2K3FA

Ribosomal protein l11 from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
b'MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L11
publication title Domain reorientation and induced fit upon RNA binding: solution structure and dynamics of ribosomal protein L11 from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Ribosomal protein
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2k3fA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2k3fA01
3CCJI 1WIBA 1VQLI 3CCMI 1VQ6I 2ZJRF 1VQMI 1YHQI 2E36A 1S72I 2FOWA 1VQOI 3J7YJ 4IO9F 5GADJ 1YIJI 1VQNI 3DLLF 1VQ5I 3PIOF 3EGVB 3CJQB 5GAHJ 5GAEJ 3CC4I 2OTJI 1HC8A 2E35A 2ZJPF 3CCQI 3CCRI 3CCVI 1ACIA 5GAGJ 2NXNB 2K3FA 1YJNI 3G71I 1VQ7I 3CJRB 3CCEI 1VQPI 4IOAF 3CC2I 3I56I 3CC7I 3J7ZI 1Y39A 1FOXA 1FOYA 2JQ7A 5DM7F 3G4SI 1YITI 4V19K 3CF5F 3I55I 1YJWI 1QA6A 5DM6F 1VQ8I 1FOWA 2OTLI 1MMSA 1VQ4I 3PIPF 3CMAI 3CJTB 4UY8I 5JVGF 4IOCF 3CD6I 2H8WA 1VQ9I 3CCSI 2QA4I 1YJ9I 1VQKI 1YI2I 2E34A 3G6EI 3CCUI 3CMEI 3CJSB 2QEXI 2ZJQF 3CCLI
chains in the Genus database with same CATH superfamily
3BG3A 4G7OF 4NDLA 3ZMUA 1RUNA 3ZQIA 2VQHA 2L3DA 1ETWA 5HDKA 3PJRA 3K6GA 3GFLA 1HLVA 1EF4A 3HTUA 3NEUA 2JA6J 1FSEA 5BNGA 3O8GA 1MKMA 1Z21A 3RPUA 2AO9A 2QVOA 3TP0A 3OYKA 2EZKA 5DCMB 2OC6A 4CYCB 5LD2C 1OCCH 3BG7A 1R5GA 1ETOA 3DPUA 4ESJA 4RB2C 5LGNA 3O8HA 1IG7A 3BPVA 2ZXHA 4C3HJ 2JMWA 4JQFA 3OYNA 5GAHJ 4CH7A 2P7VB 1MNEA 3OOPA 2EFWA 3OIQA 5KNLA 3AKZA 3ROUA 1ACIA 4KT6A 2MBFA 2K3FA 2MC4A 4IVNA 3W2WA 3ZMSA 2LK2A 1J0RA 2DFIA 1LDDA 4PGGA 1ZGWA 5TISC 3NAUA 5IT9K 3VOEA 3KZYA 3WG9A 4CSWA 4Y3OA 4BHBA 2FSWA 2LP0A 4CCMA 3SJMA 3SFIA 4G9YA 1TW2A 3K10A 1EH8A 2COBA 4OU0A 3L2UA 1ZLJA 4EV0A 1R23A 2KJCA 4F93B 1PUEE 4BEHB 2JVHA 3PUFA 1MDMB 1K7AA 1BC8C 2W57A 3HGGA 5F27A 3RPQA 5H6RA 4FISA 3BR3A 2IJLA 2NS8A 2V6CA 2ESHA 1LEBA 4IL6C 4ZC3A 5HDNA 1GXPA 3BDDA 3HBLA 3MKLA 2DW4A 5LGUA 2QM3A 3K70C 4RLQA 4TV7A 3LA2A 2W4SA 5EGOB 3E6CC 1FOKA 1Y0NA 3ZCOA 5KVRA 2HU9A 1OR7A 2XIGA 2CQXA 4AIHA 1SMTA 2KIFA 1I1GA 2DJIA 2ZMEB 3KYCB 5HS9A 2LOOA 4NQWA 4NB5A 3VYUB 3IP4B 2VIXA 3HG9A 4XRSG 3ERMA 3TDUC 2HKOA 2MABA 3GTQJ 3OL3A 3VEPA 2D1VA 2IRFG 3G1OA 3TP3A 2ZSIB 4GO1A 1HSTA 5GTIC 5JHUA 3PSFA 1EKEA 3L2QA 3CJSB 3H3ZA 5EEHA 4AIJA 2JA5J 2F5FA 1SANA 2K9MA 2QEXI 1IXSB 3H5RA 2XHKA 2ME0A 3N05A 2LDUA 3DKWA 4LLGF 3BZKA 4EM0B 3CCYA 1W36D 1JTYA 4P55A 1TZLA 1JUSA 5LGTA 1DQUA 3H0DA 5JLXA 1IN8A 2EA4A 4ENJA 3WGHA 3WGGA 3LSHA 1ON2A 1O3RA 4WWCA 2ZB9A 1UJ8A 3GMEA 3QQAA 1D5YA 1PUFA 1LFUP 3VYRB 4MQ9F 4N9IA 2VUMJ 2V9VA 4BE0A 4II2A 4IPAA 1TC3C 1Q1HA 2EA2A 3LAJA 1F36A 1JKOC 3VYTB 4I99C 5B1AH 2XKPA 1KYWA 2K27A 3ECOA 3RQIA 1BR2A 3V7RA 1HW2A 5D4SA 2HOTA 3CJQB 4ZYDA 4Y13A 3M8FA 4L5IA 4UXNA 1MBGA 5HLGA 2M8EA 5LBQA 3JRFA 5J1RA 1K83J 1KONA 3MEXA 2NVYJ 3PFIA 2R4GA 4KNYA 5EF6A 2OZ6A 4E7JA 2OBPA 3MMYB 4A3JJ 5JHFA 5E3MA 2OQGA 1SFXA 3OV8A 3OIPA 1F5TA 2GZWA 2LR8A 4KITB 4L5JA 1BJZA 1I6XA 4E7LA 4FHTA 4JK1X 3LA7A 2E60A 5K5QA 3MZ8A 3FBIB 3O2PE 3VWBA 2BE5F 5K7ZA 5DUKA 3HDDA 2L4AA 2XRNA 3K1MA 3ISPA 2ZNYA 1MD0A 3JCUC 1KQ9A 3T5XA 1E3PA 3FMRA 2GIZA 2ZO4A 2JVGA 2BVLA 3Q9VA 1N25A 4PCQA 4E4HA 4WXDA 4YIIA 4HLYA 3GFMA 3L00A 1DDNA 3OYHA 2HYGD 3CP2A 2WADA 2X1DA 3MZHA 5M3FJ 3LFKA 3KEQA 3H0GJ 3I54A 4GYIA 1JE8A 2QKLB 2JA2A 2RKHA 5HNFA 1S5LC 3FXUA 5J4VA 3JRIA 2JUCA 1F9NA 1YX5A 3H35A 1LVAA 1RC9A 2WBMA 3A02A 5E8IA 3JREA 1X19A 4D5FA 1SD6A 3GVAA 3S32A 1Y0UA 2CMPA 2XGDA 2CW8A 3K2ZA 4XICA 4B1RA 3WU1B 1IV8A 2H6BA 3FKJA 1DGWY 4MQVA 3CCLI 4C2MJ 2H94A 1RNLA 5M5XJ 2X6WA 2OCEA 4EMSA 1OYWA 5FFZA 3FZVA 1U2WA 4GXOA 5LEJA 4OOIA 4FT8A 1G6NA 1Z05A 3LA3A 3EPZA 3HKZN 2XF7A 2NVTJ 3RYPA 3H9QA 3SQNA 2LRDA 2Z99A 1M1EB 3AG1H 1CF7B 2DAOA 3KETA 3G1MA 3HB9A 4MEYF 1IN5A 1VQ5I 3GTKJ 1MMNA 2R7SA 4UNOA 4HPQA 2HTSA 3J81K 1ZR2A 1XCVA 4ITVA 3QYEA 3B6CA 4Y52J 4N4OB 3FMQA 3K4CA 2NXNB 2JSCA 4EJUA 2ZC2A 2TDXA 3CUQC 3B6AA 1B9NA 4XN0A 4B48A 4AC0A 1I39A 1OCZH 2B9SA 3WU0A 3ZQGA 1WPKA 3E5XA 2W00A 4RGSA 2BGCA 4KJZA 3OMYA 2CYYA 4PSXA 2DCEA 2WAFA 1O7LA 1K61A 1LJ9A 1MH3A 3CCEI 1SFOJ 3KP6A 1I3AA 2P5VA 3NWSA 3H9GA 5B66C 2OF7A 1AKHA 4NC8A 3EUAA 2FRHA 3V4GA 3OYEA 2RQQA 4EGZA 3RTRA 3BC8A 2VN2A 3NQOA 1TQIA 4UUVA 2F48A 3OIOA 4I0BA 3G4SI 2K02A 1YITI 3AL0B 4BEHA 2QLZA 1MDMA 1YX3A 5C4JJ 2L9NA 4Z2YA 5DM6F 3BJAA 5CKTA 4C2UA 4A12A 3JTHA 2K4BA 4A3EJ 3V8JA 4BBRJ 3S17J 4FETA 4CCKA 1YS7A 3W3CA 3S2HJ 2HI3A 4XRSA 3OR2C 3KEYA 1WJ5A 2VODA 2P8TA 2DMQA 3CUQA 5CVJA 4A0YA 3S1RJ 2OCCH 4RGXA 5B5EC 1Z6RA 3QPHA 2BY1A 2E1MC 3K9TA 2VE9A 2BY0A 2RN7A 2ZMEA 3TQNA 1U8BA 2WAQN 1OLTA 1F4KA 5TJJA 2IVMA 3E5UA 3QYBA 2PMZN 2GLOA 5E3NA 2STWA 1Z7UA 1UFMA 4IEJA 5E79C 4A93J 5CQEA 5F0FA 1IZ1A 3SEQA 4U0WA 1VQLI 1GXQA 2MH9A 3ASOH 3ESWB 3F21A 3F8CA 3CQZJ 1HXDA 2VKEA 1YG2A 1WH7A 3PNYA 3GTMJ 1LNWA 1Z67A 3TMOA 1BR4A 3KP5A 4XLNF 4KFCA 2HTJA 1V5FA 2M2EA 2XASA 3D5SC 3FISA 3IRQA 1XG1A 1G3TA 5L3DA 2P0WA 4MFEA 1S72I 2CUEA 4MEXF 5IOZA 3ZQQA 4HX4A 4RDUA 2JT1A 3JSOA 4E7HA 1WCMJ 1D3YA 5K5OA 4P1WA 4M71A 4NNJA 5TGTA 4Q4ZF 3BQYA 1UZCA 5GTHC 2KDOA 3S1MJ 2ELKA 5IP6A 3BG6A 4U87A 1AWCA 2G7HA 3GZ5A 2ZJPF 2BOLA 3CESA 5A2QZ 4A3MJ 2DQLA 4PZJA 1TL8A 1L3LA 1P6RA 2V79A 5KHDA 4LK1F 5FLXK 2F5EA 2R7WA 2M3AA 2YX4A 2VC1A 4U0VA 2XF5A 3KLNA 2XF6A 3V42A 4L0ZB 2HVQA 4YFXF 2R7ZJ 4B43A 1FY7A 3J80Z 2QWWA 4IX7A 5LFAA 2M34A 1S7EA 3HOTA 2OA4A 3ELKA 3BZ6A 2EBIA 2O3FA 4AYBN 1H89C 3K4NA 5F64A 1B59A 3EYIA 1BOBA 2XVCA 4PGHA 5ED4A 1JKPC 1JKRC 1IN7A 2ADUA 2X1CA 4HX8A 1HKSA 4HNVA 3ASNH 1UB9A 1TQPA 1O3TA 2HPMA 2DA1A 5ILUA 5K5RA 2HDCA 2QF7A 4Y33A 3DP7A 1YW7A 1G8XA 4Y17A 2EV5A 4BS9A 2EWNA 2QSFX 2UUZA 1ZREA 2W1OA 1UMQA 5C3EJ 2P7CB 1QA6A 1MJBA 4JX6A 4C3JJ 5J1YA 3C1DA 3SZGA 1U5TC 4LG3A 4LLNA 1HOMA 2CRGA 1BIAA 2DOAA 3GEZA 2WWYA 5DYMA 2GA1A 2BY3A 2V1DA 3CJTB 3OYCA 3IWZA 2V9KA 2MW8A 4XQFA 3HZJA 4BBSJ 2KKOA 3BOQA 1XDSA 1T33A 4YEJA 4S05A 1R22A 3TEDA 3DQVC 2OU2A 4RBOA 1ODDA 2JSPA 1I5ZA 3H3UA 5L3FA 3K4KA 4BHCA 2EK5A 1YYVA 2PJRB 2VI6A 3A2KA 1A04A 1J7KA 2X4HA 4U0YA 3IH2A 3HHGA 1HQCA 1FC3A 2L7FP 2HZDA 4ZH4F 3OYIA 1R5HA 4B3XA 4HNUA 2A6EF 3I53A 5D6FA 4JBAA 1ETQA 4Y4RA 1HKQA 3F6OA 2O61A 1R58A 5E8GA 1K4SA 2HYJA 2M5WA 4BQNA 1FTZA 4CUGA 4E7ZA 1BI1A 2QYOA 1DGRM 1KU2A 3COAC 1U5TA 2COMA 3MQ0A 2V7FA 4HQEA 1R71A 4A6DA 2PG4A 2R92J 1LDJA 2BYVE 3ABUA 1VQNI 3ZOBA 2XSDC 2W25A 4LFUA 2E7XA 3S16J 1MGTA 3LFUA 5CVIA 5BOXA 2LMDA 5GAEJ 3CC4I 1JT6A 3PQKA 3GTOJ 4CCJA 3HHHA 1ZKGA 2ISZA 2QZ8A 4O3MA 1FP1D 3CLQA 3KFWX 1YJNI 