3U2RA

Crystal structure of marr transcription factor from planctomyces limnophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
135
Chain Sequence
RFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVHPEGMATLQIADRLAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein MarR
publication title Crystal structure of MarR transcription factor from Planctomyces limnophilus
rcsb
source organism Planctomyces limnophilus
molecule tags Transcription regulator
total genus 49
structure length 135
sequence length 138
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u2rA00
4N9IA 3K0LA 2YR2A 1XDSA 4IVNA 1YG2A 1KU2A 2CSOA 3BPVA 5J8FA 1RIOH 2VC0A 3J81Z 2MLKA 4M6YA 2GAUA 2DPUA 2DAOA 3GZ6A 5K1YA 3I53A 4UXNA 4YFNF 2A07F 2IA2A 3M1EA 4L0ZB 4RB1A 1HSTA 1A04A 2PG4A 2VODA 1J0RA 3QRFF 3QP5A 3VODA 1CGPA 1BI0A 2FSWA 1WI9A 5AONA 1OKRA 2ACJA 2A6HF 2P5KA 3M7GA 3TO6A 1J2XA 5ERIA 1IN6A 5ILSA 1G3TA 2GZWA 4RGRA 3ZQ7A 4LG0A 2X4HA 2CGPA 4EM2A 1F1ZA 1P4AA 3IWFA 3I5UA 3WG9A 3WTSC 3DF8A 5EEHA 1PUEE 1IXCA 2ISYA 3TKYA 1T39A 2FNPA 2DK8A 3REOA 3J81K 2W25A 1C0WA 4F7ZA 2KIFA 2BGCA 1LQ1A 2DI3A 2RKHA 3HSFA 4HX4A 3GX4X 5HLGA 2EV5A 1ZRDA 3FMQA 4UUVA 3V8KA 2ZKZA 2DU9A 2V1DA 3C7JA 1D8JA 1JGSA 2JZYA 1FBUA 3K1NA 3L00A 2IRFG 2YPRA 4RGUA 2P7CB 2JTVA 1MJ9A 2VT2A 1TQPA 4WF2A 2G9WA 2PI0A 5LGTA 3KEQA 1YYVA 4ON0A 2EV6A 2QWWA 4KMUX 5D8LB 2RNJA 6PAXA 1S8NA 1GVJA 4KIBA 2RVCA 3HSEA 4EV0A 4YIIA 5DD8A 3K2ZA 1HW5A 4M73A 3I59B 5BMZA 4HZFA 1BJAA 4ESJA 4GGGA 4NB5A 1RUOA 5L3FA 3WE3A 1OYYA 3U1DA 3SQNA 3E5UA 2PEXA 1S3JA 3GW2A 2K27A 2QBYB 2ISZA 3TO9A 1HQCA 1TQIA 3SZPA 2UZKA 4IPAA 4IXAA 4U7BA 5LBQA 4IRIA 3QAHA 5HDKA 1HW2A 2P7VB 1TW3A 3CO7C 3FZVA 2JPCA 4Q5SF 4M71A 3FXUA 2BV6A 2F2EA 3QOPA 3K69A 3FWEA 5IT3A 5HS9A 3R6SA 2H27A 5K5OA 4EM1A 2HTSA 5BOXA 3BPXA 1U6GA 2VOPA 3QU3A 1FBSA 5L3GA 2QQBA 3KP2A 4UHTA 1QZZA 5J6XA 4ZYDA 4HAMA 3V7SA 1U5TA 2X0LA 1B4AA 3WU1B 3G73A 4IRGA 1SMYF 1D5VA 4PZJA 1IXSB 5KK1A 4GYIA 3HOTA 3E3VA 2ZXJA 4S05A 1ON1A 2EJRA 1IXRC 1TW2A 4HV6A 3RPUA 1FPQA 3P9IA 5HOOA 5JFRA 2F5EA 3RDIA 2P6TA 4M9ZA 1HKQA 3GFMA 4KN4X 2XGXA 2LNBA 1Z91A 4A6EA 1IRFA 2OU2A 1Z6RA 1BN5A 5F64A 3WGHA 2CFXA 4HF2A 2GXGA 4WWCA 4IF4A 2MBFA 5HLIA 5D4RA 3HRTA 5ICGA 3F8FA 1QNTA 5IT9K 4A5MA 2BE5F 1EH8A 4OIRF 4O3MA 2ELHA 2RC4A 4I01A 2PN6A 3U9GA 2QLZA 1XDUA 4D0PA 2HOEA 3DEUA 1FX7A 2XHKA 1TLHB 2AXLA 4ENMA 1ZHFA 3ZMVA 2L4AA 4IHTA 3ZMZA 3PFIA 5A2QZ 4CICA 5LLQA 2O61A 5KVRA 4IHSA 1IN5A 2Z9OA 4I0BA 2O6GE 4G94A 2M1BA 1IAWA 3JSOA 3K9TA 3HTSB 4G9YA 1T0FA 2FRHA 2IPQX 2ESNA 2V1XA 3FMSA 1XMKA 1XGMA 2LDUA 1KGSA 3KP7A 1HKSA 1KYZA 4JK1X 2DPDA 1R7JA 1K79A 1MJBA 2PQ8A 4LG0B 1B1BA 1R36A 2D1VA 3L09A 1AWCA 1J9IA 2CG4A 1KYWA 2ZCWA 3VEPA 3C1DA 3E6MA 4LB5A 1FYLA 1TTYA 4OINF 3TDZC 4GO1A 1PP7U 1YFHA 3CUQA 4WK8F 4HQMA 3DXJF 3K1MA 2HQRA 1VTNC 1XSXA 1JHHA 5A2QK 3HOSA 2HYGD 4ASNA 2HFHA 1KU3A 2L54A 2C6YA 3HTUA 2J5OA 4BAYA 4U0YA 2M8EA 5DDGA 1R58A 4Y15A 1O7LA 3ROUA 1ZGJA 2KRFA 3SHFA 2EK5A 2K4BA 3MQ0A 3QP6A 4FHTA 3BZ6A 3KCCA 4Q47A 1USSA 2KKOA 4UV9A 2LKPA 2XIGA 2XAJA 1XGNA 4UV8A 2E7XA 2Q2EA 1ODDA 4P9FA 1HW1A 4TV7A 3DFGA 4MNUA 2PMUA 1V3FA 4HF0A 2GA1A 4JQFA 3KZZA 2B0LA 2XKPA 2GA2A 3GUDA 1W4MA 2QQ9A 4LB6B 3V4GA 1ZH5A 4KNYA 3SZTA 1U5TC 1HSJA 5CLSA 4YIFA 5BPDA 3NEUA 3CO6C 1RUNA 3J7AO 4EJTA 3I58A 4WXDA 4KICA 3ZPLA 3QU6A 3JAMZ 3LA2A 2BYVE 2ZFWA 3DPLC 4OMZA 1Z05A 2VC1A 2XV4S 1T38A 1DPRA 4MQ9F 3I71A 3VB2A 4CO8A 2L3DA 4PGGA 3SFZA 5D8KB 2CYYA 4L9JA 3RKYA 2DK5A 2ESHA 1Z9CA 1REPC 3KP3A 3EYYA 2QENA 4PCQA 2RGVA 4UVAA 4XLNF 2XASA 4LD5A 4OOIA 3RKXA 4I2OA 1U5TB 1BBYA 2A6EF 3JTGA 5BQTA 4CHUA 3M8FA 1Z6TA 4ZYHA 3F8NA 2DO7A 4GCVA 4FX0A 3L9FA 3WTVC 2OZ6A 5DEQA 3WGIA 1HKTA 1IN4A 3RI4A 4ENJA 3F8MA 3DV8A 2PBIA 2O3FA 2HWVA 1KU9A 3WTYC 3JAMK 3GXOA 2DBBA 3I64A 3B73A 5JI6A 3F6VA 2FA5A 1SD5A 4NQWA 3DQVC 1IF1A 1O57A 1U2WA 3ULQB 1IN7A 3F21A 1YS6A 5L3DA 3OV8A 2OQGA 1FOKA 2EA4A 4L9VA 2CW0F 5CVJA 5FB2A 2VBXA 4XSZF 1YTYA 3LAPA 1MDMA 2Z99A 1SD7A 1MZBA 4R79A 1HBXG 3HHHA 4AIKA 2Z5UA 5D5WB 5L3BA 1FYMA 4LLLA 1F5TA 3V7RA 4NHJA 3LAJA 4G7OF 3TOBA 2RQPA 1DPUA 1XN7A 2V79A 3LFKA 1ZG1A 3AAFA 4M6XA 3GLXA 2KIMA 2ZBKA 3E5XA 3CUQC 4I09A 3VOEA 4WXHA 4KMFA 2IW5A 2DW4A 4EJWA 3Q9SA 1UB9A 3KETA 3JSPA 1O3TA 3MZHA 2IA1A 5ICFA 4E70A 3HYIA 4I7HA 3RIRA 2DQLA 3WTTC 3MEXA 4ZYGA 2GWRA 3MWMA 3KFWX 1SFXA 2XRNA 2E1CA 1ZGAA 4HV5A 2Y75A 1YLFA 1XCVA 4ZYEA 4DNCA 4U0VA 2H94A 2V9VA 3CUQB 2YSRA 1QBJA 4BQAA 2HR3A 2R3SA 2FF4A 2O0YA 3O6BB 1ZYRF 3HHGA 2F5CA 5IT9Z 1T6SA 4RGSA 1P2FA 4KIFA 3FX3A 1OMIA 3V8JA 1O3RA 5LGNA 2MC3A 3NQOA 2PMHA 3FMRA 1SFUA 3EUHA 4U88A 1R1TA 4ETSA 5LEKA 4YG2F 3E6CC 2W57A 1BC7C 2LF7A 5DYMA 3O2PE 4FX4A 3IL2A 1S29A 4U7DA 4YFXF 2D1HA 4RS8A 3HSRA 2HZTA 2VBWA 4HLXA 1XGOA 4A5NA 5HS8A 3IKTA 2YX4A 3RPQA 1F9NA 5ILUA 4HQEA 2Q8KA 4BXUA 1TQMA 2K4JA 5CJ9A 3CJNA 1S7OA 2UXNA 2KJBA 2A5YB 4AVPA 4HW0A 1F4KA 3F3XA 3IHUA 2M45A 3TOAA 2YX7A 3T0YA 2BBYA 4PGHA 3ECHA 1SAXA 1J7KA 1FP2A 5FO5A 1NHAA 5E17F 1ZRFA 1FYKA 3ML6A 1QO0D 3F23A 3Q5FA 3HRUA 3FM3A 4A0YA 5D4SA 2WWYA 1YW8A 2COMA 2ADUA 2F5DA 2IA0A 2ZNZA 1DP7P 5CVUA 3EYIA 4WXCA 1P4XA 1TNSA 3EQLF 2NAZA 1FZPB 1UHMA 3C3WA 5LRSA 2W84A 5BS6A 4IRHA 2E1NA 2P8TA 5E8IA 4AIJA 4G6DA 1YIOA 4CZZA 3E6DA 3WTUC 4LMYA 3F8CA 4HA8A 4L5IA 3IRQA 3ABUA 4G8XA 1QGPA 4MTDA 4BNCA 1ULYA 1WQ2A 2P6SA 2A69F 3ECOA 2J5PA 1R5GA 3OOPA 5D6FA 3I0TA 4CYDA 4P9UA 1QPMA 3R60A 3KLNA 2EFWA 1BI3A 5L3EA 3RYPA 3J80Z 3N4MA 2HEOA 2DQRA 1UFMA 5AIPA 2ZNYA 5CYVA 1XSDA 3BP8A 1ZG3A 1MKMA 4K2EA 3BY6A 4OIOF 2QZ8A 4AIHA 3T8TA 5ILVA 3ELKA 2HKXA 3F6OA 4EQQA 2L4MA 4MHGA 3JW4A 4CDGA 5EEGA 4P5OA 3H3ZA 2G7UA 4EVIA 4L9TA 2Z3YA 4RB3C 4KIGA 4LLNA 1Z7UA 4A6DA 5E1XA 2FNAA 4R8HA 2WV0A 2GXBA 4G7HF 3CTAA 5ED4A 1FC3A 5DUIA 5ICEA 3C18A 2FXAA 2IVMA 5H20A 3F8BA 2XAFA 4Z2YA 4B8XA 1EH6A 4L0YB 3GFJA 2MA3A 3MZYA 2FOKA 1ZN2A 1LDJA 2HYFA 3BJOA 1W5TA 5LHIA 3I4PA 3Q9VA 1L3LA 1BC8C 1MDMB 1JXSA 4BHPA 5DCFA 4ESBA 2IT0A 3R4KA 4KT5C 2FE3A 3J80K 3BROA 4WCGA 1LEAA 2VOOA 2NS0A 3D5LA 4Y17A 1LEBA 1KQ0A 1RI7A 4I02A 1ZRCA 4QLCU 4HOBA 4G6QA 5HDGA 4N0BA 2RV8A 3H92A 2O03A 2XAQA 1CF7B 1PP8F 2Q0OA 3SXYA 2Z33A 3E97A 1ZARA 1I6XA 4EJUA 2FMLA 3QPHA 5E8GA 5J8CA 5CVIA 5L3CA 4RAZA 2XAHA 4HX8A 2DFIA 3BDDA 1KA8A 4MTEA 4ENKA 1D3YA 4BH9A 3TO7A 5E1WA 5FFZA 4U0WA 1B6AA 1H0MA 4L9NA 1XMAA 1B9NA 5H6QA 4Q4ZF 3E5QA 5D5VB 3KP5A 1FNNA 4EMSA 2A68F 5FD5A 2K02A 3V7CA 2FBHA 4Q48A 3RJPA 2BEOA 4KYWA 2P4WA 2R7DA 1FT9A 1R1UA 2QM3A 3MFKA 3GYHX 4R1HA 2UWMA 2ZMEA 3FF5A 1I27A 3T5XA 3TGNA 1TNTA 2PLYA 2CWEA 2K7LA 5E1ZB 2XVCA 3VFZA 2OBPA 4G7ZF 1FP1D 4P96A 5ICCA 4LK0F 4HDVA 3H3UA 3NRVA 3LSTA 1K6OA 4MEYF 3P7NA 3R0JA 2OA4A 2EWNA 4LK1F 5JHUA 1BOAA 2H09A 3GFIA 1U8RA 1I1SA 5LGUA 1I1GA 3WTXC 1FSHA 2V1UA 2QUFA 3HRSA 1OYIA 3BOQA 3U2RA 2UXXA 3I54A 5FFXA 2CQKA 3IC7A 3R0AA 5FD6A 4ZZLA 4YFKF 2LF8A 1Z1DA 3WTZA 2MH2A 3ZN1A 4OIQF 1O3QA 4M9XA 1LJ9A 2HGCA 1ZREA 2L02A 1G3YA 2IP2A 2EA2A 1QZYA 2OAZA 3G3ZA 2L01A 1YS7A 3TQNA 3KEOA 2DTRA 3LWFA 1QQIA 2FQ3A 1IW7F 1W7PA 2OD5A 2FU4A 5LHHA 1R5HA 1T2KA 1MGTA 4JBAA 1R22A 3BWGA 2CO5A 3FM5A 1WSUA 4AWXB 3L2CA 2NRAC 4EM0B 2EFPA 1LVAA 5LRRA 2HQNA 1IZ1A 1EH7A 1G6NA 1CF7A 3PQKA 1XD7A 4L18B 1SFEA 4FT8A 4LJZF 2ZO4A 4OU0A 1OR7A 3T8RA 3W6JB 5HVQC 1ZG5A 1ON2A 1ZAOA 5CVRA 1E2XA 4BYYA 2YU3A 1FBQA 4XLPF 2JSCA 2VONA 2XKOA 4DQ2A 1W7PD 1L0OC 3GF2A 2DLLA 3EDPA 5D5UB 1J59A 1XGSA 1D8KA 2VXZA 1H9TA 1AOYA 2P5VA 4ZZDA 2VBZA 3ERED 1KU7A 1UCRA 2Y48A 1YW7A 4ZH4F 1OPCA 3R61A 5H6RA 3HIFA 4B09A 2MD5A 1HXDA 5HDNA 4MQVA 4CXFA 3MAJA 4WX9A 1Y0UA 4LGWA 1K78A 1T98A 1RZ4A 1KQ9A 3KLOA 4HDUA 1WRJA 4LLGF 3ZN0A 2STWA 1OYWA 2RN7A 1YQAA 2IJLA 2MLGA 4L5JA 2V6CA 3COAC 1U78A 1R23A 3KP6A 1X3UA 2JT1A 3S2WA 3WU0A 1R00A 3WGGA 4PDKA 4XSXF 3B02A 1K7AA 2VBYA 3QPTA 3ABTA 5JR3A 5F6FA 4RB0A 3F72A 3FXQA 2DT5A 3RTRA 1ZLJA 3HRMA 4EJVA 1XCBA 5DD4A 2JPBA 3LQQA 2KIUA 2E7WA 2HS5A 1S6LA 4UVCA 3ZMDA 3DP7A 2K86A 1U3EM 1FSEA 3P9KA 4M74A 5K5RA 2TDXA 2A61A 5E20A 2P5LC 4KN7X 5FLXZ 5TRDA 2G7HA 2KJCA 2WTEA 4HYEA 1SD6A 3WODF 4KA4A 1G3SA 1S7AA 4EGZA 1BI2A 4AD9A 2A3SA 2HTJA 2D45A 1B9MA 3ISPA 4HX7A 1GXQA 3V8LA 4M9SA 1WWXA 2QYOA 4H0EA 4OMYA 1LDKB 3RYRA 4Y13A 2H6BA 1O7FA 4BHBA 1BI1A 1PDNC 3ZMUA 1WKMA 1TBXA 5F1RA 4I0AA 2QVOA 3O3KA 3ZP5A 1YO5C 1E17A 1LNWA 4N9HA 3KP4A 5K5QA 1O3SA 2XAGA 1DDNA 5DCMB 2EFOA 4UNOA 3ZMTA 2EB7A 4GYGA 4P55A 4HLYA 4O5VA 2ZMEB 1SD4A 4A0XA 3LA7A 3TDUC 3PQJA 3LQRA 1LDDA 5CVVA 5HLHA 1BM9A 5FGMA 2MH9A 2LSOA 3MCZA 4BHCA 1LB2A 5FLXK 3M9AA 2F5FA 4HF1A 3GEZA 3BJAA 2HKOA 2STTA 2M5WA 3GO5A 3GZ5A 3L7WA 3IRRA 1G4DA 1XB4A 2M30A 2ETHA 1IRGA 2RDPA 4A2UA 3P9CA 2Y0MA 4EGYA 3E6BA 4MEXF 3IKVA 2VE8A 4IJAA 3FXRA 2QQAA 3I59A 1B59A 2WC2A 5D6EA 2M87A 2ZJ2A 4UVBA 3HUGA 2FMYA 2OZUA 4A12A 3K1PA 1G3WA 2R7FA 4M72A 2QBYA 5E18F 2VN2A 1MJAA 5BPIA 3F22A 1I5ZA 1RNLA 5JVTA 2EV0A 2W24A 3D0SA 1ONVA 2NNNA 3RKWA 1W7PB 1DUXC 4KDPA 2EFQA 2OQRA 1R1VA 1JE8A 5DV5A 4LFUA 2XROA 2JRTA 3GWZA 2AS5F 2O8XA 2FBIA 4QWQA 3CLOA 1GHCA 2NNYA 3IWZA 1P6RA 2XUBA 2GIVA 2VE9A 3WE2A 5LHGA 2FEZA 3LA3A 5HS7A 3ZMSA 2EFNA 3WTWC 3EETA 1XSVA 2HDCA 4HBLA 3KZYA 1FY7A 1J5YA 3BJ6A 4RAYA 1USTA 4S04A 1UHWA 3CDHA 1H9GA 4O6JA 2VT3A 1JHFA 2H6CA 3CUOA 3GFLA 2W85A 4XRFA 2GQQA 1IUYA 1ZLKA 5TJJA 1FLIA 4XBFA 5LEJA 1STZA 4CGZA 3FHZA 4GXOA 4KFCA 1J75A 1SMTA 5D5XB 1KQ8A 1V4RA 3N97A 1P92A 1EV7A 3M8EA 4OIPF 1IN8A 3T1BA 3DPTA 5DCMA 4RGXA 4ESFA 1K78B 1BIAA 2PFBA 1P4WA 1W5SA 4RB2C 4ENNA 3DKWA 2FBKA 1GXPA 2NYXA 3JTHA 4I98B 3KE2A 1YW9A 4MGRA 2PJPA 5AIQA 1MD0A 4A0ZA 5DUKA 1Q1HA 3W6KB 3GVAA 4KUMA 1FWZA 4EJOA 2D2WA 1BIBA
chains in the Genus database with same CATH superfamily
1XMXA 4N9IA 3K0LA 3GCMA 2X6XA 3ZCOA 1QZEA 2YR2A 1XDSA 4IVNA 1YG2A 4XOPA 2I10A 3CP8A 1KU2A 2JA7J 2CSOA 2RNGA 3BPVA 5J8FA 1RIOH 3CD6I 2EZKA 1ENHA 2VC0A 4DZPA 3J81Z 2R4GA 2MLKA 4M6YA 3S15J 2R7VA 2GAUA 2L9VA 2DPUA 2DAOA 3GZ6A 3IP4B 2KLOA 5H2FC 4BACA 2A05A 5IP7J 3I53A 5K1YA 4UXNA 4YFNF 2A07F 1AU7A 1Y8QB 3PO2J 2IA2A 4DBQA 3M1EA 4L0ZB 5K7HA 4RB1A 1HSTA 1A04A 1Y56A 2PG4A 2VODA 4CCKA 1J0RA 4F92B 2M2EA 1YOVB 1WPKA 3QRFF 3QP5A 3VODA 3HOZJ 3SJMA 3Q0VA 2R5ZA 1CGPA 1BI0A 2ICWG 2FSWA 3MKZA 3OR2C 1WI9A 5AONA 2FUG2 1OKRA 4B3XA 1X2MA 4GDFA 3CCLI 2ACJA 2A6HF 1YIJI 1Z3XA 2P5KA 1A36A 3M7GA 3TO6A 4Y52J 1J2XA 2Y0SA 4ITVA 4V2GA 5ERIA 3BR2A 1IN6A 5ILSA 1G3TA 4PJNA 1RESA 3F9KA 4E7SA 3IV5A 2GZWA 2VB6A 4RGRA 3HKZN 3ZQ7A 4LG0A 2VASA 3NWSA 2X4HA 3NAUA 2CGPA 3E7LA 4EM2A 1F1ZA 2HQAA 4L5EA 1W36C 3IH4A 1P4AA 2Y2ZA 3IWFA 2GOMA 1P9QC 4IHVA 5J3LA 4DOZA 3I5UA 2DDAA 5B1AH 3FDYA 3CDIA 3WG9A 5KAFC 3WTSC 3DF8A 2IGKA 2HPIA 3DU5A 1FOYA 2BVMA 9ANTA 5EEHA 1PUEE 1IXCA 2ISYA 3TKYA 3JRHA 3OS2A 3FKJA 1T39A 4A3CJ 2HOAA 4QTRA 4IOCF 4Z6YA 2FNPA 2DK8A 3REOA 3J81K 2W25A 2Y0SN 3MD2A 4M3EA 1C0WA 2B9SA 4F7ZA 2CU7A 1RETA 2KIFA 4V19K 2BGCA 1LQ1A 1WVRA 1JUMA 2DI3A 2IXSA 3MMYB 5EG0B 4GRIA 1VI0A 2RKHA 1H8AC 1FTTA 1X3WB 3HSFA 3OYKA 5JLXA 4HX4A 3HG9A 3GX4X 5HLGA 2EV5A 1ZRDA 1VQNI 4UB6C 2M0MA 3FMQA 2BY3A 3AL0C 4BXFA 1XS9A 4UUVA 3V8KA 2ZKZA 4CZCA 5GPCA 1VQMI 2DU9A 4G12A 2V1DA 2DT6A 3C7JA 1D8JA 1X58A 3S3MA 2COBA 1JGSA 2JZYA 2LREA 1FTZA 1FBUA 3J7YJ 1MMGA 3K1NA 2QF7A 2KQRA 5GAEJ 1UJ8A 3L00A 2IRFG 2YUSA 4CYCA 4ZTJA 1IDZA 1ETQA 1T95A 2KZVA 2YPRA 4RGUA 1X1DA 3TEDA 2P7CB 1X2NA 1MJ9A 2JTVA 2VT2A 1W1WE 1GT0C 3FBNB 1TQPA 4WF2A 2G9WA 2KRCA 2DMNA 2PI0A 3GTOJ 4ZJZA 2X85A 5LGTA 3KEQA 3G6EI 1YYVA 2W4SA 4ON0A 2EV6A 2QWWA 4KMUX 4C30A 5D8LB 2RNJA 6PAXA 1S8NA 1GVJA 4KIBA 2CV2A 2IS4A 2HVSA 2RVCA 2M8GX 1X1AA 5IP9J 1JUSA 3HSEA 1A6IA 4OAZA 2VL8A 4EV0A 2IBDA 4YIIA 5DD8A 3BG9A 1HW5A 3K2ZA 4M73A 3I59B 1Z3YA 5GPAA 2BW3B 1BL0A 1UHSA 5BMZA 3GLLA 2A6TA 4HZFA 1BJAA 4ESJA 4GGGA 1K83J 4NB5A 1FOWA 1TC3C 2BHZA 3HUGB 2DA3A 3TP3A 1RUOA 