1WJ5A

Solution structure of the hypothetical domain of riken cdna 0610009h20
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
120
structure length
120
Chain Sequence
GSSGSSGNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein (RIKEN cDNA 0610009H20)
publication title Solution structure of the hypothetical domain of RIKEN cDNA 0610009H20
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 20
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.980 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wj5A01
1WJ5A 4JQFA
chains in the Genus database with same CATH superfamily
1B9MA 3ELKA 3QU3A 2QSGX 3ZP5A 5DM6F 3FXKA 1A6IA 1RRJA 5LGTA 2H6BA 3FHNA 5DYMA 2VQHA 2NAZA 4XOPA 2K7LA 1D8JA 1HBXG 1UB9A 5KAIC 2MSYA 4IRGA 1FIPA 2HQ5A 2CG4A 4UV9A 1X4OA 2BY3A 3PSIA 3W6KB 2QKMB 2EZHA 3U2RA 1YFHA 2M8GX 5K7HA 2PFBA 3JSOA 4M3EA 2WB1A 2HVQA 2VJ4A 4LLLA 1B1BA 3DQVC 4GXOA 3H5RA 3GZ6A 4J01A 2Y9ZA 2RQQA 5HVQC 4YIRX 5F0CA 3I4NJ 1WJDA 3A4CA 2MC4A 3ZQCA 1FSHA 1HOMA 1S9HA 4IHYA 3NAUA 5GADJ 3RQIA 2LC2A 5F64A 3IKVA 4EMSA 5L3EA 2Z9OA 4RLFA 1MBJA 1EV7A 3LSJA 4Y3OA 1EJ9A 1EH6A 1ETQA 5GAHJ 2LG4A 4OMYA 2QKLB 3KIOA 4M6VA 2XSJC 4BQAA 1ZGJA 3RYRA 2A6TA 2OQRA 2P7VB 3BTIA 2PJPA 1U0JA 3N97A 1YTYA 4Q4ZF 3C2HA 3RPUA 4L5EA 1W4MA 3KP7A 1JUPA 4F55A 4N0BA 4Q48A 4MEYF 1E3PA 1JJ6C 1QU3A 5J1YA 2HOSA 4OOIA 2HPMA 1VQLI 3HBLA 4LB6B 5DCMB 5TISC 3HKZN 4Z2YA 3BROA 1ZRFA 2ME0A 4XRFA 1GV5A 2Z3YA 3L2QA 3I59B 1MJ9A 2FQ3A 4NC7A 1Q1VA 2KRFA 3GYHX 1WHUA 1Z05A 5CQEA 5EEHA 1ZYRF 3I64A 4IQJA 3F23A 5E20A 3I56I 3PO3J 2BVMA 4LITA 1Z7UA 2MH9A 4A3BJ 1FEXA 1PDNC 3J7AY 2WA0A 4Y13A 1FOYA 4AYBA 1E2XA 4CXFA 4WXDA 1WH5A 2R92J 3FF5A 2HWVA 3TGNA 2R5YA 4XL9A 4RAYA 1IRFA 2IVMA 1V5EA 1ZREA 2XRLA 2UZKA 2K4JA 1I5ZA 2DLLA 4CYCB 4LK1F 2KFDA 2JZYA 3OR1C 3DKYA 2JVHA 4UXNA 5CVVA 1H8AC 2RGVA 2YPRA 4KMUX 4M9SA 3CO7C 4PZJA 4L0ZB 4HRIA 2E71A 4G7ZF 5C4XJ 4F92B 4IVNA 1MNDA 1F36A 3DWLE 4F3QA 3SDGA 3C18A 1HKSA 4Y4RA 2HVRA 1WH7A 3LAPA 1X19A 1ZR2A 5K7FA 2H27A 2LBFB 3LSRA 3VYTB 2EJRA 5K5OA 2R7VA 3G1LA 1QGPA 3CCEI 2BGCA 2DA7A 1Y1WJ 3IRRA 1LQ1A 2GIVA 3VDXA 4NDLA 2GIZA 2A6EF 4YFNF 2HYFA 2LTPA 2JTVA 1V55H 2DFFA 3D5SC 4M3GA 3BQYA 2Z33A 3HG9A 3PNTA 4FX0A 1X1CA 1I27A 4ESBA 3BR3A 3HGYA 4ABZA 2JRMA 1EH7A 3F8NA 5M3FJ 1LE8A 4BEHA 5J6XA 2IA0A 4P1WA 3PFIA 2M8EA 2W85A 1SVOA 2LY2A 3SYTA 2KT0A 4ON0A 5GTIC 4MGRA 2E7WA 2TRTA 1ON2A 3TMOA 3J81Z 3HSFA 3LSMA 4BUPA 1USTA 5FD5A 2CUJA 4ZYAA 4B3XA 2E2IJ 1BN5A 2IT0A 1ETWA 2EFWA 1VQ6I 3E5UA 1BJZA 5DM7F 2XROA 3C2BA 3BY6A 1RPWA 4BS9A 2Y0SA 3K6GA 2K9NA 2DA2A 2H94A 2WWYA 1MBKA 3GFIA 4I98B 1BI0A 4AIHA 1EH8A 4A5NA 2LY9A 3A01B 4HX8A 3K4MA 4QTRA 1FPQA 2PQ8A 3V8KA 5ED4A 2X1DA 3CP8A 5IYDJ 1R9TJ 4P5OA 1FTTA 3CF2A 4M6YA 1YS7A 3ZQ7A 1T56A 4P9UA 2M1BA 4CCOA 2MG4A 2QSFX 1AKHA 3HUGB 1XD7A 3KYCB 3VPRA 5FB2A 5FRNA 1MW7A 5IP6A 1YJNI 3W2AA 4Q47A 3REOA 2CW0F 1F1ZA 5EF6A 1TP4A 1MSFC 1KZHA 2VODA 4BXUA 1JI8A 2VPRA 1AHDP 2O3FA 3ABTA 2IXSA 3SEZA 1VZ0A 2LOOA 2IP2A 3GUDA 1WJFA 1I39A 2IGNA 3DEWA 3OYDA 3DF8A 1I50J 1UG2A 1KQ0A 4G6DA 5JFRA 2NXNB 2QVOA 1BM9A 4PUSA 4AIDA 1IN5A 2KHMA 4DIQA 3RDIA 2LVSA 5FJ8J 3GXOA 3WODF 1V4RA 2XUBA 9ANTA 2MC3A 4EATA 4RB0A 3FISA 3OSFA 3BG9A 3ZCOA 2I10A 1FWZA 1NTCA 5E1WA 1BC8C 4EJUA 3QPTA 1XGOA 1ZARA 4CCMA 2V6CA 1FIAA 3A0HC 4KJZA 3J80K 1LNWA 3B02A 2X4HA 3MN2A 3SFIA 4DYQA 1OCZH 2E1OA 2CGPA 1ZAOA 3E97A 3TDUC 5FRMA 2BEOA 1ORKA 3ZMVA 5LGNA 2YX4A 2PJRB 2X48A 1FMWA 3F6OA 4BNCA 4HF1A 4RAFA 1QO0D 1T6SA 2CJJA 3E7LA 4IHTA 2P5KA 2QWWA 4LOCA 1U8RA 4CZZA 3ZMUA 1FYKA 3OV8A 4JP0A 4X6AJ 1QA6A 2GAUA 4PSWA 2KIQA 3T8RA 3EYYA 3KLNA 2KIUA 3MKWB 3HTSB 3HXLA 2LD5A 1KA8A 1MDMA 2DDBA 3S1MJ 5GPAA 3HRMA 4HBLA 4HLXA 3MQ0A 5D5VB 3CZ6A 3H0DA 2F4IA 2NVUB 3T1BA 4KFCA 2ZB9A 2EV6A 4M9ZA 2MA3A 3LSTA 1ZQ3P 2B63J 1FY7A 4BY7J 3WU0A 3AG1H 1NH3A 2ZJPF 5FLXK 5E3MA 2LF8A 1KQ9A 2W24A 4EGYA 3P9KA 2BHYA 3H92A 2FA5A 2DMPA 1OPCA 4CCNA 4ZDPA 4BYYA 5J1UA 4A0XA 3OYAA 1T0FC 5LGUA 1Z7LA 2LP0A 3K0LA 3HDDA 1IXRC 2JA7J 1IN7A 1IN8A 1CF7A 1Y0UA 4KICA 3IL2A 1J5YA 5IOYA 1IW7F 2MABA 2P6TA 3HRSA 2IS2A 1BI2A 1X3WB 3SHFA 2D1VA 2L02A 4QWQA 2W82A 1FBUA 4XKVA 5BPIA 4I0BA 3WGIA 1S8NA 3DLAA 3M8EA 3OY9A 2JRTA 5CVUA 4KNYA 2CU7A 2GQQA 3EUHC 3ML6A 2OJED 2NNYA 4IHSA 2XHKA 2Y2ZA 1B4AA 2ICWG 1LFPA 4I02A 4RM2A 3PQKA 3QAHA 1JGSA 4P96A 1OYWA 4B1RA 2XDVA 2PMHA 4HAMA 3GO5A 3GCMA 4RA2A 3L2WA 2HZDA 1NK2P 1OCRH 1MBHA 5A2QK 1X3ZB 2A68F 2IS6A 2KIFA 3HYIA 2L9NA 1IC8A 3WGHA 3BTCA 3HPGA 1A04A 1M1EB 2ADUA 2V79A 4H4KC 1FX7A 5D8LB 1RUOA 2A3SA 3CF5F 1IUFA 2ISZA 3GTGJ 2ELKA 4HX4A 1Q1HA 2PBIA 5IY5H 1JHFA 1P2FA 3MKZA 1JT0A 1UG0A 1ZLJA 3P9IA 4DNCA 2E1NA 1XMAA 5FLMJ 2IA1A 3JRDA 4AC0A 3TP0A 4XN3A 2CS3A 2R7SA 2QENA 2BXYA 4L9VA 5J40A 1Y0NA 4C9YA 1YO5C 3OIQA 2H09A 3E6BA 1VFCA 3ZMDA 3RTRA 4OAZA 4R1HA 2EFOA 2JT1A 1VQ5I 4IRIA 3B6AA 1BI3A 4FHTA 1IAWA 1DP7P 1PUFA 2WAQA 3GZNB 2DOEA 4GGGA 3OMYA 2RDPA 5BMZA 1O4XA 2H1KA 2W25A 1NG7A 2LK2A 3FK6A 4HQMA 2YS9A 3CCQI 3S3MA 5K7ZA 2K9LA 1ZG3A 2DN0A 2F5CA 2B9SA 4M3DA 2KZGA 5GPCA 5H20A 4ZZDA 3HM5A 3F21A 2OQGA 4W1UA 2JUCA 3F0CA 2LH9A 2CW8A 1R23A 3E6MA 3M07A 3WTTC 2CUFA 2O8KA 3WHBA 2IW5A 4V19K 1W36D 4F7ZA 3HHGA 2BXZA 4JYKA 4ENNA 3WTZA 5CQGA 2V1UA 2PG4A 1H0MA 1BW6A 2XIGA 1GV2A 4LGWA 1SAUA 1LB2A 4HA8A 1KONA 1R22A 2EZKA 2O7OA 4CCKA 4D0PA 5HLGA 4D5CA 5LHHA 1ZTRA 2ZNZA 3X2QH 3JRAA 4ZTJA 1YS6A 3C7JA 3K4JA 2DI3A 2X1CA 4M71A 5FFZA 5J4VA 1F4KA 1K6YA 3LOCA 2IS4A 4LK0F 1R58A 4BGDA 1USSA 3BR1A 3K4NA 3OS2A 4XORA 3IKTA 4XR6A 3F6VA 4F91B 2L54A 1TWCJ 4M74A 2LKSA 2R7XA 4A3KJ 1OCOH 1J75A 1NG6A 3GVAA 4UVAA 4D7MA 1YJ9I 2IA2A 1K7AA 1ERDA 4Y17A 1C0WA 3BJAA 3MZHA 2QYOA 4J19A 1GLNA 3ZN1A 5EZGA 2EFPA 1UHMA 2E7XA 2EBIA 1UCRA 2HPIA 3M9AA 3TEDA 1U6GA 3FBNB 3H3UA 4AU7A 2JPBA 1L0OC 2QBYB 3JREA 5DS9A 3QYEA 3H3VK 3L2UA 1MH3A 1W7PD 2DO7A 2V1DA 1MMAA 4F52A 4A3LJ 4B3AA 1HDDC 5HOOA 1U5TB 1P9QC 1MNMC 1AWCA 3GF2A 4M3BA 2LRDA 4UVBA 2XVCA 4G6QA 3KEQA 3U21A 3ULQB 1VQNI 3FM5A 3ZN0A 2M7AA 1N25A 4OINF 4RDUA 2VT2A 3RYPA 3DLLF 3B73A 2XSDC 2R7FA 4HDVA 4G7HF 1ZR4A 2H6CA 2MBFA 1LKXA 1O7FA 5F04A 4E6KG 5HLTA 4ZYEA 2DPDA 3MAJA 1R00A 3JAMZ 3WG7H 2GBYA 2FXAA 4EV0A 1SMTA 2R93J 2EWNA 3D5LA 1TZLA 1YJWI 3GFJA 2E5ZA 1IDYA 4MQVA 3VODA 2CV2A 1ETYA 2ME6A 5JLXA 1QBJA 2QSHX 3J7AO 3BG7A 2DFIA 5JI6A 2D1HA 2NOGA 1VQ7I 2KZVA 3KP2A 1SD6A 1W7PB 2DMUA 3AG3H 3BTJA 2FQ4A 2V7FA 4G6TB 3GTJJ 1TT0A 4C3IJ 3P9CA 3ZXSA 2ACJA 4GCVA 5LRRA 4GFBA 2IPQX 4NHJA 3KZIC 2J5PA 4IPAA 4UUSA 1V54H 3Q0UA 3ZMTA 4JOMA 3AAFA 4Y52J 2CFOA 5CVJA 2KJBA 1D1BA 2L01A 5LD2C 3CD6I 1IV8A 3EUKL 2P5VA 2ID3A 3UR3C 3FIWA 1X1BA 1ON1A 4WF2A 2HS5A 3NRVA 2ETHA 2VJJA 3JCUC 3FDYA 4FE4A 2K5CA 1WKMA 3QOEA 4A2UA 3L09A 4UY8I 1IV6A 3J80Z 2VQLA 3GZ5A 5M5WJ 1XSDA 1IDZA 5D5UB 5LEJA 4ZJZA 1SVLA 3LMMA 2UWMA 3JW4A 4HF0A 2V26A 3VSKA 2L7FP 3I9V2 5HDGA 2R0QC 3TQNA 4IQ4A 4ENMA 3KEYA 3V7RA 4DBQA 1B72B 2IGKA 1YITI 1VI0A 2HKOA 3BR0A 3CLQA 3I4PA 2RNGA 1T39A 4KISA 3RSNA 4A3DJ 4IHWA 3HIFA 2A6HF 3GWZA 1R5GA 1TW2A 4BHPA 2JN6A 1JXSA 1DGRM 3AKZA 1D0XA 2L7KA 2JUGA 1J9IA 1ETXA 2FOKA 4IL6C 4KUMA 2E2JJ 4RGRA 2E19A 2HOAA 4XLAA 1X1AA 2A69F 4A0ZA 4EM1A 1B8IB 3JSPA 3M8FA 2XGCA 2RAEA 1PVEA 1PP7U 1RKWA 1RNLA 1WGXA 3MWMA 1LFBA 3QP6A 2NS7A 3BLYA 2KKOA 4XONA 1A5JA 2K40A 2YR2A 3CUQB 1AU7A 1HCRA 3R4KA 3AG4H 3ERMA 5FKNA 4X0GA 2R4GA 4GO1A 2DTZA 1CQTA 1WVRA 2JQ7A 2LREA 2DCEA 4KIGA 4HQEA 2COMA 2X0LA 2OA4A 4NNJA 1BL0A 4GDFA 1SFEA 2I5UA 2CUZA 3GEZA 2DA5A 3HSEA 1K78B 2UV1A 3E5QA 5EDNA 2F2EA 