5ILSA

Autoinhibited etv1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
101
structure length
101
Chain Sequence
b'SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS translocation variant 1
publication title Structured and disordered regions cooperatively mediate DNA-binding autoinhibition of ETS factors ETV1, ETV4 and ETV5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ilsA00
1W4MA 2COMA 2RVCA 3F6OA 2XHKA 5D8LB 2Y48A 2FBKA 5FLXK 2ESNA 1YFHA 5FO5A 1DUXC 3JSOA 4PDKA 4KFCA 2DI3A 4EJUA 1FLIA 3C3WA 1Y0UA 1TBXA 4HLXA 3L2CA 2EFPA 2EK5A 4L0YB 4FX4A 2A6EF 2VBXA 1SMYF 4UVCA 3GEZA 5JHUA 3R0AA 2GA1A 3WTSC 4ENMA 1R1VA 4AIJA 3IWZA 3MZHA 5D6EA 4Y17A 1T0FA 4M74A 5EEHA 3M1EA 3SFZA 3P9IA 4EM1A 1KQ0A 4RB3C 3RKXA 4ZZDA 1R23A 3BJOA 1MDMB 2GZWA 1KU2A 5DDGA 3RIRA 2XUBA 2ZO4A 1YYVA 4LB6B 2ADUA 1H9TA 1S7OA 3ZMDA 3CLOA 4LB5A 4QLCU 5L3GA 2YR2A 4KICA 2V1DA 1MGTA 3HYIA 2OZ6A 4FT8A 1T38A 1QZYA 2L4MA 2HWVA 2PMUA 3KP7A 3DQVC 2EA2A 2BEOA 2Z33A 4Q5SF 3EQLF 3LFKA 3ZQ7A 1DDNA 1WKMA 1USTA 3DXJF 4LJZF 3WTWC 1ZG5A 1J2XA 2PG4A 2IW5A 1ON2A 2F5FA 4AVPA 2A61A 2DW4A 2ISYA 2XASA 3SXYA 1H9GA 4MQVA 4KN7X 1WI9A 2P5VA 4XLNF 2KIFA 3ZN1A 1I1SA 1SD6A 2XGXA 4A0YA 2XAJA 3K69A 1TW2A 4KN4X 4M71A 3AAFA 3FXRA 1SFUA 5LGUA 2D1VA 5BQTA 2HKXA 4G6QA 4ZYGA 3WTZA 3VB2A 4LK1F 2OQRA 4M9ZA 1BM9A 5JFRA 4R8HA 3KZYA 3TOBA 4IXAA 1E17A 1SMTA 2H27A 3LAJA 5J8FA 1XMAA 3CUQB 4OINF 1ZLKA 1W7PA 2MH2A 1Z6TA 4ZYEA 4PCQA 4H0EA 3TDUC 1MKMA 4MGRA 1MJ9A 1CF7A 2XAHA 1Z05A 2RC4A 4L9TA 3V8LA 5DEQA 2F2EA 4YG2F 4S04A 3ZPLA 3VOEA 1G4DA 3MEXA 1ZHFA 4G7HF 1I27A 1TW3A 3V7SA 5D6FA 3K2ZA 2XROA 4MTDA 1OKRA 1HW1A 2O03A 1OYIA 3REOA 1HW5A 3OOPA 4BH9A 4Y13A 1ZYRF 3RYPA 2Q2EA 4U7DA 3J80Z 2UXNA 3ZMSA 4KMFA 3FMSA 3FMQA 4RB0A 1SD7A 3RPQA 3WG9A 3RYRA 2Z9OA 1YQAA 4WXCA 2G9WA 2DK8A 3BJAA 1YO5C 3HTUA 4G7ZF 5AIQA 1ZGAA 3SQNA 1ZAOA 4BHCA 2EA4A 1UB9A 1Z6RA 2G7UA 2MA3A 1LVAA 4HX4A 3LQRA 1BIBA 1QNTA 2EJRA 2EV0A 3T8TA 4A5MA 2MBFA 1EV7A 4LLNA 4NB5A 2BGCA 1U6GA 4A6DA 3LAPA 4IRGA 2QBYB 1FP2A 3EYIA 4IHSA 1ZRCA 1FWZA 3WU1B 1W5TA 1JGSA 3B02A 3TO6A 1FBSA 1ZREA 4A12A 4RB2C 2OU2A 3PFIA 1K78A 4KNYA 3GLXA 3E5UA 4LMYA 5FD5A 2QQ9A 1U3EM 3MCZA 2VT2A 3FM5A 5JVTA 4K2EA 2VC0A 1ULYA 1ZLJA 1O3SA 3LA7A 4RGRA 3GFJA 2IP2A 5H6QA 2QQBA 4R1HA 4PGHA 1KA8A 3TOAA 1F9NA 1OYYA 1T2KA 2D1HA 1GXQA 5F6FA 4ESJA 5CVVA 2VODA 3GVAA 4EMSA 2KIMA 2K4JA 2PI0A 3ABUA 2GWRA 3L00A 2PBIA 3F72A 3O6BB 2EB7A 3TO9A 2XKPA 1MJAA 4Y15A 4OIOF 1Z7UA 1O7LA 4N9IA 1U5TA 4CGZA 4BAYA 5LEJA 2JZYA 3WE2A 4ENJA 1QO0D 1FX7A 1BOAA 4ZYHA 4U0WA 4UHTA 2GAUA 2M5WA 4GGGA 5L3BA 3Q9VA 3T5XA 2QYOA 3P7NA 3GYHX 2ZXJA 4YFKF 4OIPF 3QPTA 1G3TA 4MHGA 3DF8A 2MLKA 4GXOA 1T39A 3KEOA 1SAXA 2HTJA 2X0LA 2HZTA 1IXSB 3F8NA 1QPMA 5FGMA 2K02A 1YS7A 3EYYA 2ZMEA 1V3FA 2NAZA 3M9AA 3U9GA 2HR3A 5TJJA 2FNPA 4A0XA 4I98B 1G6NA 1JHFA 5CYVA 4LFUA 3GFLA 4EVIA 4HYEA 2RN7A 1O7FA 4DQ2A 3QPHA 2P5KA 2VBWA 5J8CA 1LDKB 2HDCA 2Y0MA 4YIIA 1CGPA 2DAOA 3WTYC 2RNJA 4Z2YA 1DPRA 5DD4A 2W24A 1FZPB 2P5LC 2VN2A 2NNNA 3DV8A 1FBQA 5DD8A 2DBBA 4ESFA 3HTSB 5A2QZ 3TGNA 4UUVA 4YFXF 4M6YA 3WTVC 3E5QA 4JBAA 3LWFA 2PMHA 3VODA 2OAZA 4GCVA 2XIGA 1XN7A 3H3ZA 1IF1A 4EJOA 1IN7A 3HOSA 1D3YA 3BROA 1ZARA 3J81K 2RGVA 4WF2A 3F22A 5F64A 4QWQA 1YG2A 1E2XA 5E1WA 4IVNA 4HAMA 1IW7F 1FYMA 3H92A 3E6BA 3G3ZA 2NYXA 2P4WA 1UFMA 4MEXF 4OIRF 5IT3A 1B1BA 3F3XA 1F1ZA 4L9JA 1B6AA 4MTEA 3RPUA 2ZCWA 1H0MA 1ZG1A 5BS6A 2F5CA 2HGCA 2CWEA 1B9MA 5CVIA 3F6VA 3ZP5A 3U2RA 4JK1X 5BOXA 3ZMTA 2V6CA 2W57A 2B0LA 3HHHA 2VXZA 1S3JA 1SFXA 2HS5A 5D4RA 3V7RA 4MQ9F 4HA8A 4OMZA 2GA2A 5HDNA 3KP5A 2ZJ2A 1FP1D 1WQ2A 5IT9K 2FXAA 5E8IA 3ERED 4AIHA 1GXPA 5ED4A 2P7VB 3BZ6A 4G94A 3KP2A 3BJ6A 3E6MA 2RV8A 5CJ9A 3LQQA 4EJTA 4CZZA 3GX4X 3PQKA 2Y75A 4XRFA 1ON1A 1U5TC 5DCMA 1MD0A 4PGGA 4BQAA 4U0YA 1LEBA 2PN6A 3HSEA 4XLPF 3QU3A 1MDMA 4M9XA 4WWCA 1L0OC 2IA0A 5HVQC 4L5IA 5JI6A 3CO7C 1LEAA 4BNCA 3ISPA 1JHHA 3F8BA 1FBUA 4N9HA 4I2OA 2UZKA 2IRFG 4ASNA 3KETA 4D0PA 1HBXG 2BE5F 4CO8A 4OU0A 6PAXA 1O57A 3K0LA 4S05A 1J59A 2E7XA 3I58A 3HOTA 3JAMK 4HW0A 2FE3A 3ABTA 2EFQA 4HX7A 1HW2A 2QZ8A 1FT9A 2RDPA 2ZNZA 3R60A 3CTAA 4EM0B 1KU9A 1JE8A 3IRRA 1XB4A 2KIUA 2C6YA 3LSTA 1D8KA 2OA4A 1KGSA 3I4PA 2HQRA 5E17F 3S2WA 3L09A 1WRJA 1FYLA 4M73A 1KU3A 3E6DA 3TQNA 3Q5FA 1D8JA 1FPQA 1ZG3A 2ISZA 4KYWA 2FRHA 4L0ZB 1L3LA 1BI1A 1W7PB 1XSVA 1OMIA 4CYDA 4CICA 4RGUA 5KVRA 1CF7B 1XGNA 3G73A 1BI3A 1ODDA 1UHWA 5LEKA 5FFXA 3CUQA 2Q8KA 5HS9A 1MZBA 4EJVA 2Z3YA 5L3CA 3WE3A 3GFIA 3O2PE 2W25A 5D5UB 5CVUA 1KQ8A 1YTYA 4P9UA 4HOBA 1P4WA 4HV6A 1K79A 2W84A 2F5DA 1BBYA 3JSPA 1O3RA 5KK1A 2BV6A 1BC8C 3OV8A 5HS8A 5CVJA 1TLHB 2XAGA 2NS0A 4I0AA 2XKOA 3BPVA 2E1NA 2HKOA 3L7WA 1HQCA 1YW7A 1R5GA 4OIQF 5CVRA 3V7CA 5ILSA 5HOOA 3SHFA 2ACJA 3LA2A 3F8CA 4UXNA 3MQ0A 2R7DA 5HLIA 2UWMA 2OQGA 5LRRA 2H6CA 2HYGD 1LB2A 3FWEA 2KKOA 2H6BA 3ZN0A 2DO7A 3GW2A 1I1GA 1TNTA 2EWNA 3RJPA 3GUDA 2CW0F 3TKYA 4RGSA 5D5VB 1SFEA 2CO5A 4WX9A 3WTUC 4HBLA 2OZUA 3M8EA 2OBPA 3FM3A 3FXUA 2IA1A 1P92A 2YSRA 4LG0A 3CO6C 3BWGA 1XDSA 4ON0A 2DFIA 2G7HA 2P6TA 2DK5A 4LGWA 1XDUA 5FD6A 2K4BA 1BIAA 1KYZA 3FMRA 5H6RA 3FXQA 1RUOA 3T0YA 3V8KA 1IXCA 3IL2A 1XGMA 2W85A 1RIOH 3U1DA 3BPXA 3EETA 2DPUA 3E6CC 4JQFA 4U7BA 3MZYA 5L3DA 1HKTA 5K5OA 5BMZA 3MWMA 1ZH5A 1ONVA 1VTNC 3N4MA 1G3YA 3RKWA 5LBQA 4U88A 1HSJA 2TDXA 4GYIA 4XSZF 4FHTA 2XAQA 1AWCA 5FLXZ 3ZMUA 3HRUA 2L4AA 5D4SA 1R22A 4IHTA 4RAYA 1DPUA 2MLGA 2H09A 2ELHA 4IRHA 3NQOA 4KA4A 3SZPA 3ZMZA 5FB2A 1U5TB 5D5XB 3QP5A 4ENKA 2Q0OA 4ETSA 3P9KA 2GXGA 1BJAA 4HV5A 4HDVA 1HXDA 3K1NA 5JR3A 1XCBA 3KZZA 2HQNA 4LLLA 1ZGJA 3R0JA 4KIFA 4KIGA 2K86A 4A2UA 1KU7A 3V4GA 2IPQX 1PP8F 1R58A 2L54A 1FSEA 2NRAC 3I54A 2A3SA 4GO1A 4YFNF 2RQPA 4KMUX 3KE2A 3O3KA 3E5XA 3HRSA 2FNAA 2LSOA 1RUNA 5LGTA 1IXRC 2HYFA 3DPLC 3QOPA 5FFZA 2WWYA 2GXBA 1K7AA 3RTRA 4NQWA 3J80K 5F1RA 5E18F 3D0SA 2RKHA 1T6SA 3BDDA 2ETHA 2HTSA 4UVAA 4EGYA 2HOEA 4TV7A 2V9VA 1IN8A 1UCRA 4ZZLA 5DUIA 1R1UA 2K7LA 1T98A 2PFBA 2R7FA 2QENA 1Z1DA 3I5UA 3KLOA 3M8FA 1U2WA 1O3TA 3JW4A 1SD5A 2O0YA 1B59A 2MD5A 5LHHA 1RNLA 1K6OA 1BN5A 4P9FA 2V1UA 1QZZA 1YW9A 3T8RA 5LHGA 2PQ8A 5EEGA 2VBYA 3ROUA 3CJNA 4G9YA 3BY6A 4AIKA 2ZKZA 1D5VA 4Q4ZF 1YLFA 3KEQA 5DYMA 2H94A 1PUEE 5HDKA 3BP8A 1EH8A 1G3WA 4R79A 1R1TA 4ENNA 4HF0A 4NHJA 2AXLA 2STTA 3F8MA 2J5PA 2E7WA 1O3QA 2A5YB 1HKQA 1S29A 3WODF 1TNSA 4O5VA 4A6EA 2CGPA 5DUKA 3KLNA 3I59A 1I5ZA 3GO5A 1IUYA 4YIFA 4G6DA 3ECOA 5E1XA 3K1MA 3I53A 2VE9A 2O3FA 4HQMA 3KP4A 3TDZC 3F8FA 5ICFA 2IJLA 2FF4A 4IF4A 1FNNA 2OD5A 4M9SA 1YIOA 2P6SA 3WGGA 1IRGA 2L01A 5K1YA 1B4AA 3ZMVA 3HIFA 4RS8A 5HDGA 3EDPA 2NNYA 3QP6A 3H3UA 2EFWA 1EH6A 1DP7P 2EV5A 5K5RA 2EFOA 1B9NA 3R4KA 1PP7U 4OOIA 5DCMB 2R3SA 3I64A 4WXHA 4O3MA 1FSHA 5ILVA 2FA5A 2QUFA 1LDDA 3C18A 2FQ3A 1REPC 3MFKA 1NHAA 1BI0A 3C7JA 3HSRA 2V1XA 2Z99A 1LQ1A 1KYWA 1GVJA 2O6GE 1XSXA 1OYWA 2P7CB 3HRMA 2L02A 2M8EA 1PDNC 3I0TA 2ZBKA 3ECHA 1GHCA 4FX0A 1RI7A 5HS7A 2XAFA 2O61A 5AIPA 5LGNA 1XSDA 2CYYA 4HF1A 2VT3A 4A5NA 4L18B 1XMKA 1SD4A 1TTYA 4PZJA 1W7PD 1QBJA 3HHGA 4I7HA 4BYYA 3VFZA 1X3UA 2JPCA 5E8GA 2STWA 3JTHA 1LJ9A 3W6KB 2O8XA 3QRFF 2GQQA 1P6RA 4IPAA 2BYVE 2QWWA 2A69F 4HZFA 4I0BA 2FOKA 2Z5UA 5A2QK 3FX3A 3HRTA 3GWZA 2F5EA 3EUHA 3GZ6A 1XD7A 3V8JA 1STZA 1W5SA 2P8TA 2VBZA 2HFHA 2KJBA 2LNBA 4AD9A 3RKYA 1WSUA 2CFXA 2BBYA 2YPRA 2VONA 1TQIA 4MNUA 3SZTA 4RGXA 5BPIA 2QVOA 4U0VA 5E1ZB 1MJBA 2ZFWA 3LA3A 3W6JB 3F21A 3WGIA 4F7ZA 1S8NA 3CDHA 4P55A 4EQQA 2LF8A 4I09A 2VOOA 2PJPA 1IRFA 4HDUA 1YW8A 2CG4A 4MEYF 2DLLA 1HKSA 3J7AO 1HSTA 2LF7A 2VE8A 2KJCA 3DEUA 3KP6A 3L9FA 3BOQA 2JTVA 2J5OA 4LK0F 3COAC 5D5WB 4EJWA 2FSWA 4UVBA 2IA2A 3IRQA 1TQPA 2EFNA 1Z9CA 1XGOA 3HSFA 4CDGA 1OR7A 1G3SA 3DFGA 2EV6A 3TO7A 3RDIA 1JXSA 3E97A 1J7KA 4IRIA 5DCFA 4LD5A 4L9VA 3GXOA 3WTXC 1J0RA 1P2FA 1XCVA 1RZ4A 4Q48A 3ML6A 2FU4A 3R61A 4HF2A 3R6SA 3F23A 3M7GA 3KP3A 3KFWX 1UHMA 2FMLA 4KUMA 1A04A 4RB1A 1Z91A 2A6HF 3D5LA 4B8XA 4WK8F 5D8KB 1R7JA 4UNOA 3CUOA 3DKWA 3GZ5A 1IN5A 2DU9A 4Q47A 3IWFA 3K9TA 1V4RA 2GIVA 4LG0B 1K78B 3IC7A 1QQIA 1WWXA 1BI2A 2IVMA 5J6XA 1IN6A 2M30A 4EV0A 4E70A 1QGPA 3DPTA 3NEUA 5L3EA 2UXXA 3J81Z 5L3FA 2D2WA 2QBYA 2V79A 2PLYA 2JT1A 3FHZA 2VOPA 3QU6A 4M6XA 4ZYDA 3E3VA 4AWXB 3ELKA 1EH7A 4G7OF 2AS5F 5ILUA 5BPDA 2M1BA 2E1CA 4HX8A 1S6LA 1I6XA 3DP7A 3MAJA 5H20A 4DNCA 4KT5C 5LHIA 3KCCA 5K5QA 2MH9A 3IKTA 4O6JA 4L5JA 2YX4A 1FOKA 2L3DA 2JSCA 4ESBA 3FF5A 3Q9SA 2XVCA 2WV0A 1USSA 4UV9A 4HLYA 2D45A 3T1BA 3GFMA 2JPBA 5IT9Z 4I01A 1IZ1A 4KIBA 2FBIA 1ZRDA 2DPDA 1XGSA 5ICGA 4G8XA 1LDJA 2QLZA 1U8RA 1BC7C 2FEZA 2DT5A 2DQLA 4BHPA 2QM3A 4N0BA 4CHUA 3P9CA 1Q1HA 1J5YA 1FC3A 3RI4A 1S7AA 1C0WA 4LLGF 2DQRA 2IT0A 4UV8A 3FZVA 5CLSA 4XSXF 5DV5A 2M87A 2QQAA 2ZMEB 2LKPA 5LRSA 1FY7A 3HUGA 3IKVA 3CUQC 4RAZA 4EM2A 3WGHA 2MC3A 4B09A 5ICCA 4BXUA 1FYKA 3K1PA 1R5HA 1F4KA 1IAWA 2CQKA 1R36A 3VEPA 2K27A 3N97A 3PQJA 1AOYA 2WC2A 2LDUA 5LLQA 1KQ9A 3JAMZ 4M72A 4WXDA 2VC1A 3ULQB 3I71A 2ESHA 4CXFA 4P96A 3WU0A 2JRTA 2PEXA 4GYGA 5HLHA 2DTRA 1TQMA 1LNWA 1OPCA 1P4XA 4L9NA 5E20A 4P5OA 2WTEA 2KRFA 5ICEA 3QAHA 2ZNYA 1J75A 5TRDA 1IN4A 2M45A 4KDPA 4I02A 5ERIA 2XRNA 1ZN2A 1F5TA 2XV4S 2YX7A 2CSOA 1YS6A 4OMYA 3JTGA 3B73A 4XBFA 2A07F 2FMYA 4ZH4F 4HQEA 4EGZA 4A0ZA 4WCGA 4IJAA 2FBHA 2A68F 3IHUA 1U78A 3WTTC 1P4AA 3I59B 2X4HA 3C1DA 1R00A 3GF2A 2HEOA 2YU3A 5HLGA 4BHBA 3NRVA 1J9IA 1ZRFA 5AONA
chains in the Genus database with same CATH superfamily
1W4MA 2COMA 4ZYAA 2RVCA 3F6OA 2XHKA 4E7KA 5D8LB 2Y48A 1WH5A 1XG1A 2FBKA 5FLXK 2BY0A 2VJ4A 1K4TA 2ESNA 2M0MA 3I56I 5FO5A 1YFHA 1A31A 1I6HJ 1DUXC 3JSOA 2ZFUA 4PDKA 4RLQA 4KFCA 2DI3A 1U0JA 2CH0A 4EJUA 1FLIA 4DYRA 2OPTA 1JJ6C 3C3WA 1Y0UA 1TBXA 4HLXA 3L2CA 2EFPA 2EK5A 3DLLF 1W0UA 1IRZA 1WZ2A 4L0YB 5LD2C 2AO9A 2MC4A 5FKNA 4IOCF 4FX4A 2A6EF 4BGDA 2VBXA 1SMYF 4UVCA 3H35A 2V26A 3GEZA 2DFFA 5JHUA 4QPOA 3R0AA 1VQ6I 3I4MJ 4A3DJ 2GA1A 1Q1VA 2CQXA 3WTSC 4ENMA 1R1VA 4AIJA 5JVGF 3IWZA 3MZHA 5D6EA 4Y17A 1R9TJ 4A3CJ 3HKZN 4V2GA 1T0FA 1JTXA 2R7QA 4KT6A 1H89C 3ZQLA 1ORKA 4M74A 5EEHA 3CCJI 3M1EA 1NH3A 2LMDA 3SFZA 3CMYA 3AL0B 2I8DA 2HYJA 3P9IA 4EM1A 1KQ0A 4RB3C 1UG0A 3RKXA 4ZZDA 1GV5A 1LKXA 2BVMA 3HDDA 4HRIA 1R23A 4HG2A 3BJOA 2GBYA 3M07A 1MDMB 2GZWA 1KU2A 1S7EA 2CS3A 3LMMA 3GCMA 5DDGA 2CJJA 3RIRA 1GVDA 2XUBA 4GFBA 2WY8Q 1RC9A 2ZO4A 1YYVA 4A3KJ 2QKMB 4LB6B 3OS0A 3OYMA 2ADUA 1H9TA 2R7UA 3L2VA 1S7OA 4U87A 3ZMDA 3CLOA 1RR7A 4CCLA 4LB5A 1HDPA 4QLCU 5L3GA 1X1CA 2NOGA 2YR2A 4DZJA 4KICA 1F43A 2V1DA 1FOXA 1MGTA 3OR2C 4XLHA 3ZRGA 3GBGA 3HYIA 3C2BA 4BY7J 2OZ6A 4FT8A 4AIDA 1T38A 4L5EA 1QZYA 2DA7A 2L4MA 2HWVA 2PMUA 3KP7A 3DQVC 2EA2A 3CCQI 3PSIA 2BEOA 1EF4A 2Z33A 4Q5SF 3EQLF 3AG1H 3OYLA 3LFKA 2V1NA 2HDDA 3ZQ7A 4MFEA 2X9DA 1WKMA 1DDNA 2CV1A 1LUJB 1USTA 3DXJF 2JUGA 4LJZF 3WTWC 1E0EA 1ZG5A 1J2XA 2QQ8A 2PG4A 2CRGA 4I6ZA 3NARA 2M7AA 2IW5A 2JQ7A 1ON2A 2F5FA 4AVPA 2A61A 2DW4A 1ZKGA 2ISYA 1D0ZA 2XASA 3SXYA 2TCTA 1H9GA 2IAIA 4MQVA 2EIMH 3MMYB 2LY9A 4XR6A 4KN7X 3K4BA 1WI9A 4BDYA 4BL0B 2P5VA 4XLNF 2KIFA 3ZN1A 1I1SA 1SD6A 2XGXA 4A0YA 4BKXA 3CF2A 2EBIA 2XAJA 3K69A 3FK7A 1TW2A 3IUOA 3QOEA 2K3FA 4KN4X 4M71A 2VUMJ 3AAFA 3FXRA 4XKCA 1K61A 1SFUA 5LGUA 1R71A 2D1VA 2KZVA 3MN2A 5BQTA 2HKXA 4G6QA 4PJLA 2IGKA 3BR2A 4YEJA 4ZYGA 1JI8A 3WTZA 3VB2A 2IBDA 3DTEA 1NG7A 4LK1F 1R5ID 3MKWB 2OQRA 4M9ZA 1BM9A 2EIKH 2NVYJ 3A0HC 2O8KA 5JFRA 2A6TA 4R8HA 4ZDLA 4QSHA 3KZYA 1DGWY 1SANA 2WAEA 4IXAA 3TOBA 2W7NA 1WJ5A 1E17A 2H8WA 1SMTA 3LSGA 2H27A 5FKOA 2R7WA 2DMPA 3PSFA 3UNGC 3LAJA 5J8FA 1XMAA 1VQNI 3CUQB 4OINF 1GV2A 1W7PA 1D1CA 2JVGA 3MZ8A 1RRJA 1ZLKA 4A3MJ 2MH2A 1Z6TA 4ZYEA 4PCQA 2XB0X 4DYCA 4H0EA 3K4LA 5M5WJ 3TDUC 4OAYA 2BW3B 1MKMA 4MGRA 1MJ9A 1Y6IA 1CF7A 2XAHA 1Z05A 