2R5ZB 3ZMZA 1WRJA 2EQRA 4XORA 1S3JA 1I6HJ 2D5VA 1LEAA 2DYSH 3K1PA 3H1CA 4J00A 3TW6A 1GT0C 2YSRA 4DYCA 2KHMA 3CLOA 1D0YA 1RESA 1WHUA 3V7SA 2PI0A 3CC2I 4J01A 1Z6TA 1E3OC 1LE8B 3A0HC 5AIPA 1T0FC 4F91B 1MJ9A 3RZOJ 2QGUA 3B02A 4M3BA 5LLQA 4QLCU 3DXJF 1X58A 4XOPA 2FEZA 3A0BC 3K2AA 1FBSA 3C2HA 3C3WA 5FRMA 1Z77A 1BI0A 2DPUA 5HOOA 2JTVA 2Q1ZB 3OWTA 1FWZA 2UZKA 2HXOA 5D5XB 2O7OA 1TBXA 2FBHA 2I10A 3FXRA 3KZZA 1QQIA 1FIAA 2EZLA 4B3AA 2AS5F 3BG5A 3ZRGA 1T2KA 2VPRA 3FBNB 4XR6A 1N78A 2DQRA 2HQRA 1P7JA 4EEFG 3KCCA 2CQ7A 3UR3C 2VT2A 2YU3A 1ZRCA 3CCSI 4A3DJ 1X3WB 5FB2A 1FZPB 2ZXIA 1MNDA 3EUKL 1P4AA 2STTA 2XV4S 4EJTA 1TNTA 1QRYA 1ZG5A 1NK2P 1VQKI 1GLNA 3R0JA 3KYDB 5FKNA 4ZYEA 4BACA 4XLHA 5F0CA 2RNJA 5CPRB 3T8TA 2MH2A 2IA1A 3SEZA 1T0FA 4MNUA 2WTEA 1WH5A 2LNBA 3KP4A 4XLEA 2M4GA 3IH3A 1TT0A 2W82A 2K9SA 2VJ5A 4BE1A 1SFKA 1WJFA 2HVSA 4KMFA 2BHYA 3IAM2 1X2NA 4KMUX 3RYRA 2ZJRF 2F5DA 2NVXJ 2VLAA 2DYRH 3GUDA 1TT5B 1YRNB 2R7FA 5AONA 2LREA 3SZPA 1XTAA 4FX0A 3MZYA 2K3PA 2A6TA 3M8EA 1X4PA 3PO2J 1QZEA 4IHSA 2PQ8A 2X51A 1P4XA 1IRZA 5ILSA 1RPWA 4HAMA 1ETKA 1OMIA 4IHXA 3FIWA 1WWXA 2LSOA 3BQZA 3I59B 3M1CA 4H0EA 4EVIA 5F1JA 1V55H 3OL4A 4DQ2A 4J19A 5IYBJ 2EZHA 3HIFA 1FIPA 4BAYA 2ELHA 5HVQC 3BTCA 3FMSA 3FXQA 3L7WA 5HLTA 3VDXA 3CJNA 3D5RC 4D0PA 1KGSA 3BT9A 2WB1A 4HV6A 4PJMA 2K9NA 3GZNB 5JI6A 1IUYA 1SFEA 2DA2A 3LSIA 4DW6A 1T38A 3K70D 3ERED 2A69F 3M7GA 1G3WA 2QQAA 3GTPJ 3ZPLA 4MFDA 1OR7C 1FOYA 1C0WA 4N4NB 2VJJA 3OR1C 4QPOA 1JXSA 1HDPA 4C3IJ 3I64A 3I55I 2IBDA 2X0LA 2XDVA 1YJWI 1DU0A 1J2XA 4L9VA 1KA8A 2IEKA 3KP7A 1I1SA 3V8KA 3W6JB 3JRHA 3WE3A 1T95A 5FD5A 5FKLA 4NBQA 3DKYA 1MBHA 1OYIA 2KRCA 2IW5A 1ZR4A 1AU7A 2DXIA 2ZNZA 4LB6B 2KP6A 1KU9A 1GV2A 1YQAA 1R36A 1BJAA 3HPHA 2CUZA 4W97A 1YLFA 2VQGA 1Z3YA 1XSDA 4ENKA 2XRLA 3NRVA 1WKMA 2H27A 2M30A 3W2VA 1WJDA 4ZTJA 3IL2A 3F8BA 4CXFA 3C2GA 2L54A 1QO0D 3I9V2 1XGNA 4A69C 1XDUA 2IGMA 3FXJA 4XLCA 4A0XA 2M7AA 2ZJQF 3PM1A 3BLYA 3U2RA 4AU7A 4MLOA 4YELA 5J8CA 5K7HA 1WIBA 4LGWA 1B9MA 2D1HA 1FBQA 4KIFA 3W6KB 3JRAA 2DI3A 1MMGA 1O7FA 3HPGA 3HTSB 2JZYA 4ABZA 1R1VA 2EIJH 4P9UA 2ZSHB 3WODF 1IDYA 3O6BB 3M3YJ 2VKHA 1JTXA 2RVCA 3R4KA 3R6SA 2VKDA 3LNQA 1FP2A 1JGGA 3Q0UA 3QPSA 1ZGAA 5FLMJ 1X2MA 2X9DA 3UNGC 2FD5A 1RKWA 2E35A 4BL0B 2NOGA 1DUXC 2NYXA 3JAMZ 1ETYA 1NG7A 1VQ7I 5BMZA 2ECCA 3C7JA 5CJ9A 2PJPA 3ZMDA 1U6GA 1B72B 1EJ9A 3K4BA 1TWAJ 1ZRDA 1RR8C 2PBIA 5TRDA 4N0BA 1O57A 3U21A 5BPDA 1XGSA 2WY8Q 4DYRA 4EM1A 4EJWA 2FX0A 2GXGA 2Y0SA 2PMZA 2IS1A 5M5WJ 4CZZA 1K78B 1BC7C 3G73A 2VPLA 1E2XA 4AVPA 3KX2A 2HDDA 4CA0A 5JR3A 1UHSA 3DPTA 2F2EA 4HW0A 3OYAA 1UHWA 2Z3YA 3A01B 4BQAA 1B6AA 3E0JB 2BY2A 3L1PA 3HL2A 1LE8A 4M6XA 1BW5A 1WJAA 4XKVA 4EATA 4G94A 3IH4A 1NH3A 1J09A 2XB5A 5DCFA 5EG0A 1GDTA 3BR2A 4WXHA 1ZG3A 3FHZA 1YOVB 2JA7J 3MVPA 3MN2A 3GF2A 4BKXA 1FMVA 3E97A 1P7IA 4DIQA 2O9LA 3K4MA 2FNPA 4IOCF 2EINH 4PJ0C 3VFZA 4Y15A 1ZK8A 2HQ5A 2R7VA 1VQ9I 2A07F 2Z5UA 3PQJA 2DOFA 3DF8A 2FE3A 2M45A 2VXZA 5CQGA 4OIRF 1WQ2A 3HSFA 2DA4A 5L3GA 1W36C 3OYMA 2V1NA 4PSWA 4H4KC 4KA4A 1WI3A 3G6EI 2L7KA 2DFHA 3ABMH 5J8FA 2DMNA 1J75A 3MFKA 3CTAA 3WTSC 4WX9A 4AIKA 2EFNA 5CVRA 3AG2H 2CV2A 2VJIA 5IOYA 3S93A 2FUG2 5E20A 3L9FA 3Q0VA 4AIDA 2E5ZA 1WSUA 3RDIA 3JW4A 2Q0OA 4I09A 5GPCA 2LVSA 5EYRA 4IHTA 2P6TA 5FROA 1O3SA 4RM2A 3IAS2 2ECBA 4A2UA 1ON1A 4V2FA 3F8MA 4BUPA 1BM9A 5FJ8J 3VSKA 1ITYA 3E3VA 5L3CA 1YRNA 1IC8A 4CDGA 3I58A 2FBIA 4ESBA 5IP7J 1AOYA 2M0MA 4RA2A 4Z6YA 1W0TA 3CZ6A 1OJLA 1P9QC 2X6YA 3GWZA 3GFIA 1WFXA 1SD4A 2OZUA 3TGNA 1J59A 1A5JA 1TWFJ 4HX7A 2XAHA 1X1BA 4FE4A 3E7LA 1W5SA 3LMMA 3RKQA 3SZTA 3I3LA 3HEFA 1CQTA 3I59A 4GYGA 2VBWA 2E2HJ 1IUFA 2W48A 1V4RA 5D5WB 2K9QA 1Q1VA 2NOJB 2VE8A 5L3BA 3JRBA 3I56I 5DCMA 2MYSA 2OUMA 3ABLH 2UWMA 1QGPA 4CYCA 1X1PA 3EYYA 3KZIC 3BP8A 4LD5A 1MBJA 1ZYRF 2H6CA 3QAHA 5EJCA 2LBFB 2KRFA 1BL0A 2CQKA 3GBGA 3T1BA 1W7PB 4RM3A 3ZXSA 1RR7A 4XBFA 4XRMA 4O5VA 4JX5A 2L4MA 3JR9A 3QP6A 1SEUA 4G7HF 2FJ1A 2M8GX 4Q5SF 2DJNA 1RUOA 1UAAA 3GLXA 1VTNC 2ZMEC 2E2IJ 3SDGA 2OTLI 1T8IA 2Q2EB 4UUSB 2IS2A 1U8RA 4HF1A 4A5MA 5F1RA 1X1CA 1MSFC 4M3FA 1ORKA 3T0YA 3FHNA 2H8WA 1QHGA 4IQ4A 5HS8A 1X1AA 3GCMA 3KIOA 2EILH 2F4MB 4ZDLA 3TKYA 5DTDA 3FWEA 1JGSA 2A61A 1XS9A 4OAYA 1YI2I 3LOCA 1SVLA 2F5CA 4MGRA 5LEKA 4HA8A 1WJBA 2AQFA 3ZQFA 3FXOA 3G3ZA 4JP0A 6PAXA 2XAQA 4DZPA 1Z3XA 2KZVA 1Z1DA 2PFBA 2Z16A 1IAWA 4S0HB 5FKOA 1XGOA 4BQQA 1SD5A 3A4CA 3C18A 4BDYA 1WVRA 4G12A 5F08A 3GZ6A 3CCMI 5HDGA 1VQ6I 3MAJA 1B4AA 5EGOA 3PSIA 4UB8C 4C30A 5A2QK 2CV0A 1JHFA 4KIBA 3ZN1A 2DK5A 4F52A 3N97A 4JYKA 2B63J 1QZZA 3GXOA 5GADJ 4KDPA 2O5RA 4KIGA 1S9HA 1OFCX 3J80K 3QU6A 3FDYA 4FQGA 4XRFA 2CUFA 2KIMA 2OTJI 2PEXA 4MIMA 3QPLA 1LFBA 3EETA 2EFOA 2ID6A 1L0OC 2A6HF 3ULQB 3DTKA 3X2QH 4GDFA 3IKTA 3G71I 5J1UA 2DT5A 2KL4A 4E70A 5J6XA 1PP7U 3HYIA 4RLFA 2MFZA 1A36A 3ZQHA 3MKZA 4DGWB 2XGEA 2VQCA 4UVAA 4FX4A 1GVJA 2HXIA 2PMUA 4M6YA 3SYTA 3F22A 2BW3B 4UHTA 1B72A 1USTA 4KICA 4R8HA 2V4JC 3DKXA 3H92A 1WGXA 4QSHA 3F8FA 2G0EA 1IN6A 2MLGA 1KZHA 1HW5A 1D1AA 2M0CA 3LQQA 1MNMC 1J5YA 2E19A 2W85A 5H20A 4CICA 3WTWC 1EH6A 3Q0WA 2XAGA 2DOEA 5BS6A 3OYDA 1SVMA 1W7PD 1F1ZA 4K2EA 2P6SA 3A01A 4HF2A 1BI3A 3OYFA 5D6EA 5FGMA 4XOTA 3N4MA 4BE2A 3HSEA 1MZBA 4ON0A 1IF1A 2VQLA 4IKFA 5JLWA 3K7AJ 4ZZLA 1LUJB 1N77A 4CCLA 3LSRA 1IV6A 3ZMTA 4HSTA 2DK8A 3ZP5A 4BH9A 2FXAA 1SAUA 2ZXJA 4C9YA 4LB5A 2RV8A 4XMYA 3IC7A 2NS7A 5D8LB 1XPXA 3PUBA 1A31A 2P4WA 2DA7A 4I2OA 3ML6A 3CMEI 3S8PA 1IJWC 2KIUA 2R7DA 3V8LA 5KK1A 2UXXA 4CO8A 2I8DA 2ESNA 2GXAA 5K1YA 5E1ZB 2MD0A 1ZLKA 2ZBKA 2EJRA 3R60A 3DTIA 4DBRA 2XC7A 1WJCA 2OQRA 1QPIA 1YIOA 3W6VA 3WG7H 2GOXB 1WJEA 1STZA 1W1WE 2ZFWA 3HOXJ 1ETVA 4DZJA 1LDKB 1LFPA 3VYSB 5IPAA 4BY7J 4HLXA 2HVRA 2Y0MA 3I4MJ 2W7NA 4HBLA 4QIWN 2FQ3A 2E36A 1I27A 5FKKA 4ESFA 4XSXF 2FOKA 3K4JA 4UV9A 5ERIA 4YIRX 4IRGA 2D45A 3EGVB 2HKXA 1WI9A 2NRAC 4GCVA 3RSNA 2ZCWA 1VNDA 5H2FC 1QVUA 3F9KA 3CMMA 3HUGB 4QTRA 1FTTA 1ENHA 4U7DA 1JUPA 3CCRI 2FA5A 3GTLJ 2KQRA 1PJRA 5FKMA 1MBEA 1E17A 3AG4H 2D2WA 2WAEA 4PFPA 2OV7A 4PK4A 1H88C 5IYCJ 1RETA 1D8JA 5EEGA 2HEOA 1Z7LA 2QCOA 4OAZA 3D5LA 2DT6A 3OSFA 4E7SA 4EJOA 3F72A 3DWLE 3RKWA 2CQQA 4CZCA 3TO9A 2K4JA 4I0AA 4D7NA 2XROA 2K40A 4IZZA 1HBXG 2XB0X 2MD5A 3WTXC 1OISA 3J7ZI 3AAFA 1CF7A 3M8JA 2X85A 2Y2ZA 1IRFA 2A3SA 2QBYB 3REOA 1Y6IA 2ISYA 2DTRA 1SFUA 2VOOA 1V3FA 3H3VK 4V19K 2AQEA 3KLOA 3JSPA 4D1QA 2BV6A 3CF5F 5DD8A 2JN6A 2Z1DA 5DUIA 1S6LA 1U0JA 5JVTA 2LY9A 4XNFA 2L7ZA 3S3OA 2IPQX 