2K3FA

Ribosomal protein l11 from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L11
publication title Domain reorientation and induced fit upon RNA binding: solution structure and dynamics of ribosomal protein L11 from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2k3fA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2k3fA01
4IOAF 3CC7I 1VQNI 1Y39A 3CC4I 4V19K 1VQ7I 1VQ5I 3CMAI 3CCRI 1YJ9I 1S72I 1VQ8I 1YIJI 1WIBA 5GADJ 2H8WA 1YJNI 1VQ6I 1ACIA 1FOXA 2FOWA 1YI2I 3CCJI 1VQPI 2E36A 1VQ4I 2OTLI 3PIOF 3CJSB 5DM7F 3CJTB 1YHQI 1VQKI 4UY8I 2QA4I 3CCMI 3J7ZI 2ZJPF 4IOCF 1YJWI 1VQLI 2NXNB 2OTJI 3CCQI 5DM6F 1VQOI 3CJRB 1YITI 1HC8A 3PIPF 3CCEI 3CCUI 1VQMI 5GAGJ 3I56I 3G4SI 2ZJQF 3G71I 1MMSA 3CJQB 3G6EI 2QEXI 3CC2I 2E35A 3CCLI 5JVGF 2K3FA 3I55I 1QA6A 1FOYA 5GAEJ 3EGVB 5GAHJ 2ZJRF 3CCVI 2E34A 3CF5F 3CCSI 1VQ9I 1FOWA 3J7YJ 4IO9F 3CMEI 3DLLF 3CD6I 2JQ7A
chains in the Genus database with same CATH superfamily
4ZYDA 1GLNA 5FFZA 1WHUA 1WH5A 2EIKH 2F4OB 5HLHA 1DQUA 5L3CA 3E6CC 2PMHA 3LWFA 3OYAA 4UVAA 4A6EA 5DS9A 3JSPA 1RR8C 4KT6A 2ME6A 1YIJI 3BR5A 1ETOA 2DJIA 2YS9A 4OIPF 3H1CA 1UCRA 4XN3A 2X0LA 2CRGA 4ETSA 3HRUA 1OISA 3GLLA 2VL8A 2KJCA 1YW7A 3I4MJ 3ECHA 4Q48A 1MD0A 5LLQA 4LG0A 1ZG3A 3C2BA 3I71A 1JTYA 4DYRA 2R7SA 1K78A 2OF7A 5IYCJ 3ZMZA 4A0ZA 2Y2ZA 4G7OF 4FQGA 5J1UA 2L4MA 2VONA 3S1NJ 2E2IJ 4UHTA 2GA2A 4GFBA 2X6WA 2QENA 1MIJA 3OYKA 4NHJA 3MZHA 3DBRB 3FKJA 3KP3A 1YW8A 5F1RA 3OYBA 5HNHA 3JRCA 3KYDB 4II2A 1M1EB 4LMYA 3OSFA 2IGNA 1ETWA 4EV0A 2NXNB 3OR2C 5JR3A 5L3BA 1E0EA 5AIPA 2DMPA 1QNTA 1LFUP 1BI1A 3F8FA 3MWMA 3I54A 5FGMA 5HVQC 1BM9A 5HDNA 1TTYA 3DTEA 2XGXA 1IG7A 3K4KA 2DA7A 3DEEA 5LEJA 1Z1DA 1NHAA 2P81A 5TISC 3HXLA 2LY1A 2L9RA 3DPLC 3RKXA 2R92J 2ZMEA 4RLQA 3KP2A 4LLNA 4XKCA 4FE4A 4WK8F 2VODA 4F91B 1MMSA 4G12A 3E97A 2RGVA 4DQ2A 4A3FJ 1T0FC 1R49A 3HRSA 1XSDA 1RRJA 3IH2A 3WE3A 3I55I 4M74A 2VI6A 4XLEA 3EGVB 1ZHFA 4XLHA 1CGPA 3JSOA 3HOYJ 4L9TA 2H8RA 3LSPA 2IPQX 1E3OC 1ON2A 3TBIA 2WV1A 1R1VA 5F0FA 2VN2A 4BJ5C 4L0YB 1QU3A 2KIQA 2GM4A 3LA7A 1K7AA 1BIAA 3LQQA 2A5WA 5IPAA 5D4RA 2F48A 2DA5A 5D6EA 4CCOA 1D0YA 1W0UA 3CMEI 5LBQA 1QVTA 4B3XA 1MBKA 3Q3SA 4XICA 1YQAA 3FXJA 4N4OB 4I6ZA 2B63J 4G94A 1JGGA 1TP4A 2L3DA 2HDWA 3DP7A 1HSJA 2QBYA 2WAEA 3KX2A 2K9SA 2P5KA 3ZN1A 2VQCA 4LG3A 1HCRA 1LDKB 2HWVA 3O2PE 4E7SA 1MDMA 3MCZA 1HBXG 2W1OA 2QCOA 4CGZA 4UB8C 3KIOA 3VWBA 3TO9A 2Q2EA 2VJIA 2DT7B 5FRNA 1V4RA 2LFBA 2IVMA 1BR4A 4E7KA 1OFCX 2RNJA 1PP7U 5EDNA 2KRFA 4KN7X 3PO3J 2FX0A 2V9PA 3W6VA 1Z0XA 1Z9CA 4BY7J 2R5ZB 2HGCA 2IA2A 4AU7A 3ZMSA 4A3LJ 3OYNA 1IRFA 1QVUA 1B8IA 4BGDA 1D1BA 5HLGA 3BWGA 4RLFA 1DDNA 1YOVB 3SHFA 4KNYA 3HHHA 3L2CA 5EYRA 2VC0A 2K4JA 4BY1J 3CP8A 3PJRA 2DTZA 3VFZA 1IUYA 3RTRA 3L1PA 3RCOA 3FM3A 2DYSH 3ASOH 3OMYA 2FEZA 1VQOI 3K4LA 3A0HC 2M5WA 4XRSA 3H5AA 2AXLA 2WV0A 2JT1A 4LJZF 4BS9A 2C6YA 3SEQA 3UNGC 2D2WA 3ZQGA 1HC8A 4AC0A 3OYLA 4ESBA 4M73A 3K1MA 1FYLA 4WXCA 2FMLA 1NG7A 1SVLA 3CUQB 2A07F 4OIOF 5J3LA 1YLFA 4IRIA 3TP3A 2HZTA 3RJPA 3DBLB 3OYMA 4G9YA 1R9TJ 2D1VA 3ZMTA 4OAYA 2VJ4A 1BIBA 1R23A 5KHDA 3A02A 2E2JJ 1F36A 3TEDA 1O4XA 1U8RA 1YX3A 2G0EA 3GWZA 3KEYA 1JHHA 2W00A 3LQRA 1D5YA 3O8HA 4RA2A 4MQVA 2HQNA 3S8PA 1H9TA 2E34A 2V7FA 3NQOA 1BA5A 3IC7A 3GTMJ 3GFJA 2YU9J 1TW2A 1LVAA 2DA6A 2XPWA 3JTGA 3SXYA 2FBHA 3HZJA 1ERDA 3FWEA 3J80K 3JRIA 3G3ZA 1IXSB 4RB3C 1ZG5A 1B9MA 1FIPA 3SDBA 3E5UA 2Z16A 4HA8A 2Y9YA 3MKYB 4BNCA 2OPTA 2CQ7A 3HOWJ 4CZCA 1MJAA 3WTYC 3HSEA 1XMKA 2Z3YA 2FNPA 4QPOA 4IF4A 2Z1DA 2JRMA 2GA1A 3FHNA 2X1EA 2JMWA 4V19K 2Q1ZB 1WJDA 2VBXA 1VQ7I 3I5UA 3OYDA 1W5SA 4IXAA 4RAYA 3L2VA 2ESHA 1O3RA 1HW2A 1R7JA 1SFOJ 4I99C 2LD5A 3BCAA 4NC8A 3BG5A 4HNTA 4BAYA 2VQLA 3ASNH 4XM3A 2K27A 3PUFA 2LREA 2O03A 1MGTA 4G6TB 1U5TB 4WXDA 1LFPA 3GVAA 3BR6A 5DD4A 4A3CJ 4NDLA 3ZRGA 3OSGA 4BHCA 4UUSB 5FKNA 4GYGA 3WTTC 3AL0C 4ZYHA 1Z3YA 3R4KA 5J40A 1P9QC 3K9TA 1OPCA 4Q5SF 4LIVA 2M30A 2FBKA 3IRRA 4RGUA 5LGNA 4BUPA 1TC3C 1TT0A 5IT9Z 1A04A 3JCUC 5ED4A 1J9IA 1PUFA 1XX5A 2QQAA 2O3FA 1STZA 3CJRB 3T5XA 2CV1A 4XONA 3FXLA 2HTJA 4DZPA 3I58A 2OZUA 2R4GA 3FMSA 2QQBA 3AKZA 3V7SA 1QHGA 3GTPJ 3V8LA 4HX8A 4P55A 2E1NA 3R0JA 2KIFA 2EA2A 4PJ0C 2O9LA 1P92A 2CYYA 3OR1C 1ONVA 1XMXA 5GP9A 3L2RA 3PNYA 4JP0A 2WY8Q 3GTKJ 3FXUA 3BR2A 3RQIA 5GAHJ 2R7XA 4DYQA 1P4AA 1ZN2A 2MC3A 1O7FA 4EJWA 4KN4X 4XLCA 1KGSA 5H20A 2RDPA 1J75A 1KQ0A 2MLGA 3VDXA 4C2UA 3V7RA 2LNBA 4BXFA 2ZXJA 1ZELA 1HW1A 2VE9A 5EGOB 5FD5A 3CD6I 2ZO4A 1GDTA 2P8TA 5D8LB 3G1OA 3TL4X 1BL0A 1R71A 2AHQA 2IS1A 3H5NA 1W7PA 2EV0A 3OL3A 2XGCA 3CC4I 3S3NA 3K4JA 4C2TA 4Y52J 1MJ9A 1SVMA 1R22A 3A01B 3CUOA 5LD2C 2LVSA 2DA2A 1TWCJ 2MSYA 1YFHA 3KYLA 4DZJA 1BI2A 4NB5A 4A69C 4V2FA 1XC5A 4AYBA 3JAMZ 4HF2A 4PGGA 2O0YA 2YX7A 4XL9A 3K0LA 3B73A 2PJPA 4JX5A 4XR6A 3P9KA 3VSKA 3H3ZA 4C3HJ 1G3SA 1ACIA 5F08A 1WZ2A 3K1NA 4IQ4A 3TDZC 3BR3A 3C2HA 5FB2A 4KDPA 3E5XA 3FDYA 5BNGA 1OMIA 2E36A 4I0AA 4HV5A 2UZKA 2F4MB 2F5VA 5DM7F 2LMDA 2BY2A 2QSFX 2XSDC 2NVYJ 2MD0A 1ETVA 4HV6A 2D45A 2CV2A 2EZIA 3I59B 5E8IA 3F22A 2DMUA 3R0AA 3VOEA 3SJMA 1IRGA 2R7WA 2H94A 4NUBA 3QQAA 2MH2A 1E3PA 1VNDA 2M4KA 3TOAA 3DKYA 3F6VA 1I3QJ 4X6AJ 2XAHA 2OTJI 3FXOA 5FROA 1MH3A 5B66C 3ZMUA 1J7KA 1YE9A 2EZLA 3T1BA 1DP3A 2A68F 5D5XB 4J00A 1D3YA 1YITI 3CP2A 4HZFA 3JREA 2R7DA 4FETA 3DFGA 1OCTC 1FP1D 2OQRA 3N97A 2K40A 1N77A 3I56I 1W36D 2YSRA 2E1MC 4M71A 1AKHB 3E6DA 3PUBA 1WI9A 4K2EA 1JUMA 3LSMA 2QEXI 3Q9SA 3W6JB 2R5YB 3LNQA 3GZ6A 1LQ1A 3KLOA 1Z6RA 5JVTA 4DNCA 3AFHA 2Y48A 1KU9A 2L2OA 1W36C 5A2QK 1XTAA 2QM3A 2ZJRF 2WADA 3LFKA 2NVXJ 3PM1A 1ZG1A 3FM5A 3C7JA 1QZZA 2QGUA 4CSWA 2GLOA 4ZH4F 3GX4X 2BV6A 5HDKA 3OYIA 1IN4A 3GTGJ 1MMDA 5F04A 2A3SA 4E7ZA 1AHDP 2LY2A 5IOYA 5CQEA 3MZ8A 2OJED 4A3BJ 2ECCA 3DWLE 5E20A 3JTHA 4I2OA 3JRDA 2DTRA 2IS4A 4G7HF 1JJ8C 3QODA 4TV7A 4C9YA 4HNUA 5LEKA 3M7GA 3ML6A 4YFNF 2XC7A 3BPXA 2JVGA 3P9IA 3HG9A 3OOPA 1JTXA 5CYVA 2E1OA 3LOCA 2NVUB 4HDVA 3J81Z 4XBFA 3BCBA 4HX7A 5K5RA 1GVDA 2CQXA 2L7KA 4JX6A 3V42A 3WTUC 3IKTA 1A36A 3JRHA 2X1CA 1O3TA 3ZCOA 1S9HA 2E1CA 2B9SA 3ZQCA 3EYYA 2VIXA 2BVMA 2X85A 3FZVA 3KYCB 2P6TA 2K86A 4M3GA 1V54H 3QWLA 1L3LA 5FLVA 1RZ4A 2DAOA 3WTZA 5DDGA 1UJ8A 1MMGA 2KPMA 2BE5F 1X3ZB 1POGA 4L5EA 1QBJA 2PMZN 1IDYA 4FASD 2BW3B 1REPC 2V1NA 5KVRA 3I53A 1T08B 3A1YA 2JUGA 2ZNZA 2DOEA 4U0YA 2RVCA 4WWCA 2EV5A 1TL8A 1AWCA 4BHPA 3LSKA 4B48A 4DJAA 2OBPA 5GPAA 1LJ9A 2TCTA 4PUSA 3CO7C 1SVOA 2TDXA 2F2EA 1OLTA 4D5FA 1LE8A 