1CF7B

Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
GKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*TP*TP*TP*TP*CP*GP*CP*GP*CP*GP*GP*TP*TP*TP*T)-3
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1999-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02319 E2F_TDP E2F/DP family winged-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1cf7B00
3R0AA 4L0ZB 4PDKA 3R60A 2UZKA 3KP6A 4PZJA 1T6SA 4P5OA 5BS6A 3CDHA 2GAUA 2QQBA 4LLGF 4KUMA 2FQ3A 1DP7P 4K2EA 2V1UA 4I2OA 3H92A 3WTZA 2R3SA 5HDKA 3BWGA 4BAYA 4UVAA 3WGGA 2HGCA 4KN4X 4EJOA 2QLZA 4GO1A 1IXSB 1JHFA 4MGRA 1KYZA 1ZGAA 2LF8A 1GXQA 1FLIA 4EVIA 1USSA 4E70A 3QPHA 3J7AO 1W7PA 1YS6A 4I98B 1EV7A 5FD6A 5KVRA 2L01A 4N0BA 2EA2A 2OQRA 4L0YB 3OOPA 4NB5A 2BYVE 3SXYA 2BGCA 1YQAA 2KRFA 4XRFA 2DK5A 1JHHA 2IA1A 5HVQC 4M9XA 1DUXC 5IT3A 3Q5FA 3F3XA 2O6GE 1DDNA 2CYYA 2ZXJA 2K86A 2H6BA 2P7VB 2V1DA 3F6VA 4O5VA 5DCMB 4RAZA 3L00A 3F22A 1YFHA 2GA2A 1X3UA 4EMSA 2RC4A 3RYPA 2QZ8A 1MKMA 2K7LA 4B09A 2VC0A 4BYYA 3J81Z 2HQNA 1UCRA 3QAHA 4EM2A 2HTJA 2YU3A 2EFOA 2A6HF 2A69F 3ZN1A 1KU9A 1XMKA 1REPC 2BE5F 1KYWA 3JW4A 1G3SA 1KU2A 4ZH4F 1V4RA 3P9CA 3W6KB 2WC2A 2XRNA 1FX7A 2P6SA 4A2UA 2P5LC 4EV0A 2EFQA 4OIRF 2MH9A 1P2FA 1IF1A 1WRJA 1QZYA 3TO6A 2KIMA 2O0YA 5TRDA 2ACJA 5HLIA 2ZNZA 2ZMEB 4IRIA 2M87A 5FLXK 1HKQA 4ENKA 4A5NA 4I01A 2Z3YA 1YS7A 3TO7A 3V8KA 4U7DA 2PEXA 5E17F 3E3VA 1O7LA 2XAQA 1MDMA 5HOOA 5K5RA 3IRQA 3GF2A 1QBJA 4AWXB 3F8NA 2MA3A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 2IPQX 2WTEA 1RUNA 1B59A 5D6EA 2Z5UA 1KQ9A 5LBQA 1R58A 2MC3A 2HS5A 1STZA 1BI1A 4KIGA 3QPTA 3FX3A 1FC3A 4LK1F 4Q48A 1FBQA 3J80K 4HX4A 2PFBA 4H0EA 4L18B 2FA5A 4HOBA 1XGMA 3DV8A 3GW2A 1R1UA 3BDDA 4RGXA 2UWMA 4OMZA 3I71A 1KA8A 2CWEA 2PBIA 3QP6A 4P9UA 3I4PA 4WXDA 3VB2A 3HRUA 4ZYDA 6PAXA 1LDKB 2W24A 4RB0A 4XSXF 4DNCA 5E8GA 5A2QZ 4CO8A 3C3WA 3TDZC 4HW0A 5LGUA 5LGTA 3GZ6A 5EEHA 4D0PA 1YIOA 2KKOA 4I0BA 2IA2A 3LQQA 3BP8A 5KK1A 2VE8A 2MLGA 3E5XA 4UNOA 3RPQA 3O6BB 1W5SA 2D45A 1IUYA 1BIAA 3GLXA 1BBYA 1H9GA 1OR7A 2EV5A 4BQAA 3DXJF 2OQGA 4G7HF 4S04A 3GO5A 4MHGA 3GVAA 4WXHA 4N9HA 1HXDA 3QP5A 2IJLA 3C18A 1CGPA 3KEQA 3O2PE 2OU2A 3ISPA 3HRMA 3EQLF 1IXCA 1JE8A 4LG0B 1QQIA 3ZN0A 2J5OA 1HBXG 5FO5A 3SZTA 4ZYHA 2R7FA 2QYOA 5CVJA 2PJPA 1FOKA 1LDDA 4RB3C 1XGNA 2XASA 3CUQB 5HDGA 1XDUA 3I53A 3HIFA 1A04A 2VODA 2QBYA 2RV8A 1T2KA 2PI0A 3Q9VA 1HW5A 5EEGA 1FBSA 1LEAA 5LHIA 3TOBA 3LAJA 3ZMUA 4M72A 3IWFA 4RB2C 1F4KA 3M7GA 3GYHX 5LHHA 1I1GA 1R23A 1TNTA 2HTSA 2IP2A 4KT5C 1L0OC 3WTSC 4ESFA 4U7BA 3E6CC 3V7CA 1XGOA 4WXCA 2EV0A 2BBYA 1V3FA 1YW9A 3MQ0A 2GZWA 1O3TA 1XDSA 2QQAA 2JZYA 1XCBA 3F8MA 4AIJA 4WK8F 1G4DA 2A6EF 2X0LA 5D5XB 2X4HA 5CJ9A 1ONVA 1YTYA 4I7HA 1IRFA 2YPRA 3U1DA 5L3CA 4ENJA 3GWZA 1U5TC 4EJUA 3L2CA 4CHUA 1QO0D 3R61A 4MEXF 4AD9A 2COMA 5AONA 4OIQF 1T38A 3HSRA 3R6SA 1P4WA 2D1VA 1IXRC 2XGXA 5LGNA 3V8JA 5E1XA 3WODF 2VOPA 5ICEA 3ABUA 4MQVA 4FT8A 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 4UHTA 1KU3A 2VBWA 2XAJA 5FFXA 4FX4A 5L3EA 3FXRA 1FYMA 2HDCA 2PLYA 1MDMB 2HR3A 4EGZA 1D3YA 4IJAA 3I59B 5CVIA 1E2XA 4M9ZA 1OPCA 4XBFA 1PP7U 1XD7A 3PQJA 3IL2A 5HS7A 3KP3A 5H20A 1OKRA 2BV6A 5E1ZB 5L3FA 2L3DA 2XROA 1E17A 1BC8C 3TKYA 3FMSA 2P5KA 1FPQA 2BEOA 3E97A 3D5LA 4ZYGA 2PMUA 5K1YA 2M45A 1F1ZA 2OZUA 2W84A 2FRHA 1K7AA 3JTHA 1ZREA 4CICA 4A0XA 1Z1DA 1RNLA 2Y0MA 2PQ8A 3OV8A 1TW2A 3CLOA 4BNCA 3C1DA 2IT0A 1ZG3A 2FEZA 2JT1A 1R1TA 3WTUC 5JHUA 1ZG5A 4G7OF 2EFWA 2ZCWA 3M9AA 1H9TA 2ZKZA 2DAOA 4JK1X 4IRHA 1ZG1A 2QQ9A 3BJOA 1YW8A 5HDNA 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 4HF1A 2XAGA 1XSDA 3M8EA 2UXXA 1NHAA 3COAC 1PDNC 2DPDA 4HV6A 3BJAA 1Z91A 4M73A 4MTDA 3F8CA 4F7ZA 2LF7A 2VXZA 1TBXA 2ZMEA 1XSVA 5CYVA 3WTXC 1YO5C 3F8BA 1S3JA 1TQPA 1UB9A 3U9GA 2L54A 5CVVA 2V79A 2Q8KA 3KLOA 3KE2A 3T8TA 3CUQA 4IVNA 1P92A 3DPTA 3TDUC 2QWWA 1B6AA 1ZYRF 1P4AA 4ETSA 4A6DA 4O6JA 2F2EA 2HQRA 5DYMA 3RJPA 4WCGA 2V1XA 1LEBA 4NHJA 4LK0F 3MEXA 1S7AA 3V7SA 2XVCA 3C7JA 4LD5A 1WWXA 2M30A 1I6XA 2DBBA 2EK5A 4GXOA 3GUDA 2RNJA 3AAFA 5LLQA 2F5DA 2L4MA 2OA4A 1IN4A 1C0WA 4XLNF 1BIBA 1TTYA 4G9YA 1TLHB 5JI6A 3BROA 2B0LA 3ZQ7A 3GFJA 4L9TA 1IZ1A 1HW2A 2FNAA 2ZFWA 4A5MA 3DQVC 1K78A 1ZRCA 2CGPA 3BPXA 3E5QA 2XHKA 3R4KA 3T1BA 1TW3A 3B02A 2M8EA 4Q5SF 5FB2A 3TGNA 1XCVA 2A68F 3KCCA 1BN5A 1GXPA 2NS0A 5DD8A 4RGSA 4L5JA 4HQEA 2RN7A 2ZNYA 5ICGA 2HYGD 2H09A 4LG0A 3GXOA 1K6OA 3I59A 5D4RA 3N4MA 5D5UB 2ZJ2A 2RVCA 2Y75A 4OINF 1SD4A 3PFIA 4JBAA 3CUOA 3QRFF 3G73A 3E6DA 3BPVA 5LRSA 3KP7A 4UUVA 1Z6TA 1ZARA 2DQRA 3JAMZ 2D2WA 3EYIA 2GXGA 5FFZA 3FZVA 3QU6A 4R79A 2STTA 4CXFA 3PQKA 2DQLA 2PN6A 3E6MA 5E18F 4HQMA 3HHGA 5D5VB 5F1RA 1L3LA 3LA7A 2J5PA 4Y13A 2YX7A 5ILUA 2G9WA 2H94A 4KICA 1G3WA 2KJCA 4LLNA 4GYGA 2W85A 3F8FA 4S05A 5HLHA 3K69A 4YIIA 3MFKA 1I27A 2ZO4A 2QUFA 3RI4A 1IRGA 1I1SA 5D6FA 1W4MA 3HSEA 1ZGJA 3LAPA 2Y48A 2FNPA 1BC7C 4KA4A 1FYKA 4GYIA 1LB2A 1HSTA 5DEQA 3RKYA 3WTTC 3ERED 4KFCA 1RI7A 3ULQB 5A2QK 3W6JB 3FHZA 4HX8A 3KP5A 4EJWA 2E1CA 5F64A 3LA3A 1O3QA 1ZRFA 2CFXA 2HZTA 3WG9A 3ZMSA 4KIFA 5ICFA 3TQNA 4MNUA 3I0TA 1J2XA 3FM5A 1XB4A 4HX7A 5ILVA 2EB7A 2FE3A 5DV5A 4PCQA 1IAWA 2P8TA 4P55A 5LEKA 1IN6A 3LWFA 2E1NA 2FXAA 2VOOA 1FT9A 2UXNA 4LGWA 3L09A 5DUIA 4Z2YA 2QM3A 3M8FA 3QU3A 5HLGA 1BI3A 4ESBA 1YW7A 4CDGA 2RKHA 3HYIA 5F6FA 1G3TA 3VEPA 1SFEA 1EH6A 3CO7C 1MJ9A 3CJNA 1FWZA 5H6RA 2R7DA 3FXUA 3K1MA 2A07F 1R36A 2MBFA 2NAZA 4CGZA 4EQQA 4KDPA 1ZLJA 2Z99A 3KP4A 5DCFA 3HTSB 4KMUX 5LEJA 1ODDA 4ENNA 2HWVA 4M74A 3I64A 2DO7A 1P6RA 1KGSA 2JSCA 2W25A 4A12A 3KP2A 2AXLA 3RYRA 1S7OA 4HLYA 1FSEA 4U0WA 2FBHA 1HKTA 2VBZA 5D8LB 4KIBA 3GFIA 2DI3A 3ZMDA 1B9MA 4HAMA 4ZZDA 3ZPLA 2DT5A 3H3ZA 1ZHFA 2ADUA 3KZZA 1WQ2A 2WV0A 1SD6A 5CVRA 2LKPA 3ECOA 5CLSA 4CYDA 3MZHA 1ZRDA 3ZMVA 4FHTA 3DF8A 4BXUA 5HS9A 3SFZA 2JPCA 4CZZA 2V9VA 4HZFA 4GCVA 4YFXF 2OZ6A 4RAYA 2JTVA 2XKPA 1OYIA 5E1WA 3DFGA 4U0VA 2C6YA 2K02A 1WI9A 4AVPA 1W7PD 3P9IA 5DD4A 4UVBA 4EM0B 3IKVA 2A3SA 4HA8A 1JGSA 1J59A 4M6XA 4IHTA 3P9KA 3IRRA 1Q1HA 4LJZF 3RTRA 1MJBA 1U78A 2HFHA 4G6DA 2AS5F 1RIOH 2M5WA 3FXQA 4PGGA 2F5FA 1TQMA 2XAFA 1FYLA 1I5ZA 3KZYA 4FX0A 3E6BA 4I0AA 4IPAA 1DPUA 1YYVA 1ON1A 1Z05A 1LJ9A 5J8FA 4A0ZA 4KMFA 4OOIA 1QNTA 1K78B 2O03A 3EETA 1R5HA 1DPRA 3G3ZA 3D0SA 2LDUA 2HEOA 4DQ2A 3Q9SA 4OIPF 1J7KA 4LFUA 2VC1A 3QOPA 1MJAA 2FOKA 3JSOA 3KEOA 1KU7A 4P9FA 2ZBKA 4YG2F 3J81K 2RDPA 4A6EA 2CW0F 4P96A 2E7WA 1S29A 3FWEA 4MEYF 4WWCA 4RB1A 1AOYA 1SFXA 4R1HA 1O3SA 4GGGA 2A61A 3GX4X 1GHCA 4WF2A 1SAXA 2ISZA 3HTUA 1OYWA 3J80Z 4ZZLA 2EA4A 3V8LA 2F5CA 3K1NA 5H6QA 5LHGA 1J9IA 1TQIA 1O3RA 3GFLA 1PP8F 2HKOA 1K79A 1PUEE 4RGRA 1U2WA 4OMYA 2OD5A 2VT2A 5BPIA 1BJAA 4R8HA 1OYYA 3U2RA 3JTGA 2WWYA 3HOTA 2K4BA 3L9FA 5BQTA 3I5UA 3RKWA 1U5TB 4G6QA 4HLXA 4QWQA 2FSWA 2EJRA 3RKXA 4OIOF 1UHMA 1FP1D 2L4AA 1B4AA 3WGHA 4EJTA 5ERIA 5FLXZ 5J6XA 1J0RA 3K1PA 1R5GA 2KIFA 1JXSA 5ILSA 4EM1A 4AIHA 3MZYA 2FBKA 1ON2A 3CUQC 2P6TA 4OU0A 1O57A 1ZAOA 1BI2A 4G94A 4L5IA 2XKOA 3DP7A 3NRVA 4MQ9F 3WTYC 1YLFA 3I58A 3VODA 2VT3A 4Y17A 3NEUA 4XLPF 4ASNA 2ESHA 5E20A 4EGYA 5L3BA 2FMYA 1AWCA 1J75A 3HSFA 4HDVA 2GA1A 3M1EA 2QBYB 2OAZA 2TDXA 3CO6C 3LSTA 1ZLKA 3MCZA 4AIKA 4G7ZF 2LSOA 2OBPA 4ENMA 4PGHA 5DUKA 2XAHA 3HUGA 5L3GA 1SMTA 3HRTA 2VONA 2H27A 2YSRA 3DEUA 4L9NA 2VBXA 4M71A 3B73A 1EH7A 2GWRA 5BOXA 3EUHA 5D8KB 4Q4ZF 2MLKA 3ELKA 3KLNA 1HW1A 3FF5A 2NRAC 2G7HA 4N9IA 3ZP5A 4HYEA 1IW7F 3DPLC 5JR3A 1U6GA 3F6OA 2FMLA 2ELHA 2NNYA 3K2ZA 1QGPA 1D8KA 3VFZA 3HOSA 4MTEA 2G7UA 3CTAA 1BI0A 4IXAA 2M1BA 1VTNC 1HKSA 1Y0UA 3ZMTA 2DTRA 1MZBA 1TNSA 1W7PB 2D1HA 2DK8A 2YX4A 3P7NA 5LRRA 4YFKF 1SFUA 4KNYA 2IW5A 4L9JA 1HQCA 1WKMA 1R7JA 2IA0A 3WE2A 2GIVA 2O61A 1XSXA 4JQFA 5IT9K 1UFMA 1F9NA 1YG2A 2PMHA 2HYFA 4RGUA 4G8XA 1Z9CA 1ZN2A 2XUBA 1R22A 2DW4A 1B1BA 4TV7A 5JFRA 3WU1B 1T98A 1J5YA 4YFNF 3O3KA 1MD0A 1QZZA 1XMAA 1R00A 1B9NA 2NNNA 1FP2A 3WTWC 3BZ6A 5E8IA 3RDIA 3V7RA 4Q47A 1U3EM 3JSPA 5IT9Z 1R1VA 1XN7A 4RS8A 2EFPA 3V4GA 2EFNA 3WU0A 5FGMA 2DFIA 3IKTA 4LMYA 1IN7A 2DLLA 1ULYA 3T8RA 5J8CA 1T0FA 1XGSA 3BJ6A 3NQOA 2K27A 4IF4A 2RGVA 5BMZA 2VBYA 5D4SA 2DU9A 3ZMZA 3JAMK 2QVOA 2KJBA 2YR2A 4I02A 1RUOA 2EWNA 1FSHA 3VOEA 5JVTA 5DCMA 2Q0OA 3TO9A 2ISYA 2FU4A 2MH2A 4HV5A 5K5OA 1KQ0A 4NQWA 4XSZF 4I09A 5FD5A 1LVAA 3ROUA 4U0YA 1Z6RA 3MWMA 3RIRA 3BOQA 1D8JA 3SHFA 1U8RA 2GQQA 3WGIA 2CSOA 1WSUA 3WE3A 2F5EA 4EJVA 1OMIA 3FMQA 4HF2A 4HBLA 3BY6A 4UV9A 1F5TA 2CG4A 4QLCU 1S6LA 1MGTA 2VE9A 2XIGA 2P5VA 5AIQA 3EYYA 2STWA 1SMYF 3K9TA 4IRGA 3F72A 3T5XA 2MD5A 1LQ1A 1S8NA 4ESJA 1P4XA 2DPUA 2QENA 5BPDA 3HRSA 3K0LA 1IN5A 4IHSA 2KIUA 3FM3A 4BH9A 1O7FA 1FBUA 5K5QA 2K4JA 5DDGA 3KETA 1ZH5A 2CO5A 3KFWX 1LNWA 2ETHA 2V6CA 1H0MA 2E7XA 3GEZA 3SZPA 3REOA 2IVMA 4WX9A 4KYWA 3EDPA 5CVUA 2EV6A 2HOEA 3RPUA 1D5VA 4BHCA 3LA2A 2LNBA 4YIFA 3F23A 3S2WA 1EH8A 2Z33A 3F21A 2PG4A 4UXNA 4O3MA 1CF7B 1HSJA 3DKWA 1FNNA 4UVCA 1QPMA 3WTVC 1FY7A 1LDJA 2A5YB 1IN8A 2NYXA 3GFMA 4UV8A 1USTA 1UHWA 3ML6A 2IRFG 3L7WA 3GZ5A 1BOAA 2O3FA 5HS8A 2Q2EA 4KN7X 2GXBA 1BM9A 5ED4A 2ESNA 4M9SA 1G6NA 3SQNA 2O8XA 4HF0A 5AIPA 3LQRA 2CQKA 3FMRA 4BHBA 1Z7UA 2Z9OA 5TJJA 2JRTA 3E5UA 1U5TA 3T0YA 2HKXA 1KQ8A 3H3UA 2RQPA 1SD5A 3IWZA 2FBIA 4Y15A 1FZPB 5L3DA 2L02A 2H6CA 3HHHA 4U88A 2XV4S 1T39A 1W5TA 2FF4A 3R0JA 3TOAA 4B8XA 4A0YA 4BHPA 2JPBA 3ECHA 5ICCA 1G3YA 4HDUA 1GVJA 3LFKA 5D5WB 4LLLA
chains in the Genus database with same CATH superfamily
3R0AA 5LD2C 4BJ5C 4BDZA 2N8GA 4L0ZB 4PDKA 2HU9A 2DN0A 3R60A 4B3XA 3DTIA 2FD5A 2UZKA 3KP6A 4PZJA 1G2HA 1T6SA 4PK4A 4KISA 4P5OA 5BS6A 3CDHA 2GAUA 2QQBA 4LLGF 1OLTA 3MVPA 4KUMA 2FQ3A 1H8AC 3DU6A 2DFFA 2O9LA 5FRMA 1DP7P 4K2EA 2B7EA 2V1UA 3U1KA 1VQOI 3H92A 3WTZA 4I2OA 1W1WE 4A69C 2R3SA 5HDKA 5FROA 3BWGA 1D1CA 4BAYA 3S3MA 1KONA 2LY9A 4UVAA 3WGGA 2HPIA 2A05A 2M4KA 1U9OA 3H5RA 2HGCA 4Y3OA 4KN4X 4MFDA 4EJOA 4UB6C 2QLZA 5FKOA 2LG4A 4GO1A 1IXSB 1HDDC 1JHFA 4MGRA 4AUXA 1KYZA 4D1QA 1ZGAA 2LF8A 1GXQA 1FLIA 1EA3A 4ZTJA 3S8PA 2X6WA 4EVIA 4A3MJ 1USSA 4NC8A 1IG7A 4E70A 3QPHA 3J7AO 3IH4A 1W7PA 2V9KA 3A01B 1YS6A 4I98B 2R7TA 1EV7A 5FD6A 2E2HJ 4ZDLA 2JRMA 2VQGA 4LIVA 2JA7J 5KVRA 2L01A 4N0BA 2EA2A 2OQRA 4L0YB 3A4CA 3OOPA 4NB5A 1PYVA 1N75A 3G1LA 4GRIA 2BYVE 3ZQFA 3SXYA 2BGCA 2KFDA 2LD5A 1YQAA 1IUFA 2KRFA 2WA0A 3ZQGA 1Z3XA 4XRFA 3GTJJ 2DK5A 3L2VA 1JHHA 5FRNA 5IOYA 3CMYA 2IA1A 3CJTB 1JKOC 5HVQC 4XLCA 4M9XA 4OWRB 4MO7A 4CSWA 3IH3A 4MLOA 1X2MA 4MFEA 1DUXC 5IT3A 3Q5FA 1ZKGA 3F3XA 2O6GE 1DDNA 2CYYA 2ZXJA 3FIWA 2K86A 1MNEA 4BE0A 2OC6A 2H6BA 2DFEA 2XB0X 2VKHA 2P7VB 2V1DA 2F4IA 3EUKL 3F6VA 4O5VA 1WJCA 2TRTA 5DCMB 4B48A 2JQ7A 4RAZA 3L00A 3F22A 3BG5A 1YFHA 2GA2A 3CDIA 4PJNA 3OL3A 3CF5F 1WH5A 1X3UA 1QRYA 4EMSA 3H35A 1A35A 1N78A 4IHYA 3ABLH 2RC4A 2M7BA 2M2EA 2TCTA 3OWTA 1H89C 1NG7A 2ME6A 3RYPA 2IS2A 1QVUA 2QZ8A 3S1MJ 4X1EA 1MKMA 3BG3A 1LE8A 2HDWA 1B8IB 2K7LA 4B09A 2VC0A 5TGTA 2WAQN 2ECCA 4BYYA 3J81Z 2HQNA 1UCRA 1OJLA 1Y8RB 3E0JB 3QAHA 4EM2A 4IKFA 3D5RC 2HTJA 1X1AA 3L2UA 1Y39A 4C3IJ 2YU3A 2EFOA 2R5ZB 2A6HF 2A69F 3ZN1A 3DKYA 4JX5A 1T56A 3FXLA 3OIQA 1JKQC 1KU9A 4HNTA 1BR2A 2K5CA 2XPUA 3DEWA 4ZJZA 4FISA 1ZELA 1XMKA 2R7UA 1DU0A 5FLMJ 4HEA2 2Q1ZB 3RCOA 1REPC 3HGGA 3CCSI 2L7FP 2BE5F 3VDXA 1FJLA 1KYWA 1I50J 3S15J 3JW4A 1G3SA 2FJ1A 1KU2A 1V4RA 3P9CA 3W6KB 1QVTA 4E7SA 4ZH4F 1FOXA 2Y0SN 4B43A 2WC2A 2XRNA 1FX7A 1OQYA 2P6SA 4A2UA 3B6AA 2Q2EB 4XM3A 3GCMA 2P5LC 2ID3A 2ZJRF 4EV0A 2EFQA 2XF6A 5CKTA 2LOOA 4BL0B 3CC7I 4OIRF 2MH9A 1P2FA 3DLLF 1IF1A 1WRJA 2FX0A 1QZYA 2IEKA 1PJRA 1ETQA 3TO6A 2KIMA 2L7ZA 2EPFA 2O0YA 5TRDA 2ACJA 5HLIA 1S9HA 2ZNZA 2ZMEB 5M5YJ 2M87A 4IRIA 1TWAJ 5FLXK 1VI0A 1UELB 2K40A 2WAFA 3K4LA 2KDZA 1HKQA 4RAGA 4ENKA 4A5NA 4I01A 