2K3FA

Ribosomal protein l11 from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
b'MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L11
molecule tags Ribosomal protein
source organism Thermotoga maritima
publication title Domain reorientation and induced fit upon RNA binding: solution structure and dynamics of ribosomal protein L11 from Thermotoga maritima
pubmed doi rcsb
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2k3fA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2k3fA01
3CCQI 2QA4I 3CCSI 1VQ5I 3EGVB 3CD6I 3CJRB 3CCLI 2E35A 1VQ7I 3CCUI 2E36A 2ZJQF 2E34A 5JVGF 1YITI 2FOWA 1YI2I 1ACIA 1FOYA 5GAEJ 1VQNI 1VQLI 1HC8A 3J7ZI 1VQ8I 3J7YJ 2JQ7A 4IO9F 3CMEI 1YHQI 5DM6F 3CJSB 1VQ4I 3CJQB 5GAGJ 3I56I 3G71I 1FOXA 1YJ9I 2K3FA 3PIPF 2ZJRF 1WIBA 3CCVI 2OTLI 3CCJI 1YJWI 1VQOI 3CJTB 2OTJI 1VQMI 3G6EI 1YJNI 5GADJ 1FOWA 1VQ9I 3G4SI 3CCRI 3CCMI 2QEXI 3CC2I 4V19K 3CC7I 2ZJPF 4IOAF 5DM7F 1YIJI 3I55I 3PIOF 1VQ6I 3CMAI 3DLLF 1Y39A 2H8WA 5GAHJ 3CC4I 4IOCF 1MMSA 3CF5F 1S72I 1QA6A 1VQKI 2NXNB 1VQPI 4UY8I 3CCEI
chains in the Genus database with same CATH superfamily
3BJOA 3ERMA 3QP6A 4Y15A 2QGUA 3HPGA 3I5UA 2M5WA 1FY7A 5EEHA 3KP5A 2R7SA 2CV0A 4YRVA 2RV8A 1M1EB 2QQBA 1GUUA 4BS9A 4IRGA 1K78B 1D0YA 1XB4A 1ZAOA 2EV6A 1FSEA 2WV1A 3CUQC 1I27A 2ESNA 3WTTC 3OYBA 1WI9A 1G3WA 3W6KB 4HRIA 4OMYA 3LSMA 1XD7A 3E5QA 2MH9A 4AIHA 3JAMK 2QBYA 5DCMA 4LG3A 3GBGA 2FX0A 3TKYA 2Y69H 2F4MB 3TOAA 2IRFG 3IH4A 4A0XA 4F52A 4JK1X 3F8BA 2VKDA 3H36A 1MIJA 1LNWA 4B09A 3Q9SA 3ONQA 2BHZA 1G6NA 3QODA 2YX4A 4OWRB 2IS2A 4G6DA 3F8NA 3G73A 1DU0A 5F27A 3CESA 1EA3A 2LVSA 1T38A 5HLTA 3OWTA 2CW7A 1BIAA 4PUSA 1R9TJ 4PFOA 2X51A 2HGCA 2RQQA 5EEAA 1QNTA 4HSRA 2NYXA 2A61A 1IW7F 1SFUA 4Q5SF 3DPTA 1HW5A 1HW2A 2ZKZA 2AS5F 1OCRH 5H2FC 1XDSA 5FJ8J 4BHBA 2L7KA 2XGEA 5E3NA 2FBKA 4Y7NJ 3U1DA 2OTJI 2LREA 3FX3A 2DA4A 1VQMI 1O3SA 2ZMEB 1OLTA 4LB6B 2VQGA 1U5TA 2GZWA 3M1CA 5J6XA 4A3DJ 4BKXA 2LKSA 3GFJA 4WXDA 1EH7A 2L54A 4WXHA 3FK7A 4FETA 2QEXI 5BMZA 1FYMA 4GDFA 4XN3A 2W82A 4I0BA 3V7RA 2STTA 1KU2A 4G6TB 5CVIA 4O6JA 1P6RA 1W7PA 1NH3A 1ZH5A 3GZ5A 1E0EA 3PJRA 1B6AA 1X2MA 2BVMA 3GEZA 2GAUA 4FHTA 2XROA 2B0LA 2DW4A 3CDHA 1NK2P 2GQQA 3S1QJ 1HSTA 2VC1A 1O57A 2KPMA 1DP7P 4CSWA 1BI2A 3NARA 3I59A 1OKRA 2CW8A 2MH2A 2DT7B 5HOOA 4EJVA 1U6GA 2HOSA 2EA2A 2A69F 1Z7LA 1S7EA 5J1RA 3L2RA 4BXUA 2QA4I 1U8BA 5HS7A 1MNDA 3CJRB 1YS6A 2Q2EB 1QZZA 2RN7A 4XSXF 4XN0A 1BI1A 2V7FA 4A6DA 4I2OA 2Y0SA 4A5NA 2ZMEA 4Y4RA 3MFKA 2ECBA 1T0FC 1ZGWA 3CUOA 3IKVA 5J8FA 4G7HF 1IN8A 3VB2A 3S1NJ 3SQNA 3K69A 1X4OA 1EV7A 2A68F 5KVRA 4HF0A 4Z6YA 2PJRB 1TLHB 4F7ZA 3JRHA 3JRDA 3HZJA 4KYWA 4MFEA 2KDZA 2EQRA 4YIIA 1YOVB 3HSRA 3OS2A 1VI0A 4PJJA 3KE2A 2IT0A 3DF8A 4CCOA 1LVAA 4UHTA 2OUMA 1MH3A 1FBSA 3HC7A 3TL4X 1OYYA 1UHWA 4JQFA 1MBJA 4JP0A 3JAMZ 3S93A 4IEJA 2X4HA 3BR5A 2W84A 2R7VA 3T8RA 3CJSB 1VQ4I 5E8IA 1Y56A 3GFMA 3F9KA 3C7JA 3BZCA 1OQYA 5KCMA 3VSKA 1MBKA 5FD6A 2WAQN 2WY8Q 2EZLA 2R92J 1IO2A 5DUIA 2DQRA 5LD2C 3CCVI 3RKQA 3B6CA 4FCYA 2OD5A 3DU6A 4C3IJ 1R1UA 5D5UB 4U0WA 2X6WA 2VB6A 3FZVA 3BPVA 2HYJA 2OJED 1K61A 4RB3C 4Q48A 1R36A 2DA1A 2QLZA 4MFDA 3M8JA 4LOCA 1FC3A 2ZXWH 1TT0A 1D3YA 4QLCU 2DOEA 3FXKA 4C2TA 2W25A 1BC8C 1UMQA 1Z7UA 2FD5A 2IJLA 2NVXJ 1FNNA 4V2FA 2CGPA 3HM5A 1BR1A 4A3KJ 2COBA 3K10A 5J40A 2H1KA 4PSWA 4GO1A 2XPWA 2LBFB 3JRGA 1E3PA 3AAFA 3W2WA 2AQFA 1TQMA 4LD5A 4OMZA 4EMSA 3WTUC 4UXNA 2Y48A 2R5YB 1F9NA 2G9WA 3LAJA 1VQPI 1RPWA 2VL8A 4P5OA 3CCEI 3ERED 3LA2A 3CCQI 3IAM2 2LK2A 2DOFA 2DTZA 4M6YA 3OS0A 4XKWA 4UUTA 2LOOA 3VODA 4ZTJA 1Y6IA 2A6EF 2DMPA 4E7ZA 3F21A 3SZPA 3LFKA 3WU1B 2OPTA 1OMIA 4BJTA 3K4KA 2KRCA 1Z77A 2ME6A 2NVTJ 2V4JC 5FD5A 2ZFWA 4CZZA 2VC0A 1IDYA 3WHCA 2E60A 1F1ZA 3A1YA 2LH9A 2LYCA 3S32A 1ULYA 1BL0A 4OOIA 1YIOA 3BY6A 4U7BA 5FRNA 3GXOA 1JKOC 2PMUA 4BEHB 1YX3A 3IUOA 4IL6C 1IUFA 2D2WA 2F5VA 3AG2H 1ONVA 1XN7A 4IHTA 5JHFA 2BGCA 1JHHA 4RDUA 4N0BA 2R5ZA 4HG2A 4Z2YA 3FHNA 3OIPA 2ICWG 3MMYB 5EGOA 3OYNA 3FHZA 2M0MA 2RREA 4KJZA 1HKTA 3FBIB 3HBLA 5LFAA 1QPMA 4Q47A 1ON1A 4QWQA 2MC4A 3LMMA 1EJ9A 3MD2A 2KLOA 1D1BA 4ESBA 3D1NI 3V7SA 5IP9J 3K4JA 5JFRA 2ZSHB 5A2QZ 1NHAA 3SJMA 2W00A 3MEXA 1GV2A 2OU2A 3VYTB 2VBZA 1W0TA 1QHHD 3ZQQA 2JZYA 2QCOA 3O2PE 3I4PA 1GXQA 3E0JB 4WCGA 3HTSB 3OV8A 3MQ0A 2XAFA 3COAC 1PDNC 3TDZC 4AYBA 1EH8A 5LEKA 5FO5A 1MSFC 4JOMA 2WA0A 2K3PA 1MBEA 2V9VA 4XKCA 1D1CA 1ZG3A 2FU4A 2IAIA 2XASA 4MTEA 2EJRA 2FNAA 2G7HA 3KP3A 4S05A 2K5CA 3E6MA 5IT3A 5CVRA 3P9KA 1VZ0A 1LDDA 3DLAA 1Y39A 2RQPA 2Y9ZA 4QIWN 2DI3A 4EJTA 1MNEA 5CQEA 2F5FA 3CF5F 2X48A 2E2HJ 3S3NA 2XDVA 3HOWJ 1Z05A 5IYBJ 2A6TA 2H94A 2X6XA 1IV6A 1WRJA 4L5IA 3BPXA 1F43A 4RGXA 5LGNA 3QYBA 4IHXA 4P1WA 1DU6A 4UB6C 2JVHA 3O8GA 4IF4A 4Y33A 1PVEA 3K4CA 3WE3A 2LMDA 3K4LA 2B63J 4I76A 2NVQJ 1E3OC 5LHHA 5BOXA 1K4SA 2M30A 3IV5A 2TCTA 4ESFA 3L2UA 3WGGA 4KIFA 4M3GA 1LFBA 4LFUA 2M1BA 3T8TA 5DV5A 1OYIA 4KIBA 1YLFA 3MWMA 2FNPA 4I09A 3BZ6A 4RGUA 4BQAA 2DDAA 5CVUA 3R4KA 1RR7A 1Z67A 2LTPA 4C9YA 2VPRA 3BT9A 3ZMUA 2UXXA 3BP8A 1BOAA 4PGGA 1W36C 2M3AA 3C18A 3ULQB 2KJBA 2KL4A 3I54A 2DPUA 1OCTC 5FKLA 3H1CA 4BBRJ 2JA6J 3E1SA 4MEYF 3OOUA 1NG7A 4C3JJ 1DQUA 5J47A 1QGPA 2PI0A 2XF5A 2EPFA 4IKFA 3F6VA 1GV5A 2X1EA 1XCBA 3E6DA 2E7XA 5DEQA 5IY5H 2FF4A 4KIGA 1R58A 3K6GA 2JMWA 4OIPF 3ZOBA 4KITB 4DIQA 2QVOA 5F0CA 3GX4X 3HXLA 1I3QJ 3PSFA 3T5XA 3K70C 1I6HJ 1DDNA 4KMUX 3OYKA 3FXMA 4PJMA 3IWZA 4RM2A 1XPXA 3PO2J 1GVJA 2DMTA 3FKJA 3VYSB 4ANJA 4YG2F 4IRIA 4BJ6C 3ABLH 4ITVA 3ROUA 4OIOF 5F1JA 1XGOA 3E5XA 3OMYA 4ZDPA 3P9CA 4ZDOA 2PQ8A 5KNLA 1V5EA 5LGTA 4TV7A 4DW6A 5HLHA 5EG0A 2HTSA 1UCRA 2TDXA 3HHHA 2NNYA 4FQGA 1MMAA 2GLOA 4IHSA 2H6BA 1YIJI 1WJAA 2V6CA 5KK1A 4DYRA 2HNHA 2HVQA 2A6HF 3LA3A 5DYMA 5E3LA 4EGZA 2O8XA 4ZYAA 1U78A 1KA8A 4LK0F 3CMYA 2KIMA 3MAJA 4EJOA 3EUHC 3DU5A 3AFHA 2ZXJA 2YU3A 2VOPA 5B66C 1JT6A 2BW3A 2PJRA 1L0OC 2BBYA 2XAQA 2V1UA 2HKOA 4E7LA 2WB1A 3CCSI 4QSHA 1FIAA 2FQ3A 1SD6A 3FXLA 1SD4A 3FM5A 1XDUA 3H9QA 1VQ7I 2XF7A 3DTKA 3GTQJ 4YFKF 4XLAA 1LFPA 2E36A 2G0EA 3KETA 3TP3A 3LSIA 1JJ8C 1LVKA 3A01B 2OCEA 1Z1DA 4M74A 2L02A 2ELHA 1S7AA 2IEKA 2CUZA 1TNSA 5JVTA 4A3GJ 3RKWA 3CQZJ 3CF2A 4Q4ZF 2XV4S 1WPKA 5CLSA 4CHUA 1VQNI 3R0AA 5EEGA 1FT9A 2JUGA 3M4OJ 3A4CA 2DFEA 3J7ZI 5HS9A 2W85A 4AD9A 1ZKGA 1B9NA 1ORKA 1OR7A 3ZQGA 3HJEA 5HLIA 4XSZF 2PFBA 3OYCA 3GYHX 3OS1A 2EV5A 2HYFA 2V26A 5D8LB 1SVLA 5CQGA 2VONA 3I3LA 4DOZA 4A0YA 4E4HA 4NBQA 1VFCA 1QVUA 1BJAA 1BI0A 4UVBA 