4XRSG 2KMUA 1OKRA 1MSFC 2IW5A 1XDUA 3JRBA 2BEOA 2HQRA 3PQJA 1KONA 1KQ8A 1UHWA 3CESA 5CVJA 2FRHA 4CO8A 2HKOA 3BROA 4JK1X 1J0RA 2PBIA 2CQQA 3DV8A 3IKVA 1K4TA 3CCYA 5B1AH 4IHYA 2ZJ2A 4AIHA 2JPBA 5GAGJ 3MN2A 4M6VA 1BR1A 1V5FA 1VTNC 3D5RC 1EKEA 4KMFA 4IHSA 2GXBA 2E35A 5L3EA 3BQZA 2W25A 3HPHA 2JN6A 3BZ6A 4CICA 2Z33A 2BXYA 3IH4A 3J7AY 2LBFB 3FX3A 2MGQA 4BU2A 2TRTA 4OINF 5BMZA 5K7HA 1FOKA 3U9GA 1FYKA 4ZYGA 4GCVA 3DF8A 2ELHA 5ERIA 5BPIA 2PEXA 2R7QA 3T8TA 4W97A 5EEGA 4AWXB 5D5VB 3WODF 3NARA 3VYUB 3F0CA 3KEQA 3LSTA 3JRGA 2XF6A 1O7LA 2LKXA 2H6CA 2GQQA 1RUOA 1W7PD 4DW6A 3WG7H 1KYZA 1K78B 5ILVA 2CQNA 4EM1A 4M3EA 1BI3A 2VB6A 3AL0B 1X2NA 4RBOA 3TMOA 3KETA 3GLXA 3OYFA 1U9OA 1WIBA 2LY9A 2GZWA 5D4SA 1K6YA 3M3YJ 5B1BH 1Y56A 3M1CA 3Q9VA 3QPLA 2MD5A 1TNSA 1DPRA 1KU2A 4EATA 2NYXA 1K61A 4MO7A 3BLYA 4CXFA 2FOWA 1OYWA 1R5ID 4OIQF 3DBHB 4E7IA 3MQ0A 2H1KA 2V79A 3B6CA 2LF7A 3HB9A 4MEYF 4E7LA 3FF5A 4ENJA 3JR9A 1ODDA 4NQWB 2XVCA 3HTUA 3BJ6A 2IEKA 1I5ZA 2VPRA 5E1XA 4A3JJ 3CJTB 2F4IA 4O6JA 4KISA 3WHCA 2EWNA 2X6XA 3WE2A 4CCNA 2HVQA 2XDVA 3OS2A 4E70A 2P7VB 4GXOA 1FNNA 3VPRA 2VPLA 1IDZA 1X1PA 1LDJA 3BZKA 2CGPA 2ZJPF 3HOZJ 2Y69H 4A5MA 4IOCF 4BEHA 3ZP5A 1SAUA 1ETYA 1USTA 3FXRA 3H9QA 3GFLA 2X6YA 1RETA 4AVZA 5LHIA 5L3FA 3CZ6A 1I39A 3K70D 2DYRH 4C3JJ 1GHCA 1OCCH 1X3WB 5LHGA 4N4NB 3BQYA 4FX4A 2WB1N 3CCEI 1SMTA 2ECBA 2YU3A 3Q0UA 1VQMI 1TNTA 4BJ6C 4U7DA 4AIJA 1XGNA 1XB4A 2RKHA 5DCMB 2O6GE 3K70C 4PDKA 2M0MA 4ON0A 3REOA 4Q4ZF 2BY1A 4EJUA 3EETA 2QSHX 1J2XA 4Y33A 2DBBA 2ME0A 5GTIC 1R1TA 4XKVA 2IJLA 1UB9A 4HSRA 5D5WB 2GIVA 3MAJA 2W84A 3O6BB 2AQFA 1XCVA 2CFOA 2HQ5A 2XV4S 1GV5A 1XGSA 4LD5A 1ZAOA 3RZOJ 2LSOA 1MDMB 1WJEA 2WAQN 2K85A 2D1HA 4DBRA 5FLXZ 4XSZF 3HOSA 5EEHA 2R7OA 1VQ9I 4EM2A 3S3OA 4IO9F 4L5IA 2DOAA 2Q2EB 1YS7A 1UZCA 4EJOA 4BACA 4BBSJ 5H2FC 1X58A 3VYTB 5J1RA 4YEJA 1NK2P 4OAZA 2LF8A 3RYPA 1G8XA 4HNVA 1SANA 1OCRH 2NS8A 4RM3A 5L3GA 2ZNYA 3F6OA 2Q0OA 1XGMA 5KCMA 4MNUA 4HLYA 4UV8A 2BOLA 4Y3OA 1I6HJ 4KICA 1FC3A 1FYMA 4N9IA 5FJ8J 4KT5C 2CW0F 5K7ZA 2H27A 4ESFA 2PI0A 2VUMJ 1KZHA 2R7ZJ 2P6SA 5KK1A 2RQQA 1XGOA 5IOZA 1HOMA 4JBAA 2V1DA 1A6IA 5DEQA 2CSOA 1J5YA 3K6GA 2DT5A 2PN6A 2UV1A 1RKWA 2DA4A 5FKLA 1ZARA 4A2UA 1EJ9A 2Y9ZA 1KQ9A 1F1ZA 2CG4A 2QSGX 4HRIA 3E5QA 5LGUA 3HRMA 5CVIA 2FSWA 2VC1A 4FHTA 4DOZA 5JHFA 3CTAA 3QPTA 2QKLB 3IWFA 4YRVA 2VBYA 4ZTJA 3DEUA 3N05A 2KT0A 3TW6A 5HLTA 1E17A 3V7CA 1FEXA 1B72A 4IHWA 1PDNC 2E19A 2DOFA 1T39A 5EF6A 2QLZA 4RM2A 3L2QA 3CO6C 4BQNA 3U1DA 5LRSA 1DUXC 3W2VA 2ZSIB 5B3SH 1Q1HA 2CWEA 1T38A 4JQFA 4Y13A 4ZDOA 5E3MA 1QO0D 2LP0A 5K5QA 3F8NA 2O5RA 4ZJZA 1A6QA 4B44A 2DI3A 3FXMA 2OAZA 1DP7P 1G6NA 4YG2F 2AS5F 2HOAA 2L7ZA 1FWZA 2EFQA 4B47A 3CCUI 1ZR2A 3HUGB 4PJMA 1VZ0A 2RQPA 1SD7A 1PJRA 2W24A 4UUVA 1IN6A 2VT3A 2CFXA 2I5UA 1BOBA 1ETKA 5F0HA 4N9HA 3VYSB 4M9XA 2WY7Q 3GO5A 2XKPA 2AXTC 2KKOA 1IRXA 2IGOA 1MNDA 3BDDA 1V5GA 4FT8A 3VSLA 1WFXA 2G7HA 2H09A 1FLIA 3LFUA 1ETXA 3HOVJ 5F1JA 1E2XA 2CW7A 3BTIA 1X19A 3CDHA 1UAAA 3L09A 1ZLJA 2CUJA 2ZB9A 3TW7A 4GYIA 1NH3A 4EJTA 1Z05A 3ZQFA 3WTVC 4IHVA 2M8EA 1SFUA 4WF2A 1FZPB 4ZDLA 3IP4B 3P5JA 2IA1A 5J8FA 3PO2J 1HKTA 3RSNA 4XLPF 1SMYF 2KJBA 3HDDA 1Y39A 3ULQB 3HKZA 4XRFA 1P6RA 1ULYA 2DT6A 4H4KC 1EH6A 4HQEA 1H0MA 5GTHC 3SDGA 2DDBA 2VE8A 3C3WA 2K5CA 1MJBA 3K7AJ 1Y0NA 4OOIA 5LFAA 2L02A 1H89C 4R1HA 2DU9A 1HF0A 1U3EM 1DU0A 1I50J 3B02A 3OV8A 1U6GA 2IS6A 3I9V2 1YI2I 2LR8A 4P9UA 2KQRA 4B8XA 2EILH 5KNLA 1GXPA 5IYDJ 3E0JB 2A05A 2V4JC 2EFPA 1FPQA 3LMMA 1QHHD 3LSHA 5BQTA 2ACJA 1VQ4I 4O3MA 3FMRA 1ZQ3P 2R5ZA 3W2WA 1WI3A 2BYVE 2J5PA 3GCMA 4MHGA 3VODA 5J8CA 3JRAA 1IN7A 2EV6A 2WTEA 3H9JA 3GTLJ 2DMNA 3EUAA 3M1EA 4YIIA 3GW2A 1HSTA 3NRVA 3O3KA 4D9JA 3CCMI 4OU0A 3IWZA 5E1WA 3P7NA 2LLKA 2BZTA 3WG9A 2IRFG 1X1CA 3EPZA 2WAFA 4U88A 4A93J 4OWRB 4Y17A 5CKTA 1D1CA 3AG3H 1HA8A 5IP7J 2ISZA 5HS9A 1BJZA 3F3XA 4MTDA 1T8IA 4ESJA 1G3TA 3ZR8X 1LUJB 1FT9A 2W82A 3AG1H 2BGCA 2HYFA 2KL4A 3CUQA 3OY9A 4XNFA 2JK3A 1ZRFA 4RB1A 3G71I 4Y4RA 2WA0A 4BBRJ 2CW8A 4LOCA 3AAFA 2IAIA 1Z7UA 1R5HA 3LSRA 2Z5UA 2K3FA 2ELKA 2K9QA 2KP6A 2W85A 1RUNA 3K69A 4QTRA 2HDDA 4MTEA 4A3IJ 4RGSA 4HF0A 1R4MB 3BR0A 3S2DJ 2KRHA 2MBFA 4F93B 3OIOA 1P7IA 1BI0A 4U87A 3BJAA 1W5CC 2GAUA 3DPUA 4R8HA 3IL2A 4XOTA 1FTTA 3RDIA 1V5EA 2AO9A 4AD9A 3J7YJ 2LDUA 4XKBA 5M3FJ 1WJCA 2KRCA 4I09A 4G6DA 2EK5A 2ZMEC 1FP2A 1GVJA 2W48A 3EUKL 4RMNA 2H1LA 3QP5A 1FTZA 3BTJA 1WJBA 1W4MA 5GPCA 3FHZA 3LSGA 4XOPA 1BC7C 4LFUA 4IQJA 1YJ9I 1VQ8I 2FD5A 2EFNA 5CVRA 4KMUX 2IT0A 4XRMA 2Y0SN 1YJNI 3R61A 1F4KA 1X2MA 2R7FA 3BZCA 2E5NA 2L01A 3DCFA 5IYBJ 2VOPA 2PLYA 4IZZA 2ZC2A 1YS6A 2BY0A 3PNTA 5J6XA 1U5TA 1D0XA 2VBZA 2OC6A 3AG4H 1TBXA 2K02A 4F55A 2DDAA 2XF7A 2PJRB 5HOOA 5HS7A 1OCOH 4HOBA 4XLNF 2GBYA 4UUSA 3KZYA 2L4AA 4P1WA 1UHSA 3LA3A 5CJ9A 4B43A 1IXRC 1N75A 1DU6A 4ENNA 1B6AA 2DPDA 2VKHA 4JOMA 2GWRA 1TQIA 2XKOA 4M3BA 4CH7A 5IP9J 1ZR4A 1MH4A 2XRNA 3ZQHA 5BOXA 2CH0A 1ZK8A 1MZBA 3ABLH 3V8KA 2F5FA 4UVBA 2DA3A 2VQHA 1RI7A 1G3WA 2KISA 2RREA 4RAZA 3N4MA 1MKMA 1YX5A 2W57A 2KFDA 2L9SA 3NEUA 2OCEA 2OD5A 2X9DA 2NNYA 3BG7A 4BYYA 4HQMA 2HNHA 3NWSA 1LVKA 1S7AA 4KIBA 2X51A 3ZPLA 3ABMH 3VB2A 1HKQA 1Z67A 4ENMA 2VJ5A 1K6OA 1K79A 4LB6B 2F5EA 2ZSHB 2ZJQF 3TGNA 4HAMA 4A3GJ 3D1NI 2FQ4A 3VYRB 4I01A 1JKRC 1FJLA 3FISA 1RR7A 2RV8A 1ORKA 2ETHA 2R7TA 1Z21A 1T56A 5GAEJ 3V8JA 1D8JA 1VI0A 1Y0UA 5EEAA 2UWMA 1JE8A 3ZQLA 3M8JA 4ANJA 2QF7A 2NVTJ 5E3NA 3JW4A 5DV5A 1JUPA 4RGXA 2HKXA 2EQRA 2GXGA 1HXDA 2M0CA 3L2WA 3WTWC 3PSIA 2EFOA 5EG0B 2FJ1A 5EGOA 3S15J 3OYGA 3SQNA 3DLLF 3S3MA 4FX0A 4RGRA 2JQ7A 2DQRA 3F8MA 2B0LA 1LNWA 3WU1B 4FCYA 4KA4A 4CCKA 5HS8A 4M3FA 2GOMA 3A01A 3BY6A 2M7BA 1OR7A 4P5OA 1FSEA 3ZOBA 2ZCWA 4ZZDA 3TQNA 1BW5A 5HNFA 2H8WA 3H36A 3PFIA 4E6KG 4F3QA 1JKPC 3BC8A 3QPSA 2G9WA 1HDDC 2OUMA 3ELKA 1NTCA 1TQPA 3SEZA 3L00A 2NAZA 1FOXA 4G6QA 5E3OA 4YIRX 1LE8B 3WTSC 3WU2C 2M4GA 2STTA 1ZKGA 4YIFA 4XMYA 3OYHA 1IJWC 4U0VA 3QP6A 1YW9A 3KLNA 1FIAA 2OTLI 3QU3A 4RDUA 1VQKI 2XPVA 4A3EJ 2RC4A 3U1KA 2RN7A 1H88C 5IY5H 1Y8QB 3I59A 3PSFA 3HGYA 1V3FA 1MW7A 2XRLA 3KZZA 3R6SA 3SZTA 4L9NA 1J59A 2UXXA 4D5CA 2DJNA 1Z91A 3ZN0A 3H3UA 2CJJA 2QQ8A 1OCZH 1P2FA 1OJLA 4L9JA 2NOJB 2E7WA 2M34A 5DM6F 3LL7A 4X1EA 4CYCA 4DGWB 3KFWX 5M5YJ 3CLQA 4BQOA 4YELA 2L9NA 2JJ7A 1P4WA 4LK1F 5K7FA 3HM5A 3K4CA 1RC9A 3PNVA 4I7HA 3T8RA 3HGGA 1AKHA 2V9KA 3U21A 2LOOA 3QRFF 3CJQB 2ZFUA 4NNJA 2LH9A 2PQ8A 3QU6A 3DKWA 4BQQA 4PZJA 3S1QJ 3MMYB 3MKZA 1YRNB 