3BJ6A

Crystal structure of marr family transcription regulator sp03579
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
SNAMTHETDQLYQAVQATRPLLRNITAAVERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEMAKLALFSEGFSSVELTAYHKVQLALTRFFADLAKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MarR family Transcription Regulator SP03579.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
total genus 51
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bj6A00
3WODF 5BQTA 1R1TA 1YQAA 4EJVA 4EGYA 1ODDA 4UHTA 4IRIA 3I54A 3MEXA 2UXXA 2UZKA 5HOOA 2XHKA 1Z05A 2W24A 2LSOA 1T39A 2Q0OA 3KE2A 4Y13A 5TJJA 3C3WA 4LK0F 1KQ8A 5LHGA 1HXDA 4O3MA 2FXAA 2NRAC 3WTTC 5J8CA 2MLGA 3QRFF 3HRUA 2FF4A 1W5TA 2MD5A 3M9AA 4MGRA 4EQQA 1LB2A 1R36A 2FSWA 1BI3A 5DCMA 2FA5A 2HQNA 3T5XA 1W4MA 2O61A 4L18B 4GYIA 2EFPA 5H20A 3M1EA 3HTSB 3ERED 4PDKA 1P2FA 1KYWA 4UXNA 5D4RA 3L9FA 3ZMZA 3JW4A 1UCRA 5E8GA 3BPXA 1R1UA 2YSRA 4B09A 2OQRA 5EEGA 1TNTA 4ENJA 2WTEA 3F8CA 4YG2F 3RPUA 2Y0MA 1YFHA 3CDHA 2CYYA 4M9SA 1U6GA 2DFIA 1O7FA 5IT3A 2UWMA 3BJ6A 4L9TA 4RB3C 3FXUA 2E7XA 4N9IA 2PJPA 3DQVC 4BAYA 3E5XA 3FM3A 1TLHB 1MDMB 2FNPA 3NQOA 3N4MA 2YX7A 1Z1DA 4Y15A 2A6HF 4K2EA 2HKOA 3V8KA 4BQAA 1IAWA 3MWMA 1T6SA 5F1RA 3E5UA 1OYIA 4UVCA 1SD4A 3QPHA 3J81K 5K1YA 1TQMA 3HYIA 1O3QA 2X4HA 2ESNA 3U9GA 2LF7A 1QZZA 5AIPA 3ECOA 4Q4ZF 3IL2A 2W84A 3C18A 4NQWA 1CGPA 5BS6A 4M9ZA 1GVJA 5FB2A 2LNBA 5ED4A 5H6RA 1JHHA 3V7RA 2JSCA 2XAQA 1TTYA 1BC7C 2OBPA 5HLGA 1D8JA 3FXRA 1R7JA 3K0LA 4HV6A 3RKYA 3WGGA 4LG0A 1HW2A 3KLOA 1IRGA 4L5JA 3GZ5A 4P9FA 3TOBA 1K7AA 3P7NA 2IPQX 3K2ZA 2D1VA 2XAJA 4A5NA 1R5HA 4L9JA 4F7ZA 5D6FA 4AVPA 2VE9A 1SFEA 2P6SA 1BI1A 2CO5A 2Z33A 1ZREA 2CW0F 3DV8A 5K5OA 4UNOA 2KRFA 4AIKA 5IT9Z 1H0MA 5FO5A 1CF7B 2GXBA 4IHSA 3GFJA 4WWCA 3ZPLA 2JPCA 4KN4X 2ZFWA 3TO9A 2RGVA 3LA7A 2MC3A 1F9NA 3CUQC 5ILSA 4RGRA 3E6BA 5EEHA 2JTVA 2ZMEB 1P6RA 3I71A 1FSEA 5E20A 3IKTA 2EA2A 1R22A 3GO5A 3B73A 5F64A 5D5VB 1BIAA 3ZN1A 4FHTA 3H3ZA 2JPBA 4BHPA 4KYWA 2MBFA 1XCVA 3BPVA 4Q5SF 3ABUA 3CO6C 1QO0D 3I59A 1FX7A 3NRVA 2XRNA 1IZ1A 3I59B 3RYPA 1F5TA 2V9VA 5FD5A 4IVNA 2NYXA 1S29A 4GO1A 3KP5A 1UB9A 3FZVA 1KU3A 2FOKA 1XGNA 3O6BB 2M87A 1Z91A 4MHGA 4CICA 2ELHA 1YIOA 2Z99A 2ADUA 2P7VB 5DD4A 4MEYF 4OIOF 3S2WA 1FNNA 3B02A 1LDJA 4CYDA 4WF2A 3MZYA 4P9UA 2EK5A 1J2XA 1XSDA 5E1XA 1MD0A 1IN5A 1PUEE 3GX4X 2GXGA 3MCZA 4LLLA 2LDUA 2XKPA 4BYYA 5CVVA 1S8NA 2FBIA 4ZH4F 4IJAA 2OA4A 5E8IA 2KIFA 2HYGD 1BM9A 4KUMA 2ETHA 2OZ6A 1ZG3A 1REPC 4JBAA 2F5DA 4AIHA 3GVAA 3ZMUA 4G6DA 4OIPF 1KU2A 1MJAA 4KIFA 5DD8A 1U8RA 3D5LA 2PI0A 1B1BA 3IHUA 1KQ9A 5D4SA 2GA1A 2HWVA 4BHBA 1XDUA 3ZN0A 1XD7A 2FMLA 2M1BA 3E97A 2NAZA 2TDXA 3ZMDA 4A6DA 3K1PA 1TQIA 3V8JA 4CDGA 2VBWA 1ZHFA 1LNWA 2DTRA 3ABTA 2K7LA 4RGSA 4KT5C 2O8XA 1XCBA 4M72A 1ULYA 1J75A 4OMYA 4LK1F 2V1XA 5LBQA 5HS7A 4PGGA 3PQJA 2GZWA 2PMUA 3T8RA 4HA8A 1TNSA 2E1CA 3SXYA 1F1ZA 4EM2A 2ZCWA 5DUKA 4RB0A 2P4WA 2VBXA 3CUQA 4ZYEA 4AIJA 5JR3A 1OMIA 1T0FA 2D2WA 2L02A 2R7DA 1BBYA 1XB4A 1E17A 1HW1A 1U78A 2HDCA 4LB6B 4O6JA 3GFMA 3E6CC 1DPRA 3WTVC 4PZJA 4HW0A 4WXCA 4M6XA 1LDDA 4U7BA 1ZRCA 2GWRA 4G7OF 4KICA 3WGIA 2BE5F 2PLYA 2AS5F 3HUGA 4LFUA 1BIBA 3RJPA 2BYVE 3GYHX 3WU0A 1E2XA 4HX8A 1I1SA 3BWGA 4UV9A 1XDSA 4HX4A 4ZYDA 5HLIA 2H27A 2ZO4A 3H3UA 3HTUA 1IUYA 5E18F 1FT9A 1OYYA 4KIBA 5FLXZ 1IW7F 1ZG5A 2K27A 1S3JA 1HKQA 2BEOA 2G7UA 1EH6A 4I02A 1HKTA 3WU1B 2FQ3A 3PFIA 3LFKA 1ZGAA 4G7HF 1K79A 4A2UA 2RV8A 3E6DA 2LF8A 3GFLA 2COMA 3TQNA 3WE3A 2IA0A 2YU3A 2GIVA 4ENNA 2A3SA 3GFIA 3HOSA 3GZ6A 1LJ9A 3F72A 1ZAOA 4RAZA 1SD7A 2VONA 3JSOA 3VOEA 4OMZA 2EV5A 2K86A 3MAJA 3F8FA 1STZA 3DFGA 2LKPA 1ON1A 4WX9A 2HGCA 4KMUX 3FMQA 2VBZA 2QZ8A 5FD6A 1QNTA 1O3RA 4CO8A 2PBIA 3GXOA 2YX4A 1B6AA 4KNYA 4MQ9F 2K4BA 1RZ4A 5FLXK 1LVAA 4GYGA 3CO7C 2HS5A 2IT0A 1U3EM 4IXAA 4XLNF 5L3FA 3KP3A 5D5WB 3WTSC 4NB5A 1PP8F 1JXSA 3E3VA 5L3EA 1GXQA 4UVBA 1HSJA 3KZZA 3P9KA 1B9NA 3DPLC 3HHHA 2DO7A 2ISYA 3F6VA 3QOPA 1QGPA 2FEZA 1ZN2A 2F5CA 3C7JA 3HSEA 5DDGA 2IVMA 4AWXB 4A0YA 1T98A 1HQCA 4M6YA 1G3SA 1W7PB 2NS0A 4IF4A 3HHGA 2VODA 1S7AA 4KFCA 3EYIA 1WI9A 4GCVA 2FNAA 1O57A 2F2EA 3F23A 3O3KA 3H92A 2FBHA 1W5SA 2J5OA 3DPTA 2BGCA 4PCQA 4EM1A 4MTDA 3CUOA 1SD6A 4D0PA 3COAC 1G4DA 1HSTA 3M8FA 2HTSA 5E17F 3CLOA 2A5YB 3ZMVA 2PFBA 2XAHA 1USTA 3LAPA 1Y0UA 1YW8A 4M74A 3BZ6A 1KU9A 1Z9CA 5ERIA 2NNNA 5ICGA 3QPTA 1H9TA 5CVRA 4KA4A 2KIMA 2Z3YA 4G7ZF 1T38A 4S04A 1MJBA 1OYWA 2GA2A 4HDVA 2JRTA 4XBFA 3J80K 1FY7A 4R1HA 2XUBA 4YIIA 1ZLKA 3JTGA 2KKOA 3BDDA 1P4XA 1ONVA 1RNLA 2XASA 5L3DA 5DV5A 3R61A 5BPIA 5TRDA 3E6MA 5DEQA 4OOIA 3V4GA 1DDNA 1AOYA 5L3CA 2A69F 3ISPA 2C6YA 2DK8A 3GF2A 2QQ9A 1SAXA 4RAYA 1D3YA 1W7PA 5J8FA 3R0JA 1KQ0A 1ON2A 1SMYF 1HW5A 5CLSA 3J7AO 4LJZF 2PN6A 5L3GA 3HRMA 1K78B 1YLFA 2GQQA 1SD5A 1XSXA 1TBXA 3MZHA 1ZRDA 4BXUA 4L0YB 3BY6A 6PAXA 5LRRA 1C0WA 2G9WA 4EMSA 1I1GA 2JT1A 4RGXA 3VFZA 5D6EA 2L4MA 2RVCA 2ZNYA 1OR7A 2DK5A 1J59A 4MEXF 1ZH5A 4OINF 2HR3A 2DI3A 5FFXA 4M9XA 3RYRA 2P5VA 4HX7A 2HOEA 2K02A 3LA2A 3QP6A 4RGUA 3FMSA 5KVRA 4A12A 1JGSA 3J81Z 4EJOA 2PQ8A 2QBYA 4LLNA 1ZLJA 2EFOA 5ICEA 4JQFA 1IRFA 3K1NA 1U5TA 3LWFA 1MJ9A 2IW5A 3F8MA 3U1DA 4XLPF 2FMYA 1SMTA 4ZYHA 2IA2A 2VBYA 5LRSA 4P96A 5HS8A 5IT9K 5HVQC 5JHUA 4L9VA 2IP2A 5JI6A 2W85A 4RB1A 3E5QA 3GWZA 4LGWA 1PDNC 5DCFA 4M71A 5H6QA 1FLIA 3QAHA 2O0YA 2QYOA 3T1BA 3ZQ7A 5BPDA 3HSRA 5K5RA 2RQPA 2VE8A 1WQ2A 3R6SA 3FXQA 4UVAA 3MFKA 1G3TA 3P9CA 1YO5C 5A2QK 3MQ0A 4ZYGA 2QUFA 3V8LA 3TGNA 1D5VA 4EVIA 3O2PE 2ZBKA 2PMHA 1W7PD 2KJCA 4FT8A 3M8EA 2UXNA 2AXLA 3L09A 2H6CA 5A2QZ 3F21A 3GEZA 2B0LA 3OV8A 1K6OA 1FZPB 4HF0A 2FBKA 1EV7A 2ACJA 1UHWA 1FSHA 4KN7X 3N97A 4QWQA 4OIQF 1I27A 2MH9A 1J7KA 2RNJA 1ZG1A 2EFWA 1RUOA 1KU7A 3Q5FA 5ICCA 4B8XA 2XGXA 4PGHA 2MLKA 2XV4S 2L4AA 3KFWX 3CUQB 1BI2A 2HEOA 1TW2A 5JVTA 2X0LA 1XGMA 3RPQA 1Q1HA 4N9HA 2IA1A 1H9GA 5CJ9A 4EGZA 3CJNA 4I98B 3TO7A 1LDKB 4LD5A 1GXPA 1LQ1A 4IPAA 2QENA 1MZBA 4N0BA 3KCCA 2K4JA 2DPUA 2J5PA 2EB7A 2Z9OA 2EV6A 2E1NA 2HTJA 1HKSA 4R8HA 4IRGA 2VC1A 4Y17A 3BROA 2M8EA 1YG2A 1DUXC 2RKHA 2GAUA 4BHCA 1OPCA 2QM3A 2D45A 1UFMA 3BOQA 1RI7A 4DQ2A 4LMYA 4UV8A 4G6QA 1V3FA 4P5OA 4IHTA 2QQAA 3WGHA 3EYYA 1LEAA 2OAZA 1R58A 4U7DA 4ESFA 1QZYA 2PEXA 3IWFA 2XROA 3F22A 4Z2YA 3IKVA 2V79A 2RN7A 4BH9A 4I7HA 4G94A 1R23A 2STTA 3C1DA 4HZFA 2V1UA 3IWZA 1O3TA 2A6EF 5HLHA 2ZJ2A 1QBJA 4G8XA 2R3SA 2DAOA 1Z6TA 3WE2A 3I64A 2ZMEA 2W57A 2M45A 1JHFA 4U0WA 4YFXF 3RI4A 1ZGJA 3Q9VA 3RKXA 1L0OC 1S6LA 4BNCA 3GUDA 1I5ZA 3SFZA 4MQVA 1RIOH 1U5TB 3IRQA 3KEOA 4DNCA 3DF8A 5LGTA 5E1WA 2ZKZA 3NEUA 2DW4A 1F4KA 2DLLA 3WTYC 1XSVA 3WTZA 4TV7A 2EWNA 4IRHA 1FWZA 4YFNF 1FOKA 1ZARA 2QLZA 3ROUA 3KLNA 2Q8KA 2L54A 1YS7A 5DYMA 4ZZDA 1MKMA 2HYFA 3ULQB 4LLGF 1KA8A 1FBUA 3DP7A 1FP2A 3WTWC 4WXHA 4XSXF 2VT3A 4UUVA 2P6TA 4CZZA 1IXRC 4L5IA 1TW3A 4XRFA 2BV6A 1U2WA 1V4RA 1YW7A 3W6KB 2D1HA 1BN5A 1FPQA 4FX4A 3RTRA 3TKYA 3AAFA 2V6CA 4LB5A 1R00A 3QU3A 5ILUA 4Q47A 4HF1A 4YIFA 4WCGA 4MNUA 2XAGA 4QLCU 3KP2A 3K9TA 3KP4A 1U5TC 3WTUC 4S05A 3IC7A 2HZTA 2ZNZA 5LHIA 3PQKA 3RIRA 1YYVA 3LQQA 2P8TA 2L01A 2YR2A 3HRTA 4HDUA 2DPDA 4HLYA 3ELKA 3ZMTA 5JFRA 1FP1D 1JE8A 2Y48A 1USSA 1XGOA 2DBBA 4P55A 4ZZLA 5K5QA 4ENMA 3Q9SA 3I0TA 1ZYRF 5BOXA 1YW9A 1S7OA 5L3BA 1UHMA 4FX0A 5D8LB 2ZXJA 2WWYA 2QBYB 1ZRFA 1VTNC 4WK8F 1T2KA 2MH2A 3WTXC 1DP7P 1IF1A 3FWEA 1IN7A 1XMKA 4OU0A 3KP6A 1WSUA 2EFQA 3VEPA 3EUHA 4A0XA 4RS8A 1NHAA 5D5UB 3REOA 1P92A 4CHUA 3ML6A 5HDKA 2PG4A 5AIQA 2O3FA 3VB2A 5CVUA 2QWWA 3DKWA 1RUNA 4ESJA 4HBLA 1GHCA 5KK1A 2VOPA 3GW2A 1FBSA 1XMAA 2XAFA 4ON0A 4RB2C 2HQRA 4U0YA 4LG0B 1G6NA 3KEQA 3L2CA 3IRRA 2M5WA 4A0ZA 1AWCA 2CFXA 2ISZA 2A61A 3J80Z 1I6XA 4ENKA 3K69A 3HRSA 3BJOA 1IXCA 2FRHA 5FGMA 3JAMK 2OD5A 2HFHA 3JTHA 2CSOA 1P4WA 3SQNA 2A07F 2DQLA 1R5GA 4L0ZB 4HAMA 1FYKA 2BBYA 3V7SA 1FYMA 1G3WA 3JAMZ 1B59A 1XN7A 4YFKF 3DXJF 3EETA 4HQMA 3HIFA 3K1MA 2FU4A 3G73A 1XGSA 2P7CB 3T0YA 2QVOA 4GXOA 2CWEA 4Q48A 2VC0A 4R79A 3F8BA 3QU6A 4EM0B 2L3DA 2H94A 2HKXA 1DPUA 1YS6A 2DQRA 3LQRA 2V1DA 2VT2A 2Z5UA 3V7CA 4HF2A 4L9NA 5D8KB 4M73A 1SFXA 1BOAA 3EDPA 1WRJA 1R1VA 3F3XA 1O3SA 1MGTA 3SHFA 3LA3A 1K78A 1J9IA 1OKRA 1BC8C 4OIRF 1QPMA 5F6FA 3TDZC 5LEJA 2DT5A 3HOTA 4HQEA 2VXZA 4I09A 2YPRA 2M30A 2OZUA 4A6EA 1J5YA 2P5KA 3BP8A 4MTEA 1A04A 1LEBA 1P4AA 5D5XB 2O03A 2E7WA 5ILVA 4KMFA 4HV5A 3KZYA 5DCMB 3HSFA 1Z7UA 5J6XA 3CTAA 1KYZA 4I2OA 4EJTA 3W6JB 2FE3A 2CGPA 2CQKA 3DEUA 1SFUA 1Z6RA 2STWA 2IRFG 2VN2A 3TOAA 3VODA 3I58A 3I4PA 4HOBA 2W25A 2NNYA 2P5LC 2ESHA 3FHZA 1HBXG 1IN6A 4ASNA 1IN4A 3I5UA 1YTYA 4CGZA 2JZYA 1CF7A 4EV0A 3KP7A 2EJRA 1BJAA 4U0VA 1X3UA 2EA4A 1KGSA 5HDGA 4I0AA 3TDUC 1BI0A 2OQGA 4NHJA 1B9MA 3SZTA 1EH8A 5LGNA 3FF5A 3M7GA 5LGUA 2RDPA 2DU9A 4KDPA 4KIGA 4ETSA 4EJWA 1WWXA 3R60A 2EV0A 3D0SA 3FM5A 4XSZF 2H09A 2XKOA 3WG9A 5HDNA 2XVCA 2Y75A 3BJAA 4I0BA 2CG4A 3R0AA 2F5EA 2Q2EA 5BMZA 1IXSB 3KETA 1EH7A 4G9YA 1IN8A 1G3YA 1QQIA 5FFZA 3R4KA 2QQBA 4WXDA 1WKMA 2KJBA 3ZMSA 4EJUA 5LHHA 4A5MA 1FC3A 3RDIA 2MA3A 5CVJA 5CYVA 5AONA 2RC4A 2A68F 3QP5A 2F5FA 4E70A 4AD9A 3OOPA 4ESBA 1O7LA 2WC2A 2KIUA 4O5VA 5ICFA 5LLQA 3ECHA 4GGGA 4CXFA 5LEKA 2H6BA 1D8KA 1PP7U 3JSPA 3GLXA 5HS9A 1FYLA 3I53A 3FMRA 2VOOA 3P9IA 3TO6A 3T8TA 5E1ZB 1TQPA 3EQLF 4HLXA 3ZP5A 3G3ZA 2OU2A 2EFNA 3RKWA 2R7FA 1B4AA 4U88A 2WV0A 3LSTA 3F6OA 3LAJA 5CVIA 4JK1X 1J0RA 3SZPA 2IJLA 3L7WA 5DUIA 1L3LA 4HYEA 2O6GE 3FX3A 3U2RA 4I01A 4H0EA 3F8NA 2G7HA 1MDMA 3L00A 2XIGA 1FBQA
chains in the Genus database with same CATH superfamily
3WODF 5BQTA 3G1MA 3PUBA 1R1TA 1YQAA 4EJVA 1YX3A 3U21A 3C2HA 1XC5A 4EGYA 1ODDA 4UHTA 4IRIA 3I54A 3MEXA 2UXXA 5E79C 2UZKA 5HOOA 2XHKA 1Z05A 2W24A 2LSOA 1T39A 1Y1VJ 2Q0OA 3KE2A 4Y13A 3ABLH 4IX7A 3NWTA 3VPRA 1S72I 2ZXHA 5TJJA 3ABMH 3KZIC 3DU5A 3K4JA 1YJ9I 1ETWA 3C3WA 2JK3A 4LK0F 1KQ8A 5LHGA 5EEAA 1HXDA 4O3MA 2FXAA 3ESWB 3OYLA 2NRAC 5F27A 3WTTC 4E7KA 5J8CA 2MLGA 3QRFF 2B7EA 3HJEA 3HRUA 2KMUA 4M3GA 2FF4A 3O8HA 2ECBA 3M8JA 1W5TA 2V9PA 3QQAA 2MD5A 3M9AA 3G2BA 4MGRA 4EQQA 1LB2A 3H9GA 1U8BA 1R36A 2FSWA 1BI3A 5DCMA 2FA5A 1UELB 2HQNA 3T5XA 3VSLA 4BJ5C 2NXNB 2BW3B 4ZDLA 2QF7A 1W4MA 1WJEA 2M34A 2HXIA 2JMWA 5IYBJ 4A3GJ 2O61A 2BXYA 4L18B 1V5GA 4GYIA 2EFPA 5H20A 4II3A 3KEYA 3M1EA 3K10A 1OR7C 3HTSB 3ERED 4PDKA 1XPXA 1P2FA 2E2IJ 1KYWA 1X1PA 2VKDA 3CC4I 4UXNA 3IP4B 3QPLA 5D4RA 3L9FA 3ZMZA 1I50J 3JW4A 1UCRA 5E8GA 3BPXA 3GTGJ 1R1UA 1BL0A 4UB8C 1SFKA 2FUG2 2YSRA 3FIWA 2G0EA 2VKVA 1ETOA 2XB0X 2N8GA 1JGGA 3RSNA 2BZTA 2FD5A 4B09A 1R6RA 2OQRA 5EEGA 2M4KA 3SYTA 1TNTA 1Z0XA 3SEQA 3ZR8X 2WTEA 3F8CA 5M3MJ 4ENJA 1ZR4A 1H88C 4YG2F 1F43A 5KCMA 2AXTC 2VQCA 2W4SA 2XF5A 3RPUA 2Y0MA 1YFHA 3CDHA 2CH0A 2L2OA 5M5XJ 2CYYA 4M9SA 3CJTB 1MNEA 1U6GA 2DFIA 1O7FA 2EQRA 5IT3A 2UWMA 3BJ6A 3H35A 5IYCJ 2EINH 2HI3A 4L9TA 4RB3C 3FXUA 1ZKGA 1WJ5A 2ZJQF 1D5YA 2E7XA 3LSIA 1ITYA 4N9IA 3HDDA 2CUFA 2NVTJ 3M1CA 2PJPA 3DQVC 2OJED 1KONA 4BAYA 3E5XA 3FM3A 3GTQJ 1TLHB 5IP9J 3OYMA 1MDMB 3A01A 2FNPA 1MBJA 2ELJA 3MKWB 1FTTA 2WY8Q 3GBGA 3NQOA 1OLTA 3SJMA 1VZ0A 3N4MA 2CW7A 1Y1WJ 2YX7A 1Z1DA 4Y15A 4L5EA 2A6HF 4K2EA 3IAM2 2HKOA 1BA5A 3B6AA 3V8KA 4BQAA 1IAWA 3MWMA 5IY5H 4D5FA 1T6SA 5F1RA 2QKLB 3E5UA 1OYIA 4UVCA 2VXDA 2ID3A 1QVTA 2IAIA 1SD4A 2HPIA 3QPHA 3J81K 4B48A 2DA5A 5K1YA 3SZGA 1TQMA 3HYIA 1O3QA 4XICA 3E7LA 2X4HA 3ZQQA 4IZZA 2GXAA 2ESNA 3U9GA 2LF7A 1QZZA 5AIPA 2DMTA 3ECOA 2ECCA 2LBFB 3DBLB 4Q4ZF 3IL2A 2W84A 3C18A 4NQWA 1TL8A 1CGPA 5BS6A 2WAFA 3LSJA 3RZOJ 5TISC 4M9ZA 4A3BJ 3LSPA 1GVJA 5EF6A 5FB2A 4DYRA 1OCCH 2LNBA 5ED4A 1WI3A 3HM5A 5H6RA 1JHHA 1MMAA 3CCVI 3V7RA 2MG4A 2IS2A 2X85A 2ID6A 4RM3A 2JSCA 1FJLA 2XAQA 2XGCA 1TTYA 1BC7C 2OBPA 5HLGA 1Y56A 1P9QC 2ZSHB 3GTKJ 1D8JA 3FXRA 2K9QA 1R7JA 3K0LA 4NC8A 