3BJ6A

Crystal structure of marr family transcription regulator sp03579
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
SNAMTHETDQLYQAVQATRPLLRNITAAVERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEMAKLALFSEGFSSVELTAYHKVQLALTRFFADLAKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
publication title Crystal Structure of MarR family Transcription Regulator SP03579.
rcsb
source organism Silicibacter pomeroyi dss-3
total genus 51
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bj6A00
4BQAA 2OQGA 3TOBA 4Q4ZF 1Z7UA 1CGPA 1JHFA 2ZMEA 5FO5A 4A0XA 1I6XA 3SQNA 3H3UA 1TNTA 1FLIA 1XCVA 4F7ZA 4BYYA 1QO0D 2P5VA 3BP8A 1HKSA 4Z2YA 4LLNA 1TQPA 2IA0A 1U2WA 2RN7A 1EH7A 3O2PE 2QQ9A 5FB2A 4NQWA 2ESNA 2MLGA 1F5TA 1R5GA 5HLGA 1RUOA 5E18F 4M74A 3Q9SA 2Q2EA 3TDUC 4E70A 1J7KA 4L5IA 2K27A 3QAHA 4AWXB 2VXZA 3RI4A 3DPLC 4O3MA 4S04A 1I1GA 3GF2A 4IPAA 5A2QK 4S05A 5H6QA 4EJWA 2HOEA 2ZXJA 4CICA 2FF4A 4G7ZF 4Y13A 5D5XB 4RGRA 4WK8F 6PAXA 2AS5F 4WWCA 2VONA 2ISZA 3F6OA 3FMQA 3WTWC 4ZYHA 2Z3YA 2CSOA 4GYGA 1Z9CA 1KA8A 3O3KA 3JSOA 3TO6A 2L02A 2BE5F 1FX7A 3GX4X 5ILSA 1IUYA 3EETA 5A2QZ 5E17F 1TNSA 1T39A 3LAPA 2XHKA 3M8EA 2O03A 3FMRA 3ERED 3RPQA 4I0AA 1QPMA 1O3TA 1U78A 5BPIA 4K2EA 2EFOA 3F8FA 3ZP5A 5KK1A 4BHBA 3S2WA 2QQAA 2XIGA 5H6RA 2YU3A 3C18A 2W57A 4L9TA 3G73A 4FHTA 2FRHA 2R7DA 3SXYA 2KIMA 3O6BB 2WV0A 5ICGA 2Q8KA 2G9WA 3DEUA 1XMAA 2CQKA 4UVAA 1SD7A 1YYVA 5KVRA 4LK0F 1R7JA 2QLZA 3SFZA 2EFQA 1K78B 2GWRA 2ACJA 1XSDA 2R7FA 1FYLA 1W7PD 2ESHA 1J9IA 3F3XA 3DKWA 4MTDA 1TW3A 3FXQA 2RVCA 4TV7A 1TBXA 1W5SA 4YFKF 2KRFA 2DQLA 2FSWA 3R4KA 4IRIA 5AIQA 2Z33A 1ZGAA 3QPHA 1SFUA 5JR3A 3KZYA 1ONVA 2XVCA 1B9MA 2P7CB 1IRFA 4UXNA 5CVRA 3RKWA 5DV5A 5D8LB 1X3UA 2EJRA 3ISPA 4EVIA 1CF7A 4OIOF 1P4WA 4WCGA 2EA4A 3RTRA 4LMYA 3R6SA 1D8JA 5DDGA 1L0OC 2A68F 4R1HA 3EYYA 3K1PA 3GFMA 1RI7A 3MZHA 1Y0UA 2NNNA 2O6GE 3BWGA 4HLXA 4LG0B 3U1DA 4A5MA 2Y48A 4OIRF 3ZN1A 2ETHA 3FF5A 3HUGA 1P4AA 3PQKA 1EH8A 1KGSA 1BI0A 4IRHA 1YW7A 1QBJA 5E1ZB 4OOIA 5FD5A 1TW2A 5CVJA 5E1XA 1XD7A 4HQEA 1R58A 2H27A 1OMIA 4UHTA 3H92A 1UB9A 3RYPA 2Z9OA 2IA2A 1IN5A 2V6CA 3WTSC 1KU9A 2DI3A 3GZ5A 3M9AA 3ROUA 4JBAA 2EFPA 4KA4A 2HEOA 1K79A 1OYWA 3VODA 5LHHA 5K1YA 3F6VA 1LDKB 4I2OA 2K86A 1EH6A 1MJ9A 1ON2A 2XKPA 4O5VA 5J6XA 3B02A 4WX9A 4HX7A 1LDJA 1T98A 1XGOA 4M6XA 3V7SA 1O3QA 1UCRA 1TTYA 4ENNA 2KJCA 1HSJA 3CUOA 5FD6A 4HW0A 4ON0A 2A6HF 2FNPA 1MZBA 4ASNA 3VOEA 2E1CA 4I01A 2D2WA 2W24A 1YO5C 2OU2A 2DPUA 1KU3A 2VBYA 3GW2A 4AD9A 4IHTA 2HR3A 2PQ8A 2D1VA 4CDGA 3ZPLA 2O61A 4KIGA 2P7VB 5JVTA 3JTGA 5HOOA 2GAUA 4U0YA 1G3SA 4I02A 3KETA 1QQIA 2QVOA 2PMHA 3HTSB 3DF8A 3KZZA 1Z6RA 4ZYDA 3PFIA 3JAMZ 3CDHA 1ZYRF 1ZGJA 2PLYA 2XROA 1F4KA 3RJPA 3TO9A 4M71A 5EEGA 3I71A 1B59A 3GLXA 1E17A 3KLNA 1ZREA 4EM0B 2G7HA 3LA7A 3ZMTA 3ULQB 3LFKA 3T5XA 1IN7A 3T8RA 4IHSA 2VE8A 3WU1B 4A2UA 3PQJA 1EV7A 1ULYA 2CWEA 1KU2A 3CTAA 4DQ2A 2O0YA 1GXPA 4D0PA 3CLOA 2OZ6A 4GXOA 4H0EA 2M87A 2A61A 2JPBA 3ABUA 3J80Z 3CUQC 4HX8A 3QRFF 3MQ0A 5HDGA 1IN6A 2YX4A 3LA2A 2YSRA 5DYMA 3CO6C 2DPDA 3FXUA 4ESJA 3KP5A 3LWFA 3NRVA 3WGHA 3Q9VA 4WXDA 1P92A 2E1NA 4LLLA 4EGZA 3FM3A 4ZYGA 4M6YA 5LGTA 3JTHA 4XBFA 3KCCA 1K6OA 1KQ0A 1F9NA 2ZKZA 3ECOA 4A6DA 2GA2A 2QQBA 1FBUA 1U5TA 1BJAA 5JFRA 2RGVA 4IVNA 1TLHB 3WTXC 4IF4A 1SD4A 3BJ6A 4LB6B 1DPRA 2H94A 5D5VB 4EJTA 1QGPA 4MGRA 5F6FA 3V8JA 2V1DA 3KP4A 5L3FA 1ZN2A 3I4PA 2FEZA 5L3GA 2LDUA 4I7HA 4GCVA 3F22A 4KIFA 3CO7C 2VOPA 4ESFA 4EJOA 5HS8A 3GYHX 1XCBA 2WWYA 5K5RA 2X4HA 3L9FA 3BJOA 5K5OA 4AVPA 4AIJA 4UNOA 3K0LA 2RQPA 5AIPA 3ZMZA 2ZFWA 4JQFA 4AIKA 3MCZA 1YFHA 2A69F 1P6RA 3N4MA 4P5OA 4KN7X 3KP7A 2O8XA 2FMLA 1FSEA 1AWCA 2OAZA 4HZFA 2FBKA 3R0JA 3EDPA 4GO1A 4ENKA 1HKTA 4AIHA 1YTYA 4RB0A 2FBHA 1GHCA 2L4MA 4L9NA 1J2XA 4LLGF 2PBIA 4LGWA 3I5UA 3WTTC 4KMUX 4U7DA 2DLLA 4MEYF 1XN7A 2DW4A 4OIPF 5LLQA 1LEBA 2X0LA 2E7WA 2FNAA 2PFBA 1ZRFA 3CUQA 2HQNA 3U9GA 1P4XA 2K4JA 4YIIA 3V4GA 2XGXA 4N9HA 1JGSA 1FY7A 3IHUA 3B73A 2FE3A 3HSRA 3BJAA 2PEXA 1AOYA 2YR2A 4RGUA 1MDMB 4OMYA 1D8KA 1R36A 4UV8A 4P55A 4PCQA 4RGXA 2JRTA 2HQRA 4MHGA 1WKMA 2NAZA 4L5JA 1MGTA 5LRRA 2ELHA 5LRSA 4P9FA 1KQ8A 2XAQA 1IN8A 2UZKA 1XMKA 1J5YA 4KNYA 1W7PA 4CO8A 2VC0A 3HHHA 4L0ZB 3W6KB 2EK5A 4A5NA 1XB4A 1SFEA 3GWZA 2W25A 5LHGA 1FC3A 2A6EF 1FP2A 3K2ZA 2XAFA 3JSPA 3LSTA 2XUBA 1BI2A 4MNUA 1OYIA 2CW0F 4G6DA 1PP7U 3CJNA 2MA3A 2C6YA 3KFWX 4GYIA 2HDCA 3I54A 4PGGA 1OR7A 2XASA 2P5LC 1SD6A 4L18B 4L9JA 3VEPA 3K69A 3BPXA 3W6JB 1LNWA 2DFIA 3E3VA 2HYFA 4BXUA 3M8FA 1TQMA 3GEZA 1LB2A 4BNCA 1Q1HA 3K9TA 4UVBA 4ENJA 3IL2A 3V7CA 3GO5A 5DCMA 1O3RA 2QENA 3DV8A 2J5OA 2OZUA 1IZ1A 3WU0A 1YLFA 4HAMA 4HDUA 1O7LA 1G3WA 2DBBA 3SZTA 2MH9A 1IRGA 4L9VA 1FWZA 2R3SA 2AXLA 4UVCA 2FBIA 3C3WA 4WXCA 4QWQA 2JT1A 5D6FA 3M1EA 3KE2A 5HDKA 3MZYA 1B6AA 2PG4A 1ZH5A 1YW8A 3E5QA 4QLCU 3RPUA 1STZA 3HOSA 4XRFA 1UHMA 1RZ4A 1WSUA 1WRJA 4M73A 1ZRCA 3NQOA 1HW2A 2K4BA 5CVIA 2NNYA 2WTEA 2XRNA 2BBYA 4HQMA 3T8TA 2ZO4A 3P9CA 3MEXA 4ZZLA 1XGSA 2XAJA 1LJ9A 4ZH4F 5LGNA 5L3DA 3HRMA 4KYWA 3ZMDA 3FWEA 3QP5A 4NB5A 2V1XA 1BC7C 2V9VA 4Q47A 3IRRA 4RB1A 1LDDA 3H3ZA 4MEXF 3V7RA 1IXSB 3E5UA 1LEAA 1W4MA 4BHPA 3KEQA 3R60A 2BGCA 1MJBA 1FSHA 1DDNA 2M30A 4A0YA 1U5TC 3I64A 2XV4S 3C1DA 4XSXF 2ISYA 4I0BA 3BZ6A 5FLXZ 4O6JA 4KN4X 3HYIA 2V1UA 3WG9A 3IWZA 1I27A 2YX7A 3JAMK 3I53A 5BMZA 2M1BA 4FT8A 2F5EA 1ZG5A 3RDIA 3D5LA 4HOBA 2L01A 1UHWA 2ZMEB 4OINF 3HRTA 1HSTA 1Z91A 2XAGA 3BY6A 1E2XA 4KT5C 1FNNA 1H9GA 1R5HA 3RKYA 5J8CA 3TOAA 4KFCA 5DCFA 4IJAA 4FX0A 2XKOA 2HYGD 5FFZA 3L00A 3F21A 2ZNZA 2H09A 2VBWA 4G7HF 1XGNA 2GQQA 4U0WA 1IXCA 3TQNA 5LHIA 1USSA 1FBQA 5D5WB 1B1BA 5EEHA 1W5TA 5HDNA 3J80K 1K7AA 2L54A 4HV5A 3L7WA 3CUQB 1I5ZA 1BOAA 5LBQA 3E5XA 1MKMA 4LJZF 2JSCA 1FYKA 5TRDA 3IWFA 3J7AO 1MJAA 3FMSA 2ADUA 3OV8A 5LEKA 5ICFA 3REOA 4Q48A 5E8GA 1OYYA 1R1VA 2K7LA 3LQQA 4DNCA 3K1NA 2DO7A 2IPQX 1T6SA 1S6LA 2EWNA 2Q0OA 2L4AA 1BC8C 4FX4A 2COMA 3BROA 4HF1A 2G7UA 1YG2A 1XGMA 2ZBKA 4WXHA 4HYEA 4EJVA 4ENMA 4PZJA 1SFXA 5IT3A 4RB2C 3LQRA 1C0WA 4MQ9F 1JHHA 3KP2A 3P9IA 3DPTA 2DK5A 1YQAA 4RAYA 4Q5SF 3U2RA 2P5KA 3WODF 5DUIA 2VODA 1HBXG 2HGCA 2A07F 4I98B 3TDZC 1D5VA 2K02A 4YFXF 4OMZA 4KICA 5AONA 5D8KB 5LGUA 2FMYA 2ZNYA 2VBXA 5DUKA 3HRSA 2F5CA 4MQVA 4KUMA 3WTUC 4Y17A 2M8EA 4PDKA 2VN2A 4RB3C 4KDPA 2IT0A 3JW4A 2EFWA 3I59A 1TQIA 4LFUA 1FYMA 1O7FA 3DXJF 3BOQA 4LK1F 4ZYEA 5E1WA 4P96A 1G4DA 4LB5A 1XDUA 3L2CA 4M72A 2MLKA 2IP2A 2HKOA 3IKVA 2MBFA 2DAOA 1BI3A 2QBYA 5FFXA 3GFLA 5CJ9A 5F1RA 1V3FA 4JK1X 1T38A 4HV6A 2BEOA 5ICCA 5DCMB 4XSZF 4G6QA 1ON1A 4U7BA 2GXBA 4B09A 1HW1A 4EM2A 3TGNA 3QU3A 1BI1A 2H6CA 3FHZA 2FOKA 4LD5A 3I0TA 1XDSA 2OA4A 1CF7B 1SMYF 5BQTA 4EGYA 2IA1A 2DK8A 5DEQA 2D45A 5J8FA 1FPQA 2TDXA 5IT9K 4HLYA 2PI0A 1G3TA 2IVMA 3DQVC 4HF0A 2JPCA 3IRQA 1JE8A 3F8NA 2KIUA 3GUDA 5BOXA 1R1UA 2MD5A 1HXDA 2WC2A 4RS8A 4PGHA 1HKQA 4M9ZA 2UWMA 3WTVC 3P9KA 2GZWA 5IT9Z 5DD4A 4M9SA 2P8TA 1R1TA 4HF2A 2ZJ2A 4U88A 5CVUA 3R61A 1QZYA 4BHCA 1O57A 1ZLJA 1O3SA 1IF1A 3FZVA 2XAHA 1T2KA 1ZHFA 2UXXA 3WE2A 4EV0A 2QYOA 4YIFA 2VC1A 3TKYA 2HFHA 5HS7A 1QNTA 2V79A 1A04A 3D0SA 3J81K 4KIBA 1ZARA 3KEOA 3Q5FA 3IKTA 1DPUA 4A0ZA 1S8NA 3AAFA 2VE9A 2EV0A 3KLOA 2NRAC 2KKOA 2JTVA 1R23A 1PP8F 1DUXC 4BAYA 1OPCA 4RAZA 1YW9A 2IW5A 2STWA 2RV8A 3J81Z 3M7GA 1Z05A 1KYWA 1ZLKA 2MH2A 1G3YA 1FT9A 3RKXA 1SMTA 5CYVA 2QZ8A 4CXFA 1J0RA 2P6SA 3T0YA 1FBSA 5JI6A 5ERIA 2HZTA 1I1SA 3FXRA 2LKPA 3EQLF 1BIAA 1S7OA 2LSOA 2QWWA 3F72A 1G6NA 4ETSA 2B0LA 2RDPA 3V8LA 1OKRA 4G9YA 5CVVA 4HA8A 4M9XA 4A6EA 1S29A 3I58A 2YPRA 3E6MA 2IJLA 1YIOA 2FQ3A 3WTYC 1FOKA 1GVJA 2RKHA 1H0MA 2FA5A 1DP7P 3RYRA 4MTEA 2IRFG 4XLPF 2EA2A 2E7XA 2GXGA 5BS6A 4UV9A 1ZAOA 3HOTA 2CG4A 4G94A 3WE3A 2HWVA 4R8HA 4G7OF 2NYXA 3GZ6A 3E6DA 1GXQA 3OOPA 1IAWA 2KJBA 1ZRDA 2LF7A 3P7NA 1IN4A 2J5PA 5ILVA 1VTNC 2STTA 3ELKA 3LA3A 1MD0A 4R79A 3QOPA 3QU6A 3DFGA 3GFIA 1U3EM 1SD5A 5HS9A 3NEUA 1V4RA 5H20A 3BPVA 1H9TA 4A12A 2MC3A 2Z5UA 5D4RA 5ED4A 1UFMA 2CYYA 1YS6A 2F5DA 3HRUA 1U5TB 1FZPB 1ZG3A 3E97A 2Y0MA 4YFNF 3LAJA 5FLXK 1MDMA 2P6TA 3EUHA 3WGGA 1J59A 4EJUA 1HW5A 1U6GA 3VFZA 4N0BA 2A5YB 4XLNF 3ECHA 1IW7F 2VBZA 2HTSA 3QP6A 1KYZA 3WTZA 1YS7A 3ZQ7A 2L3DA 4HDVA 1S3JA 1JXSA 1KU7A 3I59B 1RNLA 3L09A 1BIBA 3F8MA 4OU0A 2GIVA 2FU4A 1PDNC 4N9IA 1F1ZA 4IRGA 4WF2A 2PN6A 3DP7A 3F23A 2DT5A 2Z99A 1Z1DA 4EM1A 2ZCWA 2F5FA 2QBYB 3VB2A 5D5UB 1WQ2A 2UXNA 2VT2A 2DU9A 2EV5A 4IXAA 2LNBA 4CGZA 2FXAA 4ESBA 5L3CA 1BN5A 1SAXA 3BDDA 3MFKA 2BV6A 3HSEA 3HHGA 2QUFA 2PMUA 1REPC 5FGMA 1K78A 4OIQF 4YG2F 1PUEE 3ZMVA 1BM9A 2PJPA 2QM3A 3HTUA 1LQ1A 2D1HA 1R00A 5D4SA 3ZN0A 2VT3A 4EMSA 3COAC 3ZMSA 1R22A 1B9NA 1IXRC 2JZYA 4GGGA 5L3BA 1KQ9A 3N97A 1WWXA 2EFNA 1D3YA 1BBYA 2LF8A 2M5WA 3G3ZA 2OQRA 3F8CA 2CFXA 5BPDA 3KP3A 3QPTA 2DQRA 5L3EA 3HIFA 5HLHA 1RIOH 2RC4A 2HTJA 4HBLA 4P9UA 2CGPA 2W85A 2W84A 2EV6A 2RNJA 5E20A 5HLIA 4CYDA 4G8XA 4EQQA 1USTA 2OD5A 5D6EA 1L3LA 4CHUA 1XSXA 2O3FA 2GA1A 4LG0A 3K1MA 3MAJA 4Y15A 2OBPA 4NHJA 2H6BA 1Z6TA 5E8IA 5ILUA 1W7PB 2NS0A 4RGSA 4KMFA 1HQCA 3IC7A 5K5QA 3TO7A 5TJJA 5F64A 5JHUA 5ICEA 2CO5A 2F2EA 1LVAA 3MWMA 1T0FA 3WGIA 3FM5A 3E6CC 5LEJA 3FX3A 1B4AA 2EB7A 2HKXA 3SHFA 1J75A 2KIFA 1NHAA 4I09A 3V8KA 3T1BA 4U0VA 4CZZA 1U8RA 3ML6A 3RIRA 2DTRA 3GXOA 3HSFA 3GVAA 2VOOA 5HVQC 1WI9A 4BH9A 4HX4A 5CLSA 1FP1D 1P2FA 2M45A 3EYIA 3KP6A 3ZMUA 2HS5A 4B8XA 5DD8A 2Y75A 3SZPA 1XSVA 4ZZDA 4L0YB 2A3SA 3C7JA 3E6BA 3GFJA 3ABTA 1ODDA 2P4WA 3F8BA 4UUVA 1S7AA 3R0AA 2BYVE 1ZG1A 1RUNA 1QZZA
chains in the Genus database with same CATH superfamily
1ZK8A 4BQAA 2OQGA 4B44A 3TOBA 4Q4ZF 1Z7UA 1CGPA 3CCRI 1JHFA 4U87A 2ZMEA 2ELKA 5FO5A 1SVLA 4A0XA 1I6XA 4PSXA 3SQNA 4A3GJ 3H3UA 3HKZA 1TNTA 2E36A 4OAZA 5F1JA 3HG9A 1FLIA 1XCVA 4JX4A 4F7ZA 1LE8B 5GP9A 4HRIA 4FQGA 3A0BC 4BYYA 1QO0D 2VXDA 2XF5A 2P5VA 4CCOA 3BP8A 4AYBN 1HKSA 1T8IA 2BXZA 4Z2YA 4LLNA 2W4SA 1TQPA 2IA0A 3CJTB 2PMZN 3CP8A 2ELJA 3SYTA 1U2WA 2RN7A 1EH7A 3O2PE 5GPAA 2QQ9A 3PM1A 5FB2A 4NQWA 2F48A 4CH7A 1MBEA 1BR1A 5M3MJ 2ESNA 3VDXA 3BR0A 1BW6A 2MLGA 1F5TA 3FDYA 1A35A 2DMQA 1R5GA 3DCFA 4XLEA 5HLGA 3OYEA 4XLHA 1RUOA 4PUSA 5E18F 3RSNA 3ASOH 3BT9A 3FXOA 1QPIA 4M74A 4X1EA 2DA3A 3Q9SA 2Q2EA 3TDUC 2ECBA 3H5RA 3FBNB 1IO2A 2ZXWH 1K61A 4E70A 1A5JA 1J7KA 1ETKA 4L5IA 2K27A 2F6CA 3QAHA 4AWXB 2VXZA 1TT5B 3RI4A 3HBLA 2X9DA 4XQFA 4BE0A 3DPLC 4O3MA 4S04A 5J1YA 1JT0A 1YOVB 1I1GA 3GF2A 3QPSA 4IPAA 2IGNA 4MIMA 4S05A 5A2QK 5H6QA 4EJWA 2EZIA 3H35A 5TGTA 3JRDA 3KPHA 3LFUA 1UJ8A 2HOEA 4XLFA 3MKWB 2ZXJA 3D5SC 4CICA 2FF4A 5E79C 5J1UA 1MMGA 3OS0A 2R5ZA 4G7ZF 4Y13A 3DTEA 2VUMJ 3GTMJ 5D5XB 4RGRA 4WK8F 1X1AA 6PAXA 2AS5F 4WWCA 4PJJA 3UR3C 2VQLA 4FISA 2VONA 2ISZA 3F6OA 3FMQA 3AL0B 3WTWC 4ZYHA 2WY7Q 4B43A 2Z3YA 2CSOA 5M5YJ 3Q0UA 4GYGA 3OYKA 1Z9CA 1KA8A 2QKMB 1GVDA 3A02A 3O3KA 3S2HJ 3JSOA 3D5RC 3TO6A 1XS9A 2L02A 2BE5F 4BS9A 2HPMA 1FX7A 2PX9A 3GX4X 5ILSA 3CMEI 1IUYA 3E7LA 3EETA 5A2QZ 5E17F 3K4BA 4DBRA 3OYAA 1TNSA 2KDZA 3QYEA 1T39A 3LAPA 3M3YJ 2XHKA 2E35A 3M8EA 2O03A 3FMRA 5B1BH 3K6GA 3ERED 2L7ZA 3RPQA 4I0AA 1Y6IA 5LFAA 2VPLA 1QPMA 2KQRA 1U78A 1O3TA 3OS1A 2HVSA 5BPIA 3DBHB 4AIDA 4K2EA 2EFOA 3F8FA 1WJ5A 3CCMI 3ZP5A 3HPHA 2W7NA 5KK1A 2X48A 4BHBA 3V42A 3S2WA 4F52A 1K4TA 4FE7A 2XF6A 5EZHA 2Y69H 2QQAA 2XIGA 5H6RA 5F0HA 2H8RA 4YRVA 2IAIA 2YU3A 3C18A 1N78A 2W57A 1MNMC 2V26A 2LKXA 1I3QJ 2M8GX 1MMNA 2XGDA 4L9TA 4HNUA 3G73A 4FHTA 2FRHA 2R7DA 3SXYA 2KIMA 3O6BB 1YJNI 2WV0A 3HB9A 5ICGA 2Q8KA 5GTIC 3S1MJ 2G9WA 2O7OA 4HG2A 3DEUA 1XMAA 2CQKA 2OUMA 5F0FA 3TL4X 4UVAA 1MSFC 1SD7A 4CYCA 4BY1J 1YYVA 5KVRA 4Y3OA 4XOPA 4LK0F 1R7JA 3CCSI 3ZQIA 2QLZA 3SFZA 2EFQA 3KZIC 1WCMJ 3JRAA 1K78B 4DOZA 2JVGA 2GWRA 2ACJA 3JRFA 2MGQA 2Z1DA 3K70C 1XSDA 2IS1A 5GADJ 1WJEA 