3U2RA

Crystal structure of marr transcription factor from planctomyces limnophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
135
Chain Sequence
RFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVHPEGMATLQIADRLAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MarR transcription factor from Planctomyces limnophilus
rcsb
source organism Planctomyces limnophilus
molecule tags Transcription regulator
molecule keywords Regulatory protein MarR
total genus 49
structure length 135
sequence length 138
ec nomenclature
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u2rA00
2QENA 4A2UA 2STWA 4Q48A 1UHWA 4M71A 4PDKA 1P4XA 2VE8A 4IRGA 2VBZA 3CO6C 2DPUA 2RKHA 1HSJA 1D5VA 4IPAA 3WTSC 1IN4A 4Q4ZF 2ESNA 3GF2A 5LLQA 4YFXF 1I6XA 2Q2EA 5BPDA 2ZKZA 1RIOH 4EQQA 1KU3A 4AD9A 4M6YA 3J7AO 3E6CC 1TLHB 3KZZA 2ZMEB 4RGXA 2ZFWA 2X0LA 2V79A 4KMUX 4WCGA 3QPHA 3BOQA 3DPLC 4LG0B 1DP7P 3GEZA 4OIRF 1LVAA 5FGMA 5D6EA 2GXGA 2F5CA 2L4AA 4G7HF 1STZA 4YFKF 1TW2A 2KIFA 5KVRA 4KA4A 4LK1F 3TOAA 1KGSA 4OIPF 3M8FA 1F5TA 2Z9OA 1TNTA 2ZJ2A 4HDVA 2QQBA 3RYPA 2FXAA 2RC4A 2OU2A 3ELKA 2M5WA 1R7JA 3WGGA 3KLNA 1IRGA 1ZLKA 5ILSA 3KFWX 2VN2A 3SHFA 2A6EF 1T0FA 3JAMZ 1BOAA 4NQWA 3ERED 3IWZA 4G6DA 1Z6TA 1UHMA 2P5LC 1FWZA 1XGSA 1SMTA 4Q5SF 2IPQX 1FY7A 1U3EM 4KIBA 1FBQA 2BE5F 3S2WA 3K1MA 1K7AA 2GAUA 5HS8A 3SZPA 4KMFA 1SFUA 1ZARA 1CGPA 4LLGF 1AOYA 1R1TA 5DCMA 4IF4A 1YYVA 1KYWA 1O7FA 1CF7B 2CW0F 2P8TA 2CO5A 1F4KA 4CXFA 3KEOA 1J5YA 3FMQA 3H3UA 4PCQA 4L0ZB 4M9ZA 5FFZA 2M1BA 1FPQA 1P6RA 3CDHA 3TO6A 3ZMZA 1J75A 1R36A 3CUQC 5TJJA 1EH7A 3GO5A 1O3RA 4UNOA 4IVNA 1GXPA 4L0YB 3P9IA 5KK1A 3DP7A 1S8NA 3ROUA 4EJOA 3ZP5A 1LDKB 2HKXA 3K0LA 5H20A 3C3WA 1XB4A 2HFHA 3F8CA 1B59A 2PEXA 4QLCU 1J59A 4I09A 3DKWA 4BH9A 5CYVA 2WWYA 2EFQA 3EUHA 3K1NA 2QM3A 1ZLJA 4HLXA 4S04A 1FP2A 3HRSA 4KT5C 3AAFA 2V6CA 3EETA 2DW4A 1SFEA 2HDCA 1BI1A 2NAZA 1W4MA 2M8EA 1ZGJA 4EGYA 1EV7A 1ZGAA 3MCZA 4GXOA 2HS5A 3ZMSA 4WXHA 2E7WA 4AIKA 3DXJF 1HKQA 1HW1A 1XMAA 1WRJA 2A6HF 3L9FA 2W57A 4OMZA 1BIAA 2UXNA 2MLKA 1P2FA 4GYGA 1IF1A 4XLPF 1B6AA 4A12A 5ICCA 4S05A 2BGCA 5BQTA 2IRFG 1WI9A 2DBBA 3QRFF 3K9TA 1KU7A 3LQRA 1U8RA 1W5SA 1LNWA 3WTUC 3WTWC 2MH2A 3WU1B 1FZPB 1JGSA 1S7OA 1G3WA 4WXCA 3E3VA 3F6VA 2LSOA 1XD7A 2XROA 4KYWA 1HKTA 5D5XB 5L3EA 1VTNC 2XV4S 1FBUA 3COAC 2PJPA 2VODA 2XRNA 3GFMA 4LMYA 1QO0D 1L3LA 2ETHA 1HXDA 5H6QA 3ECHA 4ZH4F 2V1UA 4BHCA 1P4WA 3F72A 4ENMA 2RQPA 5DCFA 5J8CA 3ZMUA 2FMLA 2L02A 4BXUA 1K79A 1JXSA 2XUBA 1DUXC 4BHBA 3ZQ7A 3H92A 2QQ9A 4OMYA 3EDPA 2O6GE 2FMYA 3F23A 3VEPA 4EJWA 3GUDA 2RV8A 3D0SA 3I5UA 1H0MA 3D5LA 3FXQA 3TO7A 2Z5UA 5HDKA 2K4BA 2XAJA 2VE9A 2W24A 2OAZA 2IT0A 4R8HA 2Y48A 1TTYA 1ZG5A 3I71A 2DK5A 4U0YA 3W6KB 2XVCA 4KFCA 1FC3A 3BWGA 2EFOA 2LNBA 1PUEE 4HF1A 1IXRC 2Y0MA 3GFJA 3QP6A 4XBFA 2H09A 2FF4A 1RUNA 3TKYA 5JVTA 1B9NA 1YS7A 2ESHA 1TQMA 5LRSA 1XSXA 1HQCA 1U5TA 4L9TA 2QZ8A 5CJ9A 1TBXA 4KN4X 1PP7U 2D1HA 5CLSA 4LB5A 1YW9A 1QPMA 4RS8A 5D6FA 2KIMA 3V4GA 2TDXA 1NHAA 4EJVA 3LSTA 1IRFA 1LQ1A 3CTAA 1G4DA 2X4HA 4M74A 3E5QA 4WK8F 3KLOA 3NEUA 2Z33A 3U1DA 4AVPA 2CG4A 2RDPA 3O3KA 2EB7A 2CSOA 4HQMA 1UCRA 2XHKA 3ZN1A 3T8TA 2G7UA 1G3SA 3G3ZA 3L2CA 3T5XA 2O8XA 5E1ZB 2DPDA 3U9GA 1EH8A 2CYYA 3F6OA 3ISPA 1HW2A 2W85A 2NNYA 4MQ9F 1GXQA 2UWMA 1UB9A 4MEYF 5HS7A 5D8KB 1G3YA 2Z99A 2K4JA 4WXDA 4HYEA 5K5RA 2BEOA 3BZ6A 3GXOA 3I4PA 2WV0A 4UXNA 2ZBKA 2F5EA 1FLIA 1SD6A 1WSUA 5JI6A 4BYYA 4HX8A 1XDSA 3JTGA 4N0BA 2EFNA 3T1BA 1QZZA 5L3BA 1BJAA 2VBYA 3F8BA 1FOKA 1R22A 2H6CA 3P9KA 1FYLA 2QVOA 2JRTA 2HZTA 4HLYA 2YU3A 1XSVA 1SAXA 4G7OF 1IXCA 1BN5A 5ILVA 5FD5A 1UFMA 2R7DA 1J0RA 1FSHA 1W7PB 3OV8A 2QLZA 4LFUA 3GZ5A 4OIQF 3R0AA 3KE2A 4I98B 4U0WA 1MDMB 5D5UB 2XKOA 2DK8A 2DU9A 2BYVE 1R5HA 5BMZA 2FU4A 4CO8A 5K5QA 1MZBA 3B73A 4KNYA 3DF8A 4HV5A 1HSTA 4G7ZF 4LB6B 1TNSA 3HRMA 3V7CA 2W25A 1R58A 5LHGA 3HOTA 4EJUA 3L7WA 2C6YA 1I1SA 1O7LA 1O3SA 1HKSA 2E1CA 1KU9A 2CFXA 5D8LB 4O6JA 1E17A 4P9UA 2EJRA 3Q9SA 4CHUA 3BPVA 2P7CB 4TV7A 1S6LA 2FBKA 4UVBA 4M9XA 1A04A 3I53A 2ZO4A 2P5KA 2JT1A 5ICGA 1BBYA 3H3ZA 4GYIA 5LEKA 1MJAA 5JR3A 3J80Z 4EJTA 3M7GA 1IN6A 4MTDA 5ILUA 3B02A 3BJOA 3GYHX 3LA2A 5L3FA 5D5VB 4EGZA 1H9TA 5F6FA 3FM5A 3Q9VA 1W7PA 4CYDA 2CGPA 3QP5A 2QUFA 1YW7A 3QU6A 3F3XA 1S29A 3FXUA 2PI0A 1MKMA 4NHJA 2OBPA 4M72A 2HTJA 3FXRA 2YX4A 5DUKA 1ZYRF 3IHUA 3WG9A 3JSPA 1YQAA 4U0VA 1OR7A 1K78A 3PQJA 4HZFA 2K27A 1Q1HA 4ZYDA 1WQ2A 4IJAA 5CVIA 1LEAA 4BQAA 1IN5A 2DAOA 4QWQA 2Q0OA 2HR3A 4PGHA 5CVJA 2XASA 3RKXA 2E1NA 1YO5C 2HYGD 1DPRA 5E8GA 3IWFA 1LDDA 3HSEA 2OQRA 2P4WA 4FHTA 1B9MA 3ML6A 3N97A 1QNTA 3M9AA 1OKRA 2FA5A 2A07F 4Y15A 3LFKA 1YFHA 1C0WA 4ETSA 3HHHA 1WWXA 2JPBA 3IRQA 3KP5A 3WTVC 3WTXC 2DT5A 2H6BA 1E2XA 2J5OA 2RN7A 3HRUA 4U7DA 5JHUA 4A5MA 1I27A 3RYRA 2STTA 3BDDA 4LK0F 1ZRFA 5FB2A 3IC7A 3R0JA 4B8XA 1D8JA 2HKOA 4KDPA 3KP6A 3HOSA 4XLNF 3WGHA 1BI0A 4H0EA 1IUYA 1XGOA 2OA4A 3SQNA 4KN7X 5DV5A 4NB5A 1YTYA 4UV9A 4N9IA 4XSZF 2Q8KA 3GWZA 3BJAA 3L09A 2CQKA 4OIOF 4A0YA 4WF2A 3GZ6A 3J81Z 4P96A 2P6TA 3M1EA 5ICEA 3EQLF 2LDUA 1QZYA 1U78A 1RNLA 1KU2A 1T98A 1G6NA 1O3QA 4UHTA 1OYIA 1CF7A 4U7BA 4A0ZA 2DI3A 2DQRA 2KJBA 1IN7A 3RKWA 2VC0A 5K1YA 1T39A 2P5VA 1IW7F 3SZTA 3C7JA 2MC3A 1T6SA 4O3MA 1XMKA 2IP2A 4ASNA 3DQVC 2PMUA 3PFIA 3TQNA 4R79A 2M45A 3TOBA 5LGUA 1ON1A 2GWRA 5LEJA 1JE8A 3V8JA 4CICA 4P5OA 5LHIA 2NYXA 2IA2A 5F1RA 4Q47A 3JAMK 4I2OA 3BP8A 2A68F 3HIFA 2VT3A 1P92A 3TO9A 2HYFA 1I1GA 2EA2A 2UZKA 3MWMA 3HSFA 5JFRA 5F64A 2D1VA 3TDUC 2ISZA 4ENJA 1U2WA 3VFZA 1Z05A 4HAMA 1RZ4A 2DLLA 2GZWA 3HRTA 1FP1D 3P9CA 2MA3A 2A61A 4IRIA 3ZMTA 2PFBA 3HSRA 5HDGA 4EV0A 2PLYA 3E6DA 2JZYA 2Z3YA 4GO1A 5L3GA 1KQ9A 3VODA 2NNNA 2FEZA 1YS6A 1REPC 4N9HA 4ESFA 3CUQB 4ENKA 1R5GA 3BY6A 4HW0A 3IL2A 2ACJA 3CUQA 1G3TA 2BV6A 5E1XA 1FYKA 1QBJA 1ZRDA 2P7VB 5FD6A 4G8XA 1LJ9A 3J80K 3F8NA 1QQIA 1S3JA 4RB0A 4DQ2A 2PN6A 5LGNA 5DYMA 4KICA 4UVCA 2YSRA 3N4MA 1PDNC 1T2KA 3EYYA 5DD4A 3R60A 3NRVA 1ZRCA 4L9NA 4G9YA 1ZH5A 3HTUA 2MH9A 4OOIA 4IXAA 1Z9CA 4I7HA 4YIIA 4R1HA 3LA3A 1T38A 5ED4A 3M8EA 2AXLA 1USTA 3T0YA 5LRRA 4YIFA 1S7AA 2L01A 2PMHA 4FX0A 3R6SA 1XSDA 1KQ8A 3ZPLA 2L3DA 1DDNA 1XN7A 3I64A 4JK1X 4CDGA 1OYYA 1F9NA 4EM0B 2ELHA 2OQGA 2IA0A 3V7RA 4RGSA 2NS0A 2B0LA 3FM3A 3OOPA 1L0OC 2W84A 5D4SA 4HF2A 4A5NA 1MDMA 3V8KA 5BOXA 5E18F 2D2WA 4KIFA 4EM2A 5IT3A 1XCBA 4ZZDA 4P55A 1GHCA 1PP8F 4CZZA 4Z2YA 3RJPA 4A6DA 4O5VA 4AIHA 3WGIA 2PQ8A 4M73A 2F5FA 4BHPA 1FNNA 1TQIA 2L4MA 1IN8A 2XAFA 2IVMA 1ON2A 2G7HA 4M6XA 5DCMB 2KJCA 3FF5A 5FLXZ 3PQKA 3ZMDA 2FRHA 1D3YA 1V4RA 2RGVA 1B4AA 1V3FA 4I0BA 3LA7A 5J6XA 4Y13A 4E70A 1FYMA 2H27A 5E17F 3JW4A 4M9SA 4HDUA 3HHGA 4CGZA 3DFGA 4WWCA 3KP4A 3MEXA 1RI7A 1ZHFA 1SD7A 4LLLA 3DEUA 1B1BA 3C1DA 4AWXB 3IKVA 1YIOA 4UVAA 4GGGA 1GVJA 1ONVA 3GVAA 3TDZC 2L54A 2FOKA 5AIQA 5J8FA 3MFKA 3IKTA 3GLXA 3LQQA 1FX7A 3FMSA 3MZYA 4K2EA 1ZREA 1Z7UA 3WE3A 2A69F 4OINF 3O6BB 1K6OA 3KZYA 1XDUA 1USSA 3J81K 1U5TC 2KRFA 6PAXA 1ODDA 1I5ZA 1WKMA 4HQEA 1K78B 1OPCA 2QBYB 2V9VA 4ZYGA 3DV8A 2XGXA 4ZYEA 1IAWA 4BNCA 1ZG3A 3O2PE 2DO7A 1Z6RA 3LAPA 5A2QK 2ZMEA 3KP3A 1HBXG 2QYOA 2ZXJA 1LEBA 2R7FA 1RUOA 2VXZA 4EM1A 3E5UA 4IRHA 3I58A 1Y0UA 2HEOA 2O0YA 3ZN0A 4LJZF 2HWVA 1SFXA 1XGNA 5DUIA 3GX4X 3CJNA 5CVVA 3BPXA 1J2XA 3QPTA 5L3DA 1SMYF 1BI2A 2PG4A 4Y17A 5DEQA 1X3UA 3K69A 3JTHA 4U88A 5HS9A 3MZHA 2XAHA 4OU0A 3F8MA 2VOPA 4YG2F 2YR2A 2HTSA 4KUMA 4KIGA 2O03A 5H6RA 4I01A 4G6QA 3I59A 1R1VA 2G9WA 4HBLA 3V8LA 3W6JB 2HQNA 2JSCA 4GCVA 5BPIA 3MAJA 2EWNA 1LDJA 3JSOA 5L3CA 4JQFA 3Q5FA 1MJBA 3VOEA 2FNAA 4MNUA 2BBYA 4L9JA 3WU0A 1R1UA 1YW8A 2JTVA 2XIGA 4PGGA 1ZAOA 2QQAA 3VB2A 2LF8A 2GXBA 4HOBA 2GIVA 2A3SA 3FX3A 3EYIA 3SXYA 3R4KA 2VT2A 1W5TA 3WTTC 1LB2A 4HX4A 1XGMA 2QWWA 4LLNA 3WTZA 4BAYA 4EMSA 2PBIA 3KP7A 2YPRA 5D5WB 3HUGA 5K5OA 3KETA 2MLGA 4LD5A 1DPUA 4L18B 2M87A 5E8IA 2WC2A 3DPTA 1KA8A 5LBQA 3NQOA 3I54A 5A2QZ 2ISYA 4I02A 4MHGA 2LF7A 4ON0A 1Z91A 2ADUA 1JHFA 3V7SA 1KQ0A 5HOOA 5ERIA 3WE2A 3R61A 2DQLA 5HLIA 2ZCWA 2DTRA 1YLFA 3E6MA 4RGRA 2OZ6A 3MQ0A 5AONA 3U2RA 4ZZLA 3G73A 3GFLA 3C18A 4RB2C 4ZYHA 4JBAA 5EEGA 3FZVA 1D8KA 4XSXF 3F21A 3FHZA 2DFIA 4XRFA 1BC7C 5HDNA 1IXSB 1ZG1A 4D0PA 4FX4A 2FBIA 4I0AA 4LGWA 3RPQA 1MGTA 1R00A 2AS5F 2ZNZA 3CUOA 4G94A 1QGPA 1R23A 2K7LA 4L5JA 5HVQC 2EV0A 2FBHA 3FMRA 2E7XA 4YFNF 4L5IA 5DDGA 2YX7A 5CVUA 2P6SA 2IW5A 3E97A 4UUVA 2HOEA 1EH6A 1AWCA 3BROA 4ENNA 3F22A 4RAZA 3KEQA 5EEHA 4UV8A 3IRRA 1BI3A 3CLOA 2O61A 5LGTA 3LWFA 4IHTA 1JHHA 4FT8A 2HGCA 4HA8A 3RTRA 4MQVA 1O57A 3E5XA 3K2ZA 2H94A 2V1XA 2FE3A 5ICFA 2O3FA 1OMIA 3REOA 1U5TB 4A6EA 5CVRA 1U6GA 3WTYC 2IA1A 2MBFA 2K86A 3F8FA 3L00A 5AIPA 4P9FA 2QBYA 2LKPA 2V1DA 4MTEA 2OD5A 3P7NA 2XAQA 4AIJA 1BM9A 4PZJA 2GA2A 4F7ZA 3E6BA 2VOOA 5IT9Z 2F2EA 4ESBA 2J5PA 1TW3A 3KP2A 4HV6A 4MEXF 1HW5A 2EFPA 2UXXA 2CWEA 4RGUA 2FQ3A 1YG2A 2VC1A 2EV6A 2GQQA 5IT9K 1FBSA 5LHHA 1OYWA 5FO5A 1MD0A 3SFZA 3QAHA 2EFWA 4DNCA 2RNJA 3KCCA 2JPCA 4WX9A 1O3TA 4RAYA 3BJ6A 1MJ9A 3T8RA 4HX7A 1J7KA 1XCVA 3TGNA 2EV5A 3K1PA 5E20A 5HLHA 3GFIA 5FFXA 3RIRA 3ECOA 5E1WA 1J9IA 3QOPA 5BS6A 4L9VA 2NRAC 1W7PD 5DD8A 4RB3C 5HLGA 2KIUA 2OZUA 1BIBA 2XKPA 1IZ1A 2EA4A 2XAGA 2Y75A 1SD5A 3I0TA 3FWEA 3ULQB 4LG0A 2MD5A 3I59B 3HTSB 2R3SA 3RPUA 4EVIA 3ABUA 4A0XA 2COMA 2K02A 1F1ZA 4IHSA 1KYZA 1Z1DA 2VBWA 2KKOA 3LAJA 1H9GA 2A5YB 2WTEA 2FNPA 2EK5A 1ZN2A 1SD4A 3HYIA 2HQRA 1P4AA 3ABTA 2RVCA 2VBXA 2GA1A 5D4RA 3RDIA 1FT9A 5TRDA 3RKYA 2VONA 3RI4A 2FSWA 1BC8C 1FSEA 3QU3A 3WODF 1ULYA 4B09A 4ESJA 2F5DA 3ZMVA 4RB1A 2IJLA 4HF0A 1TQPA 3CO7C 3GW2A 4MGRA 2D45A 2ZNYA 2M30A 5FLXK
chains in the Genus database with same CATH superfamily
5B66C 2QENA 4A2UA 2STWA 1TP4A 4Q48A 1UHWA 3M07A 4M71A 2K3FA 3BQYA 1VQ8I 2M3AA 4A69C 2UV1A 3PNVA 4PDKA 1P4XA 4BDZA 2VE8A 3OY9A 4DJAA 4IRGA 4XMYA 2VBZA 3JRIA 3QWLA 2WBMA 3CO6C 2OF7A 1MH3A 4Y3OA 2DMTA 2DPUA 2D5VA 2HOTA 2RKHA 1HSJA 1ITYA 2DA7A 2E1OA 1D5VA 4IPAA 5CPRB 4FETA 3WTSC 1KONA 3KPHA 3QPLA 3S8PA 1IN4A 4Q4ZF 1T8IA 4W97A 2ESNA 2LKSA 3GF2A 5LLQA 1ETQA 3G4SI 4PSWA 2XGDA 1NK3P 4YFXF 2ZXWH 1ETVA 1I6XA 2Q2EA 2HQAA 5BPDA 1N75A 4B3AA 2F5VA 4JYKA 4BACA 1UELB 2ZKZA 1RIOH 4EQQA 3WHCA 3VYRB 1KU3A 4FE7A 1QU3A 4AD9A 4M6YA 1XS9A 2KRCA 3GBGA 4BXFA 3J7AO 4XR6A 2WA0A 3N05A 2E34A 5JLXA 2DODA 3E6CC 5DTDA 4B4CA 1TLHB 2Z2SB 2ZMEB 3KZZA 4RGXA 1R49A 1A36A 1AHDP 2ZFWA 4FISA 4F52A 1GUUA 4J00A 5B1AH 3RSNA 2X0LA 2V79A 4KMUX 4LIUA 4XN3A 2LOOA 4WCGA 3CMAI 3QPHA 3BOQA 4XRSA 3A0BC 3DPLC 4LG0B 3MVPA 1DP7P 3GEZA 4OIRF 3OS2A 3PJRA 2XGEA 1LVAA 5FGMA 1WPKA 2I8DA 5D6EA 2V9PA 3TP3A 2DOFA 3VYUB 2LC2A 2GXGA 4HG2A 1BOBA 3BR6A 3DLLF 2F5CA 3GTOJ 3SEZA 3OYFA 2L4AA 1IDYA 4G7HF 1VQLI 2JSPA 1STZA 3JR9A 1Z67A 4YFKF 1TW2A 2KIFA 5KVRA 1BR4A 4KA4A 4LK1F 3TOAA 1KGSA 4OIPF 3M8FA 2V26A 1F5TA 3ERMA 2Z9OA 3OYAA 3MKLA 2K9QA 1T95A 3DTKA 3AFHA 1TNTA 2ZJ2A 4HDVA 2COBA 3HL2A 1H89C 3SYTA 3LSRA 2K5CA 3HZJA 2QQBA 4ANJA 2CH0A 3H9QA 2RREA 2FXAA 1D0YA 4JX6A 3RYPA 2RC4A 2ICWG 2OU2A 3ELKA 2M5WA 1R7JA 1SVLA 3WGGA 2ZMEC 3KLNA 3BG6A 1IRGA 1ZLKA 3V42A 5ILSA 1N25A 3GCMA 4C3HJ 4EEFG 2IS2A 4HRIA 1G2HA 2JWTA 3DCFA 5EJCA 1MNEA 3KFWX 2OUMA 4S0HB 2VN2A 3SHFA 4ZJZA 2A6EF 1G59A 5FLVA 5F27A 5GADJ 5IP7J 1T0FA 3LSHA 3L2VA 3JAMZ 3U1KA 1UG2A 1BOAA 2MG4A 2YUSA 4NQWA 1EA3A 3ERED 3IWZA 4G6DA 4UUSA 1Z6TA 1UHMA 2P5LC 4UY8I 1FWZA 1XGSA 2EZHA 2NXNB 1SMTA 4Q5SF 1MBFA 2JJ7A 2IPQX 3S3MA 1FY7A 3DKXA 1U3EM 2H1KA 3HGGA 3VWBA 2DA5A 4KIBA 3HOXJ 3LSKA 1FBQA 2BE5F 4J01A 1TWCJ 3S2WA 3K1MA 2XSJC 1K7AA 2GAUA 5HS8A 2E36A 3NAUA 3SZPA 4KMFA 2KRHA 2OCEA 3MKZA 1SFUA 1TT0A 1ZARA 1CGPA 2BVMA 2F48A 1V55H 2AQFA 4LLGF 1R1TA 1WJBA 3CESA 5CKTA 1AOYA 2A6TA 5DCMA 3FK6A 4IF4A 1YYVA 4A3CJ 1MMAA 1X1AA 3JCUC 2DA2A 1KYWA 3BLYA 1YJNI 1O7FA 3MMYB 1CF7B 