5ILSA

Autoinhibited etv1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
101
structure length
101
Chain Sequence
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords ETS translocation variant 1
publication title Structured and disordered regions cooperatively mediate DNA-binding autoinhibition of ETS factors ETV1, ETV4 and ETV5.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ilsA00
3WE3A 1KYWA 4ENMA 1GXQA 1OR7A 2L54A 1R1TA 3FZVA 2K86A 4NB5A 2P5LC 4HW0A 3HRTA 4CICA 2F5DA 1ON2A 1T0FA 2QQAA 2XAJA 1HKTA 5HDGA 4BXUA 2PFBA 1XN7A 4M9XA 1Q1HA 1EH8A 5L3BA 3NRVA 1JE8A 1G3YA 2A5YB 1X3UA 1BIBA 4KICA 4S05A 3KP5A 1P4XA 1EV7A 4MHGA 2FBHA 2V9VA 1O7FA 4U7DA 2HGCA 1O3RA 3FWEA 2K7LA 3WTSC 1YQAA 2P7CB 1IN5A 5HDNA 4RB3C 4AIJA 1RNLA 1U78A 5BOXA 5BMZA 3ELKA 1OYWA 1JHHA 2ZO4A 3I58A 3N97A 4L18B 4KDPA 2D1VA 1BC7C 3ECOA 1EH6A 1Z05A 1J9IA 3WE2A 5L3CA 5LHGA 1LB2A 4KN4X 1HW5A 1IAWA 1RI7A 4OU0A 4U88A 2HTSA 4UV9A 1I5ZA 1S7AA 3PQJA 4KUMA 5FD5A 2MLGA 2O0YA 1S29A 4I09A 4BAYA 2PQ8A 4BHBA 3K69A 4LGWA 4O6JA 1HBXG 4EJVA 1R23A 3HIFA 4M9SA 5LBQA 2R7DA 2EV6A 5IT9Z 3Q5FA 4CGZA 1WWXA 1ZARA 1HXDA 5CVJA 1IN4A 2IA2A 3K1PA 2EV5A 2QBYA 3DPLC 2OZUA 1L3LA 3VB2A 5EEHA 5K5QA 2DK5A 1K79A 1FYKA 4D0PA 3C18A 4O3MA 1FT9A 2P7VB 3WTYC 4HF2A 4MNUA 1ULYA 2QWWA 1W7PD 1B9MA 1UB9A 3ML6A 3HHHA 4QWQA 1HKQA 5L3DA 3W6JB 3T8TA 2UXXA 2QQBA 5D4RA 4JK1X 4IF4A 2W85A 2QYOA 4JBAA 1ZLKA 3QPHA 1TQPA 4P5OA 5LGNA 2EFQA 5DUKA 2P5KA 3K9TA 2VBZA 2HKXA 2P6SA 2X4HA 5HDKA 4G9YA 5F1RA 2IVMA 2EV0A 2V1UA 2ESNA 2V6CA 3KE2A 3ZN0A 5JFRA 1HSTA 2RV8A 3HSFA 2QBYB 4QLCU 4KYWA 1IZ1A 4NHJA 4PGGA 2MA3A 2HR3A 3JTHA 3LQRA 3W6KB 4LG0B 4LFUA 1KQ8A 3LWFA 5KK1A 3M7GA 3TO6A 4HX4A 4M9ZA 1USSA 5HS8A 2QUFA 4HQMA 4E70A 4HA8A 1I27A 2W84A 1PP7U 3J80K 5ICEA 4M74A 2EB7A 3O3KA 2CG4A 4L0YB 2ESHA 5A2QK 1T38A 1MGTA 5ILUA 4A0XA 3O2PE 2ZXJA 4ZZDA 3KP6A 4BNCA 1LVAA 2JSCA 4IHTA 2XRNA 2A07F 3GZ6A 2NYXA 2MC3A 5LEJA 4OIQF 5ILSA 2V1XA 2EJRA 4RGRA 3ZP5A 3EDPA 4IRIA 3KLOA 3E5UA 3WTUC 1U8RA 5DCFA 5HS7A 3SHFA 3EETA 2K4BA 1FNNA 1RUOA 3HTSB 5HLHA 2DI3A 3BPXA 4MTDA 1B4AA 5KVRA 1QZZA 5F6FA 2FNPA 2GWRA 3KP3A 5CLSA 3RYPA 2LNBA 5ILVA 5FLXZ 4HV5A 3GWZA 1YTYA 1QNTA 3F23A 1FBUA 4KN7X 3K1NA 4ON0A 4KFCA 4RGSA 4BYYA 4FX4A 3ZN1A 2JPCA 1DPRA 2F5CA 4RB0A 1V3FA 1GXPA 3CUOA 5CYVA 2Z9OA 1IUYA 5CVIA 1KU7A 3HTUA 3QRFF 4EMSA 2ZMEA 1DP7P 3DF8A 4P96A 2Z33A 1R36A 4ZYHA 3MAJA 2OQRA 4A5NA 1R7JA 3BJAA 2FMLA 4N0BA 1KYZA 2LF7A 3KETA 2IPQX 3E5QA 1JGSA 3FMRA 1I1GA 2OBPA 2ZFWA 3RKWA 4AIHA 4XLPF 5H6RA 1R5HA 3I59A 5LGTA 3HHGA 2P6TA 2GA2A 4HOBA 4DNCA 2QM3A 3GO5A 2FQ3A 3TGNA 1FPQA 1WI9A 1BBYA 3Q9VA 1S8NA 1REPC 2NRAC 2O61A 2RNJA 2Y48A 4PDKA 4GYIA 3P9KA 3V8LA 2DU9A 2O8XA 4BQAA 1USTA 4ZH4F 1H9TA 2A6EF 3WTWC 3L00A 2KJBA 4ASNA 2H09A 1FSEA 2J5OA 4TV7A 2STWA 5FGMA 2KIUA 3CUQC 1U6GA 5ERIA 5DCMB 2ELHA 1WQ2A 4OMYA 2Z5UA 2AXLA 3TOBA 1D5VA 2MH2A 4Q4ZF 1OYIA 4I02A 4EM2A 1QQIA 4I98B 3BWGA 4WCGA 1R00A 4M73A 4B8XA 4HLYA 2A3SA 3F21A 4MGRA 1L0OC 2YR2A 3EYIA 3MZHA 3KP4A 2JZYA 1SMTA 1ZGAA 5BPDA 3TO9A 2C6YA 3TKYA 3WG9A 2QZ8A 4FHTA 4IRHA 2D1HA 2COMA 4KIFA 1IRFA 2GXGA 4LK0F 1XCBA 4KIBA 3WGIA 1SFEA 4U0WA 1KU9A 3I53A 5AIPA 1R1UA 4UVBA 1FY7A 3RI4A 2NNNA 2HOEA 2PN6A 2VT3A 3QAHA 2IRFG 1B59A 3P9CA 4CXFA 2ZJ2A 4HX7A 4LLLA 1I1SA 3E97A 4L9NA 4OOIA 5J8FA 3I5UA 3FMQA 1YW7A 3U9GA 4EM1A 4HBLA 4MEYF 1FP1D 3KFWX 1RUNA 2G7UA 2JT1A 3H92A 2IJLA 4GGGA 5HVQC 2BBYA 3F3XA 3C7JA 1O57A 2R7FA 3MFKA 1S6LA 3E5XA 1QO0D 1KU2A 2XKPA 2CWEA 3DPTA 1DUXC 4I2OA 3V7CA 3HRSA 3BROA 5LLQA 3V8KA 1TNTA 2EFWA 2VBYA 2XHKA 2CGPA 3T8RA 1FX7A 3VODA 1G3WA 4WXCA 2GXBA 3WU1B 1CGPA 2QQ9A 1BJAA 2CQKA 2ISZA 4LJZF 5EEGA 1J0RA 4WXDA 2M8EA 3GF2A 5LEKA 2NNYA 2VC1A 5FLXK 1MKMA 5L3EA 4BH9A 2D45A 1HSJA 3OV8A 1TLHB 1BI1A 2W25A 2P4WA 3L9FA 2DQLA 5K5OA 1GHCA 3M1EA 4G7HF 1XGSA 2BYVE 1D8JA 1H0MA 3QU3A 3FM3A 4A0ZA 1VTNC 3DEUA 1SFXA 2DK8A 1PDNC 1HKSA 2DFIA 5H6QA 3F72A 2IT0A 2DT5A 3LAJA 3CO6C 2DPUA 1YW8A 1J2XA 3RPUA 1TQIA 3F8MA 1D3YA 3E3VA 2L3DA 3PQKA 5DDGA 3JAMZ 1U2WA 2RN7A 2FA5A 2V79A 3I0TA 5L3GA 4LG0A 3HRUA 1ZRFA 3GW2A 3COAC 2O03A 3AAFA 1BIAA 3E6MA 4N9HA 1FSHA 3IWFA 4DQ2A 5JI6A 3QOPA 4P55A 4ZZLA 2ZCWA 1IXCA 3KP7A 4PZJA 4UXNA 3IKVA 2HYFA 3LQQA 4L5JA 5JR3A 4CDGA 3HRMA 2LSOA 2VXZA 3M8FA 1J75A 2H6CA 3TQNA 2HKOA 4RGXA 3G3ZA 2Z99A 1ZRDA 1O3TA 5CVUA 2RC4A 3R0AA 3LSTA 5L3FA 1SD6A 2WC2A 5TJJA 4ESFA 1J7KA 4G94A 1HW2A 3VEPA 2CYYA 2IA0A 4AVPA 1TTYA 5DEQA 1BI2A 1K7AA 1JXSA 4ENJA 2VOPA 1ODDA 2GZWA 3IL2A 3DXJF 4OINF 2VODA 1K6OA 1U3EM 4UHTA 2BV6A 3KEOA 3QPTA 2WV0A 4R79A 3T1BA 4AD9A 4HF1A 3EYYA 5E18F 3I71A 3WTZA 2DAOA 1LDKB 2Y75A 2O3FA 1MJBA 2M45A 4F7ZA 1YS6A 4H0EA 2ZKZA 2HWVA 3HUGA 3ZMUA 2RDPA 1T39A 3S2WA 4ETSA 3I4PA 3FXQA 2M1BA 1TQMA 4G7ZF 4AIKA 3R0JA 1XDSA 2EFOA 1WRJA 3KP2A 4UNOA 2VC0A 4M6YA 4U0VA 4KA4A 1ZLJA 1CF7A 4Y13A 1IF1A 4LD5A 4YFNF 1IXSB 3GEZA 3J81Z 2XAFA 4CZZA 2XVCA 3CTAA 1TBXA 1UHMA 4MEXF 4O5VA 2GA1A 4EJOA 4HYEA 4N9IA 2NS0A 4YG2F 5FFXA 2M5WA 3RTRA 2VBXA 4RB1A 4WF2A 2MH9A 5H20A 3C3WA 2HS5A 1Z1DA 1R1VA 2FBIA 1C0WA 1EH7A 3E6DA 2HEOA 1QBJA 2D2WA 5D6EA 1XGNA 3P7NA 5AIQA 4YIIA 1XGOA 4CYDA 3FHZA 2LDUA 5J6XA 3M8EA 4XBFA 1YIOA 4G8XA 3G73A 4R8HA 1W5TA 1F5TA 1G3SA 1LNWA 4HX8A 3SXYA 1Z6RA 4NQWA 5E8GA 1XD7A 2DO7A 3ULQB 3K2ZA 3K0LA 3NEUA 3RJPA 4EQQA 2J5PA 4IVNA 1V4RA 3RPQA 2PMUA 5DCMA 3BJOA 4HDVA 1Z9CA 1CF7B 2PEXA 4LK1F 3IHUA 4WXHA 2QLZA 4RAZA 1FYLA 4HQEA 2V1DA 2CW0F 1FZPB 1LEBA 4A5MA 1BI0A 1R5GA 4G6DA 1T98A 4Z2YA 1OPCA 5D5UB 1LDDA 3WU0A 2FNAA 4JQFA 2G7HA 4KMUX 2DPDA 3GVAA 2DTRA 1E17A 3HSRA 2JPBA 3L2CA 2RVCA 1ZYRF 2QVOA 2NAZA 3HOTA 4EVIA 3B73A 5IT9K 1MJ9A 1T6SA 2HFHA 3OOPA 1O3QA 3RIRA 1FWZA 2AS5F 3QP6A 2VE9A 3F8CA 3JAMK 2YU3A 3LA7A 4UV8A 3ROUA 1R22A 3ABTA 5DV5A 4YIFA 2KIMA 3KLNA 1XMKA 2R3SA 4MTEA 2CFXA 1T2KA 3Q9SA 6PAXA 3IRQA 1HQCA 2JTVA 4A6DA 3BJ6A 1Z7UA 3K1MA 4P9FA 1U5TC 1P4AA 5D4SA 2YX7A 4FT8A 4IRGA 1YS7A 3V7RA 3R61A 2FEZA 4LB6B 1G4DA 3ZPLA 2XV4S 3HSEA 4IJAA 3P9IA 3WTTC 2PBIA 2EFNA 2MBFA 5F64A 1MD0A 1KA8A 4M72A 5E8IA 4Q48A 4KT5C 3E6BA 4HLXA 1SD7A 3D0SA 1Z91A 2XUBA 4L0ZB 4BHPA 3ZMDA 2W24A 3FM5A 4GYGA 2X0LA 3SZTA 3SFZA 1F1ZA 3R60A 1W7PA 3I54A 1RIOH 1DDNA 5FD6A 2Q8KA 1ZG1A 3IRRA 3H3ZA 3ECHA 3LFKA 4RB2C 3GX4X 3ABUA 3MZYA 2HQRA 1BI3A 2EA4A 5LGUA 3GFLA 4Y15A 1KU3A 3GZ5A 2VOOA 1KGSA 2K4JA 1R58A 3DV8A 5K1YA 1LQ1A 2L02A 3MWMA 1Z6TA 2ETHA 3IWZA 1RZ4A 3LAPA 3GYHX 3U1DA 5D8LB 1PUEE 3J80Z 5ICFA 3CJNA 2P5VA 1BM9A 3REOA 4A0YA 4WWCA 2XROA 5HLIA 5TRDA 2EFPA 3QP5A 2Z3YA 4R1HA 4EJTA 1OMIA 4A6EA 3N4MA 2DQRA 1YW9A 1TNSA 3KCCA 2L4AA 3WTVC 3F6OA 3RYRA 2KRFA 4ESJA 2UZKA 1D8KA 4P9UA 5CJ9A 5ICCA 2QENA 2HTJA 2P8TA 1W5SA 1SMYF 1YLFA 3WGGA 3D5LA 5FFZA 1XSXA 4IPAA 3I64A 4WK8F 3BOQA 1W7PB 2RKHA 2MD5A 3GFMA 5BS6A 3GXOA 1MZBA 1H9GA 1J59A 2VE8A 2H6BA 4KIGA 3E6CC 1I6XA 2WWYA 4L5IA 1SAXA 3FF5A 4OIRF 3DP7A 5LHHA 1XSVA 2STTA 1FP2A 4ENNA 2YPRA 2FBKA 3L09A 1XMAA 4GO1A 1BN5A 4S04A 2CO5A 1PP8F 2XASA 2TDXA 3BPVA 4I7HA 3EQLF 1XSDA 2B0LA 2ZNYA 5DYMA 3RKXA 2E7XA 5E17F 3TOAA 2RGVA 2GIVA 2K02A 4XLNF 2H27A 1E2XA 1ZG3A 4OIPF 1FLIA 4KNYA 1XB4A 2DBBA 2VN2A 2FU4A 4K2EA 1K78A 2FF4A 4RGUA 1UHWA 5HLGA 2M30A 4L9JA 3HYIA 5E1WA 1XCVA 3QU6A 2CSOA 3FXUA 5LRRA 4HF0A 3JW4A 4U7BA 1ZRCA 2KKOA 4L9TA 4WX9A 1S3JA 2KJCA 3DQVC 4LLGF 4MQVA 3U2RA 2A6HF 5AONA 1MDMA 4EM0B 4XRFA 2ISYA 2MLKA 1BOAA 4ZYDA 5E20A 3BDDA 2K27A 4FX0A 3FX3A 4UUVA 4PCQA 2DW4A 1J5YA 1G3TA 1O3SA 1JHFA 1KQ0A 1AWCA 3O6BB 4G6QA 1HW1A 3WGHA 4UVAA 4LLNA 2UXNA 1MJAA 3HOSA 5BPIA 1FC3A 4XSXF 3ZMVA 1ZG5A 2M87A 5FB2A 5LHIA 2O6GE 4IHSA 3JSOA 1K78B 3GFJA 2PLYA 4UVCA 2YX4A 2F5EA 1AOYA 3M9AA 4YFKF 1LJ9A 3CLOA 4ZYEA 4OMZA 2ACJA 3EUHA 2KIFA 3V7SA 3LA2A 3TO7A 3ISPA 3NQOA 4G7OF 1SD4A 4Q47A 3L7WA 5HOOA 4KMFA 3BY6A 4GXOA 1WSUA 1UCRA 3F8FA 2OD5A 5D5VB 1FOKA 3VFZA 2IW5A 1ZAOA 4I0AA 3CO7C 4EJUA 5ICGA 5HS9A 4HV6A 3GUDA 4GCVA 2OA4A 1MDMB 5D6FA 5D5WB 1LDJA 2PG4A 1NHAA 4RAYA 4I0BA 4CO8A 2GQQA 2LKPA 2A61A 3F8NA 2PI0A 3LA3A 3ZMTA 1IXRC 2IP2A 4RS8A 3SZPA 1SD5A 1YFHA 1SFUA 2BGCA 4MQ9F 2G9WA 3IKTA 4XSZF 3DKWA 2L4MA 2Q2EA 2HYGD 2WTEA 2HDCA 5DUIA 4L9VA 1QZYA 3GFIA 1YG2A 3F6VA 3TDZC 2OZ6A 1F9NA 3C1DA 1LEAA 4B09A 3RDIA 1ZN2A 1UFMA 1W4MA 4LMYA 4YFXF 3TDUC 1XDUA 2XGXA 3FMSA 1O7LA 4LB5A 5FO5A 2F2EA 4HDUA 2VONA 3V8JA 1P2FA 3WTXC 2PJPA 2F5FA 1FBSA 5D8KB 3JTGA 1ZREA 3MCZA 1IN7A 4EGYA 1YO5C 2OU2A 1QGPA 2XAGA 1KQ9A 3IC7A 1GVJA 4EV0A 1OKRA 5E1XA 2FSWA 2XAHA 5IT3A 3ZQ7A 2Y0MA 4EGZA 2VBWA 4Q5SF 5DD4A 3B02A 1U5TA 5JVTA 4M71A 2YSRA 4AWXB 2FXAA 3F8BA 4I01A 3CUQA 2PMHA 1B6AA 4HAMA 1A04A 1P6RA 1P92A 5DD8A 3ZMZA 3H3UA 1OYYA 2Q0OA 1BC8C 3SQNA 2E7WA 4U0YA 2HZTA 2BEOA 3BZ6A 2XIGA 3T5XA 5E1ZB 1IW7F 3MQ0A 1DPUA 3MEXA 4A12A 4A2UA 5K5RA 1P4WA 4OIOF 1ZHFA 3KEQA 2FOKA 3R4KA 4M6XA 1FBQA 2GAUA 2UWMA 1IN6A 1TW2A 5CVVA 5CVRA 1ZGJA 3ZMSA 2ZNZA 5D5XB 2EA2A 1STZA 5BQTA 2A68F 1B1BA 5J8CA 3KZYA 2ADUA 3VOEA 2BE5F 1YYVA 1FYMA 1WKMA 3R6SA 2FE3A 1U5TB 2EWNA 3PFIA 2DLLA 2FMYA 3KZZA 4EJWA 2IA1A 3BP8A 1ZH5A 2E1CA 3WODF 1S7OA 2LF8A 2ZMEB 4ZYGA 3F22A 3FXRA 1Y0UA 3JSPA 3CUQB 3ERED 2FRHA 1G6NA 2H94A 3J7AO 1IRGA 5ED4A 2A69F 2VT2A 4Y17A 2OQGA 3V4GA 1F4KA 3RKYA 5LRSA 2W57A 2XKOA 2OAZA 4ENKA 4BHCA 4CHUA 3GLXA 3I59B 4PGHA 4ESBA 2EK5A 2E1NA 2JRTA 1QPMA 2ZBKA 1ONVA 3CDHA 4IXAA 3J81K 3DFGA 4HZFA 1IN8A 1ON1A 5A2QZ 3T0YA 2HQNA 2XAQA 2RQPA 1TW3A 5JHUA 1B9NA 1XGMA 2L01A
chains in the Genus database with same CATH superfamily
3WE3A 1KYWA 4ENMA 1VQ4I 4XOPA 4BXFA 1ETQA 3FBIB 1GXQA 3JREA 1OR7A 1K6YA 2L54A 2IS6A 4C9YA 5IPAA 2LMDA 1JTYA 4XK4A 1R1TA 3GTKJ 3FZVA 2K86A 2XF7A 4NB5A 2GLOA 2P5LC 3QYBA 3GTMJ 4HW0A 3HRTA 4CICA 2F5DA 2EINH 1ON2A 1T0FA 2QQAA 2XAJA 3SEQA 1HKTA 5HDGA 4BXUA 3IV5A 1JUPA 2PFBA 1V5GA 1XN7A 4IOAF 4M9XA 1Q1HA 3A2KA 5EF6A 1EH8A 1V5FA 3NRVA 5L3BA 1JE8A 1G3YA 3PSFA 1A31A 2A5YB 1X3UA 1BIBA 4KICA 4S05A 3DU5A 3KP5A 1P4XA 1EV7A 4MHGA 2FBHA 2FUG2 2V9VA 1O7FA 3TP3A 4U7DA 1NG6A 2HGCA 2VQCA 1FOYA 3CP2A 1MMSA 1O3RA 2ME0A 3FWEA 2L0KA 2K7LA 3WTSC 3BT9A 4AIDA 3EUAA 1YQAA 2P7CB 1PUFB 3M1CA 2XF5A 2XPVA 1XC5A 3UR3C 1IN5A 5HDNA 3GTOJ 5TGTA 4RB3C 4AIJA 3KYLA 1RNLA 1U78A 4RA2A 5HNFA 5BOXA 1Z21A 5LD2C 5BMZA 3FKIJ 3ELKA 3H9JA 1LPQA 1OYWA 5GADJ 4BBSJ 1JHHA 1GT0C 1MMDA 3BG6A 3V42A 4UB8C 2ZO4A 3I58A 3N97A 4L18B 3Q3SA 1WJBA 4KDPA 2D1VA 1BC7C 3AG1H 3ECOA 1EH6A 1Z05A 1J9IA 3OWTA 2K9NA 3WE2A 5L3CA 5LHGA 3HPHA 1LB2A 4KN4X 1HW5A 1IAWA 1RR8C 1RI7A 4KT6A 4OU0A 4U88A 2LY1A 2HTSA 4UV9A 3OMYA 3K70C 1I5ZA 1S7AA 2QKMB 3IP4B 1IDZA 2EIJH 3H35A 3OIPA 3PQJA 4KUMA 1XTAA 2JSPA 5FD5A 5F0HA 2MLGA 2KIQA 2O0YA 1S29A 2NXNB 4I09A 1X1AA 4BAYA 1Y8RB 2PQ8A 3K69A 4BHBA 2KLOA 3BC8A 3MZ8A 4LGWA 4O6JA 1HBXG 4EJVA 2LTPA 4ZTJA 1R23A 1VQPI 3HIFA 4M9SA 5LBQA 2R7DA 3CZ6A 2EV6A 4MIMA 2GOXB 5IT9Z 3Q5FA 4NUBA 4CGZA 1WWXA 1ZARA 1HXDA 1H89C 5CVJA 2CUZA 1IN4A 3AFHA 1YX5A 2IA2A 1JT0A 1A6IA 2LVSA 3K1PA 4XLEA 1YHQI 2EV5A 2QBYA 3DPLC 2OZUA 4F91B 1L3LA 3VB2A 5EEHA 5K5QA 1EKEA 2DK5A 5F1JA 1K79A 2W1OA 2R5ZB 1ZQ3P 2EH3A 1OCTC 1FYKA 4D0PA 2O5RA 5JVGF 3C18A 1YRNB 4O3MA 1FT9A 4HSTA 2P7VB 5CKTA 2M8GX 1T08B 3WTYC 1R49A 1WHUA 2KISA 4IL6C 3S1NJ 1VQ9I 4HF2A 3P5JA 1D1AA 3PNVA 3IH4A 4MNUA 1ULYA 2QWWA 3A03A 4BBRJ 1W7PD 2HXOA 1FEXA 1B9MA 4XLCA 3HOUJ 1UB9A 1ENHA 3ML6A 2FX0A 3DBLB 1RPWA 1RKTA 3KIOA 4QIWN 5FKKA 1WJ5A 3HHHA 4DOZA 5GTIC 4QWQA 1HKQA 5L3DA 3W6JB 5EDNA 1GVDA 4E7ZA 5LFAA 3T8TA 2QGUA 2BHYA 2UXXA 1WPKA 2K9LA 2QQBA 2R7ZJ 2PX9A 5D4RA 4JK1X 1MNEA 4IF4A 2W85A 4CSWA 2QYOA 4JBAA 1ZLKA 3QPHA 1JJ6C 3OYIA 3BG5A 1TQPA 3VSKA 4P5OA 5LGNA 2EFQA 3OR1C 2MYSA 2R7QA 5DUKA 3CF5F 2P5KA 1MW7A 2BY1A 2HQ5A 3K9TA 2VBZA 2HKXA 4RBOA 2P6SA 4UUSA 3A0BC 2X4HA 5HDKA 4D7NA 1XG1A 1ETYA 4G9YA 5C3EJ 2BY3A 2DA6A 4ITVA 