1WJ5A

Solution structure of the hypothetical domain of riken cdna 0610009h20
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
120
structure length
120
Chain Sequence
GSSGSSGNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein (RIKEN cDNA 0610009H20)
publication title Solution structure of the hypothetical domain of RIKEN cDNA 0610009H20
rcsb
source organism Mus musculus
total genus 20
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.980 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wj5A01
1WJ5A 4JQFA
chains in the Genus database with same CATH superfamily
4EEFG 2MD5A 4LFUA 2F48A 1P7JA 1Z1DA 1BOAA 2CW0F 2DN0A 5ILSA 2IJLA 2YPRA 2KFDA 5EGOA 2P7VB 2HTSA 1R00A 3L2VA 1X4OA 2JVHA 3R61A 2NXNB 3VDXA 1OR7C 4RGUA 5J40A 3DEUA 4JX5A 1A6QA 3I3LA 3R60A 4XLHA 3TOBA 4HA8A 2VKVA 2G7UA 3IH4A 4AVPA 1KYZA 4HOBA 4AM3A 3DPUA 2WTEA 3D5RC 1X2NA 2E1MB 2BOLA 3H3ZA 1JT6A 2OZUA 2EV5A 3GZ6A 1SAXA 1VQMI 2E34A 5LGTA 1LNWA 1U5TA 1I1SA 5M5XJ 1BR4A 1TLHB 1I3AA 4IVNA 2ESHA 2JUGA 1R58A 2O5RA 2OPTA 4MGRA 1DUXC 5F27A 1KQ0A 2QWWA 1LFUP 3DBHB 4B47A 1YW8A 2NOJB 2QUFA 2ZNZA 1U78A 2EH3A 1BJZA 3BZ6A 5EEGA 5D5UB 4KMFA 5C4XJ 3B6CA 3F8FA 3A4CA 3A01A 1NH3A 3LMMA 1K7AA 2FQ4A 4KYWA 1MJAA 1MJBA 1QQIA 3ZQGA 1MBHA 5KCMA 1TNTA 4I76A 2FA5A 3TO7A 3Q5FA 4Y52J 3S16J 3C1DA 1XSVA 1G3WA 3CP8A 4CDGA 1B59A 5L3CA 5CQGA 3ZQCA 2WC2A 3ESWB 2X6YA 2BY0A 2OTLI 1JTYA 1R5ID 3JRHA 1W1WE 2P5VA 4ENKA 3J80Z 5BOXA 1FOYA 1ONVA 3EETA 3RYRA 2LKXA 2IW5A 2DMQA 1IN4A 4NUBA 2K9NA 5M5YJ 4CO8A 3IRQA 2OA4A 3OYBA 3JRFA 4MIMA 2XKOA 4RAFA 3RI4A 2DA5A 2IGOA 1TWFJ 1UJ8A 4CICA 1P92A 4A6EA 5D4SA 5D8KB 3H3UA 3QPLA 1ORKA 4M74A 1STZA 4UB8C 5TISC 2M8GX 3M8JA 4RAYA 2KIUA 1OFCX 2XSJC 2L54A 2MH9A 2H6BA 4P55A 3N05A 4RAGA 3I4MJ 2Z5UA 5TGTA 3PFIA 2EZHA 2QCOA 3GFLA 4LMYA 1IUFA 3MKYB 2IXSA 3FXMA 3S15J 1BJAA 5GPAA 5LBQA 2V79A 2AO9A 4DYCA 1V5FA 4M3BA 3JRBA 2DT6A 1B72B 2L0KA 2X85A 2GLOA 1XDUA 1ZYRF 1WZ2A 2LYCA 5F0FA 5K1YA 1FP2A 1MBJA 2CQNA 3BCAA 3CC4I 1FIPA 5TJJA 2EV0A 1VQ7I 3CJRB 1EH8A 2E7WA 2OV7A 2E5NA 3LSKA 4ZYHA 1VQLI 4JYKA 1FP1D 3HGYA 3TOAA 1QZEA 4NC7A 1ZQ3P 2LOOA 2JRTA 5L3EA 2EFQA 2Y0MA 3BJ6A 3ZQQA 4CA0A 4D9JA 1ULYA 2O7OA 5DV5A 2DK8A 3ZMTA 1B9NA 2OF7A 4KIGA 3PQKA 5J3LA 1WPKA 2XF7A 2Z1DA 4CZCA 3BLYA 2HQAA 3QQAA 3ONQA 3FXUA 3QP6A 4IRHA 1YQAA 2K86A 3IV5A 4WK8F 2Y75A 5F64A 1MMDA 1LVKA 3H0DA 2WADA 3SZGA 2HI3A 4XOPA 4A3JJ 3K1MA 2CRGA 4BAYA 5C4JJ 2Z3YA 2GQQA 2P0WA 1DDNA 4IHXA 4E7IA 3CMMA 5BS6A 3OWTA 1F1ZA 1TWAJ 3B73A 5H6RA 3I4PA 3TDZC 1KGSA 2VKEA 3VYRB 4M9ZA 1CF7B 3WG7H 2MYSA 1DGRM 2ID6A 3M9AA 4MFEA 1JHFA 1S8NA 1IG7A 3E6MA 2EFNA 2PQ8A 3I59B 3I5UA 3OYDA 4ANJA 2NYXA 1YJWI 1PP8F 2BW3A 1LDKB 1QZYA 2WBMA 4ASNA 3MZYA 4LGWA 2CGPA 5BPIA 4N4OB 4A0XA 2GIZA 1HDPA 1BIBA 2HVQA 3MMYB 3K9TA 2EWNA 3IP4B 2LFBA 4GRIA 3LSMA 2DT7B 2HPIA 4I2OA 2DYRH 1K79A 2VOOA 3KFWX 3R0AA 3IAM2 4BUPA 1X58A 3LQQA 1B72A 2VJIA 2D1HA 2ZJPF 2P8TA 3BR0A 4OOIA 2LF7A 4J01A 1YG2A 2W82A 1MJ9A 1R23A 4C2MJ 2W25A 3I71A 3TW7A 1S72I 3QPTA 3ZP5A 1MBKA 2L7ZA 3HSFA 3SDGA 3E6CC 3IHUA 3CDLA 5EDNA 3MN2A 4XRSG 1PP7U 4E7HA 3CCEI 5ICFA 3F21A 4HLYA 2F5DA 4CXFA 4EJUA 2H1KA 2HQ5A 2LY2A 2ZFUA 4Y3OA 1J5YA 5HDKA 3E5UA 1XCBA 3OYMA 1EKEA 1ZR4A 4LOCA 4R8HA 1Y8QB 2R7VA 2JPCA 3P9IA 3O6BB 3T8TA 3SZPA 2DJIA 1GV5A 2RVCA 3H5NA 4HSRA 3F22A 1PJRA 2ZFWA 4PGGA 1TBXA 3M8EA 1DPRA 2UXNA 3RQIA 2HZDA 3BG3A 3BQYA 3EUAA 2DK5A 1X2MA 3KP2A 3OY9A 3CF2A 2DYSH 3BG5A 3CESA 4D5CA 4CSWA 3GTPJ 3HUGA 3J81K 3JTHA 4A3LJ 2EZIA 2LBFA 4S0HB 2VKHA 3M07A 4B1RA 3I59A 2MSYA 4B48A 3TKYA 4EM1A 3OS2A 1RR7A 1QBJA 1TWGJ 2QVOA 2ZJRF 2HOAA 2X4HA 1G2HA 3QPHA 4QTRA 3HOVJ 1WI9A 1UFMA 2BY3A 2L7MP 3SZTA 3SXYA 2M0CA 4RM3A 4AIHA 2RNJA 1D0YA 5DCMA 2LY9A 2W1OA 2XAFA 2M7BA 2VT2A 1HF0A 1AKHB 3MZHA 1K78B 1XDSA 1R36A 4KIBA 3W6VA 3ABKH 1QNTA 2XGEA 3LFKA 3ML6A 2B9SA 1G3SA 3R4KA 2IPQX 3K0LA 3PL8A 5KVRA 2FSWA 4YRVA 3HHGA 5E3NA 2N8GA 5FGMA 3SYTA 3RPQA 2HYJA 2ZSHB 4I98B 2DW4A 4HSTA 1TTYA 4IZZA 4BE0A 4ZDOA 1TNSA 2R7DA 2EZKA 4RLQA 5HLGA 3FXLA 3GTMJ 2OQGA 3CDHA 5FD5A 4EJVA 5FRNA 4YFNF 4KJZA 3I4NJ 1FBUA 1FJLA 1IAWA 2FRHA 4G7OF 5F08A 2VB6A 4CGZA 1V54H 2W85A 1PUFB 4BGDA 4ZTJA 3C3WA 3PFYA 2HWVA 4IHVA 4F3QA 3WU0A 2RC4A 2PN6A 4OU0A 4IJAA 5ERIA 1YX3A 4A3MJ 2P5KA 5E8GA 2K02A 1BA5A 4O3MA 2CQQA 4A3EJ 3COAC 3WG9A 1IUYA 3CC7I 3E3VA 2LTPA 4LIVA 2VBZA 3CUOA 4NQWA 3MFKA 5FLXZ 4ESFA 3BPVA 2JUCA 3IKTA 5J4YA 2HOTA 1G4DA 4BJTA 2M87A 2JN6A 4WXHA 2OC6A 3TDUC 4YIFA 5FLMJ 1I50J 3HOSA 1K83J 4KN4X 1JUSA 2LK2A 4BE2A 1K78A 3WTXC 2DODA 3BTIA 3FBIB 3KZYA 2CQ7A 2WWYA 1Y39A 5ICGA 5LEJA 4HX8A 4DW6A 3ZPLA 3FKJA 3M3YJ 1N78A 2QEXI 4PFOA 1MMSA 2VBYA 1K4TA 2A6HF 4M3FA 4XRFA 3K4MA 1EV7A 2FD5A 1TT5B 3NARA 3W6KB 2CUJA 3IC7A 1RC9A 4XNFA 1JKPC 1SC7A 3M8FA 5L3BA 1FC3A 2DOEA 3SDBA 3GTGJ 2PX9A 1U8RA 1OMIA 4L9NA 3HPHA 3WTZA 4A5NA 5E1ZB 2LNBA 2VC1A 3TMOA 2CQXA 1LKXA 1U6GA 4C30A 1ENHA 2Q2EB 1LE8A 3P9CA 3ZMVA 3HSRA 4BL0B 2K7LA 3EUHC 3S8PA 4LLGF 2P6TA 3LSPA 1A5JA 1PUFA 1A31A 2Y2ZA 3K6GA 2VLAA 2NS0A 2UUZA 5J6XA 3TGNA 1NHAA 1OLTA 2CO5A 2KPMA 3ERED 1SFKA 2K40A 1PYVA 1KU7A 3S2DJ 3DCFA 3CJNA 1SVMA 3GLXA 3H0GJ 2ZMEA 1Z7UA 1ON2A 4HEA2 1B8IA 1NTCA 2DCEA 2XIGA 3H1CA 3ZXSA 1E3PA 3W2AA 4XIDA 1Z67A 3LQRA 3L00A 5EJCA 4MEXF 1IDZA 4HV6A 4XLEA 3VYSB 3H9GA 3ABLH 3DBRB 2HQRA 2P4WA 4F92B 1QRYA 3K4NA 1YIJI 2FBIA 3JRDA 2QGUA 1ETOA 2BHYA 3H3VK 3FDYA 2B0LA 5EEHA 4OIOF 3ZOBA 2PMZN 3T5XA 3HKZN 3IWFA 1T38A 4MNUA 2DT5A 4II2A 2DA7A 1ZKGA 1FIAA 3HM5A 4ZC3A 4UVCA 3KYLA 3AL0B 3BG9A 1AA7A 1ZGJA 4ZDPA 4BHBA 1X1DA 2X6WA 4BU2A 2DFFA 5B5EC 5CLSA 3K1PA 2O8XA 3D0SA 4BY7J 3ZN0A 3FM3A 1QZZA 1ZREA 2EZLA 2O3FA 3H5RA 2DFEA 3C7JA 1W0TA 3QYBA 3LWFA 2DA3A 3NWTA 3DPTA 1XMKA 3OYFA 2CFOA 2DA6A 2JZYA 2X1EA 2KZGA 4HNUA 3GFJA 5EYRA 1J59A 4DNCA 3I0TA 5H2FC 2ECCA 3PNVA 3FXKA 1ZARA 2HYGD 4KT6A 2JMWA 3GFIA 2A6TA 2X1DA 1SFUA 1V55H 2LY1A 1I3QJ 1P9QC 3FF5A 4IRGA 5F0HA 2WAQN 3S2HJ 3ZQIA 3JR9A 3NQOA 4JOMA 2BYVE 1G3YA 1R4NB 4JP0A 1Z91A 2IA1A 3OYKA 4XM3A 4E7JA 1WVRA 1K6YA 1Z3XA 4GYGA 5EGOB 1UG0A 2LREA 3HXLA 2H8RA 4XK4A 1WJ5A 1MBEA 1IC8A 1TWCJ 1SFEA 2E2HJ 2DDBA 3K4KA 4U88A 3BC8A 4A3DJ 1XN7A 3FXJA 3WTVC 1DP3A 4XLAA 2K5CA 3S1MJ 2TDXA 2WB1N 3KZIC 1MKMA 4RM2A 3ULQB 5GAHJ 5HLIA 5IYBJ 3OYGA 3FMSA 4C2TA 1P4WA 3A1YA 5IT9K 2KIQA 2BGCA 3REOA 3T0YA 1RUNA 1U5TB 4IPAA 5FROA 1OCOH 2XAGA 3FXOA 5FKMA 3OOPA 2M34A 4WX9A 3JRIA 3SQNA 3LA2A 1IGNA 1FMWA 3WTWC 2V1XA 3CP2A 3GYHX 1WJEA 3DLAA 3S32A 1TZLA 1DQUA 4BE1A 1KQ8A 4P9FA 2A68F 5FKNA 2UXXA 1ZRDA 1WJDA 4EJOA 3KEOA 1JJ8C 2FBKA 3I58A 3MQ0A 4U0YA 1XMAA 1UHMA 1RKWA 2PEXA 2Y9ZA 1O3TA 4DOZA 1NG6A 1AWCA 2OZ6A 2RNGA 4BHPA 4HPQA 3CCQI 5CYVA 4KA4A 5CKTA 3F8BA 2KDZA 3BZKA 1YO5C 1LEBA 1ZRFA 1KA8A 1Z9CA 1S3JA 2F4OB 3QYFA 4IRIA 2TCTA 3EYIA 2X1CA 3ZQ7A 1SVOA 1SFXA 4XRSA 1S7OA 3KP5A 2F4MB 2AQEA 3K4CA 2LKPA 4EATA 1O57A 2MGQA 2V7FA 1K4SA 2KRHA 1G59A 1OCCH 3HRMA 1Y1VJ 4YEJA 3SEZA 4AYBA 2CV0A 1J09A 1XGOA 2E60A 2EA4A 1JKOC 2VUMJ 1E0EA 1FY7A 2DO7A 3TW6A 1IV8A 3KEQA 4XR6A 1SMTA 2DOFA 3O2PE 3RPUD 1RETA 2RREA 3FMQA 1IRXA 5GAEJ 1T39A 3BR3A 3GTOJ 2Z2SB 5LHGA 2KHMA 2ZXIA 5JFRA 1AHDP 3RYPA 5JHFA 2VE8A 2FNAA 3B6AA 3IH3A 2ELJA 1IJWC 2M2EA 3ROUA 2CFXA 2MD0A 3OV8A 4Z2YA 4B8XA 2R7ZJ 1J7KA 5HDNA 2L7KA 5EEAA 2OTJI 2M5WA 1T56A 5HLHA 3E7LA 1OCPA 1SFOJ 2EA2A 3I9V2 1BM9A 4TV7A 4CHUA 5AONA 4BBRJ 3HSEA 3ZRGA 1MMGA 2RGVA 4XKBA 1DP7P 2XRNA 4ZYGA 4N9IA 2ZSIB 4PDKA 1Z21A 2NS7A 4DZPA 2Y0SN 5LRSA 3OR1C 3OYLA 2DOAA 4FHTA 4B44A 2HS5A 5A2QZ 