2DPUA

Crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer b-site dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer B-site DNA
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/dna
molecule keywords 5'-D(P*AP*TP*GP*TP*TP*CP*AP*TP*AP*G)-3'
total genus 31
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dpuA00
2TDXA 5KVRA 2CGPA 1LDJA 2MA3A 3LSTA 2IJLA 1PP7U 2BBYA 1K6OA 1BI0A 2K4JA 2RNJA 5K5OA 2Q8KA 3WTYC 4CGZA 2PMUA 2P5KA 4I09A 1FOKA 1PP8F 2P5VA 4EJWA 1HXDA 1KQ8A 4OIRF 2OAZA 1XCBA 4Y17A 1BIAA 2E7XA 2M87A 3JTHA 4GCVA 4CYDA 1J7KA 4O6JA 4JK1X 3MWMA 3VB2A 1XB4A 2E1NA 2KJBA 4LK1F 3K9TA 2V1DA 2MBFA 2UXNA 4IJAA 1KQ9A 3ECOA 3FXQA 4WXDA 3R0JA 3ZMDA 3BY6A 2BV6A 5D8KB 1OKRA 4OU0A 4LFUA 5E1WA 3WTZA 1W7PA 3RJPA 1R1TA 1UB9A 1I6XA 2VODA 4KNYA 3BDDA 4I0AA 3CLOA 4CICA 5HLGA 2X0LA 4ENKA 4KIBA 2HDCA 1K7AA 4G6DA 3LA7A 4M6XA 1U2WA 3KETA 2KRFA 3SXYA 5BOXA 5DEQA 1O57A 1RUNA 4I98B 4YIFA 1LQ1A 3KP3A 2OA4A 1HKSA 1W7PD 2QM3A 4U0WA 3WTSC 3CUQB 5CVJA 1D8JA 5LBQA 1Z05A 2OQRA 3ML6A 1KA8A 1PUEE 3FXRA 1ULYA 4FT8A 2QYOA 4BQAA 4RS8A 4M71A 1XGSA 3EETA 1DPRA 2PN6A 2JPBA 1T0FA 2XV4S 3LQRA 3RKYA 3H3ZA 4IRIA 4LJZF 2DQLA 3TO7A 4OOIA 2IVMA 4N9IA 2A6HF 2H6CA 4ZH4F 5BQTA 2PMHA 3K1MA 2CSOA 1TNSA 4OIOF 4L9JA 4F7ZA 2ZXJA 4N0BA 1I1GA 2MH9A 4R79A 3IKTA 3FMRA 1W5TA 3WGHA 3WODF 3Q9SA 1ZRCA 2EA2A 3RPUA 5E1ZB 2FMLA 1O3TA 3DP7A 1MJAA 4YFNF 1H9TA 3F23A 2E7WA 1SFXA 2QENA 4FX0A 2LF8A 1FYLA 3JAMK 3DXJF 4WK8F 2PLYA 2VONA 3U1DA 3DPTA 5ERIA 3JSPA 3BJAA 4HF2A 2GWRA 1B59A 3ZMSA 1R58A 4MQ9F 3GWZA 3WTWC 4BNCA 2HKXA 2COMA 2YPRA 1QPMA 3KE2A 3REOA 3L2CA 2VC1A 4CO8A 4UUVA 3GFJA 4G8XA 5K5QA 4KMFA 4EM0B 3PFIA 4A2UA 4HV6A 1LEAA 4ENNA 5HS9A 3K0LA 4AVPA 3RKWA 2FU4A 4I02A 1IN4A 2XAJA 3SQNA 3BJOA 2QUFA 2K27A 1O7FA 3R0AA 1XGMA 2MD5A 1F4KA 3LWFA 3ZN1A 2STWA 4A5NA 2IA2A 4A6EA 3T8RA 1U8RA 1IZ1A 1PDNC 5CVRA 4EM2A 3EYYA 1WKMA 2VBXA 1HQCA 5LLQA 2H6BA 5TJJA 3BPVA 4HF1A 1R5GA 4IHTA 1Q1HA 1BC8C 2DK8A 3M7GA 4U0YA 3IC7A 5BPIA 2ESNA 3GX4X 5E8IA 3GVAA 2HTJA 4KDPA 2HWVA 4AIHA 4HAMA 4G7OF 2QQAA 1OR7A 2P6TA 4EJUA 2M1BA 2ADUA 1G3SA 1GHCA 1J0RA 2EJRA 2HQRA 4KFCA 2EFPA 5DCMA 2V9VA 1DDNA 4WF2A 1FY7A 3J80Z 3L09A 2K86A 1S6LA 2KJCA 2VBWA 1XGNA 1FZPB 1TQMA 3ABTA 4EGZA 1BN5A 3ROUA 3KEOA 3HTSB 4B8XA 2ACJA 2YSRA 3H92A 3OOPA 4MTDA 1U3EM 3IL2A 3CDHA 1XDUA 4FX4A 3U2RA 5L3FA 1I5ZA 4IF4A 3LA2A 1MKMA 3R61A 1JGSA 1HW2A 2WTEA 4YFXF 3KLOA 3GFIA 3K2ZA 2IRFG 5LGTA 2DTRA 4OMZA 1ON2A 3FXUA 1RIOH 3ZQ7A 3ZMZA 3I4PA 2PI0A 1IRGA 4RAZA 4BXUA 1IXSB 1BJAA 4LG0A 2P8TA 4DQ2A 4ZYEA 1H9GA 5FLXZ 3JW4A 2Y48A 5ICFA 5EEHA 2MH2A 2XASA 4K2EA 1UHMA 3VFZA 4LD5A 1XDSA 1BC7C 3MZHA 5DCFA 3SZTA 3ZN0A 5K1YA 2X4HA 1FX7A 3SHFA 2ZFWA 2QWWA 4P5OA 4HYEA 2DLLA 3VEPA 3BP8A 1KGSA 3F3XA 2XVCA 4IRGA 2D2WA 2EFNA 1P4AA 3KEQA 4R1HA 5CYVA 3KP2A 1R36A 3N97A 2CWEA 3ZMVA 2Y0MA 4KUMA 4OINF 1D8KA 3E6BA 2FMYA 5CLSA 1P4XA 3R6SA 1USSA 3DPLC 1U5TC 4KN4X 4P9FA 2F5EA 3ZMUA 2VT3A 3GFMA 4BYYA 5ICCA 4S04A 1SD7A 3V4GA 1RNLA 5ICGA 1J2XA 4A5MA 4WWCA 1V3FA 2BYVE 2RQPA 5H6RA 3RTRA 4Q48A 4BAYA 4UV8A 1G3WA 4AIKA 4L0YB 1J75A 1BOAA 1VTNC 2L01A 2DO7A 2M30A 3L00A 1QNTA 2CW0F 1HKTA 3CTAA 4HX7A 3QPHA 3T8TA 1HSJA 1Z1DA 4NB5A 1IN8A 3ULQB 1B4AA 3TGNA 1YIOA 3KZZA 3TKYA 2VE9A 5K5RA 1HBXG 1FBSA 1OYWA 3V7RA 4U0VA 1Z7UA 2P6SA 4NHJA 3IKVA 1YFHA 5LRRA 3V7CA 3GF2A 2H09A 2IA0A 5DUKA 5JI6A 1FBQA 5J8FA 2EFOA 2J5PA 3L9FA 3QOPA 3OV8A 4PCQA 4HX4A 1X3UA 5AIQA 5D6FA 3H3UA 2FOKA 2RDPA 5L3CA 3E6DA 3LA3A 3F8MA 2EA4A 3FHZA 3QRFF 4HDVA 4UVAA 1T98A 2GAUA 2FA5A 4GGGA 2ZKZA 5D5WB 1BI1A 1K79A 2ZMEB 3WGGA 4OIQF 1P4WA 2KIFA 5DCMB 4GO1A 1T38A 5DD8A 1YW8A 5LRSA 4P9UA 4LB5A 5IT9K 4HBLA 3RYRA 5DYMA 1JXSA 1T6SA 1WQ2A 2IPQX 2ZMEA 5ICEA 2A61A 4L5IA 3HOTA 1S3JA 5HS8A 4ZZDA 2V1UA 3T0YA 2UWMA 3I53A 2XKOA 2XGXA 2HFHA 3KZYA 2D1VA 3BROA 2FF4A 3HUGA 4EQQA 2M45A 1W4MA 4EJVA 2EFWA 3HHHA 1D3YA 2B0LA 2OD5A 3FF5A 3VODA 2JZYA 4A0YA 1ZARA 3MQ0A 2JPCA 4ENJA 1YO5C 1T39A 4HLXA 1K78B 4YIIA 2JT1A 3CUQA 1D5VA 2W85A 1ZG3A 2Q2EA 5CVVA 4CZZA 4HF0A 3RKXA 3NRVA 4M9SA 2RKHA 2GA1A 1G6NA 1XN7A 2EV5A 2K7LA 4E70A 5A2QK 5AIPA 3BZ6A 1XGOA 4QLCU 1V4RA 5DUIA 3DQVC 1Y0UA 4A0ZA 3JAMZ 2NNYA 2MLGA 2XAFA 3TOAA 3GLXA 3G3ZA 2QBYA 5HLHA 5HVQC 5DDGA 5AONA 2CFXA 1NHAA 5HDKA 4BHBA 2L4MA 4HDUA 2BE5F 3IWFA 4G7ZF 2LF7A 3ECHA 5KK1A 3C1DA 4LB6B 1MJ9A 2GZWA 3P7NA 2ETHA 1KU2A 4EVIA 3O2PE 4RB1A 3KFWX 1GXQA 1ZREA 1ZLJA 4HOBA 3LAPA 4ESBA 5IT9Z 2M5WA 2OQGA 2PQ8A 4KIGA 1IF1A 4KMUX 2P4WA 1YW7A 4UNOA 4WXCA 1TQPA 3HYIA 4R8HA 5FD6A 1ZH5A 3FZVA 3DKWA 3ZPLA 1IXRC 2D1HA 2DPUA 4ASNA 2XIGA 1XSVA 1LNWA 4L9NA 2FBKA 2EV0A 2HQNA 4CHUA 1QBJA 1ON1A 1SFUA 3WE3A 4YG2F 4U88A 1AOYA 1IN6A 1IRFA 3TO6A 1QO0D 3F22A 1U6GA 1YYVA 3ZP5A 4EV0A 4RB0A 3C3WA 2IP2A 3DV8A 5ED4A 3E5UA 1R1VA 2M8EA 2R7FA 1ZGJA 2HYFA 5LEJA 2EK5A 2DI3A 4I7HA 2VE8A 1B9MA 4RB3C 2RVCA 4BHPA 2XAGA 2A3SA 2AXLA 2YX7A 3HRSA 4FHTA 2KIUA 2ZJ2A 1HSTA 1IW7F 1MD0A 2RV8A 4DNCA 3V7SA 3R60A 2V1XA 3V8JA 2W25A 3GYHX 4KA4A 2O6GE 3WTUC 1YS7A 2NRAC 1W5SA 1OYIA 5A2QZ 2KKOA 2K4BA 1O3QA 3BOQA 3CUQC 3CO6C 1F9NA 3E6CC 4PGHA 3HTUA 4RGXA 2V6CA 3RI4A 5D5UB 1BI3A 2FEZA 2V79A 4QWQA 1EH6A 4HLYA 4P96A 2OU2A 2LDUA 2HTSA 1WSUA 3WU1B 4U7DA 3F8CA 5BMZA 2VT2A 1EH8A 1KYWA 1ONVA 3ABUA 4Q47A 4ESFA 3J80K 5E1XA 4L0ZB 3BWGA 2LKPA 2DU9A 2BGCA 1Z9CA 2KIMA 1SD4A 4UVCA 3W6JB 4MHGA 3CJNA 1HKQA 2JSCA 3I59A 3M9AA 1FPQA 2EFQA 1G3YA 1IN5A 2FBIA 1LEBA 3NEUA 4ESJA 2STTA 3E6MA 3ERED 4PZJA 1UFMA 1I1SA 5HLIA 3F72A 2NYXA 1S29A 3ELKA 2PBIA 1KU7A 3I54A 3G73A 4MEXF 2A6EF 3T5XA 1J59A 3GZ6A 2DBBA 4NQWA 1XSDA 4WCGA 1O7LA 5D8LB 3IRRA 1MGTA 4I0BA 3L7WA 4O3MA 1T2KA 5LGNA 1TQIA 3QPTA 4Q5SF 2ZNZA 4LGWA 2MLKA 1XMAA 3TQNA 2DK5A 5J6XA 4LG0B 1ZLKA 4L18B 1G4DA 6PAXA 2YX4A 4ON0A 1AWCA 3GUDA 3F8NA 3EUHA 2JRTA 4Q4ZF 4RAYA 3HSRA 3NQOA 3HRMA 2GA2A 4B09A 4BH9A 2CYYA 3WGIA 3TOBA 2DT5A 1ZAOA 4ZZLA 4ETSA 4UV9A 2L4AA 2ISZA 1R7JA 2EWNA 2A07F 3DFGA 1U5TB 3FM5A 2R7DA 1FWZA 3P9IA 1LDDA 1SFEA 4KIFA 5D6EA 2GXBA 2L54A 3F8FA 3HOSA 2IT0A 5F6FA 2WV0A 1U78A 1B1BA 1FSHA 3WG9A 2A69F 2WWYA 2Z33A 3VOEA 2ZNYA 4CDGA 5EEGA 3BJ6A 1OMIA 1TW3A 3N4MA 1FC3A 3GEZA 1P92A 2JTVA 3M8FA 5FGMA 4RGRA 4JBAA 5FFZA 1E2XA 2FBHA 2VBYA 1YLFA 1GVJA 3V8KA 1A04A 3GXOA 1USTA 2O8XA 3PQJA 2HOEA 4LLLA 3O6BB 5D5VB 2XAQA 3TDUC 3EYIA 5CVIA 2ELHA 2F5FA 1XD7A 2Z3YA 5CJ9A 3JSOA 4XSZF 5L3GA 4IHSA 2G7HA 2Z99A 1ZN2A 2HS5A 4ENMA 3ISPA 4GXOA 4EM1A 3MAJA 2ZCWA 2QZ8A 4IVNA 2P7VB 1K78A 4HX8A 1IAWA 5D5XB 3IRQA 1ZHFA 3R4KA 2LSOA 3GW2A 3RDIA 5CVUA 2E1CA 3T1BA 3F21A 2CQKA 2QLZA 4LLGF 5E20A 1XMKA 3O3KA 4XLPF 3K1NA 4WX9A 3WTXC 3P9CA 2PG4A 5ILSA 1UCRA 2VN2A 1YG2A 3TDZC 1SD6A 2UXXA 2FE3A 2F5CA 2NS0A 2RGVA 1TNTA 4RGUA 4EMSA 2G7UA 5HOOA 4G9YA 4PGGA 4HW0A 2PEXA 2J5OA 3EDPA 4KN7X 2A68F 5LEKA 1QZZA 2ISYA 5JR3A 3KLNA 3U9GA 1RI7A 3DEUA 3MEXA 3GZ5A 1DUXC 2W24A 2FXAA 1F1ZA 3D5LA 1FP1D 4CXFA 2XKPA 2Z5UA 2HZTA 1P6RA 1Z6TA 4L9TA 4KT5C 1J9IA 3IWZA 3HRUA 3WTTC 4G6QA 1ODDA 2VXZA 4M74A 1S8NA 4EJTA 5FLXK 2DAOA 5BS6A 3KP4A 5FB2A 1MDMB 1S7OA 3COAC 2FNPA 1LJ9A 5F1RA 2C6YA 1QGPA 2ESHA 3QU6A 3ZMTA 3RPQA 3M1EA 5E8GA 2W57A 2H27A 2ZO4A 1TBXA 3LFKA 1FBUA 1YTYA 2FRHA 3J81K 3FWEA 1HW1A 4IRHA 2YR2A 4O5VA 2O03A 4HZFA 2QVOA 1QQIA 3B73A 3GO5A 2EB7A 5L3DA 1WWXA 4HQMA 2VOOA 4IPAA 4LK0F 4Y15A 2PJPA 4EGYA 1SAXA 3B02A 2XUBA 3FMQA 1BM9A 3FM3A 3RYPA 4L5JA 4LMYA 2QQ9A 4HA8A 3WE2A 5FO5A 1J5YA 1P2FA 2VOPA 2QQBA 1WI9A 1O3RA 4A12A 2WC2A 5L3BA 4AWXB 3HRTA 1W7PB 3S2WA 1YQAA 5LHGA 2OZUA 1ZGAA 5E18F 5H6QA 2UZKA 4WXHA 1L3LA 4XLNF 4XBFA 4MTEA 1C0WA 5F64A 1R22A 1ZG5A 2QBYB 1ZYRF 1TLHB 1GXPA 2CO5A 3K1PA 4PDKA 1H0MA 3SZPA 4HV5A 1UHWA 2PFBA 1IXCA 1E17A 3Q5FA 3M8EA 1TW2A 1EV7A 2LNBA 3E97A 2VBZA 1MJBA 4RB2C 2MC3A 3P9KA 1L0OC 1YS6A 1MZBA 1CGPA 5E17F 3F8BA 4M9ZA 1B6AA 4OIPF 4L9VA 4MGRA 1R1UA 2AS5F 4G94A 3JTGA 4XSXF 4G7HF 2YU3A 1JE8A 3W6KB 1DPUA 5JFRA 2Y75A 4OMYA 2XROA 5JHUA 2DW4A 1FYKA 3QP5A 1FYMA 1BBYA 5LHIA 1QZYA 3HHGA 3J81Z 3C7JA 4BHCA 2NAZA 5ILUA 1R23A 1XCVA 1MDMA 1FLIA 3E5XA 2P5LC 3F6VA 1CF7B 1SD5A 3LAJA 2OBPA 2XAHA 4GYGA 3SFZA 3J7AO 2HKOA 1JHHA 1RZ4A 2XHKA 3WTVC 4IXAA 3CO7C 3IHUA 4P55A 4I2OA 2G9WA 1ZG1A 3FMSA 2IW5A 3C18A 4MNUA 2EV6A 3RIRA 2GQQA 1F5TA 2DQRA 1S7AA 3TO9A 2BEOA 2VC0A 4N9HA 5J8CA 4AD9A 2CG4A 2O3FA 2GXGA 2P7CB 2XRNA 5LGUA 1Z91A 4MEYF 3CUOA 5LHHA 3HSEA 1KU3A 2W84A 1STZA 4TV7A 1BIBA 1FSEA 2RN7A 1R5HA 1U5TA 2DFIA 5D4RA 5TRDA 3BPXA 3E5QA 4ZYHA 4Z2YA 3GFLA 2HGCA 4YFKF 3HIFA 4XRFA 1CF7A 1KYZA 1LDKB 3QU3A 3K69A 3MFKA 3I5UA 1R00A 1SMTA 4EJOA 1TTYA 2A5YB 3MZYA 3KP7A 5IT3A 3KCCA 2L02A 4HQEA 1IUYA 3KP6A 3HSFA 5FFXA 5DD4A 1EH7A 4A6DA 2Z9OA 1FP2A 4M9XA 3I59B 2HR3A 4MQVA 4M72A 3EQLF 2FQ3A 1JHFA 1REPC 5HDNA 4UXNA 4U7BA 1O3SA 3I58A 1KU9A 5DV5A 3KP5A 2L3DA 4M73A 1ZRFA 3I71A 3FX3A 3PQKA 3I64A 3DF8A 5L3EA 2ZBKA 2HEOA 2K02A 1OPCA 2Q0OA 1LVAA 2FNAA 1Z6RA 3Q9VA 2GIVA 4UHTA 1YW9A 1WRJA 3QAHA 3V8LA 2F2EA 3QP6A 3WU0A 1B9NA 2O0YA 1DP7P 4H0EA 3LQQA 1OYYA 1IN7A 4LLNA 3F6OA 2DPDA 2FSWA 2HYGD 5JVTA 2RC4A 4A0XA 1XSXA 5D4SA 3I0TA 5BPDA 4KICA 4S05A 2R3SA 1KQ0A 4M6YA 1RUOA 3MCZA 4UVBA 3E3VA 4D0PA 5ILVA 5HDGA 1BI2A 2D45A 2NNNA 3AAFA 4KYWA 5FD5A 1FNNA 2H94A 4ZYGA 1G3TA 2OZ6A 1LB2A 4AIJA 1ZRDA 1SMYF 2O61A 3D0SA 4RGSA 5HS7A 4Y13A 1FT9A 4GYIA 4JQFA 2IA1A 2F5DA 5H20A 1HW5A 1I27A 4ZYDA 4I01A
chains in the Genus database with same CATH superfamily
1A31A 2TDXA 1WJCA 5KVRA 2CGPA 4II2A 1LDJA 2MA3A 1W36C 3IAS2 2IJLA 3LSTA 4C3HJ 1PP7U 2BBYA 1K6OA 1BI0A 2K4JA 3BQYA 2RNJA 5K5OA 4AIDA 1MSEC 3EUKL 3TMOA 1YRNB 3E7LA 2Q8KA 3WTYC 1WJEA 2PMUA 4CGZA 2P5KA 4I09A 4BEHA 3OYKA 1FOKA 1PP8F 1JKRC 2P5VA 2EILH 1HXDA 2X48A 4EJWA 1BW6A 1KQ8A 4OIRF 2OAZA 1XCBA 1UG2A 2GM4A 2CV0A 4Y17A 1BIAA 4DBQA 1ETWA 1LE8B 3ZQIA 4OAYA 2E7XA 2M87A 3JTHA 4GCVA 3TP0A 4CYDA 1J7KA 4O6JA 2ZJQF 2VASA 1NK2P 5EDNA 4JK1X 3OYJA 3MWMA 3VB2A 2LK2A 1XB4A 2E1NA 2KJBA 2EZKA 2DOEA 4LK1F 3K9TA 3F9KA 2V1DA 5FKMA 2MBFA 2UXNA 3OL3A 3PIPF 1FOXA 1JGGA 4IJAA 1KQ9A 3ECOA 2VIXA 3FXQA 4WXDA 4IEJA 4RDUA 3VYSB 3R0JA 3ZMDA 2LG4A 4KISA 3BY6A 4E7SA 3CCJI 2BV6A 5D8KB 1OKRA 3ABMH 2ZMEC 4OU0A 2GXAA 3H0GJ 1TT0A 4LFUA 5E1WA 3WTZA 2NS8A 3U21A 1W7PA 3RJPA 3W6VA 1R1TA 1ETYA 1MH3A 2CS3A 1UB9A 1I6XA 2VODA 4KNYA 1P9QC 2AQEA 2BW3A 3HG9A 2XSDC 3W3CA 1TWCJ 3BDDA 2ZFUA 4I0AA 4XLEA 1MMAA 3CLOA 3ABLH 4CICA 5HLGA 2X0LA 1ETKA 3DBLB 4ENKA 4KIBA 2DCEA 2HDCA 3VWBA 1K7AA 4G6DA 3LA7A 4M6XA 1U2WA 2AHQA 3KETA 4CCLA 4ZTJA 5FRNA 4RAFA 2KRFA 2XSJC 2CQQA 3IP4B 5IYBJ 4IHVA 3SXYA 5BOXA 5DEQA 2YU9J 1O57A 1RUNA 2F4OB 4I98B 2RAEA 4YIFA 1JUPA 3D5RC 2E34A 3KP3A 1LQ1A 1CQTA 2XGDA 2OA4A 1IO2A 3OYFA 3HBLA 1HKSA 1YJNI 1LFUP 2KIQA 3ZQQA 1W7PD 2QM3A 2V7FA 3SJMA 4U0WA 4H4KC 4XRMA 3WTSC 3CUQB 4JOMA 1MMSA 2K9QA 5CVJA 1WZ2A 4A3MJ 1D8JA 4A3JJ 2VKHA 1LFPA 1MMGA 2QQ8A 3OS0A 5LBQA 1Z05A 2OQRA 3W2VA 3ML6A 3ZXSA 1KA8A 1PUEE 4BQQA 3FXRA 1ULYA 3A4CA 4FT8A 2QYOA 4BQAA 1X2NA 3U1KA 2ME6A 3CJQB 4RS8A 4M71A 1XGSA 1R71A 3EETA 1DPRA 2PN6A 3HJEA 2JPBA 1T0FA 2XV4S 2E2JJ 3M3YJ 2L9VA 3LQRA 3RKYA 5IPAA 3H3ZA 5KAIC 2Y31A 2BVMA 2IGNA 4IRIA 2M3AA 2DQLA 3IH3A 4LJZF 5J1YA 2WAEA 2XGCA 3PUBA 3TO7A 4OOIA 5DM7F 1WVRA 2IXSA 5EEAA 2IVMA 5B5EC 4HPQA 4N9IA 2A6HF 2H6CA 4ZH4F 4BY1J 1LUJB 2EINH 5M5WJ 2JA8J 3EUHC 5F0HA 2M7BA 2X51A 3M1CA 3CCLI 5BQTA 1H89C 2PMHA 4XKCA 1BR2A 1JUSA 3K1MA 2VJ5A 3OYIA 1T8IA 4M6VA 2CSOA 2XB0X 4F55A 1TNSA 3H9JA 1IGNA 1VQ5I 4OIOF 2FUG2 2K40A 4L9JA 4F7ZA 3GTQJ 2ZXJA 4FCYA 4N0BA 2HDDA 2ME0A 1I1GA 2MH9A 3ZQCA 3VSLA 1XMXA 2QGUA 1WJBA 4C30A 2VL8A 4R79A 3IKTA 1VQ8I 3FMRA 3JRBA 1W5TA 3WGHA 3WODF 3Q9SA 3G6EI 3GTPJ 1ZRCA 2EA2A 4XKVA 2LD5A 1JI8A 2L7KA 5E1ZB 1VF9A 3RPUA 4B44A 1W0UA 2CUJA 1KZHA 2MG4A 2FMLA 1O3TA 3DP7A 4V2GA 1MJAA 2ZXWH 