2K3FA

Ribosomal protein l11 from thermotoga maritima
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain reorientation and induced fit upon RNA binding: solution structure and dynamics of ribosomal protein L11 from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L11
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2k3fA02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2k3fA01
4IO9F 1VQNI 3CCMI 3CJTB 2OTLI 5JVGF 3DLLF 3CCJI 3G71I 3J7ZI 3CCEI 3I55I 2NXNB 1YJWI 3J7YJ 1FOYA 3CCSI 2E35A 3CJSB 1YIJI 1VQMI 1FOXA 3G4SI 5GAEJ 1VQ8I 2E34A 1VQOI 5GADJ 2JQ7A 3CJQB 3EGVB 1YI2I 1HC8A 3CCUI 3I56I 3CCLI 1YJNI 1ACIA 2ZJQF 3CC4I 3CJRB 3CCQI 3CF5F 2H8WA 3CMEI 2OTJI 3PIOF 5DM6F 2QEXI 4IOCF 2QA4I 3G6EI 1VQ5I 1VQKI 4IOAF 2E36A 3CD6I 1MMSA 3CC7I 1YJ9I 5GAGJ 1S72I 2ZJRF 2FOWA 4UY8I 1VQLI 1FOWA 2K3FA 1VQ9I 1YITI 1VQ7I 4V19K 3CCRI 1QA6A 1VQ6I 5DM7F 1WIBA 1Y39A 5GAHJ 1YHQI 3PIPF 1VQ4I 3CC2I 3CCVI 3CMAI 2ZJPF 1VQPI
chains in the Genus database with same CATH superfamily
2QZ8A 3OS2A 1LQ1A 1AWCA 3BOQA 1UJ8A 2CO5A 2DYRH 3O6BB 2L9RA 2PFBA 3QP5A 1ETYA 4B47A 4IEJA 2ICWG 2JA8J 1W1WE 3I71A 2NNYA 4PUSA 3CMMA 1KGSA 2PI0A 1YTYA 3QP6A 1H8AC 4L9JA 4X0GA 1FLIA 2LKPA 2VJJA 3M07A 1O7LA 1ZKGA 4CYCA 1GXPA 3LAJA 1JKPC 2CQKA 3ASNH 3OWTA 2G0EA 1BR1A 5J6XA 3E97A 4JQFA 2JVHA 3QU3A 5FFXA 3IC7A 1KONA 1YS7A 1Z91A 2LDUA 4N0BA 4Y15A 1PP7U 1ZH5A 2BVMA 2EPFA 1RUOA 1I50J 3F3XA 2VKDA 1O57A 5KCMA 1UCRA 3DU5A 2F48A 5IP6A 4CCOA 3W6VA 3OYKA 3A01B 1QNTA 2KZGA 5E8GA 4UHTA 2HOAA 5E18F 1MNDA 1USTA 1SFOJ 1YO5C 4C30A 1FMVA 3FXOA 4PK4A 1YFHA 2M0MA 2ZXHA 1MH4A 2A5YB 2CUFA 2W24A 5J4YA 5FLXK 3DTIA 2QGUA 4JX6A 2ELKA 2E5ZA 3CMEI 2R7RA 2XGDA 2KHMA 3SZPA 5DM6F 1DQUA 2VQLA 1R22A 1T39A 2X48A 4A3EJ 3GLXA 3LFUA 2DPUA 3I4MJ 2EIMH 3TDZC 1H9TA 1YG2A 5FFZA 5L3EA 2GXGA 1EV7A 3E6CC 3FXRA 2M8EA 