2KRCA

Solution structure of the n-terminal domain of bacillus subtilis delta subunit of rna polymerase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'GIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit delta
publication title Solution structure of the N-terminal domain of Bacillus subtilis delta subunit of RNA polymerase and its classification based on structural homologs
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2krcA01
2KRCA 2M4KA 4NC8A 4NC7A
chains in the Genus database with same CATH superfamily
5E3MA 4N4NB 5DD4A 5F04A 4CGZA 1GHCA 3MKZA 2IJLA 1LQ1A 4HAMA 1WVRA 4MHGA 4B43A 2QKMB 3GUDA 3F9KA 3LAJA 3GX4X 2CW7A 4OIPF 1B72B 3K4BA 2JPBA 3HKZA 1R9TJ 1G8XA 1R6RA 2G0EA 2CWEA 3H1CA 3LOCA 5FD5A 2HQAA 2KLOA 2XRLA 1IO2A 1XN7A 2XGCA 2ZFUA 1FIAA 3BPXA 2HQNA 2XAGA 5DM7F 2EIKH 4XLHA 2RV8A 4ZZLA 1OCOH 5EDNA 2XAFA 3E7LA 2BZTA 3AG3H 2RQPA 1KU7A 4MFDA 3S8PA 3ML6A 4RGRA 4RLFA 1W0TA 3ZPLA 4A0XA 4HRIA 3L00A 2DN0A 3BJOA 2NNYA 4OMYA 5DTDA 3RZOJ 2A6EF 2AQFA 3SEZA 3WE3A 1A04A 1IUFA 1S8NA 2ZJ2A 3K6GA 2ELHA 4I0AA 4C30A 2H1KA 4BXXJ 1WKMA 2HOSA 1X19A 2OUMA 3L2WA 2X1EA 3E3VA 4F7ZA 5GPCA 3DPUA 3JAMK 3A01A 1XSDA 3E97A 3V7CA 4HBLA 1QZYA 3TOBA 1ETOA 1FBSA 1JT6A 1IN7A 1PYVA 2LBFB 2NYXA 4DJAA 3IAM2 4XKCA 2W4SA 1Y1WJ 2KDZA 3MEXA 3SYTA 1U5TA 2IEKA 2YX4A 4XN0A 1IN8A 1W36D 5DEQA 1I39A 1U0JA 5DV5A 2GXAA 2LMDA 3D5LA 3E1SA 3TOAA 1ZH5A 2FNPA 3CZ6A 2HDWA 2K9QA 4DZPA 3AL0B 3HUGA 1S7EA 4F93B 2QBYA 2UUZA 3BTLA 4XK4A 1TWHJ 1I27A 1R1VA 1XGNA 3FX3A 3R4KA 1KQ8A 3PUFA 3WHBA 1WSUA 2M3AA 1UHMA 2XKOA 4BQQA 2DK8A 5IP7J 4YELA 1ULYA 2FEZA 4L5JA 3WTYC 3OYKA 1RKWA 4BBSJ 2K9SA 1LFUP 4DQ2A 2BW3B 3FXKA 4LD5A 2E1MB 2VQGA 3GZNB 3FXJA 2WWYA 2CQQA 4M9XA 3ZQIA 4AUXA 2XAJA 2FXAA 4HLYA 1ZG1A 4BHPA 4EJOA 3JRFA 3MFKA 1B59A 2L4AA 2ZJQF 2G7HA 2EB7A 3K4NA 2DAOA 2Y75A 5IYBJ 3ZMUA 3DCFA 3H36A 2HPMA 4ON0A 1R4NB 4ZTJA 3ABLH 2LK2A 1TBXA 1XPXA 5M5YJ 3RKQA 3WGIA 1QRYA 3PFIA 1KU3A 1MMAA 2EWNA 2J5OA 1FBQA 3IRQA 4IKFA 3RKXA 2F4MB 5D6EA 3BROA 3E6DA 3HRTA 3KLOA 1UJ8A 3AG2H 3VB2A 3LFUA 1WJFA 1P4AA 5EEGA 2GIZA 1MMGA 1ZGAA 3CO6C 2K9LA 1OPCA 1IV6A 1DDNA 4RAZA 1DPUA 1ZREA 1YIJI 1S6LA 3DTIA 1RPWA 4DBQA 5DS9A 3BWGA 4M71A 1G3YA 2LNBA 4XRFA 2HYFA 2O8KA 5F64A 2HVRA 2P6TA 3EUKL 1W5CC 3T8TA 1DUXC 1AKHA 4XIDA 3KP3A 3UR3C 1Z6RA 2CV1A 1FOKA 2VXDA 5FRMA 1BL0A 5KVRA 2EBIA 2DFIA 2KIQA 1V54H 1N77A 5C4XJ 4P9FA 2C6YA 1HCRA 5E17F 1ZGWA 4YIIA 1XMXA 2PBIA 4PFPA 4AD9A 5ICCA 1Y39A 2NVYJ 2A3SA 5EF6A 1U9OA 4D7MA 3GTMJ 3F23A 5GTIC 4X0GA 2AXLA 3GWZA 3GTPJ 4FE4A 3H5AA 3BJ6A 5LHHA 2V9KA 4B47A 3KEQA 1DU0A 5D6FA 2BHYA 3HOXJ 1VNDA 1P92A 3F21A 1IG7A 1IUYA 1PP8F 1FSEA 2YR2A 1MW7A 3P9CA 3H92A 4YIFA 3RIRA 4KT5C 3W6JB 4XRSA 1STZA 5D5XB 4EJTA 3CDHA 1LEAA 4A12A 2LDUA 2OTLI 2Z1DA 3DBRB 3QU3A 4UUSB 5F0FA 2M87A 2QZ8A 1MDMA 1J0RA 2W7NA 3MAJA 3I55I 4A3FJ 4OAYA 3NRVA 5C44J 1GV2A 4IRHA 1SFXA 3UKGA 2A05A 3P5JA 3PIPF 2KRCA 2M2EA 2KIUA 3K2ZA 4ZYHA 3Q5FA 4LLNA 1K4SA 4HOBA 3U9GA 1IW7F 4MFEA 4FCYA 5DUKA 1U6GA 2A69F 3GO5A 4XSZF 3BC8A 3IAS2 4RGSA 1D3YA 5B66C 2M30A 1W36C 1Z05A 2L9VA 4LIVA 3OYDA 4DW6A 1UHSA 4CDGA 1GVDA 2BW3A 3H0DA 4BY7J 1IN4A 1Y56A 3LSGA 1XDSA 1T08B 2F5DA 5IP6A 4D1QA 1G4DA 2L7MP 3S1QJ 1IV8A 3ZQLA 3ZQHA 3BZ6A 2JMWA 1ZR2A 1MJBA 1R5HA 1I3QJ 4EM0B 1FYMA 4KA4A 1ZHFA 4L9NA 2DT6A 3C2HA 3S3MA 3FM5A 5IY5H 1T95A 2IRFG 2YPRA 2V9VA 3ZMTA 4V19K 1LE8B 1UG0A 3CMYA 2ZFWA 2Q2EA 3KE2A 3CJRB 2KT0A 4PSXA 1ZR4A 2KMUA 2WB1A 2ZJPF 2MGQA 4BUPA 3HZJA 1RKTA 1UCRA 5FJ8J 2VL8A 2Y0SN 3C3WA 3AL0C 3QAHA 1YTYA 2JT1A 2R7OA 3K10A 3BZCA 1SAUA 4E7KA 1Z67A 3BR5A 1BI1A 1QZZA 4BL0B 3T8RA 4IHTA 1IJWC 2DJIA 4WXHA 1G3SA 4PFOA 4AIJA 4KDPA 4C3IJ 3VDXA 4RB0A 5FLMJ 3WTWC 2WV0A 2ME0A 5J1YA 1ONVA 3HOTA 3HPGA 2W48A 5HLGA 1HLVA 1LDJA 2E1MC 4Y3OA 1RETA 3KYCB 3C7JA 2FD5A 2V9PA 1P9QC 2EZHA 3RYRA 3K0LA 3RPQA 4KISA 4G94A 2BEOA 1RUNA 1PDNC 1T38A 1Y8RB 3K1PA 3FMQA 3RZDJ 4IHSA 4NDLA 4LG0A 1I6XA 1JHFA 3GYHX 1W5SA 2B7EA 4ENKA 5FRNA 3R0JA 2P8TA 2UV1A 3MMYB 2NS8A 5EEAA 2ETHA 3Q0WA 3CC4I 1AOYA 4L9JA 5EZHA 2NVQJ 1ZRFA 2BV6A 1T0FC 4RAGA 1O57A 1BIAA 2E1NA 5C3EJ 1Z91A 1Z1DA 1OCRH 3C2GA 1HKSA 2R0QC 2CS3A 2R7FA 3BPVA 4M9SA 1IN6A 1WH7A 3CDLA 3GEZA 1A35A 1R7JA 2CV2A 3ROUA 3M1CA 2QQAA 1UAAA 2W82A 5E18F 5GADJ 3VODA 4AIKA 3RQ4A 3V42A 4M3EA 3G71I 2HKOA 2OD5A 2V1XA 3I64A 2B0LA 3DBHB 4BS9A 4A3MJ 1QQIA 3CF5F 3BQZA 4DNCA 3PL8A 2KKOA 1V5FA 2K4BA 2DTRA 3LMMA 2EZIA 3DU6A 3BZKA 1SVOA 2HXOA 1YHQI 3JAMZ 2LY9A 2MD0A 3BY6A 1VQMI 3WG9A 1QHHD 1J59A 2JUGA 2IW5A 3O8HA 2IA1A 1T56A 2QSHX 1OQYA 3S1NJ 1ZG5A 5H2FC 1H89C 1R49A 3W3CA 1BR4A 3ZCOA 2M4GA 2OJED 2E19A 2NVXJ 3VYRB 2PEXA 2WADA 1M1EB 1JKQC 2XRNA 4M6XA 1TWGJ 4V2GA 5BOXA 2RAEA 4EVIA 1I1SA 4ESFA 2LREA 3DV8A 1HA8A 2JPCA 4Q47A 2L2OA 3OMYA 3SQNA 3I58A 1LE8A 2BVLA 2ZJRF 3IUOA 3S17J 4G9YA 4HSRA 5LGTA 2V1DA 2DOEA 2KDOA 1ON2A 3OR2C 3WGGA 4HX7A 4YFKF 4DGWB 2EINH 3V7RA 4BYYA 3I0TA 4FASD 3BR3A 5E20A 5GAHJ 3L2UA 4BJ5C 3BR2A 2CUZA 1T8IA 2K9MA 2QQ8A 1FY7A 4HF0A 5F08A 1R1UA 2ZBKA 1KGSA 3FIWA 1YJWI 4NC8A 1X1PA 2RKHA 3PQJA 1SMYF 1R22A 2VPRA 3QODA 4E6KG 5LGNA 3OYMA 4I98B 2ECBA 1IRFA 4HDUA 2ZMEA 1ZRDA 1ON1A 4YEJA 4MO7A 2Z33A 5D4SA 1JE8A 2QKLB 5J4VA 3FBIB 3ZMZA 5LLQA 2F4OB 1TP4A 3HBLA 2QF7A 5K5RA 2XF7A 4U0VA 3NARA 2MABA 3JRGA 2GLOA 1DGWY 3E5UA 2VONA 2X0LA 2XAUA 5F27A 3DLLF 1T2KA 2ESHA 3L2VA 4AVZA 2E2IJ 3P9KA 3G6EI 1JGSA 4F55A 5E3OA 2W24A 3LSHA 3LA3A 4Y4RA 1MKMA 3ISPA 1JJ6C 2MH9A 1SC7A 4IO9F 1F9NA 2VBXA 2MW8A 3G1MA 2O6GE 1QBJA 4HX8A 2P7CB 1U8BA 3DBLB 4JK1X 5M3FJ 2JJ7A 1X58A 3PSFA 4HV5A 4M6VA 4I01A 1XGMA 3W2AA 3F0CA 2DI3A 2QUFA 2XAQA 4XKVA 2KJCA 5EG0B 3HYIA 1S29A 1TNTA 3TP0A 4CSWA 1TWFJ 3IH2A 4BBRJ 5LHGA 4MEXF 2EFOA 1BW6A 3CDIA 3I4PA 3HDDA 3SXYA 4XLCA 4KMFA 3BTJA 4NC7A 2H1LA 2XASA 5H6RA 1O7FA 1R00A 2EPFA 2PX9A 3I4MJ 5E3LA 4OU0A 3ESWB 4BQAA 4ESBA 2R7VA 3U2RA 3CCQI 2QLZA 3WTXC 1DP3A 2WC2A 2E1CA 1IXCA 3HPHA 5CQGA 2LC2A 3H5NA 1ZARA 4RDUA 2M1BA 2HKXA 2DMUA 3F6OA 2E60A 1LJ9A 2EA2A 3G1OA 3ZMSA 2PMZN 4UVBA 2WA0A 1X1CA 3I9V2 2K86A 1SAXA 3FMSA 1FYKA 4NQWB 1YE9A 3QPHA 2EA4A 2ZXIA 4GYIA 5F1RA 4GYGA 1OR7A 2ZNZA 3A0BC 4BJTA 5EEHA 3ZN1A 1G3WA 4CO8A 1WJ5A 2MLKA 3W6VA 2VC1A 1R71A 5M3MJ 1YOVB 4CCMA 2ZC2A 2V6EA 3HTUA 2DA5A 2V79A 3PQKA 1G59A 1FMWA 2L7KA 2A5WA 2Z16A 1K6OA 5HDNA 2Y48A 1JUSA 1TT5B 4M6YA 4PGGA 1YW8A 2HR3A 1D0YA 2RVCA 4HA8A 3JW4A 3LFKA 3NWSA 4O5VA 1CF7A 1FZPB 5FFXA 3HTSB 2DW4A 2DU9A 2KJBA 2XF5A 1S72I 3K4CA 5CPRB 2CV0A 2EILH 5IOZA 2EFNA 1BJAA 2FSWA 1VQNI 2X1CA 1E2XA 1IXSB 1WWXA 4IRIA 3M1EA 1G3TA 2DA1A 1U8RA 2JVGA 4PJMA 4RAYA 1APLC 2EIJH 4Q5SF 1TNSA 2YS9A 4L18B 4CYCA 3GTGJ 2FBKA 5CKTA 3HL2A 4XSXF 2HU9A 1L3LA 5TRDA 2DYSH 1MBFA 1RNLA 1A31A 1FOXA 1VQ7I 3LSKA 4GGGA 4CCNA 4BEHA 2KZGA 3JRBA 3CCYA 1MGTA 4IXAA 3QYBA 4KN7X 3ULQB 3FBNB 9ANTA 3TBIA 3G4SI 5LBQA 2H27A 1MNEA 2O5RA 2DA2A 1ETXA 1V4RA 4J00A 2N8GA 3GF2A 3VSLA 4BQOA 3ZQFA 4ENJA 3E0JB 4G7ZF 2ZXHA 4PJJA 5CLSA 3VWBA 2PG4A 4B3XA 3LSPA 1Z0XA 4P5OA 3TO9A 5TISC 2Z5UA 2P0WA 3DPLC 2FBIA 3ABKH 1EH8A 5EGOB 5L3CA 2X6YA 1TQPA 2O7OA 3HJEA 1HF0A 5EG0A 3LNQA 5DCMB 2JA7J 1QO0D 4FE7A 3S2DJ 4IEJA 4PGHA 4IF4A 3ERMA 3GFJA 4B1RA 2VJ5A 1S9HA 2GAUA 3E5QA 3EUAA 3NWTA 4A6DA 4ZTFA 3I59B 2DPUA 2UWMA 1X1AA 2WBMA 3IKVA 2QGUA 4A0YA 1HOMA 2NS7A 2L4MA 2MA3A 3WU0A 4S04A 3S14J 3ZR8X 1TWAJ 5TJJA 3JTHA 1GT0C 1H0MA 3EYYA 2F5VA 4LOCA 1HXDA 3MN2A 3HRMA 4U0WA 4AWXB 2E2JJ 3AG4H 1IAWA 3LSIA 3FHZA 3BCBA 2X1DA 1I6HJ 1LNWA 2MFZA 4M74A 2JN6A 2FNAA 3OV8A 3OYJA 