2M34A 2DA1A 2H1LA 3T8TA 5A2QZ 3OYBA 1SC7A 3EDPA 1YOVB 1HW1A 2F4OB 1QQIA 4DBRA 1MBFA 3L9FA 2ZMEB 1O3SA 3PM1A 1TBXA 3CMEI 1K6OA 3AFHA 2DODA 5LHIA 2K86A 4OIQF 2DK5A 2FJ1A 4E7HA 2MLGA 3BCBA 1IXCA 3KYDB 2P7CB 1HDPA 2X6WA 3K9TA 4E70A 1WJBA 4EJVA 3HEFA 3KCCA 2HOTA 1MBEA 3IC7A 5E8GA 4PGHA 4DW6A 3E6DA 4CZCA 1QVUA 1YRNA 3PUBA 2EIJH 4OIOF 2RN7A 3ZQHA 2R5ZA 2E36A 2LR8A 1I6XA 1QRYA 3S8PA 2ZXIA 1G3SA 1OKRA 2F5DA 5F1RA 5FLVA 1ITYA 3C1DA 2M0CA 3KE2A 1FYMA 1UHSA 1CGPA 4XICA 2W48A 2EFNA 1YX5A 3F8CA 4A3FJ 3MZ8A 2M4KA 1YIJI 4AD9A 1JKRC 4KDPA 3LNQA 1KYZA 2LYCA 3RZOJ 1P4WA 4XBFA 4W97A 1H88C 5CYVA 4U7BA 1W5SA 1IRXA 5HNHA 3G71I 1LDJA 1MGTA 2V9PA 5K1YA 4HF2A 5F27A 1OCTC 1Z0XA 3LWFA 5GTHC 2JWTA 4MTEA 1OMIA 2J5OA 2ZCWA 3RPUD 4IX7A 4RGXA 2P81A 2VI6A 2UUZA 2ZC2A 5B5EC 4KIBA 2VKDA 4YIFA 1U9NA 3H1CA 5DTDA 2QEXI 3QU6A 5CVRA 4BJTA 1FYLA 3FMRA 3VWBA 3IWZA 3BC8A 4IKFA 3S3NA 3S3OA 2L4AA 4LLNA 1G2HA 2VQGA 3HGGA 1X58A 2VXDA 2HR3A 3EQLF 1GDTA 2FMYA 4A3MJ 3A01A 2YSRA 2HKXA 4BU2A 2R7TA 3OS0A 3DBRB 1OCCH 5FKLA 4DZPA 5EEAA 4C30A 3OYIA 4LIVA 2O61A 1XDUA 3CCSI 3S17J 3OYCA 4NBQA 2FOWA 2K3PA 5DV5A 3EETA 2XPUA 1LFUP 3ZGKA 1HKQA 1TQMA 3HTUA 4RS8A 2E34A 4ZC3A 5F08A 1YW7A 3WGGA 1A6QA 1TQPA 2OCEA 4ESJA 2M9HA 3M3YJ 1T98A 2DOFA 5D4SA 1FP1D 1YW8A 3ZQIA 1Z67A 1JUSA 1T95A 2JA5J 3G1OA 1Y1VJ 4B47A 2VN2A 1Y6IA 3BT9A 3CTAA 4HEA2 4ANJA 5DD4A 1ZK8A 4BL0B 4XMYA 3QP5A 4NC6A 3K70C 2XAUA 3G4SI 4UUVA 5LFAA 1O7LA 4LG0A 3MMYB 1GXPA 2KDOA 4FE7A 5CPRB 2QCOA 2NVTJ 5ICFA 2VUMJ 2M7BA 2KISA 3I71A 4KYWA 5IT9Z 2DYSH 3I54A 2ZFUA 1SFXA 4U0WA 2IRFG 1OLTA 3I55I 3LSHA 5FO5A 2EZLA 4B48A 2K9QA 2Z5UA 4LJZF 1UAAA 5DUIA 1PYVA 2R5YB 2G0EA 1FP2A 3BCAA 3KP5A 2P0WA 3OL3A 1WI9A 5M3MJ 2FNPA 2WC2A 1RZ4A 3Q3SA 3JAMK 2DA3A 2BY2A 2NS8A 3KEOA 3TOAA 3IRQA 1YYVA 4PFPA 2O6GE 1HC8A 2F48A 3PUFA 2LKXA 1P7JA 3PIPF 4EEFG 4MEXF 2AO9A 2DMQA 2IJLA 3FXOA 4LIUA 4L9JA 2AQEA 4PSXA 4ETSA 1MBGA 2EA4A 2O03A 3HSRA 3A0BC 1TTYA 4Y15A 1UJ8A 1DU0A 3A2KA 3WTVC 1LDDA 4QPOA 5IOZA 3FKIJ 3LSIA 2ID6A 5J1RA 1WPKA 3TW7A 4BJ6C 4WCGA 3HPHA 4BQQA 1XPXA 1HSJA 4C2UA 2ISYA 1FSEA 1OISA 2FUG2 1WRJA 2OZUA 3NWSA 2OF7A 3ZQFA 1O3TA 3ZQGA 2HXIA 4G7OF 4RB2C 3GFLA 3W6JB 4AVZA 2HI3A 3D5RC 1H89C 2F5VA 3SXYA 4KN4X 3OS1A 1LE8B 2AXLA 3OR2C 1XSXA 1QNTA 2PX9A 4BEHB 5H6RA 4BBRJ 4IO9F 2CV0A 1EKEA 2Y0MA 1ZRCA 2I8DA 3GMEA 3U9GA 2W1OA 4HPQA 3CMAI 5TJJA 3L2RA 1S5LC 2OTJI 1P92A 3VYUB 1HKTA 3GX4X 4XRMA 3F3XA 4C3JJ 2VJIA 2BW3A 2L9SA 2X9DA 3DCFA 1SMYF 1TQIA 3O2PE 5AIPA 5J8CA 2IAIA 3ECOA 3MEXA 1KU3A 4JK1X 2EPFA 5E8IA 1PP8F 3MKYB 3OYLA 4CICA 3DKXA 1G4DA 4K2EA 1N77A 4FETA 2QA4I 2VBWA 3MKLA 3CMYA 2HZTA 1POGA 4HNTA 3HOXJ 5FKOA 3OYFA 4RAGA 5J3LA 4HX7A 2VC1A 2Y9YA 2XF6A 2XB0X 5JR3A 1XDSA 4L5IA 2EH3A 2DJNA 5IP7J 4JX4A 2Q2EA 1AKHB 1ZLKA 4I76A 4DOZA 4BAYA 4G94A 1I1GA 4BXFA 3QPLA 2FE3A 2L0KA 4YIIA 1SD7A 3J7YJ 3WTSC 3WG9A 1OJLA 4JQFA 5FFXA 3SQNA 3BJOA 1BIAA 1K83J 2YU9J 4M72A 2HTJA 1LVAA 1HSTA 2ZKZA 1I3QJ 1KGSA 2YUSA 4PDKA 3PJRA 3HZJA 4XQFA 2DAOA 4J00A 2FRHA 2EIMH 1RUNA 2A5WA 1XCVA 4CO8A 1ZELA 3G2BA 2WADA 2RC4A 3OOPA 1FOWA 1ZG1A 3VEPA 2R7DA 3SZTA 5CLSA 1KQ8A 3K4KA 2AS5F 3GLLA 2WY7Q 2Z1DA 1OYYA 1RR7A 3DEUA 3PQJA 1BOAA 4NQWA 4O5VA 2O9LA 2R7UA 4QSHA 3HJEA 3M1CA 3FWEA 5HDKA 2V4JC 2E1MB 2OU2A 2PI0A 3JRIA 2RVCA 5C3EJ 1QPIA 3RCOA 1W36C 1T0FA 4OMZA 1VQ4I 4XIDA 4KMFA 4L5JA 5KNLA 1WFXA 2L2OA 3CCJI 5KCMA 3JRGA 3QYBA 2P6SA 3TL4X 1B6AA 4U7DA 2KDZA 2MLKA 4BQNA 4BE0A 3M7GA 1XGSA 3H5AA 1JKQC 2X6OA 4A6DA 2Y48A 2ZJ2A 2FEZA 2XAJA 4HSRA 3SZPA 1Z3YA 3HKZA 2L4MA 4LB5A 3C3WA 1D0ZA 1E17A 1LEBA 2WB1N 3EUHA 4HLYA 5HODA 1U8BA 1U5TC 3B6CA 2XPWA 1D5VA 2NVYJ 3DBLB 1VF9A 2HQRA 3LSGA 3Q9VA 1GUUA 2MW8A 3V8LA 4YRVA 1MDMB 2LDUA 1SVMA 4YG2F 1OFCX 2Y69H 4PJMA 5M5XJ 2FMLA 1G3WA 5EGOA 2L7MP 4G12A 2NVXJ 1WI3A 3FBIB 4XLNF 4CCJA 1BR4A 1FMVA 2EB7A 1W1WE 4NUBA 1MH4A 5EG0A 2QQBA 3SFZA 3N4MA 2DA4A 1XMKA 3RKXA 5HNFA 5ERIA 2XAGA 2HDDA 2K4BA 1OR7C 2QGUA 2QBYA 3CC2I 1YW9A 3IP4B 4EM2A 3GTQJ 2NRAC 5L3CA 4S04A 1CF7B 2X51A 2HDWA 1XC5A 3K1NA 4C2MJ 3ESWB 1K61A 4BDYA 3FXRA 2DFHA 4WXHA 3OWTA 3GTLJ 1XMXA 2CMPA 3M8JA 4F93B 2GOMA 4Y7NJ 2L9VA 4ITVA 4UV8A 4FISA 3L2CA 2PLYA 1XSVA 5D6FA 2VPLA 4KIFA 4MNUA 1ULYA 3U1KA 2MFZA 2EA2A 4L9TA 3HOZJ 1ODDA 2B7EA 4ENKA 1IGNA 1WJCA 1O3RA 4AYBN 4RMNA 1OR7A 2D2WA 4HNVA 3GTMJ 4EVIA 3E6CC 2OPTA 3FXLA 1R36A 3V4GA 1HA8A 3IHUA 2A61A 4LLGF 2KLOA 3F22A 1JHHA 2GXBA 4UHTA 2TDXA 3WHCA 1J09A 2M3AA 2W7NA 3Q5FA 2L5QA 3LA7A 3RQ4A 4ESFA 1JJ8C 2WAEA 2GA2A 2CQKA 3BPVA 2VASA 4B4CA 3SDBA 3R61A 4YELA 2TCTA 1BBYA 3IUOA 3COAC 2BY1A 4KITB 3CC7I 3DU5A 5F6FA 2FNAA 3L1PA 2E5NA 3KZZA 3ECHA 1JKOC 2GLOA 2HYGD 3A03A 1PUFB 1S6LA 1PJRA 4G9YA 2ZBKA 2VONA 3JR9A 3ZRGA 3JTHA 1ZRDA 3TO9A 3G1MA 1F43A 3PSFA 5HS7A 1I3AA 1SD4A 4A12A 3ABLH 3E5XA 3I53A 4N9HA 3VYRB 3C2GA 5ILUA 3GFMA 3CCLI 1LUJB 4KT6A 1ZGWA 3A02A 4E7ZA 5IT9K 3HOVJ 3EYIA 3CUQC 5AIQA 3HRTA 4E7SA 2DQLA 2RQPA 1IRGA 2CUEA 4KN7X 1NHAA 1SFOJ 1E0EA 2HQNA 2JPCA 2RKHA 2DMTA 4A0YA 2ZXWH 2KRCA 1MMGA 2QM3A 1XGMA 3FMQA 5C44J 5IPAA 4DYRA 2GWRA 4MFDA 3LSKA 3N05A 2DT5A 3PIOF 1JUMA 2Y0SN 2DXIA 4O6JA 3DPTA 1SANA 1X1PA 1DPUA 2VL8A 4TV7A 2VBYA 5EEGA 3M4OJ 2G7HA 3S2HJ 2DBBA 3RKQA 4WK8F 3DFGA 4AVPA 5B66C 4XSXF 1K4SA 2ZMEC 1VQ9I 4E7JA 1UFMA 3PO2J 3ZMZA 3CCVI 4AUXA 2KIMA 2PEXA 3KZYA 3HC7A 2F5EA 1FC3A 5JHUA 4IXAA 2D45A 4PJJA 3VFZA 2HVSA 2CSOA 4A69C 1IRZA 2DW4A 2Y31A 4ZTFA 2BV6A 3H35A 4G8XA 4X1EA 3R6SA 1I1SA 1QPMA 3FMSA 1FBQA 3BR5A 2HU9A 3LA3A 1KYWA 1TT5B 3AG2H 5GAEJ 1ZKGA 4II2A 1D8KA 1FOXA 1DPRA 2ZO4A 4M73A 1Y56A 4PGGA 4OAYA 4UNOA 3HOUJ 2VBZA 3IAM2 1K4TA 2R7RA 4Y33A 5K5QA 3HL2A 2VLAA 3L7WA 1ACIA 3PNYA 3SEQA 3FX3A 1JTXA 2FX0A 3WE3A 4EJWA 3JRHA 1H9TA 2WTEA 2E35A 4UB8C 4AIKA 2NOJB 4WWCA 1HXDA 4MLOA 4MFEA 5HLIA 2ZJRF 4ASNA 1BR2A 4Q5SF 2L9RA 4UB6C 3LQQA 2HFHA 4GYIA 1GVJA 2ZNYA 2BHZA 1V3FA 2DTRA 4CDGA 3I5UA 1DDNA 5DCMA 3OYKA 1FNNA 2F6CA 2CFXA 3RKWA 3DKWA 4UUSB 4BXXJ 1O57A 1U2WA 1R5ID 3I59A 2M30A 1S7AA 3CJNA 2DA6A 2JK3A 4PJLA 5B1BH 2NYXA 2JA2A 3K2ZA 5EZHA 3IWFA 2JMWA 2HDCA 2JJ7A 2DU9A 5E3NA 4OIPF 4LG3A 4HW0A 1BA5A 1S7OA 1K79A 1IG7A 2BZTA 2VB6A 3P7NA 4IOAF 1R1UA 1Z3XA 3CUOA 1DQUA 3OYEA 1R6RA 1BJAA 2CQ7A 4HV6A 1G59A 3CC4I 2LF7A 3BWGA 1X4PA 2YU3A 3F8MA 3V7CA 3D1NI 2OTLI 1MJAA 4FTHA 1X3UA 4C3HJ 5E3OA 5K5RA 5ILSA 2V6EA 2FBIA 2C6YA 2K9MA 2MGQA 1WCMJ 2DQRA 2MYSA 4CYCA 4IZZA 1GVDA 5BNGA 5EJCA 5GAGJ 3ABUA 1S3JA 3RKYA 1E3HA 5J47A 1WQ2A 2W00A 2KJCA 3E0JB 3WTUC 2V9KA 3H5NA 2AXTC 4E7LA 4ZYHA 2UXNA 5DEQA 3KP4A 2BBYA 2OD5A 1XX5A 3A1YA 1GHCA 1D3YA 4XKWA 2VKHA 2XKPA 3CLOA 4XLEA 5ICGA 2ELJA 4CYDA 2LBFA 2DT6A 3ASOH 3CDIA 3VB2A 2R7QA 1T8IA 2H8RA 3AL0B 4JX5A 2XKOA 1A31A 1TW3A 3FXUA 4OWRB 3KX2A 1N75A 2OC6A 2HGCA 2QZ8A 3OOUA 3S15J 4Z6YA 5HDNA 2NS0A 2EQRA 3G6EI 4KT5C 1B59A 1GXQA 4ZDLA 1T2KA 4LMYA 2XGEA 5B3SH 3RZDJ 2AQFA 3NEUA 4D1QA 1E3OC 2LFBA 4HSTA 2VE9A 2Q0OA 4RBOA 5AONA 1YLFA 1ZN2A 2ZSIB 3SZGA 2LKPA 5J8FA 1QZZA 1WWXA 5E18F 4HOBA 3BZKA 4CGZA 4QLCU 4I2OA 2L3DA 3CJRB 1SD5A 4U88A 5ICEA 2CQXA 3G73A 3TDZC 3LAJA 1IF1A 4XNFA 2KMUA 3BG6A 3OSGA 5D8KB 2VXZA 1XN7A 3H36A 2VJ5A 4WX9A 3TBIA 2K27A 3GW2A 2K02A 2WAQN 3I0TA 3F72A 4DQ2A 3CP2A 3Q0VA 1MSEC 2VQCA 3RJPA 1XCBA 2HTSA 4QPQA 3DP7A 4MIMA 4WXCA 3E3VA 2GOXB 1YIOA 1X1DA 4XRSG 4EQQA 3LL7A 4AM3A 3I58A 4XKCA 2V1XA 3KP3A 3W2WA 2M5WA 3L00A 3K1PA 4B44A 3MCZA 2R7OA 3GTKJ 1N78A 2QF7A 4IF4A 1T08B 4M6XA 5FKMA 3W2VA 4DZJA 1R71A 3HUGA 4XKBA 2ESHA 2FU4A 2XF7A 5FGMA 4BH9A 4E7KA 1QVTA 4II3A 1OCPA 4A3GJ 