4RM2A 5F1RA 2IVMA 2NVTJ 2CH0A 2EV0A 4XR6A 2VJ4A 2V1UA 2ESNA 5J4YA 2V6CA 1Y1VJ 3KE2A 2M0MA 1R9TJ 4I6ZA 3ZN0A 4GRIA 5JFRA 1HSTA 2EZKA 2RV8A 5EZGA 2TRTA 4JX4A 3HSFA 4RAFA 2QBYB 2Z1DA 3H5AA 3SFIA 4QLCU 2E2HJ 1IZ1A 4KYWA 4NHJA 1RESA 2NS7A 2WY8Q 3C2GA 4PGGA 4A3DJ 1ETOA 2MA3A 2WAQN 2HR3A 3QWLA 1BR4A 1Y56A 2K9MA 3JTHA 3LQRA 3W6KB 4LG0B 4LFUA 1KQ8A 3LWFA 5KK1A 1VF9A 3M7GA 2DYRH 3TO6A 4HX4A 4M9ZA 1USSA 5HS8A 2QUFA 4HQMA 4E70A 4HA8A 1HDDC 5B5EC 3JR9A 1VQ8I 3JRCA 1I27A 5FKOA 2NS8A 2W84A 1PP7U 1NK2P 3J80K 2MFZA 1OCOH 3FXKA 5ICEA 3OOUA 4LOCA 3K10A 4M74A 3TMOA 2EB7A 2VJIA 3LSGA 4DBQA 3O3KA 2CG4A 3FXJA 4L0YB 1RRJA 4A3GJ 4BQOA 4XICA 2ESHA 5A2QK 4BS9A 3KYCB 3K4MA 1T38A 3HOYJ 2KZVA 3D5RC 1MGTA 2ZSIB 3OYMA 4EEFG 3Q0VA 5ILUA 3S16J 4A0XA 3O2PE 2ZXJA 3EUHC 3KP6A 4ZZDA 4BNCA 1LVAA 1Z7LA 4M3BA 2ID3A 5C44J 4XN3A 1ETXA 2JSCA 4IHTA 2X1CA 2XRNA 2A07F 5KNLA 3JRBA 1ETWA 3ERMA 3GZ6A 3G1OA 1VNDA 2JVHA 2NYXA 5B1BH 5FROA 4BE1A 2MC3A 5LEJA 1JJ8C 4OIQF 5ILSA 2V1XA 2EJRA 4RGRA 3ZP5A 3EDPA 2CUEA 4IRIA 2XGDA 3KLOA 4XN0A 3E5UA 4XOTA 3WTUC 1U8RA 5DCFA 4UUSB 5HS7A 3SHFA 3EETA 2K4BA 2IGKA 1FNNA 1A36A 4HRIA 1RUOA 3HTSB 4CH7A 5HLHA 5DM6F 2DI3A 3L1PA 4IEJA 1POGA 3E0JB 3BPXA 4DJAA 3GTPJ 4MTDA 4CCLA 3PNYA 1OCRH 5M5YJ 5FKNA 3K4CA 3CCQI 1B4AA 3KZIC 2VKEA 5KVRA 1EJ9A 4CCJA 2CQXA 1DU6A 1VI0A 1QZZA 3G1LA 1N77A 5F6FA 2FNPA 2BXYA 2GWRA 2ZXIA 1W5CC 1AKHA 3KP3A 4XMYA 5CLSA 3HUGB 3RYPA 2LNBA 5ILVA 5FLXZ 3AG3H 4HV5A 3GWZA 4G12A 2R7RA 3WU2C 1YTYA 2CV0A 3GTQJ 1G8XA 1QNTA 2WAEA 3TW7A 3E7LA 2LFBA 4S0HB 3RZOJ 4M3GA 2FD5A 2V9PA 3F23A 2UUZA 1FBUA 5HLTA 3G2BA 4QTRA 2R93J 4KN7X 3K1NA 4ON0A 4KFCA 4RGSA 4BYYA 4FX4A 2CW8A 3ZN1A 2JPCA 1JKRC 1DPRA 2F5CA 3KEYA 4RB0A 1UHSA 2HOAA 4AVZA 1TWCJ 1V3FA 1GXPA 4MFDA 3CUOA 5CYVA 4B1RA 2IS2A 2QSFX 2Z9OA 3I9V2 2XSJC 2ZJPF 4A3LJ 1IUYA 2DOAA 2CFOA 5CVIA 2AQEA 1KU7A 3HTUA 3OR2C 2KHMA 3PSIA 3QRFF 4EMSA 2ZMEA 1ZR2A 1DP7P 2X51A 3DF8A 4P96A 2Z33A 1OFCX 1R36A 5J1UA 5C4JJ 4XRSG 4D5CA 4ZYHA 2X6YA 3MAJA 2OQRA 4PJNA 2F4OB 3GTLJ 2E1MC 4A5NA 1XS9A 2OTJI 1R7JA 3HC7A 4LIVA 2E2JJ 3BJAA 2DMQA 2FMLA 4N0BA 1KYZA 1QVUA 2Y9ZA 2LF7A 3KETA 2IGNA 2JA2A 3QPSA 2IPQX 1EF4A 3E5QA 3BZCA 1JGSA 3FMRA 3OYJA 3M07A 4XKWA 4C2MJ 1I1GA 2VQHA 2OBPA 2D5VA 2ZFWA 2Y30A 1X1CA 3RKWA 2L2OA 3FDYA 2FOWA 4AIHA 4XLPF 2WB1N 2EIKH 3BR6A 4XORA 3CCVI 5IOYA 5H6RA 5E3MA 1R5HA 3RZDJ 3K7AJ 3H5RA 3S93A 3I59A 2E2IJ 5LGTA 3HHGA 1SEUA 3UKGA 2P6TA 2GA2A 2ZSHB 4HOBA 3A1YA 4DNCA 2QM3A 1RKWA 3GO5A 2FQ3A 3TGNA 3VYRB 1FPQA 1N25A 1WI9A 1WJFA 4A3IJ 3BR2A 1TWFJ 1BBYA 2CU7A 3Q9VA 3DWLE 1S8NA 1REPC 4FCYA 2NRAC 3IH3A 2K3PA 2O61A 2RNJA 2Y48A 2DDBA 1AKHB 4PDKA 4GYIA 3P9KA 3BTIA 3V8LA 3A0HC 2DU9A 2O8XA 2RREA 3DTKA 4E4HA 1TL8A 1USTA 1B72A 4BQAA 4DGWB 2LKXA 4W1UA 2GM4A 4ZH4F 2K5CA 1T56A 1SVLA 1H9TA 2A6EF 5EZHA 4AU7A 3ZRGA 2WADA 3WTWC 1JKPC 3L00A 2KJBA 2UV1A 1OCPA 4ASNA 2H09A 2X1DA 1VQLI 1FSEA 2J5OA 4TV7A 2STWA 5IYDJ 5FGMA 1QPIA 2KIUA 3CUQC 1U6GA 4D9JA 2TCTA 4E6KG 5ERIA 5DCMB 2ELHA 1WQ2A 4OMYA 2Z5UA 2AXLA 3QYEA 2K9SA 2OC6A 3TOBA 3HL2A 1ETVA 1FTTA 3G6EI 2MH2A 1D5VA 4Q4ZF 1ETKA 1OYIA 4I02A 4II2A 5HNHA 4EM2A 1QQIA 2F48A 4I98B 3BWGA 2ZFUA 4WCGA 1R00A 1LE8B 4M73A 4B8XA 4HLYA 2A3SA 3F21A 1F36A 4MGRA 3HKZA 1L0OC 3W2AA 3BG7A 2YR2A 3EYIA 2JA5J 3MZHA 3KP4A 2JZYA 2DA2A 1KONA 1X1BA 1SMTA 4BDZA 2CUFA 1ZGAA 5BPDA 4DYQA 1A35A 2CV2A 3TO9A 5KAFC 2C6YA 5EYRA 3TKYA 4AUXA 5JLWA 3WG9A 2OJED 1GV2A 2QZ8A 4A3FJ 4BEHA 1R6RA 4FHTA 5KHDA 4CZCA 4IRHA 3CD6I 1DP3A 1X2MA 2D1HA 2COMA 3ZQQA 4KIFA 3PUBA 3M3YJ 1IRFA 1YX3A 3AG4H 2E1OA 4B3XA 2GXGA 4LK0F 2B63J 1XCBA 1QA6A 3QOEA 4KIBA 3ZCOA 4RAGA 2JA8J 3JRHA 1SFEA 3WGIA 1S9HA 4U0WA 1IJWC 1KU9A 2L5QA 2BVLA 1MBFA 3I53A 5DS9A 5AIPA 1R1UA 4RM3A 2BW3B 4NC8A 2BOLA 4UVBA 1FY7A 3RI4A 2H1KA 2PMZA 2NNNA 2HOEA 2XPUA 1ZKGA 2PN6A 2VT3A 5C4XJ 3CQZJ 3QAHA 1B72B 2IRFG 1B59A 3M4OJ 2ZJQF 3P9CA 4CXFA 2ZJ2A 4HX7A 4LLLA 3SEZA 1NH3A 1ERDA 2JRMA 1I1SA 3E97A 3OIOA 5GPAA 3JRFA 4L9NA 4OOIA 5J8FA 3GBGA 4PK4A 3I5UA 2HVQA 3CP8A 4MLOA 3FMQA 1YW7A 1IO2A 2EIMH 3BQYA 3U9GA 2RNGA 2F6CA 3VYUB 1Z3XA 4EM1A 4HBLA 4MEYF 1UMQA 2EPFA 1FP1D 2Q1ZB 3KFWX 3DLLF 1MBKA 1RUNA 2G7UA 2JT1A 3H92A 2DA4A 2IJLA 3CC7I 4GGGA 4ZJZA 3HOZJ 5HVQC 2BBYA 3LSIA 3TL4X 3F3XA 5IYBJ 4IHWA 1VZ0A 4ZYAA 3C7JA 2DN0A 1O57A 2R7FA 3MFKA 1Y1WJ 1BL0A 1S6LA 3E5XA 3CCYA 2KP6A 3PO3J 1QO0D 1KU2A 2XKPA 4CUGA 2CWEA 3PUFA 4C3JJ 3HM5A 4HNVA 3DPTA 1VFCA 1DUXC 4I2OA 1X4PA 3V7CA 3HRSA 3BROA 5LLQA 3V8KA 3PM1A 1TNTA 2R5ZA 2EFWA 2VBYA 3BG3A 4GFBA 2XHKA 1YRNA 4JYKA 3S3NA 1X1DA 2FJ1A 2CGPA 3T8RA 1FX7A 4BEHB 1JUMA 3VODA 4Y3OA 1G3WA 4WXCA 2GXBA 2BVMA 5GTHC 3WU1B 1CGPA 2QQ9A 2HVRA 1BJAA 2CQKA 5CPRB 1G2HA 2P81A 2ISZA 4LJZF 3HDDA 5EEGA 2DDAA 1J0RA 1VQOI 2EZLA 2QSGX 2AHQA 4WXDA 2M8EA 3GF2A 5LEKA 2A6TA 2NNYA 3F9KA 3N05A 1W36D 2VC1A 5FLXK 1S72I 4CYCB 1MKMA 5L3EA 4BH9A 4NC6A 2IS4A 2D45A 4DZPA 1HSJA 3OV8A 3PIOF 1TLHB 2M7BA 3LFUA 2GXAA 2O8KA 1BI1A 1T8IA 1BW6A 2W25A 3BR1A 4CCKA 2P4WA 3L9FA 2DQLA 5K5OA 1GHCA 3M1EA 1MMNA 4G7HF 1XGSA 1FOXA 3PNTA 2BYVE 1OR7C 3ZOBA 9ANTA 5FKMA 1D8JA 3RQIA 1H0MA 4HPQA 1FMWA 1WH5A 3QU3A 4PJJA 3FM3A 4A0ZA 1VTNC 3DEUA 1SFXA 2DK8A 3K6GA 1PDNC 1LFBA 1N78A 2E35A 1HKSA 3MKYB 5K7HA 2DFIA 5E3NA 4AM3A 1PYVA 3KYDB 1OJLA 5H6QA 3F72A 3RSNA 4DYRA 2IT0A 2M2EA 2DT5A 4YELA 3W6VA 3LAJA 3VDXA 3B6CA 5JLXA 2Y2ZA 1K61A 1JKQC 3CO6C 2DPUA 4PFOA 1GDTA 1YW8A 1J2XA 3RPUA 1TQIA 3F8MA 1D3YA 3E3VA 1HOMA 4D5FA 2L3DA 2DMTA 3FHNA 1YIJI 3PQKA 5DDGA 2KDZA 1S7EA 1O4XA 2QKLB 1D0ZA 2QEXI 3CJQB 3JAMZ 2YU9J 1U2WA 1Y39A 2RN7A 3ASOH 4PSWA 2FA5A 2V79A 3I0TA 5L3GA 4LG0A 3HRUA 1GLNA 1ZRFA 3GW2A 2L9NA 3COAC 2O03A 3OSFA 2CW7A 3AAFA 1BIAA 1MMGA 3E6MA 3OYDA 3OSGA 4N9HA 1FSHA 2X6OA 3IWFA 4DQ2A 5JI6A 5E3OA 3QOPA 2L9SA 4P55A 4ZZLA 4EATA 2ZCWA 1IXCA 3KP7A 4PZJA 4UXNA 3IKVA 2HYFA 4F92B 2JUCA 2JMWA 3LQQA 4E7LA 3NWTA 3CCJI 4ZDPA 4J01A 1T33A 4L5JA 5JR3A 5B1AH 3GTGJ 4CDGA 2DFHA 3HRMA 5M5XJ 2F4MB 2LSOA 4PJMA 2K85A 2VXZA 3M8FA 1J75A 2H6CA 1B8IA 3TQNA 3K4NA 2HKOA 1Z3YA 4RGXA 3G3ZA 2Z99A 1ZRDA 1O3TA 4JX6A 5CVUA 2RC4A 3LSHA 3R0AA 2IGOA 3LSTA 5L3FA 1SD6A 2WC2A 2IGMA 5TJJA 1Y8QB 2E36A 4ESFA 1J7KA 3MN2A 4G94A 1DU0A 2M34A 1HW2A 3VEPA 2CYYA 3ZQLA 4XQFA 1VQ7I 4UY8I 2DT7B 3J7AY 2JVGA 2Z16A 2IA0A 4AVPA 1TTYA 5DEQA 5K7ZA 5IOZA 4GDFA 1BI2A 1K7AA 1VQKI 2YS9A 3CMEI 4FISA 2K40A 4CA0A 1JXSA 4ENJA 1YJNI 2VOPA 1ODDA 4Z6YA 2GZWA 4IQJA 2QA4I 2V1NA 3DXJF 3IL2A 4BUPA 4OINF 2VODA 1K6OA 1U3EM 3TBIA 3S1RJ 4UHTA 1YE9A 2BV6A 4YRVA 3KEOA 2W00A 1LFPA 3QPTA 2WV0A 4R79A 3T1BA 5DM7F 4AD9A 4ZDLA 1FOWA 4HF1A 3EYYA 1BOBA 1OISA 5E18F 3JCUC 3I71A 3WTZA 2QF7A 3DBRB 2DAOA 4XKVA 1LDKB 1R4NB 2Y75A 2O3FA 2HOTA 3O8HA 1MJBA 2M45A 4F7ZA 1YS6A 4MO7A 2R7OA 4NC7A 1Z67A 4H0EA 2ZKZA 2G0EA 1A6QA 2HWVA 1WFXA 2AXTC 3HUGA 2ICWG 3ZMUA 5FRNA 2RDPA 1T39A 3S2WA 1D5YA 4ETSA 3I4PA 3FXQA 2M1BA 4QSHA 4QPOA 1TQMA 4G7ZF 4AIKA 1WH7A 3R0JA 4HSRA 1XDSA 2EFOA 1WRJA 5J3LA 3KP2A 4UNOA 3DU6A 2IEKA 2VC0A 2BHZA 4BY1J 4OWRB 4FETA 1R5ID 2MGQA 3DKXA 4M6YA 4U0VA 2CQNA 3S32A 4KA4A 1ZLJA 2DODA 1CF7A 4HEA2 4Y13A 2JWTA 1RR7A 1IF1A 4LD5A 2Z2SB 4YFNF 3LSJA 2LY2A 1IXSB 3GEZA 1IC8A 3J81Z 4JX5A 2XAFA 4CZZA 1B8IB 3HEFA 1XPXA 5GAHJ 2XVCA 3CTAA 1UELB 2HZDA 3EUKL 1XMXA 1TBXA 2M3AA 2IBDA 1UHMA 4MEXF 2R7VA 4O5VA 2GA1A 1VQ6I 4EJOA 1WJDA 2XSDC 4C2UA 2VL8A 4YIRX 1DQUA 5CQGA 1FIPA 2AO9A 2ELKA 3PJRA 2LC2A 3MD2A 4HYEA 4N9IA 1K4TA 2NS0A 4YG2F 2X6WA 3FISA 2DMUA 4M6VA 5FFXA 2M5WA 5F0FA 3RTRA 2VBXA 1I3AA 3BCBA 4RB1A 2IS1A 1I50J 1MBHA 1LFUP 1N75A 2EZIA 4WF2A 4ZTFA 2MH9A 3GZNB 5H20A 1WJEA 4LIUA 3C3WA 5J47A 2DFFA 2HS5A 3CMAI 3BZKA 2XDVA 3D1NI 1Z1DA 1R1VA 2FBIA 1C0WA 1EH7A 3E6DA 2HEOA 4BU2A 3RCOA 1QBJA 2KMUA 3OIQA 3H9GA 2D2WA 3A02A 1Z77A 3I55I 3LNQA 3I4MJ 5D6EA 1XGNA 1MMAA 3A4CA 5FLVA 2ECCA 2M4KA 3P7NA 5AIQA 4YIIA 1XGOA 4B47A 4CYDA 4Y33A 3FHZA 2LDUA 5J6XA 1LUJB 3RKQA 3M8EA 4RDUA 4XBFA 2GBYA 1YIOA 4G8XA 4FTHA 3G73A 4R8HA 1W5TA 3AL0C 1F5TA 3KX2A 1G3SA 1LNWA 3HGGA 4HX8A 3SXYA 1Z6RA 2VJ5A 4NQWA 5E8GA 1XD7A 2DO7A 3OL4A 4L5EA 3ULQB 3K2ZA 2E34A 4X0GA 3K0LA 4IO9F 5EG0A 2W48A 3NEUA 4IHYA 3RJPA 4EQQA 2J5PA 2GOMA 4KISA 2Y0SN 2R7TA 1UJ8A 4XKBA 4IVNA 1JGGA 4U87A 1V4RA 3CLQA 3L2WA 3RPQA 2IAIA 2PMUA 5DCMA 5FLMJ 3BJOA 4HDVA 1Z9CA 1CF7B 2PEXA 4LK1F 3S17J 1ZGWA 3S3OA 3IHUA 4UB6C 3S8PA 4IKFA 4WXHA 2QLZA 4RAZA 1FYLA 3IAM2 3L2RA 2I5UA 4HQEA 2V1DA 2CW0F 1FZPB 1LEBA 2VKVA 2LREA 1PJRA 1BI0A 2LRDA 4A5MA 1R5GA 4G6DA 1T98A 4LITA 4Z2YA 1OPCA 2O7OA 3S2HJ 1I6HJ 5D5UB 1IUFA 1LDDA 3WU0A 1CQTA 2E19A 1LE8A 2FNAA 4JQFA 2G7HA 4KMUX 3BR3A 2KDOA 3H9QA 3OYGA 5M5WJ 2XRLA 2DPDA 3GVAA 2ZXWH 2DTRA 2MD0A 1E17A 3HSRA 2JPBA 3L2CA 2RVCA 1ZYRF 4BJ5C 3NARA 1OQYA 2QVOA 2NAZA 4BL0B 2BXZA 3HOTA 4EVIA 4V2GA 3B73A 5IT9K 3VWBA 1MJ9A 1T6SA 1U8BA 1XX5A 2HFHA 4E7KA 4QPQA 3OOPA 1O3QA 4A69C 3RIRA 2ZC2A 1FWZA 2AS5F 5M3FJ 4I76A 5HODA 3QP6A 2VE9A 3WHCA 2MC4A 3F8CA 4B3AA 3JAMK 2HI3A 2H8WA 2YU3A 3ONQA 4ZC3A 3AKZA 3LA7A 4UV8A 4PFPA 3BG9A 3ROUA 1R22A 1MNMC 3ABTA 2E1MB 5DV5A 5EJCA 4YIFA 2KIMA 1MH3A 3KLNA 3O8GA 4HG2A 1XMKA 2JA7J 5F08A 2R3SA 4MTEA 2CFXA 2BW3A 2NVQJ 1WI3A 3CC2I 4M3FA 2COBA 1T2KA 3DLAA 3Q9SA 6PAXA 3IRQA 4OAZA 4XRSA 2GIZA 2MW8A 3HJEA 4NQWB 4IHVA 1HQCA 2JTVA 3DPUA 4A6DA 3BJ6A 1Z7UA 1FMVA 5IYCJ 3K1MA 4P9FA 2WA0A 1U5TC 3FK7A 1P4AA 2E60A 5D4SA 2WB1A 2YX7A 2HNHA 5EG0B 4FT8A 4IRGA 4AYBN 2X48A 3WG7H 1YS7A 3V7RA 3R61A 2FEZA 4LB6B 1G4DA 3OYCA 2F4IA 3CESA 1X19A 2R7SA 2ZMEC 2DJIA 4FQGA 3OYKA 3L2VA 4DYCA 3ZPLA 1JUSA 2DMNA 1LVKA 5B66C 2PJRA 3Q0WA 2KRCA 2XV4S 3HSEA 4IJAA 1W36C 3P9IA 3WTTC 2PBIA 3PFYA 2EFNA 2MBFA 1H8AC 5F64A 4PSXA 1MD0A 1KA8A 4M72A 1SVMA 5E8IA 3K2AA 4Q48A 4KT5C 3E6BA 5DTDA 2CV1A 4HLXA 3ZQHA 1ZELA 2LK2A 1SD7A 1VQNI 3D0SA 1Z91A 2XUBA 3I56I 4L0ZB 4CCOA 4BHPA 3NAUA 3OS0A 3S15J 3ABLH 3ZMDA 3I4NJ 2W24A 2M0CA 1TP4A 3FM5A 4GYGA 1MSFC 2LG4A 2X0LA 4H4KC 2KPMA 2XGCA 3SZTA 2HYJA 3LSMA 1OLTA 5KCMA 3SFZA 1F1ZA 2RQQA 3R60A 2AQFA 3JRGA 1YI2I 1IRZA 5GP9A 1W7PA 1S5LC 3I54A 1RIOH 5FD6A 1DDNA 2Q8KA 1ACIA 3M8JA 4AC0A 3S1MJ 1RETA 1DGRM 1ZG1A 4B44A 4B43A 3IRRA 3H3ZA 3CCUI 3ECHA 3LFKA 2PMZN 2LH9A 4RB2C 1IRXA 3H5NA 3GX4X 3ABUA 3MZYA 2HQRA 1BI3A 2EA4A 5TISC 5LGUA 5FRMA 2R0QC 2QCOA 3OYEA 3GFLA 4Y15A 3ZQGA 1KU3A 2V26A 2CRGA 3GZ5A 3K4BA 2I8DA 4IQ4A 4CYCA 2VOOA 4IX7A 1P7JA 1YOVB 3DTIA 2HVSA 1KGSA 3JRDA 2K4JA 5GPCA 3H3VK 3MKZA 1R58A 3DV8A 5K1YA 4BXXJ 3CJTB 1LQ1A 3G4SI 2L02A 3MWMA 1Z6TA 1HCRA 2WY7Q 2ETHA 3IWZA 1RZ4A 3LAPA 3QQAA 2XC7A 1WGXA 3GYHX 2LBFB 3U1DA 5D8LB 1PUEE 2M4GA 3H0GJ 3J80Z 3JRIA 3LSKA 2DCEA 1JI8A 1SAUA 5ICFA 3CJNA 2P5VA 1BM9A 3REOA 4A0YA 4W97A 2CQQA 3FXOA 4WWCA 2XROA 3OY9A 3OYNA 2PJRB 2DOEA 5FJ8J 4A3BJ 1ZK8A 4B4CA 5HLIA 5TRDA 3SYTA 2EFPA 3QP5A 4A93J 2VASA 2Z3YA 4R1HA 4EJTA 1IV6A 2A5WA 2BY0A 1OMIA 4A6EA 3VSLA 3N4MA 5E3LA 2M7AA 3NWSA 2Y69H 2DQRA 1YW9A 1TNSA 3KCCA 2L4AA 3ZQCA 2HDWA 3OYAA 3WTVC 3UNGC 4J00A 3F6OA 5BNGA 3RYRA 2R7UA 2YUSA 2KRFA 3K4KA 4II3A 4ESJA 3QODA 2OV7A 1AHDP 2UZKA 2OPTA 1D8KA 3X2QH 4P9UA 2JN6A 3IH2A 3ZQIA 5F04A 2A05A 3L2QA 4DBRA 1GV5A 5CJ9A 5ICCA 4BKXA 2QENA 2HTJA 2P8TA 5K7FA 1E3HA 1W5SA 1SMYF 1YLFA 3WGGA 2V7FA 3D5LA 5FFZA 1XSXA 4CCMA 5JHFA 4IPAA 3I64A 4WK8F 3BOQA 1Z0XA 2R5YA 1W7PB 2RKHA 2V6EA 2H1LA 2VPLA 1E3OC 2MD5A 3HXLA 4N4OB 3GFMA 5BS6A 3GXOA 3A01B 2DOFA 1MZBA 3CDLA 1M1EB 1H9GA 5J40A 1J59A 2VE8A 2H6BA 4KIGA 3E6CC 1FIAA 1I6XA 2WWYA 4NNJA 4L5IA 2R7WA 1JT6A 3FF5A 4OIRF 1SAXA 3DP7A 5LHHA 2K9QA 1XSVA 3J7ZI 5EGOA 2STTA 1FP2A 1X3WB 2YPRA 4ENNA 2DXIA 2FBKA 3L09A 1XMAA 4DIQA 1RC9A 2L9VA 4GO1A 1BN5A 4S04A 3B6AA 2CO5A 1PP8F 2XASA 2TDXA 1R4MB 1X4OA 3FIWA 2ID6A 3BPVA 4I7HA 3EQLF 3BTLA 1XSDA 2B0LA 3S3MA 4X1EA 3KPHA 1WVRA 2ZNYA 5DYMA 3RKXA 2E7XA 5E17F 2BZTA 3TOAA 5IP7J 