3W2AA 4NUBA 2RC4A 4L9TA 1B8IA 3V8LA 4E7HA 4D9JA 5DEQA 2F2EA 4YG2F 4S04A 3ZPLA 4BE2A 3VOEA 2XF5A 1G4DA 3MEXA 5LFAA 1ZHFA 4CCMA 3HOYJ 1V5GA 3S3MA 4G7HF 3DTIA 5IP9J 3Q0WA 4CCOA 1I27A 1Z3XA 3CCVI 1TW3A 3V7SA 5D6FA 2QSGX 3RCOA 2KPMA 3K2ZA 2XROA 1W1WE 3IH3A 2LOOA 4MTDA 1OKRA 1HW1A 3BG5A 2O03A 1OYIA 3K10A 3REOA 1MMDA 1HW5A 3OOPA 3CDLA 1I39A 4BH9A 3I55I 4Y13A 2VKHA 4HSRA 1ZYRF 3RYPA 2Q2EA 5F1JA 4RAGA 5CPRB 3J80Z 4U7DA 2GOMA 2UXNA 1MBKA 5FRMA 1UJ8A 3ZMSA 2JA7J 2K9NA 4KMFA 1G2HA 3BR3A 3IH4A 3FMSA 3FMQA 3VDXA 2X6YA 4RB0A 1SD7A 3RPQA 2DOEA 2XPVA 4M3DA 3FKJA 3TL4X 4MO7A 3WG9A 3RYRA 2Z9OA 3CLQA 1YQAA 3DU5A 4WXCA 2G9WA 3QYEA 1D1AA 4JYKA 2DK8A 2MD0A 3BJAA 1YO5C 3HTUA 1BOBA 4G7ZF 5AIQA 3H5AA 4A3GJ 1ZGAA 3SQNA 4W97A 1ZAOA 2AHQA 4NC7A 2VQCA 2ELJA 2VXDA 4XKWA 4BHCA 3HOWJ 2CMPA 5F0CA 2EA4A 3OYBA 2O5RA 2M8GX 1ZK8A 1UB9A 2F4MB 2QSHX 3DEEA 3HOUJ 4IKFA 1Z6RA 2WV1A 2G7UA 1SVLA 2MA3A 4E7JA 2ZSHB 1LVAA 4HX4A 4XORA 3LQRA 2HZDA 1BIBA 1QNTA 2CQ7A 2EJRA 2EV0A 1T0FC 2XDVA 3T8TA 4A5MA 2X85A 2MBFA 1EV7A 4LLNA 4NB5A 4XL9A 2BGCA 1U6GA 4A6DA 3LAPA 1D0XA 4IRGA 3ZQGA 1WJCA 2DA1A 3AL0C 5CQEA 1NG6A 2QBYB 1FP2A 3EYIA 1QRYA 1ZRCA 4IHSA 1FWZA 2W82A 3H1CA 2X6WA 3W3CA 3WU1B 2L9NA 1W5TA 2ZSIB 2JVHA 4X0GA 1JGSA 2R5YA 3LSRA 3TW7A 3B02A 3H5NA 1FBSA 3TO6A 1ZREA 1FOYA 3E7LA 3QYBA 4A12A 4RB2C 2OU2A 1GLNA 3PFIA 5EZHA 1K78A 4KNYA 3GLXA 3E5UA 4LMYA 5FD5A 2MYSA 3S93A 3SFIA 1TC3C 1YX3A 2QQ9A 1OCTC 1U3EM 3MCZA 3OYDA 2VT2A 3DBLB 3FM5A 5JVTA 5J3LA 1XMXA 5KHDA 4K2EA 2VC0A 2E36A 2KIQA 4XK4A 1ULYA 1ZLJA 4BY1J 1O3SA 3LA7A 4RGRA 2HOSA 3BG7A 1QHHD 1X2NA 2Y30A 3GFJA 2ZJRF 2IS6A 2IP2A 1V5FA 3K4MA 4PSWA 5H6QA 3S1RJ 2QQBA 4B1RA 3I3LA 3ONQA 4R1HA 4PGHA 1MNMC 1KA8A 3CCYA 3TOAA 1F9NA 1OYYA 4IX7A 1T2KA 2D1HA 4E7IA 1GXQA 5F6FA 1A6IA 4ESJA 3RZOJ 4A3JJ 1AHDP 3PUBA 5CVVA 1MBEA 4FE7A 2VODA 4C3HJ 1MMSA 2X51A 3GVAA 4EMSA 5B3SH 2Y31A 4B44A 2KIMA 2K4JA 2PI0A 1A36A 1K6YA 1YIJI 3ABUA 2GWRA 3BR5A 3RQ4A 3L00A 3H3VK 3FXKA 2DA3A 1TZLA 2Y9ZA 2PBIA 3GLLA 1MH3A 3F72A 1BW6A 2EB7A 3O6BB 3TO9A 4BU2A 1MMGA 3RSNA 2XKPA 1MJAA 1E3HA 1NK2P 2Q1ZB 4Y15A 4OIOF 4IHWA 1Z7UA 2ZJPF 4CCNA 4ITVA 1O7LA 4N9IA 3S32A 1U5TA 3KEYA 4CGZA 1QPIA 3JCUC 4BAYA 3CJTB 5LEJA 2JZYA 2K85A 4QPQA 3UR3C 2R7SA 3WE2A 2DN0A 2V9KA 1OJLA 2LR8A 3CMMA 4ENJA 1QO0D 4PUSA 1FX7A 1BOAA 3RZDJ 3C2GA 4U0WA 4ZYHA 4UHTA 2GAUA 2M5WA 4GGGA 4PFPA 5L3BA 1A6QA 2JN6A 1JKOC 3Q9VA 3T5XA 1QVTA 2ZJQF 2JSPA 2RAEA 4UB6C 4CA0A 3HOXJ 4BJTA 4BUPA 3PO2J 4D7MA 2QYOA 3BTLA 3P7NA 3GYHX 3NWTA 4DJAA 2BOLA 2DJIA 4HSTA 3HUGB 1IRXA 1BA5A 2ZXJA 3WG7H 4BQQA 4YFKF 4OIPF 3HOZJ 1YHQI 1Y8RB 3HKZA 3QPTA 1G3TA 1OCOH 3BR0A 4MHGA 3DF8A 4NQWB 4J00A 2MLKA 3LFUA 4GXOA 5IYCJ 1T39A 3BTJA 3A01A 3FDYA 3KEOA 4UY8I 2OC6A 5JHFA 3CDIA 4F92B 1SAXA 2HTJA 2X0LA 2HZTA 1IXSB 4A3EJ 3F8NA 1D5YA 3Q0UA 1QPMA 4PJ0C 2K02A 5FGMA 3DTKA 1YS7A 3EYYA 2ZMEA 4BEHA 1V3FA 2DJNA 2NAZA 1EA3A 4UUTA 3M9AA 3U9GA 2HR3A 4C2UA 1FTZA 5TJJA 4B3AA 1I3QJ 2FNPA 3OYJA 4A0XA 2W1OA 4I98B 1G6NA 3DPUA 1PUFA 5JLXA 3HOVJ 1JHFA 1WJBA 2Y69H 5DM7F 5EG0B 1WFXA 5CYVA 1S72I 4LFUA 3GFLA 5H2FC 4EVIA 4HYEA 1W36D 4F52A 3CESA 2RN7A 1O7FA 1D1BA 4DQ2A 3QPHA 2P5KA 1VQ5I 2VBWA 5J8CA 1LDKB 2HDCA 3CZ6A 4G12A 2Y0MA 4YIIA 1CGPA 5EGOB 2DAOA 3WTYC 2RNJA 3ZOBA 4Z2YA 1DPRA 5DD4A 1DU0A 3GMEA 3A2KA 1LE8A 2W24A 1FZPB 4B47A 2P5LC 4MFDA 5F0FA 2VN2A 2B7EA 2NNNA 2IEKA 1TWAJ 1WJDA 3DBHB 3H9JA 3DV8A 1FBQA 5DD8A 2JK3A 2E2IJ 2DBBA 3FBNB 4ESFA 2W00A 3HTSB 5A2QZ 4XN3A 3TGNA 4UUVA 4XLFA 4YFXF 4PFOA 4M6YA 5F08A 3WTVC 3E5QA 3CP8A 2PMZA 4JBAA 1SEUA 3LWFA 2PMHA 1UZCA 3VODA 2LP0A 2NVTJ 2OAZA 4GCVA 2XIGA 1XN7A 3HG9A 2Z1DA 3H3ZA 1IF1A 4EJOA 1BL0A 2FUG2 1I3AA 1IN7A 3HOSA 1D3YA 3BROA 2CQNA 2LYCA 1ZARA 3JRCA 3J81K 2FQ4A 4KISA 1X3WB 2RGVA 4WF2A 3ZXSA 2JA6J 3F22A 3D5SC 5F64A 4QWQA 1YG2A 1E2XA 5E1WA 2CUZA 4IVNA 5M3MJ 3GTLJ 5J1YA 3TEDA 4HAMA 1IW7F 1S9HA 1FYMA 3H92A 3E6BA 1XC5A 1BR2A 1VF9A 5EYRA 4II2A 1J09A 3G3ZA 3EUAA 2NYXA 3A03A 3OYHA 1QVUA 2P4WA 4DZPA 1UFMA 4LOCA 4MEXF 5B1BH 3OIQA 4OIRF 5IT3A 1B1BA 2FX0A 3F3XA 1F1ZA 3JRFA 2COBA 4BQNA 3PM1A 4L9JA 3SDGA 1HCRA 3A02A 1JT0A 1B6AA 4MTEA 3RPUA 3IH2A 3PIPF 2ZCWA 3DLAA 3BG6A 3L2RA 2VIXA 2VQHA 3HM5A 2DFHA 4HPQA 1H0MA 1WCMJ 1ZG1A 5BS6A 2F5CA 1FEXA 1XX5A 2HGCA 2CWEA 5C44J 5E3MA 1B9MA 4M3BA 5CVIA 3F6VA 3ZP5A 3S3NA 2DMUA 3U2RA 4JK1X 5BOXA 1X2MA 3ZMTA 2V6CA 2LREA 3K70D 5E3OA 2W57A 3BCAA 2B0LA 3HHHA 2VXZA 1S3JA 3BR1A 1SFXA 2HS5A 1Y1WJ 4PJJA 5D4RA 3V7RA 4MQ9F 5M5YJ 4XKVA 4AUXA 4HA8A 3CQZJ 2ZXHA 2HDWA 4OMZA 2IS4A 2GA2A 3NWSA 5HDNA 3KP5A 5TISC 1CQTA 3BLYA 5J40A 2ZJ2A 4FCYA 1FP1D 2R0QC 1WQ2A 5IT9K 2FXAA 1ZGWA 3U1KA 5E8IA 3ERED 4AIHA 1GXPA 3FISA 3AFHA 5ED4A 2DXIA 2OTJI 2AQFA 2P7VB 3BZ6A 1P9QC 3A1YA 3KP2A 4G94A 1QZEA 1GUUA 3ZGKA 3HPGA 4QTRA 3BJ6A 3E6MA 2RV8A 2HVQA 5CJ9A 3LQQA 2EH3A 4RAFA 1MNDA 4EJTA 4CZZA 3GX4X 5FKLA 3TW6A 3PQKA 4IEJA 1OQYA 3GZNB 5C3EJ 2F48A 1HLVA 1JKQC 1WVRA 2Y75A 4FE4A 2LG4A 3BC8A 3GTKJ 4XRFA 1ON1A 4D5FA 3OYCA 2VPLA 1U5TC 1T56A 5DCMA 1MD0A 4PGGA 4BQAA 4U0YA 1LEBA 2PN6A 1X1AA 3HSEA 3PNYA 1VQPI 2X6XA 2L9VA 4II3A 3CJRB 2MABA 1VQ4I 4XLPF 1X3ZB 4FTHA 3QU3A 1MDMA 1E3PA 3RKQA 4M9XA 4WWCA 5IP6A 3BQZA 1L0OC 4XKBA 4N4NB 3CCRI 1WH7A 2MFZA 2K9QA 2Z2SB 2QCOA 2IA0A 5HLTA 1X19A 3PIOF 4PJNA 5HVQC 4L5IA 2DYSH 4XOPA 5JI6A 1LEAA 4XRSA 3CO7C 1R4MB 4BNCA 3ISPA 2XSDC 1JHHA 2WY7Q 1MBFA 3F8BA 4XRSG 1KZHA 1FBUA 4N9HA 4I2OA 2K5CA 4YELA 2UZKA 4BE1A 2PX9A 2IRFG 4NC8A 1MNEA 4ASNA 1DU6A 3KETA 3QYFA 3Q3SA 4D0PA 4AYBN 3HGYA 1H88C 2X1EA 4C30A 3KZIC 3ZQHA 1VQLI 1HBXG 2BE5F 4CO8A 3VYSB 4OU0A 4DGWB 6PAXA 3S1NJ 1O57A 2LBFA 1K83J 2VB6A 2PMZN 3K0LA 4IHVA 4S05A 1J59A 1P7IA 3BT9A 1V55H 2E7XA 3EUKL 3I58A 4HNVA 3HOTA 1ETOA 3JAMK 1OLTA 4HW0A 4A93J 2FE3A 1VQ8I 4XM3A 3ABTA 2EFQA 4HX7A 1HW2A 2QZ8A 4CYCA 2VASA 1FT9A 2RDPA 2FOWA 4Y7NJ 2R5ZA 2BXZA 2ZNZA 3R60A 3JRAA 3CTAA 4EM0B 1KU9A 1JE8A 3IRRA 1XB4A 2KIUA 1IGNA 1IV8A 3FXLA 2C6YA 3FIWA 3LSTA 2LRDA 2E5ZA 2VLAA 2JMWA 1D8KA 2H1LA 3HEFA 4Z6YA 2DOAA 3CP2A 2QGUA 2OA4A 1KGSA 2XF7A 3I4PA 2HQRA 3A4CA 5E17F 3CC2I 3S2WA 3L09A 1WRJA 1X58A 4ZJZA 3H9GA 1U9OA 2ZXWH 2LTPA 3Q0VA 1ETQA 1FYLA 4M73A 2E5NA 1KU3A 3GTJJ 3E6DA 3TQNA 2JWTA 3Q5FA 1FPQA 1ZG3A 1D8JA 1K4SA 5GAHJ 2ISZA 1E3OC 4KYWA 1T95A 2FRHA 1SAUA 4L0ZB 1L3LA 1BI1A 1W7PB 1XSVA 1Y39A 1OMIA 3CJQB 5IOYA 1IJWC 1Z3YA 4CYDA 3G4SI 2HVSA 4HEA2 4CICA 2VKVA 1IG7A 1FJLA 4RGUA 5KVRA 2ME0A 1CF7B 1IV6A 4AC0A 1JTYA 1Y0NA 1B8IB 1XGNA 2R7VA 4QIWN 3G73A 1Z0XA 3IP4B 2WADA 1BI3A 2EINH 1OCPA 1ODDA 5HNFA 5FRNA 1UHWA 5LEKA 5DM6F 5FFXA 2Y2ZA 2BY1A 3CUQA 2Q8KA 1POGA 5HS9A 1MZBA 2HPIA 3SYTA 4EJVA 2Z3YA 2WBMA 3FBIB 2NVXJ 5L3CA 3H0GJ 3OYFA 3WE3A 2BW3A 3GFIA 3O2PE 3J7YJ 1MSFC 4C2TA 2IGOA 3BZCA 2W25A 3K4KA 5D5UB 5CVUA 1KQ8A 1YTYA 3MKZA 4P9UA 4HOBA 5KAFC 2Q2EB 1P4WA 4HV6A 1K79A 2W84A 5B1AH 2F5DA 4IHXA 3K4CA 1BBYA 3JSPA 3MD2A 1O3RA 5KK1A 2BV6A 3OOUA 4A3IJ 1BC8C 3OV8A 5E3NA 3W2WA 5HS8A 2E71A 5CVJA 1TLHB 2QSFX 2XAGA 2NS0A 2UV1A 2XGCA 4I0AA 3OS1A 2XKOA 1ZQ3P 3BPVA 4E6KG 1MBJA 2E1NA 2G0EA 2HKOA 3L7WA 1HQCA 2O7OA 2R7OA 1YW7A 2VL8A 1R5GA 4OIQF 5CVRA 4A3FJ 3V7CA 1B72A 2DA4A 5ILSA 5HOOA 5J47A 2L5QA 4AVZA 3SHFA 4D5CA 2ACJA 2HXIA 3LA2A 1IUFA 2M0CA 3F8CA 4UXNA 2KHMA 2R7DA 3MQ0A 5HLIA 2UWMA 4IZZA 2OQGA 5LRRA 2H6CA 2HYGD 3LOCA 1LB2A 3FWEA 1ZTRA 2KKOA 2NS8A 2H6BA 2DO7A 3ZN0A 1ZR4A 1ACIA 3DKYA 3GW2A 1I1GA 1TNTA 2ZB9A 2EWNA 3RJPA 3DKXA 2EZLA 1R49A 3GUDA 2CW0F 3TKYA 4RGSA 5D5VB 4BJ6C 3C2HA 1SFEA 2CO5A 3W2VA 4WX9A 1HDDC 1A5JA 3WTUC 2E60A 4HBLA 2DT6A 4D1QA 1SFOJ 2R5YB 3OS2A 3DEWA 3G2BA 2OZUA 3M8EA 4LIUA 2OBPA 3FM3A 1ZR2A 3FXUA 2IA1A 2P0WA 4FASD 1P92A 2YSRA 3PFYA 4LG0A 4DW6A 3CO6C 3BWGA 3OYKA 1XDSA 2X48A 4ON0A 2DFIA 2G7HA 2IS2A 2P6TA 3O8HA 2DK5A 1HF0A 2M9HA 4LGWA 1XDUA 4FISA 3B6AA 5FD6A 3L1PA 2K4BA 4BQOA 1Z21A 1H8AC 1BIAA 1KYZA 3FMRA 3CC4I 5H6RA 3FXQA 4E7SA 1RUOA 1N75A 1TWFJ 3T0YA 3V8KA 1IXCA 3IL2A 1XGMA 2W85A 1RIOH 3U1DA 4C3JJ 2I5UA 3HC7A 2DMTA 3CCLI 3DU6A 3BPXA 2NXNB 3EETA 2DPUA 1UMQA 3E6CC 4JQFA 3CC7I 4U7BA 3MZYA 1MMAA 3TP0A 5L3DA 5KCMA 5IYBJ 2KL4A 4C2MJ 1RPWA 2DODA 4HNTA 1HKTA 2D5VA 3VSKA 2XRLA 1VQKI 5K5OA 5BMZA 3MWMA 1MBGA 2YUSA 1ZH5A 2R92J 1ONVA 1VTNC 3N4MA 1G3YA 1FOWA 3RKWA 4B4CA 2GOXB 5LBQA 3D5RC 4U88A 4DBQA 1HSJA 2TDXA 2M4KA 3F9KA 4GYIA 4XSZF 4FHTA 2XAQA 2AXTC 1AWCA 4NC6A 5FLXZ 3ZMUA 3HRUA 2QEXI 2L4AA 3OYGA 2K9SA 5D4SA 1R22A 4IHTA 2LVSA 2KQRA 4RAYA 4J19A 1DPUA 2DA5A 2RNGA 3PNTA 3GTQJ 2MLGA 1JUMA 1JUPA 2H09A 2ELHA 3NAUA 1DQUA 3I4NJ 3TMOA 4IOAF 4IRHA 3NQOA 4KA4A 3SZPA 3ZMZA 5FB2A 1U5TB 5D5XB 3QP5A 5K7FA 3KIOA 4ENKA 1AU7A 3CCUI 3OL4A 2Q0OA 4ETSA 3P9KA 2XPWA 1UG2A 2GXGA 3HJEA 1TWHJ 1BJAA 4HV5A 4HDVA 1HXDA 3K1NA 4Y33A 3H36A 5JR3A 1XCBA 3KZZA 1X1PA 2HQNA 4LLLA 5C4JJ 1ZGJA 3R0JA 4M3FA 2EZIA 5FLVA 4KIFA 4KIGA 2K86A 1WHUA 4CZCA 1EKEA 4A2UA 3LNQA 1KU7A 3M1CA 3V4GA 1X1DA 2IPQX 2EZKA 1PP8F 4UUSB 1R58A 1WJAA 2ECBA 2L54A 1FSEA 2NRAC 3I54A 3IAS2 3GTGJ 3OYNA 2CV0A 3A01B 2A3SA 4GO1A 1IO2A 4PSXA 4YFNF 4RDUA 3X2QH 2RQPA 4KMUX 2DCEA 2WA0A 3M8JA 2DA6A 3KE2A 3O3KA 3BTCA 2BY2A 3E5XA 3HRSA 2FNAA 4BEHB 2LSOA 3JR9A 1BJZA 1RUNA 5LGTA 1IXRC 2HYFA 3DPLC 3QOPA 1YJWI 3AG2H 1T33A 5FFZA 2HOAA 2E34A 2LLKA 4IQ4A 2WWYA 1WJFA 2GXBA 2EPFA 1K7AA 3RTRA 4NQWA 1PUFB 3J80K 5F1RA 4RLFA 5GAEJ 5E18F 1OCZH 2IXSA 2EIJH 3D0SA 1U8BA 2RKHA 2ZXIA 1T6SA 3FHNA 1W0TA 1WJEA 3BDDA 2VJIA 4H4KC 1YRNA 1MIJA 2ETHA 2HTSA 2DT7B 4UVAA 3WHBA 1YJ9I 3KYCB 3QPLA 3QPSA 4EGYA 2V7FA 5EZGA 2HOEA 2NOJB 4TV7A 3L2QA 4CCKA 2XPUA 1LE8B 2V9VA 1IN8A 3ABKH 1UCRA 3S8PA 4ZZLA 5DUIA 4S0HB 1R1UA 4E7ZA 3CMEI 2K7LA 2IGMA 2FJ1A 4B43A 1T98A 2PFBA 2R7FA 2QENA 3ABMH 4AYBA 5C4XJ 2HVRA 3OSGA 1Z1DA 3I5UA 3KLOA 3E1SA 3E0JB 3BG3A 3M8FA 4IO9F 1U2WA 4G6TB 3JW4A 1O3TA 1SD5A 1AKHA 2O0YA 5IPAA 1B59A 2F5VA 2MD5A 3CCMI 1Z7LA 1OISA 5LHHA 1RNLA 1K6OA 2K9LA 1BN5A 4P9FA 2V1UA 1ETXA 2LKXA 1FIAA 4ZC3A 1QZZA 5J4YA 1YW9A 3T8RA 5LHGA 2PQ8A 4A3LJ 2XAUA 1TP4A 5EEGA 2KT0A 2VBYA 1MMNA 3ROUA 3CJNA 1V5EA 4F3QA 1MW7A 1VFCA 4G9YA 1YJNI 4ZDOA 1T08B 3FXJA 4RA2A 1ETKA 2MW8A 2L9RA 3BY6A 2V4JC 4AIKA 2VPRA 2X1CA 2ZKZA 1D5VA 4Q4ZF 3HBLA 1TWCJ 1YLFA 3KEQA 4LIVA 2UUZA 2VQGA 5DYMA 2H94A 3J7AY 2JUCA 4JX5A 1PUEE 5KAIC 4X1EA 2LFBA 5HDKA 2VKDA 2Y0SN 3BP8A 4IHYA 1EH8A 4A69C 1IDZA 4NDLA 4BE0A 1RR8C 1G3WA 4R79A 1R1TA 5TGTA 4I76A 4ENNA 4HF0A 5DTDA 4NHJA 2AXLA 2STTA 3F8MA 2WB1N 2J5PA 2E7WA 1AA7A 1O3QA 2A5YB 4JP0A 1HKQA 1ENHA 1S29A 5FROA 2N8GA 3S2HJ 3JRDA 3WODF 1MH4A 1TNSA 5IY5H 3G6EI 4O5VA 4A6EA 2LY1A 2CGPA 2PJRA 5DUKA 3KLNA 3I59A 1I5ZA 2HQ5A 1LVKA 2LY2A 3GO5A 3ZR8X 2X6OA 1IUYA 3OY9A 4YIFA 4V2FA 4G6DA 3ECOA 5E1XA 3CCEI 3K1MA 4JX4A 3I53A 2VE9A 2O3FA 4EATA 4HQMA 3KP4A 3LSHA 3TDZC 4XONA 3F8FA 4BDZA 5ICFA 2TRTA 1N78A 2IJLA 3FK6A 1WGXA 2FF4A 2NVQJ 4OWRB 4IF4A 1FNNA 2OD5A 4HNUA 2IS1A 4M9SA 1YIOA 2P6SA 3WGGA 1IRGA 1JT6A 1Y56A 3DCFA 2L01A 4XNFA 5K1YA 1B4AA 3ZMVA 3IV5A 3HIFA 3OIPA 4RS8A 3N05A 1ETWA 2XSJC 5HDGA 3EDPA 3DBRB 1ETYA 1QU3A 2NNYA 2AQEA 2KZGA 2W4SA 3S2DJ 3QP6A 3H3UA 2EFWA 1EH6A 1SFKA 2DTZA 2OUMA 1DP7P 2E1OA 3ZQCA 4ANJA 4XOTA 2R7TA 5J4VA 3LSPA 2EV5A 1Y1VJ 4M3GA 2QA4I 2EZHA 5K5RA 2EFOA 1B9NA 4C9YA 3GTMJ 2R7ZJ 3R4KA 1PP7U 4OOIA 5DCMB 4ZDPA 2GLOA 2R3SA 3I64A 4WXHA 2YS9A 3VYTB 4O3MA 2JA2A 4RBOA 1FTTA 1LFPA 1FSHA 2BZTA 5ILVA 1LFUP 2FA5A 2QUFA 3K2AA 1LDDA 3C18A 2FQ3A 1REPC 3MFKA 1NHAA 1BI0A 3HZJA 3S16J 1TWGJ 4RM3A 3C7JA 1OFCX 1PJRA 3HSRA 2V1XA 2Z99A 2KDOA 1LQ1A 2V9PA 4XLCA 1KYWA 2LC2A 1GVJA 2O6GE 1XSXA 2XB5A 5B66C 2F6CA 4PJMA 1OYWA 2R7XA 1OCRH 2DMQA 2P7CB 1Z77A 4F91B 4XLAA 2ID6A 4CCJA 3HRMA 4M6VA 3CMAI 3S3OA 2L02A 3UKGA 2M8EA 2EILH 1DGRM 3SZGA 1XS9A 3I0TA 2ZBKA 1PDNC 3ECHA 1GHCA 4FX0A 1RI7A 2LBFB 4I99C 5HS7A 3ZCOA 2OCCH 2XAFA 3CD6I 4BXXJ 3W6VA 