1N25A 3F0CA 3W6JB 1PJRA 1Z91A 1R23A 2DYRH 3RJPA 1T2KA 1KGSA 2VQLA 5FLXZ 3S3OA 3RPUD 1L3LA 5KHDA 2DLLA 4A69C 1GXPA 2GM4A 2X6OA 1AKHA 2IGKA 5GADJ 1IV8A 3SFZA 1ZGAA 4XIDA 1YS7A 4H4KC 2KRHA 3CCRI 4G9YA 1ZGJA 1Z0XA 1H0MA 2R5YA 3CC2I 3DKYA 2Y0MA 1BJZA 1XMXA 2D5VA 4HX4A 4BQNA 1BN5A 1R4MB 2DJNA 1TL8A 4RLFA 3PIOF 2QSHX 1MMDA 4LG0A 4AIDA 3ZQ7A 3TO6A 4I02A 2QSFX 3ABUA 2E5NA 2HKXA 3GW2A 4FASD 4OINF 2UUZA 1YFHA 1D0XA 1GT0C 2YR2A 3CDLA 1LDJA 3BOQA 1LQ1A 1T8IA 1O7LA 5K7HA 1B72B 2XSJC 1DPUA 3CZ6A 3UNGC 1YTYA 3VFZA 1WWXA 4Y17A 1TQIA 2R7UA 2E35A 1MH4A 3BLYA 5HVQC 4A5MA 1UZCA 2EIMH 3RCOA 4E7KA 1XX5A 1I6XA 2QSGX 3LA7A 2ELKA 2DMNA 2XRLA 2CW0F 2QQ8A 3NQOA 3J80K 1FSHA 4LLGF 5FGMA 2E34A 3TO9A 4XOTA 4EJUA 4UV8A 2GXAA 2L0KA 5A2QK 1B59A 2XAGA 2E1CA 2LDUA 3M8EA 3DKWA 1N75A 2JPCA 5BPIA 1XS9A 5FLMJ 1LE8A 3WTZA 1N78A 3BTJA 1J0RA 3EQLF 1MD0A 4OIQF 2DMUA 1WH7A 2D45A 1ETQA 2GXGA 1FOYA 2DA6A 2L3DA 4CA0A 4DZPA 2FXAA 5FKOA 4XRSA 3TDUC 4DYCA 4E7HA 1HSJA 2E1NA 5E1WA 1AWCA 2PEXA 2VKHA 4CCLA 4YFNF 5JI6A 3OYHA 1Z3YA 2ETHA 4CCKA 1JE8A 4GYGA 2XUBA 4CGZA 3A0HC 1XGNA 3A01A 1ZG5A 2IA2A 5DM6F 4FX0A 3S15J 2YPRA 2K7LA 3VWBA 1POGA 1W5TA 3NEUA 2M7BA 1FP1D 1O4XA 1ITYA 2P7VB 4F92B 3OYIA 1MMNA 2NVUB 4J00A 1ZELA 2VXDA 2KHMA 4CICA 3OYLA 2L5QA 1R71A 4CCJA 2Y30A 2CYYA 2IBDA 3I64A 1AHDP 1OJLA 3TOBA 5K5RA 3HRMA 2R5ZB 2ZBKA 1J09A 3D5RC 2OCCH 5M5WJ 4OU0A 3DP7A 3LQRA 5D5WB 1YRNB 3PNVA 2OZUA 1TQPA 1OR7C 2VJJA 2F4IA 1WJ5A 4MNUA 1JI8A 2COMA 2M8GX 2MSYA 2XGCA 1USSA 3HOZJ 3DWLE 1HQCA 3CO6C 1P2FA 4C2UA 4MEXF 1VNDA 3NAUA 2HQNA 2J5PA 3DEWA 3AKZA 1RNLA 4IOAF 3WE2A 2KP6A 5CVJA 5K7FA 3DPLC 3ELKA 4DQ2A 2JA7J 1YQAA 3RI4A 2CV2A 4XMYA 3DLLF 2FE3A 2VBXA 2EIJH 3TEDA 2N8GA 3P5JA 3GFIA 3MCZA 2ZJ2A 3KEQA 3ZRGA 4HZFA 5D8KB 1T33A 3C1DA 3K7AJ 3HG9A 5K5QA 3RPQA 2QM3A 2OZ6A 1E2XA 1IGNA 1RUOA 2DFIA 2GBYA 1BR2A 4B3AA 4CCNA 1WJEA 4E70A 4O3MA 2NXNB 3BTCA 4RB0A 1V5FA 4BH9A 2DA2A 4J19A 2K85A 2BXYA 3KYDB 4IZZA 1WQ2A 2GOXB 1Q1VA 4IRHA 2L9VA 2HDDA 1VQ5I 5B5EC 2RAEA 1MSEC 2QUFA 3I4NJ 1V55H 1C0WA 4BDZA 1ZR4A 5IOZA 4KFCA 4CYCB 4L0YB 3IRRA 3V8KA 1BW6A 1HCRA 3BQZA 5GPCA 3LL7A 2HTJA 3F22A 3CLQA 1F36A 2M87A 3BR6A 3QAHA 1SFKA 2CV1A 3TBIA 4G6QA 3JRIA 2HPMA 2KIQA 4R1HA 3U21A 1SANA 2Y9YA 3WTVC 3QPSA 4ZH4F 4I01A 4U0VA 3BR2A 4BBSJ 3QPLA 2WAQA 1JGGA 1DPRA 3A03A 4S0HB 3PL8A 2MLKA 3G1MA 2DTRA 4HX7A 3J81Z 3KCCA 1YE9A 1YX5A 4ASNA 3C3WA 1R1TA 1G8XA 2JRMA 2DFFA 2ESHA 3ZMTA 5HDKA 2H27A 1GDTA 2JJ7A 2HQ5A 4RAYA 1AOYA 2X0LA 2IS1A 2Q1ZB 1I39A 5IT9K 3SZGA 1BA5A 4KICA 1PUFA 4GYIA 2H1LA 3CP2A 4XK4A 2ID3A 1XMAA 2PX9A 2MD5A 3BTIA 3HSEA 5D6FA 5DD8A 4L9TA 2RGVA 1LEBA 3CUQA 3KP2A 3CCJI 5JLXA 2LF8A 3AG3H 2G7UA 5D4SA 3G1OA 4LK1F 1IJWC 5FKMA 1W5CC 2K4JA 2RNJA 2CG4A 3M1EA 3H3VK 5LHGA 2P7CB 2A07F 4A2UA 2IVMA 2JT1A 2XGDA 2I10A 4B3XA 3EPZA 1FLIA 2MD0A 3S2WA 1FYLA 2ZCWA 2KT0A 1K6YA 2OA4A 4M71A 3WTYC 3A2KA 3PSIA 4HF2A 1A6QA 3KP4A 3LSJA 1TT5B 5DM7F 5L3FA 5TISC 4BXXJ 5D4RA 4C2MJ 2DPDA 1CF7A 1BM9A 4PCQA 2Y31A 3FDYA 1STZA 4RA2A 4NQWB 5J3LA 2ZO4A 2JA2A 2E2JJ 3FXUA 3VSLA 4UY8I 1WJDA 3ZR8X 2L01A 3FMQA 1TTYA 1OYWA 5M3FJ 1S3JA 1FPQA 5DS9A 3IH2A 4IJAA 3EGVB 1RI7A 3CD6I 4AC0A 3RYRA 5FB2A 2Y2ZA 1A35A 1WVRA 4L5EA 2QQAA 5ILVA 2JSCA 1ZTRA 2Z2SB 2FUG2 1LKXA 1P7IA 2K9MA 3BG6A 4XM3A 1YRNA 1PP8F 1D8JA 3ABTA 3AG1H 5C4XJ 4X1EA 3ZQHA 4XBFA 2FOWA 1Z21A 2CUEA 3OYFA 2JK3A 1YI2I 3GTLJ 5C3EJ 1LFUP 3Q0VA 1S7OA 3ZPLA 3ECOA 5FKNA 2VN2A 3BROA 5HNFA 3S8PA 1WGXA 1JKPC 4DJAA 1VQLI 1HC8A 3HTUA 1S5LC 2LF7A 3Q0WA 1JUMA 1FTTA 3SXYA 3FBNB 3J7YJ 4YFXF 1X1AA 1DUXC 4XLHA 4WWCA 3BWGA 2KMUA 3IWFA 3KZIC 4HQEA 5D6EA 2EB7A 2P8TA 2L4MA 4FX4A 3JR9A 2AO9A 4BEHA 1G3TA 4M3EA 2DK8A 2O3FA 2Q2EA 2JA5J 3I58A 1UG0A 2D1HA 3C2GA 3A02A 4UVCA 5GTHC 3KEYA 4XKVA 2R4GA 1QU3A 2V1DA 2CRGA 2HDCA 1XG1A 5M5XJ 3RTRA 3QOEA 3KIOA 4C30A 2ID6A 3G6EI 3K1MA 2KZVA 2DFHA 1X1DA 2XPUA 2VI6A 5ILUA 4UUSB 4E7JA 3G4SI 4XL9A 4CYDA 3U9GA 4JX4A 4BNCA 4E7SA 3FXRA 1MMGA 4EEFG 1FIPA 1YG2A 4XLCA 3JREA 3H0DA 3OR1C 1Y1WJ 3ZGKA 3I55I 1RIOH 2CS3A 2HXIA 3JTHA 5E1XA 1NK3P 1UELB 4BQQA 3UKGA 4M3BA 5ERIA 2H09A 4II3A 5CJ9A 2QKLB 3KLOA 4RAZA 2L7MP 2H8WA 2PMZA 4KN7X 2FRHA 4F91B 3L7WA 2GXBA 1D1AA 2LLKA 3CC4I 1ETOA 4I7HA 4RGRA 1ETXA 3ZN0A 2K9NA 2XGXA 2GIZA 2DOAA 2F2EA 2HU9A 3K1NA 1K79A 1G2HA 3H35A 1BIBA 3CMMA 3BCBA 1HBXG 1ODDA 1AA7A 2DU9A 2R0QC 3IL2A 2QF7A 5IYCJ 5CVVA 1EF4A 2P5KA 2I8DA 4B43A 4B1RA 5JLWA 2VJ5A 4NUBA 4BAYA 2HXOA 2IXSA 3D5SC 1K78A 4BJ5C 3QYEA 5ICCA 2QYOA 2K4BA 3K0LA 2HQRA 1XSDA 2MFZA 2KISA 5H20A 1SD7A 4RM3A 2NAZA 1SMTA 3CO7C 4KNYA 4GFBA 3H9GA 4LLLA 1USTA 1ZLJA 1I1GA 5F0HA 1IDZA 3HYIA 3ZCOA 3M8FA 3LSTA 1EKEA 1BBYA 4KT6A 5GPAA 2ELJA 3BJAA 2ZNZA 1J9IA 1S6LA 4LB5A 4WK8F 2BE5F 2EFQA 3HRUA 2HZDA 1T39A 1KQ8A 4CH7A 1HDDC 3I9V2 4ZZDA 1R5HA 3HSFA 1H9GA 1A6IA 1R1VA 2GA2A 2IP2A 4I99C 2VJ4A 2M7AA 3N4MA 2R7TA 1KU9A 3BR3A 3RQ4A 4KMFA 2IGNA 5IP6A 5FFZA 3VDXA 3BG3A 3OYEA 3FIWA 1YJ9I 2P5LC 1PUFB 4ZYDA 4HX8A 4RBOA 2R7DA 3M7GA 4DYQA 4I6ZA 1CQTA 2YSRA 3IKTA 3QQAA 4PJ0C 4BDYA 2BXZA 4ZYHA 4HSTA 1XSXA 1RKWA 2PG4A 2WBMA 1X58A 5DUKA 4XICA 4BL0B 1A04A 2DDBA 3QU3A 2XB0X 5DD4A 1WJFA 4G7OF 1OISA 5L3BA 4J01A 3QYFA 3FXJA 1U3EM 1HKSA 2MYSA 2Z16A 4EM0B 1WJBA 5EYRA 3CCMI 5KAIC 4GRIA 5FFXA 3IC7A 3PM1A 4KN4X 4IHVA 2DQLA 2ZJPF 2HPIA 1J5YA 4BYYA 2EINH 1R49A 3F8CA 2E19A 1O7FA 1W7PB 3DV8A 4RB1A 4IX7A 2FSWA 1H89C 3W3CA 3K2ZA 1UHSA 2CUFA 1SVOA 2FQ4A 1WH5A 1G3YA 2HI3A 2HOAA 1WJCA 4EM1A 1IN5A 2EFPA 2EZIA 4BU2A 5ILSA 4EATA 1I50J 3A0BC 3VEPA 4S04A 2H6CA 4YIRX 4D5FA 5D5VB 3G3ZA 5GTIC 1K83J 1TWAJ 4QTRA 4L9NA 4XLFA 3BR1A 5FLXK 4MLOA 3MZHA 3WTSC 3REOA 3IP4B 2UZKA 3PNYA 1R00A 1ZREA 1FTZA 1PUEE 2BHYA 4BY1J 1B4AA 1ZARA 3BZKA 2EBIA 3CCUI 3RIRA 3LSPA 4HDVA 4HA8A 5K5OA 2R7WA 5FLVA 1QZEA 3WG7H 1LEAA 5AONA 3DPUA 2BY0A 3KLNA 2BY1A 4ZYGA 4YIFA 1MW7A 2VE9A 4EV0A 3L2CA 1D5YA 1GVDA 1ZRDA 2L9NA 2FEZA 4JBAA 4P55A 2Q8KA 1BW5A 3ZMVA 4RAFA 3SEZA 2VKVA 4OAZA 1S9HA 3KYLA 1TZLA 1UB9A 4D7MA 3W2VA 2LY9A 1IAWA 3GTGJ 4RB2C 1RR8C 1P4XA 3OIQA 2DA7A 4ZDLA 3HRTA 3MKWB 2LY2A 1FZPB 2LD5A 1YYVA 4ENJA 1V5GA 1SFXA 2DBBA 3VYUB 1QPIA 1JJ6C 3S1MJ 3K70D 1TBXA 3FWEA 4D7NA 1IXRC 1X3WB 1F4KA 1KYWA 4AIKA 5L3GA 1YHQI 4HV6A 3RPUA 1AKHB 5DTDA 3L9FA 4EQQA 3SZTA 3JSOA 4Y3OA 3TW6A 3WHBA 4HW0A 3T1BA 3G71I 3N05A 2KIUA 2K3FA 1O3TA 2K86A 1ETVA 2OV7A 3FKIJ 4HAMA 2BW3B 2MC3A 1YW8A 1FWZA 4QPOA 3RDIA 3I4MJ 3WGIA 2ZJRF 2DXIA 4F55A 3C2BA 1WIBA 3QPHA 2F5EA 4N9IA 1U8RA 1XTAA 3CDIA 4HPQA 1R5ID 