2HQ5A 4OIRF 1J7KA 4RLQA 5HDGA 2IS1A 3K4KA 1ETVA 4XKBA 4B44A 1P7JA 4N9IA 3OOUA 3FKIJ 2LKSA 1PUFB 1T98A 4I02A 3H0GJ 1MJ9A 1V3FA 2MD5A 2KRHA 1KZHA 2HVSA 2LR8A 1SMTA 3K70D 2VPLA 3BT9A 5BQTA 1LVAA 3W6KB 4OWRB 2HS5A 3P7NA 5L3DA 2DPDA 1ZG3A 2FF4A 2P6SA 2HOEA 2BGCA 3W2WA 1W7PA 4CZZA 1KYZA 4ZDOA 5JVGF 3CUQB 1KQ9A 1WQ2A 3M07A 5J1UA 3U21A 3FXRA 3HOZJ 3CF2A 2OCEA 2E7WA 2RN7A 3CP8A 3FXMA 3FWEA 5IP9J 1AU7A 3GFLA 1Z7LA 3GVAA 4CZCA 3HOUJ 2L9SA 1W4MA 4N4OB 5ICFA 1ETKA 1KU9A 1YS6A 5E79C 3ZGKA 4BACA 2HOAA 3HHGA 2VASA 5JR3A 4AVPA 4BE1A 3DEEA 2LF8A 1IXRC 3RJPA 3GBGA 1NHAA 4A0ZA 4M3GA 3M7GA 4HQMA 4ESJA 3QPTA 2K9NA 2CW8A 4KN4X 1TW2A 2YX7A 2R7WA 2W25A 3SZTA 2DBBA 2F6CA 2ZXWH 2E71A 2L9NA 4AYBN 2FBHA 4HX4A 4YFNF 3BG6A 2IA2A 2BBYA 1HW5A 1VQLI 1E3OC 3OIPA 1F5TA 3WG7H 1TQIA 2OC6A 5ICGA 5D5VB 3G73A 3DWLE 1JGGA 5J47A 1DU6A 1QPIA 5E8IA 2FUG2 3J7AY 1WJAA 2R7DA 1MH4A 4QTRA 3RKYA 1CQTA 1GXQA 5E1ZB 2PJPA 2ELJA 3DKXA 4UUTA 3CCEI 3H9JA 1W0UA 4Y13A 2XROA 2K85A 1MSFC 4XICA 2ADUA 2KL4A 2DDAA 1TWCJ 1NG6A 2E7XA 1B72A 3HGYA 2O9LA 2A07F 4OOIA 1BM9A 6PAXA 1LKXA 4U7BA 3OYCA 2ID6A 4U0YA 4LMYA 1UFMA 1P4XA 1H8AC 5CVRA 3IC7A 1UB9A 4XR6A 3AAFA 2VBWA 1ZLKA 2R7QA 3A2KA 4G6DA 3SDGA 2DMTA 4U87A 5HNFA 4Y15A 3D0SA 5J8CA 1RI7A 5ILSA 2DMNA 1XGSA 2XAHA 2VKVA 4IOCF 1FT9A 1X3ZB 4EJVA 3TW6A 1FOYA 1J75A 2JRTA 2STWA 4C3HJ 5CVIA 2BY0A 2DJNA 5HODA 1DPRA 4DBRA 1RESA 1TZLA 4YIRX 1XG1A 2FRHA 1UELB 1PUFA 3AG1H 3LA2A 1ODDA 5CVUA 2AS5F 2LBFA 4BE0A 3I4NJ 3CMMA 1OFCX 1I3AA 1HDDC 1U2WA 4IQ4A 2A6HF 1I50J 2LTPA 1Z9CA 3EDPA 1TW3A 3CCUI 3FHNA 3CCVI 1POGA 5F0CA 3OR1C 1K78B 1R58A 4G6TB 4XOPA 5JHFA 4B8XA 1FBUA 4IRGA 5ERIA 4XBFA 2HZDA 3N05A 1RZ4A 3CLQA 3LSMA 3CCSI 2ZSIB 3SHFA 2VJ4A 2IGKA 2DCEA 4UB8C 2WAQA 3ASNH 2V1UA 3TGNA 1YRNB 3WU1B 1WRJA 3Q0UA 2HYJA 3K70C 4C2TA 2XUBA 5HLIA 4GO1A 4IHXA 4XKWA 5HS9A 5M5WJ 2LY1A 2Y31A 2NRAC 4BU2A 3GFIA 3K2AA 2P5LC 3RQIA 3SFZA 4K2EA 2NNNA 3DEWA 4ZYAA 4E4HA 3GLLA 1MMSA 2A68F 3LQQA 4LK0F 1K79A 1LDDA 3REOA 2V6CA 4HYEA 4B09A 4DZJA 4KIGA 1DGRM 1F43A 3ERED 3I3LA 5CYVA 1O3RA 2X51A 5J1RA 3QYEA 2R7TA 2UZKA 5J8FA 1UHWA 4A5NA 3CLOA 3GTLJ 2PQ8A 2UXXA 3F22A 1SVMA 1T0FA 3ZMDA 4P9UA 2TDXA 1VI0A 2KIFA 1B8IB 2F48A 3ABUA 1BR2A 2LP0A 4IJAA 2P7VB 2FMLA 3V7SA 3S93A 1HSJA 5HS7A 1F1ZA 1WJEA 4NC6A 1R1TA 2PN6A 5LFAA 1ERDA 2KRFA 1FMVA 3B6CA 5TGTA 5F6FA 2Q1ZB 2O61A 4EV0A 2X85A 1TL8A 2OCCH 3CUQC 2KISA 4MTDA 2VKDA 1BI0A 1VTNC 1AHDP 2R7UA 3TDZC 2XF6A 3J81K 1XD7A 4BXUA 4EGZA 3R0AA 1JTYA 4FHTA 5D8KB 4ZH4F 3DQVC 2HQRA 3LA7A 1VQKI 5HLHA 4A3LJ 4AIHA 2BXYA 1BOBA 4UV9A 3HHHA 2XIGA 3CD6I 2NXNB 1FEXA 1FSHA 3CMEI 4WX9A 1FX7A 4BDYA 2HFHA 2VE8A 4RBOA 2M0MA 1JUPA 5LGUA 2DMPA 2KPMA 2PJRB 4EQQA 3NQOA 3L9FA 3KP2A 1HBXG 1XMKA 3HC7A 5F0HA 2VI6A 1JUMA 3SEQA 2KP6A 2F4IA 3M8EA 2EV5A 1D1AA 3PUBA 3LSRA 5HNHA 5FKMA 3H3ZA 2R5YB 1Z3XA 3S1RJ 2DT5A 2IXSA 2XKPA 4UV8A 3OS0A 3TEDA 3KEOA 2BYVE 4B4CA 4W1UA 4XL9A 5FFZA 1OCTC 4F91B 2VKEA 2CO5A 4WXCA 4D9JA 2XDVA 4UUSA 3MKLA 2VN2A 1FC3A 3KLNA 2KIMA 1H9GA 4MIMA 2M0CA 2VXZA 1REPC 3OS2A 2H6BA 2CYYA 4C9YA 1X3WB 2O3FA 2MSYA 2QWWA 2ESNA 4JQFA 1RR7A 2GA2A 2WAEA 4P96A 2NVUB 4BHBA 5HS8A 3J80K 5IOYA 4E7LA 2IS6A 2B63J 2R4GA 1LDKB 4HNVA 3HRSA 1V5EA 2BOLA 2KHMA 3K69A 3RI4A 2Z2SB 3N97A 1ZGJA 3QP6A 3S16J 2VUMJ 2FX0A 2K02A 4XN3A 4M73A 4I09A 3J7YJ 5ICEA 4FETA 5FKLA 2LD5A 1XSXA 2NOJB 2GQQA 3LAPA 3WTUC 4U7DA 4C3JJ 1MJAA 2R92J 2OZ6A 3I56I 1UMQA 3MZHA 5JVTA 3M8JA 4HLXA 4RMNA 3R6SA 4H0EA 3QPLA 4MNUA 1EV7A 3BTIA 1ETYA 2LSOA 3OYGA 1I1GA 3AFHA 1K61A 4RS8A 3RDIA 1USSA 2AQEA 3L1PA 5DYMA 3L09A 1D8JA 1Z7UA 2W57A 1YQAA 4C2UA 2RNGA 3PJRA 2Y9ZA 5D5UB 2XGEA 2P81A 3Q9VA 3GTKJ 1HDPA 5B5EC 2JUCA 1XS9A 2PLYA 4J19A 3RCOA 4E7IA 3FXOA 1USTA 3DKYA 4I76A 4XORA 5HDKA 3IP4B 3ZQGA 2DFHA 2GOXB 2ZO4A 2EFPA 5M5XJ 5J40A 4AM3A 2G7UA 2FQ4A 4E70A 2H94A 1E0EA 1HKQA 2QQBA 4M3DA 3C18A 2EFQA 1EA3A 2DTZA 3KX2A 3AKZA 2XB0X 3W2VA 3PO3J 3FK7A 4HNTA 2JSCA 4MQ9F 4WWCA 2FA5A 2CMPA 2BY3A 1SFOJ 3ZN0A 5C4JJ 4G12A 1QGPA 3F8FA 3BG5A 2RREA 3DXJF 5KAIC 5HLTA 4LLLA 2TCTA 3JREA 2VLAA 4UB6C 5F1JA 2QA4I 4IHVA 1B9NA 2F2EA 1NK3P 2LRDA 1ZYRF 1ETQA 1OKRA 4H4KC 4CA0A 1T39A 5LHIA 1WFXA 3G1LA 1FJLA 1F4KA 4UY8I 1SANA 3LL7A 1V5GA 2X4HA 3DLAA 4J01A 2VBZA 2DA4A 3OS1A 3F8CA 4CUGA 3SJMA 3WE2A 5AIPA 2K3PA 4LJZF 4PCQA 4KNYA 2LKPA 3ZQQA 3VYSB 3ZQCA 1KONA 2PMHA 1B4AA 2F5CA 5L3EA 1MH3A 4LIUA 4EATA 4II2A 3I5UA 3KYDB 1S3JA 5LRSA 3K4LA 2HTSA 3KZIC 2X48A 2GXBA 3QWLA 4ZJZA 3BCAA 3HRUA 3VYTB 4DYRA 4ZZDA 4GFBA 1D5YA 2MYSA 3GXOA 1YG2A 4KICA 3CUOA 2AXTC 2VE9A 1Y0NA 2GBYA 4ZC3A 1HW2A 1VQOI 3KETA 4A3DJ 2K40A 1E3HA 1EF4A 4JYKA 4PUSA 3IHUA 1ZRCA 3TMOA 3ECOA 2MC4A 4A3BJ 1MMNA 1XSVA 2DK5A 3B02A 1QA6A 4Y52J 2VQHA 5FGMA 2B9SA 5E8GA 1PUEE 2Z3YA 1XDUA 1HC8A 2M34A 1BC8C 5IPAA 4ASNA 4XLAA 4II3A 3GTJJ 4JX4A 2DFEA 3R61A 1LPQA 3GFMA 3FF5A 3LQRA 2IT0A 4KIBA 1EH6A 1FOWA 4KFCA 5H6QA 2EQRA 1DQUA 2QENA 1I5ZA 2YU9J 3WODF 4KIFA 4BAYA 2OF7A 4FX4A 2M7BA 4RA2A 1Y8QB 5CJ9A 2OA4A 3U1DA 4HNUA 1LFPA 3OOPA 4S0HB 1HSTA 3HEFA 1B6AA 1K7AA 1BIBA 1J09A 3Q0VA 3BR6A 1D0XA 4Y33A 3VSKA 4KMUX 4OMZA 4QLCU 4HV6A 1Y1VJ 2K5CA 3HSEA 5J6XA 3A01B 2IS2A 1WI3A 2CRGA 4I6ZA 1IRXA 3CJTB 3IWZA 4M72A 2DQLA 3HOVJ 1X4OA 2WB1N 5K7HA 3HOSA 3EUHC 5BPDA 1DP7P 3K9TA 1EKEA 1U5TB 3QYFA 3BG7A 3QPSA 1MD0A 5LD2C 1K4TA 5DDGA 2JWTA 3RKWA 1MSEC 4ABZA 2XVCA 3RSNA 3MZ8A 1VQ8I 3PNYA 2F5EA 1H9TA 1G2HA 4JX5A 3GLXA 3TKYA 1E3PA 2OPTA 3HUGB 4L5EA 2QBYB 1MMDA 1YJNI 3QOEA 2CQNA 2CGPA 1IF1A 1XCBA 3RTRA 4IPAA 3FM3A 3A02A 4Z6YA 5JFRA 3JTGA 1D5VA 3CQZJ 3QP5A 4BY1J 1PP7U 1FP2A 1SD6A 4A69C 3L2RA 4R1HA 5K7FA 3MKWB 4BHCA 5AIQA 4ZYEA 2X6OA 2CQKA 4Z2YA 4WXDA 2L7ZA 3J81Z 4E7ZA 1GV5A 3OSGA 3M9AA 1GUUA 2WTEA 1J9IA 2I10A 3CCMI 1ZK8A 2LLKA 2Q8KA 5EYRA 2DDBA 1WH5A 4UHTA 1YW7A 4A93J 5E1XA 2D2WA 3K1NA 4ZYDA 2DQRA 1S7AA 1NH3A 4A3IJ 5IYDJ 5FB2A 1K6YA 3Q3SA 3CP2A 2JK3A 2IP2A 1X1BA 2COMA 3U1KA 2Y0SA 3UNGC 3K7AJ 3HOYJ 1RIOH 2NOGA 4NUBA 4RB1A 3BR0A 3EETA 3CC7I 2EFWA 2DOAA 2GWRA 3HXLA 1B9MA 3TW7A 2CUFA 1Q1HA 3N4MA 3FK6A 2M45A 3F3XA 1IDYA 2GIVA 2QCOA 1R23A 4TV7A 2HWVA 2R3SA 4G7HF 3BJAA 1FP1D 3A03A 4XNFA 2WV1A 1A6IA 2JSPA 4A3EJ 3E5XA 3KCCA 4G6QA 3KPHA 5E3NA 3IV5A 1NK2P 1VQ6I 1AKHB 5IT3A 4PSWA 1BI2A 2K4JA 1QVUA 3DP7A 4PK4A 3IRRA 4MLOA 5LRRA 2R5ZB 1JKRC 3MZYA 3BOQA 5ILUA 3P9IA 1WGXA 3J80Z 1WHUA 1JJ8C 2QEXI 3V4GA 2Y0MA 3T0YA 5FROA 2O8XA 3MQ0A 4LK1F 2M9HA 1FIPA 1KU2A 1T33A 2A61A 4NQWA 4XLEA 3CC2I 1IDZA 2JA2A 2HGCA 2VC0A 1ZKGA 3KP6A 4RM2A 5DM6F 1X4PA 2Y9YA 2AO9A 4QPQA 3V8KA 2E5NA 3PFYA 3GMEA 2HEOA 1NTCA 4ZYGA 1JT0A 4AU7A 4IZZA 4W97A 4IHYA 2UXNA 5A2QK 3KP4A 1MIJA 5LEJA 5HOOA 2P5VA 3GZ6A 2ZKZA 1BJZA 4F3QA 3ONQA 2YSRA 1YITI 3QQAA 4D0PA 1RUOA 3SZGA 3S2HJ 4YRVA 1QVTA 4IQJA 1QZEA 1MDMB 1IRZA 2HPIA 1BBYA 4ENMA 5FKNA 3BP8A 4CH7A 1D0ZA 2VJIA 3MD2A 3RPUD 4BQNA 2DA3A 2OU2A 1S7OA 4LG3A 4A3KJ 1YYVA 3MCZA 2FJ1A 3SDBA 1BW5A 3IH4A 4Q48A 1D8KA 4Y17A 2G9WA 2HVQA 1RC9A 3G3ZA 3DU5A 1OISA 3OSFA 2CJJA 4ANJA 1U3EM 4KUMA 1ZQ3P 4ITVA 1R36A 2O0YA 2LF7A 3TO6A 1YS7A 4EJUA 5L3BA 1ENHA 2ZB9A 4CCKA 2XGXA 2IPQX 3M3YJ 3QU6A 2HDCA 1FTZA 4EM1A 1YLFA 1D1CA 1FNNA 4FTHA 1VQ9I 4R8HA 1K83J 2CUEA 3ABMH 5DUIA 1QPMA 1B1BA 3S15J 2R7RA 2H6CA 1T6SA 3ASOH 3LSJA 4BE2A 1A36A 4HG2A 2VOOA 1VZ0A 3A1YA 1FLIA 4BNCA 2VB6A 3SFIA 1SFUA 2D1VA 4D5FA 2K7LA 5EGOA 2Q2EB 4HSTA 5FKKA 3QRFF 1U5TC 1CGPA 5ED4A 5GP9A 4NBQA 3L2QA 3TL4X 1VQPI 3IH3A 1JKPC 5DCMA 4EM2A 5E1WA 5D4RA 2LYCA 2NS0A 2ISYA 3DEUA 1U9NA 4QSHA 5GTHC 2A6TA 2QQ9A 