3BJ6A

Crystal structure of marr family transcription regulator sp03579
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
SNAMTHETDQLYQAVQATRPLLRNITAAVERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEMAKLALFSEGFSSVELTAYHKVQLALTRFFADLAKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MarR family Transcription Regulator SP03579.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
total genus 51
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bj6A00
4EV0A 2IA1A 1C0WA 2ZKZA 1U8RA 2VBWA 1OR7A 3BDDA 2VBZA 2DK5A 4M6XA 4Q4ZF 2J5PA 3LFKA 1FOKA 4HAMA 1RI7A 5KVRA 3KCCA 3VOEA 3MEXA 3I54A 4ESBA 4EQQA 1HXDA 1LQ1A 2ZMEA 1FNNA 4KMUX 3C3WA 3QU6A 2DAOA 5ICFA 2OZ6A 5LEKA 1KYZA 1XDSA 2UXNA 5A2QZ 4EJOA 3TQNA 1FWZA 1T6SA 3ZMUA 2FBHA 1WWXA 5L3CA 2CFXA 4HF1A 2MH2A 3D0SA 3V7SA 1L3LA 2XASA 4XLPF 1YS6A 5BOXA 2GQQA 3ZMDA 1ZN2A 4HX4A 2CO5A 3ECHA 3GUDA 1D8JA 1KU9A 1RUOA 4FT8A 2JT1A 2V6CA 5F6FA 3DV8A 3BPVA 2KIUA 2ZXJA 1FLIA 1HKSA 1T38A 3Q5FA 3R60A 2Q8KA 2HQRA 3RI4A 1ZHFA 1XGSA 2V1DA 3CLOA 5FB2A 2XVCA 2EA4A 1MJBA 2NNYA 1YW8A 1IUYA 2A68F 2O6GE 3TGNA 3IKVA 1W7PB 5LGUA 1KQ0A 3HSRA 5TJJA 1IRGA 3MZHA 4RGRA 1R7JA 4LFUA 1T98A 4RB1A 3SQNA 3LAPA 2IT0A 3ML6A 3MCZA 3DFGA 4KIGA 4G6QA 4HQMA 5AIQA 1SMTA 2RVCA 2XAQA 1LVAA 4CDGA 2VONA 4IRIA 1I5ZA 3QAHA 4HX8A 3K1MA 4HV6A 1EH8A 4KYWA 3G73A 2MC3A 1SMYF 5DCMA 4EJVA 4KA4A 4U7BA 1BC8C 3JSPA 2ESHA 3RKYA 2XKOA 2QUFA 3E97A 3BY6A 2P7CB 1O3SA 3F8MA 4A6DA 3VFZA 5JHUA 2ELHA 4RGUA 2FA5A 3NRVA 4G7HF 3C7JA 5BPIA 3SXYA 5DCFA 3F6OA 1PUEE 5D4RA 4P96A 4P55A 4XSZF 4DNCA 1XSXA 3HRUA 5ICEA 3FXQA 2PJPA 2BE5F 4XRFA 3I71A 3ULQB 2C6YA 1STZA 2QVOA 4G8XA 1ZLJA 2VOPA 5CVIA 5DV5A 3J80K 1FBQA 2BBYA 4I01A 3FXUA 4RGSA 4YG2F 4ESJA 1D3YA 5D8LB 3F3XA 4I7HA 1JHHA 3R4KA 4UUVA 1KA8A 4L0YB 4NQWA 3IWZA 3I0TA 1ZLKA 1GVJA 3V8KA 5CLSA 2VN2A 4BHPA 1UCRA 1CF7B 3WE2A 2OZUA 1W7PD 1ZREA 5HDNA 2DK8A 2BYVE 3TO9A 3WODF 2FNAA 3BPXA 1FPQA 1BI3A 3CUQA 1G3WA 2EJRA 5DUKA 5HDKA 2RGVA 2AXLA 5HLIA 2A6EF 5BMZA 4L9JA 3TOAA 2XAGA 3BWGA 4OIOF 1HW5A 3H3ZA 1USSA 3TKYA 1S6LA 2QQAA 1FSEA 2XHKA 3HRMA 1ON2A 3FF5A 4HF0A 1I27A 1S3JA 2MLGA 4EGZA 5HS7A 4WCGA 2GIVA 2EFNA 4XBFA 4CICA 4UHTA 1K78B 1ZH5A 2UZKA 3H92A 2H09A 3SZTA 2WWYA 1L0OC 4L9TA 5FLXK 3WTXC 3KP2A 4L0ZB 2P6TA 1LNWA 3HUGA 1TW3A 2Y0MA 3VEPA 4KT5C 3PQJA 1DDNA 2IJLA 4R79A 3WTYC 3QPTA 1SFUA 1TQMA 2FRHA 4FX4A 5LEJA 4XSXF 1J59A 3REOA 2QZ8A 5IT3A 3WGIA 1LB2A 4CGZA 1U2WA 2XAJA 3ZP5A 1V3FA 1IXCA 3LWFA 4O6JA 1FYKA 1R1UA 3KP7A 1O3TA 4YFKF 3IRRA 3F21A 1LDDA 1IRFA 2HTJA 2QM3A 1WQ2A 2QBYB 4HOBA 1W5SA 3I64A 2CW0F 3LSTA 4LG0B 1SFXA 4BYYA 1G3TA 3L7WA 3CTAA 2DQRA 1IN6A 3DEUA 2EV0A 4Z2YA 2E7XA 3ZN0A 3QP5A 1O57A 4BHCA 4HF2A 5L3EA 4MTEA 1HSJA 1WRJA 4E70A 2M30A 3MZYA 1B1BA 3HTSB 5J8CA 1TNTA 4R1HA 4P9FA 2VBXA 2DTRA 5CJ9A 3C18A 1MDMA 3EUHA 3WTTC 2K86A 5D6EA 4ENNA 5JI6A 3F72A 3IHUA 1KU2A 2ZNYA 2M8EA 1UHWA 2D1HA 1HKTA 2KRFA 3ISPA 2ESNA 5L3FA 1H9GA 2A61A 1TTYA 3CJNA 4JK1X 2OQGA 2VXZA 4PGHA 3TO7A 2FMLA 2DQLA 3P7NA 1JGSA 2VODA 2P5VA 3CO7C 1MJAA 3K0LA 3EETA 3RYRA 3R0AA 3V8JA 2Y75A 3BOQA 4YIIA 2D2WA 1IXSB 3ABUA 1OPCA 3EYIA 4UV9A 1YQAA 5TRDA 1IN5A 2HR3A 3KP6A 2ADUA 1QQIA 2R3SA 2VE9A 2A3SA 3B02A 3DF8A 3I58A 4M72A 4KN7X 3LQQA 3DPLC 1BC7C 3KZZA 4UVCA 1KQ9A 2JPBA 1OYWA 1W4MA 2BEOA 1UFMA 3IC7A 1QNTA 1S7AA 4ZZDA 4P5OA 1RNLA 3GW2A 2E1NA 1IF1A 3M9AA 1AWCA 4U0VA 5DD8A 1R1TA 2KJCA 2FSWA 3W6KB 4QWQA 3R6SA 5HS8A 5L3DA 1BI1A 5E1XA 2HYFA 1PDNC 1G4DA 1BJAA 3KLNA 1YG2A 3FXRA 2ETHA 1IZ1A 3W6JB 5DD4A 2GAUA 4GO1A 4A0YA 2A69F 1O7LA 1I6XA 5HLHA 3TOBA 1FP2A 3SZPA 3WU1B 3S2WA 2P8TA 4Q48A 5J6XA 4I0BA 1I1SA 2XKPA 1XMAA 3ECOA 1FSHA 2ZCWA 1FZPB 4D0PA 2EK5A 4H0EA 2CYYA 3BROA 1TNSA 4QLCU 2H6CA 1P4WA 4M71A 3RTRA 2OQRA 2PLYA 3LAJA 4HLYA 2VC0A 5L3BA 2YPRA 3HYIA 3KEOA 2HFHA 2RKHA 4MEXF 1HQCA 2JPCA 4LG0A 1J0RA 1HW2A 1YLFA 1USTA 2IW5A 2PFBA 2IRFG 3SFZA 4R8HA 5AIPA 4B8XA 4OMZA 4OU0A 3QP6A 4CHUA 2UXXA 2FQ3A 5FD5A 1OYYA 1B9MA 2O3FA 2KJBA 4IF4A 3IKTA 1XGOA 3GFJA 3I5UA 3F8CA 1XB4A 1P2FA 4MEYF 5ILVA 3TDUC 5D5UB 4ZYGA 4OIRF 2Z5UA 4G9YA 2JRTA 1RUNA 2EFOA 5D5WB 4U0YA 1SD4A 5K1YA 4M74A 1ZYRF 4L9NA 1F5TA 4A6EA 5ED4A 1B4AA 1OYIA 1R5HA 2M87A 1YW7A 3KFWX 5L3GA 4A2UA 4LLGF 2V9VA 4RAZA 2LF8A 2IVMA 4MGRA 1RZ4A 1IN8A 4AIKA 1YO5C 1MGTA 4RGXA 3L00A 3FM3A 2P5LC 1R1VA 1J9IA 1YW9A 3IRQA 2NYXA 6PAXA 3FMRA 1IN4A 5DEQA 4OOIA 1S29A 1SD5A 2V1XA 2YSRA 3V4GA 3GX4X 5HOOA 2D1VA 3QRFF 5BPDA 2PBIA 3COAC 2AS5F 4I02A 4OIQF 2XUBA 2Z99A 4KICA 1UB9A 1KU3A 4LK1F 2HYGD 3JAMK 5E20A 3CUQB 4S04A 2FMYA 4A12A 1U5TA 1MKMA 4A5MA 4KFCA 3F8BA 3LA3A 3GZ6A 5DDGA 1Z91A 1EH7A 2KKOA 3ZN1A 3FZVA 4A0XA 2STTA 1SAXA 1BIAA 1MD0A 2WTEA 3FMQA 4U7DA 3QOPA 4IRHA 4KIBA 5H6QA 2V79A 2HQNA 1RIOH 1IW7F 3EYYA 3GFIA 2PMUA 4BH9A 4OINF 4IJAA 1NHAA 2KIMA 1J2XA 2VT2A 2G7UA 4EM0B 4O3MA 2FNPA 1PP7U 2JZYA 1SD6A 1LEBA 2KIFA 3M1EA 1D8KA 3DXJF 1WSUA 2JSCA 4YIFA 2HKOA 2WV0A 4FHTA 1ODDA 5LLQA 2VT3A 2HEOA 2H6BA 1IN7A 4BXUA 1OKRA 2ISZA 4P9UA 2OD5A 4Y15A 4IHTA 5FLXZ 2A07F 2PI0A 2L3DA 1TLHB 3FHZA 4M6YA 1P4XA 4BNCA 3U9GA 3CUOA 4HW0A 1S7OA 5ERIA 2HKXA 4HDUA 5FFXA 2GA2A 2DPUA 4HX7A 1DUXC 5DUIA 4LGWA 3E6DA 1SD7A 5LRSA 2RQPA 4KIFA 1R5GA 1HBXG 2J5OA 5F64A 1IAWA 1H0MA 2COMA 2EA2A 3HOSA 3IL2A 2K02A 5D8KB 2DO7A 5HS9A 3RJPA 5J8FA 2Q0OA 1KGSA 1BIBA 2CSOA 3WTUC 4KN4X 3LA2A 3E6MA 2OU2A 3F8FA 5LGNA 3CDHA 4KDPA 1TBXA 2P5KA 4EJTA 1W7PA 4BQAA 2DW4A 5E1WA 2DU9A 4ZZLA 1LDKB 3LA7A 2RN7A 1WI9A 2ZNZA 1U78A 2K4JA 4L9VA 2L4MA 5DCMB 3WGHA 2OAZA 1K78A 3IWFA 1FBUA 3L2CA 3KP4A 2BGCA 5FFZA 4CO8A 3E5UA 4F7ZA 5E8IA 1EV7A 4G7ZF 1K6OA 1Y0UA 4IRGA 4LMYA 4IVNA 3GXOA 3RYPA 1PP8F 4GYGA 1ZARA 4AWXB 1XDUA 5FO5A 1IXRC 1FT9A 2F5EA 2O03A 2O0YA 1OMIA 3WTWC 1XSVA 4K2EA 3R61A 2E7WA 3QU3A 2ZMEB 4LD5A 1ZG1A 3T0YA 3BJAA 1UHMA 2IP2A 2PQ8A 2FE3A 1Z7UA 1DPUA 1GHCA 2RNJA 2ZFWA 2P4WA 3WGGA 5EEHA 1WKMA 4M73A 1B6AA 2W25A 1YIOA 3GEZA 5ILSA 2LNBA 1XD7A 4HDVA 4I0AA 3FX3A 2FEZA 2IA2A 5FD6A 4DQ2A 3V8LA 2K4BA 2XGXA 4Y17A 3CUQC 3F23A 1SFEA 2M45A 1KQ8A 3E6CC 5LGTA 3WG9A 3GO5A 3EDPA 2EFQA 5LHGA 4JBAA 1XN7A 1R58A 3B73A 2GZWA 5HDGA 4L18B 2NAZA 3RPUA 4IHSA 2DI3A 5LBQA 3JW4A 1F4KA 4M9XA 5CVUA 1FX7A 1ZRDA 2P6SA 3ZMTA 3T1BA 4JQFA 2FOKA 2GA1A 3I53A 2A5YB 1JE8A 3P9KA 3MFKA 2XAHA 3GF2A 2QYOA 3HHHA 4EM1A 4I98B 1TW2A 2X4HA 5K5RA 1XGNA 4Y13A 3M8EA 1JXSA 5LHIA 3U1DA 3VB2A 2PG4A 4PDKA 4HZFA 4UV8A 3HIFA 2XV4S 2W24A 3E5QA 3ZMSA 4PGGA 3NQOA 3KP5A 5CVRA 2NS0A 2HGCA 2XAFA 1BBYA 4U0WA 3FWEA 4EJUA 5JFRA 2GXGA 2IA0A 3BJOA 5H20A 2X0LA 2LKPA 3M7GA 4L5IA 4OMYA 5BQTA 3U2RA 3TO6A 5IT9Z 3ZMZA 5F1RA 4PZJA 1B9NA 3FMSA 2YR2A 2Z9OA 1O3QA 1Z1DA 3O3KA 3ZQ7A 2YX7A 4ENMA 4WXCA 4WK8F 1E17A 1TQPA 4MQ9F 1QZZA 3RDIA 1ON1A 2RV8A 1A04A 3GVAA 5K5QA 2MH9A 4AIJA 2CQKA 2LSOA 2FU4A 1Z9CA 2P7VB 5HLGA 3E3VA 4G94A 4KNYA 1XGMA 2W57A 4O5VA 2BV6A 2DT5A 5CVVA 2F5FA 4YFNF 1U5TB 2Z3YA 2XIGA 5E1ZB 2MA3A 2HWVA 1VTNC 4KMFA 4LB5A 3RIRA 3HHGA 2HDCA 2UWMA 1U5TC 1BI2A 3RPQA 3KZYA 3V7CA 3ELKA 1ONVA 4M9SA 4LJZF 2CWEA 3KE2A 3K1NA 4AD9A 1D5VA 3K1PA 1REPC 4ASNA 5KK1A 4RB0A 2MD5A 3TDZC 2K27A 3K9TA 1XMKA 2FF4A 2QWWA 2L01A 4Q5SF 2CGPA 2L54A 3K2ZA 1W5TA 5DYMA 4EMSA 1B59A 3VODA 2ZJ2A 4ZYHA 2Y48A 2ISYA 3ROUA 1X3UA 5D5XB 4ETSA 1ZGJA 2HS5A 4EVIA 4N0BA 3RKWA 3O2PE 3I59B 1HKQA 3GWZA 1U3EM 2EFWA 1YYVA 1J7KA 3KP3A 3HRSA 4HA8A 1T39A 1HSTA 3P9CA 3MQ0A 4IPAA 4YFXF 4A0ZA 3T8TA 3L09A 4KUMA 4ENKA 4RB2C 2DLLA 4PCQA 2ACJA 1MJ9A 5E8GA 3V7RA 3GFLA 3H3UA 4LK0F 4M9ZA 4ZH4F 3HTUA 4XLNF 1ZRFA 5K5OA 2IPQX 3OOPA 3J81Z 4MHGA 1S8NA 1HW1A 2QQ9A 5HVQC 2L02A 1ULYA 3MWMA 4BHBA 3QPHA 5IT9K 2W85A 2YU3A 3EQLF 4ZYDA 1QGPA 4LB6B 4ON0A 3K69A 4MQVA 2JTVA 4HBLA 3JSOA 4WXHA 3N4MA 3J7AO 2HZTA 3I4PA 1O7FA 4HLXA 1BN5A 3WU0A 3F6VA 4AIHA 4EJWA 2ZO4A 2K7LA 2D45A 4U88A 1TQIA 3KLOA 3JAMZ 2LF7A 2HOEA 5H6RA 3BJ6A 3F22A 4HQEA 3HSFA 2M5WA 3ZMVA 4RAYA 4RB3C 2G9WA 5D6FA 1JHFA 1G6NA 4WXDA 5CYVA 3WTSC 4LLLA 5JVTA 2E1CA 3E5XA 4A5NA 4CYDA 3HRTA 2LDUA 2V1UA 3MAJA 2HTSA 4BAYA 2FXAA 4Q47A 1V4RA 2YX4A 4RS8A 2O61A 1Z6TA 2RDPA 1FYMA 2DFIA 1E2XA 4GYIA 5ICGA 3DPTA 3ZPLA 2MBFA 4GCVA 1F1ZA 4WX9A 3BZ6A 1ZRCA 2EV5A 3DQVC 2DBBA 1R22A 2EWNA 3M8FA 3GZ5A 2QLZA 2ZBKA 1I1GA 1Q1HA 3JTGA 3LQRA 3HSEA 1P92A 2FBKA 2A6HF 1KYWA 2VE8A 1KU7A 4NB5A 4MTDA 1LDJA 1Z6RA 1YTYA 3O6BB 4N9HA 1YFHA 1AOYA 3OV8A 3AAFA 1ZAOA 3GYHX 2GXBA 1XCBA 4I09A 2MLKA 2RC4A 1J5YA 1BM9A 3E6BA 5E18F 3C1DA 1FY7A 1YS7A 1Z05A 4WWCA 3WE3A 1FC3A 2W84A 2OBPA 4IXAA 3CO6C 4G6DA 2OA4A 4GGGA 2L4AA 3T8RA 2QQBA 5A2QK 1ZGAA 5EEGA 2R7DA 4CXFA 3BP8A 3FM5A 1GXQA 1K7AA 1P4AA 2CG4A 3G3ZA 4UVBA 5D4SA 4MNUA 1BI0A 4AVPA 1FBSA 1XCVA 2QENA 2B0LA 4TV7A 2QBYA 1R23A 3PQKA 4FX0A 4ESFA 4UXNA 2WC2A 1U6GA 4HV5A 2XROA 4B09A 3F8NA 1R00A 4WF2A 4N9IA 1F9NA 2NRAC 3Q9VA 3WTVC 4NHJA 3KETA 2NNNA 2PEXA 4I2OA 1MZBA 1R36A 5LHHA 1T2KA 3DP7A 3R0JA 2EFPA 2FBIA 2TDXA 1G3SA 4OIPF 2GWRA 1LEAA 3J80Z 5BS6A 4EGYA 2XRNA 2EV6A 1ZG5A 3SHFA 4UNOA 1DP7P 3NEUA 3L9FA 4CZZA 3D5LA 1MDMB 1GXPA 1CGPA 3ABTA 1O3RA 5CVJA 4UVAA 1BOAA 2H94A 1QO0D 3KEQA 3T5XA 1CF7A 2PN6A 5JR3A 2O8XA 1QPMA 2H27A 2EB7A 3DKWA 3GLXA 3RKXA 1J75A 2Z33A 4L5JA 4EM2A 1FYLA 1G3YA 1H9TA 5D5VB 4G7OF 2PMHA 4ZYEA 3HOTA 1LJ9A 4LLNA 5ICCA 2DPDA 2VBYA 2M1BA 3N97A 1QBJA 5ILUA 2F5DA 1T0FA 2VC1A 3JTHA 1EH6A 2F2EA 2R7FA 3I59A 5LRRA 3GFMA 3Q9SA 1XSDA 3PFIA 4ENJA 3J81K 1FP1D 3WTZA 5FGMA 3P9IA 4GXOA 4S05A 5E17F 2G7HA 2F5CA 2Q2EA 1P6RA 1ZG3A 4HYEA 5AONA 3ERED 1K79A 2VOOA 1QZYA 1DPRA 2STWA
chains in the Genus database with same CATH superfamily
4EV0A 3SEQA 2Y9ZA 3PSFA 3I3LA 1Y39A 2IA1A 1C0WA 2ZKZA 5F08A 3BG9A 2VLAA 1R4NB 1U8RA 2VBWA 1OR7A 4X0GA 3BDDA 2LBFA 2VBZA 3QQAA 2DK5A 4G6TB 4OWRB 4M6XA 4AU7A 2XAUA 2J5PA 4Q4ZF 2ZSHB 3LFKA 5TISC 1FIPA 4BL0B 1FOKA 4OAYA 4HAMA 1RI7A 5KVRA 3KCCA 3VOEA 3MEXA 3I54A 3OYCA 3KYLA 4ESBA 3LSGA 4EQQA 2G0EA 1HXDA 4UUSB 1LQ1A 2KT0A 2QA4I 4HPQA 2ZMEA 1FNNA 2VL8A 1B72B 4KMUX 1RKTA 4E7ZA 3VDXA 3C3WA 3QU6A 2DAOA 5ICFA 2R5YB 2OZ6A 3CCRI 5LEKA 1KYZA 4F92B 1XDSA 2UXNA 5A2QZ 1N75A 3FXOA 1U9OA 4EJOA 2KDOA 3AFHA 3TQNA 3CCUI 1FWZA 1RR8C 2DOEA 1O4XA 3FXKA 4W97A 1Z21A 5EYRA 2MD0A 1T6SA 1JGGA 1VQNI 4CUGA 3ZMUA 2FBHA 1WWXA 3MVPA 1X4PA 5L3CA 2CFXA 4HF1A 2MH2A 3L2UA 3CMAI 3D0SA 3V7SA 1L3LA 2XASA 4XLPF 1YS6A 4ZTJA 3LSJA 4EEFG 3OYLA 5BOXA 2GQQA 4Y52J 3ZMDA 1DP3A 1ZN2A 4RLFA 4HX4A 2CO5A 3ECHA 3BTIA 3GUDA 1D8JA 5CQGA 1KU9A 1RUOA 3ZQHA 1YJWI 4FT8A 2JT1A 3M4OJ 2NVYJ 4BBRJ 2H1KA 3VPRA 2V6CA 3JRDA 5F6FA 1R5ID 3DV8A 3OIOA 3BPVA 2KIUA 5K7HA 2OC6A 2ZXJA 1FLIA 1HKSA 1T38A 3Q5FA 3R60A 2Q8KA 2HQRA 1FOWA 2JA2A 3CCMI 2UV1A 3RI4A 1WI3A 1ZHFA 1XGSA 2V1DA 3SZGA 3A02A 3CLOA 5FB2A 2XVCA 2EA4A 1X1CA 1MJBA 2WAFA 2NNYA 2X48A 1YW8A 1IUYA 2E34A 2A68F 1NG7A 3MMYB 3S3MA 2O6GE 3TGNA 1WJAA 3IKVA 1MMAA 1W7PB 5LGUA 1KQ0A 3HSRA 2DDAA 2L7KA 5TJJA 1NTCA 2VKDA 1IRGA 3MZHA 4RGRA 2M9HA 5H2FC 1R7JA 4LFUA 1GVDA 1T98A 1U8BA 4RB1A 3SQNA 1FTTA 3OYDA 2HOTA 1V54H 2K85A 2XDVA 2VJ4A 3E0JB 3GMEA 3LAPA 3PJRA 4XM3A 1S7EA 1UELB 2IT0A 3ML6A 1YJ9I 3DKXA 2OTJI 3MCZA 4Y7NJ 3DFGA 4KIGA 2NVUB 1H8AC 3AKZA 2VXDA 4G6QA 1K6YA 4XKCA 1K61A 4HQMA 5AIQA 1W36C 2AO9A 2DODA 1SMTA 2RVCA 5IOYA 1Z67A 2XAQA 1LVAA 4CDGA 2E2IJ 4C30A 1ORKA 3IUOA 3J7YJ 2VONA 2K3PA 2VASA 4X1EA 2IS6A 4IRIA 2Y2ZA 2CQ7A 2ID3A 1I5ZA 3KZIC 3ZOBA 1HDDC 3QAHA 2CW8A 3VYTB 4HX8A 5FKKA 2I5UA 3K1MA 4HV6A 1V55H 2LOOA 1EH8A 1XX5A 2GOMA 1YHQI 4KYWA 2M7AA 2DCEA 4C3JJ 3G73A 2MC3A 1SMYF 5DCMA 4NBQA 4CSWA 4EJVA 3HOVJ 3MKYB 4KA4A 2W1OA 1EA3A 4U7BA 2KHMA 1BC8C 2GIZA 3GLLA 1LUJB 3JSPA 4E7JA 1S72I 2ESHA 4BUPA 3RKYA 2XKOA 2DOFA 2QUFA 2BOLA 3BY6A 3E97A 2P7CB 1O3SA 3ZCOA 2XRLA 1ETYA 3F8MA 2V6EA 2HVSA 2ZJQF 5C4XJ 4A6DA 3AG4H 3VFZA 4IKFA 2E5NA 5JHUA 2ELHA 2LY9A 4RGUA 4E7SA 4Y3OA 