5KAIC 1GLNA 4W1UA 1LFUP 2R7FA 1FYLA 4DYQA 1OLTA 1W7PD 4Y7NJ 3CCUI 2ESHA 4DGWB 4CCMA 1J9IA 3F3XA 3ZR8X 3DKWA 1SC7A 3HGGA 4F92B 4C9YA 4MTDA 1TW3A 3FXQA 3FIWA 2H1LA 2RVCA 4TV7A 1TBXA 1W5SA 4YFKF 2V7FA 2KRFA 4BEHB 2LH9A 2DQLA 4IEJA 2FSWA 3R4KA 3ZQHA 4IRIA 1V5GA 1F36A 4BE2A 5AIQA 2Z33A 1W0TA 1D5YA 1ZGAA 3QPHA 1SFUA 5JR3A 3E1SA 2DMNA 3BLYA 3M07A 3KZYA 1ONVA 2XVCA 2ZJQF 1B9MA 3BR6A 2P7CB 5FKNA 1ETOA 1IRFA 4UXNA 2ID6A 5CVRA 3RKWA 5DV5A 3WHCA 3OR1C 1VF9A 5D8LB 1X3UA 2EJRA 2KL4A 3ZQCA 1IUFA 3ISPA 1QRYA 4EVIA 1U9OA 3VYUB 1HC8A 3FKIJ 2VJIA 1CF7A 3BQZA 4OIOF 1P4WA 2W48A 4WCGA 2XC7A 2EA4A 3OIPA 3RTRA 1SEUA 4LMYA 5EZGA 3R6SA 3RZOJ 1D8JA 5DDGA 1G8XA 1UAAA 1L0OC 2A68F 4D1QA 4R1HA 2DA6A 3OYHA 3EYYA 1HDDC 2OC6A 3BR3A 3K1PA 2L2OA 3GFMA 1RI7A 3MZHA 3CF2A 1Y0UA 2NNNA 2O6GE 3BWGA 2QSHX 4HLXA 1WJDA 2HU9A 4LG0B 3U1DA 4A5MA 2M4KA 2BOLA 2Y48A 4OIRF 2FUG2 4JP0A 4NC6A 3ZN1A 2ETHA 3FBIB 3FF5A 3UNGC 3HUGA 1P4AA 3PQKA 1TP4A 1EH8A 2VJ4A 1KGSA 1R49A 1X1BA 3PFYA 1BI0A 1T08B 2CFOA 3IP4B 3SDGA 4A93J 2YU9J 2ZFUA 2DFHA 4IRHA 1YW7A 4NC8A 1QBJA 5E1ZB 1Z3XA 3K7AJ 4OOIA 5FD5A 5JLXA 1WJBA 2JJ7A 3F9KA 1TW2A 2CW7A 2ZC2A 5CVJA 5E1XA 1PVEA 1XD7A 2KP6A 1R58A 4HQEA 1X2NA 2H27A 1OMIA 2A5WA 1M1EB 4UHTA 2DA7A 3DLAA 3H92A 2XSDC 5B1AH 1UB9A 3RYPA 3J7AY 2Z9OA 2KDOA 2IA2A 3BG7A 3ZQQA 1IN5A 2V6CA 2ZXIA 3WTSC 1KU9A 3AG2H 1BJZA 2DI3A 3GZ5A 4II2A 3M9AA 3ROUA 2M7BA 4JBAA 2EFPA 4KA4A 3KYCB 2HEOA 4IHVA 1K79A 2DXIA 1OYWA 4JOMA 3VODA 5LHHA 5K1YA 2Y9ZA 1RR7A 4RMNA 9ANTA 3F6VA 2E71A 4PJLA 1LDKB 4I2OA 2K86A 1EH6A 1MJ9A 1ON2A 1SVOA 2XKPA 1W1WE 4O5VA 1T0FC 4BXXJ 5J6XA 2LFBA 3B02A 3CQZJ 3S8PA 3O8HA 4WX9A 2HYJA 1IDYA 4HX7A 1LDJA 1T98A 2OCEA 1XGOA 4M6XA 5EEAA 4C30A 4E6KG 3V7SA 1O3QA 1UCRA 5EF6A 4BJ6C 1TTYA 1ITYA 4ENNA 2KJCA 1HSJA 3CUOA 5FD6A 1D1CA 4HW0A 1WGXA 4W97A 1Z77A 4ON0A 1GUUA 2A6HF 2FNPA 4BDYA 1MZBA 2VKHA 4ASNA 3HOZJ 3VOEA 4F91B 2E1CA 4I01A 3MKZA 2L9VA 2F4IA 2W24A 2D2WA 1YO5C 2OU2A 2DPUA 1MW7A 3BR5A 2VI6A 1KU3A 2VBYA 3GW2A 2LMDA 4AD9A 3EUAA 1IRXA 1E3PA 2HZDA 4IHTA 1NG7A 1XMXA 2HR3A 2PQ8A 1B8IB 2D1VA 3ESWB 3HKZN 4CDGA 2E1MB 4AM3A 3ZPLA 2XGEA 4DZJA 2O61A 4KIGA 2P7VB 5JVTA 3JTGA 5HOOA 4XR6A 2GAUA 4Z6YA 4U0YA 4AUXA 1V55H 1G3SA 4I02A 1G59A 3KETA 2A05A 4BQNA 1GV5A 2EIKH 1QQIA 1X1CA 2R7SA 1TWGJ 3DBLB 3U1KA 2IXSA 2QVOA 2PMHA 3HTSB 4MO7A 3GTGJ 3DF8A 3KZZA 2QCOA 1Z6RA 4PSWA 3CESA 4ZYDA 3PFIA 3JAMZ 3DBRB 3CDHA 3KIOA 1ZYRF 1ZGJA 3ERMA 2PLYA 1MBGA 2XROA 5JLWA 1F4KA 1UMQA 3RJPA 3TO9A 4M71A 1Z7LA 3HJEA 3HOYJ 3GZNB 4E7IA 5EEGA 3I71A 4DJAA 2ZMEC 1B59A 1IV8A 3GLXA 1AKHB 1FJLA 1E17A 4HSRA 2K3FA 4A3MJ 3KLNA 2N8GA 1ZREA 4EM0B 2G7HA 2K9NA 4ABZA 3LA7A 4RA2A 5C4JJ 3JRHA 3ZMTA 3ULQB 3LFKA 3T5XA 1OCTC 1EKEA 1IN7A 3ZRGA 3T8RA 4IHSA 4BJTA 3KYDB 3JRGA 2VE8A 4A3IJ 2BW3B 2KISA 4GRIA 1HCRA 5DM7F 3WU1B 4A2UA 2IGMA 3PQJA 1EV7A 2VPRA 2M7AA 5GTHC 1QVUA 1ULYA 2CWEA 1KU2A 3CTAA 4BQOA 1WHUA 4DQ2A 2O0YA 1GXPA 4D0PA 1LFPA 3CLOA 2OZ6A 4PJ0C 5JVGF 3QYFA 2V6EA 4GXOA 4H0EA 2B7EA 2M87A 2A61A 4C2MJ 2JPBA 3BQYA 2R7VA 3ABUA 3J80Z 2BY1A 3CUQC 4HX8A 4CCLA 3QRFF 2AXTC 3HL2A 3MQ0A 3LMMA 5HDGA 1IN6A 2IGKA 4A69C 2DOAA 5J4VA 2YX4A 3LA2A 1TWCJ 2YSRA 5DYMA 3CO6C 4CCJA 2DPDA 3FXUA 1IGNA 4ESJA 4HEA2 3KP5A 2VIXA 1WZ2A 4M3EA 3O8GA 3HOWJ 2DJNA 3CJRB 1KZHA 3A01A 3LWFA 1JGGA 1VFCA 1APLC 3NRVA 2ZJPF 3WGHA 3Q9VA 4WXDA 1S72I 1P92A 2E1NA 3G1OA 3GTLJ 1QZEA 4LLLA 4EGZA 3FM3A 4ZYGA 3W2VA 4KT6A 4M6YA 4CCKA 2KLOA 5B5EC 5LGTA 5EGOA 3OYCA 3GTQJ 3JTHA 4XBFA 3KCCA 1K6OA 4BU2A 1KQ0A 2CU7A 1F9NA 3LSRA 1EA3A 3OIQA 1A31A 2KFDA 2ZKZA 2M0MA 5M3FJ 3ECOA 4XORA 5F27A 1T56A 4C3HJ 1R4NB 2JVHA 3FHNA 4A6DA 3QOEA 2GA2A 3KEYA 2QQBA 1FBUA 1U5TA 1BJAA 1ZELA 3H5AA 5JFRA 2LC2A 3PL8A 2RGVA 4IVNA 1MBHA 1TLHB 2Y31A 3NWSA 4IF4A 3WTXC 4C3IJ 1SD4A 1JUMA 3BJ6A 4LB6B 3MD2A 1DPRA 2H94A 1HA8A 5D5VB 3ABKH 4EJTA 1QGPA 4MGRA 5F6FA 3V8JA 2V1DA 3KP4A 1H8AC 2DTZA 5L3FA 3L1PA 1ZN2A 5FLVA 2MABA 2G0EA 3RZDJ 3I4PA 4AVZA 3K4KA 2FEZA 2XPUA 5L3GA 2I10A 2LDUA 4E7HA 4CYCB 4I7HA 3G1LA 4GCVA 4UUSB 3F22A 2OF7A 4KIFA 5F0CA 3CO7C 2VOPA 2L7KA 4ESFA 1WVRA 4EJOA 5HS8A 5IPAA 3GYHX 1XCBA 2WWYA 5K5RA 1UG0A 5IP7J 2BVMA 2X4HA 3L9FA 3BJOA 2X51A 5K5OA 4AVPA 5FRNA 4AIJA 5B3SH 3PIPF 4UNOA 3K0LA 2RQPA 5AIPA 4PFOA 5E3OA 3LSMA 3ZMZA 1WJCA 2FX0A 4FCYA 2ZFWA 1VQLI 2L5QA 4JQFA 4AIKA 3MCZA 2E60A 1TWHJ 3JRBA 1YFHA 1VNDA 3IAS2 4HNVA 2A69F 1DP3A 5FJ8J 1EF4A 2DFFA 4I76A 3K4LA 1P6RA 3N4MA 4P5OA 2EPFA 4KN7X 3KP7A 3AG1H 2O8XA 4B1RA 1U9NA 2EINH 2FMLA 3H9JA 4PFPA 1VQPI 3QWLA 1FTTA 3W2AA 2LY1A 1FSEA 1AWCA 2OAZA 3RCOA 1AU7A 2GLOA 3JR9A 4HZFA 2FBKA 2Y0SA 4XN3A 3R0JA 3EDPA 4GO1A 3OYJA 3K10A 2L9SA 2K85A 2K5CA 3NARA 4BY7J 4ENKA 2IS6A 4UUTA 1FIAA 4AIHA 1HKTA 1X1DA 1YTYA 2DN0A 1JTYA 3L2VA 4RB0A 2AO9A 3MVPA 2QSFX 2FBHA 1GHCA 2L4MA 4L9NA 1T33A 1J2XA 4LLGF 2PBIA 4LGWA 1BL0A 3I5UA 3ONQA 1P7IA 3OR2C 4KMUX 2DLLA 4U7DA 3WTTC 4MEYF 3AKZA 2CQXA 1XN7A 5CKTA 4H4KC 2DW4A 2JN6A 5HODA 4OIPF 5LLQA 1LEBA 2X0LA 2V4JC 2CMPA 3IH3A 2E7WA 2FNAA 2LKSA 2K40A 1PYVA 2PFBA 1ZRFA 2KRHA 3CUQA 4CA0A 5J47A 3EUKL 2HOTA 3QQAA 2QSGX 1E3HA 2HQNA 1A6IA 3U9GA 1P4XA 2P81A 1OISA 2K4JA 3HUGB 4YIIA 1UG2A 3V4GA 2XGXA 2HOSA 4LITA 4LIVA 4N9HA 1JGSA 1FY7A 4XKVA 2W1OA 1VQOI 2B63J 2BY0A 2VJ5A 3IHUA 3I56I 1Y1VJ 4BGDA 3RKQA 2NVQJ 3H9QA 3B73A 2FE3A 2ECCA 3HSRA 2LRDA 3BJAA 2PEXA 1AOYA 2AHQA 2YR2A 4RGUA 4LIUA 2DJIA 2DA2A 4F3QA 4N4NB 1MDMB 3FXKA 4OMYA 1D8KA 4KISA 1R36A 4UV8A 4P55A 4D7NA 4PCQA 4RGXA 3GBGA 5FKMA 4RLFA 2JRTA 2HQRA 2IEKA 4MHGA 1WKMA 3W3CA 2DA4A 1E3OC 2UV1A 4ITVA 1JTXA 1XPXA 2NAZA 2GIZA 4L5JA 4CZCA 3RQ4A 3DLLF 1DGWY 1MGTA 2CH0A 2ELHA 2VQCA 5LRRA 4OAYA 3SZGA 5LRSA 4P9FA 1KQ8A 1U0JA 2XAQA 1A6QA 3BTJA 1IN8A 2UZKA 4RAGA 1XMKA 2E1OA 2OCCH 3NAUA 2WAQA 1J5YA 4KNYA 1W7PA 4CO8A 3IV5A 2EBIA 4PK4A 2VC0A 3PJRA 3HHHA 4L0ZB 3W6KB 1OJLA 3PSIA 2EK5A 2CUZA 1NTCA 2ID3A 4A5NA 2HI3A 4IO9F 4XRSA 2LP0A 2HVRA 1XB4A 4Y4RA 2VL8A 2XDVA 4IZZA 4NNJA 1SFEA 3GWZA 3ZGKA 2I5UA 2M9HA 2W25A 1K4SA 3HGYA 5LHGA 2GXAA 1FC3A 2A6EF 3WG7H 1FP2A 3K2ZA 2R92J 2XAFA 3JSPA 3BG6A 3LSTA 2XUBA 1BI2A 4MNUA 3S15J 4QIWN 1OYIA 2DOFA 2CW0F 4G6DA 1PP7U 2FQ4A 3JRCA 3CC7I 1X58A 4B3XA 3CJNA 1WJAA 2MA3A 2C6YA 2BVLA 3CMAI 1WI3A 3DKXA 1I3AA 3KFWX 4GYIA 2HDCA 1R71A 3I54A 2JA6J 4PGGA 4A3BJ 2LBFA 1OR7A 2XASA 2P5LC 1N75A 2DOEA 1YX3A 1X3ZB 5F08A 3A1YA 4J19A 1SD6A 4DYCA 4L18B 1LKXA 3H36A 4G12A 2VKVA 4L9JA 3VEPA 1QVTA 3K69A 3BPXA 4YIRX 3W6JB 3DU5A 4XOTA 1LNWA 2DFIA 3E3VA 2HYFA 3LL7A 2HPIA 4F93B 2NOJB 1OCOH 3J7ZI 3M1CA 1VZ0A 4BXUA 5J1RA 3M8FA 1TQMA 3GEZA 4HPQA 1LB2A 4BNCA 1Q1HA 3K9TA 4UVBA 2ZJRF 3I55I 3JREA 4ENJA 3IL2A 3VSKA 3V7CA 1FOWA 1S7EA 2EIJH 1FMWA 2NS7A 1PUFB 3GO5A 5DCMA 1SFOJ 1O3RA 2QENA 3DV8A 2J5OA 4N4OB 5DM6F 2OZUA 4XK4A 5K7ZA 1IZ1A 3WU0A 1YLFA 2GM4A 4HAMA 2JA2A 1A36A 4HDUA 4IHXA 1O7LA 3HPGA 2HDWA 2NVUB 1G3WA 2KZVA 2DBBA 2WV1A 3SZTA 3DTIA 2M3AA 2MH9A 1VQNI 2M4GA 3SEZA 1IRGA 1YRNB 4XMYA 1LE8A 2LK2A 4L9VA 1FWZA 1LPQA 1JKPC 2JA7J 2K9QA 2R3SA 2AXLA 1D1BA 4UVCA 1POGA 1DU0A 4C2UA 5IY5H 2CQQA 2FBIA 4A3EJ 5BNGA 2XRLA 3OL3A 3C3WA 4WXCA 4QWQA 2JT1A 2DDAA 1SFKA 3PO2J 3HM5A 5D6FA 3M1EA 1QA6A 5FRMA 2QQ8A 3KE2A 1HOMA 5HDKA 3MZYA 5KHDA 1B6AA 3L2QA 3M8JA 5FLMJ 2PG4A 3DTKA 3A01B 4E4HA 3I4NJ 1ZH5A 4NBQA 3UKGA 1YW8A 3E5QA 4QLCU 1UHSA 1CQTA 3OSGA 3RPUA 1STZA 2UUZA 3HOSA 2LY9A 1YJ9I 4XRFA 4I6ZA 1UHMA 1RRJA 1RZ4A 1WSUA 1RPWA 1WRJA 2EZLA 1UZCA 4M73A 1ZRCA 3NQOA 3ZQLA 3OOUA 3BTIA 1HW2A 1UELB 3QPLA 2K4BA 2OPTA 5CVIA 1JKOC 2NNYA 2WTEA 2K9MA 3IH4A 2XRNA 3OYMA 2BBYA 4XKCA 4HQMA 3T8TA 2ZO4A 3Q3SA 2R5YA 1Y39A 3P9CA 3PUFA 1W0UA 3MEXA 2VKEA 4ZZLA 1XGSA 2XAJA 1LJ9A 2BY3A 1ZGWA 3I4MJ 4ZH4F 5LGNA 5L3DA 1W36C 3HRMA 3VYSB 4KYWA 3ZMDA 3FWEA 3ABLH 3QP5A 4NB5A 2V1XA 4RAFA 1BC7C 3MKLA 2V9VA 4Q47A 3IRRA 4RB1A 2EIMH 1LDDA 2VQGA 3H3ZA 4I99C 4MEXF 2XAUA 3V7RA 1IXSB 3E5UA 2QGUA 2XB0X 2R7TA 1MNDA 1LEAA 1W4MA 4BHPA 3KEQA 2LOOA 3R60A 2R7RA 2BGCA 1MJBA 1FSHA 1DDNA 2M30A 1MSEC 3DU6A 4A0YA 4D7MA 1U5TC 3I64A 2XV4S 3HOUJ 2IS4A 3C1DA 4XSXF 4Y52J 2ISYA 3TP3A 2OTJI 4I0BA 4YELA 3LSPA 1R5ID 2VQHA 5IOZA 3HOVJ 3BZ6A 5FLXZ 4O6JA 4KN4X 3HYIA 2VASA 2V1UA 3WG9A 3IWZA 1I27A 3WHBA 3S32A 3IUOA 2O8KA 4Y33A 2YX7A 3JRIA 1R6RA 3IH2A 3JAMK 3I53A 5IP9J 5BMZA 1ETQA 2M1BA 1B72B 4FT8A 2F5EA 4X0GA 4QPOA 3LSJA 3S14J 1E0EA 1ZG5A 2KPMA 3RDIA 3D5LA 4HOBA 1Y8RB 2L01A 3CZ6A 3OIOA 3CC4I 3OYDA 3PIOF 2DMUA 2KHMA 2QKLB 1FTZA 3S1RJ 1NK2P 5J4YA 2V9KA 1UHWA 4B4CA 2ZMEB 4OINF 3VYTB 3LNQA 3HRTA 1TZLA 1HSTA 1Z91A 1XTAA 2XAGA 5KAFC 5DTDA 3BY6A 1E2XA 1RR8C 4KT5C 1FNNA 1H9GA 1R5HA 3PNTA 3RKYA 5J8CA 3TOAA 4KFCA 2XSJC 4IQJA 5DCFA 1SANA 4IJAA 4FX0A 2XKOA 2HYGD 5FFZA 3L00A 1YX5A 2JA8J 3N05A 2L7FP 2DT6A 2CQNA 2L9NA 3F21A 2ZNZA 2H09A 2VBWA 4NQWB 4AC0A 4G7HF 3AG4H 1I50J 1BR4A 1XGNA 4XIDA 3TEDA 2H8WA 1TL8A 2GQQA 4B3AA 1LUJB 4U0WA 1IXCA 1K83J 2GBYA 3TQNA 5LHIA 4UY8I 1USSA 3FXMA 1FBQA 1ZTRA 5D5WB 1B1BA 5EEHA 1V54H 1W5TA 5HDNA 3J80K 1K7AA 1JJ6C 4IHWA 2L54A 4HV5A 4IOAF 3L7WA 4ZDPA 3CUQB 1I5ZA 1BOAA 5LBQA 2Q2EB 1X3WB 3E5XA 4RM2A 4B47A 1ETWA 1WH5A 2BZTA 4C3JJ 1MKMA 4LJZF 3OYGA 4IHYA 2JSCA 1FYKA 2JSPA 3FK6A 5EG0A 5TRDA 3IWFA 3LSKA 3K70D 3J7AO 2M2EA 4RDUA 4A3JJ 4BQQA 1MJAA 3FMSA 5FKLA 2ADUA 2Q1ZB 1TT0A 3QYBA 3OV8A 3H0DA 5LEKA 1IJWC 5ICFA 3REOA 1AA7A 1DQUA 4Q48A 2R5ZB 5E8GA 1OYYA 1R1VA 2K7LA 3LQQA 4DNCA 2DODA 3K1NA 1D0YA 2DO7A 2IPQX 1T6SA 2JUGA 2F5VA 1S6LA 2EWNA 2Q0OA 2L4AA 2NXNB 3E0JB 1BC8C 2YUSA 4FX4A 1Y1WJ 4XICA 3FK7A 3GCMA 2COMA 3BROA 4HF1A 4A3CJ 2G7UA 5E3MA 3ZOBA 1YG2A 2EQRA 1XGMA 4NDLA 2HVQA 2ZSHB 3GTJJ 2ZBKA 2WAQN 1MMDA 2ICWG 4A3KJ 4WXHA 5GAEJ 2XF7A 2I8DA 1HDPA 2Z2SB 4HYEA 3K2AA 2VKDA 4G6TB 4EJVA 4ENMA 4PZJA 1SFXA 5IT3A 4RB2C 3LQRA 5IP6A 1YIJI 1C0WA 1VQ5I 4MQ9F 1G2HA 2Z16A 3BG3A 1JHHA 2EH3A 3KP2A 3P9IA 3DPTA 2DK5A 1YQAA 3IAM2 1OCCH 4RAYA 1O4XA 4Q5SF 3U2RA 2M0CA 2R0QC 3GTOJ 2P5KA 3WODF 2JA5J 5DUIA 2MSYA 2VODA 1HBXG 3S1QJ 4E7ZA 2VLAA 2HGCA 2Y9YA 3HEFA 2BHZA 1JI8A 3HC7A 2A07F 4I98B 3TDZC 2E2IJ 1D5VA 1HF0A 2K02A 3TBIA 2D5VA 4YFXF 5DS9A 2E2HJ 4OMZA 2HQAA 4KICA 1ZKGA 5AONA 3CJQB 1VQMI 2NVXJ 2LG4A 2W00A 5D8KB 2F4MB 5LGUA 2FMYA 2CUJA 2MC4A 2ZNYA 2VBXA 4BACA 3ZCOA 4EEFG 5DUKA 4RM3A 3HRSA 4BL0B 3SJMA 2F5CA 4MQVA 4KUMA 3WTUC 4Y17A 2M8EA 2Y2ZA 4CSWA 3Q0VA 3CMMA 4FETA 5HNHA 3W6VA 4PDKA 2VN2A 3B6CA 2X6WA 4RB3C 4EATA 1JUPA 4KDPA 3ZXSA 2IT0A 3L2UA 3JW4A 1ACIA 2EFWA 2NOGA 2RNGA 3I59A 1TQIA 4LFUA 1FYMA 3HOXJ 4LG3A 2V1NA 1MBFA 1O7FA 3G4SI 3S3OA 3DXJF 3BOQA 4LK1F 2DYRH 3CLQA 4ZYEA 5E1WA 2L7MP 2AQEA 4P96A 1G4DA 4LB5A 1XDUA 3L2CA 4FTHA 4M72A 3LSGA 5KCMA 4ZC3A 4D5FA 2MLKA 2IP2A 4DIQA 5GPCA 2HKOA 3IKVA 3A03A 1FOXA 2MBFA 2DAOA 3G2BA 1Q1VA 1BI3A 3OYBA 1W5CC 1PJRA 2QBYA 2L0KA 5FFXA 2X6OA 3GFLA 5CJ9A 4CUGA 5F1RA 4GFBA 1V3FA 2DA5A 4JK1X 1T38A 4HV6A 2BEOA 4D9JA 1I39A 1OR7C 3MMYB 1B8IA 5ICCA 5DCMB 3L2RA 1WH7A 2FD5A 4XSZF 4NUBA 2QF7A 4G6QA 1MH3A 1ON1A 2E5NA 3FXJA 4KITB 4U7BA 2GXBA 2TCTA 4QSHA 1XC5A 2CS3A 2CV0A 4B09A 1HW1A 4BXFA 4EM2A 3TGNA 3QU3A 1BI1A 1Y56A 2IGOA 2V9PA 2H6CA 3LSIA 2WB1A 2FOWA 3FHZA 2FOKA 5IYBJ 4LD5A 3I0TA 1XDSA 2OA4A 3OYFA 1CF7B 1SMYF 5BQTA 3A4CA 3OL4A 2KRCA 3NWTA 1H88C 4EGYA 2IA1A 5IYCJ 2DK8A 5DEQA 4V2GA 2D45A 5J8FA 1FPQA 2TDXA 1VQ8I 5IT9K 4HLYA 2PI0A 1G3TA 3DWLE 2IVMA 1R4MB 3K4NA 3DQVC 4HF0A 4F55A 4E7KA 3CCJI 2XPWA 4UB6C 1JJ8C 3BR1A 1JKRC 4IOCF 2JPCA 3IRQA 1JE8A 5JHFA 3F8NA 5TISC 2KIUA 1AKHA 2H1KA 1Z3YA 3GUDA 5BOXA 1R1UA 2MD5A 2PJRA 3S2DJ 1HXDA 2WC2A 4RS8A 1N25A 4PGHA 1HKQA 4M9ZA 3OS2A 2UWMA 1IV6A 3WTVC 3P9KA 3GTKJ 2EILH 4BDZA 2GZWA 5IT9Z 3HXLA 3CCVI 3S93A 3OYLA 5DD4A 1LFBA 5H2FC 3JCUC 3CD6I 1IDZA 2F4OB 1J09A 2LYCA 3GTPJ 4M9SA 2P8TA 1TC3C 3OMYA 2BW3A 1R1TA 4JYKA 3SEQA 3U21A 3GMEA 2ZJ2A 4IQ4A 4XLCA 4HF2A 4U88A 5HNFA 5CVUA 