4PJLA 1KA8A 2X6XA 4RGUA 1R5GA 2E36A 3I59A 2VIXA 2COBA 5CQEA 3GZ5A 2HOTA 2ZSHB 3BG3A 2JTVA 4A3CJ 1GLNA 3EPZA 3CJNA 4XLFA 2W1OA 4CHUA 4UVAA 3NEUA 5KAFC 1P4WA 2M5WA 4HDVA 5JLWA 2MLGA 4UXNA 3OYHA 1N25A 2Q0OA 2QSFX 2R5ZA 4FX0A 2Z9OA 3RPUA 3PO2J 2ME6A 3TO7A 5BNGA 3ZOBA 3DFGA 2CH0A 3EYIA 2XGDA 1IRGA 4AC0A 4LG0B 2JA8J 5FLXK 4CCLA 1JHHA 3TDUC 5KK1A 1IC8A 4ETSA 3FKJA 2W84A 4FT8A 5KCMA 1JI8A 4WK8F 5JI6A 4A3GJ 1OCPA 3ZMVA 1OYWA 2I8DA 4ZDLA 2RNJA 3H9GA 2FQ3A 4G7OF 3B6AA 4L9TA 3HIFA 5GAEJ 1ZELA 4CXFA 2CG4A 2PFBA 2DOFA 2D1HA 3OYNA 2L01A 4GXOA 2LOOA 3VFZA 2VBYA 4WCGA 2LVSA 2R7SA 2R7ZJ 2OQGA 3CUQA 1QNTA 2NAZA 2DA7A 2IBDA 4UVCA 3DKWA 2LKXA 3LSTA 3JRIA 3JRCA 1P6RA 1EH7A 1PJRA 1O4XA 5BS6A 2VOPA 4BKXA 4M9ZA 4XQFA 4F52A 2DMQA 3OYEA 1OCCH 1J5YA 3B73A 2JA5J 1BI3A 1SD7A 5JHUA 2OAZA 2ELKA 3JSPA 2CUJA 2AHQA 4KT6A 2GM4A 1H88C 4CYDA 5K7ZA 4CICA 3D5SC 1OCZH 1WCMJ 2VT3A 5IT9K 1L0OC 2BXZA 4XONA 1YO5C 2ZNYA 2HXIA 2XSDC 2DFFA 2R7XA 3K1MA 1MZBA 1W5TA 2GA1A 3CJQB 3IWFA 1Y0UA 4IHWA 2Z99A 2WAFA 3F8MA 2PMZA 3F8NA 1GXPA 1KYWA 4OIQF 4IL6C 5K5QA 4MGRA 2I5UA 3SZPA 5FO5A 4A3JJ 1SFEA 3WTZA 2IVMA 2J5PA 3JSOA 2BE5F 2V1NA 1FTTA 2DYRH 3BDDA 3MWMA 2IGNA 4JBAA 4CCOA 1Z77A 4EJWA 2CU7A 1XC5A 4UUVA 2FMYA 4GCVA 1NG7A 3OL3A 4RGXA 4EMSA 4R79A 3PNTA 5FD6A 2XC7A 2IAIA 3EQLF 5ILVA 3H3UA 3O8GA 3HKZN 3KP7A 2OTJI 4MQVA 2E35A 4ZDPA 1LVKA 2BVMA 4HEA2 3G2BA 3E6CC 2FOKA 2GZWA 4M3BA 4UNOA 1WZ2A 5FKOA 5B3SH 1AWCA 1MNDA 1XMAA 3J7AO 3BR1A 2W85A 5B1BH 1X2NA 2FOWA 2ZMEB 4PJ0C 4DYQA 1LUJB 1ORKA 2Y30A 1IN5A 1Z3YA 5L3FA 1V55H 2E34A 3O6BB 2JZYA 2ISZA 5H20A 3CTAA 3OYFA 5IYCJ 2IGMA 4QPOA 3J7ZI 4I99C 3V8LA 1BC7C 1ITYA 3JRAA 2HYGD 4FISA 4IX7A 2CFOA 3RYPA 3TP3A 4O6JA 1OJLA 4BH9A 1ZTRA 2XV4S 1C0WA 3S32A 2JA6J 1UG2A 1D1BA 2KFDA 2L54A 2JRMA 5CVJA 2LG4A 2EIMH 2FE3A 2RGVA 2EZLA 5GAGJ 1UZCA 1P2FA 4JOMA 2DLLA 1K78A 3M4OJ 3IKTA 3ECHA 3X2QH 1ZN2A 3DTKA 1W1WE 2ICWG 3S3OA 4X6AJ 2MBFA 2HTJA 3FDYA 3I54A 2ZCWA 4CCJA 2HNHA 3FZVA 2E5ZA 4MTEA 4LB5A 1YRNA 2MG4A 2WY8Q 4P55A 5FLVA 3HGGA 3GTQJ 4I7HA 1JKOC 2X6WA 1YIOA 1O3TA 5B1AH 1KQ0A 2EV0A 1Q1VA 1R5ID 1SD4A 2ACJA 1BOAA 1LFBA 5A2QZ 2VQLA 3OL4A 3T5XA 5KHDA 1X3UA 2W00A 1BR1A 1VQ5I 1G6NA 2K3FA 4HW0A 1N75A 3H3VK 4KYWA 3VPRA 2DT7B 4XLNF 2P5KA 4QWQA 2M8GX 1HQCA 1EJ9A 3Q9SA 4I0BA 4XRSG 4G8XA 2H8WA 3L7WA 3LWFA 1VFCA 4M3FA 2BY1A 1P7IA 4LGWA 1B8IA 2A5YB 3CCLI 2TRTA 3PNVA 4X1EA 5BPIA 1LB2A 1BA5A 4D5CA 2LH9A 4U88A 2DO7A 4BJ6C 4PJNA 1VF9A 4RB3C 2H09A 4HF1A 1QHGA 3K4JA 2DA6A 1HW1A 4QIWN 3MKYB 2LFBA 4BXFA 4IOAF 3FXUA 1MBJA 2BY2A 2HZTA 3PIOF 3ZRGA 4YG2F 2L3DA 3NAUA 4RM3A 2O03A 1YX5A 3GTOJ 3KIOA 5JLXA 2M8EA 3FISA 2HI3A 3MVPA 3O2PE 3WTSC 1A5JA 4JX6A 2IA0A 2QVOA 2L9RA 5K1YA 3F8BA 4OAZA 2KZVA 4NNJA 4Y7NJ 4DOZA 1WI9A 3WGHA 4OINF 3V8JA 1YJ9I 2MH2A 1WJBA 3OIOA 2PJRA 3FMRA 3ZQ7A 2OZUA 1CF7B 1QU3A 1FYLA 2CQXA 4BDZA 5DCFA 2QSGX 2RC4A 4KJZA 1O3SA 3OYIA 1GVJA 3H35A 3KYLA 1YW9A 1YX3A 3GCMA 3CO7C 2ID3A 1RR8C 1TC3C 1TQMA 3E6MA 2R5YA 1X1DA 1SD5A 5AONA 1GDTA 2V4JC 3A4CA 1MBGA 1AA7A 2XB5A 2XPUA 3R60A 5J4YA 4HZFA 4AYBA 3GW2A 5HVQC 1XTAA 3WU2C 5GPAA 1FWZA 3OY9A 2L5QA 4CYCB 1Z6TA 2H8RA 3KZYA 5D5WB 3OYAA 3TQNA 3HSRA 4S05A 4C2MJ 1OLTA 3E6BA 3ELKA 2WY7Q 1MBHA 4BEHB 2Y2ZA 1ZLJA 2D5VA 4XM3A 2L02A 2VT2A 2QYOA 1ZAOA 3IL2A 4HQEA 2CW0F 5J3LA 1TT0A 4LB6B 4L0ZB 1MBEA 4JP0A 2F5FA 2LY2A 3EUHA 4DIQA 2RDPA 2R93J 2OBPA 1Y6IA 3S1MJ 3BTCA 1YFHA 3KZZA 3KP5A 2DXIA 2IS4A 4KITB 4D7NA 5K5OA 2MC3A 1SVLA 1S5LC 2CSOA 2XPWA 4YFXF 4NHJA 1SFKA 3M8FA 3A0HC 1OMIA 2EJRA 2ZXJA 1XGOA 2JVHA 4B48A 1TTYA 4BGDA 4E7HA 2WAQN 1HKTA 3COAC 3S3NA 1JTXA 3BQYA 3HG9A 5CVVA 5FLXZ 2PI0A 3F72A 3HSFA 3C1DA 4EGYA 4L0YB 2YU3A 3PSIA 2ZMEC 2VODA 3L2CA 4IVNA 5EZGA 5KNLA 3CMAI 2STTA 4HPQA 3OWTA 2DODA 3H9QA 1F36A 4E7SA 1WJCA 2GOMA 1N78A 3T1BA 4P1WA 4A2UA 2X9DA 2YUSA 2EZKA 3JCUC 5EJCA 3K4MA 4DYCA 3I71A 1ETWA 4V2FA 5LEKA 4N9HA 4PZJA 5D8LB 2GXGA 4EEFG 1OYYA 2VQCA 1O7LA 4A5MA 2E1OA 2E2HJ 1IZ1A 4LLGF 2BHZA 1YI2I 3D5RC 3VYUB 4A6EA 3WTVC 3O3KA 2QM3A 1PVEA 2XPVA 4ENNA 1FPQA 4I2OA 1WPKA 2RQQA 4NB5A 4PDKA 3S2WA 1X2MA 1SEUA 3VOEA 2FU4A 5IT9Z 3JRHA 1WJDA 3CESA 3BLYA 3D1NI 2CFXA 2EV6A 5L3GA 3OYBA 1ACIA 1E17A 4OIOF 3FXQA 3JRDA 4XOTA 2M4KA 2OQRA 4O3MA 3QOPA 2M7AA 1TLHB 1XB4A 2IGOA 3WHCA 1RRJA 2VKHA 1MBKA 1W7PB 1MNMC 3HB9A 4XLPF 3JR9A 5BMZA 3OYLA 2L7FP 2CQ7A 4XRMA 4N0BA 1A6QA 2V7FA 3H5RA 3OIQA 3VEPA 2KQRA 4XMYA 3I53A 3ZP5A 3DTEA 4WF2A 3DF8A 4LFUA 4HF2A 2PMUA 2VJJA 1JXSA 3ABTA 3F6VA 3PM1A 4RB2C 2NVTJ 2EH3A 4MEYF 3C2BA 4L5IA 2Y69H 2XHKA 4RAFA 2HDDA 4L9VA 4F92B 4LITA 2L0KA 1R4MB 3BG9A 1Z21A 2EK5A 1XCVA 2D45A 1BN5A 1XX5A 1U78A 1J2XA 1LEBA 4GDFA 4Q4ZF 2ECCA 3KEYA 3CCRI 4B3AA 4AIDA 1W7PD 3ZXSA 3WTTC 1VQ4I 3DPTA 2OV7A 1IGNA 3KFWX 3HM5A 3HOWJ 1OYIA 3CCJI 2XSJC 2JQ7A 4E7JA 1OR7C 4FQGA 5DD8A 1O3QA 2K27A 2P4WA 4GRIA 2V26A 3FXLA
chains in the Genus database with same CATH topology
2X6XA 3SEQA 2KP6A 2F4IA 4N4NB 1D1AA 2VIXA 3PUBA 3MKZA 5CQEA 4F55A 5HNHA 2ZSHB 4B43A 2QKMB 3F9KA 3LSHA 1GLNA 2CW7A 4Y4RA 3EPZA 4XLFA 1Z3XA 2W1OA 2IXSA 3K4BA 3OS0A 3HKZA 1G8XA 4XL9A 1R6RA 4F91B 3OYHA 2HQAA 3PSFA 2KLOA 4D9JA 2XDVA 3W2AA 2ZFUA 4XKVA 2CH0A 2VXZA 3OS2A 4XLHA 4CSWA 4CCLA 4C9YA 3FKJA 4JQFA 2WAEA 4E7LA 2IS6A 3S8PA 4XLCA 4RLFA 5KCMA 1JI8A 2R4GA 1LDKB 4HRIA 1V5EA 2BOLA 2I8DA 4NC7A 3H9GA 4ZDLA 2KHMA 2AQFA 2Z2SB 3SEZA 1ZELA 3K6GA 3OYNA 4C30A 4XN3A 2LOOA 2R7SA 2R7VA 4FETA 1X19A 2OUMA 3L2WA 2X1EA 1DP3A 3DPUA 3HPHA 2NOJB 5CQGA 2LC2A 3H5NA 1PYVA 2E60A 2LBFB 1PJRA 4DJAA 3IAM2 4XKCA 2W4SA 4XQFA 2WA0A 3SYTA 4F52A 1X1CA 3I9V2 3OYEA 4XN0A 1W36D 1U0JA 4NQWB 3M8JA 4RMNA 1YE9A 3D5LA 3E1SA 2ZXIA 2CUJA 3CZ6A 4KT6A 2HDWA 3OYGA 3AFHA 3AL0B 2AQEA 3D5SC 4F93B 4BJTA 2UUZA 4XONA 1WJ5A 4C2UA 2RNGA 3PJRA 4CCMA 2V6EA 1G59A 2R7XA 1FMWA 2L7KA 2A5WA 2Z16A 2M3AA 4BQQA 3RCOA 4E7IA 4YELA 3CJQB 3DKYA 4XORA 2WAFA 3OYKA 2PMZA 3IP4B 1D0YA 2BW3B 2E1MB 2GOXB 2VQGA 3NWSA 2XF5A 1E0EA 3K4CA 5CPRB 1EA3A 2V1NA 3KX2A 2CV0A 3AKZA 3W2VA 4CCOA 2IGNA 2X1CA 4HNTA 3K4NA 2CMPA 1NG7A 2JVGA 3OL3A 4PJMA 4R79A 3PNTA 2HPMA 2XC7A 4ZTJA 2RREA 5HLTA 2VLAA 5CKTA 3HL2A 2HU9A 4ZDPA 1MMAA 2LRDA 1LVKA 2BVMA 4H4KC 4HEA2 4CA0A 4IKFA 3G2BA 3LSKA 1WFXA 4BEHA 4CCNA 3LFUA 1WJFA 3QYBA 3FBNB 3TBIA 1MNDA 1MNEA 1MMGA 1V5GA 2O5RA 3LL7A 4J00A 2K9LA 3VSLA 3DLAA 4J01A 4BQOA 3OS1A 3E0JB 4CUGA 2ZXHA 4PJJA 3VWBA 2K3PA 4B3XA 4P5OA 3ZQQA 3VYSB 3DTIA 1Z3YA 4DBQA 1KONA 2P0WA 3DPLC 2HVRA 3EUKL 3OYFA 4LIUA 2IGMA 4EATA 4QPOA 4II2A 3UR3C 2CV1A 2X6YA 2VXDA 3K4LA 5FRMA 4IX7A 2CFOA 1N77A 4ZJZA 3BCAA 3VYTB 4PFPA 3S32A 2VJ5A 1D1BA 1S9HA 2MYSA 4ZTFA 3EUAA 3NWTA 2UWMA 1X1AA 2WBMA 2LG4A 4X0GA 3H5AA 4JOMA 2V9KA 4B47A 4ZC3A 3DTKA 3ZR8X 3S3OA 2F5VA 4PUSA 3TMOA 3FDYA 1MW7A 2MC4A 1MMNA 4CCJA 3LSIA 2HNHA 2VQHA 2E5ZA 2X1DA 2MFZA 3BCBA 3OYJA 2WY8Q 4RLQA 2Z1DA 2IS1A 3K4KA 2X6WA 2W7NA 4XKBA 4XLAA 4II3A 4B44A 3OOUA 4OAYA 1DQUA 2KRCA 2HVSA 2KRHA 2VQLA 3K70D 2VPLA 3OL4A 2M7BA 4HNUA 5KHDA 1LFPA 4OWRB 2W00A 1BR1A 1N75A 1J09A 3BC8A 1D0XA 4Y33A 3IAS2 3VSKA 2DT7B 3W2WA 1W36C 4ZDOA 2K5CA 3U21A 2IS2A 1IRXA 4LIVA 3OYDA 3CF2A 1X4OA 3CP8A 3HOSA 2BW3A 3EUHC 1Z7LA 4CZCA 3H0DA 2L9SA 1Y56A 3LSGA 4N4OB 3ZGKA 3PNVA 4BACA 3QYFA 4D1QA 3BG7A 5LD2C 2VASA 2LH9A 4BJ6C 4BE1A 3DEEA 4PJNA 3GBGA 2DT6A 1QHGA 3C2HA 3K4JA 3RSNA 3PNYA 3S3MA 2CW8A 3MKYB 3HUGB 4BXFA 1T95A 1MMDA 2R7WA 3QOEA 2F6CA 3ZRGA 2L9NA 1UG0A 4RM3A 3RTRA 1YX5A 3BG6A 3CJRB 4PSXA 2KMUA 2WB1A 3OIPA 4BUPA 3L2RA 2VL8A 3MKWB 2OC6A 4OAZA 2KZVA 3DWLE 