB 2UV1A 3ZQQA 3OY9A 2E1MC 4XN3A 2X51A 3OWTA 2HVSA 3A1YA 4H4KC 3V42A 2KQRA 2ZFUA 2UWMA 1TT0A 4F92B 2LYCA 3LMMA 2HU9A 2WY7Q 2LH9A 4J00A 3FBNB 3S3NA 4BDYA 3UR3C 3NWTA 2Z16A 1D0YA 4HSRA 2ZXHA 3DTEA 3L2UA 2W00A 2NOJB 4II2A 4U7BA 4ZDLA 4BE0A 2E60A 3OYCA 2PMZA 4BEHB 4E7KA 3M1CA 4D1QA 3SZGA 2LY1A 4D9JA 2VJJA 1QHHD 2L9NA 3HG9A 3J7AY 4FASD 1WJCA 2W82A 4XOPA 1KONA 3W2WA 3PUBA 2VB6A 3DTIA 1UAAA 1S9HA 2A6TA 2BOLA 2R7QA 4ZTFA 3DU6A 4C2UA 1W36D 3L2WA 2CFOA 5FRNA 2CW7A 2Q2EB 3PNYA 3MMYB 1X1CA 2L7KA 2CV0A 3OYHA 1BR2A 3DTKA 4XKWA 3CMMA 5TGTA 1FMWA 4IX7A 2JA2A 1V5FA 3CF2A 4OAYA 4XLCA 4XORA 3PSIA 4XR6A 2MYSA 1MMNA 2WADA 2P0WA 2L5QA 3BG6A 4KJZA 1MNDA 2HNHA 3E0JB 3PNVA 3D5RC 5KNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRC A;  4NC7 A;  2M4K A;  4NC8 A; 
#chains in the Genus database with same CATH topology
 2FBK A;  2ZME B;  2V4J C;  1NK3 P;  4BQQ A;  2DMT A;  1G6N A;  3VWB A;  2VXZ A;  1D3Y A;  2QSF X;  1W0U A;  2L54 A;  5HDN A;  3MKW B;  4B44 A;  2W7N A;  1ITY A;  4RB0 A;  1R1V A;  3E6M A;  1VZ0 A;  1FIP A;  4A3B J;  1D8J A;  2HZT A;  3QP6 A;  2VXD A;  2O03 A;  3RQI A;  4GYI A;  2Y75 A;  5ICG A;  1U5T B;  2RQQ A;  1KA8 A;  3OMY A;  2M7A A;  3PQJ A;  2P7C B;  1OYY A;  1FTT A;  2MFZ A;  3HTU A;  3R60 A;  2ZNZ A;  3ZP5 A;  4NUB A;  3O8H A;  2B0L A;  5CYV A;  4BAY A;  1W5T A;  3W6V A;  4HZF A;  3VDX A;  1I6H J;  4KIS A;  2ZXW H;  3K4J A;  3HKZ A;  3EUK L;  3HGY A;  4JOM A;  4D7N A;  2NS8 A;  2K9N A;  2VT3 A;  1UJ8 A;  4A3G J;  1FC3 A;  1K6O A;  2XKO A;  3ABK H;  3K1P A;  3BC8 A;  4M73 A;  1YJ9 I;  5LGN A;  5HLT A;  2V6C A;  3K10 A;  1MD0 A;  3I55 I;  4M9Z A;  3S2H J;  2BBY A;  2Q0O A;  4G9Y A;  5FLM J;  1TQP A;  2COM A;  2ECB A;  1LPQ A;  1G3T A;  3QWL A;  3CDH A;  1J0R A;  1QO0 D;  4NC6 A;  1X3U A;  5C3E J;  1RPW A;  4V19 K;  2FOK A;  2EWN A;  4JK1 X;  5DUI A;  3PIP F;  4BAC A;  5AON A;  5DM7 F;  1HST A;  1BIB A;  2VBZ A;  4LJZ F;  4D5C A;  2FSW A;  4KIC A;  4R79 A;  2FMY A;  2K9L A;  4XON A;  4CCK A;  1RUO A;  2L4M A;  1QU3 A;  1MKM A;  1TZL A;  3H5A A;  3MN2 A;  4I01 A;  1HF0 A;  2PG4 A;  4P1W A;  2HTS A;  1F9N A;  1HW5 A;  1RR8 C;  4ZDO A;  2Y30 A;  3KEO A;  1R7J A;  4AD9 A;  3CCE I;  4F93 B;  1G2H A;  2K7L A;  4BDZ A;  3GW2 A;  1XS9 A;  2ICW G;  4F55 A;  2OZU A;  4C30 A;  3G1L A;  1SFU A;  2L02 A;  5ED4 A;  1VQ5 I;  1VTN C;  5E3M A;  4F52 A;  2IT0 A;  2OA4 A;  1X4P A;  4NQW B;  3E5X A;  4UVA A;  1I50 J;  4CSW A;  4RB1 A;  1MBG A;  4A2U A;  3I9V 2;  2W84 A;  1DGW Y;  2DFH A;  2R3S A;  3WGH A;  1T2K A;  1IGN A;  1RUN A;  3SDG A;  1AA7 A;  3L2Q A;  4H0E A;  2IP2 A;  3IWZ A;  4MLO A;  3FHN A;  4KUM A;  4KDP A;  2XAJ A;  1QA6 A;  4E6K G;  2O7O A;  2W4S A;  4WXC A;  4CCJ A;  4ZYH A;  1HKT A;  4PJJ A;  4NNJ A;  2HZD A;  2XPV A;  3C2B A;  4EQQ A;  3B6A A;  2Y0S A;  4ZZL A;  1X1D A;  3BCA A;  1IN8 A;  3TDU C;  4ESF A;  4A69 C;  2MAB A;  4G7H F;  2XGX A;  3LFK A;  2IA0 A;  2WTE A;  5H6R A;  3F8C A;  3F6O A;  4ENN A;  2HQ5 A;  5J40 A;  5BQT A;  3Q0U A;  3BR3 A;  4JX4 A;  4ZTJ A;  4ON0 A;  4Y13 A;  3S14 J;  5HOD A;  1G4D A;  3AL0 B;  2GLO A;  2ELH A;  1XSD A;  3CMA I;  4RBO A;  3LA2 A;  3DU5 A;  1IN6 A;  3L7W A;  3EQL F;  3CZ6 A;  1KU2 A;  1OCZ H;  2R7F A;  4NC8 A;  1QPM A;  4FE7 A;  1TWH J;  2YR2 A;  4F3Q A;  3HBL A;  4IRI A;  1DP7 P;  3HUG B;  1ZR4 A;  4WXH A;  1ETK A;  1T0F A;  4CZC A;  2CO5 A;  2IS6 A;  3KFW X;  5H20 A;  3I58 A;  2O6G E;  1QRY A;  3KE2 A;  5F0C A;  4WCG A;  1LE8 B;  2G9W A;  2I8D A;  1GXQ A;  5FRM A;  1X2N A;  2L9V A;  3G4S I;  1K61 A;  5E3N A;  1BIA A;  4Y3O A;  3K2Z A;  5GP9 A;  4CYC B;  3OS0 A;  2HYG D;  2QKL B;  2KIF A;  4HX7 A;  2ADU A;  3ISP A;  2RNG A;  1I27 A;  2EFW A;  3K4M A;  3FWE A;  1BOB A;  4C3I J;  1M1E B;  2LFB A;  4PSW A;  4M71 A;  2FD5 A;  4LG0 B;  3VPR A;  5LD2 C;  3IKT A;  1IDZ A;  4ZYG A;  5ERI A;  4W97 A;  3DQV C;  1RNL A;  1T39 A;  3TQN A;  3C2G A;  2VOP A;  1YQA A;  3BPV A;  1CGP A;  3OYE A;  4DW6 A;  2OF7 A;  5EDN A;  1FOY A;  1S8N A;  2QWW A;  1A6Q A;  4IL6 C;  4GXO A;  1X1P A;  3WTW C;  3QOE A;  3RZD J;  2CH0 A;  1OR7 A;  2DO7 A;  2GXG A;  4LOC A;  4AIK A;  5IYD J;  2VL8 A;  5LRR A;  1LDK B;  3KYL A;  1JUS A;  2VJI A;  1YRN B;  3HB9 A;  1F43 A;  2X6Y A;  2XB5 A;  5GAD J;  2LOO A;  4BS9 A;  3VFZ A;  1LKX A;  2UUZ A;  4XM3 A;  2D2W A;  2Z3Y A;  4WX9 A;  1OR7 C;  1SFK A;  2DXI A;  1FNN A;  2DDA A;  2KT0 A;  2X6X A;  4M74 A;  3FHZ A;  4YFN F;  4BHB A;  2LD5 A;  