4J00A 1JKQC 5GAHJ 2R5YB 3R61A 1QZYA 5EDNA 1MMAA 4XRSG 2CRGA 4CCNA 2NVYJ 4BHCA 1O57A 2WA0A 3CMYA 4XKWA 1ZLJA 1O3SA 3VWBA 1IF1A 3K4JA 3FZVA 5K7HA 2XAHA 1T2KA 1ZHFA 3FKJA 2UXXA 3WE2A 4EV0A 2DT7B 2QYOA 1BOBA 2VC1A 4YIFA 3TKYA 2HFHA 3PO3J 5HS7A 1QNTA 2V79A 1A04A 3D0SA 3MZ8A 3J81K 4PJMA 4KIBA 2HNHA 2XB5A 2R7ZJ 2P0WA 3EPZA 1ZARA 3KEOA 3Q5FA 1MIJA 1GDTA 1MBJA 3IKTA 1DPUA 1TWFJ 4XM3A 4A0ZA 1S8NA 4HNTA 3AAFA 2VE9A 2EV0A 3H9GA 3KLOA 5HLTA 2KMUA 2NRAC 2KKOA 2DA1A 2JTVA 1N77A 2R7OA 1R23A 3EUHC 1PP8F 1DUXC 1X2MA 2IS2A 3P5JA 2GOMA 3AFHA 4BAYA 1OPCA 3GLLA 4XNFA 4RAZA 3CCLI 3AL0C 3BCBA 1YW9A 4BJ5C 2IW5A 3G1MA 2STWA 1QHGA 2RV8A 3BCAA 2R7XA 3J81Z 1ZR4A 3M7GA 3PNVA 1Z05A 1KYWA 2JQ7A 1FOYA 3S3NA 2MD0A 4DZPA 2NS8A 1RESA 1ZLKA 2ME0A 2FJ1A 3OYNA 2MH2A 2NVTJ 1G3YA 3BC8A 1FT9A 2JWTA 3RKXA 3PUBA 1SMTA 5CYVA 2QZ8A 3I3LA 4XL9A 4CXFA 1J0RA 2P6SA 3MKYB 1OFCX 1FBSA 1OCPA 4HSTA 3T0YA 2LD5A 4IL6C 3RQIA 2R7UA 1ETXA 5ERIA 2HZTA 5JI6A 1GT0C 1I1SA 3FXRA 4UUSA 5EYRA 1X1PA 1YHQI 2DYSH 2LKPA 2X85A 2HXIA 2MYSA 3EQLF 3CCQI 4MLOA 4M3GA 1BIAA 1S7OA 2IBDA 4UB8C 4ZDLA 1MH4A 1X4OA 3DEEA 4OWRB 2JK3A 2LSOA 4BKXA 4RBOA 1ZQ3P 2QWWA 3F72A 1G6NA 4ETSA 4BE1A 2MFZA 4M3DA 5GAGJ 2B0LA 2RDPA 2DMTA 3V8LA 1VQ9I 2X1DA 1OKRA 4G9YA 2WBMA 5CVVA 4HA8A 1QHHD 4M9XA 4XONA 4A6EA 3HDDA 1S29A 3I58A 2YPRA 3HZJA 5EG0B 1TWAJ 3E6MA 2IJLA 3OSFA 1YIOA 3ASNH 2FQ3A 3WTYC 1FOKA 1GVJA 1D1AA 2RKHA 1H0MA 2FA5A 2CUEA 2K9LA 3RYRA 1DP7P 4MTEA 3L2WA 2IRFG 4XLPF 2GOXB 3K4CA 2EA2A 2E7XA 2GXGA 5BS6A 3I9V2 4ZTJA 2X1EA 5CPRB 4LOCA 1ZAOA 4UV9A 3S3MA 3HOTA 2QEXI 2CG4A 4G94A 1NG6A 3WE3A 2HWVA 4R8HA 4P1WA 2DCEA 4G7OF 2NYXA 1JUSA 3GZ6A 3E6DA 1GXQA 3OOPA 1IAWA 3VPRA 3SDBA 4ZTFA 2KJBA 3WU2C 1VQ4I 1ZRDA 2LF7A 2E5ZA 1XG1A 2CUFA 3P7NA 1IN4A 2J5PA 1IC8A 3TMOA 4XRMA 5ILVA 1VTNC 2X1CA 2STTA 4V2FA 3DPUA 1OCZH 4AYBA 3ELKA 1YI2I 2OV7A 3LA3A 2LTPA 1MD0A 4R79A 2PMZA 3QOPA 3QU6A 3DFGA 3GFIA 1XX5A 2LVSA 4E7LA 1U3EM 1SD5A 2R7QA 1IRZA 1WJFA 5HS9A 4MFEA 1SVMA 3NEUA 1V4RA 1NH3A 2O5RA 5EGOB 4MFDA 2KT0A 5H20A 4ANJA 3BPVA 1H9TA 3H3VK 4A12A 2ZSIB 3CCEI 2MC3A 2Z5UA 1X4PA 1D0ZA 2LY2A 2A6TA 5D4RA 1D0XA 5ED4A 4YEJA 1UFMA 2CYYA 5EJCA 1YS6A 5C44J 1I6HJ 2F5DA 2AQFA 3HRUA 3BR2A 1HLVA 1U5TB 2CQ7A 4S0HB 1FZPB 3LSHA 1ZG3A 2KZGA 4IKFA 3E97A 2Y0MA 3CC2I 4YFNF 3LAJA 1RETA 5FLXK 1MDMA 2P6TA 2L9RA 3EUHA 3WGGA 3TW6A 1J59A 4EJUA 1HW5A 1U6GA 3OY9A 3VFZA 2XGCA 1ZR2A 2DDBA 4N0BA 2A5YB 2EZHA 4XLNF 3G71I 2CV1A 2WAEA 3ECHA 1IW7F 3A0HC 4E7JA 2VBZA 3BZKA 2HTSA 2X6YA 1NK3P 3QP6A 1SAUA 1KYZA 3WTZA 1YS7A 1DU6A 3ZQ7A 2L3DA 4HDVA 1S3JA 1JXSA 3S17J 1KU7A 2OJED 3I59B 4QTRA 1RNLA 1KONA 3L09A 1BIBA 2EZKA 3F8MA 2W82A 4OU0A 2GIVA 1R9TJ 1OCRH 2FU4A 1PDNC 2OTLI 4N9IA 2QA4I 3S16J 1FIPA 1F1ZA 4IRGA 1Z67A 4ZDOA 1RC9A 1ORKA 2WADA 3B6AA 2MG4A 4WF2A 2PN6A 3DP7A 3VSLA 2Y0SN 3F23A 3C2HA 2DT5A 3RPUD 2Z99A 1Z1DA 1EJ9A 4EM1A 1RKTA 1S5LC 2YS9A 2ZCWA 5LD2C 2F5FA 4GDFA 2QBYB 3VB2A 5D5UB 2COBA 1WQ2A 2UXNA 1BR2A 2VT2A 2DU9A 2EV5A 4IXAA 2O9LA 2LNBA 4CGZA 2WB1N 4IX7A 2FXAA 2ZB9A 4ESBA 1Z21A 5L3CA 1ETYA 1BN5A 1SAXA 5FKOA 3BDDA 3ZQGA 3MFKA 2BV6A 2JMWA 3HSEA 2TRTA 1Y8QB 3CCYA 4DBQA 3BG9A 2QUFA 3HHGA 4RLQA 2PMUA 1REPC 1VQ7I 3QODA 3OWTA 5FGMA 4V19K 1K78A 4KJZA 3ZQFA 4OIQF 4YG2F 2JUCA 1YJWI 1PUEE 3ZMVA 1BM9A 2PJPA 2QM3A 5F04A 4BBSJ 3HTUA 1MNEA 1LQ1A 2D1HA 5C4XJ 5IYDJ 1R00A 5B66C 3PSFA 1FEXA 5D4SA 2MW8A 3ZN0A 2VT3A 4JX5A 4DW6A 3TP0A 4EMSA 3CF5F 5E3NA 1IG7A 3COAC 4XN0A 5E3LA 3ZMSA 2VB6A 1R22A 1B9NA 4A3FJ 3M4OJ 2E1MC 4XLAA 1IXRC 2JZYA 1VI0A 4E7SA 4GGGA 5L3BA 2M34A 5J3LA 1KQ9A 3N97A 1WWXA 2EFNA 2DFEA 1D3YA 1BBYA 2CJJA 2LR8A 3C2GA 1P7JA 4BEHA 2LF8A 2M5WA 3G3ZA 3FXLA 2OQRA 3F8CA 2CFXA 5BPDA 2PJRB 3KP3A 1T95A 3QPTA 1V5EA 2DQRA 2LREA 2RREA 4D5CA 1Y0NA 3G6EI 5L3EA 1PUFA 2CW8A 4NC7A 1GV2A 3S1NJ 2HXOA 3HIFA 4M6VA 1FMVA 2E19A 1H89C 5HLHA 4PJNA 2ME6A 1RIOH 2E2JJ 1ENHA 3D1NI 2RC4A 1MBKA 5CQEA 2HTJA 4L5EA 2JRMA 2LLKA 4JX6A 4HBLA 4P9UA 4FE4A 2CGPA 2W85A 5IOYA 1YRNA 5FROA 3OYIA 5CQGA 2W84A 2EV6A 2RNJA 5E20A 5HLIA 4CYDA 4DYRA 3SFIA 1LVKA 4XKBA 1MMSA 3BZCA 4G8XA 4M3BA 4EQQA 3BTLA 1USTA 4X6AJ 3C2BA 2RQQA 2OD5A 1OQYA 5D6EA 4ZYAA 1L3LA 4CHUA 1YE9A 4BUPA 3PNYA 3FISA 1VQ6I 5C3EJ 1XSXA 2O3FA 5KNLA 2GA1A 5J40A 4LG0A 1JT6A 3K1MA 3MAJA 4Y15A 2VJJA 2OBPA 4NHJA 1V5FA 2H6BA 1ERDA 2K3PA 1Z6TA 5E8IA 5ILUA 1W7PB 3KX2A 2BY2A 2NS0A 3K4MA 1HQCA 2XPVA 4RGSA 3IC7A 1AHDP 5K5QA 4KMFA 3TO7A 3F0CA 3Q0WA 5FKKA 3BTCA 1P9QC 1DGRM 2HDDA 5TJJA 4J01A 5F64A 5JHUA 2R93J 5ICEA 2CO5A 2F2EA 2R7WA 1LVAA 3MWMA 1T0FA 3X2QH 3WGIA 3FM5A 3H5NA 1RKWA 3H1CA 3E6CC 2Y30A 2ZXHA 1BW5A 3W2WA 2K9SA 3MN2A 3AG3H 5LEJA 3FX3A 4B48A 1B4AA 2EB7A 3TW7A 1S9HA 2HKXA 3A2KA 3H0GJ 3SHFA 1J75A 4BBRJ 2KIFA 1NHAA 2WAFA 3DKYA 4I09A 3V8KA 4A3LJ 3T1BA 1F43A 5K7FA 4U0VA 4CZZA 1U8RA 3LOCA 3CDIA 3ML6A 3RIRA 2DTRA 3GXOA 1WFXA 3GVAA 3HSFA 1YITI 2VOOA 2B9SA 2KIQA 5HVQC 1WI9A 3CP2A 2BXYA 1K6YA 2R4GA 1WPKA 2LBFB 4BH9A 2BHYA 4HX4A 4AU7A 5CLSA 1FP1D 2WY8Q 3DEWA 5M5WJ 3KYLA 2HQ5A 4A3DJ 2X6XA 1P2FA 1U8BA 2M45A 1X19A 4QPQA 3EYIA 3J7YJ 3KP6A 1W36D 3ZMUA 1BA5A 2HS5A 4B8XA 1QU3A 1Z0XA 5DD8A 2Y75A 3SZPA 1XSVA 4ZZDA 4L0YB 3CDLA 4II3A 2A3SA 2RAEA 3C7JA 3E6BA 3GFJA 3ABTA 4C2TA 1ODDA 2P4WA 3F8BA 2CV2A 4UUVA 4ZJZA 1ETVA 3ABMH 4M3FA 1B72A 1S7AA 2E34A 1VQKI 3BG5A 3R0AA 2HOAA 5M5XJ 2BYVE 1ZG1A 1RUNA 3VYRB 1QZZA 4FASD 2DMPA
chains in the Genus database with same CATH topology
4BQAA 2OQGA 3TOBA 4Q4ZF 1Z7UA 1CGPA 1JHFA 2ZMEA 5FO5A 4A0XA 1I6XA 3SQNA 3H3UA 1TNTA 1FLIA 1XCVA 4F7ZA 4BYYA 1QO0D 2P5VA 3BP8A 1HKSA 4Z2YA 4LLNA 1TQPA 2IA0A 1U2WA 2RN7A 1EH7A 3O2PE 2QQ9A 5FB2A 4NQWA 2ESNA 2MLGA 1F5TA 1R5GA 5HLGA 1RUOA 5E18F 4M74A 3Q9SA 2Q2EA 3TDUC 4E70A 1J7KA 4L5IA 2K27A 3QAHA 4AWXB 2VXZA 3RI4A 3DPLC 4O3MA 4S04A 1I1GA 3GF2A 4IPAA 5A2QK 4S05A 5H6QA 4EJWA 2HOEA 2ZXJA 4CICA 2FF4A 4G7ZF 4Y13A 5D5XB 4RGRA 4WK8F 6PAXA 2AS5F 4WWCA 2VONA 2ISZA 3F6OA 3FMQA 3WTWC 4ZYHA 2Z3YA 2CSOA 4GYGA 1Z9CA 1KA8A 3O3KA 3JSOA 3TO6A 2L02A 2BE5F 1FX7A 3GX4X 5ILSA 1IUYA 3EETA 5A2QZ 5E17F 1TNSA 1T39A 3LAPA 2XHKA 3M8EA 2O03A 3FMRA 3ERED 3RPQA 4I0AA 1QPMA 1O3TA 1U78A 5BPIA 4K2EA 2EFOA 3F8FA 3ZP5A 5KK1A 4BHBA 3S2WA 2QQAA 2XIGA 5H6RA 2YU3A 3C18A 2W57A 4L9TA 3G73A 4FHTA 2FRHA 2R7DA 3SXYA 2KIMA 3O6BB 2WV0A 5ICGA 2Q8KA 2G9WA 3DEUA 1XMAA 2CQKA 4UVAA 1SD7A 1YYVA 5KVRA 4LK0F 1R7JA 2QLZA 3SFZA 2EFQA 1K78B 2GWRA 2ACJA 1XSDA 2R7FA 1FYLA 1W7PD 2ESHA 1J9IA 3F3XA 3DKWA 4MTDA 1TW3A 3FXQA 2RVCA 4TV7A 1TBXA 1W5SA 4YFKF 2KRFA 2DQLA 2FSWA 3R4KA 4IRIA 5AIQA 2Z33A 1ZGAA 3QPHA 1SFUA 5JR3A 3KZYA 1ONVA 2XVCA 1B9MA 2P7CB 1IRFA 4UXNA 5CVRA 3RKWA 5DV5A 5D8LB 1X3UA 2EJRA 3ISPA 4EVIA 1CF7A 4OIOF 1P4WA 4WCGA 2EA4A 3RTRA 4LMYA 3R6SA 1D8JA 5DDGA 1L0OC 2A68F 4R1HA 3EYYA 3K1PA 3GFMA 1RI7A 3MZHA 1Y0UA 2NNNA 2O6GE 3BWGA 4HLXA 4LG0B 3U1DA 4A5MA 2Y48A 4OIRF 3ZN1A 2ETHA 3FF5A 3HUGA 1P4AA 3PQKA 1EH8A 1KGSA 1BI0A 4IRHA 1YW7A 1QBJA 5E1ZB 4OOIA 5FD5A 1TW2A 5CVJA 5E1XA 1XD7A 4HQEA 1R58A 2H27A 1OMIA 4UHTA 3H92A 1UB9A 3RYPA 2Z9OA 2IA2A 1IN5A 2V6CA 3WTSC 1KU9A 2DI3A 3GZ5A 3M9AA 3ROUA 4JBAA 2EFPA 4KA4A 2HEOA 1K79A 1OYWA 3VODA 5LHHA 5K1YA 3F6VA 1LDKB 4I2OA 2K86A 1EH6A 1MJ9A 1ON2A 2XKPA 4O5VA 5J6XA 3B02A 4WX9A 4HX7A 1LDJA 1T98A 1XGOA 4M6XA 3V7SA 1O3QA 1UCRA 1TTYA 4ENNA 2KJCA 1HSJA 3CUOA 5FD6A 4HW0A 4ON0A 2A6HF 2FNPA 1MZBA 4ASNA 3VOEA 2E1CA 4I01A 2D2WA 2W24A 1YO5C 2OU2A 2DPUA 1KU3A 2VBYA 3GW2A 4AD9A 4IHTA 2HR3A 2PQ8A 2D1VA 4CDGA 3ZPLA 2O61A 4KIGA 2P7VB 5JVTA 3JTGA 5HOOA 2GAUA 4U0YA 1G3SA 4I02A 3KETA 1QQIA 2QVOA 2PMHA 3HTSB 3DF8A 3KZZA 1Z6RA 4ZYDA 3PFIA 3JAMZ 3CDHA 1ZYRF 1ZGJA 2PLYA 2XROA 1F4KA 3RJPA 3TO9A 4M71A 5EEGA 3I71A 1B59A 3GLXA 1E17A 3KLNA 1ZREA 4EM0B 2G7HA 3LA7A 3ZMTA 3ULQB 3LFKA 3T5XA 1IN7A 3T8RA 4IHSA 2VE8A 3WU1B 4A2UA 3PQJA 1EV7A 1ULYA 2CWEA 1KU2A 3CTAA 4DQ2A 2O0YA 1GXPA 4D0PA 3CLOA 2OZ6A 4GXOA 4H0EA 2M87A 2A61A 2JPBA 3ABUA 3J80Z 3CUQC 4HX8A 3QRFF 3MQ0A 5HDGA 1IN6A 2YX4A 3LA2A 2YSRA 5DYMA 3CO6C 2DPDA 3FXUA 4ESJA 3KP5A 3LWFA 3NRVA 3WGHA 3Q9VA 4WXDA 1P92A 2E1NA 4LLLA 4EGZA 3FM3A 4ZYGA 4M6YA 5LGTA 3JTHA 4XBFA 3KCCA 1K6OA 1KQ0A 1F9NA 2ZKZA 3ECOA 4A6DA 2GA2A 2QQBA 1FBUA 1U5TA 1BJAA 5JFRA 2RGVA 4IVNA 1TLHB 3WTXC 4IF4A 1SD4A 3BJ6A 4LB6B 1DPRA 2H94A 5D5VB 4EJTA 1QGPA 4MGRA 5F6FA 3V8JA 2V1DA 3KP4A 5L3FA 1ZN2A 3I4PA 2FEZA 5L3GA 2LDUA 4I7HA 4GCVA 3F22A 4KIFA 3CO7C 2VOPA 4ESFA 4EJOA 5HS8A 3GYHX 1XCBA 2WWYA 5K5RA 2X4HA 3L9FA 3BJOA 5K5OA 4AVPA 4AIJA 4UNOA 3K0LA 2RQPA 5AIPA 3ZMZA 2ZFWA 4JQFA 4AIKA 3MCZA 1YFHA 2A69F 1P6RA 3N4MA 4P5OA 4KN7X 3KP7A 2O8XA 2FMLA 1FSEA 1AWCA 2OAZA 4HZFA 2FBKA 3R0JA 3EDPA 4GO1A 4ENKA 1HKTA 4AIHA 1YTYA 4RB0A 2FBHA 1GHCA 2L4MA 4L9NA 1J2XA 4LLGF 2PBIA 4LGWA 3I5UA 3WTTC 4KMUX 4U7DA 2DLLA 4MEYF 1XN7A 2DW4A 4OIPF 5LLQA 1LEBA 2X0LA 2E7WA 2FNAA 2PFBA 1ZRFA 3CUQA 2HQNA 3U9GA 1P4XA 2K4JA 4YIIA 3V4GA 2XGXA 4N9HA 1JGSA 1FY7A 3IHUA 3B73A 2FE3A 3HSRA 3BJAA 2PEXA 1AOYA 2YR2A 4RGUA 1MDMB 4OMYA 1D8KA 1R36A 4UV8A 4P55A 4PCQA 4RGXA 2JRTA 2HQRA 4MHGA 1WKMA 2NAZA 4L5JA 1MGTA 5LRRA 2ELHA 5LRSA 4P9FA 1KQ8A 2XAQA 1IN8A 2UZKA 1XMKA 1J5YA 4KNYA 1W7PA 4CO8A 2VC0A 3HHHA 4L0ZB 3W6KB 2EK5A 4A5NA 1XB4A 1SFEA 3GWZA 2W25A 5LHGA 1FC3A 2A6EF 1FP2A 3K2ZA 2XAFA 3JSPA 3LSTA 2XUBA 1BI2A 4MNUA 1OYIA 2CW0F 4G6DA 1PP7U 3CJNA 2MA3A 2C6YA 3KFWX 4GYIA 2HDCA 3I54A 4PGGA 1OR7A 2XASA 2P5LC 1SD6A 4L18B 4L9JA 3VEPA 3K69A 3BPXA 3W6JB 1LNWA 2DFIA 3E3VA 2HYFA 4BXUA 3M8FA 1TQMA 3GEZA 1LB2A 4BNCA 1Q1HA 3K9TA 4UVBA 4ENJA 3IL2A 3V7CA 3GO5A 5DCMA 1O3RA 2QENA 3DV8A 2J5OA 2OZUA 1IZ1A 3WU0A 1YLFA 4HAMA 4HDUA 1O7LA 1G3WA 2DBBA 3SZTA 2MH9A 1IRGA 4L9VA 1FWZA 2R3SA 2AXLA 4UVCA 2FBIA 3C3WA 4WXCA 4QWQA 2JT1A 5D6FA 3M1EA 3KE2A 5HDKA 3MZYA 1B6AA 2PG4A 1ZH5A 1YW8A 3E5QA 4QLCU 3RPUA 1STZA 3HOSA 4XRFA 1UHMA 1RZ4A 1WSUA 1WRJA 4M73A 1ZRCA 3NQOA 1HW2A 2K4BA 5CVIA 2NNYA 2WTEA 2XRNA 2BBYA 4HQMA 3T8TA 2ZO4A 3P9CA 3MEXA 4ZZLA 1XGSA 2XAJA 1LJ9A 4ZH4F 5LGNA 5L3DA 3HRMA 4KYWA 3ZMDA 3FWEA 3QP5A 4NB5A 2V1XA 1BC7C 2V9VA 4Q47A 3IRRA 4RB1A 1LDDA 3H3ZA 4MEXF 3V7RA 1IXSB 3E5UA 1LEAA 1W4MA 4BHPA 3KEQA 3R60A 2BGCA 1MJBA 1FSHA 1DDNA 2M30A 4A0YA 1U5TC 3I64A 2XV4S 3C1DA 4XSXF 2ISYA 4I0BA 3BZ6A 5FLXZ 4O6JA 4KN4X 3HYIA 2V1UA 3WG9A 3IWZA 1I27A 2YX7A 3JAMK 3I53A 5BMZA 2M1BA 4FT8A 2F5EA 1ZG5A 3RDIA 3D5LA 4HOBA 2L01A 1UHWA 2ZMEB 4OINF 3HRTA 1HSTA 1Z91A 2XAGA 3BY6A 1E2XA 4KT5C 1FNNA 1H9GA 1R5HA 3RKYA 5J8CA 3TOAA 4KFCA 5DCFA 4IJAA 4FX0A 2XKOA 2HYGD 5FFZA 3L00A 3F21A 2ZNZA 2H09A 2VBWA 4G7HF 1XGNA 2GQQA 4U0WA 1IXCA 3TQNA 5LHIA 1USSA 1FBQA 5D5WB 1B1BA 5EEHA 1W5TA 5HDNA 3J80K 1K7AA 2L54A 4HV5A 3L7WA 3CUQB 1I5ZA 1BOAA 5LBQA 3E5XA 1MKMA 4LJZF 2JSCA 1FYKA 5TRDA 3IWFA 3J7AO 1MJAA 3FMSA 2ADUA 3OV8A 5LEKA 5ICFA 3REOA 4Q48A 5E8GA 1OYYA 1R1VA 2K7LA 3LQQA 4DNCA 3K1NA 2DO7A 2IPQX 1T6SA 1S6LA 2EWNA 2Q0OA 2L4AA 1BC8C 4FX4A 2COMA 3BROA 4HF1A 2G7UA 1YG2A 1XGMA 2ZBKA 4WXHA 4HYEA 4EJVA 4ENMA 4PZJA 1SFXA 5IT3A 4RB2C 3LQRA 1C0WA 4MQ9F 1JHHA 3KP2A 3P9IA 3DPTA 2DK5A 1YQAA 4RAYA 4Q5SF 3U2RA 2P5KA 3WODF 5DUIA 2VODA 1HBXG 2HGCA 2A07F 4I98B 3TDZC 1D5VA 2K02A 4YFXF 4OMZA 4KICA 5AONA 5D8KB 5LGUA 2FMYA 2ZNYA 2VBXA 5DUKA 3HRSA 2F5CA 4MQVA 4KUMA 3WTUC 4Y17A 2M8EA 4PDKA 2VN2A 4RB3C 4KDPA 2IT0A 3JW4A 2EFWA 3I59A 1TQIA 4LFUA 1FYMA 1O7FA 3DXJF 3BOQA 4LK1F 4ZYEA 5E1WA 4P96A 1G4DA 4LB5A 1XDUA 3L2CA 4M72A 2MLKA 2IP2A 2HKOA 3IKVA 2MBFA 2DAOA 1BI3A 2QBYA 5FFXA 3GFLA 5CJ9A 5F1RA 1V3FA 4JK1X 1T38A 4HV6A 2BEOA 5ICCA 5DCMB 4XSZF 4G6QA 1ON1A 4U7BA 2GXBA 4B09A 1HW1A 4EM2A 3TGNA 3QU3A 1BI1A 2H6CA 3FHZA 2FOKA 4LD5A 3I0TA 1XDSA 2OA4A 1CF7B 1SMYF 5BQTA 4EGYA 2IA1A 2DK8A 5DEQA 2D45A 5J8FA 1FPQA 2TDXA 5IT9K 4HLYA 2PI0A 1G3TA 2IVMA 3DQVC 4HF0A 2JPCA 3IRQA 1JE8A 3F8NA 2KIUA 3GUDA 5BOXA 1R1UA 2MD5A 