3U2RA 2DA4A 4YEJA 2XHKA 3LSPA 1YW9A 2VKEA 2HOSA 2IS2A 3UKGA 2HTJA 1J5YA 3WTSC 2FOWA 1D1BA 2EFNA 3FDYA 3HRTA 1JI8A 2F5EA 4D5FA 4C3IJ 5JVTA 4MHGA 4ITVA 2B0LA 4PJMA 5E1XA 2F5CA 4AM3A 3ZGKA 2FOKA 3H0GJ 2M1BA 4O6JA 2DXIA 2GLOA 2M2EA 2VC1A 1O7FA 1YE9A 3A02A 1IN6A 2X85A 4MEXF 5DUIA 3RCOA 3S3MA 4KT6A 4PCQA 4XNFA 4E7IA 2DDBA 2V1NA 3S3NA 1YX5A 2IXSA 3FMSA 1JXSA 4XIDA 3ZCOA 4CYDA 3DCFA 4BHPA 2ADUA 4U0VA 3CCMI 2V1XA 3B6AA 3TGNA 3IL2A 2OTLI 1L0OC 3H5AA 4BHBA 2H1LA 1P6RA 4KA4A 1J9IA 2O03A 4FTHA 1SAXA 2VONA 4D5CA 2V9PA 2Y69H 3AFHA 3K4KA 5H2FC 1JKQC 1A31A 2DCEA 1BOBA 3X2QH 3CDHA 2A6EF 1R71A 4ESJA 4EATA 2JA7J 5HS8A 4EV0A 1K83J 3H35A 4IRHA 3CCSI 4BDYA 1IG7A 2EWNA 4DOZA 1KQ8A 1FP2A 1MMDA 5LLQA 1QO0D 3R0AA 4BJTA 1P4WA 1OYWA 5CKTA 4BY7J 1N25A 2BYVE 3HM5A 2BY0A 3NEUA 4M74A 1LDDA 2EZHA 4YELA 4YFNF 2XKOA 2HOEA 4DYCA 1ONVA 1ACIA 1MDMB 3GTOJ 1WQ2A 4OMYA 2VPLA 1A04A 1P9QC 2NRAC 3MVPA 5E3LA 1Z67A 3JR9A 3EPZA 2VJ4A 3TOAA 4IRIA 1LB2A 4P9FA 2COBA 1X4PA 1T95A 3ML6A 2STTA 3RQIA 4BE1A 4BQQA 4LLNA 4L0YB 4LGWA 2BOLA 3KZIC 2VL8A 5FGMA 1SMTA 2PBIA 3CZ6A 2QBYA 4XLCA 3GMEA 3JSOA 4A69C 5CPRB 5EDNA 3J81K 1GXQA 4F93B 2MC3A 5CQGA 4IHYA 1BOAA 3CQZJ 2DT6A 1IUFA 2V7FA 3QYFA 3PNTA 3FM5A 3KP5A 1BIAA 2P81A 2RREA 1TT5B 5IY5H 1ETVA 4Q5SF 4E70A 3CUQC 3QYEA 1E0EA 1KU9A 3BZKA 3FXLA 4MQ9F 4BNCA 1IUYA 2X6YA 4GRIA 1VQ9I 2QKMB 1DGRM 1Y1VJ 3OYFA 2QQBA 4FE7A 2ZB9A 1WIBA 2JPBA 4PFPA 2LF7A 3M9AA 2VKVA 3CUQB 4LJZF 4KUMA 2PEXA 2HDCA 3K0LA 4IXAA 4MQVA 3CC2I 5CJ9A 1BBYA 5H6QA 4AYBN 4S0HB 1Z9CA 5FROA 2BY3A 1C0WA 1FT9A 2BXYA 3DKYA 3HRSA 3VYSB 2P7VB 1ZG5A 1P4AA 3BJ6A 3K1MA 1I39A 2E60A 3E3VA 2R7TA 4ENJA 3ABMH 4WXCA 2FNPA 3DEWA 3LQRA 3HSRA 4M3GA 1ZGJA 1MNEA 3C1DA 4XL9A 4J00A 1U3EM 3K4MA 3FISA 4ZZDA 3S2WA 4OIOF 2G7HA 4AYBA 1W5SA 3KZZA 4A2UA 1WPKA 3TMOA 1CF7B 2B63J 4DJAA 3E5QA 2HDDA 4L5IA 4CH7A 2ELHA 