2O61A 5AIPA 4ABZA 2CUFA 5LGNA 1XSDA 2CYYA 4MLOA 1IC8A 3A0BC 4HF1A 1VQ7I 3ERMA 2VT3A 3ZQQA 1S5LC 4A5NA 2B9SA 1RKTA 2ZMEC 4L18B 3PNVA 3WHCA 2JA8J 1XMKA 4BBSJ 2MSYA 3JRIA 4CYCB 4E7LA 1RESA 1SD4A 1TTYA 4PZJA 1W7PD 2OV7A 1QBJA 2OCEA 3PJRA 2R5ZB 1Y8QB 3HHGA 4I7HA 4Y4RA 5GPCA 4BYYA 3VFZA 1X3UA 2JPCA 4JX6A 5E8GA 2STWA 3ASOH 3JTHA 3D1NI 1LJ9A 3W6KB 2O8XA 2M2EA 2GQQA 3QRFF 1P6RA 4BS9A 3G1LA 3H9QA 1JGGA 4IPAA 2BYVE 2QWWA 2A69F 3QQAA 4J01A 4HZFA 2JA5J 2WAQN 1DP3A 4I0BA 4KJZA 2FOKA 4BACA 2Z5UA 1ZELA 5A2QK 3FX3A 4XIDA 1TT0A 5K7ZA 2L7KA 3HRTA 3GWZA 2F5EA 2JJ7A 3EUHA 3GZ6A 1XD7A 3V8JA 1STZA 1W5SA 4CH7A 1R6RA 2P8TA 2M4GA 2MGQA 2VBZA 1VI0A 2Z16A 2HFHA 5M5XJ 3WU2C 2KJBA 2LNBA 4AD9A 3RKYA 1WSUA 2CFXA 5K7HA 2BBYA 2YPRA 2XC7A 2VONA 3ESWB 1XPXA 1TQIA 4MNUA 4Y3OA 3VSLA 2R93J 2OJED 2DYRH 3G71I 2LK2A 3SZTA 3VYUB 4AM3A 4RGXA 1RKWA 4DYQA 2P81A 5BPIA 2QVOA 4U0VA 5F0HA 5E1ZB 1MJBA 2ZFWA 4XRMA 3K4JA 3LA3A 3W6JB 3F21A 3WGIA 5HODA 2GXAA 5GPAA 4F7ZA 2B63J 1WPKA 1S8NA 3LSIA 5GADJ 1LPQA 4PK4A 1YI2I 3CDHA 4P55A 3LL7A 4EQQA 3S15J 2LF8A 1XTAA 4I09A 2VOOA 2PJPA 1IRFA 4HDUA 1YW8A 2CG4A 4MEYF 2DLLA 3KYLA 1HKSA 3LSJA 3KPHA 1HSTA 3J7AO 2LF7A 4AU7A 2VE8A 2KJCA 3DEUA 4NBQA 3KYDB 1W36C 1EJ9A 1V54H 3KP6A 3L9FA 1VZ0A 3BOQA 2JTVA 1A35A 1YX5A 1APLC 4MIMA 1VQ9I 2L7MP 2J5OA 4LK0F 1X4OA 3COAC 5D5WB 2HQAA 4EJWA 2FSWA 1UELB 4UVBA 3BCBA 5FKKA 3S1MJ 5KNLA 4XLEA 2IA2A 3IRQA 1TQPA 2CW7A 1TL8A 2EFNA 2E1MB 1Z9CA 1LFBA 5E3LA 1XGOA 2Y9YA 4B3XA 2F4IA 2DFEA 2E19A 3BZKA 3HSFA 3MKLA 1F36A 5CKTA 3BG9A 5GTHC 4CDGA 1UAAA 2M3AA 1O4XA 2BHYA 1OR7A 1G3SA 2L2OA 3OYIA 3DFGA 2EV6A 4M3EA 2EQRA 3TO7A 3KX2A 3RDIA 1JXSA 3E97A 1B72B 1NK3P 2NS7A 3HPHA 1J7KA 2I10A 4IRIA 5DCFA 1YITI 4LD5A 4L9VA 3GXOA 4E4HA 3WTXC 1J0RA 3SDBA 1P2FA 4XMYA 1XCVA 1RZ4A 4Q48A 2KRHA 2BXYA 1R4NB 2OTLI 2FD5A 2BHZA 3ML6A 2FU4A 1MSEC 3R61A 4HF2A 2M34A 3R6SA 3F23A 3M7GA 3H0DA 3ASNH 4P1WA 1HA8A 3KP3A 3JREA 2M7BA 1SVMA 1PYVA 1VNDA 3BR6A 5EEAA 3KFWX 3QWLA 1UHMA 2FMLA 4KUMA 3GTOJ 1FIPA 2CU7A 1A04A 4RB1A 3BTIA 1GDTA 1Z91A 2A6HF 2CUJA 3D5LA 4B8XA 3FXOA 4WK8F 2O9LA 2WAFA 1R7JA 5D8KB 4UNOA 3CUOA 3DKWA 3GZ5A 1OCCH 4CSWA 1IN5A 2DU9A 1HOMA 1X1BA 2HNHA 4Q47A 1YOVB 3IWFA 3K9TA 1V4RA 5FLMJ 2HPMA 2GIVA 4LG0B 1K78B 5HNHA 3IC7A 1QQIA 1WWXA 1BI2A 2IVMA 3EPZA 2KP6A 1IN6A 5J6XA 4DBRA 2R4GA 2M30A 4EV0A 4E70A 3M3YJ 1QGPA 3DPTA 3NEUA 5L3EA 4IQJA 2UXXA 1FMVA 3J81Z 5L3FA 2D2WA 3OIOA 3K70C 1HC8A 3HXLA 2QBYA 2V79A 2PLYA 3U21A 2JT1A 5IOZA 3FHZA 2VOPA 5FKMA 3QU6A 4M6XA 2A05A 4CUGA 4ZYDA 4BXFA 3E3VA 1BW5A 4GDFA 4AWXB 4B48A 5F27A 4DOZA 3ELKA 5DS9A 1EH7A 5E79C 4G7OF 2ZC2A 2VKEA 2AS5F 5ILUA 5BPDA 2M1BA 2E1CA 4YRVA 1WI3A 4HX8A 3LSKA 4EEFG 1S6LA 1ETVA 2HI3A 1I6XA 3DP7A 5CQGA 3G1MA 4LITA 2BVLA 4A3BJ 3CCSI 3MAJA 3AG3H 5H20A 2YU9J 3B6CA 3QODA 4DNCA 4KT5C 5LHIA 3JRBA 4W1UA 5F04A 2DOFA 3BQYA 2Y0SA 3KCCA 5GTIC 5K5QA 2MH9A 4D7NA 3IKTA 4O6JA 4V19K 2HOTA 4L5JA 3K4NA 2YX4A 2W48A 1FOKA 2L3DA 3S1QJ 2JSCA 2VI6A 3K6GA 3I9V2 2WB1A 3MKYB 3HL2A 2VJJA 1JJ8C 4ESBA 3FF5A 3Q9SA 2K40A 2XVCA 4GRIA 2WV0A 1USSA 4UV9A 3M4OJ 1VQOI 3JRHA 4HLYA 2D45A 3T1BA 3GFMA 5GAGJ 3JRGA 5BNGA 4IL6C 3AG4H 2JPBA 2QF7A 3VYRB 5IT9Z 4I01A 2K9MA 2VQLA 1IZ1A 3OSFA 4KIBA 3RQIA 2FBIA 1QA6A 3PO3J 3L2WA 1ZRDA 2DPDA 2ECCA 4F55A 1XGSA 5ICGA 3G1OA 4G8XA 4DIQA 2GM4A 1LDJA 2XGDA 2QLZA 2JRMA 3EUHC 2ID3A 1U8RA 1BC7C 2FEZA 2DT5A 2DQLA 3ZQFA 4BHPA 4BJ5C 3OMYA 3GTPJ 2X1DA 2QM3A 3OL3A 1JKPC 5B5EC 2DDBA 4LG3A 4N0BA 2KFDA 4CHUA 5IP7J 3P9CA 1Q1HA 1Z67A 1W5CC 2DDAA 1J5YA 1FC3A 5IYDJ 3RI4A 1S7AA 3FKIJ 1C0WA 3J7ZI 2KLOA 2DQRA 4LLGF 2IT0A 2KRCA 2CUEA 4XICA 2DMNA 4UV8A 3FZVA 3S14J 3TBIA 5CLSA 1GT0C 4XSXF 5DV5A 3SJMA 2M87A 4RMNA 3VPRA 2QQAA 2ZMEB 3FXMA 3SEZA 4ZTFA 2LKPA 5LRSA 1JUSA 1FY7A 3HUGA 3IKVA 3CUQC 3ZQIA 4JOMA 1SVOA 4UUSA 5GP9A 4RAZA 4EM2A 3VWBA 1G8XA 2R7RA 3WGHA 2L0KA 2BY3A 2MC3A 4B09A 4N4OB 5ICCA 4BXUA 1FYKA 5JLWA 2LH9A 3K1PA 2L9SA 1R5HA 4ZTJA 1F4KA 2CW8A 3IAM2 3SEQA 1IAWA 2CQKA 1YRNB 1R36A 3P5JA 4F93B 3VEPA 3CF5F 1N77A 2K27A 2QKLB 1FMWA 1T8IA 1BR1A 3N97A 3PQJA 5EF6A 1ERDA 3PUFA 2HXOA 1ITYA 1AOYA 2WC2A 2LD5A 2CFOA 1U9NA 1UHSA 2E1MC 2LDUA 5LLQA 2L7FP 1IDYA 1KQ9A 5EG0A 3JAMZ 2K3PA 1NTCA 4M72A 2E2JJ 4WXDA 2OF7A 1QHGA 1OR7C 2VC1A 3PL8A 3ULQB 5M3FJ 4X6AJ 2F4OB 2LKSA 3I71A 2ESHA 3ABLH 4CXFA 2V6EA 2XGEA 2ICWG 4P96A 3WU0A 4XQFA 3AKZA 1AKHB 2DA2A 3TP3A 3RPUD 2CV2A 2JRTA 4FQGA 2E35A 5EJCA 4UB8C 4YIRX 3S17J 2PEXA 5EGOA 4XN0A 4GYGA 5HLHA 4RM2A 2DTRA 4OAZA 1TQMA 3LSMA 4C3IJ 3HB9A 1LNWA 2E2HJ 1OPCA 1P4XA 4L9NA 5J1UA 1PVEA 5E20A 4P5OA 2WTEA 1BR4A 2KRFA 2H8RA 1JKRC 5ICEA 2PJRB 2MG4A 3HGGA 3QAHA 2KISA 9ANTA 1X4PA 5FJ8J 2KMUA 1RETA 2ZNYA 1J75A 2H1KA 5TRDA 1IN4A 2M45A 4KDPA 2A5WA 4I02A 2HU9A 5ERIA 3MVPA 2XRNA 1ZN2A 2XF6A 2KDZA 1F5TA 2WAQA 2XV4S 2YX7A 2CSOA 1YS6A 1G59A 4OMYA 3JTGA 1KONA 5J1RA 3B73A 4XBFA 2A07F 2FMYA 1N25A 3OWTA 4ZH4F 1VQMI 4Y52J 4HQEA 4NNJA 4EGZA 4A0ZA 4WCGA 2IGNA 2ELKA 1M1EB 4KITB 4IJAA 3L2UA 2CQQA 2FBHA 3V42A 2A68F 1YE9A 3K7AJ 2RQQA 1SC7A 3OR1C 3IHUA 1I50J 2RREA 1TT5B 3OYEA 2NVUB 4BBRJ 3WTTC 1P4AA 1P7JA 4FETA 1U78A 3DWLE 1MBHA 3I59B 1D0YA 2X4HA 3C1DA 1R00A 5EDNA 3GF2A 2HEOA 3H5RA 2GIZA 2YU3A 3F0CA 2ME6A 4BHBA 3NRVA 5HLGA 1J9IA 1ZRFA 3O8GA 5AONA 2L7ZA 2VJ5A 3OYAA
chains in the Genus database with same CATH topology
1W4MA 2COMA 2RVCA 3F6OA 2XHKA 5D8LB 2Y48A 2FBKA 5FLXK 2ESNA 1YFHA 5FO5A 1DUXC 3JSOA 4PDKA 4KFCA 2DI3A 4EJUA 1FLIA 3C3WA 1Y0UA 1TBXA 4HLXA 3L2CA 2EFPA 2EK5A 4L0YB 4FX4A 2A6EF 2VBXA 1SMYF 4UVCA 3GEZA 5JHUA 3R0AA 2GA1A 3WTSC 4ENMA 1R1VA 4AIJA 3IWZA 3MZHA 5D6EA 4Y17A 1T0FA 4M74A 5EEHA 3M1EA 3SFZA 3P9IA 4EM1A 1KQ0A 4RB3C 3RKXA 4ZZDA 1R23A 3BJOA 1MDMB 2GZWA 1KU2A 5DDGA 3RIRA 2XUBA 2ZO4A 1YYVA 4LB6B 2ADUA 1H9TA 1S7OA 3ZMDA 3CLOA 4LB5A 4QLCU 5L3GA 2YR2A 4KICA 2V1DA 1MGTA 3HYIA 2OZ6A 4FT8A 1T38A 1QZYA 2L4MA 2HWVA 2PMUA 3KP7A 3DQVC 2EA2A 2BEOA 2Z33A 4Q5SF 3EQLF 3LFKA 3ZQ7A 1DDNA 1WKMA 1USTA 3DXJF 4LJZF 3WTWC 1ZG5A 1J2XA 2PG4A 2IW5A 1ON2A 2F5FA 4AVPA 2A61A 2DW4A 2ISYA 2XASA 3SXYA 1H9GA 4MQVA 4KN7X 1WI9A 2P5VA 4XLNF 2KIFA 3ZN1A 1I1SA 1SD6A 2XGXA 4A0YA 2XAJA 3K69A 1TW2A 4KN4X 4M71A 3AAFA 3FXRA 1SFUA 5LGUA 2D1VA 5BQTA 2HKXA 4G6QA 4ZYGA 3WTZA 3VB2A 4LK1F 2OQRA 4M9ZA 1BM9A 5JFRA 4R8HA 3KZYA 3TOBA 4IXAA 1E17A 1SMTA 2H27A 3LAJA 5J8FA 1XMAA 3CUQB 4OINF 1ZLKA 1W7PA 2MH2A 1Z6TA 4ZYEA 4PCQA 4H0EA 3TDUC 1MKMA 4MGRA 1MJ9A 1CF7A 2XAHA 1Z05A 2RC4A 4L9TA 3V8LA 5DEQA 2F2EA 4YG2F 4S04A 3ZPLA 3VOEA 1G4DA 3MEXA 1ZHFA 4G7HF 1I27A 1TW3A 3V7SA 5D6FA 3K2ZA 2XROA 4MTDA 1OKRA 1HW1A 2O03A 1OYIA 3REOA 1HW5A 3OOPA 4BH9A 4Y13A 1ZYRF 3RYPA 2Q2EA 4U7DA 3J80Z 2UXNA 3ZMSA 4KMFA 3FMSA 3FMQA 4RB0A 1SD7A 3RPQA 3WG9A 3RYRA 2Z9OA 1YQAA 4WXCA 2G9WA 2DK8A 3BJAA 1YO5C 3HTUA 4G7ZF 5AIQA 1ZGAA 3SQNA 1ZAOA 4BHCA 2EA4A 1UB9A 1Z6RA 2G7UA 2MA3A 1LVAA 4HX4A 3LQRA 1BIBA 1QNTA 2EJRA 2EV0A 3T8TA 4A5MA 2MBFA 1EV7A 4LLNA 4NB5A 2BGCA 1U6GA 4A6DA 3LAPA 4IRGA 2QBYB 1FP2A 3EYIA 4IHSA 1ZRCA 1FWZA 3WU1B 1W5TA 1JGSA 3B02A 3TO6A 1FBSA 1ZREA 4A12A 4RB2C 2OU2A 3PFIA 1K78A 4KNYA 3GLXA 3E5UA 4LMYA 5FD5A 2QQ9A 1U3EM 3MCZA 2VT2A 3FM5A 5JVTA 4K2EA 2VC0A 1ULYA 1ZLJA 1O3SA 3LA7A 4RGRA 3GFJA 2IP2A 5H6QA 2QQBA 4R1HA 4PGHA 1KA8A 3TOAA 1F9NA 1OYYA 1T2KA 2D1HA 1GXQA 5F6FA 4ESJA 5CVVA 2VODA 3GVAA 4EMSA 2KIMA 2K4JA 2PI0A 3ABUA 2GWRA 3L00A 2PBIA 3F72A 3O6BB 2EB7A 3TO9A 2XKPA 1MJAA 4Y15A 4OIOF 1Z7UA 1O7LA 4N9IA 1U5TA 4CGZA 4BAYA 5LEJA 2JZYA 3WE2A 4ENJA 1QO0D 1FX7A 1BOAA 4ZYHA 4U0WA 4UHTA 2GAUA 2M5WA 4GGGA 5L3BA 3Q9VA 3T5XA 2QYOA 3P7NA 3GYHX 2ZXJA 4YFKF 4OIPF 3QPTA 1G3TA 4MHGA 3DF8A 2MLKA 4GXOA 1T39A 3KEOA 1SAXA 2HTJA 2X0LA 2HZTA 1IXSB 3F8NA 1QPMA 5FGMA 2K02A 1YS7A 3EYYA 2ZMEA 1V3FA 2NAZA 3M9AA 3U9GA 2HR3A 5TJJA 2FNPA 4A0XA 4I98B 1G6NA 1JHFA 5CYVA 4LFUA 3GFLA 4EVIA 4HYEA 2RN7A 1O7FA 4DQ2A 3QPHA 2P5KA 2VBWA 5J8CA 1LDKB 2HDCA 2Y0MA 4YIIA 1CGPA 2DAOA 3WTYC 2RNJA 4Z2YA 1DPRA 5DD4A 2W24A 1FZPB 2P5LC 2VN2A 2NNNA 3DV8A 1FBQA 5DD8A 2DBBA 4ESFA 3HTSB 5A2QZ 3TGNA 4UUVA 4YFXF 4M6YA 3WTVC 3E5QA 4JBAA 3LWFA 2PMHA 3VODA 2OAZA 4GCVA 2XIGA 1XN7A 3H3ZA 1IF1A 4EJOA 1IN7A 3HOSA 1D3YA 3BROA 1ZARA 3J81K 2RGVA 4WF2A 3F22A 5F64A 4QWQA 1YG2A 1E2XA 5E1WA 4IVNA 4HAMA 1IW7F 1FYMA 3H92A 3E6BA 3G3ZA 2NYXA 2P4WA 1UFMA 4MEXF 4OIRF 5IT3A 1B1BA 3F3XA 1F1ZA 4L9JA 1B6AA 4MTEA 3RPUA 2ZCWA 1H0MA 1ZG1A 5BS6A 2F5CA 2HGCA 2CWEA 1B9MA 5CVIA 3F6VA 3ZP5A 3U2RA 4JK1X 5BOXA 3ZMTA 2V6CA 2W57A 2B0LA 3HHHA 2VXZA 1S3JA 1SFXA 2HS5A 5D4RA 3V7RA 4MQ9F 4HA8A 4OMZA 2GA2A 5HDNA 3KP5A 2ZJ2A 1FP1D 1WQ2A 5IT9K 2FXAA 5E8IA 3ERED 4AIHA 1GXPA 5ED4A 2P7VB 3BZ6A 4G94A 3KP2A 3BJ6A 3E6MA 2RV8A 5CJ9A 3LQQA 4EJTA 4CZZA 3GX4X 3PQKA 2Y75A 4XRFA 1ON1A 1U5TC 5DCMA 1MD0A 4PGGA 4BQAA 4U0YA 1LEBA 2PN6A 3HSEA 4XLPF 3QU3A 1MDMA 4M9XA 4WWCA 1L0OC 2IA0A 5HVQC 4L5IA 5JI6A 3CO7C 1LEAA 4BNCA 3ISPA 1JHHA 3F8BA 1FBUA 4N9HA 4I2OA 2UZKA 2IRFG 4ASNA 3KETA 4D0PA 1HBXG 2BE5F 4CO8A 4OU0A 6PAXA 1O57A 3K0LA 4S05A 1J59A 2E7XA 3I58A 3HOTA 3JAMK 4HW0A 2FE3A 3ABTA 2EFQA 4HX7A 1HW2A 2QZ8A 1FT9A 2RDPA 2ZNZA 3R60A 3CTAA 4EM0B 1KU9A 1JE8A 3IRRA 1XB4A 2KIUA 2C6YA 3LSTA 1D8KA 2OA4A 1KGSA 3I4PA 2HQRA 5E17F 3S2WA 3L09A 1WRJA 1FYLA 4M73A 1KU3A 3E6DA 3TQNA 3Q5FA 1D8JA 1FPQA 1ZG3A 2ISZA 4KYWA 2FRHA 4L0ZB 1L3LA 1BI1A 1W7PB 1XSVA 1OMIA 4CYDA 4CICA 4RGUA 5KVRA 1CF7B 1XGNA 3G73A 1BI3A 1ODDA 1UHWA 5LEKA 5FFXA 3CUQA 2Q8KA 5HS9A 1MZBA 4EJVA 2Z3YA 5L3CA 3WE3A 3GFIA 3O2PE 2W25A 5D5UB 5CVUA 1KQ8A 1YTYA 4P9UA 4HOBA 1P4WA 4HV6A 1K79A 2W84A 2F5DA 1BBYA 3JSPA 1O3RA 5KK1A 2BV6A 1BC8C 3OV8A 5HS8A 5CVJA 1TLHB 2XAGA 2NS0A 4I0AA 2XKOA 3BPVA 2E1NA 2HKOA 3L7WA 1HQCA 1YW7A 1R5GA 4OIQF 5CVRA 3V7CA 5ILSA 5HOOA 3SHFA 2ACJA 3LA2A 3F8CA 4UXNA 3MQ0A 2R7DA 5HLIA 2UWMA 2OQGA 5LRRA 2H6CA 2HYGD 1LB2A 3FWEA 2KKOA 2H6BA 3ZN0A 2DO7A 3GW2A 1I1GA 1TNTA 2EWNA 3RJPA 3GUDA 2CW0F 3TKYA 4RGSA 5D5VB 1SFEA 2CO5A 4WX9A 3WTUC 4HBLA 2OZUA 3M8EA 2OBPA 3FM3A 3FXUA 2IA1A 1P92A 2YSRA 4LG0A 3CO6C 3BWGA 1XDSA 4ON0A 2DFIA 2G7HA 2P6TA 2DK5A 4LGWA 1XDUA 5FD6A 2K4BA 1BIAA 1KYZA 3FMRA 5H6RA 3FXQA 1RUOA 3T0YA 3V8KA 1IXCA 3IL2A 1XGMA 2W85A 1RIOH 3U1DA 3BPXA 3EETA 2DPUA 3E6CC 4JQFA 4U7BA 3MZYA 5L3DA 1HKTA 5K5OA 5BMZA 3MWMA 1ZH5A 1ONVA 1VTNC 3N4MA 1G3YA 3RKWA 5LBQA 4U88A 1HSJA 2TDXA 4GYIA 4XSZF 4FHTA 2XAQA 1AWCA 5FLXZ 3ZMUA 3HRUA 2L4AA 5D4SA 1R22A 4IHTA 4RAYA 1DPUA 2MLGA 2H09A 2ELHA 4IRHA 3NQOA 4KA4A 3SZPA 3ZMZA 5FB2A 1U5TB 5D5XB 3QP5A 4ENKA 2Q0OA 4ETSA 3P9KA 2GXGA 1BJAA 4HV5A 4HDVA 1HXDA 3K1NA 5JR3A 1XCBA 3KZZA 2HQNA 4LLLA 1ZGJA 3R0JA 4KIFA 4KIGA 2K86A 4A2UA 1KU7A 3V4GA 2IPQX 1PP8F 1R58A 2L54A 1FSEA 2NRAC 3I54A 2A3SA 4GO1A 4YFNF 2RQPA 4KMUX 3KE2A 3O3KA 3E5XA 3HRSA 2FNAA 2LSOA 1RUNA 5LGTA 1IXRC 2HYFA 3DPLC 3QOPA 5FFZA 2WWYA 2GXBA 1K7AA 3RTRA 4NQWA 3J80K 5F1RA 5E18F 3D0SA 2RKHA 1T6SA 3BDDA 2ETHA 2HTSA 4UVAA 4EGYA 2HOEA 4TV7A 2V9VA 1IN8A 1UCRA 4ZZLA 5DUIA 1R1UA 2K7LA 1T98A 2PFBA 2R7FA 2QENA 1Z1DA 3I5UA 3KLOA 3M8FA 1U2WA 1O3TA 3JW4A 1SD5A 2O0YA 1B59A 2MD5A 5LHHA 1RNLA 1K6OA 1BN5A 4P9FA 2V1UA 1QZZA 1YW9A 3T8RA 5LHGA 2PQ8A 5EEGA 2VBYA 3ROUA 3CJNA 4G9YA 3BY6A 4AIKA 2ZKZA 1D5VA 4Q4ZF 1YLFA 3KEQA 5DYMA 2H94A 1PUEE 5HDKA 3BP8A 1EH8A 1G3WA 4R79A 1R1TA 4ENNA 4HF0A 4NHJA 2AXLA 2STTA 3F8MA 2J5PA 2E7WA 1O3QA 2A5YB 1HKQA 1S29A 3WODF 1TNSA 4O5VA 4A6EA 2CGPA 5DUKA 3KLNA 3I59A 1I5ZA 3GO5A 1IUYA 4YIFA 4G6DA 3ECOA 5E1XA 3K1MA 3I53A 2VE9A 2O3FA 4HQMA 3KP4A 3TDZC 3F8FA 5ICFA 2IJLA 2FF4A 4IF4A 1FNNA 2OD5A 4M9SA 1YIOA 2P6SA 3WGGA 1IRGA 2L01A 5K1YA 1B4AA 3ZMVA 3HIFA 4RS8A 5HDGA 3EDPA 2NNYA 3QP6A 3H3UA 2EFWA 1EH6A 1DP7P 2EV5A 5K5RA 2EFOA 1B9NA 3R4KA 1PP7U 4OOIA 5DCMB 2R3SA 3I64A 4WXHA 4O3MA 1FSHA 5ILVA 2FA5A 2QUFA 1LDDA 3C18A 2FQ3A 1REPC 3MFKA 1NHAA 