4HV6A 3RKYA 3HKZN 3ERMA 3WGGA 4LG0A 1HW2A 2YU9J 3KLOA 4B47A 1IRGA 3FDYA 4L5JA 1MNDA 3GZ5A 4P9FA 1V5EA 1WH5A 3TOBA 4ZDPA 3DLLF 1K7AA 3P7NA 2IPQX 3K2ZA 1DP3A 2D1VA 3RZDJ 4RMNA 2XAJA 4A5NA 2LOOA 3K70D 1ERDA 1R5HA 4L9JA 1TWAJ 4F7ZA 1G2HA 1N75A 5D6FA 4AVPA 2VE9A 2HPMA 1SFEA 3PNYA 2XPUA 3ZQHA 3HOVJ 2P6SA 5FROA 1BI1A 2CO5A 5B5EC 2Z33A 1UMQA 1ZREA 5M5YJ 2CW0F 1X58A 3DV8A 5K5OA 4UNOA 2KRFA 2R0QC 1Z21A 2K9NA 4W97A 4AIKA 5IT9Z 1H0MA 5FO5A 1CF7B 3B6CA 2MGQA 1OFCX 4OAYA 2GXBA 3FKJA 4IHSA 3GFJA 3FBIB 4WWCA 3ZPLA 4CCKA 2KDZA 3ZQLA 2JPCA 2R5YA 4CYCA 1MIJA 4KN4X 1ACIA 2I10A 5E3NA 4ZTJA 1X4OA 2ZFWA 3TO9A 1K61A 2RGVA 3LA7A 2L9SA 3BZKA 1MBKA 2MC3A 1F9NA 3CUQC 5J4VA 5ILSA 4RGRA 3E6BA 3HUGB 3BG6A 5EEHA 2JTVA 2ZMEB 2QQ8A 1HOMA 4PJMA 4QSHA 4BQOA 1P6RA 1X1CA 2GOMA 1FSEA 3I71A 5E20A 5JLWA 4ZC3A 3IKTA 2EA2A 3H1CA 1R22A 3QWLA 4XIDA 5FJ8J 3GO5A 1E0EA 4UB6C 3B73A 3W2AA 3MD2A 5F64A 1OCPA 5D5VB 2LFBA 2OTJI 5GPAA 1TT5B 1JI8A 1BIAA 3ZN1A 4FHTA 4Y7NJ 1G8XA 3H3ZA 4M3DA 2JPBA 4BHPA 4KYWA 2MBFA 2JJ7A 1B8IB 1EJ9A 1XCVA 3BPVA 4Q5SF 4C3JJ 3E1SA 3ABUA 3CO6C 1QO0D 4UUSA 3I59A 1FX7A 4M3FA 2L7KA 3NRVA 1VQOI 2GM4A 2XRNA 1PUFA 1Y0NA 1IZ1A 2AQFA 3I59B 2Q2EB 1EF4A 2E5NA 3MKZA 3RYPA 2O8KA 5F0HA 1F5TA 4A3IJ 2V9VA 4AIDA 1RESA 1QU3A 5FD5A 4C3IJ 4BUPA 5J47A 4IVNA 2GOXB 2NYXA 2IGMA 4FTHA 1S29A 4GO1A 4MFDA 3KP5A 1UB9A 1I39A 3FZVA 2KL4A 2DMQA 1KU3A 1NK2P 2FOKA 1XGNA 3O6BB 2M87A 5IOZA 2Q1ZB 4RA2A 3DKXA 1Z91A 4MHGA 4CICA 2ELHA 2LY1A 1YIOA 2Z99A 3FBNB 2ADUA 1ETVA 1H8AC 2P7VB 5DD4A 5F1JA 4BQQA 4MEYF 2VPLA 4OIOF 5IP7J 3BCBA 3S2WA 3OYCA 1FNNA 2HVSA 3B02A 2DYRH 1LDJA 4CYDA 4WF2A 3K4MA 3OYGA 3K4LA 3MZYA 4P9UA 2EK5A 1J2XA 4JYKA 1XSDA 5E1XA 2VKEA 1WJFA 3TMOA 3OYFA 4NC7A 1MD0A 4RAFA 4QTRA 2BVLA 2X48A 1IN5A 2YS9A 1PUEE 1QA6A 4IL6C 2CQ7A 2OPTA 3E0JB 3GX4X 2GXGA 2CRGA 5J1YA 1RKTA 3MCZA 4LLLA 2LDUA 4E7ZA 2XKPA 4BYYA 2E2JJ 2R7UA 5CVVA 5KHDA 2DODA 2XSJC 3GTMJ 1S8NA 4XMYA 2FBIA 4ZH4F 2DJIA 4IJAA 5JVGF 2OA4A 3PUFA 3CCQI 5E8IA 3H36A 2KIFA 2HYGD 1BM9A 4KUMA 3LFUA 2ETHA 2OZ6A 3AG2H 1ZG3A 3C2GA 1REPC 4JBAA 1Z3XA 2XPVA 1YI2I 2F5DA 4AIHA 1JJ8C 3GVAA 1IDZA 3ZMUA 4G6DA 2MD0A 4CCNA 4CH7A 4OIPF 1KU2A 3OS0A 1MJAA 4CCLA 4G6TB 3DBRB 4KIFA 2X6YA 5DD8A 1U8RA 3D5LA 3RQIA 4E6KG 2PI0A 1B1BA 3IHUA 4A3LJ 1KQ9A 1OJLA 3ZQCA 1W5CC 2RNGA 2XDVA 5D4SA 5EG0B 3HOUJ 2GA1A 5E3MA 1R71A 2HWVA 4PJJA 4BHBA 1XDUA 4XLCA 3ZN0A 1XD7A 4Y3OA 2FMLA 4NNJA 2M1BA 3E97A 5EJCA 2NAZA 5LD2C 3WHCA 2TDXA 5FRMA 3ZMDA 2DMPA 4A6DA 2K9LA 1XX5A 3K1PA 3EUHC 1TQIA 3CP2A 1ETYA 3V8JA 1O4XA 4CDGA 4DZPA 1AU7A 2VBWA 1ZHFA 1LNWA 2DTRA 3LSRA 2F5VA 2EZHA 3ZQGA 3JRIA 3ABTA 2JA5J 2K7LA 3L2WA 2E1MC 4RGSA 4V2GA 1PYVA 3GLLA 5F0FA 4KT5C 2O8XA 1XCBA 4M72A 1ULYA 1J75A 1VQ6I 4OMYA 1AKHA 4LK1F 3K70C 2V1XA 5LBQA 3QYFA 2BW3A 5HS7A 2E5ZA 4A3CJ 1OCRH 4MLOA 4PGGA 3PQJA 2E35A 2GZWA 2PMUA 4PFOA 2O7OA 3M3YJ 3T8RA 1NG6A 4HA8A 1TNSA 2E1CA 4S0HB 1VQ9I 3OYAA 1Q1VA 1RR8C 1JKOC 2OTLI 3SXYA 2R92J 3L2VA 1F1ZA 2CUEA 4EM2A 4BY1J 2QGUA 2ZCWA 5DUKA 2JA8J 4RB0A 2XAUA 2P4WA 3HGGA 2VBXA 3CUQA 4ZYEA 3S3NA 1W36D 1R5ID 2LREA 4AIJA 2LLKA 5JR3A 1OMIA 1JTXA 2EIJH 1T0FA 1W1WE 2D2WA 2L02A 1BBYA 1XB4A 2R7DA 4F93B 1ZR2A 5FRNA 4BL0B 1HW1A 1E17A 5K7ZA 1U78A 2HDCA 3FISA 3ABKH 3GFMA 4O6JA 1DPRA 4LB6B 3TBIA 3E6CC 3HL2A 4CUGA 3FXJA 4F91B 3AL0C 2MFZA 1NK3P 3WTVC 4PZJA 2L9VA 4HW0A 4WXCA 4M6XA 1LDDA 4U7BA 1PJRA 2Y0SA 1WPKA 1ZRCA 2GWRA 1RC9A 1ZTRA 4I6ZA 1W0UA 4G7OF 2BY3A 1FTZA 3HKZA 2DN0A 2LKXA 4KICA 3WGIA 2BE5F 2PLYA 3K4CA 2AS5F 4XLHA 2LY2A 3HUGA 4LFUA 1BIBA 1WJBA 4GRIA 3OSFA 3RJPA 2BYVE 3GYHX 1HCRA 1LPQA 3CQZJ 3WU0A 1E2XA 1FOXA 4J00A 4HX8A 3RPUD 1I1SA 1VQ8I 3BWGA 4UV9A 1XDSA 4HX4A 4ZYDA 4BXXJ 2R5ZB 1D0ZA 5HLIA 4B3AA 2H27A 3IH4A 3PJRA 2ZO4A 3H3UA 3HTUA 4Y4RA 4F92B 2VIXA 1IUYA 1V5FA 3EPZA 5E18F 1JKQC 1FT9A 1OYYA 4KIBA 2XC7A 1UAAA 4BBRJ 1MBGA 5FLXZ 1IW7F 2WA0A 1ZG5A 2K27A 2L7MP 1S3JA 1HKQA 2BEOA 2G7UA 1D1BA 1EH6A 4I02A 4C9YA 3W3CA 1VQNI 1HKTA 3WU1B 2FQ3A 3PFIA 3SFIA 3MN2A 3LFKA 1ZGAA 1WJDA 2DMNA 5FKLA 4G7HF 1K79A 4A2UA 1VQ7I 2CQXA 3MVPA 2RV8A 3QYEA 3LL7A 3DWLE 4C2UA 3E6DA 2LF8A 3GFLA 3HBLA 2COMA 2E36A 3IV5A 2ZFUA 2M9HA 3TQNA 2HNHA 2NVYJ 3WE3A 2IA0A 2YU3A 2GIVA 4ENNA 1QZEA 2A3SA 4DBQA 2L5QA 3GFIA 3HOSA 3GZ6A 4PJLA 1LJ9A 1X3WB 4BY7J 3F72A 1MBEA 1T56A 2LMDA 3BTCA 1ZAOA 3PO3J 4RAZA 3BR1A 1SD7A 3Q0WA 3BTIA 3PL8A 2VONA 3CZ6A 4NDLA 3JSOA 2DFFA 3VOEA 5J4YA 3S1RJ 2DJNA 4OMZA 2EV5A 5C4XJ 1A6IA 2K86A 3CCYA 3CMAI 1A35A 3MAJA 3F8FA 1STZA 3CCMI 2MYSA 1XMXA 1GV2A 2NS7A 3ZOBA 3NAUA 3DFGA 2LKPA 3OYKA 1ON1A 4XLAA 3WG7H 3DPUA 3ZCOA 3H5AA 1E3PA 4WX9A 2HGCA 4KMUX 3FMQA 2VBZA 1S7EA 1RRJA 2V7FA 4KT6A 2QZ8A 3A02A 2VJ4A 2IGNA 5FD6A 2OCCH 4KJZA 4H4KC 1D1AA 1R49A 1QNTA 1O3RA 4CO8A 4A3JJ 2XB5A 1BR1A 2PBIA 4FQGA 3GXOA 2JN6A 2YX4A 3TL4X 2PJRB 1B6AA 1RETA 5EZGA 1K83J 4KNYA 3PIOF 2JUCA 4MQ9F 4B43A 2K4BA 2NVXJ 1RZ4A 1AA7A 5JHFA 5FLXK 3CF5F 1LVAA 2R5ZA 1R4MB 1ZELA 3H9QA 2XPWA 3CJRB 4GYGA 3CO7C 2HS5A 5TGTA 3TEDA 2IT0A 1U3EM 1WJCA 2VJ5A 3FKIJ 3OIQA 4IXAA 2VQHA 1S5LC 2DTZA 1I3AA 2XGDA 2YUSA 3CLQA 4RM2A 4XLNF 3QODA 1ETQA 3KP3A 5L3FA 5D5WB 2E71A 2MABA 1IDYA 2O9LA 3WTSC 4NB5A 3OS2A 1PP8F 2VKHA 4Y52J 1IV8A 1JXSA 3E3VA 2GIZA 4ZDOA 5L3EA 1GXQA 4UVBA 1HSJA 3KZZA 1QPIA 3JCUC 2NOGA 3P9KA 1B9NA 3DPLC 2KRHA 4BE0A 2LBFA 2QSGX 2LTPA 2WV1A 3HHHA 4UY8I 3HOXJ 2DO7A 1X1AA 3F6VA 2ISYA 3MMYB 1K4TA 3QOPA 1QGPA 2FEZA 1X1DA 1ZN2A 2F5CA 3CCEI 1NH3A 3C7JA 3HSEA 4JX4A 4PUSA 5DDGA 2IVMA 3OOUA 2HDWA 3BG5A 4AWXB 4A0YA 2IS1A 4IHVA 1T98A 1HQCA 1W7PB 1G3SA 2NS0A 4M6YA 4IF4A 3HHGA 2VODA 1S7AA 4KFCA 3EYIA 1LFUP 2LR8A 5EGOA 1MW7A 1WI9A 4D5CA 1AHDP 4A3MJ 4GCVA 2FNAA 1O57A 2D5VA 5DTDA 2F2EA 3FK6A 3F23A 4NQWB 3O3KA 2R4GA 3H92A 5J3LA 2FBHA 1W5SA 1VI0A 4BJTA 4XRSG 2J5OA 4BDYA 3DPTA 2R7RA 1M1EB 2BGCA 1Z3YA 1A36A 4PCQA 4AM3A 4XKCA 4EM1A 3L2UA 3PFYA 3S93A 4MTDA 3CUOA 1FIPA 4IEJA 1SD6A 4D0PA 2WB1N 3COAC 1G4DA 1U9OA 4FE4A 3F9KA 1HSTA 3M8FA 2PMZN 2HTSA 3I4NJ 5E17F 3CLOA 2A5YB 3ZMVA 3SDGA 1HF0A 2PFBA 2XAHA 3CCJI 2I8DA 1UG2A 1USTA 3LAPA 1Y0UA 1YW8A 2HQ5A 5EYRA 4M74A 4XN0A 3BZ6A 1P7JA 1X2MA 2W00A 4HSRA 2ZJRF 1JUSA 1KU9A 1HC8A 1ETKA 3IH3A 2QA4I 5ERIA 4CZCA 2R5YB 1Z9CA 4DOZA 2NNNA 4XKVA 1MMNA 5FKNA 5ICGA 3QPTA 1H9TA 5CVRA 1UZCA 4IQ4A 4KA4A 4NUBA 2KIMA 4BDZA 2Z3YA 4C30A 1MBHA 4G7ZF 1T38A 4S04A 1MJBA 4BS9A 1OYWA 2GA2A 4YRVA 4CCOA 4HDVA 5HNHA 1TWGJ 2JRTA 4XBFA 3CC7I 3AL0B 1GVDA 3J80K 1FY7A 1JTYA 4R1HA 4BEHB 2VQGA 2XUBA 4BEHA 4YIIA 1Y6IA 1IV6A 1ZLKA 3JTGA 2KKOA 3BDDA 1P4XA 4XK4A 3AKZA 3H5NA 1ONVA 4FISA 1RNLA 4PSXA 2XASA 5L3DA 2EZKA 2QEXI 1LUJB 3RKQA 5DV5A 1FMVA 4BXFA 1MSEC 4CA0A 3I56I 4AYBN 3R61A 5BPIA 5TRDA 2B63J 4JX6A 3E6MA 5DEQA 3W6VA 1OCZH 3OWTA 4OOIA 3V4GA 1DDNA 1AOYA 2OCEA 5L3CA 2A69F 5M5WJ 2IGOA 3G1LA 4W1UA 3L2QA 3LOCA 3ISPA 2C6YA 2VJJA 2DK8A 3GF2A 2QQ9A 2DDBA 1SAXA 1AKHB 3CESA 4RAYA 1RPWA 1D3YA 2BOLA 2E1MB 2CQNA 2F4OB 2HVRA 1W7PA 2W48A 5J8FA 3R0JA 1KQ0A 1ON2A 2ZJPF 2E60A 1SMYF 1K6YA 1D1CA 1HW5A 5CLSA 2UUZA 3J7AO 2FX0A 4LJZF 3S1NJ 1HA8A 4DIQA 1I6HJ 3KYDB 3OR2C 2PN6A 3CMEI 2DA4A 3S3MA 5L3GA 3PNTA 3HRMA 3TP3A 1K78B 2ICWG 2CW8A 3W2VA 1TWHJ 2LC2A 2AO9A 1YLFA 2CU7A 3OR1C 3FHNA 3JRDA 1ZGWA 2QCOA 3Q3SA 3JREA 2GQQA 1SD5A 1XSXA 3ZXSA 3SDBA 2EIKH 1TBXA 3MZHA 1ZRDA 5KAFC 1Y39A 4BXUA 4L0YB 3HGYA 3BY6A 5IYDJ 6PAXA 2Z2SB 3HPGA 5LRRA 3S8PA 3KPHA 3G1OA 1VQPI 2G9WA 1C0WA 4EMSA 5B3SH 1I1GA 4U87A 2JT1A 2P81A 4RGXA 4M3BA 3VFZA 3TW6A 3CCSI 5D6EA 2L4MA 1DU0A 1YX5A 2RVCA 2ZNYA 1OR7A 2DK5A 3VYSB 1J59A 4MEXF 3LSHA 1X4PA 5F04A 1ZH5A 4NBQA 3IH2A 2HR3A 2DI3A 5FFXA 4OINF 4M9XA 3RYRA 4E7HA 4IHXA 2P5VA 2K3FA 4HX7A 1KZHA 4E4HA 2HOEA 2JVGA 5F0CA 2K02A 3LA2A 4CCMA 3QP6A 4RGUA 3FMSA 4A3KJ 3TW7A 3JRGA 5KVRA 1IJWC 2X1CA 4A12A 1JGSA 3J81Z 4EJOA 2LP0A 2PQ8A 2X1EA 2CV2A 2QBYA 4LLNA 1ZLJA 1OCOH 2HYJA 3HZJA 3TP0A 4XKBA 2EFOA 5ICEA 4N4NB 4JQFA 1VQ4I 1IRFA 3S3OA 3K1NA 2CUZA 5JLXA 2M8GX 1U5TA 2F6CA 2DA7A 3LWFA 5KAIC 2ZSIB 1MJ9A 2IW5A 3F8MA 4LOCA 3U1DA 4AU7A 4XLPF 2R7VA 1BR4A 2H1KA 2FMYA 1SMTA 2ZMEC 1FIAA 4ZYHA 1PUFB 2IA2A 4XORA 2VBYA 1YE9A 3CMYA 1VQMI 4DW6A 5LRSA 4P96A 5HS8A 5IT9K 5FKKA 5GAGJ 5HVQC 3CCUI 5JHUA 4L9VA 2IP2A 3FXKA 5JI6A 2XSDC 2W85A 1YRNA 3K4KA 4RB1A 4A3DJ 1YJNI 3E5QA 3DTIA 3GWZA 4JX5A 2KIQA 4LGWA 4IKFA 1JT6A 1PDNC 3HXLA 1JUPA 2R7QA 5DCFA 3BQYA 1VFCA 4CSWA 3BT9A 4M71A 5H6QA 1FLIA 3QAHA 2XF6A 1IUFA 2O0YA 2QYOA 2XRLA 3T1BA 3ZQ7A 5BPDA 3HSRA 4P1WA 5K5RA 1T0FC 1T8IA 1WH7A 2B9SA 2RQPA 1NG7A 2VE8A 1WQ2A 2DT6A 3R6SA 1JJ6C 4X0GA 3FXQA 4UVAA 3MFKA 1G3TA 3P9CA 2MSYA 1YO5C 5A2QK 2VI6A 3MQ0A 1N25A 1A5JA 4ZYGA 2QUFA 2KRCA 3CDIA 3V8LA 3TGNA 1B72B 1D5VA 3OYBA 3WU2C 3DKYA 4EVIA 3SEZA 5F08A 3O2PE 2ZBKA 3D1NI 1VNDA 2PMHA 1YJWI 4PJ0C 1W7PD 2M4GA 1E3OC 3HC7A 3BZCA 2KJCA 4FT8A 3M8EA 2UXNA 2AXLA 3L09A 2H6CA 5A2QZ 4MO7A 5IPAA 5K7HA 4QPQA 3F21A 3GEZA 2B0LA 3OV8A 1K6OA 3S2HJ 2RQQA 3BTJA 1FZPB 4HF0A 2FBKA 2Y9ZA 2V26A 1V54H 1EV7A 2ACJA 1UHWA 1FSHA 4KN7X 5GP9A 3N97A 4QWQA 4MFEA 2ZB9A 4OIQF 1I27A 2MH9A 5GPCA 1J7KA 4A3EJ 3HG9A 2RNJA 4XKWA 1YOVB 1ZG1A 1V55H 2EFWA 3CDLA 1QVUA 1WGXA 2A05A 5ICCA 2WY7Q 1SANA 3FXLA 3Q5FA 1KU7A 1RUOA 4B8XA 2XGXA 2OUMA 1GT0C 4PGHA 2MLKA 2XV4S 2L4AA 3KFWX 4BE1A 1POGA 2O5RA 3CUQB 3AG4H 1BI2A 2K9MA 2R7TA 4I76A 2HEOA 4YIRX 1TW2A 5JVTA 1WCMJ 2X0LA 3OSGA 1SC7A 1XGMA 1IRZA 1WFXA 3RPQA 3A03A 1Q1HA 4N9HA 1U0JA 1QRYA 2IA1A 1H9GA 2PX9A 5CJ9A 4CYCB 4EGZA 3CJNA 4I98B 1YITI 3TO7A 1LDKB 3GTLJ 2E34A 4LD5A 1GXPA 2FOWA 4D9JA 1NTCA 1LQ1A 1T08B 4IPAA 2QENA 1MZBA 4N0BA 3BR6A 1GDTA 5FKOA 3KCCA 3BG9A 1QHGA 2ZXWH 2K4JA 2DPUA 2PJRA 2J5PA 2EB7A 1SEUA 3MKYB 4IHYA 3JRAA 3GTPJ 2EIMH 4D1QA 1B8IA 2QSFX 3Q0UA 2Z9OA 2LK2A 4RDUA 3JRHA 2EV6A 2H8WA 1ZK8A 2E1NA 2FQ4A 2TCTA 2HTJA 1HKSA 4R8HA 4IRGA 2VC1A 4Y17A 1R9TJ 3BQZA 3BROA 3BR2A 4DBRA 2M8EA 2P0WA 3K2AA 1YG2A 1DUXC 2EZIA 2RKHA 2GAUA 4BHCA 5LFAA 1TC3C 1OPCA 4OAZA 4XLFA 3M4OJ 2DFEA 2QM3A 1LVKA 2I5UA 1W36C 1VQKI 2D45A 4OWRB 3CC2I 1UFMA 2IXSA 3BOQA 1RI7A 1WZ2A 4XOTA 4DQ2A 4LMYA 4UV8A 3PIPF 2BXZA 3FXMA 4G6QA 4V2FA 2KDOA 4J01A 1G59A 3OY9A 1V3FA 4P5OA 3L2RA 4IHTA 2QQAA 3WGHA 1MMDA 3EYYA 1LEAA 3HOWJ 2VASA 3QOEA 2VL8A 2Y9YA 2OAZA 4G12A 1H89C 1BW5A 1R58A 3ASOH 4U7DA 3JRFA 1DGWY 1I3QJ 1RR7A 2VLAA 4FCYA 4ESFA 1QZYA 2WAEA 2PEXA 1J09A 1F36A 3IWFA 2XROA 3IKVA 4Z2YA 3F22A 2V79A 3DEWA 2RN7A 1QHHD 5HODA 3OIPA 3LSMA 2WBMA 4BH9A 4I7HA 4JOMA 4G94A 1R23A 4HEA2 5CKTA 3W2WA 2CV0A 2STTA 1FEXA 3C1DA 1P7IA 4HZFA 1RKWA 3K4NA 5KNLA 3I4MJ 9ANTA 2V1UA 4PK4A 3IWZA 1O3TA 2A6EF 5HLHA 2ZJ2A 1QBJA 3PNVA 4G8XA 1MH3A 2R3SA 2DAOA 2DOFA 4XRSA 1Z6TA 5K7FA 3WE2A 5DM7F 3I64A 2ZMEA 5M3FJ 2W57A 3H0DA 4XM3A 3A01B 1E3HA 2M45A 3PM1A 1TP4A 5GAEJ 3AFHA 1JHFA 3CCLI 1Y8QB 3QPSA 4U0WA 4YFXF 3ZRGA 3RI4A 1ZGJA 3Q9VA 3RKXA 1L0OC 2E19A 4X6AJ 4RLFA 4A3FJ 1S6LA 4RAGA 4BNCA 3FXOA 3GUDA 1HDDC 1I5ZA 2EZLA 3SFZA 3VSKA 2W7NA 4MQVA 2DCEA 2HOAA 1FOWA 1RIOH 5B1BH 1DQUA 2EILH 1U5TB 3IRQA 3KEOA 4DNCA 4LG3A 4M3EA 3DF8A 5LGTA 4D7MA 3I55I 2Y30A 5E1WA 2LH9A 2ZKZA 3ZQIA 3NEUA 2DW4A 1F4KA 2Y31A 3A0BC 2DLLA 3WTYC 1XSVA 4XRMA 3WTZA 2WAQA 4TV7A 3OYDA 2EWNA 3ZQFA 4BGDA 2HXOA 2DXIA 4IRHA 1FWZA 4YFNF 1FOKA 4AUXA 2ZXIA 3CMMA 2CV1A 1ZARA 2QLZA 3ROUA 3KLNA 3KYCB 2HVQA 3NWSA 1APLC 2Q8KA 2X51A 2L54A 1YS7A 2L7FP 5DYMA 2E2HJ 4ZZDA 3DTEA 1MKMA 2HYFA 3S17J 3ULQB 2PMZA 4LLGF 3L1PA 4NC6A 1KA8A 1FBUA 3DP7A 1FP2A 2Z1DA 4MIMA 3WTWC 2X6XA 2L0KA 3BR5A 4WXHA 4A69C 4JP0A 2IS6A 1ENHA 2M3AA 2XF7A 1XG1A 2A5WA 1OQYA 2VT3A 1UG0A 4XSXF 1JT0A 1VQ5I 2LYCA 2QSHX 4UUVA 1IC8A 1BR2A 1T95A 2P6TA 3BG3A 4CZZA 3UNGC 1IXRC 3BLYA 2JRMA 2CFOA 1JUMA 1TT0A 1TW3A 4L5IA 3DU6A 5EDNA 3BR0A 4XRFA 2BV6A 1X19A 2K40A 4F3QA 4XOPA 4CCJA 5H2FC 2M0MA 1U2WA 2DDAA 2L9RA 1V4RA 1YW7A 3W6KB 3S15J 3DTKA 