3U2RA

Crystal structure of marr transcription factor from planctomyces limnophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
135
Chain Sequence
RFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVHPEGMATLQIADRLAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Regulatory protein MarR
publication title Crystal structure of MarR transcription factor from Planctomyces limnophilus
rcsb
source organism Planctomyces limnophilus
total genus 49
structure length 135
sequence length 138
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u2rA00
3B02A 5CYVA 1B9NA 5DV5A 4FX0A 4OMZA 2XAJA 3TOBA 2EFWA 2IW5A 1QO0D 2GQQA 3MZYA 1DPUA 2QWWA 3P7NA 4KMFA 2X4HA 2HOEA 4HX8A 2DK5A 2KIMA 5BQTA 1BBYA 3BP8A 1LQ1A 2BGCA 2RQPA 3CLOA 3AAFA 3SFZA 3EDPA 2HYFA 5K5OA 1T6SA 4OMYA 2P8TA 3ECOA 1OR7A 3J80K 4R8HA 2HYGD 3IL2A 3R0JA 4EMSA 3IWZA 3IRRA 2Y0MA 2VODA 2MH9A 4KA4A 2O03A 4ZYEA 2Z9OA 4L9NA 3KP5A 3GFMA 4P96A 2V1XA 4RAYA 3E97A 2IPQX 4AD9A 4M74A 4EJUA 1EH8A 5HS9A 1ULYA 2IA0A 3T1BA 3I0TA 4I02A 2Z5UA 2G7HA 3GZ5A 2IVMA 1FOKA 4HQMA 1STZA 1R1TA 3BJOA 1SMTA 4L9TA 3WTSC 2P6SA 3BROA 4YFXF 4RGRA 4U0VA 5LGUA 2MLKA 2IP2A 1WKMA 3GUDA 1H9GA 1Y0UA 2YPRA 3PQKA 3P9KA 1F4KA 4P5OA 2MD5A 3Q9VA 5K5RA 1Z1DA 1ZLKA 3CTAA 4BAYA 2MA3A 3F3XA 3VB2A 1QNTA 2HTSA 3ERED 5ICGA 3DPTA 2EB7A 3GO5A 2LSOA 1HKTA 3F8MA 2IJLA 1SFEA 3KP6A 3V7CA 3ZMSA 3WGHA 3IKVA 1YW9A 2FU4A 2WV0A 1J5YA 1I6XA 4U88A 1PUEE 4XLNF 2Y48A 2XAGA 1YQAA 3KEQA 3QPTA 4HDUA 2XAHA 3FMSA 4EJOA 3HHHA 2ESNA 1TTYA 3CO6C 1U78A 3FXRA 3M1EA 2F2EA 3PFIA 1L0OC 3GFLA 4HLXA 5FD5A 2A69F 3O3KA 5D4RA 3M7GA 2EV6A 1JGSA 5D8LB 1EH6A 4BHPA 1JHHA 2QM3A 3DPLC 1YO5C 4KIBA 4ENKA 4N0BA 2K02A 5FLXK 1S29A 2DBBA 4WXHA 5J8CA 1GXQA 2CQKA 4A6DA 1U2WA 4TV7A 2CWEA 1PDNC 3K2ZA 2MLGA 2QUFA 2CSOA 1YS6A 5HVQC 4EM1A 3JAMZ 5CLSA 4RB1A 2VBWA 3H3ZA 2V6CA 2VC0A 4UVCA 1IUYA 5D6EA 4MQVA 2G7UA 2EA4A 5LEJA 4NQWA 4YIFA 1YTYA 3RKWA 4GO1A 3CJNA 3BPVA 3KLOA 1SMYF 2XGXA 2ZNZA 1YG2A 3SXYA 1WI9A 1O7FA 1GHCA 1J59A 1C0WA 1IXSB 4BHCA 4M6XA 3GLXA 5L3BA 3DXJF 2V1DA 3I4PA 1BI3A 3JW4A 4S04A 1F1ZA 5E1WA 1R5GA 1BIAA 2PMUA 3QAHA 3GXOA 2FRHA 4KMUX 3V7SA 1P92A 3ABUA 1HQCA 3DF8A 2Y75A 2P5LC 1Z6RA 2OD5A 2QENA 5DUKA 3RPQA 2RGVA 5H6RA 1JE8A 1IN8A 4EVIA 5HLHA 1ZRCA 4IRGA 4KIFA 1QPMA 2HFHA 3KE2A 2XIGA 5CJ9A 5JR3A 1D5VA 3MWMA 1K79A 2TDXA 3HOTA 3ZMTA 2RC4A 3NQOA 1XMAA 2F5DA 4MTDA 2A6EF 4LJZF 5FB2A 1BI1A 3L09A 1CGPA 2JPBA 2R7DA 5LLQA 1Q1HA 2RDPA 5F6FA 2A6HF 4OIQF 3WE2A 1G6NA 3HRSA 2C6YA 4MTEA 4XSZF 4KFCA 1XD7A 2DLLA 2OZ6A 3HRUA 4I98B 2FA5A 3BDDA 4HBLA 3RYRA 4I01A 1G3SA 2P7CB 1KQ8A 3LA7A 4G7OF 5ERIA 1S3JA 1R1VA 3LA2A 3ZMUA 3FHZA 4RB0A 3MFKA 2J5OA 3FMQA 4RB2C 4EGZA 4CYDA 2A07F 4HV6A 5E18F 4HZFA 3GZ6A 2RV8A 1R1UA 1FX7A 3MEXA 3H3UA 4B8XA 2E7WA 2F5FA 4I0BA 3E3VA 4L18B 2NNNA 4L5IA 3LFKA 4AIJA 2HDCA 3S2WA 2P7VB 1O3TA 3N97A 3WTXC 4Z2YA 2RVCA 2YU3A 1LVAA 4G9YA 2YR2A 4ENJA 1X3UA 2ISZA 3RI4A 3ROUA 5ILUA 4Y17A 3F22A 2FF4A 2XVCA 2F5EA 5D5UB 4D0PA 4I7HA 3WTWC 3J81Z 2ZXJA 3CUQA 3TQNA 4M9XA 2H6CA 1MD0A 4Q48A 1B59A 4I0AA 4QWQA 2PEXA 2MC3A 1XMKA 3E5QA 4ZYGA 2UXNA 5IT3A 1OKRA 1SFUA 4P9UA 3CUQB 1ZH5A 2D1VA 3WODF 4E70A 3W6JB 5CVRA 1XGOA 1K6OA 2M87A 4YFKF 2ZJ2A 5DDGA 2ZO4A 2OQRA 4ZYHA 4LK0F 5TJJA 3BY6A 2P5VA 1LEAA 3KLNA 5A2QK 3C18A 4MEYF 4GCVA 3FWEA 1UHMA 2ETHA 5JHUA 1T2KA 3OOPA 1KU3A 1REPC 4BXUA 1YS7A 3HTSB 2FMLA 1BC8C 2VT2A 1FC3A 4IXAA 4L5JA 3TDUC 2XKPA 5F64A 5LRSA 1HKQA 4NB5A 3RTRA 2ZBKA 3JSPA 3QU6A 1P4AA 4KIGA 1R5HA 2VN2A 5DCMA 4Q4ZF 4LGWA 3LSTA 1FP1D 4O5VA 1S8NA 5BS6A 2FNAA 3ECHA 2JSCA 3KEOA 4LK1F 3JSOA 2KJBA 5E17F 4RS8A 2XAQA 4R79A 3LQQA 5AONA 2LKPA 1OYWA 5ILVA 3CO7C 2FQ3A 1ZAOA 3WTZA 4Y13A 5CVVA 1GXPA 1ODDA 1R7JA 4CICA 2O0YA 3U2RA 2HQNA 5D5XB 1MDMA 1RUNA 2PFBA 1FSEA 1TBXA 2GA1A 2XAFA 1W7PD 2K4BA 2JPCA 3LAJA 1MDMB 2OQGA 2O61A 2EFNA 2VE9A 5CVUA 4EGYA 4HAMA 4WF2A 2VE8A 1YIOA 1IAWA 2HZTA 3ELKA 5BPIA 3KCCA 3R0AA 3T5XA 1HSTA 2DPUA 3TDZC 1VTNC 2JZYA 5DEQA 2ACJA 3P9CA 2L54A 2VXZA 3GFJA 1KYZA 4RAZA 2Z33A 4DQ2A 4LLGF 1IN6A 4B09A 1PP7U 2KIUA 3ZMVA 1FT9A 2A68F 5ILSA 3KP4A 4XSXF 2DTRA 4WXCA 2VOPA 3ZMDA 2DFIA 3DV8A 1KGSA 2H94A 1T98A 1ZHFA 1ON2A 2M8EA 2R3SA 2ZMEA 3GVAA 3EYIA 3MZHA 5HOOA 2ZNYA 5DCFA 1RI7A 1R22A 3PQJA 3J7AO 3FM3A 2FSWA 1FYMA 3KZYA 1BI2A 2A61A 1A04A 3TO6A 1SD4A 4OIPF 5K1YA 3KP2A 2EV5A 2VT3A 4L9JA 3FM5A 1MKMA 1YYVA 1BJAA 1U5TC 3HSRA 4EJVA 3RIRA 1AOYA 3L00A 1UFMA 1ZRDA 2E1NA 2HR3A 4RB3C 4LD5A 5KK1A 4IRHA 4M72A 2ESHA 4RGXA 2O8XA 1S7OA 3HOSA 2VOOA 4LB6B 1YFHA 3E5XA 4CXFA 2W57A 3I54A 1FYKA 4IHSA 1LJ9A 3ZP5A 1ZN2A 3DKWA 5A2QZ 2M5WA 3M8FA 5JVTA 2W24A 4M73A 1ONVA 2K7LA 1AWCA 3K0LA 3BJ6A 3F8NA 1Z7UA 2K27A 3NRVA 3H92A 1QZYA 2YX7A 2P6TA 1G3YA 3J81K 1UCRA 3WTYC 2IA1A 4BQAA 1LDKB 1S6LA 5E8IA 4L0YB 4ZH4F 1KA8A 4UNOA 1TQMA 1B9MA 1BI0A 2EA2A 2H6BA 1GVJA 4XRFA 2V1UA 2GZWA 2YSRA 4LLLA 1DP7P 2NNYA 1MGTA 1MJAA 3REOA 1HXDA 1G4DA 2ZFWA 1ZRFA 2W25A 4G7ZF 5TRDA 1H9TA 4KNYA 3GFIA 2M1BA 3SHFA 3WGIA 3F8BA 3IC7A 4M9SA 3F21A 2STWA 4M71A 1O3SA 1H0MA 4CO8A 2WTEA 2VBYA 2V9VA 1OYYA 1LDJA 4NHJA 5E20A 3GF2A 4G6QA 5H6QA 3EETA 1Z9CA 3V8KA 4HA8A 5J6XA 1FWZA 2M45A 4IJAA 4FHTA 2L3DA 4U7BA 4FT8A 5CVJA 2O3FA 2VC1A 1T39A 4HLYA 3HYIA 5HLIA 1TLHB 2OA4A 1HW5A 1WRJA 3C7JA 2L4AA 5J8FA 1QZZA 2H27A 2AXLA 5DUIA 1WWXA 4MQ9F 2QLZA 1WQ2A 2QQBA 3R60A 3RKYA 1CF7A 1RIOH 4XBFA 1YW8A 4G6DA 4YG2F 1FPQA 3JTGA 1TW2A 2BE5F 1LEBA 2K86A 5E8GA 1KQ9A 3C3WA 5FD6A 1IN7A 4PDKA 3K1MA 3TGNA 3WGGA 1KU2A 1B4AA 2CGPA 1E2XA 3ML6A 1HW1A 4WXDA 4UV8A 3V8LA 1U5TA 1HBXG 2DU9A 3RJPA 1ZYRF 5LHIA 3M9AA 3L9FA 2HTJA 4N9IA 4WWCA 4UVBA 3R61A 3HRMA 4A5NA 3D5LA 5ICFA 5IT9Z 3K1PA 3FX3A 4ESFA 3TOAA 4HX7A 4BNCA 2BYVE 2QYOA 2EV0A 3F23A 5LRRA 2XASA 4GGGA 2ADUA 3M8EA 1IXCA 2UXXA 1ZGAA 3K9TA 4ASNA 5D4SA 3HTUA 3WU0A 4KYWA 2XHKA 2FMYA 4L9VA 1T38A 4O3MA 3DP7A 4PZJA 5LEKA 2M30A 1FNNA 3ZN0A 3HRTA 3WG9A 5JI6A 3VFZA 3L7WA 2HKOA 1SAXA 2DQLA 1JXSA 2NS0A 2L4MA 4JBAA 1R00A 3G3ZA 2FOKA 3E6MA 2HKXA 2UZKA 1W7PA 1MJBA 4YFNF 1O7LA 1J75A 3RYPA 5KVRA 1QGPA 4OOIA 2ISYA 3JTHA 4EM0B 1XSXA 2LDUA 3LAPA 1OPCA 2GXBA 2PN6A 1MJ9A 1XGMA 1XGSA 1KQ0A 4KN7X 1JHFA 5L3DA 4UUVA 1IXRC 1IF1A 2QVOA 3QU3A 3KZZA 4ENMA 5D5WB 3V7RA 3T8RA 4HF0A 1BC7C 1K7AA 2GA2A 1P6RA 2WC2A 2D2WA 1IRFA 3DQVC 1R36A 1LB2A 3WU1B 2Q2EA 1Z05A 1U6GA 1IN4A 4G8XA 4A5MA 4HQEA 2L01A 4I09A 1P2FA 1UB9A 3EUHA 1XSDA 3MAJA 1K78A 3BZ6A 5HLGA 1ZREA 3MCZA 3GWZA 3IHUA 1V3FA 2IRFG 5L3EA 2H09A 3HSEA 1QQIA 2LNBA 5JFRA 3RPUA 1XDUA 3U9GA 1LNWA 1BM9A 4M6YA 1F9NA 2CYYA 5DCMB 5D5VB 1K78B 1HSJA 4OIOF 2F5CA 1J0RA 3T8TA 3K69A 4G94A 2FBHA 4ZZDA 4F7ZA 2DPDA 2W84A 2PQ8A 5FFZA 4ON0A 4A0XA 3FZVA 2PJPA 5EEHA 2UWMA 3F8FA 4HF1A 2RKHA 2JT1A 4JK1X 5BOXA 1ON1A 5ICEA 3LQRA 1RNLA 3HHGA 1TNSA 4U0WA 3LA3A 1T0FA 4HOBA 3QP6A 1SFXA 2HQRA 1KYWA 1FYLA 4KT5C 3E6BA 3DEUA 4AIKA 1V4RA 4U0YA 1DPRA 2G9WA 5LGNA 2E7XA 5ICCA 3D0SA 1XGNA 4M9ZA 1OYIA 2HEOA 3KP7A 4RGUA 3WTVC 4LMYA 3CUOA 3ZMZA 1OMIA 1HKSA 3IKTA 1YLFA 2HS5A 2NAZA 4AIHA 1J2XA 1G3TA 4CGZA 4HYEA 5BPDA 4HV5A 2OU2A 4ZZLA 1BN5A 2EK5A 4ETSA 1W4MA 2VBZA 1TQPA 1XDSA 5HDGA 1J9IA 2DQRA 2W85A 2A5YB 5HDKA 2GAUA 1WSUA 4Y15A 4P55A 4A2UA 1FSHA 2NYXA 1D8KA 3U1DA 3IWFA 4MHGA 2HGCA 5D8KB 3HUGA 3B73A 4BYYA 2WWYA 3GEZA 5LHGA 1I1SA 1O57A 2ZMEB 3ABTA 1UHWA 5HDNA 3I64A 4QLCU 5L3GA 2OBPA 5IT9K 1SD6A 3FF5A 1QBJA 2QQAA 1R58A 1F5TA 2J5PA 2Q8KA 1YW7A 5ED4A 3ISPA 3MQ0A 3I5UA 2FBIA 2P5KA 2BEOA 5CVIA 2FNPA 3SZTA 2PLYA 3VEPA 1P4XA 3VODA 1FP2A 3BJAA 1RZ4A 2QZ8A 5BMZA 4Q5SF 4WK8F 5LGTA 1IZ1A 4ZYDA 1TQIA 4WX9A 3QRFF 1DUXC 4ESBA 1I1GA 2X0LA 1Z91A 4OINF 4EM2A 4PGHA 3K1NA 1XB4A 2PMHA 1IN5A 3I58A 2K4JA 2GXGA 2E1CA 4JQFA 4PGGA 2VONA 3QOPA 5L3FA 2B0LA 4CDGA 2IT0A 3FXUA 2OZUA 4YIIA 2Z3YA 5F1RA 5E1ZB 1P4WA 2ZCWA 4KICA 2KRFA 3F72A 3E6DA 5H20A 1HW2A 3QP5A 4WCGA 3BWGA 3IRQA 2R7FA 4CHUA 1XSVA 1SD5A 4I2OA 1O3QA 1RUOA 2GIVA 2ZKZA 4O6JA 1ZG5A 2D45A 2XROA 3WE3A 1BOAA 4BH9A 4ENNA 3E5UA 2DI3A 5K5QA 1ZG1A 1S7AA 3WTUC 1BIBA 3CUQC 2D1HA 3P9IA 3I71A 3O2PE 4GYIA 2JTVA 2VBXA 2CW0F 5FO5A 3EQLF 3BOQA 3TO7A 4P9FA 2BBYA 3SZPA 1J7KA 3I53A 3VOEA 2MBFA 4IVNA 4KN4X 2BV6A 3TO9A 1FBSA 3SQNA 3J80Z 2KIFA 1FY7A 3FMRA 1FZPB 2EFPA 3BPXA 2LF7A 3V8JA 3F8CA 4IRIA 2FE3A 2O6GE 1USTA 2STTA 5AIQA 4EV0A 1ZGJA 3DFGA 1SD7A 4RGSA 2ELHA 4DNCA 3T0YA 5DD8A 4IPAA 1E17A 4UV9A 3R4KA 1I27A 4UXNA 3LWFA 3QPHA 5FGMA 5DYMA 5EEGA 1MZBA 1EV7A 1Z6TA 5AIPA 1XCBA 1IW7F 3O6BB 3KETA 2EJRA 5DD4A 2PI0A 2DT5A 3ULQB 4HDVA 5LBQA 5FFXA 5E1XA 3Q9SA 4LLNA 2HWVA 4AVPA 1R23A 4H0EA 3G73A 5D6FA 3OV8A 2CO5A 2MH2A 4Q47A 4CZZA 4ESJA 1CF7B 4HW0A 1I5ZA 3HIFA 1D8JA 2Q0OA 4GXOA 4R1HA 2XUBA 3HSFA 2LF8A 1KU9A 6PAXA 2NRAC 4LFUA 2DO7A 4EQQA 2KJCA 1U5TB 4UVAA 2KKOA 3L2CA 2P4WA 2RNJA 4IHTA 2Z99A 1IRGA 4OU0A 1B1BA 3ZPLA 1B6AA 4LB5A 3COAC 2L02A 1G3WA 2XRNA 1ZLJA 4KUMA 4MNUA 2EFOA 3EYYA 3N4MA 4A6EA 2IA2A 1EH7A 1TW3A 1L3LA 2A3SA 2CFXA 3GX4X 1O3RA 3ZQ7A 4IF4A 3KFWX 1XCVA 1U3EM 3RKXA 4S05A 3GYHX 1D3YA 3ZN1A 1ZARA 2EFQA 3V4GA 2RN7A 4L0ZB 4A0ZA 3F6VA 4HF2A 2DAOA 4MEXF 1W5TA 3RDIA 4MGRA 3NEUA 4FX4A 3I59A 2DK8A 3KP3A 5FLXZ 2FEZA 2FXAA 4G7HF 4N9HA 2QQ9A 2V79A 3R6SA 4GYGA 4OIRF 2QBYA 4UHTA 3I59B 2COMA 1XN7A 4AWXB 3E6CC 1TNTA 2PG4A 2CG4A 3W6KB 1FBQA 2EWNA 1W7PB 4K2EA 2QBYB 4A0YA 1PP8F 4HX4A 2JRTA 4XLPF 1DDNA 4LG0A 1FBUA 1USSA 4EJTA 2FBKA 1KU7A 2PBIA 2AS5F 2YX4A 4EJWA 3Q5FA 1W5SA 5HS7A 2XKOA 1LDDA 1NHAA 4PCQA 1FLIA 2DW4A 5LHHA 4LG0B 3WTTC 2GWRA 2XV4S 4U7DA 2OAZA 3CDHA 4KDPA 1ZG3A 1U8RA 3GW2A 5L3CA 3F6OA 4A12A 3C1DA 5HS8A 3JAMK 3TKYA 3FXQA 4BHBA
chains in the Genus database with same CATH superfamily
3B02A 4E7KA 5CYVA 1BJZA 3QWLA 1B9NA 2OCCH 5DV5A 5EGOA 4FX0A 4OMZA 3KX2A 2XAJA 1WVRA 3TOBA 2EFWA 3BQZA 2IW5A 1QO0D 4C2MJ 1A31A 2H8WA 4C30A 4C9YA 1K4SA 2GQQA 3MZYA 1DPUA 2L9RA 2QWWA 1BW6A 3P7NA 4KMFA 2X4HA 4YIRX 2HOEA 4HX8A 1VQMI 2DK5A 3LOCA 2LY2A 2KIMA 5BQTA 1BBYA 3BP8A 5J4YA 1ZR2A 2BZTA 2HPMA 1LQ1A 3LMMA 4PSWA 3CC4I 5EGOB 1UHSA 2WB1A 1Z0XA 2HYJA 2O9LA 2BGCA 2RQPA 3CLOA 2KMUA 3AAFA 3HOWJ 3SFZA 3EDPA 1Z21A 2XF5A 3LSHA 2HYFA 4XONA 1N78A 5K5OA 2EH3A 1T6SA 4OMYA 2P8TA 4NUBA 3ZQFA 3ECOA 1OR7A 1Y56A 4XMYA 3J80K 4R8HA 2NOGA 2HYGD 3IL2A 3R0JA 4EMSA 3IWZA 3DTEA 2Y0MA 3IRRA 2VODA 2MH9A 2HDWA 2CU7A 4KA4A 9ANTA 2O03A 4ZYEA 2Z9OA 2LBFA 4E7IA 4L9NA 3KP5A 2R7UA 3GFMA 1VQLI 1JI8A 4P96A 1ETYA 4RLQA 3AL0C 3X2QH 2V1XA 4D7NA 1XTAA 3B6AA 3TW6A 4RAYA 3E97A 1D0ZA 2IPQX 2R7OA 4AD9A 3K4KA 4M74A 2M7BA 4EJUA 3RSNA 1EH8A 2XB5A 1MBJA 5F27A 5HS9A 2JA5J 1ULYA 3MKLA 2LBFB 3CC2I 5IOYA 2X1CA 4FE4A 4AYBN 2IA0A 4A3DJ 3T1BA 1WJBA 1E0EA 3HXLA 3I0TA 5M3FJ 2W48A 3RZOJ 4I02A 2Z5UA 2G7HA 3GZ5A 2IVMA 4BU2A 4PJJA 1FOKA 3Q0UA 4HQMA 3A0HC 3BLYA 3IH4A 1STZA 1R1TA 3BJOA 1SMTA 4L9TA 3OYKA 4FTHA 3WTSC 1WPKA 2XAUA 5F0CA 2P6SA 4A69C 3BROA 4PSXA 4YFXF 4RGRA 5FLVA 1FOXA 2DA6A 4U0VA 2DTZA 3D5RC 2A05A 5LGUA 2K9NA 4FCYA 2VKHA 3OYJA 1QHGA 1ZKGA 2MLKA 3VSKA 4BBSJ 2IP2A 4IQ4A 1WKMA 2Y9YA 3GUDA 1H9GA 1Y0UA 2KLOA 2O5RA 2YPRA 3PQKA 3P9KA 1F4KA 2L9NA 4P5OA 2MD5A 3Q9VA 5K5RA 2P81A 1Z1DA 5K7ZA 1ZLKA 3CTAA 5F0FA 4HPQA 4BAYA 2MA3A 3F3XA 3VB2A 1QNTA 1D0XA 2HTSA 1Z77A 1KONA 3ERED 4AIDA 2KDZA 2AO9A 3N05A 5ICGA 3RPUD 1I39A 3DPTA 5DS9A 1GVDA 2EB7A 2WY8Q 3GO5A 2HQ5A 4XM3A 3OYBA 2LSOA 5GAHJ 2KP6A 3CCJI 4PUSA 1VQOI 1HKTA 3F8MA 3PIPF 2IJLA 1SFEA 3HUGB 3KP6A 2L7KA 3V7CA 1OCPA 3ZMSA 1S7EA 3WGHA 3IKVA 1YW9A 2FU4A 2WV0A 1J5YA 5E3NA 1I6XA 4U88A 1PUEE 4XLFA 4HNUA 4H4KC 3O8HA 4XLNF 2Y48A 4M3GA 3OYGA 1LKXA 2XAGA 4CCMA 3G1LA 2LR8A 1YQAA 3CJTB 3KEQA 3OR2C 3QPTA 3LFUA 5CQEA 5IYDJ 3F0CA 1X4PA 5HNFA 4HDUA 1HC8A 3NWTA 2XAHA 4E7LA 3FMSA 4EJOA 3HHHA 4A3EJ 2ESNA 1TTYA 1V54H 1HDDC 3CO6C 1YX5A 1U78A 3FXRA 3M1EA 2F2EA 3PFIA 5FKLA 1X3WB 5FRNA 2BOLA 3OS0A 