4D7MA 2M4KA 5L3FA 3WE3A 1OYYA 4N4NB 2RQQA 4LIVA 3E5UA 3SQNA 3U1DA 1LPQA 2PEXA 5FKOA 1S3JA 2R7XA 3GW2A 1SVMA 3KYCB 2K27A 3CCSI 2QBYB 3H9JA 2ISZA 3TO9A 1ZR2A 3O8HA 2KDZA 1WJCA 1HQCA 1TQIA 1VNDA 3SZPA 1X19A 4E7LA 2UZKA 4IPAA 4XLEA 4IXAA 4U7BA 5LBQA 4IRIA 3QAHA 1OQYA 5HDKA 2P81A 1HW2A 2P7VB 3FISA 4W97A 1TW3A 3CO7C 3FZVA 2JPCA 3DLAA 3S8PA 4Q5SF 3BCBA 4M71A 5HNFA 3FXUA 2ZJRF 2BV6A 2F2EA 3QOPA 3K69A 1JKRC 3FWEA 5IT3A 1APLC 3BG6A 3LSIA 5HS9A 4FETA 3R6SA 5TGTA 2H27A 2ZXHA 3W3CA 5K5OA 4EM1A 2HTSA 5BOXA 1E0EA 2HXIA 3BPXA 1U6GA 2VOPA 3QU3A 1FBSA 4HSTA 5L3GA 2QQBA 4AYBA 2R93J 4ZDOA 4BE2A 3KP2A 4UHTA 1QZZA 3WU2C 5J6XA 4ZYDA 4HAMA 2DA4A 3BZCA 3V7SA 2DTZA 1HDPA 4KT6A 1U5TA 2X0LA 1B4AA 1VQ5I 2HDDA 3WU1B 1A31A 3G73A 4IRGA 2YU9J 1SMYF 3E0JB 1D5VA 2XB5A 2ZMEC 2M7AA 2W48A 1TL8A 2LTPA 4PZJA 1X1BA 2E1MB 1IXSB 5KK1A 1SVOA 4GYIA 4D1QA 1UG2A 3GTJJ 3HOTA 3E3VA 3ZQHA 2ZXJA 4S05A 1M1EB 1ON1A 3OYJA 2EJRA 2E35A 3SFIA 1IXRC 3BR6A 2DFHA 1TW2A 4HV6A 3RPUA 3GMEA 1WJBA 1FPQA 4X0GA 3P9IA 5HOOA 4N4OB 5F0HA 1BA5A 1FMVA 2V26A 4BXXJ 2L2OA 4YIRX 1O4XA 5JFRA 2F5EA 3RDIA 2JA6J 2P6TA 3A1YA 4M9ZA 1HKQA 1X4PA 3GFMA 4KN4X 2QEXI 2XGXA 2LNBA 1Z91A 2BXZA 4A6EA 2R92J 1IRFA 3HOUJ 2OU2A 1Z6RA 1BN5A 5F64A 2ME0A 1LVKA 3WGHA 2CFXA 4F3QA 4HF2A 2GXGA 4WWCA 2VJ5A 4IF4A 2L7MP 2MBFA 5KAIC 4XLFA 3M8JA 3HRTA 5HLIA 5D4RA 2LBFA 5ICGA 2DN0A 2X6WA 3K70D 3F8FA 2R5YB 1QNTA 5IT9K 4BQNA 4A5MA 1MSFC 4QPOA 3OY9A 4C2TA 2BE5F 2Z16A 2OPTA 1EH8A 4OIRF 4O3MA 1DGRM 5IP6A 5DM7F 2IS6A 5B1BH 2ELHA 1N77A 2RC4A 2UUZA 4I01A 2PN6A 3MKLA 3U9GA 3LOCA 2EIMH 3L2QA 2QLZA 2R7WA 2CUEA 2EQRA 3H35A 2XC7A 1ETXA 1XDUA 5BNGA 4D0PA 3GTLJ 2R7ZJ 3BTCA 2HOEA 3DEUA 2ZSHB 2XF6A 1FX7A 4C3IJ 3OIQA 2XHKA 3CCQI 1TLHB 3L2WA 3GZNB 2AXLA 4FISA 4ENMA 2TCTA 1ZHFA 3ZMVA 2L4AA 2Q1ZB 4J00A 1QHGA 4I99C 1VQ6I 2ZXIA 4IHTA 1B72A 1MMDA 3ZMZA 3PFIA 5A2QZ 4CICA 3DTIA 5LLQA 2O61A 2CQNA 1U8BA 3K4MA 1TWHJ 5KVRA 4IHSA 2JSPA 3OYAA 1IN5A 1NH3A 3LSHA 3S1QJ 4MO7A 2L7ZA 2Z9OA 4I0BA 2O6GE 5M3FJ 2BHYA 3ZXSA 1QPIA 2H8RA 3J7AY 4G94A 5J1RA 2M1BA 1MBKA 2M7BA 1R4NB 1D0ZA 1IAWA 1MH3A 2V6EA 3JSOA 1IRXA 1WGXA 3K9TA 2R5ZB 2DOFA 3HTSB 4G9YA 3SDBA 4BKXA 1T0FA 3M3YJ 2FRHA 1JGGA 3H1CA 2IPQX 1EF4A 2ESNA 3KEYA 2V1XA 1IV8A 3FMSA 1XMKA 3HL2A 1XGMA 1AKHB 2LDUA 1KGSA 3KP7A 1HKSA 2PMZN 5C4XJ 1KYZA 4JK1X 5DTDA 2DPDA 1BR1A 1R7JA 1K79A 3LSGA 3ZOBA 3OL3A 2MG4A 4XL9A 1MJBA 4IHWA 2PQ8A 4LG0B 1B1BA 1R36A 2K85A 4JX6A 2D1VA 2PX9A 3L09A 1AWCA 2LG4A 4QIWN 1VQPI 2CG4A 2XSJC 2CW8A 1KYWA 3QYFA 1J9IA 2ZCWA 3VEPA 3C1DA 1OR7C 3ZQLA 1JJ6C 3E6MA 4LB5A 2DT7B 4XRSA 2R7UA 1FYLA 1TTYA 3JREA 1W36D 5EEAA 3K4LA 1NK2P 1J09A 3CJRB 4DYCA 4U87A 4OINF 3AG4H 1BR2A 3TDZC 4HPQA 1U9NA 2FD5A 4GO1A 1PP7U 4B47A 1MNDA 1YFHA 3CUQA 4WK8F 4HQMA 3G1LA 4CCNA 2XF5A 4I6ZA 3DXJF 3K1MA 4M6VA 2HQRA 3PNVA 1VTNC 1XSXA 3OSFA 1JHHA 5A2QK 2FOWA 3HOSA 4CSWA 2HNHA 2HYGD 3DTKA 5EGOB 3LNQA 1LFPA 4ASNA 2HFHA 2X1CA 1ERDA 2AXTC 1MNMC 2L7FP 1KU3A 2L54A 2C6YA 4A3DJ 2KRHA 3HTUA 2JN6A 2J5OA 4UY8I 2IS1A 2G0EA 1BJZA 4BAYA 4U0YA 3HEFA 1PJRA 3HOYJ 2MFZA 2JVHA 3ZQCA 2M8EA 2Y69H 5DDGA 3HB9A 1R58A 4Y15A 3VYSB 1I3QJ 1O7LA 3CF5F 3FXMA 3ROUA 1ZGJA 2KRFA 3DPUA 3SHFA 2EK5A 3TL4X 2XPUA 1ETWA 2K4BA 3MQ0A 3QP6A 2E5ZA 4FHTA 3ERMA 3BZ6A 4OAYA 3KCCA 2EZLA 2DMQA 4KJZA 4BJ5C 4Q47A 1USSA 2KKOA 2XPWA 4UV9A 2LKPA 2XIGA 1Y6IA 2XAJA 1XGNA 4UV8A 1LE8A 2E7XA 2Q2EA 1ODDA 4JX4A 4P9FA 2GIZA 3H36A 1NK3P 1HW1A 3K4BA 2QCOA 1TWFJ 4PK4A 2K9LA 1QHHD 4TV7A 3DFGA 4IEJA 3MKWB 1AA7A 4MNUA 1FIAA 2WB1A 2PMUA 3CC7I 4BJ6C 1V3FA 2M34A 3BR3A 1NG7A 2RREA 4HF0A 4BGDA 2JWTA 2NS7A 2GA1A 3ZQIA 2HXOA 1VQ9I 4JQFA 1MMSA 3KZZA 1JKQC 2B0LA 2ZJQF 3S2DJ 2V9KA 2XKPA 2WAFA 2HVRA 2GA2A 3GUDA 1W4MA 2QQ9A 4LB6B 3V4GA 4BE1A 2TRTA 5E3NA 3DBLB 1ZH5A 3W2AA 2M4GA 5FKLA 4KNYA 3H5RA 3SZTA 1U5TC 5J4VA 1WFXA 3UKGA 1I50J 3KYLA 1HSJA 5CLSA 4YIFA 1Y1WJ 5BPDA 3NEUA 3CO6C 1RUNA 3J7AO 4EJTA 3I58A 4LOCA 4WXDA 4JYKA 2FX0A 4KICA 3ZPLA 3BTLA 3U21A 3QU6A 2D5VA 3S17J 3JAMZ 3LA2A 4DYQA 2BYVE 2ZC2A 2ZFWA 3DPLC 2NVTJ 3OYGA 3M07A 2O9LA 4OMZA 1Z05A 3HOWJ 4A3MJ 2VC1A 2XV4S 1T38A 1DPRA 3BR5A 4MQ9F 4FTHA 3I71A 2VI6A 4HRIA 1FIPA 3VB2A 3LSKA 1OCTC 4FE4A 4CO8A 2L3DA 4PGGA 3SFZA 5D8KB 4BE0A 2CYYA 4L9JA 3RKYA 2DK5A 3EPZA 1IDYA 2ESHA 4E7ZA 1Z9CA 3H5AA 1REPC 1RPWA 1LUJB 2CQ7A 3KP3A 3OYIA 1IO2A 1A6QA 1XC5A 2QENA 3EYYA 4PCQA 4A3IJ 1WJFA 1YE9A 5K7FA 2RGVA 4UVAA 1ETVA 4XLNF 2XASA 4C3JJ 4NDLA 2OTLI 4LD5A 4OOIA 1JUPA 2KT0A 3TBIA 5CQGA 4EATA 4JP0A 4RLQA 3RKXA 4I2OA 2LH9A 4XN0A 1YX5A 1U5TB 3BQZA 3VYRB 3HXLA 1BBYA 5FRNA 2A6EF 3JTGA 5BQTA 3CQZJ 4CHUA 3M8FA 1Z6TA 4ZYHA 4PUSA 3F8NA 2DO7A 4GCVA 4FX0A 1ZQ3P 3L9FA 2JVGA 3WTVC 1MNEA 2OZ6A 1AKHA 2VUMJ 3ZQQA 5DEQA 3CESA 4D5CA 1YJNI 5B66C 3WGIA 4X1EA 4LITA 2X48A 2KPMA 1HKTA 5M5WJ 3B6CA 1ETYA 3AFHA 4XONA 4ANJA 5IOYA 1IN4A 3RI4A 3VYTB 4KITB 5TISC 3IH2A 2MSYA 3FBIB 2JA2A 4ENJA 3DLLF 3F8MA 4DYRA 1SFKA 3DV8A 4HNUA 2IGOA 2PBIA 1QU3A 2O3FA 2HWVA 1KU9A 4FASD 3WTYC 3JAMK 2OC6A 3GXOA 2DBBA 3I64A 3ZGKA 3B73A 5JI6A 3IUOA 3F6VA 4GFBA 3VSLA 2FA5A 1K61A 2O8KA 4Y33A 2WBMA 2BY2A 3HOVJ 1SD5A 3ZR8X 4NQWA 3DQVC 1IF1A 4CA0A 1O57A 1U2WA 3HGGA 3ULQB 1IN7A 2VKDA 1ORKA 3F21A 1ZR4A 1YS6A 2LBFB 4B48A 1Z77A 1TZLA 4MLOA 1D1CA 2KISA 4B43A 2LP0A 5L3DA 3OV8A 2OQGA 5EGOA 1FOKA 4D7NA 2EA4A 4L9VA 2CW0F 3L1PA 5CVJA 3D5SC 5FB2A 2VBXA 1T0FC 4BY1J 4XSZF 1YTYA 3LAPA 1MDMA 3VWBA 3CCMI 4A3KJ 2Z99A 1SD7A 3G2BA 1MZBA 2ZFUA 4R79A 1HBXG 2YS9A 5EZHA 4IHXA 3HHHA 1OFCX 1U9OA 2FQ4A 3G4SI 3UR3C 1MMNA 3IAM2 2EBIA 4AIKA 4E6KG 5M3MJ 5IYCJ 2Z5UA 5D5WB 5L3BA 1FYMA 4FCYA 4LLLA 1F5TA 4D5FA 3V7RA 4NHJA 3LAJA 3LSRA 4G7OF 3TOBA 2RQPA 1DPUA 1XN7A 3FKIJ 4XKCA 4PSWA 1B72B 2V79A 3FXKA 2LRDA 3LFKA 1ZG1A 2GXAA 3AAFA 4M6XA 1S5LC 3GLXA 3S3NA 2W00A 4XK4A 2KIMA 2ZBKA 3E5XA 2CV1A 5DM6F 2HDWA 2X6OA 3CUQC 4I09A 1WJDA 4YELA 3VOEA 1OISA 1TWAJ 2NOGA 4WXHA 4KMFA 3DBHB 2XPVA 4Y7NJ 2QSHX 3A02A 2M0CA 1POGA 2IW5A 2F4IA 2DW4A 1GDTA 4EJWA 2BVLA 3Q9SA 3OYDA 5JVGF 3PIPF 4DIQA 4IO9F 4QPQA 1UB9A 3QPLA 3KETA 2LC2A 3JSPA 1O3TA 3OYBA 3MZHA 2IA1A 1R6RA 5ICFA 3HYIA 4E70A 2LYCA 4A3LJ 3CCJI 1LKXA 4I7HA 2WAEA 1QRYA 3I3LA 2EZIA 3RIRA 2CUFA 2DA6A 4F93B 2DQLA 3KZIC 4E4HA 3WTTC 4PFOA 3OYEA 3MEXA 2WY7Q 4PJMA 4ZYGA 2GWRA 3MWMA 4B4CA 3KFWX 1H88C 2LKSA 1SFXA 2XRNA 2E1CA 1ZGAA 1T56A 4Y3OA 1TT5B 4HV5A 2Y75A 1YLFA 3JR9A 3VDXA 1XCVA 2Y30A 2E1MC 4PFPA 4DNCA 4ZYEA 3AG3H 5LD2C 2EZHA 1JI8A 3HJEA 4E7HA 1KZHA 1X1CA 4U0VA 2H94A 3KIOA 2DFEA 1VQ7I 2NVQJ 1RRJA 2V9VA 1XG1A 3ONQA 4UUSA 3C2BA 3CUQB 2YSRA 2LD5A 1QBJA 4BQAA 2HR3A 2R3SA 4RAGA 2FF4A 4XRMA 1WHUA 3FXLA 3PO3J 5GTIC 2O0YA 3O6BB 1ZYRF 3HHGA 1SEUA 3MZ8A 1JKPC 2F5CA 5IT9Z 4IL6C 1A35A 1T6SA 2O5RA 4RGSA 3HPGA 1IRZA 1P2FA 4KIFA 3J7ZI 3FX3A 2DA2A 4YRVA 5M5YJ 1OMIA 3V8JA 1O3RA 5E79C 5LGNA 2MC3A 2ID6A 3NQOA 2PMHA 2LVSA 3QWLA 3FMRA 1P7IA 1SFUA 3QYEA 3EUHA 4U88A 1R1TA 4ETSA 5B3SH 3OWTA 4YG2F 5LEKA 3E6CC 2W57A 2DOAA 1BC7C 2LF7A 5DYMA 3ZQGA 3O2PE 3ABLH 1FJLA 3LMMA 1IV6A 4FX4A 2GBYA 2VQLA 3IL2A 1S29A 3U1KA 4U7DA 3CCYA 4XORA 4YFXF 2D1HA 4RS8A 3RZDJ 3HSRA 5FJ8J 3DCFA 4IZZA 3M4OJ 2M3AA 4A3EJ 2HZTA 2VBWA 3GTGJ 4HLXA 1XGOA 1JTYA 3H5NA 4A5NA 5HS8A 3IKTA 2K9SA 2YX4A 3RPQA 1F9NA 5ILUA 4HQEA 2Q8KA 4BXUA 1OCPA 3ASNH 3RQ4A 2JA8J 1TQMA 2K4JA 2HYJA 5CJ9A 3CJNA 1LE8B 1S7OA 2Q2EB 2UXNA 4F52A 2KJBA 5F27A 1TWGJ 4AYBN 2A5YB 3QODA 4AVPA 4HW0A 2MC4A 1F4KA 2BY0A 3QYBA 5GADJ 3F3XA 3S14J 3IHUA 2V9PA 2M45A 3TOAA 2YX7A 2F4MB 2UV1A 4G6TB 1YJWI 3T0YA 4P1WA 1P7JA 2BBYA 4PGHA 1JT6A 3ECHA 2VLAA 1SAXA 1J7KA 1F36A 1FP2A 5FO5A 1NHAA 2E19A 3RCOA 1ZRFA 5E17F 3QOEA 1FYKA 3ML6A 1QVUA 3HOXJ 3ZQFA 1QO0D 3F23A 3PSFA 3Q5FA 3HRUA 3FM3A 4A0YA 4E7JA 5D4SA 1SANA 3HDDA 2WWYA 3CF2A 5FLVA 3K4CA 3CP2A 3I56I 1YW8A 2COMA 2ADUA 5DS9A 1V5EA 1ZKGA 2F5DA 3S1NJ 2IA0A 2DXIA 2ZNZA 3RSNA 2PJRA 1DP7P 5CVUA 3EYIA 4A3BJ 4WXCA 2Z1DA 1P4XA 3OIOA 1TNSA 3EQLF 2E2IJ 2ID3A 2JA5J 2NAZA 1FZPB 1UHMA 3C3WA 4AU7A 4RDUA 5CQEA 1DU6A 5LRSA 5GAHJ 2W84A 5BS6A 3JRAA 4X6AJ 3WG7H 4A3JJ 3BT9A 4IRHA 2I5UA 4RLFA 2E1NA 2K40A 2P8TA 5E8IA 4AIJA 4G6DA 1YIOA 3OS1A 3BTJA 4CZZA 3OSGA 3E6DA 1RC9A 3I4MJ 3K7AJ 3WTUC 3TMOA 4LMYA 3F8CA 5FKMA 1N75A 3RPUD 4HA8A 1MMAA 3ESWB 1V5GA 4L5IA 5HODA 3IRQA 3S2HJ 1VQLI 2CFOA 3ABUA 3S3OA 4G8XA 5KCMA 1QGPA 4MTDA 5K7ZA 4BNCA 4DJAA 2DA5A 3I55I 1ULYA 1WQ2A 5GP9A 2P6SA 2A69F 3ECOA 2J5PA 1R5GA 4CUGA 1AHDP 3OOPA 5E3LA 1VQ4I 1RR8C 4AC0A 1V54H 5D6FA 2WAQA 3I0TA 4CYDA 4P9UA 1QPMA 4EEFG 4C2MJ 2CV0A 3R60A 3AG2H 3C2HA 3KLNA 2EFWA 1R71A 1BI3A 5L3EA 4BY7J 3RYPA 3J80Z 3N4MA 2HEOA 2DQRA 1X4OA 1UFMA 5AIPA 3BQYA 2ZNYA 5CYVA 1XSDA 3A4CA 3BP8A 1OCCH 3HBLA 1ZG3A 1MKMA 2A5WA 5F0FA 4K2EA 3BY6A 1Z7LA 5HNHA 4OIOF 4NC7A 5F1JA 3BZKA 5LFAA 2QZ8A 2X1EA 4MFDA 4AIHA 3T8TA 1QVTA 5ILVA 3ELKA 2HKXA 3F6OA 4EQQA 2L4MA 4MHGA 2DA7A 3JW4A 4E7IA 4CDGA 5EEGA 4P5OA 3TW7A 3H3ZA 2G7UA 4EVIA 4L9TA 2NOJB 2Z3YA 4RB3C 3KX2A 4BDYA 4KIGA 4LLNA 2K3FA 4PJJA 4S0HB 3S32A 1Z7UA 2WAQN 5J40A 1T33A 4A6DA 1ZTRA 2MYSA 2FNAA 4XKWA 3M1CA 5E1XA 4R8HA 2WV0A 1R49A 1JTXA 1JKOC 3OS0A 2GXBA 2X1DA 4G7HF 1KONA 3CTAA 5ED4A 1FC3A 2KMUA 3NARA 5DUIA 2Y31A 5ICEA 3C18A 2FXAA 3CCUI 2IVMA 5H20A 3F8BA 2XAFA 4NQWB 3PIOF 2JMWA 4XLAA 4Z2YA 3KPHA 4B8XA 1EH6A 2XRLA 4L0YB 3CJQB 1R9TJ 1MIJA 4C3HJ 3GFJA 2MA3A 4BEHA 2W82A 3MZYA 2FOKA 4JX5A 3HGYA 1WJEA 1ZN2A 1LDJA 2E34A 1IG7A 2HYFA 3BJOA 4HEA2 1W5TA 5LHIA 2FJ1A 3I4PA 1MBFA 3Q9VA 1WH5A 2H8WA 3OYCA 3G1MA 1L3LA 1X1PA 1BC8C 1DQUA 2ELJA 2L0KA 1MDMB 4J19A 2K5CA 4C9YA 4CCLA 1JXSA 4BHPA 4XMYA 5DCFA 1EJ9A 4ESBA 2IT0A 2QA4I 1X3ZB 2LLKA 2R7SA 3R4KA 2AQEA 4NC8A 2I8DA 2LOOA 2FE3A 4KT5C 3BROA 3J80K 1T8IA 3A2KA 4A93J 3JRIA 4WCGA 1WI3A 4RA2A 1LEAA 2XGCA 1DU0A 3FK6A 2VOOA 2NS0A 3I9V2 3D5LA 4F91B 2KDOA 4Y17A 1LEBA 1KQ0A 1RI7A 3G1OA 4I02A 1ZRCA 4QLCU 4HOBA 2OCEA 4G6QA 3VYUB 1WCMJ 3H9QA 3AKZA 3K6GA 5HDGA 5IY5H 3LSJA 4N0BA 2KZGA 2RV8A 2KIQA 3H92A 4YEJA 4IOAF 2E5NA 2O03A 2F6CA 1Y8RB 2XAQA 1CF7B 1E3OC 1S7EA 3RQIA 2CQXA 1PP8F 2Q0OA 3FIWA 2L9RA 2IAIA 3V42A 3SXYA 2Z33A 3E1SA 2KP6A 3E97A 1ZARA 1I6XA 2E1OA 4EJUA 2FMLA 2IEKA 3QPHA 5E8GA 5J8CA 5B5EC 5IOZA 3H0DA 1V55H 2OCCH 3CJTB 5CVIA 1VZ0A 2V7FA 5L3CA 4RAZA 1WJAA 2XAHA 2BXYA 2JK3A 4CCOA 1PUFA 2DMTA 4HX8A 5EDNA 1N25A 3OYHA 4LIUA 2K9MA 3SYTA 3GTPJ 2DFIA 1TT0A 3BDDA 1KA8A 4MTEA 4ENKA 1D3YA 1Y0NA 4BH9A 2DA1A 5E1WA 3TO7A 2XGDA 3A01A 5FFZA 2X51A 3DBRB 4U0WA 1B6AA 1H0MA 4L9NA 1XMAA 3PL8A 2KL4A 2AQFA 1B9NA 1B8IA 5H6QA 4Q4ZF 4BS9A 2E2JJ 3E5QA 5D5VB 3KP5A 1FNNA 1VQKI 3MVPA 4EMSA 2A68F 4XOTA 3JRFA 4FE7A 4BL0B 5FD5A 4BBSJ 2K02A 3V7CA 1HCRA 4RMNA 2EPFA 3H9GA 2FBHA 2WB1N 4A3FJ 2DFFA 4M3GA 4MIMA 2BOLA 4Q48A 3RJPA 2BEOA 4KYWA 2P4WA 4UUSB 2R7DA 1FT9A 1R1UA 2QM3A 2F5VA 3N05A 4RM2A 3MFKA 3GYHX 4R1HA 2UWMA 1T08B 5GTHC 2KFDA 2ZMEA 3FF5A 3FXOA 3PM1A 4RM3A 1I27A 5EF6A 5E3MA 2QKLB 3OL4A 3T5XA 2ZB9A 2R7RA 3TGNA 2E60A 2CUJA 2B63J 2DMPA 1TNTA 2DYRH 4QSHA 2XF7A 2ECCA 3TP0A 2PLYA 2CWEA 2K7LA 5E1ZB 2XVCA 2OF7A 3VPRA 3VFZA 2ECBA 2OBPA 2LR8A 4G7ZF 2CMPA 2L9SA 1FP1D 3S1MJ 4P96A 1QA6A 2CH0A 4XLCA 5ICCA 4LK0F 4HDVA 2CS3A 3H3UA 3NRVA 2DJIA 2X9DA 3LSTA 1K6OA 4C2UA 3HKZA 3P7NA 1D0XA 4MEYF 2B7EA 2XB0X 3R0JA 4ZDLA 3OYNA 2OA4A 2EWNA 2QSFX 4LK1F 1BR4A 5JHUA 2JQ7A 1BOAA 2L5QA 2H09A 3GFIA 2EH3A 1U8RA 1MSEC 4XICA 4M3BA 5FRMA 1MBJA 1I1SA 5LGUA 1I1GA 1Q1VA 3WTXC 3ZRGA 2JUCA 3FHNA 2JUGA 2OUMA 4J01A 3MN2A 1MBEA 1FSHA 2V1UA 2QUFA 3HRSA 4H4KC 4BBRJ 1OYIA 3BOQA 3U2RA 2UXXA 3I54A 5FFXA 2CQKA 3IC7A 2R0QC 3R0AA 5FD6A 4ZZLA 2CQQA 3GTKJ 4YFKF 2LF8A 1Z1DA 4AUXA 1I6HJ 1OLTA 1RKTA 3WTZA 2MH2A 3W6VA 2HI3A 3ZN1A 4OIQF 3B6AA 1ZK8A 3OOUA 1O3QA 1G8XA 4M9XA 1LJ9A 2HGCA 3QQAA 1ZREA 2L02A 3Q0UA 1G3YA 4II3A 3H3VK 2IP2A 2EA2A 4NBQA 1QZYA 1VQOI 3EUKL 3W2WA 2OAZA 3G3ZA 1S9HA 2DJNA 3CMEI 5F0CA 