1W7PA 4KT5C 2R5YB 1V5GA 2QQ8A 2BBYA 3I0TA 3GTGJ 1XCBA 1HA8A 4XL9A 1HDDC 1TWGJ 4ZYGA 2EIMH 2XAJA 1I50J 4IRIA 2VL8A 2E7WA 3RIRA 1DPRA 2Q2EA 4UUSA 4FTHA 4WXCA 4E7KA 2QSGX 4PFOA 2F4IA 4NUBA 1ZHFA 1FT9A 1IW7F 2VBYA 4PUSA 3G2BA 1T98A 2E34A 2H8RA 2CWEA 4BYYA 2EB7A 1XMAA 2VXDA 5D5UB 1U78A 1ZAOA 1TWCJ 3DBRB 2IGNA 1YW8A 4OIPF 1IRGA 2GBYA 1HCRA 5FO5A 5E3LA 2R7RA 3QPTA 2XUBA 1ZTRA 3ZGKA 4WCGA 3P7NA 3H5NA 5LRRA 1FYLA 1U9OA 4YG2F 2NVQJ 4B4CA 4M3GA 4XK4A 4UB6C 3LQRA 2IXSA 4OIQF 1F43A 1I3QJ 5HLHA 3I4NJ 5KCMA 3BR5A 3PNTA 1VQOI 2L5QA 1RIOH 2M9HA 3HRUA 4RB1A 3TO7A 3WE2A 3S2DJ 2Y48A 1XB4A 2J5OA 4ENMA 5B1BH 2FNAA 4MTDA 3DU6A 1KYZA 2M7BA 2LKXA 1T08B 4LG0B 2VOPA 1DPUA 2HQNA 1FEXA 3S2WA 5EEAA 4A3CJ 2LFBA 3B73A 1XSXA 4L9NA 4LIUA 3U9GA 3K0LA 2JK3A 3ONQA 3J7AY 4HDVA 1P92A 3ZQ7A 3BY6A 4B09A 1UCRA 2MSYA 1FYKA 2JA8J 4RB0A 3JTGA 2O03A 1RRJA 3ABTA 4FE7A 1JHHA 1REPC 1Y8RB 3QOEA 3S15J 1HW1A 1OKRA 3LSMA 2PMHA 2W24A 4LK0F 3BWGA 3CC7I 5F04A 4OIOF 1QBJA 4GFBA 3IKVA 2ZXWH 4BU2A 4DJAA 2Z33A 5BPIA 2QUFA 5F0HA 1R4NB 3MKYB 3TOBA 2OJED 3FXMA 4KUMA 4A3GJ 2H1KA 3Q5FA 4CCNA 2BW3A 3NARA 2FMYA 2A68F 2LG4A 4BQOA 1R7JA 2L9RA 3RQ4A 4A6EA 1LB2A 4XKWA 3BR0A 4EJVA 2E1NA 5HNHA 2Y75A 4D5CA 4L9TA 3M1EA 1TTYA 3H36A 4XKBA 4LITA 3EUHA 2Y9YA 1MMSA 5J40A 4M6VA 3G1LA 1QU3A 5IYDJ 2RQPA 2PLYA 3HOYJ 4IXAA 3HOZJ 2BZTA 2YS9A 3CD6I 1GVDA 4DOZA 1D0XA 4UVCA 4R79A 1D8KA 1TW3A 1GUUA 2ACJA 4NHJA 1SC7A 1XC5A 2EZIA 2QA4I 1VF9A 2L7MP 5EDNA 3BROA 1S8NA 3HKZA 3LWFA 2FU4A 5IT3A 3F23A 4A0ZA 2L02A 3CDIA 1TQMA 3RZDJ 1H9TA 1TP4A 3AFHA 4ZDPA 4RGRA 1MMAA 4I01A 4KISA 2BXZA 2X6OA 1ZQ3P 4P96A 4XN3A 2YR2A 4A3IJ 4BXUA 2G9WA 2HOAA 3HRTA 3IWFA 1T6SA 4ZTFA 2KFDA 2CV1A 3JAMK 1O4XA 2TRTA 1AKHB 2A5WA 5GP9A 2HOEA 2KDZA 3QODA 1FNNA 4HV5A 1BR1A 2FOWA 4OMYA 4G6DA 1YE9A 3DLLF 4DYQA 2DA5A 4F92B 1IXRC 1IXCA 4HG2A 5ICFA 2MG4A 3RI4A 3KE2A 2O8KA 4ZYHA 2A05A 1IRXA 3GW2A 4I76A 1SVOA 3DEWA 2QQ9A 3BPXA 2PJRA 2LH9A 2F5VA 2JWTA 1AA7A 2BHZA 2X48A 3H9JA 1OCPA 2H1LA 3HUGA 2P5KA 4GGGA 3CUQB 5DV5A 3E6BA 3WGIA 2CG4A 4M9SA 3SXYA 1W0UA 1LQ1A 3WU2C 4RS8A 3HOUJ 4IF4A 2GA2A 3K69A 4WF2A 2XPWA 4PDKA 2CU7A 1QHHD 4BHPA 3OSGA 3EQLF 3IRRA 2HQAA 1PP8F 1HSJA 2N8GA 1XMXA 3WTZA 5HODA 1DP7P 2BXYA 2ID3A 2GXBA 2JPCA 4CCOA 2YUSA 3GYHX 4KN4X 2L01A 4B47A 5IT9Z 4IRHA 2QBYA 4ZZDA 2L9VA 2LD5A 1FJLA 2WAQA 2ETHA 3BJ6A 2K5CA 2KJBA 4P9FA 4RAYA 3I5UA 2R5ZA 4BDZA 1VQ4I 1TNSA 3OY9A 4PJNA 3I71A 2V9PA 4RAGA 3BTIA 1Y8QB 4XKCA 3U1DA 2CW7A 3BG9A 2Z9OA 1W4MA 2B0LA 2E1OA 2EV6A 3L2CA 1PYVA 3TOAA 2R5YA 3CDHA 5L3EA 3LSTA 4HQMA 4FASD 3QWLA 1HKTA 1LVKA 4A3FJ 1H8AC 3JRCA 2RGVA 4GRIA 2Z2SB 4CYDA 3KYLA 1IDZA 3BCAA 3CCUI 2O0YA 2VASA 2HR3A 2M87A 2HZTA 2V26A 2E1MB 3JRDA 1FLIA 4HOBA 1AHDP 4KN7X 3CCJI 1FX7A 4OINF 2X1EA 3E1SA 3Q3SA 3TW7A 3ZR8X 2IS4A 3DBHB 1XN7A 2K7LA 3MD2A 2NNYA 2FF4A 2LKPA 2DMPA 1ETXA 3VSLA 5J4YA 1V54H 3CF2A 3R0AA 5M3MJ 2Y31A 3FKIJ 4F55A 3JRGA 3F8NA 2R0QC 4I6ZA 4NC7A 2GAUA 4EQQA 2BVMA 3DPLC 4A5NA 3DBLB 4DNCA 2LKSA 2DBBA 2JRMA 2QKMB 4Y7NJ 1K6OA 3L2RA 1BOAA 3HXLA 3T8RA 1OCOH 3PIOF 2R3SA 1J9IA 2C6YA 4RMNA 2ZKZA 2R7QA 1APLC 1HC8A 4AYBA 4HF0A 2K85A 2XSJC 5ICCA 3CCQI 3OS1A 3FM5A 3PFYA 2EPFA 1FSHA 5M5YJ 3W2AA 1ZH5A 2V6EA 5FLVA 2DU9A 2IAIA 3O3KA 2I5UA 1JI8A 2RREA 1WZ2A 3L2VA 3PNVA 3QOPA 2OD5A 4DBQA 1D1BA 5D4RA 4LG0A 2DN0A 2OAZA 1MBKA 4E7IA 4IOAF 3ZMVA 2X6XA 3HC7A 3R61A 4BGDA 1NHAA 1JJ8C 1IO2A 4AD9A 1JKQC 4YRVA 3E6DA 1KQ0A 5HLIA 1USSA 3AG3H 2DLLA 3BR6A 4I02A 4N9HA 1NG6A 4EM2A 4L18B 2E71A 1X3UA 2XKOA 2A5YB 5E1WA 4IHVA 2Y9ZA 3LSKA 4G7ZF 1V5EA 2RC4A 4MO7A 5C4XJ 1P4WA 5E1XA 3GX4X 1GV5A 3VODA 2HDWA 2WB1N 2KIQA 1YTYA 1FOWA 2PN6A 3A1YA 4AUXA 4QPQA 1XD7A 2QENA 4G6TB 2L9SA 4BJ5C 1FYMA 2XAFA 2R7OA 4ZJZA 1XGMA 1POGA 3RJPA 4X6AJ 1DP3A 3P5JA 3CDLA 3J7AO 1U5TB 4LJZF 4IQJA 1UG2A 4RB3C 1RKTA 1FPQA 4L9JA 4V2GA 5F6FA 3SHFA 1U3EM 4B44A 3MKWB 4A3KJ 4LIVA 4YFKF 2ICWG 4F7ZA 4BJTA 3PO3J 2CS3A 5H6QA 2CGPA 4X0GA 1Y1VJ 5ICEA 1QPMA 3CMYA 5J47A 2CSOA 5KAIC 1KU3A 5DD4A 4JOMA 4LMYA 1D5VA 4WK8F 3WHCA 3QU3A 2TCTA 3MWMA 3FF5A 1ERDA 4R1HA 3MCZA 4XM3A 1VQMI 4AM3A 2LTPA 5EZHA 5LHIA 3TO6A 3DFGA 3FK7A 1QZYA 5E3OA 2CQNA 3V7CA 3HSRA 3HRMA 3D0SA 4OMZA 3S1QJ 1R1UA 2WY7Q 4W1UA 3M4OJ 1EV7A 2HFHA 3OS0A 2O6GE 5D8KB 2LF8A 3TBIA 3OOUA 3P9IA 2L2OA 4CHUA 2EV0A 5BQTA 3ZQCA 4AWXB 1BIBA 1G3YA 5GAGJ 4XLAA 2KT0A 1B8IB 3OYJA 2YX7A 2XPVA 4G8XA 3VPRA 4EGYA 3HJEA 2KRHA 1QNTA 2NS0A 4BJ6C 2XGXA 2MC3A 1R4MB 3TDZC 5CVVA 2EIKH 3FXKA 1SD7A 2DPDA 1MH4A 2HNHA 2YU9J 3DV8A 3OYGA 2M4KA 4G6QA 3ZN0A 1QVTA 2CJJA 3J81Z 1R49A 5FD6A 4QWQA 1KU7A 1S7OA 2MA3A 4IHWA 2KZGA 1KQ8A 1OCTC 2VBZA 1VFCA 2JJ7A 2LYCA 3DTEA 4MHGA 2CFXA 3HRSA 1O3QA 1H0MA 1W5TA 4MTEA 3D1NI 2RAEA 2LLKA 4ANJA 4BXXJ 2E1CA 3GTJJ 4A3LJ 2WV0A 3L2WA 2Y0SN 4PJLA 4A3BJ 5LRSA 3FM3A 2DA6A 1BBYA 1DU6A 1K79A 4Q47A 3BTLA 2ELJA 1ZARA 3HOSA 3WHBA 3RKYA 1G2HA 4YFNF 4M9XA 4XLFA 1HF0A 2Q8KA 4O6JA 1Z0XA 4P5OA 1K78A 2IP2A 4I98B 4ZDOA 4ZYAA 1IGNA 4XONA 4PJJA 2VONA 2NVUB 1E0EA 1ZRFA 2ZJ2A 3HOWJ 4E6KG 2K9LA 1B1BA 2FQ4A 1R6RA 1N75A 4M72A 1MJAA 4U7BA 5ICGA 1OQYA 1A6IA 1MW7A 3P9CA 2LF7A 1IN4A 5CVUA 1Z91A 2G7UA 3QRFF 5AIQA 3BZCA 2VC0A 1ONVA 2NNNA 5HS7A 2ZFUA 2MGQA 4HZFA 2KMUA 2Y30A 4RAFA 1ZGJA 5JFRA 2RDPA 2CW0F 4M74A 2E2JJ 2JUGA 3LSJA 1MSEC 3DLAA 2F4OB 1GHCA 4IO9F 2W84A 5ILVA 2BEOA 2DA3A 4M3DA 1SMYF 5FFXA 3QYFA 2XGCA 3TL4X 4M73A 3WTTC 2GQQA 2UXNA 3GO5A 1K4TA 1W5CC 2CO5A 2DMUA 3NWTA 3CO6C 1K6YA 3DEEA 1JJ6C 1VQPI 3F3XA 1LKXA 4IHYA 3KP2A 1S29A 5CYVA 3FX3A 2KLOA 1A35A 1BA5A 3LSGA 2HGCA 5LHHA 5K7FA 5DS9A 2HOSA 2F6CA 2H09A 1P2FA 3K4LA 5IP9J 3WTVC 2LY1A 4D9JA 1R00A 4M3EA 4B8XA 2VJ4A 3CUOA 9ANTA 1FOXA 4HSRA 1D1CA 5FLXZ 4X1EA 4IJAA 5DM7F 1Y1WJ 2P81A 3BJOA 2DMTA 1JT0A 1NK3P 4ASNA 3M07A 4LOCA 4LLLA 2YPRA 2OPTA 3S1NJ 5E17F 1VZ0A 2HWVA 3KP3A 2XPUA 4XSZF 2WC2A 1TLHB 4NQWB 3PL8A 5J3LA 4HNTA 2E5NA 2R7XA 3IV5A 2R7TA 1G59A 3WTUC 2CH0A 4CGZA 2EH3A 2HPIA 3CP8A 1T56A 3OYLA 4UVBA 1JUMA 1OPCA 4II3A 1XX5A 3HOVJ 1EH7A 4I7HA 1SAXA 2XAUA 2M1BA 3AL0C 1S7AA 3E5QA 3S3MA 3HM5A 1Z9CA 2DODA 3VB2A 1YJ9I 2DDAA 3OS2A 4L5EA 2EFQA 1PDNC 1XSVA 4ENNA 1MMDA 3ECHA 4HDUA 2EFPA 1UHMA 2CFOA 4FCYA 3F0CA 2LBFA 4ETSA 3IUOA 4JX4A 2LY2A 3SFZA 2MLKA 3Q9SA 3EDPA 1BI2A 3RCOA 1PUFB 2IT0A 3S14J 3KPHA 1RI7A 4S04A 3A03A 3RPUD 1TWHJ 5CLSA 3SDBA 2IS6A 1UG0A 3C2BA 2VB6A 3DU5A 4L0YB 1YFHA 2CUJA 2DTZA 3HGYA 1ULYA 3L09A 2IA2A 1ZN2A 1YHQI 2DFFA 1H9GA 3UKGA 4BXFA 3BCBA 3CO7C 3P9KA 3ZQLA 2UV1A 3J7YJ 2QSHX 1YIJI 1FBUA 1R1TA 1R5ID 3QP5A 2LC2A 4BNCA 2JPBA 4D7MA 1R9TJ 5DDGA 1ZELA 5FRNA 1RZ4A 2DT7B 2R7UA 5GPAA 1G3SA 2IA0A 5EG0B 2R93J 1YW9A 4XLPF 3FK6A 3CCVI 4AVZA 1PVEA 2VKVA 4U88A 2IGKA 2WA0A 3I4PA 4RGUA 5C44J 2Y69H 1EA3A 2WV1A 1NTCA 2FBKA 3K1NA 1UELB 1X3ZB 4M9ZA 1E3HA 1X4OA 3CJRB 5E18F 4NC6A 5EZGA 1XMKA 2IGOA 1OYYA 3BTJA 5KAFC 2V1XA 3ABKH 1B8IA 1YO5C 4YIFA 3F6VA 2O8XA 3FXLA 3S3NA 2QQBA 2DFEA 2DDBA 1MIJA 1VI0A 1OCRH 2AXTC 4RAZA 3EUHC 3U1KA 4BY1J 2B7EA 2FMLA 4OWRB 1Y39A 1G4DA 2V1UA 3H5AA 2AXLA 2VBXA 1U9NA 2JQ7A 1MBFA 2ME6A 2KISA 1ZG1A 4C2TA 3BR1A 4HEA2 1T39A 4F3QA 5IY5H 1FMWA 2KPMA 1YS6A 2PX9A 4UV8A 2GIVA 5DEQA 3OYBA 1VQ8I 5D5VB 3M9AA 4UUTA 3LL7A 5LHGA 3GFJA 3PIPF 3CMAI 2DO7A 4UY8I 1X1DA 5JVGF 1LPQA 2AHQA 2RNGA 3LSPA 3E6MA 2P5LC 2K86A 3KEOA 2GOMA 3GLLA 3LAPA 1D0ZA 3RKXA 2GM4A 2L0KA 4XIDA 1BW6A 3DEUA 4KYWA 2HS5A 2NAZA 3IHUA 1Y56A 4HYEA 5B3SH 4Q48A 2VT3A 1CGPA 2HYFA 4HRIA 3DCFA 2J5PA 3WTYC 2GWRA 1BN5A 2JRTA 1A6QA