3K4LA 3S1NJ 4U0VA 2XC7A 3BJ6A 3HOSA 3ZOBA 2O5RA 1QZEA 1VQMI 4DJAA 1FTZA 5FROA 3RIRA 2XV4S 3K2AA 3ABKH 3S2WA 3ABMH 4CSWA 3F8BA 2VE8A 3JRBA 1YRNB 2P4WA 2FBHA 1QZYA 2VOPA 2R5ZB 3LA2A 2DOAA 4KA4A 2ZXHA 4B43A 5JVGF 2N8GA 2XAFA 4XLFA 2EIKH 4L0YB 3PNVA 5KHDA 3S14J 4IOCF 3DV8A 3QPHA 2YX7A 2FBKA 3LSPA 2WY8Q 1DU6A 3E1SA 2P8TA 5LHGA 3S2DJ 1Z6RA 3FXJA 2BYVE 3BPXA 5BS6A 5D6EA 3ASNH 4A3JJ 2M2EA 1W0TA 1REPC 1TWGJ 2VKEA 1Z1DA 4XRSA 2GXAA 4A3IJ 1DUXC 2COBA 3BZ6A 2IGMA 4PCQA 4MTDA 5CJ9A 3GTPJ 2EZIA 1V5GA 2MD0A 3BG5A 4XN0A 1T33A 1X2NA 2PJRA 1S7EA 4CH7A 4XLHA 1RR8C 2ECCA 1UMQA 5C4JJ 3PL8A 3OYHA 3NARA 3JTGA 2CQQA 3BQZA 1IN4A 2ZFWA 1MKMA 5F0HA 4RAZA 1V5FA 3DTKA 5BQTA 2XF5A 1W5TA 5D5WB 2STWA 3QODA 2HXOA 2WBMA 4BY1J 4ZYDA 1D0YA 5FKKA 3TO6A 3ROUA 1BC7C 1JGGA 4C2TA 5BOXA 4JX6A 3H0GJ 4FX4A 4S05A 1RKTA 4E7IA 3U1DA 2HQAA 3H3ZA 2VT3A 3WTWC 4YFKF 3JRFA 2K85A 5L3FA 3K1MA 2GXGA 2E1MC 4B09A 4IEJA 2M87A 1HW5A 5KK1A 1BI1A 4BACA 2DJIA 4ZZLA 2JA6J 1FLIA 1ENHA 2PMZA 4HNUA 3QWLA 2OZ6A 3I4MJ 1Z91A 4E4HA 5B1AH 1R4MB 3GLXA 3KYLA 1JTYA 4M3FA 1FZPB 4HV5A 3WU2C 1R1TA 5DDGA 3K70D 4I01A 5E79C 4L9NA 1XB4A 3QPSA 5E1XA 4RB1A 4LG0B 1FT9A 1TL8A 1BW5A 4A3CJ 2MD5A 3O3KA 2QQAA 2IEKA 2E60A 1X2MA 2A07F 3OYMA 1LPQA 2ZSHB 2K3FA 3GBGA 1YG2A 2EFQA 3CJTB 3ISPA 1P7IA 3BG3A 1Z6TA 4I09A 3FXMA 4BHBA 2ESNA 2JVGA 3FXQA 1TWHJ 2V9VA 1ZG5A 5LEKA 3K4CA 4N4NB 4U0YA 1A36A 3VOEA 2JSPA 4N4OB 2LY1A 2Y30A 4XSZF 3CJQB 1YE9A 2XASA 1T38A 2LMDA 2KRHA 1J0RA 4CUGA 1ETVA 3W3CA 1LDKB 1MZBA 3I3LA 3TO7A 4ENJA 2OV7A 5CVIA 4LFUA 2VC0A 2XAHA 3MVPA 2Z16A 5ILVA 4CCLA 3R0JA 2OBPA 4CHUA 4O3MA 3Q9SA 5L3GA 3T5XA 1J59A 3K7AJ 5J4YA 4NC8A 4FT8A 1P4XA 4B8XA 5LBQA 1KU9A 3EPZA 1G8XA 2XGDA 2XRNA 3CMMA 3ZPLA 4D5FA 4MO7A 2Z2SB 4IHVA 3OYGA 2STTA 5TRDA 3KFWX 2A5YB 3QOPA 2GA1A 2F4MB 2PMUA 1G3TA 5H2FC 2FD5A 2LLKA 1TC3C 5IP9J 3S1QJ 4DGWB 3ERED 4EJTA 1NK3P 5LLQA 2BY0A 5HS9A 2E2HJ 1MMSA 2A05A 1BIBA 1J2XA 2NVQJ 4XK4A 5IYCJ 5D4RA 2KL4A 2XGXA 4PJ0C 4RLQA 4ZDOA 3KLOA 1YI2I 5F0FA 1OYIA 1XS9A 1PUEE 3CCRI 3CDLA 4P9FA 1MNEA 1ONVA 1J7KA 4QIWN 3SJMA 4HDUA 5IYBJ 1P6RA 4AWXB 4BQOA 4L18B 1MMDA 4EJOA 1WSUA 1VQKI 2BW3B 4RM3A 1B9NA 4BDZA 2CRGA 1R49A 2R7WA 2GZWA 1F9NA 1STZA 1U9OA 2XB5A 2V1NA 1EA3A 4IRHA 2RREA 4XLCA 4BE1A 1YHQI 1KU7A 1WJAA 2X85A 1XG1A 2WV0A 3FKJA 3H9GA 1YQAA 2HNHA 3BTLA 3QRFF 4OIRF 3CCYA 2PN6A 3LFUA 4IHXA 1S29A 1APLC 3CO6C 2QQ8A 1D1AA 5JHFA 2DYRH 1TNSA 2EV5A 3R0AA 1MMNA 3HRUA 1SAXA 3LFKA 3EUAA 4UVCA 2KPMA 3RPQA 3T0YA 3HHHA 2Q2EB 3ONQA 1A35A 4A5MA 3K69A 2M0MA 3DU6A 2DFEA 2H8WA 2FF4A 2X1EA 3NWTA 4U87A 4A6EA 4XLPF 1RI7A 5KVRA 4DYCA 1Y8QB 1S72I 1WZ2A 4NB5A 2CH0A 1UELB 4EGZA 3O8GA 1D1CA 4I99C 2K9SA 1AA7A 2Y75A 4I6ZA 1U5TA 4HZFA 4P55A 3FK7A 1R1VA 2AHQA 2EK5A 2VIXA 2OAZA 5DCFA 3K10A 1VQ8I 1MJBA 4BBSJ 2EV0A 1Y8RB 4MQ9F 3O6BB 1SFUA 1ETKA 5LRSA 3DEEA 3NQOA 2KQRA 3PFYA 4I0AA 3KETA 1DP3A 1HQCA 1IXSB 4NQWB 3CCUI 1VQOI 3BP8A 1SFKA 3CESA 5E17F 1HW2A 4PJNA 2IS1A 4IJAA 2G9WA 1VTNC 2EINH 2OUMA 1TNTA 2QQ9A 2VKVA 4R8HA 3CDHA 2CV1A 2QLZA 3Q0WA 1Z21A 1JE8A 3TP3A 1JKPC 5E1ZB 3TOBA 1QHGA 3IAS2 3HOTA 4EM0B 1W7PA 2CYYA 3BDDA 1VNDA 5ICCA 3DXJF 3KPHA 5D5XB 3DTIA 1LJ9A 1O3QA 3BR2A 1YX3A 3QYFA 2P5LC 5KAFC 2HYJA 1WJ5A 3BR6A 4FQGA 3DPLC 1Y39A 3P5JA 2DT7B 2RNJA 2ZXJA 1TWFJ 3WTXC 4S0HB 3QQAA 1D5YA 2X6XA 1IO2A 4GYGA 3FHZA 5CKTA 1UHWA 5IT3A 2E1CA 3W6VA 2M45A 5E3LA 5DD8A 3CCMI 5EGOB 4FASD 2NNNA 1L3LA 4BE2A 2VOOA 1FJLA 1AOYA 1HF0A 4V2FA 5EG0B 4ZYGA 3R60A 3WU1B 1G6NA 2W4SA 3D0SA 1G3YA 1MD0A 2Z99A 4XOTA 4ZH4F 2R7ZJ 2VBXA 5L3DA 4BKXA 3KP6A 3OYJA 2OCCH 3S1RJ 4H0EA 1H9GA 3BZCA 1F5TA 1B72A 1UZCA 5M5YJ 1GT0C 1IN6A 3K4BA 4D7NA 3J81K 1I6HJ 4HYEA 2EILH 2MH2A 2DPUA 3DBHB 5JLWA 1ZHFA 2CO5A 4BJ5C 2XPVA 3MZYA 2DMNA 5HLHA 1MIJA 6PAXA 5BPDA 1R7JA 3ZQQA 4PK4A 3H9QA 4I7HA 1ZH5A 1B8IA 3OIPA 1OQYA 2M4GA 4YFXF 2DDAA 1XGNA 4PFOA 4HG2A 1RETA 4RGUA 5TGTA 5HS8A 2CQNA 4M9XA 2BE5F 1SEUA 1W5CC 4V2GA 3VSLA 3CUQA 5FD6A 4CA0A 4RB3C 4A3EJ 2L7ZA 1IUYA 4R79A 2Q1ZB 3H9JA 2UXXA 2Q8KA 4UUTA 1ETOA 3OYNA 2CWEA 2XAQA 2WAFA 3LQRA 2O8XA 3MD2A 1LVKA 1FOKA 4GRIA 3WE2A 1TLHB 3S93A 1Z9CA 3V7SA 4LD5A 2F5FA 5EYRA 3FM3A 3S32A 2R3SA 2RV8A 3UKGA 1P4AA 1K78A 3IH4A 4N9IA 3HOWJ 3CQZJ 1QHHD 2JA8J 1HLVA 3TKYA 2LNBA 3FZVA 2ELHA 5JVTA 3AL0C 1TWAJ 3V42A 3HB9A 2ZJQF 1U78A 2BOLA 3IH3A 3V8JA 1RC9A 4BHCA 1BOBA 2W84A 2ZMEA 1W0UA 3S16J 1LEAA 2CW7A 4FCYA 3J7ZI 1EF4A 1BR1A 2IBDA 2PMZN 4XM3A 3RI4A 1WJEA 5L3BA 3GTOJ 2KP6A 5GP9A 3BOQA 3OIOA 2HEOA 4JBAA 2LSOA 5DUKA 1VQPI 1IJWC 4D9JA 3DTEA 3M1EA 3ZR8X 3DPUA 1IZ1A 4A93J 2HOEA 2W57A 3MFKA 1U3EM 3L2VA 1JT6A 1ZGAA 2IGOA 3UNGC 1R5HA 3WTYC 4RGSA 1Z77A 2ECBA 2QUFA 1XTAA 3VYSB 1R4NB 2BVLA 2FSWA 3IV5A 4MHGA 2X6YA 3F9KA 3OL4A 2JSCA 4YEJA 3G3ZA 2O0YA 1RESA 2G7UA 5H6QA 2GM4A 2WV1A 2DK8A 5FLXZ 2B0LA 3HOYJ 1FBSA 2D5VA 3F8FA 3JRCA 5F1JA 4OU0A 3ZQLA 1KU2A 3IH2A 3O8HA 4AIJA 1RIOH 1DGWY 3ZMSA 3TW6A
chains in the Genus database with same CATH topology
3QYEA 2A5WA 2WY8Q 3E1SA 1ZELA 3G2BA 2WADA 3L2UA 1MMAA 4F52A 5HOOA 1P9QC 3FHNA 2LRDA 2VQHA 4XOPA 3K4KA 2WY7Q 2Z1DA 3U21A 2M7AA 1X4OA 3PSIA 2R7UA 2QKMB 2IGMA 3M1CA 2V4JC 2E1MB 1V5GA 2MD0A 1LKXA 2WB1A 2HVQA 2VJ4A 4XN0A 4E6KG 3RCOA 3DQVC 5HLTA 3H5RA 4CH7A 4XLHA 4J01A 1W36C 2PJRA 2RQQA 5HVQC 5KNLA 1WJDA 3PL8A 3A4CA 2MC4A 3OYHA 1WFXA 1S9HA 2L2OA 5KCMA 2LC2A 3QYBA 3D5LA 1TZLA 3TL4X 2E5ZA 4BQNA 1V5FA 3DTKA 4BE0A 4RLFA 2XF5A 2CV2A 3H5AA 4Y3OA 3QODA 4HSRA 3BG7A 1Z3YA 2WBMA 3HKZA 2LG4A 2KZVA 1D0ZA 2QKLB 2XSJC 1D0YA 2A6TA 4G6TB 2V7FA 1U0JA 4C2TA 1TT0A 3C2HA 3ZXSA 3LSGA 4YRVA 4E7IA 4PJMA 2HQAA 4F55A 4JOMA 1QU3A 2HPMA 2CFOA 2E1MC 3FBIB 1D1BA 4CCJA 5LD2C 4BACA 1BR4A 1FMVA 2DJIA 4NUBA 3EUKL 3UR3C 2PMZA 4HNUA 3L2QA 1X1BA 5HNFA 2VJJA 4NC7A 4E4HA 3FDYA 2K5CA 3KYLA 3QOEA 1OR7C 5CQEA 3K70D 4IQJA 2VQLA 3IP4B 2X51A 2HDWA 4ZJZA 2BVMA 4LITA 4BDYA 3LMMA 3OWTA 2UWMA 3J7AY 2WA0A 2V26A 2CMPA 4AYBA 3VSKA 3M8JA 4F93B 2GOMA 3I9V2 4ITVA 4IQ4A 2E60A 3KEYA 4DBQA 3OYMA 2ZSHB 4XL9A 3GBGA 1V5EA 2IGKA 2VPLA 2MFZA 2JVGA 2RNGA 3OR1C 3DKYA 2JVHA 4KISA 3RSNA 3K4CA 4N4NB 2JSPA 1WJCA 4N4OB 2LY1A 4RMNA 4HRIA 3CJQB 1YE9A 1DGRM 1MNDA 4F92B 3DWLE 3AKZA 2KRHA 1D0XA 2L7KA 2JUGA 4CUGA 4F3QA 1HA8A 3W3CA 4Y4RA 2KLOA 2HVRA 1LDKB 3I3LA 4XLAA 1J09A 2M3AA 2OV7A 1X1AA 1X19A 2W7NA 2LBFB 2L5QA 3VYTB 2Z16A 3RQ4A 4CCLA 2WAEA 2R7VA 2VASA 3SDBA 3BLYA 4XONA 4YELA 3IUOA 4NC8A 3EPZA 1G8XA 4KITB 3DU5A 3VDXA 4X0GA 2R4GA 3CMMA 2Z2SB 3D5SC 2LREA 2E5NA 3OYGA 2DCEA 3HG9A 3PNTA 1X1CA 1PJRA 4NNJA 4BEHA 4DGWB 2CUZA 3ZRGA 4P1WA 2LY2A 3SYTA 2UV1A 2KL4A 4RLQA 3PSFA 3TMOA 3LSMA 4BUPA 4ZDOA 3VYRB 4ZYAA 2CUJA 4B3XA 3C2GA 3OYBA 4KT6A 1MNEA 4E7ZA 4BQOA 4DBRA 1MMDA 4E7SA 4BS9A 2Y0SA 3K6GA 3AFHA 2BW3B 4RM3A 1E0EA 4BDZA 2R7WA 4E7HA 4XLCA 2V1NA 1EA3A 4BE1A 2RREA 3BCBA 3K4MA 1WJAA 2KRCA 2X1DA 2X85A 3FKJA 3H9GA 3CP8A 1MMGA 2HNHA 2X6WA 1WJBA 4P5OA 3CF2A 3LFUA 4CCOA 3LSKA 3HUGB 1D1AA 3N05A 5JHFA 5FRNA 1MW7A 2DXIA 3W2AA 1MMNA 3DPTA 4CZCA 2VL8A 3EUAA 3PUBA 2KPMA 2Q2EB 3ONQA 1JI8A 2M0MA 2IXSA 3DU6A 3S8PA 3SEZA 1VZ0A 2X1EA 2ZXIA 3NWTA 2LOOA 4U87A 1WJFA 2IGNA 3OYDA 4PUSA 2CH0A 1UELB 4E7JA 2KHMA 1YX5A 4DIQA 1D1CA 2M4KA 1AA7A 2LYCA 3HC7A 4EATA 4PJJA 4U7BA 1IRXA 2HVSA 5HNHA 2VIXA 3ZCOA 3K10A 4ZTFA 3H35A 4CCMA 3RPUD 3DEEA 4IX7A 4KJZA 2KQRA 2UUZA 2HU9A 2VKDA 3PFYA 1DP3A 4II2A 4NQWB 4BJTA 3VWBA 1SFKA 3CESA 3BC8A 1Y56A 4OAYA 4PJNA 5FRMA 4IKFA 3S3NA 2IS1A 3IAM2 3S3OA 2R7RA 4Y33A 2PJRB 2OUMA 2VQGA 1FMWA 3HL2A 2VXDA 2VLAA 2CV1A 3PNYA 3SEQA 