1JTXA 2FA5A 3NRVA 4G7HF 3TW6A 3C7JA 5BPIA 3SXYA 4DYQA 1YITI 1I6HJ 2RREA 3BR3A 4II3A 5DCFA 3F6OA 1PUEE 1A6IA 3QYFA 3DLLF 5D4RA 4P96A 4P55A 4XSZF 4DNCA 1XSXA 3HRUA 5ICEA 3EUAA 3FXQA 2PJPA 2R7XA 2BE5F 1TWFJ 2DT7B 4XRFA 2JA6J 5F0FA 3I71A 3ULQB 2EZKA 2C6YA 4BQNA 5IYCJ 2EIKH 1STZA 2QVOA 2R5YA 2V9KA 4G8XA 3LL7A 1ZLJA 2Q1ZB 4H4KC 3HOYJ 3S14J 2CUJA 2VOPA 3IH3A 5CVIA 5DV5A 3J80K 4HSTA 4I76A 1K4TA 2M3AA 3CD6I 1FBQA 2M2EA 2ZJPF 2BBYA 4I01A 3FXUA 4RGSA 1TT0A 1YIJI 3VYSB 4YG2F 2HU9A 5JVGF 3SDGA 3HGGA 3TBIA 4ESJA 1D3YA 2NVQJ 5D8LB 3F3XA 4I7HA 4PSWA 1JHHA 3R4KA 1I3AA 4UUVA 1KA8A 1VQKI 3SFIA 4L0YB 1POGA 4NQWA 3LSMA 3AL0C 3IH2A 1JJ8C 3IWZA 1MBHA 3RQ4A 1X1BA 2MYSA 3I0TA 5EDNA 5EG0B 1ZLKA 1GVJA 1GV2A 2N8GA 2VN2A 1QVTA 5CLSA 3V8KA 2E1MB 5J3LA 4G12A 4BXFA 2JVHA 4BHPA 2GM4A 1UCRA 4NUBA 4ZC3A 3AL0B 1ERDA 1MMNA 2DMPA 4CCJA 1CF7B 3WE2A 3S1NJ 3OIQA 2OZUA 1S9HA 1Y56A 2DFHA 3ZQCA 1MMSA 4XKVA 2CRGA 1W7PD 1ZREA 5HDNA 2DK8A 2BYVE 3TO9A 4JX4A 3RSNA 4QPQA 3K4NA 4C3HJ 3WODF 2FNAA 3BPXA 1FPQA 3OSFA 1MW7A 2Z1DA 4V2GA 1BI3A 3CUQA 3H5RA 3J7AY 1G3WA 2EJRA 3JCUC 4GRIA 4FASD 1MMDA 5DUKA 3CZ6A 5HDKA 5C44J 1T08B 2RGVA 2AXLA 5HLIA 2A6EF 2CJJA 5JLXA 5BMZA 2NOGA 4L9JA 4W1UA 2XF7A 1A36A 3TOAA 2XAGA 2E2HJ 3BWGA 4OIOF 1HW5A 3OMYA 3H3ZA 4IEJA 1USSA 3TKYA 1WHUA 4UUSA 1XC5A 1S6LA 2F48A 1YE9A 5FJ8J 2W48A 3GZNB 3BT9A 2QQAA 3HG9A 4J19A 1FSEA 2XHKA 2ZB9A 1BW5A 2TRTA 4YELA 3HOWJ 1E0EA 2EZIA 1WPKA 2JRMA 3HRMA 3FF5A 1ON2A 4ANJA 2E71A 5GP9A 4HF0A 1I27A 1S3JA 2MLGA 4QTRA 4F52A 4EGZA 5HS7A 4WCGA 2GIVA 2IXSA 2EFNA 4MO7A 2IGMA 2VJ5A 4UB6C 4XBFA 4CICA 2CFOA 4UHTA 1K78B 2RNGA 1ZH5A 2UZKA 3VSKA 3H92A 3A1YA 3PNVA 2W7NA 2H09A 3FKJA 3LSHA 3OR1C 3SZTA 2WWYA 1N77A 3JRIA 4A3EJ 2VB6A 1L0OC 4L9TA 2CV2A 5FLXK 3WTXC 2XF5A 3KP2A 4L0ZB 2WAQN 5J4YA 2P6TA 1LNWA 3HUGA 4DGWB 1TW3A 2JN6A 3K4BA 1S5LC 2Y0MA 3VEPA 1JKOC 4FETA 3Q0VA 2IBDA 2R7QA 3Q0WA 4KT5C 5DM6F 4J00A 3NARA 3PQJA 1DDNA 2QF7A 2IJLA 3QWLA 4R79A 3WTYC 3QPTA 1SFUA 1TQMA 1G2HA 2FRHA 1WJBA 4FX4A 5LEJA 4XSXF 1OFCX 3UNGC 1J59A 4DZJA 3REOA 2DT6A 2QZ8A 5IT3A 3SJMA 3WGIA 3L2WA 1LB2A 4CGZA 3PNTA 1U2WA 4KISA 3H9JA 2XAJA 1B72A 3ZP5A 2X6OA 1V3FA 2KFDA 2WAEA 1IXCA 3LWFA 1VFCA 4O6JA 3L2VA 1IV6A 4XRMA 2B9SA 1FYKA 1R1UA 3KP7A 1O3TA 5EZGA 4YFKF 3IRRA 3F21A 1LDDA 4NC6A 1IRFA 2HTJA 2QM3A 4DBRA 1WQ2A 2QBYB 2LBFB 1BOBA 1W5SA 4HOBA 4XLEA 2OPTA 3LMMA 3I64A 2CW0F 3LSTA 5E79C 4LG0B 1ZGWA 1KONA 1SFXA 4BYYA 2X51A 1G3TA 1V5FA 2ZMEC 4BGDA 3D1NI 2WV1A 3L7WA 2FD5A 3CTAA 1GV5A 2HYJA 2DQRA 1IN6A 3DEUA 2EV0A 3W6VA 4Z2YA 3H5NA 2KISA 5J1UA 2E7XA 4EATA 3ZN0A 3QP5A 1O57A 4BHCA 3CESA 4HF2A 5L3EA 4MTEA 1HSJA 3PM1A 3OYBA 4D9JA 1WRJA 4E70A 2M30A 3MZYA 1B1BA 3HTSB 5J8CA 2XGDA 3K4KA 1TNTA 1D0XA 4R1HA 1MSFC 5EGOB 2QQ8A 3IAS2 1UAAA 4P9FA 1X58A 2VBXA 2DTRA 5CJ9A 3C18A 1MDMA 3EUHA 3WTTC 2K86A 5D6EA 4ENNA 5JI6A 3F72A 4XKWA 3IHUA 1KU2A 2ZNYA 3KIOA 2M8EA 5F27A 3RKQA 4XICA 1UHWA 2D1HA 4FCYA 1HKTA 4CYCA 2R7SA 2KRFA 3ISPA 2ESNA 3ABKH 5L3FA 1H9GA 2A61A 3AG1H 3ABLH 4S0HB 1TTYA 4CZCA 3CJNA 4JK1X 1VQ5I 2OQGA 2VXZA 3DTEA 4PGHA 3TO7A 1MMGA 2FMLA 1IV8A 2DQLA 2EZLA 3IH4A 3P7NA 3BG6A 3CDIA 4IQ4A 2Z2SB 3PFYA 5E3OA 3BG5A 2K9LA 4BKXA 1JGSA 2VODA 1JUPA 2P5VA 3CO7C 1MJAA 3K0LA 3EETA 3RYRA 2L7MP 3R0AA 3V8JA 2Y75A 5J47A 1Y8QB 3BOQA 1B8IA 3W2AA 4YIIA 1SC7A 5GPAA 2PX9A 2D2WA 4C2TA 1IXSB 2K40A 3HJEA 3ABUA 1OPCA 2HZDA 3EYIA 4UV9A 3H35A 1YQAA 2DJNA 4KJZA 5TRDA 1T8IA 1IN5A 2HR3A 3W2VA 1LE8A 3KP6A 2ADUA 2HNHA 1QQIA 2R3SA 2VE9A 2A3SA 3B02A 3PIPF 3DF8A 3I58A 4V2FA 3OYIA 4M72A 3S16J 2JUGA 4KN7X 1BJZA 3LQQA 4B1RA 3DPLC 4JOMA 1JUMA 3RCOA 2ZXIA 1BC7C 2IEKA 3KZZA 4UVCA 4BDYA 1KQ9A 1ETWA 1R6RA 2JPBA 2X1CA 1OYWA 1W4MA 2BEOA 1UFMA 3OR2C 3IC7A 1QNTA 3A01A 2ME0A 2F6CA 1BR1A 1VNDA 1S7AA 4NNJA 4XR6A 1DGWY 3BCBA 2WADA 4ZZDA 5DS9A 4P5OA 1RNLA 3GW2A 5HNHA 2E1NA 2FJ1A 2JMWA 1SVLA 2LREA 1IF1A 3M9AA 3EUHC 4BY7J 1K4SA 1AWCA 4U0VA 2JA5J 5DD8A 1R1TA 4XOTA 2KJCA 1D1CA 2FSWA 3W6KB 4QWQA 3R6SA 2ELJA 5HS8A 1RESA 5L3DA 1BI1A 5E1XA 3X2QH 1DQUA 3H1CA 2HYFA 3G6EI 1PDNC 1G4DA 1X1AA 2W4SA 1BJAA 3KLNA 4AYBN 4AVZA 2CQQA 1R49A 1YG2A 2Y9YA 5GTHC 2FX0A 2R7TA 3SEZA 3FXRA 2ETHA 1IZ1A 3W6JB 5DD4A 5M3FJ 1VQ7I 2NOJB 1MH3A 2GAUA 4GO1A 3K4MA 3RQIA 1QU3A 4UUTA 1OISA 3BTLA 4A0YA 2OF7A 3V42A 4RLQA 2A69F 2O9LA 2R93J 1O7LA 1I6XA 4CYCB 5E3NA 5HLHA 3TOBA 1FP2A 5IYBJ 3SZPA 2KPMA 2LMDA 2H8WA 4LIVA 3WU1B 3S3OA 3PUFA 3U1KA 3M07A 3S2WA 2VPLA 1T95A 2ECBA 2P8TA 4UY8I 2EQRA 4Q48A 5J6XA 4I0BA 1I1SA 2XKPA 1OCRH 3BR2A 3OYMA 3UKGA 1XMAA 1Y1VJ 3ECOA 1FSHA 2ZCWA 1FJLA 1FZPB 4D0PA 2ID6A 1A6QA 4QPOA 1JKPC 2EK5A 1OCPA 4H0EA 2CYYA 1E3HA 3BROA 1TNSA 5GAHJ 2X1DA 3OYAA 4QLCU 1ZR4A 2H6CA 1P4WA 4M71A 3RTRA 1MH4A 2OQRA 3CCVI 2MABA 2PLYA 3JRAA 3HEFA 2PMZN 5J1RA 1JKRC 2K9SA 3LAJA 2XPUA 3BC8A 4HLYA 2VC0A 5L3BA 2BHZA 2YPRA 2BY3A 2F4OB 2TCTA 3HYIA 3KEOA 2HFHA 2RKHA 4MEXF 1HQCA 2JPCA 4LG0A 1J0RA 3GTQJ 1HW2A 1H89C 1YLFA 1HC8A 1HF0A 2DXIA 3CC4I 1USTA 2IW5A 2PFBA 2IRFG 1V5GA 3SFZA 2VQCA 4R8HA 5AIPA 4B8XA 4OMZA 1SAUA 4OU0A 1FMVA 3QP6A 4CHUA 2UXXA 2D5VA 1LFPA 2FQ3A 5FD5A 1QA6A 4A93J 4J01A 1OYYA 4D5CA 3OYHA 3O8GA 3H0DA 3CMYA 1B9MA 2O3FA 1Z7LA 2KJBA 1Z0XA 4IF4A 4A3BJ 3IKTA 1XGOA 3GFJA 3I5UA 3F8CA 1XB4A 1P2FA 4MEYF 5ILVA 3TDUC 5D5UB 4XORA 4ZYGA 4OIRF 2Z5UA 4G9YA 2JRTA 1RUNA 2EFOA 5D5WB 4U0YA 4CCMA 1SD4A 1W1WE 3C2HA 4P1WA 3K10A 4M74A 5K1YA 1ZYRF 2DA6A 1IDZA 3K4JA 4L9NA 1F5TA 4A6EA 5ED4A 3GTGJ 3KYCB 1B4AA 3CC7I 1OYIA 1R5HA 3LFUA 2M87A 2CUFA 1YW7A 4QIWN 5EZHA 1P7JA 2F4IA 3KFWX 5L3GA 2VIXA 2VJIA 3JREA 2ICWG 4A2UA 1WJFA 1R71A 2QSGX 4LLGF 4CCKA 5LFAA 3ZQQA 1MNEA 4MIMA 2V9VA 4RAZA 2ZJRF 2LF8A 3G4SI 2IVMA 4MGRA 3CQZJ 1JJ6C 1RZ4A 1IN8A 4AIKA 1JKQC 4D5FA 1YO5C 5FLVA 1MGTA 4RGXA 3L00A 3AG2H 3BCAA 3FM3A 2LYCA 4FTHA 2P5LC 1HDPA 1R1VA 2MGQA 2KRHA 1YW9A 3IRQA 1J9IA 2NYXA 4HRIA 3RPUD 2P0WA 6PAXA 1Y6IA 3FMRA 4A3GJ 1IN4A 2EILH 3K2AA 3H36A 3DU5A 4Z6YA 5DEQA 3CCEI 3RZOJ 3S15J 2MFZA 4NDLA 4OOIA 1GT0C 3FISA 1S29A 1VQ4I 3CJTB 1SVMA 2EIJH 1AHDP 1SD5A 2VKEA 1M1EB 2V1XA 2YSRA 3V4GA 3GX4X 3B6AA 1EJ9A 5HOOA 2D1VA 2LH9A 2WB1A 3TP0A 1MNDA 4FQGA 2L7ZA 3QRFF 5BPDA 3NAUA 1OCOH 2PBIA 1E3OC 4XMYA 3COAC 2AS5F 4I02A 1YRNA 4OIQF 2XUBA 2K5CA 2Z99A 4KICA 1UB9A 3HOXJ 3PIOF 1KU3A 1UG2A 4A3MJ 3QOEA 4LK1F 2DMTA 1IRZA 2HYGD 2MSYA 1SFKA 3JAMK 2NVXJ 4BACA 5E20A 3A01B 2X6WA 3DBHB 3CUQB 2VQLA 5HLTA 5BNGA 4S04A 2FMYA 4A12A 5B66C 1U5TA 1MKMA 4A5MA 4U87A 2QSHX 1F43A 1TC3C 3MN2A 4KFCA 1XG1A 3F8BA 1AU7A 4PK4A 3LA3A 4PJMA 3GZ6A 5DDGA 1Z91A 1EH7A 5CQEA 1SFOJ 2KKOA 4GDFA 3ZN1A 3FZVA 3HDDA 4A0XA 2STTA 1IDYA 1SAXA 1BIAA 1MD0A 2WTEA 2X1EA 3FMQA 1XTAA 4U7DA 4LOCA 3QOPA 4IRHA 4A3JJ 4KIBA 3DEWA 1NK2P 5H6QA 3VYRB 2LVSA 2FOWA 2XB0X 3IP4B 2V79A 2OTLI 2HQNA 3BQYA 1RIOH 1IW7F 3EYYA 5J1YA 1HA8A 4PJLA 4AYBA 1ETVA 3KEYA 3GFIA 1TT5B 2E60A 2XB5A 2PMUA 4BH9A 4OINF 2NXNB 4ZYAA 1OCTC 4IJAA 2XF6A 4B3XA 1NHAA 2KIMA 1J2XA 2VT2A 2G7UA 2HXOA 4EM0B 3W3CA 4XLAA 1PJRA 2Y69H 4NC8A 4O3MA 2FNPA 1PP7U 3EPZA 3A0HC 3L1PA 2JZYA 2ZSIB 1SD6A 2BW3A 1LEBA 2KIFA 2ME6A 1MBKA 1D8KA 3M1EA 5HODA 3I9V2 2KRCA 4IHYA 4GFBA 2VKVA 3DXJF 1WSUA 2JSCA 4E6KG 2HKOA 4YIFA 2WV0A 4FHTA 1ODDA 5LLQA 1IJWC 2KZGA 2VJJA 3GTPJ 2VT3A 2HEOA 1OCCH 2CV0A 2H8RA 1Q1VA 2H6BA 1IN7A 4BXUA 1OKRA 2AHQA 2ISZA 2V4JC 3DTIA 4P9UA 4X6AJ 3EUKL 1BW6A 3QYBA 5F1JA 1RC9A 4A3DJ 2OD5A 4Y15A 2A07F 5FLXZ 2PI0A 4IHTA 3HL2A 2L3DA 1TLHB 3FHZA 1A35A 4M6YA 4ZDOA 1P4XA 1VI0A 4BNCA 3CUOA 3U9GA 3DEEA 4HW0A 3QPLA 2DTZA 1S7OA 2X85A 5ERIA 1ENHA 2HKXA 4NQWB 4BE1A 2MC4A 4HDUA 4BE0A 5M5XJ 3S17J 5FFXA 3HM5A 1WJ5A 2GA2A 1G8XA 1IGNA 2DPUA 2DMNA 4HX7A 5C4JJ 1DUXC 3CCLI 5DUIA 4LGWA 3E6DA 2L9RA 1VZ0A 2DMUA 1ETXA 4DJAA 2IGOA 1SD7A 1YOVB 2M0MA 5LRSA 5DTDA 2RQPA 4IHWA 1JI8A 4KIFA 1ACIA 3PSIA 4RM2A 1R5GA 1ZK8A 4BQOA 3CMMA 5DM7F 1HBXG 3HXLA 3MD2A 2R0QC 2J5OA 5F64A 3A0BC 2E2JJ 2DA5A 2CU7A 1IAWA 1H0MA 2COMA 2R92J 3NWTA 2EA2A 3HOSA 3IL2A 2IS4A 2HOAA 2K02A 5D8KB 2DO7A 5HS9A 3ASNH 5FLMJ 2XGEA 3RJPA 5J8FA 2Q0OA 4UB8C 1FIAA 1KGSA 1BIBA 2CSOA 3BG7A 3WTUC 1MNMC 4KN4X 3C2GA 3LA2A 3E6MA 1NK3P 2OU2A 3F8FA 5LGNA 1HCRA 3CDHA 4KDPA 3UR3C 1IC8A 1TBXA 2P5KA 2JWTA 4EJTA 2RAEA 1LVKA 1W7PA 3DBRB 4BQAA 2DW4A 5E1WA 3FKIJ 2DU9A 1W0TA 3ZQFA 3ZQIA 4ZZLA 1LDKB 3WU2C 2R7UA 4RMNA 5GAEJ 2LG4A 2JA8J 3TEDA 3OOUA 4ZDLA 2EIMH 3LA7A 2RN7A 1WI9A 2ZNZA 4RA2A 1U78A 4FE4A 1MBJA 4A3LJ 2K4JA 3H0GJ 4NC7A 2BHYA 3OS2A 4L9VA 2B63J 3PUBA 2L4MA 5DCMB 3WGHA 3M1CA 3L2RA 2GLOA 2OAZA 1K78A 3IWFA 2MW8A 3E7LA 1FBUA 3IV5A 1YI2I 3CMEI 2FQ4A 3L2CA 3KP4A 2BGCA 5FFZA 3W2WA 4CO8A 2ZXHA 2ZFUA 2QKMB 3E5UA 4F7ZA 2AXTC 5IP9J 5E8IA 4B3AA 2KL4A 4A3CJ 1EV7A 1K83J 4G7ZF 1K6OA 1X2NA 2BVMA 1N25A 1Y0UA 4IRGA 1J09A 4LMYA 3HOUJ 4N4OB 4IVNA 2LR8A 3GXOA 3RYPA 1PP8F 4GYGA 1ZARA 1FEXA 5EJCA 1Y0NA 1XDUA 4AWXB 5JHFA 5FO5A 3DCFA 4D7MA 2IS1A 1T56A 2EBIA 3G1LA 1IXRC 1GLNA 1FT9A 2F5EA 2L9SA 4FE7A 2O03A 3MKLA 3GTKJ 3OYNA 2O0YA 3OYEA 1OMIA 2HOSA 5IY5H 5E3MA 3WTWC 1XSVA 1YJNI 4K2EA 3R61A 2E7WA 3BLYA 3QU3A 1OCZH 1Z3YA 4BU2A 2ZMEB 4LD5A 1ZG1A 3DU6A 3T0YA 3BJAA 1UHMA 2IP2A 2PQ8A 1FOYA 3S1MJ 2FE3A 1NH3A 1Z7UA 2KMUA 1DPUA 1GHCA 3BG3A 2I8DA 2HQ5A 2RNJA 3OYGA 1MIJA 2IAIA 2K3FA 2ZFWA 2P4WA 3WGGA 1KZHA 5EEHA 1ZELA 5K7FA 3ASOH 1WKMA 2HDWA 3S93A 3HC7A 4M73A 1B6AA 4AIDA 2W25A 1YIOA 4C2UA 3E1SA 2GOXB 3BTCA 3GEZA 2E35A 5ILSA 2LNBA 1XD7A 3G1MA 1V5EA 2HI3A 3CF5F 4HDVA 1QRYA 4XN0A 1YX5A 4I0AA 2NS7A 2W82A 3FX3A 4XN3A 2FEZA 1AA7A 3BR1A 4CCNA 3MKZA 2LKXA 2XPVA 1T33A 1NG6A 2IA2A 2K9NA 4DQ2A 5FD6A 3V8LA 5IOZA 2K4BA 2XGXA 4Y17A 3CUQC 4HNVA 3F23A 1AKHB 3CC2I 1SFEA 2M45A 1KQ8A 3I55I 5B5EC 2KZVA 3E6CC 3OY9A 5LGTA 3WG9A 5B3SH 3GO5A 3CCJI 3EDPA 2E5ZA 1XS9A 2EFQA 5LHGA 2Y0SA 2DA3A 4JBAA 1XN7A 3B73A 1R58A 2GZWA 5GAGJ 5HDGA 2ZC2A 3HZJA 4L18B 4XK4A 2ELKA 5F0CA 2DDBA 2NAZA 3RPUA 2DFEA 4HNTA 4IHSA 2DI3A 1D0YA 5LBQA 4BE2A 3JW4A 1F4KA 1Y8RB 1X3ZB 4M9XA 2A05A 3O8HA 5CVUA 1IO2A 2M8GX 1X1PA 2L9VA 1FX7A 3KYDB 4CCOA 4A69C 2P6SA 1ZRDA 4XNFA 3ZMTA 3T1BA 4JQFA 2FOKA 2GA1A 2QEXI 3I53A 4AUXA 2A5YB 2CUEA 3OS0A 3JRHA 4N4NB 1JE8A 4IHVA 1VQ9I 3P9KA 3Q0UA 3PL8A 4BS9A 3ONQA 3MFKA 3I4MJ 2L0KA 4DYCA 2LFBA 2XAHA 1WVRA 2QYOA 3GF2A 2E19A 4A3FJ 1ZR2A 3HHHA 3ZXSA 4EM1A 3CP8A 3QODA 4I98B 1TW2A 1I3QJ 2IS2A 2ZXWH 3U21A 1T0FC 2X4HA 5K5RA 1XGNA 2YS9A 3S8PA 2KDZA 4Y13A 2R4GA 1W5CC 3K4CA 3M8EA 1F36A 1JXSA 4PJJA 1UJ8A 3G1OA 3A4CA 5LHIA 3U1DA 3A03A 3VB2A 3K4LA 2PG4A 4PDKA 4RM3A 1OJLA 4HZFA 1WJDA 1TWHJ 4YEJA 2OCCH 2Q2EB 2WY7Q 4UV8A 4M3EA 3HIFA 3C2BA 1WFXA 2XV4S 2K9MA 1FMWA 2W24A 1WCMJ 1LPQA 3CCYA 3E5QA 3ZMSA 1DU6A 4PGGA 4M6VA 3NQOA 4L5EA 3KP5A 5CVRA 1XPXA 4BJ5C 2NS0A 2HGCA 3S3NA 2VUMJ 4E7KA 2XAFA 1BBYA 4U0WA 3FWEA 4EJUA 3D5RC 4B47A 2KQRA 5JFRA 3K7AJ 2X9DA 2GXGA 5EEAA 1BR4A 3RZDJ 2IA0A 2L5QA 3BJOA 1VQ6I 5H20A 2X0LA 2V26A 2LKPA 2YU9J 3M7GA 4IOAF 4L5IA 4OMYA 5BQTA 1D5YA 3U2RA 2VKHA 3TO6A 5IT9Z 3ZMZA 5F1RA 4PZJA 3DWLE 1B9NA 3FMSA 4YRVA 2L7FP 1EF4A 2YR2A 2Z9OA 1UHSA 2VQHA 4RAGA 1O3QA 1Z1DA 3O3KA 1OR7C 2Y30A 2JK3A 1ITYA 3ZQ7A 1Z3XA 2AQFA 1TWCJ 1PYVA 3F0CA 2DYRH 2YX7A 2V1NA 3MKWB 3FXJA 4WXCA 4ENMA 4WK8F 1E17A 1TQPA 4MQ9F 4F3QA 1QZZA 4IZZA 3RDIA 1TWAJ 1ON1A 4ZDPA 2RV8A 1A04A 2V9PA 3GVAA 3PNYA 5K5QA 2R5ZA 4XRSA 2MH9A 3IAM2 4AIJA 4OAZA 2CQKA 2LSOA 2BY1A 3DBLB 2FU4A 1Z9CA 4PFPA 2P7VB 2LY1A 3AG3H 1IUFA 5HLGA 3E3VA 3P5JA 2A5WA 4G94A 4KNYA 3GTOJ 1DU0A 1XGMA 2W57A 4O5VA 2QCOA 2BV6A 2DT5A 1VQLI 5CVVA 2F5FA 4YFNF 1U5TB 2Z3YA 4DIQA 1RR7A 2XIGA 5E1ZB 1LFBA 1WJCA 2MA3A 2HWVA 4B4CA 1VTNC 2F5VA 3GTLJ 3QYEA 2DMQA 4KMFA 3G2BA 2M4GA 2X6XA 4LB5A 3RIRA 1SEUA 3LOCA 2CV1A 1GDTA 1YRNB 3HHGA 1PVEA 2HDCA 3M3YJ 3HB9A 4PUSA 2CMPA 1DGRM 2UWMA 1U5TC 3LSRA 1BI2A 3RPQA 5E3LA 3KZYA 3V7CA 3ELKA 2KP6A 1G59A 1ONVA 4M9SA 