chains in the Genus database with same CATH topology
3CCJI 1WIBA 1VQLI 3CCMI 1VQ6I 2ZJRF 1VQMI 1YHQI 2E36A 1S72I 2FOWA 1VQOI 3J7YJ 4IO9F 5GADJ 1YIJI 1VQNI 3DLLF 1VQ5I 3PIOF 3EGVB 3CJQB 5GAHJ 5GAEJ 3CC4I 2OTJI 1HC8A 2E35A 2ZJPF 3CCQI 3CCRI 3CCVI 1ACIA 5GAGJ 2NXNB 2K3FA 1YJNI 3G71I 1VQ7I 3CJRB 3CCEI 1VQPI 4IOAF 3CC2I 3I56I 3CC7I 3J7ZI 1Y39A 1FOXA 1FOYA 2JQ7A 5DM7F 3G4SI 1YITI 4V19K 3CF5F 3I55I 1YJWI 1QA6A 5DM6F 1VQ8I 1FOWA 2OTLI 1MMSA 1VQ4I 3PIPF 3CMAI 3CJTB 4UY8I 5JVGF 4IOCF 3CD6I 2H8WA 1VQ9I 3CCSI 2QA4I 1YJ9I 1VQKI 1YI2I 2E34A 3G6EI 3CCUI 3CMEI 3CJSB 2QEXI 2ZJQF 3CCLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ I;  1WIB A;  1VQL I;  3CCM I;  1VQ6 I;  2ZJR F;  1VQM I;  1YHQ I;  2E36 A;  1S72 I;  2FOW A;  1VQO I;  3J7Y J;  4IO9 F;  5GAD J;  1YIJ I;  1VQN I;  3DLL F;  1VQ5 I;  3PIO F;  3EGV B;  3CJQ B;  5GAH J;  5GAE J;  3CC4 I;  2OTJ I;  1HC8 A;  2E35 A;  2ZJP F;  3CCQ I;  3CCR I;  3CCV I;  1ACI A;  5GAG J;  2NXN B;  2K3F A;  1YJN I;  3G71 I;  1VQ7 I;  3CJR B;  3CCE I;  1VQP I;  4IOA F;  3CC2 I;  3I56 I;  3CC7 I;  3J7Z I;  1Y39 A;  1FOX A;  1FOY A;  2JQ7 A;  5DM7 F;  3G4S I;  1YIT I;  4V19 K;  3CF5 F;  3I55 I;  1YJW I;  1QA6 A;  5DM6 F;  1VQ8 I;  1FOW A;  2OTL I;  1MMS A;  1VQ4 I;  3PIP F;  3CMA I;  3CJT B;  4UY8 I;  5JVG F;  4IOC F;  3CD6 I;  2H8W A;  1VQ9 I;  3CCS I;  2QA4 I;  1YJ9 I;  1VQK I;  1YI2 I;  2E34 A;  3G6E I;  3CCU I;  3CME I;  3CJS B;  2QEX I;  2ZJQ F;  3CCL I; 
#chains in the Genus database with same CATH topology
 3BG3 A;  4G7O F;  4NDL A;  3ZMU A;  1RUN A;  3ZQI A;  2VQH A;  2L3D A;  1ETW A;  5HDK A;  3PJR A;  3K6G A;  3GFL A;  1HLV A;  1EF4 A;  3HTU A;  3NEU A;  2JA6 J;  1FSE A;  5BNG A;  3O8G A;  1MKM A;  1Z21 A;  3RPU A;  2AO9 A;  2QVO A;  3TP0 A;  3OYK A;  2EZK A;  5DCM B;  2OC6 A;  4CYC B;  5LD2 C;  1OCC H;  3BG7 A;  1R5G A;  1ETO A;  3DPU A;  4ESJ A;  4RB2 C;  5LGN A;  3O8H A;  1IG7 A;  3BPV A;  2ZXH A;  4C3H J;  2JMW A;  4JQF A;  3OYN A;  5GAH J;  4CH7 A;  2P7V B;  1MNE A;  3OOP A;  2EFW A;  3OIQ A;  5KNL A;  3AKZ A;  3ROU A;  1ACI A;  4KT6 A;  2MBF A;  2K3F A;  2MC4 A;  4IVN A;  3W2W A;  3ZMS A;  2LK2 A;  1J0R A;  2DFI A;  1LDD A;  4PGG A;  1ZGW A;  5TIS C;  3NAU A;  5IT9 K;  3VOE A;  3KZY A;  3WG9 A;  4CSW A;  4Y3O A;  4BHB A;  2FSW A;  2LP0 A;  4CCM A;  3SJM A;  3SFI A;  4G9Y A;  1TW2 A;  3K10 A;  1EH8 A;  2COB A;  4OU0 A;  3L2U A;  1ZLJ A;  4EV0 A;  1R23 A;  2KJC A;  4F93 B;  1PUE E;  4BEH B;  2JVH A;  3PUF A;  1MDM B;  1K7A A;  1BC8 C;  2W57 A;  3HGG A;  5F27 A;  3RPQ A;  5H6R A;  4FIS A;  3BR3 A;  2IJL A;  2NS8 A;  2V6C A;  2ESH A;  1LEB A;  4IL6 C;  4ZC3 A;  5HDN A;  1GXP A;  3BDD A;  3HBL A;  3MKL A;  2DW4 A;  5LGU A;  2QM3 A;  3K70 C;  4RLQ A;  4TV7 A;  3LA2 A;  2W4S A;  5EGO B;  3E6C C;  1FOK A;  1Y0N A;  3ZCO A;  5KVR A;  2HU9 A;  1OR7 A;  2XIG A;  2CQX A;  4AIH A;  1SMT A;  2KIF A;  1I1G A;  2DJI A;  2ZME B;  3KYC B;  5HS9 A;  2LOO A;  4NQW A;  4NB5 A;  3VYU B;  3IP4 B;  2VIX A;  3HG9 A;  4XRS G;  3ERM A;  3TDU C;  2HKO A;  2MAB A;  3GTQ J;  3OL3 A;  3VEP A;  2D1V A;  2IRF G;  3G1O A;  3TP3 A;  2ZSI B;  4GO1 A;  1HST A;  5GTI C;  5JHU A;  3PSF A;  1EKE A;  3L2Q A;  3CJS B;  3H3Z A;  5EEH A;  4AIJ A;  2JA5 J;  2F5F A;  1SAN A;  2K9M A;  2QEX I;  1IXS B;  3H5R A;  2XHK A;  2ME0 A;  3N05 A;  2LDU A;  3DKW A;  4LLG F;  3BZK A;  4EM0 B;  3CCY A;  1W36 D;  1JTY A;  4P55 A;  1TZL A;  1JUS A;  5LGT A;  1DQU A;  3H0D A;  5JLX A;  1IN8 A;  2EA4 A;  4ENJ A;  3WGH A;  3WGG A;  3LSH A;  1ON2 A;  1O3R A;  4WWC A;  2ZB9 A;  1UJ8 A;  3GME A;  3QQA A;  1D5Y A;  1PUF A;  1LFU P;  3VYR B;  4MQ9 F;  4N9I A;  2VUM J;  2V9V A;  4BE0 A;  4II2 A;  4IPA A;  1TC3 C;  1Q1H A;  2EA2 A;  3LAJ A;  1F36 A;  1JKO C;  3VYT B;  4I99 C;  5B1A H;  2XKP A;  1KYW A;  2K27 A;  3ECO A;  3RQI A;  1BR2 A;  3V7R A;  1HW2 A;  5D4S A;  2HOT A;  3CJQ B;  4ZYD A;  4Y13 A;  3M8F A;  4L5I A;  4UXN A;  1MBG A;  5HLG A;  2M8E A;  5LBQ A;  3JRF A;  5J1R A;  1K83 J;  1KON A;  3MEX A;  2NVY J;  3PFI A;  2R4G A;  4KNY A;  5EF6 A;  2OZ6 A;  4E7J A;  2OBP A;  3MMY B;  4A3J J;  5JHF A;  5E3M A;  2OQG A;  1SFX A;  3OV8 A;  3OIP A;  1F5T A;  2GZW A;  2LR8 A;  4KIT B;  4L5J A;  1BJZ A;  1I6X A;  4E7L A;  4FHT A;  4JK1 X;  3LA7 A;  2E60 A;  5K5Q A;  3MZ8 A;  3FBI B;  3O2P E;  3VWB A;  2BE5 F;  5K7Z A;  5DUK A;  3HDD A;  2L4A A;  2XRN A;  3K1M A;  3ISP A;  2ZNY A;  1MD0 A;  3JCU C;  1KQ9 A;  3T5X A;  1E3P A;  3FMR A;  2GIZ A;  2ZO4 A;  2JVG A;  2BVL A;  3Q9V A;  1N25 A;  4PCQ A;  4E4H A;  4WXD A;  4YII A;  4HLY A;  3GFM A;  3L00 A;  1DDN A;  3OYH A;  2HYG D;  3CP2 A;  2WAD A;  2X1D A;  3MZH A;  5M3F J;  3LFK A;  3KEQ A;  3H0G J;  3I54 A;  4GYI A;  1JE8 A;  2QKL B;  2JA2 A;  2RKH A;  5HNF A;  1S5L C;  3FXU A;  5J4V A;  3JRI A;  2JUC A;  1F9N A;  1YX5 A;  3H35 A;  1LVA A;  1RC9 A;  2WBM A;  3A02 A;  5E8I A;  3JRE A;  1X19 A;  4D5F A;  1SD6 A;  3GVA A;  3S32 A;  1Y0U A;  2CMP A;  2XGD A;  2CW8 A;  3K2Z A;  4XIC A;  4B1R A;  3WU1 B;  1IV8 A;  2H6B A;  3FKJ A;  1DGW Y;  4MQV A;  3CCL I;  4C2M J;  2H94 A;  1RNL A;  5M5X J;  2X6W A;  2OCE A;  4EMS A;  1OYW A;  5FFZ A;  3FZV A;  1U2W A;  4GXO A;  5LEJ A;  4OOI A;  4FT8 A;  1G6N A;  1Z05 A;  3LA3 A;  3EPZ A;  3HKZ N;  2XF7 A;  2NVT J;  3RYP A;  3H9Q A;  3SQN A;  2LRD A;  2Z99 A;  1M1E B;  3AG1 H;  1CF7 B;  2DAO A;  3KET A;  3G1M A;  3HB9 A;  4MEY F;  