3SFIA 2Z99A 2G0EA 3CF5F 3I53A 5JR3A 1HSJA 2QSGX 3J7ZI 4AIKA 1QU3A 2OAZA 3BJAA 1NK2P 2Y48A 2CV2A 1OR7A 4M3DA 2HPMA 1UELB 2V9PA 4XORA 2AS5F 4ZYEA 1T95A 5IPAA 5J1RA 1H9TA 4JK1X 1WJFA 3FWEA 4XQFA 2HTJA 3V4GA 2VXZA 1MDMA 1BOBA 1IN5A 3HL2A 5DUKA 2KDOA 4BXUA 3CCYA 1IN7A 2GOMA 1W7PB 1RR8C 1HCRA 4RGRA 1RKTA 3BCBA 2ZXJA 4F55A 2M9HA 3DKYA 4IXAA 5D4RA 3A2KA 1ACIA 1QVTA 3QAHA 2XASA 2NAZA 4M3GA 2E1OA 3EUKL 3OIPA 1MBGA 2QQ8A 3CUQC 3WHCA 5HDGA 1QA6A 3HRSA 2LVSA 4KT5C 4L5JA 2ZCWA 5AIQA 2ID3A 1AOYA 2V26A 4HZFA 4L9TA 2NNYA 1MD0A 5K5RA 1BR2A 1MW7A 3NRVA 2E5ZA 2HKOA 1KU9A 2EV6A 4L0ZB 2JJ7A 1MIJA 3WODF 2E35A 2BW3B 1LQ1A 2HOSA 4NNJA 3OYHA 1P6RA 1X3ZB 5CVRA 1BC8C 1B1BA 2IGNA 3H9QA 4F7ZA 3AAFA 4A12A 3PUFA 4FETA 4IQ4A 1O3QA 4FX0A 4ABZA 1TC3C 4GGGA 5LFAA 1R71A 2Q0OA 4N9HA 4WXCA 3L2CA 3GLLA 5LLQA 1P4AA 4PJJA 1S7AA 1QPIA 3OOUA 1SVLA 1RRJA 3MVPA 5ILVA 1HDDC 1LB2A 1IXCA 3DKWA 4QIWN 4WCGA 2MW8A 4I01A 4QPQA 4FASD 2XC7A 3TEDA 2MC3A 1TL8A 4A93J 3C2GA 5CVVA 4Y17A 1WHUA 2M8EA 2H27A 2VIXA 1IXSB 3QP5A 2A61A 5K5OA 3J80K 2QA4I 2O6GE 5ED4A 2LG4A 4WF2A 2V1UA 2VQLA 5KAFC 4C2UA 2Y31A 2VXDA 3JSPA 4A3GJ 2ME0A 4NHJA 1Y0NA 1W7PA 4NB5A 3MCZA 4HF1A 3AFHA 1MH4A 1IV6A 3RZOJ 1E17A 1RIOH 1OKRA 2B63J 2AQFA 4NDLA 4DZJA 1DU0A 5L3DA 2GAUA 2C6YA 1DU6A 1ZR2A 2MFZA 3ZR8X 1TQIA 4YIIA 4UB6C 3BTJA 3FK6A 2VJ4A 2G9WA 1L3LA 4V2GA 5EZGA 5ILUA 2LF8A 1FMVA 1YS6A 4I02A 1IZ1A 1USSA 5GP9A 4Z6YA 3HUGB 5E3LA 5LHHA 3OS0A 2L2OA 4BQQA 1XTAA 3GCMA 2FEZA 2H09A 3E1SA 2LBFB 5KNLA 2BV6A 2CH0A 1YLFA 2BE5F 1G3TA 5B66C 2VPLA 4G94A 3GUDA 3I64A 3WU2C 5JVTA 2X48A 4ZYDA 3CCVI 4EGYA 3SFZA 3GF2A 3RDIA 1LDJA 1S7EA 3KIOA 4A2UA 1FTZA 4LG0A 2XAQA 4Q47A 4A5MA 5ICEA 2A5YB 5DCMB 2M1BA 2WAEA 4I0AA 4Y15A 4C9YA 2V1DA 2VBXA 5HNHA 3FXQA 2DFIA 3D5LA 3HG9A 3V8JA 3J81Z 3S1RJ 2L4AA 2ZKZA 3M4OJ 3G1OA 3RCOA 3M1EA 3BT9A 5CQEA 1IN6A 3V7CA 4M72A 3Q0VA 3K4BA 1XGNA 1ZHFA 3R0JA 1J0RA 2NNNA 1J75A 1X19A 3DTKA 4HLXA 2K9MA 2ISZA 2LR8A 2ZO4A 2JA6J 3QOEA 1SAUA 3HTSB 4EGZA 5JHUA 3GEZA 1MGTA 3JRCA 3IKVA 4W1UA 3OYCA 2QKMB 1H89C 2FF4A 2J5OA 3JTGA 4IL6C 4E7SA 4K2EA 3E5QA 3LAJA 2PMUA 4X6AJ 2HU9A 3OYEA 1ETYA 1VQPI 4IEJA 2HGCA 2CG4A 4DYRA 4KMUX 3S3MA 1UCRA 3FHNA 4RB1A 4GDFA 4KISA 3U9GA 1UG2A 2YX7A 3VEPA 4C3IJ 5B3SH 1ETKA 3NEUA 5IYCJ 2ELHA 3JSOA 2ETHA 3HPGA 4BQNA 4LK0F 3KETA 5DD4A 2KJBA 2FQ3A 3MKWB 4BJ5C 2RAEA 4IOCF 3TQNA 5FRMA 1JKRC 4HAMA 4PJMA 1N75A 4GO1A 1RNLA 2HVSA 4EMSA 3CCSI 4J19A 2FOWA 2COMA 3GW2A 4HQEA 4PJLA 1TWHJ 2RV8A 3WGHA 3MKLA 3FIWA 2Y69H 2X9DA 4PK4A 1HKQA 2HDDA 3DTEA 2GXAA 4NQWB 2XSDC 2EILH 2KLOA 3CD6I 3HZJA 2BBYA 4N0BA 2RDPA 3BG6A 1WKMA 2XVCA 1GXPA 4BBSJ 1HQCA 4GCVA 4F91B 4C3JJ 2QM3A 1GLNA 2A69F 1NK3P 2VOPA 2F5VA 1BN5A 2IGMA 3IWZA 4EM0B 3W6JB 1FYKA 3HEFA 2RQPA 3GZNB 1CGPA 3S1NJ 4EV0A 2CUZA 1A36A 3BR2A 1MBFA 3QODA 2XF6A 4CCJA 4CCMA 5AIPA 4A6DA 4HQMA 1OJLA 1FNNA 5GTIC 4UHTA 2O0YA 2P5LC 1F9NA 1XPXA 4P1WA 4FE7A 2R0QC 4RB0A 4ESBA 1DGWY 1T6SA 2OD5A 3PQJA 3V42A 1JI8A 4IKFA 3GO5A 4XLNF 2FOKA 1ZN2A 4CH7A 4XLPF 1LE8B 1OISA 4XOTA 1FWZA 1HLVA 3JAMZ 1IRGA 4HF0A 2AHQA 3S3OA 3GTQJ 1FSEA 1I27A 3Q9VA 1JHHA 2QZ8A 2VQCA 2CUEA 2FMLA 3KEYA 4ZTFA 1VQKI 5HS9A 3FBNB 4U7DA 5M5WJ 1I1GA 3QPSA 4IOAF 2O61A 5J1UA 1T33A 3LSRA 3KLNA 1MNMC 2ZMEB 2V6CA 3OL4A 3ERMA 2CSOA 1B8IB 3V8LA 2NVXJ 4GFBA 4Y7NJ 4UUTA 2W84A 5GAGJ 4BEHA 4BNCA 1W5TA 3PUBA 2IS4A 2NOGA 3RTRA 3CJTB 1BL0A 4MLOA 3ABUA 2YUSA 4ZZLA 1P2FA 2VC0A 1ZGAA 1K61A 4X1EA 1PDNC 2TRTA 4QLCU 3R6SA 4HNTA 1B9MA 4ZDLA 1I39A 4U7BA 1JTXA 3GX4X 2RN7A 4ETSA 1VQ5I 4Y4RA 3F9KA 2M4GA 4G12A 2L4MA 2F5CA 5J8CA 2DMUA 2ACJA 2R7UA 1FZPB 4I7HA 1XS9A 4FQGA 4E6KG 4A3CJ 4D1QA 2D1VA 3E5XA 5D8LB 2PFBA 3BP8A 1FOXA 3LSJA 5E1WA 2CS3A 1R6RA 1ZELA 3JCUC 4YG2F 5H20A 2K9LA 3G71I 4AC0A 1R1UA 4UUSB 2DBBA 4B43A 2WV1A 4CCNA 4LIUA 2WY8Q 4KICA 4M9XA 1HBXG 5BQTA 2DU9A 3E97A 3F3XA 1D8JA 4I0BA 3K1NA 2DPUA 3CZ6A 5HNFA 5HODA 2A07F 2EB7A 2R7RA 2FU4A 1XD7A 2CW8A 3J7AO 3CO7C 3Q0WA 3Q3SA 2KRFA 4OIPF 5GADJ 2CWEA 4UXNA 4M71A 1Z0XA 3NWSA 3CCMI 4Y33A 2IEKA 2XGXA 2ZNYA 1D0XA 4AD9A 2PLYA 1N25A 3H36A 2R93J 4JQFA 3T1BA 1VI0A 1W5SA 1ZG3A 3FMRA 4BQOA 3HBLA 3KP6A 2YU9J 3PIOF 4ON0A 1FT9A 1FBSA 3PNTA 4RAZA 4NBQA 5J8FA 2EJRA 4C3HJ 2O9LA 1J9IA 1ETXA 2ICWG 2YS9A 4KDPA 1KQ9A 1A04A 2Q1ZB 3L9FA 2BVLA 1S5LC 5B1AH 1YRNB 3OS1A 5F04A 4PGHA 1W36D 5DM6F 4XMYA 2KP6A 4UVBA 2DMPA 4XSXF 2VL8A 3EUHA 2I8DA 3U21A 1SD6A 3F0CA 2K9QA 3BPXA 2JK3A 3KP7A 3ABMH 5DD8A 2LH9A 3C2BA 4B09A 1ETQA 2D2WA 2MG4A 4DJAA 2NVQJ 1SMYF 2R7OA 2WA0A 4HV5A 3N4MA 2F5EA 4AU7A 4B4CA 5M3FJ 4UY8I 1J2XA 2Y9YA 1QHHD 4BYYA 4UUSA 5HLTA 3OIOA 3G1LA 5K7FA 4WXDA 2FUG2 2QSFX 4V2FA 3ZMDA 2O8KA 2O03A 2PI0A 3VSLA 2K3PA 2V9KA 3L2RA 1M1EB 1U2WA 1FPQA 3FK7A 4A69C 4KUMA 3A0BC 5E79C 2BHZA 1ERDA 3DWLE 4AIJA 2XV4S 3F8CA 3QWLA 1HC8A 2H8WA 1FEXA 1HOMA 2KL4A 2AXTC 2X6XA 1ZG5A 3RKYA 2K4BA 2L01A 1JKQC 2BVMA 3GMEA 3KCCA 4XSZF 5IYDJ 1ODDA 2XROA 3OL3A 4EM2A 1WSUA 5E20A 1H9GA 1ZTRA 2EBIA 3L2QA 3BTLA 3BR6A 1S6LA 3M7GA 1Z6RA 3HYIA 5E8IA 3DPLC 2R5YB 2LC2A 4A3FJ 3SJMA 4CYCA 2ZJQF 4E7LA 3S17J 3S3NA 2L9NA 2CW7A 2AXLA 1X3WB 1YRNA 2JTVA 2VJ5A 1VQ8I 2VQGA 3V7RA 4XONA 2XAUA 3CMYA 2QYOA 5HS7A 2NVUB 1WFXA 4RGSA 2D5VA 2E19A 1WJAA 2IAIA 1WCMJ 2KRCA 2DLLA 3HRUA 3TO6A 3UKGA 4OINF 5BMZA 4A0YA 2F4IA 3F72A 4ZH4F 2Z9OA 3K69A 2QBYB 1GHCA 1YTYA 3LA3A 2A5WA 1UHSA 5E3OA 1O7FA 3TL4X 2KIFA 2FMYA 2L9VA 2V6EA 2HFHA 2ESNA 6PAXA 2PJPA 1TQMA 2HNHA 3CJQB 2M3AA 1JUPA 4BDZA 1IRFA 3MD2A 4HYEA 4M3EA 4RLFA 5DCFA 1I6HJ 1X3UA 2MBFA 3VB2A 3A0HC 3ZMSA 5D5VB 3HOWJ 2ZJ2A 2UV1A 2E7XA 3DU6A 3FISA 1GXQA 1Y0UA 5IOZA 2GA1A 2JT1A 4PZJA 4F52A 1LUJB 1OCRH 1YX5A 5C3EJ 3P7NA 4GYIA 1BI1A 4HW0A 1AU7A 4RMNA 1MDMB 1MNDA 4XN0A 5DEQA 3HC7A 4BQAA 3K10A 2ISYA 2M4KA 1WRJA 5EG0A 4AWXB 4L0YB 1GUUA 4I6ZA 1E3OC 3CCRI 2HXIA 2IS1A 1BI2A 2IBDA 2DI3A 3UR3C 4DIQA 2R7QA 5FD6A 1BW5A 1W36C 4RA2A 5HOOA 2R5YA 3WTYC 2HDWA 3LOCA 5E3MA 1VQNI 1UHWA 3Q0UA 4S05A 4YELA 2L9RA 5D6EA 3PO3J 3K2AA 4H0EA 4PJ0C 4XKWA 2E1CA 3BOQA 1YOVB 4HX7A 4L5EA 1XB4A 1T0FC 2XPUA 3KE2A 4ENNA 3ZQFA 1A35A 1YHQI 2HQNA 3PSFA 3MKZA 3I55I 4G6DA 4IHTA 3FXRA 3W3CA 3LL7A 2W57A 4I09A 3DQVC 1FLIA 3AKZA 5TRDA 2CU7A 2EFPA 2EFWA 2L3DA 2GBYA 2CUFA 4MTDA 5DUIA 2FX0A 4MEYF 1IO2A 3PM1A 1VTNC 1KU3A 2KMUA 2QBYA 3FHZA 2R92J 3BY6A 3S14J 4AUXA 1R49A 3RSNA 3KPHA 4BDYA 4QPOA 4FX4A 2HDCA 1LFBA 2HZTA 3HOZJ 2MH2A 4M6XA 2Q8KA 3OSGA 1H8AC 2Z16A 1QHGA 3OYJA 1V5GA 4ZZDA 2QF7A 1U0JA 1X1BA 2COBA 4UUVA 2EINH 1H0MA 2ECBA 1D1AA 3CUQB 1I6XA 1LFPA 5K7HA 2D45A 3AG2H 3MWMA 2OU2A 2IP2A 3G4SI 1W0UA 4G7ZF 1KYWA 2NRAC 3RZDJ 3GBGA 2JA7J 5JLXA 1T0FA 3B02A 2V1NA 2V9VA 1H88C 1IW7F 2R4GA 2XKPA 2ZB9A 2VJJA 3BR1A 3F8NA 3ISPA 4YIRX 1HW1A 5FFZA 2UZKA 4LLLA 5B1BH 1FYLA 2MLGA 4DBRA 2R7SA 3VODA 4ENJA 3OSFA 2E1MC 3FM5A 3AG4H 3HOXJ 2G7HA 2Y30A 2IVMA 4JX4A 2OQRA 2WY7Q 4UV8A 5IP9J 4KN7X 1Z77A 3IL2A 4KIFA 1XCVA 4HG2A 4CCOA 5F1JA 1T98A 4A3KJ 1BW6A 4D5FA 1BC7C 3SHFA 2B7EA 3OYNA 1U9NA 5HS8A 2OJED 5CVUA 5IOYA 1R22A 3F6VA 1V3FA 3DP7A 3OYIA 3Q9SA 5EF6A 2M30A 5DS9A 2DMTA 3HB9A 5K7ZA 3LAPA 1G8XA 4QWQA 1EH6A 2BXYA 4QSHA 1LDDA 4PSXA 4FCYA 4IO9F 4OMZA 3L1PA 1Q1HA 1X1PA 5DYMA 3HOTA 1YJ9I 2DDAA 2JWTA 5A2QK 3F6OA 1OYWA 5DTDA 3L2WA 4LG0B 4WWCA 3K70D 1MMAA 1SD7A 1YW9A 1WWXA 3GTLJ 3S2WA 3HHHA 3ZMZA 4OMYA 2F6CA 1JE8A 1PUEE 5FKLA 3ZN1A 1HKTA 2X0LA 1KONA 4IF4A 2FBHA 2W00A 1YFHA 3GXOA 1O3RA 1HW2A 3G3ZA 3PNYA 3MEXA 5J47A 4PCQA 4II3A 3CUQA 2XAHA 4CCLA 1YS7A 1NG7A 1WJBA 3CO6C 3VSKA 4MFDA 5LHIA 2XGDA 3BZCA 1Y1WJ 