2L01A 1YS7A 3LSMA 4ZTFA 4NNJA 3TQNA 2AHQA 3A0BC 3KEOA 3IAS2 5F08A 2DTRA 3WHCA 4B44A 3LWFA 3BG3A 1QQIA 4ZDPA 2BY1A 5IPAA 1SFOJ 2PJRB 2FQ3A 1IW7F 3A03A 1LFUP 1W7PA 2XAUA 2OD5A 4BDZA 4NC6A 4PJLA 2FU4A 5LHHA 2JRMA 3F0CA 2GLOA 1R5HA 1T2KA 3C2GA 3HPHA 4AIDA 1MGTA 4JBAA 1HDDC 2LKXA 5EYRA 3BWGA 1R22A 1IGNA 2VIXA 3OR1C 2NXNB 2NVXJ 5J1YA 1K4SA 4PSXA 2CO5A 1W0TA 3FM5A 3L2UA 1IUFA 1TWCJ 1WSUA 4AWXB 3L2CA 1W5CC 1PVEA 2NRAC 3G71I 4EM0B 3DU6A 2EFPA 4BQOA 1LVAA 5LRRA 2HQNA 5FKKA 1HC8A 1IZ1A 4B3AA 1EH7A 1G6NA 3PFYA 1CF7A 3PQKA 1XD7A 1Z21A 4L18B 1SFEA 3IH3A 3CMYA 1BW6A 3SDGA 1RR7A 4FT8A 5HLTA 3CMMA 4LJZF 4BQQA 3CMAI 3K4KA 2DODA 2ZO4A 1OR7A 4OU0A 2IGNA 3T8RA 3W6JB 1OCOH 5HVQC 1ZG5A 1GV2A 2MD0A 3D1NI 2ZXWH 2NVUB 1ON2A 3GBGA 1ZAOA 5CVRA 1E2XA 2DCEA 2W1OA 4BYYA 5E3OA 2YU3A 2ME6A 1FBQA 4XLPF 2JSCA 2VONA 2MW8A 2XKOA 3JCUC 4DQ2A 1W7PD 1L0OC 4IKFA 3GF2A 3OYFA 2DLLA 5KNLA 3EDPA 5D5UB 1J59A 1XGSA 3FK7A 1D8KA 1MW7A 3ABKH 2VXDA 3SEZA 4KISA 3CCVI 2VXZA 1ETOA 3KYDB 1H9TA 2LFBA 3WHBA 1AOYA 2P5VA 4ZZDA 1EKEA 2VBZA 3ERED 1Y1VJ 2O7OA 1KU7A 2EILH 1CQTA 1UCRA 2WA0A 1YW7A 2Y48A 4B1RA 1OPCA 4ZH4F 3R61A 5H6RA 3HIFA 4UB8C 3LL7A 4B09A 2MD5A 1HXDA 5HDNA 3CCEI 4MQVA 1IJWC 3BTIA 4CXFA 2LY1A 3MAJA 4WX9A 1Y0UA 4F55A 1HF0A 1GVDA 4XKVA 1GV5A 3BCAA 1ZGWA 4LGWA 3AL0B 1K78A 1E3PA 1T98A 1RZ4A 2EIJH 2P0WA 1BW5A 1KQ9A 3KLOA 2IGMA 3ASOH 3UNGC 4HDUA 1WRJA 1MBGA 2DOEA 2KHMA 4LLGF 3ZN0A 4MFEA 3OYLA 2STWA 1V5FA 1OYWA 1YRNA 2RN7A 1YQAA 4BEHB 5JHFA 2CRGA 2IJLA 2MLGA 4L5JA 2V6CA 3COAC 1FOXA 3BR0A 1U78A 4XN3A 1R23A 3KP6A 1X3UA 2JT1A 4BJTA 3S2WA 3WU0A 1R00A 3SZGA 3JRBA 3K2AA 1Z0XA 3WGGA 3CCRI 2QGUA 4PDKA 3B02A 4XSXF 1K7AA 2VBYA 3QPTA 2Z2SB 4DGWB 3ABTA 5JR3A 5F6FA 4NUBA 4RB0A 3F72A 3FXQA 2DT5A 1JJ8C 1VQ8I 1UG0A 3BR1A 3RTRA 3DKXA 3K4JA 1ZLJA 4LG3A 3HRMA 2M9HA 4II2A 4EJVA 1XCBA 2W7NA 3BLYA 1WH7A 5DD4A 3PUFA 2JPBA 3LQQA 2KIUA 2E7WA 2HS5A 4FQGA 1S72I 1S6LA 4RAFA 4UVCA 2DMUA 3ABMH 2VQHA 2Y9YA 2VKHA 3BG5A 3ZMDA 3DP7A 2VJIA 1YHQI 2AO9A 2DYSH 2K86A 4ZC3A 1U3EM 1OJLA 1FSEA 3H0GJ 4AVZA 1NTCA 3P9KA 4M74A 5K5RA 4RBOA 2TDXA 2A61A 3CZ6A 5E20A 2P5LC 2F48A 4KN7X 1VFCA 5FLXZ 5TRDA 5J4YA 2G7HA 2KJCA 1YI2I 5IYDJ 2WTEA 4HYEA 1SD6A 3WODF 4KA4A 1G3SA 2E71A 1S7AA 1K4TA 4XKBA 4EGZA 1BI2A 4AD9A 1E3HA 2A3SA 2HTJA 2MABA 2WV1A 2D45A 1PUFB 1B9MA 4HG2A 3ISPA 4PJ0C 4HX7A 1GXQA 1DGWY 3V8LA 2E36A 4M9SA 1WWXA 5EZGA 2QYOA 4H0EA 1W0UA 4DBRA 1XTAA 1YJ9I 1YX3A 4OMYA 1LDKB 3EUAA 2X6YA 3A01B 3RYRA 4Y13A 2HVQA 1F43A 2H6BA 4XNFA 1O7FA 4BHBA 4M3FA 1B8IB 1UAAA 1DP3A 1BI1A 4XIDA 1PDNC 3ZMUA 4OWRB 1WKMA 4I76A 1TBXA 5F1RA 4I0AA 2QVOA 2V4JC 3O3KA 2VPRA 5FKNA 3ZP5A 4JOMA 1EA3A 1YO5C 1E17A 2VPLA 3CC2I 1LNWA 4N9HA 3KP4A 5K5QA 3A0HC 1O3SA 2XAGA 2VJ4A 1DDNA 4W1UA 5DCMB 1K6YA 3DWLE 3P5JA 2EFOA 4UNOA 3ZMTA 2EB7A 4GYGA 4P55A 4HLYA 5EG0A 1N78A 2ZSIB 4O5VA 2ZMEB 1SD4A 4A0XA 3LA7A 4ZYAA 5J47A 3TDUC 1OCZH 3PQJA 3LQRA 5CKTA 1LDDA 1UELB 1R5ID 1WJ5A 2CJJA 5CVVA 2HZDA 5HLHA 2XSDC 4ABZA 1BM9A 2HU9A 5FGMA 3JRGA 1U0JA 2MH9A 4XLHA 4E7KA 2K3PA 2PMZA 1I39A 2LSOA 2LY9A 3MCZA 4BHCA 2RAEA 1LB2A 5FLXK 3M9AA 2F5FA 4CH7A 5JLWA 3S1RJ 3GTMJ 5CPRB 2OJED 4BU2A 2R7TA 3GTQJ 2QSGX 2K9NA 2MGQA 4HF1A 3GEZA 2L7KA 3BJAA 2HKOA 3HM5A 2Y9ZA 1GLNA 1GUUA 1OCRH 3AG1H 3W2VA 3OIPA 2STTA 2M5WA 3DKYA 3GO5A 3GZ5A 2GOXB 3L7WA 3TW6A 4DZJA 3IRRA 2N8GA 3JRCA 1G4DA 3X2QH 2QQ8A 1HA8A 1XB4A 2M30A 2ETHA 1IRGA 2RDPA 2IS2A 4A2UA 3P9CA 2Y0MA 1Z67A 3E6BA 4EGYA 1UZCA 3IKVA 4MEXF 2VE8A 3PUBA 4IJAA 2OV7A 1I3AA 3D5RC 3FXRA 2QQAA 3I59A 1B59A 2BW3A 2WC2A 5D6EA 2M87A 1D0YA 2GM4A 2ZJ2A 4UVBA 3HUGA 2OTJI 2EIKH 1Y39A 2FMYA 2OZUA 4A12A 3K1PA 3PSIA 5FROA 3DTEA 3CC4I 4A3GJ 3PJRA 4HSRA 1UMQA 2WADA 1ACIA 1G3WA 1MH4A 3S93A 3CDLA 2R7FA 4M72A 1SVLA 3JRDA 2QBYA 5E18F 2WY8Q 2VN2A 3RZOJ 1MJAA 4D9JA 5BPIA 3F22A 3I4NJ 3L2VA 1I5ZA 4XQFA 5M5XJ 2XGEA 1RKWA 1RNLA 5JVTA 3CLQA 2EV0A 1LFBA 2VQCA 4AM3A 2W24A 3D0SA 1ONVA 2NNNA 3QPSA 3RKWA 1W7PB 2ELKA 1DUXC 5FLMJ 2VJJA 1IC8A 4KDPA 2K9QA 2EFQA 3K10A 2OQRA 1R1VA 2H1LA 2BZTA 2R7OA 4LFUA 5DV5A 2XROA 3OYMA 1JE8A 2JJ7A 2JRTA 5EJCA 3GWZA 4Y4RA 4CCJA 3PNYA 2AS5F 2O8XA 2FBIA 4QWQA 3HC7A 5KHDA 3CLOA 1GHCA 4CCMA 2NNYA 3IWZA 1P6RA 4IQJA 2XUBA 3DEWA 2GIVA 1VF9A 3BC8A 2VE9A 4M3DA 2LK2A 3WE2A 5LHGA 2FEZA 3LA3A 5HS7A 3ZMSA 4BUPA 2LY2A 2EFNA 3WTWC 3L2RA 3S16J 1G2HA 3EETA 1XSVA 1ZELA 2HDCA 4HBLA 3KZYA 4HNVA 3OMYA 2R7QA 1FY7A 1J5YA 3BJ6A 4RAYA 1USTA 1ITYA 3K4NA 4XRSG 4S04A 2E2HJ 1YITI 3HZJA 2NVYJ 2VQGA 1UHWA 3CDHA 1H89C 4CYCB 1D5YA 1H9GA 4O6JA 1WZ2A 2HQ5A 3PNTA 2VT3A 1JHFA 5C3EJ 3FXJA 3O8GA 5C44J 2H6CA 1ETKA 1FEXA 5J1UA 3CUOA 1HLVA 3GFLA 2W85A 4XRFA 2GQQA 1IUYA 1ZLKA 2ZJPF 3NWTA 5TJJA 1FLIA 1XX5A 1R4MB 3EUHC 4XBFA 4XR6A 1A5JA 2HOSA 4IHYA 5C4JJ 5LEJA 1STZA 4CGZA 3LFUA 3FHZA 4GXOA 4KFCA 4DW6A 1J75A 1SMTA 5D5XB 2EINH 1G59A 1KQ8A 1V4RA 3K70C 3N97A 1P92A 1PYVA 1HOMA 1EV7A 2F4OB 2R5YA 3M8EA 4OIPF 3RKQA 1IN8A 3T1BA 1SC7A 1XPXA 2DDBA 3Q0WA 2VKVA 3LSPA 4A69C 3DPTA 5DCMA 4RGXA 4ESFA 1K78B 1NG6A 2HOTA 4IX7A 2CUZA 2H1KA 4V2FA 1BOBA 1BIAA 2PFBA 2HPMA 3SEQA 3DEEA 1P4WA 1W5SA 4RB2C 3MKYB 1D1BA 2CW7A 4ENNA 3DKWA 2FBKA 4IQ4A 1GXPA 5F04A 2NYXA 5GAGJ 1FMWA 3Q3SA 1YRNB 5IYBJ 2L9NA 2QKMB 2V1NA 3JTHA 3VSKA 1SAUA 2NS8A 4I98B 2XDVA 2LMDA 3KE2A 1YW9A 2VKEA 4MGRA 5AIQA 2PJPA 1MD0A 4A0ZA 5DUKA 1MBHA 1Q1HA 1TP4A 3W6KB 3GVAA 4KUMA 3BG7A 4UUTA 1JT0A 4XM3A 1FWZA 4HNTA 4EJOA 2D2WA 1D1AA 1BIBA
chains in the Genus database with same CATH topology
4N9IA 3K0LA 2YR2A 1XDSA 4IVNA 1YG2A 1KU2A 2CSOA 3BPVA 5J8FA 1RIOH 2VC0A 3J81Z 2MLKA 4M6YA 2GAUA 2DPUA 2DAOA 3GZ6A 5K1YA 3I53A 4UXNA 4YFNF 2A07F 2IA2A 3M1EA 4L0ZB 4RB1A 1HSTA 1A04A 2PG4A 2VODA 1J0RA 3QRFF 3QP5A 3VODA 1CGPA 1BI0A 2FSWA 1WI9A 5AONA 1OKRA 2ACJA 2A6HF 2P5KA 3M7GA 3TO6A 1J2XA 5ERIA 1IN6A 5ILSA 1G3TA 2GZWA 4RGRA 3ZQ7A 4LG0A 2X4HA 2CGPA 4EM2A 1F1ZA 1P4AA 3IWFA 3I5UA 3WG9A 3WTSC 3DF8A 5EEHA 1PUEE 1IXCA 2ISYA 3TKYA 1T39A 2FNPA 2DK8A 3REOA 3J81K 2W25A 1C0WA 4F7ZA 2KIFA 2BGCA 1LQ1A 2DI3A 2RKHA 3HSFA 4HX4A 3GX4X 5HLGA 2EV5A 1ZRDA 3FMQA 4UUVA 3V8KA 2ZKZA 2DU9A 2V1DA 3C7JA 1D8JA 1JGSA 2JZYA 1FBUA 3K1NA 3L00A 2IRFG 2YPRA 4RGUA 2P7CB 2JTVA 1MJ9A 2VT2A 1TQPA 4WF2A 2G9WA 2PI0A 5LGTA 3KEQA 1YYVA 4ON0A 2EV6A 2QWWA 4KMUX 5D8LB 2RNJA 6PAXA 1S8NA 1GVJA 4KIBA 2RVCA 3HSEA 4EV0A 4YIIA 5DD8A 3K2ZA 1HW5A 4M73A 3I59B 5BMZA 4HZFA 1BJAA 4ESJA 4GGGA 4NB5A 1RUOA 5L3FA 3WE3A 1OYYA 3U1DA 3SQNA 3E5UA 2PEXA 1S3JA 3GW2A 2K27A 2QBYB 2ISZA 3TO9A 1HQCA 1TQIA 3SZPA 2UZKA 4IPAA 4IXAA 4U7BA 5LBQA 4IRIA 3QAHA 5HDKA 1HW2A 2P7VB 1TW3A 3CO7C 3FZVA 2JPCA 4Q5SF 4M71A 3FXUA 2BV6A 2F2EA 3QOPA 3K69A 3FWEA 5IT3A 5HS9A 3R6SA 2H27A 5K5OA 4EM1A 2HTSA 5BOXA 3BPXA 1U6GA 2VOPA 3QU3A 1FBSA 5L3GA 2QQBA 3KP2A 4UHTA 1QZZA 5J6XA 4ZYDA 4HAMA 3V7SA 1U5TA 2X0LA 1B4AA 3WU1B 3G73A 4IRGA 1SMYF 1D5VA 4PZJA 1IXSB 5KK1A 4GYIA 3HOTA 3E3VA 2ZXJA 4S05A 1ON1A 2EJRA 1IXRC 1TW2A 4HV6A 3RPUA 1FPQA 3P9IA 5HOOA 5JFRA 2F5EA 3RDIA 2P6TA 4M9ZA 1HKQA 3GFMA 4KN4X 2XGXA 2LNBA 1Z91A 4A6EA 1IRFA 2OU2A 1Z6RA 1BN5A 5F64A 3WGHA 2CFXA 4HF2A 2GXGA 4WWCA 4IF4A 2MBFA 5HLIA 5D4RA 3HRTA 5ICGA 3F8FA 1QNTA 5IT9K 4A5MA 2BE5F 1EH8A 4OIRF 4O3MA 2ELHA 2RC4A 4I01A 2PN6A 3U9GA 2QLZA 1XDUA 4D0PA 2HOEA 3DEUA 1FX7A 2XHKA 1TLHB 2AXLA 4ENMA 1ZHFA 3ZMVA 2L4AA 4IHTA 3ZMZA 3PFIA 5A2QZ 4CICA 5LLQA 2O61A 5KVRA 4IHSA 1IN5A 2Z9OA 4I0BA 2O6GE 4G94A 2M1BA 1IAWA 3JSOA 3K9TA 3HTSB 4G9YA 1T0FA 2FRHA 2IPQX 2ESNA 2V1XA 3FMSA 1XMKA 1XGMA 2LDUA 1KGSA 3KP7A 1HKSA 1KYZA 4JK1X 2DPDA 1R7JA 1K79A 1MJBA 2PQ8A 4LG0B 1B1BA 1R36A 2D1VA 3L09A 1AWCA 1J9IA 2CG4A 1KYWA 2ZCWA 3VEPA 3C1DA 3E6MA 4LB5A 1FYLA 1TTYA 4OINF 3TDZC 4GO1A 1PP7U 1YFHA 3CUQA 4WK8F 4HQMA 3DXJF 3K1MA 2HQRA 1VTNC 1XSXA 1JHHA 5A2QK 3HOSA 2HYGD 4ASNA 2HFHA 1KU3A 2L54A 2C6YA 3HTUA 2J5OA 4BAYA 4U0YA 2M8EA 5DDGA 1R58A 4Y15A 1O7LA 3ROUA 1ZGJA 2KRFA 3SHFA 2EK5A 2K4BA 3MQ0A 3QP6A 4FHTA 3BZ6A 3KCCA 4Q47A 1USSA 2KKOA 4UV9A 2LKPA 2XIGA 2XAJA 1XGNA 4UV8A 2E7XA 2Q2EA 1ODDA 4P9FA 1HW1A 4TV7A 3DFGA 4MNUA 2PMUA 1V3FA 4HF0A 2GA1A 4JQFA 3KZZA 2B0LA 2XKPA 2GA2A 3GUDA 1W4MA 2QQ9A 4LB6B 3V4GA 1ZH5A 4KNYA 3SZTA 1U5TC 1HSJA 5CLSA 4YIFA 5BPDA 3NEUA 3CO6C 1RUNA 3J7AO 4EJTA 3I58A 4WXDA 4KICA 3ZPLA 3QU6A 3JAMZ 3LA2A 2BYVE 2ZFWA 3DPLC 4OMZA 1Z05A 2VC1A 2XV4S 1T38A 1DPRA 4MQ9F 3I71A 3VB2A 4CO8A 2L3DA 4PGGA 3SFZA 5D8KB 2CYYA 4L9JA 3RKYA 2DK5A 2ESHA 1Z9CA 1REPC 3KP3A 3EYYA 2QENA 4PCQA 2RGVA 4UVAA 4XLNF 2XASA 4LD5A 4OOIA 3RKXA 4I2OA 1U5TB 1BBYA 2A6EF 3JTGA 5BQTA 4CHUA 3M8FA 1Z6TA 4ZYHA 3F8NA 2DO7A 4GCVA 4FX0A 3L9FA 3WTVC 2OZ6A 5DEQA 3WGIA 1HKTA 1IN4A 3RI4A 4ENJA 3F8MA 3DV8A 2PBIA 2O3FA 2HWVA 1KU9A 3WTYC 3JAMK 3GXOA 2DBBA 3I64A 3B73A 5JI6A 3F6VA 2FA5A 1SD5A 4NQWA 3DQVC 1IF1A 1O57A 1U2WA 3ULQB 1IN7A 3F21A 1YS6A 5L3DA 3OV8A 2OQGA 1FOKA 2EA4A 4L9VA 2CW0F 5CVJA 5FB2A 2VBXA 4XSZF 1YTYA 3LAPA 1MDMA 2Z99A 1SD7A 1MZBA 4R79A 1HBXG 3HHHA 4AIKA 2Z5UA 5D5WB 5L3BA 1FYMA 4LLLA 1F5TA 3V7RA 4NHJA 3LAJA 4G7OF 3TOBA 2RQPA 1DPUA 1XN7A 2V79A 3LFKA 1ZG1A 3AAFA 4M6XA 3GLXA 2KIMA 2ZBKA 3E5XA 3CUQC 4I09A 3VOEA 4WXHA 4KMFA 2IW5A 2DW4A 4EJWA 3Q9SA 1UB9A 3KETA 3JSPA 1O3TA 3MZHA 2IA1A 5ICFA 4E70A 3HYIA 4I7HA 3RIRA 2DQLA 3WTTC 3MEXA 4ZYGA 2GWRA 3MWMA 3KFWX 1SFXA 2XRNA 2E1CA 1ZGAA 4HV5A 2Y75A 1YLFA 1XCVA 4ZYEA 4DNCA 4U0VA 2H94A 2V9VA 3CUQB 2YSRA 1QBJA 4BQAA 2HR3A 2R3SA 2FF4A 2O0YA 3O6BB 1ZYRF 3HHGA 2F5CA 5IT9Z 1T6SA 4RGSA 1P2FA 4KIFA 3FX3A 1OMIA 3V8JA 1O3RA 5LGNA 2MC3A 3NQOA 2PMHA 3FMRA 1SFUA 3EUHA 4U88A 1R1TA 4ETSA 5LEKA 4YG2F 3E6CC 2W57A 1BC7C 2LF7A 5DYMA 3O2PE 4FX4A 3IL2A 1S29A 4U7DA 4YFXF 2D1HA 4RS8A 3HSRA 2HZTA 2VBWA 4HLXA 1XGOA 4A5NA 5HS8A 3IKTA 2YX4A 3RPQA 1F9NA 5ILUA 4HQEA 2Q8KA 4BXUA 1TQMA 2K4JA 5CJ9A 3CJNA 1S7OA 2UXNA 2KJBA 2A5YB 4AVPA 4HW0A 1F4KA 3F3XA 3IHUA 2M45A 3TOAA 2YX7A 3T0YA 2BBYA 4PGHA 3ECHA 1SAXA 1J7KA 1FP2A 5FO5A 1NHAA 5E17F 1ZRFA 1FYKA 3ML6A 1QO0D 3F23A 3Q5FA 3HRUA 3FM3A 4A0YA 5D4SA 2WWYA 1YW8A 2COMA 2ADUA 2F5DA 2IA0A 2ZNZA 1DP7P 5CVUA 3EYIA 4WXCA 1P4XA 1TNSA 3EQLF 2NAZA 1FZPB 1UHMA 3C3WA 5LRSA 2W84A 5BS6A 4IRHA 2E1NA 2P8TA 5E8IA 4AIJA 4G6DA 1YIOA 4CZZA 3E6DA 3WTUC 4LMYA 3F8CA 4HA8A 4L5IA 3IRQA 3ABUA 4G8XA 1QGPA 4MTDA 4BNCA 1ULYA 1WQ2A 2P6SA 2A69F 3ECOA 2J5PA 1R5GA 3OOPA 5D6FA 3I0TA 4CYDA 4P9UA 1QPMA 3R60A 3KLNA 2EFWA 1BI3A 5L3EA 3RYPA 3J80Z 3N4MA 2HEOA 2DQRA 1UFMA 5AIPA 2ZNYA 5CYVA 1XSDA 3BP8A 1ZG3A 1MKMA 4K2EA 3BY6A 4OIOF 2QZ8A 4AIHA 3T8TA 5ILVA 3ELKA 2HKXA 3F6OA 4EQQA 2L4MA 4MHGA 3JW4A 4CDGA 5EEGA 4P5OA 3H3ZA 2G7UA 4EVIA 4L9TA 2Z3YA 4RB3C 4KIGA 4LLNA 1Z7UA 4A6DA 5E1XA 2FNAA 4R8HA 2WV0A 2GXBA 4G7HF 3CTAA 5ED4A 1FC3A 5DUIA 5ICEA 3C18A 2FXAA 2IVMA 5H20A 3F8BA 2XAFA 4Z2YA 4B8XA 1EH6A 4L0YB 3GFJA 2MA3A 3MZYA 2FOKA 1ZN2A 1LDJA 2HYFA 3BJOA 1W5TA 5LHIA 3I4PA 3Q9VA 1L3LA 1BC8C 1MDMB 1JXSA 4BHPA 5DCFA 4ESBA 2IT0A 3R4KA 4KT5C 2FE3A 3J80K 3BROA 4WCGA 1LEAA 2VOOA 2NS0A 3D5LA 4Y17A 1LEBA 1KQ0A 1RI7A 4I02A 1ZRCA 4QLCU 4HOBA 4G6QA 5HDGA 4N0BA 2RV8A 3H92A 2O03A 2XAQA 1CF7B 1PP8F 2Q0OA 3SXYA 2Z33A 3E97A 1ZARA 1I6XA 4EJUA 2FMLA 3QPHA 5E8GA 5J8CA 5CVIA 5L3CA 4RAZA 2XAHA 4HX8A 2DFIA 3BDDA 1KA8A 4MTEA 4ENKA 1D3YA 4BH9A 3TO7A 5E1WA 5FFZA 4U0WA 1B6AA 1H0MA 4L9NA 1XMAA 1B9NA 5H6QA 4Q4ZF 3E5QA 5D5VB 3KP5A 1FNNA 4EMSA 2A68F 5FD5A 2K02A 3V7CA 2FBHA 4Q48A 3RJPA 2BEOA 4KYWA 2P4WA 2R7DA 1FT9A 1R1UA 2QM3A 3MFKA 3GYHX 4R1HA 2UWMA 2ZMEA 3FF5A 1I27A 3T5XA 3TGNA 1TNTA 2PLYA 2CWEA 2K7LA 5E1ZB 2XVCA 3VFZA 2OBPA 4G7ZF 1FP1D 4P96A 5ICCA 4LK0F 4HDVA 3H3UA 3NRVA 3LSTA 1K6OA 4MEYF 3P7NA 3R0JA 2OA4A 2EWNA 4LK1F 5JHUA 1BOAA 2H09A 3GFIA 1U8RA 1I1SA 5LGUA 1I1GA 3WTXC 1FSHA 2V1UA 2QUFA 3HRSA 1OYIA 3BOQA 3U2RA 2UXXA 3I54A 5FFXA 2CQKA 3IC7A 3R0AA 5FD6A 4ZZLA 4YFKF 2LF8A 1Z1DA 3WTZA 2MH2A 3ZN1A 