2Z2SB 4DJAA 3LSKA 4YFNF 3CMYA 1H9TA 2M4GA 2EZHA 3RPUD 1OLTA 4XNFA 4EATA 2V9KA 5IP7J 2E5ZA 4BQNA 3IH2A 3F23A 1HOMA 2E7WA 1SFXA 2QENA 4RM3A 3ZQLA 2IS6A 4FX0A 2LF8A 1FYLA 1XC5A 4NUBA 3DXJF 3JAMK 4WK8F 2PLYA 2VONA 2R7TA 3MMYB 3U1DA 3DPTA 5ERIA 3JSPA 1YITI 3BJAA 1G2HA 4RLFA 4HF2A 2GWRA 1TZLA 4HNVA 1B59A 3ZMSA 1R58A 2E60A 4W97A 4MQ9F 3GWZA 3ZOBA 3PNYA 4E7JA 1R9TJ 3WTWC 1I3AA 4YEJA 2CQNA 4BNCA 2HKXA 2COMA 3AL0C 3A0BC 2YPRA 3OYDA 3ABKH 1QPMA 3OSGA 3KE2A 3REOA 3L2CA 2VC1A 4CO8A 4UUVA 4J01A 3GFJA 4G8XA 2R92J 5K5QA 2JQ7A 4KMFA 2AXTC 3PFIA 4A2UA 4EM0B 4BJTA 3A01A 3FXLA 2NS7A 4HV6A 1LEAA 5EZGA 4ENNA 3BZCA 5HS9A 1IJWC 3K0LA 2G0EA 2VUMJ 4AVPA 1Y0NA 2LP0A 3E0JB 3RKWA 2R7RA 2FU4A 4I02A 2LRDA 1IN4A 2XAJA 2FOWA 3BZKA 3SQNA 3BJOA 2QUFA 2ZXHA 2R7QA 1EA3A 3MKWB 1UJ8A 2K27A 1O7FA 4XONA 3R0AA 1XGMA 5FKKA 2IS1A 2MD5A 1F4KA 2RQQA 1I50J 2E1OA 3CQZJ 3LWFA 3ZN1A 2STWA 4YRVA 3H9QA 1Z67A 5J4VA 3CJRB 4LITA 3I4MJ 4A5NA 2IA2A 2ECCA 4A6EA 4BJ5C 2W7NA 3H35A 2EH3A 3T8RA 1U8RA 3KYDB 1IZ1A 1PDNC 3ZR8X 5CVRA 4EM2A 3EYYA 2EQRA 1WKMA 2VBXA 1M1EB 3RQ4A 4DZPA 1HQCA 1LVKA 3VYRB 2MGQA 5B3SH 5LLQA 5F0CA 2H6BA 3M4OJ 5TJJA 3BPVA 2YS9A 2Y30A 3CCEI 4HF1A 1R5GA 4IHTA 1Q1HA 1BC8C 2DK8A 4XOPA 3M7GA 4U0YA 3F0CA 1Q1VA 4Y52J 3IC7A 5BPIA 3BQZA 4DBRA 2ESNA 3HUGB 1MNDA 1JKPC 1QVTA 1IRZA 3GX4X 5EGOB 5E8IA 5IYDJ 3GVAA 2HI3A 4PSXA 2HOAA 2HTJA 3GTKJ 2DA2A 4KDPA 2HWVA 4AIHA 4HAMA 1RESA 2HXIA 1PUFA 4G7OF 2KRHA 4HSRA 3HDDA 2O7OA 2QQAA 2CQXA 1MNMC 3LFUA 3MKZA 1OR7A 1QHGA 2P6TA 3EUAA 4EJUA 5B1BH 4ZDPA 1GUUA 2M1BA 2ADUA 1G3SA 1GHCA 1ZR4A 2HVSA 4XN0A 1SAUA 1J0RA 3HOVJ 2EJRA 5FRMA 2HQRA 3K4NA 4KFCA 2EFPA 4PSWA 5EG0B 1JKOC 5DCMA 4XLFA 1X19A 2V9VA 2E19A 4UUTA 4WF2A 1DDNA 2F48A 1FY7A 3J80Z 2DFEA 3L09A 2Y0SA 1TWFJ 2K86A 3NWTA 4JX4A 1S6LA 3X2QH 2D5VA 4NC8A 2GLOA 3WG7H 2KJCA 4FE7A 3PL8A 2CV1A 2VBWA 5EGOA 5M5YJ 1NTCA 1XGNA 1FZPB 1YIJI 1TQMA 2KP6A 2M34A 3ABTA 5JVGF 4EGZA 1BN5A 3BTLA 3BG9A 4HEA2 2AO9A 2IEKA 4J19A 4IOAF 3TL4X 2JA2A 1UG0A 3CP8A 3ROUA 3KEOA 3HTSB 4C9YA 1LKXA 3OL4A 1V5FA 4B8XA 4Y33A 2YSRA 3H92A 3OOPA 4MTDA 2ACJA 2X1EA 1XPXA 2CV2A 3OYEA 2VJIA 2KQRA 1U3EM 3IL2A 3PSFA 4LIUA 3CDHA 3I9V2 1XDUA 3CCVI 5K7FA 4FX4A 3U2RA 5L3FA 4MLOA 2I8DA 5F0FA 2HVQA 1W5CC 1I5ZA 4IF4A 3AKZA 3LA2A 1MKMA 2LTPA 3R61A 3CCMI 3UR3C 1WGXA 1JGSA 1HW2A 2L9NA 2WTEA 4D7NA 4YFXF 3AG2H 3KLOA 4IO9F 3GFIA 2DA6A 1POGA 3HEFA 3K2ZA 2IRFG 5LGTA 2DTRA 4OMZA 4BU2A 3BLYA 1ON2A 1MNEA 1T08B 3FXUA 3OR1C 4FISA 1RIOH 3ZQ7A 1RETA 1W36D 3ZMZA 3I4PA 2PI0A 1IRGA 4RAZA 2IS2A 4BXUA 3M8JA 1D1BA 1IXSB 2VKDA 2DOFA 1BJAA 3K4LA 4LG0A 2P8TA 4DQ2A 1VQ6I 4ZYEA 1H9GA 5FLXZ 1BR1A 3IV5A 3JW4A 3K4MA 2Y48A 5ICFA 3VYTB 5EEHA 5KAFC 2R0QC 2MH2A 2X1DA 3FK7A 2XASA 4K2EA 1UHMA 2B9SA 3CD6I 3DTIA 3A02A 3VFZA 4LD5A 1XDSA 4IX7A 1RRJA 2W00A 4CCKA 1BC7C 3HOYJ 3MZHA 2VKVA 5DCFA 3SZTA 3ZN0A 5K1YA 4X0GA 2X4HA 2IGMA 1FX7A 3SHFA 2ZFWA 5FKOA 2IAIA 2H1LA 2QWWA 4P5OA 4HYEA 5KHDA 2DLLA 3VEPA 4RLQA 4XKWA 3BP8A 1XX5A 1GDTA 2R7UA 1WJ5A 4G12A 2MYSA 1KGSA 3F3XA 3CMAI 2XVCA 3O8HA 4GRIA 4IRGA 2D2WA 3GBGA 2EFNA 1P4AA 3KEQA 4R1HA 5CYVA 2KL4A 3KP2A 1R36A 3N97A 1RKWA 2CWEA 1AA7A 3ZMVA 2VPRA 2Y0MA 3IAM2 1JT6A 5HNHA 1I6HJ 4KUMA 4IKFA 4OINF 1D8KA 5B66C 5HLTA 3BR3A 3E6BA 1U9NA 2DT6A 2FMYA 2CFOA 3OYBA 4CCJA 3HC7A 1OQYA 5CLSA 3BG7A 1P4XA 3R6SA 1X1AA 3H3VK 1USSA 3C2BA 2R7VA 3DPLC 1VFCA 4DYCA 1U5TC 3I3LA 2DMUA 2WV1A 4M3DA 1QZEA 4KN4X 4N4OB 4P9FA 5TGTA 2F5EA 3M07A 3ZMUA 2VT3A 4C2TA 3GFMA 4BYYA 5ICCA 5M5XJ 4S04A 2V6EA 1SD7A 4X6AJ 3V4GA 1IRXA 1RNLA 5ICGA 1SEUA 2BZTA 3WHCA 1J2XA 4BL0B 4A5MA 4WWCA 1TT5B 1V3FA 2Z1DA 3OYAA 3S93A 1Y56A 2BYVE 3HB9A 3KIOA 2XPWA 2RQPA 5H6RA 4A3DJ 3RTRA 4Q48A 4BAYA 1WH5A 4UV8A 1G3WA 2HQ5A 2ZC2A 4AIKA 4L0YB 1VQMI 2JUGA 3KEYA 1J75A 2Z16A 3G1LA 1IDZA 2NXNB 1BOAA 3S2HJ 3FBIB 2V1NA 1YJWI 4U87A 5JHFA 1VTNC 2L01A 1YX5A 4PJLA 2N8GA 2LR8A 2DO7A 3OSFA 2M30A 3L00A 1QNTA 3GTJJ 2CW0F 4FTHA 4JYKA 1HKTA 1X3ZB 3CTAA 4HX7A 3QPHA 3T8TA 4MFDA 1HSJA 3K4BA 4DW6A 1Z1DA 4NB5A 1IN8A 3JRAA 2KPMA 4LG3A 3ULQB 1B4AA 2DA5A 2M4KA 3TGNA 3OYGA 2DMQA 1YIOA 3KZZA 4BE1A 2K9MA 4CSWA 1TWHJ 3TKYA 2VE9A 5K5RA 1HBXG 1FBSA 1OYWA 4I6ZA 3V7RA 3TBIA 3PNVA 5CQEA 1WPKA 5H2FC 1IV8A 4U0VA 1Z7UA 2P6SA 4NHJA 2W48A 1D1CA 3IKVA 5LFAA 4UUSA 1YFHA 1JTXA 5LRRA 4ABZA 3V7CA 4IHWA 3GF2A 2H09A 3SZGA 1SC7A 1D0ZA 5C44J 3AL0B 2DFHA 2IA0A 4XOTA 2NVUB 4E7KA 1N78A 3QPSA 4V2FA 1BA5A 5DUKA 5E79C 3O8GA 5JI6A 2H8RA 3KPHA 2R5YB 4BJ6C 2F4IA 1VQPI 1FBQA 1OISA 5J8FA 2EFOA 2J5PA 3L9FA 2KDOA 3QOPA 3SDBA 5GAEJ 3BT9A 3OV8A 4PCQA 4HX4A 1X3UA 5AIQA 2UUZA 1NK3P 3AG1H 2OTLI 5D6FA 4XMYA 3H3UA 2FOKA 1TWGJ 2RDPA 5L3CA 3IH4A 3S8PA 3E6DA 3LA3A 3F8MA 2EA4A 2BY2A 3FHZA 2WBMA 3QRFF 4M3GA 2PMZA 4UVAA 4HDVA 4F3QA 1T98A 2GAUA 2FA5A 4GGGA 3JRIA 3IUOA 3FXJA 1P7JA 2MC4A 1DGRM 1B72B 4DZJA 2ZKZA 5D5WB 1BI1A 3PSIA 1I39A 3C2GA 1K79A 1MSFC 1SANA 1H8AC 2ZMEB 3LNQA 9ANTA 1ETQA 2V26A 3S1NJ 1QU3A 1A35A 3WGGA 4OIQF 2KLOA 1UELB 3OS2A 1P4WA 2DYSH 2KIFA 3QYFA 5DCMB 4GO1A 1HC8A 1T38A 1WFXA 1YW8A 5DD8A 1ZELA 2HDWA 4P9UA 5LRSA 4LB5A 3BTJA 4ZDOA 5IT9K 2PX9A 4HBLA 3K2AA 3RYRA 5DYMA 2BW3B 4DYQA 3DBHB 4IOCF 1JXSA 1T6SA 2K5CA 1WQ2A 4ANJA 2IPQX 4M3EA 2ZMEA 5ICEA 2A61A 4L5IA 4E7HA 4D5CA 3HOTA 5M3MJ 1S3JA 4FE4A 4XKBA 5HS8A 1V55H 3RQIA 4ZZDA 2V1UA 1G8XA 4ITVA 4QTRA 1VQKI 3T0YA 2UWMA 4V19K 3I53A 2XKOA 2EIKH 1RPWA 1WJFA 4BGDA 2XGXA 3G1MA 1JJ6C 2HFHA 3OIQA 2OTJI 3KZYA 1MBJA 2JWTA 1VQOI 2D1VA 3QODA 2HU9A 3BROA 2FF4A 2WAQN 2X85A 3KYCB 3HUGA 4EQQA 2VQLA 2LFBA 2M45A 3L2VA 1W4MA 4CA0A 4EJVA 2EFWA 1OCRH 2X6OA 3HHHA 1D3YA 2B0LA 2H1KA 1SVLA 4B3XA 5J40A 2OD5A 3FF5A 5GTIC 3CZ6A 2JA6J 3VODA 2JZYA 2KRCA 4A0YA 1RR7A 1A6QA 1ZARA 3MQ0A 2JPCA 4A3BJ 2DN0A 1S9HA 2ELJA 2DA3A 1E3HA 4ENJA 2KISA 3OYHA 1KONA 2QEXI 1BOBA 4N4NB 1YO5C 1T39A 4HLXA 3H5NA 3H36A 4DIQA 3J7YJ 1K78B 2HNHA 2TRTA 3MKLA 4YIIA 2JT1A 3CUQA 1D5VA 2R7OA 1VQLI 2W85A 3BG3A 2K85A 1ZG3A 2Q2EA 4BQOA 3HZJA 4LOCA 5CVVA 4CZZA 4J00A 4HF0A 3OS1A 2NVXJ 5CPRB 3RKXA 3NRVA 4KJZA 4M9SA 4C2UA 2R7ZJ 2CW7A 2RKHA 4C2MJ 1VI0A 2GA1A 3S16J 3G71I 1G6NA 1XN7A 2EV5A 4PFPA 1T95A 2K7LA 4I76A 4E70A 3DLLF 2DA1A 2PMZN 4KITB 5GPAA 5A2QK 5AIPA 3BZ6A 1XGOA 4QLCU 1V4RA 5DUIA 3DQVC 1Z77A 1Y0UA 4A0ZA 3JAMZ 4XRSA 2CUEA 2ELKA 2MLGA 4YIRX 2NNYA 2EIMH 3HPHA 2CH0A 2XAFA 3TOAA 1A6IA 3GLXA 3GLLA 2WAFA 1OJLA 1HLVA 4BDZA 3HXLA 3DTKA 3A2KA 1B72A 3G3ZA 4BBRJ 2QBYA 5HLHA 5HVQC 2F5VA 4A3IJ 5DDGA 1MBGA 5AONA 2CFXA 3HM5A 1NHAA 5HDKA 4E4HA 1Z21A 1S72I 2L7ZA 1AKHB 1OR7C 3DCFA 4BHBA 4CYCA 2L4MA 4HDUA 2EPFA 2BE5F 3IWFA 4G7ZF 1BJZA 2LF7A 3ECHA 1WJDA 2BXZA 1XG1A 5KK1A 3C1DA 4LB6B 1ETOA 2DA7A 2CRGA 2VJJA 1MJ9A 1ZTRA 1VZ0A 2GZWA 3P7NA 2ETHA 1KU2A 1MH4A 2WB1A 3LSHA 2OPTA 4QSHA 3SYTA 2LBFA 3LSPA 4EVIA 3A1YA 3O2PE 3SEQA 3HKZA 3KFWX 1GXQA 4RB1A 1ZREA 1ZLJA 4HOBA 3FXMA 3L2UA 3LAPA 4F91B 2Q1ZB 4ESBA 5IT9Z 2M5WA 4XM3A 2OQGA 2PQ8A 3CP2A 4KIGA 2XDVA 1IF1A 4MO7A 4KMUX 2P4WA 3FKJA 3L2WA 1Y1WJ 1YW7A 4UNOA 4WXCA 1TQPA 4B47A 3HYIA 4R8HA 3S2DJ 5FD6A 1ZH5A 3FZVA 2GOMA 1JTYA 3DKWA 3ZPLA 1IXRC 2D1HA 2DPUA 4ASNA 2XIGA 4ZTFA 1XSVA 1LNWA 2IBDA 2OC6A 4L9NA 2DMTA 4B48A 2FBKA 2EV0A 2ID3A 1YI2I 4II3A 2HQNA 3FKIJ 3OYCA 1QBJA 4CHUA 3RZOJ 1ON1A 1SFUA 3WE3A 4YG2F 4U88A 1AOYA 1IN6A 5GADJ 1IRFA 1B8IB 3TO6A 4NBQA 1QO0D 4NNJA 1X1CA 4A93J 1D5YA 5DTDA 3F22A 1U6GA 1YYVA 1X3WB 2I10A 3ZP5A 1Z0XA 4EV0A 4RB0A 3CF2A 3C3WA 1HDPA 2IP2A 2HPIA 3DV8A 5ED4A 3E5UA 2DDAA 1R1VA 3QPLA 2M8EA 1F36A 2R7FA 1ZGJA 5IOZA 2HYFA 2BY1A 5LEJA 2EK5A 4FQGA 3CLQA 4BXFA 2BHZA 2DI3A 4I7HA 5KNLA 1V5GA 2VE8A 3S14J 4UUSB 1B9MA 1Y1VJ 2QKMB 1D1AA 1VNDA 2RVCA 4M3FA 4RB3C 3BTCA 4BHPA 2XAGA 4XLCA 2A3SA 2K3PA 3K6GA 4XQFA 2AXLA 2YX7A 3HRSA 3I4NJ 4FHTA 3BG6A 4YELA 2KIUA 1QVUA 4E7IA 2O8KA 2ZJ2A 2XPVA 3ASOH 3KX2A 2JVHA 3V42A 1FOWA 1HSTA 1IW7F 1MD0A 4XN3A 2RV8A 1QA6A 4DNCA 3G2BA 3R60A 3V7SA 2V1XA 3V8JA 2COBA 4E7LA 1S5LC 1G59A 2W25A 2KZGA 3ZRGA 3GYHX 4KA4A 2O6GE 3WTUC 4A69C 2JUCA 2F6CA 1YS7A 1X1BA 3TW7A 1GV2A 2MW8A 1W5SA 2NRAC 1OYIA 1R49A 5A2QZ 1QHHD 4HG2A 2KKOA 2QF7A 1SVOA 1DGWY 3DU6A 2K4BA 1O3QA 2X6WA 3BOQA 3CUQC 3CO6C 1F9NA 3E6CC 4PGHA 3HTUA 2E5NA 4RGXA 2V6CA 3RI4A 5D5UB 1BI3A 2FEZA 2V79A 4QWQA 5C3EJ 1EH6A 2LMDA 4HLYA 1V5EA 4P96A 2OU2A 2GIZA 2LDUA 3GTOJ 2HTSA 2F4MB 1WSUA 3WU1B 2M0MA 4U7DA 1EKEA 4HNUA 3F8CA 1OCTC 4PUSA 5BMZA 3CC7I 3PFYA 2VT2A 3BR5A 1EH8A 3ABUA 1KYWA 1ONVA 1WH7A 2L2OA 4FASD 1Y8QB 4Q47A 4ESFA 1X1PA 3J80K 5E1XA 3KYLA 2LOOA 4L0ZB 5C4JJ 2QKLB 2E1MC 2QCOA 4A3KJ 2XF5A 3BWGA 4I99C 5C4XJ 2LKPA 2DU9A 2BGCA 4W1UA 1Z9CA 1ETVA 2KIMA 1SD4A 4UVCA 1VQ9I 3W6JB 4MHGA 3CJNA 1HKQA 2JSCA 3I59A 3M9AA 1FPQA 1MIJA 3FBNB 5IP9J 3S3OA 3GTMJ 1V54H 2EFQA 1G3YA 1IN5A 3K4KA 2X6YA 4E7ZA 1RKTA 2FBIA 3DBRB 1LEBA 4PJ0C 2O5RA 3NEUA 4ESJA 2VB6A 3JRGA 2STTA 3E6MA 3BG5A 4AVZA 1FTTA 2A5WA 3ERED 4PZJA 3HGYA 5GP9A 1MMNA 1UFMA 1I1SA 3ZQGA 1ETXA 5HLIA 3F72A 5M3FJ 2NYXA 1S29A 4D1QA 3KZIC 3OIPA 3ELKA 1QPIA 4KT6A 1NG6A 2E71A 2PBIA 1KU7A 3I54A 3LSIA 3G73A 4MEXF 2A6EF 1ORKA 2K9LA 2DT7B 3T5XA 1J59A 3VYUB 3GZ6A 2DBBA 1HF0A 4NQWA 5F1JA 1XSDA 2CMPA 2E36A 3I56I 4WCGA 2EIJH 3D1NI 2M2EA 1O7LA 4XRSG 5D8LB 1W1WE 4DGWB 3IRRA 1MGTA 4I0BA 3L7WA 4O3MA 1T2KA 5LGNA 1TQIA 3JCUC 3CCSI 3QPTA 4E6KG 4Q5SF 2ZNZA 4LGWA 4GFBA 2MLKA 1XMAA 3TQNA 1FIPA 4NC7A 5EYRA 3OY9A 3LOCA 2DK5A 5J6XA 4LG0B 3LSGA 2P0WA 1ZLKA 4L18B 2IGOA 4QPOA 1FJLA 3GZNB 1G4DA 6PAXA 3RKQA 2HOSA 2K9SA 2YX4A 3GTLJ 3LSRA 3ONQA 4ON0A 1AWCA 4X1EA 4B43A 3GUDA 1TWAJ 3F8NA 3EUHA 3E1SA 4AM3A 2JRTA 4Q4ZF 5FJ8J 4RAYA 4C3IJ 3HSRA 3QYEA 3NQOA 1W0TA 3HRMA 3DEWA 2GA2A 4B09A 4BH9A 3ESWB 3TW6A 1DQUA 2CYYA 4IHYA 5B1AH 5J1RA 3WGIA 2ZSIB 1OCOH 3TOBA 3MN2A 2DT5A 1ZAOA 3DU5A 4ZZLA 4ETSA 4UV9A 2ZSHB 2L4AA 1RC9A 3BR2A 2ISZA 5FLMJ 2BVLA 4HSTA 1R7JA 2KHMA 5TISC 1Z7LA 3AG4H 2EWNA 2A07F 3HOUJ 1PYVA 3DFGA 1U5TB 3FM5A 1VQ7I 2R7DA 2M7AA 4RMNA 5J3LA 1FWZA 3K7AJ 5CKTA 3P9IA 1LDDA 1SFEA 4KIFA 5D6EA 2GXBA 1Y8RB 2L54A 2HZDA 4D7MA 3F8FA 3HOSA 2IT0A 2XAUA 3PNTA 5F6FA 2HYJA 2WV0A 1U78A 1B1BA 2MFZA 1FSHA 3Q0UA 3AFHA 3WG9A 5K7HA 2A69F 4RA2A 4ZDLA 4AC0A 4CYCB 1MW7A 3L2QA 2WWYA 2Z33A 4BE2A 1S7EA 1LPQA 1LE8A 3VOEA 2ZNYA 4CDGA 5EEGA 3BJ6A 4PJJA 2ZJPF 1OMIA 1TW3A 3N4MA 5E3NA 1FC3A 3GEZA 2DDBA 1P92A 2JTVA 2LREA 3M8FA 5FGMA 4RGRA 2LYCA 4JBAA 1DU6A 2R5YA 1YRNA 2VKEA 5FFZA 1E2XA 2FBHA 2LKSA 2WY8Q 1FTZA 2VBYA 4UB6C 1YLFA 3W2AA 1GVJA 3V8KA 1A04A 2KMUA 3GXOA 1U8BA 1USTA 2O8XA 2MABA 3PQJA 2HOEA 2L9RA 4IZZA 3PO3J 4LLLA 3O6BB 3FISA 5D5VB 2XAQA 3TDUC 3EYIA 5CVIA 1MBHA 2ELHA 4D5FA 2F5FA 1Y6IA 1XD7A 2R5ZB 2Z3YA 5CJ9A 3JSOA 2XGEA 4XSZF 5L3GA 4IHSA 2QSFX 2G7HA 4XK4A 2Z99A 3FDYA 1ZN2A 2HS5A 4ENMA 3ISPA 4DOZA 2Q2EB 2ID6A 1ZGWA 1X1DA 4GXOA 4EM1A 3MAJA 2ZCWA 2NOJB 2QZ8A 4IVNA 3WU2C 2P7VB 1K78A 2NVYJ 4HX8A 1IAWA 5D5XB 3IRQA 4BE0A 1MMDA 1T56A 1QRYA 2KT0A 3BC8A 1ZHFA 4XL9A 3R4KA 1FOYA 4BY7J 2LSOA 3GW2A 3RDIA 5CVUA 3G1OA 5E3LA 2E1CA 2QSGX 3OR2C 2WAQA 3T1BA 3VDXA 3F21A 2RREA 2XC7A 2CQKA 1GVDA 3HL2A 2JMWA 2DOAA 2QLZA 3FHNA 2VQCA 5EF6A 4LLGF 2ICWG 5E20A 3VPRA 4A3CJ 2M8GX 4Y3OA 1XMKA 3O3KA 4XLPF 4ZJZA 2OCCH 1OCPA 5GAGJ 3K1NA 4WX9A 3WTXC 3P9CA 2PG4A 2L7FP 5ILSA 1UCRA 2VN2A 1NG7A 1YG2A 3TDZC 1SD6A 2DFFA 2UXXA 2FE3A 1WCMJ 3CJTB 2DJIA 4A3EJ 2F5CA 1APLC 1IDYA 2NS0A 2RGVA 3HPGA 4L5EA 4AUXA 1TNTA 1PVEA 4RGUA 1HCRA 1BR4A 4EMSA 3LL7A 2G7UA 1SVMA 5EG0A 4BXXJ 5FKLA 3H5AA 3JRCA 5HOOA 4G9YA 4PGGA 3J7ZI 2JA7J 1YX3A 4HW0A 1JJ8C 3OOUA 3H0DA 2PEXA 3NAUA 2J5OA 3EDPA 3QOEA 5F27A 2Y9ZA 3CC2I 1ZQ3P 1FIAA 5JLXA 4KN7X 2A68F 5LEKA 4XIDA 4IHXA 1EJ9A 1QZZA 2GOXB 2ISYA 5JR3A 1WHUA 3KLNA 3U9GA 2E1MB 1RI7A 3DEUA 1DP3A 3MEXA 3GZ5A 1DUXC 2W24A 2WADA 3RZDJ 2FXAA 2LY2A 1F1ZA 3D5LA 1FP1D 4CXFA 2XKPA 2Z5UA 2HZTA 4AYBA 