1UG0A 2R7XA 3BJOA 2DMTA 3M4OJ 2MYSA 1MBGA 2G9WA 2X6XA 4ESFA 1V4RA 4G12A 2R7WA 2R7OA 1W7PD 4HZFA 4PGHA 3GFIA 2VBWA 2IP2A 4FCYA 2KKOA 4RB0A 1HDPA 2DMQA 2H6CA 3ELKA 4B3XA 1LKXA 2MA3A 2O6GE 1IDZA 3AG2H 1FBUA 3Q0UA 3DLAA 2KPMA 1X58A 3R0JA 4HLXA 2BHZA 1X19A 5E1ZB 4Q4ZF 1J75A 3WTYC 1LFPA 2B7EA 4NB5A 4OIPF 4HAMA 3JRBA 4M3DA 2ME0A 3K10A 2E5NA 2DFIA 3VWBA 3KIOA 4F92B 2PJRB 3GZNB 4Z2YA 2IGNA 3JAMZ 3PIOF 2RQPA 6PAXA 2Y0MA 4ZYGA 3COAC 1D5YA 3IKVA 3RPUA 2BW3B 4C3JJ 1POGA 2CQ7A 3GLLA 3LNQA 2O61A 3RYPA 1DGWY 2QKLB 1NG7A 2QA4I 3K4NA 2JJ7A 4Z6YA 4I01A 5CVIA 5IP7J 4BE2A 1W7PA 4XONA 1LVKA 3OSFA 3FMQA 2NVYJ 3GFLA 3EUAA 4M73A 1MKMA 1IW7F 4L5EA 3KX2A 5J1UA 2ZSHB 5HS9A 3N4MA 2R7VA 3JREA 1FP1D 4I98B 2L7FP 3IH2A 2R3SA 2VB6A 4A6DA 4YFKF 4D1QA 3FWEA 3V7CA 1IGNA 2XVCA 2FBKA 1RKTA 2EA4A 4A3JJ 5DDGA 4XKVA 4AIHA 2LH9A 1X1CA 2L4MA 2W82A 5LGTA 4RMNA 4EJOA 1HCRA 3WGHA 2KDZA 3O8GA 4N9IA 2CSOA 4Y7NJ 3HOYJ 4PJJA 4ZYDA 1Z7LA 4ZTFA 3CJNA 4NHJA 1F4KA 4DIQA 1UHWA 2LTPA 2W25A 1R49A 2EV6A 5KHDA 4HNTA 1IN7A 3ZR8X 1AKHB 2DMUA 3FBNB 2H8RA 5C4XJ 2QUFA 3IRRA 3HOSA 4ZH4F 5DTDA 3ZN1A 1REPC 4OMZA 4D7MA 4KISA 3KPHA 1T08B 5DUKA 4AVPA 4IL6C 1GVJA 1SVLA 3OSGA 3TW6A 5BPIA 4XSZF 2JVGA 3T5XA 3BPVA 4DGWB 5LBQA 2R5YB 4LFUA 2VUMJ 1ZHFA 1R1TA 3S1NJ 4IHXA 2DA7A 5HDGA 2WBMA 1FSEA 3QPTA 4ESBA 1Y1WJ 1OYYA 3T8RA 3F23A 1JUPA 2LR8A 1JTXA 2ZFUA 4IHVA 3I5UA 2LY2A 1RC9A 1GV2A 3SEQA 1KQ9A 4HW0A 4P5OA 1QQIA 4IQ4A 1W36C 4WXHA 3L2VA 1S7AA 1IF1A 2ZSIB 3HPGA 2HYJA 1IV8A 1OCOH 2P0WA 3K7AJ 2XGEA 4C2TA 1OJLA 2M9HA 3V42A 3MEXA 1BL0A 1BI0A 2HPIA 3LSGA 2O8KA 2NS8A 1G3YA 5D4SA 2E71A 3F8BA 3KP6A 5FLMJ 1B8IA 2ZBKA 1EH7A 3AG1H 2TDXA 5M3MJ 5IT9Z 5AONA 3P9CA 2DA2A 3H92A 4OIRF 1UMQA 2MSYA 1EJ9A 1JT6A 2CJJA 1J7KA 5IOZA 2HQAA 2P5VA 2UV1A 2V26A 4LOCA 3CC7I 4OIQF 2FU4A 2GIVA 2IRFG 2HS5A 3HHGA 1S72I 2E2IJ 4KIGA 3DU6A 1V5GA 