4OIQF 1O3QA 4M9XA 1LJ9A 2HGCA 1ZREA 2L02A 1G3YA 2IP2A 2EA2A 1QZYA 2OAZA 3G3ZA 2L01A 1YS7A 3TQNA 3KEOA 2DTRA 3LWFA 1QQIA 2FQ3A 1IW7F 1W7PA 2OD5A 2FU4A 5LHHA 1R5HA 1T2KA 1MGTA 4JBAA 1R22A 3BWGA 2CO5A 3FM5A 1WSUA 4AWXB 3L2CA 2NRAC 4EM0B 2EFPA 1LVAA 5LRRA 2HQNA 1IZ1A 1EH7A 1G6NA 1CF7A 3PQKA 1XD7A 4L18B 1SFEA 4FT8A 4LJZF 2ZO4A 4OU0A 1OR7A 3T8RA 3W6JB 5HVQC 1ZG5A 1ON2A 1ZAOA 5CVRA 1E2XA 4BYYA 2YU3A 1FBQA 4XLPF 2JSCA 2VONA 2XKOA 4DQ2A 1W7PD 1L0OC 3GF2A 2DLLA 3EDPA 5D5UB 1J59A 1XGSA 1D8KA 2VXZA 1H9TA 1AOYA 2P5VA 4ZZDA 2VBZA 3ERED 1KU7A 1UCRA 2Y48A 1YW7A 4ZH4F 1OPCA 3R61A 5H6RA 3HIFA 4B09A 2MD5A 1HXDA 5HDNA 4MQVA 4CXFA 3MAJA 4WX9A 1Y0UA 4LGWA 1K78A 1T98A 1RZ4A 1KQ9A 3KLOA 4HDUA 1WRJA 4LLGF 3ZN0A 2STWA 1OYWA 2RN7A 1YQAA 2IJLA 2MLGA 4L5JA 2V6CA 3COAC 1U78A 1R23A 3KP6A 1X3UA 2JT1A 3S2WA 3WU0A 1R00A 3WGGA 4PDKA 4XSXF 3B02A 1K7AA 2VBYA 3QPTA 3ABTA 5JR3A 5F6FA 4RB0A 3F72A 3FXQA 2DT5A 3RTRA 1ZLJA 3HRMA 4EJVA 1XCBA 5DD4A 2JPBA 3LQQA 2KIUA 2E7WA 2HS5A 1S6LA 4UVCA 3ZMDA 3DP7A 2K86A 1U3EM 1FSEA 3P9KA 4M74A 5K5RA 2TDXA 2A61A 5E20A 2P5LC 4KN7X 5FLXZ 5TRDA 2G7HA 2KJCA 2WTEA 4HYEA 1SD6A 3WODF 4KA4A 1G3SA 1S7AA 4EGZA 1BI2A 4AD9A 2A3SA 2HTJA 2D45A 1B9MA 3ISPA 4HX7A 1GXQA 3V8LA 4M9SA 1WWXA 2QYOA 4H0EA 4OMYA 1LDKB 3RYRA 4Y13A 2H6BA 1O7FA 4BHBA 1BI1A 1PDNC 3ZMUA 1WKMA 1TBXA 5F1RA 4I0AA 2QVOA 3O3KA 3ZP5A 1YO5C 1E17A 1LNWA 4N9HA 3KP4A 5K5QA 1O3SA 2XAGA 1DDNA 5DCMB 2EFOA 4UNOA 3ZMTA 2EB7A 4GYGA 4P55A 4HLYA 4O5VA 2ZMEB 1SD4A 4A0XA 3LA7A 3TDUC 3PQJA 3LQRA 1LDDA 5CVVA 5HLHA 1BM9A 5FGMA 2MH9A 2LSOA 3MCZA 4BHCA 1LB2A 5FLXK 3M9AA 2F5FA 4HF1A 3GEZA 3BJAA 2HKOA 2STTA 2M5WA 3GO5A 3GZ5A 3L7WA 3IRRA 1G4DA 1XB4A 2M30A 2ETHA 1IRGA 2RDPA 4A2UA 3P9CA 2Y0MA 4EGYA 3E6BA 4MEXF 3IKVA 2VE8A 4IJAA 3FXRA 2QQAA 3I59A 1B59A 2WC2A 5D6EA 2M87A 2ZJ2A 4UVBA 3HUGA 2FMYA 2OZUA 4A12A 3K1PA 1G3WA 2R7FA 4M72A 2QBYA 5E18F 2VN2A 1MJAA 5BPIA 3F22A 1I5ZA 1RNLA 5JVTA 2EV0A 2W24A 3D0SA 1ONVA 2NNNA 3RKWA 1W7PB 1DUXC 4KDPA 2EFQA 2OQRA 1R1VA 1JE8A 5DV5A 4LFUA 2XROA 2JRTA 3GWZA 2AS5F 2O8XA 2FBIA 4QWQA 3CLOA 1GHCA 2NNYA 3IWZA 1P6RA 2XUBA 2GIVA 2VE9A 3WE2A 5LHGA 2FEZA 3LA3A 5HS7A 3ZMSA 2EFNA 3WTWC 3EETA 1XSVA 2HDCA 4HBLA 3KZYA 1FY7A 1J5YA 3BJ6A 4RAYA 1USTA 4S04A 1UHWA 3CDHA 1H9GA 4O6JA 2VT3A 1JHFA 2H6CA 3CUOA 3GFLA 2W85A 4XRFA 2GQQA 1IUYA 1ZLKA 5TJJA 1FLIA 4XBFA 5LEJA 1STZA 4CGZA 3FHZA 4GXOA 4KFCA 1J75A 1SMTA 5D5XB 1KQ8A 1V4RA 3N97A 1P92A 1EV7A 3M8EA 4OIPF 1IN8A 3T1BA 3DPTA 5DCMA 4RGXA 4ESFA 1K78B 1BIAA 2PFBA 1P4WA 1W5SA 4RB2C 4ENNA 3DKWA 2FBKA 1GXPA 2NYXA 3JTHA 4I98B 3KE2A 1YW9A 4MGRA 2PJPA 5AIQA 1MD0A 4A0ZA 5DUKA 1Q1HA 3W6KB 3GVAA 4KUMA 1FWZA 4EJOA 2D2WA 1BIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9I A;  3K0L A;  2YR2 A;  1XDS A;  4IVN A;  1YG2 A;  1KU2 A;  2CSO A;  3BPV A;  5J8F A;  1RIO H;  2VC0 A;  3J81 Z;  2MLK A;  4M6Y A;  2GAU A;  2DPU A;  2DAO A;  3GZ6 A;  5K1Y A;  3I53 A;  4UXN A;  4YFN F;  2A07 F;  2IA2 A;  3M1E A;  4L0Z B;  4RB1 A;  1HST A;  1A04 A;  2PG4 A;  2VOD A;  1J0R A;  3QRF F;  3QP5 A;  3VOD A;  1CGP A;  1BI0 A;  2FSW A;  1WI9 A;  5AON A;  1OKR A;  2ACJ A;  2A6H F;  2P5K A;  3M7G A;  3TO6 A;  1J2X A;  5ERI A;  1IN6 A;  5ILS A;  1G3T A;  2GZW A;  4RGR A;  3ZQ7 A;  4LG0 A;  2X4H A;  2CGP A;  4EM2 A;  1F1Z A;  1P4A A;  3IWF A;  3I5U A;  3WG9 A;  3WTS C;  3DF8 A;  5EEH A;  1PUE E;  1IXC A;  2ISY A;  3TKY A;  1T39 A;  2FNP A;  2DK8 A;  3REO A;  3J81 K;  2W25 A;  1C0W A;  4F7Z A;  2KIF A;  2BGC A;  1LQ1 A;  2DI3 A;  2RKH A;  3HSF A;  4HX4 A;  3GX4 X;  5HLG A;  2EV5 A;  1ZRD A;  3FMQ A;  4UUV A;  3V8K A;  2ZKZ A;  2DU9 A;  2V1D A;  3C7J A;  1D8J A;  1JGS A;  2JZY A;  1FBU A;  3K1N A;  3L00 A;  2IRF G;  2YPR A;  4RGU A;  2P7C B;  2JTV A;  1MJ9 A;  2VT2 A;  1TQP A;  4WF2 A;  2G9W A;  2PI0 A;  5LGT A;  3KEQ A;  1YYV A;  4ON0 A;  2EV6 A;  2QWW A;  4KMU X;  5D8L B;  2RNJ A;  6PAX A;  1S8N A;  1GVJ A;  4KIB A;  2RVC A;  3HSE A;  4EV0 A;  4YII A;  5DD8 A;  3K2Z A;  1HW5 A;  4M73 A;  3I59 B;  5BMZ A;  4HZF A;  1BJA A;  4ESJ A;  4GGG A;  4NB5 A;  1RUO A;  5L3F A;  3WE3 A;  1OYY A;  3U1D A;  3SQN A;  3E5U A;  2PEX A;  1S3J A;  3GW2 A;  2K27 A;  2QBY B;  2ISZ A;  3TO9 A;  1HQC A;  1TQI A;  3SZP A;  2UZK A;  4IPA A;  4IXA A;  4U7B A;  5LBQ A;  4IRI A;  3QAH A;  5HDK A;  1HW2 A;  2P7V B;  1TW3 A;  3CO7 C;  3FZV A;  2JPC A;  4Q5S F;  4M71 A;  3FXU A;  2BV6 A;  2F2E A;  3QOP A;  3K69 A;  3FWE A;  5IT3 A;  5HS9 A;  3R6S A;  2H27 A;  5K5O A;  4EM1 A;  2HTS A;  5BOX A;  3BPX A;  1U6G A;  2VOP A;  3QU3 A;  1FBS A;  5L3G A;  2QQB A;  3KP2 A;  4UHT A;  1QZZ A;  5J6X A;  4ZYD A;  4HAM A;  3V7S A;  1U5T A;  2X0L A;  1B4A A;  3WU1 B;  3G73 A;  4IRG A;  1SMY F;  1D5V A;  4PZJ A;  1IXS B;  5KK1 A;  4GYI A;  3HOT A;  3E3V A;  2ZXJ A;  4S05 A;  1ON1 A;  2EJR A;  1IXR C;  1TW2 A;  4HV6 A;  3RPU A;  1FPQ A;  3P9I A;  5HOO A;  5JFR A;  2F5E A;  3RDI A;  2P6T A;  4M9Z A;  1HKQ A;  3GFM A;  4KN4 X;  2XGX A;  2LNB A;  1Z91 A;  4A6E A;  1IRF A;  2OU2 A;  1Z6R A;  1BN5 A;  5F64 A;  3WGH A;  2CFX A;  4HF2 A;  2GXG A;  4WWC A;  4IF4 A;  2MBF A;  5HLI A;  5D4R A;  3HRT A;  5ICG A;  3F8F A;  1QNT A;  5IT9 K;  4A5M A;  2BE5 F;  1EH8 A;  4OIR F;  4O3M A;  2ELH A;  2RC4 A;  4I01 A;  2PN6 A;  3U9G A;  2QLZ A;  1XDU A;  4D0P A;  2HOE A;  3DEU A;  1FX7 A;  2XHK A;  1TLH B;  2AXL A;  4ENM A;  1ZHF A;  3ZMV A;  2L4A A;  4IHT A;  3ZMZ A;  3PFI A;  5A2Q Z;  4CIC A;  5LLQ A;  2O61 A;  5KVR A;  4IHS A;  1IN5 A;  2Z9O A;  4I0B A;  2O6G E;  4G94 A;  2M1B A;  1IAW A;  3JSO A;  3K9T A;  3HTS B;  4G9Y A;  1T0F A;  2FRH A;  2IPQ X;  2ESN A;  2V1X A;  3FMS A;  1XMK A;  1XGM A;  2LDU A;  1KGS A;  3KP7 A;  1HKS A;  1KYZ A;  4JK1 X;  2DPD A;  1R7J A;  1K79 A;  1MJB A;  2PQ8 A;  4LG0 B;  1B1B A;  1R36 A;  2D1V A;  3L09 A;  1AWC A;  1J9I A;  2CG4 A;  1KYW A;  2ZCW A;  3VEP A;  3C1D A;  3E6M A;  4LB5 A;  1FYL A;  1TTY A;  4OIN F;  3TDZ C;  4GO1 A;  1PP7 U;  1YFH A;  3CUQ A;  4WK8 F;  4HQM A;  3DXJ F;  3K1M A;  2HQR A;  1VTN C;  1XSX A;  1JHH A;  5A2Q K;  3HOS A;  2HYG D;  4ASN A;  2HFH A;  1KU3 A;  2L54 A;  2C6Y A;  3HTU A;  2J5O A;  4BAY A;  4U0Y A;  2M8E A;  5DDG A;  1R58 A;  4Y15 A;  1O7L A;  3ROU A;  1ZGJ A;  2KRF A;  3SHF A;  2EK5 A;  2K4B A;  3MQ0 A;  3QP6 A;  4FHT A;  3BZ6 A;  3KCC A;  4Q47 A;  1USS A;  2KKO A;  4UV9 A;  2LKP A;  2XIG A;  2XAJ A;  1XGN A;  4UV8 A;  2E7X A;  2Q2E A;  1ODD A;  4P9F A;  1HW1 A;  4TV7 A;  3DFG A;  4MNU A;  2PMU A;  1V3F A;  4HF0 A;  2GA1 A;  4JQF A;  3KZZ A;  2B0L A;  2XKP A;  2GA2 A;  3GUD A;  1W4M A;  2QQ9 A;  4LB6 B;  3V4G A;  1ZH5 A;  4KNY A;  3SZT A;  1U5T C;  1HSJ A;  5CLS A;  4YIF A;  5BPD A;  3NEU A;  3CO6 C;  1RUN A;  3J7A O;  4EJT A;  3I58 A;  4WXD A;  4KIC A;  3ZPL A;  3QU6 A;  3JAM Z;  3LA2 A;  2BYV E;  2ZFW A;  3DPL C;  4OMZ A;  1Z05 A;  2VC1 A;  2XV4 S;  1T38 A;  1DPR A;  4MQ9 F;  3I71 A;  3VB2 A;  4CO8 A;  2L3D A;  4PGG A;  3SFZ A;  5D8K B;  2CYY A;  4L9J A;  3RKY A;  2DK5 A;  2ESH A;  1Z9C A;  1REP C;  3KP3 A;  3EYY A;  2QEN A;  4PCQ A;  2RGV A;  4UVA A;  4XLN F;  2XAS A;  4LD5 A;  4OOI A;  3RKX A;  4I2O A;  1U5T B;  1BBY A;  2A6E F;  3JTG A;  5BQT A;  4CHU A;  3M8F A;  1Z6T A;  4ZYH A;  3F8N A;  2DO7 A;  4GCV A;  4FX0 A;  3L9F A;  3WTV C;  2OZ6 A;  5DEQ A;  3WGI A;  1HKT A;  1IN4 A;  3RI4 A;  4ENJ A;  3F8M A;  3DV8 A;  2PBI A;  2O3F A;  2HWV A;  1KU9 A;  3WTY C;  3JAM K;  3GXO A;  2DBB A;  3I64 A;  3B73 A;  5JI6 A;  3F6V A;  2FA5 A;  1SD5 A;  4NQW A;  3DQV C;  1IF1 A;  1O57 A;  1U2W A;  3ULQ B;  1IN7 A;  3F21 A;  1YS6 A;  5L3D A;  3OV8 A;  2OQG A;  1FOK A;  2EA4 A;  4L9V A;  2CW0 F;  5CVJ A;  5FB2 A;  2VBX A;  4XSZ F;  1YTY A;  3LAP A;  1MDM A;  2Z99 A;  1SD7 A;  1MZB A;  4R79 A;  1HBX G;  3HHH A;  4AIK A;  2Z5U A;  5D5W B;  5L3B A;  1FYM A;  4LLL A;  1F5T A;  3V7R A;  4NHJ A;  3LAJ A;  4G7O F;  3TOB A;  2RQP A;  1DPU A;  1XN7 A;  2V79 A;  3LFK A;  1ZG1 A;  3AAF A;  4M6X A;  3GLX A;  2KIM A;  2ZBK A;  3E5X A;  3CUQ C;  4I09 A;  3VOE A;  4WXH A;  4KMF A;  2IW5 A;  2DW4 A;  4EJW A;  3Q9S A;  1UB9 A;  3KET A;  3JSP A;  1O3T A;  3MZH A;  2IA1 A;  5ICF A;  4E70 A;  3HYI A;  4I7H A;  3RIR A;  2DQL A;  3WTT C;  3MEX A;  4ZYG A;  2GWR A;  3MWM A;  3KFW X;  1SFX A;  2XRN A;  2E1C A;  1ZGA A;  4HV5 A;  2Y75 A;  1YLF A;  1XCV A;  4ZYE A;  4DNC A;  4U0V A;  2H94 A;  2V9V A;  3CUQ B;  2YSR A;  1QBJ A;  4BQA A;  2HR3 A;  2R3S A;  2FF4 A;  2O0Y A;  3O6B B;  1ZYR F;  3HHG A;  2F5C A;  5IT9 Z;  1T6S A;  4RGS A;  1P2F A;  4KIF A;  3FX3 A;  1OMI A;  3V8J A;  1O3R A;  5LGN A;  2MC3 A;  3NQO A;  2PMH A;  3FMR A;  1SFU A;  3EUH A;  4U88 A;  1R1T A;  4ETS A;  5LEK A;  4YG2 F;  3E6C C;  2W57 A;  1BC7 C;  2LF7 A;  5DYM A;  3O2P E;  4FX4 A;  3IL2 A;  1S29 A;  4U7D A;  4YFX F;  2D1H A;  4RS8 A;  3HSR A;  2HZT A;  2VBW A;  4HLX A;  1XGO A;  4A5N A;  5HS8 A;  3IKT A;  2YX4 A;  3RPQ A;  1F9N A;  5ILU A;  4HQE A;  2Q8K A;  4BXU A;  1TQM A;  2K4J A;  5CJ9 A;  3CJN A;  1S7O A;  2UXN A;  2KJB A;  2A5Y B;  4AVP A;  4HW0 A;  1F4K A;  3F3X A;  3IHU A;  2M45 A;  3TOA A;  2YX7 A;  3T0Y A;  2BBY A;  4PGH A;  3ECH A;  1SAX A;  1J7K A;  1FP2 A;  5FO5 A;  1NHA A;  5E17 F;  1ZRF A;  1FYK A;  3ML6 A;  1QO0 D;  3F23 A;  3Q5F A;  3HRU A;  3FM3 A;  4A0Y A;  5D4S A;  2WWY A;  1YW8 A;  2COM A;  2ADU A;  2F5D A;  2IA0 A;  2ZNZ A;  1DP7 P;  5CVU A;  3EYI A;  4WXC A;  1P4X A;  1TNS A;  3EQL F;  2NAZ A;  1FZP B;  1UHM A;  3C3W A;  5LRS A;  2W84 A;  5BS6 A;  4IRH A;  2E1N A;  2P8T A;  5E8I A;  4AIJ A;  4G6D A;  1YIO A;  4CZZ A;  3E6D A;  3WTU C;  4LMY A;  3F8C A;  4HA8 A;  4L5I A;  3IRQ A;  3ABU A;  4G8X A;  1QGP A;  4MTD A;  4BNC A;  1ULY A;  1WQ2 A;  2P6S A;  2A69 F;  3ECO A;  2J5P A;  1R5G A;  3OOP A;  5D6F A;  3I0T A;  4CYD A;  4P9U A;  1QPM A;  3R60 A;  3KLN A;  2EFW A;  1BI3 A;  5L3E A;  3RYP A;  3J80 Z;  3N4M A;  2HEO A;  2DQR A;  1UFM A;  5AIP A;  2ZNY A;  5CYV A;  1XSD A;  3BP8 A;  1ZG3 A;  1MKM A;  4K2E A;  3BY6 A;  4OIO F;  2QZ8 A;  4AIH A;  3T8T A;  5ILV A;  3ELK A;  2HKX A;  3F6O A;  4EQQ A;  2L4M A;  4MHG A;  3JW4 A;  4CDG A;  5EEG A;  4P5O A;  3H3Z A;  2G7U A;  4EVI A;  4L9T A;  2Z3Y A;  4RB3 C;  4KIG A;  4LLN A;  1Z7U A;  4A6D A;  5E1X A;  2FNA A;  4R8H A;  2WV0 A;  2GXB A;  4G7H F;  3CTA A;  5ED4 A;  1FC3 A;  5DUI A;  5ICE A;  3C18 A;  2FXA A;  2IVM A;  5H20 A;  3F8B A;  2XAF A;  4Z2Y A;  4B8X A;  1EH6 A;  4L0Y B;  3GFJ A;  2MA3 A;  3MZY A;  2FOK A;  1ZN2 A;  1LDJ A;  2HYF A;  3BJO A;  1W5T A;  5LHI A;  3I4P A;  3Q9V A;  1L3L A;  1BC8 C;  1MDM B;  1JXS A;  4BHP A;  5DCF A;  4ESB A;  2IT0 A;  3R4K A;  4KT5 C;  2FE3 A;  3J80 K;  3BRO A;  4WCG A;  1LEA A;  2VOO A;  2NS0 A;  3D5L A;  4Y17 A;  1LEB A;  1KQ0 A;  1RI7 A;  4I02 A;  1ZRC A;  4QLC U;  4HOB A;  4G6Q A;  5HDG A;  4N0B A;  2RV8 A;  3H92 A;  2O03 A;  2XAQ A;  1CF7 B;  1PP8 F;  2Q0O A;  3SXY A;  2Z33 A;  3E97 A;  1ZAR A;  1I6X A;  4EJU A;  2FML A;  3QPH A;  5E8G A;  5J8C A;  5CVI A;  5L3C A;  4RAZ A;  2XAH A;  4HX8 A;  2DFI A;  3BDD A;  1KA8 A;  4MTE A;  4ENK A;  1D3Y A;  4BH9 A;  3TO7 A;  5E1W A;  5FFZ A;  4U0W A;  1B6A A;  1H0M A;  4L9N A;  1XMA A;  1B9N A;  5H6Q A;  4Q4Z F;  3E5Q A;  5D5V B;  3KP5 A;  1FNN A;  4EMS A;  2A68 F;  5FD5 A;  2K02 A;  3V7C A;  2FBH A;  4Q48 A;  3RJP A;  2BEO A;  4KYW A;  2P4W A;  2R7D A;  1FT9 A;  1R1U A;  2QM3 A;  3MFK A;  3GYH X;  4R1H A;  2UWM A;  2ZME A;  3FF5 A;  1I27 A;  3T5X A;  3TGN A;  1TNT A;  2PLY A;  2CWE A;  2K7L A;  5E1Z B;  2XVC A;  3VFZ A;  2OBP A;  4G7Z F;  1FP1 D;  4P96 A;  5ICC A;  4LK0 