1BI0A 3C7JA 3HSRA 2V1XA 2Z99A 1LQ1A 1KYWA 1GVJA 2O6GE 1XSXA 1OYWA 2P7CB 3HRMA 2L02A 2M8EA 1PDNC 3I0TA 2ZBKA 3ECHA 1GHCA 4FX0A 1RI7A 5HS7A 2XAFA 2O61A 5AIPA 5LGNA 1XSDA 2CYYA 4HF1A 2VT3A 4A5NA 4L18B 1XMKA 1SD4A 1TTYA 4PZJA 1W7PD 1QBJA 3HHGA 4I7HA 4BYYA 3VFZA 1X3UA 2JPCA 5E8GA 2STWA 3JTHA 1LJ9A 3W6KB 2O8XA 3QRFF 2GQQA 1P6RA 4IPAA 2BYVE 2QWWA 2A69F 4HZFA 4I0BA 2FOKA 2Z5UA 5A2QK 3FX3A 3HRTA 3GWZA 2F5EA 3EUHA 3GZ6A 1XD7A 3V8JA 1STZA 1W5SA 2P8TA 2VBZA 2HFHA 2KJBA 2LNBA 4AD9A 3RKYA 1WSUA 2CFXA 2BBYA 2YPRA 2VONA 1TQIA 4MNUA 3SZTA 4RGXA 5BPIA 2QVOA 4U0VA 5E1ZB 1MJBA 2ZFWA 3LA3A 3W6JB 3F21A 3WGIA 4F7ZA 1S8NA 3CDHA 4P55A 4EQQA 2LF8A 4I09A 2VOOA 2PJPA 1IRFA 4HDUA 1YW8A 2CG4A 4MEYF 2DLLA 1HKSA 3J7AO 1HSTA 2LF7A 2VE8A 2KJCA 3DEUA 3KP6A 3L9FA 3BOQA 2JTVA 2J5OA 4LK0F 3COAC 5D5WB 4EJWA 2FSWA 4UVBA 2IA2A 3IRQA 1TQPA 2EFNA 1Z9CA 1XGOA 3HSFA 4CDGA 1OR7A 1G3SA 3DFGA 2EV6A 3TO7A 3RDIA 1JXSA 3E97A 1J7KA 4IRIA 5DCFA 4LD5A 4L9VA 3GXOA 3WTXC 1J0RA 1P2FA 1XCVA 1RZ4A 4Q48A 3ML6A 2FU4A 3R61A 4HF2A 3R6SA 3F23A 3M7GA 3KP3A 3KFWX 1UHMA 2FMLA 4KUMA 1A04A 4RB1A 1Z91A 2A6HF 3D5LA 4B8XA 4WK8F 5D8KB 1R7JA 4UNOA 3CUOA 3DKWA 3GZ5A 1IN5A 2DU9A 4Q47A 3IWFA 3K9TA 1V4RA 2GIVA 4LG0B 1K78B 3IC7A 1QQIA 1WWXA 1BI2A 2IVMA 5J6XA 1IN6A 2M30A 4EV0A 4E70A 1QGPA 3DPTA 3NEUA 5L3EA 2UXXA 3J81Z 5L3FA 2D2WA 2QBYA 2V79A 2PLYA 2JT1A 3FHZA 2VOPA 3QU6A 4M6XA 4ZYDA 3E3VA 4AWXB 3ELKA 1EH7A 4G7OF 2AS5F 5ILUA 5BPDA 2M1BA 2E1CA 4HX8A 1S6LA 1I6XA 3DP7A 3MAJA 5H20A 4DNCA 4KT5C 5LHIA 3KCCA 5K5QA 2MH9A 3IKTA 4O6JA 4L5JA 2YX4A 1FOKA 2L3DA 2JSCA 4ESBA 3FF5A 3Q9SA 2XVCA 2WV0A 1USSA 4UV9A 4HLYA 2D45A 3T1BA 3GFMA 2JPBA 5IT9Z 4I01A 1IZ1A 4KIBA 2FBIA 1ZRDA 2DPDA 1XGSA 5ICGA 4G8XA 1LDJA 2QLZA 1U8RA 1BC7C 2FEZA 2DT5A 2DQLA 4BHPA 2QM3A 4N0BA 4CHUA 3P9CA 1Q1HA 1J5YA 1FC3A 3RI4A 1S7AA 1C0WA 4LLGF 2DQRA 2IT0A 4UV8A 3FZVA 5CLSA 4XSXF 5DV5A 2M87A 2QQAA 2ZMEB 2LKPA 5LRSA 1FY7A 3HUGA 3IKVA 3CUQC 4RAZA 4EM2A 3WGHA 2MC3A 4B09A 5ICCA 4BXUA 1FYKA 3K1PA 1R5HA 1F4KA 1IAWA 2CQKA 1R36A 3VEPA 2K27A 3N97A 3PQJA 1AOYA 2WC2A 2LDUA 5LLQA 1KQ9A 3JAMZ 4M72A 4WXDA 2VC1A 3ULQB 3I71A 2ESHA 4CXFA 4P96A 3WU0A 2JRTA 2PEXA 4GYGA 5HLHA 2DTRA 1TQMA 1LNWA 1OPCA 1P4XA 4L9NA 5E20A 4P5OA 2WTEA 2KRFA 5ICEA 3QAHA 2ZNYA 1J75A 5TRDA 1IN4A 2M45A 4KDPA 4I02A 5ERIA 2XRNA 1ZN2A 1F5TA 2XV4S 2YX7A 2CSOA 1YS6A 4OMYA 3JTGA 3B73A 4XBFA 2A07F 2FMYA 4ZH4F 4HQEA 4EGZA 4A0ZA 4WCGA 4IJAA 2FBHA 2A68F 3IHUA 1U78A 3WTTC 1P4AA 3I59B 2X4HA 3C1DA 1R00A 3GF2A 2HEOA 2YU3A 5HLGA 4BHBA 3NRVA 1J9IA 1ZRFA 5AONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4M A;  2COM A;  2RVC A;  3F6O A;  2XHK A;  5D8L B;  2Y48 A;  2FBK A;  5FLX K;  2ESN A;  1YFH A;  5FO5 A;  1DUX C;  3JSO A;  4PDK A;  4KFC A;  2DI3 A;  4EJU A;  1FLI A;  3C3W A;  1Y0U A;  1TBX A;  4HLX A;  3L2C A;  2EFP A;  2EK5 A;  4L0Y B;  4FX4 A;  2A6E F;  2VBX A;  1SMY F;  4UVC A;  3GEZ A;  5JHU A;  3R0A A;  2GA1 A;  3WTS C;  4ENM A;  1R1V A;  4AIJ A;  3IWZ A;  3MZH A;  5D6E A;  4Y17 A;  1T0F A;  4M74 A;  5EEH A;  3M1E A;  3SFZ A;  3P9I A;  4EM1 A;  1KQ0 A;  4RB3 C;  3RKX A;  4ZZD A;  1R23 A;  3BJO A;  1MDM B;  2GZW A;  1KU2 A;  5DDG A;  3RIR A;  2XUB A;  2ZO4 A;  1YYV A;  4LB6 B;  2ADU A;  1H9T A;  1S7O A;  3ZMD A;  3CLO A;  4LB5 A;  4QLC U;  5L3G A;  2YR2 A;  4KIC A;  2V1D A;  1MGT A;  3HYI A;  2OZ6 A;  4FT8 A;  1T38 A;  1QZY A;  2L4M A;  2HWV A;  2PMU A;  3KP7 A;  3DQV C;  2EA2 A;  2BEO A;  2Z33 A;  4Q5S F;  3EQL F;  3LFK A;  3ZQ7 A;  1DDN A;  1WKM A;  1UST A;  3DXJ F;  4LJZ F;  3WTW C;  1ZG5 A;  1J2X A;  2PG4 A;  2IW5 A;  1ON2 A;  2F5F A;  4AVP A;  2A61 A;  2DW4 A;  2ISY A;  2XAS A;  3SXY A;  1H9G A;  4MQV A;  4KN7 X;  1WI9 A;  2P5V A;  4XLN F;  2KIF A;  3ZN1 A;  1I1S A;  1SD6 A;  2XGX A;  4A0Y A;  2XAJ A;  3K69 A;  1TW2 A;  4KN4 X;  4M71 A;  3AAF A;  3FXR A;  1SFU A;  5LGU A;  2D1V A;  5BQT A;  2HKX A;  4G6Q A;  4ZYG A;  3WTZ A;  3VB2 A;  4LK1 F;  2OQR A;  4M9Z A;  1BM9 A;  5JFR A;  4R8H A;  3KZY A;  3TOB A;  4IXA A;  1E17 A;  1SMT A;  2H27 A;  3LAJ A;  5J8F A;  1XMA A;  3CUQ B;  4OIN F;  1ZLK A;  1W7P A;  2MH2 A;  1Z6T A;  4ZYE A;  4PCQ A;  4H0E A;  3TDU C;  1MKM A;  4MGR A;  1MJ9 A;  1CF7 A;  2XAH A;  1Z05 A;  2RC4 A;  4L9T A;  3V8L A;  5DEQ A;  2F2E A;  4YG2 F;  4S04 A;  3ZPL A;  3VOE A;  1G4D A;  3MEX A;  1ZHF A;  4G7H F;  1I27 A;  1TW3 A;  3V7S A;  5D6F A;  3K2Z A;  2XRO A;  4MTD A;  1OKR A;  1HW1 A;  2O03 A;  1OYI A;  3REO A;  1HW5 A;  3OOP A;  4BH9 A;  4Y13 A;  1ZYR F;  3RYP A;  2Q2E A;  4U7D A;  3J80 Z;  2UXN A;  3ZMS A;  4KMF A;  3FMS A;  3FMQ A;  4RB0 A;  1SD7 A;  3RPQ A;  3WG9 A;  3RYR A;  2Z9O A;  1YQA A;  4WXC A;  2G9W A;  2DK8 A;  3BJA A;  1YO5 C;  3HTU A;  4G7Z F;  5AIQ A;  1ZGA A;  3SQN A;  1ZAO A;  4BHC A;  2EA4 A;  1UB9 A;  1Z6R A;  2G7U A;  2MA3 A;  1LVA A;  4HX4 A;  3LQR A;  1BIB A;  1QNT A;  2EJR A;  2EV0 A;  3T8T A;  4A5M A;  2MBF A;  1EV7 A;  4LLN A;  4NB5 A;  2BGC A;  1U6G A;  4A6D A;  3LAP A;  4IRG A;  2QBY B;  1FP2 A;  3EYI A;  4IHS A;  1ZRC A;  1FWZ A;  3WU1 B;  1W5T A;  1JGS A;  3B02 A;  3TO6 A;  1FBS A;  1ZRE A;  4A12 A;  4RB2 C;  2OU2 A;  3PFI A;  1K78 A;  4KNY A;  3GLX A;  3E5U A;  4LMY A;  5FD5 A;  2QQ9 A;  1U3E M;  3MCZ A;  2VT2 A;  3FM5 A;  5JVT A;  4K2E A;  2VC0 A;  1ULY A;  1ZLJ A;  1O3S A;  3LA7 A;  4RGR A;  3GFJ A;  2IP2 A;  5H6Q A;  2QQB A;  4R1H A;  4PGH A;  1KA8 A;  3TOA A;  1F9N A;  1OYY A;  1T2K A;  2D1H A;  1GXQ A;  5F6F A;  4ESJ A;  5CVV A;  2VOD A;  3GVA A;  4EMS A;  2KIM A;  2K4J A;  2PI0 A;  3ABU A;  2GWR A;  3L00 A;  2PBI A;  3F72 A;  3O6B B;  2EB7 A;  3TO9 A;  2XKP A;  1MJA A;  4Y15 A;  4OIO F;  1Z7U A;  1O7L A;  4N9I A;  1U5T A;  4CGZ A;  4BAY A;  5LEJ A;  2JZY A;  3WE2 A;  4ENJ A;  1QO0 D;  1FX7 A;  1BOA A;  4ZYH A;  4U0W A;  4UHT A;  2GAU A;  2M5W A;  4GGG A;  5L3B A;  3Q9V A;  3T5X A;  2QYO A;  3P7N A;  3GYH X;  2ZXJ A;  4YFK F;  4OIP F;  3QPT A;  1G3T A;  4MHG A;  3DF8 A;  2MLK A;  4GXO A;  1T39 A;  3KEO A;  1SAX A;  2HTJ A;  2X0L A;  2HZT A;  1IXS B;  3F8N A;  1QPM A;  5FGM A;  2K02 A;  1YS7 A;  3EYY A;  2ZME A;  1V3F A;  2NAZ A;  3M9A A;  3U9G A;  2HR3 A;  5TJJ A;  2FNP A;  4A0X A;  4I98 B;  1G6N A;  1JHF A;  5CYV A;  4LFU A;  3GFL A;  4EVI A;  4HYE A;  2RN7 A;  1O7F A;  4DQ2 A;  3QPH A;  2P5K A;  2VBW A;  5J8C A;  1LDK B;  2HDC A;  2Y0M A;  4YII A;  1CGP A;  2DAO A;  3WTY C;  2RNJ A;  4Z2Y A;  1DPR A;  5DD4 A;  2W24 A;  1FZP B;  2P5L C;  2VN2 A;  2NNN A;  3DV8 A;  1FBQ A;  5DD8 A;  2DBB A;  4ESF A;  3HTS B;  5A2Q Z;  3TGN A;  4UUV A;  4YFX F;  4M6Y A;  3WTV C;  3E5Q A;  4JBA A;  3LWF A;  2PMH A;  3VOD A;  2OAZ A;  4GCV A;  2XIG A;  1XN7 A;  3H3Z A;  1IF1 A;  4EJO A;  1IN7 A;  3HOS A;  1D3Y A;  3BRO A;  1ZAR A;  3J81 K;  2RGV A;  4WF2 A;  3F22 A;  5F64 A;  4QWQ A;  1YG2 A;  1E2X A;  5E1W A;  4IVN A;  4HAM A;  1IW7 F;  1FYM A;  3H92 A;  3E6B A;  3G3Z A;  2NYX A;  2P4W A;  1UFM A;  4MEX F;  4OIR F;  5IT3 A;  1B1B A;  3F3X A;  1F1Z A;  4L9J A;  1B6A A;  4MTE A;  3RPU A;  2ZCW A;  1H0M A;  1ZG1 A;  5BS6 A;  2F5C A;  2HGC A;  2CWE A;  1B9M A;  5CVI A;  3F6V A;  3ZP5 A;  3U2R A;  4JK1 X;  5BOX A;  3ZMT A;  2V6C A;  2W57 A;  2B0L A;  3HHH A;  2VXZ A;  1S3J A;  1SFX A;  2HS5 A;  5D4R A;  3V7R A;  4MQ9 F;  4HA8 A;  4OMZ A;  2GA2 A;  5HDN A;  3KP5 A;  2ZJ2 A;  1FP1 D;  1WQ2 A;  5IT9 K;  2FXA A;  5E8I A;  3ERE D;  4AIH A;  1GXP A;  5ED4 A;  2P7V B;  3BZ6 A;  4G94 A;  3KP2 A;  3BJ6 A;  3E6M A;  2RV8 A;  5CJ9 A;  3LQQ A;  4EJT A;  4CZZ A;  3GX4 X;  3PQK A;  2Y75 A;  4XRF A;  1ON1 A;  1U5T C;  5DCM A;  1MD0 A;  4PGG A;  4BQA A;  4U0Y A;  1LEB A;  2PN6 A;  3HSE A;  4XLP F;  3QU3 A;  1MDM A;  4M9X A;  4WWC A;  1L0O C;  2IA0 A;  5HVQ C;  4L5I A;  5JI6 A;  3CO7 C;  1LEA A;  4BNC A;  3ISP A;  1JHH A;  3F8B A;  1FBU A;  4N9H A;  4I2O A;  2UZK A;  2IRF G;  4ASN A;  3KET A;  4D0P A;  1HBX G;  2BE5 F;  4CO8 A;  4OU0 A;  6PAX A;  1O57 A;  3K0L A;  4S05 A;  1J59 A;  2E7X A;  3I58 A;  3HOT A;  3JAM K;  4HW0 A;  2FE3 A;  3ABT A;  2EFQ A;  4HX7 A;  1HW2 A;  2QZ8 A;  1FT9 A;  2RDP A;  2ZNZ A;  3R60 A;  3CTA A;  4EM0 B;  1KU9 A;  1JE8 A;  3IRR A;  1XB4 A;  2KIU A;  2C6Y A;  3LST A;  1D8K A;  2OA4 A;  1KGS A;  3I4P A;  2HQR A;  5E17 F;  3S2W A;  3L09 A;  1WRJ A;  1FYL A;  4M73 A;  1KU3 A;  3E6D A;  3TQN A;  3Q5F A;  1D8J A;  1FPQ A;  1ZG3 A;  2ISZ A;  4KYW A;  2FRH A;  4L0Z B;  1L3L A;  1BI1 A;  1W7P B;  1XSV A;  1OMI A;  4CYD A;  4CIC A;  4RGU A;  5KVR A;  1CF7 B;  1XGN A;  3G73 A;  1BI3 A;  1ODD A;  1UHW A;  5LEK A;  5FFX A;  3CUQ A;  2Q8K A;  5HS9 A;  1MZB A;  4EJV A;  2Z3Y A;  5L3C A;  3WE3 A;  3GFI A;  3O2P E;  2W25 A;  5D5U B;  5CVU A;  1KQ8 A;  1YTY A;  4P9U A;  4HOB A;  1P4W A;  4HV6 A;  1K79 A;  2W84 A;  2F5D A;  1BBY A;  3JSP A;  1O3R A;  5KK1 A;  2BV6 A;  1BC8 C;  3OV8 A;  5HS8 A;  5CVJ A;  1TLH B;  2XAG A;  2NS0 A;  4I0A A;  2XKO A;  3BPV A;  2E1N A;  2HKO A;  3L7W A;  1HQC A;  1YW7 A;  1R5G A;  4OIQ F;  5CVR A;  3V7C A;  5ILS A;  5HOO A;  3SHF A;  2ACJ A;  3LA2 A;  3F8C A;  4UXN A;  3MQ0 A;  2R7D A;  5HLI A;  2UWM A;  2OQG A;  5LRR A;  2H6C A;  2HYG D;  1LB2 A;  3FWE A;  2KKO A;  2H6B A;  3ZN0 A;  2DO7 A;  3GW2 A;  1I1G A;  1TNT A;  2EWN A;  3RJP A;  3GUD A;  2CW0 F;  3TKY A;  4RGS A;  5D5V B;  1SFE A;  2CO5 A;  4WX9 A;  3WTU C;  4HBL A;  2OZU A;  3M8E A;  2OBP A;  3FM3 A;  3FXU A;  2IA1 A;  1P92 A;  2YSR A;  4LG0 A;  3CO6 C;  3BWG A;  1XDS A;  4ON0 A;  2DFI A;  2G7H A;  2P6T A;  2DK5 A;  4LGW A;  1XDU A;  5FD6 A;  2K4B A;  1BIA A;  1KYZ A;  3FMR A;  5H6R A;  3FXQ A;  1RUO A;  3T0Y A;  3V8K A;  1IXC A;  3IL2 A;  1XGM A;  2W85 A;  1RIO H;  3U1D A;  3BPX A;  3EET A;  2DPU A;  3E6C C;  4JQF A;  4U7B A;  3MZY A;  5L3D A;  1HKT A;  5K5O A;  5BMZ A;  3MWM A;  1ZH5 A;  1ONV A;  1VTN C;  3N4M A;  1G3Y A;  3RKW A;  5LBQ A;  4U88 A;  1HSJ A;  2TDX A;  4GYI A;  4XSZ F;  4FHT A;  2XAQ A;  1AWC A;  5FLX Z;  3ZMU A;  3HRU A;  2L4A A;  5D4S A;  1R22 A;  4IHT A;  4RAY A;  1DPU A;  2MLG A;  2H09 A;  2ELH A;  4IRH A;  3NQO A;  4KA4 A;  3SZP A;  3ZMZ A;  5FB2 A;  1U5T B;  5D5X B;  3QP5 A;  4ENK A;  2Q0O A;  4ETS A;  3P9K A;  2GXG A;  1BJA A;  4HV5 A;  4HDV A;  1HXD A;  3K1N A;  5JR3 A;  1XCB A;  3KZZ A;  2HQN A;  4LLL A;  1ZGJ A;  3R0J A;  4KIF A;  4KIG A;  2K86 A;  4A2U A;  1KU7 A;  3V4G A;  2IPQ X;  1PP8 F;  1R58 A;  2L54 A;  1FSE A;  2NRA C;  3I54 A;  2A3S A;  4GO1 A;  4YFN F;  2RQP A;  4KMU X;  3KE2 A;  3O3K A;  3E5X A;  3HRS A;  2FNA A;  2LSO A;  1RUN A;  5LGT A;  1IXR C;  2HYF A;  3DPL C;  3QOP A;  5FFZ A;  2WWY A;  2GXB A;  1K7A A;  3RTR A;  4NQW A;  3J80 K;  5F1R A;  5E18 F;  3D0S A;  2RKH A;  1T6S A;  3BDD A;  2ETH A;  2HTS A;  4UVA A;  4EGY A;  2HOE A;  4TV7 A;  2V9V A;  1IN8 A;  1UCR A;  4ZZL A;  5DUI A;  1R1U A;  2K7L A;  1T98 A;  2PFB A;  2R7F A;  2QEN A;  1Z1D A;  3I5U A;  3KLO A;  3M8F A;  1U2W A;  1O3T A;  3JW4 A;  1SD5 A;  2O0Y A;  1B59 A;  2MD5 A;  5LHH A;  1RNL A;  1K6O A;  1BN5 A;  4P9F A;  2V1U A;  1QZZ A;  1YW9 A;  3T8R A;  5LHG A;  2PQ8 A;  5EEG A;  2VBY A;  3ROU A;  3CJN A;  4G9Y A;  3BY6 A;  4AIK A;  2ZKZ A;  1D5V A;  4Q4Z F;  1YLF A;  3KEQ A;  5DYM A;  2H94 A;  1PUE E;  5HDK A;  3BP8 A;  1EH8 A;  1G3W A;  4R79 A;  1R1T A;  4ENN A;  4HF0 A;  4NHJ A;  2AXL A;  2STT A;  3F8M A;  2J5P A;  2E7W A;  1O3Q A;  2A5Y B;  1HKQ A;  1S29 A;  3WOD F;  1TNS A;  4O5V A;  4A6E A;  2CGP A;  5DUK A;  3KLN A;  3I59 A;  1I5Z A;  3GO5 A;  1IUY A;  4YIF A;  4G6D A;  3ECO A;  5E1X A;  3K1M A;  3I53 A;  2VE9 A;  2O3F A;  