1SD5A 1LEAA 3BDDA 4I99C 3T8RA 3PO2J 4Q48A 2PMZA 1SANA 1Z7LA 4GXOA 1F43A 4JBAA 1YIOA 3HGGA 2LRDA 1D5VA 5KK1A 1R1TA 3HKZA 2MC4A 4EVIA 3GVAA 2GM4A 3VYTB 2H94A 3DEWA 3CTAA 5JI6A 3TO9A 4ESJA 4ENMA 1MMNA 4M73A 3P9KA 4F93B 2XGCA 1D1CA 3WTSC 3JRGA 5LRRA 1ZRCA 1R5GA 3A02A 3H92A 4R79A 5DDGA 4Q5SF 2X51A 3AG3H 2MABA 1FSHA 1BIAA 1X4PA 4MO7A 3PJRA 2EIKH 1S29A 1UB9A 1HA8A 1V5EA 2VBWA 3E6BA 3UNGC 5L3FA 4IHWA 1GT0C 3J7AY 4HDVA 2NVTJ 3KYCB 5CVJA 1EF4A 2W7NA 1ZK8A 5E18F 5C44J 1IXRC 1D1BA 1YJNI 1P4XA 2QQAA 2JRMA 1LJ9A 4S04A 4DYQA 1X1CA 3NAUA 3AG1H 1TW2A 1GVDA 3U2RA 2FJ1A 4J00A 2VONA 2WAQA 2A05A 3E0JB 3F8MA 4X0GA 3W2WA 3CQZJ 4E70A 3ZQHA 1POGA 3ABTA 4NC8A 4EJWA 3RPUA 3CMAI 3QOPA 3EYYA 5CPRB 2LP0A 1APLC 3ASOH 1WI3A 2XUBA 3G2BA 3O8GA 4A3IJ 1OPCA 2A3SA 2VQHA 3I56I 1WGXA 4L9VA 1KZHA 3MAJA 4BS9A 2CYYA 3ZCOA 2IT0A 4PUSA 1R5HA 1IN8A 2DA2A 1USTA 2L5QA 2XB0X 4YFKF 4ITVA 2JA5J 2WB1A 2KIMA 1UAAA 1REPC 2P81A 3U1DA 2IRFG 2OCEA 2ZXWH 1HXDA 3DKXA 2R3SA 1V4RA 3BROA 3E6DA 1RESA 2FNPA 1E2XA 3QU3A 1Y6IA 3WHBA 4NC6A 2EIJH 4G9YA 3JREA 2JA2A 1ZLKA 1F36A 1U8BA 2DA4A 4PSWA 5ICCA 2BZTA 3HRTA 2HOEA 4E7ZA 2QLZA 1XSDA 2H6CA 3OIQA 4H4KC 2QQBA 3OMYA 3P5JA 4CZZA 3VPRA 4HBLA 4A3BJ 1BI3A 2EFOA 2GXGA 1C0WA 4CCKA 2E1NA 2QENA 4LB6B 2KISA 5EZHA 1T08B 1R9TJ 3K70C 4BEHB 1ZG1A 1T8IA 4AIDA 1XC5A 2LLKA 4KFCA 3V7SA 4RBOA 2OBPA 1FTTA 2M7AA 4DBQA 3RJPA 2R7FA 4CUGA 3WE2A 2VN2A 1ZGWA 4OIRF 5FKKA 1OCZH 2J5PA 2BEOA 3BJOA 2M45A 2E2JJ 2R7XA 3KYDB 1VZ0A 5DM7F 2LSOA 4G8XA 1VNDA 1CF7A 2XHKA 2PBIA 1B4AA 3O3KA 2E36A 1XGSA 3QU6A 2I5UA 3G1MA 4R1HA 3WE3A 3VWBA 4HRIA 2WAFA 3CLOA 3K4JA 3VOEA 1HKSA 1QVUA 1ETWA 1FBQA 3FKIJ 5FLVA 5KAIC 3RKQA 3IUOA 1RUOA 2DFHA 2I10A 3KX2A 1HW5A 4OWRB 2DMNA 2F2EA 2WV0A 4OAYA 4BJ6C 4BH9A 2GIVA 2K27A 2OUMA 1EH7A 1O7LA 4MQVA 2X6OA 3H35A 4DQ2A 1MZBA 1GV2A 1YYVA 2L9SA 2UWMA 2K85A 1VF9A 3GZ5A 1YI2I 1D0ZA 5J1YA 1MSFC 1BBYA 1WJCA 1SD4A 1XMXA 3I54A 2JPBA 4AYBN 3HOUJ 5KHDA 2BY2A 4G7HF 4JX6A 1W5CC 2CQKA 3D5SC 3IAS2 4D0PA 4MQ9F 2Y0SA 1FOKA 2LDUA 2KKOA 2YR2A 2CV1A 2GZWA 1QGPA 5GTHC 2XDVA 2HKXA 4U0VA 4BACA 2EPFA 4B3XA 2Z33A 2R5ZB 2GA2A 4O5VA 3FZVA 4ZJZA 2QKLB 2JVGA 2MA3A 1R7JA 4FT8A 3J7YJ 1BR1A 4L18B 1OYIA 1R4MB 1TT0A 1A6IA 1IRZA 1JGGA 1JGSA 3C2HA 3TP3A 3TBIA 2VT3A 3CMEI 5JLWA 2YSRA 2V4JC 2BXZA 1OYYA 1PVEA 4BHCA 4XRMA 4LB5A 2BY1A 1QPMA 2IA2A 3QRFF 2HEOA 1JJ6C 4D7MA 2GOXB 1DPUA 2QQ9A 4E4HA 3FX3A 3RIRA 5H6QA 1N77A 1XX5A 2GXBA 4LJZF 2W24A 1B6AA 1RI7A 1TP4A 2RKHA 3DBLB 4FE4A 3F23A 1FOWA 4L9JA 5JVGF 4M6YA 3K4LA 2HXOA 3CCUI 1YW7A 5FFXA 1O3SA 3JAMK 2ZXHA 2R7TA 3C18A 3EPZA 3CCJI 1AKHA 3MZ8A 3PIPF 4V19K 4KITB 2KJCA 5E17F 4YFXF 2IGKA 3BQZA 3BTCA 1VQ9I 2ZMEC 4LD5A 4DGWB 1QO0D 4D7NA 5J4VA 4EQQA 1EA3A 3LSHA 5FJ8J 4W97A 4XBFA 2VASA 2HR3A 4OIQF 2JSCA 3WGGA 2DXIA 1FX7A 2IS2A 2PJRB 2VI6A 2M0MA 1TW3A 4IX7A 2W4SA 2IA0A 3EDPA 4Y13A 1XG1A 3DXJF 3ZGKA 5M3MJ 5CJ9A 5LGUA 4UV9A 2R5ZA 4BY1J 3D1NI 1K6OA 5FLXK 1U3EM 3HJEA 1Q1VA 1I5ZA 2PG4A 3S1QJ 4M9SA 1OQYA 3KLOA 4ZYAA 1F4KA 1WH5A 1HSTA 1D8KA 1FYMA 2STWA 4O6JA 1G6NA 4PFPA 1VQ6I 3BWGA 4CYCB 3ZQLA 2CJJA 4RB2C 4UVAA 2ELKA 9ANTA 4N4NB 5F1RA 3CDIA 2E2IJ 1Y56A 5IP6A 4UNOA 1Z6TA 1Z05A 2KZVA 2ADUA 3WTTC 3SEQA 4LITA 4HNVA 2XB5A 1ETVA 4MHGA 3M1CA 2F5FA 4L5IA 3ZMUA 4BXXJ 1JUMA 3KZZA 4BKXA 2KT0A 5IP7J 3IRRA 2HYFA 2P7CB 1UMQA 2ZBKA 3PSIA 1BI0A 1YITI 4AVZA 4IHSA 2IS6A 3K7AJ 2XPWA 5K5QA 1ITYA 2P6SA 4HDUA 4HF2A 1P7IA 1IF1A 1RPWA 3ELKA 4RS8A 5LD2C 1TQPA 1RZ4A 4LLNA 3GFMA 4B3AA 4CYDA 3H5AA 3JRAA 2DQLA 5IT9Z 2EIMH 2LMDA 1O4XA 3VYUB 2VODA 2OCCH 2L7FP 2MLKA 3L2UA 1MNEA 3QYEA 2RQQA 3W2VA 1EJ9A 4RDUA 4OAZA 1LPQA 3RQ4A 2PJRA 1GVJA 3RKWA 5FO5A 3GTJJ 3N97A 2VKDA 2KQRA 3ASNH 3L7WA 3L09A 5EG0B 1XGMA 4IHYA 2K9SA 2R7WA 2JA8J 5D5WB 1S9HA 4A0ZA 1VQ4I 1VFCA 2E71A 3KP3A 5HVQC 3WTUC 3G73A 1ON1A 2Q2EA 2JQ7A 2EQRA 5BPDA 3G6EI 5IY5H 2FXAA 3HOYJ 1UZCA 2ZC2A 5LEKA 3A03A 3AL0C 1YE9A 5CVIA 3U1KA 1Z3YA 2DJNA 4LK1F 3OYAA 1F5TA 4EJTA 1OCTC 2STTA 1GDTA 4KNYA 3DLLF 3CLQA 1W4MA 1KU2A 4XN3A 2K3FA 2PMHA 1ZLJA 4RB3C 3X2QH 5IT3A 3V8KA 4FTHA 1WH7A 1MSEC 4BXFA 3ECHA 1U9OA 3KP4A 3JW4A 4XLFA 5GPCA 4XL9A 4XKVA 2DAOA 1VQOI 1E3HA 5F6FA 2L02A 3DFGA 4MTEA 1IDYA 4HX4A 2K4JA 1WQ2A 1Y8RB 2H1LA 3DU5A 2XF5A 1D5YA 2DA1A 3RKXA 2DTRA 5FKOA 2XAJA 4XKCA 3LSTA 2YU3A 5LGNA 3O8HA 2A6EF 1JT0A 2XPVA 2ME6A 5E1XA 3LNQA 2W48A 1ZAOA 4XLCA 1T2KA 2JSPA 3K2ZA 1JXSA 4U87A 1D3YA 4P5OA 3CCLI 4LG3A 1W7PD 3DTIA 4Q4ZF 2HVRA 2NS8A 4U0WA 1ZH5A 5F0CA 3WGIA 3GTKJ 3LSGA 3A01B 3LSIA 2YX4A 4PJNA 4G6QA 2DQRA 3GWZA 3VFZA 1XSXA 1LVAA 3H9JA 3HTUA 4XICA 2QSHX 3BG7A 3DF8A 5BNGA 4FISA 1X1AA 4P96A 2DTZA 3HDDA 3CC2I 2FE3A 1R1VA 3EQLF 3HIFA 3OR2C 4P9UA 2VPRA 1U5TC 3TP0A 4IQJA 5L3GA 3BR5A 2NVYJ 2CMPA 2LKSA 5FB2A 5D6FA 3IH2A 3ECOA 3WU1B 3LA7A 4G6TB 4E7KA 1L0OC 2LD5A 2DPDA 3LFUA 3DV8A 1CQTA 2EK5A 3S93A 1SEUA 2GWRA 3DEEA 2VE9A 4M6VA 2XRLA 1MH3A 5D5XB 4RGXA
chains in the Genus database with same CATH topology
4CCJA 3FDYA 4CCMA 4F93B 1D1CA 4R79A 4P1WA 3L2VA 1X4OA 2JVHA 2X51A 4II2A 1OR7C 1DGWY 2MABA 3V42A 3VDXA 1JI8A 1X4PA 4IKFA 4ZC3A 3AL0B 3KYLA 3PJRA 1AA7A 4ZDPA 3I3LA 1X1DA 2X6WA 4XLHA 1HA8A 1V5EA 3UNGC 4BU2A 4CH7A 3J7AY 3DPUA 4XOTA 3D5RC 2E1MB 2BOLA 3S3OA 3H5RA 2W7NA 3QYBA 2VQCA 3NWTA 1D1BA 1BR4A 3DPTA 3KEYA 3OYFA 2CFOA 4ZTFA 2X1EA 3FBNB 2JUGA 1X1CA 2O5RA 4HNUA 4B47A 4J00A 3OL4A 2WAQA 4X0GA 3E0JB 2NOJB 3W2WA 3PNVA 4KT6A 4NC8A 2A6TA 5CPRB 2X1DA 4BEHA 3PUBA 2IS4A 3A4CA 3G2BA 3RTRA 2LY1A 2VQHA 3LMMA 4MLOA 1P9QC 4BS9A 3ZCOA 4PUSA 2L5QA 4JOMA 5KCMA 4ITVA 4HNTA 3OYKA 2WB1A 4XM3A 4ZDLA 4E7JA 1UAAA 3CP8A 4U7BA 1K6YA 1Z3XA 5CQGA 1UG0A 2LREA 3HXLA 4Y4RA 3F9KA 2M4GA 1WJ5A 2X6YA 3DKXA 3K4KA 3BC8A 2R7UA 1DP3A 4XLAA 2K5CA 4E6KG 4D1QA 4RM2A 1Y6IA 3OYGA 4C2TA 3A1YA 2JA2A 4PSWA 2CS3A 1R6RA 1ZELA 4E7ZA 4NUBA 2K9LA 3OIQA 4H4KC 5FROA 3OYBA 4B43A 4CCNA 3OMYA 4LIUA 2WY8Q 2IGOA 1FMWA 3CP2A 1WJEA 3DLAA 3S32A 1TZLA 4CCKA 1DQUA 3CZ6A 3M8JA 5HNFA 4BE1A 2XSJC 2R7RA 2CW8A 3K70C 4BEHB 3N05A 1WJDA 5TGTA 2M7AA 4DBQA 4CUGA 3NWSA 4DOZA 1NG6A 4Y33A 1D0XA 2RNGA 2IXSA 3MKYB 4HPQA 2R7XA 4JQFA 1VZ0A 5CKTA 1V5FA 2DT6A 4BQOA 2X85A 4HRIA 3QYFA 3VWBA 3PNTA 2WAFA 3K4JA 2LYCA 2X1CA 3BCAA 3IUOA 3KX2A 2Q1ZB 2AQEA 2BVLA 3CJRB 2OV7A 2E5NA 3K4CA 3LSKA 4OWRB 3OS1A 4EATA 2V7FA 1W36D 4BJ6C 4OAYA 2KRHA 4NC7A 1G59A 2LOOA 4XMYA 2OUMA 4YEJA 3SEZA 2KP6A 4AYBA 2CV0A 3H35A 1J09A 2E60A 1E0EA 3ZQQA 4CA0A 2VL8A 4D9JA 2I8DA 2L9SA 2UWMA 3U21A 4XR6A 3RPUD 2RREA 1IRXA 1D0ZA 2Z2SB 2KHMA 1WJCA 2ZXIA 2XF7A 2Z1DA 4CZCA 3BLYA 2HQAA 3ONQA 5JHFA 2LH9A 5KHDA 2ELJA 3IAS2 2MD0A 3D5SC 4DJAA 2R7OA 2WA0A 2L7KA 4AU7A 2Y0SA 1MMDA 1LVKA 3H0DA 2WADA 3SZGA 4XOPA 1QHHD 2CV1A 2P0WA 5HLTA 3I9V2 4E7IA 3CMMA 2XDVA 3OWTA 3ZRGA 1MMGA 2FUG2 4XKBA 3VSLA 4BACA 2K3PA 2V9KA 2ZSIB 4B3XA 1Z21A 3L2RA 3VYRB 3OR1C 3OYLA 4ZJZA 2MYSA 1DGRM 2DOAA 2QKLB 4B44A 2JVGA 1ERDA 3DWLE 3OYDA 1BR1A 4ANJA 2BW3A 1LDKB 1TT0A 2WBMA 3C2HA 1QU3A 4N4OB 3TBIA 2HVQA 3MMYB 2CV2A 2KL4A 2X6XA 3IP4B 2HPMA 4GRIA 3LSMA 1UELB 2DT7B 2HPIA 4XORA 2V4JC 2BVMA 1T95A 3OL3A 3IAM2 4BUPA 3L2QA 1WJFA 4XQFA 2VXZA 2VJIA 1BOBA 3DPLC 2LC2A 3HL2A 2GOXB 2KDOA 4E4HA 4J01A 1N77A 4E7LA 2W82A 3S3NA 2L9NA 2GOMA 2CW7A 3BCBA 2VJ5A 4F55A 2VQGA 4XONA 3DKYA 3A2KA 2XAUA 3K4LA 1WFXA 4E7HA 3EUKL 3OIPA 1WJAA 2KRCA 2R7TA 2ZXHA 3EPZA 2LY2A 2ZFUA 4Y3OA 4KITB 3OYMA 2IGKA 2F4IA 2V26A 4DGWB 2R7VA 2A5WA 1EA3A 3LSHA 3TL4X 2VASA 1BR2A 2DJIA 2V6EA 1MW7A 2E5ZA 2DXIA 3H5NA 4HSRA 2IS2A 2PJRB 2M0MA 2HNHA 3CJQB 2W4SA 