2DPUA

Crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer b-site dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(P*AP*TP*GP*TP*TP*CP*AP*TP*AP*G)-3'
publication title Crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer B-site DNA
rcsb
source organism Bacillus subtilis
total genus 31
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dpuA00
2EJRA 3V7CA 1K6OA 3I59A 2FF4A 3FM5A 1G3SA 2OZ6A 1WRJA 1QPMA 3I64A 2XV4S 2F5CA 4LLGF 2Y48A 4AD9A 2XUBA 2WTEA 4CYDA 3FXQA 5A2QZ 1YFHA 1LJ9A 2KRFA 2M87A 4ENKA 3FXRA 3TOBA 4HV5A 3RIRA 5HDGA 3LAJA 3V4GA 2W84A 3K9TA 4M6XA 4HX8A 4I02A 2K4JA 1XGSA 5HS8A 2H09A 4XBFA 1SD4A 2EFPA 2ZCWA 2D1HA 1B1BA 2DW4A 3F8NA 3HRTA 3KCCA 3PFIA 4MTEA 1H9TA 1TNTA 1YO5C 2MBFA 4HBLA 5AIPA 3BDDA 5E1ZB 2MH2A 3F22A 1O3QA 1GVJA 5JVTA 4XLPF 4BHBA 3ZMZA 4HF2A 1ODDA 2IA0A 3EYIA 2HQNA 4EMSA 5H20A 3R6SA 3JW4A 2M5WA 2ZNZA 2R7FA 1HKQA 5D8KB 2IRFG 4G9YA 4L0ZB 1ZG1A 2MC3A 2FRHA 1XDUA 3GZ5A 4RAYA 4XSXF 1BN5A 1E17A 1XD7A 3V7SA 3WGHA 4E70A 1IRGA 4WXHA 2Y75A 2PFBA 2Z99A 1H9GA 1ZREA 4A0YA 1H0MA 3M1EA 3BP8A 3T1BA 3RPQA 4I98B 3V8LA 2HKOA 4KUMA 2XAQA 4EM1A 1UB9A 4HOBA 2GXBA 3JTGA 1KYZA 5CVIA 2L01A 3R61A 5LRSA 3D5LA 1IN8A 3SZTA 2VN2A 1QQIA 3HRMA 3LQQA 3HSEA 2YR2A 2EV0A 2F5EA 5FB2A 4AWXB 1TW3A 3WTYC 3F8CA 1LB2A 4UNOA 1KU9A 5ERIA 3I53A 3F23A 1MJ9A 3O6BB 2JZYA 1LDKB 3ULQB 1ZRDA 3TO9A 3WU1B 4LMYA 2V1UA 3HRUA 4CO8A 1TQIA 4HLYA 4RAZA 2QQAA 3B02A 2V6CA 2VOPA 3JTHA 4CXFA 1W4MA 1B9MA 1KQ0A 3F72A 3KP2A 1BI1A 2P5KA 1P92A 1GHCA 3C18A 2NS0A 3E5XA 2G7HA 2HYGD 2XHKA 2LSOA 3I58A 2E1CA 5DCMA 4ETSA 2IW5A 5LRRA 3Q9VA 1Z1DA 1XDSA 5KK1A 4DQ2A 2FNPA 1DPRA 3V8KA 1NHAA 3QAHA 4M9ZA 4YFNF 4IHTA 1BM9A 5D8LB 2ZFWA 5LEKA 2O03A 2O6GE 2CW0F 3BZ6A 2LKPA 1BBYA 4CICA 4N0BA 3SHFA 5L3FA 4MTDA 2G9WA 1ZGJA 4MNUA 3F8FA 3P9CA 4KA4A 1YG2A 2MLKA 3BY6A 1R1TA 1EV7A 2QWWA 4BXUA 2ZKZA 2J5PA 3ZN0A 1TNSA 1RI7A 2XAFA 2XIGA 4DNCA 5JFRA 1OYYA 2UWMA 1B59A 2X0LA 3O2PE 1MDMA 2IP2A 3MZYA 2QLZA 3IHUA 1S3JA 3IL2A 5FGMA 3FMSA 3FMRA 3CO7C 5BPDA 5IT9K 3MCZA 4M71A 3H3UA 1G3TA 4HF0A 1IF1A 1QBJA 5LGUA 2W85A 2OU2A 5AONA 1XMAA 1SFXA 4N9HA 1SD5A 3GWZA 1KU2A 4P96A 4U7BA 4HZFA 4ENJA 3FHZA 1L0OC 2DLLA 1ULYA 2Z9OA 1U5TB 1MJBA 2JPCA 3Q5FA 1BI3A 1YLFA 4IRGA 1USTA 1FY7A 2ISZA 4O3MA 1F5TA 3K69A 3T8RA 4RB3C 2HQRA 2RGVA 4EJTA 4ON0A 4LB6B 4BYYA 5AIQA 5IT3A 2A3SA 4RGXA 3KP3A 4BHPA 1YTYA 4R1HA 4NQWA 1XN7A 4A2UA 1U5TC 1ON1A 1QO0D 1YIOA 4ENNA 2K4BA 1T39A 6PAXA 4ZYDA 2HWVA 4CHUA 2BV6A 3N97A 1JXSA 3PQJA 3ERED 4G6DA 3CTAA 5DV5A 1Y0UA 2HDCA 5K5QA 3CUQB 2VT2A 4AIHA 1IXSB 1BI2A 2UXNA 1FWZA 4R8HA 2JT1A 3TDZC 1OYIA 4F7ZA 2W57A 2VOOA 4M9XA 2DQRA 3HYIA 1O3TA 3CUQA 2ACJA 3N4MA 5FFXA 2L02A 1STZA 1K79A 3SQNA 2MA3A 1QZZA 2EK5A 4Q5SF 2HTJA 4PZJA 1O7LA 3DPLC 2P6TA 2QVOA 3GEZA 2Q2EA 2RV8A 4L5IA 1MKMA 4P9UA 1YW7A 2MLGA 4A6DA 2W24A 3ECHA 2A68F 1J7KA 1S6LA 1PDNC 4UUVA 1EH8A 3T8TA 3FX3A 2XGXA 5HLHA 1O3SA 4ZZDA 4KMFA 4K2EA 4MEYF 3WTUC 1SAXA 1ZYRF 2H6CA 4KFCA 5LHGA 4IPAA 3DXJF 2QUFA 5D4SA 2BGCA 3M8FA 4HX7A 1TLHB 3KLOA 3NEUA 4YIFA 1IN5A 1IRFA 2HTSA 4IJAA 2EFNA 1YW9A 3O3KA 2K86A 3CLOA 3IWFA 3LA3A 1G3WA 2EA4A 4LD5A 3BJAA 3QU3A 3E97A 3WTXC 4WXCA 2GWRA 4A12A 3RJPA 2EB7A 3HUGA 4UV9A 4G7HF 1FP2A 3F3XA 2PMHA 3LWFA 3FMQA 4B09A 3H3ZA 2Q0OA 2YSRA 3VB2A 1Z9CA 1D5VA 1T38A 1W7PD 4G7ZF 5ICEA 2JSCA 1Z6TA 4KIFA 2OD5A 4KYWA 1JE8A 2WWYA 5LLQA 3TGNA 2GQQA 2PEXA 3DP7A 3IC7A 3JAMK 1FP1D 1WKMA 5DDGA 2VBWA 1U2WA 3QU6A 1LEBA 3DV8A 3RKYA 4CGZA 1WSUA 2HS5A 2YX4A 3MWMA 1D8JA 4ZYEA 1HBXG 2QYOA 3R0JA 1O57A 5HS9A 3G73A 1Z05A 2GZWA 1HW1A 4HA8A 1XGMA 1XB4A 3SXYA 2BYVE 3J81Z 3IKVA 2COMA 2HOEA 1FYKA 3L7WA 1QZYA 4M9SA 5BOXA 1XMKA 1RUNA 1HKTA 2QENA 3MEXA 4CZZA 1W7PB 1TBXA 4IVNA 1HKSA 3KEQA 4WXDA 4U88A 4WX9A 2VBYA 2NNNA 3DKWA 5L3GA 3KZYA 3GVAA 4BQAA 2ELHA 2EA2A 2A69F 1E2XA 1F4KA 3OOPA 1F1ZA 3E5QA 5EEHA 2XAGA 2OQRA 4L9NA 2ZO4A 4MQVA 5CVJA 2PG4A 1SMYF 2F5DA 2GXGA 1GXQA 4I7HA 4RB0A 2HEOA 2UXXA 2DPUA 4KNYA 2D2WA 1DUXC 3FF5A 2QBYB 2WC2A 4FX4A 4IXAA 2CQKA 1ZH5A 3M7GA 4RGRA 4U0YA 4FHTA 4JQFA 2XROA 3HOTA 2RDPA 5FFZA 4WK8F 4P5OA 1SFUA 4RB2C 2QBYA 4RB1A 3WTTC 1WWXA 4M72A 1IUYA 1PP8F 2DPDA 1XSDA 3AAFA 1SMTA 3IRRA 5HDKA 4S05A 4EM0B 2NYXA 4YG2F 4LK0F 4ZZLA 1S29A 5HLGA 3KP6A 2Q8KA 2Z33A 4EGYA 1LVAA 5JHUA 2VE8A 2K7LA 3EQLF 2IVMA 2IT0A 2ZMEB 4U0VA 3PQKA 4P55A 4I01A 4M74A 4M73A 4OOIA 4HV6A 1C0WA 3T5XA 2HYFA 4A0ZA 3DPTA 3HHGA 1HSTA 2CYYA 3M8EA 2AXLA 2P4WA 3ABUA 1R58A 4OIRF 5K1YA 1P4XA 3HSRA 1R00A 3GF2A 2F2EA 2CGPA 1HQCA 1IN7A 1FLIA 1T6SA 2RKHA 2GIVA 2VE9A 5LHIA 2YPRA 3E6MA 2UZKA 3VODA 1J5YA 1TTYA 2HR3A 4PCQA 3RI4A 3K1NA 2FXAA 4OIPF 2EWNA 3QP6A 3KFWX 5CLSA 3CJNA 1J0RA 3GLXA 3P7NA 4FX0A 2A07F 2DBBA 1SFEA 4EVIA 5D6FA 2O3FA 4UXNA 3K2ZA 5HDNA 2QZ8A 2ZBKA 4PDKA 3RTRA 4I0BA 3FWEA 1IXCA 3I4PA 4EJOA 1PUEE 2P5VA 1CGPA 2H6BA 3WG9A 5E8GA 5CVUA 4M6YA 2FSWA 1IN6A 5E1XA 4OMZA 3ECOA 4HAMA 3GFMA 5J8CA 2B0LA 1IW7F 1CF7B 5L3CA 2OAZA 2DFIA 4KT5C 3TOAA 1QNTA 3GUDA 2JPBA 1T0FA 5E1WA 1AOYA 4B8XA 1ZRCA 1LDDA 2R3SA 4A0XA 1U5TA 4GGGA 1J9IA 3RYRA 1CF7A 2EFOA 5HVQC 4NHJA 1FYMA 4U0WA 3F8MA 2VODA 4BNCA 4HYEA 2DTRA 3E6DA 3I5UA 5KVRA 1U8RA 3MQ0A 3G3ZA 4D0PA 1ZHFA 4HQEA 3GO5A 1IAWA 3LFKA 2XAHA 3GW2A 3WODF 3ZPLA 4TV7A 2L4AA 1LDJA 5L3DA 1KQ8A 3BOQA 1FC3A 5ILUA 2STWA 2A6EF 4LG0B 3J80K 4HDUA 1J2XA 2PBIA 5FLXK 2J5OA 4KN7X 2FA5A 1YS6A 2RVCA 2L3DA 2PN6A 2NRAC 2VT3A 4QWQA 4L18B 1FSHA 1HSJA 1I27A 1MGTA 1WQ2A 2XAJA 5HOOA 3E6BA 1FPQA 4LG0A 5FD5A 2E1NA 3V7RA 1KGSA 3I71A 2VBXA 4Y17A 2OA4A 4MEXF 3EUHA 4YFKF 2CSOA 5CVRA 4I2OA 5A2QK 2FMLA 5H6RA 2BE5F 4HF1A 5IT9Z 4BHCA 1U3EM 3WTSC 2DI3A 1RZ4A 2M1BA 1KU7A 4GXOA 4KIGA 5J8FA 2KIFA 2L54A 4YFXF 4UHTA 5DCFA 3GXOA 1S7OA 3L9FA 2DQLA 3SFZA 3ZQ7A 2VC1A 2HKXA 1OR7A 1Z91A 5BS6A 5DD8A 5HS7A 3R60A 1JGSA 2PLYA 3VFZA 3GFIA 3E3VA 4R79A 3W6KB 3KETA 2GA1A 1UHWA 2VC0A 3D0SA 5EEGA 2Y0MA 1BOAA 3R4KA 3KE2A 3ROUA 1RIOH 2CO5A 2WV0A 4ESFA 1R7JA 2RQPA 4N9IA 1XGNA 5FO5A 3HRSA 5FD6A 4GYIA 2XASA 2A5YB 4ZYGA 1ZG5A 1Z6RA 2V1DA 3WTVC 4EJWA 2A61A 2OBPA 3L00A 5CVVA 2IA2A 2GA2A 2V79A 1XSVA 2LNBA 3ML6A 1DPUA 3NRVA 2ZJ2A 1XCVA 1QGPA 4WF2A 2FEZA 4RGUA 4P9FA 4AIKA 4AIJA 5FLXZ 1MJAA 1FBUA 2IJLA 1GXPA 1J59A 4LGWA 4EJVA 3M9AA 1KA8A 1R5HA 2K27A 2JTVA 2DT5A 1R22A 3BROA 1K78B 3ZP5A 3CUOA 4ESJA 1U6GA 3WGGA 3BPVA 1EH7A 1HW2A 1ZRFA 1G6NA 5CJ9A 1FT9A 5LHHA 1S7AA 3LA7A 4UVBA 1L3LA 1LQ1A 3ZMUA 1K78A 5DYMA 4EV0A 3RKXA 2FE3A 1MD0A 1UFMA 4KIBA 5H6QA 2DO7A 5BQTA 1P4AA 4EQQA 4HQMA 3HTSB 1XCBA 3S2WA 5J6XA 1SD6A 2XKOA 3RDIA 5E18F 2ESNA 5HLIA 4LLNA 3KEOA 3ZMSA 4HDVA 4KN4X 4L9VA 4LB5A 2CFXA 3KZZA 2M8EA 2FBHA 3OV8A 3EETA 3W6JB 2KJCA 2Z3YA 5JR3A 3L2CA 5BPIA 4EGZA 3EDPA 5TRDA 5D5UB 1A04A 1I5ZA 2M30A 1W7PA 2G7UA 3HHHA 4IF4A 4EM2A 3DEUA 4GCVA 3U2RA 3IRQA 2OQGA 3QPHA 4MGRA 3JSOA 1IN4A 2ADUA 2BEOA 2M45A 4OIQF 2KJBA 3FM3A 4G94A 1T98A 2ZXJA 2D1VA 5ED4A 3WTWC 3DQVC 3F6VA 2XRNA 4Q4ZF 1OMIA 4I09A 3VEPA 2DU9A 2VXZA 4WWCA 5L3EA 1IXRC 2W25A 3VOEA 4FT8A 3T0YA 3ELKA 2LF8A 4PGHA 3RKWA 3KP4A 1I1GA 4Z2YA 2RNJA 4IHSA 3ZMVA 2Z5UA 4ESBA 4MHGA 1R23A 2QQBA 2TDXA 3BWGA 3KP7A 3I54A 1FBQA 2A6HF 2FOKA 5DUKA 1FSEA 5LGNA 2HGCA 1R5GA 2FU4A 3GZ6A 1V3FA 1TQPA 1YQAA 4EJUA 5D4RA 1JHHA 1LNWA 1YS7A 3EYYA 3JAMZ 3QOPA 4YIIA 4JK1X 2P6SA 3FXUA 4LLLA 1B4AA 4XLNF 3GFJA 2P7CB 5ICCA 2HFHA 4A6EA 3DFGA 3QRFF 1ZLKA 1BC7C 3FZVA 3SZPA 3ISPA 2EV5A 3QPTA 5F1RA 5F6FA 4H0EA 1AWCA 1HW5A 2D45A 3HSFA 1VTNC 5DCMB 4L5JA 2XVCA 3K1MA 4HX4A 4PGGA 1P6RA 2EFQA 1FNNA 2ZMEA 1REPC 1FZPB 3K0LA 2EV6A 1FBSA 2FMYA 2JRTA 1MZBA 2V1XA 5LGTA 5DD4A 4ZH4F 5JI6A 3RPUA 1U78A 3HTUA 2ISYA 3L09A 3CDHA 4OU0A 4Y15A 2QQ9A 1KQ9A 1HXDA 4O6JA 4U7DA 1V4RA 4L0YB 3BJ6A 2AS5F 3E6CC 4L9TA 1W5SA 2FBIA 2GAUA 1FOKA 1G3YA 1OYWA 4KDPA 4GYGA 3P9KA 2P5LC 5DUIA 2MH9A 1S8NA 2QM3A 1MDMB 3LA2A 3U9GA 3TDUC 3B73A 3NQOA 1TW2A 2DK8A 3C1DA 3ZN1A 1I6XA 3REOA 3ZMDA 1FX7A 4Y13A 5D5WB 3LSTA 3JSPA 2O0YA 4JBAA 1ZGAA 2KIUA 3HIFA 4ZYHA 3TKYA 4LJZF 2IPQX 3R0AA 2FNAA 2YU3A 1J75A 2C6YA 5DEQA 4WCGA 1IZ1A 3GX4X 2VBZA 1YW8A 4GO1A 3GYHX 2PI0A 2FQ3A 1BIAA 2PQ8A 2L4MA 1ZG3A 2MD5A 4RS8A 1O7FA 2DAOA 2E7XA 5ICFA 1K7AA 3IWZA 2DK5A 3ZMTA 2X4HA 2ESHA 3WE3A 2RN7A 2P7VB 3P9IA 2V9VA 3CO6C 1ON2A 3KP5A 4RGSA 1B6AA 3LQRA 1R1UA 3WU0A 2BBYA 4LK1F 4CDGA 4Q48A 4KICA 2NNYA 1JHFA 4G6QA 1KYWA 5ILVA 2F5FA 1SD7A 5LBQA 1P4WA 5K5OA 3MZHA 1BJAA 4G8XA 4ENMA 3F6OA 1UHMA 3MAJA 2E7WA 4S04A 4XRFA 3F8BA 1ZN2A 2VONA 2EFWA 1EH6A 3TO7A 1FYLA 2HZTA 4BAYA 4OINF 1T2KA 1D3YA 5TJJA 1RNLA 1OKRA 1DDNA 3IKTA 1X3UA 2PMUA 2LF7A 1XSXA 2R7DA 2P8TA 3WTZA 1PP7U 4I0AA 2ZNYA 1BI0A 1ZARA 2FBKA 2IA1A 2RC4A 2O8XA 4KMUX 3QP5A 3K1PA 3V8JA 2CWEA 4IRIA 2STTA 3J7AO 4UVAA 4HLXA 1Q1HA 4MQ9F 2KKOA 2O61A 2LDUA 5BMZA 1BC8C 1BIBA 5ILSA 5L3BA 5E17F 4BH9A 1ZAOA 3F21A 5D6EA 1R1VA 3CUQC 1KU3A 3HOSA 5D5VB 5ICGA 4IRHA 3TO6A 1YYVA 3H92A 4O5VA 4LFUA 5K5RA 1O3RA 2YX7A 3ABTA 4UV8A 4Q47A 1XGOA 1ONVA 3C7JA 3MFKA 2OZUA 4XSZF 3TQNA 3J81K 5E8IA 1D8KA 4G7OF 1UCRA 2H94A 4UVCA 5LEJA 4NB5A 5CYVA 2NAZA 2K02A 1OPCA 3RYPA 3WGIA 3Q9SA 1DP7P 1B9NA 1LEAA 2KIMA 3BJOA 3DF8A 4QLCU 3GFLA 1G4DA 3LAPA 3C3WA 5D5XB 4L9JA 3KLNA 4OIOF 1ZLJA 1F9NA 3BPXA 3U1DA 2PJPA 3COAC 1Z7UA 3WE2A 3E5UA 2CG4A 5E20A 4OMYA 4HW0A 1USSA 1TQMA 4A5MA 3I59B 2H27A 3I0TA 4AVPA 4ASNA 1RUOA 1P2FA 2XKPA 5F64A 2ETHA 3J80Z 1W5TA 4A5NA 1WI9A 1I1SA 1R36A
chains in the Genus database with same CATH superfamily
2EJRA 2XDVA 3VYTB 3P5JA 3CP8A 1UG0A 3V7CA 1K6OA 3I59A 2FF4A 3FM5A 1UG2A 2R7XA 1G3SA 4Y4RA 3RQ4A 1TP4A 4ITVA 3DLAA 1RKTA 4XN0A 1MNMC 2DA5A 3VDXA 3ZPLA 3NWSA 2OZ6A 2X9DA 1WRJA 3WHCA 2NVQJ 5E79C 1QPMA 3I64A 2XV4S 2F5CA 2O5RA 3WG7H 1LFPA 3K4CA 3ZRGA 4LLGF 2Y48A 4AD9A 1NH3A 2LMDA 2XUBA 1VQNI 4A3MJ 1NTCA 2WTEA 4CYDA 3FXQA 5A2QZ 1QU3A 1YFHA 1LJ9A 4FCYA 4A3IJ 2KRFA 2M87A 4ENKA 3LSHA 2BHZA 4BBSJ 4D7MA 4BQNA 3FXRA 3TOBA 2KT0A 4HV5A 3RIRA 3B6AA 1QRYA 3MKLA 5HDGA 3LAJA 3PFYA 1Y0NA 3KYCB 3V4GA 2W84A 3K9TA 4M6XA 2IS4A 4HX8A 1J09A 2XGEA 4I02A 2K4JA 1N75A 1XGSA 3LSMA 5HS8A 5J1UA 2H09A 2A6TA 4XBFA 1SD4A 2EFPA 2ZCWA 3J7AY 4BL0B 2D1HA 1Z3YA 2AHQA 1B1BA 3CCVI 4IOAF 1GDTA 2ID3A 2DW4A 4D9JA 1JGGA 3F8NA 3HRTA 3KCCA 3PFIA 4MTEA 2DYSH 1H9TA 1TNTA 1YO5C 2NVYJ 5EJCA 1ENHA 5IOZA 2MBFA 3ZOBA 4HBLA 5AIPA 3BDDA 5E1ZB 4C30A 2MH2A 2V9PA 3F22A 3PNVA 3H5NA 1O3QA 4X1EA 1GVJA 5JVTA 2WY7Q 4D7NA 2TRTA 4XLPF 4BHBA 3AG1H 3ZMZA 1ODDA 4BJ6C 4HF2A 1VF9A 2JJ7A 4E7SA 1JKOC 3Q0WA 2IA0A 1WI3A 3EYIA 2MD0A 2HQNA 2YS9A 4EMSA 5H20A 3R6SA 2VI6A 4XKBA 3KPHA 5FKKA 3JW4A 2M5WA 2JSPA 2ZNZA 2R7FA 4QPOA 1HKQA 1W5CC 5D8KB 4OAYA 4UB8C 2IRFG 3HBLA 4G9YA 4L0ZB 3Q3SA 1ZG1A 2MC3A 2CV2A 2CV0A 1A31A 2FRHA 1XDUA 3GZ5A 4RAYA 4XSXF 1BN5A 1E17A 4HG2A 1XD7A 3V7SA 3WGHA 4E70A 1T95A 5B1BH 4NNJA 1IRGA 4NC6A 1YRNA 3K4KA 4WXHA 1DU0A 2Y75A 3GTMJ 2PFBA 2Z99A 1H9GA 3QQAA 4A0YA 1ZREA 4YIRX 1H0MA 3M1EA 3BP8A 2CUZA 3RZOJ 1LVKA 3T1BA 3GTQJ 3RPQA 4I98B 3V8LA 2HKOA 4XOTA 4C3IJ 4KUMA 2X48A 5FKMA 2XAQA 4YRVA 4E7IA 4EM1A 1UB9A 2BHYA 1XG1A 4HOBA 2GXBA 3JTGA 3M1CA 1FIPA 1R4MB 2L9VA 3OY9A 1KYZA 5CVIA 2L01A 3R61A 1YOVB 1Y56A 5LRSA 2DODA 3D5LA 5FLVA 1IN8A 2BXZA 3SZTA 3HB9A 4GFBA 2VN2A 1QQIA 2DOAA 4HSRA 3HRMA 3LQQA 4BXXJ 5E3NA 5FROA 3HSEA 2JVGA 3ZQLA 4NC8A 2DFFA 2YR2A 3HJEA 2EV0A 4W97A 2F5EA 3LSGA 5FB2A 4AWXB 3DCFA 5B3SH 5C44J 1TW3A 3WTYC 1EF4A 3MZ8A 2MC4A 4C3HJ 3F8CA 1LB2A 1NK3P 2M2EA 4UNOA 1UHSA 3K4LA 1GV5A 2L7MP 1IRZA 1KU9A 2DTZA 5ERIA 3DBLB 3I53A 1VFCA 3F23A 1PUFA 2ZJPF 1MJ9A 3O6BB 2JZYA 4DYRA 4B44A 4F3QA 1LDKB 2DFEA 3ULQB 1WGXA 1ZRDA 1MBHA 5IP6A 4BS9A 3TL4X 3TO9A 5GTHC 3WU1B 1TWAJ 4LMYA 1ETOA 2V1UA 3HRUA 4CO8A 1TQIA 3H35A 4HLYA 4RAZA 2QQAA 3B02A 2V6CA 4PSWA 2VOPA 1X3ZB 3JTHA 4OAZA 4CXFA 1W4MA 1B9MA 1KQ0A 3F72A 