4A3KJ 3UNGC 1ETOA 4MLOA 2CW0F 2P8TA 4BE0A 3TEDA 2CO5A 1F4KA 1VQ7I 4CXFA 3KEOA 3M8JA 1J5YA 3FMQA 1R6RA 2L9VA 2GXAA 3HJEA 1MNDA 3H3UA 4PCQA 4M9ZA 4L0ZB 2Z16A 5FFZA 2M1BA 4CCOA 1FPQA 4NC6A 2BVLA 1P6RA 1RC9A 5GPCA 4DYCA 4ZYAA 4I99C 5GP9A 3CDHA 3TO6A 3ZMZA 1J75A 1R36A 3CUQC 5TJJA 1EH7A 3GO5A 2X6XA 1A6QA 2XGCA 2I10A 1O3RA 4IVNA 1GXPA 4L0YB 4UNOA 3P9IA 1IV8A 5KK1A 3MZ8A 3DP7A 2UUZA 1S8NA 3ROUA 4EJOA 1Z77A 2O5RA 1LDKB 1X2MA 2HKXA 3K0LA 3ZP5A 5H20A 3C3WA 5TGTA 2M2EA 2FX0A 3HB9A 1XB4A 2HFHA 3F8CA 2OCCH 1B59A 2PEXA 4QLCU 1ETXA 1I39A 2QEXI 1J59A 4I09A 3DKWA 4BH9A 5CYVA 2WWYA 1GDTA 2O9LA 2ZFUA 3FISA 1ZR4A 4W1UA 1E3HA 2EFQA 5IYBJ 3EUHA 2TRTA 3K1NA 2QM3A 1ZLJA 1UG0A 4HLXA 4S04A 4GDFA 1FP2A 3HM5A 3HRSA 2M7AA 4BS9A 2WAEA 3K4CA 4V2GA 4KT5C 3AAFA 1NK2P 2V6CA 3LNQA 4Y52J 3EETA 3S32A 5EG0A 2DW4A 1SFEA 2HDCA 1BI1A 2NAZA 1W4MA 1IV6A 3PSFA 1XC5A 4BL0B 2M8EA 1ZGJA 4EGYA 2KL4A 3FIWA 1EV7A 1ZGAA 2R7UA 3MCZA 4GXOA 2HS5A 3OR1C 3ZMSA 4WXHA 2OTLI 2E7WA 2MW8A 4AIKA 3DXJF 1HKQA 1HW1A 1XMAA 3JRDA 3PO2J 2LR8A 2FQ4A 1WHUA 1WRJA 2LFBA 2A6HF 2H1LA 3DEWA 4E7HA 3L9FA 2E1MB 4YEJA 2W57A 4OMZA 4II2A 1BIAA 2UXNA 3CQZJ 2VUMJ 3O8HA 4XL9A 2MLKA 3LL7A 1P2FA 2Q1ZB 3BTJA 4GYGA 1HDPA 1D1BA 1IF1A 4XLPF 1B6AA 3A03A 4A12A 1SEUA 4AVZA 5ICCA 4S05A 2BGCA 4C3JJ 5M5XJ 2LLKA 2P81A 5BQTA 4Y7NJ 4XNFA 1NH3A 2IRFG 4BJ6C 1WI9A 2DBBA 3QRFF 1LPQA 3K9TA 1KU7A 4IHWA 1ETYA 3LQRA 5KAFC 4M3EA 3M3YJ 1U8RA 1W5SA 1W36D 1LNWA 2WB1A 3WTUC 3WTWC 4B1RA 1E0EA 2MH2A 3WU1B 1R5ID 2ECBA 2LK2A 3H0DA 3S17J 2EZKA 1MMDA 4QTRA 1VQ9I 1FZPB 1JGSA 2EBIA 1S7OA 3VPRA 2E2IJ 2CW8A 2ME6A 3I55I 2HI3A 2OJED 3S93A 2F4MB 1G3WA 4Y33A 4WXCA 4RMNA 1R71A 3E3VA 3F6VA 2LSOA 3ZQQA 1XD7A 5KHDA 1U8BA 2X48A 2XROA 4KJZA 4KYWA 1HKTA 5D5XB 5L3EA 1VTNC 2XV4S 3L2WA 1FBUA 1NG7A 1FJLA 3COAC 2PJPA 2VODA 2XRNA 3GFMA 3AG4H 3FHNA 4LMYA 3MKWB 2E60A 1QZEA 4YRVA 3BT9A 3F9KA 4C9YA 1QO0D 1L3LA 4RA2A 2ETHA 2DXIA 1HXDA 4ABZA 1HDDC 2VKDA 5J4YA 5H6QA 3ECHA 4J19A 1U9NA 3J7AY 4ZH4F 3GTGJ 3RKQA 3CZ6A 2ID6A 2V1UA 4MO7A 2VQHA 3H9JA 4BHCA 1P4WA 1WJ5A 1R9TJ 4XKBA 3F72A 2CV2A 4ENMA 2CW7A 4UB8C 2DYRH 2RQPA 5DCFA 4BGDA 5J8CA 3ZMUA 1WI3A 3H35A 2FMLA 2L02A 4BXUA 4BQOA 4I6ZA 1K79A 1JXSA 2BOLA 2XUBA 1DUXC 4MFEA 5CQEA 4BHBA 3ZQ7A 3H92A 3S1RJ 2QKLB 2QQ9A 3ASOH 4OAYA 3HPHA 5EZHA 4OMYA 5FRMA 3EDPA 2O6GE 2R5ZA 4HNTA 2X6OA 3CMMA 4XRSG 2KZGA 2FMYA 3OYKA 4FQGA 4HPQA 3OYCA 4H4KC 3F23A 2CUFA 3VEPA 4P1WA 4EJWA 3GUDA 3SJMA 2RV8A 3D0SA 3LSPA 3I5UA 1H0MA 4E7SA 4N4OB 2LKXA 3F0CA 2LY2A 1B8IA 3D5LA 3CMYA 3FXQA 5IPAA 3CP8A 3TO7A 3CCQI 2Z5UA 1YRNB 5HDKA 3HOYJ 2K4BA 2XAJA 1Y8RB 2VKVA 2VE9A 2W24A 1Y0NA 2OAZA 2IT0A 4R8HA 3L2RA 5B5EC 2Y48A 4PK4A 3OSGA 2BHZA 2MD0A 4CZCA 1TTYA 1ZG5A 1O4XA 1K4TA 3I71A 2DK5A 1XX5A 4XONA 4U0YA 3W6KB 2XVCA 3E1SA 4KFCA 1A5JA 1V5GA 2JVGA 1FC3A 2RAEA 4XM3A 4XLHA 3BWGA 2EFOA 2LNBA 3CC4I 2AO9A 4BJTA 1PUEE 4HF1A 1IXRC 2Y0MA 3GFJA 2QA4I 2LG4A 3QP6A 4XBFA 3BZCA 1VQNI 2H09A 2XF5A 4D1QA 2FF4A 1RUNA 3TKYA 5IP6A 5JVTA 3OYGA 5FKNA 1P9QC 2R93J 1M1EB 1B9NA 1YS7A 3Q0VA 2ESHA 3J7YJ 1TQMA 5LRSA 1OR7C 2FD5A 2LYCA 1XSXA 1HQCA 3G1MA 1U5TA 4E7LA 4L9TA 2IAIA 2QZ8A 2ELJA 5CJ9A 1TBXA 4KN4X 3AL0B 1PP7U 3S1QJ 2D1HA 5CLSA 4LB5A 1YW9A 2A05A 1QPMA 5E3LA 2GOMA 1XMXA 3G1LA 4RS8A 5D6FA 2L9NA 2KIMA 3V4GA 4AYBN 2TDXA 1NHAA 4EJVA 3LSTA 2HQ5A 2IBDA 1IRFA 3OYIA 3BCAA 1LQ1A 4GRIA 1TL8A 3CTAA 4M3FA 2HDDA 1F43A 1OCCH 1G4DA 2EINH 1SANA 1ETKA 2X4HA 4M74A 3E5QA 2LBFB 4WK8F 5EZGA 3KLOA 3NEUA 2JUGA 4B48A 2MSYA 3K4MA 2Z33A 3U1DA 4AVPA 2CV0A 4BUPA 2CG4A 2RDPA 2CUEA 2E5ZA 2EIJH 4PJ0C 3O3KA 1OJLA 2EB7A 4NUBA 4FASD 2HVSA 3ASNH 3FKIJ 2CSOA 4HQMA 1UCRA 2L2OA 2XHKA 2WY8Q 3A4CA 3ZN1A 2M7BA 4I76A 2G7UA 3T8TA 1G3SA 3G3ZA 1PJRA 3L2CA 2DT6A 3KX2A 3T5XA 5J40A 2O8XA 5E1ZB 2DPDA 5FKOA 3U9GA 4BJ5C 1EH8A 2CYYA 1E3PA 3F6OA 1VFCA 1W0UA 3ZXSA 2DJNA 1Y8QB 4Y4RA 3ISPA 3RPUD 1HW2A 2R7SA 3BR5A 4PUSA 4IOCF 2W85A 2NNYA 4MQ9F 2X1EA 2VJIA 1GXQA 2UWMA 2CQXA 3HOWJ 1UB9A 1IO2A 3GLLA 4MEYF 5B1BH 5EYRA 5HS7A 1G3YA 5D8KB 3CCYA 5IOYA 3X2QH 2Z99A 4HNUA 1NG6A 2K4JA 3K4BA 3NWSA 4WXDA 3IAM2 4HYEA 5K5RA 2GM4A 2CJJA 1FEXA 2BEOA 2VASA 3BZ6A 3GXOA 3I4PA 3A01A 2Q2EB 2WV0A 4UXNA 2ZBKA 2F5EA 1FLIA 4IOAF 1VQKI 2OPTA 5KNLA 4A3DJ 2ZSHB 2IGKA 3ZQGA 1SD6A 2XSDC 2LD5A 1WSUA 1Z3YA 5JI6A 4BYYA 2QSHX 3GTJJ 1WJFA 3K70C 4HX8A 1XDSA 3JTGA 4UUTA 2LBFA 2DDAA 1IRXA 4DIQA 4N0BA 1X1CA 1R4MB 3L2QA 2EFNA 3T1BA 1QZZA 1ZGWA 1TC3C 2XC7A 3PFYA 3WU2C 5L3BA 1BJAA 2E1MC 1IRZA 2VBYA 3F8BA 2E35A 1FOKA 2YU9J 1R22A 2WAQA 2I5UA 3FBNB 4E7IA 2H6CA 5C4JJ 3PIPF 5IOZA 3P9KA 4BY7J 1VQ4I 2JQ7A 4IHVA 1FYLA 2CFOA 2R5YB 2MYSA 2QVOA 4DOZA 2JRTA 2HZTA 1IC8A 4HLYA 2YU3A 3CCVI 2DMQA 1XSVA 3EUAA 1SAXA 4G7OF 1IXCA 1ZELA 1BN5A 5ILVA 3HUGB 3IH3A 5FD5A 2KDZA 4AUXA 2AHQA 2KMUA 1WZ2A 1UFMA 2R7DA 1J0RA 1FSHA 1W7PB 3OV8A 4IHYA 2OC6A 5C3EJ 2QLZA 3SEQA 4LFUA 3GZ5A 5GPAA 1VNDA 4OIQF 3R0AA 3KE2A 2NVTJ 4I98B 4IKFA 5J4VA 3PO3J 2HOSA 4U0WA 2VPRA 1D1CA 1MDMB 3OYHA 4XKVA 5D5UB 2XKOA 2DK8A 2DU9A 2B63J 1Q1VA 4HSTA 2BYVE 1WJAA 3DU5A 5K7FA 1R5HA 5BMZA 1SFOJ 2FU4A 4CO8A 5K5QA 3FXJA 4ZC3A 4CYCB 1LKXA 2V9KA 3DBLB 1MZBA 3B73A 1MBJA 1X2NA 4KNYA 3DF8A 5DM7F 4HV5A 1HSTA 3SDBA 4C30A 2BY0A 3H5AA 4G7ZF 1WCMJ 4XOTA 4OAZA 4LB6B 1TNSA 3HRMA 5HODA 3V7CA 2W25A 1R58A 4BBRJ 5LHGA 3RQIA 2F4OB 3HOTA 2M34A 3EUKL 4EJUA 3L7WA 4D5FA 3KIOA 3CCLI 2C6YA 1I1SA 1O7LA 4AIDA 1O3SA 2KLOA 1HKSA 3FXKA 2E1CA 2FUG2 1KU9A 2CFXA 5D8LB 5C4XJ 4DW6A 4O6JA 5F0FA 1E17A 3U21A 5GTHC 4P9UA 2EJRA 1G8XA 3Q9SA 1K83J 4CHUA 1MH4A 3BPVA 2P7CB 1FIAA 3ZQHA 3OSFA 4TV7A 1S6LA 1VQOI 2FBKA 4UVBA 1VQ6I 4M9XA 1A04A 3QYFA 5H2FC 3OL3A 2R7VA 2V1NA 3I53A 3UR3C 2ZO4A 4AYBA 1QHHD 2P5KA 2JT1A 5ICGA 1BBYA 2HVQA 3H3ZA 2GBYA 2HZDA 3BG9A 4GYIA 1RR7A 5LEKA 2KP6A 3OOUA 1S9HA 4ITVA 1MJAA 5IP9J 5JR3A 3OR2C 2ZSIB 3J80Z 2DFHA 2W7NA 4EJTA 3K4NA 3M7GA 1IN6A 4MTDA 5ILUA 2DYSH 3B02A 3BJOA 3GYHX 1BR1A 3LA2A 1JI8A 5L3FA 5D5VB 4EGZA 4E6KG 1H9TA 4C3IJ 3I3LA 5F6FA 3FM5A 3Q9VA 3PUBA 1W7PA 4CYDA 5JHFA 3DU6A 3OYDA 2CGPA 3QP5A 5F0CA 2QUFA 3I56I 1GT0C 1YW7A 1W5CC 3QU6A 3F3XA 2R4GA 4LG3A 1SFKA 1S29A 3FXUA 4PJNA 4PJJA 2PI0A 1MKMA 4NHJA 4JX4A 2OBPA 4M72A 2DT7B 2HTJA 3FXRA 3JRBA 2YX4A 5DUKA 1ZYRF 3IHUA 2QKMB 1RETA 3WG9A 3JSPA 3VYSB 2HPMA 1YQAA 4XORA 4U0VA 2MABA 1OR7A 1K78A 5F08A 3PQJA 1FMWA 2M4KA 4HZFA 2PX9A 2HU9A 2K27A 1Y6IA 3BR0A 2IS6A 1Q1HA 1TWAJ 4ZYDA 1WQ2A 4IJAA 1PYVA 2DA6A 1LEAA 5CVIA 4BQAA 1IN5A 1QRYA 2KT0A 2DAOA 2M8GX 1ZKGA 2QGUA 4QWQA 2Q0OA 2HR3A 1Z0XA 2KISA 5GAGJ 2F4IA 3OYEA 2VJ4A 4PGHA 4CCMA 5CVJA 2XASA 1VQ5I 3RKXA 2E1NA 3HEFA 1YO5C 2HYGD 1DPRA 5E8GA 1ACIA 1D0XA 3IWFA 1LDDA 3HSEA 1IDZA 4IL6C 2OQRA 4RLFA 2P4WA 4FHTA 1B9MA 3ML6A 3N97A 1QNTA 1DGWY 1P7JA 4XK4A 3G6EI 3FK7A 3M9AA 3SFIA 5HLTA 1OKRA 1LFUP 1MMNA 4BQQA 1RRJA 2FA5A 2A07F 4L5EA 3PIOF 4Y15A 3LFKA 5DS9A 4V19K 1YFHA 1C0WA 2VIXA 3CCJI 2VJ5A 4ETSA 3JRHA 3WHBA 3HHHA 1WWXA 2JPBA 3IRQA 3KP5A 1GLNA 3WTVC 3WTXC 1QA6A 2DT5A 2H6BA 3TP0A 1BW6A 1E2XA 2J5OA 2RN7A 2NOJB 1VQPI 2B9SA 3HRUA 4U7DA 5JHUA 3CCMI 4A5MA 4E4HA 1I27A 3RYRA 1VQMI 2O7OA 3BDDA 4JX5A 4LK0F 2VLAA 5FJ8J 1ZRFA 2STTA 1OLTA 5FB2A 3IC7A 5KCMA 1MMGA 2XF6A 1K6YA 3HOZJ 3R0JA 3CDLA 4B8XA 2JN6A 1D8JA 2W1OA 4CA0A 3CCEI 2HKOA 4KDPA 2CUJA 3KP6A 3HOSA 4XLNF 3FXMA 3WGHA 2QSGX 1BI0A 4H0EA 1IUYA 3HDDA 2EILH 1MNMC 1XGOA 2OA4A 4IO9F 3SQNA 1B8IB 4KN7X 1VI0A 1HA8A 5DV5A 3CDIA 3OWTA 1XPXA 3DTIA 4NB5A 2GOXB 2DN0A 4D9JA 2K9SA 1YTYA 4XIDA 4UV9A 2BY3A 1EJ9A 1QVTA 4N9IA 4XSZF 4MIMA 2Q8KA 1WH7A 3GWZA 3VSLA 3BJAA 3L09A 3O8GA 1X3WB 1F36A 2ZB9A 2CQKA 3BG3A 4A0YA 4OIOF 2XAUA 4WF2A 3GZ6A 3J81Z 4P96A 2P6TA 3M1EA 1D1AA 1LUJB 5ICEA 3EQLF 2LDUA 1QZYA 1U78A 1RNLA 1KU2A 4NC7A 5F04A 2DTZA 1T98A 1WH5A 1G6NA 4RM2A 1ZTRA 1O3QA 2CS3A 4UHTA 1CQTA 1R4NB 4RM3A 1OYIA 1TWGJ 1D5YA 3TW6A 3TBIA 1CF7A 4U7BA 2DMUA 2DI3A 4A0ZA 2DQRA 1JUMA 2IS1A 3S2HJ 2KJBA 1IN7A 3RKWA 2VC0A 2M4GA 5K1YA 3CLQA 1T39A 1VZ0A 2V4JC 1UMQA 4JP0A 1W1WE 3B6AA 2DOEA 2P5VA 2Y0SN 2R7OA 1IW7F 3SZTA 3C7JA 4DBRA 2MC3A 2OV7A 1YRNA 1T6SA 2ZXHA 4O3MA 1XMKA 2W82A 2IP2A 1FOWA 2MFZA 1HF0A 4ASNA 4A93J 2RQQA 3BR1A 2BHYA 3DQVC 4LOCA 1IUFA 2PMUA 2QQ8A 4HEA2 1QPIA 3PFIA 3S15J 4B47A 3TQNA 4JOMA 4R79A 2M45A 3KYDB 2DFEA 3TOBA 5LGUA 2HXIA 1ON1A 2DA4A 2GWRA 4M3BA 5LEJA 1JE8A 1JUSA 3DTEA 2L7KA 3PSIA 3OMYA 5E3MA 2WB1N 3A2KA 3V8JA 4CICA 4P5OA 5LHIA 2NYXA 2IA2A 5F1RA 5FKMA 2ELKA 4Q47A 3H9GA 3JAMK 4I2OA 3BP8A 3HIFA 2A68F 2H8WA 1WJDA 2VT3A 1P92A 3TO9A 2HYFA 1I1GA 2EA2A 1QHGA 2OTJI 4Z6YA 2UZKA 3BG7A 4U87A 3MWMA 4ZDOA 5JLWA 3HSFA 2NVQJ 5CQGA 5JFRA 1ORKA 5F64A 2DCEA 2D1VA 2BXYA 3TDUC 2LMDA 2ZJQF 2ISZA 1MMSA 4ENJA 1U2WA 4FTHA 1UZCA 3VFZA 1Z05A 4HAMA 5IY5H 1RZ4A 2DLLA 2F6CA 2GZWA 3HRTA 3NARA 1FP1D 3K7AJ 3AG1H 3P9CA 2MA3A 4IHXA 2A61A 2XDVA 4IRIA 3ZMTA 2XB5A 5E3NA 3HSRA 2PFBA 4KT6A 2ME0A 5HDGA 1X1PA 4EV0A 1UAAA 2PLYA 3E6DA 3QOEA 2JZYA 4CCNA 4PJLA 2Z3YA 3QQAA 1JKQC 4GO1A 5L3GA 1RR8C 1KQ9A 1B72B 1MW7A 3VODA 1SVOA 2NNNA 2K9MA 3CJTB 2FEZA 3ZCOA 3Q0WA 1HC8A 1YS6A 3EPZA 4N9HA 4XKWA 1REPC 3HBLA 1I3AA 3CUQB 4ESFA 2K40A 1YE9A 4ENKA 1R5GA 3BY6A 2LH9A 4HW0A 3IL2A 2VL8A 3CUQA 2ACJA 3ABLH 1G3TA 2BV6A 5E1XA 4CCKA 1FYKA 4D7NA 1QBJA 1ZRDA 2P0WA 2P7VB 5FD6A 5DM6F 4G8XA 2LREA 1LJ9A 1EKEA 2XB0X 4DBQA 1Z7LA 3J80K 5FROA 3F8NA 1QQIA 2LRDA 1S3JA 3OYLA 4RB0A 4KISA 1IJWC 3A0HC 4DQ2A 2PN6A 2K9NA 3BG5A 2HXOA 5LGNA 5DYMA 3CCSI 3D5SC 4KICA 1OFCX 2YSRA 4UVCA 2G0EA 4EATA 3N4MA 1OCTC 2IS4A 1PDNC 1T2KA 2ZJPF 1TT5B 3EYYA 3E7LA 3H5NA 5DD4A 3DBRB 1SVMA 3R60A 4ZDLA 2E71A 4B3XA 3NRVA 2H8RA 2L0KA 2LP0A 3ZQCA 1ZRCA 4L9NA 4G9YA 1ZH5A 3HTUA 2MH9A 4OOIA 4AU7A 3IH4A 4IXAA 4CCJA 1Z21A 5TISC 3BTLA 3VYTB 1GV5A 1Z9CA 4I7HA 4YIIA 4R1HA 3LA3A 3GZNB 1T38A 5ED4A 1YI2I 3H5RA 3M8EA 2AXLA 1USTA 2EZIA 2K3PA 2JA6J 3T0YA 4BBSJ 2DMNA 5LRRA 3SZGA 3LSGA 4YIFA 5EDNA 3ZQIA 2XF7A 1S7AA 4IZZA 2L01A 2PMHA 4FX0A 4RBOA 2B7EA 3R6SA 1XSDA 1KQ8A 3G2BA 3OS0A 1T08B 1MSEC 3ZPLA 5FKKA 2L3DA 1JKOC 1MBKA 3CF5F 1JKPC 1DDNA 1XN7A 2HOAA 3ONQA 3I64A 4JK1X 4CDGA 1OYYA 1F9NA 3AL0C 1RKTA 2ELHA 2OQGA 4EM0B 2IA0A 4CYCA 3V7RA 1DU0A 2A5WA 1DQUA 4RGSA 2CRGA 3TL4X 3MKYB 2NS0A 3CF2A 1X3ZB 3UKGA 2B0LA 3FM3A 3P5JA 3OOPA 9ANTA 2RNGA 3K4KA 2W84A 1L0OC 5D4SA 4A3JJ 1YHQI 4HF2A 2DA1A 4A5NA 4BDYA 1MDMA 3V8KA 1VF9A 4LITA 4BKXA 3W6VA 5BOXA 5E18F 5FRNA 2Y0SA 1PUFA 2D2WA 4KIFA 4EM2A 5LD2C 5IT3A 1A6IA 5M5YJ 4CSWA 1XCBA 4ZZDA 4P55A 1Y39A 1LE8A 4FCYA 1GHCA 4UUSB 1PP8F 4F91B 1RPWA 3OYBA 4CZZA 4Z2YA 3RJPA 3KEYA 4A6DA 3JRFA 4O5VA 4AIHA 3WGIA 2CQNA 2WAQN 2PQ8A 4M73A 4QSHA 2F5FA 2R7WA 3LMMA 2R5YA 4OWRB 4BHPA 4BE2A 1FNNA 1TQIA 2L9RA 2L4MA 5M3MJ 1IN8A 4ZTJA 2XAFA 3GTQJ 1DP3A 2IVMA 1I50J 1ON2A 3A1YA 1BA5A 1NTCA 1U0JA 3OS1A 2VQLA 3HOUJ 3K10A 1LVKA 1S72I 2G7HA 1JT6A 4CH7A 4IQJA 3S2DJ 1DU6A 3ZQLA 4M6XA 2IEKA 5DCMB 1T33A 2KJCA 2VKEA 3FF5A 3S1NJ 5FLXZ 2MGQA 2VKHA 3PQKA 3Q0UA 3ZMDA 3D5RC 2FRHA 2KPMA 3S14J 1POGA 3AG2H 1D3YA 1BR2A 1JTXA 1V4RA 5K7ZA 2VB6A 2RGVA 1B4AA 1V3FA 4I0BA 2AQEA 3LA7A 1W0TA 5J6XA 4PFPA 4E70A 4Y13A 1FYMA 2R7ZJ 3MN2A 2H27A 5E17F 4IQ4A 2W00A 2CUZA 3ESWB 4NDLA 2VI6A 3JW4A 3IP4B 5GAEJ 4M9SA 4HDUA 3HHGA 4CGZA 3DFGA 4G6TB 4WWCA 3KP4A 4RAFA 1AKHB 2NVYJ 3MEXA 1SC7A 3EUHC 1RI7A 1UJ8A 1ZHFA 3H36A 1SD7A 4LLLA 3DEUA 1B1BA 2X51A 3C1DA 4AC0A 2JRMA 1X4OA 1PUFB 4AWXB 3IKVA 1YIOA 3JREA 4UVAA 3H3VK 1HCRA 4GGGA 1GVJA 1ONVA 4DGWB 3GVAA 4G12A 2EIMH 3TDZC 2L54A 2FOKA 3VSKA 4DYRA 5AIQA 2HDWA 5J8FA 3BC8A 3MFKA 1JUPA 3IKTA 3GLXA 3LQQA 1FX7A 3I4NJ 3C2GA 3FMSA 3MZYA 4K2EA 3DWLE 1ZREA 4XICA 1Z7UA 3WE3A 2A69F 4OINF 3O6BB 1K6OA 3KZYA 4HNVA 1XDUA 1USSA 5IYDJ 3J81K 3I4MJ 1Y1VJ 1K4SA 1U5TC 5J1UA 2KRFA 2FOWA 4PJMA 2KQRA 6PAXA 1WJCA 1ODDA 2E2HJ 4IX7A 2NVXJ 1I5ZA 1WKMA 4HQEA 2KHMA 2R0QC 1T0FC 1K78B 1OPCA 4BU2A 