2D1HA 5C4JJ 2ME6A 1BN5A 1FPQA 4FX4A 4DZJA 3DEEA 3RTRA 3TKYA 3V42A 3AAFA 2V9KA 3K7AJ 5HNFA 3K4BA 4BJ6C 2V6CA 4LB5A 4UUTA 1R00A 3QU3A 5ILUA 4Q47A 3LNQA 2OV7A 4HF1A 4YIFA 4WCGA 2KZGA 3GMEA 1ORKA 4MNUA 2XAGA 4QLCU 3KP2A 3K9TA 1SVLA 2CS3A 3KP4A 3VYUB 4ANJA 1U5TC 5CPRB 2EH3A 3WTUC 4LITA 4V19K 4S05A 3CP8A 3IC7A 3OYHA 1IO2A 2HZTA 2ZNZA 5LHIA 3IUOA 3PQKA 2ELKA 1YYVA 3RIRA 3LQQA 4I99C 1X2NA 2P8TA 5GAHJ 2L01A 2YR2A 4HSTA 3HRTA 4HDUA 2DPDA 3S1QJ 4HLYA 2DA3A 3ELKA 3CF2A 3KX2A 3ZMTA 2W82A 3O8GA 1FP1D 5JFRA 1JE8A 2A6TA 2Y48A 5FKMA 3VYRB 2DOEA 1WHUA 3AG1H 1USSA 1XGOA 2DBBA 4P55A 4ZZLA 5K5QA 4ENMA 1YIJI 3Q9SA 2Y2ZA 3D5SC 3I0TA 4Y33A 1VF9A 2HQAA 2KISA 2X6OA 3FK7A 3OYNA 1ZYRF 5BOXA 1YW9A 1S7OA 2GLOA 3OS1A 2LRDA 2RREA 1UHMA 4FX0A 5L3BA 5D8LB 2ZXJA 2WWYA 4HNTA 1X3ZB 2QBYB 5C44J 3J7ZI 1ZRFA 4YEJA 1VTNC 4WK8F 1T2KA 2MH2A 3WTXC 4RBOA 1DP7P 2KLOA 2F48A 4FE7A 3JRBA 2VQLA 2JVHA 1IF1A 1Y8RB 5GADJ 4IHWA 3FWEA 1IN7A 1XMKA 2LKSA 4OU0A 2TRTA 2IGKA 2FJ1A 2IEKA 2BHZA 2NOJB 3BC8A 3HPHA 4BACA 3KP6A 2DA1A 3F0CA 1WSUA 4UUSB 1MSFC 3EUAA 1BOBA 3JRCA 2EFQA 3VEPA 3EUHA 4A0XA 3CJQB 4RS8A 3P5JA 3HOYJ 2F4IA 2KQRA 2AQEA 1Z67A 2W1OA 1NHAA 5D5UB 1A31A 1MMGA 1ETXA 3REOA 1P92A 2DMUA 3ML6A 4CHUA 5HDKA 2PG4A 4IOAF 2H1LA 2O3FA 5AIQA 3VB2A 5CVUA 3S14J 4Z6YA 2QWWA 2KT0A 3DKWA 1RUNA 2R93J 3J7AY 3G6EI 4F55A 1OISA 3G4SI 4ESJA 2VB6A 4HBLA 2K85A 1GHCA 5KK1A 4LIVA 5C3EJ 2VOPA 2BY0A 2HU9A 3GW2A 1FBSA 3OYJA 1N78A 1XMAA 2XAFA 4LIUA 4ON0A 4RB2C 2HQRA 4U0YA 4PJNA 1JKPC 4LG0B 2R7XA 2JUGA 1G6NA 2CMPA 3KEQA 3Q0VA 3UR3C 3L2CA 3IRRA 1YHQI 1LE8A 2M5WA 4A0ZA 1AWCA 2CFXA 2ISZA 3VWBA 2KFDA 2NVUB 3WHBA 2CQQA 5E3OA 2A61A 1TWFJ 2CUJA 3J80Z 1I6XA 4PFPA 4ENKA 2QKMB 3K69A 3RCOA 1XS9A 3HRSA 2WAQN 2KHMA 4BKXA 4IO9F 3K6GA 1SFOJ 1DGRM 3BJOA 3LMMA 3GTOJ 1SAUA 2RAEA 1IXCA 2FRHA 5FGMA 3JAMK 2OD5A 2DFHA 2HFHA 3JTHA 2CSOA 4BE2A 1P4WA 3SQNA 1IG7A 2KPMA 2A07F 2DQLA 1MBFA 3HEFA 1R5GA 3ONQA 4L0ZB 5EG0A 3H3VK 5B66C 4HAMA 3ASNH 4M6VA 4AVZA 3VDXA 2BBYA 4B4CA 3C2BA 1FYKA 1MNMC 3V7SA 1FYMA 3IAS2 1D0YA 1G3WA 3JAMZ 1LKXA 1B59A 1XN7A 4XONA 4YFKF 3DXJF 3EETA 2ME0A 5FLMJ 4DGWB 4HQMA 3HIFA 2NVQJ 3K1MA 5GTHC 2FU4A 4A93J 3G73A 1XGSA 1R4NB 2OC6A 2P7CB 3T0YA 2E1OA 2NS8A 2QVOA 3D5RC 4GXOA 2JA7J 2K5CA 2CWEA 4Q48A 2VC0A 3LSGA 2LG4A 4R79A 3F8BA 3QU6A 2DA6A 4EM0B 3ZGKA 2L3DA 2H94A 2HKXA 3I9V2 1DPUA 4GDFA 2DT7B 1YS6A 2DQRA 2XGEA 3LQRA 2V1DA 2VT2A 2Z5UA 2MW8A 4XLEA 3V7CA 4EEFG 5HLTA 4L9NA 5D8KB 2Y0SN 4M73A 1IRXA 4QIWN 4HF2A 2KP6A 1SFXA 5EZHA 1BOAA 1S9HA 3EDPA 4B44A 3DCFA 1WRJA 1R1VA 3F3XA 1O3SA 2BHYA 1MGTA 2VPRA 3SHFA 3BCAA 4J19A 2LY9A 1N77A 1FOYA 3LA3A 1K78A 1J9IA 1OKRA 2VJIA 1BC8C 3GCMA 2WB1A 4OIRF 1VQLI 1QPMA 5F6FA 3TDZC 5LEJA 2DT5A 3HOTA 4HQEA 1OCTC 2VXZA 4I09A 2YPRA 2M30A 2OZUA 4GFBA 4AC0A 1HDPA 4A6EA 1J5YA 2P5KA 3J7YJ 3BP8A 3MKLA 4MTEA 1A04A 1B72A 1LEBA 5BNGA 1P4AA 5D5XB 4XNFA 2O03A 4ABZA 2E7WA 5ILVA 3KYLA 4KMFA 4HV5A 3KZYA 5DCMB 5FLVA 3HSFA 4ZYAA 1Z7UA 3H5RA 4II2A 3MZ8A 4DJAA 5J6XA 3CTAA 1KYZA 2HOSA 4I2OA 1U9NA 4EJTA 1LFBA 1FMWA 3EUKL 3W6JB 3S32A 2FE3A 5EGOB 2CGPA 1TZLA 2CQKA 3A0HC 3DEUA 3PSIA 3G71I 2LD5A 2R7ZJ 5B1AH 2OF7A 1SFUA 1Z6RA 2STWA 2R7WA 2M2EA 3H9JA 3PO2J 2IRFG 5E3LA 2VN2A 3TOAA 3VODA 1EA3A 2V4JC 3CCRI 3DBHB 2LVSA 2JA2A 3I58A 1ZQ3P 3I4PA 4BBSJ 3A2KA 5IOYA 1BW6A 4XL9A 4HOBA 2W25A 2NNYA 3GZNB 2P5LC 3A1YA 2ESHA 3A4CA 4E7SA 3FHZA 1HBXG 1IN6A 1UJ8A 1LE8B 4ASNA 3S16J 1IN4A 3I5UA 1YTYA 4CGZA 5J1UA 2JZYA 2L9NA 2UV1A 1CF7A 2K9SA 4E7JA 4EV0A 3BTLA 4D7NA 5CQGA 1GLNA 2M0CA 2R7OA 2M7AA 1WJAA 3KP7A 1XTAA 2EJRA 1BJAA 1CQTA 4U0VA 1X3UA 2GBYA 4DYCA 2EA4A 1KGSA 5HDGA 2L7ZA 1LFPA 4I0AA 3TDUC 1BI0A 2IS4A 2OQGA 4NHJA 1B9MA 2DOAA 2V1NA 3GTJJ 3SZTA 1EH8A 2WADA 5LGNA 4BQNA 3FF5A 4ITVA 3M7GA 1PVEA 5LGUA 2RDPA 2DU9A 1EKEA 1SVOA 4KDPA 4KIGA 4ETSA 4EJWA 1WWXA 3AG3H 3R60A 4XN3A 2EV0A 3D0SA 1JKRC 3FM5A 3HOZJ 4XSZF 2H09A 2XKOA 1Z77A 3WG9A 2HOTA 2HDDA 5HDNA 1D0XA 2XVCA 2Z16A 3DLAA 1SVMA 2Y75A 4PSWA 3BJAA 2R7SA 2V6EA 2DYSH 4I0BA 2BY1A 3X2QH 2DA2A 2CG4A 3R0AA 5J40A 2F5EA 2Q2EA 3VYTB 4HNUA 5BMZA 1IXSB 3HB9A 3OL3A 2JWTA 3KETA 1EH7A 4G9YA 1YRNB 3M07A 5CQEA 1IN8A 1G3YA 1QQIA 5FFZA 4B3XA 1IGNA 5DS9A 4XR6A 1MH4A 3R4KA 2QQBA 4F52A 5GTIC 4ZTFA 4WXDA 1WKMA 4E7LA 2KJBA 3S2DJ 3ZMSA 4C2TA 4HRIA 4EJUA 4X1EA 5DM6F 3OL4A 3OIOA 2X9DA 5LHHA 2JQ7A 5IP6A 4DYQA 4A5MA 1FC3A 4EATA 3RDIA 2MA3A 4KITB 4E7IA 5CVJA 1A6QA 5CYVA 3I3LA 3OYIA 2VUMJ 5AONA 2CJJA 3RQ4A 2RC4A 4C3HJ 4B1RA 3U1KA 2A68F 3QP5A 2M7BA 4RLQA 2F5FA 4E70A 4HNVA 4YELA 4AD9A 3OOPA 4ESBA 1O7LA 2WC2A 2KIUA 4O5VA 5ICFA 2ZC2A 5LLQA 3CD6I 2EBIA 2KZVA 2JSPA 3ECHA 4GGGA 4HG2A 4BU2A 4CXFA 1BJZA 2JA6J 2Y69H 5LEKA 1GV5A 3OMYA 4QPOA 2H6BA 1D8KA 3BG7A 1PP7U 4HPQA 3JSPA 3N05A 4KISA 3S1MJ 3GLXA 3NARA 5HS9A 3PSFA 2X1DA 2AHQA 3I53A 3FMRA 4C2MJ 1FYLA 2H8RA 2VOOA 3P9IA 2K3PA 1UHSA 3TO6A 2HZDA 3T8TA 2MC4A 3QYBA 5E1ZB 3H0GJ 1TQPA 3EQLF 4HLXA 3ZP5A 3G3ZA 1W0TA 4FETA 2OU2A 2EFNA 3RKWA 4ZJZA 4IQJA 3KIOA 2R7FA 3BR3A 2BY2A 1X1BA 1B4AA 4XQFA 2COBA 2WV0A 3LSTA 3F6OA 4U88A 3LAJA 5CVIA 2X6WA 2EPFA 1WVRA 4FASD 4JK1X 1Z7LA 1GUUA 1J0RA 4N4OB 3SZPA 1HLVA 2IJLA 3UKGA 1K4SA 3L7WA 1MMSA 5DUIA 2F4MB 1L3LA 4HYEA 3OYEA 2O6GE 3FX3A 3U2RA 4I01A 1TWCJ 2BVMA 4AYBA 4H0EA 3F8NA 4IOCF 2G7HA 3JR9A 1MDMA 2IBDA 1T33A 3LSKA 1DU6A 3L00A 2XIGA 5J1RA 1FBQA
chains in the Genus database with same CATH topology
3WODF 5BQTA 1R1TA 1YQAA 4EJVA 4EGYA 1ODDA 4UHTA 4IRIA 3I54A 3MEXA 2UXXA 2UZKA 5HOOA 2XHKA 1Z05A 2W24A 2LSOA 1T39A 2Q0OA 3KE2A 4Y13A 5TJJA 3C3WA 4LK0F 1KQ8A 5LHGA 1HXDA 4O3MA 2FXAA 2NRAC 3WTTC 5J8CA 2MLGA 3QRFF 3HRUA 2FF4A 1W5TA 2MD5A 3M9AA 4MGRA 4EQQA 1LB2A 1R36A 2FSWA 1BI3A 5DCMA 2FA5A 2HQNA 3T5XA 1W4MA 2O61A 4L18B 4GYIA 2EFPA 5H20A 3M1EA 3HTSB 3ERED 4PDKA 1P2FA 1KYWA 4UXNA 5D4RA 3L9FA 3ZMZA 3JW4A 1UCRA 5E8GA 3BPXA 1R1UA 2YSRA 4B09A 2OQRA 5EEGA 1TNTA 4ENJA 2WTEA 3F8CA 4YG2F 3RPUA 2Y0MA 1YFHA 3CDHA 2CYYA 4M9SA 1U6GA 2DFIA 1O7FA 5IT3A 2UWMA 3BJ6A 4L9TA 4RB3C 3FXUA 2E7XA 4N9IA 2PJPA 3DQVC 4BAYA 3E5XA 3FM3A 1TLHB 1MDMB 2FNPA 3NQOA 3N4MA 2YX7A 1Z1DA 4Y15A 2A6HF 4K2EA 2HKOA 3V8KA 4BQAA 1IAWA 3MWMA 1T6SA 5F1RA 3E5UA 1OYIA 4UVCA 1SD4A 3QPHA 3J81K 5K1YA 1TQMA 3HYIA 1O3QA 2X4HA 2ESNA 3U9GA 2LF7A 1QZZA 5AIPA 3ECOA 4Q4ZF 3IL2A 2W84A 3C18A 4NQWA 1CGPA 5BS6A 4M9ZA 1GVJA 5FB2A 2LNBA 5ED4A 5H6RA 1JHHA 3V7RA 2JSCA 2XAQA 1TTYA 1BC7C 2OBPA 5HLGA 1D8JA 3FXRA 1R7JA 3K0LA 4HV6A 3RKYA 3WGGA 4LG0A 1HW2A 3KLOA 1IRGA 4L5JA 3GZ5A 4P9FA 3TOBA 1K7AA 3P7NA 2IPQX 3K2ZA 2D1VA 2XAJA 4A5NA 1R5HA 4L9JA 4F7ZA 5D6FA 4AVPA 2VE9A 1SFEA 2P6SA 1BI1A 2CO5A 2Z33A 1ZREA 2CW0F 3DV8A 5K5OA 4UNOA 2KRFA 4AIKA 5IT9Z 1H0MA 5FO5A 1CF7B 2GXBA 4IHSA 3GFJA 4WWCA 3ZPLA 2JPCA 4KN4X 2ZFWA 3TO9A 2RGVA 3LA7A 2MC3A 1F9NA 3CUQC 5ILSA 4RGRA 3E6BA 5EEHA 2JTVA 2ZMEB 1P6RA 3I71A 1FSEA 5E20A 3IKTA 2EA2A 1R22A 3GO5A 3B73A 5F64A 5D5VB 1BIAA 3ZN1A 4FHTA 3H3ZA 2JPBA 4BHPA 4KYWA 2MBFA 1XCVA 3BPVA 4Q5SF 3ABUA 3CO6C 1QO0D 3I59A 1FX7A 3NRVA 2XRNA 1IZ1A 3I59B 3RYPA 1F5TA 2V9VA 5FD5A 4IVNA 2NYXA 1S29A 4GO1A 3KP5A 1UB9A 3FZVA 1KU3A 2FOKA 1XGNA 3O6BB 2M87A 1Z91A 4MHGA 4CICA 2ELHA 1YIOA 2Z99A 2ADUA 2P7VB 5DD4A 4MEYF 4OIOF 3S2WA 1FNNA 3B02A 1LDJA 4CYDA 4WF2A 3MZYA 4P9UA 2EK5A 1J2XA 1XSDA 5E1XA 1MD0A 1IN5A 1PUEE 3GX4X 2GXGA 3MCZA 4LLLA 2LDUA 2XKPA 4BYYA 5CVVA 1S8NA 2FBIA 4ZH4F 4IJAA 2OA4A 5E8IA 2KIFA 2HYGD 1BM9A 4KUMA 2ETHA 2OZ6A 1ZG3A 1REPC 4JBAA 2F5DA 4AIHA 3GVAA 3ZMUA 4G6DA 4OIPF 1KU2A 1MJAA 4KIFA 5DD8A 1U8RA 3D5LA 2PI0A 1B1BA 3IHUA 1KQ9A 5D4SA 2GA1A 2HWVA 4BHBA 1XDUA 3ZN0A 1XD7A 2FMLA 2M1BA 3E97A 2NAZA 2TDXA 3ZMDA 4A6DA 3K1PA 1TQIA 3V8JA 4CDGA 2VBWA 1ZHFA 1LNWA 2DTRA 3ABTA 2K7LA 4RGSA 4KT5C 2O8XA 1XCBA 4M72A 1ULYA 1J75A 4OMYA 4LK1F 2V1XA 5LBQA 5HS7A 4PGGA 3PQJA 2GZWA 2PMUA 3T8RA 4HA8A 1TNSA 2E1CA 3SXYA 1F1ZA 4EM2A 2ZCWA 5DUKA 4RB0A 2P4WA 2VBXA 3CUQA 4ZYEA 4AIJA 5JR3A 1OMIA 1T0FA 2D2WA 2L02A 2R7DA 1BBYA 1XB4A 1E17A 1HW1A 1U78A 2HDCA 4LB6B 4O6JA 3GFMA 3E6CC 1DPRA 3WTVC 4PZJA 4HW0A 4WXCA 4M6XA 1LDDA 4U7BA 1ZRCA 2GWRA 4G7OF 4KICA 3WGIA 2BE5F 2PLYA 2AS5F 3HUGA 4LFUA 1BIBA 3RJPA 2BYVE 3GYHX 3WU0A 1E2XA 4HX8A 1I1SA 3BWGA 4UV9A 1XDSA 4HX4A 4ZYDA 5HLIA 2H27A 2ZO4A 3H3UA 3HTUA 1IUYA 5E18F 1FT9A 1OYYA 4KIBA 5FLXZ 1IW7F 1ZG5A 2K27A 1S3JA 1HKQA 2BEOA 2G7UA 1EH6A 4I02A 1HKTA 3WU1B 2FQ3A 3PFIA 3LFKA 1ZGAA 4G7HF 1K79A 4A2UA 2RV8A 3E6DA 2LF8A 3GFLA 2COMA 3TQNA 3WE3A 2IA0A 2YU3A 2GIVA 4ENNA 2A3SA 3GFIA 3HOSA 3GZ6A 1LJ9A 3F72A 1ZAOA 4RAZA 1SD7A 2VONA 3JSOA 3VOEA 4OMZA 2EV5A 2K86A 3MAJA 3F8FA 1STZA 3DFGA 2LKPA 1ON1A 4WX9A 2HGCA 4KMUX 3FMQA 2VBZA 2QZ8A 5FD6A 1QNTA 1O3RA 4CO8A 2PBIA 3GXOA 2YX4A 1B6AA 4KNYA 4MQ9F 2K4BA 1RZ4A 5FLXK 1LVAA 4GYGA 3CO7C 2HS5A 2IT0A 1U3EM 4IXAA 4XLNF 5L3FA 3KP3A 5D5WB 3WTSC 4NB5A 1PP8F 1JXSA 3E3VA 5L3EA 1GXQA 4UVBA 1HSJA 3KZZA 3P9KA 1B9NA 3DPLC 3HHHA 2DO7A 2ISYA 3F6VA 3QOPA 1QGPA 2FEZA 1ZN2A 2F5CA 3C7JA 3HSEA 5DDGA 2IVMA 4AWXB 4A0YA 1T98A 1HQCA 4M6YA 1G3SA 1W7PB 2NS0A 4IF4A 3HHGA 2VODA 1S7AA 4KFCA 3EYIA 1WI9A 4GCVA 2FNAA 1O57A 2F2EA 3F23A 3O3KA 3H92A 2FBHA 1W5SA 2J5OA 3DPTA 2BGCA 4PCQA 4EM1A 4MTDA 3CUOA 1SD6A 4D0PA 3COAC 1G4DA 1HSTA 3M8FA 2HTSA 5E17F 3CLOA 2A5YB 3ZMVA 2PFBA 2XAHA 1USTA 3LAPA 1Y0UA 1YW8A 4M74A 3BZ6A 1KU9A 1Z9CA 5ERIA 2NNNA 5ICGA 3QPTA 1H9TA 5CVRA 4KA4A 2KIMA 2Z3YA 4G7ZF 1T38A 4S04A 1MJBA 1OYWA 2GA2A 4HDVA 2JRTA 4XBFA 3J80K 1FY7A 4R1HA 2XUBA 4YIIA 1ZLKA 3JTGA 2KKOA 3BDDA 1P4XA 1ONVA 1RNLA 2XASA 5L3DA 5DV5A 3R61A 5BPIA 5TRDA 3E6MA 5DEQA 4OOIA 3V4GA 1DDNA 1AOYA 5L3CA 2A69F 3ISPA 2C6YA 2DK8A 3GF2A 2QQ9A 1SAXA 4RAYA 1D3YA 1W7PA 5J8FA 3R0JA 1KQ0A 1ON2A 1SMYF 1HW5A 5CLSA 3J7AO 4LJZF 2PN6A 5L3GA 3HRMA 1K78B 1YLFA 2GQQA 1SD5A 1XSXA 1TBXA 3MZHA 1ZRDA 4BXUA 4L0YB 3BY6A 6PAXA 5LRRA 1C0WA 2G9WA 4EMSA 1I1GA 2JT1A 4RGXA 3VFZA 5D6EA 2L4MA 2RVCA 2ZNYA 1OR7A 2DK5A 1J59A 4MEXF 1ZH5A 4OINF 2HR3A 2DI3A 5FFXA 4M9XA 3RYRA 2P5VA 4HX7A 2HOEA 2K02A 3LA2A 3QP6A 4RGUA 3FMSA 5KVRA 4A12A 1JGSA 3J81Z 4EJOA 2PQ8A 2QBYA 4LLNA 1ZLJA 2EFOA 5ICEA 4JQFA 1IRFA 3K1NA 1U5TA 3LWFA 1MJ9A 2IW5A 3F8MA 3U1DA 4XLPF 2FMYA 1SMTA 4ZYHA 2IA2A 2VBYA 5LRSA 4P96A 5HS8A 5IT9K 5HVQC 5JHUA 4L9VA 2IP2A 5JI6A 2W85A 4RB1A 3E5QA 3GWZA 4LGWA 1PDNC 5DCFA 4M71A 5H6QA 1FLIA 3QAHA 2O0YA 2QYOA 3T1BA 3ZQ7A 5BPDA 3HSRA 5K5RA 2RQPA 2VE8A 1WQ2A 3R6SA 3FXQA 4UVAA 3MFKA 1G3TA 3P9CA 1YO5C 5A2QK 3MQ0A 4ZYGA 2QUFA 3V8LA 3TGNA 1D5VA 4EVIA 3O2PE 2ZBKA 2PMHA 1W7PD 2KJCA 4FT8A 3M8EA 2UXNA 2AXLA 3L09A 2H6CA 5A2QZ 3F21A 3GEZA 2B0LA 3OV8A 1K6OA 1FZPB 4HF0A 2FBKA 1EV7A 2ACJA 1UHWA 1FSHA 4KN7X 3N97A 4QWQA 4OIQF 1I27A 2MH9A 1J7KA 2RNJA 1ZG1A 2EFWA 1RUOA 1KU7A 3Q5FA 5ICCA 4B8XA 2XGXA 4PGHA 2MLKA 2XV4S 2L4AA 3KFWX 3CUQB 1BI2A 2HEOA 1TW2A 5JVTA 2X0LA 1XGMA 3RPQA 1Q1HA 4N9HA 2IA1A 1H9GA 5CJ9A 4EGZA 3CJNA 4I98B 3TO7A 1LDKB 4LD5A 1GXPA 1LQ1A 4IPAA 2QENA 1MZBA 4N0BA 3KCCA 2K4JA 2DPUA 2J5PA 2EB7A 2Z9OA 2EV6A 2E1NA 2HTJA 1HKSA 4R8HA 4IRGA 2VC1A 4Y17A 3BROA 2M8EA 1YG2A 1DUXC 2RKHA 2GAUA 4BHCA 1OPCA 2QM3A 2D45A 1UFMA 3BOQA 1RI7A 4DQ2A 4LMYA 4UV8A 4G6QA 1V3FA 4P5OA 4IHTA 2QQAA 3WGHA 3EYYA 1LEAA 2OAZA 1R58A 4U7DA 4ESFA 1QZYA 2PEXA 3IWFA 2XROA 3F22A 4Z2YA 3IKVA 2V79A 2RN7A 4BH9A 4I7HA 4G94A 1R23A 2STTA 3C1DA 4HZFA 2V1UA 3IWZA 1O3TA 2A6EF 5HLHA 2ZJ2A 1QBJA 4G8XA 2R3SA 2DAOA 1Z6TA 3WE2A 3I64A 2ZMEA 2W57A 2M45A 1JHFA 4U0WA 4YFXF 3RI4A 1ZGJA 3Q9VA 3RKXA 1L0OC 1S6LA 4BNCA 3GUDA 1I5ZA 3SFZA 4MQVA 1RIOH 1U5TB 3IRQA 3KEOA 4DNCA 3DF8A 5LGTA 5E1WA 2ZKZA 3NEUA 2DW4A 1F4KA 2DLLA 3WTYC 1XSVA 3WTZA 4TV7A 2EWNA 4IRHA 1FWZA 4YFNF 1FOKA 1ZARA 2QLZA 3ROUA 3KLNA 2Q8KA 2L54A 1YS7A 5DYMA 4ZZDA 1MKMA 2HYFA 3ULQB 4LLGF 1KA8A 1FBUA 3DP7A 1FP2A 3WTWC 4WXHA 4XSXF 2VT3A 4UUVA 2P6TA 4CZZA 1IXRC 