1X3ZB 2Z3YA 4Z6YA 3E7LA 2BZTA 1YS7A 3TO7A 3HOVJ 3V8KA 4U7DA 4E7HA 2PEXA 5E17F 3E3VA 1LUJB 1O7LA 2XAQA 1MDMA 1MBJA 5HOOA 5K5RA 1YJNI 2DT6A 2M4GA 3IRQA 3OL4A 1QHHD 1V5FA 2VJ4A 3GF2A 1QBJA 4XOTA 1T8IA 4BQNA 3A0BC 4KITB 4AWXB 3F8NA 2MA3A 2WB1A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 1YJWI 1Y1VJ 2IPQX 2WTEA 4PJLA 1B59A 1RUNA 2QF7A 5D6EA 4JX4A 3KPHA 1XX5A 2IS1A 2Z5UA 3M1CA 1KQ9A 5LBQA 2EZHA 5E79C 1JUPA 3JRDA 1R58A 2MC3A 4FTHA 1VZ0A 3HOYJ 3ZGKA 2HS5A 1STZA 4LOCA 1BI1A 4KIGA 3QPTA 3HG9A 3FX3A 1FC3A 4LK1F 4Q48A 4DW6A 4HPQA 1FBQA 3J80K 1P7IA 4HX4A 2PFBA 4H0EA 4L18B 2FA5A 2ELJA 2MC4A 2R7ZJ 4M6VA 2KISA 4HOBA 1XGMA 1OCCH 3DV8A 1RR7A 3GW2A 3WU2C 1R1UA 3BDDA 1NH3A 4RGXA 2UWMA 5F0HA 3JRGA 2R7OA 4OMZA 2JA5J 3I71A 1WHUA 2LBFA 1KA8A 2CWEA 2PBIA 4ITVA 3KEYA 2OJED 3QP6A 1HLVA 4BUPA 4P9UA 1DGRM 5JLWA 4PFOA 3I4PA 3GZNB 4WXDA 4U87A 3VB2A 3OYGA 3HRUA 4ZYDA 3DU5A 4LG3A 3V42A 3BTJA 5FJ8J 1LDKB 1M1EB 2CJJA 2EINH 6PAXA 2W24A 1B72A 4RB0A 4XSXF 1Z21A 3VSLA 2QGUA 5E8GA 4DNCA 5A2QZ 4CO8A 3C3WA 2CUFA 3TDZC 4HW0A 3LSRA 2LMDA 4AU7A 5LGUA 3OYBA 5LGTA 4YELA 3GZ6A 5EEHA 3D1NI 4D0PA 1YIOA 2KKOA 5C44J 1BOBA 1SANA 4I0BA 1YX3A 4BS9A 2VPRA 3FKJA 2IAIA 3DBRB 1Z0XA 2IA2A 3I56I 1VQLI 1ZK8A 3LQQA 3BP8A 5KK1A 2VE8A 2MLGA 2XB5A 2DOEA 3BG9A 4CCMA 3ZQLA 4XNFA 3P5JA 4D7MA 4NQWB 1WJDA 2CQXA 3E5XA 2PMZN 2CMPA 4UNOA 3OYHA 1R4MB 2LVSA 3O6BB 3RPQA 1W5SA 2D45A 1IUYA 1BIAA 3GLXA 1BBYA 1ETXA 1H9GA 2M0CA 1OR7A 3X2QH 2EV5A 1XG1A 3MD2A 4BQAA 3DXJF 5JVGF 2OQGA 2ZXHA 1E3OC 4II3A 4S04A 4G7HF 1HOMA 3GO5A 4MHGA 1A36A 3GVAA 4WXHA 4RMNA 2XC7A 4N9HA 3LSKA 1MW7A 4UY8I 1HXDA 3QP5A 1NK3P 2PMZA 3QYFA 2IJLA 3C18A 1NTCA 4E7LA 4X6AJ 1RETA 1CGPA 2MD0A 1D0YA 2DA7A 2OU2A 3KEQA 3O2PE 2BY1A 3ISPA 3KIOA 3HRMA 1GDTA 3BR0A 3EQLF 2DXIA 1IXCA 1JE8A 4LG0B 4BEHB 1QQIA 3ZN0A 2K3FA 2J5OA 2V26A 3DCFA 2KT0A 1HBXG 2UUZA 2VPLA 4S0HB 5FO5A 3SZTA 5F0CA 1JUMA 4ZYHA 3QPSA 2R7FA 2BW3B 2QYOA 5CVJA 2PJPA 1FOKA 2NS7A 1LDDA 4RB3C 2RNGA 2BY0A 1XGNA 1Y6IA 1TP4A 3RPUD 3NAUA 4C3JJ 4ZTFA 2XASA 2WY8Q 5KHDA 1YJ9I 3CUQB 5HDGA 2H8RA 1XDUA 3K7AJ 3I53A 1IO2A 3HIFA 4NNJA 3CD6I 4IL6C 1A04A 3BR3A 2R5YA 1BL0A 2VODA 2NXNB 2QBYA 2RV8A 3M07A 1T2KA 1S5LC 3BQZA 5E3LA 2PI0A 3Q9VA 2DA5A 4E7IA 1HW5A 5EEGA 1FBSA 2QCOA 1LEAA 5LHIA 2EILH 3TOBA 3ZMUA 3LAJA 3M8JA 3CLQA 4M72A 3IWFA 1D0XA 2YS9A 1LFPA 2VQLA 3BLYA 2NVYJ 3ONQA 9ANTA 4RB2C 3CDLA 1F4KA 4ANJA 3M7GA 3GYHX 5C4JJ 1AU7A 5LHHA 4XONA 4A3IJ 5HNFA 1I1GA 1Q1VA 1R23A 3A01A 1XTAA 1TNTA 2EBIA 2HTSA 2IP2A 3GTKJ 5GTHC 4KT5C 1L0OC 3BG6A 1RRJA 3HZJA 2HXOA 2E1MB 4XOPA 3WTSC 4ESFA 4U7BA 1O4XA 3GTLJ 5TISC 1LVKA 3E6CC 3V7CA 1XGOA 4WXCA 2EV0A 1ENHA 1BR1A 1MBKA 2BBYA 1V3FA 1YW9A 2OTJI 3MQ0A 2Y31A 1I39A 1R6RA 4B4CA 2PJRA 2BOLA 1R4NB 2GZWA 2L9VA 3ASNH 1O3TA 4JX6A 1JTYA 1AKHA 1XDSA 4XKWA 2QQAA 2JZYA 2CRGA 3UNGC 1XCBA 3F8MA 2VIXA 3CCJI 1P9QC 4AIJA 1Y8QB 2BHZA 4WK8F 3ASOH 3Q0WA 3K70C 1G4DA 2A6EF 2X0LA 3DBHB 3GTQJ 5D5XB 2X4HA 2MGQA 3FHNA 4XKVA 2Z16A 5CJ9A 1R5ID 3QWLA 2V9PA 1ONVA 4W1UA 1YTYA 4I7HA 1IRFA 2YPRA 3U1DA 5L3CA 5EGOA 4ENJA 1AHDP 3GWZA 1U5TC 4DOZA 3DBLB 5J40A 2W48A 4EJUA 2ZB9A 3L2CA 2BXZA 3CCMI 5EZHA 4CHUA 2KHMA 3ZQHA 4D5FA 1WVRA 1QO0D 3R61A 4MEXF 4AD9A 2COMA 5AONA 4OIQF 2MABA 1T38A 3HSRA 5J1UA 3R6SA 1P4WA 2D1VA 5BNGA 1IXRC 2XGXA 1WFXA 2HI3A 5LGNA 2LP0A 2X51A 1V5EA 2O7OA 3V8JA 3RQIA 1FTTA 3BR1A 5E1XA 3WODF 2I10A 1JJ8C 2VOPA 5ICEA 3ABUA 3A02A 3QYEA 4MQVA 4FT8A 2XF7A 2QA4I 3KYLA 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 3IUOA 4UHTA 3M4OJ 1YOVB 3Q3SA 1Z7LA 2CQQA 1KU3A 4JYKA 2Y0SA 1VF9A 2VBWA 2XAJA 5FFXA 4FX4A 2CV0A 5GPAA 5L3EA 1ETWA 3FXRA 3BG7A 1FYMA 3CP8A 1BJZA 2Y69H 2HDCA 2PLYA 1MDMB 1P7JA 3K10A 2Z2SB 5IYBJ 1XPXA 3S1QJ 2HR3A 2IGKA 4EGZA 1D3YA 2PJRB 2DA3A 2LBFB 4IJAA 2XF5A 3I59B 5CVIA 1E2XA 3FBIB 4M9ZA 1OPCA 3JRAA 2AXTC 3S3NA 2HQAA 3SFIA 4D7NA 1OCZH 1FOWA 4XBFA 3I55I 2MYSA 1PP7U 2BXYA 3LSGA 2KZVA 1XD7A 2LC2A 3IAS2 3TP0A 3PQJA 3IL2A 3PNTA 5EGOB 4FE4A 3HL2A 5HS7A 4HRIA 3KP3A 5H20A 1OKRA 2BV6A 2VI6A 3TP3A 2BHYA 4C3HJ 3PNVA 4DBRA 5E1ZB 5L3FA 3OYMA 2L3DA 2XROA 1E17A 4NBQA 2WAQA 1BC8C 1SVLA 3TKYA 1X1BA 1XMXA 3FMSA 1X1DA 2P5KA 2COBA 3K6GA 1FPQA 1POGA 5B3SH 2BEOA 3S1NJ 2X1CA 3E97A 3D5LA 4ZYGA 2PMUA 5K1YA 2M45A 1HF0A 1F1ZA 4XRSA 3L2QA 2GLOA 2DMNA 2OZUA 2K3PA 2W84A 2R7QA 2FRHA 1XS9A 1K7AA 3JTHA 2R7SA 1ZREA 2KMUA 4A0XA 4CICA 1TWHJ 1RNLA 1Z1DA 2W4SA 2Y0MA 1IC8A 3AFHA 1V55H 2PQ8A 3OV8A 2ZJPF 3HPHA 1TW2A 3CLOA 4BNCA 2KDOA 2VQCA 5IYCJ 3C1DA 2IT0A 1ZG3A 2FEZA 2O8KA 2HDDA 3SDBA 2JT1A 1RR8C 3A1YA 3BC8A 3EPZA 1R1TA 3WTUC 5JHUA 1ZG5A 3K4CA 1IDYA 4G7OF 4AC0A 2EFWA 3OYFA 2ZCWA 2LK2A 4B47A 2MW8A 3M9AA 3OYAA 1H9TA 2ZKZA 2DAOA 2VB6A 4JK1X 3TEDA 3ZCOA 4V2FA 4IRHA 4C2MJ 1ZG1A 2QQ9A 3AG2H 3BJOA 3PIOF 1U9NA 1YW8A 1MMAA 3SEZA 5HDNA 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 3OYLA 1VQ7I 4HF1A 1TT0A 2XAGA 3NARA 5GP9A 1XSDA 3M8EA 2UXXA 2P81A 3LFKA 2V1NA 5HLTA 1NHAA 2ZSHB 1DGWY 2OPTA 2JUGA 3NWSA 1YHQI 1E3PA 2H1LA 3COAC 4A3EJ 2ZXWH 1PDNC 2DPDA 4HV6A 2CW7A 3BJAA 2D5VA 1Z91A 4M73A 1DP3A 4MTDA 1ZGWA 4E7ZA 3F8CA 3PJRA 4F7ZA 2LF7A 2VXZA 4C9YA 3H3VK 1TBXA 2ZMEA 3GTMJ 1XSVA 1JKRC 1MMSA 3HB9A 2MG4A 5CYVA 3L1PA 3WTXC 2X1EA 1YO5C 3F8BA 1WJ5A 1S3JA 1TQPA 1UB9A 4GFBA 2BY2A 3U9GA 2L54A 5CVVA 2BVLA 2V79A 2Q8KA 3VSKA 2AHQA 3KLOA 3KE2A 2DCEA 5GAHJ 3T8TA 1APLC 3CUQA 4IVNA 2R5ZA 1P92A 2XSJC 1V5GA 3DPTA 3TDUC 2QWWA 1RKTA 3M3YJ 1B6AA 1ZYRF 2VXDA 4MIMA 4X0GA 2DOFA 1P4AA 2X1DA 4ETSA 3ABKH 4A6DA 4O6JA 2F2EA 4AYBA 1WJBA 2HQRA 5DYMA 3RJPA 4WCGA 4N4OB 2V1XA 1N77A 1LEBA 4NHJA 1DU6A 4LK0F 3MEXA 1S7AA 1TC3C 4Y33A 2LKSA 1JT0A 3VWBA 2HVQA 2KRHA 3V7SA 1FTZA 2XVCA 3H9JA 2KLOA 3C7JA 4LD5A 1WWXA 4RBOA 2M30A 1I6XA 1Z3YA 5FLVA 4J19A 2DBBA 4DYCA 3LL7A 2HZDA 2EK5A 4GXOA 2QKMB 1IRZA 3OR1C 3K4KA 3H36A 4IHVA 3H5NA 4XK4A 3KX2A 1W36D 3GUDA 2RNJA 3AAFA 5LLQA 1YI2I 1MNMC 2F5DA 4BBRJ 3C2BA 2L4MA 3BCAA 3N05A 2OA4A 1IN4A 1C0WA 3JREA 3SJMA 3K4BA 4XLNF 1IV8A 1BIBA 1VQMI 4XL9A 1TTYA 4G9YA 1TLHB 5KNLA 5JI6A 3BROA 4XLAA 2B0LA 3ZQ7A 3GFJA 4L9TA 1UAAA 3B6CA 2ZMEC 1IZ1A 2IBDA 2L7KA 4EEFG 1HW2A 2FNAA 3PSIA 2ZFWA 3DEEA 3DQVC 4A5MA 2DDAA 4A3CJ 4XQFA 1K78A 1ZRCA 2CGPA 3BPXA 2DFHA 1B72B 2KRCA 3E5QA 2XHKA 3IP4B 3R4KA 3T1BA 4NDLA 1LFUP 1TW3A 3B02A 2M8EA 5IP7J 3BR6A 2R7WA 3S14J 4Q5SF 5FB2A 2WAEA 3TGNA 2ELKA 3L2WA 1VQNI 1XCVA 2A68F 1BW5A 3KCCA 4XLHA 2Z1DA 1BN5A 1FMWA 2K85A 1GXPA 2NS0A 5DD8A 4RGSA 4L5JA 4HQEA 2RN7A 4GDFA 2ZNYA 2OCCH 5ICGA 2HYGD 5IP9J 2H09A 4LG0A 4BQOA 3CCUI 3GXOA 1K6OA 5DM6F 1ZR4A 3I59A 5D4RA 4DBQA 5DM7F 3N4MA 2EIJH 5D5UB 4EATA 1F43A 2ZJ2A 2RVCA 2Y75A 4OINF 1SD4A 3PFIA 4JBAA 4V19K 3HKZN 3CUOA 3QRFF 4QPQA 5IP6A 4M3EA 3G73A 3E6DA 3BPVA 5LRSA 4UUSB 1I3AA 3KP7A 1HDPA 2NVUB 3S2DJ 2JVGA 4HG2A 2JSPA 2ID6A 4XRSG 1JGGA 4UUVA 1GLNA 3QPLA 1Z6TA 5M5WJ 1S72I 3FXKA 1I3QJ 5F27A 1W36C 1ZARA 2DQRA 3IH2A 3JAMZ 2D2WA 3EYIA 2R92J 4M3FA 1EKEA 2GXGA 5FFZA 3S32A 3FZVA 3QU6A 4R79A 2STTA 4CXFA 2B63J 2E2IJ 3PQKA 1RC9A 2DQLA 3OS2A 2PN6A 3E6MA 5JLXA 5E18F 4HQMA 3HHGA 5D5VB 5F1RA 5IOZA 1LKXA 1L3LA 4IEJA 1X58A 3LA7A 3CMEI 2J5PA 4Y13A 2G0EA 2YX7A 5ILUA 4PJ0C 2G9WA 3FXOA 2R7VA 4FASD 2H94A 3OYIA 3KYDB 1G3WA 2KJCA 4KICA 1K61A 4LLNA 4GYGA 1T95A 2W85A 3DPUA 5FKMA 3F9KA 3F8FA 3VPRA 5IY5H 4S05A 4A3LJ 3EUHC 1X4PA 5HLHA 3K69A 4YIIA 3MFKA 3MMYB 1I27A 2ZO4A 2DODA 2QUFA 3RI4A 1IRGA 1ETKA 2KIQA 1I1SA 3CC4I 5D6FA 3ZQQA 1W4MA 3HSEA 1ZGJA 4AYBN 3LAPA 3LFUA 2Y48A 2WBMA 2FNPA 3G6EI 1BC7C 5FKNA 5GPCA 1VQ6I 3ZXSA 4KA4A 1FYKA 4GYIA 1LB2A 1HSTA 1RPWA 1LPQA 3K4JA 5DEQA 1SC7A 1QU3A 3RKYA 3OR2C 1TWFJ 3WTTC 4KJZA 3ERED 4KFCA 2GBYA 1RI7A 1WPKA 3ULQB 3AKZA 5A2QK 4UUSA 3BZCA 3W6JB 2GIZA 4BGDA 2HOSA 3FHZA 4HX8A 4FE7A 3KP5A 4EJWA 2E1CA 5F64A 2VJJA 3LA3A 1YE9A 1O3QA 1ZRFA 4Y4RA 1OCPA 2CFXA 2HZTA 3WG9A 2VKEA 3ZMSA 4KIFA 5B5EC 4H4KC 5ICFA 3TQNA 5H2FC 4MNUA 3I0TA 4PJMA 4BKXA 1E3HA 1MBFA 1J2XA 3FM5A 1XB4A 2IGNA 3D5SC 4ZDOA 4HX7A 5ILVA 2EB7A 2FE3A 4RLFA 5DV5A 2L0KA 4BJ6C 2OV7A 2CS3A 3G4SI 4C2UA 1AA7A 4PCQA 1T08B 1IAWA 4PSXA 2LRDA 2P8TA 4P55A 5LEKA 1IN6A 2CW8A 3QODA 3K4NA 1A5JA 3PM1A 5E3MA 3LWFA 3GMEA 5JHFA 2E1NA 5F1JA 2FXAA 5EEAA 3JRBA 3C2HA 2VOOA 1FT9A 2UXNA 2Y9YA 3FISA 4LGWA 3L09A 5DUIA 4Z2YA 2QM3A 1W0TA 3M8FA 2E35A 2X6OA 2ECBA 2XDVA 3QU3A 1BI3A 5HLGA 4ESBA 1YW7A 2JA6J 4CDGA 1UG0A 2RKHA 3HYIA 1T33A 5F6FA 1GV2A 1G3TA 3VEPA 1SFEA 1EH6A 3CO7C 1MJ9A 3CJNA 1FWZA 3FBNB 5H6RA 2DA2A 2R7DA 1X1PA 3FXUA 1OCRH 1NG6A 3K1MA 2HQ5A 4BY7J 2A07F 1R36A 2MBFA 1MMNA 1JI8A 4RAFA 2JN6A 2NAZA 4CGZA 2R93J 4EQQA 3S17J 4M3BA 4KDPA 3A0HC 3FXMA 1ZLJA 2Z99A 3KP4A 4J01A 1PUFA 3BQYA 3FK6A 3A03A 1TT5B 5DCFA 3GTGJ 4XR6A 3CCEI 3HTSB 3ESWB 4A3GJ 4KMUX 1G8XA 5LEJA 1ODDA 4ENNA 2RAEA 2RQQA 2BVMA 4XORA 3CCVI 2HWVA 4M74A 1YRNA 3I64A 2DO7A 4BDYA 1P6RA 1KGSA 2JSCA 2W25A 4A12A 2HYJA 3KP2A 2AXLA 3RYRA 2FOWA 1S7OA 3CP2A 4HLYA 2FQ4A 1MMGA 1FSEA 2M34A 4U0WA 2FBHA 1HKTA 2EH3A 4IHWA 2HNHA 4UUTA 1GV5A 2VBZA 5D8LB 3RZOJ 2JA2A 4KIBA 1IRXA 3GFIA 3UR3C 2DI3A 3TL4X 3ZMDA 1B9MA 4HAMA 4ZZDA 3ZPLA 3OYCA 5CPRB 3HOWJ 2DT5A 2QSHX 3AL0B 3H3ZA 1ZHFA 2ADUA 3SEQA 2DMQA 3KZZA 1WQ2A 3J7ZI 4ZC3A 2ZJQF 2WV0A 1SD6A 5CVRA 4HSTA 4XKCA 3OIOA 2VQHA 1SFOJ 2F4MB 3FDYA 3WG7H 2LKPA 1MSEC 3ECOA 5CLSA 4NC6A 3KZIC 4CYDA 3MZHA 1ZRDA 3PNYA 3DKXA 4I76A 3ZMVA 4FHTA 3DF8A 4BXUA 5FKKA 4BQQA 5HS9A 2HPMA 5EG0A 3SFZA 2JPCA 1K4SA 1K6YA 3EUAA 2EZIA 1X4OA 2W00A 1VQPI 2CFOA 4CZZA 1Z67A 4DIQA 2QEXI 2V9VA 3OOUA 1A6IA 4HZFA 4GCVA 4II2A 2HOTA 2DJIA 2DMUA 4YFXF 1OISA 3G1MA 2OZ6A 1U8BA 1ITYA 4RAYA 3J7YJ 3HXLA 2JTVA 2XKPA 1OYIA 5E1WA 3DFGA 4U0VA 2C6YA 2K02A 3JRCA 1WI9A 1UMQA 3NWTA 4E7KA 5IYDJ 1X2NA 1BA5A 3HC7A 4AVPA 1W7PD 2DTZA 3P9IA 4BBSJ 5EZGA 1PUFB 3CC2I 1FIPA 5DD4A 4UVBA 2HXIA 2VL8A 1D0ZA 2DA6A 4EM0B 1YIJI 3IKVA 3WHBA 2A3SA 4HA8A 1JGSA 4PJJA 3I3LA 2E5ZA 4M6XA 1J59A 1QA6A 3P9KA 3MKYB 4IHTA 3CCRI 3IRRA 4CYCA 1Q1HA 4LJZF 5K7HA 1FEXA 1VQ5I 2M0MA 3RTRA 2CUEA 1MJBA 4BXFA 3BZKA 1U78A 4XICA 4G6TB 2XRLA 2HFHA 2CV1A 4G6DA 2AS5F 3QOEA 2DYSH 1RIOH 5KAFC 2UV1A 5C4XJ 2M5WA 3FXQA 4CCNA 1XC5A 3S2HJ 1ETOA 4PGGA 3HDDA 2F5FA 1TQMA 2XAFA 3C2GA 2LKXA 3CJQB 1FYLA 2R7RA 4BXXJ 1I5ZA 5EG0B 3KZYA 1SVOA 4FX0A 3E6BA 3CQZJ 4I0AA 4XMYA 2K9NA 1TWCJ 2H1KA 4IPAA 5J1YA 3OYDA 3RZDJ 1DPUA 3OYJA 1YYVA 3HGYA 3W2WA 3JRIA 4PSWA 1ON1A 4JOMA 1Z05A 1LJ9A 5J3LA 3JRFA 5J8FA 2K9SA 1MH3A 2CH0A 4A0ZA 5HODA 3BCBA 4KMFA 4OOIA 1QNTA 1K78B 2O03A 4C30A 3EETA 2EIKH 4W97A 3O8GA 1R5HA 1DPRA 2DDBA 3G3ZA 3D0SA 2E34A 3OIPA 2LDUA 3RSNA 3DTEA 2HEOA 4PFPA 4DQ2A 5DS9A 5E3NA 3Q9SA 1ERDA 2KZGA 3HKZA 4OIPF 1J7KA 4LFUA 3VYSB 2VC1A 4G12A 2X9DA 2DOAA 2JWTA 3QOPA 2DYRH 1MJAA 2FOKA 3JSOA 2W82A 3S1RJ 3KEOA 3S93A 1KU7A 4P9FA 3OYEA 4RM2A 2ZBKA 1D5YA 4YG2F 3J81K 4IOAF 2RDPA 3LNQA 4A6EA 4AVZA 4ABZA 2CW0F 4P96A 2E7WA 1S29A 2LR8A 3FWEA 3HOUJ 3H9GA 3RKQA 2Y30A 4MEYF 3I4MJ 4WWCA 2X6YA 1S7EA 4JP0A 4RB1A 1H88C 1AOYA 3GTOJ 4Y7NJ 1SFXA 4R1HA 5GADJ 4IZZA 1O3SA 4GGGA 2A61A 3GX4X 1GHCA 3HOXJ 4LIUA 4WF2A 2DT7B 1SAXA 2AQEA 2ISZA 3HTUA 4F93B 2ICWG 1WZ2A 1OYWA 3DWLE 5EYRA 2PX9A 3J80Z 1Y0NA 4ZZLA 2WB1N 2EA4A 3V8LA 2F5CA 3K1NA 4N4NB 5H6QA 5LHGA 1J9IA 3F0CA 1TQIA 3PFYA 1O3RA 1HCRA 3GFLA 1PP8F 2HKOA 3L2RA 1K79A 1J09A 3LOCA 1PUEE 3AG1H 4RGRA 1U2WA 3OSFA 1ZQ3P 4DGWB 4OMYA 3ABMH 5J4VA 4E7JA 2OD5A 2Y9ZA 2VT2A 3MN2A 2KQRA 2GOMA 5BPIA 2NOGA 3OYNA 3H9QA 1BJAA 1EJ9A 4F52A 4R8HA 3QYBA 4NC7A 1OYYA 2WY7Q 3LSJA 2M3AA 3U2RA 1X1CA 3VYRB 1JT6A 3JTGA 5CQGA 2WWYA 3HOTA 2VJIA 2B9SA 3LSPA 4BU2A 2K4BA 4HNUA 3L9FA 3ZOBA 5BQTA 5B1BH 1W0UA 3I5UA 2JUCA 3RKWA 1U5TB 4G6QA 4HLXA 4QWQA 3G1OA 2FSWA 2EJRA 3RKXA 3QQAA 4OIOF 1UHMA 4OAYA 1FP1D 3K70D 2L4AA 2M9HA 1JKPC 1B4AA 3WGHA 3CJRB 2CV2A 1Y56A 2X6XA 2OUMA 