2QBYB 2V9VA 4ZYGA 3OYMA 3BZKA 3DV8A 4A3EJ 2XGXA 3G71I 2IGNA 4ZYEA 5BNGA 2BW3A 1Y1WJ 3HOVJ 1IAWA 4BNCA 1ZG3A 3QPSA 3O2PE 1H8AC 4DZJA 2KIQA 2DO7A 3H0GJ 1XTAA 3OL4A 3HC7A 1Z6RA 3LAPA 1BJZA 3K6GA 2ZMEA 3KP3A 5A2QK 2QYOA 2ZXJA 1HBXG 1JJ8C 1RKWA 3C2BA 1LEBA 2VXDA 2R7FA 1YX3A 1T56A 1RUOA 2VXZA 4EM1A 3E5UA 4IRHA 3I58A 1Y0UA 2HEOA 2O0YA 2EQRA 2JA7J 3ZN0A 4FE4A 4D7MA 4LJZF 2HWVA 1SFXA 1XGNA 5DUIA 3MD2A 4XOPA 3GX4X 1MBGA 3CJNA 3K4JA 5CVVA 3BPXA 1OCPA 1FMVA 3L1PA 1J2XA 3PL8A 3CCUI 4A3LJ 3HG9A 3QPTA 5L3DA 1X58A 1UHSA 4QPOA 2PJRA 3W2AA 1SMYF 1BI2A 1LFPA 2IXSA 3FXOA 4GFBA 2PG4A 4AM3A 4Y17A 5DEQA 1V5EA 1FOXA 2NOGA 3B6CA 1X3UA 3K69A 2CMPA 3JTHA 1U9OA 3HXLA 2JA2A 2QSFX 4U88A 4N4NB 5HS9A 3OIPA 2XPUA 2WV1A 3MZHA 4B44A 4BY1J 3BTCA 2XAHA 4OU0A 3F8MA 4M3DA 4YG2F 2VOPA 2YR2A 2PMZN 2BZTA 5EGOB 2HTSA 4KUMA 4KIGA 2O03A 2W48A 5H6RA 2JMWA 4I01A 1A35A 3SDGA 4G6QA 3J7ZI 2BY2A 2XPVA 2R5ZB 3I59A 1WJEA 1OISA 2CV1A 2O8KA 1D0ZA 1R1VA 2G9WA 4HBLA 1FIPA 3V8LA 3W6JB 2HQNA 2K9LA 2JSCA 4GCVA 5BPIA 1B72A 2GIZA 4D5CA 3MAJA 2EWNA 2R7XA 4BE1A 1LDJA 3JSOA 5KAIC 3W2WA 5L3CA 1V54H 4JQFA 3Q5FA 1MJBA 3VOEA 2FNAA 4MNUA 2BBYA 4L9JA 4MFDA 3RCOA 3WU0A 1R1UA 1OCRH 1YW8A 2JTVA 2XIGA 4PGGA 1ZAOA 1ZR2A 2QQAA 3VB2A 2LF8A 4XKCA 2GXBA 4HOBA 2GIVA 2A3SA 3KYCB 3M1CA 5F1JA 2V6EA 5B3SH 4BEHA 3S16J 3FX3A 1N78A 5F0HA 3EYIA 4XLFA 4A3IJ 1I6HJ 2L5QA 5E3OA 3SXYA 3W2VA 5M5WJ 3R4KA 2VT2A 4A3GJ 3L2UA 1Z3XA 3CC7I 1QVUA 1W5TA 3WTTC 2DJIA 4B43A 1LB2A 4HX4A 3KZIC 1XGMA 2QWWA 2L9SA 1OCOH 3WTZA 4BAYA 4LLNA 4EMSA 2R7TA 2PBIA 1TZLA 3C2HA 1YIJI 2EPFA 1K61A 2JUCA 3IAS2 3KP7A 2YPRA 5D5WB 3HUGA 1ETWA 2JA8J 2X1DA 5K5OA 3KETA 2MLGA 1IGNA 4LD5A 3IUOA 1DPUA 4CUGA 4L18B 2M87A 5E8IA 2WC2A 1YX5A 3DPTA 2FJ1A 4PSXA 1KA8A 1N77A 5LBQA 3NQOA 3I54A 5A2QZ 2ISYA 3CJRB 4I02A 1SAUA 4MHGA 2LF7A 4ON0A 1Z91A 3JRGA 2Y69H 2ADUA 1JHFA 5EGOA 1APLC 2WADA 3V7SA 4DZPA 3S1MJ 1KQ0A 3CCRI 4A3BJ 3DKYA 5HOOA 2ZXIA 5ERIA 2Y30A 3WE2A 2EH3A 2DQLA 3R61A 3M4OJ 5HLIA 2ZCWA 2DTRA 3K4LA 2LVSA 2ID3A 1P7IA 4F55A 1YLFA 4BEHB 3OIOA 3E6MA 4RGRA 3D1NI 3QODA 2OZ6A 3MQ0A 5AONA 3U2RA 1ZQ3P 4ZZLA 3G73A 3GFLA 1TWFJ 2E19A 3C18A 4V2FA 4RB2C 3A02A 4ZYHA 3A01B 1AU7A 4JBAA 3RQ4A 2V7FA 4XLCA 5EEGA 2DDBA 3FZVA 3FBIB 1D8KA 4XSXF 3ZRGA 3F21A 1A31A 3BR3A 3FHZA 2DFIA 3AG3H 4XRFA 1BC7C 5HDNA 4XQFA 2VPLA 1HLVA 1IXSB 1ZG1A 4D0PA 2M0CA 4FX4A 2FBIA 2HYJA 2AXTC 3QYBA 4I0AA 4LGWA 2VJJA 3RZDJ 3RPQA 1MGTA 1R00A 2AS5F 1W36C 4C2MJ 2ZNZA 3CUOA 4G94A 2ZJRF 1DGRM 1QGPA 5EG0B 1R23A 2EIKH 2K7LA 4L5JA 5HVQC 2EV0A 2PMZA 2FBHA 3FMRA 2E7XA 1TWHJ 4C2UA 4YFNF 4L5IA 4RDUA 3K70D 2DFFA 2X1CA 5DDGA 3Q3SA 1JT0A 5GTIC 2YX7A 2EZLA 5CVUA 2P6SA 2IW5A 3E97A 4YELA 2HOEA 2XPWA 4UUVA 1EH6A 3LFUA 1AWCA 3BROA 3CP2A 4ENNA 2PJRB 3ZGKA 3F22A 4RAZA 1ZK8A 1GV2A 5HNFA 4E7JA 3KEQA 5EEHA 4UV8A 2N8GA 3LSJA 3CMEI 1JJ6C 3IRRA 1BI3A 2DA3A 1S5LC 3CLOA 1JKRC 2E5NA 2O61A 5LGTA 3GTKJ 2L7FP 3S3NA 1YJWI 3LWFA 2R92J 2JVHA 4IHTA 1JHHA 2BXZA 2E2JJ 4FT8A 2Y9ZA 2HGCA 4ZDPA 3FDYA 4HA8A 3RTRA 2JK3A 4MQVA 1O57A 3BTIA 3FXLA 3E5XA 2BY1A 1PVEA 3K2ZA 2H94A 2V1XA 1J09A 4XLAA 2HNHA 2FE3A 5ICFA 2O3FA 1OMIA 3BR2A 2M9HA 3REOA 2R7RA 3ABKH 1U5TB 5J1RA 2QCOA 4A6EA 4XLEA 5CVRA 2NS7A 2YS9A 2M0MA 2BW3B 2WY7Q 1MSFC 1U6GA 3WTYC 2IA1A 1V5FA 2MBFA 2K86A 1LFBA 1HOMA 3F8FA 3L00A 2CQQA 5AIPA 4P9FA 2QBYA 2LKPA 2V1DA 4MTEA 1X1DA 2OD5A 3NWTA 2X6YA 3P7NA 2L7ZA 2XAQA 3HPGA 3W3CA 3VDXA 4AIJA 2KZVA 4QPQA 1BM9A 1I3QJ 4PZJA 3PM1A 1XG1A 2K85A 3CC2I 2GA2A 2R7QA 2L7MP 3BCBA 4F7ZA 3E6BA 2VOOA 5IT9Z 1BW5A 3LSIA 3WG7H 2F2EA 4M3GA 4ESBA 2J5PA 3CD6I 2CQ7A 4E7ZA 1TW3A 3KP2A 4HSRA 4HV6A 2NVUB 3ZOBA 4MEXF 1EF4A 2HVRA 5IYCJ 1HW5A 2EFPA 3ABMH 2UXXA 2DOAA 3TW7A 2CWEA 4RGUA 3DPUA 3RZOJ 1ERDA 3I9V2 3KYLA 3OIQA 2FQ3A 1YG2A 5FKLA 2VC1A 1AKHA 3FKJA 2EV6A 1IG7A 2X6WA 4A3MJ 2GQQA 2IGOA 1FBSA 2Z1DA 4NQWB 5LHHA 1JGGA 1BL0A 5IT9K 2LY1A 1OYWA 3HGYA 5FO5A 1MD0A 4E7KA 3PUFA 3G1OA 3SFZA 2TCTA 3QAHA 1Y56A 5C44J 4XN0A 4DNCA 2EFWA 2LTPA 2RNJA 2QF7A 4PFOA 3PNTA 4NC8A 4XRMA 4F93B 3KCCA 2JPCA 4LIVA 4WX9A 1O3TA 4RAYA 5J1YA 3BJ6A 1MJ9A 3T8RA 4QIWN 5EF6A 4HX7A 5LFAA 1AA7A 1J7KA 1OCZH 2DMPA 5EEAA 4NBQA 1XCVA 2WAFA 2JA5J 3TGNA 3GTLJ 2EV5A 2Y9YA 1WVRA 5M3FJ 3K1PA 5E20A 5HLHA 4NNJA 3GFIA 5FFXA 3LOCA 3S3OA 3RIRA 5J47A 1X4PA 3ECOA 4F92B 1MBEA 5E1WA 3PNYA 1J9IA 5E79C 3E0JB 3QOPA 5BS6A 2IGMA 4L9VA 1W7PD 2NRAC 1JTYA 5DD8A 1MBHA 5K7HA 5HLGA 2KIUA 4RB3C 2OZUA 3DEEA 1FTTA 4RAGA 3ZR8X 1BIBA 2XKPA 2VQGA 1MIJA 1YJ9I 1IZ1A 3GMEA 1X1BA 2CU7A 3JRAA 2EA4A 2XAGA 2Y75A 1SD5A 3I0TA 3FWEA 1H88C 4BQNA 3ULQB 2NS8A 4LG0A 2MD5A 1WFXA 1YITI 1GVDA 3LSMA 3I59B 2Y2ZA 3HTSB 2R3SA 5J3LA 3DLAA 3ABUA 3RPUA 3BQZA 4EVIA 4A0XA 3AKZA 1FTZA 4ZTFA 4KITB 2COMA 2K02A 4X1EA 1F1ZA 1LE8B 4IHSA 3QYEA 1KYZA 1Z1DA 2VBWA 2KKOA 1KZHA 3IH2A 1FOYA 4YIRX 1H9GA 3LAJA 2LY9A 1ENHA 2A5YB 2XRLA 2WTEA 2FNPA 2EK5A 3H1CA 4BXXJ 1ZN2A 4A3FJ 1SD4A 4X0GA 2VQCA 3HYIA 3K2AA 1S7EA 2HQRA 4IEJA 2ECCA 3OYNA 3OYJA 1YOVB 1P4AA 3ABTA 2RVCA 2VBXA 2GA1A 4X6AJ 3HKZA 5D4RA 3RDIA 1FT9A 5TRDA 4UB6C 3RKYA 3JRCA 2VONA 3HKZN 4II3A 1E3OC 3TMOA 5JVGF 1RESA 3RI4A 4RLQA 2FSWA 1WGXA 1OQYA 2KDOA 1BC8C 5HNHA 4CCLA 1X19A 2GLOA 1FSEA 2HPIA 2W4SA 5FLMJ 3DBHB 3QU3A 3WODF 3ZQFA 1ULYA 4B09A 4ESJA 2F5DA 3ZMVA 4RB1A 2ZC2A 2IJLA 4F3QA 3GTMJ 2MC4A 5GAHJ 2X85A 2X9DA 4HF0A 3IV5A 2Y31A 1TQPA 3CO7C 4M6VA 3CJQB 4DYQA 2KFDA 3GTPJ 3GW2A 4MGRA 2D45A 2ZNYA 4C2TA 2M30A 5FLXK
chains in the Genus database with same CATH topology
2QENA 4A2UA 2STWA 4Q48A 1UHWA 4M71A 4PDKA 1P4XA 2VE8A 4IRGA 2VBZA 3CO6C 2DPUA 2RKHA 1HSJA 1D5VA 4IPAA 3WTSC 1IN4A 4Q4ZF 2ESNA 3GF2A 5LLQA 4YFXF 1I6XA 2Q2EA 5BPDA 2ZKZA 1RIOH 4EQQA 1KU3A 4AD9A 4M6YA 3J7AO 3E6CC 1TLHB 3KZZA 2ZMEB 4RGXA 2ZFWA 2X0LA 2V79A 4KMUX 4WCGA 3QPHA 3BOQA 3DPLC 4LG0B 1DP7P 3GEZA 4OIRF 1LVAA 5FGMA 5D6EA 2GXGA 2F5CA 2L4AA 4G7HF 1STZA 4YFKF 1TW2A 2KIFA 5KVRA 4KA4A 4LK1F 3TOAA 1KGSA 4OIPF 3M8FA 1F5TA 2Z9OA 1TNTA 2ZJ2A 4HDVA 2QQBA 3RYPA 2FXAA 2RC4A 2OU2A 3ELKA 2M5WA 1R7JA 3WGGA 3KLNA 1IRGA 1ZLKA 5ILSA 3KFWX 2VN2A 3SHFA 2A6EF 1T0FA 3JAMZ 1BOAA 4NQWA 3ERED 3IWZA 4G6DA 1Z6TA 1UHMA 2P5LC 1FWZA 1XGSA 1SMTA 4Q5SF 2IPQX 1FY7A 1U3EM 4KIBA 1FBQA 2BE5F 3S2WA 3K1MA 1K7AA 2GAUA 5HS8A 3SZPA 4KMFA 1SFUA 1ZARA 1CGPA 4LLGF 1AOYA 1R1TA 5DCMA 4IF4A 1YYVA 1KYWA 1O7FA 1CF7B 2CW0F 2P8TA 2CO5A 1F4KA 4CXFA 3KEOA 1J5YA 3FMQA 3H3UA 4PCQA 4L0ZB 4M9ZA 5FFZA 2M1BA 1FPQA 1P6RA 3CDHA 3TO6A 3ZMZA 1J75A 1R36A 3CUQC 5TJJA 1EH7A 3GO5A 1O3RA 4UNOA 4IVNA 1GXPA 4L0YB 3P9IA 5KK1A 3DP7A 1S8NA 3ROUA 4EJOA 3ZP5A 1LDKB 2HKXA 3K0LA 5H20A 3C3WA 1XB4A 2HFHA 3F8CA 1B59A 2PEXA 4QLCU 1J59A 4I09A 3DKWA 4BH9A 5CYVA 2WWYA 2EFQA 3EUHA 3K1NA 2QM3A 1ZLJA 4HLXA 4S04A 1FP2A 3HRSA 4KT5C 3AAFA 2V6CA 3EETA 2DW4A 1SFEA 2HDCA 1BI1A 2NAZA 1W4MA 2M8EA 1ZGJA 4EGYA 1EV7A 1ZGAA 3MCZA 4GXOA 2HS5A 3ZMSA 4WXHA 2E7WA 4AIKA 3DXJF 1HKQA 1HW1A 1XMAA 1WRJA 2A6HF 3L9FA 2W57A 4OMZA 1BIAA 2UXNA 2MLKA 1P2FA 4GYGA 1IF1A 4XLPF 1B6AA 4A12A 5ICCA 4S05A 2BGCA 5BQTA 2IRFG 1WI9A 2DBBA 3QRFF 3K9TA 1KU7A 3LQRA 1U8RA 1W5SA 1LNWA 3WTUC 3WTWC 2MH2A 3WU1B 1FZPB 1JGSA 1S7OA 1G3WA 4WXCA 3E3VA 3F6VA 2LSOA 1XD7A 2XROA 4KYWA 1HKTA 5D5XB 5L3EA 1VTNC 2XV4S 1FBUA 3COAC 2PJPA 2VODA 2XRNA 3GFMA 4LMYA 1QO0D 1L3LA 2ETHA 1HXDA 5H6QA 3ECHA 4ZH4F 2V1UA 4BHCA 1P4WA 3F72A 4ENMA 2RQPA 5DCFA 5J8CA 3ZMUA 2FMLA 2L02A 4BXUA 1K79A 1JXSA 2XUBA 1DUXC 4BHBA 3ZQ7A 3H92A 2QQ9A 4OMYA 3EDPA 2O6GE 2FMYA 3F23A 3VEPA 4EJWA 3GUDA 2RV8A 3D0SA 3I5UA 1H0MA 3D5LA 3FXQA 3TO7A 2Z5UA 5HDKA 2K4BA 2XAJA 2VE9A 2W24A 2OAZA 2IT0A 4R8HA 2Y48A 1TTYA 1ZG5A 3I71A 2DK5A 4U0YA 3W6KB 2XVCA 4KFCA 1FC3A 3BWGA 2EFOA 2LNBA 1PUEE 4HF1A 1IXRC 2Y0MA 3GFJA 3QP6A 4XBFA 2H09A 2FF4A 1RUNA 3TKYA 5JVTA 1B9NA 1YS7A 2ESHA 1TQMA 5LRSA 1XSXA 1HQCA 1U5TA 4L9TA 2QZ8A 5CJ9A 1TBXA 4KN4X 1PP7U 2D1HA 5CLSA 4LB5A 1YW9A 1QPMA 4RS8A 5D6FA 2KIMA 3V4GA 2TDXA 1NHAA 4EJVA 3LSTA 1IRFA 1LQ1A 3CTAA 1G4DA 2X4HA 4M74A 3E5QA 4WK8F 3KLOA 3NEUA 2Z33A 3U1DA 4AVPA 2CG4A 2RDPA 3O3KA 2EB7A 2CSOA 4HQMA 1UCRA 2XHKA 3ZN1A 3T8TA 2G7UA 1G3SA 3G3ZA 3L2CA 3T5XA 2O8XA 5E1ZB 2DPDA 3U9GA 1EH8A 2CYYA 3F6OA 3ISPA 1HW2A 2W85A 2NNYA 4MQ9F 1GXQA 2UWMA 1UB9A 4MEYF 5HS7A 5D8KB 1G3YA 2Z99A 2K4JA 4WXDA 4HYEA 5K5RA 2BEOA 3BZ6A 3GXOA 3I4PA 2WV0A 4UXNA 2ZBKA 2F5EA 1FLIA 1SD6A 1WSUA 5JI6A 4BYYA 4HX8A 1XDSA 3JTGA 4N0BA 2EFNA 3T1BA 1QZZA 5L3BA 1BJAA 2VBYA 3F8BA 1FOKA 1R22A 2H6CA 3P9KA 1FYLA 2QVOA 2JRTA 2HZTA 4HLYA 2YU3A 1XSVA 1SAXA 4G7OF 1IXCA 1BN5A 5ILVA 5FD5A 1UFMA 2R7DA 1J0RA 1FSHA 1W7PB 3OV8A 2QLZA 4LFUA 3GZ5A 4OIQF 3R0AA 3KE2A 4I98B 4U0WA 1MDMB 5D5UB 2XKOA 2DK8A 2DU9A 2BYVE 1R5HA 5BMZA 2FU4A 4CO8A 5K5QA 1MZBA 3B73A 4KNYA 3DF8A 4HV5A 1HSTA 4G7ZF 4LB6B 1TNSA 3HRMA 3V7CA 2W25A 1R58A 5LHGA 3HOTA 4EJUA 3L7WA 2C6YA 1I1SA 1O7LA 1O3SA 1HKSA 2E1CA 1KU9A 2CFXA 5D8LB 4O6JA 1E17A 4P9UA 2EJRA 3Q9SA 4CHUA 3BPVA 2P7CB 4TV7A 1S6LA 2FBKA 4UVBA 4M9XA 1A04A 3I53A 2ZO4A 2P5KA 2JT1A 5ICGA 1BBYA 3H3ZA 4GYIA 5LEKA 1MJAA 5JR3A 3J80Z 4EJTA 3M7GA 1IN6A 4MTDA 5ILUA 3B02A 3BJOA 3GYHX 3LA2A 5L3FA 5D5VB 4EGZA 1H9TA 5F6FA 3FM5A 3Q9VA 1W7PA 4CYDA 2CGPA 3QP5A 2QUFA 1YW7A 3QU6A 3F3XA 1S29A 3FXUA 2PI0A 1MKMA 4NHJA 2OBPA 4M72A 2HTJA 3FXRA 2YX4A 5DUKA 1ZYRF 3IHUA 3WG9A 3JSPA 1YQAA 4U0VA 1OR7A 1K78A 3PQJA 4HZFA 2K27A 1Q1HA 4ZYDA 1WQ2A 4IJAA 5CVIA 1LEAA 4BQAA 1IN5A 2DAOA 4QWQA 2Q0OA 2HR3A 4PGHA 5CVJA 2XASA 3RKXA 2E1NA 1YO5C 2HYGD 1DPRA 5E8GA 3IWFA 1LDDA 3HSEA 2OQRA 2P4WA 4FHTA 1B9MA 3ML6A 3N97A 1QNTA 3M9AA 1OKRA 2FA5A 2A07F 4Y15A 3LFKA 1YFHA 1C0WA 4ETSA 3HHHA 1WWXA 2JPBA 3IRQA 3KP5A 3WTVC 3WTXC 2DT5A 2H6BA 1E2XA 2J5OA 2RN7A 3HRUA 4U7DA 5JHUA 4A5MA 1I27A 3RYRA 2STTA 3BDDA 4LK0F 1ZRFA 5FB2A 3IC7A 3R0JA 4B8XA 1D8JA 2HKOA 4KDPA 3KP6A 3HOSA 4XLNF 3WGHA 1BI0A 4H0EA 1IUYA 1XGOA 2OA4A 3SQNA 4KN7X 5DV5A 4NB5A 1YTYA 4UV9A 4N9IA 4XSZF 2Q8KA 3GWZA 3BJAA 3L09A 2CQKA 4OIOF 4A0YA 4WF2A 3GZ6A 3J81Z 4P96A 2P6TA 3M1EA 5ICEA 3EQLF 2LDUA 1QZYA 1U78A 1RNLA 1KU2A 1T98A 1G6NA 1O3QA 4UHTA 1OYIA 1CF7A 4U7BA 4A0ZA 2DI3A 2DQRA 2KJBA 1IN7A 3RKWA 2VC0A 5K1YA 1T39A 2P5VA 1IW7F 3SZTA 3C7JA 2MC3A 1T6SA 4O3MA 1XMKA 2IP2A 4ASNA 3DQVC 2PMUA 3PFIA 3TQNA 4R79A 2M45A 3TOBA 5LGUA 1ON1A 2GWRA 5LEJA 1JE8A 3V8JA 4CICA 4P5OA 5LHIA 2NYXA 2IA2A 5F1RA 4Q47A 3JAMK 4I2OA 3BP8A 2A68F 3HIFA 2VT3A 1P92A 3TO9A 2HYFA 1I1GA 2EA2A 2UZKA 3MWMA 3HSFA 5JFRA 5F64A 2D1VA 3TDUC 2ISZA 4ENJA 1U2WA 3VFZA 1Z05A 4HAMA 1RZ4A 2DLLA 2GZWA 3HRTA 1FP1D 3P9CA 2MA3A 2A61A 4IRIA 3ZMTA 2PFBA 3HSRA 5HDGA 4EV0A 2PLYA 3E6DA 2JZYA 2Z3YA 4GO1A 5L3GA 1KQ9A 3VODA 2NNNA 2FEZA 1YS6A 1REPC 4N9HA 4ESFA 3CUQB 4ENKA 1R5GA 3BY6A 4HW0A 3IL2A 2ACJA 3CUQA 1G3TA 2BV6A 5E1XA 1FYKA 1QBJA 1ZRDA 2P7VB 5FD6A 4G8XA 1LJ9A 3J80K 3F8NA 1QQIA 1S3JA 4RB0A 4DQ2A 2PN6A 5LGNA 5DYMA 4KICA 4UVCA 2YSRA 3N4MA 1PDNC 1T2KA 3EYYA 5DD4A 3R60A 3NRVA 1ZRCA 4L9NA 4G9YA 1ZH5A 3HTUA 2MH9A 4OOIA 4IXAA 1Z9CA 4I7HA 4YIIA 4R1HA 3LA3A 1T38A 5ED4A 3M8EA 2AXLA 1USTA 3T0YA 5LRRA 4YIFA 1S7AA 2L01A 2PMHA 4FX0A 3R6SA 1XSDA 1KQ8A 3ZPLA 2L3DA 1DDNA 1XN7A 3I64A 4JK1X 4CDGA 1OYYA 1F9NA 4EM0B 2ELHA 2OQGA 2IA0A 3V7RA 4RGSA 2NS0A 2B0LA 3FM3A 3OOPA 1L0OC 2W84A 5D4SA 4HF2A 4A5NA 1MDMA 3V8KA 5BOXA 5E18F 2D2WA 4KIFA 4EM2A 5IT3A 1XCBA 4ZZDA 4P55A 1GHCA 1PP8F 4CZZA 4Z2YA 3RJPA 4A6DA 4O5VA 4AIHA 3WGIA 2PQ8A 4M73A 2F5FA 4BHPA 1FNNA 1TQIA 2L4MA 1IN8A 2XAFA 2IVMA 1ON2A 2G7HA 4M6XA 5DCMB 2KJCA 3FF5A 5FLXZ 3PQKA 3ZMDA 2FRHA 1D3YA 1V4RA 2RGVA 1B4AA 1V3FA 4I0BA 3LA7A 5J6XA 4Y13A 4E70A 1FYMA 2H27A 5E17F 3JW4A 4M9SA 4HDUA 3HHGA 4CGZA 3DFGA 4WWCA 3KP4A 3MEXA 1RI7A 1ZHFA 1SD7A 4LLLA 3DEUA 1B1BA 3C1DA 4AWXB 3IKVA 1YIOA 4UVAA 4GGGA 1GVJA 1ONVA 3GVAA 3TDZC 2L54A 2FOKA 5AIQA 5J8FA 3MFKA 3IKTA 3GLXA 3LQQA 1FX7A 3FMSA 3MZYA 4K2EA 