1FBQA 1I6XA 2HVQA 2A61A 1A36A 3K1NA 4KDPA 4P55A 1ZYRF 1J59A 3HEFA 2KP6A 4XLPF 2L54A 3JSPA 2X1EA 3OOUA 2I5UA 2FRHA 4I02A 4CCJA 4A3IJ 3NWSA 3S8PA 1TZLA 2LY1A 1YQAA 4HF1A 5GTIC 2KRFA 4XOPA 3I9V2 1BIBA 2R7DA 1HLVA 5HLIA 1FMWA 4BBSJ 1R23A 1VQPI 2D1VA 3HKZA 5K1YA 3S16J 1I27A 1I1SA 3GZ5A 2EFPA 5K7FA 3ZQLA 1BJAA 2EFOA 2OCEA 3BQZA 2O3FA 4EM1A 4XQFA 4RGXA 3KCCA 3H3VK 4HX7A 2KJBA 3DV8A 3KEYA 5FKMA 3LOCA 3GBGA 3MQ0A 4UVCA 3TOBA 2HU9A 1HKTA 4EM2A 4BYYA 4LG0B 4BQAA 1I1GA 5F0HA 3ZMTA 4B43A 5FKLA 2Z2SB 5EZHA 3WTXC 2K7LA 2V6CA 3L2CA 5LGUA 4B44A 1O4XA 5F0CA 3TP0A 1B9NA 3ZPLA 4IKFA 4EEFG 5HODA 3F72A 3DQVC 2F2EA 1KU3A 1T0FC 3TDUC 4G7HF 2A69F 3K4JA 2DT7B 1PJRA 3JW4A 3ONQA 5FRMA 5AIPA 2R7QA 1KQ0A 3SDBA 1MH3A 1OLTA 1OISA 4FE4A 3V8KA 2WAFA 3JRCA 1YI2I 2KRHA 4UVAA 4XRSA 4O5VA 1XX5A 3WTZA 3J81Z 1YX3A 2QBYB 4IQJA 1XD7A 1FOKA 3AKZA 3OIQA 4U0YA 1ZR4A 2XAFA 1NG6A 2EJRA 1F1ZA 2WAEA 1EH8A 3CC4I 2ZJ2A 2DBBA 2JPCA 4LG3A 3L1PA 2LYCA 4UB6C 1X3WB 5EEAA 5EGOB 3QAHA 3BY6A 1D8JA 3ABTA 4XMYA 1K4SA 2WV1A 1TC3C 3J7AO 2AQFA 2JMWA 2CV0A 1OYIA 2D2WA 4G7ZF 4DYQA 4A3KJ 4L18B 2MBFA 3F8NA 3GVAA 4NBQA 3HYIA 3VYTB 1FYMA 1TLHB 4PJNA 1MMSA 4V2GA 4QLCU 1B4AA 4II2A 2CH0A 2HVSA 3HJEA 3QPLA 2LK2A 5K5RA 3D5SC 2IA0A 1K78A 3H36A 4DZJA 4RB3C 1Y6IA 1CQTA 3WU2C 1ZGWA 2L9SA 5BOXA 1G6NA 3ECHA 4CYCB 4YIFA 3DKWA 1Y39A 2KLOA 4HSTA 1EA3A 3WGGA 1SC7A 1VQ4I 1WJEA 1JUSA 3CCVI 5J1RA 2KDOA 4UUSA 2ZJPF 1QZYA 1E17A 1IN4A 2ZNYA 3OYJA 4IHTA 1S29A 2OU2A 4FISA 3L00A 5ILSA 1X1DA 1U2WA 5IYBJ 3ZQCA 1DU0A 1XC5A 4IJAA 2ECBA 3F6OA 1NK3P 2EIJH 2VJ5A 1MBHA 2MD5A 2HGCA 4UVBA 2O5RA 1P92A 3HSFA 3CTAA 1TWFJ 1LEAA 1XSDA 3ZMDA 3RPQA 1PP8F 3QOPA 3NRVA 1SANA 4CXFA 1HA8A 1CGPA 5JLXA 3A03A 4AU7A 3CO7C 2ESHA 3HOTA 4A3GJ 3HG9A 3MFKA 3OYGA 2CU7A 5ILUA 4ETSA 2AXLA 3AL0C 1LE8A 2KQRA 1K7AA 2IA1A 2Z33A 3OS0A 5DYMA 3FK6A 3L2UA 1GVDA 