2KRCA

Solution structure of the n-terminal domain of bacillus subtilis delta subunit of rna polymerase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit delta
publication title Solution structure of the N-terminal domain of Bacillus subtilis delta subunit of RNA polymerase and its classification based on structural homologs
pubmed doi rcsb
source organism Bacillus subtilis
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2krcA01
2KRCA 4NC8A 2M4KA 4NC7A
chains in the Genus database with same CATH superfamily
4GXOA 3B02A 2EINH 4C2MJ 1UMQA 4KT5C 2QF7A 2CUFA 1JHHA 2MC3A 4XSZF 4E7ZA 1ULYA 1STZA 2R7VA 2LD5A 2XAUA 2EIMH 3CLOA 1JKQC 2DW4A 1SFOJ 2L2OA 1YRNB 3CC2I 2LF8A 2MLKA 3CD6I 3AKZA 3CDIA 3HHHA 4XORA 3WTYC 5IT9Z 5F1JA 3BCBA 3RKXA 3H36A 4A3GJ 1MDMA 1MBJA 3LA7A 1VTNC 4O3MA 1IRFA 1JJ8C 3W6VA 4BXFA 3TO9A 1KGSA 2TCTA 2CU7A 3GXOA 4I7HA 4IO9F 1WZ2A 1G59A 5E1WA 3BG9A 2JUGA 1K7AA 2DA5A 3LSPA 2R7SA 2Z99A 1U9OA 3OOUA 2ZMEC 1YHQI 1VQ8I 3Q9SA 4U0YA 1QO0D 5H2FC 2KMUA 3FIWA 3ABUA 5LHGA 4ZTFA 1TWAJ 2R7DA 3DPTA 3KP5A 4F93B 1P4XA 3R60A 5GPAA 1N75A 3E6MA 3QAHA 1OCCH 3PUBA 5BNGA 3M3YJ 2NAZA 2PN6A 3C18A 4IHYA 3IC7A 2WTEA 3CCQI 3HBLA 4L0ZB 2OBPA 4KMUX 1S7EA 4RGUA 2VQLA 2DYSH 1DDNA 2COMA 1HCRA 1ON1A 2VJJA 5CVUA 2VBZA 3NRVA 4LJZF 1QBJA 1Y6IA 4G9YA 3D5RC 1TT5B 3GFMA 4MQ9F 1P6RA 4ZYDA 3CCEI 1LVAA 4IX7A 2W57A 4HDUA 3OYDA 1MD0A 1UHWA 3ZQFA 2BYVE 5M3MJ 2Y2ZA 3G3ZA 4EM0B 2QWWA 2YU9J 2A69F 2XAFA 2NNYA 3GVAA 3P7NA 4RAZA 3E6BA 2V79A 2FRHA 2CFXA 1TWCJ 1MDMB 4ON0A 1EH8A 1ETOA 4C2TA 1XMKA 2LRDA 4PJNA 4RAYA 2V7FA 1MJAA 3SDBA 3DEUA 2ISZA 1RI7A 4CSWA 3KP7A 4J19A 1ZK8A 4LMYA 4RB1A 1P4AA 5H6RA 5K7ZA 2HDCA 2DA1A 2WAQA 3F6OA 5LRRA 2XC7A 2VOOA 4HEA2 2KJCA 3FX3A 3JRAA 4GFBA 3EUAA 1JUMA 1R71A 4KN4X 4CZCA 3JAMK 4XBFA 4KNYA 2HS5A 3OL3A 3GWZA 4CXFA 1SFEA 3OYIA 3K1NA 2X6OA 4ZDLA 1VFCA 2IGOA 3DTIA 3LSTA 2E2IJ 3HB9A 1BBYA 2O6GE 1VQ9I 1EA3A 3Q0WA 2YPRA 4A3EJ 4UUSA 2QSHX 1UG0A 1IV6A 2JK3A 5D5XB 2Q0OA 3HKZA 4UNOA 2GOXB 2R5ZA 3H92A 3ZMZA 3WGIA 2OAZA 4RLQA 3TW6A 1CF7B 1X1BA 3RZOJ 3A0BC 3HYIA 3KPHA 3GTGJ 1MNMC 1U8BA 3RKQA 2NS8A 5JLXA 2H1KA 4WWCA 3GFJA 2GA2A 3BWGA 4M6VA 2V26A 5J4VA 4BQOA 3CUQA 1OYWA 2KKOA 4CCKA 2CW0F 4HV5A 1HKSA 4I98B 1U3EM 2RV8A 2G9WA 1S9HA 2W00A 4W97A 3IRQA 2VE8A 2QZ8A 1N25A 3E7LA 3DP7A 2MLGA 2QQAA 4I01A 1LVKA 2HI3A 3T0YA 1X4PA 1IXCA 3L2VA 4A3IJ 1Z7LA 3DTEA 2D1VA 4Y15A 5FROA 2CSOA 3BZCA 3ZQCA 2X4HA 1R23A 1XC5A 3SHFA 4XLCA 2FF4A 2AQFA 3OYMA 3TW7A 5GAGJ 3OYHA 1YO5C 1J59A 3ZP5A 4FX4A 1IRXA 2VXDA 4IHSA 2EV0A 3S1QJ 1RNLA 3BR6A 1U2WA 4HX4A 2JN6A 2XAQA 3CCVI 5E3OA 1JKRC 2H8RA 4AWXB 4C3HJ 3PFIA 3RIRA 2DDAA 4B44A 2M4KA 3FZVA 2N8GA 3BC8A 4ESJA 1LFUP 3HOYJ 5EDNA 2P7CB 3ZCOA 4UUSB 4AD9A 3EDPA 1Z05A 3R61A 1Q1HA 3R4KA 3E5XA 5CPRB 1VZ0A 2R5ZB 4BXUA 2LREA 3WTUC 3I4PA 1BW6A 1PUFB 2DT6A 2HWVA 3F0CA 3DCFA 3KP2A 2R7UA 2QCOA 2XDVA 4HF2A 2O8KA 1BIBA 2DJNA 1MH4A 3KE2A 2F2EA 4BS9A 3KYLA 3LSGA 3HRUA 3KCCA 5LGUA 2K4JA 2K86A 2V6CA 3CUQB 4WK8F 3LOCA 2ZNYA 3WU1B 4XQFA 2K9MA 3MD2A 2DA6A 3HGGA 1E3PA 1EF4A 2DOFA 5KHDA 1MBHA 3CDLA 3BZKA 3HOZJ 5IY5H 2L7FP 3F8BA 2QSGX 2PJRA 3OY9A 1FLIA 1FSEA 3FXOA 5FGMA 1APLC 1JGGA 1R1TA 2MH2A 5LEJA 4DOZA 2R7TA 2DCEA 3ERMA 2C6YA 1I1SA 1D8KA 2KRFA 2LY9A 2L7MP 2P81A 2PMHA 3I59B 1BR1A 4A0YA 3JRGA 3LSKA 5E20A 2RVCA 2ECCA 1O7LA 4DYCA 2A6HF 2DFFA 5FKNA 3IH4A 2L9NA 4IJAA 4RA2A 1XTAA 3TOAA 4CUGA 3FK7A 4EGZA 1XSVA 2IT0A 2K3PA 1G3SA 2KL4A 3HOVJ 2LF7A 2EILH 1U0JA 2JPBA 2FXAA 4EJTA 3BPXA 5LBQA 2F4IA 3HRTA 1XGOA 2ZSIB 2DODA 4BEHA 4E7JA 1MIJA 2JQ7A 3L2UA 2UXNA 4R79A 1UB9A 4NBQA 3MFKA 2EFNA 2V6EA 3SYTA 1Z91A 2XGEA 4A5MA 3U2RA 1LDJA 2VLAA 2EV5A 1X1CA 1SC7A 5C4JJ 2R0QC 3W2WA 1H88C 3KX2A 5F08A 5KVRA 3HGYA 1IXRC 2F5CA 2K02A 3OYLA 2Q2EB 3NWTA 1W1WE 2K3FA 1FY7A 1YX3A 3FF5A 1E3OC 2L0KA 3GF2A 1FYKA 1Z1DA 1B8IA 1IC8A 4FTHA 1B6AA 2Z33A 1ZELA 4R1HA 3LQRA 1TNTA 2PJRB 1S7AA 1WGXA 1TW3A 2DFIA 4L0YB 2FJ1A 1F36A 1T98A 2HYJA 1ZRCA 1GXQA 1TC3C 4LG3A 2HVRA 5EEGA 4YFNF 3MZHA 4ESFA 4A6DA 5A2QZ 2R7XA 3W2VA 5D8LB 2HQ5A 3CCLI 2IRFG 1JJ6C 3HOXJ 1SVLA 3S16J 2CH0A 4FCYA 4HX8A 3BLYA 4DIQA 3I4MJ 2ELHA 2F5VA 3K2ZA 1QPMA 2E35A 3E6CC 4IHXA 2DK8A 2HU9A 3EETA 2ZXIA 3IH3A 5GTIC 3GTQJ 1DP3A 1A35A 2IS1A 2CUEA 4NDLA 1UHSA 4HYEA 2UZKA 5F04A 4M3DA 4BEHB 4XRSG 5AONA 2OUMA 4BHPA 1R49A 4AM3A 3WTZA 2JSCA 4Y4RA 4M9XA 3JRIA 3TOBA 2Z16A 5EF6A 1AHDP 1H0MA 1IRZA 2RREA 4LLLA 4KITB 4XLNF 2IBDA 1QZEA 3SEZA 5ICGA 5JHFA 1NK2P 3H1CA 2MD5A 4M3FA 2JA8J 1J09A 2VKEA 2KRHA 3I64A 4N4OB 1Z0XA 2Y9YA 3IKTA 1RUOA 3F9KA 3HPHA 3ZQGA 3K10A 5JHUA 3H0DA 4ENMA 4I2OA 3VYUB 2BXYA 1DGWY 4EGYA 1IGNA 2DLLA 3JTGA 2EB7A 2OF7A 1B8IB 1F5TA 1QGPA 1LKXA 4XL9A 3QPLA 2VOPA 5DM7F 1LUJB 1GVJA 2D1HA 1K6YA 1HXDA 1P7JA 3FDYA 3J80K 1IJWC 4JYKA 5KAIC 3LSHA 3DKXA 1O3QA 1QVUA 2QEXI 3J7AY 5CVVA 4CYDA 2VT2A 1YS7A 4L9VA 2Y0MA 2ZC2A 4PUSA 1G3YA 1JTYA 2VBWA 1GT0C 4XOTA 1W7PD 3JR9A 4XLAA 1XSXA 3KFWX 2IPQX 3K4LA 2DA4A 5CYVA 2F6CA 1GVDA 1IRGA 2A6EF 2DQLA 5D6EA 5B3SH 5J4YA 2R7FA 3ECOA 3PO3J 3L9FA 2CQNA 2WV0A 5M5XJ 4OIPF 2Z2SB 2AQEA 2HFHA 2WB1N 4PJ0C 3HL2A 4E7KA 3WG9A 4BH9A 1R1UA 2MYSA 2J5PA 4ESBA 3UNGC 1WFXA 2PFBA 4XLEA 5D5UB 3IRRA 2KDZA 3S2DJ 1GV2A 2EIKH 5GAHJ 3ABTA 3QOEA 5CQEA 3PIPF 2KRCA 3RJPA 5HS8A 1IZ1A 2HNHA 2GBYA 2X85A 5DYMA 4E4HA 1OLTA 1JT6A 3J81Z 2Y0SN 5TRDA 2VI6A 1DGRM 5IP7J 1B9NA 2A07F 4NB5A 3NQOA 4ZYAA 2LKXA 3CC4I 2OQGA 4HLYA 3CJQB 4ZYGA 4MEYF 3X2QH 4KISA 3OS2A 1XGMA 5HDNA 3FXRA 3FHNA 2A3SA 3P9CA 2M87A 4B43A 2RN7A 1FOKA 2PBIA 4IHVA 2ZCWA 3OOPA 4G7OF 2K9NA 2GXBA 3R0AA 3OS0A 3DPUA 1UJ8A 1DU0A 4ENNA 1GDTA 4RM3A 4F3QA 5HLIA 3ZR8X 2JA6J 2VBXA 4FT8A 2MG4A 2IGKA 5DM6F 4HPQA 3CCUI 1HF0A 1EH7A 1L3LA 4AC0A 3IKVA 2CGPA 5EEHA 1FYMA 4KIFA 4KN7X 2JA7J 2ZBKA 1Z3XA 4LD5A 4P9UA 5E1XA 3JRBA 4WXHA 3IHUA 4D5FA 2IA2A 2IA1A 3M9AA 4OWRB 4IEJA 1OYIA 3IV5A 1ODDA 2ECBA 3DFGA 4JX4A 4LG0A 1SD6A 3ZMVA 5L3CA 3BROA 4MNUA 3OYKA 5BQTA 2FX0A 5K5OA 5E3MA 5LGTA 2GAUA 3F8MA 3BTCA 3E5UA 4Z6YA 3M8EA 4BY7J 1A5JA 2EV6A 2I8DA 2RQPA 4PFOA 3ZQIA 4A3JJ 3I4NJ 1FP1D 4GO1A 1X3UA 3ZN0A 1LEAA 3T8RA 1P9QC 1LEBA 2IXSA 2XUBA 2FNPA 3N05A 4IOCF 3FBIB 2IS4A 2DOEA 2ESNA 3OL4A 2EIJH 1FTZA 1XX5A 3H35A 2EZKA 3VOEA 1OMIA 3GUDA 3W6JB 2XRLA 3S2HJ 4BHBA 1DUXC 5F0CA 2CQ7A 1U78A 4II2A 1YRNA 1TW2A 5L3BA 3CDHA 5E1ZB 3V8JA 2FSWA 2ISYA 2RAEA 2G7UA 4UV8A 2I10A 2JPCA 3LA3A 3K1PA 2BE5F 4NUBA 3FISA 1RKWA 3E3VA 3GFLA 4BDZA 2CWEA 3TDZC 4A0ZA 2NXNB 1EV7A 1UELB 3WG7H 5FKMA 3S1NJ 3G73A 2B7EA 3FXUA 4RB2C 1FZPB 3KETA 3HOUJ 2FBKA 2OCEA 2KJBA 4D0PA 1SVMA 5IOYA 3RZDJ 3VYRB 2ACJA 5D5WB 1ON2A 1QZZA 3KLOA 3Q9VA 3T1BA 4D7MA 3RDIA 3U1DA 4FASD 4JQFA 3JW4A 1AOYA 4Q5SF 3K7AJ 4YRVA 2NVYJ 1BW5A 2BOLA 2KIQA 1NG6A 1D5YA 2ZMEA 4S0HB 1Y1WJ 2P5VA 2QM3A 4KFCA 4LG0B 2DMUA 3GYHX 1ZR4A 3BTLA 3V8LA 2VN2A 1QNTA 2HGCA 3H5NA 3LWFA 5GADJ 2Y31A 4E70A 3KYCB 4BYYA 2AXLA 1BI0A 1MKMA 3VYSB 1N77A 1D0YA 2QQ9A 2K9LA 4A5NA 4UVAA 3CQZJ 5ERIA 5CLSA 1PP7U 2KIUA 2XVCA 5L3GA 4PK4A 1FWZA 2ZJPF 2PQ8A 1WPKA 1PDNC 3AFHA 3GZ5A 1PUEE 1YIOA 3I58A 2R7RA 3EYYA 4GYIA 2VC0A 2VKVA 2ZFUA 1KQ0A 1R7JA 4XKBA 1VQ6I 4OIQF 2DBBA 3ABKH 1JI8A 4U88A 3VB2A 3LNQA 1K78A 2UV1A 1MJ9A 2MFZA 3VPRA 4BACA 3JRFA 3KEQA 3K2AA 4JP0A 1NK3P 2DMPA 4XOPA 4D1QA 2GA1A 1AKHA 3GLLA 3GTPJ 3MVPA 1KYZA 3E5QA 1AA7A 1TLHB 2V4JC 3OIQA 2GLOA 2LP0A 1TP4A 1YG2A 1QHGA 4QSHA 2V9KA 3AAFA 2K40A 3L2RA 3HUGA 2IAIA 4U87A 2XSJC 1A36A 2NVTJ 2BZTA 4UV9A 5ICEA 2V9VA 3CF5F 3ABLH 5DUIA 4XICA 2PMUA 3GTLJ 2BHYA 