1B8IA 4EJTA 5ERIA 5FLXZ 5J6XA 1J0RA 3K1PA 1R5GA 2KIFA 1JXSA 5ILSA 4EM1A 1G59A 4AIHA 3MZYA 2FBKA 1ON2A 2CU7A 3CUQC 2P6TA 2NVQJ 4YIRX 2R4GA 5GAEJ 4OU0A 1O57A 2GOXB 1VNDA 3HBLA 1SAUA 5J4YA 3DLAA 1ZAOA 2GXAA 1BI2A 1VQ8I 4G94A 2OF7A 3FKIJ 4L5IA 3PL8A 2XKOA 3DP7A 3NRVA 4CA0A 4M3GA 4MQ9F 3WTYC 1YRNB 3S3OA 1YLFA 2MFZA 4QIWN 2EQRA 1Z77A 2L9SA 2NVTJ 3BT9A 3I58A 4E4HA 3JRHA 3VODA 3H0DA 2VT3A 4CZCA 1E0EA 4Y17A 4ZYAA 5F0FA 3NEUA 4CCJA 4I99C 3ZRGA 4XLPF 1X3WB 4ASNA 4AM3A 2ESHA 5E20A 4BJTA 2ME0A 2ZSIB 3O8HA 4EGYA 3H5AA 5L3BA 2FMYA 3FXJA 1AWCA 2NS8A 3OY9A 1J75A 1IGNA 3HSFA 4HDVA 1GVDA 5C3EJ 2GA1A 1RESA 3M1EA 2QBYB 2CUZA 2OAZA 1WJAA 2TDXA 3CO6C 5K7FA 2XAUA 3LSTA 4ZDPA 1ZLKA 2QSFX 3MCZA 1JUSA 4IOCF 4AIKA 1WGXA 2R7XA 3PO2J 1LE8B 4G7ZF 4Y52J 2NVXJ 2LSOA 2OBPA 4ENMA 4PGHA 4V2GA 1N25A 5DUKA 2XAHA 3HUGA 5L3GA 1SMTA 3HRTA 4IHXA 1KZHA 2VONA 4A3BJ 2H27A 2YSRA 3DEUA 4A3DJ 1QZEA 4L9NA 3CCLI 2VBXA 1SEUA 2V6EA 2XPVA 4M71A 4YRVA 1ZR2A 3B73A 2LLKA 1EH7A 2GWRA 3KYCB 5BOXA 2F48A 2NOJB 4BEHA 3EUHA 2XGDA 3JR9A 4DYRA 2AQFA 5D8KB 4Q4ZF 3PUFA 2MLKA 3ELKA 3KLNA 4CH7A 1HW1A 3FF5A 1VFCA 3SDGA 1YITI 4A3KJ 2XSDC 2G7HA 2NRAC 4N9IA 3CF2A 3ZP5A 4HYEA 1MNDA 1IW7F 3DPLC 3WHCA 5K7ZA 4BACA 5JR3A 1U6GA 3F6OA 1HA8A 1A31A 3LSHA 2FMLA 5F08A 2ELHA 1PVEA 4QSHA 3VYUB 2NNYA 2DMTA 3JCUC 3K2ZA 1ACIA 1QGPA 1D8KA 2I8DA 1TZLA 3VFZA 5EF6A 3HOSA 4MTEA 2G7UA 3CTAA 2L9RA 1UZCA 1R71A 1HC8A 1BI0A 5GTIC 2JMWA 2QQ8A 4A3JJ 4IXAA 1UJ8A 2M1BA 1VTNC 1WI3A 1HKSA 5KAIC 3AG4H 1Y0UA 3ZMTA 2DTRA 2EIMH 1MZBA 2QKLB 1TNSA 4LITA 1X19A 2E1MC 3OS0A 1W7PB 1DQUA 2D1HA 2VJ5A 2DK8A 3H1CA 2YX4A 3P7NA 5LRRA 4YFKF 5EDNA 1D1BA 1SFUA 1OCOH 4KNYA 3GTPJ 4BE1A 2VLAA 2IW5A 4L9JA 1HQCA 1ORKA 5CQEA 1SFKA 1WKMA 1R7JA 2IA0A 3ZQIA 1D1AA 3WE2A 2GIVA 2O61A 1XSXA 4JQFA 1UHSA 5IT9K 3ZR8X 4E6KG 1UFMA 1VQ4I 1F9NA 1MBHA 1YG2A 3FK7A 1K83J 2PMHA 1F36A 2HYFA 4G8XA 4RGUA 2IGOA 2H8WA 1BR4A 1RKWA 1Z9CA 2HOAA 3H0GJ 3OSGA 1ZN2A 5B66C 3LMMA 2XUBA 3K2AA 1R22A 1I6HJ 2DW4A 1B1BA 2K9LA 1IJWC 4TV7A 5JFRA 1VQ9I 2K9MA 3WU1B 4DZPA 3J7AY 1T98A 2DA1A 2L9NA 1J5YA 3CCQI 3PUBA 4YFNF 4FQGA 3UKGA 3O3KA 2M8GX 1MD0A 2VASA 1QZZA 2E19A 1XMAA 1R49A 3I4NJ 1R00A 1B9NA 2LREA 4C2TA 4YEJA 4P1WA 2F4OB 2DA4A 3G2BA 2NNNA 1WJFA 1FP2A 3WTWC 3BZ6A 4B1RA 5E8IA 4M3DA 3OS1A 3RDIA 3V7RA 4Q47A 1U3EM 3JSPA 5IT9Z 2IXSA 5GAGJ 1R1VA 1XN7A 3PSFA 2IS6A 1MBGA 2KP6A 4RS8A 2EFPA 2V4JC 3V4GA 2EFNA 3WU0A 1U0JA 5FGMA 2DFIA 5IPAA 2HVRA 5M3MJ 3IKTA 1VQKI 2BW3A 5M3FJ 1QPIA 3IV5A 4LMYA 3SYTA 3MKLA 1EF4A 1IN7A 2DLLA 2WADA 2FUG2 3HM5A 4F3QA 1ULYA 3RQ4A 3T8RA 3BR5A 5J8CA 1T0FA 1XGSA 3BJ6A 2F6CA 3NQOA 1WJEA 2I5UA 2K27A 3LSMA 1WH7A 3TBIA 4IF4A 2A5WA 2RGVA 4BY1J 4L5EA 1TWGJ 2DJNA 4UB8C 5BMZA 2VBYA 5D4SA 2R5YB 2DU9A 2M7AA 2L5QA 3ZMZA 3JAMK 2QVOA 2KJBA 2YR2A 4I02A 2L2OA 1RUOA 2EWNA 1IV6A 3VOEA 5JVTA 5DCMA 1FSHA 2Q0OA 3TO9A 2ISYA 2FU4A 2MH2A 4HV5A 5K5OA 5EJCA 1KQ0A 2LTPA 4NQWA 4DJAA 4XSZF 1ETVA 4FETA 4I09A 4CYCB 4A3FJ 5FD5A 2F5VA 1LVAA 3I9V2 3W2VA 3ROUA 3VYTB 1Z6RA 4F92B 4U0YA 1OR7C 1FOYA 3MWMA 2JK3A 3RIRA 3W3CA 2E5NA 3BOQA 2K9QA 1YX5A 1D8JA 4B3AA 1JTXA 2JJ7A 3SHFA 2CUJA 3WGIA 2GQQA 3DTKA 1U8RA 2ZFUA 4XKBA 2CSOA 1WSUA 2YU9J 3WE3A 2F5EA 4EJVA 1OMIA 5J1RA 2JA8J 2LY1A 2IGMA 3FMQA 1SVMA 4HF2A 4HBLA 3BY6A 4UV9A 2BY3A 1MSFC 1F5TA 2CG4A 4QLCU 2IS4A 1S6LA 4I6ZA 1MGTA 3GBGA 2EZKA 3S16J 2VE9A 2XIGA 2P5VA 4RLQA 5AIQA 3MKZA 3EYYA 4IQ4A 2STWA 3Q0VA 2OCEA 2VKVA 1SMYF 3K9TA 2LY2A 1WCMJ 4IRGA 3F72A 2V7FA 3T5XA 5LFAA 3IAM2 2W7NA 2MD5A 1LQ1A 1S8NA 4ESJA 1P4XA 4J00A 2DPUA 4A93J 2QENA 4QTRA 5BPDA 4XLEA 2EZLA 3HRSA 1LFBA 2W1OA 3K0LA 2VUMJ 1IN5A 4D5CA 1OCTC 3HUGB 4IHSA 2VKDA 2LH9A 2KIUA 3FM3A 4BH9A 1CQTA 1O7FA 1Y1WJ 2CQ7A 3GLLA 3HJEA 1FBUA 5K5QA 2K4JA 3U21A 3CESA 5DDGA 4XRMA 3A2KA 3KETA 5F04A 1ZH5A 2CO5A 4IX7A 1TL8A 3OYKA 3KFWX 1LNWA 3Q0UA 2ETHA 4FCYA 5B1AH 1MBEA 2L7MP 2V6CA 2X85A 4DZJA 1GT0C 4D9JA 1H0MA 2E7XA 3GEZA 1MH4A 3SZPA 2JVHA 3REOA 2KPMA 5KCMA 1GUUA 2IVMA 3BTCA 4NUBA 4IO9F 4WX9A 4KYWA 3EDPA 5CVUA 3BTIA 2EV6A 5FKLA 3CMMA 2P0WA 2HOEA 3RPUA 2XGEA 1D5VA 4BHCA 4CCLA 4CCOA 3LA2A 2LNBA 4RA2A 4YIFA 3F23A 3S2WA 1EH8A 3BR2A 2Z33A 4HNVA 1NK2P 2HVSA 2YUSA 2E2JJ 4F55A 3F21A 5J47A 1ETYA 3ZQCA 2PG4A 4UXNA 1R9TJ 5M5XJ 4O3MA 2XPWA 1CF7B 2E71A 1MMDA 2GM4A 3LSIA 1HSJA 3DKWA 4XIDA 3K4MA 2Y2ZA 1FNNA 3G71I 3HOZJ 2WV1A 4RDUA 4QPOA 3PIPF 2XGCA 2ZC2A 2CQNA 3E1SA 4UVCA 2R0QC 4BE2A 1QPMA 3WTVC 1FY7A 1LDJA 2A5YB 3MZ8A 3SZGA 1AKHB 2RREA 1A6QA 3W2AA 1IN8A 2NYXA 3GFMA 4UV8A 3AL0C 1USTA 1UHWA 1ZTRA 2MSYA 2AO9A 3ML6A 4B44A 2IRFG 1MIJA 3L7WA 3GZ5A 1BOAA 3OMYA 2O3FA 3PO3J 5E3OA 5HS8A 2Q2EA 4KN7X 2GXBA 2KL4A 4F91B 2DMPA 3HEFA 3CMAI 1FIAA 4DYQA 1BM9A 5ED4A 2ESNA 4M9SA 1G6NA 3SQNA 2E60A 4AIDA 4RM3A 1QHGA 1W5CC 2O8XA 2OTLI 4HF0A 5AIPA 3LQRA 2CQKA 3FMRA 4BHBA 3AG3H 2E1OA 1Z7UA 4HSRA 3MKWB 3W6VA 4CUGA 2Z9OA 2LYCA 3TW7A 5TJJA 2JRTA 2X48A 2ZXIA 2O5RA 3E5UA 4IQJA 1U5TA 3T0YA 2HKXA 1T0FC 3TMOA 3H3UA 1KQ8A 1K4TA 5HNHA 3CZ6A 2RQPA 1SD5A 3IWZA 2FBIA 4PUSA 4Y15A 1FZPB 4XN0A 4OAZA 5L3DA 2L02A 2H6CA 3HHHA 4CCKA 2A6TA 2QSGX 4U88A 2XV4S 4XN3A 1UG2A 2LFBA 1T39A 2E36A 1W5TA 2FF4A 1JJ6C 3R0JA 3ERMA 3TOAA 4XLFA 4B8XA 1FMVA 3BTLA 4A0YA 4BHPA 1OFCX 2JPBA 3ECHA 1G3YA 4KT6A 3TW6A 1BW6A 5DTDA 5ICCA 3CCYA 4HDUA 1IDZA 1GVJA 1V54H 3HPGA 5D5WB 4LLLA
chains in the Genus database with same CATH topology
3R0AA 4L0ZB 4PDKA 3R60A 2UZKA 3KP6A 4PZJA 1T6SA 4P5OA 5BS6A 3CDHA 2GAUA 2QQBA 4LLGF 4KUMA 2FQ3A 1DP7P 4K2EA 2V1UA 4I2OA 3H92A 3WTZA 2R3SA 5HDKA 3BWGA 4BAYA 4UVAA 3WGGA 2HGCA 4KN4X 4EJOA 2QLZA 4GO1A 1IXSB 1JHFA 4MGRA 1KYZA 1ZGAA 2LF8A 1GXQA 1FLIA 4EVIA 1USSA 4E70A 3QPHA 3J7AO 1W7PA 1YS6A 4I98B 1EV7A 5FD6A 5KVRA 2L01A 4N0BA 2EA2A 2OQRA 4L0YB 3OOPA 4NB5A 2BYVE 3SXYA 2BGCA 1YQAA 2KRFA 4XRFA 2DK5A 1JHHA 2IA1A 5HVQC 4M9XA 1DUXC 5IT3A 3Q5FA 3F3XA 2O6GE 1DDNA 2CYYA 2ZXJA 2K86A 2H6BA 2P7VB 2V1DA 3F6VA 4O5VA 5DCMB 4RAZA 3L00A 3F22A 1YFHA 2GA2A 1X3UA 4EMSA 2RC4A 3RYPA 2QZ8A 1MKMA 2K7LA 4B09A 2VC0A 4BYYA 3J81Z 2HQNA 1UCRA 3QAHA 4EM2A 2HTJA 2YU3A 2EFOA 2A6HF 2A69F 3ZN1A 1KU9A 1XMKA 1REPC 2BE5F 1KYWA 3JW4A 1G3SA 1KU2A 4ZH4F 1V4RA 3P9CA 3W6KB 2WC2A 2XRNA 1FX7A 2P6SA 4A2UA 2P5LC 4EV0A 2EFQA 4OIRF 2MH9A 1P2FA 1IF1A 1WRJA 1QZYA 3TO6A 2KIMA 2O0YA 5TRDA 2ACJA 5HLIA 2ZNZA 2ZMEB 4IRIA 2M87A 5FLXK 1HKQA 4ENKA 4A5NA 4I01A 2Z3YA 1YS7A 3TO7A 3V8KA 4U7DA 2PEXA 5E17F 3E3VA 1O7LA 2XAQA 1MDMA 5HOOA 5K5RA 3IRQA 3GF2A 1QBJA 4AWXB 3F8NA 2MA3A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 2IPQX 2WTEA 1RUNA 1B59A 5D6EA 2Z5UA 1KQ9A 5LBQA 1R58A 2MC3A 2HS5A 1STZA 1BI1A 4KIGA 3QPTA 3FX3A 1FC3A 4LK1F 4Q48A 1FBQA 3J80K 4HX4A 2PFBA 4H0EA 4L18B 2FA5A 4HOBA 1XGMA 3DV8A 3GW2A 1R1UA 3BDDA 4RGXA 2UWMA 4OMZA 3I71A 1KA8A 2CWEA 2PBIA 3QP6A 4P9UA 3I4PA 4WXDA 3VB2A 3HRUA 4ZYDA 6PAXA 1LDKB 2W24A 4RB0A 4XSXF 4DNCA 5E8GA 5A2QZ 4CO8A 3C3WA 3TDZC 4HW0A 5LGUA 5LGTA 3GZ6A 5EEHA 4D0PA 1YIOA 2KKOA 4I0BA 2IA2A 3LQQA 3BP8A 5KK1A 2VE8A 2MLGA 3E5XA 4UNOA 3RPQA 3O6BB 1W5SA 2D45A 1IUYA 1BIAA 3GLXA 1BBYA 1H9GA 1OR7A 2EV5A 4BQAA 3DXJF 2OQGA 4G7HF 4S04A 3GO5A 4MHGA 3GVAA 4WXHA 4N9HA 1HXDA 3QP5A 2IJLA 3C18A 1CGPA 3KEQA 3O2PE 2OU2A 3ISPA 3HRMA 3EQLF 1IXCA 1JE8A 4LG0B 1QQIA 3ZN0A 2J5OA 1HBXG 5FO5A 3SZTA 4ZYHA 2R7FA 2QYOA 5CVJA 2PJPA 1FOKA 1LDDA 4RB3C 1XGNA 2XASA 3CUQB 5HDGA 1XDUA 3I53A 3HIFA 1A04A 2VODA 2QBYA 2RV8A 1T2KA 2PI0A 3Q9VA 1HW5A 5EEGA 1FBSA 1LEAA 5LHIA 3TOBA 3LAJA 3ZMUA 4M72A 3IWFA 4RB2C 1F4KA 3M7GA 3GYHX 5LHHA 1I1GA 1R23A 1TNTA 2HTSA 2IP2A 4KT5C 1L0OC 3WTSC 4ESFA 4U7BA 3E6CC 3V7CA 1XGOA 4WXCA 2EV0A 2BBYA 1V3FA 1YW9A 3MQ0A 2GZWA 1O3TA 1XDSA 2QQAA 2JZYA 1XCBA 3F8MA 4AIJA 4WK8F 1G4DA 2A6EF 2X0LA 5D5XB 2X4HA 5CJ9A 1ONVA 1YTYA 4I7HA 1IRFA 2YPRA 3U1DA 5L3CA 4ENJA 3GWZA 1U5TC 4EJUA 3L2CA 4CHUA 1QO0D 3R61A 4MEXF 4AD9A 2COMA 5AONA 4OIQF 1T38A 3HSRA 3R6SA 1P4WA 2D1VA 1IXRC 2XGXA 5LGNA 3V8JA 5E1XA 3WODF 2VOPA 5ICEA 3ABUA 4MQVA 4FT8A 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 4UHTA 1KU3A 2VBWA 2XAJA 5FFXA 4FX4A 5L3EA 3FXRA 1FYMA 2HDCA 2PLYA 1MDMB 2HR3A 4EGZA 1D3YA 4IJAA 3I59B 5CVIA 1E2XA 4M9ZA 1OPCA 4XBFA 1PP7U 1XD7A 3PQJA 3IL2A 5HS7A 3KP3A 5H20A 1OKRA 2BV6A 5E1ZB 5L3FA 2L3DA 2XROA 1E17A 1BC8C 3TKYA 3FMSA 2P5KA 1FPQA 2BEOA 3E97A 3D5LA 4ZYGA 2PMUA 5K1YA 2M45A 1F1ZA 2OZUA 2W84A 2FRHA 1K7AA 3JTHA 1ZREA 4CICA 4A0XA 1Z1DA 1RNLA 2Y0MA 2PQ8A 3OV8A 1TW2A 3CLOA 4BNCA 3C1DA 2IT0A 1ZG3A 2FEZA 2JT1A 1R1TA 3WTUC 5JHUA 1ZG5A 4G7OF 2EFWA 2ZCWA 3M9AA 1H9TA 2ZKZA 2DAOA 4JK1X 4IRHA 1ZG1A 2QQ9A 3BJOA 1YW8A 5HDNA 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 4HF1A 2XAGA 1XSDA 3M8EA 2UXXA 1NHAA 3COAC 1PDNC 2DPDA 4HV6A 3BJAA 1Z91A 4M73A 4MTDA 3F8CA 4F7ZA 2LF7A 2VXZA 1TBXA 2ZMEA 1XSVA 5CYVA 3WTXC 1YO5C 3F8BA 1S3JA 1TQPA 1UB9A 3U9GA 2L54A 5CVVA 2V79A 2Q8KA 3KLOA 3KE2A 3T8TA 3CUQA 4IVNA 1P92A 3DPTA 3TDUC 2QWWA 1B6AA 1ZYRF 1P4AA 4ETSA 4A6DA 4O6JA 2F2EA 2HQRA 5DYMA 3RJPA 4WCGA 2V1XA 1LEBA 4NHJA 4LK0F 3MEXA 1S7AA 3V7SA 2XVCA 3C7JA 4LD5A 1WWXA 2M30A 1I6XA 2DBBA 2EK5A 4GXOA 3GUDA 2RNJA 3AAFA 5LLQA 2F5DA 2L4MA 2OA4A 1IN4A 1C0WA 4XLNF 1BIBA 1TTYA 4G9YA 1TLHB 5JI6A 3BROA 2B0LA 3ZQ7A 3GFJA 4L9TA 1IZ1A 1HW2A 2FNAA 2ZFWA 4A5MA 3DQVC 1K78A 1ZRCA 2CGPA 3BPXA 3E5QA 2XHKA 3R4KA 3T1BA 1TW3A 3B02A 2M8EA 4Q5SF 5FB2A 3TGNA 1XCVA 2A68F 3KCCA 1BN5A 1GXPA 2NS0A 5DD8A 4RGSA 4L5JA 4HQEA 2RN7A 2ZNYA 5ICGA 2HYGD 2H09A 4LG0A 3GXOA 1K6OA 3I59A 5D4RA 3N4MA 5D5UB 2ZJ2A 2RVCA 2Y75A 4OINF 1SD4A 3PFIA 4JBAA 3CUOA 3QRFF 3G73A 3E6DA 3BPVA 5LRSA 3KP7A 4UUVA 1Z6TA 1ZARA 2DQRA 3JAMZ 2D2WA 3EYIA 2GXGA 5FFZA 3FZVA 3QU6A 4R79A 2STTA 4CXFA 3PQKA 2DQLA 2PN6A 3E6MA 5E18F 4HQMA 3HHGA 5D5VB 5F1RA 1L3LA 3LA7A 2J5PA 4Y13A 2YX7A 5ILUA 2G9WA 2H94A 4KICA 1G3WA 2KJCA 4LLNA 4GYGA 2W85A 3F8FA 4S05A 5HLHA 3K69A 4YIIA 3MFKA 1I27A 2ZO4A 2QUFA 3RI4A 1IRGA 1I1SA 5D6FA 1W4MA 3HSEA 1ZGJA 3LAPA 2Y48A 2FNPA 1BC7C 4KA4A 1FYKA 4GYIA 1LB2A 1HSTA 5DEQA 3RKYA 3WTTC 3ERED 4KFCA 1RI7A 3ULQB 5A2QK 3W6JB 3FHZA 4HX8A 3KP5A 4EJWA 2E1CA 5F64A 3LA3A 1O3QA 1ZRFA 2CFXA 2HZTA 3WG9A 3ZMSA 4KIFA 5ICFA 3TQNA 4MNUA 3I0TA 1J2XA 3FM5A 1XB4A 4HX7A 5ILVA 2EB7A 2FE3A 5DV5A 4PCQA 1IAWA 2P8TA 4P55A 5LEKA 1IN6A 3LWFA 2E1NA 2FXAA 2VOOA 1FT9A 2UXNA 4LGWA 3L09A 5DUIA 4Z2YA 2QM3A 3M8FA 3QU3A 5HLGA 1BI3A 4ESBA 1YW7A 4CDGA 2RKHA 3HYIA 5F6FA 1G3TA 3VEPA 1SFEA 1EH6A 3CO7C 1MJ9A 3CJNA 1FWZA 5H6RA 2R7DA 3FXUA 3K1MA 2A07F 1R36A 2MBFA 2NAZA 4CGZA 4EQQA 4KDPA 1ZLJA 2Z99A 3KP4A 5DCFA 3HTSB 4KMUX 5LEJA 1ODDA 4ENNA 2HWVA 4M74A 3I64A 2DO7A 1P6RA 1KGSA 2JSCA 2W25A 4A12A 3KP2A 2AXLA 3RYRA 1S7OA 4HLYA 1FSEA 4U0WA 2FBHA 1HKTA 2VBZA 5D8LB 4KIBA 3GFIA 2DI3A 3ZMDA 1B9MA 4HAMA 4ZZDA 3ZPLA 2DT5A 3H3ZA 1ZHFA 2ADUA 3KZZA 1WQ2A 2WV0A 1SD6A 5CVRA 2LKPA 3ECOA 5CLSA 4CYDA 3MZHA 1ZRDA 3ZMVA 4FHTA 3DF8A 4BXUA 5HS9A 3SFZA 2JPCA 4CZZA 2V9VA 4HZFA 4GCVA 4YFXF 2OZ6A 4RAYA 2JTVA 2XKPA 1OYIA 5E1WA 3DFGA 4U0VA 2C6YA 2K02A 1WI9A 4AVPA 1W7PD 3P9IA 5DD4A 4UVBA 4EM0B 3IKVA 2A3SA 4HA8A 1JGSA 1J59A 4M6XA 4IHTA 3P9KA 3IRRA 1Q1HA 4LJZF 3RTRA 1MJBA 1U78A 2HFHA 4G6DA 2AS5F 1RIOH 2M5WA 3FXQA 4PGGA 2F5FA 1TQMA 2XAFA 1FYLA 1I5ZA 3KZYA 4FX0A 3E6BA 4I0AA 4IPAA 1DPUA 1YYVA 1ON1A 1Z05A 1LJ9A 5J8FA 4A0ZA 4KMFA 4OOIA 1QNTA 1K78B 2O03A 3EETA 1R5HA 1DPRA 3G3ZA 3D0SA 2LDUA 2HEOA 4DQ2A 3Q9SA 4OIPF 1J7KA 4LFUA 2VC1A 3QOPA 1MJAA 2FOKA 3JSOA 3KEOA 1KU7A 4P9FA 2ZBKA 4YG2F 3J81K 2RDPA 4A6EA 2CW0F 4P96A 2E7WA 1S29A 3FWEA 4MEYF 4WWCA 4RB1A 1AOYA 1SFXA 4R1HA 1O3SA 4GGGA 2A61A 3GX4X 1GHCA 4WF2A 1SAXA 2ISZA 3HTUA 1OYWA 3J80Z 4ZZLA 2EA4A 3V8LA 2F5CA 3K1NA 5H6QA 5LHGA 1J9IA 1TQIA 1O3RA 3GFLA 1PP8F 2HKOA 1K79A 1PUEE 4RGRA 1U2WA 4OMYA 2OD5A 2VT2A 5BPIA 1BJAA 4R8HA 1OYYA 3U2RA 