F;  4HDV A;  3H3U A;  3NRV A;  3LST A;  1K6O A;  4MEY F;  3P7N A;  3R0J A;  2OA4 A;  2EWN A;  4LK1 F;  5JHU A;  1BOA A;  2H09 A;  3GFI A;  1U8R A;  1I1S A;  5LGU A;  1I1G A;  3WTX C;  1FSH A;  2V1U A;  2QUF A;  3HRS A;  1OYI A;  3BOQ A;  3U2R A;  2UXX A;  3I54 A;  5FFX A;  2CQK A;  3IC7 A;  3R0A A;  5FD6 A;  4ZZL A;  4YFK F;  2LF8 A;  1Z1D A;  3WTZ A;  2MH2 A;  3ZN1 A;  4OIQ F;  1O3Q A;  4M9X A;  1LJ9 A;  2HGC A;  1ZRE A;  2L02 A;  1G3Y A;  2IP2 A;  2EA2 A;  1QZY A;  2OAZ A;  3G3Z A;  2L01 A;  1YS7 A;  3TQN A;  3KEO A;  2DTR A;  3LWF A;  1QQI A;  2FQ3 A;  1IW7 F;  1W7P A;  2OD5 A;  2FU4 A;  5LHH A;  1R5H A;  1T2K A;  1MGT A;  4JBA A;  1R22 A;  3BWG A;  2CO5 A;  3FM5 A;  1WSU A;  4AWX B;  3L2C A;  2NRA C;  4EM0 B;  2EFP A;  1LVA A;  5LRR A;  2HQN A;  1IZ1 A;  1EH7 A;  1G6N A;  1CF7 A;  3PQK A;  1XD7 A;  4L18 B;  1SFE A;  4FT8 A;  4LJZ F;  2ZO4 A;  4OU0 A;  1OR7 A;  3T8R A;  3W6J B;  5HVQ C;  1ZG5 A;  1ON2 A;  1ZAO A;  5CVR A;  1E2X A;  4BYY A;  2YU3 A;  1FBQ A;  4XLP F;  2JSC A;  2VON A;  2XKO A;  4DQ2 A;  1W7P D;  1L0O C;  3GF2 A;  2DLL A;  3EDP A;  5D5U B;  1J59 A;  1XGS A;  1D8K A;  2VXZ A;  1H9T A;  1AOY A;  2P5V A;  4ZZD A;  2VBZ A;  3ERE D;  1KU7 A;  1UCR A;  2Y48 A;  1YW7 A;  4ZH4 F;  1OPC A;  3R61 A;  5H6R A;  3HIF A;  4B09 A;  2MD5 A;  1HXD A;  5HDN A;  4MQV A;  4CXF A;  3MAJ A;  4WX9 A;  1Y0U A;  4LGW A;  1K78 A;  1T98 A;  1RZ4 A;  1KQ9 A;  3KLO A;  4HDU A;  1WRJ A;  4LLG F;  3ZN0 A;  2STW A;  1OYW A;  2RN7 A;  1YQA A;  2IJL A;  2MLG A;  4L5J A;  2V6C A;  3COA C;  1U78 A;  1R23 A;  3KP6 A;  1X3U A;  2JT1 A;  3S2W A;  3WU0 A;  1R00 A;  3WGG A;  4PDK A;  4XSX F;  3B02 A;  1K7A A;  2VBY A;  3QPT A;  3ABT A;  5JR3 A;  5F6F A;  4RB0 A;  3F72 A;  3FXQ A;  2DT5 A;  3RTR A;  1ZLJ A;  3HRM A;  4EJV A;  1XCB A;  5DD4 A;  2JPB A;  3LQQ A;  2KIU A;  2E7W A;  2HS5 A;  1S6L A;  4UVC A;  3ZMD A;  3DP7 A;  2K86 A;  1U3E M;  1FSE A;  3P9K A;  4M74 A;  5K5R A;  2TDX A;  2A61 A;  5E20 A;  2P5L C;  4KN7 X;  5FLX Z;  5TRD A;  2G7H A;  2KJC A;  2WTE A;  4HYE A;  1SD6 A;  3WOD F;  4KA4 A;  1G3S A;  1S7A A;  4EGZ A;  1BI2 A;  4AD9 A;  2A3S A;  2HTJ A;  2D45 A;  1B9M A;  3ISP A;  4HX7 A;  1GXQ A;  3V8L A;  4M9S A;  1WWX A;  2QYO A;  4H0E A;  4OMY A;  1LDK B;  3RYR A;  4Y13 A;  2H6B A;  1O7F A;  4BHB A;  1BI1 A;  1PDN C;  3ZMU A;  1WKM A;  1TBX A;  5F1R A;  4I0A A;  2QVO A;  3O3K A;  3ZP5 A;  1YO5 C;  1E17 A;  1LNW A;  4N9H A;  3KP4 A;  5K5Q A;  1O3S A;  2XAG A;  1DDN A;  5DCM B;  2EFO A;  4UNO A;  3ZMT A;  2EB7 A;  4GYG A;  4P55 A;  4HLY A;  4O5V A;  2ZME B;  1SD4 A;  4A0X A;  3LA7 A;  3TDU C;  3PQJ A;  3LQR A;  1LDD A;  5CVV A;  5HLH A;  1BM9 A;  5FGM A;  2MH9 A;  2LSO A;  3MCZ A;  4BHC A;  1LB2 A;  5FLX K;  3M9A A;  2F5F A;  4HF1 A;  3GEZ A;  3BJA A;  2HKO A;  2STT A;  2M5W A;  3GO5 A;  3GZ5 A;  3L7W A;  3IRR A;  1G4D A;  1XB4 A;  2M30 A;  2ETH A;  1IRG A;  2RDP A;  4A2U A;  3P9C A;  2Y0M A;  4EGY A;  3E6B A;  4MEX F;  3IKV A;  2VE8 A;  4IJA A;  3FXR A;  2QQA A;  3I59 A;  1B59 A;  2WC2 A;  5D6E A;  2M87 A;  2ZJ2 A;  4UVB A;  3HUG A;  2FMY A;  2OZU A;  4A12 A;  3K1P A;  1G3W A;  2R7F A;  4M72 A;  2QBY A;  5E18 F;  2VN2 A;  1MJA A;  5BPI A;  3F22 A;  1I5Z A;  1RNL A;  5JVT A;  2EV0 A;  2W24 A;  3D0S A;  1ONV A;  2NNN A;  3RKW A;  1W7P B;  1DUX C;  4KDP A;  2EFQ A;  2OQR A;  1R1V A;  1JE8 A;  5DV5 A;  4LFU A;  2XRO A;  2JRT A;  3GWZ A;  2AS5 F;  2O8X A;  2FBI A;  4QWQ A;  3CLO A;  1GHC A;  2NNY A;  3IWZ A;  1P6R A;  2XUB A;  2GIV A;  2VE9 A;  3WE2 A;  5LHG A;  2FEZ A;  3LA3 A;  5HS7 A;  3ZMS A;  2EFN A;  3WTW C;  3EET A;  1XSV A;  2HDC A;  4HBL A;  3KZY A;  1FY7 A;  1J5Y A;  3BJ6 A;  4RAY A;  1UST A;  4S04 A;  1UHW A;  3CDH A;  1H9G A;  4O6J A;  2VT3 A;  1JHF A;  2H6C A;  3CUO A;  3GFL A;  2W85 A;  4XRF A;  2GQQ A;  1IUY A;  1ZLK A;  5TJJ A;  1FLI A;  4XBF A;  5LEJ A;  1STZ A;  4CGZ A;  3FHZ A;  4GXO A;  4KFC A;  1J75 A;  1SMT A;  5D5X B;  1KQ8 A;  1V4R A;  3N97 A;  1P92 A;  1EV7 A;  3M8E A;  4OIP F;  1IN8 A;  3T1B A;  3DPT A;  5DCM A;  4RGX A;  4ESF A;  1K78 B;  1BIA A;  2PFB A;  1P4W A;  1W5S A;  4RB2 C;  4ENN A;  3DKW A;  2FBK A;  1GXP A;  2NYX A;  3JTH A;  4I98 B;  3KE2 A;  1YW9 A;  4MGR A;  2PJP A;  5AIQ A;  1MD0 A;  4A0Z A;  5DUK A;  1Q1H A;  3W6K B;  3GVA A;  4KUM A;  1FWZ A;  4EJO A;  2D2W A;  1BIB A; 
#chains in the Genus database with same CATH topology
 1XMX A;  4N9I A;  3K0L A;  3GCM A;  2X6X A;  3ZCO A;  1QZE A;  2YR2 A;  1XDS A;  4IVN A;  1YG2 A;  4XOP A;  2I10 A;  3CP8 A;  1KU2 A;  2JA7 J;  2CSO A;  2RNG A;  3BPV A;  5J8F A;  1RIO H;  3CD6 I;  2EZK A;  1ENH A;  2VC0 A;  4DZP A;  3J81 Z;  2R4G A;  2MLK A;  4M6Y A;  3S15 J;  2R7V A;  2GAU A;  2L9V A;  2DPU A;  2DAO A;  3GZ6 A;  3IP4 B;  2KLO A;  5H2F C;  4BAC A;  2A05 A;  5IP7 J;  3I53 A;  5K1Y A;  4UXN A;  4YFN F;  2A07 F;  1AU7 A;  1Y8Q B;  3PO2 J;  2IA2 A;  4DBQ A;  3M1E A;  4L0Z B;  5K7H A;  4RB1 A;  1HST A;  1A04 A;  1Y56 A;  2PG4 A;  2VOD A;  4CCK A;  1J0R A;  4F92 B;  2M2E A;  1YOV B;  1WPK A;  3QRF F;  3QP5 A;  3VOD A;  3HOZ J;  3SJM A;  3Q0V A;  2R5Z A;  1CGP A;  1BI0 A;  2ICW G;  2FSW A;  3MKZ A;  3OR2 C;  1WI9 A;  5AON A;  2FUG 2;  1OKR A;  4B3X A;  1X2M A;  4GDF A;  3CCL I;  2ACJ A;  2A6H F;  1YIJ I;  1Z3X A;  2P5K A;  1A36 A;  3M7G A;  3TO6 A;  4Y52 J;  1J2X A;  2Y0S A;  4ITV A;  4V2G A;  5ERI A;  3BR2 A;  1IN6 A;  5ILS A;  1G3T A;  4PJN A;  1RES A;  3F9K A;  4E7S A;  3IV5 A;  2GZW A;  2VB6 A;  4RGR A;  3HKZ N;  3ZQ7 A;  4LG0 A;  2VAS A;  3NWS A;  2X4H A;  3NAU A;  2CGP A;  3E7L A;  4EM2 A;  1F1Z A;  2HQA A;  4L5E A;  1W36 C;  3IH4 A;  1P4A A;  2Y2Z A;  3IWF A;  2GOM A;  1P9Q C;  4IHV A;  5J3L A;  4DOZ A;  3I5U A;  2DDA A;  5B1A H;  3FDY A;  3CDI A;  3WG9 A;  5KAF C;  3WTS C;  3DF8 A;  2IGK A;  2HPI A;  3DU5 A;  1FOY A;  2BVM A;  9ANT A;  5EEH A;  1PUE E;  1IXC A;  2ISY A;  3TKY A;  3JRH A;  3OS2 A;  3FKJ A;  1T39 A;  4A3C J;  2HOA A;  4QTR A;  4IOC F;  4Z6Y A;  2FNP A;  2DK8 A;  3REO A;  3J81 K;  2W25 A;  2Y0S N;  3MD2 A;  4M3E A;  1C0W A;  2B9S A;  4F7Z A;  2CU7 A;  1RET A;  2KIF A;  4V19 K;  2BGC A;  1LQ1 A;  1WVR A;  1JUM A;  2DI3 A;  2IXS A;  3MMY B;  5EG0 B;  4GRI A;  1VI0 A;  2RKH A;  1H8A C;  1FTT A;  1X3W B;  3HSF A;  3OYK A;  5JLX A;  4HX4 A;  3HG9 A;  3GX4 X;  5HLG A;  2EV5 A;  1ZRD A;  1VQN I;  4UB6 C;  2M0M A;  3FMQ A;  2BY3 A;  3AL0 C;  4BXF A;  1XS9 A;  4UUV A;  3V8K A;  2ZKZ A;  4CZC A;  5GPC A;  1VQM I;  2DU9 A;  4G12 A;  2V1D A;  2DT6 A;  3C7J A;  1D8J A;  1X58 A;  3S3M A;  2COB A;  1JGS A;  2JZY A;  2LRE A;  1FTZ A;  1FBU A;  3J7Y J;  1MMG A;  3K1N A;  2QF7 A;  2KQR A;  5GAE J;  1UJ8 A;  3L00 A;  2IRF G;  2YUS A;  4CYC A;  4ZTJ A;  1IDZ A;  1ETQ A;  1T95 A;  2KZV A;  2YPR A;  4RGU A;  1X1D A;  3TED A;  2P7C B;  1X2N A;  1MJ9 A;  2JTV A;  2VT2 A;  1W1W E;  1GT0 C;  3FBN B;  1TQP A;  4WF2 A;  2G9W A;  2KRC A;  2DMN A;  2PI0 A;  3GTO J;  4ZJZ A;  2X85 A;  5LGT A;  3KEQ A;  3G6E I;  1YYV A;  2W4S A;  4ON0 A;  2EV6 A;  2QWW A;  4KMU X;  4C30 A;  5D8L B;  2RNJ A;  6PAX A;  1S8N A;  1GVJ A;  4KIB A;  2CV2 A;  2IS4 A;  2HVS A;  2RVC A;  2M8G X;  1X1A A;  5IP9 J;  1JUS A;  3HSE A;  1A6I A;  4OAZ A;  2VL8 A;  4EV0 A;  2IBD A;  4YII A;  5DD8 A;  3BG9 A;  1HW5 A;  3K2Z A;  4M73 A;  3I59 B;  1Z3Y A;  5GPA A;  2BW3 B;  1BL0 A;  1UHS A;  5BMZ A;  3GLL A;  2A6T A;  4HZF A;  1BJA A;  4ESJ A;  4GGG A;  1K83 J;  4NB5 A;  1FOW A;  1TC3 C;  2BHZ A;  3HUG B;  2DA3 A;  3TP3 A;  1RUO A;  4D7M A;  2M4K A;  5L3F A;  3WE3 A;  1OYY A;  4N4N B;  2RQQ A;  4LIV A;  3E5U A;  3SQN A;  3U1D A;  1LPQ A;  2PEX A;  5FKO A;  1S3J A;  2R7X A;  3GW2 A;  1SVM A;  3KYC B;  2K27 A;  3CCS I;  2QBY B;  3H9J A;  2ISZ A;  3TO9 A;  1ZR2 A;  3O8H A;  2KDZ A;  1WJC A;  1HQC A;  1TQI A;  1VND A;  3SZP A;  1X19 A;  4E7L A;  2UZK A;  4IPA A;  4XLE A;  4IXA A;  4U7B A;  5LBQ A;  4IRI A;  3QAH A;  1OQY A;  5HDK A;  2P81 A;  1HW2 A;  2P7V B;  3FIS A;  4W97 A;  1TW3 A;  3CO7 C;  3FZV A;  2JPC A;  3DLA A;  3S8P A;  4Q5S F;  3BCB A;  4M71 A;  5HNF A;  3FXU A;  2ZJR F;  2BV6 A;  2F2E A;  3QOP A;  3K69 A;  1JKR C;  3FWE A;  5IT3 A;  1APL C;  3BG6 A;  3LSI A;  5HS9 A;  4FET A;  3R6S A;  5TGT A;  2H27 A;  2ZXH A;  3W3C A;  5K5O A;  4EM1 A;  2HTS A;  5BOX A;  1E0E A;  2HXI A;  3BPX A;  1U6G A;  2VOP A;  3QU3 A;  1FBS A;  4HST A;  5L3G A;  2QQB A;  4AYB A;  2R93 J;  4ZDO A;  4BE2 A;  3KP2 A;  4UHT A;  1QZZ A;  3WU2 C;  5J6X A;  4ZYD A;  4HAM A;  2DA4 A;  3BZC A;  3V7S A;  2DTZ A;  1HDP A;  4KT6 A;  1U5T A;  2X0L A;  1B4A A;  1VQ5 I;  2HDD A;  3WU1 B;  1A31 A;  3G73 A;  4IRG A;  2YU9 J;  1SMY F;  3E0J B;  1D5V A;  2XB5 A;  2ZME C;  2M7A A;  2W48 A;  1TL8 A;  2LTP A;  4PZJ A;  1X1B A;  2E1M B;  1IXS B;  5KK1 A;  1SVO A;  4GYI A;  4D1Q A;  1UG2 A;  3GTJ J;  3HOT A;  3E3V A;  3ZQH A;  2ZXJ A;  4S05 A;  1M1E B;  1ON1 A;  3OYJ A;  2EJR A;  2E35 A;  3SFI A;  1IXR C;  3BR6 A;  2DFH A;  1TW2 A;  4HV6 A;  3RPU A;  3GME A;  1WJB A;  1FPQ A;  4X0G A;  3P9I A;  5HOO A;  4N4O B;  5F0H A;  1BA5 A;  1FMV A;  2V26 A;  4BXX J;  2L2O A;  4YIR X;  1O4X A;  5JFR A;  2F5E A;  3RDI A;  2JA6 J;  2P6T A;  3A1Y A;  4M9Z A;  1HKQ A;  1X4P A;  3GFM A;  4KN4 X;  2QEX I;  2XGX A;  2LNB A;  1Z91 A;  2BXZ A;  4A6E A;  2R92 J;  1IRF A;  3HOU J;  2OU2 A;  1Z6R A;  1BN5 A;  5F64 A;  2ME0 A;  1LVK A;  3WGH A;  2CFX A;  4F3Q A;  4HF2 A;  2GXG A;  4WWC A;  2VJ5 A;  4IF4 A;  2L7M P;  2MBF A;  5KAI C;  4XLF A;  3M8J A;  3HRT A;  5HLI A;  5D4R A;  2LBF A;  5ICG A;  2DN0 A;  2X6W A;  3K70 D;  3F8F A;  2R5Y B;  1QNT A;  5IT9 K;  4BQN A;  4A5M A;  1MSF C;  4QPO A;  3OY9 A;  4C2T A;  2BE5 F;  2Z16 A;  2OPT A;  1EH8 A;  4OIR F;  4O3M A;  1DGR M;  5IP6 A;  5DM7 F;  2IS6 A;  5B1B H;  2ELH A;  1N77 A;  2RC4 A;  2UUZ A;  4I01 A;  2PN6 A;  3MKL A;  3U9G A;  3LOC A;  2EIM H;  3L2Q A;  2QLZ A;  2R7W A;  2CUE A;  2EQR A;  3H35 A;  2XC7 A;  1ETX A;  1XDU A;  5BNG A;  4D0P A;  3GTL J;  2R7Z J;  3BTC A;  2HOE A;  3DEU A;  2ZSH B;  2XF6 A;  1FX7 A;  4C3I J;  3OIQ A;  2XHK A;  3CCQ I;  1TLH B;  3L2W A;  3GZN B;  2AXL A;  4FIS A;  4ENM A;  2TCT A;  1ZHF A;  3ZMV A;  2L4A A;  2Q1Z B;  4J00 A;  1QHG A;  4I99 C;  1VQ6 I;  2ZXI A;  4IHT A;  1B72 A;  1MMD A;  3ZMZ A;  3PFI A;  5A2Q Z;  4CIC A;  3DTI A;  5LLQ A;  2O61 A;  2CQN A;  1U8B A;  3K4M A;  1TWH J;  5KVR A;  4IHS A;  2JSP A;  3OYA A;  1IN5 A;  1NH3 A;  3LSH A;  3S1Q J;  4MO7 A;  2L7Z A;  2Z9O A;  4I0B A;  2O6G E;  5M3F J;  2BHY A;  3ZXS A;  1QPI A;  2H8R A;  3J7A Y;  4G94 A;  5J1R A;  2M1B A;  1MBK A;  2M7B A;  1R4N B;  1D0Z A;  1IAW A;  1MH3 A;  2V6E A;  3JSO A;  1IRX A;  1WGX A;  3K9T A;  2R5Z B;  2DOF A;  3HTS B;  4G9Y A;  3SDB A;  4BKX A;  1T0F A;  3M3Y J;  2FRH A;  1JGG A;  3H1C A;  2IPQ X;  1EF4 A;  2ESN A;  3KEY A;  2V1X A;  1IV8 A;  3FMS A;  1XMK A;  3HL2 A;  1XGM A;  1AKH B;  2LDU A;  1KGS A;  3KP7 A;  1HKS A;  2PMZ N;  5C4X J;  1KYZ A;  4JK1 X;  5DTD A;  2DPD A;  1BR1 A;  1R7J A;  1K79 A;  3LSG A;  3ZOB A;  3OL3 A;  2MG4 A;  4XL9 A;  1MJB A;  4IHW A;  2PQ8 A;  4LG0 B;  1B1B A;  1R36 A;  2K85 A;  4JX6 A;  2D1V A;  2PX9 A;  3L09 A;  1AWC A;  2LG4 A;  4QIW N;  1VQP I;  2CG4 A;  2XSJ C;  2CW8 A;  1KYW A;  3QYF A;  1J9I A;  2ZCW A;  3VEP A;  3C1D A;  1OR7 C;  3ZQL A;  1JJ6 C;  3E6M A;  4LB5 A;  2DT7 B;  4XRS A;  2R7U A;  1FYL A;  1TTY A;  3JRE A;  1W36 D;  5EEA A;  3K4L A;  1NK2 P;  1J09 A;  3CJR B;  4DYC A;  4U87 A;  4OIN F;  3AG4 H;  1BR2 A;  3TDZ C;  4HPQ A;  1U9N A;  2FD5 A;  