2RGVA 2GIVA 2K02A 1W0UA 4XLNF 1IG7A 2H27A 1E2XA 1BW5A 1ZG3A 2W82A 1ZR4A 4OIPF 1FLIA 4KNYA 1XB4A 2V4JC 1T0FC 2DBBA 2VN2A 2KRHA 2FU4A 4K2EA 1P9QC 2VKDA 2LD5A 1K78A 1TT0A 2FF4A 2W7NA 1V55H 5GAGJ 1DGWY 3LOCA 4RGUA 4XL9A 3LMMA 1UHWA 4XKCA 4J19A 3W2VA 5HLGA 1NK3P 3U21A 4FE4A 1NTCA 3SJMA 2M30A 1WJAA 4L9JA 3HYIA 4ZDOA 1J09A 5IP6A 3HOXJ 5E1WA 3CCLI 1TC3C 1XCVA 2H8RA 2L7ZA 3LL7A 2L9RA 3ABKH 3QU6A 3OS1A 3H36A 2CSOA 3FXUA 1U0JA 5LRRA 4HF0A 3JW4A 1MNDA 1QHGA 4JP0A 2DA1A 2NVXJ 4U7BA 1ZRCA 2KKOA 4L9TA 4KJZA 3F0CA 2NOJB 1HDPA 4WX9A 1S3JA 1GUUA 2KJCA 3DQVC 5H2FC 4IOCF 2V9KA 1MBEA 4LLGF 2R5YB 2NOGA 4MQVA 2DYSH 1QU3A 4A3JJ 4D7MA 2IXSA 2MG4A 3U2RA 2HDDA 3BLYA 1D1CA 2F5VA 2A6HF 3IAS2 2B7EA 2XB0X 3ABMH 3BCAA 4PJLA 1K83J 5AONA 1MDMA 4EM0B 1QZEA 3GLLA 2ELJA 2ISYA 4XRFA 4ABZA 2MLKA 5EGOB 1MBGA 1BOAA 2R4GA 3CMYA 3AG2H 4ZYDA 5E20A 3BDDA 1PVEA 3BTCA 1K4SA 3G71I 2K27A 4PUSA 3SZGA 4FX0A 3OYFA 1SFKA 3FX3A 4UUVA 4PCQA 2DW4A 2KQRA 1J5YA 1V5EA 1G3TA 5KAIC 3PL8A 1JHFA 1O3SA 1KQ0A 2DFEA 1AWCA 3O6BB 1UAAA 1UZCA 4YEJA 4G6QA 1HW1A 3DCFA 3WGHA 4XONA 4UVAA 2W4SA 2UXNA 4LLNA 4C2TA 1MJAA 4XRMA 3BTJA 2I10A 1NG7A 3HOSA 2JA6J 5BPIA 1FC3A 4XSXF 3ZMVA 1ZG5A 2M87A 2DA5A 5FB2A 5LHIA 2O6GE 3J7YJ 1G59A 4IHSA 3JSOA 1Q1VA 1K78B 3GFJA 2PLYA 4UVCA 2KT0A 2F5EA 2VKHA 2YX4A 3E1SA 3M9AA 3VYSB 1MSEC 1AOYA 4YFKF 1Y6IA 1LJ9A 3CLOA 4ZYEA 4OMZA 2ACJA 3EUHA 2WV1A 1OCCH 2KIFA 4F3QA 3V7SA 2LKSA 3LA2A 2CUJA 3TO7A 3ISPA 3NQOA 4G7OF 1APLC 2KFDA 3CCEI 1JTXA 3HB9A 1ZTRA 1SD4A 4P1WA 2LP0A 4PJ0C 1TT5B 5FKLA 4Q47A 3L7WA 5HOOA 4KMFA 3BY6A 1X58A 1LKXA 4GXOA 4OAYA 4Y4RA 1WSUA 1UCRA 3F8FA 2OD5A 2VUMJ 2EILH 1TWGJ 1UG2A 5D5VB 1FOKA 3CCRI 3VFZA 2IW5A 5F0CA 1ZAOA 4I0AA 3CO7C 4EJUA 5ICGA 4C3HJ 5J1YA 5HS9A 4HV6A 1U9OA 3TEDA 2B9SA 3PO2J 1ORKA 3GUDA 3CF2A 4GCVA 2FQ4A 2OA4A 2JJ7A 1MDMB 3CMMA 1E3PA 2EQRA 2O9LA 2L7KA 5D6FA 2KZGA 4BQNA 5D5WB 1LDJA 4E7HA 2PG4A 3DEWA 4CCNA 1NHAA 4NBQA 4RAYA 2NVYJ 2ZXHA 4I0BA 2GQQA 2LKPA 2A61A 3K4JA 3DBHB 4CO8A 2EBIA 2CQ7A 4XLAA 3F8NA 3MKWB 2PI0A 2OTLI 3K70D 2WAQA 3LA3A 3L2UA 1X3ZB 4E7JA 3ZMTA 2VLAA 2BY2A 1IXRC 3VPRA 3FXMA 2IP2A 4RS8A 3SZPA 3OYHA 1QVTA 4V19K 1SD5A 2MSYA 2DA7A 2VIXA 2VXDA 1YFHA 1SFUA 1VQMI 2BGCA 3BR5A 4MQ9F 4RMNA 4BJTA 2G9WA 3IKTA 4XSZF 3CDIA 2CJJA 3DKWA 2L4MA 4ANJA 1BJZA 4A3CJ 2MABA 2Q2EA 2HYGD 2WTEA 2HDCA 5DUIA 2R7XA 4L9VA 1QZYA 3GFIA 3S2DJ 3CCMI 1YG2A 2KL4A 2ZB9A 3F6VA 3TDZC 2HPMA 2OZ6A 3ZR8X 2K3FA 1I3QJ 5J4VA 3BR0A 1F9NA 3C1DA 4RLQA 1LEAA 4DW6A 4B09A 3RDIA 1ZN2A 1UFMA 1SC7A 1W4MA 5IY5H 3ASNH 4LMYA 1QRYA 3SDBA 2R92J 4YFXF 4BACA 4BDYA 3TDUC 1D1BA 1XDUA 3W3CA 1MH4A 3LSPA 5F27A 4E7SA 2XGXA 3FBNB 1MIJA 3FMSA 2LY9A 3H1CA 1O7LA 3VYTB 4LB5A 5FO5A 4N4NB 4F52A 4BE0A 2VQGA 3S1QJ 2F2EA 1MBJA 4HDUA 4Y52J 2VONA 3V8JA 4E7IA 1P2FA 3OL3A 3WTXC 4RLFA 2PJPA 2F5FA 1FBSA 5D8KB 3JTGA 1ZREA 3MCZA 1IN7A 2XB5A 4EGYA 2DT6A 1YO5C 2OU2A 2LLKA 1YITI 3RPUD 4V2FA 1QGPA 2XAGA 2ZJRF 2QSHX 1KQ9A 3LSRA 3IC7A 1E0EA 1GVJA 4EV0A 1HC8A 5EEAA 1OKRA 1U9NA 3HG9A 4NDLA 5E1XA 2FSWA 4XIDA 3HZJA 2E5NA 2XAHA 5IT3A 3AL0B 3ZQ7A 2Y0MA 4EGZA 2VBWA 2P0WA 4Q5SF 3G1MA 3C2HA 2VPRA 5DD4A 3B02A 1U5TA 2ME6A 4DZJA 1HF0A 5JVTA 4M71A 1SFOJ 3MVPA 1FTZA 5CQEA 2RAEA 2Y0SA 1X1PA 2YSRA 4AWXB 2Q2EB 2VB6A 2XPWA 3CC4I 2FXAA 3F8BA 4I01A 3CUQA 2PMHA 3WHBA 1B6AA 4HAMA 2DA3A 1I39A 5B3SH 1A04A 3I3LA 1P6RA 1P92A 5DD8A 3ZMZA 2DTZA 4F55A 3U1KA 3H3UA 4FASD 1OYYA 2Q0OA 1BC8C 3SQNA 2E7WA 1HA8A 4U0YA 3CJRB 3HPGA 3S14J 4B48A 2HZTA 2BEOA 4BE2A 3ZXSA 3BZ6A 1WZ2A 2HXIA 2XIGA 3T5XA 3TW6A 4F93B 2X6XA 3MMYB 2E71A 4UUTA 3DKYA 2HPIA 5E1ZB 1IW7F 4G6TB 2OCEA 3MQ0A 1DPUA 2OCCH 4D1QA 3MEXA 4A12A 4A2UA 4IZZA 1AU7A 5K5RA 2HQAA 3ZQFA 4HNUA 1P7IA 1WCMJ 4XLHA 1JKOC 2LBFA 1P4WA 2XAUA 4OIOF 4C30A 1ZHFA 4A3EJ 3KEQA 2FOKA 3R4KA 4M6XA 2ECBA 1FBQA 2GAUA 3D5SC 2UWMA 2N8GA 3PIPF 1HLVA 1IN6A 2HU9A 3C2BA 3H0DA 1TW2A 1D0YA 5CVVA 3EPZA 5CVRA 1ZGJA 3DEEA 2ZNZA 3ZMSA 5D5XB 4A3MJ 2EA2A 1STZA 5BQTA 2A68F 3HOVJ 1XGMA 1B1BA 3HKZN 5J8CA 5M3MJ 3KZYA 5GAEJ 4M3DA 2L7MP 1W1WE 2ADUA 3VOEA 2LOOA 1ITYA 4M3EA 4XM3A 3BQZA 3HGYA 3DTEA 1UG0A 2JK3A 2BE5F 4KITB 2EZHA 1YYVA 1FYMA 1TWAJ 1WKMA 3R6SA 2FE3A 1U5TB 2EWNA 3PFIA 4XNFA 2DLLA 2FMYA 2OUMA 3KZZA 4AYBA 4EJWA 2VJJA 2IA1A 2WAFA 3BP8A 4BGDA 1YJ9I 1ZH5A 2E1CA 2X9DA 3WODF 1S7OA 2LF8A 1IGNA 2ZMEB 4ZYGA 5E79C 2JUGA 3F22A 3FXRA 1Y0UA 3JSPA 3CUQB 3ERED 1AA7A 5IP9J 5J1RA 2X1EA 3GMEA 3CCSI 1V54H 2FRHA 1KZHA 1G6NA 4IHXA 2H94A 3J7AO 3A01A 1IV8A 1IRGA 2XGEA 1QHHD 4BQQA 2OF7A 4I99C 5ED4A 2A69F 1YJWI 2LYCA 1IDYA 2QQ8A 4FE7A 2LR8A 3SDGA 4XLFA 4X6AJ 2VQLA 2VT2A 4Y17A 1BA5A 2OQGA 3OYLA 1FJLA 3Q0UA 3V4GA 1F4KA 4JOMA 3RQ4A 4MFEA 3TP0A 3FK6A 3GCMA 3FXLA 3RKYA 3QPLA 5LRSA 2W57A 1BR1A 3W2WA 1D0XA 1H88C 2XKOA 2OAZA 1PUFA 2HOSA 2JQ7A 2M9HA 4HNTA 4ENKA 4BHCA 3IUOA 3K4LA 4BY7J 4CHUA 1SVOA 3OS2A 3OYBA 3FKJA 3GLXA 2VI6A 1R71A 3I59B 4PGHA 4ESBA 1EA3A 2EK5A 2E1NA 2JRTA 3ESWB 1QPMA 1X2NA 4A3KJ 1WJCA 2ZBKA 2CS3A 2XF6A 1ONVA 3CDHA 3JRAA 1VQ5I 2DJNA 1OCZH 4IXAA 1TZLA 3J81K 2E5ZA 3DFGA 4HZFA 1IN8A 4C3IJ 2Y31A 2L7FP 1ON1A 5A2QZ 3T0YA 1Y0NA 3ZGKA 3HOWJ 2DMPA 1W0TA 2X85A 4Y7NJ 2Y9YA 2CMPA 3GTJJ 1A5JA 2HQNA 3QYFA 2XAQA 2RQPA 1TWHJ 1BR2A 3HBLA 4LG3A 4BJ6C 1TW3A 5JHUA 3MKLA 2NVUB 1F43A 1B9NA 1T95A 1SANA 2WBMA 2L01A
chains in the Genus database with same CATH topology
3WE3A 1KYWA 4ENMA 1GXQA 1OR7A 2L54A 1R1TA 3FZVA 2K86A 4NB5A 2P5LC 4HW0A 3HRTA 4CICA 2F5DA 1ON2A 1T0FA 2QQAA 2XAJA 1HKTA 5HDGA 4BXUA 2PFBA 1XN7A 4M9XA 1Q1HA 1EH8A 5L3BA 3NRVA 1JE8A 1G3YA 2A5YB 1X3UA 1BIBA 4KICA 4S05A 3KP5A 1P4XA 1EV7A 4MHGA 2FBHA 2V9VA 1O7FA 4U7DA 2HGCA 1O3RA 3FWEA 2K7LA 3WTSC 1YQAA 2P7CB 1IN5A 5HDNA 4RB3C 4AIJA 1RNLA 1U78A 5BOXA 5BMZA 3ELKA 1OYWA 1JHHA 2ZO4A 3I58A 3N97A 4L18B 4KDPA 2D1VA 1BC7C 3ECOA 1EH6A 1Z05A 1J9IA 3WE2A 5L3CA 5LHGA 1LB2A 4KN4X 1HW5A 1IAWA 1RI7A 4OU0A 4U88A 2HTSA 4UV9A 1I5ZA 1S7AA 3PQJA 4KUMA 5FD5A 2MLGA 2O0YA 1S29A 4I09A 4BAYA 2PQ8A 4BHBA 3K69A 4LGWA 4O6JA 1HBXG 4EJVA 1R23A 3HIFA 4M9SA 5LBQA 2R7DA 2EV6A 5IT9Z 3Q5FA 4CGZA 1WWXA 1ZARA 1HXDA 5CVJA 1IN4A 2IA2A 3K1PA 2EV5A 2QBYA 3DPLC 2OZUA 1L3LA 3VB2A 5EEHA 5K5QA 2DK5A 1K79A 1FYKA 4D0PA 3C18A 4O3MA 1FT9A 2P7VB 3WTYC 4HF2A 4MNUA 1ULYA 2QWWA 1W7PD 1B9MA 1UB9A 3ML6A 3HHHA 4QWQA 1HKQA 5L3DA 3W6JB 3T8TA 2UXXA 2QQBA 5D4RA 4JK1X 4IF4A 2W85A 2QYOA 4JBAA 1ZLKA 3QPHA 1TQPA 4P5OA 5LGNA 2EFQA 5DUKA 2P5KA 3K9TA 2VBZA 2HKXA 2P6SA 2X4HA 5HDKA 4G9YA 5F1RA 2IVMA 2EV0A 2V1UA 2ESNA 2V6CA 3KE2A 3ZN0A 5JFRA 1HSTA 2RV8A 3HSFA 2QBYB 4QLCU 4KYWA 1IZ1A 4NHJA 4PGGA 2MA3A 2HR3A 3JTHA 3LQRA 3W6KB 4LG0B 4LFUA 1KQ8A 3LWFA 5KK1A 3M7GA 3TO6A 4HX4A 4M9ZA 1USSA 5HS8A 2QUFA 4HQMA 4E70A 4HA8A 1I27A 2W84A 1PP7U 3J80K 5ICEA 4M74A 2EB7A 3O3KA 2CG4A 4L0YB 2ESHA 5A2QK 1T38A 1MGTA 5ILUA 4A0XA 3O2PE 2ZXJA 4ZZDA 3KP6A 4BNCA 1LVAA 2JSCA 4IHTA 2XRNA 2A07F 3GZ6A 2NYXA 2MC3A 5LEJA 4OIQF 5ILSA 2V1XA 2EJRA 4RGRA 3ZP5A 3EDPA 4IRIA 3KLOA 3E5UA 3WTUC 1U8RA 5DCFA 5HS7A 3SHFA 3EETA 2K4BA 1FNNA 1RUOA 3HTSB 5HLHA 2DI3A 3BPXA 4MTDA 1B4AA 5KVRA 1QZZA 5F6FA 2FNPA 2GWRA 3KP3A 5CLSA 3RYPA 2LNBA 5ILVA 5FLXZ 4HV5A 3GWZA 1YTYA 1QNTA 3F23A 1FBUA 4KN7X 3K1NA 4ON0A 4KFCA 4RGSA 4BYYA 4FX4A 3ZN1A 2JPCA 1DPRA 2F5CA 4RB0A 1V3FA 1GXPA 3CUOA 5CYVA 2Z9OA 1IUYA 5CVIA 1KU7A 3HTUA 3QRFF 4EMSA 2ZMEA 1DP7P 3DF8A 4P96A 2Z33A 1R36A 4ZYHA 3MAJA 2OQRA 4A5NA 1R7JA 3BJAA 2FMLA 4N0BA 1KYZA 2LF7A 3KETA 2IPQX 3E5QA 1JGSA 3FMRA 1I1GA 2OBPA 2ZFWA 3RKWA 4AIHA 4XLPF 5H6RA 1R5HA 3I59A 5LGTA 3HHGA 2P6TA 2GA2A 4HOBA 4DNCA 2QM3A 3GO5A 2FQ3A 3TGNA 1FPQA 1WI9A 1BBYA 3Q9VA 1S8NA 1REPC 2NRAC 2O61A 2RNJA 2Y48A 4PDKA 4GYIA 3P9KA 3V8LA 2DU9A 2O8XA 4BQAA 1USTA 4ZH4F 1H9TA 2A6EF 3WTWC 3L00A 2KJBA 4ASNA 2H09A 1FSEA 2J5OA 4TV7A 2STWA 5FGMA 2KIUA 3CUQC 1U6GA 5ERIA 5DCMB 2ELHA 1WQ2A 4OMYA 2Z5UA 2AXLA 3TOBA 1D5VA 2MH2A 4Q4ZF 1OYIA 4I02A 4EM2A 1QQIA 4I98B 3BWGA 4WCGA 1R00A 4M73A 4B8XA 4HLYA 2A3SA 3F21A 4MGRA 1L0OC 2YR2A 3EYIA 3MZHA 3KP4A 2JZYA 1SMTA 1ZGAA 5BPDA 3TO9A 2C6YA 3TKYA 3WG9A 2QZ8A 4FHTA 4IRHA 2D1HA 2COMA 4KIFA 1IRFA 2GXGA 4LK0F 1XCBA 4KIBA 3WGIA 1SFEA 4U0WA 1KU9A 3I53A 5AIPA 1R1UA 4UVBA 1FY7A 3RI4A 2NNNA 2HOEA 2PN6A 2VT3A 3QAHA 2IRFG 1B59A 3P9CA 4CXFA 2ZJ2A 4HX7A 4LLLA 1I1SA 3E97A 4L9NA 4OOIA 5J8FA 3I5UA 3FMQA 1YW7A 3U9GA 4EM1A 4HBLA 4MEYF 1FP1D 3KFWX 1RUNA 2G7UA 2JT1A 3H92A 2IJLA 4GGGA 5HVQC 2BBYA 3F3XA 3C7JA 1O57A 2R7FA 3MFKA 1S6LA 3E5XA 1QO0D 1KU2A 2XKPA 2CWEA 3DPTA 1DUXC 4I2OA 3V7CA 3HRSA 3BROA 5LLQA 3V8KA 1TNTA 2EFWA 2VBYA 2XHKA 2CGPA 3T8RA 1FX7A 3VODA 1G3WA 4WXCA 2GXBA 3WU1B 1CGPA 2QQ9A 1BJAA 2CQKA 2ISZA 4LJZF 5EEGA 1J0RA 4WXDA 2M8EA 3GF2A 5LEKA 2NNYA 2VC1A 5FLXK 1MKMA 5L3EA 4BH9A 2D45A 1HSJA 3OV8A 1TLHB 1BI1A 2W25A 2P4WA 3L9FA 2DQLA 5K5OA 1GHCA 3M1EA 4G7HF 1XGSA 2BYVE 1D8JA 1H0MA 3QU3A 3FM3A 4A0ZA 1VTNC 3DEUA 1SFXA 2DK8A 1PDNC 1HKSA 2DFIA 5H6QA 3F72A 2IT0A 2DT5A 3LAJA 3CO6C 2DPUA 1YW8A 1J2XA 3RPUA 1TQIA 3F8MA 1D3YA 3E3VA 2L3DA 3PQKA 5DDGA 3JAMZ 1U2WA 2RN7A 2FA5A 2V79A 3I0TA 5L3GA 4LG0A 3HRUA 1ZRFA 3GW2A 3COAC 2O03A 3AAFA 1BIAA 3E6MA 4N9HA 1FSHA 3IWFA 4DQ2A 5JI6A 3QOPA 4P55A 4ZZLA 2ZCWA 1IXCA 3KP7A 4PZJA 4UXNA 3IKVA 2HYFA 3LQQA 4L5JA 5JR3A 4CDGA 3HRMA 2LSOA 2VXZA 3M8FA 1J75A 2H6CA 3TQNA 2HKOA 4RGXA 3G3ZA 2Z99A 1ZRDA 1O3TA 5CVUA 2RC4A 3R0AA 3LSTA 5L3FA 1SD6A 2WC2A 5TJJA 4ESFA 1J7KA 4G94A 1HW2A 3VEPA 2CYYA 2IA0A 4AVPA 1TTYA 5DEQA 1BI2A 1K7AA 1JXSA 4ENJA 2VOPA 1ODDA 2GZWA 3IL2A 3DXJF 4OINF 2VODA 1K6OA 1U3EM 4UHTA 2BV6A 3KEOA 3QPTA 2WV0A 4R79A 3T1BA 4AD9A 4HF1A 3EYYA 5E18F 3I71A 3WTZA 2DAOA 1LDKB 2Y75A 2O3FA 1MJBA 2M45A 4F7ZA 1YS6A 4H0EA 2ZKZA 2HWVA 3HUGA 3ZMUA 2RDPA 1T39A 3S2WA 4ETSA 3I4PA 3FXQA 2M1BA 1TQMA 4G7ZF 4AIKA 3R0JA 1XDSA 2EFOA 1WRJA 3KP2A 4UNOA 2VC0A 4M6YA 4U0VA 4KA4A 1ZLJA 1CF7A 4Y13A 1IF1A 4LD5A 4YFNF 1IXSB 3GEZA 3J81Z 2XAFA 4CZZA 2XVCA 3CTAA 1TBXA 1UHMA 4MEXF 4O5VA 2GA1A 4EJOA 4HYEA 4N9IA 2NS0A 4YG2F 5FFXA 2M5WA 3RTRA 2VBXA 4RB1A 4WF2A 2MH9A 5H20A 3C3WA 2HS5A 1Z1DA 1R1VA 2FBIA 1C0WA 1EH7A 3E6DA 2HEOA 1QBJA 2D2WA 5D6EA 1XGNA 3P7NA 5AIQA 4YIIA 1XGOA 4CYDA 3FHZA 2LDUA 5J6XA 3M8EA 4XBFA 1YIOA 4G8XA 3G73A 4R8HA 1W5TA 1F5TA 1G3SA 1LNWA 4HX8A 3SXYA 1Z6RA 4NQWA 5E8GA 1XD7A 2DO7A 3ULQB 3K2ZA 3K0LA 3NEUA 3RJPA 4EQQA 2J5PA 4IVNA 1V4RA 3RPQA 2PMUA 5DCMA 3BJOA 4HDVA 1Z9CA 1CF7B 2PEXA 4LK1F 3IHUA 4WXHA 2QLZA 4RAZA 1FYLA 4HQEA 2V1DA 2CW0F 1FZPB 1LEBA 4A5MA 1BI0A 1R5GA 4G6DA 1T98A 4Z2YA 1OPCA 5D5UB 1LDDA 3WU0A 2FNAA 4JQFA 2G7HA 4KMUX 2DPDA 3GVAA 2DTRA 1E17A 3HSRA 2JPBA 3L2CA 2RVCA 1ZYRF 2QVOA 2NAZA 3HOTA 4EVIA 3B73A 5IT9K 1MJ9A 1T6SA 2HFHA 3OOPA 1O3QA 3RIRA 1FWZA 2AS5F 3QP6A 2VE9A 3F8CA 3JAMK 2YU3A 3LA7A 4UV8A 3ROUA 1R22A 3ABTA 5DV5A 4YIFA 2KIMA 3KLNA 1XMKA 2R3SA 4MTEA 2CFXA 1T2KA 3Q9SA 6PAXA 3IRQA 1HQCA 2JTVA 4A6DA 3BJ6A 1Z7UA 3K1MA 4P9FA 1U5TC 1P4AA 5D4SA 2YX7A 4FT8A 4IRGA 1YS7A 3V7RA 3R61A 2FEZA 4LB6B 1G4DA 3ZPLA 2XV4S 3HSEA 4IJAA 3P9IA 3WTTC 2PBIA 2EFNA 2MBFA 5F64A 1MD0A 1KA8A 4M72A 5E8IA 4Q48A 4KT5C 3E6BA 4HLXA 1SD7A 3D0SA 1Z91A 2XUBA 4L0ZB 4BHPA 3ZMDA 2W24A 3FM5A 4GYGA 2X0LA 3SZTA 3SFZA 1F1ZA 3R60A 1W7PA 3I54A 1RIOH 1DDNA 5FD6A 2Q8KA 1ZG1A 3IRRA 3H3ZA 3ECHA 3LFKA 4RB2C 3GX4X 3ABUA 3MZYA 2HQRA 1BI3A 2EA4A 5LGUA 3GFLA 4Y15A 1KU3A 3GZ5A 2VOOA 1KGSA 2K4JA 1R58A 3DV8A 5K1YA 1LQ1A 2L02A 3MWMA 1Z6TA 2ETHA 3IWZA 1RZ4A 3LAPA 3GYHX 3U1DA 5D8LB 1PUEE 3J80Z 5ICFA 3CJNA 2P5VA 1BM9A 3REOA 4A0YA 4WWCA 2XROA 5HLIA 5TRDA 2EFPA 3QP5A 2Z3YA 4R1HA 4EJTA 1OMIA 4A6EA 3N4MA 2DQRA 1YW9A 1TNSA 3KCCA 2L4AA 3WTVC 3F6OA 3RYRA 2KRFA 4ESJA 2UZKA 1D8KA 4P9UA 5CJ9A 5ICCA 2QENA 2HTJA 2P8TA 1W5SA 1SMYF 1YLFA 3WGGA 3D5LA 5FFZA 1XSXA 4IPAA 3I64A 4WK8F 3BOQA 1W7PB 2RKHA 2MD5A 3GFMA 5BS6A 3GXOA 1MZBA 1H9GA 1J59A 