2IBDA 1L0OC 3CZ6A 2CV1A 5B3SH 1FMWA 3GFLA 4HLXA 5FD5A 1WJAA 2HVRA 2A69F 2CQXA 2FJ1A 5E3MA 5DTDA 1MNMC 4PJ0C 3O3KA 5D4RA 3M7GA 2W82A 2EV6A 1JGSA 2NVYJ 1YX3A 5D8LB 2XPVA 1EH6A 4AC0A 4IKFA 4BHPA 2CJJA 3W6VA 1JHHA 1JJ8C 2QM3A 1SANA 4XKVA 1VQ4I 2DCEA 1IO2A 3DPLC 1YO5C 1MSFC 4KIBA 3KYCB 2V9PA 1YE9A 3ZQLA 4ENKA 4N0BA 2K02A 5FLXK 2LKSA 4UUTA 2R5YA 1S29A 2DBBA 1A6IA 3BG6A 4WXHA 5J8CA 1GXQA 5CPRB 3VSLA 4JP0A 2CQKA 3LSGA 4A6DA 3A2KA 1U2WA 4TV7A 2CWEA 1PDNC 3K2ZA 5B66C 2E2IJ 4BXFA 2MLGA 1B8IA 3BR2A 1ZGWA 3JRBA 2QUFA 2CSOA 1YS6A 5HVQC 1VQ7I 4EM1A 4ZTFA 2JN6A 2GM4A 5IP7J 1UELB 3JAMZ 5CLSA 4RB1A 1SFOJ 2VBWA 3CP2A 3H3ZA 2V6CA 2AQFA 2LRDA 2VC0A 5F0HA 4UVCA 1IUYA 2Y69H 3G4SI 4I99C 5D6EA 4ZYAA 1B8IB 4MQVA 2G7UA 2EA4A 1WGXA 4NQWA 5LEJA 4YIFA 1YTYA 4Z6YA 3RKWA 3S2DJ 1MBHA 3FXMA 4GO1A 1BR2A 2Z16A 3CJNA 1Z7LA 3BPVA 1MSEC 3KLOA 3W3CA 2ZNZA 1SMYF 2XGXA 1YG2A 4Y52J 3ZQCA 5EZGA 1WH5A 3SXYA 1RRJA 2ZJQF 1WI9A 1O7FA 2ZB9A 3RQ4A 2NVUB 1GHCA 1J59A 4ITVA 1LUJB 1C0WA 4GFBA 1IXSB 3IP4B 1W5CC 2CS3A 3CMMA 2D5VA 1ERDA 4BHCA 2HPIA 3C2GA 3K4NA 4M6XA 3GLXA 2HXOA 1FIAA 5L3BA 3DXJF 4XL9A 2V1DA 3I4PA 1BI3A 1HF0A 3U21A 1PVEA 2DFHA 3JW4A 2CW7A 3CD6I 1RC9A 3CLQA 2OCEA 4UB8C 1UJ8A 2CMPA 4DYQA 1F1ZA 4S04A 5E1WA 1R5GA 1BIAA 2JVGA 3BTIA 1I3AA 2PMUA 3QAHA 3GXOA 4F93B 2FRHA 2Y2ZA 4KMUX 3V7SA 1P92A 4V2FA 3ABUA 1HQCA 3DF8A 2Y75A 2P5LC 1Z6RA 2OD5A 2QENA 4UB6C 5DUKA 1FOWA 3RPQA 2IS6A 3MZ8A 2RGVA 3C2HA 2XF7A 2K3FA 5H6RA 1JE8A 2Y9ZA 1IN8A 4PJMA 4EVIA 3OIPA 5HLHA 3L2UA 1ZRCA 4IRGA 2BW3A 4DBQA 3HOYJ 3TW7A 3KYLA 4NC7A 4KIFA 1QPMA 2HFHA 3C2BA 3KE2A 2E1MC 3JRCA 2XIGA 5CJ9A 5JR3A 1D5VA 1PUFA 2JJ7A 3MWMA 1K79A 1BR1A 3BZCA 2TDXA 5B1AH 2DT7B 3HOTA 1TC3C 2VQHA 5C3EJ 3ZMTA 2RC4A 1UG0A 2TCTA 4XICA 3NQOA 1XMAA 2DA3A 2F5DA 4PJNA 2HZDA 4MTDA 1FIPA 2A6EF 4LJZF 5BNGA 1R4MB 5FB2A 2YS9A 1LFBA 1BI1A 3BG3A 3S1NJ 3L09A 4DJAA 2VJJA 1E3PA 2ID3A 1CGPA 2HVQA 2JPBA 2R7DA 3GCMA 4JYKA 2KISA 5LLQA 1G8XA 1Q1HA 4B1RA 3LNQA 2BY3A 4BQOA 5GADJ 2RDPA 5F6FA 2A6HF 3ZQGA 3L2VA 4OIQF 3WE2A 1G6NA 3MN2A 3HRSA 2LKXA 3HG9A 4MTEA 2C6YA 4XSZF 4KFCA 5CKTA 1XD7A 2K3PA 5KAFC 2DLLA 2OZ6A 3HRUA 1S9HA 1VI0A 2FA5A 3ASNH 4I98B 3FXJA 3BDDA 3GTPJ 2JUCA 1F43A 4HBLA 1F36A 4AYBA 3RYRA 3H35A 4I01A 1G3SA 3ABLH 5J47A 3GTKJ 1XC5A 4FISA 2P7CB 3K6GA 1KQ8A 1D1BA 3LA7A 4G7OF 1S3JA 1R1VA 5ERIA 3LA2A 4IHXA 1WJFA 3ZMUA 2MFZA 3HBLA 2HVSA 3FHZA 4RB0A 3MFKA 2J5OA 3AG1H 2EINH 3FMQA 4RB2C 4EGZA 3DKYA 4CYDA 2A07F 4HV6A 1I6HJ 5E18F 4A3JJ 1SAUA 3JRGA 3EUAA 1ETXA 2L0KA 4HZFA 4B44A 3GZ6A 3UNGC 1BA5A 3S1RJ 1K4TA 3HOUJ 4DBRA 2RV8A 1R1UA 1FX7A 3K7AJ 3MEXA 3I55I 3GTLJ 1W0TA 3H3UA 4B8XA 2E7WA 1W36D 2F5FA 1SVLA 2CW8A 3PIOF 1OCCH 1VQKI 3VYRB 4I0BA 2XB0X 3E3VA 4L18B 2NNNA 4L5IA 3LFKA 3PNTA 4B43A 4AIJA 3HPHA 3LSKA 2HDCA 3FXLA 3S2WA 1LVKA 1E3OC 2P7VB 2DOAA 1O3TA 2DODA 3CCLI 3N97A 2DMNA 3WTXC 4Z2YA 2X6OA 1X4OA 4OAYA 4DZJA 1UAAA 3DEEA 1IDZA 2RVCA 2YU3A 1HOMA 3K4CA 1LVAA 4G9YA 2YR2A 3SFIA 2F6CA 4ENJA 1X3UA 1YOVB 2XGCA 2R5ZA 2ISZA 3FISA 1JKOC 5IYBJ 3RI4A 3I4NJ 1HCRA 3CESA 4BQNA 3ROUA 3JRIA 3FBNB 5ILUA 4Y17A 3F22A 1DGWY 2FF4A 2IGNA 2XVCA 3L2WA 2F5EA 2DFEA 2XF6A 4BKXA 3JREA 5D5UB 2ZMEC 3CMYA 4D0PA 1W0UA 4I7HA 2K85A 5GTIC 4XLEA 3WTWC 2LY1A 1MIJA 2K9QA 3J81Z 2ZXJA 3CUQA 3TQNA 2EIJH 4M9XA 2DA5A 2H6CA 1MD0A 1ZTRA 1K6YA 4Q48A 1B59A 2JVHA 4I0AA 4QWQA 4A3GJ 2PEXA 3CMAI 2MC3A 1TP4A 1XMKA 2L7FP 2E34A 3E5QA 4ZYGA 5FKKA 2UV1A 2UXNA 5IT3A 4HSTA 1W1WE 1OKRA 1SFUA 4P9UA 3CUQB 2E36A 1ZH5A 2D1VA 3WODF 4E70A 3CCSI 2FD5A 5CVRA 3W6JB 1XGOA 1MBFA 1K6OA 2XSDC 2HXIA 2M87A 4YFKF 1BW5A 2ZJ2A 5DDGA 1MBGA 2FX0A 1LE8A 2ID6A 3L2QA 1N77A 2R7WA 4XLAA 1R71A 2ZO4A 4BJTA 2OQRA 5IY5H 5C4JJ 4ZYHA 4LK0F 5TJJA 3BY6A 2P5VA 3S1QJ 1LEAA 3QYFA 4NC6A 4YEJA 3KLNA 5A2QK 4A3IJ 3C18A 2W00A 1VF9A 4RM3A 4MEYF 4I76A 4GCVA 1VQNI 3FWEA 2EILH 5J1UA 1UHMA 1IDYA 2ETHA 2X85A 3CCYA 1Y39A 4GDFA 1AKHA 5JHUA 1T2KA 3OOPA 4CSWA 1KU3A 1REPC 4IOCF 1LE8B 4BXUA 2M0MA 3D1NI 1YS7A 3HTSB 3M4OJ 2FMLA 1BC8C 2VT2A 3AKZA 3CDIA 2V7FA 2DMPA 4JX6A 1LFPA 4QPOA 3BC8A 1FC3A 2IS1A 4IXAA 4L5JA 4PFPA 2XKPA 3TDUC 5F64A 2EPFA 3I3LA 3A01B 3PNYA 2QKLB 5LRSA 3AG4H 1HKQA 4NB5A 3RTRA 2ZBKA 1SEUA 3BG5A 3JSPA 3QU6A 1P4AA 4AU7A 5J1RA 4KIGA 1R5HA 1D1AA 2VN2A 5DCMA 4Q4ZF 1NH3A 4LGWA 3LSTA 2W1OA 4RBOA 3S14J 1FP1D 4O5VA 3GBGA 1S8NA 4XORA 2XPWA 5BS6A 2FNAA 3OYFA 5J3LA 2LH9A 3ECHA 2JSCA 3KEOA 4LK1F 3JSOA 2KJBA 4JX5A 1JKQC 4A3CJ 2R7TA 3ZQHA 5E17F 2VKEA 4RS8A 1R5ID 2Q1ZB 2XAQA 5IP6A 4R79A 3DBLB 3LQQA 5AONA 2PJRA 2L7MP 2LKPA 3S93A 1OYWA 5ILVA 5E79C 3CO7C 3A1YA 2FQ3A 4QIWN 1FMVA 3ERMA 3KPHA 1ZAOA 3WTZA 4JX4A 4Y13A 5CVVA 3H3VK 1GXPA 3WU2C 2RREA 1ODDA 4XN0A 1R7JA 4CICA 2O0YA 3U2RA 3DLAA 1GUUA 2HQNA 1NTCA 2L2OA 5D5XB 1H89C 1GV2A 2R92J 1MDMA 1RUNA 2PJRB 2PFBA 3OYDA 2JSPA 1YJ9I 1Z3YA 3BG9A 2KL4A 1VFCA 1FSEA 1TBXA 2F4IA 2GA1A 4HEA2 2XAFA 1W7PD 2IGMA 2K4BA 4BGDA 1RKTA 2E5ZA 2EBIA 5DM7F 2ZJPF 2EIMH 2L9SA 2JPCA 1ETVA 4BBRJ 4BY7J 5E3OA 1XS9A 3FIWA 3LAJA 1X1CA 1MDMB 2OQGA 4B3XA 2O61A 3M3YJ 2V9KA 3OYCA 2V4JC 2EFNA 2VE9A 3OYMA 1WJDA 3G71I 5CVUA 4EGYA 3E0JB 2CUZA 4HAMA 4WF2A 2MC4A 1YIOA 2VE8A 2KZVA 1U8BA 1IAWA 2HZTA 4Y4RA 3ELKA 5BPIA 3KCCA 1RPWA 3R0AA 5TGTA 3BR3A 3T5XA 1HSTA 2DPUA 3TDZC 4BE1A 1VTNC 1MH4A 1WJ5A 4CCOA 2GXAA 2NS7A 3QYBA 1A6QA 2JZYA 2V1NA 5DEQA 2ACJA 3P9CA 2L54A 1W36C 2VXZA 3GFJA 1ZQ3P 1KYZA 4RAZA 2Z33A 4DQ2A 1XG1A 2K9SA 4LLGF 1IN6A 4B09A 2WA0A 1PP7U 4E7ZA 2JA8J 4XQFA 3LL7A 3QQAA 3K2AA 1VQ8I 2KIUA 3ZMVA 1FT9A 4PJLA 2A68F 5ILSA 3OS1A 4DIQA 2PMZN 3KP4A 1SVMA 4MLOA 4XSXF 3S3NA 2DTRA 4WXCA 3TL4X 2VPLA 2VOPA 3ZMDA 2VKVA 3HM5A 2DFIA 3DV8A 2IS2A 1O4XA 1KGSA 2ZC2A 2H94A 1QRYA 2JUGA 1N75A 2VPRA 3RZDJ 1WHUA 2LOOA 4FE7A 5EZHA 1T98A 1OQYA 1ZHFA 1ON2A 2M8EA 4N4NB 1POGA 2R3SA 2ZMEA 3GVAA 4I6ZA 1HLVA 3EYIA 3BCAA 3MZHA 4W97A 1B72A 3S17J 5HOOA 1MBEA 5KAIC 2ZNYA 2LLKA 2JA6J 1R6RA 3TEDA 2NS8A 5DCFA 2KPMA 1RI7A 3I4MJ 3FK7A 4RA2A 1R22A 3PQJA 1YHQI 3J7AO 3HOVJ 3FM3A 2FSWA 3HC7A 4MO7A 2DYRH 1FYMA 3KZYA 2NVXJ 2CV0A 1NK3P 1R9TJ 4M3FA 1BI2A 3CDLA 2A61A 2MG4A 1Z67A 1A04A 3TO6A 4BEHA 1SD4A 4OIPF 2L5QA 3ZR8X 1GT0C 5HNHA 2XGEA 5K1YA 1WFXA 3L1PA 1JT0A 1SFKA 3KP2A 4B4CA 3H36A 1T56A 3J7YJ 4MFDA 3CF5F 2EV5A 1LPQA 2VT3A 4L9JA 3FM5A 2B63J 1KZHA 1MKMA 1YYVA 1BJAA 5J1YA 1U5TC 2VQLA 3HSRA 3A4CA 5F04A 4EJVA 3VWBA 3RIRA 2DOFA 2H1LA 4BEHB 1AOYA 4OWRB 3L00A 1UFMA 1ZRDA 2E1NA 2EZKA 2HR3A 4RB3C 1DQUA 3BZKA 4D9JA 2DN0A 4LD5A 5KK1A 4IRHA 4M72A 2ESHA 4RGXA 2O8XA 1S7OA 3HOSA 3FDYA 2VOOA 4LB6B 1V5EA 1YFHA 1D0YA 3E5XA 3TMOA 3ONQA 2DA4A 1QU3A 3RCOA 4CXFA 2GBYA 1IRXA 2W57A 3HKZN 4IHWA 1S72I 3I54A 4D1QA 1FYKA 4IHSA 1LJ9A 5M3MJ 1RESA 3ZQQA 3ZP5A 1ZN2A 2QSGX 3DKWA 5A2QZ 4V19K 2M5WA 3M8FA 3TBIA 2W24A 4M73A 5JVTA 1ONVA 2VB6A 3BTLA 1X1DA 2K7LA 3K0LA 1AWCA 3W2WA 2LP0A 3BJ6A 2N8GA 2LVSA 1SC7A 3F8NA 2JA7J 1Z7UA 2K27A 4XLHA 3NRVA 5JHFA 1FTZA 5DM6F 3H92A 3SEQA 1QZYA 2YX7A 2P6TA 4C2UA 5H2FC 1G3YA 1A36A 3J81K 1VQ9I 1UCRA 4DZPA 1P7IA 4CCNA 4BDYA 1MNDA 4A3BJ 3WTYC 2IA1A 3CCQI 4BQAA 3O8GA 2K9MA 2R5YB 1LDKB 2MSYA 2K5CA 3S3MA 3MVPA 1S6LA 2KIQA 5E8IA 2AXTC 4L0YB 4ZH4F 1DGRM 1KA8A 2VL8A 4UNOA 4BS9A 4Y7NJ 1TQMA 1B9MA 1BI0A 2EA2A 2H6BA 1GVJA 2ZXWH 4XRFA 4D5CA 2V1UA 4IHVA 2GZWA 2YSRA 3IH3A 3I56I 2BVMA 4LLLA 4JOMA 1T08B 1DP7P 2NNYA 2B9SA 1MGTA 1MJAA 3REOA 1HXDA 2AHQA 1NK2P 2OC6A 1M1EB 3WHBA 3GTMJ 1G4DA 2ZFWA 1ZRFA 2W25A 3F9KA 3A0BC 4G7ZF 4XR6A 4NQWB 3HDDA 4IX7A 5TRDA 1MMGA 3CCMI 1H9TA 4KNYA 2RQQA 2K40A 3GFIA 4G6TB 1AA7A 2M1BA 3SHFA 3FKIJ 3WGIA 3F8BA 1Y1VJ 3IC7A 4M9SA 3F21A 1SVOA 2STWA 4M71A 1O3SA 1ACIA 1H0MA 4CO8A 2WTEA 1VNDA 3OYHA 2VBYA 2DYSH 2V9VA 1OYYA 3AL0B 1YIJI 1ITYA 1LDJA 2RAEA 4M3EA 5IP9J 2ME0A 2X1EA 4NHJA 5E20A 5C44J 2ZFUA 3GF2A 4G6QA 5H6QA 3EETA 1Z9CA 3V8KA 1DU0A 1QZEA 1WJEA 2WBMA 4HA8A 1OCZH 5J6XA 1FWZA 2E2HJ 4HRIA 3HJEA 5GAGJ 2M45A 4IJAA 2E1OA 4FHTA 2L3DA 3S8PA 4XIDA 4U7BA 4FT8A 2CQQA 5CVJA 2R7VA 4B3AA 2DXIA 2O3FA 3JRDA 2VC1A 1T39A 4HLYA 2QGUA 3HYIA 5GP9A 2E19A 2IGOA 5HLIA 5KNLA 3BR6A 1TLHB 2OA4A 1HW5A 1WRJA 3C7JA 3KZIC 3EUHC 2L4AA 3CCEI 2BY2A 5J8FA 4XKCA 1QZZA 2H8RA 2BW3B 2H27A 3HOZJ 1Z3XA 5EEAA 3DTIA 4IHYA 2AQEA 2AXLA 4NBQA 3FXKA 5DUIA 1WWXA 4MQ9F 3MKYB 2QLZA 1WQ2A 2QQBA 3R60A 1OCTC 1PUFB 1RR8C 4X0GA 3RKYA 4AM3A 3G2BA 3OYIA 1CF7A 1RIOH 4XBFA 4XNFA 1QHHD 1YW8A 4G6DA 4YG2F 1FPQA 1I3QJ 3OIQA 3JTGA 1TW2A 1X2MA 5E3LA 3HB9A 2Y30A 2BE5F 1LEBA 2K86A 1Y8RB 3DPUA 5E8GA 3IV5A 2M3AA 2COBA 1KQ9A 5IOZA 3C3WA 2I5UA 5FD6A 1IN7A 4PDKA 3K1MA 3TGNA 4ABZA 5K7FA 5LFAA 1YRNA 3WGGA 1KU2A 1B4AA 4BY1J 3H0DA 1TT5B 2CGPA 1E2XA 3ML6A 1HW1A 1OLTA 1WJCA 3CQZJ 4UY8I 4WXDA 4UV8A 4KITB 3V8LA 1U5TA 1HBXG 3VYUB 2I8DA 3KEYA 2DU9A 3RJPA 1ZYRF 4IZZA 5LHIA 3M9AA 3L9FA 2HTJA 2M34A 4N9IA 4WWCA 4UVBA 2G0EA 2BVLA 2LY9A 3R61A 1P7JA 1YRNB 4QPQA 1DU6A 4XK4A 3H9QA 2Z1DA 3HRMA 4A5NA 3D5LA 2IEKA 3KIOA 3K1PA 5ICFA 5IT9Z 2QF7A 2XGDA 3FX3A 4ESFA 3TOAA 4HX7A 4XLCA 4BNCA 3MKZA 2PMZA 1BR4A 2BYVE 3OR1C 3CCVI 2ZXHA 2BXZA 2QYOA 4PFOA 1MW7A 3RQIA 3MKWB 4MIMA 3OMYA 1T0FC 4CUGA 2EZHA 3H5RA 4C3IJ 2EV0A 4C3JJ 3F23A 5LRRA 2LD5A 2XASA 4ZDOA 4DYCA 1UG2A 5FJ8J 4M3DA 3ZGKA 2DMTA 2MD0A 3J7AY 4GGGA 4RMNA 2ADUA 2BXYA 2W7NA 2ECCA 3OL4A 3M8EA 1IXCA 2FOWA 2UXXA 1ZGAA 3K9TA 3SDGA 4ASNA 4CH7A 5D4SA 3HTUA 2JQ7A 5JLXA 1JUMA 4IOAF 5M5WJ 3WU0A 2R7RA 3PJRA 4KYWA 2M9HA 2XPUA 2XHKA 4LIUA 3BG7A 2FMYA 3M8JA 3DWLE 3Q0WA 4L9VA 1T38A 4O3MA 3OL3A 1TWFJ 2VIXA 1IJWC 5KHDA 3UR3C 3DP7A 5HODA 4PZJA 5LEKA 3H5NA 1BL0A 1ORKA 3AFHA 2M30A 1FNNA 1X58A 1GDTA 3ZN0A 3HRTA 2R5ZB 1J09A 3WG9A 5GPCA 5JI6A 3ZCOA 3OYNA 3VFZA 3L7WA 2HKOA 1SAXA 1LFUP 2DQLA 1JXSA 2NS0A 2L4MA 3CF2A 3JCUC 4JBAA 1R00A 5GTHC 3GZNB 3FKJA 3G3ZA 2M0CA 2FOKA 3E6MA 2HKXA 3VPRA 2UZKA 1W7PA 1MJBA 1JUSA 3SYTA 4YFNF 1O7LA 1J75A 4LITA 3RYPA 4P1WA 5KVRA 1X3ZB 1QGPA 3FXOA 4OOIA 2ISYA 1HA8A 2OJED 2GLOA 3JTHA 5FKOA 2R0QC 4EM0B 1X1PA 3MD2A 1XSXA 4UUSA 2LDUA 3LAPA 3HKZA 4J01A 4HG2A 1OPCA 2GXBA 2PN6A 3CMEI 2M2EA 1MJ9A 2KT0A 2X6WA 3GLLA 1XGMA 1XGSA 5F1JA 2WADA 1KQ0A 1TWCJ 2IAIA 4KN7X 1JHFA 1XMXA 5L3DA 2BY1A 4UUVA 3S32A 1IXRC 3B6CA 1IF1A 2DA2A 1XX5A 2QVOA 3QU3A 3KZZA 1X1AA 4ENMA 4V2GA 2DDAA 4A3LJ 5D5WB 4A3FJ 4EATA 2ELJA 4LIVA 4C3HJ 3V7RA 4Y3OA 3T8RA 2DT6A 2CUFA 3EPZA 4HF0A 1ETKA 1BC7C 1K7AA 2GA2A 2X51A 1P6RA 2WC2A 2D2WA 1OISA 3DBRB 3H1CA 1IRFA 2JA2A 1QA6A 3DQVC 1R36A 1LB2A 3H5AA 1MH3A 3WG7H 3WU1B 2Q2EA 1Z05A 2XDVA 3ZOBA 1U6GA 1IN4A 4G8XA 4A5MA 4HQEA 2L01A 4I09A 3GMEA 1AKHB 3VYTB 2KFDA 3JRHA 1P2FA 1UB9A 3EUHA 2KRHA 3BTCA 1XSDA 4C2TA 3MAJA 1TWHJ 1K78A 3BCBA 3BZ6A 5HLGA 1ZREA 3MCZA 3W2AA 3ESWB 3GWZA 3IHUA 1V3FA 2IRFG 5L3EA 2H09A 3HSEA 2W4SA 2E1MB 4LOCA 2H1KA 2IS4A 1QQIA 2JRMA 2FQ4A 2LNBA 2Q2EB 5JFRA 1T95A 5J4VA 3RPUA 4KJZA 2JWTA 3M07A 1XDUA 3U9GA 2E35A 1E3HA 3VYSB 1LNWA 2LK2A 1TZLA 1BM9A 4M6YA 1F9NA 2CYYA 2IXSA 5DCMB 5D5VB 1K78B 1HSJA 4OIOF 1JUPA 2F5CA 1A5JA 1J0RA 4XRSA 3T8TA 2Y0SN 4F3QA 3ZRGA 3K69A 3DU5A 4G94A 2P0WA 4YELA 2FBHA 3SEZA 4ZZDA 3D5SC 2MYSA 3E7LA 5EJCA 4F7ZA 4BACA 4FASD 1IGNA 2HOAA 2KRCA 2DPDA 2W84A 2PQ8A 2R7ZJ 3FHNA 3GTJJ 5FFZA 5EF6A 4X1EA 4ON0A 3BR0A 4A0XA 2WAQN 3BR5A 3FZVA 2PJPA 5F08A 1ZR4A 1Q1VA 5EEHA 2E71A 2O8KA 2UWMA 2R4GA 4AUXA 3F8FA 4HF1A 2LG4A 3VDXA 2RKHA 2EZIA 1PYVA 2JT1A 1WH7A 3DLLF 1ETQA 4JK1X 3J7ZI 5BOXA 2CUEA 2FUG2 2NVTJ 4DOZA 1ON1A 3AG3H 2R7XA 4CYCA 5ICEA 3LQRA 3QYEA 1RNLA 3HGGA 1HDPA 4XKWA 2F4MB 3HHGA 3A02A 1TNSA 4U0WA 3I9V2 2CH0A 1T0FA 3LA3A 3AG2H 4HOBA 1FTTA 2R93J 4BXXJ 3QP6A 1SFXA 4A3MJ 3NAUA 2HQRA 1KYWA 4XOTA 1FYLA 4KT5C 3E6BA 3DEUA 4AIKA 1V4RA 2HNHA 4LG3A 1DPRA 4U0YA 3K70D 4XKBA 2G9WA 4A3KJ 1AU7A 2LYCA 3LSMA 5LGNA 2E7XA 5ICCA 3D0SA 1IG7A 4ZTJA 1XGNA 2QSHX 1TWGJ 2ZSHB 3IAM2 2DOEA 4M9ZA 2WY7Q 2GOXB 1OYIA 3ABMH 1JT6A 3IAS2 