1ZREA 1Z7UA 3WE3A 2A69F 4OINF 3O6BB 1K6OA 3KZYA 1XDUA 1USSA 3J81K 1U5TC 2KRFA 6PAXA 1ODDA 1I5ZA 1WKMA 4HQEA 1K78B 1OPCA 2QBYB 2V9VA 4ZYGA 3DV8A 2XGXA 4ZYEA 1IAWA 4BNCA 1ZG3A 3O2PE 2DO7A 1Z6RA 3LAPA 5A2QK 2ZMEA 3KP3A 1HBXG 2QYOA 2ZXJA 1LEBA 2R7FA 1RUOA 2VXZA 4EM1A 3E5UA 4IRHA 3I58A 1Y0UA 2HEOA 2O0YA 3ZN0A 4LJZF 2HWVA 1SFXA 1XGNA 5DUIA 3GX4X 3CJNA 5CVVA 3BPXA 1J2XA 3QPTA 5L3DA 1SMYF 1BI2A 2PG4A 4Y17A 5DEQA 1X3UA 3K69A 3JTHA 4U88A 5HS9A 3MZHA 2XAHA 4OU0A 3F8MA 2VOPA 4YG2F 2YR2A 2HTSA 4KUMA 4KIGA 2O03A 5H6RA 4I01A 4G6QA 3I59A 1R1VA 2G9WA 4HBLA 3V8LA 3W6JB 2HQNA 2JSCA 4GCVA 5BPIA 3MAJA 2EWNA 1LDJA 3JSOA 5L3CA 4JQFA 3Q5FA 1MJBA 3VOEA 2FNAA 4MNUA 2BBYA 4L9JA 3WU0A 1R1UA 1YW8A 2JTVA 2XIGA 4PGGA 1ZAOA 2QQAA 3VB2A 2LF8A 2GXBA 4HOBA 2GIVA 2A3SA 3FX3A 3EYIA 3SXYA 3R4KA 2VT2A 1W5TA 3WTTC 1LB2A 4HX4A 1XGMA 2QWWA 4LLNA 3WTZA 4BAYA 4EMSA 2PBIA 3KP7A 2YPRA 5D5WB 3HUGA 5K5OA 3KETA 2MLGA 4LD5A 1DPUA 4L18B 2M87A 5E8IA 2WC2A 3DPTA 1KA8A 5LBQA 3NQOA 3I54A 5A2QZ 2ISYA 4I02A 4MHGA 2LF7A 4ON0A 1Z91A 2ADUA 1JHFA 3V7SA 1KQ0A 5HOOA 5ERIA 3WE2A 3R61A 2DQLA 5HLIA 2ZCWA 2DTRA 1YLFA 3E6MA 4RGRA 2OZ6A 3MQ0A 5AONA 3U2RA 4ZZLA 3G73A 3GFLA 3C18A 4RB2C 4ZYHA 4JBAA 5EEGA 3FZVA 1D8KA 4XSXF 3F21A 3FHZA 2DFIA 4XRFA 1BC7C 5HDNA 1IXSB 1ZG1A 4D0PA 4FX4A 2FBIA 4I0AA 4LGWA 3RPQA 1MGTA 1R00A 2AS5F 2ZNZA 3CUOA 4G94A 1QGPA 1R23A 2K7LA 4L5JA 5HVQC 2EV0A 2FBHA 3FMRA 2E7XA 4YFNF 4L5IA 5DDGA 2YX7A 5CVUA 2P6SA 2IW5A 3E97A 4UUVA 2HOEA 1EH6A 1AWCA 3BROA 4ENNA 3F22A 4RAZA 3KEQA 5EEHA 4UV8A 3IRRA 1BI3A 3CLOA 2O61A 5LGTA 3LWFA 4IHTA 1JHHA 4FT8A 2HGCA 4HA8A 3RTRA 4MQVA 1O57A 3E5XA 3K2ZA 2H94A 2V1XA 2FE3A 5ICFA 2O3FA 1OMIA 3REOA 1U5TB 4A6EA 5CVRA 1U6GA 3WTYC 2IA1A 2MBFA 2K86A 3F8FA 3L00A 5AIPA 4P9FA 2QBYA 2LKPA 2V1DA 4MTEA 2OD5A 3P7NA 2XAQA 4AIJA 1BM9A 4PZJA 2GA2A 4F7ZA 3E6BA 2VOOA 5IT9Z 2F2EA 4ESBA 2J5PA 1TW3A 3KP2A 4HV6A 4MEXF 1HW5A 2EFPA 2UXXA 2CWEA 4RGUA 2FQ3A 1YG2A 2VC1A 2EV6A 2GQQA 5IT9K 1FBSA 5LHHA 1OYWA 5FO5A 1MD0A 3SFZA 3QAHA 2EFWA 4DNCA 2RNJA 3KCCA 2JPCA 4WX9A 1O3TA 4RAYA 3BJ6A 1MJ9A 3T8RA 4HX7A 1J7KA 1XCVA 3TGNA 2EV5A 3K1PA 5E20A 5HLHA 3GFIA 5FFXA 3RIRA 3ECOA 5E1WA 1J9IA 3QOPA 5BS6A 4L9VA 2NRAC 1W7PD 5DD8A 4RB3C 5HLGA 2KIUA 2OZUA 1BIBA 2XKPA 1IZ1A 2EA4A 2XAGA 2Y75A 1SD5A 3I0TA 3FWEA 3ULQB 4LG0A 2MD5A 3I59B 3HTSB 2R3SA 3RPUA 4EVIA 3ABUA 4A0XA 2COMA 2K02A 1F1ZA 4IHSA 1KYZA 1Z1DA 2VBWA 2KKOA 3LAJA 1H9GA 2A5YB 2WTEA 2FNPA 2EK5A 1ZN2A 1SD4A 3HYIA 2HQRA 1P4AA 3ABTA 2RVCA 2VBXA 2GA1A 5D4RA 3RDIA 1FT9A 5TRDA 3RKYA 2VONA 3RI4A 2FSWA 1BC8C 1FSEA 3QU3A 3WODF 1ULYA 4B09A 4ESJA 2F5DA 3ZMVA 4RB1A 2IJLA 4HF0A 1TQPA 3CO7C 3GW2A 4MGRA 2D45A 2ZNYA 2M30A 5FLXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEN A;  4A2U A;  2STW A;  4Q48 A;  1UHW A;  4M71 A;  4PDK A;  1P4X A;  2VE8 A;  4IRG A;  2VBZ A;  3CO6 C;  2DPU A;  2RKH A;  1HSJ A;  1D5V A;  4IPA A;  3WTS C;  1IN4 A;  4Q4Z F;  2ESN A;  3GF2 A;  5LLQ A;  4YFX F;  1I6X A;  2Q2E A;  5BPD A;  2ZKZ A;  1RIO H;  4EQQ A;  1KU3 A;  4AD9 A;  4M6Y A;  3J7A O;  3E6C C;  1TLH B;  3KZZ A;  2ZME B;  4RGX A;  2ZFW A;  2X0L A;  2V79 A;  4KMU X;  4WCG A;  3QPH A;  3BOQ A;  3DPL C;  4LG0 B;  1DP7 P;  3GEZ A;  4OIR F;  1LVA A;  5FGM A;  5D6E A;  2GXG A;  2F5C A;  2L4A A;  4G7H F;  1STZ A;  4YFK F;  1TW2 A;  2KIF A;  5KVR A;  4KA4 A;  4LK1 F;  3TOA A;  1KGS A;  4OIP F;  3M8F A;  1F5T A;  2Z9O A;  1TNT A;  2ZJ2 A;  4HDV A;  2QQB A;  3RYP A;  2FXA A;  2RC4 A;  2OU2 A;  3ELK A;  2M5W A;  1R7J A;  3WGG A;  3KLN A;  1IRG A;  1ZLK A;  5ILS A;  3KFW X;  2VN2 A;  3SHF A;  2A6E F;  1T0F A;  3JAM Z;  1BOA A;  4NQW A;  3ERE D;  3IWZ A;  4G6D A;  1Z6T A;  1UHM A;  2P5L C;  1FWZ A;  1XGS A;  1SMT A;  4Q5S F;  2IPQ X;  1FY7 A;  1U3E M;  4KIB A;  1FBQ A;  2BE5 F;  3S2W A;  3K1M A;  1K7A A;  2GAU A;  5HS8 A;  3SZP A;  4KMF A;  1SFU A;  1ZAR A;  1CGP A;  4LLG F;  1AOY A;  1R1T A;  5DCM A;  4IF4 A;  1YYV A;  1KYW A;  1O7F A;  1CF7 B;  2CW0 F;  2P8T A;  2CO5 A;  1F4K A;  4CXF A;  3KEO A;  1J5Y A;  3FMQ A;  3H3U A;  4PCQ A;  4L0Z B;  4M9Z A;  5FFZ A;  2M1B A;  1FPQ A;  1P6R A;  3CDH A;  3TO6 A;  3ZMZ A;  1J75 A;  1R36 A;  3CUQ C;  5TJJ A;  1EH7 A;  3GO5 A;  1O3R A;  4UNO A;  4IVN A;  1GXP A;  4L0Y B;  3P9I A;  5KK1 A;  3DP7 A;  1S8N A;  3ROU A;  4EJO A;  3ZP5 A;  1LDK B;  2HKX A;  3K0L A;  5H20 A;  3C3W A;  1XB4 A;  2HFH A;  3F8C A;  1B59 A;  2PEX A;  4QLC U;  1J59 A;  4I09 A;  3DKW A;  4BH9 A;  5CYV A;  2WWY A;  2EFQ A;  3EUH A;  3K1N A;  2QM3 A;  1ZLJ A;  4HLX A;  4S04 A;  1FP2 A;  3HRS A;  4KT5 C;  3AAF A;  2V6C A;  3EET A;  2DW4 A;  1SFE A;  2HDC A;  1BI1 A;  2NAZ A;  1W4M A;  2M8E A;  1ZGJ A;  4EGY A;  1EV7 A;  1ZGA A;  3MCZ A;  4GXO A;  2HS5 A;  3ZMS A;  4WXH A;  2E7W A;  4AIK A;  3DXJ F;  1HKQ A;  1HW1 A;  1XMA A;  1WRJ A;  2A6H F;  3L9F A;  2W57 A;  4OMZ A;  1BIA A;  2UXN A;  2MLK A;  1P2F A;  4GYG A;  1IF1 A;  4XLP F;  1B6A A;  4A12 A;  5ICC A;  4S05 A;  2BGC A;  5BQT A;  2IRF G;  1WI9 A;  2DBB A;  3QRF F;  3K9T A;  1KU7 A;  3LQR A;  1U8R A;  1W5S A;  1LNW A;  3WTU C;  3WTW C;  2MH2 A;  3WU1 B;  1FZP B;  1JGS A;  1S7O A;  1G3W A;  4WXC A;  3E3V A;  3F6V A;  2LSO A;  1XD7 A;  2XRO A;  4KYW A;  1HKT A;  5D5X B;  5L3E A;  1VTN C;  2XV4 S;  1FBU A;  3COA C;  2PJP A;  2VOD A;  2XRN A;  3GFM A;  4LMY A;  1QO0 D;  1L3L A;  2ETH A;  1HXD A;  5H6Q A;  3ECH A;  4ZH4 F;  2V1U A;  4BHC A;  1P4W A;  3F72 A;  4ENM A;  2RQP A;  5DCF A;  5J8C A;  3ZMU A;  2FML A;  2L02 A;  4BXU A;  1K79 A;  1JXS A;  2XUB A;  1DUX C;  4BHB A;  3ZQ7 A;  3H92 A;  2QQ9 A;  4OMY A;  3EDP A;  2O6G E;  2FMY A;  3F23 A;  3VEP A;  4EJW A;  3GUD A;  2RV8 A;  3D0S A;  3I5U A;  1H0M A;  3D5L A;  3FXQ A;  3TO7 A;  2Z5U A;  5HDK A;  2K4B A;  2XAJ A;  2VE9 A;  2W24 A;  2OAZ A;  2IT0 A;  4R8H A;  2Y48 A;  1TTY A;  1ZG5 A;  3I71 A;  2DK5 A;  4U0Y A;  3W6K B;  2XVC A;  4KFC A;  1FC3 A;  3BWG A;  2EFO A;  2LNB A;  1PUE E;  4HF1 A;  1IXR C;  2Y0M A;  3GFJ A;  3QP6 A;  4XBF A;  2H09 A;  2FF4 A;  1RUN A;  3TKY A;  5JVT A;  1B9N A;  1YS7 A;  2ESH A;  1TQM A;  5LRS A;  1XSX A;  1HQC A;  1U5T A;  4L9T A;  2QZ8 A;  5CJ9 A;  1TBX A;  4KN4 X;  1PP7 U;  2D1H A;  5CLS A;  4LB5 A;  1YW9 A;  1QPM A;  4RS8 A;  5D6F A;  2KIM A;  3V4G A;  2TDX A;  1NHA A;  4EJV A;  3LST A;  1IRF A;  1LQ1 A;  3CTA A;  1G4D A;  2X4H A;  4M74 A;  3E5Q A;  4WK8 F;  3KLO A;  3NEU A;  2Z33 A;  3U1D A;  4AVP A;  2CG4 A;  2RDP A;  3O3K A;  2EB7 A;  2CSO A;  4HQM A;  1UCR A;  2XHK A;  3ZN1 A;  3T8T A;  2G7U A;  1G3S A;  3G3Z A;  3L2C A;  3T5X A;  2O8X A;  5E1Z B;  2DPD A;  3U9G A;  1EH8 A;  2CYY A;  3F6O A;  3ISP A;  1HW2 A;  2W85 A;  2NNY A;  4MQ9 F;  1GXQ A;  2UWM A;  1UB9 A;  4MEY F;  5HS7 A;  5D8K B;  1G3Y A;  2Z99 A;  2K4J A;  4WXD A;  4HYE A;  5K5R A;  2BEO A;  3BZ6 A;  3GXO A;  3I4P A;  2WV0 A;  4UXN A;  2ZBK A;  2F5E A;  1FLI A;  1SD6 A;  1WSU A;  5JI6 A;  4BYY A;  4HX8 A;  1XDS A;  3JTG A;  4N0B A;  2EFN A;  3T1B A;  1QZZ A;  5L3B A;  1BJA A;  2VBY A;  3F8B A;  1FOK A;  1R22 A;  2H6C A;  3P9K A;  1FYL A;  2QVO A;  2JRT A;  2HZT A;  4HLY A;  2YU3 A;  1XSV A;  1SAX A;  4G7O F;  1IXC A;  1BN5 A;  5ILV A;  5FD5 A;  1UFM A;  2R7D A;  1J0R A;  1FSH A;  1W7P B;  3OV8 A;  2QLZ A;  4LFU A;  3GZ5 A;  4OIQ F;  3R0A A;  3KE2 A;  4I98 B;  4U0W A;  1MDM B;  5D5U B;  2XKO A;  2DK8 A;  2DU9 A;  2BYV E;  1R5H A;  5BMZ A;  2FU4 A;  4CO8 A;  5K5Q A;  1MZB A;  3B73 A;  4KNY A;  3DF8 A;  4HV5 A;  1HST A;  4G7Z F;  4LB6 B;  1TNS A;  3HRM A;  3V7C A;  2W25 A;  1R58 A;  5LHG A;  3HOT A;  4EJU A;  3L7W A;  2C6Y A;  1I1S A;  1O7L A;  1O3S A;  1HKS A;  2E1C A;  1KU9 A;  2CFX A;  5D8L B;  4O6J A;  1E17 A;  4P9U A;  2EJR A;  3Q9S A;  4CHU A;  3BPV A;  2P7C B;  4TV7 A;  1S6L A;  2FBK A;  4UVB A;  4M9X A;  1A04 A;  3I53 A;  2ZO4 A;  2P5K A;  2JT1 A;  5ICG A;  1BBY A;  3H3Z A;  4GYI A;  5LEK A;  1MJA A;  5JR3 A;  3J80 Z;  4EJT A;  3M7G A;  1IN6 A;  4MTD A;  5ILU A;  3B02 A;  3BJO A;  3GYH X;  3LA2 A;  5L3F A;  5D5V B;  4EGZ A;  1H9T A;  5F6F A;  3FM5 A;  3Q9V A;  1W7P A;  4CYD A;  2CGP A;  3QP5 A;  2QUF A;  1YW7 A;  3QU6 A;  3F3X A;  1S29 A;  3FXU A;  2PI0 A;  1MKM A;  4NHJ A;  2OBP A;  4M72 A;  2HTJ A;  3FXR A;  2YX4 A;  5DUK A;  1ZYR F;  3IHU A;  3WG9 A;  3JSP A;  1YQA A;  4U0V A;  1OR7 A;  1K78 A;  3PQJ A;  4HZF A;  2K27 A;  1Q1H A;  4ZYD A;  1WQ2 A;  4IJA A;  5CVI A;  1LEA A;  4BQA A;  1IN5 A;  2DAO A;  4QWQ A;  2Q0O A;  2HR3 A;  4PGH A;  5CVJ A;  2XAS A;  3RKX A;  2E1N A;  1YO5 C;  2HYG D;  1DPR A;  5E8G A;  3IWF A;  1LDD A;  3HSE A;  2OQR A;  2P4W A;  4FHT A;  1B9M A;  3ML6 A;  3N97 A;  1QNT A;  3M9A A;  1OKR A;  2FA5 A;  2A07 F;  4Y15 A;  3LFK A;  1YFH A;  1C0W A;  4ETS A;  3HHH A;  1WWX A;  2JPB A;  3IRQ A;  3KP5 A;  3WTV C;  3WTX C;  2DT5 A;  2H6B A;  1E2X A;  2J5O A;  2RN7 A;  3HRU A;  4U7D A;  5JHU A;  4A5M A;  1I27 A;  3RYR A;  2STT A;  3BDD A;  4LK0 F;  1ZRF A;  5FB2 A;  3IC7 A;  3R0J A;  4B8X A;  1D8J A;  2HKO A;  4KDP A;  3KP6 A;  3HOS A;  4XLN F;  3WGH A;  1BI0 A;  4H0E A;  1IUY A;  1XGO A;  2OA4 A;  3SQN A;  4KN7 X;  5DV5 A;  4NB5 A;  1YTY A;  4UV9 A;  4N9I A;  4XSZ F;  2Q8K A;  3GWZ A;  3BJA A;  3L09 A;  2CQK A;  4OIO F;  4A0Y A;  4WF2 A;  3GZ6 A;  3J81 Z;  4P96 A;  2P6T A;  3M1E A;  5ICE A;  3EQL F;  2LDU A;  1QZY A;  1U78 A;  1RNL A;  1KU2 A;  1T98 A;  1G6N A;  1O3Q A;  4UHT A;  1OYI A;  1CF7 A;  4U7B A;  4A0Z A;  2DI3 A;  2DQR A;  2KJB A;  1IN7 A;  3RKW A;  2VC0 A;  5K1Y A;  1T39 A;  2P5V A;  1IW7 F;  3SZT A;  3C7J A;  2MC3 A;  1T6S A;  4O3M A;  1XMK A;  2IP2 A;  4ASN A;  3DQV C;  2PMU A;  3PFI A;  3TQN A;  4R79 A;  2M45 A;  3TOB A;  5LGU A;  1ON1 A;  2GWR A;  5LEJ A;  1JE8 A;  3V8J A;  4CIC A;  4P5O A;  5LHI A;  2NYX A;  2IA2 A;  5F1R A;  4Q47 A;  3JAM K;  4I2O A;  3BP8 A;  2A68 F;  3HIF A;  2VT3 A;  1P92 A;  3TO9 A;  2HYF A;  1I1G A;  2EA2 A;  2UZK A;  3MWM A;  3HSF A;  5JFR A;  5F64 A;  2D1V A;  3TDU C;  2ISZ A;  4ENJ A;  1U2W A;  3VFZ A;  1Z05 A;  4HAM A;  1RZ4 A;  2DLL A;  2GZW A;  3HRT A;  1FP1 D;  3P9C A;  2MA3 A;  2A61 A;  4IRI A;  3ZMT A;  2PFB A;  3HSR A;  5HDG A;  4EV0 A;  2PLY A;  3E6D A;  2JZY A;  2Z3Y A;  4GO1 A;  5L3G A;  1KQ9 A;  3VOD A;  2NNN A;  2FEZ A;  1YS6 A;  1REP C;  4N9H A;  4ESF A;  3CUQ B;  4ENK A;  1R5G A;  3BY6 A;  4HW0 A;  3IL2 A;  2ACJ A;  3CUQ A;  1G3T A;  2BV6 A;  5E1X A;  1FYK A;  1QBJ A;  1ZRD A;  2P7V B;  5FD6 A;  4G8X A;  1LJ9 A;  3J80 K;  3F8N A;  1QQI A;  1S3J A;  4RB0 A;  4DQ2 A;  2PN6 A;  5LGN A;  5DYM A;  4KIC A;  4UVC A;  2YSR A;  3N4M A;  1PDN C;  1T2K A;  3EYY A;  5DD4 A;  3R60 A;  3NRV A;  1ZRC A;  4L9N A;  4G9Y A;  1ZH5 A;  3HTU A;  2MH9 A;  4OOI A;  4IXA A;  1Z9C A;  4I7H A;  4YII A;  4R1H A;  3LA3 A;  1T38 A;  5ED4 A;  3M8E A;  2AXL A;  1UST A;  3T0Y A;  5LRR A;  4YIF A;  1S7A A;  2L01 A;  2PMH A;  4FX0 A;  3R6S A;  1XSD A;  1KQ8 A;  3ZPL A;  2L3D A;  1DDN A;  1XN7 A;  3I64 A;  4JK1 X;  4CDG A;  1OYY A;  1F9N A;  4EM0 B;  2ELH A;  2OQG A;  2IA0 A;  3V7R A;  4RGS A;  2NS0 A;  2B0L A;  3FM3 A;  3OOP A;  1L0O C;  2W84 A;  5D4S A;  4HF2 A;  4A5N A;  1MDM A;  3V8K A;  5BOX A;  5E18 F;  2D2W A;  4KIF A;  4EM2 A;  5IT3 A;  1XCB A;  4ZZD A;  4P55 A;  1GHC A;  1PP8 F;  4CZZ A;  4Z2Y A;  3RJP A;  4A6D A;  4O5V A;  4AIH A;  3WGI A;  2PQ8 A;  4M73 A;  2F5F A;  4BHP A;  1FNN A;  1TQI A;  2L4M A;  1IN8 A;  2XAF A;  2IVM A;  1ON2 A;  2G7H A;  4M6X A;  5DCM B;  2KJC A;  3FF5 A;  5FLX Z;  3PQK A;  3ZMD A;  2FRH A;  1D3Y A;  1V4R A;  2RGV A;  1B4A A;  1V3F A;  4I0B A;  3LA7 A;  5J6X A;  4Y13 A;  