3FXOA 2OTLI 3EDPA 4HYEA 4JX6A 4CUGA 2RKHA 1VQOI 3S1RJ 3TW7A 1NG6A 3EUAA 4AVZA 1WI3A 1FOKA 1W7PD 3GF2A 5KAFC 4UV9A 1IN4A 2IPQX 1W5SA 2Z99A 3IH3A 3KFWX 1FYKA 5C44J 2R93J 3ESWB 3U2RA 4O5VA 4DZJA 4G12A 3WG9A 4PJLA 1X19A 3H5NA 4UB8C 2Z33A 3RZDJ 3Q5FA 4YEJA 2JUCA 1VQ6I 1JGSA 3DBHB 3MN2A 3UR3C 2A5WA 1B9MA 3R61A 2PN6A 3DCFA 5J1UA 2R7FA 4RLQA 1OCZH 1IRXA 1SFEA 2RC4A 3I0TA 4IOCF 3RKYA 1K4TA 3W2AA 1W1WE 1QA6A 2ZXHA 3CP8A 1RZ4A 1SD5A 2VT2A 3F8MA 1HF0A 4PJNA 1B8IB 1RUNA 2HQAA 2O9LA 1JXSA 4LJZF 4XONA 1APLC 3GUDA 1FP2A 3HOYJ 3GTMJ 2E1MB 1ETYA 2BOLA 3KYCB 4DGWB 1UAAA 3LFUA 2CQNA 5LRSA 4ZTFA 1HXDA 5LHIA 3BTLA 1ERDA 5TGTA 3CCLI 2F48A 4CXFA 4P9FA 2P81A 4AIJA 3PO3J 2XSDC 2LY1A 2A5YB 2BYVE 2V6EA 1J75A 2FBIA 2CQXA 3ZMSA 1JTYA 1HKQA 4MTDA 5EZHA 1TWGJ 1W0UA 2CQ7A 1JUSA 3BCAA 5JVGF 2RVCA 4WF2A 2R7ZJ 2NNNA 3LSGA 5JHUA 2VODA 4PZJA 5TJJA 3X2QH 1I3AA 1TWHJ 4XORA 2UWMA 4AUXA 3S3MA 1SAUA 4U88A 3O3KA 4L9JA 5GAEJ 4U7DA 2OC6A 1TC3C 4C3HJ 2PBIA 2BEOA 2HYGD 5DCFA 1W4MA 4BXFA 3HOVJ 1XMKA 2P6TA 3GTPJ 3EUHA 1ZYRF 2WV0A 4A3BJ 4L18B 3PUFA 5ICEA 4N4OB 3V4GA 4BE2A 3E97A 3KX2A 5D5XB 2KQRA 2V79A 3IRQA 1FOXA 2VBYA 3HPHA 1B1BA 1F5TA 3BR0A 3R6SA 2LFBA 5BS6A 4DBQA 3ECHA 1OCPA 4HNTA 1JUPA 4RMNA 2HWVA 3GVAA 3HGYA 1KQ0A 4KDPA 1U2WA 3OR2C 1P4AA 2QWWA 3VOEA 3HOSA 1IG7A 3GWZA 5AIPA 2AHQA 5EF6A 3V8JA 1T98A 2ZMEC 3PNTA 3G1LA 1IZ1A 3DBRB 2O5RA 1TNTA 1VQ9I 2KZGA 1MNMC 2ZB9A 2CU7A 4LITA 2VUMJ 4YELA 4ENMA 1BI3A 3BG9A 1ZR2A 3I71A 2NS8A 1KQ9A 2B7EA 2R7XA 1E3HA 2NS0A 1H9TA 4N4NB 2RDPA 1XSVA 4HOBA 3QOPA 3C2HA 3B6AA 3H9JA 4LIVA 1JT0A 1OFCX 3HOTA 5L3EA 1SFOJ 1DP3A 1MJBA 4HNVA 3OSGA 3HB9A 5CKTA 5C4JJ 1Y0NA 1ZLKA 3J7AY 1QBJA 2L9SA 4D5CA 2OBPA 4XLPF 2M8EA 1B72A 1YW7A 4AVPA 3HDDA 3DQVC 2KKOA 2CFXA 2IGOA 2LSOA 5EZGA 4XRMA 2HEOA 3EYYA 4G94A 1T95A 3Q9VA 1QHGA 4OAYA 4M6XA 2Y75A 3LWFA 5CPRB 2BY3A 2W24A 2DMQA 2Z1DA 3P9IA 1E17A 5IT9Z 1G4DA 5E79C 5J4VA 3ML6A 1O3RA 2IA1A 1UJ8A 1REPC 5IOYA 4FISA 2NS7A 3E5UA 3R60A 4JYKA 4A0ZA 4ZC3A 3JCUC 5EG0B 3F23A 2ADUA 4IHWA 1OCCH 2Z5UA 2VKEA 2DCEA 4I0AA 3BJ6A 5L3DA 2TRTA 4HBLA 2P4WA 2FJ1A 2EIKH 3ABKH 2AQEA 3K2AA 3M3YJ 3JRAA 2HS5A 1KU3A 1X1CA 2WTEA 3ZQFA 5IPAA 4H0EA 3K4BA 4KISA 4KUMA 3DTEA 2K9LA 1GLNA 4HQMA 3KP6A 4NC6A 4A12A 3D0SA 5CYVA 1A31A 2L7FP 1Y0UA 3PIPF 4XKBA 3S2HJ 2CFOA 3WGHA 4F93B 1JKRC 1WHUA 4MHGA 1IN7A 5F0FA 3DEEA 3E6BA 3GLXA 1Z9CA 1UHMA 5FKKA 3OL3A 2A05A 4EVIA 3FF5A 2X85A 2H8RA 3JSPA 2WAFA 4EM2A 1MBFA 4B4CA 2V9KA 5EGOB 1U9OA 3V42A 3OYAA 3HRSA 3QP5A 2DT5A 1KZHA 3ZN1A 3LSKA 4L5JA 3JTGA 2DJIA 1D5VA 4UUSA 2M2EA 3HEFA 1JHFA 3LQQA 2EZHA 2VLAA 5HODA 4V19K 2ZXIA 3KEOA 2M4KA 2HZTA 2JTVA 2V1NA 5LEJA 2UV1A 2EFWA 4ZYEA 1Y1VJ 4W1UA 3IAS2 2XPVA 3CUQB 5H6RA 1IN6A 2FOKA 1ETWA 4MQ9F 4HV5A 5HDNA 2CMPA 2ME0A 3H5AA 2QKMB 4XR6A 4PSXA 3GO5A 1P9QC 1U5TB 1DGRM 1QQIA 4IQ4A 2E2IJ 3BC8A 3AL0B 3BQYA 5LRRA 4B47A 1TW2A 4BACA 4XRFA 3SDBA 2AXTC 2QQ9A 2STWA 4R8HA 1Z6TA 1IF1A 4B8XA 5GP9A 4M72A 2P6SA 1HW1A 2HOTA 3I59B 3FMRA 2XB5A 5B1BH 1R6RA 2E7WA 2R7QA 1P4WA 4XLEA 3RYPA 4F3QA 2O6GE 1K6OA 2OQRA 1YITI 2OQGA 4A93J 3L2WA 3K4NA 1ZQ3P 4X6AJ 2EV0A 1QZYA 4M6VA 2JN6A 1ACIA 3F72A 5E3MA 2MG4A 1TP4A 4NNJA 3ZP5A 3NWSA 2ACJA 1D0ZA 4M3FA 4A3LJ 2CH0A 2K9SA 1MDMA 3KP7A 2ZNYA 2M0CA 3WU2C 2DAOA 2HFHA 5E20A 1UG2A 2DODA 2F5CA 1FX7A 1MZBA 3P7NA 3OY9A 4IO9F 3CMEI 2MW8A 3CJNA 1QO0D 2W7NA 3SYTA 5L3CA 2JSPA 3SHFA 2JRTA 2V1XA 4G7ZF 3CJQB 3Q3SA 4NQWA 2KIFA 3TMOA 4HLYA 2Y0SN 1LE8B 4ZJZA 3T0YA 4A3JJ 3MVPA 2XKOA 1YO5C 3S17J 2DA3A 3HL2A 1PP7U 3O6BB 2MLGA 3ZMDA 2VT3A 1SMYF 4E7IA 1X2NA 1FMVA 1RC9A 1P92A 3OIOA 4MGRA 1SC7A 3OYDA 4P9UA 1TW3A 3JRBA 2PJPA 5ICGA 4ZZLA 3D5LA 2O61A 3KZZA 3L2QA 5LBQA 3TP0A 3R0JA 4MIMA 2QBYB 3OOPA 3GZNB 2XAHA 4P96A 3M9AA 2PMZN 1FOWA 2YX7A 3LAPA 5JR3A 3FM3A 3TQNA 2K40A 3K4MA 3LOCA 4BHPA 5M3MJ 3M07A 2VQCA 3L09A 4A3EJ 2MGQA 1OCOH 2LG4A 3PUBA 2WB1N 3BG5A 2XAJA 2IW5A 2MABA 3QPTA 4CYCA 3PFIA 4MO7A 2LR8A 3G2BA 1S8NA 3S14J 3GTJJ 3HUGB 4XOPA 2XF6A 1FBUA 2OF7A 4Y13A 2L9RA 4JX5A 1LB2A 4LLNA 5DCMB 3H0GJ 4GGGA 4LMYA 3RKXA 5J1YA 1P7JA 3EETA 3GCMA 3OYJA 3ISPA 1RRJA 1PYVA 4PGHA 2CQQA 2LBFA 4U87A 4II2A 1ZRCA 3GTKJ 3RSNA 2Z3YA 2QZ8A 2JPBA 3E7LA 4CZCA 2CWEA 2Q0OA 5HLGA 3RZOJ 2KRFA 3OYMA 5F1RA 1H88C 2LKXA 5J4YA 5ED4A 3WTXC 4XRSG 2A3SA 5FRMA 3ZMZA 2BVLA 3GTOJ 1ZHFA 5K7ZA 1Q1HA 4LG0B 1TWFJ 2K27A 2MBFA 1SVMA 4EJWA 5E3OA 4GCVA 3ABMH 2NRAC 3H92A 4UVAA 4G8XA 1MKMA 1VQ8I 2Z9OA 2O0YA 1BOBA 3HUGA 3ZXSA 4QPQA 4BUPA 1T08B 2GOMA 1ZN2A 2VOOA 5LGUA 3J81K 3FISA 4NDLA 1R7JA 1JTXA 2ISYA 4BGDA 1ZK8A 3IHUA 1Z3XA 2AXLA 1JKQC 1R22A 3U1KA 3SFIA 1XCVA 4KA4A 3AL0C 2X1DA 2IS4A 2ZSIB 2M45A 5J8CA 3LSHA 2IS6A 5BPDA 5K1YA 1LUJB 4BY7J 1XGMA 2HOEA 5LLQA 4WXCA 1MDMB 4D1QA 2D1VA 1MJAA 3I53A 2EFNA 1IRZA 2GIVA 4D0PA 1YJWI 3B02A 3LNQA 3CJTB 4RS8A 1HA8A 4B44A 5B1AH 2GWRA 3HOUJ 1YJNI 2VQHA 3AG4H 2VJIA 4ESJA 3F3XA 4PDKA 4W97A 1WKMA 1RESA 2X9DA 4BE1A 1G3SA 3CTAA 5TRDA 1A36A 2KDOA 3V7CA 1S29A 2DYSH 4EGYA 2P0WA 2W4SA 5F64A 4BHCA 3MKYB 4A3CJ 3PQJA 1WCMJ 4HLXA 3SDGA 5BQTA 1T0FA 2XIGA 2YUSA 3CLOA 3NRVA 5H6QA 2XC7A 4ON0A 1QRYA 1X4PA 1I5ZA 4HF1A 1OPCA 2VE8A 3DFGA 4K2EA 5GAHJ 1MMSA 1NTCA 4FE4A 1IUYA 2M4GA 5IP7J 3HOXJ 3HKZA 1VQKI 4IPAA 1WFXA 1LPQA 4FT8A 3QU6A 1VTNC 4IVNA 1KYZA 4IQJA 3HHGA 9ANTA 1RETA 2X1CA 2LRDA 4M9SA 1QVTA 1IC8A 4DBRA 3OYGA 1MGTA 2WADA 3JRCA 1CF7B 2NOJB 1X1PA 3SEQA 1KU7A 2OAZA 4M9ZA 4M73A 2DK5A 4DNCA 4AYBN 3FK6A 5F04A 3V8LA 3ZQCA 3J7AO 2VXZA 5E18F 3ASOH 2B9SA 1HOMA 5M5YJ 2M9HA 4NC8A 2LKPA 4ETSA 1V4RA 1H8AC 3ZQLA 2IA0A 4XLNF 3W6VA 5DDGA 2HVRA 2BY2A 5HS8A 1XGSA 1ZRFA 3O8HA 3GFLA 1UFMA 2UXNA 1KONA 3EUKL 2E1MC 2EZKA 3DBLB 1HLVA 2VPLA 2FMYA 3EYIA 4UUVA 2QENA 4IXAA 4NC7A 1FEXA 3TGNA 1J2XA 4D9JA 3HIFA 3DKXA 2W48A 5E8GA 1SAXA 4FE7A 2W1OA 2CQKA 4V2GA 3KPHA 2XHKA 3JRFA 2JWTA 5ICFA 1LJ9A 1D8KA 4E6KG 2CSOA 3BG7A 2KJCA 1GHCA 3PQKA 3VPRA 3MZYA 5E17F 2ZFUA 4AWXB 4I98B 1G59A 1BR4A 4ENNA 2XKPA 4X0GA 5BNGA 1ZG1A 4HNUA 5FROA 1X1BA 2FBHA 3QRFF 3J80Z 1U0JA 2WC2A 1BC7C 1VF9A 6PAXA 3QWLA 1ETKA 4BQOA 4NB5A 4A3IJ 3JW4A 2O7OA 4XNFA 1U9NA 1WZ2A 3HKZN 3E6CC 3L2VA 2E71A 4AU7A 2ISZA 4CO8A 3FXQA 4LGWA 1V54H 2EFOA 4UNOA 4XQFA 2GA1A 4A3MJ 3VYRB 2XAUA 2NOGA 2CO5A 1T6SA 2JA8J 3WODF 1Y8QB 1I1SA 2E5ZA 2BZTA 2HDWA 3H5RA 4KT5C 2VIXA 5E1ZB 1J7KA 2NVYJ 1TWCJ 2R3SA 1EH6A 2W57A 4HEA2 2F4OB 2C6YA 1T56A 5EJCA 4ABZA 5AIQA 2O8KA 1IXCA 5F6FA 3MKLA 3H3UA 2EA4A 3DTIA 2PMHA 4MQVA 4U0YA 2ECCA 4N9HA 2RNGA 4M3DA 1MBGA 3RQIA 1K7AA 5IYDJ 1FBQA 