2LREA 3K4BA 2QCOA 2HEOA 3KP7A 2CFOA 2KHMA 4RGUA 2JK3A 4LMYA 4CYCB 3WTVC 3CUOA 5EYRA 5IYCJ 3ZMZA 2KZGA 3HL2A 4FETA 1OMIA 1HKSA 3IKTA 1YLFA 4IEJA 4D7MA 2HS5A 2NAZA 2ZSIB 3UKGA 4AIHA 1CQTA 1J2XA 1G3TA 4BL0B 4CGZA 2VI6A 3K4JA 4HYEA 2GIZA 5B1BH 4QTRA 1N25A 1Y1WJ 5BPDA 4HV5A 2OU2A 4J19A 4ZZLA 1AHDP 1BN5A 2EK5A 4ETSA 4BJ5C 1W4MA 2VBZA 1TQPA 3H9GA 2WV1A 1XDSA 5HDGA 1T8IA 1J9IA 2DQRA 2W85A 1JKRC 3LSPA 2A5YB 4E4HA 3BQYA 5FKMA 5HDKA 2GAUA 3A03A 1WSUA 4Y15A 4P55A 4A2UA 1FSHA 1OJLA 1NG6A 1U0JA 1D8KA 2NYXA 2QSFX 3IWFA 3U1DA 5GAEJ 4BUPA 5EDNA 4MHGA 2HGCA 5D8KB 3HUGA 3B73A 4BYYA 1FEXA 1OFCX 2WWYA 3GEZA 3OIOA 5LHGA 1I1SA 1O57A 3DTKA 2ZMEB 2E5NA 3ABTA 1UHWA 5HDNA 1VQ6I 4D5FA 1B72B 3GTGJ 3I64A 4M3BA 1IUFA 4QLCU 2UUZA 1G59A 5L3GA 2OBPA 4DW6A 3OYEA 5IT9K 1SD6A 1BOBA 2CQNA 3FF5A 2E60A 4L5EA 1QBJA 2QQAA 3HEFA 2V6EA 1R58A 4G12A 1F5TA 3QPSA 4F91B 2J5PA 1Y0NA 3PL8A 2Q8KA 3CP8A 2EQRA 3SDBA 1YW7A 5ED4A 3ISPA 3PFYA 3MQ0A 3I5UA 2FBIA 2P5KA 2QKMB 3HPGA 4BE2A 2BEOA 5CVIA 2QEXI 2BHYA 2OV7A 1X19A 5FKNA 2FNPA 4A93J 3SZTA 2PLYA 3VEPA 1P4XA 3VODA 1FP2A 2DDBA 1EJ9A 5KCMA 2WAFA 3BJAA 1U9OA 1RZ4A 2QZ8A 4HSRA 3LSJA 3CJRB 5BMZA 3OYAA 4Q5SF 4WK8F 5LGTA 1IZ1A 4ZYDA 3H9JA 1TQIA 4WX9A 5IPAA 2EZLA 3QRFF 2HU9A 1DUXC 2I10A 3HZJA 4B47A 1I1GA 4ESBA 3S1MJ 2L9VA 2X0LA 2LFBA 4NNJA 1Z91A 4OINF 4EM2A 4BQQA 4PGHA 3K1NA 1S5LC 4ZDPA 1XB4A 2PMHA 1IN5A 3I58A 2CQ7A 1V5GA 1JTYA 2K4JA 1FJLA 1QVUA 5TISC 1WZ2A 1VZ0A 2GXGA 3P5JA 4N4OB 4JQFA 2VLAA 2E1CA 4PGGA 1DP3A 2XSJC 4XN3A 4CZCA 2VONA 3QOPA 4RAFA 2X9DA 5L3FA 2ZJRF 2ECBA 2B0LA 2DMQA 4CDGA 3EUKL 2IT0A 3FXUA 2OZUA 4YIIA 2OPTA 2Z3YA 2HOTA 5F1RA 5E1ZB 1P4WA 3ZXSA 2ZCWA 4QSHA 1V55H 5CQGA 4KICA 3CCUI 4CCJA 2KRFA 2X6XA 3F72A 1D1CA 3E6DA 5H20A 4S0HB 1HW2A 3DU6A 3QP5A 4WCGA 3BWGA 3IRQA 4ZDLA 2R7FA 3DCFA 4CHUA 1XSVA 1SD5A 4XOPA 4I2OA 1YJNI 1O3QA 1RUOA 2GIVA 2ZKZA 2CUJA 4X6AJ 4O6JA 1ZG5A 2D45A 2XROA 3L2RA 3WE3A 4EEFG 1IV6A 1BOAA 4E7JA 4CCLA 4BH9A 5FROA 4ENNA 1IC8A 2K9LA 3E5UA 2DI3A 5K5QA 1ZG1A 3Q0VA 1S7AA 2VJ5A 4KISA 2VJ4A 5LD2C 1TT0A 3WTUC 1BIBA 5M5XJ 3CUQC 2D1HA 3P9IA 5FLMJ 3I71A 3O2PE 4GYIA 2JTVA 2VBXA 2LTPA 3HOXJ 4Y33A 2WB1N 2CW0F 3ZQIA 5FO5A 3EQLF 3BOQA 3TO7A 3BR1A 1IV8A 2R7QA 4P9FA 4ZJZA 2BBYA 3SZPA 1J7KA 1EKEA 1Y6IA 4BDZA 3I53A 3VOEA 2MBFA 4IVNA 5GPAA 4KN4X 2BV6A 3TO9A 1FBSA 2M4GA 3QODA 3CC7I 3SQNA 3IH2A 3K10A 2DFFA 2QQ8A 3J80Z 2Y31A 5EG0A 2KIFA 2MW8A 1FY7A 4DYRA 3DKXA 3JRFA 1XPXA 3FMRA 4PK4A 3K70C 3PNVA 1H8AC 1FZPB 2XRLA 2EFPA 3BPXA 2LF7A 1QVTA 4ZC3A 3F8CA 3V8JA 3SJMA 4IRIA 4E6KG 2DA7A 2FE3A 2O6GE 2LC2A 1JKPC 1USTA 2STTA 5AIQA 1APLC 1ZGJA 4EV0A 3DFGA 1SD7A 3LSIA 4RGSA 3K4MA 3OSGA 2F48A 2ELHA 4DNCA 3T0YA 1PJRA 5DD8A 1OCRH 5EG0B 1MBKA 4IPAA 4XRSG 1E17A 2Y0SA 3FBIB 4E7HA 4UV9A 3R4KA 3S16J 1I27A 1ETOA 3MMYB 4RAGA 4UXNA 2HDDA 3LWFA 3QPHA 5FGMA 3OYLA 4BE0A 2DMUA 3PUFA 5DYMA 5EEGA 1MZBA 2L7ZA 3WHCA 1EV7A 4XRMA 1Z6TA 2KDOA 4IQJA 5AIPA 2OTJI 1D5YA 1XCBA 1IW7F 1MNEA 2VQCA 3O6BB 2HQAA 2R7SA 3KETA 2EJRA 5DD4A 3PO3J 1ZELA 3G6EI 2PI0A 4W1UA 4OAZA 2DT5A 2E2JJ 2XC7A 2WAQA 3ULQB 1A35A 4HDVA 5LBQA 3TP0A 5FFXA 1MMNA 5E1XA 3Q9SA 2X1DA 1RETA 2M4KA 3PUBA 4F52A 4LLNA 2HWVA 4AVPA 1R23A 3K4LA 4H0EA 3CJQB 3G73A 5D6FA 5K7HA 1TWAJ 3OV8A 4AVZA 2CO5A 2OF7A 2MH2A 1EF4A 2HOSA 4Q47A 4CZZA 4ESJA 1CF7B 4ANJA 4CA0A 3IUOA 4HW0A 1I5ZA 2GOMA 3HIFA 3FK6A 1D8JA 2YU9J 3GTQJ 3TP3A 2Q0OA 3BTJA 2RNGA 2CRGA 2EIKH 1GV5A 3QOEA 3OSFA 2BHZA 4GXOA 4R1HA 2NVQJ 2XUBA 1EA3A 1K61A 1WI3A 1OR7C 3HSFA 3PM1A 2JMWA 2LF8A 1KU9A 1R4NB 6PAXA 4MFEA 2CV2A 2NRAC 1IRZA 4LFUA 2DO7A 4EQQA 3S3OA 2KJCA 3QPLA 2DJNA 1U5TB 4UVAA 4BJ6C 2KKOA 2P4WA 2RNJA 2Z2SB 3L2CA 4GRIA 4IHTA 2Z99A 5M5YJ 4F55A 2TRTA 1IRGA 4OU0A 3JR9A 1WCMJ 1B1BA 2BY0A 1YITI 3ZPLA 1UZCA 5J40A 1B6AA 4LB5A 1FOYA 2L02A 3COAC 2NOJB 1G3WA 2XRNA 1ZLJA 4KUMA 4MNUA 3OY9A 2EFOA 2HI3A 3EYYA 3N4MA 2VUMJ 3KYDB 4A6EA 2IA2A 1Y8QB 4HNVA 1EH7A 2V26A 1TW3A 5JLWA 1L3LA 1ZK8A 2A3SA 2WAEA 2MABA 4RLFA 2CFXA 3GX4X 1O3RA 2VASA 3ZQ7A 3PSFA 4IF4A 3KFWX 1JJ6C 1XCVA 3OS2A 5C4XJ 1U3EM 3Q3SA 1G2HA 3RKXA 1VQPI 3S2HJ 5JVGF 4S05A 3GYHX 1D3YA 3DEWA 4HNTA 2QA4I 2IGKA 3ZN1A 1ZARA 3GTOJ 3E1SA 3SZGA 2EFQA 3V4GA 2RN7A 4II2A 2MGQA 4L0ZB 3BT9A 4IL6C 4A0ZA 3F6VA 4HF2A 1U9NA 2DAOA 4KT6A 4MEXF 1W5TA 3RDIA 2DJIA 4MGRA 2VKDA 3NWSA 3NEUA 3U1KA 4FX4A 3I59A 4IO9F 1YI2I 2DK8A 1JTXA 4NDLA 1VQ5I 3H0GJ 3KP3A 2ICWG 5FLXZ 2FEZA 2FXAA 3M1CA 4G7HF 2KQRA 4N9HA 2QQ9A 2O7OA 2V79A 3R6SA 4GYGA 1JGGA 4OIRF 1I50J 1YJWI 1MMSA 1T33A 4CCKA 2ZXIA 2QBYA 1RR7A 4FQGA 1UMQA 3PO2J 2A6TA 3NARA 4UHTA 2A5WA 4YRVA 1QPIA 1MMAA 4DGWB 2DA1A 1V5FA 3CCRI 3I59B 2COMA 3PSIA 1XN7A 4AWXB 4B48A 1RKWA 3E6CC 1TNTA 2PG4A 2X6YA 2CG4A 2F5VA 2VJIA 3W6KB 1FBQA 2EWNA 3JRAA 4F92B 1W7PB 4K2EA 2QBYB 4A0YA 1PP8F 3OWTA 2VXDA 4HX4A 2JRTA 3HGYA 4XLPF 1DDNA 4M6VA 4RM2A 2OTLI 4LG0A 2B7EA 1FBUA 1K83J 1R49A 1USSA 4EJTA 2FBKA 2PX9A 1KU7A 2PBIA 3OOUA 4J00A 2AS5F 4UUSB 2YX4A 4EJWA 2M8GX 2ME6A 3Q5FA 1W5SA 2F4OB 4U87A 5HS7A 2XKOA 1LDDA 2OUMA 3G1MA 4E7SA 1NHAA 4PCQA 1ENHA 1FLIA 3DBHB 3LSRA 2DW4A 5B5EC 5LHHA 2X48A 1NG7A 2ELKA 4LG0B 1TL8A 5HLTA 3WTTC 2GWRA 2XV4S 3A01A 4U7DA 4II3A 1H88C 1GLNA 2OAZA 1X1BA 3W2VA 1P9QC 3G1OA 1OCOH 2LMDA 3CDHA 4NC8A 4KDPA 1ZG3A 1U8RA 3ABKH 3RKQA 3S15J 3GW2A 1ETWA 5L3CA 5FRMA 3F6OA 4A12A 1X2NA 3C1DA 2M7AA 1MMDA 2NXNB 3ASOH 5HS8A 2YUSA 4RDUA 2VQGA 3V42A 3JAMK 3TKYA 3FXQA 4BHBA
chains in the Genus database with same CATH topology
3B02A 5CYVA 1B9NA 5DV5A 4FX0A 4OMZA 2XAJA 3TOBA 2EFWA 2IW5A 1QO0D 2GQQA 3MZYA 1DPUA 2QWWA 3P7NA 4KMFA 2X4HA 2HOEA 4HX8A 2DK5A 2KIMA 5BQTA 1BBYA 3BP8A 1LQ1A 2BGCA 2RQPA 3CLOA 3AAFA 3SFZA 3EDPA 2HYFA 5K5OA 1T6SA 4OMYA 2P8TA 3ECOA 1OR7A 3J80K 4R8HA 2HYGD 3IL2A 3R0JA 4EMSA 3IWZA 3IRRA 2Y0MA 2VODA 2MH9A 4KA4A 2O03A 4ZYEA 2Z9OA 4L9NA 3KP5A 3GFMA 4P96A 2V1XA 4RAYA 3E97A 2IPQX 4AD9A 4M74A 4EJUA 1EH8A 5HS9A 1ULYA 2IA0A 3T1BA 3I0TA 4I02A 2Z5UA 2G7HA 3GZ5A 2IVMA 1FOKA 4HQMA 1STZA 1R1TA 3BJOA 1SMTA 4L9TA 3WTSC 2P6SA 3BROA 4YFXF 4RGRA 4U0VA 5LGUA 2MLKA 2IP2A 1WKMA 3GUDA 1H9GA 1Y0UA 2YPRA 3PQKA 3P9KA 1F4KA 4P5OA 2MD5A 3Q9VA 5K5RA 1Z1DA 1ZLKA 3CTAA 4BAYA 2MA3A 3F3XA 3VB2A 1QNTA 2HTSA 3ERED 5ICGA 3DPTA 2EB7A 3GO5A 2LSOA 1HKTA 3F8MA 2IJLA 1SFEA 3KP6A 3V7CA 3ZMSA 3WGHA 3IKVA 1YW9A 2FU4A 2WV0A 1J5YA 1I6XA 4U88A 1PUEE 4XLNF 2Y48A 2XAGA 1YQAA 3KEQA 3QPTA 4HDUA 2XAHA 3FMSA 4EJOA 3HHHA 2ESNA 1TTYA 3CO6C 1U78A 3FXRA 3M1EA 2F2EA 3PFIA 1L0OC 3GFLA 4HLXA 5FD5A 2A69F 3O3KA 5D4RA 3M7GA 2EV6A 1JGSA 5D8LB 1EH6A 4BHPA 1JHHA 2QM3A 3DPLC 1YO5C 4KIBA 4ENKA 4N0BA 2K02A 5FLXK 1S29A 2DBBA 4WXHA 5J8CA 1GXQA 2CQKA 4A6DA 1U2WA 4TV7A 2CWEA 1PDNC 3K2ZA 2MLGA 2QUFA 2CSOA 1YS6A 5HVQC 4EM1A 3JAMZ 5CLSA 4RB1A 2VBWA 3H3ZA 2V6CA 2VC0A 4UVCA 1IUYA 5D6EA 4MQVA 2G7UA 2EA4A 5LEJA 4NQWA 4YIFA 1YTYA 3RKWA 4GO1A 3CJNA 3BPVA 3KLOA 1SMYF 2XGXA 2ZNZA 1YG2A 3SXYA 1WI9A 1O7FA 1GHCA 1J59A 1C0WA 1IXSB 4BHCA 4M6XA 3GLXA 5L3BA 3DXJF 2V1DA 3I4PA 1BI3A 3JW4A 4S04A 1F1ZA 5E1WA 1R5GA 1BIAA 2PMUA 3QAHA 3GXOA 2FRHA 4KMUX 3V7SA 1P92A 3ABUA 1HQCA 3DF8A 2Y75A 2P5LC 1Z6RA 2OD5A 2QENA 5DUKA 3RPQA 2RGVA 5H6RA 1JE8A 1IN8A 4EVIA 5HLHA 1ZRCA 4IRGA 4KIFA 1QPMA 2HFHA 3KE2A 2XIGA 5CJ9A 5JR3A 1D5VA 3MWMA 1K79A 2TDXA 3HOTA 3ZMTA 2RC4A 3NQOA 1XMAA 2F5DA 4MTDA 2A6EF 4LJZF 5FB2A 1BI1A 3L09A 1CGPA 2JPBA 2R7DA 5LLQA 1Q1HA 2RDPA 5F6FA 2A6HF 4OIQF 3WE2A 1G6NA 3HRSA 2C6YA 4MTEA 4XSZF 4KFCA 1XD7A 2DLLA 2OZ6A 3HRUA 4I98B 2FA5A 3BDDA 4HBLA 3RYRA 4I01A 1G3SA 2P7CB 1KQ8A 3LA7A 4G7OF 5ERIA 1S3JA 1R1VA 3LA2A 3ZMUA 3FHZA 4RB0A 3MFKA 2J5OA 3FMQA 4RB2C 4EGZA 4CYDA 2A07F 4HV6A 5E18F 4HZFA 3GZ6A 2RV8A 1R1UA 1FX7A 3MEXA 3H3UA 4B8XA 2E7WA 2F5FA 4I0BA 3E3VA 4L18B 2NNNA 4L5IA 3LFKA 4AIJA 2HDCA 3S2WA 2P7VB 1O3TA 3N97A 3WTXC 4Z2YA 2RVCA 2YU3A 1LVAA 4G9YA 2YR2A 4ENJA 1X3UA 2ISZA 3RI4A 3ROUA 5ILUA 4Y17A 3F22A 2FF4A 2XVCA 2F5EA 5D5UB 4D0PA 4I7HA 3WTWC 3J81Z 2ZXJA 3CUQA 3TQNA 4M9XA 2H6CA 1MD0A 4Q48A 1B59A 4I0AA 4QWQA 2PEXA 2MC3A 1XMKA 3E5QA 4ZYGA 2UXNA 5IT3A 1OKRA 1SFUA 4P9UA 3CUQB 1ZH5A 2D1VA 3WODF 4E70A 3W6JB 5CVRA 1XGOA 1K6OA 2M87A 4YFKF 2ZJ2A 5DDGA 2ZO4A 2OQRA 4ZYHA 4LK0F 5TJJA 3BY6A 2P5VA 1LEAA 3KLNA 5A2QK 3C18A 4MEYF 4GCVA 3FWEA 1UHMA 2ETHA 5JHUA 1T2KA 3OOPA 1KU3A 1REPC 4BXUA 1YS7A 3HTSB 2FMLA 1BC8C 2VT2A 1FC3A 4IXAA 4L5JA 3TDUC 2XKPA 5F64A 5LRSA 1HKQA 4NB5A 3RTRA 2ZBKA 3JSPA 3QU6A 1P4AA 4KIGA 1R5HA 2VN2A 5DCMA 4Q4ZF 4LGWA 3LSTA 1FP1D 4O5VA 1S8NA 5BS6A 2FNAA 3ECHA 2JSCA 3KEOA 4LK1F 3JSOA 2KJBA 5E17F 4RS8A 2XAQA 4R79A 3LQQA 5AONA 2LKPA 1OYWA 5ILVA 3CO7C 2FQ3A 1ZAOA 3WTZA 4Y13A 5CVVA 1GXPA 1ODDA 1R7JA 4CICA 2O0YA 3U2RA 2HQNA 5D5XB 1MDMA 1RUNA 2PFBA 1FSEA 1TBXA 2GA1A 2XAFA 1W7PD 2K4BA 2JPCA 3LAJA 1MDMB 2OQGA 2O61A 2EFNA 2VE9A 5CVUA 4EGYA 4HAMA 4WF2A 2VE8A 1YIOA 1IAWA 2HZTA 3ELKA 5BPIA 3KCCA 3R0AA 3T5XA 1HSTA 2DPUA 3TDZC 1VTNC 2JZYA 5DEQA 2ACJA 3P9CA 2L54A 2VXZA 3GFJA 1KYZA 4RAZA 2Z33A 4DQ2A 4LLGF 1IN6A 4B09A 1PP7U 2KIUA 3ZMVA 1FT9A 2A68F 5ILSA 3KP4A 4XSXF 2DTRA 4WXCA 2VOPA 3ZMDA 2DFIA 3DV8A 1KGSA 2H94A 1T98A 1ZHFA 1ON2A 2M8EA 2R3SA 2ZMEA 3GVAA 3EYIA 3MZHA 5HOOA 2ZNYA 5DCFA 1RI7A 1R22A 3PQJA 3J7AO 3FM3A 2FSWA 1FYMA 3KZYA 1BI2A 2A61A 1A04A 3TO6A 1SD4A 4OIPF 5K1YA 3KP2A 2EV5A 2VT3A 4L9JA 3FM5A 1MKMA 1YYVA 1BJAA 1U5TC 3HSRA 4EJVA 3RIRA 1AOYA 3L00A 1UFMA 1ZRDA 2E1NA 2HR3A 4RB3C 4LD5A 5KK1A 4IRHA 4M72A 2ESHA 4RGXA 2O8XA 1S7OA 3HOSA 2VOOA 4LB6B 1YFHA 3E5XA 4CXFA 2W57A 3I54A 1FYKA 4IHSA 1LJ9A 3ZP5A 1ZN2A 3DKWA 5A2QZ 2M5WA 3M8FA 5JVTA 2W24A 4M73A 1ONVA 2K7LA 1AWCA 3K0LA 3BJ6A 3F8NA 1Z7UA 2K27A 3NRVA 3H92A 1QZYA 2YX7A 2P6TA 1G3YA 3J81K 1UCRA 3WTYC 2IA1A 4BQAA 1LDKB 1S6LA 5E8IA 4L0YB 4ZH4F 1KA8A 4UNOA 1TQMA 1B9MA 1BI0A 2EA2A 2H6BA 1GVJA 4XRFA 2V1UA 2GZWA 2YSRA 4LLLA 1DP7P 2NNYA 1MGTA 1MJAA 3REOA 1HXDA 1G4DA 2ZFWA 1ZRFA 2W25A 4G7ZF 5TRDA 1H9TA 4KNYA 3GFIA 2M1BA 3SHFA 3WGIA 3F8BA 3IC7A 4M9SA 3F21A 2STWA 4M71A 1O3SA 1H0MA 4CO8A 2WTEA 2VBYA 2V9VA 1OYYA 1LDJA 4NHJA 5E20A 3GF2A 4G6QA 5H6QA 3EETA 1Z9CA 3V8KA 4HA8A 5J6XA 1FWZA 2M45A 4IJAA 4FHTA 2L3DA 4U7BA 4FT8A 5CVJA 2O3FA 2VC1A 1T39A 4HLYA 3HYIA 5HLIA 1TLHB 2OA4A 1HW5A 1WRJA 3C7JA 2L4AA 5J8FA 1QZZA 2H27A 2AXLA 5DUIA 1WWXA 4MQ9F 2QLZA 1WQ2A 2QQBA 3R60A 3RKYA 1CF7A 1RIOH 4XBFA 1YW8A 4G6DA 4YG2F 1FPQA 3JTGA 1TW2A 2BE5F 1LEBA 2K86A 5E8GA 1KQ9A 3C3WA 5FD6A 1IN7A 4PDKA 3K1MA 3TGNA 3WGGA 1KU2A 1B4AA 2CGPA 1E2XA 3ML6A 1HW1A 4WXDA 4UV8A 3V8LA 1U5TA 1HBXG 2DU9A 3RJPA 1ZYRF 5LHIA 3M9AA 3L9FA 2HTJA 4N9IA 4WWCA 4UVBA 3R61A 3HRMA 4A5NA 3D5LA 5ICFA 5IT9Z 3K1PA 3FX3A 4ESFA 3TOAA 4HX7A 4BNCA 2BYVE 2QYOA 2EV0A 3F23A 5LRRA 2XASA 4GGGA 2ADUA 3M8EA 1IXCA 2UXXA 1ZGAA 3K9TA 4ASNA 5D4SA 3HTUA 3WU0A 4KYWA 2XHKA 2FMYA 4L9VA 1T38A 4O3MA 3DP7A 4PZJA 5LEKA 2M30A 1FNNA 3ZN0A 3HRTA 3WG9A 5JI6A 3VFZA 3L7WA 2HKOA 1SAXA 2DQLA 1JXSA 2NS0A 2L4MA 4JBAA 1R00A 3G3ZA 2FOKA 3E6MA 2HKXA 2UZKA 1W7PA 1MJBA 4YFNF 1O7LA 1J75A 3RYPA 5KVRA 1QGPA 4OOIA 2ISYA 3JTHA 4EM0B 1XSXA 2LDUA 3LAPA 1OPCA 2GXBA 2PN6A 1MJ9A 1XGMA 1XGSA 1KQ0A 4KN7X 1JHFA 5L3DA 4UUVA 1IXRC 1IF1A 2QVOA 3QU3A 3KZZA 4ENMA 5D5WB 3V7RA 3T8RA 4HF0A 1BC7C 1K7AA 2GA2A 1P6RA 2WC2A 2D2WA 1IRFA 3DQVC 1R36A 1LB2A 3WU1B 2Q2EA 1Z05A 1U6GA 1IN4A 4G8XA 4A5MA 4HQEA 2L01A 4I09A 1P2FA 1UB9A 3EUHA 1XSDA 3MAJA 1K78A 3BZ6A 5HLGA 1ZREA 3MCZA 3GWZA 3IHUA 1V3FA 2IRFG 5L3EA 2H09A 3HSEA 1QQIA 2LNBA 5JFRA 3RPUA 1XDUA 3U9GA 1LNWA 1BM9A 4M6YA 1F9NA 2CYYA 5DCMB 5D5VB 1K78B 1HSJA 4OIOF 2F5CA 1J0RA 3T8TA 3K69A 4G94A 2FBHA 4ZZDA 4F7ZA 2DPDA 2W84A 2PQ8A 5FFZA 4ON0A 4A0XA 3FZVA 2PJPA 5EEHA 2UWMA 3F8FA 4HF1A 2RKHA 2JT1A 4JK1X 5BOXA 1ON1A 5ICEA 3LQRA 1RNLA 3HHGA 1TNSA 4U0WA 3LA3A 1T0FA 4HOBA 3QP6A 1SFXA 2HQRA 1KYWA 1FYLA 4KT5C 3E6BA 3DEUA 4AIKA 1V4RA 4U0YA 1DPRA 