4NNJA 4DOZA 3AL0C 3K10A 2R7OA 1WJBA 2PJRA 1QU3A 3J7AY 2FUG2 1SAUA 4E7KA 4BDZA 1WJAA 4E7ZA 4BL0B 4KJZA 2ELJA 3H35A 3DKXA 3OYIA 1YX3A 3KYLA 2DJIA 3H9JA 4PFOA 3VDXA 1X1DA 2KL4A 1NG6A 2V4JC 3A4CA 1AA7A 1K6YA 4AYBA 3HOTA 3HPGA 3CP2A 5HVQC 1LKXA 2E1MC 4Y3OA 4U7BA 3OYCA 1X1BA 3OY9A 2L5QA 2Y0SA 1P9QC 3UNGC 4KISA 3OYAA 4NUBA 4XR6A 1OLTA 2WY7Q 4BEHB 2R7QA 2DOAA 4XM3A 5FRNA 3A2KA 2UV1A 3HXLA 3MMYB 4U87A 1TT0A 5HNFA 2LY2A 4DIQA 1Y6IA 1T0FC 2DXIA 4XNFA 2IS4A 4KITB 2JSPA 1SFKA 3C2GA 2JVHA 4B48A 4BGDA 4E7HA 2CS3A 4PSWA 3S3NA 2CV2A 1UAAA 3HG9A 3M1CA 4PK4A 4DBRA 4MLOA 1TZLA 2W82A 1UELB 3PSIA 2LBFA 4BE0A 3RQ4A 3V42A 3CMMA 5KNLA 4IQ4A 4HPQA 5FROA 3OWTA 3H9QA 4BS9A 4XLEA 3FHNA 4E7SA 1WJCA 2JA2A 2GOMA 1N78A 4RM2A 1X4PA 3OR1C 3PL8A 4P1WA 4QPQA 1V5FA 2E5NA 4G6TB 3PFYA 3LMMA 4XOPA 3DU6A 5JHFA 3K4MA 4AU7A 4IZZA 2MD0A 2HZDA 3N05A 3LSMA 5HOOA 2ZSIB 1QHHD 2VJ4A 2IGKA 2DCEA 2JUGA 2WAQA 4F3QA 3ONQA 2VQCA 3SZGA 3K70C 4YRVA 4C2TA 4IQJA 3D5RC 3VYUB 2HPIA 3W3CA 4XKWA 1BR4A 3ZCOA 2M4GA 1D0ZA 2VJIA 3MD2A 3RPUD 2LY1A 4BQNA 4CH7A 4BU2A 2RQQA 3VYRB 2WADA 4LG3A 3SDBA 4ZYAA 4E4HA 1WJDA 2LREA 2HVQA 3CESA 3DU5A 1HA8A 3BLYA 4ANJA 3OYBA 2L2OA 3OMYA 4ITVA 1DGRM 2M4KA 4XOTA 2BVLA 3I3LA 2M7AA 2IGOA 3IUOA 2X51A 4HSRA 2VKHA 3QYEA 3OR2C 2KDOA 2R7TA 3OYLA 4CCKA 4AVZA 4DGWB 2V7FA 3H5RA 3OIQA 2KQRA 4FASD 4XMYA 1D1CA 3L2UA 4BJ5C 3DTEA 1BR2A 2CUZA 3S93A 2K9MA 1WJEA 2VJJA 4NC8A 5LFAA 2R7RA 1ERDA 1FMVA 5TGTA 2Q1ZB 3QODA 2X85A 4E6KG 3OYMA 4BE2A 2VKDA 4YEJA 4F92B 4HG2A 4LITA 1VZ0A 3A1YA 2R7UA 1Z21A 2XF6A 2VB6A 2QKLB 3FBIB 3DQVC 2Q2EB 4HSTA 3KEYA 2XF7A 3ZXSA 2MABA 1BOBA 3L2QA 3DPTA 3TL4X 2OV7A 1DGWY 4BDYA 2LYCA 2XAUA 2XSJC 2M0MA 4E7JA 1OR7C 2KPMA 2PJRB 3L2VA 2A6TA 4GRIA 2V26A 4PJLA 3HC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRC A;  2M4K A;  4NC8 A;  4NC7 A; 
#chains in the Genus database with same CATH topology
 5E3M A;  4N4N B;  5DD4 A;  5F04 A;  4CGZ A;  1GHC A;  3MKZ A;  2IJL A;  1LQ1 A;  4HAM A;  1WVR A;  4MHG A;  4B43 A;  2QKM B;  3GUD A;  3F9K A;  3LAJ A;  3GX4 X;  2CW7 A;  4OIP F;  1B72 B;  3K4B A;  2JPB A;  3HKZ A;  1R9T J;  1G8X A;  1R6R A;  2G0E A;  2CWE A;  3H1C A;  3LOC A;  5FD5 A;  2HQA A;  2KLO A;  2XRL A;  1IO2 A;  1XN7 A;  2XGC A;  2ZFU A;  1FIA A;  3BPX A;  2HQN A;  2XAG A;  5DM7 F;  2EIK H;  4XLH A;  2RV8 A;  4ZZL A;  1OCO H;  5EDN A;  2XAF A;  3E7L A;  2BZT A;  3AG3 H;  2RQP A;  1KU7 A;  4MFD A;  3S8P A;  3ML6 A;  4RGR A;  4RLF A;  1W0T A;  3ZPL A;  4A0X A;  4HRI A;  3L00 A;  2DN0 A;  3BJO A;  2NNY A;  4OMY A;  5DTD A;  3RZO J;  2A6E F;  2AQF A;  3SEZ A;  3WE3 A;  1A04 A;  1IUF A;  1S8N A;  2ZJ2 A;  3K6G A;  2ELH A;  4I0A A;  4C30 A;  2H1K A;  4BXX J;  1WKM A;  2HOS A;  1X19 A;  2OUM A;  3L2W A;  2X1E A;  3E3V A;  4F7Z A;  5GPC A;  3DPU A;  3JAM K;  3A01 A;  1XSD A;  3E97 A;  3V7C A;  4HBL A;  1QZY A;  3TOB A;  1ETO A;  1FBS A;  1JT6 A;  1IN7 A;  1PYV A;  2LBF B;  2NYX A;  4DJA A;  3IAM 2;  4XKC A;  2W4S A;  1Y1W J;  2KDZ A;  3MEX A;  3SYT A;  1U5T A;  2IEK A;  2YX4 A;  4XN0 A;  1IN8 A;  1W36 D;  5DEQ A;  1I39 A;  1U0J A;  5DV5 A;  2GXA A;  2LMD A;  3D5L A;  3E1S A;  3TOA A;  1ZH5 A;  2FNP A;  3CZ6 A;  2HDW A;  2K9Q A;  4DZP A;  3AL0 B;  3HUG A;  1S7E A;  4F93 B;  2QBY A;  2UUZ A;  3BTL A;  4XK4 A;  1TWH J;  1I27 A;  1R1V A;  1XGN A;  3FX3 A;  3R4K A;  1KQ8 A;  3PUF A;  3WHB A;  1WSU A;  2M3A A;  1UHM A;  2XKO A;  4BQQ A;  2DK8 A;  5IP7 J;  4YEL A;  1ULY A;  2FEZ A;  4L5J A;  3WTY C;  3OYK A;  1RKW A;  4BBS J;  2K9S A;  1LFU P;  4DQ2 A;  2BW3 B;  3FXK A;  4LD5 A;  2E1M B;  2VQG A;  3GZN B;  3FXJ A;  2WWY A;  2CQQ A;  4M9X A;  3ZQI A;  4AUX A;  2XAJ A;  2FXA A;  4HLY A;  1ZG1 A;  4BHP A;  4EJO A;  3JRF A;  3MFK A;  1B59 A;  2L4A A;  2ZJQ F;  2G7H A;  2EB7 A;  3K4N A;  2DAO A;  2Y75 A;  5IYB J;  3ZMU A;  3DCF A;  3H36 A;  2HPM A;  4ON0 A;  1R4N B;  4ZTJ A;  3ABL H;  2LK2 A;  1TBX A;  1XPX A;  5M5Y J;  3RKQ A;  3WGI A;  1QRY A;  3PFI A;  1KU3 A;  1MMA A;  2EWN A;  2J5O A;  1FBQ A;  3IRQ A;  4IKF A;  3RKX A;  2F4M B;  5D6E A;  3BRO A;  3E6D A;  3HRT A;  3KLO A;  1UJ8 A;  3AG2 H;  3VB2 A;  3LFU A;  1WJF A;  1P4A A;  5EEG A;  2GIZ A;  1MMG A;  1ZGA A;  3CO6 C;  2K9L A;  1OPC A;  1IV6 A;  1DDN A;  4RAZ A;  1DPU A;  1ZRE A;  1YIJ I;  1S6L A;  3DTI A;  1RPW A;  4DBQ A;  5DS9 A;  3BWG A;  4M71 A;  1G3Y A;  2LNB A;  4XRF A;  2HYF A;  2O8K A;  5F64 A;  2HVR A;  2P6T A;  3EUK L;  1W5C C;  3T8T A;  1DUX C;  1AKH A;  4XID A;  3KP3 A;  3UR3 C;  1Z6R A;  2CV1 A;  1FOK A;  2VXD A;  5FRM A;  1BL0 A;  5KVR A;  2EBI A;  2DFI A;  2KIQ A;  1V54 H;  1N77 A;  5C4X J;  4P9F A;  2C6Y A;  1HCR A;  5E17 F;  1ZGW A;  4YII A;  1XMX A;  2PBI A;  4PFP A;  4AD9 A;  5ICC A;  1Y39 A;  2NVY J;  2A3S A;  5EF6 A;  1U9O A;  4D7M A;  3GTM J;  3F23 A;  5GTI C;  4X0G A;  2AXL A;  3GWZ A;  3GTP J;  4FE4 A;  3H5A A;  3BJ6 A;  5LHH A;  2V9K A;  4B47 A;  3KEQ A;  1DU0 A;  5D6F A;  2BHY A;  3HOX J;  1VND A;  1P92 A;  3F21 A;  1IG7 A;  1IUY A;  1PP8 F;  1FSE A;  2YR2 A;  1MW7 A;  3P9C A;  3H92 A;  4YIF A;  3RIR A;  4KT5 C;  3W6J B;  4XRS A;  1STZ A;  5D5X B;  4EJT A;  3CDH A;  1LEA A;  4A12 A;  2LDU A;  2OTL I;  2Z1D A;  3DBR B;  3QU3 A;  4UUS B;  5F0F A;  2M87 A;  2QZ8 A;  1MDM A;  1J0R A;  2W7N A;  3MAJ A;  3I55 I;  4A3F J;  4OAY A;  3NRV A;  5C44 J;  1GV2 A;  4IRH A;  1SFX A;  3UKG A;  2A05 A;  3P5J A;  3PIP F;  2KRC A;  2M2E A;  2KIU A;  3K2Z A;  4ZYH A;  3Q5F A;  4LLN A;  1K4S A;  4HOB A;  3U9G A;  1IW7 F;  4MFE A;  4FCY A;  5DUK A;  1U6G A;  2A69 F;  3GO5 A;  4XSZ F;  3BC8 A;  3IAS 2;  4RGS A;  1D3Y A;  5B66 C;  2M30 A;  1W36 C;  1Z05 A;  2L9V A;  4LIV A;  3OYD A;  4DW6 A;  1UHS A;  4CDG A;  1GVD A;  2BW3 A;  3H0D A;  4BY7 J;  1IN4 A;  1Y56 A;  3LSG A;  1XDS A;  1T08 B;  2F5D A;  5IP6 A;  4D1Q A;  1G4D A;  2L7M P;  3S1Q J;  1IV8 A;  3ZQL A;  3ZQH A;  3BZ6 A;  2JMW A;  1ZR2 A;  1MJB A;  1R5H A;  1I3Q J;  4EM0 B;  1FYM A;  4KA4 A;  1ZHF A;  4L9N A;  2DT6 A;  3C2H A;  3S3M A;  3FM5 A;  5IY5 H;  1T95 A;  2IRF G;  2YPR A;  2V9V A;  3ZMT A;  4V19 K;  1LE8 B;  1UG0 A;  3CMY A;  2ZFW A;  2Q2E A;  3KE2 A;  3CJR B;  2KT0 A;  4PSX A;  1ZR4 A;  2KMU A;  2WB1 A;  2ZJP F;  2MGQ A;  4BUP A;  3HZJ A;  1RKT A;  1UCR A;  5FJ8 J;  2VL8 A;  2Y0S N;  3C3W A;  3AL0 C;  3QAH A;  1YTY A;  2JT1 A;  2R7O A;  3K10 A;  3BZC A;  1SAU A;  4E7K A;  1Z67 A;  3BR5 A;  1BI1 A;  1QZZ A;  4BL0 B;  3T8R A;  4IHT A;  1IJW C;  2DJI A;  4WXH A;  1G3S A;  4PFO A;  4AIJ A;  4KDP A;  4C3I J;  3VDX A;  4RB0 A;  5FLM J;  3WTW C;  2WV0 A;  2ME0 A;  5J1Y A;  1ONV A;  3HOT A;  3HPG A;  2W48 A;  5HLG A;  1HLV A;  1LDJ A;  2E1M C;  4Y3O A;  1RET A;  3KYC B;  3C7J A;  2FD5 A;  2V9P A;  1P9Q C;  2EZH A;  3RYR A;  3K0L A;  3RPQ A;  4KIS A;  4G94 A;  2BEO A;  1RUN A;  1PDN C;  1T38 A;  1Y8R B;  3K1P A;  3FMQ A;  3RZD J;  4IHS A;  4NDL A;  4LG0 A;  1I6X A;  1JHF A;  3GYH X;  1W5S A;  2B7E A;  4ENK A;  5FRN A;  3R0J A;  2P8T A;  2UV1 A;  3MMY B;  2NS8 A;  5EEA A;  2ETH A;  3Q0W A;  3CC4 I;  1AOY A;  4L9J A;  5EZH A;  2NVQ J;  1ZRF A;  2BV6 A;  1T0F C;  4RAG A;  1O57 A;  1BIA A;  2E1N A;  5C3E J;  1Z91 A;  1Z1D A;  1OCR H;  3C2G A;  1HKS A;  2R0Q C;  2CS3 A;  2R7F A;  3BPV A;  4M9S A;  1IN6 A;  1WH7 A;  3CDL A;  3GEZ A;  1A35 A;  1R7J A;  2CV2 A;  3ROU A;  3M1C A;  2QQA A;  1UAA A;  2W82 A;  5E18 F;  5GAD J;  3VOD