3JTGA 2WWYA 3HOTA 2K4BA 3L9FA 5BQTA 3I5UA 3RKWA 1U5TB 4G6QA 4HLXA 4QWQA 2FSWA 2EJRA 3RKXA 4OIOF 1UHMA 1FP1D 2L4AA 1B4AA 3WGHA 4EJTA 5ERIA 5FLXZ 5J6XA 1J0RA 3K1PA 1R5GA 2KIFA 1JXSA 5ILSA 4EM1A 4AIHA 3MZYA 2FBKA 1ON2A 3CUQC 2P6TA 4OU0A 1O57A 1ZAOA 1BI2A 4G94A 4L5IA 2XKOA 3DP7A 3NRVA 4MQ9F 3WTYC 1YLFA 3I58A 3VODA 2VT3A 4Y17A 3NEUA 4XLPF 4ASNA 2ESHA 5E20A 4EGYA 5L3BA 2FMYA 1AWCA 1J75A 3HSFA 4HDVA 2GA1A 3M1EA 2QBYB 2OAZA 2TDXA 3CO6C 3LSTA 1ZLKA 3MCZA 4AIKA 4G7ZF 2LSOA 2OBPA 4ENMA 4PGHA 5DUKA 2XAHA 3HUGA 5L3GA 1SMTA 3HRTA 2VONA 2H27A 2YSRA 3DEUA 4L9NA 2VBXA 4M71A 3B73A 1EH7A 2GWRA 5BOXA 3EUHA 5D8KB 4Q4ZF 2MLKA 3ELKA 3KLNA 1HW1A 3FF5A 2NRAC 2G7HA 4N9IA 3ZP5A 4HYEA 1IW7F 3DPLC 5JR3A 1U6GA 3F6OA 2FMLA 2ELHA 2NNYA 3K2ZA 1QGPA 1D8KA 3VFZA 3HOSA 4MTEA 2G7UA 3CTAA 1BI0A 4IXAA 2M1BA 1VTNC 1HKSA 1Y0UA 3ZMTA 2DTRA 1MZBA 1TNSA 1W7PB 2D1HA 2DK8A 2YX4A 3P7NA 5LRRA 4YFKF 1SFUA 4KNYA 2IW5A 4L9JA 1HQCA 1WKMA 1R7JA 2IA0A 3WE2A 2GIVA 2O61A 1XSXA 4JQFA 5IT9K 1UFMA 1F9NA 1YG2A 2PMHA 2HYFA 4RGUA 4G8XA 1Z9CA 1ZN2A 2XUBA 1R22A 2DW4A 1B1BA 4TV7A 5JFRA 3WU1B 1T98A 1J5YA 4YFNF 3O3KA 1MD0A 1QZZA 1XMAA 1R00A 1B9NA 2NNNA 1FP2A 3WTWC 3BZ6A 5E8IA 3RDIA 3V7RA 4Q47A 1U3EM 3JSPA 5IT9Z 1R1VA 1XN7A 4RS8A 2EFPA 3V4GA 2EFNA 3WU0A 5FGMA 2DFIA 3IKTA 4LMYA 1IN7A 2DLLA 1ULYA 3T8RA 5J8CA 1T0FA 1XGSA 3BJ6A 3NQOA 2K27A 4IF4A 2RGVA 5BMZA 2VBYA 5D4SA 2DU9A 3ZMZA 3JAMK 2QVOA 2KJBA 2YR2A 4I02A 1RUOA 2EWNA 1FSHA 3VOEA 5JVTA 5DCMA 2Q0OA 3TO9A 2ISYA 2FU4A 2MH2A 4HV5A 5K5OA 1KQ0A 4NQWA 4XSZF 4I09A 5FD5A 1LVAA 3ROUA 4U0YA 1Z6RA 3MWMA 3RIRA 3BOQA 1D8JA 3SHFA 1U8RA 2GQQA 3WGIA 2CSOA 1WSUA 3WE3A 2F5EA 4EJVA 1OMIA 3FMQA 4HF2A 4HBLA 3BY6A 4UV9A 1F5TA 2CG4A 4QLCU 1S6LA 1MGTA 2VE9A 2XIGA 2P5VA 5AIQA 3EYYA 2STWA 1SMYF 3K9TA 4IRGA 3F72A 3T5XA 2MD5A 1LQ1A 1S8NA 4ESJA 1P4XA 2DPUA 2QENA 5BPDA 3HRSA 3K0LA 1IN5A 4IHSA 2KIUA 3FM3A 4BH9A 1O7FA 1FBUA 5K5QA 2K4JA 5DDGA 3KETA 1ZH5A 2CO5A 3KFWX 1LNWA 2ETHA 2V6CA 1H0MA 2E7XA 3GEZA 3SZPA 3REOA 2IVMA 4WX9A 4KYWA 3EDPA 5CVUA 2EV6A 2HOEA 3RPUA 1D5VA 4BHCA 3LA2A 2LNBA 4YIFA 3F23A 3S2WA 1EH8A 2Z33A 3F21A 2PG4A 4UXNA 4O3MA 1CF7B 1HSJA 3DKWA 1FNNA 4UVCA 1QPMA 3WTVC 1FY7A 1LDJA 2A5YB 1IN8A 2NYXA 3GFMA 4UV8A 1USTA 1UHWA 3ML6A 2IRFG 3L7WA 3GZ5A 1BOAA 2O3FA 5HS8A 2Q2EA 4KN7X 2GXBA 1BM9A 5ED4A 2ESNA 4M9SA 1G6NA 3SQNA 2O8XA 4HF0A 5AIPA 3LQRA 2CQKA 3FMRA 4BHBA 1Z7UA 2Z9OA 5TJJA 2JRTA 3E5UA 1U5TA 3T0YA 2HKXA 1KQ8A 3H3UA 2RQPA 1SD5A 3IWZA 2FBIA 4Y15A 1FZPB 5L3DA 2L02A 2H6CA 3HHHA 4U88A 2XV4S 1T39A 1W5TA 2FF4A 3R0JA 3TOAA 4B8XA 4A0YA 4BHPA 2JPBA 3ECHA 5ICCA 1G3YA 4HDUA 1GVJA 3LFKA 5D5WB 4LLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0A A;  4L0Z B;  4PDK A;  3R60 A;  2UZK A;  3KP6 A;  4PZJ A;  1T6S A;  4P5O A;  5BS6 A;  3CDH A;  2GAU A;  2QQB A;  4LLG F;  4KUM A;  2FQ3 A;  1DP7 P;  4K2E A;  2V1U A;  4I2O A;  3H92 A;  3WTZ A;  2R3S A;  5HDK A;  3BWG A;  4BAY A;  4UVA A;  3WGG A;  2HGC A;  4KN4 X;  4EJO A;  2QLZ A;  4GO1 A;  1IXS B;  1JHF A;  4MGR A;  1KYZ A;  1ZGA A;  2LF8 A;  1GXQ A;  1FLI A;  4EVI A;  1USS A;  4E70 A;  3QPH A;  3J7A O;  1W7P A;  1YS6 A;  4I98 B;  1EV7 A;  5FD6 A;  5KVR A;  2L01 A;  4N0B A;  2EA2 A;  2OQR A;  4L0Y B;  3OOP A;  4NB5 A;  2BYV E;  3SXY A;  2BGC A;  1YQA A;  2KRF A;  4XRF A;  2DK5 A;  1JHH A;  2IA1 A;  5HVQ C;  4M9X A;  1DUX C;  5IT3 A;  3Q5F A;  3F3X A;  2O6G E;  1DDN A;  2CYY A;  2ZXJ A;  2K86 A;  2H6B A;  2P7V B;  2V1D A;  3F6V A;  4O5V A;  5DCM B;  4RAZ A;  3L00 A;  3F22 A;  1YFH A;  2GA2 A;  1X3U A;  4EMS A;  2RC4 A;  3RYP A;  2QZ8 A;  1MKM A;  2K7L A;  4B09 A;  2VC0 A;  4BYY A;  3J81 Z;  2HQN A;  1UCR A;  3QAH A;  4EM2 A;  2HTJ A;  2YU3 A;  2EFO A;  2A6H F;  2A69 F;  3ZN1 A;  1KU9 A;  1XMK A;  1REP C;  2BE5 F;  1KYW A;  3JW4 A;  1G3S A;  1KU2 A;  4ZH4 F;  1V4R A;  3P9C A;  3W6K B;  2WC2 A;  2XRN A;  1FX7 A;  2P6S A;  4A2U A;  2P5L C;  4EV0 A;  2EFQ A;  4OIR F;  2MH9 A;  1P2F A;  1IF1 A;  1WRJ A;  1QZY A;  3TO6 A;  2KIM A;  2O0Y A;  5TRD A;  2ACJ A;  5HLI A;  2ZNZ A;  2ZME B;  4IRI A;  2M87 A;  5FLX K;  1HKQ A;  4ENK A;  4A5N A;  4I01 A;  2Z3Y A;  1YS7 A;  3TO7 A;  3V8K A;  4U7D A;  2PEX A;  5E17 F;  3E3V A;  1O7L A;  2XAQ A;  1MDM A;  5HOO A;  5K5R A;  3IRQ A;  3GF2 A;  1QBJ A;  4AWX B;  3F8N A;  2MA3 A;  3ABT A;  1CF7 A;  4LB5 A;  4ON0 A;  3N97 A;  4ZYE A;  2IPQ X;  2WTE A;  1RUN A;  1B59 A;  5D6E A;  2Z5U A;  1KQ9 A;  5LBQ A;  1R58 A;  2MC3 A;  2HS5 A;  1STZ A;  1BI1 A;  4KIG A;  3QPT A;  3FX3 A;  1FC3 A;  4LK1 F;  4Q48 A;  1FBQ A;  3J80 K;  4HX4 A;  2PFB A;  4H0E A;  4L18 B;  2FA5 A;  4HOB A;  1XGM A;  3DV8 A;  3GW2 A;  1R1U A;  3BDD A;  4RGX A;  2UWM A;  4OMZ A;  3I71 A;  1KA8 A;  2CWE A;  2PBI A;  3QP6 A;  4P9U A;  3I4P A;  4WXD A;  3VB2 A;  3HRU A;  4ZYD A;  6PAX A;  1LDK B;  2W24 A;  4RB0 A;  4XSX F;  4DNC A;  5E8G A;  5A2Q Z;  4CO8 A;  3C3W A;  3TDZ C;  4HW0 A;  5LGU A;  5LGT A;  3GZ6 A;  5EEH A;  4D0P A;  1YIO A;  2KKO A;  4I0B A;  2IA2 A;  3LQQ A;  3BP8 A;  5KK1 A;  2VE8 A;  2MLG A;  3E5X A;  4UNO A;  3RPQ A;  3O6B B;  1W5S A;  2D45 A;  1IUY A;  1BIA A;  3GLX A;  1BBY A;  1H9G A;  1OR7 A;  2EV5 A;  4BQA A;  3DXJ F;  2OQG A;  4G7H F;  4S04 A;  3GO5 A;  4MHG A;  3GVA A;  4WXH A;  4N9H A;  1HXD A;  3QP5 A;  2IJL A;  3C18 A;  1CGP A;  3KEQ A;  3O2P E;  2OU2 A;  3ISP A;  3HRM A;  3EQL F;  1IXC A;  1JE8 A;  4LG0 B;  1QQI A;  3ZN0 A;  2J5O A;  1HBX G;  5FO5 A;  3SZT A;  4ZYH A;  2R7F A;  2QYO A;  5CVJ A;  2PJP A;  1FOK A;  1LDD A;  4RB3 C;  1XGN A;  2XAS A;  3CUQ B;  5HDG A;  1XDU A;  3I53 A;  3HIF A;  1A04 A;  2VOD A;  2QBY A;  2RV8 A;  1T2K A;  2PI0 A;  3Q9V A;  1HW5 A;  5EEG A;  1FBS A;  1LEA A;  5LHI A;  3TOB A;  3LAJ A;  3ZMU A;  4M72 A;  3IWF A;  4RB2 C;  1F4K A;  3M7G A;  3GYH X;  5LHH A;  1I1G A;  1R23 A;  1TNT A;  2HTS A;  2IP2 A;  4KT5 C;  1L0O C;  3WTS C;  4ESF A;  4U7B A;  3E6C C;  3V7C A;  1XGO A;  4WXC A;  2EV0 A;  2BBY A;  1V3F A;  1YW9 A;  3MQ0 A;  2GZW A;  1O3T A;  1XDS A;  2QQA A;  2JZY A;  1XCB A;  3F8M A;  4AIJ A;  4WK8 F;  1G4D A;  2A6E F;  2X0L A;  5D5X B;  2X4H A;  5CJ9 A;  1ONV A;  1YTY A;  4I7H A;  1IRF A;  2YPR A;  3U1D A;  5L3C A;  4ENJ A;  3GWZ A;  1U5T C;  4EJU A;  3L2C A;  4CHU A;  1QO0 D;  3R61 A;  4MEX F;  4AD9 A;  2COM A;  5AON A;  4OIQ F;  1T38 A;  3HSR A;  3R6S A;  1P4W A;  2D1V A;  1IXR C;  2XGX A;  5LGN A;  3V8J A;  5E1X A;  3WOD F;  2VOP A;  5ICE A;  3ABU A;  4MQV A;  4FT8 A;  3IHU A;  2W57 A;  4M6Y A;  2P7C B;  3IC7 A;  4UHT A;  1KU3 A;  2VBW A;  2XAJ A;  5FFX A;  4FX4 A;  5L3E A;  3FXR A;  1FYM A;  2HDC A;  2PLY A;  1MDM B;  2HR3 A;  4EGZ A;  1D3Y A;  4IJA A;  3I59 B;  5CVI A;  1E2X A;  4M9Z A;  1OPC A;  4XBF A;  1PP7 U;  1XD7 A;  3PQJ A;  3IL2 A;  5HS7 A;  3KP3 A;  5H20 A;  1OKR A;  2BV6 A;  5E1Z B;  5L3F A;  2L3D A;  2XRO A;  1E17 A;  1BC8 C;  3TKY A;  3FMS A;  2P5K A;  1FPQ A;  2BEO A;  3E97 A;  3D5L A;  4ZYG A;  2PMU A;  5K1Y A;  2M45 A;  1F1Z A;  2OZU A;  2W84 A;  2FRH A;  1K7A A;  3JTH A;  1ZRE A;  4CIC A;  4A0X A;  1Z1D A;  1RNL A;  2Y0M A;  2PQ8 A;  3OV8 A;  1TW2 A;  3CLO A;  4BNC A;  3C1D A;  2IT0 A;  1ZG3 A;  2FEZ A;  2JT1 A;  1R1T A;  3WTU C;  5JHU A;  1ZG5 A;  4G7O F;  2EFW A;  2ZCW A;  3M9A A;  1H9T A;  2ZKZ A;  2DAO A;  4JK1 X;  4IRH A;  1ZG1 A;  2QQ9 A;  3BJO A;  1YW8 A;  5HDN A;  1SD7 A;  3I54 A;  4LB6 B;  2P4W A;  1RZ4 A;  2VN2 A;  3MAJ A;  4L9V A;  4HF1 A;  2XAG A;  1XSD A;  3M8E A;  2UXX A;  1NHA A;  3COA C;  1PDN C;  2DPD A;  4HV6 A;  3BJA A;  1Z91 A;  4M73 A;  4MTD A;  3F8C A;  4F7Z A;  2LF7 A;  2VXZ A;  1TBX A;  2ZME A;  1XSV A;  5CYV A;  3WTX C;  1YO5 C;  3F8B A;  1S3J A;  1TQP A;  1UB9 A;  3U9G A;  2L54 A;  5CVV A;  2V79 A;  2Q8K A;  3KLO A;  3KE2 A;  3T8T A;  3CUQ A;  4IVN A;  1P92 A;  3DPT A;  3TDU C;  2QWW A;  1B6A A;  1ZYR F;  1P4A A;  4ETS A;  4A6D A;  4O6J A;  2F2E A;  2HQR A;  5DYM A;  3RJP A;  4WCG A;  2V1X A;  1LEB A;  4NHJ A;  4LK0 F;  3MEX A;  1S7A A;  3V7S A;  2XVC A;  3C7J A;  4LD5 A;  1WWX A;  2M30 A;  1I6X A;  2DBB A;  2EK5 A;  4GXO A;  3GUD A;  2RNJ A;  3AAF A;  5LLQ A;  2F5D A;  2L4M A;  2OA4 A;  1IN4 A;  1C0W A;  4XLN F;  1BIB A;  1TTY A;  4G9Y A;  1TLH B;  5JI6 A;  3BRO A;  2B0L A;  3ZQ7 A;  3GFJ A;  4L9T A;  1IZ1 A;  1HW2 A;  2FNA A;  2ZFW A;  4A5M A;  3DQV C;  1K78 A;  1ZRC A;  2CGP A;  3BPX A;  3E5Q A;  2XHK A;  3R4K A;  3T1B A;  1TW3 A;  3B02 A;  2M8E A;  4Q5S F;  5FB2 A;  3TGN A;  1XCV A;  2A68 F;  3KCC A;  1BN5 A;  1GXP A;  2NS0 A;  5DD8 A;  4RGS A;  4L5J A;  4HQE A;  2RN7 A;  2ZNY A;  5ICG A;  2HYG D;  2H09 A;  4LG0 A;  3GXO A;  1K6O A;  3I59 A;  5D4R A;  3N4M A;  5D5U B;  2ZJ2 A;  2RVC A;  2Y75 A;  4OIN F;  1SD4 A;  3PFI A;  4JBA A;  3CUO A;  3QRF F;  3G73 A;  3E6D A;  3BPV A;  5LRS A;  3KP7 A;  4UUV A;  1Z6T A;  1ZAR A;  2DQR A;  3JAM Z;  2D2W A;  3EYI A;  2GXG A;  5FFZ A;  3FZV A;  3QU6 A;  4R79 A;  2STT A;  4CXF A;  3PQK A;  2DQL A;  2PN6 A;  3E6M A;  5E18 F;  4HQM A;  3HHG A;  5D5V B;  5F1R A;  1L3L A;  3LA7 A;  2J5P A;  4Y13 A;  2YX7 A;  5ILU A;  2G9W A;  2H94 A;  4KIC A;  1G3W A;  2KJC A;  4LLN A;  4GYG A;  2W85 A;  3F8F A;  4S05 A;  5HLH A;  3K69 A;  4YII A;  3MFK A;  1I27 A;  2ZO4 A;  2QUF A;  3RI4 A;  1IRG A;  1I1S A;  5D6F A;  1W4M A;  3HSE A;  1ZGJ A;  3LAP A;  2Y48 A;  2FNP A;  1BC7 C;  4KA4 A;  1FYK A;  4GYI A;  1LB2 A;  1HST A;  5DEQ A;  3RKY A;  3WTT C;  3ERE D;  4KFC A;  1RI7 A;  3ULQ B;  5A2Q K;  3W6J B;  3FHZ A;  4HX8 A;  3KP5 A;  4EJW A;  2E1C A;  5F64 A;  3LA3 A;  1O3Q A;  1ZRF A;  2CFX A;  2HZT A;  3WG9 A;  3ZMS A;  4KIF A;  5ICF A;  3TQN A;  4MNU A;  3I0T A;  1J2X A;  3FM5 A;  1XB4 A;  4HX7 A;  5ILV A;  2EB7 A;  2FE3 A;  5DV5 A;  4PCQ A;  1IAW A;  2P8T A;  4P55 A;  5LEK A;  1IN6 A;  3LWF A;  2E1N A;  2FXA A;  2VOO A;  1FT9 A;  2UXN A;  4LGW A;  3L09 A;  5DUI A;  4Z2Y A;  2QM3 A;  3M8F A;  3QU3 A;  5HLG A;  1BI3 A;  4ESB A;  1YW7 A;  4CDG A;  2RKH A;  3HYI A;  5F6F A;  1G3T A;  3VEP A;  1SFE A;  1EH6 A;  3CO7 C;  1MJ9 A;  3CJN A;  1FWZ A;  5H6R A;  2R7D A;  3FXU A;  3K1M A;  2A07 F;  1R36 A;  2MBF A;  2NAZ A;  4CGZ A;  4EQQ A;  4KDP A;  1ZLJ A;  2Z99 A;  3KP4 A;  5DCF A;  3HTS B;  4KMU X;  5LEJ A;  1ODD A;  4ENN A;  2HWV A;  4M74 A;  3I64 A;  2DO7 A;  1P6R A;  1KGS A;  2JSC A;  2W25 A;  4A12 A;  3KP2 A;  2AXL A;  3RYR A;  1S7O A;  4HLY A;  1FSE A;  4U0W A;  2FBH A;  1HKT A;  2VBZ A;  5D8L B;  4KIB A;  3GFI A;  2DI3 A;  3ZMD A;  1B9M A;  4HAM A;  4ZZD A;  3ZPL A;  2DT5 A;  3H3Z A;  1ZHF A;  2ADU A;  3KZZ A;  1WQ2 A;  2WV0 A;  1SD6 A;  5CVR A;  2LKP A;  3ECO A;  5CLS A;  4CYD A;  3MZH A;  1ZRD A;  3ZMV A;  4FHT A;  3DF8 A;  4BXU A;  5HS9 A;  3SFZ A;  2JPC A;  4CZZ A;  2V9V A;  4HZF A;  4GCV A;  4YFX F;  2OZ6 A;  4RAY A;  2JTV A;  2XKP A;  1OYI A;  5E1W A;  3DFG A;  4U0V A;  2C6Y A;  2K02 A;  1WI9 A;  4AVP A;  1W7P D;  3P9I A;  5DD4 A;  4UVB A;  4EM0 B;  3IKV A;  2A3S A;  4HA8 A;  1JGS A;  1J59 A;  4M6X A;  4IHT A;  3P9K A;  3IRR A;  1Q1H A;  4LJZ F;  3RTR A;  1MJB A;  1U78 A;  2HFH A;  4G6D A;  2AS5 F;  1RIO H;  2M5W A;  3FXQ A;  4PGG A;  2F5F A;  1TQM A;  2XAF A;  1FYL A;  1I5Z A;  3KZY A;  4FX0 A;  3E6B A;  4I0A A;  4IPA A;  1DPU A;  1YYV A;  1ON1 A;  1Z05 A;  1LJ9 A;  5J8F A;  4A0Z A;  4KMF A;  4OOI A;  1QNT A;  1K78 B;  2O03 A;  3EET A;  1R5H A;  1DPR A;  3G3Z A;  3D0S A;  2LDU A;  2HEO A;  4DQ2 A;  3Q9S A;  4OIP F;  1J7K A;  4LFU A;  2VC1 A;  3QOP A;  1MJA A;  2FOK A;  3JSO A;  3KEO A;  1KU7 A;  4P9F A;  2ZBK A;  4YG2 F;  3J81 K;  2RDP A;  4A6E A;  2CW0 F;  4P96 A;  2E7W