1HXDA 2WC2A 4RS8A 4PGHA 1HKQA 4M9ZA 2UWMA 3WTVC 3P9KA 2GZWA 5IT9Z 5DD4A 4M9SA 2P8TA 1R1TA 4HF2A 2ZJ2A 4U88A 5CVUA 3R61A 1QZYA 4BHCA 1O57A 1ZLJA 1O3SA 1IF1A 3FZVA 2XAHA 1T2KA 1ZHFA 2UXXA 3WE2A 4EV0A 2QYOA 4YIFA 2VC1A 3TKYA 2HFHA 5HS7A 1QNTA 2V79A 1A04A 3D0SA 3J81K 4KIBA 1ZARA 3KEOA 3Q5FA 3IKTA 1DPUA 4A0ZA 1S8NA 3AAFA 2VE9A 2EV0A 3KLOA 2NRAC 2KKOA 2JTVA 1R23A 1PP8F 1DUXC 4BAYA 1OPCA 4RAZA 1YW9A 2IW5A 2STWA 2RV8A 3J81Z 3M7GA 1Z05A 1KYWA 1ZLKA 2MH2A 1G3YA 1FT9A 3RKXA 1SMTA 5CYVA 2QZ8A 4CXFA 1J0RA 2P6SA 3T0YA 1FBSA 5JI6A 5ERIA 2HZTA 1I1SA 3FXRA 2LKPA 3EQLF 1BIAA 1S7OA 2LSOA 2QWWA 3F72A 1G6NA 4ETSA 2B0LA 2RDPA 3V8LA 1OKRA 4G9YA 5CVVA 4HA8A 4M9XA 4A6EA 1S29A 3I58A 2YPRA 3E6MA 2IJLA 1YIOA 2FQ3A 3WTYC 1FOKA 1GVJA 2RKHA 1H0MA 2FA5A 1DP7P 3RYRA 4MTEA 2IRFG 4XLPF 2EA2A 2E7XA 2GXGA 5BS6A 4UV9A 1ZAOA 3HOTA 2CG4A 4G94A 3WE3A 2HWVA 4R8HA 4G7OF 2NYXA 3GZ6A 3E6DA 1GXQA 3OOPA 1IAWA 2KJBA 1ZRDA 2LF7A 3P7NA 1IN4A 2J5PA 5ILVA 1VTNC 2STTA 3ELKA 3LA3A 1MD0A 4R79A 3QOPA 3QU6A 3DFGA 3GFIA 1U3EM 1SD5A 5HS9A 3NEUA 1V4RA 5H20A 3BPVA 1H9TA 4A12A 2MC3A 2Z5UA 5D4RA 5ED4A 1UFMA 2CYYA 1YS6A 2F5DA 3HRUA 1U5TB 1FZPB 1ZG3A 3E97A 2Y0MA 4YFNF 3LAJA 5FLXK 1MDMA 2P6TA 3EUHA 3WGGA 1J59A 4EJUA 1HW5A 1U6GA 3VFZA 4N0BA 2A5YB 4XLNF 3ECHA 1IW7F 2VBZA 2HTSA 3QP6A 1KYZA 3WTZA 1YS7A 3ZQ7A 2L3DA 4HDVA 1S3JA 1JXSA 1KU7A 3I59B 1RNLA 3L09A 1BIBA 3F8MA 4OU0A 2GIVA 2FU4A 1PDNC 4N9IA 1F1ZA 4IRGA 4WF2A 2PN6A 3DP7A 3F23A 2DT5A 2Z99A 1Z1DA 4EM1A 2ZCWA 2F5FA 2QBYB 3VB2A 5D5UB 1WQ2A 2UXNA 2VT2A 2DU9A 2EV5A 4IXAA 2LNBA 4CGZA 2FXAA 4ESBA 5L3CA 1BN5A 1SAXA 3BDDA 3MFKA 2BV6A 3HSEA 3HHGA 2QUFA 2PMUA 1REPC 5FGMA 1K78A 4OIQF 4YG2F 1PUEE 3ZMVA 1BM9A 2PJPA 2QM3A 3HTUA 1LQ1A 2D1HA 1R00A 5D4SA 3ZN0A 2VT3A 4EMSA 3COAC 3ZMSA 1R22A 1B9NA 1IXRC 2JZYA 4GGGA 5L3BA 1KQ9A 3N97A 1WWXA 2EFNA 1D3YA 1BBYA 2LF8A 2M5WA 3G3ZA 2OQRA 3F8CA 2CFXA 5BPDA 3KP3A 3QPTA 2DQRA 5L3EA 3HIFA 5HLHA 1RIOH 2RC4A 2HTJA 4HBLA 4P9UA 2CGPA 2W85A 2W84A 2EV6A 2RNJA 5E20A 5HLIA 4CYDA 4G8XA 4EQQA 1USTA 2OD5A 5D6EA 1L3LA 4CHUA 1XSXA 2O3FA 2GA1A 4LG0A 3K1MA 3MAJA 4Y15A 2OBPA 4NHJA 2H6BA 1Z6TA 5E8IA 5ILUA 1W7PB 2NS0A 4RGSA 4KMFA 1HQCA 3IC7A 5K5QA 3TO7A 5TJJA 5F64A 5JHUA 5ICEA 2CO5A 2F2EA 1LVAA 3MWMA 1T0FA 3WGIA 3FM5A 3E6CC 5LEJA 3FX3A 1B4AA 2EB7A 2HKXA 3SHFA 1J75A 2KIFA 1NHAA 4I09A 3V8KA 3T1BA 4U0VA 4CZZA 1U8RA 3ML6A 3RIRA 2DTRA 3GXOA 3HSFA 3GVAA 2VOOA 5HVQC 1WI9A 4BH9A 4HX4A 5CLSA 1FP1D 1P2FA 2M45A 3EYIA 3KP6A 3ZMUA 2HS5A 4B8XA 5DD8A 2Y75A 3SZPA 1XSVA 4ZZDA 4L0YB 2A3SA 3C7JA 3E6BA 3GFJA 3ABTA 1ODDA 2P4WA 3F8BA 4UUVA 1S7AA 3R0AA 2BYVE 1ZG1A 1RUNA 1QZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQA A;  2OQG A;  3TOB A;  4Q4Z F;  1Z7U A;  1CGP A;  1JHF A;  2ZME A;  5FO5 A;  4A0X A;  1I6X A;  3SQN A;  3H3U A;  1TNT A;  1FLI A;  1XCV A;  4F7Z A;  4BYY A;  1QO0 D;  2P5V A;  3BP8 A;  1HKS A;  4Z2Y A;  4LLN A;  1TQP A;  2IA0 A;  1U2W A;  2RN7 A;  1EH7 A;  3O2P E;  2QQ9 A;  5FB2 A;  4NQW A;  2ESN A;  2MLG A;  1F5T A;  1R5G A;  5HLG A;  1RUO A;  5E18 F;  4M74 A;  3Q9S A;  2Q2E A;  3TDU C;  4E70 A;  1J7K A;  4L5I A;  2K27 A;  3QAH A;  4AWX B;  2VXZ A;  3RI4 A;  3DPL C;  4O3M A;  4S04 A;  1I1G A;  3GF2 A;  4IPA A;  5A2Q K;  4S05 A;  5H6Q A;  4EJW A;  2HOE A;  2ZXJ A;  4CIC A;  2FF4 A;  4G7Z F;  4Y13 A;  5D5X B;  4RGR A;  4WK8 F;  6PAX A;  2AS5 F;  4WWC A;  2VON A;  2ISZ A;  3F6O A;  3FMQ A;  3WTW C;  4ZYH A;  2Z3Y A;  2CSO A;  4GYG A;  1Z9C A;  1KA8 A;  3O3K A;  3JSO A;  3TO6 A;  2L02 A;  2BE5 F;  1FX7 A;  3GX4 X;  5ILS A;  1IUY A;  3EET A;  5A2Q Z;  5E17 F;  1TNS A;  1T39 A;  3LAP A;  2XHK A;  3M8E A;  2O03 A;  3FMR A;  3ERE D;  3RPQ A;  4I0A A;  1QPM A;  1O3T A;  1U78 A;  5BPI A;  4K2E A;  2EFO A;  3F8F A;  3ZP5 A;  5KK1 A;  4BHB A;  3S2W A;  2QQA A;  2XIG A;  5H6R A;  2YU3 A;  3C18 A;  2W57 A;  4L9T A;  3G73 A;  4FHT A;  2FRH A;  2R7D A;  3SXY A;  2KIM A;  3O6B B;  2WV0 A;  5ICG A;  2Q8K A;  2G9W A;  3DEU A;  1XMA A;  2CQK A;  4UVA A;  1SD7 A;  1YYV A;  5KVR A;  4LK0 F;  1R7J A;  2QLZ A;  3SFZ A;  2EFQ A;  1K78 B;  2GWR A;  2ACJ A;  1XSD A;  2R7F A;  1FYL A;  1W7P D;  2ESH A;  1J9I A;  3F3X A;  3DKW A;  4MTD A;  1TW3 A;  3FXQ A;  2RVC A;  4TV7 A;  1TBX A;  1W5S A;  4YFK F;  2KRF A;  2DQL A;  2FSW A;  3R4K A;  4IRI A;  5AIQ A;  2Z33 A;  1ZGA A;  3QPH A;  1SFU A;  5JR3 A;  3KZY A;  1ONV A;  2XVC A;  1B9M A;  2P7C B;  1IRF A;  4UXN A;  5CVR A;  3RKW A;  5DV5 A;  5D8L B;  1X3U A;  2EJR A;  3ISP A;  4EVI A;  1CF7 A;  4OIO F;  1P4W A;  4WCG A;  2EA4 A;  3RTR A;  4LMY A;  3R6S A;  1D8J A;  5DDG A;  1L0O C;  2A68 F;  4R1H A;  3EYY A;  3K1P A;  3GFM A;  1RI7 A;  3MZH A;  1Y0U A;  2NNN A;  2O6G E;  3BWG A;  4HLX A;  4LG0 B;  3U1D A;  4A5M A;  2Y48 A;  4OIR F;  3ZN1 A;  2ETH A;  3FF5 A;  3HUG A;  1P4A A;  3PQK A;  1EH8 A;  1KGS A;  1BI0 A;  4IRH A;  1YW7 A;  1QBJ A;  5E1Z B;  4OOI A;  5FD5 A;  1TW2 A;  5CVJ A;  5E1X A;  1XD7 A;  4HQE A;  1R58 A;  2H27 A;  1OMI A;  4UHT A;  3H92 A;  1UB9 A;  3RYP A;  2Z9O A;  2IA2 A;  1IN5 A;  2V6C A;  3WTS C;  1KU9 A;  2DI3 A;  3GZ5 A;  3M9A A;  3ROU A;  4JBA A;  2EFP A;  4KA4 A;  2HEO A;  1K79 A;  1OYW A;  3VOD A;  5LHH A;  5K1Y A;  3F6V A;  1LDK B;  4I2O A;  2K86 A;  1EH6 A;  1MJ9 A;  1ON2 A;  2XKP A;  4O5V A;  5J6X A;  3B02 A;  4WX9 A;  4HX7 A;  1LDJ A;  1T98 A;  1XGO A;  4M6X A;  3V7S A;  1O3Q A;  1UCR A;  1TTY A;  4ENN A;  2KJC A;  1HSJ A;  3CUO A;  5FD6 A;  4HW0 A;  4ON0 A;  2A6H F;  2FNP A;  1MZB A;  4ASN A;  3VOE A;  2E1C A;  4I01 A;  2D2W A;  2W24 A;  1YO5 C;  2OU2 A;  2DPU A;  1KU3 A;  2VBY A;  3GW2 A;  4AD9 A;  4IHT A;  2HR3 A;  2PQ8 A;  2D1V A;  4CDG A;  3ZPL A;  2O61 A;  4KIG A;  2P7V B;  5JVT A;  3JTG A;  5HOO A;  2GAU A;  4U0Y A;  1G3S A;  4I02 A;  3KET A;  1QQI A;  2QVO A;  2PMH A;  3HTS B;  3DF8 A;  3KZZ A;  1Z6R A;  4ZYD A;  3PFI A;  3JAM Z;  3CDH A;  1ZYR F;  1ZGJ A;  2PLY A;  2XRO A;  1F4K A;  3RJP A;  3TO9 A;  4M71 A;  5EEG A;  3I71 A;  1B59 A;  3GLX A;  1E17 A;  3KLN A;  1ZRE A;  4EM0 B;  2G7H A;  3LA7 A;  3ZMT A;  3ULQ B;  3LFK A;  3T5X A;  1IN7 A;  3T8R A;  4IHS A;  2VE8 A;  3WU1 B;  4A2U A;  3PQJ A;  1EV7 A;  1ULY A;  2CWE A;  1KU2 A;  3CTA A;  4DQ2 A;  2O0Y A;  1GXP A;  4D0P A;  3CLO A;  2OZ6 A;  4GXO A;  4H0E A;  2M87 A;  2A61 A;  2JPB A;  3ABU A;  3J80 Z;  3CUQ C;  4HX8 A;  3QRF F;  3MQ0 A;  5HDG A;  1IN6 A;  2YX4 A;  3LA2 A;  2YSR A;  5DYM A;  3CO6 C;  2DPD A;  3FXU A;  4ESJ A;  3KP5 A;  3LWF A;  3NRV A;  3WGH A;  3Q9V A;  4WXD A;  1P92 A;  2E1N A;  4LLL A;  4EGZ A;  3FM3 A;  4ZYG A;  4M6Y A;  5LGT A;  3JTH A;  4XBF A;  3KCC A;  1K6O A;  1KQ0 A;  1F9N A;  2ZKZ A;  3ECO A;  4A6D A;  2GA2 A;  2QQB A;  1FBU A;  1U5T A;  1BJA A;  5JFR A;  2RGV A;  4IVN A;  1TLH B;  3WTX C;  4IF4 A;  1SD4 A;  3BJ6 A;  4LB6 B;  1DPR A;  2H94 A;  5D5V B;  4EJT A;  1QGP A;  4MGR A;  5F6F A;  3V8J A;  2V1D A;  3KP4 A;  5L3F A;  1ZN2 A;  3I4P A;  2FEZ A;  5L3G A;  2LDU A;  4I7H A;  4GCV A;  3F22 A;  4KIF A;  3CO7 C;  2VOP A;  4ESF A;  4EJO A;  5HS8 A;  3GYH X;  1XCB A;  2WWY A;  5K5R A;  2X4H A;  3L9F A;  3BJO A;  5K5O A;  4AVP A;  4AIJ A;  4UNO A;  3K0L A;  2RQP A;  5AIP A;  3ZMZ A;  2ZFW A;  4JQF A;  4AIK A;  3MCZ A;  1YFH A;  2A69 F;  1P6R A;  3N4M A;  4P5O A;  4KN7 X;  3KP7 A;  2O8X A;  2FML A;  1FSE A;  1AWC A;  2OAZ A;  4HZF A;  2FBK A;  3R0J A;  3EDP A;  4GO1 A;  4ENK A;  1HKT A;  4AIH A;  1YTY A;  4RB0 A;  2FBH A;  1GHC A;  2L4M A;  4L9N A;  1J2X A;  4LLG F;  2PBI A;  4LGW A;  3I5U A;  3WTT C;  4KMU X;  4U7D A;  2DLL A;  4MEY F;  1XN7 A;  2DW4 A;  4OIP F;  5LLQ A;  1LEB A;  2X0L A;  2E7W A;  2FNA A;  2PFB A;  1ZRF A;  3CUQ A;  2HQN A;  3U9G A;  1P4X A;  2K4J A;  4YII A;  3V4G A;  2XGX A;  4N9H A;  1JGS A;  1FY7 A;  3IHU A;  3B73 A;  2FE3 A;  3HSR A;  3BJA A;  2PEX A;  1AOY A;  2YR2 A;  4RGU A;  1MDM B;  4OMY A;  1D8K A;  1R36 A;  4UV8 A;  4P55 A;  4PCQ A;  4RGX A;  2JRT A;  2HQR A;  4MHG A;  1WKM A;  2NAZ A;  4L5J A;  1MGT A;  5LRR A;  2ELH A;  5LRS A;  4P9F A;  1KQ8 A;  2XAQ A;  1IN8 A;  2UZK A;  1XMK A;  1J5Y A;  4KNY A;  1W7P A;  4CO8 A;  2VC0 A;  3HHH A;  4L0Z B;  3W6K B;  2EK5 A;  4A5N A;  1XB4 A;  1SFE A;  3GWZ A;  2W25 A;  5LHG A;  1FC3 A;  2A6E F;  1FP2 A;  3K2Z A;  2XAF A;  3JSP A;  3LST A;  2XUB A;  1BI2 A;  4MNU A;  1OYI A;  2CW0 F;  4G6D A;  1PP7 U;  3CJN A;  2MA3 A;  2C6Y A;  3KFW X;  4GYI A;  2HDC A;  3I54 A;  4PGG A;  1OR7 A;  2XAS A;  2P5L C;  1SD6 A;  4L18 B;  4L9J A;  3VEP A;  3K69 A;  3BPX A;  3W6J B;  1LNW A;  2DFI A;  3E3V A;  2HYF A;  4BXU A;  3M8F A;  1TQM A;  3GEZ A;  1LB2 A;  4BNC A;  1Q1H A;  3K9T A;  4UVB A;  4ENJ A;  3IL2 A;  3V7C A;  3GO5 A;  5DCM A;  1O3R A;  2QEN A;  3DV8 A;  2J5O A;  2OZU A;  1IZ1 A;  3WU0 A;  1YLF A;  4HAM A;  4HDU A;  1O7L A;  1G3W A;  2DBB A;  3SZT A;  2MH9 A;  1IRG A;  4L9V A;  1FWZ A;  2R3S A;  2AXL A;  4UVC A;  2FBI A;  3C3W A;  4WXC A;  4QWQ A;  2JT1 A;  5D6F A;  3M1E A;  3KE2 A;  5HDK A;  3MZY A;  1B6A A;  2PG4 A;  1ZH5 A;  1YW8 A;  3E5Q A;  4QLC U;  3RPU A;  1STZ A;  3HOS A;  4XRF A;  1UHM A;  1RZ4 A;  1WSU A;  1WRJ A;  4M73 A;  1ZRC A;  3NQO A;  1HW2 A;  2K4B A;  5CVI A;  2NNY A;  2WTE A;  2XRN A;  2BBY A;  4HQM A;  3T8T A;  2ZO4 A;  3P9C A;  3MEX A;  4ZZL A;  1XGS A;  2XAJ A;  1LJ9 A;  4ZH4 F;  5LGN A;  5L3D A;  3HRM A;  4KYW A;  3ZMD A;  3FWE A;  3QP5 A;  4NB5 A;  2V1X A;  1BC7 C;  2V9V A;  4Q47 A;  3IRR A;  4RB1 A;  1LDD A;  3H3Z A;  4MEX F;  3V7R A;  1IXS B;  3E5U A;  1LEA A;  1W4M A;  4BHP A;  3KEQ A;  3R60 A;  2BGC A;  1MJB A;  1FSH A;  1DDN A;  2M30 A;  4A0Y A;  1U5T C;  3I64 A;  2XV4 S;  3C1D A;  4XSX F;  2ISY A;  4I0B A;  3BZ6 A;  5FLX Z;  4O6J A;  4KN4 X;  3HYI A;  2V1U A;  3WG9 A;  3IWZ A;  1I27 A;  2YX7 A;  3JAM K;  3I53 A;  5BMZ A;  2M1B A;  4FT8 A;  2F5E A;  1ZG5 A;  3RDI A;  3D5L A;  4HOB A;  2L01 A;  1UHW A;  2ZME B;  4OIN F;  3HRT A;  1HST A;  1Z91 A;  2XAG A;  3BY6 A;  1E2X A;  4KT5 C;  1FNN A;  1H9G A;  1R5H A;  3RKY A;  5J8C A;  3TOA A;  4KFC A;  5DCF A;  4IJA A;  4FX0 A;  2XKO A;  2HYG D;  5FFZ A;  3L00 A;  3F21 A;  2ZNZ A;  2H09 A;  2VBW A;  4G7H F;  1XGN A;  2GQQ A;  4U0W A;  1IXC A;  3TQN A;  5LHI A;  1USS A;  1FBQ A;  5D5W B;  1B1B A;  5EEH A;  1W5T A;  5HDN A;  3J80 K;  1K7A A;  2L54 A;  4HV5 A;  3L7W A;  3CUQ B;  1I5Z A;  1BOA A;  5LBQ A;  3E5X A;  1MKM A;  4LJZ F;  2JSC A;  1FYK A;  5TRD A;  3IWF A;  3J7A O;  1MJA A;  3FMS A;  2ADU A;  3OV8 A;  5LEK A;  5ICF A;  3REO A;  4Q48 A;  5E8G A;  1OYY A;  1R1V A;  2K7L A;  3LQQ A;  4DNC A;  3K1N A;  2DO7 A;  2IPQ X;  1T6S A;  1S6L A;  2EWN A;  2Q0O A;  2L4A A;  1BC8 C;  4FX4 A;  2COM A;  3BRO A;  4HF1 A;  2G7U A;  1YG2 A;  1XGM A;  2ZBK A;  4WXH A;  4HYE A;  4EJV A;  4ENM A;  4PZJ A;  1SFX A;  5IT3 A;  4RB2 C;  3LQR A;  1C0W A;  4MQ9 F;  1JHH A;  3KP2 A;  3P9I A;  3DPT A;  2DK5 A;  1YQA A;  4RAY A;  4Q5S F;  3U2R A;  2P5K A;  3WOD F;  5DUI A;  2VOD A;  1HBX G;  2HGC A;  2A07 F;  4I98 B;  3TDZ C;  1D5V A;  2K02 A;  4YFX F;  4OMZ A;  4KIC A;  5AON A;  5D8K B;  5LGU A;  2FMY A;  2ZNY A;  2VBX A;  5DUK A;  3HRS A;  2F5C A;  4MQV A;  4KUM A;  3WTU C;  4Y17 A;  2M8E A;  4PDK A;  2VN2 A;  4RB3 C;  4KDP A;  2IT0 A;  3JW4 A;  2EFW A;  3I59 A;  1TQI A;  4LFU A;  1FYM A;  1O7F A;  3DXJ F;  3BOQ A;  4LK1 F;  4ZYE A;  5E1W A;  4P96 A;  1G4D A;  4LB5 A;  1XDU A;  3L2C A;  4M72 A;  2MLK A;  2IP2 A;  2HKO A;  3IKV A;  2MBF A;  2DAO A;  1BI3 A;  2QBY A;  5FFX A;  3GFL A;  5CJ9 A;  5F1R A;  1V3F A;  4JK1 X;  1T38 A;  4HV6 A;  2BEO A;  5ICC A;  5DCM