1PJRA 4IX7A 2M3AA 2BW3B 4BDZA 4NNJA 3MD2A 4RLFA 2HZDA 3OYHA 3EUAA 3H9QA 2IGNA 3ZGKA 3OY9A 3CF2A 4FETA 4IQ4A 2UV1A 3CESA 4CSWA 3DU6A 5LFAA 2LBFA 4F52A 1YX5A 2VKHA 4ZYAA 4PJJA 4B48A 4RMNA 3OS2A 1MNDA 3OOUA 4XN0A 3HC7A 4PFPA 3K10A 2M4KA 4N4NB 1Y56A 4QPQA 4FASD 2XC7A 2KZVA 4RM3A 3C2GA 2IS1A 1D0YA 2VIXA 3SEQA 4LITA 3UR3C 4DIQA 2R7QA 3M1CA 2W1OA 1W36C 2M7BA 2LG4A 5HOOA 2HDWA 2VQLA 4C2UA 2VXDA 4YELA 4XKWA 3PL8A 3PSIA 3AFHA 4YRVA 1T0FC 4AVZA 3PSFA 3SYTA 2AQFA 2IS6A 3MKZA 2ZSHB 3W3CA 3LL7A 2MFZA 4HSTA 3ZR8X 4IZZA 4BE0A 4ZDOA 3DQVC 3AKZA 5LD2C 4RLQA 2VJ4A 3H5AA 1FMVA 5FRNA 2KMUA 4KJZA 3VYUB 3HUGB 3OS0A 3RSNA 2L2OA 3L2UA 4BQQA 1MNEA 3QYEA 2RQQA 3E1SA 2LBFB 3W2VA 4BDYA 4OAZA 4QPOA 5KNLA 2CH0A 3RQ4A 2PJRA 2Z16A 1QHGA 3OYJA 1V5GA 2VPLA 2VB6A 2VKDA 2KQRA 1U0JA 1X1BA 4BGDA 4ZTJA 3PFYA 4F3QA 1D1AA 2R7WA 1LFPA 1S9HA 1YX3A 5HVQC 2WAEA 4C9YA 3GBGA 2V1NA 2R4GA 2VJJA 3AL0C 1YE9A 4LIVA 5HNHA 1Z3YA 3D5LA 3HG9A 3OYAA 3RCOA 4DBRA 5CQEA 2R7SA 2E1MC 3K4BA 4XN3A 4BJTA 2WY7Q 1X19A 3DTKA 2K9MA 2OC6A 4HG2A 4CCOA 3QOEA 1SAUA 3HOSA 3OYNA 4BE2A 4BXFA 3FBIB 3OYCA 2QKMB 4XLFA 4E7SA 1N78A 3FKJA 3OYIA 4XL9A 4XKVA 4PFOA 2HU9A 3OYEA 3K4MA 2CUJA 3DU5A 2XF5A 1G8XA 4XNFA 4XKCA 3S3MA 4PSXA 3SDBA 3FHNA 4KISA 3HOTA 3HPGA 4BQNA 3HPHA 4XLCA 2JSPA 3TMOA 3L2WA 3MKWB 4BJ5C 5FRMA 1LKXA 3K70D 1MMAA 4U87A 4P5OA 4PJMA 1N75A 4C30A 4LG3A 2HVSA 2Q2EB 2F6CA 4BL0B 3DTIA 2HVRA 3EUHC 3S8PA 4PJLA 1KONA 2W00A 3LSGA 3PNYA 3K6GA 3LSIA 4PJNA 2UUZA 2VLAA 4PK4A 3DTEA 4NQWB 1OLTA 3H9JA 4II3A 2KPMA 2KLOA 1SFKA 3BG7A 4CCLA 1PYVA 1X1AA 3BG6A 1NG7A 1WJBA 3OR2C 4HEA2 3VSKA 4F91B 2DCEA 3ZXSA 1GLNA 4IQJA 3W2AA 2CMPA 4E7KA 2F5VA 4XLEA 4G6TB 3VYSB 2IGMA 1Z7LA 2PMZA 3H9GA 3LFUA 2LRDA 3HKZA 4F92B 2MC4A 3K4NA 3S93A 3VYTB 3DEEA 2CUZA 3QODA 1MMNA 2XF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ5 A;  4JQF A; 
#chains in the Genus database with same CATH topology
 4EEF G;  2MD5 A;  4LFU A;  2F48 A;  1P7J A;  1Z1D A;  1BOA A;  2CW0 F;  2DN0 A;  5ILS A;  2IJL A;  2YPR A;  2KFD A;  5EGO A;  2P7V B;  2HTS A;  1R00 A;  3L2V A;  1X4O A;  2JVH A;  3R61 A;  2NXN B;  3VDX A;  1OR7 C;  4RGU A;  5J40 A;  3DEU A;  4JX5 A;  1A6Q A;  3I3L A;  3R60 A;  4XLH A;  3TOB A;  4HA8 A;  2VKV A;  2G7U A;  3IH4 A;  4AVP A;  1KYZ A;  4HOB A;  4AM3 A;  3DPU A;  2WTE A;  3D5R C;  1X2N A;  2E1M B;  2BOL A;  3H3Z A;  1JT6 A;  2OZU A;  2EV5 A;  3GZ6 A;  1SAX A;  1VQM I;  2E34 A;  5LGT A;  1LNW A;  1U5T A;  1I1S A;  5M5X J;  1BR4 A;  1TLH B;  1I3A A;  4IVN A;  2ESH A;  2JUG A;  1R58 A;  2O5R A;  2OPT A;  4MGR A;  1DUX C;  5F27 A;  1KQ0 A;  2QWW A;  1LFU P;  3DBH B;  4B47 A;  1YW8 A;  2NOJ B;  2QUF A;  2ZNZ A;  1U78 A;  2EH3 A;  1BJZ A;  3BZ6 A;  5EEG A;  5D5U B;  4KMF A;  5C4X J;  3B6C A;  3F8F A;  3A4C A;  3A01 A;  1NH3 A;  3LMM A;  1K7A A;  2FQ4 A;  4KYW A;  1MJA A;  1MJB A;  1QQI A;  3ZQG A;  1MBH A;  5KCM A;  1TNT A;  4I76 A;  2FA5 A;  3TO7 A;  3Q5F A;  4Y52 J;  3S16 J;  3C1D A;  1XSV A;  1G3W A;  3CP8 A;  4CDG A;  1B59 A;  5L3C A;  5CQG A;  3ZQC A;  2WC2 A;  3ESW B;  2X6Y A;  2BY0 A;  2OTL I;  1JTY A;  1R5I D;  3JRH A;  1W1W E;  2P5V A;  4ENK A;  3J80 Z;  5BOX A;  1FOY A;  1ONV A;  3EET A;  3RYR A;  2LKX A;  2IW5 A;  2DMQ A;  1IN4 A;  4NUB A;  2K9N A;  5M5Y J;  4CO8 A;  3IRQ A;  2OA4 A;  3OYB A;  3JRF A;  4MIM A;  2XKO A;  4RAF A;  3RI4 A;  2DA5 A;  2IGO A;  1TWF J;  1UJ8 A;  4CIC A;  1P92 A;  4A6E A;  5D4S A;  5D8K B;  3H3U A;  3QPL A;  1ORK A;  4M74 A;  1STZ A;  4UB8 C;  5TIS C;  2M8G X;  3M8J A;  4RAY A;  2KIU A;  1OFC X;  2XSJ C;  2L54 A;  2MH9 A;  2H6B A;  4P55 A;  3N05 A;  4RAG A;  3I4M J;  2Z5U A;  5TGT A;  3PFI A;  2EZH A;  2QCO A;  3GFL A;  4LMY A;  1IUF A;  3MKY B;  2IXS A;  3FXM A;  3S15 J;  1BJA A;  5GPA A;  5LBQ A;  2V79 A;  2AO9 A;  4DYC A;  1V5F A;  4M3B A;  3JRB A;  2DT6 A;  1B72 B;  2L0K A;  2X85 A;  2GLO A;  1XDU A;  1ZYR F;  1WZ2 A;  2LYC A;  5F0F A;  5K1Y A;  1FP2 A;  1MBJ A;  2CQN A;  3BCA A;  3CC4 I;  1FIP A;  5TJJ A;  2EV0 A;  1VQ7 I;  3CJR B;  1EH8 A;  2E7W A;  2OV7 A;  2E5N A;  3LSK A;  4ZYH A;  1VQL I;  4JYK A;  1FP1 D;  3HGY A;  3TOA A;  1QZE A;  4NC7 A;  1ZQ3 P;  2LOO A;  2JRT A;  5L3E A;  2EFQ A;  2Y0M A;  3BJ6 A;  3ZQQ A;  4CA0 A;  4D9J A;  1ULY A;  2O7O A;  5DV5 A;  2DK8 A;  3ZMT A;  1B9N A;  2OF7 A;  4KIG A;  3PQK A;  5J3L A;  1WPK A;  2XF7 A;  2Z1D A;  4CZC A;  3BLY A;  2HQA A;  3QQA A;  3ONQ A;  3FXU A;  3QP6 A;  4IRH A;  1YQA A;  2K86 A;  3IV5 A;  4WK8 F;  2Y75 A;  5F64 A;  1MMD A;  1LVK A;  3H0D A;  2WAD A;  3SZG A;  2HI3 A;  4XOP A;  4A3J J;  3K1M A;  2CRG A;  4BAY A;  5C4J J;  2Z3Y A;  2GQQ A;  2P0W A;  1DDN A;  4IHX A;  4E7I A;  3CMM A;  5BS6 A;  3OWT A;  1F1Z A;  1TWA J;  3B73 A;  5H6R A;  3I4P A;  3TDZ C;  1KGS A;  2VKE A;  3VYR B;  4M9Z A;  1CF7 B;  3WG7 H;  2MYS A;  1DGR M;  2ID6 A;  3M9A A;  4MFE A;  1JHF A;  1S8N A;  1IG7 A;  3E6M A;  2EFN A;  2PQ8 A;  3I59 B;  3I5U A;  3OYD A;  4ANJ A;  2NYX A;  1YJW I;  1PP8 F;  2BW3 A;  1LDK B;  1QZY A;  2WBM A;  4ASN A;  3MZY A;  4LGW A;  2CGP A;  5BPI A;  4N4O B;  4A0X A;  2GIZ A;  1HDP A;  1BIB A;  2HVQ A;  3MMY B;  3K9T A;  2EWN A;  3IP4 B;  2LFB A;  4GRI A;  3LSM A;  2DT7 B;  2HPI A;  4I2O A;  2DYR H;  1K79 A;  2VOO A;  3KFW X;  3R0A A;  3IAM 2;  4BUP A;  1X58 A;  3LQQ A;  1B72 A;  2VJI A;  2D1H A;  2ZJP F;  2P8T A;  3BR0 A;  4OOI A;  2LF7 A;  4J01 A;  1YG2 A;  2W82 A;  1MJ9 A;  1R23 A;  4C2M J;  2W25 A;  3I71 A;  3TW7 A;  1S72 I;  3QPT A;  3ZP5 A;  1MBK A;  2L7Z A;  3HSF A;  3SDG A;  3E6C C;  3IHU A;  3CDL A;  5EDN A;  3MN2 A;  4XRS G;  1PP7 U;  4E7H A;  3CCE I;  5ICF A;  3F21 A;  4HLY A;  2F5D A;  4CXF A;  4EJU A;  2H1K A;  2HQ5 A;  2LY2 A;  2ZFU A;  4Y3O A;  1J5Y A;  5HDK A;  3E5U A;  1XCB A;  3OYM A;  1EKE A;  1ZR4 A;  4LOC A;  4R8H A;  1Y8Q B;  2R7V A;  2JPC A;  3P9I A;  3O6B B;  3T8T A;  3SZP A;  2DJI A;  1GV5 A;  2RVC A;  3H5N A;  4HSR A;  3F22 A;  1PJR A;  2ZFW A;  4PGG A;  1TBX A;  3M8E A;  1DPR A;  2UXN A;  3RQI A;  2HZD A;  3BG3 A;  3BQY A;  3EUA A;  2DK5 A;  1X2M A;  3KP2 A;  3OY9 A;  3CF2 A;  2DYS H;  3BG5 A;  3CES A;  4D5C A;  4CSW A;  3GTP J;  3HUG A;  3J81 K;  3JTH A;  4A3L J;  2EZI A;  2LBF A;  4S0H B;  2VKH A;  3M07 A;  4B1R A;  3I59 A;  2MSY A;  4B48 A;  3TKY A;  4EM1 A;  3OS2 A;  1RR7 A;  1QBJ A;  1TWG J;  2QVO A;  2ZJR F;  2HOA A;  2X4H A;  1G2H A;  3QPH A;  4QTR A;  3HOV J;  1WI9 A;  1UFM A;  2BY3 A;  2L7M P;  3SZT A;  3SXY A;  2M0C A;  4RM3 A;  4AIH A;  2RNJ A;  1D0Y A;  5DCM A;  2LY9 A;  2W1O A;  2XAF A;  2M7B A;  2VT2 A;  1HF0 A;  1AKH B;  3MZH A;  1K78 B;  1XDS A;  1R36 A;  4KIB A;  3W6V A;  3ABK H;  1QNT A;  2XGE A;  3LFK A;  3ML6 A;  2B9S A;  1G3S A;  3R4K A;  2IPQ X;  3K0L A;  3PL8 A;  5KVR A;  2FSW A;  4YRV A;  3HHG A;  5E3N A;  2N8G A;  5FGM A;  3SYT A;  3RPQ A;  2HYJ A;  2ZSH B;  4I98 B;  2DW4 A;  4HST A;  1TTY A;  4IZZ A;  4BE0 A;  4ZDO A;  1TNS A;  2R7D A;  2EZK A;  4RLQ A;  5HLG A;  3FXL A;  3GTM J;  2OQG A;  3CDH A;  5FD5 A;  4EJV A;  5FRN A;  4YFN F;  4KJZ A;  3I4N J;  1FBU A;  1FJL A;  1IAW A;  2FRH A;  4G7O F;  5F08 A;  2VB6 A;  4CGZ A;  1V54 H;  2W85 A;  1PUF B;  4BGD A;  4ZTJ A;  3C3W A;  3PFY A;  2HWV A;  4IHV A;  4F3Q A;  3WU0 A;  2RC4 A;  2PN6 A;  4OU0 A;  4IJA A;  5ERI A;  1YX3 A;  4A3M J;  2P5K A;  5E8G A;  2K02 A;  1BA5 A;  4O3M A;  2CQQ A;  4A3E J;  3COA C;  3WG9 