4HQM A;  3KP4 A;  3TDZ C;  3F8F A;  5ICF A;  2IJL A;  2FF4 A;  4IF4 A;  1FNN A;  2OD5 A;  4M9S A;  1YIO A;  2P6S A;  3WGG A;  1IRG A;  2L01 A;  5K1Y A;  1B4A A;  3ZMV A;  3HIF A;  4RS8 A;  5HDG A;  3EDP A;  2NNY A;  3QP6 A;  3H3U A;  2EFW A;  1EH6 A;  1DP7 P;  2EV5 A;  5K5R A;  2EFO A;  1B9N A;  3R4K A;  1PP7 U;  4OOI A;  5DCM B;  2R3S A;  3I64 A;  4WXH A;  4O3M A;  1FSH A;  5ILV A;  2FA5 A;  2QUF A;  1LDD A;  3C18 A;  2FQ3 A;  1REP C;  3MFK A;  1NHA A;  1BI0 A;  3C7J A;  3HSR A;  2V1X A;  2Z99 A;  1LQ1 A;  1KYW A;  1GVJ A;  2O6G E;  1XSX A;  1OYW A;  2P7C B;  3HRM A;  2L02 A;  2M8E A;  1PDN C;  3I0T A;  2ZBK A;  3ECH A;  1GHC A;  4FX0 A;  1RI7 A;  5HS7 A;  2XAF A;  2O61 A;  5AIP A;  5LGN A;  1XSD A;  2CYY A;  4HF1 A;  2VT3 A;  4A5N A;  4L18 B;  1XMK A;  1SD4 A;  1TTY A;  4PZJ A;  1W7P D;  1QBJ A;  3HHG A;  4I7H A;  4BYY A;  3VFZ A;  1X3U A;  2JPC A;  5E8G A;  2STW A;  3JTH A;  1LJ9 A;  3W6K B;  2O8X A;  3QRF F;  2GQQ A;  1P6R A;  4IPA A;  2BYV E;  2QWW A;  2A69 F;  4HZF A;  4I0B A;  2FOK A;  2Z5U A;  5A2Q K;  3FX3 A;  3HRT A;  3GWZ A;  2F5E A;  3EUH A;  3GZ6 A;  1XD7 A;  3V8J A;  1STZ A;  1W5S A;  2P8T A;  2VBZ A;  2HFH A;  2KJB A;  2LNB A;  4AD9 A;  3RKY A;  1WSU A;  2CFX A;  2BBY A;  2YPR A;  2VON A;  1TQI A;  4MNU A;  3SZT A;  4RGX A;  5BPI A;  2QVO A;  4U0V A;  5E1Z B;  1MJB A;  2ZFW A;  3LA3 A;  3W6J B;  3F21 A;  3WGI A;  4F7Z A;  1S8N A;  3CDH A;  4P55 A;  4EQQ A;  2LF8 A;  4I09 A;  2VOO A;  2PJP A;  1IRF A;  4HDU A;  1YW8 A;  2CG4 A;  4MEY F;  2DLL A;  1HKS A;  3J7A O;  1HST A;  2LF7 A;  2VE8 A;  2KJC A;  3DEU A;  3KP6 A;  3L9F A;  3BOQ A;  2JTV A;  2J5O A;  4LK0 F;  3COA C;  5D5W B;  4EJW A;  2FSW A;  4UVB A;  2IA2 A;  3IRQ A;  1TQP A;  2EFN A;  1Z9C A;  1XGO A;  3HSF A;  4CDG A;  1OR7 A;  1G3S A;  3DFG A;  2EV6 A;  3TO7 A;  3RDI A;  1JXS A;  3E97 A;  1J7K A;  4IRI A;  5DCF A;  4LD5 A;  4L9V A;  3GXO A;  3WTX C;  1J0R A;  1P2F A;  1XCV A;  1RZ4 A;  4Q48 A;  3ML6 A;  2FU4 A;  3R61 A;  4HF2 A;  3R6S A;  3F23 A;  3M7G A;  3KP3 A;  3KFW X;  1UHM A;  2FML A;  4KUM A;  1A04 A;  4RB1 A;  1Z91 A;  2A6H F;  3D5L A;  4B8X A;  4WK8 F;  5D8K B;  1R7J A;  4UNO A;  3CUO A;  3DKW A;  3GZ5 A;  1IN5 A;  2DU9 A;  4Q47 A;  3IWF A;  3K9T A;  1V4R A;  2GIV A;  4LG0 B;  1K78 B;  3IC7 A;  1QQI A;  1WWX A;  1BI2 A;  2IVM A;  5J6X A;  1IN6 A;  2M30 A;  4EV0 A;  4E70 A;  1QGP A;  3DPT A;  3NEU A;  5L3E A;  2UXX A;  3J81 Z;  5L3F A;  2D2W A;  2QBY A;  2V79 A;  2PLY A;  2JT1 A;  3FHZ A;  2VOP A;  3QU6 A;  4M6X A;  4ZYD A;  3E3V A;  4AWX B;  3ELK A;  1EH7 A;  4G7O F;  2AS5 F;  5ILU A;  5BPD A;  2M1B A;  2E1C A;  4HX8 A;  1S6L A;  1I6X A;  3DP7 A;  3MAJ A;  5H20 A;  4DNC A;  4KT5 C;  5LHI A;  3KCC A;  5K5Q A;  2MH9 A;  3IKT A;  4O6J A;  4L5J A;  2YX4 A;  1FOK A;  2L3D A;  2JSC A;  4ESB A;  3FF5 A;  3Q9S A;  2XVC A;  2WV0 A;  1USS A;  4UV9 A;  4HLY A;  2D45 A;  3T1B A;  3GFM A;  2JPB A;  5IT9 Z;  4I01 A;  1IZ1 A;  4KIB A;  2FBI A;  1ZRD A;  2DPD A;  1XGS A;  5ICG A;  4G8X A;  1LDJ A;  2QLZ A;  1U8R A;  1BC7 C;  2FEZ A;  2DT5 A;  2DQL A;  4BHP A;  2QM3 A;  4N0B A;  4CHU A;  3P9C A;  1Q1H A;  1J5Y A;  1FC3 A;  3RI4 A;  1S7A A;  1C0W A;  4LLG F;  2DQR A;  2IT0 A;  4UV8 A;  3FZV A;  5CLS A;  4XSX F;  5DV5 A;  2M87 A;  2QQA A;  2ZME B;  2LKP A;  5LRS A;  1FY7 A;  3HUG A;  3IKV A;  3CUQ C;  4RAZ A;  4EM2 A;  3WGH A;  2MC3 A;  4B09 A;  5ICC A;  4BXU A;  1FYK A;  3K1P A;  1R5H A;  1F4K A;  1IAW A;  2CQK A;  1R36 A;  3VEP A;  2K27 A;  3N97 A;  3PQJ A;  1AOY A;  2WC2 A;  2LDU A;  5LLQ A;  1KQ9 A;  3JAM Z;  4M72 A;  4WXD A;  2VC1 A;  3ULQ B;  3I71 A;  2ESH A;  4CXF A;  4P96 A;  3WU0 A;  2JRT A;  2PEX A;  4GYG A;  5HLH A;  2DTR A;  1TQM A;  1LNW A;  1OPC A;  1P4X A;  4L9N A;  5E20 A;  4P5O A;  2WTE A;  2KRF A;  5ICE A;  3QAH A;  2ZNY A;  1J75 A;  5TRD A;  1IN4 A;  2M45 A;  4KDP A;  4I02 A;  5ERI A;  2XRN A;  1ZN2 A;  1F5T A;  2XV4 S;  2YX7 A;  2CSO A;  1YS6 A;  4OMY A;  3JTG A;  3B73 A;  4XBF A;  2A07 F;  2FMY A;  4ZH4 F;  4HQE A;  4EGZ A;  4A0Z A;  4WCG A;  4IJA A;  2FBH A;  2A68 F;  3IHU A;  1U78 A;  3WTT C;  1P4A A;  3I59 B;  2X4H A;  3C1D A;  1R00 A;  3GF2 A;  2HEO A;  2YU3 A;  5HLG A;  4BHB A;  3NRV A;  1J9I A;  1ZRF A;  5AON A; 
#chains in the Genus database with same CATH topology
 1W4M A;  2COM A;  4ZYA A;  2RVC A;  3F6O A;  2XHK A;  4E7K A;  5D8L B;  2Y48 A;  1WH5 A;  1XG1 A;  2FBK A;  5FLX K;  2BY0 A;  2VJ4 A;  1K4T A;  2ESN A;  2M0M A;  3I56 I;  5FO5 A;  1YFH A;  1A31 A;  1I6H J;  1DUX C;  3JSO A;  2ZFU A;  4PDK A;  4RLQ A;  4KFC A;  2DI3 A;  1U0J A;  2CH0 A;  4EJU A;  1FLI A;  4DYR A;  2OPT A;  1JJ6 C;  3C3W A;  1Y0U A;  1TBX A;  4HLX A;  3L2C A;  2EFP A;  2EK5 A;  3DLL F;  1W0U A;  1IRZ A;  1WZ2 A;  4L0Y B;  5LD2 C;  2AO9 A;  2MC4 A;  5FKN A;  4IOC F;  4FX4 A;  2A6E F;  4BGD A;  2VBX A;  1SMY F;  4UVC A;  3H35 A;  2V26 A;  3GEZ A;  2DFF A;  5JHU A;  4QPO A;  3R0A A;  1VQ6 I;  3I4M J;  4A3D J;  2GA1 A;  1Q1V A;  2CQX A;  3WTS C;  4ENM A;  1R1V A;  4AIJ A;  5JVG F;  3IWZ A;  3MZH A;  5D6E A;  4Y17 A;  1R9T J;  4A3C J;  3HKZ N;  4V2G A;  1T0F A;  1JTX A;  2R7Q A;  4KT6 A;  1H89 C;  3ZQL A;  1ORK A;  4M74 A;  5EEH A;  3CCJ I;  3M1E A;  1NH3 A;  2LMD A;  3SFZ A;  3CMY A;  3AL0 B;  2I8D A;  2HYJ A;  3P9I A;  4EM1 A;  1KQ0 A;  4RB3 C;  1UG0 A;  3RKX A;  4ZZD A;  1GV5 A;  1LKX A;  2BVM A;  3HDD A;  4HRI A;  1R23 A;  4HG2 A;  3BJO A;  2GBY A;  3M07 A;  1MDM B;  2GZW A;  1KU2 A;  1S7E A;  2CS3 A;  3LMM A;  3GCM A;  5DDG A;  2CJJ A;  3RIR A;  1GVD A;  2XUB A;  4GFB A;  2WY8 Q;  1RC9 A;  2ZO4 A;  1YYV A;  4A3K J;  2QKM B;  4LB6 B;  3OS0 A;  3OYM A;  2ADU A;  1H9T A;  2R7U A;  3L2V A;  1S7O A;  4U87 A;  3ZMD A;  3CLO A;  1RR7 A;  4CCL A;  4LB5 A;  1HDP A;  4QLC U;  5L3G A;  1X1C A;  2NOG A;  2YR2 A;  4DZJ A;  4KIC A;  1F43 A;  2V1D A;  1FOX A;  1MGT A;  3OR2 C;  4XLH A;  3ZRG A;  3GBG A;  3HYI A;  3C2B A;  4BY7 J;  2OZ6 A;  4FT8 A;  4AID A;  1T38 A;  4L5E A;  1QZY A;  2DA7 A;  2L4M A;  2HWV A;  2PMU A;  3KP7 A;  3DQV C;  2EA2 A;  3CCQ I;  3PSI A;  2BEO A;  1EF4 A;  2Z33 A;  4Q5S F;  3EQL F;  3AG1 H;  3OYL A;  3LFK A;  2V1N A;  2HDD A;  3ZQ7 A;  4MFE A;  2X9D A;  1WKM A;  1DDN A;  2CV1 A;  1LUJ B;  1UST A;  3DXJ F;  2JUG A;  4LJZ F;  3WTW C;  1E0E A;  1ZG5 A;  1J2X A;  2QQ8 A;  2PG4 A;  2CRG A;  4I6Z A;  3NAR A;  2M7A A;  2IW5 A;  2JQ7 A;  1ON2 A;  2F5F A;  4AVP A;  2A61 A;  2DW4 A;  1ZKG A;  2ISY A;  1D0Z A;  2XAS A;  3SXY A;  2TCT A;  1H9G A;  2IAI A;  4MQV A;  2EIM H;  3MMY B;  2LY9 A;  4XR6 A;  4KN7 X;  3K4B A;  1WI9 A;  4BDY A;  4BL0 B;  2P5V A;  4XLN F;  2KIF A;  3ZN1 A;  1I1S A;  1SD6 A;  2XGX A;  4A0Y A;  4BKX A;  3CF2 A;  2EBI A;  2XAJ A;  3K69 A;  3FK7 A;  1TW2 A;  3IUO A;  3QOE A;  2K3F A;  4KN4 X;  4M71 A;  2VUM J;  3AAF A;  3FXR A;  4XKC A;  1K61 A;  1SFU A;  5LGU A;  1R71 A;  2D1V A;  2KZV A;  3MN2 A;  5BQT A;  2HKX A;  4G6Q A;  4PJL A;  2IGK A;  3BR2 A;  4YEJ A;  4ZYG A;  1JI8 A;  3WTZ A;  3VB2 A;  2IBD A;  3DTE A;  1NG7 A;  4LK1 F;  1R5I D;  3MKW B;  2OQR A;  4M9Z A;  1BM9 A;  2EIK H;  2NVY J;  3A0H C;  2O8K A;  5JFR A;  2A6T A;  4R8H A;  4ZDL A;  4QSH A;  3KZY A;  1DGW Y;  1SAN A;  2WAE A;  4IXA A;  3TOB A;  2W7N A;  1WJ5 A;  1E17 A;  2H8W A;  1SMT A;  3LSG A;  2H27 A;  5FKO A;  2R7W A;  2DMP A;  3PSF A;  3UNG C;  3LAJ A;  5J8F A;  1XMA A;  1VQN I;  3CUQ B;  4OIN F;  1GV2 A;  1W7P A;  1D1C A;  2JVG A;  3MZ8 A;  1RRJ A;  1ZLK A;  4A3M J;  2MH2 A;  1Z6T A;  4ZYE A;  4PCQ A;  2XB0 X;  4DYC A;  4H0E A;  3K4L A;  5M5W J;  3TDU C;  4OAY A;  2BW3 B;  1MKM A;  4MGR A;  1MJ9 A;  1Y6I A;  1CF7 A;  2XAH A;  1Z05 A;  3W2A A;  4NUB A;  2RC4 A;  4L9T A;  1B8I A;  3V8L A;  4E7H A;  4D9J A;  5DEQ A;  2F2E A;  4YG2 F;  4S04 A;  3ZPL A;  4BE2 A;  3VOE A;  2XF5 A;  1G4D A;  3MEX A;  5LFA A;  1ZHF A;  4CCM A;  3HOY J;  1V5G A;  3S3M A;  4G7H F;  3DTI A;  5IP9 J;  3Q0W A;  4CCO A;  1I27 A;  1Z3X A;  3CCV I;  1TW3 A;  3V7S A;  5D6F A;  2QSG X;  3RCO A;  2KPM A;  3K2Z A;  2XRO A;  1W1W E;  3IH3 A;  2LOO A;  4MTD A;  1OKR A;  1HW1 A;  3BG5 A;  2O03 A;  1OYI A;  3K10 A;  3REO A;  1MMD A;  1HW5 A;  3OOP A;  3CDL A;  1I39 A;  4BH9 A;  3I55 I;  4Y13 A;  2VKH A;  4HSR A;  1ZYR F;  3RYP A;  2Q2E A;  5F1J A;  4RAG A;  5CPR B;  3J80 Z;  4U7D A;  2GOM A;  2UXN A;  1MBK A;  5FRM A;  1UJ8 A;  3ZMS A;  2JA7 J;  2K9N A;  4KMF A;  1G2H A;  3BR3 A;  3IH4 A;  3FMS A;  3FMQ A;  3VDX A;  2X6Y A;  4RB0 A;  1SD7 A;  3RPQ A;  2DOE A;  2XPV A;  4M3D A;  3FKJ A;  3TL4 X;  4MO7 A;  3WG9 A;  3RYR A;  2Z9O A;  3CLQ A;  1YQA A;  3DU5 A;  4WXC A;  2G9W A;  3QYE A;  1D1A A;  4JYK A;  2DK8 A;  2MD0 A;  3BJA A;  1YO5 C;  3HTU A;  1BOB A;  4G7Z F;  5AIQ A;  3H5A A;  4A3G J;  1ZGA A;  3SQN A;  4W97 A;  1ZAO A;  2AHQ A;  4NC7 A;  2VQC A;  2ELJ A;  2VXD A;  4XKW A;  4BHC A;  3HOW J;  2CMP A;  5F0C A;  2EA4 A;  3OYB A;  2O5R A;  2M8G X;  1ZK8 A;  1UB9 A;  2F4M B;  2QSH X;  3DEE A;  3HOU J;  4IKF A;  1Z6R A;  2WV1 A;  2G7U A;  1SVL A;  2MA3 A;  4E7J A;  2ZSH B;  1LVA A;  4HX4 A;  4XOR A;  3LQR A;  2HZD A;  1BIB A;  1QNT A;  2CQ7 A;  2EJR A;  2EV0 A;  1T0F C;  2XDV A;  3T8T A;  4A5M A;  2X85 A;  2MBF A;  1EV7 A;  4LLN A;  4NB5 A;  4XL9 A;  2BGC A;  1U6G A;  4A6D A;  3LAP A;  1D0X A;  4IRG A;  3ZQG A;  1WJC A;  2DA1 A;  3AL0 C;  5CQE A;  1NG6 A;  2QBY B;  1FP2 A;  3EYI A;  1QRY A;  1ZRC A;  4IHS A;  1FWZ A;  2W82 A;  3H1C A;  2X6W A;  3W3C A;  3WU1 B;  2L9N A;  1W5T A;  2ZSI B;  2JVH A;  4X0G A;  1JGS A;  2R5Y A;  3LSR A;  3TW7 A;  3B02 A;  3H5N A;  1FBS A;  3TO6 A;  1ZRE A;  1FOY A;  3E7L A;  3QYB A;  4A12 A;  4RB2 C;  2OU2 A;  1GLN A;  3PFI A;  5EZH A;  1K78 A;  4KNY A;  3GLX A;  3E5U A;  4LMY A;  5FD5 A;  2MYS A;  3S93 A;  3SFI A;  1TC3 C;  1YX3 A;  2QQ9 A;  1OCT C;  1U3E M;  3MCZ A;  3OYD A;  2VT2 A;  3DBL B;  3FM5 A;  5JVT A;  5J3L A;  1XMX A;  5KHD A;  4K2E A;  2VC0 A;  2E36 A;  2KIQ A;  4XK4 A;  1ULY A;  1ZLJ A;  4BY1 J;  1O3S A;  3LA7 A;  4RGR A;  2HOS A;  3BG7 A;  1QHH D;  1X2N A;  2Y30 A;  3GFJ A;  2ZJR F;  2IS6 A;  2IP2 A;  1V5F A;  3K4M A;  4PSW A;  5H6Q A;  3S1R J;  2QQB A;  4B1R A;  3I3L A;  3ONQ A;  4R1H A;  4PGH A;  1MNM C;  1KA8 A;  3CCY A;  3TOA A;  1F9N A;  1OYY A;  4IX7 A;  1T2K A;  2D1H A;  4E7I A;  1GXQ A;  5F6F A;  1A6I A;  4ESJ A;  3RZO J;  4A3J J;  1AHD P;  3PUB A;  5CVV A;  1MBE A;  4FE7 A;  2VOD A;  4C3H J;  1MMS A;  2X51 A;  3GVA A;  4EMS A;  5B3S H;  2Y31 A;  4B44 A;  2KIM A;  2K4J A;  2PI0 A;  1A36 A;  1K6Y A;  1YIJ I;  3ABU A;  2GWR A;  3BR5 A;  3RQ4 A;  3L00 A;  3H3V K;  3FXK A;  2DA3 A;  1TZL A;  2Y9Z A;  2PBI A;  3GLL A;  1MH3 A;  3F72 A;  1BW6 A;  2EB7 A;  3O6B B;  3TO9 A;  4BU2 A;  1MMG A;  3RSN A;  2XKP A;  1MJA A;  1E3H A;  1NK2 P;  2Q1Z B;  4Y15 A;  4OIO F;  4IHW A;  1Z7U A;  2ZJP F;  4CCN A;  4ITV A;  1O7L A;  4N9I A;  3S32 A;  1U5T A;  3KEY A;  4CGZ A;  1QPI A;  3JCU C;  4BAY A;  3CJT B;  5LEJ A;  2JZY A;  2K85 A;  4QPQ A;  3UR3 C;  2R7S A;  3WE2 A;  2DN0 A;  2V9K A;  1OJL A;  2LR8 A;  3CMM A;  4ENJ A;  1QO0 D;  4PUS A;  1FX7 A;  1BOA A;  3RZD J;  3C2G A;  4U0W A;  4ZYH A;  4UHT A;  2GAU A;  2M5W A;  4GGG A;  4PFP A;  5L3B A;  1A6Q A;  2JN6 A;  1JKO C;  3Q9V A;  3T5X A;  1QVT A;  2ZJQ F;  2JSP A;  2RAE A;  4UB6 C;  4CA0 A;  3HOX J;  4BJT A;  4BUP A;  3PO2 J;  4D7M A;  2QYO A;  3BTL A;  3P7N A;  3GYH X;  3NWT A;  4DJA A;  2BOL A;  2DJI A;  4HST A;  3HUG B;  1IRX A;  1BA5 A;  2ZXJ A;  3WG7 H;  4BQQ A;  4YFK