B;  4XSZ F;  4G6Q A;  1ON1 A;  4U7B A;  2GXB A;  4B09 A;  1HW1 A;  4EM2 A;  3TGN A;  3QU3 A;  1BI1 A;  2H6C A;  3FHZ A;  2FOK A;  4LD5 A;  3I0T A;  1XDS A;  2OA4 A;  1CF7 B;  1SMY F;  5BQT A;  4EGY A;  2IA1 A;  2DK8 A;  5DEQ A;  2D45 A;  5J8F A;  1FPQ A;  2TDX A;  5IT9 K;  4HLY A;  2PI0 A;  1G3T A;  2IVM A;  3DQV C;  4HF0 A;  2JPC A;  3IRQ A;  1JE8 A;  3F8N A;  2KIU A;  3GUD A;  5BOX A;  1R1U A;  2MD5 A;  1HXD A;  2WC2 A;  4RS8 A;  4PGH A;  1HKQ A;  4M9Z A;  2UWM A;  3WTV C;  3P9K A;  2GZW A;  5IT9 Z;  5DD4 A;  4M9S A;  2P8T A;  1R1T A;  4HF2 A;  2ZJ2 A;  4U88 A;  5CVU A;  3R61 A;  1QZY A;  4BHC A;  1O57 A;  1ZLJ A;  1O3S A;  1IF1 A;  3FZV A;  2XAH A;  1T2K A;  1ZHF A;  2UXX A;  3WE2 A;  4EV0 A;  2QYO A;  4YIF A;  2VC1 A;  3TKY A;  2HFH A;  5HS7 A;  1QNT A;  2V79 A;  1A04 A;  3D0S A;  3J81 K;  4KIB A;  1ZAR A;  3KEO A;  3Q5F A;  3IKT A;  1DPU A;  4A0Z A;  1S8N A;  3AAF A;  2VE9 A;  2EV0 A;  3KLO A;  2NRA C;  2KKO A;  2JTV A;  1R23 A;  1PP8 F;  1DUX C;  4BAY A;  1OPC A;  4RAZ A;  1YW9 A;  2IW5 A;  2STW A;  2RV8 A;  3J81 Z;  3M7G A;  1Z05 A;  1KYW A;  1ZLK A;  2MH2 A;  1G3Y A;  1FT9 A;  3RKX A;  1SMT A;  5CYV A;  2QZ8 A;  4CXF A;  1J0R A;  2P6S A;  3T0Y A;  1FBS A;  5JI6 A;  5ERI A;  2HZT A;  1I1S A;  3FXR A;  2LKP A;  3EQL F;  1BIA A;  1S7O A;  2LSO A;  2QWW A;  3F72 A;  1G6N A;  4ETS A;  2B0L A;  2RDP A;  3V8L A;  1OKR A;  4G9Y A;  5CVV A;  4HA8 A;  4M9X A;  4A6E A;  1S29 A;  3I58 A;  2YPR A;  3E6M A;  2IJL A;  1YIO A;  2FQ3 A;  3WTY C;  1FOK A;  1GVJ A;  2RKH A;  1H0M A;  2FA5 A;  1DP7 P;  3RYR A;  4MTE A;  2IRF G;  4XLP F;  2EA2 A;  2E7X A;  2GXG A;  5BS6 A;  4UV9 A;  1ZAO A;  3HOT A;  2CG4 A;  4G94 A;  3WE3 A;  2HWV A;  4R8H A;  4G7O F;  2NYX A;  3GZ6 A;  3E6D A;  1GXQ A;  3OOP A;  1IAW A;  2KJB A;  1ZRD A;  2LF7 A;  3P7N A;  1IN4 A;  2J5P A;  5ILV A;  1VTN C;  2STT A;  3ELK A;  3LA3 A;  1MD0 A;  4R79 A;  3QOP A;  3QU6 A;  3DFG A;  3GFI A;  1U3E M;  1SD5 A;  5HS9 A;  3NEU A;  1V4R A;  5H20 A;  3BPV A;  1H9T A;  4A12 A;  2MC3 A;  2Z5U A;  5D4R A;  5ED4 A;  1UFM A;  2CYY A;  1YS6 A;  2F5D A;  3HRU A;  1U5T B;  1FZP B;  1ZG3 A;  3E97 A;  2Y0M A;  4YFN F;  3LAJ A;  5FLX K;  1MDM A;  2P6T A;  3EUH A;  3WGG A;  1J59 A;  4EJU A;  1HW5 A;  1U6G A;  3VFZ A;  4N0B A;  2A5Y B;  4XLN F;  3ECH A;  1IW7 F;  2VBZ A;  2HTS A;  3QP6 A;  1KYZ A;  3WTZ A;  1YS7 A;  3ZQ7 A;  2L3D A;  4HDV A;  1S3J A;  1JXS A;  1KU7 A;  3I59 B;  1RNL A;  3L09 A;  1BIB A;  3F8M A;  4OU0 A;  2GIV A;  2FU4 A;  1PDN C;  4N9I A;  1F1Z A;  4IRG A;  4WF2 A;  2PN6 A;  3DP7 A;  3F23 A;  2DT5 A;  2Z99 A;  1Z1D A;  4EM1 A;  2ZCW A;  2F5F A;  2QBY B;  3VB2 A;  5D5U B;  1WQ2 A;  2UXN A;  2VT2 A;  2DU9 A;  2EV5 A;  4IXA A;  2LNB A;  4CGZ A;  2FXA A;  4ESB A;  5L3C A;  1BN5 A;  1SAX A;  3BDD A;  3MFK A;  2BV6 A;  3HSE A;  3HHG A;  2QUF A;  2PMU A;  1REP C;  5FGM A;  1K78 A;  4OIQ F;  4YG2 F;  1PUE E;  3ZMV A;  1BM9 A;  2PJP A;  2QM3 A;  3HTU A;  1LQ1 A;  2D1H A;  1R00 A;  5D4S A;  3ZN0 A;  2VT3 A;  4EMS A;  3COA C;  3ZMS A;  1R22 A;  1B9N A;  1IXR C;  2JZY A;  4GGG A;  5L3B A;  1KQ9 A;  3N97 A;  1WWX A;  2EFN A;  1D3Y A;  1BBY A;  2LF8 A;  2M5W A;  3G3Z A;  2OQR A;  3F8C A;  2CFX A;  5BPD A;  3KP3 A;  3QPT A;  2DQR A;  5L3E A;  3HIF A;  5HLH A;  1RIO H;  2RC4 A;  2HTJ A;  4HBL A;  4P9U A;  2CGP A;  2W85 A;  2W84 A;  2EV6 A;  2RNJ A;  5E20 A;  5HLI A;  4CYD A;  4G8X A;  4EQQ A;  1UST A;  2OD5 A;  5D6E A;  1L3L A;  4CHU A;  1XSX A;  2O3F A;  2GA1 A;  4LG0 A;  3K1M A;  3MAJ A;  4Y15 A;  2OBP A;  4NHJ A;  2H6B A;  1Z6T A;  5E8I A;  5ILU A;  1W7P B;  2NS0 A;  4RGS A;  4KMF A;  1HQC A;  3IC7 A;  5K5Q A;  3TO7 A;  5TJJ A;  5F64 A;  5JHU A;  5ICE A;  2CO5 A;  2F2E A;  1LVA A;  3MWM A;  1T0F A;  3WGI A;  3FM5 A;  3E6C C;  5LEJ A;  3FX3 A;  1B4A A;  2EB7 A;  2HKX A;  3SHF A;  1J75 A;  2KIF A;  1NHA A;  4I09 A;  3V8K A;  3T1B A;  4U0V A;  4CZZ A;  1U8R A;  3ML6 A;  3RIR A;  2DTR A;  3GXO A;  3HSF A;  3GVA A;  2VOO A;  5HVQ C;  1WI9 A;  4BH9 A;  4HX4 A;  5CLS A;  1FP1 D;  1P2F A;  2M45 A;  3EYI A;  3KP6 A;  3ZMU A;  2HS5 A;  4B8X A;  5DD8 A;  2Y75 A;  3SZP A;  1XSV A;  4ZZD A;  4L0Y B;  2A3S A;  3C7J A;  3E6B A;  3GFJ A;  3ABT A;  1ODD A;  2P4W A;  3F8B A;  4UUV A;  1S7A A;  3R0A A;  2BYV E;  1ZG1 A;  1RUN A;  1QZZ A; 
#chains in the Genus database with same CATH topology
 1ZK8 A;  4BQA A;  2OQG A;  4B44 A;  3TOB A;  4Q4Z F;  1Z7U A;  1CGP A;  3CCR I;  1JHF A;  4U87 A;  2ZME A;  2ELK A;  5FO5 A;  1SVL A;  4A0X A;  1I6X A;  4PSX A;  3SQN A;  4A3G J;  3H3U A;  3HKZ A;  1TNT A;  2E36 A;  4OAZ A;  5F1J A;  3HG9 A;  1FLI A;  1XCV A;  4JX4 A;  4F7Z A;  1LE8 B;  5GP9 A;  4HRI A;  4FQG A;  3A0B C;  4BYY A;  1QO0 D;  2VXD A;  2XF5 A;  2P5V A;  4CCO A;  3BP8 A;  4AYB N;  1HKS A;  1T8I A;  2BXZ A;  4Z2Y A;  4LLN A;  2W4S A;  1TQP A;  2IA0 A;  3CJT B;  2PMZ N;  3CP8 A;  2ELJ A;  3SYT A;  1U2W A;  2RN7 A;  1EH7 A;  3O2P E;  5GPA A;  2QQ9 A;  3PM1 A;  5FB2 A;  4NQW A;  2F48 A;  4CH7 A;  1MBE A;  1BR1 A;  5M3M J;  2ESN A;  3VDX A;  3BR0 A;  1BW6 A;  2MLG A;  1F5T A;  3FDY A;  1A35 A;  2DMQ A;  1R5G A;  3DCF A;  4XLE A;  5HLG A;  3OYE A;  4XLH A;  1RUO A;  4PUS A;  5E18 F;  3RSN A;  3ASO H;  3BT9 A;  3FXO A;  1QPI A;  4M74 A;  4X1E A;  2DA3 A;  3Q9S A;  2Q2E A;  3TDU C;  2ECB A;  3H5R A;  3FBN B;  1IO2 A;  2ZXW H;  1K61 A;  4E70 A;  1A5J A;  1J7K A;  1ETK A;  4L5I A;  2K27 A;  2F6C A;  3QAH A;  4AWX B;  2VXZ A;  1TT5 B;  3RI4 A;  3HBL A;  2X9D A;  4XQF A;  4BE0 A;  3DPL C;  4O3M A;  4S04 A;  5J1Y A;  1JT0 A;  1YOV B;  1I1G A;  3GF2 A;  3QPS A;  4IPA A;  2IGN A;  4MIM A;  4S05 A;  5A2Q K;  5H6Q A;  4EJW A;  2EZI A;  3H35 A;  5TGT A;  3JRD A;  3KPH A;  3LFU A;  1UJ8 A;  2HOE A;  4XLF A;  3MKW B;  2ZXJ A;  3D5S C;  4CIC A;  2FF4 A;  5E79 C;  5J1U A;  1MMG A;  3OS0 A;  2R5Z A;  4G7Z F;  4Y13 A;  3DTE A;  2VUM J;  3GTM J;  5D5X B;  4RGR A;  4WK8 F;  1X1A A;  6PAX A;  2AS5 F;  4WWC A;  4PJJ A;  3UR3 C;  2VQL A;  4FIS A;  2VON A;  2ISZ A;  3F6O A;  3FMQ A;  3AL0 B;  3WTW C;  4ZYH A;  2WY7 Q;  4B43 A;  2Z3Y A;  2CSO A;  5M5Y J;  3Q0U A;  4GYG A;  3OYK A;  1Z9C A;  1KA8 A;  2QKM B;  1GVD A;  3A02 A;  3O3K A;  3S2H J;  3JSO A;  3D5R C;  3TO6 A;  1XS9 A;  2L02 A;  2BE5 F;  4BS9 A;  2HPM A;  1FX7 A;  2PX9 A;  3GX4 X;  5ILS A;  3CME I;  1IUY A;  3E7L A;  3EET A;  5A2Q Z;  5E17 F;  3K4B A;  4DBR A;  3OYA A;  1TNS A;  2KDZ A;  3QYE A;  1T39 A;  3LAP A;  3M3Y J;  2XHK A;  2E35 A;  3M8E A;  2O03 A;  3FMR A;  5B1B H;  3K6G A;  3ERE D;  2L7Z A;  3RPQ A;  4I0A A;  1Y6I A;  5LFA A;  2VPL A;  1QPM A;  2KQR A;  1U78 A;  1O3T A;  3OS1 A;  2HVS A;  5BPI A;  3DBH B;  4AID A;  4K2E A;  2EFO A;  3F8F A;  1WJ5 A;  3CCM I;  3ZP5 A;  3HPH A;  2W7N A;  5KK1 A;  2X48 A;  4BHB A;  3V42 A;  3S2W A;  4F52 A;  1K4T A;  4FE7 A;  2XF6 A;  5EZH A;  2Y69 H;  2QQA A;  2XIG A;  5H6R A;  5F0H A;  2H8R A;  4YRV A;  2IAI A;  2YU3 A;  3C18 A;  1N78 A;  2W57 A;  1MNM C;  2V26 A;  2LKX A;  1I3Q J;  2M8G X;  1MMN A;  2XGD A;  4L9T A;  4HNU A;  3G73 A;  4FHT A;  2FRH A;  2R7D A;  3SXY A;  2KIM A;  3O6B B;  1YJN I;  2WV0 A;  3HB9 A;  5ICG A;  2Q8K A;  5GTI C;  3S1M J;  2G9W A;  2O7O A;  4HG2 A;  3DEU A;  1XMA A;  2CQK A;  2OUM A;  5F0F A;  3TL4 X;  4UVA A;  1MSF C;  1SD7 A;  4CYC A;  4BY1 J;  1YYV A;  5KVR A;  4Y3O A;  4XOP A;  4LK0 F;  1R7J A;  3CCS I;  3ZQI A;  2QLZ A;  3SFZ A;  2EFQ A;  3KZI C;  1WCM J;  3JRA A;  1K78 B;  4DOZ A;  2JVG A;  2GWR A;  2ACJ A;  3JRF A;  2MGQ A;  2Z1D A;  3K70 C;  1XSD A;  2IS1 A;  5GAD J;  1WJE A;  5KAI C;  1GLN A;  4W1U A;  1LFU P;  2R7F A;  1FYL A;  4DYQ A;  1OLT A;  1W7P D;  4Y7N J;  3CCU I;  2ESH A;  4DGW B;  4CCM A;  1J9I A;  3F3X A;  3ZR8 X;  3DKW A;  1SC7 A;  3HGG A;  4F92 B;  4C9Y A;  4MTD A;  1TW3 A;  3FXQ A;  3FIW A;  2H1L A;  2RVC A;  4TV7 A;  1TBX A;  1W5S A;  4YFK F;  2V7F A;  2KRF A;  4BEH B;  2LH9 A;  2DQL A;  4IEJ A;  2FSW A;  3R4K A;  3ZQH A;  4IRI A;  1V5G A;  1F36 A;  4BE2 A;  5AIQ A;  2Z33 A;  1W0T A;  1D5Y A;  1ZGA A;  3QPH A;  1SFU A;  5JR3 A;  3E1S A;  2DMN A;  3BLY A;  3M07 A;  3KZY A;  1ONV A;  2XVC A;  2ZJQ F;  1B9M A;  3BR6 A;  2P7C B;  5FKN A;  1ETO A;  1IRF A;  4UXN A;  2ID6 A;  5CVR A;  3RKW A;  5DV5 A;  3WHC A;  3OR1 C;  1VF9 A;  5D8L B;  1X3U A;  2EJR A;  2KL4 A;  3ZQC A;  1IUF A;  3ISP A;  1QRY A;  4EVI A;  1U9O A;  3VYU B;  1HC8 A;  3FKI J;  2VJI A;  1CF7 A;  3BQZ A;  4OIO F;  1P4W A;  2W48 A;  4WCG A;  2XC7 A;  2EA4 A;  3OIP A;  3RTR A;  1SEU A;  4LMY A;  5EZG A;  3R6S A;  3RZO J;  1D8J A;  5DDG A;  1G8X A;  1UAA A;  1L0O C;  2A68 F;  4D1Q A;  4R1H A;  2DA6 A;  3OYH A;  3EYY A;  1HDD C;  2OC6 A;  3BR3 A;  3K1P A;  2L2O A;  3GFM A;  1RI7 A;  3MZH A;  3CF2 A;  1Y0U A;  2NNN A;  2O6G E;  3BWG A;  2QSH X;  4HLX A;  1WJD A;  2HU9 A;  4LG0 B;  3U1D A;  4A5M A;  2M4K A;  2BOL A;  2Y48 A;  4OIR F;  2FUG 2;  4JP0 A;  4NC6 A;  3ZN1 A;  2ETH A;  3FBI B;  3FF5 A;  3UNG C;  3HUG A;  1P4A A;  3PQK A;  1TP4 A;  1EH8 A;  2VJ4 A;  1KGS A;  1R49 A;  1X1B A;  3PFY A;  1BI0 A;  1T08 B;  2CFO A;  3IP4 B;  3SDG A;  4A93 J;  2YU9 J;  2ZFU A;  2DFH A;  4IRH A;  1YW7 A;  4NC8 A;  1QBJ A;  5E1Z B;  1Z3X A;  3K7A J;  4OOI A;  5FD5 A;  5JLX A;  1WJB A;  2JJ7 A;  3F9K A;  1TW2 A;  2CW7 A;  2ZC2 A;  5CVJ A;  5E1X A;  1PVE A;  1XD7 A;  2KP6 A;  1R58 A;  4HQE A;  1X2N A;  2H27 A;  1OMI A;  2A5W A;  1M1E B;  4UHT A;  2DA7 A;  3DLA A;  3H92 A;  2XSD C;  5B1A H;  1UB9 A;  3RYP A;  3J7A Y;  2Z9O A;  2KDO A;  2IA2 A;  3BG7 A;  3ZQQ A;  1IN5 A;  2V6C A;  2ZXI A;  3WTS C;  1KU9 A;  3AG2 H;  1BJZ A;  2DI3 A;  3GZ5 A;  4II2 A;  3M9A A;  3ROU A;  2M7B A;  4JBA A;  2EFP A;  4KA4 A;  3KYC B;  2HEO A;  4IHV A;  1K79 A;  2DXI A;  1OYW A;  4JOM A;  3VOD A;  5LHH A;  5K1Y A;  2Y9Z A;  1RR7 A;  4RMN A;  9ANT A;  3F6V A;  2E71 A;  4PJL A;  1LDK B;  4I2O A;  2K86 A;  1EH6 A;  1MJ9 A;  1ON2 A;  1SVO A;  2XKP A;  1W1W E;  4O5V A;  1T0F C;  4BXX J;  5J6X A;  2LFB A;  3B02 A;  3CQZ J;  3S8P A;  3O8H A;  4WX9 A;  2HYJ A;  1IDY A;  4HX7 A;  1LDJ A;  1T98 A;  2OCE A;  1XGO A;  4M6X A;  5EEA A;  4C30 A;  4E6K G;  3V7S A;  1O3Q A;  1UCR A;  5EF6 A;  4BJ6 C;  1TTY A;  1ITY A;  4ENN A;  2KJC A;  1HSJ A;  3CUO A;  5FD6 A;  1D1C A;  4HW0 A;  1WGX A;  4W97 A;  1Z77 A;  4ON0 A;  1GUU A;  2A6H F;  2FNP A;  4BDY A;  1MZB A;  2VKH A;  4ASN A;  3HOZ J;  3VOE A;  4F91 B;  2E1C A;  4I01 A;  3MKZ A;  2L9V A;  2F4I A;  2W24 A;  2D2W A;  1YO5 C;  2OU2 A;  2DPU A;  1MW7 A;  3BR5 A;  2VI6 A;  1KU3 A;  2VBY A;  3GW2 A;  2LMD A;  4AD9 A;  3EUA A;  1IRX A;  1E3P A;  2HZD A;  4IHT A;  1NG7 A;  1XMX A;  2HR3 A;  2PQ8 A;  1B8I B;  2D1V A;  3ESW B;  3HKZ N;  4CDG A;  2E1M B;  4AM3 A;  3ZPL A;  2XGE A;  4DZJ A;  2O61 A;  4KIG A;  2P7V B;  5JVT A;  3JTG A;  5HOO A;  4XR6 A;  2GAU A;  4Z6Y A;  4U0Y A;  4AUX A;  1V55 H;  1G3S A;  4I02 A;  1G59 A;  3KET A;  2A05 A;  4BQN A;  1GV5 A;  2EIK H;  1QQI A;  1X1C A;  2R7S A;  1TWG J;  3DBL B;  3U1K A;  2IXS A;  2QVO A;  2PMH A;  3HTS B;  4MO7 A;  3GTG J;  3DF8 A;  3KZZ A;  2QCO A;  1Z6R A;  4PSW A;  3CES A;  4ZYD A;  3PFI A;  3JAM Z;  3DBR B;  3CDH A;  3KIO A;  1ZYR F;  1ZGJ A;  3ERM A;  2PLY A;  1MBG A;  2XRO A;  5JLW A;  1F4K A;  1UMQ A;  3RJP A;  3TO9 A;  4M71 A;  1Z7L A;  3HJE A;  3HOY J;  3GZN B;  4E7I A;  5EEG A;  3I71 A;  4DJA A;  2ZME C;  1B59 A;  1IV8 A;  3GLX A;  1AKH B;  1FJL A;  1E17 A;  4HSR A;  2K3F A;  4A3M J;  3KLN A;  2N8G A;  1ZRE A;  4EM0 B;  2G7H A;  2K9N A;  4ABZ A;  