4E70 A;  1FYM A;  2H27 A;  5E17 F;  3JW4 A;  4M9S A;  4HDU A;  3HHG A;  4CGZ A;  3DFG A;  4WWC A;  3KP4 A;  3MEX A;  1RI7 A;  1ZHF A;  1SD7 A;  4LLL A;  3DEU A;  1B1B A;  3C1D A;  4AWX B;  3IKV A;  1YIO A;  4UVA A;  4GGG A;  1GVJ A;  1ONV A;  3GVA A;  3TDZ C;  2L54 A;  2FOK A;  5AIQ A;  5J8F A;  3MFK A;  3IKT A;  3GLX A;  3LQQ A;  1FX7 A;  3FMS A;  3MZY A;  4K2E A;  1ZRE A;  1Z7U A;  3WE3 A;  2A69 F;  4OIN F;  3O6B B;  1K6O A;  3KZY A;  1XDU A;  1USS A;  3J81 K;  1U5T C;  2KRF A;  6PAX A;  1ODD A;  1I5Z A;  1WKM A;  4HQE A;  1K78 B;  1OPC A;  2QBY B;  2V9V A;  4ZYG A;  3DV8 A;  2XGX A;  4ZYE A;  1IAW A;  4BNC A;  1ZG3 A;  3O2P E;  2DO7 A;  1Z6R A;  3LAP A;  5A2Q K;  2ZME A;  3KP3 A;  1HBX G;  2QYO A;  2ZXJ A;  1LEB A;  2R7F A;  1RUO A;  2VXZ A;  4EM1 A;  3E5U A;  4IRH A;  3I58 A;  1Y0U A;  2HEO A;  2O0Y A;  3ZN0 A;  4LJZ F;  2HWV A;  1SFX A;  1XGN A;  5DUI A;  3GX4 X;  3CJN A;  5CVV A;  3BPX A;  1J2X A;  3QPT A;  5L3D A;  1SMY F;  1BI2 A;  2PG4 A;  4Y17 A;  5DEQ A;  1X3U A;  3K69 A;  3JTH A;  4U88 A;  5HS9 A;  3MZH A;  2XAH A;  4OU0 A;  3F8M A;  2VOP A;  4YG2 F;  2YR2 A;  2HTS A;  4KUM A;  4KIG A;  2O03 A;  5H6R A;  4I01 A;  4G6Q A;  3I59 A;  1R1V A;  2G9W A;  4HBL A;  3V8L A;  3W6J B;  2HQN A;  2JSC A;  4GCV A;  5BPI A;  3MAJ A;  2EWN A;  1LDJ A;  3JSO A;  5L3C A;  4JQF A;  3Q5F A;  1MJB A;  3VOE A;  2FNA A;  4MNU A;  2BBY A;  4L9J A;  3WU0 A;  1R1U A;  1YW8 A;  2JTV A;  2XIG A;  4PGG A;  1ZAO A;  2QQA A;  3VB2 A;  2LF8 A;  2GXB A;  4HOB A;  2GIV A;  2A3S A;  3FX3 A;  3EYI A;  3SXY A;  3R4K A;  2VT2 A;  1W5T A;  3WTT C;  1LB2 A;  4HX4 A;  1XGM A;  2QWW A;  4LLN A;  3WTZ A;  4BAY A;  4EMS A;  2PBI A;  3KP7 A;  2YPR A;  5D5W B;  3HUG A;  5K5O A;  3KET A;  2MLG A;  4LD5 A;  1DPU A;  4L18 B;  2M87 A;  5E8I A;  2WC2 A;  3DPT A;  1KA8 A;  5LBQ A;  3NQO A;  3I54 A;  5A2Q Z;  2ISY A;  4I02 A;  4MHG A;  2LF7 A;  4ON0 A;  1Z91 A;  2ADU A;  1JHF A;  3V7S A;  1KQ0 A;  5HOO A;  5ERI A;  3WE2 A;  3R61 A;  2DQL A;  5HLI A;  2ZCW A;  2DTR A;  1YLF A;  3E6M A;  4RGR A;  2OZ6 A;  3MQ0 A;  5AON A;  3U2R A;  4ZZL A;  3G73 A;  3GFL A;  3C18 A;  4RB2 C;  4ZYH A;  4JBA A;  5EEG A;  3FZV A;  1D8K A;  4XSX F;  3F21 A;  3FHZ A;  2DFI A;  4XRF A;  1BC7 C;  5HDN A;  1IXS B;  1ZG1 A;  4D0P A;  4FX4 A;  2FBI A;  4I0A A;  4LGW A;  3RPQ A;  1MGT A;  1R00 A;  2AS5 F;  2ZNZ A;  3CUO A;  4G94 A;  1QGP A;  1R23 A;  2K7L A;  4L5J A;  5HVQ C;  2EV0 A;  2FBH A;  3FMR A;  2E7X A;  4YFN F;  4L5I A;  5DDG A;  2YX7 A;  5CVU A;  2P6S A;  2IW5 A;  3E97 A;  4UUV A;  2HOE A;  1EH6 A;  1AWC A;  3BRO A;  4ENN A;  3F22 A;  4RAZ A;  3KEQ A;  5EEH A;  4UV8 A;  3IRR A;  1BI3 A;  3CLO A;  2O61 A;  5LGT A;  3LWF A;  4IHT A;  1JHH A;  4FT8 A;  2HGC A;  4HA8 A;  3RTR A;  4MQV A;  1O57 A;  3E5X A;  3K2Z A;  2H94 A;  2V1X A;  2FE3 A;  5ICF A;  2O3F A;  1OMI A;  3REO A;  1U5T B;  4A6E A;  5CVR A;  1U6G A;  3WTY C;  2IA1 A;  2MBF A;  2K86 A;  3F8F A;  3L00 A;  5AIP A;  4P9F A;  2QBY A;  2LKP A;  2V1D A;  4MTE A;  2OD5 A;  3P7N A;  2XAQ A;  4AIJ A;  1BM9 A;  4PZJ A;  2GA2 A;  4F7Z A;  3E6B A;  2VOO A;  5IT9 Z;  2F2E A;  4ESB A;  2J5P A;  1TW3 A;  3KP2 A;  4HV6 A;  4MEX F;  1HW5 A;  2EFP A;  2UXX A;  2CWE A;  4RGU A;  2FQ3 A;  1YG2 A;  2VC1 A;  2EV6 A;  2GQQ A;  5IT9 K;  1FBS A;  5LHH A;  1OYW A;  5FO5 A;  1MD0 A;  3SFZ A;  3QAH A;  2EFW A;  4DNC A;  2RNJ A;  3KCC A;  2JPC A;  4WX9 A;  1O3T A;  4RAY A;  3BJ6 A;  1MJ9 A;  3T8R A;  4HX7 A;  1J7K A;  1XCV A;  3TGN A;  2EV5 A;  3K1P A;  5E20 A;  5HLH A;  3GFI A;  5FFX A;  3RIR A;  3ECO A;  5E1W A;  1J9I A;  3QOP A;  5BS6 A;  4L9V A;  2NRA C;  1W7P D;  5DD8 A;  4RB3 C;  5HLG A;  2KIU A;  2OZU A;  1BIB A;  2XKP A;  1IZ1 A;  2EA4 A;  2XAG A;  2Y75 A;  1SD5 A;  3I0T A;  3FWE A;  3ULQ B;  4LG0 A;  2MD5 A;  3I59 B;  3HTS B;  2R3S A;  3RPU A;  4EVI A;  3ABU A;  4A0X A;  2COM A;  2K02 A;  1F1Z A;  4IHS A;  1KYZ A;  1Z1D A;  2VBW A;  2KKO A;  3LAJ A;  1H9G A;  2A5Y B;  2WTE A;  2FNP A;  2EK5 A;  1ZN2 A;  1SD4 A;  3HYI A;  2HQR A;  1P4A A;  3ABT A;  2RVC A;  2VBX A;  2GA1 A;  5D4R A;  3RDI A;  1FT9 A;  5TRD A;  3RKY A;  2VON A;  3RI4 A;  2FSW A;  1BC8 C;  1FSE A;  3QU3 A;  3WOD F;  1ULY A;  4B09 A;  4ESJ A;  2F5D A;  3ZMV A;  4RB1 A;  2IJL A;  4HF0 A;  1TQP A;  3CO7 C;  3GW2 A;  4MGR A;  2D45 A;  2ZNY A;  2M30 A;  5FLX K; 
#chains in the Genus database with same CATH topology
 5B66 C;  2QEN A;  4A2U A;  2STW A;  1TP4 A;  4Q48 A;  1UHW A;  3M07 A;  4M71 A;  2K3F A;  3BQY A;  1VQ8 I;  2M3A A;  4A69 C;  2UV1 A;  3PNV A;  4PDK A;  1P4X A;  4BDZ A;  2VE8 A;  3OY9 A;  4DJA A;  4IRG A;  4XMY A;  2VBZ A;  3JRI A;  3QWL A;  2WBM A;  3CO6 C;  2OF7 A;  1MH3 A;  4Y3O A;  2DMT A;  2DPU A;  2D5V A;  2HOT A;  2RKH A;  1HSJ A;  1ITY A;  2DA7 A;  2E1O A;  1D5V A;  4IPA A;  5CPR B;  4FET A;  3WTS C;  1KON A;  3KPH A;  3QPL A;  3S8P A;  1IN4 A;  4Q4Z F;  1T8I A;  4W97 A;  2ESN A;  2LKS A;  3GF2 A;  5LLQ A;  1ETQ A;  3G4S I;  4PSW A;  2XGD A;  1NK3 P;  4YFX F;  2ZXW H;  1ETV A;  1I6X A;  2Q2E A;  2HQA A;  5BPD A;  1N75 A;  4B3A A;  2F5V A;  4JYK A;  4BAC A;  1UEL B;  2ZKZ A;  1RIO H;  4EQQ A;  3WHC A;  3VYR B;  1KU3 A;  4FE7 A;  1QU3 A;  4AD9 A;  4M6Y A;  1XS9 A;  2KRC A;  3GBG A;  4BXF A;  3J7A O;  4XR6 A;  2WA0 A;  3N05 A;  2E34 A;  5JLX A;  2DOD A;  3E6C C;  5DTD A;  4B4C A;  1TLH B;  2Z2S B;  2ZME B;  3KZZ A;  4RGX A;  1R49 A;  1A36 A;  1AHD P;  2ZFW A;  4FIS A;  4F52 A;  1GUU A;  4J00 A;  5B1A H;  3RSN A;  2X0L A;  2V79 A;  4KMU X;  4LIU A;  4XN3 A;  2LOO A;  4WCG A;  3CMA I;  3QPH A;  3BOQ A;  4XRS A;  3A0B C;  3DPL C;  4LG0 B;  3MVP A;  1DP7 P;  3GEZ A;  4OIR F;  3OS2 A;  3PJR A;  2XGE A;  1LVA A;  5FGM A;  1WPK A;  2I8D A;  5D6E A;  2V9P A;  3TP3 A;  2DOF A;  3VYU B;  2LC2 A;  2GXG A;  4HG2 A;  1BOB A;  3BR6 A;  3DLL F;  2F5C A;  3GTO J;  3SEZ A;  3OYF A;  2L4A A;  1IDY A;  4G7H F;  1VQL I;  2JSP A;  1STZ A;  3JR9 A;  1Z67 A;  4YFK F;  1TW2 A;  2KIF A;  5KVR A;  1BR4 A;  4KA4 A;  4LK1 F;  3TOA A;  1KGS A;  4OIP F;  3M8F A;  2V26 A;  1F5T A;  3ERM A;  2Z9O A;  3OYA A;  3MKL A;  2K9Q A;  1T95 A;  3DTK A;  3AFH A;  1TNT A;  2ZJ2 A;  4HDV A;  2COB A;  3HL2 A;  1H89 C;  3SYT A;  3LSR A;  2K5C A;  3HZJ A;  2QQB A;  4ANJ A;  2CH0 A;  3H9Q A;  2RRE A;  2FXA A;  1D0Y A;  4JX6 A;  3RYP A;  2RC4 A;  2ICW G;  2OU2 A;  3ELK A;  2M5W A;  1R7J A;  1SVL A;  3WGG A;  2ZME C;  3KLN A;  3BG6 A;  1IRG A;  1ZLK A;  3V42 A;  5ILS A;  1N25 A;  3GCM A;  4C3H J;  4EEF G;  2IS2 A;  4HRI A;  1G2H A;  2JWT A;  3DCF A;  5EJC A;  1MNE A;  3KFW X;  2OUM A;  4S0H B;  2VN2 A;  3SHF A;  4ZJZ A;  2A6E F;  1G59 A;  5FLV A;  5F27 A;  5GAD J;  5IP7 J;  1T0F A;  3LSH A;  3L2V A;  3JAM Z;  3U1K A;  1UG2 A;  1BOA A;  2MG4 A;  2YUS A;  4NQW A;  1EA3 A;  3ERE D;  3IWZ A;  4G6D A;  4UUS A;  1Z6T A;  1UHM A;  2P5L C;  4UY8 I;  1FWZ A;  1XGS A;  2EZH A;  2NXN B;  1SMT A;  4Q5S F;  1MBF A;  2JJ7 A;  2IPQ X;  3S3M A;  1FY7 A;  3DKX A;  1U3E M;  2H1K A;  3HGG A;  3VWB A;  2DA5 A;  4KIB A;  3HOX J;  3LSK A;  1FBQ A;  2BE5 F;  4J01 A;  1TWC J;  3S2W A;  3K1M A;  2XSJ C;  1K7A A;  2GAU A;  5HS8 A;  2E36 A;  3NAU A;  3SZP A;  4KMF A;  2KRH A;  2OCE A;  3MKZ A;  1SFU A;  1TT0 A;  1ZAR A;  1CGP A;  2BVM A;  2F48 A;  1V55 H;  2AQF A;  4LLG F;  1R1T A;  1WJB A;  3CES A;  5CKT A;  1AOY A;  2A6T A;  5DCM A;  3FK6 A;  4IF4 A;  1YYV A;  4A3C J;  1MMA A;  1X1A A;  3JCU C;  2DA2 A;  1KYW A;  3BLY A;  1YJN I;  1O7F A;  3MMY B;  1CF7 B;  4A3K J;  3UNG C;  1ETO A;  4MLO A;  2CW0 F;  2P8T A;  4BE0 A;  3TED A;  2CO5 A;  1F4K A;  1VQ7 I;  4CXF A;  3KEO A;  3M8J A;  1J5Y A;  3FMQ A;  1R6R A;  2L9V A;  2GXA A;  3HJE A;  1MND A;  3H3U A;  4PCQ A;  4M9Z A;  4L0Z B;  2Z16 A;  5FFZ A;  2M1B A;  4CCO A;  1FPQ A;  4NC6 A;  2BVL A;  1P6R A;  1RC9 A;  5GPC A;  4DYC A;  4ZYA A;  4I99 C;  5GP9 A;  3CDH A;  3TO6 A;  3ZMZ A;  1J75 A;  1R36 A;  3CUQ C;  5TJJ A;  1EH7 A;  3GO5 A;  2X6X A;  1A6Q A;  2XGC A;  2I10 A;  1O3R A;  4IVN A;  1GXP A;  4L0Y B;  4UNO A;  3P9I A;  1IV8 A;  5KK1 A;  3MZ8 A;  3DP7 A;  2UUZ A;  1S8N A;  3ROU A;  4EJO A;  1Z77 A;  2O5R A;  1LDK B;  1X2M A;  2HKX A;  3K0L A;  3ZP5 A;  5H20 A;  3C3W A;  5TGT A;  2M2E A;  2FX0 A;  3HB9 A;  1XB4 A;  2HFH A;  3F8C A;  2OCC H;  1B59 A;  2PEX A;  4QLC U;  1ETX A;  1I39 A;  2QEX I;  1J59 A;  4I09 A;  3DKW A;  4BH9 A;  5CYV A;  2WWY A;  1GDT A;  2O9L A;  2ZFU A;  3FIS A;  1ZR4 A;  4W1U A;  1E3H A;  2EFQ A;  5IYB J;  3EUH A;  2TRT A;  3K1N A;  2QM3 A;  1ZLJ A;  1UG0 A;  4HLX A;  4S04 A;  4GDF A;  1FP2 A;  3HM5 A;  3HRS A;  2M7A A;  4BS9 A;  2WAE A;  3K4C A;  4V2G A;  4KT5 C;  3AAF A;  1NK2 P;  2V6C A;  3LNQ A;  4Y52 J;  3EET A;  3S32 A;  5EG0 A;  2DW4 A;  1SFE A;  2HDC A;  1BI1 A;  2NAZ A;  1W4M A;  1IV6 A;  3PSF A;  1XC5 A;  4BL0 B;  2M8E A;  1ZGJ A;  4EGY A;  2KL4 A;  3FIW A;  1EV7 A;  1ZGA A;  2R7U A;  3MCZ A;  4GXO A;  2HS5 A;  3OR1 C;  3ZMS A;  4WXH A;  2OTL I;  2E7W A;  2MW8 A;  4AIK A;  3DXJ F;  1HKQ A;  1HW1 A;  1XMA A;  3JRD A;  3PO2 J;  2LR8 A;  2FQ4 A;  1WHU A;  1WRJ A;  2LFB A;  2A6H F;  2H1L A;  3DEW A;  4E7H A;  3L9F A;  2E1M B;  4YEJ A;  2W57 A;  4OMZ A;  4II2 A;  1BIA A;  2UXN A;  3CQZ J;  2VUM J;  3O8H A;  4XL9 A;  2MLK A;  3LL7 A;  1P2F A;  2Q1Z B;  3BTJ A;  4GYG A;  1HDP A;  1D1B A;  1IF1 A;  4XLP F;  1B6A A;  3A03 A;  4A12 A;  1SEU A;  4AVZ A;  5ICC A;  4S05 A;  2BGC A;  4C3J J;  5M5X J;  2LLK A;  2P81 A;  5BQT A;  4Y7N J;  4XNF A;  1NH3 A;  2IRF G;  4BJ6 C;  1WI9 A;  2DBB A;  3QRF F;  1LPQ A;  3K9T A;  1KU7 A;  4IHW A;  1ETY A;  3LQR A;  5KAF C;  4M3E A;  3M3Y J;  1U8R A;  1W5S A;  1W36 D;  1LNW A;  2WB1 A;  3WTU C;  3WTW C;  4B1R A;  1E0E A;  2MH2 A;  3WU1 B;  1R5I D;  2ECB A;  2LK2 A;  3H0D A;  3S17 J;  2EZK A;  1MMD A;  4QTR A;  1VQ9 I;  1FZP B;  1JGS A;  2EBI A;  1S7O A;  3VPR A;  2E2I J;  2CW8 A;  2ME6 A;  3I55 I;  2HI3 A;  2OJE D;  3S93 A;  2F4M B;  1G3W A;  4Y33 A;  4WXC A;  4RMN A;  1R71 A;  3E3V A;  3F6V A;  2LSO A;  3ZQQ A;  1XD7 A;  5KHD A;  1U8B A;  2X48 A;  2XRO A;  4KJZ A;  4KYW A;  1HKT A;  5D5X B;  5L3E A;  1VTN C;  2XV4 S;  3L2W A;  1FBU A;  1NG7 A;  1FJL A;  3COA C;  2PJP A;  2VOD A;  2XRN A;  3GFM A;  3AG4 H;  3FHN A;  4LMY A;  3MKW B;  2E60 A;  1QZE A;  4YRV A;  3BT9 A;  3F9K A;  4C9Y A;  1QO0 D;  1L3L A;  4RA2 A;  2ETH A;  2DXI A;  1HXD A;  4ABZ A;  1HDD C;  2VKD A;  5J4Y A;  5H6Q A;  3ECH A;  4J19 A;  1U9N A;  3J7A Y;  4ZH4 F;  3GTG J;  3RKQ A;  3CZ6 A;  2ID6 A;  2V1U A;  4MO7 A;  2VQH A;  3H9J A;  4BHC A;  1P4W A;  1WJ5 A;  1R9T J;  4XKB A;  3F72 A;  2CV2 A;  4ENM A;  2CW7 A;  4UB8 C;  2DYR H;  2RQP A;  5DCF A;  4BGD A;  5J8C A;  3ZMU A;  1WI3 A;  3H35 A;  2FML A;  2L02 A;  4BXU A;  4BQO A;  4I6Z A;  1K79 A;  1JXS A;  2BOL A;  2XUB A;  1DUX C;  4MFE A;  5CQE A;  4BHB A;  3ZQ7 A;  3H92 A;  3S1R J;  2QKL B;  2QQ9 A;  3ASO H;  4OAY A;  3HPH A;  5EZH A;  4OMY A;  5FRM A;  3EDP A;  2O6G E;  2R5Z A;  4HNT A;  2X6O A;  3CMM A;  4XRS G;  2KZG A;  2FMY A;  3OYK A;  4FQG A;  4HPQ A;  3OYC A;  4H4K C;  3F23 A;  2CUF A;  3VEP A;  4P1W A;  4EJW A;  3GUD A;  3SJM A;  2RV8 A;  3D0S A;  3LSP A;  3I5U A;  1H0M A;  4E7S A;  4N4O B;  2LKX A;  3F0C A;  2LY2 A;  1B8I A;  3D5L A;  3CMY A;  3FXQ A;  5IPA A;  3CP8 A;  3TO7 A;  3CCQ I;  2Z5U A;  1YRN B;  5HDK A;  3HOY J;  2K4B A;  2XAJ A;  1Y8R B;  2VKV A;  2VE9 A;  2W24 A;  1Y0N A;  2OAZ A;  2IT0 A;  4R8H A;  3L2R A;  5B5E C;  2Y48 A;  4PK4 A;  3OSG A;  2BHZ A;  2MD0 A;  4CZC A;  1TTY