2G9WA 5LGNA 2E7XA 5ICCA 3D0SA 1XGNA 4M9ZA 1OYIA 2HEOA 3KP7A 4RGUA 3WTVC 4LMYA 3CUOA 3ZMZA 1OMIA 1HKSA 3IKTA 1YLFA 2HS5A 2NAZA 4AIHA 1J2XA 1G3TA 4CGZA 4HYEA 5BPDA 4HV5A 2OU2A 4ZZLA 1BN5A 2EK5A 4ETSA 1W4MA 2VBZA 1TQPA 1XDSA 5HDGA 1J9IA 2DQRA 2W85A 2A5YB 5HDKA 2GAUA 1WSUA 4Y15A 4P55A 4A2UA 1FSHA 2NYXA 1D8KA 3U1DA 3IWFA 4MHGA 2HGCA 5D8KB 3HUGA 3B73A 4BYYA 2WWYA 3GEZA 5LHGA 1I1SA 1O57A 2ZMEB 3ABTA 1UHWA 5HDNA 3I64A 4QLCU 5L3GA 2OBPA 5IT9K 1SD6A 3FF5A 1QBJA 2QQAA 1R58A 1F5TA 2J5PA 2Q8KA 1YW7A 5ED4A 3ISPA 3MQ0A 3I5UA 2FBIA 2P5KA 2BEOA 5CVIA 2FNPA 3SZTA 2PLYA 3VEPA 1P4XA 3VODA 1FP2A 3BJAA 1RZ4A 2QZ8A 5BMZA 4Q5SF 4WK8F 5LGTA 1IZ1A 4ZYDA 1TQIA 4WX9A 3QRFF 1DUXC 4ESBA 1I1GA 2X0LA 1Z91A 4OINF 4EM2A 4PGHA 3K1NA 1XB4A 2PMHA 1IN5A 3I58A 2K4JA 2GXGA 2E1CA 4JQFA 4PGGA 2VONA 3QOPA 5L3FA 2B0LA 4CDGA 2IT0A 3FXUA 2OZUA 4YIIA 2Z3YA 5F1RA 5E1ZB 1P4WA 2ZCWA 4KICA 2KRFA 3F72A 3E6DA 5H20A 1HW2A 3QP5A 4WCGA 3BWGA 3IRQA 2R7FA 4CHUA 1XSVA 1SD5A 4I2OA 1O3QA 1RUOA 2GIVA 2ZKZA 4O6JA 1ZG5A 2D45A 2XROA 3WE3A 1BOAA 4BH9A 4ENNA 3E5UA 2DI3A 5K5QA 1ZG1A 1S7AA 3WTUC 1BIBA 3CUQC 2D1HA 3P9IA 3I71A 3O2PE 4GYIA 2JTVA 2VBXA 2CW0F 5FO5A 3EQLF 3BOQA 3TO7A 4P9FA 2BBYA 3SZPA 1J7KA 3I53A 3VOEA 2MBFA 4IVNA 4KN4X 2BV6A 3TO9A 1FBSA 3SQNA 3J80Z 2KIFA 1FY7A 3FMRA 1FZPB 2EFPA 3BPXA 2LF7A 3V8JA 3F8CA 4IRIA 2FE3A 2O6GE 1USTA 2STTA 5AIQA 4EV0A 1ZGJA 3DFGA 1SD7A 4RGSA 2ELHA 4DNCA 3T0YA 5DD8A 4IPAA 1E17A 4UV9A 3R4KA 1I27A 4UXNA 3LWFA 3QPHA 5FGMA 5DYMA 5EEGA 1MZBA 1EV7A 1Z6TA 5AIPA 1XCBA 1IW7F 3O6BB 3KETA 2EJRA 5DD4A 2PI0A 2DT5A 3ULQB 4HDVA 5LBQA 5FFXA 5E1XA 3Q9SA 4LLNA 2HWVA 4AVPA 1R23A 4H0EA 3G73A 5D6FA 3OV8A 2CO5A 2MH2A 4Q47A 4CZZA 4ESJA 1CF7B 4HW0A 1I5ZA 3HIFA 1D8JA 2Q0OA 4GXOA 4R1HA 2XUBA 3HSFA 2LF8A 1KU9A 6PAXA 2NRAC 4LFUA 2DO7A 4EQQA 2KJCA 1U5TB 4UVAA 2KKOA 3L2CA 2P4WA 2RNJA 4IHTA 2Z99A 1IRGA 4OU0A 1B1BA 3ZPLA 1B6AA 4LB5A 3COAC 2L02A 1G3WA 2XRNA 1ZLJA 4KUMA 4MNUA 2EFOA 3EYYA 3N4MA 4A6EA 2IA2A 1EH7A 1TW3A 1L3LA 2A3SA 2CFXA 3GX4X 1O3RA 3ZQ7A 4IF4A 3KFWX 1XCVA 1U3EM 3RKXA 4S05A 3GYHX 1D3YA 3ZN1A 1ZARA 2EFQA 3V4GA 2RN7A 4L0ZB 4A0ZA 3F6VA 4HF2A 2DAOA 4MEXF 1W5TA 3RDIA 4MGRA 3NEUA 4FX4A 3I59A 2DK8A 3KP3A 5FLXZ 2FEZA 2FXAA 4G7HF 4N9HA 2QQ9A 2V79A 3R6SA 4GYGA 4OIRF 2QBYA 4UHTA 3I59B 2COMA 1XN7A 4AWXB 3E6CC 1TNTA 2PG4A 2CG4A 3W6KB 1FBQA 2EWNA 1W7PB 4K2EA 2QBYB 4A0YA 1PP8F 4HX4A 2JRTA 4XLPF 1DDNA 4LG0A 1FBUA 1USSA 4EJTA 2FBKA 1KU7A 2PBIA 2AS5F 2YX4A 4EJWA 3Q5FA 1W5SA 5HS7A 2XKOA 1LDDA 1NHAA 4PCQA 1FLIA 2DW4A 5LHHA 4LG0B 3WTTC 2GWRA 2XV4S 4U7DA 2OAZA 3CDHA 4KDPA 1ZG3A 1U8RA 3GW2A 5L3CA 3F6OA 4A12A 3C1DA 5HS8A 3JAMK 3TKYA 3FXQA 4BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B02 A;  5CYV A;  1B9N A;  5DV5 A;  4FX0 A;  4OMZ A;  2XAJ A;  3TOB A;  2EFW A;  2IW5 A;  1QO0 D;  2GQQ A;  3MZY A;  1DPU A;  2QWW A;  3P7N A;  4KMF A;  2X4H A;  2HOE A;  4HX8 A;  2DK5 A;  2KIM A;  5BQT A;  1BBY A;  3BP8 A;  1LQ1 A;  2BGC A;  2RQP A;  3CLO A;  3AAF A;  3SFZ A;  3EDP A;  2HYF A;  5K5O A;  1T6S A;  4OMY A;  2P8T A;  3ECO A;  1OR7 A;  3J80 K;  4R8H A;  2HYG D;  3IL2 A;  3R0J A;  4EMS A;  3IWZ A;  3IRR A;  2Y0M A;  2VOD A;  2MH9 A;  4KA4 A;  2O03 A;  4ZYE A;  2Z9O A;  4L9N A;  3KP5 A;  3GFM A;  4P96 A;  2V1X A;  4RAY A;  3E97 A;  2IPQ X;  4AD9 A;  4M74 A;  4EJU A;  1EH8 A;  5HS9 A;  1ULY A;  2IA0 A;  3T1B A;  3I0T A;  4I02 A;  2Z5U A;  2G7H A;  3GZ5 A;  2IVM A;  1FOK A;  4HQM A;  1STZ A;  1R1T A;  3BJO A;  1SMT A;  4L9T A;  3WTS C;  2P6S A;  3BRO A;  4YFX F;  4RGR A;  4U0V A;  5LGU A;  2MLK A;  2IP2 A;  1WKM A;  3GUD A;  1H9G A;  1Y0U A;  2YPR A;  3PQK A;  3P9K A;  1F4K A;  4P5O A;  2MD5 A;  3Q9V A;  5K5R A;  1Z1D A;  1ZLK A;  3CTA A;  4BAY A;  2MA3 A;  3F3X A;  3VB2 A;  1QNT A;  2HTS A;  3ERE D;  5ICG A;  3DPT A;  2EB7 A;  3GO5 A;  2LSO A;  1HKT A;  3F8M A;  2IJL A;  1SFE A;  3KP6 A;  3V7C A;  3ZMS A;  3WGH A;  3IKV A;  1YW9 A;  2FU4 A;  2WV0 A;  1J5Y A;  1I6X A;  4U88 A;  1PUE E;  4XLN F;  2Y48 A;  2XAG A;  1YQA A;  3KEQ A;  3QPT A;  4HDU A;  2XAH A;  3FMS A;  4EJO A;  3HHH A;  2ESN A;  1TTY A;  3CO6 C;  1U78 A;  3FXR A;  3M1E A;  2F2E A;  3PFI A;  1L0O C;  3GFL A;  4HLX A;  5FD5 A;  2A69 F;  3O3K A;  5D4R A;  3M7G A;  2EV6 A;  1JGS A;  5D8L B;  1EH6 A;  4BHP A;  1JHH A;  2QM3 A;  3DPL C;  1YO5 C;  4KIB A;  4ENK A;  4N0B A;  2K02 A;  5FLX K;  1S29 A;  2DBB A;  4WXH A;  5J8C A;  1GXQ A;  2CQK A;  4A6D A;  1U2W A;  4TV7 A;  2CWE A;  1PDN C;  3K2Z A;  2MLG A;  2QUF A;  2CSO A;  1YS6 A;  5HVQ C;  4EM1 A;  3JAM Z;  5CLS A;  4RB1 A;  2VBW A;  3H3Z A;  2V6C A;  2VC0 A;  4UVC A;  1IUY A;  5D6E A;  4MQV A;  2G7U A;  2EA4 A;  5LEJ A;  4NQW A;  4YIF A;  1YTY A;  3RKW A;  4GO1 A;  3CJN A;  3BPV A;  3KLO A;  1SMY F;  2XGX A;  2ZNZ A;  1YG2 A;  3SXY A;  1WI9 A;  1O7F A;  1GHC A;  1J59 A;  1C0W A;  1IXS B;  4BHC A;  4M6X A;  3GLX A;  5L3B A;  3DXJ F;  2V1D A;  3I4P A;  1BI3 A;  3JW4 A;  4S04 A;  1F1Z A;  5E1W A;  1R5G A;  1BIA A;  2PMU A;  3QAH A;  3GXO A;  2FRH A;  4KMU X;  3V7S A;  1P92 A;  3ABU A;  1HQC A;  3DF8 A;  2Y75 A;  2P5L C;  1Z6R A;  2OD5 A;  2QEN A;  5DUK A;  3RPQ A;  2RGV A;  5H6R A;  1JE8 A;  1IN8 A;  4EVI A;  5HLH A;  1ZRC A;  4IRG A;  4KIF A;  1QPM A;  2HFH A;  3KE2 A;  2XIG A;  5CJ9 A;  5JR3 A;  1D5V A;  3MWM A;  1K79 A;  2TDX A;  3HOT A;  3ZMT A;  2RC4 A;  3NQO A;  1XMA A;  2F5D A;  4MTD A;  2A6E F;  4LJZ F;  5FB2 A;  1BI1 A;  3L09 A;  1CGP A;  2JPB A;  2R7D A;  5LLQ A;  1Q1H A;  2RDP A;  5F6F A;  2A6H F;  4OIQ F;  3WE2 A;  1G6N A;  3HRS A;  2C6Y A;  4MTE A;  4XSZ F;  4KFC A;  1XD7 A;  2DLL A;  2OZ6 A;  3HRU A;  4I98 B;  2FA5 A;  3BDD A;  4HBL A;  3RYR A;  4I01 A;  1G3S A;  2P7C B;  1KQ8 A;  3LA7 A;  4G7O F;  5ERI A;  1S3J A;  1R1V A;  3LA2 A;  3ZMU A;  3FHZ A;  4RB0 A;  3MFK A;  2J5O A;  3FMQ A;  4RB2 C;  4EGZ A;  4CYD A;  2A07 F;  4HV6 A;  5E18 F;  4HZF A;  3GZ6 A;  2RV8 A;  1R1U A;  1FX7 A;  3MEX A;  3H3U A;  4B8X A;  2E7W A;  2F5F A;  4I0B A;  3E3V A;  4L18 B;  2NNN A;  4L5I A;  3LFK A;  4AIJ A;  2HDC A;  3S2W A;  2P7V B;  1O3T A;  3N97 A;  3WTX C;  4Z2Y A;  2RVC A;  2YU3 A;  1LVA A;  4G9Y A;  2YR2 A;  4ENJ A;  1X3U A;  2ISZ A;  3RI4 A;  3ROU A;  5ILU A;  4Y17 A;  3F22 A;  2FF4 A;  2XVC A;  2F5E A;  5D5U B;  4D0P A;  4I7H A;  3WTW C;  3J81 Z;  2ZXJ A;  3CUQ A;  3TQN A;  4M9X A;  2H6C A;  1MD0 A;  4Q48 A;  1B59 A;  4I0A A;  4QWQ A;  2PEX A;  2MC3 A;  1XMK A;  3E5Q A;  4ZYG A;  2UXN A;  5IT3 A;  1OKR A;  1SFU A;  4P9U A;  3CUQ B;  1ZH5 A;  2D1V A;  3WOD F;  4E70 A;  3W6J B;  5CVR A;  1XGO A;  1K6O A;  2M87 A;  4YFK F;  2ZJ2 A;  5DDG A;  2ZO4 A;  2OQR A;  4ZYH A;  4LK0 F;  5TJJ A;  3BY6 A;  2P5V A;  1LEA A;  3KLN A;  5A2Q K;  3C18 A;  4MEY F;  4GCV A;  3FWE A;  1UHM A;  2ETH A;  5JHU A;  1T2K A;  3OOP A;  1KU3 A;  1REP C;  4BXU A;  1YS7 A;  3HTS B;  2FML A;  1BC8 C;  2VT2 A;  1FC3 A;  4IXA A;  4L5J A;  3TDU C;  2XKP A;  5F64 A;  5LRS A;  1HKQ A;  4NB5 A;  3RTR A;  2ZBK A;  3JSP A;  3QU6 A;  1P4A A;  4KIG A;  1R5H A;  2VN2 A;  5DCM A;  4Q4Z F;  4LGW A;  3LST A;  1FP1 D;  4O5V A;  1S8N A;  5BS6 A;  2FNA A;  3ECH A;  2JSC A;  3KEO A;  4LK1 F;  3JSO A;  2KJB A;  5E17 F;  4RS8 A;  2XAQ A;  4R79 A;  3LQQ A;  5AON A;  2LKP A;  1OYW A;  5ILV A;  3CO7 C;  2FQ3 A;  1ZAO A;  3WTZ A;  4Y13 A;  5CVV A;  1GXP A;  1ODD A;  1R7J A;  4CIC A;  2O0Y A;  3U2R A;  2HQN A;  5D5X B;  1MDM A;  1RUN A;  2PFB A;  1FSE A;  1TBX A;  2GA1 A;  2XAF A;  1W7P D;  2K4B A;  2JPC A;  3LAJ A;  1MDM B;  2OQG A;  2O61 A;  2EFN A;  2VE9 A;  5CVU A;  4EGY A;  4HAM A;  4WF2 A;  2VE8 A;  1YIO A;  1IAW A;  2HZT A;  3ELK A;  5BPI A;  3KCC A;  3R0A A;  3T5X A;  1HST A;  2DPU A;  3TDZ C;  1VTN C;  2JZY A;  5DEQ A;  2ACJ A;  3P9C A;  2L54 A;  2VXZ A;  3GFJ A;  1KYZ A;  4RAZ A;  2Z33 A;  4DQ2 A;  4LLG F;  1IN6 A;  4B09 A;  1PP7 U;  2KIU A;  3ZMV A;  1FT9 A;  2A68 F;  5ILS A;  3KP4 A;  4XSX F;  2DTR A;  4WXC A;  2VOP A;  3ZMD A;  2DFI A;  3DV8 A;  1KGS A;  2H94 A;  1T98 A;  1ZHF A;  1ON2 A;  2M8E A;  2R3S A;  2ZME A;  3GVA A;  3EYI A;  3MZH A;  5HOO A;  2ZNY A;  5DCF A;  1RI7 A;  1R22 A;  3PQJ A;  3J7A O;  3FM3 A;  2FSW A;  1FYM A;  3KZY A;  1BI2 A;  2A61 A;  1A04 A;  3TO6 A;  1SD4 A;  4OIP F;  5K1Y A;  3KP2 A;  2EV5 A;  2VT3 A;  4L9J A;  3FM5 A;  1MKM A;  1YYV A;  1BJA A;  1U5T C;  3HSR A;  4EJV A;  3RIR A;  1AOY A;  3L00 A;  1UFM A;  1ZRD A;  2E1N A;  2HR3 A;  4RB3 C;  4LD5 A;  5KK1 A;  4IRH A;  4M72 A;  2ESH A;  4RGX A;  2O8X A;  1S7O A;  3HOS A;  2VOO A;  4LB6 B;  1YFH A;  3E5X A;  4CXF A;  2W57 A;  3I54 A;  1FYK A;  4IHS A;  1LJ9 A;  3ZP5 A;  1ZN2 A;  3DKW A;  5A2Q Z;  2M5W A;  3M8F A;  5JVT A;  2W24 A;  4M73 A;  1ONV A;  2K7L A;  1AWC A;  3K0L A;  3BJ6 A;  3F8N A;  1Z7U A;  2K27 A;  3NRV A;  3H92 A;  1QZY A;  2YX7 A;  2P6T A;  1G3Y A;  3J81 K;  1UCR A;  3WTY C;  2IA1 A;  4BQA A;  1LDK B;  1S6L A;  5E8I A;  4L0Y B;  4ZH4 F;  1KA8 A;  4UNO A;  1TQM A;  1B9M A;  1BI0 A;  2EA2 A;  2H6B A;  1GVJ A;  4XRF A;  2V1U A;  2GZW A;  2YSR A;  4LLL A;  1DP7 P;  2NNY A;  1MGT A;  1MJA A;  3REO A;  1HXD A;  1G4D A;  2ZFW A;  1ZRF A;  2W25 A;  4G7Z F;  5TRD A;  1H9T A;  4KNY A;  3GFI A;  2M1B A;  3SHF A;  3WGI A;  3F8B A;  3IC7 A;  4M9S A;  3F21 A;  2STW A;  4M71 A;  1O3S A;  1H0M A;  4CO8 A;  2WTE A;  2VBY A;  2V9V A;  1OYY A;  1LDJ A;  4NHJ A;  5E20 A;  3GF2 A;  4G6Q A;  5H6Q A;  3EET A;  1Z9C A;  3V8K A;  4HA8 A;  5J6X A;  1FWZ A;  2M45 A;  4IJA A;  4FHT A;  2L3D A;  4U7B A;  4FT8 A;  5CVJ A;  2O3F A;  2VC1 A;  1T39 A;  4HLY A;  3HYI A;  5HLI A;  1TLH B;  2OA4 A;  1HW5 A;  1WRJ A;  3C7J A;  2L4A A;  5J8F A;  1QZZ A;  2H27 A;  2AXL A;  5DUI A;  1WWX A;  4MQ9 F;  2QLZ A;  1WQ2 A;  2QQB A;  3R60 A;  3RKY A;  1CF7 A;  1RIO H;  4XBF A;  1YW8 A;  4G6D A;  4YG2 F;  1FPQ A;  3JTG A;  1TW2 A;  2BE5 F;  1LEB A;  2K86 A;  5E8G A;  1KQ9 A;  3C3W A;  5FD6 A;  1IN7 A;  4PDK A;  3K1M A;  3TGN A;  3WGG A;  1KU2 A;  1B4A A;  2CGP A;  1E2X A;  3ML6 A;  1HW1 A;  4WXD A;  4UV8 A;  3V8L A;  1U5T A;  1HBX G;  2DU9 A;  3RJP A;  1ZYR F;  5LHI A;  3M9A A;  3L9F A;  2HTJ A;  4N9I A;  4WWC A;  4UVB A;  3R61 A;  3HRM A;  4A5N A;  3D5L A;  5ICF A;  5IT9 Z;  3K1P A;  3FX3 A;  4ESF A;  3TOA A;  4HX7 A;  4BNC A;  2BYV E;  2QYO A;  2EV0 A;  3F23 A;  5LRR A;  2XAS A;  4GGG A;  2ADU A;  3M8E A;  1IXC A;  2UXX A;  1ZGA A;  3K9T A;  4ASN A;  5D4S A;  3HTU A;  3WU0 A;  4KYW A;  2XHK A;  2FMY A;  4L9V A;  1T38 A;  4O3M A;  3DP7 A;  4PZJ A;  5LEK A;  2M30 A;  1FNN A;  3ZN0 A;  3HRT A;  3WG9 A;  5JI6 A;  3VFZ A;  3L7W A;  2HKO A;  1SAX A;  2DQL A;  1JXS A;  2NS0 A;  2L4M A;  4JBA A;  1R00 A;  3G3Z A;  2FOK A;  3E6M A;  2HKX A;  2UZK A;  1W7P A;  1MJB A;  4YFN F;  1O7L A;  1J75 A;  3RYP A;  5KVR A;  1QGP A;  4OOI A;  2ISY A;  3JTH A;  4EM0 B;  1XSX A;  2LDU A;  3LAP A;  1OPC A;  2GXB A;  2PN6 A;  1MJ9 A;  1XGM A;  1XGS A;  1KQ0 A;  4KN7 X;  1JHF A;  5L3D A;  4UUV A;  1IXR C;  1IF1 A;  2QVO A;  3QU3 A;  3KZZ A;  4ENM A;  5D5W B;  3V7R A;  3T8R A;  4HF0 A;  1BC7 C;  1K7A A;  2GA2 A;  1P6R A;  2WC2 A;  2D2W A;  1IRF A;  3DQV C;  1R36 A;  1LB2 A;  3WU1 B;  2Q2E A;  1Z05 A;  1U6G A;  1IN4 A;  4G8X A;  4A5M A;  4HQE A;  2L01 A;  4I09 A;  1P2F A;  1UB9 A;  3EUH A;  1XSD A;  3MAJ A;  1K78 A;  3BZ6 A;  5HLG A;  1ZRE A;  3MCZ A;  3GWZ A;  3IHU A;  1V3F A;  2IRF G;  5L3E A;  2H09 A;  3HSE A;  1QQI A;  2LNB A;  5JFR A;  3RPU A;  1XDU A;  3U9G A;  1LNW A;  1BM9 A;  4M6Y A;  1F9N A;  2CYY A;  5DCM B;  5D5V B;  1K78 B;  1HSJ A;  4OIO F;  2F5C A;  1J0R A;  3T8T A;  