4P96A 1OCPA 2HOAA 2ZMEB 4XLFA 1RRJA 2KZGA 4KIBA 1ZLKA 1HQCA 2MBFA 5FD6A 3PNVA 3S17J 2VJIA 2CUZA 4RS8A 5E17F 2XHKA 4U0WA 1R1VA 2FD5A 2JVGA 4M3BA 1PYVA 1SFXA 3RPQA 1K4TA 2F5EA 2LSOA 3S3MA 1B59A 1JXSA 2HZDA 1IAWA 2NS0A 2O8XA 3TP3A 1Z21A 4IHTA 1ORKA 1IDYA 1WRJA 4NQWB 5DV5A 4G6DA 3RPUD 5DTDA 3SJMA 3HOSA 1UAAA 3K1MA 1P7IA 1CF7A 2XF5A 1FTTA 4BU2A 4BAYA 2K5CA 2R7QA 5JI6A 4HNUA 3QRFF 1BL0A 1VQ4I 4A3LJ 1PJRA 4EM2A 3S32A 2H09A 3K70D 2XB0X 3HXLA 3DTKA 4XK4A 3VFZA 5DCFA 1S6LA 1H9TA 1K78B 1XDSA 4Q48A 4A3DJ 1S5LC 4NC7A 1OR7C 1AU7A 1ZH5A 1F1ZA 3IWFA 3R0JA 1AKHB 3SDGA 2XKPA 3E6DA 3HM5A 3K4JA 1ZLJA 4LB6B 3JRHA 5IT3A 1YJ9I 2K85A 3CO6C 1X1AA 2XAJA 1LFBA 4PJLA 5J8FA 2NVQJ 2P5LC 4B47A 5K1YA 1I39A 2QQBA 2RKHA 5BPDA 1IN7A 3HUGB 3HEFA 3A02A 4DBQA 1TL8A 1R36A 1B1BA 1VNDA 3BCAA 4IF4A 1ZRFA 1RZ4A 2M30A 1SMYF 4A2UA 4AYBA 3OYBA 2LDUA 3M07A 1OPCA 2BHZA 1TTYA 5FRNA 1QA6A 2R7WA 3BG6A 4AIJA 1V5GA 2L7ZA 4PGHA 3NWSA 4DZJA 2W4SA 1R58A 2KQRA 2IS2A 3L09A 5LD2C 3W6KB 2VL8A 3OYAA 4IRHA 5J47A 4BJTA 2HOSA 2L5QA 2E34A 3GCMA 5LHIA 4EJOA 2YX4A 4IZZA 1WHUA 4A3KJ 1M1EB 2CUJA 4C30A 1TZLA 3K4KA 1PUFA 2CV2A 2A6TA 4N0BA 2OPTA 1W0UA 5CJ9A 3H5RA 4Q4ZF 4KMFA 3LSMA 4Y7NJ 2LMDA 3DKYA 1UCRA 3I54A 3DEWA 4BE1A 3HDDA 2CJJA 3O8HA 5DD4A 4UVCA 4M71A 1FOYA 1S8NA 4PJJA 2KIFA 3QODA 4M9SA 4EM1A 2VONA 3DQVC 1TT0A 2W82A 3OR1C 3L2WA 2HTSA 4AVZA 3WTTC 3K70C 1YIJI 1FBSA 3H9GA 5TISC 3LMMA 4B8XA 4WF2A 4TV7A 3BQZA 1MBGA 4EEFG 2ZJRF 2AO9A 1OFCX 5F0FA 1X58A 1JUPA 1X2MA 2PLYA 5BPIA 1QZYA 3WGHA 3AG2H 4BQQA 2E2JJ 2Y0SA 3ZOBA 2XPUA 3I59A 1HKTA 5EG0A 3TBIA 3N4MA 2XPVA 3C2GA 3RQIA 2EZIA 3JAMZ 1EKEA 1B4AA 1BR2A 1OKRA 1WJFA 3H3VK 2LK2A 3FWEA 3GTJJ 2WC2A 2XROA 4BGDA 2UXXA 4MHGA 5K7FA 3PJRA 1O3RA 3G1LA 3L1PA 1WJCA 4L5EA 1XGSA 2K4BA 2XRNA 5JLWA 1QVTA 3WHCA 1JUSA 1R22A 1W5CC 2BGCA 2OA4A 4ZYEA 4DQ2A 2OJED 4ETSA 1XG1A 3K6GA 2KIMA 3FMRA 4LK1F 1W5TA 2EWNA 2K9QA 4JOMA 3RCOA 2KPMA 2GIZA 1GHCA 5JR3A 1XB4A 4I6ZA 1MSEC 4FETA 4XMYA 4CCMA 4GDFA 1P4WA 2HDWA 2M3AA 2ZB9A 3A0HC 2Q2EA 4DBRA 5C3EJ 3EUHC 1BA5A 3CMMA 3IUOA 4F92B 2LC2A 2V1UA 1YW8A 5M5YJ 1BIAA 3BR5A 3HOWJ 2CV0A 2G7HA 3G2BA 4FX0A 4M72A 2M5WA 3BG5A 4MEXF 3WE2A 5HLHA 3DWLE 5BS6A 1X2NA 1X3WB 4AIHA 1K61A 1WJAA 5GP9A 2DAOA 2Z1DA 2L9VA 1FC3A 3TP0A 5E18F 1IF1A 2M0CA 4N9IA 1KU3A 2OV7A 3BDDA 4MFEA 4XRMA 3JRCA 1D0XA 2KLOA 3I53A 3OSFA 3F72A 5EG0B 3JSPA 3S1RJ 1IV8A 2IVMA 1BJZA 1ETVA 3GFIA 1V54H 2YUSA 3OYEA 2FOKA 4CCOA 2WAEA 1F9NA 3BJOA 2E60A 1O57A 3H5AA 1H89C 4FE7A 5F0HA 2ZO4A 5EZHA 4B3AA 4O5VA 2XF7A 2ICWG 4YEJA 5E79C 5F64A 4BY1J 3D1NI 5F6FA 2V1DA 3TGNA 1E17A 2PMZN 3T5XA 2CMPA 1IUFA 1UFMA 2STWA 1W4MA 3COAC 4DYRA 4F7ZA 3IAS2 5L3FA 2JRMA 2PEXA 2M4GA 1T56A 2L7KA 3GO5A 2L4AA 2Y75A 1OJLA 1XPXA 2X9DA 2L9RA 3MCZA 3V4GA 3L2CA 2ID3A 3A2KA 2PG4A 4I76A 1O3SA 2VT3A 5CVRA 5FKLA 2ZXJA 1ZAOA 4HNVA 5D6FA 2DK5A 2W48A 3V42A 4YFKF 3PL8A 3MN2A 3ZMTA 4MTDA 4RB3C 3P9KA 2LKSA 3T8TA 2H8WA 3CTAA 3CJRB 4E7LA 3AL0C 1W0TA 4HQMA 1FX7A 2OTLI 3OS1A 5J1UA 4G6TB 3DV8A 1ENHA 2HOEA 4JK1X 2OCCH 3AG4H 4NC8A 2VKHA 3FMSA 1HDDC 1ETWA 4XONA 2E7WA 1U6GA 2CG4A 4G7HF 5E8IA 1W5SA 2IA0A 3EPZA 4LB5A 1LE8B 1WJEA 5EYRA 3HRSA 1V55H 2OZ6A 1SEUA 1FJLA 3SQNA 3OMYA 1HW2A 3CO7C 2HVQA 4AIDA 3BJAA 3JRDA 4LLGF 2FU4A 1S3JA 4UB6C 1YQAA 1POGA 1MNDA 3HZJA 3ZQHA 3FXJA 3F22A 3HTUA 4OMZA 2VUMJ 2DI3A 1FSHA 2M8EA 3JSOA 4IL6C 1DU6A 2R93J 5FJ8J 1VQPI 3LA2A 3ZPLA 3M8FA 4U7DA 4JBAA 3D5LA 3ZQLA 4IPAA 2FMYA 1IN8A 1RKTA 4ZJZA 2XAGA 4QWQA 1RR7A 1ACIA 1OYYA 4G8XA 3HOTA 1TWGJ 4FHTA 1J2XA 4UHTA 4CCNA 2HOTA 3KZZA 3U9GA 3LAPA 3H9QA 2DXIA 3ESWB 2VIXA 2HKOA 3ZRGA 1KQ9A 2X1CA 2HPIA 3CJNA 5B1AH 1SFUA 1FOXA 1J0RA 1ZYRF 3LSRA 1MSFC 2OZUA 2TDXA 4CA0A 4HQEA 2X0LA 2ELKA 1BM9A 2K7LA 3QQAA 3LQQA 1YS6A 2PX9A 3TEDA 2Y30A 1OCRH 1FP2A 1SFKA 1RIOH 1KONA 4ENJA 2JZYA 2L54A 5AIQA 2JUCA 2WAQN 1F43A 4RAFA 4DZPA 3WTSC 1D1CA 1U5TC 5FRMA 2CW8A 3MEXA 3A1YA 2LY2A 3CCJI 1RR8C 3GW2A 3I5UA 1WKMA 2DT5A 5BOXA 1TWFJ 5CQGA 1ZR2A 2ZFWA 3O8GA 4JX5A 1TQPA 2XF6A 3S3NA 2P6TA 3KEYA 4N9HA 1IN6A 5HDKA 3V7SA 1V4RA 2VPRA 1T2KA 2JVHA 2LY1A 1TBXA 3LAJA 2VBYA 2ZNZA 3HHGA 1FIPA 5GPCA 3HKZN 3FBNB 3M1EA 3OWTA 2W84A 1X1DA 3K69A 2HQAA 4L9TA 3CC7I 1J7KA 3S8PA 2KDOA 2DFHA 1WJBA 2YS9A 4P5OA 4UXNA 1VQNI 3G71I 3SFIA 3HJEA 3U21A 4P9FA 4HNTA 1ZREA 1DPRA 1W7PA 3PFYA 4A3FJ 4KYWA 1I27A 3B6CA 1C0WA 3QP5A 5GTHC 3O6BB 3FXLA 3CLQA 4PZJA 3VSLA 3A4CA 3ZQ7A 5LEKA 5FLXK 2M9HA 2WADA 2HEOA 4UUVA 3QP6A 2LLKA 1R6RA 2P6SA 2E1NA 4L9NA 4OOIA 4XM3A 1HKQA 3V8KA 4I09A 5HOOA 2EFWA 2B63J 3ERED 2DJIA 3C1DA 5DDGA 1G8XA 2YSRA 4N4NB 4V2FA 1G6NA 4PSWA 1HOMA 4ANJA 1UG2A 3V7CA 5D8KB 4MO7A 2IEKA 5DCMB 1FNNA 2MABA 3ZQQA 1BOBA 4BQAA 2DU9A 4B1RA 1YYVA 3BTJA 3QOPA 3J80Z 3OYFA 4NHJA 1ZKGA 2BXZA 3B73A 4W1UA 1QQIA 4RGRA 2KP6A 1Z9CA 5F1RA 2D2WA 3MAJA 3QPTA 5GAEJ 4G7ZF 4KJZA 4EQQA 5K7HA 2HQRA 5H6QA 4RGSA 2ZJ2A 2M8GX 2X48A 2X51A 4MFDA 1R5HA 1Y1VJ 4ENKA 2HTJA 4E7IA 2P5KA 4MIMA 2CV1A 5HVQC 2EZHA 1YJWI 2ME6A 1IN4A 1A6QA 1XMAA 2Y69H 4JX6A 4DYQA 1IG7A 2XGDA 4YELA 3WGGA 3M7GA 1JTXA 1Y39A 1GUUA 1FBQA 3G1MA 3MKYB 3C7JA 4P55A 3CCYA 4WCGA 1W7PB 3MKZA 3OV8A 1UHMA 2R4GA 5FLMJ 2LR8A 3WTWC 1BC7C 2R5YB 4AUXA 2OTJI 1TQIA 1ETQA 2QYOA 1HW5A 3HSEA 3CP8A 1JKOC 2QBYA 4EMSA 3OYJA 4Y52J 2QVOA 1RPWA 2Y9ZA 3KZYA 2JTVA 1RESA 2KFDA 3HIFA 5CVIA 2A5YB 4R8HA 2YR2A 5E8GA 2DA2A 2EK5A 2W24A 2AXTC 3REOA 3DU6A 3SFZA 1RC9A 5L3EA 2HYFA 4CYCA 4FQGA 3ULQB 2BY2A 2ZXHA 1BR4A 2EBIA 2MA3A 4IVNA 3FM5A 4O6JA 1VQLI 1E2XA 1WCMJ 4UVBA 3ELKA 3BZ6A 3FMQA 3IAM2 3GMEA 2L02A 5J1RA 2OU2A 4CHUA 2WAFA 2GM4A 3W3CA 1UZCA 2P8TA 1SD4A 2P0WA 2CO5A 1CGPA 1ZRDA 2VQHA 3PSIA 1AWCA 2DPDA 1PVEA 1I3AA 4A0XA 2E2HJ 3OIPA 1A31A 1IN5A 1BOAA 4OMYA 1HSJA 2EFQA 5IT9K 2IJLA 3CMYA 1ZQ3P 1FIAA 2DT7B 4CDGA 3CUOA 1FT9A 4EV0A 4OAYA 4IOAF 1QHHD 1EH6A 1WJDA 3JTHA 5D4SA 1O7FA 5KNLA 2O9LA 1X3ZB 3DPLC 5KCMA 3K0LA 3I56I 2E7XA 1KU7A 3LSIA 1MMAA 3QPSA 4OIOF 2VJ5A 4EVIA 3ABMH 3IP4B 1HSTA 1K6OA 1GLNA 2QGUA 1WI3A 2RC4A 4D9JA 4A93J 4F55A 4HV6A 1LPQA 4M6XA 4KA4A 4HLXA 2CW7A 1R5GA 1ZN2A 5B66C 1Z7UA 3NARA 2GIVA 4YIFA 4IRIA 3CCSI 1ZHFA 4NQWA 4Y33A 2QBYB 2CQKA 1BJAA 2PI0A 3PQKA 2W7NA 3JCUC 1ZGJA 1LB2A 4WXCA 2VASA 2LG4A 3TDUC 1Z6TA 2JJ7A 2A5WA 1T38A 2A05A 2OC6A 3A01A 3W2AA 1SD7A 2HVSA 3FKIJ 1R5ID 3RYPA 4CYCB 3K4BA 4EJVA 1DPUA 2P7VB 4C3IJ 2CRGA 4KICA 1I6XA 4IKFA 4XRFA 3KEOA 4L18B 4NNJA 2DMQA 4ZDOA 4KDPA 1OR7A 4LITA 5DUKA 1E0EA 3G6EI 1MH3A 1YTYA 3GTMJ 1FYLA 2HPMA 4MGRA 3J7ZI 4B09A 1SAXA 2PMZA 2EA2A 1ZGWA 2L3DA 2D45A 2FBIA 5EZGA 4G94A 4UUTA 1XMXA 1Q1VA 2GWRA 4FISA 1SAUA 2X1EA 3BG3A 1OCOH 1T6SA 3RI4A 2R7ZJ 5HNHA 1YITI 4E6KG 5FLVA 2W25A 5B1BH 4HRIA 1MBEA 2W85A 3U1KA 5J8CA 4PCQA 4C9YA 1R4MB 1WH5A 1H8AC 1GV5A 3M1CA 3OR2C 4BBSJ 4F52A 1NG7A 5FO5A 2UUZA 1G2HA 1Z3YA 2H6BA 3RTRA 2ZJQF 1JKPC 2K27A 2HXOA 5H20A 1USSA 3CCMI 4II3A 3EQLF 4QPQA 2Z5UA 1OCTC 3BJ6A 1QU3A 2O61A 2JWTA 4EJWA 2TRTA 3DBRB 4HW0A 4NC6A 5HDGA 1ZTRA 3SEQA 1KQ8A 4LIVA 5J1YA 5D4RA 4XLPF 3QU6A 2CS3A 3L00A 2VC1A 3PO2J 3BOQA 1MJBA 2X6XA 3K4MA 4RMNA 4IXAA 3G4SI 4HA8A 4D7NA 4CGZA 1WH7A 2B0LA 3H0GJ 2P4WA 5KK1A 3A01B 1O3TA 3K4CA 3A03A 2M7AA 1R4NB 2VB6A 3BR3A 1D8JA 4LOCA 2LFBA 1XCVA 2EH3A 3ZN1A 1XS9A 1ETXA 5HLGA 1D3YA 2BBYA 1TQMA 2LH9A 4M3EA 1T8IA 3LSJA 3QU3A 2XIGA 1Y8RB 5CKTA 3RPUA 1JHFA 3BR0A 3Q0VA 1ONVA 2X1DA 2M2EA 3CESA 2KISA 1Y8QB 2ME0A 2QKMB 3WE3A 1HLVA 2M1BA 4I02A 5IPAA 5LLQA 3MKWB 5DD8A 3VODA 2IS6A 2WY8Q 2BV6A 3KIOA 1NH3A 3QWLA 1JE8A 2VPLA 4M73A 4BXXJ 3Q3SA 2LNBA 