3KPHA 2CWEA 4LJZF 4DZPA 3KE2A 5J40A 3K1NA 4MFDA 5B1AH 4AD9A 5IPAA 3DLAA 1D5VA 3K1PA 2B7EA 2HVRA 1REPC 4ASNA 5KK1A 4RB0A 1ETOA 4A3KJ 1JUSA 3HBLA 2MD5A 5B1BH 1W36D 3TDZC 3OL3A 3S2HJ 3SDBA 1U0JA 2K27A 2V7FA 3K9TA 1XMKA 2FF4A 1ZKGA 2QWWA 3OL4A 3OS1A 2L01A 2WY8Q 4Q5SF 2GXAA 3H9GA 2L54A 3K2ZA 2CGPA 1W5TA 5DYMA 4EMSA 4BBSJ 3B6CA 2Y0SN 1B59A 4A3IJ 3S32A 3VODA 4E4HA 4RDUA 2ZJ2A 3QPSA 4MFEA 4ZYHA 1A5JA 2Y48A 2YUSA 2ISYA 3FXMA 1IRXA 3FK7A 3ROUA 1X3UA 5D5XB 1E3PA 4ETSA 1ZGJA 2DYSH 2HDDA 2HS5A 4EVIA 4N0BA 3RKWA 2A6TA 3ABMH 4JX5A 2Y31A 3O2PE 3A2KA 3I59B 5J4VA 2Z16A 1HKQA 3GWZA 1U3EM 2EFWA 1YYVA 4YIRX 1J7KA 2CQXA 2FUG2 4CCLA 2P81A 1SANA 3KP3A 2BW3B 3HRSA 4HA8A 4BEHB 1HSTA 3P9CA 3MQ0A 1T39A 4IPAA 1P7IA 3I4NJ 1VF9A 4YFXF 4A0ZA 3T8TA 3JRCA 2LK2A 3FIWA 5C3EJ 1D1AA 2O8KA 3L09A 4KUMA 4ENKA 4RB2C 2DLLA 4IQJA 4PCQA 3BZCA 1MJ9A 2ACJA 5E8GA 3V7RA 1CQTA 2UUZA 5JLWA 5KCMA 3GFLA 2DA4A 3N05A 3H3UA 4IL6C 1H88C 1FTZA 3HPGA 2EPFA 4LK0F 4M9ZA 3TP3A 1WH5A 3HTUA 4CH7A 4ZH4F 2M7BA 4XLNF 1ZRFA 3BQZA 2WAQA 5K5OA 2BZTA 5CPRB 3GCMA 4D7NA 4XL9A 2IPQX 3WHCA 1QPIA 3OOPA 3J81Z 4MHGA 1S8NA 1HW1A 3LSKA 4XIDA 2QQ9A 5HVQC 2L02A 1ETQA 4BXXJ 1ULYA 2E36A 3MWMA 3MZ8A 1X19A 2EZHA 3QPHA 4BHBA 1N78A 1TZLA 4XONA 3NWSA 5IT9K 2X6YA 3GTMJ 2W85A 2YU3A 3EQLF 2HPMA 4ZYDA 4DBQA 1U9NA 1QGPA 4HG2A 4LB6B 4ON0A 3K69A 5GPCA 4MQVA 3ERMA 4M3DA 2JTVA 4HBLA 3JSOA 4WXHA 4JP0A 1LFUP 3N4MA 2XSDC 2HQAA 2PJRA 2RQQA 3J7AO 2HZTA 3I4PA 4C2MJ 1O7FA 2KLOA 4HLXA 3CF2A 4XRSG 1BN5A 3WU0A 3WG7H 2AQEA 4IO9F 3F6VA 2L9NA 1PUFB 4AIHA 4EJWA 2ZO4A 2K7LA 2D45A 1R9TJ 2MG4A 3I56I 3L2QA 4U88A 4AC0A 1TQIA 3KLOA 3JAMZ 4M3BA 2LF7A 2HOEA 2M4KA 4PSXA 5H6RA 2JJ7A 2OCEA 4F55A 2CH0A 3BR5A 3ZQGA 3BJ6A 3F22A 4HQEA 5F04A 3HSFA 2W00A 2M5WA 3ZMVA 4BY1J 4RAYA 4XLFA 4RB3C 2G9WA 5D6FA 1JHFA 3OYFA 3Q3SA 1G6NA 4II2A 4WXDA 3FXLA 4IHXA 4CA0A 5CYVA 3WTSC 1W0UA 1BR2A 4KT6A 1OQYA 4LLLA 5JVTA 2I10A 2ECCA 2E1CA 3S2DJ 3PO2J 2DN0A 3E5XA 4BDZA 3DTKA 3VSLA 4A5NA 4CYDA 5IP7J 3HRTA 2O7OA 2LDUA 2V1UA 4BEHA 3MAJA 4F91B 1VQPI 2DJIA 3BTJA 1PUFA 2BVLA 5K7ZA 3HKZA 2HTSA 3KX2A 4BAYA 2FXAA 1JT0A 4Q47A 3K6GA 1V4RA 1X3WB 9ANTA 2YX4A 4BQQA 2M0CA 3FBNB 3BR6A 4RS8A 5FRNA 2O61A 4DW6A 3G71I 1Z6TA 2RDPA 1FYMA 2EINH 2JVGA 2DFIA 1E2XA 4V19K 4GYIA 5ICGA 4ITVA 5LD2C 3DPTA 3ZPLA 2MBFA 4GCVA 1F1ZA 4WX9A 3BZ6A 3WHBA 1ZRCA 2EV5A 4XOPA 3JR9A 3DQVC 4I99C 2DBBA 1R22A 2EWNA 1P9QC 5CKTA 5F0HA 3M8FA 1Z77A 3GZ5A 2XC7A 2OJED 1UZCA 5FKMA 2QLZA 2LD5A 2ZBKA 3TW7A 1I1GA 2E1OA 3OSGA 2LY2A 1Q1HA 2QSFX 3D5SC 3JTGA 3LQRA 3HSEA 1P92A 2FBKA 2A6HF 1KYWA 1LKXA 2R7WA 1MSEC 4PJNA 2VE8A 1WH7A 1KU7A 4NB5A 2JQ7A 4MTDA 1LDJA 1Z6RA 2O5RA 4RBOA 2DA2A 3BZKA 3O6BB 5KAFC 2LP0A 4N9HA 4ZJZA 1YTYA 1VQ8I 4B43A 1YFHA 1HLVA 1AOYA 3OV8A 3AAFA 2H1LA 2COBA 2R7RA 1ZAOA 3F9KA 3GYHX 3TMOA 2BXZA 3TL4X 2GXBA 1XCBA 3VWBA 4I09A 2MLKA 1APLC 2RC4A 2QKLB 1J5YA 2OV7A 1BM9A 3E6BA 4DYRA 1WJEA 3FDYA 2CQNA 5E18F 3FHNA 1EKEA 3C1DA 4IX7A 1FY7A 1YS7A 3JRGA 4BJ6C 1JTYA 1QHGA 2BY0A 1Z05A 2M34A 4JYKA 4WWCA 4Y33A 4XLCA 1R4MB 5FRMA 4MLOA 3WE3A 1MBFA 1BA5A 1FC3A 2W84A 2OBPA 4IXAA 3CO6C 4G6DA 1YX3A 2OA4A 4GGGA 2L4AA 2GBYA 3T8RA 1JT6A 5EGOA 2DA7A 3LNQA 1HOMA 2QQBA 3GTJJ 3HUGB 2DA1A 5TGTA 5EF6A 2HPIA 3ESWB 1RRJA 5A2QK 3CJQB 1ZGAA 5EEGA 4LIUA 2R7DA 4CXFA 3CJRB 3LSIA 4XKBA 2VI6A 3BP8A 5M5YJ 1TP4A 3FM5A 1GXQA 1B8IB 1X4OA 1K7AA 1P4AA 2CG4A 3G3ZA 3S1RJ 4UVBA 5D4SA 2L2OA 3OYJA 4XLHA 2JUCA 3DPUA 4MNUA 1BI0A 1D0ZA 1FBSA 1XCVA 2QENA 4AVPA 1WGXA 2B0LA 2K9QA 4TV7A 2QBYA 1QVUA 1R23A 3PQKA 4FX0A 4ESFA 2HVQA 4UXNA 3K70C 2WC2A 2NS8A 1VQMI 1U6GA 4HV5A 4AM3A 4RAFA 2XROA 1FOXA 3SYTA 5IP6A 4B09A 3F8NA 1R00A 4WF2A 4N9IA 1F9NA 1TWGJ 3Q9VA 4LG3A 3WTVC 2CUZA 2NRAC 3GBGA 2WBMA 5FROA 4NHJA 3KETA 2NNNA 2R7ZJ 4E7IA 2PEXA 5KAIC 4I2OA 1MZBA 1R36A 2LTPA 1D1BA 5LHHA 3DP7A 3R0JA 1T2KA 2EFPA 4F93B 2FBIA 2TDXA 4QSHA 4ZTFA 5FKNA 2HXIA 2CW7A 1XMXA 1G3SA 4OIPF 2GWRA 1LEAA 3J80Z 1ETKA 5BS6A 3HOZJ 4HSRA 4EGYA 1A31A 2XRNA 2EV6A 1ZG5A 3ZRGA 4BJTA 4E7HA 3SHFA 1DP7P 4UNOA 3NEUA 2WB1N 3L9FA 4CZZA 2IGKA 4HNUA 2BY2A 1X1DA 3D5LA 2PJRB 1MDMB 4B44A 4C9YA 1VQOI 2R7OA 1UG0A 5M5WJ 1GXPA 1CGPA 3ABTA 1ZTRA 1O3RA 5CVJA 3K70D 3ZQLA 4UVAA 1BOAA 5GTIC 2H94A 1QO0D 1WZ2A 3KEQA 2KIQA 3T5XA 1CF7A 2XGCA 2DFFA 2PN6A 5JR3A 1RPWA 1LE8B 2O8XA 1QPMA 3ZGKA 3OWTA 2H27A 3HPHA 5EG0A 1UMQA 2EB7A 3DKWA 1I50J 3CP2A 4I6ZA 3J7ZI 5GADJ 1TL8A 1Y1WJ 1RETA 3GLXA 2LC2A 2OUMA 5KHDA 3OYKA 3RKXA 1RKWA 2R5ZB 2JSPA 2Z33A 1J75A 4Y4RA 4XQFA 5FKLA 4L5JA 3OIPA 2JA7J 4EM2A 2QGUA 1OLTA 1FYLA 4C3IJ 1G3YA 1H9TA 3FK6A 1I39A 5D5VB 5KNLA 4G7OF 2PMHA 4ZYEA 1MBEA 3HOTA 1LJ9A 2VPRA 3H5AA 3CLQA 4PJ0C 4LLNA 4IOCF 3FBIB 3S1QJ 4LITA 5ICCA 2DPDA 2VBYA 2LRDA 2M1BA 2XSJC 3N97A 4DOZA 3LSPA 1QBJA 1X2MA 5ILUA 2F5DA 2PMZA 2R7VA 5FKOA 4E7LA 1T0FA 2IGNA 3H9QA 3VYUB 4FISA 1IG7A 3BR0A 3JRBA 2VC1A 3JTHA 1EH6A 3H3VK 2F2EA 4KITB 2R7FA 2NVTJ 1ZQ3P 5IYDJ 2VQGA 3I59A 5LRRA 1QZEA 2WA0A 3ZR8X 2DOAA 3HKZN 3GFMA 1GUUA 3Q9SA 1SVOA 3PFIA 3CCQI 1XSDA 5M3MJ 4ENJA 3J81K 1FP1D 2E1MC 3CDLA 3HGYA 3WTZA 2XPWA 4M3FA 5FGMA 2BXYA 3P9IA 4D1QA 4GXOA 2F4MB 4S05A 5E17F 2G7HA 4HEA2 2F5CA 1AKHA 2Q2EA 2CS3A 2EH3A 1P6RA 4JX6A 1ZG3A 4HYEA 5HNFA 2LLKA 4ABZA 1BL0A 5AONA 3DKYA 4B48A 3ERED 1K79A 2VOOA 1MBGA 4M3GA 3JRFA 3PO3J 3CCSI 4PFOA 1QZYA 1DPRA 2STWA 3M8JA 1QHHD 2LKSA
chains in the Genus database with same CATH topology
4EV0A 2IA1A 1C0WA 2ZKZA 1U8RA 2VBWA 1OR7A 3BDDA 2VBZA 2DK5A 4M6XA 4Q4ZF 2J5PA 3LFKA 1FOKA 4HAMA 1RI7A 5KVRA 3KCCA 3VOEA 3MEXA 3I54A 4ESBA 4EQQA 1HXDA 1LQ1A 2ZMEA 1FNNA 4KMUX 3C3WA 3QU6A 2DAOA 5ICFA 2OZ6A 5LEKA 1KYZA 1XDSA 2UXNA 5A2QZ 4EJOA 3TQNA 1FWZA 1T6SA 3ZMUA 2FBHA 1WWXA 5L3CA 2CFXA 4HF1A 2MH2A 3D0SA 3V7SA 1L3LA 2XASA 4XLPF 1YS6A 5BOXA 2GQQA 3ZMDA 1ZN2A 4HX4A 2CO5A 3ECHA 3GUDA 1D8JA 1KU9A 1RUOA 4FT8A 2JT1A 2V6CA 5F6FA 3DV8A 3BPVA 2KIUA 2ZXJA 1FLIA 1HKSA 1T38A 3Q5FA 3R60A 2Q8KA 2HQRA 3RI4A 1ZHFA 1XGSA 2V1DA 3CLOA 5FB2A 2XVCA 2EA4A 1MJBA 2NNYA 1YW8A 1IUYA 2A68F 2O6GE 3TGNA 3IKVA 1W7PB 5LGUA 1KQ0A 3HSRA 5TJJA 1IRGA 3MZHA 4RGRA 1R7JA 4LFUA 1T98A 4RB1A 3SQNA 3LAPA 2IT0A 3ML6A 3MCZA 3DFGA 4KIGA 4G6QA 4HQMA 5AIQA 1SMTA 2RVCA 2XAQA 1LVAA 4CDGA 2VONA 4IRIA 1I5ZA 3QAHA 4HX8A 3K1MA 4HV6A 1EH8A 4KYWA 3G73A 2MC3A 1SMYF 5DCMA 4EJVA 4KA4A 4U7BA 1BC8C 3JSPA 2ESHA 3RKYA 2XKOA 2QUFA 3E97A 3BY6A 2P7CB 1O3SA 3F8MA 4A6DA 3VFZA 5JHUA 2ELHA 4RGUA 2FA5A 3NRVA 4G7HF 3C7JA 5BPIA 3SXYA 5DCFA 3F6OA 1PUEE 5D4RA 4P96A 4P55A 4XSZF 4DNCA 1XSXA 3HRUA 5ICEA 3FXQA 2PJPA 2BE5F 4XRFA 3I71A 3ULQB 2C6YA 1STZA 2QVOA 4G8XA 1ZLJA 2VOPA 5CVIA 5DV5A 3J80K 1FBQA 2BBYA 4I01A 3FXUA 4RGSA 4YG2F 4ESJA 1D3YA 5D8LB 3F3XA 4I7HA 1JHHA 3R4KA 4UUVA 1KA8A 4L0YB 4NQWA 3IWZA 3I0TA 1ZLKA 1GVJA 3V8KA 5CLSA 2VN2A 4BHPA 1UCRA 1CF7B 3WE2A 2OZUA 1W7PD 1ZREA 5HDNA 2DK8A 2BYVE 3TO9A 3WODF 2FNAA 3BPXA 1FPQA 1BI3A 3CUQA 1G3WA 2EJRA 5DUKA 5HDKA 2RGVA 2AXLA 5HLIA 2A6EF 5BMZA 4L9JA 3TOAA 2XAGA 3BWGA 4OIOF 1HW5A 3H3ZA 1USSA 3TKYA 1S6LA 2QQAA 1FSEA 2XHKA 3HRMA 1ON2A 3FF5A 4HF0A 1I27A 1S3JA 2MLGA 4EGZA 5HS7A 4WCGA 2GIVA 2EFNA 4XBFA 4CICA 4UHTA 1K78B 1ZH5A 2UZKA 3H92A 2H09A 3SZTA 2WWYA 1L0OC 4L9TA 5FLXK 3WTXC 3KP2A 4L0ZB 2P6TA 1LNWA 3HUGA 1TW3A 2Y0MA 3VEPA 4KT5C 3PQJA 1DDNA 2IJLA 4R79A 3WTYC 3QPTA 1SFUA 1TQMA 2FRHA 4FX4A 5LEJA 4XSXF 1J59A 3REOA 2QZ8A 5IT3A 3WGIA 1LB2A 4CGZA 1U2WA 2XAJA 3ZP5A 1V3FA 1IXCA 3LWFA 4O6JA 1FYKA 1R1UA 3KP7A 1O3TA 4YFKF 3IRRA 3F21A 1LDDA 1IRFA 2HTJA 2QM3A 1WQ2A 2QBYB 4HOBA 1W5SA 3I64A 2CW0F 3LSTA 4LG0B 1SFXA 4BYYA 1G3TA 3L7WA 3CTAA 2DQRA 1IN6A 3DEUA 2EV0A 4Z2YA 2E7XA 3ZN0A 3QP5A 1O57A 4BHCA 4HF2A 5L3EA 4MTEA 1HSJA 1WRJA 4E70A 2M30A 3MZYA 1B1BA 3HTSB 5J8CA 1TNTA 4R1HA 4P9FA 2VBXA 2DTRA 5CJ9A 3C18A 1MDMA 3EUHA 3WTTC 2K86A 5D6EA 4ENNA 5JI6A 3F72A 3IHUA 1KU2A 2ZNYA 2M8EA 1UHWA 2D1HA 1HKTA 2KRFA 3ISPA 2ESNA 5L3FA 1H9GA 2A61A 1TTYA 3CJNA 4JK1X 2OQGA 2VXZA 4PGHA 3TO7A 2FMLA 2DQLA 3P7NA 1JGSA 2VODA 2P5VA 3CO7C 1MJAA 3K0LA 3EETA 3RYRA 3R0AA 3V8JA 2Y75A 3BOQA 4YIIA 2D2WA 1IXSB 3ABUA 1OPCA 3EYIA 4UV9A 1YQAA 5TRDA 1IN5A 2HR3A 3KP6A 2ADUA 1QQIA 2R3SA 2VE9A 2A3SA 3B02A 3DF8A 3I58A 4M72A 4KN7X 3LQQA 3DPLC 1BC7C 3KZZA 4UVCA 1KQ9A 2JPBA 1OYWA 1W4MA 2BEOA 1UFMA 3IC7A 1QNTA 1S7AA 4ZZDA 4P5OA 1RNLA 3GW2A 2E1NA 1IF1A 3M9AA 1AWCA 4U0VA 5DD8A 1R1TA 2KJCA 2FSWA 3W6KB 4QWQA 3R6SA 5HS8A 5L3DA 1BI1A 5E1XA 2HYFA 1PDNC 1G4DA 1BJAA 3KLNA 1YG2A 3FXRA 2ETHA 1IZ1A 3W6JB 5DD4A 2GAUA 4GO1A 4A0YA 2A69F 1O7LA 1I6XA 5HLHA 3TOBA 1FP2A 3SZPA 3WU1B 3S2WA 2P8TA 4Q48A 5J6XA 4I0BA 1I1SA 2XKPA 1XMAA 3ECOA 1FSHA 2ZCWA 1FZPB 4D0PA 2EK5A 4H0EA 2CYYA 3BROA 1TNSA 4QLCU 2H6CA 1P4WA 4M71A 3RTRA 2OQRA 2PLYA 3LAJA 4HLYA 2VC0A 5L3BA 2YPRA 3HYIA 3KEOA 2HFHA 2RKHA 4MEXF 1HQCA 2JPCA 4LG0A 1J0RA 1HW2A 1YLFA 1USTA 2IW5A 2PFBA 2IRFG 3SFZA 4R8HA 5AIPA 4B8XA 4OMZA 4OU0A 3QP6A 4CHUA 2UXXA 2FQ3A 5FD5A 1OYYA 1B9MA 2O3FA 2KJBA 4IF4A 3IKTA 1XGOA 3GFJA 3I5UA 3F8CA 1XB4A 1P2FA 4MEYF 5ILVA 3TDUC 5D5UB 4ZYGA 4OIRF 2Z5UA 4G9YA 2JRTA 1RUNA 2EFOA 5D5WB 4U0YA 1SD4A 5K1YA 4M74A 1ZYRF 4L9NA 1F5TA 4A6EA 5ED4A 1B4AA 1OYIA 1R5HA 2M87A 1YW7A 3KFWX 5L3GA 4A2UA 4LLGF 2V9VA 4RAZA 2LF8A 2IVMA 4MGRA 1RZ4A 1IN8A 4AIKA 1YO5C 1MGTA 4RGXA 3L00A 3FM3A 2P5LC 1R1VA 1J9IA 1YW9A 3IRQA 2NYXA 6PAXA 3FMRA 1IN4A 5DEQA 4OOIA 1S29A 1SD5A 2V1XA 2YSRA 3V4GA 3GX4X 5HOOA 2D1VA 3QRFF 5BPDA 2PBIA 3COAC 2AS5F 4I02A 4OIQF 2XUBA 2Z99A 4KICA 1UB9A 1KU3A 4LK1F 2HYGD 3JAMK 5E20A 3CUQB 4S04A 2FMYA 4A12A 1U5TA 1MKMA 4A5MA 4KFCA 3F8BA 3LA3A 3GZ6A 5DDGA 1Z91A 1EH7A 2KKOA 3ZN1A 3FZVA 4A0XA 2STTA 1SAXA 1BIAA 1MD0A 2WTEA 3FMQA 4U7DA 3QOPA 4IRHA 4KIBA 5H6QA 2V79A 2HQNA 1RIOH 1IW7F 3EYYA 3GFIA 2PMUA 4BH9A 4OINF 4IJAA 1NHAA 2KIMA 1J2XA 2VT2A 2G7UA 4EM0B 4O3MA 2FNPA 1PP7U 2JZYA 1SD6A 1LEBA 2KIFA 3M1EA 1D8KA 3DXJF 1WSUA 2JSCA 4YIFA 2HKOA 2WV0A 4FHTA 1ODDA 5LLQA 2VT3A 2HEOA 2H6BA 1IN7A 4BXUA 1OKRA 2ISZA 4P9UA 2OD5A 4Y15A 4IHTA 5FLXZ 2A07F 2PI0A 2L3DA 1TLHB 3FHZA 4M6YA 1P4XA 4BNCA 3U9GA 3CUOA 4HW0A 1S7OA 5ERIA 2HKXA 4HDUA 5FFXA 2GA2A 2DPUA 4HX7A 1DUXC 5DUIA 4LGWA 3E6DA 1SD7A 5LRSA 2RQPA 4KIFA 1R5GA 1HBXG 2J5OA 5F64A 1IAWA 1H0MA 2COMA 2EA2A 3HOSA 3IL2A 2K02A 5D8KB 2DO7A 5HS9A 3RJPA 5J8FA 2Q0OA 1KGSA 1BIBA 2CSOA 3WTUC 4KN4X 3LA2A 3E6MA 2OU2A 3F8FA 5LGNA 3CDHA 4KDPA 1TBXA 2P5KA 4EJTA 1W7PA 4BQAA 2DW4A 5E1WA 2DU9A 4ZZLA 1LDKB 3LA7A 2RN7A 1WI9A 2ZNZA 1U78A 2K4JA 4L9VA 2L4MA 5DCMB 3WGHA 2OAZA 1K78A 3IWFA 1FBUA 3L2CA 3KP4A 2BGCA 5FFZA 4CO8A 3E5UA 4F7ZA 5E8IA 1EV7A 4G7ZF 1K6OA 1Y0UA 4IRGA 4LMYA 4IVNA 3GXOA 3RYPA 1PP8F 4GYGA 1ZARA 4AWXB 1XDUA 5FO5A 1IXRC 1FT9A 2F5EA 2O03A 2O0YA 1OMIA 3WTWC 1XSVA 4K2EA 3R61A 2E7WA 3QU3A 2ZMEB 4LD5A 1ZG1A 3T0YA 3BJAA 1UHMA 2IP2A 2PQ8A 2FE3A 1Z7UA 1DPUA 1GHCA 2RNJA 2ZFWA 2P4WA 3WGGA 5EEHA 1WKMA 4M73A 1B6AA 2W25A 1YIOA 3GEZA 5ILSA 2LNBA 1XD7A 4HDVA 4I0AA 3FX3A 2FEZA 2IA2A 5FD6A 4DQ2A 3V8LA 2K4BA 2XGXA 4Y17A 3CUQC 3F23A 1SFEA 2M45A 1KQ8A 3E6CC 5LGTA 3WG9A 3GO5A 3EDPA 2EFQA 5LHGA 4JBAA 1XN7A 1R58A 3B73A 2GZWA 5HDGA 4L18B 2NAZA 3RPUA 4IHSA 2DI3A 5LBQA 3JW4A 1F4KA 4M9XA 5CVUA 1FX7A 1ZRDA 2P6SA 3ZMTA 3T1BA 4JQFA 2FOKA 2GA1A 3I53A 2A5YB 1JE8A 3P9KA 3MFKA 2XAHA 3GF2A 2QYOA 3HHHA 4EM1A 4I98B 1TW2A 2X4HA 5K5RA 1XGNA 4Y13A 3M8EA 1JXSA 5LHIA 3U1DA 3VB2A 2PG4A 4PDKA 4HZFA 4UV8A 3HIFA 2XV4S 2W24A 3E5QA 3ZMSA 4PGGA 3NQOA 3KP5A 5CVRA 2NS0A 2HGCA 2XAFA 1BBYA 4U0WA 3FWEA 4EJUA 5JFRA 2GXGA 2IA0A 3BJOA 5H20A 2X0LA 2LKPA 3M7GA 4L5IA 4OMYA 5BQTA 3U2RA 3TO6A 5IT9Z 3ZMZA 5F1RA 4PZJA 1B9NA 3FMSA 2YR2A 2Z9OA 1O3QA 1Z1DA 3O3KA 3ZQ7A 2YX7A 4ENMA 4WXCA 4WK8F 1E17A 1TQPA 4MQ9F 1QZZA 3RDIA 1ON1A 2RV8A 1A04A 3GVAA 5K5QA 2MH9A 4AIJA 2CQKA 2LSOA 2FU4A 1Z9CA 2P7VB 5HLGA 3E3VA 4G94A 4KNYA 1XGMA 2W57A 4O5VA 