1Z21A 4BU2A 2R7TA 3OS0A 1QHGA 3IAS2 3HOTA 4C30A 2NOJB 3OYIA 4LIVA 3DTIA 1YX3A 3OYCA 3QYFA 4PSWA 4MLOA 2K3PA 1WJ5A 3MKWB 3HXLA 3DPLC 3ZGKA 2DT7B 1BR2A 4ZC3A 3CZ6A 3H0DA 2X6XA 2F4IA 3OYKA 2F6CA 5CKTA 1T95A 4FASD 4PJLA 4B47A 4BE2A 4CCNA 2JA2A 1Y6IA 4ZDPA 3OYAA 1T0FC 1Z7LA 4HEA2 4ANJA 4BL0B 4XMYA 2W4SA 3K70C 4LG3A 2MABA 2XAUA 2IS2A 2VB6A 5LFAA 4XOTA 1Z3XA 3MMYB 2KDOA 5CPRB 1DQUA 3OYJA 3OYEA 1R6RA 2W82A 4XKVA 1G59A 2M7BA 1X4PA 3DLAA 3OY9A 3EUHC 2ZFUA 1OLTA 3LSHA 2V6EA 1LFPA 2K9MA 4RM2A 4B48A 2MYSA 3K4BA 4IZZA 1UAAA 2XDVA 1PYVA 3L2WA 2HZDA 3BCAA 2W00A 2IS6A 3E0JB 2V9KA 3H5NA 4E7LA 2L9NA 2P0WA 3OL3A 3HPGA 4BJ5C 4H4KC 3A1YA 4PFPA 3ZQQA 4PK4A 4XKWA 3H9QA 2VKHA 4XLEA 2ELJA 3OIPA 4LIUA 2LBFA 2DT6A 3MKZA 2M4GA 2AQEA 4PSXA 1UG0A 4PFOA 4HG2A 2R7QA 5TGTA 3AL0B 4XN3A 3A2KA 4OWRB 3KX2A 3VSLA 2CS3A 4CA0A 1N75A 2OC6A 3OOUA 2R7SA 4R79A 2Q1ZB 3H9JA 4QPOA 4C9YA 3LSIA 3OIQA 3RTRA 3OYNA 4ZDLA 4OAZA 2AQFA 4BJ6C 2WAFA 3HPHA 4BQQA 4D1QA 4C2UA 3MD2A 2WAQA 2FUG2 1LVKA 3OMYA 4HSTA 4GRIA 3NWSA 3S93A 1NG7A 2ZSIB 3SZGA 3S3MA 4AVZA 3D5RC 2K9LA 2F5VA 3CJRB 3S32A 3OS1A 3OR2C 4BEHB 4XNFA 2KMUA 3BG6A 2CV0A 2LH9A 1QHHD 2VXZA 2CW8A 2VJ5A 2I8DA 3TBIA 2W1OA 4HPQA 3CP2A 2VQCA 3AL0C 3L2RA 3V42A 3VYUB 4QPQA 2BOLA 1W36D 1BOBA 2GOXB 5CQGA 2CW7A 1BR1A 1X1DA 2VJIA 2BW3A 2L9SA 3LL7A 4XM3A 1WJEA 4XKCA 1SAUA 3W2WA 1KONA 2KP6A 4CCKA 4B44A 4D9JA 4ZTJA 3MKYB 2R7OA 3K4JA 3DKXA 3OYLA 3DTEA 2X1CA 3ZR8X 3DPUA 4FETA 1N77A 1N78A 1K6YA 4HNTA 3L2VA 2IS4A 2IGOA 3UNGC 3W2VA 3OYFA 4XKBA 2XF7A 4BGDA 4E7KA 3K4NA 3OS2A 4XORA 4XR6A 4II3A 3VYSB 4F91B 3K4LA 2XF6A 2BVLA 2R7XA 2XC7A 2X6YA 3F9KA 3HOSA 2O5RA 1NG6A 3OL4A 4YEJA 4DJAA 5FROA 4DOZA 1ERDA 4BXFA 4CSWA 1GLNA 4JQFA 2DOAA 2ZXHA 4B43A 4XLFA 2HPIA 3FBNB 4AU7A 3PNVA 3PJRA 5KHDA 1DGWY 4XQFA 4J00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ5 A;  4JQF A; 
#chains in the Genus database with same CATH topology
 1B9M A;  3ELK A;  3QU3 A;  2QSG X;  3ZP5 A;  5DM6 F;  3FXK A;  1A6I A;  1RRJ A;  5LGT A;  2H6B A;  3FHN A;  5DYM A;  2VQH A;  2NAZ A;  4XOP A;  2K7L A;  1D8J A;  1HBX G;  1UB9 A;  5KAI C;  2MSY A;  4IRG A;  1FIP A;  2HQ5 A;  2CG4 A;  4UV9 A;  1X4O A;  2BY3 A;  3PSI A;  3W6K B;  2QKM B;  2EZH A;  3U2R A;  1YFH A;  2M8G X;  5K7H A;  2PFB A;  3JSO A;  4M3E A;  2WB1 A;  2HVQ A;  2VJ4 A;  4LLL A;  1B1B A;  3DQV C;  4GXO A;  3H5R A;  3GZ6 A;  4J01 A;  2Y9Z A;  2RQQ A;  5HVQ C;  4YIR X;  5F0C A;  3I4N J;  1WJD A;  3A4C A;  2MC4 A;  3ZQC A;  1FSH A;  1HOM A;  1S9H A;  4IHY A;  3NAU A;  5GAD J;  3RQI A;  2LC2 A;  5F64 A;  3IKV A;  4EMS A;  5L3E A;  2Z9O A;  4RLF A;  1MBJ A;  1EV7 A;  3LSJ A;  4Y3O A;  1EJ9 A;  1EH6 A;  1ETQ A;  5GAH J;  2LG4 A;  4OMY A;  2QKL B;  3KIO A;  4M6V A;  2XSJ C;  4BQA A;  1ZGJ A;  3RYR A;  2A6T A;  2OQR A;  2P7V B;  3BTI A;  2PJP A;  1U0J A;  3N97 A;  1YTY A;  4Q4Z F;  3C2H A;  3RPU A;  4L5E A;  1W4M A;  3KP7 A;  1JUP A;  4F55 A;  4N0B A;  4Q48 A;  4MEY F;  1E3P A;  1JJ6 C;  1QU3 A;  5J1Y A;  2HOS A;  4OOI A;  2HPM A;  1VQL I;  3HBL A;  4LB6 B;  5DCM B;  5TIS C;  3HKZ N;  4Z2Y A;  3BRO A;  1ZRF A;  2ME0 A;  4XRF A;  1GV5 A;  2Z3Y A;  3L2Q A;  3I59 B;  1MJ9 A;  2FQ3 A;  4NC7 A;  1Q1V A;  2KRF A;  3GYH X;  1WHU A;  1Z05 A;  5CQE A;  5EEH A;  1ZYR F;  3I64 A;  4IQJ A;  3F23 A;  5E20 A;  3I56 I;  3PO3 J;  2BVM A;  4LIT A;  1Z7U A;  2MH9 A;  4A3B J;  1FEX A;  1PDN C;  3J7A Y;  2WA0 A;  4Y13 A;  1FOY A;  4AYB A;  1E2X A;  4CXF A;  4WXD A;  1WH5 A;  2R92 J;  3FF5 A;  2HWV A;  3TGN A;  2R5Y A;  4XL9 A;  4RAY A;  1IRF A;  2IVM A;  1V5E A;  1ZRE A;  2XRL A;  2UZK A;  2K4J A;  1I5Z A;  2DLL A;  4CYC B;  4LK1 F;  2KFD A;  2JZY A;  3OR1 C;  3DKY A;  2JVH A;  4UXN A;  5CVV A;  1H8A C;  2RGV A;  2YPR A;  4KMU X;  4M9S A;  3CO7 C;  4PZJ A;  4L0Z B;  4HRI A;  2E71 A;  4G7Z F;  5C4X J;  4F92 B;  4IVN A;  1MND A;  1F36 A;  3DWL E;  4F3Q A;  3SDG A;  3C18 A;  1HKS A;  4Y4R A;  2HVR A;  1WH7 A;  3LAP A;  1X19 A;  1ZR2 A;  5K7F A;  2H27 A;  2LBF B;  3LSR A;  3VYT B;  2EJR A;  5K5O A;  2R7V A;  3G1L A;  1QGP A;  3CCE I;  2BGC A;  2DA7 A;  1Y1W J;  3IRR A;  1LQ1 A;  2GIV A;  3VDX A;  4NDL A;  2GIZ A;  2A6E F;  4YFN F;  2HYF A;  2LTP A;  2JTV A;  1V55 H;  2DFF A;  3D5S C;  4M3G A;  3BQY A;  2Z33 A;  3HG9 A;  3PNT A;  4FX0 A;  1X1C A;  1I27 A;  4ESB A;  3BR3 A;  3HGY A;  4ABZ A;  2JRM A;  1EH7 A;  3F8N A;  5M3F J;  1LE8 A;  4BEH A;  5J6X A;  2IA0 A;  4P1W A;  3PFI A;  2M8E A;  2W85 A;  1SVO A;  2LY2 A;  3SYT A;  2KT0 A;  4ON0 A;  5GTI C;  4MGR A;  2E7W A;  2TRT A;  1ON2 A;  3TMO A;  3J81 Z;  3HSF A;  3LSM A;  4BUP A;  1UST A;  5FD5 A;  2CUJ A;  4ZYA A;  4B3X A;  2E2I J;  1BN5 A;  2IT0 A;  1ETW A;  2EFW A;  1VQ6 I;  3E5U A;  1BJZ A;  5DM7 F;  2XRO A;  3C2B A;  3BY6 A;  1RPW A;  4BS9 A;  2Y0S A;  3K6G A;  2K9N A;  2DA2 A;  2H94 A;  2WWY A;  1MBK A;  3GFI A;  4I98 B;  1BI0 A;  4AIH A;  1EH8 A;  4A5N A;  2LY9 A;  3A01 B;  4HX8 A;  3K4M A;  4QTR A;  1FPQ A;  2PQ8 A;  3V8K A;  5ED4 A;  2X1D A;  3CP8 A;  5IYD J;  1R9T J;  4P5O A;  1FTT A;  3CF2 A;  4M6Y A;  1YS7 A;  3ZQ7 A;  1T56 A;  4P9U A;  2M1B A;  4CCO A;  2MG4 A;  2QSF X;  1AKH A;  3HUG B;  1XD7 A;  3KYC B;  3VPR A;  5FB2 A;  5FRN A;  1MW7 A;  5IP6 A;  1YJN I;  3W2A A;  4Q47 A;  3REO A;  2CW0 F;  1F1Z A;  5EF6 A;  1TP4 A;  1MSF C;  1KZH A;  2VOD A;  4BXU A;  1JI8 A;  2VPR A;  1AHD P;  2O3F A;  3ABT A;  2IXS A;  3SEZ A;  1VZ0 A;  2LOO A;  2IP2 A;  3GUD A;  1WJF A;  1I39 A;  2IGN A;  3DEW A;  3OYD A;  3DF8 A;  1I50 J;  1UG2 A;  1KQ0 A;  4G6D A;  5JFR A;  2NXN B;  2QVO A;  1BM9 A;  4PUS A;  4AID A;  1IN5 A;  2KHM A;  4DIQ A;  3RDI A;  2LVS A;  5FJ8 J;  3GXO A;  3WOD F;  1V4R A;  2XUB A;  9ANT A;  2MC3 A;  4EAT A;  4RB0 A;  3FIS A;  3OSF A;  3BG9 A;  3ZCO A;  2I10 A;  1FWZ A;  1NTC A;  5E1W A;  1BC8 C;  4EJU A;  3QPT A;  1XGO A;  1ZAR A;  4CCM A;  2V6C A;  1FIA A;  3A0H C;  4KJZ A;  3J80 K;  1LNW A;  3B02 A;  2X4H A;  3MN2 A;  3SFI A;  4DYQ A;  1OCZ H;  2E1O A;  2CGP A;  1ZAO A;  3E97 A;  3TDU C;  5FRM A;  2BEO A;  1ORK A;  3ZMV A;  5LGN A;  2YX4 A;  2PJR B;  2X48 A;  1FMW A;  3F6O A;  4BNC A;  4HF1 A;  4RAF A;  1QO0 D;  1T6S A;  2CJJ A;  3E7L A;  4IHT A;  2P5K A;  2QWW A;  4LOC A;  1U8R A;  4CZZ A;  3ZMU A;  1FYK A;  3OV8 A;  4JP0 A;  4X6A J;  1QA6 A;  2GAU A;  4PSW A;  2KIQ A;  3T8R A;  3EYY A;  3KLN A;  2KIU A;  3MKW B;  3HTS B;  3HXL A;  2LD5 A;  1KA8 A;  1MDM A;  2DDB A;  3S1M J;  5GPA A;  3HRM A;  4HBL A;  4HLX A;  3MQ0 A;  5D5V B;  3CZ6 A;  3H0D A;  2F4I A;  2NVU B;  3T1B A;  4KFC A;  2ZB9 A;  2EV6 A;  4M9Z A;  2MA3 A;  3LST A;  1ZQ3 P;  2B63 J;  1FY7 A;  4BY7 J;  3WU0 A;  3AG1 H;  1NH3 A;  2ZJP F;  5FLX K;  5E3M A;  2LF8 A;  1KQ9 A;  2W24 A;  4EGY A;  3P9K A;  2BHY A;  3H92 A;  2FA5 A;  2DMP A;  1OPC A;  4CCN A;  4ZDP A;  4BYY A;  5J1U A;  4A0X A;  3OYA A;  1T0F C;  5LGU A;  1Z7L A;  2LP0 A;  3K0L A;  3HDD A;  1IXR C;  2JA7 J;  1IN7 A;  1IN8 A;  1CF7 A;  1Y0U A;  4KIC A;  3IL2 A;  1J5Y A;  5IOY A;  1IW7 F;  2MAB A;  2P6T A;  3HRS A;  2IS2 A;  1BI2 A;  1X3W B;  3SHF A;  2D1V A;  2L02 A;  4QWQ A;  2W82 A;  1FBU A;  4XKV A;  5BPI A;  4I0B A;  3WGI A;  1S8N A;  3DLA A;  3M8E A;  3OY9 A;  2JRT A;  5CVU A;  4KNY A;  2CU7 A;  2GQQ A;  3EUH C;  3ML6 A;  2OJE D;  2NNY A;  4IHS A;  2XHK A;  2Y2Z A;  1B4A A;  2ICW G;  1LFP A;  4I02 A;  4RM2 A;  3PQK A;  3QAH A;  1JGS A;  