2VE8A 2H6BA 4KIGA 3E6CC 1I6XA 2WWYA 4L5IA 1SAXA 3FF5A 4OIRF 3DP7A 5LHHA 1XSVA 2STTA 1FP2A 4ENNA 2YPRA 2FBKA 3L09A 1XMAA 4GO1A 1BN5A 4S04A 2CO5A 1PP8F 2XASA 2TDXA 3BPVA 4I7HA 3EQLF 1XSDA 2B0LA 2ZNYA 5DYMA 3RKXA 2E7XA 5E17F 3TOAA 2RGVA 2GIVA 2K02A 4XLNF 2H27A 1E2XA 1ZG3A 4OIPF 1FLIA 4KNYA 1XB4A 2DBBA 2VN2A 2FU4A 4K2EA 1K78A 2FF4A 4RGUA 1UHWA 5HLGA 2M30A 4L9JA 3HYIA 5E1WA 1XCVA 3QU6A 2CSOA 3FXUA 5LRRA 4HF0A 3JW4A 4U7BA 1ZRCA 2KKOA 4L9TA 4WX9A 1S3JA 2KJCA 3DQVC 4LLGF 4MQVA 3U2RA 2A6HF 5AONA 1MDMA 4EM0B 4XRFA 2ISYA 2MLKA 1BOAA 4ZYDA 5E20A 3BDDA 2K27A 4FX0A 3FX3A 4UUVA 4PCQA 2DW4A 1J5YA 1G3TA 1O3SA 1JHFA 1KQ0A 1AWCA 3O6BB 4G6QA 1HW1A 3WGHA 4UVAA 4LLNA 2UXNA 1MJAA 3HOSA 5BPIA 1FC3A 4XSXF 3ZMVA 1ZG5A 2M87A 5FB2A 5LHIA 2O6GE 4IHSA 3JSOA 1K78B 3GFJA 2PLYA 4UVCA 2YX4A 2F5EA 1AOYA 3M9AA 4YFKF 1LJ9A 3CLOA 4ZYEA 4OMZA 2ACJA 3EUHA 2KIFA 3V7SA 3LA2A 3TO7A 3ISPA 3NQOA 4G7OF 1SD4A 4Q47A 3L7WA 5HOOA 4KMFA 3BY6A 4GXOA 1WSUA 1UCRA 3F8FA 2OD5A 5D5VB 1FOKA 3VFZA 2IW5A 1ZAOA 4I0AA 3CO7C 4EJUA 5ICGA 5HS9A 4HV6A 3GUDA 4GCVA 2OA4A 1MDMB 5D6FA 5D5WB 1LDJA 2PG4A 1NHAA 4RAYA 4I0BA 4CO8A 2GQQA 2LKPA 2A61A 3F8NA 2PI0A 3LA3A 3ZMTA 1IXRC 2IP2A 4RS8A 3SZPA 1SD5A 1YFHA 1SFUA 2BGCA 4MQ9F 2G9WA 3IKTA 4XSZF 3DKWA 2L4MA 2Q2EA 2HYGD 2WTEA 2HDCA 5DUIA 4L9VA 1QZYA 3GFIA 1YG2A 3F6VA 3TDZC 2OZ6A 1F9NA 3C1DA 1LEAA 4B09A 3RDIA 1ZN2A 1UFMA 1W4MA 4LMYA 4YFXF 3TDUC 1XDUA 2XGXA 3FMSA 1O7LA 4LB5A 5FO5A 2F2EA 4HDUA 2VONA 3V8JA 1P2FA 3WTXC 2PJPA 2F5FA 1FBSA 5D8KB 3JTGA 1ZREA 3MCZA 1IN7A 4EGYA 1YO5C 2OU2A 1QGPA 2XAGA 1KQ9A 3IC7A 1GVJA 4EV0A 1OKRA 5E1XA 2FSWA 2XAHA 5IT3A 3ZQ7A 2Y0MA 4EGZA 2VBWA 4Q5SF 5DD4A 3B02A 1U5TA 5JVTA 4M71A 2YSRA 4AWXB 2FXAA 3F8BA 4I01A 3CUQA 2PMHA 1B6AA 4HAMA 1A04A 1P6RA 1P92A 5DD8A 3ZMZA 3H3UA 1OYYA 2Q0OA 1BC8C 3SQNA 2E7WA 4U0YA 2HZTA 2BEOA 3BZ6A 2XIGA 3T5XA 5E1ZB 1IW7F 3MQ0A 1DPUA 3MEXA 4A12A 4A2UA 5K5RA 1P4WA 4OIOF 1ZHFA 3KEQA 2FOKA 3R4KA 4M6XA 1FBQA 2GAUA 2UWMA 1IN6A 1TW2A 5CVVA 5CVRA 1ZGJA 3ZMSA 2ZNZA 5D5XB 2EA2A 1STZA 5BQTA 2A68F 1B1BA 5J8CA 3KZYA 2ADUA 3VOEA 2BE5F 1YYVA 1FYMA 1WKMA 3R6SA 2FE3A 1U5TB 2EWNA 3PFIA 2DLLA 2FMYA 3KZZA 4EJWA 2IA1A 3BP8A 1ZH5A 2E1CA 3WODF 1S7OA 2LF8A 2ZMEB 4ZYGA 3F22A 3FXRA 1Y0UA 3JSPA 3CUQB 3ERED 2FRHA 1G6NA 2H94A 3J7AO 1IRGA 5ED4A 2A69F 2VT2A 4Y17A 2OQGA 3V4GA 1F4KA 3RKYA 5LRSA 2W57A 2XKOA 2OAZA 4ENKA 4BHCA 4CHUA 3GLXA 3I59B 4PGHA 4ESBA 2EK5A 2E1NA 2JRTA 1QPMA 2ZBKA 1ONVA 3CDHA 4IXAA 3J81K 3DFGA 4HZFA 1IN8A 1ON1A 5A2QZ 3T0YA 2HQNA 2XAQA 2RQPA 1TW3A 5JHUA 1B9NA 1XGMA 2L01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WE3 A;  1KYW A;  4ENM A;  1GXQ A;  1OR7 A;  2L54 A;  1R1T A;  3FZV A;  2K86 A;  4NB5 A;  2P5L C;  4HW0 A;  3HRT A;  4CIC A;  2F5D A;  1ON2 A;  1T0F A;  2QQA A;  2XAJ A;  1HKT A;  5HDG A;  4BXU A;  2PFB A;  1XN7 A;  4M9X A;  1Q1H A;  1EH8 A;  5L3B A;  3NRV A;  1JE8 A;  1G3Y A;  2A5Y B;  1X3U A;  1BIB A;  4KIC A;  4S05 A;  3KP5 A;  1P4X A;  1EV7 A;  4MHG A;  2FBH A;  2V9V A;  1O7F A;  4U7D A;  2HGC A;  1O3R A;  3FWE A;  2K7L A;  3WTS C;  1YQA A;  2P7C B;  1IN5 A;  5HDN A;  4RB3 C;  4AIJ A;  1RNL A;  1U78 A;  5BOX A;  5BMZ A;  3ELK A;  1OYW A;  1JHH A;  2ZO4 A;  3I58 A;  3N97 A;  4L18 B;  4KDP A;  2D1V A;  1BC7 C;  3ECO A;  1EH6 A;  1Z05 A;  1J9I A;  3WE2 A;  5L3C A;  5LHG A;  1LB2 A;  4KN4 X;  1HW5 A;  1IAW A;  1RI7 A;  4OU0 A;  4U88 A;  2HTS A;  4UV9 A;  1I5Z A;  1S7A A;  3PQJ A;  4KUM A;  5FD5 A;  2MLG A;  2O0Y A;  1S29 A;  4I09 A;  4BAY A;  2PQ8 A;  4BHB A;  3K69 A;  4LGW A;  4O6J A;  1HBX G;  4EJV A;  1R23 A;  3HIF A;  4M9S A;  5LBQ A;  2R7D A;  2EV6 A;  5IT9 Z;  3Q5F A;  4CGZ A;  1WWX A;  1ZAR A;  1HXD A;  5CVJ A;  1IN4 A;  2IA2 A;  3K1P A;  2EV5 A;  2QBY A;  3DPL C;  2OZU A;  1L3L A;  3VB2 A;  5EEH A;  5K5Q A;  2DK5 A;  1K79 A;  1FYK A;  4D0P A;  3C18 A;  4O3M A;  1FT9 A;  2P7V B;  3WTY C;  4HF2 A;  4MNU A;  1ULY A;  2QWW A;  1W7P D;  1B9M A;  1UB9 A;  3ML6 A;  3HHH A;  4QWQ A;  1HKQ A;  5L3D A;  3W6J B;  3T8T A;  2UXX A;  2QQB A;  5D4R A;  4JK1 X;  4IF4 A;  2W85 A;  2QYO A;  4JBA A;  1ZLK A;  3QPH A;  1TQP A;  4P5O A;  5LGN A;  2EFQ A;  5DUK A;  2P5K A;  3K9T A;  2VBZ A;  2HKX A;  2P6S A;  2X4H A;  5HDK A;  4G9Y A;  5F1R A;  2IVM A;  2EV0 A;  2V1U A;  2ESN A;  2V6C A;  3KE2 A;  3ZN0 A;  5JFR A;  1HST A;  2RV8 A;  3HSF A;  2QBY B;  4QLC U;  4KYW A;  1IZ1 A;  4NHJ A;  4PGG A;  2MA3 A;  2HR3 A;  3JTH A;  3LQR A;  3W6K B;  4LG0 B;  4LFU A;  1KQ8 A;  3LWF A;  5KK1 A;  3M7G A;  3TO6 A;  4HX4 A;  4M9Z A;  1USS A;  5HS8 A;  2QUF A;  4HQM A;  4E70 A;  4HA8 A;  1I27 A;  2W84 A;  1PP7 U;  3J80 K;  5ICE A;  4M74 A;  2EB7 A;  3O3K A;  2CG4 A;  4L0Y B;  2ESH A;  5A2Q K;  1T38 A;  1MGT A;  5ILU A;  4A0X A;  3O2P E;  2ZXJ A;  4ZZD A;  3KP6 A;  4BNC A;  1LVA A;  2JSC A;  4IHT A;  2XRN A;  2A07 F;  3GZ6 A;  2NYX A;  2MC3 A;  5LEJ A;  4OIQ F;  5ILS A;  2V1X A;  2EJR A;  4RGR A;  3ZP5 A;  3EDP A;  4IRI A;  3KLO A;  3E5U A;  3WTU C;  1U8R A;  5DCF A;  5HS7 A;  3SHF A;  3EET A;  2K4B A;  1FNN A;  1RUO A;  3HTS B;  5HLH A;  2DI3 A;  3BPX A;  4MTD A;  1B4A A;  5KVR A;  1QZZ A;  5F6F A;  2FNP A;  2GWR A;  3KP3 A;  5CLS A;  3RYP A;  2LNB A;  5ILV A;  5FLX Z;  4HV5 A;  3GWZ A;  1YTY A;  1QNT A;  3F23 A;  1FBU A;  4KN7 X;  3K1N A;  4ON0 A;  4KFC A;  4RGS A;  4BYY A;  4FX4 A;  3ZN1 A;  2JPC A;  1DPR A;  2F5C A;  4RB0 A;  1V3F A;  1GXP A;  3CUO A;  5CYV A;  2Z9O A;  1IUY A;  5CVI A;  1KU7 A;  3HTU A;  3QRF F;  4EMS A;  2ZME A;  1DP7 P;  3DF8 A;  4P96 A;  2Z33 A;  1R36 A;  4ZYH A;  3MAJ A;  2OQR A;  4A5N A;  1R7J A;  3BJA A;  2FML A;  4N0B A;  1KYZ A;  2LF7 A;  3KET A;  2IPQ X;  3E5Q A;  1JGS A;  3FMR A;  1I1G A;  2OBP A;  2ZFW A;  3RKW A;  4AIH A;  4XLP F;  5H6R A;  1R5H A;  3I59 A;  5LGT A;  3HHG A;  2P6T A;  2GA2 A;  4HOB A;  4DNC A;  2QM3 A;  3GO5 A;  2FQ3 A;  3TGN A;  1FPQ A;  1WI9 A;  1BBY A;  3Q9V A;  1S8N A;  1REP C;  2NRA C;  2O61 A;  2RNJ A;  2Y48 A;  4PDK A;  4GYI A;  3P9K A;  3V8L A;  2DU9 A;  2O8X A;  4BQA A;  1UST A;  4ZH4 F;  1H9T A;  2A6E F;  3WTW C;  3L00 A;  2KJB A;  4ASN A;  2H09 A;  1FSE A;  2J5O A;  4TV7 A;  2STW A;  5FGM A;  2KIU A;  3CUQ C;  1U6G A;  5ERI A;  5DCM B;  2ELH A;  1WQ2 A;  4OMY A;  2Z5U A;  2AXL A;  3TOB A;  1D5V A;  2MH2 A;  4Q4Z F;  1OYI A;  4I02 A;  4EM2 A;  1QQI A;  4I98 B;  3BWG A;  4WCG A;  1R00 A;  4M73 A;  4B8X A;  4HLY A;  2A3S A;  3F21 A;  4MGR A;  1L0O C;  2YR2 A;  3EYI A;  3MZH A;  3KP4 A;  2JZY A;  1SMT A;  1ZGA A;  5BPD A;  3TO9 A;  2C6Y A;  3TKY A;  3WG9 A;  2QZ8 A;  4FHT A;  4IRH A;  2D1H A;  2COM A;  4KIF A;  1IRF A;  2GXG A;  4LK0 F;  1XCB A;  4KIB A;  3WGI A;  1SFE A;  4U0W A;  1KU9 A;  3I53 A;  5AIP A;  1R1U A;  4UVB A;  1FY7 A;  3RI4 A;  2NNN A;  2HOE A;  2PN6 A;  2VT3 A;  3QAH A;  2IRF G;  1B59 A;  3P9C A;  4CXF A;  2ZJ2 A;  4HX7 A;  4LLL A;  1I1S A;  3E97 A;  4L9N A;  4OOI A;  5J8F A;  3I5U A;  3FMQ A;  1YW7 A;  3U9G A;  4EM1 A;  4HBL A;  4MEY F;  1FP1 D;  3KFW X;  1RUN A;  2G7U A;  2JT1 A;  3H92 A;  2IJL A;  4GGG A;  5HVQ C;  2BBY A;  3F3X A;  3C7J A;  1O57 A;  2R7F A;  3MFK A;  1S6L A;  3E5X A;  1QO0 D;  1KU2 A;  2XKP A;  2CWE A;  3DPT A;  1DUX C;  4I2O A;  3V7C A;  3HRS A;  3BRO A;  5LLQ A;  3V8K A;  1TNT A;  2EFW A;  2VBY A;  2XHK A;  2CGP A;  3T8R A;  1FX7 A;  3VOD A;  1G3W A;  4WXC A;  2GXB A;  3WU1 B;  1CGP A;  2QQ9 A;  1BJA A;  2CQK A;  2ISZ A;  4LJZ F;  5EEG A;  1J0R A;  4WXD A;  2M8E A;  3GF2 A;  5LEK A;  2NNY A;  2VC1 A;  5FLX K;  1MKM A;  5L3E A;  4BH9 A;  2D45 A;  1HSJ A;  3OV8 A;  1TLH B;  1BI1 A;  2W25 A;  2P4W A;  3L9F A;  2DQL A;  5K5O A;  1GHC A;  3M1E A;  4G7H F;  1XGS A;  2BYV E;  1D8J A;  1H0M A;  3QU3 A;  3FM3 A;  4A0Z A;  1VTN C;  3DEU A;  1SFX A;  2DK8 A;  1PDN C;  1HKS A;  2DFI A;  5H6Q A;  3F72 A;  2IT0 A;  2DT5 A;  3LAJ A;  3CO6 C;  2DPU A;  1YW8 A;  1J2X A;  3RPU A;  1TQI A;  3F8M A;  1D3Y A;  3E3V A;  2L3D A;  3PQK A;  5DDG A;  3JAM Z;  1U2W A;  2RN7 A;  2FA5 A;  2V79 A;  3I0T A;  5L3G A;  4LG0 A;  3HRU A;  1ZRF A;  3GW2 A;  3COA C;  2O03 A;  3AAF A;  1BIA A;  3E6M A;  4N9H A;  1FSH A;  3IWF A;  4DQ2 A;  5JI6 A;  3QOP A;  4P55 A;  4ZZL A;  2ZCW A;  1IXC A;  3KP7 A;  4PZJ A;  4UXN A;  3IKV A;  2HYF A;  3LQQ A;  4L5J A;  5JR3 A;  4CDG A;  3HRM A;  2LSO A;  2VXZ A;  3M8F A;  1J75 A;  2H6C A;  3TQN A;  2HKO A;  4RGX A;  3G3Z A;  2Z99 A;  1ZRD A;  1O3T A;  5CVU A;  2RC4 A;  3R0A A;  3LST A;  5L3F A;  1SD6 A;  2WC2 A;  5TJJ A;  4ESF A;  1J7K A;  4G94 A;  1HW2 A;  3VEP A;  2CYY A;  2IA0 A;  4AVP A;  1TTY A;  5DEQ A;  1BI2 A;  1K7A A;  1JXS A;  4ENJ A;  2VOP A;  1ODD A;  2GZW A;  3IL2 A;  3DXJ F;  4OIN F;  2VOD A;  1K6O A;  1U3E M;  4UHT A;  2BV6 A;  3KEO A;  3QPT A;  2WV0 A;  4R79 A;  3T1B A;  4AD9 A;  4HF1 A;  3EYY A;  5E18 F;  3I71 A;  3WTZ A;  2DAO A;  1LDK B;  2Y75 A;  2O3F A;  1MJB A;  2M45 A;  4F7Z A;  1YS6 A;  4H0E A;  2ZKZ A;  2HWV A;  3HUG A;  3ZMU A;  2RDP A;  1T39 A;  3S2W A;  4ETS A;  3I4P A;  3FXQ A;  2M1B A;  1TQM A;  4G7Z F;  4AIK A;  3R0J A;  1XDS A;  2EFO A;  1WRJ A;  3KP2 A;  4UNO A;  2VC0 A;  4M6Y A;  4U0V A;  4KA4 A;  1ZLJ A;  1CF7 A;  4Y13 A;  1IF1 A;  4LD5 A;  4YFN F;  1IXS B;  3GEZ A;  3J81 Z;  2XAF A;  4CZZ A;  2XVC A;  3CTA A;  1TBX A;  1UHM A;  4MEX F;  4O5V A;  2GA1 A;  4EJO A;  4HYE A;  4N9I A;  2NS0 A;  4YG2 F;  5FFX A;  2M5W A;  3RTR A;  2VBX A;  4RB1 A;  4WF2 A;  2MH9 A;  5H20 A;  3C3W A;  2HS5 A;  1Z1D A;  1R1V A;  2FBI A;  1C0W A;  1EH7 A;  3E6D A;  2HEO A;  1QBJ A;  2D2W A;  5D6E A;  1XGN A;  3P7N A;  5AIQ A;  4YII A;  1XGO A;  4CYD A;  3FHZ A;  2LDU A;  5J6X A;  3M8E A;  4XBF A;  1YIO A;  4G8X A;  3G73 A;  4R8H A;  1W5T A;  1F5T A;  1G3S A;  1LNW A;  4HX8 A;  3SXY A;  1Z6R A;  4NQW A;  5E8G A;  1XD7 A;  2DO7 A;  3ULQ B;  3K2Z A;  3K0L A;  3NEU A;  3RJP A;  4EQQ A;  2J5P A;  4IVN A;  1V4R A;  3RPQ A;  2PMU A;  5DCM A;  3BJO A;  4HDV A;  1Z9C A;  1CF7 B;  2PEX A;  4LK1 F;  3IHU A;  4WXH A;  2QLZ A;  4RAZ A;  1FYL A;  4HQE A;  2V1D A;  2CW0 F;  1FZP B;  1LEB A;  4A5M A;  1BI0 A;  1R5G A;  4G6D A;  1T98 A;  4Z2Y A;  1OPC A;  5D5U B;  1LDD A;  3WU0 A;  2FNA A;  4JQF A;  2G7H A;  4KMU X;  2DPD A;  3GVA A;  2DTR A;  1E17 A;  3HSR A;  2JPB A;  3L2C A;  2RVC A;  1ZYR F;  2QVO A;  2NAZ A;  3HOT A;  4EVI A;  3B73 A;  5IT9 K;  1MJ9 A;  1T6S A;  2HFH A;  3OOP A;  1O3Q A;  3RIR A;  1FWZ A;  2AS5 F;  3QP6 A;  2VE9 A;  3F8C A;  3JAM K;  2YU3 A;  3LA7 A;  4UV8 A;  3ROU A;  1R22 A;  3ABT A;  5DV5 A;  4YIF A;  2KIM A;  3KLN A;  1XMK A;  2R3S A;  4MTE A;  2CFX A;  1T2K A;  3Q9S A;  6PAX A;  3IRQ A;  1HQC A;  2JTV A;  4A6D A;  3BJ6 A;  1Z7U A;  3K1M A;  4P9F A;  1U5T C;  1P4A A;  5D4S A;  2YX7 A;  4FT8 A;  4IRG A;  1YS7 A;  3V7R A;  3R61 A;  2FEZ A;  4LB6 B;  1G4D A;  3ZPL A;  2XV4 S;  3HSE A;  4IJA A;  3P9I A;  3WTT C;  2PBI A;  2EFN A;  2MBF A;  5F64 A;  1MD0 A;  1KA8 A;  4M72 A;  5E8I A;  4Q48 A;  4KT5 C;  3E6B A;  4HLX A;  1SD7 A;  3D0S A;  1Z91 A;  2XUB A;  4L0Z B;  4BHP A;  3ZMD A;  2W24 A;  3FM5 A;  4GYG A;  2X0L A;  3SZT A;  3SFZ A;  1F1Z A;  3R60 A;  1W7P A;  3I54 A;  1RIO H;  1DDN A;  5FD6 A;  2Q8K A;  1ZG1 A;  3IRR A;  3H3Z A;  3ECH A;  3LFK A;  4RB2 C;  3GX4 X;  3ABU A;  3MZY A;  2HQR A;  1BI3 A;  2EA4 A;  5LGU A;  3GFL A;  4Y15 A;  1KU3 A;  3GZ5 A;  2VOO A;  1KGS A;  2K4J A;  1R58 A;  3DV8 A;  5K1Y A;  1LQ1 A;  2L02 A;  3MWM A;  1Z6T A;  2ETH A;  3IWZ A;  1RZ4 A;  3LAP A;  3GYH X;  3U1D A;  5D8L B;  1PUE E;  3J80 Z;  5ICF A;  3CJN A;  2P5V A;  1BM9 A;  3REO A;  4A0Y