2BV6A 2DT5A 5CVVA 2F5FA 4YFNF 1U5TB 2Z3YA 2XIGA 5E1ZB 2MA3A 2HWVA 1VTNC 4KMFA 4LB5A 3RIRA 3HHGA 2HDCA 2UWMA 1U5TC 1BI2A 3RPQA 3KZYA 3V7CA 3ELKA 1ONVA 4M9SA 4LJZF 2CWEA 3KE2A 3K1NA 4AD9A 1D5VA 3K1PA 1REPC 4ASNA 5KK1A 4RB0A 2MD5A 3TDZC 2K27A 3K9TA 1XMKA 2FF4A 2QWWA 2L01A 4Q5SF 2CGPA 2L54A 3K2ZA 1W5TA 5DYMA 4EMSA 1B59A 3VODA 2ZJ2A 4ZYHA 2Y48A 2ISYA 3ROUA 1X3UA 5D5XB 4ETSA 1ZGJA 2HS5A 4EVIA 4N0BA 3RKWA 3O2PE 3I59B 1HKQA 3GWZA 1U3EM 2EFWA 1YYVA 1J7KA 3KP3A 3HRSA 4HA8A 1T39A 1HSTA 3P9CA 3MQ0A 4IPAA 4YFXF 4A0ZA 3T8TA 3L09A 4KUMA 4ENKA 4RB2C 2DLLA 4PCQA 2ACJA 1MJ9A 5E8GA 3V7RA 3GFLA 3H3UA 4LK0F 4M9ZA 4ZH4F 3HTUA 4XLNF 1ZRFA 5K5OA 2IPQX 3OOPA 3J81Z 4MHGA 1S8NA 1HW1A 2QQ9A 5HVQC 2L02A 1ULYA 3MWMA 4BHBA 3QPHA 5IT9K 2W85A 2YU3A 3EQLF 4ZYDA 1QGPA 4LB6B 4ON0A 3K69A 4MQVA 2JTVA 4HBLA 3JSOA 4WXHA 3N4MA 3J7AO 2HZTA 3I4PA 1O7FA 4HLXA 1BN5A 3WU0A 3F6VA 4AIHA 4EJWA 2ZO4A 2K7LA 2D45A 4U88A 1TQIA 3KLOA 3JAMZ 2LF7A 2HOEA 5H6RA 3BJ6A 3F22A 4HQEA 3HSFA 2M5WA 3ZMVA 4RAYA 4RB3C 2G9WA 5D6FA 1JHFA 1G6NA 4WXDA 5CYVA 3WTSC 4LLLA 5JVTA 2E1CA 3E5XA 4A5NA 4CYDA 3HRTA 2LDUA 2V1UA 3MAJA 2HTSA 4BAYA 2FXAA 4Q47A 1V4RA 2YX4A 4RS8A 2O61A 1Z6TA 2RDPA 1FYMA 2DFIA 1E2XA 4GYIA 5ICGA 3DPTA 3ZPLA 2MBFA 4GCVA 1F1ZA 4WX9A 3BZ6A 1ZRCA 2EV5A 3DQVC 2DBBA 1R22A 2EWNA 3M8FA 3GZ5A 2QLZA 2ZBKA 1I1GA 1Q1HA 3JTGA 3LQRA 3HSEA 1P92A 2FBKA 2A6HF 1KYWA 2VE8A 1KU7A 4NB5A 4MTDA 1LDJA 1Z6RA 1YTYA 3O6BB 4N9HA 1YFHA 1AOYA 3OV8A 3AAFA 1ZAOA 3GYHX 2GXBA 1XCBA 4I09A 2MLKA 2RC4A 1J5YA 1BM9A 3E6BA 5E18F 3C1DA 1FY7A 1YS7A 1Z05A 4WWCA 3WE3A 1FC3A 2W84A 2OBPA 4IXAA 3CO6C 4G6DA 2OA4A 4GGGA 2L4AA 3T8RA 2QQBA 5A2QK 1ZGAA 5EEGA 2R7DA 4CXFA 3BP8A 3FM5A 1GXQA 1K7AA 1P4AA 2CG4A 3G3ZA 4UVBA 5D4SA 4MNUA 1BI0A 4AVPA 1FBSA 1XCVA 2QENA 2B0LA 4TV7A 2QBYA 1R23A 3PQKA 4FX0A 4ESFA 4UXNA 2WC2A 1U6GA 4HV5A 2XROA 4B09A 3F8NA 1R00A 4WF2A 4N9IA 1F9NA 2NRAC 3Q9VA 3WTVC 4NHJA 3KETA 2NNNA 2PEXA 4I2OA 1MZBA 1R36A 5LHHA 1T2KA 3DP7A 3R0JA 2EFPA 2FBIA 2TDXA 1G3SA 4OIPF 2GWRA 1LEAA 3J80Z 5BS6A 4EGYA 2XRNA 2EV6A 1ZG5A 3SHFA 4UNOA 1DP7P 3NEUA 3L9FA 4CZZA 3D5LA 1MDMB 1GXPA 1CGPA 3ABTA 1O3RA 5CVJA 4UVAA 1BOAA 2H94A 1QO0D 3KEQA 3T5XA 1CF7A 2PN6A 5JR3A 2O8XA 1QPMA 2H27A 2EB7A 3DKWA 3GLXA 3RKXA 1J75A 2Z33A 4L5JA 4EM2A 1FYLA 1G3YA 1H9TA 5D5VB 4G7OF 2PMHA 4ZYEA 3HOTA 1LJ9A 4LLNA 5ICCA 2DPDA 2VBYA 2M1BA 3N97A 1QBJA 5ILUA 2F5DA 1T0FA 2VC1A 3JTHA 1EH6A 2F2EA 2R7FA 3I59A 5LRRA 3GFMA 3Q9SA 1XSDA 3PFIA 4ENJA 3J81K 1FP1D 3WTZA 5FGMA 3P9IA 4GXOA 4S05A 5E17F 2G7HA 2F5CA 2Q2EA 1P6RA 1ZG3A 4HYEA 5AONA 3ERED 1K79A 2VOOA 1QZYA 1DPRA 2STWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EV0 A;  2IA1 A;  1C0W A;  2ZKZ A;  1U8R A;  2VBW A;  1OR7 A;  3BDD A;  2VBZ A;  2DK5 A;  4M6X A;  4Q4Z F;  2J5P A;  3LFK A;  1FOK A;  4HAM A;  1RI7 A;  5KVR A;  3KCC A;  3VOE A;  3MEX A;  3I54 A;  4ESB A;  4EQQ A;  1HXD A;  1LQ1 A;  2ZME A;  1FNN A;  4KMU X;  3C3W A;  3QU6 A;  2DAO A;  5ICF A;  2OZ6 A;  5LEK A;  1KYZ A;  1XDS A;  2UXN A;  5A2Q Z;  4EJO A;  3TQN A;  1FWZ A;  1T6S A;  3ZMU A;  2FBH A;  1WWX A;  5L3C A;  2CFX A;  4HF1 A;  2MH2 A;  3D0S A;  3V7S A;  1L3L A;  2XAS A;  4XLP F;  1YS6 A;  5BOX A;  2GQQ A;  3ZMD A;  1ZN2 A;  4HX4 A;  2CO5 A;  3ECH A;  3GUD A;  1D8J A;  1KU9 A;  1RUO A;  4FT8 A;  2JT1 A;  2V6C A;  5F6F A;  3DV8 A;  3BPV A;  2KIU A;  2ZXJ A;  1FLI A;  1HKS A;  1T38 A;  3Q5F A;  3R60 A;  2Q8K A;  2HQR A;  3RI4 A;  1ZHF A;  1XGS A;  2V1D A;  3CLO A;  5FB2 A;  2XVC A;  2EA4 A;  1MJB A;  2NNY A;  1YW8 A;  1IUY A;  2A68 F;  2O6G E;  3TGN A;  3IKV A;  1W7P B;  5LGU A;  1KQ0 A;  3HSR A;  5TJJ A;  1IRG A;  3MZH A;  4RGR A;  1R7J A;  4LFU A;  1T98 A;  4RB1 A;  3SQN A;  3LAP A;  2IT0 A;  3ML6 A;  3MCZ A;  3DFG A;  4KIG A;  4G6Q A;  4HQM A;  5AIQ A;  1SMT A;  2RVC A;  2XAQ A;  1LVA A;  4CDG A;  2VON A;  4IRI A;  1I5Z A;  3QAH A;  4HX8 A;  3K1M A;  4HV6 A;  1EH8 A;  4KYW A;  3G73 A;  2MC3 A;  1SMY F;  5DCM A;  4EJV A;  4KA4 A;  4U7B A;  1BC8 C;  3JSP A;  2ESH A;  3RKY A;  2XKO A;  2QUF A;  3E97 A;  3BY6 A;  2P7C B;  1O3S A;  3F8M A;  4A6D A;  3VFZ A;  5JHU A;  2ELH A;  4RGU A;  2FA5 A;  3NRV A;  4G7H F;  3C7J A;  5BPI A;  3SXY A;  5DCF A;  3F6O A;  1PUE E;  5D4R A;  4P96 A;  4P55 A;  4XSZ F;  4DNC A;  1XSX A;  3HRU A;  5ICE A;  3FXQ A;  2PJP A;  2BE5 F;  4XRF A;  3I71 A;  3ULQ B;  2C6Y A;  1STZ A;  2QVO A;  4G8X A;  1ZLJ A;  2VOP A;  5CVI A;  5DV5 A;  3J80 K;  1FBQ A;  2BBY A;  4I01 A;  3FXU A;  4RGS A;  4YG2 F;  4ESJ A;  1D3Y A;  5D8L B;  3F3X A;  4I7H A;  1JHH A;  3R4K A;  4UUV A;  1KA8 A;  4L0Y B;  4NQW A;  3IWZ A;  3I0T A;  1ZLK A;  1GVJ A;  3V8K A;  5CLS A;  2VN2 A;  4BHP A;  1UCR A;  1CF7 B;  3WE2 A;  2OZU A;  1W7P D;  1ZRE A;  5HDN A;  2DK8 A;  2BYV E;  3TO9 A;  3WOD F;  2FNA A;  3BPX A;  1FPQ A;  1BI3 A;  3CUQ A;  1G3W A;  2EJR A;  5DUK A;  5HDK A;  2RGV A;  2AXL A;  5HLI A;  2A6E F;  5BMZ A;  4L9J A;  3TOA A;  2XAG A;  3BWG A;  4OIO F;  1HW5 A;  3H3Z A;  1USS A;  3TKY A;  1S6L A;  2QQA A;  1FSE A;  2XHK A;  3HRM A;  1ON2 A;  3FF5 A;  4HF0 A;  1I27 A;  1S3J A;  2MLG A;  4EGZ A;  5HS7 A;  4WCG A;  2GIV A;  2EFN A;  4XBF A;  4CIC A;  4UHT A;  1K78 B;  1ZH5 A;  2UZK A;  3H92 A;  2H09 A;  3SZT A;  2WWY A;  1L0O C;  4L9T A;  5FLX K;  3WTX C;  3KP2 A;  4L0Z B;  2P6T A;  1LNW A;  3HUG A;  1TW3 A;  2Y0M A;  3VEP A;  4KT5 C;  3PQJ A;  1DDN A;  2IJL A;  4R79 A;  3WTY C;  3QPT A;  1SFU A;  1TQM A;  2FRH A;  4FX4 A;  5LEJ A;  4XSX F;  1J59 A;  3REO A;  2QZ8 A;  5IT3 A;  3WGI A;  1LB2 A;  4CGZ A;  1U2W A;  2XAJ A;  3ZP5 A;  1V3F A;  1IXC A;  3LWF A;  4O6J A;  1FYK A;  1R1U A;  3KP7 A;  1O3T A;  4YFK F;  3IRR A;  3F21 A;  1LDD A;  1IRF A;  2HTJ A;  2QM3 A;  1WQ2 A;  2QBY B;  4HOB A;  1W5S A;  3I64 A;  2CW0 F;  3LST A;  4LG0 B;  1SFX A;  4BYY A;  1G3T A;  3L7W A;  3CTA A;  2DQR A;  1IN6 A;  3DEU A;  2EV0 A;  4Z2Y A;  2E7X A;  3ZN0 A;  3QP5 A;  1O57 A;  4BHC A;  4HF2 A;  5L3E A;  4MTE A;  1HSJ A;  1WRJ A;  4E70 A;  2M30 A;  3MZY A;  1B1B A;  3HTS B;  5J8C A;  1TNT A;  4R1H A;  4P9F A;  2VBX A;  2DTR A;  5CJ9 A;  3C18 A;  1MDM A;  3EUH A;  3WTT C;  2K86 A;  5D6E A;  4ENN A;  5JI6 A;  3F72 A;  3IHU A;  1KU2 A;  2ZNY A;  2M8E A;  1UHW A;  2D1H A;  1HKT A;  2KRF A;  3ISP A;  2ESN A;  5L3F A;  1H9G A;  2A61 A;  1TTY A;  3CJN A;  4JK1 X;  2OQG A;  2VXZ A;  4PGH A;  3TO7 A;  2FML A;  2DQL A;  3P7N A;  1JGS A;  2VOD A;  2P5V A;  3CO7 C;  1MJA A;  3K0L A;  3EET A;  3RYR A;  3R0A A;  3V8J A;  2Y75 A;  3BOQ A;  4YII A;  2D2W A;  1IXS B;  3ABU A;  1OPC A;  3EYI A;  4UV9 A;  1YQA A;  5TRD A;  1IN5 A;  2HR3 A;  3KP6 A;  2ADU A;  1QQI A;  2R3S A;  2VE9 A;  2A3S A;  3B02 A;  3DF8 A;  3I58 A;  4M72 A;  4KN7 X;  3LQQ A;  3DPL C;  1BC7 C;  3KZZ A;  4UVC A;  1KQ9 A;  2JPB A;  1OYW A;  1W4M A;  2BEO A;  1UFM A;  3IC7 A;  1QNT A;  1S7A A;  4ZZD A;  4P5O A;  1RNL A;  3GW2 A;  2E1N A;  1IF1 A;  3M9A A;  1AWC A;  4U0V A;  5DD8 A;  1R1T A;  2KJC A;  2FSW A;  3W6K B;  4QWQ A;  3R6S A;  5HS8 A;  5L3D A;  1BI1 A;  5E1X A;  2HYF A;  1PDN C;  1G4D A;  1BJA A;  3KLN A;  1YG2 A;  3FXR A;  2ETH A;  1IZ1 A;  3W6J B;  5DD4 A;  2GAU A;  4GO1 A;  4A0Y A;  2A69 F;  1O7L A;  1I6X A;  5HLH A;  3TOB A;  1FP2 A;  3SZP A;  3WU1 B;  3S2W A;  2P8T A;  4Q48 A;  5J6X A;  4I0B A;  1I1S A;  2XKP A;  1XMA A;  3ECO A;  1FSH A;  2ZCW A;  1FZP B;  4D0P A;  2EK5 A;  4H0E A;  2CYY A;  3BRO A;  1TNS A;  4QLC U;  2H6C A;  1P4W A;  4M71 A;  3RTR A;  2OQR A;  2PLY A;  3LAJ A;  4HLY A;  2VC0 A;  5L3B A;  2YPR A;  3HYI A;  3KEO A;  2HFH A;  2RKH A;  4MEX F;  1HQC A;  2JPC A;  4LG0 A;  1J0R A;  1HW2 A;  1YLF A;  1UST A;  2IW5 A;  2PFB A;  2IRF G;  3SFZ A;  4R8H A;  5AIP A;  4B8X A;  4OMZ A;  4OU0 A;  3QP6 A;  4CHU A;  2UXX A;  2FQ3 A;  5FD5 A;  1OYY A;  1B9M A;  2O3F A;  2KJB A;  4IF4 A;  3IKT A;  1XGO A;  3GFJ A;  3I5U A;  3F8C A;  1XB4 A;  1P2F A;  4MEY F;  5ILV A;  3TDU C;  5D5U B;  4ZYG A;  4OIR F;  2Z5U A;  4G9Y A;  2JRT A;  1RUN A;  2EFO A;  5D5W B;  4U0Y A;  1SD4 A;  5K1Y A;  4M74 A;  1ZYR F;  4L9N A;  1F5T A;  4A6E A;  5ED4 A;  1B4A A;  1OYI A;  1R5H A;  2M87 A;  1YW7 A;  3KFW X;  5L3G A;  4A2U A;  4LLG F;  2V9V A;  4RAZ A;  2LF8 A;  2IVM A;  4MGR A;  1RZ4 A;  1IN8 A;  4AIK A;  1YO5 C;  1MGT A;  4RGX A;  3L00 A;  3FM3 A;  2P5L C;  1R1V A;  1J9I A;  1YW9 A;  3IRQ A;  2NYX A;  6PAX A;  3FMR A;  1IN4 A;  5DEQ A;  4OOI A;  1S29 A;  1SD5 A;  2V1X A;  2YSR A;  3V4G A;  3GX4 X;  5HOO A;  2D1V A;  3QRF F;  5BPD A;  2PBI A;  3COA C;  2AS5 F;  4I02 A;  4OIQ F;  2XUB A;  2Z99 A;  4KIC A;  1UB9 A;  1KU3 A;  4LK1 F;  2HYG D;  3JAM K;  5E20 A;  3CUQ B;  4S04 A;  2FMY A;  4A12 A;  1U5T A;  1MKM A;  4A5M A;  4KFC A;  3F8B A;  3LA3 A;  3GZ6 A;  5DDG A;  1Z91 A;  1EH7 A;  2KKO A;  3ZN1 A;  3FZV A;  4A0X A;  2STT A;  1SAX A;  1BIA A;  1MD0 A;  2WTE A;  3FMQ A;  4U7D A;  3QOP A;  4IRH A;  4KIB A;  5H6Q A;  2V79 A;  2HQN A;  1RIO H;  1IW7 F;  3EYY A;  3GFI A;  2PMU A;  4BH9 A;  4OIN F;  4IJA A;  1NHA A;  2KIM A;  1J2X A;  2VT2 A;  2G7U A;  4EM0 B;  4O3M A;  2FNP A;  1PP7 U;  2JZY A;  1SD6 A;  1LEB A;  2KIF A;  3M1E A;  1D8K A;  3DXJ F;  1WSU A;  2JSC A;  4YIF A;  2HKO A;  2WV0 A;  4FHT A;  1ODD A;  5LLQ A;  2VT3 A;  2HEO A;  2H6B A;  1IN7 A;  4BXU A;  1OKR A;  2ISZ A;  4P9U A;  2OD5 A;  4Y15 A;  4IHT A;  5FLX Z;  2A07 F;  2PI0 A;  2L3D A;  1TLH B;  3FHZ A;  4M6Y A;  1P4X A;  4BNC A;  3U9G A;  3CUO A;  4HW0 A;  1S7O A;  5ERI A;  2HKX A;  4HDU A;  5FFX A;  2GA2 A;  2DPU A;  4HX7 A;  1DUX C;  5DUI A;  4LGW A;  3E6D A;  1SD7 A;  5LRS A;  2RQP A;  4KIF A;  1R5G A;  1HBX G;  2J5O A;  5F64 A;  1IAW A;  1H0M A;  2COM A;  2EA2 A;  3HOS A;  3IL2 A;  2K02 A;  5D8K B;  2DO7 A;  5HS9 A;  3RJP A;  5J8F A;  2Q0O A;  1KGS A;  1BIB A;  2CSO A;  3WTU C;  4KN4 X;  3LA2 A;  3E6M A;  2OU2 A;  3F8F A;  5LGN A;  3CDH A;  4KDP A;  1TBX A;  2P5K A;  4EJT A;  1W7P A;  4BQA A;  2DW4 A;  5E1W A;  2DU9 A;  4ZZL A;  1LDK B;  3LA7 A;  2RN7 A;  1WI9 A;  2ZNZ A;  1U78 A;  2K4J A;  4L9V A;  2L4M A;  5DCM B;  3WGH A;  2OAZ A;  1K78 A;  3IWF A;  1FBU A;  3L2C A;  3KP4 A;  2BGC A;  5FFZ A;  4CO8 A;  3E5U A;  4F7Z A;  5E8I A;  1EV7 A;  4G7Z F;  1K6O A;  1Y0U A;  4IRG A;  4LMY A;  4IVN A;  3GXO A;  3RYP A;  1PP8 F;  4GYG A;  1ZAR A;  4AWX B;  1XDU A;  5FO5 A;  1IXR C;  1FT9 A;  2F5E A;  2O03 A;  2O0Y A;  1OMI A;  3WTW C;  1XSV A;  4K2E A;  3R61 A;  2E7W A;  3QU3 A;  2ZME B;  4LD5 A;  1ZG1 A;  3T0Y A;  3BJA A;  1UHM A;  2IP2 A;  2PQ8 A;  2FE3 A;  1Z7U A;  1DPU A;  1GHC A;  2RNJ A;  2ZFW A;  2P4W A;  3WGG A;  5EEH A;  1WKM A;  4M73 A;  1B6A A;  2W25 A;  1YIO A;  3GEZ A;  5ILS A;  2LNB A;  1XD7 A;  4HDV A;  4I0A A;  3FX3 A;  2FEZ A;  2IA2 A;  5FD6 A;  4DQ2 A;  3V8L A;  2K4B A;  2XGX A;  4Y17 A;  3CUQ C;  3F23 A;  1SFE A;  2M45 A;  1KQ8 A;  3E6C C;  5LGT A;  3WG9 A;  3GO5 A;  3EDP A;  2EFQ A;  5LHG A;  4JBA A;  1XN7 A;  1R58 A;  3B73 A;  2GZW A;  5HDG A;  4L18 B;  2NAZ A;  3RPU A;  4IHS A;  2DI3 A;  5LBQ A;  3JW4 A;  1F4K A;  4M9X A;  5CVU A;  1FX7 A;  1ZRD A;  2P6S A;  3ZMT A;  3T1B A;  4JQF A;  2FOK A;  2GA1 A;  3I53 A;  2A5Y B;  1JE8 A;  3P9K A;  3MFK A;  2XAH A;  3GF2 A;  2QYO A;  3HHH A;  4EM1 A;  4I98 B;  1TW2 A;  2X4H A;  5K5R A;  1XGN A;  4Y13 A;  3M8E A;  1JXS A;  5LHI A;  3U1D A;  3VB2 A;  2PG4 A;  4PDK A;  4HZF A;  4UV8 A;  3HIF A;  2XV4 S;  2W24 A;  3E5Q A;  3ZMS A;  4PGG A;  3NQO A;  3KP5 A;  5CVR A;  2NS0 A;  2HGC A;  2XAF A;  1BBY A;  4U0W A;  3FWE A;  4EJU A;  5JFR A;  2GXG A;  2IA0 A;  3BJO A;  5H20 A;  2X0L