4GO1 A;  1PP7 U;  4B47 A;  1MND A;  1YFH A;  3CUQ A;  4WK8 F;  4HQM A;  3G1L A;  4CCN A;  2XF5 A;  4I6Z A;  3DXJ F;  3K1M A;  4M6V A;  2HQR A;  3PNV A;  1VTN C;  1XSX A;  3OSF A;  1JHH A;  5A2Q K;  2FOW A;  3HOS A;  4CSW A;  2HNH A;  2HYG D;  3DTK A;  5EGO B;  3LNQ A;  1LFP A;  4ASN A;  2HFH A;  2X1C A;  1ERD A;  2AXT C;  1MNM C;  2L7F P;  1KU3 A;  2L54 A;  2C6Y A;  4A3D J;  2KRH A;  3HTU A;  2JN6 A;  2J5O A;  4UY8 I;  2IS1 A;  2G0E A;  1BJZ A;  4BAY A;  4U0Y A;  3HEF A;  1PJR A;  3HOY J;  2MFZ A;  2JVH A;  3ZQC A;  2M8E A;  2Y69 H;  5DDG A;  3HB9 A;  1R58 A;  4Y15 A;  3VYS B;  1I3Q J;  1O7L A;  3CF5 F;  3FXM A;  3ROU A;  1ZGJ A;  2KRF A;  3DPU A;  3SHF A;  2EK5 A;  3TL4 X;  2XPU A;  1ETW A;  2K4B A;  3MQ0 A;  3QP6 A;  2E5Z A;  4FHT A;  3ERM A;  3BZ6 A;  4OAY A;  3KCC A;  2EZL A;  2DMQ A;  4KJZ A;  4BJ5 C;  4Q47 A;  1USS A;  2KKO A;  2XPW A;  4UV9 A;  2LKP A;  2XIG A;  1Y6I A;  2XAJ A;  1XGN A;  4UV8 A;  1LE8 A;  2E7X A;  2Q2E A;  1ODD A;  4JX4 A;  4P9F A;  2GIZ A;  3H36 A;  1NK3 P;  1HW1 A;  3K4B A;  2QCO A;  1TWF J;  4PK4 A;  2K9L A;  1QHH D;  4TV7 A;  3DFG A;  4IEJ A;  3MKW B;  1AA7 A;  4MNU A;  1FIA A;  2WB1 A;  2PMU A;  3CC7 I;  4BJ6 C;  1V3F A;  2M34 A;  3BR3 A;  1NG7 A;  2RRE A;  4HF0 A;  4BGD A;  2JWT A;  2NS7 A;  2GA1 A;  3ZQI A;  2HXO A;  1VQ9 I;  4JQF A;  1MMS A;  3KZZ A;  1JKQ C;  2B0L A;  2ZJQ F;  3S2D J;  2V9K A;  2XKP A;  2WAF A;  2HVR A;  2GA2 A;  3GUD A;  1W4M A;  2QQ9 A;  4LB6 B;  3V4G A;  4BE1 A;  2TRT A;  5E3N A;  3DBL B;  1ZH5 A;  3W2A A;  2M4G A;  5FKL A;  4KNY A;  3H5R A;  3SZT A;  1U5T C;  5J4V A;  1WFX A;  3UKG A;  1I50 J;  3KYL A;  1HSJ A;  5CLS A;  4YIF A;  1Y1W J;  5BPD A;  3NEU A;  3CO6 C;  1RUN A;  3J7A O;  4EJT A;  3I58 A;  4LOC A;  4WXD A;  4JYK A;  2FX0 A;  4KIC A;  3ZPL A;  3BTL A;  3U21 A;  3QU6 A;  2D5V A;  3S17 J;  3JAM Z;  3LA2 A;  4DYQ A;  2BYV E;  2ZC2 A;  2ZFW A;  3DPL C;  2NVT J;  3OYG A;  3M07 A;  2O9L A;  4OMZ A;  1Z05 A;  3HOW J;  4A3M J;  2VC1 A;  2XV4 S;  1T38 A;  1DPR A;  3BR5 A;  4MQ9 F;  4FTH A;  3I71 A;  2VI6 A;  4HRI A;  1FIP A;  3VB2 A;  3LSK A;  1OCT C;  4FE4 A;  4CO8 A;  2L3D A;  4PGG A;  3SFZ A;  5D8K B;  4BE0 A;  2CYY A;  4L9J A;  3RKY A;  2DK5 A;  3EPZ A;  1IDY A;  2ESH A;  4E7Z A;  1Z9C A;  3H5A A;  1REP C;  1RPW A;  1LUJ B;  2CQ7 A;  3KP3 A;  3OYI A;  1IO2 A;  1A6Q A;  1XC5 A;  2QEN A;  3EYY A;  4PCQ A;  4A3I J;  1WJF A;  1YE9 A;  5K7F A;  2RGV A;  4UVA A;  1ETV A;  4XLN F;  2XAS A;  4C3J J;  4NDL A;  2OTL I;  4LD5 A;  4OOI A;  1JUP A;  2KT0 A;  3TBI A;  5CQG A;  4EAT A;  4JP0 A;  4RLQ A;  3RKX A;  4I2O A;  2LH9 A;  4XN0 A;  1YX5 A;  1U5T B;  3BQZ A;  3VYR B;  3HXL A;  1BBY A;  5FRN A;  2A6E F;  3JTG A;  5BQT A;  3CQZ J;  4CHU A;  3M8F A;  1Z6T A;  4ZYH A;  4PUS A;  3F8N A;  2DO7 A;  4GCV A;  4FX0 A;  1ZQ3 P;  3L9F A;  2JVG A;  3WTV C;  1MNE A;  2OZ6 A;  1AKH A;  2VUM J;  3ZQQ A;  5DEQ A;  3CES A;  4D5C A;  1YJN I;  5B66 C;  3WGI A;  4X1E A;  4LIT A;  2X48 A;  2KPM A;  1HKT A;  5M5W J;  3B6C A;  1ETY A;  3AFH A;  4XON A;  4ANJ A;  5IOY A;  1IN4 A;  3RI4 A;  3VYT B;  4KIT B;  5TIS C;  3IH2 A;  2MSY A;  3FBI B;  2JA2 A;  4ENJ A;  3DLL F;  3F8M A;  4DYR A;  1SFK A;  3DV8 A;  4HNU A;  2IGO A;  2PBI A;  1QU3 A;  2O3F A;  2HWV A;  1KU9 A;  4FAS D;  3WTY C;  3JAM K;  2OC6 A;  3GXO A;  2DBB A;  3I64 A;  3ZGK A;  3B73 A;  5JI6 A;  3IUO A;  3F6V A;  4GFB A;  3VSL A;  2FA5 A;  1K61 A;  2O8K A;  4Y33 A;  2WBM A;  2BY2 A;  3HOV J;  1SD5 A;  3ZR8 X;  4NQW A;  3DQV C;  1IF1 A;  4CA0 A;  1O57 A;  1U2W A;  3HGG A;  3ULQ B;  1IN7 A;  2VKD A;  1ORK A;  3F21 A;  1ZR4 A;  1YS6 A;  2LBF B;  4B48 A;  1Z77 A;  1TZL A;  4MLO A;  1D1C A;  2KIS A;  4B43 A;  2LP0 A;  5L3D A;  3OV8 A;  2OQG A;  5EGO A;  1FOK A;  4D7N A;  2EA4 A;  4L9V A;  2CW0 F;  3L1P A;  5CVJ A;  3D5S C;  5FB2 A;  2VBX A;  1T0F C;  4BY1 J;  4XSZ F;  1YTY A;  3LAP A;  1MDM A;  3VWB A;  3CCM I;  4A3K J;  2Z99 A;  1SD7 A;  3G2B A;  1MZB A;  2ZFU A;  4R79 A;  1HBX G;  2YS9 A;  5EZH A;  4IHX A;  3HHH A;  1OFC X;  1U9O A;  2FQ4 A;  3G4S I;  3UR3 C;  1MMN A;  3IAM 2;  2EBI A;  4AIK A;  4E6K G;  5M3M J;  5IYC J;  2Z5U A;  5D5W B;  5L3B A;  1FYM A;  4FCY A;  4LLL A;  1F5T A;  4D5F A;  3V7R A;  4NHJ A;  3LAJ A;  3LSR A;  4G7O F;  3TOB A;  2RQP A;  1DPU A;  1XN7 A;  3FKI J;  4XKC A;  4PSW A;  1B72 B;  2V79 A;  3FXK A;  2LRD A;  3LFK A;  1ZG1 A;  2GXA A;  3AAF A;  4M6X A;  1S5L C;  3GLX A;  3S3N A;  2W00 A;  4XK4 A;  2KIM A;  2ZBK A;  3E5X A;  2CV1 A;  5DM6 F;  2HDW A;  2X6O A;  3CUQ C;  4I09 A;  1WJD A;  4YEL A;  3VOE A;  1OIS A;  1TWA J;  2NOG A;  4WXH A;  4KMF A;  3DBH B;  2XPV A;  4Y7N J;  2QSH X;  3A02 A;  2M0C A;  1POG A;  2IW5 A;  2F4I A;  2DW4 A;  1GDT A;  4EJW A;  2BVL A;  3Q9S A;  3OYD A;  5JVG F;  3PIP F;  4DIQ A;  4IO9 F;  4QPQ A;  1UB9 A;  3QPL A;  3KET A;  2LC2 A;  3JSP A;  1O3T A;  3OYB A;  3MZH A;  2IA1 A;  1R6R A;  5ICF A;  3HYI A;  4E70 A;  2LYC A;  4A3L J;  3CCJ I;  1LKX A;  4I7H A;  2WAE A;  1QRY A;  3I3L A;  2EZI A;  3RIR A;  2CUF A;  2DA6 A;  4F93 B;  2DQL A;  3KZI C;  4E4H A;  3WTT C;  4PFO A;  3OYE A;  3MEX A;  2WY7 Q;  4PJM A;  4ZYG A;  2GWR A;  3MWM A;  4B4C A;  3KFW X;  1H88 C;  2LKS A;  1SFX A;  2XRN A;  2E1C A;  1ZGA A;  1T56 A;  4Y3O A;  1TT5 B;  4HV5 A;  2Y75 A;  1YLF A;  3JR9 A;  3VDX A;  1XCV A;  2Y30 A;  2E1M C;  4PFP A;  4DNC A;  4ZYE A;  3AG3 H;  5LD2 C;  2EZH A;  1JI8 A;  3HJE A;  4E7H A;  1KZH A;  1X1C A;  4U0V A;  2H94 A;  3KIO A;  2DFE A;  1VQ7 I;  2NVQ J;  1RRJ A;  2V9V A;  1XG1 A;  3ONQ A;  4UUS A;  3C2B A;  3CUQ B;  2YSR A;  2LD5 A;  1QBJ A;  4BQA A;  2HR3 A;  2R3S A;  4RAG A;  2FF4 A;  4XRM A;  1WHU A;  3FXL A;  3PO3 J;  5GTI C;  2O0Y A;  3O6B B;  1ZYR F;  3HHG A;  1SEU A;  3MZ8 A;  1JKP C;  2F5C A;  5IT9 Z;  4IL6 C;  1A35 A;  1T6S A;  2O5R A;  4RGS A;  3HPG A;  1IRZ A;  1P2F A;  4KIF A;  3J7Z I;  3FX3 A;  2DA2 A;  4YRV A;  5M5Y J;  1OMI A;  3V8J A;  1O3R A;  5E79 C;  5LGN A;  2MC3 A;  2ID6 A;  3NQO A;  2PMH A;  2LVS A;  3QWL A;  3FMR A;  1P7I A;  1SFU A;  3QYE A;  3EUH A;  4U88 A;  1R1T A;  4ETS A;  5B3S H;  3OWT A;  4YG2 F;  5LEK A;  3E6C C;  2W57 A;  2DOA A;  1BC7 C;  2LF7 A;  5DYM A;  3ZQG A;  3O2P E;  3ABL H;  1FJL A;  3LMM A;  1IV6 A;  4FX4 A;  2GBY A;  2VQL A;  3IL2 A;  1S29 A;  3U1K A;  4U7D A;  3CCY A;  4XOR A;  4YFX F;  2D1H A;  4RS8 A;  3RZD J;  3HSR A;  5FJ8 J;  3DCF A;  4IZZ A;  3M4O J;  2M3A A;  4A3E J;  2HZT A;  2VBW A;  3GTG J;  4HLX A;  1XGO A;  1JTY A;  3H5N A;  4A5N A;  5HS8 A;  3IKT A;  2K9S A;  2YX4 A;  3RPQ A;  1F9N A;  5ILU A;  4HQE A;  2Q8K A;  4BXU A;  1OCP A;  3ASN H;  3RQ4 A;  2JA8 J;  1TQM A;  2K4J A;  2HYJ A;  5CJ9 A;  3CJN A;  1LE8 B;  1S7O A;  2Q2E B;  2UXN A;  4F52 A;  2KJB A;  5F27 A;  1TWG J;  4AYB N;  2A5Y B;  3QOD A;  4AVP A;  4HW0 A;  2MC4 A;  1F4K A;  2BY0 A;  3QYB A;  5GAD J;  3F3X A;  3S14 J;  3IHU A;  2V9P A;  2M45 A;  3TOA A;  2YX7 A;  2F4M B;  2UV1 A;  4G6T B;  1YJW I;  3T0Y A;  4P1W A;  1P7J A;  2BBY A;  4PGH A;  1JT6 A;  3ECH A;  2VLA A;  1SAX A;  1J7K A;  1F36 A;  1FP2 A;  5FO5 A;  1NHA A;  2E19 A;  3RCO A;  1ZRF A;  5E17 F;  3QOE A;  1FYK A;  3ML6 A;  1QVU A;  3HOX J;  3ZQF A;  1QO0 D;  3F23 A;  3PSF A;  3Q5F A;  3HRU A;  3FM3 A;  4A0Y A;  4E7J A;  5D4S A;  1SAN A;  3HDD A;  2WWY A;  3CF2 A;  5FLV A;  3K4C A;  3CP2 A;  3I56 I;  1YW8 A;  2COM A;  2ADU A;  5DS9 A;  1V5E A;  1ZKG A;  2F5D A;  3S1N J;  2IA0 A;  2DXI A;  2ZNZ A;  3RSN A;  2PJR A;  1DP7 P;  5CVU A;  3EYI A;  4A3B J;  4WXC A;  2Z1D A;  1P4X A;  3OIO A;  1TNS A;  3EQL F;  2E2I J;  2ID3 A;  2JA5 J;  2NAZ A;  1FZP B;  1UHM A;  3C3W A;  4AU7 A;  4RDU A;  5CQE A;  1DU6 A;  5LRS A;  5GAH J;  2W84 A;  5BS6 A;  3JRA A;  4X6A J;  3WG7 H;  4A3J J;  3BT9 A;  4IRH A;  2I5U A;  4RLF A;  2E1N A;  2K40 A;  2P8T A;  5E8I A;  4AIJ A;  4G6D A;  1YIO A;  3OS1 A;  3BTJ A;  4CZZ A;  3OSG A;  3E6D A;  1RC9 A;  3I4M J;  3K7A J;  3WTU C;  3TMO A;  4LMY A;  3F8C A;  5FKM A;  1N75 A;  3RPU D;  4HA8 A;  1MMA A;  3ESW B;  1V5G A;  4L5I A;  5HOD A;  3IRQ A;  3S2H J;  1VQL I;  2CFO A;  3ABU A;  3S3O A;  4G8X A;  5KCM A;  1QGP A;  4MTD A;  5K7Z A;  4BNC A;  4DJA A;  2DA5 A;  3I55 I;  1ULY A;  1WQ2 A;  5GP9 A;  2P6S A;  2A69 F;  3ECO A;  2J5P A;  1R5G A;  4CUG A;  1AHD P;  3OOP A;  5E3L A;  1VQ4 I;  1RR8 C;  4AC0 A;  1V54 H;  5D6F A;  2WAQ A;  3I0T A;  4CYD A;  4P9U A;  1QPM A;  4EEF G;  4C2M J;  2CV0 A;  3R60 A;  3AG2 H;  3C2H A;  3KLN A;  2EFW A;  1R71 A;  1BI3 A;  5L3E A;  4BY7 J;  3RYP A;  3J80 Z;  3N4M A;  2HEO A;  2DQR A;  1X4O A;  1UFM A;  5AIP A;  3BQY A;  2ZNY A;  5CYV A;  1XSD A;  3A4C A;  3BP8 A;  1OCC H;  3HBL A;  1ZG3 A;  1MKM A;  2A5W A;  5F0F A;  4K2E A;  3BY6 A;  1Z7L A;  5HNH A;  4OIO F;  4NC7 A;  5F1J A;  3BZK A;  5LFA A;  2QZ8 A;  2X1E A;  4MFD A;  4AIH A;  3T8T A;  1QVT A;  5ILV A;  3ELK A;  2HKX A;  3F6O A;  4EQQ A;  2L4M A;  4MHG A;  2DA7 A;  3JW4 A;  4E7I A;  4CDG A;  5EEG A;  4P5O A;  3TW7 A;  3H3Z A;  2G7U A;  4EVI A;  4L9T A;  2NOJ B;  2Z3Y A;  4RB3 C;  3KX2 A;  4BDY A;  4KIG A;  4LLN A;  2K3F A;  4PJJ A;  4S0H B;  3S32 A;  1Z7U A;  2WAQ N;  5J40 A;  1T33 A;  4A6D A;  1ZTR A;  2MYS A;  2FNA A;  4XKW A;  3M1C A;  5E1X A;  4R8H A;  2WV0 A;  1R49 A;  1JTX A;  1JKO C;  3OS0 A;  2GXB A;  2X1D A;  4G7H F;  1KON A;  3CTA A;  5ED4 A;  1FC3 A;  2KMU A;  3NAR A;  5DUI A;  2Y31 A;  5ICE A;  3C18 A;  2FXA A;  3CCU I;  2IVM A;  5H20 A;  3F8B A;  2XAF A;  4NQW B;  3PIO F;  2JMW A;  4XLA A;  4Z2Y A;  3KPH A;  4B8X A;  1EH6 A;  2XRL A;  4L0Y B;  3CJQ B;  1R9T J;  1MIJ A;  4C3H J;  3GFJ A;  2MA3 A;  4BEH A;  2W82 A;  3MZY A;  2FOK A;  4JX5 A;  3HGY A;  1WJE A;  1ZN2 A;  1LDJ A;  2E34 A;  1IG7 A;  2HYF A;  3BJO A;  4HEA 2;  1W5T A;  5LHI A;  2FJ1 A;  3I4P A;  1MBF A;  3Q9V A;  1WH5 A;  2H8W A;  3OYC A;  3G1M A;  1L3L A;  1X1P A;  1BC8 C;  1DQU A;  2ELJ A;  2L0K A;  1MDM B;  4J19 A;  2K5C A;  4C9Y A;  4CCL A;  1JXS A;  4BHP A;  4XMY A;  5DCF A;  1EJ9 A;  4ESB A;  2IT0 A;  2QA4 I;  1X3Z B;  2LLK A;  2R7S A;  3R4K A;  2AQE A;  4NC8 A;  2I8D A;  2LOO A;  2FE3 A;  4KT5 C;  3BRO A;  3J80 K;  1T8I A;  3A2K A;  4A93 J;  3JRI A;  4WCG A;  1WI3 A;  4RA2 A;  1LEA A;  2XGC A;  1DU0 A;  3FK6 A;  2VOO A;  2NS0 A;  3I9V 2;  3D5L A;  4F91 B;  2KDO A;  4Y17 A;  1LEB A;  1KQ0 A;  1RI7 A;  3G1O A;  4I02 A;  1ZRC A;  4QLC U;  4HOB A;  2OCE A;  4G6Q A;  3VYU B;  1WCM J;  3H9Q A;  3AKZ A;  3K6G A;  5HDG A;  5IY5 H;  3LSJ A;  4N0B A;  2KZG A;  2RV8 A;  2KIQ A;  3H92 A;  4YEJ A;  4IOA F;  2E5N A;  2O03 A;  2F6C A;  1Y8R B;  2XAQ A;  1CF7 B;  1E3O C;  1S7E A;  3RQI A;  2CQX A;  1PP8 F;  2Q0O A;  3FIW A;  2L9R A;  2IAI A;  3V42 A;  3SXY A;  2Z33 A;  3E1S A;  2KP6 A;  3E97 A;  1ZAR A;  1I6X A;  2E1O A;  4EJU A;  2FML A;  2IEK A;  3QPH A;  5E8G A;  5J8C A;  5B5E C;  5IOZ A;  3H0D A;  1V55 H;  2OCC H;  3CJT B;  5CVI A;  1VZ0 A;  2V7F A;  5L3C A;  4RAZ A;  1WJA A;  2XAH A;  2BXY A;  2JK3 A;  4CCO A;  1PUF A;  2DMT A;  4HX8 A;  5EDN A;  1N25 A;  3OYH A;  4LIU A;  2K9M A;  3SYT A;  3GTP J;  2DFI A;  1TT0 A;  3BDD A;  1KA8 A;  4MTE A;  4ENK A;  1D3Y A;  1Y0N A;  4BH9 A;  2DA1 A;  5E1W A;  3TO7 A;  2XGD A;  3A01 A;  5FFZ A;  2X51 A;  3DBR B;  4U0W A;  1B6A A;  1H0M A;  4L9N A;  1XMA A;  3PL8 A;  2KL4 A;  2AQF A;  1B9N A;  1B8I A;  5H6Q A;  4Q4Z F;  4BS9 A;  2E2J J;  3E5Q A;  5D5V B;  3KP5 A;  1FNN A;  1VQK I;  3MVP A;  4EMS A;  2A68 F;  4XOT A;  3JRF A;  4FE7 A;  4BL0 B;  5FD5 A;  4BBS J;  2K02 A;  3V7C A;  