1CF7B

Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
GKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3
publication title Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
pubmed rcsb
source organism Homo sapiens
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02319 E2F_TDP E2F/DP family winged-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cf7B00
3VOEA 4EVIA 4KMUX 3R4KA 3V7SA 4RB2C 1LB2A 3FMQA 4EMSA 2DU9A 3I53A 4BHCA 4BYYA 1ZAOA 4WXDA 2ESNA 1OMIA 1O7FA 1W7PA 2CQKA 5E1WA 2H09A 2QM3A 4ZYHA 5ICEA 2STTA 1FT9A 3JW4A 5CVVA 3SHFA 4MNUA 2XKPA 4QLCU 1LEBA 1YIOA 1FYMA 2IA2A 4WXCA 4XBFA 4KUMA 1B1BA 3C3WA 4S04A 2VBWA 1ULYA 4IRGA 2QQBA 2A6EF 1TW3A 4HV5A 2FBKA 2K86A 3DF8A 2RN7A 4EJUA 4MEYF 3F8MA 1LVAA 4BH9A 2B0LA 2H6CA 4ETSA 1ZGAA 4UVCA 2GIVA 3U2RA 4AWXB 3H3UA 2GA1A 3NEUA 1YYVA 3ZMDA 1MDMB 2HS5A 4EQQA 3RPQA 3DQVC 4LGWA 1D8JA 1RZ4A 1ZG1A 5LLQA 1ZRDA 3ZPLA 1P4AA 1WQ2A 2A68F 1W5TA 2K02A 1YG2A 3M7GA 1KU7A 4A12A 1K78A 4L9JA 4I7HA 2CGPA 5D6FA 3D0SA 3GF2A 1B59A 3IC7A 2D1VA 3HSFA 3O3KA 3MWMA 2P7VB 4JK1X 3QPTA 4G7OF 5LHHA 2HFHA 1ZARA 2XAGA 4GO1A 4M72A 5BPDA 1MGTA 3FMSA 4L9NA 1BI2A 3E5XA 1BI1A 3DEUA 1MJAA 2HR3A 5CVRA 1RNLA 3IWZA 4CXFA 1MJBA 3QRFF 1ZYRF 3MEXA 2H27A 4L0YB 1E17A 4G94A 3ZP5A 3DKWA 1A04A 4U0WA 1FYKA 4HX4A 4G7HF 3KLOA 2VXZA 3DFGA 3RKWA 5F1RA 1D8KA 2EV5A 1U5TC 1FX7A 2W24A 4XLNF 3ZMUA 5D5UB 4HW0A 3VODA 4OINF 1K79A 1OPCA 3B73A 4RAYA 1H9TA 4HA8A 5ICCA 2PEXA 1B9MA 3KZYA 5K5RA 2RC4A 3V8KA 2F2EA 5HLIA 1BM9A 3HTSB 5FD5A 1IW7F 2LDUA 5FO5A 5HDGA 4L5IA 2HQRA 1HW5A 2LKPA 3ROUA 2COMA 2L4MA 1YW9A 1DP7P 2CWEA 4I09A 2LSOA 1R58A 3CUQA 5E18F 1ON1A 2ZBKA 1TQIA 4NHJA 1LQ1A 3M9AA 2FBIA 1MJ9A 4G6DA 1XD7A 2K4BA 1U8RA 2Y48A 4Y15A 3QU6A 1R1UA 4HX7A 4HQEA 4G6QA 5HS9A 1DPUA 1U2WA 1IN4A 4RAZA 2QLZA 4B09A 2GXGA 1MKMA 2YX4A 2CYYA 2NYXA 3HOSA 2DW4A 4G9YA 3KP4A 4RS8A 2F5FA 3EUHA 3LAJA 4LG0A 3DPLC 1PDNC 2FOKA 1W4MA 5AONA 5CVUA 2EA4A 1ZG5A 2VC1A 4AIHA 1XDUA 5K5OA 3KETA 2JPCA 5DV5A 3O6BB 4KN7X 1I6XA 3Q9SA 4IXAA 1EV7A 3EYYA 1QQIA 4L5JA 1HKSA 2M30A 1ZG3A 2QYOA 3V7CA 2BYVE 3U1DA 2XAHA 2JSCA 2P5LC 1S29A 2AXLA 3J7AO 1KU2A 6PAXA 3V8LA 1TQPA 2ESHA 2OZ6A 3W6JB 3TO6A 4MQVA 4F7ZA 5E20A 1GVJA 5DD8A 3R60A 2M1BA 1BIAA 3K0LA 3QP5A 1FP1D 1XMAA 2O8XA 3R0JA 1F5TA 5LGUA 2F5DA 5TRDA 2ZKZA 3LFKA 4OOIA 5DCMB 1G3YA 4OIQF 3EDPA 1EH8A 3M8EA 5DCFA 3FWEA 3BY6A 4L9VA 4EJOA 2XAJA 3GFMA 1ZLJA 1KQ9A 2EFOA 2YSRA 3ELKA 1FNNA 5FGMA 2FBHA 3WTWC 3KP6A 1MDMA 4Q4ZF 3T8TA 4GYGA 1AWCA 2VBYA 2HEOA 4RGRA 1FBQA 2KKOA 3CTAA 3FHZA 1T98A 2GWRA 4BQAA 4ZH4F 4IJAA 3WTZA 3D5LA 2YU3A 2Y75A 1B4AA 2L4AA 5L3FA 4CZZA 2D1HA 5L3BA 2PI0A 3IKTA 4M71A 1R7JA 2VOPA 5AIQA 3ZMVA 3P9CA 2V6CA 5CJ9A 1XGOA 3KLNA 1D5VA 4MGRA 2HGCA 4NQWA 3SFZA 4LK0F 1T2KA 4N9HA 1ZGJA 3CLOA 2X0LA 3FXUA 2OQRA 3VFZA 4ZZDA 1J2XA 2P7CB 1R36A 3I5UA 2QQAA 1XGNA 1YS7A 2NRAC 4YIIA 1Z1DA 4KIFA 4YFKF 1H0MA 2IJLA 3G73A 2QVOA 3HUGA 2VODA 4LLGF 1FPQA 5LRRA 4LLNA 1R1TA 3J81K 4UXNA 2BE5F 4EM2A 1DDNA 2CW0F 2QWWA 2BBYA 5HLHA 3RIRA 4IF4A 3JAMK 4CHUA 3GWZA 2FXAA 2P5KA 2ZNYA 3H3ZA 1LJ9A 4CO8A 3LA7A 5EEGA 4RGUA 4HYEA 3IL2A 2L01A 5DDGA 3QAHA 2DLLA 2DQRA 2O6GE 4HQMA 5HDNA 4M73A 4UVBA 1ZH5A 1FOKA 4YFXF 2K4JA 4Q48A 2O61A 2DBBA 3LA3A 2UXXA 2A5YB 2KJCA 2Z3YA 3LAPA 1Q1HA 3U9GA 3F21A 1FZPB 2HWVA 2YR2A 2V1DA 4WK8F 3P9IA 4AIJA 3H92A 1XGMA 3LSTA 4WWCA 1J0RA 5HS8A 3BPVA 1OR7A 2PBIA 1BC8C 1V3FA 5FLXZ 1KU9A 5KK1A 4AVPA 3F6OA 1EH7A 1FC3A 1G3TA 2TDXA 1IZ1A 4U0YA 4O5VA 1KA8A 2EV6A 1L0OC 1P2FA 2VC0A 5D8KB 2YX7A 2R7FA 1KYWA 2O0YA 1TQMA 3KFWX 2ISZA 3WU0A 3WTUC 4I02A 3AAFA 1KU3A 5L3GA 3LWFA 4R79A 4EV0A 1DPRA 5BPIA 2EJRA 2M45A 3FMRA 3KCCA 3JAMZ 3R0AA 2JTVA 2EFNA 2Z99A 3QPHA 2FRHA 1IN7A 1Z7UA 3BJ6A 2BV6A 1YTYA 4BXUA 1KGSA 2VN2A 4Y13A 3K1MA 1MZBA 5JVTA 4UV9A 5HOOA 3BP8A 2L54A 1T39A 4BHBA 1WKMA 5CYVA 5FFXA 2ETHA 3F8FA 5DCMA 2HTSA 2KJBA 3GFJA 1ZLKA 2VBXA 4P5OA 2DFIA 4P9FA 3JTGA 3F3XA 3CUOA 3DXJF 1STZA 1W7PD 1RUOA 1SMTA 2ZXJA 1QGPA 1U6GA 2ZO4A 3W6KB 2DPUA 4U7DA 2RV8A 1W5SA 2HTJA 3PQJA 1P6RA 2PN6A 2V1UA 3RDIA 3I64A 5E8GA 1TLHB 4GXOA 5HDKA 1Z6RA 4FHTA 5H6RA 1FYLA 3WE2A 5CLSA 2E7WA 4AD9A 5JHUA 2R7DA 2KIFA 3G3ZA 3GYHX 4RGXA 1FSHA 1Z91A 4ESJA 1G6NA 3L7WA 2DAOA 2HKXA 4ZYGA 4LJZF 2E1NA 3WG9A 2QENA 1V4RA 2VONA 2A69F 5DYMA 5DUKA 3HHGA 2STWA 2DK8A 2XUBA 5AIPA 1SD7A 4P9UA 3M1EA 5H6QA 2DK5A 3JSPA 1ON2A 2G7HA 4ON0A 3CUQC 5F64A 2H94A 2HYGD 2FF4A 2NNNA 3RTRA 2QBYB 4KT5C 3BPXA 2VT2A 2EFWA 5D5WB 1SFXA 2RQPA 1IN8A 1J7KA 5DUIA 1TTYA 2DTRA 2BGCA 1JXSA 2GXBA 1HKQA 2HDCA 2ZMEB 3RPUA 3HRUA 3GX4X 2IA1A 1LEAA 1FP2A 3BROA 4DQ2A 1AOYA 2V79A 3KE2A 1RIOH 1YLFA 3TKYA 4M6YA 3EETA 1UFMA 1WWXA 3HYIA 1Z6TA 3V8JA 1QZYA 2J5PA 3C18A 2XAQA 2PJPA 3PFIA 3HRMA 4HF2A 4O3MA 4EGYA 3HSRA 3N4MA 5BOXA 1OYWA 1HQCA 3N97A 3QOPA 4OU0A 1LDKB 3WTXC 3IRQA 4N0BA 3T1BA 1LDJA 2IRFG 2A3SA 2ZFWA 2OAZA 5DEQA 3LQQA 1W7PB 3KZZA 3M8FA 5FD6A 3RKYA 3SQNA 1TW2A 2GA2A 5L3EA 1JHHA 1S6LA 5ILUA 3WGHA 3E3VA 4FX4A 2XGXA 4IHSA 4OMZA 5L3CA 3P7NA 3E6MA 1T0FA 3GLXA 2FA5A 4ENNA 2XKOA 4HF0A 3FXQA 5D5XB 1O3TA 3ZN0A 3FZVA 4Q5SF 1USSA 3BDDA 1WSUA 2P4WA 3GXOA 5K5QA 1SD4A 2HZTA 3BZ6A 2XASA 4CGZA 4G8XA 2IP2A 1GXQA 1H9GA 3S2WA 3FF5A 1ZRCA 3R61A 1T6SA 4LD5A 1E2XA 2WWYA 3K69A 2P5VA 3CDHA 4PDKA 4CICA 3TQNA 2JT1A 5E17F 3QP6A 3KP7A 1FBUA 3L09A 5JI6A 3ABTA 5KVRA 1X3UA 5K1YA 4BHPA 1SD5A 1CF7B 3BOQA 3KP5A 3Q5FA 2Z33A 4A2UA 4HBLA 3C1DA 4EM0B 2FNPA 4I98B 1YFHA 4EGZA 1OYYA 4LMYA 4ZZLA 3WU1B 3P9KA 5LBQA 2HOEA 2VBZA 2PFBA 2MD5A 5FFZA 2A61A 1I5ZA 1D3YA 3GVAA 2P6TA 3RJPA 2GAUA 2H6BA 5BQTA 2V9VA 4IPAA 1BN5A 4DNCA 1IN5A 5CVIA 2P6SA 3MZYA 1ZN2A 2M87A 1HKTA 2MH9A 4Y17A 2P8TA 2K7LA 1O7LA 3GEZA 1KQ8A 4M6XA 2EK5A 3NRVA 3EQLF 2MLGA 1FY7A 3E5QA 5E1ZB 4O6JA 3L00A 4KA4A 4KFCA 2LF7A 1R5HA 2UZKA 2WV0A 2Z5UA 3OV8A 2W84A 1FSEA 3F22A 5H20A 4BAYA 3T0YA 2KRFA 1J59A 2OA4A 3O2PE 1U5TB 2CSOA 4GYIA 4AIKA 5CVJA 3IHUA 3REOA 1WRJA 1I1GA 4OIPF 5J6XA 1UCRA 4S05A 3ULQB 1RI7A 2XV4S 4FX0A 1B6AA 2WC2A 2JZYA 3WTSC 2RDPA 4YIFA 1ONVA 2A6HF 3BJOA 2BEOA 2ZMEA 1P4XA 1XSXA 4N9IA 2E1CA 4A0XA 5DD4A 2A07F 3E6DA 3HOTA 3FXRA 2QQ9A 1CGPA 1BOAA 2V1XA 4A0ZA 3OOPA 2MH2A 2ELHA 4EJVA 4ENMA 1R23A 2ZCWA 4I01A 2MLKA 3DPTA 4XSZF 2XIGA 1U3EM 1DUXC 1XSDA 4YG2F 4JBAA 4EJWA 2X4HA 3CO6C 4ENJA 1BBYA 5HLGA 1XDSA 4EJTA 4ESFA 4RB1A 3JTHA 5HVQC 4B8XA 1ODDA 4A5NA 2UWMA 5LGNA 3ZMSA 1I27A 3ML6A 3B02A 1GHCA 1IUYA 3TDUC 4Z2YA 2VE8A 1XN7A 1UB9A 3E6BA 4M9XA 3J81Z 1S7AA 4XRFA 3SZTA 2EFQA 1K6OA 3LA2A 3MCZA 4NB5A 4M9ZA 4KIBA 5E1XA 2EWNA 2OBPA 1REPC 4UNOA 2ADUA 2IW5A 1PUEE 1FWZA 4CDGA 4JQFA 4ZYEA 3J80K 4HDUA 4KIGA 1O3SA 5HS7A 5A2QK 4I2OA 5IT9K 4XLPF 4PGHA 3GUDA 1U78A 2JRTA 2IPQX 2JPBA 2FMYA 4YFNF 3QU3A 4A5MA 4LK1F 4RGSA 1SFEA 2LNBA 1LNWA 2RGVA 2IT0A 4I0BA 1XMKA 5D5VB 1UHMA 3I71A 1JE8A 2FMLA 1IXSB 3V7RA 4Q47A 4I0AA 4HX8A 3ZMTA 1OKRA 3TDZC 4OIOF 2EB7A 1ZREA 1BJAA 2Z9OA 1S3JA 3RKXA 3ZN1A 3TO9A 4FT8A 1IRFA 1MD0A 1CF7A 3F8BA 3F6VA 4KDPA 1R22A 2M5WA 2Q0OA 4WXHA 3WGIA 1SFUA 3COAC 4RB0A 3PQKA 1IXCA 1YQAA 2HQNA 5D4RA 1QO0D 4LLLA 2EA2A 4MQ9F 3E6CC 3HRTA 3FX3A 4HAMA 1ZRFA 4MHGA 3IWFA 3VEPA 1TNTA 3JSOA 2VT3A 4PZJA 3IKVA 2Q8KA 1P92A 1XGSA 3NQOA 3ECOA 1J9IA 4WX9A 2OD5A 3GZ6A 2RKHA 1C0WA 1BI0A 2FNAA 3MQ0A 4EM1A 3GW2A 4RB3C 4R1HA 2VE9A 2D2WA 4PCQA 2CO5A 3J80Z 1FBSA 1YO5C 2MC3A 5A2QZ 1FLIA 2ZJ2A 5IT9Z 5ICFA 1F4KA 2FEZA 3TGNA 4KMFA 5LEJA 3WODF 4U88A 4XSXF 2IVMA 4G7ZF 4U0VA 2HYFA 3ABUA 2K27A 1JGSA 4K2EA 5D6EA 5LHGA 4E70A 2EV0A 1G4DA 2OZUA 5ILSA 1U5TA 4OIRF 4HZFA 1QZZA 3I59B 4KN4X 1S8NA 2DQLA 1P4WA 4HLXA 4A6EA 2PQ8A 3WTYC 5E8IA 3ECHA 3E97A 2W57A 1NHAA 1Z9CA 3HSEA 5LRSA 1WI9A 1T38A 3DV8A 2NS0A 4P55A 1RUNA 3F8CA 1O57A 4A6DA 4WF2A 1SD6A 2NAZA 5IT3A 1B9NA 1R1VA 2FE3A 5L3DA 3TO7A 2PMUA 4HDVA 5D8LB 2RNJA 3EYIA 1J75A 2DT5A 3C7JA 3CO7C 1UHWA 3SZPA 1ZHFA 2FQ3A 1TBXA 4M74A 4UV8A 1IAWA 4LB6B 5J8FA 3V4GA 1KQ0A 4KYWA 2EFPA 1S7OA 4ASNA 2XAFA 4IRIA 3TOAA 2F5EA 4LFUA 2IA0A 3KEOA 2FU4A 3T8RA 4UHTA 2Y0MA 1USTA 1HSJA 3K1PA 1KYZA 2KIMA 1PP8F 2DO7A 3K1NA 1R00A 2NNYA 2C6YA 1BIBA 4L9TA 1L3LA 2KIUA 2PLYA 3KP3A 5BMZA 1R5GA 4A0YA 3HRSA 3GFLA 4GGGA 5EEHA 1IN6A 4HOBA 4MEXF 2RVCA 1K7AA 1JHFA 3HTUA 1F1ZA 3Q9VA 1Z05A 2Q2EA 2QUFA 4IVNA 1SMYF 5ICGA 4KICA 3FM5A 1K78B 1G3SA 4TV7A 4IRHA 2W25A 2GZWA 3F8NA 4M9SA 3ERED 2ZNZA 4BNCA 3MFKA 4OMYA 4WCGA 3WE3A 4D0PA 4UVAA 3L2CA 1HW1A 4GCVA 5JFRA 2UXNA 4HV6A 5F6FA 2XHKA 2O03A 3RYRA 5JR3A 2FSWA 1LDDA 1GXPA 3I54A 4QWQA 1IF1A 3WGGA 1BC7C 2M8EA 3WTTC 2L3DA 3SXYA 3T5XA 5D4SA 1F9NA 3ISPA 1PP7U 4R8HA 3WTVC 4MTDA 3RI4A 2OQGA 1BI3A 1Y0UA 5ERIA 1SAXA 4U7BA 3KP2A 1VTNC 1XCBA 5LGTA 2XROA 3K2ZA 4KNYA 2L02A 5FB2A 1I1SA 5FLXK 1O3RA 3MZHA 1YW7A 3KEQA 3F72A 4MTEA 2PMHA 1QPMA 2AS5F 2F5CA 2ISYA 1QNTA 4ZYDA 2HKOA 5J8CA 3ZMZA 3K9TA 3CJNA 3L9FA 2WTEA 4IHTA 1HBXG 4HF1A 3HIFA 1YW8A 1XCVA 2YPRA 2QZ8A 3F23A 1XB4A 2XVCA 4P96A 2QBYA 2D45A 3CUQB 1QBJA 4LB5A 4CYDA 2CG4A 1XSVA 2E7XA 3TOBA 2MA3A 5LHIA 5LEKA 4H0EA 5TJJA 5ED4A 3I4PA 1IRGA 3E5UA 3I0TA 3GFIA 2DI3A 3ZQ7A 1HXDA 3MAJA 2OU2A 4ESBA 2W85A 2LF8A 2ACJA 3GZ5A 1G3WA 3DP7A 2DPDA 2G7UA 1OYIA 3R6SA 1IXRC 2GQQA 4HLYA 4ENKA 3BWGA 3VB2A 4L18B 4PGGA 1HSTA 2PG4A 5ILVA 2G9WA 2MBFA 3I59A 2J5OA 1YS6A 2O3FA 5BS6A 1EH6A 4LG0B 2XRNA 2VOOA 3BJAA 4UUVA 1HW2A 1O3QA 3LQRA 1J5YA 3I58A 3FM3A 3GO5A 3HHHA 3IRRA 1TNSA 2R3SA 2CFXA 4L0ZB 3RYPA
chains in the Genus database with same CATH superfamily
4AU7A 2ELKA 3VOEA 2B63J 4EVIA 1TWAJ 1Z77A 3FBIB 4KMUX 3BQYA 3R4KA 3V7SA 4BDYA 4XNFA 4RB2C 2JA5J 1LB2A 3FMQA 2MC4A 4EMSA 2DU9A 4JYKA 4PJJA 3I53A 4BHCA 4BYYA 4FASD 1OQYA 1ZAOA 3OYLA 5KCMA 1ZR4A 4A3EJ 4A3MJ 2EQRA 1JKPC 4WXDA 2ESNA 1OMIA 1OCRH 1O7FA 1W7PA 2CQKA 3I4MJ 3G2BA 3J7YJ 4Z6YA 3S32A 4IQJA 5E1WA 2H09A 2QM3A 3W6VA 2XRLA 4ZYHA 5ICEA 2X1EA 4L5EA 4C3JJ 2STTA 1FT9A 3K7AJ 4A3KJ 3JW4A 5CVVA 3SHFA 4MNUA 2XKPA 4QLCU 1LEBA 3LFUA 2LBFA 4NDLA 2X48A 1YHQI 2HZDA 1YIOA 4XRSG 4DBRA 1FYMA 2IA2A 2Z16A 4Y4RA 4FETA 4WXCA 4XBFA 1IDZA 4KUMA 4CH7A 1B1BA 3S1NJ 1IDYA 2TCTA 3C3WA 4S04A 4MIMA 1BR2A 3OYGA 2DMPA 5EYRA 2VBWA 3ABLH 1ULYA 4IRGA 3L2WA 2QQBA 4NNJA 2A6EF 4HRIA 1MH4A 1TW3A 4HV5A 2FBKA 2K86A 3DF8A 3FXMA 2RN7A 3AL0B 2FD5A 4EJUA 4MEYF 3F8MA 3L2RA 1LVAA 4BH9A 2B0LA 2H6CA 4OAYA 4ETSA 1ZGAA 2LLKA 4UVCA 2GIVA 3BR1A 3U2RA 3VYUB 4AWXB 3H3UA 2CUEA 2GA1A 2E19A 3NEUA 1QU3A 2ZC2A 5DS9A 4CUGA 1Y39A 1MBKA 2YU9J 1YYVA 3ZMDA 1MDMB 2KZGA 3OR2C 2KDZA 2HS5A 4EQQA 1W1WE 1G59A 1RC9A 3CMEI 3RPQA 3DQVC 4LGWA 3CZ6A 1D8JA 1RZ4A 1ZG1A 5LLQA 1ZRDA 5IY5H 1XC5A 2E35A 1I3AA 3HJEA 4BL0B 2DA7A 3ZPLA 1T56A 5FRNA 4UB6C 2WAQA 4CCKA 1P4AA 5IP7J 1WQ2A 2A68F 1W5TA 2K02A 1YG2A 3G6EI 3DWLE 3M7GA 1KU7A 4A12A 2ZXHA 1N25A 4L9JA 1K78A 4I7HA 3S1RJ 3S2HJ 2CGPA 2XPVA 5D6FA 3GCMA 3CC2I 4YELA 3D0SA 3GF2A 2K9NA 1B59A 3IC7A 2QGUA 1X19A 2OCEA 1X4OA 2D1VA 3HSFA 3O3KA 2QSFX 1H88C 3KX2A 3MWMA 2P7VB 3CCMI 3CMAI 4JK1X 3QPTA 2WY8Q 1ZQ3P 4G7OF 3RQIA 1YJNI 5LHHA 2HFHA 1ZARA 2XAGA 4GO1A 4NQWB 1YI2I 1LPQA 4M72A 5BPDA 1MGTA 4BS9A 3FMSA 3K4CA 1BI2A 4L9NA 3E5XA 1BI1A 2Y2ZA 3DEUA 3OYFA 5DM7F 3L2UA 1MJAA 2HR3A 5CVRA 5E3OA 1RNLA 3IWZA 3BG7A 4CXFA 1MJBA 5EZGA 3QRFF 1ZYRF 5F08A 3MEXA 2H27A 4F92B 4L0YB 1E17A 4G94A 3PO2J 3ZP5A 3DKWA 5FROA 3NARA 2EZIA 1A04A 4GRIA 4U0WA 4D7MA 4CCJA 2ZB9A 1FYKA 1WCMJ 4HX4A 4G7HF 3S1QJ 3KLOA 2VXZA 5F04A 2L2OA 3HUGB 3DFGA 4UB8C 2KPMA 2V4JC 3KPHA 3RKWA 5F1RA 4IHXA 1D8KA 2EV5A 4RBOA 2HVRA 1TT0A 3ZQGA 1R5ID 5FKNA 1U5TC 3C2GA 1FX7A 2W24A 4XLNF 3QYFA 3ZMUA 4F52A 4HW0A 5D5UB 2M0CA 3VODA 2LY9A 1LUJB 3C2BA 4OINF 1R4MB 1K79A 2JMWA 1OPCA 3CESA 3OYEA 2LC2A 4FQGA 1MBGA 3B73A 5BNGA 3BR6A 3MN2A 4RAYA 5KNLA 3M4OJ 1B8IA 1H9TA 1N77A 2F6CA 2TRTA 3OL4A 4B47A 4HA8A 5ICCA 2PEXA 5GADJ 1B9MA 