4A3KJ 4BE2A 3OYEA 4B3XA 3KP2A 5DM7F 5J1RA 1BI1A 4PJJA 2P5KA 2F5VA 3OS0A 1AKHA 3HOYJ 1P92A 2EZLA 3BR0A 1GHCA 2H1KA 3C18A 2NS0A 3E5XA 2G7HA 2HYGD 2XHKA 2LSOA 3I58A 3IH2A 5FRMA 3C2GA 4BDYA 1MSFC 3AG3H 2E1CA 5DM6F 5EGOB 3S1RJ 1D0ZA 3DKYA 5DCMA 4ETSA 2IW5A 5LRRA 3Q9VA 1Z1DA 1HDDC 1XDSA 1FMVA 3QWLA 5KK1A 5IYDJ 2ECCA 4DQ2A 5CQEA 2LOOA 4LIUA 1U9NA 1IV6A 1EJ9A 1VQ6I 1JT6A 2WB1N 2FNPA 2JA6J 1DPRA 1OFCX 3V8KA 2R7WA 3JRCA 3ERMA 1NHAA 2EIMH 1VZ0A 3QAHA 3ABKH 4M9ZA 1H8AC 4YFNF 4GDFA 3JREA 4IHTA 2KMUA 3DBHB 1BM9A 1UZCA 5EGOA 2L9NA 2M4KA 2G0EA 2X6OA 2ZFWA 5D8LB 5C4XJ 1CQTA 5LEKA 4XRMA 2E1MC 2O03A 4JX4A 3O8HA 3JRIA 2O6GE 3ABLH 2CW0F 3OWTA 2KIQA 2VQHA 3C2BA 3BZ6A 1POGA 3IV5A 2DA6A 2MFZA 2LKPA 1BBYA 4CICA 2XC7A 2XRLA 4N0BA 5EYRA 3SHFA 5L3FA 4MTDA 2G9WA 1ZGJA 4MNUA 4EEFG 3F8FA 3P9CA 4KA4A 1YG2A 2MLKA 2P0WA 3BY6A 3CZ6A 1R1TA 2QSGX 1EV7A 1MSEC 2QWWA 3GLLA 3DU5A 4BXUA 1FTZA 2DOEA 2ZKZA 2J5PA 2HPMA 3ZN0A 1TNSA 1RI7A 2GOMA 4P1WA 2XAFA 2XIGA 2K9SA 4DNCA 2XSJC 3C2HA 1OYYA 5JFRA 2UWMA 1B59A 3I3LA 2X0LA 3CCSI 3O2PE 2R5ZA 1MDMA 1GLNA 3PNYA 4CCJA 2IP2A 3L2UA 3MZYA 2CS3A 2QLZA 2EZIA 4E7ZA 2JMWA 1S3JA 1XMXA 3IHUA 4UUSB 3IL2A 4IOCF 1K4SA 3B6CA 1BA5A 5FGMA 4N4NB 3FXOA 3FMSA 3FMRA 3BT9A 3CO7C 5BPDA 5IT9K 3MCZA 3FXJA 2LVSA 2LRDA 2HOTA 2ZJRF 4A3EJ 1A6QA 4II3A 4LG3A 2LYCA 1WCMJ 1YHQI 3DWLE 3FXLA 1Y8QB 4M71A 5F0HA 3H3UA 1G3TA 2I8DA 4HF0A 1IF1A 1QBJA 3DU6A 5LGUA 3GTOJ 2CW8A 2W85A 1D1CA 2OU2A 3M8JA 2GOXB 5AONA 1XMAA 4XRSA 1SFXA 2CW7A 2GIZA 3BLYA 2DA3A 1BW5A 4N9HA 1SD5A 3GWZA 3A1YA 1KU2A 4P96A 1MMGA 5GPCA 4U7BA 3W6VA 2F48A 4HZFA 4QTRA 4ENJA 5F0FA 3FHZA 1L0OC 4XM3A 1D1AA 2DLLA 1ULYA 1FOYA 2Z9OA 1U5TB 1MJBA 3FBNB 1PVEA 2JPCA 3Q5FA 2MYSA 1BI3A 3H9JA 1MNDA 1YLFA 4IRGA 3ESWB 1USTA 1FY7A 2ISZA 4O3MA 4PJNA 1F5TA 3QYFA 1OQYA 3K69A 4Y3OA 3T8RA 4RB3C 1FMWA 2E60A 3CMAI 2HQRA 2RGVA 4EJTA 2QKMB 5GAEJ 4ON0A 1IJWC 4UB6C 2LREA 4LB6B 3QOEA 4D5FA 4F91B 4BYYA 5AIQA 3FK7A 5IT3A 1W36D 1OISA 2A3SA 1FOWA 4RGXA 3KP3A 4M3FA 4BHPA 1YTYA 4R1HA 2HQ5A 4NQWA 1XN7A 4A2UA 1LUJB 1U5TC 1A35A 1ON1A 2QA4I 1QO0D 4IQ4A 1YIOA 1ITYA 4E6KG 4ENNA 3IAM2 2K4BA 3FDYA 1VQPI 1T39A 6PAXA 4ZYDA 2BY2A 1MMAA 4BBRJ 4HNTA 2HWVA 2EPFA 4RA2A 1N77A 1GT0C 2HDWA 2Y9ZA 4CHUA 3BG3A 2BV6A 4PUSA 3HOXJ 3JRFA 4XICA 3CDIA 3N97A 1JXSA 1E0EA 3PQJA 3VYSB 1OCCH 3ERED 3O8GA 4G6DA 4M6VA 3CTAA 5DV5A 1Y0UA 2HDCA 4CYCB 5M5WJ 3M4OJ 3CP2A 5K5QA 3CUQB 2VT2A 3LSPA 1ZR4A 3D5RC 4AIHA 1T56A 4Y52J 1IXSB 1BI2A 4BEHA 2UXNA 1FWZA 4C2MJ 1UELB 4II2A 4R8HA 2JT1A 2LC2A 3TDZC 2HVQA 1OYIA 3UKGA 1LPQA 4F7ZA 3BTIA 1Y8RB 2W57A 2LK2A 5J47A 2VOOA 4M9XA 2DQRA 3HYIA 1O3TA 3CUQA 3NAUA 2ACJA 3MD2A 2NXNB 3N4MA 4IO9F 5FFXA 2JUCA 4AUXA 4C9YA 4CCKA 1BR4A 2L02A 2Q2EB 1JTXA 2NS7A 1STZA 4M3DA 1K79A 1TWCJ 3SQNA 2MA3A 3K4NA 4FISA 1QZZA 3ONQA 3VYUB 5M3MJ 2EK5A 3EUHC 2HVRA 4Q5SF 2HTJA 4PZJA 3OYNA 2OF7A 2KZGA 1O7LA 3DPLC 2P6TA 5M3FJ 2L7KA 1TT0A 2QVOA 3K10A 3GEZA 2Q2EA 2RV8A 4L5IA 5JLXA 3MKYB 1MKMA 4P9UA 2M4GA 1YW7A 1TT5B 4KITB 1R36A 2MLGA 2RNGA 3BC8A 2W24A 4A6DA 3ECHA 2A68F 1J7KA 1S6LA 2KDOA 1DQUA 1PDNC 3ASOH 4UUVA 1EH8A 1W0TA 3T8TA 4JYKA 1MNEA 1MBGA 2LKSA 3FX3A 2H1LA 1S9HA 2XGXA 2CUFA 4JX6A 3BQYA 5M5YJ 1UJ8A 5HLHA 2MSYA 1O3SA 3JRGA 4ZZDA 4KMFA 2XF7A 4K2EA 4MEYF 3WTUC 1SAXA 2O9LA 4MIMA 1ZYRF 1G59A 2H6CA 2L9SA 4KFCA 5LHGA 1ERDA 4IPAA 4LIVA 2CUJA 3DXJF 4CCLA 2QUFA 1HA8A 5D4SA 1UMQA 2BY1A 1JT0A 2BGCA 4AIDA 1OR7C 3M8FA 4HX7A 4E4HA 1TLHB 3KLOA 3OYDA 1WJBA 3K70C 3NEUA 4YIFA 1IN5A 3W2VA 1IRFA 2HTSA 1WVRA 2QSHX 4IJAA 5KNLA 2AQEA 2EFNA 3S15J 3H9GA 3HGGA 3HUGB 3ASNH 1YW9A 3O3KA 1E3OC 2K86A 3CLOA 4ZDLA 2OTLI 1OCRH 3IWFA 1RRJA 4DIQA 3LA3A 2DMUA 3KEYA 2A5WA 2LKXA 4A3BJ 2VJJA 1G3WA 2EA4A 4LD5A 4J00A 2KRCA 3BJAA 2VJ5A 3QU3A 3E97A 3WTXC 3JCUC 1MBFA 1X2NA 5EZGA 4WXCA 4DW6A 1UAAA 2GWRA 3ZQQA 4A12A 3VSKA 2DFHA 2UV1A 2VQGA 3RJPA 1HC8A 1K61A 4MFEA 2DT6A 2EB7A 3CCRI 3HUGA 4UV9A 1Z0XA 4G7HF 1FP2A 3F3XA 2PMHA 2Y9YA 3LWFA 3FMQA 2KZVA 2Y0SA 4B09A 3H3ZA 2Q0OA 2YSRA 3CC4I 3VB2A 1P7IA 3NWTA 4BJTA 1Z9CA 3S2DJ 1D5VA 4A3LJ 1T38A 1AHDP 1W7PD 3A02A 4G7ZF 4Z6YA 4DGWB 2EINH 5ICEA 4BY7J 3RZDJ 3PO3J 4HNVA 2JSCA 3OSFA 3HGYA 1Z6TA 4KIFA 3OL4A 2BY0A 2A05A 3FK6A 1VQMI 2OD5A 3DPUA 4KYWA 1AA7A 2M9HA 3PM1A 5FKLA 2EIJH 2WWYA 1JE8A 5LLQA 3TGNA 5F0CA 4MFDA 2GQQA 2PEXA 2VJIA 3DP7A 3IC7A 3HPHA 3JAMK 2ZJQF 3S1QJ 1FP1D 1WKMA 1OCTC 1VQ5I 3TP0A 2JK3A 4XLCA 5DDGA 3OYLA 1PYVA 1ETXA 3DTKA 2VBWA 1U2WA 4HRIA 3QU6A 3SFIA 1LEBA 3DV8A 3RKYA 2CJJA 2Y2ZA 4CGZA 3ZQHA 1S7EA 2KISA 1WSUA 4BDZA 2DN0A 1ZKGA 5BNGA 1K83J 2HS5A 1QHGA 2YX4A 3MWMA 1D8JA 4ZYEA 1HBXG 2QYOA 3R0JA 3BR5A 1O57A 5HS9A 3G73A 1G2HA 1Z05A 2GZWA 1HW1A 4IL6C 1X1CA 4HA8A 1N78A 1XGMA 1XB4A 3SXYA 1I3QJ 4BQQA 1MMDA 2BYVE 3J81Z 1XX5A 2EQRA 3IKVA 2E2HJ 2OC6A 2E2JJ 2COMA 1WJDA 2CFOA 2HOEA 3MMYB 1FYKA 3L7WA 1QZYA 1P7JA 4M9SA 2E36A 2XB0X 5BOXA 1XMKA 1MMSA 3KYDB 1RUNA 1HKTA 1X4OA 3OYHA 2NOJB 2QENA 3MEXA 4C3JJ 4EATA 4CZZA 1W7PB 1TBXA 4DZJA 2ZSIB 4IVNA 1HKSA 1D0YA 2JQ7A 3KEQA 3QODA 2K3FA 1T08B 1ETQA 2X85A 4WXDA 4A93J 2Y31A 2DMNA 2LR8A 4U88A 3GMEA 4WX9A 4CA0A 2M7BA 2VBYA 2HU9A 4D1QA 5HODA 2ICWG 3GTKJ 2NNNA 2N8GA 3PUBA 3DKWA 5L3GA 3KZYA 3GVAA 2R92J 1B8IB 4BQAA 2JN6A 2ELHA 2EA2A 4FE7A 2CMPA 1WH7A 4BE1A 2X6YA 2A69F 1E2XA 3HOWJ 1X1DA 4CZCA 3MVPA 3ZCOA 1K4TA 1F4KA 3A0HC 3PIPF 2HVSA 4MO7A 1WHUA 2DCEA 3OOPA 5FKOA 3SEZA 1F1ZA 3E5QA 3OYJA 5EEHA 1B8IA 1HCRA 1GVDA 1T8IA 2XAGA 2OQRA 4L9NA 2ZB9A 2ZO4A 1ZGWA 4FE4A 2MG4A 4MQVA 5CVJA 3JRDA 2PG4A 4XL9A 1SMYF 2IGNA 2ZXHA 1YJNI 3CQZJ 2F5DA 2ECBA 2GXGA 3K4MA 1GXQA 2OUMA 4I7HA 4RB0A 2HEOA 1VI0A 2UXXA 3G71I 2DPUA 5J4VA 2ZXIA 4KNYA 2D2WA 4DZPA 1DUXC 3PO2J 3FF5A 2QBYB 3IH3A 2WC2A 3OR1C 2LH9A 1RR7A 1SC7A 1I39A 1IC8A 1D0XA 2NVXJ 2M0MA 4B1RA 4FX4A 3H36A 2KL4A 4IXAA 2KPMA 2CQKA 2ZC2A 1V5FA 1ZH5A 3BG6A 3M7GA 2X51A 3SJMA 3H9QA 1RPWA 2HDDA 3ABMH 4RGRA 4DYCA 4U0YA 4FHTA 3L2RA 4JQFA 2XROA 3HOTA 3ZR8X 2DMPA 2VIXA 2RDPA 5FFZA 1IGNA 4WK8F 4OWRB 4P5OA 1MBJA 2DDBA 4RB2C 2IAIA 1SFUA 2QBYA 1FTTA 3FXMA 3EUAA 4RB1A 3WTTC 2GBYA 1R5ID 3VYRB 3BR1A 1WWXA 2TCTA 4FETA 2VQLA 4M72A 1IUYA 1PP8F 3LSIA 3CCJI 2DPDA 1XSDA 1ZR2A 2CQXA 2KQRA 1SMTA 3AAFA 2QF7A 4DJAA 3D1NI 3IAS2 1X4PA 3IRRA 3VWBA 5HDKA 1LKXA 4S05A 1JUSA 3DBRB 2VPRA 1MMNA 4RLFA 4EM0B 2NYXA 4YG2F 4LK0F 4ZZLA 1S29A 2JA7J 4JX5A 5HLGA 3KP6A 1ZK8A 2K40A 3JRHA 4Y7NJ 4X6AJ 2E2IJ 2Q8KA 2P81A 4CCOA 4F52A 2Z33A 4EGYA 1LVAA 3BG7A 5JHUA 2VE8A 2IBDA 3OMYA 2K7LA 3EQLF 2IVMA 2IT0A 3G2BA 2EBIA 2FX0A 2ZMEB 4U0VA 3OS2A 3V42A 3PQKA 4P55A 4I01A 4M74A 4M73A 4OOIA 4HV6A 4AYBA 2E1MB 1BR2A 1C0WA 3T5XA 1OCPA 2HYFA 4A0ZA 3H0GJ 1X2MA 1SVLA 2X6XA 4UY8I 3DPTA 1VQ9I 3H1CA 3HHGA 4CSWA 1HSTA 2CYYA 1BOBA 3M8EA 4D5CA 2AXLA 2K9NA 3HZJA 2P4WA 4RBOA 3ABUA 1R58A 3CF2A 4OIRF 5K1YA 1P4XA 2L0KA 2ZMEC 3HSRA 4BACA 3RKQA 1R00A 3GF2A 2BVMA 2F2EA 2CGPA 1HQCA 3CD6I 1I6HJ 1IN7A 3TBIA 1FLIA 1OLTA 5DTDA 1T6SA 2RKHA 2DA2A 2M34A 4A3JJ 3FXKA 1WZ2A 2GIVA 2VE9A 3CCUI 1GUUA 4N4OB 5LHIA 3VSLA 2YPRA 3E6MA 2JRMA 2UZKA 3VODA 2NVTJ 2HOSA 1J5YA 1TTYA 2HR3A 4PCQA 3RI4A 3K1NA 2R7VA 1LFUP 2FXAA 3CC2I 3CF5F 1MW7A 4XOPA 4OIPF 2EWNA 3QP6A 3KFWX 1G8XA 2HNHA 5CLSA 3AL0C 3CJNA 1J0RA 4FASD 3GLXA 3P7NA 4FX0A 2VKEA 2A07F 2DBBA 1SFEA 4EVIA 5D6FA 4QPQA 1H88C 2O3FA 4UXNA 3BQZA 4RAFA 3K2ZA 5HDNA 2QZ8A 2QEXI 1TZLA 1JTYA 4QSHA 2ZBKA 4PDKA 3RTRA 4I0BA 3FWEA 1IXCA 3I4PA 5LFAA 4EJOA 4ZYAA 1PUEE 2WAFA 1ETWA 3BR2A 4PK4A 4XN3A 4ZTJA 2RAEA 1TC3C 2P5VA 2V9KA 3KX2A 1CGPA 2XB5A 4S0HB 2H6BA 2IEKA 3WG9A 4UUSA 4IHVA 1GV2A 5E8GA 3ZXSA 1S5LC 5FRNA 5CVUA 4M6YA 3EPZA 4BQOA 2FSWA 1R71A 4E7HA 1IN6A 5E1XA 2E1OA 4OMZA 2I10A 3ECOA 3GZNB 3M3YJ 4HAMA 3GFMA 5J8CA 3GTGJ 2B0LA 1YITI 1IW7F 3HEFA 1CF7B 2ID6A 4RAGA 1DU6A 2LY1A 4BKXA 4XNFA 2DYRH 5L3CA 4B48A 2OAZA 2JA8J 2V26A 2DFIA 1YJ9I 1JJ8C 2KHMA 1JKRC 4KT5C 3TOAA 1QNTA 5CPRB 3GUDA 3W2AA 2GLOA 3D5SC 2JPBA 1Z67A 1T0FA 5E1WA 1RC9A 3CCQI 4ABZA 1AOYA 4B8XA 2KRHA 3E7LA 3K6GA 1ZRCA 1LDDA 2ZFUA 2R3SA 4A0XA 1U5TA 4GGGA 2NS8A 2L2OA 1J9IA 3RYRA 1CF7A 1YX5A 1Z77A 2EFOA 4DYQA 4V2FA 3S17J 3J7YJ 2WY8Q 5HVQC 4NHJA 3DKXA 1FYMA 4U0WA 3F8MA 3DLLF 3CCMI 2VODA 4BNCA 4HYEA 1DP3A 2DTRA 3E6DA 3I5UA 5KVRA 1U8RA 4FQGA 3MQ0A 3G3ZA 3E0JB 3CESA 2V1NA 4D0PA 4BU2A 3S8PA 1ZHFA 4HQEA 3LNQA 5IPAA 2M8GX 3GO5A 1IAWA 3LFKA 2XAHA 1X19A 3TW7A 1WH5A 4XQFA 4KT6A 1F36A 3IH4A 3GW2A 3OIOA 4IEJA 2DA7A 3Q0UA 4TV7A 1E3HA 1Z21A 3WODF 2L4AA 3K70D 2X1EA 2EILH 1LDJA 5L3DA 1KQ8A 2ZXWH 4XKCA 3BOQA 1FC3A 5ILUA 2STWA 2A6EF 1QPIA 4LG0B 1EKEA 1DGWY 3J80K 2W7NA 3A03A 3PIOF 1YX3A 4IHYA 2JUGA 3F0CA 3J7ZI 4HDUA 1J2XA 2PBIA 5FLXK 2J5OA 4KN7X 2FA5A 4PJLA 1YS6A 2OTJI 2RVCA 2L3DA 2H8WA 2M7AA 2PN6A 2NRAC 2VT3A 4QWQA 4L18B 5K7HA 1FSHA 2UUZA 2L7FP 1HSJA 1I27A 1MGTA 3AKZA 1WQ2A 2XAJA 2JA2A 3CCLI 5HOOA 4CYCA 1A6IA 3E6BA 3CCEI 3S3NA 2R4GA 1FPQA 4LG0A 3OYIA 1IUFA 5FD5A 2AO9A 1SANA 2E1NA 3S93A 3V7RA 2VLAA 1KGSA 3I71A 2PJRB 1QVUA 2VBXA 2AQFA 3AG2H 4Y17A 4GRIA 2OA4A 2V4JC 3K4JA 3EUHA 4MEXF 2MABA 4YFKF 2CSOA 3RSNA 3K4BA 5CVRA 4I2OA 5J40A 5A2QK 2BVLA 2WAEA 2FMLA 5H6RA 4PFPA 1QA6A 2BE5F 4HF1A 4ZDPA 3L2VA 3BZCA 5IT9Z 1RR8C 2F4OB 4BHCA 2PJRA 3HPGA 5F04A 3OYGA 1U3EM 3S16J 3FBIB 3WTSC 2DI3A 1QVTA 2DA1A 2PMZA 1RZ4A 2M1BA 2R7OA 5TISC 3GTPJ 3JRBA 1KU7A 4GXOA 4KIGA 2M3AA 3PUFA 5J8FA 2KP6A 2KIFA 1LFBA 3GTJJ 4PJMA 2L54A 4YFXF 4UHTA 1R49A 4YEJA 3ZQGA 5DCFA 1YI2I 3GXOA 1AU7A 1S7OA 2VKHA 4XMYA 3L9FA 2DQLA 3SFZA 4IQJA 3ZQ7A 2VC1A 2HKXA 1V5GA 1OR7A 1Z91A 2CUEA 5BS6A 1KONA 2CQQA 5DD8A 5HS7A 1ETYA 3R60A 1PJRA 4JP0A 4BE0A 1WJEA 2E5ZA 2WAQA 2V6EA 1JGSA 3RQIA 3ZGKA 2ELKA 3OL3A 3QYBA 2PLYA 2W00A 3CJQB 3VFZA 3E3VA 4R79A 3GFIA 4V19K 3W6KB 2GA1A 3KETA 4IHXA 1UHWA 2BW3B 4J19A 2VC0A 3D0SA 5EEGA 2Y0MA 2CV1A 1SFOJ 1BOAA 3R4KA 1WJAA 3GTLJ 3KE2A 2E71A 2WAQN 2HOAA 3ROUA 2CO5A 1RIOH 2WV0A 4ESFA 1R7JA 2RQPA 4N9IA 1XGNA 2K9QA 5FO5A 3HRSA 5FD6A 1IDYA 4GYIA 2XASA 4XLEA 2BW3A 4A3GJ 1NG7A 1Y6IA 2A5YB 3TW6A 4ZYGA 1VQ4I 1ZG5A 5E3OA 4F55A 1Q1VA 4B47A 2R0QC 2R7QA 1Z6RA 2V1DA 5HNFA 3WTVC 4EJWA 4RDUA 4QIWN 1P9QC 2W82A 2A61A 1H89C 1RKWA 2OBPA 3S3MA 1OCZH 3L00A 5CVVA 3FHNA 2IA2A 2GA2A 3CLQA 1ZQ3P 2V79A 1XSVA 3TP3A 3IUOA 2LNBA 3ML6A 1Y39A 1DPUA 1W1WE 1WPKA 3NRVA 3ZQFA 2ZJ2A 4U87A 3HC7A 1XCVA 1QGPA 4WF2A 2X6WA 4DBRA 3TEDA 1IRXA 2YU9J 2FEZA 4RGUA 4P9FA 4AIKA 4AIJA 2DOFA 3I9V2 2RREA 5FLXZ 1MJAA 1FBUA 2IJLA 1GXPA 1J59A 4LGWA 4EJVA 1U9OA 2DDAA 2Y0SN 3M9AA 5K7FA 1KA8A 2LP0A 1R5HA 5F1JA 2H8RA 2K27A 3L2QA 2JTVA 2VKVA 2DT5A 5JVGF 1BL0A 1R22A 2IS2A 3S32A 4C2TA 2VXDA 3OS1A 3BROA 1K78B 1M1EB 2VJ4A 3CUOA 3UR3C 3ZP5A 4ESJA 1U6GA 2LY2A 2R7SA 4XKVA 3WGGA 3BPVA 2DMQA 2VKDA 3BTCA 3LSJA 2RQQA 4LITA 1EH7A 1HW2A 5F27A 1ZRFA 5EZHA 1G6NA 2PX9A 5CJ9A 5KCMA 3DEWA 2WADA 1X1PA 1FT9A 4XR6A 5LHHA 1S7AA 3LA7A 4JOMA 4UVBA 1L3LA 2WBMA 3ZMUA 1LQ1A 1K78A 1RETA 1FIAA 5DYMA 2QQ8A 4EV0A 3QPSA 5KAIC 3RKXA 1Z7LA 1MD0A 2FE3A 1UFMA 4KIBA 1ACIA 5H6QA 2DO7A 5CKTA 5BQTA 1JKPC 1P4AA 4EQQA 4HQMA 3HTSB 1XCBA 3S2WA 5J6XA 2EH3A 2FQ4A 1SD6A 2XKOA 3RDIA 4C2UA 5EF6A 2ESNA 5HLIA 5E18F 4LLNA 2XGDA 3KEOA 3ZMSA 4HDVA 4E7JA 4KN4X 3NARA 4HNUA 4L9VA 3MKWB 4LB5A 2CFXA 3KZZA 2M8EA 2KDZA 2XGCA 2FBHA 3OYBA 2X1CA 3OV8A 2JWTA 3EETA 4PFOA 3G6EI 3W6JB 2KJCA 4DOZA 4XK4A 2DA4A 2WV1A 2Z3YA 5JR3A 3L2CA 5BPIA 4EGZA 3EDPA 3OOUA 5TRDA 5D5UB 1I3AA 1A04A 3G1MA 1I5ZA 2M30A 1W7PA 1X3WB 2G7UA 5KAFC 3HHHA 4IF4A 3W2WA 4EM2A 3DEUA 4GCVA 3U2RA 1R6RA 5B5EC 3IRQA 2OQGA 3QPHA 5IP9J 1ZELA 4MGRA 3S14J 3JSOA 1IN4A 1Y1VJ 3U1KA 2ADUA 2EZHA 3QPLA 2BEOA 1X1BA 2VL8A 2M45A 2XF6A 1YRNB 4OIQF 2K9LA 2KJBA 1FJLA 3FM3A 3A2KA 4G94A 2W48A 3M07A 2R7RA 1T98A 2ZXJA 1S72I 2D1VA 2HXOA 3A0BC 3GBGA 5FKNA 5ED4A 3WTWC 1A5JA 3DQVC 3F6VA 2XRNA 1BR1A 4Q4ZF 2IGKA 