3WTV C;  3F23 A;  1MGT A;  3KP2 A;  2FA5 A;  2E5N A;  3BPX A;  1PYV A;  1YE9 A;  3GTO J;  3IRQ A;  2LC2 A;  4V2F A;  2GAU A;  4PGG A;  1O3T A;  2VQG A;  3FX3 A;  1CF7 A;  1A6I A;  4ZDP A;  2CQN A;  3DPT A;  3I59 B;  3K6G A;  3FMS A;  3PIO F;  1RIO H;  2HEO A;  4FET A;  4QWQ A;  2Y31 A;  3SHF A;  2VN2 A;  3SEZ A;  3JRE A;  3M8E A;  3F9K A;  1WJF A;  1UFM A;  2EIM H;  1SD4 A;  2DMU A;  4IRH A;  2DOF A;  1IW7 F;  5CQG A;  2P81 A;  5CKT A;  3TO6 A;  1K79 A;  1B72 A;  1NHA A;  1UEL B;  3PM1 A;  2HPI A;  3AFH A;  4RAG A;  4A3I J;  1FSE A;  2R5Y A;  2QEX I;  1GHC A;  5EEA A;  4HX4 A;  2PJR A;  2W57 A;  2GIV A;  2FQ4 A;  4BU2 A;  1F5T A;  2E7W A;  3TBI A;  2OTL I;  3H5N A;  1IRX A;  4LIU A;  1V54 H;  2L4A A;  2ELK A;  2PBI A;  4EM1 A;  2ISZ A;  1WCM J;  2DU9 A;  3HSF A;  2CW8 A;  1GUU A;  2DBB A;  1JUM A;  1L0O C;  4G6D A;  3ZXS A;  3O3K A;  3EPZ A;  3CJN A;  4HOB A;  4CUG A;  2D1V A;  5BMZ A;  4C9Y A;  1KGS A;  4RLF A;  2XRN A;  3BDD A;  2XAG A;  2BVL A;  4Y15 A;  2R5Z B;  1IG7 A;  3ZQL A;  2DPU A;  2ESN A;  1VQ9 I;  4GDF A;  3WGI A;  2BW3 B;  1UHM A;  1JTY A;  3LQQ A;  2V79 A;  2LDU A;  3I56 I;  4KYW A;  1OLT A;  3LL7 A;  3ABM H;  3LWF A;  1KZH A;  1IUF A;  2KIM A;  1TL8 A;  2RNJ A;  2DI3 A;  3JTH A;  1U9N A;  2X9D A;  2VIX A;  5CVI A;  4CCO A;  2CGP A;  5ILV A;  3T1B A;  2OAZ A;  2DYR H;  3K4C A;  1KYZ A;  1ZRC A;  3WHB A;  2K9M A;  2VC0 A;  5IOY A;  5DCF A;  3ULQ B;  2LBF B;  4A5M A;  1EJ9 A;  3TOA A;  2UXX A;  4N9H A;  1U8R A;  5HNF A;  2RC4 A;  3MVP A;  2XGC A;  3DEE A;  4NC7 A;  4E7L A;  1Z7L A;  1SFO J;  2OTJ I;  1FWZ A;  2EH3 A;  3PL8 A;  4D0P A;  4XLP F;  2MSY A;  1A35 A;  3DPL C;  3ZQC A;  1B6A A;  2OQG A;  3J80 K;  2IJL A;  5IP6 A;  4L5J A;  3MEX A;  4Y7N J;  1ETX A;  2BY3 A;  2Q2E A;  1XTA A;  3BQZ A;  3CO6 C;  1BI1 A;  1W1W E;  3EET A;  3HPH A;  4RAF A;  1G3S A;  2FBH A;  2GOM A;  3BJA A;  4RGU A;  3H36 A;  1YW8 A;  2RRE A;  3DKX A;  3KZY A;  4HPQ A;  4EM0 B;  2AS5 F;  3CCR I;  2R7X A;  4L9N A;  1ETQ A;  2G7U A;  4J19 A;  3BTI A;  4M6Y A;  3VEP A;  1O57 A;  1DP3 A;  3CC4 I;  4IRG A;  1ZGW A;  4RGR A;  3OSF A;  3DXJ F;  2EZL A;  2LKP A;  4ENM A;  1IDY A;  2W1O A;  3MCZ A;  4XKV A;  1RKT A;  2J5P A;  2KJC A;  2LSO A;  1VI0 A;  1TC3 C;  2L3D A;  3JRF A;  3MAJ A;  1FTZ A;  1Z67 A;  3ERE D;  2ZME C;  3QQA A;  1V55 H;  3K70 C;  3RI4 A;  2M30 A;  3ASO H;  1JGG A;  1U5T A;  5HLG A;  1BJA A;  3T0Y A;  2DPD A;  4IJA A;  3I64 A;  2UV1 A;  2X51 A;  1JGS A;  2HVS A;  2CU7 A;  3V42 A;  2KQR A;  1Y8Q B;  4F92 B;  2DOE A;  2LH9 A;  3FBN B;  3UR3 C;  2H6B A;  3HRU A;  1D0Y A;  5JVT A;  3DEW A;  1R36 A;  5CVJ A;  2F5D A;  3ZOB A;  2ZXH A;  3IWF A;  1O7L A;  2W00 A;  4A6D A;  2Q8K A;  5IYB J;  1RC9 A;  4II2 A;  4U7B A;  4MFE A;  1PDN C;  2E60 A;  3BOQ A;  2LY1 A;  3NAR A;  3ZQ7 A;  3HG9 A;  3J7A Y;  4FAS D;  3ZQH A;  1UG2 A;  3W2W A;  4KT5 C;  3PUB A;  3HSR A;  2JRT A;  4GO1 A;  2TDX A;  5IP9 J;  2A6T A;  3DCF A;  3JSP A;  5IT9 K;  1ODD A;  3LA7 A;  1B1B A;  1LFU P;  5K1Y A;  2F2E A;  4ASN A;  3ZQF A;  3V7R A;  3JAM K;  1J75 A;  2LK2 A;  3N97 A;  1OCP A;  3DTK A;  4XKW A;  3CMM A;  1H8A C;  2DA2 A;  3LOC A;  3IH3 A;  3GO5 A;  1FMW A;  1U6G A;  3C1D A;  1YTY A;  2IRF G;  2JA2 A;  3GFM A;  1ZG3 A;  1OQY A;  2CG4 A;  4XLC A;  4XOR A;  1FP1 D;  1MZB A;  4HV5 A;  2PMU A;  3CD6 I;  1JUP A;  1MMN A;  2WAD A;  1XMA A;  5C44 J;  2X6O A;  1OYW A;  4CYD A;  1YG2 A;  1FYL A;  2H09 A;  4M9S A;  4HDU A;  1YI2 I;  1JJ8 C;  2ZJ2 A;  1P92 A;  3CF5 F;  1Z91 A;  3D5R C;  5KNL A;  5HNH A;  4XKB A;  5DS9 A;  4NQW A;  2IS1 A;  3AG1 H;  3QPS A;  2FQ3 A;  4AU7 A;  5EGO B;  3E1S A;  3E6C C;  5E17 F;  5FFX A;  3F8N A;  3COA C;  1OCC H;  2NVT J;  1B4A A;  1P7I A;  2E71 A;  1FSH A;  2CSO A;  1X2M A;  4G12 A;  4A3D J;  2Z99 A;  3DEU A;  4EGZ A;  2K02 A;  1BC7 C;  4HST A;  1SVM A;  3TDZ C;  3IL2 A;  1G3W A;  3ZMT A;  3U9G A;  4YFK F;  3VYT B;  3H0D A;  3FZV A;  1IUY A;  1FEX A;  5AIP A;  4FX4 A;  2V1U A;  3MZ8 A;  2EZI A;  1ZEL A;  1VQK I;  2CQ7 A;  3VSK A;  1ETV A;  1WJB A;  1WQ2 A;  3OS1 A;  4BUP A;  2DT7 B;  3P9C A;  4IXA A;  4LIT A;  1NG6 A;  4PJM A;  3CCQ I;  1PUE E;  4PJL A;  3I4M J;  2BY1 A;  4MHG A;  4I98 B;  1TNT A;  3NQO A;  1X3W B;  1FOW A;  1D1A A;  3M07 A;  2GA1 A;  3HJE A;  1OCT C;  3S3O A;  3F8F A;  4MQV A;  1B59 A;  4N9I A;  3TW6 A;  1DU6 A;  4RA2 A;  4RMN A;  2H8W A;  1SFX A;  3OR2 C;  4I09 A;  2PMH A;  1MNE A;  