4L5IA 1TW3A 4XRFA 2BV6A 1U2WA 1V4RA 1YW7A 3W6KB 2D1HA 1BN5A 1FPQA 4FX4A 3RTRA 3TKYA 3AAFA 2V6CA 4LB5A 1R00A 3QU3A 5ILUA 4Q47A 4HF1A 4YIFA 4WCGA 4MNUA 2XAGA 4QLCU 3KP2A 3K9TA 3KP4A 1U5TC 3WTUC 4S05A 3IC7A 2HZTA 2ZNZA 5LHIA 3PQKA 3RIRA 1YYVA 3LQQA 2P8TA 2L01A 2YR2A 3HRTA 4HDUA 2DPDA 4HLYA 3ELKA 3ZMTA 5JFRA 1FP1D 1JE8A 2Y48A 1USSA 1XGOA 2DBBA 4P55A 4ZZLA 5K5QA 4ENMA 3Q9SA 3I0TA 1ZYRF 5BOXA 1YW9A 1S7OA 5L3BA 1UHMA 4FX0A 5D8LB 2ZXJA 2WWYA 2QBYB 1ZRFA 1VTNC 4WK8F 1T2KA 2MH2A 3WTXC 1DP7P 1IF1A 3FWEA 1IN7A 1XMKA 4OU0A 3KP6A 1WSUA 2EFQA 3VEPA 3EUHA 4A0XA 4RS8A 1NHAA 5D5UB 3REOA 1P92A 4CHUA 3ML6A 5HDKA 2PG4A 5AIQA 2O3FA 3VB2A 5CVUA 2QWWA 3DKWA 1RUNA 4ESJA 4HBLA 1GHCA 5KK1A 2VOPA 3GW2A 1FBSA 1XMAA 2XAFA 4ON0A 4RB2C 2HQRA 4U0YA 4LG0B 1G6NA 3KEQA 3L2CA 3IRRA 2M5WA 4A0ZA 1AWCA 2CFXA 2ISZA 2A61A 3J80Z 1I6XA 4ENKA 3K69A 3HRSA 3BJOA 1IXCA 2FRHA 5FGMA 3JAMK 2OD5A 2HFHA 3JTHA 2CSOA 1P4WA 3SQNA 2A07F 2DQLA 1R5GA 4L0ZB 4HAMA 1FYKA 2BBYA 3V7SA 1FYMA 1G3WA 3JAMZ 1B59A 1XN7A 4YFKF 3DXJF 3EETA 4HQMA 3HIFA 3K1MA 2FU4A 3G73A 1XGSA 2P7CB 3T0YA 2QVOA 4GXOA 2CWEA 4Q48A 2VC0A 4R79A 3F8BA 3QU6A 4EM0B 2L3DA 2H94A 2HKXA 1DPUA 1YS6A 2DQRA 3LQRA 2V1DA 2VT2A 2Z5UA 3V7CA 4HF2A 4L9NA 5D8KB 4M73A 1SFXA 1BOAA 3EDPA 1WRJA 1R1VA 3F3XA 1O3SA 1MGTA 3SHFA 3LA3A 1K78A 1J9IA 1OKRA 1BC8C 4OIRF 1QPMA 5F6FA 3TDZC 5LEJA 2DT5A 3HOTA 4HQEA 2VXZA 4I09A 2YPRA 2M30A 2OZUA 4A6EA 1J5YA 2P5KA 3BP8A 4MTEA 1A04A 1LEBA 1P4AA 5D5XB 2O03A 2E7WA 5ILVA 4KMFA 4HV5A 3KZYA 5DCMB 3HSFA 1Z7UA 5J6XA 3CTAA 1KYZA 4I2OA 4EJTA 3W6JB 2FE3A 2CGPA 2CQKA 3DEUA 1SFUA 1Z6RA 2STWA 2IRFG 2VN2A 3TOAA 3VODA 3I58A 3I4PA 4HOBA 2W25A 2NNYA 2P5LC 2ESHA 3FHZA 1HBXG 1IN6A 4ASNA 1IN4A 3I5UA 1YTYA 4CGZA 2JZYA 1CF7A 4EV0A 3KP7A 2EJRA 1BJAA 4U0VA 1X3UA 2EA4A 1KGSA 5HDGA 4I0AA 3TDUC 1BI0A 2OQGA 4NHJA 1B9MA 3SZTA 1EH8A 5LGNA 3FF5A 3M7GA 5LGUA 2RDPA 2DU9A 4KDPA 4KIGA 4ETSA 4EJWA 1WWXA 3R60A 2EV0A 3D0SA 3FM5A 4XSZF 2H09A 2XKOA 3WG9A 5HDNA 2XVCA 2Y75A 3BJAA 4I0BA 2CG4A 3R0AA 2F5EA 2Q2EA 5BMZA 1IXSB 3KETA 1EH7A 4G9YA 1IN8A 1G3YA 1QQIA 5FFZA 3R4KA 2QQBA 4WXDA 1WKMA 2KJBA 3ZMSA 4EJUA 5LHHA 4A5MA 1FC3A 3RDIA 2MA3A 5CVJA 5CYVA 5AONA 2RC4A 2A68F 3QP5A 2F5FA 4E70A 4AD9A 3OOPA 4ESBA 1O7LA 2WC2A 2KIUA 4O5VA 5ICFA 5LLQA 3ECHA 4GGGA 4CXFA 5LEKA 2H6BA 1D8KA 1PP7U 3JSPA 3GLXA 5HS9A 1FYLA 3I53A 3FMRA 2VOOA 3P9IA 3TO6A 3T8TA 5E1ZB 1TQPA 3EQLF 4HLXA 3ZP5A 3G3ZA 2OU2A 2EFNA 3RKWA 2R7FA 1B4AA 4U88A 2WV0A 3LSTA 3F6OA 3LAJA 5CVIA 4JK1X 1J0RA 3SZPA 2IJLA 3L7WA 5DUIA 1L3LA 4HYEA 2O6GE 3FX3A 3U2RA 4I01A 4H0EA 3F8NA 2G7HA 1MDMA 3L00A 2XIGA 1FBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD F;  5BQT A;  1R1T A;  1YQA A;  4EJV A;  4EGY A;  1ODD A;  4UHT A;  4IRI A;  3I54 A;  3MEX A;  2UXX A;  2UZK A;  5HOO A;  2XHK A;  1Z05 A;  2W24 A;  2LSO A;  1T39 A;  2Q0O A;  3KE2 A;  4Y13 A;  5TJJ A;  3C3W A;  4LK0 F;  1KQ8 A;  5LHG A;  1HXD A;  4O3M A;  2FXA A;  2NRA C;  3WTT C;  5J8C A;  2MLG A;  3QRF F;  3HRU A;  2FF4 A;  1W5T A;  2MD5 A;  3M9A A;  4MGR A;  4EQQ A;  1LB2 A;  1R36 A;  2FSW A;  1BI3 A;  5DCM A;  2FA5 A;  2HQN A;  3T5X A;  1W4M A;  2O61 A;  4L18 B;  4GYI A;  2EFP A;  5H20 A;  3M1E A;  3HTS B;  3ERE D;  4PDK A;  1P2F A;  1KYW A;  4UXN A;  5D4R A;  3L9F A;  3ZMZ A;  3JW4 A;  1UCR A;  5E8G A;  3BPX A;  1R1U A;  2YSR A;  4B09 A;  2OQR A;  5EEG A;  1TNT A;  4ENJ A;  2WTE A;  3F8C A;  4YG2 F;  3RPU A;  2Y0M A;  1YFH A;  3CDH A;  2CYY A;  4M9S A;  1U6G A;  2DFI A;  1O7F A;  5IT3 A;  2UWM A;  3BJ6 A;  4L9T A;  4RB3 C;  3FXU A;  2E7X A;  4N9I A;  2PJP A;  3DQV C;  4BAY A;  3E5X A;  3FM3 A;  1TLH B;  1MDM B;  2FNP A;  3NQO A;  3N4M A;  2YX7 A;  1Z1D A;  4Y15 A;  2A6H F;  4K2E A;  2HKO A;  3V8K A;  4BQA A;  1IAW A;  3MWM A;  1T6S A;  5F1R A;  3E5U A;  1OYI A;  4UVC A;  1SD4 A;  3QPH A;  3J81 K;  5K1Y A;  1TQM A;  3HYI A;  1O3Q A;  2X4H A;  2ESN A;  3U9G A;  2LF7 A;  1QZZ A;  5AIP A;  3ECO A;  4Q4Z F;  3IL2 A;  2W84 A;  3C18 A;  4NQW A;  1CGP A;  5BS6 A;  4M9Z A;  1GVJ A;  5FB2 A;  2LNB A;  5ED4 A;  5H6R A;  1JHH A;  3V7R A;  2JSC A;  2XAQ A;  1TTY A;  1BC7 C;  2OBP A;  5HLG A;  1D8J A;  3FXR A;  1R7J A;  3K0L A;  4HV6 A;  3RKY A;  3WGG A;  4LG0 A;  1HW2 A;  3KLO A;  1IRG A;  4L5J A;  3GZ5 A;  4P9F A;  3TOB A;  1K7A A;  3P7N A;  2IPQ X;  3K2Z A;  2D1V A;  2XAJ A;  4A5N A;  1R5H A;  4L9J A;  4F7Z A;  5D6F A;  4AVP A;  2VE9 A;  1SFE A;  2P6S A;  1BI1 A;  2CO5 A;  2Z33 A;  1ZRE A;  2CW0 F;  3DV8 A;  5K5O A;  4UNO A;  2KRF A;  4AIK A;  5IT9 Z;  1H0M A;  5FO5 A;  1CF7 B;  2GXB A;  4IHS A;  3GFJ A;  4WWC A;  3ZPL A;  2JPC A;  4KN4 X;  2ZFW A;  3TO9 A;  2RGV A;  3LA7 A;  2MC3 A;  1F9N A;  3CUQ C;  5ILS A;  4RGR A;  3E6B A;  5EEH A;  2JTV A;  2ZME B;  1P6R A;  3I71 A;  1FSE A;  5E20 A;  3IKT A;  2EA2 A;  1R22 A;  3GO5 A;  3B73 A;  5F64 A;  5D5V B;  1BIA A;  3ZN1 A;  4FHT A;  3H3Z A;  2JPB A;  4BHP A;  4KYW A;  2MBF A;  1XCV A;  3BPV A;  4Q5S F;  3ABU A;  3CO6 C;  1QO0 D;  3I59 A;  1FX7 A;  3NRV A;  2XRN A;  1IZ1 A;  3I59 B;  3RYP A;  1F5T A;  2V9V A;  5FD5 A;  4IVN A;  2NYX A;  1S29 A;  4GO1 A;  3KP5 A;  1UB9 A;  3FZV A;  1KU3 A;  2FOK A;  1XGN A;  3O6B B;  2M87 A;  1Z91 A;  4MHG A;  4CIC A;  2ELH A;  1YIO A;  2Z99 A;  2ADU A;  2P7V B;  5DD4 A;  4MEY F;  4OIO F;  3S2W A;  1FNN A;  3B02 A;  1LDJ A;  4CYD A;  4WF2 A;  3MZY A;  4P9U A;  2EK5 A;  1J2X A;  1XSD A;  5E1X A;  1MD0 A;  1IN5 A;  1PUE E;  3GX4 X;  2GXG A;  3MCZ A;  4LLL A;  2LDU A;  2XKP A;  4BYY A;  5CVV A;  1S8N A;  2FBI A;  4ZH4 F;  4IJA A;  2OA4 A;  5E8I A;  2KIF A;  2HYG D;  1BM9 A;  4KUM A;  2ETH A;  2OZ6 A;  1ZG3 A;  1REP C;  4JBA A;  2F5D A;  4AIH A;  3GVA A;  3ZMU A;  4G6D A;  4OIP F;  1KU2 A;  1MJA A;  4KIF A;  5DD8 A;  1U8R A;  3D5L A;  2PI0 A;  1B1B A;  3IHU A;  1KQ9 A;  5D4S A;  2GA1 A;  2HWV A;  4BHB A;  1XDU A;  3ZN0 A;  1XD7 A;  2FML A;  2M1B A;  3E97 A;  2NAZ A;  2TDX A;  3ZMD A;  4A6D A;  3K1P A;  1TQI A;  3V8J A;  4CDG A;  2VBW A;  1ZHF A;  1LNW A;  2DTR A;  3ABT A;  2K7L A;  4RGS A;  4KT5 C;  2O8X A;  1XCB A;  4M72 A;  1ULY A;  1J75 A;  4OMY A;  4LK1 F;  2V1X A;  5LBQ A;  5HS7 A;  4PGG A;  3PQJ A;  2GZW A;  2PMU A;  3T8R A;  4HA8 A;  1TNS A;  2E1C A;  3SXY A;  1F1Z A;  4EM2 A;  2ZCW A;  5DUK A;  4RB0 A;  2P4W A;  2VBX A;  3CUQ A;  4ZYE A;  4AIJ A;  5JR3 A;  1OMI A;  1T0F A;  2D2W A;  2L02 A;  2R7D A;  1BBY A;  1XB4 A;  1E17 A;  1HW1 A;  1U78 A;  2HDC A;  4LB6 B;  4O6J A;  3GFM A;  3E6C C;  1DPR A;  3WTV C;  4PZJ A;  4HW0 A;  4WXC A;  4M6X A;  1LDD A;  4U7B A;  1ZRC A;  2GWR A;  4G7O F;  4KIC A;  3WGI A;  2BE5 F;  2PLY A;  2AS5 F;  3HUG A;  4LFU A;  1BIB A;  3RJP A;  2BYV E;  3GYH X;  3WU0 A;  1E2X A;  4HX8 A;  1I1S A;  3BWG A;  4UV9 A;  1XDS A;  4HX4 A;  4ZYD A;  5HLI A;  2H27 A;  2ZO4 A;  3H3U A;  3HTU A;  1IUY A;  5E18 F;  1FT9 A;  1OYY A;  4KIB A;  5FLX Z;  1IW7 F;  1ZG5 A;  2K27 A;  1S3J A;  1HKQ A;  2BEO A;  2G7U A;  1EH6 A;  4I02 A;  1HKT A;  3WU1 B;  2FQ3 A;  3PFI A;  3LFK A;  1ZGA A;  4G7H F;  1K79 A;  4A2U A;  2RV8 A;  3E6D A;  2LF8 A;  3GFL A;  2COM A;  3TQN A;  3WE3 A;  2IA0 A;  2YU3 A;  2GIV A;  4ENN A;  2A3S A;  3GFI A;  3HOS A;  3GZ6 A;  1LJ9 A;  3F72 A;  1ZAO A;  4RAZ A;  1SD7 A;  2VON A;  3JSO A;  3VOE A;  4OMZ A;  2EV5 A;  2K86 A;  3MAJ A;  3F8F A;  1STZ A;  3DFG A;  2LKP A;  1ON1 A;  4WX9 A;  2HGC A;  4KMU X;  3FMQ A;  2VBZ A;  2QZ8 A;  5FD6 A;  1QNT A;  1O3R A;  4CO8 A;  2PBI A;  3GXO A;  2YX4 A;  1B6A A;  4KNY A;  4MQ9 F;  2K4B A;  1RZ4 A;  5FLX K;  1LVA A;  4GYG A;  3CO7 C;  2HS5 A;  2IT0 A;  1U3E M;  4IXA A;  4XLN F;  5L3F A;  3KP3 A;  5D5W B;  3WTS C;  4NB5 A;  1PP8 F;  1JXS A;  3E3V A;  5L3E A;  1GXQ A;  4UVB A;  1HSJ A;  3KZZ A;  3P9K A;  1B9N A;  3DPL C;  3HHH A;  2DO7 A;  2ISY A;  3F6V A;  3QOP A;  1QGP A;  2FEZ A;  1ZN2 A;  2F5C A;  3C7J A;  3HSE A;  5DDG A;  2IVM A;  4AWX B;  4A0Y A;  1T98 A;  1HQC A;  4M6Y A;  1G3S A;  1W7P B;  2NS0 A;  4IF4 A;  3HHG A;  2VOD A;  1S7A A;  4KFC A;  3EYI A;  1WI9 A;  4GCV A;  2FNA A;  1O57 A;  2F2E A;  3F23 A;  3O3K A;  3H92 A;  2FBH A;  1W5S A;  2J5O A;  3DPT A;  2BGC A;  4PCQ A;  4EM1 A;  4MTD A;  3CUO A;  1SD6 A;  4D0P A;  3COA C;  1G4D A;  1HST A;  3M8F A;  2HTS A;  5E17 F;  3CLO A;  2A5Y B;  3ZMV A;  2PFB A;  2XAH A;  1UST A;  3LAP A;  1Y0U A;  1YW8 A;  4M74 A;  3BZ6 A;  1KU9 A;  1Z9C A;  5ERI A;  2NNN A;  5ICG A;  3QPT A;  1H9T A;  5CVR A;  4KA4 A;  2KIM A;  2Z3Y A;  4G7Z F;  1T38 A;  4S04 A;  1MJB A;  1OYW A;  2GA2 A;  4HDV A;  2JRT A;  4XBF A;  3J80 K;  1FY7 A;  4R1H A;  2XUB A;  4YII A;  1ZLK A;  3JTG A;  2KKO A;  3BDD A;  1P4X A;  1ONV A;  1RNL A;  2XAS A;  5L3D A;  5DV5 A;  3R61 A;  5BPI A;  5TRD A;  3E6M A;  5DEQ A;  4OOI A;  3V4G A;  1DDN A;  1AOY A;  5L3C A;  2A69 F;  3ISP A;  2C6Y A;  2DK8 A;  3GF2 A;  2QQ9 A;  1SAX A;  4RAY A;  1D3Y A;  1W7P A;  5J8F A;  3R0J A;  1KQ0 A;  1ON2 A;  1SMY F;  1HW5 A;  5CLS A;  3J7A O;  4LJZ F;  2PN6 A;  5L3G A;  3HRM A;  1K78 B;  1YLF A;  2GQQ A;  1SD5 A;  1XSX A;  1TBX A;  3MZH A;  1ZRD A;  4BXU A;  4L0Y B;  3BY6 A;  6PAX A;  5LRR A;  1C0W A;  2G9W A;  4EMS A;  1I1G A;  2JT1 A;  4RGX A;  3VFZ A;  5D6E A;  2L4M A;  2RVC A;  2ZNY A;  1OR7 A;  2DK5 A;  1J59 A;  4MEX F;  1ZH5 A;  4OIN F;  2HR3 A;  2DI3 A;  5FFX A;  4M9X A;  3RYR A;  2P5V A;  4HX7 A;  2HOE A;  2K02 A;  3LA2 A;  3QP6 A;  4RGU A;  3FMS A;  5KVR A;  4A12 A;  1JGS A;  3J81 Z;  4EJO A;  2PQ8 A;  2QBY A;  4LLN A;  1ZLJ A;  2EFO A;  5ICE A;  4JQF A;  1IRF A;  3K1N A;  1U5T A;  3LWF A;  1MJ9 A;  2IW5 A;  3F8M A;  3U1D A;  4XLP F;  2FMY A;  1SMT A;  4ZYH A;  2IA2 A;  2VBY A;  5LRS A;  4P96 A;  5HS8 A;  5IT9 K;  5HVQ C;  5JHU A;  4L9V A;  2IP2 A;  5JI6 A;  2W85 A;  4RB1 A;  3E5Q A;  3GWZ A;  4LGW A;  1PDN C;  5DCF A;  4M71 A;  5H6Q A;  1FLI A;  3QAH A;  2O0Y A;  2QYO A;  3T1B A;  3ZQ7 A;  5BPD A;  3HSR A;  5K5R A;  2RQP A;  2VE8 A;  1WQ2 A;  3R6S A;  3FXQ A;  4UVA A;  3MFK A;  1G3T A;  3P9C A;  1YO5 C;  5A2Q K;  3MQ0 A;  4ZYG A;  2QUF A;  3V8L A;  3TGN A;  1D5V A;  4EVI A;  3O2P E;  2ZBK A;  2PMH A;  1W7P D;  2KJC A;  4FT8 A;  3M8E A;  2UXN A;  2AXL A;  3L09 A;  2H6C A;  5A2Q Z;  3F21 A;  3GEZ A;  2B0L A;  3OV8 A;  1K6O A;  1FZP B;  4HF0 A;  2FBK A;  1EV7 A;  2ACJ A;  1UHW A;  1FSH A;  4KN7 X;  3N97 A;  4QWQ A;  4OIQ F;  1I27 A;  2MH9 A;  1J7K A;  2RNJ A;  1ZG1 A;  2EFW A;  1RUO A;  1KU7 A;  3Q5F A;  5ICC A;  4B8X A;  2XGX A;  4PGH A;  2MLK A;  2XV4 S;  2L4A A;  3KFW X;  3CUQ B;  1BI2 A;  2HEO A;  1TW2 A;  5JVT A;  2X0L A;  1XGM A;  3RPQ A;  1Q1H A;  4N9H A;  2IA1 A;  1H9G A;  5CJ9 A;  4EGZ A;  3CJN A;  4I98 B;  3TO7 A;  1LDK B;  4LD5 A;  1GXP A;  1LQ1 A;  4IPA A;  2QEN A;  1MZB A;  4N0B A;  3KCC A;  2K4J A;  2DPU A;  2J5P A;  2EB7 A;  2Z9O A;  2EV6 A;  2E1N A;  2HTJ A;  1HKS A;  4R8H A;  4IRG A;  2VC1 A;  4Y17 A;  3BRO A;  2M8E A;  1YG2 A;  1DUX C;  2RKH A;  2GAU A;  4BHC A;  1OPC A;  2QM3 A;  2D45 A;  1UFM A;  3BOQ A;  1RI7 A;  4DQ2 A;  4LMY A;  4UV8 A;  4G6Q A;  1V3F A;  4P5O A;  4IHT A;  2QQA A;  3WGH A;  3EYY A;  1LEA A;  2OAZ A;  1R58 A;  4U7D A;  4ESF A;  1QZY A;  2PEX A;  3IWF A;  2XRO A;  3F22 A;  4Z2Y A;  3IKV A;  2V79 A;  2RN7 A;  4BH9 A;  4I7H A;  4G94 A;  1R23 A;  2STT A;  3C1D A;  4HZF A;  2V1U A;  3IWZ A;  1O3T A;  2A6E F;  5HLH A;  2ZJ2 A;  1QBJ A;  4G8X A;  2R3S A;  2DAO A;  1Z6T A;  3WE2 A;  3I64 A;  2ZME A;  2W57 A;  2M45 A;  1JHF A;  4U0W A;  4YFX F;  3RI4 A;  1ZGJ A;  3Q9V A;  3RKX A;  1L0O C;  1S6L A;  4BNC A;  3GUD A;  1I5Z A;  3SFZ A;  4MQV A;  1RIO H;  