1OMIA 4I09A 3VEPA 3S1NJ 2DU9A 1V5EA 2VXZA 4BUPA 4WWCA 5L3EA 1IXRC 2W25A 3VOEA 1YE9A 4FT8A 3T0YA 1VQLI 1HDPA 2VUMJ 3ELKA 1SFKA 2XPWA 2IGMA 4RLQA 3W3CA 3WHBA 2YUSA 4A3FJ 2LF8A 3AG4H 2LD5A 2KLOA 1VQ7I 4PGHA 4XORA 1MBKA 3RKWA 3KP4A 2Z16A 1I1GA 3I4NJ 4Z2YA 2RNJA 4ZDOA 4IHSA 4F92B 3ZMVA 2Z5UA 4B3AA 4ESBA 4MHGA 1R23A 2QQBA 4G12A 4CH7A 4DBQA 3RPUD 2TDXA 3BWGA 1XTAA 3KP7A 3I54A 1FBQA 2A6HF 1SVMA 1QHHD 2LBFB 1ORKA 2B63J 2FOKA 5DUKA 1FSEA 5LGNA 2HGCA 1OCOH 1R5GA 4MLOA 2FU4A 3GZ6A 1V3FA 1VQ8I 2HI3A 4BGDA 3LFUA 4H4KC 1TQPA 1YQAA 4EJUA 4PSXA 5D4RA 4RM2A 1JHHA 1LNWA 1YS7A 1EA3A 2M0CA 2ME0A 3EYYA 3JAMZ 1PUFB 3QOPA 2O8KA 1IO2A 2E19A 3K7AJ 4YIIA 4M3EA 4JK1X 2P6SA 3FXUA 4LLLA 3CMEI 4HEA2 5IYCJ 1B4AA 2LBFA 4XLNF 3GFJA 3BTJA 1T33A 2P7CB 5ICCA 2HFHA 4A6EA 4AVZA 3DFGA 3BG9A 3AFHA 4B4CA 1OJLA 3QRFF 3LMMA 1ZLKA 1BC7C 2EZKA 3CC7I 3FZVA 3SZPA 5H2FC 3FISA 1AKHB 3ISPA 3OYKA 2QCOA 2EV5A 1X1AA 4AU7A 1APLC 3QPTA 5F1RA 3HOUJ 2VQCA 5F6FA 3Q0VA 4H0EA 1AWCA 1HW5A 2CQNA 1I50J 2FUG2 2D45A 3HSFA 3H3VK 1VTNC 5DCMB 4L5JA 2XVCA 3LOCA 3K1MA 4HX4A 4LOCA 3S2HJ 4PGGA 1KZHA 1P6RA 1U8BA 2EFQA 5IOYA 4NUBA 1FNNA 2ZMEA 4IX7A 2WB1A 1REPC 1FZPB 3K0LA 1MIJA 4AYBN 2EV6A 3G1OA 3LSKA 1FBSA 1SAUA 2FMYA 2JRTA 1MZBA 2BY3A 2V1XA 3AL0B 2L9RA 5LGTA 1WJCA 5DD4A 4ZH4F 5JI6A 3RPUA 1U78A 3LL7A 3HOZJ 3HTUA 2ISYA 3FKIJ 2CH0A 3L09A 3CDHA 4HSTA 1N25A 1WFXA 4XIDA 4OU0A 4Y15A 4CUGA 2QQ9A 4ANJA 2JA5J 5F08A 4CCNA 3MN2A 2ELJA 1KQ9A 1HXDA 2JVHA 4O6JA 3OR2C 4U7DA 1V4RA 2CQ7A 1XS9A 4L0YB 2IS6A 4BXFA 3BJ6A 2AS5F 3E6CC 4L9TA 1W5SA 1Z3XA 2FBIA 2BXYA 2GAUA 1FOKA 1G3YA 1B72B 1OYWA 3HL2A 3HG9A 4KDPA 4GYGA 3P9KA 4G6TB 4XLAA 2P5LC 5DUIA 3RCOA 2R5ZB 2LTPA 2MH9A 1DGRM 1ETKA 1S8NA 2QM3A 1MDMB 3PNTA 3LA2A 2VASA 3U9GA 4BJ5C 1FOXA 3TDUC 1K6YA 5GAHJ 3GCMA 3S1MJ 3FKJA 3B73A 3NQOA 2IS1A 3CJTB 2FJ1A 1TW2A 2DK8A 2Y30A 2EIKH 3C1DA 4IZZA 3CCYA 3HKZA 3ZN1A 1Y1WJ 5GPAA 4YELA 1I6XA 1U0JA 3REOA 3ZMDA 4A3DJ 1FX7A 1R4NB 4Y13A 1JKQC 3VPRA 4M3BA 5D5WB 2VPLA 3LSTA 4IKFA 3JSPA 2O0YA 2Y69H 1B72A 2IGOA 4JBAA 1ZGAA 2R93J 3BCBA 1D1BA 2KIUA 2OV7A 3HIFA 3DTIA 1HLVA 3CMMA 2HQAA 4ZYHA 2WA0A 1X58A 3TKYA 4UUTA 4LJZF 2IPQX 3R0AA 2FNAA 2OPTA 2YU3A 2R7TA 1TWHJ 1MH3A 2Z1DA 5J4YA 3OYMA 1J75A 2C6YA 3QYEA 3ZQCA 3HKZN 1YIJI 5B1AH 5DEQA 4WCGA 1V55H 2DJNA 3BCAA 4NC7A 1IZ1A 3GX4X 1YJWI 2VBZA 1YW8A 4GO1A 3GYHX 4I76A 2B9SA 4XLFA 2PI0A 2FQ3A 4A69C 1BIAA 2PQ8A 3KIOA 3BG5A 3A4CA 2L4MA 1ZG3A 2MD5A 5GAGJ 4RS8A 4KJZA 1O7FA 5FLMJ 2DAOA 2E7XA 5ICFA 1K7AA 3IWZA 2DK5A 5E3MA 5GTIC 3H5RA 3ZMTA 2X4HA 3BZKA 3H0DA 2ESHA 3BTLA 4ZC3A 4X0GA 3WE3A 2RN7A 4V2GA 5E3LA 2AXTC 1BW6A 2P7VB 3CDLA 3P9IA 2V9VA 2KFDA 3CO6C 1ON2A 3KP5A 3HXLA 4RGSA 1B6AA 3LQRA 2XF5A 1R1UA 3WU0A 5KHDA 1I1SA 2BBYA 2LG4A 4LK1F 4A3CJ 4CDGA 3HOVJ 3SDBA 4Q48A 4KICA 2NNYA 1JHFA 4G6QA 2OJED 1KYWA 4CCMA 5ILVA 2F5FA 1SD7A 2K5CA 1P4WA 4XRSG 3TMOA 5LBQA 5K5OA 4I99C 3MZHA 2E35A 1BJAA 4G8XA 5EEAA 2O7OA 5J1YA 4NQWB 3OYCA 3JRAA 3E1SA 5JHFA 5GADJ 2CU7A 4FTHA 3OIPA 1NG6A 4ENMA 4W1UA 2DMTA 3OYFA 2CRGA 4E7LA 3F6OA 3BR6A 1JUPA 1D5YA 1UHMA 3MAJA 1T0FC 2E7WA 3SYTA 4S04A 5EG0B 5IP7J 4BY1J 2V7FA 4XRFA 3F8BA 2XSDC 1ZN2A 1HOMA 4L5EA 5EDNA 1NK2P 2VONA 2EFWA 1EH6A 2HYJA 3TO7A 4RM3A 2E5NA 5IYBJ 2HZTA 3SDGA 4XONA 3K2AA 2LLKA 2X1DA 4BAYA 1SEUA 1FYLA 1IG7A 2QSFX 5C4JJ 4OINF 3LSRA 1T2KA 4ZJZA 4XKWA 1D3YA 5TJJA 1RNLA 5B66C 1OKRA 3G1LA 4BEHB 1DDNA 3IKTA 5LD2C 1X3UA 1SVOA 2PMUA 3EUKL 2Q1ZB 2LF7A 1XSXA 2R7DA 2DXIA 1VNDA 2P8TA 5EG0A 2XPUA 3WTZA 1PP7U 5K7ZA 4I0AA 2ZNYA 1BI0A 3I56I 1R9TJ 1WJ5A 2FOWA 1ZARA 2FBKA 2IA1A 2RC4A 1XPXA 2O8XA 4KMUX 3QP5A 3K1PA 2XAUA 3F9KA 4KISA 3V8JA 2L5QA 2CWEA 5HLTA 1TWGJ 2NVUB 4IRIA 3FIWA 2STTA 4Y33A 3J7AO 3N05A 4I6ZA 2Z2SB 3ZQIA 3KYLA 4AM3A 4UVAA 4HLXA 3UNGC 1Q1HA 3H5AA 4MQ9F 2KKOA 3JR9A 2O61A 2R7UA 1RESA 2LDUA 5BMZA 2I5UA 1BIBA 3CJRB 5ILSA 1BC8C 2IXSA 3A01B 1W0UA 5L3BA 5FJ8J 5E17F 4BH9A 1ZAOA 3F21A 3SZGA 5D6EA 4ZTFA 1R1VA 3SEQA 3CUQC 5DS9A 5M5XJ 1KU3A 4J01A 1FEXA 2GXAA 3HOSA 2HPIA 4NDLA 5D5VB 5ICGA 4IRHA 3TO6A 1YYVA 2F4MB 3H92A 4O5VA 2K9MA 4LFUA 5K5RA 1O3RA 2ME6A 2YX7A 1IV8A 3ABTA 4UV8A 4Q47A 1XGOA 1O4XA 1A36A 1ONVA 3C7JA 3MFKA 2OZUA 4XSZF 3TQNA 3I55I 3DTEA 3J81K 5CQGA 1F43A 5E8IA 3L2WA 1D8KA 3L1PA 3A01A 1UCRA 4G7OF 2H94A 4UVCA 5LEJA 2GM4A 1XC5A 1JJ6C 4NB5A 1BJZA 2PMZN 3PSIA 3OIQA 1HF0A 3PJRA 2E34A 5CYVA 2NAZA 3S3OA 2R7ZJ 2K02A 1OPCA 1W36C 3RYPA 1V54H 3WGIA 2FD5A 3I4MJ 3MKZA 3Q9SA 1QZEA 1DP7P 5GP9A 4IHWA 1B9NA 1LEAA 2DT7B 1WJFA 3IP4B 2KIMA 2LFBA 3BJOA 1JI8A 3BR3A 3DF8A 3PSFA 4QLCU 3U21A 4RMNA 3GFLA 3HM5A 3PL8A 1G4DA 3LAPA 3C3WA 5D5XB 2F6CA 2QKLB 4E7KA 4L9JA 5JLWA 4PJ0C 3KLNA 4OIOF 1ZLJA 1F9NA 3BPXA 3U1DA 2K3PA 2PJPA 3COAC 1Z7UA 3OYAA 2R5YB 5TGTA 3WE2A 2BZTA 2W4SA 2DJIA 2D5VA 3G4SI 3E5UA 2CG4A 4AC0A 2HXIA 2NOGA 2OCEA 5E20A 3HDDA 4OMYA 1MH4A 2HZDA 2MW8A 1VQOI 1LE8B 1ZTRA 4HW0A 4HPQA 1USSA 2XPVA 1JUMA 1E3PA 1MBEA 2F4IA 2LY9A 2OCCH 2COBA 2VB6A 5J3LA 3X2QH 3KZIC 1TQMA 1TL8A 1IDZA 2L7ZA 1TWFJ 4M3GA 1VQKI 4A5MA 3I59B 1ETVA 2H27A 3I0TA 4AVPA 2B7EA 4XLHA 4ASNA 2R5YA 1RUOA 1P2FA 2XKPA 5F64A 2ETHA 3J80Z 2K85A 2W1OA 5IY5H 3WU2C 4B43A 3CMYA 9ANTA 1W5TA 2MGQA 5C3EJ 4NBQA 5HNHA 4F93B 1LE8A 4A5NA 2BOLA 1WI9A 3DEEA 3OSGA 2ZSHB 2QGUA
chains in the Genus database with same CATH topology
2EJRA 3V7CA 1K6OA 3I59A 2FF4A 3FM5A 1G3SA 2OZ6A 1WRJA 1QPMA 3I64A 2XV4S 2F5CA 4LLGF 2Y48A 4AD9A 2XUBA 2WTEA 4CYDA 3FXQA 5A2QZ 1YFHA 1LJ9A 2KRFA 2M87A 4ENKA 3FXRA 3TOBA 4HV5A 3RIRA 5HDGA 3LAJA 3V4GA 2W84A 3K9TA 4M6XA 4HX8A 4I02A 2K4JA 1XGSA 5HS8A 2H09A 4XBFA 1SD4A 2EFPA 2ZCWA 2D1HA 1B1BA 2DW4A 3F8NA 3HRTA 3KCCA 3PFIA 4MTEA 1H9TA 1TNTA 1YO5C 2MBFA 4HBLA 5AIPA 3BDDA 5E1ZB 2MH2A 3F22A 1O3QA 1GVJA 5JVTA 4XLPF 4BHBA 3ZMZA 4HF2A 1ODDA 2IA0A 3EYIA 2HQNA 4EMSA 5H20A 3R6SA 3JW4A 2M5WA 2ZNZA 2R7FA 1HKQA 5D8KB 2IRFG 4G9YA 4L0ZB 1ZG1A 2MC3A 2FRHA 1XDUA 3GZ5A 4RAYA 4XSXF 1BN5A 1E17A 1XD7A 3V7SA 3WGHA 4E70A 1IRGA 4WXHA 2Y75A 2PFBA 2Z99A 1H9GA 1ZREA 4A0YA 1H0MA 3M1EA 3BP8A 3T1BA 3RPQA 4I98B 3V8LA 2HKOA 4KUMA 2XAQA 4EM1A 1UB9A 4HOBA 2GXBA 3JTGA 1KYZA 5CVIA 2L01A 3R61A 5LRSA 3D5LA 1IN8A 3SZTA 2VN2A 1QQIA 3HRMA 3LQQA 3HSEA 2YR2A 2EV0A 2F5EA 5FB2A 4AWXB 1TW3A 3WTYC 3F8CA 1LB2A 4UNOA 1KU9A 5ERIA 3I53A 3F23A 1MJ9A 3O6BB 2JZYA 1LDKB 3ULQB 1ZRDA 3TO9A 3WU1B 4LMYA 2V1UA 3HRUA 4CO8A 1TQIA 4HLYA 4RAZA 2QQAA 3B02A 2V6CA 2VOPA 3JTHA 4CXFA 1W4MA 1B9MA 1KQ0A 3F72A 3KP2A 1BI1A 2P5KA 1P92A 1GHCA 3C18A 2NS0A 3E5XA 2G7HA 2HYGD 2XHKA 2LSOA 3I58A 2E1CA 5DCMA 4ETSA 2IW5A 5LRRA 3Q9VA 1Z1DA 1XDSA 5KK1A 4DQ2A 2FNPA 1DPRA 3V8KA 1NHAA 3QAHA 4M9ZA 4YFNF 4IHTA 1BM9A 5D8LB 2ZFWA 5LEKA 2O03A 2O6GE 2CW0F 3BZ6A 2LKPA 1BBYA 4CICA 4N0BA 3SHFA 5L3FA 4MTDA 2G9WA 1ZGJA 4MNUA 3F8FA 3P9CA 4KA4A 1YG2A 2MLKA 3BY6A 1R1TA 1EV7A 2QWWA 4BXUA 2ZKZA 2J5PA 3ZN0A 1TNSA 1RI7A 2XAFA 2XIGA 4DNCA 5JFRA 1OYYA 2UWMA 1B59A 2X0LA 3O2PE 1MDMA 2IP2A 3MZYA 2QLZA 3IHUA 1S3JA 3IL2A 5FGMA 3FMSA 3FMRA 3CO7C 5BPDA 5IT9K 3MCZA 4M71A 3H3UA 1G3TA 4HF0A 1IF1A 1QBJA 5LGUA 2W85A 2OU2A 5AONA 1XMAA 1SFXA 4N9HA 1SD5A 3GWZA 1KU2A 4P96A 4U7BA 4HZFA 4ENJA 3FHZA 1L0OC 2DLLA 1ULYA 2Z9OA 1U5TB 1MJBA 2JPCA 3Q5FA 1BI3A 1YLFA 4IRGA 1USTA 1FY7A 2ISZA 4O3MA 1F5TA 3K69A 3T8RA 4RB3C 2HQRA 2RGVA 4EJTA 4ON0A 4LB6B 4BYYA 5AIQA 5IT3A 2A3SA 4RGXA 3KP3A 4BHPA 1YTYA 4R1HA 4NQWA 1XN7A 4A2UA 1U5TC 1ON1A 1QO0D 1YIOA 4ENNA 2K4BA 1T39A 6PAXA 4ZYDA 2HWVA 4CHUA 2BV6A 3N97A 1JXSA 3PQJA 3ERED 4G6DA 3CTAA 5DV5A 1Y0UA 2HDCA 5K5QA 3CUQB 2VT2A 4AIHA 1IXSB 1BI2A 2UXNA 1FWZA 4R8HA 2JT1A 3TDZC 1OYIA 4F7ZA 2W57A 2VOOA 4M9XA 2DQRA 3HYIA 1O3TA 3CUQA 2ACJA 3N4MA 5FFXA 2L02A 1STZA 1K79A 3SQNA 2MA3A 1QZZA 2EK5A 4Q5SF 2HTJA 4PZJA 1O7LA 3DPLC 2P6TA 2QVOA 3GEZA 2Q2EA 2RV8A 4L5IA 1MKMA 4P9UA 1YW7A 2MLGA 4A6DA 2W24A 3ECHA 2A68F 1J7KA 1S6LA 1PDNC 4UUVA 1EH8A 3T8TA 3FX3A 2XGXA 5HLHA 1O3SA 4ZZDA 4KMFA 4K2EA 4MEYF 3WTUC 1SAXA 1ZYRF 2H6CA 4KFCA 5LHGA 4IPAA 3DXJF 2QUFA 5D4SA 2BGCA 3M8FA 4HX7A 1TLHB 3KLOA 3NEUA 4YIFA 1IN5A 1IRFA 2HTSA 4IJAA 2EFNA 1YW9A 3O3KA 2K86A 3CLOA 3IWFA 3LA3A 1G3WA 2EA4A 4LD5A 3BJAA 3QU3A 3E97A 3WTXC 4WXCA 2GWRA 4A12A 3RJPA 2EB7A 3HUGA 4UV9A 4G7HF 1FP2A 3F3XA 2PMHA 3LWFA 3FMQA 4B09A 3H3ZA 2Q0OA 2YSRA 3VB2A 1Z9CA 1D5VA 1T38A 1W7PD 4G7ZF 5ICEA 2JSCA 1Z6TA 4KIFA 2OD5A 4KYWA 1JE8A 2WWYA 5LLQA 3TGNA 2GQQA 2PEXA 3DP7A 3IC7A 3JAMK 1FP1D 1WKMA 5DDGA 2VBWA 1U2WA 3QU6A 1LEBA 3DV8A 3RKYA 4CGZA 1WSUA 2HS5A 2YX4A 3MWMA 1D8JA 4ZYEA 1HBXG 2QYOA 3R0JA 1O57A 5HS9A 3G73A 1Z05A 2GZWA 1HW1A 4HA8A 1XGMA 1XB4A 3SXYA 2BYVE 3J81Z 3IKVA 2COMA 2HOEA 1FYKA 3L7WA 1QZYA 4M9SA 5BOXA 1XMKA 1RUNA 1HKTA 2QENA 3MEXA 4CZZA 1W7PB 1TBXA 4IVNA 1HKSA 3KEQA 4WXDA 4U88A 4WX9A 2VBYA 2NNNA 3DKWA 5L3GA 3KZYA 3GVAA 4BQAA 2ELHA 2EA2A 2A69F 1E2XA 1F4KA 3OOPA 1F1ZA 3E5QA 5EEHA 2XAGA 2OQRA 4L9NA 2ZO4A 4MQVA 5CVJA 2PG4A 1SMYF 2F5DA 2GXGA 1GXQA 4I7HA 4RB0A 2HEOA 2UXXA 2DPUA 4KNYA 2D2WA 1DUXC 3FF5A 2QBYB 2WC2A 4FX4A 4IXAA 2CQKA 1ZH5A 3M7GA 4RGRA 4U0YA 4FHTA 4JQFA 2XROA 3HOTA 2RDPA 5FFZA 4WK8F 4P5OA 1SFUA 4RB2C 2QBYA 4RB1A 3WTTC 1WWXA 4M72A 1IUYA 1PP8F 2DPDA 1XSDA 3AAFA 1SMTA 3IRRA 5HDKA 4S05A 4EM0B 2NYXA 4YG2F 4LK0F 4ZZLA 1S29A 5HLGA 3KP6A 2Q8KA 2Z33A 4EGYA 1LVAA 5JHUA 2VE8A 2K7LA 3EQLF 2IVMA 2IT0A 2ZMEB 4U0VA 3PQKA 4P55A 4I01A 4M74A 4M73A 4OOIA 4HV6A 1C0WA 3T5XA 2HYFA 4A0ZA 3DPTA 3HHGA 1HSTA 2CYYA 3M8EA 2AXLA 2P4WA 3ABUA 1R58A 4OIRF 5K1YA 1P4XA 3HSRA 1R00A 3GF2A 2F2EA 2CGPA 1HQCA 1IN7A 1FLIA 1T6SA 2RKHA 2GIVA 2VE9A 5LHIA 2YPRA 3E6MA 2UZKA 3VODA 1J5YA 1TTYA 2HR3A 4PCQA 3RI4A 3K1NA 2FXAA 4OIPF 2EWNA 3QP6A 3KFWX 5CLSA 3CJNA 1J0RA 3GLXA 3P7NA 4FX0A 2A07F 2DBBA 1SFEA 4EVIA 5D6FA 2O3FA 4UXNA 3K2ZA 5HDNA 2QZ8A 2ZBKA 4PDKA 3RTRA 4I0BA 3FWEA 1IXCA 3I4PA 4EJOA 1PUEE 2P5VA 1CGPA 2H6BA 3WG9A 5E8GA 5CVUA 4M6YA 2FSWA 1IN6A 5E1XA 4OMZA 3ECOA 4HAMA 3GFMA 5J8CA 2B0LA 1IW7F 1CF7B 5L3CA 2OAZA 2DFIA 4KT5C 3TOAA 1QNTA 3GUDA 2JPBA 1T0FA 5E1WA 1AOYA 4B8XA 1ZRCA 1LDDA 2R3SA 4A0XA 1U5TA 4GGGA 1J9IA 3RYRA 1CF7A 2EFOA 5HVQC 4NHJA 1FYMA 4U0WA 3F8MA 2VODA 4BNCA 4HYEA 2DTRA 3E6DA 3I5UA 5KVRA 1U8RA 3MQ0A 3G3ZA 4D0PA 1ZHFA 4HQEA 3GO5A 1IAWA 3LFKA 2XAHA 3GW2A 3WODF 3ZPLA 4TV7A 2L4AA 1LDJA 5L3DA 1KQ8A 3BOQA 1FC3A 5ILUA 2STWA 2A6EF 4LG0B 3J80K 4HDUA 1J2XA 2PBIA 5FLXK 2J5OA 4KN7X 2FA5A 1YS6A 2RVCA 2L3DA 2PN6A 2NRAC 2VT3A 4QWQA 4L18B 1FSHA 1HSJA 1I27A 1MGTA 1WQ2A 2XAJA 5HOOA 3E6BA 1FPQA 4LG0A 5FD5A 2E1NA 3V7RA 1KGSA 3I71A 2VBXA 4Y17A 2OA4A 4MEXF 3EUHA 4YFKF 2CSOA 5CVRA 4I2OA 5A2QK 2FMLA 5H6RA 2BE5F 4HF1A 5IT9Z 4BHCA 1U3EM 3WTSC 2DI3A 1RZ4A 2M1BA 1KU7A 4GXOA 4KIGA 5J8FA 2KIFA 2L54A 4YFXF 4UHTA 5DCFA 3GXOA 1S7OA 3L9FA 2DQLA 3SFZA 3ZQ7A 2VC1A 2HKXA 1OR7A 1Z91A 5BS6A 5DD8A 5HS7A 3R60A 1JGSA 2PLYA 3VFZA 3GFIA 3E3VA 4R79A 3W6KB 3KETA 2GA1A 1UHWA 2VC0A 3D0SA 5EEGA 2Y0MA 1BOAA 3R4KA 3KE2A 3ROUA 1RIOH 2CO5A 2WV0A 4ESFA 1R7JA 2RQPA 4N9IA 1XGNA 5FO5A 3HRSA 5FD6A 4GYIA 2XASA 2A5YB 4ZYGA 1ZG5A 1Z6RA 2V1DA 3WTVC 4EJWA 2A61A 2OBPA 3L00A 5CVVA 2IA2A 2GA2A 2V79A 1XSVA 2LNBA 3ML6A 1DPUA 3NRVA 2ZJ2A 1XCVA 1QGPA 4WF2A 2FEZA 4RGUA 4P9FA 4AIKA 4AIJA 5FLXZ 1MJAA 1FBUA 2IJLA 1GXPA 1J59A 4LGWA 4EJVA 3M9AA 1KA8A 1R5HA 2K27A 2JTVA 2DT5A 1R22A 3BROA 1K78B 3ZP5A 3CUOA 4ESJA 1U6GA 3WGGA 3BPVA 1EH7A 1HW2A 1ZRFA 1G6NA 5CJ9A 1FT9A 5LHHA 1S7AA 3LA7A 4UVBA 1L3LA 1LQ1A 3ZMUA 1K78A 5DYMA 4EV0A 3RKXA 2FE3A 1MD0A 1UFMA 4KIBA 5H6QA 2DO7A 5BQTA 1P4AA 4EQQA 4HQMA 3HTSB 1XCBA 3S2WA 5J6XA 1SD6A 2XKOA 3RDIA 5E18F 2ESNA 5HLIA 4LLNA 3KEOA 3ZMSA 4HDVA 4KN4X 4L9VA 4LB5A 2CFXA 3KZZA 2M8EA 2FBHA 3OV8A 3EETA 3W6JB 2KJCA 2Z3YA 5JR3A 3L2CA 5BPIA 4EGZA 3EDPA 5TRDA 5D5UB 1A04A 1I5ZA 2M30A 1W7PA 2G7UA 3HHHA 4IF4A 4EM2A 3DEUA 4GCVA 3U2RA 3IRQA 2OQGA 