1W0T A;  4BJ5 C;  2L7F P;  1ZAO A;  3HUG A;  1N77 A;  1BW5 A;  4KIT B;  2DLL A;  4XSZ F;  4XLE A;  2HR3 A;  3P9K A;  2V6E A;  1YIJ I;  3GTG J;  1KU3 A;  4L9T A;  3MZH A;  3CCS I;  1XGM A;  2K9Q A;  2MC3 A;  2IS4 A;  1LE8 A;  4A3E J;  3LSG A;  2ELJ A;  2K40 A;  2COB A;  1JHF A;  2JWT A;  2V1N A;  4DOZ A;  3R0J A;  4HA8 A;  2DFE A;  1TWC J;  1HDD C;  5CVR A;  1K4T A;  1XC5 A;  3MWM A;  1UCR A;  2ZJR F;  3JRG A;  2YU9 J;  3SFI A;  2IGK A;  5FFZ A;  5E20 A;  1RRJ A;  4A0Z A;  4OIQ F;  3KCC A;  1E17 A;  4LG0 A;  2EIJ H;  4A5N A;  5LGU A;  2XPU A;  1TWA J;  5CJ9 A;  4NHJ A;  1RR7 A;  2PX9 A;  2VLA A;  1KQ0 A;  1FX7 A;  3H92 A;  4M9X A;  3F22 A;  1J09 A;  4QTR A;  1T38 A;  1XN7 A;  2X85 A;  2GM4 A;  3H3V K;  2HYF A;  2QEN A;  2M4G A;  1E0E A;  2CS3 A;  3WU0 A;  3AG2 H;  1TLH B;  4EJO A;  4RAZ A;  4I2O A;  3OYA A;  1MBF A;  4WK8 F;  3IHU A;  3MKZ A;  1VQ4 I;  4U87 A;  2ISY A;  2V1X A;  5J4V A;  3QPT A;  1YRN A;  4E7H A;  3A4C A;  1WH5 A;  3BG5 A;  4LLL A;  2BXY A;  1WJA A;  3VOE A;  3JRI A;  1GDT A;  2DMN A;  3M7G A;  2QZ8 A;  1EV7 A;  2M4K A;  4U0Y A;  3R6S A;  3E6D A;  3FDY A;  4LFU A;  2G7H A;  3Q9V A;  4UVC A;  3O2P E;  1NG7 A;  3WG7 H;  4RM2 A;  3A0H C;  5DCM B;  3WTS C;  4FCY A;  1Z0X A;  1A04 A;  4KFC A;  2MGQ A;  1Z7U A;  3H9G A;  5KVR A;  3IH4 A;  3B02 A;  1KYW A;  2ID6 A;  4EJW A;  5L3F A;  3CME I;  3I59 A;  2F6C A;  3AKZ A;  5J47 A;  3S3M A;  5BS6 A;  2YX7 A;  3ZPL A;  4A3J J;  3D0S A;  1TQI A;  3OS2 A;  2P6T A;  2Q1Z B;  2RKH A;  4ABZ A;  1ZYR F;  2DQR A;  3BWG A;  1I39 A;  3DPU A;  4N4O B;  4RB3 C;  2XAH A;  2ZFW A;  4EGY A;  1HA8 A;  4HLX A;  2FX0 A;  2BYV E;  5E1X A;  1BR4 A;  1ETY A;  2X0L A;  3QU6 A;  4NB5 A;  3H1C A;  5K7H A;  3BR5 A;  2QCO A;  3PUF A;  1YHQ I;  3KPH A;  3ZMU A;  2ZO4 A;  3J81 K;  2E5Z A;  3LAJ A;  4KMF A;  2MH9 A;  4GFB A;  3NWS A;  2JA8 J;  2BW3 A;  2R7S A;  1AOY A;  2B7E A;  2OQR A;  4BJT A;  1ONV A;  1G8X A;  2LF8 A;  3HSE A;  3S2W A;  2BY0 A;  4FHT A;  3E7L A;  2PN6 A;  3L1P A;  1KU7 A;  5J8F A;  4YEJ A;  2XAS A;  1EH6 A;  4RGX A;  1HOM A;  1ZLK A;  3CP8 A;  2XKP A;  4L9J A;  2Y9Z A;  5LBQ A;  3CDI A;  4XNF A;  3BRO A;  4DYC A;  2OJE D;  5EG0 B;  4OIP F;  4UHT A;  3GXO A;  2V26 A;  3G73 A;  2UZK A;  4C2T A;  4XRM A;  3C3W A;  4HNT A;  2LBF A;  3EDP A;  3M8F A;  1REP C;  1Z3Y A;  2XAU A;  3NRV A;  2VKH A;  3PFY A;  2E36 A;  5KAF C;  3HL2 A;  3MKL A;  4AM3 A;  1YJN I;  2CQX A;  2O3F A;  1FZP B;  1Z9C A;  4CDG A;  2H8R A;  4PGH A;  2ZB9 A;  5E18 F;  3I3L A;  1WI9 A;  3FIS A;  1IAW A;  3RKQ A;  3S16 J;  1H0M A;  4FE4 A;  4DIQ A;  5M3M J;  3G1M A;  1YS6 A;  2HDW A;  3ROU A;  5HVQ C;  3CO7 C;  2NNY A;  1BI0 A;  5M3F J;  5HDK A;  2QQA A;  3KYD B;  5M5W J;  2R7Z J;  4MEY F;  2R7O A;  3KP6 A;  2KRH A;  3V8L A;  2CFX A;  1FPQ A;  2L2O A;  2DJI A;  2KZV A;  3DFG A;  1MSE C;  2EFP A;  5FKM A;  3BCB A;  4IQ4 A;  3BJ6 A;  5JHU A;  3BG9 A;  3O8G A;  1X1B A;  2Y2Z A;  3E5U A;  2OU2 A;  3QP5 A;  5EEG A;  2DTR A;  3SEQ A;  1ZG1 A;  2QBY B;  1YX5 A;  1I1S A;  3LSK A;  3H5R A;  3W6J B;  4D5F A;  4IHX A;  3ZN0 A;  2M9H A;  4MIM A;  3RKX A;  2CW0 F;  3WTX C;  5B66 C;  3GTL J;  2HOA A;  2XF7 A;  4YEL A;  3ZMD A;  1OCR H;  4JQF A;  2XIG A;  1H89 C;  1KU9 A;  2E1N A;  2EV6 A;  3M4O J;  1JKO C;  5FB2 A;  3HIF A;  4U0V A;  1N25 A;  3OYL A;  1D1B A;  3GLL A;  2ZBK A;  3WU1 B;  3FXR A;  1Y8R B;  4QPQ A;  2JZY A;  3WTY C;  5GPC A;  1ZGJ A;  2AQF A;  5CVU A;  1VQL I;  1MMD A;  1SVO A;  4WXD A;  1K83 J;  3JRA A;  1JXS A;  4HYE A;  5DDG A;  5C4X J;  1F1Z A;  3RPU A;  4LB5 A;  3REO A;  5L3B A;  1T56 A;  5EEH A;  1OFC X;  4II3 A;  3S8P A;  4G7Z F;  4KIG A;  1Z21 A;  1XGO A;  3HOV J;  3BJO A;  4BE1 A;  3W6K B;  1QVU A;  4BKX A;  4HF0 A;  3ONQ A;  2OCC H;  2WA0 A;  1KQ8 A;  3HTS B;  5D8K B;  1TP4 A;  2FNP A;  2VE9 A;  3ELK A;  4OMY A;  1YIO A;  4LLG F;  1ZR2 A;  4PZJ A;  3HYI A;  2VUM J;  2H6C A;  2MLG A;  3LSH A;  5DD4 A;  5GAG J;  4XL9 A;  2JSC A;  5KAI C;  4UUS B;  4FX0 A;  2O5R A;  2FU4 A;  3K70 D;  2LTP A;  1K78 B;  4C3H J;  4IQJ A;  3K1M A;  1MH4 A;  1XPX A;  2MLK A;  1YYV A;  2M1B A;  4KNY A;  3GUD A;  2O61 A;  1IN7 A;  4XRS G;  2VQH A;  3FKJ A;  1HKQ A;  3KLN A;  5JI6 A;  4FTH A;  1B8I B;  4Q47 A;  1EA3 A;  2A3S A;  1ULY A;  3DWL E;  3S17 J;  1WWX A;  3HRS A;  2IA2 A;  1WH7 A;  4MQ9 F;  1WZ2 A;  2KP6 A;  3QAH A;  4BY1 J;  5ICC A;  4MTD A;  3SDB A;  2QVO A;  2PQ8 A;  5B3S H;  4MTE