1U5T B;  3IRQ A;  3KEO A;  4DNC A;  3DF8 A;  5LGT A;  5E1W A;  2ZKZ A;  3NEU A;  2DW4 A;  1F4K A;  2DLL A;  3WTY C;  1XSV A;  3WTZ A;  4TV7 A;  2EWN A;  4IRH A;  1FWZ A;  4YFN F;  1FOK A;  1ZAR A;  2QLZ A;  3ROU A;  3KLN A;  2Q8K A;  2L54 A;  1YS7 A;  5DYM A;  4ZZD A;  1MKM A;  2HYF A;  3ULQ B;  4LLG F;  1KA8 A;  1FBU A;  3DP7 A;  1FP2 A;  3WTW C;  4WXH A;  4XSX F;  2VT3 A;  4UUV A;  2P6T A;  4CZZ A;  1IXR C;  4L5I A;  1TW3 A;  4XRF A;  2BV6 A;  1U2W A;  1V4R A;  1YW7 A;  3W6K B;  2D1H A;  1BN5 A;  1FPQ A;  4FX4 A;  3RTR A;  3TKY A;  3AAF A;  2V6C A;  4LB5 A;  1R00 A;  3QU3 A;  5ILU A;  4Q47 A;  4HF1 A;  4YIF A;  4WCG A;  4MNU A;  2XAG A;  4QLC U;  3KP2 A;  3K9T A;  3KP4 A;  1U5T C;  3WTU C;  4S05 A;  3IC7 A;  2HZT A;  2ZNZ A;  5LHI A;  3PQK A;  3RIR A;  1YYV A;  3LQQ A;  2P8T A;  2L01 A;  2YR2 A;  3HRT A;  4HDU A;  2DPD A;  4HLY A;  3ELK A;  3ZMT A;  5JFR A;  1FP1 D;  1JE8 A;  2Y48 A;  1USS A;  1XGO A;  2DBB A;  4P55 A;  4ZZL A;  5K5Q A;  4ENM A;  3Q9S A;  3I0T A;  1ZYR F;  5BOX A;  1YW9 A;  1S7O A;  5L3B A;  1UHM A;  4FX0 A;  5D8L B;  2ZXJ A;  2WWY A;  2QBY B;  1ZRF A;  1VTN C;  4WK8 F;  1T2K A;  2MH2 A;  3WTX C;  1DP7 P;  1IF1 A;  3FWE A;  1IN7 A;  1XMK A;  4OU0 A;  3KP6 A;  1WSU A;  2EFQ A;  3VEP A;  3EUH A;  4A0X A;  4RS8 A;  1NHA A;  5D5U B;  3REO A;  1P92 A;  4CHU A;  3ML6 A;  5HDK A;  2PG4 A;  5AIQ A;  2O3F A;  3VB2 A;  5CVU A;  2QWW A;  3DKW A;  1RUN A;  4ESJ A;  4HBL A;  1GHC A;  5KK1 A;  2VOP A;  3GW2 A;  1FBS A;  1XMA A;  2XAF A;  4ON0 A;  4RB2 C;  2HQR A;  4U0Y A;  4LG0 B;  1G6N A;  3KEQ A;  3L2C A;  3IRR A;  2M5W A;  4A0Z A;  1AWC A;  2CFX A;  2ISZ A;  2A61 A;  3J80 Z;  1I6X A;  4ENK A;  3K69 A;  3HRS A;  3BJO A;  1IXC A;  2FRH A;  5FGM A;  3JAM K;  2OD5 A;  2HFH A;  3JTH A;  2CSO A;  1P4W A;  3SQN A;  2A07 F;  2DQL A;  1R5G A;  4L0Z B;  4HAM A;  1FYK A;  2BBY A;  3V7S A;  1FYM A;  1G3W A;  3JAM Z;  1B59 A;  1XN7 A;  4YFK F;  3DXJ F;  3EET A;  4HQM A;  3HIF A;  3K1M A;  2FU4 A;  3G73 A;  1XGS A;  2P7C B;  3T0Y A;  2QVO A;  4GXO A;  2CWE A;  4Q48 A;  2VC0 A;  4R79 A;  3F8B A;  3QU6 A;  4EM0 B;  2L3D A;  2H94 A;  2HKX A;  1DPU A;  1YS6 A;  2DQR A;  3LQR A;  2V1D A;  2VT2 A;  2Z5U A;  3V7C A;  4HF2 A;  4L9N A;  5D8K B;  4M73 A;  1SFX A;  1BOA A;  3EDP A;  1WRJ A;  1R1V A;  3F3X A;  1O3S A;  1MGT A;  3SHF A;  3LA3 A;  1K78 A;  1J9I A;  1OKR A;  1BC8 C;  4OIR F;  1QPM A;  5F6F A;  3TDZ C;  5LEJ A;  2DT5 A;  3HOT A;  4HQE A;  2VXZ A;  4I09 A;  2YPR A;  2M30 A;  2OZU A;  4A6E A;  1J5Y A;  2P5K A;  3BP8 A;  4MTE A;  1A04 A;  1LEB A;  1P4A A;  5D5X B;  2O03 A;  2E7W A;  5ILV A;  4KMF A;  4HV5 A;  3KZY A;  5DCM B;  3HSF A;  1Z7U A;  5J6X A;  3CTA A;  1KYZ A;  4I2O A;  4EJT A;  3W6J B;  2FE3 A;  2CGP A;  2CQK A;  3DEU A;  1SFU A;  1Z6R A;  2STW A;  2IRF G;  2VN2 A;  3TOA A;  3VOD A;  3I58 A;  3I4P A;  4HOB A;  2W25 A;  2NNY A;  2P5L C;  2ESH A;  3FHZ A;  1HBX G;  1IN6 A;  4ASN A;  1IN4 A;  3I5U A;  1YTY A;  4CGZ A;  2JZY A;  1CF7 A;  4EV0 A;  3KP7 A;  2EJR A;  1BJA A;  4U0V A;  1X3U A;  2EA4 A;  1KGS A;  5HDG A;  4I0A A;  3TDU C;  1BI0 A;  2OQG A;  4NHJ A;  1B9M A;  3SZT A;  1EH8 A;  5LGN A;  3FF5 A;  3M7G A;  5LGU A;  2RDP A;  2DU9 A;  4KDP A;  4KIG A;  4ETS A;  4EJW A;  1WWX A;  3R60 A;  2EV0 A;  3D0S A;  3FM5 A;  4XSZ F;  2H09 A;  2XKO A;  3WG9 A;  5HDN A;  2XVC A;  2Y75 A;  3BJA A;  4I0B A;  2CG4 A;  3R0A A;  2F5E A;  2Q2E A;  5BMZ A;  1IXS B;  3KET A;  1EH7 A;  4G9Y A;  1IN8 A;  1G3Y A;  1QQI A;  5FFZ A;  3R4K A;  2QQB A;  4WXD A;  1WKM A;  2KJB A;  3ZMS A;  4EJU A;  5LHH A;  4A5M A;  1FC3 A;  3RDI A;  2MA3 A;  5CVJ A;  5CYV A;  5AON A;  2RC4 A;  2A68 F;  3QP5 A;  2F5F A;  4E70 A;  4AD9 A;  3OOP A;  4ESB A;  1O7L A;  2WC2 A;  2KIU A;  4O5V A;  5ICF A;  5LLQ A;  3ECH A;  4GGG A;  4CXF A;  5LEK A;  2H6B A;  1D8K A;  1PP7 U;  3JSP A;  3GLX A;  5HS9 A;  1FYL A;  3I53 A;  3FMR A;  2VOO A;  3P9I A;  3TO6 A;  3T8T A;  5E1Z B;  1TQP A;  3EQL F;  4HLX A;  3ZP5 A;  3G3Z A;  2OU2 A;  2EFN A;  3RKW A;  2R7F A;  1B4A A;  4U88 A;  2WV0 A;  3LST A;  3F6O A;  3LAJ A;  5CVI A;  4JK1 X;  1J0R A;  3SZP A;  2IJL A;  3L7W A;  5DUI A;  1L3L A;  4HYE A;  2O6G E;  3FX3 A;  3U2R A;  4I01 A;  4H0E A;  3F8N A;  2G7H A;  1MDM A;  3L00 A;  2XIG A;  1FBQ A; 
#chains in the Genus database with same CATH topology
 3WOD F;  5BQT A;  3G1M A;  3PUB A;  1R1T A;  1YQA A;  4EJV A;  1YX3 A;  3U21 A;  3C2H A;  1XC5 A;  4EGY A;  1ODD A;  4UHT A;  4IRI A;  3I54 A;  3MEX A;  2UXX A;  5E79 C;  2UZK A;  5HOO A;  2XHK A;  1Z05 A;  2W24 A;  2LSO A;  1T39 A;  1Y1V J;  2Q0O A;  3KE2 A;  4Y13 A;  3ABL H;  4IX7 A;  3NWT A;  3VPR A;  1S72 I;  2ZXH A;  5TJJ A;  3ABM H;  3KZI C;  3DU5 A;  3K4J A;  1YJ9 I;  1ETW A;  3C3W A;  2JK3 A;  4LK0 F;  1KQ8 A;  5LHG A;  5EEA A;  1HXD A;  4O3M A;  2FXA A;  3ESW B;  3OYL A;  2NRA C;  5F27 A;  3WTT C;  4E7K A;  5J8C A;  2MLG A;  3QRF F;  2B7E A;  3HJE A;  3HRU A;  2KMU A;  4M3G A;  2FF4 A;  3O8H A;  2ECB A;  3M8J A;  1W5T A;  2V9P A;  3QQA A;  2MD5 A;  3M9A A;  3G2B A;  4MGR A;  4EQQ A;  1LB2 A;  3H9G A;  1U8B A;  1R36 A;  2FSW A;  1BI3 A;  5DCM A;  2FA5 A;  1UEL B;  2HQN A;  3T5X A;  3VSL A;  4BJ5 C;  2NXN B;  2BW3 B;  4ZDL A;  2QF7 A;  1W4M A;  1WJE A;  2M34 A;  2HXI A;  2JMW A;  5IYB J;  4A3G J;  2O61 A;  2BXY A;  4L18 B;  1V5G A;  4GYI A;  2EFP A;  5H20 A;  4II3 A;  3KEY A;  3M1E A;  3K10 A;  1OR7 C;  3HTS B;  3ERE D;  4PDK A;  1XPX A;  1P2F A;  2E2I J;  1KYW A;  1X1P A;  2VKD A;  3CC4 I;  4UXN A;  3IP4 B;  3QPL A;  5D4R A;  3L9F A;  3ZMZ A;  1I50 J;  3JW4 A;  1UCR A;  5E8G A;  3BPX A;  3GTG J;  1R1U A;  1BL0 A;  4UB8 C;  1SFK A;  2FUG 2;  2YSR A;  3FIW A;  2G0E A;  2VKV A;  1ETO A;  2XB0 X;  2N8G A;  1JGG A;  3RSN A;  2BZT A;  2FD5 A;  4B09 A;  1R6R A;  2OQR A;  5EEG A;  2M4K A;  3SYT A;  1TNT A;  1Z0X A;  3SEQ A;  3ZR8 X;  2WTE A;  3F8C A;  5M3M J;  4ENJ A;  1ZR4 A;  1H88 C;  4YG2 F;  1F43 A;  5KCM A;  2AXT C;  2VQC A;  2W4S A;  2XF5 A;  3RPU A;  2Y0M A;  1YFH A;  3CDH A;  2CH0 A;  2L2O A;  5M5X J;  2CYY A;  4M9S A;  3CJT B;  1MNE A;  1U6G A;  2DFI A;  1O7F A;  2EQR A;  5IT3 A;  2UWM A;  3BJ6 A;  3H35 A;  5IYC J;  2EIN H;  2HI3 A;  4L9T A;  4RB3 C;  3FXU A;  1ZKG A;  1WJ5 A;  2ZJQ F;  1D5Y A;  2E7X A;  3LSI A;  1ITY A;  4N9I A;  3HDD A;  2CUF A;  2NVT J;  3M1C A;  2PJP A;  3DQV C;  2OJE D;  1KON A;  4BAY A;  3E5X A;  3FM3 A;  3GTQ J;  1TLH B;  5IP9 J;  3OYM A;  1MDM B;  3A01 A;  2FNP A;  1MBJ A;  2ELJ A;  3MKW B;  1FTT A;  2WY8 Q;  3GBG A;  3NQO A;  1OLT A;  3SJM A;  1VZ0 A;  3N4M A;  2CW7 A;  1Y1W J;  2YX7 A;  1Z1D A;  4Y15 A;  4L5E A;  2A6H F;  4K2E A;  3IAM 2;  2HKO A;  1BA5 A;  3B6A A;  3V8K A;  4BQA A;  1IAW A;  3MWM A;  5IY5 H;  4D5F A;  1T6S A;  5F1R A;  2QKL B;  3E5U A;  1OYI A;  4UVC A;  2VXD A;  2ID3 A;  1QVT A;  2IAI A;  1SD4 A;  2HPI A;  3QPH A;  3J81 K;  4B48 A;  2DA5 A;  5K1Y A;  3SZG A;  1TQM A;  3HYI A;  1O3Q A;  4XIC A;  3E7L A;  2X4H A;  3ZQQ A;  4IZZ A;  2GXA A;  2ESN A;  3U9G A;  2LF7 A;  1QZZ A;  5AIP A;  2DMT A;  3ECO A;  2ECC A;  2LBF B;  3DBL B;  4Q4Z F;  3IL2 A;  2W84 A;  3C18 A;  4NQW A;  1TL8 A;  1CGP A;  5BS6 A;  2WAF A;  3LSJ A;  3RZO J;  5TIS C;  4M9Z A;  4A3B J;  3LSP A;  1GVJ A;  5EF6 A;  5FB2 A;  4DYR A;  1OCC H;  2LNB A;  5ED4 A;  1WI3 A;  3HM5 A;  5H6R A;  1JHH A;  1MMA A;  3CCV I;  3V7R A;  2MG4 A;  2IS2 A;  2X85 A;  2ID6 A;  4RM3 A;  2JSC A;  1FJL A;  2XAQ A;  2XGC A;  1TTY A;  1BC7 C;  2OBP A;  5HLG A;  1Y56 A;  1P9Q C;  2ZSH B;  3GTK J;  1D8J A;  3FXR A;  2K9Q A;  1R7J A;  3K0L A;  4NC8 A;  4HV6 A;  3RKY A;  3HKZ N;  3ERM A;  3WGG A;  4LG0 A;  1HW2 A;  2YU9 J;  3KLO A;  4B47 A;  1IRG A;  3FDY A;  4L5J A;  1MND A;  3GZ5 A;  4P9F A;  1V5E A;  1WH5 A;  3TOB A;  4ZDP A;  3DLL F;  1K7A A;  3P7N A;  2IPQ X;  3K2Z A;  1DP3 A;  2D1V A;  3RZD J;  4RMN A;  2XAJ A;  4A5N A;  2LOO A;  3K70 D;  1ERD A;  1R5H A;  4L9J A;  1TWA J;  4F7Z A;  1G2H A;  1N75 A;  5D6F A;  4AVP A;  2VE9 A;  2HPM A;  1SFE A;  3PNY A;  2XPU A;  3ZQH A;  3HOV J;  2P6S A;  5FRO A;  1BI1 A;  2CO5 A;  5B5E C;  2Z33 A;  1UMQ A;  1ZRE A;  5M5Y J;  2CW0 F;  1X58 A;  3DV8 A;  5K5O A;  4UNO A;  2KRF A;  2R0Q C;  1Z21 A;  2K9N A;  4W97 A;  4AIK A;  5IT9 Z;  1H0M A;  5FO5 A;  1CF7 B;  3B6C A;  2MGQ A;  1OFC X;  4OAY A;  2GXB A;  3FKJ A;  4IHS A;  3GFJ A;  3FBI B;  4WWC A;  3ZPL A;  4CCK A;  2KDZ A;  3ZQL A;  2JPC A;  2R5Y A;  4CYC A;  1MIJ A;  4KN4 X;  1ACI A;  2I10 A;  5E3N A;  4ZTJ A;  1X4O A;  2ZFW A;  3TO9 A;  1K61 A;  2RGV A;  3LA7 A;  2L9S A;  3BZK A;  1MBK A;  2MC3 A;  1F9N A;  3CUQ C;  5J4V A;  5ILS A;  4RGR A;  3E6B A;  3HUG B;  3BG6 A;  5EEH A;  2JTV A;  2ZME B;  2QQ8 A;  1HOM A;  4PJM A;  4QSH A;  4BQO A;  1P6R A;  1X1C A;  2GOM A;  1FSE A;  3I71 A;  5E20 A;  5JLW A;  4ZC3 A;  3IKT A;  2EA2 A;  3H1C A;  1R22 A;  3QWL A;  4XID A;  5FJ8 J;  3GO5 A;  1E0E A;  4UB6 C;  3B73 A;  3W2A A;  3MD2 A;  5F64 A;  1OCP A;  5D5V B;  2LFB A;  2OTJ I;  5GPA A;  1TT5 B;  1JI8 A;  1BIA A;  3ZN1 A;  4FHT A;  4Y7N J;  1G8X A;  3H3Z A;  4M3D A;  2JPB A;  4BHP A;  4KYW A;  2MBF A;  2JJ7 A;  1B8I B;  1EJ9 A;  1XCV A;  3BPV A;  4Q5S F;  4C3J J;  3E1S A;  3ABU A;  3CO6 C;  1QO0 D;  4UUS A;  3I59 A;  1FX7 A;  4M3F A;  2L7K A;  3NRV A;  1VQO I;  2GM4 A;  2XRN A;  1PUF A;  1Y0N A;  1IZ1 A;  2AQF A;  3I59 B;  2Q2E B;  1EF4 A;  2E5N A;  3MKZ A;  3RYP A;  2O8K A;  5F0H A;  1F5T A;  4A3I J;  2V9V A;  4AID A;  1RES A;  1QU3 A;  5FD5 A;  4C3I J;  4BUP A;  5J47 A;  4IVN A;  2GOX B;  2NYX A;  2IGM A;  4FTH A;  1S29 A;  4GO1 A;  4MFD A;  3KP5 A;  1UB9 A;  1I39 A;  3FZV A;  2KL4 A;  2DMQ A;  1KU3 A;  1NK2 P;  2FOK A;  1XGN A;  3O6B B;  2M87 A;  5IOZ A;  2Q1Z B;  4RA2 A;  3DKX A;  1Z91 A;  4MHG A;  4CIC A;  2ELH A;  2LY1 A;  1YIO A;  2Z99 A;  3FBN B;  2ADU A;  1ETV A;  1H8A C;  2P7V B;  5DD4 A;  5F1J A;  4BQQ A;  4MEY F;  2VPL A;  4OIO F;  5IP7 J;  3BCB A;  3S2W A;  3OYC A;  1FNN A;  2HVS A;  3B02 A;  2DYR H;  1LDJ A;  4CYD A;  4WF2 A;  3K4M A;  3OYG A;  3K4L A;  3MZY A;  4P9U A;  2EK5 A;  1J2X A;  4JYK A;  1XSD A;  5E1X A;  2VKE A;  1WJF A;  3TMO A;  3OYF A;  4NC7 A;  1MD0 A;  4RAF A;  4QTR A;  2BVL A;  2X48 A;  1IN5 A;  2YS9 A;  1PUE E;  1QA6 A;  4IL6 C;  2CQ7 A;  2OPT A;  3E0J B;  3GX4 X;  2GXG A;  2CRG A;  5J1Y A;  1RKT A;  3MCZ A;  4LLL A;  2LDU A;  4E7Z A;  2XKP A;  4BYY A;  2E2J J;  2R7U A;  5CVV A;  5KHD A;  2DOD A;  2XSJ C;  3GTM J;  1S8N A;  4XMY A;  2FBI A;  4ZH4 F;  2DJI A;  4IJA A;  5JVG F;  2OA4 A;  3PUF A;  3CCQ I;  5E8I A;  3H36 A;  2KIF A;  2HYG D;  1BM9 A;  4KUM A;  3LFU A;  2ETH A;  2OZ6 A;  3AG2 H;  1ZG3 A;  3C2G A;  1REP C;  4JBA A;  1Z3X A;  2XPV A;  1YI2 I;  2F5D A;  4AIH A;  1JJ8 C;  3GVA A;  1IDZ A;  3ZMU A;  4G6D A;  2MD0 A;  4CCN A;  4CH7 A;  4OIP F;  1KU2 A;  3OS0 A;  1MJA A;  4CCL A;  4G6T B;  3DBR B;  4KIF A;  2X6Y A;  5DD8 A;  1U8R A;  3D5L A;  3RQI A;  4E6K G;  2PI0 A;  1B1B A;  3IHU A;  4A3L J;  1KQ9 A;  1OJL A;  3ZQC A;  1W5C C;  2RNG A;  2XDV A;  5D4S A;  5EG0 B;  3HOU J;  2GA1 A;  5E3M A;  1R71 A;  2HWV A;  4PJJ A;  4BHB A;  1XDU A;  4XLC A;  3ZN0 A;  1XD7 A;  4Y3O A;  2FML A;  4NNJ A;  2M1B A;  3E97 A;  5EJC A;  2NAZ A;  5LD2 C;  3WHC A;  2TDX A;  5FRM A;  3ZMD A;  2DMP A;  4A6D A;  2K9L A;  1XX5 A;  3K1P A;  3EUH C;  1TQI A;  3CP2 A;  1ETY A;  3V8J A;  1O4X A;  4CDG A;  4DZP A;  1AU7 A;  2VBW A;  1ZHF A;  1LNW A;  2DTR A;  3LSR A;  2F5V A;  2EZH A;  3ZQG A;  3JRI A;  3ABT A;  2JA5 