3L2RA 1P6RA 1Z6TA 4L9TA 4KT5C 1J9IA 2UV1A 3S1MJ 1AU7A 3IWZA 3HRUA 3WTTC 2L0KA 4G6QA 1ODDA 1TL8A 4B1RA 2M9HA 3ZQFA 2VXZA 4BACA 2AQFA 4CCMA 4M74A 1S8NA 3JRHA 4EJTA 1TP4A 2DAOA 5FLXK 5BS6A 3KP4A 5BNGA 3Q0VA 5FB2A 1MDMB 2R7XA 3N05A 1BW5A 1S7OA 3COAC 2FNPA 1LJ9A 5F1RA 2C6YA 4IQJA 1QGPA 2W82A 2PJRA 3CCUI 4BUPA 2ESHA 3QU6A 3ZMTA 3TEDA 3MZ8A 2FX0A 3RPQA 3M1EA 4Y7NJ 5E8GA 2W57A 2H27A 1MBFA 4PK4A 2LH9A 5J47A 3GMEA 1UMQA 2ZO4A 1Z3YA 3MVPA 2OCEA 4JX6A 3HOXJ 1TBXA 2JJ7A 3LFKA 3OIOA 1FBUA 1YTYA 1B8IA 3S17J 3DLAA 3OMYA 2FRHA 5JLWA 2DA4A 3J81K 2YUSA 2LY9A 3H1CA 3FWEA 1HW1A 4JX5A 4IRHA 2YR2A 4JP0A 4O5VA 2O03A 2RNGA 4HZFA 2PJRB 2OUMA 2NVTJ 2QVOA 1QQIA 3B73A 3GO5A 5F04A 5IP6A 2EB7A 5L3DA 1WWXA 4HNTA 4HQMA 2VOOA 4NC6A 3CMEI 2DMPA 4IPAA 3SEZA 4LK0F 4Y15A 2PJPA 4EGYA 2JK3A 1SAXA 4UY8I 2V9PA 3B02A 2XUBA 3FMQA 1BM9A 3FM3A 3RYPA 1X2MA 4L5JA 4LMYA 2E2IJ 2QQ9A 2R93J 2EZIA 3D5SC 4HA8A 1YJ9I 3WE2A 5FROA 2XB5A 1UZCA 5FO5A 1J5YA 1P2FA 2VOPA 1D0YA 2QQBA 3DKYA 1WI9A 1U0JA 4A12A 1O3RA 2WC2A 5L3BA 2EZLA 4AWXB 4OWRB 1ZR2A 4UB8C 3HRTA 1UHSA 1FMWA 1U9OA 4HRIA 1W7PB 4P1WA 3S2WA 1YQAA 1GV5A 5LHGA 2DTZA 2OZUA 4NDLA 2LY1A 1ZGAA 2Y69H 5E18F 5H6QA 2UZKA 1K4SA 4WXHA 1L3LA 5E3OA 1XS9A 3K4CA 4XLNF 4XBFA 4MTEA 1C0WA 5F64A 2LLKA 3QWLA 2XF7A 3S1RJ 5DM6F 1GLNA 1FEXA 3BR6A 1R22A 1ZG5A 1K83J 2QBYB 2BY0A 3QQAA 2QA4I 1ZYRF 1OFCX 1TLHB 1GXPA 2CO5A 2W4SA 3K1PA 4PDKA 3HKZN 3JREA 1OCZH 4F52A 1N75A 1H0MA 2CQ7A 1VQNI 1XTAA 3H9GA 2BXYA 3SZPA 1MBEA 4HV5A 1GT0C 4QIWN 2B7EA 5GAHJ 1WI3A 2HXOA 1UHWA 2PFBA 1IXCA 1E17A 2DJNA 3Q5FA 4M3BA 1K4TA 2VI6A 3M8EA 1TW2A 1EV7A 4RAGA 2LNBA 3E97A 3A01B 2VBZA 1PJRA 1K61A 1MJBA 3JRFA 3SDGA 1P7IA 3NWSA 3ZGKA 4RB2C 2MC3A 1LFBA 1SFOJ 3P9KA 3UKGA 4NQWB 1L0OC 1YS6A 4XR6A 2CJJA 1MZBA 4A3FJ 3SFIA 1CGPA 5E17F 2M0CA 3F8BA 3RCOA 4M9ZA 1YOVB 4AU7A 1PUFB 1B6AA 2V4JC 3ZCOA 4BKXA 4OIPF 4L9VA 4F93B 5EZHA 2DMNA 4MGRA 1R1UA 2HOTA 2AS5F 4G94A 2E35A 4ZC3A 1EF4A 2ZJRF 2EBIA 4CH7A 1I3QJ 3CCQI 4XLHA 2P81A 2WY7Q 3JTGA 2H8WA 4XSXF 4G7HF 2YU3A 3A03A 2JN6A 2KFDA 3CC4I 2DXIA 2OJED 3UNGC 1JE8A 3HOZJ 3W6KB 1DPUA 5JFRA 2Y75A 2R4GA 4OMYA 1E0EA 2XROA 5JHUA 3BTIA 2DW4A 1FYKA 1JUMA 4Y4RA 3QP5A 1FYMA 4LIVA 5KCMA 1X4OA 5LD2C 1BBYA 5LHIA 1QZYA 3HHGA 1X58A 3CF5F 3J81Z 2VJ4A 2BOLA 3C7JA 5FLVA 1AHDP 1ZK8A 4BHCA 2NAZA 4CCNA 2OV7A 4C3JJ 3C2HA 3NARA 5ILUA 1IUFA 1R23A 1XCVA 5IY5H 1A36A 1MDMA 1FLIA 3E5XA 4D9JA 2P5LC 3F6VA 3B6AA 2E2HJ 3GTGJ 3CESA 1R6RA 1CF7B 1SD5A 5GTHC 3LAJA 2OBPA 4CUGA 2XAHA 2XRLA 1HA8A 4GYGA 3SFZA 3J7AO 1A5JA 2BY3A 2HKOA 4AYBN 1H88C 1JHHA 1RZ4A 2XHKA 3WTVC 3JRDA 4BBSJ 2A6TA 2KDZA 4IXAA 3CO7C 3PJRA 3IHUA 3HOWJ 1UAAA 4BS9A 4DYRA 4P55A 2IGKA 2O9LA 1WJAA 4I2OA 2G9WA 2K3FA 1ZG1A 4S0HB 3K10A 1DU0A 1HDDC 1NH3A 2DYRH 3LSJA 2X9DA 3S32A 5J4YA 3FMSA 1ITYA 2IW5A 2X6XA 3C18A 1N77A 4MNUA 2W1OA 1T33A 2EV6A 2B63J 3RIRA 2NOGA 2GQQA 2ZB9A 3Q3SA 3K70C 1T0FC 1F5TA 3VSKA 2DQRA 4GDFA 1S7AA 3TO9A 1R4NB 3MD2A 3QYBA 3CCRI 1OCCH 4A3LJ 2BEOA 4PFOA 3G4SI 2VC0A 2Y9YA 3ASNH 4N9HA 2OF7A 5J8CA 5E3MA 4AD9A 2CG4A 2O3FA 1E3OC 3BR0A 2GXGA 2XF6A 3DPUA 1J09A 3AG3H 3FIWA 2P7CB 3DTEA 2XRNA 2CUFA 3PIOF 5LGUA 1YHQI 1Z91A 3J7AY 3CDIA 4MEYF 4CCOA 1O4XA 3CUOA 5LHHA 3I55I 3HSEA 1ACIA 3LSMA 1KU3A 2W84A 2MSYA 2CU7A 1STZA 4TV7A 4A3GJ 1BIBA 1FSEA 2RN7A 1K6YA 4ZYAA 1R5HA 2LC2A 1U5TA 2DFIA 2HQAA 2Y0SN 5D4RA 5TRDA 3BPXA 2TCTA 3E5QA 4ZYHA 3DEEA 5IOYA 2JSPA 2X1CA 3OYNA 4Z2YA 3GFLA 1E3PA 1MBKA 2HGCA 4QPQA 1X4PA 2VQHA 4YFKF 3Q0WA 4B3AA 3HIFA 4XRFA 5IYCJ 1JT0A 3CDLA 1CF7A 1KYZA 1LDKB 3RSNA 4XICA 3QU3A 2CUZA 3K69A 5J1UA 2WB1N 4XORA 3DKXA 3I5UA 2LVSA 3MFKA 1BL0A 4MFEA 2JA5J 1SFKA 1R00A 1ZKGA 2CW8A 5K7ZA 5HNFA 1SMTA 4EJOA 2R5ZA 4G6TB 1TTYA 3EPZA 3L1PA 4XLAA 2A5YB 2A05A 3MZYA 3KP7A 3W2WA 5IT3A 3KCCA 3S3MA 2JVGA 3ZQHA 1ENHA 5CQGA 2L02A 4HQEA 1IUYA 3KP6A 2R7WA 4IL6C 3HSFA 5FFXA 2BHYA 4RM2A 3BR1A 5DD4A 2FQ4A 1EH7A 4A6DA 2Z9OA 1FP2A 2QSHX 4M9XA 3I59B 2HR3A 4MQVA 4M72A 3EQLF 1YE9A 2FQ3A 1JHFA 1REPC 1VQ4I 2I5UA 2XPUA 5HDNA 4UXNA 4U7BA 1O3SA 5EJCA 4MIMA 3FK6A 3I58A 4CZCA 3DWLE 1KU9A 4FETA 5DV5A 1AKHA 3KP5A 2ECBA 2R7SA 2WA0A 2L3DA 4M73A 2GBYA 3BCBA 1ZRFA 3I71A 3FX3A 3PQKA 3I64A 2VLAA 5DS9A 3DF8A 5L3EA 2ZBKA 4BDYA 2DODA 3P5JA 2HEOA 2K02A 1OPCA 3PM1A 2Q0OA 1ERDA 1R4MB 3CMMA 3OWTA 1LVAA 2FNAA 4Z6YA 1Z6RA 3Q9VA 2VQGA 3H5RA 3S3NA 2GIVA 3HGGA 4UHTA 3PO2J 3TP3A 1YW9A 4B4CA 1WRJA 3QAHA 5F08A 3V8LA 2F2EA 3LMMA 3PUFA 3QP6A 3WU0A 2NVQJ 1B9NA 1IC8A 1RR8C 2O0YA 1Y39A 5HODA 1DP7P 2LBFB 3OYMA 4H0EA 1IG7A 1F43A 3LQQA 1OYYA 1IN7A 4LLNA 2ZXIA 1IV6A 3F6OA 2DPDA 2FSWA 3A0HC 2VXDA 2HYGD 5JVTA 2RC4A 4A0XA 3ERMA 2HPMA 1XSXA 5D4SA 4RBOA 3I0TA 2FJ1A 3JR9A 5BPDA 2HVRA 2L9SA 2FD5A 4KICA 4S05A 4PJMA 2MD0A 2R3SA 1KQ0A 3S15J 4M6YA 1RUOA 3MCZA 4UVBA 3E3VA 4D0PA 3FXKA 5ILVA 5HDGA 1BI2A 2D45A 3B6CA 2LKXA 2NNNA 1D0XA 1TC3C 2K9NA 3AAFA 4KYWA 5FD5A 3BCAA 1FNNA 4IQ4A 4EEFG 2H94A 4ZYGA 1G3TA 2OZ6A 1LB2A 1JKQC 2L5QA 4OAZA 3GCMA 5GPCA 5FKNA 4PJNA 3FXOA 4AIJA 1R5ID 2IS4A 3S1QJ 2L7MP 1ZRDA 3K4JA 1SMYF 2VPLA 2O61A 3WHBA 3D0SA 1Z3XA 4RGSA 4BEHB 3K70D 5HS7A 1FMVA 4Y13A 3MKYB 1FT9A 3CCYA 4F92B 4GYIA 3OYLA 1N25A 4JQFA 2IA1A 2KZVA 2JRMA 2F5DA 2Y2ZA 1HW5A 1I27A 5H20A 4ZYDA 4I01A
chains in the Genus database with same CATH topology
2TDXA 5KVRA 2CGPA 1LDJA 2MA3A 3LSTA 2IJLA 1PP7U 2BBYA 1K6OA 1BI0A 2K4JA 2RNJA 5K5OA 2Q8KA 3WTYC 4CGZA 2PMUA 2P5KA 4I09A 1FOKA 1PP8F 2P5VA 4EJWA 1HXDA 1KQ8A 4OIRF 2OAZA 1XCBA 4Y17A 1BIAA 2E7XA 2M87A 3JTHA 4GCVA 4CYDA 1J7KA 4O6JA 4JK1X 3MWMA 3VB2A 1XB4A 2E1NA 2KJBA 4LK1F 3K9TA 2V1DA 2MBFA 2UXNA 4IJAA 1KQ9A 3ECOA 3FXQA 4WXDA 3R0JA 3ZMDA 3BY6A 2BV6A 5D8KB 1OKRA 4OU0A 4LFUA 5E1WA 3WTZA 1W7PA 3RJPA 1R1TA 1UB9A 1I6XA 2VODA 4KNYA 3BDDA 4I0AA 3CLOA 4CICA 5HLGA 2X0LA 4ENKA 4KIBA 2HDCA 1K7AA 4G6DA 3LA7A 4M6XA 1U2WA 3KETA 2KRFA 3SXYA 5BOXA 5DEQA 1O57A 1RUNA 4I98B 4YIFA 1LQ1A 3KP3A 2OA4A 1HKSA 1W7PD 2QM3A 4U0WA 3WTSC 3CUQB 5CVJA 1D8JA 5LBQA 1Z05A 2OQRA 3ML6A 1KA8A 1PUEE 3FXRA 1ULYA 4FT8A 2QYOA 4BQAA 4RS8A 4M71A 1XGSA 3EETA 1DPRA 2PN6A 2JPBA 1T0FA 2XV4S 3LQRA 3RKYA 3H3ZA 4IRIA 4LJZF 2DQLA 3TO7A 4OOIA 2IVMA 4N9IA 2A6HF 2H6CA 4ZH4F 5BQTA 2PMHA 3K1MA 2CSOA 1TNSA 4OIOF 4L9JA 4F7ZA 2ZXJA 4N0BA 1I1GA 2MH9A 4R79A 3IKTA 3FMRA 1W5TA 3WGHA 3WODF 3Q9SA 1ZRCA 2EA2A 3RPUA 5E1ZB 2FMLA 1O3TA 3DP7A 1MJAA 4YFNF 1H9TA 3F23A 2E7WA 1SFXA 2QENA 4FX0A 2LF8A 1FYLA 3JAMK 3DXJF 4WK8F 2PLYA 2VONA 3U1DA 3DPTA 5ERIA 3JSPA 3BJAA 4HF2A 2GWRA 1B59A 3ZMSA 1R58A 4MQ9F 3GWZA 3WTWC 4BNCA 2HKXA 2COMA 2YPRA 1QPMA 3KE2A 3REOA 3L2CA 2VC1A 4CO8A 4UUVA 3GFJA 4G8XA 5K5QA 4KMFA 4EM0B 3PFIA 4A2UA 4HV6A 1LEAA 4ENNA 5HS9A 3K0LA 4AVPA 3RKWA 2FU4A 4I02A 1IN4A 2XAJA 3SQNA 3BJOA 2QUFA 2K27A 1O7FA 3R0AA 1XGMA 2MD5A 1F4KA 3LWFA 3ZN1A 2STWA 4A5NA 2IA2A 4A6EA 3T8RA 1U8RA 1IZ1A 1PDNC 5CVRA 4EM2A 3EYYA 1WKMA 2VBXA 1HQCA 5LLQA 2H6BA 5TJJA 3BPVA 4HF1A 1R5GA 4IHTA 1Q1HA 1BC8C 2DK8A 3M7GA 4U0YA 3IC7A 5BPIA 2ESNA 3GX4X 5E8IA 3GVAA 2HTJA 4KDPA 2HWVA 4AIHA 4HAMA 4G7OF 2QQAA 1OR7A 2P6TA 4EJUA 2M1BA 2ADUA 1G3SA 1GHCA 1J0RA 2EJRA 2HQRA 4KFCA 2EFPA 5DCMA 2V9VA 1DDNA 4WF2A 1FY7A 3J80Z 3L09A 2K86A 1S6LA 2KJCA 2VBWA 1XGNA 1FZPB 1TQMA 3ABTA 4EGZA 1BN5A 3ROUA 3KEOA 3HTSB 4B8XA 2ACJA 2YSRA 3H92A 3OOPA 4MTDA 1U3EM 3IL2A 3CDHA 1XDUA 4FX4A 3U2RA 5L3FA 1I5ZA 4IF4A 3LA2A 1MKMA 3R61A 1JGSA 1HW2A 2WTEA 4YFXF 3KLOA 3GFIA 3K2ZA 2IRFG 5LGTA 2DTRA 4OMZA 1ON2A 3FXUA 1RIOH 3ZQ7A 3ZMZA 3I4PA 2PI0A 1IRGA 4RAZA 4BXUA 1IXSB 1BJAA 4LG0A 2P8TA 4DQ2A 4ZYEA 1H9GA 5FLXZ 3JW4A 2Y48A 5ICFA 5EEHA 2MH2A 2XASA 4K2EA 1UHMA 3VFZA 4LD5A 1XDSA 1BC7C 3MZHA 5DCFA 3SZTA 3ZN0A 5K1YA 2X4HA 1FX7A 3SHFA 2ZFWA 2QWWA 4P5OA 4HYEA 2DLLA 3VEPA 3BP8A 1KGSA 3F3XA 2XVCA 4IRGA 2D2WA 2EFNA 1P4AA 3KEQA 4R1HA 5CYVA 3KP2A 1R36A 3N97A 2CWEA 3ZMVA 2Y0MA 4KUMA 4OINF 1D8KA 3E6BA 2FMYA 5CLSA 1P4XA 3R6SA 1USSA 3DPLC 1U5TC 4KN4X 4P9FA 2F5EA 3ZMUA 2VT3A 3GFMA 4BYYA 5ICCA 4S04A 1SD7A 3V4GA 1RNLA 5ICGA 1J2XA 4A5MA 4WWCA 1V3FA 2BYVE 2RQPA 5H6RA 3RTRA 4Q48A 4BAYA 4UV8A 1G3WA 4AIKA 4L0YB 1J75A 1BOAA 1VTNC 2L01A 2DO7A 2M30A 3L00A 1QNTA 2CW0F 1HKTA 3CTAA 4HX7A 3QPHA 3T8TA 1HSJA 1Z1DA 4NB5A 1IN8A 3ULQB 1B4AA 3TGNA 1YIOA 3KZZA 3TKYA 2VE9A 5K5RA 1HBXG 1FBSA 1OYWA 3V7RA 4U0VA 1Z7UA 2P6SA 4NHJA 3IKVA 1YFHA 5LRRA 3V7CA 3GF2A 2H09A 2IA0A 5DUKA 5JI6A 1FBQA 5J8FA 2EFOA 2J5PA 3L9FA 3QOPA 3OV8A 4PCQA 4HX4A 1X3UA 5AIQA 5D6FA 3H3UA 2FOKA 2RDPA 5L3CA 3E6DA 3LA3A 3F8MA 2EA4A 3FHZA 3QRFF 4HDVA 4UVAA 1T98A 2GAUA 2FA5A 4GGGA 2ZKZA 5D5WB 1BI1A 1K79A 2ZMEB 3WGGA 4OIQF 1P4WA 2KIFA 5DCMB 4GO1A 1T38A 5DD8A 1YW8A 5LRSA 4P9UA 4LB5A 5IT9K 4HBLA 3RYRA 5DYMA 1JXSA 1T6SA 1WQ2A 2IPQX 2ZMEA 5ICEA 2A61A 4L5IA 3HOTA 1S3JA 5HS8A 4ZZDA 2V1UA 3T0YA 2UWMA 3I53A 2XKOA 2XGXA 2HFHA 3KZYA 2D1VA 3BROA 2FF4A 3HUGA 4EQQA 2M45A 1W4MA 4EJVA 2EFWA 3HHHA 1D3YA 2B0LA 2OD5A 3FF5A 3VODA 2JZYA 4A0YA 1ZARA 3MQ0A 2JPCA 4ENJA 1YO5C 1T39A 4HLXA 1K78B 4YIIA 2JT1A 3CUQA 1D5VA 2W85A 1ZG3A 2Q2EA 5CVVA 4CZZA 4HF0A 3RKXA 3NRVA 4M9SA 2RKHA 2GA1A 1G6NA 1XN7A 2EV5A 2K7LA 4E70A 5A2QK 5AIPA 3BZ6A 1XGOA 4QLCU 1V4RA 5DUIA 3DQVC 1Y0UA 4A0ZA 3JAMZ 2NNYA 2MLGA 2XAFA 3TOAA 3GLXA 3G3ZA 2QBYA 5HLHA 5HVQC 5DDGA 5AONA 2CFXA 1NHAA 5HDKA 4BHBA 2L4MA 4HDUA 2BE5F 3IWFA 4G7ZF 2LF7A 3ECHA 5KK1A 3C1DA 4LB6B 1MJ9A 2GZWA 3P7NA 2ETHA 1KU2A 4EVIA 3O2PE 4RB1A 3KFWX 1GXQA 1ZREA 1ZLJA 4HOBA 3LAPA 4ESBA 5IT9Z 2M5WA 2OQGA 2PQ8A 4KIGA 1IF1A 4KMUX 2P4WA 1YW7A 4UNOA 4WXCA 1TQPA 3HYIA 4R8HA 5FD6A 1ZH5A 3FZVA 3DKWA 3ZPLA 1IXRC 2D1HA 2DPUA 4ASNA 2XIGA 1XSVA 1LNWA 4L9NA 2FBKA 2EV0A 2HQNA 4CHUA 1QBJA 1ON1A 1SFUA 3WE3A 4YG2F 4U88A 1AOYA 1IN6A 1IRFA 3TO6A 1QO0D 3F22A 1U6GA 1YYVA 3ZP5A 4EV0A 4RB0A 3C3WA 2IP2A 3DV8A 5ED4A 3E5UA 1R1VA 2M8EA 2R7FA 1ZGJA 2HYFA 5LEJA 2EK5A 2DI3A 4I7HA 2VE8A 1B9MA 4RB3C 2RVCA 4BHPA 2XAGA 2A3SA 2AXLA 2YX7A 3HRSA 4FHTA 2KIUA 2ZJ2A 1HSTA 1IW7F 1MD0A 2RV8A 4DNCA 3V7SA 3R60A 2V1XA 3V8JA 2W25A 3GYHX 4KA4A 2O6GE 3WTUC 1YS7A 2NRAC 1W5SA 1OYIA 5A2QZ 2KKOA 2K4BA 1O3QA 3BOQA 3CUQC 3CO6C 1F9NA 3E6CC 4PGHA 3HTUA 4RGXA 2V6CA 3RI4A 5D5UB 1BI3A 2FEZA 2V79A 4QWQA 1EH6A 4HLYA 4P96A 2OU2A 2LDUA 2HTSA 1WSUA 3WU1B 4U7DA 3F8CA 5BMZA 2VT2A 1EH8A 1KYWA 1ONVA 3ABUA 4Q47A 4ESFA 3J80K 5E1XA 4L0ZB 3BWGA 2LKPA 2DU9A 2BGCA 1Z9CA 2KIMA 1SD4A 4UVCA 3W6JB 4MHGA 3CJNA 1HKQA 2JSCA 3I59A 3M9AA 1FPQA 2EFQA 1G3YA 1IN5A 2FBIA 1LEBA 3NEUA 4ESJA 2STTA 3E6MA 3ERED 4PZJA 1UFMA 1I1SA 5HLIA 3F72A 2NYXA 1S29A 3ELKA 2PBIA 1KU7A 3I54A 3G73A 4MEXF 2A6EF 3T5XA 1J59A 3GZ6A 2DBBA 4NQWA 1XSDA 4WCGA 1O7LA 5D8LB 3IRRA 1MGTA 4I0BA 3L7WA 4O3MA 1T2KA 5LGNA 1TQIA 3QPTA 4Q5SF 2ZNZA 4LGWA 2MLKA 1XMAA 3TQNA 2DK5A 5J6XA 4LG0B 1ZLKA 4L18B 1G4DA 6PAXA 2YX4A 4ON0A 1AWCA 3GUDA 3F8NA 3EUHA 2JRTA 4Q4ZF 4RAYA 3HSRA 3NQOA 3HRMA 2GA2A 4B09A 4BH9A 2CYYA 3WGIA 3TOBA 2DT5A 1ZAOA 4ZZLA 4ETSA 4UV9A 2L4AA 2ISZA 1R7JA 2EWNA 2A07F 3DFGA 1U5TB 3FM5A 2R7DA 1FWZA 3P9IA 1LDDA 1SFEA 4KIFA 5D6EA 2GXBA 2L54A 3F8FA 3HOSA 2IT0A 5F6FA 2WV0A 1U78A 1B1BA 1FSHA 3WG9A 2A69F 2WWYA 2Z33A 3VOEA 2ZNYA 4CDGA 5EEGA 3BJ6A 1OMIA 1TW3A 3N4MA 1FC3A 3GEZA 1P92A 2JTVA 3M8FA 5FGMA 4RGRA 4JBAA 5FFZA 1E2XA 2FBHA 2VBYA 1YLFA 1GVJA 3V8KA 1A04A 3GXOA 1USTA 2O8XA 3PQJA 2HOEA 4LLLA 3O6BB 5D5VB 2XAQA 3TDUC 3EYIA 5CVIA 2ELHA 2F5FA 1XD7A 2Z3YA 5CJ9A 3JSOA 4XSZF 5L3GA 4IHSA 2G7HA 2Z99A 1ZN2A 2HS5A 4ENMA 3ISPA 4GXOA 4EM1A 3MAJA 2ZCWA 2QZ8A 4IVNA 2P7VB 1K78A 4HX8A 1IAWA 5D5XB 3IRQA 1ZHFA 3R4KA 2LSOA 3GW2A 3RDIA 5CVUA 2E1CA 3T1BA 3F21A 2CQKA 2QLZA 4LLGF 5E20A 1XMKA 3O3KA 4XLPF 3K1NA 4WX9A 3WTXC 3P9CA 2PG4A 5ILSA 1UCRA 2VN2A 1YG2A 3TDZC 1SD6A 2UXXA 2FE3A 2F5CA 2NS0A 2RGVA 1TNTA 4RGUA 4EMSA 2G7UA 5HOOA 4G9YA 4PGGA 4HW0A 2PEXA 2J5OA 3EDPA 4KN7X 2A68F 