1RKTA 2F6CA 2HVSA 2EWNA 3FMSA 3DXJF 2ZJQF 1SEUA 4A3FJ 2K9QA 3ASNH 1X3UA 1XC5A 2IGMA 2XVCA 1WSUA 3GZ6A 1J59A 2FMLA 2X6YA 2I5UA 2YU9J 1DGWY 1MBHA 2BV6A 2YS9A 3MZ8A 2JVGA 3Q0UA 2XRNA 3L00A 2CJJA 2DN0A 3KZYA 2EILH 3L1PA 2P5VA 1O3QA 5HNHA 4AM3A 1V3FA 2DA5A 1R5GA 2L7ZA 1R4NB 1ENHA 3PFYA 4NHJA 4CDGA 2JQ7A 2R7RA 1U5TC 3S2DJ 2O03A 3LSRA 3H3ZA 3ZQIA 5EDNA 3K9TA 5GAGJ 3I56I 4BE0A 2PLYA 2DO7A 3WU0A 3B73A 3BDDA 2R7OA 2WWYA 3GLLA 2MA3A 5B3SH 4IHYA 1X3ZB 2WY7Q 2LP0A 2VASA 4GXOA 1HDPA 1A5JA 3F6OA 5HDGA 2V9PA 2EK5A 4RGSA 4A6EA 5F08A 3WTWC 1W36D 1YW9A 1Y8RB 2FA5A 3OL4A 4B48A 2L2OA 3MKZA 4WX9A 3K1PA 3OSFA 4PFPA 2M34A 4LIUA 4R79A 2F5DA 3N97A 1CGPA 1IRFA 2LC2A 3DEUA 2CUJA 1LDKB 3CC7I 4L0ZB 3F8FA 4PK4A 2EH3A 2K02A 3E3VA 4HDUA 2DT6A 2VBWA 1FJLA 2L4AA 3CMAI 1AU7A 1IRGA 3NWTA 4ENKA 4OIRF 2ZC2A 1ON2A 1FMWA 4M9XA 4CCMA 4RAGA 3HGGA 4FTHA 3GMEA 1S72I 2J5OA 2HR3A 3TO7A 2E1OA 2WAEA 1B8IA 1Z6RA 2KFDA 3CCYA 4Y52J 1IXSB 3S16J 4L9VA 2LNBA 1N77A 1MJ9A
chains in the Genus database with same CATH topology
3CCQI 2QA4I 3CCSI 1VQ5I 3EGVB 3CD6I 3CJRB 3CCLI 2E35A 1VQ7I 3CCUI 2E36A 2ZJQF 2E34A 5JVGF 1YITI 2FOWA 1YI2I 1ACIA 1FOYA 5GAEJ 1VQNI 1VQLI 1HC8A 3J7ZI 1VQ8I 3J7YJ 2JQ7A 4IO9F 3CMEI 1YHQI 5DM6F 3CJSB 1VQ4I 3CJQB 5GAGJ 3I56I 3G71I 1FOXA 1YJ9I 2K3FA 3PIPF 2ZJRF 1WIBA 3CCVI 2OTLI 3CCJI 1YJWI 1VQOI 3CJTB 2OTJI 1VQMI 3G6EI 1YJNI 5GADJ 1FOWA 1VQ9I 3G4SI 3CCRI 3CCMI 2QEXI 3CC2I 4V19K 3CC7I 2ZJPF 4IOAF 5DM7F 1YIJI 3I55I 3PIOF 1VQ6I 3CMAI 3DLLF 1Y39A 2H8WA 5GAHJ 3CC4I 4IOCF 1MMSA 3CF5F 1S72I 1QA6A 1VQKI 2NXNB 1VQPI 4UY8I 3CCEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ I;  2QA4 I;  3CCS I;  1VQ5 I;  3EGV B;  3CD6 I;  3CJR B;  3CCL I;  2E35 A;  1VQ7 I;  3CCU I;  2E36 A;  2ZJQ F;  2E34 A;  5JVG F;  1YIT I;  2FOW A;  1YI2 I;  1ACI A;  1FOY A;  5GAE J;  1VQN I;  1VQL I;  1HC8 A;  3J7Z I;  1VQ8 I;  3J7Y J;  2JQ7 A;  4IO9 F;  3CME I;  1YHQ I;  5DM6 F;  3CJS B;  1VQ4 I;  3CJQ B;  5GAG J;  3I56 I;  3G71 I;  1FOX A;  1YJ9 I;  2K3F A;  3PIP F;  2ZJR F;  1WIB A;  3CCV I;  2OTL I;  3CCJ I;  1YJW I;  1VQO I;  3CJT B;  2OTJ I;  1VQM I;  3G6E I;  1YJN I;  5GAD J;  1FOW A;  1VQ9 I;  3G4S I;  3CCR I;  3CCM I;  2QEX I;  3CC2 I;  4V19 K;  3CC7 I;  2ZJP F;  4IOA F;  5DM7 F;  1YIJ I;  3I55 I;  3PIO F;  1VQ6 I;  3CMA I;  3DLL F;  1Y39 A;  2H8W A;  5GAH J;  3CC4 I;  4IOC F;  1MMS A;  3CF5 F;  1S72 I;  1QA6 A;  1VQK I;  2NXN B;  1VQP I;  4UY8 I;  3CCE I; 
#chains in the Genus database with same CATH topology
 3BJO A;  3ERM A;  3QP6 A;  4Y15 A;  2QGU A;  3HPG A;  3I5U A;  2M5W A;  1FY7 A;  5EEH A;  3KP5 A;  2R7S A;  2CV0 A;  4YRV A;  2RV8 A;  1M1E B;  2QQB A;  1GUU A;  4BS9 A;  4IRG A;  1K78 B;  1D0Y A;  1XB4 A;  1ZAO A;  2EV6 A;  1FSE A;  2WV1 A;  3CUQ C;  1I27 A;  2ESN A;  3WTT C;  3OYB A;  1WI9 A;  1G3W A;  3W6K B;  4HRI A;  4OMY A;  3LSM A;  1XD7 A;  3E5Q A;  2MH9 A;  4AIH A;  3JAM K;  2QBY A;  5DCM A;  4LG3 A;  3GBG A;  2FX0 A;  3TKY A;  2Y69 H;  2F4M B;  3TOA A;  2IRF G;  3IH4 A;  4A0X A;  4F52 A;  4JK1 X;  3F8B A;  2VKD A;  3H36 A;  1MIJ A;  1LNW A;  4B09 A;  3Q9S A;  3ONQ A;  2BHZ A;  1G6N A;  3QOD A;  2YX4 A;  4OWR B;  2IS2 A;  4G6D A;  3F8N A;  3G73 A;  1DU0 A;  5F27 A;  3CES A;  1EA3 A;  2LVS A;  1T38 A;  5HLT A;  3OWT A;  2CW7 A;  1BIA A;  4PUS A;  1R9T J;  4PFO A;  2X51 A;  2HGC A;  2RQQ A;  5EEA A;  1QNT A;  4HSR A;  2NYX A;  2A61 A;  1IW7 F;  1SFU A;  4Q5S F;  3DPT A;  1HW5 A;  1HW2 A;  2ZKZ A;  2AS5 F;  1OCR H;  5H2F C;  1XDS A;  5FJ8 J;  4BHB A;  2L7K A;  2XGE A;  5E3N A;  2FBK A;  4Y7N J;  3U1D A;  2OTJ I;  2LRE A;  3FX3 A;  2DA4 A;  1VQM I;  1O3S A;  2ZME B;  1OLT A;  4LB6 B;  2VQG A;  1U5T A;  2GZW A;  3M1C A;  5J6X A;  4A3D J;  4BKX A;  2LKS A;  3GFJ A;  4WXD A;  1EH7 A;  2L54 A;  4WXH A;  3FK7 A;  4FET A;  2QEX I;  5BMZ A;  1FYM A;  4GDF A;  4XN3 A;  2W82 A;  4I0B A;  3V7R A;  2STT A;  1KU2 A;  4G6T B;  5CVI A;  4O6J A;  1P6R A;  1W7P A;  1NH3 A;  1ZH5 A;  3GZ5 A;  1E0E A;  3PJR A;  1B6A A;  1X2M A;  2BVM A;  3GEZ A;  2GAU A;  4FHT A;  2XRO A;  2B0L A;  2DW4 A;  3CDH A;  1NK2 P;  2GQQ A;  3S1Q J;  1HST A;  2VC1 A;  1O57 A;  2KPM A;  1DP7 P;  4CSW A;  1BI2 A;  3NAR A;  3I59 A;  1OKR A;  2CW8 A;  2MH2 A;  2DT7 B;  5HOO A;  4EJV A;  1U6G A;  2HOS A;  2EA2 A;  2A69 F;  1Z7L A;  1S7E A;  5J1R A;  3L2R A;  4BXU A;  2QA4 I;  1U8B A;  5HS7 A;  1MND A;  3CJR B;  1YS6 A;  2Q2E B;  1QZZ A;  2RN7 A;  4XSX F;  4XN0 A;  1BI1 A;  2V7F A;  4A6D A;  4I2O A;  2Y0S A;  4A5N A;  2ZME A;  4Y4R A;  3MFK A;  2ECB A;  1T0F C;  1ZGW A;  3CUO A;  3IKV A;  5J8F A;  4G7H F;  1IN8 A;  3VB2 A;  3S1N J;  3SQN A;  3K69 A;  1X4O A;  1EV7 A;  2A68 F;  5KVR A;  4HF0 A;  4Z6Y A;  2PJR B;  1TLH B;  4F7Z A;  3JRH A;  3JRD A;  3HZJ A;  4KYW A;  4MFE A;  2KDZ A;  2EQR A;  4YII A;  1YOV B;  3HSR A;  3OS2 A;  1VI0 A;  4PJJ A;  3KE2 A;  2IT0 A;  3DF8 A;  4CCO A;  1LVA A;  4UHT A;  2OUM A;  1MH3 A;  1FBS A;  3HC7 A;  3TL4 X;  1OYY A;  1UHW A;  4JQF A;  1MBJ A;  4JP0 A;  3JAM Z;  3S93 A;  4IEJ A;  2X4H A;  3BR5 A;  2W84 A;  2R7V A;  3T8R A;  3CJS B;  1VQ4 I;  5E8I A;  1Y56 A;  3GFM A;  3F9K A;  3C7J A;  3BZC A;  1OQY A;  5KCM A;  3VSK A;  1MBK A;  5FD6 A;  2WAQ N;  2WY8 Q;  2EZL A;  2R92 J;  1IO2 A;  5DUI A;  2DQR A;  5LD2 C;  3CCV I;  3RKQ A;  3B6C A;  4FCY A;  2OD5 A;  3DU6 A;  4C3I J;  1R1U A;  5D5U B;  4U0W A;  2X6W A;  2VB6 A;  3FZV A;  3BPV A;  2HYJ A;  2OJE D;  1K61 A;  4RB3 C;  4Q48 A;  1R36 A;  2DA1 A;  2QLZ A;  4MFD A;  3M8J A;  4LOC A;  1FC3 A;  2ZXW H;  1TT0 A;  1D3Y A;  4QLC U;  2DOE A;  3FXK A;  4C2T A;  2W25 A;  1BC8 C;  1UMQ A;  1Z7U A;  2FD5 A;  2IJL A;  2NVX J;  1FNN A;  4V2F A;  2CGP A;  3HM5 A;  1BR1 A;  4A3K J;  2COB A;  3K10 A;  5J40 A;  2H1K A;  4PSW A;  4GO1 A;  2XPW A;  2LBF B;  3JRG A;  1E3P A;  3AAF A;  3W2W A;  2AQF A;  1TQM A;  4LD5 A;  4OMZ A;  4EMS A;  3WTU C;  4UXN A;  2Y48 A;  2R5Y B;  1F9N A;  2G9W A;  3LAJ A;  1VQP I;  1RPW A;  2VL8 A;  4P5O A;  3CCE I;  3ERE D;  3LA2 A;  3CCQ I;  3IAM 2;  2LK2 A;  2DOF A;  2DTZ A;  4M6Y A;  3OS0 A;  4XKW A;  4UUT A;  2LOO A;  3VOD A;  4ZTJ A;  1Y6I A;  2A6E F;  2DMP A;  4E7Z A;  3F21 A;  3SZP A;  3LFK A;  3WU1 B;  2OPT A;  1OMI A;  4BJT A;  3K4K A;  2KRC A;  1Z77 A;  2ME6 A;  2NVT J;  2V4J C;  5FD5 A;  2ZFW A;  4CZZ A;  2VC0 A;  1IDY A;  3WHC A;  2E60 A;  1F1Z A;  3A1Y A;  2LH9 