2K3FA

Ribosomal protein l11 from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain reorientation and induced fit upon RNA binding: solution structure and dynamics of ribosomal protein L11 from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L11
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2k3fA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2k3fA01
2K3FA 1HC8A 2QA4I 3G71I 4IOCF 3CD6I 4UY8I 3CJQB 5GAGJ 2E36A 2H8WA 3I55I 2OTLI 3CCJI 1YJNI 2JQ7A 1VQ8I 5DM6F 5GAHJ 3G6EI 3CCQI 1VQ4I 2ZJPF 3CMAI 1YJ9I 1YHQI 2E35A 5GAEJ 1Y39A 3CCUI 1VQ7I 5DM7F 1VQPI 1S72I 1FOYA 3DLLF 3PIOF 3CCMI 3CJSB 3CCEI 3CC4I 2ZJRF 1VQNI 3CJRB 3CMEI 2E34A 3G4SI 1WIBA 3CJTB 3I56I 3CCRI 3CF5F 1YIJI 2OTJI 4IO9F 1YJWI 3CCVI 1YITI 2QEXI 1VQ5I 1QA6A 2NXNB 5GADJ 1VQLI 1ACIA 2ZJQF 1MMSA 1FOWA 3CCSI 1VQ9I 3EGVB 4V19K 2FOWA 3CC2I 5JVGF 3CC7I 1FOXA 4IOAF 1VQMI 3J7YJ 1YI2I 3PIPF 3CCLI 1VQ6I 3J7ZI 1VQOI 1VQKI
chains in the Genus database with same CATH superfamily
1BJAA 2QA4I 2KZVA 1XN7A 1TZLA 3KP6A 1XGOA 2HDWA 1PUEE 1FX7A 2WWYA 1KQ0A 1ZRFA 4KMUX 2ADUA 5LHHA 2RAEA 4I6ZA 1QVTA 1XTAA 5L3EA 2QBYB 2W4SA 2Y0SA 4UV8A 5ILUA 2RNGA 5E3MA 3QWLA 2R4GA 4HEA2 5JR3A 3QPLA 2ECBA 3WHBA 5TRDA 3HOYJ 1JT0A 4JP0A 4ZTFA 4BQNA 2DOFA 3GTPJ 3G6EI 4ENMA 4XOPA 1S8NA 3NWTA 3VFZA 3OYLA 3VYRB 2R93J 2IVMA 3DEEA 1VQ4I 2L0KA 4IF4A 1N75A 2Y9YA 4PSXA 4J19A 2K5CA 1XGNA 3HZJA 4M9ZA 5J4YA 1YFHA 2EFPA 3IUOA 3ZMVA 2R92J 4IVNA 3FZVA 5FLVA 4D1QA 2DO7A 3CP8A 4GXOA 5GP9A 1PDNC 4PJMA 1HOMA 3BR5A 2M7BA 2WY8Q 5EGOA 4AIDA 2VKEA 4FASD 3DEWA 3HPGA 2CQXA 1FSHA 3HGGA 1U0JA 1KYWA 1POGA 3CC4I 3HOUJ 2ZJRF 1NK2P 1IZ1A 4BUPA 2Q8KA 4E7HA 3K4JA 5E1ZB 3MZYA 3S3OA 4ASNA 2CO5A 2E2JJ 2NVUB 1R1UA 4IEJA 3OS2A 1RZ4A 4A3GJ 2OQRA 3BOQA 1A35A 2HOSA 2YU3A 3E5UA 1TT5B 4RB0A 1WI3A 1VQ5I 1KYZA 1WJCA 1Z1DA 1U8BA 1QA6A 2HVRA 3Q0VA 1IN4A 4AUXA 3RYRA 4EATA 3I71A 4IKFA 2IEKA 5GADJ 2EV0A 2HOAA 2IA0A 1Y1VJ 2I8DA 2KLOA 2VC1A 3S93A 4PK4A 2KISA 1OR7A 3V8LA 1BR1A 4HOBA 4G7OF 3FDYA 4ZDLA 3CUQA 2EINH 3W2WA 4PFPA 2V26A 4OAZA 4FISA 1B6AA 4XSXF 2XGEA 3IKTA 4N4OB 4CICA 1Y8RB 5EJCA 5FB2A 3J80K 3AG1H 1EH6A 3GUDA 5H6RA 1MJBA 1VQMI 2ZCWA 1S29A 5LEKA 4M3EA 2EFQA 2KIFA 1GVJA 3HUGA 5FLXZ 3J7ZI 1ZRDA 2K3FA 3JRDA 2LKXA 3TGNA 2XRNA 1JKPC 1DU6A 2VC0A 3E6BA 1IN7A 4CZZA 3OYBA 3I53A 4JX6A 4RB2C 1XDUA 3TOBA 5HOOA 4CYCB 2XAGA 4MTEA 4XR6A 2QYOA 4PJNA 5K7FA 2BHYA 1QRYA 4UB6C 2OD5A 3TMOA 2GLOA 2V79A 4ENKA 6PAXA 2XKOA 3FXLA 5B66C 4DBQA 2V9PA 1W0TA 4WXCA 3ABKH 4QTRA 3KX2A 3BZ6A 3LSGA 2KHMA 1D1BA 2RN7A 5HLGA 4P1WA 2DOEA 3CCUI 3VDXA 4HRIA 4LITA 2EV5A 1HSJA 1XB4A 3IP4B 4I09A 2ZXHA 4M9SA 1MDMA 3PIOF 4WWCA 2VQHA 1LEAA 4E7KA 2O9LA 1X3WB 3H0DA 2BBYA 5CKTA 2HGCA 2LNBA 1K7AA 2L2OA 4CDGA 1JHFA 1TW3A 1YOVB 3ZMUA 2DA1A 3QYFA 3HSFA 1O3SA 1R6RA 3H3ZA 3ABTA 1DUXC 1FP1D 3GZ5A 3GX4X 4EVIA 1ON1A 1D0YA 1X1AA 3SZTA 1ENHA 1WFXA 2Z9OA 1T2KA 2JK3A 3FX3A 3D1NI 3TOAA 2M9HA 3PQJA 4H0EA 1OCOH 4UB8C 4CGZA 2QLZA 2M0MA 2CS3A 3S16J 4IZZA 3WG7H 4UV9A 4IHXA 4IHWA 5FKMA 4ANJA 3OMYA 1OKRA 2NOGA 5JLWA 3K4MA 1Z7LA 3KZZA 1D0ZA 2LBFA 2X1EA 3N97A 3C1DA 3P7NA 4FE7A 2BEOA 4GCVA 2VJ5A 4UVCA 4P96A 3EUKL 4N4NB 2BYVE 4LIUA 1LNWA 3K70C 4J00A 4A6EA 5E1WA 3ZPLA 2HI3A 2M0CA 4IHTA 1I1GA 2P5KA 2L7KA 5KCMA 2O7OA 3DPUA 4G6DA 3W6KB 3KP5A 1YG2A 1LVKA 4AYBA 1YQAA 2KRCA 1IN8A 2ZNZA 5J40A 3CO7C 2MH2A 1KZHA 2ACJA 4M71A 3S1NJ 2AQFA 2H1LA 3LSIA 3QYEA 4IOCF 2F2EA 3CJQB 4PGHA 1TC3C 3LSMA 2E36A 1K61A 2P5LC 1SEUA 1ZGWA 4B3XA 2JVHA 4HAMA 2GQQA 4G6TB 5BS6A 1VNDA 2A6HF 3HXLA 3MN2A 3LMMA 1D3YA 3IV5A 3OSGA 4M6YA 5JVTA 3OYNA 2DN0A 3OYKA 4EJUA 2AO9A 2NVQJ 5EZHA 1G8XA 3GVAA 3K1MA 4LK0F 4G7ZF 2FBKA 2VXDA 4W1UA 2RC4A 2KDZA 2XPWA 3DV8A 4Q4ZF 1TT0A 1JHHA 4ON0A 3A03A 2MGQA 5F1RA 3M9AA 3ZQHA 4Y17A 5GAEJ 1WKMA 5LGTA 1FYLA 3MMYB 1VQ7I 2GXGA 5LFAA 3PSFA 5EZGA 5F64A 3CP2A 4OIOF 2PBIA 1UHSA 1CQTA 5FKLA 2BVLA 3ELKA 3NQOA 5LHGA 1RR8C 1Y8QB 2D1VA 3L9FA 2MW8A 3PJRA 2X4HA 2VQLA 1WPKA 4WXDA 2HYJA 1RUNA 1JI8A 2MABA 4BXUA 1IRGA 3CJTB 3SFZA 4F52A 2M3AA 3QAHA 5D4RA 1HLVA 4BEHA 2COMA 2CW0F 4O5VA 4PZJA 1IXSB 4JK1X 3OYFA 1OYIA 4B4CA 4KYWA 1YJWI 1FOKA 5HLTA 5DCMA 4CXFA 4FTHA 3Q0UA 2XKPA 4MHGA 4HSTA 3WTVC 2LD5A 2ICWG 4XLHA 5AIQA 4HNVA 2JA7J 1VI0A 2HU9A 1D5VA 2X1CA 2CGPA 1ACIA 4EQQA 1IV6A 5GTHC 4S0HB 3CCYA 3CCSI 3IH2A 2A69F 1OYYA 2F5VA 3F9KA 1YLFA 2E5NA 2FD5A 4CO8A 2VBXA 5JVGF 1XSDA 2OC6A 3W6VA 3H0GJ 3BY6A 3KEQA 3LNQA 1HW5A 4XK4A 2FXAA 2CV0A 1TQIA 5F1JA 2L7ZA 2QSFX 1VFCA 4A5MA 3DPLC 1WJFA 5E18F 1APLC 3FXRA 1QPMA 2X6YA 3RZOJ 2Y48A 4BACA 3WTXC 2DLLA 1GXQA 4WF2A 1PP7U 4BYYA 5ICGA 2L3DA 4LLNA 2VJ4A 4CCJA 5DS9A 2RQPA 2XGXA 3ESWB 3GFJA 1DGWY 2IXSA 2Y31A 3A2KA 1ETVA 3PNVA 1L3LA 3WE3A 2GWRA 2IGNA 1J0RA 4UUSB 3TDUC 1G4DA 4GRIA 1JGGA 4BNCA 5GAHJ 3QRFF 3D5LA 3ISPA 2M4KA 5FD6A 2P6SA 4HX8A 2FSWA 2LVSA 3GFMA 3CZ6A 1R49A 4L18B 1R58A 2IAIA 4MIMA 4XKVA 3ZQQA 2ZXWH 1O57A 2F4IA 2R7VA 2ZC2A 2PJRB 3MCZA 4IL6C 2JMWA 3OOUA 5M3FJ 3G73A 2Z2SB 5E3OA 4XICA 2A6EF 1BW6A 3O3KA 3F8CA 3C18A 1MNEA 2RKHA 2JA6J 4JQFA 1E3PA 4IRGA 2L5QA 5BPIA 1VF9A 4M6VA 1J09A 1SFKA 4OMYA 5TGTA 3IL2A 2XAFA 4CYDA 2HKOA 2VOOA 3JAMZ 1BN5A 2VKVA 2LMDA 1ZQ3P 2DMUA 2P7VB 2RREA 3T1BA 4ZC3A 4L5EA 4RAYA 2W7NA 4DZJA 2R5YA 1R9TJ 5D5VB 4BE0A 4RB1A 4J01A 4BE2A 4BKXA 2F6CA 2EIJH 1S7OA 2JA2A 3DF8A 5IY5H 2I5UA 2IBDA 2IP2A 2QCOA 2CH0A 4DZPA 2RQQA 3MZ8A 1NG7A 1WHUA 3ZQGA 1H89C 1IUFA 2NAZA 1QPIA 4KIGA 1HW1A 3C2GA 2KJCA 2H8RA 2V4JC 4XRMA 4Q5SF 1DQUA 1IXRC 4HV5A 3MD2A 3TO6A 2JPCA 5EEHA 4A2UA 5J4VA 3K0LA 4BJ6C 1TWCJ 3LA3A 5B3SH 5D8KB 3QQAA 4B3AA 2W57A 3B6AA 3IRQA 3RKWA 1H8AC 4GGGA 5JI6A 4V2FA 3LSPA 4XNFA 4P9FA 3J7YJ 3TL4X 2GAUA 4ITVA 2WAQN 4FX0A 1U3EM 2M7AA 3JSOA 1MJ9A 1HC8A 3KLNA 1T0FA 1WI9A 1MGTA 2CUFA 2XAHA 2C6YA 2K9SA 3BQYA 3BJOA 1TQPA 4KDPA 3K4NA 1SANA 1PVEA 2IGMA 2IS6A 1T38A 2LK2A 1HKTA 3PL8A 3K7AJ 4HSRA 1VQ8I 2GA2A 1LDJA 1YTYA 4ZZDA 2ESHA 1GT0C 3RTRA 1YS6A 3L2VA 2IW5A 4ESJA 2GXBA 2DT7B 2MD5A 4GFBA 3DKWA 3DLAA 1K4SA 5F0CA 3DWLE 2STWA 4DIQA 3ZQLA 5K7ZA 1WZ2A 2DDAA 4F91B 2FJ1A 5EYRA 4XLAA 1W1WE 3RQ4A 2EA4A 2X1DA 3LA7A 4I0AA 2XROA 3QODA 5E8GA 1QU3A 5HDKA 4HG2A 1J5YA 3DTEA 2Q2EB 2LF8A 1J59A 2MYSA 1TL8A 2W1OA 3BR1A 4EGYA 3E97A 2JVGA 3CJRB 1F36A 3F8NA 4AM3A 2HZTA 3G1LA 2HEOA 1ZTRA 3CUQB 5CPRB 5F04A 3E6CC 1IN6A 1MZBA 4HW0A 1WWXA 1LJ9A 2KFDA 4XBFA 5ILSA 5L3GA 5FKOA 5LGNA 1W5CC 4YG2F 1DP3A 3S2DJ 3QP5A 2WY7Q 2BHZA 1YITI 1RIOH 1T33A 4LG3A 3PNYA 4B8XA 4F92B 