A;  4WWC A;  2XRO A;  5HLI A;  5TRD A;  2EFP A;  3QP5 A;  2Z3Y A;  4R1H A;  4EJT A;  1OMI A;  4A6E A;  3N4M A;  2DQR A;  1YW9 A;  1TNS A;  3KCC A;  2L4A A;  3WTV C;  3F6O A;  3RYR A;  2KRF A;  4ESJ A;  2UZK A;  1D8K A;  4P9U A;  5CJ9 A;  5ICC A;  2QEN A;  2HTJ A;  2P8T A;  1W5S A;  1SMY F;  1YLF A;  3WGG A;  3D5L A;  5FFZ A;  1XSX A;  4IPA A;  3I64 A;  4WK8 F;  3BOQ A;  1W7P B;  2RKH A;  2MD5 A;  3GFM A;  5BS6 A;  3GXO A;  1MZB A;  1H9G A;  1J59 A;  2VE8 A;  2H6B A;  4KIG A;  3E6C C;  1I6X A;  2WWY A;  4L5I A;  1SAX A;  3FF5 A;  4OIR F;  3DP7 A;  5LHH A;  1XSV A;  2STT A;  1FP2 A;  4ENN A;  2YPR A;  2FBK A;  3L09 A;  1XMA A;  4GO1 A;  1BN5 A;  4S04 A;  2CO5 A;  1PP8 F;  2XAS A;  2TDX A;  3BPV A;  4I7H A;  3EQL F;  1XSD A;  2B0L A;  2ZNY A;  5DYM A;  3RKX A;  2E7X A;  5E17 F;  3TOA A;  2RGV A;  2GIV A;  2K02 A;  4XLN F;  2H27 A;  1E2X A;  1ZG3 A;  4OIP F;  1FLI A;  4KNY A;  1XB4 A;  2DBB A;  2VN2 A;  2FU4 A;  4K2E A;  1K78 A;  2FF4 A;  4RGU A;  1UHW A;  5HLG A;  2M30 A;  4L9J A;  3HYI A;  5E1W A;  1XCV A;  3QU6 A;  2CSO A;  3FXU A;  5LRR A;  4HF0 A;  3JW4 A;  4U7B A;  1ZRC A;  2KKO A;  4L9T A;  4WX9 A;  1S3J A;  2KJC A;  3DQV C;  4LLG F;  4MQV A;  3U2R A;  2A6H F;  5AON A;  1MDM A;  4EM0 B;  4XRF A;  2ISY A;  2MLK A;  1BOA A;  4ZYD A;  5E20 A;  3BDD A;  2K27 A;  4FX0 A;  3FX3 A;  4UUV A;  4PCQ A;  2DW4 A;  1J5Y A;  1G3T A;  1O3S A;  1JHF A;  1KQ0 A;  1AWC A;  3O6B B;  4G6Q A;  1HW1 A;  3WGH A;  4UVA A;  4LLN A;  2UXN A;  1MJA A;  3HOS A;  5BPI A;  1FC3 A;  4XSX F;  3ZMV A;  1ZG5 A;  2M87 A;  5FB2 A;  5LHI A;  2O6G E;  4IHS A;  3JSO A;  1K78 B;  3GFJ A;  2PLY A;  4UVC A;  2YX4 A;  2F5E A;  1AOY A;  3M9A A;  4YFK F;  1LJ9 A;  3CLO A;  4ZYE A;  4OMZ A;  2ACJ A;  3EUH A;  2KIF A;  3V7S A;  3LA2 A;  3TO7 A;  3ISP A;  3NQO A;  4G7O F;  1SD4 A;  4Q47 A;  3L7W A;  5HOO A;  4KMF A;  3BY6 A;  4GXO A;  1WSU A;  1UCR A;  3F8F A;  2OD5 A;  5D5V B;  1FOK A;  3VFZ A;  2IW5 A;  1ZAO A;  4I0A A;  3CO7 C;  4EJU A;  5ICG A;  5HS9 A;  4HV6 A;  3GUD A;  4GCV A;  2OA4 A;  1MDM B;  5D6F A;  5D5W B;  1LDJ A;  2PG4 A;  1NHA A;  4RAY A;  4I0B A;  4CO8 A;  2GQQ A;  2LKP A;  2A61 A;  3F8N A;  2PI0 A;  3LA3 A;  3ZMT A;  1IXR C;  2IP2 A;  4RS8 A;  3SZP A;  1SD5 A;  1YFH A;  1SFU A;  2BGC A;  4MQ9 F;  2G9W A;  3IKT A;  4XSZ F;  3DKW A;  2L4M A;  2Q2E A;  2HYG D;  2WTE A;  2HDC A;  5DUI A;  4L9V A;  1QZY A;  3GFI A;  1YG2 A;  3F6V A;  3TDZ C;  2OZ6 A;  1F9N A;  3C1D A;  1LEA A;  4B09 A;  3RDI A;  1ZN2 A;  1UFM A;  1W4M A;  4LMY A;  4YFX F;  3TDU C;  1XDU A;  2XGX A;  3FMS A;  1O7L A;  4LB5 A;  5FO5 A;  2F2E A;  4HDU A;  2VON A;  3V8J A;  1P2F A;  3WTX C;  2PJP A;  2F5F A;  1FBS A;  5D8K B;  3JTG A;  1ZRE A;  3MCZ A;  1IN7 A;  4EGY A;  1YO5 C;  2OU2 A;  1QGP A;  2XAG A;  1KQ9 A;  3IC7 A;  1GVJ A;  4EV0 A;  1OKR A;  5E1X A;  2FSW A;  2XAH A;  5IT3 A;  3ZQ7 A;  2Y0M A;  4EGZ A;  2VBW A;  4Q5S F;  5DD4 A;  3B02 A;  1U5T A;  5JVT A;  4M71 A;  2YSR A;  4AWX B;  2FXA A;  3F8B A;  4I01 A;  3CUQ A;  2PMH A;  1B6A A;  4HAM A;  1A04 A;  1P6R A;  1P92 A;  5DD8 A;  3ZMZ A;  3H3U A;  1OYY A;  2Q0O A;  1BC8 C;  3SQN A;  2E7W A;  4U0Y A;  2HZT A;  2BEO A;  3BZ6 A;  2XIG A;  3T5X A;  5E1Z B;  1IW7 F;  3MQ0 A;  1DPU A;  3MEX A;  4A12 A;  4A2U A;  5K5R A;  1P4W A;  4OIO F;  1ZHF A;  3KEQ A;  2FOK A;  3R4K A;  4M6X A;  1FBQ A;  2GAU A;  2UWM A;  1IN6 A;  1TW2 A;  5CVV A;  5CVR A;  1ZGJ A;  3ZMS A;  2ZNZ A;  5D5X B;  2EA2 A;  1STZ A;  5BQT A;  2A68 F;  1B1B A;  5J8C A;  3KZY A;  2ADU A;  3VOE A;  2BE5 F;  1YYV A;  1FYM A;  1WKM A;  3R6S A;  2FE3 A;  1U5T B;  2EWN A;  3PFI A;  2DLL A;  2FMY A;  3KZZ A;  4EJW A;  2IA1 A;  3BP8 A;  1ZH5 A;  2E1C A;  3WOD F;  1S7O A;  2LF8 A;  2ZME B;  4ZYG A;  3F22 A;  3FXR A;  1Y0U A;  3JSP A;  3CUQ B;  3ERE D;  2FRH A;  1G6N A;  2H94 A;  3J7A O;  1IRG A;  5ED4 A;  2A69 F;  2VT2 A;  4Y17 A;  2OQG A;  3V4G A;  1F4K A;  3RKY A;  5LRS A;  2W57 A;  2XKO A;  2OAZ A;  4ENK A;  4BHC A;  4CHU A;  3GLX A;  3I59 B;  4PGH A;  4ESB A;  2EK5 A;  2E1N A;  2JRT A;  1QPM A;  2ZBK A;  1ONV A;  3CDH A;  4IXA A;  3J81 K;  3DFG A;  4HZF A;  1IN8 A;  1ON1 A;  5A2Q Z;  3T0Y A;  2HQN A;  2XAQ A;  2RQP A;  1TW3 A;  5JHU A;  1B9N A;  1XGM A;  2L01 A; 
#chains in the Genus database with same CATH topology
 3WE3 A;  1KYW A;  4ENM A;  1VQ4 I;  4XOP A;  4BXF A;  1ETQ A;  3FBI B;  1GXQ A;  3JRE A;  1OR7 A;  1K6Y A;  2L54 A;  2IS6 A;  4C9Y A;  5IPA A;  2LMD A;  1JTY A;  4XK4 A;  1R1T A;  3GTK J;  3FZV A;  2K86 A;  2XF7 A;  4NB5 A;  2GLO A;  2P5L C;  3QYB A;  3GTM J;  4HW0 A;  3HRT A;  4CIC A;  2F5D A;  2EIN H;  1ON2 A;  1T0F A;  2QQA A;  2XAJ A;  3SEQ A;  1HKT A;  5HDG A;  4BXU A;  3IV5 A;  1JUP A;  2PFB A;  1V5G A;  1XN7 A;  4IOA F;  4M9X A;  1Q1H A;  3A2K A;  5EF6 A;  1EH8 A;  1V5F A;  3NRV A;  5L3B A;  1JE8 A;  1G3Y A;  3PSF A;  1A31 A;  2A5Y B;  1X3U A;  1BIB A;  4KIC A;  4S05 A;  3DU5 A;  3KP5 A;  1P4X A;  1EV7 A;  4MHG A;  2FBH A;  2FUG 2;  2V9V A;  1O7F A;  3TP3 A;  4U7D A;  1NG6 A;  2HGC A;  2VQC A;  1FOY A;  3CP2 A;  1MMS A;  1O3R A;  2ME0 A;  3FWE A;  2L0K A;  2K7L A;  3WTS C;  3BT9 A;  4AID A;  3EUA A;  1YQA A;  2P7C B;  1PUF B;  3M1C A;  2XF5 A;  2XPV A;  1XC5 A;  3UR3 C;  1IN5 A;  5HDN A;  3GTO J;  5TGT A;  4RB3 C;  4AIJ A;  3KYL A;  1RNL A;  1U78 A;  4RA2 A;  5HNF A;  5BOX A;  1Z21 A;  5LD2 C;  5BMZ A;  3FKI J;  3ELK A;  3H9J A;  1LPQ A;  1OYW A;  5GAD J;  4BBS J;  1JHH A;  1GT0 C;  1MMD A;  3BG6 A;  3V42 A;  4UB8 C;  2ZO4 A;  3I58 A;  3N97 A;  4L18 B;  3Q3S A;  1WJB A;  4KDP A;  2D1V A;  1BC7 C;  3AG1 H;  3ECO A;  1EH6 A;  1Z05 A;  1J9I A;  3OWT A;  2K9N A;  3WE2 A;  5L3C A;  5LHG A;  3HPH A;  1LB2 A;  4KN4 X;  1HW5 A;  1IAW A;  1RR8 C;  1RI7 A;  4KT6 A;  4OU0 A;  4U88 A;  2LY1 A;  2HTS A;  4UV9 A;  3OMY A;  3K70 C;  1I5Z A;  1S7A A;  2QKM B;  3IP4 B;  1IDZ A;  2EIJ H;  3H35 A;  3OIP A;  3PQJ A;  4KUM A;  1XTA A;  2JSP A;  5FD5 A;  5F0H A;  2MLG A;  2KIQ A;  2O0Y A;  1S29 A;  2NXN B;  4I09 A;  1X1A A;  4BAY A;  1Y8R B;  2PQ8 A;  3K69 A;  4BHB A;  2KLO A;  3BC8 A;  3MZ8 A;  4LGW A;  4O6J A;  1HBX G;  4EJV A;  2LTP A;  4ZTJ A;  1R23 A;  1VQP I;  3HIF A;  4M9S A;  5LBQ A;  2R7D A;  3CZ6 A;  2EV6 A;  4MIM A;  2GOX B;  5IT9 Z;  3Q5F A;  4NUB A;  4CGZ A;  1WWX A;  1ZAR A;  1HXD A;  1H89 C;  5CVJ A;  2CUZ A;  1IN4 A;  3AFH A;  1YX5 A;  2IA2 A;  1JT0 A;  1A6I A;  2LVS A;  3K1P A;  4XLE A;  1YHQ I;  2EV5 A;  2QBY A;  3DPL C;  2OZU A;  4F91 B;  1L3L A;  3VB2 A;  5EEH A;  5K5Q A;  1EKE A;  2DK5 A;  5F1J A;  1K79 A;  2W1O A;  2R5Z B;  1ZQ3 P;  2EH3 A;  1OCT C;  1FYK A;  4D0P A;  2O5R A;  5JVG F;  3C18 A;  1YRN B;  4O3M A;  1FT9 A;  4HST A;  2P7V B;  5CKT A;  2M8G X;  1T08 B;  3WTY C;  1R49 A;  1WHU A;  2KIS A;  4IL6 C;  3S1N J;  1VQ9 I;  4HF2 A;  3P5J A;  1D1A A;  3PNV A;  3IH4 A;  4MNU A;  1ULY A;  2QWW A;  3A03 A;  4BBR J;  1W7P D;  2HXO A;  1FEX A;  1B9M A;  4XLC A;  3HOU J;  1UB9 A;  1ENH A;  3ML6 A;  2FX0 A;  3DBL B;  1RPW A;  1RKT A;  3KIO A;  4QIW N;  5FKK A;  1WJ5 A;  3HHH A;  4DOZ A;  5GTI C;  4QWQ A;  1HKQ A;  5L3D A;  3W6J B;  5EDN A;  1GVD A;  4E7Z A;  5LFA A;  3T8T A;  2QGU A;  2BHY A;  2UXX A;  1WPK A;  2K9L A;  2QQB A;  2R7Z J;  2PX9 A;  5D4R A;  4JK1 X;  1MNE A;  4IF4 A;  2W85 A;  4CSW A;  2QYO A;  4JBA A;  1ZLK A;  3QPH A;  1JJ6 C;  3OYI A;  3BG5 A;  1TQP A;  3VSK A;  4P5O A;  5LGN A;  2EFQ A;  3OR1 C;  2MYS A;  2R7Q A;  5DUK A;  3CF5 F;  2P5K A;  1MW7 A;  2BY1 A;  2HQ5 A;  3K9T A;  2VBZ A;  2HKX A;  4RBO A;  2P6S A;  4UUS A;  3A0B C;  2X4H A;  5HDK A;  4D7N A;  1XG1 A;  1ETY A;  4G9Y A;  5C3E J;  2BY3 A;  2DA6 A;  4ITV A;  4RM2 A;  5F1R A;  2IVM A;  2NVT J;  2CH0 A;  2EV0 A;  4XR6 A;  2VJ4 A;  2V1U A;  2ESN A;  5J4Y A;  2V6C A;  1Y1V J;  3KE2 A;  2M0M A;  1R9T J;  4I6Z A;  3ZN0 A;  4GRI A;  5JFR A;  1HST A;  2EZK A;  2RV8 A;  5EZG A;  2TRT A;  4JX4 A;  3HSF A;  4RAF A;  2QBY B;  2Z1D A;  3H5A A;  3SFI A;  4QLC U;  2E2H J;  1IZ1 A;  4KYW A;  4NHJ A;  1RES A;  2NS7 A;  2WY8 Q;  3C2G A;  4PGG A;  4A3D J;  1ETO A;  2MA3 A;  2WAQ N;  2HR3 A;  3QWL A;  1BR4 A;  1Y56 A;  2K9M A;  3JTH A;  3LQR A;  3W6K B;  4LG0 B;  4LFU A;  1KQ8 A;  3LWF A;  5KK1 A;  1VF9 A;  3M7G A;  2DYR H;  3TO6 A;  4HX4 A;  4M9Z A;  1USS A;  5HS8 A;  2QUF A;  4HQM A;  4E70 A;  4HA8 A;  1HDD C;  5B5E C;  3JR9 A;  1VQ8 I;  3JRC A;  1I27 A;  5FKO A;  2NS8 A;  2W84 A;  1PP7 U;  1NK2 P;  3J80 K;  2MFZ A;  1OCO H;  3FXK A;  5ICE A;  3OOU A;  4LOC A;  3K10 A;  4M74 A;  3TMO A;  2EB7 A;  2VJI A;  3LSG A;  4DBQ A;  3O3K A;  2CG4 A;  3FXJ A;  4L0Y B;  1RRJ A;  4A3G J;  4BQO A;  4XIC A;  2ESH A;  5A2Q K;  4BS9 A;  3KYC B;  3K4M A;  1T38 A;  3HOY J;  2KZV A;  3D5R C;  1MGT A;  2ZSI B;  3OYM A;  4EEF G;  3Q0V A;  5ILU A;  3S16 J;  4A0X A;  3O2P E;  2ZXJ A;  3EUH C;  3KP6 A;  4ZZD A;  4BNC A;  1LVA A;  1Z7L A;  4M3B A;  2ID3 A;  5C44 J;  4XN3 A;  1ETX A;  2JSC A;  4IHT A;  2X1C A;  2XRN A;  2A07 F;  5KNL A;  3JRB A;  1ETW A;  3ERM A;  3GZ6 A;  3G1O A;  1VND A;  2JVH A;  2NYX A;  5B1B H;  5FRO A;  4BE1 A;  2MC3 A;  5LEJ A;  1JJ8 C;  4OIQ F;  5ILS A;  2V1X A;  2EJR A;  4RGR A;  3ZP5 A;  3EDP A;  2CUE A;  4IRI A;  2XGD A;  3KLO A;  4XN0 A;  3E5U A;  4XOT A;  3WTU C;  1U8R A;  5DCF A;  4UUS B;  5HS7 A;  3SHF A;  3EET A;  2K4B A;  2IGK A;  1FNN A;  1A36 A;  4HRI A;  1RUO A;  3HTS B;  4CH7 A;  5HLH A;  5DM6 F;  2DI3 A;  3L1P A;  4IEJ A;  1POG A;  3E0J B;  3BPX A;  4DJA A;  3GTP J;  4MTD A;  4CCL A;  3PNY A;  1OCR H;  5M5Y J;  5FKN A;  3K4C A;  3CCQ I;  1B4A A;  3KZI C;  2VKE A;  5KVR A;  1EJ9 A;  4CCJ A;  2CQX A;  1DU6 A;  1VI0 A;  1QZZ A;  3G1L A;  1N77 A;  5F6F A;  2FNP A;  2BXY A;  2GWR A;  2ZXI A;  1W5C C;  1AKH A;  3KP3 A;  4XMY A;  5CLS A;  3HUG B;  3RYP A;  2LNB A;  5ILV A;  5FLX Z;  3AG3 H;  4HV5 A;  3GWZ A;  4G12 A;  2R7R A;  3WU2 C;  1YTY A;  2CV0 A;  3GTQ J;  1G8X A;  1QNT A;  2WAE A;  3TW7 A;  3E7L A;  2LFB A;  4S0H B;  3RZO J;  4M3G A;  2FD5 A;  2V9P A;  3F23 A;  2UUZ A;  1FBU A;  5HLT A;  3G2B A;  4QTR A;  2R93 J;  4KN7 X;  3K1N A;  4ON0 A;  4KFC A;  4RGS A;  4BYY A;  4FX4 A;  2CW8 A;  3ZN1 A;  2JPC A;  1JKR C;  1DPR A;  2F5C A;  3KEY A;  4RB0 A;  1UHS A;  2HOA A;  4AVZ A;  1TWC J;  1V3F A;  1GXP A;  4MFD A;  3CUO A;  5CYV A;  4B1R A;  2IS2 A;  2QSF X;  2Z9O A;  3I9V 2;  2XSJ C;  2ZJP F;  4A3L J;  1IUY A;  2DOA A;  2CFO A;  5CVI A;  2AQE A;  1KU7 A;  3HTU A;  3OR2 C;  2KHM A;  3PSI A;  3QRF F;  4EMS A;  2ZME A;  1ZR2 A;  1DP7 P;  2X51 A;  3DF8 A;  4P96 A;  2Z33 A;  1OFC X;  1R36 A;  5J1U A;  5C4J J;  4XRS G;  4D5C A;  4ZYH A;  2X6Y A;  3MAJ A;  2OQR A;  4PJN A;  2F4O B;  3GTL J;  2E1M C;  4A5N A;  1XS9 A;  2OTJ I;  1R7J A;  3HC7 A;  4LIV A;  2E2J J;  3BJA A;  2DMQ A;  2FML A;  4N0B A;  1KYZ A;  1QVU A;  2Y9Z A;  2LF7 A;  3KET A;  2IGN A;  2JA2 A;  3QPS A;  2IPQ X;  1EF4 A;  3E5Q A;  3BZC A;  1JGS A;  3FMR A;  3OYJ A;  3M07 A;  4XKW A;  4C2M J;  1I1G A;  2VQH A;  2OBP A;  2D5V A;  2ZFW A;  2Y30 A;  1X1C A;  3RKW A;  2L2O A;  3FDY A;  2FOW A;  4AIH A;  4XLP F;  2WB1 N;  2EIK H;  3BR6 A;  4XOR A;  3CCV I;  5IOY A;  5H6R A;  5E3M A;  1R5H A;  3RZD J;  3K7A J;  3H5R A;  3S93 A;  3I59 A;  2E2I J;  5LGT A;  3HHG A;  1SEU A;  3UKG A;  2P6T A;  2GA2 A;  2ZSH B;  4HOB A;  3A1Y A;  4DNC A;  2QM3 A;  1RKW A;  3GO5 A;  2FQ3 A;  3TGN A;  3VYR B;  1FPQ A;  1N25 A;  1WI9 A;  1WJF A;  4A3I J;  3BR2 A;  1TWF J;  1BBY A;  2CU7 A;  3Q9V A;  3DWL E;  1S8N A;  1REP