5C4JJ 1JT6A 5HDGA 5FKKA 5JVGF 2LK2A 4XIDA 1CF7A 5EZHA 4BDYA 3R60A 4EEFG 1CQTA 1HDPA 1FBUA 1WKMA 1SFKA 1QRYA 3FBIB 5E18F 1WJFA 1FBSA 3BT9A 5JLXA 2Y75A 3WHBA 2CUFA 1UMQA 1EA3A 2DW4A 1RIOH 2X4HA 3HHGA 3KE2A 2PG4A 1JGSA 1APLC 3GBGA 4XN0A 5IP6A 4IEJA 2M2EA 3HRTA 1TLHB 4HPQA 2NVQJ 1H9GA 3COAC 3OIQA 3ABKH 3QYEA 1VQNI 3KP6A 2IGMA 2P4WA 3RKWA 2ID6A 3A4CA 1ETQA 3NWTA 2ICWG 2WWYA 3H9GA 4XK4A 3D0SA 2OV7A 4PJNA 5JFRA 2DK8A 4MFEA 2ELJA 2ID3A 5F6FA 2JA2A 4C3IJ 2P5VA 1UFMA 1BOAA 1XN7A 2Z2SB 1MMAA 3JRFA 4W1UA 2B7EA 2J5OA 4PGHA 1SD4A 4BEHB 1IN5A 4M9ZA 3RPUA 3S2WA 3GYHX 1P7JA 4LG0B 4QWQA 2M8GX 5A2QZ 4LLLA 2BW3A 4AUXA 4R79A 1VQPI 1IW7F 2V26A 3AG2H 4EMSA 3VEPA 2ISYA 1R58A 3MEXA 1U5TC 2PX9A 3F8BA 3F9KA 4HW0A 3ECOA 4WX9A 1MBJA 4KFCA 2JWTA 3ZGKA 5FO5A 4A12A 1ENHA 2IA0A 2LTPA 3RIRA 4D1QA 2DMTA 3QYBA 4BQAA 5AIQA 3K10A 1JKQC 2Q8KA 2VT2A 3BTCA 4L5JA 1BC8C 2QWWA 1AOYA 4ZYEA 1YJWI 1D1AA 3E7LA 3GZNB 1C0WA 1R36A 2EB7A 2BY3A 3MVPA 1X1BA 3P9CA 2EIJH 2ZKZA 1K4SA 1I1SA 3KP5A 2DO7A 3I3LA 3KP4A 4IKFA 4AIDA 1WWXA 3DTKA 1MBEA 2M87A 1G3YA 2JRTA 2YUSA 3EUHA 1LFBA 3BPVA 4S05A 2CMPA 2ZMEB 3ZQIA 1WCMJ 2EPFA 5K5OA 3LAPA 4PJJA 1SEUA 3CC2I 3GEZA 1T95A 4PFPA 1O3SA 2L7FP 1A35A 5E79C 1A5JA 2LBFA 1QA6A 2JSPA 2FMYA 5E3LA 3GTQJ 4P96A 3EQLF 3C2GA 1X3UA 3KZIC 2DFFA 2K9NA 5KAIC 2EIMH 3KCCA 3CCSI 2VQGA 4ITVA 4XORA 2HZDA 1ZRDA 1IF1A 4LGWA 1N25A 5EZGA 1F9NA 4UXNA 1WJ5A 2X48A 2A61A 3ABUA 2XUBA 1EH7A 3EYIA 3DLAA 3OIPA 4CCLA 3RI4A 3H3VK 1D5VA 1R1UA 3D5SC 3FXKA 3ABTA 3BOQA 1D0ZA 3KPHA 4E7HA 4ZTFA 3H0GJ 1S3JA 3M9AA 1JKOC 4GO1A 2P0WA 3KP7A 4S04A 2AQEA 3LSIA 3RQ4A 3CMAI 2QBYB 4B4CA 1KYWA 3H5RA 5C3EJ 1I1GA 1UELB 4RB2C 3D5LA 3OYCA 2M7AA 1U78A 5CVUA 1OR7C 3BP8A 2KLOA 3QPHA 3M4OJ 1B72B 1JHFA 4H0EA 4BE2A 2XGEA 4D7NA 1ZH5A 4CCJA 1ZLKA 1T2KA 1VFCA 4NQWA 5D6FA 4JYKA 4DIQA 1ZTRA 1X1AA 2EH3A 4ZC3A 1XD7A 1TQMA 1XSVA 2HTSA 1Q1VA 1YIOA 3OWTA 4WCGA 3PIOF 2XF5A 3GXOA 1W1WE 2OA4A 1YHQI 4RAGA 4FTHA 1I27A 5LGTA 4MGRA 1IO2A 3HC7A 4BJTA 3A0BC 4LK0F 3FMQA 1B8IB 3QAHA 2QA4I 2GIZA 2HEOA 1QQIA 4EM0B 1U2WA 4CCMA 5B5EC 1K83J 1ZGWA 4IL6C 5J47A 3F8CA 1Z77A 1Y1WJ 2HXOA 1VQLI 1XPXA 1WPKA 5D5UB 1MNEA 2A69F 3FBNB 1UHMA 1KU3A 2XAJA 3TO7A 4YFKF 2EZKA 1L0OC 3CQZJ 3TKYA 3S93A 4KJZA 2K9LA 2KZVA 2Y0MA 2E1MB 3MKLA 1MBGA 2MYSA 1LPQA 1ZGAA 5DCMA 4BKXA 2ZXWH 2O8XA 2CUEA 3TDUC 2BHZA 2MH9A 2ZFWA 1IAWA 4EGYA 1WVRA 3DPTA 4AYBN 1SC7A 2R93J 1DGWY 4BHBA 2EINH 2LKSA 1PYVA 1F43A 3LAJA 2PMZA 1DPUA 3X2QH 3G73A 4IX7A 4I02A 3GZ5A 1UG2A 2L7MP 1EH8A 3ISPA 1TWFJ 2KIMA 3E3VA 5J4YA 3ZXSA 5FLMJ 4ENKA 3DTIA 4HDUA 2HU9A 2HOEA 5ILUA 2P7CB 3LSJA 3HBLA 4QPQA 4N0BA 3HYIA 3M8EA 4DBQA 4CA0A 3WGIA 2EJRA 2MFZA 1AU7A 1G4DA 2VKVA 1B4AA 2JPCA 2MLKA 2EA4A 5FKMA 2HXIA 4P9FA 1S8NA 3H35A 4UVCA 1TWAJ 3PQKA 2JTVA 2JUCA 5IT9K 3DKXA 4UV9A 3I0TA 1E3HA 2LKPA 4BXUA 5GADJ 1U8BA 2R0QC 2VBWA 5LRRA 1SAXA 2DFHA 2LYCA 3DXJF 3FKIJ 1IRZA 3RPUD 2XAQA 2EFWA 5E17F 4B1RA 1SFXA 5F27A 5LHHA 1KA8A 1F5TA 9ANTA 1MNMC 2BXZA 4Y7NJ 2P5LC 2WBMA 4XKWA 3HOUJ 2R3SA 4L9VA 2YR2A 1NK3P 4IHTA 1NG6A 2COBA 1LB2A 1GXQA 1YG2A 5EJCA 4CUGA 1X4PA 4KIFA 4A6DA 1O57A 3MKWB 4HYEA 4A5NA 3E6BA 3G1MA 4PJLA 1XS9A 3IV5A 5ICGA 1G2HA 3RZDJ 4UY8I 3J7AO 2HOTA 5J4VA 1HW5A 5D8KB 2NNNA 1TT5B 2UUZA 5IT3A 3K1PA 5FRMA 4M72A 2VOOA 2R7VA 1RESA 3HEFA 4I76A 1WRJA 3ERMA 2ESNA 5M5WJ 4IJAA 2DCEA 5DD8A 1GT0C 1PUFB 1MMNA 3HOXJ 3PIPF 1ON1A 3PFYA 3S2HJ 3RPQA 3HUGA 3WTXC 4XSXF 4E7JA 2O7OA 3MFKA 2L9VA 2FQ3A 1YO5C 1TW3A 3W6KB 3UKGA 3OL4A 4A3DJ 2VKEA 5C4XJ 3KEOA 3JAMK 3G6EI 2V1XA 3K4MA 2A6EF 2XB5A 2YX4A 3EUHC 3G2BA 4B3AA 2OCCH 3DEWA 4L18B 2N8GA 1FOYA 3ZQ7A 4QSHA 1JUSA 4F92B 4GRIA 2JA8J 1U9NA 3CCVI 2ADUA 5JLWA 1W0TA 1Z6TA 5FKOA 2XAFA 3SYTA 2Z99A 2VXZA 1WSUA 1OQYA 5DTDA 1ITYA 1X4OA 2V6EA 5F0CA 1LKXA 2IP2A 2QQ9A 2F5CA 4C2MJ 3ONQA 3CJNA 4AIKA 2STWA 1A31A 4KUMA 1TWGJ 2IS2A 1BN5A 2CQKA 2V6CA 4MEXF 3CMMA 1FY7A 5CQGA 1WH7A 4CYDA 1QZYA 1SD5A 3HSRA 4A3MJ 1R5GA 5DUKA 4FISA 2A6TA 1IV6A 3OOUA 1W7PB 2GOXB 2H6BA 2WB1A 4WXHA 1VQ5I 4HF1A 3EDPA 2WC2A 3F23A 3CCRI 1TZLA 5KAFC 2KZGA 1IUFA 2MG4A 2O8KA 4B09A 1KU7A 3DQVC 2XAUA 1Z7LA 4EJVA 2HYJA 3O8GA 1WQ2A 2DQLA 4CZZA 2IBDA 1LEAA 3I4NJ 4KYWA 4G8XA 3S17J 2A6HF 3SZGA 2I10A 2HS5A 2O61A 1S6LA 2DA1A 2HDCA 2XHKA 3GMEA 3W3CA 3CJSB 4RS8A 2XROA 2FE3A 2ZBKA 3GF2A 3RKYA 1O3QA 2WAQA 4XQFA 1Y6IA 3G1LA 1Y8RB 2BHYA 1AA7A 2E60A 3FIWA 5F64A 3H92A 6PAXA 1QGPA 2L54A 2VXDA 3J7ZI 3GTOJ 1OYYA 2F6CA 4M6XA 2LC2A 2R7RA 2ZXIA 5JHUA 3M8FA 5E8GA 5J1YA 5ICFA 2Z9OA 4J01A 1R4NB 4O5VA 2JSCA 2K4BA 3IHUA 5AONA 4ZDPA 4OMZA 2V1UA 4IVNA 3J81K 1XSXA 4BE1A 2X6OA 4MQ9F 3J80Z 1XG1A 3IH3A 3S14J 2FOKA 4Q47A 1XDSA 4XLAA 3C1DA 1SD6A 2CU7A 3CDIA 3DU5A 4CDGA 2M1BA 4X0GA 3HL2A 1H8AC 4HEA2 2NRAC 1Y1VJ 3K2AA 2GXAA 3Q0WA 2DFIA 1ZRCA 5M3MJ 2QKMB 5H6QA 3CDLA 4AM3A 2M9HA 3I64A 2HR3A 4HLXA 4E4HA 4NBQA 1JXSA 3UR3C 4MLOA 4EVIA 3OS1A 2DK5A 2HFHA 3OYEA 3LA2A 5M5XJ 2QZ8A 2JVHA 2HPIA 1Z3XA 4PK4A 1BJAA 4I98B 2DXIA 2PMUA 2RNGA 1IXCA 3BTLA 4RAFA 5TRDA 4IOAF 3IAS2 2BVLA 4BDZA 5FFXA 1R00A 3E6MA 2LRDA 3BG3A 3K4NA 4ZYAA 1S72I 1FX7A 4YFXF 1W5TA 3DU6A 3V4GA 2MA3A 5DUIA 2E7XA 4M9SA 4U0WA 3S1MJ 1QZEA 2OQGA 2HVRA 1QPMA 3ROUA 2W4SA 2HYGD 2FBIA 3CCJI 5H6RA 4S0HB 4ASNA 3HIFA 2VASA 2FF4A 1ZGJA 4AVPA 2PJRA 4MFDA 4ABZA 3SFZA 4CYCB 4G7ZF 4BXXJ 4QLCU 4KIGA 1QPIA 1FMVA 5DYMA 2K3PA 3A2KA 1JT0A 2XASA 1XCBA 5E1ZB 4D7MA 1IGNA 1WGXA 4FE7A 2DFEA 4GDFA 3S16J 1ZREA 3GUDA 5C44J 1J09A 2V9VA 2E2HJ 1B1BA 3C18A 2A5YB 4JX4A 3OS0A 1S29A 1BW6A 1T98A 3CCQI 3QYFA 1BBYA 1FBQA 1DGRM 1CF7B 4LLGF 4C30A 2QYOA 3FK6A 5BPDA 5ILSA 3HOTA 3MZYA 1I6XA 3BG9A 3TOBA 5JI6A 1T0FA 3RKQA 1U0JA 3QOEA 5K1YA 3G4SI 2HI3A 4I0BA 4BH9A 1GUUA 1IZ1A 3HTSB 3Q5FA 1FMWA 1FSHA 2OU2A 4V2GA 4PFOA 2JZYA 2EZHA 1YTYA 4IRHA 1EF4A 2X1DA 3F72A 4A3KJ 3NAUA 2DN0A 1I3AA 2NS7A 1PVEA 2KIUA 3FK7A 4J19A 1S7OA 4HG2A 1RPWA 3S1RJ 2HPMA 2HOSA 1HQCA 3F21A 2DODA 3CF5F 2W7NA 1S7EA 2VKDA 4GGGA 4M6YA 1G59A 1BR2A 1RNLA 1IN8A 3K4BA 5EG0A 2CV0A 1MBFA 4HSTA 5TGTA 4NC6A 2R7UA 1FOWA 3ZMDA 4LITA 2E71A 3TP0A 2HQAA 2VLAA 2R5YA 3QOPA 3Q0VA 3CUQC 3WGGA 1TWHJ 3GFIA 1VF9A 2FA5A 2FUG2 3CC7I 3TO6A 2DPUA 1R6RA 2CO5A 3IAM2 1WJAA 3HPGA 2M45A 3B6AA 4F52A 3L2UA 2Y30A 2NS0A 2BBYA 4HBLA 1JJ6C 2KDOA 2MC4A 4UNOA 1GV2A 2XPUA 3U2RA 4M3DA 2IGKA 2MABA 1VQ6I 2DMQA 3FXQA 3H0DA 2M3AA 4OMYA 1T6SA 3GTJJ 3A03A 4MIMA 4LIUA 2L0KA 2RAEA 3IUOA 3BR1A 2I8DA 3BJOA 3ZQQA 5FD6A 1UG0A 3CMYA 3SZPA 4CHUA 2YPRA 4OIRF 4U7BA 1HLVA 4A0YA 3IRQA 4DYCA 3PL8A 4PCQA 3HSFA 1LEBA 1B9NA 2XSJC 1PUEE 1D8KA 3WGHA 2XAGA 1OYIA 2PFBA 2VJJA 4Z6YA 5FLXK 1YYVA 4PSXA 5HODA 1PP8F 1N78A 5ICCA 2FXAA 3CF2A 3GFMA 4Z2YA 4D0PA 2EBIA 2G7UA 1XMAA 2QVOA 5CPRB 4HX4A 2D5VA 1MBHA 2OZ6A 1IC8A 1T33A 2K9MA 3L9FA 2MW8A 3K2ZA 4QIWN 2XIGA 2UXNA 3WU0A 2Y0SA 2Y31A 2L5QA 1X1DA 3HKZN 3T0YA 2E5ZA 2JA5J 3ZMVA 1S5LC 2XGDA 4F7ZA 2XB0X 4II3A 4A0XA 3CLOA 4IRGA 1LDDA 2DLLA 2CUZA 1RKTA 2IXSA 3ERED 1IV8A 5DCFA 4XLFA 3S32A 2KDZA 3HJEA 3L7WA 4EQQA 1YRNA 2K7LA 2JA7J 2LG4A 3CCLI 3ESWB 2JA6J 1EV7A 1HKSA 3MD2A 2KHMA 1P4XA 1USSA 4RB0A 5BS6A 4KITB 5CLSA 4IHXA 4IPAA 3RYRA 4L0ZB 3W2AA 4PSWA 4ZZLA 5ICEA 1SFEA 4NC7A 5L3DA 2NOGA 2F5DA 4BL0B 1OCPA 1MSEC 4EGZA 5TJJA 1ZYRF 2QUFA 1JI8A 5HLIA 2ZXHA 3E1SA 3BG6A 4BE0A 3OYJA 4UUTA 1V55H 2CS3A 5CVVA 2HVSA 1B59A 3I4PA 4LB5A 4Y15A 4UB6C 3SFIA 2COMA 2FU4A 2FNAA 3M07A