A;  2LKP A;  3M7G A;  4L5I A;  4OMY A;  5BQT A;  3U2R A;  3TO6 A;  5IT9 Z;  3ZMZ A;  5F1R A;  4PZJ A;  1B9N A;  3FMS A;  2YR2 A;  2Z9O A;  1O3Q A;  1Z1D A;  3O3K A;  3ZQ7 A;  2YX7 A;  4ENM A;  4WXC A;  4WK8 F;  1E17 A;  1TQP A;  4MQ9 F;  1QZZ A;  3RDI A;  1ON1 A;  2RV8 A;  1A04 A;  3GVA A;  5K5Q A;  2MH9 A;  4AIJ A;  2CQK A;  2LSO A;  2FU4 A;  1Z9C A;  2P7V B;  5HLG A;  3E3V A;  4G94 A;  4KNY A;  1XGM A;  2W57 A;  4O5V A;  2BV6 A;  2DT5 A;  5CVV A;  2F5F A;  4YFN F;  1U5T B;  2Z3Y A;  2XIG A;  5E1Z B;  2MA3 A;  2HWV A;  1VTN C;  4KMF A;  4LB5 A;  3RIR A;  3HHG A;  2HDC A;  2UWM A;  1U5T C;  1BI2 A;  3RPQ A;  3KZY A;  3V7C A;  3ELK A;  1ONV A;  4M9S A;  4LJZ F;  2CWE A;  3KE2 A;  3K1N A;  4AD9 A;  1D5V A;  3K1P A;  1REP C;  4ASN A;  5KK1 A;  4RB0 A;  2MD5 A;  3TDZ C;  2K27 A;  3K9T A;  1XMK A;  2FF4 A;  2QWW A;  2L01 A;  4Q5S F;  2CGP A;  2L54 A;  3K2Z A;  1W5T A;  5DYM A;  4EMS A;  1B59 A;  3VOD A;  2ZJ2 A;  4ZYH A;  2Y48 A;  2ISY A;  3ROU A;  1X3U A;  5D5X B;  4ETS A;  1ZGJ A;  2HS5 A;  4EVI A;  4N0B A;  3RKW A;  3O2P E;  3I59 B;  1HKQ A;  3GWZ A;  1U3E M;  2EFW A;  1YYV A;  1J7K A;  3KP3 A;  3HRS A;  4HA8 A;  1T39 A;  1HST A;  3P9C A;  3MQ0 A;  4IPA A;  4YFX F;  4A0Z A;  3T8T A;  3L09 A;  4KUM A;  4ENK A;  4RB2 C;  2DLL A;  4PCQ A;  2ACJ A;  1MJ9 A;  5E8G A;  3V7R A;  3GFL A;  3H3U A;  4LK0 F;  4M9Z A;  4ZH4 F;  3HTU A;  4XLN F;  1ZRF A;  5K5O A;  2IPQ X;  3OOP A;  3J81 Z;  4MHG A;  1S8N A;  1HW1 A;  2QQ9 A;  5HVQ C;  2L02 A;  1ULY A;  3MWM A;  4BHB A;  3QPH A;  5IT9 K;  2W85 A;  2YU3 A;  3EQL F;  4ZYD A;  1QGP A;  4LB6 B;  4ON0 A;  3K69 A;  4MQV A;  2JTV A;  4HBL A;  3JSO A;  4WXH A;  3N4M A;  3J7A O;  2HZT A;  3I4P A;  1O7F A;  4HLX A;  1BN5 A;  3WU0 A;  3F6V A;  4AIH A;  4EJW A;  2ZO4 A;  2K7L A;  2D45 A;  4U88 A;  1TQI A;  3KLO A;  3JAM Z;  2LF7 A;  2HOE A;  5H6R A;  3BJ6 A;  3F22 A;  4HQE A;  3HSF A;  2M5W A;  3ZMV A;  4RAY A;  4RB3 C;  2G9W A;  5D6F A;  1JHF A;  1G6N A;  4WXD A;  5CYV A;  3WTS C;  4LLL A;  5JVT A;  2E1C A;  3E5X A;  4A5N A;  4CYD A;  3HRT A;  2LDU A;  2V1U A;  3MAJ A;  2HTS A;  4BAY A;  2FXA A;  4Q47 A;  1V4R A;  2YX4 A;  4RS8 A;  2O61 A;  1Z6T A;  2RDP A;  1FYM A;  2DFI A;  1E2X A;  4GYI A;  5ICG A;  3DPT A;  3ZPL A;  2MBF A;  4GCV A;  1F1Z A;  4WX9 A;  3BZ6 A;  1ZRC A;  2EV5 A;  3DQV C;  2DBB A;  1R22 A;  2EWN A;  3M8F A;  3GZ5 A;  2QLZ A;  2ZBK A;  1I1G A;  1Q1H A;  3JTG A;  3LQR A;  3HSE A;  1P92 A;  2FBK A;  2A6H F;  1KYW A;  2VE8 A;  1KU7 A;  4NB5 A;  4MTD A;  1LDJ A;  1Z6R A;  1YTY A;  3O6B B;  4N9H A;  1YFH A;  1AOY A;  3OV8 A;  3AAF A;  1ZAO A;  3GYH X;  2GXB A;  1XCB A;  4I09 A;  2MLK A;  2RC4 A;  1J5Y A;  1BM9 A;  3E6B A;  5E18 F;  3C1D A;  1FY7 A;  1YS7 A;  1Z05 A;  4WWC A;  3WE3 A;  1FC3 A;  2W84 A;  2OBP A;  4IXA A;  3CO6 C;  4G6D A;  2OA4 A;  4GGG A;  2L4A A;  3T8R A;  2QQB A;  5A2Q K;  1ZGA A;  5EEG A;  2R7D A;  4CXF A;  3BP8 A;  3FM5 A;  1GXQ A;  1K7A A;  1P4A A;  2CG4 A;  3G3Z A;  4UVB A;  5D4S A;  4MNU A;  1BI0 A;  4AVP A;  1FBS A;  1XCV A;  2QEN A;  2B0L A;  4TV7 A;  2QBY A;  1R23 A;  3PQK A;  4FX0 A;  4ESF A;  4UXN A;  2WC2 A;  1U6G A;  4HV5 A;  2XRO A;  4B09 A;  3F8N A;  1R00 A;  4WF2 A;  4N9I A;  1F9N A;  2NRA C;  3Q9V A;  3WTV C;  4NHJ A;  3KET A;  2NNN A;  2PEX A;  4I2O A;  1MZB A;  1R36 A;  5LHH A;  1T2K A;  3DP7 A;  3R0J A;  2EFP A;  2FBI A;  2TDX A;  1G3S A;  4OIP F;  2GWR A;  1LEA A;  3J80 Z;  5BS6 A;  4EGY A;  2XRN A;  2EV6 A;  1ZG5 A;  3SHF A;  4UNO A;  1DP7 P;  3NEU A;  3L9F A;  4CZZ A;  3D5L A;  1MDM B;  1GXP A;  1CGP A;  3ABT A;  1O3R A;  5CVJ A;  4UVA A;  1BOA A;  2H94 A;  1QO0 D;  3KEQ A;  3T5X A;  1CF7 A;  2PN6 A;  5JR3 A;  2O8X A;  1QPM A;  2H27 A;  2EB7 A;  3DKW A;  3GLX A;  3RKX A;  1J75 A;  2Z33 A;  4L5J A;  4EM2 A;  1FYL A;  1G3Y A;  1H9T A;  5D5V B;  4G7O F;  2PMH A;  4ZYE A;  3HOT A;  1LJ9 A;  4LLN A;  5ICC A;  2DPD A;  2VBY A;  2M1B A;  3N97 A;  1QBJ A;  5ILU A;  2F5D A;  1T0F A;  2VC1 A;  3JTH A;  1EH6 A;  2F2E A;  2R7F A;  3I59 A;  5LRR A;  3GFM A;  3Q9S A;  1XSD A;  3PFI A;  4ENJ A;  3J81 K;  1FP1 D;  3WTZ A;  5FGM A;  3P9I A;  4GXO A;  4S05 A;  5E17 F;  2G7H A;  2F5C A;  2Q2E A;  1P6R A;  1ZG3 A;  4HYE A;  5AON A;  3ERE D;  1K79 A;  2VOO A;  1QZY A;  1DPR A;  2STW A; 
#chains in the Genus database with same CATH topology
 4EV0 A;  3SEQ A;  2Y9Z A;  3PSF A;  3I3L A;  1Y39 A;  2IA1 A;  1C0W A;  2ZKZ A;  5F08 A;  3BG9 A;  2VLA A;  1R4N B;  1U8R A;  2VBW A;  1OR7 A;  4X0G A;  3BDD A;  2LBF A;  2VBZ A;  3QQA A;  2DK5 A;  4G6T B;  4OWR B;  4M6X A;  4AU7 A;  2XAU A;  2J5P A;  4Q4Z F;  2ZSH B;  3LFK A;  5TIS C;  1FIP A;  4BL0 B;  1FOK A;  4OAY A;  4HAM A;  1RI7 A;  5KVR A;  3KCC A;  3VOE A;  3MEX A;  3I54 A;  3OYC A;  3KYL A;  4ESB A;  3LSG A;  4EQQ A;  2G0E A;  1HXD A;  4UUS B;  1LQ1 A;  2KT0 A;  2QA4 I;  4HPQ A;  2ZME A;  1FNN A;  2VL8 A;  1B72 B;  4KMU X;  1RKT A;  4E7Z A;  3VDX A;  3C3W A;  3QU6 A;  2DAO A;  5ICF A;  2R5Y B;  2OZ6 A;  3CCR I;  5LEK A;  1KYZ A;  4F92 B;  1XDS A;  2UXN A;  5A2Q Z;  1N75 A;  3FXO A;  1U9O A;  4EJO A;  2KDO A;  3AFH A;  3TQN A;  3CCU I;  1FWZ A;  1RR8 C;  2DOE A;  1O4X A;  3FXK A;  4W97 A;  1Z21 A;  5EYR A;  2MD0 A;  1T6S A;  1JGG A;  1VQN I;  4CUG A;  3ZMU A;  2FBH A;  1WWX A;  3MVP A;  1X4P A;  5L3C A;  2CFX A;  4HF1 A;  2MH2 A;  3L2U A;  3CMA I;  3D0S A;  3V7S A;  1L3L A;  2XAS A;  4XLP F;  1YS6 A;  4ZTJ A;  3LSJ A;  4EEF G;  3OYL A;  5BOX A;  2GQQ A;  4Y52 J;  3ZMD A;  1DP3 A;  1ZN2 A;  4RLF A;  4HX4 A;  2CO5 A;  3ECH A;  3BTI A;  3GUD A;  1D8J A;  5CQG A;  1KU9 A;  1RUO A;  3ZQH A;  1YJW I;  4FT8 A;  2JT1 A;  3M4O J;  2NVY J;  4BBR J;  2H1K A;  3VPR A;  2V6C A;  3JRD A;  5F6F A;  1R5I D;  3DV8 A;  3OIO A;  3BPV A;  2KIU A;  5K7H A;  2OC6 A;  2ZXJ A;  1FLI A;  1HKS A;  1T38 A;  3Q5F A;  3R60 A;  2Q8K A;  2HQR A;  1FOW A;  2JA2 A;  3CCM I;  2UV1 A;  3RI4 A;  1WI3 A;  1ZHF A;  1XGS A;  2V1D A;  3SZG A;  3A02 A;  3CLO A;  5FB2 A;  2XVC A;  2EA4 A;  1X1C A;  1MJB A;  2WAF A;  2NNY A;  2X48 A;  1YW8 A;  1IUY A;  2E34 A;  2A68 F;  1NG7 A;  3MMY B;  3S3M A;  2O6G E;  3TGN A;  1WJA A;  3IKV A;  1MMA A;  1W7P B;  5LGU A;  1KQ0 A;  3HSR A;  2DDA A;  2L7K A;  5TJJ A;  1NTC A;  2VKD A;  1IRG A;  3MZH A;  4RGR A;  2M9H A;  5H2F C;  1R7J A;  4LFU A;  1GVD A;  1T98 A;  1U8B A;  4RB1 A;  3SQN A;  1FTT A;  3OYD A;  2HOT A;  1V54 H;  2K85 A;  2XDV A;  2VJ4 A;  3E0J B;  3GME A;  3LAP A;  3PJR A;  4XM3 A;  1S7E A;  1UEL B;  2IT0 A;  3ML6 A;  1YJ9 I;  3DKX A;  2OTJ I;  3MCZ A;  4Y7N J;  3DFG A;  4KIG A;  2NVU B;  1H8A C;  3AKZ A;  2VXD A;  4G6Q A;  1K6Y A;  4XKC A;  1K61 A;  4HQM A;  5AIQ A;  1W36 C;  2AO9 A;  2DOD A;  1SMT A;  2RVC A;  5IOY A;  1Z67 A;  2XAQ A;  1LVA A;  4CDG A;  2E2I J;  4C30 A;  1ORK A;  3IUO A;  3J7Y J;  2VON A;  2K3P A;  2VAS A;  4X1E A;  2IS6 A;  4IRI A;  2Y2Z A;  2CQ7 A;  2ID3 A;  1I5Z A;  3KZI C;  3ZOB A;  1HDD C;  3QAH A;  2CW8 A;  3VYT B;  4HX8 A;  5FKK A;  2I5U A;  3K1M A;  4HV6 A;  1V55 H;  2LOO A;  1EH8 A;  1XX5 A;  2GOM A;  1YHQ I;  4KYW A;  2M7A A;  2DCE A;  4C3J J;  3G73 A;  2MC3 A;  1SMY F;  5DCM A;  4NBQ A;  4CSW A;  4EJV A;  3HOV J;  3MKY B;  4KA4 A;  2W1O A;  1EA3 A;  4U7B A;  2KHM A;  1BC8 C;  2GIZ A;  3GLL A;  1LUJ B;  3JSP A;  4E7J A;  1S72 I;  2ESH A;  4BUP A;  3RKY A;  2XKO A;  2DOF A;  2QUF A;  2BOL A;  3BY6 A;  3E97 A;  2P7C B;  1O3S A;  3ZCO A;  2XRL A;  1ETY A;  3F8M A;  2V6E A;  2HVS A;  2ZJQ F;  5C4X J;  4A6D A;  3AG4 H;  3VFZ A;  4IKF A;  2E5N A;  5JHU A;  2ELH A;  2LY9 A;  4RGU A;  4E7S A;  4Y3O A;  1JTX A;  2FA5 A;  3NRV A;  4G7H F;  3TW6 A;  3C7J A;  5BPI A;  3SXY A;  4DYQ A;  1YIT I;  1I6H J;  2RRE A;  3BR3 A;  4II3 A;  5DCF A;  3F6O A;  1PUE E;  1A6I A;  3QYF A;  3DLL F;  5D4R A;  4P96 A;  4P55 A;  4XSZ F;  4DNC A;  1XSX A;  3HRU A;  5ICE A;  3EUA A;  3FXQ A;  2PJP A;  2R7X A;  2BE5 F;  1TWF J;  2DT7 B;  4XRF A;  2JA6 J;  5F0F A;  3I71 A;  3ULQ B;  2EZK A;  2C6Y A;  4BQN A;  5IYC J;  2EIK H;  1STZ A;  2QVO A;  2R5Y A;  2V9K A;  4G8X A;  3LL7 A;  1ZLJ A;  2Q1Z B;  4H4K C;  3HOY J;  3S14 J;  2CUJ A;  2VOP A;  3IH3 A;  5CVI A;  5DV5 A;  3J80 K;  4HST A;  4I76 A;  1K4T A;  2M3A A;  3CD6 I;  1FBQ A;  2M2E A;  2ZJP F;  2BBY A;  4I01 A;  3FXU A;  4RGS A;  1TT0 A;  1YIJ I;  3VYS B;  4YG2 F;  2HU9 A;  5JVG F;  3SDG A;  3HGG A;  3TBI A;  4ESJ A;  1D3Y A;  2NVQ J;  5D8L B;  3F3X A;  4I7H A;  4PSW A;  1JHH A;  3R4K A;  1I3A A;  4UUV A;  1KA8 A;  1VQK I;  3SFI A;  4L0Y B;  1POG A;  4NQW A;  3LSM A;  3AL0 C;  3IH2 A;  1JJ8 C;  3IWZ A;  1MBH A;  3RQ4 A;  1X1B A;  2MYS A;  3I0T A;  5EDN A;  5EG0 B;  1ZLK A;  1GVJ A;  1GV2 A;  2N8G A;  2VN2 A;  1QVT A;  5CLS A;  3V8K A;  2E1M B;  5J3L A;  4G12 A;  4BXF A;  2JVH A;  4BHP A;  2GM4 A;  1UCR A;  4NUB A;  4ZC3 A;  3AL0 B;  1ERD A;  1MMN A;  2DMP A;  4CCJ A;  1CF7 B;  3WE2 A;  3S1N J;  3OIQ A;  2OZU A;  1S9H A;  1Y56 A;  2DFH A;  3ZQC A;  1MMS A;  4XKV A;  2CRG A;  1W7P D;  1ZRE A;  5HDN A;  2DK8 A;  2BYV E;  3TO9 A;  4JX4 A;  3RSN A;  4QPQ A;  3K4N A;  4C3H J;  3WOD F;  2FNA A;  3BPX A;  1FPQ A;  3OSF A;  1MW7 A;  2Z1D A;  4V2G A;  1BI3 A;  3CUQ A;  3H5R A;  3J7A Y;  1G3W A;  2EJR A;  3JCU C;  4GRI A;  4FAS D;  1MMD A;  5DUK A;  3CZ6 A;  5HDK A;  5C44 J;  1T08 B;  2RGV A;  2AXL A;  5HLI A;  2A6E F;  2CJJ A;  5JLX A;  5BMZ A;  2NOG A;  4L9J A;  4W1U A;  2XF7 A;  1A36 A;  3TOA A;  2XAG A;  2E2H J;  3BWG A;  4OIO F;  1HW5 A;  3OMY A;  3H3Z A;  4IEJ A;  1USS A;  3TKY A;  1WHU A;  4UUS A;  1XC5 A;  1S6L A;  2F48 A;  1YE9 A;  5FJ8 J;  2W48 A;  3GZN B;  3BT9 A;  2QQA A;  3HG9 A;  4J19 A;  1FSE A;  2XHK A;  2ZB9 A;  1BW5 A;  2TRT A;  4YEL A;  3HOW J;  1E0E A;  2EZI A;  1WPK A;  2JRM A;  3HRM A;  3FF5 A;  1ON2 A;  4ANJ A;  2E71 A;  5GP9 A;  4HF0 A;  1I27 A;  1S3J A;  2MLG A;  4QTR A;  4F52 A;  4EGZ A;  5HS7 A;  4WCG A;  2GIV A;  2IXS A;  2EFN A;  4MO7 A;  2IGM A;  2VJ5 A;  4UB6 C;  4XBF A;  4CIC A;  2CFO A;  4UHT A;  1K78 B;  2RNG A;  1ZH5 A;  2UZK A;  3VSK A;  3H92 A;  3A1Y A;  3PNV A;  2W7N A;  2H09 A;  3FKJ A;  3LSH A;  3OR1 C;  3SZT A;  2WWY A;  1N77 A;  3JRI A;  4A3E J;  2VB6 A;  1L0O C;  4L9T A;  2CV2 A;  5FLX K;  3WTX C;  2XF5 A;  3KP2 A;  4L0Z B;  2WAQ N;  5J4Y A;  2P6T A;  1LNW A;  3HUG A;  4DGW B;  1TW3 A;  2JN6 A;  3K4B A;  1S5L C;  2Y0M A;  3VEP A;  1JKO C;  4FET A;  3Q0V A;  2IBD A;  2R7Q A;  3Q0W A;  4KT5 C;  5DM6 F;  4J00 A;  3NAR A;  3PQJ A;  1DDN A;  2QF7 A;  2IJL A;  3QWL A;  4R79 A;  3WTY C;  3QPT A;  1SFU A;  1TQM A;  1G2H A;  2FRH A;  1WJB A;  4FX4 A;  5LEJ A;  4XSX F;  1OFC X;  3UNG C;  1J59 A;  4DZJ A;  3REO A;  2DT6 A;  2QZ8 A;  5IT3 A;  3SJM A;  3WGI A;  3L2W A;  1LB2 A;  4CGZ A;  3PNT A;  1U2W A;  4KIS A;  3H9J A;  2XAJ A;  1B72 A;  3ZP5 A;  2X6O A;  1V3F A;  2KFD A;  2WAE A;  1IXC A;  3LWF A;  1VFC A;  4O6J A;  3L2V A;  1IV6 A;  4XRM A;  2B9S A;  1FYK A;  1R1U A;  3KP7 A;  1O3T A;  5EZG A;  4YFK F;  3IRR A;  3F21 A;  1LDD A;  4NC6 A;  1IRF A;  2HTJ A;  2QM3 A;  4DBR A;  1WQ2 A;  2QBY B;  2LBF B;  1BOB A;  1W5S A;  4HOB A;  4XLE A;  2OPT A;  3LMM A;  3I64 A;  2CW0 F;  3LST A;  5E79 C;  4LG0 B;  1ZGW A;  1KON A;  1SFX A;  4BYY A;  2X51 A;  1G3T A;  1V5F A;  2ZME C;  4BGD A;  3D1N I;  2WV1 A;  3L7W A;  2FD5 A;  3CTA A;  1GV5 A;  2HYJ A;  2DQR A;  1IN6 A;  3DEU A;  2EV0 A;  3W6V A;  4Z2Y A;  3H5N A;  2KIS A;  5J1U A;  2E7X A;  4EAT A;  3ZN0 A;  3QP5 A;  1O57 A;  4BHC A;  3CES A;  4HF2 A;  5L3E A;  4MTE