5LEKA 1QZZA 2ISYA 5JR3A 3KLNA 3U9GA 1RI7A 3DEUA 3MEXA 3GZ5A 1DUXC 2W24A 2FXAA 1F1ZA 3D5LA 1FP1D 4CXFA 2XKPA 2Z5UA 2HZTA 1P6RA 1Z6TA 4L9TA 4KT5C 1J9IA 3IWZA 3HRUA 3WTTC 4G6QA 1ODDA 2VXZA 4M74A 1S8NA 4EJTA 5FLXK 2DAOA 5BS6A 3KP4A 5FB2A 1MDMB 1S7OA 3COAC 2FNPA 1LJ9A 5F1RA 2C6YA 1QGPA 2ESHA 3QU6A 3ZMTA 3RPQA 3M1EA 5E8GA 2W57A 2H27A 2ZO4A 1TBXA 3LFKA 1FBUA 1YTYA 2FRHA 3J81K 3FWEA 1HW1A 4IRHA 2YR2A 4O5VA 2O03A 4HZFA 2QVOA 1QQIA 3B73A 3GO5A 2EB7A 5L3DA 1WWXA 4HQMA 2VOOA 4IPAA 4LK0F 4Y15A 2PJPA 4EGYA 1SAXA 3B02A 2XUBA 3FMQA 1BM9A 3FM3A 3RYPA 4L5JA 4LMYA 2QQ9A 4HA8A 3WE2A 5FO5A 1J5YA 1P2FA 2VOPA 2QQBA 1WI9A 1O3RA 4A12A 2WC2A 5L3BA 4AWXB 3HRTA 1W7PB 3S2WA 1YQAA 5LHGA 2OZUA 1ZGAA 5E18F 5H6QA 2UZKA 4WXHA 1L3LA 4XLNF 4XBFA 4MTEA 1C0WA 5F64A 1R22A 1ZG5A 2QBYB 1ZYRF 1TLHB 1GXPA 2CO5A 3K1PA 4PDKA 1H0MA 3SZPA 4HV5A 1UHWA 2PFBA 1IXCA 1E17A 3Q5FA 3M8EA 1TW2A 1EV7A 2LNBA 3E97A 2VBZA 1MJBA 4RB2C 2MC3A 3P9KA 1L0OC 1YS6A 1MZBA 1CGPA 5E17F 3F8BA 4M9ZA 1B6AA 4OIPF 4L9VA 4MGRA 1R1UA 2AS5F 4G94A 3JTGA 4XSXF 4G7HF 2YU3A 1JE8A 3W6KB 1DPUA 5JFRA 2Y75A 4OMYA 2XROA 5JHUA 2DW4A 1FYKA 3QP5A 1FYMA 1BBYA 5LHIA 1QZYA 3HHGA 3J81Z 3C7JA 4BHCA 2NAZA 5ILUA 1R23A 1XCVA 1MDMA 1FLIA 3E5XA 2P5LC 3F6VA 1CF7B 1SD5A 3LAJA 2OBPA 2XAHA 4GYGA 3SFZA 3J7AO 2HKOA 1JHHA 1RZ4A 2XHKA 3WTVC 4IXAA 3CO7C 3IHUA 4P55A 4I2OA 2G9WA 1ZG1A 3FMSA 2IW5A 3C18A 4MNUA 2EV6A 3RIRA 2GQQA 1F5TA 2DQRA 1S7AA 3TO9A 2BEOA 2VC0A 4N9HA 5J8CA 4AD9A 2CG4A 2O3FA 2GXGA 2P7CB 2XRNA 5LGUA 1Z91A 4MEYF 3CUOA 5LHHA 3HSEA 1KU3A 2W84A 1STZA 4TV7A 1BIBA 1FSEA 2RN7A 1R5HA 1U5TA 2DFIA 5D4RA 5TRDA 3BPXA 3E5QA 4ZYHA 4Z2YA 3GFLA 2HGCA 4YFKF 3HIFA 4XRFA 1CF7A 1KYZA 1LDKB 3QU3A 3K69A 3MFKA 3I5UA 1R00A 1SMTA 4EJOA 1TTYA 2A5YB 3MZYA 3KP7A 5IT3A 3KCCA 2L02A 4HQEA 1IUYA 3KP6A 3HSFA 5FFXA 5DD4A 1EH7A 4A6DA 2Z9OA 1FP2A 4M9XA 3I59B 2HR3A 4MQVA 4M72A 3EQLF 2FQ3A 1JHFA 1REPC 5HDNA 4UXNA 4U7BA 1O3SA 3I58A 1KU9A 5DV5A 3KP5A 2L3DA 4M73A 1ZRFA 3I71A 3FX3A 3PQKA 3I64A 3DF8A 5L3EA 2ZBKA 2HEOA 2K02A 1OPCA 2Q0OA 1LVAA 2FNAA 1Z6RA 3Q9VA 2GIVA 4UHTA 1YW9A 1WRJA 3QAHA 3V8LA 2F2EA 3QP6A 3WU0A 1B9NA 2O0YA 1DP7P 4H0EA 3LQQA 1OYYA 1IN7A 4LLNA 3F6OA 2DPDA 2FSWA 2HYGD 5JVTA 2RC4A 4A0XA 1XSXA 5D4SA 3I0TA 5BPDA 4KICA 4S05A 2R3SA 1KQ0A 4M6YA 1RUOA 3MCZA 4UVBA 3E3VA 4D0PA 5ILVA 5HDGA 1BI2A 2D45A 2NNNA 3AAFA 4KYWA 5FD5A 1FNNA 2H94A 4ZYGA 1G3TA 2OZ6A 1LB2A 4AIJA 1ZRDA 1SMYF 2O61A 3D0SA 4RGSA 5HS7A 4Y13A 1FT9A 4GYIA 4JQFA 2IA1A 2F5DA 5H20A 1HW5A 1I27A 4ZYDA 4I01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TDX A;  5KVR A;  2CGP A;  1LDJ A;  2MA3 A;  3LST A;  2IJL A;  1PP7 U;  2BBY A;  1K6O A;  1BI0 A;  2K4J A;  2RNJ A;  5K5O A;  2Q8K A;  3WTY C;  4CGZ A;  2PMU A;  2P5K A;  4I09 A;  1FOK A;  1PP8 F;  2P5V A;  4EJW A;  1HXD A;  1KQ8 A;  4OIR F;  2OAZ A;  1XCB A;  4Y17 A;  1BIA A;  2E7X A;  2M87 A;  3JTH A;  4GCV A;  4CYD A;  1J7K A;  4O6J A;  4JK1 X;  3MWM A;  3VB2 A;  1XB4 A;  2E1N A;  2KJB A;  4LK1 F;  3K9T A;  2V1D A;  2MBF A;  2UXN A;  4IJA A;  1KQ9 A;  3ECO A;  3FXQ A;  4WXD A;  3R0J A;  3ZMD A;  3BY6 A;  2BV6 A;  5D8K B;  1OKR A;  4OU0 A;  4LFU A;  5E1W A;  3WTZ A;  1W7P A;  3RJP A;  1R1T A;  1UB9 A;  1I6X A;  2VOD A;  4KNY A;  3BDD A;  4I0A A;  3CLO A;  4CIC A;  5HLG A;  2X0L A;  4ENK A;  4KIB A;  2HDC A;  1K7A A;  4G6D A;  3LA7 A;  4M6X A;  1U2W A;  3KET A;  2KRF A;  3SXY A;  5BOX A;  5DEQ A;  1O57 A;  1RUN A;  4I98 B;  4YIF A;  1LQ1 A;  3KP3 A;  2OA4 A;  1HKS A;  1W7P D;  2QM3 A;  4U0W A;  3WTS C;  3CUQ B;  5CVJ A;  1D8J A;  5LBQ A;  1Z05 A;  2OQR A;  3ML6 A;  1KA8 A;  1PUE E;  3FXR A;  1ULY A;  4FT8 A;  2QYO A;  4BQA A;  4RS8 A;  4M71 A;  1XGS A;  3EET A;  1DPR A;  2PN6 A;  2JPB A;  1T0F A;  2XV4 S;  3LQR A;  3RKY A;  3H3Z A;  4IRI A;  4LJZ F;  2DQL A;  3TO7 A;  4OOI A;  2IVM A;  4N9I A;  2A6H F;  2H6C A;  4ZH4 F;  5BQT A;  2PMH A;  3K1M A;  2CSO A;  1TNS A;  4OIO F;  4L9J A;  4F7Z A;  2ZXJ A;  4N0B A;  1I1G A;  2MH9 A;  4R79 A;  3IKT A;  3FMR A;  1W5T A;  3WGH A;  3WOD F;  3Q9S A;  1ZRC A;  2EA2 A;  3RPU A;  5E1Z B;  2FML A;  1O3T A;  3DP7 A;  1MJA A;  4YFN F;  1H9T A;  3F23 A;  2E7W A;  1SFX A;  2QEN A;  4FX0 A;  2LF8 A;  1FYL A;  3JAM K;  3DXJ F;  4WK8 F;  2PLY A;  2VON A;  3U1D A;  3DPT A;  5ERI A;  3JSP A;  3BJA A;  4HF2 A;  2GWR A;  1B59 A;  3ZMS A;  1R58 A;  4MQ9 F;  3GWZ A;  3WTW C;  4BNC A;  2HKX A;  2COM A;  2YPR A;  1QPM A;  3KE2 A;  3REO A;  3L2C A;  2VC1 A;  4CO8 A;  4UUV A;  3GFJ A;  4G8X A;  5K5Q A;  4KMF A;  4EM0 B;  3PFI A;  4A2U A;  4HV6 A;  1LEA A;  4ENN A;  5HS9 A;  3K0L A;  4AVP A;  3RKW A;  2FU4 A;  4I02 A;  1IN4 A;  2XAJ A;  3SQN A;  3BJO A;  2QUF A;  2K27 A;  1O7F A;  3R0A A;  1XGM A;  2MD5 A;  1F4K A;  3LWF A;  3ZN1 A;  2STW A;  4A5N A;  2IA2 A;  4A6E A;  3T8R A;  1U8R A;  1IZ1 A;  1PDN C;  5CVR A;  4EM2 A;  3EYY A;  1WKM A;  2VBX A;  1HQC A;  5LLQ A;  2H6B A;  5TJJ A;  3BPV A;  4HF1 A;  1R5G A;  4IHT A;  1Q1H A;  1BC8 C;  2DK8 A;  3M7G A;  4U0Y A;  3IC7 A;  5BPI A;  2ESN A;  3GX4 X;  5E8I A;  3GVA A;  2HTJ A;  4KDP A;  2HWV A;  4AIH A;  4HAM A;  4G7O F;  2QQA A;  1OR7 A;  2P6T A;  4EJU A;  2M1B A;  2ADU A;  1G3S A;  1GHC A;  1J0R A;  2EJR A;  2HQR A;  4KFC A;  2EFP A;  5DCM A;  2V9V A;  1DDN A;  4WF2 A;  1FY7 A;  3J80 Z;  3L09 A;  2K86 A;  1S6L A;  2KJC A;  2VBW A;  1XGN A;  1FZP B;  1TQM A;  3ABT A;  4EGZ A;  1BN5 A;  3ROU A;  3KEO A;  3HTS B;  4B8X A;  2ACJ A;  2YSR A;  3H92 A;  3OOP A;  4MTD A;  1U3E M;  3IL2 A;  3CDH A;  1XDU A;  4FX4 A;  3U2R A;  5L3F A;  1I5Z A;  4IF4 A;  3LA2 A;  1MKM A;  3R61 A;  1JGS A;  1HW2 A;  2WTE A;  4YFX F;  3KLO A;  3GFI A;  3K2Z A;  2IRF G;  5LGT A;  2DTR A;  4OMZ A;  1ON2 A;  3FXU A;  1RIO H;  3ZQ7 A;  3ZMZ A;  3I4P A;  2PI0 A;  1IRG A;  4RAZ A;  4BXU A;  1IXS B;  1BJA A;  4LG0 A;  2P8T A;  4DQ2 A;  4ZYE A;  1H9G A;  5FLX Z;  3JW4 A;  2Y48 A;  5ICF A;  5EEH A;  2MH2 A;  2XAS A;  4K2E A;  1UHM A;  3VFZ A;  4LD5 A;  1XDS A;  1BC7 C;  3MZH A;  5DCF A;  3SZT A;  3ZN0 A;  5K1Y A;  2X4H A;  1FX7 A;  3SHF A;  2ZFW A;  2QWW A;  4P5O A;  4HYE A;  2DLL A;  3VEP A;  3BP8 A;  1KGS A;  3F3X A;  2XVC A;  4IRG A;  2D2W A;  2EFN A;  1P4A A;  3KEQ A;  4R1H A;  5CYV A;  3KP2 A;  1R36 A;  3N97 A;  2CWE A;  3ZMV A;  2Y0M A;  4KUM A;  4OIN F;  1D8K A;  3E6B A;  2FMY A;  5CLS A;  1P4X A;  3R6S A;  1USS A;  3DPL C;  1U5T C;  4KN4 X;  4P9F A;  2F5E A;  3ZMU A;  2VT3 A;  3GFM A;  4BYY A;  5ICC A;  4S04 A;  1SD7 A;  3V4G A;  1RNL A;  5ICG A;  1J2X A;  4A5M A;  4WWC A;  1V3F A;  2BYV E;  2RQP A;  5H6R A;  3RTR A;  4Q48 A;  4BAY A;  4UV8 A;  1G3W A;  4AIK A;  4L0Y B;  1J75 A;  1BOA A;  1VTN C;  2L01 A;  2DO7 A;  2M30 A;  3L00 A;  1QNT A;  2CW0 F;  1HKT A;  3CTA A;  4HX7 A;  3QPH A;  3T8T A;  1HSJ A;  1Z1D A;  4NB5 A;  1IN8 A;  3ULQ B;  1B4A A;  3TGN A;  1YIO A;  3KZZ A;  3TKY A;  2VE9 A;  5K5R A;  1HBX G;  1FBS A;  1OYW A;  3V7R A;  4U0V A;  1Z7U A;  2P6S A;  4NHJ A;  3IKV A;  1YFH A;  5LRR A;  3V7C A;  3GF2 A;  2H09 A;  2IA0 A;  5DUK A;  5JI6 A;  1FBQ A;  5J8F A;  2EFO A;  2J5P A;  3L9F A;  3QOP A;  3OV8 A;  4PCQ A;  4HX4 A;  1X3U A;  5AIQ A;  5D6F A;  3H3U A;  2FOK A;  2RDP A;  5L3C A;  3E6D A;  3LA3 A;  3F8M A;  2EA4 A;  3FHZ A;  3QRF F;  4HDV A;  4UVA A;  1T98 A;  2GAU A;  2FA5 A;  4GGG A;  2ZKZ A;  5D5W B;  1BI1 A;  1K79 A;  2ZME B;  3WGG A;  4OIQ F;  1P4W A;  2KIF A;  5DCM B;  4GO1 A;  1T38 A;  5DD8 A;  1YW8 A;  5LRS A;  4P9U A;  4LB5 A;  5IT9 K;  4HBL A;  3RYR A;  5DYM A;  1JXS A;  1T6S A;  1WQ2 A;  2IPQ X;  2ZME A;  5ICE A;  2A61 A;  4L5I A;  3HOT A;  1S3J A;  5HS8 A;  4ZZD A;  2V1U A;  3T0Y A;  2UWM A;  3I53 A;  2XKO A;  2XGX A;  2HFH A;  3KZY A;  2D1V A;  3BRO A;  2FF4 A;  3HUG A;  4EQQ A;  2M45 A;  1W4M A;  4EJV A;  2EFW A;  3HHH A;  1D3Y A;  2B0L A;  2OD5 A;  3FF5 A;  3VOD A;  2JZY A;  4A0Y A;  1ZAR A;  3MQ0 A;  2JPC A;  4ENJ A;  1YO5 C;  1T39 A;  4HLX A;  1K78 B;  4YII A;  2JT1 A;  3CUQ A;  1D5V A;  2W85 A;  1ZG3 A;  2Q2E A;  5CVV A;  4CZZ A;  4HF0 A;  3RKX A;  3NRV A;  4M9S A;  2RKH A;  2GA1 A;  1G6N A;  1XN7 A;  2EV5 A;  2K7L A;  4E70 A;  5A2Q K;  5AIP A;  3BZ6 A;  1XGO A;  4QLC U;  1V4R A;  5DUI A;  3DQV C;  1Y0U A;  4A0Z A;  3JAM Z;  2NNY A;  2MLG A;  2XAF A;  3TOA A;  3GLX A;  3G3Z A;  2QBY A;  5HLH A;  5HVQ C;  5DDG A;  5AON A;  2CFX A;  1NHA A;  5HDK A;  4BHB A;  2L4M A;  4HDU A;  2BE5 F;  3IWF A;  4G7Z F;  2LF7 A;  3ECH A;  5KK1 A;  3C1D A;  4LB6 B;  1MJ9 A;  2GZW A;  3P7N A;  2ETH A;  1KU2 A;  4EVI A;  3O2P E;  4RB1 A;  3KFW X;  1GXQ A;  1ZRE A;  1ZLJ A;  4HOB A;  3LAP A;  4ESB A;  5IT9 Z;  2M5W A;  2OQG A;  2PQ8 A;  4KIG A;  1IF1 A;  4KMU X;  2P4W A;  1YW7 A;  4UNO A;  4WXC A;  1TQP A;  3HYI A;  4R8H A;  5FD6 A;  1ZH5 A;  3FZV A;  3DKW A;  3ZPL A;  1IXR C;  2D1H A;  2DPU A;  4ASN A;  2XIG A;  1XSV A;  1LNW A;  4L9N A;  2FBK A;  2EV0 A;  2HQN A;  4CHU A;  1QBJ A;  1ON1 A;  1SFU A;  3WE3 A;  4YG2 F;  4U88 A;  1AOY A;  1IN6 A;  1IRF A;  3TO6 A;  1QO0 D;  3F22 A;  1U6G A;  1YYV A;  3ZP5 A;  4EV0 A;  4RB0 A;  3C3W A;  2IP2 A;  3DV8 A;  5ED4 A;  3E5U A;  1R1V A;  2M8E A;  2R7F A;  1ZGJ A;  2HYF A;  5LEJ A;  2EK5 A;  2DI3 A;  4I7H A;  2VE8 A;  1B9M A;  4RB3 C;  2RVC A;  4BHP A;  2XAG A;  2A3S A;  2AXL A;  2YX7 A;  3HRS A;  4FHT A;  2KIU A;  2ZJ2 A;  1HST A;  1IW7 F;  1MD0 A;  2RV8 A;  4DNC A;  3V7S A;  3R60 A;  2V1X A;  3V8J A;  2W25 A;  3GYH X;  4KA4 A;  2O6G E;  3WTU C;  1YS7 A;  2NRA C;  1W5S A;  1OYI A;  5A2Q Z;  2KKO A;  2K4B A;  1O3Q A;  3BOQ A;  3CUQ C;  3CO6 C;  1F9N A;  3E6C C;  4PGH A;  3HTU A;  4RGX A;  2V6C A;  3RI4 A;  5D5U B;  1BI3 A;  2FEZ A;  2V79 A;  4QWQ A;  1EH6 A;  4HLY A;  4P96 A;  2OU2 A;  2LDU A;  2HTS A;  1WSU A;  3WU1 B;  4U7D A;  3F8C A;  5BMZ A;  2VT2 A;  1EH8 A;  1KYW A;  1ONV A;  3ABU A;  4Q47 A;  4ESF A;  3J80 K;  5E1X A;  4L0Z B;  3BWG A;  2LKP A;  2DU9 A;  2BGC A;  1Z9C A;  2KIM A;  1SD4 A;  4UVC A;  3W6J B;  4MHG A;  3CJN A;  1HKQ A;  2JSC A;  3I59 A;  3M9A A;  1FPQ A;  2EFQ A;  1G3Y A;  1IN5 A;  2FBI A;  1LEB A;  3NEU A;  4ESJ A;  2STT A;  3E6M A;  3ERE D;  4PZJ A;  1UFM A;  1I1S A;  5HLI A;  3F72 A;  2NYX A;  1S29 A;  3ELK A;  2PBI A;  1KU7 A;  3I54 A;  3G73 A;  4MEX F;  2A6E F;  3T5X A;  1J59 A;  3GZ6 A;  2DBB A;  4NQW A;  1XSD A;  4WCG A;  1O7L A;  5D8L B;  3IRR A;  1MGT A;  4I0B A;  3L7W A;  4O3M A;  1T2K A;  5LGN A;  1TQI A;  3QPT A;  4Q5S F;  2ZNZ A;  4LGW A;  2MLK A;  1XMA A;  3TQN A;  2DK5 A;  5J6X A;  4LG0 B;  1ZLK A;  4L18 B;  1G4D A;  6PAX A;  2YX4 A;  4ON0 A;  1AWC A;  3GUD A;  3F8N A;  3EUH A;  2JRT A;  4Q4Z F;  4RAY A;  3HSR A;  3NQO A;  3HRM A;  2GA2 A;  4B09 A;  4BH9 A;  2CYY A;  3WGI A;  3TOB A;  2DT5 A;  1ZAO A;  4ZZL A;  4ETS A;  4UV9 A;  2L4A A;  2ISZ A;  1R7J A;  2EWN A;  2A07 F;  3DFG A;  1U5T B;  3FM5 A;  2R7D A;  1FWZ A;  3P9I A;  1LDD A;  1SFE A;  4KIF A;  5D6E A;  2GXB A;  2L54 A;  3F8F A;  3HOS A;  2IT0 A;  5F6F A;  2WV0 A;  1U78 A;  1B1B A;  1FSH A;  3WG9 A;  2A69 F;  2WWY A;  2Z33 A;  3VOE A;  2ZNY A;  4CDG A;  5EEG A;  3BJ6 A;  1OMI A;  1TW3 A;  3N4M A;  1FC3 A;  3GEZ A;  1P92 A;  2JTV A;  3M8F A;  5FGM A;  4RGR A;  4JBA A;  5FFZ A;  1E2X A;  2FBH A;  2VBY A;  1YLF A;  1GVJ A;  3V8K A;  1A04 A;  3GXO A;  1UST A;  2O8X A;  3PQJ A;  2HOE A;  4LLL A;  3O6B B;  5D5V B;  2XAQ A;  3TDU C;  3EYI A;  5CVI A;  2ELH A;  2F5F A;  1XD7 A;  2Z3Y A;  5CJ9 A;  3JSO A;  4XSZ F;  5L3G A;  4IHS A;  2G7H A;  2Z99 A;  1ZN2 A;  2HS5 A;  4ENM A;  3ISP A;  4GXO A;  4EM1 A;  3MAJ A;  2ZCW