3QPHA 4MGRA 3JSOA 1IN4A 2ADUA 2BEOA 2M45A 4OIQF 2KJBA 3FM3A 4G94A 1T98A 2ZXJA 2D1VA 5ED4A 3WTWC 3DQVC 3F6VA 2XRNA 4Q4ZF 1OMIA 4I09A 3VEPA 2DU9A 2VXZA 4WWCA 5L3EA 1IXRC 2W25A 3VOEA 4FT8A 3T0YA 3ELKA 2LF8A 4PGHA 3RKWA 3KP4A 1I1GA 4Z2YA 2RNJA 4IHSA 3ZMVA 2Z5UA 4ESBA 4MHGA 1R23A 2QQBA 2TDXA 3BWGA 3KP7A 3I54A 1FBQA 2A6HF 2FOKA 5DUKA 1FSEA 5LGNA 2HGCA 1R5GA 2FU4A 3GZ6A 1V3FA 1TQPA 1YQAA 4EJUA 5D4RA 1JHHA 1LNWA 1YS7A 3EYYA 3JAMZ 3QOPA 4YIIA 4JK1X 2P6SA 3FXUA 4LLLA 1B4AA 4XLNF 3GFJA 2P7CB 5ICCA 2HFHA 4A6EA 3DFGA 3QRFF 1ZLKA 1BC7C 3FZVA 3SZPA 3ISPA 2EV5A 3QPTA 5F1RA 5F6FA 4H0EA 1AWCA 1HW5A 2D45A 3HSFA 1VTNC 5DCMB 4L5JA 2XVCA 3K1MA 4HX4A 4PGGA 1P6RA 2EFQA 1FNNA 2ZMEA 1REPC 1FZPB 3K0LA 2EV6A 1FBSA 2FMYA 2JRTA 1MZBA 2V1XA 5LGTA 5DD4A 4ZH4F 5JI6A 3RPUA 1U78A 3HTUA 2ISYA 3L09A 3CDHA 4OU0A 4Y15A 2QQ9A 1KQ9A 1HXDA 4O6JA 4U7DA 1V4RA 4L0YB 3BJ6A 2AS5F 3E6CC 4L9TA 1W5SA 2FBIA 2GAUA 1FOKA 1G3YA 1OYWA 4KDPA 4GYGA 3P9KA 2P5LC 5DUIA 2MH9A 1S8NA 2QM3A 1MDMB 3LA2A 3U9GA 3TDUC 3B73A 3NQOA 1TW2A 2DK8A 3C1DA 3ZN1A 1I6XA 3REOA 3ZMDA 1FX7A 4Y13A 5D5WB 3LSTA 3JSPA 2O0YA 4JBAA 1ZGAA 2KIUA 3HIFA 4ZYHA 3TKYA 4LJZF 2IPQX 3R0AA 2FNAA 2YU3A 1J75A 2C6YA 5DEQA 4WCGA 1IZ1A 3GX4X 2VBZA 1YW8A 4GO1A 3GYHX 2PI0A 2FQ3A 1BIAA 2PQ8A 2L4MA 1ZG3A 2MD5A 4RS8A 1O7FA 2DAOA 2E7XA 5ICFA 1K7AA 3IWZA 2DK5A 3ZMTA 2X4HA 2ESHA 3WE3A 2RN7A 2P7VB 3P9IA 2V9VA 3CO6C 1ON2A 3KP5A 4RGSA 1B6AA 3LQRA 1R1UA 3WU0A 2BBYA 4LK1F 4CDGA 4Q48A 4KICA 2NNYA 1JHFA 4G6QA 1KYWA 5ILVA 2F5FA 1SD7A 5LBQA 1P4WA 5K5OA 3MZHA 1BJAA 4G8XA 4ENMA 3F6OA 1UHMA 3MAJA 2E7WA 4S04A 4XRFA 3F8BA 1ZN2A 2VONA 2EFWA 1EH6A 3TO7A 1FYLA 2HZTA 4BAYA 4OINF 1T2KA 1D3YA 5TJJA 1RNLA 1OKRA 1DDNA 3IKTA 1X3UA 2PMUA 2LF7A 1XSXA 2R7DA 2P8TA 3WTZA 1PP7U 4I0AA 2ZNYA 1BI0A 1ZARA 2FBKA 2IA1A 2RC4A 2O8XA 4KMUX 3QP5A 3K1PA 3V8JA 2CWEA 4IRIA 2STTA 3J7AO 4UVAA 4HLXA 1Q1HA 4MQ9F 2KKOA 2O61A 2LDUA 5BMZA 1BC8C 1BIBA 5ILSA 5L3BA 5E17F 4BH9A 1ZAOA 3F21A 5D6EA 1R1VA 3CUQC 1KU3A 3HOSA 5D5VB 5ICGA 4IRHA 3TO6A 1YYVA 3H92A 4O5VA 4LFUA 5K5RA 1O3RA 2YX7A 3ABTA 4UV8A 4Q47A 1XGOA 1ONVA 3C7JA 3MFKA 2OZUA 4XSZF 3TQNA 3J81K 5E8IA 1D8KA 4G7OF 1UCRA 2H94A 4UVCA 5LEJA 4NB5A 5CYVA 2NAZA 2K02A 1OPCA 3RYPA 3WGIA 3Q9SA 1DP7P 1B9NA 1LEAA 2KIMA 3BJOA 3DF8A 4QLCU 3GFLA 1G4DA 3LAPA 3C3WA 5D5XB 4L9JA 3KLNA 4OIOF 1ZLJA 1F9NA 3BPXA 3U1DA 2PJPA 3COAC 1Z7UA 3WE2A 3E5UA 2CG4A 5E20A 4OMYA 4HW0A 1USSA 1TQMA 4A5MA 3I59B 2H27A 3I0TA 4AVPA 4ASNA 1RUOA 1P2FA 2XKPA 5F64A 2ETHA 3J80Z 1W5TA 4A5NA 1WI9A 1I1SA 1R36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJR A;  3V7C A;  1K6O A;  3I59 A;  2FF4 A;  3FM5 A;  1G3S A;  2OZ6 A;  1WRJ A;  1QPM A;  3I64 A;  2XV4 S;  2F5C A;  4LLG F;  2Y48 A;  4AD9 A;  2XUB A;  2WTE A;  4CYD A;  3FXQ A;  5A2Q Z;  1YFH A;  1LJ9 A;  2KRF A;  2M87 A;  4ENK A;  3FXR A;  3TOB A;  4HV5 A;  3RIR A;  5HDG A;  3LAJ A;  3V4G A;  2W84 A;  3K9T A;  4M6X A;  4HX8 A;  4I02 A;  2K4J A;  1XGS A;  5HS8 A;  2H09 A;  4XBF A;  1SD4 A;  2EFP A;  2ZCW A;  2D1H A;  1B1B A;  2DW4 A;  3F8N A;  3HRT A;  3KCC A;  3PFI A;  4MTE A;  1H9T A;  1TNT A;  1YO5 C;  2MBF A;  4HBL A;  5AIP A;  3BDD A;  5E1Z B;  2MH2 A;  3F22 A;  1O3Q A;  1GVJ A;  5JVT A;  4XLP F;  4BHB A;  3ZMZ A;  4HF2 A;  1ODD A;  2IA0 A;  3EYI A;  2HQN A;  4EMS A;  5H20 A;  3R6S A;  3JW4 A;  2M5W A;  2ZNZ A;  2R7F A;  1HKQ A;  5D8K B;  2IRF G;  4G9Y A;  4L0Z B;  1ZG1 A;  2MC3 A;  2FRH A;  1XDU A;  3GZ5 A;  4RAY A;  4XSX F;  1BN5 A;  1E17 A;  1XD7 A;  3V7S A;  3WGH A;  4E70 A;  1IRG A;  4WXH A;  2Y75 A;  2PFB A;  2Z99 A;  1H9G A;  1ZRE A;  4A0Y A;  1H0M A;  3M1E A;  3BP8 A;  3T1B A;  3RPQ A;  4I98 B;  3V8L A;  2HKO A;  4KUM A;  2XAQ A;  4EM1 A;  1UB9 A;  4HOB A;  2GXB A;  3JTG A;  1KYZ A;  5CVI A;  2L01 A;  3R61 A;  5LRS A;  3D5L A;  1IN8 A;  3SZT A;  2VN2 A;  1QQI A;  3HRM A;  3LQQ A;  3HSE A;  2YR2 A;  2EV0 A;  2F5E A;  5FB2 A;  4AWX B;  1TW3 A;  3WTY C;  3F8C A;  1LB2 A;  4UNO A;  1KU9 A;  5ERI A;  3I53 A;  3F23 A;  1MJ9 A;  3O6B B;  2JZY A;  1LDK B;  3ULQ B;  1ZRD A;  3TO9 A;  3WU1 B;  4LMY A;  2V1U A;  3HRU A;  4CO8 A;  1TQI A;  4HLY A;  4RAZ A;  2QQA A;  3B02 A;  2V6C A;  2VOP A;  3JTH A;  4CXF A;  1W4M A;  1B9M A;  1KQ0 A;  3F72 A;  3KP2 A;  1BI1 A;  2P5K A;  1P92 A;  1GHC A;  3C18 A;  2NS0 A;  3E5X A;  2G7H A;  2HYG D;  2XHK A;  2LSO A;  3I58 A;  2E1C A;  5DCM A;  4ETS A;  2IW5 A;  5LRR A;  3Q9V A;  1Z1D A;  1XDS A;  5KK1 A;  4DQ2 A;  2FNP A;  1DPR A;  3V8K A;  1NHA A;  3QAH A;  4M9Z A;  4YFN F;  4IHT A;  1BM9 A;  5D8L B;  2ZFW A;  5LEK A;  2O03 A;  2O6G E;  2CW0 F;  3BZ6 A;  2LKP A;  1BBY A;  4CIC A;  4N0B A;  3SHF A;  5L3F A;  4MTD A;  2G9W A;  1ZGJ A;  4MNU A;  3F8F A;  3P9C A;  4KA4 A;  1YG2 A;  2MLK A;  3BY6 A;  1R1T A;  1EV7 A;  2QWW A;  4BXU A;  2ZKZ A;  2J5P A;  3ZN0 A;  1TNS A;  1RI7 A;  2XAF A;  2XIG A;  4DNC A;  5JFR A;  1OYY A;  2UWM A;  1B59 A;  2X0L A;  3O2P E;  1MDM A;  2IP2 A;  3MZY A;  2QLZ A;  3IHU A;  1S3J A;  3IL2 A;  5FGM A;  3FMS A;  3FMR A;  3CO7 C;  5BPD A;  5IT9 K;  3MCZ A;  4M71 A;  3H3U A;  1G3T A;  4HF0 A;  1IF1 A;  1QBJ A;  5LGU A;  2W85 A;  2OU2 A;  5AON A;  1XMA A;  1SFX A;  4N9H A;  1SD5 A;  3GWZ A;  1KU2 A;  4P96 A;  4U7B A;  4HZF A;  4ENJ A;  3FHZ A;  1L0O C;  2DLL A;  1ULY A;  2Z9O A;  1U5T B;  1MJB A;  2JPC A;  3Q5F A;  1BI3 A;  1YLF A;  4IRG A;  1UST A;  1FY7 A;  2ISZ A;  4O3M A;  1F5T A;  3K69 A;  3T8R A;  4RB3 C;  2HQR A;  2RGV A;  4EJT A;  4ON0 A;  4LB6 B;  4BYY A;  5AIQ A;  5IT3 A;  2A3S A;  4RGX A;  3KP3 A;  4BHP A;  1YTY A;  4R1H A;  4NQW A;  1XN7 A;  4A2U A;  1U5T C;  1ON1 A;  1QO0 D;  1YIO A;  4ENN A;  2K4B A;  1T39 A;  6PAX A;  4ZYD A;  2HWV A;  4CHU A;  2BV6 A;  3N97 A;  1JXS A;  3PQJ A;  3ERE D;  4G6D A;  3CTA A;  5DV5 A;  1Y0U A;  2HDC A;  5K5Q A;  3CUQ B;  2VT2 A;  4AIH A;  1IXS B;  1BI2 A;  2UXN A;  1FWZ A;  4R8H A;  2JT1 A;  3TDZ C;  1OYI A;  4F7Z A;  2W57 A;  2VOO A;  4M9X A;  2DQR A;  3HYI A;  1O3T A;  3CUQ A;  2ACJ A;  3N4M A;  5FFX A;  2L02 A;  1STZ A;  1K79 A;  3SQN A;  2MA3 A;  1QZZ A;  2EK5 A;  4Q5S F;  2HTJ A;  4PZJ A;  1O7L A;  3DPL C;  2P6T A;  2QVO A;  3GEZ A;  2Q2E A;  2RV8 A;  4L5I A;  1MKM A;  4P9U A;  1YW7 A;  2MLG A;  4A6D A;  2W24 A;  3ECH A;  2A68 F;  1J7K A;  1S6L A;  1PDN C;  4UUV A;  1EH8 A;  3T8T A;  3FX3 A;  2XGX A;  5HLH A;  1O3S A;  4ZZD A;  4KMF A;  4K2E A;  4MEY F;  3WTU C;  1SAX A;  1ZYR F;  2H6C A;  4KFC A;  5LHG A;  4IPA A;  3DXJ F;  2QUF A;  5D4S A;  2BGC A;  3M8F A;  4HX7 A;  1TLH B;  3KLO A;  3NEU A;  4YIF A;  1IN5 A;  1IRF A;  2HTS A;  4IJA A;  2EFN A;  1YW9 A;  3O3K A;  2K86 A;  3CLO A;  3IWF A;  3LA3 A;  1G3W A;  2EA4 A;  4LD5 A;  3BJA A;  3QU3 A;  3E97 A;  3WTX C;  4WXC A;  2GWR A;  4A12 A;  3RJP A;  2EB7 A;  3HUG A;  4UV9 A;  4G7H F;  1FP2 A;  3F3X A;  2PMH A;  3LWF A;  3FMQ A;  4B09 A;  3H3Z A;  2Q0O A;  2YSR A;  3VB2 A;  1Z9C A;  1D5V A;  1T38 A;  1W7P D;  4G7Z F;  5ICE A;  2JSC A;  1Z6T A;  4KIF A;  2OD5 A;  4KYW A;  1JE8 A;  2WWY A;  5LLQ A;  3TGN A;  2GQQ A;  2PEX A;  3DP7 A;  3IC7 A;  3JAM K;  1FP1 D;  1WKM A;  5DDG A;  2VBW A;  1U2W A;  3QU6 A;  1LEB A;  3DV8 A;  3RKY A;  4CGZ A;  1WSU A;  2HS5 A;  2YX4 A;  3MWM A;  1D8J A;  4ZYE A;  1HBX G;  2QYO A;  3R0J A;  1O57 A;  5HS9 A;  3G73 A;  1Z05 A;  2GZW A;  1HW1 A;  4HA8 A;  1XGM A;  1XB4 A;  3SXY A;  2BYV E;  3J81 Z;  3IKV A;  2COM A;  2HOE A;  1FYK A;  3L7W A;  1QZY A;  4M9S A;  5BOX A;  1XMK A;  1RUN A;  1HKT A;  2QEN A;  3MEX A;  4CZZ A;  1W7P B;  1TBX A;  4IVN A;  1HKS A;  3KEQ A;  4WXD A;  4U88 A;  4WX9 A;  2VBY A;  2NNN A;  3DKW A;  5L3G A;  3KZY A;  3GVA A;  4BQA A;  2ELH A;  2EA2 A;  2A69 F;  1E2X A;  1F4K A;  3OOP A;  1F1Z A;  3E5Q A;  5EEH A;  2XAG A;  2OQR A;  4L9N A;  2ZO4 A;  4MQV A;  5CVJ A;  2PG4 A;  1SMY F;  2F5D A;  2GXG A;  1GXQ A;  4I7H A;  4RB0 A;  2HEO A;  2UXX A;  2DPU A;  4KNY A;  2D2W A;  1DUX C;  3FF5 A;  2QBY B;  2WC2 A;  4FX4 A;  4IXA A;  2CQK A;  1ZH5 A;  3M7G A;  4RGR A;  4U0Y A;  4FHT A;  4JQF A;  2XRO A;  3HOT A;  2RDP A;  5FFZ A;  4WK8 F;  4P5O A;  1SFU A;  4RB2 C;  2QBY A;  4RB1 A;  3WTT C;  1WWX A;  4M72 A;  1IUY A;  1PP8 F;  2DPD A;  1XSD A;  3AAF A;  1SMT A;  3IRR A;  5HDK A;  4S05 A;  4EM0 B;  2NYX A;  4YG2 F;  4LK0 F;  4ZZL A;  1S29 A;  5HLG A;  3KP6 A;  2Q8K A;  2Z33 A;  4EGY A;  1LVA A;  5JHU A;  2VE8 A;  2K7L A;  3EQL F;  2IVM A;  2IT0 A;  2ZME B;  4U0V A;  3PQK A;  4P55 A;  4I01 A;  4M74 A;  4M73 A;  4OOI A;  4HV6 A;  1C0W A;  3T5X A;  2HYF A;  4A0Z A;  3DPT A;  3HHG A;  1HST A;  2CYY A;  3M8E A;  2AXL A;  2P4W A;  3ABU A;  1R58 A;  4OIR F;  5K1Y A;  1P4X A;  3HSR A;  1R00 A;  3GF2 A;  2F2E A;  2CGP A;  1HQC A;  1IN7 A;  1FLI A;  1T6S A;  2RKH A;  2GIV A;  2VE9 A;  5LHI A;  2YPR A;  3E6M A;  2UZK A;  3VOD A;  1J5Y A;  1TTY A;  2HR3 A;  4PCQ A;  3RI4 A;  3K1N A;  2FXA A;  4OIP F;  2EWN A;  3QP6 A;  3KFW X;  5CLS A;  3CJN A;  1J0R A;  3GLX A;  3P7N A;  4FX0 A;  2A07 F;  2DBB A;  1SFE A;  4EVI A;  5D6F A;  2O3F A;  4UXN A;  3K2Z A;  5HDN A;  2QZ8 A;  2ZBK A;  4PDK A;  3RTR A;  4I0B A;  3FWE A;  1IXC A;  3I4P A;  4EJO A;  1PUE E;  2P5V A;  1CGP A;  2H6B A;  3WG9 A;  5E8G A;  5CVU A;  4M6Y A;  2FSW A;  1IN6 A;  5E1X A;  4OMZ A;  3ECO A;  4HAM A;  3GFM A;  5J8C A;  2B0L A;  1IW7 F;  1CF7 B;  5L3C A;  2OAZ A;  2DFI A;  4KT5 C;  3TOA A;  1QNT A;  3GUD A;  2JPB A;  1T0F A;  5E1W A;  1AOY A;  4B8X A;  1ZRC A;  1LDD A;  2R3S A;  4A0X A;  1U5T A;  4GGG A;  1J9I A;  3RYR A;  1CF7 A;  2EFO A;  5HVQ C;  4NHJ A;  1FYM A;  4U0W A;  3F8M A;  2VOD A;  4BNC A;  4HYE A;  2DTR A;  3E6D A;  3I5U A;  5KVR A;  1U8R A;  3MQ0 A;  3G3Z A;  4D0P A;  1ZHF A;  4HQE A;  3GO5 A;  1IAW A;  3LFK A;  2XAH A;  3GW2 A;  3WOD F;  3ZPL A;  4TV7 A;  2L4A A;  1LDJ A;  5L3D A;  1KQ8 A;  3BOQ A;  1FC3 A;  5ILU A;  2STW A;  2A6E F;  4LG0 B;  3J80 K;  4HDU A;  1J2X A;  2PBI A;  5FLX K;  2J5O A;  4KN7 X;  2FA5 A;  1YS6 A;  2RVC A;  2L3D A;  2PN6 A;  2NRA C;  2VT3 A;  4QWQ A;  4L18 B;  1FSH A;  1HSJ A;  1I27 A;  1MGT A;  1WQ2 A;  2XAJ A;  5HOO A;  3E6B A;  1FPQ A;  4LG0 A;  5FD5 A;  2E1N A;  3V7R A;  1KGS A;  3I71 A;  2VBX A;  4Y17 A;  2OA4 A;  4MEX F;  3EUH A;  4YFK F;  2CSO A;  5CVR A;  4I2O A;  5A2Q K;  2FML A;  5H6R A;  2BE5 F;  4HF1 A;  5IT9 Z;  4BHC A;  1U3E M;  3WTS C;  2DI3 A;  1RZ4 A;  2M1B A;  1KU7 A;  4GXO A;  4KIG A;  5J8F A;  2KIF A;  2L54 A;  4YFX F;  4UHT A;  5DCF A;  3GXO A;  1S7O A;  3L9F A;  2DQL A;  3SFZ A;  3ZQ7 A;  2VC1 A;  2HKX A;  1OR7 A;  1Z91 A;  5BS6 A;  5DD8 A;  5HS7 A;  3R60 A;  1JGS A;  2PLY A;  3VFZ A;  3GFI A;  3E3V A;  4R79 A;  3W6K B;  3KET A;  2GA1 A;  1UHW A;  2VC0 A;  3D0S A;  5EEG A;  2Y0M A;  1BOA A;  3R4K A;  3KE2 A;  3ROU A;  1RIO H;  2CO5 A;  2WV0 A;  4ESF A;  1R7J A;  2RQP A;  4N9I A;  1XGN A;  5FO5 A;  3HRS A;  5FD6 A;  4GYI A;  2XAS A;  2A5Y B;  4ZYG A;  1ZG5 A;  1Z6R A;  2V1D A;  3WTV C;  4EJW A;  2A61 A;  2OBP A;  3L00 A;  5CVV A;  2IA2 A;  2GA2 A;  2V79 A;  1XSV A;  2LNB A;  3ML6 A;  1DPU A;  3NRV A;  2ZJ2 A;  1XCV A;  1QGP A;  4WF2 A;  2FEZ A;  4RGU A;  4P9F A;  4AIK A;  4AIJ A;  5FLX Z;  1MJA A;  1FBU A;  2IJL A;  1GXP A;  1J59 A;  4LGW A;  4EJV A;  3M9A A;  1KA8 A;  1R5H A;  2K27 A;  2JTV A;  2DT5 A;  1R22 A;  3BRO A;  1K78 B;  3ZP5 A;  3CUO A;  4ESJ A;  1U6G A;  3WGG A;  3BPV A;  1EH7 A;  1HW2 A;  1ZRF A;  1G6N A;  5CJ9 A;  1FT9 A;  5LHH A;  1S7A A;  3LA7 A;  4UVB A;  1L3L A;  1LQ1 A;  3ZMU A;  1K78 A;  5DYM A;  4EV0 A;  3RKX A;  2FE3 A;  1MD0 A;  1UFM A;  4KIB A;  