3LA7 A;  4RA2 A;  5C4J J;  3JRH A;  3ZMT A;  3ULQ B;  3LFK A;  3T5X A;  1OCT C;  1EKE A;  1IN7 A;  3ZRG A;  3T8R A;  4IHS A;  4BJT A;  3KYD B;  3JRG A;  2VE8 A;  4A3I J;  2BW3 B;  2KIS A;  4GRI A;  1HCR A;  5DM7 F;  3WU1 B;  4A2U A;  2IGM A;  3PQJ A;  1EV7 A;  2VPR A;  2M7A A;  5GTH C;  1QVU A;  1ULY A;  2CWE A;  1KU2 A;  3CTA A;  4BQO A;  1WHU A;  4DQ2 A;  2O0Y A;  1GXP A;  4D0P A;  1LFP A;  3CLO A;  2OZ6 A;  4PJ0 C;  5JVG F;  3QYF A;  2V6E A;  4GXO A;  4H0E A;  2B7E A;  2M87 A;  2A61 A;  4C2M J;  2JPB A;  3BQY A;  2R7V A;  3ABU A;  3J80 Z;  2BY1 A;  3CUQ C;  4HX8 A;  4CCL A;  3QRF F;  2AXT C;  3HL2 A;  3MQ0 A;  3LMM A;  5HDG A;  1IN6 A;  2IGK A;  4A69 C;  2DOA A;  5J4V A;  2YX4 A;  3LA2 A;  1TWC J;  2YSR A;  5DYM A;  3CO6 C;  4CCJ A;  2DPD A;  3FXU A;  1IGN A;  4ESJ A;  4HEA 2;  3KP5 A;  2VIX A;  1WZ2 A;  4M3E A;  3O8G A;  3HOW J;  2DJN A;  3CJR B;  1KZH A;  3A01 A;  3LWF A;  1JGG A;  1VFC A;  1APL C;  3NRV A;  2ZJP F;  3WGH A;  3Q9V A;  4WXD A;  1S72 I;  1P92 A;  2E1N A;  3G1O A;  3GTL J;  1QZE A;  4LLL A;  4EGZ A;  3FM3 A;  4ZYG A;  3W2V A;  4KT6 A;  4M6Y A;  4CCK A;  2KLO A;  5B5E C;  5LGT A;  5EGO A;  3OYC A;  3GTQ J;  3JTH A;  4XBF A;  3KCC A;  1K6O A;  4BU2 A;  1KQ0 A;  2CU7 A;  1F9N A;  3LSR A;  1EA3 A;  3OIQ A;  1A31 A;  2KFD A;  2ZKZ A;  2M0M A;  5M3F J;  3ECO A;  4XOR A;  5F27 A;  1T56 A;  4C3H J;  1R4N B;  2JVH A;  3FHN A;  4A6D A;  3QOE A;  2GA2 A;  3KEY A;  2QQB A;  1FBU A;  1U5T A;  1BJA A;  1ZEL A;  3H5A A;  5JFR A;  2LC2 A;  3PL8 A;  2RGV A;  4IVN A;  1MBH A;  1TLH B;  2Y31 A;  3NWS A;  4IF4 A;  3WTX C;  4C3I J;  1SD4 A;  1JUM A;  3BJ6 A;  4LB6 B;  3MD2 A;  1DPR A;  2H94 A;  1HA8 A;  5D5V B;  3ABK H;  4EJT A;  1QGP A;  4MGR A;  5F6F A;  3V8J A;  2V1D A;  3KP4 A;  1H8A C;  2DTZ A;  5L3F A;  3L1P A;  1ZN2 A;  5FLV A;  2MAB A;  2G0E A;  3RZD J;  3I4P A;  4AVZ A;  3K4K A;  2FEZ A;  2XPU A;  5L3G A;  2I10 A;  2LDU A;  4E7H A;  4CYC B;  4I7H A;  3G1L A;  4GCV A;  4UUS B;  3F22 A;  2OF7 A;  4KIF A;  5F0C A;  3CO7 C;  2VOP A;  2L7K A;  4ESF A;  1WVR A;  4EJO A;  5HS8 A;  5IPA A;  3GYH X;  1XCB A;  2WWY A;  5K5R A;  1UG0 A;  5IP7 J;  2BVM A;  2X4H A;  3L9F A;  3BJO A;  2X51 A;  5K5O A;  4AVP A;  5FRN A;  4AIJ A;  5B3S H;  3PIP F;  4UNO A;  3K0L A;  2RQP A;  5AIP A;  4PFO A;  5E3O A;  3LSM A;  3ZMZ A;  1WJC A;  2FX0 A;  4FCY A;  2ZFW A;  1VQL I;  2L5Q A;  4JQF A;  4AIK A;  3MCZ A;  2E60 A;  1TWH J;  3JRB A;  1YFH A;  1VND A;  3IAS 2;  4HNV A;  2A69 F;  1DP3 A;  5FJ8 J;  1EF4 A;  2DFF A;  4I76 A;  3K4L A;  1P6R A;  3N4M A;  4P5O A;  2EPF A;  4KN7 X;  3KP7 A;  3AG1 H;  2O8X A;  4B1R A;  1U9N A;  2EIN H;  2FML A;  3H9J A;  4PFP A;  1VQP I;  3QWL A;  1FTT A;  3W2A A;  2LY1 A;  1FSE A;  1AWC A;  2OAZ A;  3RCO A;  1AU7 A;  2GLO A;  3JR9 A;  4HZF A;  2FBK A;  2Y0S A;  4XN3 A;  3R0J A;  3EDP A;  4GO1 A;  3OYJ A;  3K10 A;  2L9S A;  2K85 A;  2K5C A;  3NAR A;  4BY7 J;  4ENK A;  2IS6 A;  4UUT A;  1FIA A;  4AIH A;  1HKT A;  1X1D A;  1YTY A;  2DN0 A;  1JTY A;  3L2V A;  4RB0 A;  2AO9 A;  3MVP A;  2QSF X;  2FBH A;  1GHC A;  2L4M A;  4L9N A;  1T33 A;  1J2X A;  4LLG F;  2PBI A;  4LGW A;  1BL0 A;  3I5U A;  3ONQ A;  1P7I A;  3OR2 C;  4KMU X;  2DLL A;  4U7D A;  3WTT C;  4MEY F;  3AKZ A;  2CQX A;  1XN7 A;  5CKT A;  4H4K C;  2DW4 A;  2JN6 A;  5HOD A;  4OIP F;  5LLQ A;  1LEB A;  2X0L A;  2V4J C;  2CMP A;  3IH3 A;  2E7W A;  2FNA A;  2LKS A;  2K40 A;  1PYV A;  2PFB A;  1ZRF A;  2KRH A;  3CUQ A;  4CA0 A;  5J47 A;  3EUK L;  2HOT A;  3QQA A;  2QSG X;  1E3H A;  2HQN A;  1A6I A;  3U9G A;  1P4X A;  2P81 A;  1OIS A;  2K4J A;  3HUG B;  4YII A;  1UG2 A;  3V4G A;  2XGX A;  2HOS A;  4LIT A;  4LIV A;  4N9H A;  1JGS A;  1FY7 A;  4XKV A;  2W1O A;  1VQO I;  2B63 J;  2BY0 A;  2VJ5 A;  3IHU A;  3I56 I;  1Y1V J;  4BGD A;  3RKQ A;  2NVQ J;  3H9Q A;  3B73 A;  2FE3 A;  2ECC A;  3HSR A;  2LRD A;  3BJA A;  2PEX A;  1AOY A;  2AHQ A;  2YR2 A;  4RGU A;  4LIU A;  2DJI A;  2DA2 A;  4F3Q A;  4N4N B;  1MDM B;  3FXK A;  4OMY A;  1D8K A;  4KIS A;  1R36 A;  4UV8 A;  4P55 A;  4D7N A;  4PCQ A;  4RGX A;  3GBG A;  5FKM A;  4RLF A;  2JRT A;  2HQR A;  2IEK A;  4MHG A;  1WKM A;  3W3C A;  2DA4 A;  1E3O C;  2UV1 A;  4ITV A;  1JTX A;  1XPX A;  2NAZ A;  2GIZ A;  4L5J A;  4CZC A;  3RQ4 A;  3DLL F;  1DGW Y;  1MGT A;  2CH0 A;  2ELH A;  2VQC A;  5LRR A;  4OAY A;  3SZG A;  5LRS A;  4P9F A;  1KQ8 A;  1U0J A;  2XAQ A;  1A6Q A;  3BTJ A;  1IN8 A;  2UZK A;  4RAG A;  1XMK A;  2E1O A;  2OCC H;  3NAU A;  2WAQ A;  1J5Y A;  4KNY A;  1W7P A;  4CO8 A;  3IV5 A;  2EBI A;  4PK4 A;  2VC0 A;  3PJR A;  3HHH A;  4L0Z B;  3W6K B;  1OJL A;  3PSI A;  2EK5 A;  2CUZ A;  1NTC A;  2ID3 A;  4A5N A;  2HI3 A;  4IO9 F;  4XRS A;  2LP0 A;  2HVR A;  1XB4 A;  4Y4R A;  2VL8 A;  2XDV A;  4IZZ A;  4NNJ A;  1SFE A;  3GWZ A;  3ZGK A;  2I5U A;  2M9H A;  2W25 A;  1K4S A;  3HGY A;  5LHG A;  2GXA A;  1FC3 A;  2A6E F;  3WG7 H;  1FP2 A;  3K2Z A;  2R92 J;  2XAF A;  3JSP A;  3BG6 A;  3LST A;  2XUB A;  1BI2 A;  4MNU A;  3S15 J;  4QIW N;  1OYI A;  2DOF A;  2CW0 F;  4G6D A;  1PP7 U;  2FQ4 A;  3JRC A;  3CC7 I;  1X58 A;  4B3X A;  3CJN A;  1WJA A;  2MA3 A;  2C6Y A;  2BVL A;  3CMA I;  1WI3 A;  3DKX A;  1I3A A;  3KFW X;  4GYI A;  2HDC A;  1R71 A;  3I54 A;  2JA6 J;  4PGG A;  4A3B J;  2LBF A;  1OR7 A;  2XAS A;  2P5L C;  1N75 A;  2DOE A;  1YX3 A;  1X3Z B;  5F08 A;  3A1Y A;  4J19 A;  1SD6 A;  4DYC A;  4L18 B;  1LKX A;  3H36 A;  4G12 A;  2VKV A;  4L9J A;  3VEP A;  1QVT A;  3K69 A;  3BPX A;  4YIR X;  3W6J B;  3DU5 A;  4XOT A;  1LNW A;  2DFI A;  3E3V A;  2HYF A;  3LL7 A;  2HPI A;  4F93 B;  2NOJ B;  1OCO H;  3J7Z I;  3M1C A;  1VZ0 A;  4BXU A;  5J1R A;  3M8F A;  1TQM A;  3GEZ A;  4HPQ A;  1LB2 A;  4BNC A;  1Q1H A;  3K9T A;  4UVB A;  2ZJR F;  3I55 I;  3JRE A;  4ENJ A;  3IL2 A;  3VSK A;  3V7C A;  1FOW A;  1S7E A;  2EIJ H;  1FMW A;  2NS7 A;  1PUF B;  3GO5 A;  5DCM A;  1SFO J;  1O3R A;  2QEN A;  3DV8 A;  2J5O A;  4N4O B;  5DM6 F;  2OZU A;  4XK4 A;  5K7Z A;  1IZ1 A;  3WU0 A;  1YLF A;  2GM4 A;  4HAM A;  2JA2 A;  1A36 A;  4HDU A;  4IHX A;  1O7L A;  3HPG A;  2HDW A;  2NVU B;  1G3W A;  2KZV A;  2DBB A;  2WV1 A;  3SZT A;  3DTI A;  2M3A A;  2MH9 A;  1VQN I;  2M4G A;  3SEZ A;  1IRG A;  1YRN B;  4XMY A;  1LE8 A;  2LK2 A;  4L9V A;  1FWZ A;  1LPQ A;  1JKP C;  2JA7 J;  2K9Q A;  2R3S A;  2AXL A;  1D1B A;  4UVC A;  1POG A;  1DU0 A;  4C2U A;  5IY5 H;  2CQQ A;  2FBI A;  4A3E J;  5BNG A;  2XRL A;  3OL3 A;  3C3W A;  4WXC A;  4QWQ A;  2JT1 A;  2DDA A;  1SFK A;  3PO2 J;  3HM5 A;  5D6F A;  3M1E A;  1QA6 A;  5FRM A;  2QQ8 A;  3KE2 A;  1HOM A;  5HDK A;  3MZY A;  5KHD A;  1B6A A;  3L2Q A;  3M8J A;  5FLM J;  2PG4 A;  3DTK A;  3A01 B;  4E4H A;  3I4N J;  1ZH5 A;  4NBQ A;  3UKG A;  1YW8 A;  3E5Q A;  4QLC U;  1UHS A;  1CQT A;  3OSG A;  3RPU A;  1STZ A;  2UUZ A;  3HOS A;  2LY9 A;  1YJ9 I;  4XRF A;  4I6Z A;  1UHM A;  1RRJ A;  1RZ4 A;  1WSU A;  1RPW A;  1WRJ A;  2EZL A;  1UZC A;  4M73 A;  1ZRC A;  3NQO A;  3ZQL A;  3OOU A;  3BTI A;  1HW2 A;  1UEL B;  3QPL A;  2K4B A;  2OPT A;  5CVI A;  1JKO C;  2NNY A;  2WTE A;  2K9M A;  3IH4 A;  2XRN A;  3OYM A;  2BBY A;  4XKC A;  4HQM A;  3T8T A;  2ZO4 A;  3Q3S A;  2R5Y A;  1Y39 A;  3P9C A;  3PUF A;  1W0U A;  3MEX A;  2VKE A;  4ZZL A;  1XGS A;  2XAJ A;  1LJ9 A;  2BY3 A;  1ZGW A;  3I4M J;  4ZH4 F;  5LGN A;  5L3D A;  1W36 C;  3HRM A;  3VYS B;  4KYW A;  3ZMD A;  3FWE A;  3ABL H;  3QP5 A;  4NB5 A;  2V1X A;  4RAF A;  1BC7 C;  3MKL A;  2V9V A;  4Q47 A;  3IRR A;  4RB1 A;  2EIM H;  1LDD A;  2VQG A;  3H3Z A;  4I99 C;  4MEX F;  2XAU A;  3V7R A;  1IXS B;  3E5U A;  2QGU A;  2XB0 X;  2R7T A;  1MND A;  1LEA A;  1W4M A;  4BHP A;  3KEQ A;  2LOO A;  3R60 A;  2R7R A;  2BGC A;  1MJB A;  1FSH A;  1DDN A;  2M30 A;  1MSE C;  3DU6 A;  4A0Y A;  4D7M A;  1U5T C;  3I64 A;  2XV4 S;  3HOU J;  2IS4 A;  3C1D A;  4XSX F;  4Y52 J;  2ISY A;  3TP3 A;  2OTJ I;  4I0B A;  4YEL A;  3LSP A;  1R5I D;  2VQH A;  5IOZ A;  3HOV J;  3BZ6 A;  5FLX Z;  4O6J A;  4KN4 X;  3HYI A;  2VAS A;  2V1U A;  3WG9 A;  3IWZ A;  1I27 A;  3WHB A;  3S32 A;  3IUO A;  2O8K A;  4Y33 A;  2YX7 A;  3JRI A;  1R6R A;  3IH2 A;  3JAM K;  3I53 A;  5IP9 J;  5BMZ A;  1ETQ A;  2M1B A;  1B72 B;  4FT8 A;  2F5E A;  4X0G A;  4QPO A;  3LSJ A;  3S14 J;  1E0E A;  1ZG5 A;  2KPM A;  3RDI A;  3D5L A;  4HOB A;  1Y8R B;  2L01 A;  3CZ6 A;  3OIO A;  3CC4 I;  3OYD A;  3PIO F;  2DMU A;  2KHM A;  2QKL B;  1FTZ A;  3S1R J;  1NK2 P;  5J4Y A;  2V9K A;  1UHW A;  4B4C A;  2ZME B;  4OIN F;  3VYT B;  3LNQ A;  3HRT A;  1TZL A;  1HST A;  1Z91 A;  1XTA A;  2XAG A;  5KAF C;  5DTD A;  3BY6 A;  1E2X A;  1RR8 C;  4KT5 C;  1FNN A;  1H9G A;  1R5H A;  3PNT A;  3RKY A;  5J8C A;  3TOA A;  4KFC A;  2XSJ C;  4IQJ A;  5DCF A;  1SAN A;  4IJA A;  4FX0 A;  2XKO A;  2HYG D;  5FFZ A;  3L00 A;  1YX5 A;  2JA8 J;  3N05 A;  2L7F P;  2DT6 A;  2CQN A;  2L9N A;  3F21 A;  2ZNZ A;  2H09 A;  2VBW A;  4NQW B;  4AC0 A;  4G7H F;  3AG4 H;  1I50 J;  1BR4 A;  1XGN A;  4XID A;  3TED A;  2H8W A;  1TL8 A;  2GQQ A;  4B3A A;  1LUJ B;  4U0W A;  1IXC A;  1K83 J;  2GBY A;  3TQN A;  5LHI A;  4UY8 I;  1USS A;  3FXM A;  1FBQ A;  1ZTR A;  5D5W B;  1B1B A;  5EEH A;  1V54 H;  1W5T A;  5HDN A;  3J80 K;  1K7A A;  1JJ6 C;  4IHW A;  2L54 A;  4HV5 A;  4IOA F;  3L7W A;  4ZDP A;  3CUQ B;  1I5Z A;  1BOA A;  5LBQ A;  2Q2E B;  1X3W B;  3E5X A;  4RM2 A;  4B47 A;  1ETW A;  1WH5 A;  2BZT A;  4C3J J;  1MKM A;  4LJZ F;  3OYG A;  4IHY A;  2JSC A;  1FYK A;  2JSP A;  3FK6 A;  5EG0 A;  5TRD A;  3IWF A;  3LSK A;  3K70 D;  3J7A O;  2M2E A;  4RDU A;  4A3J J;  4BQQ A;  1MJA A;  3FMS A;  5FKL A;  2ADU A;  2Q1Z B;  1TT0 A;  3QYB A;  3OV8 A;  3H0D A;  5LEK A;  1IJW C;  5ICF A;  3REO A;  1AA7 A;  1DQU A;  4Q48 A;  2R5Z B;  5E8G A;  1OYY A;  1R1V A;  2K7L A;  3LQQ A;  4DNC A;  2DOD A;  3K1N A;  1D0Y A;  2DO7 A;  2IPQ X;  1T6S A;  2JUG A;  2F5V A;  1S6L A;  2EWN A;  2Q0O A;  2L4A A;  2NXN B;  3E0J B;  1BC8 C;  2YUS A;  4FX4 A;  1Y1W J;  4XIC A;  3FK7 A;  3GCM A;  2COM A;  3BRO A;  4HF1 A;  4A3C J;  2G7U A;  5E3M A;  3ZOB A;  1YG2 A;  2EQR A;  1XGM A;  4NDL A;  2HVQ A;  2ZSH B;  3GTJ J;  2ZBK A;  2WAQ N;  1MMD A;  2ICW G;  4A3K J;  4WXH A;  5GAE J;  2XF7 A;  2I8D A;  1HDP A;  2Z2S B;  4HYE A;  3K2A A;  2VKD A;  4G6T B;  4EJV A;  4ENM A;  4PZJ A;  1SFX A;  5IT3 A;  4RB2 C;  3LQR A;  5IP6 A;  1YIJ I;  1C0W A;  1VQ5 I;  4MQ9 F;  1G2H A;  2Z16 A;  3BG3 A;  1JHH A;  2EH3 A;  3KP2 A;  3P9I A;  3DPT A;  2DK5 A;  1YQA A;  3IAM 2;  1OCC H;  4RAY A;  1O4X A;  4Q5S F;  3U2R A;  2M0C A;  2R0Q C;  3GTO J;  2P5K A;  3WOD F;  2JA5 J;  5DUI A;  2MSY A;  2VOD A;  1HBX G;  3S1Q J;  4E7Z A;  2VLA A;  2HGC A;  2Y9Y A;  3HEF A;  2BHZ A;  1JI8 A;  3HC7 A;  2A07 F;  4I98 B;  3TDZ C;  2E2I J;  1D5V A;  1HF0 A;  2K02 A;  3TBI A;  2D5V A;  4YFX F;  5DS9 A;  2E2H J;  4OMZ A;  2HQA A;  4KIC A;  1ZKG A;  5AON A;  3CJQ B;  1VQM I;  2NVX J;  2LG4 A;  2W00 A;  5D8K B;  2F4M B;  5LGU A;  2FMY A;  2CUJ A;  2MC4 A;  2ZNY A;  2VBX A;  4BAC A;  3ZCO A;  4EEF G;  5DUK A;  4RM3 A;  3HRS A;  4BL0 B;  3SJM A;  2F5C A;  4MQV A;  4KUM A;  3WTU C;  4Y17 A;  2M8E A;  2Y2Z A;  4CSW A;  3Q0V A;  3CMM A;  4FET A;  5HNH A;  3W6V A;  4PDK A;  2VN2 A;  3B6C A;  2X6W A;  4RB3 C;  4EAT A;  1JUP A;  4KDP A;  3ZXS A;  2IT0 A;  3L2U A;  3JW4 A;  1ACI A;  2EFW A;  2NOG A;  2RNG A;  3I59 A;  1TQI A;  4LFU A;  1FYM A;  3HOX J;  4LG3 A;  2V1N A;  1MBF A;  1O7F A;  3G4S I;  3S3O A;  3DXJ F;  3BOQ A;  4LK1 F;  2DYR H;  3CLQ A;  4ZYE A;  5E1W A;  