C;  4FCY A;  2NRA C;  3IH3 A;  2K3P A;  2O61 A;  2RNJ A;  2Y48 A;  2DDB A;  1AKH B;  4PDK A;  4GYI A;  3P9K A;  3BTI A;  3V8L A;  3A0H C;  2DU9 A;  2O8X A;  2RRE A;  3DTK A;  4E4H A;  1TL8 A;  1UST A;  1B72 A;  4BQA A;  4DGW B;  2LKX A;  4W1U A;  2GM4 A;  4ZH4 F;  2K5C A;  1T56 A;  1SVL A;  1H9T A;  2A6E F;  5EZH A;  4AU7 A;  3ZRG A;  2WAD A;  3WTW C;  1JKP C;  3L00 A;  2KJB A;  2UV1 A;  1OCP A;  4ASN A;  2H09 A;  2X1D A;  1VQL I;  1FSE A;  2J5O A;  4TV7 A;  2STW A;  5IYD J;  5FGM A;  1QPI A;  2KIU A;  3CUQ C;  1U6G A;  4D9J A;  2TCT A;  4E6K G;  5ERI A;  5DCM B;  2ELH A;  1WQ2 A;  4OMY A;  2Z5U A;  2AXL A;  3QYE A;  2K9S A;  2OC6 A;  3TOB A;  3HL2 A;  1ETV A;  1FTT A;  3G6E I;  2MH2 A;  1D5V A;  4Q4Z F;  1ETK A;  1OYI A;  4I02 A;  4II2 A;  5HNH A;  4EM2 A;  1QQI A;  2F48 A;  4I98 B;  3BWG A;  2ZFU A;  4WCG A;  1R00 A;  1LE8 B;  4M73 A;  4B8X A;  4HLY A;  2A3S A;  3F21 A;  1F36 A;  4MGR A;  3HKZ A;  1L0O C;  3W2A A;  3BG7 A;  2YR2 A;  3EYI A;  2JA5 J;  3MZH A;  3KP4 A;  2JZY A;  2DA2 A;  1KON A;  1X1B A;  1SMT A;  4BDZ A;  2CUF A;  1ZGA A;  5BPD A;  4DYQ A;  1A35 A;  2CV2 A;  3TO9 A;  5KAF C;  2C6Y A;  5EYR A;  3TKY A;  4AUX A;  5JLW A;  3WG9 A;  2OJE D;  1GV2 A;  2QZ8 A;  4A3F J;  4BEH A;  1R6R A;  4FHT A;  5KHD A;  4CZC A;  4IRH A;  3CD6 I;  1DP3 A;  1X2M A;  2D1H A;  2COM A;  3ZQQ A;  4KIF A;  3PUB A;  3M3Y J;  1IRF A;  1YX3 A;  3AG4 H;  2E1O A;  4B3X A;  2GXG A;  4LK0 F;  2B63 J;  1XCB A;  1QA6 A;  3QOE A;  4KIB A;  3ZCO A;  4RAG A;  2JA8 J;  3JRH A;  1SFE A;  3WGI A;  1S9H A;  4U0W A;  1IJW C;  1KU9 A;  2L5Q A;  2BVL A;  1MBF A;  3I53 A;  5DS9 A;  5AIP A;  1R1U A;  4RM3 A;  2BW3 B;  4NC8 A;  2BOL A;  4UVB A;  1FY7 A;  3RI4 A;  2H1K A;  2PMZ A;  2NNN A;  2HOE A;  2XPU A;  1ZKG A;  2PN6 A;  2VT3 A;  5C4X J;  3CQZ J;  3QAH A;  1B72 B;  2IRF G;  1B59 A;  3M4O J;  2ZJQ F;  3P9C A;  4CXF A;  2ZJ2 A;  4HX7 A;  4LLL A;  3SEZ A;  1NH3 A;  1ERD A;  2JRM A;  1I1S A;  3E97 A;  3OIO A;  5GPA A;  3JRF A;  4L9N A;  4OOI A;  5J8F A;  3GBG A;  4PK4 A;  3I5U A;  2HVQ A;  3CP8 A;  4MLO A;  3FMQ A;  1YW7 A;  1IO2 A;  2EIM H;  3BQY A;  3U9G A;  2RNG A;  2F6C A;  3VYU B;  1Z3X A;  4EM1 A;  4HBL A;  4MEY F;  1UMQ A;  2EPF A;  1FP1 D;  2Q1Z B;  3KFW X;  3DLL F;  1MBK A;  1RUN A;  2G7U A;  2JT1 A;  3H92 A;  2DA4 A;  2IJL A;  3CC7 I;  4GGG A;  4ZJZ A;  3HOZ J;  5HVQ C;  2BBY A;  3LSI A;  3TL4 X;  3F3X A;  5IYB J;  4IHW A;  1VZ0 A;  4ZYA A;  3C7J A;  2DN0 A;  1O57 A;  2R7F A;  3MFK A;  1Y1W J;  1BL0 A;  1S6L A;  3E5X A;  3CCY A;  2KP6 A;  3PO3 J;  1QO0 D;  1KU2 A;  2XKP A;  4CUG A;  2CWE A;  3PUF A;  4C3J J;  3HM5 A;  4HNV A;  3DPT A;  1VFC A;  1DUX C;  4I2O A;  1X4P A;  3V7C A;  3HRS A;  3BRO A;  5LLQ A;  3V8K A;  3PM1 A;  1TNT A;  2R5Z A;  2EFW A;  2VBY A;  3BG3 A;  4GFB A;  2XHK A;  1YRN A;  4JYK A;  3S3N A;  1X1D A;  2FJ1 A;  2CGP A;  3T8R A;  1FX7 A;  4BEH B;  1JUM A;  3VOD A;  4Y3O A;  1G3W A;  4WXC A;  2GXB A;  2BVM A;  5GTH C;  3WU1 B;  1CGP A;  2QQ9 A;  2HVR A;  1BJA A;  2CQK A;  5CPR B;  1G2H A;  2P81 A;  2ISZ A;  4LJZ F;  3HDD A;  5EEG A;  2DDA A;  1J0R A;  1VQO I;  2EZL A;  2QSG X;  2AHQ A;  4WXD A;  2M8E A;  3GF2 A;  5LEK A;  2A6T A;  2NNY A;  3F9K A;  3N05 A;  1W36 D;  2VC1 A;  5FLX K;  1S72 I;  4CYC B;  1MKM A;  5L3E A;  4BH9 A;  4NC6 A;  2IS4 A;  2D45 A;  4DZP A;  1HSJ A;  3OV8 A;  3PIO F;  1TLH B;  2M7B A;  3LFU A;  2GXA A;  2O8K A;  1BI1 A;  1T8I A;  1BW6 A;  2W25 A;  3BR1 A;  4CCK A;  2P4W A;  3L9F A;  2DQL A;  5K5O A;  1GHC A;  3M1E A;  1MMN A;  4G7H F;  1XGS A;  1FOX A;  3PNT A;  2BYV E;  1OR7 C;  3ZOB A;  9ANT A;  5FKM A;  1D8J A;  3RQI A;  1H0M A;  4HPQ A;  1FMW A;  1WH5 A;  3QU3 A;  4PJJ A;  3FM3 A;  4A0Z A;  1VTN C;  3DEU A;  1SFX A;  2DK8 A;  3K6G A;  1PDN C;  1LFB A;  1N78 A;  2E35 A;  1HKS A;  3MKY B;  5K7H A;  2DFI A;  5E3N A;  4AM3 A;  1PYV A;  3KYD B;  1OJL A;  5H6Q A;  3F72 A;  3RSN A;  4DYR A;  2IT0 A;  2M2E A;  2DT5 A;  4YEL A;  3W6V A;  3LAJ A;  3VDX A;  3B6C A;  5JLX A;  2Y2Z A;  1K61 A;  1JKQ C;  3CO6 C;  2DPU A;  4PFO A;  1GDT A;  1YW8 A;  1J2X A;  3RPU A;  1TQI A;  3F8M A;  1D3Y A;  3E3V A;  1HOM A;  4D5F A;  2L3D A;  2DMT A;  3FHN A;  1YIJ I;  3PQK A;  5DDG A;  2KDZ A;  1S7E A;  1O4X A;  2QKL B;  1D0Z A;  2QEX I;  3CJQ B;  3JAM Z;  2YU9 J;  1U2W A;  1Y39 A;  2RN7 A;  3ASO H;  4PSW A;  2FA5 A;  2V79 A;  3I0T A;  5L3G A;  4LG0 A;  3HRU A;  1GLN A;  1ZRF A;  3GW2 A;  2L9N A;  3COA C;  2O03 A;  3OSF A;  2CW7 A;  3AAF A;  1BIA A;  1MMG A;  3E6M A;  3OYD A;  3OSG A;  4N9H A;  1FSH A;  2X6O A;  3IWF A;  4DQ2 A;  5JI6 A;  5E3O A;  3QOP A;  2L9S A;  4P55 A;  4ZZL A;  4EAT A;  2ZCW A;  1IXC A;  3KP7 A;  4PZJ A;  4UXN A;  3IKV A;  2HYF A;  4F92 B;  2JUC A;  2JMW A;  3LQQ A;  4E7L A;  3NWT A;  3CCJ I;  4ZDP A;  4J01 A;  1T33 A;  4L5J A;  5JR3 A;  5B1A H;  3GTG J;  4CDG A;  2DFH A;  3HRM A;  5M5X J;  2F4M B;  2LSO A;  4PJM A;  2K85 A;  2VXZ A;  3M8F A;  1J75 A;  2H6C A;  1B8I A;  3TQN A;  3K4N A;  2HKO A;  1Z3Y A;  4RGX A;  3G3Z A;  2Z99 A;  1ZRD A;  1O3T A;  4JX6 A;  5CVU A;  2RC4 A;  3LSH A;  3R0A A;  2IGO A;  3LST A;  5L3F A;  1SD6 A;  2WC2 A;  2IGM A;  5TJJ A;  1Y8Q B;  2E36 A;  4ESF A;  1J7K A;  3MN2 A;  4G94 A;  1DU0 A;  2M34 A;  1HW2 A;  3VEP A;  2CYY A;  3ZQL A;  4XQF A;  1VQ7 I;  4UY8 I;  2DT7 B;  3J7A Y;  2JVG A;  2Z16 A;  2IA0 A;  4AVP A;  1TTY A;  5DEQ A;  5K7Z A;  5IOZ A;  4GDF A;  1BI2 A;  1K7A A;  1VQK I;  2YS9 A;  3CME I;  4FIS A;  2K40 A;  4CA0 A;  1JXS A;  4ENJ A;  1YJN I;  2VOP A;  1ODD A;  4Z6Y A;  2GZW A;  4IQJ A;  2QA4 I;  2V1N A;  3DXJ F;  3IL2 A;  4BUP A;  4OIN F;  2VOD A;  1K6O A;  1U3E M;  3TBI A;  3S1R J;  4UHT A;  1YE9 A;  2BV6 A;  4YRV A;  3KEO A;  2W00 A;  1LFP A;  3QPT A;  2WV0 A;  4R79 A;  3T1B A;  5DM7 F;  4AD9 A;  4ZDL A;  1FOW A;  4HF1 A;  3EYY A;  1BOB A;  1OIS A;  5E18 F;  3JCU C;  3I71 A;  3WTZ A;  2QF7 A;  3DBR B;  2DAO A;  4XKV A;  1LDK B;  1R4N B;  2Y75 A;  2O3F A;  2HOT A;  3O8H A;  1MJB A;  2M45 A;  4F7Z A;  1YS6 A;  4MO7 A;  2R7O A;  4NC7 A;  1Z67 A;  4H0E A;  2ZKZ A;  2G0E A;  1A6Q A;  2HWV A;  1WFX A;  2AXT C;  3HUG A;  2ICW G;  3ZMU A;  5FRN A;  2RDP A;  1T39 A;  3S2W A;  1D5Y A;  4ETS A;  3I4P A;  3FXQ A;  2M1B A;  4QSH A;  4QPO A;  1TQM A;  4G7Z F;  4AIK A;  1WH7 A;  3R0J A;  4HSR A;  1XDS A;  2EFO A;  1WRJ A;  5J3L A;  3KP2 A;  4UNO A;  3DU6 A;  2IEK A;  2VC0 A;  2BHZ A;  4BY1 J;  4OWR B;  4FET A;  1R5I D;  2MGQ A;  3DKX A;  4M6Y A;  4U0V A;  2CQN A;  3S32 A;  4KA4 A;  1ZLJ A;  2DOD A;  1CF7 A;  4HEA 2;  4Y13 A;  2JWT A;  1RR7 A;  1IF1 A;  4LD5 A;  2Z2S B;  4YFN F;  3LSJ A;  2LY2 A;  1IXS B;  3GEZ A;  1IC8 A;  3J81 Z;  4JX5 A;  2XAF A;  4CZZ A;  1B8I B;  3HEF A;  1XPX A;  5GAH J;  2XVC A;  3CTA A;  1UEL B;  2HZD A;  3EUK L;  1XMX A;  1TBX A;  2M3A A;  2IBD A;  1UHM A;  4MEX F;  2R7V A;  4O5V A;  2GA1 A;  1VQ6 I;  4EJO A;  1WJD A;  2XSD C;  4C2U A;  2VL8 A;  4YIR X;  1DQU A;  5CQG A;  1FIP A;  2AO9 A;  2ELK A;  3PJR A;  2LC2 A;  3MD2 A;  4HYE A;  4N9I A;  1K4T A;  2NS0 A;  4YG2 F;  2X6W A;  3FIS A;  2DMU A;  4M6V A;  5FFX A;  2M5W A;  5F0F A;  3RTR A;  2VBX A;  1I3A A;  3BCB A;  4RB1 A;  2IS1 A;  1I50 J;  1MBH A;  1LFU P;  1N75 A;  2EZI A;  4WF2 A;  4ZTF A;  2MH9 A;  3GZN B;  5H20 A;  1WJE A;  4LIU A;  3C3W A;  5J47 A;  2DFF A;  2HS5 A;  3CMA I;  3BZK A;  2XDV A;  3D1N I;  1Z1D A;  1R1V A;  2FBI A;  1C0W A;  1EH7 A;  3E6D A;  2HEO A;  4BU2 A;  3RCO A;  1QBJ A;  2KMU A;  3OIQ A;  3H9G A;  2D2W A;  3A02 A;  1Z77 A;  3I55 I;  3LNQ A;  3I4M J;  5D6E A;  1XGN A;  1MMA A;  3A4C A;  5FLV A;  2ECC A;  2M4K A;  3P7N A;  5AIQ A;  4YII A;  1XGO A;  4B47 A;  4CYD A;  4Y33 A;  3FHZ A;  2LDU A;  5J6X A;  1LUJ B;  3RKQ A;  3M8E A;  4RDU A;  4XBF A;  2GBY A;  1YIO A;  4G8X A;  4FTH A;  3G73 A;  4R8H A;  1W5T A;  3AL0 C;  1F5T A;  3KX2 A;  1G3S A;  1LNW A;  3HGG A;  4HX8 A;  3SXY A;  1Z6R A;  2VJ5 A;  4NQW A;  5E8G A;  1XD7 A;  2DO7 A;  3OL4 A;  4L5E A;  3ULQ B;  3K2Z A;  2E34 A;  4X0G A;  3K0L A;  4IO9 F;  5EG0 A;  2W48 A;  3NEU A;  4IHY A;  3RJP A;  4EQQ A;  2J5P A;  2GOM A;  4KIS A;  2Y0S N;  2R7T A;  1UJ8 A;  4XKB A;  4IVN A;  1JGG A;  4U87 A;  1V4R A;  3CLQ A;  3L2W A;  3RPQ A;  2IAI A;  2PMU A;  5DCM A;  5FLM J;  3BJO A;  4HDV A;  1Z9C A;  1CF7 B;  2PEX A;  4LK1 F;  3S17 J;  1ZGW A;  3S3O A;  3IHU A;  4UB6 C;  3S8P A;  4IKF A;  4WXH A;  2QLZ A;  4RAZ A;  1FYL A;  3IAM 2;  3L2R A;  2I5U A;  4HQE A;  2V1D A;  2CW0 F;  1FZP B;  1LEB A;  2VKV A;  2LRE A;  1PJR A;  1BI0 A;  2LRD A;  4A5M A;  1R5G A;  4G6D A;  1T98 A;  4LIT A;  4Z2Y A;  1OPC A;  2O7O A;  3S2H J;  1I6H J;  5D5U B;  1IUF A;  1LDD A;  3WU0 A;  1CQT A;  2E19 A;  1LE8 A;  2FNA A;  4JQF A;  2G7H A;  4KMU X;  3BR3 A;  2KDO A;  3H9Q A;  3OYG A;  5M5W J;  2XRL A;  2DPD A;  3GVA A;  2ZXW H;  2DTR A;  2MD0 A;  1E17 A;  3HSR A;  2JPB A;  3L2C A;  2RVC A;  1ZYR F;  4BJ5 C;  3NAR A;  1OQY A;  2QVO A;  2NAZ A;  4BL0 B;  2BXZ A;  3HOT A;  4EVI A;  4V2G A;  3B73 A;  5IT9 K;  3VWB A;  1MJ9 A;  1T6S A;  1U8B A;  1XX5 A;  2HFH A;  4E7K A;  4QPQ A;  3OOP A;  1O3Q A;  4A69 C;  3RIR A;  2ZC2 A;  1FWZ A;  2AS5 F;  5M3F J;  4I76 A;  5HOD A;  3QP6 A;  2VE9 A;  3WHC A;  2MC4 A;  3F8C A;  4B3A A;  3JAM K;  2HI3 A;  2H8W A;  2YU3 A;  3ONQ A;  4ZC3 A;  3AKZ A;  3LA7 A;  4UV8 A;  4PFP A;  3BG9 A;  3ROU A;  1R22 A;  1MNM C;  3ABT A;  2E1M B;  5DV5 A;  5EJC A;  4YIF A;  2KIM A;  1MH3 A;  3KLN A;  3O8G A;  4HG2 A;  1XMK A;  2JA7 J;  5F08 A;  2R3S A;  4MTE A;  2CFX A;  2BW3 A;  2NVQ J;  1WI3 A;  3CC2 I;  4M3F A;  2COB A;  1T2K A;  3DLA A;  3Q9S A;  6PAX A;  3IRQ A;  4OAZ A;  4XRS A;  2GIZ A;  2MW8 A;  3HJE A;  4NQW B;  4IHV A;  1HQC A;  2JTV A;  3DPU A;  4A6D A;  3BJ6 A;  1Z7U A;  1FMV A;  5IYC J;  3K1M A;  4P9F A;  2WA0 A;  1U5T C;  3FK7 A;  1P4A A;  2E60 A;  5D4S A;  2WB1 A;  2YX7 A;  2HNH A;  5EG0 B;  4FT8 A;  4IRG A;  4AYB N;  2X48 A;  3WG7 H;  1YS7 A;  3V7R A;  3R61 A;  2FEZ A;  4LB6 B;  1G4D A;  3OYC A;  2F4I A;  3CES A;  1X19 A;  2R7S A;  2ZME C;  2DJI A;  4FQG A;  3OYK A;  3L2V A;  4DYC A;  3ZPL A;  1JUS A;  2DMN A;  1LVK A;  5B66 C;  2PJR A;  3Q0W A;  2KRC A;  2XV4 S;  3HSE A;  4IJA A;  1W36 C;  3P9I A;  3WTT C;  2PBI A;  3PFY A;  2EFN A;  2MBF A;  1H8A C;  5F64 A;  4PSX A;  1MD0 A;  1KA8 A;  4M72 A;  1SVM A;  5E8I A;  3K2A A;  4Q48 A;  4KT5 C;  3E6B A;  5DTD A;  2CV1 A;  4HLX A;  3ZQH A;  1ZEL A;  2LK2 A;  1SD7 A;  1VQN I;  3D0S A;  1Z91 A;  2XUB A;  3I56 I;  4L0Z B;  4CCO A;  4BHP A;  3NAU A;  3OS0 A;  3S15 J;  3ABL H;  3ZMD A;  3I4N J;  2W24 A;  2M0C A;  1TP4 A;  3FM5 A;  4GYG A;  1MSF C;  2LG4 A;  2X0L A;  4H4K C;  2KPM A;  2XGC A;  3SZT A;  2HYJ A;  3LSM A;  1OLT A;  5KCM A;  3SFZ A;  1F1Z A;  2RQQ A;  3R60 A;  2AQF A;  3JRG A;  1YI2 I;  1IRZ A;  5GP9 A;  1W7P A;  1S5L C;  3I54 A;  1RIO H;  5FD6 A;  1DDN A;  2Q8K A;  1ACI A;  3M8J A;  4AC0 A;  3S1M J;  1RET A;  1DGR M;  1ZG1 A;  4B44 A;  4B43 A;  3IRR A;  3H3Z A;  3CCU I;  3ECH A;  3LFK A;  2PMZ N;  2LH9 A;  4RB2 C;  1IRX A;  3H5N A;  3GX4 X;  3ABU A;  3MZY A;  2HQR A;  1BI3 A;  2EA4 A;  5TIS C;  5LGU A;  5FRM A;  2R0Q C;  2QCO A;  3OYE A;  3GFL A;  4Y15 A;  3ZQG A;  1KU3 A;  2V26 A;  2CRG A;  3GZ5 A;  3K4B A;  2I8D A;  4IQ4 A;  4CYC A;  2VOO A;  4IX7 A;  1P7J A;  1YOV B;  3DTI A;  2HVS A;  1KGS A;  3JRD A;  2K4J A;  5GPC A;  3H3V K;  3MKZ A;  1R58 A;  3DV8 A;  5K1Y A;  4BXX J;  3CJT B;  1LQ1 A;  3G4S I;  2L02 A;  3MWM A;  1Z6T A;  