chains in the Genus database with same CATH topology
4IOAF 3CC7I 1VQNI 1Y39A 3CC4I 4V19K 1VQ7I 1VQ5I 3CMAI 3CCRI 1YJ9I 1S72I 1VQ8I 1YIJI 1WIBA 5GADJ 2H8WA 1YJNI 1VQ6I 1ACIA 1FOXA 2FOWA 1YI2I 3CCJI 1VQPI 2E36A 1VQ4I 2OTLI 3PIOF 3CJSB 5DM7F 3CJTB 1YHQI 1VQKI 4UY8I 2QA4I 3CCMI 3J7ZI 2ZJPF 4IOCF 1YJWI 1VQLI 2NXNB 2OTJI 3CCQI 5DM6F 1VQOI 3CJRB 1YITI 1HC8A 3PIPF 3CCEI 3CCUI 1VQMI 5GAGJ 3I56I 3G4SI 2ZJQF 3G71I 1MMSA 3CJQB 3G6EI 2QEXI 3CC2I 2E35A 3CCLI 5JVGF 2K3FA 3I55I 1QA6A 1FOYA 5GAEJ 3EGVB 5GAHJ 2ZJRF 3CCVI 2E34A 3CF5F 3CCSI 1VQ9I 1FOWA 3J7YJ 4IO9F 3CMEI 3DLLF 3CD6I 2JQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA F;  3CC7 I;  1VQN I;  1Y39 A;  3CC4 I;  4V19 K;  1VQ7 I;  1VQ5 I;  3CMA I;  3CCR I;  1YJ9 I;  1S72 I;  1VQ8 I;  1YIJ I;  1WIB A;  5GAD J;  2H8W A;  1YJN I;  1VQ6 I;  1ACI A;  1FOX A;  2FOW A;  1YI2 I;  3CCJ I;  1VQP I;  2E36 A;  1VQ4 I;  2OTL I;  3PIO F;  3CJS B;  5DM7 F;  3CJT B;  1YHQ I;  1VQK I;  4UY8 I;  2QA4 I;  3CCM I;  3J7Z I;  2ZJP F;  4IOC F;  1YJW I;  1VQL I;  2NXN B;  2OTJ I;  3CCQ I;  5DM6 F;  1VQO I;  3CJR B;  1YIT I;  1HC8 A;  3PIP F;  3CCE I;  3CCU I;  1VQM I;  5GAG J;  3I56 I;  3G4S I;  2ZJQ F;  3G71 I;  1MMS A;  3CJQ B;  3G6E I;  2QEX I;  3CC2 I;  2E35 A;  3CCL I;  5JVG F;  2K3F A;  3I55 I;  1QA6 A;  1FOY A;  5GAE J;  3EGV B;  5GAH J;  2ZJR F;  3CCV I;  2E34 A;  3CF5 F;  3CCS I;  1VQ9 I;  1FOW A;  3J7Y J;  4IO9 F;  3CME I;  3DLL F;  3CD6 I;  2JQ7 A; 
#chains in the Genus database with same CATH topology
 4ZYD A;  1GLN A;  5FFZ A;  1WHU A;  1WH5 A;  2EIK H;  2F4O B;  5HLH A;  1DQU A;  5L3C A;  3E6C C;  2PMH A;  3LWF A;  3OYA A;  4UVA A;  4A6E A;  5DS9 A;  3JSP A;  1RR8 C;  4KT6 A;  2ME6 A;  1YIJ I;  3BR5 A;  1ETO A;  2DJI A;  2YS9 A;  4OIP F;  3H1C A;  1UCR A;  4XN3 A;  2X0L A;  2CRG A;  4ETS A;  3HRU A;  1OIS A;  3GLL A;  2VL8 A;  2KJC A;  1YW7 A;  3I4M J;  3ECH A;  4Q48 A;  1MD0 A;  5LLQ A;  4LG0 A;  1ZG3 A;  3C2B A;  3I71 A;  1JTY A;  4DYR A;  2R7S A;  1K78 A;  2OF7 A;  5IYC J;  3ZMZ A;  4A0Z A;  2Y2Z A;  4G7O F;  4FQG A;  5J1U A;  2L4M A;  2VON A;  3S1N J;  2E2I J;  4UHT A;  2GA2 A;  4GFB A;  2X6W A;  2QEN A;  1MIJ A;  3OYK A;  4NHJ A;  3MZH A;  3DBR B;  3FKJ A;  3KP3 A;  1YW8 A;  5F1R A;  3OYB A;  5HNH A;  3JRC A;  3KYD B;  4II2 A;  1M1E B;  4LMY A;  3OSF A;  2IGN A;  1ETW A;  4EV0 A;  2NXN B;  3OR2 C;  5JR3 A;  5L3B A;  1E0E A;  5AIP A;  2DMP A;  1QNT A;  1LFU P;  1BI1 A;  3F8F A;  3MWM A;  3I54 A;  5FGM A;  5HVQ C;  1BM9 A;  5HDN A;  1TTY A;  3DTE A;  2XGX A;  1IG7 A;  3K4K A;  2DA7 A;  3DEE A;  5LEJ A;  1Z1D A;  1NHA A;  2P81 A;  5TIS C;  3HXL A;  2LY1 A;  2L9R A;  3DPL C;  3RKX A;  2R92 J;  2ZME A;  4RLQ A;  3KP2 A;  4LLN A;  4XKC A;  4FE4 A;  4WK8 F;  2VOD A;  4F91 B;  1MMS A;  4G12 A;  3E97 A;  2RGV A;  4DQ2 A;  4A3F J;  1T0F C;  1R49 A;  3HRS A;  1XSD A;  1RRJ A;  3IH2 A;  3WE3 A;  3I55 I;  4M74 A;  2VI6 A;  4XLE A;  3EGV B;  1ZHF A;  4XLH A;  1CGP A;  3JSO A;  3HOY J;  4L9T A;  2H8R A;  3LSP A;  2IPQ X;  1E3O C;  1ON2 A;  3TBI A;  2WV1 A;  1R1V A;  5F0F A;  2VN2 A;  4BJ5 C;  4L0Y B;  1QU3 A;  2KIQ A;  2GM4 A;  3LA7 A;  1K7A A;  1BIA A;  3LQQ A;  2A5W A;  5IPA A;  5D4R A;  2F48 A;  2DA5 A;  5D6E A;  4CCO A;  1D0Y A;  1W0U A;  3CME I;  5LBQ A;  1QVT A;  4B3X A;  1MBK A;  3Q3S A;  4XIC A;  1YQA A;  3FXJ A;  4N4O B;  4I6Z A;  2B63 J;  4G94 A;  1JGG A;  1TP4 A;  2L3D A;  2HDW A;  3DP7 A;  1HSJ A;  2QBY A;  2WAE A;  3KX2 A;  2K9S A;  2P5K A;  3ZN1 A;  2VQC A;  4LG3 A;  1HCR A;  1LDK B;  2HWV A;  3O2P E;  4E7S A;  1MDM A;  3MCZ A;  1HBX G;  2W1O A;  2QCO A;  4CGZ A;  4UB8 C;  3KIO A;  3VWB A;  3TO9 A;  2Q2E A;  2VJI A;  2DT7 B;  5FRN A;  1V4R A;  2LFB A;  2IVM A;  1BR4 A;  4E7K A;  1OFC X;  2RNJ A;  1PP7 U;  5EDN A;  2KRF A;  4KN7 X;  3PO3 J;  2FX0 A;  2V9P A;  3W6V A;  1Z0X A;  1Z9C A;  4BY7 J;  2R5Z B;  2HGC A;  2IA2 A;  4AU7 A;  3ZMS A;  4A3L J;  3OYN A;  1IRF A;  1QVU A;  1B8I A;  4BGD A;  1D1B A;  5HLG A;  3BWG A;  4RLF A;  1DDN A;  1YOV B;  3SHF A;  4KNY A;  3HHH A;  3L2C A;  5EYR A;  2VC0 A;  2K4J A;  4BY1 J;  3CP8 A;  3PJR A;  2DTZ A;  3VFZ A;  1IUY A;  3RTR A;  3L1P A;  3RCO A;  3FM3 A;  2DYS H;  3ASO H;  3OMY A;  2FEZ A;  1VQO I;  3K4L A;  3A0H C;  2M5W A;  4XRS A;  3H5A A;  2AXL A;  2WV0 A;  2JT1 A;  4LJZ F;  4BS9 A;  2C6Y A;  3SEQ A;  3UNG C;  2D2W A;  3ZQG A;  1HC8 A;  4AC0 A;  3OYL A;  4ESB A;  4M73 A;  3K1M A;  1FYL A;  4WXC A;  2FML A;  1NG7 A;  1SVL A;  3CUQ B;  2A07 F;  4OIO F;  5J3L A;  1YLF A;  4IRI A;  3TP3 A;  2HZT A;  3RJP A;  3DBL B;  3OYM A;  4G9Y A;  1R9T J;  2D1V A;  3ZMT A;  4OAY A;  2VJ4 A;  1BIB A;  1R23 A;  5KHD A;  3A02 A;  2E2J J;  1F36 A;  3TED A;  1O4X A;  1U8R A;  1YX3 A;  2G0E A;  3GWZ A;  3KEY A;  1JHH A;  2W00 A;  3LQR A;  1D5Y A;  3O8H A;  4RA2 A;  4MQV A;  2HQN A;  3S8P A;  1H9T A;  2E34 A;  2V7F A;  3NQO A;  1BA5 A;  3IC7 A;  3GTM J;  3GFJ A;  2YU9 J;  1TW2 A;  1LVA A;  2DA6 A;  2XPW A;  3JTG A;  3SXY A;  2FBH A;  3HZJ A;  1ERD A;  3FWE A;  3J80 K;  3JRI A;  3G3Z A;  1IXS B;  4RB3 C;  1ZG5 A;  1B9M A;  1FIP A;  3SDB A;  3E5U A;  2Z16 A;  4HA8 A;  2Y9Y A;  3MKY B;  4BNC A;  2OPT A;  2CQ7 A;  3HOW J;  4CZC A;  1MJA A;  3WTY C;  3HSE A;  1XMK A;  2Z3Y A;  2FNP A;  4QPO A;  4IF4 A;  2Z1D A;  2JRM A;  2GA1 A;  3FHN A;  2X1E A;  2JMW A;  4V19 K;  2Q1Z B;  1WJD A;  2VBX A;  1VQ7 I;  3I5U A;  3OYD A;  1W5S A;  4IXA A;  4RAY A;  3L2V A;  2ESH A;  1O3R A;  1HW2 A;  