2L7M P;  2AQE A;  4P96 A;  1G4D A;  4LB5 A;  1XDU A;  3L2C A;  4FTH A;  4M72 A;  3LSG A;  5KCM A;  4ZC3 A;  4D5F A;  2MLK A;  2IP2 A;  4DIQ A;  5GPC A;  2HKO A;  3IKV A;  3A03 A;  1FOX A;  2MBF A;  2DAO A;  3G2B A;  1Q1V A;  1BI3 A;  3OYB A;  1W5C C;  1PJR A;  2QBY A;  2L0K A;  5FFX A;  2X6O A;  3GFL A;  5CJ9 A;  4CUG A;  5F1R A;  4GFB A;  1V3F A;  2DA5 A;  4JK1 X;  1T38 A;  4HV6 A;  2BEO A;  4D9J A;  1I39 A;  1OR7 C;  3MMY B;  1B8I A;  5ICC A;  5DCM B;  3L2R A;  1WH7 A;  2FD5 A;  4XSZ F;  4NUB A;  2QF7 A;  4G6Q A;  1MH3 A;  1ON1 A;  2E5N A;  3FXJ A;  4KIT B;  4U7B A;  2GXB A;  2TCT A;  4QSH A;  1XC5 A;  2CS3 A;  2CV0 A;  4B09 A;  1HW1 A;  4BXF A;  4EM2 A;  3TGN A;  3QU3 A;  1BI1 A;  1Y56 A;  2IGO A;  2V9P A;  2H6C A;  3LSI A;  2WB1 A;  2FOW A;  3FHZ A;  2FOK A;  5IYB J;  4LD5 A;  3I0T A;  1XDS A;  2OA4 A;  3OYF A;  1CF7 B;  1SMY F;  5BQT A;  3A4C A;  3OL4 A;  2KRC A;  3NWT A;  1H88 C;  4EGY A;  2IA1 A;  5IYC J;  2DK8 A;  5DEQ A;  4V2G A;  2D45 A;  5J8F A;  1FPQ A;  2TDX A;  1VQ8 I;  5IT9 K;  4HLY A;  2PI0 A;  1G3T A;  3DWL E;  2IVM A;  1R4M B;  3K4N A;  3DQV C;  4HF0 A;  4F55 A;  4E7K A;  3CCJ I;  2XPW A;  4UB6 C;  1JJ8 C;  3BR1 A;  1JKR C;  4IOC F;  2JPC A;  3IRQ A;  1JE8 A;  5JHF A;  3F8N A;  5TIS C;  2KIU A;  1AKH A;  2H1K A;  1Z3Y A;  3GUD A;  5BOX A;  1R1U A;  2MD5 A;  2PJR A;  3S2D J;  1HXD A;  2WC2 A;  4RS8 A;  1N25 A;  4PGH A;  1HKQ A;  4M9Z A;  3OS2 A;  2UWM A;  1IV6 A;  3WTV C;  3P9K A;  3GTK J;  2EIL H;  4BDZ A;  2GZW A;  5IT9 Z;  3HXL A;  3CCV I;  3S93 A;  3OYL A;  5DD4 A;  1LFB A;  5H2F C;  3JCU C;  3CD6 I;  1IDZ A;  2F4O B;  1J09 A;  2LYC A;  3GTP J;  4M9S A;  2P8T A;  1TC3 C;  3OMY A;  2BW3 A;  1R1T A;  4JYK A;  3SEQ A;  3U21 A;  3GME A;  2ZJ2 A;  4IQ4 A;  4XLC A;  4HF2 A;  4U88 A;  5HNF A;  5CVU A;  4J00 A;  1JKQ C;  5GAH J;  2R5Y B;  3R61 A;  1QZY A;  5EDN A;  1MMA A;  4XRS G;  2CRG A;  4CCN A;  2NVY J;  4BHC A;  1O57 A;  2WA0 A;  3CMY A;  4XKW A;  1ZLJ A;  1O3S A;  3VWB A;  1IF1 A;  3K4J A;  3FZV A;  5K7H A;  2XAH A;  1T2K A;  1ZHF A;  3FKJ A;  2UXX A;  3WE2 A;  4EV0 A;  2DT7 B;  2QYO A;  1BOB A;  2VC1 A;  4YIF A;  3TKY A;  2HFH A;  3PO3 J;  5HS7 A;  1QNT A;  2V79 A;  1A04 A;  3D0S A;  3MZ8 A;  3J81 K;  4PJM A;  4KIB A;  2HNH A;  2XB5 A;  2R7Z J;  2P0W A;  3EPZ A;  1ZAR A;  3KEO A;  3Q5F A;  1MIJ A;  1GDT A;  1MBJ A;  3IKT A;  1DPU A;  1TWF J;  4XM3 A;  4A0Z A;  1S8N A;  4HNT A;  3AAF A;  2VE9 A;  2EV0 A;  3H9G A;  3KLO A;  5HLT A;  2KMU A;  2NRA C;  2KKO A;  2DA1 A;  2JTV A;  1N77 A;  2R7O A;  1R23 A;  3EUH C;  1PP8 F;  1DUX C;  1X2M A;  2IS2 A;  3P5J A;  2GOM A;  3AFH A;  4BAY A;  1OPC A;  3GLL A;  4XNF A;  4RAZ A;  3CCL I;  3AL0 C;  3BCB A;  1YW9 A;  4BJ5 C;  2IW5 A;  3G1M A;  2STW A;  1QHG A;  2RV8 A;  3BCA A;  2R7X A;  3J81 Z;  1ZR4 A;  3M7G A;  3PNV A;  1Z05 A;  1KYW A;  2JQ7 A;  1FOY A;  3S3N A;  2MD0 A;  4DZP A;  2NS8 A;  1RES A;  1ZLK A;  2ME0 A;  2FJ1 A;  3OYN A;  2MH2 A;  2NVT J;  1G3Y A;  3BC8 A;  1FT9 A;  2JWT A;  3RKX A;  3PUB A;  1SMT A;  5CYV A;  2QZ8 A;  3I3L A;  4XL9 A;  4CXF A;  1J0R A;  2P6S A;  3MKY B;  1OFC X;  1FBS A;  1OCP A;  4HST A;  3T0Y A;  2LD5 A;  4IL6 C;  3RQI A;  2R7U A;  1ETX A;  5ERI A;  2HZT A;  5JI6 A;  1GT0 C;  1I1S A;  3FXR A;  4UUS A;  5EYR A;  1X1P A;  1YHQ I;  2DYS H;  2LKP A;  2X85 A;  2HXI A;  2MYS A;  3EQL F;  3CCQ I;  4MLO A;  4M3G A;  1BIA A;  1S7O A;  2IBD A;  4UB8 C;  4ZDL A;  1MH4 A;  1X4O A;  3DEE A;  4OWR B;  2JK3 A;  2LSO A;  4BKX A;  4RBO A;  1ZQ3 P;  2QWW A;  3F72 A;  1G6N A;  4ETS A;  4BE1 A;  2MFZ A;  4M3D A;  5GAG J;  2B0L A;  2RDP A;  2DMT A;  3V8L A;  1VQ9 I;  2X1D A;  1OKR A;  4G9Y A;  2WBM A;  5CVV A;  4HA8 A;  1QHH D;  4M9X A;  4XON A;  4A6E A;  3HDD A;  1S29 A;  3I58 A;  2YPR A;  3HZJ A;  5EG0 B;  1TWA J;  3E6M A;  2IJL A;  3OSF A;  1YIO A;  3ASN H;  2FQ3 A;  3WTY C;  1FOK A;  1GVJ A;  1D1A A;  2RKH A;  1H0M A;  2FA5 A;  2CUE A;  2K9L A;  3RYR A;  1DP7 P;  4MTE A;  3L2W A;  2IRF G;  4XLP F;  2GOX B;  3K4C A;  2EA2 A;  2E7X A;  2GXG A;  5BS6 A;  3I9V 2;  4ZTJ A;  2X1E A;  5CPR B;  4LOC A;  1ZAO A;  4UV9 A;  3S3M A;  3HOT A;  2QEX I;  2CG4 A;  4G94 A;  1NG6 A;  3WE3 A;  2HWV A;  4R8H A;  4P1W A;  2DCE A;  4G7O F;  2NYX A;  1JUS A;  3GZ6 A;  3E6D A;  1GXQ A;  3OOP A;  1IAW A;  3VPR A;  3SDB A;  4ZTF A;  2KJB A;  3WU2 C;  1VQ4 I;  1ZRD A;  2LF7 A;  2E5Z A;  1XG1 A;  2CUF A;  3P7N A;  1IN4 A;  2J5P A;  1IC8 A;  3TMO A;  4XRM A;  5ILV A;  1VTN C;  2X1C A;  2STT A;  4V2F A;  3DPU A;  1OCZ H;  4AYB A;  3ELK A;  1YI2 I;  2OV7 A;  3LA3 A;  2LTP A;  1MD0 A;  4R79 A;  2PMZ A;  3QOP A;  3QU6 A;  3DFG A;  3GFI A;  1XX5 A;  2LVS A;  4E7L A;  1U3E M;  1SD5 A;  2R7Q A;  1IRZ A;  1WJF A;  5HS9 A;  4MFE A;  1SVM A;  3NEU A;  1V4R A;  1NH3 A;  2O5R A;  5EGO B;  4MFD A;  2KT0 A;  5H20 A;  4ANJ A;  3BPV A;  1H9T A;  3H3V K;  4A12 A;  2ZSI B;  3CCE I;  2MC3 A;  2Z5U A;  1X4P A;  1D0Z A;  2LY2 A;  2A6T A;  5D4R A;  1D0X A;  5ED4 A;  4YEJ A;  1UFM A;  2CYY A;  5EJC A;  1YS6 A;  5C44 J;  1I6H J;  2F5D A;  2AQF A;  3HRU A;  3BR2 A;  1HLV A;  1U5T B;  2CQ7 A;  4S0H B;  1FZP B;  3LSH A;  1ZG3 A;  2KZG A;  4IKF A;  3E97 A;  2Y0M A;  3CC2 I;  4YFN F;  3LAJ A;  1RET A;  5FLX K;  1MDM A;  2P6T A;  2L9R A;  3EUH A;  3WGG A;  3TW6 A;  1J59 A;  4EJU A;  1HW5 A;  1U6G A;  3OY9 A;  3VFZ A;  2XGC A;  1ZR2 A;  2DDB A;  4N0B A;  2A5Y B;  2EZH A;  4XLN F;  3G71 I;  2CV1 A;  2WAE A;  3ECH A;  1IW7 F;  3A0H C;  4E7J A;  2VBZ A;  3BZK A;  2HTS A;  2X6Y A;  1NK3 P;  3QP6 A;  1SAU A;  1KYZ A;  3WTZ A;  1YS7 A;  1DU6 A;  3ZQ7 A;  2L3D A;  4HDV A;  1S3J A;  1JXS A;  3S17 J;  1KU7 A;  2OJE D;  3I59 B;  4QTR A;  1RNL A;  1KON A;  3L09 A;  1BIB A;  2EZK A;  3F8M A;  2W82 A;  4OU0 A;  2GIV A;  1R9T J;  1OCR H;  2FU4 A;  1PDN C;  2OTL I;  4N9I A;  2QA4 I;  3S16 J;  1FIP A;  1F1Z A;  4IRG A;  1Z67 A;  4ZDO A;  1RC9 A;  1ORK A;  2WAD A;  3B6A A;  2MG4 A;  4WF2 A;  2PN6 A;  3DP7 A;  3VSL A;  2Y0S N;  3F23 A;  3C2H A;  2DT5 A;  3RPU D;  2Z99 A;  1Z1D A;  1EJ9 A;  4EM1 A;  1RKT A;  1S5L C;  2YS9 A;  2ZCW A;  5LD2 C;  2F5F A;  4GDF A;  2QBY B;  3VB2 A;  5D5U B;  2COB A;  1WQ2 A;  2UXN A;  1BR2 A;  2VT2 A;  2DU9 A;  2EV5 A;  4IXA A;  2O9L A;  2LNB A;  4CGZ A;  2WB1 N;  4IX7 A;  2FXA A;  2ZB9 A;  4ESB A;  1Z21 A;  5L3C A;  1ETY A;  1BN5 A;  1SAX A;  5FKO A;  3BDD A;  3ZQG A;  3MFK A;  2BV6 A;  2JMW A;  3HSE A;  2TRT A;  1Y8Q B;  3CCY A;  4DBQ A;  3BG9 A;  2QUF A;  3HHG A;  4RLQ A;  2PMU A;  1REP C;  1VQ7 I;  3QOD A;  3OWT A;  5FGM A;  4V19 K;  1K78 A;  4KJZ A;  3ZQF A;  4OIQ F;  4YG2 F;  2JUC A;  1YJW I;  1PUE E;  3ZMV A;  1BM9 A;  2PJP A;  2QM3 A;  5F04 A;  4BBS J;  3HTU A;  1MNE A;  1LQ1 A;  2D1H A;  5C4X J;  5IYD J;  1R00 A;  5B66 C;  3PSF A;  1FEX A;  5D4S A;  2MW8 A;  3ZN0 A;  2VT3 A;  4JX5 A;  4DW6 A;  3TP0 A;  4EMS A;  3CF5 F;  5E3N A;  1IG7 A;  3COA C;  4XN0 A;  5E3L A;  3ZMS A;  2VB6 A;  1R22 A;  1B9N A;  4A3F J;  3M4O J;  2E1M C;  4XLA A;  1IXR C;  2JZY A;  1VI0 A;  4E7S A;  4GGG A;  5L3B A;  2M34 A;  5J3L A;  1KQ9 A;  3N97 A;  1WWX A;  2EFN A;  2DFE A;  1D3Y A;  1BBY A;  2CJJ A;  2LR8 A;  3C2G A;  1P7J A;  4BEH A;  2LF8 A;  2M5W A;  3G3Z A;  3FXL A;  2OQR A;  3F8C A;  2CFX A;  5BPD A;  2PJR B;  3KP3 A;  1T95 A;  3QPT A;  1V5E A;  2DQR A;  2LRE A;  2RRE A;  4D5C A;  1Y0N A;  3G6E I;  5L3E A;  1PUF A;  2CW8 A;  4NC7 A;  1GV2 A;  3S1N J;  2HXO A;  3HIF A;  4M6V A;  1FMV A;  2E19 A;  1H89 C;  5HLH A;  4PJN A;  2ME6 A;  1RIO H;  2E2J J;  1ENH A;  3D1N I;  2RC4 A;  1MBK A;  5CQE A;  2HTJ A;  4L5E A;  2JRM A;  2LLK A;  4JX6 A;  4HBL A;  4P9U A;  4FE4 A;  2CGP A;  2W85 A;  5IOY A;  1YRN A;  5FRO A;  3OYI A;  5CQG A;  2W84 A;  2EV6 A;  2RNJ A;  5E20 A;  5HLI A;  4CYD A;  4DYR A;  3SFI A;  1LVK A;  4XKB A;  1MMS A;  3BZC A;  4G8X A;  4M3B A;  4EQQ A;  3BTL A;  1UST A;  4X6A J;  3C2B A;  2RQQ A;  2OD5 A;  1OQY A;  5D6E A;  4ZYA A;  1L3L A;  4CHU A;  1YE9 A;  4BUP A;  3PNY A;  3FIS A;  1VQ6 I;  5C3E J;  1XSX A;  2O3F A;  5KNL A;  2GA1 A;  5J40 A;  4LG0 A;  1JT6 A;  3K1M A;  3MAJ A;  4Y15 A;  2VJJ A;  2OBP A;  4NHJ A;  1V5F A;  2H6B A;  1ERD A;  2K3P A;  1Z6T A;  5E8I A;  5ILU A;  1W7P B;  3KX2 A;  2BY2 A;  2NS0 A;  3K4M A;  1HQC A;  2XPV A;  4RGS A;  3IC7 A;  1AHD P;  5K5Q A;  4KMF A;  3TO7 A;  3F0C A;  3Q0W A;  5FKK A;  3BTC A;  1P9Q C;  1DGR M;  2HDD A;  5TJJ A;  4J01 A;  5F64 A;  5JHU A;  2R93 J;  5ICE A;  2CO5 A;  2F2E A;  2R7W A;  1LVA A;  3MWM A;  1T0F A;  3X2Q H;  3WGI A;  3FM5 A;  3H5N A;  1RKW A;  3H1C A;  3E6C C;  2Y30 A;  2ZXH A;  1BW5 A;  3W2W A;  2K9S A;  3MN2 A;  3AG3 H;  5LEJ A;  3FX3 A;  4B48 A;  1B4A A;  2EB7 A;  3TW7 A;  1S9H A;  2HKX A;  3A2K A;  3H0G J;  3SHF A;  1J75 A;  4BBR J;  2KIF A;  1NHA A;  2WAF A;  3DKY A;  4I09 A;  3V8K A;  4A3L J;  3T1B A;  1F43 A;  5K7F A;  4U0V A;  4CZZ A;  1U8R A;  3LOC A;  3CDI A;  3ML6 A;  3RIR A;  2DTR A;  3GXO A;  1WFX A;  3GVA A;  3HSF A;  1YIT I;  2VOO A;  2B9S A;  2KIQ A;  5HVQ C;  1WI9 A;  3CP2 A;  2BXY A;  1K6Y A;  2R4G A;  1WPK A;  2LBF B;  4BH9 A;  2BHY A;  4HX4 A;  4AU7 A;  5CLS A;  1FP1 D;  2WY8 Q;  3DEW A;  5M5W J;  3KYL A;  2HQ5 A;  4A3D J;  2X6X A;  1P2F A;  1U8B A;  2M45 A;  1X19 A;  4QPQ A;  3EYI A;  3J7Y J;  3KP6 A;  1W36 D;  3ZMU A;  1BA5 A;  2HS5 A;  4B8X A;  1QU3 A;  1Z0X A;  5DD8 A;  2Y75 A;  3SZP A;  1XSV A;  4ZZD A;  4L0Y B;  3CDL A;  4II3 A;  2A3S A;  2RAE A;  3C7J A;  3E6B A;  3GFJ A;  3ABT A;  4C2T A;  1ODD A;  2P4W A;  3F8B A;  2CV2 A;  4UUV A;  4ZJZ A;  1ETV A;  3ABM H;  4M3F A;  1B72 A;  1S7A A;  2E34 A;  1VQK I;  3BG5 A;  3R0A A;  2HOA A;  5M5X J;  2BYV E;  1ZG1 A;  1RUN A;  3VYR B;  1QZZ A;  4FAS D;  2DMP A; 
#chains in the Genus database with same CATH homology
 4BQA A;  2OQG A;  3TOB A;  4Q4Z F;  1Z7U A;  1CGP A;  1JHF A;  2ZME A;  5FO5 A;  4A0X A;  1I6X A;  3SQN A;  3H3U A;  1TNT A;  1FLI A;  1XCV A;  4F7Z A;  4BYY A;  1QO0 D;  2P5V A;  3BP8 A;  1HKS A;  4Z2Y A;  4LLN A;  1TQP A;  2IA0 A;  1U2W A;  2RN7 A;  1EH7 A;  3O2P E;  2QQ9 A;  5FB2 A;  4NQW A;  2ESN A;  2MLG A;  1F5T A;  1R5G A;  5HLG A;  1RUO A;  5E18 F;  4M74 A;  3Q9S A;  2Q2E A;  3TDU C;  4E70 A;  1J7K A;  4L5I A;  2K27 A;  3QAH A;  4AWX B;  2VXZ A;  3RI4 A;  3DPL C;  4O3M A;  4S04 A;  1I1G A;  3GF2 A;  4IPA A;  5A2Q K;  4S05 A;  5H6Q A;  4EJW A;  2HOE A;  2ZXJ A;  4CIC A;  2FF4 A;  4G7Z F;  4Y13 A;  5D5X B;  4RGR A;  4WK8 F;  6PAX A;  2AS5 F;  4WWC A;  2VON A;  2ISZ A;  3F6O A;  3FMQ A;  3WTW C;  4ZYH A;  2Z3Y A;  2CSO A;  4GYG A;  1Z9C A;  1KA8 A;  3O3K A;  3JSO A;  3TO6 A;  2L02 A;  2BE5 F;  1FX7 A;  3GX4 X;  5ILS A;  1IUY A;  3EET A;  5A2Q Z;  5E17 F;  1TNS A;  1T39 A;  3LAP A;  2XHK A;  3M8E A;  2O03 A;  3FMR A;  3ERE D;  3RPQ A;  4I0A A;  1QPM A;  1O3T A;  1U78 A;  5BPI A;  4K2E A;  2EFO A;  3F8F A;  3ZP5 A;  5KK1 A;  4BHB A;  3S2W A;  2QQA A;  2XIG A;  5H6R A;  2YU3 A;  3C18 A;  2W57 A;  4L9T A;  3G73 A;  4FHT A;  2FRH A;  2R7D A;  3SXY A;  2KIM A;  3O6B B;  2WV0 A;  5ICG A;  2Q8K A;  2G9W A;  3DEU A;  1XMA A;  2CQK A;  4UVA A;  1SD7 A;  1YYV A;  5KVR A;  4LK0 F;  1R7J A;  2QLZ A;  3SFZ A;  2EFQ A;  1K78 B;  2GWR A;  2ACJ A;  1XSD A;  2R7F A;  1FYL A;  1W7P D;  2ESH A;  1J9I A;  3F3X A;  3DKW A;  4MTD A;  1TW3 A;  3FXQ A;  2RVC A;  4TV7 A;  1TBX A;  1W5S A;  4YFK F;  2KRF A;  2DQL A;  2FSW A;  3R4K A;  4IRI A;  5AIQ A;  2Z33 A;  1ZGA A;  3QPH A;  1SFU A;  5JR3 A;  3KZY A;  1ONV A;  2XVC A;  1B9M A;  2P7C B;  1IRF