3K69 A;  4G94 A;  2FBH A;  4ZZD A;  4F7Z A;  2DPD A;  2W84 A;  2PQ8 A;  5FFZ A;  4ON0 A;  4A0X A;  3FZV A;  2PJP A;  5EEH A;  2UWM A;  3F8F A;  4HF1 A;  2RKH A;  2JT1 A;  4JK1 X;  5BOX A;  1ON1 A;  5ICE A;  3LQR A;  1RNL A;  3HHG A;  1TNS A;  4U0W A;  3LA3 A;  1T0F A;  4HOB A;  3QP6 A;  1SFX A;  2HQR A;  1KYW A;  1FYL A;  4KT5 C;  3E6B A;  3DEU A;  4AIK A;  1V4R A;  4U0Y A;  1DPR A;  2G9W A;  5LGN A;  2E7X A;  5ICC A;  3D0S A;  1XGN A;  4M9Z A;  1OYI A;  2HEO A;  3KP7 A;  4RGU A;  3WTV C;  4LMY A;  3CUO A;  3ZMZ A;  1OMI A;  1HKS A;  3IKT A;  1YLF A;  2HS5 A;  2NAZ A;  4AIH A;  1J2X A;  1G3T A;  4CGZ A;  4HYE A;  5BPD A;  4HV5 A;  2OU2 A;  4ZZL A;  1BN5 A;  2EK5 A;  4ETS A;  1W4M A;  2VBZ A;  1TQP A;  1XDS A;  5HDG A;  1J9I A;  2DQR A;  2W85 A;  2A5Y B;  5HDK A;  2GAU A;  1WSU A;  4Y15 A;  4P55 A;  4A2U A;  1FSH A;  2NYX A;  1D8K A;  3U1D A;  3IWF A;  4MHG A;  2HGC A;  5D8K B;  3HUG A;  3B73 A;  4BYY A;  2WWY A;  3GEZ A;  5LHG A;  1I1S A;  1O57 A;  2ZME B;  3ABT A;  1UHW A;  5HDN A;  3I64 A;  4QLC U;  5L3G A;  2OBP A;  5IT9 K;  1SD6 A;  3FF5 A;  1QBJ A;  2QQA A;  1R58 A;  1F5T A;  2J5P A;  2Q8K A;  1YW7 A;  5ED4 A;  3ISP A;  3MQ0 A;  3I5U A;  2FBI A;  2P5K A;  2BEO A;  5CVI A;  2FNP A;  3SZT A;  2PLY A;  3VEP A;  1P4X A;  3VOD A;  1FP2 A;  3BJA A;  1RZ4 A;  2QZ8 A;  5BMZ A;  4Q5S F;  4WK8 F;  5LGT A;  1IZ1 A;  4ZYD A;  1TQI A;  4WX9 A;  3QRF F;  1DUX C;  4ESB A;  1I1G A;  2X0L A;  1Z91 A;  4OIN F;  4EM2 A;  4PGH A;  3K1N A;  1XB4 A;  2PMH A;  1IN5 A;  3I58 A;  2K4J A;  2GXG A;  2E1C A;  4JQF A;  4PGG A;  2VON A;  3QOP A;  5L3F A;  2B0L A;  4CDG A;  2IT0 A;  3FXU A;  2OZU A;  4YII A;  2Z3Y A;  5F1R A;  5E1Z B;  1P4W A;  2ZCW A;  4KIC A;  2KRF A;  3F72 A;  3E6D A;  5H20 A;  1HW2 A;  3QP5 A;  4WCG A;  3BWG A;  3IRQ A;  2R7F A;  4CHU A;  1XSV A;  1SD5 A;  4I2O A;  1O3Q A;  1RUO A;  2GIV A;  2ZKZ A;  4O6J A;  1ZG5 A;  2D45 A;  2XRO A;  3WE3 A;  1BOA A;  4BH9 A;  4ENN A;  3E5U A;  2DI3 A;  5K5Q A;  1ZG1 A;  1S7A A;  3WTU C;  1BIB A;  3CUQ C;  2D1H A;  3P9I A;  3I71 A;  3O2P E;  4GYI A;  2JTV A;  2VBX A;  2CW0 F;  5FO5 A;  3EQL F;  3BOQ A;  3TO7 A;  4P9F A;  2BBY A;  3SZP A;  1J7K A;  3I53 A;  3VOE A;  2MBF A;  4IVN A;  4KN4 X;  2BV6 A;  3TO9 A;  1FBS A;  3SQN A;  3J80 Z;  2KIF A;  1FY7 A;  3FMR A;  1FZP B;  2EFP A;  3BPX A;  2LF7 A;  3V8J A;  3F8C A;  4IRI A;  2FE3 A;  2O6G E;  1UST A;  2STT A;  5AIQ A;  4EV0 A;  1ZGJ A;  3DFG A;  1SD7 A;  4RGS A;  2ELH A;  4DNC A;  3T0Y A;  5DD8 A;  4IPA A;  1E17 A;  4UV9 A;  3R4K A;  1I27 A;  4UXN A;  3LWF A;  3QPH A;  5FGM A;  5DYM A;  5EEG A;  1MZB A;  1EV7 A;  1Z6T A;  5AIP A;  1XCB A;  1IW7 F;  3O6B B;  3KET A;  2EJR A;  5DD4 A;  2PI0 A;  2DT5 A;  3ULQ B;  4HDV A;  5LBQ A;  5FFX A;  5E1X A;  3Q9S A;  4LLN A;  2HWV A;  4AVP A;  1R23 A;  4H0E A;  3G73 A;  5D6F A;  3OV8 A;  2CO5 A;  2MH2 A;  4Q47 A;  4CZZ A;  4ESJ A;  1CF7 B;  4HW0 A;  1I5Z A;  3HIF A;  1D8J A;  2Q0O A;  4GXO A;  4R1H A;  2XUB A;  3HSF A;  2LF8 A;  1KU9 A;  6PAX A;  2NRA C;  4LFU A;  2DO7 A;  4EQQ A;  2KJC A;  1U5T B;  4UVA A;  2KKO A;  3L2C A;  2P4W A;  2RNJ A;  4IHT A;  2Z99 A;  1IRG A;  4OU0 A;  1B1B A;  3ZPL A;  1B6A A;  4LB5 A;  3COA C;  2L02 A;  1G3W A;  2XRN A;  1ZLJ A;  4KUM A;  4MNU A;  2EFO A;  3EYY A;  3N4M A;  4A6E A;  2IA2 A;  1EH7 A;  1TW3 A;  1L3L A;  2A3S A;  2CFX A;  3GX4 X;  1O3R A;  3ZQ7 A;  4IF4 A;  3KFW X;  1XCV A;  1U3E M;  3RKX A;  4S05 A;  3GYH X;  1D3Y A;  3ZN1 A;  1ZAR A;  2EFQ A;  3V4G A;  2RN7 A;  4L0Z B;  4A0Z A;  3F6V A;  4HF2 A;  2DAO A;  4MEX F;  1W5T A;  3RDI A;  4MGR A;  3NEU A;  4FX4 A;  3I59 A;  2DK8 A;  3KP3 A;  5FLX Z;  2FEZ A;  2FXA A;  4G7H F;  4N9H A;  2QQ9 A;  2V79 A;  3R6S A;  4GYG A;  4OIR F;  2QBY A;  4UHT A;  3I59 B;  2COM A;  1XN7 A;  4AWX B;  3E6C C;  1TNT A;  2PG4 A;  2CG4 A;  3W6K B;  1FBQ A;  2EWN A;  1W7P B;  4K2E A;  2QBY B;  4A0Y A;  1PP8 F;  4HX4 A;  2JRT A;  4XLP F;  1DDN A;  4LG0 A;  1FBU A;  1USS A;  4EJT A;  2FBK A;  1KU7 A;  2PBI A;  2AS5 F;  2YX4 A;  4EJW A;  3Q5F A;  1W5S A;  5HS7 A;  2XKO A;  1LDD A;  1NHA A;  4PCQ A;  1FLI A;  2DW4 A;  5LHH A;  4LG0 B;  3WTT C;  2GWR A;  2XV4 S;  4U7D A;  2OAZ A;  3CDH A;  4KDP A;  1ZG3 A;  1U8R A;  3GW2 A;  5L3C A;  3F6O A;  4A12 A;  3C1D A;  5HS8 A;  3JAM K;  3TKY A;  3FXQ A;  4BHB A; 
#chains in the Genus database with same CATH topology
 3B02 A;  4E7K A;  5CYV A;  1BJZ A;  3QWL A;  1B9N A;  2OCC H;  5DV5 A;  5EGO A;  4FX0 A;  4OMZ A;  3KX2 A;  2XAJ A;  1WVR A;  3TOB A;  2EFW A;  3BQZ A;  2IW5 A;  1QO0 D;  4C2M J;  1A31 A;  2H8W A;  4C30 A;  4C9Y A;  1K4S A;  2GQQ A;  3MZY A;  1DPU A;  2L9R A;  2QWW A;  1BW6 A;  3P7N A;  4KMF A;  2X4H A;  4YIR X;  2HOE A;  4HX8 A;  1VQM I;  2DK5 A;  3LOC A;  2LY2 A;  2KIM A;  5BQT A;  1BBY A;  3BP8 A;  5J4Y A;  1ZR2 A;  2BZT A;  2HPM A;  1LQ1 A;  3LMM A;  4PSW A;  3CC4 I;  5EGO B;  1UHS A;  2WB1 A;  1Z0X A;  2HYJ A;  2O9L A;  2BGC A;  2RQP A;  3CLO A;  2KMU A;  3AAF A;  3HOW J;  3SFZ A;  3EDP A;  1Z21 A;  2XF5 A;  3LSH A;  2HYF A;  4XON A;  1N78 A;  5K5O A;  2EH3 A;  1T6S A;  4OMY A;  2P8T A;  4NUB A;  3ZQF A;  3ECO A;  1OR7 A;  1Y56 A;  4XMY A;  3J80 K;  4R8H A;  2NOG A;  2HYG D;  3IL2 A;  3R0J A;  4EMS A;  3IWZ A;  3DTE A;  2Y0M A;  3IRR A;  2VOD A;  2MH9 A;  2HDW A;  2CU7 A;  4KA4 A;  9ANT A;  2O03 A;  4ZYE A;  2Z9O A;  2LBF A;  4E7I A;  4L9N A;  3KP5 A;  2R7U A;  3GFM A;  1VQL I;  1JI8 A;  4P96 A;  1ETY A;  4RLQ A;  3AL0 C;  3X2Q H;  2V1X A;  4D7N A;  1XTA A;  3B6A A;  3TW6 A;  4RAY A;  3E97 A;  1D0Z A;  2IPQ X;  2R7O A;  4AD9 A;  3K4K A;  4M74 A;  2M7B A;  4EJU A;  3RSN A;  1EH8 A;  2XB5 A;  1MBJ A;  5F27 A;  5HS9 A;  2JA5 J;  1ULY A;  3MKL A;  2LBF B;  3CC2 I;  5IOY A;  2X1C A;  4FE4 A;  4AYB N;  2IA0 A;  4A3D J;  3T1B A;  1WJB A;  1E0E A;  3HXL A;  3I0T A;  5M3F J;  2W48 A;  3RZO J;  4I02 A;  2Z5U A;  2G7H A;  3GZ5 A;  2IVM A;  4BU2 A;  4PJJ A;  1FOK A;  3Q0U A;  4HQM A;  3A0H C;  3BLY A;  3IH4 A;  1STZ A;  1R1T A;  3BJO A;  1SMT A;  4L9T A;  3OYK A;  4FTH A;  3WTS C;  1WPK A;  2XAU A;  5F0C A;  2P6S A;  4A69 C;  3BRO A;  4PSX A;  4YFX F;  4RGR A;  5FLV A;  1FOX A;  2DA6 A;  4U0V A;  2DTZ A;  3D5R C;  2A05 A;  5LGU A;  2K9N A;  4FCY A;  2VKH A;  3OYJ A;  1QHG A;  1ZKG A;  2MLK A;  3VSK A;  4BBS J;  2IP2 A;  4IQ4 A;  1WKM A;  2Y9Y A;  3GUD A;  1H9G A;  1Y0U A;  2KLO A;  2O5R A;  2YPR A;  3PQK A;  3P9K A;  1F4K A;  2L9N A;  4P5O A;  2MD5 A;  3Q9V A;  5K5R A;  2P81 A;  1Z1D A;  5K7Z A;  1ZLK A;  3CTA A;  5F0F A;  4HPQ A;  4BAY A;  2MA3 A;  3F3X A;  3VB2 A;  1QNT A;  1D0X A;  2HTS A;  1Z77 A;  1KON A;  3ERE D;  4AID A;  2KDZ A;  2AO9 A;  3N05 A;  5ICG A;  3RPU D;  1I39 A;  3DPT A;  5DS9 A;  1GVD A;  2EB7 A;  2WY8 Q;  3GO5 A;  2HQ5 A;  4XM3 A;  3OYB A;  2LSO A;  5GAH J;  2KP6 A;  3CCJ I;  4PUS A;  1VQO I;  1HKT A;  3F8M A;  3PIP F;  2IJL A;  1SFE A;  3HUG B;  3KP6 A;  2L7K A;  3V7C A;  1OCP A;  3ZMS A;  1S7E A;  3WGH A;  3IKV A;  1YW9 A;  2FU4 A;  2WV0 A;  1J5Y A;  5E3N A;  1I6X A;  4U88 A;  1PUE E;  4XLF A;  4HNU A;  4H4K C;  3O8H A;  4XLN F;  2Y48 A;  4M3G A;  3OYG A;  1LKX A;  2XAG A;  4CCM A;  3G1L A;  2LR8 A;  1YQA A;  3CJT B;  3KEQ A;  3OR2 C;  3QPT A;  3LFU A;  5CQE A;  5IYD J;  3F0C A;  1X4P A;  5HNF A;  4HDU A;  1HC8 A;  3NWT A;  2XAH A;  4E7L A;  3FMS A;  4EJO A;  3HHH A;  4A3E J;  2ESN A;  1TTY A;  1V54 H;  1HDD C;  3CO6 C;  1YX5 A;  1U78 A;  3FXR A;  3M1E A;  2F2E A;  3PFI A;  5FKL A;  1X3W B;  5FRN A;  2BOL A;  3OS0 A;  2IBD A;  1L0O C;  3CZ6 A;  2CV1 A;  5B3S H;  1FMW A;  3GFL A;  4HLX A;  5FD5 A;  1WJA A;  2HVR A;  2A69 F;  2CQX A;  2FJ1 A;  5E3M A;  5DTD A;  1MNM C;  4PJ0 C;  3O3K A;  5D4R A;  3M7G A;  2W82 A;  2EV6 A;  1JGS A;  2NVY J;  1YX3 A;  5D8L B;  2XPV A;  1EH6 A;  4AC0 A;  4IKF A;  4BHP A;  2CJJ A;  3W6V A;  1JHH A;  1JJ8 C;  2QM3 A;  1SAN A;  4XKV A;  1VQ4 I;  2DCE A;  1IO2 A;  3DPL C;  1YO5 C;  1MSF C;  4KIB A;  3KYC B;  2V9P A;  1YE9 A;  3ZQL A;  4ENK A;  4N0B A;  2K02 A;  5FLX K;  2LKS A;  4UUT A;  2R5Y A;  1S29 A;  2DBB A;  1A6I A;  3BG6 A;  4WXH A;  5J8C A;  1GXQ A;  5CPR B;  3VSL A;  4JP0 A;  2CQK A;  3LSG A;  4A6D A;  3A2K A;  1U2W A;  4TV7 A;  2CWE A;  1PDN C;  3K2Z A;  5B66 C;  2E2I J;  4BXF A;  2MLG A;  1B8I A;  3BR2 A;  1ZGW A;  3JRB A;  2QUF A;  2CSO A;  1YS6 A;  5HVQ C;  1VQ7 I;  4EM1 A;  4ZTF A;  2JN6 A;  2GM4 A;  5IP7 J;  1UEL B;  3JAM Z;  5CLS A;  4RB1 A;  1SFO J;  2VBW A;  3CP2 A;  3H3Z A;  2V6C A;  2AQF A;  2LRD A;  2VC0 A;  5F0H A;  4UVC A;  1IUY A;  2Y69 H;  3G4S I;  4I99 C;  5D6E A;  4ZYA A;  1B8I B;  4MQV A;  2G7U A;  2EA4 A;  1WGX A;  4NQW A;  5LEJ A;  4YIF A;  1YTY A;  4Z6Y A;  3RKW A;  3S2D J;  1MBH A;  3FXM A;  4GO1 A;  1BR2 A;  2Z16 A;  3CJN A;  1Z7L A;  3BPV A;  1MSE C;  3KLO A;  3W3C A;  2ZNZ A;  1SMY F;  2XGX A;  1YG2 A;  4Y52 J;  3ZQC A;  5EZG A;  1WH5 A;  3SXY A;  1RRJ A;  2ZJQ F;  1WI9 A;  1O7F A;  2ZB9 A;  3RQ4 A;  2NVU B;  1GHC A;  1J59 A;  4ITV A;  1LUJ B;  1C0W A;  4GFB A;  1IXS B;  3IP4 B;  1W5C C;  2CS3 A;  3CMM A;  2D5V A;  1ERD A;  4BHC A;  2HPI A;  3C2G A;  3K4N A;  4M6X A;  3GLX A;  2HXO A;  1FIA A;  5L3B A;  3DXJ F;  4XL9 A;  2V1D A;  3I4P A;  1BI3 A;  1HF0 A;  3U21 A;  1PVE A;  2DFH A;  3JW4 A;  2CW7 A;  3CD6 I;  1RC9 A;  3CLQ A;  2OCE A;  4UB8 C;  1UJ8 A;  2CMP A;  4DYQ A;  1F1Z A;  4S04 A;  5E1W A;  1R5G A;  1BIA A;  2JVG A;  3BTI A;  1I3A A;  2PMU A;  3QAH A;  3GXO A;  4F93 B;  2FRH A;  2Y2Z A;  4KMU X;  3V7S A;  1P92 A;  4V2F A;  3ABU A;  1HQC A;  3DF8 A;  2Y75 A;  2P5L C;  1Z6R A;  2OD5 A;  2QEN A;  4UB6 C;  5DUK A;  1FOW A;  3RPQ A;  2IS6 A;  3MZ8 A;  2RGV A;  3C2H A;  2XF7 A;  2K3F A;  5H6R A;  1JE8 A;  2Y9Z A;  1IN8 A;  4PJM A;  4EVI A;  3OIP A;  5HLH A;  3L2U A;  1ZRC A;  4IRG A;  2BW3 A;  4DBQ A;  3HOY J;  3TW7 A;  3KYL A;  4NC7 A;  4KIF A;  1QPM A;  2HFH A;  3C2B A;  3KE2 A;  2E1M C;  3JRC A;  2XIG A;  5CJ9 A;  5JR3 A;  1D5V A;  1PUF A;  2JJ7 A;  3MWM A;  1K79 A;  1BR1 A;  3BZC A;  2TDX A;  5B1A H;  2DT7 B;  3HOT A;  1TC3 C;  2VQH A;  5C3E J;  3ZMT A;  2RC4 A;  1UG0 A;  2TCT A;  4XIC A;  3NQO A;  1XMA A;  2DA3 A;  2F5D A;  4PJN A;  2HZD A;  4MTD A;  1FIP A;  2A6E F;  4LJZ F;  5BNG A;  1R4M B;  5FB2 A;  2YS9 A;  1LFB A;  1BI1 A;  3BG3 A;  3S1N J;  3L09 A;  4DJA A;  2VJJ A;  1E3P A;  2ID3 A;  1CGP A;  2HVQ A;  2JPB A;  2R7D A;  3GCM A;  4JYK A;  2KIS A;  5LLQ A;  1G8X A;  1Q1H A;  4B1R A;  3LNQ A;  2BY3 A;  4BQO A;  5GAD J;  2RDP A;  5F6F A;  2A6H F;  3ZQG A;  3L2V A;  4OIQ F;  3WE2 A;  1G6N A;  3MN2 A;  3HRS A;  2LKX A;  3HG9 A;  4MTE A;  2C6Y A;  4XSZ F;  4KFC A;  5CKT A;  1XD7 A;  2K3P A;  5KAF C;  2DLL A;  2OZ6 A;  3HRU A;  1S9H A;  1VI0 A;  2FA5 A;  3ASN H;  4I98 B;  3FXJ A;  3BDD A;  3GTP J;  2JUC A;  1F43 A;  4HBL A;  1F36 A;  4AYB A;  3RYR A;  3H35 A;  4I01 A;  1G3S A;  3ABL H;  5J47 A;  3GTK J;  1XC5 A;  4FIS A;  2P7C B;  3K6G A;  1KQ8 A;  1D1B A;  3LA7 A;  4G7O F;  1S3J A;  1R1V A;  5ERI A;  3LA2 A;  4IHX A;  1WJF A;  3ZMU A;  2MFZ A;  3HBL A;  2HVS A;  3FHZ A;  4RB0 A;  3MFK A;  2J5O A;  3AG1 H;  2EIN H;  3FMQ A;  4RB2 C;  4EGZ A;  3DKY A;  4CYD A;  2A07 F;  4HV6 A;  1I6H J;  5E18 F;  4A3J J;  1SAU A;  3JRG A;  3EUA A;  1ETX A;  2L0K A;  4HZF A;  4B44 A;  3GZ6 A;  3UNG C;  1BA5 A;  3S1R J;  1K4T A;  3HOU J;  4DBR A;  2RV8 A;  1R1U A;  1FX7 A;  3K7A J;  3MEX A;  3I55 I;  3GTL J;  1W0T A;  3H3U A;  4B8X A;  2E7W A;  1W36 D;  2F5F A;  1SVL A;  2CW8 A;  3PIO F;  1OCC H;  