1R7J A;  1SFO J;  4I99 C;  2LD5 A;  3BCA A;  4NC8 A;  3BG5 A;  4HNT A;  4BAY A;  2VQL A;  3ASN H;  4XM3 A;  2K27 A;  3PUF A;  2LRE A;  2O03 A;  1MGT A;  4G6T B;  1U5T B;  4WXD A;  1LFP A;  3GVA A;  3BR6 A;  5DD4 A;  4A3C J;  4NDL A;  3ZRG A;  3OSG A;  4BHC A;  4UUS B;  5FKN A;  4GYG A;  3WTT C;  3AL0 C;  4ZYH A;  1Z3Y A;  3R4K A;  5J40 A;  1P9Q C;  3K9T A;  1OPC A;  4Q5S F;  4LIV A;  2M30 A;  2FBK A;  3IRR A;  4RGU A;  5LGN A;  4BUP A;  1TC3 C;  1TT0 A;  5IT9 Z;  1A04 A;  3JCU C;  5ED4 A;  1J9I A;  1PUF A;  1XX5 A;  2QQA A;  2O3F A;  1STZ A;  3CJR B;  3T5X A;  2CV1 A;  4XON A;  3FXL A;  2HTJ A;  4DZP A;  3I58 A;  2OZU A;  2R4G A;  3FMS A;  2QQB A;  3AKZ A;  3V7S A;  1QHG A;  3GTP J;  3V8L A;  4HX8 A;  4P55 A;  2E1N A;  3R0J A;  2KIF A;  2EA2 A;  4PJ0 C;  2O9L A;  1P92 A;  2CYY A;  3OR1 C;  1ONV A;  1XMX A;  5GP9 A;  3L2R A;  3PNY A;  4JP0 A;  2WY8 Q;  3GTK J;  3FXU A;  3BR2 A;  3RQI A;  5GAH J;  2R7X A;  4DYQ A;  1P4A A;  1ZN2 A;  2MC3 A;  1O7F A;  4EJW A;  4KN4 X;  4XLC A;  1KGS A;  5H20 A;  2RDP A;  1J75 A;  1KQ0 A;  2MLG A;  3VDX A;  4C2U A;  3V7R A;  2LNB A;  4BXF A;  2ZXJ A;  1ZEL A;  1HW1 A;  2VE9 A;  5EGO B;  5FD5 A;  3CD6 I;  2ZO4 A;  1GDT A;  2P8T A;  5D8L B;  3G1O A;  3TL4 X;  1BL0 A;  1R71 A;  2AHQ A;  2IS1 A;  3H5N A;  1W7P A;  2EV0 A;  3OL3 A;  2XGC A;  3CC4 I;  3S3N A;  3K4J A;  4C2T A;  4Y52 J;  1MJ9 A;  1SVM A;  1R22 A;  3A01 B;  3CUO A;  5LD2 C;  2LVS A;  2DA2 A;  1TWC J;  2MSY A;  1YFH A;  3KYL A;  4DZJ A;  1BI2 A;  4NB5 A;  4A69 C;  4V2F A;  1XC5 A;  4AYB A;  3JAM Z;  4HF2 A;  4PGG A;  2O0Y A;  2YX7 A;  4XL9 A;  3K0L A;  3B73 A;  2PJP A;  4JX5 A;  4XR6 A;  3P9K A;  3VSK A;  3H3Z A;  4C3H J;  1G3S A;  1ACI A;  5F08 A;  1WZ2 A;  3K1N A;  4IQ4 A;  3TDZ C;  3BR3 A;  3C2H A;  5FB2 A;  4KDP A;  3E5X A;  3FDY A;  5BNG A;  1OMI A;  2E36 A;  4I0A A;  4HV5 A;  2UZK A;  2F4M B;  2F5V A;  5DM7 F;  2LMD A;  2BY2 A;  2QSF X;  2XSD C;  2NVY J;  2MD0 A;  1ETV A;  4HV6 A;  2D45 A;  2CV2 A;  2EZI A;  3I59 B;  5E8I A;  3F22 A;  2DMU A;  3R0A A;  3VOE A;  3SJM A;  1IRG A;  2R7W A;  2H94 A;  4NUB A;  3QQA A;  2MH2 A;  1E3P A;  1VND A;  2M4K A;  3TOA A;  3DKY A;  3F6V A;  1I3Q J;  4X6A J;  2XAH A;  2OTJ I;  3FXO A;  5FRO A;  1MH3 A;  5B66 C;  3ZMU A;  1J7K A;  1YE9 A;  2EZL A;  3T1B A;  1DP3 A;  2A68 F;  5D5X B;  4J00 A;  1D3Y A;  1YIT I;  3CP2 A;  4HZF A;  3JRE A;  2R7D A;  4FET A;  3DFG A;  1OCT C;  1FP1 D;  2OQR A;  3N97 A;  2K40 A;  1N77 A;  3I56 I;  1W36 D;  2YSR A;  2E1M C;  4M71 A;  1AKH B;  3E6D A;  3PUB A;  1WI9 A;  4K2E A;  1JUM A;  3LSM A;  2QEX I;  3Q9S A;  3W6J B;  2R5Y B;  3LNQ A;  3GZ6 A;  1LQ1 A;  3KLO A;  1Z6R A;  5JVT A;  4DNC A;  3AFH A;  2Y48 A;  1KU9 A;  2L2O A;  1W36 C;  5A2Q K;  1XTA A;  2QM3 A;  2ZJR F;  2WAD A;  3LFK A;  2NVX J;  3PM1 A;  1ZG1 A;  3FM5 A;  3C7J A;  1QZZ A;  2QGU A;  4CSW A;  2GLO A;  4ZH4 F;  3GX4 X;  2BV6 A;  5HDK A;  3OYI A;  1IN4 A;  3GTG J;  1MMD A;  5F04 A;  2A3S A;  4E7Z A;  1AHD P;  2LY2 A;  5IOY A;  5CQE A;  3MZ8 A;  2OJE D;  4A3B J;  2ECC A;  3DWL E;  5E20 A;  3JTH A;  4I2O A;  3JRD A;  2DTR A;  2IS4 A;  4G7H F;  1JJ8 C;  3QOD A;  4TV7 A;  4C9Y A;  4HNU A;  5LEK A;  3M7G A;  3ML6 A;  4YFN F;  2XC7 A;  3BPX A;  2JVG A;  3P9I A;  3HG9 A;  3OOP A;  1JTX A;  5CYV A;  2E1O A;  3LOC A;  2NVU B;  4HDV A;  3J81 Z;  4XBF A;  3BCB A;  4HX7 A;  5K5R A;  1GVD A;  2CQX A;  2L7K A;  4JX6 A;  3V42 A;  3WTU C;  3IKT A;  1A36 A;  3JRH A;  2X1C A;  1O3T A;  3ZCO A;  1S9H A;  2E1C A;  2B9S A;  3ZQC A;  3EYY A;  2VIX A;  2BVM A;  2X85 A;  3FZV A;  3KYC B;  2P6T A;  2K86 A;  4M3G A;  1V54 H;  3QWL A;  1L3L A;  5FLV A;  1RZ4 A;  2DAO A;  3WTZ A;  5DDG A;  1UJ8 A;  1MMG A;  2KPM A;  2BE5 F;  1X3Z B;  1POG A;  4L5E A;  1QBJ A;  2PMZ N;  1IDY A;  4FAS D;  2BW3 B;  1REP C;  2V1N A;  5KVR A;  3I53 A;  1T08 B;  3A1Y A;  2JUG A;  2ZNZ A;  2DOE A;  4U0Y A;  2RVC A;  4WWC A;  2EV5 A;  1TL8 A;  1AWC A;  4BHP A;  3LSK A;  4B48 A;  4DJA A;  2OBP A;  5GPA A;  1LJ9 A;  2TCT A;  4PUS A;  3CO7 C;  1SVO A;  2TDX A;  2F2E A;  1OLT A;  4D5F A;  1LE8 A;  4XRS G;  2KMU A;  1OKR A;  1MSF C;  2IW5 A;  1XDU A;  3JRB A;  2BEO A;  2HQR A;  3PQJ A;  1KON A;  1KQ8 A;  1UHW A;  3CES A;  5CVJ A;  2FRH A;  4CO8 A;  2HKO A;  3BRO A;  4JK1 X;  1J0R A;  2PBI A;  2CQQ A;  3DV8 A;  3IKV A;  1K4T A;  3CCY A;  5B1A H;  4IHY A;  2ZJ2 A;  4AIH A;  2JPB A;  5GAG J;  3MN2 A;  4M6V A;  1BR1 A;  1V5F A;  1VTN C;  3D5R C;  1EKE A;  4KMF A;  4IHS A;  2GXB A;  2E35 A;  5L3E A;  3BQZ A;  2W25 A;  3HPH A;  2JN6 A;  3BZ6 A;  4CIC A;  2Z33 A;  2BXY A;  3IH4 A;  3J7A Y;  2LBF B;  3FX3 A;  2MGQ A;  4BU2 A;  2TRT A;  4OIN F;  5BMZ A;  5K7H A;  1FOK A;  3U9G A;  1FYK A;  4ZYG A;  4GCV A;  3DF8 A;  2ELH A;  5ERI A;  5BPI A;  2PEX A;  2R7Q A;  3T8T A;  4W97 A;  5EEG A;  4AWX B;  5D5V B;  3WOD F;  3NAR A;  3VYU B;  3F0C A;  3KEQ A;  3LST A;  3JRG A;  2XF6 A;  1O7L A;  2LKX A;  2H6C A;  2GQQ A;  1RUO A;  1W7P D;  4DW6 A;  3WG7 H;  1KYZ A;  1K78 B;  5ILV A;  2CQN A;  4EM1 A;  4M3E A;  1BI3 A;  2VB6 A;  3AL0 B;  1X2N A;  4RBO A;  3TMO A;  3KET A;  3GLX A;  3OYF A;  1U9O A;  1WIB A;  2LY9 A;  2GZW A;  5D4S A;  1K6Y A;  3M3Y J;  5B1B H;  1Y56 A;  3M1C A;  3Q9V A;  3QPL A;  2MD5 A;  1TNS A;  1DPR A;  1KU2 A;  4EAT A;  2NYX A;  1K61 A;  4MO7 A;  3BLY A;  4CXF A;  2FOW A;  1OYW A;  1R5I D;  4OIQ F;  3DBH B;  4E7I A;  3MQ0 A;  2H1K A;  2V79 A;  3B6C A;  2LF7 A;  3HB9 A;  4MEY F;  4E7L A;  3FF5 A;  4ENJ A;  3JR9 A;  1ODD A;  4NQW B;  2XVC A;  3HTU A;  3BJ6 A;  2IEK A;  1I5Z A;  2VPR A;  5E1X A;  4A3J J;  3CJT B;  2F4I A;  4O6J A;  4KIS A;  3WHC A;  2EWN A;  2X6X A;  3WE2 A;  4CCN A;  2HVQ A;  2XDV A;  3OS2 A;  4E70 A;  2P7V B;  4GXO A;  1FNN A;  3VPR A;  2VPL A;  1IDZ A;  1X1P A;  1LDJ A;  3BZK A;  2CGP A;  2ZJP F;  3HOZ J;  2Y69 H;  4A5M A;  4IOC F;  4BEH A;  3ZP5 A;  1SAU A;  1ETY A;  1UST A;  3FXR A;  3H9Q A;  3GFL A;  2X6Y A;  1RET A;  4AVZ A;  5LHI A;  5L3F A;  3CZ6 A;  1I39 A;  3K70 D;  2DYR H;  4C3J J;  1GHC A;  1OCC H;  1X3W B;  5LHG A;  4N4N B;  3BQY A;  4FX4 A;  2WB1 N;  3CCE I;  1SMT A;  2ECB A;  2YU3 A;  3Q0U A;  1VQM I;  1TNT A;  4BJ6 C;  4U7D A;  4AIJ A;  1XGN A;  1XB4 A;  2RKH A;  5DCM B;  2O6G E;  3K70 C;  4PDK A;  2M0M A;  4ON0 A;  3REO A;  4Q4Z F;  2BY1 A;  4EJU A;  