A;  4AIK A;  3RQ4 A;  3V42 A;  4M3E A;  3G71 I;  2HKO A;  2OD5 A;  2V1X A;  3I64 A;  2B0L A;  3DBH B;  4BS9 A;  4A3M J;  1QQI A;  3CF5 F;  3BQZ A;  4DNC A;  3PL8 A;  2KKO A;  1V5F A;  2K4B A;  2DTR A;  3LMM A;  2EZI A;  3DU6 A;  3BZK A;  1SVO A;  2HXO A;  1YHQ I;  3JAM Z;  2LY9 A;  2MD0 A;  3BY6 A;  1VQM I;  3WG9 A;  1QHH D;  1J59 A;  2JUG A;  2IW5 A;  3O8H A;  2IA1 A;  1T56 A;  2QSH X;  1OQY A;  3S1N J;  1ZG5 A;  5H2F C;  1H89 C;  1R49 A;  3W3C A;  1BR4 A;  3ZCO A;  2M4G A;  2OJE D;  2E19 A;  2NVX J;  3VYR B;  2PEX A;  2WAD A;  1M1E B;  1JKQ C;  2XRN A;  4M6X A;  1TWG J;  4V2G A;  5BOX A;  2RAE A;  4EVI A;  1I1S A;  4ESF A;  2LRE A;  3DV8 A;  1HA8 A;  2JPC A;  4Q47 A;  2L2O A;  3OMY A;  3SQN A;  3I58 A;  1LE8 A;  2BVL A;  2ZJR F;  3IUO A;  3S17 J;  4G9Y A;  4HSR A;  5LGT A;  2V1D A;  2DOE A;  2KDO A;  1ON2 A;  3OR2 C;  3WGG A;  4HX7 A;  4YFK F;  4DGW B;  2EIN H;  3V7R A;  4BYY A;  3I0T A;  4FAS D;  3BR3 A;  5E20 A;  5GAH J;  3L2U A;  4BJ5 C;  3BR2 A;  2CUZ A;  1T8I A;  2K9M A;  2QQ8 A;  1FY7 A;  4HF0 A;  5F08 A;  1R1U A;  2ZBK A;  1KGS A;  3FIW A;  1YJW I;  4NC8 A;  1X1P A;  2RKH A;  3PQJ A;  1SMY F;  1R22 A;  2VPR A;  3QOD A;  4E6K G;  5LGN A;  3OYM A;  4I98 B;  2ECB A;  1IRF A;  4HDU A;  2ZME A;  1ZRD A;  1ON1 A;  4YEJ A;  4MO7 A;  2Z33 A;  5D4S A;  1JE8 A;  2QKL B;  5J4V A;  3FBI B;  3ZMZ A;  5LLQ A;  2F4O B;  1TP4 A;  3HBL A;  2QF7 A;  5K5R A;  2XF7 A;  4U0V A;  3NAR A;  2MAB A;  3JRG A;  2GLO A;  1DGW Y;  3E5U A;  2VON A;  2X0L A;  2XAU A;  5F27 A;  3DLL F;  1T2K A;  2ESH A;  3L2V A;  4AVZ A;  2E2I J;  3P9K A;  3G6E I;  1JGS A;  4F55 A;  5E3O A;  2W24 A;  3LSH A;  3LA3 A;  4Y4R A;  1MKM A;  3ISP A;  1JJ6 C;  2MH9 A;  1SC7 A;  4IO9 F;  1F9N A;  2VBX A;  2MW8 A;  3G1M A;  2O6G E;  1QBJ A;  4HX8 A;  2P7C B;  1U8B A;  3DBL B;  4JK1 X;  5M3F J;  2JJ7 A;  1X58 A;  3PSF A;  4HV5 A;  4M6V A;  4I01 A;  1XGM A;  3W2A A;  3F0C A;  2DI3 A;  2QUF A;  2XAQ A;  4XKV A;  2KJC A;  5EG0 B;  3HYI A;  1S29 A;  1TNT A;  3TP0 A;  4CSW A;  1TWF J;  3IH2 A;  4BBR J;  5LHG A;  4MEX F;  2EFO A;  1BW6 A;  3CDI A;  3I4P A;  3HDD A;  3SXY A;  4XLC A;  4KMF A;  3BTJ A;  4NC7 A;  2H1L A;  2XAS A;  5H6R A;  1O7F A;  1R00 A;  2EPF A;  2PX9 A;  3I4M J;  5E3L A;  4OU0 A;  3ESW B;  4BQA A;  4ESB A;  2R7V A;  3U2R A;  3CCQ I;  2QLZ A;  3WTX C;  1DP3 A;  2WC2 A;  2E1C A;  1IXC A;  3HPH A;  5CQG A;  2LC2 A;  3H5N A;  1ZAR A;  4RDU A;  2M1B A;  2HKX A;  2DMU A;  3F6O A;  2E60 A;  1LJ9 A;  2EA2 A;  3G1O A;  3ZMS A;  2PMZ N;  4UVB A;  2WA0 A;  1X1C A;  3I9V 2;  2K86 A;  1SAX A;  3FMS A;  1FYK A;  4NQW B;  1YE9 A;  3QPH A;  2EA4 A;  2ZXI A;  4GYI A;  5F1R A;  4GYG A;  1OR7 A;  2ZNZ A;  3A0B C;  4BJT A;  5EEH A;  3ZN1 A;  1G3W A;  4CO8 A;  1WJ5 A;  2MLK A;  3W6V A;  2VC1 A;  1R71 A;  5M3M J;  1YOV B;  4CCM A;  2ZC2 A;  2V6E A;  3HTU A;  2DA5 A;  2V79 A;  3PQK A;  1G59 A;  1FMW A;  2L7K A;  2A5W A;  2Z16 A;  1K6O A;  5HDN A;  2Y48 A;  1JUS A;  1TT5 B;  4M6Y A;  4PGG A;  1YW8 A;  2HR3 A;  1D0Y A;  2RVC A;  4HA8 A;  3JW4 A;  3LFK A;  3NWS A;  4O5V A;  1CF7 A;  1FZP B;  5FFX A;  3HTS B;  2DW4 A;  2DU9 A;  2KJB A;  2XF5 A;  1S72 I;  3K4C A;  5CPR B;  2CV0 A;  2EIL H;  5IOZ A;  2EFN A;  1BJA A;  2FSW A;  1VQN I;  2X1C A;  1E2X A;  1IXS B;  1WWX A;  4IRI A;  3M1E A;  1G3T A;  2DA1 A;  1U8R A;  2JVG A;  4PJM A;  4RAY A;  1APL C;  2EIJ H;  4Q5S F;  1TNS A;  2YS9 A;  4L18 B;  4CYC A;  3GTG J;  2FBK A;  5CKT A;  3HL2 A;  4XSX F;  2HU9 A;  1L3L A;  5TRD A;  2DYS H;  1MBF A;  1RNL A;  1A31 A;  1FOX A;  1VQ7 I;  3LSK A;  4GGG A;  4CCN A;  4BEH A;  2KZG A;  3JRB A;  3CCY A;  1MGT A;  4IXA A;  3QYB A;  4KN7 X;  3ULQ B;  3FBN B;  9ANT A;  3TBI A;  3G4S I;  5LBQ A;  2H27 A;  1MNE A;  2O5R A;  2DA2 A;  1ETX A;  1V4R A;  4J00 A;  2N8G A;  3GF2 A;  3VSL A;  4BQO A;  3ZQF A;  4ENJ A;  3E0J B;  4G7Z F;  2ZXH A;  4PJJ A;  5CLS A;  3VWB A;  2PG4 A;  4B3X A;  3LSP A;  1Z0X A;  4P5O A;  3TO9 A;  5TIS C;  2Z5U A;  2P0W A;  3DPL C;  2FBI A;  3ABK H;  1EH8 A;  5EGO B;  5L3C A;  2X6Y A;  1TQP A;  2O7O A;  3HJE A;  1HF0 A;  5EG0 A;  3LNQ A;  5DCM B;  2JA7 J;  1QO0 D;  4FE7 A;  3S2D J;  4IEJ A;  4PGH A;  4IF4 A;  3ERM A;  3GFJ A;  4B1R A;  2VJ5 A;  1S9H A;  2GAU A;  3E5Q A;  3EUA A;  3NWT A;  4A6D A;  4ZTF A;  3I59 B;  2DPU A;  2UWM A;  1X1A A;  2WBM A;  3IKV A;  2QGU A;  4A0Y A;  1HOM A;  2NS7 A;  2L4M A;  2MA3 A;  3WU0 A;  4S04 A;  3S14 J;  3ZR8 X;  1TWA J;  5TJJ A;  3JTH A;  1GT0 C;  1H0M A;  3EYY A;  2F5V A;  4LOC A;  1HXD A;  3MN2 A;  3HRM A;  4U0W A;  4AWX B;  2E2J J;  3AG4 H;  1IAW A;  3LSI A;  3FHZ A;  3BCB A;  2X1D A;  1I6H J;  1LNW A;  2MFZ A;  4M74 A;  2JN6 A;  2FNA A;  3OV8 A;  3OYJ A;  2HQ5 A;  4OIR F;  1J7K A;  4RLQ A;  5HDG A;  2IS1 A;  3K4K A;  1ETV A;  4XKB A;  4B44 A;  1P7J A;  4N9I A;  3OOU A;  3FKI J;  2LKS A;  1PUF B;  1T98 A;  4I02 A;  3H0G J;  1MJ9 A;  1V3F A;  2MD5 A;  2KRH A;  1KZH A;  2HVS A;  2LR8 A;  1SMT A;  3K70 D;  2VPL A;  3BT9 A;  5BQT A;  1LVA A;  3W6K B;  4OWR B;  2HS5 A;  3P7N A;  5L3D A;  2DPD A;  1ZG3 A;  2FF4 A;  2P6S A;  2HOE A;  2BGC A;  3W2W A;  1W7P A;  4CZZ A;  1KYZ A;  4ZDO A;  5JVG F;  3CUQ B;  1KQ9 A;  1WQ2 A;  3M07 A;  5J1U A;  3U21 A;  3FXR A;  3HOZ J;  3CF2 A;  2OCE A;  2E7W A;  2RN7 A;  3CP8 A;  3FXM A;  3FWE A;  5IP9 J;  1AU7 A;  3GFL A;  1Z7L A;  3GVA A;  4CZC A;  3HOU J;  2L9S A;  1W4M A;  4N4O B;  5ICF A;  1ETK A;  1KU9 A;  1YS6 A;  5E79 C;  3ZGK A;  4BAC A;  2HOA A;  3HHG A;  2VAS A;  5JR3 A;  4AVP A;  4BE1 A;  3DEE A;  2LF8 A;  1IXR C;  3RJP A;  3GBG A;  1NHA A;  4A0Z A;  4M3G A;  3M7G A;  4HQM A;  4ESJ A;  3QPT A;  2K9N A;  2CW8 A;  4KN4 X;  1TW2 A;  2YX7 A;  2R7W A;  2W25 A;  3SZT A;  2DBB A;  2F6C A;  2ZXW H;  2E71 A;  2L9N A;  4AYB N;  2FBH A;  4HX4 A;  4YFN F;  3BG6 A;  2IA2 A;  2BBY A;  1HW5 A;  1VQL I;  1E3O C;  3OIP A;  1F5T A;  3WG7 H;  1TQI A;  2OC6 A;  5ICG A;  5D5V B;  3G73 A;  3DWL E;  1JGG A;  5J47 A;  1DU6 A;  1QPI A;  5E8I A;  2FUG 2;  3J7A Y;  1WJA A;  2R7D A;  1MH4 A;  4QTR A;  3RKY A;  1CQT A;  1GXQ A;  5E1Z B;  2PJP A;  2ELJ A;  3DKX A;  4UUT A;  3CCE I;  3H9J A;  1W0U A;  4Y13 A;  2XRO A;  2K85 A;  1MSF C;  4XIC A;  2ADU A;  2KL4 A;  2DDA A;  1TWC J;  1NG6 A;  2E7X A;  1B72 A;  3HGY A;  2O9L A;  2A07 F;  4OOI A;  1BM9 A;  6PAX A;  1LKX A;  4U7B A;  3OYC A;  2ID6 A;  4U0Y A;  4LMY A;  1UFM A;  1P4X A;  1H8A C;  5CVR A;  3IC7 A;  1UB9 A;  4XR6 A;  3AAF A;  2VBW A;  1ZLK A;  2R7Q A;  3A2K A;  4G6D A;  3SDG A;  2DMT A;  4U87 A;  5HNF A;  4Y15 A;  3D0S A;  5J8C A;  1RI7 A;  5ILS A;  2DMN A;  1XGS A;  2XAH A;  2VKV A;  4IOC F;  1FT9 A;  1X3Z B;  4EJV A;  3TW6 A;  1FOY A;  1J75 A;  2JRT A;  2STW A;  4C3H J;  5CVI A;  2BY0 A;  2DJN A;  5HOD A;  1DPR A;  4DBR A;  1RES A;  1TZL A;  4YIR X;  1XG1 A;  2FRH A;  1UEL B;  1PUF A;  3AG1 H;  3LA2 A;  1ODD A;  5CVU A;  2AS5 F;  2LBF A;  4BE0 A;  3I4N J;  3CMM A;  1OFC X;  1I3A A;  1HDD C;  1U2W A;  4IQ4 A;  2A6H F;  1I50 J;  2LTP A;  1Z9C A;  3EDP A;  1TW3 A;  3CCU I;  3FHN A;  3CCV I;  1POG A;  5F0C A;  3OR1 C;  1K78 B;  1R58 A;  4G6T B;  4XOP A;  5JHF A;  4B8X A;  1FBU A;  4IRG A;  5ERI A;  4XBF A;  2HZD A;  3N05 A;  1RZ4 A;  3CLQ A;  3LSM A;  3CCS I;  2ZSI B;  3SHF A;  2VJ4 A;  2IGK A;  2DCE A;  4UB8 C;  2WAQ A;  3ASN H;  2V1U A;  3TGN A;  1YRN