4HX7A 4A3MJ 2CFOA 4DNCA 3FHZA 1D0ZA 1MMDA 3RYRA 2O0YA 1VI0A 3P9IA 5C4XJ 1Z77A 1NTCA 1HBXG 3C3WA 5ED4A 3I9V2 2VJ4A 4RDUA 3PNTA 3PM1A 4AIKA 2DMTA 4AU7A 3V7RA 4HAMA 2LTPA 3J7AO 2FUG2 1K79A 2BW3A 4YIIA 4XKVA 3KYDB 1BC8C 2F4MB 4ZDPA 3ECHA 5DS9A 3M4OJ 1ZARA 2LBFA 1IO2A 1F4KA 2DYRH 2GQQA 5L3DA 5JFRA 3AG3H 3BR1A 2CQQA 2EZLA 4A6EA 3LL7A 4I0BA 2YX7A 1MMGA 2ADUA 1WVRA 1B9MA 2Y48A 4A12A 1K83J 3H3UA 3HPGA 1WSUA 5ILSA 1YE9A 2LYCA 4HOBA 3RKYA 3SZGA 1XSDA 4KIGA 3NAUA 1YW7A 1REPC 1Z67A 1D5VA 3DXJF 3HTSB 5HODA 2EPFA 3I0TA 3KLNA 3CMAI 5HNFA 1BI1A 1MBKA 3K4NA 5EGOA 4E7SA 2JA2A 3KP3A 5AIPA 2WB1A 3FXQA 4LIUA 2MGQA 2O3FA 6PAXA 3AG1H 3I55I 2DQRA 3DLAA 3EUHA 3HSFA 3PUFA 4B4CA 2NOGA 2H1LA 2Z9OA 2IP2A 3JREA 1B72A 2W1OA 2EQRA 2AS5F 4A3BJ 3F21A 3NEUA 5LGNA 4PSXA 5ILVA 4YIRX 3ISPA 2E5ZA 3GX4X 3MKLA 3N97A 3ASNH 2A68F 5FKKA 2DTRA 1WWXA 5J40A 1ETKA 3IL2A 4HSRA 2NVUB 2MW8A 3O2PE 5LRSA 1XGNA 1JGSA 3DEEA 2E1MC 2WWYA 2H94A 2FQ3A 2BW3B 4LK0F 1VQKI 1BN5A 2WY7Q 2JRTA 2WA0A 2LBFB 4BDYA 2XGCA 2E1MB 2VE9A 1Y56A 4Z2YA 2HKXA 3ZMSA 1SANA 1FMVA 4H0EA 1MMNA 3OYCA 2JSPA 3WHBA 5DEQA 3DLLF 2BY0A 4XKWA 4CZZA 5EEAA 3OSGA 2HZTA 5FFZA 5TJJA 5K5RA 2XSDC 3S3OA 2NYXA 2VODA 2O5RA 2F4OB 2KZVA 4K2EA 1FOWA 1IDZA 5M5WJ 2K9SA 2QENA 5EGOB 2DA3A 1V5EA 4RAGA 2YU3A 3GZ6A 1ZG3A 1QPIA 1DP7P 1GXPA 1E3HA 1KZHA 4EJUA 1S72I 3L7WA 3ONQA 4IRGA 3IH2A 3CUQC 2BY1A 4CH7A 5ICFA 1KYWA 3TQNA 3F8NA 1B72B 2STTA 4HF0A 3CF2A 1NHAA 1P92A 4M9ZA 1LE8A 2ZKZA 4V2GA 4QTRA 4RLFA 1ETYA 5ILUA 3KZIC 3DKWA 3GZNB 1XDUA 4MQVA 2XKOA 2LVSA 2ID6A 5IP9J 2NRAC 4XN0A 3CP2A 4OINF 4ZTJA 1YI2I 1FPQA 2A61A 5HLTA 3D0SA 1YOVB 3RQ4A 1J75A 4QIWN 3ML6A 4U7BA 2ELJA 2NNNA 1I6HJ 3WTXC 3BR2A 5TGTA 2VQGA 5A2QK 3BQYA 2BVLA 1TNSA 2CYYA 1VQMI 4J00A 2HR3A 3O3KA 2E1OA 3HG9A 1X1PA 1G4DA 5KAFC 1WI9A 2G0EA 1VQOI 3TMOA 1LFPA 3H9JA 2FBHA 2F48A 3IWZA 1HDPA 4XLHA 4ASNA 3KP4A 4YFXF 2DDBA 1MNEA 4ZH4F 3F8CA 3E1SA 1V3FA 3OYGA 2AHQA 4DW6A 3UR3C 2CQXA 2D5VA 2GZWA 3S15J 2OQRA 2WV1A 3D5SC 2QA4I 1YJNI 2DN0A 2M45A 1O4XA 2LOOA 2ETHA 2RQQA 4HZFA 3R6SA 2H27A 4ABZA 4GYGA 1FEXA 4IQ4A 4BL0B 3VSKA 1MZBA 2X6YA 2GXAA 4A69C 3AL0B 1U8RA 1G3WA 2FNAA 3VDXA 4XNFA 9ANTA 1XN7A 2GXGA 2XGXA 1U5TA 1LDDA 2M7BA 4QLCU 1LQ1A 4XIDA 2KT0A 4PGGA 2DPUA 4D5CA 1LJ9A 2R92J 4HF1A 2M34A 4BQNA 4PJMA 1S29A 3ZXSA 4I0AA 1ZG5A 4BJ6C 4BJ5C 4LGWA 2E36A 1Y0NA 5IOZA 4J01A 4C3JJ 3WU0A 4WXDA 3H3ZA 1DQUA 2B9SA 3GLXA 1IW7F 2IW5A 3C2BA 1ERDA 3BY6A 1I1GA 3FXKA 4F91B 3ZMDA 4Y17A 3G1OA 4PDKA 3J7YJ 4ZZLA 1EJ9A 3QYFA 2IGMA 2FE3A 3E97A 3MZYA 5J6XA 2FMLA 3GBGA 3VWBA 4IHWA 2R3SA 1IXSB 5E3NA 1ZG1A 4HG2A 1T39A 4I99C 2MD0A 1V5FA 4QPOA 4DJAA 4L5JA 4M6YA 4RGXA 1I5ZA 4OAZA 2X6WA 5CVJA 1OQYA 5JVTA 1J9IA 2DA7A 2L01A 2E5NA 5FFXA 2UWMA 2EJRA 3BTIA 4PFPA 4Y3OA 2BY3A 5HS9A 2COBA 3CZ6A 3F3XA 2FQ4A 4AYBN 3S1MJ 1HC8A 3J81K 5HS7A 4RBOA 5DCMA 4GRIA 1OISA 1K4SA 1D1BA 3BPVA 5IYDJ 2DTZA 1MGTA 4U0VA 1MW7A 2QLZA 3MWMA 4AVPA 1S7OA 5IP6A 2I5UA 1XCBA 3PQJA 4OIRF 4M74A 4BKXA 2XAHA 2XPWA 3HRMA 4G12A 2FA5A 1P2FA 1U5TB 3HSRA 3GTOJ 4H4KC 2DFEA 4EATA 3ASOH 3TKYA 3CMEI 2VXZA 1T08B 3OIOA 4FE4A 1LDKB 3KP6A 1T33A 3PIOF 1T95A 3K9TA 2FEZA 2QSFX 4BBRJ 4X6AJ 3Q0UA 4L5IA 1HW1A 2Z3YA 4IQJA 4BNCA 2E19A 1J5YA 2Q8KA 3UKGA 2BEOA 2HDDA 3BT9A 3OYNA 4XR6A 1ITYA 3SZPA 3PSFA 4MTEA 3B6AA 4CO8A 2HXIA 1YFHA 1HA8A 3DBLB 4BE2A 2R7OA 3DBHB 1X4OA 2V9PA 2R5YA 2QUFA 1T0FA 2FOWA 4MLOA 3BG7A 4V19K 2RNJA 3MQ0A 4GCVA 1KU2A 5J3LA 3BP8A 2RGVA 3CJTB 4HSTA 3SXYA 4BE0A 3TO7A 2E71A 3CCRI 5IYCJ 3FKJA 3EYIA 1YLFA 3QYBA 4RB0A 1USTA 1R00A 1CQTA 4DGWB 5K5QA 4KUMA 1VF9A 3TL4X 4LLNA 3S93A 1RUNA 4S05A 4UY8I 2F5DA 4X1EA 4CCJA 2IGNA 1R9TJ 4GGGA 3E0JB 3F8FA 4KT6A 4B3XA 2LKPA 5B5EC 3TO6A 2MSYA 5FD5A 2ESHA 2NS7A 2Q1ZB 3P5JA 4M3GA 2XB5A 3WODF 5D5VB 4ITVA 4ZC3A 3DU5A 3C2HA 1YX5A 5BMZA 5JVGF 3WU2C 3GEZA 3RSNA 1U9NA 2QKLB 3I3LA 5FKOA 2XASA 1MMSA 2BVMA 5M3FJ 1T0FC 4G6QA 4E7HA 1KU9A 2VQCA 1W36D 5FB2A 5LFAA 4CCLA 3EUKL 5C44J 4P1WA 3GTKJ 4XSXF 2L4MA 5ICCA 2DO7A 2E1CA 2MH9A 4UB8C 4B48A 2HYGD 3PNYA 1I50J 3ZGKA 5FLXZ 4XRSA 1YW9A 1VQ7I 1XD7A 2DMNA 2DOAA 2GOMA 4HDVA 3M8JA 4ZZDA 2L9SA 1ZGAA 3Q5FA 2QQ8A 3ZMUA 3S14J 2EA4A 4S04A 3WTVC 4XKCA 2XV4S 4WX9A 1VQ5I 2RDPA 1BI3A 5F27A 1I3QJ 2ZSHB 3MMYB 3SZTA 2HQNA 1SD5A 4Y13A 5EJCA 5IYBJ 4CICA 3MZ8A 2H6CA 4RM2A 2V1NA 3F23A 1LNWA 1Y0UA 4XN3A 5LHHA 4L9JA 1RETA 3FXMA 1A6IA 1SVOA 3F6VA 4LFUA 1IUYA 2F5FA 2OD5A 1D1AA 2VKDA 3RKWA 5E3LA 3I71A 3FM3A 3L2QA 1A04A 1WJ5A 2EFPA 3FK6A 1Z6RA 1QRYA 2NOJB 2O03A 2O7OA 3HC7A 2V1XA 2MC4A 4YG2F 4C2UA 1OCZH 3VYTB 4OU0A 4ZYHA 2NVXJ 1G3TA 1X19A 2PJPA 4HBLA 1PP8F 2KHMA 4BUPA 1FBUA 1SMTA 3QYEA 1FMWA 4BHCA 2JMWA 2JA5J 3ROUA 1BI2A 1W36C 3VEPA 2WBMA 3DF8A 3LFKA 1L0OC 1JT0A 1WQ2A 4X0GA 3S2WA 1MBFA 2ZXWH 3QPHA 4Q47A 1N78A 4A3CJ 2RNGA 2J5OA 1KA8A 2M0MA 1H9GA 3LFUA 2JT1A 2EFOA 1TWHJ
chains in the Genus database with same CATH topology
3A2KA 2HNHA 2X85A 4E4HA 1OLTA 3V42A 1DGRM 5HNFA 3PL8A 4ZYAA 3K4NA 4E7ZA 3CJQB 4E7SA 2R7VA 2JA2A 2XAUA 4KISA 2WB1A 3CJRB 4LIUA 3OS2A 4E7LA 2L2OA 3AL0C 3FHNA 4B43A 3OS1A 3DLAA 4G6TB 3AKZA 4NC8A 2VKHA 3OS0A 4XORA 2W1OA 3DPUA 4XONA 3BCBA 3EPZA 4RM3A 1WJEA 4F3QA 3ZR8X 4BXFA 4PSXA 2IGKA 4HPQA 2E5ZA 3OMYA 1G59A 2HVQA 2JUGA 2R7SA 1MNDA 3OOUA 1Z3XA 2KMUA 4HSRA 4OWRB 4ZTFA 3DEEA 3DPTA 2E1MC 4F93B 2BW3B 1N75A 3D5LA 3OYKA 2WY7Q 2WA0A 3PUBA 2LBFB 4BDYA 2E1MB 1Y56A 4ZJZA 1FMVA 2I8DA 4PFOA 1MMNA 3OYCA 3HOTA 2JSPA 4CCNA 4XKWA 1P9QC 3H9QA 2IXSA 2DXIA 2VIXA 3S3OA 3N05A 3ZRGA 2X1CA 2HPIA 2O5RA 2KZVA 3FBIB 2VQLA 2IS4A 3OL4A 4CA0A 2VJJA 3H35A 1Y6IA 3D5RC 4IX7A 1V5EA 4II2A 3OYDA 1SFKA 1KONA 3ONQA 4NUBA 4CH7A 4BDZA 1D1CA 1UELB 5FRMA 2CW8A 3A1YA 3CF2A 2LY2A 5CQGA 4C2TA 4RLFA 2LRDA 4PJNA 2XF6A 3VYRB 3S3NA 2V7FA 3SDBA 3KEYA 4CSWA 4FASD 4XN0A 3CP2A 4JQFA 4ZTJA 2JVHA 2LY1A 4YRVA 5HLTA 3FBNB 2BOLA 3RQ4A 2WAQA 1NG6A 3OWTA 4U7BA 2XC7A 1X1DA 4HEA2 2ELJA 2HQAA 2VQGA 3EUAA 5TGTA 3S8PA 2BVLA 2KDOA 4CZCA 1WJBA 4J00A 3H5NA 3HG9A 4P5OA 3OL3A 3U21A 4HNTA 3OYIA 3TMOA 1LFPA 3H9JA 3PFYA 1D0YA 4XLHA 4ZDLA 3VYSB 1N77A 2K9LA 1MNEA 2IGOA 3DTIA 3E1SA 3VSLA 3OYGA 3A4CA 1EA3A 4PK4A 3UR3C 2WADA 1UG0A 3HKZA 3AFHA 2GOXB 3D5SC 1R6RA 2R7RA 4RLQA 1X1BA 2LOOA 2RQQA 4XM3A 5HOOA 2ZFUA 4XKBA 2DJIA 1G8XA 4N4NB 4PSWA 4ANJA 1JI8A 4IQ4A 4BL0B 2UV1A 3VSKA 2MFZA 2X6YA 2MABA 3ZQQA 3AL0B 1BOBA 4BACA 2V26A 4XOPA 3OYFA 4BQOA 4D1QA 3VDXA 4XNFA 4CCKA 1S9HA 2W00A 2KP6A 1AA7A 2V4JC 3OIQA 2M7BA 1QHGA 4KJZA 2V9KA 1LVKA 3L2RA 4U87A 2XSJC 4BQNA 1X4PA 4PJMA 3L2VA 2X51A 3ZXSA 1Z7LA 3DTEA 4BJ6C 4E7IA 4BJ5C 5FROA 2CV1A 5HVQC 4J01A 1DQUA 4XLFA 4XLCA 2AQFA 3OYMA 3OYHA 1IRXA 4YELA 1ERDA 2VXDA 3PNVA 2VJIA 2CUZA 3MKYB 4F91B 2JVGA 1PYVA 3QYFA 2IGMA 3MKZA 4B44A 2M4KA 3GBGA 3S3MA 3VWBA 2R4GA 2HZDA 3BC8A 4HG2A 3CP8A 1Z21A 2MD0A 3ZCOA 1V5FA 4QPOA 4DJAA 3OYJA 4NQWB 3RPUD 4OAZA 2X6WA 3HOSA 1UAAA 5CPRB 1VZ0A 2XF5A 2LREA 4BU2A 2E5NA 2K5CA 2R7QA 4HNUA 2UWMA 2DT6A 4PFPA 4Y3OA 1PJRA 3CZ6A 3S32A 2R7UA 3DU6A 3K70D 2XDVA 3HXLA 3DTKA 2ZXHA 1BR4A 4GRIA 1D1BA 4NC7A 1OR7C 4BS9A 3KYLA 3LSGA 1MW7A 3IAM2 2WAFA 3K4JA 4XQFA 2K9MA 3W3CA 2P0WA 3MD2A 1X1AA 4H4KC 4PJLA 2VQHA 3PSIA 4B47A 4EATA 3HUGB 5KHDA 2VXZA 3OIPA 4DBQA 1LDKB 2PJRA 3BCAA 1T95A 3OY9A 4AYBA 2DT7B 3OYBA 4OAYA 1QHHD 4IQJA 1WJDA 5KNLA 4DOZA 2R7WA 3BG6A 5FRNA 2R7TA 2DCEA 1V5GA 3DPLC 3NWSA 5KCMA 1BR1A 3LSKA 3LSIA 1MMAA 2W4SA 3OYNA 4XR6A 2KQRA 2IS2A 2VJ5A 3PSFA 5LD2C 2L9NA 2VL8A 3IP4B 1GLNA 1HA8A 3OYAA 4BE2A 4D9JA 4CUGA 2R7OA 4F55A 4BJTA 