A;  2LYC A;  3S32 A;  1ULY A;  1BL0 A;  4OOI A;  1YIO A;  3BY6 A;  4U7B A;  5FRN A;  3GXO A;  1JKO C;  2PMU A;  4BEH B;  1YX3 A;  3IUO A;  4IL6 C;  1IUF A;  2D2W A;  2F5V A;  3AG2 H;  1ONV A;  1XN7 A;  4IHT A;  5JHF A;  2BGC A;  1JHH A;  4RDU A;  4N0B A;  2R5Z A;  4HG2 A;  4Z2Y A;  3FHN A;  3OIP A;  2ICW G;  3MMY B;  5EGO A;  3OYN A;  3FHZ A;  2M0M A;  2RRE A;  4KJZ A;  1HKT A;  3FBI B;  3HBL A;  5LFA A;  1QPM A;  4Q47 A;  1ON1 A;  4QWQ A;  2MC4 A;  3LMM A;  1EJ9 A;  3MD2 A;  2KLO A;  1D1B A;  4ESB A;  3D1N I;  3V7S A;  5IP9 J;  3K4J A;  5JFR A;  2ZSH B;  5A2Q Z;  1NHA A;  3SJM A;  2W00 A;  3MEX A;  1GV2 A;  2OU2 A;  3VYT B;  2VBZ A;  1W0T A;  1QHH D;  3ZQQ A;  2JZY A;  2QCO A;  3O2P E;  3I4P A;  1GXQ A;  3E0J B;  4WCG A;  3HTS B;  3OV8 A;  3MQ0 A;  2XAF A;  3COA C;  1PDN C;  3TDZ C;  4AYB A;  1EH8 A;  5LEK A;  5FO5 A;  1MSF C;  4JOM A;  2WA0 A;  2K3P A;  1MBE A;  2V9V A;  4XKC A;  1D1C A;  1ZG3 A;  2FU4 A;  2IAI A;  2XAS A;  4MTE A;  2EJR A;  2FNA A;  2G7H A;  3KP3 A;  4S05 A;  2K5C A;  3E6M A;  5IT3 A;  5CVR A;  3P9K A;  1VZ0 A;  1LDD A;  3DLA A;  1Y39 A;  2RQP A;  2Y9Z A;  4QIW N;  2DI3 A;  4EJT A;  1MNE A;  5CQE A;  2F5F A;  3CF5 F;  2X48 A;  2E2H J;  3S3N A;  2XDV A;  3HOW J;  1Z05 A;  5IYB J;  2A6T A;  2H94 A;  2X6X A;  1IV6 A;  1WRJ A;  4L5I A;  3BPX A;  1F43 A;  4RGX A;  5LGN A;  3QYB A;  4IHX A;  4P1W A;  1DU6 A;  4UB6 C;  2JVH A;  3O8G A;  4IF4 A;  4Y33 A;  1PVE A;  3K4C A;  3WE3 A;  2LMD A;  3K4L A;  2B63 J;  4I76 A;  2NVQ J;  1E3O C;  5LHH A;  5BOX A;  1K4S A;  2M30 A;  3IV5 A;  2TCT A;  4ESF A;  3L2U A;  3WGG A;  4KIF A;  4M3G A;  1LFB A;  4LFU A;  2M1B A;  3T8T A;  5DV5 A;  1OYI A;  4KIB A;  1YLF A;  3MWM A;  2FNP A;  4I09 A;  3BZ6 A;  4RGU A;  4BQA A;  2DDA A;  5CVU A;  3R4K A;  1RR7 A;  1Z67 A;  2LTP A;  4C9Y A;  2VPR A;  3BT9 A;  3ZMU A;  2UXX A;  3BP8 A;  1BOA A;  4PGG A;  1W36 C;  2M3A A;  3C18 A;  3ULQ B;  2KJB A;  2KL4 A;  3I54 A;  2DPU A;  1OCT C;  5FKL A;  3H1C A;  4BBR J;  2JA6 J;  3E1S A;  4MEY F;  3OOU A;  1NG7 A;  4C3J J;  1DQU A;  5J47 A;  1QGP A;  2PI0 A;  2XF5 A;  2EPF A;  4IKF A;  3F6V A;  1GV5 A;  2X1E A;  1XCB A;  3E6D A;  2E7X A;  5DEQ A;  5IY5 H;  2FF4 A;  4KIG A;  1R58 A;  3K6G A;  2JMW A;  4OIP F;  3ZOB A;  4KIT B;  4DIQ A;  2QVO A;  5F0C A;  3GX4 X;  3HXL A;  1I3Q J;  3PSF A;  3T5X A;  3K70 C;  1I6H J;  1DDN A;  4KMU X;  3OYK A;  3FXM A;  4PJM A;  3IWZ A;  4RM2 A;  1XPX A;  3PO2 J;  1GVJ A;  2DMT A;  3FKJ A;  3VYS B;  4ANJ A;  4YG2 F;  4IRI A;  4BJ6 C;  3ABL H;  4ITV A;  3ROU A;  4OIO F;  5F1J A;  1XGO A;  3E5X A;  3OMY A;  4ZDP A;  3P9C A;  4ZDO A;  2PQ8 A;  5KNL A;  1V5E A;  5LGT A;  4TV7 A;  4DW6 A;  5HLH A;  5EG0 A;  2HTS A;  1UCR A;  2TDX A;  3HHH A;  2NNY A;  4FQG A;  1MMA A;  2GLO A;  4IHS A;  2H6B A;  1YIJ I;  1WJA A;  2V6C A;  5KK1 A;  4DYR A;  2HNH A;  2HVQ A;  2A6H F;  3LA3 A;  5DYM A;  5E3L A;  4EGZ A;  2O8X A;  4ZYA A;  1U78 A;  1KA8 A;  4LK0 F;  3CMY A;  2KIM A;  3MAJ A;  4EJO A;  3EUH C;  3DU5 A;  3AFH A;  2ZXJ A;  2YU3 A;  2VOP A;  5B66 C;  1JT6 A;  2BW3 A;  2PJR A;  1L0O C;  2BBY A;  2XAQ A;  2V1U A;  2HKO A;  4E7L A;  2WB1 A;  3CCS I;  4QSH A;  1FIA A;  2FQ3 A;  1SD6 A;  3FXL A;  1SD4 A;  3FM5 A;  1XDU A;  3H9Q A;  1VQ7 I;  2XF7 A;  3DTK A;  3GTQ J;  4YFK F;  4XLA A;  1LFP A;  2E36 A;  2G0E A;  3KET A;  3TP3 A;  3LSI A;  1JJ8 C;  1LVK A;  3A01 B;  2OCE A;  1Z1D A;  4M74 A;  2L02 A;  2ELH A;  1S7A A;  2IEK A;  2CUZ A;  1TNS A;  5JVT A;  4A3G J;  3RKW A;  3CQZ J;  3CF2 A;  4Q4Z F;  2XV4 S;  1WPK A;  5CLS A;  4CHU A;  1VQN I;  3R0A A;  5EEG A;  1FT9 A;  2JUG A;  3M4O J;  3A4C A;  2DFE A;  3J7Z I;  5HS9 A;  2W85 A;  4AD9 A;  1ZKG A;  1B9N A;  1ORK A;  1OR7 A;  3ZQG A;  3HJE A;  5HLI A;  4XSZ F;  2PFB A;  3OYC A;  3GYH X;  3OS1 A;  2EV5 A;  2HYF A;  2V26 A;  5D8L B;  1SVL A;  5CQG A;  2VON A;  3I3L A;  4DOZ A;  4A0Y A;  4E4H A;  4NBQ A;  1VFC A;  1QVU A;  1BJA A;  1BI0 A;  4UVB A;  1N25 A;  3F0C A;  3W6J B;  1PJR A;  1Z91 A;  1R23 A;  2DYR H;  3RJP A;  1T2K A;  1KGS A;  2VQL A;  5FLX Z;  3S3O A;  3RPU D;  1L3L A;  5KHD A;  2DLL A;  4A69 C;  1GXP A;  2GM4 A;  2X6O A;  1AKH A;  2IGK A;  5GAD J;  1IV8 A;  3SFZ A;  1ZGA A;  4XID A;  1YS7 A;  4H4K C;  2KRH A;  3CCR I;  4G9Y A;  1ZGJ A;  1Z0X A;  1H0M A;  2R5Y A;  3CC2 I;  3DKY A;  2Y0M A;  1BJZ A;  1XMX A;  2D5V A;  4HX4 A;  4BQN A;  1BN5 A;  1R4M B;  2DJN A;  1TL8 A;  4RLF A;  3PIO F;  2QSH X;  1MMD A;  4LG0 A;  4AID A;  3ZQ7 A;  3TO6 A;  4I02 A;  2QSF X;  3ABU A;  2E5N A;  2HKX A;  3GW2 A;  4FAS D;  4OIN F;  2UUZ A;  1YFH A;  1D0X A;  1GT0 C;  2YR2 A;  3CDL A;  1LDJ A;  3BOQ A;  1LQ1 A;  1T8I A;  1O7L A;  5K7H A;  1B72 B;  2XSJ C;  1DPU A;  3CZ6 A;  3UNG C;  1YTY A;  3VFZ A;  1WWX A;  4Y17 A;  1TQI A;  2R7U A;  2E35 A;  1MH4 A;  3BLY A;  5HVQ C;  4A5M A;  1UZC A;  2EIM H;  3RCO A;  4E7K A;  1XX5 A;  1I6X A;  2QSG X;  3LA7 A;  2ELK A;  2DMN A;  2XRL A;  2CW0 F;  2QQ8 A;  3NQO A;  3J80 K;  1FSH A;  4LLG F;  5FGM A;  2E34 A;  3TO9 A;  4XOT A;  4EJU A;  4UV8 A;  2GXA A;  2L0K A;  5A2Q K;  1B59 A;  2XAG A;  2E1C A;  2LDU A;  3M8E A;  3DKW A;  1N75 A;  2JPC A;  5BPI A;  1XS9 A;  5FLM J;  1LE8 A;  3WTZ A;  1N78 A;  3BTJ A;  1J0R A;  3EQL F;  1MD0 A;  4OIQ F;  2DMU A;  1WH7 A;  2D45 A;  1ETQ A;  2GXG A;  1FOY A;  2DA6 A;  2L3D A;  4CA0 A;  4DZP A;  2FXA A;  5FKO A;  4XRS A;  3TDU C;  4DYC A;  4E7H A;  1HSJ A;  2E1N A;  5E1W A;  1AWC A;  2PEX A;  2VKH A;  4CCL A;  4YFN F;  5JI6 A;  3OYH A;  1Z3Y A;  2ETH A;  4CCK A;  1JE8 A;  4GYG A;  2XUB A;  4CGZ A;  3A0H C;  1XGN A;  3A01 A;  1ZG5 A;  2IA2 A;  5DM6 F;  4FX0 A;  3S15 J;  2YPR A;  2K7L A;  3VWB A;  1POG A;  1W5T A;  3NEU A;  2M7B A;  1FP1 D;  1O4X A;  1ITY A;  2P7V B;  4F92 B;  3OYI A;  1MMN A;  2NVU B;  4J00 A;  1ZEL A;  2VXD A;  2KHM A;  4CIC A;  3OYL A;  2L5Q A;  1R71 A;  4CCJ A;  2Y30 A;  2CYY A;  2IBD A;  3I64 A;  1AHD P;  1OJL A;  3TOB A;  5K5R A;  3HRM A;  2R5Z B;  2ZBK A;  1J09 A;  3D5R C;  2OCC H;  5M5W J;  4OU0 A;  3DP7 A;  3LQR A;  5D5W B;  1YRN B;  3PNV A;  2OZU A;  1TQP A;  1OR7 C;  2VJJ A;  2F4I A;  1WJ5 A;  4MNU A;  1JI8 A;  2COM A;  2M8G X;  2MSY A;  2XGC A;  1USS A;  3HOZ J;  3DWL E;  1HQC A;  3CO6 C;  1P2F A;  4C2U A;  4MEX F;  1VND A;  3NAU A;  2HQN A;  2J5P A;  3DEW A;  3AKZ A;  1RNL A;  4IOA F;  3WE2 