J;  2K7L A;  3L2W A;  2E1M C;  4RGS A;  4V2G A;  1PYV A;  3GLL A;  5F0F A;  4KT5 C;  2O8X A;  1XCB A;  4M72 A;  1ULY A;  1J75 A;  1VQ6 I;  4OMY A;  1AKH A;  4LK1 F;  3K70 C;  2V1X A;  5LBQ A;  3QYF A;  2BW3 A;  5HS7 A;  2E5Z A;  4A3C J;  1OCR H;  4MLO A;  4PGG A;  3PQJ A;  2E35 A;  2GZW A;  2PMU A;  4PFO A;  2O7O A;  3M3Y J;  3T8R A;  1NG6 A;  4HA8 A;  1TNS A;  2E1C A;  4S0H B;  1VQ9 I;  3OYA A;  1Q1V A;  1RR8 C;  1JKO C;  2OTL I;  3SXY A;  2R92 J;  3L2V A;  1F1Z A;  2CUE A;  4EM2 A;  4BY1 J;  2QGU A;  2ZCW A;  5DUK A;  2JA8 J;  4RB0 A;  2XAU A;  2P4W A;  3HGG A;  2VBX A;  3CUQ A;  4ZYE A;  3S3N A;  1W36 D;  1R5I D;  2LRE A;  4AIJ A;  2LLK A;  5JR3 A;  1OMI A;  1JTX A;  2EIJ H;  1T0F A;  1W1W E;  2D2W A;  2L02 A;  1BBY A;  1XB4 A;  2R7D A;  4F93 B;  1ZR2 A;  5FRN A;  4BL0 B;  1HW1 A;  1E17 A;  5K7Z A;  1U78 A;  2HDC A;  3FIS A;  3ABK H;  3GFM A;  4O6J A;  1DPR A;  4LB6 B;  3TBI A;  3E6C C;  3HL2 A;  4CUG A;  3FXJ A;  4F91 B;  3AL0 C;  2MFZ A;  1NK3 P;  3WTV C;  4PZJ A;  2L9V A;  4HW0 A;  4WXC A;  4M6X A;  1LDD A;  4U7B A;  1PJR A;  2Y0S A;  1WPK A;  1ZRC A;  2GWR A;  1RC9 A;  1ZTR A;  4I6Z A;  1W0U A;  4G7O F;  2BY3 A;  1FTZ A;  3HKZ A;  2DN0 A;  2LKX A;  4KIC A;  3WGI A;  2BE5 F;  2PLY A;  3K4C A;  2AS5 F;  4XLH A;  2LY2 A;  3HUG A;  4LFU A;  1BIB A;  1WJB A;  4GRI A;  3OSF A;  3RJP A;  2BYV E;  3GYH X;  1HCR A;  1LPQ A;  3CQZ J;  3WU0 A;  1E2X A;  1FOX A;  4J00 A;  4HX8 A;  3RPU D;  1I1S A;  1VQ8 I;  3BWG A;  4UV9 A;  1XDS A;  4HX4 A;  4ZYD A;  4BXX J;  2R5Z B;  1D0Z A;  5HLI A;  4B3A A;  2H27 A;  3IH4 A;  3PJR A;  2ZO4 A;  3H3U A;  3HTU A;  4Y4R A;  4F92 B;  2VIX A;  1IUY A;  1V5F A;  3EPZ A;  5E18 F;  1JKQ C;  1FT9 A;  1OYY A;  4KIB A;  2XC7 A;  1UAA A;  4BBR J;  1MBG A;  5FLX Z;  1IW7 F;  2WA0 A;  1ZG5 A;  2K27 A;  2L7M P;  1S3J A;  1HKQ A;  2BEO A;  2G7U A;  1D1B A;  1EH6 A;  4I02 A;  4C9Y A;  3W3C A;  1VQN I;  1HKT A;  3WU1 B;  2FQ3 A;  3PFI A;  3SFI A;  3MN2 A;  3LFK A;  1ZGA A;  1WJD A;  2DMN A;  5FKL A;  4G7H F;  1K79 A;  4A2U A;  1VQ7 I;  2CQX A;  3MVP A;  2RV8 A;  3QYE A;  3LL7 A;  3DWL E;  4C2U A;  3E6D A;  2LF8 A;  3GFL A;  3HBL A;  2COM A;  2E36 A;  3IV5 A;  2ZFU A;  2M9H A;  3TQN A;  2HNH A;  2NVY J;  3WE3 A;  2IA0 A;  2YU3 A;  2GIV A;  4ENN A;  1QZE A;  2A3S A;  4DBQ A;  2L5Q A;  3GFI A;  3HOS A;  3GZ6 A;  4PJL A;  1LJ9 A;  1X3W B;  4BY7 J;  3F72 A;  1MBE A;  1T56 A;  2LMD A;  3BTC A;  1ZAO A;  3PO3 J;  4RAZ A;  3BR1 A;  1SD7 A;  3Q0W A;  3BTI A;  3PL8 A;  2VON A;  3CZ6 A;  4NDL A;  3JSO A;  2DFF A;  3VOE A;  5J4Y A;  3S1R J;  2DJN A;  4OMZ A;  2EV5 A;  5C4X J;  1A6I A;  2K86 A;  3CCY A;  3CMA I;  1A35 A;  3MAJ A;  3F8F A;  1STZ A;  3CCM I;  2MYS A;  1XMX A;  1GV2 A;  2NS7 A;  3ZOB A;  3NAU A;  3DFG A;  2LKP A;  3OYK A;  1ON1 A;  4XLA A;  3WG7 H;  3DPU A;  3ZCO A;  3H5A A;  1E3P A;  4WX9 A;  2HGC A;  4KMU X;  3FMQ A;  2VBZ A;  1S7E A;  1RRJ A;  2V7F A;  4KT6 A;  2QZ8 A;  3A02 A;  2VJ4 A;  2IGN A;  5FD6 A;  2OCC H;  4KJZ A;  4H4K C;  1D1A A;  1R49 A;  1QNT A;  1O3R A;  4CO8 A;  4A3J J;  2XB5 A;  1BR1 A;  2PBI A;  4FQG A;  3GXO A;  2JN6 A;  2YX4 A;  3TL4 X;  2PJR B;  1B6A A;  1RET A;  5EZG A;  1K83 J;  4KNY A;  3PIO F;  2JUC A;  4MQ9 F;  4B43 A;  2K4B A;  2NVX J;  1RZ4 A;  1AA7 A;  5JHF A;  5FLX K;  3CF5 F;  1LVA A;  2R5Z A;  1R4M B;  1ZEL A;  3H9Q A;  2XPW A;  3CJR B;  4GYG A;  3CO7 C;  2HS5 A;  5TGT A;  3TED A;  2IT0 A;  1U3E M;  1WJC A;  2VJ5 A;  3FKI J;  3OIQ A;  4IXA A;  2VQH A;  1S5L C;  2DTZ A;  1I3A A;  2XGD A;  2YUS A;  3CLQ A;  4RM2 A;  4XLN F;  3QOD A;  1ETQ A;  3KP3 A;  5L3F A;  5D5W B;  2E71 A;  2MAB A;  1IDY A;  2O9L A;  3WTS C;  4NB5 A;  3OS2 A;  1PP8 F;  2VKH A;  4Y52 J;  1IV8 A;  1JXS A;  3E3V A;  2GIZ A;  4ZDO A;  5L3E A;  1GXQ A;  4UVB A;  1HSJ A;  3KZZ A;  1QPI A;  3JCU C;  2NOG A;  3P9K A;  1B9N A;  3DPL C;  2KRH A;  4BE0 A;  2LBF A;  2QSG X;  2LTP A;  2WV1 A;  3HHH A;  4UY8 I;  3HOX J;  2DO7 A;  1X1A A;  3F6V A;  2ISY A;  3MMY B;  1K4T A;  3QOP A;  1QGP A;  2FEZ A;  1X1D A;  1ZN2 A;  2F5C A;  3CCE I;  1NH3 A;  3C7J A;  3HSE A;  4JX4 A;  4PUS A;  5DDG A;  2IVM A;  3OOU A;  2HDW A;  3BG5 A;  4AWX B;  4A0Y A;  2IS1 A;  4IHV A;  1T98 A;  1HQC A;  1W7P B;  1G3S A;  2NS0 A;  4M6Y A;  4IF4 A;  3HHG A;  2VOD A;  1S7A A;  4KFC A;  3EYI A;  1LFU P;  2LR8 A;  5EGO A;  1MW7 A;  1WI9 A;  4D5C A;  1AHD P;  4A3M J;  4GCV A;  2FNA A;  1O57 A;  2D5V A;  5DTD A;  2F2E A;  3FK6 A;  3F23 A;  4NQW B;  3O3K A;  2R4G A;  3H92 A;  5J3L A;  2FBH A;  1W5S A;  1VI0 A;  4BJT A;  4XRS G;  2J5O A;  4BDY A;  3DPT A;  2R7R A;  1M1E B;  2BGC A;  1Z3Y A;  1A36 A;  4PCQ A;  4AM3 A;  4XKC A;  4EM1 A;  3L2U A;  3PFY A;  3S93 A;  4MTD A;  3CUO A;  1FIP A;  4IEJ A;  1SD6 A;  4D0P A;  2WB1 N;  3COA C;  1G4D A;  1U9O A;  4FE4 A;  3F9K A;  1HST A;  3M8F A;  2PMZ N;  2HTS A;  3I4N J;  5E17 F;  3CLO A;  2A5Y B;  3ZMV A;  3SDG A;  1HF0 A;  2PFB A;  2XAH A;  3CCJ I;  2I8D A;  1UG2 A;  1UST A;  3LAP A;  1Y0U A;  1YW8 A;  2HQ5 A;  5EYR A;  4M74 A;  4XN0 A;  3BZ6 A;  1P7J A;  1X2M A;  2W00 A;  4HSR A;  2ZJR F;  1JUS A;  1KU9 A;  1HC8 A;  1ETK A;  3IH3 A;  2QA4 I;  5ERI A;  4CZC A;  2R5Y B;  1Z9C A;  4DOZ A;  2NNN A;  4XKV A;  1MMN A;  5FKN A;  5ICG A;  3QPT A;  1H9T A;  5CVR A;  1UZC A;  4IQ4 A;  4KA4 A;  4NUB A;  2KIM A;  4BDZ A;  2Z3Y A;  4C30 A;  1MBH A;  4G7Z F;  1T38 A;  4S04 A;  1MJB A;  4BS9 A;  1OYW A;  2GA2 A;  4YRV A;  4CCO A;  4HDV A;  5HNH A;  1TWG J;  2JRT A;  4XBF A;  3CC7 I;  3AL0 B;  1GVD A;  3J80 K;  1FY7 A;  1JTY A;  4R1H A;  4BEH B;  2VQG A;  2XUB A;  4BEH A;  4YII A;  1Y6I A;  1IV6 A;  1ZLK A;  3JTG A;  2KKO A;  3BDD A;  1P4X A;  4XK4 A;  3AKZ A;  3H5N A;  1ONV A;  4FIS A;  1RNL A;  4PSX A;  2XAS A;  5L3D A;  2EZK A;  2QEX I;  1LUJ B;  3RKQ A;  5DV5 A;  1FMV A;  4BXF A;  1MSE C;  4CA0 A;  3I56 I;  4AYB N;  3R61 A;  5BPI A;  5TRD A;  2B63 J;  4JX6 A;  3E6M A;  5DEQ A;  3W6V A;  1OCZ H;  3OWT A;  4OOI A;  3V4G A;  1DDN A;  1AOY A;  2OCE A;  5L3C A;  2A69 F;  5M5W J;  2IGO A;  3G1L A;  4W1U A;  3L2Q A;  3LOC A;  3ISP A;  2C6Y A;  2VJJ A;  2DK8 A;  3GF2 A;  2QQ9 A;  2DDB A;  1SAX A;  1AKH B;  3CES A;  4RAY A;  1RPW A;  1D3Y A;  2BOL A;  2E1M B;  2CQN A;  2F4O B;  2HVR A;  1W7P A;  2W48 A;  5J8F A;  3R0J A;  1KQ0 A;  1ON2 A;  2ZJP F;  2E60 A;  1SMY F;  1K6Y A;  1D1C A;  1HW5 A;  5CLS A;  2UUZ A;  3J7A O;  2FX0 A;  4LJZ F;  3S1N J;  1HA8 A;  4DIQ A;  1I6H J;  3KYD B;  3OR2 C;  2PN6 A;  3CME I;  2DA4 A;  3S3M A;  5L3G A;  3PNT A;  3HRM A;  3TP3 A;  1K78 B;  2ICW G;  2CW8 A;  3W2V A;  1TWH J;  2LC2 A;  2AO9 A;  1YLF A;  2CU7 A;  3OR1 C;  3FHN A;  3JRD A;  1ZGW A;  2QCO A;  3Q3S A;  3JRE A;  2GQQ A;  1SD5 A;  1XSX A;  3ZXS A;  3SDB A;  2EIK H;  1TBX A;  3MZH A;  1ZRD A;  5KAF C;  1Y39 A;  4BXU A;  4L0Y B;  3HGY A;  3BY6 A;  5IYD J;  6PAX A;  2Z2S B;  3HPG A;  5LRR A;  3S8P A;  3KPH A;  3G1O A;  1VQP I;  2G9W A;  1C0W A;  4EMS A;  5B3S H;  1I1G A;  4U87 A;  2JT1 A;  2P81 A;  4RGX A;  4M3B A;  3VFZ A;  3TW6 A;  3CCS I;  5D6E A;  2L4M A;  1DU0 A;  1YX5 A;  2RVC A;  2ZNY A;  1OR7 A;  2DK5 A;  3VYS B;  1J59 A;  4MEX F;  3LSH A;  1X4P A;  5F04 A;  1ZH5 A;  4NBQ A;  3IH2 A;  2HR3 A;  2DI3 A;  5FFX A;  4OIN F;  4M9X A;  3RYR A;  4E7H A;  4IHX A;  2P5V A;  2K3F A;  4HX7 A;  1KZH A;  4E4H A;  2HOE A;  2JVG A;  5F0C A;  2K02 A;  3LA2 A;  4CCM A;  3QP6 A;  4RGU A;  3FMS A;  4A3K J;  3TW7 A;  3JRG A;  5KVR A;  1IJW C;  2X1C A;  4A12 A;  1JGS A;  3J81 Z;  4EJO A;  2LP0 A;  2PQ8 A;  2X1E A;  2CV2 A;  2QBY A;  4LLN A;  1ZLJ A;  1OCO H;  2HYJ A;  3HZJ A;  3TP0 A;  4XKB A;  2EFO A;  5ICE A;  4N4N B;  4JQF A;  1VQ4 I;  1IRF A;  3S3O A;  3K1N A;  2CUZ A;  5JLX A;  2M8G X;  1U5T A;  2F6C A;  2DA7 A;  3LWF A;  5KAI C;  2ZSI B;  1MJ9 A;  2IW5 A;  3F8M A;  4LOC A;  3U1D A;  4AU7 A;  4XLP F;  2R7V A;  1BR4 A;  2H1K A;  2FMY A;  1SMT A;  2ZME C;  1FIA A;  4ZYH A;  1PUF B;  2IA2 A;  4XOR A;  2VBY A;  1YE9 A;  3CMY A;  1VQM I;  4DW6 A;  5LRS A;  4P96 A;  5HS8 A;  5IT9 K;  5FKK A;  5GAG J;  5HVQ C;  3CCU I;  5JHU A;  4L9V A;  2IP2 A;  3FXK A;  5JI6 A;  2XSD C;  2W85 A;  1YRN A;  3K4K A;  4RB1 A;  4A3D J;  1YJN I;  3E5Q A;  3DTI A;  3GWZ A;  4JX5 A;  2KIQ A;  4LGW A;  4IKF A;  1JT6 A;  1PDN C;  3HXL A;  1JUP A;  2R7Q A;  5DCF A;  3BQY A;  1VFC A;  4CSW A;  3BT9 A;  4M71 A;  5H6Q A;  1FLI A;  3QAH A;  2XF6 A;  1IUF A;  2O0Y A;  2QYO A;  2XRL A;  3T1B A;  3ZQ7 A;  5BPD A;  3HSR A;  4P1W A;  5K5R A;  1T0F C;  1T8I A;  1WH7 A;  2B9S A;  2RQP A;  1NG7 A;  2VE8 A;  1WQ2 A;  2DT6 A;  3R6S A;  1JJ6 C;  4X0G A;  3FXQ A;  4UVA A;  3MFK A;  1G3T A;  3P9C A;  2MSY A;  1YO5 C;  5A2Q K;  2VI6 A;  3MQ0 A;  1N25 A;  1A5J A;  4ZYG A;  2QUF A;  2KRC A;  3CDI A;  3V8L A;  3TGN A;  1B72 B;  1D5V A;  3OYB A;  3WU2 C;  3DKY A;  4EVI A;  3SEZ A;  5F08 A;  3O2P E;  2ZBK A;  3D1N I;  1VND A;  2PMH A;  1YJW I;  4PJ0 C;  1W7P D;  2M4G A;  1E3O C;  3HC7 A;  3BZC A;  2KJC A;  4FT8 A;  3M8E A;  2UXN A;  2AXL A;  3L09 A;  2H6C A;  5A2Q Z;  4MO7 A;  5IPA A;  5K7H A;  4QPQ A;  3F21 A;  3GEZ A;  2B0L A;  3OV8 A;  1K6O A;  3S2H J;  2RQQ A;  3BTJ A;  1FZP B;  4HF0 A;  2FBK A;  2Y9Z A;  2V26 A;  1V54 H;  1EV7 A;  2ACJ A;  1UHW A;  1FSH A;  4KN7 X;  5GP9 A;  3N97 A;  4QWQ A;  4MFE A;  2ZB9 A;  4OIQ F;  1I27 A;  2MH9 A;  5GPC A;  1J7K A;  4A3E J;  3HG9 A;  2RNJ A;  4XKW A;  1YOV B;  1ZG1 A;  1V55 H;  2EFW A;  3CDL A;  1QVU A;  1WGX A;  2A05 A;  5ICC A;  2WY7 Q;  1SAN A;  3FXL A;  3Q5F A;  1KU7 A;  1RUO A;  4B8X A;  2XGX A;  2OUM A;  1GT0 C;  4PGH A;  2MLK A;  2XV4 S;  2L4A A;  3KFW X;  4BE1 A;  1POG A;  2O5R A;  3CUQ B;  3AG4 H;  1BI2 A;  2K9M A;  2R7T A;  4I76 A;  2HEO A;  4YIR X;  1TW2 A;  5JVT A;  1WCM J;  2X0L A;  3OSG A;  1SC7 A;  1XGM A;  1IRZ A;  1WFX A;  3RPQ A;  3A03 A;  1Q1H A;  4N9H A;  1U0J A;  1QRY A;  2IA1 A;  1H9G A;  2PX9 A;  5CJ9 A;  4CYC B;  4EGZ A;  3CJN A;  4I98 B;  1YIT I;  3TO7 A;  1LDK B;  3GTL J;  2E34 A;  4LD5 A;  1GXP A;  2FOW A;  4D9J A;  1NTC A;  1LQ1 A;  1T08 B;  4IPA A;  2QEN A;  1MZB A;  4N0B A;  3BR6 A;  1GDT A;  5FKO A;  3KCC A;  3BG9 A;  1QHG A;  2ZXW H;  2K4J A;  2DPU A;  2PJR A;  2J5P A;  2EB7 A;  1SEU A;  3MKY B;  4IHY A;  3JRA A;  3GTP J;  2EIM H;  4D1Q A;  1B8I A;  2QSF X;  3Q0U A;  2Z9O A;  2LK2 A;  4RDU A;  3JRH A;  2EV6 A;  2H8W A;  1ZK8 A;  2E1N A;  2FQ4 A;  2TCT A;  2HTJ A;  1HKS A;  4R8H A;  4IRG A;  2VC1 A;  4Y17 A;  1R9T J;  3BQZ A;  3BRO A;  3BR2 A;  4DBR A;  2M8E A;  2P0W A;  3K2A A;  1YG2 A;  1DUX C;  2EZI A;  2RKH A;  2GAU A;  4BHC A;  5LFA A;  1TC3 C;  1OPC A;  4OAZ A;  4XLF A;  3M4O J;  2DFE A;  2QM3 A;  1LVK A;  2I5U A;  1W36 C;  1VQK I;  2D45 A;  4OWR B;  3CC2 I;  1UFM A;  2IXS A;  3BOQ A;  1RI7 A;  1WZ2 A;  4XOT A;  4DQ2 A;  4LMY A;  4UV8 A;  3PIP F;  2BXZ A;  3FXM A;  4G6Q A;  4V2F A;  2KDO A;  4J01 A;  1G59 A;  3OY9 A;  1V3F A;  4P5O A;  3L2R A;  4IHT A;  2QQA A;  3WGH A;  1MMD A;  3EYY A;  1LEA A;  3HOW J;  2VAS A;  3QOE A;  2VL8 A;  2Y9Y A;  2OAZ A;  4G12 A;  1H89 C;  1BW5 A;  1R58 A;  3ASO H;  4U7D A;  3JRF A;  1DGW Y;  1I3Q J;  1RR7 A;  2VLA A;  4FCY A;  4ESF A;  1QZY A;  2WAE A;  2PEX A;  1J09 A;  1F36 A;  3IWF A;  2XRO A;  3IKV A;  4Z2Y A;  3F22 A;  2V79 A;  3DEW A;  2RN7 A;  1QHH D;  5HOD A;  3OIP A;  3LSM A;  2WBM A;  4BH9 A;  4I7H A;  4JOM A;  4G94 A;  1R23 A;  4HEA 2;  5CKT A;  3W2W A;  2CV0 A;  2STT A;  1FEX A;  3C1D A;  1P7I A;  4HZF A;  1RKW A;  3K4N A;  5KNL A;  3I4M J;  