4P96 A;  1OYW A;  4B1R A;  2XDV A;  2PMH A;  4HAM A;  3GO5 A;  3GCM A;  4RA2 A;  3L2W A;  2HZD A;  1NK2 P;  1OCR H;  1MBH A;  5A2Q K;  1X3Z B;  2A68 F;  2IS6 A;  2KIF A;  3HYI A;  2L9N A;  1IC8 A;  3WGH A;  3BTC A;  3HPG A;  1A04 A;  1M1E B;  2ADU A;  2V79 A;  4H4K C;  1FX7 A;  5D8L B;  1RUO A;  2A3S A;  3CF5 F;  1IUF A;  2ISZ A;  3GTG J;  2ELK A;  4HX4 A;  1Q1H A;  2PBI A;  5IY5 H;  1JHF A;  1P2F A;  3MKZ A;  1JT0 A;  1UG0 A;  1ZLJ A;  3P9I A;  4DNC A;  2E1N A;  1XMA A;  5FLM J;  2IA1 A;  3JRD A;  4AC0 A;  3TP0 A;  4XN3 A;  2CS3 A;  2R7S A;  2QEN A;  2BXY A;  4L9V A;  5J40 A;  1Y0N A;  4C9Y A;  1YO5 C;  3OIQ A;  2H09 A;  3E6B A;  1VFC A;  3ZMD A;  3RTR A;  4OAZ A;  4R1H A;  2EFO A;  2JT1 A;  1VQ5 I;  4IRI A;  3B6A A;  1BI3 A;  4FHT A;  1IAW A;  1DP7 P;  1PUF A;  2WAQ A;  3GZN B;  2DOE A;  4GGG A;  3OMY A;  2RDP A;  5BMZ A;  1O4X A;  2H1K A;  2W25 A;  1NG7 A;  2LK2 A;  3FK6 A;  4HQM A;  2YS9 A;  3CCQ I;  3S3M A;  5K7Z A;  2K9L A;  1ZG3 A;  2DN0 A;  2F5C A;  2B9S A;  4M3D A;  2KZG A;  5GPC A;  5H20 A;  4ZZD A;  3HM5 A;  3F21 A;  2OQG A;  4W1U A;  2JUC A;  3F0C A;  2LH9 A;  2CW8 A;  1R23 A;  3E6M A;  3M07 A;  3WTT C;  2CUF A;  2O8K A;  3WHB A;  2IW5 A;  4V19 K;  1W36 D;  4F7Z A;  3HHG A;  2BXZ A;  4JYK A;  4ENN A;  3WTZ A;  5CQG A;  2V1U A;  2PG4 A;  1H0M A;  1BW6 A;  2XIG A;  1GV2 A;  4LGW A;  1SAU A;  1LB2 A;  4HA8 A;  1KON A;  1R22 A;  2EZK A;  2O7O A;  4CCK A;  4D0P A;  5HLG A;  4D5C A;  5LHH A;  1ZTR A;  2ZNZ A;  3X2Q H;  3JRA A;  4ZTJ A;  1YS6 A;  3C7J A;  3K4J A;  2DI3 A;  2X1C A;  4M71 A;  5FFZ A;  5J4V A;  1F4K A;  1K6Y A;  3LOC A;  2IS4 A;  4LK0 F;  1R58 A;  4BGD A;  1USS A;  3BR1 A;  3K4N A;  3OS2 A;  4XOR A;  3IKT A;  4XR6 A;  3F6V A;  4F91 B;  2L54 A;  1TWC J;  4M74 A;  2LKS A;  2R7X A;  4A3K J;  1OCO H;  1J75 A;  1NG6 A;  3GVA A;  4UVA A;  4D7M A;  1YJ9 I;  2IA2 A;  1K7A A;  1ERD A;  4Y17 A;  1C0W A;  3BJA A;  3MZH A;  2QYO A;  4J19 A;  1GLN A;  3ZN1 A;  5EZG A;  2EFP A;  1UHM A;  2E7X A;  2EBI A;  1UCR A;  2HPI A;  3M9A A;  3TED A;  1U6G A;  3FBN B;  3H3U A;  4AU7 A;  2JPB A;  1L0O C;  2QBY B;  3JRE A;  5DS9 A;  3QYE A;  3H3V K;  3L2U A;  1MH3 A;  1W7P D;  2DO7 A;  2V1D A;  1MMA A;  4F52 A;  4A3L J;  4B3A A;  1HDD C;  5HOO A;  1U5T B;  1P9Q C;  1MNM C;  1AWC A;  3GF2 A;  4M3B A;  2LRD A;  4UVB A;  2XVC A;  4G6Q A;  3KEQ A;  3U21 A;  3ULQ B;  1VQN I;  3FM5 A;  3ZN0 A;  2M7A A;  1N25 A;  4OIN F;  4RDU A;  2VT2 A;  3RYP A;  3DLL F;  3B73 A;  2XSD C;  2R7F A;  4HDV A;  4G7H F;  1ZR4 A;  2H6C A;  2MBF A;  1LKX A;  1O7F A;  5F04 A;  4E6K G;  5HLT A;  4ZYE A;  2DPD A;  3MAJ A;  1R00 A;  3JAM Z;  3WG7 H;  2GBY A;  2FXA A;  4EV0 A;  1SMT A;  2R93 J;  2EWN A;  3D5L A;  1TZL A;  1YJW I;  3GFJ A;  2E5Z A;  1IDY A;  4MQV A;  3VOD A;  2CV2 A;  1ETY A;  2ME6 A;  5JLX A;  1QBJ A;  2QSH X;  3J7A O;  3BG7 A;  2DFI A;  5JI6 A;  2D1H A;  2NOG A;  1VQ7 I;  2KZV A;  3KP2 A;  1SD6 A;  1W7P B;  2DMU A;  3AG3 H;  3BTJ A;  2FQ4 A;  2V7F A;  4G6T B;  3GTJ J;  1TT0 A;  4C3I J;  3P9C A;  3ZXS A;  2ACJ A;  4GCV A;  5LRR A;  4GFB A;  2IPQ X;  4NHJ A;  3KZI C;  2J5P A;  4IPA A;  4UUS A;  1V54 H;  3Q0U A;  3ZMT A;  4JOM A;  3AAF A;  4Y52 J;  2CFO A;  5CVJ A;  2KJB A;  1D1B A;  2L01 A;  5LD2 C;  3CD6 I;  1IV8 A;  3EUK L;  2P5V A;  2ID3 A;  3UR3 C;  3FIW A;  1X1B A;  1ON1 A;  4WF2 A;  2HS5 A;  3NRV A;  2ETH A;  2VJJ A;  3JCU C;  3FDY A;  4FE4 A;  2K5C A;  1WKM A;  3QOE A;  4A2U A;  3L09 A;  4UY8 I;  1IV6 A;  3J80 Z;  2VQL A;  3GZ5 A;  5M5W J;  1XSD A;  1IDZ A;  5D5U B;  5LEJ A;  4ZJZ A;  1SVL A;  3LMM A;  2UWM A;  3JW4 A;  4HF0 A;  2V26 A;  3VSK A;  2L7F P;  3I9V 2;  5HDG A;  2R0Q C;  3TQN A;  4IQ4 A;  4ENM A;  3KEY A;  3V7R A;  4DBQ A;  1B72 B;  2IGK A;  1YIT I;  1VI0 A;  2HKO A;  3BR0 A;  3CLQ A;  3I4P A;  2RNG A;  1T39 A;  4KIS A;  3RSN A;  4A3D J;  4IHW A;  3HIF A;  2A6H F;  3GWZ A;  1R5G A;  1TW2 A;  4BHP A;  2JN6 A;  1JXS A;  1DGR M;  3AKZ A;  1D0X A;  2L7K A;  2JUG A;  1J9I A;  1ETX A;  2FOK A;  4IL6 C;  4KUM A;  2E2J J;  4RGR A;  2E19 A;  2HOA A;  4XLA A;  1X1A A;  2A69 F;  4A0Z A;  4EM1 A;  1B8I B;  3JSP A;  3M8F A;  2XGC A;  2RAE A;  1PVE A;  1PP7 U;  1RKW A;  1RNL A;  1WGX A;  3MWM A;  1LFB A;  3QP6 A;  2NS7 A;  3BLY A;  2KKO A;  4XON A;  1A5J A;  2K40 A;  2YR2 A;  3CUQ B;  1AU7 A;  1HCR A;  3R4K A;  3AG4 H;  3ERM A;  5FKN A;  4X0G A;  2R4G A;  4GO1 A;  2DTZ A;  1CQT A;  1WVR A;  2JQ7 A;  2LRE A;  2DCE A;  4KIG A;  4HQE A;  2COM A;  2X0L A;  2OA4 A;  4NNJ A;  1BL0 A;  4GDF A;  1SFE A;  2I5U A;  2CUZ A;  3GEZ A;  2DA5 A;  3HSE A;  1K78 B;  2UV1 A;  3E5Q A;  5EDN A;  2F2E A;  2M34 A;  2DA1 A;  2H1L A;  3T8T A;  5A2Q Z;  3OYB A;  1SC7 A;  3EDP A;  1YOV B;  1HW1 A;  2F4O B;  1QQI A;  4DBR A;  1MBF A;  3L9F A;  2ZME B;  1O3S A;  3PM1 A;  1TBX A;  3CME I;  1K6O A;  3AFH A;  2DOD A;  5LHI A;  2K86 A;  4OIQ F;  2DK5 A;  2FJ1 A;  4E7H A;  2MLG A;  3BCB A;  1IXC A;  3KYD B;  2P7C B;  1HDP A;  2X6W A;  3K9T A;  4E70 A;  1WJB A;  4EJV A;  3HEF A;  3KCC A;  2HOT A;  1MBE A;  3IC7 A;  5E8G A;  4PGH A;  4DW6 A;  3E6D A;  4CZC A;  1QVU A;  1YRN A;  3PUB A;  2EIJ H;  4OIO F;  2RN7 A;  3ZQH A;  2R5Z A;  2E36 A;  2LR8 A;  1I6X A;  1QRY A;  3S8P A;  2ZXI A;  1G3S A;  1OKR A;  2F5D A;  5F1R A;  5FLV A;  1ITY A;  3C1D A;  2M0C A;  3KE2 A;  1FYM A;  1UHS A;  1CGP A;  4XIC A;  2W48 A;  2EFN A;  1YX5 A;  3F8C A;  4A3F J;  3MZ8 A;  2M4K A;  1YIJ I;  4AD9 A;  1JKR C;  4KDP A;  3LNQ A;  1KYZ A;  2LYC A;  3RZO J;  1P4W A;  4XBF A;  4W97 A;  1H88 C;  5CYV A;  4U7B A;  1W5S A;  1IRX A;  5HNH A;  3G71 I;  1LDJ A;  1MGT A;  2V9P A;  5K1Y A;  4HF2 A;  5F27 A;  1OCT C;  1Z0X A;  3LWF A;  5GTH C;  2JWT A;  4MTE A;  1OMI A;  2J5O A;  2ZCW A;  3RPU D;  4IX7 A;  4RGX A;  2P81 A;  2VI6 A;  2UUZ A;  2ZC2 A;  5B5E C;  4KIB A;  2VKD A;  4YIF A;  1U9N A;  3H1C A;  5DTD A;  2QEX I;  3QU6 A;  5CVR A;  4BJT A;  1FYL A;  3FMR A;  3VWB A;  3IWZ A;  3BC8 A;  4IKF A;  3S3N A;  3S3O A;  2L4A A;  4LLN A;  1G2H A;  2VQG A;  3HGG A;  1X58 A;  2VXD A;  2HR3 A;  3EQL F;  1GDT A;  2FMY A;  4A3M J;  3A01 A;  2YSR A;  2HKX A;  4BU2 A;  2R7T A;  3OS0 A;  3DBR B;  1OCC H;  5FKL A;  4DZP A;  5EEA A;  4C30 A;  3OYI A;  4LIV A;  2O61 A;  1XDU A;  3CCS I;  3S17 J;  3OYC A;  4NBQ A;  2FOW A;  2K3P A;  5DV5 A;  3EET A;  2XPU A;  1LFU P;  3ZGK A;  1HKQ A;  1TQM A;  3HTU A;  4RS8 A;  2E34 A;  4ZC3 A;  5F08 A;  1YW7 A;  3WGG A;  1A6Q A;  1TQP A;  2OCE A;  4ESJ A;  2M9H A;  3M3Y J;  1T98 A;  2DOF A;  5D4S A;  1FP1 D;  1YW8 A;  3ZQI A;  1Z67 A;  1JUS A;  1T95 A;  2JA5 J;  3G1O A;  1Y1V J;  4B47 A;  2VN2 A;  1Y6I A;  3BT9 A;  3CTA A;  4HEA 2;  4ANJ A;  5DD4 A;  1ZK8 A;  4BL0 B;  4XMY A;  3QP5 A;  4NC6 A;  3K70 C;  2XAU A;  3G4S I;  4UUV A;  5LFA A;  1O7L A;  4LG0 A;  3MMY B;  1GXP A;  2KDO A;  4FE7 A;  5CPR B;  2QCO A;  2NVT J;  5ICF A;  2VUM J;  2M7B A;  2KIS A;  3I71 A;  4KYW A;  5IT9 Z;  2DYS H;  3I54 A;  2ZFU A;  1SFX A;  4U0W A;  2IRF G;  1OLT A;  3I55 I;  3LSH A;  5FO5 A;  2EZL A;  4B48 A;  2K9Q A;  2Z5U A;  4LJZ F;  1UAA A;  5DUI A;  1PYV A;  2R5Y B;  2G0E A;  1FP2 A;  3BCA A;  3KP5 A;  2P0W A;  3OL3 A;  1WI9 A;  5M3M J;  2FNP A;  2WC2 A;  1RZ4 A;  3Q3S A;  3JAM K;  2DA3 A;  2BY2 A;  2NS8 A;  3KEO A;  3TOA A;  3IRQ A;  1YYV A;  4PFP A;  2O6G E;  1HC8 A;  2F48 A;  3PUF