1X4OA 2L5QA 2CW7A 2K3PA 2KL4A 4MLOA 3BG7A 1U0JA 4Y33A 4IZZA 2F4IA 2ZSIB 2W7NA 2CUJA 4HSTA 4C30A 1TZLA 3K4KA 4BEHA 4E7JA 2CV2A 2VASA 2A6TA 2LG4A 4BE0A 3L2UA 4R79A 2A5WA 3H5RA 3LSMA 2OC6A 3W2AA 3FKJA 2V6EA 3QYBA 3SYTA 2HVSA 3K4BA 3DKYA 4BE1A 2VLAA 4DGWB 4IKFA 1X1CA 3W2WA 4PJJA 3KX2A 3QODA 4NNJA 3S93A 3TL4X 3DQVC 4ZDOA 1TT0A 2W82A 3OR1C 3L2WA 4LITA 4AVZA 3OYLA 1E0EA 2Q2EB 3NWTA 2IGNA 4CCJA 3K70C 3E0JB 3H9GA 4KT6A 3LMMA 1YX3A 4B3XA 2HPMA 2PMZA 2Q1ZB 1ZELA 4ITVA 4ZC3A 1SAUA 3DU5A 2X1EA 2PJRB 3C2HA 1YX5A 5HNHA 4E6KG 4BQQA 4HRIA 4LG3A 2Y0SA 2HVRA 4C9YA 3RSNA 3TBIA 3M1CA 2QKLB 3I3LA 3C2GA 3OR2C 4F52A 2R7XA 1NG7A 3W2VA 2BVMA 2UUZA 1Z3YA 3RTRA 1BR2A 1WJFA 1T0FC 4E7HA 2CH0A 2VQCA 1W36D 3BLYA 4DIQA 5LFAA 4CCLA 3EUKL 4P1WA 4BGDA 4II3A 2F5VA 4QPQA 3PJRA 1QU3A 1WJCA 4B48A 2HU9A 3PNYA 3SEQA 2ZXIA 4LIVA 3ZGKA 2CS3A 1DP3A 2IS1A 2X6XA 3K4MA 4RMNA 4BEHB 2OUMA 2DOAA 3K6GA 2GOMA 3K4CA 4Y4RA 2M7AA 3M8JA 4JOMA 2VB6A 3RCOA 2KPMA 2L9SA 2Z16A 4FETA 2LH9A 4XMYA 2RREA 4CCMA 4KITB 3SEZA 2HDWA 5CKTA 2M3AA 4DBRA 5JHFA 3EUHC 3CMMA 4XKCA 1J09A 4N4OB 2KRHA 3IUOA 2X1DA 2LC2A 4F92B 3CESA 3F9KA 3HPHA 3K10A 3H0DA 2QKMB 2ZSHB 3MMYB 2CV0A 3VYUB 3G2BA 1DGWY 3MKWB 1LKXA 4XL9A 2IS6A 2WY8Q 3DWLE 1K6YA 1WJAA 3FDYA 4RM2A 2V1NA 2VPLA 3LSHA 2Z1DA 3DKXA 4XN3A 3J7AY 2OV7A 2CFOA 1D0ZA 1MMDA 1D1AA 1D0XA 2KLOA 2VKDA 4PUSA 3L2QA 1WJ5A 4XOTA 3OYEA 4CCOA 2NOJB 2WAEA 4XLAA 3I9V2 3HC7A 2E60A 2MC4A 2VJ4A 3H5AA 3K4LA 4C2UA 3PNTA 2F6CA 3VYTB 4AU7A 1X19A 2FUG2 2XF7A 2BW3A 2KHMA 4YEJA 4BUPA 4XKVA 2Z2SB 2AQEA 3HL2A 4E7KA 4ZDPA 2MYSA 3QYEA 1FMWA 1WFXA 2LBFA 3UNGC 1W36C 2CMPA 4XLEA 2WBMA 3LL7A 3IAS2 4X0GA 1N78A 3QOEA 1MMGA 2M4GA 2L7KA 5CQEA 3HPGA 2RNGA 2KRCA 2M0MA 1YE9A 2LYCA 3SZGA 3LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRC A;  4NC8 A;  2M4K A;  4NC7 A; 
#chains in the Genus database with same CATH topology
 4GXO A;  3B02 A;  2EIN H;  4C2M J;  1UMQ A;  4KT5 C;  2QF7 A;  2CUF A;  1JHH A;  2MC3 A;  4XSZ F;  4E7Z A;  1ULY A;  1STZ A;  2R7V A;  2LD5 A;  2XAU A;  2EIM H;  3CLO A;  1JKQ C;  2DW4 A;  1SFO J;  2L2O A;  1YRN B;  3CC2 I;  2LF8 A;  2MLK A;  3CD6 I;  3AKZ A;  3CDI A;  3HHH A;  4XOR A;  3WTY C;  5IT9 Z;  5F1J A;  3BCB A;  3RKX A;  3H36 A;  4A3G J;  1MDM A;  1MBJ A;  3LA7 A;  1VTN C;  4O3M A;  1IRF A;  1JJ8 C;  3W6V A;  4BXF A;  3TO9 A;  1KGS A;  2TCT A;  2CU7 A;  3GXO A;  4I7H A;  4IO9 F;  1WZ2 A;  1G59 A;  5E1W A;  3BG9 A;  2JUG A;  1K7A A;  2DA5 A;  3LSP A;  2R7S A;  2Z99 A;  1U9O A;  3OOU A;  2ZME C;  1YHQ I;  1VQ8 I;  3Q9S A;  4U0Y A;  1QO0 D;  5H2F C;  2KMU A;  3FIW A;  3ABU A;  5LHG A;  4ZTF A;  1TWA J;  2R7D A;  3DPT A;  3KP5 A;  4F93 B;  1P4X A;  3R60 A;  5GPA A;  1N75 A;  3E6M A;  3QAH A;  1OCC H;  3PUB A;  5BNG A;  3M3Y J;  2NAZ A;  2PN6 A;  3C18 A;  4IHY A;  3IC7 A;  2WTE A;  3CCQ I;  3HBL A;  4L0Z B;  2OBP A;  4KMU X;  1S7E A;  4RGU A;  2VQL A;  2DYS H;  1DDN A;  2COM A;  1HCR A;  1ON1 A;  2VJJ A;  5CVU A;  2VBZ A;  3NRV A;  4LJZ F;  1QBJ A;  1Y6I A;  4G9Y A;  3D5R C;  1TT5 B;  3GFM A;  4MQ9 F;  1P6R A;  4ZYD A;  3CCE I;  1LVA A;  4IX7 A;  2W57 A;  4HDU A;  3OYD A;  1MD0 A;  1UHW A;  3ZQF A;  2BYV E;  5M3M J;  2Y2Z A;  3G3Z A;  4EM0 B;  2QWW A;  2YU9 J;  2A69 F;  2XAF A;  2NNY A;  3GVA A;  3P7N A;  4RAZ A;  3E6B A;  2V79 A;  2FRH A;  2CFX A;  1TWC J;  1MDM B;  4ON0 A;  1EH8 A;  1ETO A;  4C2T A;  1XMK A;  2LRD A;  4PJN A;  4RAY A;  2V7F A;  1MJA A;  3SDB A;  3DEU A;  2ISZ A;  1RI7 A;  4CSW A;  3KP7 A;  4J19 A;  1ZK8 A;  4LMY A;  4RB1 A;  1P4A A;  5H6R A;  5K7Z A;  2HDC A;  2DA1 A;  2WAQ A;  3F6O A;  5LRR A;  2XC7 A;  2VOO A;  4HEA 2;  2KJC A;  3FX3 A;  3JRA A;  4GFB A;  3EUA A;  1JUM A;  1R71 A;  4KN4 X;  4CZC A;  3JAM K;  4XBF A;  4KNY A;  2HS5 A;  3OL3 A;  3GWZ A;  4CXF A;  1SFE A;  3OYI A;  3K1N A;  2X6O A;  4ZDL A;  1VFC A;  2IGO A;  3DTI A;  3LST A;  2E2I J;  3HB9 A;  1BBY A;  2O6G E;  1VQ9 I;  1EA3 A;  3Q0W A;  2YPR A;  4A3E J;  4UUS A;  2QSH X;  1UG0 A;  1IV6 A;  2JK3 A;  5D5X B;  2Q0O A;  3HKZ A;  4UNO A;  2GOX B;  2R5Z A;  3H92 A;  3ZMZ A;  3WGI A;  2OAZ A;  4RLQ A;  3TW6 A;  1CF7 B;  1X1B A;  3RZO J;  3A0B C;  3HYI A;  3KPH A;  3GTG J;  1MNM C;  1U8B A;  3RKQ A;  2NS8 A;  5JLX A;  2H1K A;  4WWC A;  3GFJ A;  2GA2 A;  3BWG A;  4M6V A;  2V26 A;  5J4V A;  4BQO A;  3CUQ A;  1OYW A;  2KKO A;  4CCK A;  2CW0 F;  4HV5 A;  1HKS A;  4I98 B;  1U3E M;  2RV8 A;  2G9W A;  1S9H A;  2W00 A;  4W97 A;  3IRQ A;  2VE8 A;  2QZ8 A;  1N25 A;  3E7L A;  3DP7 A;  2MLG A;  2QQA A;  4I01 A;  1LVK A;  2HI3 A;  3T0Y A;  1X4P A;  1IXC A;  3L2V A;  4A3I J;  1Z7L A;  3DTE A;  2D1V A;  4Y15 A;  5FRO A;  2CSO A;  3BZC A;  3ZQC A;  2X4H A;  1R23 A;  1XC5 A;  3SHF A;  4XLC A;  2FF4 A;  2AQF A;  3OYM A;  3TW7 A;  5GAG J;  3OYH A;  1YO5 C;  1J59 A;  3ZP5 A;  4FX4 A;  1IRX A;  2VXD A;  4IHS A;  2EV0 A;  3S1Q J;  1RNL A;  3BR6 A;  1U2W A;  4HX4 A;  2JN6 A;  2XAQ A;  3CCV I;  5E3O A;  1JKR C;  2H8R A;  4AWX B;  4C3H J;  3PFI A;  3RIR A;  2DDA A;  4B44 A;  2M4K A;  3FZV A;  2N8G A;  3BC8 A;  4ESJ A;  1LFU P;  3HOY J;  5EDN A;  2P7C B;  3ZCO A;  4UUS B;  4AD9 A;  3EDP A;  1Z05 A;  3R61 A;  1Q1H A;  3R4K A;  3E5X A;  5CPR B;  1VZ0 A;  2R5Z B;  4BXU A;  2LRE A;  3WTU C;  3I4P A;  1BW6 A;  1PUF B;  2DT6 A;  2HWV A;  3F0C A;  3DCF A;  3KP2 A;  2R7U A;  2QCO A;  2XDV A;  4HF2 A;  2O8K A;  1BIB A;  2DJN A;  1MH4 A;  3KE2 A;  2F2E A;  4BS9 A;  3KYL A;  3LSG A;  3HRU A;  3KCC A;  5LGU A;  2K4J A;  2K86 A;  2V6C A;  3CUQ B;  4WK8 F;  3LOC A;  2ZNY A;  3WU1 B;  4XQF A;  2K9M A;  3MD2 A;  2DA6 A;  3HGG A;  1E3P A;  1EF4 A;  2DOF A;  5KHD A;  1MBH A;  3CDL A;  3BZK A;  3HOZ J;  5IY5 H;  2L7F P;  3F8B A;  2QSG X;  2PJR A;  3OY9 A;  1FLI A;  1FSE A;  3FXO A;  5FGM A;  1APL C;  1JGG A;  1R1T A;  2MH2 A;  5LEJ A;  4DOZ A;  2R7T A;  2DCE A;  3ERM A;  2C6Y A;  1I1S A;  1D8K A;  2KRF A;  2LY9 A;  2L7M P;  2P81 A;  2PMH A;  3I59 B;  1BR1 A;  4A0Y A;  3JRG A;  3LSK A;  5E20 A;  2RVC A;  2ECC A;  1O7L A;  4DYC A;  2A6H F;  2DFF A;  5FKN A;  3IH4 A;  2L9N A;  4IJA A;  4RA2 A;  1XTA A;  3TOA A;  4CUG A;  3FK7 A;  4EGZ A;  1XSV A;  2IT0 A;  2K3P A;  1G3S A;  2KL4 A;  3HOV J;  2LF7 A;  2EIL H;  1U0J A;  2JPB A;  2FXA A;  4EJT A;  3BPX A;  5LBQ A;  2F4I A;  3HRT A;  1XGO A;  2ZSI B;  2DOD A;  4BEH A;  4E7J A;  1MIJ A;  2JQ7 A;  3L2U A;  2UXN A;  4R79 A;  1UB9 A;  4NBQ A;  3MFK A;  2EFN A;  2V6E A;  3SYT A;  1Z91 A;  2XGE A;  4A5M A;  3U2R A;  1LDJ A;  2VLA A;  2EV5 A;  1X1C A;  1SC7 A;  5C4J J;  2R0Q C;  3W2W A;  1H88 C;  3KX2 A;  5F08 A;  5KVR A;  3HGY A;  1IXR C;  2F5C A;  2K02 A;  3OYL A;  2Q2E B;  3NWT A;  1W1W E;  2K3F A;  1FY7 A;  1YX3 A;  3FF5 A;  1E3O C;  2L0K A;  3GF2 A;  1FYK A;  1Z1D A;  1B8I A;  1IC8 A;  4FTH A;  1B6A A;  2Z33 A;  1ZEL A;  4R1H A;  3LQR A;  1TNT A;  2PJR B;  1S7A A;  1WGX A;  1TW3 A;  2DFI A;  4L0Y B;  2FJ1 A;  1F36 A;  1T98 A;  2HYJ A;  1ZRC A;  1GXQ A;  1TC3 C;  4LG3 A;  2HVR A;  5EEG A;  4YFN F;  3MZH A;  4ESF A;  4A6D A;  5A2Q Z;  2R7X A;  3W2V A;  5D8L B;  2HQ5 A;  3CCL I;  2IRF G;  1JJ6 C;  3HOX J;  1SVL A;  3S16 J;  2CH0 A;  4FCY A;  4HX8 A;  3BLY A;  4DIQ A;  3I4M J;  2ELH A;  2F5V A;  3K2Z A;  1QPM A;  2E35 A;  3E6C C;  4IHX A;  2DK8 A;  2HU9 A;  3EET A;  2ZXI A;  3IH3 A;  5GTI C;  3GTQ J;  1DP3 A;  1A35 A;  2IS1 A;  2CUE A;  4NDL A;  1UHS A;  