A;  2KP6 A;  5CVJ A;  5K7F A;  3DPL C;  3ELK A;  4DQ2 A;  2JA7 J;  1YQA A;  3RI4 A;  2CV2 A;  4XMY A;  3DLL F;  2FE3 A;  2VBX A;  2EIJ H;  3TED A;  2N8G A;  3P5J A;  3GFI A;  3MCZ A;  2ZJ2 A;  3KEQ A;  3ZRG A;  4HZF A;  5D8K B;  1T33 A;  3C1D A;  3K7A J;  3HG9 A;  5K5Q A;  3RPQ A;  2QM3 A;  2OZ6 A;  1E2X A;  1IGN A;  1RUO A;  2DFI A;  2GBY A;  1BR2 A;  4B3A A;  4CCN A;  1WJE A;  4E70 A;  4O3M A;  2NXN B;  3BTC A;  4RB0 A;  1V5F A;  4BH9 A;  2DA2 A;  4J19 A;  2K85 A;  2BXY A;  3KYD B;  4IZZ A;  1WQ2 A;  2GOX B;  1Q1V A;  4IRH A;  2L9V A;  2HDD A;  1VQ5 I;  5B5E C;  2RAE A;  1MSE C;  2QUF A;  3I4N J;  1V55 H;  1C0W A;  4BDZ A;  1ZR4 A;  5IOZ A;  4KFC A;  4CYC B;  4L0Y B;  3IRR A;  3V8K A;  1BW6 A;  1HCR A;  3BQZ A;  5GPC A;  3LL7 A;  2HTJ A;  3F22 A;  3CLQ A;  1F36 A;  2M87 A;  3BR6 A;  3QAH A;  1SFK A;  2CV1 A;  3TBI A;  4G6Q A;  3JRI A;  2HPM A;  2KIQ A;  4R1H A;  3U21 A;  1SAN A;  2Y9Y A;  3WTV C;  3QPS A;  4ZH4 F;  4I01 A;  4U0V A;  3BR2 A;  4BBS J;  3QPL A;  2WAQ A;  1JGG A;  1DPR A;  3A03 A;  4S0H B;  3PL8 A;  2MLK A;  3G1M A;  2DTR A;  4HX7 A;  3J81 Z;  3KCC A;  1YE9 A;  1YX5 A;  4ASN A;  3C3W A;  1R1T A;  1G8X A;  2JRM A;  2DFF A;  2ESH A;  3ZMT A;  5HDK A;  2H27 A;  1GDT A;  2JJ7 A;  2HQ5 A;  4RAY A;  1AOY A;  2X0L A;  2IS1 A;  2Q1Z B;  1I39 A;  5IT9 K;  3SZG A;  1BA5 A;  4KIC A;  1PUF A;  4GYI A;  2H1L A;  3CP2 A;  4XK4 A;  2ID3 A;  1XMA A;  2PX9 A;  2MD5 A;  3BTI A;  3HSE A;  5D6F A;  5DD8 A;  4L9T A;  2RGV A;  1LEB A;  3CUQ A;  3KP2 A;  3CCJ I;  5JLX A;  2LF8 A;  3AG3 H;  2G7U A;  5D4S A;  3G1O A;  4LK1 F;  1IJW C;  5FKM A;  1W5C C;  2K4J A;  2RNJ A;  2CG4 A;  3M1E A;  3H3V K;  5LHG A;  2P7C B;  2A07 F;  4A2U A;  2IVM A;  2JT1 A;  2XGD A;  2I10 A;  4B3X A;  3EPZ A;  1FLI A;  2MD0 A;  3S2W A;  1FYL A;  2ZCW A;  2KT0 A;  1K6Y A;  2OA4 A;  4M71 A;  3WTY C;  3A2K A;  3PSI A;  4HF2 A;  1A6Q A;  3KP4 A;  3LSJ A;  1TT5 B;  5DM7 F;  5L3F A;  5TIS C;  4BXX J;  5D4R A;  4C2M J;  2DPD A;  1CF7 A;  1BM9 A;  4PCQ A;  2Y31 A;  3FDY A;  1STZ A;  4RA2 A;  4NQW B;  5J3L A;  2ZO4 A;  2JA2 A;  2E2J J;  3FXU A;  3VSL A;  4UY8 I;  1WJD A;  3ZR8 X;  2L01 A;  3FMQ A;  1TTY A;  1OYW A;  5M3F J;  1S3J A;  1FPQ A;  5DS9 A;  3IH2 A;  4IJA A;  3EGV B;  1RI7 A;  3CD6 I;  4AC0 A;  3RYR A;  5FB2 A;  2Y2Z A;  1A35 A;  1WVR A;  4L5E A;  2QQA A;  5ILV A;  2JSC A;  1ZTR A;  2Z2S B;  2FUG 2;  1LKX A;  1P7I A;  2K9M A;  3BG6 A;  4XM3 A;  1YRN A;  1PP8 F;  1D8J A;  3ABT A;  3AG1 H;  5C4X J;  4X1E A;  3ZQH A;  4XBF A;  2FOW A;  1Z21 A;  2CUE A;  3OYF A;  2JK3 A;  1YI2 I;  3GTL J;  5C3E J;  1LFU P;  3Q0V A;  1S7O A;  3ZPL A;  3ECO A;  5FKN A;  2VN2 A;  3BRO A;  5HNF A;  3S8P A;  1WGX A;  1JKP C;  4DJA A;  1VQL I;  1HC8 A;  3HTU A;  1S5L C;  2LF7 A;  3Q0W A;  1JUM A;  1FTT A;  3SXY A;  3FBN B;  3J7Y J;  4YFX F;  1X1A A;  1DUX C;  4XLH A;  4WWC A;  3BWG A;  2KMU A;  3IWF A;  3KZI C;  4HQE A;  5D6E A;  2EB7 A;  2P8T A;  2L4M A;  4FX4 A;  3JR9 A;  2AO9 A;  4BEH A;  1G3T A;  4M3E A;  2DK8 A;  2O3F A;  2Q2E A;  2JA5 J;  3I58 A;  1UG0 A;  2D1H A;  3C2G A;  3A02 A;  4UVC A;  5GTH C;  3KEY A;  4XKV A;  2R4G A;  1QU3 A;  2V1D A;  2CRG A;  2HDC A;  1XG1 A;  5M5X J;  3RTR A;  3QOE A;  3KIO A;  4C30 A;  2ID6 A;  3G6E I;  3K1M A;  2KZV A;  2DFH A;  1X1D A;  2XPU A;  2VI6 A;  5ILU A;  4UUS B;  4E7J A;  3G4S I;  4XL9 A;  4CYD A;  3U9G A;  4JX4 A;  4BNC A;  4E7S A;  3FXR A;  1MMG A;  4EEF G;  1FIP A;  1YG2 A;  4XLC A;  3JRE A;  3H0D A;  3OR1 C;  1Y1W J;  3ZGK A;  3I55 I;  1RIO H;  2CS3 A;  2HXI A;  3JTH A;  5E1X A;  1NK3 P;  1UEL B;  4BQQ A;  3UKG A;  4M3B A;  5ERI A;  2H09 A;  4II3 A;  5CJ9 A;  2QKL B;  3KLO A;  4RAZ A;  2L7M P;  2H8W A;  2PMZ A;  4KN7 X;  2FRH A;  4F91 B;  3L7W A;  2GXB A;  1D1A A;  2LLK A;  3CC4 I;  1ETO A;  4I7H A;  4RGR A;  1ETX A;  3ZN0 A;  2K9N A;  2XGX A;  2GIZ A;  2DOA A;  2F2E A;  2HU9 A;  3K1N A;  1K79 A;  1G2H A;  3H35 A;  1BIB A;  3CMM A;  3BCB A;  1HBX G;  1ODD A;  1AA7 A;  2DU9 A;  2R0Q C;  3IL2 A;  2QF7 A;  5IYC J;  5CVV A;  1EF4 A;  2P5K A;  2I8D A;  4B43 A;  4B1R A;  5JLW A;  2VJ5 A;  4NUB A;  4BAY A;  2HXO A;  2IXS A;  3D5S C;  1K78 A;  4BJ5 C;  3QYE A;  5ICC A;  2QYO A;  2K4B A;  3K0L A;  2HQR A;  1XSD A;  2MFZ A;  2KIS A;  5H20 A;  1SD7 A;  4RM3 A;  2NAZ A;  1SMT A;  3CO7 C;  4KNY A;  4GFB A;  3H9G A;  4LLL A;  1UST A;  1ZLJ A;  1I1G A;  5F0H A;  1IDZ A;  3HYI A;  3ZCO A;  3M8F A;  3LST A;  1EKE A;  1BBY A;  4KT6 A;  5GPA A;  2ELJ A;  3BJA A;  2ZNZ A;  1J9I A;  1S6L A;  4LB5 A;  4WK8 F;  2BE5 F;  2EFQ A;  3HRU A;  2HZD A;  1T39 A;  1KQ8 A;  4CH7 A;  1HDD C;  3I9V 2;  4ZZD A;  1R5H A;  3HSF A;  1H9G A;  1A6I A;  1R1V A;  2GA2 A;  2IP2 A;  4I99 C;  2VJ4 A;  2M7A A;  3N4M A;  2R7T A;  1KU9 A;  3BR3 A;  3RQ4 A;  4KMF A;  2IGN A;  5IP6 A;  5FFZ A;  3VDX A;  3BG3 A;  3OYE A;  3FIW A;  1YJ9 I;  2P5L C;  1PUF B;  4ZYD A;  4HX8 A;  4RBO A;  2R7D A;  3M7G A;  4DYQ A;  4I6Z A;  1CQT A;  2YSR A;  3IKT A;  3QQA A;  4PJ0 C;  4BDY A;  2BXZ A;  4ZYH A;  4HST A;  1XSX A;  1RKW A;  2PG4 A;  2WBM A;  1X58 A;  5DUK A;  4XIC A;  4BL0 B;  1A04 A;  2DDB A;  3QU3 A;  2XB0 X;  5DD4 A;  1WJF A;  4G7O F;  1OIS A;  5L3B A;  4J01 A;  3QYF A;  3FXJ A;  1U3E M;  1HKS A;  2MYS A;  2Z16 A;  4EM0 B;  1WJB A;  5EYR A;  3CCM I;  5KAI C;  4GRI A;  5FFX A;  3IC7 A;  3PM1 A;  4KN4 X;  4IHV A;  2DQL A;  2ZJP F;  2HPI A;  1J5Y A;  4BYY A;  2EIN H;  1R49 A;  3F8C A;  2E19 A;  1O7F A;  1W7P B;  3DV8 A;  4RB1 A;  4IX7 A;  2FSW A;  1H89 C;  3W3C A;  3K2Z A;  1UHS A;  2CUF A;  1SVO A;  2FQ4 A;  1WH5 A;  1G3Y A;  2HI3 A;  2HOA A;  1WJC A;  4EM1 A;  1IN5 A;  2EFP A;  2EZI A;  4BU2 A;  5ILS A;  4EAT A;  1I50 J;  3A0B C;  3VEP A;  4S04 A;  2H6C A;  4YIR X;  4D5F A;  5D5V B;  3G3Z A;  5GTI C;  1K83 J;  1TWA J;  4QTR A;  4L9N A;  4XLF A;  3BR1 A;  5FLX K;  4MLO A;  3MZH A;  3WTS C;  3REO A;  3IP4 B;  2UZK A;  3PNY A;  1R00 A;  1ZRE A;  1FTZ A;  1PUE E;  2BHY A;  4BY1 J;  1B4A A;  1ZAR A;  3BZK A;  2EBI A;  3CCU I;  3RIR A;  3LSP A;  4HDV A;  4HA8 A;  5K5O A;  2R7W A;  5FLV A;  1QZE A;  3WG7 H;  1LEA A;  5AON A;  3DPU A;  2BY0 A;  3KLN A;  2BY1 A;  4ZYG A;  4YIF A;  1MW7 A;  2VE9 A;  4EV0 A;  3L2C A;  1D5Y A;  1GVD A;  1ZRD A;  2L9N A;  2FEZ A;  4JBA A;  4P55 A;  2Q8K A;  1BW5 A;  3ZMV A;  4RAF A;  3SEZ A;  2VKV A;  4OAZ A;  1S9H A;  3KYL A;  1TZL A;  1UB9 A;  4D7M A;  3W2V A;  2LY9 A;  1IAW A;  3GTG J;  4RB2 C;  1RR8 C;  1P4X A;  3OIQ A;  2DA7 A;  4ZDL A;  3HRT A;  3MKW B;  2LY2 A;  1FZP B;  2LD5 A;  1YYV A;  4ENJ A;  1V5G A;  1SFX A;  2DBB A;  3VYU B;  1QPI A;  1JJ6 C;  3S1M J;  3K70 D;  1TBX A;  3FWE A;  4D7N A;  1IXR C;  1X3W B;  1F4K A;  1KYW A;  4AIK A;  5L3G A;  1YHQ I;  4HV6 A;  3RPU A;  1AKH B;  5DTD A;  3L9F A;  4EQQ A;  3SZT A;  3JSO A;  4Y3O A;  3TW6 A;  3WHB A;  4HW0 A;  3T1B A;  3G71 I;  3N05 A;  2KIU A;  2K3F A;  1O3T A;  2K86 A;  1ETV A;  2OV7 A;  3FKI J;  4HAM A;  2BW3 B;  2MC3 A;  1YW8 A;  1FWZ A;  4QPO A;  3RDI A;  3I4M J;  3WGI A;  2ZJR F;  2DXI A;  4F55 A;  3C2B A;  1WIB A;  3QPH A;  2F5E A;  4N9I A;  1U8R A;  1XTA A;  3CDI A;  4HPQ A;  1R5I D;  3FXO A;  2OTL I;  3EDP A;  4HYE A;  4JX6 A;  4CUG A;  2RKH A;  1VQO I;  3S1R J;  3TW7 A;  1NG6 A;  3EUA A;  4AVZ A;  1WI3 A;  1FOK A;  1W7P D;  3GF2 A;  5KAF C;  4UV9 A;  1IN4 A;  2IPQ X;  1W5S A;  2Z99 A;  3IH3 A;  3KFW X;  1FYK A;  5C44 J;  2R93 J;  3ESW B;  3U2R A;  4O5V A;  4DZJ A;  4G12 A;  3WG9 A;  4PJL A;  1X19 A;  3H5N A;  4UB8 C;  2Z33 A;  3RZD J;  3Q5F A;  4YEJ A;  2JUC A;  1VQ6 I;  1JGS A;  3DBH B;  3MN2 A;  3UR3 C;  2A5W A;  1B9M A;  3R61 A;  2PN6 A;  3DCF A;  5J1U A;  2R7F A;  4RLQ A;  1OCZ H;  1IRX A;  1SFE A;  2RC4 A;  3I0T A;  4IOC F;  3RKY A;  1K4T A;  3W2A A;  1W1W E;  1QA6 A;  2ZXH A;  3CP8 A;  1RZ4 A;  1SD5 A;  2VT2 A;  3F8M A;  1HF0 A;  4PJN A;  1B8I B;  1RUN A;  2HQA A;  2O9L A;  1JXS A;  4LJZ F;  4XON A;  1APL C;  3GUD A;  1FP2 A;  3HOY J;  3GTM J;  2E1M B;  1ETY A;  2BOL A;  3KYC B;  4DGW B;  1UAA A;  3LFU A;  2CQN A;  5LRS A;  4ZTF A;  1HXD A;  5LHI A;  3BTL A;  1ERD A;  5TGT A;  3CCL I;  2F48 A;  4CXF A;  4P9F A;  2P81 A;  4AIJ A;  3PO3 J;  2XSD C;  2LY1 A;  2A5Y B;  2BYV E;  2V6E A;  1J75 A;  2FBI A;  2CQX A;  3ZMS A;  1JTY A;  1HKQ A;  4MTD A;  5EZH A;  1TWG J;  1W0U A;  2CQ7 A;  1JUS A;  3BCA A;  5JVG F;  2RVC A;  4WF2 A;  2R7Z J;  2NNN A;  3LSG A;  5JHU A;  2VOD A;  4PZJ A;  5TJJ A;  3X2Q H;  1I3A A;  1TWH J;  4XOR A;  2UWM A;  4AUX A;  3S3M A;  1SAU A;  4U88 A;  3O3K A;  4L9J A;  5GAE J;  4U7D A;  2OC6 A;  1TC3 C;  4C3H J;  2PBI A;  2BEO A;  2HYG D;  5DCF A;  1W4M A;  4BXF A;  3HOV J;  1XMK A;  2P6T A;  3GTP J;  3EUH A;  1ZYR F;  2WV0 A;  4A3B J;  4L18 B;  3PUF A;  5ICE A;  4N4O B;  3V4G A;  4BE2 A;  3E97 A;  3KX2 A;  5D5X B;  2KQR A;  2V79 A;  3IRQ A;  1FOX A;  2VBY A;  3HPH A;  1B1B A;  1F5T A;  3BR0 A;  3R6S A;  2LFB A;  5BS6 A;  4DBQ A;  3ECH A;  1OCP A;  4HNT A;  1JUP A;  4RMN A;  2HWV A;  3GVA A;  3HGY A;  1KQ0 A;  4KDP A;  1U2W A;  3OR2 C;  1P4A A;  2QWW A;  3VOE A;  3HOS A;  1IG7 A;  3GWZ A;  5AIP A;  2AHQ A;  5EF6 A;  3V8J A;  1T98 A;  2ZME C;  3PNT A;  3G1L A;  1IZ1 A;  3DBR B;  2O5R A;  1TNT A;  1VQ9 I;  2KZG A;  1MNM C;  2ZB9 A;  2CU7 A;  4LIT A;  2VUM J;  4YEL A;  4ENM A;  1BI3 A;  3BG9 A;  1ZR2 A;  3I71 A;  2NS8 A;  1KQ9 A;  2B7E A;  2R7X A;  1E3H A;  2NS0 A;  1H9T A;  4N4N B;  2RDP A;  1XSV A;  4HOB A;  3QOP A;  3C2H A;  3B6A A;  3H9J A;  4LIV A;  1JT0 A;  1OFC X;  3HOT A;  5L3E A;  1SFO J;  1DP3 A;  1MJB A;  4HNV A;  3OSG A;  3HB9 A;  5CKT A;  5C4J J;  1Y0N A;  1ZLK A;  3J7A Y;  1QBJ A;  2L9S A;  4D5C A;  2OBP A;  4XLP F;  2M8E A;  1B72 A;  1YW7 A;  4AVP A;  3HDD A;  3DQV C;  2KKO A;  2CFX A;  2IGO A;  2LSO A;  5EZG A;  4XRM A;  2HEO A;  3EYY A;  4G94 A;  1T95 A;  3Q9V A;  1QHG A;  4OAY A;  4M6X A;  2Y75 A;  3LWF A;  5CPR B;  2BY3 A;  2W24 A;  2DMQ A;  2Z1D A;  3P9I A;  1E17 A;  5IT9 Z;  1G4D A;  5E79 C;  5J4V A;  3ML6 A;  1O3R A;  2IA1 A;  1UJ8 A;  1REP C;  5IOY A;  4FIS A;  2NS7 A;  3E5U A;  3R60 A;  4JYK A;  4A0Z A;  4ZC3 A;  3JCU C;  5EG0 B;  3F23 A;  2ADU A;  4IHW A;  1OCC H;  2Z5U A;  2VKE A;  2DCE A;  4I0A A;  3BJ6 A;  5L3D A;  2TRT A;  4HBL A;  2P4W A;  2FJ1 A;  2EIK H;  3ABK H;  2AQE A;  3K2A A;  3M3Y J;  3JRA A;  2HS5 A;  1KU3 A;  1X1C A;  2WTE A;  3ZQF A;  5IPA A;  4H0E A;  3K4B A;  4KIS A;  4KUM A;  3DTE A;  2K9L A;  1GLN A;  4HQM A;  3KP6 A;  4NC6 A;  4A12 A;  3D0S A;  5CYV A;  1A31 A;  2L7F P;  1Y0U A;  3PIP F;  4XKB A;  3S2H J;  2CFO A;  3WGH A;  4F93 B;  1JKR C;  1WHU A;  4MHG A;  1IN7 A;  5F0F A;  3DEE A;  3E6B A;  3GLX A;  1Z9C A;  1UHM A;  5FKK A;  3OL3 A;  2A05 A;  4EVI A;  3FF5 A;  2X85 A;  2H8R A;  3JSP A;  2WAF A;  4EM2 A;  1MBF A;  4B4C A;  2V9K A;  5EGO B;  1U9O A;  3V42 A;  3OYA A;  3HRS A;  3QP5 A;  2DT5 A;  1KZH A;  3ZN1 A;  3LSK A;  4L5J A;  3JTG A;  2DJI A;  1D5V A;  4UUS A;  2M2E A;  3HEF A;  1JHF A;  3LQQ A;  2EZH A;  2VLA A;  5HOD A;  4V19 K;  2ZXI A;  3KEO A;  2M4K A;  2HZT A;  2JTV A;  2V1N A;  5LEJ A;  2UV1 A;  2EFW A;  4ZYE A;  1Y1V J;  4W1U A;  3IAS 2;  2XPV A;  3CUQ B;  5H6R A;  1IN6 A;  2FOK A;  1ETW A;  4MQ9 F;  4HV5 A;  5HDN A;  2CMP A;  2ME0 A;  3H5A A;  2QKM B;  4XR6 A;  4PSX A;  3GO5 A;  1P9Q C;  1U5T B;  1DGR M;  1QQI A;  4IQ4 A;  2E2I J;  3BC8 A;  3AL0 B;  3BQY A;  5LRR A;  4B47 A;  1TW2 A;  4BAC A;  4XRF A;  3SDB A;  2AXT C;  2QQ9 A;  2STW A;  4R8H A;  1Z6T A;  1IF1 A;  4B8X A;  5GP9 A;  4M72 A;  2P6S A;  1HW1 A;  2HOT A;  3I59 B;  3FMR A;  2XB5 A;  5B1B H;  1R6R A;  2E7W A;  2R7Q A;  1P4W A;  4XLE A;  3RYP A;  4F3Q A;  2O6G E;  1K6O A;  2OQR A;  1YIT I;  2OQG A;  4A93 J;  3L2W A;  3K4N A;  1ZQ3 P;  4X6A J;  2EV0 A;  1QZY A;  4M6V A;  2JN6 A;  1ACI A;  3F72 A;  5E3M A;  2MG4 A;  1TP4 A;  4NNJ A;  3ZP5 A;  3NWS A;  2ACJ A;  1D0Z A;  4M3F A;  4A3L J;  2CH0 A;  2K9S A;  1MDM A;  3KP7 A;  2ZNY A;  2M0C A;  3WU2 C;  2DAO A;  2HFH A;  5E20 A;  1UG2 A;  2DOD A;  2F5C A;  1FX7 A;  1MZB A;  3P7N A;  3OY9 A;  4IO9 F;  3CME I;  2MW8 A;  3CJN A;  1QO0 D;  2W7N A;  3SYT A;  5L3C A;  2JSP A;  3SHF A;  2JRT A;  2V1X A;  4G7Z F;  3CJQ B;  3Q3S A;  4NQW A;  2KIF A;  3TMO A;  4HLY A;  2Y0S N;  1LE8 B;  4ZJZ A;  3T0Y A;  4A3J J;  3MVP A;  2XKO A;  1YO5 C;  3S17 J;  2DA3 A;  3HL2 A;  1PP7 U;  3O6B B;  2MLG A;  3ZMD A;  2VT3 A;  1SMY F;  4E7I A;  1X2N A;  1FMV A;  1RC9 A;  1P92 A;  3OIO A;  4MGR A;  1SC7 A;  3OYD A;  4P9U A;  1TW3 A;  3JRB A;  2PJP A;  5ICG A;  4ZZL A;  3D5L A;  2O61 A;  3KZZ A;  3L2Q A;  5LBQ A;  3TP0 A;  3R0J A;  4MIM A;  2QBY B;  3OOP A;  3GZN B;  2XAH A;  4P96 A;  3M9A A;  2PMZ N;  1FOW A;  2YX7 A;  3LAP A;  5JR3 A;  3FM3 