A;  2LKX A;  1P7J A;  3PIP F;  4EEF G;  4MEX F;  2AO9 A;  2DMQ A;  2IJL A;  3FXO A;  4LIU A;  4L9J A;  2AQE A;  4PSX A;  4ETS A;  1MBG A;  2EA4 A;  2O03 A;  3HSR A;  3A0B C;  1TTY A;  4Y15 A;  1UJ8 A;  1DU0 A;  3A2K A;  3WTV C;  1LDD A;  4QPO A;  5IOZ A;  3FKI J;  3LSI A;  2ID6 A;  5J1R A;  1WPK A;  3TW7 A;  4BJ6 C;  4WCG A;  3HPH A;  4BQQ A;  1XPX A;  1HSJ A;  4C2U A;  2ISY A;  1FSE A;  1OIS A;  2FUG 2;  1WRJ A;  2OZU A;  3NWS A;  2OF7 A;  3ZQF A;  1O3T A;  3ZQG A;  2HXI A;  4G7O F;  4RB2 C;  3GFL A;  3W6J B;  4AVZ A;  2HI3 A;  3D5R C;  1H89 C;  2F5V A;  3SXY A;  4KN4 X;  3OS1 A;  1LE8 B;  2AXL A;  3OR2 C;  1XSX A;  1QNT A;  2PX9 A;  4BEH B;  5H6R A;  4BBR J;  4IO9 F;  2CV0 A;  1EKE A;  2Y0M A;  1ZRC A;  2I8D A;  3GME A;  3U9G A;  2W1O A;  4HPQ A;  3CMA I;  5TJJ A;  3L2R A;  1S5L C;  2OTJ I;  1P92 A;  3VYU B;  1HKT A;  3GX4 X;  4XRM A;  3F3X A;  4C3J J;  2VJI A;  2BW3 A;  2L9S A;  2X9D A;  3DCF A;  1SMY F;  1TQI A;  3O2P E;  5AIP A;  5J8C A;  2IAI A;  3ECO A;  3MEX A;  1KU3 A;  4JK1 X;  2EPF A;  5E8I A;  1PP8 F;  3MKY B;  3OYL A;  4CIC A;  3DKX A;  1G4D A;  4K2E A;  1N77 A;  4FET A;  2QA4 I;  2VBW A;  3MKL A;  3CMY A;  2HZT A;  1POG A;  4HNT A;  3HOX J;  5FKO A;  3OYF A;  4RAG A;  5J3L A;  4HX7 A;  2VC1 A;  2Y9Y A;  2XF6 A;  2XB0 X;  5JR3 A;  1XDS A;  4L5I A;  2EH3 A;  2DJN A;  5IP7 J;  4JX4 A;  2Q2E A;  1AKH B;  1ZLK A;  4I76 A;  4DOZ A;  4BAY A;  4G94 A;  1I1G A;  4BXF A;  3QPL A;  2FE3 A;  2L0K A;  4YII A;  1SD7 A;  3J7Y J;  3WTS C;  3WG9 A;  1OJL A;  4JQF A;  5FFX A;  3SQN A;  3BJO A;  1BIA A;  1K83 J;  2YU9 J;  4M72 A;  2HTJ A;  1LVA A;  1HST A;  2ZKZ A;  1I3Q J;  1KGS A;  2YUS A;  4PDK A;  3PJR A;  3HZJ A;  4XQF A;  2DAO A;  4J00 A;  2FRH A;  2EIM H;  1RUN A;  2A5W A;  1XCV A;  4CO8 A;  1ZEL A;  3G2B A;  2WAD A;  2RC4 A;  3OOP A;  1FOW A;  1ZG1 A;  3VEP A;  2R7D A;  3SZT A;  5CLS A;  1KQ8 A;  3K4K A;  2AS5 F;  3GLL A;  2WY7 Q;  2Z1D A;  1OYY A;  1RR7 A;  3DEU A;  3PQJ A;  1BOA A;  4NQW A;  4O5V A;  2O9L A;  2R7U A;  4QSH A;  3HJE A;  3M1C A;  3FWE A;  5HDK A;  2V4J C;  2E1M B;  2OU2 A;  2PI0 A;  3JRI A;  2RVC A;  5C3E J;  1QPI A;  3RCO A;  1W36 C;  1T0F A;  4OMZ A;  1VQ4 I;  4XID A;  4KMF A;  4L5J A;  5KNL A;  1WFX A;  2L2O A;  3CCJ I;  5KCM A;  3JRG A;  3QYB A;  2P6S A;  3TL4 X;  1B6A A;  4U7D A;  2KDZ A;  2MLK A;  4BQN A;  4BE0 A;  3M7G A;  1XGS A;  3H5A A;  1JKQ C;  2X6O A;  4A6D A;  2Y48 A;  2ZJ2 A;  2FEZ A;  2XAJ A;  4HSR A;  3SZP A;  1Z3Y A;  3HKZ A;  2L4M A;  4LB5 A;  3C3W A;  1D0Z A;  1E17 A;  1LEB A;  2WB1 N;  3EUH A;  4HLY A;  5HOD A;  1U8B A;  1U5T C;  3B6C A;  2XPW A;  1D5V A;  2NVY J;  3DBL B;  1VF9 A;  2HQR A;  3LSG A;  3Q9V A;  1GUU A;  2MW8 A;  3V8L A;  4YRV A;  1MDM B;  2LDU A;  1SVM A;  4YG2 F;  1OFC X;  2Y69 H;  4PJM A;  5M5X J;  2FML A;  1G3W A;  5EGO A;  2L7M P;  4G12 A;  2NVX J;  1WI3 A;  3FBI B;  4XLN F;  4CCJ A;  1BR4 A;  1FMV A;  2EB7 A;  1W1W E;  4NUB A;  1MH4 A;  5EG0 A;  2QQB A;  3SFZ A;  3N4M A;  2DA4 A;  1XMK A;  3RKX A;  5HNF A;  5ERI A;  2XAG A;  2HDD A;  2K4B A;  1OR7 C;  2QGU A;  2QBY A;  3CC2 I;  1YW9 A;  3IP4 B;  4EM2 A;  3GTQ J;  2NRA C;  5L3C A;  4S04 A;  1CF7 B;  2X51 A;  2HDW A;  1XC5 A;  3K1N A;  4C2M J;  3ESW B;  1K61 A;  4BDY A;  3FXR A;  2DFH A;  4WXH A;  3OWT A;  3GTL J;  1XMX A;  2CMP A;  3M8J A;  4F93 B;  2GOM A;  4Y7N J;  2L9V A;  4ITV A;  4UV8 A;  4FIS A;  3L2C A;  2PLY A;  1XSV A;  5D6F A;  2VPL A;  4KIF A;  4MNU A;  1ULY A;  3U1K A;  2MFZ A;  2EA2 A;  4L9T A;  3HOZ J;  1ODD A;  2B7E A;  4ENK A;  1IGN A;  1WJC A;  1O3R A;  4AYB N;  4RMN A;  1OR7 A;  2D2W A;  4HNV A;  3GTM J;  4EVI A;  3E6C C;  2OPT A;  3FXL A;  1R36 A;  3V4G A;  1HA8 A;  3IHU A;  2A61 A;  4LLG F;  2KLO A;  3F22 A;  1JHH A;  2GXB A;  4UHT A;  2TDX A;  3WHC A;  1J09 A;  2M3A A;  2W7N A;  3Q5F A;  2L5Q A;  3LA7 A;  3RQ4 A;  4ESF A;  1JJ8 C;  2WAE A;  2GA2 A;  2CQK A;  3BPV A;  2VAS A;  4B4C A;  3SDB A;  3R61 A;  4YEL A;  2TCT A;  1BBY A;  3IUO A;  3COA C;  2BY1 A;  4KIT B;  3CC7 I;  3DU5 A;  5F6F A;  2FNA A;  3L1P A;  2E5N A;  3KZZ A;  3ECH A;  1JKO C;  2GLO A;  2HYG D;  3A03 A;  1PUF B;  1S6L A;  1PJR A;  4G9Y A;  2ZBK A;  2VON A;  3JR9 A;  3ZRG A;  3JTH A;  1ZRD A;  3TO9 A;  3G1M A;  1F43 A;  3PSF A;  5HS7 A;  1I3A A;  1SD4 A;  4A12 A;  3ABL H;  3E5X A;  3I53 A;  4N9H A;  3VYR B;  3C2G A;  5ILU A;  3GFM A;  3CCL I;  1LUJ B;  4KT6 A;  1ZGW A;  3A02 A;  4E7Z A;  5IT9 K;  3HOV J;  3EYI A;  3CUQ C;  5AIQ A;  3HRT A;  4E7S A;  2DQL A;  2RQP A;  1IRG A;  2CUE A;  4KN7 X;  1NHA A;  1SFO J;  1E0E A;  2HQN A;  2JPC A;  2RKH A;  2DMT A;  4A0Y A;  2ZXW H;  2KRC A;  1MMG A;  2QM3 A;  1XGM A;  3FMQ A;  5C44 J;  5IPA A;  4DYR A;  2GWR A;  4MFD A;  3LSK A;  3N05 A;  2DT5 A;  3PIO F;  1JUM A;  2Y0S N;  2DXI A;  4O6J A;  3DPT A;  1SAN A;  1X1P A;  1DPU A;  2VL8 A;  4TV7 A;  2VBY A;  5EEG A;  3M4O J;  2G7H A;  3S2H J;  2DBB A;  3RKQ A;  4WK8 F;  3DFG A;  4AVP A;  5B66 C;  4XSX F;  1K4S A;  2ZME C;  1VQ9 I;  4E7J A;  1UFM A;  3PO2 J;  3ZMZ A;  3CCV I;  4AUX A;  2KIM A;  2PEX A;  3KZY A;  3HC7 A;  2F5E A;  1FC3 A;  5JHU A;  4IXA A;  2D45 A;  4PJJ A;  3VFZ A;  2HVS A;  2CSO A;  4A69 C;  1IRZ A;  2DW4 A;  2Y31 A;  4ZTF A;  2BV6 A;  3H35 A;  4G8X A;  4X1E A;  3R6S A;  1I1S A;  1QPM A;  3FMS A;  1FBQ A;  3BR5 A;  2HU9 A;  3LA3 A;  1KYW A;  1TT5 B;  3AG2 H;  5GAE J;  1ZKG A;  4II2 A;  1D8K A;  1FOX A;  1DPR A;  2ZO4 A;  4M73 A;  1Y56 A;  4PGG A;  4OAY A;  4UNO A;  3HOU J;  2VBZ A;  3IAM 2;  1K4T A;  2R7R A;  4Y33 A;  5K5Q A;  3HL2 A;  2VLA A;  3L7W A;  1ACI A;  3PNY A;  3SEQ A;  3FX3 A;  1JTX A;  2FX0 A;  3WE3 A;  4EJW A;  3JRH A;  1H9T A;  2WTE A;  2E35 A;  4UB8 C;  4AIK A;  2NOJ B;  4WWC A;  1HXD A;  4MLO A;  4MFE A;  5HLI A;  2ZJR F;  4ASN A;  1BR2 A;  4Q5S F;  2L9R A;  4UB6 C;  3LQQ A;  2HFH A;  4GYI A;  1GVJ A;  2ZNY A;  2BHZ A;  1V3F A;  2DTR A;  4CDG A;  3I5U A;  1DDN A;  5DCM A;  3OYK A;  1FNN A;  2F6C A;  2CFX A;  3RKW A;  3DKW A;  4UUS B;  4BXX J;  1O57 A;  1U2W A;  1R5I D;  3I59 A;  2M30 A;  1S7A A;  3CJN A;  2DA6 A;  2JK3 A;  4PJL A;  5B1B H;  2NYX A;  2JA2 A;  3K2Z A;  5EZH A;  3IWF A;  2JMW A;  2HDC A;  2JJ7 A;  2DU9 A;  5E3N A;  4OIP F;  4LG3 A;  4HW0 A;  1BA5 A;  1S7O A;  1K79 A;  1IG7 A;  2BZT A;  2VB6 A;  3P7N A;  4IOA F;  1R1U A;  1Z3X A;  3CUO A;  1DQU A;  3OYE A;  1R6R A;  1BJA A;  2CQ7 A;  4HV6 A;  1G59 A;  3CC4 I;  2LF7 A;  3BWG A;  1X4P A;  2YU3 A;  3F8M A;  3V7C A;  3D1N I;  2OTL I;  1MJA A;  4FTH A;  1X3U A;  4C3H J;  5E3O A;  5K5R A;  5ILS A;  2V6E A;  2FBI A;  2C6Y A;  2K9M A;  2MGQ A;  1WCM J;  2DQR A;  2MYS A;  4CYC A;  4IZZ A;  1GVD A;  5BNG A;  5EJC A;  5GAG J;  3ABU A;  1S3J A;  3RKY A;  1E3H A;  5J47 A;  1WQ2 A;  2W00 A;  2KJC A;  3E0J B;  3WTU C;  2V9K A;  3H5N A;  2AXT C;  4E7L A;  4ZYH A;  2UXN A;  5DEQ A;  3KP4 A;  2BBY A;  2OD5 A;  1XX5 A;  3A1Y A;  1GHC A;  1D3Y A;  4XKW A;  2VKH A;  2XKP A;  3CLO A;  4XLE A;  5ICG A;  2ELJ A;  4CYD A;  2LBF A;  2DT6 A;  3ASO H;  3CDI A;  3VB2 A;  2R7Q A;  1T8I A;  2H8R A;  3AL0 B;  4JX5 A;  2XKO A;  1A31 A;  1TW3 A;  3FXU A;  4OWR B;  3KX2 A;  1N75 A;  2OC6 A;  2HGC A;  2QZ8 A;  3OOU A;  3S15 J;  4Z6Y A;  5HDN A;  2NS0 A;  2EQR A;  3G6E I;  4KT5 C;  1B59 A;  1GXQ A;  4ZDL A;  1T2K A;  4LMY A;  2XGE A;  5B3S H;  3RZD J;  2AQF