A;  1S29 A;  3FWE A;  4MEY F;  4WWC A;  4RB1 A;  1AOY A;  1SFX A;  4R1H A;  1O3S A;  4GGG A;  2A61 A;  3GX4 X;  1GHC A;  4WF2 A;  1SAX A;  2ISZ A;  3HTU A;  1OYW A;  3J80 Z;  4ZZL A;  2EA4 A;  3V8L A;  2F5C A;  3K1N A;  5H6Q A;  5LHG A;  1J9I A;  1TQI A;  1O3R A;  3GFL A;  1PP8 F;  2HKO A;  1K79 A;  1PUE E;  4RGR A;  1U2W A;  4OMY A;  2OD5 A;  2VT2 A;  5BPI A;  1BJA A;  4R8H A;  1OYY A;  3U2R A;  3JTG A;  2WWY A;  3HOT A;  2K4B A;  3L9F A;  5BQT A;  3I5U A;  3RKW A;  1U5T B;  4G6Q A;  4HLX A;  4QWQ A;  2FSW A;  2EJR A;  3RKX A;  4OIO F;  1UHM A;  1FP1 D;  2L4A A;  1B4A A;  3WGH A;  4EJT A;  5ERI A;  5FLX Z;  5J6X A;  1J0R A;  3K1P A;  1R5G A;  2KIF A;  1JXS A;  5ILS A;  4EM1 A;  4AIH A;  3MZY A;  2FBK A;  1ON2 A;  3CUQ C;  2P6T A;  4OU0 A;  1O57 A;  1ZAO A;  1BI2 A;  4G94 A;  4L5I A;  2XKO A;  3DP7 A;  3NRV A;  4MQ9 F;  3WTY C;  1YLF A;  3I58 A;  3VOD A;  2VT3 A;  4Y17 A;  3NEU A;  4XLP F;  4ASN A;  2ESH A;  5E20 A;  4EGY A;  5L3B A;  2FMY A;  1AWC A;  1J75 A;  3HSF A;  4HDV A;  2GA1 A;  3M1E A;  2QBY B;  2OAZ A;  2TDX A;  3CO6 C;  3LST A;  1ZLK A;  3MCZ A;  4AIK A;  4G7Z F;  2LSO A;  2OBP A;  4ENM A;  4PGH A;  5DUK A;  2XAH A;  3HUG A;  5L3G A;  1SMT A;  3HRT A;  2VON A;  2H27 A;  2YSR A;  3DEU A;  4L9N A;  2VBX A;  4M71 A;  3B73 A;  1EH7 A;  2GWR A;  5BOX A;  3EUH A;  5D8K B;  4Q4Z F;  2MLK A;  3ELK A;  3KLN A;  1HW1 A;  3FF5 A;  2NRA C;  2G7H A;  4N9I A;  3ZP5 A;  4HYE A;  1IW7 F;  3DPL C;  5JR3 A;  1U6G A;  3F6O A;  2FML A;  2ELH A;  2NNY A;  3K2Z A;  1QGP A;  1D8K A;  3VFZ A;  3HOS A;  4MTE A;  2G7U A;  3CTA A;  1BI0 A;  4IXA A;  2M1B A;  1VTN C;  1HKS A;  1Y0U A;  3ZMT A;  2DTR A;  1MZB A;  1TNS A;  1W7P B;  2D1H A;  2DK8 A;  2YX4 A;  3P7N A;  5LRR A;  4YFK F;  1SFU A;  4KNY A;  2IW5 A;  4L9J A;  1HQC A;  1WKM A;  1R7J A;  2IA0 A;  3WE2 A;  2GIV A;  2O61 A;  1XSX A;  4JQF A;  5IT9 K;  1UFM A;  1F9N A;  1YG2 A;  2PMH A;  2HYF A;  4RGU A;  4G8X A;  1Z9C A;  1ZN2 A;  2XUB A;  1R22 A;  2DW4 A;  1B1B A;  4TV7 A;  5JFR A;  3WU1 B;  1T98 A;  1J5Y A;  4YFN F;  3O3K A;  1MD0 A;  1QZZ A;  1XMA A;  1R00 A;  1B9N A;  2NNN A;  1FP2 A;  3WTW C;  3BZ6 A;  5E8I A;  3RDI A;  3V7R A;  4Q47 A;  1U3E M;  3JSP A;  5IT9 Z;  1R1V A;  1XN7 A;  4RS8 A;  2EFP A;  3V4G A;  2EFN A;  3WU0 A;  5FGM A;  2DFI A;  3IKT A;  4LMY A;  1IN7 A;  2DLL A;  1ULY A;  3T8R A;  5J8C A;  1T0F A;  1XGS A;  3BJ6 A;  3NQO A;  2K27 A;  4IF4 A;  2RGV A;  5BMZ A;  2VBY A;  5D4S A;  2DU9 A;  3ZMZ A;  3JAM K;  2QVO A;  2KJB A;  2YR2 A;  4I02 A;  1RUO A;  2EWN A;  1FSH A;  3VOE A;  5JVT A;  5DCM A;  2Q0O A;  3TO9 A;  2ISY A;  2FU4 A;  2MH2 A;  4HV5 A;  5K5O A;  1KQ0 A;  4NQW A;  4XSZ F;  4I09 A;  5FD5 A;  1LVA A;  3ROU A;  4U0Y A;  1Z6R A;  3MWM A;  3RIR A;  3BOQ A;  1D8J A;  3SHF A;  1U8R A;  2GQQ A;  3WGI A;  2CSO A;  1WSU A;  3WE3 A;  2F5E A;  4EJV A;  1OMI A;  3FMQ A;  4HF2 A;  4HBL A;  3BY6 A;  4UV9 A;  1F5T A;  2CG4 A;  4QLC U;  1S6L A;  1MGT A;  2VE9 A;  2XIG A;  2P5V A;  5AIQ A;  3EYY A;  2STW A;  1SMY F;  3K9T A;  4IRG A;  3F72 A;  3T5X A;  2MD5 A;  1LQ1 A;  1S8N A;  4ESJ A;  1P4X A;  2DPU A;  2QEN A;  5BPD A;  3HRS A;  3K0L A;  1IN5 A;  4IHS A;  2KIU A;  3FM3 A;  4BH9 A;  1O7F A;  1FBU A;  5K5Q A;  2K4J A;  5DDG A;  3KET A;  1ZH5 A;  2CO5 A;  3KFW X;  1LNW A;  2ETH A;  2V6C A;  1H0M A;  2E7X A;  3GEZ A;  3SZP A;  3REO A;  2IVM A;  4WX9 A;  4KYW A;  3EDP A;  5CVU A;  2EV6 A;  2HOE A;  3RPU A;  1D5V A;  4BHC A;  3LA2 A;  2LNB A;  4YIF A;  3F23 A;  3S2W A;  1EH8 A;  2Z33 A;  3F21 A;  2PG4 A;  4UXN A;  4O3M A;  1CF7 B;  1HSJ A;  3DKW A;  1FNN A;  4UVC A;  1QPM A;  3WTV C;  1FY7 A;  1LDJ A;  2A5Y B;  1IN8 A;  2NYX A;  3GFM A;  4UV8 A;  1UST A;  1UHW A;  3ML6 A;  2IRF G;  3L7W A;  3GZ5 A;  1BOA A;  2O3F A;  5HS8 A;  2Q2E A;  4KN7 X;  2GXB A;  1BM9 A;  5ED4 A;  2ESN A;  4M9S A;  1G6N A;  3SQN A;  2O8X A;  4HF0 A;  5AIP A;  3LQR A;  2CQK A;  3FMR A;  4BHB A;  1Z7U A;  2Z9O A;  5TJJ A;  2JRT A;  3E5U A;  1U5T A;  3T0Y A;  2HKX A;  1KQ8 A;  3H3U A;  2RQP A;  1SD5 A;  3IWZ A;  2FBI A;  4Y15 A;  1FZP B;  5L3D A;  2L02 A;  2H6C A;  3HHH A;  4U88 A;  2XV4 S;  1T39 A;  1W5T A;  2FF4 A;  3R0J A;  3TOA A;  4B8X A;  4A0Y A;  4BHP A;  2JPB A;  3ECH A;  5ICC A;  1G3Y A;  4HDU A;  1GVJ A;  3LFK A;  5D5W B;  4LLL A; 
#chains in the Genus database with same CATH topology
 3R0A A;  5LD2 C;  4BJ5 C;  4BDZ A;  2N8G A;  4L0Z B;  4PDK A;  2HU9 A;  2DN0 A;  3R60 A;  4B3X A;  3DTI A;  2FD5 A;  2UZK A;  3KP6 A;  4PZJ A;  1G2H A;  1T6S A;  4PK4 A;  4KIS A;  4P5O A;  5BS6 A;  3CDH A;  2GAU A;  2QQB A;  4LLG F;  1OLT A;  3MVP A;  4KUM A;  2FQ3 A;  1H8A C;  3DU6 A;  2DFF A;  2O9L A;  5FRM A;  1DP7 P;  4K2E A;  2B7E A;  2V1U A;  3U1K A;  1VQO I;  3H92 A;  3WTZ A;  4I2O A;  1W1W E;  4A69 C;  2R3S A;  5HDK A;  5FRO A;  3BWG A;  1D1C A;  4BAY A;  3S3M A;  1KON A;  2LY9 A;  4UVA A;  3WGG A;  2HPI A;  2A05 A;  2M4K A;  1U9O A;  3H5R A;  2HGC A;  4Y3O A;  4KN4 X;  4MFD A;  4EJO A;  4UB6 C;  2QLZ A;  5FKO A;  2LG4 A;  4GO1 A;  1IXS B;  1HDD C;  1JHF A;  4MGR A;  4AUX A;  1KYZ A;  4D1Q A;  1ZGA A;  2LF8 A;  1GXQ A;  1FLI A;  1EA3 A;  4ZTJ A;  3S8P A;  2X6W A;  4EVI A;  4A3M J;  1USS A;  4NC8 A;  1IG7 A;  4E70 A;  3QPH A;  3J7A O;  3IH4 A;  1W7P A;  2V9K A;  3A01 B;  1YS6 A;  4I98 B;  2R7T A;  1EV7 A;  5FD6 A;  2E2H J;  4ZDL A;  2JRM A;  2VQG A;  4LIV A;  2JA7 J;  5KVR A;  2L01 A;  4N0B A;  2EA2 A;  2OQR A;  4L0Y B;  3A4C A;  3OOP A;  4NB5 A;  1PYV A;  1N75 A;  3G1L A;  4GRI A;  2BYV E;  3ZQF A;  3SXY A;  2BGC A;  2KFD A;  2LD5 A;  1YQA A;  1IUF A;  2KRF A;  2WA0 A;  3ZQG A;  1Z3X A;  4XRF A;  3GTJ J;  2DK5 A;  3L2V A;  1JHH A;  5FRN A;  5IOY A;  3CMY A;  2IA1 A;  3CJT B;  1JKO C;  5HVQ C;  4XLC A;  4M9X A;  4OWR B;  4MO7 A;  4CSW A;  3IH3 A;  4MLO A;  1X2M A;  4MFE A;  1DUX C;  5IT3 A;  3Q5F A;  1ZKG A;  3F3X A;  2O6G E;  1DDN A;  2CYY A;  2ZXJ A;  3FIW A;  2K86 A;  1MNE A;  4BE0 A;  2OC6 A;  2H6B A;  2DFE A;  2XB0 X;  2VKH A;  2P7V B;  2V1D A;  2F4I A;  3EUK L;  3F6V A;  4O5V A;  1WJC A;  2TRT A;  5DCM B;  4B48 A;  2JQ7 A;  4RAZ A;  3L00 A;  3F22 A;  3BG5 A;  1YFH A;  2GA2 A;  3CDI A;  4PJN A;  3OL3 A;  3CF5 F;  1WH5 A;  1X3U A;  1QRY A;  4EMS A;  3H35 A;  1A35 A;  1N78 A;  4IHY A;  3ABL H;  2RC4 A;  2M7B A;  2M2E A;  2TCT A;  3OWT A;  1H89 C;  1NG7 A;  2ME6 A;  3RYP A;  2IS2 A;  1QVU A;  2QZ8 A;  3S1M J;  4X1E A;  1MKM A;  3BG3 A;  1LE8 A;  2HDW A;  1B8I B;  2K7L A;  4B09 A;  2VC0 A;  5TGT A;  2WAQ N;  2ECC A;  4BYY A;  3J81 Z;  2HQN A;  1UCR A;  1OJL A;  1Y8R B;  3E0J B;  3QAH A;  4EM2 A;  4IKF A;  3D5R C;  2HTJ A;  1X1A A;  3L2U A;  1Y39 A;  4C3I J;  2YU3 A;  2EFO A;  2R5Z B;  2A6H F;  2A69 F;  3ZN1 A;  3DKY A;  4JX5 A;  1T56 A;  3FXL A;  3OIQ A;  1JKQ C;  1KU9 A;  4HNT A;  1BR2 A;  2K5C A;  2XPU A;  3DEW A;  4ZJZ A;  4FIS A;  1ZEL A;  1XMK A;  2R7U A;  1DU0 A;  5FLM J;  4HEA 2;  2Q1Z B;  3RCO A;  1REP C;  3HGG A;  3CCS I;  2L7F P;  2BE5 F;  3VDX A;  1FJL A;  1KYW A;  1I50 J;  3S15 J;  3JW4 A;  1G3S A;  2FJ1 A;  1KU2 A;  1V4R A;  3P9C A;  3W6K B;  1QVT A;  4E7S A;  4ZH4 F;  1FOX A;  2Y0S N;  4B43 A;  2WC2 A;  2XRN A;  1FX7 A;  1OQY A;  2P6S A;  4A2U A;  3B6A A;  2Q2E B;  4XM3 A;  3GCM A;  2P5L C;  2ID3 A;  2ZJR F;  4EV0 A;  2EFQ A;  2XF6 A;  5CKT A;  2LOO A;  4BL0 B;  3CC7 I;  4OIR F;  2MH9 A;  1P2F A;  3DLL F;  1IF1 A;  1WRJ A;  2FX0 A;  1QZY A;  2IEK A;  1PJR A;  1ETQ A;  3TO6 A;  2KIM A;  2L7Z A;  2EPF A;  2O0Y A;  5TRD A;  2ACJ A;  5HLI A;  1S9H A;  2ZNZ A;  2ZME B;  5M5Y J;  2M87 A;  4IRI A;  1TWA J;  5FLX K;  1VI0 A;  1UEL B;  2K40 A;  2WAF A;  3K4L A;  2KDZ A;  1HKQ A;  4RAG A;  4ENK A;  4A5N A;  4I01 A;  1X3Z B;  2Z3Y A;  4Z6Y A;  3E7L A;  2BZT A;  1YS7 A;  3TO7 A;  3HOV J;  3V8K A;  4U7D A;  4E7H A;  2PEX A;  5E17 F;  3E3V A;  1LUJ B;  1O7L A;  2XAQ A;  1MDM A;  1MBJ A;  5HOO A;  5K5R A;  1YJN I;  2DT6 A;  2M4G A;  3IRQ A;  3OL4 A;  1QHH D;  1V5F A;  2VJ4 A;  3GF2 A;  1QBJ A;  4XOT A;  1T8I A;  4BQN A;  3A0B C;  4KIT B;  4AWX B;  3F8N A;  2MA3 A;  2WB1 A;  3ABT A;  1CF7 A;  4LB5 A;  4ON0 A;  3N97 A;  4ZYE A;  1YJW I;  1Y1V J;  2IPQ X;  2WTE A;  4PJL A;  1B59 A;  1RUN A;  2QF7 A;  5D6E A;  4JX4 A;  3KPH A;  1XX5 A;  2IS1 A;  2Z5U A;  3M1C A;  1KQ9 A;  5LBQ A;  2EZH A;  5E79 C;  1JUP A;  3JRD A;  1R58 A;  2MC3 A;  4FTH A;  1VZ0 A;  3HOY J;  3ZGK A;  2HS5 A;  1STZ A;  4LOC A;  1BI1 A;  4KIG A;  3QPT A;  3HG9 A;  3FX3 A;  1FC3 A;  4LK1 F;  4Q48 A;  4DW6 A;  4HPQ A;  1FBQ A;  3J80 K;  1P7I A;  4HX4 A;  2PFB A;  4H0E A;  4L18 B;  2FA5 A;  2ELJ A;  2MC4 A;  2R7Z J;  4M6V A;  2KIS A;  4HOB A;  1XGM A;  1OCC H;  3DV8 A;  1RR7 A;  3GW2 A;  3WU2 C;  1R1U A;  3BDD A;  1NH3 A;  4RGX A;  2UWM A;  5F0H A;  3JRG A;  2R7O A;  4OMZ A;  2JA5 J;  3I71 A;  1WHU A;  2LBF A;  1KA8 A;  2CWE A;  2PBI A;  4ITV A;  3KEY A;  2OJE D;  3QP6 A;  1HLV A;  4BUP A;  4P9U A;  1DGR M;  5JLW A;  4PFO A;  3I4P A;  3GZN B;  4WXD A;  4U87 A;  3VB2 A;  3OYG A;  3HRU A;  4ZYD A;  3DU5 A;  4LG3 A;  3V42 A;  3BTJ A;  5FJ8 J;  1LDK B;  1M1E B;  2CJJ A;  2EIN H;  6PAX A;  2W24 A;  1B72 A;  4RB0 A;  4XSX F;  1Z21 A;  3VSL A;  2QGU A;  5E8G A;  4DNC A;  5A2Q Z;  4CO8 A;  3C3W A;  2CUF A;  3TDZ C;  4HW0 A;  3LSR A;  2LMD A;  4AU7 A;  5LGU A;  3OYB A;  5LGT A;  4YEL A;  3GZ6 A;  5EEH A;  3D1N I;  4D0P A;  1YIO A;  2KKO A;  5C44 J;  1BOB A;  1SAN A;  4I0B A;  1YX3 A;  4BS9 A;  2VPR A;  3FKJ A;  2IAI A;  3DBR B;  1Z0X A;  2IA2 A;  3I56 I;  1VQL I;  1ZK8 A;  3LQQ A;  3BP8 A;  5KK1 A;  2VE8 A;  2MLG A;  2XB5 A;  2DOE A;  3BG9 A;  4CCM A;  3ZQL A;  4XNF A;  3P5J A;  4D7M A;  4NQW B;  1WJD A;  2CQX A;  3E5X A;  2PMZ N;  2CMP A;  4UNO A;  3OYH A;  1R4M B;  2LVS A;  3O6B B;  3RPQ A;  1W5S A;  2D45 A;  1IUY A;  1BIA A;  3GLX A;  1BBY A;  1ETX A;  1H9G A;  2M0C A;  1OR7 A;  3X2Q H;  2EV5 A;  1XG1 A;  3MD2 A;  4BQA A;  3DXJ F;  5JVG F;  2OQG A;  2ZXH A;  1E3O C;  4II3 A;  4S04 A;  4G7H F;  1HOM A;  3GO5 A;  4MHG A;  1A36 A;  3GVA A;  4WXH A;  4RMN A;  2XC7 A;  4N9H A;  3LSK A;  1MW7 A;  4UY8 I;  1HXD A;  3QP5 A;  1NK3 P;  2PMZ A;  3QYF A;  2IJL A;  3C18 A;  1NTC A;  4E7L A;  4X6A J;  1RET A;  1CGP A;  2MD0 A;  1D0Y A;  2DA7 A;  2OU2 A;  3KEQ A;  3O2P E;  2BY1 A;  3ISP A;  3KIO A;  3HRM A;  1GDT A;  3BR0 A;  3EQL F;  2DXI A;  1IXC A;  1JE8 A;  4LG0 B;  4BEH B;  1QQI A;  3ZN0 A;  2K3F A;  2J5O A;  2V26 A;  3DCF A;  2KT0 A;  1HBX G;  2UUZ A;  2VPL A;  4S0H B;  5FO5 A;  3SZT A;  5F0C A;  1JUM A;  4ZYH A;  3QPS A;  2R7F A;  2BW3 B;  2QYO A;  5CVJ A;  2PJP A;  1FOK A;  2NS7 A;  1LDD A;  4RB3 C;  2RNG A;  2BY0 A;  1XGN A;  1Y6I A;  1TP4 A;  3RPU D;  3NAU A;  4C3J J;  4ZTF A;  2XAS A;  2WY8 Q;  5KHD A;  1YJ9 I;  3CUQ B;  5HDG A;  2H8R A;  1XDU A;  3K7A J;  3I53 A;  1IO2 A;  3HIF A;  4NNJ A;  3CD6 I;  4IL6 C;  1A04 A;  3BR3 A;  2R5Y A;  1BL0 A;  2VOD A;  2NXN B;  2QBY A;  2RV8 A;  3M07 A;  1T2K A;  1S5L C;  3BQZ A;  5E3L A;  2PI0 A;  3Q9V A;  2DA5 A;  4E7I A;  1HW5 A;  5EEG A;  1FBS A;  2QCO A;  1LEA A;  5LHI A;  2EIL H;  3TOB A;  3ZMU A;  3LAJ A;  3M8J A;  3CLQ A;  4M72 A;  3IWF A;  1D0X A;  2YS9 A;  1LFP A;  2VQL A;  3BLY A;  2NVY J;  3ONQ A;  9ANT A;  4RB2 C;  3CDL A;  1F4K A;  4ANJ A;  3M7G A;  3GYH X;  5C4J J;  1AU7 A;  5LHH A;  4XON A;  4A3I J;  5HNF A;  1I1G A;  1Q1V A;  1R23 A;  3A01 A;  1XTA A;  1TNT A;  2EBI A;  2HTS A;  2IP2 A;  3GTK J;  5GTH C;  4KT5 C;  1L0O C;  3BG6 A;  1RRJ A;  3HZJ A;  2HXO A;  2E1M