1Q1HA 3ZMSA 1FOYA 4EM0B 2VE8A 3ISPA 3G2BA 1YIJI 2OUMA 2XB5A 2M4KA 2VBZA 1FEXA 4KFCA 5ICEA 3IAS2 3P9KA 4Y13A 1SFUA 4BS9A 4AWXB 2F5DA 2OPTA 2LC2A 3ABUA 3R6SA 1L3LA 3ERED 4OU0A 1HC8A 2IBDA 2GBYA 2AO9A 1X3UA 2HNHA 2UXXA 1STZA 4A5MA 3GYHX 5IT3A 3I53A 4WF2A 3CJRB 1BA5A 4BL0B 1WJBA 2CQXA 2M3AA 4ZJZA 4EGYA 2R92J 5ICFA 4WXDA 2AXTC 5LGNA 3ZRGA 4CSWA 4I7HA 1UAAA 9ANTA 1WHUA 4UUTA 4BGDA 4BACA 5M3FJ 3TBIA 1ETOA 3PNVA 2L7KA 3TO6A 5E1WA 4E7LA 1D8KA 2M0CA 3I54A 1Z3XA 4MEYF 2XAQA 2FNAA 3KP7A 2UZKA 3VSLA 4H4KC 1TQMA 5H6RA 4PFOA 3UNGC 1CF7A 1WJ5A 4ZDLA 1HW1A 2L4AA 4MTEA 2X1DA 3OYHA 3K2AA 4C2UA 2DOFA 1E3OC 2E2JJ 4UY8I 1WH5A 1VQLI 3IAM2 2LY9A 2VT3A 1ZELA 4V19K 3A0HC 1KZHA 2EILH 2KISA 4KJZA 2LG4A 1U9OA 4QWQA 1FPQA 2NS0A 2XAJA 3CLOA 2Y0SN 1F9NA 4LG0A 1MMAA 4LK0F 4AIKA 2Z16A 3KP3A 3ABLH 3SZGA 3REOA 5HDKA 4HX4A 3H3ZA 3QWLA 3VDXA 2L3DA 3ZP5A 3GW2A 3K4LA 2HYFA 1IRFA 1KYWA 4BE0A 2F4IA 5CLSA 1LDKB 1T98A 2J5PA 3PUFA 2V1UA 1D0ZA 2BY2A 2DA3A 3ROUA 2QQAA 1MBJA 2NYXA 2DJIA 2IEKA 2DTZA 3AG3H 2A6HF 1GDTA 5ED4A 4CHUA 2NOGA 4DNCA 4IX7A 1RIOH 2F5FA 5HLGA 2XGCA 3O3KA 1XMAA 3DBRB 2MLGA 1B9MA 1HKSA 1T56A 1EH6A 1S8NA 3J80K 3WU1B 3I55I 4BUPA 2LF8A 3TQNA 1Y56A 1R6RA 3OYLA 3PO3J 1AOYA 3K69A 3FF5A 1RKWA 1XGMA 4M72A 5M5WJ 2EFQA 3J80Z 2QSHX 1B72A 4ZYHA 2XAUA 4NQWB 2DTRA 1VQ8I 1R36A 2KMUA 3JRDA 3LSIA 2QVOA 3OIOA 1FNNA 1WJAA 4RBOA 5ILVA 4A12A 1TNTA 5KVRA 1MD0A 1YJNI 2JK3A 3W2VA 1FTZA 3E7LA 4IPAA 3PSIA 2VXDA 2XDVA 2WV0A 2PQ8A 1SMYF 1FTTA 3HRMA 2H8WA 2YUSA 3BR0A 3JCUC 1TW2A 3M1CA 1X4OA 4E7JA 5H20A 1RR8C 4NQWA 4MTDA 4KIFA 5C3EJ 1S9HA 2D1HA 3IRQA 4AIJA 5GTHC 2JUGA 1U5TC 3DPLC 3P9IA 5LRSA 2E1OA 3P7NA 4DZPA 2HDWA 5CVRA 5F1RA 3KEOA 3S93A 1WSUA 5K5QA 3RKYA 2OA4A 3W6KB 1Z0XA 2M87A 1YJ9I 2DI3A 1RNLA 3M1EA 4M6VA 3H0DA 2X0LA 3CF2A 1HXDA 3MCZA 5EF6A 2ZMEB 5BNGA 1WZ2A 4XICA 3FMRA 2RDPA 1ZG3A 