5H6Q A;  2DO7 A;  5BQT A;  1P4A A;  4EQQ A;  4HQM A;  3HTS B;  1XCB A;  3S2W A;  5J6X A;  1SD6 A;  2XKO A;  3RDI A;  5E18 F;  2ESN A;  5HLI A;  4LLN A;  3KEO A;  3ZMS A;  4HDV A;  4KN4 X;  4L9V A;  4LB5 A;  2CFX A;  3KZZ A;  2M8E A;  2FBH A;  3OV8 A;  3EET A;  3W6J B;  2KJC A;  2Z3Y A;  5JR3 A;  3L2C A;  5BPI A;  4EGZ A;  3EDP A;  5TRD A;  5D5U B;  1A04 A;  1I5Z A;  2M30 A;  1W7P A;  2G7U A;  3HHH A;  4IF4 A;  4EM2 A;  3DEU A;  4GCV A;  3U2R A;  3IRQ A;  2OQG A;  3QPH A;  4MGR A;  3JSO A;  1IN4 A;  2ADU A;  2BEO A;  2M45 A;  4OIQ F;  2KJB A;  3FM3 A;  4G94 A;  1T98 A;  2ZXJ A;  2D1V A;  5ED4 A;  3WTW C;  3DQV C;  3F6V A;  2XRN A;  4Q4Z F;  1OMI A;  4I09 A;  3VEP A;  2DU9 A;  2VXZ A;  4WWC A;  5L3E A;  1IXR C;  2W25 A;  3VOE A;  4FT8 A;  3T0Y A;  3ELK A;  2LF8 A;  4PGH A;  3RKW A;  3KP4 A;  1I1G A;  4Z2Y A;  2RNJ A;  4IHS A;  3ZMV A;  2Z5U A;  4ESB A;  4MHG A;  1R23 A;  2QQB A;  2TDX A;  3BWG A;  3KP7 A;  3I54 A;  1FBQ A;  2A6H F;  2FOK A;  5DUK A;  1FSE A;  5LGN A;  2HGC A;  1R5G A;  2FU4 A;  3GZ6 A;  1V3F A;  1TQP A;  1YQA A;  4EJU A;  5D4R A;  1JHH A;  1LNW A;  1YS7 A;  3EYY A;  3JAM Z;  3QOP A;  4YII A;  4JK1 X;  2P6S A;  3FXU A;  4LLL A;  1B4A A;  4XLN F;  3GFJ A;  2P7C B;  5ICC A;  2HFH A;  4A6E A;  3DFG A;  3QRF F;  1ZLK A;  1BC7 C;  3FZV A;  3SZP A;  3ISP A;  2EV5 A;  3QPT A;  5F1R A;  5F6F A;  4H0E A;  1AWC A;  1HW5 A;  2D45 A;  3HSF A;  1VTN C;  5DCM B;  4L5J A;  2XVC A;  3K1M A;  4HX4 A;  4PGG A;  1P6R A;  2EFQ A;  1FNN A;  2ZME A;  1REP C;  1FZP B;  3K0L A;  2EV6 A;  1FBS A;  2FMY A;  2JRT A;  1MZB A;  2V1X A;  5LGT A;  5DD4 A;  4ZH4 F;  5JI6 A;  3RPU A;  1U78 A;  3HTU A;  2ISY A;  3L09 A;  3CDH A;  4OU0 A;  4Y15 A;  2QQ9 A;  1KQ9 A;  1HXD A;  4O6J A;  4U7D A;  1V4R A;  4L0Y B;  3BJ6 A;  2AS5 F;  3E6C C;  4L9T A;  1W5S A;  2FBI A;  2GAU A;  1FOK A;  1G3Y A;  1OYW A;  4KDP A;  4GYG A;  3P9K A;  2P5L C;  5DUI A;  2MH9 A;  1S8N A;  2QM3 A;  1MDM B;  3LA2 A;  3U9G A;  3TDU C;  3B73 A;  3NQO A;  1TW2 A;  2DK8 A;  3C1D A;  3ZN1 A;  1I6X A;  3REO A;  3ZMD A;  1FX7 A;  4Y13 A;  5D5W B;  3LST A;  3JSP A;  2O0Y A;  4JBA A;  1ZGA A;  2KIU A;  3HIF A;  4ZYH A;  3TKY A;  4LJZ F;  2IPQ X;  3R0A A;  2FNA A;  2YU3 A;  1J75 A;  2C6Y A;  5DEQ A;  4WCG A;  1IZ1 A;  3GX4 X;  2VBZ A;  1YW8 A;  4GO1 A;  3GYH X;  2PI0 A;  2FQ3 A;  1BIA A;  2PQ8 A;  2L4M A;  1ZG3 A;  2MD5 A;  4RS8 A;  1O7F A;  2DAO A;  2E7X A;  5ICF A;  1K7A A;  3IWZ A;  2DK5 A;  3ZMT A;  2X4H A;  2ESH A;  3WE3 A;  2RN7 A;  2P7V B;  3P9I A;  2V9V A;  3CO6 C;  1ON2 A;  3KP5 A;  4RGS A;  1B6A A;  3LQR A;  1R1U A;  3WU0 A;  2BBY A;  4LK1 F;  4CDG A;  4Q48 A;  4KIC A;  2NNY A;  1JHF A;  4G6Q A;  1KYW A;  5ILV A;  2F5F A;  1SD7 A;  5LBQ A;  1P4W A;  5K5O A;  3MZH A;  1BJA A;  4G8X A;  4ENM A;  3F6O A;  1UHM A;  3MAJ A;  2E7W A;  4S04 A;  4XRF A;  3F8B A;  1ZN2 A;  2VON A;  2EFW A;  1EH6 A;  3TO7 A;  1FYL A;  2HZT A;  4BAY A;  4OIN F;  1T2K A;  1D3Y A;  5TJJ A;  1RNL A;  1OKR A;  1DDN A;  3IKT A;  1X3U A;  2PMU A;  2LF7 A;  1XSX A;  2R7D A;  2P8T A;  3WTZ A;  1PP7 U;  4I0A A;  2ZNY A;  1BI0 A;  1ZAR A;  2FBK A;  2IA1 A;  2RC4 A;  2O8X A;  4KMU X;  3QP5 A;  3K1P A;  3V8J A;  2CWE A;  4IRI A;  2STT A;  3J7A O;  4UVA A;  4HLX A;  1Q1H A;  4MQ9 F;  2KKO A;  2O61 A;  2LDU A;  5BMZ A;  1BC8 C;  1BIB A;  5ILS A;  5L3B A;  5E17 F;  4BH9 A;  1ZAO A;  3F21 A;  5D6E A;  1R1V A;  3CUQ C;  1KU3 A;  3HOS A;  5D5V B;  5ICG A;  4IRH A;  3TO6 A;  1YYV A;  3H92 A;  4O5V A;  4LFU A;  5K5R A;  1O3R A;  2YX7 A;  3ABT A;  4UV8 A;  4Q47 A;  1XGO A;  1ONV A;  3C7J A;  3MFK A;  2OZU A;  4XSZ F;  3TQN A;  3J81 K;  5E8I A;  1D8K A;  4G7O F;  1UCR A;  2H94 A;  4UVC A;  5LEJ A;  4NB5 A;  5CYV A;  2NAZ A;  2K02 A;  1OPC A;  3RYP A;  3WGI A;  3Q9S A;  1DP7 P;  1B9N A;  1LEA A;  2KIM A;  3BJO A;  3DF8 A;  4QLC U;  3GFL A;  1G4D A;  3LAP A;  3C3W A;  5D5X B;  4L9J A;  3KLN A;  4OIO F;  1ZLJ A;  1F9N A;  3BPX A;  3U1D A;  2PJP A;  3COA C;  1Z7U A;  3WE2 A;  3E5U A;  2CG4 A;  5E20 A;  4OMY A;  4HW0 A;  1USS A;  1TQM A;  4A5M A;  3I59 B;  2H27 A;  3I0T A;  4AVP A;  4ASN A;  1RUO A;  1P2F A;  2XKP A;  5F64 A;  2ETH A;  3J80 Z;  1W5T A;  4A5N A;  1WI9 A;  1I1S A;  1R36 A; 
#chains in the Genus database with same CATH topology
 2EJR A;  2XDV A;  3VYT B;  3P5J A;  3CP8 A;  1UG0 A;  3V7C A;  1K6O A;  3I59 A;  2FF4 A;  3FM5 A;  1UG2 A;  2R7X A;  1G3S A;  4Y4R A;  3RQ4 A;  1TP4 A;  4ITV A;  3DLA A;  1RKT A;  4XN0 A;  1MNM C;  2DA5 A;  3VDX A;  3ZPL A;  3NWS A;  2OZ6 A;  2X9D A;  1WRJ A;  3WHC A;  2NVQ J;  5E79 C;  1QPM A;  3I64 A;  2XV4 S;  2F5C A;  2O5R A;  3WG7 H;  1LFP A;  3K4C A;  3ZRG A;  4LLG F;  2Y48 A;  4AD9 A;  1NH3 A;  2LMD A;  2XUB A;  1VQN I;  4A3M J;  1NTC A;  2WTE A;  4CYD A;  3FXQ A;  5A2Q Z;  1QU3 A;  1YFH A;  1LJ9 A;  4FCY A;  4A3I J;  2KRF A;  2M87 A;  4ENK A;  3LSH A;  2BHZ A;  4BBS J;  4D7M A;  4BQN A;  3FXR A;  3TOB A;  2KT0 A;  4HV5 A;  3RIR A;  3B6A A;  1QRY A;  3MKL A;  5HDG A;  3LAJ A;  3PFY A;  1Y0N A;  3KYC B;  3V4G A;  2W84 A;  3K9T A;  4M6X A;  2IS4 A;  4HX8 A;  1J09 A;  2XGE A;  4I02 A;  2K4J A;  1N75 A;  1XGS A;  3LSM A;  5HS8 A;  5J1U A;  2H09 A;  2A6T A;  4XBF A;  1SD4 A;  2EFP A;  2ZCW A;  3J7A Y;  4BL0 B;  2D1H A;  1Z3Y A;  2AHQ A;  1B1B A;  3CCV I;  4IOA F;  1GDT A;  2ID3 A;  2DW4 A;  4D9J A;  1JGG A;  3F8N A;  3HRT A;  3KCC A;  3PFI A;  4MTE A;  2DYS H;  1H9T A;  1TNT A;  1YO5 C;  2NVY J;  5EJC A;  1ENH A;  5IOZ A;  2MBF A;  3ZOB A;  4HBL A;  5AIP A;  3BDD A;  5E1Z B;  4C30 A;  2MH2 A;  2V9P A;  3F22 A;  3PNV A;  3H5N A;  1O3Q A;  4X1E A;  1GVJ A;  5JVT A;  2WY7 Q;  4D7N A;  2TRT A;  4XLP F;  4BHB A;  3AG1 H;  3ZMZ A;  1ODD A;  4BJ6 C;  4HF2 A;  1VF9 A;  2JJ7 A;  4E7S A;  1JKO C;  3Q0W A;  2IA0 A;  1WI3 A;  3EYI A;  2MD0 A;  2HQN A;  2YS9 A;  4EMS A;  5H20 A;  3R6S A;  2VI6 A;  4XKB A;  3KPH A;  5FKK A;  3JW4 A;  2M5W A;  2JSP A;  2ZNZ A;  2R7F A;  4QPO A;  1HKQ A;  1W5C C;  5D8K B;  4OAY A;  4UB8 C;  2IRF G;  3HBL A;  4G9Y A;  4L0Z B;  3Q3S A;  1ZG1 A;  2MC3 A;  2CV2 A;  2CV0 A;  1A31 A;  2FRH A;  1XDU A;  3GZ5 A;  4RAY A;  4XSX F;  1BN5 A;  1E17 A;  4HG2 A;  1XD7 A;  3V7S A;  3WGH A;  4E70 A;  1T95 A;  5B1B H;  4NNJ A;  1IRG A;  4NC6 A;  1YRN A;  3K4K A;  4WXH A;  1DU0 A;  2Y75 A;  3GTM J;  2PFB A;  2Z99 A;  1H9G A;  3QQA A;  4A0Y A;  1ZRE A;  4YIR X;  1H0M A;  3M1E A;  3BP8 A;  2CUZ A;  3RZO J;  1LVK A;  3T1B A;  3GTQ J;  3RPQ A;  4I98 B;  3V8L A;  2HKO A;  4XOT A;  4C3I J;  4KUM A;  2X48 A;  5FKM A;  2XAQ A;  4YRV A;  4E7I A;  4EM1 A;  1UB9 A;  2BHY A;  1XG1 A;  4HOB A;  2GXB A;  3JTG A;  3M1C A;  1FIP A;  1R4M B;  2L9V A;  3OY9 A;  1KYZ A;  5CVI A;  2L01 A;  3R61 A;  1YOV B;  1Y56 A;  5LRS A;  2DOD A;  3D5L A;  5FLV A;  1IN8 A;  2BXZ A;  3SZT A;  3HB9 A;  4GFB A;  2VN2 A;  1QQI A;  2DOA A;  4HSR A;  3HRM A;  3LQQ A;  4BXX J;  5E3N A;  5FRO A;  3HSE A;  2JVG A;  3ZQL A;  4NC8 A;  2DFF A;  2YR2 A;  3HJE A;  2EV0 A;  4W97 A;  2F5E A;  3LSG A;  5FB2 A;  4AWX B;  3DCF A;  5B3S H;  5C44 J;  1TW3 A;  3WTY C;  1EF4 A;  3MZ8 A;  2MC4 A;  4C3H J;  3F8C A;  1LB2 A;  1NK3 P;  2M2E A;  4UNO A;  1UHS A;  3K4L A;  1GV5 A;  2L7M P;  1IRZ A;  1KU9 A;  2DTZ A;  5ERI A;  3DBL B;  3I53 A;  1VFC A;  3F23 A;  1PUF A;  2ZJP F;  1MJ9 A;  3O6B B;  2JZY A;  4DYR A;  4B44 A;  4F3Q A;  1LDK B;  2DFE A;  3ULQ B;  1WGX A;  1ZRD A;  1MBH A;  5IP6 A;  4BS9 A;  3TL4 X;  3TO9 A;  5GTH C;  3WU1 B;  1TWA J;  4LMY A;  1ETO A;  2V1U A;  3HRU A;  4CO8 A;  1TQI A;  3H35 A;  4HLY A;  4RAZ A;  2QQA A;  3B02 A;  2V6C A;  4PSW A;  2VOP A;  1X3Z B;  3JTH A;  4OAZ A;  4CXF A;  1W4M A;  1B9M A;  1KQ0 A;  3F72 A;  4A3K J;  4BE2 A;  3OYE A;  4B3X A;  3KP2 A;  5DM7 F;  5J1R A;  1BI1 A;  4PJJ A;  2P5K A;  2F5V A;  3OS0 A;  1AKH A;  3HOY J;  1P92 A;  2EZL A;  3BR0 A;  1GHC A;  2H1K A;  3C18 A;  2NS0 A;  3E5X A;  2G7H A;  2HYG D;  2XHK A;  2LSO A;  3I58 A;  3IH2 A;  5FRM A;  3C2G A;  4BDY A;  1MSF C;  3AG3 H;  2E1C A;  5DM6 F;  5EGO B;  3S1R J;  1D0Z A;  3DKY A;  5DCM A;  4ETS A;  2IW5 A;  5LRR A;  3Q9V A;  1Z1D A;  1HDD C;  1XDS A;  1FMV A;  3QWL A;  5KK1 A;  5IYD J;  2ECC A;  4DQ2 A;  5CQE A;  2LOO A;  4LIU A;  1U9N A;  1IV6 A;  1EJ9 A;  1VQ6 I;  1JT6 A;  2WB1 N;  2FNP A;  2JA6 J;  1DPR A;  1OFC X;  3V8K A;  2R7W A;  3JRC A;  3ERM A;  1NHA A;  2EIM H;  1VZ0 A;  3QAH A;  3ABK H;  4M9Z A;  1H8A C;  4YFN F;  4GDF A;  3JRE A;  4IHT A;  2KMU A;  3DBH B;  1BM9 A;  1UZC A;  5EGO A;  2L9N A;  2M4K A;  2G0E A;  2X6O A;  2ZFW A;  5D8L B;  5C4X J;  1CQT A;  5LEK A;  4XRM A;  2E1M C;  2O03 A;  4JX4 A;  3O8H A;  3JRI A;  2O6G E;  3ABL H;  2CW0 F;  3OWT A;  2KIQ A;  2VQH A;  3C2B A;  3BZ6 A;  1POG A;  3IV5 A;  2DA6 A;  2MFZ A;  2LKP A;  1BBY A;  4CIC A;  2XC7 A;  2XRL A;  4N0B A;  5EYR A;  3SHF A;  5L3F A;  4MTD A;  2G9W A;  1ZGJ A;  4MNU A;  4EEF G;  3F8F A;  3P9C A;  4KA4 A;  1YG2 A;  2MLK A;  2P0W A;  3BY6 A;  3CZ6 A;  1R1T A;  2QSG X;  1EV7 A;  1MSE C;  2QWW A;  3GLL A;  3DU5 A;  4BXU A;  1FTZ A;  2DOE A;  2ZKZ A;  2J5P A;  2HPM A;  3ZN0 A;  1TNS A;  1RI7 A;  2GOM A;  4P1W A;  2XAF A;  2XIG A;  2K9S A;  4DNC A;  2XSJ C;  3C2H A;  1OYY A;  5JFR A;  2UWM A;  1B59 A;  3I3L A;  2X0L A;  3CCS I;  3O2P E;  2R5Z A;  1MDM A;  1GLN A;  3PNY A;  4CCJ A;  2IP2 A;  3L2U A;  3MZY A;  2CS3 A;  2QLZ A;  2EZI A;  4E7Z A;  2JMW A;  1S3J A;  1XMX A;  3IHU A;  4UUS B;  3IL2 A;  4IOC F;  1K4S A;  3B6C A;  1BA5 A;  5FGM A;  4N4N B;  3FXO A;  3FMS A;  3FMR A;  3BT9 A;  3CO7 C;  5BPD A;  5IT9 K;  3MCZ A;  3FXJ A;  2LVS A;  2LRD A;  2HOT A;  2ZJR F;  4A3E J;  1A6Q A;  4II3 A;  4LG3 A;  2LYC A;  1WCM J;  1YHQ I;  3DWL E;  3FXL A;  1Y8Q B;  4M71 A;  5F0H A;  3H3U A;  1G3T A;  2I8D A;  4HF0 A;  1IF1 A;  1QBJ A;  3DU6 A;  5LGU A;  3GTO J;  2CW8 A;  2W85 A;  1D1C A;  2OU2 A;  3M8J A;  2GOX B;  5AON A;  1XMA A;  4XRS A;  1SFX A;  2CW7 A;  2GIZ A;  3BLY A;  2DA3 A;  1BW5 A;  4N9H A;  1SD5 A;  3GWZ A;  3A1Y A;  1KU2 A;  4P96 A;  1MMG A;  5GPC A;  4U7B A;  3W6V A;  2F48 A;  4HZF A;  4QTR A;  4ENJ A;  5F0F A;  3FHZ A;  1L0O C;  4XM3 A;  1D1A A;  2DLL A;  1ULY A;  1FOY A;  2Z9O A;  1U5T B;  1MJB A;  3FBN B;  1PVE A;  2JPC A;  3Q5F A;  2MYS A;  1BI3 A;  3H9J A;  1MND A;  1YLF A;  4IRG A;  3ESW B;  1UST A;  1FY7 A;  2ISZ A;  4O3M A;  4PJN A;  1F5T A;  3QYF A;  1OQY A;  3K69 A;  4Y3O A;  3T8R A;  4RB3 C;  1FMW A;  2E60 A;  3CMA I;  2HQR A;  2RGV A;  4EJT A;  2QKM B;  5GAE J;  4ON0 A;  1IJW C;  4UB6 C;  2LRE A;  4LB6 B;  3QOE A;  4D5F A;  4F91 B;  4BYY A;  5AIQ A;  3FK7 A;  5IT3 A;  1W36 D;  1OIS A;  2A3S A;  1FOW A;  4RGX A;  3KP3 A;  4M3F A;  4BHP A;  1YTY A;  4R1H A;  2HQ5 A;  4NQW A;  1XN7 A;  4A2U A;  1LUJ B;  1U5T C;  1A35 A;  1ON1 A;  2QA4 I;  1QO0 D;  4IQ4 A;  1YIO A;  1ITY A;  4E6K G;  4ENN A;  3IAM 2;  2K4B A;  3FDY A;  1VQP I;  1T39 A;  6PAX A;  4ZYD A;  2BY2 A;  1MMA A;  4BBR J;  4HNT A;  2HWV A;  2EPF A;  4RA2 A;  1N77 A;  1GT0 C;  2HDW A;  2Y9Z A;  4CHU A;  3BG3 A;  2BV6 A;  4PUS A;  3HOX J;  3JRF A;  4XIC A;  3CDI A;  3N97 A;  1JXS A;  1E0E A;  3PQJ A;  3VYS B;  1OCC H;  3ERE D;  3O8G A;  4G6D A;  4M6V A;  3CTA A;  5DV5 A;  1Y0U A;  2HDC A;  4CYC B;  5M5W J;  3M4O J;  3CP2 A;  5K5Q A;  3CUQ B;  2VT2 A;  3LSP A;  1ZR4 A;  3D5R C;  4AIH A;  1T56 A;  4Y52 J;  1IXS B;  1BI2 A;  4BEH A;  2UXN A;  1FWZ A;  4C2M J;  1UEL B;  4II2 A;  4R8H A;  2JT1 A;  2LC2 A;  3TDZ C;  2HVQ A;  1OYI A;  3UKG A;  1LPQ A;  