B;  4XOP A;  3WTS C;  4ESF A;  4U7B A;  1O4X A;  3GTL J;  5TIS C;  1LVK A;  3E6C C;  3V7C A;  1XGO A;  4WXC A;  2EV0 A;  1ENH A;  1BR1 A;  1MBK A;  2BBY A;  1V3F A;  1YW9 A;  2OTJ I;  3MQ0 A;  2Y31 A;  1I39 A;  1R6R A;  4B4C A;  2PJR A;  2BOL A;  1R4N B;  2GZW A;  2L9V A;  3ASN H;  1O3T A;  4JX6 A;  1JTY A;  1AKH A;  1XDS A;  4XKW A;  2QQA A;  2JZY A;  2CRG A;  3UNG C;  1XCB A;  3F8M A;  2VIX A;  3CCJ I;  1P9Q C;  4AIJ A;  1Y8Q B;  2BHZ A;  4WK8 F;  3ASO H;  3Q0W A;  3K70 C;  1G4D A;  2A6E F;  2X0L A;  3DBH B;  3GTQ J;  5D5X B;  2X4H A;  2MGQ A;  3FHN A;  4XKV A;  2Z16 A;  5CJ9 A;  1R5I D;  3QWL A;  2V9P A;  1ONV A;  4W1U A;  1YTY A;  4I7H A;  1IRF A;  2YPR A;  3U1D A;  5L3C A;  5EGO A;  4ENJ A;  1AHD P;  3GWZ A;  1U5T C;  4DOZ A;  3DBL B;  5J40 A;  2W48 A;  4EJU A;  2ZB9 A;  3L2C A;  2BXZ A;  3CCM I;  5EZH A;  4CHU A;  2KHM A;  3ZQH A;  4D5F A;  1WVR A;  1QO0 D;  3R61 A;  4MEX F;  4AD9 A;  2COM A;  5AON A;  4OIQ F;  2MAB A;  1T38 A;  3HSR A;  5J1U A;  3R6S A;  1P4W A;  2D1V A;  5BNG A;  1IXR C;  2XGX A;  1WFX A;  2HI3 A;  5LGN A;  2LP0 A;  2X51 A;  1V5E A;  2O7O A;  3V8J A;  3RQI A;  1FTT A;  3BR1 A;  5E1X A;  3WOD F;  2I10 A;  1JJ8 C;  2VOP A;  5ICE A;  3ABU A;  3A02 A;  3QYE A;  4MQV A;  4FT8 A;  2XF7 A;  2QA4 I;  3KYL A;  3IHU A;  2W57 A;  4M6Y A;  2P7C B;  3IC7 A;  3IUO A;  4UHT A;  3M4O J;  1YOV B;  3Q3S A;  1Z7L A;  2CQQ A;  1KU3 A;  4JYK A;  2Y0S A;  1VF9 A;  2VBW A;  2XAJ A;  5FFX A;  4FX4 A;  2CV0 A;  5GPA A;  5L3E A;  1ETW A;  3FXR A;  3BG7 A;  1FYM A;  3CP8 A;  1BJZ A;  2Y69 H;  2HDC A;  2PLY A;  1MDM B;  1P7J A;  3K10 A;  2Z2S B;  5IYB J;  1XPX A;  3S1Q J;  2HR3 A;  2IGK A;  4EGZ A;  1D3Y A;  2PJR B;  2DA3 A;  2LBF B;  4IJA A;  2XF5 A;  3I59 B;  5CVI A;  1E2X A;  3FBI B;  4M9Z A;  1OPC A;  3JRA A;  2AXT C;  3S3N A;  2HQA A;  3SFI A;  4D7N A;  1OCZ H;  1FOW A;  4XBF A;  3I55 I;  2MYS A;  1PP7 U;  2BXY A;  3LSG A;  2KZV A;  1XD7 A;  2LC2 A;  3IAS 2;  3TP0 A;  3PQJ A;  3IL2 A;  3PNT A;  5EGO B;  4FE4 A;  3HL2 A;  5HS7 A;  4HRI A;  3KP3 A;  5H20 A;  1OKR A;  2BV6 A;  2VI6 A;  3TP3 A;  2BHY A;  4C3H J;  3PNV A;  4DBR A;  5E1Z B;  5L3F A;  3OYM A;  2L3D A;  2XRO A;  1E17 A;  4NBQ A;  2WAQ A;  1BC8 C;  1SVL A;  3TKY A;  1X1B A;  1XMX A;  3FMS A;  1X1D A;  2P5K A;  2COB A;  3K6G A;  1FPQ A;  1POG A;  5B3S H;  2BEO A;  3S1N J;  2X1C A;  3E97 A;  3D5L A;  4ZYG A;  2PMU A;  5K1Y A;  2M45 A;  1HF0 A;  1F1Z A;  4XRS A;  3L2Q A;  2GLO A;  2DMN A;  2OZU A;  2K3P A;  2W84 A;  2R7Q A;  2FRH A;  1XS9 A;  1K7A A;  3JTH A;  2R7S A;  1ZRE A;  2KMU A;  4A0X A;  4CIC A;  1TWH J;  1RNL A;  1Z1D A;  2W4S A;  2Y0M A;  1IC8 A;  3AFH A;  1V55 H;  2PQ8 A;  3OV8 A;  2ZJP F;  3HPH A;  1TW2 A;  3CLO A;  4BNC A;  2KDO A;  2VQC A;  5IYC J;  3C1D A;  2IT0 A;  1ZG3 A;  2FEZ A;  2O8K A;  2HDD A;  3SDB A;  2JT1 A;  1RR8 C;  3A1Y A;  3BC8 A;  3EPZ A;  1R1T A;  3WTU C;  5JHU A;  1ZG5 A;  3K4C A;  1IDY A;  4G7O F;  4AC0 A;  2EFW A;  3OYF A;  2ZCW A;  2LK2 A;  4B47 A;  2MW8 A;  3M9A A;  3OYA A;  1H9T A;  2ZKZ A;  2DAO A;  2VB6 A;  4JK1 X;  3TED A;  3ZCO A;  4V2F A;  4IRH A;  4C2M J;  1ZG1 A;  2QQ9 A;  3AG2 H;  3BJO A;  3PIO F;  1U9N A;  1YW8 A;  1MMA A;  3SEZ A;  5HDN A;  1SD7 A;  3I54 A;  4LB6 B;  2P4W A;  1RZ4 A;  2VN2 A;  3MAJ A;  4L9V A;  3OYL A;  1VQ7 I;  4HF1 A;  1TT0 A;  2XAG A;  3NAR A;  5GP9 A;  1XSD A;  3M8E A;  2UXX A;  2P81 A;  3LFK A;  2V1N A;  5HLT A;  1NHA A;  2ZSH B;  1DGW Y;  2OPT A;  2JUG A;  3NWS A;  1YHQ I;  1E3P A;  2H1L A;  3COA C;  4A3E J;  2ZXW H;  1PDN C;  2DPD A;  4HV6 A;  2CW7 A;  3BJA A;  2D5V A;  1Z91 A;  4M73 A;  1DP3 A;  4MTD A;  1ZGW A;  4E7Z A;  3F8C A;  3PJR A;  4F7Z A;  2LF7 A;  2VXZ A;  4C9Y A;  3H3V K;  1TBX A;  2ZME A;  3GTM J;  1XSV A;  1JKR C;  1MMS A;  3HB9 A;  2MG4 A;  5CYV A;  3L1P A;  3WTX C;  2X1E A;  1YO5 C;  3F8B A;  1WJ5 A;  1S3J A;  1TQP A;  1UB9 A;  4GFB A;  2BY2 A;  3U9G A;  2L54 A;  5CVV A;  2BVL A;  2V79 A;  2Q8K A;  3VSK A;  2AHQ A;  3KLO A;  3KE2 A;  2DCE A;  5GAH J;  3T8T A;  1APL C;  3CUQ A;  4IVN A;  2R5Z A;  1P92 A;  2XSJ C;  1V5G A;  3DPT A;  3TDU C;  2QWW A;  1RKT A;  3M3Y J;  1B6A A;  1ZYR F;  2VXD A;  4MIM A;  4X0G A;  2DOF A;  1P4A A;  2X1D A;  4ETS A;  3ABK H;  4A6D A;  4O6J A;  2F2E A;  4AYB A;  1WJB A;  2HQR A;  5DYM A;  3RJP A;  4WCG A;  4N4O B;  2V1X A;  1N77 A;  1LEB A;  4NHJ A;  1DU6 A;  4LK0 F;  3MEX A;  1S7A A;  1TC3 C;  4Y33 A;  2LKS A;  1JT0 A;  3VWB A;  2HVQ A;  2KRH A;  3V7S A;  1FTZ A;  2XVC A;  3H9J A;  2KLO A;  3C7J A;  4LD5 A;  1WWX A;  4RBO A;  2M30 A;  1I6X A;  1Z3Y A;  5FLV A;  4J19 A;  2DBB A;  4DYC A;  3LL7 A;  2HZD A;  2EK5 A;  4GXO A;  2QKM B;  1IRZ A;  3OR1 C;  3K4K A;  3H36 A;  4IHV A;  3H5N A;  4XK4 A;  3KX2 A;  1W36 D;  3GUD A;  2RNJ A;  3AAF A;  5LLQ A;  1YI2 I;  1MNM C;  2F5D A;  4BBR J;  3C2B A;  2L4M A;  3BCA A;  3N05 A;  2OA4 A;  1IN4 A;  1C0W A;  3JRE A;  3SJM A;  3K4B A;  4XLN F;  1IV8 A;  1BIB A;  1VQM I;  4XL9 A;  1TTY A;  4G9Y A;  1TLH B;  5KNL A;  5JI6 A;  3BRO A;  4XLA A;  2B0L A;  3ZQ7 A;  3GFJ A;  4L9T A;  1UAA A;  3B6C A;  2ZME C;  1IZ1 A;  2IBD A;  2L7K A;  4EEF G;  1HW2 A;  2FNA A;  3PSI A;  2ZFW A;  3DEE A;  3DQV C;  4A5M A;  2DDA A;  4A3C J;  4XQF A;  1K78 A;  1ZRC A;  2CGP A;  3BPX A;  2DFH A;  1B72 B;  2KRC A;  3E5Q A;  2XHK A;  3IP4 B;  3R4K A;  3T1B A;  4NDL A;  1LFU P;  1TW3 A;  3B02 A;  2M8E A;  5IP7 J;  3BR6 A;  2R7W A;  3S14 J;  4Q5S F;  5FB2 A;  2WAE A;  3TGN A;  2ELK A;  3L2W A;  1VQN I;  1XCV A;  2A68 F;  1BW5 A;  3KCC A;  4XLH A;  2Z1D A;  1BN5 A;  1FMW A;  2K85 A;  1GXP A;  2NS0 A;  5DD8 A;  4RGS A;  4L5J A;  4HQE A;  2RN7 A;  4GDF A;  2ZNY A;  2OCC H;  5ICG A;  2HYG D;  5IP9 J;  2H09 A;  4LG0 A;  4BQO A;  3CCU I;  3GXO A;  1K6O A;  5DM6 F;  1ZR4 A;  3I59 A;  5D4R A;  4DBQ A;  5DM7 F;  3N4M A;  2EIJ H;  5D5U B;  4EAT A;  1F43 A;  2ZJ2 A;  2RVC A;  2Y75 A;  4OIN F;  1SD4 A;  3PFI A;  4JBA A;  4V19 K;  3HKZ N;  3CUO A;  3QRF F;  4QPQ A;  5IP6 A;  4M3E A;  3G73 A;  3E6D A;  3BPV A;  5LRS A;  4UUS B;  1I3A A;  3KP7 A;  1HDP A;  2NVU B;  3S2D J;  2JVG A;  4HG2 A;  2JSP A;  2ID6 A;  4XRS G;  1JGG A;  4UUV A;  1GLN A;  3QPL A;  1Z6T A;  5M5W J;  1S72 I;  3FXK A;  1I3Q J;  5F27 A;  1W36 C;  1ZAR A;  2DQR A;  3IH2 A;  3JAM Z;  2D2W A;  3EYI A;  2R92 J;  4M3F A;  1EKE A;  2GXG A;  5FFZ A;  3S32 A;  3FZV A;  3QU6 A;  4R79 A;  2STT A;  4CXF A;  2B63 J;  2E2I J;  3PQK A;  1RC9 A;  2DQL A;  3OS2 A;  2PN6 A;  3E6M A;  5JLX A;  5E18 F;  4HQM A;  3HHG A;  5D5V B;  5F1R A;  5IOZ A;  1LKX A;  1L3L A;  4IEJ A;  1X58 A;  3LA7 A;  3CME I;  2J5P A;  4Y13 A;  2G0E A;  2YX7 A;  5ILU A;  4PJ0 C;  2G9W A;  3FXO A;  2R7V A;  4FAS D;  2H94 A;  3OYI A;  3KYD B;  1G3W A;  2KJC A;  4KIC A;  1K61 A;  4LLN A;  4GYG A;  1T95 A;  2W85 A;  3DPU A;  5FKM A;  3F9K A;  3F8F A;  3VPR A;  5IY5 H;  4S05 A;  4A3L J;  3EUH C;  1X4P A;  5HLH A;  3K69 A;  4YII A;  3MFK A;  3MMY B;  1I27 A;  2ZO4 A;  2DOD A;  2QUF A;  3RI4 A;  1IRG A;  1ETK A;  2KIQ A;  1I1S A;  3CC4 I;  5D6F A;  3ZQQ A;  1W4M A;  3HSE A;  1ZGJ A;  4AYB N;  3LAP A;  3LFU A;  2Y48 A;  2WBM A;  2FNP A;  3G6E I;  1BC7 C;  5FKN A;  5GPC A;  1VQ6 I;  3ZXS A;  4KA4 A;  1FYK A;  4GYI A;  1LB2 A;  1HST A;  1RPW A;  1LPQ A;  3K4J A;  5DEQ A;  1SC7 A;  1QU3 A;  3RKY A;  3OR2 C;  1TWF J;  3WTT C;  4KJZ A;  3ERE D;  4KFC A;  2GBY A;  1RI7 A;  1WPK A;  3ULQ B;  3AKZ A;  5A2Q K;  4UUS A;  3BZC A;  3W6J B;  2GIZ A;  4BGD A;  2HOS A;  3FHZ A;  4HX8 A;  4FE7 A;  3KP5 A;  4EJW A;  2E1C A;  5F64 A;  2VJJ A;  3LA3 A;  1YE9 A;  1O3Q A;  1ZRF A;  4Y4R A;  1OCP A;  2CFX A;  2HZT A;  3WG9 A;  2VKE A;  3ZMS A;  4KIF A;  5B5E C;  4H4K C;  5ICF A;  3TQN A;  5H2F C;  4MNU A;  3I0T A;  4PJM A;  4BKX A;  1E3H A;  1MBF A;  1J2X A;  3FM5 A;  1XB4 A;  2IGN A;  3D5S C;  4ZDO A;  4HX7 A;  5ILV A;  2EB7 A;  2FE3 A;  4RLF A;  5DV5 A;  2L0K A;  4BJ6 C;  2OV7 A;  2CS3 A;  3G4S I;  4C2U A;  1AA7 A;  4PCQ A;  1T08 B;  1IAW A;  4PSX A;  2LRD A;  2P8T A;  4P55 A;  5LEK A;  1IN6 A;  2CW8 A;  3QOD A;  3K4N A;  1A5J A;  3PM1 A;  5E3M A;  3LWF A;  3GME A;  5JHF A;  2E1N A;  5F1J A;  2FXA A;  5EEA A;  3JRB A;  3C2H A;  2VOO A;  1FT9 A;  2UXN A;  2Y9Y A;  3FIS A;  4LGW A;  3L09 A;  5DUI A;  4Z2Y A;  2QM3 A;  1W0T A;  3M8F A;  2E35 A;  2X6O A;  2ECB A;  2XDV A;  3QU3 A;  1BI3 A;  5HLG A;  4ESB A;  1YW7 A;  2JA6 J;  4CDG A;  1UG0 A;  2RKH A;  3HYI A;  1T33 A;  5F6F A;  1GV2 A;  1G3T A;  3VEP A;  1SFE A;  1EH6 A;  3CO7 C;  1MJ9 A;  3CJN A;  1FWZ A;  3FBN B;  5H6R A;  2DA2 A;  2R7D A;  1X1P A;  3FXU A;  1OCR H;  1NG6 A;  3K1M A;  2HQ5 A;  4BY7 J;  2A07 F;  1R36 A;  2MBF A;  1MMN A;  1JI8 A;  4RAF A;  2JN6 A;  2NAZ A;  4CGZ A;  2R93 J;  4EQQ A;  3S17 J;  4M3B A;  4KDP A;  3A0H C;  3FXM A;  1ZLJ A;  2Z99 A;  3KP4 A;  4J01 A;  1PUF A;  3BQY A;  3FK6 A;  3A03 A;  1TT5 B;  5DCF A;  3GTG J;  4XR6 A;  3CCE I;  3HTS B;  3ESW B;  4A3G J;  4KMU X;  1G8X A;  5LEJ A;  1ODD A;  4ENN A;  2RAE A;  2RQQ A;  2BVM A;  4XOR A;  3CCV I;  2HWV A;  4M74 A;  1YRN A;  3I64 A;  2DO7 A;  4BDY A;  1P6R A;  1KGS A;  2JSC A;  2W25 A;  4A12 A;  2HYJ A;  3KP2 A;  2AXL A;  3RYR A;  2FOW A;  1S7O A;  3CP2 A;  4HLY A;  2FQ4 A;  1MMG A;  1FSE A;  2M34 A;  4U0W A;  2FBH A;  1HKT A;  2EH3 A;  4IHW A;  2HNH A;  4UUT A;  1GV5 A;  2VBZ A;  5D8L B;  3RZO J;  2JA2 A;  4KIB A;  1IRX A;  3GFI A;  3UR3 C;  2DI3 A;  3TL4 X;  3ZMD A;  1B9M A;  4HAM A;  4ZZD A;  3ZPL A;  3OYC A;  5CPR B;  3HOW J;  2DT5 A;  2QSH X;  3AL0 B;  3H3Z A;  1ZHF A;  2ADU A;  3SEQ A;  2DMQ A;  3KZZ A;  1WQ2 A;  3J7Z I;  4ZC3 A;  2ZJQ F;  2WV0 A;  1SD6 A;  5CVR A;  4HST A;  4XKC A;  3OIO A;  2VQH A;  1SFO J;  2F4M B;  3FDY A;  3WG7 H;  2LKP A;  1MSE C;  3ECO A;  5CLS A;  4NC6 A;  3KZI C;  4CYD A;  3MZH A;  1ZRD A;  3PNY A;  3DKX A;  4I76 A;  3ZMV A;  4FHT A;  3DF8 A;  4BXU A;  5FKK A;  4BQQ A;  5HS9 A;  2HPM A;  5EG0 A;  3SFZ A;  2JPC A;  1K4S A;  1K6Y A;  3EUA A;  2EZI A;  1X4O A;  2W00 A;  1VQP I;  2CFO A;  4CZZ A;  1Z67 A;  4DIQ A;  2QEX I;  2V9V A;  3OOU A;  1A6I A;  4HZF A;  4GCV A;  4II2 A;  2HOT A;  2DJI A;  2DMU A;  4YFX F;  1OIS A;  3G1M A;  2OZ6 A;  1U8B A;  1ITY A;  4RAY A;  3J7Y J;  3HXL A;  2JTV A;  2XKP A;  1OYI A;  5E1W A;  3DFG A;  4U0V A;  2C6Y A;  2K02 A;  3JRC A;  1WI9 A;  1UMQ A;  3NWT A;  4E7K A;  5IYD J;  1X2N A;  1BA5 A;  3HC7 A;  4AVP A;  1W7P D;  2DTZ A;  3P9I A;  4BBS J;  5EZG A;  1PUF B;  3CC2 I;  1FIP A;  5DD4 A;  4UVB A;  2HXI A;  2VL8 A;  1D0Z A;  2DA6 A;  4EM0 B;  1YIJ I;  3IKV A;  3WHB A;  2A3S A;  4HA8 A;  1JGS A;  4PJJ A;  3I3L A;  2E5Z A;  4M6X A;  1J59 A;  1QA6 A;  3P9K A;  3MKY B;  4IHT A;  3CCR I;  3IRR A;  4CYC A;  1Q1H A;  4LJZ F;  5K7H A;  1FEX A;  1VQ5 I;  2M0M A;  3RTR A;  2CUE A;  1MJB A;  4BXF A;  3BZK A;  1U78 A;  4XIC A;  4G6T B;  2XRL A;  2HFH A;  2CV1 A;  4G6D A;  2AS5 F;  3QOE A;  2DYS H;  1RIO H;  5KAF C;  2UV1 A;  5C4X J;  2M5W A;  3FXQ A;  4CCN A;  1XC5 A;  3S2H J;  1ETO A;  4PGG A;  3HDD A;  2F5F A;  1TQM A;  2XAF A;  3C2G A;  2LKX A;  3CJQ B;  1FYL A;  2R7R A;  4BXX J;  1I5Z A;  5EG0 B;  3KZY A;  1SVO A;  4FX0 A;  3E6B A;  3CQZ J;  4I0A A;  4XMY A;  2K9N A;  1TWC J;  2H1K A;  4IPA A;  5J1Y A;  3OYD A;  3RZD J;  1DPU A;  3OYJ A;  1YYV A;  3HGY A;  3W2W A;  3JRI A;  4PSW A;  1ON1 A;  4JOM A;  1Z05 A;  1LJ9 A;  5J3L A;  3JRF A;  5J8F A;  2K9S A;  1MH3 A;  2CH0 A;  4A0Z A;  5HOD A;  3BCB A;  4KMF A;  4OOI A;  1QNT A;  1K78 B;  2O03 A;  4C30 A;  