2NRAC 3V4GA 3MAJA 1LDKB 3OIPA 3RZDJ 4Z2YA 1KQ8A 3I4MJ 4KJZA 1E17A 4RA2A 4YIIA 3QPHA 2ELHA 1STZA 1RI7A 4L9TA 1SFEA 2FOWA 2K02A 5IP7J 2V6EA 1FP2A 3HOXJ 3K69A 3F8MA 2YR2A 3LQQA 4G9YA 5DTDA 5HS8A 2NS0A 4XMYA 5C4XJ 2DTZA 1ZG1A 1EJ9A 5FRMA 4CCKA 1NH3A 3RKQA 2Z3YA 4AIKA 3U1DA 1I1SA 3QPSA 3U2RA 2EK5A 3KYDB 4DYQA 1RNLA 1SD5A 2ZB9A 2JRMA 5D5UB 5B1BH 2G7UA 4FCYA 2IS1A 3NWSA 2EZHA 5GAGJ 2OJED 4YFKF 2EZIA 3L2WA 1Q1HA 3I55I 3AFHA 2LY2A 2ETHA 4R1HA 2G7HA 3LQRA 4H4KC 3PSIA 3WGGA 3BROA 4A3FJ 4I02A 4U7DA 4BGDA 1SFUA 3TKYA 3CCQI 1K6OA 2O8XA 4QPOA 4ZDPA 4D9JA 4QWQA 1ITYA 5C44J 2EB7A 2O6GE 3KE2A 3TBIA 1HKSA 3O8HA 1Y6IA 2DMNA 2ZMEA 3T0YA 3CUOA 2QGUA 2Y0SN 3W2AA 1Z21A 4CSWA 5GTIC 1FNNA 2HYFA 2DYSH 1X3ZB 2I10A 4ESFA 3BTCA 4CHUA 4CH7A 4D5FA 3KCCA 3DLLF 2PMZN 2F4MB 1G2HA 2LKPA 3D5RC 4QSHA 5FJ8J 3DU5A 4A3MJ 2CRGA 3H5NA 2FOKA 4BS9A 4CCMA 5LRSA 3ASNH 3KEYA 1VQNI 2XAQA 3G4SI 5D6FA 1VZ0A 4KNYA 2DA3A 3DKXA 2ISYA 1MBFA 2Y2ZA 3CCRI 2ZFWA 2KZGA 3L2QA 4IJAA 3M7GA 2HFHA 3FBIB 4IO9F 1NG6A 3H92A 5J8CA 4KA4A 5GPAA 1F5TA 2XGDA 1Y0NA 1FIPA 2R7FA 1EH7A 3ZP5A 3JSPA 1V54H 5FKKA 1MBKA 4S05A 3TDZC 4XLEA 2VJIA 2IA2A 4OINF 4NB5A 4EM0B 4X1EA 1KU9A 1WJDA 1FOWA 2L4AA 5J3LA 3IRRA 2V1DA 1UFMA 3C7JA 3IH3A 2DXIA 1P4WA 2OV7A 5LBQA 3HPHA 1P7JA 3ZQIA 2A07F 2FU4A 1V5FA 2E2HJ 1FOXA 1JGSA 2XASA 2F5DA 4L9VA 2Q0OA 2LP0A 1B72B 5A2QK 4B47A 3EYIA 3ERMA 3C2BA 5DUKA 3L2CA 1P7IA 3QYBA 3G1MA 2K40A 2HR3A 3RPQA 1SC7A 5IP6A 3WTSC 2QM3A 3VWBA 2OBPA 1RR7A 3JRHA 3GMEA 3HUGB 3HOVJ 5F27A 3FK6A 2VIXA 4R8HA 1LE8B 3GCMA 3BC8A 4U0VA 2VOPA 2JA5J 4IQ4A 3F21A 4RMNA 3GTLJ 1WVRA 1HCRA 1ETOA 1QBJA 2P4WA 3GEZA 3LAPA 1ZLJA 3NRVA 3F22A 1VTNC 4G12A 2VE8A 3BT9A 3GTQJ 5KAFC 4CYCA 1KU7A 4HDVA 1MNMC 1ZELA 1XDSA 4HA8A 2R7RA 4IHVA 3IWZA 2P81A 3CMYA 2LTPA 4KUMA 1GLNA 3A0BC 4UXNA 1P92A 1V55H 4LJZF 1XC5A 3O2PE 2ME6A 1XPXA 3QOPA 4MNUA 4ZYEA 1USSA 2P5VA 3PFYA 5E8IA 2Y0MA 3I58A 4K2EA 3HKZA 3IH4A 2CJJA 3HB9A 2WADA 1SMYF 3OWTA 3M1CA 2GA1A 1BOBA 4UUTA 5IOYA 1R5GA 2X85A 2AQEA 2Z1DA 4XRSG 1X1DA 2OQGA 2DA2A 3HRSA 5K5QA 2ZFUA 1ON2A 3H9QA 2R7OA 3M8JA 3Q9VA 1V3FA 1UELB 4KISA 2PEXA 1W7PB 2M4GA 5CVVA 2ZXJA 5TJJA 3O6BB 3IAS2 5IYCJ 5JHFA 5E3LA 3NAUA 3CLQA 3M4OJ 3PQKA 2EFOA 4ETSA 1HKQA 3HOWJ 1Z3XA 2WC2A 1JXSA 2V6CA 2LC2A 2D5VA 2OTJI 1MJAA 1R5HA 3GYHX 4DQ2A 1X4OA 2K3PA 3AG2H 2BW3B 2HQNA 4L9JA 3F0CA 3G3ZA 1B59A 2KQRA 3OYGA 2A5YB 2E1OA 1K78A 1UMQA 5EF6A 1Z3YA 3WHCA 5BOXA 1FBUA 2A05A 5LGUA 3S3MA 2RDPA 2LBFB 1FWZA 5K5RA 3ZMDA 3ZN1A 3DEUA 1JE8A 1FYKA 2FF4A 1T98A 3EYYA 2GBYA 1UHWA 2R7XA 5M5XJ 2KIMA 9ANTA 1DP7P 2RNJA 1RPWA 3C2HA 1OCTC 5HLHA 4X0GA 4KN4X 4IQJA 3HOSA 1XMXA 2VKHA 1QGPA 1BBYA 2EIMH 1BR4A 1ZGAA 2NVYJ 3KETA 2XIGA 1MNDA 4EMSA 4ZZLA 2DFIA 3I59B 3CCVI 1U6GA 5DM6F 3I9V2 2OCCH 3F6VA 3HRTA 2MC4A 3WTUC 2DMPA 4JYKA 4U0YA 3GLXA 1NTCA 4UY8I 1YE9A 5KK1A 4I01A 3P9CA 4X6AJ 2XVCA 1R4MB 5F6FA 2FUG2 3SXYA 2NNNA 4CCOA 3CCJI 2ELKA 1FBQA 2JJ7A 4B48A 3I54A 4EJTA 2Q1ZB 2OU2A 1JKOC 4NUBA 1LQ1A 3SDBA 3L2UA 2XF5A 3KYLA 3K2ZA 1SFOJ 1FMVA 5CQGA 2LKSA 3J80Z 3OYMA 3CMAI 3I3LA 1IC8A 3TO7A 3QP6A 4M72A 1OJLA 4RM3A 3SQNA 3MVPA 2QKMB 1TWHJ 1MH4A 1X2MA 1O7FA 2XHKA 4LMYA 4II3A 4PFOA 2HKXA 4PGGA 4NC8A 1KONA 4AD9A 3JR9A 2GM4A 2QSHX 2DJNA 4A3KJ 1S72I 4BXXJ 2M87A 2OZUA 3VYUB 3CF2A 5J47A 2R7UA 3BJAA 3P9IA 1ORKA 3TP0A 2VQGA 1X3UA 1CGPA 1MBEA 2JSPA 3BG7A 4HLXA 1U5TB 3BG5A 3DFGA 1BI0A 2EILH 3SFIA 1QHHD 1BOAA 2BY3A 5JHUA 4C30A 3CMEI 3UKGA 1AWCA 1EH8A 2XB0X 2E60A 2L4MA 1H88C 1AKHB 4RS8A 4IPAA 2GIVA 2K4BA 3B73A 3K6GA 4M3BA 5KNLA 1AU7A 3HL2A 2JZYA 2X9DA 5FFXA 3H9GA 3ULQB 1OLTA 2FMYA 1W7PA 2IS4A 2GIZA 4ZJZA 5BNGA 4GYIA 1IXCA 1OCZH 3B6CA 4LG0A 2EFWA 1FJLA 3HTUA 2FRHA 4Y52J 1PUFA 1P4AA 1U8RA 2W82A 4NHJA 5EG0B 2B9SA 1QZEA 3LSRA 2GZWA 5L3CA 1VQ9I 3VODA 2BOLA 4F55A 4YIRX 3OYJA 2L54A 2IJLA 2PI0A 5L3BA 2YX4A 4JOMA 5E3NA 2AS5F 2DK5A 3KZYA 3FXJA 4FE4A 2HPMA 1TTYA 2DODA 1T8IA 2D1HA 2X0LA 2EQRA 5FLMJ 3PO3J 3ZRGA 4S04A 5DD8A 1MMNA 5D8LB 4KICA 3BQZA 2XB5A 4RLFA 2DDBA 4KT6A 2LF7A 4MGRA 2Z5UA 3MWMA 4L5JA 2XGCA 2UWMA 1B4AA 4YRVA 3FXOA 5D4SA 3F8BA 2L9VA 2M34A 2P8TA 2JWTA 2QF7A 2FNPA 3BR6A 4A3LJ 1XX5A 2P7CB 5B1AH 1P6RA 1QO0D 3HTSB 2DJIA 2QQ9A 3FXMA 4GDFA 4KIFA 2O5RA 2WB1N 4HV6A 5ICEA 5TISC 1QHGA 2HVSA 4BBRJ 1R1TA 1IG7A 4GO1A 2ZSIB 3HGYA 4XKWA 4P5OA 1Z77A 2KDOA 3UR3C 2VKDA 3I64A 3FBNB 2LY1A 1UCRA 2PJRA 4A93J 2DA5A 3CTAA 4ZYDA 2R5ZA 5BPDA 1ZR2A 4A3BJ 1FBSA 3TQNA 4D7NA 4KFCA 1N78A 4DYCA 1D1CA 2DYRH 4NQWA 1U78A 2VUMJ 4XKCA 2EV6A 1KQ9A 4B09A 2F48A 1QNTA 5C4JJ 4M73A 3W3CA 2Y69H 3K9TA 5ICFA 4Y13A 4HDUA 1OFCX 2LFBA 4XIDA 3AG4H 5HDGA 4MEXF 5IT9Z 1GVDA 1B1BA 3AL0C 1RKTA 2HS5A 1JUMA 3OL4A 3J81Z 3GTMJ 4HF1A 4XOTA 3L2RA 1FTZA 2M30A 1OYWA 1SD7A 3HC7A 1TNTA 1HBXG 3M07A 3OIQA 1ERDA 3P9KA 4XL9A 4MQ9F 3DU6A 2PJPA 2QEXI 4B44A 4BY7J 1WJ5A 3MKLA 2O8KA 2N8GA 2JTVA 1J7KA 1XCBA 2CSOA 1ZLKA 5F08A 1S9HA 3EETA 1S6LA 3E5QA 4PCQA 1ZGJA 5D5XB 4A3EJ 1R36A 3HG9A 2ZJQF 3HIFA 4A3IJ 4L0YB 4V19K 1T0FC 3WG9A 4W97A 3CC2I 2K9NA 2V1XA 4DW6A 2XPUA 1Y0UA 4BDZA 3A0HC 4NDLA 2F5CA 3GO5A 2BY2A 2ISZA 4FQGA 1PJRA 3DCFA 4QLCU 3ECHA 5EG0A 1YI2I 5DCFA 3CCLI 3IC7A 5EDNA 1OR7C 3SHFA 1EF4A 4C2MJ 4HNTA 5LD2C 1R71A 4DBRA 1BC7C 2CQKA 3KEOA 4NC7A 5IPAA 3ABUA 2L01A 2DFFA 3JRBA 3VYTB 3OYDA 4XN0A 4MLOA 2UZKA 2A3SA 4PSWA 2E1MC 5CVUA 2G9WA 2HQRA 4BE1A 1IV8A 1BR2A 4I7HA 3OYEA 2K7LA 3VSLA 2PG4A 5EEAA 2KP6A 3CDLA 3NEUA 2K9LA 3H3VK 4KMFA 4I0BA 3OL3A 4BH9A 4PJLA 3HOZJ 1MW7A 5HS7A 1FMWA 1N25A 2EA2A 4LGWA 4RM2A 3VOEA 2GOXB 1WCMJ 3ZMZA 2W25A 1HDPA 4Y7NJ 4MQVA 3M8EA 4BBSJ 2NOJB 5DM7F 4XLFA 2H27A 1ZKGA 3COAC 3JW4A 3KLOA 3PUFA 1FOYA 1IO2A 2BY1A 2HOTA 2QQBA 1K79A 1T6SA 2EFNA 2Q2EA 3DTKA 4DYRA 1E3HA 3O8GA 2DOAA 2QWWA 1QVUA 1HXDA 2OZ6A 3A1YA 1XG1A 1Y56A 3S32A 3R0JA 4AVPA 2DPDA 3RJPA 1YX5A 5HNFA 3CF5F 1ETXA 2A6TA 3S2HJ 4HQEA 5F0HA 1SAXA 2YS9A 1BW5A 2KRFA 3CJNA 4KT5C 1LVAA 1QZZA 2NVXJ 2HXOA 5KHDA 1ETWA 5L3DA 2DA7A 1KU2A 2M45A 3R0AA 1B8IA 4YEJA 3ROUA 1F9NA 1LDDA 5F0FA 4FX4A 2KRHA 4G7HF 3OIOA 2NNYA 4OWRB 1B9MA 5LEJA 1MMSA 4Y15A 4FETA 2JRTA 3Q5FA 1TBXA 1F4KA 3HJEA 1WJBA 4EM1A 2TDXA 1XGMA 4Y3OA 2MLGA 3AL0B 1A6IA 1W7PD 4ZH4F 2WAFA 4QIWN 4D7MA 5IOZA 1I6HJ 3GLLA 4XM3A 2DMQA 2EJRA 1HDDC 2BGCA 4E70A 3GFLA 1MD0A 3MKZA 1SVMA 4E7LA 4E7ZA 1WQ2A 4C3IJ 2WA0A 1Z05A 2PFBA 3FXUA 1OCCH 3K1NA 2Y75A 3WTZA 4A69C 1TWAJ 3V7RA 2PX9A 1UZCA 4TV7A 3J7AO 1J2XA 3FHNA 4PUSA 1O3TA 4C2UA 1BJZA 1MSFC 4LFUA 2R7ZJ 5HODA 1OISA 3GTOJ 1ZHFA 