3EET A;  2QSH X;  1J2X A;  4Y33 A;  2DBB A;  2ME0 A;  5GTI C;  1R1T A;  4XKV A;  2IJL A;  1UB9 A;  4HSR A;  5D5W B;  2GIV A;  3MAJ A;  2W84 A;  3O6B B;  2AQF A;  1XCV A;  2CFO A;  2HQ5 A;  2XV4 S;  1GV5 A;  1XGS A;  4LD5 A;  1ZAO A;  3RZO J;  2LSO A;  1MDM B;  1WJE A;  2WAQ N;  2K85 A;  2D1H A;  4DBR A;  5FLX Z;  4XSZ F;  3HOS A;  5EEH A;  2R7O A;  1VQ9 I;  4EM2 A;  3S3O A;  4IO9 F;  4L5I A;  2DOA A;  2Q2E B;  1YS7 A;  1UZC A;  4EJO A;  4BAC A;  4BBS J;  5H2F C;  1X58 A;  3VYT B;  5J1R A;  4YEJ A;  1NK2 P;  4OAZ A;  2LF8 A;  3RYP A;  1G8X A;  4HNV A;  1SAN A;  1OCR H;  2NS8 A;  4RM3 A;  5L3G A;  2ZNY A;  3F6O A;  2Q0O A;  1XGM A;  5KCM A;  4MNU A;  4HLY A;  4UV8 A;  2BOL A;  4Y3O A;  1I6H J;  4KIC A;  1FC3 A;  1FYM A;  4N9I A;  5FJ8 J;  4KT5 C;  2CW0 F;  5K7Z A;  2H27 A;  4ESF A;  2PI0 A;  2VUM J;  1KZH A;  2R7Z J;  2P6S A;  5KK1 A;  2RQQ A;  1XGO A;  5IOZ A;  1HOM A;  4JBA A;  2V1D A;  1A6I A;  5DEQ A;  2CSO A;  1J5Y A;  3K6G A;  2DT5 A;  2PN6 A;  2UV1 A;  1RKW A;  2DA4 A;  5FKL A;  1ZAR A;  4A2U A;  1EJ9 A;  2Y9Z A;  1KQ9 A;  1F1Z A;  2CG4 A;  2QSG X;  4HRI A;  3E5Q A;  5LGU A;  3HRM A;  5CVI A;  2FSW A;  2VC1 A;  4FHT A;  4DOZ A;  5JHF A;  3CTA A;  3QPT A;  2QKL B;  3IWF A;  4YRV A;  2VBY A;  4ZTJ A;  3DEU A;  3N05 A;  2KT0 A;  3TW6 A;  5HLT A;  1E17 A;  3V7C A;  1FEX A;  1B72 A;  4IHW A;  1PDN C;  2E19 A;  2DOF A;  1T39 A;  5EF6 A;  2QLZ A;  4RM2 A;  3L2Q A;  3CO6 C;  4BQN A;  3U1D A;  5LRS A;  1DUX C;  3W2V A;  2ZSI B;  5B3S H;  1Q1H A;  2CWE A;  1T38 A;  4JQF A;  4Y13 A;  4ZDO A;  5E3M A;  1QO0 D;  2LP0 A;  5K5Q A;  3F8N A;  2O5R A;  4ZJZ A;  1A6Q A;  4B44 A;  2DI3 A;  3FXM A;  2OAZ A;  1DP7 P;  1G6N A;  4YG2 F;  2AS5 F;  2HOA A;  2L7Z A;  1FWZ A;  2EFQ A;  4B47 A;  3CCU I;  1ZR2 A;  3HUG B;  4PJM A;  1VZ0 A;  2RQP A;  1SD7 A;  1PJR A;  2W24 A;  4UUV A;  1IN6 A;  2VT3 A;  2CFX A;  2I5U A;  1BOB A;  1ETK A;  5F0H A;  4N9H A;  3VYS B;  4M9X A;  2WY7 Q;  3GO5 A;  2XKP A;  2AXT C;  2KKO A;  1IRX A;  2IGO A;  1MND A;  3BDD A;  1V5G A;  4FT8 A;  3VSL A;  1WFX A;  2G7H A;  2H09 A;  1FLI A;  3LFU A;  1ETX A;  3HOV J;  5F1J A;  1E2X A;  2CW7 A;  3BTI A;  1X19 A;  3CDH A;  1UAA A;  3L09 A;  1ZLJ A;  2CUJ A;  2ZB9 A;  3TW7 A;  4GYI A;  1NH3 A;  4EJT A;  1Z05 A;  3ZQF A;  3WTV C;  4IHV A;  2M8E A;  1SFU A;  4WF2 A;  1FZP B;  4ZDL A;  3IP4 B;  3P5J A;  2IA1 A;  5J8F A;  3PO2 J;  1HKT A;  3RSN A;  4XLP F;  1SMY F;  2KJB A;  3HDD A;  1Y39 A;  3ULQ B;  3HKZ A;  4XRF A;  1P6R A;  1ULY A;  2DT6 A;  4H4K C;  1EH6 A;  4HQE A;  1H0M A;  5GTH C;  3SDG A;  2DDB A;  2VE8 A;  3C3W A;  2K5C A;  1MJB A;  3K7A J;  1Y0N A;  4OOI A;  5LFA A;  2L02 A;  1H89 C;  4R1H A;  2DU9 A;  1HF0 A;  1U3E M;  1DU0 A;  1I50 J;  3B02 A;  3OV8 A;  1U6G A;  2IS6 A;  3I9V 2;  1YI2 I;  2LR8 A;  4P9U A;  2KQR A;  4B8X A;  2EIL H;  5KNL A;  1GXP A;  5IYD J;  3E0J B;  2A05 A;  2V4J C;  2EFP A;  1FPQ A;  3LMM A;  1QHH D;  3LSH A;  5BQT A;  2ACJ A;  1VQ4 I;  4O3M A;  3FMR A;  1ZQ3 P;  2R5Z A;  3W2W A;  1WI3 A;  2BYV E;  2J5P A;  3GCM A;  4MHG A;  3VOD A;  5J8C A;  3JRA A;  1IN7 A;  2EV6 A;  2WTE A;  3H9J A;  3GTL J;  2DMN A;  3EUA A;  3M1E A;  4YII A;  3GW2 A;  1HST A;  3NRV A;  3O3K A;  4D9J A;  3CCM I;  4OU0 A;  3IWZ A;  5E1W A;  3P7N A;  2LLK A;  2BZT A;  3WG9 A;  2IRF G;  1X1C A;  3EPZ A;  2WAF A;  4U88 A;  4A93 J;  4OWR B;  4Y17 A;  5CKT A;  1D1C A;  3AG3 H;  1HA8 A;  5IP7 J;  2ISZ A;  5HS9 A;  1BJZ A;  3F3X A;  4MTD A;  1T8I A;  4ESJ A;  1G3T A;  3ZR8 X;  1LUJ B;  1FT9 A;  2W82 A;  3AG1 H;  2BGC A;  2HYF A;  2KL4 A;  3CUQ A;  3OY9 A;  4XNF A;  2JK3 A;  1ZRF A;  4RB1 A;  3G71 I;  4Y4R A;  2WA0 A;  4BBR J;  2CW8 A;  4LOC A;  3AAF A;  2IAI A;  1Z7U A;  1R5H A;  3LSR A;  2Z5U A;  2K3F A;  2ELK A;  2K9Q A;  2KP6 A;  2W85 A;  1RUN A;  3K69 A;  4QTR A;  2HDD A;  4MTE A;  4A3I J;  4RGS A;  4HF0 A;  1R4M B;  3BR0 A;  3S2D J;  2KRH A;  2MBF A;  4F93 B;  3OIO A;  1P7I A;  1BI0 A;  4U87 A;  3BJA A;  1W5C C;  2GAU A;  3DPU A;  4R8H A;  3IL2 A;  4XOT A;  1FTT A;  3RDI A;  1V5E A;  2AO9 A;  4AD9 A;  3J7Y J;  2LDU A;  4XKB A;  5M3F J;  1WJC A;  2KRC A;  4I09 A;  4G6D A;  2EK5 A;  2ZME C;  1FP2 A;  1GVJ A;  2W48 A;  3EUK L;  4RMN A;  2H1L A;  3QP5 A;  1FTZ A;  3BTJ A;  1WJB A;  1W4M A;  5GPC A;  3FHZ A;  3LSG A;  4XOP A;  1BC7 C;  4LFU A;  4IQJ A;  1YJ9 I;  1VQ8 I;  2FD5 A;  2EFN A;  5CVR A;  4KMU X;  2IT0 A;  4XRM A;  2Y0S N;  1YJN I;  3R61 A;  1F4K A;  1X2M A;  2R7F A;  3BZC A;  2E5N A;  2L01 A;  3DCF A;  5IYB J;  2VOP A;  2PLY A;  4IZZ A;  2ZC2 A;  1YS6 A;  2BY0 A;  3PNT A;  5J6X A;  1U5T A;  1D0X A;  2VBZ A;  2OC6 A;  3AG4 H;  1TBX A;  2K02 A;  4F55 A;  2DDA A;  2XF7 A;  2PJR B;  5HOO A;  5HS7 A;  1OCO H;  4HOB A;  4XLN F;  2GBY A;  4UUS A;  3KZY A;  2L4A A;  4P1W A;  1UHS A;  3LA3 A;  5CJ9 A;  4B43 A;  1IXR C;  1N75 A;  1DU6 A;  4ENN A;  1B6A A;  2DPD A;  2VKH A;  4JOM A;  2GWR A;  1TQI A;  2XKO A;  4M3B A;  4CH7 A;  5IP9 J;  1ZR4 A;  1MH4 A;  2XRN A;  3ZQH A;  5BOX A;  2CH0 A;  1ZK8 A;  1MZB A;  3ABL H;  3V8K A;  2F5F A;  4UVB A;  2DA3 A;  2VQH A;  1RI7 A;  1G3W A;  2KIS A;  2RRE A;  4RAZ A;  3N4M A;  1MKM A;  1YX5 A;  2W57 A;  2KFD A;  2L9S A;  3NEU A;  2OCE A;  2OD5 A;  2X9D A;  2NNY A;  3BG7 A;  4BYY A;  4HQM A;  2HNH A;  3NWS A;  1LVK A;  1S7A A;  4KIB A;  2X51 A;  3ZPL A;  3ABM H;  3VB2 A;  1HKQ A;  1Z67 A;  4ENM A;  2VJ5 A;  1K6O A;  1K79 A;  4LB6 B;  2F5E A;  2ZSH B;  2ZJQ F;  3TGN A;  4HAM A;  4A3G J;  3D1N I;  2FQ4 A;  3VYR B;  4I01 A;  1JKR C;  1FJL A;  3FIS A;  1RR7 A;  2RV8 A;  1ORK A;  2ETH A;  2R7T A;  1Z21 A;  1T56 A;  5GAE J;  3V8J A;  1D8J A;  1VI0 A;  1Y0U A;  5EEA A;  2UWM A;  1JE8 A;  3ZQL A;  3M8J A;  4ANJ A;  2QF7 A;  2NVT J;  5E3N A;  3JW4 A;  5DV5 A;  1JUP A;  4RGX A;  2HKX A;  2EQR A;  2GXG A;  1HXD A;  2M0C A;  3L2W A;  3WTW C;  3PSI A;  2EFO A;  5EG0 B;  2FJ1 A;  5EGO A;  3S15 J;  3OYG A;  3SQN A;  3DLL F;  3S3M A;  4FX0 A;  4RGR A;  2JQ7 A;  2DQR A;  3F8M A;  2B0L A;  1LNW A;  3WU1 B;  4FCY A;  4KA4 A;  4CCK A;  5HS8 A;  4M3F A;  2GOM A;  3A01 A;  3BY6 A;  2M7B A;  1OR7 A;  4P5O A;  1FSE A;  3ZOB A;  2ZCW A;  4ZZD A;  3TQN A;  1BW5 A;  5HNF A;  2H8W A;  3H36 A;  3PFI A;  4E6K G;  4F3Q A;  1JKP C;  3BC8 A;  3QPS A;  2G9W A;  1HDD C;  2OUM A;  3ELK A;  1NTC A;  1TQP A;  