3EET A;  2EIK H;  4W97 A;  3O8G A;  1R5H A;  1DPR A;  2DDB A;  3G3Z A;  3D0S A;  2E34 A;  3OIP A;  2LDU A;  3RSN A;  3DTE A;  2HEO A;  4PFP A;  4DQ2 A;  5DS9 A;  5E3N A;  3Q9S A;  1ERD A;  2KZG A;  3HKZ A;  4OIP F;  1J7K A;  4LFU A;  3VYS B;  2VC1 A;  4G12 A;  2X9D A;  2DOA A;  2JWT A;  3QOP A;  2DYR H;  1MJA A;  2FOK A;  3JSO A;  2W82 A;  3S1R J;  3KEO A;  3S93 A;  1KU7 A;  4P9F A;  3OYE A;  4RM2 A;  2ZBK A;  1D5Y A;  4YG2 F;  3J81 K;  4IOA F;  2RDP A;  3LNQ A;  4A6E A;  4AVZ A;  4ABZ A;  2CW0 F;  4P96 A;  2E7W A;  1S29 A;  2LR8 A;  3FWE A;  3HOU J;  3H9G A;  3RKQ A;  2Y30 A;  4MEY F;  3I4M J;  4WWC A;  2X6Y A;  1S7E A;  4JP0 A;  4RB1 A;  1H88 C;  1AOY A;  3GTO J;  4Y7N J;  1SFX A;  4R1H A;  5GAD J;  4IZZ A;  1O3S A;  4GGG A;  2A61 A;  3GX4 X;  1GHC A;  3HOX J;  4LIU A;  4WF2 A;  2DT7 B;  1SAX A;  2AQE A;  2ISZ A;  3HTU A;  4F93 B;  2ICW G;  1WZ2 A;  1OYW A;  3DWL E;  5EYR A;  2PX9 A;  3J80 Z;  1Y0N A;  4ZZL A;  2WB1 N;  2EA4 A;  3V8L A;  2F5C A;  3K1N A;  4N4N B;  5H6Q A;  5LHG A;  1J9I A;  3F0C A;  1TQI A;  3PFY A;  1O3R A;  1HCR A;  3GFL A;  1PP8 F;  2HKO A;  3L2R A;  1K79 A;  1J09 A;  3LOC A;  1PUE E;  3AG1 H;  4RGR A;  1U2W A;  3OSF A;  1ZQ3 P;  4DGW B;  4OMY A;  3ABM H;  5J4V A;  4E7J A;  2OD5 A;  2Y9Z A;  2VT2 A;  3MN2 A;  2KQR A;  2GOM A;  5BPI A;  2NOG A;  3OYN A;  3H9Q A;  1BJA A;  1EJ9 A;  4F52 A;  4R8H A;  3QYB A;  4NC7 A;  1OYY A;  2WY7 Q;  3LSJ A;  2M3A A;  3U2R A;  1X1C A;  3VYR B;  1JT6 A;  3JTG A;  5CQG A;  2WWY A;  3HOT A;  2VJI A;  2B9S A;  3LSP A;  4BU2 A;  2K4B A;  4HNU A;  3L9F A;  3ZOB A;  5BQT A;  5B1B H;  1W0U A;  3I5U A;  2JUC A;  3RKW A;  1U5T B;  4G6Q A;  4HLX A;  4QWQ A;  3G1O A;  2FSW A;  2EJR A;  3RKX A;  3QQA A;  4OIO F;  1UHM A;  4OAY A;  1FP1 D;  3K70 D;  2L4A A;  2M9H A;  1JKP C;  1B4A A;  3WGH A;  3CJR B;  2CV2 A;  1Y56 A;  2X6X A;  2OUM A;  1B8I A;  4EJT A;  5ERI A;  5FLX Z;  5J6X A;  1J0R A;  3K1P A;  1R5G A;  2KIF A;  1JXS A;  5ILS A;  4EM1 A;  1G59 A;  4AIH A;  3MZY A;  2FBK A;  1ON2 A;  2CU7 A;  3CUQ C;  2P6T A;  2NVQ J;  4YIR X;  2R4G A;  5GAE J;  4OU0 A;  1O57 A;  2GOX B;  1VND A;  3HBL A;  1SAU A;  5J4Y A;  3DLA A;  1ZAO A;  2GXA A;  1BI2 A;  1VQ8 I;  4G94 A;  2OF7 A;  3FKI J;  4L5I A;  3PL8 A;  2XKO A;  3DP7 A;  3NRV A;  4CA0 A;  4M3G A;  4MQ9 F;  3WTY C;  1YRN B;  3S3O A;  1YLF A;  2MFZ A;  4QIW N;  2EQR A;  1Z77 A;  2L9S A;  2NVT J;  3BT9 A;  3I58 A;  4E4H A;  3JRH A;  3VOD A;  3H0D A;  2VT3 A;  4CZC A;  1E0E A;  4Y17 A;  4ZYA A;  5F0F A;  3NEU A;  4CCJ A;  4I99 C;  3ZRG A;  4XLP F;  1X3W B;  4ASN A;  4AM3 A;  2ESH A;  5E20 A;  4BJT A;  2ME0 A;  2ZSI B;  3O8H A;  4EGY A;  3H5A A;  5L3B A;  2FMY A;  3FXJ A;  1AWC A;  2NS8 A;  3OY9 A;  1J75 A;  1IGN A;  3HSF A;  4HDV A;  1GVD A;  5C3E J;  2GA1 A;  1RES A;  3M1E A;  2QBY B;  2CUZ A;  2OAZ A;  1WJA A;  2TDX A;  3CO6 C;  5K7F A;  2XAU A;  3LST A;  4ZDP A;  1ZLK A;  2QSF X;  3MCZ A;  1JUS A;  4IOC F;  4AIK A;  1WGX A;  2R7X A;  3PO2 J;  1LE8 B;  4G7Z F;  4Y52 J;  2NVX J;  2LSO A;  2OBP A;  4ENM A;  4PGH A;  4V2G A;  1N25 A;  5DUK A;  2XAH A;  3HUG A;  5L3G A;  1SMT A;  3HRT A;  4IHX A;  1KZH A;  2VON A;  4A3B J;  2H27 A;  2YSR A;  3DEU A;  4A3D J;  1QZE A;  4L9N A;  3CCL I;  2VBX A;  1SEU A;  2V6E A;  2XPV A;  4M71 A;  4YRV A;  1ZR2 A;  3B73 A;  2LLK A;  1EH7 A;  2GWR A;  3KYC B;  5BOX A;  2F48 A;  2NOJ B;  4BEH A;  3EUH A;  2XGD A;  3JR9 A;  4DYR A;  2AQF A;  5D8K B;  4Q4Z F;  3PUF A;  2MLK A;  3ELK A;  3KLN A;  4CH7 A;  1HW1 A;  3FF5 A;  1VFC A;  3SDG A;  1YIT I;  4A3K J;  2XSD C;  2G7H A;  2NRA C;  4N9I A;  3CF2 A;  3ZP5 A;  4HYE A;  1MND A;  1IW7 F;  3DPL C;  3WHC A;  5K7Z A;  4BAC A;  5JR3 A;  1U6G A;  3F6O A;  1HA8 A;  1A31 A;  3LSH A;  2FML A;  5F08 A;  2ELH A;  1PVE A;  4QSH A;  3VYU B;  2NNY A;  2DMT A;  3JCU C;  3K2Z A;  1ACI A;  1QGP A;  1D8K A;  2I8D A;  1TZL A;  3VFZ A;  5EF6 A;  3HOS A;  4MTE A;  2G7U A;  3CTA A;  2L9R A;  1UZC A;  1R71 A;  1HC8 A;  1BI0 A;  5GTI C;  2JMW A;  2QQ8 A;  4A3J J;  4IXA A;  1UJ8 A;  2M1B A;  1VTN C;  1WI3 A;  1HKS A;  5KAI C;  3AG4 H;  1Y0U A;  3ZMT A;  2DTR A;  2EIM H;  1MZB A;  2QKL B;  1TNS A;  4LIT A;  1X19 A;  2E1M C;  3OS0 A;  1W7P B;  1DQU A;  2D1H A;  2VJ5 A;  2DK8 A;  3H1C A;  2YX4 A;  3P7N A;  5LRR A;  4YFK F;  5EDN A;  1D1B A;  1SFU A;  1OCO H;  4KNY A;  3GTP J;  4BE1 A;  2VLA A;  2IW5 A;  4L9J A;  1HQC A;  1ORK A;  5CQE A;  1SFK A;  1WKM A;  1R7J A;  2IA0 A;  3ZQI A;  1D1A A;  3WE2 A;  2GIV A;  2O61 A;  1XSX A;  4JQF A;  1UHS A;  5IT9 K;  3ZR8 X;  4E6K G;  1UFM A;  1VQ4 I;  1F9N A;  1MBH A;  1YG2 A;  3FK7 A;  1K83 J;  2PMH A;  1F36 A;  2HYF A;  4G8X A;  4RGU A;  2IGO A;  2H8W A;  1BR4 A;  1RKW A;  1Z9C A;  2HOA A;  3H0G J;  3OSG A;  1ZN2 A;  5B66 C;  3LMM A;  2XUB A;  3K2A A;  1R22 A;  1I6H J;  2DW4 A;  1B1B A;  2K9L A;  1IJW C;  4TV7 A;  5JFR A;  1VQ9 I;  2K9M A;  3WU1 B;  4DZP A;  3J7A Y;  1T98 A;  2DA1 A;  2L9N A;  1J5Y A;  3CCQ I;  3PUB A;  4YFN F;  4FQG A;  3UKG A;  3O3K A;  2M8G X;  1MD0 A;  2VAS A;  1QZZ A;  2E19 A;  1XMA A;  1R49 A;  3I4N J;  1R00 A;  1B9N A;  2LRE A;  4C2T A;  4YEJ A;  4P1W A;  2F4O B;  2DA4 A;  3G2B A;  2NNN A;  1WJF A;  1FP2 A;  3WTW C;  3BZ6 A;  4B1R A;  5E8I A;  4M3D A;  3OS1 A;  3RDI A;  3V7R A;  4Q47 A;  1U3E M;  3JSP A;  5IT9 Z;  2IXS A;  5GAG J;  1R1V A;  1XN7 A;  3PSF A;  2IS6 A;  1MBG A;  2KP6 A;  4RS8 A;  2EFP A;  2V4J C;  3V4G A;  2EFN A;  3WU0 A;  1U0J A;  5FGM A;  2DFI A;  5IPA A;  2HVR A;  5M3M J;  3IKT A;  1VQK I;  2BW3 A;  5M3F J;  1QPI A;  3IV5 A;  4LMY A;  3SYT A;  3MKL A;  1EF4 A;  1IN7 A;  2DLL A;  2WAD A;  2FUG 2;  3HM5 A;  4F3Q A;  1ULY A;  3RQ4 A;  3T8R A;  3BR5 A;  5J8C A;  1T0F A;  1XGS A;  3BJ6 A;  2F6C A;  3NQO A;  1WJE A;  2I5U A;  2K27 A;  3LSM A;  1WH7 A;  3TBI A;  4IF4 A;  2A5W A;  2RGV A;  4BY1 J;  4L5E A;  1TWG J;  2DJN A;  4UB8 C;  5BMZ A;  2VBY A;  5D4S A;  2R5Y B;  2DU9 A;  2M7A A;  2L5Q A;  3ZMZ A;  3JAM K;  2QVO A;  2KJB A;  2YR2 A;  4I02 A;  2L2O A;  1RUO A;  2EWN A;  1IV6 A;  3VOE A;  5JVT A;  5DCM A;  1FSH A;  2Q0O A;  3TO9 A;  2ISY A;  2FU4 A;  2MH2 A;  4HV5 A;  5K5O A;  5EJC A;  1KQ0 A;  2LTP A;  4NQW A;  4DJA A;  4XSZ F;  1ETV A;  4FET A;  4I09 A;  4CYC B;  4A3F J;  5FD5 A;  2F5V A;  1LVA A;  3I9V 2;  3W2V A;  3ROU A;  3VYT B;  1Z6R A;  4F92 B;  4U0Y A;  1OR7 C;  1FOY A;  3MWM A;  2JK3 A;  3RIR A;  3W3C A;  2E5N A;  3BOQ A;  2K9Q A;  1YX5 A;  1D8J A;  4B3A A;  1JTX A;  2JJ7 A;  3SHF A;  2CUJ A;  3WGI A;  2GQQ A;  3DTK A;  1U8R A;  2ZFU A;  4XKB A;  2CSO A;  1WSU A;  2YU9 J;  3WE3 A;  2F5E A;  4EJV A;  1OMI A;  5J1R A;  2JA8 J;  2LY1 A;  2IGM A;  3FMQ A;  1SVM A;  4HF2 A;  4HBL A;  3BY6 A;  4UV9 A;  2BY3 A;  1MSF C;  1F5T A;  2CG4 A;  4QLC U;  2IS4 A;  1S6L A;  4I6Z A;  1MGT A;  3GBG A;  2EZK A;  3S16 J;  2VE9 A;  2XIG A;  2P5V A;  4RLQ A;  5AIQ A;  3MKZ A;  3EYY A;  4IQ4 A;  2STW A;  3Q0V A;  2OCE A;  2VKV A;  1SMY F;  3K9T A;  2LY2 A;  1WCM J;  4IRG A;  3F72 A;  2V7F A;  3T5X A;  5LFA A;  3IAM 2;  2W7N A;  2MD5 A;  1LQ1 A;  1S8N A;  4ESJ A;  1P4X A;  4J00 A;  2DPU A;  4A93 J;  2QEN A;  4QTR A;  5BPD A;  4XLE A;  2EZL A;  3HRS A;  1LFB A;  2W1O A;  3K0L A;  2VUM J;  1IN5 A;  4D5C A;  1OCT C;  3HUG B;  4IHS A;  2VKD A;  2LH9 A;  2KIU A;  3FM3 A;  4BH9 A;  1CQT A;  1O7F A;  1Y1W J;  2CQ7 A;  3GLL A;  3HJE A;  1FBU A;  5K5Q A;  2K4J A;  3U21 A;  3CES A;  5DDG A;  4XRM A;  3A2K A;  3KET A;  5F04 A;  1ZH5 A;  2CO5 A;  4IX7 A;  1TL8 A;  3OYK A;  3KFW X;  1LNW A;  3Q0U A;  2ETH A;  4FCY A;  5B1A H;  1MBE A;  2L7M P;  2V6C A;  2X85 A;  4DZJ A;  1GT0 C;  4D9J A;  1H0M A;  2E7X A;  3GEZ A;  1MH4 A;  3SZP A;  2JVH A;  3REO A;  2KPM A;  5KCM A;  1GUU A;  2IVM A;  3BTC A;  4NUB A;  4IO9 F;  4WX9 A;  4KYW A;  3EDP A;  5CVU A;  3BTI A;  2EV6 A;  5FKL A;  3CMM A;  2P0W A;  2HOE A;  3RPU A;  2XGE A;  1D5V A;  4BHC A;  4CCL A;  4CCO A;  3LA2 A;  2LNB A;  4RA2 A;  4YIF A;  3F23 A;  3S2W A;  1EH8 A;  3BR2 A;  2Z33 A;  4HNV A;  1NK2 P;  2HVS A;  2YUS A;  2E2J J;  4F55 A;  3F21 A;  5J47 A;  1ETY A;  3ZQC A;  2PG4 A;  4UXN A;  1R9T J;  5M5X J;  4O3M A;  2XPW A;  1CF7 B;  2E71 A;  1MMD A;  2GM4 A;  3LSI A;  1HSJ A;  3DKW A;  4XID A;  3K4M A;  2Y2Z A;  1FNN A;  3G71 I;  3HOZ J;  2WV1 A;  4RDU A;  4QPO A;  3PIP F;  2XGC A;  2ZC2 A;  2CQN A;  3E1S A;  4UVC A;  2R0Q C;  4BE2 A;  1QPM A;  3WTV C;  1FY7 A;  1LDJ A;  2A5Y B;  3MZ8 A;  3SZG A;  1AKH B;  2RRE A;  1A6Q A;  3W2A A;  1IN8 A;  2NYX A;  3GFM A;  4UV8 A;  3AL0 C;  1UST A;  1UHW A;  1ZTR A;  2MSY A;  2AO9 A;  3ML6 A;  4B44 A;  2IRF G;  1MIJ A;  3L7W A;  3GZ5 A;  1BOA A;  3OMY A;  2O3F A;  3PO3 J;  5E3O A;  5HS8 A;  2Q2E A;  4KN7 X;  2GXB A;  2KL4 A;  4F91 B;  2DMP A;  3HEF A;  3CMA I;  1FIA A;  4DYQ A;  1BM9 A;  5ED4 A;  2ESN A;  4M9S A;  1G6N A;  3SQN A;  2E60 A;  4AID A;  4RM3 A;  1QHG A;  1W5C C;  2O8X A;  2OTL I;  4HF0 A;  5AIP A;  3LQR A;  2CQK A;  3FMR A;  4BHB A;  3AG3 H;  2E1O A;  1Z7U A;  4HSR A;  3MKW B;  3W6V A;  4CUG A;  2Z9O A;  2LYC A;  3TW7 A;  5TJJ A;  2JRT A;  2X48 A;  2ZXI A;  2O5R A;  3E5U A;  4IQJ A;  1U5T A;  3T0Y A;  2HKX A;  1T0F C;  3TMO A;  3H3U A;  1KQ8 A;  1K4T A;  5HNH A;  3CZ6 A;  2RQP A;  1SD5 A;  3IWZ A;  2FBI A;  4PUS A;  4Y15 A;  1FZP B;  4XN0 A;  4OAZ A;  5L3D A;  2L02 A;  2H6C A;  3HHH A;  4CCK A;  2A6T A;  2QSG X;  4U88 A;  2XV4 S;  4XN3 A;  1UG2 A;  2LFB A;  1T39 A;  2E36 A;  1W5T A;  2FF4 A;  1JJ6 C;  3R0J A;  3ERM A;  3TOA A;  4XLF A;  4B8X A;  1FMV A;  3BTL A;  4A0Y A;  4BHP A;  1OFC X;  2JPB A;  3ECH A;  1G3Y A;  4KT6 A;  3TW6 A;  1BW6 A;  5DTD A;  5ICC A;  3CCY A;  4HDU A;  1IDZ A;  1GVJ A;  1V54 H;  3HPG A;  5D5W B;  4LLL A; 
#chains in the Genus database with same CATH homology
 3R0A A;  4L0Z B;  4PDK A;  3R60 A;  2UZK A;  3KP6 A;  4PZJ A;  1T6S A;  4P5O A;  5BS6 A;  3CDH A;  2GAU A;  2QQB A;  4LLG F;  4KUM A;  2FQ3 A;  1DP7 P;  4K2E A;  2V1U A;  4I2O A;  3H92 A;  3WTZ A;  2R3S A;  5HDK A;  3BWG A;  4BAY A;  4UVA A;  3WGG A;  2HGC A;  4KN4 X;  4EJO A;  2QLZ A;  4GO1 A;  1IXS B;  1JHF A;  4MGR A;  1KYZ A;  1ZGA A;  2LF8 A;  1GXQ A;  1FLI A;  4EVI A;  1USS A;  4E70 A;  3QPH A;  3J7A O;  1W7P A;  1YS6 A;  4I98 B;  1EV7 A;  5FD6 A;  5KVR A;  2L01 A;  4N0B A;  2EA2 A;  2OQR A;  4L0Y B;  3OOP A;  4NB5 A;  2BYV E;  3SXY A;  2BGC A;  1YQA A;  2KRF A;  4XRF A;  2DK5 A;  1JHH A;  2IA1 A;  5HVQ C;  4M9X A;  1DUX C;  5IT3 A;  3Q5F A;  3F3X A;  2O6G E;  1DDN A;  2CYY A;  2ZXJ A;  2K86 A;  2H6B A;  2P7V B;  2V1D A;  3F6V A;  4O5V A;  5DCM B;  4RAZ A;  3L00 A;  3F22 A;  1YFH A;  2GA2 A;  1X3U A;  4EMS A;  2RC4 A;  3RYP A;  2QZ8 A;  1MKM A;  2K7L A;  4B09 A;  2VC0 A;  4BYY A;  3J81 Z;  2HQN A;  1UCR A;  3QAH A;  4EM2 A;  2HTJ A;  2YU3 A;  2EFO A;  2A6H F;  2A69 F;  3ZN1 A;  1KU9 A;  1XMK A;  1REP C;  2BE5 F;  1KYW A;  3JW4 A;  1G3S A;  1KU2 A;  4ZH4 F;  1V4R A;  3P9C A;  3W6K B;  2WC2 A;  2XRN A;  1FX7 A;  2P6S A;  4A2U A;  2P5L C;  4EV0 A;  2EFQ A;  4OIR F;  2MH9 A;  1P2F A;  1IF1 A;  1WRJ A;  1QZY A;  3TO6 A;  2KIM A;  2O0Y A;  5TRD A;  2ACJ A;  5HLI A;  2ZNZ A;  2ZME B;  4IRI A;  2M87 A;  5FLX K;  1HKQ A;  4ENK A;  4A5N A;  4I01 A;  2Z3Y A;  1YS7 A;  3TO7 A;  3V8K A;  4U7D A;  2PEX A;  5E17 F;  3E3V A;  1O7L A;  2XAQ A;  1MDM A;  5HOO A;  5K5R A;  3IRQ A;  3GF2 A;  1QBJ A;  4AWX B;  3F8N A;  2MA3 A;  3ABT A;  1CF7 A;  4LB5 A;  4ON0 A;  3N97 A;  4ZYE A;  2IPQ X;  2WTE A;  1RUN A;  1B59 A;  5D6E A;  2Z5U A;  