1YJNI 2QVOA 3WODF 3I4PA 4Q47A 2ESNA 5DYMA 4GYGA 3JRFA 2EZKA 5JLXA 3G1OA 1LKXA 2XDVA 2CQ7A 5HVQC 1KA8A 4LD5A 3SDGA 1BI1A 1R23A 2K86A 1IN5A 2LYCA 3ML6A 4A0XA 4E6KG 4G94A 3JREA 3RI4A 2IRFG 5CVJA 2M5WA 2MA3A 3KP7A 4I98B 1YHQI 2VODA 3ZMSA 2W48A 1Z91A 2QQ8A 3IAM2 3M8FA 5FFZA 4BDYA 2DTRA 3FISA 3JRAA 2HQAA 1S7EA 1D0XA 3J7AY 1VQPI 3BR0A 4BQAA 3TW7A 1D5YA 1HF0A 1G3WA 1Y1WJ 2R7QA 3F8FA 1F1ZA 2A5WA 1ETYA 1K78B 3LL7A 3BTIA 3N05A 2MFZA 1YW9A 3S3NA 1TQMA 2VASA 5B5EC 2M8GX 3LSKA 2A61A 3P5JA 2P6TA 1BM9A 2MD0A 3KP2A 2VBZA 4L5IA 1G6NA 1RC9A 1I50J 2DFHA 4DJAA 3RYPA 3PO2J 2ME0A 1UG2A 4NBQA 3MQ0A 4JX4A 2GOMA 5GPCA 1UG0A 3ZGKA 3I5UA 2LH9A 4U0WA 5ED4A 3ABMH 1TLHB 2WAEA 2HOEA 3BG3A 1FLIA 2FE3A 1IRFA 2K27A 2PN6A 2WV1A 3S14J 5E79C 2MLKA 1WH7A 3I59A 3OV8A 1U9NA 3BG6A 1XGSA 3VB2A 2Z16A 1IDYA 4XSZF 3GZNB 3L00A 4OOIA 3Q3SA 4PJJA 2R7WA 3OS0A 3EPZA 3HSEA 3DBRB 3VYSB 5E17F 1Q1VA 3V7CA 4WCGA 1DPUA 1B8IB 1FZPB 2H1KA 3TEDA 2LRDA 3J81K 2HTJA 2VLAA 1B72A 2B63J 4HZFA 3GFIA 2JUCA 2LR8A 1VQOI 1ZREA 1TWFJ 5FGMA 3FKJA 2YPRA 1VQKI 2G0EA 3WTTC 1CF7A 3ECOA 3CD6I 1DGRM 3FXQA 1YW7A 4U88A 3L09A 2BVMA 4HF2A 4BU2A 2E5ZA 2X6OA 2H8WA 3ZXSA 3MKWB 1T39A 2QENA 5CVRA 1JKQC 3H3UA 2OCEA 3ZN0A 3CDIA 2B7EA 2CUZA 3VEPA 1X19A 1LFUP 1H9TA 2FX0A 1IAWA 4RAFA 2RV8A 1ZAOA 4QPQA 4ESBA 1R5ID 3E1SA 4RAGA 2L9NA 5LHIA 2CFXA 4F3QA 4Y33A 1MH3A 3HHHA 1I3QJ 5AIPA 4AIHA 3UNGC 1RESA 1SD6A 2R7SA 1MKMA 4UUVA 1C0WA 1SAUA 3AAFA 2V9KA 1DPRA 1AKHA 5D5WB 2JT1A 3HOTA 2DFEA 1S7AA 1KGSA 4KIBA 4LLLA 3JTHA 1T08B 5EGOB 3H35A 1FSEA 4MTDA 4M3FA 1OCPA 2XRLA 1ODDA 2V7FA 3KZIC 3U9GA 3ASOH 4I99C 4BXFA 5J8FA 4LG0B 1UB9A 4L9NA 4N9HA 1IRZA 1ULYA 1PUFB 4MFDA 3S1RJ 3SJMA 3VSKA 4AVZA 1ZR4A 2K85A 4G6QA 3ONQA 2IS2A 2R0QC 2BV6A 2QKLB 3S1MJ 1W5TA 3IHUA 2BXYA 4YELA 2MG4A 2DK8A 3M3YJ 5IP9J 3CQZJ 3Q0WA 2JA8J 1IW7F 4C9YA 3OSFA 3I56I 1WH5A 2QQAA 1YIJI 3WU0A 2VJJA 3ZOBA 2AHQA 4HNUA 1FYMA 2DQRA 3JTGA 3QU3A 1SFXA 3PNTA 4E7IA 5J1RA 3LAJA 2E1MB 1SD4A 2CQQA 2VXZA 5H6QA 2CV2A 2BW3A 4OAYA 3LSJA 1XS9A 4BY1J 2X51A 1A31A 3SZPA 4EJWA 4EJVA 3C3WA 3RKYA 1EV7A 3RPUD 3K70D 3WTYC 5M5YJ 2L9SA 3SEQA 4KITB 2YUSA 2M1BA 4XN3A 4BHBA 1IJWC 2ID3A 2HXIA 3S17J 1AA7A 1JKRC 1ZK8A 5ILVA 4IOAF 2OF7A 2AXLA 3WGIA 2E7WA 3PIPF 2O61A 3GBGA 4A0ZA 2J5PA 4RGXA 3CUQC 5FO5A 3GW2A 3RKXA 1W0UA 2HDDA 3MZHA 2DAOA 1P4XA 3BG9A 2KPMA 3BLYA 3H36A 1K4TA 5IT3A 5AONA 2R5ZB 4BQQA 1D8JA 4EGZA 3FM3A 3V8KA 1PP8F 1YW8A 2JQ7A 2VBWA 2XAUA 2UV1A 2EPFA 2OUMA 4NQWB 1LUJB 5IT9K 1JJ8C 5M5WJ 1HA8A 2PMZA 3NARA 2W85A 1NHAA 4MFEA 3HBLA 1S5LC 2OPTA 3K4BA 4RB3C 3I4NJ 2LG4A 2ECCA 2VI6A 1LEBA 2CV1A 1R00A 1TNSA 4RAZA 2L7MP 2VL8A 2F5EA 3IKVA 3A01A 2CG4A 4HQMA 2R7TA 3SZGA 3OR2C 4RDUA 2CQNA 1J75A 1FC3A 2STTA 3GTKJ 4M9XA 2DI3A 2XC7A 1J9IA 2H6BA 1W4MA 3CESA 2QBYA 1DDNA 1I3AA 3E6MA 4I76A 1E2XA 1W36C 1GV2A 2R7DA 5H2FC 3HDDA 2NVTJ 1X58A 3A4CA 2VBYA 3DBLB 3LWFA 2R3SA 3CCMI 1ZRCA 3CJSB 3K4LA 1YRNA 4ZTJA 1V5GA 2NYXA 4ENJA 2WBMA 3Q9SA 5FRNA 1OCRH 1EKEA 4BEHB 3OYHA 2ZKZA 4IHSA 2DPUA 3OR1C 1X1BA 5DV5A 4XLNF 2DQLA 2NS8A 4CUGA 4UNOA 2XUBA 4WX9A 2IT0A 3K4CA 2CW7A 2PMUA 1EA3A 3BDDA 4RLQA 5LLQA 1LB2A 3BWGA 1Z67A 4HX4A 1GXPA 3H5AA 3CLOA 2FEZA 1REPC 3W2VA 1N77A 1Z7UA 2P0WA 4II2A 1UAAA 4AC0A 3E0JB 3RIRA 3E5XA 1WSUA 2ZXIA 3EUAA 1IF1A 2X48A 5K1YA 4AWXB 2KKOA 2ZJ2A 2WB1A 2EWNA 2JUGA 2K9MA 3GF2A 1B9NA 4LK1F 3V7SA 2HTSA 3DKYA 2A68F 1RKWA 3ABLH 3RQIA 3OYCA 1BI3A 4ZYAA 1R4NB 4JX5A 5DDGA 4WXHA 3VPRA 4ZYHA 3F3XA 2L7FP 3MEXA 4V2GA 4B1RA 5K7HA 3FM5A 5HDNA 2CFOA 1I6XA 3FIWA 1WGXA 1NK3P 4RGRA 2L02A 4DOZA 1IUYA 2W00A 2LOOA 3KP4A 1JTYA 2DBBA 1LPQA 1K83J 1SVOA 3HEFA 2HWVA 1HSTA 4KN7X 4HF0A 1ZH5A 3DP7A 2GXAA 1V5EA 5JFRA 2DU9A 3R4KA 2OTLI 2KT0A 2FA5A 1ZN2A 4JBAA 2E1NA 2FNAA 2VQCA 3DXJF 3IWFA 3JRIA 4IHYA 2CU7A 1G3YA 1GDTA 1K6YA 2NS7A 2H94A 3ZQ7A 3BP8A 3JRCA 1HQCA 3BCBA 1R7JA 3WTWC 4AU7A 1ONVA 2ZJPF 4N9IA 1IDZA 1TP4A 2CMPA 2E2IJ 4CZCA 1FEXA 4YFXF 1E0EA 5ERIA 2O0YA 4LOCA 1WJEA 1RUOA 2XPVA 3T5XA 5HLIA 3R61A 2W84A 2B0LA 3SEZA 2ZSHB 2J5OA 3ZCOA 1PYVA 1SMTA 1R1VA 2DW4A 1P9QC 2COBA 3RCOA 1ETKA 2VB6A 3H5RA 3E3VA 2WTEA 3BZKA 3AG3H 3OOPA 3A01B 2PMHA 3CCEI 1ETQA 2PQ8A 2JSCA 1BI2A 3FMQA 2XSDC 4CCLA 1OQYA 2X6XA 2DCEA 2KIUA 4A0YA 4IRHA 3ZQFA 1BC8C 3F6OA 3BPXA 3H9JA 5KVRA 5FLXK 1U5TA 2FBIA 2MC3A 4U87A 3M1EA 4D5CA 2CYYA 3AKZA 1YRNB 4BJ5C 3ZMTA 1GUUA 4ABZA 4PDKA 3HKZN 3KYCB 1BA5A 5LRRA 1MDMB 4EV0A 3BTLA 4E4HA 2NXNB 3K10A 2PLYA 3TW6A 4NNJA 5E1XA 3WU1B 1RRJA 3ZR8X 3GTJJ 2EIKH 5ICCA 2MBFA 4HYEA 1YIOA 3G2BA 4M3GA 3U1KA 1VQLI 2V9VA 3GTGJ 2ELJA 1XSVA 4O6JA 3EGVB 1MMDA 2JPBA 2Z33A 1H9GA 4EM2A 3KP3A 2KJBA 3H1CA 3S2WA 3R60A 2Y9ZA 1I27A 1U9OA 4XKBA 5J1UA 4XQFA 3BR3A 4BHPA 3DBHB 2QUFA 3TO9A 4N0BA 1GV5A 4FHTA 2RVCA 2WV0A 4C2TA 3D0SA 4AYBN 2HPIA 2IPQX 5KAIC 4HX7A 1VQ6I 1S3JA 4HPQA 3OYAA 3V42A 3ERED 3L7WA 2E71A 4MO7A 2VT3A 3G71I 3BR2A 5CLSA 4UHTA 1UHMA 2K4JA 3V8JA 3WU2C 2VPLA 3X2QH 4O3MA 5CJ9A 2YSRA 4RGSA 2ZMEC 4RBOA 1DU0A 2JN6A 1LFPA 5IYBJ 1YO5C 2CW8A 2XAJA 3BJ6A 4UUSA 3JAMK 4B43A 1OMIA 4A3DJ 2IA1A 2V1UA 4XRFA 2LLKA 5C3EJ 2D45A 1D1AA 4IXAA 4M74A 4R79A 1JUSA 2H6CA 1F43A 2EBIA 4PJ0C 1FIAA 1FY7A 2UXNA 3LSHA 3JCUC 2F5FA 2ZNYA 5H20A 3I0TA 2H09A 1R22A 4D0PA 5IYDJ 4E7SA 2O3FA 4C3JJ 2BY0A 1O7LA 2E35A 1SVLA 4BL0B 5L3FA 4A5NA 3EUHA 3MKYB 2Y30A 2IGOA 3DPTA 5DEQA 4XLCA 1BIAA 2LDUA 3TP3A 1X1CA 2EZLA 1BIBA 2XSJC 3FK7A 2HNHA 3OY9A 3S1QJ 2ZBKA 3BCAA 1TW2A 1MIJA 1I39A 3FKIJ 3SYTA 4DNCA 3RSNA 1OPCA 4LLGF 2RGVA 3EUHC 2TRTA 4ZDOA 4WK8F 2Z99A 2TCTA 4FT8A 1T56A 1QZYA 2E34A 3BTJA 1LFBA 2VN2A 3RDIA 1WIBA 2DT5A 4CA0A 1W36D 4BHCA 4F7ZA 1E3OC 4OIQF 2YU9J 5K5OA 5A2QZ 2UXXA 2DMTA 3KFWX 3DQVC 5D6EA 3T8RA 3S15J 5M3MJ 2IGKA 3PM1A 5FKNA 3B02A 1O3QA 2XF7A 4OMZA 4HBLA 4EJOA 4BJTA 4UVAA 3LFUA 1P2FA 3FWEA 3R6SA 2OAZA 3L1PA 2CUEA 4NC6A 1T95A 2E19A 1MMGA 5BMZA 1MBHA 3EQLF 2KMUA 3LFKA 3N4MA 1CF7B 2YX7A 4LB6B 1G3TA 4YFNF 5FROA 2ID6A 2MH9A 5CQEA 2M2EA 2DT6A 1A36A 2HQ5A 1W5SA 1Z9CA 2LY9A 2UUZA 1X2NA 5CYVA 4ZYGA 2F4OB 1WRJA 3KIOA 3WE2A 5DCMB 1G59A 2BXZA 3K1PA 3HHGA 3CO6C 3WGHA 3GXOA 1IGNA 4L0ZB 3ZQCA 4XORA 4OIRF 2E1CA 1QQIA 1YYVA 2DA6A 5DUIA 4I2OA 1FTTA 3MFKA 4Z6YA 1MBJA 3FHZA 4A12A 2HYGD 2KIQA 1IRXA 3E7LA 1M1EB 5J1YA 4P55A 3F72A 3S8PA 4OU0A 3D5SC 1ZYRF 3RPUA 4HLYA 1JT6A 3PFIA 1XMAA 1AOYA 3K4KA 4ENNA 3CMMA 2E7XA 4Q48A 2HZDA 2CUJA 4E7JA 2AXTC 1XCVA 2KL4A 1XSXA 3GWZA 2ZMEB 5E20A 3FMSA 1YJ9I 2EH3A 1WJAA 1UJ8A 4Y4RA 2QZ8A 1Z6RA 3HM5A 5CVIA 2X6WA 5J6XA 5HNHA 4OIPF 3HRMA 2CWEA 5EEGA 2VE9A 2BZTA 2V1NA 1L0OC 4M3DA 1Y39A 3FMRA 1HW2A 1V4RA 1I5ZA 1XMKA 3FXKA 2HVQA 4A3CJ 4YIFA 2FQ4A 4XRSA 1KU3A 3OS1A 2LREA 1AHDP 5FD5A 4IX7A 1O3RA 3T8TA 3PUBA 2FMLA 1ZG3A 4BQOA 3HRUA 3A02A 3LSTA 2BE5F 1Z0XA 4A6DA 4G8XA 4LB5A 2D2WA 3BPVA 1ZARA 1D8KA 2QSGX 2XV4S 4LIVA 1U2WA 4IRIA 3JRGA 3LOCA 3EDPA 1YS7A 5HS9A 5BQTA 4A3JJ 1ZG5A 1A04A 3F23A 1X4PA 1MSEC 5DD4A 4AIJA 3QU6A 3CDHA 2O03A 1JJ6C 1USTA 4U7BA 1X1PA 1H0MA 2MSYA 4XONA 1MMAA 1A5JA 1XD7A 1MBGA 2XF6A 4DGWB 4F93B 4P9UA 4C3HJ 4UVBA 1JTXA 3DTIA 3E6DA 4MEYF 2FBHA 4M6XA 3KPHA 1FPQA 2L9RA 4XLPF 3QOEA 1JUPA 3REOA 2DA4A 2FQ3A 3HYIA 1BL0A 1U5TC 2LSOA 1YX3A 2K9QA 3OYIA 4BAYA 1RETA 2R5YB 3CC7I 3LA2A 1A6QA 4CCNA 1GHCA 2ZO4A 3HSRA 3K2AA 3FF5A 4EEFG 2VONA 3U21A 1FT9A 1LE8A 1Z6TA 1TWGJ 2W24A 3BZCA 1O4XA 2OA4A 3W6JB 2WAQA 3QPTA 4RGUA 2VPRA 3GZ6A 2M8EA 2VT2A 1G3SA 2HDCA