A;  1ZG5 A;  1O4X A;  1K4T A;  3I71 A;  2DK5 A;  1XX5 A;  4XON A;  4U0Y A;  3W6K B;  2XVC A;  3E1S A;  4KFC A;  1A5J A;  1V5G A;  2JVG A;  1FC3 A;  2RAE A;  4XM3 A;  4XLH A;  3BWG A;  2EFO A;  2LNB A;  3CC4 I;  2AO9 A;  4BJT A;  1PUE E;  4HF1 A;  1IXR C;  2Y0M A;  3GFJ A;  2QA4 I;  2LG4 A;  3QP6 A;  4XBF A;  3BZC A;  1VQN I;  2H09 A;  2XF5 A;  4D1Q A;  2FF4 A;  1RUN A;  3TKY A;  5IP6 A;  5JVT A;  3OYG A;  5FKN A;  1P9Q C;  2R93 J;  1M1E B;  1B9N A;  1YS7 A;  3Q0V A;  2ESH A;  3J7Y J;  1TQM A;  5LRS A;  1OR7 C;  2FD5 A;  2LYC A;  1XSX A;  1HQC A;  3G1M A;  1U5T A;  4E7L A;  4L9T A;  2IAI A;  2QZ8 A;  2ELJ A;  5CJ9 A;  1TBX A;  4KN4 X;  3AL0 B;  1PP7 U;  3S1Q J;  2D1H A;  5CLS A;  4LB5 A;  1YW9 A;  2A05 A;  1QPM A;  5E3L A;  2GOM A;  1XMX A;  3G1L A;  4RS8 A;  5D6F A;  2L9N A;  2KIM A;  3V4G A;  4AYB N;  2TDX A;  1NHA A;  4EJV A;  3LST A;  2HQ5 A;  2IBD A;  1IRF A;  3OYI A;  3BCA A;  1LQ1 A;  4GRI A;  1TL8 A;  3CTA A;  4M3F A;  2HDD A;  1F43 A;  1OCC H;  1G4D A;  2EIN H;  1SAN A;  1ETK A;  2X4H A;  4M74 A;  3E5Q A;  2LBF B;  4WK8 F;  5EZG A;  3KLO A;  3NEU A;  2JUG A;  4B48 A;  2MSY A;  3K4M A;  2Z33 A;  3U1D A;  4AVP A;  2CV0 A;  4BUP A;  2CG4 A;  2RDP A;  2CUE A;  2E5Z A;  2EIJ H;  4PJ0 C;  3O3K A;  1OJL A;  2EB7 A;  4NUB A;  4FAS D;  2HVS A;  3ASN H;  3FKI J;  2CSO A;  4HQM A;  1UCR A;  2L2O A;  2XHK A;  2WY8 Q;  3A4C A;  3ZN1 A;  2M7B A;  4I76 A;  2G7U A;  3T8T A;  1G3S A;  3G3Z A;  1PJR A;  3L2C A;  2DT6 A;  3KX2 A;  3T5X A;  5J40 A;  2O8X A;  5E1Z B;  2DPD A;  5FKO A;  3U9G A;  4BJ5 C;  1EH8 A;  2CYY A;  1E3P A;  3F6O A;  1VFC A;  1W0U A;  3ZXS A;  2DJN A;  1Y8Q B;  4Y4R A;  3ISP A;  3RPU D;  1HW2 A;  2R7S A;  3BR5 A;  4PUS A;  4IOC F;  2W85 A;  2NNY A;  4MQ9 F;  2X1E A;  2VJI A;  1GXQ A;  2UWM A;  2CQX A;  3HOW J;  1UB9 A;  1IO2 A;  3GLL A;  4MEY F;  5B1B H;  5EYR A;  5HS7 A;  1G3Y A;  5D8K B;  3CCY A;  5IOY A;  3X2Q H;  2Z99 A;  4HNU A;  1NG6 A;  2K4J A;  3K4B A;  3NWS A;  4WXD A;  3IAM 2;  4HYE A;  5K5R A;  2GM4 A;  2CJJ A;  1FEX A;  2BEO A;  2VAS A;  3BZ6 A;  3GXO A;  3I4P A;  3A01 A;  2Q2E B;  2WV0 A;  4UXN A;  2ZBK A;  2F5E A;  1FLI A;  4IOA F;  1VQK I;  2OPT A;  5KNL A;  4A3D J;  2ZSH B;  2IGK A;  3ZQG A;  1SD6 A;  2XSD C;  2LD5 A;  1WSU A;  1Z3Y A;  5JI6 A;  4BYY A;  2QSH X;  3GTJ J;  1WJF A;  3K70 C;  4HX8 A;  1XDS A;  3JTG A;  4UUT A;  2LBF A;  2DDA A;  1IRX A;  4DIQ A;  4N0B A;  1X1C A;  1R4M B;  3L2Q A;  2EFN A;  3T1B A;  1QZZ A;  1ZGW A;  1TC3 C;  2XC7 A;  3PFY A;  3WU2 C;  5L3B A;  1BJA A;  2E1M C;  1IRZ A;  2VBY A;  3F8B A;  2E35 A;  1FOK A;  2YU9 J;  1R22 A;  2WAQ A;  2I5U A;  3FBN B;  4E7I A;  2H6C A;  5C4J J;  3PIP F;  5IOZ A;  3P9K A;  4BY7 J;  1VQ4 I;  2JQ7 A;  4IHV A;  1FYL A;  2CFO A;  2R5Y B;  2MYS A;  2QVO A;  4DOZ A;  2JRT A;  2HZT A;  1IC8 A;  4HLY A;  2YU3 A;  3CCV I;  2DMQ A;  1XSV A;  3EUA A;  1SAX A;  4G7O F;  1IXC A;  1ZEL A;  1BN5 A;  5ILV A;  3HUG B;  3IH3 A;  5FD5 A;  2KDZ A;  4AUX A;  2AHQ A;  2KMU A;  1WZ2 A;  1UFM A;  2R7D A;  1J0R A;  1FSH A;  1W7P B;  3OV8 A;  4IHY A;  2OC6 A;  5C3E J;  2QLZ A;  3SEQ A;  4LFU A;  3GZ5 A;  5GPA A;  1VND A;  4OIQ F;  3R0A A;  3KE2 A;  2NVT J;  4I98 B;  4IKF A;  5J4V A;  3PO3 J;  2HOS A;  4U0W A;  2VPR A;  1D1C A;  1MDM B;  3OYH A;  4XKV A;  5D5U B;  2XKO A;  2DK8 A;  2DU9 A;  2B63 J;  1Q1V A;  4HST A;  2BYV E;  1WJA A;  3DU5 A;  5K7F A;  1R5H A;  5BMZ A;  1SFO J;  2FU4 A;  4CO8 A;  5K5Q A;  3FXJ A;  4ZC3 A;  4CYC B;  1LKX A;  2V9K A;  3DBL B;  1MZB A;  3B73 A;  1MBJ A;  1X2N A;  4KNY A;  3DF8 A;  5DM7 F;  4HV5 A;  1HST A;  3SDB A;  4C30 A;  2BY0 A;  3H5A A;  4G7Z F;  1WCM J;  4XOT A;  4OAZ A;  4LB6 B;  1TNS A;  3HRM A;  5HOD A;  3V7C A;  2W25 A;  1R58 A;  4BBR J;  5LHG A;  3RQI A;  2F4O B;  3HOT A;  2M34 A;  3EUK L;  4EJU A;  3L7W A;  4D5F A;  3KIO A;  3CCL I;  2C6Y A;  1I1S A;  1O7L A;  4AID A;  1O3S A;  2KLO A;  1HKS A;  3FXK A;  2E1C A;  2FUG 2;  1KU9 A;  2CFX A;  5D8L B;  5C4X J;  4DW6 A;  4O6J A;  5F0F A;  1E17 A;  3U21 A;  5GTH C;  4P9U A;  2EJR A;  1G8X A;  3Q9S A;  1K83 J;  4CHU A;  1MH4 A;  3BPV A;  2P7C B;  1FIA A;  3ZQH A;  3OSF A;  4TV7 A;  1S6L A;  1VQO I;  2FBK A;  4UVB A;  1VQ6 I;  4M9X A;  1A04 A;  3QYF A;  5H2F C;  3OL3 A;  2R7V A;  2V1N A;  3I53 A;  3UR3 C;  2ZO4 A;  4AYB A;  1QHH D;  2P5K A;  2JT1 A;  5ICG A;  1BBY A;  2HVQ A;  3H3Z A;  2GBY A;  2HZD A;  3BG9 A;  4GYI A;  1RR7 A;  5LEK A;  2KP6 A;  3OOU A;  1S9H A;  4ITV A;  1MJA A;  5IP9 J;  5JR3 A;  3OR2 C;  2ZSI B;  3J80 Z;  2DFH A;  2W7N A;  4EJT A;  3K4N A;  3M7G A;  1IN6 A;  4MTD A;  5ILU A;  2DYS H;  3B02 A;  3BJO A;  3GYH X;  1BR1 A;  3LA2 A;  1JI8 A;  5L3F A;  5D5V B;  4EGZ A;  4E6K G;  1H9T A;  4C3I J;  3I3L A;  5F6F A;  3FM5 A;  3Q9V A;  3PUB A;  1W7P A;  4CYD A;  5JHF A;  3DU6 A;  3OYD A;  2CGP A;  3QP5 A;  5F0C A;  2QUF A;  3I56 I;  1GT0 C;  1YW7 A;  1W5C C;  3QU6 A;  3F3X A;  2R4G A;  4LG3 A;  1SFK A;  1S29 A;  3FXU A;  4PJN A;  4PJJ A;  2PI0 A;  1MKM A;  4NHJ A;  4JX4 A;  2OBP A;  4M72 A;  2DT7 B;  2HTJ A;  3FXR A;  3JRB A;  2YX4 A;  5DUK A;  1ZYR F;  3IHU A;  2QKM B;  1RET A;  3WG9 A;  3JSP A;  3VYS B;  2HPM A;  1YQA A;  4XOR A;  4U0V A;  2MAB A;  1OR7 A;  1K78 A;  5F08 A;  3PQJ A;  1FMW A;  2M4K A;  4HZF A;  2PX9 A;  2HU9 A;  2K27 A;  1Y6I A;  3BR0 A;  2IS6 A;  1Q1H A;  1TWA J;  4ZYD A;  1WQ2 A;  4IJA A;  1PYV A;  2DA6 A;  1LEA A;  5CVI A;  4BQA A;  1IN5 A;  1QRY A;  2KT0 A;  2DAO A;  2M8G X;  1ZKG A;  2QGU A;  4QWQ A;  2Q0O A;  2HR3 A;  1Z0X A;  2KIS A;  5GAG J;  2F4I A;  3OYE A;  2VJ4 A;  4PGH A;  4CCM A;  5CVJ A;  2XAS A;  1VQ5 I;  3RKX A;  2E1N A;  3HEF A;  1YO5 C;  2HYG D;  1DPR A;  5E8G A;  1ACI A;  1D0X A;  3IWF A;  1LDD A;  3HSE A;  1IDZ A;  4IL6 C;  2OQR A;  4RLF A;  2P4W A;  4FHT A;  1B9M A;  3ML6 A;  3N97 A;  1QNT A;  1DGW Y;  1P7J A;  4XK4 A;  3G6E I;  3FK7 A;  3M9A A;  3SFI A;  5HLT A;  1OKR A;  1LFU P;  1MMN A;  4BQQ A;  1RRJ A;  2FA5 A;  2A07 F;  4L5E A;  3PIO F;  4Y15 A;  3LFK A;  5DS9 A;  4V19 K;  1YFH A;  1C0W A;  2VIX A;  3CCJ I;  2VJ5 A;  4ETS A;  3JRH A;  3WHB A;  3HHH A;  1WWX A;  2JPB A;  3IRQ A;  3KP5 A;  1GLN A;  3WTV C;  3WTX C;  1QA6 A;  2DT5 A;  2H6B A;  3TP0 A;  1BW6 A;  1E2X A;  2J5O A;  2RN7 A;  2NOJ B;  1VQP I;  2B9S A;  3HRU A;  4U7D A;  5JHU A;  3CCM I;  4A5M A;  4E4H A;  1I27 A;  3RYR A;  1VQM I;  2O7O A;  3BDD A;  4JX5 A;  4LK0 F;  2VLA A;  5FJ8 J;  1ZRF A;  2STT A;  1OLT A;  5FB2 A;  3IC7 A;  5KCM A;  1MMG A;  2XF6 A;  1K6Y A;  3HOZ J;  3R0J A;  3CDL A;  4B8X A;  2JN6 A;  1D8J A;  2W1O A;  4CA0 A;  3CCE I;  2HKO A;  4KDP A;  2CUJ A;  3KP6 A;  3HOS A;  4XLN F;  3FXM A;  3WGH A;  2QSG X;  1BI0 A;  4H0E A;  1IUY A;  3HDD A;  2EIL H;  1MNM C;  1XGO A;  2OA4 A;  4IO9 F;  3SQN A;  1B8I B;  4KN7 X;  1VI0 A;  1HA8 A;  5DV5 A;  3CDI A;  3OWT A;  1XPX A;  3DTI A;  4NB5 A;  2GOX B;  2DN0 A;  4D9J A;  2K9S A;  1YTY A;  4XID A;  4UV9 A;  2BY3 A;  1EJ9 A;  1QVT A;  4N9I A;  4XSZ F;  4MIM A;  2Q8K A;  1WH7 A;  3GWZ A;  3VSL A;  3BJA A;  3L09 A;  3O8G A;  1X3W B;  1F36 A;  2ZB9 A;  2CQK A;  3BG3 A;  4A0Y A;  4OIO F;  2XAU A;  4WF2 A;  3GZ6 A;  3J81 Z;  4P96 A;  2P6T A;  3M1E A;  1D1A A;  1LUJ B;  5ICE A;  3EQL F;  2LDU A;  1QZY A;  1U78 A;  1RNL A;  1KU2 A;  4NC7 A;  5F04 A;  2DTZ A;  1T98 A;  1WH5 A;  1G6N A;  4RM2 A;  1ZTR A;  1O3Q A;  2CS3 A;  4UHT A;  1CQT A;  1R4N B;  4RM3 A;  1OYI A;  1TWG J;  1D5Y A;  3TW6 A;  3TBI A;  1CF7 A;  4U7B A;  2DMU A;  2DI3 A;  4A0Z A;  2DQR A;  1JUM A;  2IS1 A;  3S2H J;  2KJB A;  1IN7 A;  3RKW A;  2VC0 A;  2M4G A;  5K1Y A;  3CLQ A;  1T39 A;  1VZ0 A;  2V4J C;  1UMQ A;  4JP0 A;  1W1W E;  3B6A A;  2DOE A;  2P5V A;  2Y0S N;  2R7O A;  1IW7 F;  3SZT A;  3C7J A;  4DBR A;  2MC3 A;  2OV7 A;  1YRN A;  1T6S A;  2ZXH A;  4O3M A;  1XMK A;  2W82 A;  2IP2 A;  1FOW A;  2MFZ A;  1HF0 A;  4ASN A;  4A93 J;  2RQQ A;  3BR1 A;  2BHY A;  3DQV C;  4LOC A;  1IUF A;  2PMU A;  2QQ8 A;  4HEA 2;  1QPI A;  3PFI A;  3S15 J;  4B47 A;  3TQN A;  4JOM A;  4R79 A;  2M45 A;  3KYD B;  2DFE A;  3TOB A;  5LGU A;  2HXI A;  1ON1 A;  2DA4 A;  2GWR A;  4M3B A;  5LEJ A;  1JE8 A;  1JUS A;  3DTE A;  2L7K A;  3PSI A;  3OMY A;  5E3M A;  2WB1 N;  3A2K A;  3V8J A;  4CIC A;  4P5O A;  5LHI A;  2NYX A;  2IA2 A;  5F1R A;  5FKM A;  2ELK A;  4Q47 A;  3H9G A;  3JAM K;  4I2O A;  3BP8 A;  3HIF A;  2A68 F;  2H8W A;  1WJD A;  2VT3 A;  1P92 A;  3TO9 A;  2HYF A;  1I1G A;  2EA2 A;  1QHG A;  2OTJ I;  4Z6Y A;  2UZK A;  3BG7 A;  4U87 A;  3MWM A;  4ZDO A;  5JLW A;  3HSF A;  2NVQ J;  5CQG A;  5JFR A;  1ORK A;  5F64 A;  2DCE A;  2D1V A;  2BXY A;  3TDU C;  2LMD A;  2ZJQ F;  2ISZ A;  1MMS A;  4ENJ A;  1U2W A;  4FTH A;  1UZC A;  3VFZ A;  1Z05 A;  4HAM A;  5IY5 H;  1RZ4 A;  2DLL A;  2F6C A;  2GZW A;  3HRT A;  3NAR A;  1FP1 D;  3K7A J;  3AG1 H;  3P9C A;  2MA3 A;  4IHX A;  2A61 A;  2XDV A;  4IRI A;  3ZMT A;  2XB5 A;  5E3N A;  3HSR A;  2PFB A;  4KT6 A;  2ME0 A;  5HDG A;  1X1P A;  4EV0 A;  1UAA A;  2PLY A;  3E6D A;  3QOE A;  2JZY A;  4CCN A;  4PJL A;  2Z3Y A;  3QQA A;  1JKQ C;  4GO1 A;  5L3G A;  1RR8 C;  1KQ9 A;  1B72 B;  1MW7 A;  3VOD A;  1SVO A;  2NNN A;  2K9M A;  3CJT B;  2FEZ A;  3ZCO A;  3Q0W A;  1HC8 A;  1YS6 A;  3EPZ A;  4N9H A;  4XKW A;  1REP C;  3HBL A;  1I3A A;  3CUQ B;  4ESF A;  2K40 A;  1YE9 A;  4ENK A;  1R5G A;  3BY6 A;  2LH9 A;  4HW0 A;  3IL2 A;  2VL8 A;  3CUQ A;  2ACJ A;  3ABL H;  1G3T A;  2BV6 A;  5E1X A;  4CCK A;  1FYK A;  4D7N A;  1QBJ A;  1ZRD A;  2P0W A;  2P7V B;  5FD6 A;  5DM6 F;  4G8X A;  2LRE A;  1LJ9 A;  1EKE A;  2XB0 X;  4DBQ A;  1Z7L A;  3J80 K;  5FRO A;  3F8N A;  1QQI A;  2LRD A;  1S3J A;  3OYL A;  4RB0 A;  4KIS A;  1IJW C;  3A0H C;  4DQ2 A;  2PN6 A;  2K9N A;  3BG5 A;  2HXO A;  5LGN A;  5DYM A;  3CCS I;  3D5S C;  4KIC A;  1OFC X;  2YSR A;  4UVC A;  2G0E A;  4EAT A;  3N4M A;  1OCT C;  2IS4 A;  1PDN C;  1T2K A;  2ZJP F;  1TT5 B;  3EYY A;  3E7L A;  3H5N A;  5DD4 A;  3DBR B;  1SVM A;  3R60 A;  4ZDL A;  2E71 A;  4B3X A;  3NRV A;  2H8R A;  2L0K A;  2LP0 A;  3ZQC A;  1ZRC A;  4L9N A;  4G9Y A;  1ZH5 A;  3HTU A;  2MH9 A;  4OOI A;  4AU7 A;  3IH4 A;  4IXA A;  4CCJ A;  1Z21 A;  5TIS C;  3BTL A;  3VYT B;  1GV5 A;  1Z9C A;  4I7H A;  4YII A;  4R1H A;  3LA3 A;  3GZN B;  1T38 A;  5ED4 A;  1YI2 I;  3H5R A;  3M8E A;  2AXL A;  1UST A;  2EZI A;  2K3P A;  2JA6 J;  3T0Y A;  4BBS J;  2DMN A;  5LRR A;  3SZG A;  3LSG A;  4YIF A;  5EDN A;  3ZQI A;  2XF7 A;  1S7A A;  4IZZ A;  2L01 A;  2PMH A;  4FX0 A;  4RBO A;  2B7E A;  3R6S A;  1XSD A;  1KQ8 A;  3G2B A;  3OS0 A;  1T08 B;  1MSE C;  3ZPL A;  5FKK A;  2L3D A;  1JKO C;  1MBK A;  3CF5 F;  1JKP C;  1DDN A;  1XN7 A;  2HOA A;  3ONQ A;  3I64 A;  4JK1 X;  4CDG A;  1OYY A;  1F9N A;  3AL0 C;  1RKT A;  2ELH A;  2OQG A;  4EM0 B;  2IA0 A;  4CYC A;  3V7R A;  1DU0 A;  2A5W A;  1DQU A;  4RGS A;  2CRG A;  3TL4 X;  3MKY B;  2NS0 A;  3CF2 A;  1X3Z B;  3UKG A;  2B0L A;  3FM3 A;  3P5J A;  3OOP A;  9ANT A;  2RNG A;  3K4K A;  2W84 A;  1L0O C;  5D4S A;  4A3J J;  1YHQ I;  4HF2 A;  2DA1 A;  4A5N A;  4BDY A;  1MDM A;  3V8K A;  1VF9 A;  4LIT A;  4BKX A;  3W6V A;  5BOX A;  5E18 F;  5FRN A;  2Y0S A;  1PUF A;  2D2W A;  4KIF A;  4EM2 A;  5LD2 C;  5IT3 A;  1A6I A;  5M5Y J;  4CSW A;  1XCB A;  4ZZD A;  4P55 A;  1Y39 A;  1LE8 A;  4FCY A;  1GHC A;  4UUS B;  1PP8 F;  4F91 B;  1RPW A;  3OYB A;  4CZZ A;  4Z2Y A;  3RJP A;  3KEY A;  4A6D A;  3JRF A;  4O5V A;  4AIH A;  3WGI A;  2CQN A;  2WAQ N;  2PQ8 A;  4M73 A;  4QSH A;  2F5F A;  2R7W A;  3LMM A;  