1KQ9 A;  5LBQ A;  1R58 A;  2MC3 A;  2HS5 A;  1STZ A;  1BI1 A;  4KIG A;  3QPT A;  3FX3 A;  1FC3 A;  4LK1 F;  4Q48 A;  1FBQ A;  3J80 K;  4HX4 A;  2PFB A;  4H0E A;  4L18 B;  2FA5 A;  4HOB A;  1XGM A;  3DV8 A;  3GW2 A;  1R1U A;  3BDD A;  4RGX A;  2UWM A;  4OMZ A;  3I71 A;  1KA8 A;  2CWE A;  2PBI A;  3QP6 A;  4P9U A;  3I4P A;  4WXD A;  3VB2 A;  3HRU A;  4ZYD A;  6PAX A;  1LDK B;  2W24 A;  4RB0 A;  4XSX F;  4DNC A;  5E8G A;  5A2Q Z;  4CO8 A;  3C3W A;  3TDZ C;  4HW0 A;  5LGU A;  5LGT A;  3GZ6 A;  5EEH A;  4D0P A;  1YIO A;  2KKO A;  4I0B A;  2IA2 A;  3LQQ A;  3BP8 A;  5KK1 A;  2VE8 A;  2MLG A;  3E5X A;  4UNO A;  3RPQ A;  3O6B B;  1W5S A;  2D45 A;  1IUY A;  1BIA A;  3GLX A;  1BBY A;  1H9G A;  1OR7 A;  2EV5 A;  4BQA A;  3DXJ F;  2OQG A;  4G7H F;  4S04 A;  3GO5 A;  4MHG A;  3GVA A;  4WXH A;  4N9H A;  1HXD A;  3QP5 A;  2IJL A;  3C18 A;  1CGP A;  3KEQ A;  3O2P E;  2OU2 A;  3ISP A;  3HRM A;  3EQL F;  1IXC A;  1JE8 A;  4LG0 B;  1QQI A;  3ZN0 A;  2J5O A;  1HBX G;  5FO5 A;  3SZT A;  4ZYH A;  2R7F A;  2QYO A;  5CVJ A;  2PJP A;  1FOK A;  1LDD A;  4RB3 C;  1XGN A;  2XAS A;  3CUQ B;  5HDG A;  1XDU A;  3I53 A;  3HIF A;  1A04 A;  2VOD A;  2QBY A;  2RV8 A;  1T2K A;  2PI0 A;  3Q9V A;  1HW5 A;  5EEG A;  1FBS A;  1LEA A;  5LHI A;  3TOB A;  3LAJ A;  3ZMU A;  4M72 A;  3IWF A;  4RB2 C;  1F4K A;  3M7G A;  3GYH X;  5LHH A;  1I1G A;  1R23 A;  1TNT A;  2HTS A;  2IP2 A;  4KT5 C;  1L0O C;  3WTS C;  4ESF A;  4U7B A;  3E6C C;  3V7C A;  1XGO A;  4WXC A;  2EV0 A;  2BBY A;  1V3F A;  1YW9 A;  3MQ0 A;  2GZW A;  1O3T A;  1XDS A;  2QQA A;  2JZY A;  1XCB A;  3F8M A;  4AIJ A;  4WK8 F;  1G4D A;  2A6E F;  2X0L A;  5D5X B;  2X4H A;  5CJ9 A;  1ONV A;  1YTY A;  4I7H A;  1IRF A;  2YPR A;  3U1D A;  5L3C A;  4ENJ A;  3GWZ A;  1U5T C;  4EJU A;  3L2C A;  4CHU A;  1QO0 D;  3R61 A;  4MEX F;  4AD9 A;  2COM A;  5AON A;  4OIQ F;  1T38 A;  3HSR A;  3R6S A;  1P4W A;  2D1V A;  1IXR C;  2XGX A;  5LGN A;  3V8J A;  5E1X A;  3WOD F;  2VOP A;  5ICE A;  3ABU A;  4MQV A;  4FT8 A;  3IHU A;  2W57 A;  4M6Y A;  2P7C B;  3IC7 A;  4UHT A;  1KU3 A;  2VBW A;  2XAJ A;  5FFX A;  4FX4 A;  5L3E A;  3FXR A;  1FYM A;  2HDC A;  2PLY A;  1MDM B;  2HR3 A;  4EGZ A;  1D3Y A;  4IJA A;  3I59 B;  5CVI A;  1E2X A;  4M9Z A;  1OPC A;  4XBF A;  1PP7 U;  1XD7 A;  3PQJ A;  3IL2 A;  5HS7 A;  3KP3 A;  5H20 A;  1OKR A;  2BV6 A;  5E1Z B;  5L3F A;  2L3D A;  2XRO A;  1E17 A;  1BC8 C;  3TKY A;  3FMS A;  2P5K A;  1FPQ A;  2BEO A;  3E97 A;  3D5L A;  4ZYG A;  2PMU A;  5K1Y A;  2M45 A;  1F1Z A;  2OZU A;  2W84 A;  2FRH A;  1K7A A;  3JTH A;  1ZRE A;  4CIC A;  4A0X A;  1Z1D A;  1RNL A;  2Y0M A;  2PQ8 A;  3OV8 A;  1TW2 A;  3CLO A;  4BNC A;  3C1D A;  2IT0 A;  1ZG3 A;  2FEZ A;  2JT1 A;  1R1T A;  3WTU C;  5JHU A;  1ZG5 A;  4G7O F;  2EFW A;  2ZCW A;  3M9A A;  1H9T A;  2ZKZ A;  2DAO A;  4JK1 X;  4IRH A;  1ZG1 A;  2QQ9 A;  3BJO A;  1YW8 A;  5HDN A;  1SD7 A;  3I54 A;  4LB6 B;  2P4W A;  1RZ4 A;  2VN2 A;  3MAJ A;  4L9V A;  4HF1 A;  2XAG A;  1XSD A;  3M8E A;  2UXX A;  1NHA A;  3COA C;  1PDN C;  2DPD A;  4HV6 A;  3BJA A;  1Z91 A;  4M73 A;  4MTD A;  3F8C A;  4F7Z A;  2LF7 A;  2VXZ A;  1TBX A;  2ZME A;  1XSV A;  5CYV A;  3WTX C;  1YO5 C;  3F8B A;  1S3J A;  1TQP A;  1UB9 A;  3U9G A;  2L54 A;  5CVV A;  2V79 A;  2Q8K A;  3KLO A;  3KE2 A;  3T8T A;  3CUQ A;  4IVN A;  1P92 A;  3DPT A;  3TDU C;  2QWW A;  1B6A A;  1ZYR F;  1P4A A;  4ETS A;  4A6D A;  4O6J A;  2F2E A;  2HQR A;  5DYM A;  3RJP A;  4WCG A;  2V1X A;  1LEB A;  4NHJ A;  4LK0 F;  3MEX A;  1S7A A;  3V7S A;  2XVC A;  3C7J A;  4LD5 A;  1WWX A;  2M30 A;  1I6X A;  2DBB A;  2EK5 A;  4GXO A;  3GUD A;  2RNJ A;  3AAF A;  5LLQ A;  2F5D A;  2L4M A;  2OA4 A;  1IN4 A;  1C0W A;  4XLN F;  1BIB A;  1TTY A;  4G9Y A;  1TLH B;  5JI6 A;  3BRO A;  2B0L A;  3ZQ7 A;  3GFJ A;  4L9T A;  1IZ1 A;  1HW2 A;  2FNA A;  2ZFW A;  4A5M A;  3DQV C;  1K78 A;  1ZRC A;  2CGP A;  3BPX A;  3E5Q A;  2XHK A;  3R4K A;  3T1B A;  1TW3 A;  3B02 A;  2M8E A;  4Q5S F;  5FB2 A;  3TGN A;  1XCV A;  2A68 F;  3KCC A;  1BN5 A;  1GXP A;  2NS0 A;  5DD8 A;  4RGS A;  4L5J A;  4HQE A;  2RN7 A;  2ZNY A;  5ICG A;  2HYG D;  2H09 A;  4LG0 A;  3GXO A;  1K6O A;  3I59 A;  5D4R A;  3N4M A;  5D5U B;  2ZJ2 A;  2RVC A;  2Y75 A;  4OIN F;  1SD4 A;  3PFI A;  4JBA A;  3CUO A;  3QRF F;  3G73 A;  3E6D A;  3BPV A;  5LRS A;  3KP7 A;  4UUV A;  1Z6T A;  1ZAR A;  2DQR A;  3JAM Z;  2D2W A;  3EYI A;  2GXG A;  5FFZ A;  3FZV A;  3QU6 A;  4R79 A;  2STT A;  4CXF A;  3PQK A;  2DQL A;  2PN6 A;  3E6M A;  5E18 F;  4HQM A;  3HHG A;  5D5V B;  5F1R A;  1L3L A;  3LA7 A;  2J5P A;  4Y13 A;  2YX7 A;  5ILU A;  2G9W A;  2H94 A;  4KIC A;  1G3W A;  2KJC A;  4LLN A;  4GYG A;  2W85 A;  3F8F A;  4S05 A;  5HLH A;  3K69 A;  4YII A;  3MFK A;  1I27 A;  2ZO4 A;  2QUF A;  3RI4 A;  1IRG A;  1I1S A;  5D6F A;  1W4M A;  3HSE A;  1ZGJ A;  3LAP A;  2Y48 A;  2FNP A;  1BC7 C;  4KA4 A;  1FYK A;  4GYI A;  1LB2 A;  1HST A;  5DEQ A;  3RKY A;  3WTT C;  3ERE D;  4KFC A;  1RI7 A;  3ULQ B;  5A2Q K;  3W6J B;  3FHZ A;  4HX8 A;  3KP5 A;  4EJW A;  2E1C A;  5F64 A;  3LA3 A;  1O3Q A;  1ZRF A;  2CFX A;  2HZT A;  3WG9 A;  3ZMS A;  4KIF A;  5ICF A;  3TQN A;  4MNU A;  3I0T A;  1J2X A;  3FM5 A;  1XB4 A;  4HX7 A;  5ILV A;  2EB7 A;  2FE3 A;  5DV5 A;  4PCQ A;  1IAW A;  2P8T A;  4P55 A;  5LEK A;  1IN6 A;  3LWF A;  2E1N A;  2FXA A;  2VOO A;  1FT9 A;  2UXN A;  4LGW A;  3L09 A;  5DUI A;  4Z2Y A;  2QM3 A;  3M8F A;  3QU3 A;  5HLG A;  1BI3 A;  4ESB A;  1YW7 A;  4CDG A;  2RKH A;  3HYI A;  5F6F A;  1G3T A;  3VEP A;  1SFE A;  1EH6 A;  3CO7 C;  1MJ9 A;  3CJN A;  1FWZ A;  5H6R A;  2R7D A;  3FXU A;  3K1M A;  2A07 F;  1R36 A;  2MBF A;  2NAZ A;  4CGZ A;  4EQQ A;  4KDP A;  1ZLJ A;  2Z99 A;  3KP4 A;  5DCF A;  3HTS B;  4KMU X;  5LEJ A;  1ODD A;  4ENN A;  2HWV A;  4M74 A;  3I64 A;  2DO7 A;  1P6R A;  1KGS A;  2JSC A;  2W25 A;  4A12 A;  3KP2 A;  2AXL A;  3RYR A;  1S7O A;  4HLY A;  1FSE A;  4U0W A;  2FBH A;  1HKT A;  2VBZ A;  5D8L B;  4KIB A;  3GFI A;  2DI3 A;  3ZMD A;  1B9M A;  4HAM A;  4ZZD A;  3ZPL A;  2DT5 A;  3H3Z A;  1ZHF A;  2ADU A;  3KZZ A;  1WQ2 A;  2WV0 A;  1SD6 A;  5CVR A;  2LKP A;  3ECO A;  5CLS A;  4CYD A;  3MZH A;  1ZRD A;  3ZMV A;  4FHT A;  3DF8 A;  4BXU A;  5HS9 A;  3SFZ A;  2JPC A;  4CZZ A;  2V9V A;  4HZF A;  4GCV A;  4YFX F;  2OZ6 A;  4RAY A;  2JTV A;  2XKP A;  1OYI A;  5E1W A;  3DFG A;  4U0V A;  2C6Y A;  2K02 A;  1WI9 A;  4AVP A;  1W7P D;  3P9I A;  5DD4 A;  4UVB A;  4EM0 B;  3IKV A;  2A3S A;  4HA8 A;  1JGS A;  1J59 A;  4M6X A;  4IHT A;  3P9K A;  3IRR A;  1Q1H A;  4LJZ F;  3RTR A;  1MJB A;  1U78 A;  2HFH A;  4G6D A;  2AS5 F;  1RIO H;  2M5W A;  3FXQ A;  4PGG A;  2F5F A;  1TQM A;  2XAF A;  1FYL A;  1I5Z A;  3KZY A;  4FX0 A;  3E6B A;  4I0A A;  4IPA A;  1DPU A;  1YYV A;  1ON1 A;  1Z05 A;  1LJ9 A;  5J8F A;  4A0Z A;  4KMF A;  4OOI A;  1QNT A;  1K78 B;  2O03 A;  3EET A;  1R5H A;  1DPR A;  3G3Z A;  3D0S A;  2LDU A;  2HEO A;  4DQ2 A;  3Q9S A;  4OIP F;  1J7K A;  4LFU A;  2VC1 A;  3QOP A;  1MJA A;  2FOK A;  3JSO A;  3KEO A;  1KU7 A;  4P9F A;  2ZBK A;  4YG2 F;  3J81 K;  2RDP A;  4A6E A;  2CW0 F;  4P96 A;  2E7W A;  1S29 A;  3FWE A;  4MEY F;  4WWC A;  4RB1 A;  1AOY A;  1SFX A;  4R1H A;  1O3S A;  4GGG A;  2A61 A;  3GX4 X;  1GHC A;  4WF2 A;  1SAX A;  2ISZ A;  3HTU A;  1OYW A;  3J80 Z;  4ZZL A;  2EA4 A;  3V8L A;  2F5C A;  3K1N A;  5H6Q A;  5LHG A;  1J9I A;  1TQI A;  1O3R A;  3GFL A;  1PP8 F;  2HKO A;  1K79 A;  1PUE E;  4RGR A;  1U2W A;  4OMY A;  2OD5 A;  2VT2 A;  5BPI A;  1BJA A;  4R8H A;  1OYY A;  3U2R A;  3JTG A;  2WWY A;  3HOT A;  2K4B A;  3L9F A;  5BQT A;  3I5U A;  3RKW A;  1U5T B;  4G6Q A;  4HLX A;  4QWQ A;  2FSW A;  2EJR A;  3RKX A;  4OIO F;  1UHM A;  1FP1 D;  2L4A A;  1B4A A;  3WGH A;  4EJT A;  5ERI A;  5FLX Z;  5J6X A;  1J0R A;  3K1P A;  1R5G A;  2KIF A;  1JXS A;  5ILS A;  4EM1 A;  4AIH A;  3MZY A;  2FBK A;  1ON2 A;  3CUQ C;  2P6T A;  4OU0 A;  1O57 A;  1ZAO A;  1BI2 A;  4G94 A;  4L5I A;  2XKO A;  3DP7 A;  3NRV A;  4MQ9 F;  3WTY C;  1YLF A;  3I58 A;  3VOD A;  2VT3 A;  4Y17 A;  3NEU A;  4XLP F;  4ASN A;  2ESH A;  5E20 A;  4EGY A;  5L3B A;  2FMY A;  1AWC A;  1J75 A;  3HSF A;  4HDV A;  2GA1 A;  3M1E A;  2QBY B;  2OAZ A;  2TDX A;  3CO6 C;  3LST A;  1ZLK A;  3MCZ A;  4AIK A;  4G7Z F;  2LSO A;  2OBP A;  4ENM A;  4PGH A;  5DUK A;  2XAH A;  3HUG A;  5L3G A;  1SMT A;  3HRT A;  2VON A;  2H27 A;  2YSR A;  3DEU A;  4L9N A;  2VBX A;  4M71 A;  3B73 A;  1EH7 A;  2GWR A;  5BOX A;  3EUH A;  5D8K B;  4Q4Z F;  2MLK A;  3ELK A;  3KLN A;  1HW1 A;  3FF5 A;  2NRA C;  2G7H A;  4N9I A;  3ZP5 A;  4HYE A;  1IW7 F;  3DPL C;  5JR3 A;  1U6G A;  3F6O A;  2FML A;  2ELH A;  2NNY A;  3K2Z A;  1QGP A;  1D8K A;  3VFZ A;  3HOS A;  4MTE A;  2G7U A;  3CTA A;  1BI0 A;  4IXA A;  2M1B A;  1VTN C;  1HKS A;  1Y0U A;  3ZMT A;  2DTR A;  1MZB A;  1TNS A;  1W7P B;  2D1H A;  2DK8 A;  2YX4 A;  3P7N A;  5LRR A;  4YFK F;  1SFU A;  4KNY A;  2IW5 A;  4L9J A;  1HQC A;  1WKM A;  1R7J A;  2IA0 A;  3WE2 A;  2GIV A;  2O61 A;  1XSX A;  4JQF A;  5IT9 K;  1UFM A;  1F9N A;  1YG2 A;  2PMH A;  2HYF A;  4RGU A;  4G8X A;  1Z9C A;  1ZN2 A;  2XUB A;  1R22 A;  2DW4 A;  1B1B A;  4TV7 A;  5JFR A;  3WU1 B;  1T98 A;  1J5Y A;  4YFN F;  3O3K A;  1MD0 A;  1QZZ A;  1XMA A;  1R00 A;  1B9N A;  2NNN A;  1FP2 A;  3WTW C;  3BZ6 A;  5E8I A;  3RDI A;  3V7R A;  4Q47 A;  1U3E M;  3JSP A;  5IT9 Z;  1R1V A;  1XN7 A;  4RS8 A;  2EFP A;  3V4G A;  2EFN A;  3WU0 A;  5FGM A;  2DFI A;  3IKT A;  4LMY A;  1IN7 A;  2DLL A;  1ULY A;  3T8R A;  5J8C A;  1T0F A;  1XGS A;  3BJ6 A;  3NQO A;  2K27 A;  4IF4 A;  2RGV A;  5BMZ A;  2VBY A;  5D4S A;  2DU9 A;  3ZMZ A;  3JAM K;  2QVO A;  2KJB A;  2YR2 A;  4I02 A;  1RUO A;  2EWN A;  1FSH A;  3VOE A;  5JVT A;  5DCM A;  2Q0O A;  3TO9 A;  2ISY A;  2FU4 A;  2MH2 A;  4HV5 A;  5K5O A;  1KQ0 A;  4NQW A;  4XSZ F;  4I09 A;  5FD5 A;  1LVA A;  3ROU A;  4U0Y A;  1Z6R A;  3MWM A;  3RIR A;  3BOQ A;  1D8J A;  3SHF A;  1U8R A;  2GQQ A;  3WGI A;  2CSO A;  1WSU A;  3WE3 A;  2F5E A;  4EJV A;  1OMI A;  3FMQ A;  4HF2 A;  4HBL A;  3BY6 A;  4UV9 A;  1F5T A;  2CG4 A;  4QLC U;  1S6L A;  1MGT A;  2VE9 A;  2XIG A;  2P5V A;  5AIQ A;  3EYY A;  2STW A;  1SMY F;  3K9T A;  4IRG A;  3F72 A;  3T5X A;  2MD5 A;  1LQ1 A;  1S8N A;  4ESJ A;  1P4X A;  2DPU A;  2QEN A;  5BPD A;  3HRS A;  3K0L A;  1IN5 A;  4IHS A;  2KIU A;  3FM3 A;  4BH9 A;  1O7F A;  1FBU A;  5K5Q A;  2K4J A;  5DDG A;  3KET A;  1ZH5 A;  2CO5 A;  3KFW X;  1LNW A;  2ETH A;  2V6C A;  1H0M A;  2E7X A;  3GEZ A;  3SZP A;  3REO A;  2IVM A;  4WX9 A;  4KYW A;  3EDP A;  5CVU A;  2EV6 A;  2HOE A;  3RPU A;  1D5V A;  4BHC A;  3LA2 A;  2LNB A;  4YIF A;  3F23 A;  3S2W A;  1EH8 A;  2Z33 A;  3F21 A;  2PG4 A;  4UXN A;  4O3M A;  1CF7 B;  1HSJ A;  3DKW A;  1FNN A;  4UVC A;  1QPM A;  3WTV C;  1FY7 A;  1LDJ A;  2A5Y B;  1IN8 A;  2NYX A;  3GFM A;  4UV8 A;  1UST A;  1UHW A;  3ML6 A;  2IRF G;  3L7W A;  3GZ5 A;  1BOA A;  2O3F A;  5HS8 A;  2Q2E A;  4KN7 X;  2GXB A;  1BM9 A;  5ED4 A;  2ESN A;  4M9S A;  1G6N A;  3SQN A;  2O8X A;  4HF0 A;  5AIP A;  3LQR A;  2CQK A;  3FMR A;  4BHB A;  1Z7U A;  2Z9O A;  5TJJ A;  2JRT A;  3E5U A;  1U5T A;  3T0Y A;  2HKX A;  1KQ8 A;  3H3U A;  2RQP A;  1SD5 A;  3IWZ A;  2FBI A;  4Y15 A;  1FZP B;  5L3D A;  2L02 A;  2H6C A;  3HHH A;  4U88 A;  2XV4 S;  1T39 A;  1W5T A;  2FF4 A;  3R0J A;  3TOA A;  4B8X A;  4A0Y A;  4BHP A;  2JPB A;  3ECH A;  5ICC A;  1G3Y A;  4HDU A;  1GVJ A;  3LFK A;  5D5W B;  4LLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...