1IN5 A;  1VQ5 I;  3GTK J;  1MMN A;  2R7S A;  4UNO A;  4HPQ A;  2HTS A;  3J81 K;  1ZR2 A;  1XCV A;  4ITV A;  3QYE A;  3B6C A;  4Y52 J;  4N4O B;  3FMQ A;  3K4C A;  2NXN B;  2JSC A;  4EJU A;  2ZC2 A;  2TDX A;  3CUQ C;  3B6A A;  1B9N A;  4XN0 A;  4B48 A;  4AC0 A;  1I39 A;  1OCZ H;  2B9S A;  3WU0 A;  3ZQG A;  1WPK A;  3E5X A;  2W00 A;  4RGS A;  2BGC A;  4KJZ A;  3OMY A;  2CYY A;  4PSX A;  2DCE A;  2WAF A;  1O7L A;  1K61 A;  1LJ9 A;  1MH3 A;  3CCE I;  1SFO J;  3KP6 A;  1I3A A;  2P5V A;  3NWS A;  3H9G A;  5B66 C;  2OF7 A;  1AKH A;  4NC8 A;  3EUA A;  2FRH A;  3V4G A;  3OYE A;  2RQQ A;  4EGZ A;  3RTR A;  3BC8 A;  2VN2 A;  3NQO A;  1TQI A;  4UUV A;  2F48 A;  3OIO A;  4I0B A;  3G4S I;  2K02 A;  1YIT I;  3AL0 B;  4BEH A;  2QLZ A;  1MDM A;  1YX3 A;  5C4J J;  2L9N A;  4Z2Y A;  5DM6 F;  3BJA A;  5CKT A;  4C2U A;  4A12 A;  3JTH A;  2K4B A;  4A3E J;  3V8J A;  4BBR J;  3S17 J;  4FET A;  4CCK A;  1YS7 A;  3W3C A;  3S2H J;  2HI3 A;  4XRS A;  3OR2 C;  3KEY A;  1WJ5 A;  2VOD A;  2P8T A;  2DMQ A;  3CUQ A;  5CVJ A;  4A0Y A;  3S1R J;  2OCC H;  4RGX A;  5B5E C;  1Z6R A;  3QPH A;  2BY1 A;  2E1M C;  3K9T A;  2VE9 A;  2BY0 A;  2RN7 A;  2ZME A;  3TQN A;  1U8B A;  2WAQ N;  1OLT A;  1F4K A;  5TJJ A;  2IVM A;  3E5U A;  3QYB A;  2PMZ N;  2GLO A;  5E3N A;  2STW A;  1Z7U A;  1UFM A;  4IEJ A;  5E79 C;  4A93 J;  5CQE A;  5F0F A;  1IZ1 A;  3SEQ A;  4U0W A;  1VQL I;  1GXQ A;  2MH9 A;  3ASO H;  3ESW B;  3F21 A;  3F8C A;  3CQZ J;  1HXD A;  2VKE A;  1YG2 A;  1WH7 A;  3PNY A;  3GTM J;  1LNW A;  1Z67 A;  3TMO A;  1BR4 A;  3KP5 A;  4XLN F;  4KFC A;  2HTJ A;  1V5F A;  2M2E A;  2XAS A;  3D5S C;  3FIS A;  3IRQ A;  1XG1 A;  1G3T A;  5L3D A;  2P0W A;  4MFE A;  1S72 I;  2CUE A;  4MEX F;  5IOZ A;  3ZQQ A;  4HX4 A;  4RDU A;  2JT1 A;  3JSO A;  4E7H A;  1WCM J;  1D3Y A;  5K5O A;  4P1W A;  4M71 A;  4NNJ A;  5TGT A;  4Q4Z F;  3BQY A;  1UZC A;  5GTH C;  2KDO A;  3S1M J;  2ELK A;  5IP6 A;  3BG6 A;  4U87 A;  1AWC A;  2G7H A;  3GZ5 A;  2ZJP F;  2BOL A;  3CES A;  5A2Q Z;  4A3M J;  2DQL A;  4PZJ A;  1TL8 A;  1L3L A;  1P6R A;  2V79 A;  5KHD A;  4LK1 F;  5FLX K;  2F5E A;  2R7W A;  2M3A A;  2YX4 A;  2VC1 A;  4U0V A;  2XF5 A;  3KLN A;  2XF6 A;  3V42 A;  4L0Z B;  2HVQ A;  4YFX F;  2R7Z J;  4B43 A;  1FY7 A;  3J80 Z;  2QWW A;  4IX7 A;  5LFA A;  2M34 A;  1S7E A;  3HOT A;  2OA4 A;  3ELK A;  3BZ6 A;  2EBI A;  2O3F A;  4AYB N;  1H89 C;  3K4N A;  5F64 A;  1B59 A;  3EYI A;  1BOB A;  2XVC A;  4PGH A;  5ED4 A;  1JKP C;  1JKR C;  1IN7 A;  2ADU A;  2X1C A;  4HX8 A;  1HKS A;  4HNV A;  3ASN H;  1UB9 A;  1TQP A;  1O3T A;  2HPM A;  2DA1 A;  5ILU A;  5K5R A;  2HDC A;  2QF7 A;  4Y33 A;  3DP7 A;  1YW7 A;  1G8X A;  4Y17 A;  2EV5 A;  4BS9 A;  2EWN A;  2QSF X;  2UUZ A;  1ZRE A;  2W1O A;  1UMQ A;  5C3E J;  2P7C B;  1QA6 A;  1MJB A;  4JX6 A;  4C3J J;  5J1Y A;  3C1D A;  3SZG A;  1U5T C;  4LG3 A;  4LLN A;  1HOM A;  2CRG A;  1BIA A;  2DOA A;  3GEZ A;  2WWY A;  5DYM A;  2GA1 A;  2BY3 A;  2V1D A;  3CJT B;  3OYC A;  3IWZ A;  2V9K A;  2MW8 A;  4XQF A;  3HZJ A;  4BBS J;  2KKO A;  3BOQ A;  1XDS A;  1T33 A;  4YEJ A;  4S05 A;  1R22 A;  3TED A;  3DQV C;  2OU2 A;  4RBO A;  1ODD A;  2JSP A;  1I5Z A;  3H3U A;  5L3F A;  3K4K A;  4BHC A;  2EK5 A;  1YYV A;  2PJR B;  2VI6 A;  3A2K A;  1A04 A;  1J7K A;  2X4H A;  4U0Y A;  3IH2 A;  3HHG A;  1HQC A;  1FC3 A;  2L7F P;  2HZD A;  4ZH4 F;  3OYI A;  1R5H A;  4B3X A;  4HNU A;  2A6E F;  3I53 A;  5D6F A;  4JBA A;  1ETQ A;  4Y4R A;  1HKQ A;  3F6O A;  2O61 A;  1R58 A;  5E8G A;  1K4S A;  2HYJ A;  2M5W A;  4BQN A;  1FTZ A;  4CUG A;  4E7Z A;  1BI1 A;  2QYO A;  1DGR M;  1KU2 A;  3COA C;  1U5T A;  2COM A;  3MQ0 A;  2V7F A;  4HQE A;  1R71 A;  4A6D A;  2PG4 A;  2R92 J;  1LDJ A;  2BYV E;  3ABU A;  1VQN I;  3ZOB A;  2XSD C;  2W25 A;  4LFU A;  2E7X A;  3S16 J;  1MGT A;  3LFU A;  5CVI A;  5BOX A;  2LMD A;  5GAE J;  3CC4 I;  1JT6 A;  3PQK A;  3GTO J;  4CCJ A;  3HHH A;  1ZKG A;  2ISZ A;  2QZ8 A;  4O3M A;  1FP1 D;  3CLQ A;  3KFW X;  1YJN I;  2R5Z B;  3ZMZ A;  1WRJ A;  2EQR A;  4XOR A;  1S3J A;  1I6H J;  2D5V A;  1LEA A;  2DYS H;  3K1P A;  3H1C A;  4J00 A;  3TW6 A;  1GT0 C;  2YSR A;  4DYC A;  2KHM A;  3CLO A;  1D0Y A;  1RES A;  1WHU A;  3V7S A;  2PI0 A;  3CC2 I;  4J01 A;  1Z6T A;  1E3O C;  1LE8 B;  3A0H C;  5AIP A;  1T0F C;  4F91 B;  1MJ9 A;  3RZO J;  2QGU A;  3B02 A;  4M3B A;  5LLQ A;  4QLC U;  3DXJ F;  1X58 A;  4XOP A;  2FEZ A;  3A0B C;  3K2A A;  1FBS A;  3C2H A;  3C3W A;  5FRM A;  1Z77 A;  1BI0 A;  2DPU A;  5HOO A;  2JTV A;  2Q1Z B;  3OWT A;  1FWZ A;  2UZK A;  2HXO A;  5D5X B;  2O7O A;  1TBX A;  2FBH A;  2I10 A;  3FXR A;  3KZZ A;  1QQI A;  1FIA A;  2EZL A;  4B3A A;  2AS5 F;  3BG5 A;  3ZRG A;  1T2K A;  2VPR A;  3FBN B;  4XR6 A;  1N78 A;  2DQR A;  2HQR A;  1P7J A;  4EEF G;  3KCC A;  2CQ7 A;  3UR3 C;  2VT2 A;  2YU3 A;  1ZRC A;  3CCS I;  4A3D J;  1X3W B;  5FB2 A;  1FZP B;  2ZXI A;  1MND A;  3EUK L;  1P4A A;  2STT A;  2XV4 S;  4EJT A;  1TNT A;  1QRY A;  1ZG5 A;  1NK2 P;  1VQK I;  1GLN A;  3R0J A;  3KYD B;  5FKN A;  4ZYE A;  4BAC A;  4XLH A;  5F0C A;  2RNJ A;  5CPR B;  3T8T A;  2MH2 A;  2IA1 A;  3SEZ A;  1T0F A;  4MNU A;  2WTE A;  1WH5 A;  2LNB A;  3KP4 A;  4XLE A;  2M4G A;  3IH3 A;  1TT0 A;  2W82 A;  2K9S A;  2VJ5 A;  4BE1 A;  1SFK A;  1WJF A;  2HVS A;  4KMF A;  2BHY A;  3IAM 2;  1X2N A;  4KMU X;  3RYR A;  2ZJR F;  2F5D A;  2NVX J;  2VLA A;  2DYR H;  3GUD A;  1TT5 B;  1YRN B;  2R7F A;  5AON A;  2LRE A;  3SZP A;  1XTA A;  4FX0 A;  3MZY A;  2K3P A;  2A6T A;  3M8E A;  1X4P A;  3PO2 J;  1QZE A;  4IHS A;  2PQ8 A;  2X51 A;  1P4X A;  1IRZ A;  5ILS A;  1RPW A;  4HAM A;  1ETK A;  1OMI A;  4IHX A;  3FIW A;  1WWX A;  2LSO A;  3BQZ A;  3I59 B;  3M1C A;  4H0E A;  4EVI A;  5F1J A;  1V55 H;  3OL4 A;  4DQ2 A;  4J19 A;  5IYB J;  2EZH A;  3HIF A;  1FIP A;  4BAY A;  2ELH A;  5HVQ C;  3BTC A;  3FMS A;  3FXQ A;  3L7W A;  5HLT A;  3VDX A;  3CJN A;  3D5R C;  4D0P A;  1KGS A;  3BT9 A;  2WB1 A;  4HV6 A;  4PJM A;  2K9N A;  3GZN B;  5JI6 A;  1IUY A;  1SFE A;  2DA2 A;  3LSI A;  4DW6 A;  1T38 A;  3K70 D;  3ERE D;  2A69 F;  3M7G A;  1G3W A;  2QQA A;  3GTP J;  3ZPL A;  4MFD A;  1OR7 C;  1FOY A;  1C0W A;  4N4N B;  2VJJ A;  3OR1 C;  4QPO A;  1JXS A;  1HDP A;  4C3I J;  3I64 A;  3I55 I;  2IBD A;  2X0L A;  2XDV A;  1YJW I;  1DU0 A;  1J2X A;  4L9V A;  1KA8 A;  2IEK A;  3KP7 A;  1I1S