3KZYA 4DYRA 2XSJC 5K5RA 4XLEA 2RC4A 2EZKA 5CQGA 1WJAA 3V8KA 1D0ZA 2F2EA 4W97A 2EH3A 3S8PA 3TW7A 1X1DA 4Y33A 1Q1VA 3S14J 4BEHA 1UMQA 2Q1ZB 1ETXA 5HLIA 1BM9A 3HTSB 1IGNA 5FD5A 1IW7F 2LDUA 2XB5A 3LSKA 5FO5A 2JA6J 5HDGA 4L5IA 1OCPA 2HQRA 1HW5A 2KL4A 5GPAA 2LKPA 1MIJA 2W1OA 3ROUA 2COMA 2VQCA 4RAGA 3OYMA 2L4MA 1JTXA 1YW9A 1M1EB 2CWEA 4I09A 1DP7P 3RZDJ 2LSOA 1O4XA 1R58A 2HNHA 3H0GJ 2JA2A 3CUQA 2VQLA 4DJAA 1MMSA 5E18F 2R93J 1ON1A 3JRAA 2ZBKA 2OCCH 1TQIA 3EUHC 3K70D 3RZOJ 1B72B 4NHJA 1LQ1A 3M9AA 1V55H 2FBIA 4A3IJ 1MJ9A 4G6DA 1XD7A 2PMZN 1P7IA 2K4BA 1GLNA 4B1RA 2DT7B 4KJZA 4M3BA 1U8RA 2Y48A 4Y15A 4XLFA 3QU6A 4UY8I 2QA4I 2CU7A 1R1UA 4DYCA 2X6WA 2VB6A 3WG7H 2MGQA 4HX7A 4HQEA 3LSGA 4G6QA 2HYJA 1VQPI 5GP9A 3MVPA 3QPLA 5HS9A 1DPUA 1U2WA 1IN4A 2M3AA 3HOZJ 4RAZA 1ETKA 3BQZA 3RKQA 2QLZA 5EGOA 4B09A 2GXGA 3QYEA 5JHFA 1MKMA 2YX4A 5K7HA 2CYYA 2NYXA 3HOSA 2DW4A 2VJJA 3VWBA 4G9YA 2DFEA 3KP4A 4RS8A 2F5FA 3EUHA 2Z1DA 3LAJA 4LG0A 2R7TA 3DPLC 1PDNC 2FOKA 4XLCA 2LR8A 1W4MA 5AONA 5CVUA 1OCTC 2EA4A 1JKRC 1G2HA 1ZG5A 2VC1A 1TZLA 1OLTA 1JUPA 4AIHA 3QQAA 1W36D 4E7SA 1XDUA 5K5OA 1ITYA 2M8GX 3KETA 2G0EA 1OCCH 2JPCA 3RCOA 5DTDA 5HNHA 3PSFA 4A3GJ 4XKVA 5DV5A 3O6BB 4KN7X 1WH7A 3ZQCA 2H1KA 1I6XA 3Q9SA 4IXAA 1BR1A 5KAFC 1EV7A 3RPUD 3CCYA 3TBIA 3EYYA 3VPRA 1QQIA 4L5JA 4PJNA 1HKSA 2M30A 1DGRM 1ZG3A 5C3EJ 5J4VA 3JRGA 2QYOA 4J00A 3BCBA 3V7CA 2BYVE 3H35A 3U1DA 2V9KA 2XAHA 2JSCA 4ZTFA 4Y3OA 2JUGA 2X1CA 1P9QC 4YEJA 1R49A 2W82A 2A05A 4AVZA 4Y52J 2P5LC 1S29A 2AXLA 3J7AO 2VPRA 1KU2A 6PAXA 4LIUA 1U9OA 3V8LA 1TQPA 1IJWC 2ESHA 4D5CA 2OZ6A 3HG9A 2M4KA 3W6JB 3S3MA 3TO6A 4MQVA 4F7ZA 5E20A 1VQ5I 1GVJA 2W00A 5DD8A 3R60A 2M1BA 1BIAA 2RQQA 3FIWA 3K0LA 3QP5A 3SZGA 1FP1D 1XMAA 2O8XA 2Y31A 3R0JA 1F5TA 5LGUA 2F5DA 1R4NB 5TRDA 1LKXA 1WVRA 2ZKZA 3LFKA 4OOIA 5GAGJ 5DCMB 4AYBN 1UJ8A 5EEAA 4UUSB 4IOCF 4XORA 2CH0A 1G3YA 5H2FC 4OIQF 3EDPA 1EH8A 3M8EA 5DCFA 3FWEA 3BY6A 1OJLA 4L9VA 1HCRA 4EJOA 4HSTA 1IC8A 1PUFA 2QKMB 2XAJA 4LITA 3GFMA 1ZLJA 5B1AH 1KQ9A 2VJ5A 1V5EA 2EFOA 2OUMA 2YSRA 1FJLA 4XRSA 4BE1A 1ETWA 4ZTJA 3ELKA 1FNNA 1Y56A 2I10A 4F91B 1D1BA 3H9GA 5FGMA 2FBHA 3WTWC 4A3DJ 3KP6A 1MDMA 4Q4ZF 5E79C 3RSNA 3X2QH 3T8TA 4PJ0C 4GYGA 1SFKA 3LSMA 1AWCA 4IHVA 2VPLA 2VBYA 2HEOA 1LFPA 4RGRA 1FBQA 3CMMA 2KKOA 3CTAA 1TT5B 3FHZA 1T98A 2GWRA 4BQAA 4ZH4F 4IJAA 1HLVA 5E3MA 3WTZA 3U21A 2Y9YA 3H3VK 3D5LA 1XTAA 2YU3A 2Y75A 1B4AA 2L4AA 2GIZA 4XQFA 5L3FA 3DU5A 4CZZA 2D1HA 2DDAA 5FKMA 3LMMA 4DBQA 2WB1N 1R71A 1HF0A 4A93J 5L3BA 2PI0A 2ZSIB 3IKTA 2IBDA 4C3HJ 5J1RA 2A6TA 4BJ6C 4M71A 1R7JA 1MBJA 2VOPA 5F0HA 5AIQA 3ZMVA 2IS6A 3P9CA 2DODA 2V6CA 4LIVA 5J1YA 5CJ9A 4D1QA 1XGOA 1MBEA 4H4KC 3CCUI 3KLNA 1LFUP 4MGRA 2HGCA 4NQWA 1D5VA 3SFZA 4LK0F 4JX6A 1T2KA 4N9HA 2F4MB 4IQ4A 1ZGJA 3CLOA 3BTCA 3KYCB 2X0LA 4FE4A 3FXUA 2OQRA 1HA8A 3VFZA 3LSHA 1RR7A 1VFCA 4ZZDA 3TP3A 3OYJA 1J2XA 2P7CB 1R36A 3I5UA 2QQAA 1XGNA 2VQGA 1YS7A 2NRAC 2HVSA 4YIIA 1Z1DA 2HDDA 4KIFA 4YFKF 1H0MA 2IJLA 3G73A 4E4HA 2NVUB 2QVOA 2KQRA 3HUGA 4NC8A 2WADA 2VKDA 2VODA 4LLGF 1EF4A 1FPQA 2LVSA 2GXAA 2XC7A 5LRRA 4LLNA 5J4YA 3M3YJ 2NVTJ 1R1TA 3J81K 4UXNA 2BE5F 4EM2A 1BL0A 1DDNA 2CW0F 5DM6F 2QWWA 2R0QC 2BBYA 5HLHA 1FTZA 4ZYAA 3RIRA 3BTLA 4IF4A 4BKXA 5M3FJ 3JAMK 4CHUA 3GWZA 2FXAA 2P5KA 3D5RC 3ZCOA 2ZNYA 4D5FA 3NWTA 5K7FA 1YRNB 3H3ZA 1AU7A 1LJ9A 4BJ5C 4CO8A 2RAEA 2FQ4A 2LREA 3LA7A 1E3HA 5EEGA 4RGUA 1MBHA 4HYEA 2DT6A 3LNQA 3IL2A 2L01A 5DDGA 2DA2A 3QAHA 2WBMA 2DLLA 2DQRA 2O6GE 2VI6A 1JGGA 2L9SA 3HOWJ 2PJRB 2CV0A 3A2KA 1S72I 4HQMA 2R7QA 2WY7Q 3PUFA 1OR7C 5HDNA 4E6KG 5KHDA 1X4PA 3SDBA 1TWHJ 4M73A 4UVBA 2JVGA 1ZH5A 3G1OA 1FOKA 3VYRB 4YFXF 3JRIA 2K4JA 4Q48A 1DQUA 2O61A 2DBBA 2E5ZA 3LA3A 2UXXA 2A5YB 4BE2A 2IEKA 2L7FP 2KJCA 2Z3YA 2CW8A 4BY7J 3LAPA 3FKIJ 1Q1HA 3U9GA 1B72A 1WH5A 1X1CA 2IS4A 3UR3C 3HDDA 4I6ZA 4A69C 5J47A 3FXKA 1FOYA 1TWGJ 3F21A 1FZPB 2HWVA 2Z2SB 1WJCA 2YR2A 4NUBA 2V1DA 2BY1A 2D5VA 4WK8F 3P9IA 2ZXIA 4AIJA 3H92A 1XGMA 3LSTA 4WWCA 3CQZJ 1J0RA 2R7XA 5HS8A 3BPVA 3ASOH 2K3FA 1OR7A 5IP9J 2PBIA 4HEA2 1BC8C 1X1PA 1V3FA 2VQHA 3GBGA 3H5AA 4XMYA 5FLXZ 4CYCB 1KU9A 1XX5A 3IH2A 5KK1A 3MKYB 2LTPA 3MMYB 1ZK8A 1BJZA 2CS3A 4IHYA 2AXTC 2HOAA 4AVPA 2R5YB 3OY9A 2ZJPF 3F6OA 3CC4I 1EH7A 1FC3A 1G3TA 2DA5A 2KT0A 4EATA 1HDDC 2TDXA 1IZ1A 2X51A 3OIPA 3ZQHA 4O5VA 4U0YA 1KA8A 2EV6A 1L0OC 3CCEI 2DOAA 1P2FA 2VC0A 3OSFA 3H9QA 5D8KB 4NBQA 3WU2C 2YX7A 2X6OA 2L7ZA 2R7FA 4C9YA 1KYWA 1FIAA 1RR8C 2O0YA 1TQMA 3KFWX 2ISZA 3WU0A 3WTUC 4I02A 2XPWA 4E7IA 3AAFA 1KU3A 5L3GA 3TEDA 1YITI 3CJRB 3LWFA 4P1WA 4R79A 3OS2A 4EV0A 1DPRA 5BPIA 3ABMH 5J40A 2EJRA 1WJDA 2M45A 4NC7A 1WJ5A 1SVOA 2Y30A 5FLVA 3FMRA 3KCCA 3JAMZ 3R0AA 2LKXA 3BT9A 3S17J 2JTVA 2EFNA 4CCLA 2Z99A 5FKLA 3QPHA 2FRHA 1IN7A 1Z7UA 3HPHA 2Q2EB 2BV6A 3BJ6A 2NVQJ 1YTYA 1WPKA 5B3SH 3S1MJ 2E1OA 3ABKH 4BXUA 1KGSA 4J01A 2VN2A 4ZDLA 5LD2C 3CCLI 4Y13A 2E71A 3K1MA 2L9NA 1MZBA 4ITVA 1K83J 5JVTA 4UV9A 5HOOA 3BP8A 3HL2A 4JOMA 2L54A 1T39A 4M3FA 1WKMA 4BHBA 5CYVA 5FFXA 2ZJQF 4DW6A 2ETHA 2V7FA 2IS2A 3F8FA 5DCMA 5K7ZA 4UUSA 1POGA 2EINH 2HTSA 2K85A 2HDWA 2KJBA 9ANTA 3H36A 3MKLA 3GFJA 1ZLKA 3K70C 3CCQI 1OCZH 2VBXA 4P5OA 1MMNA 4XL9A 2DFIA 4P9FA 1NG6A 3DLLF 1JKQC 4C2UA 3JTGA 3F3XA 3CUOA 2FJ1A 3DXJF 2CQ7A 1STZA 4FTHA 1W7PD 1RUOA 1SMTA 2ZXJA 3H5RA 1QGPA 1U6GA 2ZO4A 3W6KB 1LE8B 2DPUA 2IAIA 4U7DA 2RV8A 5F0CA 1W5SA 5GAEJ 5LFAA 3OYHA 4CCMA 2HTJA 3PQJA 4KISA 1P6RA 2LOOA 3PM1A 1WJEA 2PN6A 2V1UA 2LRDA 4DGWB 3RDIA 3MKWB 3PUBA 3I64A 4DZPA 5E8GA 1TLHB 2CFOA 2CUZA 4GXOA 5HDKA 2LYCA 1Z6RA 5M5YJ 4FHTA 5H6RA 1FYLA 3WE2A 4J19A 4MO7A 4A3FJ 2OC6A 3A0HC 5CLSA 1Y1WJ 3CC7I 2E7WA 2WAFA 4AD9A 5JHUA 2R7DA 2KIFA 1Z7LA 3G3ZA 3PNYA 3OWTA 3GYHX 3PSIA 4RGXA 1FSHA 1YJ9I 1YJWI 1ETQA 2QF7A 3G1LA 1Z91A 4ESJA 1G6NA 3K6GA 5TISC 3L7WA 2DAOA 2HKXA 4ZYGA 4LJZF 2HU9A 1MH3A 4N4NB 1UHSA 3BC8A 3GTGJ 4S0HB 2E1NA 1X1BA 1JT6A 2NOGA 3WG9A 2QENA 1W36C 2MSYA 1V4RA 2B7EA 4KT6A 2M0MA 2VONA 2A69F 5DYMA 4GFBA 5DUKA 3HHGA 2STWA 2DK8A 2XUBA 2W7NA 5AIPA 1SD7A 4P9UA 3M1EA 5H6QA 2DK5A 1W0UA 3JSPA 5E3LA 3FXJA 3FKJA 3SYTA 3OYNA 2LY1A 1ON2A 2LH9A 3KZIC 2G7HA 4ON0A 4PUSA 3CUQC 5F64A 4M3DA 2H94A 2HYGD 2FF4A 2NNNA 4XKCA 5GTIC 4ABZA 4E7ZA 3S3OA 2JA8J 3HXLA 3ZQFA 2DYRH 4A3CJ 3RTRA 2R7WA 3ERMA 2QBYB 1QHHD 2Y0SN 1RRJA 2K5CA 3OIQA 1YOVB 4KT5C 3BPXA 2VT2A 3LSJA 4ZJZA 2EFWA 2WAEA 4ZDPA 3Q0WA 1SFXA 2RQPA 5D5WB 1IN8A 1J7KA 2I5UA 4BGDA 5DUIA 2X6YA 1TTYA 3DU6A 3V42A 3VYTB 2DTRA 4MFEA 4M3GA 1YX5A 2BGCA 2ELJA 3OR1C 3A01B 3IV5A 1JXSA 2GXBA 1HKQA 3GTOJ 2HDCA 1R9TJ 3DBRB 3BZCA 2ZMEB 3CCRI 2HPMA 3RPUA 3HRUA 4FE7A 3GX4X 2EBIA 2IA1A 2O8KA 1LEAA 4BE0A 1W0TA 1FP2A 3BROA 4DQ2A 2JA7J 1AOYA 2GOXB 1Y8RB 2V79A 1WI3A 3K4LA 3OL3A 1P7JA 1MMDA 3KE2A 3QOEA 1RIOH 4DYQA 1VQOI 3S93A 2M7BA 2JK3A 3LSRA 3MZ8A 1YLFA 3TKYA 1XMXA 2K9MA 4M6YA 3OSGA 2UV1A 3EETA 1E3OC 1UFMA 1WGXA 1ZKGA 1TC3C 1WWXA 3HYIA 1Z6TA 3V8JA 1QZYA 2J5PA 3CCVI 2DA3A 5B66C 3PJRA 2WA0A 3GTJJ 1IG7A 2IGKA 3C18A 3DEEA 2PJRA 1HC8A 2XAQA 4XN0A 2PJPA 3A1YA 3PFIA 3HRMA 1DU6A 4HF2A 4HNUA 4O3MA 5C4XJ 3ZXSA 3D1NI 4EGYA 3HSRA 3N4MA 5BOXA 1OYWA 1OCOH 1HQCA 4JP0A 2OF7A 3N97A 1QA6A 3QOPA 5HODA 4OU0A 1LDKB 3H9JA 3WTXC 1PJRA 3K4BA 3K4NA 4N0BA 3K10A 1D0XA 3T1BA 3IRQA 2R7RA 4ZDOA 1LDJA 2IRFG 1G8XA 2A3SA 2CRGA 2ZFWA 4BDZA 4DZJA 2OAZA 3ZQLA 1FIPA 4B48A 1FEXA 4A3LJ 1LVKA 5DEQA 4IEJA 1Z67A 3LQQA 1W7PB 1ZGWA 1MBFA 2IXSA 2JUCA 3W2WA 2V6EA 3KZZA 3M8FA 5FD6A 2A5WA 1BW6A 4RA2A 1SANA 3QODA 1K61A 3RKYA 1AKHB 4AC0A 3SQNA 4QSHA 1TW2A 2X9DA 2GA2A 5L3EA 1VQ7I 3M1CA 1JHHA 2XF7A 2HI3A 4BXFA 2PMZA 1S6LA 5ILUA 2CMPA 3DEWA 5B5EC 3WGHA 3E3VA 4FX4A 4CYCA 2XGXA 4IHSA 3BG9A 4OMZA 5L3CA 4XLHA 3S2DJ 1HDPA 1JUMA 2JN6A 3P7NA 3AL0C 3E6MA 1T0FA 2XSDC 3GLXA 2FA5A 5CQEA 4ENNA 2XKOA 4HF0A 3W2AA 3FXQA 5D5XB 1O3TA 3ZN0A 3FZVA 1JJ6C 3GTKJ 4Q5SF 1USSA 3BDDA 3NWSA 4IZZA 2QCOA 2HXIA 4M3EA 1WSUA 5F0FA 2KLOA 2P4WA 5FKOA 4B3XA 1SEUA 3GXOA 3ASNH 1SFOJ 5K5QA 1SD4A 1VI0A 2ECCA 2AQFA 2HZTA 1Y1VJ 3HOVJ 3BZ6A 2XASA 3ZQQA 4CGZA 4G8XA 2IP2A 4B43A 2JVHA 1GXQA 1VZ0A 4RDUA 2AQEA 1H9GA 3G71I 3S2WA 3FF5A 4QIWN 1ZRCA 3R61A 1T6SA 4LD5A 4FISA 2H8RA 3BLYA 5HLTA 3BG3A 5CPRB 1E2XA 3CF2A 4OAZA 2WWYA 3K69A 2P5VA 3CDHA 2K40A 2LMDA 4M6VA 1YX3A 4PDKA 5CKTA 2L5QA 4CICA 2Y9ZA 3TQNA 1WFXA 2NVYJ 2JT1A 5E17F 2KISA 1ORKA 3QP6A 3KP7A 2E2IJ 3I4NJ 1NG7A 1FBUA 1KONA 2R7UA 1UG0A 1H89C 3L09A 1BR4A 5JI6A 3ABTA 4CSWA 5KVRA 1X3UA 5K1YA 4BHPA 1SD5A 1CF7B 3BOQA 2KMUA 3KP5A 3G1MA 3Q5FA 3UNGC 3A03A 4G12A 2Z33A 3ZQIA 1QRYA 4A2UA 4BJTA 2P81A 4HBLA 3C1DA 4EM0B 5M5WJ 2L7MP 3MD2A 3GLLA 2FNPA 2ME0A 2VXDA 5EJCA 4I98B 1YFHA 5C44J 1JT0A 4RM2A 2K9QA 4EGZA 1OYYA 3HBLA 3OYIA 2XGDA 2LK2A 2VASA 4LMYA 4XIDA 4XN3A 3SFIA 3ONQA 3ZR8X 2M4GA 4ZZLA 1FTTA 3HKZN 3WU1B 3G4SI 3P9KA 1WZ2A 4BBSJ 5LBQA 2DOEA 2BOLA 2HOEA 2KFDA 2N8GA 4AYBA 2VBZA 2PFBA 2XF6A 3VSKA 3FDYA 2MD5A 4I99C 2JQ7A 1VQ9I 5FFZA 2A61A 1K6YA 1I5ZA 1D3YA 4I76A 1NH3A 2KP6A 3GVAA 1K4TA 2P6TA 2X6XA 3DLAA 3RJPA 2GAUA 1QHGA 2H6BA 4YRVA 1LE8A 3KYLA 5BQTA 2V9VA 1JKOC 1MMAA 1VQNI 2BVMA 4IPAA 3GTMJ 1BN5A 2X1DA 5IYCJ 1NK3P 1U8BA 1Y6IA 4DNCA 1VQMI 1IN5A 5CVIA 1RKWA 2P6SA 4LG3A 3LSIA 3MZYA 3OYBA 2YS9A 4A3JJ 4RAFA 1ZN2A 2M87A 1VNDA 3W3CA 2L9VA 1HKTA 3JRCA 2MH9A 4QPOA 1BW5A 4Y17A 4B44A 2P8TA 2K7LA 2I8DA 2ZSHB 1O7LA 3GEZA 3H1CA 3AG3H 3P5JA 4XK4A 1KQ8A 1YE9A 4M6XA 5J1UA 2WV1A 2EK5A 4B3AA 3NRVA 3EQLF 2MLGA 2NVXJ 1FY7A 3E5QA 5E1ZB 4O6JA 3L00A 5FKKA 4KA4A 4KFCA 4XKBA 5EDNA 2LF7A 1R5HA 2UZKA 2WV0A 2Z5UA 3OV8A 2W84A 2FX0A 1FSEA 3BR5A 3CDIA 1UZCA 4BU2A 2HOSA 1SVLA 3JRHA 2E60A 3HGYA 1JTYA 2NXNB 3F22A 5H20A 2WB1A 4BEHB 4RM3A 4BAYA 3T0YA 2KRFA 1BOBA 2IS1A 1NTCA 1J59A 4X6AJ 4F93B 2OA4A 3M07A 3O2PE 4C2MJ 3JRBA 5B1BH 1U5TB 4IKFA 1V5GA 2CJJA 2CSOA 4JX4A 2CV1A 3QYBA 1T33A 4GYIA 1FOXA 2COBA 1EKEA 1SVMA 4HPQA 5CVJA 4AIKA 2LP0A 1Z21A 3GTLJ 5M5XJ 1ZR2A 3IHUA 2JRMA 2VKEA 3WHCA 5FLMJ 2RREA 3REOA 1WRJA 1I1GA 4OIPF 2OTJI 2EPFA 5J6XA 3IH4A 1UG2A 2NS8A 2XB0X 4IL6C 1UCRA 3CDLA 3K4JA 1K4SA 4S05A 1TP4A 3ULQB 3ESWB 2ZXWH 4XOPA 4XR6A 1RI7A 2XV4S 4FX0A 1B6AA 2WC2A 2H8WA 2JZYA 5JLXA 3WTSC 3JRDA 3A01A 2RDPA 4BXXJ 4YIFA 1ACIA 1ONVA 2V1NA 2A6HF 1JI8A 2XPUA 3BJOA 3N05A 2BEOA 1X1AA 2EIJH 2ZMEA 1P4XA 1XSXA 3DKYA 4XRMA 4N9IA 2E1CA 4RMNA 1GVDA 3M8JA 4A0XA 1TWFJ 5DD4A 2A07F 2FOWA 3E6DA 2QSHX 3HOTA 1UAAA 3FXRA 4PJLA 4LOCA 2QQ9A 2XF5A 2VLAA 1CGPA 3AG2H 1ENHA 4BQQA 4KITB 4C3IJ 1H8AC 3L2QA 1MSEC 1BOAA 2V1XA 4A0ZA 1E0EA 1X2MA 3OOPA 1MW7A 2MH2A 2ELHA 3JRFA 4EJVA 3CJQB 2KRCA 4ENMA 1NK2P 1R23A 2ZCWA 4I01A 1I6HJ 3CLQA 2MLKA 1ETVA 4BQNA 1MMGA 3DPTA 2HQ5A 3Q0UA 4XICA 1A6QA 2BHYA 1I3QJ 4XSZF 2AO9A 2XIGA 2O9LA 1U3EM 1DUXC 1XS9A 1XSDA 4YG2F 4JBAA 4XM3A 2X4HA 3ZGKA 4EJWA 3CO6C 1BBYA 2EIMH 4ENJA 2DFHA 5HLGA 2CQNA 1XDSA 4EJTA 3CCSI 4ESFA 2GOMA 4RB1A 3JTHA 3JREA 5JVGF 2LG4A 3BR2A 3BZKA 4U87A 5HVQC 1MNDA 4B8XA 4XKWA 1ODDA 2QQ8A 3AG4H 4Y7NJ 4A5NA 3B6AA 1OISA 2UWMA 5LGNA 3ZMSA 3NAUA 1I27A 3ML6A 3B02A 1GHCA 1IUYA 3TDUC 4Z2YA 2VE8A 1XN7A 1T95A 1UB9A 3E6BA 2FUG2 4M9XA 3J81Z 1S7AA 4XRFA 1AKHA 3SZTA 4V2GA 3SJMA 2EFQA 1RETA 1K6OA 1RKTA 1AA7A 2WAQN 2K3PA 4HG2A 3LA2A 2E2HJ 1U0JA 3CD6I 3CMYA 2DJNA 3MCZA 3F0CA 4NB5A 3EUKL 4M9ZA 4KIBA 1X58A 5E1XA 2EWNA 2ID6A 2OBPA 3PFYA 3BTJA 1REPC 2IGOA 2R5ZB 4UNOA 2ADUA 3HOXJ 2IW5A 4OWRB 2DXIA 1PUEE 1FWZA 2V26A 4CDGA 4JQFA 4N4OB 4ZYEA 3J80K 3QPSA 4HDUA 4KIGA 5EG0B 1D5YA 1XPXA 2W4SA 4CZCA 4DIQA 1O3SA 5HS7A 5A2QK 2DTZA 2M7AA 4I2OA 5IT9K 1FMWA 1PUFB 2MFZA 3OYKA 4XLPF 2MABA 3C2HA 4PGHA 2BW3B 3GUDA 1U78A 2JRTA 2IPQX 1R6RA 2JPBA 2FMYA 4YFNF 1ZTRA 3QU3A 2GLOA 4A5MA 4LK1F 4RGSA 1SFEA 2LNBA 1LNWA 1VQ8I 2RGVA 2IT0A 1EA3A 4I0BA 1T08B 5TGTA 5GPCA 1XMKA 3OS1A 5D5VB 1UHMA 3I3LA 3K4KA 