F;  4OIP F;  3HOZ J;  1YHQ I;  1Y8R B;  3HKZ A;  3QPT A;  1G3T A;  1OCO H;  3BR0 A;  4MHG A;  3DF8 A;  4NQW B;  4J00 A;  2MLK A;  3LFU A;  4GXO A;  5IYC J;  1T39 A;  3BTJ A;  3A01 A;  3FDY A;  3KEO A;  4UY8 I;  2OC6 A;  5JHF A;  3CDI A;  4F92 B;  1SAX A;  2HTJ A;  2X0L A;  2HZT A;  1IXS B;  4A3E J;  3F8N A;  1D5Y A;  3Q0U A;  1QPM A;  4PJ0 C;  2K02 A;  5FGM A;  3DTK A;  1YS7 A;  3EYY A;  2ZME A;  4BEH A;  1V3F A;  2DJN A;  2NAZ A;  1EA3 A;  4UUT A;  3M9A A;  3U9G A;  2HR3 A;  4C2U A;  1FTZ A;  5TJJ A;  4B3A A;  1I3Q J;  2FNP A;  3OYJ A;  4A0X A;  2W1O A;  4I98 B;  1G6N A;  3DPU A;  1PUF A;  5JLX A;  3HOV J;  1JHF A;  1WJB A;  2Y69 H;  5DM7 F;  5EG0 B;  1WFX A;  5CYV A;  1S72 I;  4LFU A;  3GFL A;  5H2F C;  4EVI A;  4HYE A;  1W36 D;  4F52 A;  3CES A;  2RN7 A;  1O7F A;  1D1B A;  4DQ2 A;  3QPH A;  2P5K A;  1VQ5 I;  2VBW A;  5J8C A;  1LDK B;  2HDC A;  3CZ6 A;  4G12 A;  2Y0M A;  4YII A;  1CGP A;  5EGO B;  2DAO A;  3WTY C;  2RNJ A;  3ZOB A;  4Z2Y A;  1DPR A;  5DD4 A;  1DU0 A;  3GME A;  3A2K A;  1LE8 A;  2W24 A;  1FZP B;  4B47 A;  2P5L C;  4MFD A;  5F0F A;  2VN2 A;  2B7E A;  2NNN A;  2IEK A;  1TWA J;  1WJD A;  3DBH B;  3H9J A;  3DV8 A;  1FBQ A;  5DD8 A;  2JK3 A;  2E2I J;  2DBB A;  3FBN B;  4ESF A;  2W00 A;  3HTS B;  5A2Q Z;  4XN3 A;  3TGN A;  4UUV A;  4XLF A;  4YFX F;  4PFO A;  4M6Y A;  5F08 A;  3WTV C;  3E5Q A;  3CP8 A;  2PMZ A;  4JBA A;  1SEU A;  3LWF A;  2PMH A;  1UZC A;  3VOD A;  2LP0 A;  2NVT J;  2OAZ A;  4GCV A;  2XIG A;  1XN7 A;  3HG9 A;  2Z1D A;  3H3Z A;  1IF1 A;  4EJO A;  1BL0 A;  2FUG 2;  1I3A A;  1IN7 A;  3HOS A;  1D3Y A;  3BRO A;  2CQN A;  2LYC A;  1ZAR A;  3JRC A;  3J81 K;  2FQ4 A;  4KIS A;  1X3W B;  2RGV A;  4WF2 A;  3ZXS A;  2JA6 J;  3F22 A;  3D5S C;  5F64 A;  4QWQ A;  1YG2 A;  1E2X A;  5E1W A;  2CUZ A;  4IVN A;  5M3M J;  3GTL J;  5J1Y A;  3TED A;  4HAM A;  1IW7 F;  1S9H A;  1FYM A;  3H92 A;  3E6B A;  1XC5 A;  1BR2 A;  1VF9 A;  5EYR A;  4II2 A;  1J09 A;  3G3Z A;  3EUA A;  2NYX A;  3A03 A;  3OYH A;  1QVU A;  2P4W A;  4DZP A;  1UFM A;  4LOC A;  4MEX F;  5B1B H;  3OIQ A;  4OIR F;  5IT3 A;  1B1B A;  2FX0 A;  3F3X A;  1F1Z A;  3JRF A;  2COB A;  4BQN A;  3PM1 A;  4L9J A;  3SDG A;  1HCR A;  3A02 A;  1JT0 A;  1B6A A;  4MTE A;  3RPU A;  3IH2 A;  3PIP F;  2ZCW A;  3DLA A;  3BG6 A;  3L2R A;  2VIX A;  2VQH A;  3HM5 A;  2DFH A;  4HPQ A;  1H0M A;  1WCM J;  1ZG1 A;  5BS6 A;  2F5C A;  1FEX A;  1XX5 A;  2HGC A;  2CWE A;  5C44 J;  5E3M A;  1B9M A;  4M3B A;  5CVI A;  3F6V A;  3ZP5 A;  3S3N A;  2DMU A;  3U2R A;  4JK1 X;  5BOX A;  1X2M A;  3ZMT A;  2V6C A;  2LRE A;  3K70 D;  5E3O A;  2W57 A;  3BCA A;  2B0L A;  3HHH A;  2VXZ A;  1S3J A;  3BR1 A;  1SFX A;  2HS5 A;  1Y1W J;  4PJJ A;  5D4R A;  3V7R A;  4MQ9 F;  5M5Y J;  4XKV A;  4AUX A;  4HA8 A;  3CQZ J;  2ZXH A;  2HDW A;  4OMZ A;  2IS4 A;  2GA2 A;  3NWS A;  5HDN A;  3KP5 A;  5TIS C;  1CQT A;  3BLY A;  5J40 A;  2ZJ2 A;  4FCY A;  1FP1 D;  2R0Q C;  1WQ2 A;  5IT9 K;  2FXA A;  1ZGW A;  3U1K A;  5E8I A;  3ERE D;  4AIH A;  1GXP A;  3FIS A;  3AFH A;  5ED4 A;  2DXI A;  2OTJ I;  2AQF A;  2P7V B;  3BZ6 A;  1P9Q C;  3A1Y A;  3KP2 A;  4G94 A;  1QZE A;  1GUU A;  3ZGK A;  3HPG A;  4QTR A;  3BJ6 A;  3E6M A;  2RV8 A;  2HVQ A;  5CJ9 A;  3LQQ A;  2EH3 A;  4RAF A;  1MND A;  4EJT A;  4CZZ A;  3GX4 X;  5FKL A;  3TW6 A;  3PQK A;  4IEJ A;  1OQY A;  3GZN B;  5C3E J;  2F48 A;  1HLV A;  1JKQ C;  1WVR A;  2Y75 A;  4FE4 A;  2LG4 A;  3BC8 A;  3GTK J;  4XRF A;  1ON1 A;  4D5F A;  3OYC A;  2VPL A;  1U5T C;  1T56 A;  5DCM A;  1MD0 A;  4PGG A;  4BQA A;  4U0Y A;  1LEB A;  2PN6 A;  1X1A A;  3HSE A;  3PNY A;  1VQP I;  2X6X A;  2L9V A;  4II3 A;  3CJR B;  2MAB A;  1VQ4 I;  4XLP F;  1X3Z B;  4FTH A;  3QU3 A;  1MDM A;  1E3P A;  3RKQ A;  4M9X A;  4WWC A;  5IP6 A;  3BQZ A;  1L0O C;  4XKB A;  4N4N B;  3CCR I;  1WH7 A;  2MFZ A;  2K9Q A;  2Z2S B;  2QCO A;  2IA0 A;  5HLT A;  1X19 A;  3PIO F;  4PJN A;  5HVQ C;  4L5I A;  2DYS H;  4XOP A;  5JI6 A;  1LEA A;  4XRS A;  3CO7 C;  1R4M B;  4BNC A;  3ISP A;  2XSD C;  1JHH A;  2WY7 Q;  1MBF A;  3F8B A;  4XRS G;  1KZH A;  1FBU A;  4N9H A;  4I2O A;  2K5C A;  4YEL A;  2UZK A;  4BE1 A;  2PX9 A;  2IRF G;  4NC8 A;  1MNE A;  4ASN A;  1DU6 A;  3KET A;  3QYF A;  3Q3S A;  4D0P A;  4AYB N;  3HGY A;  1H88 C;  2X1E A;  4C30 A;  3KZI C;  3ZQH A;  1VQL I;  1HBX G;  2BE5 F;  4CO8 A;  3VYS B;  4OU0 A;  4DGW B;  6PAX A;  3S1N J;  1O57 A;  2LBF A;  1K83 J;  2VB6 A;  2PMZ N;  3K0L A;  4IHV A;  4S05 A;  1J59 A;  1P7I A;  3BT9 A;  1V55 H;  2E7X A;  3EUK L;  3I58 A;  4HNV A;  3HOT A;  1ETO A;  3JAM K;  1OLT A;  4HW0 A;  4A93 J;  2FE3 A;  1VQ8 I;  4XM3 A;  3ABT A;  2EFQ A;  4HX7 A;  1HW2 A;  2QZ8 A;  4CYC A;  2VAS A;  1FT9 A;  2RDP A;  2FOW A;  4Y7N J;  2R5Z A;  2BXZ A;  2ZNZ A;  3R60 A;  3JRA A;  3CTA A;  4EM0 B;  1KU9 A;  1JE8 A;  3IRR A;  1XB4 A;  2KIU A;  1IGN A;  1IV8 A;  3FXL A;  2C6Y A;  3FIW A;  3LST A;  2LRD A;  2E5Z A;  2VLA A;  2JMW A;  1D8K A;  2H1L A;  3HEF A;  4Z6Y A;  2DOA A;  3CP2 A;  2QGU A;  2OA4 A;  1KGS A;  2XF7 A;  3I4P A;  2HQR A;  3A4C A;  5E17 F;  3CC2 I;  3S2W A;  3L09 A;  1WRJ A;  1X58 A;  4ZJZ A;  3H9G A;  1U9O A;  2ZXW H;  2LTP A;  3Q0V A;  1ETQ A;  1FYL A;  4M73 A;  2E5N A;  1KU3 A;  3GTJ J;  3E6D A;  3TQN A;  2JWT A;  3Q5F A;  1FPQ A;  1ZG3 A;  1D8J A;  1K4S A;  5GAH J;  2ISZ A;  1E3O C;  4KYW A;  1T95 A;  2FRH A;  1SAU A;  4L0Z B;  1L3L A;  1BI1 A;  1W7P B;  1XSV A;  1Y39 A;  1OMI A;  3CJQ B;  5IOY A;  1IJW C;  1Z3Y A;  4CYD A;  3G4S I;  2HVS A;  4HEA 2;  4CIC A;  2VKV A;  1IG7 A;  1FJL A;  4RGU A;  5KVR A;  2ME0 A;  1CF7 B;  1IV6 A;  4AC0 A;  1JTY A;  1Y0N A;  1B8I B;  1XGN A;  2R7V A;  4QIW N;  3G73 A;  1Z0X A;  3IP4 B;  2WAD A;  1BI3 A;  2EIN H;  1OCP A;  1ODD A;  5HNF A;  5FRN A;  1UHW A;  5LEK A;  5DM6 F;  5FFX A;  2Y2Z A;  2BY1 A;  3CUQ A;  2Q8K A;  1POG A;  5HS9 A;  1MZB A;  2HPI A;  3SYT A;  4EJV A;  2Z3Y A;  2WBM A;  3FBI B;  2NVX J;  5L3C A;  3H0G J;  3OYF A;  3WE3 A;  2BW3 A;  3GFI A;  3O2P E;  3J7Y J;  1MSF C;  4C2T A;  2IGO A;  3BZC A;  2W25 A;  3K4K A;  5D5U B;  5CVU A;  1KQ8 A;  1YTY A;  3MKZ A;  4P9U A;  4HOB A;  5KAF C;  2Q2E B;  1P4W A;  4HV6 A;  1K79 A;  2W84 A;  5B1A H;  2F5D A;  4IHX A;  3K4C A;  1BBY A;  3JSP A;  3MD2 A;  1O3R A;  5KK1 A;  2BV6 A;  3OOU A;  4A3I J;  1BC8 C;  3OV8 A;  5E3N A;  3W2W A;  5HS8 A;  2E71 A;  5CVJ A;  1TLH B;  2QSF X;  2XAG A;  2NS0 A;  2UV1 A;  2XGC A;  4I0A A;  3OS1 A;  2XKO A;  1ZQ3 P;  3BPV A;  4E6K G;  1MBJ A;  2E1N A;  2G0E A;  2HKO A;  3L7W A;  1HQC A;  2O7O A;  2R7O A;  1YW7 A;  2VL8 A;  1R5G A;  4OIQ F;  5CVR A;  4A3F J;  3V7C A;  1B72 A;  2DA4 A;  5ILS A;  5HOO A;  5J47 A;  2L5Q A;  4AVZ A;  3SHF A;  4D5C A;  2ACJ A;  2HXI A;  3LA2 A;  1IUF A;  2M0C A;  3F8C A;  4UXN A;  2KHM A;  2R7D A;  3MQ0 A;  5HLI A;  2UWM A;  4IZZ A;  2OQG A;  5LRR A;  2H6C A;  2HYG D;  3LOC A;  1LB2 A;  3FWE A;  1ZTR A;  2KKO A;  2NS8 A;  2H6B A;  2DO7 A;  3ZN0 A;  1ZR4 A;  1ACI A;  3DKY A;  3GW2 A;  1I1G A;  1TNT A;  2ZB9 A;  2EWN A;  3RJP A;  3DKX A;  2EZL A;  1R49 A;  3GUD A;  2CW0 F;  3TKY A;  4RGS A;  5D5V B;  4BJ6 C;  3C2H A;  1SFE A;  2CO5 A;  3W2V A;  4WX9 A;  1HDD C;  1A5J A;  3WTU C;  2E60 A;  4HBL A;  2DT6 A;  4D1Q A;  1SFO J;  2R5Y B;  3OS2 A;  3DEW A;  3G2B A;  2OZU A;  3M8E A;  4LIU A;  2OBP A;  3FM3 A;  1ZR2 A;  3FXU A;  2IA1 A;  2P0W A;  4FAS D;  1P92 A;  2YSR A;  3PFY A;  4LG0 A;  4DW6 A;  3CO6 C;  3BWG A;  3OYK A;  1XDS A;  2X48 A;  4ON0 A;  2DFI A;  2G7H A;  2IS2 A;  2P6T A;  3O8H A;  2DK5 A;  1HF0 A;  2M9H A;  4LGW A;  1XDU A;  4FIS A;  3B6A A;  5FD6 A;  3L1P A;  2K4B A;  4BQO A;  1Z21 A;  1H8A C;  1BIA A;  1KYZ A;  3FMR A;  3CC4 I;  5H6R A;  3FXQ A;  4E7S A;  1RUO A;  1N75 A;  1TWF J;  3T0Y A;  3V8K A;  1IXC A;  3IL2 A;  1XGM A;  2W85 A;  1RIO H;  3U1D A;  4C3J J;  2I5U A;  3HC7 A;  2DMT A;  3CCL I;  3DU6 A;  3BPX A;  2NXN B;  3EET A;  2DPU A;  1UMQ A;  3E6C C;  4JQF A;  3CC7 I;  4U7B A;  3MZY A;  1MMA A;  3TP0 A;  5L3D A;  5KCM A;  5IYB J;  2KL4 A;  4C2M J;  1RPW A;  2DOD A;  4HNT A;  1HKT A;  2D5V A;  3VSK A;  2XRL A;  1VQK I;  5K5O A;  5BMZ A;  3MWM A;  1MBG A;  2YUS A;  1ZH5 A;  2R92 J;  1ONV A;  1VTN C;  3N4M A;  1G3Y A;  1FOW A;  3RKW A;  4B4C A;  2GOX B;  5LBQ A;  3D5R C;  4U88 A;  4DBQ A;  1HSJ A;  2TDX A;  2M4K A;  3F9K A;  4GYI A;  4XSZ F;  4FHT A;  2XAQ A;  2AXT C;  1AWC A;  4NC6 A;  5FLX Z;  3ZMU A;  3HRU A;  2QEX I;  2L4A A;  3OYG A;  2K9S A;  5D4S A;  1R22 A;  4IHT A;  2LVS A;  2KQR A;  4RAY A;  4J19 A;  1DPU A;  2DA5 A;  2RNG A;  3PNT A;  3GTQ J;  2MLG A;  1JUM A;  1JUP A;  2H09 A;  2ELH A;  3NAU A;  1DQU A;  3I4N J;  3TMO A;  4IOA F;  4IRH A;  3NQO A;  4KA4 A;  3SZP A;  3ZMZ A;  5FB2 A;  1U5T B;  5D5X B;  3QP5 A;  5K7F A;  3KIO A;  4ENK A;  1AU7 A;  3CCU I;  3OL4 A;  2Q0O A;  4ETS A;  3P9K A;  2XPW A;  1UG2 A;  2GXG A;  3HJE A;  1TWH J;  1BJA A;  4HV5 A;  4HDV A;  1HXD A;  3K1N A;  4Y33 A;  3H36 A;  5JR3 A;  1XCB A;  3KZZ A;  1X1P A;  2HQN A;  4LLL A;  5C4J J;  1ZGJ A;  3R0J A;  4M3F A;  2EZI A;  5FLV A;  4KIF A;  4KIG A;  2K86 A;  1WHU A;  4CZC A;  1EKE A;  4A2U A;  3LNQ A;  1KU7 A;  3M1C A;  3V4G A;  1X1D A;  2IPQ X;  2EZK A;  1PP8 F;  4UUS B;  1R58 A;  1WJA A;  2ECB A;  2L54 A;  1FSE A;  2NRA C;  3I54 A;  3IAS 2;  3GTG J;  3OYN A;  2CV0 A;  3A01 B;  2A3S A;  4GO1 A;  1IO2 A;  4PSX A;  4YFN F;  4RDU A;  3X2Q H;  2RQP A;  4KMU X;  2DCE A;  2WA0 A;  3M8J A;  2DA6 A;  3KE2 A;  3O3K A;  3BTC A;  2BY2 A;  3E5X A;  3HRS A;  2FNA A;  4BEH B;  2LSO A;  3JR9 A;  1BJZ A;  1RUN A;  5LGT A;  1IXR C;  2HYF A;  3DPL C;  3QOP A;  1YJW I;  3AG2 H;  1T33 A;  5FFZ A;  2HOA A;  2E34 A;  2LLK A;  4IQ4 A;  2WWY A;  1WJF A;  2GXB A;  2EPF A;  1K7A A;  3RTR A;  4NQW A;  1PUF B;  3J80 K;  5F1R A;  4RLF A;  5GAE J;  5E18 F;  1OCZ H;  2IXS A;  2EIJ H;  3D0S A;  1U8B A;  2RKH A;  2ZXI A;  1T6S A;  3FHN A;  1W0T A;  1WJE A;  3BDD A;  2VJI A;  4H4K C;  1YRN A;  1MIJ A;  2ETH A;  2HTS A;  2DT7 B;  4UVA A;  3WHB A;  1YJ9 I;  3KYC B;  3QPL A;  3QPS A;  4EGY A;  2V7F A;  5EZG A;  2HOE A;  2NOJ B;  4TV7 A;  3L2Q A;  4CCK A;  2XPU A;  1LE8 B;  2V9V A;  1IN8 A;  3ABK H;  1UCR A;  3S8P A;  4ZZL A;  5DUI A;  4S0H B;  1R1U A;  4E7Z A;  3CME I;  2K7L A;  2IGM A;  2FJ1 A;  4B43 A;  1T98 A;  2PFB A;  2R7F A;  2QEN A;  3ABM H;  4AYB A;  5C4X J;  2HVR A;  3OSG A;  1Z1D A;  3I5U A;  3KLO A;  3E1S A;  3E0J B;  3BG3 A;  3M8F A;  4IO9 F;  1U2W A;  4G6T B;  3JW4 A;  1O3T A;  1SD5 A;  1AKH A;  2O0Y A;  5IPA A;  1B59 A;  2F5V A;  2MD5 A;  3CCM I;  1Z7L A;  1OIS A;  5LHH A;  1RNL A;  1K6O A;  2K9L A;  1BN5 A;  4P9F A;  2V1U A;  1ETX A;  2LKX A;  1FIA A;  4ZC3 A;  1QZZ A;  5J4Y A;  1YW9 A;  3T8R A;  5LHG A;  2PQ8 A;  4A3L J;  2XAU A;  1TP4 A;  5EEG A;  2KT0 A;  2VBY A;  1MMN A;  3ROU A;  3CJN A;  1V5E A;  4F3Q A;  1MW7 A;  1VFC A;  4G9Y A;  1YJN I;  4ZDO A;  1T08 B;  3FXJ A;  4RA2 A;  1ETK A;  2MW8 A;  2L9R A;  3BY6 A;  2V4J C;  4AIK A;  2VPR A;  2X1C A;  2ZKZ A;  1D5V A;  4Q4Z F;  3HBL A;  1TWC J;  1YLF A;  3KEQ A;  4LIV A;  2UUZ A;  2VQG A;  5DYM A;  2H94 A;  3J7A Y;  2JUC A;  4JX5 A;  1PUE E;  5KAI C;  4X1E A;  2LFB A;  5HDK A;  2VKD A;  2Y0S N;  3BP8 A;  4IHY A;  1EH8 A;  4A69 C;  1IDZ A;  4NDL A;  4BE0 A;  1RR8 C;  1G3W A;  4R79 A;  1R1T A;  5TGT A;  4I76 A;  4ENN A;  4HF0 A;  5DTD A;  4NHJ A;  2AXL A;  2STT A;  3F8M A;  2WB1 N;  2J5P A;  2E7W A;  1AA7 A;  1O3Q A;  2A5Y B;  4JP0 A;  1HKQ A;  1ENH A;  1S29 A;  5FRO