A;  2IEK A;  1S3J A;  2YX4 A;  5GPA A;  2R7R A;  4FT8 A;  3HC7 A;  3TW7 A;  1PJR A;  5LFA A;  2FEZ A;  4FIS A;  1IF1 A;  1BBY A;  2DA7 A;  3U2R A;  5EGO A;  2VBY A;  1MBK A;  2CQK A;  5FLX K;  5AIQ A;  2HVQ A;  2JVH A;  3AG4 H;  5K5O A;  4I02 A;  2W25 A;  3V7C A;  4E7I A;  2LNB A;  1XX5 A;  2KJB A;  2ZXJ A;  2MD5 A;  1Y39 A;  2KKO A;  5D4R A;  2CUF A;  1QNT A;  2JTV A;  3CUQ C;  1JT6 A;  1TWF J;  2HYJ A;  2LYC A;  2QSG X;  5FJ8 J;  1MDM B;  1IRF A;  3S3N A;  3WTZ A;  5HS7 A;  3LQR A;  1ZK8 A;  2NYX A;  1Z6T A;  4OMZ A;  3Q5F A;  2WB1 N;  1FYK A;  4IHY A;  4GYG A;  1Y1W J;  3DTE A;  3T8R A;  2NOJ B;  3J7Z I;  3OSG A;  2XAQ A;  4M3B A;  1RKW A;  1IJW C;  2BHZ A;  4A0Y A;  3KYC B;  3SZG A;  3JW4 A;  4D9J A;  4LB6 B;  5D8L B;  3JTG A;  1QHH D;  1Y1V J;  1J2X A;  4BNC A;  1WJC A;  1QVT A;  4JBA A;  5K5R A;  2FML A;  2MA3 A;  2JN6 A;  2BOL A;  3CTA A;  3DU6 A;  4IOC F;  3M1E A;  3L2W A;  1OCO H;  1V3F A;  2BV6 A;  1LDD A;  1SC7 A;  1EKE A;  1X1C A;  2CV0 A;  4PJ0 C;  1BR2 A;  3F6V A;  1SD7 A;  1J7K A;  2STT A;  2EV5 A;  2N8G A;  3KZZ A;  3VB2 A;  1XDU A;  5LRS A;  3FXL A;  3SQN A;  1PUF B;  1QZZ A;  2HOS A;  2A5Y B;  1W5S A;  2LF7 A;  3BP8 A;  2MYS A;  2DMP A;  4RGS A;  3BG6 A;  1L3L A;  1ZRD A;  2H1K A;  1BW6 A;  1MND A;  4XK4 A;  1WSU A;  1HC8 A;  4Z6Y A;  1OYI A;  2NS7 A;  3CCY A;  3GCM A;  3HEF A;  3WE3 A;  2I5U A;  1ZRF A;  1LB2 A;  1IRG A;  4BEH A;  5A2Q Z;  1P7J A;  3MKY B;  1SD5 A;  2X4H A;  2M0M A;  2VI6 A;  4IKF A;  1XCV A;  1UZC A;  2F4M B;  2NVX J;  2DA4 A;  1A36 A;  4QSH A;  3WU2 C;  4U88 A;  3V7S A;  2IBD A;  1R49 A;  1USS A;  4C2M J;  1D5V A;  2KIQ A;  2VBX A;  3KLO A;  1XDS A;  2ME0 A;  3BR6 A;  1TW3 A;  3EYY A;  4U0W A;  3ASN H;  2CYY A;  1TTY A;  3OL4 A;  2YUS A;  4UB6 C;  3U1K A;  3UKG A;  2RVC A;  1AHD P;  1YOV B;  3H3Z A;  3B73 A;  3VYU B;  5F0H A;  1V5E A;  3TKY A;  4OIN F;  2ACJ A;  2M8G X;  2NOG A;  2IS2 A;  3GTJ J;  2QLZ A;  4ZYD A;  2R7D A;  1Y56 A;  2A5W A;  3CJQ B;  1NK2 P;  1QZE A;  5E3O A;  4UY8 I;  2VT2 A;  3DLL F;  1MBE A;  3TOB A;  4B48 A;  5D6F A;  1VQ8 I;  2KRC A;  1P9Q C;  2EK5 A;  4OIR F;  1XMK A;  3RPQ A;  4YG2 F;  3BLY A;  2DFI A;  2CJJ A;  5JHF A;  1D8K A;  4DBQ A;  1Z77 A;  2ZME A;  5DCM A;  2F48 A;  3O6B B;  2E2I J;  4BJ6 C;  3GFL A;  2QQ9 A;  2YPR A;  1GXP A;  3D1N I;  5DEQ A;  5TRD A;  4LMY A;  1B9M A;  3W3C A;  2F5V A;  2Y69 H;  4OOI A;  2STW A;  5LEK A;  2WY8 Q;  3GBG A;  4G8X A;  2JPB A;  3WHC A;  1O7F A;  3GYH X;  3OV8 A;  5E1Z B;  2DW4 A;  5TIS C;  1E3O C;  1LQ1 A;  4B43 A;  4XN0 A;  1YS7 A;  4EJU A;  2WB1 A;  2CRG A;  3GF2 A;  1K4S A;  2H27 A;  1S7E A;  1UMQ A;  2WAE A;  3I54 A;  2EFQ A;  3ECO A;  4ANJ A;  1A31 A;  3FXU A;  3I0T A;  1XCB A;  2DA1 A;  1JJ6 C;  2EIN H;  2RDP A;  1LNW A;  3HHG A;  1YO5 C;  3EYI A;  2K86 A;  2V7F A;  1MBH A;  3ABT A;  4AWX B;  4KN7 X;  4M6X A;  4JX5 A;  1BOA A;  3DF8 A;  4EVI A;  1IC8 A;  2WV0 A;  4UUT A;  1U3E M;  3GTP J;  1HBX G;  3ABL H;  5BNG A;  1U0J A;  3HPG A;  4KMU X;  3ZGK A;  4CGZ A;  4F91 B;  5FKO A;  4S0H B;  4B3X A;  1SD6 A;  2JUC A;  5IYC J;  5D5X B;  4M72 A;  3TL4 X;  3JRH A;  2E7X A;  1RI7 A;  1MMG A;  2W24 A;  5KK1 A;  2KDZ A;  2DA6 A;  2WBM A;  3IAM 2;  1D0X A;  1WKM A;  2QSH X;  2K3P A;  4ETS A;  2IPQ X;  1WPK A;  3GFJ A;  3Q3S A;  2JA7 J;  1Z1D A;  3OYF A;  3A02 A;  3Q0W A;  2X6W A;  3I4P A;  2A6H F;  1G59 A;  3HOY J;  1GLN A;  5L3G A;  5EG0 A;  3GZ5 A;  3OYB A;  1LFP A;  3ZQG A;  2R7V A;  3FXQ A;  4XKC A;  2KIS A;  3PSF A;  5J1R A;  5B1A H;  1LFB A;  2IXS A;  5H6Q A;  3TGN A;  5F0F A;  3C7J A;  1WHU A;  3CCV I;  1JE8 A;  4MGR A;  1DU0 A;  4CA0 A;  3A01 B;  2VPL A;  3FK6 A;  2Z33 A;  1R22 A;  2ZJQ F;  3J7A O;  3ML6 A;  1LDJ A;  4PDK A;  4BBS J;  4AVP A;  2K85 A;  4HEA 2;  4LK1 F;  3HZJ A;  3GLX A;  5E8G A;  1PP7 U;  2LRD A;  3UNG C;  2A05 A;  2QUF A;  2NAZ A;  2TCT A;  1I6X A;  2V1D A;  3MZY A;  3IC7 A;  3RSN A;  1R00 A;  2YS9 A;  4XIC A;  2BY2 A;  2GOX B;  4ESB A;  2OZ6 A;  3CUQ B;  2Z1D A;  2F5F A;  3ZCO A;  3PFI A;  4IPA A;  2CWE A;  2VOD A;  4PJN A;  4XLH A;  3P7N A;  3HRM A;  1S5L C;  3RJP A;  2XPW A;  1ON1 A;  2NNN A;  1W5C C;  2EA4 A;  1FOK A;  2GBY A;  2EV0 A;  2B63 J;  2DOA A;  3DBH B;  2HOT A;  1S7A A;  2XGD A;  3L09 A;  2Y0M A;  2XRO A;  1ZQ3 P;  3K69 A;  4N4N B;  4YIF A;  3OYM A;  4L18 B;  3CCM I;  2FRH A;  2X48 A;  2NS0 A;  3TO7 A;  2MW8 A;  4MEX F;  1PVE A;  4HRI A;  2M45 A;  1O3S