3I71A 1JE8A 2E2JJ 4CA0A 2FMLA 1RPWA 1IXSB 5F27A 3HPGA 3V7RA 1MNMC 2UUZA 1S7EA 2E36A 3A4CA 4Q47A 4I0AA 2CV2A 5IOZA 4HX8A 2M34A 1N75A 3SEZA 3ZMTA 1OKRA 3TDZC 1EJ9A 4OIOF 2EB7A 1ZREA 1BJAA 2VL8A 2Z9OA 4W1UA 1S3JA 2F48A 4EEFG 3AFHA 3RKXA 4XONA 2CQQA 1DU0A 3ZN1A 2VKHA 3TO9A 2W48A 1F43A 1WJBA 4F3QA 2K9SA 4FT8A 1V54H 1IRFA 1MD0A 1CF7A 2BXZA 3F8BA 3F6VA 3OIOA 4KDPA 1R22A 3FHNA 1IV6A 1IO2A 1Z3YA 2R4GA 1MNEA 2M5WA 2Q0OA 4WXHA 3WGIA 3S16J 3GTQJ 1SFUA 2E34A 3COAC 1S5LC 4RB0A 3PQKA 1IXCA 1YQAA 2VKVA 2HQNA 5D4RA 5E3NA 3JCUC 2R92J 2BZTA 2Y69H 1QO0D 4LLLA 4HSRA 3DTIA 2EA2A 3K4MA 3OOUA 3I55I 4MQ9F 3E6CC 2DJIA 3HRTA 3GZNB 4PJMA 2OV7A 3FX3A 4HAMA 1ZRFA 4MHGA 3IWFA 3OYDA 2B9SA 5IOYA 3VEPA 3TW6A 1TNTA 2DCEA 1DGWY 3HB9A 3JSOA 5M3MJ 2MG4A 4BY1J 2VT3A 4PZJA 2DMNA 1CQTA 3IAM2 3IKVA 2Q8KA 5IYDJ 1P92A 1XGSA 3NQOA 5JLWA 3ECOA 1J9IA 3FBNB 4WX9A 2OD5A 4E7KA 1Y0NA 2RKHA 3LSPA 3PNTA 3GZ6A 5GAHJ 1C0WA 1BI0A 2FNAA 3DBLB 3MQ0A 1E3PA 4EM1A 4D9JA 3GW2A 2KDOA 3AG1H 1TWCJ 2L0KA 3HOUJ 4RB3C 4R1HA 3HOYJ 3PO3J 2VE9A 2D2WA 2RNGA 4PCQA 2CO5A 3HZJA 2ICWG 3J80Z 3QWLA 2XGEA 1FBSA 1YO5C 4RLQA 2MC3A 5A2QZ 1FLIA 2ZJ2A 5IT9Z 1VQKI 5ICFA 2KZVA 1F4KA 1A6IA 1I50J 2FEZA 3TGNA 5FJ8J 2BY0A 3TL4X 4KMFA 1ETYA 1FOWA 5LEJA 3WODF 2QEXI 1IRZA 4U88A 4XSXF 2ZFUA 2QSGX 2IVMA 3VDXA 4D7NA 4G7ZF 4U0VA 2HYFA 1UELB 1XG1A 2LY2A 4B4CA 3ABUA 2P0WA 2K27A 4II3A 1JGSA 4K2EA 1DP3A 1JJ8C 3FK6A 5D6EA 3IP4B 2CUJA 3U1KA 5LHGA 1I39A 4E70A 1GDTA 2EV0A 1G4DA 1VQ4I 2OZUA 4E7LA 5ILSA 1U5TA 4C30A 4OIRF 1YRNA 5IYBJ 1A5JA 4HZFA 3DTEA 1QZZA 3I59B 3J7ZI 1GUUA 4KN4X 3FXLA 1APLC 1S8NA 2DQLA 4BBRJ 1P4WA 2EZLA 4HLXA 1HOMA 2R7ZJ 4A6EA 2PQ8A 3WTYC 5E8IA 4HNVA 3ECHA 3DTKA 3CCJI 3E97A 3AKZA 1ERDA 2W57A 1NHAA 3DCFA 1Z9CA 4E7JA 3PIOF 2Y0SA 2R7SA 3S3NA 3HSEA 2AHQA 2F4IA 5LRSA 5C4JJ 1WI9A 1T38A 1SAUA 1W5CC 2ZJRF 1FMVA 4C2TA 3DV8A 2NS0A 1T0FC 1IV8A 4P55A 4BUPA 4CCOA 2X85A 4G6TB 1RUNA 1ZELA 3F8CA 4FCYA 2L7KA 1O57A 4A6DA 4WF2A 1SD6A 2H1LA 2NAZA 5IT3A 2M9HA 4AIDA 2E1MB 1S9HA 3FISA 4V19K 3EPZA 1B9NA 4ANJA 4IHWA 1R1VA 3PNVA 2FE3A 5L3DA 5EF6A 5J3LA 3DKXA 3IH3A 1WJFA 1OFCX 3TO7A 4CCNA 1IUFA 2PMUA 1PYVA 4E7HA 2IGMA 4HDVA 3PL8A 5D8LB 3OMYA 2RNJA 1N78A 3EYIA 2EIKH 2LBFB 3A0BC 3ZRGA 1J75A 2DT5A 2BVLA 3C7JA 3CO7C 1UHWA 3SZPA 1ZHFA 3CF5F 3WHBA 2HXOA 3KYDB 3I9V2 3OS0A 2FQ3A 5EZHA 1TBXA 4M74A 4UV8A 3UKGA 3KIOA 4LB6B 1IAWA 5J8FA 5F1JA 3V4GA 1KQ0A 4KYWA 2JWTA 2EFPA 2DYSH 2R5YA 2V9PA 1S7OA 2OJED 4ASNA 2MD0A 2XAFA 2VUMJ 4IRIA 3TOAA 2VJIA 1GV5A 2F5EA 4LFUA 2IA0A 3KEOA 2FU4A 4UHTA 2YUSA 3T8RA 2Y0MA 1USTA 2DA1A 1HSJA 3K1PA 1KYZA 2KIMA 2CW7A 4ZC3A 3J7AY 1PP8F 2DO7A 3K1NA 1T8IA 1R00A 3I56I 1YIJI 2NNYA 2C6YA 1BIBA 4QPQA 4L9TA 1X3WB 4NC6A 4PFOA 2VIXA 1L3LA 1QZEA 4PSWA 3ZOBA 2KIUA 2PLYA 3KP3A 5BMZA 1R5GA 1BA5A 4A0YA 3L1PA 3HRSA 3GFLA 4GGGA 3DBHB 5EEHA 1WHUA 3W2VA 1IN6A 4HOBA 4UUTA 1A31A 4MEXF 2RVCA 1K7AA 1JHFA 2QKLB 3HTUA 1F1ZA 5IPAA 4QTRA 1MSFC 3Q9VA 2R5ZA 1Z05A 2Q2EA 2QUFA 2XAUA 4IVNA 2OPTA 3FK7A 1LFBA 1SMYF 1U9NA 5ICGA 4KICA 3FM5A 5EG0A 2JSPA 1K78B 1G3SA 1IRXA 2OTLI 2XGCA 2K9LA 4AUXA 4TV7A 4IRHA 2W25A 2GZWA 2BW3A 3H0DA 3F8NA 2GBYA 1D1AA 4M9SA 3ERED 4BACA 2ZNZA 4BNCA 3MFKA 4IX7A 3D5SC 2DA4A 3BCAA 4AM3A 3A02A 3OYAA 2GM4A 1X2NA 3K2AA 4OMYA 5KAIC 3HC7A 2DN0A 4V2FA 4WCGA 3WE3A 4D0PA 4UVAA 3L2CA 2KHMA 1HW1A 3S15J 2XDVA 4X1EA 4XOTA 3EUAA 4GCVA 2HVQA 5JFRA 2UXNA 2BXYA 4HV6A 5F6FA 2F5VA 2XHKA 2O03A 3E7LA 2IGNA 2EILH 2CUFA 3RYRA 2BY3A 5JR3A 2FSWA 1LDDA 1GXPA 2DFFA 1QVTA 3VSLA 3I54A 4QWQA 1IF1A 4PK4A 3WGGA 1BC7C 2M8EA 3WTTC 2O5RA 2L3DA 3SXYA 4JX5A 3T5XA 1GT0C 5D4SA 1F9NA 2HPIA 3ISPA 1PP7U 3O8GA 4R8HA 2DMTA 2ME6A 3WTVC 3CP8A 2EZHA 4MTDA 3RI4A 2OQGA 3OYCA 1BI3A 1Y0UA 1AHDP 3LL7A 3O8HA 5ERIA 1SAXA 2JJ7A 4BQOA 4X0GA 3F9KA 4U7BA 2LD5A 3KP2A 1VTNC 1XCBA 5LGTA 1TL8A 1X3ZB 2XROA 2DOFA 3JR9A 3K2ZA 4KNYA 2L02A 5FB2A 1I1SA 5GTHC 5FLXK 1A36A 4DOZA 4F55A 1B8IB 1A35A 2NS7A 3MZHA 1YW7A 1O3RA 4A3BJ 3KEQA 3CJTB 3F72A 4MTEA 2PMHA 2CQXA 1D0YA 3DPUA 1QPMA 2AS5F 2F5CA 2ISYA 3HKZA 1QNTA 3BG6A 4ZYDA 1KZHA 2R7VA 2HKOA 5J8CA 3ZMZA 1PVEA 4MFDA 2ECBA 4IO9F 3CP2A 3K9TA 3SEQA 3TMOA 2BY2A 3CJNA 3FXOA 2ZMEC 2PX9A 3L9FA 1Z0XA 2WTEA 1QVUA 1HBXG 4IHTA 4HF1A 3HIFA 1VF9A 1YW8A 2DMUA 2LFBA 1XCVA 1Y8QB 1SC7A 2YPRA 3Q3SA 2QZ8A 4PFPA 3F23A 1XB4A 2XVCA 3HM5A 2KIQA 4P96A 2QBYA 2D45A 3SDGA 3CUQB 1QBJA 3H5NA 1GV2A 1D1CA 4LB5A 2BHZA 2R7OA 4CYDA 2CG4A 3LOCA 1XSVA 2E7XA 3TOBA 2MA3A 5LHIA 5LEKA 4H0EA 5TJJA 5ED4A 2DMQA 3BR0A 1J09A 3I4PA 2DA6A 3BTIA 3RQ4A 3BG5A 1IRGA 3E5UA 3HGGA 3I0TA 4RLFA 3GFIA 2L9RA 2ID3A 3PIPF 2DI3A 3ZQ7A 2HQAA 5FRMA 3IUOA 1HXDA 3MAJA 3VYSB 2NOJB 2OU2A 4ESBA 1Z3XA 2W85A 1VQLI 2LF8A 2ACJA 2E5NA 3GZ5A 1G3WA 4IOAF 3DP7A 2DPDA 2G7UA 4YIRX 1OYIA 2HOTA 2DDBA 4II2A 5HNFA 3R6SA 1IXRC 2GQQA 4GDFA 4HLYA 4ENKA 5IP6A 1RESA 5EGOB 3BWGA 3VB2A 4L18B 2VJ4A 1V5FA 4MLOA 1HSTA 3GMEA 4PGGA 3GTPJ 1QPIA 3Q0VA 2MW8A 2PG4A 5ILVA 2G9WA 2E1MC 4PSXA 2MBFA 2M2EA 3I59A 2MYSA 2J5OA 1YS6A 2O3FA 3L2VA 5BS6A 1EH6A 4LG0B 2XRNA 2VOOA 2LKSA 3BJAA 1JUSA 3HEFA 4XLAA 4UUVA 1HW2A 1O3QA 1F36A 3KEYA 3LQRA 3E0JB 3B6CA 1J5YA 3I58A 4HNTA 3IAS2 1ETOA 2O7OA 3FM3A 3GO5A 3HHHA 3IRRA 1TNSA 2R3SA 2CFXA 3E1SA 3MKZA 1VQ6I 2F4OB 3TP0A 3BR3A 4L0ZB 3RYPA 2KRHA
chains in the Genus database with same CATH topology
3VOEA 4EVIA 4KMUX 3R4KA 3V7SA 4RB2C 1LB2A 3FMQA 4EMSA 2DU9A 3I53A 4BHCA 4BYYA 1ZAOA 4WXDA 2ESNA 1OMIA 1O7FA 1W7PA 2CQKA 5E1WA 2H09A 2QM3A 4ZYHA 5ICEA 2STTA 1FT9A 3JW4A 5CVVA 3SHFA 4MNUA 2XKPA 4QLCU 1LEBA 1YIOA 1FYMA 2IA2A 4WXCA 4XBFA 4KUMA 1B1BA 3C3WA 4S04A 2VBWA 1ULYA 4IRGA 2QQBA 2A6EF 1TW3A 4HV5A 2FBKA 2K86A 3DF8A 2RN7A 4EJUA 4MEYF 3F8MA 1LVAA 4BH9A 2B0LA 2H6CA 4ETSA 1ZGAA 4UVCA 2GIVA 3U2RA 4AWXB 3H3UA 2GA1A 3NEUA 1YYVA 3ZMDA 1MDMB 2HS5A 4EQQA 3RPQA 3DQVC 4LGWA 1D8JA 1RZ4A 1ZG1A 5LLQA 1ZRDA 3ZPLA 1P4AA 1WQ2A 2A68F 1W5TA 2K02A 1YG2A 3M7GA 1KU7A 4A12A 1K78A 4L9JA 4I7HA 2CGPA 5D6FA 3D0SA 3GF2A 1B59A 3IC7A 2D1VA 3HSFA 3O3KA 3MWMA 2P7VB 4JK1X 3QPTA 4G7OF 5LHHA 2HFHA 1ZARA 2XAGA 4GO1A 4M72A 5BPDA 1MGTA 3FMSA 4L9NA 1BI2A 3E5XA 1BI1A 3DEUA 1MJAA 2HR3A 5CVRA 1RNLA 3IWZA 4CXFA 1MJBA 3QRFF 1ZYRF 3MEXA 2H27A 4L0YB 1E17A 4G94A 3ZP5A 3DKWA 1A04A 4U0WA 1FYKA 4HX4A 4G7HF 3KLOA 2VXZA 3DFGA 3RKWA 5F1RA 1D8KA 2EV5A 1U5TC 1FX7A 2W24A 4XLNF 3ZMUA 5D5UB 4HW0A 3VODA 4OINF 1K79A 1OPCA 3B73A 4RAYA 1H9TA 4HA8A 5ICCA 2PEXA 1B9MA 3KZYA 5K5RA 2RC4A 3V8KA 2F2EA 5HLIA 1BM9A 3HTSB 5FD5A 1IW7F 2LDUA 5FO5A 5HDGA 4L5IA 2HQRA 1HW5A 2LKPA 3ROUA 2COMA 2L4MA 1YW9A 1DP7P 2CWEA 4I09A 2LSOA 1R58A 3CUQA 5E18F 1ON1A 2ZBKA 1TQIA 4NHJA 1LQ1A 3M9AA 2FBIA 1MJ9A 4G6DA 1XD7A 2K4BA 1U8RA 2Y48A 4Y15A 3QU6A 1R1UA 4HX7A 4HQEA 4G6QA 5HS9A 1DPUA 1U2WA 1IN4A 4RAZA 2QLZA 4B09A 2GXGA 1MKMA 2YX4A 2CYYA 2NYXA 3HOSA 2DW4A 4G9YA 3KP4A 4RS8A 2F5FA 3EUHA 3LAJA 4LG0A 3DPLC 1PDNC 2FOKA 1W4MA 5AONA 5CVUA 2EA4A 1ZG5A 2VC1A 4AIHA 1XDUA 5K5OA 3KETA 2JPCA 5DV5A 3O6BB 4KN7X 1I6XA 3Q9SA 4IXAA 1EV7A 3EYYA 1QQIA 4L5JA 1HKSA 2M30A 1ZG3A 2QYOA 3V7CA 2BYVE 3U1DA 2XAHA 2JSCA 2P5LC 1S29A 2AXLA 3J7AO 1KU2A 6PAXA 3V8LA 1TQPA 2ESHA 2OZ6A 3W6JB 3TO6A 4MQVA 4F7ZA 5E20A 1GVJA 5DD8A 3R60A 2M1BA 1BIAA 3K0LA 3QP5A 1FP1D 1XMAA 2O8XA 3R0JA 1F5TA 5LGUA 2F5DA 5TRDA 2ZKZA 3LFKA 4OOIA 5DCMB 1G3YA 4OIQF 3EDPA 1EH8A 3M8EA 5DCFA 3FWEA 3BY6A 4L9VA 4EJOA 2XAJA 3GFMA 1ZLJA 1KQ9A 2EFOA 2YSRA 3ELKA 1FNNA 5FGMA 2FBHA 3WTWC 3KP6A 1MDMA 4Q4ZF 3T8TA 4GYGA 1AWCA 2VBYA 2HEOA 4RGRA 1FBQA 2KKOA 3CTAA 3FHZA 1T98A 2GWRA 4BQAA 4ZH4F 4IJAA 3WTZA 3D5LA 2YU3A 2Y75A 1B4AA 2L4AA 5L3FA 4CZZA 2D1HA 5L3BA 2PI0A 3IKTA 4M71A 1R7JA 2VOPA 5AIQA 3ZMVA 3P9CA 2V6CA 5CJ9A 1XGOA 3KLNA 1D5VA 4MGRA 2HGCA 4NQWA 3SFZA 4LK0F 1T2KA 4N9HA 1ZGJA 3CLOA 2X0LA 3FXUA 2OQRA 3VFZA 4ZZDA 1J2XA 2P7CB 1R36A 3I5UA 2QQAA 1XGNA 1YS7A 2NRAC 4YIIA 1Z1DA 4KIFA 4YFKF 1H0MA 2IJLA 3G73A 2QVOA 3HUGA 2VODA 4LLGF 1FPQA 5LRRA 4LLNA 1R1TA 3J81K 4UXNA 2BE5F 4EM2A 1DDNA 2CW0F 2QWWA 2BBYA 5HLHA 3RIRA 4IF4A 3JAMK 4CHUA 3GWZA 2FXAA 2P5KA 2ZNYA 3H3ZA 1LJ9A 4CO8A 3LA7A 5EEGA 4RGUA 4HYEA 3IL2A 2L01A 5DDGA 3QAHA 2DLLA 2DQRA 2O6GE 4HQMA 5HDNA 4M73A 4UVBA 1ZH5A 1FOKA 4YFXF 2K4JA 4Q48A 2O61A 2DBBA 3LA3A 2UXXA 2A5YB 2KJCA 2Z3YA 3LAPA 1Q1HA 3U9GA 3F21A 1FZPB 2HWVA 2YR2A 2V1DA 4WK8F 3P9IA 4AIJA 3H92A 1XGMA 3LSTA 4WWCA 1J0RA 5HS8A 3BPVA 1OR7A 2PBIA 1BC8C 1V3FA 5FLXZ 1KU9A 5KK1A 4AVPA 3F6OA 1EH7A 1FC3A 1G3TA 2TDXA 1IZ1A 4U0YA 4O5VA 1KA8A 2EV6A 1L0OC 1P2FA 2VC0A 5D8KB 2YX7A 2R7FA 1KYWA 2O0YA 1TQMA 3KFWX 2ISZA 3WU0A 3WTUC 4I02A 3AAFA 1KU3A 5L3GA 3LWFA 4R79A 4EV0A 1DPRA 5BPIA 2EJRA 2M45A 3FMRA 3KCCA 3JAMZ 3R0AA 2JTVA 2EFNA 2Z99A 3QPHA 2FRHA 1IN7A 1Z7UA 3BJ6A 2BV6A 1YTYA 4BXUA 1KGSA 2VN2A 4Y13A 3K1MA 1MZBA 5JVTA 4UV9A 5HOOA 3BP8A 2L54A 1T39A 4BHBA 1WKMA 5CYVA 5FFXA 2ETHA 3F8FA 5DCMA 2HTSA 2KJBA 3GFJA 1ZLKA 2VBXA 4P5OA 2DFIA 4P9FA 3JTGA 3F3XA 3CUOA 3DXJF 1STZA 1W7PD 1RUOA 1SMTA 2ZXJA 1QGPA 1U6GA 2ZO4A 3W6KB 2DPUA 4U7DA 2RV8A 1W5SA 2HTJA 3PQJA 1P6RA 2PN6A 2V1UA 3RDIA 3I64A 5E8GA 1TLHB 4GXOA 5HDKA 1Z6RA 4FHTA 5H6RA 1FYLA 3WE2A 5CLSA 2E7WA 4AD9A 5JHUA 2R7DA 2KIFA 3G3ZA 3GYHX 4RGXA 1FSHA 1Z91A 4ESJA 1G6NA 3L7WA 2DAOA 2HKXA 4ZYGA 4LJZF 2E1NA 3WG9A 2QENA 1V4RA 2VONA 2A69F 5DYMA 5DUKA 3HHGA 2STWA 2DK8A 2XUBA 5AIPA 1SD7A 4P9UA 3M1EA 5H6QA 2DK5A 3JSPA 1ON2A 2G7HA 4ON0A 3CUQC 5F64A 2H94A 2HYGD 2FF4A 2NNNA 3RTRA 2QBYB 4KT5C 3BPXA 2VT2A 2EFWA 5D5WB 1SFXA 2RQPA 1IN8A 1J7KA 5DUIA 1TTYA 2DTRA 2BGCA 1JXSA 2GXBA 1HKQA 2HDCA 2ZMEB 3RPUA 3HRUA 3GX4X 2IA1A 1LEAA 1FP2A 3BROA 4DQ2A 1AOYA 2V79A 3KE2A 1RIOH 1YLFA 3TKYA 4M6YA 3EETA 1UFMA 1WWXA 3HYIA 1Z6TA 3V8JA 1QZYA 2J5PA 3C18A 2XAQA 2PJPA 3PFIA 3HRMA 4HF2A 4O3MA 4EGYA 3HSRA 3N4MA 5BOXA 1OYWA 1HQCA 3N97A 3QOPA 4OU0A 1LDKB 3WTXC 3IRQA 4N0BA 3T1BA 1LDJA 2IRFG 2A3SA 2ZFWA 2OAZA 5DEQA 3LQQA 1W7PB 3KZZA 3M8FA 5FD6A 3RKYA 3SQNA 1TW2A 2GA2A 5L3EA 1JHHA 1S6LA 5ILUA 3WGHA 3E3VA 4FX4A 2XGXA 4IHSA 4OMZA 5L3CA 3P7NA 3E6MA 1T0FA 3GLXA 2FA5A 4ENNA 2XKOA 4HF0A 3FXQA 5D5XB 1O3TA 3ZN0A 3FZVA 4Q5SF 1USSA 3BDDA 1WSUA 2P4WA 3GXOA 5K5QA 1SD4A 2HZTA 3BZ6A 2XASA 4CGZA 4G8XA 2IP2A 1GXQA 1H9GA 3S2WA 3FF5A 1ZRCA 3R61A 1T6SA 4LD5A 1E2XA 2WWYA 3K69A 2P5VA 3CDHA 4PDKA 4CICA 3TQNA 2JT1A 5E17F 3QP6A 3KP7A 1FBUA 3L09A 5JI6A 3ABTA 5KVRA 1X3UA 5K1YA 4BHPA 1SD5A 1CF7B 3BOQA 3KP5A 3Q5FA 2Z33A 4A2UA 4HBLA 3C1DA 4EM0B 2FNPA 4I98B 1YFHA 4EGZA 1OYYA 4LMYA 4ZZLA 3WU1B 3P9KA 5LBQA 2HOEA 2VBZA 2PFBA 2MD5A 5FFZA 2A61A 1I5ZA 1D3YA 3GVAA 2P6TA 3RJPA 2GAUA 2H6BA 5BQTA 2V9VA 4IPAA 1BN5A 4DNCA 1IN5A 5CVIA 2P6SA 3MZYA 1ZN2A 2M87A 1HKTA 2MH9A 4Y17A 2P8TA 2K7LA 1O7LA 3GEZA 1KQ8A 4M6XA 2EK5A 3NRVA 3EQLF 2MLGA 1FY7A 3E5QA 5E1ZB 4O6JA 3L00A 4KA4A 4KFCA 2LF7A 1R5HA 2UZKA 2WV0A 2Z5UA 3OV8A 2W84A 1FSEA 3F22A 5H20A 4BAYA 3T0YA 2KRFA 1J59A 2OA4A 3O2PE 1U5TB 2CSOA 4GYIA 4AIKA 5CVJA 3IHUA 3REOA 1WRJA 1I1GA 4OIPF 5J6XA 1UCRA 4S05A 3ULQB 1RI7A 2XV4S 4FX0A 1B6AA 2WC2A 2JZYA 3WTSC 2RDPA 4YIFA 1ONVA 2A6HF 3BJOA 2BEOA 2ZMEA 1P4XA 1XSXA 4N9IA 2E1CA 4A0XA 5DD4A 2A07F 3E6DA 3HOTA 3FXRA 2QQ9A 1CGPA 1BOAA 2V1XA 4A0ZA 3OOPA 2MH2A 2ELHA 4EJVA 4ENMA 1R23A 2ZCWA 4I01A 2MLKA 3DPTA 4XSZF 2XIGA 1U3EM 1DUXC 1XSDA 4YG2F 4JBAA 4EJWA 2X4HA 3CO6C 4ENJA 1BBYA 5HLGA 1XDSA 4EJTA 4ESFA 4RB1A 3JTHA 5HVQC 4B8XA 1ODDA 4A5NA 2UWMA 5LGNA 3ZMSA 1I27A 3ML6A 3B02A 1GHCA 1IUYA 3TDUC 4Z2YA 2VE8A 1XN7A 1UB9A 3E6BA 4M9XA 3J81Z 1S7AA 4XRFA 3SZTA 2EFQA 1K6OA 3LA2A 3MCZA 4NB5A 4M9ZA 4KIBA 5E1XA 2EWNA 2OBPA 1REPC 4UNOA 2ADUA 2IW5A 1PUEE 1FWZA 4CDGA 4JQFA 4ZYEA 3J80K 4HDUA 4KIGA 1O3SA 5HS7A 5A2QK 4I2OA 5IT9K 4XLPF 4PGHA 3GUDA 1U78A 2JRTA 2IPQX 2JPBA 2FMYA 4YFNF 3QU3A 4A5MA 4LK1F 4RGSA 1SFEA 2LNBA 1LNWA 2RGVA 2IT0A 4I0BA 1XMKA 5D5VB 