A;  3V8K A;  3W6J B;  3JRH A;  3WE3 A;  1T95 A;  5FD5 A;  5FKL A;  4NBQ A;  3DKY A;  1MBH A;  1OYI A;  2KRC A;  2IW5 A;  1ZR4 A;  1AU7 A;  2DXI A;  2ZNZ A;  4LB6 B;  2KP6 A;  1KU9 A;  1GV2 A;  1YQA A;  1R36 A;  1BJA A;  3HPH A;  2CUZ A;  4W97 A;  1YLF A;  2VQG A;  1Z3Y A;  1XSD A;  4ENK A;  2XRL A;  3NRV A;  1WKM A;  2H27 A;  2M30 A;  3W2V A;  1WJD A;  4ZTJ A;  3IL2 A;  3F8B A;  4CXF A;  3C2G A;  2L54 A;  1QO0 D;  3I9V 2;  1XGN A;  4A69 C;  1XDU A;  2IGM A;  3FXJ A;  4XLC A;  4A0X A;  2M7A A;  2ZJQ F;  3PM1 A;  3BLY A;  3U2R A;  4AU7 A;  4MLO A;  4YEL A;  5J8C A;  5K7H A;  1WIB A;  4LGW A;  1B9M A;  2D1H A;  1FBQ A;  4KIF A;  3W6K B;  3JRA A;  2DI3 A;  1MMG A;  1O7F A;  3HPG A;  3HTS B;  2JZY A;  4ABZ A;  1R1V A;  2EIJ H;  4P9U A;  2ZSH B;  3WOD F;  1IDY A;  3O6B B;  3M3Y J;  2VKH A;  1JTX A;  2RVC A;  3R4K A;  3R6S A;  2VKD A;  3LNQ A;  1FP2 A;  1JGG A;  3Q0U A;  3QPS A;  1ZGA A;  5FLM J;  1X2M A;  2X9D A;  3UNG C;  2FD5 A;  1RKW A;  2E35 A;  4BL0 B;  2NOG A;  1DUX C;  2NYX A;  3JAM Z;  1ETY A;  1NG7 A;  1VQ7 I;  5BMZ A;  2ECC A;  3C7J A;  5CJ9 A;  2PJP A;  3ZMD A;  1U6G A;  1B72 B;  1EJ9 A;  3K4B A;  1TWA J;  1ZRD A;  1RR8 C;  2PBI A;  5TRD A;  4N0B A;  1O57 A;  3U21 A;  5BPD A;  1XGS A;  2WY8 Q;  4DYR A;  4EM1 A;  4EJW A;  2FX0 A;  2GXG A;  2Y0S A;  2PMZ A;  2IS1 A;  5M5W J;  4CZZ A;  1K78 B;  1BC7 C;  3G73 A;  2VPL A;  1E2X A;  4AVP A;  3KX2 A;  2HDD A;  4CA0 A;  5JR3 A;  1UHS A;  3DPT A;  2F2E A;  4HW0 A;  3OYA A;  1UHW A;  2Z3Y A;  3A01 B;  4BQA A;  1B6A A;  3E0J B;  2BY2 A;  3L1P A;  3HL2 A;  1LE8 A;  4M6X A;  1BW5 A;  1WJA A;  4XKV A;  4EAT A;  4G94 A;  3IH4 A;  1NH3 A;  1J09 A;  2XB5 A;  5DCF A;  5EG0 A;  1GDT A;  3BR2 A;  4WXH A;  1ZG3 A;  3FHZ A;  1YOV B;  2JA7 J;  3MVP A;  3MN2 A;  3GF2 A;  4BKX A;  1FMV A;  3E97 A;  1P7I A;  4DIQ A;  2O9L A;  3K4M A;  2FNP A;  4IOC F;  2EIN H;  4PJ0 C;  3VFZ A;  4Y15 A;  1ZK8 A;  2HQ5 A;  2R7V A;  1VQ9 I;  2A07 F;  2Z5U A;  3PQJ A;  2DOF A;  3DF8 A;  2FE3 A;  2M45 A;  2VXZ A;  5CQG A;  4OIR F;  1WQ2 A;  3HSF A;  2DA4 A;  5L3G A;  1W36 C;  3OYM A;  2V1N A;  4PSW A;  4H4K C;  4KA4 A;  1WI3 A;  3G6E I;  2L7K A;  2DFH A;  3ABM H;  5J8F A;  2DMN A;  1J75 A;  3MFK A;  3CTA A;  3WTS C;  4WX9 A;  4AIK A;  2EFN A;  5CVR A;  3AG2 H;  2CV2 A;  2VJI A;  5IOY A;  3S93 A;  2FUG 2;  5E20 A;  3L9F A;  3Q0V A;  4AID A;  2E5Z A;  1WSU A;  3RDI A;  3JW4 A;  2Q0O A;  4I09 A;  5GPC A;  2LVS A;  5EYR A;  4IHT A;  2P6T A;  5FRO A;  1O3S A;  4RM2 A;  3IAS 2;  2ECB A;  4A2U A;  1ON1 A;  4V2F A;  3F8M A;  4BUP A;  1BM9 A;  5FJ8 J;  3VSK A;  1ITY A;  3E3V A;  5L3C A;  1YRN A;  1IC8 A;  4CDG A;  3I58 A;  2FBI A;  4ESB A;  5IP7 J;  1AOY A;  2M0M A;  4RA2 A;  4Z6Y A;  1W0T A;  3CZ6 A;  1OJL A;  1P9Q C;  2X6Y A;  3GWZ A;  3GFI A;  1WFX A;  1SD4 A;  2OZU A;  3TGN A;  1J59 A;  1A5J A;  1TWF J;  4HX7 A;  2XAH A;  1X1B A;  4FE4 A;  3E7L A;  1W5S A;  3LMM A;  3RKQ A;  3SZT A;  3I3L A;  3HEF A;  1CQT A;  3I59 A;  4GYG A;  2VBW A;  2E2H J;  1IUF A;  2W48 A;  1V4R A;  5D5W B;  2K9Q A;  1Q1V A;  2NOJ B;  2VE8 A;  5L3B A;  3JRB A;  3I56 I;  5DCM A;  2MYS A;  2OUM A;  3ABL H;  2UWM A;  1QGP A;  4CYC A;  1X1P A;  3EYY A;  3KZI C;  3BP8 A;  4LD5 A;  1MBJ A;  1ZYR F;  2H6C A;  3QAH A;  5EJC A;  2LBF B;  2KRF A;  1BL0 A;  2CQK A;  3GBG A;  3T1B A;  1W7P B;  4RM3 A;  3ZXS A;  1RR7 A;  4XBF A;  4XRM A;  4O5V A;  4JX5 A;  2L4M A;  3JR9 A;  3QP6 A;  1SEU A;  4G7H F;  2FJ1 A;  2M8G X;  4Q5S F;  2DJN A;  1RUO A;  1UAA A;  3GLX A;  1VTN C;  2ZME C;  2E2I J;  3SDG A;  2OTL I;  1T8I A;  2Q2E B;  4UUS B;  2IS2 A;  1U8R A;  4HF1 A;  4A5M A;  5F1R A;  1X1C A;  1MSF C;  4M3F A;  1ORK A;  3T0Y A;  3FHN A;  2H8W A;  1QHG A;  4IQ4 A;  5HS8 A;  1X1A A;  3GCM A;  3KIO A;  2EIL H;  2F4M B;  4ZDL A;  3TKY A;  5DTD A;  3FWE A;  1JGS A;  2A61 A;  1XS9 A;  4OAY A;  1YI2 I;  3LOC A;  1SVL A;  2F5C A;  4MGR A;  5LEK A;  4HA8 A;  1WJB A;  2AQF A;  3ZQF A;  3FXO A;  3G3Z A;  4JP0 A;  6PAX A;  2XAQ A;  4DZP A;  1Z3X A;  2KZV A;  1Z1D A;  2PFB A;  2Z16 A;  1IAW A;  4S0H B;  5FKO A;  1XGO A;  4BQQ A;  1SD5 A;  3A4C A;  3C18 A;  4BDY A;  1WVR A;  4G12 A;  5F08 A;  3GZ6 A;  3CCM I;  5HDG A;  1VQ6 I;  3MAJ A;  1B4A A;  5EGO A;  3PSI A;  4UB8 C;  4C30 A;  5A2Q K;  2CV0 A;  1JHF A;  4KIB A;  3ZN1 A;  2DK5 A;  4F52 A;  3N97 A;  4JYK A;  2B63 J;  1QZZ A;  3GXO A;  5GAD J;  4KDP A;  2O5R A;  4KIG A;  1S9H A;  1OFC X;  3J80 K;  3QU6 A;  3FDY A;  4FQG A;  4XRF A;  2CUF A;  2KIM A;  2OTJ I;  2PEX A;  4MIM A;  3QPL A;  1LFB A;  3EET A;  2EFO A;  2ID6 A;  1L0O C;  2A6H F;  3ULQ B;  3DTK A;  3X2Q H;  4GDF A;  3IKT A;  3G71 I;  5J1U A;  2DT5 A;  2KL4 A;  4E70 A;  5J6X A;  1PP7 U;  3HYI A;  4RLF A;  2MFZ A;  1A36 A;  3ZQH A;  3MKZ A;  4DGW B;  2XGE A;  2VQC A;  4UVA A;  4FX4 A;  1GVJ A;  2HXI A;  2PMU A;  4M6Y A;  3SYT A;  3F22 A;  2BW3 B;  4UHT A;  1B72 A;  1UST A;  4KIC A;  4R8H A;  2V4J C;  3DKX A;  3H92 A;  1WGX A;  4QSH A;  3F8F A;  2G0E A;  1IN6 A;  2MLG A;  1KZH A;  1HW5 A;  1D1A A;  2M0C A;  3LQQ A;  1MNM C;  1J5Y A;  2E19 A;  2W85 A;  5H20 A;  4CIC A;  3WTW C;  1EH6 A;  3Q0W A;  2XAG A;  2DOE A;  5BS6 A;  3OYD A;  1SVM A;  1W7P D;  1F1Z A;  4K2E A;  2P6S A;  3A01 A;  4HF2 A;  1BI3 A;  3OYF A;  5D6E A;  5FGM A;  4XOT A;  3N4M A;  4BE2 A;  3HSE A;  1MZB A;  4ON0 A;  1IF1 A;  2VQL A;  4IKF A;  5JLW A;  3K7A J;  4ZZL A;  1LUJ B;  1N77 A;  4CCL A;  3LSR A;  1IV6 A;  3ZMT A;  4HST A;  2DK8 A;  3ZP5 A;  4BH9 A;  2FXA A;  1SAU A;  2ZXJ A;  4C9Y A;  4LB5 A;  2RV8 A;  4XMY A;  3IC7 A;  2NS7 A;  5D8L B;  1XPX A;  3PUB A;  1A31 A;  2P4W A;  2DA7 A;  4I2O A;  3ML6 A;  3CME I;  3S8P A;  1IJW C;  2KIU A;  2R7D A;  3V8L A;  5KK1 A;  2UXX A;  4CO8 A;  2I8D A;  2ESN A;  2GXA A;  5K1Y A;  5E1Z B;  2MD0 A;  1ZLK A;  2ZBK A;  2EJR A;  3R60 A;  3DTI A;  4DBR A;  2XC7 A;  1WJC A;  2OQR A;  1QPI A;  1YIO A;  3W6V A;  3WG7 H;  2GOX B;  1WJE A;  1STZ A;  1W1W E;  2ZFW A;  3HOX J;  1ETV A;  4DZJ A;  1LDK B;  1LFP A;  3VYS B;  5IPA A;  4BY7 J;  4HLX A;  2HVR A;  2Y0M A;  3I4M J;  2W7N A;  4HBL A;  4QIW N;  2FQ3 A;  2E36 A;  1I27 A;  5FKK A;  4ESF A;  4XSX F;  2FOK A;  3K4J A;  4UV9 A;  5ERI A;  4YIR X;  4IRG A;  2D45 A;  3EGV B;  2HKX A;  1WI9 A;  2NRA C;  4GCV A;  3RSN A;  2ZCW A;  1VND A;  5H2F C;  1QVU A;  3F9K A;  3CMM