1HCR A;  4RMN A;  2EPF A;  3H9G A;  2FBH A;  2WB1 N;  4A3F J;  2DFF A;  4M3G A;  4MIM A;  2BOL A;  4Q48 A;  3RJP A;  2BEO A;  4KYW A;  2P4W A;  4UUS B;  2R7D A;  1FT9 A;  1R1U A;  2QM3 A;  2F5V A;  3N05 A;  4RM2 A;  3MFK A;  3GYH X;  4R1H A;  2UWM A;  1T08 B;  5GTH C;  2KFD A;  2ZME A;  3FF5 A;  3FXO A;  3PM1 A;  4RM3 A;  1I27 A;  5EF6 A;  5E3M A;  2QKL B;  3OL4 A;  3T5X A;  2ZB9 A;  2R7R A;  3TGN A;  2E60 A;  2CUJ A;  2B63 J;  2DMP A;  1TNT A;  2DYR H;  4QSH A;  2XF7 A;  2ECC A;  3TP0 A;  2PLY A;  2CWE A;  2K7L A;  5E1Z B;  2XVC A;  2OF7 A;  3VPR A;  3VFZ A;  2ECB A;  2OBP A;  2LR8 A;  4G7Z F;  2CMP A;  2L9S A;  1FP1 D;  3S1M J;  4P96 A;  1QA6 A;  2CH0 A;  4XLC A;  5ICC A;  4LK0 F;  4HDV A;  2CS3 A;  3H3U A;  3NRV A;  2DJI A;  2X9D A;  3LST A;  1K6O A;  4C2U A;  3HKZ A;  3P7N A;  1D0X A;  4MEY F;  2B7E A;  2XB0 X;  3R0J A;  4ZDL A;  3OYN A;  2OA4 A;  2EWN A;  2QSF X;  4LK1 F;  1BR4 A;  5JHU A;  2JQ7 A;  1BOA A;  2L5Q A;  2H09 A;  3GFI A;  2EH3 A;  1U8R A;  1MSE C;  4XIC A;  4M3B A;  5FRM A;  1MBJ A;  1I1S A;  5LGU A;  1I1G A;  1Q1V A;  3WTX C;  3ZRG A;  2JUC A;  3FHN A;  2JUG A;  2OUM A;  4J01 A;  3MN2 A;  1MBE A;  1FSH A;  2V1U A;  2QUF A;  3HRS A;  4H4K C;  4BBR J;  1OYI A;  3BOQ A;  3U2R A;  2UXX A;  3I54 A;  5FFX A;  2CQK A;  3IC7 A;  2R0Q C;  3R0A A;  5FD6 A;  4ZZL A;  2CQQ A;  3GTK J;  4YFK F;  2LF8 A;  1Z1D A;  4AUX A;  1I6H J;  1OLT A;  1RKT A;  3WTZ A;  2MH2 A;  3W6V A;  2HI3 A;  3ZN1 A;  4OIQ F;  3B6A A;  1ZK8 A;  3OOU A;  1O3Q A;  1G8X A;  4M9X A;  1LJ9 A;  2HGC A;  3QQA A;  1ZRE A;  2L02 A;  3Q0U A;  1G3Y A;  4II3 A;  3H3V K;  2IP2 A;  2EA2 A;  4NBQ A;  1QZY A;  1VQO I;  3EUK L;  3W2W A;  2OAZ A;  3G3Z A;  1S9H A;  2DJN A;  3CME I;  5F0C A;  2L01 A;  1YS7 A;  3LSM A;  4ZTF A;  4NNJ A;  3TQN A;  2AHQ A;  3A0B C;  3KEO A;  3IAS 2;  5F08 A;  2DTR A;  3WHC A;  4B44 A;  3LWF A;  3BG3 A;  1QQI A;  4ZDP A;  2BY1 A;  5IPA A;  1SFO J;  2PJR B;  2FQ3 A;  1IW7 F;  3A03 A;  1LFU P;  1W7P A;  2XAU A;  2OD5 A;  4BDZ A;  4NC6 A;  4PJL A;  2FU4 A;  5LHH A;  2JRM A;  3F0C A;  2GLO A;  1R5H A;  1T2K A;  3C2G A;  3HPH A;  4AID A;  1MGT A;  4JBA A;  1HDD C;  2LKX A;  5EYR A;  3BWG A;  1R22 A;  1IGN A;  2VIX A;  3OR1 C;  2NXN B;  2NVX J;  5J1Y A;  1K4S A;  4PSX A;  2CO5 A;  1W0T A;  3FM5 A;  3L2U A;  1IUF A;  1TWC J;  1WSU A;  4AWX B;  3L2C A;  1W5C C;  1PVE A;  2NRA C;  3G71 I;  4EM0 B;  3DU6 A;  2EFP A;  4BQO A;  1LVA A;  5LRR A;  2HQN A;  5FKK A;  1HC8 A;  1IZ1 A;  4B3A A;  1EH7 A;  1G6N A;  3PFY A;  1CF7 A;  3PQK A;  1XD7 A;  1Z21 A;  4L18 B;  1SFE A;  3IH3 A;  3CMY A;  1BW6 A;  3SDG A;  1RR7 A;  4FT8 A;  5HLT A;  3CMM A;  4LJZ F;  4BQQ A;  3CMA I;  3K4K A;  2DOD A;  2ZO4 A;  1OR7 A;  4OU0 A;  2IGN A;  3T8R A;  3W6J B;  1OCO H;  5HVQ C;  1ZG5 A;  1GV2 A;  2MD0 A;  3D1N I;  2ZXW H;  2NVU B;  1ON2 A;  3GBG A;  1ZAO A;  5CVR A;  1E2X A;  2DCE A;  2W1O A;  4BYY A;  5E3O A;  2YU3 A;  2ME6 A;  1FBQ A;  4XLP F;  2JSC A;  2VON A;  2MW8 A;  2XKO A;  3JCU C;  4DQ2 A;  1W7P D;  1L0O C;  4IKF A;  3GF2 A;  3OYF A;  2DLL A;  5KNL A;  3EDP A;  5D5U B;  1J59 A;  1XGS A;  3FK7 A;  1D8K A;  1MW7 A;  3ABK H;  2VXD A;  3SEZ A;  4KIS A;  3CCV I;  2VXZ A;  1ETO A;  3KYD B;  1H9T A;  2LFB A;  3WHB A;  1AOY A;  2P5V A;  4ZZD A;  1EKE A;  2VBZ A;  3ERE D;  1Y1V J;  2O7O A;  1KU7 A;  2EIL H;  1CQT A;  1UCR A;  2WA0 A;  1YW7 A;  2Y48 A;  4B1R A;  1OPC A;  4ZH4 F;  3R61 A;  5H6R A;  3HIF A;  4UB8 C;  3LL7 A;  4B09 A;  2MD5 A;  1HXD A;  5HDN A;  3CCE I;  4MQV A;  1IJW C;  3BTI A;  4CXF A;  2LY1 A;  3MAJ A;  4WX9 A;  1Y0U A;  4F55 A;  1HF0 A;  1GVD A;  4XKV A;  1GV5 A;  3BCA A;  1ZGW A;  4LGW A;  3AL0 B;  1K78 A;  1E3P A;  1T98 A;  1RZ4 A;  2EIJ H;  2P0W A;  1BW5 A;  1KQ9 A;  3KLO A;  2IGM A;  3ASO H;  3UNG C;  4HDU A;  1WRJ A;  1MBG A;  2DOE A;  2KHM A;  4LLG F;  3ZN0 A;  4MFE A;  3OYL A;  2STW A;  1V5F A;  1OYW A;  1YRN A;  2RN7 A;  1YQA A;  4BEH B;  5JHF A;  2CRG A;  2IJL A;  2MLG A;  4L5J A;  2V6C A;  3COA C;  1FOX A;  3BR0 A;  1U78 A;  4XN3 A;  1R23 A;  3KP6 A;  1X3U A;  2JT1 A;  4BJT A;  3S2W A;  3WU0 A;  1R00 A;  3SZG A;  3JRB A;  3K2A A;  1Z0X A;  3WGG A;  3CCR I;  2QGU A;  4PDK A;  3B02 A;  4XSX F;  1K7A A;  2VBY A;  3QPT A;  2Z2S B;  4DGW B;  3ABT A;  5JR3 A;  5F6F A;  4NUB A;  4RB0 A;  3F72 A;  3FXQ A;  2DT5 A;  1JJ8 C;  1VQ8 I;  1UG0 A;  3BR1 A;  3RTR A;  3DKX A;  3K4J A;  1ZLJ A;  4LG3 A;  3HRM A;  2M9H A;  4II2 A;  4EJV A;  1XCB A;  2W7N A;  3BLY A;  1WH7 A;  5DD4 A;  3PUF A;  2JPB A;  3LQQ A;  2KIU A;  2E7W A;  2HS5 A;  4FQG A;  1S72 I;  1S6L A;  4RAF A;  4UVC A;  2DMU A;  3ABM H;  2VQH A;  2Y9Y A;  2VKH A;  3BG5 A;  3ZMD A;  3DP7 A;  2VJI A;  1YHQ I;  2AO9 A;  2DYS H;  2K86 A;  4ZC3 A;  1U3E M;  1OJL A;  1FSE A;  3H0G J;  4AVZ A;  1NTC A;  3P9K A;  4M74 A;  5K5R A;  4RBO A;  2TDX A;  2A61 A;  3CZ6 A;  5E20 A;  2P5L C;  2F48 A;  4KN7 X;  1VFC A;  5FLX Z;  5TRD A;  5J4Y A;  2G7H A;  2KJC A;  1YI2 I;  5IYD J;  2WTE A;  4HYE A;  1SD6 A;  3WOD F;  4KA4 A;  1G3S A;  2E71 A;  1S7A A;  1K4T A;  4XKB A;  4EGZ A;  1BI2 A;  4AD9 A;  1E3H A;  2A3S A;  2HTJ A;  2MAB A;  2WV1 A;  2D45 A;  1PUF B;  1B9M A;  4HG2 A;  3ISP A;  4PJ0 C;  4HX7 A;  1GXQ A;  1DGW Y;  3V8L A;  2E36 A;  4M9S A;  1WWX A;  5EZG A;  2QYO A;  4H0E A;  1W0U A;  4DBR A;  1XTA A;  1YJ9 I;  1YX3 A;  4OMY A;  1LDK B;  3EUA A;  2X6Y A;  3A01 B;  3RYR A;  4Y13 A;  2HVQ A;  1F43 A;  2H6B A;  4XNF A;  1O7F A;  4BHB A;  4M3F A;  1B8I B;  1UAA A;  1DP3 A;  1BI1 A;  4XID A;  1PDN C;  3ZMU A;  4OWR B;  1WKM A;  4I76 A;  1TBX A;  5F1R A;  4I0A A;  2QVO A;  2V4J C;  3O3K A;  2VPR A;  5FKN A;  3ZP5 A;  4JOM A;  1EA3 A;  1YO5 C;  1E17 A;  2VPL A;  3CC2 I;  1LNW A;  4N9H A;  3KP4 A;  5K5Q A;  3A0H C;  1O3S A;  2XAG A;  2VJ4 A;  1DDN A;  4W1U A;  5DCM B;  1K6Y A;  3DWL E;  3P5J A;  2EFO A;  4UNO A;  3ZMT A;  2EB7 A;  4GYG A;  4P55 A;  4HLY A;  5EG0 A;  1N78 A;  2ZSI B;  4O5V A;  2ZME B;  1SD4 A;  4A0X A;  3LA7 A;  4ZYA A;  5J47 A;  3TDU C;  1OCZ H;  3PQJ A;  3LQR A;  5CKT A;  1LDD A;  1UEL B;  1R5I D;  1WJ5 A;  2CJJ A;  5CVV A;  2HZD A;  5HLH A;  2XSD C;  4ABZ A;  1BM9 A;  2HU9 A;  5FGM A;  3JRG A;  1U0J A;  2MH9 A;  4XLH A;  4E7K A;  2K3P A;  2PMZ A;  1I39 A;  2LSO A;  2LY9 A;  3MCZ A;  4BHC A;  2RAE A;  1LB2 A;  5FLX K;  3M9A A;  2F5F A;  4CH7 A;  5JLW A;  3S1R J;  3GTM J;  5CPR B;  2OJE D;  4BU2 A;  2R7T A;  3GTQ J;  2QSG X;  2K9N A;  2MGQ A;  4HF1 A;  3GEZ A;  2L7K A;  3BJA A;  2HKO A;  3HM5 A;  2Y9Z A;  1GLN A;  1GUU A;  1OCR H;  3AG1 H;  3W2V A;  3OIP A;  2STT A;  2M5W A;  3DKY A;  3GO5 A;  3GZ5 A;  2GOX B;  3L7W A;  3TW6 A;  4DZJ A;  3IRR A;  2N8G A;  3JRC A;  1G4D A;  3X2Q H;  2QQ8 A;  1HA8 A;  1XB4 A;  2M30 A;  2ETH A;  1IRG A;  2RDP A;  2IS2 A;  4A2U A;  3P9C A;  2Y0M A;  1Z67 A;  3E6B A;  4EGY A;  1UZC A;  3IKV A;  4MEX F;  2VE8 A;  3PUB A;  4IJA A;  2OV7 A;  1I3A A;  3D5R C;  3FXR A;  2QQA A;  3I59 A;  1B59 A;  2BW3 A;  2WC2 A;  5D6E A;  2M87 A;  1D0Y A;  2GM4 A;  2ZJ2 A;  4UVB A;  3HUG A;  2OTJ I;  2EIK H;  1Y39 A;  2FMY A;  2OZU A;  4A12 A;  3K1P A;  3PSI A;  5FRO A;  3DTE A;  3CC4 I;  4A3G J;  3PJR A;  4HSR A;  1UMQ A;  2WAD A;  1ACI A;  1G3W A;  1MH4 A;  3S93 A;  3CDL A;  2R7F A;  4M72 A;  1SVL A;  3JRD A;  2QBY A;  5E18 F;  2WY8 Q;  2VN2 A;  3RZO J;  1MJA A;  4D9J A;  5BPI A;  3F22 A;  3I4N J;  3L2V A;  1I5Z A;  4XQF A;  5M5X J;  2XGE A;  1RKW A;  1RNL A;  5JVT A;  3CLQ A;  2EV0 A;  1LFB A;  2VQC A;  4AM3 A;  2W24 A;  3D0S A;  1ONV A;  2NNN A;  3QPS A;  3RKW A;  1W7P B;  2ELK A;  1DUX C;  5FLM J;  2VJJ A;  1IC8 A;  4KDP A;  2K9Q A;  2EFQ A;  3K10 A;  2OQR A;  1R1V A;  2H1L A;  2BZT A;  2R7O A;  4LFU A;  5DV5 A;  2XRO A;  3OYM A;  1JE8 A;  2JJ7 A;  2JRT A;  5EJC A;  3GWZ A;  4Y4R A;  4CCJ A;  3PNY A;  2AS5 F;  2O8X A;  2FBI A;  4QWQ A;  3HC7 A;  5KHD A;  3CLO A;  1GHC A;  4CCM A;  2NNY A;  3IWZ A;  1P6R A;  4IQJ A;  2XUB A;  3DEW A;  2GIV A;  1VF9 A;  3BC8 A;  2VE9 A;  4M3D A;  2LK2 A;  3WE2 A;  5LHG A;  2FEZ A;  3LA3 A;  5HS7 A;  3ZMS A;  4BUP A;  2LY2 A;  2EFN A;  3WTW C;  3L2R A;  3S16 J;  1G2H A;  3EET A;  1XSV A;  1ZEL A;  2HDC A;  4HBL A;  3KZY A;  4HNV A;  3OMY A;  2R7Q A;  1FY7 A;  1J5Y A;  3BJ6 A;  4RAY A;  1UST A;  1ITY A;  3K4N A;  4XRS G;  4S04 A;  2E2H J;  1YIT I;  3HZJ A;  2NVY J;  2VQG A;  1UHW A;  3CDH A;  1H89 C;  4CYC B;  1D5Y A;  1H9G A;  4O6J A;  1WZ2 A;  2HQ5 A;  3PNT A;  2VT3 A;  1JHF A;  5C3E J;  3FXJ A;  3O8G A;  5C44 J;  2H6C A;  1ETK A;  1FEX A;  5J1U A;  3CUO A;  1HLV A;  3GFL A;  2W85 A;  4XRF A;  2GQQ A;  1IUY A;  1ZLK A;  2ZJP F;  3NWT A;  5TJJ A;  1FLI A;  1XX5 A;  1R4M B;  3EUH C;  4XBF A;  4XR6 A;  1A5J A;  2HOS A;  4IHY A;  5C4J J;  5LEJ A;  1STZ A;  4CGZ A;  3LFU A;  3FHZ A;  4GXO A;  4KFC A;  4DW6 A;  1J75 A;  1SMT A;  5D5X B;  2EIN H;  1G59 A;  1KQ8 A;  1V4R A;  3K70 C;  3N97 A;  1P92 A;  1PYV A;  1HOM A;  1EV7 A;  2F4O B;  2R5Y A;  3M8E A;  4OIP F;  3RKQ A;  1IN8 A;  3T1B A;  1SC7 A;  1XPX A;  2DDB A;  3Q0W A;  2VKV A;  3LSP A;  4A69 C;  3DPT A;  5DCM A;  4RGX A;  4ESF A;  1K78 B;  1NG6 A;  2HOT A;  4IX7 A;  2CUZ A;  2H1K A;  4V2F A;  1BOB A;  1BIA A;  2PFB A;  2HPM A;  3SEQ A;  3DEE A;  1P4W A;  1W5S A;  4RB2 C;  3MKY B;  1D1B A;  2CW7 A;  4ENN A;  3DKW A;  2FBK A;  4IQ4 A;  1GXP A;  5F04 A;  2NYX A;  5GAG J;  1FMW A;  3Q3S A;  1YRN B;  5IYB J;  2L9N A;  2QKM B;  2V1N A;  3JTH A;  3VSK A;  1SAU A;  2NS8 A;  4I98 B;  2XDV A;  2LMD A;  3KE2 A;  1YW9 A;  2VKE A;  4MGR A;  5AIQ A;  2PJP A;  1MD0 A;  4A0Z A;  5DUK A;  1MBH A;  1Q1H A;  1TP4 A;  3W6K B;  3GVA A;  4KUM A;  3BG7 A;  4UUT A;  1JT0 A;  4XM3 A;  1FWZ A;  4HNT A;  4EJO A;  2D2W A;  1D1A A;  1BIB A; 
#chains in the Genus database with same CATH homology