9ANT A;  2V1U A;  4PK4 A;  3IWZ A;  1O3T A;  2A6E F;  5HLH A;  2ZJ2 A;  1QBJ A;  3PNV A;  4G8X A;  1MH3 A;  2R3S A;  2DAO A;  2DOF A;  4XRS A;  1Z6T A;  5K7F A;  3WE2 A;  5DM7 F;  3I64 A;  2ZME A;  5M3F J;  2W57 A;  3H0D A;  4XM3 A;  3A01 B;  1E3H A;  2M45 A;  3PM1 A;  1TP4 A;  5GAE J;  3AFH A;  1JHF A;  3CCL I;  1Y8Q B;  3QPS A;  4U0W A;  4YFX F;  3ZRG A;  3RI4 A;  1ZGJ A;  3Q9V A;  3RKX A;  1L0O C;  2E19 A;  4X6A J;  4RLF A;  4A3F J;  1S6L A;  4RAG A;  4BNC A;  3FXO A;  3GUD A;  1HDD C;  1I5Z A;  2EZL A;  3SFZ A;  3VSK A;  2W7N A;  4MQV A;  2DCE A;  2HOA A;  1FOW A;  1RIO H;  5B1B H;  1DQU A;  2EIL H;  1U5T B;  3IRQ A;  3KEO A;  4DNC A;  4LG3 A;  4M3E A;  3DF8 A;  5LGT A;  4D7M A;  3I55 I;  2Y30 A;  5E1W A;  2LH9 A;  2ZKZ A;  3ZQI A;  3NEU A;  2DW4 A;  1F4K A;  2Y31 A;  3A0B C;  2DLL A;  3WTY C;  1XSV A;  4XRM A;  3WTZ A;  2WAQ A;  4TV7 A;  3OYD A;  2EWN A;  3ZQF A;  4BGD A;  2HXO A;  2DXI A;  4IRH A;  1FWZ A;  4YFN F;  1FOK A;  4AUX A;  2ZXI A;  3CMM A;  2CV1 A;  1ZAR A;  2QLZ A;  3ROU A;  3KLN A;  3KYC B;  2HVQ A;  3NWS A;  1APL C;  2Q8K A;  2X51 A;  2L54 A;  1YS7 A;  2L7F P;  5DYM A;  2E2H J;  4ZZD A;  3DTE A;  1MKM A;  2HYF A;  3S17 J;  3ULQ B;  2PMZ A;  4LLG F;  3L1P A;  4NC6 A;  1KA8 A;  1FBU A;  3DP7 A;  1FP2 A;  2Z1D A;  4MIM A;  3WTW C;  2X6X A;  2L0K A;  3BR5 A;  4WXH A;  4A69 C;  4JP0 A;  2IS6 A;  1ENH A;  2M3A A;  2XF7 A;  1XG1 A;  2A5W A;  1OQY A;  2VT3 A;  1UG0 A;  4XSX F;  1JT0 A;  1VQ5 I;  2LYC A;  2QSH X;  4UUV A;  1IC8 A;  1BR2 A;  1T95 A;  2P6T A;  3BG3 A;  4CZZ A;  3UNG C;  1IXR C;  3BLY A;  2JRM A;  2CFO A;  1JUM A;  1TT0 A;  1TW3 A;  4L5I A;  3DU6 A;  5EDN A;  3BR0 A;  4XRF A;  2BV6 A;  1X19 A;  2K40 A;  4F3Q A;  4XOP A;  4CCJ A;  5H2F C;  2M0M A;  1U2W A;  2DDA A;  2L9R A;  1V4R A;  1YW7 A;  3W6K B;  3S15 J;  3DTK A;  2D1H A;  5C4J J;  2ME6 A;  1BN5 A;  1FPQ A;  4FX4 A;  4DZJ A;  3DEE A;  3RTR A;  3TKY A;  3V42 A;  3AAF A;  2V9K A;  3K7A J;  5HNF A;  3K4B A;  4BJ6 C;  2V6C A;  4LB5 A;  4UUT A;  1R00 A;  3QU3 A;  5ILU A;  4Q47 A;  3LNQ A;  2OV7 A;  4HF1 A;  4YIF A;  4WCG A;  2KZG A;  3GME A;  1ORK A;  4MNU A;  2XAG A;  4QLC U;  3KP2 A;  3K9T A;  1SVL A;  2CS3 A;  3KP4 A;  3VYU B;  4ANJ A;  1U5T C;  5CPR B;  2EH3 A;  3WTU C;  4LIT A;  4V19 K;  4S05 A;  3CP8 A;  3IC7 A;  3OYH A;  1IO2 A;  2HZT A;  2ZNZ A;  5LHI A;  3IUO A;  3PQK A;  2ELK A;  1YYV A;  3RIR A;  3LQQ A;  4I99 C;  1X2N A;  2P8T A;  5GAH J;  2L01 A;  2YR2 A;  4HST A;  3HRT A;  4HDU A;  2DPD A;  3S1Q J;  4HLY A;  2DA3 A;  3ELK A;  3CF2 A;  3KX2 A;  3ZMT A;  2W82 A;  3O8G A;  1FP1 D;  5JFR A;  1JE8 A;  2A6T A;  2Y48 A;  5FKM A;  3VYR B;  2DOE A;  1WHU A;  3AG1 H;  1USS A;  1XGO A;  2DBB A;  4P55 A;  4ZZL A;  5K5Q A;  4ENM A;  1YIJ I;  3Q9S A;  2Y2Z A;  3D5S C;  3I0T A;  4Y33 A;  1VF9 A;  2HQA A;  2KIS A;  2X6O A;  3FK7 A;  3OYN A;  1ZYR F;  5BOX A;  1YW9 A;  1S7O A;  2GLO A;  3OS1 A;  2LRD A;  2RRE A;  1UHM A;  4FX0 A;  5L3B A;  5D8L B;  2ZXJ A;  2WWY A;  4HNT A;  1X3Z B;  2QBY B;  5C44 J;  3J7Z I;  1ZRF A;  4YEJ A;  1VTN C;  4WK8 F;  1T2K A;  2MH2 A;  3WTX C;  4RBO A;  1DP7 P;  2KLO A;  2F48 A;  4FE7 A;  3JRB A;  2VQL A;  2JVH A;  1IF1 A;  1Y8R B;  5GAD J;  4IHW A;  3FWE A;  1IN7 A;  1XMK A;  2LKS A;  4OU0 A;  2TRT A;  2IGK A;  2FJ1 A;  2IEK A;  2BHZ A;  2NOJ B;  3BC8 A;  3HPH A;  4BAC A;  3KP6 A;  2DA1 A;  3F0C A;  1WSU A;  4UUS B;  1MSF C;  3EUA A;  1BOB A;  3JRC A;  2EFQ A;  3VEP A;  3EUH A;  4A0X A;  3CJQ B;  4RS8 A;  3P5J A;  3HOY J;  2F4I A;  2KQR A;  2AQE A;  1Z67 A;  2W1O A;  1NHA A;  5D5U B;  1A31 A;  1MMG A;  1ETX A;  3REO A;  1P92 A;  2DMU A;  3ML6 A;  4CHU A;  5HDK A;  2PG4 A;  4IOA F;  2H1L A;  2O3F A;  5AIQ A;  3VB2 A;  5CVU A;  3S14 J;  4Z6Y A;  2QWW A;  2KT0 A;  3DKW A;  1RUN A;  2R93 J;  3J7A Y;  3G6E I;  4F55 A;  1OIS A;  3G4S I;  4ESJ A;  2VB6 A;  4HBL A;  2K85 A;  1GHC A;  5KK1 A;  4LIV A;  5C3E J;  2VOP A;  2BY0 A;  2HU9 A;  3GW2 A;  1FBS A;  3OYJ A;  1N78 A;  1XMA A;  2XAF A;  4LIU A;  4ON0 A;  4RB2 C;  2HQR A;  4U0Y A;  4PJN A;  1JKP C;  4LG0 B;  2R7X A;  2JUG A;  1G6N A;  2CMP A;  3KEQ A;  3Q0V A;  3UR3 C;  3L2C A;  3IRR A;  1YHQ I;  1LE8 A;  2M5W A;  4A0Z A;  1AWC A;  2CFX A;  2ISZ A;  3VWB A;  2KFD A;  2NVU B;  3WHB A;  2CQQ A;  5E3O A;  2A61 A;  1TWF J;  2CUJ A;  3J80 Z;  1I6X A;  4PFP A;  4ENK A;  2QKM B;  3K69 A;  3RCO A;  1XS9 A;  3HRS A;  2WAQ N;  2KHM A;  4BKX A;  4IO9 F;  3K6G A;  1SFO J;  1DGR M;  3BJO A;  3LMM A;  3GTO J;  1SAU A;  2RAE A;  1IXC A;  2FRH A;  5FGM A;  3JAM K;  2OD5 A;  2DFH A;  2HFH A;  3JTH A;  2CSO A;  4BE2 A;  1P4W A;  3SQN A;  1IG7 A;  2KPM A;  2A07 F;  2DQL A;  1MBF A;  3HEF A;  1R5G A;  3ONQ A;  4L0Z B;  5EG0 A;  3H3V K;  5B66 C;  4HAM A;  3ASN H;  4M6V A;  4AVZ A;  3VDX A;  2BBY A;  4B4C A;  3C2B A;  1FYK A;  1MNM C;  3V7S A;  1FYM A;  3IAS 2;  1D0Y A;  1G3W A;  3JAM Z;  1LKX A;  1B59 A;  1XN7 A;  4XON A;  4YFK F;  3DXJ F;  3EET A;  2ME0 A;  5FLM J;  4DGW B;  4HQM A;  3HIF A;  2NVQ J;  3K1M A;  5GTH C;  2FU4 A;  4A93 J;  3G73 A;  1XGS A;  1R4N B;  2OC6 A;  2P7C B;  3T0Y A;  2E1O A;  2NS8 A;  2QVO A;  3D5R C;  4GXO A;  2JA7 J;  2K5C A;  2CWE A;  4Q48 A;  2VC0 A;  3LSG A;  2LG4 A;  4R79 A;  3F8B A;  3QU6 A;  2DA6 A;  4EM0 B;  3ZGK A;  2L3D A;  2H94 A;  2HKX A;  3I9V 2;  1DPU A;  4GDF A;  2DT7 B;  1YS6 A;  2DQR A;  2XGE A;  3LQR A;  2V1D A;  2VT2 A;  2Z5U A;  2MW8 A;  4XLE A;  3V7C A;  4EEF G;  5HLT A;  4L9N A;  5D8K B;  2Y0S N;  4M73 A;  1IRX A;  4QIW N;  4HF2 A;  2KP6 A;  1SFX A;  5EZH A;  1BOA A;  1S9H A;  3EDP A;  4B44 A;  3DCF A;  1WRJ A;  1R1V A;  3F3X A;  1O3S A;  2BHY A;  1MGT A;  2VPR A;  3SHF A;  3BCA A;  4J19 A;  2LY9 A;  1N77 A;  1FOY A;  3LA3 A;  1K78 A;  1J9I A;  1OKR A;  2VJI A;  1BC8 C;  3GCM A;  2WB1 A;  4OIR F;  1VQL I;  1QPM A;  5F6F A;  3TDZ C;  5LEJ A;  2DT5 A;  3HOT A;  4HQE A;  1OCT C;  2VXZ A;  4I09 A;  2YPR A;  2M30 A;  2OZU A;  4GFB A;  4AC0 A;  1HDP A;  4A6E A;  1J5Y A;  2P5K A;  3J7Y J;  3BP8 A;  3MKL A;  4MTE A;  1A04 A;  1B72 A;  1LEB A;  5BNG A;  1P4A A;  5D5X B;  4XNF A;  2O03 A;  4ABZ A;  2E7W A;  5ILV A;  3KYL A;  4KMF A;  4HV5 A;  3KZY A;  5DCM B;  5FLV A;  3HSF A;  4ZYA A;  1Z7U A;  3H5R A;  4II2 A;  3MZ8 A;  4DJA A;  5J6X A;  3CTA A;  1KYZ A;  2HOS A;  4I2O A;  1U9N A;  4EJT A;  1LFB A;  1FMW A;  3EUK L;  3W6J B;  3S32 A;  2FE3 A;  5EGO B;  2CGP A;  1TZL A;  2CQK A;  3A0H C;  3DEU A;  3PSI A;  3G71 I;  2LD5 A;  2R7Z J;  5B1A H;  2OF7 A;  1SFU A;  1Z6R A;  2STW A;  2R7W A;  2M2E A;  3H9J A;  3PO2 J;  2IRF G;  5E3L A;  2VN2 A;  3TOA A;  3VOD A;  1EA3 A;  2V4J C;  3CCR I;  3DBH B;  2LVS A;  2JA2 A;  3I58 A;  1ZQ3 P;  3I4P A;  4BBS J;  3A2K A;  5IOY A;  1BW6 A;  4XL9 A;  4HOB A;  2W25 A;  2NNY A;  3GZN B;  2P5L C;  3A1Y A;  2ESH A;  3A4C A;  4E7S A;  3FHZ A;  1HBX G;  1IN6 A;  1UJ8 A;  1LE8 B;  4ASN A;  3S16 J;  1IN4 A;  3I5U A;  1YTY A;  4CGZ A;  5J1U A;  2JZY A;  2L9N A;  2UV1 A;  1CF7 A;  2K9S A;  4E7J A;  4EV0 A;  3BTL A;  4D7N A;  5CQG A;  1GLN A;  2M0C A;  2R7O A;  2M7A A;  1WJA A;  3KP7 A;  1XTA A;  2EJR A;  1BJA A;  1CQT A;  4U0V A;  1X3U A;  2GBY A;  4DYC A;  2EA4 A;  1KGS A;  5HDG A;  2L7Z A;  1LFP A;  4I0A A;  3TDU C;  1BI0 A;  2IS4 A;  2OQG A;  4NHJ A;  1B9M A;  2DOA A;  2V1N A;  3GTJ J;  3SZT A;  1EH8 A;  2WAD A;  5LGN A;  4BQN A;  3FF5 A;  4ITV A;  3M7G A;  1PVE A;  5LGU A;  2RDP A;  2DU9 A;  1EKE A;  1SVO A;  4KDP A;  4KIG A;  4ETS A;  4EJW A;  1WWX A;  3AG3 H;  3R60 A;  4XN3 A;  2EV0 A;  3D0S A;  1JKR C;  3FM5 A;  3HOZ J;  4XSZ F;  2H09 A;  2XKO A;  1Z77 A;  3WG9 A;  2HOT A;  2HDD A;  5HDN A;  1D0X A;  2XVC A;  2Z16 A;  3DLA A;  1SVM A;  2Y75 A;  4PSW A;  3BJA A;  2R7S A;  2V6E A;  2DYS H;  4I0B A;  2BY1 A;  3X2Q H;  2DA2 A;  2CG4 A;  3R0A A;  5J40 A;  2F5E A;  2Q2E A;  3VYT B;  4HNU A;  5BMZ A;  1IXS B;  3HB9 A;  3OL3 A;  2JWT A;  3KET A;  1EH7 A;  4G9Y A;  1YRN B;  3M07 A;  5CQE A;  1IN8 A;  1G3Y A;  1QQI A;  5FFZ A;  4B3X A;  1IGN A;  5DS9 A;  4XR6 A;  1MH4 A;  3R4K A;  2QQB A;  4F52 A;  5GTI C;  4ZTF A;  4WXD A;  1WKM A;  4E7L A;  2KJB A;  3S2D J;  3ZMS A;  4C2T A;  4HRI A;  4EJU A;  4X1E A;  5DM6 F;  3OL4 A;  3OIO A;  2X9D A;  5LHH A;  2JQ7 A;  5IP6 A;  4DYQ A;  4A5M A;  1FC3 A;  4EAT A;  3RDI A;  2MA3 A;  4KIT B;  4E7I A;  5CVJ A;  1A6Q A;  5CYV A;  3I3L A;  3OYI A;  2VUM J;  5AON A;  2CJJ A;  3RQ4 A;  2RC4 A;  4C3H J;  4B1R A;  3U1K A;  2A68 F;  3QP5 A;  2M7B A;  4RLQ A;  2F5F A;  4E70 A;  4HNV A;  4YEL A;  4AD9 A;  3OOP A;  4ESB A;  1O7L A;  2WC2 A;  2KIU A;  4O5V A;  5ICF A;  2ZC2 A;  5LLQ A;  3CD6 I;  2EBI A;  2KZV A;  2JSP A;  3ECH A;  4GGG A;  4HG2 A;  4BU2 A;  4CXF A;  1BJZ A;  2JA6 J;  2Y69 H;  5LEK A;  1GV5 A;  3OMY A;  4QPO A;  2H6B A;  1D8K A;  3BG7 A;  1PP7 U;  4HPQ A;  3JSP A;  3N05 A;  4KIS A;  3S1M J;  3GLX A;  3NAR A;  5HS9 A;  3PSF A;  2X1D A;  2AHQ A;  3I53 A;  3FMR A;  4C2M J;  1FYL A;  2H8R A;  2VOO A;  3P9I A;  2K3P A;  1UHS A;  3TO6 A;  2HZD A;  3T8T A;  2MC4 A;  3QYB A;  5E1Z B;  3H0G J;  1TQP A;  3EQL F;  4HLX A;  3ZP5 A;  3G3Z A;  1W0T A;  4FET A;  2OU2 A;  2EFN A;  3RKW A;  4ZJZ A;  4IQJ A;  3KIO A;  2R7F A;  3BR3 A;  2BY2 A;  1X1B A;  1B4A A;  4XQF A;  2COB A;  2WV0 A;  3LST A;  3F6O A;  4U88 A;  3LAJ A;  5CVI A;  2X6W A;  2EPF A;  1WVR A;  4FAS D;  4JK1 X;  1Z7L A;  1GUU A;  1J0R A;  4N4O B;  3SZP A;  1HLV A;  2IJL A;  3UKG A;  1K4S A;  3L7W A;  1MMS A;  5DUI A;  2F4M B;  1L3L A;  4HYE A;  3OYE A;  2O6G E;  3FX3 A;  3U2R A;  4I01 A;  1TWC J;  2BVM A;  4AYB A;  4H0E A;  3F8N A;  4IOC F;  2G7H A;  3JR9 A;  1MDM A;  2IBD A;  1T33 A;  3LSK A;  1DU6 A;  3L00 A;  2XIG A;  5J1R A;  1FBQ A; 
#chains in the Genus database with same CATH homology
 3WOD F;  5BQT A;  1R1T A;  1YQA A;  4EJV A;  4EGY A;  1ODD A;  4UHT A;  4IRI A;  3I54 A;  3MEX A;  2UXX A;  2UZK A;  5HOO A;  2XHK A;  1Z05 A;  2W24 A;  2LSO A;  1T39 A;  2Q0O A;  3KE2 A;  4Y13 A;  5TJJ A;  3C3W A;  4LK0 F;  1KQ8 A;  5LHG A;  1HXD A;  4O3M A;  2FXA A;  2NRA C;  3WTT C;  5J8C A;  2MLG A;  3QRF F;  3HRU A;  2FF4 A;  1W5T A;  2MD5 A;  3M9A A;  4MGR A;  4EQQ A;  1LB2 A;  1R36 A;  2FSW A;  1BI3 A;  5DCM A;  2FA5 A;  2HQN A;  3T5X A;  1W4M A;  2O61 A;  4L18 B;  4GYI A;  2EFP A;  5H20 A;  3M1E A;  3HTS B;  3ERE D;  4PDK A;  1P2F A;  1KYW A;  4UXN A;  5D4R A;  3L9F A;  3ZMZ A;  3JW4 A;  1UCR A;  5E8G A;  3BPX A;  1R1U A;  2YSR A;  4B09 A;  2OQR A;  5EEG A;  1TNT A;  4ENJ A;  2WTE A;  3F8C A;  4YG2 F;  3RPU A;  2Y0M A;  1YFH A;  3CDH A;  2CYY A;  4M9S A;  1U6G A;  2DFI A;  1O7F A;  5IT3 A;  2UWM A;  3BJ6 A;  4L9T A;  4RB3 C;  3FXU A;  2E7X A;  4N9I A;  2PJP A;  3DQV C;  4BAY A;  3E5X A;  3FM3 A;  1TLH B;  1MDM B;  2FNP A;  3NQO A;  3N4M A;  2YX7 A;  1Z1D A;  4Y15 A;  2A6H F;  4K2E A;  2HKO A;  3V8K A;  4BQA A;  1IAW A;  3MWM A;  1T6S A;  5F1R A;  3E5U A;  1OYI A;  4UVC A;  1SD4 A;  3QPH A;  3J81 K;  5K1Y A;  1TQM A;  3HYI A;  1O3Q A;  2X4H A;  2ESN A;  3U9G A;  2LF7 A;  1QZZ A;  5AIP A;  3ECO A;  4Q4Z F;  3IL2 A;  2W84 A;  3C18 A;  4NQW A;  1CGP A;  5BS6 A;  4M9Z A;  1GVJ A;  5FB2 A;  2LNB A;  5ED4 A;  5H6R A;  1JHH A;  3V7R A;  2JSC A;  2XAQ A;  1TTY A;  1BC7 C;  2OBP A;  5HLG A;  1D8J A;  3FXR A;  1R7J A;  3K0L A;  4HV6 A;  3RKY A;  3WGG A;  4LG0 A;  1HW2 A;  3KLO A;  1IRG A;  4L5J A;  3GZ5 A;  4P9F A;  3TOB A;  1K7A A;  3P7N A;  2IPQ X;  3K2Z A;  2D1V A;  2XAJ A;  4A5N A;  1R5H A;  4L9J A;  4F7Z A;  5D6F A;  4AVP A;  