2R5Y A;  4OWR B;  4BHP A;  4BE2 A;  1FNN A;  1TQI A;  2L9R A;  2L4M A;  5M3M J;  1IN8 A;  4ZTJ A;  2XAF A;  3GTQ J;  1DP3 A;  2IVM A;  1I50 J;  1ON2 A;  3A1Y A;  1BA5 A;  1NTC A;  1U0J A;  3OS1 A;  2VQL A;  3HOU J;  3K10 A;  1LVK A;  1S72 I;  2G7H A;  1JT6 A;  4CH7 A;  4IQJ A;  3S2D J;  1DU6 A;  3ZQL A;  4M6X A;  2IEK A;  5DCM B;  1T33 A;  2KJC A;  2VKE A;  3FF5 A;  3S1N J;  5FLX Z;  2MGQ A;  2VKH A;  3PQK A;  3Q0U A;  3ZMD A;  3D5R C;  2FRH A;  2KPM A;  3S14 J;  1POG A;  3AG2 H;  1D3Y A;  1BR2 A;  1JTX A;  1V4R A;  5K7Z A;  2VB6 A;  2RGV A;  1B4A A;  1V3F A;  4I0B A;  2AQE A;  3LA7 A;  1W0T A;  5J6X A;  4PFP A;  4E70 A;  4Y13 A;  1FYM A;  2R7Z J;  3MN2 A;  2H27 A;  5E17 F;  4IQ4 A;  2W00 A;  2CUZ A;  3ESW B;  4NDL A;  2VI6 A;  3JW4 A;  3IP4 B;  5GAE J;  4M9S A;  4HDU A;  3HHG A;  4CGZ A;  3DFG A;  4G6T B;  4WWC A;  3KP4 A;  4RAF A;  1AKH B;  2NVY J;  3MEX A;  1SC7 A;  3EUH C;  1RI7 A;  1UJ8 A;  1ZHF A;  3H36 A;  1SD7 A;  4LLL A;  3DEU A;  1B1B A;  2X51 A;  3C1D A;  4AC0 A;  2JRM A;  1X4O A;  1PUF B;  4AWX B;  3IKV A;  1YIO A;  3JRE A;  4UVA A;  3H3V K;  1HCR A;  4GGG A;  1GVJ A;  1ONV A;  4DGW B;  3GVA A;  4G12 A;  2EIM H;  3TDZ C;  2L54 A;  2FOK A;  3VSK A;  4DYR A;  5AIQ A;  2HDW A;  5J8F A;  3BC8 A;  3MFK A;  1JUP A;  3IKT A;  3GLX A;  3LQQ A;  1FX7 A;  3I4N J;  3C2G A;  3FMS A;  3MZY A;  4K2E A;  3DWL E;  1ZRE A;  4XIC A;  1Z7U A;  3WE3 A;  2A69 F;  4OIN F;  3O6B B;  1K6O A;  3KZY A;  4HNV A;  1XDU A;  1USS A;  5IYD J;  3J81 K;  3I4M J;  1Y1V J;  1K4S A;  1U5T C;  5J1U A;  2KRF A;  2FOW A;  4PJM A;  2KQR A;  6PAX A;  1WJC A;  1ODD A;  2E2H J;  4IX7 A;  2NVX J;  1I5Z A;  1WKM A;  4HQE A;  2KHM A;  2R0Q C;  1T0F C;  1K78 B;  1OPC A;  4BU2 A;  2QBY B;  2V9V A;  4ZYG A;  3OYM A;  3BZK A;  3DV8 A;  4A3E J;  2XGX A;  3G71 I;  2IGN A;  4ZYE A;  5BNG A;  2BW3 A;  1Y1W J;  3HOV J;  1IAW A;  4BNC A;  1ZG3 A;  3QPS A;  3O2P E;  1H8A C;  4DZJ A;  2KIQ A;  2DO7 A;  3H0G J;  1XTA A;  3OL4 A;  3HC7 A;  1Z6R A;  3LAP A;  1BJZ A;  3K6G A;  2ZME A;  3KP3 A;  5A2Q K;  2QYO A;  2ZXJ A;  1HBX G;  1JJ8 C;  1RKW A;  3C2B A;  1LEB A;  2VXD A;  2R7F A;  1YX3 A;  1T56 A;  1RUO A;  2VXZ A;  4EM1 A;  3E5U A;  4IRH A;  3I58 A;  1Y0U A;  2HEO A;  2O0Y A;  2EQR A;  2JA7 J;  3ZN0 A;  4FE4 A;  4D7M A;  4LJZ F;  2HWV A;  1SFX A;  1XGN A;  5DUI A;  3MD2 A;  4XOP A;  3GX4 X;  1MBG A;  3CJN A;  3K4J A;  5CVV A;  3BPX A;  1OCP A;  1FMV A;  3L1P A;  1J2X A;  3PL8 A;  3CCU I;  4A3L J;  3HG9 A;  3QPT A;  5L3D A;  1X58 A;  1UHS A;  4QPO A;  2PJR A;  3W2A A;  1SMY F;  1BI2 A;  1LFP A;  2IXS A;  3FXO A;  4GFB A;  2PG4 A;  4AM3 A;  4Y17 A;  5DEQ A;  1V5E A;  1FOX A;  2NOG A;  3B6C A;  1X3U A;  3K69 A;  2CMP A;  3JTH A;  1U9O A;  3HXL A;  2JA2 A;  2QSF X;  4U88 A;  4N4N B;  5HS9 A;  3OIP A;  2XPU A;  2WV1 A;  3MZH A;  4B44 A;  4BY1 J;  3BTC A;  2XAH A;  4OU0 A;  3F8M A;  4M3D A;  4YG2 F;  2VOP A;  2YR2 A;  2PMZ N;  2BZT A;  5EGO B;  2HTS A;  4KUM A;  4KIG A;  2O03 A;  2W48 A;  5H6R A;  2JMW A;  4I01 A;  1A35 A;  3SDG A;  4G6Q A;  3J7Z I;  2BY2 A;  2XPV A;  2R5Z B;  3I59 A;  1WJE A;  1OIS A;  2CV1 A;  2O8K A;  1D0Z A;  1R1V A;  2G9W A;  4HBL A;  1FIP A;  3V8L A;  3W6J B;  2HQN A;  2K9L A;  2JSC A;  4GCV A;  5BPI A;  1B72 A;  2GIZ A;  4D5C A;  3MAJ A;  2EWN A;  2R7X A;  4BE1 A;  1LDJ A;  3JSO A;  5KAI C;  3W2W A;  5L3C A;  1V54 H;  4JQF A;  3Q5F A;  1MJB A;  3VOE A;  2FNA A;  4MNU A;  2BBY A;  4L9J A;  4MFD A;  3RCO A;  3WU0 A;  1R1U A;  1OCR H;  1YW8 A;  2JTV A;  2XIG A;  4PGG A;  1ZAO A;  1ZR2 A;  2QQA A;  3VB2 A;  2LF8 A;  4XKC A;  2GXB A;  4HOB A;  2GIV A;  2A3S A;  3KYC B;  3M1C A;  5F1J A;  2V6E A;  5B3S H;  4BEH A;  3S16 J;  3FX3 A;  1N78 A;  5F0H A;  3EYI A;  4XLF A;  4A3I J;  1I6H J;  2L5Q A;  5E3O A;  3SXY A;  3W2V A;  5M5W J;  3R4K A;  2VT2 A;  4A3G J;  3L2U A;  1Z3X A;  3CC7 I;  1QVU A;  1W5T A;  3WTT C;  2DJI A;  4B43 A;  1LB2 A;  4HX4 A;  3KZI C;  1XGM A;  2QWW A;  2L9S A;  1OCO H;  3WTZ A;  4BAY A;  4LLN A;  4EMS A;  2R7T A;  2PBI A;  1TZL A;  3C2H A;  1YIJ I;  2EPF A;  1K61 A;  2JUC A;  3IAS 2;  3KP7 A;  2YPR A;  5D5W B;  3HUG A;  1ETW A;  2JA8 J;  2X1D A;  5K5O A;  3KET A;  2MLG A;  1IGN A;  4LD5 A;  3IUO A;  1DPU A;  4CUG A;  4L18 B;  2M87 A;  5E8I A;  2WC2 A;  1YX5 A;  3DPT A;  2FJ1 A;  4PSX A;  1KA8 A;  1N77 A;  5LBQ A;  3NQO A;  3I54 A;  5A2Q Z;  2ISY A;  3CJR B;  4I02 A;  1SAU A;  4MHG A;  2LF7 A;  4ON0 A;  1Z91 A;  3JRG A;  2Y69 H;  2ADU A;  1JHF A;  5EGO A;  1APL C;  2WAD A;  3V7S A;  4DZP A;  3S1M J;  1KQ0 A;  3CCR I;  4A3B J;  3DKY A;  5HOO A;  2ZXI A;  5ERI A;  2Y30 A;  3WE2 A;  2EH3 A;  2DQL A;  3R61 A;  3M4O J;  5HLI A;  2ZCW A;  2DTR A;  3K4L A;  2LVS A;  2ID3 A;  1P7I A;  4F55 A;  1YLF A;  4BEH B;  3OIO A;  3E6M A;  4RGR A;  3D1N I;  3QOD A;  2OZ6 A;  3MQ0 A;  5AON A;  3U2R A;  1ZQ3 P;  4ZZL A;  3G73 A;  3GFL A;  1TWF J;  2E19 A;  3C18 A;  4V2F A;  4RB2 C;  3A02 A;  4ZYH A;  3A01 B;  1AU7 A;  4JBA A;  3RQ4 A;  2V7F A;  4XLC A;  5EEG A;  2DDB A;  3FZV A;  3FBI B;  1D8K A;  4XSX F;  3ZRG A;  3F21 A;  1A31 A;  3BR3 A;  3FHZ A;  2DFI A;  3AG3 H;  4XRF A;  1BC7 C;  5HDN A;  4XQF A;  2VPL A;  1HLV A;  1IXS B;  1ZG1 A;  4D0P A;  2M0C A;  4FX4 A;  2FBI A;  2HYJ A;  2AXT C;  3QYB A;  4I0A A;  4LGW A;  2VJJ A;  3RZD J;  3RPQ A;  1MGT A;  1R00 A;  2AS5 F;  1W36 C;  4C2M J;  2ZNZ A;  3CUO A;  4G94 A;  2ZJR F;  1DGR M;  1QGP A;  5EG0 B;  1R23 A;  2EIK H;  2K7L A;  4L5J A;  5HVQ C;  2EV0 A;  2PMZ A;  2FBH A;  3FMR A;  2E7X A;  1TWH J;  4C2U A;  4YFN F;  4L5I A;  4RDU A;  3K70 D;  2DFF A;  2X1C A;  5DDG A;  3Q3S A;  1JT0 A;  5GTI C;  2YX7 A;  2EZL A;  5CVU A;  2P6S A;  2IW5 A;  3E97 A;  4YEL A;  2HOE A;  2XPW A;  4UUV A;  1EH6 A;  3LFU A;  1AWC A;  3BRO A;  3CP2 A;  4ENN A;  2PJR B;  3ZGK A;  3F22 A;  4RAZ A;  1ZK8 A;  1GV2 A;  5HNF A;  4E7J A;  3KEQ A;  5EEH A;  4UV8 A;  2N8G A;  3LSJ A;  3CME I;  1JJ6 C;  3IRR A;  1BI3 A;  2DA3 A;  1S5L C;  3CLO A;  1JKR C;  2E5N A;  2O61 A;  5LGT A;  3GTK J;  2L7F P;  3S3N A;  1YJW I;  3LWF A;  2R92 J;  2JVH A;  4IHT A;  1JHH A;  2BXZ A;  2E2J J;  4FT8 A;  2Y9Z A;  2HGC A;  4ZDP A;  3FDY A;  4HA8 A;  3RTR A;  2JK3 A;  4MQV A;  1O57 A;  3BTI A;  3FXL A;  3E5X A;  2BY1 A;  1PVE A;  3K2Z A;  2H94 A;  2V1X A;  1J09 A;  4XLA A;  2HNH A;  2FE3 A;  5ICF A;  2O3F A;  1OMI A;  3BR2 A;  2M9H A;  3REO A;  2R7R A;  3ABK H;  1U5T B;  5J1R A;  2QCO A;  4A6E A;  4XLE A;  5CVR A;  2NS7 A;  2YS9 A;  2M0M A;  2BW3 B;  2WY7 Q;  1MSF C;  1U6G A;  3WTY C;  2IA1 A;  1V5F A;  2MBF A;  2K86 A;  1LFB A;  1HOM A;  3F8F A;  3L00 A;  2CQQ A;  5AIP A;  4P9F A;  2QBY A;  2LKP A;  2V1D A;  4MTE A;  1X1D A;  2OD5 A;  3NWT A;  2X6Y A;  3P7N A;  2L7Z A;  2XAQ A;  3HPG A;  3W3C A;  3VDX A;  4AIJ A;  2KZV A;  4QPQ A;  1BM9 A;  1I3Q J;  4PZJ A;  3PM1 A;  1XG1 A;  2K85 A;  3CC2 I;  2GA2 A;  2R7Q A;  2L7M P;  3BCB A;  4F7Z A;  3E6B A;  2VOO A;  5IT9 Z;  1BW5 A;  3LSI A;  3WG7 H;  2F2E A;  4M3G A;  4ESB A;  2J5P A;  3CD6 I;  2CQ7 A;  4E7Z A;  1TW3 A;  3KP2 A;  4HSR A;  4HV6 A;  2NVU B;  3ZOB A;  4MEX F;  1EF4 A;  2HVR A;  5IYC J;  1HW5 A;  2EFP A;  3ABM H;  2UXX A;  2DOA A;  3TW7 A;  2CWE A;  4RGU A;  3DPU A;  3RZO J;  1ERD A;  3I9V 2;  3KYL A;  3OIQ A;  2FQ3 A;  1YG2 A;  5FKL A;  2VC1 A;  1AKH A;  3FKJ A;  2EV6 A;  1IG7 A;  2X6W A;  4A3M J;  2GQQ A;  2IGO A;  1FBS A;  2Z1D A;  4NQW B;  5LHH A;  1JGG A;  1BL0 A;  5IT9 K;  2LY1 A;  1OYW A;  3HGY A;  5FO5 A;  1MD0 A;  4E7K A;  3PUF A;  3G1O A;  3SFZ A;  2TCT A;  3QAH A;  1Y56 A;  5C44 J;  4XN0 A;  4DNC A;  2EFW A;  2LTP A;  2RNJ A;  2QF7 A;  4PFO A;  3PNT A;  4NC8 A;  4XRM A;  4F93 B;  3KCC A;  2JPC A;  4LIV A;  4WX9 A;  1O3T A;  4RAY A;  5J1Y A;  3BJ6 A;  1MJ9 A;  3T8R A;  4QIW N;  5EF6 A;  4HX7 A;  5LFA A;  1AA7 A;  1J7K A;  1OCZ H;  2DMP A;  5EEA A;  4NBQ A;  1XCV A;  2WAF A;  2JA5 J;  3TGN A;  3GTL J;  2EV5 A;  2Y9Y A;  1WVR A;  5M3F J;  3K1P A;  5E20 A;  5HLH A;  4NNJ A;  3GFI A;  5FFX A;  3LOC A;  3S3O A;  3RIR A;  5J47 A;  1X4P A;  3ECO A;  4F92 B;  1MBE A;  5E1W A;  3PNY A;  1J9I A;  5E79 C;  3E0J B;  3QOP A;  5BS6 A;  2IGM A;  4L9V A;  1W7P D;  2NRA C;  1JTY A;  5DD8 A;  1MBH A;  5K7H A;  5HLG A;  2KIU A;  4RB3 C;  2OZU A;  3DEE A;  1FTT A;  4RAG A;  3ZR8 X;  1BIB A;  2XKP A;  2VQG A;  1MIJ A;  1YJ9 I;  1IZ1 A;  3GME A;  1X1B A;  2CU7 A;  3JRA A;  2EA4 A;  2XAG A;  2Y75 A;  1SD5 A;  3I0T A;  3FWE A;  1H88 C;  4BQN A;  3ULQ B;  2NS8 A;  4LG0 A;  2MD5 A;  1WFX A;  1YIT I;  1GVD A;  3LSM A;  3I59 B;  2Y2Z A;  3HTS B;  2R3S A;  5J3L A;  3DLA A;  3ABU A;  3RPU A;  3BQZ A;  4EVI A;  4A0X A;  3AKZ A;  1FTZ A;  4ZTF A;  4KIT B;  2COM A;  2K02 A;  4X1E A;  1F1Z A;  1LE8 B;  4IHS A;  3QYE A;  1KYZ A;  1Z1D A;  2VBW A;  2KKO A;  1KZH A;  3IH2 A;  1FOY A;  4YIR X;  1H9G A;  3LAJ A;  2LY9 A;  1ENH A;  2A5Y B;  2XRL A;  2WTE A;  2FNP A;  2EK5 A;  3H1C A;  4BXX J;  1ZN2 A;  4A3F J;  1SD4 A;  4X0G A;  2VQC A;  3HYI A;  3K2A A;  1S7E A;  2HQR A;  4IEJ A;  2ECC A;  3OYN A;  3OYJ A;  1YOV B;  1P4A A;  3ABT A;  2RVC A;  2VBX A;  2GA1 A;  4X6A J;  3HKZ A;  5D4R A;  3RDI A;  1FT9 A;  5TRD A;  4UB6 C;  3RKY A;  3JRC A;  2VON A;  3HKZ N;  4II3 A;  1E3O C;  3TMO A;  5JVG F;  1RES A;  3RI4 A;  4RLQ A;  2FSW A;  1WGX A;  1OQY A;  2KDO A;  1BC8 C;  5HNH A;  4CCL A;  1X19 A;  2GLO A;  1FSE A;  2HPI A;  2W4S A;  5FLM J;  3DBH B;  3QU3 A;  3WOD F;  3ZQF A;  1ULY A;  4B09 A;  4ESJ A;  2F5D A;  3ZMV A;  4RB1 A;  2ZC2 A;  2IJL A;  4F3Q A;  3GTM J;  2MC4 A;  5GAH J;  2X85 A;  2X9D A;  4HF0 A;  3IV5 A;  2Y31 A;  1TQP A;  3CO7 C;  4M6V A;  3CJQ B;  4DYQ A;  2KFD A;  3GTP J;  3GW2 A;  4MGR A;  2D45 A;  2ZNY A;  4C2T A;  2M30 A;  5FLX K; 
#chains in the Genus database with same CATH homology