A;  1HSJ A;  3PM1 A;  3OYB A;  4D9J A;  1WRJ A;  4E70 A;  2M30 A;  3MZY A;  1B1B A;  3HTS B;  5J8C A;  2XGD A;  3K4K A;  1TNT A;  1D0X A;  4R1H A;  1MSF C;  5EGO B;  2QQ8 A;  3IAS 2;  1UAA A;  4P9F A;  1X58 A;  2VBX A;  2DTR A;  5CJ9 A;  3C18 A;  1MDM A;  3EUH A;  3WTT C;  2K86 A;  5D6E A;  4ENN A;  5JI6 A;  3F72 A;  4XKW A;  3IHU A;  1KU2 A;  2ZNY A;  3KIO A;  2M8E A;  5F27 A;  3RKQ A;  4XIC A;  1UHW A;  2D1H A;  4FCY A;  1HKT A;  4CYC A;  2R7S A;  2KRF A;  3ISP A;  2ESN A;  3ABK H;  5L3F A;  1H9G A;  2A61 A;  3AG1 H;  3ABL H;  4S0H B;  1TTY A;  4CZC A;  3CJN A;  4JK1 X;  1VQ5 I;  2OQG A;  2VXZ A;  3DTE A;  4PGH A;  3TO7 A;  1MMG A;  2FML A;  1IV8 A;  2DQL A;  2EZL A;  3IH4 A;  3P7N A;  3BG6 A;  3CDI A;  4IQ4 A;  2Z2S B;  3PFY A;  5E3O A;  3BG5 A;  2K9L A;  4BKX A;  1JGS A;  2VOD A;  1JUP A;  2P5V A;  3CO7 C;  1MJA A;  3K0L A;  3EET A;  3RYR A;  2L7M P;  3R0A A;  3V8J A;  2Y75 A;  5J47 A;  1Y8Q B;  3BOQ A;  1B8I A;  3W2A A;  4YII A;  1SC7 A;  5GPA A;  2PX9 A;  2D2W A;  4C2T A;  1IXS B;  2K40 A;  3HJE A;  3ABU A;  1OPC A;  2HZD A;  3EYI A;  4UV9 A;  3H35 A;  1YQA A;  2DJN A;  4KJZ A;  5TRD A;  1T8I A;  1IN5 A;  2HR3 A;  3W2V A;  1LE8 A;  3KP6 A;  2ADU A;  2HNH A;  1QQI A;  2R3S A;  2VE9 A;  2A3S A;  3B02 A;  3PIP F;  3DF8 A;  3I58 A;  4V2F A;  3OYI A;  4M72 A;  3S16 J;  2JUG A;  4KN7 X;  1BJZ A;  3LQQ A;  4B1R A;  3DPL C;  4JOM A;  1JUM A;  3RCO A;  2ZXI A;  1BC7 C;  2IEK A;  3KZZ A;  4UVC A;  4BDY A;  1KQ9 A;  1ETW A;  1R6R A;  2JPB A;  2X1C A;  1OYW A;  1W4M A;  2BEO A;  1UFM A;  3OR2 C;  3IC7 A;  1QNT A;  3A01 A;  2ME0 A;  2F6C A;  1BR1 A;  1VND A;  1S7A A;  4NNJ A;  4XR6 A;  1DGW Y;  3BCB A;  2WAD A;  4ZZD A;  5DS9 A;  4P5O A;  1RNL A;  3GW2 A;  5HNH A;  2E1N A;  2FJ1 A;  2JMW A;  1SVL A;  2LRE A;  1IF1 A;  3M9A A;  3EUH C;  4BY7 J;  1K4S A;  1AWC A;  4U0V A;  2JA5 J;  5DD8 A;  1R1T A;  4XOT A;  2KJC A;  1D1C A;  2FSW A;  3W6K B;  4QWQ A;  3R6S A;  2ELJ A;  5HS8 A;  1RES A;  5L3D A;  1BI1 A;  5E1X A;  3X2Q H;  1DQU A;  3H1C A;  2HYF A;  3G6E I;  1PDN C;  1G4D A;  1X1A A;  2W4S A;  1BJA A;  3KLN A;  4AYB N;  4AVZ A;  2CQQ A;  1R49 A;  1YG2 A;  2Y9Y A;  5GTH C;  2FX0 A;  2R7T A;  3SEZ A;  3FXR A;  2ETH A;  1IZ1 A;  3W6J B;  5DD4 A;  5M3F J;  1VQ7 I;  2NOJ B;  1MH3 A;  2GAU A;  4GO1 A;  3K4M A;  3RQI A;  1QU3 A;  4UUT A;  1OIS A;  3BTL A;  4A0Y A;  2OF7 A;  3V42 A;  4RLQ A;  2A69 F;  2O9L A;  2R93 J;  1O7L A;  1I6X A;  4CYC B;  5E3N A;  5HLH A;  3TOB A;  1FP2 A;  5IYB J;  3SZP A;  2KPM A;  2LMD A;  2H8W A;  4LIV A;  3WU1 B;  3S3O A;  3PUF A;  3U1K A;  3M07 A;  3S2W A;  2VPL A;  1T95 A;  2ECB A;  2P8T A;  4UY8 I;  2EQR A;  4Q48 A;  5J6X A;  4I0B A;  1I1S A;  2XKP A;  1OCR H;  3BR2 A;  3OYM A;  3UKG A;  1XMA A;  1Y1V J;  3ECO A;  1FSH A;  2ZCW A;  1FJL A;  1FZP B;  4D0P A;  2ID6 A;  1A6Q A;  4QPO A;  1JKP C;  2EK5 A;  1OCP A;  4H0E A;  2CYY A;  1E3H A;  3BRO A;  1TNS A;  5GAH J;  2X1D A;  3OYA A;  4QLC U;  1ZR4 A;  2H6C A;  1P4W A;  4M71 A;  3RTR A;  1MH4 A;  2OQR A;  3CCV I;  2MAB A;  2PLY A;  3JRA A;  3HEF A;  2PMZ N;  5J1R A;  1JKR C;  2K9S A;  3LAJ A;  2XPU A;  3BC8 A;  4HLY A;  2VC0 A;  5L3B A;  2BHZ A;  2YPR A;  2BY3 A;  2F4O B;  2TCT A;  3HYI A;  3KEO A;  2HFH A;  2RKH A;  4MEX F;  1HQC A;  2JPC A;  4LG0 A;  1J0R A;  3GTQ J;  1HW2 A;  1H89 C;  1YLF A;  1HC8 A;  1HF0 A;  2DXI A;  3CC4 I;  1UST A;  2IW5 A;  2PFB A;  2IRF G;  1V5G A;  3SFZ A;  2VQC A;  4R8H A;  5AIP A;  4B8X A;  4OMZ A;  1SAU A;  4OU0 A;  1FMV A;  3QP6 A;  4CHU A;  2UXX A;  2D5V A;  1LFP A;  2FQ3 A;  5FD5 A;  1QA6 A;  4A93 J;  4J01 A;  1OYY A;  4D5C A;  3OYH A;  3O8G A;  3H0D A;  3CMY A;  1B9M A;  2O3F A;  1Z7L A;  2KJB A;  1Z0X A;  4IF4 A;  4A3B J;  3IKT A;  1XGO A;  3GFJ A;  3I5U A;  3F8C A;  1XB4 A;  1P2F A;  4MEY F;  5ILV A;  3TDU C;  5D5U B;  4XOR A;  4ZYG A;  4OIR F;  2Z5U A;  4G9Y A;  2JRT A;  1RUN A;  2EFO A;  5D5W B;  4U0Y A;  4CCM A;  1SD4 A;  1W1W E;  3C2H A;  4P1W A;  3K10 A;  4M74 A;  5K1Y A;  1ZYR F;  2DA6 A;  1IDZ A;  3K4J A;  4L9N A;  1F5T A;  4A6E A;  5ED4 A;  3GTG J;  3KYC B;  1B4A A;  3CC7 I;  1OYI A;  1R5H A;  3LFU A;  2M87 A;  2CUF A;  1YW7 A;  4QIW N;  5EZH A;  1P7J A;  2F4I A;  3KFW X;  5L3G A;  2VIX A;  2VJI A;  3JRE A;  2ICW G;  4A2U A;  1WJF A;  1R71 A;  2QSG X;  4LLG F;  4CCK A;  5LFA A;  3ZQQ A;  1MNE A;  4MIM A;  2V9V A;  4RAZ A;  2ZJR F;  2LF8 A;  3G4S I;  2IVM A;  4MGR A;  3CQZ J;  1JJ6 C;  1RZ4 A;  1IN8 A;  4AIK A;  1JKQ C;  4D5F A;  1YO5 C;  5FLV A;  1MGT A;  4RGX A;  3L00 A;  3AG2 H;  3BCA A;  3FM3 A;  2LYC A;  4FTH A;  2P5L C;  1HDP A;  1R1V A;  2MGQ A;  2KRH A;  1YW9 A;  3IRQ A;  1J9I A;  2NYX A;  4HRI A;  3RPU D;  2P0W A;  6PAX A;  1Y6I A;  3FMR A;  4A3G J;  1IN4 A;  2EIL H;  3K2A A;  3H36 A;  3DU5 A;  4Z6Y A;  5DEQ A;  3CCE I;  3RZO J;  3S15 J;  2MFZ A;  4NDL A;  4OOI A;  1GT0 C;  3FIS A;  1S29 A;  1VQ4 I;  3CJT B;  1SVM A;  2EIJ H;  1AHD P;  1SD5 A;  2VKE A;  1M1E B;  2V1X A;  2YSR A;  3V4G A;  3GX4 X;  3B6A A;  1EJ9 A;  5HOO A;  2D1V A;  2LH9 A;  2WB1 A;  3TP0 A;  1MND A;  4FQG A;  2L7Z A;  3QRF F;  5BPD A;  3NAU A;  1OCO H;  2PBI A;  1E3O C;  4XMY A;  3COA C;  2AS5 F;  4I02 A;  1YRN A;  4OIQ F;  2XUB A;  2K5C A;  2Z99 A;  4KIC A;  1UB9 A;  3HOX J;  3PIO F;  1KU3 A;  1UG2 A;  4A3M J;  3QOE A;  4LK1 F;  2DMT A;  1IRZ A;  2HYG D;  2MSY A;  1SFK A;  3JAM K;  2NVX J;  4BAC A;  5E20 A;  3A01 B;  2X6W A;  3DBH B;  3CUQ B;  2VQL A;  5HLT A;  5BNG A;  4S04 A;  2FMY A;  4A12 A;  5B66 C;  1U5T A;  1MKM A;  4A5M A;  4U87 A;  2QSH X;  1F43 A;  1TC3 C;  3MN2 A;  4KFC A;  1XG1 A;  3F8B A;  1AU7 A;  4PK4 A;  3LA3 A;  4PJM A;  3GZ6 A;  5DDG A;  1Z91 A;  1EH7 A;  5CQE A;  1SFO J;  2KKO A;  4GDF A;  3ZN1 A;  3FZV A;  3HDD A;  4A0X A;  2STT A;  1IDY A;  1SAX A;  1BIA A;  1MD0 A;  2WTE A;  2X1E A;  3FMQ A;  1XTA A;  4U7D A;  4LOC A;  3QOP A;  4IRH A;  4A3J J;  4KIB A;  3DEW A;  1NK2 P;  5H6Q A;  3VYR B;  2LVS A;  2FOW A;  2XB0 X;  3IP4 B;  2V79 A;  2OTL I;  2HQN A;  3BQY A;  1RIO H;  1IW7 F;  3EYY A;  5J1Y A;  1HA8 A;  4PJL A;  4AYB A;  1ETV A;  3KEY A;  3GFI A;  1TT5 B;  2E60 A;  2XB5 A;  2PMU A;  4BH9 A;  4OIN F;  2NXN B;  4ZYA A;  1OCT C;  4IJA A;  2XF6 A;  4B3X A;  1NHA A;  2KIM A;  1J2X A;  2VT2 A;  2G7U A;  2HXO A;  4EM0 B;  3W3C A;  4XLA A;  1PJR A;  2Y69 H;  4NC8 A;  4O3M A;  2FNP A;  1PP7 U;  3EPZ A;  3A0H C;  3L1P A;  2JZY A;  2ZSI B;  1SD6 A;  2BW3 A;  1LEB A;  2KIF A;  2ME6 A;  1MBK A;  1D8K A;  3M1E A;  5HOD A;  3I9V 2;  2KRC A;  4IHY A;  4GFB A;  2VKV A;  3DXJ F;  1WSU A;  2JSC A;  4E6K G;  2HKO A;  4YIF A;  2WV0 A;  4FHT A;  1ODD A;  5LLQ A;  1IJW C;  2KZG A;  2VJJ A;  3GTP J;  2VT3 A;  2HEO A;  1OCC H;  2CV0 A;  2H8R A;  1Q1V A;  2H6B A;  1IN7 A;  4BXU A;  1OKR A;  2AHQ A;  2ISZ A;  2V4J C;  3DTI A;  4P9U A;  4X6A J;  3EUK L;  1BW6 A;  3QYB A;  5F1J A;  1RC9 A;  4A3D J;  2OD5 A;  4Y15 A;  2A07 F;  5FLX Z;  2PI0 A;  4IHT A;  3HL2 A;  2L3D A;  1TLH B;  3FHZ A;  1A35 A;  4M6Y A;  4ZDO A;  1P4X A;  1VI0 A;  4BNC A;  3CUO A;  3U9G A;  3DEE A;  4HW0 A;  3QPL A;  2DTZ A;  1S7O A;  2X85 A;  5ERI A;  1ENH A;  2HKX A;  4NQW B;  4BE1 A;  2MC4 A;  4HDU A;  4BE0 A;  5M5X J;  3S17 J;  5FFX A;  3HM5 A;  1WJ5 A;  2GA2 A;  1G8X A;  1IGN A;  2DPU A;  2DMN A;  4HX7 A;  5C4J J;  1DUX C;  3CCL I;  5DUI A;  4LGW A;  3E6D A;  2L9R A;  1VZ0 A;  2DMU A;  1ETX A;  4DJA A;  2IGO A;  1SD7 A;  1YOV B;  2M0M A;  5LRS A;  5DTD A;  2RQP A;  4IHW A;  1JI8 A;  4KIF A;  1ACI A;  3PSI A;  4RM2 A;  1R5G A;  1ZK8 A;  4BQO A;  3CMM A;  5DM7 F;  1HBX G;  3HXL A;  3MD2 A;  2R0Q C;  2J5O A;  5F64 A;  3A0B C;  2E2J J;  2DA5 A;  2CU7 A;  1IAW A;  1H0M A;  2COM A;  2R92 J;  3NWT A;  2EA2 A;  3HOS A;  3IL2 A;  2IS4 A;  2HOA A;  2K02 A;  5D8K B;  2DO7 A;  5HS9 A;  3ASN H;  5FLM J;  2XGE A;  3RJP A;  5J8F A;  2Q0O A;  4UB8 C;  1FIA A;  1KGS A;  1BIB A;  2CSO A;  3BG7 A;  3WTU C;  1MNM C;  4KN4 X;  3C2G A;  3LA2 A;  3E6M A;  1NK3 P;  2OU2 A;  3F8F A;  5LGN A;  1HCR A;  3CDH A;  4KDP A;  3UR3 C;  1IC8 A;  1TBX A;  2P5K A;  2JWT A;  4EJT A;  2RAE A;  1LVK A;  1W7P A;  3DBR B;  4BQA A;  2DW4 A;  5E1W A;  3FKI J;  2DU9 A;  1W0T A;  3ZQF A;  3ZQI A;  4ZZL A;  1LDK B;  3WU2 C;  2R7U A;  4RMN A;  5GAE J;  2LG4 A;  2JA8 J;  3TED A;  3OOU A;  4ZDL A;  2EIM H;  3LA7 A;  2RN7 A;  1WI9 A;  2ZNZ A;  4RA2 A;  1U78 A;  4FE4 A;  1MBJ A;  4A3L J;  2K4J A;  3H0G J;  4NC7 A;  2BHY A;  3OS2 A;  4L9V A;  2B63 J;  3PUB A;  2L4M A;  5DCM B;  3WGH A;  3M1C A;  3L2R A;  2GLO A;  2OAZ A;  1K78 A;  3IWF A;  2MW8 A;  3E7L A;  1FBU A;  3IV5 A;  1YI2 I;  3CME I;  2FQ4 A;  3L2C A;  3KP4 A;  2BGC A;  5FFZ A;  3W2W A;  4CO8 A;  2ZXH A;  2ZFU A;  2QKM B;  3E5U A;  4F7Z A;  2AXT C;  5IP9 J;  5E8I A;  4B3A A;  2KL4 A;  4A3C J;  1EV7 A;  1K83 J;  4G7Z F;  1K6O A;  1X2N A;  2BVM A;  1N25 A;  1Y0U A;  4IRG A;  1J09 A;  4LMY A;  3HOU J;  4N4O B;  4IVN A;  2LR8 A;  3GXO A;  3RYP A;  1PP8 F;  4GYG A;  1ZAR A;  1FEX A;  5EJC A;  1Y0N A;  1XDU A;  4AWX B;  5JHF A;  5FO5 A;  3DCF A;  4D7M A;  2IS1 A;  1T56 A;  2EBI A;  3G1L A;  1IXR C;  1GLN A;  1FT9 A;  2F5E A;  2L9S A;  4FE7 A;  2O03 A;  3MKL A;  3GTK J;  3OYN A;  2O0Y A;  3OYE A;  1OMI A;  2HOS A;  5IY5 H;  5E3M A;  3WTW C;  1XSV A;  1YJN I;  4K2E A;  3R61 A;  2E7W A;  3BLY A;  3QU3 A;  1OCZ H;  1Z3Y A;  4BU2 A;  2ZME B;  4LD5 A;  1ZG1 A;  3DU6 A;  3T0Y A;  3BJA A;  1UHM A;  2IP2 A;  2PQ8 A;  1FOY A;  3S1M J;  2FE3 A;  1NH3 A;  1Z7U A;  2KMU A;  1DPU A;  1GHC A;  3BG3 A;  2I8D A;  2HQ5 A;  2RNJ A;  3OYG A;  1MIJ A;  2IAI A;  2K3F A;  2ZFW A;  2P4W A;  3WGG A;  1KZH A;  5EEH A;  1ZEL A;  5K7F A;  3ASO H;  1WKM A;  2HDW A;  3S93 A;  3HC7 A;  4M73 A;  1B6A A;  4AID A;  2W25 A;  1YIO A;  4C2U A;  3E1S A;  2GOX B;  3BTC A;  3GEZ A;  2E35 A;  5ILS A;  2LNB A;  1XD7 A;  3G1M A;  1V5E A;  2HI3 A;  3CF5 F;  4HDV A;  1QRY A;  4XN0 A;  1YX5 A;  4I0A A;  2NS7 A;  2W82 A;  3FX3 A;  4XN3 A;  2FEZ A;  1AA7 A;  3BR1 A;  4CCN A;  3MKZ A;  2LKX A;  2XPV A;  1T33 A;  1NG6 A;  2IA2 A;  2K9N A;  4DQ2 A;  5FD6 A;  3V8L A;  5IOZ A;  2K4B A;  2XGX A;  4Y17 A;  3CUQ C;  4HNV A;  3F23 A;  1AKH B;  3CC2 I;  1SFE A;  2M45 A;  1KQ8 A;  3I55 I;  5B5E C;  2KZV A;  3E6C C;  3OY9 A;  5LGT A;  3WG9 A;  5B3S H;  3GO5 A;  3CCJ I;  3EDP A;  2E5Z A;  1XS9 A;  2EFQ A;  5LHG A;  2Y0S A;  2DA3 A;  4JBA A;  1XN7 A;  3B73 A;  1R58 A;  2GZW A;  5GAG J;  5HDG A;  2ZC2 A;  3HZJ A;  4L18 B;  4XK4 A;  2ELK A;  5F0C A;  2DDB A;  2NAZ A;  3RPU A;  2DFE A;  4HNT A;  4IHS A;  2DI3 A;  1D0Y A;  5LBQ A;  4BE2 A;  3JW4 A;  1F4K A;  1Y8R B;  1X3Z B;  4M9X A;  2A05 A;  3O8H A;  5CVU A;  1IO2 A;  2M8G X;  1X1P A;  2L9V A;  1FX7 A;  3KYD B;  4CCO A;  4A69 C;  2P6S A;  1ZRD A;  4XNF A;  3ZMT A;  3T1B A;  4JQF A;  2FOK A;  2GA1 A;  2QEX I;  3I53 A;  4AUX A;  2A5Y B;  2CUE A;  3OS0 A;  3JRH A;  4N4N B;  1JE8 A;  4IHV A;  1VQ9 I;  3P9K A;  3Q0U A;  3PL8 A;  4BS9 A;  3ONQ A;  3MFK A;  3I4M J;  2L0K A;  4DYC A;  2LFB A;  2XAH A;  1WVR A;  2QYO A;  3GF2 A;  2E19 A;  4A3F J;  1ZR2 A;  3HHH A;  3ZXS A;  4EM1 A;  3CP8 A;  3QOD A;  4I98 B;  1TW2 A;  1I3Q J;  2IS2 A;  2ZXW H;  3U21 A;  1T0F C;  2X4H A;  5K5R A;  1XGN A;  2YS9 A;  3S8P A;  2KDZ A;  4Y13 A;  2R4G A;  1W5C C;  3K4C A;  3M8E A;  1F36 A;  1JXS A;  4PJJ A;  1UJ8 A;  3G1O A;  3A4C A;  5LHI A;  3U1D A;  3A03 A;  3VB2 A;  3K4L A;  2PG4 A;  4PDK A;  4RM3 A;  1OJL A;  4HZF A;  1WJD A;  1TWH J;  4YEJ A;  2OCC H;  2Q2E B;  