A;  3NEU A;  4D1Q A;  1E3O C;  2LFB A;  4HST A;  2VE9 A;  2Q0O A;  4RBO A;  5AON A;  1YLF A;  1ZN2 A;  2ZSI B;  3SZG A;  2LKP A;  5J8F A;  1QZZ A;  1WWX A;  5E18 F;  4HOB A;  3BZK A;  4CGZ A;  4QLC U;  4I2O A;  2L3D A;  3CJR B;  1SD5 A;  4U88 A;  5ICE A;  2CQX A;  3G73 A;  3TDZ C;  3LAJ A;  1IF1 A;  4XNF A;  2KMU A;  3BG6 A;  3OSG A;  5D8K B;  2VXZ A;  1XN7 A;  3H36 A;  2VJ5 A;  4WX9 A;  3TBI A;  2K27 A;  3GW2 A;  2K02 A;  2WAQ N;  3I0T A;  3F72 A;  4DQ2 A;  3CP2 A;  3Q0V A;  1MSE C;  2VQC A;  3RJP A;  1XCB A;  2HTS A;  4QPQ A;  3DP7 A;  4MIM A;  4WXC A;  3E3V A;  2GOX B;  1YIO A;  1X1D A;  4XRS G;  4EQQ A;  3LL7 A;  4AM3 A;  3I58 A;  4XKC A;  2V1X A;  3KP3 A;  3W2W A;  2M5W A;  3L00 A;  3K1P A;  4B44 A;  3MCZ A;  2R7O A;  3GTK J;  1N78 A;  2QF7 A;  4IF4 A;  1T08 B;  4M6X A;  5FKM A;  3W2V A;  4DZJ A;  1R71 A;  3HUG A;  4XKB A;  2ESH A;  2FU4 A;  2XF7 A;  5FGM A;  4BH9 A;  4E7K A;  1QVT A;  4II3 A;  1OCP A;  4A3G J;  3K4L A;  3S1N J;  4U0V A;  2XC7 A;  3BJ6 A;  3HOS A;  3ZOB A;  2O5R A;  1QZE A;  1VQM I;  4DJA A;  1FTZ A;  5FRO A;  3RIR A;  2XV4 S;  3K2A A;  3ABK H;  3S2W A;  3ABM H;  4CSW A;  3F8B A;  2VE8 A;  3JRB A;  1YRN B;  2P4W A;  2FBH A;  1QZY A;  2VOP A;  2R5Z B;  3LA2 A;  2DOA A;  4KA4 A;  2ZXH A;  4B43 A;  5JVG F;  2N8G A;  2XAF A;  4XLF A;  2EIK H;  4L0Y B;  3PNV A;  5KHD A;  3S14 J;  4IOC F;  3DV8 A;  3QPH A;  2YX7 A;  2FBK A;  3LSP A;  2WY8 Q;  1DU6 A;  3E1S A;  2P8T A;  5LHG A;  3S2D J;  1Z6R A;  3FXJ A;  2BYV E;  3BPX A;  5BS6 A;  5D6E A;  3ASN H;  4A3J J;  2M2E A;  1W0T A;  1REP C;  1TWG J;  2VKE A;  1Z1D A;  4XRS A;  2GXA A;  4A3I J;  1DUX C;  2COB A;  3BZ6 A;  2IGM A;  4PCQ A;  4MTD A;  5CJ9 A;  3GTP J;  2EZI A;  1V5G A;  2MD0 A;  3BG5 A;  4XN0 A;  1T33 A;  1X2N A;  2PJR A;  1S7E A;  4CH7 A;  4XLH A;  1RR8 C;  2ECC A;  1UMQ A;  5C4J J;  3PL8 A;  3OYH A;  3NAR A;  3JTG A;  2CQQ A;  3BQZ A;  1IN4 A;  2ZFW A;  1MKM A;  5F0H A;  4RAZ A;  1V5F A;  3DTK A;  5BQT A;  2XF5 A;  1W5T A;  5D5W B;  2STW A;  3QOD A;  2HXO A;  2WBM A;  4BY1 J;  4ZYD A;  1D0Y A;  5FKK A;  3TO6 A;  3ROU A;  1BC7 C;  1JGG A;  4C2T A;  5BOX A;  4JX6 A;  3H0G J;  4FX4 A;  4S05 A;  1RKT A;  4E7I A;  3U1D A;  2HQA A;  3H3Z A;  2VT3 A;  3WTW C;  4YFK F;  3JRF A;  2K85 A;  5L3F A;  3K1M A;  2GXG A;  2E1M C;  4B09 A;  4IEJ A;  2M87 A;  1HW5 A;  5KK1 A;  1BI1 A;  4BAC A;  2DJI A;  4ZZL A;  2JA6 J;  1FLI A;  1ENH A;  2PMZ A;  4HNU A;  3QWL A;  2OZ6 A;  3I4M J;  1Z91 A;  4E4H A;  5B1A H;  1R4M B;  3GLX A;  3KYL A;  1JTY A;  4M3F A;  1FZP B;  4HV5 A;  3WU2 C;  1R1T A;  5DDG A;  3K70 D;  4I01 A;  5E79 C;  4L9N A;  1XB4 A;  3QPS A;  5E1X A;  4RB1 A;  4LG0 B;  1FT9 A;  1TL8 A;  1BW5 A;  4A3C J;  2MD5 A;  3O3K A;  2QQA A;  2IEK A;  2E60 A;  1X2M A;  2A07 F;  3OYM A;  1LPQ A;  2ZSH B;  2K3F A;  3GBG A;  1YG2 A;  2EFQ A;  3CJT B;  3ISP A;  1P7I A;  3BG3 A;  1Z6T A;  4I09 A;  3FXM A;  4BHB A;  2ESN A;  2JVG A;  3FXQ A;  1TWH J;  2V9V A;  1ZG5 A;  5LEK A;  3K4C A;  4N4N B;  4U0Y A;  1A36 A;  3VOE A;  2JSP A;  4N4O B;  2LY1 A;  2Y30 A;  4XSZ F;  3CJQ B;  1YE9 A;  2XAS A;  1T38 A;  2LMD A;  2KRH A;  1J0R A;  4CUG A;  1ETV A;  3W3C A;  1LDK B;  1MZB A;  3I3L A;  3TO7 A;  4ENJ A;  2OV7 A;  5CVI A;  4LFU A;  2VC0 A;  2XAH A;  3MVP A;  2Z16 A;  5ILV A;  4CCL A;  3R0J A;  2OBP A;  4CHU A;  4O3M A;  3Q9S A;  5L3G A;  3T5X A;  1J59 A;  3K7A J;  5J4Y A;  4NC8 A;  4FT8 A;  1P4X A;  4B8X A;  5LBQ A;  1KU9 A;  3EPZ A;  1G8X A;  2XGD A;  2XRN A;  3CMM A;  3ZPL A;  4D5F A;  4MO7 A;  2Z2S B;  4IHV A;  3OYG A;  2STT A;  5TRD A;  3KFW X;  2A5Y B;  3QOP A;  2GA1 A;  2F4M B;  2PMU A;  1G3T A;  5H2F C;  2FD5 A;  2LLK A;  1TC3 C;  5IP9 J;  3S1Q J;  4DGW B;  3ERE D;  4EJT A;  1NK3 P;  5LLQ A;  2BY0 A;  5HS9 A;  2E2H J;  1MMS A;  2A05 A;  1BIB A;  1J2X A;  2NVQ J;  4XK4 A;  5IYC J;  5D4R A;  2KL4 A;  2XGX A;  4PJ0 C;  4RLQ A;  4ZDO A;  3KLO A;  1YI2 I;  5F0F A;  1OYI A;  1XS9 A;  1PUE E;  3CCR I;  3CDL A;  4P9F A;  1MNE A;  1ONV A;  1J7K A;  4QIW N;  3SJM A;  4HDU A;  5IYB J;  1P6R A;  4AWX B;  4BQO A;  4L18 B;  1MMD A;  4EJO A;  1WSU A;  1VQK I;  2BW3 B;  4RM3 A;  1B9N A;  4BDZ A;  2CRG A;  1R49 A;  2R7W A;  2GZW A;  1F9N A;  1STZ A;  1U9O A;  2XB5 A;  2V1N A;  1EA3 A;  4IRH A;  2RRE A;  4XLC A;  4BE1 A;  1YHQ I;  1KU7 A;  1WJA A;  2X85 A;  1XG1 A;  2WV0 A;  3FKJ A;  3H9G A;  1YQA A;  2HNH A;  3BTL A;  3QRF F;  4OIR F;  3CCY A;  2PN6 A;  3LFU A;  4IHX A;  1S29 A;  1APL C;  3CO6 C;  2QQ8 A;  1D1A A;  5JHF A;  2DYR H;  1TNS A;  2EV5 A;  3R0A A;  1MMN A;  3HRU A;  1SAX A;  3LFK A;  3EUA A;  4UVC A;  2KPM A;  3RPQ A;  3T0Y A;  3HHH A;  2Q2E B;  3ONQ A;  1A35 A;  4A5M A;  3K69 A;  2M0M A;  3DU6 A;  2DFE A;  2H8W A;  2FF4 A;  2X1E A;  3NWT A;  4U87 A;  4A6E A;  4XLP F;  1RI7 A;  5KVR A;  4DYC A;  1Y8Q B;  1S72 I;  1WZ2 A;  4NB5 A;  2CH0 A;  1UEL B;  4EGZ A;  3O8G A;  1D1C A;  4I99 C;  2K9S A;  1AA7 A;  2Y75 A;  4I6Z A;  1U5T A;  4HZF A;  4P55 A;  3FK7 A;  1R1V A;  2AHQ A;  2EK5 A;  2VIX A;  2OAZ A;  5DCF A;  3K10 A;  1VQ8 I;  1MJB A;  4BBS J;  2EV0 A;  1Y8R B;  4MQ9 F;  3O6B B;  1SFU A;  1ETK A;  5LRS A;  3DEE A;  3NQO A;  2KQR A;  3PFY A;  4I0A A;  3KET A;  1DP3 A;  1HQC A;  1IXS B;  4NQW B;  3CCU I;  1VQO I;  3BP8 A;  1SFK A;  3CES A;  5E17 F;  1HW2 A;  4PJN A;  2IS1 A;  4IJA A;  2G9W A;  1VTN C;  2EIN H;  2OUM A;  1TNT A;  2QQ9 A;  2VKV A;  4R8H A;  3CDH A;  2CV1 A;  2QLZ A;  3Q0W A;  1Z21 A;  1JE8 A;  3TP3 A;  1JKP C;  5E1Z B;  3TOB A;  1QHG A;  3IAS 2;  3HOT A;  4EM0 B;  1W7P A;  2CYY A;  3BDD A;  1VND A;  5ICC A;  3DXJ F;  3KPH A;  5D5X B;  3DTI A;  1LJ9 A;  1O3Q A;  3BR2 A;  1YX3 A;  3QYF A;  2P5L C;  5KAF C;  2HYJ A;  1WJ5 A;  3BR6 A;  4FQG A;  3DPL C;  1Y39 A;  3P5J A;  2DT7 B;  2RNJ A;  2ZXJ A;  1TWF J;  3WTX C;  4S0H B;  3QQA A;  1D5Y A;  2X6X A;  1IO2 A;  4GYG A;  3FHZ A;  5CKT A;  1UHW A;  5IT3 A;  2E1C A;  3W6V A;  2M45 A;  5E3L A;  5DD8 A;  3CCM I;  5EGO B;  4FAS D;  2NNN A;  1L3L A;  4BE2 A;  2VOO A;  1FJL A;  1AOY A;  1HF0 A;  4V2F A;  5EG0 B;  4ZYG A;  3R60 A;  3WU1 B;  1G6N A;  2W4S A;  3D0S A;  1G3Y A;  1MD0 A;  2Z99 A;  4XOT A;  4ZH4 F;  2R7Z J;  2VBX A;  5L3D A;  4BKX A;  3KP6 A;  3OYJ A;  2OCC H;  3S1R J;  4H0E A;  1H9G A;  3BZC A;  1F5T A;  1B72 A;  1UZC A;  5M5Y J;  1GT0 C;  1IN6 A;  3K4B A;  4D7N A;  3J81 K;  1I6H J;  4HYE A;  2EIL H;  2MH2 A;  2DPU A;  3DBH B;  5JLW A;  1ZHF A;  2CO5 A;  4BJ5 C;  2XPV A;  3MZY A;  2DMN A;  5HLH A;  1MIJ A;  6PAX A;  5BPD A;  1R7J A;  3ZQQ A;  4PK4 A;  3H9Q A;  4I7H A;  1ZH5 A;  1B8I A;  3OIP A;  1OQY A;  2M4G A;  4YFX F;  2DDA A;  1XGN A;  4PFO A;  4HG2 A;  1RET A;  4RGU A;  5TGT A;  5HS8 A;  2CQN A;  4M9X A;  2BE5 F;  1SEU A;  1W5C C;  4V2G A;  3VSL A;  3CUQ A;  5FD6 A;  4CA0 A;  4RB3 C;  4A3E J;  2L7Z A;  1IUY A;  4R79 A;  2Q1Z B;  3H9J A;  2UXX A;  2Q8K A;  4UUT A;  1ETO A;  3OYN A;  2CWE A;  2XAQ A;  2WAF A;  3LQR A;  2O8X A;  3MD2 A;  1LVK A;  1FOK A;  4GRI A;  3WE2 A;  1TLH B;  3S93 A;  1Z9C A;  3V7S A;  4LD5 A;  2F5F A;  5EYR A;  3FM3 A;  3S32 A;  2R3S A;  2RV8 A;  3UKG A;  1P4A A;  1K78 A;  3IH4 A;  4N9I A;  3HOW J;  3CQZ J;  1QHH D;  2JA8 J;  1HLV A;  3TKY A;  2LNB A;  3FZV A;  2ELH A;  5JVT A;  3AL0 C;  1TWA J;  3V42 A;  3HB9 A;  2ZJQ F;  1U78 A;  2BOL A;  3IH3 A;  3V8J A;  1RC9 A;  4BHC A;  1BOB A;  2W84 A;  2ZME A;  1W0U A;  3S16 J;  1LEA A;  2CW7 A;  4FCY A;  3J7Z I;  1EF4 A;  1BR1 A;  2IBD A;  2PMZ N;  4XM3 A;  3RI4 A;  1WJE A;  5L3B A;  3GTO J;  2KP6 A;  5GP9 A;  3BOQ A;  3OIO A;  2HEO A;  4JBA A;  2LSO A;  5DUK A;  1VQP I;  1IJW C;  4D9J A;  3DTE A;  3M1E A;  3ZR8 X;  3DPU A;  1IZ1 A;  4A93 J;  2HOE A;  2W57 A;  3MFK A;  1U3E M;  3L2V A;  1JT6 A;  1ZGA A;  2IGO A;  3UNG C;  1R5H A;  3WTY C;  4RGS A;  1Z77 A;  2ECB A;  2QUF A;  1XTA A;  3VYS B;  1R4N B;  2BVL A;  2FSW A;  3IV5 A;  4MHG A;  2X6Y A;  3F9K A;  3OL4 A;  2JSC A;  4YEJ A;  3G3Z A;  2O0Y A;  1RES A;  2G7U A;  5H6Q A;  2GM4 A;  2WV1 A;  2DK8 A;  5FLX Z;  2B0L A;  3HOY J;  1FBS A;  2D5V A;  3F8F A;  3JRC A;  5F1J A;  4OU0 A;  3ZQL A;  1KU2 A;  3IH2 A;  3O8H A;  4AIJ A;  1RIO H;  1DGW Y;  3ZMS A;  3TW6 A; 