A;  2N8G A;  3S2H J;  3JRD A;  3WOD F;  1MH4 A;  1TNS A;  5IY5 H;  3G6E I;  4O5V A;  4A6E A;  2LY1 A;  2CGP A;  2PJR A;  5DUK A;  3KLN A;  3I59 A;  1I5Z A;  2HQ5 A;  1LVK A;  2LY2 A;  3GO5 A;  3ZR8 X;  2X6O A;  1IUY A;  3OY9 A;  4YIF A;  4V2F A;  4G6D A;  3ECO A;  5E1X A;  3CCE I;  3K1M A;  4JX4 A;  3I53 A;  2VE9 A;  2O3F A;  4EAT A;  4HQM A;  3KP4 A;  3LSH A;  3TDZ C;  4XON A;  3F8F A;  4BDZ A;  5ICF A;  2TRT A;  1N78 A;  2IJL A;  3FK6 A;  1WGX A;  2FF4 A;  2NVQ J;  4OWR B;  4IF4 A;  1FNN A;  2OD5 A;  4HNU A;  2IS1 A;  4M9S A;  1YIO A;  2P6S A;  3WGG A;  1IRG A;  1JT6 A;  1Y56 A;  3DCF A;  2L01 A;  4XNF A;  5K1Y A;  1B4A A;  3ZMV A;  3IV5 A;  3HIF A;  3OIP A;  4RS8 A;  3N05 A;  1ETW A;  2XSJ C;  5HDG A;  3EDP A;  3DBR B;  1ETY A;  1QU3 A;  2NNY A;  2AQE A;  2KZG A;  2W4S A;  3S2D J;  3QP6 A;  3H3U A;  2EFW A;  1EH6 A;  1SFK A;  2DTZ A;  2OUM A;  1DP7 P;  2E1O A;  3ZQC A;  4ANJ A;  4XOT A;  2R7T A;  5J4V A;  3LSP A;  2EV5 A;  1Y1V J;  4M3G A;  2QA4 I;  2EZH A;  5K5R A;  2EFO A;  1B9N A;  4C9Y A;  3GTM J;  2R7Z J;  3R4K A;  1PP7 U;  4OOI A;  5DCM B;  4ZDP A;  2GLO A;  2R3S A;  3I64 A;  4WXH A;  2YS9 A;  3VYT B;  4O3M A;  2JA2 A;  4RBO A;  1FTT A;  1LFP A;  1FSH A;  2BZT A;  5ILV A;  1LFU P;  2FA5 A;  2QUF A;  3K2A A;  1LDD A;  3C18 A;  2FQ3 A;  1REP C;  3MFK A;  1NHA A;  1BI0 A;  3HZJ A;  3S16 J;  1TWG J;  4RM3 A;  3C7J A;  1OFC X;  1PJR A;  3HSR A;  2V1X A;  2Z99 A;  2KDO A;  1LQ1 A;  2V9P A;  4XLC A;  1KYW A;  2LC2 A;  1GVJ A;  2O6G E;  1XSX A;  2XB5 A;  5B66 C;  2F6C A;  4PJM A;  1OYW A;  2R7X A;  1OCR H;  2DMQ A;  2P7C B;  1Z77 A;  4F91 B;  4XLA A;  2ID6 A;  4CCJ A;  3HRM A;  4M6V A;  3CMA I;  3S3O A;  2L02 A;  3UKG A;  2M8E A;  2EIL H;  1DGR M;  3SZG A;  1XS9 A;  3I0T A;  2ZBK A;  1PDN C;  3ECH A;  1GHC A;  4FX0 A;  1RI7 A;  2LBF B;  4I99 C;  5HS7 A;  3ZCO A;  2OCC H;  2XAF A;  3CD6 I;  4BXX J;  3W6V A;  2O61 A;  5AIP A;  4ABZ A;  2CUF A;  5LGN A;  1XSD A;  2CYY A;  4MLO A;  1IC8 A;  3A0B C;  4HF1 A;  1VQ7 I;  3ERM A;  2VT3 A;  3ZQQ A;  1S5L C;  4A5N A;  2B9S A;  1RKT A;  2ZME C;  4L18 B;  3PNV A;  3WHC A;  2JA8 J;  1XMK A;  4BBS J;  2MSY A;  3JRI A;  4CYC B;  4E7L A;  1RES A;  1SD4 A;  1TTY A;  4PZJ A;  1W7P D;  2OV7 A;  1QBJ A;  2OCE A;  3PJR A;  2R5Z B;  1Y8Q B;  3HHG A;  4I7H A;  4Y4R A;  5GPC A;  4BYY A;  3VFZ A;  1X3U A;  2JPC A;  4JX6 A;  5E8G A;  2STW A;  3ASO H;  3JTH A;  3D1N I;  1LJ9 A;  3W6K B;  2O8X A;  2M2E A;  2GQQ A;  3QRF F;  1P6R A;  4BS9 A;  3G1L A;  3H9Q A;  1JGG A;  4IPA A;  2BYV E;  2QWW A;  2A69 F;  3QQA A;  4J01 A;  4HZF A;  2JA5 J;  2WAQ N;  1DP3 A;  4I0B A;  4KJZ A;  2FOK A;  4BAC A;  2Z5U A;  1ZEL A;  5A2Q K;  3FX3 A;  4XID A;  1TT0 A;  5K7Z A;  2L7K A;  3HRT A;  3GWZ A;  2F5E A;  2JJ7 A;  3EUH A;  3GZ6 A;  1XD7 A;  3V8J A;  1STZ A;  1W5S A;  4CH7 A;  1R6R A;  2P8T A;  2M4G A;  2MGQ A;  2VBZ A;  1VI0 A;  2Z16 A;  2HFH A;  5M5X J;  3WU2 C;  2KJB A;  2LNB A;  4AD9 A;  3RKY A;  1WSU A;  2CFX A;  5K7H A;  2BBY A;  2YPR A;  2XC7 A;  2VON A;  3ESW B;  1XPX A;  1TQI A;  4MNU A;  4Y3O A;  3VSL A;  2R93 J;  2OJE D;  2DYR H;  3G71 I;  2LK2 A;  3SZT A;  3VYU B;  4AM3 A;  4RGX A;  1RKW A;  4DYQ A;  2P81 A;  5BPI A;  2QVO A;  4U0V A;  5F0H A;  5E1Z B;  1MJB A;  2ZFW A;  4XRM A;  3K4J A;  3LA3 A;  3W6J B;  3F21 A;  3WGI A;  5HOD A;  2GXA A;  5GPA A;  4F7Z A;  2B63 J;  1WPK A;  1S8N A;  3LSI A;  5GAD J;  1LPQ A;  4PK4 A;  1YI2 I;  3CDH A;  4P55 A;  3LL7 A;  4EQQ A;  3S15 J;  2LF8 A;  1XTA A;  4I09 A;  2VOO A;  2PJP A;  1IRF A;  4HDU A;  1YW8 A;  2CG4 A;  4MEY F;  2DLL A;  3KYL A;  1HKS A;  3LSJ A;  3KPH A;  1HST A;  3J7A O;  2LF7 A;  4AU7 A;  2VE8 A;  2KJC A;  3DEU A;  4NBQ A;  3KYD B;  1W36 C;  1EJ9 A;  1V54 H;  3KP6 A;  3L9F A;  1VZ0 A;  3BOQ A;  2JTV A;  1A35 A;  1YX5 A;  1APL C;  4MIM A;  1VQ9 I;  2L7M P;  2J5O A;  4LK0 F;  1X4O A;  3COA C;  5D5W B;  2HQA A;  4EJW A;  2FSW A;  1UEL B;  4UVB A;  3BCB A;  5FKK A;  3S1M J;  5KNL A;  4XLE A;  2IA2 A;  3IRQ A;  1TQP A;  2CW7 A;  1TL8 A;  2EFN A;  2E1M B;  1Z9C A;  1LFB A;  5E3L A;  1XGO A;  2Y9Y A;  4B3X A;  2F4I A;  2DFE A;  2E19 A;  3BZK A;  3HSF A;  3MKL A;  1F36 A;  5CKT A;  3BG9 A;  5GTH C;  4CDG A;  1UAA A;  2M3A A;  1O4X A;  2BHY A;  1OR7 A;  1G3S A;  2L2O A;  3OYI A;  3DFG A;  2EV6 A;  4M3E A;  2EQR A;  3TO7 A;  3KX2 A;  3RDI A;  1JXS A;  3E97 A;  1B72 B;  1NK3 P;  2NS7 A;  3HPH A;  1J7K A;  2I10 A;  4IRI A;  5DCF A;  1YIT I;  4LD5 A;  4L9V A;  3GXO A;  4E4H A;  3WTX C;  1J0R A;  3SDB A;  1P2F A;  4XMY A;  1XCV A;  1RZ4 A;  4Q48 A;  2KRH A;  2BXY A;  1R4N B;  2OTL I;  2FD5 A;  2BHZ A;  3ML6 A;  2FU4 A;  1MSE C;  3R61 A;  4HF2 A;  2M34 A;  3R6S A;  3F23 A;  3M7G A;  3H0D A;  3ASN H;  4P1W A;  1HA8 A;  3KP3 A;  3JRE A;  2M7B A;  1SVM A;  1PYV A;  1VND A;  3BR6 A;  5EEA A;  3KFW X;  3QWL A;  1UHM A;  2FML A;  4KUM A;  3GTO J;  1FIP A;  2CU7 A;  1A04 A;  4RB1 A;  3BTI A;  1GDT A;  1Z91 A;  2A6H F;  2CUJ A;  3D5L A;  4B8X A;  3FXO A;  4WK8 F;  2O9L A;  2WAF A;  1R7J A;  5D8K B;  4UNO A;  3CUO A;  3DKW A;  3GZ5 A;  1OCC H;  4CSW A;  1IN5 A;  2DU9 A;  1HOM A;  1X1B A;  2HNH A;  4Q47 A;  1YOV B;  3IWF A;  3K9T A;  1V4R A;  5FLM J;  2HPM A;  2GIV A;  4LG0 B;  1K78 B;  5HNH A;  3IC7 A;  1QQI A;  1WWX A;  1BI2 A;  2IVM A;  3EPZ A;  2KP6 A;  1IN6 A;  5J6X A;  4DBR A;  2R4G A;  2M30 A;  4EV0 A;  4E70 A;  3M3Y J;  1QGP A;  3DPT A;  3NEU A;  5L3E A;  4IQJ A;  2UXX A;  1FMV A;  3J81 Z;  5L3F A;  2D2W A;  3OIO A;  3K70 C;  1HC8 A;  3HXL A;  2QBY A;  2V79 A;  2PLY A;  3U21 A;  2JT1 A;  5IOZ A;  3FHZ A;  2VOP A;  5FKM A;  3QU6 A;  4M6X A;  2A05 A;  4CUG A;  4ZYD A;  4BXF A;  3E3V A;  1BW5 A;  4GDF A;  4AWX B;  4B48 A;  5F27 A;  4DOZ A;  3ELK A;  5DS9 A;  1EH7 A;  5E79 C;  4G7O F;  2ZC2 A;  2VKE A;  2AS5 F;  5ILU A;  5BPD A;  2M1B A;  2E1C A;  4YRV A;  1WI3 A;  4HX8 A;  3LSK A;  4EEF G;  1S6L A;  1ETV A;  2HI3 A;  1I6X A;  3DP7 A;  5CQG A;  3G1M A;  4LIT A;  2BVL A;  4A3B J;  3CCS I;  3MAJ A;  3AG3 H;  5H20 A;  2YU9 J;  3B6C A;  3QOD A;  4DNC A;  4KT5 C;  5LHI A;  3JRB A;  4W1U A;  5F04 A;  2DOF A;  3BQY A;  2Y0S A;  3KCC A;  5GTI C;  5K5Q A;  2MH9 A;  4D7N A;  3IKT A;  4O6J A;  4V19 K;  2HOT A;  4L5J A;  3K4N A;  2YX4 A;  2W48 A;  1FOK A;  2L3D A;  3S1Q J;  2JSC A;  2VI6 A;  3K6G A;  3I9V 2;  2WB1 A;  3MKY B;  3HL2 A;  2VJJ A;  1JJ8 C;  4ESB A;  3FF5 A;  3Q9S A;  2K40 A;  2XVC A;  4GRI A;  2WV0 A;  1USS A;  4UV9 A;  3M4O J;  1VQO I;  3JRH A;  4HLY A;  2D45 A;  3T1B A;  3GFM A;  5GAG J;  3JRG A;  5BNG A;  4IL6 C;  3AG4 H;  2JPB A;  2QF7 A;  3VYR B;  5IT9 Z;  4I01 A;  2K9M A;  2VQL A;  1IZ1 A;  3OSF A;  4KIB A;  3RQI A;  2FBI A;  1QA6 A;  3PO3 J;  3L2W A;  1ZRD A;  2DPD A;  2ECC A;  4F55 A;  1XGS A;  5ICG A;  3G1O A;  4G8X A;  4DIQ A;  2GM4 A;  1LDJ A;  2XGD A;  2QLZ A;  2JRM A;  3EUH C;  2ID3 A;  1U8R A;  1BC7 C;  2FEZ A;  2DT5 A;  2DQL A;  3ZQF A;  4BHP A;  4BJ5 C;  3OMY A;  3GTP J;  2X1D A;  2QM3 A;  3OL3 A;  1JKP C;  5B5E C;  2DDB A;  4LG3 A;  4N0B A;  2KFD A;  4CHU A;  5IP7 J;  3P9C A;  1Q1H A;  1Z67 A;  1W5C C;  2DDA A;  1J5Y A;  1FC3 A;  5IYD J;  3RI4 A;  1S7A A;  3FKI J;  1C0W A;  3J7Z I;  2KLO A;  2DQR A;  4LLG F;  2IT0 A;  2KRC A;  2CUE A;  4XIC A;  2DMN A;  4UV8 A;  3FZV A;  3S14 J;  3TBI A;  5CLS A;  1GT0 C;  4XSX F;  5DV5 A;  3SJM A;  2M87 A;  4RMN A;  3VPR A;  2QQA A;  2ZME B;  3FXM A;  3SEZ A;  4ZTF A;  2LKP A;  5LRS A;  1JUS A;  1FY7 A;  3HUG A;  3IKV A;  3CUQ C;  3ZQI A;  4JOM A;  1SVO A;  4UUS A;  5GP9 A;  4RAZ A;  4EM2 A;  3VWB A;  1G8X A;  2R7R A;  3WGH A;  2L0K A;  2BY3 A;  2MC3 A;  4B09 A;  4N4O B;  5ICC A;  4BXU A;  1FYK A;  5JLW A;  2LH9 A;  3K1P A;  2L9S A;  1R5H A;  4ZTJ A;  1F4K A;  2CW8 A;  3IAM 2;  3SEQ A;  1IAW A;  2CQK A;  1YRN B;  1R36 A;  3P5J A;  4F93 B;  3VEP A;  3CF5 F;  1N77 A;  2K27 A;  2QKL B;  1FMW A;  1T8I A;  1BR1 A;  3N97 A;  3PQJ A;  5EF6 A;  1ERD A;  3PUF A;  2HXO A;  1ITY A;  1AOY A;  2WC2 A;  2LD5 A;  2CFO A;  1U9N A;  1UHS A;  2E1M C;  2LDU A;  5LLQ A;  2L7F P;  1IDY A;  1KQ9 A;  5EG0 A;  3JAM Z;  2K3P A;  1NTC A;  4M72 A;  2E2J J;  4WXD A;  2OF7 A;  1QHG A;  1OR7 C;  2VC1 A;  3PL8 A;  3ULQ B;  5M3F J;  4X6A J;  2F4O B;  2LKS A;  3I71 A;  2ESH A;  3ABL H;  4CXF A;  2V6E A;  2XGE A;  2ICW G;  4P96 A;  3WU0 A;  4XQF A;  3AKZ A;  1AKH B;  2DA2 A;  3TP3 A;  3RPU D;  2CV2 A;  2JRT A;  4FQG A;  2E35 A;  5EJC A;  4UB8 C;  4YIR X;  3S17 J;  2PEX A;  5EGO A;  4XN0 A;  4GYG A;  5HLH A;  4RM2 A;  2DTR A;  4OAZ A;  1TQM A;  3LSM A;  4C3I J;  3HB9 A;  1LNW A;  2E2H J;  1OPC A;  1P4X A;  4L9N A;  5J1U A;  1PVE A;  5E20 A;  4P5O A;  2WTE A;  1BR4 A;  2KRF A;  2H8R A;  1JKR C;  5ICE A;  2PJR B;  2MG4 A;  3HGG A;  3QAH A;  2KIS A;  9ANT A;  1X4P A;  5FJ8 J;  2KMU A;  1RET A;  2ZNY A;  1J75 A;  2H1K A;  5TRD A;  1IN4 A;  2M45 A;  4KDP A;  2A5W A;  4I02 A;  2HU9 A;  5ERI A;  3MVP A;  2XRN A;  1ZN2 A;  2XF6 A;  2KDZ A;  1F5T A;  2WAQ A;  2XV4 S;  2YX7 A;  2CSO A;  1YS6 A;  1G59 A;  4OMY A;  3JTG A;  1KON A;  5J1R A;  3B73 A;  4XBF A;  2A07 F;  2FMY A;  1N25 A;  3OWT A;  4ZH4 F;  1VQM I;  4Y52 J;  4HQE A;  4NNJ A;  4EGZ A;  4A0Z A;  4WCG A;  2IGN A;  2ELK A;  1M1E B;  4KIT B;  4IJA A;  3L2U A;  2CQQ A;  2FBH A;  3V42 A;  2A68 F;  1YE9 A;  3K7A J;  2RQQ A;  1SC7 A;  3OR1 C;  3IHU A;  1I50 J;  2RRE A;  1TT5 B;  3OYE A;  2NVU B;  4BBR J;  3WTT C;  1P4A A;  1P7J A;  4FET A;  1U78 A;  3DWL E;  1MBH A;  3I59 B;  1D0Y A;  2X4H A;  3C1D A;  1R00 A;  5EDN A;  3GF2 A;  2HEO A;  3H5R A;  2GIZ A;  2YU3 A;  3F0C A;  2ME6 A;  4BHB A;  3NRV A;  5HLG A;  1J9I A;  1ZRF A;  3O8G A;  5AON A;  2L7Z A;  2VJ5 A;  3OYA A; 
#chains in the Genus database with same CATH homology
 1W4M A;  2COM A;  2RVC A;  3F6O A;  2XHK A;  5D8L B;  2Y48 A;  2FBK A;  5FLX K;  2ESN A;  1YFH A;  5FO5 A;  1DUX C;  3JSO A;  4PDK A;  4KFC A;  2DI3 A;  4EJU A;  1FLI A;  3C3W A;  1Y0U A;  1TBX A;  4HLX A;  3L2C A;  2EFP A;  2EK5 A;  4L0Y B;  4FX4 A;  2A6E F;  2VBX A;  1SMY F;  4UVC A;  3GEZ A;  5JHU A;  3R0A A;  2GA1 A;  3WTS C;  4ENM A;  1R1V A;  4AIJ A;  3IWZ A;  3MZH A;  5D6E A;  4Y17 A;  1T0F A;  4M74 A;  5EEH A;  3M1E A;  3SFZ A;  3P9I A;  4EM1 A;  1KQ0 A;  4RB3 C;  3RKX A;  4ZZD A;  1R23 A;  3BJO A;  1MDM B;  2GZW A;  1KU2 A;  5DDG A;  3RIR A;  2XUB A;  2ZO4 A;  1YYV A;  4LB6 B;  2ADU A;  1H9T A;  1S7O A;  3ZMD A;  3CLO A;  4LB5 A;  4QLC U;  5L3G A;  2YR2 A;  4KIC A;  2V1D A;  1MGT A;  3HYI A;  2OZ6 A;  4FT8 A;  1T38 A;  1QZY A;  2L4M A;  2HWV A;  2PMU A;  3KP7 A;  3DQV C;  2EA2 A;  2BEO A;  2Z33 A;  4Q5S F;  3EQL F;  3LFK A;  3ZQ7 A;  1DDN A;  1WKM A;  1UST A;  3DXJ F;  4LJZ F;  3WTW C;  1ZG5 A;  1J2X A;  2PG4 A;  2IW5 A;  1ON2 A;  2F5F A;  4AVP A;  2A61 A;  2DW4 A;  2ISY A;  2XAS A;  3SXY A;  1H9G A;  4MQV A;  4KN7 X;  1WI9 A;  2P5V A;  4XLN F;  2KIF A;  3ZN1 A;  1I1S A;  1SD6 A;  2XGX A;  4A0Y A;  2XAJ A;  3K69 A;  1TW2 A;  4KN4 X;  4M71 A;  3AAF A;  3FXR A;  1SFU A;  5LGU A;  2D1V A;  5BQT A;  2HKX A;  4G6Q A;  4ZYG A;  3WTZ A;  3VB2 A;  4LK1 F;  2OQR A;  4M9Z A;  1BM9 A;  5JFR A;  4R8H A;  3KZY A;  3TOB A;  4IXA A;  1E17 A;  1SMT A;  2H27 A;  3LAJ A;  5J8F A;  1XMA A;  3CUQ B;  4OIN F;  1ZLK A;  1W7P A;  2MH2 A;  1Z6T A;  4ZYE A;  4PCQ A;  4H0E A;  3TDU C;  1MKM A;  4MGR A;  1MJ9 A;  1CF7 A;  2XAH A;  1Z05 A;  2RC4 A;  4L9T A;  3V8L A;  5DEQ A;  2F2E A;  4YG2 F;  4S04 A;  3ZPL A;  3VOE A;  1G4D A;  3MEX A;  1ZHF A;  4G7H F;  