4F7Z A;  3BTI A;  1Y8R B;  2W57 A;  2LK2 A;  5J47 A;  2VOO A;  4M9X A;  2DQR A;  3HYI A;  1O3T A;  3CUQ A;  3NAU A;  2ACJ A;  3MD2 A;  2NXN B;  3N4M A;  4IO9 F;  5FFX A;  2JUC A;  4AUX A;  4C9Y A;  4CCK A;  1BR4 A;  2L02 A;  2Q2E B;  1JTX A;  2NS7 A;  1STZ A;  4M3D A;  1K79 A;  1TWC J;  3SQN A;  2MA3 A;  3K4N A;  4FIS A;  1QZZ A;  3ONQ A;  3VYU B;  5M3M J;  2EK5 A;  3EUH C;  2HVR A;  4Q5S F;  2HTJ A;  4PZJ A;  3OYN A;  2OF7 A;  2KZG A;  1O7L A;  3DPL C;  2P6T A;  5M3F J;  2L7K A;  1TT0 A;  2QVO A;  3K10 A;  3GEZ A;  2Q2E A;  2RV8 A;  4L5I A;  5JLX A;  3MKY B;  1MKM A;  4P9U A;  2M4G A;  1YW7 A;  1TT5 B;  4KIT B;  1R36 A;  2MLG A;  2RNG A;  3BC8 A;  2W24 A;  4A6D A;  3ECH A;  2A68 F;  1J7K A;  1S6L A;  2KDO A;  1DQU A;  1PDN C;  3ASO H;  4UUV A;  1EH8 A;  1W0T A;  3T8T A;  4JYK A;  1MNE A;  1MBG A;  2LKS A;  3FX3 A;  2H1L A;  1S9H A;  2XGX A;  2CUF A;  4JX6 A;  3BQY A;  5M5Y J;  1UJ8 A;  5HLH A;  2MSY A;  1O3S A;  3JRG A;  4ZZD A;  4KMF A;  2XF7 A;  4K2E A;  4MEY F;  3WTU C;  1SAX A;  2O9L A;  4MIM A;  1ZYR F;  1G59 A;  2H6C A;  2L9S A;  4KFC A;  5LHG A;  1ERD A;  4IPA A;  4LIV A;  2CUJ A;  3DXJ F;  4CCL A;  2QUF A;  1HA8 A;  5D4S A;  1UMQ A;  2BY1 A;  1JT0 A;  2BGC A;  4AID A;  1OR7 C;  3M8F A;  4HX7 A;  4E4H A;  1TLH B;  3KLO A;  3OYD A;  1WJB A;  3K70 C;  3NEU A;  4YIF A;  1IN5 A;  3W2V A;  1IRF A;  2HTS A;  1WVR A;  2QSH X;  4IJA A;  5KNL A;  2AQE A;  2EFN A;  3S15 J;  3H9G A;  3HGG A;  3HUG B;  3ASN H;  1YW9 A;  3O3K A;  1E3O C;  2K86 A;  3CLO A;  4ZDL A;  2OTL I;  1OCR H;  3IWF A;  1RRJ A;  4DIQ A;  3LA3 A;  2DMU A;  3KEY A;  2A5W A;  2LKX A;  4A3B J;  2VJJ A;  1G3W A;  2EA4 A;  4LD5 A;  4J00 A;  2KRC A;  3BJA A;  2VJ5 A;  3QU3 A;  3E97 A;  3WTX C;  3JCU C;  1MBF A;  1X2N A;  5EZG A;  4WXC A;  4DW6 A;  1UAA A;  2GWR A;  3ZQQ A;  4A12 A;  3VSK A;  2DFH A;  2UV1 A;  2VQG A;  3RJP A;  1HC8 A;  1K61 A;  4MFE A;  2DT6 A;  2EB7 A;  3CCR I;  3HUG A;  4UV9 A;  1Z0X A;  4G7H F;  1FP2 A;  3F3X A;  2PMH A;  2Y9Y A;  3LWF A;  3FMQ A;  2KZV A;  2Y0S A;  4B09 A;  3H3Z A;  2Q0O A;  2YSR A;  3CC4 I;  3VB2 A;  1P7I A;  3NWT A;  4BJT A;  1Z9C A;  3S2D J;  1D5V A;  4A3L J;  1T38 A;  1AHD P;  1W7P D;  3A02 A;  4G7Z F;  4Z6Y A;  4DGW B;  2EIN H;  5ICE A;  4BY7 J;  3RZD J;  3PO3 J;  4HNV A;  2JSC A;  3OSF A;  3HGY A;  1Z6T A;  4KIF A;  3OL4 A;  2BY0 A;  2A05 A;  3FK6 A;  1VQM I;  2OD5 A;  3DPU A;  4KYW A;  1AA7 A;  2M9H A;  3PM1 A;  5FKL A;  2EIJ H;  2WWY A;  1JE8 A;  5LLQ A;  3TGN A;  5F0C A;  4MFD A;  2GQQ A;  2PEX A;  2VJI A;  3DP7 A;  3IC7 A;  3HPH A;  3JAM K;  2ZJQ F;  3S1Q J;  1FP1 D;  1WKM A;  1OCT C;  1VQ5 I;  3TP0 A;  2JK3 A;  4XLC A;  5DDG A;  3OYL A;  1PYV A;  1ETX A;  3DTK A;  2VBW A;  1U2W A;  4HRI A;  3QU6 A;  3SFI A;  1LEB A;  3DV8 A;  3RKY A;  2CJJ A;  2Y2Z A;  4CGZ A;  3ZQH A;  1S7E A;  2KIS A;  1WSU A;  4BDZ A;  2DN0 A;  1ZKG A;  5BNG A;  1K83 J;  2HS5 A;  1QHG A;  2YX4 A;  3MWM A;  1D8J A;  4ZYE A;  1HBX G;  2QYO A;  3R0J A;  3BR5 A;  1O57 A;  5HS9 A;  3G73 A;  1G2H A;  1Z05 A;  2GZW A;  1HW1 A;  4IL6 C;  1X1C A;  4HA8 A;  1N78 A;  1XGM A;  1XB4 A;  3SXY A;  1I3Q J;  4BQQ A;  1MMD A;  2BYV E;  3J81 Z;  1XX5 A;  2EQR A;  3IKV A;  2E2H J;  2OC6 A;  2E2J J;  2COM A;  1WJD A;  2CFO A;  2HOE A;  3MMY B;  1FYK A;  3L7W A;  1QZY A;  1P7J A;  4M9S A;  2E36 A;  2XB0 X;  5BOX A;  1XMK A;  1MMS A;  3KYD B;  1RUN A;  1HKT A;  1X4O A;  3OYH A;  2NOJ B;  2QEN A;  3MEX A;  4C3J J;  4EAT A;  4CZZ A;  1W7P B;  1TBX A;  4DZJ A;  2ZSI B;  4IVN A;  1HKS A;  1D0Y A;  2JQ7 A;  3KEQ A;  3QOD A;  2K3F A;  1T08 B;  1ETQ A;  2X85 A;  4WXD A;  4A93 J;  2Y31 A;  2DMN A;  2LR8 A;  4U88 A;  3GME A;  4WX9 A;  4CA0 A;  2M7B A;  2VBY A;  2HU9 A;  4D1Q A;  5HOD A;  2ICW G;  3GTK J;  2NNN A;  2N8G A;  3PUB A;  3DKW A;  5L3G A;  3KZY A;  3GVA A;  2R92 J;  1B8I B;  4BQA A;  2JN6 A;  2ELH A;  2EA2 A;  4FE7 A;  2CMP A;  1WH7 A;  4BE1 A;  2X6Y A;  2A69 F;  1E2X A;  3HOW J;  1X1D A;  4CZC A;  3MVP A;  3ZCO A;  1K4T A;  1F4K A;  3A0H C;  3PIP F;  2HVS A;  4MO7 A;  1WHU A;  2DCE A;  3OOP A;  5FKO A;  3SEZ A;  1F1Z A;  3E5Q A;  3OYJ A;  5EEH A;  1B8I A;  1HCR A;  1GVD A;  1T8I A;  2XAG A;  2OQR A;  4L9N A;  2ZB9 A;  2ZO4 A;  1ZGW A;  4FE4 A;  2MG4 A;  4MQV A;  5CVJ A;  3JRD A;  2PG4 A;  4XL9 A;  1SMY F;  2IGN A;  2ZXH A;  1YJN I;  3CQZ J;  2F5D A;  2ECB A;  2GXG A;  3K4M A;  1GXQ A;  2OUM A;  4I7H A;  4RB0 A;  2HEO A;  1VI0 A;  2UXX A;  3G71 I;  2DPU A;  5J4V A;  2ZXI A;  4KNY A;  2D2W A;  4DZP A;  1DUX C;  3PO2 J;  3FF5 A;  2QBY B;  3IH3 A;  2WC2 A;  3OR1 C;  2LH9 A;  1RR7 A;  1SC7 A;  1I39 A;  1IC8 A;  1D0X A;  2NVX J;  2M0M A;  4B1R A;  4FX4 A;  3H36 A;  2KL4 A;  4IXA A;  2KPM A;  2CQK A;  2ZC2 A;  1V5F A;  1ZH5 A;  3BG6 A;  3M7G A;  2X51 A;  3SJM A;  3H9Q A;  1RPW A;  2HDD A;  3ABM H;  4RGR A;  4DYC A;  4U0Y A;  4FHT A;  3L2R A;  4JQF A;  2XRO A;  3HOT A;  3ZR8 X;  2DMP A;  2VIX A;  2RDP A;  5FFZ A;  1IGN A;  4WK8 F;  4OWR B;  4P5O A;  1MBJ A;  2DDB A;  4RB2 C;  2IAI A;  1SFU A;  2QBY A;  1FTT A;  3FXM A;  3EUA A;  4RB1 A;  3WTT C;  2GBY A;  1R5I D;  3VYR B;  3BR1 A;  1WWX A;  2TCT A;  4FET A;  2VQL A;  4M72 A;  1IUY A;  1PP8 F;  3LSI A;  3CCJ I;  2DPD A;  1XSD A;  1ZR2 A;  2CQX A;  2KQR A;  1SMT A;  3AAF A;  2QF7 A;  4DJA A;  3D1N I;  3IAS 2;  1X4P A;  3IRR A;  3VWB A;  5HDK A;  1LKX A;  4S05 A;  1JUS A;  3DBR B;  2VPR A;  1MMN A;  4RLF A;  4EM0 B;  2NYX A;  4YG2 F;  4LK0 F;  4ZZL A;  1S29 A;  2JA7 J;  4JX5 A;  5HLG A;  3KP6 A;  1ZK8 A;  2K40 A;  3JRH A;  4Y7N J;  4X6A J;  2E2I J;  2Q8K A;  2P81 A;  4CCO A;  4F52 A;  2Z33 A;  4EGY A;  1LVA A;  3BG7 A;  5JHU A;  2VE8 A;  2IBD A;  3OMY A;  2K7L A;  3EQL F;  2IVM A;  2IT0 A;  3G2B A;  2EBI A;  2FX0 A;  2ZME B;  4U0V A;  3OS2 A;  3V42 A;  3PQK A;  4P55 A;  4I01 A;  4M74 A;  4M73 A;  4OOI A;  4HV6 A;  4AYB A;  2E1M B;  1BR2 A;  1C0W A;  3T5X A;  1OCP A;  2HYF A;  4A0Z A;  3H0G J;  1X2M A;  1SVL A;  2X6X A;  4UY8 I;  3DPT A;  1VQ9 I;  3H1C A;  3HHG A;  4CSW A;  1HST A;  2CYY A;  1BOB A;  3M8E A;  4D5C A;  2AXL A;  2K9N A;  3HZJ A;  2P4W A;  4RBO A;  3ABU A;  1R58 A;  3CF2 A;  4OIR F;  5K1Y A;  1P4X A;  2L0K A;  2ZME C;  3HSR A;  4BAC A;  3RKQ A;  1R00 A;  3GF2 A;  2BVM A;  2F2E A;  2CGP A;  1HQC A;  3CD6 I;  1I6H J;  1IN7 A;  3TBI A;  1FLI A;  1OLT A;  5DTD A;  1T6S A;  2RKH A;  2DA2 A;  2M34 A;  4A3J J;  3FXK A;  1WZ2 A;  2GIV A;  2VE9 A;  3CCU I;  1GUU A;  4N4O B;  5LHI A;  3VSL A;  2YPR A;  3E6M A;  2JRM A;  2UZK A;  3VOD A;  2NVT J;  2HOS A;  1J5Y A;  1TTY A;  2HR3 A;  4PCQ A;  3RI4 A;  3K1N A;  2R7V A;  1LFU P;  2FXA A;  3CC2 I;  3CF5 F;  1MW7 A;  4XOP A;  4OIP F;  2EWN A;  3QP6 A;  3KFW X;  1G8X A;  2HNH A;  5CLS A;  3AL0 C;  3CJN A;  1J0R A;  4FAS D;  3GLX A;  3P7N A;  4FX0 A;  2VKE A;  2A07 F;  2DBB A;  1SFE A;  4EVI A;  5D6F A;  4QPQ A;  1H88 C;  2O3F A;  4UXN A;  3BQZ A;  4RAF A;  3K2Z A;  5HDN A;  2QZ8 A;  2QEX I;  1TZL A;  1JTY A;  4QSH A;  2ZBK A;  4PDK A;  3RTR A;  4I0B A;  3FWE A;  1IXC A;  3I4P A;  5LFA A;  4EJO A;  4ZYA A;  1PUE E;  2WAF A;  1ETW A;  3BR2 A;  4PK4 A;  4XN3 A;  4ZTJ A;  2RAE A;  1TC3 C;  2P5V A;  2V9K A;  3KX2 A;  1CGP A;  2XB5 A;  4S0H B;  2H6B A;  2IEK A;  3WG9 A;  4UUS A;  4IHV A;  1GV2 A;  5E8G A;  3ZXS A;  1S5L C;  5FRN A;  5CVU A;  4M6Y A;  3EPZ A;  4BQO A;  2FSW A;  1R71 A;  4E7H A;  1IN6 A;  5E1X A;  2E1O A;  4OMZ A;  2I10 A;  3ECO A;  3GZN B;  3M3Y J;  4HAM A;  3GFM A;  5J8C A;  3GTG J;  2B0L A;  1YIT I;  1IW7 F;  3HEF A;  1CF7 B;  2ID6 A;  4RAG A;  1DU6 A;  2LY1 A;  4BKX A;  4XNF A;  2DYR H;  5L3C A;  4B48 A;  2OAZ A;  2JA8 J;  2V26 A;  2DFI A;  1YJ9 I;  1JJ8 C;  2KHM A;  1JKR C;  4KT5 C;  3TOA A;  1QNT A;  5CPR B;  3GUD A;  3W2A A;  2GLO A;  3D5S C;  2JPB A;  1Z67 A;  1T0F A;  5E1W A;  1RC9 A;  3CCQ I;  4ABZ A;  1AOY A;  4B8X A;  2KRH A;  3E7L A;  3K6G A;  1ZRC A;  1LDD A;  2ZFU A;  2R3S A;  4A0X A;  1U5T A;  4GGG A;  2NS8 A;  2L2O A;  1J9I A;  3RYR A;  1CF7 A;  1YX5 A;  1Z77 A;  2EFO A;  4DYQ A;  4V2F A;  3S17 J;  3J7Y J;  2WY8 Q;  5HVQ C;  4NHJ A;  3DKX A;  1FYM A;  4U0W A;  3F8M A;  3DLL F;  3CCM I;  2VOD A;  4BNC A;  4HYE A;  1DP3 A;  2DTR A;  3E6D A;  3I5U A;  5KVR A;  1U8R A;  4FQG A;  3MQ0 A;  3G3Z A;  3E0J B;  3CES A;  2V1N A;  4D0P A;  4BU2 A;  3S8P A;  1ZHF A;  4HQE A;  3LNQ A;  5IPA A;  2M8G X;  3GO5 A;  1IAW A;  3LFK A;  2XAH A;  1X19 A;  3TW7 A;  1WH5 A;  4XQF A;  4KT6 A;  1F36 A;  3IH4 A;  3GW2 A;  3OIO A;  4IEJ A;  2DA7 A;  3Q0U A;  4TV7 A;  1E3H A;  1Z21 A;  3WOD F;  2L4A A;  3K70 D;  2X1E A;  2EIL H;  1LDJ A;  5L3D A;  1KQ8 A;  2ZXW H;  4XKC A;  3BOQ A;  1FC3 A;  5ILU A;  2STW A;  2A6E F;  1QPI A;  4LG0 B;  1EKE A;  1DGW Y;  3J80 K;  2W7N A;  3A03 A;  3PIO F;  1YX3 A;  4IHY A;  2JUG A;  3F0C A;  3J7Z I;  4HDU A;  1J2X A;  2PBI A;  5FLX K;  2J5O A;  4KN7 X;  2FA5 A;  4PJL A;  1YS6 A;  2OTJ I;  2RVC A;  2L3D A;  2H8W A;  2M7A A;  2PN6 A;  2NRA C;  2VT3 A;  4QWQ A;  4L18 B;  5K7H A;  1FSH A;  2UUZ A;  2L7F P;  1HSJ A;  1I27 A;  1MGT A;  3AKZ A;  1WQ2 A;  2XAJ A;  2JA2 A;  3CCL I;  5HOO A;  4CYC A;  1A6I A;  3E6B A;  3CCE I;  3S3N A;  2R4G A;  1FPQ A;  4LG0 A;  3OYI A;  1IUF A;  5FD5 A;  2AO9 A;  1SAN A;  2E1N A;  3S93 A;  3V7R A;  2VLA A;  1KGS A;  3I71 A;  2PJR B;  1QVU A;  2VBX A;  2AQF A;  3AG2 H;  4Y17 A;  4GRI A;  2OA4 A;  2V4J C;  3K4J A;  3EUH A;  4MEX F;  2MAB A;  4YFK F;  2CSO A;  3RSN A;  3K4B A;  5CVR A;  4I2O A;  5J40 A;  5A2Q K;  2BVL A;  2WAE A;  2FML A;  5H6R A;  4PFP A;  1QA6 A;  2BE5 F;  4HF1 A;  4ZDP A;  3L2V A;  3BZC A;  5IT9 Z;  1RR8 C;  2F4O B;  4BHC A;  2PJR A;  3HPG A;  5F04 A;  3OYG A;  1U3E M;  3S16 J;  3FBI B;  3WTS C;  2DI3 A;  1QVT A;  2DA1 A;  2PMZ A;  1RZ4 A;  2M1B A;  2R7O A;  5TIS C;  3GTP J;  3JRB A;  1KU7 A;  4GXO A;  4KIG A;  2M3A A;  3PUF A;  5J8F A;  2KP6 A;  2KIF A;  1LFB A;  3GTJ J;  4PJM A;  2L54 A;  4YFX F;  4UHT A;  1R49 A;  4YEJ A;  3ZQG A;  5DCF A;  1YI2 I;  3GXO A;  1AU7 A;  1S7O A;  2VKH A;  4XMY A;  3L9F A;  2DQL A;  3SFZ A;  4IQJ A;  3ZQ7 A;  2VC1 A;  2HKX A;  1V5G A;  1OR7 A;  1Z91 A;  2CUE A;  5BS6 A;  1KON A;  2CQQ A;  5DD8 A;  5HS7 A;  1ETY A;  3R60 A;  1PJR A;  4JP0 A;  4BE0 A;  1WJE A;  2E5Z A;  2WAQ A;  2V6E A;  1JGS A;  3RQI A;  3ZGK A;  2ELK A;  3OL3 A;  3QYB A;  2PLY A;  2W00 A;  3CJQ B;  3VFZ A;  3E3V A;  4R79 A;  3GFI A;  4V19 K;  3W6K B;  2GA1 A;  3KET A;  4IHX A;  1UHW A;  2BW3 B;  4J19 A;  2VC0 A;  3D0S A;  5EEG A;  2Y0M A;  2CV1 A;  1SFO J;  1BOA A;  3R4K A;  1WJA A;  3GTL J;  3KE2 A;  2E71 A;  2WAQ N;  2HOA A;  3ROU A;  2CO5 A;  1RIO H;  2WV0 A;  4ESF A;  1R7J A;  2RQP A;  4N9I A;  1XGN A;  2K9Q A;  5FO5 A;  3HRS A;  5FD6 A;  1IDY A;  4GYI A;  2XAS A;  4XLE A;  2BW3 A;  4A3G J;  1NG7 A;  1Y6I A;  2A5Y B;  3TW6 A;  4ZYG A;  1VQ4 I;  1ZG5 A;  5E3O A;  4F55 A;  1Q1V A;  4B47 A;  2R0Q C;  2R7Q A;  1Z6R A;  2V1D A;  5HNF A;  3WTV C;  4EJW A;  4RDU A;  4QIW N;  1P9Q C;  2W82 A;  2A61 A;  1H89 C;  1RKW A;  2OBP A;  3S3M A;  1OCZ H;  3L00 A;  5CVV A;  3FHN A;  2IA2 A;  2GA2 A;  3CLQ A;  1ZQ3 P;  2V79 A;  1XSV A;  3TP3 A;  3IUO A;  2LNB A;  3ML6 A;  1Y39 A;  1DPU A;  1W1W E;  1WPK A;  3NRV A;  3ZQF A;  2ZJ2 A;  4U87 A;  3HC7 A;  1XCV A;  1QGP A;  4WF2 A;  2X6W A;  4DBR A;  3TED A;  1IRX A;  2YU9 J;  2FEZ A;  4RGU A;  4P9F A;  4AIK A;  4AIJ A;  2DOF A;  3I9V 2;  2RRE A;  5FLX Z;  1MJA A;  1FBU A;  2IJL A;  1GXP A;  1J59 A;  4LGW A;  4EJV A;  