chains in the Genus database with same CATH topology
2K3FA 1HC8A 2QA4I 3G71I 4IOCF 3CD6I 4UY8I 3CJQB 5GAGJ 2E36A 2H8WA 3I55I 2OTLI 3CCJI 1YJNI 2JQ7A 1VQ8I 5DM6F 5GAHJ 3G6EI 3CCQI 1VQ4I 2ZJPF 3CMAI 1YJ9I 1YHQI 2E35A 5GAEJ 1Y39A 3CCUI 1VQ7I 5DM7F 1VQPI 1S72I 1FOYA 3DLLF 3PIOF 3CCMI 3CJSB 3CCEI 3CC4I 2ZJRF 1VQNI 3CJRB 3CMEI 2E34A 3G4SI 1WIBA 3CJTB 3I56I 3CCRI 3CF5F 1YIJI 2OTJI 4IO9F 1YJWI 3CCVI 1YITI 2QEXI 1VQ5I 1QA6A 2NXNB 5GADJ 1VQLI 1ACIA 2ZJQF 1MMSA 1FOWA 3CCSI 1VQ9I 3EGVB 4V19K 2FOWA 3CC2I 5JVGF 3CC7I 1FOXA 4IOAF 1VQMI 3J7YJ 1YI2I 3PIPF 3CCLI 1VQ6I 3J7ZI 1VQOI 1VQKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3F A;  1HC8 A;  2QA4 I;  3G71 I;  4IOC F;  3CD6 I;  4UY8 I;  3CJQ B;  5GAG J;  2E36 A;  2H8W A;  3I55 I;  2OTL I;  3CCJ I;  1YJN I;  2JQ7 A;  1VQ8 I;  5DM6 F;  5GAH J;  3G6E I;  3CCQ I;  1VQ4 I;  2ZJP F;  3CMA I;  1YJ9 I;  1YHQ I;  2E35 A;  5GAE J;  1Y39 A;  3CCU I;  1VQ7 I;  5DM7 F;  1VQP I;  1S72 I;  1FOY A;  3DLL F;  3PIO F;  3CCM I;  3CJS B;  3CCE I;  3CC4 I;  2ZJR F;  1VQN I;  3CJR B;  3CME I;  2E34 A;  3G4S I;  1WIB A;  3CJT B;  3I56 I;  3CCR I;  3CF5 F;  1YIJ I;  2OTJ I;  4IO9 F;  1YJW I;  3CCV I;  1YIT I;  2QEX I;  1VQ5 I;  1QA6 A;  2NXN B;  5GAD J;  1VQL I;  1ACI A;  2ZJQ F;  1MMS A;  1FOW A;  3CCS I;  1VQ9 I;  3EGV B;  4V19 K;  2FOW A;  3CC2 I;  5JVG F;  3CC7 I;  1FOX A;  4IOA F;  1VQM I;  3J7Y J;  1YI2 I;  3PIP F;  3CCL I;  1VQ6 I;  3J7Z I;  1VQO I;  1VQK I; 
#chains in the Genus database with same CATH topology
 1BJA A;  2QA4 I;  2KZV A;  1XN7 A;  1TZL A;  3KP6 A;  1XGO A;  2HDW A;  1PUE E;  1FX7 A;  2WWY A;  1KQ0 A;  1ZRF A;  4KMU X;  2ADU A;  5LHH A;  2RAE A;  4I6Z A;  1QVT A;  1XTA A;  5L3E A;  2QBY B;  2W4S A;  2Y0S A;  4UV8 A;  5ILU A;  2RNG A;  5E3M A;  3QWL A;  2R4G A;  4HEA 2;  5JR3 A;  3QPL A;  2ECB A;  3WHB A;  5TRD A;  3HOY J;  1JT0 A;  4JP0 A;  4ZTF A;  4BQN A;  2DOF A;  3GTP J;  3G6E I;  4ENM A;  4XOP A;  1S8N A;  3NWT A;  3VFZ A;  3OYL A;  3VYR B;  2R93 J;  2IVM A;  3DEE A;  1VQ4 I;  2L0K A;  4IF4 A;  1N75 A;  2Y9Y A;  4PSX A;  4J19 A;  2K5C A;  1XGN A;  3HZJ A;  4M9Z A;  5J4Y A;  1YFH A;  2EFP A;  3IUO A;  3ZMV A;  2R92 J;  4IVN A;  3FZV A;  5FLV A;  4D1Q A;  2DO7 A;  3CP8 A;  4GXO A;  5GP9 A;  1PDN C;  4PJM A;  1HOM A;  3BR5 A;  2M7B A;  2WY8 Q;  5EGO A;  4AID A;  2VKE A;  4FAS D;  3DEW A;  3HPG A;  2CQX A;  1FSH A;  3HGG A;  1U0J A;  1KYW A;  1POG A;  3CC4 I;  3HOU J;  2ZJR F;  1NK2 P;  1IZ1 A;  4BUP A;  2Q8K A;  4E7H A;  3K4J A;  5E1Z B;  3MZY A;  3S3O A;  4ASN A;  2CO5 A;  2E2J J;  2NVU B;  1R1U A;  4IEJ A;  3OS2 A;  1RZ4 A;  4A3G J;  2OQR A;  3BOQ A;  1A35 A;  2HOS A;  2YU3 A;  3E5U A;  1TT5 B;  4RB0 A;  1WI3 A;  1VQ5 I;  1KYZ A;  1WJC A;  1Z1D A;  1U8B A;  1QA6 A;  2HVR A;  3Q0V A;  1IN4 A;  4AUX A;  3RYR A;  4EAT A;  3I71 A;  4IKF A;  2IEK A;  5GAD J;  2EV0 A;  2HOA A;  2IA0 A;  1Y1V J;  2I8D A;  2KLO A;  2VC1 A;  3S93 A;  4PK4 A;  2KIS A;  1OR7 A;  3V8L A;  1BR1 A;  4HOB A;  4G7O F;  3FDY A;  4ZDL A;  3CUQ A;  2EIN H;  3W2W A;  4PFP A;  2V26 A;  4OAZ A;  4FIS A;  1B6A A;  4XSX F;  2XGE A;  3IKT A;  4N4O B;  4CIC A;  1Y8R B;  5EJC A;  5FB2 A;  3J80 K;  3AG1 H;  1EH6 A;  3GUD A;  5H6R A;  1MJB A;  1VQM I;  2ZCW A;  1S29 A;  5LEK A;  4M3E A;  2EFQ A;  2KIF A;  1GVJ A;  3HUG A;  5FLX Z;  3J7Z I;  1ZRD A;  2K3F A;  3JRD A;  2LKX A;  3TGN A;  2XRN A;  1JKP C;  1DU6 A;  2VC0 A;  3E6B A;  1IN7 A;  4CZZ A;  3OYB A;  3I53 A;  4JX6 A;  4RB2 C;  1XDU A;  3TOB A;  5HOO A;  4CYC B;  2XAG A;  4MTE A;  4XR6 A;  2QYO A;  4PJN A;  5K7F A;  2BHY A;  1QRY A;  4UB6 C;  2OD5 A;  3TMO A;  2GLO A;  2V79 A;  4ENK A;  6PAX A;  2XKO A;  3FXL A;  5B66 C;  4DBQ A;  2V9P A;  1W0T A;  4WXC A;  3ABK H;  4QTR A;  3KX2 A;  3BZ6 A;  3LSG A;  2KHM A;  1D1B A;  2RN7 A;  5HLG A;  4P1W A;  2DOE A;  3CCU I;  3VDX A;  4HRI A;  4LIT A;  2EV5 A;  1HSJ A;  1XB4 A;  3IP4 B;  4I09 A;  2ZXH A;  4M9S A;  1MDM A;  3PIO F;  4WWC A;  2VQH A;  1LEA A;  4E7K A;  2O9L A;  1X3W B;  3H0D A;  2BBY A;  5CKT A;  2HGC A;  2LNB A;  1K7A A;  2L2O A;  4CDG A;  1JHF A;  1TW3 A;  1YOV B;  3ZMU A;  2DA1 A;  3QYF A;  3HSF A;  1O3S A;  1R6R A;  3H3Z A;  3ABT A;  1DUX C;  1FP1 D;  3GZ5 A;  3GX4 X;  4EVI A;  1ON1 A;  1D0Y A;  1X1A A;  3SZT A;  1ENH A;  1WFX A;  2Z9O A;  1T2K A;  2JK3 A;  3FX3 A;  3D1N I;  3TOA A;  2M9H A;  3PQJ A;  4H0E A;  1OCO H;  4UB8 C;  4CGZ A;  2QLZ A;  2M0M A;  2CS3 A;  3S16 J;  4IZZ A;  3WG7 H;  4UV9 A;  4IHX A;  4IHW A;  5FKM A;  4ANJ A;  3OMY A;  1OKR A;  2NOG A;  5JLW A;  3K4M A;  1Z7L A;  3KZZ A;  1D0Z A;  2LBF A;  2X1E A;  3N97 A;  3C1D A;  3P7N A;  4FE7 A;  2BEO A;  4GCV A;  2VJ5 A;  4UVC A;  4P96 A;  3EUK L;  4N4N B;  2BYV E;  4LIU A;  1LNW A;  3K70 C;  4J00 A;  4A6E A;  5E1W A;  3ZPL A;  2HI3 A;  2M0C A;  4IHT A;  1I1G A;  2P5K A;  2L7K A;  5KCM A;  2O7O A;  3DPU A;  4G6D A;  3W6K B;  3KP5 A;  1YG2 A;  1LVK A;  4AYB A;  1YQA A;  2KRC A;  1IN8 A;  2ZNZ A;  5J40 A;  3CO7 C;  2MH2 A;  1KZH A;  2ACJ A;  4M71 A;  3S1N J;  2AQF A;  2H1L A;  3LSI A;  3QYE A;  4IOC F;  2F2E A;  3CJQ B;  4PGH A;  1TC3 C;  3LSM A;  2E36 A;  1K61 A;  2P5L C;  1SEU A;  1ZGW A;  4B3X A;  2JVH A;  4HAM A;  2GQQ A;  4G6T B;  5BS6 A;  1VND A;  2A6H F;  3HXL A;  3MN2 A;  3LMM A;  1D3Y A;  3IV5 A;  3OSG A;  4M6Y A;  5JVT A;  3OYN A;  2DN0 A;  3OYK A;  4EJU A;  2AO9 A;  2NVQ J;  5EZH A;  1G8X A;  3GVA A;  3K1M A;  4LK0 F;  4G7Z F;  2FBK A;  