1HCR A;  2WY7 Q;  2ETH A;  3IWZ A;  1RZ4 A;  3LAP A;  3QQA A;  2XC7 A;  1WGX A;  3GYH X;  2LBF B;  3U1D A;  5D8L B;  1PUE E;  2M4G A;  3H0G J;  3J80 Z;  3JRI A;  3LSK A;  2DCE A;  1JI8 A;  1SAU A;  5ICF A;  3CJN A;  2P5V A;  1BM9 A;  3REO A;  4A0Y A;  4W97 A;  2CQQ A;  3FXO A;  4WWC A;  2XRO A;  3OY9 A;  3OYN A;  2PJR B;  2DOE A;  5FJ8 J;  4A3B J;  1ZK8 A;  4B4C A;  5HLI A;  5TRD A;  3SYT A;  2EFP A;  3QP5 A;  4A93 J;  2VAS A;  2Z3Y A;  4R1H A;  4EJT A;  1IV6 A;  2A5W A;  2BY0 A;  1OMI A;  4A6E A;  3VSL A;  3N4M A;  5E3L A;  2M7A A;  3NWS A;  2Y69 H;  2DQR A;  1YW9 A;  1TNS A;  3KCC A;  2L4A A;  3ZQC A;  2HDW A;  3OYA A;  3WTV C;  3UNG C;  4J00 A;  3F6O A;  5BNG A;  3RYR A;  2R7U A;  2YUS A;  2KRF A;  3K4K A;  4II3 A;  4ESJ A;  3QOD A;  2OV7 A;  1AHD P;  2UZK A;  2OPT A;  1D8K A;  3X2Q H;  4P9U A;  2JN6 A;  3IH2 A;  3ZQI A;  5F04 A;  2A05 A;  3L2Q A;  4DBR A;  1GV5 A;  5CJ9 A;  5ICC A;  4BKX A;  2QEN A;  2HTJ A;  2P8T A;  5K7F A;  1E3H A;  1W5S A;  1SMY F;  1YLF A;  3WGG A;  2V7F A;  3D5L A;  5FFZ A;  1XSX A;  4CCM A;  5JHF A;  4IPA A;  3I64 A;  4WK8 F;  3BOQ A;  1Z0X A;  2R5Y A;  1W7P B;  2RKH A;  2V6E A;  2H1L A;  2VPL A;  1E3O C;  2MD5 A;  3HXL A;  4N4O B;  3GFM A;  5BS6 A;  3GXO A;  3A01 B;  2DOF A;  1MZB A;  3CDL A;  1M1E B;  1H9G A;  5J40 A;  1J59 A;  2VE8 A;  2H6B A;  4KIG A;  3E6C C;  1FIA A;  1I6X A;  2WWY A;  4NNJ A;  4L5I A;  2R7W A;  1JT6 A;  3FF5 A;  4OIR F;  1SAX A;  3DP7 A;  5LHH A;  2K9Q A;  1XSV A;  3J7Z I;  5EGO A;  2STT A;  1FP2 A;  1X3W B;  2YPR A;  4ENN A;  2DXI A;  2FBK A;  3L09 A;  1XMA A;  4DIQ A;  1RC9 A;  2L9V A;  4GO1 A;  1BN5 A;  4S04 A;  3B6A A;  2CO5 A;  1PP8 F;  2XAS A;  2TDX A;  1R4M B;  1X4O A;  3FIW A;  2ID6 A;  3BPV A;  4I7H A;  3EQL F;  3BTL A;  1XSD A;  2B0L A;  3S3M A;  4X1E A;  3KPH A;  1WVR A;  2ZNY A;  5DYM A;  3RKX A;  2E7X A;  5E17 F;  2BZT A;  3TOA A;  5IP7 J;  2RGV A;  2GIV A;  2K02 A;  1W0U A;  4XLN F;  1IG7 A;  2H27 A;  1E2X A;  1BW5 A;  1ZG3 A;  2W82 A;  1ZR4 A;  4OIP F;  1FLI A;  4KNY A;  1XB4 A;  2V4J C;  1T0F C;  2DBB A;  2VN2 A;  2KRH A;  2FU4 A;  4K2E A;  1P9Q C;  2VKD A;  2LD5 A;  1K78 A;  1TT0 A;  2FF4 A;  2W7N A;  1V55 H;  5GAG J;  1DGW Y;  3LOC A;  4RGU A;  4XL9 A;  3LMM A;  1UHW A;  4XKC A;  4J19 A;  3W2V A;  5HLG A;  1NK3 P;  3U21 A;  4FE4 A;  1NTC A;  3SJM A;  2M30 A;  1WJA A;  4L9J A;  3HYI A;  4ZDO A;  1J09 A;  5IP6 A;  3HOX J;  5E1W A;  3CCL I;  1TC3 C;  1XCV A;  2H8R A;  2L7Z A;  3LL7 A;  2L9R A;  3ABK H;  3QU6 A;  3OS1 A;  3H36 A;  2CSO A;  3FXU A;  1U0J A;  5LRR A;  4HF0 A;  3JW4 A;  1MND A;  1QHG A;  4JP0 A;  2DA1 A;  2NVX J;  4U7B A;  1ZRC A;  2KKO A;  4L9T A;  4KJZ A;  3F0C A;  2NOJ B;  1HDP A;  4WX9 A;  1S3J A;  1GUU A;  2KJC A;  3DQV C;  5H2F C;  4IOC F;  2V9K A;  1MBE A;  4LLG F;  2R5Y B;  2NOG A;  4MQV A;  2DYS H;  1QU3 A;  4A3J J;  4D7M A;  2IXS A;  2MG4 A;  3U2R A;  2HDD A;  3BLY A;  1D1C A;  2F5V A;  2A6H F;  3IAS 2;  2B7E A;  2XB0 X;  3ABM H;  3BCA A;  4PJL A;  1K83 J;  5AON A;  1MDM A;  4EM0 B;  1QZE A;  3GLL A;  2ELJ A;  2ISY A;  4XRF A;  4ABZ A;  2MLK A;  5EGO B;  1MBG A;  1BOA A;  2R4G A;  3CMY A;  3AG2 H;  4ZYD A;  5E20 A;  3BDD A;  1PVE A;  3BTC A;  1K4S A;  3G71 I;  2K27 A;  4PUS A;  3SZG A;  4FX0 A;  3OYF A;  1SFK A;  3FX3 A;  4UUV A;  4PCQ A;  2DW4 A;  2KQR A;  1J5Y A;  1V5E A;  1G3T A;  5KAI C;  3PL8 A;  1JHF A;  1O3S A;  1KQ0 A;  2DFE A;  1AWC A;  3O6B B;  1UAA A;  1UZC A;  4YEJ A;  4G6Q A;  1HW1 A;  3DCF A;  3WGH A;  4XON A;  4UVA A;  2W4S A;  2UXN A;  4LLN A;  4C2T A;  1MJA A;  4XRM A;  3BTJ A;  2I10 A;  1NG7 A;  3HOS A;  2JA6 J;  5BPI A;  1FC3 A;  4XSX F;  3ZMV A;  1ZG5 A;  2M87 A;  2DA5 A;  5FB2 A;  5LHI A;  2O6G E;  3J7Y J;  1G59 A;  4IHS A;  3JSO A;  1Q1V A;  1K78 B;  3GFJ A;  2PLY A;  4UVC A;  2KT0 A;  2F5E A;  2VKH A;  2YX4 A;  3E1S A;  3M9A A;  3VYS B;  1MSE C;  1AOY A;  4YFK F;  1Y6I A;  1LJ9 A;  3CLO A;  4ZYE A;  4OMZ A;  2ACJ A;  3EUH A;  2WV1 A;  1OCC H;  2KIF A;  4F3Q A;  3V7S A;  2LKS A;  3LA2 A;  2CUJ A;  3TO7 A;  3ISP A;  3NQO A;  4G7O F;  1APL C;  2KFD A;  3CCE I;  1JTX A;  3HB9 A;  1ZTR A;  1SD4 A;  4P1W A;  2LP0 A;  4PJ0 C;  1TT5 B;  5FKL A;  4Q47 A;  3L7W A;  5HOO A;  4KMF A;  3BY6 A;  1X58 A;  1LKX A;  4GXO A;  4OAY A;  4Y4R A;  1WSU A;  1UCR A;  3F8F A;  2OD5 A;  2VUM J;  2EIL H;  1TWG J;  1UG2 A;  5D5V B;  1FOK A;  3CCR I;  3VFZ A;  2IW5 A;  5F0C A;  1ZAO A;  4I0A A;  3CO7 C;  4EJU A;  5ICG A;  4C3H J;  5J1Y A;  5HS9 A;  4HV6 A;  1U9O A;  3TED A;  2B9S A;  3PO2 J;  1ORK A;  3GUD A;  3CF2 A;  4GCV A;  2FQ4 A;  2OA4 A;  2JJ7 A;  1MDM B;  3CMM A;  1E3P A;  2EQR A;  2O9L A;  2L7K A;  5D6F A;  2KZG A;  4BQN A;  5D5W B;  1LDJ A;  4E7H A;  2PG4 A;  3DEW A;  4CCN A;  1NHA A;  4NBQ A;  4RAY A;  2NVY J;  2ZXH A;  4I0B A;  2GQQ A;  2LKP A;  2A61 A;  3K4J A;  3DBH B;  4CO8 A;  2EBI A;  2CQ7 A;  4XLA A;  3F8N A;  3MKW B;  2PI0 A;  2OTL I;  3K70 D;  2WAQ A;  3LA3 A;  3L2U A;  1X3Z B;  4E7J A;  3ZMT A;  2VLA A;  2BY2 A;  1IXR C;  3VPR A;  3FXM A;  2IP2 A;  4RS8 A;  3SZP A;  3OYH A;  1QVT A;  4V19 K;  1SD5 A;  2MSY A;  2DA7 A;  2VIX A;  2VXD A;  1YFH A;  1SFU A;  1VQM I;  2BGC A;  3BR5 A;  4MQ9 F;  4RMN A;  4BJT A;  2G9W A;  3IKT A;  4XSZ F;  3CDI A;  2CJJ A;  3DKW A;  2L4M A;  4ANJ A;  1BJZ A;  4A3C J;  2MAB A;  2Q2E A;  2HYG D;  2WTE A;  2HDC A;  5DUI A;  2R7X A;  4L9V A;  1QZY A;  3GFI A;  3S2D J;  3CCM I;  1YG2 A;  2KL4 A;  2ZB9 A;  3F6V A;  3TDZ C;  2HPM A;  2OZ6 A;  3ZR8 X;  2K3F A;  1I3Q J;  5J4V A;  3BR0 A;  1F9N A;  3C1D A;  4RLQ A;  1LEA A;  4DW6 A;  4B09 A;  3RDI A;  1ZN2 A;  1UFM A;  1SC7 A;  1W4M A;  5IY5 H;  3ASN H;  4LMY A;  1QRY A;  3SDB A;  2R92 J;  4YFX F;  4BAC A;  4BDY A;  3TDU C;  1D1B A;  1XDU A;  3W3C A;  1MH4 A;  3LSP A;  5F27 A;  4E7S A;  2XGX A;  3FBN B;  1MIJ A;  3FMS A;  2LY9 A;  3H1C A;  1O7L A;  3VYT B;  4LB5 A;  5FO5 A;  4N4N B;  4F52 A;  4BE0 A;  2VQG A;  3S1Q J;  2F2E A;  1MBJ A;  4HDU A;  4Y52 J;  2VON A;  3V8J A;  4E7I A;  1P2F A;  3OL3 A;  3WTX C;  4RLF A;  2PJP A;  2F5F A;  1FBS A;  5D8K B;  3JTG A;  1ZRE A;  3MCZ A;  1IN7 A;  2XB5 A;  4EGY A;  2DT6 A;  1YO5 C;  2OU2 A;  2LLK A;  1YIT I;  3RPU D;  4V2F A;  1QGP A;  2XAG A;  2ZJR F;  2QSH X;  1KQ9 A;  3LSR A;  3IC7 A;  1E0E A;  1GVJ A;  4EV0 A;  1HC8 A;  5EEA A;  1OKR A;  1U9N A;  3HG9 A;  4NDL A;  5E1X A;  2FSW A;  4XID A;  3HZJ A;  2E5N A;  2XAH A;  5IT3 A;  3AL0 B;  3ZQ7 A;  2Y0M A;  4EGZ A;  2VBW A;  2P0W A;  4Q5S F;  3G1M A;  3C2H A;  2VPR A;  5DD4 A;  3B02 A;  1U5T A;  2ME6 A;  4DZJ A;  1HF0 A;  5JVT A;  4M71 A;  1SFO J;  3MVP A;  1FTZ A;  5CQE A;  2RAE A;  2Y0S A;  1X1P A;  2YSR A;  4AWX B;  2Q2E B;  2VB6 A;  2XPW A;  3CC4 I;  2FXA A;  3F8B A;  4I01 A;  3CUQ A;  2PMH A;  3WHB A;  1B6A A;  4HAM A;  2DA3 A;  1I39 A;  5B3S H;  1A04 A;  3I3L A;  1P6R A;  1P92 A;  5DD8 A;  3ZMZ A;  2DTZ A;  4F55 A;  3U1K A;  3H3U A;  4FAS D;  1OYY A;  2Q0O A;  1BC8 C;  3SQN A;  2E7W A;  1HA8 A;  4U0Y A;  3CJR B;  3HPG A;  3S14 J;  4B48 A;  2HZT A;  2BEO A;  4BE2 A;  3ZXS A;  3BZ6 A;  1WZ2 A;  2HXI A;  2XIG A;  3T5X A;  3TW6 A;  4F93 B;  2X6X A;  3MMY B;  2E71 A;  4UUT A;  3DKY A;  2HPI A;  5E1Z B;  1IW7 F;  4G6T B;  2OCE A;  3MQ0 A;  1DPU A;  2OCC H;  4D1Q A;  3MEX A;  4A12 A;  4A2U A;  4IZZ A;  1AU7 A;  5K5R A;  2HQA A;  3ZQF A;  4HNU A;  1P7I A;  1WCM J;  4XLH A;  1JKO C;  2LBF A;  1P4W A;  2XAU A;  4OIO F;  4C30 A;  1ZHF A;  4A3E J;  3KEQ A;  2FOK A;  3R4K A;  4M6X A;  2ECB A;  1FBQ A;  2GAU A;  3D5S C;  2UWM A;  2N8G A;  3PIP F;  1HLV A;  1IN6 A;  2HU9 A;  3C2B A;  3H0D A;  1TW2 A;  1D0Y A;  5CVV A;  3EPZ A;  5CVR A;  1ZGJ A;  3DEE A;  2ZNZ A;  3ZMS A;  5D5X B;  4A3M J;  2EA2 A;  1STZ A;  5BQT A;  2A68 F;  3HOV J;  1XGM A;  1B1B A;  3HKZ N;  5J8C A;  5M3M J;  3KZY A;  5GAE J;  4M3D A;  2L7M P;  1W1W E;  2ADU A;  3VOE A;  2LOO A;  1ITY A;  4M3E A;  4XM3 A;  3BQZ A;  3HGY A;  3DTE A;  1UG0 A;  2JK3 A;  2BE5 F;  4KIT B;  2EZH A;  1YYV A;  1FYM A;  1TWA J;  1WKM A;  3R6S A;  2FE3 A;  1U5T B;  2EWN A;  3PFI A;  4XNF A;  2DLL A;  2FMY A;  2OUM A;  3KZZ A;  4AYB A;  4EJW A;  2VJJ A;  2IA1 A;  2WAF A;  3BP8 A;  4BGD A;  1YJ9 I;  1ZH5 A;  2E1C A;  2X9D A;  3WOD F;  1S7O A;  2LF8 A;  1IGN A;  2ZME B;  4ZYG A;  5E79 C;  2JUG A;  3F22 A;  3FXR A;  1Y0U A;  3JSP A;  3CUQ B;  3ERE D;  1AA7 A;  5IP9 J;  5J1R A;  2X1E A;  3GME A;  3CCS I;  1V54 H;  2FRH A;  1KZH A;  1G6N A;  4IHX A;  2H94 A;  3J7A O;  3A01 A;  1IV8 A;  1IRG A;  2XGE A;  1QHH D;  4BQQ A;  2OF7 A;  4I99 C;  5ED4 A;  2A69 F;  1YJW I;  2LYC A;  1IDY A;  2QQ8 A;  4FE7 A;  2LR8 A;  3SDG A;  4XLF A;  4X6A J;  2VQL A;  2VT2 A;  4Y17 A;  1BA5 A;  2OQG A;  3OYL A;  1FJL A;  3Q0U A;  3V4G A;  1F4K A;  4JOM A;  3RQ4 A;  4MFE A;  3TP0 A;  3FK6 A;  3GCM A;  3FXL A;  3RKY A;  3QPL A;  5LRS A;  2W57 A;  1BR1 A;  3W2W A;  1D0X A;  1H88 C;  2XKO A;  2OAZ A;  1PUF A;  2HOS A;  2JQ7 A;  2M9H A;  4HNT A;  4ENK A;  4BHC A;  3IUO A;  3K4L A;  4BY7 J;  4CHU A;  1SVO A;  3OS2 A;  3OYB A;  3FKJ A;  3GLX A;  2VI6 A;  1R71 A;  3I59 B;  4PGH A;  4ESB A;  1EA3 A;  2EK5 A;  2E1N A;  2JRT A;  3ESW B;  1QPM A;  1X2N A;  4A3K J;  1WJC A;  2ZBK A;  2CS3 A;  2XF6 A;  1ONV A;  3CDH A;  3JRA A;  1VQ5 I;  2DJN A;  1OCZ H;  4IXA A;  1TZL A;  3J81 K;  2E5Z A;  3DFG A;  4HZF A;  1IN8 A;  4C3I J;  2Y31 A;  2L7F P;  1ON1 A;  5A2Q Z;  3T0Y A;  1Y0N A;  3ZGK A;  3HOW J;  2DMP A;  1W0T A;  2X85 A;  4Y7N J;  2Y9Y A;  2CMP A;  3GTJ J;  1A5J A;  2HQN A;  3QYF A;  2XAQ A;  2RQP A;  1TWH J;  1BR2 A;  3HBL A;  4LG3 A;  4BJ6 C;  1TW3 A;  5JHU A;  3MKL A;  2NVU B;  1F43 A;  1B9N A;  1T95 A;  1SAN A;  2WBM A;  2L01 A; 
#chains in the Genus database with same CATH homology
 3WE3 A;  1KYW A;  4ENM A;  1GXQ A;  1OR7 A;  2L54 A;  1R1T A;  3FZV A;  2K86 A;  4NB5 A;  2P5L C;  4HW0 A;  3HRT A;  4CIC A;  2F5D A;  1ON2 A;  1T0F A;  2QQA A;  2XAJ A;  1HKT A;  5HDG A;  4BXU A;  2PFB A;  1XN7 A;  4M9X A;  1Q1H A;  1EH8 A;  5L3B A;  3NRV A;  1JE8 A;  1G3Y A;  2A5Y B;  1X3U A;  1BIB A;  4KIC A;  4S05 A;  3KP5 A;  1P4X A;  1EV7 A;  4MHG A;  2FBH A;  2V9V A;  1O7F A;  4U7D A;  2HGC A;  1O3R A;  3FWE A;  2K7L A;  3WTS C;  1YQA A;  2P7C B;  1IN5 A;  5HDN A;  4RB3 C;  4AIJ A;  1RNL A;  1U78 A;  5BOX A;  5BMZ A;  3ELK A;  1OYW A;  1JHH A;  2ZO4 A;  3I58 A;  3N97 A;  4L18 B;  4KDP A;  2D1V A;  1BC7 C;  3ECO A;  1EH6 A;  1Z05 A;  1J9I A;  3WE2 A;  5L3C A;  5LHG A;  1LB2 A;  4KN4 X;  1HW5 A;  1IAW A;  1RI7 A;  4OU0 A;  4U88 A;  2HTS A;  4UV9 A;  1I5Z A;  1S7A A;  3PQJ A;  4KUM A;  5FD5 A;  2MLG A;  2O0Y A;  1S29 A;  4I09 A;  4BAY A;  2PQ8 A;  4BHB A;  3K69 A;  4LGW A;  4O6J A;  1HBX G;  4EJV A;  1R23 A;  3HIF A;  4M9S A;  5LBQ A;  2R7D A;  2EV6 A;  5IT9 Z;  3Q5F A;  4CGZ A;  1WWX A;  1ZAR A;  1HXD A;  5CVJ A;  1IN4 A;  2IA2 A;  3K1P A;  2EV5 A;  2QBY A;  3DPL C;  2OZU A;  1L3L A;  3VB2 A;  5EEH A;  5K5Q A;  2DK5 A;  1K79 A;  1FYK A;  4D0P A;  3C18 A;  4O3M A;  1FT9 A;  2P7V B;  3WTY C;  4HF2 A;  4MNU A;  1ULY A;  2QWW A;  1W7P D;  1B9M A;  1UB9 A;  3ML6 A;  3HHH A;  4QWQ A;  1HKQ A;  5L3D A;  3W6J B;  3T8T A;  2UXX A;  2QQB A;  5D4R A;  4JK1 X;  4IF4 A;  2W85 A;  2QYO A;  4JBA A;  1ZLK A;  3QPH A;  1TQP A;  4P5O A;  5LGN A;  2EFQ A;  5DUK A;  2P5K A;  3K9T A;  2VBZ A;  2HKX A;  2P6S A;  2X4H A;  5HDK A;  4G9Y A;  5F1R A;  2IVM A;  2EV0 A;  2V1U A;  2ESN A;  2V6C A;  3KE2 A;  3ZN0 A;  5JFR A;  1HST A;  2RV8 A;  3HSF A;  2QBY B;  