1U9O A;  2DDA A;  2Y0S N;  3M9A A;  5K7F A;  1KA8 A;  2LP0 A;  1R5H A;  5F1J A;  2H8R A;  2K27 A;  3L2Q A;  2JTV A;  2VKV A;  2DT5 A;  5JVG F;  1BL0 A;  1R22 A;  2IS2 A;  3S32 A;  4C2T A;  2VXD A;  3OS1 A;  3BRO A;  1K78 B;  1M1E B;  2VJ4 A;  3CUO A;  3UR3 C;  3ZP5 A;  4ESJ A;  1U6G A;  2LY2 A;  2R7S A;  4XKV A;  3WGG A;  3BPV A;  2DMQ A;  2VKD A;  3BTC A;  3LSJ A;  2RQQ A;  4LIT A;  1EH7 A;  1HW2 A;  5F27 A;  1ZRF A;  5EZH A;  1G6N A;  2PX9 A;  5CJ9 A;  5KCM A;  3DEW A;  2WAD A;  1X1P A;  1FT9 A;  4XR6 A;  5LHH A;  1S7A A;  3LA7 A;  4JOM A;  4UVB A;  1L3L A;  2WBM A;  3ZMU A;  1LQ1 A;  1K78 A;  1RET A;  1FIA A;  5DYM A;  2QQ8 A;  4EV0 A;  3QPS A;  5KAI C;  3RKX A;  1Z7L A;  1MD0 A;  2FE3 A;  1UFM A;  4KIB A;  1ACI A;  5H6Q A;  2DO7 A;  5CKT A;  5BQT A;  1JKP C;  1P4A A;  4EQQ A;  4HQM A;  3HTS B;  1XCB A;  3S2W A;  5J6X A;  2EH3 A;  2FQ4 A;  1SD6 A;  2XKO A;  3RDI A;  4C2U A;  5EF6 A;  2ESN A;  5HLI A;  5E18 F;  4LLN A;  2XGD A;  3KEO A;  3ZMS A;  4HDV A;  4E7J A;  4KN4 X;  3NAR A;  4HNU A;  4L9V A;  3MKW B;  4LB5 A;  2CFX A;  3KZZ A;  2M8E A;  2KDZ A;  2XGC A;  2FBH A;  3OYB A;  2X1C A;  3OV8 A;  2JWT A;  3EET A;  4PFO A;  3G6E I;  3W6J B;  2KJC A;  4DOZ A;  4XK4 A;  2DA4 A;  2WV1 A;  2Z3Y A;  5JR3 A;  3L2C A;  5BPI A;  4EGZ A;  3EDP A;  3OOU A;  5TRD A;  5D5U B;  1I3A A;  1A04 A;  3G1M A;  1I5Z A;  2M30 A;  1W7P A;  1X3W B;  2G7U A;  5KAF C;  3HHH A;  4IF4 A;  3W2W A;  4EM2 A;  3DEU A;  4GCV A;  3U2R A;  1R6R A;  5B5E C;  3IRQ A;  2OQG A;  3QPH A;  5IP9 J;  1ZEL A;  4MGR A;  3S14 J;  3JSO A;  1IN4 A;  1Y1V J;  3U1K A;  2ADU A;  2EZH A;  3QPL A;  2BEO A;  1X1B A;  2VL8 A;  2M45 A;  2XF6 A;  1YRN B;  4OIQ F;  2K9L A;  2KJB A;  1FJL A;  3FM3 A;  3A2K A;  4G94 A;  2W48 A;  3M07 A;  2R7R A;  1T98 A;  2ZXJ A;  1S72 I;  2D1V A;  2HXO A;  3A0B C;  3GBG A;  5FKN A;  5ED4 A;  3WTW C;  1A5J A;  3DQV C;  3F6V A;  2XRN A;  1BR1 A;  4Q4Z F;  2IGK A;  1OMI A;  4I09 A;  3VEP A;  3S1N J;  2DU9 A;  1V5E A;  2VXZ A;  4BUP A;  4WWC A;  5L3E A;  1IXR C;  2W25 A;  3VOE A;  1YE9 A;  4FT8 A;  3T0Y A;  1VQL I;  1HDP A;  2VUM J;  3ELK A;  1SFK A;  2XPW A;  2IGM A;  4RLQ A;  3W3C A;  3WHB A;  2YUS A;  4A3F J;  2LF8 A;  3AG4 H;  2LD5 A;  2KLO A;  1VQ7 I;  4PGH A;  4XOR A;  1MBK A;  3RKW A;  3KP4 A;  2Z16 A;  1I1G A;  3I4N J;  4Z2Y A;  2RNJ A;  4ZDO A;  4IHS A;  4F92 B;  3ZMV A;  2Z5U A;  4B3A A;  4ESB A;  4MHG A;  1R23 A;  2QQB A;  4G12 A;  4CH7 A;  4DBQ A;  3RPU D;  2TDX A;  3BWG A;  1XTA A;  3KP7 A;  3I54 A;  1FBQ A;  2A6H F;  1SVM A;  1QHH D;  2LBF B;  1ORK A;  2B63 J;  2FOK A;  5DUK A;  1FSE A;  5LGN A;  2HGC A;  1OCO H;  1R5G A;  4MLO A;  2FU4 A;  3GZ6 A;  1V3F A;  1VQ8 I;  2HI3 A;  4BGD A;  3LFU A;  4H4K C;  1TQP A;  1YQA A;  4EJU A;  4PSX A;  5D4R A;  4RM2 A;  1JHH A;  1LNW A;  1YS7 A;  1EA3 A;  2M0C A;  2ME0 A;  3EYY A;  3JAM Z;  1PUF B;  3QOP A;  2O8K A;  1IO2 A;  2E19 A;  3K7A J;  4YII A;  4M3E A;  4JK1 X;  2P6S A;  3FXU A;  4LLL A;  3CME I;  4HEA 2;  5IYC J;  1B4A A;  2LBF A;  4XLN F;  3GFJ A;  3BTJ A;  1T33 A;  2P7C B;  5ICC A;  2HFH A;  4A6E A;  4AVZ A;  3DFG A;  3BG9 A;  3AFH A;  4B4C A;  1OJL A;  3QRF F;  3LMM A;  1ZLK A;  1BC7 C;  2EZK A;  3CC7 I;  3FZV A;  3SZP A;  5H2F C;  3FIS A;  1AKH B;  3ISP A;  3OYK A;  2QCO A;  2EV5 A;  1X1A A;  4AU7 A;  1APL C;  3QPT A;  5F1R A;  3HOU J;  2VQC A;  5F6F A;  3Q0V A;  4H0E A;  1AWC A;  1HW5 A;  2CQN A;  1I50 J;  2FUG 2;  2D45 A;  3HSF A;  3H3V K;  1VTN C;  5DCM B;  4L5J A;  2XVC A;  3LOC A;  3K1M A;  4HX4 A;  4LOC A;  3S2H J;  4PGG A;  1KZH A;  1P6R A;  1U8B A;  2EFQ A;  5IOY A;  4NUB A;  1FNN A;  2ZME A;  4IX7 A;  2WB1 A;  1REP C;  1FZP B;  3K0L A;  1MIJ A;  4AYB N;  2EV6 A;  3G1O A;  3LSK A;  1FBS A;  1SAU A;  2FMY A;  2JRT A;  1MZB A;  2BY3 A;  2V1X A;  3AL0 B;  2L9R A;  5LGT A;  1WJC A;  5DD4 A;  4ZH4 F;  5JI6 A;  3RPU A;  1U78 A;  3LL7 A;  3HOZ J;  3HTU A;  2ISY A;  3FKI J;  2CH0 A;  3L09 A;  3CDH A;  4HST A;  1N25 A;  1WFX A;  4XID A;  4OU0 A;  4Y15 A;  4CUG A;  2QQ9 A;  4ANJ A;  2JA5 J;  5F08 A;  4CCN A;  3MN2 A;  2ELJ A;  1KQ9 A;  1HXD A;  2JVH A;  4O6J A;  3OR2 C;  4U7D A;  1V4R A;  2CQ7 A;  1XS9 A;  4L0Y B;  2IS6 A;  4BXF A;  3BJ6 A;  2AS5 F;  3E6C C;  4L9T A;  1W5S A;  1Z3X A;  2FBI A;  2BXY A;  2GAU A;  1FOK A;  1G3Y A;  1B72 B;  1OYW A;  3HL2 A;  3HG9 A;  4KDP A;  4GYG A;  3P9K A;  4G6T B;  4XLA A;  2P5L C;  5DUI A;  3RCO A;  2R5Z B;  2LTP A;  2MH9 A;  1DGR M;  1ETK A;  1S8N A;  2QM3 A;  1MDM B;  3PNT A;  3LA2 A;  2VAS A;  3U9G A;  4BJ5 C;  1FOX A;  3TDU C;  1K6Y A;  5GAH J;  3GCM A;  3S1M J;  3FKJ A;  3B73 A;  3NQO A;  2IS1 A;  3CJT B;  2FJ1 A;  1TW2 A;  2DK8 A;  2Y30 A;  2EIK H;  3C1D A;  4IZZ A;  3CCY A;  3HKZ A;  3ZN1 A;  1Y1W J;  5GPA A;  4YEL A;  1I6X A;  1U0J A;  3REO A;  3ZMD A;  4A3D J;  1FX7 A;  1R4N B;  4Y13 A;  1JKQ C;  3VPR A;  4M3B A;  5D5W B;  2VPL A;  3LST A;  4IKF A;  3JSP A;  2O0Y A;  2Y69 H;  1B72 A;  2IGO A;  4JBA A;  1ZGA A;  2R93 J;  3BCB A;  1D1B A;  2KIU A;  2OV7 A;  3HIF A;  3DTI A;  1HLV A;  3CMM A;  2HQA A;  4ZYH A;  2WA0 A;  1X58 A;  3TKY A;  4UUT A;  4LJZ F;  2IPQ X;  3R0A A;  2FNA A;  2OPT A;  2YU3 A;  2R7T A;  1TWH J;  1MH3 A;  2Z1D A;  5J4Y A;  3OYM A;  1J75 A;  2C6Y A;  3QYE A;  3ZQC A;  3HKZ N;  1YIJ I;  5B1A H;  5DEQ A;  4WCG A;  1V55 H;  2DJN A;  3BCA A;  4NC7 A;  1IZ1 A;  3GX4 X;  1YJW I;  2VBZ A;  1YW8 A;  4GO1 A;  3GYH X;  4I76 A;  2B9S A;  4XLF A;  2PI0 A;  2FQ3 A;  4A69 C;  1BIA A;  2PQ8 A;  3KIO A;  3BG5 A;  3A4C A;  2L4M A;  1ZG3 A;  2MD5 A;  5GAG J;  4RS8 A;  4KJZ A;  1O7F A;  5FLM J;  2DAO A;  2E7X A;  5ICF A;  1K7A A;  3IWZ A;  2DK5 A;  5E3M A;  5GTI C;  3H5R A;  3ZMT A;  2X4H A;  3BZK A;  3H0D A;  2ESH A;  3BTL A;  4ZC3 A;  4X0G A;  3WE3 A;  2RN7 A;  4V2G A;  5E3L A;  2AXT C;  1BW6 A;  2P7V B;  3CDL A;  3P9I A;  2V9V A;  2KFD A;  3CO6 C;  1ON2 A;  3KP5 A;  3HXL A;  4RGS A;  1B6A A;  3LQR A;  2XF5 A;  1R1U A;  3WU0 A;  5KHD A;  1I1S A;  2BBY A;  2LG4 A;  4LK1 F;  4A3C J;  4CDG A;  3HOV J;  3SDB A;  4Q48 A;  4KIC A;  2NNY A;  1JHF A;  4G6Q A;  2OJE D;  1KYW A;  4CCM A;  5ILV A;  2F5F A;  1SD7 A;  2K5C A;  1P4W A;  4XRS G;  3TMO A;  5LBQ A;  5K5O A;  4I99 C;  3MZH A;  2E35 A;  1BJA A;  4G8X A;  5EEA A;  2O7O A;  5J1Y A;  4NQW B;  3OYC A;  3JRA A;  3E1S A;  5JHF A;  5GAD J;  2CU7 A;  4FTH A;  3OIP A;  1NG6 A;  4ENM A;  4W1U A;  2DMT A;  3OYF A;  2CRG A;  4E7L A;  3F6O A;  3BR6 A;  1JUP A;  1D5Y A;  1UHM A;  3MAJ A;  1T0F C;  2E7W A;  3SYT A;  4S04 A;  5EG0 B;  5IP7 J;  4BY1 J;  2V7F A;  4XRF A;  3F8B A;  2XSD C;  1ZN2 A;  1HOM A;  4L5E A;  5EDN A;  1NK2 P;  2VON A;  2EFW A;  1EH6 A;  2HYJ A;  3TO7 A;  4RM3 A;  2E5N A;  5IYB J;  2HZT A;  3SDG A;  4XON A;  3K2A A;  2LLK A;  2X1D A;  4BAY A;  1SEU A;  1FYL A;  1IG7 A;  2QSF X;  5C4J J;  4OIN F;  3LSR A;  1T2K A;  4ZJZ A;  4XKW A;  1D3Y A;  5TJJ A;  1RNL A;  5B66 C;  1OKR A;  3G1L A;  4BEH B;  1DDN A;  3IKT A;  5LD2 C;  1X3U A;  1SVO A;  2PMU A;  3EUK L;  2Q1Z B;  2LF7 A;  1XSX A;  2R7D A;  2DXI A;  1VND A;  2P8T A;  5EG0 A;  2XPU A;  3WTZ A;  1PP7 U;  5K7Z A;  4I0A A;  2ZNY A;  1BI0 A;  3I56 I;  1R9T J;  1WJ5 A;  2FOW A;  1ZAR A;  2FBK A;  2IA1 A;  2RC4 A;  1XPX A;  2O8X A;  4KMU X;  3QP5 A;  3K1P A;  2XAU A;  3F9K A;  4KIS A;  3V8J A;  2L5Q A;  2CWE A;  5HLT A;  1TWG J;  2NVU B;  4IRI A;  3FIW A;  2STT A;  4Y33 A;  3J7A O;  3N05 A;  4I6Z A;  2Z2S B;  3ZQI A;  3KYL A;  4AM3 A;  4UVA A;  4HLX A;  3UNG C;  1Q1H A;  3H5A A;  4MQ9 F;  2KKO A;  3JR9 A;  2O61 A;  2R7U A;  1RES A;  2LDU A;  5BMZ A;  2I5U A;  1BIB A;  3CJR B;  5ILS A;  1BC8 C;  2IXS A;  3A01 B;  1W0U A;  5L3B A;  5FJ8 J;  5E17 F;  4BH9 A;  1ZAO A;  3F21 A;  3SZG A;  5D6E A;  4ZTF A;  1R1V A;  3SEQ A;  3CUQ C;  5DS9 A;  5M5X J;  1KU3 A;  4J01 A;  1FEX A;  2GXA A;  3HOS A;  2HPI A;  4NDL A;  5D5V B;  5ICG A;  4IRH A;  3TO6 A;  1YYV A;  2F4M B;  3H92 A;  4O5V A;  2K9M A;  4LFU A;  5K5R A;  1O3R A;  2ME6 A;  2YX7 A;  1IV8 A;  3ABT A;  4UV8 A;  4Q47 A;  1XGO A;  1O4X A;  1A36 A;  1ONV A;  3C7J A;  3MFK A;  2OZU A;  4XSZ F;  3TQN A;  3I55 I;  3DTE A;  3J81 K;  5CQG A;  1F43 A;  5E8I A;  3L2W A;  1D8K A;  3L1P A;  3A01 A;  1UCR A;  4G7O F;  2H94 A;  4UVC A;  5LEJ A;  2GM4 A;  1XC5 A;  1JJ6 C;  4NB5 A;  1BJZ A;  2PMZ N;  3PSI A;  3OIQ A;  1HF0 A;  3PJR A;  2E34 A;  5CYV A;  2NAZ A;  3S3O A;  2R7Z J;  2K02 A;  1OPC A;  1W36 C;  3RYP A;  1V54 H;  3WGI A;  2FD5 A;  3I4M J;  3MKZ A;  3Q9S A;  1QZE A;  1DP7 P;  5GP9 A;  4IHW A;  1B9N A;  1LEA A;  2DT7 B;  1WJF A;  3IP4 B;  2KIM A;  2LFB A;  3BJO A;  1JI8 A;  3BR3 A;  3DF8 A;  3PSF A;  4QLC U;  3U21 A;  4RMN A;  3GFL A;  3HM5 A;  3PL8 A;  1G4D A;  3LAP A;  3C3W A;  5D5X B;  2F6C A;  2QKL B;  4E7K A;  4L9J A;  5JLW A;  4PJ0 C;  3KLN A;  4OIO F;  1ZLJ A;  1F9N A;  3BPX A;  3U1D A;  2K3P A;  2PJP A;  3COA C;  1Z7U A;  3OYA A;  2R5Y B;  5TGT A;  3WE2 A;  2BZT A;  2W4S A;  2DJI A;  2D5V A;  3G4S I;  3E5U A;  2CG4 A;  4AC0 A;  2HXI A;  2NOG A;  2OCE A;  5E20 A;  3HDD A;  4OMY A;  1MH4 A;  2HZD A;  2MW8 A;  1VQO I;  1LE8 B;  1ZTR A;  4HW0 A;  4HPQ A;  1USS A;  2XPV A;  1JUM A;  1E3P A;  1MBE A;  2F4I A;  2LY9 A;  2OCC H;  2COB A;  2VB6 A;  5J3L A;  3X2Q H;  3KZI C;  1TQM A;  1TL8 A;  1IDZ A;  2L7Z A;  1TWF J;  4M3G A;  1VQK I;  4A5M A;  3I59 B;  1ETV A;  2H27 A;  3I0T A;  4AVP A;  2B7E A;  4XLH A;  4ASN A;  2R5Y A;  1RUO A;  1P2F A;  2XKP A;  5F64 A;  2ETH A;  3J80 Z;  2K85 A;  2W1O A;  5IY5 H;  3WU2 C;  4B43 A;  3CMY A;  9ANT A;  1W5T A;  2MGQ A;  5C3E J;  4NBQ A;  5HNH A;  4F93 B;  1LE8 A;  4A5N A;  2BOL A;  1WI9 A;  3DEE A;  3OSG A;  2ZSH B;  2QGU A; 
#chains in the Genus database with same CATH homology
 2EJR A;  3V7C A;  1K6O A;  3I59 A;  2FF4 A;  3FM5 A;  1G3S A;  2OZ6 A;  1WRJ A;  1QPM A;  3I64 A;  2XV4 S;  2F5C A;  4LLG F;  2Y48 A;  4AD9 A;  2XUB A;  2WTE A;  4CYD A;  3FXQ A;  5A2Q Z;  1YFH A;  1LJ9 A;  2KRF A;  2M87 A;  4ENK A;  3FXR A;  3TOB A;  4HV5 A;  3RIR A;  5HDG A;  3LAJ A;  3V4G A;  2W84 A;  3K9T A;  4M6X A;  4HX8 A;  4I02 A;  2K4J A;  1XGS A;  5HS8 A;  2H09 A;  4XBF A;  1SD4 A;  2EFP A;  2ZCW A;  2D1H A;  1B1B A;  2DW4 A;  3F8N A;  3HRT A;  3KCC A;  3PFI A;  4MTE A;  1H9T A;  1TNT A;  1YO5 C;  2MBF A;  4HBL A;  5AIP A;  3BDD A;  5E1Z B;  2MH2 A;  3F22 A;  1O3Q A;  1GVJ A;  5JVT A;  4XLP F;  4BHB A;  3ZMZ A;  4HF2 A;  1ODD A;  2IA0 A;  3EYI A;  2HQN A;  4EMS A;  5H20 A;  3R6S A;  3JW4 A;  2M5W A;  2ZNZ A;  2R7F A;  1HKQ A;  5D8K B;  2IRF G;  4G9Y A;  4L0Z B;  1ZG1 A;  2MC3 A;  2FRH A;  1XDU A;  3GZ5 A;  4RAY A;  4XSX F;  1BN5 A;  1E17 A;  1XD7 A;  3V7S A;  3WGH A;  4E70 A;  1IRG A;  4WXH A;  2Y75 A;  2PFB A;  2Z99 A;  1H9G A;  1ZRE A;  4A0Y A;  1H0M A;  3M1E A;  3BP8 A;  3T1B A;  3RPQ A;  4I98 B;  3V8L A;  2HKO A;  4KUM A;  2XAQ A;  4EM1 A;  1UB9 A;  4HOB A;  2GXB A;  3JTG A;  1KYZ A;  5CVI A;  2L01 A;  3R61 A;  5LRS A;  3D5L A;  1IN8 A;  3SZT A;  2VN2 A;  1QQI A;  3HRM A;  3LQQ A;  3HSE A;  2YR2 A;  2EV0 A;  2F5E A;  5FB2 A;  4AWX B;  1TW3 A;  3WTY C;  3F8C A;  1LB2 A;  4UNO A;  1KU9 A;  5ERI A;  3I53 A;  3F23 A;  1MJ9 A;  3O6B B;  2JZY A;  1LDK B;  3ULQ B;  1ZRD A;  3TO9 A;  3WU1 B;  4LMY A;  2V1U A;  3HRU A;  4CO8 A;  1TQI A;  4HLY A;  4RAZ A;  2QQA A;  3B02 A;  2V6C A;  2VOP A;  3JTH A;  4CXF A;  1W4M A;  1B9M A;  1KQ0 A;  3F72 A;  3KP2 A;  1BI1 A;  2P5K A;  1P92 A;  1GHC A;  3C18 A;  2NS0 A;  3E5X A;  2G7H A;  2HYG D;  2XHK