1I27 A;  1TW3 A;  3V7S A;  5D6F A;  3K2Z A;  2XRO A;  4MTD A;  1OKR A;  1HW1 A;  2O03 A;  1OYI A;  3REO A;  1HW5 A;  3OOP A;  4BH9 A;  4Y13 A;  1ZYR F;  3RYP A;  2Q2E A;  4U7D A;  3J80 Z;  2UXN A;  3ZMS A;  4KMF A;  3FMS A;  3FMQ A;  4RB0 A;  1SD7 A;  3RPQ A;  3WG9 A;  3RYR A;  2Z9O A;  1YQA A;  4WXC A;  2G9W A;  2DK8 A;  3BJA A;  1YO5 C;  3HTU A;  4G7Z F;  5AIQ A;  1ZGA A;  3SQN A;  1ZAO A;  4BHC A;  2EA4 A;  1UB9 A;  1Z6R A;  2G7U A;  2MA3 A;  1LVA A;  4HX4 A;  3LQR A;  1BIB A;  1QNT A;  2EJR A;  2EV0 A;  3T8T A;  4A5M A;  2MBF A;  1EV7 A;  4LLN A;  4NB5 A;  2BGC A;  1U6G A;  4A6D A;  3LAP A;  4IRG A;  2QBY B;  1FP2 A;  3EYI A;  4IHS A;  1ZRC A;  1FWZ A;  3WU1 B;  1W5T A;  1JGS A;  3B02 A;  3TO6 A;  1FBS A;  1ZRE A;  4A12 A;  4RB2 C;  2OU2 A;  3PFI A;  1K78 A;  4KNY A;  3GLX A;  3E5U A;  4LMY A;  5FD5 A;  2QQ9 A;  1U3E M;  3MCZ A;  2VT2 A;  3FM5 A;  5JVT A;  4K2E A;  2VC0 A;  1ULY A;  1ZLJ A;  1O3S A;  3LA7 A;  4RGR A;  3GFJ A;  2IP2 A;  5H6Q A;  2QQB A;  4R1H A;  4PGH A;  1KA8 A;  3TOA A;  1F9N A;  1OYY A;  1T2K A;  2D1H A;  1GXQ A;  5F6F A;  4ESJ A;  5CVV A;  2VOD A;  3GVA A;  4EMS A;  2KIM A;  2K4J A;  2PI0 A;  3ABU A;  2GWR A;  3L00 A;  2PBI A;  3F72 A;  3O6B B;  2EB7 A;  3TO9 A;  2XKP A;  1MJA A;  4Y15 A;  4OIO F;  1Z7U A;  1O7L A;  4N9I A;  1U5T A;  4CGZ A;  4BAY A;  5LEJ A;  2JZY A;  3WE2 A;  4ENJ A;  1QO0 D;  1FX7 A;  1BOA A;  4ZYH A;  4U0W A;  4UHT A;  2GAU A;  2M5W A;  4GGG A;  5L3B A;  3Q9V A;  3T5X A;  2QYO A;  3P7N A;  3GYH X;  2ZXJ A;  4YFK F;  4OIP F;  3QPT A;  1G3T A;  4MHG A;  3DF8 A;  2MLK A;  4GXO A;  1T39 A;  3KEO A;  1SAX A;  2HTJ A;  2X0L A;  2HZT A;  1IXS B;  3F8N A;  1QPM A;  5FGM A;  2K02 A;  1YS7 A;  3EYY A;  2ZME A;  1V3F A;  2NAZ A;  3M9A A;  3U9G A;  2HR3 A;  5TJJ A;  2FNP A;  4A0X A;  4I98 B;  1G6N A;  1JHF A;  5CYV A;  4LFU A;  3GFL A;  4EVI A;  4HYE A;  2RN7 A;  1O7F A;  4DQ2 A;  3QPH A;  2P5K A;  2VBW A;  5J8C A;  1LDK B;  2HDC A;  2Y0M A;  4YII A;  1CGP A;  2DAO A;  3WTY C;  2RNJ A;  4Z2Y A;  1DPR A;  5DD4 A;  2W24 A;  1FZP B;  2P5L C;  2VN2 A;  2NNN A;  3DV8 A;  1FBQ A;  5DD8 A;  2DBB A;  4ESF A;  3HTS B;  5A2Q Z;  3TGN A;  4UUV A;  4YFX F;  4M6Y A;  3WTV C;  3E5Q A;  4JBA A;  3LWF A;  2PMH A;  3VOD A;  2OAZ A;  4GCV A;  2XIG A;  1XN7 A;  3H3Z A;  1IF1 A;  4EJO A;  1IN7 A;  3HOS A;  1D3Y A;  3BRO A;  1ZAR A;  3J81 K;  2RGV A;  4WF2 A;  3F22 A;  5F64 A;  4QWQ A;  1YG2 A;  1E2X A;  5E1W A;  4IVN A;  4HAM A;  1IW7 F;  1FYM A;  3H92 A;  3E6B A;  3G3Z A;  2NYX A;  2P4W A;  1UFM A;  4MEX F;  4OIR F;  5IT3 A;  1B1B A;  3F3X A;  1F1Z A;  4L9J A;  1B6A A;  4MTE A;  3RPU A;  2ZCW A;  1H0M A;  1ZG1 A;  5BS6 A;  2F5C A;  2HGC A;  2CWE A;  1B9M A;  5CVI A;  3F6V A;  3ZP5 A;  3U2R A;  4JK1 X;  5BOX A;  3ZMT A;  2V6C A;  2W57 A;  2B0L A;  3HHH A;  2VXZ A;  1S3J A;  1SFX A;  2HS5 A;  5D4R A;  3V7R A;  4MQ9 F;  4HA8 A;  4OMZ A;  2GA2 A;  5HDN A;  3KP5 A;  2ZJ2 A;  1FP1 D;  1WQ2 A;  5IT9 K;  2FXA A;  5E8I A;  3ERE D;  4AIH A;  1GXP A;  5ED4 A;  2P7V B;  3BZ6 A;  4G94 A;  3KP2 A;  3BJ6 A;  3E6M A;  2RV8 A;  5CJ9 A;  3LQQ A;  4EJT A;  4CZZ A;  3GX4 X;  3PQK A;  2Y75 A;  4XRF A;  1ON1 A;  1U5T C;  5DCM A;  1MD0 A;  4PGG A;  4BQA A;  4U0Y A;  1LEB A;  2PN6 A;  3HSE A;  4XLP F;  3QU3 A;  1MDM A;  4M9X A;  4WWC A;  1L0O C;  2IA0 A;  5HVQ C;  4L5I A;  5JI6 A;  3CO7 C;  1LEA A;  4BNC A;  3ISP A;  1JHH A;  3F8B A;  1FBU A;  4N9H A;  4I2O A;  2UZK A;  2IRF G;  4ASN A;  3KET A;  4D0P A;  1HBX G;  2BE5 F;  4CO8 A;  4OU0 A;  6PAX A;  1O57 A;  3K0L A;  4S05 A;  1J59 A;  2E7X A;  3I58 A;  3HOT A;  3JAM K;  4HW0 A;  2FE3 A;  3ABT A;  2EFQ A;  4HX7 A;  1HW2 A;  2QZ8 A;  1FT9 A;  2RDP A;  2ZNZ A;  3R60 A;  3CTA A;  4EM0 B;  1KU9 A;  1JE8 A;  3IRR A;  1XB4 A;  2KIU A;  2C6Y A;  3LST A;  1D8K A;  2OA4 A;  1KGS A;  3I4P A;  2HQR A;  5E17 F;  3S2W A;  3L09 A;  1WRJ A;  1FYL A;  4M73 A;  1KU3 A;  3E6D A;  3TQN A;  3Q5F A;  1D8J A;  1FPQ A;  1ZG3 A;  2ISZ A;  4KYW A;  2FRH A;  4L0Z B;  1L3L A;  1BI1 A;  1W7P B;  1XSV A;  1OMI A;  4CYD A;  4CIC A;  4RGU A;  5KVR A;  1CF7 B;  1XGN A;  3G73 A;  1BI3 A;  1ODD A;  1UHW A;  5LEK A;  5FFX A;  3CUQ A;  2Q8K A;  5HS9 A;  1MZB A;  4EJV A;  2Z3Y A;  5L3C A;  3WE3 A;  3GFI A;  3O2P E;  2W25 A;  5D5U B;  5CVU A;  1KQ8 A;  1YTY A;  4P9U A;  4HOB A;  1P4W A;  4HV6 A;  1K79 A;  2W84 A;  2F5D A;  1BBY A;  3JSP A;  1O3R A;  5KK1 A;  2BV6 A;  1BC8 C;  3OV8 A;  5HS8 A;  5CVJ A;  1TLH B;  2XAG A;  2NS0 A;  4I0A A;  2XKO A;  3BPV A;  2E1N A;  2HKO A;  3L7W A;  1HQC A;  1YW7 A;  1R5G A;  4OIQ F;  5CVR A;  3V7C A;  5ILS A;  5HOO A;  3SHF A;  2ACJ A;  3LA2 A;  3F8C A;  4UXN A;  3MQ0 A;  2R7D A;  5HLI A;  2UWM A;  2OQG A;  5LRR A;  2H6C A;  2HYG D;  1LB2 A;  3FWE A;  2KKO A;  2H6B A;  3ZN0 A;  2DO7 A;  3GW2 A;  1I1G A;  1TNT A;  2EWN A;  3RJP A;  3GUD A;  2CW0 F;  3TKY A;  4RGS A;  5D5V B;  1SFE A;  2CO5 A;  4WX9 A;  3WTU C;  4HBL A;  2OZU A;  3M8E A;  2OBP A;  3FM3 A;  3FXU A;  2IA1 A;  1P92 A;  2YSR A;  4LG0 A;  3CO6 C;  3BWG A;  1XDS A;  4ON0 A;  2DFI A;  2G7H A;  2P6T A;  2DK5 A;  4LGW A;  1XDU A;  5FD6 A;  2K4B A;  1BIA A;  1KYZ A;  3FMR A;  5H6R A;  3FXQ A;  1RUO A;  3T0Y A;  3V8K A;  1IXC A;  3IL2 A;  1XGM A;  2W85 A;  1RIO H;  3U1D A;  3BPX A;  3EET A;  2DPU A;  3E6C C;  4JQF A;  4U7B A;  3MZY A;  5L3D A;  1HKT A;  5K5O A;  5BMZ A;  3MWM A;  1ZH5 A;  1ONV A;  1VTN C;  3N4M A;  1G3Y A;  3RKW A;  5LBQ A;  4U88 A;  1HSJ A;  2TDX A;  4GYI A;  4XSZ F;  4FHT A;  2XAQ A;  1AWC A;  5FLX Z;  3ZMU A;  3HRU A;  2L4A A;  5D4S A;  1R22 A;  4IHT A;  4RAY A;  1DPU A;  2MLG A;  2H09 A;  2ELH A;  4IRH A;  3NQO A;  4KA4 A;  3SZP A;  3ZMZ A;  5FB2 A;  1U5T B;  5D5X B;  3QP5 A;  4ENK A;  2Q0O A;  4ETS A;  3P9K A;  2GXG A;  1BJA A;  4HV5 A;  4HDV A;  1HXD A;  3K1N A;  5JR3 A;  1XCB A;  3KZZ A;  2HQN A;  4LLL A;  1ZGJ A;  3R0J A;  4KIF A;  4KIG A;  2K86 A;  4A2U A;  1KU7 A;  3V4G A;  2IPQ X;  1PP8 F;  1R58 A;  2L54 A;  1FSE A;  2NRA C;  3I54 A;  2A3S A;  4GO1 A;  4YFN F;  2RQP A;  4KMU X;  3KE2 A;  3O3K A;  3E5X A;  3HRS A;  2FNA A;  2LSO A;  1RUN A;  5LGT A;  1IXR C;  2HYF A;  3DPL C;  3QOP A;  5FFZ A;  2WWY A;  2GXB A;  1K7A A;  3RTR A;  4NQW A;  3J80 K;  5F1R A;  5E18 F;  3D0S A;  2RKH A;  1T6S A;  3BDD A;  2ETH A;  2HTS A;  4UVA A;  4EGY A;  2HOE A;  4TV7 A;  2V9V A;  1IN8 A;  1UCR A;  4ZZL A;  5DUI A;  1R1U A;  2K7L A;  1T98 A;  2PFB A;  2R7F A;  2QEN A;  1Z1D A;  3I5U A;  3KLO A;  3M8F A;  1U2W A;  1O3T A;  3JW4 A;  1SD5 A;  2O0Y A;  1B59 A;  2MD5 A;  5LHH A;  1RNL A;  1K6O A;  1BN5 A;  4P9F A;  2V1U A;  1QZZ A;  1YW9 A;  3T8R A;  5LHG A;  2PQ8 A;  5EEG A;  2VBY A;  3ROU A;  3CJN A;  4G9Y A;  3BY6 A;  4AIK A;  2ZKZ A;  1D5V A;  4Q4Z F;  1YLF A;  3KEQ A;  5DYM A;  2H94 A;  1PUE E;  5HDK A;  3BP8 A;  1EH8 A;  1G3W A;  4R79 A;  1R1T A;  4ENN A;  4HF0 A;  4NHJ A;  2AXL A;  2STT A;  3F8M A;  2J5P A;  2E7W A;  1O3Q A;  2A5Y B;  1HKQ A;  1S29 A;  3WOD F;  1TNS A;  4O5V A;  4A6E A;  2CGP A;  5DUK A;  3KLN A;  3I59 A;  1I5Z A;  3GO5 A;  1IUY A;  4YIF A;  4G6D A;  3ECO A;  5E1X A;  3K1M A;  3I53 A;  2VE9 A;  2O3F A;  4HQM A;  3KP4 A;  3TDZ C;  3F8F A;  5ICF A;  2IJL A;  2FF4 A;  4IF4 A;  1FNN A;  2OD5 A;  4M9S A;  1YIO A;  2P6S A;  3WGG A;  1IRG A;  2L01 A;  5K1Y A;  1B4A A;  3ZMV A;  3HIF A;  4RS8 A;  5HDG A;  3EDP A;  2NNY A;  3QP6 A;  3H3U A;  2EFW A;  1EH6 A;  1DP7 P;  2EV5 A;  5K5R A;  2EFO A;  1B9N A;  3R4K A;  1PP7 U;  4OOI A;  5DCM B;  2R3S A;  3I64 A;  4WXH A;  4O3M A;  1FSH A;  5ILV A;  2FA5 A;  2QUF A;  1LDD A;  3C18 A;  2FQ3 A;  1REP C;  3MFK A;  1NHA A;  1BI0 A;  3C7J A;  3HSR A;  2V1X A;  2Z99 A;  1LQ1 A;  1KYW A;  1GVJ A;  2O6G E;  1XSX A;  1OYW A;  2P7C B;  3HRM A;  2L02 A;  2M8E A;  1PDN C;  3I0T A;  2ZBK A;  3ECH A;  1GHC A;  4FX0 A;  1RI7 A;  5HS7 A;  2XAF A;  2O61 A;  5AIP A;  5LGN A;  1XSD A;  2CYY A;  4HF1 A;  2VT3 A;  4A5N A;  4L18 B;  1XMK A;  1SD4 A;  1TTY A;  4PZJ A;  1W7P D;  1QBJ A;  3HHG A;  4I7H A;  4BYY A;  3VFZ A;  1X3U A;  2JPC A;  5E8G A;  2STW A;  3JTH A;  1LJ9 A;  3W6K B;  2O8X A;  3QRF F;  2GQQ A;  1P6R A;  4IPA A;  2BYV E;  2QWW A;  2A69 F;  4HZF A;  4I0B A;  2FOK A;  2Z5U A;  5A2Q K;  3FX3 A;  3HRT A;  3GWZ A;  2F5E A;  3EUH A;  3GZ6 A;  1XD7 A;  3V8J A;  1STZ A;  1W5S A;  2P8T A;  2VBZ A;  2HFH A;  2KJB A;  2LNB A;  4AD9 A;  3RKY A;  1WSU A;  2CFX A;  2BBY A;  2YPR A;  2VON A;  1TQI A;  4MNU A;  3SZT A;  4RGX A;  5BPI A;  2QVO A;  4U0V A;  5E1Z B;  1MJB A;  2ZFW A;  3LA3 A;  3W6J B;  3F21 A;  3WGI A;  4F7Z A;  1S8N A;  3CDH A;  4P55 A;  4EQQ A;  2LF8 A;  4I09 A;  2VOO A;  2PJP A;  1IRF A;  4HDU A;  1YW8 A;  2CG4 A;  4MEY F;  2DLL A;  1HKS A;  3J7A O;  1HST A;  2LF7 A;  2VE8 A;  2KJC A;  3DEU A;  3KP6 A;  3L9F A;  3BOQ A;  2JTV A;  2J5O A;  4LK0 F;  3COA C;  5D5W B;  4EJW A;  2FSW A;  4UVB A;  2IA2 A;  3IRQ A;  1TQP A;  2EFN A;  1Z9C A;  1XGO A;  3HSF A;  4CDG A;  1OR7 A;  1G3S A;  3DFG A;  2EV6 A;  3TO7 A;  3RDI A;  1JXS A;  3E97 A;  1J7K A;  4IRI A;  5DCF A;  4LD5 A;  4L9V A;  3GXO A;  3WTX C;  1J0R A;  1P2F A;  1XCV A;  1RZ4 A;  4Q48 A;  3ML6 A;  2FU4 A;  3R61 A;  4HF2 A;  3R6S A;  3F23 A;  3M7G A;  3KP3 A;  3KFW X;  1UHM A;  2FML A;  4KUM A;  1A04 A;  4RB1 A;  1Z91 A;  2A6H F;  3D5L A;  4B8X A;  4WK8 F;  5D8K B;  1R7J A;  4UNO A;  3CUO A;  3DKW A;  3GZ5 A;  1IN5 A;  2DU9 A;  4Q47 A;  3IWF A;  3K9T A;  1V4R A;  2GIV A;  4LG0 B;  1K78 B;  3IC7 A;  1QQI A;  1WWX A;  1BI2 A;  2IVM A;  5J6X A;  1IN6 A;  2M30 A;  4EV0 A;  4E70 A;  1QGP A;  3DPT A;  3NEU A;  5L3E A;  2UXX A;  3J81 Z;  5L3F A;  2D2W A;  2QBY A;  2V79 A;  2PLY A;  2JT1 A;  3FHZ A;  2VOP A;  3QU6 A;  4M6X A;  4ZYD A;  3E3V A;  4AWX B;  3ELK A;  1EH7 A;  4G7O F;  2AS5 F;  5ILU A;  5BPD A;  2M1B A;  2E1C A;  4HX8 A;  1S6L A;  1I6X A;  3DP7 A;  3MAJ A;  5H20 A;  4DNC A;  4KT5 C;  5LHI A;  3KCC A;  5K5Q A;  2MH9 A;  3IKT A;  4O6J A;  4L5J A;  2YX4 A;  1FOK A;  2L3D A;  2JSC A;  4ESB A;  3FF5 A;  3Q9S A;  2XVC A;  2WV0 A;  1USS A;  4UV9 A;  4HLY A;  2D45 A;  3T1B A;  3GFM A;  2JPB A;  5IT9 Z;  4I01 A;  1IZ1 A;  4KIB A;  2FBI A;  1ZRD A;  2DPD A;  1XGS A;  5ICG A;  4G8X A;  1LDJ A;  2QLZ A;  1U8R A;  1BC7 C;  2FEZ A;  2DT5 A;  2DQL A;  4BHP A;  2QM3 A;  4N0B A;  4CHU A;  3P9C A;  1Q1H A;  1J5Y A;  1FC3 A;  3RI4 A;  1S7A A;  1C0W A;  4LLG F;  2DQR A;  2IT0 A;  4UV8 A;  3FZV A;  5CLS A;  4XSX F;  5DV5 A;  2M87 A;  2QQA A;  2ZME B;  2LKP A;  5LRS A;  1FY7 A;  3HUG A;  3IKV A;  3CUQ C;  4RAZ A;  4EM2 A;  3WGH A;  2MC3 A;  4B09 A;  5ICC A;  4BXU A;  1FYK A;  3K1P A;  1R5H A;  1F4K A;  1IAW A;  2CQK A;  1R36 A;  3VEP A;  2K27 A;  3N97 A;  3PQJ A;  1AOY A;  2WC2 A;  2LDU A;  5LLQ A;  1KQ9 A;  3JAM Z;  4M72 A;  4WXD A;  2VC1 A;  3ULQ B;  3I71 A;  2ESH A;  4CXF A;  4P96 A;  3WU0 A;  2JRT A;  2PEX A;  4GYG A;  5HLH A;  2DTR A;  1TQM A;  1LNW A;  1OPC A;  1P4X A;  4L9N A;  5E20 A;  4P5O A;  2WTE A;  2KRF A;  5ICE A;  3QAH A;  2ZNY A;  1J75 A;  5TRD A;  1IN4 A;  2M45 A;  4KDP A;  4I02 A;  5ERI A;  2XRN A;  1ZN2 A;  1F5T A;  2XV4 S;  2YX7 A;  2CSO A;  1YS6 A;  4OMY A;  3JTG A;  3B73 A;  4XBF A;  2A07 F;  2FMY A;  4ZH4 F;  4HQE A;  4EGZ A;  4A0Z A;  4WCG A;  4IJA A;  2FBH A;  2A68 F;  3IHU A;  1U78 A;  3WTT C;  1P4A A;  3I59 B;  2X4H A;  3C1D A;  1R00 A;  3GF2 A;  2HEO A;  2YU3 A;  5HLG A;  4BHB A;  3NRV A;  1J9I A;  1ZRF A;  5AON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...