A;  1MW7 A;  3IUO A;  4HNV A;  2CV1 A;  3HOU J;  1R1T A;  4XOT A;  1HW2 A;  4PSX A;  2EZH A;  2BEO A;  3KEY A;  2L0K A;  2LP0 A;  3EUH C;  1O4X A;  2DT6 A;  3ABU A;  4YRV A;  5ICE A;  3F21 A;  5EJC A;  5D5U B;  4B3A A;  2L01 A;  3PJR A;  4RDU A;  2TRT A;  1T95 A;  4BXF A;  1XGN A;  2E34 A;  4DGW B;  2DFF A;  4HNU A;  3D5S C;  1BJZ A;  3GX4 X;  3SXY A;  3MFK A;  1MBJ A;  2PJR B;  2RN7 A;  2BVM A;  2LY2 A;  2D5V A;  2HDC A;  3BTC A;  2FXA A;  2DQL A;  2I10 A;  5FKN A;  5B1B H;  4X0G A;  5DD8 A;  2E35 A;  2VKE A;  2YU3 A;  2FE3 A;  2C6Y A;  2KRF A;  1ORK A;  1GVD A;  4A93 J;  1S6L A;  4BGD A;  4CYC A;  3AAF A;  3FM5 A;  2B9S A;  5FLV A;  2GZW A;  4BHC A;  2MBF A;  2AHQ A;  2X1C A;  5CQE A;  4OIO F;  2IW5 A;  1DPU A;  1NH3 A;  1IV6 A;  3NAU A;  1EH8 A;  2PI0 A;  4G94 A;  3C2H A;  2RGV A;  1HQC A;  1N78 A;  3RZO J;  1K78 A;  2F4I A;  2R4G A;  1VFC A;  2FBI A;  3OYG A;  4ITV A;  2ZSI B;  5HLI A;  4AIH A;  2EA2 A;  2JSP A;  4LG3 A;  4PCQ A;  5ICF A;  3K4L A;  3ZMV A;  3OYN A;  3X2Q H;  5TJJ A;  2HKO A;  3LSI A;  3W2V A;  4RM3 A;  1HSJ A;  1BM9 A;  4O5V A;  1B8I A;  3G71 I;  5F1J A;  4RS8 A;  4HW0 A;  1MMS A;  2HFH A;  3RTR A;  5LHI A;  3L00 A;  2L7Z A;  2OUM A;  4I99 C;  5D5W B;  2E2H J;  4BL0 B;  4DNC A;  1R4M B;  1FMV A;  2O8X A;  3HOT A;  3QRF F;  3FMQ A;  1JT0 A;  2EIL H;  3E3V A;  4A0X A;  1FY7 A;  2OD5 A;  1AU7 A;  5B5E C;  4B1R A;  1DPR A;  5FKK A;  1STZ A;  2R0Q C;  3RPU D;  1HDP A;  4DYR A;  3BY6 A;  5C4J J;  4ENK A;  1F4K A;  2PMZ N;  2DJN A;  5F64 A;  3M3Y J;  3CLQ A;  1WJE A;  1WJD A;  1J5Y A;  2QYO A;  1I3Q J;  4KT6 A;  3L2V A;  3DKY A;  4DYQ A;  1IO2 A;  1BL0 A;  2BHY A;  2KL4 A;  2EJR A;  3CMY A;  1MSF C;  2HXO A;  1U9O A;  3JCU C;  5IP7 J;  4WWC A;  2K4B A;  3TMO A;  1ACI A;  2Z9O A;  4ZJZ A;  3WGG A;  2VQC A;  2CQQ A;  5K7F A;  2E1O A;  4IHT A;  4I6Z A;  1JKR C;  3OIP A;  1WI3 A;  4UUV A;  1H9G A;  1Z6R A;  4EAT A;  4XLF A;  2M7B A;  1MDM A;  4CCM A;  3IP4 B;  2E19 A;  3KP7 A;  4PK4 A;  5BPI A;  3G6E I;  3K4B A;  4E7Z A;  5J3L A;  3L2R A;  4V2G A;  4E7J A;  2ESH A;  3W2A A;  3PNT A;  5IOZ A;  2VJ4 A;  2CUJ A;  4CO8 A;  2LVS A;  3S93 A;  2JQ7 A;  2K3F A;  2ZCW A;  3RDI A;  3CES A;  2QGU A;  1E3H A;  2DT5 A;  3BTJ A;  4R8H A;  2DDB A;  4Y33 A;  3RYR A;  2X1E A;  4I7H A;  1MNM C;  3HOS A;  1NTC A;  4UV9 A;  5DUK A;  1BA5 A;  4XID A;  3ECH A;  1G3Y A;  2R5Z A;  4HBL A;  2EFO A;  1J9I A;  4HG2 A;  4Y52 J;  2F5E A;  4AVZ A;  2JRM A;  1VND A;  1B9N A;  2XHK A;  2GA2 A;  1PUF A;  5M5Y J;  4HQM A;  2LY9 A;  2DK8 A;  2PFB A;  3DLA A;  1R5H A;  4P9F A;  4RAY A;  2HDD A;  4HQE A;  5JR3 A;  2D1H A;  3LA3 A;  5H2F C;  5F04 A;  3RKW A;  3KX2 A;  1DGR M;  2HVR A;  3J80 Z;  3MD2 A;  3FBI B;  3U21 A;  5GAE J;  1UHW A;  5JLW A;  4RB2 C;  3TP0 A;  3ZMZ A;  4LGW A;  3S32 A;  2KIU A;  3OOU A;  2M8E A;  4BQA A;  4K2E A;  2DYS H;  3H35 A;  4AID A;  1KQ9 A;  4LK0 F;  1YIT I;  4N0B A;  3CC7 I;  1P4W A;  4Y4R A;  1W4M A;  1JI8 A;  1T8I A;  2LG4 A;  3JRC A;  5FO5 A;  3QU3 A;  3OYK A;  2KFD A;  1LJ9 A;  3OYI A;  2MG4 A;  2Z2S B;  3GTQ J;  4OU0 A;  3OY9 A;  3R4K A;  4GGG A;  2E1M C;  4XN3 A;  3K2A A;  3OWT A;  4NBQ A;  1TT0 A;  2Y48 A;  3R0A A;  3LMM A;  2HU9 A;  1K7A A;  4J00 A;  3DP7 A;  3I53 A;  5BOX A;  4S04 A;  1D5Y A;  3PO3 J;  3NWT A;  2Z16 A;  5ILU A;  2EZK A;  1E2X A;  4HSR A;  3KEQ A;  4CIC A;  5DYM A;  1LEA A;  3LSP A;  4M6V A;  1H88 C;  2A61 A;  4JX6 A;  4HLY A;  2PMZ A;  3GWZ A;  3DBL B;  3FXO A;  3V8J A;  3I71 A;  3JR9 A;  4E7K A;  1SAX A;  4MNU A;  1MJB A;  1BI3 A;  1OJL A;  4XOP A;  1KON A;  3CCJ I;  2A69 F;  5HS9 A;  2WV1 A;  4IEJ A;  3DTI A;  3KP4 A;  3KZI C;  1UAA A;  2R93 J;  2E1C A;  4C2U A;  4P9U A;  5J1U A;  2A6E F;  3KP3 A;  4YFX F;  3MMY B;  2L7K A;  3VOD A;  3OYH A;  3QOP A;  2K4J A;  1S7O A;  4IHS A;  4YII A;  1VQO I;  5TGT A;  2ZJP F;  1P4X A;  1WVR A;  2DK5 A;  3CJT B;  4IX7 A;  1W7P B;  2GQQ A;  4XSX F;  1V5F A;  3CF2 A;  3NEU A;  5EZG A;  1ZH5 A;  3CC2 I;  2P6S A;  1QGP A;  2P0W A;  2L5Q A;  2VON A;  1MJ9 A;  1R1U A;  4KJZ A;  1UST A;  2QQB A;  4X6A J;  5IT9 Z;  2LLK A;  2ZNY A;  3SJM A;  3PNV A;  1SVL A;  4IHV A;  3JAM Z;  2M3A A;  5E1W A;  1XGS A;  5J6X A;  1IRZ A;  4E7S A;  1IZ1 A;  1PP8 F;  3RKY A;  4BYY A;  1RES A;  2AXT C;  3HOX J;  2XC7 A;  3DBR B;  1W36 C;  2BZT A;  9ANT A;  4Q5S F;  2JJ7 A;  2WAF A;  3E97 A;  2FUG 2;  1LVA A;  1J59 A;  2OCE A;  4ZC3 A;  2DTZ A;  2M0C