A;  4UXN A;  5CVR A;  3RKW A;  5DV5 A;  5D8L B;  1X3U A;  2EJR A;  3ISP A;  4EVI A;  1CF7 A;  4OIO F;  1P4W A;  4WCG A;  2EA4 A;  3RTR A;  4LMY A;  3R6S A;  1D8J A;  5DDG A;  1L0O C;  2A68 F;  4R1H A;  3EYY A;  3K1P A;  3GFM A;  1RI7 A;  3MZH A;  1Y0U A;  2NNN A;  2O6G E;  3BWG A;  4HLX A;  4LG0 B;  3U1D A;  4A5M A;  2Y48 A;  4OIR F;  3ZN1 A;  2ETH A;  3FF5 A;  3HUG A;  1P4A A;  3PQK A;  1EH8 A;  1KGS A;  1BI0 A;  4IRH A;  1YW7 A;  1QBJ A;  5E1Z B;  4OOI A;  5FD5 A;  1TW2 A;  5CVJ A;  5E1X A;  1XD7 A;  4HQE A;  1R58 A;  2H27 A;  1OMI A;  4UHT A;  3H92 A;  1UB9 A;  3RYP A;  2Z9O A;  2IA2 A;  1IN5 A;  2V6C A;  3WTS C;  1KU9 A;  2DI3 A;  3GZ5 A;  3M9A A;  3ROU A;  4JBA A;  2EFP A;  4KA4 A;  2HEO A;  1K79 A;  1OYW A;  3VOD A;  5LHH A;  5K1Y A;  3F6V A;  1LDK B;  4I2O A;  2K86 A;  1EH6 A;  1MJ9 A;  1ON2 A;  2XKP A;  4O5V A;  5J6X A;  3B02 A;  4WX9 A;  4HX7 A;  1LDJ A;  1T98 A;  1XGO A;  4M6X A;  3V7S A;  1O3Q A;  1UCR A;  1TTY A;  4ENN A;  2KJC A;  1HSJ A;  3CUO A;  5FD6 A;  4HW0 A;  4ON0 A;  2A6H F;  2FNP A;  1MZB A;  4ASN A;  3VOE A;  2E1C A;  4I01 A;  2D2W A;  2W24 A;  1YO5 C;  2OU2 A;  2DPU A;  1KU3 A;  2VBY A;  3GW2 A;  4AD9 A;  4IHT A;  2HR3 A;  2PQ8 A;  2D1V A;  4CDG A;  3ZPL A;  2O61 A;  4KIG A;  2P7V B;  5JVT A;  3JTG A;  5HOO A;  2GAU A;  4U0Y A;  1G3S A;  4I02 A;  3KET A;  1QQI A;  2QVO A;  2PMH A;  3HTS B;  3DF8 A;  3KZZ A;  1Z6R A;  4ZYD A;  3PFI A;  3JAM Z;  3CDH A;  1ZYR F;  1ZGJ A;  2PLY A;  2XRO A;  1F4K A;  3RJP A;  3TO9 A;  4M71 A;  5EEG A;  3I71 A;  1B59 A;  3GLX A;  1E17 A;  3KLN A;  1ZRE A;  4EM0 B;  2G7H A;  3LA7 A;  3ZMT A;  3ULQ B;  3LFK A;  3T5X A;  1IN7 A;  3T8R A;  4IHS A;  2VE8 A;  3WU1 B;  4A2U A;  3PQJ A;  1EV7 A;  1ULY A;  2CWE A;  1KU2 A;  3CTA A;  4DQ2 A;  2O0Y A;  1GXP A;  4D0P A;  3CLO A;  2OZ6 A;  4GXO A;  4H0E A;  2M87 A;  2A61 A;  2JPB A;  3ABU A;  3J80 Z;  3CUQ C;  4HX8 A;  3QRF F;  3MQ0 A;  5HDG A;  1IN6 A;  2YX4 A;  3LA2 A;  2YSR A;  5DYM A;  3CO6 C;  2DPD A;  3FXU A;  4ESJ A;  3KP5 A;  3LWF A;  3NRV A;  3WGH A;  3Q9V A;  4WXD A;  1P92 A;  2E1N A;  4LLL A;  4EGZ A;  3FM3 A;  4ZYG A;  4M6Y A;  5LGT A;  3JTH A;  4XBF A;  3KCC A;  1K6O A;  1KQ0 A;  1F9N A;  2ZKZ A;  3ECO A;  4A6D A;  2GA2 A;  2QQB A;  1FBU A;  1U5T A;  1BJA A;  5JFR A;  2RGV A;  4IVN A;  1TLH B;  3WTX C;  4IF4 A;  1SD4 A;  3BJ6 A;  4LB6 B;  1DPR A;  2H94 A;  5D5V B;  4EJT A;  1QGP A;  4MGR A;  5F6F A;  3V8J A;  2V1D A;  3KP4 A;  5L3F A;  1ZN2 A;  3I4P A;  2FEZ A;  5L3G A;  2LDU A;  4I7H A;  4GCV A;  3F22 A;  4KIF A;  3CO7 C;  2VOP A;  4ESF A;  4EJO A;  5HS8 A;  3GYH X;  1XCB A;  2WWY A;  5K5R A;  2X4H A;  3L9F A;  3BJO A;  5K5O A;  4AVP A;  4AIJ A;  4UNO A;  3K0L A;  2RQP A;  5AIP A;  3ZMZ A;  2ZFW A;  4JQF A;  4AIK A;  3MCZ A;  1YFH A;  2A69 F;  1P6R A;  3N4M A;  4P5O A;  4KN7 X;  3KP7 A;  2O8X A;  2FML A;  1FSE A;  1AWC A;  2OAZ A;  4HZF A;  2FBK A;  3R0J A;  3EDP A;  4GO1 A;  4ENK A;  1HKT A;  4AIH A;  1YTY A;  4RB0 A;  2FBH A;  1GHC A;  2L4M A;  4L9N A;  1J2X A;  4LLG F;  2PBI A;  4LGW A;  3I5U A;  3WTT C;  4KMU X;  4U7D A;  2DLL A;  4MEY F;  1XN7 A;  2DW4 A;  4OIP F;  5LLQ A;  1LEB A;  2X0L A;  2E7W A;  2FNA A;  2PFB A;  1ZRF A;  3CUQ A;  2HQN A;  3U9G A;  1P4X A;  2K4J A;  4YII A;  3V4G A;  2XGX A;  4N9H A;  1JGS A;  1FY7 A;  3IHU A;  3B73 A;  2FE3 A;  3HSR A;  3BJA A;  2PEX A;  1AOY A;  2YR2 A;  4RGU A;  1MDM B;  4OMY A;  1D8K A;  1R36 A;  4UV8 A;  4P55 A;  4PCQ A;  4RGX A;  2JRT A;  2HQR A;  4MHG A;  1WKM A;  2NAZ A;  4L5J A;  1MGT A;  5LRR A;  2ELH A;  5LRS A;  4P9F A;  1KQ8 A;  2XAQ A;  1IN8 A;  2UZK A;  1XMK A;  1J5Y A;  4KNY A;  1W7P A;  4CO8 A;  2VC0 A;  3HHH A;  4L0Z B;  3W6K B;  2EK5 A;  4A5N A;  1XB4 A;  1SFE A;  3GWZ A;  2W25 A;  5LHG A;  1FC3 A;  2A6E F;  1FP2 A;  3K2Z A;  2XAF A;  3JSP A;  3LST A;  2XUB A;  1BI2 A;  4MNU A;  1OYI A;  2CW0 F;  4G6D A;  1PP7 U;  3CJN A;  2MA3 A;  2C6Y A;  3KFW X;  4GYI A;  2HDC A;  3I54 A;  4PGG A;  1OR7 A;  2XAS A;  2P5L C;  1SD6 A;  4L18 B;  4L9J A;  3VEP A;  3K69 A;  3BPX A;  3W6J B;  1LNW A;  2DFI A;  3E3V A;  2HYF A;  4BXU A;  3M8F A;  1TQM A;  3GEZ A;  1LB2 A;  4BNC A;  1Q1H A;  3K9T A;  4UVB A;  4ENJ A;  3IL2 A;  3V7C A;  3GO5 A;  5DCM A;  1O3R A;  2QEN A;  3DV8 A;  2J5O A;  2OZU A;  1IZ1 A;  3WU0 A;  1YLF A;  4HAM A;  4HDU A;  1O7L A;  1G3W A;  2DBB A;  3SZT A;  2MH9 A;  1IRG A;  4L9V A;  1FWZ A;  2R3S A;  2AXL A;  4UVC A;  2FBI A;  3C3W A;  4WXC A;  4QWQ A;  2JT1 A;  5D6F A;  3M1E A;  3KE2 A;  5HDK A;  3MZY A;  1B6A A;  2PG4 A;  1ZH5 A;  1YW8 A;  3E5Q A;  4QLC U;  3RPU A;  1STZ A;  3HOS A;  4XRF A;  1UHM A;  1RZ4 A;  1WSU A;  1WRJ A;  4M73 A;  1ZRC A;  3NQO A;  1HW2 A;  2K4B A;  5CVI A;  2NNY A;  2WTE A;  2XRN A;  2BBY A;  4HQM A;  3T8T A;  2ZO4 A;  3P9C A;  3MEX A;  4ZZL A;  1XGS A;  2XAJ A;  1LJ9 A;  4ZH4 F;  5LGN A;  5L3D A;  3HRM A;  4KYW A;  3ZMD A;  3FWE A;  3QP5 A;  4NB5 A;  2V1X A;  1BC7 C;  2V9V A;  4Q47 A;  3IRR A;  4RB1 A;  1LDD A;  3H3Z A;  4MEX F;  3V7R A;  1IXS B;  3E5U A;  1LEA A;  1W4M A;  4BHP A;  3KEQ A;  3R60 A;  2BGC A;  1MJB A;  1FSH A;  1DDN A;  2M30 A;  4A0Y A;  1U5T C;  3I64 A;  2XV4 S;  3C1D A;  4XSX F;  2ISY A;  4I0B A;  3BZ6 A;  5FLX Z;  4O6J A;  4KN4 X;  3HYI A;  2V1U A;  3WG9 A;  3IWZ A;  1I27 A;  2YX7 A;  3JAM K;  3I53 A;  5BMZ A;  2M1B A;  4FT8 A;  2F5E A;  1ZG5 A;  3RDI A;  3D5L A;  4HOB A;  2L01 A;  1UHW A;  2ZME B;  4OIN F;  3HRT A;  1HST A;  1Z91 A;  2XAG A;  3BY6 A;  1E2X A;  4KT5 C;  1FNN A;  1H9G A;  1R5H A;  3RKY A;  5J8C A;  3TOA A;  4KFC A;  5DCF A;  4IJA A;  4FX0 A;  2XKO A;  2HYG D;  5FFZ A;  3L00 A;  3F21 A;  2ZNZ A;  2H09 A;  2VBW A;  4G7H F;  1XGN A;  2GQQ A;  4U0W A;  1IXC A;  3TQN A;  5LHI A;  1USS A;  1FBQ A;  5D5W B;  1B1B A;  5EEH A;  1W5T A;  5HDN A;  3J80 K;  1K7A A;  2L54 A;  4HV5 A;  3L7W A;  3CUQ B;  1I5Z A;  1BOA A;  5LBQ A;  3E5X A;  1MKM A;  4LJZ F;  2JSC A;  1FYK A;  5TRD A;  3IWF A;  3J7A O;  1MJA A;  3FMS A;  2ADU A;  3OV8 A;  5LEK A;  5ICF A;  3REO A;  4Q48 A;  5E8G A;  1OYY A;  1R1V A;  2K7L A;  3LQQ A;  4DNC A;  3K1N A;  2DO7 A;  2IPQ X;  1T6S A;  1S6L A;  2EWN A;  2Q0O A;  2L4A A;  1BC8 C;  4FX4 A;  2COM A;  3BRO A;  4HF1 A;  2G7U A;  1YG2 A;  1XGM A;  2ZBK A;  4WXH A;  4HYE A;  4EJV A;  4ENM A;  4PZJ A;  1SFX A;  5IT3 A;  4RB2 C;  3LQR A;  1C0W A;  4MQ9 F;  1JHH A;  3KP2 A;  3P9I A;  3DPT A;  2DK5 A;  1YQA A;  4RAY A;  4Q5S F;  3U2R A;  2P5K A;  3WOD F;  5DUI A;  2VOD A;  1HBX G;  2HGC A;  2A07 F;  4I98 B;  3TDZ C;  1D5V A;  2K02 A;  4YFX F;  4OMZ A;  4KIC A;  5AON A;  5D8K B;  5LGU A;  2FMY A;  2ZNY A;  2VBX A;  5DUK A;  3HRS A;  2F5C A;  4MQV A;  4KUM A;  3WTU C;  4Y17 A;  2M8E A;  4PDK A;  2VN2 A;  4RB3 C;  4KDP A;  2IT0 A;  3JW4 A;  2EFW A;  3I59 A;  1TQI A;  4LFU A;  1FYM A;  1O7F A;  3DXJ F;  3BOQ A;  4LK1 F;  4ZYE A;  5E1W A;  4P96 A;  1G4D A;  4LB5 A;  1XDU A;  3L2C A;  4M72 A;  2MLK A;  2IP2 A;  2HKO A;  3IKV A;  2MBF A;  2DAO A;  1BI3 A;  2QBY A;  5FFX A;  3GFL A;  5CJ9 A;  5F1R A;  1V3F A;  4JK1 X;  1T38 A;  4HV6 A;  2BEO A;  5ICC A;  5DCM B;  4XSZ F;  4G6Q A;  1ON1 A;  4U7B A;  2GXB A;  4B09 A;  1HW1 A;  4EM2 A;  3TGN A;  3QU3 A;  1BI1 A;  2H6C A;  3FHZ A;  2FOK A;  4LD5 A;  3I0T A;  1XDS A;  2OA4 A;  1CF7 B;  1SMY F;  5BQT A;  4EGY A;  2IA1 A;  2DK8 A;  5DEQ A;  2D45 A;  5J8F A;  1FPQ A;  2TDX A;  5IT9 K;  4HLY A;  2PI0 A;  1G3T A;  2IVM A;  3DQV C;  4HF0 A;  2JPC A;  3IRQ A;  1JE8 A;  3F8N A;  2KIU A;  3GUD A;  5BOX A;  1R1U A;  2MD5 A;  1HXD A;  2WC2 A;  4RS8 A;  4PGH A;  1HKQ A;  4M9Z A;  2UWM A;  3WTV C;  3P9K A;  2GZW A;  5IT9 Z;  5DD4 A;  4M9S A;  2P8T A;  1R1T A;  4HF2 A;  2ZJ2 A;  4U88 A;  5CVU A;  3R61 A;  1QZY A;  4BHC A;  1O57 A;  1ZLJ A;  1O3S A;  1IF1 A;  3FZV A;  2XAH A;  1T2K A;  1ZHF A;  2UXX A;  3WE2 A;  4EV0 A;  2QYO A;  4YIF A;  2VC1 A;  3TKY A;  2HFH A;  5HS7 A;  1QNT A;  2V79 A;  1A04 A;  3D0S A;  3J81 K;  4KIB A;  1ZAR A;  3KEO A;  3Q5F A;  3IKT A;  1DPU A;  4A0Z A;  1S8N A;  3AAF A;  2VE9 A;  2EV0 A;  3KLO A;  2NRA C;  2KKO A;  2JTV A;  1R23 A;  1PP8 F;  1DUX C;  4BAY A;  1OPC A;  4RAZ A;  1YW9 A;  2IW5 A;  2STW A;  2RV8 A;  3J81 Z;  3M7G A;  1Z05 A;  1KYW A;  1ZLK A;  2MH2 A;  1G3Y A;  1FT9 A;  3RKX A;  1SMT A;  5CYV A;  2QZ8 A;  4CXF A;  1J0R A;  2P6S A;  3T0Y A;  1FBS A;  5JI6 A;  5ERI A;  2HZT A;  1I1S A;  3FXR A;  2LKP A;  3EQL F;  1BIA A;  1S7O A;  2LSO A;  2QWW A;  3F72 A;  1G6N A;  4ETS A;  2B0L A;  2RDP A;  3V8L A;  1OKR A;  4G9Y A;  5CVV A;  4HA8 A;  4M9X A;  4A6E A;  1S29 A;  3I58 A;  2YPR A;  3E6M A;  2IJL A;  1YIO A;  2FQ3 A;  3WTY C;  1FOK A;  1GVJ A;  2RKH A;  1H0M A;  2FA5 A;  1DP7 P;  3RYR A;  4MTE A;  2IRF G;  4XLP F;  2EA2 A;  2E7X A;  2GXG A;  5BS6 A;  4UV9 A;  1ZAO A;  3HOT A;  2CG4 A;  4G94 A;  3WE3 A;  2HWV A;  4R8H A;  4G7O F;  2NYX A;  3GZ6 A;  3E6D A;  1GXQ A;  3OOP A;  1IAW A;  2KJB A;  1ZRD A;  2LF7 A;  3P7N A;  1IN4 A;  2J5P A;  5ILV A;  1VTN C;  2STT A;  3ELK A;  3LA3 A;  1MD0 A;  4R79 A;  3QOP A;  3QU6 A;  3DFG A;  3GFI A;  1U3E M;  1SD5 A;  5HS9 A;  3NEU A;  1V4R A;  5H20 A;  3BPV A;  1H9T A;  4A12 A;  2MC3 A;  2Z5U A;  5D4R A;  5ED4 A;  1UFM A;  2CYY A;  1YS6 A;  2F5D A;  3HRU A;  1U5T B;  1FZP B;  1ZG3 A;  3E97 A;  2Y0M A;  4YFN F;  3LAJ A;  5FLX K;  1MDM A;  2P6T A;  3EUH A;  3WGG A;  1J59 A;  4EJU A;  1HW5 A;  1U6G A;  3VFZ A;  4N0B A;  2A5Y B;  4XLN F;  3ECH A;  1IW7 F;  2VBZ A;  2HTS A;  3QP6 A;  1KYZ A;  3WTZ A;  1YS7 A;  3ZQ7 A;  2L3D A;  4HDV A;  1S3J A;  1JXS A;  1KU7 A;  3I59 B;  1RNL A;  3L09 A;  1BIB A;  3F8M A;  4OU0 A;  2GIV A;  2FU4 A;  1PDN C;  4N9I A;  1F1Z A;  4IRG A;  4WF2 A;  2PN6 A;  3DP7 A;  3F23 A;  2DT5 A;  2Z99 A;  1Z1D A;  4EM1 A;  2ZCW A;  2F5F A;  2QBY B;  3VB2 A;  5D5U B;  1WQ2 A;  2UXN A;  2VT2 A;  2DU9 A;  2EV5 A;  4IXA A;  2LNB A;  4CGZ A;  2FXA A;  4ESB A;  5L3C A;  1BN5 A;  1SAX A;  3BDD A;  3MFK A;  2BV6 A;  3HSE A;  3HHG A;  2QUF A;  2PMU A;  1REP C;  5FGM A;  1K78 A;  4OIQ F;  4YG2 F;  1PUE E;  3ZMV A;  1BM9 A;  2PJP A;  2QM3 A;  3HTU A;  1LQ1 A;  2D1H A;  1R00 A;  5D4S A;  3ZN0 A;  2VT3 A;  4EMS A;  3COA C;  3ZMS A;  1R22 A;  1B9N A;  1IXR C;  2JZY A;  4GGG A;  5L3B A;  1KQ9 A;  3N97 A;  1WWX A;  2EFN A;  1D3Y A;  1BBY A;  2LF8 A;  2M5W A;  3G3Z A;  2OQR A;  3F8C A;  2CFX A;  5BPD A;  3KP3 A;  3QPT A;  2DQR A;  5L3E A;  3HIF A;  5HLH A;  1RIO H;  2RC4 A;  2HTJ A;  4HBL A;  4P9U A;  2CGP A;  2W85 A;  2W84 A;  2EV6 A;  2RNJ A;  5E20 A;  5HLI A;  4CYD A;  4G8X A;  4EQQ A;  1UST A;  2OD5 A;  5D6E A;  1L3L A;  4CHU A;  1XSX A;  2O3F A;  2GA1 A;  4LG0 A;  3K1M A;  3MAJ A;  4Y15 A;  2OBP A;  4NHJ A;  2H6B A;  1Z6T A;  5E8I A;  5ILU A;  1W7P B;  2NS0 A;  4RGS A;  4KMF A;  1HQC A;  3IC7 A;  5K5Q A;  3TO7 A;  5TJJ A;  5F64 A;  5JHU A;  5ICE A;  2CO5 A;  2F2E A;  1LVA A;  3MWM A;  1T0F A;  3WGI A;  3FM5 A;  3E6C C;  5LEJ A;  3FX3 A;  1B4A A;  2EB7 A;  2HKX A;  3SHF A;  1J75 A;  2KIF A;  1NHA A;  4I09 A;  3V8K A;  3T1B A;  4U0V A;  4CZZ A;  1U8R A;  3ML6 A;  3RIR A;  2DTR A;  3GXO A;  3HSF A;  3GVA A;  2VOO A;  5HVQ C;  1WI9 A;  4BH9 A;  4HX4 A;  5CLS A;  1FP1 D;  1P2F A;  2M45 A;  3EYI A;  3KP6 A;  3ZMU A;  2HS5 A;  4B8X A;  5DD8 A;  2Y75 A;  3SZP A;  1XSV A;  4ZZD A;  4L0Y B;  2A3S A;  3C7J A;  3E6B A;  3GFJ A;  3ABT A;  1ODD A;  2P4W A;  3F8B A;  4UUV A;  1S7A A;  3R0A A;  2BYV E;  1ZG1 A;  1RUN A;  1QZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...