A;  2LSO A;  3I58 A;  2E1C A;  5DCM A;  4ETS A;  2IW5 A;  5LRR A;  3Q9V A;  1Z1D A;  1XDS A;  5KK1 A;  4DQ2 A;  2FNP A;  1DPR A;  3V8K A;  1NHA A;  3QAH A;  4M9Z A;  4YFN F;  4IHT A;  1BM9 A;  5D8L B;  2ZFW A;  5LEK A;  2O03 A;  2O6G E;  2CW0 F;  3BZ6 A;  2LKP A;  1BBY A;  4CIC A;  4N0B A;  3SHF A;  5L3F A;  4MTD A;  2G9W A;  1ZGJ A;  4MNU A;  3F8F A;  3P9C A;  4KA4 A;  1YG2 A;  2MLK A;  3BY6 A;  1R1T A;  1EV7 A;  2QWW A;  4BXU A;  2ZKZ A;  2J5P A;  3ZN0 A;  1TNS A;  1RI7 A;  2XAF A;  2XIG A;  4DNC A;  5JFR A;  1OYY A;  2UWM A;  1B59 A;  2X0L A;  3O2P E;  1MDM A;  2IP2 A;  3MZY A;  2QLZ A;  3IHU A;  1S3J A;  3IL2 A;  5FGM A;  3FMS A;  3FMR A;  3CO7 C;  5BPD A;  5IT9 K;  3MCZ A;  4M71 A;  3H3U A;  1G3T A;  4HF0 A;  1IF1 A;  1QBJ A;  5LGU A;  2W85 A;  2OU2 A;  5AON A;  1XMA A;  1SFX A;  4N9H A;  1SD5 A;  3GWZ A;  1KU2 A;  4P96 A;  4U7B A;  4HZF A;  4ENJ A;  3FHZ A;  1L0O C;  2DLL A;  1ULY A;  2Z9O A;  1U5T B;  1MJB A;  2JPC A;  3Q5F A;  1BI3 A;  1YLF A;  4IRG A;  1UST A;  1FY7 A;  2ISZ A;  4O3M A;  1F5T A;  3K69 A;  3T8R A;  4RB3 C;  2HQR A;  2RGV A;  4EJT A;  4ON0 A;  4LB6 B;  4BYY A;  5AIQ A;  5IT3 A;  2A3S A;  4RGX A;  3KP3 A;  4BHP A;  1YTY A;  4R1H A;  4NQW A;  1XN7 A;  4A2U A;  1U5T C;  1ON1 A;  1QO0 D;  1YIO A;  4ENN A;  2K4B A;  1T39 A;  6PAX A;  4ZYD A;  2HWV A;  4CHU A;  2BV6 A;  3N97 A;  1JXS A;  3PQJ A;  3ERE D;  4G6D A;  3CTA A;  5DV5 A;  1Y0U A;  2HDC A;  5K5Q A;  3CUQ B;  2VT2 A;  4AIH A;  1IXS B;  1BI2 A;  2UXN A;  1FWZ A;  4R8H A;  2JT1 A;  3TDZ C;  1OYI A;  4F7Z A;  2W57 A;  2VOO A;  4M9X A;  2DQR A;  3HYI A;  1O3T A;  3CUQ A;  2ACJ A;  3N4M A;  5FFX A;  2L02 A;  1STZ A;  1K79 A;  3SQN A;  2MA3 A;  1QZZ A;  2EK5 A;  4Q5S F;  2HTJ A;  4PZJ A;  1O7L A;  3DPL C;  2P6T A;  2QVO A;  3GEZ A;  2Q2E A;  2RV8 A;  4L5I A;  1MKM A;  4P9U A;  1YW7 A;  2MLG A;  4A6D A;  2W24 A;  3ECH A;  2A68 F;  1J7K A;  1S6L A;  1PDN C;  4UUV A;  1EH8 A;  3T8T A;  3FX3 A;  2XGX A;  5HLH A;  1O3S A;  4ZZD A;  4KMF A;  4K2E A;  4MEY F;  3WTU C;  1SAX A;  1ZYR F;  2H6C A;  4KFC A;  5LHG A;  4IPA A;  3DXJ F;  2QUF A;  5D4S A;  2BGC A;  3M8F A;  4HX7 A;  1TLH B;  3KLO A;  3NEU A;  4YIF A;  1IN5 A;  1IRF A;  2HTS A;  4IJA A;  2EFN A;  1YW9 A;  3O3K A;  2K86 A;  3CLO A;  3IWF A;  3LA3 A;  1G3W A;  2EA4 A;  4LD5 A;  3BJA A;  3QU3 A;  3E97 A;  3WTX C;  4WXC A;  2GWR A;  4A12 A;  3RJP A;  2EB7 A;  3HUG A;  4UV9 A;  4G7H F;  1FP2 A;  3F3X A;  2PMH A;  3LWF A;  3FMQ A;  4B09 A;  3H3Z A;  2Q0O A;  2YSR A;  3VB2 A;  1Z9C A;  1D5V A;  1T38 A;  1W7P D;  4G7Z F;  5ICE A;  2JSC A;  1Z6T A;  4KIF A;  2OD5 A;  4KYW A;  1JE8 A;  2WWY A;  5LLQ A;  3TGN A;  2GQQ A;  2PEX A;  3DP7 A;  3IC7 A;  3JAM K;  1FP1 D;  1WKM A;  5DDG A;  2VBW A;  1U2W A;  3QU6 A;  1LEB A;  3DV8 A;  3RKY A;  4CGZ A;  1WSU A;  2HS5 A;  2YX4 A;  3MWM A;  1D8J A;  4ZYE A;  1HBX G;  2QYO A;  3R0J A;  1O57 A;  5HS9 A;  3G73 A;  1Z05 A;  2GZW A;  1HW1 A;  4HA8 A;  1XGM A;  1XB4 A;  3SXY A;  2BYV E;  3J81 Z;  3IKV A;  2COM A;  2HOE A;  1FYK A;  3L7W A;  1QZY A;  4M9S A;  5BOX A;  1XMK A;  1RUN A;  1HKT A;  2QEN A;  3MEX A;  4CZZ A;  1W7P B;  1TBX A;  4IVN A;  1HKS A;  3KEQ A;  4WXD A;  4U88 A;  4WX9 A;  2VBY A;  2NNN A;  3DKW A;  5L3G A;  3KZY A;  3GVA A;  4BQA A;  2ELH A;  2EA2 A;  2A69 F;  1E2X A;  1F4K A;  3OOP A;  1F1Z A;  3E5Q A;  5EEH A;  2XAG A;  2OQR A;  4L9N A;  2ZO4 A;  4MQV A;  5CVJ A;  2PG4 A;  1SMY F;  2F5D A;  2GXG A;  1GXQ A;  4I7H A;  4RB0 A;  2HEO A;  2UXX A;  2DPU A;  4KNY A;  2D2W A;  1DUX C;  3FF5 A;  2QBY B;  2WC2 A;  4FX4 A;  4IXA A;  2CQK A;  1ZH5 A;  3M7G A;  4RGR A;  4U0Y A;  4FHT A;  4JQF A;  2XRO A;  3HOT A;  2RDP A;  5FFZ A;  4WK8 F;  4P5O A;  1SFU A;  4RB2 C;  2QBY A;  4RB1 A;  3WTT C;  1WWX A;  4M72 A;  1IUY A;  1PP8 F;  2DPD A;  1XSD A;  3AAF A;  1SMT A;  3IRR A;  5HDK A;  4S05 A;  4EM0 B;  2NYX A;  4YG2 F;  4LK0 F;  4ZZL A;  1S29 A;  5HLG A;  3KP6 A;  2Q8K A;  2Z33 A;  4EGY A;  1LVA A;  5JHU A;  2VE8 A;  2K7L A;  3EQL F;  2IVM A;  2IT0 A;  2ZME B;  4U0V A;  3PQK A;  4P55 A;  4I01 A;  4M74 A;  4M73 A;  4OOI A;  4HV6 A;  1C0W A;  3T5X A;  2HYF A;  4A0Z A;  3DPT A;  3HHG A;  1HST A;  2CYY A;  3M8E A;  2AXL A;  2P4W A;  3ABU A;  1R58 A;  4OIR F;  5K1Y A;  1P4X A;  3HSR A;  1R00 A;  3GF2 A;  2F2E A;  2CGP A;  1HQC A;  1IN7 A;  1FLI A;  1T6S A;  2RKH A;  2GIV A;  2VE9 A;  5LHI A;  2YPR A;  3E6M A;  2UZK A;  3VOD A;  1J5Y A;  1TTY A;  2HR3 A;  4PCQ A;  3RI4 A;  3K1N A;  2FXA A;  4OIP F;  2EWN A;  3QP6 A;  3KFW X;  5CLS A;  3CJN A;  1J0R A;  3GLX A;  3P7N A;  4FX0 A;  2A07 F;  2DBB A;  1SFE A;  4EVI A;  5D6F A;  2O3F A;  4UXN A;  3K2Z A;  5HDN A;  2QZ8 A;  2ZBK A;  4PDK A;  3RTR A;  4I0B A;  3FWE A;  1IXC A;  3I4P A;  4EJO A;  1PUE E;  2P5V A;  1CGP A;  2H6B A;  3WG9 A;  5E8G A;  5CVU A;  4M6Y A;  2FSW A;  1IN6 A;  5E1X A;  4OMZ A;  3ECO A;  4HAM A;  3GFM A;  5J8C A;  2B0L A;  1IW7 F;  1CF7 B;  5L3C A;  2OAZ A;  2DFI A;  4KT5 C;  3TOA A;  1QNT A;  3GUD A;  2JPB A;  1T0F A;  5E1W A;  1AOY A;  4B8X A;  1ZRC A;  1LDD A;  2R3S A;  4A0X A;  1U5T A;  4GGG A;  1J9I A;  3RYR A;  1CF7 A;  2EFO A;  5HVQ C;  4NHJ A;  1FYM A;  4U0W A;  3F8M A;  2VOD A;  4BNC A;  4HYE A;  2DTR A;  3E6D A;  3I5U A;  5KVR A;  1U8R A;  3MQ0 A;  3G3Z A;  4D0P A;  1ZHF A;  4HQE A;  3GO5 A;  1IAW A;  3LFK A;  2XAH A;  3GW2 A;  3WOD F;  3ZPL A;  4TV7 A;  2L4A A;  1LDJ A;  5L3D A;  1KQ8 A;  3BOQ A;  1FC3 A;  5ILU A;  2STW A;  2A6E F;  4LG0 B;  3J80 K;  4HDU A;  1J2X A;  2PBI A;  5FLX K;  2J5O A;  4KN7 X;  2FA5 A;  1YS6 A;  2RVC A;  2L3D A;  2PN6 A;  2NRA C;  2VT3 A;  4QWQ A;  4L18 B;  1FSH A;  1HSJ A;  1I27 A;  1MGT A;  1WQ2 A;  2XAJ A;  5HOO A;  3E6B A;  1FPQ A;  4LG0 A;  5FD5 A;  2E1N A;  3V7R A;  1KGS A;  3I71 A;  2VBX A;  4Y17 A;  2OA4 A;  4MEX F;  3EUH A;  4YFK F;  2CSO A;  5CVR A;  4I2O A;  5A2Q K;  2FML A;  5H6R A;  2BE5 F;  4HF1 A;  5IT9 Z;  4BHC A;  1U3E M;  3WTS C;  2DI3 A;  1RZ4 A;  2M1B A;  1KU7 A;  4GXO A;  4KIG A;  5J8F A;  2KIF A;  2L54 A;  4YFX F;  4UHT A;  5DCF A;  3GXO A;  1S7O A;  3L9F A;  2DQL A;  3SFZ A;  3ZQ7 A;  2VC1 A;  2HKX A;  1OR7 A;  1Z91 A;  5BS6 A;  5DD8 A;  5HS7 A;  3R60 A;  1JGS A;  2PLY A;  3VFZ A;  3GFI A;  3E3V A;  4R79 A;  3W6K B;  3KET A;  2GA1 A;  1UHW A;  2VC0 A;  3D0S A;  5EEG A;  2Y0M A;  1BOA A;  3R4K A;  3KE2 A;  3ROU A;  1RIO H;  2CO5 A;  2WV0 A;  4ESF A;  1R7J A;  2RQP A;  4N9I A;  1XGN A;  5FO5 A;  3HRS A;  5FD6 A;  4GYI A;  2XAS A;  2A5Y B;  4ZYG A;  1ZG5 A;  1Z6R A;  2V1D A;  3WTV C;  4EJW A;  2A61 A;  2OBP A;  3L00 A;  5CVV A;  2IA2 A;  2GA2 A;  2V79 A;  1XSV A;  2LNB A;  3ML6 A;  1DPU A;  3NRV A;  2ZJ2 A;  1XCV A;  1QGP A;  4WF2 A;  2FEZ A;  4RGU A;  4P9F A;  4AIK A;  4AIJ A;  5FLX Z;  1MJA A;  1FBU A;  2IJL A;  1GXP A;  1J59 A;  4LGW A;  4EJV A;  3M9A A;  1KA8 A;  1R5H A;  2K27 A;  2JTV A;  2DT5 A;  1R22 A;  3BRO A;  1K78 B;  3ZP5 A;  3CUO A;  4ESJ A;  1U6G A;  3WGG A;  3BPV A;  1EH7 A;  1HW2 A;  1ZRF A;  1G6N A;  5CJ9 A;  1FT9 A;  5LHH A;  1S7A A;  3LA7 A;  4UVB A;  1L3L A;  1LQ1 A;  3ZMU A;  1K78 A;  5DYM A;  4EV0 A;  3RKX A;  2FE3 A;  1MD0 A;  1UFM A;  4KIB A;  5H6Q A;  2DO7 A;  5BQT A;  1P4A A;  4EQQ A;  4HQM A;  3HTS B;  1XCB A;  3S2W A;  5J6X A;  1SD6 A;  2XKO A;  3RDI A;  5E18 F;  2ESN A;  5HLI A;  4LLN A;  3KEO A;  3ZMS A;  4HDV A;  4KN4 X;  4L9V A;  4LB5 A;  2CFX A;  3KZZ A;  2M8E A;  2FBH A;  3OV8 A;  3EET A;  3W6J B;  2KJC A;  2Z3Y A;  5JR3 A;  3L2C A;  5BPI A;  4EGZ A;  3EDP A;  5TRD A;  5D5U B;  1A04 A;  1I5Z A;  2M30 A;  1W7P A;  2G7U A;  3HHH A;  4IF4 A;  4EM2 A;  3DEU A;  4GCV A;  3U2R A;  3IRQ A;  2OQG A;  3QPH A;  4MGR A;  3JSO A;  1IN4 A;  2ADU A;  2BEO A;  2M45 A;  4OIQ F;  2KJB A;  3FM3 A;  4G94 A;  1T98 A;  2ZXJ A;  2D1V A;  5ED4 A;  3WTW C;  3DQV C;  3F6V A;  2XRN A;  4Q4Z F;  1OMI A;  4I09 A;  3VEP A;  2DU9 A;  2VXZ A;  4WWC A;  5L3E A;  1IXR C;  2W25 A;  3VOE A;  4FT8 A;  3T0Y A;  3ELK A;  2LF8 A;  4PGH A;  3RKW A;  3KP4 A;  1I1G A;  4Z2Y A;  2RNJ A;  4IHS A;  3ZMV A;  2Z5U A;  4ESB A;  4MHG A;  1R23 A;  2QQB A;  2TDX A;  3BWG A;  3KP7 A;  3I54 A;  1FBQ A;  2A6H F;  2FOK A;  5DUK A;  1FSE A;  5LGN A;  2HGC A;  1R5G A;  2FU4 A;  3GZ6 A;  1V3F A;  1TQP A;  1YQA A;  4EJU A;  5D4R A;  1JHH A;  1LNW A;  1YS7 A;  3EYY A;  3JAM Z;  3QOP A;  4YII A;  4JK1 X;  2P6S A;  3FXU A;  4LLL A;  1B4A A;  4XLN F;  3GFJ A;  2P7C B;  5ICC A;  2HFH A;  4A6E A;  3DFG A;  3QRF F;  1ZLK A;  1BC7 C;  3FZV A;  3SZP A;  3ISP A;  2EV5 A;  3QPT A;  5F1R A;  5F6F A;  4H0E A;  1AWC A;  1HW5 A;  2D45 A;  3HSF A;  1VTN C;  5DCM B;  4L5J A;  2XVC A;  3K1M A;  4HX4 A;  4PGG A;  1P6R A;  2EFQ A;  1FNN A;  2ZME A;  1REP C;  1FZP B;  3K0L A;  2EV6 A;  1FBS A;  2FMY A;  2JRT A;  1MZB A;  2V1X A;  5LGT A;  5DD4 A;  4ZH4 F;  5JI6 A;  3RPU A;  1U78 A;  3HTU A;  2ISY A;  3L09 A;  3CDH A;  4OU0 A;  4Y15 A;  2QQ9 A;  1KQ9 A;  1HXD A;  4O6J A;  4U7D A;  1V4R A;  4L0Y B;  3BJ6 A;  2AS5 F;  3E6C C;  4L9T A;  1W5S A;  2FBI A;  2GAU A;  1FOK A;  1G3Y A;  1OYW A;  4KDP A;  4GYG A;  3P9K A;  2P5L C;  5DUI A;  2MH9 A;  1S8N A;  2QM3 A;  1MDM B;  3LA2 A;  3U9G A;  3TDU C;  3B73 A;  3NQO A;  1TW2 A;  2DK8 A;  3C1D A;  3ZN1 A;  1I6X A;  3REO A;  3ZMD A;  1FX7 A;  4Y13 A;  5D5W B;  3LST A;  3JSP A;  2O0Y A;  4JBA A;  1ZGA A;  2KIU A;  3HIF A;  4ZYH A;  3TKY A;  4LJZ F;  2IPQ X;  3R0A A;  2FNA A;  2YU3 A;  1J75 A;  2C6Y A;  5DEQ A;  4WCG A;  1IZ1 A;  3GX4 X;  2VBZ A;  1YW8 A;  4GO1 A;  3GYH X;  2PI0 A;  2FQ3 A;  1BIA A;  2PQ8 A;  2L4M A;  1ZG3 A;  2MD5 A;  4RS8 A;  1O7F A;  2DAO A;  2E7X A;  5ICF A;  1K7A A;  3IWZ A;  2DK5 A;  3ZMT A;  2X4H A;  2ESH A;  3WE3 A;  2RN7 A;  2P7V B;  3P9I A;  2V9V A;  3CO6 C;  1ON2 A;  3KP5 A;  4RGS A;  1B6A A;  3LQR A;  1R1U A;  3WU0 A;  2BBY A;  4LK1 F;  4CDG A;  4Q48 A;  4KIC A;  2NNY A;  1JHF A;  4G6Q A;  1KYW A;  5ILV A;  2F5F A;  1SD7 A;  5LBQ A;  1P4W A;  5K5O A;  3MZH A;  1BJA A;  4G8X A;  4ENM A;  3F6O A;  1UHM A;  3MAJ A;  2E7W A;  4S04 A;  4XRF A;  3F8B A;  1ZN2 A;  2VON A;  2EFW A;  1EH6 A;  3TO7 A;  1FYL A;  2HZT A;  4BAY A;  4OIN F;  1T2K A;  1D3Y A;  5TJJ A;  1RNL A;  1OKR A;  1DDN A;  3IKT A;  1X3U A;  2PMU A;  2LF7 A;  1XSX A;  2R7D A;  2P8T A;  3WTZ A;  1PP7 U;  4I0A A;  2ZNY A;  1BI0 A;  1ZAR A;  2FBK A;  2IA1 A;  2RC4 A;  2O8X A;  4KMU X;  3QP5 A;  3K1P A;  3V8J A;  2CWE A;  4IRI A;  2STT A;  3J7A O;  4UVA A;  4HLX A;  1Q1H A;  4MQ9 F;  2KKO A;  2O61 A;  2LDU A;  5BMZ A;  1BC8 C;  1BIB A;  5ILS A;  5L3B A;  5E17 F;  4BH9 A;  1ZAO A;  3F21 A;  5D6E A;  1R1V A;  3CUQ C;  1KU3 A;  3HOS A;  5D5V B;  5ICG A;  4IRH A;  3TO6 A;  1YYV A;  3H92 A;  4O5V A;  4LFU A;  5K5R A;  1O3R A;  2YX7 A;  3ABT A;  4UV8 A;  4Q47 A;  1XGO A;  1ONV A;  3C7J A;  3MFK A;  2OZU A;  4XSZ F;  3TQN A;  3J81 K;  5E8I A;  1D8K A;  4G7O F;  1UCR A;  2H94 A;  4UVC A;  5LEJ A;  4NB5 A;  5CYV A;  2NAZ A;  2K02 A;  1OPC A;  3RYP A;  3WGI A;  3Q9S A;  1DP7 P;  1B9N A;  1LEA A;  2KIM A;  3BJO A;  3DF8 A;  4QLC U;  3GFL A;  1G4D A;  3LAP A;  3C3W A;  5D5X B;  4L9J A;  3KLN A;  4OIO F;  1ZLJ A;  1F9N A;  3BPX A;  3U1D A;  2PJP A;  3COA C;  1Z7U A;  3WE2 A;  3E5U A;  2CG4 A;  5E20 A;  4OMY A;  4HW0 A;  1USS A;  1TQM A;  4A5M A;  3I59 B;  2H27 A;  3I0T A;  4AVP A;  4ASN A;  1RUO A;  1P2F A;  2XKP A;  5F64 A;  2ETH A;  3J80 Z;  1W5T A;  4A5N A;  1WI9 A;  1I1S A;  1R36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...