B;  3WU1 B;  1WRJ A;  3Q0U A;  2HYJ A;  3K70 C;  4C2T A;  2XUB A;  5HLI A;  4GO1 A;  4IHX A;  4XKW A;  5HS9 A;  5M5W J;  2LY1 A;  2Y31 A;  2NRA C;  4BU2 A;  3GFI A;  3K2A A;  2P5L C;  3RQI A;  3SFZ A;  4K2E A;  2NNN A;  3DEW A;  4ZYA A;  4E4H A;  3GLL A;  1MMS A;  2A68 F;  3LQQ A;  4LK0 F;  1K79 A;  1LDD A;  3REO A;  2V6C A;  4HYE A;  4B09 A;  4DZJ A;  4KIG A;  1DGR M;  1F43 A;  3ERE D;  3I3L A;  5CYV A;  1O3R A;  2X51 A;  5J1R A;  3QYE A;  2R7T A;  2UZK A;  5J8F A;  1UHW A;  4A5N A;  3CLO A;  3GTL J;  2PQ8 A;  2UXX A;  3F22 A;  1SVM A;  1T0F A;  3ZMD A;  4P9U A;  2TDX A;  1VI0 A;  2KIF A;  1B8I B;  2F48 A;  3ABU A;  1BR2 A;  2LP0 A;  4IJA A;  2P7V B;  2FML A;  3V7S A;  3S93 A;  1HSJ A;  5HS7 A;  1F1Z A;  1WJE A;  4NC6 A;  1R1T A;  2PN6 A;  5LFA A;  1ERD A;  2KRF A;  1FMV A;  3B6C A;  5TGT A;  5F6F A;  2Q1Z B;  2O61 A;  4EV0 A;  2X85 A;  1TL8 A;  2OCC H;  3CUQ C;  2KIS A;  4MTD A;  2VKD A;  1BI0 A;  1VTN C;  1AHD P;  2R7U A;  3TDZ C;  2XF6 A;  3J81 K;  1XD7 A;  4BXU A;  4EGZ A;  3R0A A;  1JTY A;  4FHT A;  5D8K B;  4ZH4 F;  3DQV C;  2HQR A;  3LA7 A;  1VQK I;  5HLH A;  4A3L J;  4AIH A;  2BXY A;  1BOB A;  4UV9 A;  3HHH A;  2XIG A;  3CD6 I;  2NXN B;  1FEX A;  1FSH A;  3CME I;  4WX9 A;  1FX7 A;  4BDY A;  2HFH A;  2VE8 A;  4RBO A;  2M0M A;  1JUP A;  5LGU A;  2DMP A;  2KPM A;  2PJR B;  4EQQ A;  3NQO A;  3L9F A;  3KP2 A;  1HBX G;  1XMK A;  3HC7 A;  5F0H A;  2VI6 A;  1JUM A;  3SEQ A;  2KP6 A;  2F4I A;  3M8E A;  2EV5 A;  1D1A A;  3PUB A;  3LSR A;  5HNH A;  5FKM A;  3H3Z A;  2R5Y B;  1Z3X A;  3S1R J;  2DT5 A;  2IXS A;  2XKP A;  4UV8 A;  3OS0 A;  3TED A;  3KEO A;  2BYV E;  4B4C A;  4W1U A;  4XL9 A;  5FFZ A;  1OCT C;  4F91 B;  2VKE A;  2CO5 A;  4WXC A;  4D9J A;  2XDV A;  4UUS A;  3MKL A;  2VN2 A;  1FC3 A;  3KLN A;  2KIM A;  1H9G A;  4MIM A;  2M0C A;  2VXZ A;  1REP C;  3OS2 A;  2H6B A;  2CYY A;  4C9Y A;  1X3W B;  2O3F A;  2MSY A;  2QWW A;  2ESN A;  4JQF A;  1RR7 A;  2GA2 A;  2WAE A;  4P96 A;  2NVU B;  4BHB A;  5HS8 A;  3J80 K;  5IOY A;  4E7L A;  2IS6 A;  2B63 J;  2R4G A;  1LDK B;  4HNV A;  3HRS A;  1V5E A;  2BOL A;  2KHM A;  3K69 A;  3RI4 A;  2Z2S B;  3N97 A;  1ZGJ A;  3QP6 A;  3S16 J;  2VUM J;  2FX0 A;  2K02 A;  4XN3 A;  4M73 A;  4I09 A;  3J7Y J;  5ICE A;  4FET A;  5FKL A;  2LD5 A;  1XSX A;  2NOJ B;  2GQQ A;  3LAP A;  3WTU C;  4U7D A;  4C3J J;  1MJA A;  2R92 J;  2OZ6 A;  3I56 I;  1UMQ A;  3MZH A;  5JVT A;  3M8J A;  4HLX A;  4RMN A;  3R6S A;  4H0E A;  3QPL A;  4MNU A;  1EV7 A;  3BTI A;  1ETY A;  2LSO A;  3OYG A;  1I1G A;  3AFH A;  1K61 A;  4RS8 A;  3RDI A;  1USS A;  2AQE A;  3L1P A;  5DYM A;  3L09 A;  1D8J A;  1Z7U A;  2W57 A;  1YQA A;  4C2U A;  2RNG A;  3PJR A;  2Y9Z A;  5D5U B;  2XGE A;  2P81 A;  3Q9V A;  3GTK J;  1HDP A;  5B5E C;  2JUC A;  1XS9 A;  2PLY A;  4J19 A;  3RCO A;  4E7I A;  3FXO A;  1UST A;  3DKY A;  4I76 A;  4XOR A;  5HDK A;  3IP4 B;  3ZQG A;  2DFH A;  2GOX B;  2ZO4 A;  2EFP A;  5M5X J;  5J40 A;  4AM3 A;  2G7U A;  2FQ4 A;  4E70 A;  2H94 A;  1E0E A;  1HKQ A;  2QQB A;  4M3D A;  3C18 A;  2EFQ A;  1EA3 A;  2DTZ A;  3KX2 A;  3AKZ A;  2XB0 X;  3W2V A;  3PO3 J;  3FK7 A;  4HNT A;  2JSC A;  4MQ9 F;  4WWC A;  2FA5 A;  2CMP A;  2BY3 A;  1SFO J;  3ZN0 A;  5C4J J;  4G12 A;  1QGP A;  3F8F A;  3BG5 A;  2RRE A;  3DXJ F;  5KAI C;  5HLT A;  4LLL A;  2TCT A;  3JRE A;  2VLA A;  4UB6 C;  5F1J A;  2QA4 I;  4IHV A;  1B9N A;  2F2E A;  1NK3 P;  2LRD A;  1ZYR F;  1ETQ A;  1OKR A;  4H4K C;  4CA0 A;  1T39 A;  5LHI A;  1WFX A;  3G1L A;  1FJL A;  1F4K A;  4UY8 I;  1SAN A;  3LL7 A;  1V5G A;  2X4H A;  3DLA A;  4J01 A;  2VBZ A;  2DA4 A;  3OS1 A;  3F8C A;  4CUG A;  3SJM A;  3WE2 A;  5AIP A;  2K3P A;  4LJZ F;  4PCQ A;  4KNY A;  2LKP A;  3ZQQ A;  3VYS B;  3ZQC A;  1KON A;  2PMH A;  1B4A A;  2F5C A;  5L3E A;  1MH3 A;  4LIU A;  4EAT A;  4II2 A;  3I5U A;  3KYD B;  1S3J A;  5LRS A;  3K4L A;  2HTS A;  3KZI C;  2X48 A;  2GXB A;  3QWL A;  4ZJZ A;  3BCA A;  3HRU A;  3VYT B;  4DYR A;  4ZZD A;  4GFB A;  1D5Y A;  2MYS A;  3GXO A;  1YG2 A;  4KIC A;  3CUO A;  2AXT C;  2VE9 A;  1Y0N A;  2GBY A;  4ZC3 A;  1HW2 A;  1VQO I;  3KET A;  4A3D J;  2K40 A;  1E3H A;  1EF4 A;  4JYK A;  4PUS A;  3IHU A;  1ZRC A;  3TMO A;  3ECO A;  2MC4 A;  4A3B J;  1MMN A;  1XSV A;  2DK5 A;  3B02 A;  1QA6 A;  4Y52 J;  2VQH A;  5FGM A;  2B9S A;  5E8G A;  1PUE E;  2Z3Y A;  1XDU A;  1HC8 A;  2M34 A;  1BC8 C;  5IPA A;  4ASN A;  4XLA A;  4II3 A;  3GTJ J;  4JX4 A;  2DFE A;  3R61 A;  1LPQ A;  3GFM A;  3FF5 A;  3LQR A;  2IT0 A;  4KIB A;  1EH6 A;  1FOW A;  4KFC A;  5H6Q A;  2EQR A;  1DQU A;  2QEN A;  1I5Z A;  2YU9 J;  3WOD F;  4KIF A;  4BAY A;  2OF7 A;  4FX4 A;  2M7B A;  4RA2 A;  1Y8Q B;  5CJ9 A;  2OA4 A;  3U1D A;  4HNU A;  1LFP A;  3OOP A;  4S0H B;  1HST A;  3HEF A;  1B6A A;  1K7A A;  1BIB A;  1J09 A;  3Q0V A;  3BR6 A;  1D0X A;  4Y33 A;  3VSK A;  4KMU X;  4OMZ A;  4QLC U;  4HV6 A;  1Y1V J;  2K5C A;  3HSE A;  5J6X A;  3A01 B;  2IS2 A;  1WI3 A;  2CRG A;  4I6Z A;  1IRX A;  3CJT B;  3IWZ A;  4M72 A;  2DQL A;  3HOV J;  1X4O A;  2WB1 N;  5K7H A;  3HOS A;  3EUH C;  5BPD A;  1DP7 P;  3K9T A;  1EKE A;  1U5T B;  3QYF A;  3BG7 A;  3QPS A;  1MD0 A;  5LD2 C;  1K4T A;  5DDG A;  2JWT A;  3RKW A;  1MSE C;  4ABZ A;  2XVC A;  3RSN A;  3MZ8 A;  1VQ8 I;  3PNY A;  2F5E A;  1H9T A;  1G2H A;  4JX5 A;  3GLX A;  3TKY A;  1E3P A;  2OPT A;  3HUG B;  4L5E A;  2QBY B;  1MMD A;  1YJN I;  3QOE A;  2CQN A;  2CGP A;  1IF1 A;  1XCB A;  3RTR A;  4IPA A;  3FM3 A;  3A02 A;  4Z6Y A;  5JFR A;  3JTG A;  1D5V A;  3CQZ J;  3QP5 A;  4BY1 J;  1PP7 U;  1FP2 A;  1SD6 A;  4A69 C;  3L2R A;  4R1H A;  5K7F A;  3MKW B;  4BHC A;  5AIQ A;  4ZYE A;  2X6O A;  2CQK A;  4Z2Y A;  4WXD A;  2L7Z A;  3J81 Z;  4E7Z A;  1GV5 A;  3OSG A;  3M9A A;  1GUU A;  2WTE A;  1J9I A;  2I10 A;  3CCM I;  1ZK8 A;  2LLK A;  2Q8K A;  5EYR A;  2DDB A;  1WH5 A;  4UHT A;  1YW7 A;  4A93 J;  5E1X A;  2D2W A;  3K1N A;  4ZYD A;  2DQR A;  1S7A A;  1NH3 A;  4A3I J;  5IYD J;  5FB2 A;  1K6Y A;  3Q3S A;  3CP2 A;  2JK3 A;  2IP2 A;  1X1B A;  2COM A;  3U1K A;  2Y0S A;  3UNG C;  3K7A J;  3HOY J;  1RIO H;  2NOG A;  4NUB A;  4RB1 A;  3BR0 A;  3EET A;  3CC7 I;  2EFW A;  2DOA A;  2GWR A;  3HXL A;  1B9M A;  3TW7 A;  2CUF A;  1Q1H A;  3N4M A;  3FK6 A;  2M45 A;  3F3X A;  1IDY A;  2GIV A;  2QCO A;  1R23 A;  4TV7 A;  2HWV A;  2R3S A;  4G7H F;  3BJA A;  1FP1 D;  3A03 A;  4XNF A;  2WV1 A;  1A6I A;  2JSP A;  4A3E J;  3E5X A;  3KCC A;  4G6Q A;  3KPH A;  5E3N A;  3IV5 A;  1NK2 P;  1VQ6 I;  1AKH B;  5IT3 A;  4PSW A;  1BI2 A;  2K4J A;  1QVU A;  3DP7 A;  4PK4 A;  3IRR A;  4MLO A;  5LRR A;  2R5Z B;  1JKR C;  3MZY A;  3BOQ A;  5ILU A;  3P9I A;  1WGX A;  3J80 Z;  1WHU A;  1JJ8 C;  2QEX I;  3V4G A;  2Y0M A;  3T0Y A;  5FRO A;  2O8X A;  3MQ0 A;  4LK1 F;  2M9H A;  1FIP A;  1KU2 A;  1T33 A;  2A61 A;  4NQW A;  4XLE A;  3CC2 I;  1IDZ A;  2JA2 A;  2HGC A;  2VC0 A;  1ZKG A;  3KP6 A;  4RM2 A;  5DM6 F;  1X4P A;  2Y9Y A;  2AO9 A;  4QPQ A;  3V8K A;  2E5N A;  3PFY A;  3GME A;  2HEO A;  1NTC A;  4ZYG A;  1JT0 A;  4AU7 A;  4IZZ A;  4W97 A;  4IHY A;  2UXN A;  5A2Q K;  3KP4 A;  1MIJ A;  5LEJ A;  5HOO A;  2P5V A;  3GZ6 A;  2ZKZ A;  1BJZ A;  4F3Q A;  3ONQ A;  2YSR A;  1YIT I;  3QQA A;  4D0P A;  1RUO A;  3SZG A;  3S2H J;  4YRV A;  1QVT A;  4IQJ A;  1QZE A;  1MDM B;  1IRZ A;  2HPI A;  1BBY A;  4ENM A;  5FKN