3SEZ A;  3L00 A;  2NAZ A;  1FOX A;  4G6Q A;  5E3O A;  4YIR X;  1LE8 B;  3WTS C;  3WU2 C;  2M4G A;  2STT A;  1ZKG A;  4YIF A;  4XMY A;  3OYH A;  1IJW C;  4U0V A;  3QP6 A;  1YW9 A;  3KLN A;  1FIA A;  2OTL I;  3QU3 A;  4RDU A;  1VQK I;  2XPV A;  4A3E J;  2RC4 A;  3U1K A;  2RN7 A;  1H88 C;  5IY5 H;  1Y8Q B;  3I59 A;  3PSF A;  3HGY A;  1V3F A;  1MW7 A;  2XRL A;  3KZZ A;  3R6S A;  3SZT A;  4L9N A;  1J59 A;  2UXX A;  4D5C A;  2DJN A;  1Z91 A;  3ZN0 A;  3H3U A;  2CJJ A;  2QQ8 A;  1OCZ H;  1P2F A;  1OJL A;  4L9J A;  2NOJ B;  2E7W A;  2M34 A;  5DM6 F;  3LL7 A;  4X1E A;  4CYC A;  4DGW B;  3KFW X;  5M5Y J;  3CLQ A;  4BQO A;  4YEL A;  2L9N A;  2JJ7 A;  1P4W A;  4LK1 F;  5K7F A;  3HM5 A;  3K4C A;  1RC9 A;  3PNV A;  4I7H A;  3T8R A;  3HGG A;  1AKH A;  2V9K A;  3U21 A;  2LOO A;  3QRF F;  3CJQ B;  2ZFU A;  4NNJ A;  2LH9 A;  2PQ8 A;  3QU6 A;  3DKW A;  4BQQ A;  4PZJ A;  3S1Q J;  3MMY B;  3MKZ A;  1YRN B;  5C4J J;  1JT6 A;  5HDG A;  5FKK A;  5JVG F;  2LK2 A;  4XID A;  1CF7 A;  5EZH A;  4BDY A;  3R60 A;  4EEF G;  1CQT A;  1HDP A;  1FBU A;  1WKM A;  1SFK A;  1QRY A;  3FBI B;  5E18 F;  1WJF A;  1FBS A;  3BT9 A;  5JLX A;  2Y75 A;  3WHB A;  2CUF A;  1UMQ A;  1EA3 A;  2DW4 A;  1RIO H;  2X4H A;  3HHG A;  3KE2 A;  2PG4 A;  1JGS A;  1APL C;  3GBG A;  4XN0 A;  5IP6 A;  4IEJ A;  2M2E A;  3HRT A;  1TLH B;  4HPQ A;  2NVQ J;  1H9G A;  3COA C;  3OIQ A;  3ABK H;  3QYE A;  1VQN I;  3KP6 A;  2IGM A;  2P4W A;  3RKW A;  2ID6 A;  3A4C A;  1ETQ A;  3NWT A;  2ICW G;  2WWY A;  3H9G A;  4XK4 A;  3D0S A;  2OV7 A;  4PJN A;  5JFR A;  2DK8 A;  4MFE A;  2ELJ A;  2ID3 A;  5F6F A;  2JA2 A;  4C3I J;  2P5V A;  1UFM A;  1BOA A;  1XN7 A;  2Z2S B;  1MMA A;  3JRF A;  4W1U A;  2B7E A;  2J5O A;  4PGH A;  1SD4 A;  4BEH B;  1IN5 A;  4M9Z A;  3RPU A;  3S2W A;  3GYH X;  1P7J A;  4LG0 B;  4QWQ A;  2M8G X;  5A2Q Z;  4LLL A;  2BW3 A;  4AUX A;  4R79 A;  1VQP I;  1IW7 F;  2V26 A;  3AG2 H;  4EMS A;  3VEP A;  2ISY A;  1R58 A;  3MEX A;  1U5T C;  2PX9 A;  3F8B A;  3F9K A;  4HW0 A;  3ECO A;  4WX9 A;  1MBJ A;  4KFC A;  2JWT A;  3ZGK A;  5FO5 A;  4A12 A;  1ENH A;  2IA0 A;  2LTP A;  3RIR A;  4D1Q A;  2DMT A;  3QYB A;  4BQA A;  5AIQ A;  3K10 A;  1JKQ C;  2Q8K A;  2VT2 A;  3BTC A;  4L5J A;  1BC8 C;  2QWW A;  1AOY A;  4ZYE A;  1YJW I;  1D1A A;  3E7L A;  3GZN B;  1C0W A;  1R36 A;  2EB7 A;  2BY3 A;  3MVP A;  1X1B A;  3P9C A;  2EIJ H;  2ZKZ A;  1K4S A;  1I1S A;  3KP5 A;  2DO7 A;  3I3L A;  3KP4 A;  4IKF A;  4AID A;  1WWX A;  3DTK A;  1MBE A;  2M87 A;  1G3Y A;  2JRT A;  2YUS A;  3EUH A;  1LFB A;  3BPV A;  4S05 A;  2CMP A;  2ZME B;  3ZQI A;  1WCM J;  2EPF A;  5K5O A;  3LAP A;  4PJJ A;  1SEU A;  3CC2 I;  3GEZ A;  1T95 A;  4PFP A;  1O3S A;  2L7F P;  1A35 A;  5E79 C;  1A5J A;  2LBF A;  1QA6 A;  2JSP A;  2FMY A;  5E3L A;  3GTQ J;  4P96 A;  3EQL F;  3C2G A;  1X3U A;  3KZI C;  2DFF A;  2K9N A;  5KAI C;  2EIM H;  3KCC A;  3CCS I;  2VQG A;  4ITV A;  4XOR A;  2HZD A;  1ZRD A;  1IF1 A;  4LGW A;  1N25 A;  5EZG A;  1F9N A;  4UXN A;  1WJ5 A;  2X48 A;  2A61 A;  3ABU A;  2XUB A;  1EH7 A;  3EYI A;  3DLA A;  3OIP A;  4CCL A;  3RI4 A;  3H3V K;  1D5V A;  1R1U A;  3D5S C;  3FXK A;  3ABT A;  3BOQ A;  1D0Z A;  3KPH A;  4E7H A;  4ZTF A;  3H0G J;  1S3J A;  3M9A A;  1JKO C;  4GO1 A;  2P0W A;  3KP7 A;  4S04 A;  2AQE A;  3LSI A;  3RQ4 A;  3CMA I;  2QBY B;  4B4C A;  1KYW A;  3H5R A;  5C3E J;  1I1G A;  1UEL B;  4RB2 C;  3D5L A;  3OYC A;  2M7A A;  1U78 A;  5CVU A;  1OR7 C;  3BP8 A;  2KLO A;  3QPH A;  3M4O J;  1B72 B;  1JHF A;  4H0E A;  4BE2 A;  2XGE A;  4D7N A;  1ZH5 A;  4CCJ A;  1ZLK A;  1T2K A;  1VFC A;  4NQW A;  5D6F A;  4JYK A;  4DIQ A;  1ZTR A;  1X1A A;  2EH3 A;  4ZC3 A;  1XD7 A;  1TQM A;  1XSV A;  2HTS A;  1Q1V A;  1YIO A;  3OWT A;  4WCG A;  3PIO F;  2XF5 A;  3GXO A;  1W1W E;  2OA4 A;  1YHQ I;  4RAG A;  4FTH A;  1I27 A;  5LGT A;  4MGR A;  1IO2 A;  3HC7 A;  4BJT A;  3A0B C;  4LK0 F;  3FMQ A;  1B8I B;  3QAH A;  2QA4 I;  2GIZ A;  2HEO A;  1QQI A;  4EM0 B;  1U2W A;  4CCM A;  5B5E C;  1K83 J;  1ZGW A;  4IL6 C;  5J47 A;  3F8C A;  1Z77 A;  1Y1W J;  2HXO A;  1VQL I;  1XPX A;  1WPK A;  5D5U B;  1MNE A;  2A69 F;  3FBN B;  1UHM A;  1KU3 A;  2XAJ A;  3TO7 A;  4YFK F;  2EZK A;  1L0O C;  3CQZ J;  3TKY A;  3S93 A;  4KJZ A;  2K9L A;  2KZV A;  2Y0M A;  2E1M B;  3MKL A;  1MBG A;  2MYS A;  1LPQ A;  1ZGA A;  5DCM A;  4BKX A;  2ZXW H;  2O8X A;  2CUE A;  3TDU C;  2BHZ A;  2MH9 A;  2ZFW A;  1IAW A;  4EGY A;  1WVR A;  3DPT A;  4AYB N;  1SC7 A;  2R93 J;  1DGW Y;  4BHB A;  2EIN H;  2LKS A;  1PYV A;  1F43 A;  3LAJ A;  2PMZ A;  1DPU A;  3X2Q H;  3G73 A;  4IX7 A;  4I02 A;  3GZ5 A;  1UG2 A;  2L7M P;  1EH8 A;  3ISP A;  1TWF J;  2KIM A;  3E3V A;  5J4Y A;  3ZXS A;  5FLM J;  4ENK A;  3DTI A;  4HDU A;  2HU9 A;  2HOE A;  5ILU A;  2P7C B;  3LSJ A;  3HBL A;  4QPQ A;  4N0B A;  3HYI A;  3M8E A;  4DBQ A;  4CA0 A;  3WGI A;  2EJR A;  2MFZ A;  1AU7 A;  1G4D A;  2VKV A;  1B4A A;  2JPC A;  2MLK A;  2EA4 A;  5FKM A;  2HXI A;  4P9F A;  1S8N A;  3H35 A;  4UVC A;  1TWA J;  3PQK A;  2JTV A;  2JUC A;  5IT9 K;  3DKX A;  4UV9 A;  3I0T A;  1E3H A;  2LKP A;  4BXU A;  5GAD J;  1U8B A;  2R0Q C;  2VBW A;  5LRR A;  1SAX A;  2DFH A;  2LYC A;  3DXJ F;  3FKI J;  1IRZ A;  3RPU D;  2XAQ A;  2EFW A;  5E17 F;  4B1R A;  1SFX A;  5F27 A;  5LHH A;  1KA8 A;  1F5T A;  9ANT A;  1MNM C;  2BXZ A;  4Y7N J;  2P5L C;  2WBM A;  4XKW A;  3HOU J;  2R3S A;  4L9V A;  2YR2 A;  1NK3 P;  4IHT A;  1NG6 A;  2COB A;  1LB2 A;  1GXQ A;  1YG2 A;  5EJC A;  4CUG A;  1X4P A;  4KIF A;  4A6D A;  1O57 A;  3MKW B;  4HYE A;  4A5N A;  3E6B A;  3G1M A;  4PJL A;  1XS9 A;  3IV5 A;  5ICG A;  1G2H A;  3RZD J;  4UY8 I;  3J7A O;  2HOT A;  5J4V A;  1HW5 A;  5D8K B;  2NNN A;  1TT5 B;  2UUZ A;  5IT3 A;  3K1P A;  5FRM A;  4M72 A;  2VOO A;  2R7V A;  1RES A;  3HEF A;  4I76 A;  1WRJ A;  3ERM A;  2ESN A;  5M5W J;  4IJA A;  2DCE A;  5DD8 A;  1GT0 C;  1PUF B;  1MMN A;  3HOX J;  3PIP F;  1ON1 A;  3PFY A;  3S2H J;  3RPQ A;  3HUG A;  3WTX C;  4XSX F;  4E7J A;  2O7O A;  3MFK A;  2L9V A;  2FQ3 A;  1YO5 C;  1TW3 A;  3W6K B;  3UKG A;  3OL4 A;  4A3D J;  2VKE A;  5C4X J;  3KEO A;  3JAM K;  3G6E I;  2V1X A;  3K4M A;  2A6E F;  2XB5 A;  2YX4 A;  3EUH C;  3G2B A;  4B3A A;  2OCC H;  3DEW A;  4L18 B;  2N8G A;  1FOY A;  3ZQ7 A;  4QSH A;  1JUS A;  4F92 B;  4GRI A;  2JA8 J;  1U9N