A;  2QZ8 A;  4IVN A;  2P7V B;  1K78 A;  4HX8 A;  1IAW A;  5D5X B;  3IRQ A;  1ZHF A;  3R4K A;  2LSO A;  3GW2 A;  3RDI A;  5CVU A;  2E1C A;  3T1B A;  3F21 A;  2CQK A;  2QLZ A;  4LLG F;  5E20 A;  1XMK A;  3O3K A;  4XLP F;  3K1N A;  4WX9 A;  3WTX C;  3P9C A;  2PG4 A;  5ILS A;  1UCR A;  2VN2 A;  1YG2 A;  3TDZ C;  1SD6 A;  2UXX A;  2FE3 A;  2F5C A;  2NS0 A;  2RGV A;  1TNT A;  4RGU A;  4EMS A;  2G7U A;  5HOO A;  4G9Y A;  4PGG A;  4HW0 A;  2PEX A;  2J5O A;  3EDP A;  4KN7 X;  2A68 F;  5LEK A;  1QZZ A;  2ISY A;  5JR3 A;  3KLN A;  3U9G A;  1RI7 A;  3DEU A;  3MEX A;  3GZ5 A;  1DUX C;  2W24 A;  2FXA A;  1F1Z A;  3D5L A;  1FP1 D;  4CXF A;  2XKP A;  2Z5U A;  2HZT A;  1P6R A;  1Z6T A;  4L9T A;  4KT5 C;  1J9I A;  3IWZ A;  3HRU A;  3WTT C;  4G6Q A;  1ODD A;  2VXZ A;  4M74 A;  1S8N A;  4EJT A;  5FLX K;  2DAO A;  5BS6 A;  3KP4 A;  5FB2 A;  1MDM B;  1S7O A;  3COA C;  2FNP A;  1LJ9 A;  5F1R A;  2C6Y A;  1QGP A;  2ESH A;  3QU6 A;  3ZMT A;  3RPQ A;  3M1E A;  5E8G A;  2W57 A;  2H27 A;  2ZO4 A;  1TBX A;  3LFK A;  1FBU A;  1YTY A;  2FRH A;  3J81 K;  3FWE A;  1HW1 A;  4IRH A;  2YR2 A;  4O5V A;  2O03 A;  4HZF A;  2QVO A;  1QQI A;  3B73 A;  3GO5 A;  2EB7 A;  5L3D A;  1WWX A;  4HQM A;  2VOO A;  4IPA A;  4LK0 F;  4Y15 A;  2PJP A;  4EGY A;  1SAX A;  3B02 A;  2XUB A;  3FMQ A;  1BM9 A;  3FM3 A;  3RYP A;  4L5J A;  4LMY A;  2QQ9 A;  4HA8 A;  3WE2 A;  5FO5 A;  1J5Y A;  1P2F A;  2VOP A;  2QQB A;  1WI9 A;  1O3R A;  4A12 A;  2WC2 A;  5L3B A;  4AWX B;  3HRT A;  1W7P B;  3S2W A;  1YQA A;  5LHG A;  2OZU A;  1ZGA A;  5E18 F;  5H6Q A;  2UZK A;  4WXH A;  1L3L A;  4XLN F;  4XBF A;  4MTE A;  1C0W A;  5F64 A;  1R22 A;  1ZG5 A;  2QBY B;  1ZYR F;  1TLH B;  1GXP A;  2CO5 A;  3K1P A;  4PDK A;  1H0M A;  3SZP A;  4HV5 A;  1UHW A;  2PFB A;  1IXC A;  1E17 A;  3Q5F A;  3M8E A;  1TW2 A;  1EV7 A;  2LNB A;  3E97 A;  2VBZ A;  1MJB A;  4RB2 C;  2MC3 A;  3P9K A;  1L0O C;  1YS6 A;  1MZB A;  1CGP A;  5E17 F;  3F8B A;  4M9Z A;  1B6A A;  4OIP F;  4L9V A;  4MGR A;  1R1U A;  2AS5 F;  4G94 A;  3JTG A;  4XSX F;  4G7H F;  2YU3 A;  1JE8 A;  3W6K B;  1DPU A;  5JFR A;  2Y75 A;  4OMY A;  2XRO A;  5JHU A;  2DW4 A;  1FYK A;  3QP5 A;  1FYM A;  1BBY A;  5LHI A;  1QZY A;  3HHG A;  3J81 Z;  3C7J A;  4BHC A;  2NAZ A;  5ILU A;  1R23 A;  1XCV A;  1MDM A;  1FLI A;  3E5X A;  2P5L C;  3F6V A;  1CF7 B;  1SD5 A;  3LAJ A;  2OBP A;  2XAH A;  4GYG A;  3SFZ A;  3J7A O;  2HKO A;  1JHH A;  1RZ4 A;  2XHK A;  3WTV C;  4IXA A;  3CO7 C;  3IHU A;  4P55 A;  4I2O A;  2G9W A;  1ZG1 A;  3FMS A;  2IW5 A;  3C18 A;  4MNU A;  2EV6 A;  3RIR A;  2GQQ A;  1F5T A;  2DQR A;  1S7A A;  3TO9 A;  2BEO A;  2VC0 A;  4N9H A;  5J8C A;  4AD9 A;  2CG4 A;  2O3F A;  2GXG A;  2P7C B;  2XRN A;  5LGU A;  1Z91 A;  4MEY F;  3CUO A;  5LHH A;  3HSE A;  1KU3 A;  2W84 A;  1STZ A;  4TV7 A;  1BIB A;  1FSE A;  2RN7 A;  1R5H A;  1U5T A;  2DFI A;  5D4R A;  5TRD A;  3BPX A;  3E5Q A;  4ZYH A;  4Z2Y A;  3GFL A;  2HGC A;  4YFK F;  3HIF A;  4XRF A;  1CF7 A;  1KYZ A;  1LDK B;  3QU3 A;  3K69 A;  3MFK A;  3I5U A;  1R00 A;  1SMT A;  4EJO A;  1TTY A;  2A5Y B;  3MZY A;  3KP7 A;  5IT3 A;  3KCC A;  2L02 A;  4HQE A;  1IUY A;  3KP6 A;  3HSF A;  5FFX A;  5DD4 A;  1EH7 A;  4A6D A;  2Z9O A;  1FP2 A;  4M9X A;  3I59 B;  2HR3 A;  4MQV A;  4M72 A;  3EQL F;  2FQ3 A;  1JHF A;  1REP C;  5HDN A;  4UXN A;  4U7B A;  1O3S A;  3I58 A;  1KU9 A;  5DV5 A;  3KP5 A;  2L3D A;  4M73 A;  1ZRF A;  3I71 A;  3FX3 A;  3PQK A;  3I64 A;  3DF8 A;  5L3E A;  2ZBK A;  2HEO A;  2K02 A;  1OPC A;  2Q0O A;  1LVA A;  2FNA A;  1Z6R A;  3Q9V A;  2GIV A;  4UHT A;  1YW9 A;  1WRJ A;  3QAH A;  3V8L A;  2F2E A;  3QP6 A;  3WU0 A;  1B9N A;  2O0Y A;  1DP7 P;  4H0E A;  3LQQ A;  1OYY A;  1IN7 A;  4LLN A;  3F6O A;  2DPD A;  2FSW A;  2HYG D;  5JVT A;  2RC4 A;  4A0X A;  1XSX A;  5D4S A;  3I0T A;  5BPD A;  4KIC A;  4S05 A;  2R3S A;  1KQ0 A;  4M6Y A;  1RUO A;  3MCZ A;  4UVB A;  3E3V A;  4D0P A;  5ILV A;  5HDG A;  1BI2 A;  2D45 A;  2NNN A;  3AAF A;  4KYW A;  5FD5 A;  1FNN A;  2H94 A;  4ZYG A;  1G3T A;  2OZ6 A;  1LB2 A;  4AIJ A;  1ZRD A;  1SMY F;  2O61 A;  3D0S A;  4RGS A;  5HS7 A;  4Y13 A;  1FT9 A;  4GYI A;  4JQF A;  2IA1 A;  2F5D A;  5H20 A;  1HW5 A;  1I27 A;  4ZYD A;  4I01 A; 
#chains in the Genus database with same CATH topology
 1A31 A;  2TDX A;  1WJC A;  5KVR A;  2CGP A;  4II2 A;  1LDJ A;  2MA3 A;  1W36 C;  3IAS 2;  2IJL A;  3LST A;  4C3H J;  1PP7 U;  2BBY A;  1K6O A;  1BI0 A;  2K4J A;  3BQY A;  2RNJ A;  5K5O A;  4AID A;  1MSE C;  3EUK L;  3TMO A;  1YRN B;  3E7L A;  2Q8K A;  3WTY C;  1WJE A;  2PMU A;  4CGZ A;  2P5K A;  4I09 A;  4BEH A;  3OYK A;  1FOK A;  1PP8 F;  1JKR C;  2P5V A;  2EIL H;  1HXD A;  2X48 A;  4EJW A;  1BW6 A;  1KQ8 A;  4OIR F;  2OAZ A;  1XCB A;  1UG2 A;  2GM4 A;  2CV0 A;  4Y17 A;  1BIA A;  4DBQ A;  1ETW A;  1LE8 B;  3ZQI A;  4OAY A;  2E7X A;  2M87 A;  3JTH A;  4GCV A;  3TP0 A;  4CYD A;  1J7K A;  4O6J A;  2ZJQ F;  2VAS A;  1NK2 P;  5EDN A;  4JK1 X;  3OYJ A;  3MWM A;  3VB2 A;  2LK2 A;  1XB4 A;  2E1N A;  2KJB A;  2EZK A;  2DOE A;  4LK1 F;  3K9T A;  3F9K A;  2V1D A;  5FKM A;  2MBF A;  2UXN A;  3OL3 A;  3PIP F;  1FOX A;  1JGG A;  4IJA A;  1KQ9 A;  3ECO A;  2VIX A;  3FXQ A;  4WXD A;  4IEJ A;  4RDU A;  3VYS B;  3R0J A;  3ZMD A;  2LG4 A;  4KIS A;  3BY6 A;  4E7S A;  3CCJ I;  2BV6 A;  5D8K B;  1OKR A;  3ABM H;  2ZME C;  4OU0 A;  2GXA A;  3H0G J;  1TT0 A;  4LFU A;  5E1W A;  3WTZ A;  2NS8 A;  3U21 A;  1W7P A;  3RJP A;  3W6V A;  1R1T A;  1ETY A;  1MH3 A;  2CS3 A;  1UB9 A;  1I6X A;  2VOD A;  4KNY A;  1P9Q C;  2AQE A;  2BW3 A;  3HG9 A;  2XSD C;  3W3C A;  1TWC J;  3BDD A;  2ZFU A;  4I0A A;  4XLE A;  1MMA A;  3CLO A;  3ABL H;  4CIC A;  5HLG A;  2X0L A;  1ETK A;  3DBL B;  4ENK A;  4KIB A;  2DCE A;  2HDC A;  3VWB A;  1K7A A;  4G6D A;  3LA7 A;  4M6X A;  1U2W A;  2AHQ A;  3KET A;  4CCL A;  4ZTJ A;  5FRN A;  4RAF A;  2KRF A;  2XSJ C;  2CQQ A;  3IP4 B;  5IYB J;  4IHV A;  3SXY A;  5BOX A;  5DEQ A;  2YU9 J;  1O57 A;  1RUN A;  2F4O B;  4I98 B;  2RAE A;  4YIF A;  1JUP A;  3D5R C;  2E34 A;  3KP3 A;  1LQ1 A;  1CQT A;  2XGD A;  2OA4 A;  1IO2 A;  3OYF A;  3HBL A;  1HKS A;  1YJN I;  1LFU P;  2KIQ A;  3ZQQ A;  1W7P D;  2QM3 A;  2V7F A;  3SJM A;  4U0W A;  4H4K C;  4XRM A;  3WTS C;  3CUQ B;  4JOM A;  1MMS A;  2K9Q A;  5CVJ A;  1WZ2 A;  4A3M J;  1D8J A;  4A3J J;  2VKH A;  1LFP A;  1MMG A;  2QQ8 A;  3OS0 A;  5LBQ A;  1Z05 A;  2OQR A;  3W2V A;  3ML6 A;  3ZXS A;  1KA8 A;  1PUE E;  4BQQ A;  3FXR A;  1ULY A;  3A4C A;  4FT8 A;  2QYO A;  4BQA A;  1X2N A;  3U1K A;  2ME6 A;  3CJQ B;  4RS8 A;  4M71 A;  1XGS A;  1R71 A;  3EET A;  1DPR A;  2PN6 A;  3HJE A;  2JPB A;  1T0F A;  2XV4 S;  2E2J J;  3M3Y J;  2L9V A;  3LQR A;  3RKY A;  5IPA A;  3H3Z A;  5KAI C;  2Y31 A;  2BVM A;  2IGN A;  4IRI A;  2M3A A;  2DQL A;  3IH3 A;  4LJZ F;  5J1Y A;  2WAE A;  2XGC A;  3PUB A;  3TO7 A;  4OOI A;  5DM7 F;  1WVR A;  2IXS A;  5EEA A;  2IVM A;  5B5E C;  4HPQ A;  4N9I A;  2A6H F;  2H6C A;  4ZH4 F;  4BY1 J;  1LUJ B;  2EIN H;  5M5W J;  2JA8 J;  3EUH C;  5F0H A;  2M7B A;  2X51 A;  3M1C A;  3CCL I;  5BQT A;  1H89 C;  2PMH A;  4XKC A;  1BR2 A;  1JUS A;  3K1M A;  2VJ5 A;  3OYI A;  1T8I A;  4M6V A;  2CSO A;  2XB0 X;  4F55 A;  1TNS A;  3H9J A;  1IGN A;  1VQ5 I;  4OIO F;  2FUG 2;  2K40 A;  4L9J A;  4F7Z A;  3GTQ J;  2ZXJ A;  4FCY A;  4N0B A;  2HDD A;  2ME0 A;  1I1G A;  2MH9 A;  3ZQC A;  3VSL A;  1XMX A;  2QGU A;  1WJB A;  4C30 A;  2VL8 A;  4R79 A;  3IKT A;  1VQ8 I;  3FMR A;  3JRB A;  1W5T A;  3WGH A;  3WOD F;  3Q9S A;  3G6E I;  3GTP J;  1ZRC A;  2EA2 A;  4XKV A;  2LD5 A;  1JI8 A;  2L7K A;  5E1Z B;  1VF9 A;  3RPU A;  4B44 A;  1W0U A;  2CUJ A;  1KZH A;  2MG4 A;  2FML A;  1O3T A;  3DP7 A;  4V2G A;  1MJA A;  2ZXW H;  2Z2S B;  4DJA A;  3LSK A;  4YFN F;  3CMY A;  1H9T A;  2M4G A;  2EZH A;  3RPU D;  1OLT A;  4XNF A;  4EAT A;  2V9K A;  5IP7 J;  2E5Z A;  4BQN A;  3IH2 A;  3F23 A;  1HOM A;  2E7W A;  1SFX A;  2QEN A;  4RM3 A;  3ZQL A;  2IS6 A;  4FX0 A;  2LF8 A;  1FYL A;  1XC5 A;  4NUB A;  3DXJ F;  3JAM K;  4WK8 F;  2PLY A;  2VON A;  2R7T A;  3MMY B;  3U1D A;  3DPT A;  5ERI A;  3JSP A;  1YIT I;  3BJA A;  1G2H A;  4RLF A;  4HF2 A;  2GWR A;  1TZL A;  4HNV A;  1B59 A;  3ZMS A;  1R58 A;  2E60 A;  4W97 A;  4MQ9 F;  3GWZ A;  3ZOB A;  3PNY A;  4E7J A;  1R9T J;  3WTW C;  1I3A A;  4YEJ A;  2CQN A;  4BNC A;  2HKX A;  2COM A;  3AL0 C;  3A0B C;  2YPR A;  3OYD A;  3ABK H;  1QPM A;  3OSG A;  3KE2 A;  3REO A;  3L2C A;  2VC1 A;  4CO8 A;  4UUV A;  4J01 A;  3GFJ A;  4G8X A;  2R92 J;  5K5Q A;  2JQ7 A;  4KMF A;  2AXT C;  3PFI A;  4A2U A;  4EM0 B;  4BJT A;  3A01 A;  3FXL A;  2NS7 A;  4HV6 A;  1LEA A;  5EZG A;  4ENN A;  3BZC A;  5HS9 A;  1IJW C;  3K0L A;  2G0E A;  2VUM J;  4AVP A;  1Y0N A;  2LP0 A;  3E0J B;  3RKW A;  2R7R A;  2FU4 A;  4I02 A;  2LRD A;  1IN4 A;  2XAJ A;  2FOW A;  3BZK A;  3SQN A;  3BJO A;  2QUF A;  2ZXH A;  2R7Q A;  1EA3 A;  3MKW B;  1UJ8 A;  2K27 A;  1O7F A;  4XON A;  3R0A A;  1XGM A;  5FKK A;  2IS1 A;  2MD5 A;  1F4K A;  2RQQ A;  1I50 J;  2E1O A;  3CQZ J;  3LWF A;  3ZN1 A;  2STW A;  4YRV A;  3H9Q A;  1Z67 A;  5J4V A;  3CJR B;  4LIT A;  3I4M J;  4A5N A;  2IA2 A;  2ECC A;  4A6E A;  4BJ5 C;  2W7N A;  3H35 A;  2EH3 A;  3T8R A;  1U8R A;  3KYD B;  1IZ1 A;  1PDN C;  3ZR8 X;  5CVR A;  4EM2 A;  3EYY A;  2EQR A;  1WKM A;  2VBX A;  1M1E B;  3RQ4 A;  4DZP A;  1HQC A;  1LVK A;  3VYR B;  2MGQ A;  5B3S H;  5LLQ A;  5F0C A;  2H6B A;  3M4O J;  5TJJ A;  3BPV A;  2YS9 A;  2Y30 A;  3CCE I;  4HF1 A;  1R5G A;  4IHT A;  1Q1H A;  1BC8 C;  2DK8 A;  4XOP A;  3M7G A;  4U0Y A;  3F0C A;  1Q1V A;  4Y52 J;  3IC7 A;  5BPI A;  3BQZ A;  4DBR A;  2ESN A;  3HUG B;  1MND A;  1JKP C;  1QVT A;  1IRZ A;  3GX4 X;  5EGO B;  5E8I A;  5IYD J;  3GVA A;  2HI3 A;  4PSX A;  2HOA A;  2HTJ A;  3GTK J;  2DA2 A;  4KDP A;  2HWV A;  4AIH A;  4HAM A;  1RES A;  2HXI A;  1PUF A;  4G7O F;  2KRH A;  4HSR A;  3HDD A;  2O7O A;  2QQA A;  2CQX A;  1MNM C;  3LFU A;  3MKZ A;  1OR7 A;  1QHG A;  2P6T A;  3EUA A;  4EJU A;  5B1B H;  4ZDP A;  1GUU A;  2M1B A;  2ADU A;  1G3S A;  1GHC A;  1ZR4 A;  2HVS A;  4XN0 A;  1SAU A;  1J0R A;  3HOV J;  2EJR A;  5FRM A;  2HQR A;  3K4N A;  4KFC A;  2EFP A;  4PSW A;  5EG0 B;  1JKO C;  5DCM A;  4XLF A;  1X19 A;  2V9V A;  2E19 A;  4UUT A;  4WF2 A;  1DDN A;  2F48 A;  1FY7 A;  3J80 Z;  2DFE A;  3L09 A;  2Y0S A;  1TWF J;  2K86 A;  3NWT A;  4JX4 A;  1S6L A;  3X2Q H;  2D5V A;  4NC8 A;  2GLO A;  3WG7 H;  2KJC A;  4FE7 A;  3PL8 A;  2CV1 A;  2VBW A;  5EGO A;  5M5Y J;  1NTC A;  1XGN A;  1FZP B;  1YIJ I;  1TQM A;  2KP6 A;  2M34 A;  3ABT A;  5JVG F;  4EGZ A;  1BN5 A;  3BTL A;  3BG9 A;  4HEA 2;  2AO9 A;  2IEK A;  4J19 A;  4IOA F;  3TL4 X;  2JA2 A;  1UG0 A;  3CP8 A;  3ROU A;  3KEO A;  3HTS B;  4C9Y A;  1LKX A;  3OL4 A;  1V5F A;  4B8X A;  4Y33 A;  2YSR A;  3H92 A;  3OOP A;  4MTD A;  2ACJ A;  2X1E A;  1XPX A;  2CV2 A;  3OYE A;  2VJI A;  2KQR A;  1U3E M;  3IL2 A;  3PSF A;  4LIU A;  3CDH A;  3I9V 2;  1XDU A;  3CCV I;  5K7F A;  4FX4 A;  3U2R A;  5L3F A;  4MLO A;  2I8D A;  5F0F A;  2HVQ A;  1W5C C;  1I5Z A;  4IF4 A;  3AKZ A;  3LA2 A;  1MKM A;  2LTP A;  3R61 A;  3CCM I;  3UR3 C;  1WGX A;  1JGS A;  1HW2 A;  2L9N A;  2WTE A;  4D7N A;  4YFX F;  3AG2 H;  3KLO A;  4IO9 F;  3GFI A;  2DA6 A;  1POG A;  3HEF A;  3K2Z A;  2IRF G;  5LGT A;  2DTR A;  4OMZ A;  4BU2 A;  3BLY A;  1ON2 A;  1MNE A;  1T08 B;  3FXU A;  3OR1 C;  4FIS A;  1RIO H;  3ZQ7 A;  1RET A;  1W36 D;  3ZMZ A;  3I4P A;  2PI0 A;  1IRG A;  4RAZ A;  2IS2 A;  4BXU A;  3M8J A;  1D1B A;  1IXS B;  2VKD A;  2DOF A;  1BJA A;  3K4L A;  4LG0 A;  2P8T A;  4DQ2 A;  1VQ6 I;  4ZYE A;  1H9G A;  5FLX Z;  1BR1 A;  3IV5 A;  3JW4 A;  3K4M A;  2Y48 A;  5ICF A;  3VYT B;  5EEH A;  5KAF C;  2R0Q C;  2MH2 A;  2X1D A;  3FK7 A;  2XAS A;  4K2E A;  1UHM A;  2B9S A;  3CD6 I;  3DTI A;  3A02 A;  3VFZ A;  4LD5 A;  1XDS A;  4IX7 A;  1RRJ A;  2W00 A;  4CCK A;  1BC7 C;  3HOY J;  3MZH A;  2VKV A;  5DCF A;  3SZT A;  3ZN0 A;  5K1Y A;  4X0G A;  2X4H A;  2IGM A;  1FX7 A;  3SHF A;  2ZFW A;  5FKO A;  2IAI A;  2H1L A;  2QWW A;  4P5O A;  4HYE A;  5KHD A;  2DLL A;  3VEP A;  4RLQ A;  4XKW A;  3BP8 A;  1XX5 A;  1GDT A;  2R7U A;  1WJ5 A;  4G12 A;  2MYS A;  1KGS A;  3F3X A;  3CMA I;  2XVC A;  3O8H A;  4GRI A;  4IRG A;  2D2W A;  3GBG A;  2EFN A;  1P4A A;  3KEQ A;  4R1H A;  5CYV A;  2KL4 A;  3KP2 A;  1R36 A;  3N97 A;  1RKW A;  2CWE A;  1AA7 A;  3ZMV A;  2VPR A;  2Y0M A;  3IAM 2;  1JT6 A;  5HNH A;  1I6H J;  4KUM A;  4IKF A;  4OIN F;  1D8K A;  5B66 C;  5HLT A;  3BR3 A;  3E6B A;  1U9N A;  2DT6 A;  2FMY A;  2CFO A;  3OYB A;  4CCJ A;  3HC7 A;  1OQY A;  5CLS A;  3BG7 A;  1P4X A;  3R6S A;  1X1A A;  3H3V K;  1USS A;  3C2B A;  2R7V A;  3DPL C;  1VFC A;  4DYC A;  1U5T C;  3I3L A;  2DMU A;  2WV1 A;  4M3D A;  1QZE A;  4KN4 X;  4N4O B;  4P9F A;  5TGT A;  2F5E A;  3M07 A;  3ZMU A;  2VT3 A;  4C2T A;  3GFM A;  4BYY A;  5ICC A;  5M5X J;  4S04 A;  2V6E A;  1SD7 A;  4X6A J;  3V4G A;  1IRX A;  1RNL A;  5ICG A;  1SEU A;  2BZT A;  3WHC A;  1J2X A;  4BL0 B;  4A5M A;  4WWC A;  1TT5 B;  1V3F A;  2Z1D A;  3OYA A;  3S93 A;  1Y56 A;  2BYV E;  3HB9 A;  3KIO A;  2XPW A;  2RQP A;  5H6R A;  4A3D J;  3RTR A;  4Q48 A;  4BAY A;  1WH5 A;  4UV8 A;  1G3W A;  2HQ5 A;  2ZC2 A;  4AIK A;  4L0Y B;  1VQM I;  2JUG A;  3KEY A;  1J75 A;  2Z16 A;  3G1L A;  1IDZ A;  2NXN B;  1BOA A;  3S2H J;  3FBI B;  2V1N A;  1YJW I;  4U87 A;  5JHF A;  1VTN C;  2L01 A;  1YX5 A;  4PJL A;  2N8G A;  2LR8 A;  2DO7 A;  3OSF A;  2M30 A;  3L00 A;  1QNT A;  3GTJ J;  2CW0 F;  4FTH A;  4JYK A;  1HKT A;  1X3Z B;  3CTA A;  4HX7 A;  3QPH A;  3T8T A;  4MFD A;  1HSJ A;  3K4B A;  4DW6 A;  1Z1D A;  4NB5 A;  1IN8 A;  3JRA A;  2KPM A;  4LG3 A;  3ULQ B;  1B4A A;  2DA5 A;  2M4K A;  3TGN A;  3OYG A;  2DMQ A;  1YIO A;  3KZZ A;  4BE1 A;  2K9M A;  4CSW A;  1TWH J;  3TKY A;  2VE9 A;  5K5R A;  1HBX G;  1FBS A;  1OYW A;  4I6Z A;  3V7R A;  3TBI A;  3PNV A;  5CQE A;  1WPK A;  5H2F C;  1IV8 A;  4U0V A;  1Z7U A;  2P6S A;  4NHJ A;  2W48 A;  1D1C A;  3IKV A;  5LFA A;  4UUS A;  1YFH A;  1JTX A;  5LRR A;  4ABZ A;  3V7C A;  4IHW A;  3GF2 A;  2H09 A;  3SZG A;  1SC7 A;  1D0Z A;  5C44 J;  3AL0 B;  2DFH A;  2IA0 A;  4XOT A;  2NVU B;  4E7K A;  1N78 A;  3QPS A;  4V2F A;  1BA5 A;  5DUK A;  5E79 C;  3O8G A;  5JI6 A;  2H8R A;  3KPH A;  2R5Y B;  4BJ6 C;  2F4I A;  1VQP I;  1FBQ A;  1OIS A;  5J8F A;  2EFO A;  2J5P A;  3L9F A;  2KDO A;  3QOP A;  3SDB A;  5GAE J;  3BT9 A;  3OV8 A;  4PCQ A;  4HX4 A;  1X3U A;  5AIQ A;  2UUZ A;  1NK3 P;  3AG1 H;  2OTL I;  5D6F A;  4XMY A;  3H3U A;  2FOK A;  1TWG J;  2RDP A;  5L3C A;  3IH4 A;  3S8P A;  3E6D A;  3LA3 A;  3F8M A;  2EA4 A;  2BY2 A;  3FHZ A;  2WBM A;  3QRF F;  4M3G A;  2PMZ A;  4UVA A;  4HDV A;  4F3Q A;  1T98 A;  2GAU A;  2FA5 A;  4GGG A;  3JRI A;  3IUO A;  3FXJ A;  1P7J A;  2MC4 A;  1DGR M;  1B72 B;  4DZJ A;  2ZKZ A;  5D5W B;  1BI1 A;  3PSI A;  1I39 A;  3C2G A;  1K79 A;  1MSF C;  1SAN A;  1H8A C;  2ZME B;  3LNQ A;  9ANT A;  1ETQ A;  2V26 A;  3S1N J;  1QU3 A;  1A35 A;  3WGG A;  4OIQ F;  2KLO A;  1UEL B;  3OS2 A;  1P4W A;  2DYS H;  2KIF A;  3QYF A;  5DCM B;  4GO1 A;  1HC8 A;  1T38 A;  1WFX A;  1YW8 A;  5DD8 A;  1ZEL A;  2HDW A;  4P9U A;  5LRS A;  4LB5 A;  3BTJ A;  4ZDO A;  5IT9 K;  2PX9 A;  4HBL A;  3K2A A;  3RYR A;  5DYM A;  2BW3 B;  4DYQ A;  3DBH B;  4IOC F;  1JXS A;  1T6S A;  2K5C A;  1WQ2 A;  4ANJ A;  2IPQ X;  4M3E A;  2ZME A;  5ICE A;  2A61 A;  4L5I A;  4E7H A;  4D5C A;  3HOT A;  5M3M J;  1S3J A;  4FE4 A;  4XKB A;  5HS8 A;  1V55 H;  3RQI A;  4ZZD A;  2V1U A;  1G8X A;  4ITV A;  4QTR A;  1VQK I;  3T0Y A;  2UWM A;  4V19 K;  3I53 A;  2XKO A;  2EIK H;  1RPW A;  1WJF A;  4BGD A;  2XGX A;  3G1M A;  1JJ6 C;  2HFH A;  3OIQ A;  2OTJ I;  3KZY A;  1MBJ A;  2JWT A;  1VQO I;  2D1V A;  3QOD A;  2HU9 A;  3BRO A;  2FF4 A;  2WAQ N;  2X85 A;  3KYC B;  3HUG A;  4EQQ A;  2VQL A;  2LFB A;  2M45 A;  3L2V A;  1W4M A;  4CA0 A;  4EJV A;  2EFW A;  1OCR H;  2X6O A;  3HHH A;  1D3Y A;  2B0L A;  2H1K A;  1SVL A;  4B3X A;  5J40 A;  2OD5 A;  3FF5 A;  5GTI C;  3CZ6 A;  2JA6 J;  3VOD A;  2JZY A;  2KRC A;  4A0Y A;  1RR7 A;  1A6Q A;  1ZAR A;  3MQ0 A;  2JPC A;  4A3B J;  2DN0 A;  1S9H A;  2ELJ A;  2DA3 A;  1E3H A;  4ENJ A;  2KIS A;  3OYH A;  1KON A;  2QEX I;  1BOB A;  4N4N B;  1YO5 C;  1T39 A;  4HLX A;  3H5N A;  3H36 A;  4DIQ A;  3J7Y J;  1K78 B;  2HNH A;  2TRT A;  3MKL A;  4YII A;  2JT1 A;  3CUQ A;  1D5V A;  2R7O A;  1VQL I;  2W85 A;  3BG3 A;  2K85 A;  1ZG3 A;  2Q2E A;  4BQO A;  3HZJ A;  4LOC A;  5CVV A;  4CZZ A;  4J00 A;  4HF0 A;  3OS1 A;  2NVX J;  5CPR B;  3RKX A;  3NRV A;  4KJZ A;  4M9S A;  4C2U A;  2R7Z J;  2CW7 A;  2RKH A;  4C2M J;  1VI0 A;  2GA1 A;  3S16 J;  3G71 I;  1G6N A;  1XN7 A;  2EV5 A;  4PFP A;  1T95 A;  2K7L A;  4I76 A;  4E70 A;  3DLL F;  2DA1 A;  2PMZ N;  4KIT B;  5GPA A;  5A2Q K;  5AIP A;  3BZ6 A;  1XGO A;  4QLC U;  1V4R A;  5DUI A;  3DQV C;  1Z77 A;  1Y0U A;  4A0Z A;  3JAM Z;  4XRS A;  2CUE A;  2ELK A;  2MLG A;  4YIR X;  2NNY A;  2EIM H;  3HPH A;  2CH0 A;  2XAF A;  3TOA A;  1A6I A;  3GLX A;  3GLL A;  2WAF A;  1OJL A;  1HLV A;  4BDZ A;  3HXL A;  3DTK A;  3A2K A;  1B72 A;  3G3Z A;  4BBR J;  2QBY A;  5HLH A;  5HVQ C;  2F5V A;  4A3I J;  5DDG A;  1MBG A;  5AON A;  2CFX A;  3HM5 A;  1NHA A;  5HDK A;  4E4H A;  1Z21 A;  1S72 I;  2L7Z A;  1AKH B;  1OR7 C;  3DCF A;  4BHB A;  4CYC A;  2L4M A;  4HDU A;  2EPF A;  2BE5 F;  3IWF A;  4G7Z F;  1BJZ A;  2LF7 A;  3ECH A;  1WJD A;  2BXZ A;  1XG1 A;  5KK1 A;  3C1D A;  4LB6 B;  1ETO A;  2DA7 A;  2CRG A;  2VJJ A;  1MJ9 A;  1ZTR A;  1VZ0 A;  2GZW A;  3P7N A;  2ETH A;  1KU2 A;  1MH4 A;  2WB1 A;  3LSH A;  2OPT A;  4QSH A;  3SYT A;  2LBF A;  3LSP A;  4EVI A;  3A1Y A;  3O2P E;  3SEQ A;  3HKZ A;  3KFW X;  1GXQ A;  4RB1 A;  1ZRE A;  1ZLJ A;  4HOB A;  3FXM A;  3L2U A;  3LAP A;  4F91 B;  2Q1Z B;  4ESB A;  5IT9 Z;  2M5W A;  4XM3 A;  2OQG A;  2PQ8 A;  3CP2 A;  4KIG A;  2XDV A;  1IF1 A;  4MO7 A;  4KMU X;  2P4W A;  3FKJ A;  3L2W A;  1Y1W J;  1YW7 A;  4UNO A;  4WXC A;  1TQP A;  4B47 A;  3HYI A;  4R8H A;  3S2D J;  5FD6 A;  1ZH5 A;  3FZV A;  2GOM A;  1JTY A;  3DKW A;  3ZPL A;  1IXR C;  2D1H A;  2DPU A;  4ASN A;  2XIG A;  4ZTF A;  1XSV A;  1LNW A;  2IBD A;  2OC6 A;  4L9N A;  2DMT A;  4B48 A;  2FBK A;  2EV0 A;  2ID3 A;  1YI2 I;  4II3 A;  2HQN A;  3FKI J;  3OYC A;  1QBJ A;  4CHU A;  3RZO J;  1ON1 A;  1SFU A;  3WE3 A;  4YG2 F;  4U88 A;  1AOY A;  1IN6 A;  5GAD J;  1IRF A;  1B8I B;  3TO6 A;  4NBQ A;  1QO0 D;  4NNJ A;  1X1C A;  4A93 J;  1D5Y A;  5DTD A;  3F22 A;  1U6G A;  1YYV A;  1X3W B;  2I10 A;  3ZP5 A;  1Z0X A;  4EV0 A;  4RB0 A;  3CF2 A;  3C3W A;  1HDP A;  2IP2 A;  2HPI A;  3DV8 A;  5ED4 A;  3E5U A;  2DDA A;  1R1V A;  3QPL A;  2M8E A;  1F36 A;  2R7F A;  1ZGJ A;  5IOZ A;  2HYF A;  2BY1 A;  5LEJ A;  2EK5 A;  4FQG A;  3CLQ A;  4BXF A;  2BHZ A;  2DI3 A;  4I7H A;  5KNL A;  1V5G A;  2VE8 A;  3S14 J;  4UUS B;  1B9M A;  1Y1V J;  2QKM B;  1D1A A;  1VND A;  2RVC A;  4M3F A;  4RB3 C;  3BTC A;  4BHP A;  2XAG A;  4XLC A;  2A3S A;  2K3P A;  3K6G A;  4XQF A;  2AXL A;  2YX7 A;  3HRS A;  3I4N J;  4FHT A;  3BG6 A;  4YEL A;  2KIU A;  1QVU A;  4E7I A;  2O8K A;  2ZJ2 A;  2XPV A;  3ASO H;  3KX2 A;  2JVH A;  3V42 A;  1FOW A;  1HST A;  1IW7 F;  1MD0 A;  4XN3 A;  2RV8 A;  1QA6 A;  4DNC A;  3G2B A;  3R60 A;  3V7S A;  2V1X A;  3V8J A;  2COB A;  4E7L A;  1S5L C;  1G59 A;  2W25 A;  2KZG A;  3ZRG A;  3GYH X;  4KA4 A;  2O6G E;  3WTU C;  4A69 C;  2JUC A;  2F6C A;  1YS7 A;  1X1B A;  3TW7 A;  1GV2 A;  2MW8 A;  1W5S A;  2NRA C;  1OYI A;  1R49 A;  5A2Q Z;  1QHH D;  4HG2 A;  2KKO A;  2QF7 A;  1SVO A;  1DGW Y;  3DU6 A;  2K4B A;  1O3Q A;  2X6W A;  3BOQ A;  3CUQ C;  3CO6 C;  1F9N A;  3E6C C;  4PGH A;  3HTU A;  2E5N A;  4RGX A;  2V6C A;  3RI4 A;  5D5U B;  1BI3 A;  2FEZ A;  2V79 A;  4QWQ A;  5C3E J;  1EH6 A;  2LMD A;  4HLY A;  1V5E A;  4P96 A;  2OU2 A;  2GIZ A;  2LDU A;  3GTO J;  2HTS A;  2F4M B;  1WSU A;  3WU1 B;  2M0M A;  4U7D A;  1EKE A;  4HNU A;  3F8C A;  1OCT C;  4PUS A;  5BMZ A;  3CC7 I;  3PFY A;  2VT2 A;  3BR5 A;  1EH8 A;  3ABU A;  1KYW A;  1ONV A;  1WH7 A;  2L2O A;  4FAS D;  1Y8Q B;  4Q47 A;  4ESF A;  1X1P A;  3J80 K;  5E1X A;  3KYL A;  2LOO A;  4L0Z B;  5C4J J;  2QKL B;  2E1M C;  2QCO A;  4A3K J;  2XF5 A;  3BWG A;  4I99 C;  5C4X J;  2LKP A;  2DU9 A;  2BGC A;  4W1U A;  1Z9C A;  1ETV A;  2KIM A;  1SD4 A;  4UVC A;  1VQ9 I;  3W6J B;  4MHG A;  3CJN A;  1HKQ A;  2JSC A;  3I59 A;  3M9A A;  1FPQ A;  1MIJ A;  3FBN B;  5IP9 J;  3S3O A;  3GTM J;  1V54 H;  2EFQ A;  1G3Y A;  1IN5 A;  3K4K A;  2X6Y A;  4E7Z A;  1RKT A;  2FBI A;  3DBR B;  1LEB A;  4PJ0 C;  2O5R A;  3NEU A;  4ESJ A;  2VB6 A;  3JRG A;  2STT A;  3E6M A;  3BG5 A;  4AVZ A;  1FTT A;  2A5W A;  3ERE D;  4PZJ A;  3HGY A;  5GP9 A;  1MMN A;  1UFM A;  1I1S A;  3ZQG A;  1ETX A;  5HLI A;  3F72 A;  5M3F J;  2NYX A;  1S29 A;  4D1Q A;  3KZI C;  3OIP A;  3ELK A;  1QPI A;  4KT6 A;  1NG6 A;  2E71 A;  2PBI A;  1KU7 A;  3I54 A;  3LSI A;  3G73 A;  4MEX F;  2A6E F;  1ORK A;  2K9L A;  2DT7 B;  3T5X A;  1J59 A;  3VYU B;  3GZ6 A;  2DBB A;  1HF0 A;  4NQW A;  5F1J A;  1XSD A;  2CMP A;  2E36 A;  3I56 I;  4WCG A;  2EIJ H;  3D1N I;  2M2E A;  1O7L A;  4XRS G;  5D8L B;  1W1W E;  4DGW B;  3IRR A;  1MGT A;  4I0B A;  3L7W A;  4O3M A;  1T2K A;  5LGN A;  1TQI A;  3JCU C;  3CCS I;  3QPT A;  4E6K G;  4Q5S F;  2ZNZ A;  4LGW A;  4GFB A;  2MLK A;  1XMA A;  3TQN A;  1FIP A;  4NC7 A;  5EYR A;  3OY9 A;  3LOC A;  2DK5 A;  5J6X A;  4LG0 B;  3LSG A;  2P0W A;  1ZLK A;  4L18 B;  2IGO A;  4QPO A;  1FJL A;  3GZN B;  1G4D A;  6PAX A;  3RKQ A;  2HOS A;  2K9S A;  2YX4 A;  3GTL J;  3LSR A;  3ONQ A;  4ON0 A;  1AWC A;  4X1E A;  4B43 A;  3GUD A;  1TWA J;  3F8N A;  3EUH A;  3E1S A;  4AM3 A;  2JRT A;  4Q4Z F;  5FJ8 J;  4RAY A;  4C3I J;  3HSR A;  3QYE A;  3NQO A;  1W0T A;  3HRM A;  3DEW A;  2GA2 A;  4B09 A;  4BH9 A;  3ESW B;  3TW6 A;  1DQU A;  2CYY A;  4IHY A;  5B1A H;  5J1R A;  3WGI A;  2ZSI B;  1OCO H;  3TOB A;  3MN2 A;  2DT5 A;  1ZAO A;  3DU5 A;  4ZZL A;  4ETS A;  4UV9 A;  2ZSH B;  2L4A A;  1RC9 A;  3BR2 A;  2ISZ A;  5FLM J;  2BVL A;  4HST A;  1R7J A;  2KHM A;  5TIS C;  1Z7L A;  3AG4 H;  2EWN A;  2A07 F;  3HOU J;  1PYV A;  3DFG A;  1U5T B;  3FM5 A;  1VQ7 I;  2R7D A;  2M7A A;  4RMN A;  5J3L A;  1FWZ A;  3K7A J;  5CKT A;  3P9I A;  1LDD A;  1SFE A;  4KIF A;  5D6E A;  2GXB A;  1Y8R B;  2L54 A;  2HZD A;  4D7M A;  3F8F A;  3HOS A;  2IT0 A;  2XAU A;  3PNT A;  5F6F A;  2HYJ A;  2WV0 A;  1U78 A;  1B1B A;  2MFZ A;  1FSH A;  3Q0U A;  3AFH A;  3WG9 A;  5K7H A;  2A69 F;  4RA2 A;  4ZDL A;  4AC0 A;  4CYC B;  1MW7 A;  3L2Q A;  2WWY A;  2Z33 A;  4BE2 A;  1S7E A;  1LPQ A;  1LE8 A;  3VOE A;  2ZNY A;  4CDG A;  5EEG A;  3BJ6 A;  4PJJ A;  2ZJP F;  1OMI A;  1TW3 A;  3N4M A;  5E3N A;  1FC3 A;  3GEZ A;  2DDB A;  1P92 A;  2JTV A;  2LRE A;  3M8F A;  5FGM A;  4RGR A;  2LYC A;  4JBA A;  1DU6 A;  2R5Y A;  1YRN A;  2VKE A;  5FFZ A;  1E2X A;  2FBH A;  2LKS A;  2WY8 Q;  1FTZ A;  2VBY A;  4UB6 C;  1YLF A;  