2VE9 A;  1SFE A;  2P6S A;  1BI1 A;  2CO5 A;  2Z33 A;  1ZRE A;  2CW0 F;  3DV8 A;  5K5O A;  4UNO A;  2KRF A;  4AIK A;  5IT9 Z;  1H0M A;  5FO5 A;  1CF7 B;  2GXB A;  4IHS A;  3GFJ A;  4WWC A;  3ZPL A;  2JPC A;  4KN4 X;  2ZFW A;  3TO9 A;  2RGV A;  3LA7 A;  2MC3 A;  1F9N A;  3CUQ C;  5ILS A;  4RGR A;  3E6B A;  5EEH A;  2JTV A;  2ZME B;  1P6R A;  3I71 A;  1FSE A;  5E20 A;  3IKT A;  2EA2 A;  1R22 A;  3GO5 A;  3B73 A;  5F64 A;  5D5V B;  1BIA A;  3ZN1 A;  4FHT A;  3H3Z A;  2JPB A;  4BHP A;  4KYW A;  2MBF A;  1XCV A;  3BPV A;  4Q5S F;  3ABU A;  3CO6 C;  1QO0 D;  3I59 A;  1FX7 A;  3NRV A;  2XRN A;  1IZ1 A;  3I59 B;  3RYP A;  1F5T A;  2V9V A;  5FD5 A;  4IVN A;  2NYX A;  1S29 A;  4GO1 A;  3KP5 A;  1UB9 A;  3FZV A;  1KU3 A;  2FOK A;  1XGN A;  3O6B B;  2M87 A;  1Z91 A;  4MHG A;  4CIC A;  2ELH A;  1YIO A;  2Z99 A;  2ADU A;  2P7V B;  5DD4 A;  4MEY F;  4OIO F;  3S2W A;  1FNN A;  3B02 A;  1LDJ A;  4CYD A;  4WF2 A;  3MZY A;  4P9U A;  2EK5 A;  1J2X A;  1XSD A;  5E1X A;  1MD0 A;  1IN5 A;  1PUE E;  3GX4 X;  2GXG A;  3MCZ A;  4LLL A;  2LDU A;  2XKP A;  4BYY A;  5CVV A;  1S8N A;  2FBI A;  4ZH4 F;  4IJA A;  2OA4 A;  5E8I A;  2KIF A;  2HYG D;  1BM9 A;  4KUM A;  2ETH A;  2OZ6 A;  1ZG3 A;  1REP C;  4JBA A;  2F5D A;  4AIH A;  3GVA A;  3ZMU A;  4G6D A;  4OIP F;  1KU2 A;  1MJA A;  4KIF A;  5DD8 A;  1U8R A;  3D5L A;  2PI0 A;  1B1B A;  3IHU A;  1KQ9 A;  5D4S A;  2GA1 A;  2HWV A;  4BHB A;  1XDU A;  3ZN0 A;  1XD7 A;  2FML A;  2M1B A;  3E97 A;  2NAZ A;  2TDX A;  3ZMD A;  4A6D A;  3K1P A;  1TQI A;  3V8J A;  4CDG A;  2VBW A;  1ZHF A;  1LNW A;  2DTR A;  3ABT A;  2K7L A;  4RGS A;  4KT5 C;  2O8X A;  1XCB A;  4M72 A;  1ULY A;  1J75 A;  4OMY A;  4LK1 F;  2V1X A;  5LBQ A;  5HS7 A;  4PGG A;  3PQJ A;  2GZW A;  2PMU A;  3T8R A;  4HA8 A;  1TNS A;  2E1C A;  3SXY A;  1F1Z A;  4EM2 A;  2ZCW A;  5DUK A;  4RB0 A;  2P4W A;  2VBX A;  3CUQ A;  4ZYE A;  4AIJ A;  5JR3 A;  1OMI A;  1T0F A;  2D2W A;  2L02 A;  2R7D A;  1BBY A;  1XB4 A;  1E17 A;  1HW1 A;  1U78 A;  2HDC A;  4LB6 B;  4O6J A;  3GFM A;  3E6C C;  1DPR A;  3WTV C;  4PZJ A;  4HW0 A;  4WXC A;  4M6X A;  1LDD A;  4U7B A;  1ZRC A;  2GWR A;  4G7O F;  4KIC A;  3WGI A;  2BE5 F;  2PLY A;  2AS5 F;  3HUG A;  4LFU A;  1BIB A;  3RJP A;  2BYV E;  3GYH X;  3WU0 A;  1E2X A;  4HX8 A;  1I1S A;  3BWG A;  4UV9 A;  1XDS A;  4HX4 A;  4ZYD A;  5HLI A;  2H27 A;  2ZO4 A;  3H3U A;  3HTU A;  1IUY A;  5E18 F;  1FT9 A;  1OYY A;  4KIB A;  5FLX Z;  1IW7 F;  1ZG5 A;  2K27 A;  1S3J A;  1HKQ A;  2BEO A;  2G7U A;  1EH6 A;  4I02 A;  1HKT A;  3WU1 B;  2FQ3 A;  3PFI A;  3LFK A;  1ZGA A;  4G7H F;  1K79 A;  4A2U A;  2RV8 A;  3E6D A;  2LF8 A;  3GFL A;  2COM A;  3TQN A;  3WE3 A;  2IA0 A;  2YU3 A;  2GIV A;  4ENN A;  2A3S A;  3GFI A;  3HOS A;  3GZ6 A;  1LJ9 A;  3F72 A;  1ZAO A;  4RAZ A;  1SD7 A;  2VON A;  3JSO A;  3VOE A;  4OMZ A;  2EV5 A;  2K86 A;  3MAJ A;  3F8F A;  1STZ A;  3DFG A;  2LKP A;  1ON1 A;  4WX9 A;  2HGC A;  4KMU X;  3FMQ A;  2VBZ A;  2QZ8 A;  5FD6 A;  1QNT A;  1O3R A;  4CO8 A;  2PBI A;  3GXO A;  2YX4 A;  1B6A A;  4KNY A;  4MQ9 F;  2K4B A;  1RZ4 A;  5FLX K;  1LVA A;  4GYG A;  3CO7 C;  2HS5 A;  2IT0 A;  1U3E M;  4IXA A;  4XLN F;  5L3F A;  3KP3 A;  5D5W B;  3WTS C;  4NB5 A;  1PP8 F;  1JXS A;  3E3V A;  5L3E A;  1GXQ A;  4UVB A;  1HSJ A;  3KZZ A;  3P9K A;  1B9N A;  3DPL C;  3HHH A;  2DO7 A;  2ISY A;  3F6V A;  3QOP A;  1QGP A;  2FEZ A;  1ZN2 A;  2F5C A;  3C7J A;  3HSE A;  5DDG A;  2IVM A;  4AWX B;  4A0Y A;  1T98 A;  1HQC A;  4M6Y A;  1G3S A;  1W7P B;  2NS0 A;  4IF4 A;  3HHG A;  2VOD A;  1S7A A;  4KFC A;  3EYI A;  1WI9 A;  4GCV A;  2FNA A;  1O57 A;  2F2E A;  3F23 A;  3O3K A;  3H92 A;  2FBH A;  1W5S A;  2J5O A;  3DPT A;  2BGC A;  4PCQ A;  4EM1 A;  4MTD A;  3CUO A;  1SD6 A;  4D0P A;  3COA C;  1G4D A;  1HST A;  3M8F A;  2HTS A;  5E17 F;  3CLO A;  2A5Y B;  3ZMV A;  2PFB A;  2XAH A;  1UST A;  3LAP A;  1Y0U A;  1YW8 A;  4M74 A;  3BZ6 A;  1KU9 A;  1Z9C A;  5ERI A;  2NNN A;  5ICG A;  3QPT A;  1H9T A;  5CVR A;  4KA4 A;  2KIM A;  2Z3Y A;  4G7Z F;  1T38 A;  4S04 A;  1MJB A;  1OYW A;  2GA2 A;  4HDV A;  2JRT A;  4XBF A;  3J80 K;  1FY7 A;  4R1H A;  2XUB A;  4YII A;  1ZLK A;  3JTG A;  2KKO A;  3BDD A;  1P4X A;  1ONV A;  1RNL A;  2XAS A;  5L3D A;  5DV5 A;  3R61 A;  5BPI A;  5TRD A;  3E6M A;  5DEQ A;  4OOI A;  3V4G A;  1DDN A;  1AOY A;  5L3C A;  2A69 F;  3ISP A;  2C6Y A;  2DK8 A;  3GF2 A;  2QQ9 A;  1SAX A;  4RAY A;  1D3Y A;  1W7P A;  5J8F A;  3R0J A;  1KQ0 A;  1ON2 A;  1SMY F;  1HW5 A;  5CLS A;  3J7A O;  4LJZ F;  2PN6 A;  5L3G A;  3HRM A;  1K78 B;  1YLF A;  2GQQ A;  1SD5 A;  1XSX A;  1TBX A;  3MZH A;  1ZRD A;  4BXU A;  4L0Y B;  3BY6 A;  6PAX A;  5LRR A;  1C0W A;  2G9W A;  4EMS A;  1I1G A;  2JT1 A;  4RGX A;  3VFZ A;  5D6E A;  2L4M A;  2RVC A;  2ZNY A;  1OR7 A;  2DK5 A;  1J59 A;  4MEX F;  1ZH5 A;  4OIN F;  2HR3 A;  2DI3 A;  5FFX A;  4M9X A;  3RYR A;  2P5V A;  4HX7 A;  2HOE A;  2K02 A;  3LA2 A;  3QP6 A;  4RGU A;  3FMS A;  5KVR A;  4A12 A;  1JGS A;  3J81 Z;  4EJO A;  2PQ8 A;  2QBY A;  4LLN A;  1ZLJ A;  2EFO A;  5ICE A;  4JQF A;  1IRF A;  3K1N A;  1U5T A;  3LWF A;  1MJ9 A;  2IW5 A;  3F8M A;  3U1D A;  4XLP F;  2FMY A;  1SMT A;  4ZYH A;  2IA2 A;  2VBY A;  5LRS A;  4P96 A;  5HS8 A;  5IT9 K;  5HVQ C;  5JHU A;  4L9V A;  2IP2 A;  5JI6 A;  2W85 A;  4RB1 A;  3E5Q A;  3GWZ A;  4LGW A;  1PDN C;  5DCF A;  4M71 A;  5H6Q A;  1FLI A;  3QAH A;  2O0Y A;  2QYO A;  3T1B A;  3ZQ7 A;  5BPD A;  3HSR A;  5K5R A;  2RQP A;  2VE8 A;  1WQ2 A;  3R6S A;  3FXQ A;  4UVA A;  3MFK A;  1G3T A;  3P9C A;  1YO5 C;  5A2Q K;  3MQ0 A;  4ZYG A;  2QUF A;  3V8L A;  3TGN A;  1D5V A;  4EVI A;  3O2P E;  2ZBK A;  2PMH A;  1W7P D;  2KJC A;  4FT8 A;  3M8E A;  2UXN A;  2AXL A;  3L09 A;  2H6C A;  5A2Q Z;  3F21 A;  3GEZ A;  2B0L A;  3OV8 A;  1K6O A;  1FZP B;  4HF0 A;  2FBK A;  1EV7 A;  2ACJ A;  1UHW A;  1FSH A;  4KN7 X;  3N97 A;  4QWQ A;  4OIQ F;  1I27 A;  2MH9 A;  1J7K A;  2RNJ A;  1ZG1 A;  2EFW A;  1RUO A;  1KU7 A;  3Q5F A;  5ICC A;  4B8X A;  2XGX A;  4PGH A;  2MLK A;  2XV4 S;  2L4A A;  3KFW X;  3CUQ B;  1BI2 A;  2HEO A;  1TW2 A;  5JVT A;  2X0L A;  1XGM A;  3RPQ A;  1Q1H A;  4N9H A;  2IA1 A;  1H9G A;  5CJ9 A;  4EGZ A;  3CJN A;  4I98 B;  3TO7 A;  1LDK B;  4LD5 A;  1GXP A;  1LQ1 A;  4IPA A;  2QEN A;  1MZB A;  4N0B A;  3KCC A;  2K4J A;  2DPU A;  2J5P A;  2EB7 A;  2Z9O A;  2EV6 A;  2E1N A;  2HTJ A;  1HKS A;  4R8H A;  4IRG A;  2VC1 A;  4Y17 A;  3BRO A;  2M8E A;  1YG2 A;  1DUX C;  2RKH A;  2GAU A;  4BHC A;  1OPC A;  2QM3 A;  2D45 A;  1UFM A;  3BOQ A;  1RI7 A;  4DQ2 A;  4LMY A;  4UV8 A;  4G6Q A;  1V3F A;  4P5O A;  4IHT A;  2QQA A;  3WGH A;  3EYY A;  1LEA A;  2OAZ A;  1R58 A;  4U7D A;  4ESF A;  1QZY A;  2PEX A;  3IWF A;  2XRO A;  3F22 A;  4Z2Y A;  3IKV A;  2V79 A;  2RN7 A;  4BH9 A;  4I7H A;  4G94 A;  1R23 A;  2STT A;  3C1D A;  4HZF A;  2V1U A;  3IWZ A;  1O3T A;  2A6E F;  5HLH A;  2ZJ2 A;  1QBJ A;  4G8X A;  2R3S A;  2DAO A;  1Z6T A;  3WE2 A;  3I64 A;  2ZME A;  2W57 A;  2M45 A;  1JHF A;  4U0W A;  4YFX F;  3RI4 A;  1ZGJ A;  3Q9V A;  3RKX A;  1L0O C;  1S6L A;  4BNC A;  3GUD A;  1I5Z A;  3SFZ A;  4MQV A;  1RIO H;  1U5T B;  3IRQ A;  3KEO A;  4DNC A;  3DF8 A;  5LGT A;  5E1W A;  2ZKZ A;  3NEU A;  2DW4 A;  1F4K A;  2DLL A;  3WTY C;  1XSV A;  3WTZ A;  4TV7 A;  2EWN A;  4IRH A;  1FWZ A;  4YFN F;  1FOK A;  1ZAR A;  2QLZ A;  3ROU A;  3KLN A;  2Q8K A;  2L54 A;  1YS7 A;  5DYM A;  4ZZD A;  1MKM A;  2HYF A;  3ULQ B;  4LLG F;  1KA8 A;  1FBU A;  3DP7 A;  1FP2 A;  3WTW C;  4WXH A;  4XSX F;  2VT3 A;  4UUV A;  2P6T A;  4CZZ A;  1IXR C;  4L5I A;  1TW3 A;  4XRF A;  2BV6 A;  1U2W A;  1V4R A;  1YW7 A;  3W6K B;  2D1H A;  1BN5 A;  1FPQ A;  4FX4 A;  3RTR A;  3TKY A;  3AAF A;  2V6C A;  4LB5 A;  1R00 A;  3QU3 A;  5ILU A;  4Q47 A;  4HF1 A;  4YIF A;  4WCG A;  4MNU A;  2XAG A;  4QLC U;  3KP2 A;  3K9T A;  3KP4 A;  1U5T C;  3WTU C;  4S05 A;  3IC7 A;  2HZT A;  2ZNZ A;  5LHI A;  3PQK A;  3RIR A;  1YYV A;  3LQQ A;  2P8T A;  2L01 A;  2YR2 A;  3HRT A;  4HDU A;  2DPD A;  4HLY A;  3ELK A;  3ZMT A;  5JFR A;  1FP1 D;  1JE8 A;  2Y48 A;  1USS A;  1XGO A;  2DBB A;  4P55 A;  4ZZL A;  5K5Q A;  4ENM A;  3Q9S A;  3I0T A;  1ZYR F;  5BOX A;  1YW9 A;  1S7O A;  5L3B A;  1UHM A;  4FX0 A;  5D8L B;  2ZXJ A;  2WWY A;  2QBY B;  1ZRF A;  1VTN C;  4WK8 F;  1T2K A;  2MH2 A;  3WTX C;  1DP7 P;  1IF1 A;  3FWE A;  1IN7 A;  1XMK A;  4OU0 A;  3KP6 A;  1WSU A;  2EFQ A;  3VEP A;  3EUH A;  4A0X A;  4RS8 A;  1NHA A;  5D5U B;  3REO A;  1P92 A;  4CHU A;  3ML6 A;  5HDK A;  2PG4 A;  5AIQ A;  2O3F A;  3VB2 A;  5CVU A;  2QWW A;  3DKW A;  1RUN A;  4ESJ A;  4HBL A;  1GHC A;  5KK1 A;  2VOP A;  3GW2 A;  1FBS A;  1XMA A;  2XAF A;  4ON0 A;  4RB2 C;  2HQR A;  4U0Y A;  4LG0 B;  1G6N A;  3KEQ A;  3L2C A;  3IRR A;  2M5W A;  4A0Z A;  1AWC A;  2CFX A;  2ISZ A;  2A61 A;  3J80 Z;  1I6X A;  4ENK A;  3K69 A;  3HRS A;  3BJO A;  1IXC A;  2FRH A;  5FGM A;  3JAM K;  2OD5 A;  2HFH A;  3JTH A;  2CSO A;  1P4W A;  3SQN A;  2A07 F;  2DQL A;  1R5G A;  4L0Z B;  4HAM A;  1FYK A;  2BBY A;  3V7S A;  1FYM A;  1G3W A;  3JAM Z;  1B59 A;  1XN7 A;  4YFK F;  3DXJ F;  3EET A;  4HQM A;  3HIF A;  3K1M A;  2FU4 A;  3G73 A;  1XGS A;  2P7C B;  3T0Y A;  2QVO A;  4GXO A;  2CWE A;  4Q48 A;  2VC0 A;  4R79 A;  3F8B A;  3QU6 A;  4EM0 B;  2L3D A;  2H94 A;  2HKX A;  1DPU A;  1YS6 A;  2DQR A;  3LQR A;  2V1D A;  2VT2 A;  2Z5U A;  3V7C A;  4HF2 A;  4L9N A;  5D8K B;  4M73 A;  1SFX A;  1BOA A;  3EDP A;  1WRJ A;  1R1V A;  3F3X A;  1O3S A;  1MGT A;  3SHF A;  3LA3 A;  1K78 A;  1J9I A;  1OKR A;  1BC8 C;  4OIR F;  1QPM A;  5F6F A;  3TDZ C;  5LEJ A;  2DT5 A;  3HOT A;  4HQE A;  2VXZ A;  4I09 A;  2YPR A;  2M30 A;  2OZU A;  4A6E A;  1J5Y A;  2P5K A;  3BP8 A;  4MTE A;  1A04 A;  1LEB A;  1P4A A;  5D5X B;  2O03 A;  2E7W A;  5ILV A;  4KMF A;  4HV5 A;  3KZY A;  5DCM B;  3HSF A;  1Z7U A;  5J6X A;  3CTA A;  1KYZ A;  4I2O A;  4EJT A;  3W6J B;  2FE3 A;  2CGP A;  2CQK A;  3DEU A;  1SFU A;  1Z6R A;  2STW A;  2IRF G;  2VN2 A;  3TOA A;  3VOD A;  3I58 A;  3I4P A;  4HOB A;  2W25 A;  2NNY A;  2P5L C;  2ESH A;  3FHZ A;  1HBX G;  1IN6 A;  4ASN A;  1IN4 A;  3I5U A;  1YTY A;  4CGZ A;  2JZY A;  1CF7 A;  4EV0 A;  3KP7 A;  2EJR A;  1BJA A;  4U0V A;  1X3U A;  2EA4 A;  1KGS A;  5HDG A;  4I0A A;  3TDU C;  1BI0 A;  2OQG A;  4NHJ A;  1B9M A;  3SZT A;  1EH8 A;  5LGN A;  3FF5 A;  3M7G A;  5LGU A;  2RDP A;  2DU9 A;  4KDP A;  4KIG A;  4ETS A;  4EJW A;  1WWX A;  3R60 A;  2EV0 A;  3D0S A;  3FM5 A;  4XSZ F;  2H09 A;  2XKO A;  3WG9 A;  5HDN A;  2XVC A;  2Y75 A;  3BJA A;  4I0B A;  2CG4 A;  3R0A A;  2F5E A;  2Q2E A;  5BMZ A;  1IXS B;  3KET A;  1EH7 A;  4G9Y A;  1IN8 A;  1G3Y A;  1QQI A;  5FFZ A;  3R4K A;  2QQB A;  4WXD A;  1WKM A;  2KJB A;  3ZMS A;  4EJU A;  5LHH A;  4A5M A;  1FC3 A;  3RDI A;  2MA3 A;  5CVJ A;  5CYV A;  5AON A;  2RC4 A;  2A68 F;  3QP5 A;  2F5F A;  4E70 A;  4AD9 A;  3OOP A;  4ESB A;  1O7L A;  2WC2 A;  2KIU A;  4O5V A;  5ICF A;  5LLQ A;  3ECH A;  4GGG A;  4CXF A;  5LEK A;  2H6B A;  1D8K A;  1PP7 U;  3JSP A;  3GLX A;  5HS9 A;  1FYL A;  3I53 A;  3FMR A;  2VOO A;  3P9I A;  3TO6 A;  3T8T A;  5E1Z B;  1TQP A;  3EQL F;  4HLX A;  3ZP5 A;  3G3Z A;  2OU2 A;  2EFN A;  3RKW A;  2R7F A;  1B4A A;  4U88 A;  2WV0 A;  3LST A;  3F6O A;  3LAJ A;  5CVI A;  4JK1 X;  1J0R A;  3SZP A;  2IJL A;  3L7W A;  5DUI A;  1L3L A;  4HYE A;  2O6G E;  3FX3 A;  3U2R A;  4I01 A;  4H0E A;  3F8N A;  2G7H A;  1MDM A;  3L00 A;  2XIG A;  1FBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...