A;  3TQN A;  2K40 A;  3K4M A;  3LOC A;  4BHP A;  5M3M J;  3M07 A;  2VQC A;  3L09 A;  4A3E J;  2MGQ A;  1OCO H;  2LG4 A;  3PUB A;  2WB1 N;  3BG5 A;  2XAJ A;  2IW5 A;  2MAB A;  3QPT A;  4CYC A;  3PFI A;  4MO7 A;  2LR8 A;  3G2B A;  1S8N A;  3S14 J;  3GTJ J;  3HUG B;  4XOP A;  2XF6 A;  1FBU A;  2OF7 A;  4Y13 A;  2L9R A;  4JX5 A;  1LB2 A;  4LLN A;  5DCM B;  3H0G J;  4GGG A;  4LMY A;  3RKX A;  5J1Y A;  1P7J A;  3EET A;  3GCM A;  3OYJ A;  3ISP A;  1RRJ A;  1PYV A;  4PGH A;  2CQQ A;  2LBF A;  4U87 A;  4II2 A;  1ZRC A;  3GTK J;  3RSN A;  2Z3Y A;  2QZ8 A;  2JPB A;  3E7L A;  4CZC A;  2CWE A;  2Q0O A;  5HLG A;  3RZO J;  2KRF A;  3OYM A;  5F1R A;  1H88 C;  2LKX A;  5J4Y A;  5ED4 A;  3WTX C;  4XRS G;  2A3S A;  5FRM A;  3ZMZ A;  2BVL A;  3GTO J;  1ZHF A;  5K7Z A;  1Q1H A;  4LG0 B;  1TWF J;  2K27 A;  2MBF A;  1SVM A;  4EJW A;  5E3O A;  4GCV A;  3ABM H;  2NRA C;  3H92 A;  4UVA A;  4G8X A;  1MKM A;  1VQ8 I;  2Z9O A;  2O0Y A;  1BOB A;  3HUG A;  3ZXS A;  4QPQ A;  4BUP A;  1T08 B;  2GOM A;  1ZN2 A;  2VOO A;  5LGU A;  3J81 K;  3FIS A;  4NDL A;  1R7J A;  1JTX A;  2ISY A;  4BGD A;  1ZK8 A;  3IHU A;  1Z3X A;  2AXL A;  1JKQ C;  1R22 A;  3U1K A;  3SFI A;  1XCV A;  4KA4 A;  3AL0 C;  2X1D A;  2IS4 A;  2ZSI B;  2M45 A;  5J8C A;  3LSH A;  2IS6 A;  5BPD A;  5K1Y A;  1LUJ B;  4BY7 J;  1XGM A;  2HOE A;  5LLQ A;  4WXC A;  1MDM B;  4D1Q A;  2D1V A;  1MJA A;  3I53 A;  2EFN A;  1IRZ A;  2GIV A;  4D0P A;  1YJW I;  3B02 A;  3LNQ A;  3CJT B;  4RS8 A;  1HA8 A;  4B44 A;  5B1A H;  2GWR A;  3HOU J;  1YJN I;  2VQH A;  3AG4 H;  2VJI A;  4ESJ A;  3F3X A;  4PDK A;  4W97 A;  1WKM A;  1RES A;  2X9D A;  4BE1 A;  1G3S A;  3CTA A;  5TRD A;  1A36 A;  2KDO A;  3V7C A;  1S29 A;  2DYS H;  4EGY A;  2P0W A;  2W4S A;  5F64 A;  4BHC A;  3MKY B;  4A3C J;  3PQJ A;  1WCM J;  4HLX A;  3SDG A;  5BQT A;  1T0F A;  2XIG A;  2YUS A;  3CLO A;  3NRV A;  5H6Q A;  2XC7 A;  4ON0 A;  1QRY A;  1X4P A;  1I5Z A;  4HF1 A;  1OPC A;  2VE8 A;  3DFG A;  4K2E A;  5GAH J;  1MMS A;  1NTC A;  4FE4 A;  1IUY A;  2M4G A;  5IP7 J;  3HOX J;  3HKZ A;  1VQK I;  4IPA A;  1WFX A;  1LPQ A;  4FT8 A;  3QU6 A;  1VTN C;  4IVN A;  1KYZ A;  4IQJ A;  3HHG A;  9ANT A;  1RET A;  2X1C A;  2LRD A;  4M9S A;  1QVT A;  1IC8 A;  4DBR A;  3OYG A;  1MGT A;  2WAD A;  3JRC A;  1CF7 B;  2NOJ B;  1X1P A;  3SEQ A;  1KU7 A;  2OAZ A;  4M9Z A;  4M73 A;  2DK5 A;  4DNC A;  4AYB N;  3FK6 A;  5F04 A;  3V8L A;  3ZQC A;  3J7A O;  2VXZ A;  5E18 F;  3ASO H;  2B9S A;  1HOM A;  5M5Y J;  2M9H A;  4NC8 A;  2LKP A;  4ETS A;  1V4R A;  1H8A C;  3ZQL A;  2IA0 A;  4XLN F;  3W6V A;  5DDG A;  2HVR A;  2BY2 A;  5HS8 A;  1XGS A;  1ZRF A;  3O8H A;  3GFL A;  1UFM A;  2UXN A;  1KON A;  3EUK L;  2E1M C;  2EZK A;  3DBL B;  1HLV A;  2VPL A;  2FMY A;  3EYI A;  4UUV A;  2QEN A;  4IXA A;  4NC7 A;  1FEX A;  3TGN A;  1J2X A;  4D9J A;  3HIF A;  3DKX A;  2W48 A;  5E8G A;  1SAX A;  4FE7 A;  2W1O A;  2CQK A;  4V2G A;  3KPH A;  2XHK A;  3JRF A;  2JWT A;  5ICF A;  1LJ9 A;  1D8K A;  4E6K G;  2CSO A;  3BG7 A;  2KJC A;  1GHC A;  3PQK A;  3VPR A;  3MZY A;  5E17 F;  2ZFU A;  4AWX B;  4I98 B;  1G59 A;  1BR4 A;  4ENN A;  2XKP A;  4X0G A;  5BNG A;  1ZG1 A;  4HNU A;  5FRO A;  1X1B A;  2FBH A;  3QRF F;  3J80 Z;  1U0J A;  2WC2 A;  1BC7 C;  1VF9 A;  6PAX A;  3QWL A;  1ETK A;  4BQO A;  4NB5 A;  4A3I J;  3JW4 A;  2O7O A;  4XNF A;  1U9N A;  1WZ2 A;  3HKZ N;  3E6C C;  3L2V A;  2E71 A;  4AU7 A;  2ISZ A;  4CO8 A;  3FXQ A;  4LGW A;  1V54 H;  2EFO A;  4UNO A;  4XQF A;  2GA1 A;  4A3M J;  3VYR B;  2XAU A;  2NOG A;  2CO5 A;  1T6S A;  2JA8 J;  3WOD F;  1Y8Q B;  1I1S A;  2E5Z A;  2BZT A;  2HDW A;  3H5R A;  4KT5 C;  2VIX A;  5E1Z B;  1J7K A;  2NVY J;  1TWC J;  2R3S A;  1EH6 A;  2W57 A;  4HEA 2;  2F4O B;  2C6Y A;  1T56 A;  5EJC A;  4ABZ A;  5AIQ A;  2O8K A;  1IXC A;  5F6F A;  3MKL A;  3H3U A;  2EA4 A;  3DTI A;  2PMH A;  4MQV A;  4U0Y A;  2ECC A;  4N9H A;  2RNG A;  4M3D A;  1MBG A;  3RQI A;  1K7A A;  5IYD J;  1FBQ A;  1RKT A;  2F6C A;  2HVS A;  2EWN A;  3FMS A;  3DXJ F;  2ZJQ F;  1SEU A;  4A3F J;  2K9Q A;  3ASN H;  1X3U A;  1XC5 A;  2IGM A;  2XVC A;  1WSU A;  3GZ6 A;  1J59 A;  2FML A;  2X6Y A;  2I5U A;  2YU9 J;  1DGW Y;  1MBH A;  2BV6 A;  2YS9 A;  3MZ8 A;  2JVG A;  3Q0U A;  2XRN A;  3L00 A;  2CJJ A;  2DN0 A;  3KZY A;  2EIL H;  3L1P A;  2P5V A;  1O3Q A;  5HNH A;  4AM3 A;  1V3F A;  2DA5 A;  1R5G A;  2L7Z A;  1R4N B;  1ENH A;  3PFY A;  4NHJ A;  4CDG A;  2JQ7 A;  2R7R A;  1U5T C;  3S2D J;  2O03 A;  3LSR A;  3H3Z A;  3ZQI A;  5EDN A;  3K9T A;  5GAG J;  3I56 I;  4BE0 A;  2PLY A;  2DO7 A;  3WU0 A;  3B73 A;  3BDD A;  2R7O A;  2WWY A;  3GLL A;  2MA3 A;  5B3S H;  4IHY A;  1X3Z B;  2WY7 Q;  2LP0 A;  2VAS A;  4GXO A;  1HDP A;  1A5J A;  3F6O A;  5HDG A;  2V9P A;  2EK5 A;  4RGS A;  4A6E A;  5F08 A;  3WTW C;  1W36 D;  1YW9 A;  1Y8R B;  2FA5 A;  3OL4 A;  4B48 A;  2L2O A;  3MKZ A;  4WX9 A;  3K1P A;  3OSF A;  4PFP A;  2M34 A;  4LIU A;  4R79 A;  2F5D A;  3N97 A;  1CGP A;  1IRF A;  2LC2 A;  3DEU A;  2CUJ A;  1LDK B;  3CC7 I;  4L0Z B;  3F8F A;  4PK4 A;  2EH3 A;  2K02 A;  3E3V A;  4HDU A;  2DT6 A;  2VBW A;  1FJL A;  2L4A A;  3CMA I;  1AU7 A;  1IRG A;  3NWT A;  4ENK A;  4OIR F;  2ZC2 A;  1ON2 A;  1FMW A;  4M9X A;  4CCM A;  4RAG A;  3HGG A;  4FTH A;  3GME A;  1S72 I;  2J5O A;  2HR3 A;  3TO7 A;  2E1O A;  2WAE A;  1B8I A;  1Z6R A;  2KFD A;  3CCY A;  4Y52 J;  1IXS B;  3S16 J;  4L9V A;  2LNB A;  1N77 A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 3CCQ I;  2QA4 I;  3CCS I;  1VQ5 I;  3EGV B;  3CD6 I;  3CJR B;  3CCL I;  2E35 A;  1VQ7 I;  3CCU I;  2E36 A;  2ZJQ F;  2E34 A;  5JVG F;  1YIT I;  2FOW A;  1YI2 I;  1ACI A;  1FOY A;  5GAE J;  1VQN I;  1VQL I;  1HC8 A;  3J7Z I;  1VQ8 I;  3J7Y J;  2JQ7 A;  4IO9 F;  3CME I;  1YHQ I;  5DM6 F;  3CJS B;  1VQ4 I;  3CJQ B;  5GAG J;  3I56 I;  3G71 I;  1FOX A;  1YJ9 I;  2K3F A;  3PIP F;  2ZJR F;  1WIB A;  3CCV I;  2OTL I;  3CCJ I;  1YJW I;  1VQO I;  3CJT B;  2OTJ I;  1VQM I;  3G6E I;  1YJN I;  5GAD J;  1FOW A;  1VQ9 I;  3G4S I;  3CCR I;  3CCM I;  2QEX I;  3CC2 I;  4V19 K;  3CC7 I;  2ZJP F;  4IOA F;  5DM7 F;  1YIJ I;  3I55 I;  3PIO F;  1VQ6 I;  3CMA I;  3DLL F;  1Y39 A;  2H8W A;  5GAH J;  3CC4 I;  4IOC F;  1MMS A;  3CF5 F;  1S72 I;  1QA6 A;  1VQK I;  2NXN B;  1VQP I;  4UY8 I;  3CCE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...