4HYE A;  2UZK A;  5F04 A;  4M3D A;  4BEH B;  4XRS G;  5AON A;  2OUM A;  4BHP A;  1R49 A;  4AM3 A;  3WTZ A;  2JSC A;  4Y4R A;  4M9X A;  3JRI A;  3TOB A;  2Z16 A;  5EF6 A;  1AHD P;  1H0M A;  1IRZ A;  2RRE A;  4LLL A;  4KIT B;  4XLN F;  2IBD A;  1QZE A;  3SEZ A;  5ICG A;  5JHF A;  1NK2 P;  3H1C A;  2MD5 A;  4M3F A;  2JA8 J;  1J09 A;  2VKE A;  2KRH A;  3I64 A;  4N4O B;  1Z0X A;  2Y9Y A;  3IKT A;  1RUO A;  3F9K A;  3HPH A;  3ZQG A;  3K10 A;  5JHU A;  3H0D A;  4ENM A;  4I2O A;  3VYU B;  2BXY A;  1DGW Y;  4EGY A;  1IGN A;  2DLL A;  3JTG A;  2EB7 A;  2OF7 A;  1B8I B;  1F5T A;  1QGP A;  1LKX A;  4XL9 A;  3QPL A;  2VOP A;  5DM7 F;  1LUJ B;  1GVJ A;  2D1H A;  1K6Y A;  1HXD A;  1P7J A;  3FDY A;  3J80 K;  1IJW C;  4JYK A;  5KAI C;  3LSH A;  3DKX A;  1O3Q A;  1QVU A;  2QEX I;  3J7A Y;  5CVV A;  4CYD A;  2VT2 A;  1YS7 A;  4L9V A;  2Y0M A;  2ZC2 A;  4PUS A;  1G3Y A;  1JTY A;  2VBW A;  1GT0 C;  4XOT A;  1W7P D;  3JR9 A;  4XLA A;  1XSX A;  3KFW X;  2IPQ X;  3K4L A;  2DA4 A;  5CYV A;  2F6C A;  1GVD A;  1IRG A;  2A6E F;  2DQL A;  5D6E A;  5B3S H;  5J4Y A;  2R7F A;  3ECO A;  3PO3 J;  3L9F A;  2CQN A;  2WV0 A;  5M5X J;  4OIP F;  2Z2S B;  2AQE A;  2HFH A;  2WB1 N;  4PJ0 C;  3HL2 A;  4E7K A;  3WG9 A;  4BH9 A;  1R1U A;  2MYS A;  2J5P A;  4ESB A;  3UNG C;  1WFX A;  2PFB A;  4XLE A;  5D5U B;  3IRR A;  2KDZ A;  3S2D J;  1GV2 A;  2EIK H;  5GAH J;  3ABT A;  3QOE A;  5CQE A;  3PIP F;  2KRC A;  3RJP A;  5HS8 A;  1IZ1 A;  2HNH A;  2GBY A;  2X85 A;  5DYM A;  4E4H A;  1OLT A;  1JT6 A;  3J81 Z;  2Y0S N;  5TRD A;  2VI6 A;  1DGR M;  5IP7 J;  1B9N A;  2A07 F;  4NB5 A;  3NQO A;  4ZYA A;  2LKX A;  3CC4 I;  2OQG A;  4HLY A;  3CJQ B;  4ZYG A;  4MEY F;  3X2Q H;  4KIS A;  3OS2 A;  1XGM A;  5HDN A;  3FXR A;  3FHN A;  2A3S A;  3P9C A;  2M87 A;  4B43 A;  2RN7 A;  1FOK A;  2PBI A;  4IHV A;  2ZCW A;  3OOP A;  4G7O F;  2K9N A;  2GXB A;  3R0A A;  3OS0 A;  3DPU A;  1UJ8 A;  1DU0 A;  4ENN A;  1GDT A;  4RM3 A;  4F3Q A;  5HLI A;  3ZR8 X;  2JA6 J;  2VBX A;  4FT8 A;  2MG4 A;  2IGK A;  5DM6 F;  4HPQ A;  3CCU I;  1HF0 A;  1EH7 A;  1L3L A;  4AC0 A;  3IKV A;  2CGP A;  5EEH A;  1FYM A;  4KIF A;  4KN7 X;  2JA7 J;  2ZBK A;  1Z3X A;  4LD5 A;  4P9U A;  5E1X A;  3JRB A;  4WXH A;  3IHU A;  4D5F A;  2IA2 A;  2IA1 A;  3M9A A;  4OWR B;  4IEJ A;  1OYI A;  3IV5 A;  1ODD A;  2ECB A;  3DFG A;  4JX4 A;  4LG0 A;  1SD6 A;  3ZMV A;  5L3C A;  3BRO A;  4MNU A;  3OYK A;  5BQT A;  2FX0 A;  5K5O A;  5E3M A;  5LGT A;  2GAU A;  3F8M A;  3BTC A;  3E5U A;  4Z6Y A;  3M8E A;  4BY7 J;  1A5J A;  2EV6 A;  2I8D A;  2RQP A;  4PFO A;  3ZQI A;  4A3J J;  3I4N J;  1FP1 D;  4GO1 A;  1X3U A;  3ZN0 A;  1LEA A;  3T8R A;  1P9Q C;  1LEB A;  2IXS A;  2XUB A;  2FNP A;  3N05 A;  4IOC F;  3FBI B;  2IS4 A;  2DOE A;  2ESN A;  3OL4 A;  2EIJ H;  1FTZ A;  1XX5 A;  3H35 A;  2EZK A;  3VOE A;  1OMI A;  3GUD A;  3W6J B;  2XRL A;  3S2H J;  4BHB A;  1DUX C;  5F0C A;  2CQ7 A;  1U78 A;  4II2 A;  1YRN A;  1TW2 A;  5L3B A;  3CDH A;  5E1Z B;  3V8J A;  2FSW A;  2ISY A;  2RAE A;  2G7U A;  4UV8 A;  2I10 A;  2JPC A;  3LA3 A;  3K1P A;  2BE5 F;  4NUB A;  3FIS A;  1RKW A;  3E3V A;  3GFL A;  4BDZ A;  2CWE A;  3TDZ C;  4A0Z A;  2NXN B;  1EV7 A;  1UEL B;  3WG7 H;  5FKM A;  3S1N J;  3G73 A;  2B7E A;  3FXU A;  4RB2 C;  1FZP B;  3KET A;  3HOU J;  2FBK A;  2OCE A;  2KJB A;  4D0P A;  1SVM A;  5IOY A;  3RZD J;  3VYR B;  2ACJ A;  5D5W B;  1ON2 A;  1QZZ A;  3KLO A;  3Q9V A;  3T1B A;  4D7M A;  3RDI A;  3U1D A;  4FAS D;  4JQF A;  3JW4 A;  1AOY A;  4Q5S F;  3K7A J;  4YRV A;  2NVY J;  1BW5 A;  2BOL A;  2KIQ A;  1NG6 A;  1D5Y A;  2ZME A;  4S0H B;  1Y1W J;  2P5V A;  2QM3 A;  4KFC A;  4LG0 B;  2DMU A;  3GYH X;  1ZR4 A;  3BTL A;  3V8L A;  2VN2 A;  1QNT A;  2HGC A;  3H5N A;  3LWF A;  5GAD J;  2Y31 A;  4E70 A;  3KYC B;  4BYY A;  2AXL A;  1BI0 A;  1MKM A;  3VYS B;  1N77 A;  1D0Y A;  2QQ9 A;  2K9L A;  4A5N A;  4UVA A;  3CQZ J;  5ERI A;  5CLS A;  1PP7 U;  2KIU A;  2XVC A;  5L3G A;  4PK4 A;  1FWZ A;  2ZJP F;  2PQ8 A;  1WPK A;  1PDN C;  3AFH A;  3GZ5 A;  1PUE E;  1YIO A;  3I58 A;  2R7R A;  3EYY A;  4GYI A;  2VC0 A;  2VKV A;  2ZFU A;  1KQ0 A;  1R7J A;  4XKB A;  1VQ6 I;  4OIQ F;  2DBB A;  3ABK H;  1JI8 A;  4U88 A;  3VB2 A;  3LNQ A;  1K78 A;  2UV1 A;  1MJ9 A;  2MFZ A;  3VPR A;  4BAC A;  3JRF A;  3KEQ A;  3K2A A;  4JP0 A;  1NK3 P;  2DMP A;  4XOP A;  4D1Q A;  2GA1 A;  1AKH A;  3GLL A;  3GTP J;  3MVP A;  1KYZ A;  3E5Q A;  1AA7 A;  1TLH B;  2V4J C;  3OIQ A;  2GLO A;  2LP0 A;  1TP4 A;  1YG2 A;  1QHG A;  4QSH A;  2V9K A;  3AAF A;  2K40 A;  3L2R A;  3HUG A;  2IAI A;  4U87 A;  2XSJ C;  1A36 A;  2NVT J;  2BZT A;  4UV9 A;  5ICE A;  2V9V A;  3CF5 F;  3ABL H;  5DUI A;  4XIC A;  2PMU A;  3GTL J;  2BHY A;  4P96 A;  1OCP A;  2HOA A;  2ZME B;  4XLF A;  1RRJ A;  2KZG A;  4KIB A;  1ZLK A;  1HQC A;  2MBF A;  5FD6 A;  3PNV A;  3S17 J;  2VJI A;  2CUZ A;  4RS8 A;  5E17 F;  2XHK A;  4U0W A;  1R1V A;  2FD5 A;  2JVG A;  4M3B A;  1PYV A;  1SFX A;  3RPQ A;  1K4T A;  2F5E A;  2LSO A;  3S3M A;  1B59 A;  1JXS A;  2HZD A;  1IAW A;  2NS0 A;  2O8X A;  3TP3 A;  1Z21 A;  4IHT A;  1ORK A;  1IDY A;  1WRJ A;  4NQW B;  5DV5 A;  4G6D A;  3RPU D;  5DTD A;  3SJM A;  3HOS A;  1UAA A;  3K1M A;  1P7I A;  1CF7 A;  2XF5 A;  1FTT A;  4BU2 A;  4BAY A;  2K5C A;  2R7Q A;  5JI6 A;  4HNU A;  3QRF F;  1BL0 A;  1VQ4 I;  4A3L J;  1PJR A;  4EM2 A;  3S32 A;  2H09 A;  3K70 D;  2XB0 X;  3HXL A;  3DTK A;  4XK4 A;  3VFZ A;  5DCF A;  1S6L A;  1H9T A;  1K78 B;  1XDS A;  4Q48 A;  4A3D J;  1S5L C;  4NC7 A;  1OR7 C;  1AU7 A;  1ZH5 A;  1F1Z A;  3IWF A;  3R0J A;  1AKH B;  3SDG A;  2XKP A;  3E6D A;  3HM5 A;  3K4J A;  1ZLJ A;  4LB6 B;  3JRH A;  5IT3 A;  1YJ9 I;  2K85 A;  3CO6 C;  1X1A A;  2XAJ A;  1LFB A;  4PJL A;  5J8F A;  2NVQ J;  2P5L C;  4B47 A;  5K1Y A;  1I39 A;  2QQB A;  2RKH A;  5BPD A;  1IN7 A;  3HUG B;  3HEF A;  3A02 A;  4DBQ A;  1TL8 A;  1R36 A;  1B1B A;  1VND A;  3BCA A;  4IF4 A;  1ZRF A;  1RZ4 A;  2M30 A;  1SMY F;  4A2U A;  4AYB A;  3OYB A;  2LDU A;  3M07 A;  1OPC A;  2BHZ A;  1TTY A;  5FRN A;  1QA6 A;  2R7W A;  3BG6 A;  4AIJ A;  1V5G A;  2L7Z A;  4PGH A;  3NWS A;  4DZJ A;  2W4S A;  1R58 A;  2KQR A;  2IS2 A;  3L09 A;  5LD2 C;  3W6K B;  2VL8 A;  3OYA A;  4IRH A;  5J47 A;  4BJT A;  2HOS A;  2L5Q A;  2E34 A;  3GCM A;  5LHI A;  4EJO A;  2YX4 A;  4IZZ A;  1WHU A;  4A3K J;  1M1E B;  2CUJ A;  4C30 A;  1TZL A;  3K4K A;  1PUF A;  2CV2 A;  2A6T A;  4N0B A;  2OPT A;  1W0U A;  5CJ9 A;  3H5R A;  4Q4Z F;  4KMF A;  3LSM A;  4Y7N J;  2LMD A;  3DKY A;  1UCR A;  3I54 A;  3DEW A;  4BE1 A;  3HDD A;  2CJJ A;  3O8H A;  5DD4 A;  4UVC A;  4M71 A;  1FOY A;  1S8N A;  4PJJ A;  2KIF A;  3QOD A;  4M9S A;  4EM1 A;  2VON A;  3DQV C;  1TT0 A;  2W82 A;  3OR1 C;  3L2W A;  2HTS A;  4AVZ A;  3WTT C;  3K70 C;  1YIJ I;  1FBS A;  3H9G A;  5TIS C;  3LMM A;  4B8X A;  4WF2 A;  4TV7 A;  3BQZ A;  1MBG A;  4EEF G;  2ZJR F;  2AO9 A;  1OFC X;  5F0F A;  1X58 A;  1JUP A;  1X2M A;  2PLY A;  5BPI A;  1QZY A;  3WGH A;  3AG2 H;  4BQQ A;  2E2J J;  2Y0S A;  3ZOB A;  2XPU A;  3I59 A;  1HKT A;  5EG0 A;  3TBI A;  3N4M A;  2XPV A;  3C2G A;  3RQI A;  2EZI A;  3JAM Z;  1EKE A;  1B4A A;  1BR2 A;  1OKR A;  1WJF A;  3H3V K;  2LK2 A;  3FWE A;  3GTJ J;  2WC2 A;  2XRO A;  4BGD A;  2UXX A;  4MHG A;  5K7F A;  3PJR A;  1O3R A;  3G1L A;  3L1P A;  1WJC A;  4L5E A;  1XGS A;  