 4N9I A;  3K0L A;  2YR2 A;  1XDS A;  4IVN A;  1YG2 A;  1KU2 A;  2CSO A;  3BPV A;  5J8F A;  1RIO H;  2VC0 A;  3J81 Z;  2MLK A;  4M6Y A;  2GAU A;  2DPU A;  2DAO A;  3GZ6 A;  5K1Y A;  3I53 A;  4UXN A;  4YFN F;  2A07 F;  2IA2 A;  3M1E A;  4L0Z B;  4RB1 A;  1HST A;  1A04 A;  2PG4 A;  2VOD A;  1J0R A;  3QRF F;  3QP5 A;  3VOD A;  1CGP A;  1BI0 A;  2FSW A;  1WI9 A;  5AON A;  1OKR A;  2ACJ A;  2A6H F;  2P5K A;  3M7G A;  3TO6 A;  1J2X A;  5ERI A;  1IN6 A;  5ILS A;  1G3T A;  2GZW A;  4RGR A;  3ZQ7 A;  4LG0 A;  2X4H A;  2CGP A;  4EM2 A;  1F1Z A;  1P4A A;  3IWF A;  3I5U A;  3WG9 A;  3WTS C;  3DF8 A;  5EEH A;  1PUE E;  1IXC A;  2ISY A;  3TKY A;  1T39 A;  2FNP A;  2DK8 A;  3REO A;  3J81 K;  2W25 A;  1C0W A;  4F7Z A;  2KIF A;  2BGC A;  1LQ1 A;  2DI3 A;  2RKH A;  3HSF A;  4HX4 A;  3GX4 X;  5HLG A;  2EV5 A;  1ZRD A;  3FMQ A;  4UUV A;  3V8K A;  2ZKZ A;  2DU9 A;  2V1D A;  3C7J A;  1D8J A;  1JGS A;  2JZY A;  1FBU A;  3K1N A;  3L00 A;  2IRF G;  2YPR A;  4RGU A;  2P7C B;  2JTV A;  1MJ9 A;  2VT2 A;  1TQP A;  4WF2 A;  2G9W A;  2PI0 A;  5LGT A;  3KEQ A;  1YYV A;  4ON0 A;  2EV6 A;  2QWW A;  4KMU X;  5D8L B;  2RNJ A;  6PAX A;  1S8N A;  1GVJ A;  4KIB A;  2RVC A;  3HSE A;  4EV0 A;  4YII A;  5DD8 A;  3K2Z A;  1HW5 A;  4M73 A;  3I59 B;  5BMZ A;  4HZF A;  1BJA A;  4ESJ A;  4GGG A;  4NB5 A;  1RUO A;  5L3F A;  3WE3 A;  1OYY A;  3U1D A;  3SQN A;  3E5U A;  2PEX A;  1S3J A;  3GW2 A;  2K27 A;  2QBY B;  2ISZ A;  3TO9 A;  1HQC A;  1TQI A;  3SZP A;  2UZK A;  4IPA A;  4IXA A;  4U7B A;  5LBQ A;  4IRI A;  3QAH A;  5HDK A;  1HW2 A;  2P7V B;  1TW3 A;  3CO7 C;  3FZV A;  2JPC A;  4Q5S F;  4M71 A;  3FXU A;  2BV6 A;  2F2E A;  3QOP A;  3K69 A;  3FWE A;  5IT3 A;  5HS9 A;  3R6S A;  2H27 A;  5K5O A;  4EM1 A;  2HTS A;  5BOX A;  3BPX A;  1U6G A;  2VOP A;  3QU3 A;  1FBS A;  5L3G A;  2QQB A;  3KP2 A;  4UHT A;  1QZZ A;  5J6X A;  4ZYD A;  4HAM A;  3V7S A;  1U5T A;  2X0L A;  1B4A A;  3WU1 B;  3G73 A;  4IRG A;  1SMY F;  1D5V A;  4PZJ A;  1IXS B;  5KK1 A;  4GYI A;  3HOT A;  3E3V A;  2ZXJ A;  4S05 A;  1ON1 A;  2EJR A;  1IXR C;  1TW2 A;  4HV6 A;  3RPU A;  1FPQ A;  3P9I A;  5HOO A;  5JFR A;  2F5E A;  3RDI A;  2P6T A;  4M9Z A;  1HKQ A;  3GFM A;  4KN4 X;  2XGX A;  2LNB A;  1Z91 A;  4A6E A;  1IRF A;  2OU2 A;  1Z6R A;  1BN5 A;  5F64 A;  3WGH A;  2CFX A;  4HF2 A;  2GXG A;  4WWC A;  4IF4 A;  2MBF A;  5HLI A;  5D4R A;  3HRT A;  5ICG A;  3F8F A;  1QNT A;  5IT9 K;  4A5M A;  2BE5 F;  1EH8 A;  4OIR F;  4O3M A;  2ELH A;  2RC4 A;  4I01 A;  2PN6 A;  3U9G A;  2QLZ A;  1XDU A;  4D0P A;  2HOE A;  3DEU A;  1FX7 A;  2XHK A;  1TLH B;  2AXL A;  4ENM A;  1ZHF A;  3ZMV A;  2L4A A;  4IHT A;  3ZMZ A;  3PFI A;  5A2Q Z;  4CIC A;  5LLQ A;  2O61 A;  5KVR A;  4IHS A;  1IN5 A;  2Z9O A;  4I0B A;  2O6G E;  4G94 A;  2M1B A;  1IAW A;  3JSO A;  3K9T A;  3HTS B;  4G9Y A;  1T0F A;  2FRH A;  2IPQ X;  2ESN A;  2V1X A;  3FMS A;  1XMK A;  1XGM A;  2LDU A;  1KGS A;  3KP7 A;  1HKS A;  1KYZ A;  4JK1 X;  2DPD A;  1R7J A;  1K79 A;  1MJB A;  2PQ8 A;  4LG0 B;  1B1B A;  1R36 A;  2D1V A;  3L09 A;  1AWC A;  1J9I A;  2CG4 A;  1KYW A;  2ZCW A;  3VEP A;  3C1D A;  3E6M A;  4LB5 A;  1FYL A;  1TTY A;  4OIN F;  3TDZ C;  4GO1 A;  1PP7 U;  1YFH A;  3CUQ A;  4WK8 F;  4HQM A;  3DXJ F;  3K1M A;  2HQR A;  1VTN C;  1XSX A;  1JHH A;  5A2Q K;  3HOS A;  2HYG D;  4ASN A;  2HFH A;  1KU3 A;  2L54 A;  2C6Y A;  3HTU A;  2J5O A;  4BAY A;  4U0Y A;  2M8E A;  5DDG A;  1R58 A;  4Y15 A;  1O7L A;  3ROU A;  1ZGJ A;  2KRF A;  3SHF A;  2EK5 A;  2K4B A;  3MQ0 A;  3QP6 A;  4FHT A;  3BZ6 A;  3KCC A;  4Q47 A;  1USS A;  2KKO A;  4UV9 A;  2LKP A;  2XIG A;  2XAJ A;  1XGN A;  4UV8 A;  2E7X A;  2Q2E A;  1ODD A;  4P9F A;  1HW1 A;  4TV7 A;  3DFG A;  4MNU A;  2PMU A;  1V3F A;  4HF0 A;  2GA1 A;  4JQF A;  3KZZ A;  2B0L A;  2XKP A;  2GA2 A;  3GUD A;  1W4M A;  2QQ9 A;  4LB6 B;  3V4G A;  1ZH5 A;  4KNY A;  3SZT A;  1U5T C;  1HSJ A;  5CLS A;  4YIF A;  5BPD A;  3NEU A;  3CO6 C;  1RUN A;  3J7A O;  4EJT A;  3I58 A;  4WXD A;  4KIC A;  3ZPL A;  3QU6 A;  3JAM Z;  3LA2 A;  2BYV E;  2ZFW A;  3DPL C;  4OMZ A;  1Z05 A;  2VC1 A;  2XV4 S;  1T38 A;  1DPR A;  4MQ9 F;  3I71 A;  3VB2 A;  4CO8 A;  2L3D A;  4PGG A;  3SFZ A;  5D8K B;  2CYY A;  4L9J A;  3RKY A;  2DK5 A;  2ESH A;  1Z9C A;  1REP C;  3KP3 A;  3EYY A;  2QEN A;  4PCQ A;  2RGV A;  4UVA A;  4XLN F;  2XAS A;  4LD5 A;  4OOI A;  3RKX A;  4I2O A;  1U5T B;  1BBY A;  2A6E F;  3JTG A;  5BQT A;  4CHU A;  3M8F A;  1Z6T A;  4ZYH A;  3F8N A;  2DO7 A;  4GCV A;  4FX0 A;  3L9F A;  3WTV C;  2OZ6 A;  5DEQ A;  3WGI A;  1HKT A;  1IN4 A;  3RI4 A;  4ENJ A;  3F8M A;  3DV8 A;  2PBI A;  2O3F A;  2HWV A;  1KU9 A;  3WTY C;  3JAM K;  3GXO A;  2DBB A;  3I64 A;  3B73 A;  5JI6 A;  3F6V A;  2FA5 A;  1SD5 A;  4NQW A;  3DQV C;  1IF1 A;  1O57 A;  1U2W A;  3ULQ B;  1IN7 A;  3F21 A;  1YS6 A;  5L3D A;  3OV8 A;  2OQG A;  1FOK A;  2EA4 A;  4L9V A;  2CW0 F;  5CVJ A;  5FB2 A;  2VBX A;  4XSZ F;  1YTY A;  3LAP A;  1MDM A;  2Z99 A;  1SD7 A;  1MZB A;  4R79 A;  1HBX G;  3HHH A;  4AIK A;  2Z5U A;  5D5W B;  5L3B A;  1FYM A;  4LLL A;  1F5T A;  3V7R A;  4NHJ A;  3LAJ A;  4G7O F;  3TOB A;  2RQP A;  1DPU A;  1XN7 A;  2V79 A;  3LFK A;  1ZG1 A;  3AAF A;  4M6X A;  3GLX A;  2KIM A;  2ZBK A;  3E5X A;  3CUQ C;  4I09 A;  3VOE A;  4WXH A;  4KMF A;  2IW5 A;  2DW4 A;  4EJW A;  3Q9S A;  1UB9 A;  3KET A;  3JSP A;  1O3T A;  3MZH A;  2IA1 A;  5ICF A;  4E70 A;  3HYI A;  4I7H A;  3RIR A;  2DQL A;  3WTT C;  3MEX A;  4ZYG A;  2GWR A;  3MWM A;  3KFW X;  1SFX A;  2XRN A;  2E1C A;  1ZGA A;  4HV5 A;  2Y75 A;  1YLF A;  1XCV A;  4ZYE A;  4DNC A;  4U0V A;  2H94 A;  2V9V A;  3CUQ B;  2YSR A;  1QBJ A;  4BQA A;  2HR3 A;  2R3S A;  2FF4 A;  2O0Y A;  3O6B B;  1ZYR F;  3HHG A;  2F5C A;  5IT9 Z;  1T6S A;  4RGS A;  1P2F A;  4KIF A;  3FX3 A;  1OMI A;  3V8J A;  1O3R A;  5LGN A;  2MC3 A;  3NQO A;  2PMH A;  3FMR A;  1SFU A;  3EUH A;  4U88 A;  1R1T A;  4ETS A;  5LEK A;  4YG2 F;  3E6C C;  2W57 A;  1BC7 C;  2LF7 A;  5DYM A;  3O2P E;  4FX4 A;  3IL2 A;  1S29 A;  4U7D A;  4YFX F;  2D1H A;  4RS8 A;  3HSR A;  2HZT A;  2VBW A;  4HLX A;  1XGO A;  4A5N A;  5HS8 A;  3IKT A;  2YX4 A;  3RPQ A;  1F9N A;  5ILU A;  4HQE A;  2Q8K A;  4BXU A;  1TQM A;  2K4J A;  5CJ9 A;  3CJN A;  1S7O A;  2UXN A;  2KJB A;  2A5Y B;  4AVP A;  4HW0 A;  1F4K A;  3F3X A;  3IHU A;  2M45 A;  3TOA A;  2YX7 A;  3T0Y A;  2BBY A;  4PGH A;  3ECH A;  1SAX A;  1J7K A;  1FP2 A;  5FO5 A;  1NHA A;  5E17 F;  1ZRF A;  1FYK A;  3ML6 A;  1QO0 D;  3F23 A;  3Q5F A;  3HRU A;  3FM3 A;  4A0Y A;  5D4S A;  2WWY A;  1YW8 A;  2COM A;  2ADU A;  2F5D A;  2IA0 A;  2ZNZ A;  1DP7 P;  5CVU A;  3EYI A;  4WXC A;  1P4X A;  1TNS A;  3EQL F;  2NAZ A;  1FZP B;  1UHM A;  3C3W A;  5LRS A;  2W84 A;  5BS6 A;  4IRH A;  2E1N A;  2P8T A;  5E8I A;  4AIJ A;  4G6D A;  1YIO A;  4CZZ A;  3E6D A;  3WTU C;  4LMY A;  3F8C A;  4HA8 A;  4L5I A;  3IRQ A;  3ABU A;  4G8X A;  1QGP A;  4MTD A;  4BNC A;  1ULY A;  1WQ2 A;  2P6S A;  2A69 F;  3ECO A;  2J5P A;  1R5G A;  3OOP A;  5D6F A;  3I0T A;  4CYD A;  4P9U A;  1QPM A;  3R60 A;  3KLN A;  2EFW A;  1BI3 A;  5L3E A;  3RYP A;  3J80 Z;  3N4M A;  2HEO A;  2DQR A;  1UFM A;  5AIP A;  2ZNY A;  5CYV A;  1XSD A;  3BP8 A;  1ZG3 A;  1MKM A;  4K2E A;  3BY6 A;  4OIO F;  2QZ8 A;  4AIH A;  3T8T A;  5ILV A;  3ELK A;  2HKX A;  3F6O A;  4EQQ A;  2L4M A;  4MHG A;  3JW4 A;  4CDG A;  5EEG A;  4P5O A;  3H3Z A;  2G7U A;  4EVI A;  4L9T A;  2Z3Y A;  4RB3 C;  4KIG A;  4LLN A;  1Z7U A;  4A6D A;  5E1X A;  2FNA A;  4R8H A;  2WV0 A;  2GXB A;  4G7H F;  3CTA A;  5ED4 A;  1FC3 A;  5DUI A;  5ICE A;  3C18 A;  2FXA A;  2IVM A;  5H20 A;  3F8B A;  2XAF A;  4Z2Y A;  4B8X A;  1EH6 A;  4L0Y B;  3GFJ A;  2MA3 A;  3MZY A;  2FOK A;  1ZN2 A;  1LDJ A;  2HYF A;  3BJO A;  1W5T A;  5LHI A;  3I4P A;  3Q9V A;  1L3L A;  1BC8 C;  1MDM B;  1JXS A;  4BHP A;  5DCF A;  4ESB A;  2IT0 A;  3R4K A;  4KT5 C;  2FE3 A;  3J80 K;  3BRO A;  4WCG A;  1LEA A;  2VOO A;  2NS0 A;  3D5L A;  4Y17 A;  1LEB A;  1KQ0 A;  1RI7 A;  4I02 A;  1ZRC A;  4QLC U;  4HOB A;  4G6Q A;  5HDG A;  4N0B A;  2RV8 A;  3H92 A;  2O03 A;  2XAQ A;  1CF7 B;  1PP8 F;  2Q0O A;  3SXY A;  2Z33 A;  3E97 A;  1ZAR A;  1I6X A;  4EJU A;  2FML A;  3QPH A;  5E8G A;  5J8C A;  5CVI A;  5L3C A;  4RAZ A;  2XAH A;  4HX8 A;  2DFI A;  3BDD A;  1KA8 A;  4MTE A;  4ENK A;  1D3Y A;  4BH9 A;  3TO7 A;  5E1W A;  5FFZ A;  4U0W A;  1B6A A;  1H0M A;  4L9N A;  1XMA A;  1B9N A;  5H6Q A;  4Q4Z F;  3E5Q A;  5D5V B;  3KP5 A;  1FNN A;  4EMS A;  2A68 F;  5FD5 A;  2K02 A;  3V7C A;  2FBH A;  4Q48 A;  3RJP A;  2BEO A;  4KYW A;  2P4W A;  2R7D A;  1FT9 A;  1R1U A;  2QM3 A;  3MFK A;  3GYH X;  4R1H A;  2UWM A;  2ZME A;  3FF5 A;  1I27 A;  3T5X A;  3TGN A;  1TNT A;  2PLY A;  2CWE A;  2K7L A;  5E1Z B;  2XVC A;  3VFZ A;  2OBP A;  4G7Z F;  1FP1 D;  4P96 A;  5ICC A;  4LK0 F;  4HDV A;  3H3U A;  3NRV A;  3LST A;  1K6O A;  4MEY F;  3P7N A;  3R0J A;  2OA4 A;  2EWN A;  4LK1 F;  5JHU A;  1BOA A;  2H09 A;  3GFI A;  1U8R A;  1I1S A;  5LGU A;  1I1G A;  3WTX C;  1FSH A;  2V1U A;  2QUF A;  3HRS A;  1OYI A;  3BOQ A;  3U2R A;  2UXX A;  3I54 A;  5FFX A;  2CQK A;  3IC7 A;  3R0A A;  5FD6 A;  4ZZL A;  4YFK F;  2LF8 A;  1Z1D A;  3WTZ A;  2MH2 A;  3ZN1 A;  4OIQ F;  1O3Q A;  4M9X A;  1LJ9 A;  2HGC A;  1ZRE A;  2L02 A;  1G3Y A;  2IP2 A;  2EA2 A;  1QZY A;  2OAZ A;  3G3Z A;  2L01 A;  1YS7 A;  3TQN A;  3KEO A;  2DTR A;  3LWF A;  1QQI A;  2FQ3 A;  1IW7 F;  1W7P A;  2OD5 A;  2FU4 A;  5LHH A;  1R5H A;  1T2K A;  1MGT A;  4JBA A;  1R22 A;  3BWG A;  2CO5 A;  3FM5 A;  1WSU A;  4AWX B;  3L2C A;  2NRA C;  4EM0 B;  2EFP A;  1LVA A;  5LRR A;  2HQN A;  1IZ1 A;  1EH7 A;  1G6N A;  1CF7 A;  3PQK A;  1XD7 A;  4L18 B;  1SFE A;  4FT8 A;  4LJZ F;  2ZO4 A;  4OU0 A;  1OR7 A;  3T8R A;  3W6J B;  5HVQ C;  1ZG5 A;  1ON2 A;  1ZAO A;  5CVR A;  1E2X A;  4BYY A;  2YU3 A;  1FBQ A;  4XLP F;  2JSC A;  2VON A;  2XKO A;  4DQ2 A;  1W7P D;  1L0O C;  3GF2 A;  2DLL A;  3EDP A;  5D5U B;  1J59 A;  1XGS A;  1D8K A;  2VXZ A;  1H9T A;  1AOY A;  2P5V A;  4ZZD A;  2VBZ A;  3ERE D;  1KU7 A;  1UCR A;  2Y48 A;  1YW7 A;  4ZH4 F;  1OPC A;  3R61 A;  5H6R A;  3HIF A;  4B09 A;  2MD5 A;  1HXD A;  5HDN A;  4MQV A;  4CXF A;  3MAJ A;  4WX9 A;  1Y0U A;  4LGW A;  1K78 A;  1T98 A;  1RZ4 A;  1KQ9 A;  3KLO A;  4HDU A;  1WRJ A;  4LLG F;  3ZN0 A;  2STW A;  1OYW A;  2RN7 A;  1YQA A;  2IJL A;  2MLG A;  4L5J A;  2V6C A;  3COA C;  1U78 A;  1R23 A;  3KP6 A;  1X3U A;  2JT1 A;  3S2W A;  3WU0 A;  1R00 A;  3WGG A;  4PDK A;  4XSX F;  3B02 A;  1K7A A;  2VBY A;  3QPT A;  3ABT A;  5JR3 A;  5F6F A;  4RB0 A;  3F72 A;  3FXQ A;  2DT5 A;  3RTR A;  1ZLJ A;  3HRM A;  4EJV A;  1XCB A;  5DD4 A;  2JPB A;  3LQQ A;  2KIU A;  2E7W A;  2HS5 A;  1S6L A;  4UVC A;  3ZMD A;  3DP7 A;  2K86 A;  1U3E M;  1FSE A;  3P9K A;  4M74 A;  5K5R A;  2TDX A;  2A61 A;  5E20 A;  2P5L C;  4KN7 X;  5FLX Z;  5TRD A;  2G7H A;  2KJC A;  2WTE A;  4HYE A;  1SD6 A;  3WOD F;  4KA4 A;  1G3S A;  1S7A A;  4EGZ A;  1BI2 A;  4AD9 A;  2A3S A;  2HTJ A;  2D45 A;  1B9M A;  3ISP A;  4HX7 A;  1GXQ A;  3V8L A;  4M9S A;  1WWX A;  2QYO A;  4H0E A;  4OMY A;  1LDK B;  3RYR A;  4Y13 A;  2H6B A;  1O7F A;  4BHB A;  1BI1 A;  1PDN C;  3ZMU A;  1WKM A;  1TBX A;  5F1R A;  4I0A A;  2QVO A;  3O3K A;  3ZP5 A;  1YO5 C;  1E17 A;  1LNW A;  4N9H A;  3KP4 A;  5K5Q A;  1O3S A;  2XAG A;  1DDN A;  5DCM B;  2EFO A;  4UNO A;  3ZMT A;  2EB7 A;  4GYG A;  4P55 A;  4HLY A;  4O5V A;  2ZME B;  1SD4 A;  4A0X A;  3LA7 A;  3TDU C;  3PQJ A;  3LQR A;  1LDD A;  5CVV A;  5HLH A;  1BM9 A;  5FGM A;  2MH9 A;  2LSO A;  3MCZ A;  4BHC A;  1LB2 A;  5FLX K;  3M9A A;  2F5F A;  4HF1 A;  3GEZ A;  3BJA A;  2HKO A;  2STT A;  2M5W A;  3GO5 A;  3GZ5 A;  3L7W A;  3IRR A;  1G4D A;  1XB4 A;  2M30 A;  2ETH A;  1IRG A;  2RDP A;  4A2U A;  3P9C A;  2Y0M A;  4EGY A;  3E6B A;  4MEX F;  3IKV A;  2VE8 A;  4IJA A;  3FXR A;  2QQA A;  3I59 A;  1B59 A;  2WC2 A;  5D6E A;  2M87 A;  2ZJ2 A;  4UVB A;  3HUG A;  2FMY A;  2OZU A;  4A12 A;  3K1P A;  1G3W A;  2R7F A;  4M72 A;  2QBY A;  5E18 F;  2VN2 A;  1MJA A;  5BPI A;  3F22 A;  1I5Z A;  1RNL A;  5JVT A;  2EV0 A;  2W24 A;  3D0S A;  1ONV A;  2NNN A;  3RKW A;  1W7P B;  1DUX C;  4KDP A;  2EFQ A;  2OQR A;  1R1V A;  1JE8 A;  5DV5 A;  4LFU A;  2XRO A;  2JRT A;  3GWZ A;  2AS5 F;  2O8X A;  2FBI A;  4QWQ A;  3CLO A;  1GHC A;  2NNY A;  3IWZ A;  1P6R A;  2XUB A;  2GIV A;  2VE9 A;  3WE2 A;  5LHG A;  2FEZ A;  3LA3 A;  5HS7 A;  3ZMS A;  2EFN A;  3WTW C;  3EET A;  1XSV A;  2HDC A;  4HBL A;  3KZY A;  1FY7 A;  1J5Y A;  3BJ6 A;  4RAY A;  1UST A;  4S04 A;  1UHW A;  3CDH A;  1H9G A;  4O6J A;  2VT3 A;  1JHF A;  2H6C A;  3CUO A;  3GFL A;  2W85 A;  4XRF A;  2GQQ A;  1IUY A;  1ZLK A;  5TJJ A;  1FLI A;  4XBF A;  5LEJ A;  1STZ A;  4CGZ A;  3FHZ A;  4GXO A;  4KFC A;  1J75 A;  1SMT A;  5D5X B;  1KQ8 A;  1V4R A;  3N97 A;  1P92 A;  1EV7 A;  3M8E A;  4OIP F;  1IN8 A;  3T1B A;  3DPT A;  5DCM A;  4RGX A;  4ESF A;  1K78 B;  1BIA A;  2PFB A;  1P4W A;  1W5S A;  4RB2 C;  4ENN A;  3DKW A;  2FBK A;  1GXP A;  2NYX A;  3JTH A;  4I98 B;  3KE2 A;  1YW9 A;  4MGR A;  2PJP A;  5AIQ A;  1MD0 A;  4A0Z A;  5DUK A;  1Q1H A;  3W6K B;  3GVA A;  4KUM A;  1FWZ A;  4EJO A;  2D2W A;  1BIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...