2VXD A;  4W1U A;  2RC4 A;  2KDZ A;  2XPW A;  3DV8 A;  4Q4Z F;  1TT0 A;  1JHH A;  4ON0 A;  3A03 A;  2MGQ A;  5F1R A;  3M9A A;  3ZQH A;  4Y17 A;  5GAE J;  1WKM A;  5LGT A;  1FYL A;  3MMY B;  1VQ7 I;  2GXG A;  5LFA A;  3PSF A;  5EZG A;  5F64 A;  3CP2 A;  4OIO F;  2PBI A;  1UHS A;  1CQT A;  5FKL A;  2BVL A;  3ELK A;  3NQO A;  5LHG A;  1RR8 C;  1Y8Q B;  2D1V A;  3L9F A;  2MW8 A;  3PJR A;  2X4H A;  2VQL A;  1WPK A;  4WXD A;  2HYJ A;  1RUN A;  1JI8 A;  2MAB A;  4BXU A;  1IRG A;  3CJT B;  3SFZ A;  4F52 A;  2M3A A;  3QAH A;  5D4R A;  1HLV A;  4BEH A;  2COM A;  2CW0 F;  4O5V A;  4PZJ A;  1IXS B;  4JK1 X;  3OYF A;  1OYI A;  4B4C A;  4KYW A;  1YJW I;  1FOK A;  5HLT A;  5DCM A;  4CXF A;  4FTH A;  3Q0U A;  2XKP A;  4MHG A;  4HST A;  3WTV C;  2LD5 A;  2ICW G;  4XLH A;  5AIQ A;  4HNV A;  2JA7 J;  1VI0 A;  2HU9 A;  1D5V A;  2X1C A;  2CGP A;  1ACI A;  4EQQ A;  1IV6 A;  5GTH C;  4S0H B;  3CCY A;  3CCS I;  3IH2 A;  2A69 F;  1OYY A;  2F5V A;  3F9K A;  1YLF A;  2E5N A;  2FD5 A;  4CO8 A;  2VBX A;  5JVG F;  1XSD A;  2OC6 A;  3W6V A;  3H0G J;  3BY6 A;  3KEQ A;  3LNQ A;  1HW5 A;  4XK4 A;  2FXA A;  2CV0 A;  1TQI A;  5F1J A;  2L7Z A;  2QSF X;  1VFC A;  4A5M A;  3DPL C;  1WJF A;  5E18 F;  1APL C;  3FXR A;  1QPM A;  2X6Y A;  3RZO J;  2Y48 A;  4BAC A;  3WTX C;  2DLL A;  1GXQ A;  4WF2 A;  1PP7 U;  4BYY A;  5ICG A;  2L3D A;  4LLN A;  2VJ4 A;  4CCJ A;  5DS9 A;  2RQP A;  2XGX A;  3ESW B;  3GFJ A;  1DGW Y;  2IXS A;  2Y31 A;  3A2K A;  1ETV A;  3PNV A;  1L3L A;  3WE3 A;  2GWR A;  2IGN A;  1J0R A;  4UUS B;  3TDU C;  1G4D A;  4GRI A;  1JGG A;  4BNC A;  5GAH J;  3QRF F;  3D5L A;  3ISP A;  2M4K A;  5FD6 A;  2P6S A;  4HX8 A;  2FSW A;  2LVS A;  3GFM A;  3CZ6 A;  1R49 A;  4L18 B;  1R58 A;  2IAI A;  4MIM A;  4XKV A;  3ZQQ A;  2ZXW H;  1O57 A;  2F4I A;  2R7V A;  2ZC2 A;  2PJR B;  3MCZ A;  4IL6 C;  2JMW A;  3OOU A;  5M3F J;  3G73 A;  2Z2S B;  5E3O A;  4XIC A;  2A6E F;  1BW6 A;  3O3K A;  3F8C A;  3C18 A;  1MNE A;  2RKH A;  2JA6 J;  4JQF A;  1E3P A;  4IRG A;  2L5Q A;  5BPI A;  1VF9 A;  4M6V A;  1J09 A;  1SFK A;  4OMY A;  5TGT A;  3IL2 A;  2XAF A;  4CYD A;  2HKO A;  2VOO A;  3JAM Z;  1BN5 A;  2VKV A;  2LMD A;  1ZQ3 P;  2DMU A;  2P7V B;  2RRE A;  3T1B A;  4ZC3 A;  4L5E A;  4RAY A;  2W7N A;  4DZJ A;  2R5Y A;  1R9T J;  5D5V B;  4BE0 A;  4RB1 A;  4J01 A;  4BE2 A;  4BKX A;  2F6C A;  2EIJ H;  1S7O A;  2JA2 A;  3DF8 A;  5IY5 H;  2I5U A;  2IBD A;  2IP2 A;  2QCO A;  2CH0 A;  4DZP A;  2RQQ A;  3MZ8 A;  1NG7 A;  1WHU A;  3ZQG A;  1H89 C;  1IUF A;  2NAZ A;  1QPI A;  4KIG A;  1HW1 A;  3C2G A;  2KJC A;  2H8R A;  2V4J C;  4XRM A;  4Q5S F;  1DQU A;  1IXR C;  4HV5 A;  3MD2 A;  3TO6 A;  2JPC A;  5EEH A;  4A2U A;  5J4V A;  3K0L A;  4BJ6 C;  1TWC J;  3LA3 A;  5B3S H;  5D8K B;  3QQA A;  4B3A A;  2W57 A;  3B6A A;  3IRQ A;  3RKW A;  1H8A C;  4GGG A;  5JI6 A;  4V2F A;  3LSP A;  4XNF A;  4P9F A;  3J7Y J;  3TL4 X;  2GAU A;  4ITV A;  2WAQ N;  4FX0 A;  1U3E M;  2M7A A;  3JSO A;  1MJ9 A;  1HC8 A;  3KLN A;  1T0F A;  1WI9 A;  1MGT A;  2CUF A;  2XAH A;  2C6Y A;  2K9S A;  3BQY A;  3BJO A;  1TQP A;  4KDP A;  3K4N A;  1SAN A;  1PVE A;  2IGM A;  2IS6 A;  1T38 A;  2LK2 A;  1HKT A;  3PL8 A;  3K7A J;  4HSR A;  1VQ8 I;  2GA2 A;  1LDJ A;  1YTY A;  4ZZD A;  2ESH A;  1GT0 C;  3RTR A;  1YS6 A;  3L2V A;  2IW5 A;  4ESJ A;  2GXB A;  2DT7 B;  2MD5 A;  4GFB A;  3DKW A;  3DLA A;  1K4S A;  5F0C A;  3DWL E;  2STW A;  4DIQ A;  3ZQL A;  5K7Z A;  1WZ2 A;  2DDA A;  4F91 B;  2FJ1 A;  5EYR A;  4XLA A;  1W1W E;  3RQ4 A;  2EA4 A;  2X1D A;  3LA7 A;  4I0A A;  2XRO A;  3QOD A;  5E8G A;  1QU3 A;  5HDK A;  4HG2 A;  1J5Y A;  3DTE A;  2Q2E B;  2LF8 A;  1J59 A;  2MYS A;  1TL8 A;  2W1O A;  3BR1 A;  4EGY A;  3E97 A;  2JVG A;  3CJR B;  1F36 A;  3F8N A;  4AM3 A;  2HZT A;  3G1L A;  2HEO A;  1ZTR A;  3CUQ B;  5CPR B;  5F04 A;  3E6C C;  1IN6 A;  1MZB A;  4HW0 A;  1WWX A;  1LJ9 A;  2KFD A;  4XBF A;  5ILS A;  5L3G A;  5FKO A;  5LGN A;  1W5C C;  4YG2 F;  1DP3 A;  3S2D J;  3QP5 A;  2WY7 Q;  2BHZ A;  1YIT I;  1RIO H;  1T33 A;  4LG3 A;  3PNY A;  4B8X A;  4F92 B;  2NRA C;  3V4G A;  3MAJ A;  1LDK B;  3OIP A;  3RZD J;  4Z2Y A;  1KQ8 A;  3I4M J;  4KJZ A;  1E17 A;  4RA2 A;  4YII A;  3QPH A;  2ELH A;  1STZ A;  1RI7 A;  4L9T A;  1SFE A;  2FOW A;  2K02 A;  5IP7 J;  2V6E A;  1FP2 A;  3HOX J;  3K69 A;  3F8M A;  2YR2 A;  3LQQ A;  4G9Y A;  5DTD A;  5HS8 A;  2NS0 A;  4XMY A;  5C4X J;  2DTZ A;  1ZG1 A;  1EJ9 A;  5FRM A;  4CCK A;  1NH3 A;  3RKQ A;  2Z3Y A;  4AIK A;  3U1D A;  1I1S A;  3QPS A;  3U2R A;  2EK5 A;  3KYD B;  4DYQ A;  1RNL A;  1SD5 A;  2ZB9 A;  2JRM A;  5D5U B;  5B1B H;  2G7U A;  4FCY A;  2IS1 A;  3NWS A;  2EZH A;  5GAG J;  2OJE D;  4YFK F;  2EZI A;  3L2W A;  1Q1H A;  3I55 I;  3AFH A;  2LY2 A;  2ETH A;  4R1H A;  2G7H A;  3LQR A;  4H4K C;  3PSI A;  3WGG A;  3BRO A;  4A3F J;  4I02 A;  4U7D A;  4BGD A;  1SFU A;  3TKY A;  3CCQ I;  1K6O A;  2O8X A;  4QPO A;  4ZDP A;  4D9J A;  4QWQ A;  1ITY A;  5C44 J;  2EB7 A;  2O6G E;  3KE2 A;  3TBI A;  1HKS A;  3O8H A;  1Y6I A;  2DMN A;  2ZME A;  3T0Y A;  3CUO A;  2QGU A;  2Y0S N;  3W2A A;  1Z21 A;  4CSW A;  5GTI C;  1FNN A;  2HYF A;  2DYS H;  1X3Z B;  2I10 A;  4ESF A;  3BTC A;  4CHU A;  4CH7 A;  4D5F A;  3KCC A;  3DLL F;  2PMZ N;  2F4M B;  1G2H A;  2LKP A;  3D5R C;  4QSH A;  5FJ8 J;  3DU5 A;  4A3M J;  2CRG A;  3H5N A;  2FOK A;  4BS9 A;  4CCM A;  5LRS A;  3ASN H;  3KEY A;  1VQN I;  2XAQ A;  3G4S I;  5D6F A;  1VZ0 A;  4KNY A;  2DA3 A;  3DKX A;  2ISY A;  1MBF A;  2Y2Z A;  3CCR I;  2ZFW A;  2KZG A;  3L2Q A;  4IJA A;  3M7G A;  2HFH A;  3FBI B;  4IO9 F;  1NG6 A;  3H92 A;  5J8C A;  4KA4 A;  5GPA A;  1F5T A;  2XGD A;  1Y0N A;  1FIP A;  2R7F A;  1EH7 A;  3ZP5 A;  3JSP A;  1V54 H;  5FKK A;  1MBK A;  4S05 A;  3TDZ C;  4XLE A;  2VJI A;  2IA2 A;  4OIN F;  4NB5 A;  4EM0 B;  4X1E A;  1KU9 A;  1WJD A;  1FOW A;  2L4A A;  5J3L A;  3IRR A;  2V1D A;  1UFM A;  3C7J A;  3IH3 A;  2DXI A;  1P4W A;  2OV7 A;  5LBQ A;  3HPH A;  1P7J A;  3ZQI A;  2A07 F;  2FU4 A;  1V5F A;  2E2H J;  1FOX A;  1JGS A;  2XAS A;  2F5D A;  4L9V A;  2Q0O A;  2LP0 A;  1B72 B;  5A2Q K;  4B47 A;  3EYI A;  3ERM A;  3C2B A;  5DUK A;  3L2C A;  1P7I A;  3QYB A;  3G1M A;  2K40 A;  2HR3 A;  3RPQ A;  1SC7 A;  5IP6 A;  3WTS C;  2QM3 A;  3VWB A;  2OBP A;  1RR7 A;  3JRH A;  3GME A;  3HUG B;  3HOV J;  5F27 A;  3FK6 