A;  3BP8 A;  4CH7 A;  1D0Z A;  2VJI A;  3MD2 A;  3RPU D;  4BQN A;  2DA3 A;  2OU2 A;  1S7O A;  4LG3 A;  4A3K J;  1YYV A;  3MCZ A;  2FJ1 A;  3SDB A;  1BW5 A;  3IH4 A;  4Q48 A;  1D8K A;  4Y17 A;  2G9W A;  2HVQ A;  1RC9 A;  3G3Z A;  3DU5 A;  1OIS A;  3OSF A;  2CJJ A;  4ANJ A;  1U3E M;  4KUM A;  1ZQ3 P;  4ITV A;  1R36 A;  2O0Y A;  2LF7 A;  3TO6 A;  1YS7 A;  4EJU A;  5L3B A;  1ENH A;  2ZB9 A;  4CCK A;  2XGX A;  2IPQ X;  3M3Y J;  3QU6 A;  2HDC A;  1FTZ A;  4EM1 A;  1YLF A;  1D1C A;  1FNN A;  4FTH A;  1VQ9 I;  4R8H A;  1K83 J;  2CUE A;  3ABM H;  5DUI A;  1QPM A;  1B1B A;  3S15 J;  2R7R A;  2H6C A;  1T6S A;  3ASO H;  3LSJ A;  4BE2 A;  1A36 A;  4HG2 A;  2VOO A;  1VZ0 A;  3A1Y A;  1FLI A;  4BNC A;  2VB6 A;  3SFI A;  1SFU A;  2D1V A;  4D5F A;  2K7L A;  5EGO A;  2Q2E B;  4HST A;  5FKK A;  3QRF F;  1U5T C;  1CGP A;  5ED4 A;  5GP9 A;  4NBQ A;  3L2Q A;  3TL4 X;  1VQP I;  3IH3 A;  1JKP C;  5DCM A;  4EM2 A;  5E1W A;  5D4R A;  2LYC A;  2NS0 A;  2ISY A;  3DEU A;  1U9N A;  4QSH A;  5GTH C;  2A6T A;  2QQ9 A;  4PJL A;  1KA8 A;  2X6X A;  4RGU A;  1R5G A;  2E36 A;  3I59 A;  2VIX A;  2COB A;  5CQE A;  3GZ5 A;  2HOT A;  2ZSH B;  3BG3 A;  2JTV A;  4A3C J;  1GLN A;  3EPZ A;  3CJN A;  4XLF A;  2W1O A;  4CHU A;  4UVA A;  3NEU A;  5KAF C;  1P4W A;  2M5W A;  4HDV A;  5JLW A;  2MLG A;  4UXN A;  3OYH A;  1N25 A;  2Q0O A;  2QSF X;  2R5Z A;  4FX0 A;  2Z9O A;  3RPU A;  3PO2 J;  2ME6 A;  3TO7 A;  5BNG A;  3ZOB A;  3DFG A;  2CH0 A;  3EYI A;  2XGD A;  1IRG A;  4AC0 A;  4LG0 B;  2JA8 J;  5FLX K;  4CCL A;  1JHH A;  3TDU C;  5KK1 A;  1IC8 A;  4ETS A;  3FKJ A;  2W84 A;  4FT8 A;  5KCM A;  1JI8 A;  4WK8 F;  5JI6 A;  4A3G J;  1OCP A;  3ZMV A;  1OYW A;  2I8D A;  4ZDL A;  2RNJ A;  3H9G A;  2FQ3 A;  4G7O F;  3B6A A;  4L9T A;  3HIF A;  5GAE J;  1ZEL A;  4CXF A;  2CG4 A;  2PFB A;  2DOF A;  2D1H A;  3OYN A;  2L01 A;  4GXO A;  2LOO A;  3VFZ A;  2VBY A;  4WCG A;  2LVS A;  2R7S A;  2R7Z J;  2OQG A;  3CUQ A;  1QNT A;  2NAZ A;  2DA7 A;  2IBD A;  4UVC A;  3DKW A;  2LKX A;  3LST A;  3JRI A;  3JRC A;  1P6R A;  1EH7 A;  1PJR A;  1O4X A;  5BS6 A;  2VOP A;  4BKX A;  4M9Z A;  4XQF A;  4F52 A;  2DMQ A;  3OYE A;  1OCC H;  1J5Y A;  3B73 A;  2JA5 J;  1BI3 A;  1SD7 A;  5JHU A;  2OAZ A;  2ELK A;  3JSP A;  2CUJ A;  2AHQ A;  4KT6 A;  2GM4 A;  1H88 C;  4CYD A;  5K7Z A;  4CIC A;  3D5S C;  1OCZ H;  1WCM J;  2VT3 A;  5IT9 K;  1L0O C;  2BXZ A;  4XON A;  1YO5 C;  2ZNY A;  2HXI A;  2XSD C;  2DFF A;  2R7X A;  3K1M A;  1MZB A;  1W5T A;  2GA1 A;  3CJQ B;  3IWF A;  1Y0U A;  4IHW A;  2Z99 A;  2WAF A;  3F8M A;  2PMZ A;  3F8N A;  1GXP A;  1KYW A;  4OIQ F;  4IL6 C;  5K5Q A;  4MGR A;  2I5U A;  3SZP A;  5FO5 A;  4A3J J;  1SFE A;  3WTZ A;  2IVM A;  2J5P A;  3JSO A;  2BE5 F;  2V1N A;  1FTT A;  2DYR H;  3BDD A;  3MWM A;  2IGN A;  4JBA A;  4CCO A;  1Z77 A;  4EJW A;  2CU7 A;  1XC5 A;  4UUV A;  2FMY A;  4GCV A;  1NG7 A;  3OL3 A;  4RGX A;  4EMS A;  4R79 A;  3PNT A;  5FD6 A;  2XC7 A;  2IAI A;  3EQL F;  5ILV A;  3H3U A;  3O8G A;  3HKZ N;  3KP7 A;  2OTJ I;  4MQV A;  2E35 A;  4ZDP A;  1LVK A;  2BVM A;  4HEA 2;  3G2B A;  3E6C C;  2FOK A;  2GZW A;  4M3B A;  4UNO A;  1WZ2 A;  5FKO A;  5B3S H;  1AWC A;  1MND A;  1XMA A;  3J7A O;  3BR1 A;  2W85 A;  5B1B H;  1X2N A;  2FOW A;  2ZME B;  4PJ0 C;  4DYQ A;  1LUJ B;  1ORK A;  2Y30 A;  1IN5 A;  1Z3Y A;  5L3F A;  1V55 H;  2E34 A;  3O6B B;  2JZY A;  2ISZ A;  5H20 A;  3CTA A;  3OYF A;  5IYC J;  2IGM A;  4QPO A;  3J7Z I;  4I99 C;  3V8L A;  1BC7 C;  1ITY A;  3JRA A;  2HYG D;  4FIS A;  4IX7 A;  2CFO A;  3RYP A;  3TP3 A;  4O6J A;  1OJL A;  4BH9 A;  1ZTR A;  2XV4 S;  1C0W A;  3S32 A;  2JA6 J;  1UG2 A;  1D1B A;  2KFD A;  2L54 A;  2JRM A;  5CVJ A;  2LG4 A;  2EIM H;  2FE3 A;  2RGV A;  2EZL A;  5GAG J;  1UZC A;  1P2F A;  4JOM A;  2DLL A;  1K78 A;  3M4O J;  3IKT A;  3ECH A;  3X2Q H;  1ZN2 A;  3DTK A;  1W1W E;  2ICW G;  3S3O A;  4X6A J;  2MBF A;  2HTJ A;  3FDY A;  3I54 A;  2ZCW A;  4CCJ A;  2HNH A;  3FZV A;  2E5Z A;  4MTE A;  4LB5 A;  1YRN A;  2MG4 A;  2WY8 Q;  4P55 A;  5FLV A;  3HGG A;  3GTQ J;  4I7H A;  1JKO C;  2X6W A;  1YIO A;  1O3T A;  5B1A H;  1KQ0 A;  2EV0 A;  1Q1V A;  1R5I D;  1SD4 A;  2ACJ A;  1BOA A;  1LFB A;  5A2Q Z;  2VQL A;  3OL4 A;  3T5X A;  5KHD A;  1X3U A;  2W00 A;  1BR1 A;  1VQ5 I;  1G6N A;  2K3F A;  4HW0 A;  1N75 A;  3H3V K;  4KYW A;  3VPR A;  2DT7 B;  4XLN F;  2P5K A;  4QWQ A;  2M8G X;  1HQC A;  1EJ9 A;  3Q9S A;  4I0B A;  4XRS G;  4G8X A;  2H8W A;  3L7W A;  3LWF A;  1VFC A;  4M3F A;  2BY1 A;  1P7I A;  4LGW A;  1B8I A;  2A5Y B;  3CCL I;  2TRT A;  3PNV A;  4X1E A;  5BPI A;  1LB2 A;  1BA5 A;  4D5C A;  2LH9 A;  4U88 A;  2DO7 A;  4BJ6 C;  4PJN A;  1VF9 A;  4RB3 C;  2H09 A;  4HF1 A;  1QHG A;  3K4J A;  2DA6 A;  1HW1 A;  4QIW N;  3MKY B;  2LFB A;  4BXF A;  4IOA F;  3FXU A;  1MBJ A;  2BY2 A;  2HZT A;  3PIO F;  3ZRG A;  4YG2 F;  2L3D A;  3NAU A;  4RM3 A;  2O03 A;  1YX5 A;  3GTO J;  3KIO A;  5JLX A;  2M8E A;  3FIS A;  2HI3 A;  3MVP A;  3O2P E;  3WTS C;  1A5J A;  4JX6 A;  2IA0 A;  2QVO A;  2L9R A;  5K1Y A;  3F8B A;  4OAZ A;  2KZV A;  4NNJ A;  4Y7N J;  4DOZ A;  1WI9 A;  3WGH A;  4OIN F;  3V8J A;  1YJ9 I;  2MH2 A;  1WJB A;  3OIO A;  2PJR A;  3FMR A;  3ZQ7 A;  2OZU A;  1CF7 B;  1QU3 A;  1FYL A;  2CQX A;  4BDZ A;  5DCF A;  2QSG X;  2RC4 A;  4KJZ A;  1O3S A;  3OYI A;  1GVJ A;  3H35 A;  3KYL A;  1YW9 A;  1YX3 A;  3GCM A;  3CO7 C;  2ID3 A;  1RR8 C;  1TC3 C;  1TQM A;  3E6M A;  2R5Y A;  1X1D A;  1SD5 A;  5AON A;  1GDT A;  2V4J C;  3A4C A;  1MBG A;  1AA7 A;  2XB5 A;  2XPU A;  3R60 A;  5J4Y A;  4HZF A;  4AYB A;  3GW2 A;  5HVQ C;  1XTA A;  3WU2 C;  5GPA A;  1FWZ A;  3OY9 A;  2L5Q A;  4CYC B;  1Z6T A;  2H8R A;  3KZY A;  5D5W B;  3OYA A;  3TQN A;  3HSR A;  4S05 A;  4C2M J;  1OLT A;  3E6B A;  3ELK A;  2WY7 Q;  1MBH A;  4BEH B;  2Y2Z A;  1ZLJ A;  2D5V A;  4XM3 A;  2L02 A;  2VT2 A;  2QYO A;  1ZAO A;  3IL2 A;  4HQE A;  2CW0 F;  5J3L A;  1TT0 A;  4LB6 B;  4L0Z B;  1MBE A;  4JP0 A;  2F5F A;  2LY2 A;  3EUH A;  4DIQ A;  2RDP A;  2R93 J;  2OBP A;  1Y6I A;  3S1M J;  3BTC A;  1YFH A;  3KZZ A;  3KP5 A;  2DXI A;  2IS4 A;  4KIT B;  4D7N A;  5K5O A;  2MC3 A;  1SVL A;  1S5L C;  2CSO A;  2XPW A;  4YFX F;  4NHJ A;  1SFK A;  3M8F A;  3A0H C;  1OMI A;  2EJR A;  2ZXJ A;  1XGO A;  2JVH A;  4B48 A;  1TTY A;  4BGD A;  4E7H A;  2WAQ N;  1HKT A;  3COA C;  3S3N A;  1JTX A;  3BQY A;  3HG9 A;  5CVV A;  5FLX Z;  2PI0 A;  3F72 A;  3HSF A;  3C1D A;  4EGY A;  4L0Y B;  2YU3 A;  3PSI A;  2ZME C;  2VOD A;  3L2C A;  4IVN A;  5EZG A;  5KNL A;  3CMA I;  2STT A;  4HPQ A;  3OWT A;  2DOD A;  3H9Q A;  1F36 A;  4E7S A;  1WJC A;  2GOM A;  1N78 A;  3T1B A;  4P1W A;  4A2U A;  2X9D A;  2YUS A;  2EZK A;  3JCU C;  5EJC A;  3K4M A;  4DYC A;  3I71 A;  1ETW A;  4V2F A;  5LEK A;  4N9H A;  4PZJ A;  5D8L B;  2GXG A;  4EEF G;  1OYY A;  2VQC A;  1O7L A;  4A5M A;  2E1O A;  2E2H J;  1IZ1 A;  4LLG F;  2BHZ A;  1YI2 I;  3D5R C;  3VYU B;  4A6E A;  3WTV C;  3O3K A;  2QM3 A;  1PVE A;  2XPV A;  4ENN A;  1FPQ A;  4I2O A;  1WPK A;  2RQQ A;  4NB5 A;  4PDK A;  3S2W A;  1X2M A;  1SEU A;  3VOE A;  2FU4 A;  5IT9 Z;  3JRH A;  1WJD A;  3CES A;  3BLY A;  3D1N I;  2CFX A;  2EV6 A;  5L3G A;  3OYB A;  1ACI A;  1E17 A;  4OIO F;  3FXQ A;  3JRD A;  4XOT A;  2M4K A;  2OQR A;  4O3M A;  3QOP A;  2M7A A;  1TLH B;  1XB4 A;  2IGO A;  3WHC A;  1RRJ A;  2VKH A;  1MBK A;  1W7P B;  1MNM C;  3HB9 A;  4XLP F;  3JR9 A;  5BMZ A;  3OYL A;  2L7F P;  2CQ7 A;  4XRM A;  4N0B A;  1A6Q A;  2V7F A;  3H5R A;  3OIQ A;  3VEP A;  2KQR A;  4XMY A;  3I53 A;  3ZP5 A;  3DTE A;  4WF2 A;  3DF8 A;  4LFU A;  4HF2 A;  2PMU A;  2VJJ A;  1JXS A;  3ABT A;  3F6V A;  3PM1 A;  4RB2 C;  2NVT J;  2EH3 A;  4MEY F;  3C2B A;  4L5I A;  2Y69 H;  2XHK A;  4RAF A;  2HDD A;  4L9V A;  4F92 B;  4LIT A;  2L0K A;  1R4M B;  3BG9 A;  1Z21 A;  2EK5 A;  1XCV A;  2D45 A;  1BN5 A;  1XX5 A;  1U78 A;  1J2X A;  1LEB A;  4GDF A;  4Q4Z F;  2ECC A;  3KEY A;  3CCR I;  4B3A A;  4AID A;  1W7P D;  3ZXS A;  3WTT C;  1VQ4 I;  3DPT A;  2OV7 A;  1IGN A;  3KFW X;  3HM5 A;  3HOW J;  1OYI A;  3CCJ I;  2XSJ C;  2JQ7 A;  4E7J A;  1OR7 C;  4FQG A;  5DD8 A;  1O3Q A;  2K27 A;  2P4W A;  4GRI A;  2V26 A;  3FXL A; 
#chains in the Genus database with same CATH homology
 2X6X A;  3SEQ A;  2KP6 A;  2F4I A;  4N4N B;  1D1A A;  2VIX A;  3PUB A;  3MKZ A;  5CQE A;  4F55 A;  5HNH A;  2ZSH B;  4B43 A;  2QKM B;  3F9K A;  3LSH A;  1GLN A;  2CW7 A;  4Y4R A;  3EPZ A;  4XLF A;  1Z3X A;  2W1O A;  2IXS A;  3K4B A;  3OS0 A;  3HKZ A;  1G8X A;  4XL9 A;  1R6R A;  4F91 B;  3OYH A;  2HQA A;  3PSF A;  2KLO A;  4D9J A;  2XDV A;  3W2A A;  2ZFU A;  4XKV A;  2CH0 A;  2VXZ A;  3OS2 A;  4XLH A;  4CSW A;  4CCL A;  4C9Y A;  3FKJ A;  4JQF A;  2WAE A;  4E7L A;  2IS6 A;  3S8P A;  4XLC A;  4RLF A;  5KCM A;  1JI8 A;  2R4G A;  1LDK B;  4HRI A;  1V5E A;  2BOL A;  2I8D A;  4NC7 A;  3H9G A;  4ZDL A;  2KHM A;  2AQF A;  2Z2S B;  3SEZ A;  1ZEL A;  3K6G A;  3OYN A;  4C30 A;  4XN3 A;  2LOO A;  2R7S A;  2R7V A;  4FET A;  1X19 A;  2OUM A;  3L2W A;  2X1E A;  1DP3 A;  3DPU A;  3HPH A;  2NOJ B;  5CQG A;  2LC2 A;  3H5N A;  1PYV A;  2E60 A;  2LBF B;  1PJR A;  4DJA A;  3IAM 2;  4XKC A;  2W4S A;  4XQF A;  2WA0 A;  3SYT A;  4F52 A;  1X1C A;  3I9V 2;  3OYE A;  4XN0 A;  1W36 D;  1U0J A;  4NQW B;  3M8J A;  4RMN A;  1YE9 A;  3D5L A;  3E1S A;  2ZXI A;  2CUJ A;  3CZ6 A;  4KT6 A;  2HDW A;  3OYG A;  3AFH A;  3AL0 B;  2AQE A;  3D5S C;  4F93 B;  4BJT A;  2UUZ A;  4XON A;  1WJ5 A;  4C2U A;  2RNG A;  3PJR A;  4CCM A;  2V6E A;  1G59 A;  2R7X A;  1FMW A;  2L7K A;  2A5W A;  2Z16 A;  2M3A A;  4BQQ A;  3RCO A;  4E7I A;  4YEL A;  3CJQ B;  3DKY A;  4XOR A;  2WAF A;  3OYK A;  2PMZ A;  3IP4 B;  1D0Y A;  2BW3 B;  2E1M B;  2GOX B;  2VQG A;  3NWS A;  2XF5 A;  1E0E A;  3K4C A;  5CPR B;  1EA3 A;  2V1N A;  3KX2 A;  2CV0 A;  3AKZ A;  3W2V A;  4CCO A;  2IGN A;  2X1C A;  4HNT A;  3K4N A;  2CMP A;  1NG7 A;  2JVG A;  3OL3 A;  4PJM A;  4R79 A;  3PNT A;  2HPM A;  2XC7 A;  4ZTJ A;  2RRE A;  5HLT A;  2VLA A;  5CKT A;  3HL2 A;  2HU9 A;  4ZDP A;  1MMA A;  2LRD A;  1LVK A;  2BVM A;  4H4K C;  4HEA 2;  4CA0 A;  4IKF A;  3G2B A;  3LSK A;  1WFX A;  4BEH A;  4CCN A;  3LFU A;  1WJF A;  3QYB A;  3FBN B;  3TBI A;  1MND A;  1MNE A;  1MMG A;  1V5G A;  2O5R A;  3LL7 A;  4J00 A;  2K9L A;  3VSL A;  3DLA A;  4J01 A;  4BQO A;  3OS1 A;  3E0J B;  4CUG A;  2ZXH A;  4PJJ A;  3VWB A;  2K3P A;  4B3X A;  4P5O A;  3ZQQ A;  3VYS B;  3DTI A;  1Z3Y A;  4DBQ A;  1KON A;  2P0W A;  3DPL C;  2HVR A;  3EUK L;  3OYF A;  4LIU A;  2IGM A;  4EAT A;  4QPO A;  4II2 A;  3UR3 C;  2CV1 A;  2X6Y A;  2VXD A;  3K4L A;  5FRM A;  4IX7 A;  2CFO A;  1N77 A;  4ZJZ A;  3BCA A;  3VYT B;  4PFP A;  3S32 A;  2VJ5 A;  1D1B A;  1S9H A;  2MYS A;  4ZTF A;  3EUA A;  3NWT A;  2UWM A;  1X1A A;  2WBM A;  2LG4 A;  4X0G A;  3H5A A;  4JOM A;  2V9K A;  4B47 A;  4ZC3 A;  3DTK A;  3ZR8 X;  3S3O A;  2F5V A;  4PUS A;  3TMO A;  3FDY A;  1MW7 A;  2MC4 A;  1MMN A;  4CCJ A;  3LSI A;  2HNH A;  2VQH A;  2E5Z A;  2X1D A;  2MFZ A;  3BCB A;  3OYJ A;  2WY8 Q;  4RLQ A;  2Z1D A;  2IS1 A;  3K4K A;  2X6W A;  2W7N A;  4XKB A;  4XLA A;  4II3 A;  4B44 A;  3OOU A;  4OAY A;  1DQU A;  2KRC A;  2HVS A;  2KRH A;  2VQL A;  3K70 D;  2VPL A;  3OL4 A;  2M7B A;  4HNU A;  5KHD A;  1LFP A;  4OWR B;  2W00 A;  1BR1 A;  1N75 A;  1J09 A;  3BC8 A;  1D0X A;  4Y33 A;  3IAS 2;  3VSK A;  2DT7 B;  3W2W A;  1W36 C;  4ZDO A;  2K5C A;  3U21 A;  2IS2 A;  1IRX A;  4LIV A;  3OYD A;  3CF2 A;  1X4O A;  3CP8 A;  3HOS A;  2BW3 A;  3EUH C;  1Z7L A;  4CZC A;  3H0D A;  2L9S A;  1Y56 A;  3LSG A;  4N4O B;  3ZGK A;  3PNV A;  4BAC A;  3QYF A;  4D1Q A;  3BG7 A;  5LD2 C;  2VAS A;  2LH9 A;  4BJ6 C;  4BE1 A;  3DEE A;  4PJN A;  3GBG A;  2DT6 A;  1QHG A;  3C2H A;  3K4J A;  3RSN A;  3PNY A;  3S3M A;  2CW8 A;  3MKY B;  3HUG B;  4BXF A;  1T95 A;  1MMD A;  2R7W A;  3QOE A;  2F6C A;  3ZRG A;  2L9N A;  1UG0 A;  4RM3 A;  3RTR A;  1YX5 A;  3BG6 A;  3CJR B;  4PSX A;  2KMU A;  2WB1 A;  3OIP A;  4BUP A;  3L2R A;  2VL8 A;  3MKW B;  2OC6 A;  4OAZ A;  2KZV A;  3DWL E;  4NNJ A;  4DOZ A;  3AL0 C;  3K10 A;  2R7O A;  1WJB A;  2PJR A;  1QU3 A;  3J7A Y;  2FUG 2;  1SAU A;  4E7K A;  4BDZ A;  1WJA A;  4E7Z A;  4BL0 B;  4KJZ A;  2ELJ A;  3H35 A;  3DKX A;  3OYI A;  1YX3 A;  3KYL A;  2DJI A;  3H9J A;  4PFO A;  3VDX A;  1X1D A;  2KL4 A;  1NG6 A;  2V4J C;  3A4C A;  1AA7 A;  1K6Y A;  4AYB A;  3HOT A;  3HPG A;  3CP2 A;  5HVQ C;  1LKX A;  2E1M C;  4Y3O A;  4U7B A;  3OYC A;  1X1B A;  3OY9 A;  2L5Q A;  2Y0S A;  1P9Q C;  3UNG C;  4KIS A;  3OYA A;  4NUB A;  4XR6 A;  1OLT A;  2WY7 Q;  4BEH B;  2R7Q A;  2DOA A;  4XM3 A;  5FRN A;  3A2K A;  2UV1 A;  3HXL A;  3MMY B;  4U87 A;  1TT0 A;  5HNF A;  2LY2 A;  4DIQ A;  1Y6I A;  1T0F C;  2DXI A;  4XNF A;  2IS4 A;  4KIT B;  2JSP A;  1SFK A;  3C2G A;  2JVH A;  4B48 A;  4BGD A;  4E7H A;  2CS3 A;  4PSW A;  3S3N A;  2CV2 A;  1UAA A;  3HG9 A;  3M1C A;  4PK4 A;  4DBR A;  4MLO A;  1TZL A;  2W82 A;  1UEL B;  3PSI A;  2LBF A;  4BE0 A;  3RQ4 A;  3V42 A;  3CMM A;  5KNL A;  4IQ4 A;  4HPQ A;  5FRO A;  3OWT A;  3H9Q A;  4BS9 A;  4XLE A;  3FHN A;  4E7S A;  1WJC A;  2JA2 A;  2GOM A;  1N78 A;  4RM2 A;  1X4P A;  3OR1 C;  3PL8 A;  4P1W A;  4QPQ A;  1V5F A;  2E5N A;  4G6T B;  3PFY A;  3LMM A;  4XOP A;  3DU6 A;  5JHF A;  3K4M A;  4AU7 A;  4IZZ A;  2MD0 A;  2HZD A;  3N05 A;  3LSM A;  5HOO A;  2ZSI B;  1QHH D;  2VJ4 A;  2IGK A;  2DCE A;  2JUG A;  2WAQ A;  4F3Q A;  3ONQ A;  2VQC A;  3SZG A;  3K70 C;  4YRV A;  4C2T A;  4IQJ A;  3D5R C;  3VYU B;  2HPI A;  3W3C A;  4XKW A;  1BR4 A;  3ZCO A;  2M4G A;  1D0Z A;  2VJI A;  3MD2 A;  3RPU D;  2LY1 A;  4BQN A;  4CH7 A;  4BU2 A;  2RQQ A;  3VYR B;  2WAD A;  4LG3 A;  3SDB A;  4ZYA A;  4E4H A;  1WJD A;  2LRE A;  2HVQ A;  3CES A;  3DU5 A;  1HA8 A;  3BLY A;  4ANJ A;  3OYB A;  2L2O A;  3OMY A;  4ITV A;  1DGR M;  2M4K A;  4XOT A;  2BVL A;  3I3L A;  2M7A A;  2IGO A;  3IUO A;  2X51 A;  4HSR A;  2VKH A;  3QYE A;  3OR2 C;  2KDO A;  2R7T A;  3OYL A;  4CCK A;  4AVZ A;  4DGW B;  2V7F A;  3H5R A;  3OIQ A;  2KQR A;  4FAS D;  4XMY A;  1D1C A;  3L2U A;  4BJ5 C;  3DTE A;  1BR2 A;  2CUZ A;  3S93 A;  2K9M A;  1WJE A;  2VJJ A;  4NC8 A;  5LFA A;  2R7R A;  1ERD A;  1FMV A;  5TGT A;  2Q1Z B;  3QOD A;  2X85 A;  4E6K G;  3OYM A;  4BE2 A;  2VKD A;  4YEJ A;  4F92 B;  4HG2 A;  4LIT A;  1VZ0 A;  3A1Y A;  2R7U A;  1Z21 A;  2XF6 A;  2VB6 A;  2QKL B;  3FBI B;  3DQV C;  2Q2E B;  4HST A;  3KEY A;  2XF7 A;  3ZXS A;  2MAB A;  1BOB A;  3L2Q A;  3DPT A;  3TL4 X;  2OV7 A;  1DGW Y;  4BDY A;  2LYC A;  2XAU A;  2XSJ C;  2M0M A;  4E7J A;  1OR7 C;  2KPM A;  2PJR B;  3L2V A;  2A6T A;  4GRI A;  2V26 A;  4PJL A;  3HC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...