4QLC U;  4KYW A;  1IZ1 A;  4NHJ A;  4PGG A;  2MA3 A;  2HR3 A;  3JTH A;  3LQR A;  3W6K B;  4LG0 B;  4LFU A;  1KQ8 A;  3LWF A;  5KK1 A;  3M7G A;  3TO6 A;  4HX4 A;  4M9Z A;  1USS A;  5HS8 A;  2QUF A;  4HQM A;  4E70 A;  4HA8 A;  1I27 A;  2W84 A;  1PP7 U;  3J80 K;  5ICE A;  4M74 A;  2EB7 A;  3O3K A;  2CG4 A;  4L0Y B;  2ESH A;  5A2Q K;  1T38 A;  1MGT A;  5ILU A;  4A0X A;  3O2P E;  2ZXJ A;  4ZZD A;  3KP6 A;  4BNC A;  1LVA A;  2JSC A;  4IHT A;  2XRN A;  2A07 F;  3GZ6 A;  2NYX A;  2MC3 A;  5LEJ A;  4OIQ F;  5ILS A;  2V1X A;  2EJR A;  4RGR A;  3ZP5 A;  3EDP A;  4IRI A;  3KLO A;  3E5U A;  3WTU C;  1U8R A;  5DCF A;  5HS7 A;  3SHF A;  3EET A;  2K4B A;  1FNN A;  1RUO A;  3HTS B;  5HLH A;  2DI3 A;  3BPX A;  4MTD A;  1B4A A;  5KVR A;  1QZZ A;  5F6F A;  2FNP A;  2GWR A;  3KP3 A;  5CLS A;  3RYP A;  2LNB A;  5ILV A;  5FLX Z;  4HV5 A;  3GWZ A;  1YTY A;  1QNT A;  3F23 A;  1FBU A;  4KN7 X;  3K1N A;  4ON0 A;  4KFC A;  4RGS A;  4BYY A;  4FX4 A;  3ZN1 A;  2JPC A;  1DPR A;  2F5C A;  4RB0 A;  1V3F A;  1GXP A;  3CUO A;  5CYV A;  2Z9O A;  1IUY A;  5CVI A;  1KU7 A;  3HTU A;  3QRF F;  4EMS A;  2ZME A;  1DP7 P;  3DF8 A;  4P96 A;  2Z33 A;  1R36 A;  4ZYH A;  3MAJ A;  2OQR A;  4A5N A;  1R7J A;  3BJA A;  2FML A;  4N0B A;  1KYZ A;  2LF7 A;  3KET A;  2IPQ X;  3E5Q A;  1JGS A;  3FMR A;  1I1G A;  2OBP A;  2ZFW A;  3RKW A;  4AIH A;  4XLP F;  5H6R A;  1R5H A;  3I59 A;  5LGT A;  3HHG A;  2P6T A;  2GA2 A;  4HOB A;  4DNC A;  2QM3 A;  3GO5 A;  2FQ3 A;  3TGN A;  1FPQ A;  1WI9 A;  1BBY A;  3Q9V A;  1S8N A;  1REP C;  2NRA C;  2O61 A;  2RNJ A;  2Y48 A;  4PDK A;  4GYI A;  3P9K A;  3V8L A;  2DU9 A;  2O8X A;  4BQA A;  1UST A;  4ZH4 F;  1H9T A;  2A6E F;  3WTW C;  3L00 A;  2KJB A;  4ASN A;  2H09 A;  1FSE A;  2J5O A;  4TV7 A;  2STW A;  5FGM A;  2KIU A;  3CUQ C;  1U6G A;  5ERI A;  5DCM B;  2ELH A;  1WQ2 A;  4OMY A;  2Z5U A;  2AXL A;  3TOB A;  1D5V A;  2MH2 A;  4Q4Z F;  1OYI A;  4I02 A;  4EM2 A;  1QQI A;  4I98 B;  3BWG A;  4WCG A;  1R00 A;  4M73 A;  4B8X A;  4HLY A;  2A3S A;  3F21 A;  4MGR A;  1L0O C;  2YR2 A;  3EYI A;  3MZH A;  3KP4 A;  2JZY A;  1SMT A;  1ZGA A;  5BPD A;  3TO9 A;  2C6Y A;  3TKY A;  3WG9 A;  2QZ8 A;  4FHT A;  4IRH A;  2D1H A;  2COM A;  4KIF A;  1IRF A;  2GXG A;  4LK0 F;  1XCB A;  4KIB A;  3WGI A;  1SFE A;  4U0W A;  1KU9 A;  3I53 A;  5AIP A;  1R1U A;  4UVB A;  1FY7 A;  3RI4 A;  2NNN A;  2HOE A;  2PN6 A;  2VT3 A;  3QAH A;  2IRF G;  1B59 A;  3P9C A;  4CXF A;  2ZJ2 A;  4HX7 A;  4LLL A;  1I1S A;  3E97 A;  4L9N A;  4OOI A;  5J8F A;  3I5U A;  3FMQ A;  1YW7 A;  3U9G A;  4EM1 A;  4HBL A;  4MEY F;  1FP1 D;  3KFW X;  1RUN A;  2G7U A;  2JT1 A;  3H92 A;  2IJL A;  4GGG A;  5HVQ C;  2BBY A;  3F3X A;  3C7J A;  1O57 A;  2R7F A;  3MFK A;  1S6L A;  3E5X A;  1QO0 D;  1KU2 A;  2XKP A;  2CWE A;  3DPT A;  1DUX C;  4I2O A;  3V7C A;  3HRS A;  3BRO A;  5LLQ A;  3V8K A;  1TNT A;  2EFW A;  2VBY A;  2XHK A;  2CGP A;  3T8R A;  1FX7 A;  3VOD A;  1G3W A;  4WXC A;  2GXB A;  3WU1 B;  1CGP A;  2QQ9 A;  1BJA A;  2CQK A;  2ISZ A;  4LJZ F;  5EEG A;  1J0R A;  4WXD A;  2M8E A;  3GF2 A;  5LEK A;  2NNY A;  2VC1 A;  5FLX K;  1MKM A;  5L3E A;  4BH9 A;  2D45 A;  1HSJ A;  3OV8 A;  1TLH B;  1BI1 A;  2W25 A;  2P4W A;  3L9F A;  2DQL A;  5K5O A;  1GHC A;  3M1E A;  4G7H F;  1XGS A;  2BYV E;  1D8J A;  1H0M A;  3QU3 A;  3FM3 A;  4A0Z A;  1VTN C;  3DEU A;  1SFX A;  2DK8 A;  1PDN C;  1HKS A;  2DFI A;  5H6Q A;  3F72 A;  2IT0 A;  2DT5 A;  3LAJ A;  3CO6 C;  2DPU A;  1YW8 A;  1J2X A;  3RPU A;  1TQI A;  3F8M A;  1D3Y A;  3E3V A;  2L3D A;  3PQK A;  5DDG A;  3JAM Z;  1U2W A;  2RN7 A;  2FA5 A;  2V79 A;  3I0T A;  5L3G A;  4LG0 A;  3HRU A;  1ZRF A;  3GW2 A;  3COA C;  2O03 A;  3AAF A;  1BIA A;  3E6M A;  4N9H A;  1FSH A;  3IWF A;  4DQ2 A;  5JI6 A;  3QOP A;  4P55 A;  4ZZL A;  2ZCW A;  1IXC A;  3KP7 A;  4PZJ A;  4UXN A;  3IKV A;  2HYF A;  3LQQ A;  4L5J A;  5JR3 A;  4CDG A;  3HRM A;  2LSO A;  2VXZ A;  3M8F A;  1J75 A;  2H6C A;  3TQN A;  2HKO A;  4RGX A;  3G3Z A;  2Z99 A;  1ZRD A;  1O3T A;  5CVU A;  2RC4 A;  3R0A A;  3LST A;  5L3F A;  1SD6 A;  2WC2 A;  5TJJ A;  4ESF A;  1J7K A;  4G94 A;  1HW2 A;  3VEP A;  2CYY A;  2IA0 A;  4AVP A;  1TTY A;  5DEQ A;  1BI2 A;  1K7A A;  1JXS A;  4ENJ A;  2VOP A;  1ODD A;  2GZW A;  3IL2 A;  3DXJ F;  4OIN F;  2VOD A;  1K6O A;  1U3E M;  4UHT A;  2BV6 A;  3KEO A;  3QPT A;  2WV0 A;  4R79 A;  3T1B A;  4AD9 A;  4HF1 A;  3EYY A;  5E18 F;  3I71 A;  3WTZ A;  2DAO A;  1LDK B;  2Y75 A;  2O3F A;  1MJB A;  2M45 A;  4F7Z A;  1YS6 A;  4H0E A;  2ZKZ A;  2HWV A;  3HUG A;  3ZMU A;  2RDP A;  1T39 A;  3S2W A;  4ETS A;  3I4P A;  3FXQ A;  2M1B A;  1TQM A;  4G7Z F;  4AIK A;  3R0J A;  1XDS A;  2EFO A;  1WRJ A;  3KP2 A;  4UNO A;  2VC0 A;  4M6Y A;  4U0V A;  4KA4 A;  1ZLJ A;  1CF7 A;  4Y13 A;  1IF1 A;  4LD5 A;  4YFN F;  1IXS B;  3GEZ A;  3J81 Z;  2XAF A;  4CZZ A;  2XVC A;  3CTA A;  1TBX A;  1UHM A;  4MEX F;  4O5V A;  2GA1 A;  4EJO A;  4HYE A;  4N9I A;  2NS0 A;  4YG2 F;  5FFX A;  2M5W A;  3RTR A;  2VBX A;  4RB1 A;  4WF2 A;  2MH9 A;  5H20 A;  3C3W A;  2HS5 A;  1Z1D A;  1R1V A;  2FBI A;  1C0W A;  1EH7 A;  3E6D A;  2HEO A;  1QBJ A;  2D2W A;  5D6E A;  1XGN A;  3P7N A;  5AIQ A;  4YII A;  1XGO A;  4CYD A;  3FHZ A;  2LDU A;  5J6X A;  3M8E A;  4XBF A;  1YIO A;  4G8X A;  3G73 A;  4R8H A;  1W5T A;  1F5T A;  1G3S A;  1LNW A;  4HX8 A;  3SXY A;  1Z6R A;  4NQW A;  5E8G A;  1XD7 A;  2DO7 A;  3ULQ B;  3K2Z A;  3K0L A;  3NEU A;  3RJP A;  4EQQ A;  2J5P A;  4IVN A;  1V4R A;  3RPQ A;  2PMU A;  5DCM A;  3BJO A;  4HDV A;  1Z9C A;  1CF7 B;  2PEX A;  4LK1 F;  3IHU A;  4WXH A;  2QLZ A;  4RAZ A;  1FYL A;  4HQE A;  2V1D A;  2CW0 F;  1FZP B;  1LEB A;  4A5M A;  1BI0 A;  1R5G A;  4G6D A;  1T98 A;  4Z2Y A;  1OPC A;  5D5U B;  1LDD A;  3WU0 A;  2FNA A;  4JQF A;  2G7H A;  4KMU X;  2DPD A;  3GVA A;  2DTR A;  1E17 A;  3HSR A;  2JPB A;  3L2C A;  2RVC A;  1ZYR F;  2QVO A;  2NAZ A;  3HOT A;  4EVI A;  3B73 A;  5IT9 K;  1MJ9 A;  1T6S A;  2HFH A;  3OOP A;  1O3Q A;  3RIR A;  1FWZ A;  2AS5 F;  3QP6 A;  2VE9 A;  3F8C A;  3JAM K;  2YU3 A;  3LA7 A;  4UV8 A;  3ROU A;  1R22 A;  3ABT A;  5DV5 A;  4YIF A;  2KIM A;  3KLN A;  1XMK A;  2R3S A;  4MTE A;  2CFX A;  1T2K A;  3Q9S A;  6PAX A;  3IRQ A;  1HQC A;  2JTV A;  4A6D A;  3BJ6 A;  1Z7U A;  3K1M A;  4P9F A;  1U5T C;  1P4A A;  5D4S A;  2YX7 A;  4FT8 A;  4IRG A;  1YS7 A;  3V7R A;  3R61 A;  2FEZ A;  4LB6 B;  1G4D A;  3ZPL A;  2XV4 S;  3HSE A;  4IJA A;  3P9I A;  3WTT C;  2PBI A;  2EFN A;  2MBF A;  5F64 A;  1MD0 A;  1KA8 A;  4M72 A;  5E8I A;  4Q48 A;  4KT5 C;  3E6B A;  4HLX A;  1SD7 A;  3D0S A;  1Z91 A;  2XUB A;  4L0Z B;  4BHP A;  3ZMD A;  2W24 A;  3FM5 A;  4GYG A;  2X0L A;  3SZT A;  3SFZ A;  1F1Z A;  3R60 A;  1W7P A;  3I54 A;  1RIO H;  1DDN A;  5FD6 A;  2Q8K A;  1ZG1 A;  3IRR A;  3H3Z A;  3ECH A;  3LFK A;  4RB2 C;  3GX4 X;  3ABU A;  3MZY A;  2HQR A;  1BI3 A;  2EA4 A;  5LGU A;  3GFL A;  4Y15 A;  1KU3 A;  3GZ5 A;  2VOO A;  1KGS A;  2K4J A;  1R58 A;  3DV8 A;  5K1Y A;  1LQ1 A;  2L02 A;  3MWM A;  1Z6T A;  2ETH A;  3IWZ A;  1RZ4 A;  3LAP A;  3GYH X;  3U1D A;  5D8L B;  1PUE E;  3J80 Z;  5ICF A;  3CJN A;  2P5V A;  1BM9 A;  3REO A;  4A0Y A;  4WWC A;  2XRO A;  5HLI A;  5TRD A;  2EFP A;  3QP5 A;  2Z3Y A;  4R1H A;  4EJT A;  1OMI A;  4A6E A;  3N4M A;  2DQR A;  1YW9 A;  1TNS A;  3KCC A;  2L4A A;  3WTV C;  3F6O A;  3RYR A;  2KRF A;  4ESJ A;  2UZK A;  1D8K A;  4P9U A;  5CJ9 A;  5ICC A;  2QEN A;  2HTJ A;  2P8T A;  1W5S A;  1SMY F;  1YLF A;  3WGG A;  3D5L A;  5FFZ A;  1XSX A;  4IPA A;  3I64 A;  4WK8 F;  3BOQ A;  1W7P B;  2RKH A;  2MD5 A;  3GFM A;  5BS6 A;  3GXO A;  1MZB A;  1H9G A;  1J59 A;  2VE8 A;  2H6B A;  4KIG A;  3E6C C;  1I6X A;  2WWY A;  4L5I A;  1SAX A;  3FF5 A;  4OIR F;  3DP7 A;  5LHH A;  1XSV A;  2STT A;  1FP2 A;  4ENN A;  2YPR A;  2FBK A;  3L09 A;  1XMA A;  4GO1 A;  1BN5 A;  4S04 A;  2CO5 A;  1PP8 F;  2XAS A;  2TDX A;  3BPV A;  4I7H A;  3EQL F;  1XSD A;  2B0L A;  2ZNY A;  5DYM A;  3RKX A;  2E7X A;  5E17 F;  3TOA A;  2RGV A;  2GIV A;  2K02 A;  4XLN F;  2H27 A;  1E2X A;  1ZG3 A;  4OIP F;  1FLI A;  4KNY A;  1XB4 A;  2DBB A;  2VN2 A;  2FU4 A;  4K2E A;  1K78 A;  2FF4 A;  4RGU A;  1UHW A;  5HLG A;  2M30 A;  4L9J A;  3HYI A;  5E1W A;  1XCV A;  3QU6 A;  2CSO A;  3FXU A;  5LRR A;  4HF0 A;  3JW4 A;  4U7B A;  1ZRC A;  2KKO A;  4L9T A;  4WX9 A;  1S3J A;  2KJC A;  3DQV C;  4LLG F;  4MQV A;  3U2R A;  2A6H F;  5AON A;  1MDM A;  4EM0 B;  4XRF A;  2ISY A;  2MLK A;  1BOA A;  4ZYD A;  5E20 A;  3BDD A;  2K27 A;  4FX0 A;  3FX3 A;  4UUV A;  4PCQ A;  2DW4 A;  1J5Y A;  1G3T A;  1O3S A;  1JHF A;  1KQ0 A;  1AWC A;  3O6B B;  4G6Q A;  1HW1 A;  3WGH A;  4UVA A;  4LLN A;  2UXN A;  1MJA A;  3HOS A;  5BPI A;  1FC3 A;  4XSX F;  3ZMV A;  1ZG5 A;  2M87 A;  5FB2 A;  5LHI A;  2O6G E;  4IHS A;  3JSO A;  1K78 B;  3GFJ A;  2PLY A;  4UVC A;  2YX4 A;  2F5E A;  1AOY A;  3M9A A;  4YFK F;  1LJ9 A;  3CLO A;  4ZYE A;  4OMZ A;  2ACJ A;  3EUH A;  2KIF A;  3V7S A;  3LA2 A;  3TO7 A;  3ISP A;  3NQO A;  4G7O F;  1SD4 A;  4Q47 A;  3L7W A;  5HOO A;  4KMF A;  3BY6 A;  4GXO A;  1WSU A;  1UCR A;  3F8F A;  2OD5 A;  5D5V B;  1FOK A;  3VFZ A;  2IW5 A;  1ZAO A;  4I0A A;  3CO7 C;  4EJU A;  5ICG A;  5HS9 A;  4HV6 A;  3GUD A;  4GCV A;  2OA4 A;  1MDM B;  5D6F A;  5D5W B;  1LDJ A;  2PG4 A;  1NHA A;  4RAY A;  4I0B A;  4CO8 A;  2GQQ A;  2LKP A;  2A61 A;  3F8N A;  2PI0 A;  3LA3 A;  3ZMT A;  1IXR C;  2IP2 A;  4RS8 A;  3SZP A;  1SD5 A;  1YFH A;  1SFU A;  2BGC A;  4MQ9 F;  2G9W A;  3IKT A;  4XSZ F;  3DKW A;  2L4M A;  2Q2E A;  2HYG D;  2WTE A;  2HDC A;  5DUI A;  4L9V A;  1QZY A;  3GFI A;  1YG2 A;  3F6V A;  3TDZ C;  2OZ6 A;  1F9N A;  3C1D A;  1LEA A;  4B09 A;  3RDI A;  1ZN2 A;  1UFM A;  1W4M A;  4LMY A;  4YFX F;  3TDU C;  1XDU A;  2XGX A;  3FMS A;  1O7L A;  4LB5 A;  5FO5 A;  2F2E A;  4HDU A;  2VON A;  3V8J A;  1P2F A;  3WTX C;  2PJP A;  2F5F A;  1FBS A;  5D8K B;  3JTG A;  1ZRE A;  3MCZ A;  1IN7 A;  4EGY A;  1YO5 C;  2OU2 A;  1QGP A;  2XAG A;  1KQ9 A;  3IC7 A;  1GVJ A;  4EV0 A;  1OKR A;  5E1X A;  2FSW A;  2XAH A;  5IT3 A;  3ZQ7 A;  2Y0M A;  4EGZ A;  2VBW A;  4Q5S F;  5DD4 A;  3B02 A;  1U5T A;  5JVT A;  4M71 A;  2YSR A;  4AWX B;  2FXA A;  3F8B A;  4I01 A;  3CUQ A;  2PMH A;  1B6A A;  4HAM A;  1A04 A;  1P6R A;  1P92 A;  5DD8 A;  3ZMZ A;  3H3U A;  1OYY A;  2Q0O A;  1BC8 C;  3SQN A;  2E7W A;  4U0Y A;  2HZT A;  2BEO A;  3BZ6 A;  2XIG A;  3T5X A;  5E1Z B;  1IW7 F;  3MQ0 A;  1DPU A;  3MEX A;  4A12 A;  4A2U A;  5K5R A;  1P4W A;  4OIO F;  1ZHF A;  3KEQ A;  2FOK A;  3R4K A;  4M6X A;  1FBQ A;  2GAU A;  2UWM A;  1IN6 A;  1TW2 A;  5CVV A;  5CVR A;  1ZGJ A;  3ZMS A;  2ZNZ A;  5D5X B;  2EA2 A;  1STZ A;  5BQT A;  2A68 F;  1B1B A;  5J8C A;  3KZY A;  2ADU A;  3VOE A;  2BE5 F;  1YYV A;  1FYM A;  1WKM A;  3R6S A;  2FE3 A;  1U5T B;  2EWN A;  3PFI A;  2DLL A;  2FMY A;  3KZZ A;  4EJW A;  2IA1 A;  3BP8 A;  1ZH5 A;  2E1C A;  3WOD F;  1S7O A;  2LF8 A;  2ZME B;  4ZYG A;  3F22 A;  3FXR A;  1Y0U A;  3JSP A;  3CUQ B;  3ERE D;  2FRH A;  1G6N A;  2H94 A;  3J7A O;  1IRG A;  5ED4 A;  2A69 F;  2VT2 A;  4Y17 A;  2OQG A;  3V4G A;  1F4K A;  3RKY A;  5LRS A;  2W57 A;  2XKO A;  2OAZ A;  4ENK A;  4BHC A;  4CHU A;  3GLX A;  3I59 B;  4PGH A;  4ESB A;  2EK5 A;  2E1N A;  2JRT A;  1QPM A;  2ZBK A;  1ONV A;  3CDH A;  4IXA A;  3J81 K;  3DFG A;  4HZF A;  1IN8 A;  1ON1 A;  5A2Q Z;  3T0Y A;  2HQN A;  2XAQ A;  2RQP A;  1TW3 A;  5JHU A;  1B9N A;  1XGM A;  2L01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...