A;  3CCV I;  2ADU A;  5JLW A;  1W0T A;  1Z6T A;  5FKO A;  2XAF A;  3SYT A;  2Z99 A;  2VXZ A;  1WSU A;  1OQY A;  5DTD A;  1ITY A;  1X4O A;  2V6E A;  5F0C A;  1LKX A;  2IP2 A;  2QQ9 A;  2F5C A;  4C2M J;  3ONQ A;  3CJN A;  4AIK A;  2STW A;  1A31 A;  4KUM A;  1TWG J;  2IS2 A;  1BN5 A;  2CQK A;  2V6C A;  4MEX F;  3CMM A;  1FY7 A;  5CQG A;  1WH7 A;  4CYD A;  1QZY A;  1SD5 A;  3HSR A;  4A3M J;  1R5G A;  5DUK A;  4FIS A;  2A6T A;  1IV6 A;  3OOU A;  1W7P B;  2GOX B;  2H6B A;  2WB1 A;  4WXH A;  1VQ5 I;  4HF1 A;  3EDP A;  2WC2 A;  3F23 A;  3CCR I;  1TZL A;  5KAF C;  2KZG A;  1IUF A;  2MG4 A;  2O8K A;  4B09 A;  1KU7 A;  3DQV C;  2XAU A;  1Z7L A;  4EJV A;  2HYJ A;  3O8G A;  1WQ2 A;  2DQL A;  4CZZ A;  2IBD A;  1LEA A;  3I4N J;  4KYW A;  4G8X A;  3S17 J;  2A6H F;  3SZG A;  2I10 A;  2HS5 A;  2O61 A;  1S6L A;  2DA1 A;  2HDC A;  2XHK A;  3GME A;  3W3C A;  3CJS B;  4RS8 A;  2XRO A;  2FE3 A;  2ZBK A;  3GF2 A;  3RKY A;  1O3Q A;  2WAQ A;  4XQF A;  1Y6I A;  3G1L A;  1Y8R B;  2BHY A;  1AA7 A;  2E60 A;  3FIW A;  5F64 A;  3H92 A;  6PAX A;  1QGP A;  2L54 A;  2VXD A;  3J7Z I;  3GTO J;  1OYY A;  2F6C A;  4M6X A;  2LC2 A;  2R7R A;  2ZXI A;  5JHU A;  3M8F A;  5E8G A;  5J1Y A;  5ICF A;  2Z9O A;  4J01 A;  1R4N B;  4O5V A;  2JSC A;  2K4B A;  3IHU A;  5AON A;  4ZDP A;  4OMZ A;  2V1U A;  4IVN A;  3J81 K;  1XSX A;  4BE1 A;  2X6O A;  4MQ9 F;  3J80 Z;  1XG1 A;  3IH3 A;  3S14 J;  2FOK A;  4Q47 A;  1XDS A;  4XLA A;  3C1D A;  1SD6 A;  2CU7 A;  3CDI A;  3DU5 A;  4CDG A;  2M1B A;  4X0G A;  3HL2 A;  1H8A C;  4HEA 2;  2NRA C;  1Y1V J;  3K2A A;  2GXA A;  3Q0W A;  2DFI A;  1ZRC A;  5M3M J;  2QKM B;  5H6Q A;  3CDL A;  4AM3 A;  2M9H A;  3I64 A;  2HR3 A;  4HLX A;  4E4H A;  4NBQ A;  1JXS A;  3UR3 C;  4MLO A;  4EVI A;  3OS1 A;  2DK5 A;  2HFH A;  3OYE A;  3LA2 A;  5M5X J;  2QZ8 A;  2JVH A;  2HPI A;  1Z3X A;  4PK4 A;  1BJA A;  4I98 B;  2DXI A;  2PMU A;  2RNG A;  1IXC A;  3BTL A;  4RAF A;  5TRD A;  4IOA F;  3IAS 2;  2BVL A;  4BDZ A;  5FFX A;  1R00 A;  3E6M A;  2LRD A;  3BG3 A;  3K4N A;  4ZYA A;  1S72 I;  1FX7 A;  4YFX F;  1W5T A;  3DU6 A;  3V4G A;  2MA3 A;  5DUI A;  2E7X A;  4M9S A;  4U0W A;  3S1M J;  1QZE A;  2OQG A;  2HVR A;  1QPM A;  3ROU A;  2W4S A;  2HYG D;  2FBI A;  3CCJ I;  5H6R A;  4S0H B;  4ASN A;  3HIF A;  2VAS A;  2FF4 A;  1ZGJ A;  4AVP A;  2PJR A;  4MFD A;  4ABZ A;  3SFZ A;  4CYC B;  4G7Z F;  4BXX J;  4QLC U;  4KIG A;  1QPI A;  1FMV A;  5DYM A;  2K3P A;  3A2K A;  1JT0 A;  2XAS A;  1XCB A;  5E1Z B;  4D7M A;  1IGN A;  1WGX A;  4FE7 A;  2DFE A;  4GDF A;  3S16 J;  1ZRE A;  3GUD A;  5C44 J;  1J09 A;  2V9V A;  2E2H J;  1B1B A;  3C18 A;  2A5Y B;  4JX4 A;  3OS0 A;  1S29 A;  1BW6 A;  1T98 A;  3CCQ I;  3QYF A;  1BBY A;  1FBQ A;  1DGR M;  1CF7 B;  4LLG F;  4C30 A;  2QYO A;  3FK6 A;  5BPD A;  5ILS A;  3HOT A;  3MZY A;  1I6X A;  3BG9 A;  3TOB A;  5JI6 A;  1T0F A;  3RKQ A;  1U0J A;  3QOE A;  5K1Y A;  3G4S I;  2HI3 A;  4I0B A;  4BH9 A;  1GUU A;  1IZ1 A;  3HTS B;  3Q5F A;  1FMW A;  1FSH A;  2OU2 A;  4V2G A;  4PFO A;  2JZY A;  2EZH A;  1YTY A;  4IRH A;  1EF4 A;  2X1D A;  3F72 A;  4A3K J;  3NAU A;  2DN0 A;  1I3A A;  2NS7 A;  1PVE A;  2KIU A;  3FK7 A;  4J19 A;  1S7O A;  4HG2 A;  1RPW A;  3S1R J;  2HPM A;  2HOS A;  1HQC A;  3F21 A;  2DOD A;  3CF5 F;  2W7N A;  1S7E A;  2VKD A;  4GGG A;  4M6Y A;  1G59 A;  1BR2 A;  1RNL A;  1IN8 A;  3K4B A;  5EG0 A;  2CV0 A;  1MBF A;  4HST A;  5TGT A;  4NC6 A;  2R7U A;  1FOW A;  3ZMD A;  4LIT A;  2E71 A;  3TP0 A;  2HQA A;  2VLA A;  2R5Y A;  3QOP A;  3Q0V A;  3CUQ C;  3WGG A;  1TWH J;  3GFI A;  1VF9 A;  2FA5 A;  2FUG 2;  3CC7 I;  3TO6 A;  2DPU A;  1R6R A;  2CO5 A;  3IAM 2;  1WJA A;  3HPG A;  2M45 A;  3B6A A;  4F52 A;  3L2U A;  2Y30 A;  2NS0 A;  2BBY A;  4HBL A;  1JJ6 C;  2KDO A;  2MC4 A;  4UNO A;  1GV2 A;  2XPU A;  3U2R A;  4M3D A;  2IGK A;  2MAB A;  1VQ6 I;  2DMQ A;  3FXQ A;  3H0D A;  2M3A A;  4OMY A;  1T6S A;  3GTJ J;  3A03 A;  4MIM A;  4LIU A;  2L0K A;  2RAE A;  3IUO A;  3BR1 A;  2I8D A;  3BJO A;  3ZQQ A;  5FD6 A;  1UG0 A;  3CMY A;  3SZP A;  4CHU A;  2YPR A;  4OIR F;  4U7B A;  1HLV A;  4A0Y A;  3IRQ A;  4DYC A;  3PL8 A;  4PCQ A;  3HSF A;  1LEB A;  1B9N A;  2XSJ C;  1PUE E;  1D8K A;  3WGH A;  2XAG A;  1OYI A;  2PFB A;  2VJJ A;  4Z6Y A;  5FLX K;  1YYV A;  4PSX A;  5HOD A;  1PP8 F;  1N78 A;  5ICC A;  2FXA A;  3CF2 A;  3GFM A;  4Z2Y A;  4D0P A;  2EBI A;  2G7U A;  1XMA A;  2QVO A;  5CPR B;  4HX4 A;  2D5V A;  1MBH A;  2OZ6 A;  1IC8 A;  1T33 A;  2K9M A;  3L9F A;  2MW8 A;  3K2Z A;  4QIW N;  2XIG A;  2UXN A;  3WU0 A;  2Y0S A;  2Y31 A;  2L5Q A;  1X1D A;  3HKZ N;  3T0Y A;  2E5Z A;  2JA5 J;  3ZMV A;  1S5L C;  2XGD A;  4F7Z A;  2XB0 X;  4II3 A;  4A0X A;  3CLO A;  4IRG A;  1LDD A;  2DLL A;  2CUZ A;  1RKT A;  2IXS A;  3ERE D;  1IV8 A;  5DCF A;  4XLF A;  3S32 A;  2KDZ A;  3HJE A;  3L7W A;  4EQQ A;  1YRN A;  2K7L A;  2JA7 J;  2LG4 A;  3CCL I;  3ESW B;  2JA6 J;  1EV7 A;  1HKS A;  3MD2 A;  2KHM A;  1P4X A;  1USS A;  4RB0 A;  5BS6 A;  4KIT B;  5CLS A;  4IHX A;  4IPA A;  3RYR A;  4L0Z B;  3W2A A;  4PSW A;  4ZZL A;  5ICE A;  1SFE A;  4NC7 A;  5L3D A;  2NOG A;  2F5D A;  4BL0 B;  1OCP A;  1MSE C;  4EGZ A;  5TJJ A;  1ZYR F;  2QUF A;  1JI8 A;  5HLI A;  2ZXH A;  3E1S A;  3BG6 A;  4BE0 A;  3OYJ A;  4UUT A;  1V55 H;  2CS3 A;  5CVV A;  2HVS A;  1B59 A;  3I4P A;  4LB5 A;  4Y15 A;  4UB6 C;  3SFI A;  2COM A;  2FU4 A;  2FNA A;  3M07 A; 
#chains in the Genus database with same CATH homology
 4IOA F;  3CC7 I;  1VQN I;  1Y39 A;  3CC4 I;  4V19 K;  1VQ7 I;  1VQ5 I;  3CMA I;  3CCR I;  1YJ9 I;  1S72 I;  1VQ8 I;  1YIJ I;  1WIB A;  5GAD J;  2H8W A;  1YJN I;  1VQ6 I;  1ACI A;  1FOX A;  2FOW A;  1YI2 I;  3CCJ I;  1VQP I;  2E36 A;  1VQ4 I;  2OTL I;  3PIO F;  3CJS B;  5DM7 F;  3CJT B;  1YHQ I;  1VQK I;  4UY8 I;  2QA4 I;  3CCM I;  3J7Z I;  2ZJP F;  4IOC F;  1YJW I;  1VQL I;  2NXN B;  2OTJ I;  3CCQ I;  5DM6 F;  1VQO I;  3CJR B;  1YIT I;  1HC8 A;  3PIP F;  3CCE I;  3CCU I;  1VQM I;  5GAG J;  3I56 I;  3G4S I;  2ZJQ F;  3G71 I;  1MMS A;  3CJQ B;  3G6E I;  2QEX I;  3CC2 I;  2E35 A;  3CCL I;  5JVG F;  2K3F A;  3I55 I;  1QA6 A;  1FOY A;  5GAE J;  3EGV B;  5GAH J;  2ZJR F;  3CCV I;  2E34 A;  3CF5 F;  3CCS I;  1VQ9 I;  1FOW A;  3J7Y J;  4IO9 F;  3CME I;  3DLL F;  3CD6 I;  2JQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...