A;  4L0Z B;  1XSV A;  2G0E A;  2IGM A;  4BE2 A;  3H9J A;  1AKH B;  3V8K A;  2ZSH B;  1BR1 A;  1T0F C;  5E3L A;  4FQG A;  3M9A A;  2BXZ A;  1FBU A;  1Z3X A;  1YLF A;  1X1A A;  3G2B A;  1X4O A;  1XSX A;  4AUX A;  2O0Y A;  2XRL A;  2HQN A;  4GCV A;  2BE5 F;  2JK3 A;  2R7T A;  3RIR A;  1QBJ A;  3HHH A;  3WTT C;  3A01 A;  2RAE A;  2M5W A;  2OBP A;  2CUZ A;  4XRF A;  2WAQ N;  3S1R J;  1S29 A;  1U8B A;  1FJL A;  4IOA F;  4HX8 A;  4U7D A;  4KIB A;  1UB9 A;  1YX3 A;  4B09 A;  5HOO A;  4A3M J;  2DN0 A;  4WF2 A;  4BXU A;  2KLO A;  4E4H A;  1FP2 A;  3CUQ A;  1ENH A;  3AG3 H;  1IN4 A;  2EFN A;  3GEZ A;  4D7M A;  1GV2 A;  4PFO A;  1FIA A;  3H0G J;  1ZKG A;  3S1Q J;  2RV8 A;  4AC0 A;  3S1N J;  2OPT A;  4XQF A;  2P5K A;  2MD0 A;  1IV8 A;  3OR1 C;  2DAO A;  3A2K A;  2R7W A;  2LR8 A;  3I4N J;  3HRT A;  4X1E A;  2ECC A;  2HXI A;  2KPM A;  5E79 C;  2LKX A;  5M5X J;  3N4M A;  4B8X A;  1ZRE A;  3VYR B;  2PJP A;  1GV5 A;  1WRJ A;  2DA3 A;  4EJV A;  3GZ6 A;  2OC6 A;  4LIV A;  3ZN1 A;  1R4N B;  5F1R A;  2MH2 A;  1QHG A;  1BN5 A;  1FLI A;  2ZXI A;  4DQ2 A;  4LD5 A;  1YW7 A;  2XGE A;  4A3C J;  5EF6 A;  3S1M J;  3K7A J;  4G6T B;  3TP3 A;  1XG1 A;  2WC2 A;  4XLN F;  2ETH A;  3H9Q A;  2AQE A;  3HM5 A;  1IXS B;  2XSD C;  2IAI A;  1TWG J;  2EBI A;  2LMD A;  3P9I A;  1IXC A;  1MIJ A;  4S05 A;  4CHU A;  3IAS 2;  2VKD A;  1JKQ C;  1P4A A;  3L9F A;  2P7V B;  4HAM A;  4BHP A;  5DM6 F;  1R9T J;  3SYT A;  3BR1 A;  5KHD A;  3T5X A;  1X19 A;  2JVG A;  4QPO A;  1P6R A;  4C3J J;  3GFI A;  2KMU A;  3WG9 A;  3F0C A;  3K1N A;  2HGC A;  5KCM A;  3H3U A;  2R92 J;  1T33 A;  5CLS A;  3JRB A;  1YJW I;  1R71 A;  2M87 A;  1O3R A;  2DCE A;  5LHH A;  1ERD A;  4XMY A;  2JMW A;  1Y0U A;  3FXJ A;  4DJA A;  4A3F J;  3VSL A;  1SEU A;  1CQT A;  2P4W A;  5F08 A;  4M3D A;  3PO2 J;  3F8B A;  2DMQ A;  2XDV A;  4B47 A;  3GTM J;  2K5C A;  2KHM A;  3QYB A;  2XB0 X;  3F72 A;  5JFR A;  4CH7 A;  2LRE A;  2EIK H;  5CPR B;  1ETO A;  5HS8 A;  1TBX A;  4M3G A;  4O3M A;  1WJ5 A;  2XV4 S;  3R61 A;  4G6Q A;  2E1M B;  1R6R A;  2L9R A;  4I0B A;  4QIW N;  5K5Q A;  1APL C;  3GZN B;  3Q9S A;  4DZJ A;  4Y17 A;  1VQN I;  2JT1 A;  1I3A A;  2EPF A;  3FKI J;  1R5I D;  2EQR A;  1JTX A;  5FKL A;  3GTK J;  3OOP A;  2V9P A;  1QPI A;  4BH9 A;  3ZR8 X;  4P55 A;  1XD7 A;  5L3D A;  3CDL A;  4L9V A;  5FGM A;  2AO9 A;  2IVM A;  1TQM A;  2V9K A;  3BZK A;  4XLA A;  4ENJ A;  1RET A;  3HDD A;  1W7P D;  2VQL A;  3SFZ A;  4J01 A;  5D5V B;  2P5V A;  3OL3 A;  2VAS A;  4KN4 X;  2XSJ C;  2XVC A;  3OIQ A;  3RQ4 A;  4BBR J;  1UHS A;  3FF5 A;  5LLQ A;  2KZG A;  3RCO A;  1OPC A;  2VE8 A;  3U1D A;  2WAQ A;  4PFP A;  5K7Z A;  4BQO A;  1E3P A;  3IH2 A;  3VYS B;  5J4Y A;  1TT5 B;  4BQN A;  1DDN A;  1JKP C;  4L5E A;  4W1U A;  4LLN A;  2NVQ J;  3JRD A;  4ZYA A;  2Z5U A;  3HXL A;  3P5J A;  4OAZ A;  1P2F A;  5EYR A;  4CZZ A;  1C0W A;  2IGN A;  4GRI A;  2OV7 A;  4AYB N;  2VJ5 A;  2X1D A;  5D6E A;  2L7M P;  2V9V A;  5IY5 H;  2VBW A;  1XMX A;  3C18 A;  4UVB A;  2WWY A;  1RZ4 A;  3J81 Z;  4HDV A;  1HKS A;  5GAH J;  2GXB A;  1D1C A;  2FOW A;  3CUO A;  4HV6 A;  2ME6 A;  3LSR A;  4EV0 A;  1OKR A;  2CUE A;  3M8J A;  4MO7 A;  2IGO A;  1V4R A;  2K27 A;  4UXN A;  3LNQ A;  2KDO A;  1HXD A;  1Y0N A;  4JP0 A;  4EMS A;  2LKS A;  1F36 A;  2GWR A;  1JHH A;  3FM3 A;  1T6S A;  3CLO A;  4CCL A;  4ZZD A;  2XF6 A;  2GIZ A;  2R7U A;  2CMP A;  4IVN A;  1ZN2 A;  1ETW A;  1T08 B;  2L9S A;  1V5G A;  3BZ6 A;  1Q1V A;  3FMR A;  3T8T A;  3E6B A;  1VQP I;  2NRA C;  1EF4 A;  5GTH C;  4I0A A;  4NDL A;  1UG0 A;  1SFE A;  1VQ6 I;  3SZP A;  1U5T C;  4P5O A;  3FIW A;  5HLH A;  1O3Q A;  4HF1 A;  4M3E A;  4PUS A;  5F27 A;  1WGX A;  2O8K A;  4G7O F;  1QQI A;  1XB4 A;  5GTI C;  3K4N A;  4M3F A;  4DBR A;  4I76 A;  2E2J J;  4A6E A;  2P5L C;  1WFX A;  5J8C A;  4EEF G;  1K6Y A;  1R58 A;  2HWV A;  3BTL A;  3IRR A;  2H94 A;  2JUG A;  1ZAR A;  3TED A;  1SAU A;  3DKW A;  5LEJ A;  3G3Z A;  2YSR A;  1MJA A;  3PQK A;  1Z05 A;  1VQM I;  4RLQ A;  3F8M A;  1X3Z B;  2F4O B;  4O6J A;  1AWC A;  4BXX J;  2RQP A;  3BZC A;  4UV8 A;  1VF9 A;  3QYF A;  3QPL A;  4QLC U;  4A3L J;  6PAX A;  2HI3 A;  4Z2Y A;  3J7Y J;  1FYM A;  2M34 A;  5HDG A;  1DUX C;  1VQ7 I;  2AXL A;  3I5U A;  4IHW A;  3ERM A;  2FNA A;  1IXR C;  5F6F A;  2BGC A;  3FK7 A;  3D5L A;  3HOW J;  1N75 A;  2QF7 A;  3ZRG A;  5JVG F;  2HPM A;  2A07 F;  1D0Z A;  2XAF A;  3K4K A;  4KIF A;  1TNS A;  2VPR A;  