2WY7 Q;  4UV8 A;  4M3E A;  3HIF A;  3C2B A;  1WFX A;  2XV4 S;  2K9M A;  1FMW A;  2W24 A;  1WCM J;  1LPQ A;  3CCY A;  3E5Q A;  3ZMS A;  1DU6 A;  4PGG A;  4M6V A;  3NQO A;  4L5E A;  3KP5 A;  5CVR A;  1XPX A;  4BJ5 C;  2NS0 A;  2HGC A;  3S3N A;  2VUM J;  4E7K A;  2XAF A;  1BBY A;  4U0W A;  3FWE A;  4EJU A;  3D5R C;  4B47 A;  2KQR A;  5JFR A;  3K7A J;  2X9D A;  2GXG A;  5EEA A;  1BR4 A;  3RZD J;  2IA0 A;  2L5Q A;  3BJO A;  1VQ6 I;  5H20 A;  2X0L A;  2V26 A;  2LKP A;  2YU9 J;  3M7G A;  4IOA F;  4L5I A;  4OMY A;  5BQT A;  1D5Y A;  3U2R A;  2VKH A;  3TO6 A;  5IT9 Z;  3ZMZ A;  5F1R A;  4PZJ A;  3DWL E;  1B9N A;  3FMS A;  4YRV A;  2L7F P;  1EF4 A;  2YR2 A;  2Z9O A;  1UHS A;  2VQH A;  4RAG A;  1O3Q A;  1Z1D A;  3O3K A;  1OR7 C;  2Y30 A;  2JK3 A;  1ITY A;  3ZQ7 A;  1Z3X A;  2AQF A;  1TWC J;  1PYV A;  3F0C A;  2DYR H;  2YX7 A;  2V1N A;  3MKW B;  3FXJ A;  4WXC A;  4ENM A;  4WK8 F;  1E17 A;  1TQP A;  4MQ9 F;  4F3Q A;  1QZZ A;  4IZZ A;  3RDI A;  1TWA J;  1ON1 A;  4ZDP A;  2RV8 A;  1A04 A;  2V9P A;  3GVA A;  3PNY A;  5K5Q A;  2R5Z A;  4XRS A;  2MH9 A;  3IAM 2;  4AIJ A;  4OAZ A;  2CQK A;  2LSO A;  2BY1 A;  3DBL B;  2FU4 A;  1Z9C A;  4PFP A;  2P7V B;  2LY1 A;  3AG3 H;  1IUF A;  5HLG A;  3E3V A;  3P5J A;  2A5W A;  4G94 A;  4KNY A;  3GTO J;  1DU0 A;  1XGM A;  2W57 A;  4O5V A;  2QCO A;  2BV6 A;  2DT5 A;  1VQL I;  5CVV A;  2F5F A;  4YFN F;  1U5T B;  2Z3Y A;  4DIQ A;  1RR7 A;  2XIG A;  5E1Z B;  1LFB A;  1WJC A;  2MA3 A;  2HWV A;  4B4C A;  1VTN C;  2F5V A;  3GTL J;  3QYE A;  2DMQ A;  4KMF A;  3G2B A;  2M4G A;  2X6X A;  4LB5 A;  3RIR A;  1SEU A;  3LOC A;  2CV1 A;  1GDT A;  1YRN B;  3HHG A;  1PVE A;  2HDC A;  3M3Y J;  3HB9 A;  4PUS A;  2CMP A;  1DGR M;  2UWM A;  1U5T C;  3LSR A;  1BI2 A;  3RPQ A;  5E3L A;  3KZY A;  3V7C A;  3ELK A;  2KP6 A;  1G59 A;  1ONV A;  4M9S A;  3KPH A;  2CWE A;  4LJZ F;  4DZP A;  3KE2 A;  5J40 A;  3K1N A;  4MFD A;  5B1A H;  4AD9 A;  5IPA A;  3DLA A;  1D5V A;  3K1P A;  2B7E A;  2HVR A;  1REP C;  4ASN A;  5KK1 A;  4RB0 A;  1ETO A;  4A3K J;  1JUS A;  3HBL A;  2MD5 A;  5B1B H;  1W36 D;  3TDZ C;  3OL3 A;  3S2H J;  3SDB A;  1U0J A;  2K27 A;  2V7F A;  3K9T A;  1XMK A;  2FF4 A;  1ZKG A;  2QWW A;  3OL4 A;  3OS1 A;  2L01 A;  2WY8 Q;  4Q5S F;  2GXA A;  3H9G A;  2L54 A;  3K2Z A;  2CGP A;  1W5T A;  5DYM A;  4EMS A;  4BBS J;  3B6C A;  2Y0S N;  1B59 A;  4A3I J;  3S32 A;  3VOD A;  4E4H A;  4RDU A;  2ZJ2 A;  3QPS A;  4MFE A;  4ZYH A;  1A5J A;  2Y48 A;  2YUS A;  2ISY A;  3FXM A;  1IRX A;  3FK7 A;  3ROU A;  1X3U A;  5D5X B;  1E3P A;  4ETS A;  1ZGJ A;  2DYS H;  2HDD A;  2HS5 A;  4EVI A;  4N0B A;  3RKW A;  2A6T A;  3ABM H;  4JX5 A;  2Y31 A;  3O2P E;  3A2K A;  3I59 B;  5J4V A;  2Z16 A;  1HKQ A;  3GWZ A;  1U3E M;  2EFW A;  1YYV A;  4YIR X;  1J7K A;  2CQX A;  2FUG 2;  4CCL A;  2P81 A;  1SAN A;  3KP3 A;  2BW3 B;  3HRS A;  4HA8 A;  4BEH B;  1HST A;  3P9C A;  3MQ0 A;  1T39 A;  4IPA A;  1P7I A;  3I4N J;  1VF9 A;  4YFX F;  4A0Z A;  3T8T A;  3JRC A;  2LK2 A;  3FIW A;  5C3E J;  1D1A A;  2O8K A;  3L09 A;  4KUM A;  4ENK A;  4RB2 C;  2DLL A;  4IQJ A;  4PCQ A;  3BZC A;  1MJ9 A;  2ACJ A;  5E8G A;  3V7R A;  1CQT A;  2UUZ A;  5JLW A;  5KCM A;  3GFL A;  2DA4 A;  3N05 A;  3H3U A;  4IL6 C;  1H88 C;  1FTZ A;  3HPG A;  2EPF A;  4LK0 F;  4M9Z A;  3TP3 A;  1WH5 A;  3HTU A;  4CH7 A;  4ZH4 F;  2M7B A;  4XLN F;  1ZRF A;  3BQZ A;  2WAQ A;  5K5O A;  2BZT A;  5CPR B;  3GCM A;  4D7N A;  4XL9 A;  2IPQ X;  3WHC A;  1QPI A;  3OOP A;  3J81 Z;  4MHG A;  1S8N A;  1HW1 A;  3LSK A;  4XID A;  2QQ9 A;  5HVQ C;  2L02 A;  1ETQ A;  4BXX J;  1ULY A;  2E36 A;  3MWM A;  3MZ8 A;  1X19 A;  2EZH A;  3QPH A;  4BHB A;  1N78 A;  1TZL A;  4XON A;  3NWS A;  5IT9 K;  2X6Y A;  3GTM J;  2W85 A;  2YU3 A;  3EQL F;  2HPM A;  4ZYD A;  4DBQ A;  1U9N A;  1QGP A;  4HG2 A;  4LB6 B;  4ON0 A;  3K69 A;  5GPC A;  4MQV A;  3ERM A;  4M3D A;  2JTV A;  4HBL A;  3JSO A;  4WXH A;  4JP0 A;  1LFU P;  3N4M A;  2XSD C;  2HQA A;  2PJR A;  2RQQ A;  3J7A O;  2HZT A;  3I4P A;  4C2M J;  1O7F A;  2KLO A;  4HLX A;  3CF2 A;  4XRS G;  1BN5 A;  3WU0 A;  3WG7 H;  2AQE A;  4IO9 F;  3F6V A;  2L9N A;  1PUF B;  4AIH A;  4EJW A;  2ZO4 A;  2K7L A;  2D45 A;  1R9T J;  2MG4 A;  3I56 I;  3L2Q A;  4U88 A;  4AC0 A;  1TQI A;  3KLO A;  3JAM Z;  4M3B A;  2LF7 A;  2HOE A;  2M4K A;  4PSX A;  5H6R A;  2JJ7 A;  2OCE A;  4F55 A;  2CH0 A;  3BR5 A;  3ZQG A;  3BJ6 A;  3F22 A;  4HQE A;  5F04 A;  3HSF A;  2W00 A;  2M5W A;  3ZMV A;  4BY1 J;  4RAY A;  4XLF A;  4RB3 C;  2G9W A;  5D6F A;  1JHF A;  3OYF A;  3Q3S A;  1G6N A;  4II2 A;  4WXD A;  3FXL A;  4IHX A;  4CA0 A;  5CYV A;  3WTS C;  1W0U A;  1BR2 A;  4KT6 A;  1OQY A;  4LLL A;  5JVT A;  2I10 A;  2ECC A;  2E1C A;  3S2D J;  3PO2 J;  2DN0 A;  3E5X A;  4BDZ A;  3DTK A;  3VSL A;  4A5N A;  4CYD A;  5IP7 J;  3HRT A;  2O7O A;  2LDU A;  2V1U A;  4BEH A;  3MAJ A;  4F91 B;  1VQP I;  2DJI A;  3BTJ A;  1PUF A;  2BVL A;  5K7Z A;  3HKZ A;  2HTS A;  3KX2 A;  4BAY A;  2FXA A;  1JT0 A;  4Q47 A;  3K6G A;  1V4R A;  1X3W B;  9ANT A;  2YX4 A;  4BQQ A;  2M0C A;  3FBN B;  3BR6 A;  4RS8 A;  5FRN A;  2O61 A;  4DW6 A;  3G71 I;  1Z6T A;  2RDP A;  1FYM A;  2EIN H;  2JVG A;  2DFI A;  1E2X A;  4V19 K;  4GYI A;  5ICG A;  4ITV A;  5LD2 C;  3DPT A;  3ZPL A;  2MBF A;  4GCV A;  1F1Z A;  4WX9 A;  3BZ6 A;  3WHB A;  1ZRC A;  2EV5 A;  4XOP A;  3JR9 A;  3DQV C;  4I99 C;  2DBB A;  1R22 A;  2EWN A;  1P9Q C;  5CKT A;  5F0H A;  3M8F A;  1Z77 A;  3GZ5 A;  2XC7 A;  2OJE D;  1UZC A;  5FKM A;  2QLZ A;  2LD5 A;  2ZBK A;  3TW7 A;  1I1G A;  2E1O A;  3OSG A;  2LY2 A;  1Q1H A;  2QSF X;  3D5S C;  3JTG A;  3LQR A;  3HSE A;  1P92 A;  2FBK A;  2A6H F;  1KYW A;  1LKX A;  2R7W A;  1MSE C;  4PJN A;  2VE8 A;  1WH7 A;  1KU7 A;  4NB5 A;  2JQ7 A;  4MTD A;  1LDJ A;  1Z6R A;  2O5R A;  4RBO A;  2DA2 A;  3BZK A;  3O6B B;  5KAF C;  2LP0 A;  4N9H A;  4ZJZ A;  1YTY A;  1VQ8 I;  4B43 A;  1YFH A;  1HLV A;  1AOY A;  3OV8 A;  3AAF A;  2H1L A;  2COB A;  2R7R A;  1ZAO A;  3F9K A;  3GYH X;  3TMO A;  2BXZ A;  3TL4 X;  2GXB A;  1XCB A;  3VWB A;  4I09 A;  2MLK A;  1APL C;  2RC4 A;  2QKL B;  1J5Y A;  2OV7 A;  1BM9 A;  3E6B A;  4DYR A;  1WJE A;  3FDY A;  2CQN A;  5E18 F;  3FHN A;  1EKE A;  3C1D A;  4IX7 A;  1FY7 A;  1YS7 A;  3JRG A;  4BJ6 C;  1JTY A;  1QHG A;  2BY0 A;  1Z05 A;  2M34 A;  4JYK A;  4WWC A;  4Y33 A;  4XLC A;  1R4M B;  5FRM A;  4MLO A;  3WE3 A;  1MBF A;  1BA5 A;  1FC3 A;  2W84 A;  2OBP A;  4IXA A;  3CO6 C;  4G6D A;  1YX3 A;  2OA4 A;  4GGG A;  2L4A A;  2GBY A;  3T8R A;  1JT6 A;  5EGO A;  2DA7 A;  3LNQ A;  1HOM A;  2QQB A;  3GTJ J;  3HUG B;  2DA1 A;  5TGT A;  5EF6 A;  2HPI A;  3ESW B;  1RRJ A;  5A2Q K;  3CJQ B;  1ZGA A;  5EEG A;  4LIU A;  2R7D A;  4CXF A;  3CJR B;  3LSI A;  4XKB A;  2VI6 A;  3BP8 A;  5M5Y J;  1TP4 A;  3FM5 A;  1GXQ A;  1B8I B;  1X4O A;  1K7A A;  1P4A A;  2CG4 A;  3G3Z A;  3S1R J;  4UVB A;  5D4S A;  2L2O A;  3OYJ A;  4XLH A;  2JUC A;  3DPU A;  4MNU A;  1BI0 A;  1D0Z A;  1FBS A;  1XCV A;  2QEN A;  4AVP A;  1WGX A;  2B0L A;  2K9Q A;  4TV7 A;  2QBY A;  1QVU A;  1R23 A;  3PQK A;  4FX0 A;  4ESF A;  2HVQ A;  4UXN A;  3K70 C;  2WC2 A;  2NS8 A;  1VQM I;  1U6G A;  4HV5 A;  4AM3 A;  4RAF A;  2XRO A;  1FOX A;  3SYT A;  5IP6 A;  4B09 A;  3F8N A;  1R00 A;  4WF2 A;  4N9I A;  1F9N A;  1TWG J;  3Q9V A;  4LG3 A;  3WTV C;  2CUZ A;  2NRA C;  3GBG A;  2WBM A;  5FRO A;  4NHJ A;  3KET A;  2NNN A;  2R7Z J;  4E7I A;  2PEX A;  5KAI C;  4I2O A;  1MZB A;  1R36 A;  2LTP A;  1D1B A;  5LHH A;  3DP7 A;  3R0J A;  1T2K A;  2EFP A;  4F93 B;  2FBI A;  2TDX A;  4QSH A;  4ZTF A;  5FKN A;  2HXI A;  2CW7 A;  1XMX A;  1G3S A;  4OIP F;  2GWR A;  1LEA A;  3J80 Z;  1ETK A;  5BS6 A;  3HOZ J;  4HSR A;  4EGY A;  1A31 A;  2XRN A;  2EV6 A;  1ZG5 A;  3ZRG A;  4BJT A;  4E7H A;  3SHF A;  1DP7 P;  4UNO A;  3NEU A;  2WB1 N;  3L9F A;  4CZZ A;  2IGK A;  4HNU A;  2BY2 A;  1X1D A;  3D5L A;  2PJR B;  1MDM B;  4B44 A;  4C9Y A;  1VQO I;  2R7O A;  1UG0 A;  5M5W J;  1GXP A;  1CGP A;  3ABT A;  1ZTR A;  1O3R A;  5CVJ A;  3K70 D;  3ZQL A;  4UVA A;  1BOA A;  5GTI C;  2H94 A;  1QO0 D;  1WZ2 A;  3KEQ A;  2KIQ A;  3T5X A;  1CF7 A;  2XGC A;  2DFF A;  2PN6 A;  5JR3 A;  1RPW A;  1LE8 B;  2O8X A;  1QPM A;  3ZGK A;  3OWT A;  2H27 A;  3HPH A;  5EG0 A;  1UMQ A;  2EB7 A;  3DKW A;  1I50 J;  3CP2 A;  4I6Z A;  3J7Z I;  5GAD J;  1TL8 A;  1Y1W J;  1RET A;  3GLX A;  2LC2 A;  2OUM A;  5KHD A;  3OYK A;  3RKX A;  1RKW A;  2R5Z B;  2JSP A;  2Z33 A;  1J75 A;  4Y4R A;  4XQF A;  5FKL A;  4L5J A;  3OIP A;  2JA7 J;  4EM2 A;  2QGU A;  1OLT A;  1FYL A;  4C3I J;  1G3Y A;  1H9T A;  3FK6 A;  1I39 A;  5D5V B;  5KNL A;  4G7O F;  2PMH A;  4ZYE A;  1MBE A;  3HOT A;  1LJ9 A;  2VPR A;  3H5A A;  3CLQ A;  4PJ0 C;  4LLN A;  4IOC F;  3FBI B;  3S1Q J;  4LIT A;  5ICC A;  2DPD A;  2VBY A;  2LRD A;  2M1B A;  2XSJ C;  3N97 A;  4DOZ A;  3LSP A;  1QBJ A;  1X2M A;  5ILU A;  2F5D A;  2PMZ A;  2R7V A;  5FKO A;  4E7L A;  1T0F A;  2IGN A;  3H9Q A;  3VYU B;  4FIS A;  1IG7 A;  3BR0 A;  3JRB A;  2VC1 A;  3JTH A;  1EH6 A;  3H3V K;  2F2E A;  4KIT B;  2R7F A;  2NVT J;  1ZQ3 P;  5IYD J;  2VQG A;  3I59 A;  5LRR A;  1QZE A;  2WA0 A;  3ZR8 X;  2DOA A;  3HKZ N;  3GFM A;  1GUU A;  3Q9S A;  1SVO A;  3PFI A;  3CCQ I;  1XSD A;  5M3M J;  4ENJ A;  3J81 K;  1FP1 D;  2E1M C;  3CDL A;  3HGY A;  3WTZ A;  2XPW A;  4M3F A;  5FGM A;  2BXY A;  3P9I A;  4D1Q A;  4GXO A;  2F4M B;  4S05 A;  5E17 F;  2G7H A;  4HEA 2;  2F5C A;  1AKH A;  2Q2E A;  2CS3 A;  2EH3 A;  1P6R A;  4JX6 A;  1ZG3 A;  4HYE A;  5HNF A;  2LLK A;  4ABZ A;  1BL0 A;  5AON A;  3DKY A;  4B48 A;  3ERE D;  1K79 A;  2VOO A;  1MBG A;  4M3G A;  3JRF A;  3PO3 J;  3CCS I;  4PFO A;  1QZY A;  1DPR A;  2STW A;  3M8J A;  1QHH D;  2LKS A; 
#chains in the Genus database with same CATH homology
 4EV0 A;  2IA1 A;  1C0W A;  2ZKZ A;  1U8R A;  2VBW A;  1OR7 A;  3BDD A;  2VBZ A;  2DK5 A;  4M6X A;  4Q4Z F;  2J5P A;  3LFK A;  1FOK A;  4HAM A;  1RI7 A;  5KVR A;  3KCC A;  3VOE A;  3MEX A;  3I54 A;  4ESB A;  4EQQ A;  1HXD A;  1LQ1 A;  2ZME A;  1FNN A;  4KMU X;  3C3W A;  3QU6 A;  2DAO A;  5ICF A;  2OZ6 A;  5LEK A;  1KYZ A;  1XDS A;  2UXN A;  5A2Q Z;  4EJO A;  3TQN A;  1FWZ A;  1T6S A;  3ZMU A;  2FBH A;  1WWX A;  5L3C A;  2CFX A;  4HF1 A;  2MH2 A;  3D0S A;  3V7S A;  1L3L A;  2XAS A;  4XLP F;  1YS6 A;  5BOX A;  2GQQ A;  3ZMD A;  1ZN2 A;  4HX4 A;  2CO5 A;  3ECH A;  3GUD A;  1D8J A;  1KU9 A;  1RUO A;  4FT8 A;  2JT1 A;  2V6C A;  5F6F A;  3DV8 A;  3BPV A;  2KIU A;  2ZXJ A;  1FLI A;  1HKS A;  1T38 A;  3Q5F A;  3R60 A;  2Q8K A;  2HQR A;  3RI4 A;  1ZHF A;  1XGS A;  2V1D A;  3CLO A;  5FB2 A;  2XVC A;  2EA4 A;  1MJB A;  2NNY A;  1YW8 A;  1IUY A;  2A68 F;  2O6G E;  3TGN A;  3IKV A;  1W7P B;  5LGU A;  1KQ0 A;  3HSR A;  5TJJ A;  1IRG A;  3MZH A;  4RGR A;  1R7J A;  4LFU A;  1T98 A;  4RB1 A;  3SQN A;  3LAP A;  2IT0 A;  3ML6 A;  3MCZ A;  3DFG A;  4KIG A;  4G6Q A;  4HQM A;  5AIQ A;  1SMT A;  2RVC A;  2XAQ A;  1LVA A;  4CDG A;  2VON A;  4IRI A;  1I5Z A;  3QAH A;  4HX8 A;  3K1M A;  4HV6 A;  1EH8 A;  4KYW A;  3G73 A;  2MC3 A;  1SMY F;  5DCM A;  4EJV A;  4KA4 A;  4U7B A;  1BC8 C;  3JSP A;  2ESH A;  3RKY A;  2XKO A;  2QUF A;  3E97 A;  3BY6 A;  2P7C B;  1O3S A;  3F8M A;  4A6D A;  3VFZ A;  5JHU A;  2ELH A;  4RGU A;  2FA5 A;  3NRV A;  4G7H F;  3C7J A;  5BPI A;  3SXY A;  5DCF A;  3F6O A;  1PUE E;  5D4R A;  4P96 A;  4P55 A;  4XSZ F;  4DNC A;  1XSX A;  3HRU A;  5ICE A;  3FXQ A;  2PJP A;  2BE5 F;  4XRF A;  3I71 A;  3ULQ B;  2C6Y A;  1STZ A;  2QVO A;  4G8X A;  