1UHMA 3I71A 1JE8A 2FMLA 1IXSB 3V7RA 4Q47A 4I0AA 4HX8A 3ZMTA 1OKRA 3TDZC 4OIOF 2EB7A 1ZREA 1BJAA 2Z9OA 1S3JA 3RKXA 3ZN1A 3TO9A 4FT8A 1IRFA 1MD0A 1CF7A 3F8BA 3F6VA 4KDPA 1R22A 2M5WA 2Q0OA 4WXHA 3WGIA 1SFUA 3COAC 4RB0A 3PQKA 1IXCA 1YQAA 2HQNA 5D4RA 1QO0D 4LLLA 2EA2A 4MQ9F 3E6CC 3HRTA 3FX3A 4HAMA 1ZRFA 4MHGA 3IWFA 3VEPA 1TNTA 3JSOA 2VT3A 4PZJA 3IKVA 2Q8KA 1P92A 1XGSA 3NQOA 3ECOA 1J9IA 4WX9A 2OD5A 3GZ6A 2RKHA 1C0WA 1BI0A 2FNAA 3MQ0A 4EM1A 3GW2A 4RB3C 4R1HA 2VE9A 2D2WA 4PCQA 2CO5A 3J80Z 1FBSA 1YO5C 2MC3A 5A2QZ 1FLIA 2ZJ2A 5IT9Z 5ICFA 1F4KA 2FEZA 3TGNA 4KMFA 5LEJA 3WODF 4U88A 4XSXF 2IVMA 4G7ZF 4U0VA 2HYFA 3ABUA 2K27A 1JGSA 4K2EA 5D6EA 5LHGA 4E70A 2EV0A 1G4DA 2OZUA 5ILSA 1U5TA 4OIRF 4HZFA 1QZZA 3I59B 4KN4X 1S8NA 2DQLA 1P4WA 4HLXA 4A6EA 2PQ8A 3WTYC 5E8IA 3ECHA 3E97A 2W57A 1NHAA 1Z9CA 3HSEA 5LRSA 1WI9A 1T38A 3DV8A 2NS0A 4P55A 1RUNA 3F8CA 1O57A 4A6DA 4WF2A 1SD6A 2NAZA 5IT3A 1B9NA 1R1VA 2FE3A 5L3DA 3TO7A 2PMUA 4HDVA 5D8LB 2RNJA 3EYIA 1J75A 2DT5A 3C7JA 3CO7C 1UHWA 3SZPA 1ZHFA 2FQ3A 1TBXA 4M74A 4UV8A 1IAWA 4LB6B 5J8FA 3V4GA 1KQ0A 4KYWA 2EFPA 1S7OA 4ASNA 2XAFA 4IRIA 3TOAA 2F5EA 4LFUA 2IA0A 3KEOA 2FU4A 3T8RA 4UHTA 2Y0MA 1USTA 1HSJA 3K1PA 1KYZA 2KIMA 1PP8F 2DO7A 3K1NA 1R00A 2NNYA 2C6YA 1BIBA 4L9TA 1L3LA 2KIUA 2PLYA 3KP3A 5BMZA 1R5GA 4A0YA 3HRSA 3GFLA 4GGGA 5EEHA 1IN6A 4HOBA 4MEXF 2RVCA 1K7AA 1JHFA 3HTUA 1F1ZA 3Q9VA 1Z05A 2Q2EA 2QUFA 4IVNA 1SMYF 5ICGA 4KICA 3FM5A 1K78B 1G3SA 4TV7A 4IRHA 2W25A 2GZWA 3F8NA 4M9SA 3ERED 2ZNZA 4BNCA 3MFKA 4OMYA 4WCGA 3WE3A 4D0PA 4UVAA 3L2CA 1HW1A 4GCVA 5JFRA 2UXNA 4HV6A 5F6FA 2XHKA 2O03A 3RYRA 5JR3A 2FSWA 1LDDA 1GXPA 3I54A 4QWQA 1IF1A 3WGGA 1BC7C 2M8EA 3WTTC 2L3DA 3SXYA 3T5XA 5D4SA 1F9NA 3ISPA 1PP7U 4R8HA 3WTVC 4MTDA 3RI4A 2OQGA 1BI3A 1Y0UA 5ERIA 1SAXA 4U7BA 3KP2A 1VTNC 1XCBA 5LGTA 2XROA 3K2ZA 4KNYA 2L02A 5FB2A 1I1SA 5FLXK 1O3RA 3MZHA 1YW7A 3KEQA 3F72A 4MTEA 2PMHA 1QPMA 2AS5F 2F5CA 2ISYA 1QNTA 4ZYDA 2HKOA 5J8CA 3ZMZA 3K9TA 3CJNA 3L9FA 2WTEA 4IHTA 1HBXG 4HF1A 3HIFA 1YW8A 1XCVA 2YPRA 2QZ8A 3F23A 1XB4A 2XVCA 4P96A 2QBYA 2D45A 3CUQB 1QBJA 4LB5A 4CYDA 2CG4A 1XSVA 2E7XA 3TOBA 2MA3A 5LHIA 5LEKA 4H0EA 5TJJA 5ED4A 3I4PA 1IRGA 3E5UA 3I0TA 3GFIA 2DI3A 3ZQ7A 1HXDA 3MAJA 2OU2A 4ESBA 2W85A 2LF8A 2ACJA 3GZ5A 1G3WA 3DP7A 2DPDA 2G7UA 1OYIA 3R6SA 1IXRC 2GQQA 4HLYA 4ENKA 3BWGA 3VB2A 4L18B 4PGGA 1HSTA 2PG4A 5ILVA 2G9WA 2MBFA 3I59A 2J5OA 1YS6A 2O3FA 5BS6A 1EH6A 4LG0B 2XRNA 2VOOA 3BJAA 4UUVA 1HW2A 1O3QA 3LQRA 1J5YA 3I58A 3FM3A 3GO5A 3HHHA 3IRRA 1TNSA 2R3SA 2CFXA 4L0ZB 3RYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOE A;  4EVI A;  4KMU X;  3R4K A;  3V7S A;  4RB2 C;  1LB2 A;  3FMQ A;  4EMS A;  2DU9 A;  3I53 A;  4BHC A;  4BYY A;  1ZAO A;  4WXD A;  2ESN A;  1OMI A;  1O7F A;  1W7P A;  2CQK A;  5E1W A;  2H09 A;  2QM3 A;  4ZYH A;  5ICE A;  2STT A;  1FT9 A;  3JW4 A;  5CVV A;  3SHF A;  4MNU A;  2XKP A;  4QLC U;  1LEB A;  1YIO A;  1FYM A;  2IA2 A;  4WXC A;  4XBF A;  4KUM A;  1B1B A;  3C3W A;  4S04 A;  2VBW A;  1ULY A;  4IRG A;  2QQB A;  2A6E F;  1TW3 A;  4HV5 A;  2FBK A;  2K86 A;  3DF8 A;  2RN7 A;  4EJU A;  4MEY F;  3F8M A;  1LVA A;  4BH9 A;  2B0L A;  2H6C A;  4ETS A;  1ZGA A;  4UVC A;  2GIV A;  3U2R A;  4AWX B;  3H3U A;  2GA1 A;  3NEU A;  1YYV A;  3ZMD A;  1MDM B;  2HS5 A;  4EQQ A;  3RPQ A;  3DQV C;  4LGW A;  1D8J A;  1RZ4 A;  1ZG1 A;  5LLQ A;  1ZRD A;  3ZPL A;  1P4A A;  1WQ2 A;  2A68 F;  1W5T A;  2K02 A;  1YG2 A;  3M7G A;  1KU7 A;  4A12 A;  1K78 A;  4L9J A;  4I7H A;  2CGP A;  5D6F A;  3D0S A;  3GF2 A;  1B59 A;  3IC7 A;  2D1V A;  3HSF A;  3O3K A;  3MWM A;  2P7V B;  4JK1 X;  3QPT A;  4G7O F;  5LHH A;  2HFH A;  1ZAR A;  2XAG A;  4GO1 A;  4M72 A;  5BPD A;  1MGT A;  3FMS A;  4L9N A;  1BI2 A;  3E5X A;  1BI1 A;  3DEU A;  1MJA A;  2HR3 A;  5CVR A;  1RNL A;  3IWZ A;  4CXF A;  1MJB A;  3QRF F;  1ZYR F;  3MEX A;  2H27 A;  4L0Y B;  1E17 A;  4G94 A;  3ZP5 A;  3DKW A;  1A04 A;  4U0W A;  1FYK A;  4HX4 A;  4G7H F;  3KLO A;  2VXZ A;  3DFG A;  3RKW A;  5F1R A;  1D8K A;  2EV5 A;  1U5T C;  1FX7 A;  2W24 A;  4XLN F;  3ZMU A;  5D5U B;  4HW0 A;  3VOD A;  4OIN F;  1K79 A;  1OPC A;  3B73 A;  4RAY A;  1H9T A;  4HA8 A;  5ICC A;  2PEX A;  1B9M A;  3KZY A;  5K5R A;  2RC4 A;  3V8K A;  2F2E A;  5HLI A;  1BM9 A;  3HTS B;  5FD5 A;  1IW7 F;  2LDU A;  5FO5 A;  5HDG A;  4L5I A;  2HQR A;  1HW5 A;  2LKP A;  3ROU A;  2COM A;  2L4M A;  1YW9 A;  1DP7 P;  2CWE A;  4I09 A;  2LSO A;  1R58 A;  3CUQ A;  5E18 F;  1ON1 A;  2ZBK A;  1TQI A;  4NHJ A;  1LQ1 A;  3M9A A;  2FBI A;  1MJ9 A;  4G6D A;  1XD7 A;  2K4B A;  1U8R A;  2Y48 A;  4Y15 A;  3QU6 A;  1R1U A;  4HX7 A;  4HQE A;  4G6Q A;  5HS9 A;  1DPU A;  1U2W A;  1IN4 A;  4RAZ A;  2QLZ A;  4B09 A;  2GXG A;  1MKM A;  2YX4 A;  2CYY A;  2NYX A;  3HOS A;  2DW4 A;  4G9Y A;  3KP4 A;  4RS8 A;  2F5F A;  3EUH A;  3LAJ A;  4LG0 A;  3DPL C;  1PDN C;  2FOK A;  1W4M A;  5AON A;  5CVU A;  2EA4 A;  1ZG5 A;  2VC1 A;  4AIH A;  1XDU A;  5K5O A;  3KET A;  2JPC A;  5DV5 A;  3O6B B;  4KN7 X;  1I6X A;  3Q9S A;  4IXA A;  1EV7 A;  3EYY A;  1QQI A;  4L5J A;  1HKS A;  2M30 A;  1ZG3 A;  2QYO A;  3V7C A;  2BYV E;  3U1D A;  2XAH A;  2JSC A;  2P5L C;  1S29 A;  2AXL A;  3J7A O;  1KU2 A;  6PAX A;  3V8L A;  1TQP A;  2ESH A;  2OZ6 A;  3W6J B;  3TO6 A;  4MQV A;  4F7Z A;  5E20 A;  1GVJ A;  5DD8 A;  3R60 A;  2M1B A;  1BIA A;  3K0L A;  3QP5 A;  1FP1 D;  1XMA A;  2O8X A;  3R0J A;  1F5T A;  5LGU A;  2F5D A;  5TRD A;  2ZKZ A;  3LFK A;  4OOI A;  5DCM B;  1G3Y A;  4OIQ F;  3EDP A;  1EH8 A;  3M8E A;  5DCF A;  3FWE A;  3BY6 A;  4L9V A;  4EJO A;  2XAJ A;  3GFM A;  1ZLJ A;  1KQ9 A;  2EFO A;  2YSR A;  3ELK A;  1FNN A;  5FGM A;  2FBH A;  3WTW C;  3KP6 A;  1MDM A;  4Q4Z F;  3T8T A;  4GYG A;  1AWC A;  2VBY A;  2HEO A;  4RGR A;  1FBQ A;  2KKO A;  3CTA A;  3FHZ A;  1T98 A;  2GWR A;  4BQA A;  4ZH4 F;  4IJA A;  3WTZ A;  3D5L A;  2YU3 A;  2Y75 A;  1B4A A;  2L4A A;  5L3F A;  4CZZ A;  2D1H A;  5L3B A;  2PI0 A;  3IKT A;  4M71 A;  1R7J A;  2VOP A;  5AIQ A;  3ZMV A;  3P9C A;  2V6C A;  5CJ9 A;  1XGO A;  3KLN A;  1D5V A;  4MGR A;  2HGC A;  4NQW A;  3SFZ A;  4LK0 F;  1T2K A;  4N9H A;  1ZGJ A;  3CLO A;  2X0L A;  3FXU A;  2OQR A;  3VFZ A;  4ZZD A;  1J2X A;  2P7C B;  1R36 A;  3I5U A;  2QQA A;  1XGN A;  1YS7 A;  2NRA C;  4YII A;  1Z1D A;  4KIF A;  4YFK F;  1H0M A;  2IJL A;  3G73 A;  2QVO A;  3HUG A;  2VOD A;  4LLG F;  1FPQ A;  5LRR A;  4LLN A;  1R1T A;  3J81 K;  4UXN A;  2BE5 F;  4EM2 A;  1DDN A;  2CW0 F;  2QWW A;  2BBY A;  5HLH A;  3RIR A;  4IF4 A;  3JAM K;  4CHU A;  3GWZ A;  2FXA A;  2P5K A;  2ZNY A;  3H3Z A;  1LJ9 A;  4CO8 A;  3LA7 A;  5EEG A;  4RGU A;  4HYE A;  3IL2 A;  2L01 A;  5DDG A;  3QAH A;  2DLL A;  2DQR A;  2O6G E;  4HQM A;  5HDN A;  4M73 A;  4UVB A;  1ZH5 A;  1FOK A;  4YFX F;  2K4J A;  4Q48 A;  2O61 A;  2DBB A;  3LA3 A;  2UXX A;  2A5Y B;  2KJC A;  2Z3Y A;  3LAP A;  1Q1H A;  3U9G A;  3F21 A;  1FZP B;  2HWV A;  2YR2 A;  2V1D A;  4WK8 F;  3P9I A;  4AIJ A;  3H92 A;  1XGM A;  3LST A;  4WWC A;  1J0R A;  5HS8 A;  3BPV A;  1OR7 A;  2PBI A;  1BC8 C;  1V3F A;  5FLX Z;  1KU9 A;  5KK1 A;  4AVP A;  3F6O A;  1EH7 A;  1FC3 A;  1G3T A;  2TDX A;  1IZ1 A;  4U0Y A;  4O5V A;  1KA8 A;  2EV6 A;  1L0O C;  1P2F A;  2VC0 A;  5D8K B;  2YX7 A;  2R7F A;  1KYW A;  2O0Y A;  1TQM A;  3KFW X;  2ISZ A;  3WU0 A;  3WTU C;  4I02 A;  3AAF A;  1KU3 A;  5L3G A;  3LWF A;  4R79 A;  4EV0 A;  1DPR A;  5BPI A;  2EJR A;  2M45 A;  3FMR A;  3KCC A;  3JAM Z;  3R0A A;  2JTV A;  2EFN A;  2Z99 A;  3QPH A;  2FRH A;  1IN7 A;  1Z7U A;  3BJ6 A;  2BV6 A;  1YTY A;  4BXU A;  1KGS A;  2VN2 A;  4Y13 A;  3K1M A;  1MZB A;  5JVT A;  4UV9 A;  5HOO A;  3BP8 A;  2L54 A;  1T39 A;  4BHB A;  1WKM A;  5CYV A;  5FFX A;  2ETH A;  3F8F A;  5DCM A;  2HTS A;  2KJB A;  3GFJ A;  1ZLK A;  2VBX A;  4P5O A;  2DFI A;  4P9F A;  3JTG A;  3F3X A;  3CUO A;  3DXJ F;  1STZ A;  1W7P D;  1RUO A;  1SMT A;  2ZXJ A;  1QGP A;  1U6G A;  2ZO4 A;  3W6K B;  2DPU A;  4U7D A;  2RV8 A;  1W5S A;  2HTJ A;  3PQJ A;  1P6R A;  2PN6 A;  2V1U A;  3RDI A;  3I64 A;  5E8G A;  1TLH B;  4GXO A;  5HDK A;  1Z6R A;  4FHT A;  5H6R A;  1FYL A;  3WE2 A;  5CLS A;  2E7W A;  4AD9 A;  5JHU A;  2R7D A;  2KIF A;  3G3Z A;  3GYH X;  4RGX A;  1FSH A;  1Z91 A;  4ESJ A;  1G6N A;  3L7W A;  2DAO A;  2HKX A;  4ZYG A;  4LJZ F;  2E1N A;  3WG9 A;  2QEN A;  1V4R A;  2VON A;  2A69 F;  5DYM A;  5DUK A;  3HHG A;  2STW A;  2DK8 A;  2XUB A;  5AIP A;  1SD7 A;  4P9U A;  3M1E A;  5H6Q A;  2DK5 A;  3JSP A;  1ON2 A;  2G7H A;  4ON0 A;  3CUQ C;  5F64 A;  2H94 A;  2HYG D;  2FF4 A;  2NNN A;  3RTR A;  2QBY B;  4KT5 C;  3BPX A;  2VT2 A;  2EFW A;  5D5W B;  1SFX A;  2RQP A;  1IN8 A;  1J7K A;  5DUI A;  1TTY A;  2DTR A;  2BGC A;  1JXS A;  2GXB A;  1HKQ A;  2HDC A;  2ZME B;  3RPU A;  3HRU A;  3GX4 X;  2IA1 A;  1LEA A;  1FP2 A;  3BRO A;  4DQ2 A;  1AOY A;  2V79 A;  3KE2 A;  1RIO H;  1YLF A;  3TKY A;  4M6Y A;  3EET A;  1UFM A;  1WWX A;  3HYI A;  1Z6T A;  3V8J A;  1QZY A;  2J5P A;  3C18 A;  2XAQ A;  2PJP A;  3PFI A;  3HRM A;  4HF2 A;  4O3M A;  4EGY A;  3HSR A;  3N4M A;  5BOX A;  1OYW A;  1HQC A;  3N97 A;  3QOP A;  4OU0 A;  1LDK B;  3WTX C;  3IRQ A;  4N0B A;  3T1B A;  1LDJ A;  2IRF G;  2A3S A;  2ZFW A;  2OAZ A;  5DEQ A;  3LQQ A;  1W7P B;  3KZZ A;  3M8F A;  5FD6 A;  3RKY A;  3SQN A;  1TW2 A;  2GA2 A;  5L3E A;  1JHH A;  1S6L A;  5ILU A;  3WGH A;  3E3V A;  4FX4 A;  2XGX A;  4IHS A;  4OMZ A;  5L3C A;  3P7N A;  3E6M A;  1T0F A;  3GLX A;  2FA5 A;  4ENN A;  2XKO A;  4HF0 A;  3FXQ A;  5D5X B;  1O3T A;  3ZN0 A;  3FZV A;  4Q5S F;  1USS A;  3BDD A;  1WSU A;  2P4W A;  3GXO A;  5K5Q A;  1SD4 A;  2HZT A;  3BZ6 A;  2XAS A;  4CGZ A;  4G8X A;  2IP2 A;  1GXQ A;  1H9G A;  3S2W A;  3FF5 A;  1ZRC A;  3R61 A;  1T6S A;  4LD5 A;  1E2X A;  2WWY A;  3K69 A;  2P5V A;  3CDH A;  4PDK A;  4CIC A;  3TQN A;  2JT1 A;  5E17 F;  3QP6 A;  3KP7 A;  1FBU A;  3L09 A;  5JI6 A;  3ABT A;  5KVR A;  1X3U A;  5K1Y A;  4BHP A;  1SD5 A;  1CF7 B;  3BOQ A;  3KP5 A;  3Q5F A;  2Z33 A;  4A2U A;  4HBL A;  3C1D A;  4EM0 B;  2FNP A;  4I98 B;  1YFH A;  4EGZ A;  1OYY A;  4LMY A;  4ZZL A;  3WU1 B;  3P9K A;  5LBQ A;  2HOE A;  2VBZ A;  2PFB A;  2MD5 A;  5FFZ A;  2A61 A;  1I5Z A;  1D3Y A;  3GVA A;  2P6T A;  3RJP A;  2GAU A;  2H6B A;  5BQT A;  2V9V A;  4IPA A;  1BN5 A;  4DNC A;  1IN5 A;  5CVI A;  2P6S A;  3MZY A;  1ZN2 A;  2M87 A;  1HKT A;  2MH9 A;  4Y17 A;  2P8T A;  2K7L A;  1O7L A;  3GEZ A;  1KQ8 A;  4M6X A;  2EK5 A;  3NRV A;  3EQL F;  2MLG A;  1FY7 A;  3E5Q A;  5E1Z B;  4O6J A;  3L00 A;  4KA4 A;  4KFC A;  2LF7 A;  1R5H A;  2UZK A;  2WV0 A;  2Z5U A;  3OV8 A;  2W84 A;  1FSE A;  3F22 A;  5H20 A;  4BAY A;  3T0Y A;  2KRF A;  1J59 A;  2OA4 A;  3O2P E;  1U5T B;  2CSO A;  4GYI A;  4AIK A;  5CVJ A;  3IHU A;  3REO A;  1WRJ A;  1I1G A;  4OIP F;  5J6X A;  1UCR A;  4S05 A;  3ULQ B;  1RI7 A;  2XV4 S;  4FX0 A;  1B6A A;  2WC2 A;  2JZY A;  3WTS C;  2RDP A;  4YIF A;  1ONV A;  2A6H F;  3BJO A;  2BEO A;  2ZME A;  1P4X A;  1XSX A;  4N9I A;  2E1C A;  4A0X A;  5DD4 A;  2A07 F;  3E6D A;  3HOT A;  3FXR A;  2QQ9 A;  1CGP A;  1BOA A;  2V1X A;  4A0Z A;  3OOP A;  2MH2 A;  2ELH A;  4EJV A;  4ENM A;  1R23 A;  2ZCW A;  4I01 A;  2MLK A;  3DPT A;  4XSZ F;  2XIG A;  1U3E M;  1DUX C;  1XSD A;  4YG2 F;  4JBA A;  4EJW A;  2X4H A;  3CO6 C;  4ENJ A;  1BBY A;  5HLG A;  1XDS A;  4EJT A;  4ESF A;  4RB1 A;  3JTH A;  5HVQ C;  4B8X A;  1ODD A;  4A5N A;  2UWM A;  5LGN A;  3ZMS A;  1I27 A;  3ML6 A;  3B02 A;  1GHC A;  1IUY A;  3TDU C;  4Z2Y A;  2VE8 A;  1XN7 A;  1UB9 A;  3E6B A;  4M9X A;  3J81 Z;  