A;  1IUY A;  3CC7 I;  3E3V A;  2LTP A;  4LIV A;  2VBZ A;  3CUO A;  4NQW A;  3MFK A;  5FLX Z;  4ESF A;  3BPV A;  2JUC A;  3IKT A;  5J4Y A;  2HOT A;  1G4D A;  4BJT A;  2M87 A;  2JN6 A;  4WXH A;  2OC6 A;  3TDU C;  4YIF A;  5FLM J;  1I50 J;  3HOS A;  1K83 J;  4KN4 X;  1JUS A;  2LK2 A;  4BE2 A;  1K78 A;  3WTX C;  2DOD A;  3BTI A;  3FBI B;  3KZY A;  2CQ7 A;  2WWY A;  1Y39 A;  5ICG A;  5LEJ A;  4HX8 A;  4DW6 A;  3ZPL A;  3FKJ A;  3M3Y J;  1N78 A;  2QEX I;  4PFO A;  1MMS A;  2VBY A;  1K4T A;  2A6H F;  4M3F A;  4XRF A;  3K4M A;  1EV7 A;  2FD5 A;  1TT5 B;  3NAR A;  3W6K B;  2CUJ A;  3IC7 A;  1RC9 A;  4XNF A;  1JKP C;  1SC7 A;  3M8F A;  5L3B A;  1FC3 A;  2DOE A;  3SDB A;  3GTG J;  2PX9 A;  1U8R A;  1OMI A;  4L9N A;  3HPH A;  3WTZ A;  4A5N A;  5E1Z B;  2LNB A;  2VC1 A;  3TMO A;  2CQX A;  1LKX A;  1U6G A;  4C30 A;  1ENH A;  2Q2E B;  1LE8 A;  3P9C A;  3ZMV A;  3HSR A;  4BL0 B;  2K7L A;  3EUH C;  3S8P A;  4LLG F;  2P6T A;  3LSP A;  1A5J A;  1PUF A;  1A31 A;  2Y2Z A;  3K6G A;  2VLA A;  2NS0 A;  2UUZ A;  5J6X A;  3TGN A;  1NHA A;  1OLT A;  2CO5 A;  2KPM A;  3ERE D;  1SFK A;  2K40 A;  1PYV A;  1KU7 A;  3S2D J;  3DCF A;  3CJN A;  1SVM A;  3GLX A;  3H0G J;  2ZME A;  1Z7U A;  1ON2 A;  4HEA 2;  1B8I A;  1NTC A;  2DCE A;  2XIG A;  3H1C A;  3ZXS A;  1E3P A;  3W2A A;  4XID A;  1Z67 A;  3LQR A;  3L00 A;  5EJC A;  4MEX F;  1IDZ A;  4HV6 A;  4XLE A;  3VYS B;  3H9G A;  3ABL H;  3DBR B;  2HQR A;  2P4W A;  4F92 B;  1QRY A;  3K4N A;  1YIJ I;  2FBI A;  3JRD A;  2QGU A;  1ETO A;  2BHY A;  3H3V K;  3FDY A;  2B0L A;  5EEH A;  4OIO F;  3ZOB A;  2PMZ N;  3T5X A;  3HKZ N;  3IWF A;  1T38 A;  4MNU A;  2DT5 A;  4II2 A;  2DA7 A;  1ZKG A;  1FIA A;  3HM5 A;  4ZC3 A;  4UVC A;  3KYL A;  3AL0 B;  3BG9 A;  1AA7 A;  1ZGJ A;  4ZDP A;  4BHB A;  1X1D A;  2X6W A;  4BU2 A;  2DFF A;  5B5E C;  5CLS A;  3K1P A;  2O8X A;  3D0S A;  4BY7 J;  3ZN0 A;  3FM3 A;  1QZZ A;  1ZRE A;  2EZL A;  2O3F A;  3H5R A;  2DFE A;  3C7J A;  1W0T A;  3QYB A;  3LWF A;  2DA3 A;  3NWT A;  3DPT A;  1XMK A;  3OYF A;  2CFO A;  2DA6 A;  2JZY A;  2X1E A;  2KZG A;  4HNU A;  3GFJ A;  5EYR A;  1J59 A;  4DNC A;  3I0T A;  5H2F C;  2ECC A;  3PNV A;  3FXK A;  1ZAR A;  2HYG D;  4KT6 A;  2JMW A;  3GFI A;  2A6T A;  2X1D A;  1SFU A;  1V55 H;  2LY1 A;  1I3Q J;  1P9Q C;  3FF5 A;  4IRG A;  5F0H A;  2WAQ N;  3S2H J;  3ZQI A;  3JR9 A;  3NQO A;  4JOM A;  2BYV E;  1G3Y A;  1R4N B;  4JP0 A;  1Z91 A;  2IA1 A;  3OYK A;  4XM3 A;  4E7J A;  1WVR A;  1K6Y A;  1Z3X A;  4GYG A;  5EGO B;  1UG0 A;  2LRE A;  3HXL A;  2H8R A;  4XK4 A;  1WJ5 A;  1MBE A;  1IC8 A;  1TWC J;  1SFE A;  2E2H J;  2DDB A;  3K4K A;  4U88 A;  3BC8 A;  4A3D J;  1XN7 A;  3FXJ A;  3WTV C;  1DP3 A;  4XLA A;  2K5C A;  3S1M J;  2TDX A;  2WB1 N;  3KZI C;  1MKM A;  4RM2 A;  3ULQ B;  5GAH J;  5HLI A;  5IYB J;  3OYG A;  3FMS A;  4C2T A;  1P4W A;  3A1Y A;  5IT9 K;  2KIQ A;  2BGC A;  3REO A;  3T0Y A;  1RUN A;  1U5T B;  4IPA A;  5FRO A;  1OCO H;  2XAG A;  3FXO A;  5FKM A;  3OOP A;  2M34 A;  4WX9 A;  3JRI A;  3SQN A;  3LA2 A;  1IGN A;  1FMW A;  3WTW C;  2V1X A;  3CP2 A;  3GYH X;  1WJE A;  3DLA A;  3S32 A;  1TZL A;  1DQU A;  4BE1 A;  1KQ8 A;  4P9F A;  2A68 F;  5FKN A;  2UXX A;  1ZRD A;  1WJD A;  4EJO A;  3KEO A;  1JJ8 C;  2FBK A;  3I58 A;  3MQ0 A;  4U0Y A;  1XMA A;  1UHM A;  1RKW A;  2PEX A;  2Y9Z A;  1O3T A;  4DOZ A;  1NG6 A;  1AWC A;  2OZ6 A;  2RNG A;  4BHP A;  4HPQ A;  3CCQ I;  5CYV A;  4KA4 A;  5CKT A;  3F8B A;  2KDZ A;  3BZK A;  1YO5 C;  1LEB A;  1ZRF A;  1KA8 A;  1Z9C A;  1S3J A;  2F4O B;  3QYF A;  4IRI A;  2TCT A;  3EYI A;  2X1C A;  3ZQ7 A;  1SVO A;  1SFX A;  4XRS A;  1S7O A;  3KP5 A;  2F4M B;  2AQE A;  3K4C A;  2LKP A;  4EAT A;  1O57 A;  2MGQ A;  2V7F A;  1K4S A;  2KRH A;  1G59 A;  1OCC H;  3HRM A;  1Y1V J;  4YEJ A;  3SEZ A;  4AYB A;  2CV0 A;  1J09 A;  1XGO A;  2E60 A;  2EA4 A;  1JKO C;  2VUM J;  1E0E A;  1FY7 A;  2DO7 A;  3TW6 A;  1IV8 A;  3KEQ A;  4XR6 A;  1SMT A;  2DOF A;  3O2P E;  3RPU D;  1RET A;  2RRE A;  3FMQ A;  1IRX A;  5GAE J;  1T39 A;  3BR3 A;  3GTO J;  2Z2S B;  5LHG A;  2KHM A;  2ZXI A;  5JFR A;  1AHD P;  3RYP A;  5JHF A;  2VE8 A;  2FNA A;  3B6A A;  3IH3 A;  2ELJ A;  1IJW C;  2M2E A;  3ROU A;  2CFX A;  2MD0 A;  3OV8 A;  4Z2Y A;  4B8X A;  2R7Z J;  1J7K A;  5HDN A;  2L7K A;  5EEA A;  2OTJ I;  2M5W A;  1T56 A;  5HLH A;  3E7L A;  1OCP A;  1SFO J;  2EA2 A;  3I9V 2;  1BM9 A;  4TV7 A;  4CHU A;  5AON A;  4BBR J;  3HSE A;  3ZRG A;  1MMG A;  2RGV A;  4XKB A;  1DP7 P;  2XRN A;  4ZYG A;  4N9I A;  2ZSI B;  4PDK A;  1Z21 A;  2NS7 A;  4DZP A;  2Y0S N;  5LRS A;  3OR1 C;  3OYL A;  2DOA A;  4FHT A;  4B44 A;  2HS5 A;  5A2Q Z;  3SFI A;  2Z99 A;  2G0E A;  3CF5 F;  3I53 A;  5JR3 A;  1HSJ A;  2QSG X;  3J7Z I;  4AIK A;  1QU3 A;  2OAZ A;  3BJA A;  1NK2 P;  2Y48 A;  2CV2 A;  1OR7 A;  4M3D A;  2HPM A;  1UEL B;  2V9P A;  4XOR A;  2AS5 F;  4ZYE A;  1T95 A;  5IPA A;  5J1R A;  1H9T A;  4JK1 X;  1WJF A;  3FWE A;  4XQF A;  2HTJ A;  3V4G A;  2VXZ A;  1MDM A;  1BOB A;  1IN5 A;  3HL2 A;  5DUK A;  2KDO A;  4BXU A;  3CCY A;  1IN7 A;  2GOM A;  1W7P B;  1RR8 C;  1HCR A;  4RGR A;  1RKT A;  3BCB A;  2ZXJ A;  4F55 A;  2M9H A;  3DKY A;  4IXA A;  5D4R A;  3A2K A;  1ACI A;  1QVT A;  3QAH A;  2XAS A;  2NAZ A;  4M3G A;  2E1O A;  3EUK L;  3OIP A;  1MBG A;  2QQ8 A;  3CUQ C;  3WHC A;  5HDG A;  1QA6 A;  3HRS A;  2LVS A;  4KT5 C;  4L5J A;  2ZCW A;  5AIQ A;  2ID3 A;  1AOY A;  2V26 A;  4HZF A;  4L9T A;  2NNY A;  1MD0 A;  5K5R A;  1BR2 A;  1MW7 A;  3NRV A;  2E5Z A;  2HKO A;  1KU9 A;  2EV6 A;  4L0Z B;  2JJ7 A;  1MIJ A;  3WOD F;  2E35 A;  2BW3 B;  1LQ1 A;  2HOS A;  4NNJ A;  3OYH A;  1P6R A;  1X3Z B;  5CVR A;  1BC8 C;  1B1B A;  2IGN A;  3H9Q A;  4F7Z A;  3AAF A;  4A12 A;  3PUF A;  4FET A;  4IQ4 A;  1O3Q A;  4FX0 A;  4ABZ A;  1TC3 C;  4GGG A;  5LFA A;  1R71 A;  2Q0O A;  4N9H A;  4WXC A;  3L2C A;  3GLL A;  5LLQ A;  1P4A A;  4PJJ A;  1S7A A;  1QPI A;  3OOU A;  1SVL A;  1RRJ A;  3MVP A;  5ILV A;  1HDD C;  1LB2 A;  1IXC A;  3DKW A;  4QIW N;  4WCG A;  2MW8 A;  4I01 A;  4QPQ A;  4FAS D;  2XC7 A;  3TED A;  2MC3 A;  1TL8 A;  4A93 J;  3C2G A;  5CVV A;  4Y17 A;  1WHU A;  2M8E A;  2H27 A;  2VIX A;  1IXS B;  3QP5 A;  2A61 A;  5K5O A;  3J80 K;  2QA4 I;  2O6G E;  5ED4 A;  2LG4 A;  4WF2 A;  2V1U A;  2VQL A;  5KAF C;  4C2U A;  2Y31 A;  2VXD A;  3JSP A;  4A3G J;  2ME0 A;  4NHJ A;  1Y0N A;  1W7P A;  4NB5 A;  3MCZ A;  4HF1 A;  3AFH A;  1MH4 A;  1IV6 A;  3RZO J;  1E17 A;  1RIO H;  1OKR A;  2B63 J;  2AQF A;  4NDL A;  4DZJ A;  1DU0 A;  5L3D A;  2GAU A;  2C6Y A;  1DU6 A;  1ZR2 A;  2MFZ A;  3ZR8 X;  1TQI A;  4YII A;  4UB6 C;  3BTJ A;  3FK6 A;  2VJ4 A;  2G9W A;  1L3L A;  4V2G A;  5EZG A;  5ILU A;  2LF8 A;  1FMV A;  1YS6 A;  4I02 A;  1IZ1 A;  1USS A;  5GP9 A;  4Z6Y A;  3HUG B;  5E3L A;  5LHH A;  3OS0 A;  2L2O A;  4BQQ A;  1XTA A;  3GCM A;  2FEZ A;  2H09 A;  3E1S A;  2LBF B;  5KNL A;  2BV6 A;  2CH0 A;  1YLF A;  2BE5 F;  1G3T A;  5B66 C;  2VPL A;  4G94 A;  3GUD A;  3I64 A;  3WU2 C;  5JVT A;  2X48 A;  4ZYD A;  3CCV I;  4EGY A;  3SFZ A;  3GF2 A;  3RDI A;  1LDJ A;  1S7E A;  3KIO A;  4A2U A;  1FTZ A;  4LG0 A;  2XAQ A;  4Q47 A;  4A5M A;  5ICE A;  2A5Y B;  5DCM B;  2M1B A;  2WAE A;  4I0A A;  4Y15 A;  4C9Y A;  2V1D A;  2VBX A;  5HNH A;  3FXQ A;  2DFI A;  3D5L A;  3HG9 A;  3V8J A;  3J81 Z;  3S1R J;  2L4A A;  2ZKZ A;  3M4O J;  