2K4B A;  2XRN A;  5JLW A;  1QVT A;  3WHC A;  1JUS A;  1R22 A;  1W5C C;  2BGC A;  2OA4 A;  4ZYE A;  4DQ2 A;  2OJE D;  4ETS A;  1XG1 A;  3K6G A;  2KIM A;  3FMR A;  4LK1 F;  1W5T A;  2EWN A;  2K9Q A;  4JOM A;  3RCO A;  2KPM A;  2GIZ A;  1GHC A;  5JR3 A;  1XB4 A;  4I6Z A;  1MSE C;  4FET A;  4XMY A;  4CCM A;  4GDF A;  1P4W A;  2HDW A;  2M3A A;  2ZB9 A;  3A0H C;  2Q2E A;  4DBR A;  5C3E J;  3EUH C;  1BA5 A;  3CMM A;  3IUO A;  4F92 B;  2LC2 A;  2V1U A;  1YW8 A;  5M5Y J;  1BIA A;  3BR5 A;  3HOW J;  2CV0 A;  2G7H A;  3G2B A;  4FX0 A;  4M72 A;  2M5W A;  3BG5 A;  4MEX F;  3WE2 A;  5HLH A;  3DWL E;  5BS6 A;  1X2N A;  1X3W B;  4AIH A;  1K61 A;  1WJA A;  5GP9 A;  2DAO A;  2Z1D A;  2L9V A;  1FC3 A;  3TP0 A;  5E18 F;  1IF1 A;  2M0C A;  4N9I A;  1KU3 A;  2OV7 A;  3BDD A;  4MFE A;  4XRM A;  3JRC A;  1D0X A;  2KLO A;  3I53 A;  3OSF A;  3F72 A;  5EG0 B;  3JSP A;  3S1R J;  1IV8 A;  2IVM A;  1BJZ A;  1ETV A;  3GFI A;  1V54 H;  2YUS A;  3OYE A;  2FOK A;  4CCO A;  2WAE A;  1F9N A;  3BJO A;  2E60 A;  1O57 A;  3H5A A;  1H89 C;  4FE7 A;  5F0H A;  2ZO4 A;  5EZH A;  4B3A A;  4O5V A;  2XF7 A;  2ICW G;  4YEJ A;  5E79 C;  5F64 A;  4BY1 J;  3D1N I;  5F6F A;  2V1D A;  3TGN A;  1E17 A;  2PMZ N;  3T5X A;  2CMP A;  1IUF A;  1UFM A;  2STW A;  1W4M A;  3COA C;  4DYR A;  4F7Z A;  3IAS 2;  5L3F A;  2JRM A;  2PEX A;  2M4G A;  1T56 A;  2L7K A;  3GO5 A;  2L4A A;  2Y75 A;  1OJL A;  1XPX A;  2X9D A;  2L9R A;  3MCZ A;  3V4G A;  3L2C A;  2ID3 A;  3A2K A;  2PG4 A;  4I76 A;  1O3S A;  2VT3 A;  5CVR A;  5FKL A;  2ZXJ A;  1ZAO A;  4HNV A;  5D6F A;  2DK5 A;  2W48 A;  3V42 A;  4YFK F;  3PL8 A;  3MN2 A;  3ZMT A;  4MTD A;  4RB3 C;  3P9K A;  2LKS A;  3T8T A;  2H8W A;  3CTA A;  3CJR B;  4E7L A;  3AL0 C;  1W0T A;  4HQM A;  1FX7 A;  2OTL I;  3OS1 A;  5J1U A;  4G6T B;  3DV8 A;  1ENH A;  2HOE A;  4JK1 X;  2OCC H;  3AG4 H;  4NC8 A;  2VKH A;  3FMS A;  1HDD C;  1ETW A;  4XON A;  2E7W A;  1U6G A;  2CG4 A;  4G7H F;  5E8I A;  1W5S A;  2IA0 A;  3EPZ A;  4LB5 A;  1LE8 B;  1WJE A;  5EYR A;  3HRS A;  1V55 H;  2OZ6 A;  1SEU A;  1FJL A;  3SQN A;  3OMY A;  1HW2 A;  3CO7 C;  2HVQ A;  4AID A;  3BJA A;  3JRD A;  4LLG F;  2FU4 A;  1S3J A;  4UB6 C;  1YQA A;  1POG A;  1MND A;  3HZJ A;  3ZQH A;  3FXJ A;  3F22 A;  3HTU A;  4OMZ A;  2VUM J;  2DI3 A;  1FSH A;  2M8E A;  3JSO A;  4IL6 C;  1DU6 A;  2R93 J;  5FJ8 J;  1VQP I;  3LA2 A;  3ZPL A;  3M8F A;  4U7D A;  4JBA A;  3D5L A;  3ZQL A;  4IPA A;  2FMY A;  1IN8 A;  1RKT A;  4ZJZ A;  2XAG A;  4QWQ A;  1RR7 A;  1ACI A;  1OYY A;  4G8X A;  3HOT A;  1TWG J;  4FHT A;  1J2X A;  4UHT A;  4CCN A;  2HOT A;  3KZZ A;  3U9G A;  3LAP A;  3H9Q A;  2DXI A;  3ESW B;  2VIX A;  2HKO A;  3ZRG A;  1KQ9 A;  2X1C A;  2HPI A;  3CJN A;  5B1A H;  1SFU A;  1FOX A;  1J0R A;  1ZYR F;  3LSR A;  1MSF C;  2OZU A;  2TDX A;  4CA0 A;  4HQE A;  2X0L A;  2ELK A;  1BM9 A;  2K7L A;  3QQA A;  3LQQ A;  1YS6 A;  2PX9 A;  3TED A;  2Y30 A;  1OCR H;  1FP2 A;  1SFK A;  1RIO H;  1KON A;  4ENJ A;  2JZY A;  2L54 A;  5AIQ A;  2JUC A;  2WAQ N;  1F43 A;  4RAF A;  4DZP A;  3WTS C;  1D1C A;  1U5T C;  5FRM A;  2CW8 A;  3MEX A;  3A1Y A;  2LY2 A;  3CCJ I;  1RR8 C;  3GW2 A;  3I5U A;  1WKM A;  2DT5 A;  5BOX A;  1TWF J;  5CQG A;  1ZR2 A;  2ZFW A;  3O8G A;  4JX5 A;  1TQP A;  2XF6 A;  3S3N A;  2P6T A;  3KEY A;  4N9H A;  1IN6 A;  5HDK A;  3V7S A;  1V4R A;  2VPR A;  1T2K A;  2JVH A;  2LY1 A;  1TBX A;  3LAJ A;  2VBY A;  2ZNZ A;  3HHG A;  1FIP A;  5GPC A;  3HKZ N;  3FBN B;  3M1E A;  3OWT A;  2W84 A;  1X1D A;  3K69 A;  2HQA A;  4L9T A;  3CC7 I;  1J7K A;  3S8P A;  2KDO A;  2DFH A;  1WJB A;  2YS9 A;  4P5O A;  4UXN A;  1VQN I;  3G71 I;  3SFI A;  3HJE A;  3U21 A;  4P9F A;  4HNT A;  1ZRE A;  1DPR A;  1W7P A;  3PFY A;  4A3F J;  4KYW A;  1I27 A;  3B6C A;  1C0W A;  3QP5 A;  5GTH C;  3O6B B;  3FXL A;  3CLQ A;  4PZJ A;  3VSL A;  3A4C A;  3ZQ7 A;  5LEK A;  5FLX K;  2M9H A;  2WAD A;  2HEO A;  4UUV A;  3QP6 A;  2LLK A;  1R6R A;  2P6S A;  2E1N A;  4L9N A;  4OOI A;  4XM3 A;  1HKQ A;  3V8K A;  4I09 A;  5HOO A;  2EFW A;  2B63 J;  3ERE D;  2DJI A;  3C1D A;  5DDG A;  1G8X A;  2YSR A;  4N4N B;  4V2F A;  1G6N A;  4PSW A;  1HOM A;  4ANJ A;  1UG2 A;  3V7C A;  5D8K B;  4MO7 A;  2IEK A;  5DCM B;  1FNN A;  2MAB A;  3ZQQ A;  1BOB A;  4BQA A;  2DU9 A;  4B1R A;  1YYV A;  3BTJ A;  3QOP A;  3J80 Z;  3OYF A;  4NHJ A;  1ZKG A;  2BXZ A;  3B73 A;  4W1U A;  1QQI A;  4RGR A;  2KP6 A;  1Z9C A;  5F1R A;  2D2W A;  3MAJ A;  3QPT A;  5GAE J;  4G7Z F;  4KJZ A;  4EQQ A;  5K7H A;  2HQR A;  5H6Q A;  4RGS A;  2ZJ2 A;  2M8G X;  2X48 A;  2X51 A;  4MFD A;  1R5H A;  1Y1V J;  4ENK A;  2HTJ A;  4E7I A;  2P5K A;  4MIM A;  2CV1 A;  5HVQ C;  2EZH A;  1YJW I;  2ME6 A;  1IN4 A;  1A6Q A;  1XMA A;  2Y69 H;  4JX6 A;  4DYQ A;  1IG7 A;  2XGD A;  4YEL A;  3WGG A;  3M7G A;  1JTX A;  1Y39 A;  1GUU A;  1FBQ A;  3G1M A;  3MKY B;  3C7J A;  4P55 A;  3CCY A;  4WCG A;  1W7P B;  3MKZ A;  3OV8 A;  1UHM A;  2R4G A;  5FLM J;  2LR8 A;  3WTW C;  1BC7 C;  2R5Y B;  4AUX A;  2OTJ I;  1TQI A;  1ETQ A;  2QYO A;  1HW5 A;  3HSE A;  3CP8 A;  1JKO C;  2QBY A;  4EMS A;  3OYJ A;  4Y52 J;  2QVO A;  1RPW A;  2Y9Z A;  3KZY A;  2JTV A;  1RES A;  2KFD A;  3HIF A;  5CVI A;  2A5Y B;  4R8H A;  2YR2 A;  5E8G A;  2DA2 A;  2EK5 A;  2W24 A;  2AXT C;  3REO A;  3DU6 A;  3SFZ A;  1RC9 A;  5L3E A;  2HYF A;  4CYC A;  4FQG A;  3ULQ B;  2BY2 A;  2ZXH A;  1BR4 A;  2EBI A;  2MA3 A;  4IVN A;  3FM5 A;  4O6J A;  1VQL I;  1E2X A;  1WCM J;  4UVB A;  3ELK A;  3BZ6 A;  3FMQ A;  3IAM 2;  3GME A;  2L02 A;  5J1R A;  2OU2 A;  4CHU A;  2WAF A;  2GM4 A;  3W3C A;  1UZC A;  2P8T A;  1SD4 A;  2P0W A;  2CO5 A;  1CGP A;  1ZRD A;  2VQH A;  3PSI A;  1AWC A;  2DPD A;  1PVE A;  1I3A A;  4A0X A;  2E2H J;  3OIP A;  1A31 A;  1IN5 A;  1BOA A;  4OMY A;  1HSJ A;  2EFQ A;  5IT9 K;  2IJL A;  3CMY A;  1ZQ3 P;  1FIA A;  2DT7 B;  4CDG A;  3CUO A;  1FT9 A;  4EV0 A;  4OAY A;  4IOA F;  1QHH D;  1EH6 A;  1WJD A;  3JTH A;  5D4S A;  1O7F A;  5KNL A;  2O9L A;  1X3Z B;  3DPL C;  5KCM A;  3K0L A;  3I56 I;  2E7X A;  1KU7 A;  3LSI A;  1MMA A;  3QPS A;  4OIO F;  2VJ5 A;  4EVI A;  3ABM H;  3IP4 B;  1HST A;  1K6O A;  1GLN A;  2QGU A;  1WI3 A;  2RC4 A;  4D9J A;  4A93 J;  4F55 A;  4HV6 A;  1LPQ A;  4M6X A;  4KA4 A;  4HLX A;  2CW7 A;  1R5G A;  1ZN2 A;  5B66 C;  1Z7U A;  3NAR A;  2GIV A;  4YIF A;  4IRI A;  3CCS I;  1ZHF A;  4NQW A;  4Y33 A;  2QBY B;  2CQK A;  1BJA A;  2PI0 A;  3PQK A;  2W7N A;  3JCU C;  1ZGJ A;  1LB2 A;  4WXC A;  2VAS A;  2LG4 A;  3TDU C;  1Z6T A;  2JJ7 A;  2A5W A;  1T38 A;  2A05 A;  2OC6 A;  3A01 A;  3W2A A;  1SD7 A;  2HVS A;  3FKI J;  1R5I D;  3RYP A;  4CYC B;  3K4B A;  4EJV A;  1DPU A;  2P7V B;  4C3I J;  2CRG A;  4KIC A;  1I6X A;  4IKF A;  4XRF A;  3KEO A;  4L18 B;  4NNJ A;  2DMQ A;  4ZDO A;  4KDP A;  1OR7 A;  4LIT A;  5DUK A;  1E0E A;  3G6E I;  1MH3 A;  1YTY A;  3GTM J;  1FYL A;  2HPM A;  4MGR A;  3J7Z I;  4B09 A;  1SAX A;  2PMZ A;  2EA2 A;  1ZGW A;  2L3D A;  2D45 A;  2FBI A;  5EZG A;  4G94 A;  4UUT A;  1XMX A;  1Q1V A;  2GWR A;  4FIS A;  1SAU A;  2X1E A;  3BG3 A;  1OCO H;  1T6S A;  3RI4 A;  2R7Z J;  5HNH A;  1YIT I;  4E6K G;  5FLV A;  2W25 A;  5B1B H;  4HRI A;  1MBE A;  2W85 A;  3U1K A;  5J8C A;  4PCQ A;  4C9Y A;  1R4M B;  1WH5 A;  1H8A C;  1GV5 A;  3M1C A;  3OR2 C;  4BBS J;  4F52 A;  1NG7 A;  5FO5 A;  2UUZ A;  1G2H A;  1Z3Y