1S7A A;  4XRF A;  3SZT A;  2EFQ A;  1K6O A;  3LA2 A;  3MCZ A;  4NB5 A;  4M9Z A;  4KIB A;  5E1X A;  2EWN A;  2OBP A;  1REP C;  4UNO A;  2ADU A;  2IW5 A;  1PUE E;  1FWZ A;  4CDG A;  4JQF A;  4ZYE A;  3J80 K;  4HDU A;  4KIG A;  1O3S A;  5HS7 A;  5A2Q K;  4I2O A;  5IT9 K;  4XLP F;  4PGH A;  3GUD A;  1U78 A;  2JRT A;  2IPQ X;  2JPB A;  2FMY A;  4YFN F;  3QU3 A;  4A5M A;  4LK1 F;  4RGS A;  1SFE A;  2LNB A;  1LNW A;  2RGV A;  2IT0 A;  4I0B A;  1XMK A;  5D5V B;  1UHM A;  3I71 A;  1JE8 A;  2FML A;  1IXS B;  3V7R A;  4Q47 A;  4I0A A;  4HX8 A;  3ZMT A;  1OKR A;  3TDZ C;  4OIO F;  2EB7 A;  1ZRE A;  1BJA A;  2Z9O A;  1S3J A;  3RKX A;  3ZN1 A;  3TO9 A;  4FT8 A;  1IRF A;  1MD0 A;  1CF7 A;  3F8B A;  3F6V A;  4KDP A;  1R22 A;  2M5W A;  2Q0O A;  4WXH A;  3WGI A;  1SFU A;  3COA C;  4RB0 A;  3PQK A;  1IXC A;  1YQA A;  2HQN A;  5D4R A;  1QO0 D;  4LLL A;  2EA2 A;  4MQ9 F;  3E6C C;  3HRT A;  3FX3 A;  4HAM A;  1ZRF A;  4MHG A;  3IWF A;  3VEP A;  1TNT A;  3JSO A;  2VT3 A;  4PZJ A;  3IKV A;  2Q8K A;  1P92 A;  1XGS A;  3NQO A;  3ECO A;  1J9I A;  4WX9 A;  2OD5 A;  3GZ6 A;  2RKH A;  1C0W A;  1BI0 A;  2FNA A;  3MQ0 A;  4EM1 A;  3GW2 A;  4RB3 C;  4R1H A;  2VE9 A;  2D2W A;  4PCQ A;  2CO5 A;  3J80 Z;  1FBS A;  1YO5 C;  2MC3 A;  5A2Q Z;  1FLI A;  2ZJ2 A;  5IT9 Z;  5ICF A;  1F4K A;  2FEZ A;  3TGN A;  4KMF A;  5LEJ A;  3WOD F;  4U88 A;  4XSX F;  2IVM A;  4G7Z F;  4U0V A;  2HYF A;  3ABU A;  2K27 A;  1JGS A;  4K2E A;  5D6E A;  5LHG A;  4E70 A;  2EV0 A;  1G4D A;  2OZU A;  5ILS A;  1U5T A;  4OIR F;  4HZF A;  1QZZ A;  3I59 B;  4KN4 X;  1S8N A;  2DQL A;  1P4W A;  4HLX A;  4A6E A;  2PQ8 A;  3WTY C;  5E8I A;  3ECH A;  3E97 A;  2W57 A;  1NHA A;  1Z9C A;  3HSE A;  5LRS A;  1WI9 A;  1T38 A;  3DV8 A;  2NS0 A;  4P55 A;  1RUN A;  3F8C A;  1O57 A;  4A6D A;  4WF2 A;  1SD6 A;  2NAZ A;  5IT3 A;  1B9N A;  1R1V A;  2FE3 A;  5L3D A;  3TO7 A;  2PMU A;  4HDV A;  5D8L B;  2RNJ A;  3EYI A;  1J75 A;  2DT5 A;  3C7J A;  3CO7 C;  1UHW A;  3SZP A;  1ZHF A;  2FQ3 A;  1TBX A;  4M74 A;  4UV8 A;  1IAW A;  4LB6 B;  5J8F A;  3V4G A;  1KQ0 A;  4KYW A;  2EFP A;  1S7O A;  4ASN A;  2XAF A;  4IRI A;  3TOA A;  2F5E A;  4LFU A;  2IA0 A;  3KEO A;  2FU4 A;  3T8R A;  4UHT A;  2Y0M A;  1UST A;  1HSJ A;  3K1P A;  1KYZ A;  2KIM A;  1PP8 F;  2DO7 A;  3K1N A;  1R00 A;  2NNY A;  2C6Y A;  1BIB A;  4L9T A;  1L3L A;  2KIU A;  2PLY A;  3KP3 A;  5BMZ A;  1R5G A;  4A0Y A;  3HRS A;  3GFL A;  4GGG A;  5EEH A;  1IN6 A;  4HOB A;  4MEX F;  2RVC A;  1K7A A;  1JHF A;  3HTU A;  1F1Z A;  3Q9V A;  1Z05 A;  2Q2E A;  2QUF A;  4IVN A;  1SMY F;  5ICG A;  4KIC A;  3FM5 A;  1K78 B;  1G3S A;  4TV7 A;  4IRH A;  2W25 A;  2GZW A;  3F8N A;  4M9S A;  3ERE D;  2ZNZ A;  4BNC A;  3MFK A;  4OMY A;  4WCG A;  3WE3 A;  4D0P A;  4UVA A;  3L2C A;  1HW1 A;  4GCV A;  5JFR A;  2UXN A;  4HV6 A;  5F6F A;  2XHK A;  2O03 A;  3RYR A;  5JR3 A;  2FSW A;  1LDD A;  1GXP A;  3I54 A;  4QWQ A;  1IF1 A;  3WGG A;  1BC7 C;  2M8E A;  3WTT C;  2L3D A;  3SXY A;  3T5X A;  5D4S A;  1F9N A;  3ISP A;  1PP7 U;  4R8H A;  3WTV C;  4MTD A;  3RI4 A;  2OQG A;  1BI3 A;  1Y0U A;  5ERI A;  1SAX A;  4U7B A;  3KP2 A;  1VTN C;  1XCB A;  5LGT A;  2XRO A;  3K2Z A;  4KNY A;  2L02 A;  5FB2 A;  1I1S A;  5FLX K;  1O3R A;  3MZH A;  1YW7 A;  3KEQ A;  3F72 A;  4MTE A;  2PMH A;  1QPM A;  2AS5 F;  2F5C A;  2ISY A;  1QNT A;  4ZYD A;  2HKO A;  5J8C A;  3ZMZ A;  3K9T A;  3CJN A;  3L9F A;  2WTE A;  4IHT A;  1HBX G;  4HF1 A;  3HIF A;  1YW8 A;  1XCV A;  2YPR A;  2QZ8 A;  3F23 A;  1XB4 A;  2XVC A;  4P96 A;  2QBY A;  2D45 A;  3CUQ B;  1QBJ A;  4LB5 A;  4CYD A;  2CG4 A;  1XSV A;  2E7X A;  3TOB A;  2MA3 A;  5LHI A;  5LEK A;  4H0E A;  5TJJ A;  5ED4 A;  3I4P A;  1IRG A;  3E5U A;  3I0T A;  3GFI A;  2DI3 A;  3ZQ7 A;  1HXD A;  3MAJ A;  2OU2 A;  4ESB A;  2W85 A;  2LF8 A;  2ACJ A;  3GZ5 A;  1G3W A;  3DP7 A;  2DPD A;  2G7U A;  1OYI A;  3R6S A;  1IXR C;  2GQQ A;  4HLY A;  4ENK A;  3BWG A;  3VB2 A;  4L18 B;  4PGG A;  1HST A;  2PG4 A;  5ILV A;  2G9W A;  2MBF A;  3I59 A;  2J5O A;  1YS6 A;  2O3F A;  5BS6 A;  1EH6 A;  4LG0 B;  2XRN A;  2VOO A;  3BJA A;  4UUV A;  1HW2 A;  1O3Q A;  3LQR A;  1J5Y A;  3I58 A;  3FM3 A;  3GO5 A;  3HHH A;  3IRR A;  1TNS A;  2R3S A;  2CFX A;  4L0Z B;  3RYP A; 
#chains in the Genus database with same CATH topology
 4AU7 A;  2ELK A;  3VOE A;  2B63 J;  4EVI A;  1TWA J;  1Z77 A;  3FBI B;  4KMU X;  3BQY A;  3R4K A;  3V7S A;  4BDY A;  4XNF A;  4RB2 C;  2JA5 J;  1LB2 A;  3FMQ A;  2MC4 A;  4EMS A;  2DU9 A;  4JYK A;  4PJJ A;  3I53 A;  4BHC A;  4BYY A;  4FAS D;  1OQY A;  1ZAO A;  3OYL A;  5KCM A;  1ZR4 A;  4A3E J;  4A3M J;  2EQR A;  1JKP C;  4WXD A;  2ESN A;  1OMI A;  1OCR H;  1O7F A;  1W7P A;  2CQK A;  3I4M J;  3G2B A;  3J7Y J;  4Z6Y A;  3S32 A;  4IQJ A;  5E1W A;  2H09 A;  2QM3 A;  3W6V A;  2XRL A;  4ZYH A;  5ICE A;  2X1E A;  4L5E A;  4C3J J;  2STT A;  1FT9 A;  3K7A J;  4A3K J;  3JW4 A;  5CVV A;  3SHF A;  4MNU A;  2XKP A;  4QLC U;  1LEB A;  3LFU A;  2LBF A;  4NDL A;  2X48 A;  1YHQ I;  2HZD A;  1YIO A;  4XRS G;  4DBR A;  1FYM A;  2IA2 A;  2Z16 A;  4Y4R A;  4FET A;  4WXC A;  4XBF A;  1IDZ A;  4KUM A;  4CH7 A;  1B1B A;  3S1N J;  1IDY A;  2TCT A;  3C3W A;  4S04 A;  4MIM A;  1BR2 A;  3OYG A;  2DMP A;  5EYR A;  2VBW A;  3ABL H;  1ULY A;  4IRG A;  3L2W A;  2QQB A;  4NNJ A;  2A6E F;  4HRI A;  1MH4 A;  1TW3 A;  4HV5 A;  2FBK A;  2K86 A;  3DF8 A;  3FXM A;  2RN7 A;  3AL0 B;  2FD5 A;  4EJU A;  4MEY F;  3F8M A;  3L2R A;  1LVA A;  4BH9 A;  2B0L A;  2H6C A;  4OAY A;  4ETS A;  1ZGA A;  2LLK A;  4UVC A;  2GIV A;  3BR1 A;  3U2R A;  3VYU B;  4AWX B;  3H3U A;  2CUE A;  2GA1 A;  2E19 A;  3NEU A;  1QU3 A;  2ZC2 A;  5DS9 A;  4CUG A;  1Y39 A;  1MBK A;  2YU9 J;  1YYV A;  3ZMD A;  1MDM B;  2KZG A;  3OR2 C;  2KDZ A;  2HS5 A;  4EQQ A;  1W1W E;  1G59 A;  1RC9 A;  3CME I;  3RPQ A;  3DQV C;  4LGW A;  3CZ6 A;  1D8J A;  1RZ4 A;  1ZG1 A;  5LLQ A;  1ZRD A;  5IY5 H;  1XC5 A;  2E35 A;  1I3A A;  3HJE A;  4BL0 B;  2DA7 A;  3ZPL A;  1T56 A;  5FRN A;  4UB6 C;  2WAQ A;  4CCK A;  1P4A A;  5IP7 J;  1WQ2 A;  2A68 F;  1W5T A;  2K02 A;  1YG2 A;  3G6E I;  3DWL E;  3M7G A;  1KU7 A;  4A12 A;  2ZXH A;  1N25 A;  4L9J A;  1K78 A;  4I7H A;  3S1R J;  3S2H J;  2CGP A;  2XPV A;  5D6F A;  3GCM A;  3CC2 I;  4YEL A;  3D0S A;  3GF2 A;  2K9N A;  1B59 A;  3IC7 A;  2QGU A;  1X19 A;  2OCE A;  1X4O A;  2D1V A;  3HSF A;  3O3K A;  2QSF X;  1H88 C;  3KX2 A;  3MWM A;  2P7V B;  3CCM I;  3CMA I;  4JK1 X;  3QPT A;  2WY8 Q;  1ZQ3 P;  4G7O F;  3RQI A;  1YJN I;  5LHH A;  2HFH A;  1ZAR A;  2XAG A;  4GO1 A;  4NQW B;  1YI2 I;  1LPQ A;  4M72 A;  5BPD A;  1MGT A;  4BS9 A;  3FMS A;  3K4C A;  1BI2 A;  4L9N A;  3E5X A;  1BI1 A;  2Y2Z A;  3DEU A;  3OYF A;  5DM7 F;  3L2U A;  1MJA A;  2HR3 A;  5CVR A;  5E3O A;  1RNL A;  3IWZ A;  3BG7 A;  4CXF A;  1MJB A;  5EZG A;  3QRF F;  1ZYR F;  5F08 A;  3MEX A;  2H27 A;  4F92 B;  4L0Y B;  1E17 A;  4G94 A;  3PO2 J;  3ZP5 A;  3DKW A;  5FRO A;  3NAR A;  2EZI A;  1A04 A;  4GRI A;  4U0W A;  4D7M A;  4CCJ A;  2ZB9 A;  1FYK A;  1WCM J;  4HX4 A;  4G7H F;  3S1Q J;  3KLO A;  2VXZ A;  5F04 A;  2L2O A;  3HUG B;  3DFG A;  4UB8 C;  2KPM A;  2V4J C;  3KPH A;  3RKW A;  5F1R A;  4IHX A;  1D8K A;  2EV5 A;  4RBO A;  2HVR A;  1TT0 A;  3ZQG A;  1R5I D;  5FKN A;  1U5T C;  3C2G A;  1FX7 A;  2W24 A;  4XLN F;  3QYF A;  3ZMU A;  4F52 A;  4HW0 A;  5D5U B;  2M0C A;  3VOD A;  2LY9 A;  1LUJ B;  3C2B A;  4OIN F;  1R4M B;  1K79 A;  2JMW A;  1OPC A;  3CES A;  3OYE A;  2LC2 A;  4FQG A;  1MBG A;  3B73 A;  5BNG A;  3BR6 A;  3MN2 A;  4RAY A;  5KNL A;  3M4O J;  1B8I A;  1H9T A;  1N77 A;  2F6C A;  2TRT A;  3OL4 A;  4B47 A;  4HA8 A;  5ICC A;  2PEX A;  5GAD J;  1B9M A;  3KZY A;  4DYR A;  2XSJ C;  5K5R A;  4XLE A;  2RC4 A;  2EZK A;  5CQG A;  1WJA A;  3V8K A;  1D0Z A;  2F2E A;  4W97 A;  2EH3 A;  3S8P A;  3TW7 A;  1X1D A;  4Y33 A;  1Q1V A;  3S14 J;  4BEH A;  1UMQ A;  2Q1Z B;  1ETX A;  5HLI A;  1BM9 A;  3HTS B;  1IGN A;  5FD5 A;  1IW7 F;  2LDU A;  2XB5 A;  3LSK A;  5FO5 A;  2JA6 J;  5HDG A;  4L5I A;  1OCP A;  2HQR A;  1HW5 A;  2KL4 A;  5GPA A;  2LKP A;  1MIJ A;  2W1O A;  3ROU A;  2COM A;  2VQC A;  4RAG A;  3OYM A;  2L4M A;  1JTX A;  1YW9 A;  1M1E B;  2CWE A;  4I09 A;  1DP7 P;  3RZD J;  2LSO A;  1O4X A;  1R58 A;  2HNH A;  3H0G J;  2JA2 A;  3CUQ A;  2VQL A;  4DJA A;  1MMS A;  5E18 F;  2R93 J;  1ON1 A;  3JRA A;  2ZBK A;  2OCC H;  1TQI A;  3EUH C;  3K70 D;  3RZO J;  1B72 B;  4NHJ A;  1LQ1 A;  3M9A A;  1V55 H;  2FBI A;  4A3I J;  1MJ9 A;  4G6D A;  1XD7 A;  2PMZ N;  1P7I A;  2K4B A;  1GLN A;  4B1R A;  2DT7 B;  4KJZ A;  4M3B A;  1U8R A;  2Y48 A;  4Y15 A;  4XLF A;  3QU6 A;  4UY8 I;  2QA4 I;  2CU7 A;  1R1U A;  4DYC A;  2X6W A;  2VB6 A;  3WG7 H;  2MGQ A;  4HX7 A;  4HQE A;  3LSG A;  4G6Q A;  2HYJ A;  1VQP I;  5GP9 A;  3MVP A;  3QPL A;  5HS9 A;  1DPU A;  1U2W A;  1IN4 A;  2M3A A;  3HOZ J;  4RAZ A;  1ETK A;  3BQZ A;  3RKQ A;  2QLZ A;  5EGO A;  4B09 A;  2GXG A;  3QYE A;  5JHF A;  1MKM A;  2YX4 A;  5K7H A;  2CYY A;  2NYX A;  3HOS A;  2DW4 A;  2VJJ A;  3VWB A;  4G9Y A;  2DFE A;  3KP4 A;  4RS8 A;  2F5F A;  3EUH A;  2Z1D A;  3LAJ A;  4LG0 A;  2R7T A;  3DPL C;  1PDN C;  2FOK A;  4XLC A;  2LR8 A;  1W4M A;  5AON A;  5CVU A;  1OCT C;  2EA4 A;  1JKR C;  1G2H A;  1ZG5 A;  2VC1 A;  1TZL A;  1OLT A;  1JUP A;  4AIH A;  3QQA A;  1W36 D;  4E7S A;  1XDU A;  5K5O A;  1ITY A;  2M8G X;  3KET A;  2G0E A;  1OCC H;  2JPC A;  3RCO A;  5DTD A;  5HNH A;  3PSF A;  4A3G J;  4XKV A;  5DV5 A;  3O6B B;  4KN7 X;  1WH7 A;  3ZQC A;  2H1K A;  1I6X A;  3Q9S A;  4IXA A;  1BR1 A;  5KAF C;  1EV7 A;  3RPU D;  3CCY A;  3TBI A;  3EYY A;  3VPR A;  1QQI A;  4L5J A;  4PJN A;  1HKS A;  2M30 A;  1DGR M;  1ZG3 A;  5C3E J;  5J4V A;  3JRG A;  2QYO A;  4J00 A;  3BCB A;  3V7C A;  2BYV E;  3H35 A;  3U1D A;  2V9K A;  2XAH A;  2JSC A;  4ZTF A;  4Y3O A;  2JUG A;  2X1C A;  1P9Q C;  4YEJ A;  1R49 A;  2W82 A;  2A05 A;  4AVZ A;  4Y52 J;  2P5L C;  1S29 A;  2AXL A;  3J7A O;  2VPR A;  1KU2 A;  6PAX A;  4LIU A;  1U9O A;  3V8L A;  1TQP A;  1IJW C;  2ESH A;  4D5C A;  2OZ6 A;  3HG9 A;  2M4K A;  3W6J B;  3S3M A;  3TO6 A;  4MQV A;  4F7Z A;  5E20 A;  1VQ5 I;  1GVJ A;  2W00 A;  5DD8 A;  3R60 A;  2M1B A;  1BIA A;  2RQQ A;  3FIW A;  3K0L A;  3QP5 A;  3SZG A;  1FP1 D;  1XMA A;  2O8X A;  2Y31 A;  3R0J A;  1F5T A;  5LGU A;  2F5D A;  1R4N B;  5TRD A;  1LKX A;  1WVR A;  2ZKZ A;  3LFK A;  4OOI A;  5GAG J;  5DCM B;  4AYB N;  1UJ8 A;  5EEA A;  4UUS B;  4IOC F;  4XOR A;  2CH0 A;  1G3Y A;  5H2F C;  4OIQ F;  3EDP A;  1EH8 A;  3M8E A;  5DCF A;  3FWE A;  3BY6 A;  1OJL A;  4L9V A;  1HCR A;  4EJO A;  4HST A;  1IC8 A;  1PUF A;  2QKM B;  2XAJ A;  4LIT A;  3GFM A;  1ZLJ A;  5B1A H;  1KQ9 A;  2VJ5 A;  1V5E A;  2EFO A;  2OUM A;  2YSR A;  1FJL A;  4XRS A;  4BE1 A;  1ETW A;  4ZTJ A;  3ELK A;  1FNN A;  1Y56 A;  2I10 A;  4F91 B;  1D1B A;  3H9G A;  5FGM A;  2FBH A;  3WTW C;  4A3D J;  3KP6 A;  1MDM A;  4Q4Z F;  5E79 C;  3RSN A;  3X2Q H;  3T8T A;  4PJ0 C;  4GYG A;  1SFK A;  3LSM A;  1AWC A;  4IHV A;  2VPL A;  2VBY A;  2HEO A;  1LFP A;  4RGR A;  1FBQ A;  3CMM A;  2KKO A;  3CTA A;  1TT5 B;  3FHZ A;  1T98 A;  2GWR A;  4BQA A;  4ZH4 F;  4IJA A;  1HLV A;  5E3M A;  3WTZ A;  3U21 A;  2Y9Y A;  3H3V K;  3D5L A;  1XTA A;  2YU3 A;  2Y75 A;  1B4A A;  2L4A A;  2GIZ A;  4XQF A;  5L3F A;  3DU5 A;  4CZZ A;  2D1H A;  2DDA A;  5FKM A;  3LMM A;  4DBQ A;  2WB1 N;  1R71 A;  1HF0 A;  4A93 J;  5L3B A;  2PI0 A;  2ZSI B;  3IKT A;  2IBD A;  4C3H J;  5J1R A;  2A6T A;  4BJ6 