1VQK I;  3VYR B;  4I0B A;  2XB0 X;  3E3V A;  4L18 B;  2NNN A;  4L5I A;  3LFK A;  3PNT A;  4B43 A;  4AIJ A;  3HPH A;  3LSK A;  2HDC A;  3FXL A;  3S2W A;  1LVK A;  1E3O C;  2P7V B;  2DOA A;  1O3T A;  2DOD A;  3CCL I;  3N97 A;  2DMN A;  3WTX C;  4Z2Y A;  2X6O A;  1X4O A;  4OAY A;  4DZJ A;  1UAA A;  3DEE A;  1IDZ A;  2RVC A;  2YU3 A;  1HOM A;  3K4C A;  1LVA A;  4G9Y A;  2YR2 A;  3SFI A;  2F6C A;  4ENJ A;  1X3U A;  1YOV B;  2XGC A;  2R5Z A;  2ISZ A;  3FIS A;  1JKO C;  5IYB J;  3RI4 A;  3I4N J;  1HCR A;  3CES A;  4BQN A;  3ROU A;  3JRI A;  3FBN B;  5ILU A;  4Y17 A;  3F22 A;  1DGW Y;  2FF4 A;  2IGN A;  2XVC A;  3L2W A;  2F5E A;  2DFE A;  2XF6 A;  4BKX A;  3JRE A;  5D5U B;  2ZME C;  3CMY A;  4D0P A;  1W0U A;  4I7H A;  2K85 A;  5GTI C;  4XLE A;  3WTW C;  2LY1 A;  1MIJ A;  2K9Q A;  3J81 Z;  2ZXJ A;  3CUQ A;  3TQN A;  2EIJ H;  4M9X A;  2DA5 A;  2H6C A;  1MD0 A;  1ZTR A;  1K6Y A;  4Q48 A;  1B59 A;  2JVH A;  4I0A A;  4QWQ A;  4A3G J;  2PEX A;  3CMA I;  2MC3 A;  1TP4 A;  1XMK A;  2L7F P;  2E34 A;  3E5Q A;  4ZYG A;  5FKK A;  2UV1 A;  2UXN A;  5IT3 A;  4HST A;  1W1W E;  1OKR A;  1SFU A;  4P9U A;  3CUQ B;  2E36 A;  1ZH5 A;  2D1V A;  3WOD F;  4E70 A;  3CCS I;  2FD5 A;  5CVR A;  3W6J B;  1XGO A;  1MBF A;  1K6O A;  2XSD C;  2HXI A;  2M87 A;  4YFK F;  1BW5 A;  2ZJ2 A;  5DDG A;  1MBG A;  2FX0 A;  1LE8 A;  2ID6 A;  3L2Q A;  1N77 A;  2R7W A;  4XLA A;  1R71 A;  2ZO4 A;  4BJT A;  2OQR A;  5IY5 H;  5C4J J;  4ZYH A;  4LK0 F;  5TJJ A;  3BY6 A;  2P5V A;  3S1Q J;  1LEA A;  3QYF A;  4NC6 A;  4YEJ A;  3KLN A;  5A2Q K;  4A3I J;  3C18 A;  2W00 A;  1VF9 A;  4RM3 A;  4MEY F;  4I76 A;  4GCV A;  1VQN I;  3FWE A;  2EIL H;  5J1U A;  1UHM A;  1IDY A;  2ETH A;  2X85 A;  3CCY A;  1Y39 A;  4GDF A;  1AKH A;  5JHU A;  1T2K A;  3OOP A;  4CSW A;  1KU3 A;  1REP C;  4IOC F;  1LE8 B;  4BXU A;  2M0M A;  3D1N I;  1YS7 A;  3HTS B;  3M4O J;  2FML A;  1BC8 C;  2VT2 A;  3AKZ A;  3CDI A;  2V7F A;  2DMP A;  4JX6 A;  1LFP A;  4QPO A;  3BC8 A;  1FC3 A;  2IS1 A;  4IXA A;  4L5J A;  4PFP A;  2XKP A;  3TDU C;  5F64 A;  2EPF A;  3I3L A;  3A01 B;  3PNY A;  2QKL B;  5LRS A;  3AG4 H;  1HKQ A;  4NB5 A;  3RTR A;  2ZBK A;  1SEU A;  3BG5 A;  3JSP A;  3QU6 A;  1P4A A;  4AU7 A;  5J1R A;  4KIG A;  1R5H A;  1D1A A;  2VN2 A;  5DCM A;  4Q4Z F;  1NH3 A;  4LGW A;  3LST A;  2W1O A;  4RBO A;  3S14 J;  1FP1 D;  4O5V A;  3GBG A;  1S8N A;  4XOR A;  2XPW A;  5BS6 A;  2FNA A;  3OYF A;  5J3L A;  2LH9 A;  3ECH A;  2JSC A;  3KEO A;  4LK1 F;  3JSO A;  2KJB A;  4JX5 A;  1JKQ C;  4A3C J;  2R7T A;  3ZQH A;  5E17 F;  2VKE A;  4RS8 A;  1R5I D;  2Q1Z B;  2XAQ A;  5IP6 A;  4R79 A;  3DBL B;  3LQQ A;  5AON A;  2PJR A;  2L7M P;  2LKP A;  3S93 A;  1OYW A;  5ILV A;  5E79 C;  3CO7 C;  3A1Y A;  2FQ3 A;  4QIW N;  1FMV A;  3ERM A;  3KPH A;  1ZAO A;  3WTZ A;  4JX4 A;  4Y13 A;  5CVV A;  3H3V K;  1GXP A;  3WU2 C;  2RRE A;  1ODD A;  4XN0 A;  1R7J A;  4CIC A;  2O0Y A;  3U2R A;  3DLA A;  1GUU A;  2HQN A;  1NTC A;  2L2O A;  5D5X B;  1H89 C;  1GV2 A;  2R92 J;  1MDM A;  1RUN A;  2PJR B;  2PFB A;  3OYD A;  2JSP A;  1YJ9 I;  1Z3Y A;  3BG9 A;  2KL4 A;  1VFC A;  1FSE A;  1TBX A;  2F4I A;  2GA1 A;  4HEA 2;  2XAF A;  1W7P D;  2IGM A;  2K4B A;  4BGD A;  1RKT A;  2E5Z A;  2EBI A;  5DM7 F;  2ZJP F;  2EIM H;  2L9S A;  2JPC A;  1ETV A;  4BBR J;  4BY7 J;  5E3O A;  1XS9 A;  3FIW A;  3LAJ A;  1X1C A;  1MDM B;  2OQG A;  4B3X A;  2O61 A;  3M3Y J;  2V9K A;  3OYC A;  2V4J C;  2EFN A;  2VE9 A;  3OYM A;  1WJD A;  3G71 I;  5CVU A;  4EGY A;  3E0J B;  2CUZ A;  4HAM A;  4WF2 A;  2MC4 A;  1YIO A;  2VE8 A;  2KZV A;  1U8B A;  1IAW A;  2HZT A;  4Y4R A;  3ELK A;  5BPI A;  3KCC A;  1RPW A;  3R0A A;  5TGT A;  3BR3 A;  3T5X A;  1HST A;  2DPU A;  3TDZ C;  4BE1 A;  1VTN C;  1MH4 A;  1WJ5 A;  4CCO A;  2GXA A;  2NS7 A;  3QYB A;  1A6Q A;  2JZY A;  2V1N A;  5DEQ A;  2ACJ A;  3P9C A;  2L54 A;  1W36 C;  2VXZ A;  3GFJ A;  1ZQ3 P;  1KYZ A;  4RAZ A;  2Z33 A;  4DQ2 A;  1XG1 A;  2K9S A;  4LLG F;  1IN6 A;  4B09 A;  2WA0 A;  1PP7 U;  4E7Z A;  2JA8 J;  4XQF A;  3LL7 A;  3QQA A;  3K2A A;  1VQ8 I;  2KIU A;  3ZMV A;  1FT9 A;  4PJL A;  2A68 F;  5ILS A;  3OS1 A;  4DIQ A;  2PMZ N;  3KP4 A;  1SVM A;  4MLO A;  4XSX F;  3S3N A;  2DTR A;  4WXC A;  3TL4 X;  2VPL A;  2VOP A;  3ZMD A;  2VKV A;  3HM5 A;  2DFI A;  3DV8 A;  2IS2 A;  1O4X A;  1KGS A;  2ZC2 A;  2H94 A;  1QRY A;  2JUG A;  1N75 A;  2VPR A;  3RZD J;  1WHU A;  2LOO A;  4FE7 A;  5EZH A;  1T98 A;  1OQY A;  1ZHF A;  1ON2 A;  2M8E A;  4N4N B;  1POG A;  2R3S A;  2ZME A;  3GVA A;  4I6Z A;  1HLV A;  3EYI A;  3BCA A;  3MZH A;  4W97 A;  1B72 A;  3S17 J;  5HOO A;  1MBE A;  5KAI C;  2ZNY A;  2LLK A;  2JA6 J;  1R6R A;  3TED A;  2NS8 A;  5DCF A;  2KPM A;  1RI7 A;  3I4M J;  3FK7 A;  4RA2 A;  1R22 A;  3PQJ A;  1YHQ I;  3J7A O;  3HOV J;  3FM3 A;  2FSW A;  3HC7 A;  4MO7 A;  2DYR H;  1FYM A;  3KZY A;  2NVX J;  2CV0 A;  1NK3 P;  1R9T J;  4M3F A;  1BI2 A;  3CDL A;  2A61 A;  2MG4 A;  1Z67 A;  1A04 A;  3TO6 A;  4BEH A;  1SD4 A;  4OIP F;  2L5Q A;  3ZR8 X;  1GT0 C;  5HNH A;  2XGE A;  5K1Y A;  1WFX A;  3L1P A;  1JT0 A;  1SFK A;  3KP2 A;  4B4C A;  3H36 A;  1T56 A;  3J7Y J;  4MFD A;  3CF5 F;  2EV5 A;  1LPQ A;  2VT3 A;  4L9J A;  3FM5 A;  2B63 J;  1KZH A;  1MKM A;  1YYV A;  1BJA A;  5J1Y A;  1U5T C;  2VQL A;  3HSR A;  3A4C A;  5F04 A;  4EJV A;  3VWB A;  3RIR A;  2DOF A;  2H1L A;  4BEH B;  1AOY A;  4OWR B;  3L00 A;  1UFM A;  1ZRD A;  2E1N A;  2EZK A;  2HR3 A;  4RB3 C;  1DQU A;  3BZK A;  4D9J A;  2DN0 A;  4LD5 A;  5KK1 A;  4IRH A;  4M72 A;  2ESH A;  4RGX A;  2O8X A;  1S7O A;  3HOS A;  3FDY A;  2VOO A;  4LB6 B;  1V5E A;  1YFH A;  1D0Y A;  3E5X A;  3TMO A;  3ONQ A;  2DA4 A;  1QU3 A;  3RCO A;  4CXF A;  2GBY A;  1IRX A;  2W57 A;  3HKZ N;  4IHW A;  1S72 I;  3I54 A;  4D1Q A;  1FYK A;  4IHS A;  1LJ9 A;  5M3M J;  1RES A;  3ZQQ A;  3ZP5 A;  1ZN2 A;  2QSG X;  3DKW A;  5A2Q Z;  4V19 K;  2M5W A;  3M8F A;  3TBI A;  2W24 A;  4M73 A;  5JVT A;  1ONV A;  2VB6 A;  3BTL A;  1X1D A;  2K7L A;  3K0L A;  1AWC A;  3W2W A;  2LP0 A;  3BJ6 A;  2N8G A;  2LVS A;  1SC7 A;  3F8N A;  2JA7 J;  1Z7U A;  2K27 A;  4XLH A;  3NRV A;  5JHF A;  1FTZ A;  5DM6 F;  3H92 A;  3SEQ A;  1QZY A;  2YX7 A;  2P6T A;  4C2U A;  5H2F C;  1G3Y A;  1A36 A;  3J81 K;  1VQ9 I;  1UCR A;  4DZP A;  1P7I A;  4CCN A;  4BDY A;  1MND A;  4A3B J;  3WTY C;  2IA1 A;  3CCQ I;  4BQA A;  3O8G A;  2K9M A;  2R5Y B;  1LDK B;  2MSY A;  2K5C A;  3S3M A;  3MVP A;  1S6L A;  2KIQ A;  5E8I A;  2AXT C;  4L0Y B;  4ZH4 F;  1DGR M;  1KA8 A;  2VL8 A;  4UNO A;  4BS9 A;  4Y7N J;  1TQM A;  1B9M A;  1BI0 A;  2EA2 A;  2H6B A;  1GVJ A;  2ZXW H;  4XRF A;  4D5C A;  2V1U A;  4IHV A;  2GZW A;  2YSR A;  3IH3 A;  3I56 I;  2BVM A;  4LLL A;  4JOM A;  1T08 B;  1DP7 P;  2NNY A;  2B9S A;  1MGT A;  1MJA A;  3REO A;  1HXD A;  2AHQ A;  1NK2 P;  2OC6 A;  1M1E B;  3WHB A;  3GTM J;  1G4D A;  2ZFW A;  1ZRF A;  2W25 A;  3F9K A;  3A0B C;  4G7Z F;  4XR6 A;  4NQW B;  3HDD A;  4IX7 A;  5TRD A;  1MMG A;  3CCM I;  1H9T A;  4KNY A;  2RQQ A;  2K40 A;  3GFI A;  4G6T B;  1AA7 A;  2M1B A;  3SHF A;  3FKI J;  3WGI A;  3F8B A;  1Y1V J;  3IC7 A;  4M9S A;  3F21 A;  1SVO A;  2STW A;  4M71 A;  1O3S A;  1ACI A;  1H0M A;  4CO8 A;  2WTE A;  1VND A;  3OYH A;  2VBY A;  2DYS H;  2V9V A;  1OYY A;  3AL0 B;  1YIJ I;  1ITY A;  1LDJ A;  2RAE A;  4M3E A;  5IP9 J;  2ME0 A;  2X1E A;  4NHJ A;  5E20 A;  5C44 J;  2ZFU A;  3GF2 A;  4G6Q A;  5H6Q A;  3EET A;  1Z9C A;  3V8K A;  1DU0 A;  1QZE A;  1WJE A;  2WBM A;  4HA8 A;  1OCZ H;  5J6X A;  1FWZ A;  2E2H J;  4HRI A;  3HJE A;  5GAG J;  2M45 A;  4IJA A;  2E1O A;  4FHT A;  2L3D A;  3S8P A;  4XID A;  4U7B A;  4FT8 A;  2CQQ A;  5CVJ A;  2R7V A;  4B3A A;  2DXI A;  2O3F A;  3JRD A;  2VC1 A;  1T39 A;  4HLY A;  2QGU A;  3HYI A;  5GP9 A;  2E19 A;  2IGO A;  5HLI A;  5KNL A;  3BR6 A;  1TLH B;  2OA4 A;  1HW5 A;  1WRJ A;  3C7J A;  3KZI C;  3EUH C;  2L4A A;  3CCE I;  2BY2 A;  5J8F A;  4XKC A;  1QZZ A;  2H8R A;  2BW3 B;  2H27 A;  3HOZ J;  1Z3X A;  5EEA A;  3DTI A;  4IHY A;  2AQE A;  2AXL A;  4NBQ A;  3FXK A;  5DUI A;  1WWX A;  4MQ9 F;  3MKY B;  2QLZ A;  1WQ2 A;  2QQB A;  3R60 A;  1OCT C;  1PUF B;  1RR8 C;  4X0G A;  3RKY A;  4AM3 A;  3G2B A;  3OYI A;  1CF7 A;  1RIO H;  4XBF A;  4XNF A;  1QHH D;  1YW8 A;  4G6D A;  4YG2 F;  1FPQ A;  1I3Q J;  3OIQ A;  3JTG A;  1TW2 A;  1X2M A;  5E3L A;  3HB9 A;  2Y30 A;  2BE5 F;  1LEB A;  2K86 A;  1Y8R B;  3DPU A;  5E8G A;  3IV5 A;  2M3A A;  2COB A;  1KQ9 A;  5IOZ A;  3C3W A;  2I5U A;  5FD6 A;  1IN7 A;  4PDK A;  3K1M A;  3TGN A;  4ABZ A;  5K7F A;  5LFA A;  1YRN A;  3WGG A;  1KU2 A;  1B4A A;  4BY1 J;  3H0D A;  1TT5 B;  2CGP A;  1E2X A;  3ML6 A;  1HW1 A;  1OLT A;  1WJC A;  3CQZ J;  4UY8 I;  4WXD A;  4UV8 A;  4KIT B;  3V8L A;  1U5T A;  1HBX G;  3VYU B;  2I8D A;  3KEY A;  2DU9 A;  3RJP A;  1ZYR F;  4IZZ A;  5LHI A;  3M9A A;  3L9F A;  2HTJ A;  2M34 A;  4N9I A;  4WWC A;  4UVB A;  2G0E A;  2BVL A;  2LY9 A;  3R61 A;  1P7J A;  1YRN B;  4QPQ A;  1DU6 A;  4XK4 A;  3H9Q A;  2Z1D A;  3HRM A;  4A5N A;  3D5L A;  2IEK A;  3KIO A;  3K1P A;  5ICF A;  5IT9 Z;  2QF7 A;  2XGD A;  3FX3 A;  4ESF A;  3TOA A;  4HX7 A;  4XLC A;  4BNC A;  3MKZ A;  2PMZ A;  1BR4 A;  2BYV E;  3OR1 C;  3CCV I;  2ZXH A;  2BXZ A;  2QYO A;  4PFO A;  1MW7 A;  3RQI A;  3MKW B;  4MIM A;  3OMY A;  1T0F C;  4CUG A;  2EZH A;  3H5R A;  4C3I J;  2EV0 A;  4C3J J;  3F23 A;  5LRR A;  2LD5 A;  2XAS A;  4ZDO A;  4DYC A;  1UG2 A;  5FJ8 J;  4M3D A;  3ZGK A;  2DMT A;  2MD0 A;  3J7A Y;  4GGG A;  4RMN A;  2ADU A;  2BXY A;  2W7N A;  2ECC A;  3OL4 A;  3M8E A;  1IXC A;  2FOW A;  2UXX A;  1ZGA A;  3K9T A;  3SDG A;  4ASN A;  4CH7 A;  5D4S A;  3HTU A;  2JQ7 A;  5JLX A;  1JUM A;  4IOA F;  5M5W J;  3WU0 A;  2R7R A;  3PJR A;  4KYW A;  2M9H A;  2XPU A;  2XHK A;  4LIU A;  3BG7 A;  2FMY A;  3M8J A;  3DWL E;  3Q0W A;  4L9V A;  1T38 A;  4O3M A;  3OL3 A;  1TWF J;  2VIX A;  1IJW C;  5KHD A;  3UR3 C;  3DP7 A;  5HOD A;  4PZJ A;  5LEK A;  3H5N A;  1BL0 A;  1ORK A;  3AFH A;  2M30 A;  1FNN A;  1X58 A;  1GDT A;  3ZN0 A;  3HRT A;  2R5Z B;  1J09 A;  3WG9 A;  5GPC A;  5JI6 A;  3ZCO A;  3OYN A;  3VFZ A;  3L7W A;  2HKO A;  1SAX A;  1LFU P;  2DQL A;  1JXS A;  2NS0 A;  2L4M A;  3CF2 A;  3JCU C;  4JBA A;  1R00 A;  5GTH C;  3GZN B;  3FKJ A;  3G3Z A;  2M0C A;  2FOK A;  3E6M A;  2HKX A;  3VPR A;  2UZK A;  1W7P A;  1MJB A;  1JUS A;  3SYT A;  4YFN F;  1O7L A;  1J75 A;  4LIT A;  3RYP A;  4P1W A;  5KVR A;  1X3Z B;  1QGP A;  3FXO A;  4OOI A;  2ISY A;  1HA8 A;  2OJE D;  2GLO A;  3JTH A;  5FKO A;  2R0Q C;  4EM0 B;  1X1P A;  3MD2 A;  1XSX A;  4UUS A;  2LDU A;  3LAP A;  3HKZ A;  4J01 A;  4HG2 A;  1OPC A;  2GXB A;  2PN6 A;  3CME I;  2M2E A;  1MJ9 A;  2KT0 A;  2X6W A;  3GLL A;  1XGM A;  1XGS A;  5F1J A;  2WAD A;  1KQ0 A;  1TWC J;  2IAI A;  4KN7 X;  1JHF A;  1XMX A;  5L3D A;  2BY1 A;  4UUV A;  3S32 A;  1IXR C;  3B6C A;  1IF1 A;  2DA2 A;  1XX5 A;  2QVO A;  3QU3 A;  3KZZ A;  1X1A A;  4ENM A;  4V2G A;  2DDA A;  4A3L J;  5D5W B;  4A3F J;  4EAT A;  2ELJ A;  4LIV A;  4C3H J;  3V7R A;  4Y3O A;  3T8R A;  2DT6 A;  2CUF A;  3EPZ A;  4HF0 A;  1ETK A;  1BC7 C;  1K7A A;  2GA2 A;  2X51 A;  1P6R A;  2WC2 A;  2D2W A;  1OIS A;  3DBR B;  3H1C A;  1IRF A;  2JA2 A;  1QA6 A;  3DQV C;  1R36 A;  1LB2 A;  3H5A A;  1MH3 A;  3WG7 H;  3WU1 B;  2Q2E A;  1Z05 A;  2XDV A;  3ZOB A;  1U6G A;  1IN4 A;  4G8X A;  4A5M A;  4HQE A;  2L01 A;  4I09 A;  3GME A;  1AKH B;  3VYT B;  2KFD A;  3JRH A;  1P2F A;  1UB9 A;  3EUH A;  2KRH A;  3BTC A;  1XSD A;  4C2T A;  3MAJ A;  1TWH J;  1K78 A;  3BCB A;  3BZ6 A;  5HLG A;  1ZRE A;  3MCZ A;  3W2A A;  3ESW B;  3GWZ A;  3IHU A;  1V3F A;  2IRF G;  5L3E A;  2H09 A;  3HSE A;  2W4S A;  2E1M B;  4LOC A;  2H1K A;  2IS4 A;  1QQI A;  2JRM A;  2FQ4 A;  2LNB A;  2Q2E B;  5JFR A;  1T95 A;  5J4V A;  3RPU A;  4KJZ A;  2JWT A;  3M07 A;  1XDU A;  3U9G A;  2E35 A;  1E3H A;  3VYS B;  1LNW A;  2LK2 A;  1TZL A;  1BM9 A;  4M6Y A;  1F9N A;  2CYY A;  2IXS A;  5DCM B;  5D5V B;  1K78 B;  1HSJ A;  4OIO F;  1JUP A;  2F5C A;  1A5J A;  1J0R A;  4XRS A;  3T8T A;  2Y0S N;  4F3Q A;  3ZRG A;  3K69 A;  3DU5 A;  4G94 A;  2P0W A;  4YEL A;  2FBH A;  3SEZ A;  4ZZD A;  3D5S C;  2MYS A;  3E7L A;  5EJC A;  4F7Z A;  4BAC A;  4FAS D;  1IGN A;  2HOA A;  2KRC A;  2DPD A;  2W84 A;  2PQ8 A;  2R7Z J;  3FHN A;  3GTJ J;  5FFZ A;  5EF6 A;  4X1E A;  4ON0 A;  3BR0 A;  4A0X A;  2WAQ N;  3BR5 A;  3FZV A;  2PJP A;  5F08 A;  1ZR4 A;  1Q1V A;  5EEH A;  2E71 A;  2O8K A;  2UWM A;  2R4G A;  4AUX A;  3F8F A;  4HF1 A;  2LG4 A;  3VDX A;  2RKH A;  2EZI A;  1PYV A;  2JT1 A;  1WH7 A;  3DLL F;  1ETQ A;  4JK1 X;  3J7Z I;  5BOX A;  2CUE A;  2FUG 2;  2NVT J;  4DOZ A;  1ON1 A;  3AG3 H;  2R7X A;  4CYC A;  5ICE A;  3LQR A;  3QYE A;  1RNL A;  3HGG A;  1HDP A;  4XKW A;  2F4M B;  3HHG A;  3A02 A;  1TNS A;  4U0W A;  3I9V 2;  2CH0 A;  1T0F A;  3LA3 A;  3AG2 H;  4HOB A;  1FTT A;  2R93 J;  4BXX J;  3QP6 A;  1SFX A;  4A3M J;  3NAU A;  2HQR A;  1KYW A;  4XOT A;  1FYL A;  4KT5 C;  3E6B A;  3DEU A;  4AIK A;  1V4R A;  2HNH A;  4LG3 A;  1DPR A;  4U0Y A;  3K70 D;  4XKB A;  2G9W A;  4A3K J;  1AU7 A;  2LYC A;  3LSM A;  5LGN A;  2E7X A;  5ICC A;  3D0S A;  1IG7 A;  4ZTJ A;  1XGN A;  2QSH X;  1TWG J;  2ZSH B;  3IAM 2;  2DOE A;  4M9Z A;  2WY7 Q;  2GOX B;  1OYI A;  3ABM H;  1JT6 A;  3IAS 2;  2LRE A;  3K4B A;  2QCO A;  2HEO A;  3KP7 A;  2CFO A;  2KHM A;  4RGU A;  2JK3 A;  4LMY A;  4CYC B;  3WTV C;  3CUO A;  5EYR A;  5IYC J;  3ZMZ A;  2KZG A;  3HL2 A;  4FET A;  1OMI A;  1HKS A;  3IKT A;  1YLF A;  4IEJ A;  4D7M A;  2HS5 A;  2NAZ A;  2ZSI B;  3UKG A;  4AIH A;  1CQT A;  1J2X A;  1G3T A;  4BL0 B;  4CGZ A;  2VI6 A;  3K4J A;  4HYE A;  2GIZ A;  5B1B H;  4QTR A;  1N25 A;  1Y1W J;  5BPD A;  4HV5 A;  2OU2 A;  4J19 A;  4ZZL A;  1AHD P;  1BN5 A;  2EK5 A;  4ETS A;  4BJ5 C;  1W4M A;  2VBZ A;  1TQP A;  3H9G A;  2WV1 A;  1XDS A;  5HDG A;  1T8I A;  1J9I A;  2DQR A;  2W85 A;  1JKR C;  3LSP A;  2A5Y B;  4E4H A;  3BQY A;  5FKM A;  5HDK A;  2GAU A;  3A03 A;  1WSU A;  4Y15 A;  4P55 A;  4A2U A;  1FSH A;  1OJL A;  1NG6 A;  1U0J A;  1D8K A;  2NYX A;  2QSF X;  3IWF A;  3U1D A;  5GAE J;  4BUP A;  5EDN A;  4MHG A;  2HGC A;  5D8K B;  3HUG A;  3B73 A;  4BYY A;  1FEX A;  1OFC X;  2WWY A;  3GEZ A;  3OIO A;  5LHG A;  1I1S A;  1O57 A;  3DTK A;  2ZME B;  2E5N A;  3ABT A;  1UHW A;  5HDN A;  1VQ6 I;  4D5F A;  1B72 B;  3GTG J;  3I64 A;  4M3B A;  1IUF A;  4QLC U;  2UUZ A;  1G59 A;  5L3G A;  2OBP A;  4DW6 A;  3OYE A;  5IT9 K;  1SD6 A;  1BOB A;  2CQN A;  3FF5 A;  2E60 A;  4L5E A;  1QBJ A;  2QQA A;  3HEF A;  2V6E A;  1R58 A;  4G12 A;  1F5T A;  3QPS A;  4F91 B;  2J5P A;  1Y0N A;  3PL8 A;  2Q8K A;  3CP8 A;  2EQR A;  3SDB A;  1YW7 A;  5ED4 A;  3ISP A;  3PFY A;  3MQ0 A;  3I5U A;  2FBI A;  2P5K A;  2QKM B;  3HPG A;  4BE2 A;  2BEO A;  5CVI A;  2QEX I;  2BHY A;  2OV7 A;  1X19 A;  5FKN A;  2FNP A;  4A93 J;  3SZT A;  2PLY A;  3VEP A;  1P4X A;  3VOD A;  1FP2 A;  2DDB A;  1EJ9 A;  5KCM A;  2WAF A;  3BJA A;  1U9O A;  1RZ4 A;  2QZ8 A;  4HSR A;  3LSJ A;  3CJR B;  5BMZ A;  3OYA A;  4Q5S F;  4WK8 F;  5LGT A;  1IZ1 A;  4ZYD A;  3H9J A;  1TQI A;  4WX9 A;  5IPA A;  2EZL A;  3QRF F;  2HU9 A;  1DUX C;  2I10 A;  3HZJ A;  4B47 A;  1I1G A;  4ESB A;  3S1M J;  2L9V A;  2X0L A;  2LFB A;  4NNJ A;  1Z91 A;  4OIN F;  4EM2 A;  4BQQ A;  4PGH A;  3K1N A;  1S5L C;  4ZDP A;  1XB4 A;  2PMH A;  1IN5 A;  3I58 A;  2CQ7 A;  1V5G A;  1JTY A;  2K4J A;  1FJL A;  1QVU A;  5TIS C;  1WZ2 A;  1VZ0 A;  2GXG A;  3P5J A;  4N4O B;  4JQF A;  2VLA A;  2E1C A;  4PGG A;  1DP3 A;  2XSJ C;  4XN3 A;  4CZC A;  2VON A;  3QOP A;  4RAF A;  2X9D A;  5L3F A;  2ZJR F;  2ECB A;  2B0L A;  2DMQ A;  4CDG A;  3EUK L;  2IT0 A;  3FXU A;  2OZU A;  4YII A;  2OPT A;  2Z3Y A;  2HOT A;  5F1R A;  5E1Z B;  1P4W A;  3ZXS A;  2ZCW A;  4QSH A;  1V55 H;  5CQG A;  4KIC A;  3CCU I;  4CCJ A;  2KRF A;  2X6X A;  3F72 A;  1D1C A;  3E6D A;  5H20 A;  4S0H B;  1HW2 A;  3DU6 A;  3QP5 A;  4WCG A;  3BWG A;  3IRQ A;  4ZDL A;  2R7F A;  3DCF A;  4CHU A;  1XSV A;  1SD5 A;  4XOP A;  4I2O A;  1YJN I;  1O3Q A;  1RUO A;  2GIV A;  2ZKZ A;  2CUJ A;  4X6A J;  4O6J A;  1ZG5 A;  2D45 A;  2XRO A;  3L2R A;  3WE3 A;  4EEF G;  1IV6 A;  1BOA A;  4E7J A;  4CCL A;  4BH9 A;  5FRO A;  4ENN A;  1IC8 A;  2K9L A;  3E5U A;  2DI3 A;  5K5Q A;  1ZG1 A;  3Q0V A;  1S7A A;  2VJ5 A;  4KIS A;  2VJ4 A;  5LD2 C;  1TT0 A;  3WTU C;  1BIB A;  5M5X J;  3CUQ C;  2D1H A;  3P9I A;  5FLM J;  3I71 A;  3O2P E;  4GYI A;  2JTV A;  2VBX A;  2LTP A;  3HOX J;  4Y33 A;  2WB1 N;  2CW0 F;  3ZQI A;  5FO5 A;  3EQL F;  3BOQ A;  3TO7 A;  3BR1 A;  1IV8 A;  2R7Q A;  4P9F A;  4ZJZ A;  2BBY A;  3SZP A;  1J7K A;  1EKE A;  1Y6I A;  4BDZ A;  3I53 A;  3VOE A;  2MBF A;  4IVN A;  5GPA A;  4KN4 X;  2BV6 A;  3TO9 A;  1FBS A;  2M4G A;  3QOD A;  3CC7 I;  3SQN A;  3IH2 A;  3K10 A;  2DFF A;  2QQ8 A;  3J80 Z;  2Y31 A;  5EG0 A;  2KIF A;  2MW8 A;  1FY7 A;  4DYR A;  3DKX A;  3JRF A;  1XPX A;  3FMR A;  4PK4 A;  3K70 C;  3PNV A;  1H8A C;  1FZP B;  2XRL A;  2EFP A;  3BPX A;  2LF7 A;  1QVT A;  4ZC3 A;  3F8C A;  3V8J A;  3SJM A;  4IRI A;  4E6K G;  2DA7 A;  2FE3 A;  2O6G E;  2LC2 A;  1JKP C;  1UST A;  2STT A;  5AIQ A;  1APL C;  1ZGJ A;  4EV0 A;  3DFG A;  1SD7 A;  3LSI A;  4RGS A;  3K4M A;  3OSG A;  2F48 A;  2ELH A;  4DNC A;  3T0Y A;  1PJR A;  5DD8 A;  1OCR H;  5EG0 B;  1MBK A;  4IPA A;  4XRS G;  1E17 A;  2Y0S A;  3FBI B;  4E7H A;  4UV9 A;  3R4K A;  3S16 J;  1I27 A;  1ETO A;  3MMY B;  4RAG A;  4UXN A;  2HDD A;  3LWF A;  3QPH A;  5FGM A;  3OYL A;  4BE0 A;  2DMU A;  3PUF A;  5DYM A;  5EEG A;  1MZB A;  2L7Z A;  3WHC A;  1EV7 A;  4XRM A;  1Z6T A;  2KDO A;  4IQJ A;  5AIP A;  2OTJ I;  1D5Y A;  1XCB A;  1IW7 F;  1MNE A;  2VQC A;  3O6B B;  2HQA A;  2R7S A;  3KET A;  2EJR A;  5DD4 A;  3PO3 J;  1ZEL A;  3G6E I;  2PI0 A;  4W1U A;  4OAZ A;  2DT5 A;  2E2J J;  2XC7 A;  2WAQ A;  3ULQ B;  1A35 A;  4HDV A;  5LBQ A;  3TP0 A;  5FFX A;  1MMN A;  5E1X A;  3Q9S A;  2X1D A;  1RET A;  2M4K A;  3PUB A;  4F52 A;  4LLN A;  2HWV A;  4AVP A;  1R23 A;  3K4L A;  4H0E A;  3CJQ B;  3G73 A;  5D6F A;  5K7H A;  1TWA J;  3OV8 A;  4AVZ A;  2CO5 A;  2OF7 A;  2MH2 A;  1EF4 A;  2HOS A;  4Q47 A;  4CZZ A;  4ESJ A;  1CF7 B;  4ANJ A;  4CA0 A;  3IUO A;  4HW0 A;  1I5Z A;  2GOM A;  3HIF A;  3FK6 A;  1D8J A;  2YU9 J;  3GTQ J;  3TP3 A;  2Q0O A;  3BTJ A;  2RNG A;  2CRG A;  2EIK H;  1GV5 A;  3QOE A;  3OSF A;  2BHZ A;  4GXO A;  4R1H A;  2NVQ J;  2XUB A;  1EA3 A;  1K61 A;  1WI3 A;  1OR7 C;  3HSF A;  3PM1 A;  2JMW A;  2LF8 A;  1KU9 A;  1R4N B;  6PAX A;  4MFE A;  2CV2 A;  2NRA C;  1IRZ A;  4LFU A;  2DO7 A;  4EQQ A;  3S3O A;  2KJC A;  3QPL A;  2DJN A;  1U5T B;  4UVA A;  4BJ6 C;  2KKO A;  2P4W A;  2RNJ A;  2Z2S B;  3L2C A;  4GRI A;  4IHT A;  2Z99 A;  5M5Y J;  4F55 A;  2TRT A;  1IRG A;  4OU0 A;  3JR9 A;  1WCM J;  1B1B A;  2BY0 A;  1YIT I;  3ZPL A;  1UZC A;  5J40 A;  1B6A A;  4LB5 A;  1FOY A;  2L02 A;  3COA C;  2NOJ B;  1G3W A;  2XRN A;  1ZLJ A;  4KUM A;  4MNU A;  3OY9 A;  2EFO A;  2HI3 A;  3EYY A;  3N4M A;  2VUM J;  3KYD B;  4A6E A;  2IA2 A;  1Y8Q B;  4HNV A;  1EH7 A;  2V26 A;  1TW3 A;  5JLW A;  1L3L A;  1ZK8 A;  2A3S A;  2WAE A;  2MAB A;  4RLF A;  2CFX A;  3GX4 X;  1O3R A;  2VAS A;  3ZQ7 A;  3PSF A;  4IF4 A;  3KFW X;  1JJ6 C;  1XCV A;  3OS2 A;  5C4X J;  1U3E M;  3Q3S A;  1G2H A;  3RKX A;  1VQP I;  3S2H J;  5JVG F;  4S05 A;  3GYH X;  1D3Y A;  3DEW A;  4HNT A;  2QA4 I;  2IGK A;  3ZN1 A;  1ZAR A;  3GTO J;  3E1S A;  3SZG A;  2EFQ A;  3V4G A;  2RN7 A;  4II2 A;  2MGQ A;  4L0Z B;  3BT9 A;  4IL6 C;  4A0Z A;  3F6V A;  4HF2 A;  1U9N A;  2DAO A;  4KT6 A;  4MEX F;  1W5T A;  3RDI A;  2DJI A;  4MGR A;  2VKD A;  3NWS A;  3NEU A;  3U1K A;  4FX4 A;  3I59 A;  4IO9 F;  1YI2 I;  2DK8 A;  1JTX A;  4NDL A;  1VQ5 I;  3H0G J;  3KP3 A;  2ICW G;  5FLX Z;  2FEZ A;  2FXA A;  3M1C A;  4G7H F;  2KQR A;  4N9H A;  2QQ9 A;  2O7O A;  2V79 A;  3R6S A;  4GYG A;  1JGG A;  4OIR F;  1I50 J;  1YJW I;  1MMS A;  1T33 A;  4CCK A;  2ZXI A;  2QBY A;  1RR7 A;  4FQG A;  1UMQ A;  3PO2 J;  2A6T A;  3NAR A;  4UHT A;  2A5W A;  4YRV A;  1QPI A;  1MMA A;  4DGW B;  2DA1 A;  1V5F A;  3CCR I;  3I59 B;  2COM A;  3PSI A;  1XN7 A;  4AWX B;  4B48 A;  1RKW A;  3E6C C;  1TNT A;  2PG4 A;  2X6Y A;  2CG4 A;  2F5V A;  2VJI A;  3W6K B;  1FBQ A;  2EWN A;  3JRA A;  4F92 B;  1W7P B;  4K2E A;  2QBY B;  4A0Y A;  1PP8 F;  3OWT A;  2VXD A;  4HX4 A;  2JRT A;  3HGY A;  4XLP F;  1DDN A;  4M6V A;  4RM2 A;  2OTL I;  4LG0 A;  2B7E A;  1FBU A;  1K83 J;  1R49 A;  1USS A;  4EJT A;  2FBK A;  2PX9 A;  1KU7 A;  2PBI A;  3OOU A;  4J00 A;  2AS5 F;  4UUS B;  2YX4 A;  4EJW A;  2M8G X;  2ME6 A;  3Q5F A;  1W5S A;  2F4O B;  4U87 A;  5HS7 A;  2XKO A;  1LDD A;  2OUM A;  3G1M A;  4E7S A;  1NHA A;  4PCQ A;  1ENH A;  1FLI A;  3DBH B;  3LSR A;  2DW4 A;  5B5E C;  5LHH A;  2X48 A;  1NG7 A;  2ELK A;  4LG0 B;  1TL8 A;  5HLT A;  3WTT C;  2GWR A;  2XV4 S;  3A01 A;  4U7D A;  4II3 A;  1H88 C;  1GLN A;  2OAZ A;  1X1B A;  3W2V A;  1P9Q C;  3G1O A;  1OCO H;  2LMD A;  3CDH A;  4NC8 A;  4KDP A;  1ZG3 A;  1U8R A;  3ABK H;  3RKQ A;  3S15 J;  3GW2 A;  1ETW A;  5L3C A;  5FRM A;  3F6O A;  4A12 A;  1X2N A;  3C1D A;  2M7A A;  1MMD A;  2NXN B;  3ASO H;  5HS8 A;  2YUS A;  4RDU A;  2VQG A;  3V42 A;  3JAM K;  3TKY A;  3FXQ A;  4BHB A; 
#chains in the Genus database with same CATH homology