A;  2H6B A;  3RTR A;  2ZJQ F;  1JKP C;  2K27 A;  2HXO A;  5H20 A;  1USS A;  3CCM I;  4II3 A;  3EQL F;  4QPQ A;  2Z5U A;  1OCT C;  3BJ6 A;  1QU3 A;  2O61 A;  2JWT A;  4EJW A;  2TRT A;  3DBR B;  4HW0 A;  4NC6 A;  5HDG A;  1ZTR A;  3SEQ A;  1KQ8 A;  4LIV A;  5J1Y A;  5D4R A;  4XLP F;  3QU6 A;  2CS3 A;  3L00 A;  2VC1 A;  3PO2 J;  3BOQ A;  1MJB A;  2X6X A;  3K4M A;  4RMN A;  4IXA A;  3G4S I;  4HA8 A;  4D7N A;  4CGZ A;  1WH7 A;  2B0L A;  3H0G J;  2P4W A;  5KK1 A;  3A01 B;  1O3T A;  3K4C A;  3A03 A;  2M7A A;  1R4N B;  2VB6 A;  3BR3 A;  1D8J A;  4LOC A;  2LFB A;  1XCV A;  2EH3 A;  3ZN1 A;  1XS9 A;  1ETX A;  5HLG A;  1D3Y A;  2BBY A;  1TQM A;  2LH9 A;  4M3E A;  1T8I A;  3LSJ A;  3QU3 A;  2XIG A;  1Y8R B;  5CKT A;  3RPU A;  1JHF A;  3BR0 A;  3Q0V A;  1ONV A;  2X1D A;  2M2E A;  3CES A;  2KIS A;  1Y8Q B;  2ME0 A;  2QKM B;  3WE3 A;  1HLV A;  2M1B A;  4I02 A;  5IPA A;  5LLQ A;  3MKW B;  5DD8 A;  3VOD A;  2IS6 A;  2WY8 Q;  2BV6 A;  3KIO A;  1NH3 A;  3QWL A;  1JE8 A;  2VPL A;  4M73 A;  4BXX J;  3Q3S A;  2LNB A;  4HX7 A;  4A3M J;  2CFO A;  4DNC A;  3FHZ A;  1D0Z A;  1MMD A;  3RYR A;  2O0Y A;  1VI0 A;  3P9I A;  5C4X J;  1Z77 A;  1NTC A;  1HBX G;  3C3W A;  5ED4 A;  3I9V 2;  2VJ4 A;  4RDU A;  3PNT A;  3PM1 A;  4AIK A;  2DMT A;  4AU7 A;  3V7R A;  4HAM A;  2LTP A;  3J7A O;  2FUG 2;  1K79 A;  2BW3 A;  4YII A;  4XKV A;  3KYD B;  1BC8 C;  2F4M B;  4ZDP A;  3ECH A;  5DS9 A;  3M4O J;  1ZAR A;  2LBF A;  1IO2 A;  1F4K A;  2DYR H;  2GQQ A;  5L3D A;  5JFR A;  3AG3 H;  3BR1 A;  2CQQ A;  2EZL A;  4A6E A;  3LL7 A;  4I0B A;  2YX7 A;  1MMG A;  2ADU A;  1WVR A;  1B9M A;  2Y48 A;  4A12 A;  1K83 J;  3H3U A;  3HPG A;  1WSU A;  5ILS A;  1YE9 A;  2LYC A;  4HOB A;  3RKY A;  3SZG A;  1XSD A;  4KIG A;  3NAU A;  1YW7 A;  1REP C;  1Z67 A;  1D5V A;  3DXJ F;  3HTS B;  5HOD A;  2EPF A;  3I0T A;  3KLN A;  3CMA I;  5HNF A;  1BI1 A;  1MBK A;  3K4N A;  5EGO A;  4E7S A;  2JA2 A;  3KP3 A;  5AIP A;  2WB1 A;  3FXQ A;  4LIU A;  2MGQ A;  2O3F A;  6PAX A;  3AG1 H;  3I55 I;  2DQR A;  3DLA A;  3EUH A;  3HSF A;  3PUF A;  4B4C A;  2NOG A;  2H1L A;  2Z9O A;  2IP2 A;  3JRE A;  1B72 A;  2W1O A;  2EQR A;  2AS5 F;  4A3B J;  3F21 A;  3NEU A;  5LGN A;  4PSX A;  5ILV A;  4YIR X;  3ISP A;  2E5Z A;  3GX4 X;  3MKL A;  3N97 A;  3ASN H;  2A68 F;  5FKK A;  2DTR A;  1WWX A;  5J40 A;  1ETK A;  3IL2 A;  4HSR A;  2NVU B;  2MW8 A;  3O2P E;  5LRS A;  1XGN A;  1JGS A;  3DEE A;  2E1M C;  2WWY A;  2H94 A;  2FQ3 A;  2BW3 B;  4LK0 F;  1VQK I;  1BN5 A;  2WY7 Q;  2JRT A;  2WA0 A;  2LBF B;  4BDY A;  2XGC A;  2E1M B;  2VE9 A;  1Y56 A;  4Z2Y A;  2HKX A;  3ZMS A;  1SAN A;  1FMV A;  4H0E A;  1MMN A;  3OYC A;  2JSP A;  3WHB A;  5DEQ A;  3DLL F;  2BY0 A;  4XKW A;  4CZZ A;  5EEA A;  3OSG A;  2HZT A;  5FFZ A;  5TJJ A;  5K5R A;  2XSD C;  3S3O A;  2NYX A;  2VOD A;  2O5R A;  2F4O B;  2KZV A;  4K2E A;  1FOW A;  1IDZ A;  5M5W J;  2K9S A;  2QEN A;  5EGO B;  2DA3 A;  1V5E A;  4RAG A;  2YU3 A;  3GZ6 A;  1ZG3 A;  1QPI A;  1DP7 P;  1GXP A;  1E3H A;  1KZH A;  4EJU A;  1S72 I;  3L7W A;  3ONQ A;  4IRG A;  3IH2 A;  3CUQ C;  2BY1 A;  4CH7 A;  5ICF A;  1KYW A;  3TQN A;  3F8N A;  1B72 B;  2STT A;  4HF0 A;  3CF2 A;  1NHA A;  1P92 A;  4M9Z A;  1LE8 A;  2ZKZ A;  4V2G A;  4QTR A;  4RLF A;  1ETY A;  5ILU A;  3KZI C;  3DKW A;  3GZN B;  1XDU A;  4MQV A;  2XKO A;  2LVS A;  2ID6 A;  5IP9 J;  2NRA C;  4XN0 A;  3CP2 A;  4OIN F;  4ZTJ A;  1YI2 I;  1FPQ A;  2A61 A;  5HLT A;  3D0S A;  1YOV B;  3RQ4 A;  1J75 A;  4QIW N;  3ML6 A;  4U7B A;  2ELJ A;  2NNN A;  1I6H J;  3WTX C;  3BR2 A;  5TGT A;  2VQG A;  5A2Q K;  3BQY A;  2BVL A;  1TNS A;  2CYY A;  1VQM I;  4J00 A;  2HR3 A;  3O3K A;  2E1O A;  3HG9 A;  1X1P A;  1G4D A;  5KAF C;  1WI9 A;  2G0E A;  1VQO I;  3TMO A;  1LFP A;  3H9J A;  2FBH A;  2F48 A;  3IWZ A;  1HDP A;  4XLH A;  4ASN A;  3KP4 A;  4YFX F;  2DDB A;  1MNE A;  4ZH4 F;  3F8C A;  3E1S A;  1V3F A;  3OYG A;  2AHQ A;  4DW6 A;  3UR3 C;  2CQX A;  2D5V A;  2GZW A;  3S15 J;  2OQR A;  2WV1 A;  3D5S C;  2QA4 I;  1YJN I;  2DN0 A;  2M45 A;  1O4X A;  2LOO A;  2ETH A;  2RQQ A;  4HZF A;  3R6S A;  2H27 A;  4ABZ A;  4GYG A;  1FEX A;  4IQ4 A;  4BL0 B;  3VSK A;  1MZB A;  2X6Y A;  2GXA A;  4A69 C;  3AL0 B;  1U8R A;  1G3W A;  2FNA A;  3VDX A;  4XNF A;  9ANT A;  1XN7 A;  2GXG A;  2XGX A;  1U5T A;  1LDD A;  2M7B A;  4QLC U;  1LQ1 A;  4XID A;  2KT0 A;  4PGG A;  2DPU A;  4D5C A;  1LJ9 A;  2R92 J;  4HF1 A;  2M34 A;  4BQN A;  4PJM A;  1S29 A;  3ZXS A;  4I0A A;  1ZG5 A;  4BJ6 C;  4BJ5 C;  4LGW A;  2E36 A;  1Y0N A;  5IOZ A;  4J01 A;  4C3J J;  3WU0 A;  4WXD A;  3H3Z A;  1DQU A;  2B9S A;  3GLX A;  1IW7 F;  2IW5 A;  3C2B A;  1ERD A;  3BY6 A;  1I1G A;  3FXK A;  4F91 B;  3ZMD A;  4Y17 A;  3G1O A;  4PDK A;  3J7Y J;  4ZZL A;  1EJ9 A;  3QYF A;  2IGM A;  2FE3 A;  3E97 A;  3MZY A;  5J6X A;  2FML A;  3GBG A;  3VWB A;  4IHW A;  2R3S A;  1IXS B;  5E3N A;  1ZG1 A;  4HG2 A;  1T39 A;  4I99 C;  2MD0 A;  1V5F A;  4QPO A;  4DJA A;  4L5J A;  4M6Y A;  4RGX A;  1I5Z A;  4OAZ A;  2X6W A;  5CVJ A;  1OQY A;  5JVT A;  1J9I A;  2DA7 A;  2L01 A;  2E5N A;  5FFX A;  2UWM A;  2EJR A;  3BTI A;  4PFP A;  4Y3O A;  2BY3 A;  5HS9 A;  2COB A;  3CZ6 A;  3F3X A;  2FQ4 A;  4AYB N;  3S1M J;  1HC8 A;  3J81 K;  5HS7 A;  4RBO A;  5DCM A;  4GRI A;  1OIS A;  1K4S A;  1D1B A;  3BPV A;  5IYD J;  2DTZ A;  1MGT A;  4U0V A;  1MW7 A;  2QLZ A;  3MWM A;  4AVP A;  1S7O A;  5IP6 A;  2I5U A;  1XCB A;  3PQJ A;  4OIR F;  4M74 A;  4BKX A;  2XAH A;  2XPW A;  3HRM A;  4G12 A;  2FA5 A;  1P2F A;  1U5T B;  3HSR A;  3GTO J;  4H4K C;  2DFE A;  4EAT A;  3ASO H;  3TKY A;  3CME I;  2VXZ A;  1T08 B;  3OIO A;  4FE4 A;  1LDK B;  3KP6 A;  1T33 A;  3PIO F;  1T95 A;  3K9T A;  2FEZ A;  2QSF X;  4BBR J;  4X6A J;  3Q0U A;  4L5I A;  1HW1 A;  2Z3Y A;  4IQJ A;  4BNC A;  2E19 A;  1J5Y A;  2Q8K A;  3UKG A;  2BEO A;  2HDD A;  3BT9 A;  3OYN A;  4XR6 A;  1ITY A;  3SZP A;  3PSF A;  4MTE A;  3B6A A;  4CO8 A;  2HXI A;  1YFH A;  1HA8 A;  3DBL B;  4BE2 A;  2R7O A;  3DBH B;  1X4O A;  2V9P A;  2R5Y A;  2QUF A;  1T0F A;  2FOW A;  4MLO A;  3BG7 A;  4V19 K;  2RNJ A;  3MQ0 A;  4GCV A;  1KU2 A;  5J3L A;  3BP8 A;  2RGV A;  3CJT B;  4HST A;  3SXY A;  4BE0 A;  3TO7 A;  2E71 A;  3CCR I;  5IYC J;  3FKJ A;  3EYI A;  1YLF A;  3QYB A;  4RB0 A;  1UST A;  1R00 A;  1CQT A;  4DGW B;  5K5Q A;  4KUM A;  1VF9 A;  3TL4 X;  4LLN A;  3S93 A;  1RUN A;  4S05 A;  4UY8 I;  2F5D A;  4X1E A;  4CCJ A;  2IGN A;  1R9T J;  4GGG A;  3E0J B;  3F8F A;  4KT6 A;  4B3X A;  2LKP A;  5B5E C;  3TO6 A;  2MSY A;  5FD5 A;  2ESH A;  2NS7 A;  2Q1Z B;  3P5J A;  4M3G A;  2XB5 A;  3WOD F;  5D5V B;  4ITV A;  4ZC3 A;  3DU5 A;  3C2H A;  1YX5 A;  5BMZ A;  5JVG F;  3WU2 C;  3GEZ A;  3RSN A;  1U9N A;  2QKL B;  3I3L A;  5FKO A;  2XAS A;  1MMS A;  2BVM A;  5M3F J;  1T0F C;  4G6Q A;  4E7H A;  1KU9 A;  2VQC A;  1W36 D;  5FB2 A;  5LFA A;  4CCL A;  3EUK L;  5C44 J;  4P1W A;  3GTK J;  4XSX F;  2L4M A;  5ICC A;  2DO7 A;  2E1C A;  2MH9 A;  4UB8 C;  4B48 A;  2HYG D;  3PNY A;  1I50 J;  3ZGK A;  5FLX Z;  4XRS A;  1YW9 A;  1VQ7 I;  1XD7 A;  2DMN A;  2DOA A;  2GOM A;  4HDV A;  3M8J A;  4ZZD A;  2L9S A;  1ZGA A;  3Q5F A;  2QQ8 A;  3ZMU A;  3S14 J;  2EA4 A;  4S04 A;  3WTV C;  4XKC A;  2XV4 S;  4WX9 A;  1VQ5 I;  2RDP A;  1BI3 A;  5F27 A;  1I3Q J;  2ZSH B;  3MMY B;  3SZT A;  2HQN A;  1SD5 A;  4Y13 A;  5EJC A;  5IYB J;  4CIC A;  3MZ8 A;  2H6C A;  4RM2 A;  2V1N A;  3F23 A;  1LNW A;  1Y0U A;  4XN3 A;  5LHH A;  4L9J A;  1RET A;  3FXM A;  1A6I A;  1SVO A;  3F6V A;  4LFU A;  1IUY A;  2F5F A;  2OD5 A;  1D1A A;  2VKD A;  3RKW A;  5E3L A;  3I71 A;  3FM3 A;  3L2Q A;  1A04 A;  1WJ5 A;  2EFP A;  3FK6 A;  1Z6R A;  1QRY A;  2NOJ B;  2O03 A;  2O7O A;  3HC7 A;  2V1X A;  2MC4 A;  4YG2 F;  4C2U A;  1OCZ H;  3VYT B;  4OU0 A;  4ZYH A;  2NVX J;  1G3T A;  1X19 A;  2PJP A;  4HBL A;  1PP8 F;  2KHM A;  4BUP A;  1FBU A;  1SMT A;  3QYE A;  1FMW A;  4BHC A;  2JMW A;  2JA5 J;  3ROU A;  1BI2 A;  1W36 C;  3VEP A;  2WBM A;  3DF8 A;  3LFK A;  1L0O C;  1JT0 A;  1WQ2 A;  4X0G A;  3S2W A;  1MBF A;  2ZXW H;  3QPH A;  4Q47 A;  1N78 A;  4A3C J;  2RNG A;  2J5O A;  1KA8 A;  2M0M A;  1H9G A;  3LFU A;  2JT1 A;  2EFO A;  1TWH J; 