A;  2VIX A;  4R8H A;  1LE8 B;  3GCM A;  3BC8 A;  4U0V A;  2VOP A;  2JA5 J;  4IQ4 A;  3F21 A;  4RMN A;  3GTL J;  1WVR A;  1HCR A;  1ETO A;  1QBJ A;  2P4W A;  3GEZ A;  3LAP A;  1ZLJ A;  3NRV A;  3F22 A;  1VTN C;  4G12 A;  2VE8 A;  3BT9 A;  3GTQ J;  5KAF C;  4CYC A;  1KU7 A;  4HDV A;  1MNM C;  1ZEL A;  1XDS A;  4HA8 A;  2R7R A;  4IHV A;  3IWZ A;  2P81 A;  3CMY A;  2LTP A;  4KUM A;  1GLN A;  3A0B C;  4UXN A;  1P92 A;  1V55 H;  4LJZ F;  1XC5 A;  3O2P E;  2ME6 A;  1XPX A;  3QOP A;  4MNU A;  4ZYE A;  1USS A;  2P5V A;  3PFY A;  5E8I A;  2Y0M A;  3I58 A;  4K2E A;  3HKZ A;  3IH4 A;  2CJJ A;  3HB9 A;  2WAD A;  1SMY F;  3OWT A;  3M1C A;  2GA1 A;  1BOB A;  4UUT A;  5IOY A;  1R5G A;  2X85 A;  2AQE A;  2Z1D A;  4XRS G;  1X1D A;  2OQG A;  2DA2 A;  3HRS A;  5K5Q A;  2ZFU A;  1ON2 A;  3H9Q A;  2R7O A;  3M8J A;  3Q9V A;  1V3F A;  1UEL B;  4KIS A;  2PEX A;  1W7P B;  2M4G A;  5CVV A;  2ZXJ A;  5TJJ A;  3O6B B;  3IAS 2;  5IYC J;  5JHF A;  5E3L A;  3NAU A;  3CLQ A;  3M4O J;  3PQK A;  2EFO A;  4ETS A;  1HKQ A;  3HOW J;  1Z3X A;  2WC2 A;  1JXS A;  2V6C A;  2LC2 A;  2D5V A;  2OTJ I;  1MJA A;  1R5H A;  3GYH X;  4DQ2 A;  1X4O A;  2K3P A;  3AG2 H;  2BW3 B;  2HQN A;  4L9J A;  3F0C A;  3G3Z A;  1B59 A;  2KQR A;  3OYG A;  2A5Y B;  2E1O A;  1K78 A;  1UMQ A;  5EF6 A;  1Z3Y A;  3WHC A;  5BOX A;  1FBU A;  2A05 A;  5LGU A;  3S3M A;  2RDP A;  2LBF B;  1FWZ A;  5K5R A;  3ZMD A;  3ZN1 A;  3DEU A;  1JE8 A;  1FYK A;  2FF4 A;  1T98 A;  3EYY A;  2GBY A;  1UHW A;  2R7X A;  5M5X J;  2KIM A;  9ANT A;  1DP7 P;  2RNJ A;  1RPW A;  3C2H A;  1OCT C;  5HLH A;  4X0G A;  4KN4 X;  4IQJ A;  3HOS A;  1XMX A;  2VKH A;  1QGP A;  1BBY A;  2EIM H;  1BR4 A;  1ZGA A;  2NVY J;  3KET A;  2XIG A;  1MND A;  4EMS A;  4ZZL A;  2DFI A;  3I59 B;  3CCV I;  1U6G A;  5DM6 F;  3I9V 2;  2OCC H;  3F6V A;  3HRT A;  2MC4 A;  3WTU C;  2DMP A;  4JYK A;  4U0Y A;  3GLX A;  1NTC A;  4UY8 I;  1YE9 A;  5KK1 A;  4I01 A;  3P9C A;  4X6A J;  2XVC A;  1R4M B;  5F6F A;  2FUG 2;  3SXY A;  2NNN A;  4CCO A;  3CCJ I;  2ELK A;  1FBQ A;  2JJ7 A;  4B48 A;  3I54 A;  4EJT A;  2Q1Z B;  2OU2 A;  1JKO C;  4NUB A;  1LQ1 A;  3SDB A;  3L2U A;  2XF5 A;  3KYL A;  3K2Z A;  1SFO J;  1FMV A;  5CQG A;  2LKS A;  3J80 Z;  3OYM A;  3CMA I;  3I3L A;  1IC8 A;  3TO7 A;  3QP6 A;  4M72 A;  1OJL A;  4RM3 A;  3SQN A;  3MVP A;  2QKM B;  1TWH J;  1MH4 A;  1X2M A;  1O7F A;  2XHK A;  4LMY A;  4II3 A;  4PFO A;  2HKX A;  4PGG A;  4NC8 A;  1KON A;  4AD9 A;  3JR9 A;  2GM4 A;  2QSH X;  2DJN A;  4A3K J;  1S72 I;  4BXX J;  2M87 A;  2OZU A;  3VYU B;  3CF2 A;  5J47 A;  2R7U A;  3BJA A;  3P9I A;  1ORK A;  3TP0 A;  2VQG A;  1X3U A;  1CGP A;  1MBE A;  2JSP A;  3BG7 A;  4HLX A;  1U5T B;  3BG5 A;  3DFG A;  1BI0 A;  2EIL H;  3SFI A;  1QHH D;  1BOA A;  2BY3 A;  5JHU A;  4C30 A;  3CME I;  3UKG A;  1AWC A;  1EH8 A;  2XB0 X;  2E60 A;  2L4M A;  1H88 C;  1AKH B;  4RS8 A;  4IPA A;  2GIV A;  2K4B A;  3B73 A;  3K6G A;  4M3B A;  5KNL A;  1AU7 A;  3HL2 A;  2JZY A;  2X9D A;  5FFX A;  3H9G A;  3ULQ B;  1OLT A;  2FMY A;  1W7P A;  2IS4 A;  2GIZ A;  4ZJZ A;  5BNG A;  4GYI A;  1IXC A;  1OCZ H;  3B6C A;  4LG0 A;  2EFW A;  1FJL A;  3HTU A;  2FRH A;  4Y52 J;  1PUF A;  1P4A A;  1U8R A;  2W82 A;  4NHJ A;  5EG0 B;  2B9S A;  1QZE A;  3LSR A;  2GZW A;  5L3C A;  1VQ9 I;  3VOD A;  2BOL A;  4F55 A;  4YIR X;  3OYJ A;  2L54 A;  2IJL A;  2PI0 A;  5L3B A;  2YX4 A;  4JOM A;  5E3N A;  2AS5 F;  2DK5 A;  3KZY A;  3FXJ A;  4FE4 A;  2HPM A;  1TTY A;  2DOD A;  1T8I A;  2D1H A;  2X0L A;  2EQR A;  5FLM J;  3PO3 J;  3ZRG A;  4S04 A;  5DD8 A;  1MMN A;  5D8L B;  4KIC A;  3BQZ A;  2XB5 A;  4RLF A;  2DDB A;  4KT6 A;  2LF7 A;  4MGR A;  2Z5U A;  3MWM A;  4L5J A;  2XGC A;  2UWM A;  1B4A A;  4YRV A;  3FXO A;  5D4S A;  3F8B A;  2L9V A;  2M34 A;  2P8T A;  2JWT A;  2QF7 A;  2FNP A;  3BR6 A;  4A3L J;  1XX5 A;  2P7C B;  5B1A H;  1P6R A;  1QO0 D;  3HTS B;  2DJI A;  2QQ9 A;  3FXM A;  4GDF A;  4KIF A;  2O5R A;  2WB1 N;  4HV6 A;  5ICE A;  5TIS C;  1QHG A;  2HVS A;  4BBR J;  1R1T A;  1IG7 A;  4GO1 A;  2ZSI B;  3HGY A;  4XKW A;  4P5O A;  1Z77 A;  2KDO A;  3UR3 C;  2VKD A;  3I64 A;  3FBN B;  2LY1 A;  1UCR A;  2PJR A;  4A93 J;  2DA5 A;  3CTA A;  4ZYD A;  2R5Z A;  5BPD A;  1ZR2 A;  4A3B J;  1FBS A;  3TQN A;  4D7N A;  4KFC A;  1N78 A;  4DYC A;  1D1C A;  2DYR H;  4NQW A;  1U78 A;  2VUM J;  4XKC A;  2EV6 A;  1KQ9 A;  4B09 A;  2F48 A;  1QNT A;  5C4J J;  4M73 A;  3W3C A;  2Y69 H;  3K9T A;  5ICF A;  4Y13 A;  4HDU A;  1OFC X;  2LFB A;  4XID A;  3AG4 H;  5HDG A;  4MEX F;  5IT9 Z;  1GVD A;  1B1B A;  3AL0 C;  1RKT A;  2HS5 A;  1JUM A;  3OL4 A;  3J81 Z;  3GTM J;  4HF1 A;  4XOT A;  3L2R A;  1FTZ A;  2M30 A;  1OYW A;  1SD7 A;  3HC7 A;  1TNT A;  1HBX G;  3M07 A;  3OIQ A;  1ERD A;  3P9K A;  4XL9 A;  4MQ9 F;  3DU6 A;  2PJP A;  2QEX I;  4B44 A;  4BY7 J;  1WJ5 A;  3MKL A;  2O8K A;  2N8G A;  2JTV A;  1J7K A;  1XCB A;  2CSO A;  1ZLK A;  5F08 A;  1S9H A;  3EET A;  1S6L A;  3E5Q A;  4PCQ A;  1ZGJ A;  5D5X B;  4A3E J;  1R36 A;  3HG9 A;  2ZJQ F;  3HIF A;  4A3I J;  4L0Y B;  4V19 K;  1T0F C;  3WG9 A;  4W97 A;  3CC2 I;  2K9N A;  2V1X A;  4DW6 A;  2XPU A;  1Y0U A;  4BDZ A;  3A0H C;  4NDL A;  2F5C A;  3GO5 A;  2BY2 A;  2ISZ A;  4FQG A;  1PJR A;  3DCF A;  4QLC U;  3ECH A;  5EG0 A;  1YI2 I;  5DCF A;  3CCL I;  3IC7 A;  5EDN A;  1OR7 C;  3SHF A;  1EF4 A;  4C2M J;  4HNT A;  5LD2 C;  1R71 A;  4DBR A;  1BC7 C;  2CQK A;  3KEO A;  4NC7 A;  5IPA A;  3ABU A;  2L01 A;  2DFF A;  3JRB A;  3VYT B;  3OYD A;  4XN0 A;  4MLO A;  2UZK A;  2A3S A;  4PSW A;  2E1M C;  5CVU A;  2G9W A;  2HQR A;  4BE1 A;  1IV8 A;  1BR2 A;  4I7H A;  3OYE A;  2K7L A;  3VSL A;  2PG4 A;  5EEA A;  2KP6 A;  3CDL A;  3NEU A;  2K9L A;  3H3V K;  4KMF A;  4I0B A;  3OL3 A;  4BH9 A;  4PJL A;  3HOZ J;  1MW7 A;  5HS7 A;  1FMW A;  1N25 A;  2EA2 A;  4LGW A;  4RM2 A;  3VOE A;  2GOX B;  1WCM J;  3ZMZ A;  2W25 A;  1HDP A;  4Y7N J;  4MQV A;  3M8E A;  4BBS J;  2NOJ B;  5DM7 F;  4XLF A;  2H27 A;  1ZKG A;  3COA C;  3JW4 A;  3KLO A;  3PUF A;  1FOY A;  1IO2 A;  2BY1 A;  2HOT A;  2QQB A;  1K79 A;  1T6S A;  2EFN A;  2Q2E A;  3DTK A;  4DYR A;  1E3H A;  3O8G A;  2DOA A;  2QWW A;  1QVU A;  1HXD A;  2OZ6 A;  3A1Y A;  1XG1 A;  1Y56 A;  3S32 A;  3R0J A;  4AVP A;  2DPD A;  3RJP A;  1YX5 A;  5HNF A;  3CF5 F;  1ETX A;  2A6T A;  3S2H J;  4HQE A;  5F0H A;  