 3B02 A;  5CYV A;  1B9N A;  5DV5 A;  4FX0 A;  4OMZ A;  2XAJ A;  3TOB A;  2EFW A;  2IW5 A;  1QO0 D;  2GQQ A;  3MZY A;  1DPU A;  2QWW A;  3P7N A;  4KMF A;  2X4H A;  2HOE A;  4HX8 A;  2DK5 A;  2KIM A;  5BQT A;  1BBY A;  3BP8 A;  1LQ1 A;  2BGC A;  2RQP A;  3CLO A;  3AAF A;  3SFZ A;  3EDP A;  2HYF A;  5K5O A;  1T6S A;  4OMY A;  2P8T A;  3ECO A;  1OR7 A;  3J80 K;  4R8H A;  2HYG D;  3IL2 A;  3R0J A;  4EMS A;  3IWZ A;  3IRR A;  2Y0M A;  2VOD A;  2MH9 A;  4KA4 A;  2O03 A;  4ZYE A;  2Z9O A;  4L9N A;  3KP5 A;  3GFM A;  4P96 A;  2V1X A;  4RAY A;  3E97 A;  2IPQ X;  4AD9 A;  4M74 A;  4EJU A;  1EH8 A;  5HS9 A;  1ULY A;  2IA0 A;  3T1B A;  3I0T A;  4I02 A;  2Z5U A;  2G7H A;  3GZ5 A;  2IVM A;  1FOK A;  4HQM A;  1STZ A;  1R1T A;  3BJO A;  1SMT A;  4L9T A;  3WTS C;  2P6S A;  3BRO A;  4YFX F;  4RGR A;  4U0V A;  5LGU A;  2MLK A;  2IP2 A;  1WKM A;  3GUD A;  1H9G A;  1Y0U A;  2YPR A;  3PQK A;  3P9K A;  1F4K A;  4P5O A;  2MD5 A;  3Q9V A;  5K5R A;  1Z1D A;  1ZLK A;  3CTA A;  4BAY A;  2MA3 A;  3F3X A;  3VB2 A;  1QNT A;  2HTS A;  3ERE D;  5ICG A;  3DPT A;  2EB7 A;  3GO5 A;  2LSO A;  1HKT A;  3F8M A;  2IJL A;  1SFE A;  3KP6 A;  3V7C A;  3ZMS A;  3WGH A;  3IKV A;  1YW9 A;  2FU4 A;  2WV0 A;  1J5Y A;  1I6X A;  4U88 A;  1PUE E;  4XLN F;  2Y48 A;  2XAG A;  1YQA A;  3KEQ A;  3QPT A;  4HDU A;  2XAH A;  3FMS A;  4EJO A;  3HHH A;  2ESN A;  1TTY A;  3CO6 C;  1U78 A;  3FXR A;  3M1E A;  2F2E A;  3PFI A;  1L0O C;  3GFL A;  4HLX A;  5FD5 A;  2A69 F;  3O3K A;  5D4R A;  3M7G A;  2EV6 A;  1JGS A;  5D8L B;  1EH6 A;  4BHP A;  1JHH A;  2QM3 A;  3DPL C;  1YO5 C;  4KIB A;  4ENK A;  4N0B A;  2K02 A;  5FLX K;  1S29 A;  2DBB A;  4WXH A;  5J8C A;  1GXQ A;  2CQK A;  4A6D A;  1U2W A;  4TV7 A;  2CWE A;  1PDN C;  3K2Z A;  2MLG A;  2QUF A;  2CSO A;  1YS6 A;  5HVQ C;  4EM1 A;  3JAM Z;  5CLS A;  4RB1 A;  2VBW A;  3H3Z A;  2V6C A;  2VC0 A;  4UVC A;  1IUY A;  5D6E A;  4MQV A;  2G7U A;  2EA4 A;  5LEJ A;  4NQW A;  4YIF A;  1YTY A;  3RKW A;  4GO1 A;  3CJN A;  3BPV A;  3KLO A;  1SMY F;  2XGX A;  2ZNZ A;  1YG2 A;  3SXY A;  1WI9 A;  1O7F A;  1GHC A;  1J59 A;  1C0W A;  1IXS B;  4BHC A;  4M6X A;  3GLX A;  5L3B A;  3DXJ F;  2V1D A;  3I4P A;  1BI3 A;  3JW4 A;  4S04 A;  1F1Z A;  5E1W A;  1R5G A;  1BIA A;  2PMU A;  3QAH A;  3GXO A;  2FRH A;  4KMU X;  3V7S A;  1P92 A;  3ABU A;  1HQC A;  3DF8 A;  2Y75 A;  2P5L C;  1Z6R A;  2OD5 A;  2QEN A;  5DUK A;  3RPQ A;  2RGV A;  5H6R A;  1JE8 A;  1IN8 A;  4EVI A;  5HLH A;  1ZRC A;  4IRG A;  4KIF A;  1QPM A;  2HFH A;  3KE2 A;  2XIG A;  5CJ9 A;  5JR3 A;  1D5V A;  3MWM A;  1K79 A;  2TDX A;  3HOT A;  3ZMT A;  2RC4 A;  3NQO A;  1XMA A;  2F5D A;  4MTD A;  2A6E F;  4LJZ F;  5FB2 A;  1BI1 A;  3L09 A;  1CGP A;  2JPB A;  2R7D A;  5LLQ A;  1Q1H A;  2RDP A;  5F6F A;  2A6H F;  4OIQ F;  3WE2 A;  1G6N A;  3HRS A;  2C6Y A;  4MTE A;  4XSZ F;  4KFC A;  1XD7 A;  2DLL A;  2OZ6 A;  3HRU A;  4I98 B;  2FA5 A;  3BDD A;  4HBL A;  3RYR A;  4I01 A;  1G3S A;  2P7C B;  1KQ8 A;  3LA7 A;  4G7O F;  5ERI A;  1S3J A;  1R1V A;  3LA2 A;  3ZMU A;  3FHZ A;  4RB0 A;  3MFK A;  2J5O A;  3FMQ A;  4RB2 C;  4EGZ A;  4CYD A;  2A07 F;  4HV6 A;  5E18 F;  4HZF A;  3GZ6 A;  2RV8 A;  1R1U A;  1FX7 A;  3MEX A;  3H3U A;  4B8X A;  2E7W A;  2F5F A;  4I0B A;  3E3V A;  4L18 B;  2NNN A;  4L5I A;  3LFK A;  4AIJ A;  2HDC A;  3S2W A;  2P7V B;  1O3T A;  3N97 A;  3WTX C;  4Z2Y A;  2RVC A;  2YU3 A;  1LVA A;  4G9Y A;  2YR2 A;  4ENJ A;  1X3U A;  2ISZ A;  3RI4 A;  3ROU A;  5ILU A;  4Y17 A;  3F22 A;  2FF4 A;  2XVC A;  2F5E A;  5D5U B;  4D0P A;  4I7H A;  3WTW C;  3J81 Z;  2ZXJ A;  3CUQ A;  3TQN A;  4M9X A;  2H6C A;  1MD0 A;  4Q48 A;  1B59 A;  4I0A A;  4QWQ A;  2PEX A;  2MC3 A;  1XMK A;  3E5Q A;  4ZYG A;  2UXN A;  5IT3 A;  1OKR A;  1SFU A;  4P9U A;  3CUQ B;  1ZH5 A;  2D1V A;  3WOD F;  4E70 A;  3W6J B;  5CVR A;  1XGO A;  1K6O A;  2M87 A;  4YFK F;  2ZJ2 A;  5DDG A;  2ZO4 A;  2OQR A;  4ZYH A;  4LK0 F;  5TJJ A;  3BY6 A;  2P5V A;  1LEA A;  3KLN A;  5A2Q K;  3C18 A;  4MEY F;  4GCV A;  3FWE A;  1UHM A;  2ETH A;  5JHU A;  1T2K A;  3OOP A;  1KU3 A;  1REP C;  4BXU A;  1YS7 A;  3HTS B;  2FML A;  1BC8 C;  2VT2 A;  1FC3 A;  4IXA A;  4L5J A;  3TDU C;  2XKP A;  5F64 A;  5LRS A;  1HKQ A;  4NB5 A;  3RTR A;  2ZBK A;  3JSP A;  3QU6 A;  1P4A A;  4KIG A;  1R5H A;  2VN2 A;  5DCM A;  4Q4Z F;  4LGW A;  3LST A;  1FP1 D;  4O5V A;  1S8N A;  5BS6 A;  2FNA A;  3ECH A;  2JSC A;  3KEO A;  4LK1 F;  3JSO A;  2KJB A;  5E17 F;  4RS8 A;  2XAQ A;  4R79 A;  3LQQ A;  5AON A;  2LKP A;  1OYW A;  5ILV A;  3CO7 C;  2FQ3 A;  1ZAO A;  3WTZ A;  4Y13 A;  5CVV A;  1GXP A;  1ODD A;  1R7J A;  4CIC A;  2O0Y A;  3U2R A;  2HQN A;  5D5X B;  1MDM A;  1RUN A;  2PFB A;  1FSE A;  1TBX A;  2GA1 A;  2XAF A;  1W7P D;  2K4B A;  2JPC A;  3LAJ A;  1MDM B;  2OQG A;  2O61 A;  2EFN A;  2VE9 A;  5CVU A;  4EGY A;  4HAM A;  4WF2 A;  2VE8 A;  1YIO A;  1IAW A;  2HZT A;  3ELK A;  5BPI A;  3KCC A;  3R0A A;  3T5X A;  1HST A;  2DPU A;  3TDZ C;  1VTN C;  2JZY A;  5DEQ A;  2ACJ A;  3P9C A;  2L54 A;  2VXZ A;  3GFJ A;  1KYZ A;  4RAZ A;  2Z33 A;  4DQ2 A;  4LLG F;  1IN6 A;  4B09 A;  1PP7 U;  2KIU A;  3ZMV A;  1FT9 A;  2A68 F;  5ILS A;  3KP4 A;  4XSX F;  2DTR A;  4WXC A;  2VOP A;  3ZMD A;  2DFI A;  3DV8 A;  1KGS A;  2H94 A;  1T98 A;  1ZHF A;  1ON2 A;  2M8E A;  2R3S A;  2ZME A;  3GVA A;  3EYI A;  3MZH A;  5HOO A;  2ZNY A;  5DCF A;  1RI7 A;  1R22 A;  3PQJ A;  3J7A O;  3FM3 A;  2FSW A;  1FYM A;  3KZY A;  1BI2 A;  2A61 A;  1A04 A;  3TO6 A;  1SD4 A;  4OIP F;  5K1Y A;  3KP2 A;  2EV5 A;  2VT3 A;  4L9J A;  3FM5 A;  1MKM A;  1YYV A;  1BJA A;  1U5T C;  3HSR A;  4EJV A;  3RIR A;  1AOY A;  3L00 A;  1UFM A;  1ZRD A;  2E1N A;  2HR3 A;  4RB3 C;  4LD5 A;  5KK1 A;  4IRH A;  4M72 A;  2ESH A;  4RGX A;  2O8X A;  1S7O A;  3HOS A;  2VOO A;  4LB6 B;  1YFH A;  3E5X A;  4CXF A;  2W57 A;  3I54 A;  1FYK A;  4IHS A;  1LJ9 A;  3ZP5 A;  1ZN2 A;  3DKW A;  5A2Q Z;  2M5W A;  3M8F A;  5JVT A;  2W24 A;  4M73 A;  1ONV A;  2K7L A;  1AWC A;  3K0L A;  3BJ6 A;  3F8N A;  1Z7U A;  2K27 A;  3NRV A;  3H92 A;  1QZY A;  2YX7 A;  2P6T A;  1G3Y A;  3J81 K;  1UCR A;  3WTY C;  2IA1 A;  4BQA A;  1LDK B;  1S6L A;  5E8I A;  4L0Y B;  4ZH4 F;  1KA8 A;  4UNO A;  1TQM A;  1B9M A;  1BI0 A;  2EA2 A;  2H6B A;  1GVJ A;  4XRF A;  2V1U A;  2GZW A;  2YSR A;  4LLL A;  1DP7 P;  2NNY A;  1MGT A;  1MJA A;  3REO A;  1HXD A;  1G4D A;  2ZFW A;  1ZRF A;  2W25 A;  4G7Z F;  5TRD A;  1H9T A;  4KNY A;  3GFI A;  2M1B A;  3SHF A;  3WGI A;  3F8B A;  3IC7 A;  4M9S A;  3F21 A;  2STW A;  4M71 A;  1O3S A;  1H0M A;  4CO8 A;  2WTE A;  2VBY A;  2V9V A;  1OYY A;  1LDJ A;  4NHJ A;  5E20 A;  3GF2 A;  4G6Q A;  5H6Q A;  3EET A;  1Z9C A;  3V8K A;  4HA8 A;  5J6X A;  1FWZ A;  2M45 A;  4IJA A;  4FHT A;  2L3D A;  4U7B A;  4FT8 A;  5CVJ A;  2O3F A;  2VC1 A;  1T39 A;  4HLY A;  3HYI A;  5HLI A;  1TLH B;  2OA4 A;  1HW5 A;  1WRJ A;  3C7J A;  2L4A A;  5J8F A;  1QZZ A;  2H27 A;  2AXL A;  5DUI A;  1WWX A;  4MQ9 F;  2QLZ A;  1WQ2 A;  2QQB A;  3R60 A;  3RKY A;  1CF7 A;  1RIO H;  4XBF A;  1YW8 A;  4G6D A;  4YG2 F;  1FPQ A;  3JTG A;  1TW2 A;  2BE5 F;  1LEB A;  2K86 A;  5E8G A;  1KQ9 A;  3C3W A;  5FD6 A;  1IN7 A;  4PDK A;  3K1M A;  3TGN A;  3WGG A;  1KU2 A;  1B4A A;  2CGP A;  1E2X A;  3ML6 A;  1HW1 A;  4WXD A;  4UV8 A;  3V8L A;  1U5T A;  1HBX G;  2DU9 A;  3RJP A;  1ZYR F;  5LHI A;  3M9A A;  3L9F A;  2HTJ A;  4N9I A;  4WWC A;  4UVB A;  3R61 A;  3HRM A;  4A5N A;  3D5L A;  5ICF A;  5IT9 Z;  3K1P A;  3FX3 A;  4ESF A;  3TOA A;  4HX7 A;  4BNC A;  2BYV E;  2QYO A;  2EV0 A;  3F23 A;  5LRR A;  2XAS A;  4GGG A;  2ADU A;  3M8E A;  1IXC A;  2UXX A;  1ZGA A;  3K9T A;  4ASN A;  5D4S A;  3HTU A;  3WU0 A;  4KYW A;  2XHK A;  2FMY A;  4L9V A;  1T38 A;  4O3M A;  3DP7 A;  4PZJ A;  5LEK A;  2M30 A;  1FNN A;  3ZN0 A;  3HRT A;  3WG9 A;  5JI6 A;  3VFZ A;  3L7W A;  2HKO A;  1SAX A;  2DQL A;  1JXS A;  2NS0 A;  2L4M A;  4JBA A;  1R00 A;  3G3Z A;  2FOK A;  3E6M A;  2HKX A;  2UZK A;  1W7P A;  1MJB A;  4YFN F;  1O7L A;  1J75 A;  3RYP A;  5KVR A;  1QGP A;  4OOI A;  2ISY A;  3JTH A;  4EM0 B;  1XSX A;  2LDU A;  3LAP A;  1OPC A;  2GXB A;  2PN6 A;  1MJ9 A;  1XGM A;  1XGS A;  1KQ0 A;  4KN7 X;  1JHF A;  5L3D A;  4UUV A;  1IXR C;  1IF1 A;  2QVO A;  3QU3 A;  3KZZ A;  4ENM A;  5D5W B;  3V7R A;  3T8R A;  4HF0 A;  1BC7 C;  1K7A A;  2GA2 A;  1P6R A;  2WC2 A;  2D2W A;  1IRF A;  3DQV C;  1R36 A;  1LB2 A;  3WU1 B;  2Q2E A;  1Z05 A;  1U6G A;  1IN4 A;  4G8X A;  4A5M A;  4HQE A;  2L01 A;  4I09 A;  1P2F A;  1UB9 A;  3EUH A;  1XSD A;  3MAJ A;  1K78 A;  3BZ6 A;  5HLG A;  1ZRE A;  3MCZ A;  3GWZ A;  3IHU A;  1V3F A;  2IRF G;  5L3E A;  2H09 A;  3HSE A;  1QQI A;  2LNB A;  5JFR A;  3RPU A;  1XDU A;  3U9G A;  1LNW A;  1BM9 A;  4M6Y A;  1F9N A;  2CYY A;  5DCM B;  5D5V B;  1K78 B;  1HSJ A;  4OIO F;  2F5C A;  1J0R A;  3T8T A;  3K69 A;  4G94 A;  2FBH A;  4ZZD A;  4F7Z A;  2DPD A;  2W84 A;  2PQ8 A;  5FFZ A;  4ON0 A;  4A0X A;  3FZV A;  2PJP A;  5EEH A;  2UWM A;  3F8F A;  4HF1 A;  2RKH A;  2JT1 A;  4JK1 X;  5BOX A;  1ON1 A;  5ICE A;  3LQR A;  1RNL A;  3HHG A;  1TNS A;  4U0W A;  3LA3 A;  1T0F A;  4HOB A;  3QP6 A;  1SFX A;  2HQR A;  1KYW A;  1FYL A;  4KT5 C;  3E6B A;  3DEU A;  4AIK A;  1V4R A;  4U0Y A;  1DPR A;  2G9W A;  5LGN A;  2E7X A;  5ICC A;  3D0S A;  1XGN A;  4M9Z A;  1OYI A;  2HEO A;  3KP7 A;  4RGU A;  3WTV C;  4LMY A;  3CUO A;  3ZMZ A;  1OMI A;  1HKS A;  3IKT A;  1YLF A;  2HS5 A;  2NAZ A;  4AIH A;  1J2X A;  1G3T A;  4CGZ A;  4HYE A;  5BPD A;  4HV5 A;  2OU2 A;  4ZZL A;  1BN5 A;  2EK5 A;  4ETS A;  1W4M A;  2VBZ A;  1TQP A;  1XDS A;  5HDG A;  1J9I A;  2DQR A;  2W85 A;  2A5Y B;  5HDK A;  2GAU A;  1WSU A;  4Y15 A;  4P55 A;  4A2U A;  1FSH A;  2NYX A;  1D8K A;  3U1D A;  3IWF A;  4MHG A;  2HGC A;  5D8K B;  3HUG A;  3B73 A;  4BYY A;  2WWY A;  3GEZ A;  5LHG A;  1I1S A;  1O57 A;  2ZME B;  3ABT A;  1UHW A;  5HDN A;  3I64 A;  4QLC U;  5L3G A;  2OBP A;  5IT9 K;  1SD6 A;  3FF5 A;  1QBJ A;  2QQA A;  1R58 A;  1F5T A;  2J5P A;  2Q8K A;  1YW7 A;  5ED4 A;  3ISP A;  3MQ0 A;  3I5U A;  2FBI A;  2P5K A;  2BEO A;  5CVI A;  2FNP A;  3SZT A;  2PLY A;  3VEP A;  1P4X A;  3VOD A;  1FP2 A;  3BJA A;  1RZ4 A;  2QZ8 A;  5BMZ A;  4Q5S F;  4WK8 F;  5LGT A;  1IZ1 A;  4ZYD A;  1TQI A;  4WX9 A;  3QRF F;  1DUX C;  4ESB A;  1I1G A;  2X0L A;  1Z91 A;  4OIN F;  4EM2 A;  4PGH A;  3K1N A;  1XB4 A;  2PMH A;  1IN5 A;  3I58 A;  2K4J A;  2GXG A;  2E1C A;  4JQF A;  4PGG A;  2VON A;  3QOP A;  5L3F A;  2B0L A;  4CDG A;  2IT0 A;  3FXU A;  2OZU A;  4YII A;  2Z3Y A;  5F1R A;  5E1Z B;  1P4W A;  2ZCW A;  4KIC A;  2KRF A;  3F72 A;  3E6D A;  5H20 A;  1HW2 A;  3QP5 A;  4WCG A;  3BWG A;  3IRQ A;  2R7F A;  4CHU A;  1XSV A;  1SD5 A;  4I2O A;  1O3Q A;  1RUO A;  2GIV A;  2ZKZ A;  4O6J A;  1ZG5 A;  2D45 A;  2XRO A;  3WE3 A;  1BOA A;  4BH9 A;  4ENN A;  3E5U A;  2DI3 A;  5K5Q A;  1ZG1 A;  1S7A A;  3WTU C;  1BIB A;  3CUQ C;  2D1H A;  3P9I A;  3I71 A;  3O2P E;  4GYI A;  2JTV A;  2VBX A;  2CW0 F;  5FO5 A;  3EQL F;  3BOQ A;  3TO7 A;  4P9F A;  2BBY A;  3SZP A;  1J7K A;  3I53 A;  3VOE A;  2MBF A;  4IVN A;  4KN4 X;  2BV6 A;  3TO9 A;  1FBS A;  3SQN A;  3J80 Z;  2KIF A;  1FY7 A;  3FMR A;  1FZP B;  2EFP A;  3BPX A;  2LF7 A;  3V8J A;  3F8C A;  4IRI A;  2FE3 A;  2O6G E;  1UST A;  2STT A;  5AIQ A;  4EV0 A;  1ZGJ A;  3DFG A;  1SD7 A;  4RGS A;  2ELH A;  4DNC A;  3T0Y A;  5DD8 A;  4IPA A;  1E17 A;  4UV9 A;  3R4K A;  1I27 A;  4UXN A;  3LWF A;  3QPH A;  5FGM A;  5DYM A;  5EEG A;  1MZB A;  1EV7 A;  1Z6T A;  5AIP A;  1XCB A;  1IW7 F;  3O6B B;  3KET A;  2EJR A;  5DD4 A;  2PI0 A;  2DT5 A;  3ULQ B;  4HDV A;  5LBQ A;  5FFX A;  5E1X A;  3Q9S A;  4LLN A;  2HWV A;  4AVP A;  1R23 A;  4H0E A;  3G73 A;  5D6F A;  3OV8 A;  2CO5 A;  2MH2 A;  4Q47 A;  4CZZ A;  4ESJ A;  1CF7 B;  4HW0 A;  1I5Z A;  3HIF A;  1D8J A;  2Q0O A;  4GXO A;  4R1H A;  2XUB A;  3HSF A;  2LF8 A;  1KU9 A;  6PAX A;  2NRA C;  4LFU A;  2DO7 A;  4EQQ A;  2KJC A;  1U5T B;  4UVA A;  2KKO A;  3L2C A;  2P4W A;  2RNJ A;  4IHT A;  2Z99 A;  1IRG A;  4OU0 A;  1B1B A;  3ZPL A;  1B6A A;  4LB5 A;  3COA C;  2L02 A;  1G3W A;  2XRN A;  1ZLJ A;  4KUM A;  4MNU A;  2EFO A;  3EYY A;  3N4M A;  4A6E A;  2IA2 A;  1EH7 A;  1TW3 A;  1L3L A;  2A3S A;  2CFX A;  3GX4 X;  1O3R A;  3ZQ7 A;  4IF4 A;  3KFW X;  1XCV A;  1U3E M;  3RKX A;  4S05 A;  3GYH X;  1D3Y A;  3ZN1 A;  1ZAR A;  2EFQ A;  3V4G A;  2RN7 A;  4L0Z B;  4A0Z A;  3F6V A;  4HF2 A;  2DAO A;  4MEX F;  1W5T A;  3RDI A;  4MGR A;  3NEU A;  4FX4 A;  3I59 A;  2DK8 A;  3KP3 A;  5FLX Z;  2FEZ A;  2FXA A;  4G7H F;  4N9H A;  2QQ9 A;  2V79 A;  3R6S A;  4GYG A;  4OIR F;  2QBY A;  4UHT A;  3I59 B;  2COM A;  1XN7 A;  4AWX B;  3E6C C;  1TNT A;  2PG4 A;  2CG4 A;  3W6K B;  1FBQ A;  2EWN A;  1W7P B;  4K2E A;  2QBY B;  4A0Y A;  1PP8 F;  4HX4 A;  2JRT A;  4XLP F;  1DDN A;  4LG0 A;  1FBU A;  1USS A;  4EJT A;  2FBK A;  1KU7 A;  2PBI A;  2AS5 F;  2YX4 A;  4EJW A;  3Q5F A;  1W5S A;  5HS7 A;  2XKO A;  1LDD A;  1NHA A;  4PCQ A;  1FLI A;  2DW4 A;  5LHH A;  4LG0 B;  3WTT C;  2GWR A;  2XV4 S;  4U7D A;  2OAZ A;  3CDH A;  4KDP A;  1ZG3 A;  1U8R A;  3GW2 A;  5L3C A;  3F6O A;  4A12 A;  3C1D A;  5HS8 A;  3JAM K;  3TKY A;  3FXQ A;  4BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...