3W2A A;  1GVJ A;  3V8K A;  1A04 A;  2KMU A;  3GXO A;  1U8B A;  1UST A;  2O8X A;  2MAB A;  3PQJ A;  2HOE A;  2L9R A;  4IZZ A;  3PO3 J;  4LLL A;  3O6B B;  3FIS A;  5D5V B;  2XAQ A;  3TDU C;  3EYI A;  5CVI A;  1MBH A;  2ELH A;  4D5F A;  2F5F A;  1Y6I A;  1XD7 A;  2R5Z B;  2Z3Y A;  5CJ9 A;  3JSO A;  2XGE A;  4XSZ F;  5L3G A;  4IHS A;  2QSF X;  2G7H A;  4XK4 A;  2Z99 A;  3FDY A;  1ZN2 A;  2HS5 A;  4ENM A;  3ISP A;  4DOZ A;  2Q2E B;  2ID6 A;  1ZGW A;  1X1D A;  4GXO A;  4EM1 A;  3MAJ A;  2ZCW A;  2NOJ B;  2QZ8 A;  4IVN A;  3WU2 C;  2P7V B;  1K78 A;  2NVY J;  4HX8 A;  1IAW A;  5D5X B;  3IRQ A;  4BE0 A;  1MMD A;  1T56 A;  1QRY A;  2KT0 A;  3BC8 A;  1ZHF A;  4XL9 A;  3R4K A;  1FOY A;  4BY7 J;  2LSO A;  3GW2 A;  3RDI A;  5CVU A;  3G1O A;  5E3L A;  2E1C A;  2QSG X;  3OR2 C;  2WAQ A;  3T1B A;  3VDX A;  3F21 A;  2RRE A;  2XC7 A;  2CQK A;  1GVD A;  3HL2 A;  2JMW A;  2DOA A;  2QLZ A;  3FHN A;  2VQC A;  5EF6 A;  4LLG F;  2ICW G;  5E20 A;  3VPR A;  4A3C J;  2M8G X;  4Y3O A;  1XMK A;  3O3K A;  4XLP F;  4ZJZ A;  2OCC H;  1OCP A;  5GAG J;  3K1N A;  4WX9 A;  3WTX C;  3P9C A;  2PG4 A;  2L7F P;  5ILS A;  1UCR A;  2VN2 A;  1NG7 A;  1YG2 A;  3TDZ C;  1SD6 A;  2DFF A;  2UXX A;  2FE3 A;  1WCM J;  3CJT B;  2DJI A;  4A3E J;  2F5C A;  1APL C;  1IDY A;  2NS0 A;  2RGV A;  3HPG A;  4L5E A;  4AUX A;  1TNT A;  1PVE A;  4RGU A;  1HCR A;  1BR4 A;  4EMS A;  3LL7 A;  2G7U A;  1SVM A;  5EG0 A;  4BXX J;  5FKL A;  3H5A A;  3JRC A;  5HOO A;  4G9Y A;  4PGG A;  3J7Z I;  2JA7 J;  1YX3 A;  4HW0 A;  1JJ8 C;  3OOU A;  3H0D A;  2PEX A;  3NAU A;  2J5O A;  3EDP A;  3QOE A;  5F27 A;  2Y9Z A;  3CC2 I;  1ZQ3 P;  1FIA A;  5JLX A;  4KN7 X;  2A68 F;  5LEK A;  4XID A;  4IHX A;  1EJ9 A;  1QZZ A;  2GOX B;  2ISY A;  5JR3 A;  1WHU A;  3KLN A;  3U9G A;  2E1M B;  1RI7 A;  3DEU A;  1DP3 A;  3MEX A;  3GZ5 A;  1DUX C;  2W24 A;  2WAD A;  3RZD J;  2FXA A;  2LY2 A;  1F1Z A;  3D5L A;  1FP1 D;  4CXF A;  2XKP A;  2Z5U A;  2HZT A;  4AYB A;  3L2R A;  1P6R A;  1Z6T A;  4L9T A;  4KT5 C;  1J9I A;  2UV1 A;  3S1M J;  1AU7 A;  3IWZ A;  3HRU A;  3WTT C;  2L0K A;  4G6Q A;  1ODD A;  1TL8 A;  4B1R A;  2M9H A;  3ZQF A;  2VXZ A;  4BAC A;  2AQF A;  4CCM A;  4M74 A;  1S8N A;  3JRH A;  4EJT A;  1TP4 A;  2DAO A;  5FLX K;  5BS6 A;  3KP4 A;  5BNG A;  3Q0V A;  5FB2 A;  1MDM B;  2R7X A;  3N05 A;  1BW5 A;  1S7O A;  3COA C;  2FNP A;  1LJ9 A;  5F1R A;  2C6Y A;  4IQJ A;  1QGP A;  2W82 A;  2PJR A;  3CCU I;  4BUP A;  2ESH A;  3QU6 A;  3ZMT A;  3TED A;  3MZ8 A;  2FX0 A;  3RPQ A;  3M1E A;  4Y7N J;  5E8G A;  2W57 A;  2H27 A;  1MBF A;  4PK4 A;  2LH9 A;  5J47 A;  3GME A;  1UMQ A;  2ZO4 A;  1Z3Y A;  3MVP A;  2OCE A;  4JX6 A;  3HOX J;  1TBX A;  2JJ7 A;  3LFK A;  3OIO A;  1FBU A;  1YTY A;  1B8I A;  3S17 J;  3DLA A;  3OMY A;  2FRH A;  5JLW A;  2DA4 A;  3J81 K;  2YUS A;  2LY9 A;  3H1C A;  3FWE A;  1HW1 A;  4JX5 A;  4IRH A;  2YR2 A;  4JP0 A;  4O5V A;  2O03 A;  2RNG A;  4HZF A;  2PJR B;  2OUM A;  2NVT J;  2QVO A;  1QQI A;  3B73 A;  3GO5 A;  5F04 A;  5IP6 A;  2EB7 A;  5L3D A;  1WWX A;  4HNT A;  4HQM A;  2VOO A;  4NC6 A;  3CME I;  2DMP A;  4IPA A;  3SEZ A;  4LK0 F;  4Y15 A;  2PJP A;  4EGY A;  2JK3 A;  1SAX A;  4UY8 I;  2V9P A;  3B02 A;  2XUB A;  3FMQ A;  1BM9 A;  3FM3 A;  3RYP A;  1X2M A;  4L5J A;  4LMY A;  2E2I J;  2QQ9 A;  2R93 J;  2EZI A;  3D5S C;  4HA8 A;  1YJ9 I;  3WE2 A;  5FRO A;  2XB5 A;  1UZC A;  5FO5 A;  1J5Y A;  1P2F A;  2VOP A;  1D0Y A;  2QQB A;  3DKY A;  1WI9 A;  1U0J A;  4A12 A;  1O3R A;  2WC2 A;  5L3B A;  2EZL A;  4AWX B;  4OWR B;  1ZR2 A;  4UB8 C;  3HRT A;  1UHS A;  1FMW A;  1U9O A;  4HRI A;  1W7P B;  4P1W A;  3S2W A;  1YQA A;  1GV5 A;  5LHG A;  2DTZ A;  2OZU A;  4NDL A;  2LY1 A;  1ZGA A;  2Y69 H;  5E18 F;  5H6Q A;  2UZK A;  1K4S A;  4WXH A;  1L3L A;  5E3O A;  1XS9 A;  3K4C A;  4XLN F;  4XBF A;  4MTE A;  1C0W A;  5F64 A;  2LLK A;  3QWL A;  2XF7 A;  3S1R J;  5DM6 F;  1GLN A;  1FEX A;  3BR6 A;  1R22 A;  1ZG5 A;  1K83 J;  2QBY B;  2BY0 A;  3QQA A;  2QA4 I;  1ZYR F;  1OFC X;  1TLH B;  1GXP A;  2CO5 A;  2W4S A;  3K1P A;  4PDK A;  3HKZ N;  3JRE A;  1OCZ H;  4F52 A;  1N75 A;  1H0M A;  2CQ7 A;  1VQN I;  1XTA A;  3H9G A;  2BXY A;  3SZP A;  1MBE A;  4HV5 A;  1GT0 C;  4QIW N;  2B7E A;  5GAH J;  1WI3 A;  2HXO A;  1UHW A;  2PFB A;  1IXC A;  1E17 A;  2DJN A;  3Q5F A;  4M3B A;  1K4T A;  2VI6 A;  3M8E A;  1TW2 A;  1EV7 A;  4RAG A;  2LNB A;  3E97 A;  3A01 B;  2VBZ A;  1PJR A;  1K61 A;  1MJB A;  3JRF A;  3SDG A;  1P7I A;  3NWS A;  3ZGK A;  4RB2 C;  2MC3 A;  1LFB A;  1SFO J;  3P9K A;  3UKG A;  4NQW B;  1L0O C;  1YS6 A;  4XR6 A;  2CJJ A;  1MZB A;  4A3F J;  3SFI A;  1CGP A;  5E17 F;  2M0C A;  3F8B A;  3RCO A;  4M9Z A;  1YOV B;  4AU7 A;  1PUF B;  1B6A A;  2V4J C;  3ZCO A;  4BKX A;  4OIP F;  4L9V A;  4F93 B;  5EZH A;  2DMN A;  4MGR A;  1R1U A;  2HOT A;  2AS5 F;  4G94 A;  2E35 A;  4ZC3 A;  1EF4 A;  2ZJR F;  2EBI A;  4CH7 A;  1I3Q J;  3CCQ I;  4XLH A;  2P81 A;  2WY7 Q;  3JTG A;  2H8W A;  4XSX F;  4G7H F;  2YU3 A;  3A03 A;  2JN6 A;  2KFD A;  3CC4 I;  2DXI A;  2OJE D;  3UNG C;  1JE8 A;  3HOZ J;  3W6K B;  1DPU A;  5JFR A;  2Y75 A;  2R4G A;  4OMY A;  1E0E A;  2XRO A;  5JHU A;  3BTI A;  2DW4 A;  1FYK A;  1JUM A;  4Y4R A;  3QP5 A;  1FYM A;  4LIV A;  5KCM A;  1X4O A;  5LD2 C;  1BBY A;  5LHI A;  1QZY A;  3HHG A;  1X58 A;  3CF5 F;  3J81 Z;  2VJ4 A;  2BOL A;  3C7J A;  5FLV A;  1AHD P;  1ZK8 A;  4BHC A;  2NAZ A;  4CCN A;  2OV7 A;  4C3J J;  3C2H A;  3NAR A;  5ILU A;  1IUF A;  1R23 A;  1XCV A;  5IY5 H;  1A36 A;  1MDM A;  1FLI A;  3E5X A;  4D9J A;  2P5L C;  3F6V A;  3B6A A;  2E2H J;  3GTG J;  3CES A;  1R6R A;  1CF7 B;  1SD5 A;  5GTH C;  3LAJ A;  2OBP A;  4CUG A;  2XAH A;  2XRL A;  1HA8 A;  4GYG A;  3SFZ A;  3J7A O;  1A5J A;  2BY3 A;  2HKO A;  4AYB N;  1H88 C;  1JHH A;  1RZ4 A;  2XHK A;  3WTV C;  3JRD A;  4BBS J;  2A6T A;  2KDZ A;  4IXA A;  3CO7 C;  3PJR A;  3IHU A;  3HOW J;  1UAA A;  4BS9 A;  4DYR A;  4P55 A;  2IGK A;  2O9L A;  1WJA A;  4I2O A;  2G9W A;  2K3F A;  1ZG1 A;  4S0H B;  3K10 A;  1DU0 A;  1HDD C;  1NH3 A;  2DYR H;  3LSJ A;  2X9D A;  3S32 A;  5J4Y A;  3FMS A;  1ITY A;  2IW5 A;  2X6X A;  3C18 A;  1N77 A;  4MNU A;  2W1O A;  1T33 A;  2EV6 A;  2B63 J;  3RIR A;  2NOG A;  2GQQ A;  2ZB9 A;  3Q3S A;  3K70 C;  1T0F C;  1F5T A;  3VSK A;  2DQR A;  4GDF A;  1S7A A;  3TO9 A;  1R4N B;  3MD2 A;  3QYB A;  3CCR I;  1OCC H;  4A3L J;  2BEO A;  4PFO A;  3G4S I;  2VC0 A;  2Y9Y A;  3ASN H;  4N9H A;  2OF7 A;  5J8C A;  5E3M A;  4AD9 A;  2CG4 A;  2O3F A;  1E3O C;  3BR0 A;  2GXG A;  2XF6 A;  3DPU A;  1J09 A;  3AG3 H;  3FIW A;  2P7C B;  3DTE A;  2XRN A;  2CUF A;  3PIO F;  5LGU A;  1YHQ I;  1Z91 A;  3J7A Y;  3CDI A;  4MEY F;  4CCO A;  1O4X A;  3CUO A;  5LHH A;  3I55 I;  3HSE A;  1ACI A;  3LSM A;  1KU3 A;  2W84 A;  2MSY A;  2CU7 A;  1STZ A;  4TV7 A;  4A3G J;  1BIB A;  1FSE A;  2RN7 A;  1K6Y A;  4ZYA A;  1R5H A;  2LC2 A;  1U5T A;  2DFI A;  2HQA A;  2Y0S N;  5D4R A;  5TRD A;  3BPX A;  2TCT A;  3E5Q A;  4ZYH A;  3DEE A;  5IOY A;  2JSP A;  2X1C A;  3OYN A;  4Z2Y A;  3GFL A;  1E3P A;  1MBK A;  2HGC A;  4QPQ A;  1X4P A;  2VQH A;  4YFK F;  3Q0W A;  4B3A A;  3HIF A;  4XRF A;  5IYC J;  1JT0 A;  3CDL A;  1CF7 A;  1KYZ A;  1LDK B;  3RSN A;  4XIC A;  3QU3 A;  2CUZ A;  3K69 A;  5J1U A;  2WB1 N;  4XOR A;  3DKX A;  3I5U A;  2LVS A;  3MFK A;  1BL0 A;  4MFE A;  2JA5 J;  1SFK A;  1R00 A;  1ZKG A;  2CW8 A;  5K7Z A;  5HNF A;  1SMT A;  4EJO A;  2R5Z A;  4G6T B;  1TTY A;  3EPZ A;  3L1P A;  4XLA A;  2A5Y B;  2A05 A;  3MZY A;  3KP7 A;  3W2W A;  5IT3 A;  3KCC A;  3S3M A;  2JVG A;  3ZQH A;  1ENH A;  5CQG A;  2L02 A;  4HQE A;  1IUY A;  3KP6 A;  2R7W A;  4IL6 C;  3HSF A;  5FFX A;  2BHY A;  4RM2 A;  3BR1 A;  5DD4 A;  2FQ4 A;  1EH7 A;  4A6D A;  2Z9O A;  1FP2 A;  2QSH X;  4M9X A;  3I59 B;  2HR3 A;  4MQV A;  4M72 A;  3EQL F;  1YE9 A;  2FQ3 A;  1JHF A;  1REP C;  1VQ4 I;  2I5U A;  2XPU A;  5HDN A;  4UXN A;  4U7B A;  1O3S A;  5EJC A;  4MIM A;  3FK6 A;  3I58 A;  4CZC A;  3DWL E;  1KU9 A;  4FET A;  5DV5 A;  1AKH A;  3KP5 A;  2ECB A;  2R7S A;  2WA0 A;  2L3D A;  4M73 A;  2GBY A;  3BCB A;  1ZRF A;  3I71 A;  3FX3 A;  3PQK A;  3I64 A;  2VLA A;  5DS9 A;  3DF8 A;  5L3E A;  2ZBK A;  4BDY A;  2DOD A;  3P5J A;  2HEO A;  2K02 A;  1OPC A;  3PM1 A;  2Q0O A;  1ERD A;  1R4M B;  3CMM A;  3OWT A;  1LVA A;  2FNA A;  4Z6Y A;  1Z6R A;  3Q9V A;  2VQG A;  3H5R A;  3S3N A;  2GIV A;  3HGG A;  4UHT A;  3PO2 J;  3TP3 A;  1YW9 A;  4B4C A;  1WRJ A;  3QAH A;  5F08 A;  3V8L A;  2F2E A;  3LMM A;  3PUF A;  3QP6 A;  3WU0 A;  2NVQ J;  1B9N A;  1IC8 A;  1RR8 C;  2O0Y A;  1Y39 A;  5HOD A;  1DP7 P;  2LBF B;  3OYM A;  4H0E A;  1IG7 A;  1F43 A;  3LQQ A;  1OYY A;  1IN7 A;  4LLN A;  2ZXI A;  1IV6 A;  3F6O A;  2DPD A;  2FSW A;  3A0H C;  2VXD A;  2HYG D;  5JVT A;  2RC4 A;  4A0X A;  3ERM A;  2HPM A;  1XSX A;  5D4S A;  4RBO A;  3I0T A;  2FJ1 A;  3JR9 A;  5BPD A;  2HVR A;  2L9S A;  2FD5 A;  4KIC A;  4S05 A;  4PJM A;  2MD0 A;  2R3S A;  1KQ0 A;  3S15 J;  4M6Y A;  1RUO A;  3MCZ A;  4UVB A;  3E3V A;  4D0P A;  3FXK A;  5ILV A;  5HDG A;  1BI2 A;  2D45 A;  3B6C A;  2LKX A;  2NNN A;  1D0X A;  1TC3 C;  2K9N A;  3AAF A;  4KYW A;  5FD5 A;  3BCA A;  1FNN A;  4IQ4 A;  4EEF G;  2H94 A;  4ZYG A;  1G3T A;  2OZ6 A;  1LB2 A;  1JKQ C;  2L5Q A;  4OAZ A;  3GCM A;  5GPC A;  5FKN A;  4PJN A;  3FXO A;  4AIJ A;  1R5I D;  2IS4 A;  3S1Q J;  2L7M P;  1ZRD A;  3K4J A;  1SMY F;  2VPL A;  2O61 A;  3WHB A;  3D0S A;  1Z3X A;  4RGS A;  4BEH B;  3K70 D;  5HS7 A;  1FMV A;  4Y13 A;  3MKY B;  1FT9 A;  3CCY A;  4F92 B;  4GYI A;  3OYL A;  1N25 A;  4JQF A;  2IA1 A;  2KZV A;  2JRM A;  2F5D A;  2Y2Z A;  1HW5 A;  1I27 A;  5H20 A;  4ZYD A;  4I01 A; 
#chains in the Genus database with same CATH homology
 2TDX A;  5KVR A;  2CGP A;  1LDJ A;  2MA3 A;  3LST A;  2IJL A;  1PP7 U;  2BBY A;  1K6O A;  1BI0 A;  2K4J A;  2RNJ A;  5K5O A;  2Q8K A;  3WTY C;  4CGZ A;  2PMU A;  2P5K A;  4I09 A;  1FOK A;  1PP8 F;  2P5V A;  4EJW A;  1HXD A;  1KQ8 A;  4OIR F;  2OAZ A;  1XCB A;  4Y17 A;  1BIA A;  2E7X A;  2M87 A;  3JTH A;  4GCV A;  4CYD A;  1J7K A;  4O6J A;  4JK1 X;  3MWM A;  3VB2 A;  1XB4 A;  2E1N A;  2KJB A;  4LK1 F;  3K9T A;  2V1D A;  2MBF A;  2UXN A;  4IJA A;  1KQ9 A;  3ECO A;  3FXQ A;  4WXD A;  3R0J A;  3ZMD A;  3BY6 A;  2BV6 A;  5D8K B;  1OKR A;  4OU0 A;  4LFU A;  5E1W A;  3WTZ A;  1W7P A;  3RJP A;  1R1T A;  1UB9 A;  1I6X A;  2VOD A;  4KNY A;  3BDD A;  4I0A A;  3CLO A;  4CIC A;  5HLG A;  2X0L A;  4ENK A;  4KIB A;  2HDC A;  1K7A A;  4G6D A;  3LA7 A;  4M6X A;  1U2W A;  3KET A;  2KRF A;  3SXY A;  5BOX A;  5DEQ A;  1O57 A;  1RUN A;  4I98 B;  4YIF A;  1LQ1 A;  3KP3 A;  2OA4 A;  1HKS A;  1W7P D;  2QM3 A;  4U0W A;  3WTS C;  3CUQ B;  5CVJ A;  1D8J A;  5LBQ A;  1Z05 A;  2OQR A;  3ML6 A;  1KA8 A;  1PUE E;  3FXR A;  1ULY A;  4FT8 A;  2QYO A;  4BQA A;  4RS8 A;  4M71 A;  1XGS A;  3EET A;  1DPR A;  2PN6 A;  2JPB A;  1T0F A;  2XV4 S;  3LQR A;  3RKY A;  3H3Z A;  4IRI A;  4LJZ F;  2DQL A;  3TO7 A;  4OOI A;  2IVM A;  4N9I A;  2A6H F;  2H6C A;  4ZH4 F;  5BQT A;  2PMH A;  3K1M A;  2CSO A;  1TNS A;  4OIO F;  4L9J A;  4F7Z A;  2ZXJ A;  4N0B A;  1I1G A;  2MH9 A;  4R79 A;  3IKT A;  3FMR A;  1W5T A;  3WGH A;  3WOD F;  3Q9S A;  1ZRC A;  2EA2 A;  3RPU A;  5E1Z B;  2FML A;  1O3T A;  3DP7 A;  1MJA A;  4YFN F;  1H9T A;  3F23 A;  2E7W A;  1SFX A;  2QEN A;  4FX0 A;  2LF8 A;  1FYL A;  3JAM K;  3DXJ F;  4WK8 F;  2PLY A;  2VON A;  3U1D A;  3DPT A;  5ERI A;  3JSP A;  3BJA A;  4HF2 A;  2GWR A;  