A;  3HUG B;  4QTR A;  1FTT A;  1ENH A;  4U7D A;  1JUP A;  3CCR I;  2FA5 A;  3GTL J;  2KQR A;  1PJR A;  5FKM A;  1MBE A;  1E17 A;  3AG4 H;  2D2W A;  2WAE A;  4PFP A;  2OV7 A;  4PK4 A;  1H88 C;  5IYC J;  1RET A;  1D8J A;  5EEG A;  2HEO A;  1Z7L A;  2QCO A;  4OAZ A;  3D5L A;  2DT6 A;  3OSF A;  4E7S A;  4EJO A;  3F72 A;  3DWL E;  3RKW A;  2CQQ A;  4CZC A;  3TO9 A;  2K4J A;  4I0A A;  4D7N A;  2XRO A;  2K40 A;  4IZZ A;  1HBX G;  2XB0 X;  2MD5 A;  3WTX C;  1OIS A;  3J7Z I;  3AAF A;  1CF7 A;  3M8J A;  2X85 A;  2Y2Z A;  1IRF A;  2A3S A;  2QBY B;  3REO A;  1Y6I A;  2ISY A;  2DTR A;  1SFU A;  2VOO A;  1V3F A;  3H3V K;  4V19 K;  2AQE A;  3KLO A;  3JSP A;  4D1Q A;  2BV6 A;  3CF5 F;  5DD8 A;  2JN6 A;  2Z1D A;  5DUI A;  1S6L A;  1U0J A;  5JVT A;  2LY9 A;  4XNF A;  2L7Z A;  3S3O A;  2IPQ X;  1W7P A;  4KT5 C;  2R5Y B;  1V5G A;  2QQ8 A;  2BBY A;  3I0T A;  3GTG J;  1XCB A;  1HA8 A;  4XL9 A;  1HDD C;  1TWG J;  4ZYG A;  2EIM H;  2XAJ A;  1I50 J;  4IRI A;  2VL8 A;  2E7W A;  3RIR A;  1DPR A;  2Q2E A;  4UUS A;  4FTH A;  4WXC A;  4E7K A;  2QSG X;  4PFO A;  2F4I A;  4NUB A;  1ZHF A;  1FT9 A;  1IW7 F;  2VBY A;  4PUS A;  3G2B A;  1T98 A;  2E34 A;  2H8R A;  2CWE A;  4BYY A;  2EB7 A;  1XMA A;  2VXD A;  5D5U B;  1U78 A;  1ZAO A;  1TWC J;  3DBR B;  2IGN A;  1YW8 A;  4OIP F;  1IRG A;  2GBY A;  1HCR A;  5FO5 A;  5E3L A;  2R7R A;  3QPT A;  2XUB A;  1ZTR A;  3ZGK A;  4WCG A;  3P7N A;  3H5N A;  5LRR A;  1FYL A;  1U9O A;  4YG2 F;  2NVQ J;  4B4C A;  4M3G A;  4XK4 A;  4UB6 C;  3LQR A;  2IXS A;  4OIQ F;  1F43 A;  1I3Q J;  5HLH A;  3I4N J;  5KCM A;  3BR5 A;  3PNT A;  1VQO I;  2L5Q A;  1RIO H;  2M9H A;  3HRU A;  4RB1 A;  3TO7 A;  3WE2 A;  3S2D J;  2Y48 A;  1XB4 A;  2J5O A;  4ENM A;  5B1B H;  2FNA A;  4MTD A;  3DU6 A;  1KYZ A;  2M7B A;  2LKX A;  1T08 B;  4LG0 B;  2VOP A;  1DPU A;  2HQN A;  1FEX A;  3S2W A;  5EEA A;  4A3C J;  2LFB A;  3B73 A;  1XSX A;  4L9N A;  4LIU A;  3U9G A;  3K0L A;  2JK3 A;  3ONQ A;  3J7A Y;  4HDV A;  1P92 A;  3ZQ7 A;  3BY6 A;  4B09 A;  1UCR A;  2MSY A;  1FYK A;  2JA8 J;  4RB0 A;  3JTG A;  2O03 A;  1RRJ A;  3ABT A;  4FE7 A;  1JHH A;  1REP C;  1Y8R B;  3QOE A;  3S15 J;  1HW1 A;  1OKR A;  3LSM A;  2PMH A;  2W24 A;  4LK0 F;  3BWG A;  3CC7 I;  5F04 A;  4OIO F;  1QBJ A;  4GFB A;  3IKV A;  2ZXW H;  4BU2 A;  4DJA A;  2Z33 A;  5BPI A;  2QUF A;  5F0H A;  1R4N B;  3MKY B;  3TOB A;  2OJE D;  3FXM A;  4KUM A;  4A3G J;  2H1K A;  3Q5F A;  4CCN A;  2BW3 A;  3NAR A;  2FMY A;  2A68 F;  2LG4 A;  4BQO A;  1R7J A;  2L9R A;  3RQ4 A;  4A6E A;  1LB2 A;  4XKW A;  3BR0 A;  4EJV A;  2E1N A;  5HNH A;  2Y75 A;  4D5C A;  4L9T A;  3M1E A;  1TTY A;  3H36 A;  4XKB A;  4LIT A;  3EUH A;  2Y9Y A;  1MMS A;  5J40 A;  4M6V A;  3G1L A;  1QU3 A;  5IYD J;  2RQP A;  2PLY A;  3HOY J;  4IXA A;  3HOZ J;  2BZT A;  2YS9 A;  3CD6 I;  1GVD A;  4DOZ A;  1D0X A;  4UVC A;  4R79 A;  1D8K A;  1TW3 A;  1GUU A;  2ACJ A;  4NHJ A;  1SC7 A;  1XC5 A;  2EZI A;  2QA4 I;  1VF9 A;  2L7M P;  5EDN A;  3BRO A;  1S8N A;  3HKZ A;  3LWF A;  2FU4 A;  5IT3 A;  3F23 A;  4A0Z A;  2L02 A;  3CDI A;  1TQM A;  3RZD J;  1H9T A;  1TP4 A;  3AFH A;  4ZDP A;  4RGR A;  1MMA A;  4I01 A;  4KIS A;  2BXZ A;  2X6O A;  1ZQ3 P;  4P96 A;  4XN3 A;  2YR2 A;  4A3I J;  4BXU A;  2G9W A;  2HOA A;  3HRT A;  3IWF A;  1T6S A;  4ZTF A;  2KFD A;  2CV1 A;  3JAM K;  1O4X A;  2TRT A;  1AKH B;  2A5W A;  5GP9 A;  2HOE A;  2KDZ A;  3QOD A;  1FNN A;  4HV5 A;  1BR1 A;  2FOW A;  4OMY A;  4G6D A;  1YE9 A;  3DLL F;  4DYQ A;  2DA5 A;  4F92 B;  1IXR C;  1IXC A;  4HG2 A;  5ICF A;  2MG4 A;  3RI4 A;  3KE2 A;  2O8K A;  4ZYH A;  2A05 A;  1IRX A;  3GW2 A;  4I76 A;  1SVO A;  3DEW A;  2QQ9 A;  3BPX A;  2PJR A;  2LH9 A;  2F5V A;  2JWT A;  1AA7 A;  2BHZ A;  2X48 A;  3H9J A;  1OCP A;  2H1L A;  3HUG A;  2P5K A;  4GGG A;  3CUQ B;  5DV5 A;  3E6B A;  3WGI A;  2CG4 A;  4M9S A;  3SXY A;  1W0U A;  1LQ1 A;  3WU2 C;  4RS8 A;  3HOU J;  4IF4 A;  2GA2 A;  3K69 A;  4WF2 A;  2XPW A;  4PDK A;  2CU7 A;  1QHH D;  4BHP A;  3OSG A;  3EQL F;  3IRR A;  2HQA A;  1PP8 F;  1HSJ A;  2N8G A;  1XMX A;  3WTZ A;  5HOD A;  1DP7 P;  2BXY A;  2ID3 A;  2GXB A;  2JPC A;  4CCO A;  2YUS A;  3GYH X;  4KN4 X;  2L01 A;  4B47 A;  5IT9 Z;  4IRH A;  2QBY A;  4ZZD A;  2L9V A;  2LD5 A;  1FJL A;  2WAQ A;  2ETH A;  3BJ6 A;  2K5C A;  2KJB A;  4P9F A;  4RAY A;  3I5U A;  2R5Z A;  4BDZ A;  1VQ4 I;  1TNS A;  3OY9 A;  4PJN A;  3I71 A;  2V9P A;  4RAG A;  3BTI A;  1Y8Q B;  4XKC A;  3U1D A;  2CW7 A;  3BG9 A;  2Z9O A;  1W4M A;  2B0L A;  2E1O A;  2EV6 A;  3L2C A;  1PYV A;  3TOA A;  2R5Y A;  3CDH A;  5L3E A;  3LST A;  4HQM A;  4FAS D;  3QWL A;  1HKT A;  1LVK A;  4A3F J;  1H8A C;  3JRC A;  2RGV A;  4GRI A;  2Z2S B;  4CYD A;  3KYL A;  1IDZ A;  3BCA A;  3CCU I;  2O0Y A;  2VAS A;  2HR3 A;  2M87 A;  2HZT A;  2V26 A;  2E1M B;  3JRD A;  1FLI A;  4HOB A;  1AHD P;  4KN7 X;  3CCJ I;  1FX7 A;  4OIN F;  2X1E A;  3E1S A;  3Q3S A;  3TW7 A;  3ZR8 X;  2IS4 A;  3DBH B;  1XN7 A;  2K7L A;  3MD2 A;  2NNY A;  2FF4 A;  2LKP A;  2DMP A;  1ETX A;  3VSL A;  5J4Y A;  1V54 H;  3CF2 A;  3R0A A;  5M3M J;  2Y31 A;  3FKI J;  4F55 A;  3JRG A;  3F8N A;  2R0Q C;  4I6Z A;  4NC7 A;  2GAU A;  4EQQ A;  2BVM A;  3DPL C;  4A5N A;  3DBL B;  4DNC A;  2LKS A;  2DBB A;  2JRM A;  2QKM B;  4Y7N J;  1K6O A;  3L2R A;  1BOA A;  3HXL A;  3T8R A;  1OCO H;  3PIO F;  2R3S A;  1J9I A;  2C6Y A;  4RMN A;  2ZKZ A;  2R7Q A;  1APL C;  1HC8 A;  4AYB A;  4HF0 A;  2K85 A;  2XSJ C;  5ICC A;  3CCQ I;  3OS1 A;  3FM5 A;  3PFY A;  2EPF A;  1FSH A;  5M5Y J;  3W2A A;  1ZH5 A;  2V6E A;  5FLV A;  2DU9 A;  2IAI A;  3O3K A;  2I5U A;  1JI8 A;  2RRE A;  1WZ2 A;  3L2V A;  3PNV A;  3QOP A;  2OD5 A;  4DBQ A;  1D1B A;  5D4R A;  4LG0 A;  2DN0 A;  2OAZ A;  1MBK A;  4E7I A;  4IOA F;  3ZMV A;  2X6X A;  3HC7 A;  3R61 A;  4BGD A;  1NHA A;  1JJ8 C;  1IO2 A;  4AD9 A;  1JKQ C;  4YRV A;  3E6D A;  1KQ0 A;  5HLI A;  1USS A;  3AG3 H;  2DLL A;  3BR6 A;  4I02 A;  4N9H A;  1NG6 A;  4EM2 A;  4L18 B;  2E71 A;  1X3U A;  2XKO A;  2A5Y B;  5E1W A;  4IHV A;  2Y9Z A;  3LSK A;  4G7Z F;  1V5E A;  2RC4 A;  4MO7 A;  5C4X J;  1P4W A;  5E1X A;  3GX4 X;  1GV5 A;  3VOD A;  2HDW A;  2WB1 N;  2KIQ A;  1YTY A;  1FOW A;  2PN6 A;  3A1Y A;  4AUX A;  4QPQ A;  1XD7 A;  2QEN A;  4G6T B;  2L9S A;  4BJ5 C;  1FYM A;  2XAF A;  2R7O A;  4ZJZ A;  1XGM A;  1POG A;  3RJP A;  4X6A J;  