#chains in the Genus database with same CATH homology
 3A2K A;  2HNH A;  2X85 A;  4E4H A;  1OLT A;  3V42 A;  1DGR M;  5HNF A;  3PL8 A;  4ZYA A;  3K4N A;  4E7Z A;  3CJQ B;  4E7S A;  2R7V A;  2JA2 A;  2XAU A;  4KIS A;  2WB1 A;  3CJR B;  4LIU A;  3OS2 A;  4E7L A;  2L2O A;  3AL0 C;  3FHN A;  4B43 A;  3OS1 A;  3DLA A;  4G6T B;  3AKZ A;  4NC8 A;  2VKH A;  3OS0 A;  4XOR A;  2W1O A;  3DPU A;  4XON A;  3BCB A;  3EPZ A;  4RM3 A;  1WJE A;  4F3Q A;  3ZR8 X;  4BXF A;  4PSX A;  2IGK A;  4HPQ A;  2E5Z A;  3OMY A;  1G59 A;  2HVQ A;  2JUG A;  2R7S A;  1MND A;  3OOU A;  1Z3X A;  2KMU A;  4HSR A;  4OWR B;  4ZTF A;  3DEE A;  3DPT A;  2E1M C;  4F93 B;  2BW3 B;  1N75 A;  3D5L A;  3OYK A;  2WY7 Q;  2WA0 A;  3PUB A;  2LBF B;  4BDY A;  2E1M B;  1Y56 A;  4ZJZ A;  1FMV A;  2I8D A;  4PFO A;  1MMN A;  3OYC A;  3HOT A;  2JSP A;  4CCN A;  4XKW A;  1P9Q C;  3H9Q A;  2IXS A;  2DXI A;  2VIX A;  3S3O A;  3N05 A;  3ZRG A;  2X1C A;  2HPI A;  2O5R A;  2KZV A;  3FBI B;  2VQL A;  2IS4 A;  3OL4 A;  4CA0 A;  2VJJ A;  3H35 A;  1Y6I A;  3D5R C;  4IX7 A;  1V5E A;  4II2 A;  3OYD A;  1SFK A;  1KON A;  3ONQ A;  4NUB A;  4CH7 A;  4BDZ A;  1D1C A;  1UEL B;  5FRM A;  2CW8 A;  3A1Y A;  3CF2 A;  2LY2 A;  5CQG A;  4C2T A;  4RLF A;  2LRD A;  4PJN A;  2XF6 A;  3VYR B;  3S3N A;  2V7F A;  3SDB A;  3KEY A;  4CSW A;  4FAS D;  4XN0 A;  3CP2 A;  4JQF A;  4ZTJ A;  2JVH A;  2LY1 A;  4YRV A;  5HLT A;  3FBN B;  2BOL A;  3RQ4 A;  2WAQ A;  1NG6 A;  3OWT A;  4U7B A;  2XC7 A;  1X1D A;  4HEA 2;  2ELJ A;  2HQA A;  2VQG A;  3EUA A;  5TGT A;  3S8P A;  2BVL A;  2KDO A;  4CZC A;  1WJB A;  4J00 A;  3H5N A;  3HG9 A;  4P5O A;  3OL3 A;  3U21 A;  4HNT A;  3OYI A;  3TMO A;  1LFP A;  3H9J A;  3PFY A;  1D0Y A;  4XLH A;  4ZDL A;  3VYS B;  1N77 A;  2K9L A;  1MNE A;  2IGO A;  3DTI A;  3E1S A;  3VSL A;  3OYG A;  3A4C A;  1EA3 A;  4PK4 A;  3UR3 C;  2WAD A;  1UG0 A;  3HKZ A;  3AFH A;  2GOX B;  3D5S C;  1R6R A;  2R7R A;  4RLQ A;  1X1B A;  2LOO A;  2RQQ A;  4XM3 A;  5HOO A;  2ZFU A;  4XKB A;  2DJI A;  1G8X A;  4N4N B;  4PSW A;  4ANJ A;  1JI8 A;  4IQ4 A;  4BL0 B;  2UV1 A;  3VSK A;  2MFZ A;  2X6Y A;  2MAB A;  3ZQQ A;  3AL0 B;  1BOB A;  4BAC A;  2V26 A;  4XOP A;  3OYF A;  4BQO A;  4D1Q A;  3VDX A;  4XNF A;  4CCK A;  1S9H A;  2W00 A;  2KP6 A;  1AA7 A;  2V4J C;  3OIQ A;  2M7B A;  1QHG A;  4KJZ A;  2V9K A;  1LVK A;  3L2R A;  4U87 A;  2XSJ C;  4BQN A;  1X4P A;  4PJM A;  3L2V A;  2X51 A;  3ZXS A;  1Z7L A;  3DTE A;  4BJ6 C;  4E7I A;  4BJ5 C;  5FRO A;  2CV1 A;  5HVQ C;  4J01 A;  1DQU A;  4XLF A;  4XLC A;  2AQF A;  3OYM A;  3OYH A;  1IRX A;  4YEL A;  1ERD A;  2VXD A;  3PNV A;  2VJI A;  2CUZ A;  3MKY B;  4F91 B;  2JVG A;  1PYV A;  3QYF A;  2IGM A;  3MKZ A;  4B44 A;  2M4K A;  3GBG A;  3S3M A;  3VWB A;  2R4G A;  2HZD A;  3BC8 A;  4HG2 A;  3CP8 A;  1Z21 A;  2MD0 A;  3ZCO A;  1V5F A;  4QPO A;  4DJA A;  3OYJ A;  4NQW B;  3RPU D;  4OAZ A;  2X6W A;  3HOS A;  1UAA A;  5CPR B;  1VZ0 A;  2XF5 A;  2LRE A;  4BU2 A;  2E5N A;  2K5C A;  2R7Q A;  4HNU A;  2UWM A;  2DT6 A;  4PFP A;  4Y3O A;  1PJR A;  3CZ6 A;  3S32 A;  2R7U A;  3DU6 A;  3K70 D;  2XDV A;  3HXL A;  3DTK A;  2ZXH A;  1BR4 A;  4GRI A;  1D1B A;  4NC7 A;  1OR7 C;  4BS9 A;  3KYL A;  3LSG A;  1MW7 A;  3IAM 2;  2WAF A;  3K4J A;  4XQF A;  2K9M A;  3W3C A;  2P0W A;  3MD2 A;  1X1A A;  4H4K C;  4PJL A;  2VQH A;  3PSI A;  4B47 A;  4EAT A;  3HUG B;  5KHD A;  2VXZ A;  3OIP A;  4DBQ A;  1LDK B;  2PJR A;  3BCA A;  1T95 A;  3OY9 A;  4AYB A;  2DT7 B;  3OYB A;  4OAY A;  1QHH D;  4IQJ A;  1WJD A;  5KNL A;  4DOZ A;  2R7W A;  3BG6 A;  5FRN A;  2R7T A;  2DCE A;  1V5G A;  3DPL C;  3NWS A;  5KCM A;  1BR1 A;  3LSK A;  3LSI A;  1MMA A;  2W4S A;  3OYN A;  4XR6 A;  2KQR A;  2IS2 A;  2VJ5 A;  3PSF A;  5LD2 C;  2L9N A;  2VL8 A;  3IP4 B;  1GLN A;  1HA8 A;  3OYA A;  4BE2 A;  4D9J A;  4CUG A;  2R7O A;  4F55 A;  4BJT A;  1X4O A;  2L5Q A;  2CW7 A;  2K3P A;  2KL4 A;  4MLO A;  3BG7 A;  1U0J A;  4Y33 A;  4IZZ A;  2F4I A;  2ZSI B;  2W7N A;  2CUJ A;  4HST A;  4C30 A;  1TZL A;  3K4K A;  4BEH A;  4E7J A;  2CV2 A;  2VAS A;  2A6T A;  2LG4 A;  4BE0 A;  3L2U A;  4R79 A;  2A5W A;  3H5R A;  3LSM A;  2OC6 A;  3W2A A;  3FKJ A;  2V6E A;  3QYB A;  3SYT A;  2HVS A;  3K4B A;  3DKY A;  4BE1 A;  2VLA A;  4DGW B;  4IKF A;  1X1C A;  3W2W A;  4PJJ A;  3KX2 A;  3QOD A;  4NNJ A;  3S93 A;  3TL4 X;  3DQV C;  4ZDO A;  1TT0 A;  2W82 A;  3OR1 C;  3L2W A;  4LIT A;  4AVZ A;  3OYL A;  1E0E A;  2Q2E B;  3NWT A;  2IGN A;  4CCJ A;  3K70 C;  3E0J B;  3H9G A;  4KT6 A;  3LMM A;  1YX3 A;  4B3X A;  2HPM A;  2PMZ A;  2Q1Z B;  1ZEL A;  4ITV A;  4ZC3 A;  1SAU A;  3DU5 A;  2X1E A;  2PJR B;  3C2H A;  1YX5 A;  5HNH A;  4E6K G;  4BQQ A;  4HRI A;  4LG3 A;  2Y0S A;  2HVR A;  4C9Y A;  3RSN A;  3TBI A;  3M1C A;  2QKL B;  3I3L A;  3C2G A;  3OR2 C;  4F52 A;  2R7X A;  1NG7 A;  3W2V A;  2BVM A;  2UUZ A;  1Z3Y A;  3RTR A;  1BR2 A;  1WJF A;  1T0F C;  4E7H A;  2CH0 A;  2VQC A;  1W36 D;  3BLY A;  4DIQ A;  5LFA A;  4CCL A;  3EUK L;  4P1W A;  4BGD A;  4II3 A;  2F5V A;  4QPQ A;  3PJR A;  1QU3 A;  1WJC A;  4B48 A;  2HU9 A;  3PNY A;  3SEQ A;  2ZXI A;  4LIV A;  3ZGK A;  2CS3 A;  1DP3 A;  2IS1 A;  2X6X A;  3K4M A;  4RMN A;  4BEH B;  2OUM A;  2DOA A;  3K6G A;  2GOM A;  3K4C A;  4Y4R A;  2M7A A;  3M8J A;  4JOM A;  2VB6 A;  3RCO A;  2KPM A;  2L9S A;  2Z16 A;  4FET A;  2LH9 A;  4XMY A;  2RRE A;  4CCM A;  4KIT B;  3SEZ A;  2HDW A;  5CKT A;  2M3A A;  4DBR A;  5JHF A;  3EUH C;  3CMM A;  4XKC A;  1J09 A;  4N4O B;  2KRH A;  3IUO A;  2X1D A;  2LC2 A;  4F92 B;  3CES A;  3F9K A;  3HPH A;  3K10 A;  3H0D A;  2QKM B;  2ZSH B;  3MMY B;  2CV0 A;  3VYU B;  3G2B A;  1DGW Y;  3MKW B;  1LKX A;  4XL9 A;  2IS6 A;  2WY8 Q;  3DWL E;  1K6Y A;  1WJA A;  3FDY A;  4RM2 A;  2V1N A;  2VPL A;  3LSH A;  2Z1D A;  3DKX A;  4XN3 A;  3J7A Y;  2OV7 A;  2CFO A;  1D0Z A;  1MMD A;  1D1A A;  1D0X A;  2KLO A;  2VKD A;  4PUS A;  3L2Q A;  1WJ5 A;  4XOT A;  3OYE A;  4CCO A;  2NOJ B;  2WAE A;  4XLA A;  3I9V 2;  3HC7 A;  2E60 A;  2MC4 A;  2VJ4 A;  3H5A A;  3K4L A;  4C2U A;  3PNT A;  2F6C A;  3VYT B;  4AU7 A;  1X19 A;  2FUG 2;  2XF7 A;  2BW3 A;  2KHM A;  4YEJ A;  4BUP A;  4XKV A;  2Z2S B;  2AQE A;  3HL2 A;  4E7K A;  4ZDP A;  2MYS A;  3QYE A;  1FMW A;  1WFX A;  2LBF A;  3UNG C;  1W36 C;  2CMP A;  4XLE A;  2WBM A;  3LL7 A;  3IAS 2;  4X0G A;  1N78 A;  3QOE A;  1MMG A;  2M4G A;  2L7K A;  5CQE A;  3HPG A;  2RNG A;  2KRC A;  2M0M A;  1YE9 A;  2LYC A;  3SZG A;  3LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...