3LSM A;  4OWR B;  2CV2 A;  1LUJ B;  3CJR B;  3BR0 A;  1MMA A;  5FRO A;  1ZG5 A;  1TW2 A;  3OYD A;  3KET A;  2QA4 I;  3WE2 A;  4XBF A;  2H1L A;  2NVU B;  1A5J A;  5IT3 A;  3BT9 A;  4ESJ A;  2VKV A;  1Y6I A;  2QBY A;  2P8T A;  1DQU A;  5LHG A;  1FT9 A;  4ZH4 F;  3K0L A;  1LVK A;  3EUA A;  1ON2 A;  3CP2 A;  3QYE A;  2FF4 A;  3EUH A;  3Q0V A;  3S2D J;  3HOZ J;  2M2E A;  1S72 I;  4ZYE A;  4A12 A;  4F7Z A;  3WTU C;  2JPC A;  1IN5 A;  3S15 J;  3LST A;  1CF7 B;  3ESW B;  1BI2 A;  4BY7 J;  2ID3 A;  5FD6 A;  4AYB A;  2PLY A;  4L5I A;  5EZH A;  3SZT A;  1W7P A;  2DA5 A;  3BR2 A;  3JSO A;  1FOX A;  1HCR A;  3N05 A;  1GT0 C;  1YFH A;  5DV5 A;  3OYJ A;  1HLV A;  4MFD A;  5CVV A;  3LSJ A;  3FXK A;  3KIO A;  1B72 B;  1OMI A;  4CXF A;  2QM3 A;  3BG7 A;  3GME A;  1HW1 A;  3OIO A;  1POG A;  3HGG A;  4JYK A;  2R5Y B;  4L0Y B;  3HKZ N;  1YW9 A;  1Q1H A;  1R5G A;  2HTJ A;  1EH7 A;  4EJT A;  4UNO A;  3LFU A;  1LEB A;  3MQ0 A;  2XF5 A;  4IZZ A;  2EB7 A;  4CCN A;  4XRS A;  3AL0 C;  2MC4 A;  1OIS A;  5FD5 A;  3ZMS A;  4R1H A;  3QOD A;  4DZP A;  1ZLJ A;  2VC1 A;  3V4G A;  2HQR A;  2QKM B;  3CCU I;  4EM2 A;  2IA1 A;  2HQA A;  4UUS A;  4UB8 C;  3ZQQ A;  5LGT A;  1BC8 C;  3GVA A;  2HOE A;  1R23 A;  2A68 F;  2QQ8 A;  3A1Y A;  5L3E A;  4IO9 F;  4KA4 A;  5D4S A;  1AKH A;  4HF2 A;  4H4K C;  2UWM A;  2ZFU A;  3K9T A;  1MH3 A;  1U2W A;  2FJ1 A;  3DV8 A;  2VOO A;  2NVY J;  2WY7 Q;  2JA6 J;  2K9S A;  4BDY A;  3BG3 A;  3L2C A;  5ILS A;  5IPA A;  3ZQI A;  4YIR X;  5E8I A;  3B6C A;  5FLX Z;  1SMY F;  3L2U A;  4P96 A;  1I5Z A;  3A03 A;  2Y9Y A;  4ZDL A;  4BE0 A;  1H9T A;  3OYC A;  4BEH B;  3M1C A;  1X58 A;  4D1Q A;  3WOD F;  3KP5 A;  1ZHF A;  2VJJ A;  2L9N A;  2ZC2 A;  1QZY A;  2F5C A;  2W82 A;  4A3K J;  4E70 A;  4TV7 A;  2NXN B;  1FBS A;  5L3C A;  2DOD A;  1U78 A;  1I1G A;  2VB6 A;  3IKV A;  3LAP A;  1S9H A;  4AIJ A;  1SAN A;  2R7Q A;  4ZTF A;  3FXM A;  3G1O A;  3CQZ J;  1ZTR A;  3RYP A;  1W36 D;  2CFO A;  1FBQ A;  5FRN A;  3QPH A;  2CW7 A;  4B4C A;  3IV5 A;  1T98 A;  2Q2E B;  3PNY A;  5JLX A;  2JA5 J;  3BQY A;  2W85 A;  2GXA A;  4Q48 A;  2HS5 A;  5A2Q K;  4Q4Z F;  1SMT A;  2J5O A;  2HKX A;  4IF4 A;  3CCL I;  2D45 A;  5J1Y A;  4OAY A;  2Y0S N;  3F3X A;  3PSI A;  2ZKZ A;  4XR6 A;  1GVJ A;  2XUB A;  5BPD A;  2PEX A;  3A0B C;  2W48 A;  2O9L A;  1ZGA A;  2UXN A;  3E5Q A;  2HNH A;  3E0J B;  5DTD A;  3TO9 A; 
#chains in the Genus database with same CATH homology
 2V4J C;  2M3A A;  4XKB A;  4BQQ A;  5HNH A;  3VWB A;  2VXZ A;  4BEH A;  4E7S A;  2IS1 A;  3MKY B;  4AU7 A;  4B44 A;  2M0M A;  3E1S A;  3MKW B;  2XC7 A;  2W7N A;  4IKF A;  1W36 C;  1VZ0 A;  2VXD A;  2WAF A;  2FUG 2;  2RQQ A;  3OMY A;  4ZC3 A;  2M7A A;  2IGM A;  4BE2 A;  3H9J A;  2MFZ A;  3OL4 A;  2ZSH B;  1BR1 A;  4NUB A;  4HST A;  3VYU B;  1T0F C;  1V5E A;  2IS2 A;  3VDX A;  3VYT B;  3H0D A;  1Z3X A;  4KIS A;  1Y56 A;  2A5W A;  3CJQ B;  3HKZ A;  3K4J A;  3EUK L;  4JOM A;  4B48 A;  1ZEL A;  1X1A A;  2KRC A;  1P9Q C;  3G2B A;  1X4O A;  3VSK A;  1WJB A;  3OS1 A;  4BUP A;  2DT7 B;  3BC8 A;  2R7T A;  5HLT A;  4LIT A;  1NG6 A;  4PJM A;  3BLY A;  4PJL A;  3K10 A;  5JHF A;  2CUZ A;  4DBQ A;  1D1A A;  4BJ6 C;  1YX3 A;  5HOO A;  3S3O A;  4RMN A;  3OR2 C;  4BAC A;  2KLO A;  3W3C A;  4E4H A;  2F5V A;  1MNE A;  4BJ5 C;  4R79 A;  1N77 A;  4XON A;  2K9L A;  2WY8 Q;  3GBG A;  4KIT B;  4CCK A;  1QU3 A;  4XLE A;  1TZL A;  4PFO A;  2V6E A;  3H5A A;  4B43 A;  2IS4 A;  4XN0 A;  4P1W A;  2WB1 A;  3LSG A;  4XQF A;  2ELJ A;  4ZDO A;  4DOZ A;  2V1N A;  2WAE A;  4F93 B;  2MD0 A;  4ANJ A;  3OR1 C;  3A2K A;  2R7W A;  4BDZ A;  2KPM A;  4F55 A;  4C30 A;  2IGK A;  2V7F A;  3VYR B;  4F52 A;  1X4P A;  4NQW B;  2OC6 A;  4LIV A;  1U0J A;  3HPG A;  3ZGK A;  4CSW A;  4F91 B;  2VLA A;  3I9V 2;  1DGW Y;  1QHG A;  4B3X A;  2ZXI A;  3TL4 X;  1J09 A;  1MMG A;  1AA7 A;  4G6T B;  2X85 A;  3L2Q A;  2WBM A;  2M4G A;  4MLO A;  1E0E A;  2CS3 A;  3FHN A;  3H9Q A;  3IAM 2;  2AQE A;  1D0X A;  4E6K G;  2W4S A;  2K3P A;  4CCJ A;  4PJJ A;  3IAS 2;  2VKD A;  4NNJ A;  3OYA A;  2HZD A;  3MKZ A;  3SYT A;  2Y0S A;  4U87 A;  5KHD A;  1X1D A;  3BCA A;  3OYF A;  1X19 A;  2JVG A;  4QPO A;  2MAB A;  2X6W A;  2KMU A;  1G59 A;  4E7H A;  1GLN A;  3A4C A;  5KCM A;  1WJA A;  3OYB A;  1LFP A;  2R7V A;  4XKC A;  2DCE A;  3PSF A;  1ERD A;  4XMY A;  2IXS A;  4DJA A;  2M4K A;  3VSL A;  4ZTJ A;  3FDY A;  3AL0 B;  4CA0 A;  2VPL A;  4B47 A;  2XDV