#chains in the Genus database with same CATH homology
 3QYE A;  2A5W A;  2WY8 Q;  3E1S A;  1ZEL A;  3G2B A;  2WAD A;  3L2U A;  1MMA A;  4F52 A;  5HOO A;  1P9Q C;  3FHN A;  2LRD A;  2VQH A;  4XOP A;  3K4K A;  2WY7 Q;  2Z1D A;  3U21 A;  2M7A A;  1X4O A;  3PSI A;  2R7U A;  2QKM B;  2IGM A;  3M1C A;  2V4J C;  2E1M B;  1V5G A;  2MD0 A;  1LKX A;  2WB1 A;  2HVQ A;  2VJ4 A;  4XN0 A;  4E6K G;  3RCO A;  3DQV C;  5HLT A;  3H5R A;  4CH7 A;  4XLH A;  4J01 A;  1W36 C;  2PJR A;  2RQQ A;  5HVQ C;  5KNL A;  1WJD A;  3PL8 A;  3A4C A;  2MC4 A;  3OYH A;  1WFX A;  1S9H A;  2L2O A;  5KCM A;  2LC2 A;  3QYB A;  3D5L A;  1TZL A;  3TL4 X;  2E5Z A;  4BQN A;  1V5F A;  3DTK A;  4BE0 A;  4RLF A;  2XF5 A;  2CV2 A;  3H5A A;  4Y3O A;  3QOD A;  4HSR A;  3BG7 A;  1Z3Y A;  2WBM A;  3HKZ A;  2LG4 A;  2KZV A;  1D0Z A;  2QKL B;  2XSJ C;  1D0Y A;  2A6T A;  4G6T B;  2V7F A;  1U0J A;  4C2T A;  1TT0 A;  3C2H A;  3ZXS A;  3LSG A;  4YRV A;  4E7I A;  4PJM A;  2HQA A;  4F55 A;  4JOM A;  1QU3 A;  2HPM A;  2CFO A;  2E1M C;  3FBI B;  1D1B A;  4CCJ A;  5LD2 C;  4BAC A;  1BR4 A;  1FMV A;  2DJI A;  4NUB A;  3EUK L;  3UR3 C;  2PMZ A;  4HNU A;  3L2Q A;  1X1B A;  5HNF A;  2VJJ A;  4NC7 A;  4E4H A;  3FDY A;  2K5C A;  3KYL A;  3QOE A;  1OR7 C;  5CQE A;  3K70 D;  4IQJ A;  2VQL A;  3IP4 B;  2X51 A;  2HDW A;  4ZJZ A;  2BVM A;  4LIT A;  4BDY A;  3LMM A;  3OWT A;  2UWM A;  3J7A Y;  2WA0 A;  2V26 A;  2CMP A;  4AYB A;  3VSK A;  3M8J A;  4F93 B;  2GOM A;  3I9V 2;  4ITV A;  4IQ4 A;  2E60 A;  3KEY A;  4DBQ A;  3OYM A;  2ZSH B;  4XL9 A;  3GBG A;  1V5E A;  2IGK A;  2VPL A;  2MFZ A;  2JVG A;  2RNG A;  3OR1 C;  3DKY A;  2JVH A;  4KIS A;  3RSN A;  3K4C A;  4N4N B;  2JSP A;  1WJC A;  4N4O B;  2LY1 A;  4RMN A;  4HRI A;  3CJQ B;  1YE9 A;  1DGR M;  1MND A;  4F92 B;  3DWL E;  3AKZ A;  2KRH A;  1D0X A;  2L7K A;  2JUG A;  4CUG A;  4F3Q A;  1HA8 A;  3W3C A;  4Y4R A;  2KLO A;  2HVR A;  1LDK B;  3I3L A;  4XLA A;  1J09 A;  2M3A A;  2OV7 A;  1X1A A;  1X19 A;  2W7N A;  2LBF B;  2L5Q A;  3VYT B;  2Z16 A;  3RQ4 A;  4CCL A;  2WAE A;  2R7V A;  2VAS A;  3SDB A;  3BLY A;  4XON A;  4YEL A;  3IUO A;  4NC8 A;  3EPZ A;  1G8X A;  4KIT B;  3DU5 A;  3VDX A;  4X0G A;  2R4G A;  3CMM A;  2Z2S B;  3D5S C;  2LRE A;  2E5N A;  3OYG A;  2DCE A;  3HG9 A;  3PNT A;  1X1C A;  1PJR A;  4NNJ A;  4BEH A;  4DGW B;  2CUZ A;  3ZRG A;  4P1W A;  2LY2 A;  3SYT A;  2UV1 A;  2KL4 A;  4RLQ A;  3PSF A;  3TMO A;  3LSM A;  4BUP A;  4ZDO A;  3VYR B;  4ZYA A;  2CUJ A;  4B3X A;  3C2G A;  3OYB A;  4KT6 A;  1MNE A;  4E7Z A;  4BQO A;  4DBR A;  1MMD A;  4E7S A;  4BS9 A;  2Y0S A;  3K6G A;  3AFH A;  2BW3 B;  4RM3 A;  1E0E A;  4BDZ A;  2R7W A;  4E7H A;  4XLC A;  2V1N A;  1EA3 A;  4BE1 A;  2RRE A;  3BCB A;  3K4M A;  1WJA A;  2KRC A;  2X1D A;  2X85 A;  3FKJ A;  3H9G A;  3CP8 A;  1MMG A;  2HNH A;  2X6W A;  1WJB A;  4P5O A;  3CF2 A;  3LFU A;  4CCO A;  3LSK A;  3HUG B;  1D1A A;  3N05 A;  5JHF A;  5FRN A;  1MW7 A;  2DXI A;  3W2A A;  1MMN A;  3DPT A;  4CZC A;  2VL8 A;  3EUA A;  3PUB A;  2KPM A;  2Q2E B;  3ONQ A;  1JI8 A;  2M0M A;  2IXS A;  3DU6 A;  3S8P A;  3SEZ A;  1VZ0 A;  2X1E A;  2ZXI A;  3NWT A;  2LOO A;  4U87 A;  1WJF A;  2IGN A;  3OYD A;  4PUS A;  2CH0 A;  1UEL B;  4E7J A;  2KHM A;  1YX5 A;  4DIQ A;  1D1C A;  2M4K A;  1AA7 A;  2LYC A;  3HC7 A;  4EAT A;  4PJJ A;  4U7B A;  1IRX A;  2HVS A;  5HNH A;  2VIX A;  3ZCO A;  3K10 A;  4ZTF A;  3H35 A;  4CCM A;  3RPU D;  3DEE A;  4IX7 A;  4KJZ A;  2KQR A;  2UUZ A;  2HU9 A;  2VKD A;  3PFY A;  1DP3 A;  4II2 A;  4NQW B;  4BJT A;  3VWB A;  1SFK A;  3CES A;  3BC8 A;  1Y56 A;  4OAY A;  4PJN A;  5FRM A;  4IKF A;  3S3N A;  2IS1 A;  3IAM 2;  3S3O A;  2R7R A;  4Y33 A;  2PJR B;  2OUM A;  2VQG A;  1FMW A;  3HL2 A;  2VXD A;  2VLA A;  2CV1 A;  3PNY A;  3SEQ A;  1Z21 A;  4BU2 A;  2R7T A;  3OS0 A;  1QHG A;  3IAS 2;  3HOT A;  4C30 A;  2NOJ B;  3OYI A;  4LIV A;  3DTI A;  1YX3 A;  3OYC A;  3QYF A;  4PSW A;  4MLO A;  2K3P A;  1WJ5 A;  3MKW B;  3HXL A;  3DPL C;  3ZGK A;  2DT7 B;  1BR2 A;  4ZC3 A;  3CZ6 A;  3H0D A;  2X6X A;  2F4I A;  3OYK A;  2F6C A;  5CKT A;  1T95 A;  4FAS D;  4PJL A;  4B47 A;  4BE2 A;  4CCN A;  2JA2 A;  1Y6I A;  4ZDP A;  3OYA A;  1T0F C;  1Z7L A;  4HEA 2;  4ANJ A;  4BL0 B;  4XMY A;  2W4S A;  3K70 C;  4LG3 A;  2MAB A;  2XAU A;  2IS2 A;  2VB6 A;  5LFA A;  4XOT A;  1Z3X A;  3MMY B;  2KDO A;  5CPR B;  1DQU A;  3OYJ A;  3OYE A;  1R6R A;  2W82 A;  4XKV A;  1G59 A;  2M7B A;  1X4P A;  3DLA A;  3OY9 A;  3EUH C;  2ZFU A;  1OLT A;  3LSH A;  2V6E A;  1LFP A;  2K9M A;  4RM2 A;  4B48 A;  2MYS A;  3K4B A;  4IZZ A;  1UAA A;  2XDV A;  1PYV A;  3L2W A;  2HZD A;  3BCA A;  2W00 A;  2IS6 A;  3E0J B;  2V9K A;  3H5N A;  4E7L A;  2L9N A;  2P0W A;  3OL3 A;  3HPG A;  4BJ5 C;  4H4K C;  3A1Y A;  4PFP A;  3ZQQ A;  4PK4 A;  4XKW A;  3H9Q A;  2VKH A;  4XLE A;  2ELJ A;  3OIP A;  4LIU A;  2LBF A;  2DT6 A;  3MKZ A;  2M4G A;  2AQE A;  4PSX A;  1UG0 A;  4PFO A;  4HG2 A;  2R7Q A;  5TGT A;  3AL0 B;  4XN3 A;  3A2K A;  4OWR B;  3KX2 A;  3VSL A;  2CS3 A;  4CA0 A;  1N75 A;  2OC6 A;  3OOU A;  2R7S A;  4R79 A;  2Q1Z B;  3H9J A;  4QPO A;  4C9Y A;  3LSI A;  3OIQ A;  3RTR A;  3OYN A;  4ZDL A;  4OAZ A;  2AQF A;  4BJ6 C;  2WAF A;  3HPH A;  4BQQ A;  4D1Q A;  4C2U A;  3MD2 A;  2WAQ A;  2FUG 2;  1LVK A;  3OMY A;  4HST A;  4GRI A;  3NWS A;  3S93 A;  1NG7 A;  2ZSI B;  3SZG A;  3S3M A;  4AVZ A;  3D5R C;  2K9L A;  2F5V A;  3CJR B;  3S32 A;  3OS1 A;  3OR2 C;  4BEH B;  4XNF A;  2KMU A;  3BG6 A;  2CV0 A;  2LH9 A;  1QHH D;  2VXZ A;  2CW8 A;  2VJ5 A;  2I8D A;  3TBI A;  2W1O A;  4HPQ A;  3CP2 A;  2VQC A;  3AL0 C;  3L2R A;  3V42 A;  3VYU B;  4QPQ A;  2BOL A;  1W36 D;  1BOB A;  2GOX B;  5CQG A;  2CW7 A;  1BR1 A;  1X1D A;  2VJI A;  2BW3 A;  2L9S A;  3LL7 A;  4XM3 A;  1WJE A;  4XKC A;  1SAU A;  3W2W A;  1KON A;  2KP6 A;  4CCK A;  4B44 A;  4D9J A;  4ZTJ A;  3MKY B;  2R7O A;  3K4J A;  3DKX A;  3OYL A;  3DTE A;  2X1C A;  3ZR8 X;  3DPU A;  4FET A;  1N77 A;  1N78 A;  1K6Y A;  4HNT A;  3L2V A;  2IS4 A;  2IGO A;  3UNG C;  3W2V A;  3OYF A;  4XKB A;  2XF7 A;  4BGD A;  4E7K A;  3K4N A;  3OS2 A;  4XOR A;  4XR6 A;  4II3 A;  3VYS B;  4F91 B;  3K4L A;  2XF6 A;  2BVL A;  2R7X A;  2XC7 A;  2X6Y A;  3F9K A;  3HOS A;  2O5R A;  1NG6 A;  3OL4 A;  4YEJ A;  4DJA A;  5FRO A;  4DOZ A;  1ERD A;  4BXF A;  4CSW A;  1GLN A;  4JQF A;  2DOA A;  2ZXH A;  4B43 A;  4XLF A;  2HPI A;  3FBN B;  4AU7 A;  3PNV A;  3PJR A;  5KHD A;  1DGW Y;  4XQF A;  4J00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...