C;  4M71 A;  1R7J A;  1MBJ A;  2VOP A;  5F0H A;  5AIQ A;  3ZMV A;  2IS6 A;  3P9C A;  2DOD A;  2V6C A;  4LIV A;  5J1Y A;  5CJ9 A;  4D1Q A;  1XGO A;  1MBE A;  4H4K C;  3CCU I;  3KLN A;  1LFU P;  4MGR A;  2HGC A;  4NQW A;  1D5V A;  3SFZ A;  4LK0 F;  4JX6 A;  1T2K A;  4N9H A;  2F4M B;  4IQ4 A;  1ZGJ A;  3CLO A;  3BTC A;  3KYC B;  2X0L A;  4FE4 A;  3FXU A;  2OQR A;  1HA8 A;  3VFZ A;  3LSH A;  1RR7 A;  1VFC A;  4ZZD A;  3TP3 A;  3OYJ A;  1J2X A;  2P7C B;  1R36 A;  3I5U A;  2QQA A;  1XGN A;  2VQG A;  1YS7 A;  2NRA C;  2HVS A;  4YII A;  1Z1D A;  2HDD A;  4KIF A;  4YFK F;  1H0M A;  2IJL A;  3G73 A;  4E4H A;  2NVU B;  2QVO A;  2KQR A;  3HUG A;  4NC8 A;  2WAD A;  2VKD A;  2VOD A;  4LLG F;  1EF4 A;  1FPQ A;  2LVS A;  2GXA A;  2XC7 A;  5LRR A;  4LLN A;  5J4Y A;  3M3Y J;  2NVT J;  1R1T A;  3J81 K;  4UXN A;  2BE5 F;  4EM2 A;  1BL0 A;  1DDN A;  2CW0 F;  5DM6 F;  2QWW A;  2R0Q C;  2BBY A;  5HLH A;  1FTZ A;  4ZYA A;  3RIR A;  3BTL A;  4IF4 A;  4BKX A;  5M3F J;  3JAM K;  4CHU A;  3GWZ A;  2FXA A;  2P5K A;  3D5R C;  3ZCO A;  2ZNY A;  4D5F A;  3NWT A;  5K7F A;  1YRN B;  3H3Z A;  1AU7 A;  1LJ9 A;  4BJ5 C;  4CO8 A;  2RAE A;  2FQ4 A;  2LRE A;  3LA7 A;  1E3H A;  5EEG A;  4RGU A;  1MBH A;  4HYE A;  2DT6 A;  3LNQ A;  3IL2 A;  2L01 A;  5DDG A;  2DA2 A;  3QAH A;  2WBM A;  2DLL A;  2DQR A;  2O6G E;  2VI6 A;  1JGG A;  2L9S A;  3HOW J;  2PJR B;  2CV0 A;  3A2K A;  1S72 I;  4HQM A;  2R7Q A;  2WY7 Q;  3PUF A;  1OR7 C;  5HDN A;  4E6K G;  5KHD A;  1X4P A;  3SDB A;  1TWH J;  4M73 A;  4UVB A;  2JVG A;  1ZH5 A;  3G1O A;  1FOK A;  3VYR B;  4YFX F;  3JRI A;  2K4J A;  4Q48 A;  1DQU A;  2O61 A;  2DBB A;  2E5Z A;  3LA3 A;  2UXX A;  2A5Y B;  4BE2 A;  2IEK A;  2L7F P;  2KJC A;  2Z3Y A;  2CW8 A;  4BY7 J;  3LAP A;  3FKI J;  1Q1H A;  3U9G A;  1B72 A;  1WH5 A;  1X1C A;  2IS4 A;  3UR3 C;  3HDD A;  4I6Z A;  4A69 C;  5J47 A;  3FXK A;  1FOY A;  1TWG J;  3F21 A;  1FZP B;  2HWV A;  2Z2S B;  1WJC A;  2YR2 A;  4NUB A;  2V1D A;  2BY1 A;  2D5V A;  4WK8 F;  3P9I A;  2ZXI A;  4AIJ A;  3H92 A;  1XGM A;  3LST A;  4WWC A;  3CQZ J;  1J0R A;  2R7X A;  5HS8 A;  3BPV A;  3ASO H;  2K3F A;  1OR7 A;  5IP9 J;  2PBI A;  4HEA 2;  1BC8 C;  1X1P A;  1V3F A;  2VQH A;  3GBG A;  3H5A A;  4XMY A;  5FLX Z;  4CYC B;  1KU9 A;  1XX5 A;  3IH2 A;  5KK1 A;  3MKY B;  2LTP A;  3MMY B;  1ZK8 A;  1BJZ A;  2CS3 A;  4IHY A;  2AXT C;  2HOA A;  4AVP A;  2R5Y B;  3OY9 A;  2ZJP F;  3F6O A;  3CC4 I;  1EH7 A;  1FC3 A;  1G3T A;  2DA5 A;  2KT0 A;  4EAT A;  1HDD C;  2TDX A;  1IZ1 A;  2X51 A;  3OIP A;  3ZQH A;  4O5V A;  4U0Y A;  1KA8 A;  2EV6 A;  1L0O C;  3CCE I;  2DOA A;  1P2F A;  2VC0 A;  3OSF A;  3H9Q A;  5D8K B;  4NBQ A;  3WU2 C;  2YX7 A;  2X6O A;  2L7Z A;  2R7F A;  4C9Y A;  1KYW A;  1FIA A;  1RR8 C;  2O0Y A;  1TQM A;  3KFW X;  2ISZ A;  3WU0 A;  3WTU C;  4I02 A;  2XPW A;  4E7I A;  3AAF A;  1KU3 A;  5L3G A;  3TED A;  1YIT I;  3CJR B;  3LWF A;  4P1W A;  4R79 A;  3OS2 A;  4EV0 A;  1DPR A;  5BPI A;  3ABM H;  5J40 A;  2EJR A;  1WJD A;  2M45 A;  4NC7 A;  1WJ5 A;  1SVO A;  2Y30 A;  5FLV A;  3FMR A;  3KCC A;  3JAM Z;  3R0A A;  2LKX A;  3BT9 A;  3S17 J;  2JTV A;  2EFN A;  4CCL A;  2Z99 A;  5FKL A;  3QPH A;  2FRH A;  1IN7 A;  1Z7U A;  3HPH A;  2Q2E B;  2BV6 A;  3BJ6 A;  2NVQ J;  1YTY A;  1WPK A;  5B3S H;  3S1M J;  2E1O A;  3ABK H;  4BXU A;  1KGS A;  4J01 A;  2VN2 A;  4ZDL A;  5LD2 C;  3CCL I;  4Y13 A;  2E71 A;  3K1M A;  2L9N A;  1MZB A;  4ITV A;  1K83 J;  5JVT A;  4UV9 A;  5HOO A;  3BP8 A;  3HL2 A;  4JOM A;  2L54 A;  1T39 A;  4M3F A;  1WKM A;  4BHB A;  5CYV A;  5FFX A;  2ZJQ F;  4DW6 A;  2ETH A;  2V7F A;  2IS2 A;  3F8F A;  5DCM A;  5K7Z A;  4UUS A;  1POG A;  2EIN H;  2HTS A;  2K85 A;  2HDW A;  2KJB A;  9ANT A;  3H36 A;  3MKL A;  3GFJ A;  1ZLK A;  3K70 C;  3CCQ I;  1OCZ H;  2VBX A;  4P5O A;  1MMN A;  4XL9 A;  2DFI A;  4P9F A;  1NG6 A;  3DLL F;  1JKQ C;  4C2U A;  3JTG A;  3F3X A;  3CUO A;  2FJ1 A;  3DXJ F;  2CQ7 A;  1STZ A;  4FTH A;  1W7P D;  1RUO A;  1SMT A;  2ZXJ A;  3H5R A;  1QGP A;  1U6G A;  2ZO4 A;  3W6K B;  1LE8 B;  2DPU A;  2IAI A;  4U7D A;  2RV8 A;  5F0C A;  1W5S A;  5GAE J;  5LFA A;  3OYH A;  4CCM A;  2HTJ A;  3PQJ A;  4KIS A;  1P6R A;  2LOO A;  3PM1 A;  1WJE A;  2PN6 A;  2V1U A;  2LRD A;  4DGW B;  3RDI A;  3MKW B;  3PUB A;  3I64 A;  4DZP A;  5E8G A;  1TLH B;  2CFO A;  2CUZ A;  4GXO A;  5HDK A;  2LYC A;  1Z6R A;  5M5Y J;  4FHT A;  5H6R A;  1FYL A;  3WE2 A;  4J19 A;  4MO7 A;  4A3F J;  2OC6 A;  3A0H C;  5CLS A;  1Y1W J;  3CC7 I;  2E7W A;  2WAF A;  4AD9 A;  5JHU A;  2R7D A;  2KIF A;  1Z7L A;  3G3Z A;  3PNY A;  3OWT A;  3GYH X;  3PSI A;  4RGX A;  1FSH A;  1YJ9 I;  1YJW I;  1ETQ A;  2QF7 A;  3G1L A;  1Z91 A;  4ESJ A;  1G6N A;  3K6G A;  5TIS C;  3L7W A;  2DAO A;  2HKX A;  4ZYG A;  4LJZ F;  2HU9 A;  1MH3 A;  4N4N B;  1UHS A;  3BC8 A;  3GTG J;  4S0H B;  2E1N A;  1X1B A;  1JT6 A;  2NOG A;  3WG9 A;  2QEN A;  1W36 C;  2MSY A;  1V4R A;  2B7E A;  4KT6 A;  2M0M A;  2VON A;  2A69 F;  5DYM A;  4GFB A;  5DUK A;  3HHG A;  2STW A;  2DK8 A;  2XUB A;  2W7N A;  5AIP A;  1SD7 A;  4P9U A;  3M1E A;  5H6Q A;  2DK5 A;  1W0U A;  3JSP A;  5E3L A;  3FXJ A;  3FKJ A;  3SYT A;  3OYN A;  2LY1 A;  1ON2 A;  2LH9 A;  3KZI C;  2G7H A;  4ON0 A;  4PUS A;  3CUQ C;  5F64 A;  4M3D A;  2H94 A;  2HYG D;  2FF4 A;  2NNN A;  4XKC A;  5GTI C;  4ABZ A;  4E7Z A;  3S3O A;  2JA8 J;  3HXL A;  3ZQF A;  2DYR H;  4A3C J;  3RTR A;  2R7W A;  3ERM A;  2QBY B;  1QHH D;  2Y0S N;  1RRJ A;  2K5C A;  3OIQ A;  1YOV B;  4KT5 C;  3BPX A;  2VT2 A;  3LSJ A;  4ZJZ A;  2EFW A;  2WAE A;  4ZDP A;  3Q0W A;  1SFX A;  2RQP A;  5D5W B;  1IN8 A;  1J7K A;  2I5U A;  4BGD A;  5DUI A;  2X6Y A;  1TTY A;  3DU6 A;  3V42 A;  3VYT B;  2DTR A;  4MFE A;  4M3G A;  1YX5 A;  2BGC A;  2ELJ A;  3OR1 C;  3A01 B;  3IV5 A;  1JXS A;  2GXB A;  1HKQ A;  3GTO J;  2HDC A;  1R9T J;  3DBR B;  3BZC A;  2ZME B;  3CCR I;  2HPM A;  3RPU A;  3HRU A;  4FE7 A;  3GX4 X;  2EBI A;  2IA1 A;  2O8K A;  1LEA A;  4BE0 A;  1W0T A;  1FP2 A;  3BRO A;  4DQ2 A;  2JA7 J;  1AOY A;  2GOX B;  1Y8R B;  2V79 A;  1WI3 A;  3K4L A;  3OL3 A;  1P7J A;  1MMD A;  3KE2 A;  3QOE A;  1RIO H;  4DYQ A;  1VQO I;  3S93 A;  2M7B A;  2JK3 A;  3LSR A;  3MZ8 A;  1YLF A;  3TKY A;  1XMX A;  2K9M A;  4M6Y A;  3OSG A;  2UV1 A;  3EET A;  1E3O C;  1UFM A;  1WGX A;  1ZKG A;  1TC3 C;  1WWX A;  3HYI A;  1Z6T A;  3V8J A;  1QZY A;  2J5P A;  3CCV I;  2DA3 A;  5B66 C;  3PJR A;  2WA0 A;  3GTJ J;  1IG7 A;  2IGK A;  3C18 A;  3DEE A;  2PJR A;  1HC8 A;  2XAQ A;  4XN0 A;  2PJP A;  3A1Y A;  3PFI A;  3HRM A;  1DU6 A;  4HF2 A;  4HNU A;  4O3M A;  5C4X J;  3ZXS A;  3D1N I;  4EGY A;  3HSR A;  3N4M A;  5BOX A;  1OYW A;  1OCO H;  1HQC A;  4JP0 A;  2OF7 A;  3N97 A;  1QA6 A;  3QOP A;  5HOD A;  4OU0 A;  1LDK B;  3H9J A;  3WTX C;  1PJR A;  3K4B A;  3K4N A;  4N0B A;  3K10 A;  1D0X A;  3T1B A;  3IRQ A;  2R7R A;  4ZDO A;  1LDJ A;  2IRF G;  1G8X A;  2A3S A;  2CRG A;  2ZFW A;  4BDZ A;  4DZJ A;  2OAZ A;  3ZQL A;  1FIP A;  4B48 A;  1FEX A;  4A3L J;  1LVK A;  5DEQ A;  4IEJ A;  1Z67 A;  3LQQ A;  1W7P B;  1ZGW A;  1MBF A;  2IXS A;  2JUC A;  3W2W A;  2V6E A;  3KZZ A;  3M8F A;  5FD6 A;  2A5W A;  1BW6 A;  4RA2 A;  1SAN A;  3QOD A;  1K61 A;  3RKY A;  1AKH B;  4AC0 A;  3SQN A;  4QSH A;  1TW2 A;  2X9D A;  2GA2 A;  5L3E A;  1VQ7 I;  3M1C A;  1JHH A;  2XF7 A;  2HI3 A;  4BXF A;  2PMZ A;  1S6L A;  5ILU A;  2CMP A;  3DEW A;  5B5E C;  3WGH A;  3E3V A;  4FX4 A;  4CYC A;  2XGX A;  4IHS A;  3BG9 A;  4OMZ A;  5L3C A;  4XLH A;  3S2D J;  1HDP A;  1JUM A;  2JN6 A;  3P7N A;  3AL0 C;  3E6M A;  1T0F A;  2XSD C;  3GLX A;  2FA5 A;  5CQE A;  4ENN A;  2XKO A;  4HF0 A;  3W2A A;  3FXQ A;  5D5X B;  1O3T A;  3ZN0 A;  3FZV A;  1JJ6 C;  3GTK J;  4Q5S F;  1USS A;  3BDD A;  3NWS A;  4IZZ A;  2QCO A;  2HXI A;  4M3E A;  1WSU A;  5F0F A;  2KLO A;  2P4W A;  5FKO A;  4B3X A;  1SEU A;  3GXO A;  3ASN H;  1SFO J;  5K5Q A;  1SD4 A;  1VI0 A;  2ECC A;  2AQF A;  2HZT A;  1Y1V J;  3HOV J;  3BZ6 A;  2XAS A;  3ZQQ A;  4CGZ A;  4G8X A;  2IP2 A;  4B43 A;  2JVH A;  1GXQ A;  1VZ0 A;  4RDU A;  2AQE A;  1H9G A;  3G71 I;  3S2W A;  3FF5 A;  4QIW N;  1ZRC A;  3R61 A;  1T6S A;  4LD5 A;  4FIS A;  2H8R A;  3BLY A;  5HLT A;  3BG3 A;  5CPR B;  1E2X A;  3CF2 A;  4OAZ A;  2WWY A;  3K69 A;  2P5V A;  3CDH A;  2K40 A;  2LMD A;  4M6V A;  1YX3 A;  4PDK A;  5CKT A;  2L5Q A;  4CIC A;  2Y9Z A;  3TQN A;  1WFX A;  2NVY J;  2JT1 A;  5E17 F;  2KIS A;  1ORK A;  3QP6 A;  3KP7 A;  2E2I J;  3I4N J;  1NG7 A;  1FBU A;  1KON A;  2R7U A;  1UG0 A;  1H89 C;  3L09 A;  1BR4 A;  5JI6 A;  3ABT A;  4CSW A;  5KVR A;  1X3U A;  5K1Y A;  4BHP A;  1SD5 A;  1CF7 B;  3BOQ A;  2KMU A;  3KP5 A;  3G1M A;  3Q5F A;  3UNG C;  3A03 A;  4G12 A;  2Z33 A;  3ZQI A;  1QRY A;  4A2U A;  4BJT A;  2P81 A;  4HBL A;  3C1D A;  4EM0 B;  5M5W J;  2L7M P;  3MD2 A;  3GLL A;  2FNP A;  2ME0 A;  2VXD A;  5EJC A;  4I98 B;  1YFH A;  5C44 J;  1JT0 A;  4RM2 A;  2K9Q A;  4EGZ A;  1OYY A;  3HBL A;  3OYI A;  2XGD A;  2LK2 A;  2VAS A;  4LMY A;  4XID A;  4XN3 A;  3SFI A;  3ONQ A;  3ZR8 X;  2M4G A;  4ZZL A;  1FTT A;  3HKZ N;  3WU1 B;  3G4S I;  3P9K A;  1WZ2 A;  4BBS J;  5LBQ A;  2DOE A;  2BOL A;  2HOE A;  2KFD A;  2N8G A;  4AYB A;  2VBZ A;  2PFB A;  2XF6 A;  3VSK A;  3FDY A;  2MD5 A;  4I99 C;  2JQ7 A;  1VQ9 I;  5FFZ A;  2A61 A;  1K6Y A;  1I5Z A;  1D3Y A;  4I76 A;  1NH3 A;  2KP6 A;  3GVA A;  1K4T A;  2P6T A;  2X6X A;  3DLA A;  3RJP A;  2GAU A;  1QHG A;  2H6B A;  4YRV A;  1LE8 A;  3KYL A;  5BQT A;  2V9V A;  1JKO C;  1MMA A;  1VQN I;  2BVM A;  4IPA A;  3GTM J;  1BN5 A;  2X1D A;  5IYC J;  1NK3 P;  1U8B A;  1Y6I A;  4DNC A;  1VQM I;  1IN5 A;  5CVI A;  1RKW A;  2P6S A;  4LG3 A;  3LSI A;  3MZY A;  3OYB A;  2YS9 A;  4A3J J;  4RAF A;  1ZN2 A;  2M87 A;  1VND A;  3W3C A;  2L9V A;  1HKT A;  3JRC A;  2MH9 A;  4QPO A;  1BW5 A;  4Y17 A;  4B44 A;  2P8T A;  2K7L A;  2I8D A;  2ZSH B;  1O7L A;  3GEZ A;  3H1C A;  3AG3 H;  3P5J A;  4XK4 A;  1KQ8 A;  1YE9 A;  4M6X A;  5J1U A;  2WV1 A;  2EK5 A;  4B3A A;  3NRV A;  3EQL F;  2MLG A;  2NVX J;  1FY7 A;  3E5Q A;  5E1Z B;  4O6J A;  3L00 A;  5FKK A;  4KA4 A;  4KFC A;  4XKB A;  5EDN A;  2LF7 A;  1R5H A;  2UZK A;  2WV0 A;  2Z5U A;  3OV8 A;  2W84 A;  2FX0 A;  1FSE A;  3BR5 A;  3CDI A;  1UZC A;  4BU2 A;  2HOS A;  1SVL A;  3JRH A;  2E60 A;  3HGY A;  1JTY A;  2NXN B;  3F22 A;  5H20 A;  2WB1 A;  4BEH B;  4RM3 A;  4BAY A;  3T0Y A;  2KRF A;  1BOB A;  2IS1 A;  1NTC A;  1J59 A;  4X6A J;  4F93 B;  2OA4 A;  3M07 A;  3O2P E;  4C2M J;  3JRB A;  5B1B H;  1U5T B;  4IKF A;  1V5G A;  2CJJ A;  2CSO A;  4JX4 A;  2CV1 A;  3QYB A;  1T33 A;  4GYI A;  1FOX A;  2COB A;  1EKE A;  1SVM A;  4HPQ A;  5CVJ A;  4AIK A;  2LP0 A;  1Z21 A;  3GTL J;  5M5X J;  1ZR2 A;  3IHU A;  2JRM A;  2VKE A;  3WHC A;  5FLM J;  2RRE A;  3REO A;  1WRJ A;  1I1G A;  4OIP F;  2OTJ I;  2EPF A;  5J6X A;  3IH4 A;  1UG2 A;  2NS8 A;  2XB0 X;  4IL6 C;  1UCR A;  3CDL A;  3K4J A;  1K4S A;  4S05 A;  1TP4 A;  3ULQ B;  3ESW B;  2ZXW H;  4XOP A;  4XR6 A;  1RI7 A;  2XV4 S;  4FX0 A;  1B6A A;  2WC2 A;  2H8W A;  2JZY A;  5JLX A;  3WTS C;  3JRD A;  3A01 A;  2RDP A;  4BXX J;  4YIF A;  1ACI A;  1ONV A;  2V1N A;  2A6H F;  1JI8 A;  2XPU A;  3BJO A;  3N05 A;  2BEO A;  1X1A A;  2EIJ H;  2ZME A;  1P4X A;  1XSX A;  3DKY A;  4XRM A;  4N9I A;  2E1C A;  4RMN A;  1GVD A;  3M8J A;  4A0X A;  1TWF J;  5DD4 A;  2A07 F;  2FOW A;  3E6D A;  2QSH X;  3HOT A;  1UAA A;  3FXR A;  4PJL A;  4LOC A;  2QQ9 A;  2XF5 A;  2VLA A;  1CGP A;  3AG2 H;  1ENH A;  4BQQ A;  4KIT B;  4C3I J;  1H8A C;  3L2Q A;  1MSE C;  1BOA A;  2V1X A;  4A0Z A;  1E0E A;  1X2M A;  3OOP A;  1MW7 A;  2MH2 A;  2ELH A;  3JRF A;  4EJV A;  3CJQ B;  2KRC A;  4ENM A;  1NK2 P;  1R23 A;  2ZCW A;  4I01 A;  1I6H J;  3CLQ A;  2MLK A;  1ETV A;  4BQN A;  1MMG A;  3DPT A;  2HQ5 A;  3Q0U A;  4XIC A;  1A6Q A;  2BHY A;  1I3Q J;  4XSZ F;  2AO9 A;  2XIG A;  2O9L A;  1U3E M;  1DUX C;  1XS9 A;  1XSD A;  4YG2 F;  4JBA A;  4XM3 A;  2X4H A;  3ZGK A;  4EJW A;  3CO6 C;  1BBY A;  2EIM H;  4ENJ A;  2DFH A;  5HLG A;  2CQN A;  1XDS A;  4EJT A;  3CCS I;  4ESF A;  2GOM A;  4RB1 A;  3JTH A;  3JRE A;  5JVG F;  2LG4 A;  3BR2 A;  3BZK A;  4U87 A;  5HVQ C;  1MND A;  4B8X A;  4XKW A;  1ODD A;  2QQ8 A;  3AG4 H;  4Y7N J;  4A5N A;  3B6A A;  1OIS A;  2UWM A;  5LGN A;  3ZMS A;  3NAU A;  1I27 A;  3ML6 A;  3B02 A;  1GHC A;  1IUY A;  3TDU C;  4Z2Y A;  2VE8 A;  1XN7 A;  1T95 A;  1UB9 A;  3E6B A;  2FUG 2;  4M9X A;  3J81 Z;  1S7A A;  4XRF A;  1AKH A;  3SZT A;  4V2G A;  3SJM A;  2EFQ A;  1RET A;  1K6O A;  1RKT A;  1AA7 A;  2WAQ N;  2K3P A;  4HG2 A;  3LA2 A;  2E2H J;  1U0J A;  3CD6 I;  3CMY A;  2DJN A;  3MCZ A;  3F0C A;  4NB5 A;  3EUK L;  4M9Z A;  4KIB A;  1X58 A;  5E1X A;  2EWN A;  2ID6 A;  2OBP A;  3PFY A;  3BTJ A;  1REP C;  2IGO A;  2R5Z B;  4UNO A;  2ADU A;  3HOX J;  2IW5 A;  4OWR B;  2DXI A;  1PUE E;  1FWZ A;  2V26 A;  4CDG A;  4JQF A;  4N4O B;  4ZYE A;  3J80 K;  3QPS A;  4HDU A;  4KIG A;  5EG0 B;  1D5Y A;  1XPX A;  2W4S A;  4CZC A;  4DIQ A;  1O3S A;  5HS7 A;  5A2Q K;  2DTZ A;  2M7A A;  4I2O A;  5IT9 K;  1FMW A;  1PUF B;  2MFZ A;  3OYK A;  4XLP F;  2MAB A;  3C2H A;  4PGH A;  2BW3 B;  3GUD A;  1U78 A;  2JRT A;  2IPQ X;  1R6R A;  2JPB A;  2FMY A;  4YFN F;  1ZTR A;  3QU3 A;  2GLO A;  4A5M A;  4LK1 F;  4RGS A;  1SFE A;  2LNB A;  1LNW A;  1VQ8 I;  2RGV A;  2IT0 A;  1EA3 A;  4I0B A;  1T08 B;  5TGT A;  5GPC A;  1XMK A;  3OS1 A;  5D5V B;  1UHM A;  3I3L A;  3K4K A;  3I71 A;  1JE8 A;  2E2J J;  4CA0 A;  2FML A;  1RPW A;  1IXS B;  5F27 A;  3HPG A;  3V7R A;  1MNM C;  2UUZ A;  1S7E A;  2E36 A;  3A4C A;  4Q47 A;  4I0A A;  2CV2 A;  5IOZ A;  4HX8 A;  2M34 A;  1N75 A;  3SEZ A;  3ZMT A;  1OKR A;  3TDZ C;  1EJ9 A;  4OIO F;  2EB7 A;  1ZRE A;  1BJA A;  2VL8 A;  2Z9O A;  4W1U A;  1S3J A;  2F48 A;  4EEF G;  3AFH A;  3RKX A;  4XON A;  2CQQ A;  1DU0 A;  3ZN1 A;  2VKH A;  3TO9 A;  2W48 A;  1F43 A;  1WJB A;  4F3Q A;  2K9S A;  4FT8 A;  1V54 H;  1IRF A;  1MD0 A;  1CF7 A;  2BXZ A;  3F8B A;  3F6V A;  3OIO A;  4KDP A;  1R22 A;  3FHN A;  1IV6 A;  1IO2 A;  1Z3Y A;  2R4G A;  1MNE A;  2M5W A;  2Q0O A;  4WXH A;  3WGI A;  3S16 J;  3GTQ J;  1SFU A;  2E34 A;  3COA C;  1S5L C;  4RB0 A;  3PQK A;  1IXC A;  1YQA A;  2VKV A;  2HQN A;  5D4R A;  5E3N A;  3JCU C;  2R92 J;  2BZT A;  2Y69 H;  1QO0 D;  4LLL A;  4HSR A;  3DTI A;  2EA2 A;  3K4M A;  3OOU A;  3I55 I;  4MQ9 F;  3E6C C;  2DJI A;  3HRT A;  3GZN B;  4PJM A;  2OV7 A;  3FX3 A;  4HAM A;  1ZRF A;  4MHG A;  3IWF A;  3OYD A;  2B9S A;  5IOY A;  3VEP A;  3TW6 A;  1TNT A;  2DCE A;  1DGW Y;  3HB9 A;  3JSO A;  5M3M J;  2MG4 A;  4BY1 J;  2VT3 A;  4PZJ A;  2DMN A;  1CQT A;  3IAM 2;  3IKV A;  2Q8K A;  5IYD J;  1P92 A;  1XGS A;  3NQO A;  5JLW A;  3ECO A;  1J9I A;  3FBN B;  4WX9 A;  2OD5 A;  4E7K A;  1Y0N A;  2RKH A;  3LSP A;  3PNT A;  3GZ6 A;  5GAH J;  1C0W A;  1BI0 A;  2FNA A;  3DBL B;  3MQ0 A;  1E3P A;  4EM1 A;  4D9J A;  3GW2 A;  2KDO A;  3AG1 H;  1TWC J;  2L0K A;  3HOU J;  4RB3 C;  4R1H A;  3HOY J;  3PO3 J;  2VE9 A;  2D2W A;  2RNG A;  4PCQ A;  2CO5 A;  3HZJ A;  2ICW G;  3J80 Z;  3QWL A;  2XGE A;  1FBS A;  1YO5 C;  4RLQ A;  2MC3 A;  5A2Q Z;  1FLI A;  2ZJ2 A;  5IT9 Z;  1VQK I;  5ICF A;  2KZV A;  1F4K A;  1A6I A;  1I50 J;  2FEZ A;  3TGN A;  5FJ8 J;  2BY0 A;  3TL4 X;  4KMF A;  1ETY A;  1FOW A;  5LEJ A;  3WOD F;  2QEX I;  1IRZ A;  4U88 A;  4XSX F;  2ZFU A;  2QSG X;  2IVM A;  3VDX A;  4D7N A;  4G7Z F;  4U0V A;  2HYF A;  1UEL B;  1XG1 A;  2LY2 A;  4B4C A;  3ABU A;  2P0W A;  2K27 A;  4II3 A;  1JGS A;  4K2E A;  1DP3 A;  1JJ8 C;  3FK6 A;  5D6E A;  3IP4 B;  2CUJ A;  3U1K A;  5LHG A;  1I39 A;  4E70 A;  1GDT A;  2EV0 A;  1G4D A;  1VQ4 I;  2OZU A;  4E7L A;  5ILS A;  1U5T A;  4C30 A;  4OIR F;  1YRN A;  5IYB J;  1A5J A;  4HZF A;  3DTE A;  1QZZ A;  3I59 B;  3J7Z I;  1GUU A;  4KN4 X;  3FXL A;  1APL C;  1S8N A;  2DQL A;  4BBR J;  1P4W A;  2EZL A;  4HLX A;  1HOM A;  2R7Z J;  4A6E A;  2PQ8 A;  3WTY C;  5E8I A;  4HNV A;  3ECH A;  3DTK A;  3CCJ I;  3E97 A;  3AKZ A;  1ERD A;  2W57 A;  1NHA A;  3DCF A;  1Z9C A;  4E7J A;  3PIO F;  2Y0S A;  2R7S A;  3S3N A;  3HSE A;  2AHQ A;  2F4I A;  5LRS A;  5C4J J;  1WI9 A;  1T38 A;  1SAU A;  1W5C C;  2ZJR F;  1FMV A;  4C2T A;  3DV8 A;  2NS0 A;  1T0F C;  1IV8 A;  4P55 A;  4BUP A;  4CCO A;  2X85 A;  4G6T B;  1RUN A;  1ZEL A;  3F8C A;  4FCY A;  2L7K A;  1O57 A;  4A6D A;  4WF2 A;  1SD6 A;  2H1L A;  2NAZ A;  5IT3 A;  2M9H A;  4AID A;  2E1M B;  1S9H A;  3FIS A;  4V19 K;  3EPZ A;  1B9N A;  4ANJ A;  4IHW A;  1R1V A;  3PNV A;  2FE3 A;  5L3D A;  5EF6 A;  5J3L A;  3DKX A;  3IH3 A;  1WJF A;  1OFC X;  3TO7 A;  4CCN A;  1IUF A;  2PMU A;  1PYV A;  4E7H A;  2IGM A;  4HDV A;  3PL8 A;  5D8L B;  3OMY A;  2RNJ A;  1N78 A;  3EYI A;  2EIK H;  2LBF B;  3A0B C;  3ZRG A;  1J75 A;  2DT5 A;  2BVL A;  3C7J A;  3CO7 C;  1UHW A;  3SZP A;  1ZHF A;  3CF5 F;  3WHB A;  2HXO A;  3KYD B;  3I9V 2;  3OS0 A;  2FQ3 A;  5EZH A;  1TBX A;  4M74 A;  4UV8 A;  3UKG A;  3KIO A;  4LB6 B;  1IAW A;  5J8F A;  5F1J A;  3V4G A;  1KQ0 A;  4KYW A;  2JWT A;  2EFP A;  2DYS H;  2R5Y A;  2V9P A;  1S7O A;  2OJE D;  4ASN A;  2MD0 A;  2XAF A;  2VUM J;  4IRI A;  3TOA A;  2VJI A;  1GV5 A;  2F5E A;  4LFU A;  2IA0 A;  3KEO A;  2FU4 A;  4UHT A;  2YUS A;  3T8R A;  2Y0M A;  1UST A;  2DA1 A;  1HSJ A;  3K1P A;  1KYZ A;  2KIM A;  2CW7 A;  4ZC3 A;  3J7A Y;  1PP8 F;  2DO7 A;  3K1N A;  1T8I A;  1R00 A;  3I56 I;  1YIJ I;  2NNY A;  2C6Y A;  1BIB A;  4QPQ A;  4L9T A;  1X3W B;  4NC6 A;  4PFO A;  2VIX A;  1L3L A;  1QZE A;  4PSW A;  3ZOB A;  2KIU A;  2PLY A;  3KP3 A;  5BMZ A;  1R5G A;  1BA5 A;  4A0Y A;  3L1P A;  3HRS A;  3GFL A;  4GGG A;  3DBH B;  5EEH A;  1WHU A;  3W2V A;  1IN6 A;  4HOB A;  4UUT A;  1A31 A;  4MEX F;  2RVC A;  1K7A A;  1JHF A;  2QKL B;  3HTU A;  1F1Z A;  5IPA A;  4QTR A;  1MSF C;  3Q9V A;  2R5Z A;  1Z05 A;  2Q2E A;  2QUF A;  2XAU A;  4IVN A;  2OPT A;  3FK7 A;  1LFB A;  1SMY F;  1U9N A;  5ICG A;  4KIC A;  3FM5 A;  5EG0 A;  2JSP A;  1K78 B;  1G3S A;  1IRX A;  2OTL I;  2XGC A;  2K9L A;  4AUX A;  4TV7 A;  4IRH A;  2W25 A;  2GZW A;  2BW3 A;  3H0D A;  3F8N A;  2GBY A;  1D1A A;  4M9S A;  3ERE D;  4BAC A;  2ZNZ A;  4BNC A;  3MFK A;  4IX7 A;  3D5S C;  2DA4 A;  3BCA A;  4AM3 A;  3A02 A;  3OYA A;  2GM4 A;  1X2N A;  3K2A A;  4OMY A;  5KAI C;  3HC7 A;  2DN0 A;  4V2F A;  4WCG A;  3WE3 A;  4D0P A;  4UVA A;  3L2C A;  2KHM A;  1HW1 A;  3S15 J;  2XDV A;  4X1E A;  4XOT A;  3EUA A;  4GCV A;  2HVQ A;  5JFR A;  2UXN A;  2BXY A;  4HV6 A;  5F6F A;  2F5V A;  2XHK A;  2O03 A;  3E7L A;  2IGN A;  2EIL H;  2CUF A;  3RYR A;  2BY3 A;  5JR3 A;  2FSW A;  1LDD A;  1GXP A;  2DFF A;  1QVT A;  3VSL A;  3I54 A;  4QWQ A;  1IF1 A;  4PK4 A;  3WGG A;  1BC7 C;  2M8E A;  3WTT C;  2O5R A;  2L3D A;  3SXY A;  4JX5 A;  3T5X A;  1GT0 C;  5D4S A;  1F9N A;  2HPI A;  3ISP A;  1PP7 U;  3O8G A;  4R8H A;  2DMT A;  2ME6 A;  3WTV C;  3CP8 A;  2EZH A;  4MTD A;  3RI4 A;  2OQG A;  3OYC A;  1BI3 A;  1Y0U A;  1AHD P;  3LL7 A;  3O8H A;  5ERI A;  1SAX A;  2JJ7 A;  4BQO A;  4X0G A;  3F9K A;  4U7B A;  2LD5 A;  3KP2 A;  1VTN C;  1XCB A;  5LGT A;  1TL8 A;  1X3Z B;  2XRO A;  2DOF A;  3JR9 A;  3K2Z A;  4KNY A;  2L02 A;  5FB2 A;  1I1S A;  5GTH C;  5FLX K;  1A36 A;  4DOZ A;  4F55 A;  1B8I B;  1A35 A;  2NS7 A;  3MZH A;  1YW7 A;  1O3R A;  4A3B J;  3KEQ A;  3CJT B;  3F72 A;  4MTE A;  2PMH A;  2CQX A;  1D0Y A;  3DPU A;  1QPM A;  2AS5 F;  2F5C A;  2ISY A;  3HKZ A;  1QNT A;  3BG6 A;  4ZYD A;  1KZH A;  2R7V A;  2HKO A;  5J8C A;  3ZMZ A;  1PVE A;  4MFD A;  2ECB A;  4IO9 F;  3CP2 A;  3K9T A;  3SEQ A;  3TMO A;  2BY2 A;  3CJN A;  3FXO A;  2ZME C;  2PX9 A;  3L9F A;  1Z0X A;  2WTE A;  1QVU A;  1HBX G;  4IHT A;  4HF1 A;  3HIF A;  1VF9 A;  1YW8 A;  2DMU A;  2LFB A;  1XCV A;  1Y8Q B;  1SC7 A;  2YPR A;  3Q3S A;  2QZ8 A;  4PFP A;  3F23 A;  1XB4 A;  2XVC A;  3HM5 A;  2KIQ A;  4P96 A;  2QBY A;  2D45 A;  3SDG A;  3CUQ B;  1QBJ A;  3H5N A;  1GV2 A;  1D1C A;  4LB5 A;  2BHZ A;  2R7O A;  4CYD A;  2CG4 A;  3LOC A;  1XSV A;  2E7X A;  3TOB A;  2MA3 A;  5LHI A;  5LEK A;  4H0E A;  5TJJ A;  5ED4 A;  2DMQ A;  3BR0 A;  1J09 A;  3I4P A;  2DA6 A;  3BTI A;  3RQ4 A;  3BG5 A;  1IRG A;  3E5U A;  3HGG A;  3I0T A;  4RLF A;  3GFI A;  2L9R A;  2ID3 A;  3PIP F;  2DI3 A;  3ZQ7 A;  2HQA A;  5FRM A;  3IUO A;  1HXD A;  3MAJ A;  3VYS B;  2NOJ B;  2OU2 A;  4ESB A;  1Z3X A;  2W85 A;  1VQL I;  2LF8 A;  2ACJ A;  2E5N A;  3GZ5 A;  1G3W A;  4IOA F;  3DP7 A;  2DPD A;  2G7U A;  4YIR X;  1OYI A;  2HOT A;  2DDB A;  4II2 A;  5HNF A;  3R6S A;  1IXR C;  2GQQ A;  4GDF A;  4HLY A;  4ENK A;  5IP6 A;  1RES A;  5EGO B;  3BWG A;  3VB2 A;  4L18 B;  2VJ4 A;  1V5F A;  4MLO A;  1HST A;  3GME A;  4PGG A;  3GTP J;  1QPI A;  3Q0V A;  2MW8 A;  2PG4 A;  5ILV A;  2G9W A;  2E1M C;  4PSX A;  2MBF A;  2M2E A;  3I59 A;  2MYS A;  2J5O A;  1YS6 A;  2O3F A;  3L2V A;  5BS6 A;  1EH6 A;  4LG0 B;  2XRN A;  2VOO A;  2LKS A;  3BJA A;  1JUS A;  3HEF A;  4XLA A;  4UUV A;  1HW2 A;  1O3Q A;  1F36 A;  3KEY A;  3LQR A;  3E0J B;  3B6C A;  1J5Y A;  3I58 A;  4HNT A;  3IAS 2;  1ETO A;  2O7O A;  3FM3 A;  3GO5 A;  3HHH A;  3IRR A;  1TNS A;  2R3S A;  2CFX A;  3E1S A;  3MKZ A;  1VQ6 I;  2F4O B;  3TP0 A;  3BR3 A;  4L0Z B;  3RYP A;  2KRH A; 
#chains in the Genus database with same CATH homology
 3VOE A;  4EVI A;  4KMU X;  3R4K A;  3V7S A;  4RB2 C;  1LB2 A;  3FMQ A;  4EMS A;  2DU9 A;  3I53 A;  4BHC A;  4BYY A;  1ZAO A;  4WXD A;  2ESN A;  1OMI A;  1O7F A;  1W7P A;  2CQK A;  5E1W A;  2H09 A;  2QM3 A;  4ZYH A;  5ICE A;  2STT A;  1FT9 A;  3JW4 A;  5CVV A;  3SHF A;  4MNU A;  2XKP A;  4QLC U;  1LEB A;  1YIO A;  1FYM A;  2IA2 A;  4WXC A;  4XBF A;  4KUM A;  1B1B A;  3C3W A;  4S04 A;  2VBW A;  1ULY A;  4IRG A;  2QQB A;  2A6E F;  1TW3 A;  4HV5 A;  2FBK A;  2K86 A;  3DF8 A;  2RN7 A;  4EJU A;  4MEY F;  3F8M A;  1LVA A;  4BH9 A;  2B0L A;  2H6C A;  4ETS A;  1ZGA A;  4UVC A;  2GIV A;  3U2R A;  4AWX B;  3H3U A;  2GA1 A;  3NEU A;  1YYV A;  3ZMD A;  1MDM B;  2HS5 A;  4EQQ A;  3RPQ A;  3DQV C;  4LGW A;  1D8J A;  1RZ4 A;  1ZG1 A;  5LLQ A;  1ZRD A;  3ZPL A;  1P4A A;  1WQ2 A;  2A68 F;  1W5T A;  2K02 A;  1YG2 A;  3M7G A;  1KU7 A;  4A12 A;  1K78 A;  4L9J A;  4I7H A;  2CGP A;  5D6F A;  3D0S A;  3GF2 A;  1B59 A;  3IC7 A;  2D1V A;  3HSF A;  3O3K A;  3MWM A;  2P7V B;  4JK1 X;  3QPT A;  4G7O F;  5LHH A;  2HFH A;  1ZAR A;  2XAG A;  4GO1 A;  4M72 A;  5BPD A;  1MGT A;  3FMS A;  4L9N A;  1BI2 A;  3E5X A;  1BI1 A;  3DEU A;  1MJA A;  2HR3 A;  5CVR A;  1RNL A;  3IWZ A;  4CXF A;  1MJB A;  3QRF F;  1ZYR F;  3MEX A;  2H27 A;  4L0Y B;  1E17 A;  4G94 A;  3ZP5 A;  3DKW A;  1A04 A;  4U0W A;  1FYK A;  4HX4 A;  4G7H F;  3KLO A;  2VXZ A;  3DFG A;  3RKW A;  5F1R A;  1D8K A;  2EV5 A;  1U5T C;  1FX7 A;  2W24 A;  4XLN F;  3ZMU A;  5D5U B;  4HW0 A;  3VOD A;  4OIN F;  1K79 A;  1OPC A;  3B73 A;  4RAY A;  1H9T A;  4HA8 A;  5ICC A;  2PEX A;  1B9M A;  3KZY A;  5K5R A;  2RC4 A;  3V8K A;  2F2E A;  5HLI A;  1BM9 A;  3HTS B;  5FD5 A;  1IW7 F;  2LDU A;  5FO5 A;  5HDG A;  4L5I A;  2HQR A;  