A;  3DU5 A;  1NG7 A;  2K5C A;  4RM2 A;  2KHM A;  3CZ6 A;  3QYB A;  4CH7 A;  2LRE A;  5CPR B;  4HEA 2;  3H9G A;  1WJ5 A;  4NC8 A;  2LRD A;  3UNG C;  2E1M B;  1R6R A;  2F6C A;  3RSN A;  3AKZ A;  3S3M A;  2GOX B;  4F3Q A;  3HUG B;  2Z1D A;  3ZCO A;  3OS2 A;  2Q1Z B;  4CZC A;  4PJN A;  4XLH A;  2IS6 A;  3ZR8 X;  3DPU A;  4N4O B;  2V9K A;  4XLA A;  2I8D A;  5FRM A;  2VQL A;  4J01 A;  1HA8 A;  2DOA A;  4Y3O A;  3OL3 A;  2VAS A;  2XSJ C;  3OS0 A;  2QKL B;  1BR4 A;  3OIQ A;  3RQ4 A;  2RNG A;  3K4M A;  4N4N B;  3RCO A;  3OYM A;  1BOB A;  2WAQ A;  4PFP A;  4HRI A;  4PSW A;  2E5Z A;  4BQO A;  1MW7 A;  3IUO A;  2CV1 A;  5LD2 C;  3VYS B;  4BQN A;  3DQV C;  3NWS A;  4XOT A;  3C2G A;  2BW3 A;  4PSX A;  2R7S A;  3KEY A;  3OYE A;  4ZYA A;  3EUH C;  4BJT A;  2DT6 A;  4YRV A;  3HXL A;  1G8X A;  4OAZ A;  2IGN A;  4GRI A;  2OV7 A;  3PJR A;  2VJ5 A;  2X1D A;  1T95 A;  4YEJ A;  4BXF A;  4DGW B;  3QOE A;  4HNU A;  2CH0 A;  3D5S C;  3CP8 A;  2VL8 A;  2PJR B;  1LDK B;  2BVM A;  2LY2 A;  2VJI A;  3KYL A;  4XNF A;  1D1C A;  2X6Y A;  2LOO A;  2V26 A;  4BS9 A;  4C2T A;  3M8J A;  1LKX A;  2UUZ A;  4XM3 A;  4HNT A;  2IGO A;  1OR7 C;  4X0G A;  2LBF A;  1SFK A;  2DXI A;  2X6X A;  4BGD A;  2KDO A;  1Z3Y A;  2XAU A;  2X1C A;  5CQE A;  2VKH A;  3PFY A;  3HL2 A;  2E5N A;  1PYV A;  1YE9 A;  4CCL A;  2XF6 A;  2R7U A;  2CMP A;  3C2H A;  2L9S A;  1V5G A;  2LC2 A;  3I3L A;  1N78 A;  2VQG A;  2F4I A;  2R4G A;  4DIQ A;  1UG0 A;  3OYG A;  4ITV A;  5HVQ C;  2HDW A;  2ZSI B;  4ZDP A;  3K6G A;  3DPT A;  4P5O A;  2JSP A;  4FET A;  4LG3 A;  4PUS A;  3K4L A;  3OYN A;  3SEZ A;  3F9K A;  1WJF A;  2R7O A;  2KRH A;  3LSI A;  3W2V A;  4RM3 A;  2L2O A;  5CQG A;  2DJI A;  5CKT A;  3RTR A;  2KZV A;  1UEL B;  2OUM A;  2HPI A;  3K4N A;  3BCB A;  3AFH A;  4IQ4 A;  4DBR A;  4BL0 B;  1FMV A;  1X1B A;  3HOT A;  2PJR A;  4BU2 A;  1WFX A;  3TBI A;  3H5N A;  3SEQ A;  1IRX A;  4LIU A;  1K6Y A;  1YX5 A;  3LSK A;  3RPU D;  3H5R A;  2JUG A;  1SAU A;  2CW8 A;  3ZXS A;  3EPZ A;  4CUG A;  1WJE A;  1WJD A;  4C9Y A;  4RLF A;  2XF7 A;  4RLQ A;  4YEL A;  4KT6 A;  2BVL A;  3L2V A;  3DKY A;  4JQF A;  2KL4 A;  2BW3 B;  3QYF A;  3OYL A;  1D1B A;  3TMO A;  4QPQ A;  1OLT A;  3LL7 A;  4ZJZ A;  2AQF A;  2VQC A;  1MMD A;  3OIP A;  3D5L A;  4EAT A;  1N75 A;  2M7B A;  4XLF A;  3ZRG A;  4CCM A;  3IP4 B;  4PK4 A;  4CCO A;  2VIX A;  2HPM A;  1D0Z A;  3K4K A;  3S8P A;  3K4B A;  4II3 A;  4E7Z A;  3L2R A;  3LSM A;  4OWR B;  1Z21 A;  4E7J A;  2CV2 A;  3CJR B;  3W2A A;  3K4C A;  1MMA A;  3PNT A;  5FRO A;  2VJ4 A;  2CUJ A;  4BE1 A;  3OYD A;  3S93 A;  2K9M A;  3ONQ A;  2WA0 A;  3CES A;  2LBF B;  1Y6I A;  5HNF A;  1DQU A;  4Y33 A;  3DEE A;  2X1E A;  4NC7 A;  1LVK A;  4E7L A;  1Z7L A;  3EUA A;  3HOS A;  3PL8 A;  3CP2 A;  3QYE A;  3LSH A;  3DPL C;  4XL9 A;  2O5R A;  3K70 D;  4HG2 A;  4IQJ A;  4AVZ A;  4AYB A;  3HPH A;  2GOM A;  2RRE A;  3DKX A;  4HPQ A;  2VQH A;  3FKJ A;  3DLA A;  3N05 A;  3OYJ A;  2R7X A;  1EA3 A;  3DWL E;  1DP3 A;  3BG7 A;  2KP6 A;  3KX2 A;  1DGR M;  2HVR A;  3SDB A;  3MD2 A;  3FBI B;  3U21 A;  3LFU A;  2W1O A;  2R7R A;  2XF5 A;  3HC7 A;  4IZZ A;  4CCN A;  1PJR A;  4XKV A;  3OOU A;  3S32 A;  5LFA A;  3AL0 C;  2MC4 A;  3H35 A;  3QOD A;  3K70 C;  4Y4R A;  2HVQ A;  2JVH A;  2QKM B;  1JI8 A;  4E7I A;  2LG4 A;  3OYK A;  3OYI A;  2HQA A;  2Z2S B;  2UV1 A;  3ZQQ A;  3OY9 A;  2E1M C;  4XN3 A;  2X51 A;  3OWT A;  2HVS A;  3A1Y A;  4H4K C;  3V42 A;  2KQR A;  2ZFU A;  2UWM A;  1TT0 A;  4F92 B;  2LYC A;  3LMM A;  2HU9 A;  2WY7 Q;  2LH9 A;  4J00 A;  3FBN B;  3S3N A;  4BDY A;  3UR3 C;  3NWT A;  2Z16 A;  1D0Y A;  4HSR A;  2ZXH A;  3DTE A;  3L2U A;  2W00 A;  2NOJ B;  4II2 A;  4U7B A;  4ZDL A;  4BE0 A;  2E60 A;  3OYC A;  2PMZ A;  4BEH B;  4E7K A;  3M1C A;  4D1Q A;  3SZG A;  2LY1 A;  4D9J A;  2VJJ A;  1QHH D;  2L9N A;  3HG9 A;  3J7A Y;  4FAS D;  1WJC A;  2W82 A;  4XOP A;  1KON A;  3W2W A;  3PUB A;  2VB6 A;  3DTI A;  1UAA A;  1S9H A;  2A6T A;  2BOL A;  2R7Q A;  4ZTF A;  3DU6 A;  4C2U A;  1W36 D;  3L2W A;  2CFO A;  5FRN A;  2CW7 A;  2Q2E B;  3PNY A;  3MMY B;  1X1C A;  2L7K A;  2CV0 A;  3OYH A;  1BR2 A;  3DTK A;  4XKW A;  3CMM A;  5TGT A;  1FMW A;  4IX7 A;  2JA2 A;  1V5F A;  3CF2 A;  4OAY A;  4XLC A;  4XOR A;  3PSI A;  4XR6 A;  2MYS A;  1MMN A;  2WAD A;  2P0W A;  2L5Q A;  3BG6 A;  4KJZ A;  1MND A;  2HNH A;  3E0J B;  3PNV A;  3D5R C;  5KNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...