1B59 A;  3ZMS A;  1R58 A;  4MQ9 F;  3GWZ A;  3WTW C;  4BNC A;  2HKX A;  2COM A;  2YPR A;  1QPM A;  3KE2 A;  3REO A;  3L2C A;  2VC1 A;  4CO8 A;  4UUV A;  3GFJ A;  4G8X A;  5K5Q A;  4KMF A;  4EM0 B;  3PFI A;  4A2U A;  4HV6 A;  1LEA A;  4ENN A;  5HS9 A;  3K0L A;  4AVP A;  3RKW A;  2FU4 A;  4I02 A;  1IN4 A;  2XAJ A;  3SQN A;  3BJO A;  2QUF A;  2K27 A;  1O7F A;  3R0A A;  1XGM A;  2MD5 A;  1F4K A;  3LWF A;  3ZN1 A;  2STW A;  4A5N A;  2IA2 A;  4A6E A;  3T8R A;  1U8R A;  1IZ1 A;  1PDN C;  5CVR A;  4EM2 A;  3EYY A;  1WKM A;  2VBX A;  1HQC A;  5LLQ A;  2H6B A;  5TJJ A;  3BPV A;  4HF1 A;  1R5G A;  4IHT A;  1Q1H A;  1BC8 C;  2DK8 A;  3M7G A;  4U0Y A;  3IC7 A;  5BPI A;  2ESN A;  3GX4 X;  5E8I A;  3GVA A;  2HTJ A;  4KDP A;  2HWV A;  4AIH A;  4HAM A;  4G7O F;  2QQA A;  1OR7 A;  2P6T A;  4EJU A;  2M1B A;  2ADU A;  1G3S A;  1GHC A;  1J0R A;  2EJR A;  2HQR A;  4KFC A;  2EFP A;  5DCM A;  2V9V A;  1DDN A;  4WF2 A;  1FY7 A;  3J80 Z;  3L09 A;  2K86 A;  1S6L A;  2KJC A;  2VBW A;  1XGN A;  1FZP B;  1TQM A;  3ABT A;  4EGZ A;  1BN5 A;  3ROU A;  3KEO A;  3HTS B;  4B8X A;  2ACJ A;  2YSR A;  3H92 A;  3OOP A;  4MTD A;  1U3E M;  3IL2 A;  3CDH A;  1XDU A;  4FX4 A;  3U2R A;  5L3F A;  1I5Z A;  4IF4 A;  3LA2 A;  1MKM A;  3R61 A;  1JGS A;  1HW2 A;  2WTE A;  4YFX F;  3KLO A;  3GFI A;  3K2Z A;  2IRF G;  5LGT A;  2DTR A;  4OMZ A;  1ON2 A;  3FXU A;  1RIO H;  3ZQ7 A;  3ZMZ A;  3I4P A;  2PI0 A;  1IRG A;  4RAZ A;  4BXU A;  1IXS B;  1BJA A;  4LG0 A;  2P8T A;  4DQ2 A;  4ZYE A;  1H9G A;  5FLX Z;  3JW4 A;  2Y48 A;  5ICF A;  5EEH A;  2MH2 A;  2XAS A;  4K2E A;  1UHM A;  3VFZ A;  4LD5 A;  1XDS A;  1BC7 C;  3MZH A;  5DCF A;  3SZT A;  3ZN0 A;  5K1Y A;  2X4H A;  1FX7 A;  3SHF A;  2ZFW A;  2QWW A;  4P5O A;  4HYE A;  2DLL A;  3VEP A;  3BP8 A;  1KGS A;  3F3X A;  2XVC A;  4IRG A;  2D2W A;  2EFN A;  1P4A A;  3KEQ A;  4R1H A;  5CYV A;  3KP2 A;  1R36 A;  3N97 A;  2CWE A;  3ZMV A;  2Y0M A;  4KUM A;  4OIN F;  1D8K A;  3E6B A;  2FMY A;  5CLS A;  1P4X A;  3R6S A;  1USS A;  3DPL C;  1U5T C;  4KN4 X;  4P9F A;  2F5E A;  3ZMU A;  2VT3 A;  3GFM A;  4BYY A;  5ICC A;  4S04 A;  1SD7 A;  3V4G A;  1RNL A;  5ICG A;  1J2X A;  4A5M A;  4WWC A;  1V3F A;  2BYV E;  2RQP A;  5H6R A;  3RTR A;  4Q48 A;  4BAY A;  4UV8 A;  1G3W A;  4AIK A;  4L0Y B;  1J75 A;  1BOA A;  1VTN C;  2L01 A;  2DO7 A;  2M30 A;  3L00 A;  1QNT A;  2CW0 F;  1HKT A;  3CTA A;  4HX7 A;  3QPH A;  3T8T A;  1HSJ A;  1Z1D A;  4NB5 A;  1IN8 A;  3ULQ B;  1B4A A;  3TGN A;  1YIO A;  3KZZ A;  3TKY A;  2VE9 A;  5K5R A;  1HBX G;  1FBS A;  1OYW A;  3V7R A;  4U0V A;  1Z7U A;  2P6S A;  4NHJ A;  3IKV A;  1YFH A;  5LRR A;  3V7C A;  3GF2 A;  2H09 A;  2IA0 A;  5DUK A;  5JI6 A;  1FBQ A;  5J8F A;  2EFO A;  2J5P A;  3L9F A;  3QOP A;  3OV8 A;  4PCQ A;  4HX4 A;  1X3U A;  5AIQ A;  5D6F A;  3H3U A;  2FOK A;  2RDP A;  5L3C A;  3E6D A;  3LA3 A;  3F8M A;  2EA4 A;  3FHZ A;  3QRF F;  4HDV A;  4UVA A;  1T98 A;  2GAU A;  2FA5 A;  4GGG A;  2ZKZ A;  5D5W B;  1BI1 A;  1K79 A;  2ZME B;  3WGG A;  4OIQ F;  1P4W A;  2KIF A;  5DCM B;  4GO1 A;  1T38 A;  5DD8 A;  1YW8 A;  5LRS A;  4P9U A;  4LB5 A;  5IT9 K;  4HBL A;  3RYR A;  5DYM A;  1JXS A;  1T6S A;  1WQ2 A;  2IPQ X;  2ZME A;  5ICE A;  2A61 A;  4L5I A;  3HOT A;  1S3J A;  5HS8 A;  4ZZD A;  2V1U A;  3T0Y A;  2UWM A;  3I53 A;  2XKO A;  2XGX A;  2HFH A;  3KZY A;  2D1V A;  3BRO A;  2FF4 A;  3HUG A;  4EQQ A;  2M45 A;  1W4M A;  4EJV A;  2EFW A;  3HHH A;  1D3Y A;  2B0L A;  2OD5 A;  3FF5 A;  3VOD A;  2JZY A;  4A0Y A;  1ZAR A;  3MQ0 A;  2JPC A;  4ENJ A;  1YO5 C;  1T39 A;  4HLX A;  1K78 B;  4YII A;  2JT1 A;  3CUQ A;  1D5V A;  2W85 A;  1ZG3 A;  2Q2E A;  5CVV A;  4CZZ A;  4HF0 A;  3RKX A;  3NRV A;  4M9S A;  2RKH A;  2GA1 A;  1G6N A;  1XN7 A;  2EV5 A;  2K7L A;  4E70 A;  5A2Q K;  5AIP A;  3BZ6 A;  1XGO A;  4QLC U;  1V4R A;  5DUI A;  3DQV C;  1Y0U A;  4A0Z A;  3JAM Z;  2NNY A;  2MLG A;  2XAF A;  3TOA A;  3GLX A;  3G3Z A;  2QBY A;  5HLH A;  5HVQ C;  5DDG A;  5AON A;  2CFX A;  1NHA A;  5HDK A;  4BHB A;  2L4M A;  4HDU A;  2BE5 F;  3IWF A;  4G7Z F;  2LF7 A;  3ECH A;  5KK1 A;  3C1D A;  4LB6 B;  1MJ9 A;  2GZW A;  3P7N A;  2ETH A;  1KU2 A;  4EVI A;  3O2P E;  4RB1 A;  3KFW X;  1GXQ A;  1ZRE A;  1ZLJ A;  4HOB A;  3LAP A;  4ESB A;  5IT9 Z;  2M5W A;  2OQG A;  2PQ8 A;  4KIG A;  1IF1 A;  4KMU X;  2P4W A;  1YW7 A;  4UNO A;  4WXC A;  1TQP A;  3HYI A;  4R8H A;  5FD6 A;  1ZH5 A;  3FZV A;  3DKW A;  3ZPL A;  1IXR C;  2D1H A;  2DPU A;  4ASN A;  2XIG A;  1XSV A;  1LNW A;  4L9N A;  2FBK A;  2EV0 A;  2HQN A;  4CHU A;  1QBJ A;  1ON1 A;  1SFU A;  3WE3 A;  4YG2 F;  4U88 A;  1AOY A;  1IN6 A;  1IRF A;  3TO6 A;  1QO0 D;  3F22 A;  1U6G A;  1YYV A;  3ZP5 A;  4EV0 A;  4RB0 A;  3C3W A;  2IP2 A;  3DV8 A;  5ED4 A;  3E5U A;  1R1V A;  2M8E A;  2R7F A;  1ZGJ A;  2HYF A;  5LEJ A;  2EK5 A;  2DI3 A;  4I7H A;  2VE8 A;  1B9M A;  4RB3 C;  2RVC A;  4BHP A;  2XAG A;  2A3S A;  2AXL A;  2YX7 A;  3HRS A;  4FHT A;  2KIU A;  2ZJ2 A;  1HST A;  1IW7 F;  1MD0 A;  2RV8 A;  4DNC A;  3V7S A;  3R60 A;  2V1X A;  3V8J A;  2W25 A;  3GYH X;  4KA4 A;  2O6G E;  3WTU C;  1YS7 A;  2NRA C;  1W5S A;  1OYI A;  5A2Q Z;  2KKO A;  2K4B A;  1O3Q A;  3BOQ A;  3CUQ C;  3CO6 C;  1F9N A;  3E6C C;  4PGH A;  3HTU A;  4RGX A;  2V6C A;  3RI4 A;  5D5U B;  1BI3 A;  2FEZ A;  2V79 A;  4QWQ A;  1EH6 A;  4HLY A;  4P96 A;  2OU2 A;  2LDU A;  2HTS A;  1WSU A;  3WU1 B;  4U7D A;  3F8C A;  5BMZ A;  2VT2 A;  1EH8 A;  1KYW A;  1ONV A;  3ABU A;  4Q47 A;  4ESF A;  3J80 K;  5E1X A;  4L0Z B;  3BWG A;  2LKP A;  2DU9 A;  2BGC A;  1Z9C A;  2KIM A;  1SD4 A;  4UVC A;  3W6J B;  4MHG A;  3CJN A;  1HKQ A;  2JSC A;  3I59 A;  3M9A A;  1FPQ A;  2EFQ A;  1G3Y A;  1IN5 A;  2FBI A;  1LEB A;  3NEU A;  4ESJ A;  2STT A;  3E6M A;  3ERE D;  4PZJ A;  1UFM A;  1I1S A;  5HLI A;  3F72 A;  2NYX A;  1S29 A;  3ELK A;  2PBI A;  1KU7 A;  3I54 A;  3G73 A;  4MEX F;  2A6E F;  3T5X A;  1J59 A;  3GZ6 A;  2DBB A;  4NQW A;  1XSD A;  4WCG A;  1O7L A;  5D8L B;  3IRR A;  1MGT A;  4I0B A;  3L7W A;  4O3M A;  1T2K A;  5LGN A;  1TQI A;  3QPT A;  4Q5S F;  2ZNZ A;  4LGW A;  2MLK A;  1XMA A;  3TQN A;  2DK5 A;  5J6X A;  4LG0 B;  1ZLK A;  4L18 B;  1G4D A;  6PAX A;  2YX4 A;  4ON0 A;  1AWC A;  3GUD A;  3F8N A;  3EUH A;  2JRT A;  4Q4Z F;  4RAY A;  3HSR A;  3NQO A;  3HRM A;  2GA2 A;  4B09 A;  4BH9 A;  2CYY A;  3WGI A;  3TOB A;  2DT5 A;  1ZAO A;  4ZZL A;  4ETS A;  4UV9 A;  2L4A A;  2ISZ A;  1R7J A;  2EWN A;  2A07 F;  3DFG A;  1U5T B;  3FM5 A;  2R7D A;  1FWZ A;  3P9I A;  1LDD A;  1SFE A;  4KIF A;  5D6E A;  2GXB A;  2L54 A;  3F8F A;  3HOS A;  2IT0 A;  5F6F A;  2WV0 A;  1U78 A;  1B1B A;  1FSH A;  3WG9 A;  2A69 F;  2WWY A;  2Z33 A;  3VOE A;  2ZNY A;  4CDG A;  5EEG A;  3BJ6 A;  1OMI A;  1TW3 A;  3N4M A;  1FC3 A;  3GEZ A;  1P92 A;  2JTV A;  3M8F A;  5FGM A;  4RGR A;  4JBA A;  5FFZ A;  1E2X A;  2FBH A;  2VBY A;  1YLF A;  1GVJ A;  3V8K A;  1A04 A;  3GXO A;  1UST A;  2O8X A;  3PQJ A;  2HOE A;  4LLL A;  3O6B B;  5D5V B;  2XAQ A;  3TDU C;  3EYI A;  5CVI A;  2ELH A;  2F5F A;  1XD7 A;  2Z3Y A;  5CJ9 A;  3JSO A;  4XSZ F;  5L3G A;  4IHS A;  2G7H A;  2Z99 A;  1ZN2 A;  2HS5 A;  4ENM A;  3ISP A;  4GXO A;  4EM1 A;  3MAJ A;  2ZCW A;  2QZ8 A;  4IVN A;  2P7V B;  1K78 A;  4HX8 A;  1IAW A;  5D5X B;  3IRQ A;  1ZHF A;  3R4K A;  2LSO A;  3GW2 A;  3RDI A;  5CVU A;  2E1C A;  3T1B A;  3F21 A;  2CQK A;  2QLZ A;  4LLG F;  5E20 A;  1XMK A;  3O3K A;  4XLP F;  3K1N A;  4WX9 A;  3WTX C;  3P9C A;  2PG4 A;  5ILS A;  1UCR A;  2VN2 A;  1YG2 A;  3TDZ C;  1SD6 A;  2UXX A;  2FE3 A;  2F5C A;  2NS0 A;  2RGV A;  1TNT A;  4RGU A;  4EMS A;  2G7U A;  5HOO A;  4G9Y A;  4PGG A;  4HW0 A;  2PEX A;  2J5O A;  3EDP A;  4KN7 X;  2A68 F;  5LEK A;  1QZZ A;  2ISY A;  5JR3 A;  3KLN A;  3U9G A;  1RI7 A;  3DEU A;  3MEX A;  3GZ5 A;  1DUX C;  2W24 A;  2FXA A;  1F1Z A;  3D5L A;  1FP1 D;  4CXF A;  2XKP A;  2Z5U A;  2HZT A;  1P6R A;  1Z6T A;  4L9T A;  4KT5 C;  1J9I A;  3IWZ A;  3HRU A;  3WTT C;  4G6Q A;  1ODD A;  2VXZ A;  4M74 A;  1S8N A;  4EJT A;  5FLX K;  2DAO A;  5BS6 A;  3KP4 A;  5FB2 A;  1MDM B;  1S7O A;  3COA C;  2FNP A;  1LJ9 A;  5F1R A;  2C6Y A;  1QGP A;  2ESH A;  3QU6 A;  3ZMT A;  3RPQ A;  3M1E A;  5E8G A;  2W57 A;  2H27 A;  2ZO4 A;  1TBX A;  3LFK A;  1FBU A;  1YTY A;  2FRH A;  3J81 K;  3FWE A;  1HW1 A;  4IRH A;  2YR2 A;  4O5V A;  2O03 A;  4HZF A;  2QVO A;  1QQI A;  3B73 A;  3GO5 A;  2EB7 A;  5L3D A;  1WWX A;  4HQM A;  2VOO A;  4IPA A;  4LK0 F;  4Y15 A;  2PJP A;  4EGY A;  1SAX A;  3B02 A;  2XUB A;  3FMQ A;  1BM9 A;  3FM3 A;  3RYP A;  4L5J A;  4LMY A;  2QQ9 A;  4HA8 A;  3WE2 A;  5FO5 A;  1J5Y A;  1P2F A;  2VOP A;  2QQB A;  1WI9 A;  1O3R A;  4A12 A;  2WC2 A;  5L3B A;  4AWX B;  3HRT A;  1W7P B;  3S2W A;  1YQA A;  5LHG A;  2OZU A;  1ZGA A;  5E18 F;  5H6Q A;  2UZK A;  4WXH A;  1L3L A;  4XLN F;  4XBF A;  4MTE A;  1C0W A;  5F64 A;  1R22 A;  1ZG5 A;  2QBY B;  1ZYR F;  1TLH B;  1GXP A;  2CO5 A;  3K1P A;  4PDK A;  1H0M A;  3SZP A;  4HV5 A;  1UHW A;  2PFB A;  1IXC A;  1E17 A;  3Q5F A;  3M8E A;  1TW2 A;  1EV7 A;  2LNB A;  3E97 A;  2VBZ A;  1MJB A;  4RB2 C;  2MC3 A;  3P9K A;  1L0O C;  1YS6 A;  1MZB A;  1CGP A;  5E17 F;  3F8B A;  4M9Z A;  1B6A A;  4OIP F;  4L9V A;  4MGR A;  1R1U A;  2AS5 F;  4G94 A;  3JTG A;  4XSX F;  4G7H F;  2YU3 A;  1JE8 A;  3W6K B;  1DPU A;  5JFR A;  2Y75 A;  4OMY A;  2XRO A;  5JHU A;  2DW4 A;  1FYK A;  3QP5 A;  1FYM A;  1BBY A;  5LHI A;  1QZY A;  3HHG A;  3J81 Z;  3C7J A;  4BHC A;  2NAZ A;  5ILU A;  1R23 A;  1XCV A;  1MDM A;  1FLI A;  3E5X A;  2P5L C;  3F6V A;  1CF7 B;  1SD5 A;  3LAJ A;  2OBP A;  2XAH A;  4GYG A;  3SFZ A;  3J7A O;  2HKO A;  1JHH A;  1RZ4 A;  2XHK A;  3WTV C;  4IXA A;  3CO7 C;  3IHU A;  4P55 A;  4I2O A;  2G9W A;  1ZG1 A;  3FMS A;  2IW5 A;  3C18 A;  4MNU A;  2EV6 A;  3RIR A;  2GQQ A;  1F5T A;  2DQR A;  1S7A A;  3TO9 A;  2BEO A;  2VC0 A;  4N9H A;  5J8C A;  4AD9 A;  2CG4 A;  2O3F A;  2GXG A;  2P7C B;  2XRN A;  5LGU A;  1Z91 A;  4MEY F;  3CUO A;  5LHH A;  3HSE A;  1KU3 A;  2W84 A;  1STZ A;  4TV7 A;  1BIB A;  1FSE A;  2RN7 A;  1R5H A;  1U5T A;  2DFI A;  5D4R A;  5TRD A;  3BPX A;  3E5Q A;  4ZYH A;  4Z2Y A;  3GFL A;  2HGC A;  4YFK F;  3HIF A;  4XRF A;  1CF7 A;  1KYZ A;  1LDK B;  3QU3 A;  3K69 A;  3MFK A;  3I5U A;  1R00 A;  1SMT A;  4EJO A;  1TTY A;  2A5Y B;  3MZY A;  3KP7 A;  5IT3 A;  3KCC A;  2L02 A;  4HQE A;  1IUY A;  3KP6 A;  3HSF A;  5FFX A;  5DD4 A;  1EH7 A;  4A6D A;  2Z9O A;  1FP2 A;  4M9X A;  3I59 B;  2HR3 A;  4MQV A;  4M72 A;  3EQL F;  2FQ3 A;  1JHF A;  1REP C;  5HDN A;  4UXN A;  4U7B A;  1O3S A;  3I58 A;  1KU9 A;  5DV5 A;  3KP5 A;  2L3D A;  4M73 A;  1ZRF A;  3I71 A;  3FX3 A;  3PQK A;  3I64 A;  3DF8 A;  5L3E A;  2ZBK A;  2HEO A;  2K02 A;  1OPC A;  2Q0O A;  1LVA A;  2FNA A;  1Z6R A;  3Q9V A;  2GIV A;  4UHT A;  1YW9 A;  1WRJ A;  3QAH A;  3V8L A;  2F2E A;  3QP6 A;  3WU0 A;  1B9N A;  2O0Y A;  1DP7 P;  4H0E A;  3LQQ A;  1OYY A;  1IN7 A;  4LLN A;  3F6O A;  2DPD A;  2FSW A;  2HYG D;  5JVT A;  2RC4 A;  4A0X A;  1XSX A;  5D4S A;  3I0T A;  5BPD A;  4KIC A;  4S05 A;  2R3S A;  1KQ0 A;  4M6Y A;  1RUO A;  3MCZ A;  4UVB A;  3E3V A;  4D0P A;  5ILV A;  5HDG A;  1BI2 A;  2D45 A;  2NNN A;  3AAF A;  4KYW A;  5FD5 A;  1FNN A;  2H94 A;  4ZYG A;  1G3T A;  2OZ6 A;  1LB2 A;  4AIJ A;  1ZRD A;  1SMY F;  2O61 A;  3D0S A;  4RGS A;  5HS7 A;  4Y13 A;  1FT9 A;  4GYI A;  4JQF A;  2IA1 A;  2F5D A;  5H20 A;  1HW5 A;  1I27 A;  4ZYD A;  4I01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...