1HW5 A;  2LKP A;  3ROU A;  2COM A;  2L4M A;  1YW9 A;  1DP7 P;  2CWE A;  4I09 A;  2LSO A;  1R58 A;  3CUQ A;  5E18 F;  1ON1 A;  2ZBK A;  1TQI A;  4NHJ A;  1LQ1 A;  3M9A A;  2FBI A;  1MJ9 A;  4G6D A;  1XD7 A;  2K4B A;  1U8R A;  2Y48 A;  4Y15 A;  3QU6 A;  1R1U A;  4HX7 A;  4HQE A;  4G6Q A;  5HS9 A;  1DPU A;  1U2W A;  1IN4 A;  4RAZ A;  2QLZ A;  4B09 A;  2GXG A;  1MKM A;  2YX4 A;  2CYY A;  2NYX A;  3HOS A;  2DW4 A;  4G9Y A;  3KP4 A;  4RS8 A;  2F5F A;  3EUH A;  3LAJ A;  4LG0 A;  3DPL C;  1PDN C;  2FOK A;  1W4M A;  5AON A;  5CVU A;  2EA4 A;  1ZG5 A;  2VC1 A;  4AIH A;  1XDU A;  5K5O A;  3KET A;  2JPC A;  5DV5 A;  3O6B B;  4KN7 X;  1I6X A;  3Q9S A;  4IXA A;  1EV7 A;  3EYY A;  1QQI A;  4L5J A;  1HKS A;  2M30 A;  1ZG3 A;  2QYO A;  3V7C A;  2BYV E;  3U1D A;  2XAH A;  2JSC A;  2P5L C;  1S29 A;  2AXL A;  3J7A O;  1KU2 A;  6PAX A;  3V8L A;  1TQP A;  2ESH A;  2OZ6 A;  3W6J B;  3TO6 A;  4MQV A;  4F7Z A;  5E20 A;  1GVJ A;  5DD8 A;  3R60 A;  2M1B A;  1BIA A;  3K0L A;  3QP5 A;  1FP1 D;  1XMA A;  2O8X A;  3R0J A;  1F5T A;  5LGU A;  2F5D A;  5TRD A;  2ZKZ A;  3LFK A;  4OOI A;  5DCM B;  1G3Y A;  4OIQ F;  3EDP A;  1EH8 A;  3M8E A;  5DCF A;  3FWE A;  3BY6 A;  4L9V A;  4EJO A;  2XAJ A;  3GFM A;  1ZLJ A;  1KQ9 A;  2EFO A;  2YSR A;  3ELK A;  1FNN A;  5FGM A;  2FBH A;  3WTW C;  3KP6 A;  1MDM A;  4Q4Z F;  3T8T A;  4GYG A;  1AWC A;  2VBY A;  2HEO A;  4RGR A;  1FBQ A;  2KKO A;  3CTA A;  3FHZ A;  1T98 A;  2GWR A;  4BQA A;  4ZH4 F;  4IJA A;  3WTZ A;  3D5L A;  2YU3 A;  2Y75 A;  1B4A A;  2L4A A;  5L3F A;  4CZZ A;  2D1H A;  5L3B A;  2PI0 A;  3IKT A;  4M71 A;  1R7J A;  2VOP A;  5AIQ A;  3ZMV A;  3P9C A;  2V6C A;  5CJ9 A;  1XGO A;  3KLN A;  1D5V A;  4MGR A;  2HGC A;  4NQW A;  3SFZ A;  4LK0 F;  1T2K A;  4N9H A;  1ZGJ A;  3CLO A;  2X0L A;  3FXU A;  2OQR A;  3VFZ A;  4ZZD A;  1J2X A;  2P7C B;  1R36 A;  3I5U A;  2QQA A;  1XGN A;  1YS7 A;  2NRA C;  4YII A;  1Z1D A;  4KIF A;  4YFK F;  1H0M A;  2IJL A;  3G73 A;  2QVO A;  3HUG A;  2VOD A;  4LLG F;  1FPQ A;  5LRR A;  4LLN A;  1R1T A;  3J81 K;  4UXN A;  2BE5 F;  4EM2 A;  1DDN A;  2CW0 F;  2QWW A;  2BBY A;  5HLH A;  3RIR A;  4IF4 A;  3JAM K;  4CHU A;  3GWZ A;  2FXA A;  2P5K A;  2ZNY A;  3H3Z A;  1LJ9 A;  4CO8 A;  3LA7 A;  5EEG A;  4RGU A;  4HYE A;  3IL2 A;  2L01 A;  5DDG A;  3QAH A;  2DLL A;  2DQR A;  2O6G E;  4HQM A;  5HDN A;  4M73 A;  4UVB A;  1ZH5 A;  1FOK A;  4YFX F;  2K4J A;  4Q48 A;  2O61 A;  2DBB A;  3LA3 A;  2UXX A;  2A5Y B;  2KJC A;  2Z3Y A;  3LAP A;  1Q1H A;  3U9G A;  3F21 A;  1FZP B;  2HWV A;  2YR2 A;  2V1D A;  4WK8 F;  3P9I A;  4AIJ A;  3H92 A;  1XGM A;  3LST A;  4WWC A;  1J0R A;  5HS8 A;  3BPV A;  1OR7 A;  2PBI A;  1BC8 C;  1V3F A;  5FLX Z;  1KU9 A;  5KK1 A;  4AVP A;  3F6O A;  1EH7 A;  1FC3 A;  1G3T A;  2TDX A;  1IZ1 A;  4U0Y A;  4O5V A;  1KA8 A;  2EV6 A;  1L0O C;  1P2F A;  2VC0 A;  5D8K B;  2YX7 A;  2R7F A;  1KYW A;  2O0Y A;  1TQM A;  3KFW X;  2ISZ A;  3WU0 A;  3WTU C;  4I02 A;  3AAF A;  1KU3 A;  5L3G A;  3LWF A;  4R79 A;  4EV0 A;  1DPR A;  5BPI A;  2EJR A;  2M45 A;  3FMR A;  3KCC A;  3JAM Z;  3R0A A;  2JTV A;  2EFN A;  2Z99 A;  3QPH A;  2FRH A;  1IN7 A;  1Z7U A;  3BJ6 A;  2BV6 A;  1YTY A;  4BXU A;  1KGS A;  2VN2 A;  4Y13 A;  3K1M A;  1MZB A;  5JVT A;  4UV9 A;  5HOO A;  3BP8 A;  2L54 A;  1T39 A;  4BHB A;  1WKM A;  5CYV A;  5FFX A;  2ETH A;  3F8F A;  5DCM A;  2HTS A;  2KJB A;  3GFJ A;  1ZLK A;  2VBX A;  4P5O A;  2DFI A;  4P9F A;  3JTG A;  3F3X A;  3CUO A;  3DXJ F;  1STZ A;  1W7P D;  1RUO A;  1SMT A;  2ZXJ A;  1QGP A;  1U6G A;  2ZO4 A;  3W6K B;  2DPU A;  4U7D A;  2RV8 A;  1W5S A;  2HTJ A;  3PQJ A;  1P6R A;  2PN6 A;  2V1U A;  3RDI A;  3I64 A;  5E8G A;  1TLH B;  4GXO A;  5HDK A;  1Z6R A;  4FHT A;  5H6R A;  1FYL A;  3WE2 A;  5CLS A;  2E7W A;  4AD9 A;  5JHU A;  2R7D A;  2KIF A;  3G3Z A;  3GYH X;  4RGX A;  1FSH A;  1Z91 A;  4ESJ A;  1G6N A;  3L7W A;  2DAO A;  2HKX A;  4ZYG A;  4LJZ F;  2E1N A;  3WG9 A;  2QEN A;  1V4R A;  2VON A;  2A69 F;  5DYM A;  5DUK A;  3HHG A;  2STW A;  2DK8 A;  2XUB A;  5AIP A;  1SD7 A;  4P9U A;  3M1E A;  5H6Q A;  2DK5 A;  3JSP A;  1ON2 A;  2G7H A;  4ON0 A;  3CUQ C;  5F64 A;  2H94 A;  2HYG D;  2FF4 A;  2NNN A;  3RTR A;  2QBY B;  4KT5 C;  3BPX A;  2VT2 A;  2EFW A;  5D5W B;  1SFX A;  2RQP A;  1IN8 A;  1J7K A;  5DUI A;  1TTY A;  2DTR A;  2BGC A;  1JXS A;  2GXB A;  1HKQ A;  2HDC A;  2ZME B;  3RPU A;  3HRU A;  3GX4 X;  2IA1 A;  1LEA A;  1FP2 A;  3BRO A;  4DQ2 A;  1AOY A;  2V79 A;  3KE2 A;  1RIO H;  1YLF A;  3TKY A;  4M6Y A;  3EET A;  1UFM A;  1WWX A;  3HYI A;  1Z6T A;  3V8J A;  1QZY A;  2J5P A;  3C18 A;  2XAQ A;  2PJP A;  3PFI A;  3HRM A;  4HF2 A;  4O3M A;  4EGY A;  3HSR A;  3N4M A;  5BOX A;  1OYW A;  1HQC A;  3N97 A;  3QOP A;  4OU0 A;  1LDK B;  3WTX C;  3IRQ A;  4N0B A;  3T1B A;  1LDJ A;  2IRF G;  2A3S A;  2ZFW A;  2OAZ A;  5DEQ A;  3LQQ A;  1W7P B;  3KZZ A;  3M8F A;  5FD6 A;  3RKY A;  3SQN A;  1TW2 A;  2GA2 A;  5L3E A;  1JHH A;  1S6L A;  5ILU A;  3WGH A;  3E3V A;  4FX4 A;  2XGX A;  4IHS A;  4OMZ A;  5L3C A;  3P7N A;  3E6M A;  1T0F A;  3GLX A;  2FA5 A;  4ENN A;  2XKO A;  4HF0 A;  3FXQ A;  5D5X B;  1O3T A;  3ZN0 A;  3FZV A;  4Q5S F;  1USS A;  3BDD A;  1WSU A;  2P4W A;  3GXO A;  5K5Q A;  1SD4 A;  2HZT A;  3BZ6 A;  2XAS A;  4CGZ A;  4G8X A;  2IP2 A;  1GXQ A;  1H9G A;  3S2W A;  3FF5 A;  1ZRC A;  3R61 A;  1T6S A;  4LD5 A;  1E2X A;  2WWY A;  3K69 A;  2P5V A;  3CDH A;  4PDK A;  4CIC A;  3TQN A;  2JT1 A;  5E17 F;  3QP6 A;  3KP7 A;  1FBU A;  3L09 A;  5JI6 A;  3ABT A;  5KVR A;  1X3U A;  5K1Y A;  4BHP A;  1SD5 A;  1CF7 B;  3BOQ A;  3KP5 A;  3Q5F A;  2Z33 A;  4A2U A;  4HBL A;  3C1D A;  4EM0 B;  2FNP A;  4I98 B;  1YFH A;  4EGZ A;  1OYY A;  4LMY A;  4ZZL A;  3WU1 B;  3P9K A;  5LBQ A;  2HOE A;  2VBZ A;  2PFB A;  2MD5 A;  5FFZ A;  2A61 A;  1I5Z A;  1D3Y A;  3GVA A;  2P6T A;  3RJP A;  2GAU A;  2H6B A;  5BQT A;  2V9V A;  4IPA A;  1BN5 A;  4DNC A;  1IN5 A;  5CVI A;  2P6S A;  3MZY A;  1ZN2 A;  2M87 A;  1HKT A;  2MH9 A;  4Y17 A;  2P8T A;  2K7L A;  1O7L A;  3GEZ A;  1KQ8 A;  4M6X A;  2EK5 A;  3NRV A;  3EQL F;  2MLG A;  1FY7 A;  3E5Q A;  5E1Z B;  4O6J A;  3L00 A;  4KA4 A;  4KFC A;  2LF7 A;  1R5H A;  2UZK A;  2WV0 A;  2Z5U A;  3OV8 A;  2W84 A;  1FSE A;  3F22 A;  5H20 A;  4BAY A;  3T0Y A;  2KRF A;  1J59 A;  2OA4 A;  3O2P E;  1U5T B;  2CSO A;  4GYI A;  4AIK A;  5CVJ A;  3IHU A;  3REO A;  1WRJ A;  1I1G A;  4OIP F;  5J6X A;  1UCR A;  4S05 A;  3ULQ B;  1RI7 A;  2XV4 S;  4FX0 A;  1B6A A;  2WC2 A;  2JZY A;  3WTS C;  2RDP A;  4YIF A;  1ONV A;  2A6H F;  3BJO A;  2BEO A;  2ZME A;  1P4X A;  1XSX A;  4N9I A;  2E1C A;  4A0X A;  5DD4 A;  2A07 F;  3E6D A;  3HOT A;  3FXR A;  2QQ9 A;  1CGP A;  1BOA A;  2V1X A;  4A0Z A;  3OOP A;  2MH2 A;  2ELH A;  4EJV A;  4ENM A;  1R23 A;  2ZCW A;  4I01 A;  2MLK A;  3DPT A;  4XSZ F;  2XIG A;  1U3E M;  1DUX C;  1XSD A;  4YG2 F;  4JBA A;  4EJW A;  2X4H A;  3CO6 C;  4ENJ A;  1BBY A;  5HLG A;  1XDS A;  4EJT A;  4ESF A;  4RB1 A;  3JTH A;  5HVQ C;  4B8X A;  1ODD A;  4A5N A;  2UWM A;  5LGN A;  3ZMS A;  1I27 A;  3ML6 A;  3B02 A;  1GHC A;  1IUY A;  3TDU C;  4Z2Y A;  2VE8 A;  1XN7 A;  1UB9 A;  3E6B A;  4M9X A;  3J81 Z;  1S7A A;  4XRF A;  3SZT A;  2EFQ A;  1K6O A;  3LA2 A;  3MCZ A;  4NB5 A;  4M9Z A;  4KIB A;  5E1X A;  2EWN A;  2OBP A;  1REP C;  4UNO A;  2ADU A;  2IW5 A;  1PUE E;  1FWZ A;  4CDG A;  4JQF A;  4ZYE A;  3J80 K;  4HDU A;  4KIG A;  1O3S A;  5HS7 A;  5A2Q K;  4I2O A;  5IT9 K;  4XLP F;  4PGH A;  3GUD A;  1U78 A;  2JRT A;  2IPQ X;  2JPB A;  2FMY A;  4YFN F;  3QU3 A;  4A5M A;  4LK1 F;  4RGS A;  1SFE A;  2LNB A;  1LNW A;  2RGV A;  2IT0 A;  4I0B A;  1XMK A;  5D5V B;  1UHM A;  3I71 A;  1JE8 A;  2FML A;  1IXS B;  3V7R A;  4Q47 A;  4I0A A;  4HX8 A;  3ZMT A;  1OKR A;  3TDZ C;  4OIO F;  2EB7 A;  1ZRE A;  1BJA A;  2Z9O A;  1S3J A;  3RKX A;  3ZN1 A;  3TO9 A;  4FT8 A;  1IRF A;  1MD0 A;  1CF7 A;  3F8B A;  3F6V A;  4KDP A;  1R22 A;  2M5W A;  2Q0O A;  4WXH A;  3WGI A;  1SFU A;  3COA C;  4RB0 A;  3PQK A;  1IXC A;  1YQA A;  2HQN A;  5D4R A;  1QO0 D;  4LLL A;  2EA2 A;  4MQ9 F;  3E6C C;  3HRT A;  3FX3 A;  4HAM A;  1ZRF A;  4MHG A;  3IWF A;  3VEP A;  1TNT A;  3JSO A;  2VT3 A;  4PZJ A;  3IKV A;  2Q8K A;  1P92 A;  1XGS A;  3NQO A;  3ECO A;  1J9I A;  4WX9 A;  2OD5 A;  3GZ6 A;  2RKH A;  1C0W A;  1BI0 A;  2FNA A;  3MQ0 A;  4EM1 A;  3GW2 A;  4RB3 C;  4R1H A;  2VE9 A;  2D2W A;  4PCQ A;  2CO5 A;  3J80 Z;  1FBS A;  1YO5 C;  2MC3 A;  5A2Q Z;  1FLI A;  2ZJ2 A;  5IT9 Z;  5ICF A;  1F4K A;  2FEZ A;  3TGN A;  4KMF A;  5LEJ A;  3WOD F;  4U88 A;  4XSX F;  2IVM A;  4G7Z F;  4U0V A;  2HYF A;  3ABU A;  2K27 A;  1JGS A;  4K2E A;  5D6E A;  5LHG A;  4E70 A;  2EV0 A;  1G4D A;  2OZU A;  5ILS A;  1U5T A;  4OIR F;  4HZF A;  1QZZ A;  3I59 B;  4KN4 X;  1S8N A;  2DQL A;  1P4W A;  4HLX A;  4A6E A;  2PQ8 A;  3WTY C;  5E8I A;  3ECH A;  3E97 A;  2W57 A;  1NHA A;  1Z9C A;  3HSE A;  5LRS A;  1WI9 A;  1T38 A;  3DV8 A;  2NS0 A;  4P55 A;  1RUN A;  3F8C A;  1O57 A;  4A6D A;  4WF2 A;  1SD6 A;  2NAZ A;  5IT3 A;  1B9N A;  1R1V A;  2FE3 A;  5L3D A;  3TO7 A;  2PMU A;  4HDV A;  5D8L B;  2RNJ A;  3EYI A;  1J75 A;  2DT5 A;  3C7J A;  3CO7 C;  1UHW A;  3SZP A;  1ZHF A;  2FQ3 A;  1TBX A;  4M74 A;  4UV8 A;  1IAW A;  4LB6 B;  5J8F A;  3V4G A;  1KQ0 A;  4KYW A;  2EFP A;  1S7O A;  4ASN A;  2XAF A;  4IRI A;  3TOA A;  2F5E A;  4LFU A;  2IA0 A;  3KEO A;  2FU4 A;  3T8R A;  4UHT A;  2Y0M A;  1UST A;  1HSJ A;  3K1P A;  1KYZ A;  2KIM A;  1PP8 F;  2DO7 A;  3K1N A;  1R00 A;  2NNY A;  2C6Y A;  1BIB A;  4L9T A;  1L3L A;  2KIU A;  2PLY A;  3KP3 A;  5BMZ A;  1R5G A;  4A0Y A;  3HRS A;  3GFL A;  4GGG A;  5EEH A;  1IN6 A;  4HOB A;  4MEX F;  2RVC A;  1K7A A;  1JHF A;  3HTU A;  1F1Z A;  3Q9V A;  1Z05 A;  2Q2E A;  2QUF A;  4IVN A;  1SMY F;  5ICG A;  4KIC A;  3FM5 A;  1K78 B;  1G3S A;  4TV7 A;  4IRH A;  2W25 A;  2GZW A;  3F8N A;  4M9S A;  3ERE D;  2ZNZ A;  4BNC A;  3MFK A;  4OMY A;  4WCG A;  3WE3 A;  4D0P A;  4UVA A;  3L2C A;  1HW1 A;  4GCV A;  5JFR A;  2UXN A;  4HV6 A;  5F6F A;  2XHK A;  2O03 A;  3RYR A;  5JR3 A;  2FSW A;  1LDD A;  1GXP A;  3I54 A;  4QWQ A;  1IF1 A;  3WGG A;  1BC7 C;  2M8E A;  3WTT C;  2L3D A;  3SXY A;  3T5X A;  5D4S A;  1F9N A;  3ISP A;  1PP7 U;  4R8H A;  3WTV C;  4MTD A;  3RI4 A;  2OQG A;  1BI3 A;  1Y0U A;  5ERI A;  1SAX A;  4U7B A;  3KP2 A;  1VTN C;  1XCB A;  5LGT A;  2XRO A;  3K2Z A;  4KNY A;  2L02 A;  5FB2 A;  1I1S A;  5FLX K;  1O3R A;  3MZH A;  1YW7 A;  3KEQ A;  3F72 A;  4MTE A;  2PMH A;  1QPM A;  2AS5 F;  2F5C A;  2ISY A;  1QNT A;  4ZYD A;  2HKO A;  5J8C A;  3ZMZ A;  3K9T A;  3CJN A;  3L9F A;  2WTE A;  4IHT A;  1HBX G;  4HF1 A;  3HIF A;  1YW8 A;  1XCV A;  2YPR A;  2QZ8 A;  3F23 A;  1XB4 A;  2XVC A;  4P96 A;  2QBY A;  2D45 A;  3CUQ B;  1QBJ A;  4LB5 A;  4CYD A;  2CG4 A;  1XSV A;  2E7X A;  3TOB A;  2MA3 A;  5LHI A;  5LEK A;  4H0E A;  5TJJ A;  5ED4 A;  3I4P A;  1IRG A;  3E5U A;  3I0T A;  3GFI A;  2DI3 A;  3ZQ7 A;  1HXD A;  3MAJ A;  2OU2 A;  4ESB A;  2W85 A;  2LF8 A;  2ACJ A;  3GZ5 A;  1G3W A;  3DP7 A;  2DPD A;  2G7U A;  1OYI A;  3R6S A;  1IXR C;  2GQQ A;  4HLY A;  4ENK A;  3BWG A;  3VB2 A;  4L18 B;  4PGG A;  1HST A;  2PG4 A;  5ILV A;  2G9W A;  2MBF A;  3I59 A;  2J5O A;  1YS6 A;  2O3F A;  5BS6 A;  1EH6 A;  4LG0 B;  2XRN A;  2VOO A;  3BJA A;  4UUV A;  1HW2 A;  1O3Q A;  3LQR A;  1J5Y A;  3I58 A;  3FM3 A;  3GO5 A;  3HHH A;  3IRR A;  1TNS A;  2R3S A;  2CFX A;  4L0Z B;  3RYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...