3G1O A;  3RCO A;  3M1E A;  3BT9 A;  5CQE A;  1IN6 A;  3V7C A;  4M72 A;  3Q0V A;  3K4B A;  1XGN A;  1ZHF A;  3R0J A;  1J0R A;  2NNN A;  1J75 A;  1X19 A;  3DTK A;  4HLX A;  2K9M A;  2ISZ A;  2LR8 A;  2ZO4 A;  2JA6 J;  3QOE A;  1SAU A;  3HTS B;  4EGZ A;  5JHU A;  3GEZ A;  1MGT A;  3JRC A;  3IKV A;  4W1U A;  3OYC A;  2QKM B;  1H89 C;  2FF4 A;  2J5O A;  3JTG A;  4IL6 C;  4E7S A;  4K2E A;  3E5Q A;  3LAJ A;  2PMU A;  4X6A J;  2HU9 A;  3OYE A;  1ETY A;  1VQP I;  4IEJ A;  2HGC A;  2CG4 A;  4DYR A;  4KMU X;  3S3M A;  1UCR A;  3FHN A;  4RB1 A;  4GDF A;  4KIS A;  3U9G A;  1UG2 A;  2YX7 A;  3VEP A;  4C3I J;  5B3S H;  1ETK A;  3NEU A;  5IYC J;  2ELH A;  3JSO A;  2ETH A;  3HPG A;  4BQN A;  4LK0 F;  3KET A;  5DD4 A;  2KJB A;  2FQ3 A;  3MKW B;  4BJ5 C;  2RAE A;  4IOC F;  3TQN A;  5FRM A;  1JKR C;  4HAM A;  4PJM A;  1N75 A;  4GO1 A;  1RNL A;  2HVS A;  4EMS A;  3CCS I;  4J19 A;  2FOW A;  2COM A;  3GW2 A;  4HQE A;  4PJL A;  1TWH J;  2RV8 A;  3WGH A;  3MKL A;  3FIW A;  2Y69 H;  2X9D A;  4PK4 A;  1HKQ A;  2HDD A;  3DTE A;  2GXA A;  4NQW B;  2XSD C;  2EIL H;  2KLO A;  3CD6 I;  3HZJ A;  2BBY A;  4N0B A;  2RDP A;  3BG6 A;  1WKM A;  2XVC A;  1GXP A;  4BBS J;  1HQC A;  4GCV A;  4F91 B;  4C3J J;  2QM3 A;  1GLN A;  2A69 F;  1NK3 P;  2VOP A;  2F5V A;  1BN5 A;  2IGM A;  3IWZ A;  4EM0 B;  3W6J B;  1FYK A;  3HEF A;  2RQP A;  3GZN B;  1CGP A;  3S1N J;  4EV0 A;  2CUZ A;  1A36 A;  3BR2 A;  1MBF A;  3QOD A;  2XF6 A;  4CCJ A;  4CCM A;  5AIP A;  4A6D A;  4HQM A;  1OJL A;  1FNN A;  5GTI C;  4UHT A;  2O0Y A;  2P5L C;  1F9N A;  1XPX A;  4P1W A;  4FE7 A;  2R0Q C;  4RB0 A;  4ESB A;  1DGW Y;  1T6S A;  2OD5 A;  3PQJ A;  3V42 A;  1JI8 A;  4IKF A;  3GO5 A;  4XLN F;  2FOK A;  1ZN2 A;  4CH7 A;  4XLP F;  1LE8 B;  1OIS A;  4XOT A;  1FWZ A;  1HLV A;  3JAM Z;  1IRG A;  4HF0 A;  2AHQ A;  3S3O A;  3GTQ J;  1FSE A;  1I27 A;  3Q9V A;  1JHH A;  2QZ8 A;  2VQC A;  2CUE A;  2FML A;  3KEY A;  4ZTF A;  1VQK I;  5HS9 A;  3FBN B;  4U7D A;  5M5W J;  1I1G A;  3QPS A;  4IOA F;  2O61 A;  5J1U A;  1T33 A;  3LSR A;  3KLN A;  1MNM C;  2ZME B;  2V6C A;  3OL4 A;  3ERM A;  2CSO A;  1B8I B;  3V8L A;  2NVX J;  4GFB A;  4Y7N J;  4UUT A;  2W84 A;  5GAG J;  4BEH A;  4BNC A;  1W5T A;  3PUB A;  2IS4 A;  2NOG A;  3RTR A;  3CJT B;  1BL0 A;  4MLO A;  3ABU A;  2YUS A;  4ZZL A;  1P2F A;  2VC0 A;  1ZGA A;  1K61 A;  4X1E A;  1PDN C;  2TRT A;  4QLC U;  3R6S A;  4HNT A;  1B9M A;  4ZDL A;  1I39 A;  4U7B A;  1JTX A;  3GX4 X;  2RN7 A;  4ETS A;  1VQ5 I;  4Y4R A;  3F9K A;  2M4G A;  4G12 A;  2L4M A;  2F5C A;  5J8C A;  2DMU A;  2ACJ A;  2R7U A;  1FZP B;  4I7H A;  1XS9 A;  4FQG A;  4E6K G;  4A3C J;  4D1Q A;  2D1V A;  3E5X A;  5D8L B;  2PFB A;  3BP8 A;  1FOX A;  3LSJ A;  5E1W A;  2CS3 A;  1R6R A;  1ZEL A;  3JCU C;  4YG2 F;  5H20 A;  2K9L A;  3G71 I;  4AC0 A;  1R1U A;  4UUS B;  2DBB A;  4B43 A;  2WV1 A;  4CCN A;  4LIU A;  2WY8 Q;  4KIC A;  4M9X A;  1HBX G;  5BQT A;  2DU9 A;  3E97 A;  3F3X A;  1D8J A;  4I0B A;  3K1N A;  2DPU A;  3CZ6 A;  5HNF A;  5HOD A;  2A07 F;  2EB7 A;  2R7R A;  2FU4 A;  1XD7 A;  2CW8 A;  3J7A O;  3CO7 C;  3Q0W A;  3Q3S A;  2KRF A;  4OIP F;  5GAD J;  2CWE A;  4UXN A;  4M71 A;  1Z0X A;  3NWS A;  3CCM I;  4Y33 A;  2IEK A;  2XGX A;  2ZNY A;  1D0X A;  4AD9 A;  2PLY A;  1N25 A;  3H36 A;  2R93 J;  4JQF A;  3T1B A;  1VI0 A;  1W5S A;  1ZG3 A;  3FMR A;  4BQO A;  3HBL A;  3KP6 A;  2YU9 J;  3PIO F;  4ON0 A;  1FT9 A;  1FBS A;  3PNT A;  4RAZ A;  4NBQ A;  5J8F A;  2EJR A;  4C3H J;  2O9L A;  1J9I A;  1ETX A;  2ICW G;  2YS9 A;  4KDP A;  1KQ9 A;  1A04 A;  2Q1Z B;  3L9F A;  2BVL A;  1S5L C;  5B1A H;  1YRN B;  3OS1 A;  5F04 A;  4PGH A;  1W36 D;  5DM6 F;  4XMY A;  2KP6 A;  4UVB A;  2DMP A;  4XSX F;  2VL8 A;  3EUH A;  2I8D A;  3U21 A;  1SD6 A;  3F0C A;  2K9Q A;  3BPX A;  2JK3 A;  3KP7 A;  3ABM H;  5DD8 A;  2LH9 A;  3C2B A;  4B09 A;  1ETQ A;  2D2W A;  2MG4 A;  4DJA A;  2NVQ J;  1SMY F;  2R7O A;  2WA0 A;  4HV5 A;  3N4M A;  2F5E A;  4AU7 A;  4B4C A;  5M3F J;  4UY8 I;  1J2X A;  2Y9Y A;  1QHH D;  4BYY A;  4UUS A;  5HLT A;  3OIO A;  3G1L A;  5K7F A;  4WXD A;  2FUG 2;  2QSF X;  4V2F A;  3ZMD A;  2O8K A;  2O03 A;  2PI0 A;  3VSL A;  2K3P A;  2V9K A;  3L2R A;  1M1E B;  1U2W A;  1FPQ A;  3FK7 A;  4A69 C;  4KUM A;  3A0B C;  5E79 C;  2BHZ A;  1ERD A;  3DWL E;  4AIJ A;  2XV4 S;  3F8C A;  3QWL A;  1HC8 A;  2H8W A;  1FEX A;  1HOM A;  2KL4 A;  2AXT C;  2X6X A;  1ZG5 A;  3RKY A;  2K4B A;  2L01 A;  1JKQ C;  2BVM A;  3GME A;  3KCC A;  4XSZ F;  5IYD J;  1ODD A;  2XRO A;  3OL3 A;  4EM2 A;  1WSU A;  5E20 A;  1H9G A;  1ZTR A;  2EBI A;  3L2Q A;  3BTL A;  3BR6 A;  1S6L A;  3M7G A;  1Z6R A;  3HYI A;  5E8I A;  3DPL C;  2R5Y B;  2LC2 A;  4A3F J;  3SJM A;  4CYC A;  2ZJQ F;  4E7L A;  3S17 J;  3S3N A;  2L9N A;  2CW7 A;  2AXL A;  1X3W B;  1YRN A;  2JTV A;  2VJ5 A;  1VQ8 I;  2VQG A;  3V7R A;  4XON A;  2XAU A;  3CMY A;  2QYO A;  5HS7 A;  2NVU B;  1WFX A;  4RGS A;  2D5V A;  2E19 A;  1WJA A;  2IAI A;  1WCM J;  2KRC A;  2DLL A;  3HRU A;  3TO6 A;  3UKG A;  4OIN F;  5BMZ A;  4A0Y A;  2F4I A;  3F72 A;  4ZH4 F;  2Z9O A;  3K69 A;  2QBY B;  1GHC A;  1YTY A;  3LA3 A;  2A5W A;  1UHS A;  5E3O A;  1O7F A;  3TL4 X;  2KIF A;  2FMY A;  2L9V A;  2V6E A;  2HFH A;  2ESN A;  6PAX A;  2PJP A;  1TQM A;  2HNH A;  3CJQ B;  2M3A A;  1JUP A;  4BDZ A;  1IRF A;  3MD2 A;  4HYE A;  4M3E A;  4RLF A;  5DCF A;  1I6H J;  1X3U A;  2MBF A;  3VB2 A;  3A0H C;  3ZMS A;  5D5V B;  3HOW J;  2ZJ2 A;  2UV1 A;  2E7X A;  3DU6 A;  3FIS A;  1GXQ A;  1Y0U A;  5IOZ A;  2GA1 A;  2JT1 A;  4PZJ A;  4F52 A;  1LUJ B;  1OCR H;  1YX5 A;  5C3E J;  3P7N A;  4GYI A;  1BI1 A;  4HW0 A;  1AU7 A;  4RMN A;  1MDM B;  1MND A;  4XN0 A;  5DEQ A;  3HC7 A;  4BQA A;  3K10 A;  2ISY A;  2M4K A;  1WRJ A;  5EG0 A;  4AWX B;  4L0Y B;  1GUU A;  4I6Z A;  1E3O C;  3CCR I;  2HXI A;  2IS1 A;  1BI2 A;  2IBD A;  2DI3 A;  3UR3 C;  4DIQ A;  2R7Q A;  5FD6 A;  1BW5 A;  1W36 C;  4RA2 A;  5HOO A;  2R5Y A;  3WTY C;  2HDW A;  3LOC A;  5E3M A;  1VQN I;  1UHW A;  3Q0U A;  4S05 A;  4YEL A;  2L9R A;  5D6E A;  3PO3 J;  3K2A A;  4H0E A;  4PJ0 C;  4XKW A;  2E1C A;  3BOQ A;  1YOV B;  4HX7 A;  4L5E A;  1XB4 A;  1T0F C;  2XPU A;  3KE2 A;  4ENN A;  3ZQF A;  1A35 A;  1YHQ I;  2HQN A;  3PSF A;  3MKZ A;  3I55 I;  4G6D A;  4IHT A;  3FXR A;  3W3C A;  3LL7 A;  2W57 A;  4I09 A;  3DQV C;  1FLI A;  3AKZ A;  5TRD A;  2CU7 A;  2EFP A;  2EFW A;  2L3D A;  2GBY A;  2CUF A;  4MTD A;  5DUI A;  2FX0 A;  4MEY F;  1IO2 A;  3PM1 A;  1VTN C;  1KU3 A;  2KMU A;  2QBY A;  3FHZ A;  2R92 J;  3BY6 A;  3S14 J;  4AUX A;  1R49 A;  3RSN A;  3KPH A;  4BDY A;  4QPO A;  4FX4 A;  2HDC A;  1LFB A;  2HZT A;  3HOZ J;  2MH2 A;  4M6X A;  2Q8K A;  3OSG A;  1H8A C;  2Z16 A;  1QHG A;  3OYJ A;  1V5G A;  4ZZD A;  2QF7 A;  1U0J A;  1X1B A;  2COB A;  4UUV A;  2EIN H;  1H0M A;  2ECB A;  1D1A A;  3CUQ B;  1I6X A;  1LFP A;  5K7H A;  2D45 A;  3AG2 H;  3MWM A;  2OU2 A;  2IP2 A;  3G4S I;  1W0U A;  4G7Z F;  1KYW A;  2NRA C;  3RZD J;  3GBG A;  2JA7 J;  5JLX A;  1T0F A;  3B02 A;  2V1N A;  2V9V A;  1H88 C;  1IW7 F;  2R4G A;  2XKP A;  2ZB9 A;  2VJJ A;  3BR1 A;  3F8N A;  3ISP A;  4YIR X;  1HW1 A;  5FFZ A;  2UZK A;  4LLL A;  5B1B H;  1FYL A;  2MLG A;  4DBR A;  2R7S A;  3VOD A;  4ENJ A;  3OSF A;  2E1M C;  3FM5 A;  3AG4 H;  3HOX J;  2G7H A;  2Y30 A;  2IVM A;  4JX4 A;  2OQR A;  2WY7 Q;  4UV8 