1ZLJ A;  2VOP A;  5CVI A;  5DV5 A;  3J80 K;  1FBQ A;  2BBY A;  4I01 A;  3FXU A;  4RGS A;  4YG2 F;  4ESJ A;  1D3Y A;  5D8L B;  3F3X A;  4I7H A;  1JHH A;  3R4K A;  4UUV A;  1KA8 A;  4L0Y B;  4NQW A;  3IWZ A;  3I0T A;  1ZLK A;  1GVJ A;  3V8K A;  5CLS A;  2VN2 A;  4BHP A;  1UCR A;  1CF7 B;  3WE2 A;  2OZU A;  1W7P D;  1ZRE A;  5HDN A;  2DK8 A;  2BYV E;  3TO9 A;  3WOD F;  2FNA A;  3BPX A;  1FPQ A;  1BI3 A;  3CUQ A;  1G3W A;  2EJR A;  5DUK A;  5HDK A;  2RGV A;  2AXL A;  5HLI A;  2A6E F;  5BMZ A;  4L9J A;  3TOA A;  2XAG A;  3BWG A;  4OIO F;  1HW5 A;  3H3Z A;  1USS A;  3TKY A;  1S6L A;  2QQA A;  1FSE A;  2XHK A;  3HRM A;  1ON2 A;  3FF5 A;  4HF0 A;  1I27 A;  1S3J A;  2MLG A;  4EGZ A;  5HS7 A;  4WCG A;  2GIV A;  2EFN A;  4XBF A;  4CIC A;  4UHT A;  1K78 B;  1ZH5 A;  2UZK A;  3H92 A;  2H09 A;  3SZT A;  2WWY A;  1L0O C;  4L9T A;  5FLX K;  3WTX C;  3KP2 A;  4L0Z B;  2P6T A;  1LNW A;  3HUG A;  1TW3 A;  2Y0M A;  3VEP A;  4KT5 C;  3PQJ A;  1DDN A;  2IJL A;  4R79 A;  3WTY C;  3QPT A;  1SFU A;  1TQM A;  2FRH A;  4FX4 A;  5LEJ A;  4XSX F;  1J59 A;  3REO A;  2QZ8 A;  5IT3 A;  3WGI A;  1LB2 A;  4CGZ A;  1U2W A;  2XAJ A;  3ZP5 A;  1V3F A;  1IXC A;  3LWF A;  4O6J A;  1FYK A;  1R1U A;  3KP7 A;  1O3T A;  4YFK F;  3IRR A;  3F21 A;  1LDD A;  1IRF A;  2HTJ A;  2QM3 A;  1WQ2 A;  2QBY B;  4HOB A;  1W5S A;  3I64 A;  2CW0 F;  3LST A;  4LG0 B;  1SFX A;  4BYY A;  1G3T A;  3L7W A;  3CTA A;  2DQR A;  1IN6 A;  3DEU A;  2EV0 A;  4Z2Y A;  2E7X A;  3ZN0 A;  3QP5 A;  1O57 A;  4BHC A;  4HF2 A;  5L3E A;  4MTE A;  1HSJ A;  1WRJ A;  4E70 A;  2M30 A;  3MZY A;  1B1B A;  3HTS B;  5J8C A;  1TNT A;  4R1H A;  4P9F A;  2VBX A;  2DTR A;  5CJ9 A;  3C18 A;  1MDM A;  3EUH A;  3WTT C;  2K86 A;  5D6E A;  4ENN A;  5JI6 A;  3F72 A;  3IHU A;  1KU2 A;  2ZNY A;  2M8E A;  1UHW A;  2D1H A;  1HKT A;  2KRF A;  3ISP A;  2ESN A;  5L3F A;  1H9G A;  2A61 A;  1TTY A;  3CJN A;  4JK1 X;  2OQG A;  2VXZ A;  4PGH A;  3TO7 A;  2FML A;  2DQL A;  3P7N A;  1JGS A;  2VOD A;  2P5V A;  3CO7 C;  1MJA A;  3K0L A;  3EET A;  3RYR A;  3R0A A;  3V8J A;  2Y75 A;  3BOQ A;  4YII A;  2D2W A;  1IXS B;  3ABU A;  1OPC A;  3EYI A;  4UV9 A;  1YQA A;  5TRD A;  1IN5 A;  2HR3 A;  3KP6 A;  2ADU A;  1QQI A;  2R3S A;  2VE9 A;  2A3S A;  3B02 A;  3DF8 A;  3I58 A;  4M72 A;  4KN7 X;  3LQQ A;  3DPL C;  1BC7 C;  3KZZ A;  4UVC A;  1KQ9 A;  2JPB A;  1OYW A;  1W4M A;  2BEO A;  1UFM A;  3IC7 A;  1QNT A;  1S7A A;  4ZZD A;  4P5O A;  1RNL A;  3GW2 A;  2E1N A;  1IF1 A;  3M9A A;  1AWC A;  4U0V A;  5DD8 A;  1R1T A;  2KJC A;  2FSW A;  3W6K B;  4QWQ A;  3R6S A;  5HS8 A;  5L3D A;  1BI1 A;  5E1X A;  2HYF A;  1PDN C;  1G4D A;  1BJA A;  3KLN A;  1YG2 A;  3FXR A;  2ETH A;  1IZ1 A;  3W6J B;  5DD4 A;  2GAU A;  4GO1 A;  4A0Y A;  2A69 F;  1O7L A;  1I6X A;  5HLH A;  3TOB A;  1FP2 A;  3SZP A;  3WU1 B;  3S2W A;  2P8T A;  4Q48 A;  5J6X A;  4I0B A;  1I1S A;  2XKP A;  1XMA A;  3ECO A;  1FSH A;  2ZCW A;  1FZP B;  4D0P A;  2EK5 A;  4H0E A;  2CYY A;  3BRO A;  1TNS A;  4QLC U;  2H6C A;  1P4W A;  4M71 A;  3RTR A;  2OQR A;  2PLY A;  3LAJ A;  4HLY A;  2VC0 A;  5L3B A;  2YPR A;  3HYI A;  3KEO A;  2HFH A;  2RKH A;  4MEX F;  1HQC A;  2JPC A;  4LG0 A;  1J0R A;  1HW2 A;  1YLF A;  1UST A;  2IW5 A;  2PFB A;  2IRF G;  3SFZ A;  4R8H A;  5AIP A;  4B8X A;  4OMZ A;  4OU0 A;  3QP6 A;  4CHU A;  2UXX A;  2FQ3 A;  5FD5 A;  1OYY A;  1B9M A;  2O3F A;  2KJB A;  4IF4 A;  3IKT A;  1XGO A;  3GFJ A;  3I5U A;  3F8C A;  1XB4 A;  1P2F A;  4MEY F;  5ILV A;  3TDU C;  5D5U B;  4ZYG A;  4OIR F;  2Z5U A;  4G9Y A;  2JRT A;  1RUN A;  2EFO A;  5D5W B;  4U0Y A;  1SD4 A;  5K1Y A;  4M74 A;  1ZYR F;  4L9N A;  1F5T A;  4A6E A;  5ED4 A;  1B4A A;  1OYI A;  1R5H A;  2M87 A;  1YW7 A;  3KFW X;  5L3G A;  4A2U A;  4LLG F;  2V9V A;  4RAZ A;  2LF8 A;  2IVM A;  4MGR A;  1RZ4 A;  1IN8 A;  4AIK A;  1YO5 C;  1MGT A;  4RGX A;  3L00 A;  3FM3 A;  2P5L C;  1R1V A;  1J9I A;  1YW9 A;  3IRQ A;  2NYX A;  6PAX A;  3FMR A;  1IN4 A;  5DEQ A;  4OOI A;  1S29 A;  1SD5 A;  2V1X A;  2YSR A;  3V4G A;  3GX4 X;  5HOO A;  2D1V A;  3QRF F;  5BPD A;  2PBI A;  3COA C;  2AS5 F;  4I02 A;  4OIQ F;  2XUB A;  2Z99 A;  4KIC A;  1UB9 A;  1KU3 A;  4LK1 F;  2HYG D;  3JAM K;  5E20 A;  3CUQ B;  4S04 A;  2FMY A;  4A12 A;  1U5T A;  1MKM A;  4A5M A;  4KFC A;  3F8B A;  3LA3 A;  3GZ6 A;  5DDG A;  1Z91 A;  1EH7 A;  2KKO A;  3ZN1 A;  3FZV A;  4A0X A;  2STT A;  1SAX A;  1BIA A;  1MD0 A;  2WTE A;  3FMQ A;  4U7D A;  3QOP A;  4IRH A;  4KIB A;  5H6Q A;  2V79 A;  2HQN A;  1RIO H;  1IW7 F;  3EYY A;  3GFI A;  2PMU A;  4BH9 A;  4OIN F;  4IJA A;  1NHA A;  2KIM A;  1J2X A;  2VT2 A;  2G7U A;  4EM0 B;  4O3M A;  2FNP A;  1PP7 U;  2JZY A;  1SD6 A;  1LEB A;  2KIF A;  3M1E A;  1D8K A;  3DXJ F;  1WSU A;  2JSC A;  4YIF A;  2HKO A;  2WV0 A;  4FHT A;  1ODD A;  5LLQ A;  2VT3 A;  2HEO A;  2H6B A;  1IN7 A;  4BXU A;  1OKR A;  2ISZ A;  4P9U A;  2OD5 A;  4Y15 A;  4IHT A;  5FLX Z;  2A07 F;  2PI0 A;  2L3D A;  1TLH B;  3FHZ A;  4M6Y A;  1P4X A;  4BNC A;  3U9G A;  3CUO A;  4HW0 A;  1S7O A;  5ERI A;  2HKX A;  4HDU A;  5FFX A;  2GA2 A;  2DPU A;  4HX7 A;  1DUX C;  5DUI A;  4LGW A;  3E6D A;  1SD7 A;  5LRS A;  2RQP A;  4KIF A;  1R5G A;  1HBX G;  2J5O A;  5F64 A;  1IAW A;  1H0M A;  2COM A;  2EA2 A;  3HOS A;  3IL2 A;  2K02 A;  5D8K B;  2DO7 A;  5HS9 A;  3RJP A;  5J8F A;  2Q0O A;  1KGS A;  1BIB A;  2CSO A;  3WTU C;  4KN4 X;  3LA2 A;  3E6M A;  2OU2 A;  3F8F A;  5LGN A;  3CDH A;  4KDP A;  1TBX A;  2P5K A;  4EJT A;  1W7P A;  4BQA A;  2DW4 A;  5E1W A;  2DU9 A;  4ZZL A;  1LDK B;  3LA7 A;  2RN7 A;  1WI9 A;  2ZNZ A;  1U78 A;  2K4J A;  4L9V A;  2L4M A;  5DCM B;  3WGH A;  2OAZ A;  1K78 A;  3IWF A;  1FBU A;  3L2C A;  3KP4 A;  2BGC A;  5FFZ A;  4CO8 A;  3E5U A;  4F7Z A;  5E8I A;  1EV7 A;  4G7Z F;  1K6O A;  1Y0U A;  4IRG A;  4LMY A;  4IVN A;  3GXO A;  3RYP A;  1PP8 F;  4GYG A;  1ZAR A;  4AWX B;  1XDU A;  5FO5 A;  1IXR C;  1FT9 A;  2F5E A;  2O03 A;  2O0Y A;  1OMI A;  3WTW C;  1XSV A;  4K2E A;  3R61 A;  2E7W A;  3QU3 A;  2ZME B;  4LD5 A;  1ZG1 A;  3T0Y A;  3BJA A;  1UHM A;  2IP2 A;  2PQ8 A;  2FE3 A;  1Z7U A;  1DPU A;  1GHC A;  2RNJ A;  2ZFW A;  2P4W A;  3WGG A;  5EEH A;  1WKM A;  4M73 A;  1B6A A;  2W25 A;  1YIO A;  3GEZ A;  5ILS A;  2LNB A;  1XD7 A;  4HDV A;  4I0A A;  3FX3 A;  2FEZ A;  2IA2 A;  5FD6 A;  4DQ2 A;  3V8L A;  2K4B A;  2XGX A;  4Y17 A;  3CUQ C;  3F23 A;  1SFE A;  2M45 A;  1KQ8 A;  3E6C C;  5LGT A;  3WG9 A;  3GO5 A;  3EDP A;  2EFQ A;  5LHG A;  4JBA A;  1XN7 A;  1R58 A;  3B73 A;  2GZW A;  5HDG A;  4L18 B;  2NAZ A;  3RPU A;  4IHS A;  2DI3 A;  5LBQ A;  3JW4 A;  1F4K A;  4M9X A;  5CVU A;  1FX7 A;  1ZRD A;  2P6S A;  3ZMT A;  3T1B A;  4JQF A;  2FOK A;  2GA1 A;  3I53 A;  2A5Y B;  1JE8 A;  3P9K A;  3MFK A;  2XAH A;  3GF2 A;  2QYO A;  3HHH A;  4EM1 A;  4I98 B;  1TW2 A;  2X4H A;  5K5R A;  1XGN A;  4Y13 A;  3M8E A;  1JXS A;  5LHI A;  3U1D A;  3VB2 A;  2PG4 A;  4PDK A;  4HZF A;  4UV8 A;  3HIF A;  2XV4 S;  2W24 A;  3E5Q A;  3ZMS A;  4PGG A;  3NQO A;  3KP5 A;  5CVR A;  2NS0 A;  2HGC A;  2XAF A;  1BBY A;  4U0W A;  3FWE A;  4EJU A;  5JFR A;  2GXG A;  2IA0 A;  3BJO A;  5H20 A;  2X0L A;  2LKP A;  3M7G A;  4L5I A;  4OMY A;  5BQT A;  3U2R A;  3TO6 A;  5IT9 Z;  3ZMZ A;  5F1R A;  4PZJ A;  1B9N A;  3FMS A;  2YR2 A;  2Z9O A;  1O3Q A;  1Z1D A;  3O3K A;  3ZQ7 A;  2YX7 A;  4ENM A;  4WXC A;  4WK8 F;  1E17 A;  1TQP A;  4MQ9 F;  1QZZ A;  3RDI A;  1ON1 A;  2RV8 A;  1A04 A;  3GVA A;  5K5Q A;  2MH9 A;  4AIJ A;  2CQK A;  2LSO A;  2FU4 A;  1Z9C A;  2P7V B;  5HLG A;  3E3V A;  4G94 A;  4KNY A;  1XGM A;  2W57 A;  4O5V A;  2BV6 A;  2DT5 A;  5CVV A;  2F5F A;  4YFN F;  1U5T B;  2Z3Y A;  2XIG A;  5E1Z B;  2MA3 A;  2HWV A;  1VTN C;  4KMF A;  4LB5 A;  3RIR A;  3HHG A;  2HDC A;  2UWM A;  1U5T C;  1BI2 A;  3RPQ A;  3KZY A;  3V7C A;  3ELK A;  1ONV A;  4M9S A;  4LJZ F;  2CWE A;  3KE2 A;  3K1N A;  4AD9 A;  1D5V A;  3K1P A;  1REP C;  4ASN A;  5KK1 A;  4RB0 A;  2MD5 A;  3TDZ C;  2K27 A;  3K9T A;  1XMK A;  2FF4 A;  2QWW A;  2L01 A;  4Q5S F;  2CGP A;  2L54 A;  3K2Z A;  1W5T A;  5DYM A;  4EMS A;  1B59 A;  3VOD A;  2ZJ2 A;  4ZYH A;  2Y48 A;  2ISY A;  3ROU A;  1X3U A;  5D5X B;  4ETS A;  1ZGJ A;  2HS5 A;  4EVI A;  4N0B A;  3RKW A;  3O2P E;  3I59 B;  1HKQ A;  3GWZ A;  1U3E M;  2EFW A;  1YYV A;  1J7K A;  3KP3 A;  3HRS A;  4HA8 A;  1T39 A;  1HST A;  3P9C A;  3MQ0 A;  4IPA A;  4YFX F;  4A0Z A;  3T8T A;  3L09 A;  4KUM A;  4ENK A;  4RB2 C;  2DLL A;  4PCQ A;  2ACJ A;  1MJ9 A;  5E8G A;  3V7R A;  3GFL A;  3H3U A;  4LK0 F;  4M9Z A;  4ZH4 F;  3HTU A;  4XLN F;  1ZRF A;  5K5O A;  2IPQ X;  3OOP A;  3J81 Z;  4MHG A;  1S8N A;  1HW1 A;  2QQ9 A;  5HVQ C;  2L02 A;  1ULY A;  3MWM A;  4BHB A;  3QPH A;  5IT9 K;  2W85 A;  2YU3 A;  3EQL F;  4ZYD A;  1QGP A;  4LB6 B;  4ON0 A;  3K69 A;  4MQV A;  2JTV A;  4HBL A;  3JSO A;  4WXH A;  3N4M A;  3J7A O;  2HZT A;  3I4P A;  1O7F A;  4HLX A;  1BN5 A;  3WU0 A;  3F6V A;  4AIH A;  4EJW A;  2ZO4 A;  2K7L A;  2D45 A;  4U88 A;  1TQI A;  3KLO A;  3JAM Z;  2LF7 A;  2HOE A;  5H6R A;  3BJ6 A;  3F22 A;  4HQE A;  3HSF A;  2M5W A;  3ZMV A;  4RAY A;  4RB3 C;  2G9W A;  5D6F A;  1JHF A;  1G6N A;  4WXD A;  5CYV A;  3WTS C;  4LLL A;  5JVT A;  2E1C A;  3E5X A;  4A5N A;  4CYD A;  3HRT A;  2LDU A;  2V1U A;  3MAJ A;  2HTS A;  4BAY A;  2FXA A;  4Q47 A;  1V4R A;  2YX4 A;  4RS8 A;  2O61 A;  1Z6T A;  2RDP A;  1FYM A;  2DFI A;  1E2X A;  4GYI A;  5ICG A;  3DPT A;  3ZPL A;  2MBF A;  4GCV A;  1F1Z A;  4WX9 A;  3BZ6 A;  1ZRC A;  2EV5 A;  3DQV C;  2DBB A;  1R22 A;  2EWN A;  3M8F A;  3GZ5 A;  2QLZ A;  2ZBK A;  1I1G A;  1Q1H A;  3JTG A;  3LQR A;  3HSE A;  1P92 A;  2FBK A;  2A6H F;  1KYW A;  2VE8 A;  1KU7 A;  4NB5 A;  4MTD A;  1LDJ A;  1Z6R A;  1YTY A;  3O6B B;  4N9H A;  1YFH A;  1AOY A;  3OV8 A;  3AAF A;  1ZAO A;  3GYH X;  2GXB A;  1XCB A;  4I09 A;  2MLK A;  2RC4 A;  1J5Y A;  1BM9 A;  3E6B A;  5E18 F;  3C1D A;  1FY7 A;  1YS7 A;  1Z05 A;  4WWC A;  3WE3 A;  1FC3 A;  2W84 A;  2OBP A;  4IXA A;  3CO6 C;  4G6D A;  2OA4 A;  4GGG A;  2L4A A;  3T8R A;  2QQB A;  5A2Q K;  1ZGA A;  5EEG A;  2R7D A;  4CXF A;  3BP8 A;  3FM5 A;  1GXQ A;  1K7A A;  1P4A A;  2CG4 A;  3G3Z A;  4UVB A;  5D4S A;  4MNU A;  1BI0 A;  4AVP A;  1FBS A;  1XCV A;  2QEN A;  2B0L A;  4TV7 A;  2QBY A;  1R23 A;  3PQK A;  4FX0 A;  4ESF A;  4UXN A;  2WC2 A;  1U6G A;  4HV5 A;  2XRO A;  4B09 A;  3F8N A;  1R00 A;  4WF2 A;  4N9I A;  1F9N A;  2NRA C;  3Q9V A;  3WTV C;  4NHJ A;  3KET A;  2NNN A;  2PEX A;  4I2O A;  1MZB A;  1R36 A;  5LHH A;  1T2K A;  3DP7 A;  3R0J A;  2EFP A;  2FBI A;  2TDX A;  1G3S A;  4OIP F;  2GWR A;  1LEA A;  3J80 Z;  5BS6 A;  4EGY A;  2XRN A;  2EV6 A;  1ZG5 A;  3SHF A;  4UNO A;  1DP7 P;  3NEU A;  3L9F A;  4CZZ A;  3D5L A;  1MDM B;  1GXP A;  1CGP A;  3ABT A;  1O3R A;  5CVJ A;  4UVA A;  1BOA A;  2H94 A;  1QO0 D;  3KEQ A;  3T5X A;  1CF7 A;  2PN6 A;  5JR3 A;  2O8X A;  1QPM A;  2H27 A;  2EB7 A;  3DKW A;  3GLX A;  3RKX A;  1J75 A;  2Z33 A;  4L5J A;  4EM2 A;  1FYL A;  1G3Y A;  1H9T A;  5D5V B;  4G7O F;  2PMH A;  4ZYE A;  3HOT A;  1LJ9 A;  4LLN A;  5ICC A;  2DPD A;  2VBY A;  2M1B A;  3N97 A;  1QBJ A;  5ILU A;  2F5D A;  1T0F A;  2VC1 A;  3JTH A;  1EH6 A;  2F2E A;  2R7F A;  3I59 A;  5LRR A;  3GFM A;  3Q9S A;  1XSD A;  3PFI A;  4ENJ A;  3J81 K;  1FP1 D;  3WTZ A;  5FGM A;  3P9I A;  4GXO A;  4S05 A;  5E17 F;  2G7H A;  2F5C A;  2Q2E A;  1P6R A;  1ZG3 A;  4HYE A;  5AON A;  3ERE D;  1K79 A;  2VOO A;  1QZY A;  1DPR A;  2STW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...