1DP3 A;  3P5J A;  3CDL A;  3J7A O;  1U5T B;  4LJZ F;  4IQJ A;  1UG2 A;  4RB3 C;  1RKT A;  1FPQ A;  4L9J A;  4V2G A;  5F6F A;  3SHF A;  1U3E M;  4B44 A;  3MKW B;  4A3K J;  4LIV A;  4YFK F;  2ICW G;  4F7Z A;  4BJT A;  3PO3 J;  2CS3 A;  5H6Q A;  2CGP A;  4X0G A;  1Y1V J;  5ICE A;  1QPM A;  3CMY A;  5J47 A;  2CSO A;  5KAI C;  1KU3 A;  5DD4 A;  4JOM A;  4LMY A;  1D5V A;  4WK8 F;  3WHC A;  3QU3 A;  2TCT A;  3MWM A;  3FF5 A;  1ERD A;  4R1H A;  3MCZ A;  4XM3 A;  1VQM I;  4AM3 A;  2LTP A;  5EZH A;  5LHI A;  3TO6 A;  3DFG A;  3FK7 A;  1QZY A;  5E3O A;  2CQN A;  3V7C A;  3HSR A;  3HRM A;  3D0S A;  4OMZ A;  3S1Q J;  1R1U A;  2WY7 Q;  4W1U A;  3M4O J;  1EV7 A;  2HFH A;  3OS0 A;  2O6G E;  5D8K B;  2LF8 A;  3TBI A;  3OOU A;  3P9I A;  2L2O A;  4CHU A;  2EV0 A;  5BQT A;  3ZQC A;  4AWX B;  1BIB A;  1G3Y A;  5GAG J;  4XLA A;  2KT0 A;  1B8I B;  3OYJ A;  2YX7 A;  2XPV A;  4G8X A;  3VPR A;  4EGY A;  3HJE A;  2KRH A;  1QNT A;  2NS0 A;  4BJ6 C;  2XGX A;  2MC3 A;  1R4M B;  3TDZ C;  5CVV A;  2EIK H;  3FXK A;  1SD7 A;  2DPD A;  1MH4 A;  2HNH A;  2YU9 J;  3DV8 A;  3OYG A;  2M4K A;  4G6Q A;  3ZN0 A;  1QVT A;  2CJJ A;  3J81 Z;  1R49 A;  5FD6 A;  4QWQ A;  1KU7 A;  1S7O A;  2MA3 A;  4IHW A;  2KZG A;  1KQ8 A;  1OCT C;  2VBZ A;  1VFC A;  2JJ7 A;  2LYC A;  3DTE A;  4MHG A;  2CFX A;  3HRS A;  1O3Q A;  1H0M A;  1W5T A;  4MTE A;  3D1N I;  2RAE A;  2LLK A;  4ANJ A;  4BXX J;  2E1C A;  3GTJ J;  4A3L J;  2WV0 A;  3L2W A;  2Y0S N;  4PJL A;  4A3B J;  5LRS A;  3FM3 A;  2DA6 A;  1BBY A;  1DU6 A;  1K79 A;  4Q47 A;  3BTL A;  2ELJ A;  1ZAR A;  3HOS A;  3WHB A;  3RKY A;  1G2H A;  4YFN F;  4M9X A;  4XLF A;  1HF0 A;  2Q8K A;  4O6J A;  1Z0X A;  4P5O A;  1K78 A;  2IP2 A;  4I98 B;  4ZDO A;  4ZYA A;  1IGN A;  4XON A;  4PJJ A;  2VON A;  2NVU B;  1E0E A;  1ZRF A;  2ZJ2 A;  3HOW J;  4E6K G;  2K9L A;  1B1B A;  2FQ4 A;  1R6R A;  1N75 A;  4M72 A;  1MJA A;  4U7B A;  5ICG A;  1OQY A;  1A6I A;  1MW7 A;  3P9C A;  2LF7 A;  1IN4 A;  5CVU A;  1Z91 A;  2G7U A;  3QRF F;  5AIQ A;  3BZC A;  2VC0 A;  1ONV A;  2NNN A;  5HS7 A;  2ZFU A;  2MGQ A;  4HZF A;  2KMU A;  2Y30 A;  4RAF A;  1ZGJ A;  5JFR A;  2RDP A;  2CW0 F;  4M74 A;  2E2J J;  2JUG A;  3LSJ A;  1MSE C;  3DLA A;  2F4O B;  1GHC A;  4IO9 F;  2W84 A;  5ILV A;  2BEO A;  2DA3 A;  4M3D A;  1SMY F;  5FFX A;  3QYF A;  2XGC A;  3TL4 X;  4M73 A;  3WTT C;  2GQQ A;  2UXN A;  3GO5 A;  1K4T A;  1W5C C;  2CO5 A;  2DMU A;  3NWT A;  3CO6 C;  1K6Y A;  3DEE A;  1JJ6 C;  1VQP I;  3F3X A;  1LKX A;  4IHY A;  3KP2 A;  1S29 A;  5CYV A;  3FX3 A;  2KLO A;  1A35 A;  1BA5 A;  3LSG A;  2HGC A;  5LHH A;  5K7F A;  5DS9 A;  2HOS A;  2F6C A;  2H09 A;  1P2F A;  3K4L A;  5IP9 J;  3WTV C;  2LY1 A;  4D9J A;  1R00 A;  4M3E A;  4B8X A;  2VJ4 A;  3CUO A;  9ANT A;  1FOX A;  4HSR A;  1D1C A;  5FLX Z;  4X1E A;  4IJA A;  5DM7 F;  1Y1W J;  2P81 A;  3BJO A;  2DMT A;  1JT0 A;  1NK3 P;  4ASN A;  3M07 A;  4LOC A;  4LLL A;  2YPR A;  2OPT A;  3S1N J;  5E17 F;  1VZ0 A;  2HWV A;  3KP3 A;  2XPU A;  4XSZ F;  2WC2 A;  1TLH B;  4NQW B;  3PL8 A;  5J3L A;  4HNT A;  2E5N A;  2R7X A;  3IV5 A;  2R7T A;  1G59 A;  3WTU C;  2CH0 A;  4CGZ A;  2EH3 A;  2HPI A;  3CP8 A;  1T56 A;  3OYL A;  4UVB A;  1JUM A;  1OPC A;  4II3 A;  1XX5 A;  3HOV J;  1EH7 A;  4I7H A;  1SAX A;  2XAU A;  2M1B A;  3AL0 C;  1S7A A;  3E5Q A;  3S3M A;  3HM5 A;  1Z9C A;  2DOD A;  3VB2 A;  1YJ9 I;  2DDA A;  3OS2 A;  4L5E A;  2EFQ A;  1PDN C;  1XSV A;  4ENN A;  1MMD A;  3ECH A;  4HDU A;  2EFP A;  1UHM A;  2CFO A;  4FCY A;  3F0C A;  2LBF A;  4ETS A;  3IUO A;  4JX4 A;  2LY2 A;  3SFZ A;  2MLK A;  3Q9S A;  3EDP A;  1BI2 A;  3RCO A;  1PUF B;  2IT0 A;  3S14 J;  3KPH A;  1RI7 A;  4S04 A;  3A03 A;  3RPU D;  1TWH J;  5CLS A;  3SDB A;  2IS6 A;  1UG0 A;  3C2B A;  2VB6 A;  3DU5 A;  4L0Y B;  1YFH A;  2CUJ A;  2DTZ A;  3HGY A;  1ULY A;  3L09 A;  2IA2 A;  1ZN2 A;  1YHQ I;  2DFF A;  1H9G A;  3UKG A;  4BXF A;  3BCB A;  3CO7 C;  3P9K A;  3ZQL A;  2UV1 A;  3J7Y J;  2QSH X;  1YIJ I;  1FBU A;  1R1T A;  1R5I D;  3QP5 A;  2LC2 A;  4BNC A;  2JPB A;  4D7M A;  1R9T J;  5DDG A;  1ZEL A;  5FRN A;  1RZ4 A;  2DT7 B;  2R7U A;  5GPA A;  1G3S A;  2IA0 A;  5EG0 B;  2R93 J;  1YW9 A;  4XLP F;  3FK6 A;  3CCV I;  4AVZ A;  1PVE A;  2VKV A;  4U88 A;  2IGK A;  2WA0 A;  3I4P A;  4RGU A;  5C44 J;  2Y69 H;  1EA3 A;  2WV1 A;  1NTC A;  2FBK A;  3K1N A;  1UEL B;  1X3Z B;  4M9Z A;  1E3H A;  1X4O A;  3CJR B;  5E18 F;  4NC6 A;  5EZG A;  1XMK A;  2IGO A;  1OYY A;  3BTJ A;  5KAF C;  2V1X A;  3ABK H;  1B8I A;  1YO5 C;  4YIF A;  3F6V A;  2O8X A;  3FXL A;  3S3N A;  2QQB A;  2DFE A;  2DDB A;  1MIJ A;  1VI0 A;  1OCR H;  2AXT C;  4RAZ A;  3EUH C;  3U1K A;  4BY1 J;  2B7E A;  2FML A;  4OWR B;  1Y39 A;  1G4D A;  2V1U A;  3H5A A;  2AXL A;  2VBX A;  1U9N A;  2JQ7 A;  1MBF A;  2ME6 A;  2KIS A;  1ZG1 A;  4C2T A;  3BR1 A;  4HEA 2;  1T39 A;  4F3Q A;  5IY5 H;  1FMW A;  2KPM A;  1YS6 A;  2PX9 A;  4UV8 A;  2GIV A;  5DEQ A;  3OYB A;  1VQ8 I;  5D5V B;  3M9A A;  4UUT A;  3LL7 A;  5LHG A;  3GFJ A;  3PIP F;  3CMA I;  2DO7 A;  4UY8 I;  1X1D A;  5JVG F;  1LPQ A;  2AHQ A;  2RNG A;  3LSP A;  3E6M A;  2P5L C;  2K86 A;  3KEO A;  2GOM A;  3GLL A;  3LAP A;  1D0Z A;  3RKX A;  2GM4 A;  2L0K A;  4XID A;  1BW6 A;  3DEU A;  4KYW A;  2HS5 A;  2NAZ A;  3IHU A;  1Y56 A;  4HYE A;  5B3S H;  4Q48 A;  2VT3 A;  1CGP A;  2HYF A;  4HRI A;  3DCF A;  2J5P A;  3WTY C;  2GWR A;  1BN5 A;  2JRT A;  1A6Q A; 
#chains in the Genus database with same CATH homology
 3CCJ I;  1WIB A;  1VQL I;  3CCM I;  1VQ6 I;  2ZJR F;  1VQM I;  1YHQ I;  2E36 A;  1S72 I;  2FOW A;  1VQO I;  3J7Y J;  4IO9 F;  5GAD J;  1YIJ I;  1VQN I;  3DLL F;  1VQ5 I;  3PIO F;  3EGV B;  3CJQ B;  5GAH J;  5GAE J;  3CC4 I;  2OTJ I;  1HC8 A;  2E35 A;  2ZJP F;  3CCQ I;  3CCR I;  3CCV I;  1ACI A;  5GAG J;  2NXN B;  2K3F A;  1YJN I;  3G71 I;  1VQ7 I;  3CJR B;  3CCE I;  1VQP I;  4IOA F;  3CC2 I;  3I56 I;  3CC7 I;  3J7Z I;  1Y39 A;  1FOX A;  1FOY A;  2JQ7 A;  5DM7 F;  3G4S I;  1YIT I;  4V19 K;  3CF5 F;  3I55 I;  1YJW I;  1QA6 A;  5DM6 F;  1VQ8 I;  1FOW A;  2OTL I;  1MMS A;  1VQ4 I;  3PIP F;  3CMA I;  3CJT B;  4UY8 I;  5JVG F;  4IOC F;  3CD6 I;  2H8W A;  1VQ9 I;  3CCS I;  2QA4 I;  1YJ9 I;  1VQK I;  1YI2 I;  2E34 A;  3G6E I;  3CCU I;  3CME I;  3CJS B;  2QEX I;  2ZJQ F;  3CCL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...