A;  5IP9 J;  4KN7 X;  1Z77 A;  3IL2 A;  4KIF A;  1XCV A;  4HG2 A;  4CCO A;  5F1J A;  1T98 A;  4A3K J;  1BW6 A;  4D5F A;  1BC7 C;  3SHF A;  2B7E A;  3OYN A;  1U9N A;  5HS8 A;  2OJE D;  5CVU A;  5IOY A;  1R22 A;  3F6V A;  1V3F A;  3DP7 A;  3OYI A;  3Q9S A;  5EF6 A;  2M30 A;  5DS9 A;  2DMT A;  3HB9 A;  5K7Z A;  3LAP A;  1G8X A;  4QWQ A;  1EH6 A;  2BXY A;  4QSH A;  1LDD A;  4PSX A;  4FCY A;  4IO9 F;  4OMZ A;  3L1P A;  1Q1H A;  1X1P A;  5DYM A;  3HOT A;  1YJ9 I;  2DDA A;  2JWT A;  5A2Q K;  3F6O A;  1OYW A;  5DTD A;  3L2W A;  4LG0 B;  4WWC A;  3K70 D;  1MMA A;  1SD7 A;  1YW9 A;  1WWX A;  3GTL J;  3S2W A;  3HHH A;  3ZMZ A;  4OMY A;  2F6C A;  1JE8 A;  1PUE E;  5FKL A;  3ZN1 A;  1HKT A;  2X0L A;  1KON A;  4IF4 A;  2FBH A;  2W00 A;  1YFH A;  3GXO A;  1O3R A;  1HW2 A;  3G3Z A;  3PNY A;  3MEX A;  5J47 A;  4PCQ A;  4II3 A;  3CUQ A;  2XAH A;  4CCL A;  1YS7 A;  1NG7 A;  1WJB A;  3CO6 C;  3VSK A;  4MFD A;  5LHI A;  2XGD A;  3BZC A;  1Y1W J;  1SD5 A;  1LEA A;  3BDD A;  4I99 C;  3T8R A;  3PO2 J;  4Q48 A;  2PMZ A;  1SAN A;  1Z7L A;  4GXO A;  1F43 A;  4JBA A;  1YIO A;  3HGG A;  2LRD A;  1D5V A;  5KK1 A;  1R1T A;  3HKZ A;  2MC4 A;  4EVI A;  3GVA A;  2GM4 A;  3VYT B;  2H94 A;  3DEW A;  3CTA A;  5JI6 A;  3TO9 A;  4ESJ A;  4ENM A;  1MMN A;  4M73 A;  3P9K A;  4F93 B;  2XGC A;  1D1C A;  3WTS C;  3JRG A;  5LRR A;  1ZRC A;  1R5G A;  3A02 A;  3H92 A;  4R79 A;  5DDG A;  4Q5S F;  2X51 A;  3AG3 H;  2MAB A;  1FSH A;  1BIA A;  1X4P A;  4MO7 A;  3PJR A;  2EIK H;  1S29 A;  1UB9 A;  1HA8 A;  1V5E A;  2VBW A;  3E6B A;  3UNG C;  5L3F A;  4IHW A;  1GT0 C;  3J7A Y;  4HDV A;  2NVT J;  3KYC B;  5CVJ A;  1EF4 A;  2W7N A;  1ZK8 A;  5E18 F;  5C44 J;  1IXR C;  1D1B A;  1YJN I;  1P4X A;  2QQA A;  2JRM A;  1LJ9 A;  4S04 A;  4DYQ A;  1X1C A;  3NAU A;  3AG1 H;  1TW2 A;  1GVD A;  3U2R A;  2FJ1 A;  4J00 A;  2VON A;  2WAQ A;  2A05 A;  3E0J B;  3F8M A;  4X0G A;  3W2W A;  3CQZ J;  4E70 A;  3ZQH A;  1POG A;  3ABT A;  4NC8 A;  4EJW A;  3RPU A;  3CMA I;  3QOP A;  3EYY A;  5CPR B;  2LP0 A;  1APL C;  3ASO H;  1WI3 A;  2XUB A;  3G2B A;  3O8G A;  4A3I J;  1OPC A;  2A3S A;  2VQH A;  3I56 I;  1WGX A;  4L9V A;  1KZH A;  3MAJ A;  4BS9 A;  2CYY A;  3ZCO A;  2IT0 A;  4PUS A;  1R5H A;  1IN8 A;  2DA2 A;  1UST A;  2L5Q A;  2XB0 X;  4YFK F;  4ITV A;  2JA5 J;  2WB1 A;  2KIM A;  1UAA A;  1REP C;  2P81 A;  3U1D A;  2IRF G;  2OCE A;  2ZXW H;  1HXD A;  3DKX A;  2R3S A;  1V4R A;  3BRO A;  3E6D A;  1RES A;  2FNP A;  1E2X A;  3QU3 A;  1Y6I A;  3WHB A;  4NC6 A;  2EIJ H;  4G9Y A;  3JRE A;  2JA2 A;  1ZLK A;  1F36 A;  1U8B A;  2DA4 A;  4PSW A;  5ICC A;  2BZT A;  3HRT A;  2HOE A;  4E7Z A;  2QLZ A;  1XSD A;  2H6C A;  3OIQ A;  4H4K C;  2QQB A;  3OMY A;  3P5J A;  4CZZ A;  3VPR A;  4HBL A;  4A3B J;  1BI3 A;  2EFO A;  2GXG A;  1C0W A;  4CCK A;  2E1N A;  2QEN A;  4LB6 B;  2KIS A;  5EZH A;  1T08 B;  1R9T J;  3K70 C;  4BEH B;  1ZG1 A;  1T8I A;  4AID A;  1XC5 A;  2LLK A;  4KFC A;  3V7S A;  4RBO A;  2OBP A;  1FTT A;  2M7A A;  4DBQ A;  3RJP A;  2R7F A;  4CUG A;  3WE2 A;  2VN2 A;  1ZGW A;  4OIR F;  5FKK A;  1OCZ H;  2J5P A;  2BEO A;  3BJO A;  2M45 A;  2E2J J;  2R7X A;  3KYD B;  1VZ0 A;  5DM7 F;  2LSO A;  4G8X A;  1VND A;  1CF7 A;  2XHK A;  2PBI A;  1B4A A;  3O3K A;  2E36 A;  1XGS A;  3QU6 A;  2I5U A;  3G1M A;  4R1H A;  3WE3 A;  3VWB A;  4HRI A;  2WAF A;  3CLO A;  3K4J A;  3VOE A;  1HKS A;  1QVU A;  1ETW A;  1FBQ A;  3FKI J;  5FLV A;  5KAI C;  3RKQ A;  3IUO A;  1RUO A;  2DFH A;  2I10 A;  3KX2 A;  1HW5 A;  4OWR B;  2DMN A;  2F2E A;  2WV0 A;  4OAY A;  4BJ6 C;  4BH9 A;  2GIV A;  2K27 A;  2OUM A;  1EH7 A;  1O7L A;  4MQV A;  2X6O A;  3H35 A;  4DQ2 A;  1MZB A;  1GV2 A;  1YYV A;  2L9S A;  2UWM A;  2K85 A;  1VF9 A;  3GZ5 A;  1YI2 I;  1D0Z A;  5J1Y A;  1MSF C;  1BBY A;  1WJC A;  1SD4 A;  1XMX A;  3I54 A;  2JPB A;  4AYB N;  3HOU J;  5KHD A;  2BY2 A;  4G7H F;  4JX6 A;  1W5C C;  2CQK A;  3D5S C;  3IAS 2;  4D0P A;  4MQ9 F;  2Y0S A;  1FOK A;  2LDU A;  2KKO A;  2YR2 A;  2CV1 A;  2GZW A;  1QGP A;  5GTH C;  2XDV A;  2HKX A;  4U0V A;  4BAC A;  2EPF A;  4B3X A;  2Z33 A;  2R5Z B;  2GA2 A;  4O5V A;  3FZV A;  4ZJZ A;  2QKL B;  2JVG A;  2MA3 A;  1R7J A;  4FT8 A;  3J7Y J;  1BR1 A;  4L18 B;  1OYI A;  1R4M B;  1TT0 A;  1A6I A;  1IRZ A;  1JGG A;  1JGS A;  3C2H A;  3TP3 A;  3TBI A;  2VT3 A;  3CME I;  5JLW A;  2YSR A;  2V4J C;  2BXZ A;  1OYY A;  1PVE A;  4BHC A;  4XRM A;  4LB5 A;  2BY1 A;  1QPM A;  2IA2 A;  3QRF F;  2HEO A;  1JJ6 C;  4D7M A;  2GOX B;  1DPU A;  2QQ9 A;  4E4H A;  3FX3 A;  3RIR A;  5H6Q A;  1N77 A;  1XX5 A;  2GXB A;  4LJZ F;  2W24 A;  1B6A A;  1RI7 A;  1TP4 A;  2RKH A;  3DBL B;  4FE4 A;  3F23 A;  1FOW A;  4L9J A;  5JVG F;  4M6Y A;  3K4L A;  2HXO A;  3CCU I;  1YW7 A;  5FFX A;  1O3S A;  3JAM K;  2ZXH A;  2R7T A;  3C18 A;  3EPZ A;  3CCJ I;  1AKH A;  3MZ8 A;  3PIP F;  4V19 K;  4KIT B;  2KJC A;  5E17 F;  4YFX F;  2IGK A;  3BQZ A;  3BTC A;  1VQ9 I;  2ZME C;  4LD5 A;  4DGW B;  1QO0 D;  4D7N A;  5J4V A;  4EQQ A;  1EA3 A;  3LSH A;  5FJ8 J;  4W97 A;  4XBF A;  2VAS A;  2HR3 A;  4OIQ F;  2JSC A;  3WGG A;  2DXI A;  1FX7 A;  2IS2 A;  2PJR B;  2VI6 A;  2M0M A;  1TW3 A;  4IX7 A;  2W4S A;  2IA0 A;  3EDP A;  4Y13 A;  1XG1 A;  3DXJ F;  3ZGK A;  5M3M J;  5CJ9 A;  5LGU A;  4UV9 A;  2R5Z A;  4BY1 J;  3D1N I;  1K6O A;  5FLX K;  1U3E M;  3HJE A;  1Q1V A;  1I5Z A;  2PG4 A;  3S1Q J;  4M9S A;  1OQY A;  3KLO A;  4ZYA A;  1F4K A;  1WH5 A;  1HST A;  1D8K A;  1FYM A;  2STW A;  4O6J A;  1G6N A;  4PFP A;  1VQ6 I;  3BWG A;  4CYC B;  3ZQL A;  2CJJ A;  4RB2 C;  4UVA A;  2ELK A;  9ANT A;  4N4N B;  5F1R A;  3CDI A;  2E2I J;  1Y56 A;  5IP6 A;  4UNO A;  1Z6T A;  1Z05 A;  2KZV A;  2ADU A;  3WTT C;  3SEQ A;  4LIT A;  4HNV A;  2XB5 A;  1ETV A;  4MHG A;  3M1C A;  2F5F A;  4L5I A;  3ZMU A;  4BXX J;  1JUM A;  3KZZ A;  4BKX A;  2KT0 A;  5IP7 J;  3IRR A;  2HYF A;  2P7C B;  1UMQ A;  2ZBK A;  3PSI A;  1BI0 A;  1YIT I;  4AVZ A;  4IHS A;  2IS6 A;  3K7A J;  2XPW A;  5K5Q A;  1ITY A;  2P6S A;  4HDU A;  4HF2 A;  1P7I A;  1IF1 A;  1RPW A;  3ELK A;  4RS8 A;  5LD2 C;  1TQP A;  1RZ4 A;  4LLN A;  3GFM A;  4B3A A;  4CYD A;  3H5A A;  3JRA A;  2DQL A;  5IT9 Z;  2EIM H;  2LMD A;  1O4X A;  3VYU B;  2VOD A;  2OCC H;  2L7F P;  2MLK A;  3L2U A;  1MNE A;  3QYE A;  2RQQ A;  3W2V A;  1EJ9 A;  4RDU A;  4OAZ A;  1LPQ A;  3RQ4 A;  2PJR A;  1GVJ A;  3RKW A;  5FO5 A;  3GTJ J;  3N97 A;  2VKD A;  2KQR A;  3ASN H;  3L7W A;  3L09 A;  5EG0 B;  1XGM A;  4IHY A;  2K9S A;  2R7W A;  2JA8 J;  5D5W B;  1S9H A;  4A0Z A;  1VQ4 I;  1VFC A;  2E71 A;  3KP3 A;  5HVQ C;  3WTU C;  3G73 A;  1ON1 A;  2Q2E A;  2JQ7 A;  2EQR A;  5BPD A;  3G6E I;  5IY5 H;  2FXA A;  3HOY J;  1UZC A;  2ZC2 A;  5LEK A;  3A03 A;  3AL0 C;  1YE9 A;  5CVI A;  3U1K A;  1Z3Y A;  2DJN A;  4LK1 F;  3OYA A;  1F5T A;  4EJT A;  1OCT C;  2STT A;  1GDT A;  4KNY A;  3DLL F;  3CLQ A;  1W4M A;  1KU2 A;  4XN3 A;  2K3F A;  2PMH A;  1ZLJ A;  4RB3 C;  3X2Q H;  5IT3 A;  3V8K A;  4FTH A;  1WH7 A;  1MSE C;  4BXF A;  3ECH A;  1U9O A;  3KP4 A;  3JW4 A;  4XLF A;  5GPC A;  4XL9 A;  4XKV A;  2DAO A;  1VQO I;  1E3H A;  5F6F A;  2L02 A;  3DFG A;  4MTE A;  1IDY A;  4HX4 A;  2K4J A;  1WQ2 A;  1Y8R B;  2H1L A;  3DU5 A;  2XF5 A;  1D5Y A;  2DA1 A;  3RKX A;  2DTR A;  5FKO A;  2XAJ A;  4XKC A;  3LST A;  2YU3 A;  5LGN A;  3O8H A;  2A6E F;  1JT0 A;  2XPV A;  2ME6 A;  5E1X A;  3LNQ A;  2W48 A;  1ZAO A;  4XLC A;  1T2K A;  2JSP A;  3K2Z A;  1JXS A;  4U87 A;  1D3Y A;  4P5O A;  3CCL I;  4LG3 A;  1W7P D;  3DTI A;  4Q4Z F;  2HVR A;  2NS8 A;  4U0W A;  1ZH5 A;  5F0C A;  3WGI A;  3GTK J;  3LSG A;  3A01 B;  3LSI A;  2YX4 A;  4PJN A;  4G6Q A;  2DQR A;  3GWZ A;  3VFZ A;  1XSX A;  1LVA A;  3H9J A;  3HTU A;  4XIC A;  2QSH X;  3BG7 A;  3DF8 A;  5BNG A;  4FIS A;  1X1A A;  4P96 A;  2DTZ A;  3HDD A;  3CC2 I;  2FE3 A;  1R1V A;  3EQL F;  3HIF A;  3OR2 C;  4P9U A;  2VPR A;  1U5T C;  3TP0 A;  4IQJ A;  5L3G A;  3BR5 A;  2NVY J;  2CMP A;  2LKS A;  5FB2 A;  5D6F A;  3IH2 A;  3ECO A;  3WU1 B;  3LA7 A;  4G6T B;  4E7K A;  1L0O C;  2LD5 A;  2DPD A;  3LFU A;  3DV8 A;  1CQT A;  2EK5 A;  3S93 A;  1SEU A;  2GWR A;  3DEE A;  2VE9 A;  4M6V A;  2XRL A;  1MH3 A;  5D5X B;  4RGX A; 