1SAX A;  2YS9 A;  1BW5 A;  2KRF A;  3CJN A;  4KT5 C;  1LVA A;  1QZZ A;  2NVX J;  2HXO A;  5KHD A;  1ETW A;  5L3D A;  2DA7 A;  1KU2 A;  2M45 A;  3R0A A;  1B8I A;  4YEJ A;  3ROU A;  1F9N A;  1LDD A;  5F0F A;  4FX4 A;  2KRH A;  4G7H F;  3OIO A;  2NNY A;  4OWR B;  1B9M A;  5LEJ A;  1MMS A;  4Y15 A;  4FET A;  2JRT A;  3Q5F A;  1TBX A;  1F4K A;  3HJE A;  1WJB A;  4EM1 A;  2TDX A;  1XGM A;  4Y3O A;  2MLG A;  3AL0 B;  1A6I A;  1W7P D;  4ZH4 F;  2WAF A;  4QIW N;  4D7M A;  5IOZ A;  1I6H J;  3GLL A;  4XM3 A;  2DMQ A;  2EJR A;  1HDD C;  2BGC A;  4E70 A;  3GFL A;  1MD0 A;  3MKZ A;  1SVM A;  4E7L A;  4E7Z A;  1WQ2 A;  4C3I J;  2WA0 A;  1Z05 A;  2PFB A;  3FXU A;  1OCC H;  3K1N A;  2Y75 A;  3WTZ A;  4A69 C;  1TWA J;  3V7R A;  2PX9 A;  1UZC A;  4TV7 A;  3J7A O;  1J2X A;  3FHN A;  4PUS A;  1O3T A;  4C2U A;  1BJZ A;  1MSF C;  4LFU A;  2R7Z J;  5HOD A;  1OIS A;  3GTO J;  1ZHF A;  1YJN I;  2QVO A;  3WOD F;  3I4P A;  4Q47 A;  2ESN A;  5DYM A;  4GYG A;  3JRF A;  2EZK A;  5JLX A;  3G1O A;  1LKX A;  2XDV A;  2CQ7 A;  5HVQ C;  1KA8 A;  4LD5 A;  3SDG A;  1BI1 A;  1R23 A;  2K86 A;  1IN5 A;  2LYC A;  3ML6 A;  4A0X A;  4E6K G;  4G94 A;  3JRE A;  3RI4 A;  2IRF G;  5CVJ A;  2M5W A;  2MA3 A;  3KP7 A;  4I98 B;  1YHQ I;  2VOD A;  3ZMS A;  2W48 A;  1Z91 A;  2QQ8 A;  3IAM 2;  3M8F A;  5FFZ A;  4BDY A;  2DTR A;  3FIS A;  3JRA A;  2HQA A;  1S7E A;  1D0X A;  3J7A Y;  1VQP I;  3BR0 A;  4BQA A;  3TW7 A;  1D5Y A;  1HF0 A;  1G3W A;  1Y1W J;  2R7Q A;  3F8F A;  1F1Z A;  2A5W A;  1ETY A;  1K78 B;  3LL7 A;  3BTI A;  3N05 A;  2MFZ A;  1YW9 A;  3S3N A;  1TQM A;  2VAS A;  5B5E C;  2M8G X;  3LSK A;  2A61 A;  3P5J A;  2P6T A;  1BM9 A;  2MD0 A;  3KP2 A;  2VBZ A;  4L5I A;  1G6N A;  1RC9 A;  1I50 J;  2DFH A;  4DJA A;  3RYP A;  3PO2 J;  2ME0 A;  1UG2 A;  4NBQ A;  3MQ0 A;  4JX4 A;  2GOM A;  5GPC A;  1UG0 A;  3ZGK A;  3I5U A;  2LH9 A;  4U0W A;  5ED4 A;  3ABM H;  1TLH B;  2WAE A;  2HOE A;  3BG3 A;  1FLI A;  2FE3 A;  1IRF A;  2K27 A;  2PN6 A;  2WV1 A;  3S14 J;  5E79 C;  2MLK A;  1WH7 A;  3I59 A;  3OV8 A;  1U9N A;  3BG6 A;  1XGS A;  3VB2 A;  2Z16 A;  1IDY A;  4XSZ F;  3GZN B;  3L00 A;  4OOI A;  3Q3S A;  4PJJ A;  2R7W A;  3OS0 A;  3EPZ A;  3HSE A;  3DBR B;  3VYS B;  5E17 F;  1Q1V A;  3V7C A;  4WCG A;  1DPU A;  1B8I B;  1FZP B;  2H1K A;  3TED A;  2LRD A;  3J81 K;  2HTJ A;  2VLA A;  1B72 A;  2B63 J;  4HZF A;  3GFI A;  2JUC A;  2LR8 A;  1VQO I;  1ZRE A;  1TWF J;  5FGM A;  3FKJ A;  2YPR A;  1VQK I;  2G0E A;  3WTT C;  1CF7 A;  3ECO A;  3CD6 I;  1DGR M;  3FXQ A;  1YW7 A;  4U88 A;  3L09 A;  2BVM A;  4HF2 A;  4BU2 A;  2E5Z A;  2X6O A;  2H8W A;  3ZXS A;  3MKW B;  1T39 A;  2QEN A;  5CVR A;  1JKQ C;  3H3U A;  2OCE A;  3ZN0 A;  3CDI A;  2B7E A;  2CUZ A;  3VEP A;  1X19 A;  1LFU P;  1H9T A;  2FX0 A;  1IAW A;  4RAF A;  2RV8 A;  1ZAO A;  4QPQ A;  4ESB A;  1R5I D;  3E1S A;  4RAG A;  2L9N A;  5LHI A;  2CFX A;  4F3Q A;  4Y33 A;  1MH3 A;  3HHH A;  1I3Q J;  5AIP A;  4AIH A;  3UNG C;  1RES A;  1SD6 A;  2R7S A;  1MKM A;  4UUV A;  1C0W A;  1SAU A;  3AAF A;  2V9K A;  1DPR A;  1AKH A;  5D5W B;  2JT1 A;  3HOT A;  2DFE A;  1S7A A;  1KGS A;  4KIB A;  4LLL A;  3JTH A;  1T08 B;  5EGO B;  3H35 A;  1FSE A;  4MTD A;  4M3F A;  1OCP A;  2XRL A;  1ODD A;  2V7F A;  3KZI C;  3U9G A;  3ASO H;  4I99 C;  4BXF A;  5J8F A;  4LG0 B;  1UB9 A;  4L9N A;  4N9H A;  1IRZ A;  1ULY A;  1PUF B;  4MFD A;  3S1R J;  3SJM A;  3VSK A;  4AVZ A;  1ZR4 A;  2K85 A;  4G6Q A;  3ONQ A;  2IS2 A;  2R0Q C;  2BV6 A;  2QKL B;  3S1M J;  1W5T A;  3IHU A;  2BXY A;  4YEL A;  2MG4 A;  2DK8 A;  3M3Y J;  5IP9 J;  3CQZ J;  3Q0W A;  2JA8 J;  1IW7 F;  4C9Y A;  3OSF A;  3I56 I;  1WH5 A;  2QQA A;  1YIJ I;  3WU0 A;  2VJJ A;  3ZOB A;  2AHQ A;  4HNU A;  1FYM A;  2DQR A;  3JTG A;  3QU3 A;  1SFX A;  3PNT A;  4E7I A;  5J1R A;  3LAJ A;  2E1M B;  1SD4 A;  2CQQ A;  2VXZ A;  5H6Q A;  2CV2 A;  2BW3 A;  4OAY A;  3LSJ A;  1XS9 A;  4BY1 J;  2X51 A;  1A31 A;  3SZP A;  4EJW A;  4EJV A;  3C3W A;  3RKY A;  1EV7 A;  3RPU D;  3K70 D;  3WTY C;  5M5Y J;  2L9S A;  3SEQ A;  4KIT B;  2YUS A;  2M1B A;  4XN3 A;  4BHB A;  1IJW C;  2ID3 A;  2HXI A;  3S17 J;  1AA7 A;  1JKR C;  1ZK8 A;  5ILV A;  4IOA F;  2OF7 A;  2AXL A;  3WGI A;  2E7W A;  3PIP F;  2O61 A;  3GBG A;  4A0Z A;  2J5P A;  4RGX A;  3CUQ C;  5FO5 A;  3GW2 A;  3RKX A;  1W0U A;  2HDD A;  3MZH A;  2DAO A;  1P4X A;  3BG9 A;  2KPM A;  3BLY A;  3H36 A;  1K4T A;  5IT3 A;  5AON A;  2R5Z B;  4BQQ A;  1D8J A;  4EGZ A;  3FM3 A;  3V8K A;  1PP8 F;  1YW8 A;  2JQ7 A;  2VBW A;  2XAU A;  2UV1 A;  2EPF A;  2OUM A;  4NQW B;  1LUJ B;  5IT9 K;  1JJ8 C;  5M5W J;  1HA8 A;  2PMZ A;  3NAR A;  2W85 A;  1NHA A;  4MFE A;  3HBL A;  1S5L C;  2OPT A;  3K4B A;  4RB3 C;  3I4N J;  2LG4 A;  2ECC A;  2VI6 A;  1LEB A;  2CV1 A;  1R00 A;  1TNS A;  4RAZ A;  2L7M P;  2VL8 A;  2F5E A;  3IKV A;  3A01 A;  2CG4 A;  4HQM A;  2R7T A;  3SZG A;  3OR2 C;  4RDU A;  2CQN A;  1J75 A;  1FC3 A;  2STT A;  3GTK J;  4M9X A;  2DI3 A;  2XC7 A;  1J9I A;  2H6B A;  1W4M A;  3CES A;  2QBY A;  1DDN A;  1I3A A;  3E6M A;  4I76 A;  1E2X A;  1W36 C;  1GV2 A;  2R7D A;  5H2F C;  3HDD A;  2NVT J;  1X58 A;  3A4C A;  2VBY A;  3DBL B;  3LWF A;  2R3S A;  3CCM I;  1ZRC A;  3CJS B;  3K4L A;  1YRN A;  4ZTJ A;  1V5G A;  2NYX A;  4ENJ A;  2WBM A;  3Q9S A;  5FRN A;  1OCR H;  1EKE A;  4BEH B;  3OYH A;  2ZKZ A;  4IHS A;  2DPU A;  3OR1 C;  1X1B A;  5DV5 A;  4XLN F;  2DQL A;  2NS8 A;  4CUG A;  4UNO A;  2XUB A;  4WX9 A;  2IT0 A;  3K4C A;  2CW7 A;  2PMU A;  1EA3 A;  3BDD A;  4RLQ A;  5LLQ A;  1LB2 A;  3BWG A;  1Z67 A;  4HX4 A;  1GXP A;  3H5A A;  3CLO A;  2FEZ A;  1REP C;  3W2V A;  1N77 A;  1Z7U A;  2P0W A;  4II2 A;  1UAA A;  4AC0 A;  3E0J B;  3RIR A;  3E5X A;  1WSU A;  2ZXI A;  3EUA A;  1IF1 A;  2X48 A;  5K1Y A;  4AWX B;  2KKO A;  2ZJ2 A;  2WB1 A;  2EWN A;  2JUG A;  2K9M A;  3GF2 A;  1B9N A;  4LK1 F;  3V7S A;  2HTS A;  3DKY A;  2A68 F;  1RKW A;  3ABL H;  3RQI A;  3OYC A;  1BI3 A;  4ZYA A;  1R4N B;  4JX5 A;  5DDG A;  4WXH A;  3VPR A;  4ZYH A;  3F3X A;  2L7F P;  3MEX A;  4V2G A;  4B1R A;  5K7H A;  3FM5 A;  5HDN A;  2CFO A;  1I6X A;  3FIW A;  1WGX A;  1NK3 P;  4RGR A;  2L02 A;  4DOZ A;  1IUY A;  2W00 A;  2LOO A;  3KP4 A;  1JTY A;  2DBB A;  1LPQ A;  1K83 J;  1SVO A;  3HEF A;  2HWV A;  1HST A;  4KN7 X;  4HF0 A;  1ZH5 A;  3DP7 A;  2GXA A;  1V5E A;  5JFR A;  2DU9 A;  3R4K A;  2OTL I;  2KT0 A;  2FA5 A;  1ZN2 A;  4JBA A;  2E1N A;  2FNA A;  2VQC A;  3DXJ F;  3IWF A;  3JRI A;  4IHY A;  2CU7 A;  1G3Y A;  1GDT A;  1K6Y A;  2NS7 A;  2H94 A;  3ZQ7 A;  3BP8 A;  3JRC A;  1HQC A;  3BCB A;  1R7J A;  3WTW C;  4AU7 A;  1ONV A;  2ZJP F;  4N9I A;  1IDZ A;  1TP4 A;  2CMP A;  2E2I J;  4CZC A;  1FEX A;  4YFX F;  1E0E A;  5ERI A;  2O0Y A;  4LOC A;  1WJE A;  1RUO A;  2XPV A;  3T5X A;  5HLI A;  3R61 A;  2W84 A;  2B0L A;  3SEZ A;  2ZSH B;  2J5O A;  3ZCO A;  1PYV A;  1SMT A;  1R1V A;  2DW4 A;  1P9Q C;  2COB A;  3RCO A;  1ETK A;  2VB6 A;  3H5R A;  3E3V A;  2WTE A;  3BZK A;  3AG3 H;  3OOP A;  3A01 B;  2PMH A;  3CCE I;  1ETQ A;  2PQ8 A;  2JSC A;  1BI2 A;  3FMQ A;  2XSD C;  4CCL A;  1OQY A;  2X6X A;  2DCE A;  2KIU A;  4A0Y A;  4IRH A;  3ZQF A;  1BC8 C;  3F6O A;  3BPX A;  3H9J A;  5KVR A;  5FLX K;  1U5T A;  2FBI A;  2MC3 A;  4U87 A;  3M1E A;  4D5C A;  2CYY A;  3AKZ A;  1YRN B;  4BJ5 C;  3ZMT A;  1GUU A;  4ABZ A;  4PDK A;  3HKZ N;  3KYC B;  1BA5 A;  5LRR A;  1MDM B;  4EV0 A;  3BTL A;  4E4H A;  2NXN B;  3K10 A;  2PLY A;  3TW6 A;  4NNJ A;  5E1X A;  3WU1 B;  1RRJ A;  3ZR8 X;  3GTJ J;  2EIK H;  5ICC A;  2MBF A;  4HYE A;  1YIO A;  3G2B A;  4M3G A;  3U1K A;  1VQL I;  2V9V A;  3GTG J;  2ELJ A;  1XSV A;  4O6J A;  3EGV B;  1MMD A;  2JPB A;  2Z33 A;  1H9G A;  4EM2 A;  3KP3 A;  2KJB A;  3H1C A;  3S2W A;  3R60 A;  2Y9Z A;  1I27 A;  1U9O A;  4XKB A;  5J1U A;  4XQF A;  3BR3 A;  4BHP A;  3DBH B;  2QUF A;  3TO9 A;  4N0B A;  1GV5 A;  4FHT A;  2RVC A;  2WV0 A;  4C2T A;  3D0S A;  4AYB N;  2HPI A;  2IPQ X;  5KAI C;  4HX7 A;  1VQ6 I;  1S3J A;  4HPQ A;  3OYA A;  3V42 A;  3ERE D;  3L7W A;  2E71 A;  4MO7 A;  2VT3 A;  3G71 I;  3BR2 A;  5CLS A;  4UHT A;  1UHM A;  2K4J A;  3V8J A;  3WU2 C;  2VPL A;  3X2Q H;  4O3M A;  5CJ9 A;  2YSR A;  4RGS A;  2ZME C;  4RBO A;  1DU0 A;  2JN6 A;  1LFP A;  5IYB J;  1YO5 C;  2CW8 A;  2XAJ A;  3BJ6 A;  4UUS A;  3JAM K;  4B43 A;  1OMI A;  4A3D J;  2IA1 A;  2V1U A;  4XRF A;  2LLK A;  5C3E J;  2D45 A;  1D1A A;  4IXA A;  4M74 A;  4R79 A;  1JUS A;  2H6C A;  1F43 A;  2EBI A;  4PJ0 C;  1FIA A;  1FY7 A;  2UXN A;  3LSH A;  3JCU C;  2F5F A;  2ZNY A;  5H20 A;  3I0T A;  2H09 A;  1R22 A;  4D0P A;  5IYD J;  4E7S A;  2O3F A;  4C3J J;  2BY0 A;  1O7L A;  2E35 A;  1SVL A;  4BL0 B;  5L3F A;  4A5N A;  3EUH A;  3MKY B;  2Y30 A;  2IGO A;  3DPT A;  5DEQ A;  4XLC A;  1BIA A;  2LDU A;  3TP3 A;  1X1C A;  2EZL A;  1BIB A;  2XSJ C;  3FK7 A;  2HNH A;  3OY9 A;  3S1Q J;  2ZBK A;  3BCA A;  1TW2 A;  1MIJ A;  1I39 A;  3FKI J;  3SYT A;  4DNC A;  3RSN A;  1OPC A;  4LLG F;  2RGV A;  3EUH C;  2TRT A;  4ZDO A;  4WK8 F;  2Z99 A;  2TCT A;  4FT8 A;  1T56 A;  1QZY A;  2E34 A;  3BTJ A;  1LFB A;  2VN2 A;  3RDI A;  1WIB A;  2DT5 A;  4CA0 A;  1W36 D;  4BHC A;  4F7Z A;  1E3O C;  4OIQ F;  2YU9 J;  5K5O A;  5A2Q Z;  2UXX A;  2DMT A;  3KFW X;  3DQV C;  5D6E A;  3T8R A;  3S15 J;  5M3M J;  2IGK A;  3PM1 A;  5FKN A;  3B02 A;  1O3Q A;  2XF7 A;  4OMZ A;  4HBL A;  4EJO A;  4BJT A;  4UVA A;  3LFU A;  1P2F A;  3FWE A;  3R6S A;  2OAZ A;  3L1P A;  2CUE A;  4NC6 A;  1T95 A;  2E19 A;  1MMG A;  5BMZ A;  1MBH A;  3EQL F;  2KMU A;  3LFK A;  3N4M A;  1CF7 B;  2YX7 A;  4LB6 B;  1G3T A;  4YFN F;  5FRO A;  2ID6 A;  2MH9 A;  5CQE A;  2M2E A;  2DT6 A;  1A36 A;  2HQ5 A;  1W5S A;  1Z9C A;  2LY9 A;  2UUZ A;  1X2N A;  5CYV A;  4ZYG A;  2F4O B;  1WRJ A;  3KIO A;  3WE2 A;  5DCM B;  1G59 A;  2BXZ A;  3K1P A;  3HHG A;  3CO6 C;  3WGH A;  3GXO A;  1IGN A;  4L0Z B;  3ZQC A;  4XOR A;  4OIR F;  2E1C A;  1QQI A;  1YYV A;  2DA6 A;  5DUI A;  4I2O A;  1FTT A;  3MFK A;  4Z6Y A;  1MBJ A;  3FHZ A;  4A12 A;  2HYG D;  2KIQ A;  1IRX A;  3E7L A;  1M1E B;  5J1Y A;  4P55 A;  3F72 A;  3S8P A;  4OU0 A;  3D5S C;  1ZYR F;  3RPU A;  4HLY A;  1JT6 A;  3PFI A;  1XMA A;  1AOY A;  3K4K A;  4ENN A;  3CMM A;  2E7X A;  4Q48 A;  2HZD A;  2CUJ A;  4E7J A;  2AXT C;  1XCV A;  2KL4 A;  1XSX A;  3GWZ A;  2ZME B;  5E20 A;  3FMS A;  1YJ9 I;  2EH3 A;  1WJA A;  1UJ8 A;  4Y4R A;  2QZ8 A;  1Z6R A;  3HM5 A;  5CVI A;  2X6W A;  5J6X A;  5HNH A;  4OIP F;  3HRM A;  2CWE A;  5EEG A;  2VE9 A;  2BZT A;  2V1N A;  1L0O C;  4M3D A;  1Y39 A;  3FMR A;  1HW2 A;  1V4R A;  1I5Z A;  1XMK A;  3FXK A;  2HVQ A;  4A3C J;  4YIF A;  2FQ4 A;  4XRS A;  1KU3 A;  3OS1 A;  2LRE A;  1AHD P;  5FD5 A;  4IX7 A;  1O3R A;  3T8T A;  3PUB A;  2FML A;  1ZG3 A;  4BQO A;  3HRU A;  3A02 A;  3LST A;  2BE5 F;  1Z0X A;  4A6D A;  4G8X A;  4LB5 A;  2D2W A;  3BPV A;  1ZAR A;  1D8K A;  2QSG X;  2XV4 S;  4LIV A;  1U2W A;  4IRI A;  3JRG A;  3LOC A;  3EDP A;  1YS7 A;  5HS9 A;  5BQT A;  4A3J J;  1ZG5 A;  1A04 A;  3F23 A;  1X4P A;  1MSE C;  5DD4 A;  4AIJ A;  3QU6 A;  3CDH A;  2O03 A;  1JJ6 C;  1UST A;  4U7B A;  1X1P A;  1H0M A;  2MSY A;  4XON A;  1MMA A;  1A5J A;  1XD7 A;  1MBG A;  2XF6 A;  4DGW B;  4F93 B;  4P9U A;  4C3H J;  4UVB A;  1JTX A;  3DTI A;  3E6D A;  4MEY F;  2FBH A;  4M6X A;  3KPH A;  1FPQ A;  2L9R A;  4XLP F;  3QOE A;  1JUP A;  3REO A;  2DA4 A;  2FQ3 A;  3HYI A;  1BL0 A;  1U5T C;  2LSO A;  1YX3 A;  2K9Q A;  3OYI A;  4BAY A;  1RET A;  2R5Y B;  3CC7 I;  3LA2 A;  1A6Q A;  4CCN A;  1GHC A;  2ZO4 A;  3HSR A;  3K2A A;  3FF5 A;  4EEF G;  2VON A;  3U21 A;  1FT9 A;  1LE8 A;  1Z6T A;  1TWG J;  2W24 A;  3BZC A;  1O4X A;  2OA4 A;  3W6J B;  2WAQ A;  3QPT A;  4RGU A;  2VPR A;  3GZ6 A;  2M8E A;  2VT2 A;  1G3S A;  2HDC A; 
#chains in the Genus database with same CATH homology
 2K3F A;  1HC8 A;  2QA4 I;  3G71 I;  4IOC F;  3CD6 I;  4UY8 I;  3CJQ B;  5GAG J;  2E36 A;  2H8W A;  3I55 I;  2OTL I;  3CCJ I;  1YJN I;  2JQ7 A;  1VQ8 I;  5DM6 F;  5GAH J;  3G6E I;  3CCQ I;  1VQ4 I;  2ZJP F;  3CMA I;  1YJ9 I;  1YHQ I;  2E35 A;  5GAE J;  1Y39 A;  3CCU I;  1VQ7 I;  5DM7 F;  1VQP I;  1S72 I;  1FOY A;  3DLL F;  3PIO F;  3CCM I;  3CJS B;  3CCE I;  3CC4 I;  2ZJR F;  1VQN I;  3CJR B;  3CME I;  2E34 A;  3G4S I;  1WIB A;  3CJT B;  3I56 I;  3CCR I;  3CF5 F;  1YIJ I;  2OTJ I;  4IO9 F;  1YJW I;  3CCV I;  1YIT I;  2QEX I;  1VQ5 I;  1QA6 A;  2NXN B;  5GAD J;  1VQL I;  1ACI A;  2ZJQ F;  1MMS A;  1FOW A;  3CCS I;  1VQ9 I;  3EGV B;  4V19 K;  2FOW A;  3CC2 I;  5JVG F;  3CC7 I;  1FOX A;  4IOA F;  1VQM I;  3J7Y J;  1YI2 I;  3PIP F;  3CCL I;  1VQ6 I;  3J7Z I;  1VQO I;  1VQK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...