 2QEN A;  4A2U A;  2STW A;  4Q48 A;  1UHW A;  4M71 A;  4PDK A;  1P4X A;  2VE8 A;  4IRG A;  2VBZ A;  3CO6 C;  2DPU A;  2RKH A;  1HSJ A;  1D5V A;  4IPA A;  3WTS C;  1IN4 A;  4Q4Z F;  2ESN A;  3GF2 A;  5LLQ A;  4YFX F;  1I6X A;  2Q2E A;  5BPD A;  2ZKZ A;  1RIO H;  4EQQ A;  1KU3 A;  4AD9 A;  4M6Y A;  3J7A O;  3E6C C;  1TLH B;  3KZZ A;  2ZME B;  4RGX A;  2ZFW A;  2X0L A;  2V79 A;  4KMU X;  4WCG A;  3QPH A;  3BOQ A;  3DPL C;  4LG0 B;  1DP7 P;  3GEZ A;  4OIR F;  1LVA A;  5FGM A;  5D6E A;  2GXG A;  2F5C A;  2L4A A;  4G7H F;  1STZ A;  4YFK F;  1TW2 A;  2KIF A;  5KVR A;  4KA4 A;  4LK1 F;  3TOA A;  1KGS A;  4OIP F;  3M8F A;  1F5T A;  2Z9O A;  1TNT A;  2ZJ2 A;  4HDV A;  2QQB A;  3RYP A;  2FXA A;  2RC4 A;  2OU2 A;  3ELK A;  2M5W A;  1R7J A;  3WGG A;  3KLN A;  1IRG A;  1ZLK A;  5ILS A;  3KFW X;  2VN2 A;  3SHF A;  2A6E F;  1T0F A;  3JAM Z;  1BOA A;  4NQW A;  3ERE D;  3IWZ A;  4G6D A;  1Z6T A;  1UHM A;  2P5L C;  1FWZ A;  1XGS A;  1SMT A;  4Q5S F;  2IPQ X;  1FY7 A;  1U3E M;  4KIB A;  1FBQ A;  2BE5 F;  3S2W A;  3K1M A;  1K7A A;  2GAU A;  5HS8 A;  3SZP A;  4KMF A;  1SFU A;  1ZAR A;  1CGP A;  4LLG F;  1AOY A;  1R1T A;  5DCM A;  4IF4 A;  1YYV A;  1KYW A;  1O7F A;  1CF7 B;  2CW0 F;  2P8T A;  2CO5 A;  1F4K A;  4CXF A;  3KEO A;  1J5Y A;  3FMQ A;  3H3U A;  4PCQ A;  4L0Z B;  4M9Z A;  5FFZ A;  2M1B A;  1FPQ A;  1P6R A;  3CDH A;  3TO6 A;  3ZMZ A;  1J75 A;  1R36 A;  3CUQ C;  5TJJ A;  1EH7 A;  3GO5 A;  1O3R A;  4UNO A;  4IVN A;  1GXP A;  4L0Y B;  3P9I A;  5KK1 A;  3DP7 A;  1S8N A;  3ROU A;  4EJO A;  3ZP5 A;  1LDK B;  2HKX A;  3K0L A;  5H20 A;  3C3W A;  1XB4 A;  2HFH A;  3F8C A;  1B59 A;  2PEX A;  4QLC U;  1J59 A;  4I09 A;  3DKW A;  4BH9 A;  5CYV A;  2WWY A;  2EFQ A;  3EUH A;  3K1N A;  2QM3 A;  1ZLJ A;  4HLX A;  4S04 A;  1FP2 A;  3HRS A;  4KT5 C;  3AAF A;  2V6C A;  3EET A;  2DW4 A;  1SFE A;  2HDC A;  1BI1 A;  2NAZ A;  1W4M A;  2M8E A;  1ZGJ A;  4EGY A;  1EV7 A;  1ZGA A;  3MCZ A;  4GXO A;  2HS5 A;  3ZMS A;  4WXH A;  2E7W A;  4AIK A;  3DXJ F;  1HKQ A;  1HW1 A;  1XMA A;  1WRJ A;  2A6H F;  3L9F A;  2W57 A;  4OMZ A;  1BIA A;  2UXN A;  2MLK A;  1P2F A;  4GYG A;  1IF1 A;  4XLP F;  1B6A A;  4A12 A;  5ICC A;  4S05 A;  2BGC A;  5BQT A;  2IRF G;  1WI9 A;  2DBB A;  3QRF F;  3K9T A;  1KU7 A;  3LQR A;  1U8R A;  1W5S A;  1LNW A;  3WTU C;  3WTW C;  2MH2 A;  3WU1 B;  1FZP B;  1JGS A;  1S7O A;  1G3W A;  4WXC A;  3E3V A;  3F6V A;  2LSO A;  1XD7 A;  2XRO A;  4KYW A;  1HKT A;  5D5X B;  5L3E A;  1VTN C;  2XV4 S;  1FBU A;  3COA C;  2PJP A;  2VOD A;  2XRN A;  3GFM A;  4LMY A;  1QO0 D;  1L3L A;  2ETH A;  1HXD A;  5H6Q A;  3ECH A;  4ZH4 F;  2V1U A;  4BHC A;  1P4W A;  3F72 A;  4ENM A;  2RQP A;  5DCF A;  5J8C A;  3ZMU A;  2FML A;  2L02 A;  4BXU A;  1K79 A;  1JXS A;  2XUB A;  1DUX C;  4BHB A;  3ZQ7 A;  3H92 A;  2QQ9 A;  4OMY A;  3EDP A;  2O6G E;  2FMY A;  3F23 A;  3VEP A;  4EJW A;  3GUD A;  2RV8 A;  3D0S A;  3I5U A;  1H0M A;  3D5L A;  3FXQ A;  3TO7 A;  2Z5U A;  5HDK A;  2K4B A;  2XAJ A;  2VE9 A;  2W24 A;  2OAZ A;  2IT0 A;  4R8H A;  2Y48 A;  1TTY A;  1ZG5 A;  3I71 A;  2DK5 A;  4U0Y A;  3W6K B;  2XVC A;  4KFC A;  1FC3 A;  3BWG A;  2EFO A;  2LNB A;  1PUE E;  4HF1 A;  1IXR C;  2Y0M A;  3GFJ A;  3QP6 A;  4XBF A;  2H09 A;  2FF4 A;  1RUN A;  3TKY A;  5JVT A;  1B9N A;  1YS7 A;  2ESH A;  1TQM A;  5LRS A;  1XSX A;  1HQC A;  1U5T A;  4L9T A;  2QZ8 A;  5CJ9 A;  1TBX A;  4KN4 X;  1PP7 U;  2D1H A;  5CLS A;  4LB5 A;  1YW9 A;  1QPM A;  4RS8 A;  5D6F A;  2KIM A;  3V4G A;  2TDX A;  1NHA A;  4EJV A;  3LST A;  1IRF A;  1LQ1 A;  3CTA A;  1G4D A;  2X4H A;  4M74 A;  3E5Q A;  4WK8 F;  3KLO A;  3NEU A;  2Z33 A;  3U1D A;  4AVP A;  2CG4 A;  2RDP A;  3O3K A;  2EB7 A;  2CSO A;  4HQM A;  1UCR A;  2XHK A;  3ZN1 A;  3T8T A;  2G7U A;  1G3S A;  3G3Z A;  3L2C A;  3T5X A;  2O8X A;  5E1Z B;  2DPD A;  3U9G A;  1EH8 A;  2CYY A;  3F6O A;  3ISP A;  1HW2 A;  2W85 A;  2NNY A;  4MQ9 F;  1GXQ A;  2UWM A;  1UB9 A;  4MEY F;  5HS7 A;  5D8K B;  1G3Y A;  2Z99 A;  2K4J A;  4WXD A;  4HYE A;  5K5R A;  2BEO A;  3BZ6 A;  3GXO A;  3I4P A;  2WV0 A;  4UXN A;  2ZBK A;  2F5E A;  1FLI A;  1SD6 A;  1WSU A;  5JI6 A;  4BYY A;  4HX8 A;  1XDS A;  3JTG A;  4N0B A;  2EFN A;  3T1B A;  1QZZ A;  5L3B A;  1BJA A;  2VBY A;  3F8B A;  1FOK A;  1R22 A;  2H6C A;  3P9K A;  1FYL A;  2QVO A;  2JRT A;  2HZT A;  4HLY A;  2YU3 A;  1XSV A;  1SAX A;  4G7O F;  1IXC A;  1BN5 A;  5ILV A;  5FD5 A;  1UFM A;  2R7D A;  1J0R A;  1FSH A;  1W7P B;  3OV8 A;  2QLZ A;  4LFU A;  3GZ5 A;  4OIQ F;  3R0A A;  3KE2 A;  4I98 B;  4U0W A;  1MDM B;  5D5U B;  2XKO A;  2DK8 A;  2DU9 A;  2BYV E;  1R5H A;  5BMZ A;  2FU4 A;  4CO8 A;  5K5Q A;  1MZB A;  3B73 A;  4KNY A;  3DF8 A;  4HV5 A;  1HST A;  4G7Z F;  4LB6 B;  1TNS A;  3HRM A;  3V7C A;  2W25 A;  1R58 A;  5LHG A;  3HOT A;  4EJU A;  3L7W A;  2C6Y A;  1I1S A;  1O7L A;  1O3S A;  1HKS A;  2E1C A;  1KU9 A;  2CFX A;  5D8L B;  4O6J A;  1E17 A;  4P9U A;  2EJR A;  3Q9S A;  4CHU A;  3BPV A;  2P7C B;  4TV7 A;  1S6L A;  2FBK A;  4UVB A;  4M9X A;  1A04 A;  3I53 A;  2ZO4 A;  2P5K A;  2JT1 A;  5ICG A;  1BBY A;  3H3Z A;  4GYI A;  5LEK A;  1MJA A;  5JR3 A;  3J80 Z;  4EJT A;  3M7G A;  1IN6 A;  4MTD A;  5ILU A;  3B02 A;  3BJO A;  3GYH X;  3LA2 A;  5L3F A;  5D5V B;  4EGZ A;  1H9T A;  5F6F A;  3FM5 A;  3Q9V A;  1W7P A;  4CYD A;  2CGP A;  3QP5 A;  2QUF A;  1YW7 A;  3QU6 A;  3F3X A;  1S29 A;  3FXU A;  2PI0 A;  1MKM A;  4NHJ A;  2OBP A;  4M72 A;  2HTJ A;  3FXR A;  2YX4 A;  5DUK A;  1ZYR F;  3IHU A;  3WG9 A;  3JSP A;  1YQA A;  4U0V A;  1OR7 A;  1K78 A;  3PQJ A;  4HZF A;  2K27 A;  1Q1H A;  4ZYD A;  1WQ2 A;  4IJA A;  5CVI A;  1LEA A;  4BQA A;  1IN5 A;  2DAO A;  4QWQ A;  2Q0O A;  2HR3 A;  4PGH A;  5CVJ A;  2XAS A;  3RKX A;  2E1N A;  1YO5 C;  2HYG D;  1DPR A;  5E8G A;  3IWF A;  1LDD A;  3HSE A;  2OQR A;  2P4W A;  4FHT A;  1B9M A;  3ML6 A;  3N97 A;  1QNT A;  3M9A A;  1OKR A;  2FA5 A;  2A07 F;  4Y15 A;  3LFK A;  1YFH A;  1C0W A;  4ETS A;  3HHH A;  1WWX A;  2JPB A;  3IRQ A;  3KP5 A;  3WTV C;  3WTX C;  2DT5 A;  2H6B A;  1E2X A;  2J5O A;  2RN7 A;  3HRU A;  4U7D A;  5JHU A;  4A5M A;  1I27 A;  3RYR A;  2STT A;  3BDD A;  4LK0 F;  1ZRF A;  5FB2 A;  3IC7 A;  3R0J A;  4B8X A;  1D8J A;  2HKO A;  4KDP A;  3KP6 A;  3HOS A;  4XLN F;  3WGH A;  1BI0 A;  4H0E A;  1IUY A;  1XGO A;  2OA4 A;  3SQN A;  4KN7 X;  5DV5 A;  4NB5 A;  1YTY A;  4UV9 A;  4N9I A;  4XSZ F;  2Q8K A;  3GWZ A;  3BJA A;  3L09 A;  2CQK A;  4OIO F;  4A0Y A;  4WF2 A;  3GZ6 A;  3J81 Z;  4P96 A;  2P6T A;  3M1E A;  5ICE A;  3EQL F;  2LDU A;  1QZY A;  1U78 A;  1RNL A;  1KU2 A;  1T98 A;  1G6N A;  1O3Q A;  4UHT A;  1OYI A;  1CF7 A;  4U7B A;  4A0Z A;  2DI3 A;  2DQR A;  2KJB A;  1IN7 A;  3RKW A;  2VC0 A;  5K1Y A;  1T39 A;  2P5V A;  1IW7 F;  3SZT A;  3C7J A;  2MC3 A;  1T6S A;  4O3M A;  1XMK A;  2IP2 A;  4ASN A;  3DQV C;  2PMU A;  3PFI A;  3TQN A;  4R79 A;  2M45 A;  3TOB A;  5LGU A;  1ON1 A;  2GWR A;  5LEJ A;  1JE8 A;  3V8J A;  4CIC A;  4P5O A;  5LHI A;  2NYX A;  2IA2 A;  5F1R A;  4Q47 A;  3JAM K;  4I2O A;  3BP8 A;  2A68 F;  3HIF A;  2VT3 A;  1P92 A;  3TO9 A;  2HYF A;  1I1G A;  2EA2 A;  2UZK A;  3MWM A;  3HSF A;  5JFR A;  5F64 A;  2D1V A;  3TDU C;  2ISZ A;  4ENJ A;  1U2W A;  3VFZ A;  1Z05 A;  4HAM A;  1RZ4 A;  2DLL A;  2GZW A;  3HRT A;  1FP1 D;  3P9C A;  2MA3 A;  2A61 A;  4IRI A;  3ZMT A;  2PFB A;  3HSR A;  5HDG A;  4EV0 A;  2PLY A;  3E6D A;  2JZY A;  2Z3Y A;  4GO1 A;  5L3G A;  1KQ9 A;  3VOD A;  2NNN A;  2FEZ A;  1YS6 A;  1REP C;  4N9H A;  4ESF A;  3CUQ B;  4ENK A;  1R5G A;  3BY6 A;  4HW0 A;  3IL2 A;  2ACJ A;  3CUQ A;  1G3T A;  2BV6 A;  5E1X A;  1FYK A;  1QBJ A;  1ZRD A;  2P7V B;  5FD6 A;  4G8X A;  1LJ9 A;  3J80 K;  3F8N A;  1QQI A;  1S3J A;  4RB0 A;  4DQ2 A;  2PN6 A;  5LGN A;  5DYM A;  4KIC A;  4UVC A;  2YSR A;  3N4M A;  1PDN C;  1T2K A;  3EYY A;  5DD4 A;  3R60 A;  3NRV A;  1ZRC A;  4L9N A;  4G9Y A;  1ZH5 A;  3HTU A;  2MH9 A;  4OOI A;  4IXA A;  1Z9C A;  4I7H A;  4YII A;  4R1H A;  3LA3 A;  1T38 A;  5ED4 A;  3M8E A;  2AXL A;  1UST A;  3T0Y A;  5LRR A;  4YIF A;  1S7A A;  2L01 A;  2PMH A;  4FX0 A;  3R6S A;  1XSD A;  1KQ8 A;  3ZPL A;  2L3D A;  1DDN A;  1XN7 A;  3I64 A;  4JK1 X;  4CDG A;  1OYY A;  1F9N A;  4EM0 B;  2ELH A;  2OQG A;  2IA0 A;  3V7R A;  4RGS A;  2NS0 A;  2B0L A;  3FM3 A;  3OOP A;  1L0O C;  2W84 A;  5D4S A;  4HF2 A;  4A5N A;  1MDM A;  3V8K A;  5BOX A;  5E18 F;  2D2W A;  4KIF A;  4EM2 A;  5IT3 A;  1XCB A;  4ZZD A;  4P55 A;  1GHC A;  1PP8 F;  4CZZ A;  4Z2Y A;  3RJP A;  4A6D A;  4O5V A;  4AIH A;  3WGI A;  2PQ8 A;  4M73 A;  2F5F A;  4BHP A;  1FNN A;  1TQI A;  2L4M A;  1IN8 A;  2XAF A;  2IVM A;  1ON2 A;  2G7H A;  4M6X A;  5DCM B;  2KJC A;  3FF5 A;  5FLX Z;  3PQK A;  3ZMD A;  2FRH A;  1D3Y A;  1V4R A;  2RGV A;  1B4A A;  1V3F A;  4I0B A;  3LA7 A;  5J6X A;  4Y13 A;  4E70 A;  1FYM A;  2H27 A;  5E17 F;  3JW4 A;  4M9S A;  4HDU A;  3HHG A;  4CGZ A;  3DFG A;  4WWC A;  3KP4 A;  3MEX A;  1RI7 A;  1ZHF A;  1SD7 A;  4LLL A;  3DEU A;  1B1B A;  3C1D A;  4AWX B;  3IKV A;  1YIO A;  4UVA A;  4GGG A;  1GVJ A;  1ONV A;  3GVA A;  3TDZ C;  2L54 A;  2FOK A;  5AIQ A;  5J8F A;  3MFK A;  3IKT A;  3GLX A;  3LQQ A;  1FX7 A;  3FMS A;  3MZY A;  4K2E A;  1ZRE A;  1Z7U A;  3WE3 A;  2A69 F;  4OIN F;  3O6B B;  1K6O A;  3KZY A;  1XDU A;  1USS A;  3J81 K;  1U5T C;  2KRF A;  6PAX A;  1ODD A;  1I5Z A;  1WKM A;  4HQE A;  1K78 B;  1OPC A;  2QBY B;  2V9V A;  4ZYG A;  3DV8 A;  2XGX A;  4ZYE A;  1IAW A;  4BNC A;  1ZG3 A;  3O2P E;  2DO7 A;  1Z6R A;  3LAP A;  5A2Q K;  2ZME A;  3KP3 A;  1HBX G;  2QYO A;  2ZXJ A;  1LEB A;  2R7F A;  1RUO A;  2VXZ A;  4EM1 A;  3E5U A;  4IRH A;  3I58 A;  1Y0U A;  2HEO A;  2O0Y A;  3ZN0 A;  4LJZ F;  2HWV A;  1SFX A;  1XGN A;  5DUI A;  3GX4 X;  3CJN A;  5CVV A;  3BPX A;  1J2X A;  3QPT A;  5L3D A;  1SMY F;  1BI2 A;  2PG4 A;  4Y17 A;  5DEQ A;  1X3U A;  3K69 A;  3JTH A;  4U88 A;  5HS9 A;  3MZH A;  2XAH A;  4OU0 A;  3F8M A;  2VOP A;  4YG2 F;  2YR2 A;  2HTS A;  4KUM A;  4KIG A;  2O03 A;  5H6R A;  4I01 A;  4G6Q A;  3I59 A;  1R1V A;  2G9W A;  4HBL A;  3V8L A;  3W6J B;  2HQN A;  2JSC A;  4GCV A;  5BPI A;  3MAJ A;  2EWN A;  1LDJ A;  3JSO A;  5L3C A;  4JQF A;  3Q5F A;  1MJB A;  3VOE A;  2FNA A;  4MNU A;  2BBY A;  4L9J A;  3WU0 A;  1R1U A;  1YW8 A;  2JTV A;  2XIG A;  4PGG A;  1ZAO A;  2QQA A;  3VB2 A;  2LF8 A;  2GXB A;  4HOB A;  2GIV A;  2A3S A;  3FX3 A;  3EYI A;  3SXY A;  3R4K A;  2VT2 A;  1W5T A;  3WTT C;  1LB2 A;  4HX4 A;  1XGM A;  2QWW A;  4LLN A;  3WTZ A;  4BAY A;  4EMS A;  2PBI A;  3KP7 A;  2YPR A;  5D5W B;  3HUG A;  5K5O A;  3KET A;  2MLG A;  4LD5 A;  1DPU A;  4L18 B;  2M87 A;  5E8I A;  2WC2 A;  3DPT A;  1KA8 A;  5LBQ A;  3NQO A;  3I54 A;  5A2Q Z;  2ISY A;  4I02 A;  4MHG A;  2LF7 A;  4ON0 A;  1Z91 A;  2ADU A;  1JHF A;  3V7S A;  1KQ0 A;  5HOO A;  5ERI A;  3WE2 A;  3R61 A;  2DQL A;  5HLI A;  2ZCW A;  2DTR A;  1YLF A;  3E6M A;  4RGR A;  2OZ6 A;  3MQ0 A;  5AON A;  3U2R A;  4ZZL A;  3G73 A;  3GFL A;  3C18 A;  4RB2 C;  4ZYH A;  4JBA A;  5EEG A;  3FZV A;  1D8K A;  4XSX F;  3F21 A;  3FHZ A;  2DFI A;  4XRF A;  1BC7 C;  5HDN A;  1IXS B;  1ZG1 A;  4D0P A;  4FX4 A;  2FBI A;  4I0A A;  4LGW A;  3RPQ A;  1MGT A;  1R00 A;  2AS5 F;  2ZNZ A;  3CUO A;  4G94 A;  1QGP A;  1R23 A;  2K7L A;  4L5J A;  5HVQ C;  2EV0 A;  2FBH A;  3FMR A;  2E7X A;  4YFN F;  4L5I A;  5DDG A;  2YX7 A;  5CVU A;  2P6S A;  2IW5 A;  3E97 A;  4UUV A;  2HOE A;  1EH6 A;  1AWC A;  3BRO A;  4ENN A;  3F22 A;  4RAZ A;  3KEQ A;  5EEH A;  4UV8 A;  3IRR A;  1BI3 A;  3CLO A;  2O61 A;  5LGT A;  3LWF A;  4IHT A;  1JHH A;  4FT8 A;  2HGC A;  4HA8 A;  3RTR A;  4MQV A;  1O57 A;  3E5X A;  3K2Z A;  2H94 A;  2V1X A;  2FE3 A;  5ICF A;  2O3F A;  1OMI A;  3REO A;  1U5T B;  4A6E A;  5CVR A;  1U6G A;  3WTY C;  2IA1 A;  2MBF A;  2K86 A;  3F8F A;  3L00 A;  5AIP A;  4P9F A;  2QBY A;  2LKP A;  2V1D A;  4MTE A;  2OD5 A;  3P7N A;  2XAQ A;  4AIJ A;  1BM9 A;  4PZJ A;  2GA2 A;  4F7Z A;  3E6B A;  2VOO A;  5IT9 Z;  2F2E A;  4ESB A;  2J5P A;  1TW3 A;  3KP2 A;  4HV6 A;  4MEX F;  1HW5 A;  2EFP A;  2UXX A;  2CWE A;  4RGU A;  2FQ3 A;  1YG2 A;  2VC1 A;  2EV6 A;  2GQQ A;  5IT9 K;  1FBS A;  5LHH A;  1OYW A;  5FO5 A;  1MD0 A;  3SFZ A;  3QAH A;  2EFW A;  4DNC A;  2RNJ A;  3KCC A;  2JPC A;  4WX9 A;  1O3T A;  4RAY A;  3BJ6 A;  1MJ9 A;  3T8R A;  4HX7 A;  1J7K A;  1XCV A;  3TGN A;  2EV5 A;  3K1P A;  5E20 A;  5HLH A;  3GFI A;  5FFX A;  3RIR A;  3ECO A;  5E1W A;  1J9I A;  3QOP A;  5BS6 A;  4L9V A;  2NRA C;  1W7P D;  5DD8 A;  4RB3 C;  5HLG A;  2KIU A;  2OZU A;  1BIB A;  2XKP A;  1IZ1 A;  2EA4 A;  2XAG A;  2Y75 A;  1SD5 A;  3I0T A;  3FWE A;  3ULQ B;  4LG0 A;  2MD5 A;  3I59 B;  3HTS B;  2R3S A;  3RPU A;  4EVI A;  3ABU A;  4A0X A;  2COM A;  2K02 A;  1F1Z A;  4IHS A;  1KYZ A;  1Z1D A;  2VBW A;  2KKO A;  3LAJ A;  1H9G A;  2A5Y B;  2WTE A;  2FNP A;  2EK5 A;  1ZN2 A;  1SD4 A;  3HYI A;  2HQR A;  1P4A A;  3ABT A;  2RVC A;  2VBX A;  2GA1 A;  5D4R A;  3RDI A;  1FT9 A;  5TRD A;  3RKY A;  2VON A;  3RI4 A;  2FSW A;  1BC8 C;  1FSE A;  3QU3 A;  3WOD F;  1ULY A;  4B09 A;  4ESJ A;  2F5D A;  3ZMV A;  4RB1 A;  2IJL A;  4HF0 A;  1TQP A;  3CO7 C;  3GW2 A;  4MGR A;  2D45 A;  2ZNY A;  2M30 A;  5FLX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...