#chains in the Genus database with same CATH homology
 4CCJ A;  3FDY A;  4CCM A;  4F93 B;  1D1C A;  4R79 A;  4P1W A;  3L2V A;  1X4O A;  2JVH A;  2X51 A;  4II2 A;  1OR7 C;  1DGW Y;  2MAB A;  3V42 A;  3VDX A;  1JI8 A;  1X4P A;  4IKF A;  4ZC3 A;  3AL0 B;  3KYL A;  3PJR A;  1AA7 A;  4ZDP A;  3I3L A;  1X1D A;  2X6W A;  4XLH A;  1HA8 A;  1V5E A;  3UNG C;  4BU2 A;  4CH7 A;  3J7A Y;  3DPU A;  4XOT A;  3D5R C;  2E1M B;  2BOL A;  3S3O A;  3H5R A;  2W7N A;  3QYB A;  2VQC A;  3NWT A;  1D1B A;  1BR4 A;  3DPT A;  3KEY A;  3OYF A;  2CFO A;  4ZTF A;  2X1E A;  3FBN B;  2JUG A;  1X1C A;  2O5R A;  4HNU A;  4B47 A;  4J00 A;  3OL4 A;  2WAQ A;  4X0G A;  3E0J B;  2NOJ B;  3W2W A;  3PNV A;  4KT6 A;  4NC8 A;  2A6T A;  5CPR B;  2X1D A;  4BEH A;  3PUB A;  2IS4 A;  3A4C A;  3G2B A;  3RTR A;  2LY1 A;  2VQH A;  3LMM A;  4MLO A;  1P9Q C;  4BS9 A;  3ZCO A;  4PUS A;  2L5Q A;  4JOM A;  5KCM A;  4ITV A;  4HNT A;  3OYK A;  2WB1 A;  4XM3 A;  4ZDL A;  4E7J A;  1UAA A;  3CP8 A;  4U7B A;  1K6Y A;  1Z3X A;  5CQG A;  1UG0 A;  2LRE A;  3HXL A;  4Y4R A;  3F9K A;  2M4G A;  1WJ5 A;  2X6Y A;  3DKX A;  3K4K A;  3BC8 A;  2R7U A;  1DP3 A;  4XLA A;  2K5C A;  4E6K G;  4D1Q A;  4RM2 A;  1Y6I A;  3OYG A;  4C2T A;  3A1Y A;  2JA2 A;  4PSW A;  2CS3 A;  1R6R A;  1ZEL A;  4E7Z A;  4NUB A;  2K9L A;  3OIQ A;  4H4K C;  5FRO A;  3OYB A;  4B43 A;  4CCN A;  3OMY A;  4LIU A;  2WY8 Q;  2IGO A;  1FMW A;  3CP2 A;  1WJE A;  3DLA A;  3S32 A;  1TZL A;  4CCK A;  1DQU A;  3CZ6 A;  3M8J A;  5HNF A;  4BE1 A;  2XSJ C;  2R7R A;  2CW8 A;  3K70 C;  4BEH B;  3N05 A;  1WJD A;  5TGT A;  2M7A A;  4DBQ A;  4CUG A;  3NWS A;  4DOZ A;  1NG6 A;  4Y33 A;  1D0X A;  2RNG A;  2IXS A;  3MKY B;  4HPQ A;  2R7X A;  4JQF A;  1VZ0 A;  5CKT A;  1V5F A;  2DT6 A;  4BQO A;  2X85 A;  4HRI A;  3QYF A;  3VWB A;  3PNT A;  2WAF A;  3K4J A;  2LYC A;  2X1C A;  3BCA A;  3IUO A;  3KX2 A;  2Q1Z B;  2AQE A;  2BVL A;  3CJR B;  2OV7 A;  2E5N A;  3K4C A;  3LSK A;  4OWR B;  3OS1 A;  4EAT A;  2V7F A;  1W36 D;  4BJ6 C;  4OAY A;  2KRH A;  4NC7 A;  1G59 A;  2LOO A;  4XMY A;  2OUM A;  4YEJ A;  3SEZ A;  2KP6 A;  4AYB A;  2CV0 A;  3H35 A;  1J09 A;  2E60 A;  1E0E A;  3ZQQ A;  4CA0 A;  2VL8 A;  4D9J A;  2I8D A;  2L9S A;  2UWM A;  3U21 A;  4XR6 A;  3RPU D;  2RRE A;  1IRX A;  1D0Z A;  2Z2S B;  2KHM A;  1WJC A;  2ZXI A;  2XF7 A;  2Z1D A;  4CZC A;  3BLY A;  2HQA A;  3ONQ A;  5JHF A;  2LH9 A;  5KHD A;  2ELJ A;  3IAS 2;  2MD0 A;  3D5S C;  4DJA A;  2R7O A;  2WA0 A;  2L7K A;  4AU7 A;  2Y0S A;  1MMD A;  1LVK A;  3H0D A;  2WAD A;  3SZG A;  4XOP A;  1QHH D;  2CV1 A;  2P0W A;  5HLT A;  3I9V 2;  4E7I A;  3CMM A;  2XDV A;  3OWT A;  3ZRG A;  1MMG A;  2FUG 2;  4XKB A;  3VSL A;  4BAC A;  2K3P A;  2V9K A;  2ZSI B;  4B3X A;  1Z21 A;  3L2R A;  3VYR B;  3OR1 C;  3OYL A;  4ZJZ A;  2MYS A;  1DGR M;  2DOA A;  2QKL B;  4B44 A;  2JVG A;  1ERD A;  3DWL E;  3OYD A;  1BR1 A;  4ANJ A;  2BW3 A;  1LDK B;  1TT0 A;  2WBM A;  3C2H A;  1QU3 A;  4N4O B;  3TBI A;  2HVQ A;  3MMY B;  2CV2 A;  2KL4 A;  2X6X A;  3IP4 B;  2HPM A;  4GRI A;  3LSM A;  1UEL B;  2DT7 B;  2HPI A;  4XOR A;  2V4J C;  2BVM A;  1T95 A;  3OL3 A;  3IAM 2;  4BUP A;  3L2Q A;  1WJF A;  4XQF A;  2VXZ A;  2VJI A;  1BOB A;  3DPL C;  2LC2 A;  3HL2 A;  2GOX B;  2KDO A;  4E4H A;  4J01 A;  1N77 A;  4E7L A;  2W82 A;  3S3N A;  2L9N A;  2GOM A;  2CW7 A;  3BCB A;  2VJ5 A;  4F55 A;  2VQG A;  4XON A;  3DKY A;  3A2K A;  2XAU A;  3K4L A;  1WFX A;  4E7H A;  3EUK L;  3OIP A;  1WJA A;  2KRC A;  2R7T A;  2ZXH A;  3EPZ A;  2LY2 A;  2ZFU A;  4Y3O A;  4KIT B;  3OYM A;  2IGK A;  2F4I A;  2V26 A;  4DGW B;  2R7V A;  2A5W A;  1EA3 A;  3LSH A;  3TL4 X;  2VAS A;  1BR2 A;  2DJI A;  2V6E A;  1MW7 A;  2E5Z A;  2DXI A;  3H5N A;  4HSR A;  2IS2 A;  2PJR B;  2M0M A;  2HNH A;  3CJQ B;  2W4S A;  1PJR A;  4IX7 A;  2M3A A;  2BW3 B;  4BDZ A;  4NNJ A;  3MD2 A;  4RLF A;  2HZD A;  3OYH A;  3EUA A;  3H9Q A;  2IGN A;  3ZGK A;  3OY9 A;  3CF2 A;  4FET A;  4IQ4 A;  2UV1 A;  3CES A;  4CSW A;  3DU6 A;  5LFA A;  2LBF A;  4F52 A;  1YX5 A;  2VKH A;  4ZYA A;  4PJJ A;  4B48 A;  4RMN A;  3OS2 A;  1MND A;  3OOU A;  4XN0 A;  3HC7 A;  4PFP A;  3K10 A;  2M4K A;  4N4N B;  1Y56 A;  4QPQ A;  4FAS D;  2XC7 A;  2KZV A;  4RM3 A;  3C2G A;  2IS1 A;  1D0Y A;  2VIX A;  3SEQ A;  4LIT A;  3UR3 C;  4DIQ A;  2R7Q A;  3M1C A;  2W1O A;  1W36 C;  2M7B A;  2LG4 A;  5HOO A;  2HDW A;  2VQL A;  4C2U A;  2VXD A;  4YEL A;  4XKW A;  3PL8 A;  3PSI A;  3AFH A;  4YRV A;  1T0F C;  4AVZ A;  3PSF A;  3SYT A;  2AQF A;  2IS6 A;  3MKZ A;  2ZSH B;  3W3C A;  3LL7 A;  2MFZ A;  4HST A;  3ZR8 X;  4IZZ A;  4BE0 A;  4ZDO A;  3DQV C;  3AKZ A;  5LD2 C;  4RLQ A;  2VJ4 A;  3H5A A;  1FMV A;  5FRN A;  2KMU A;  4KJZ A;  3VYU B;  3HUG B;  3OS0 A;  3RSN A;  2L2O A;  3L2U A;  4BQQ A;  1MNE A;  3QYE A;  2RQQ A;  3E1S A;  2LBF B;  3W2V A;  4BDY A;  4OAZ A;  4QPO A;  5KNL A;  2CH0 A;  3RQ4 A;  2PJR A;  2Z16 A;  1QHG A;  3OYJ A;  1V5G A;  2VPL A;  2VB6 A;  2VKD A;  2KQR A;  1U0J A;  1X1B A;  4BGD A;  4ZTJ A;  3PFY A;  4F3Q A;  1D1A A;  2R7W A;  1LFP A;  1S9H A;  1YX3 A;  5HVQ C;  2WAE A;  4C9Y A;  3GBG A;  2V1N A;  2R4G A;  2VJJ A;  3AL0 C;  1YE9 A;  4LIV A;  5HNH A;  1Z3Y A;  3D5L A;  3HG9 A;  3OYA A;  3RCO A;  4DBR A;  5CQE A;  2R7S A;  2E1M C;  3K4B A;  4XN3 A;  4BJT A;  2WY7 Q;  1X19 A;  3DTK A;  2K9M A;  2OC6 A;  4HG2 A;  4CCO A;  3QOE A;  1SAU A;  3HOS A;  3OYN A;  4BE2 A;  4BXF A;  3FBI B;  3OYC A;  2QKM B;  4XLF A;  4E7S A;  1N78 A;  3FKJ A;  3OYI A;  4XL9 A;  4XKV A;  4PFO A;  2HU9 A;  3OYE A;  3K4M A;  2CUJ A;  3DU5 A;  2XF5 A;  1G8X A;  4XNF A;  4XKC A;  3S3M A;  4PSX A;  3SDB A;  3FHN A;  4KIS A;  3HOT A;  3HPG A;  4BQN A;  3HPH A;  4XLC A;  2JSP A;  3TMO A;  3L2W A;  3MKW B;  4BJ5 C;  5FRM A;  1LKX A;  3K70 D;  1MMA A;  4U87 A;  4P5O A;  4PJM A;  1N75 A;  4C30 A;  4LG3 A;  2HVS A;  2Q2E B;  2F6C A;  4BL0 B;  3DTI A;  2HVR A;  3EUH C;  3S8P A;  4PJL A;  1KON A;  2W00 A;  3LSG A;  3PNY A;  3K6G A;  3LSI A;  4PJN A;  2UUZ A;  2VLA A;  4PK4 A;  3DTE A;  4NQW B;  1OLT A;  3H9J A;  4II3 A;  2KPM A;  2KLO A;  1SFK A;  3BG7 A;  4CCL A;  1PYV A;  1X1A A;  3BG6 A;  1NG7 A;  1WJB A;  3OR2 C;  4HEA 2;  3VSK A;  4F91 B;  2DCE A;  3ZXS A;  1GLN A;  4IQJ A;  3W2A A;  2CMP A;  4E7K A;  2F5V A;  4XLE A;  4G6T B;  3VYS B;  2IGM A;  1Z7L A;  2PMZ A;  3H9G A;  3LFU A;  2LRD A;  3HKZ A;  4F92 B;  2MC4 A;  3K4N A;  3S93 A;  3VYT B;  3DEE A;  2CUZ A;  3QOD A;  1MMN A;  2XF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...