1G8XA 3S32A 1T8IA 2KIUA 5IOYA 5DM7F 2C6YA 3FXMA 3DEEA 1FZPB 3E5XA 1RESA 2GM4A 3PIPF 2ZMEC 2YPRA 5BS6A 3CP8A 5KAFC 2BGCA 3LAPA 3VYRB 3CMAI 1FY7A 1S6LA 1SFXA 2E1MC 3PFYA 4FASD 3ZQQA 1QRYA 3H5NA 2FA5A 2DYSH 1F36A 1TQIA 4IO9F 3GWZA 3ASOH 2LSOA 3CJTB 1H88C 1IAWA 4GDFA 1T0FA 5FKOA 1JKRC 4X6AJ 3HIFA 2M7BA 2FMLA 3HBLA 4B48A 5D6FA 3OYMA 4KIBA 1Z21A 1K6YA 2L2OA 4RB1A 5CQEA 3E0JB 3LQQA 2HQRA 5HOOA 3DF8A 3E6BA 4HA8A 4BXUA 4CCKA 2V4JC 4DBQA 2HFHA 2X6OA 3T1BA 4RGSA 1R58A 2V1DA 1MBFA 2CW0F 2JN6A 3HXLA 2DW4A 3R60A 3S1MJ 1QZZA 1Z1DA 3CJSB 3M8JA 1ZR2A 3DBHB 2LP0A 3U9GA 4OINF 1N75A 3D5LA 1ENHA 1AU7A 3GFMA 5F0FA 3JRIA 2N8GA 1SD4A 5L3CA 5EGOA 1JUMA 3F9KA 3GZ6A 4ENMA 2EZKA 5IT9K 1MMNA 3I56I 2W84A 1GHCA 1V54H 4NUBA 2RN7A 5D8KB 3DP7A 3OYAA 4XKBA 2VE9A 4OWRB 4I6ZA 2RAEA 3BCAA 3CCQI 2P5KA 1UB9A 5EEGA 2R7FA 3IWFA 5DCFA 1JE8A 3MKZA 2KJCA 2MFZA 1U0JA 1D3YA 4A5NA 4U7BA 2BE5F 2DU9A 1USSA 1P7JA 3EYIA 1VQ5I 3H9GA 2BBYA 1O3TA 2XPVA 2E36A 2JT1A 1BM9A 2VQGA 1V5EA 3I4PA 3EUHC 2V79A 1ZTRA 4XRSG 4C3HJ 2RKHA 1HKQA 3EUKL 2E19A 1ZRFA 3OYCA 3GTPJ 4ANJA 5GAGJ 2VQCA 4I0BA 3GTQJ 4EJVA 2UWMA 2HKXA 3MMYB 4X1EA 1F43A 4HNVA 3LWFA 2BV6A 2Q8KA 2I10A 2PMHA 2PMZA 2Y31A 1WGXA 2HYGD 2PG4A 5IYDJ 3B6CA 1I5ZA 2X1CA 1KU2A 3SZTA 3I59A 2IGMA 4KNYA 1IN5A 2DQRA 3B02A 5AIQA 1RZ4A 3TO9A 2OAZA 2FD5A 4M3EA 4QSHA 2R5YA 2FJ1A 2V9KA 1D0YA 1VF9A 1QBJA 3HOVJ 1YLFA 3V7RA 4UUSB 1ULYA 3LMMA 3RQ4A 2VASA 4EJTA 4JBAA 3K4BA 2R5ZA 4GGGA 3K6GA 1IDYA 2FX0A 4MNUA 4RA2A 4BXFA 3GO5A 2LKSA 1LDJA 2PJPA 4RM3A 3ZOBA 3OL3A 1HSJA 1Z3YA 4HOBA 2CRGA 3WTTC 1FIAA 2OQGA 2E2HJ 5IP9J 2QYOA 3SQNA 2JA5J 3PQJA 1DPRA 1X1PA 3HB9A 4G94A 2EH3A 4YIRX 2CFOA 3G71I 5CVVA 3RYRA 5K7ZA 2Y0SA 2F5VA 2HZDA 3CCEI 1TWHJ 1TT0A 3BTIA 3I3LA 2MD0A 4HEA2 2NXNB 4PZJA 4HYEA 3BTLA 2WTEA 1EKEA 1A35A 3ZQIA 1G59A 1ETXA 2A5WA 4M9XA 3HUGB 4G8XA 1TP4A 4WCGA 3RZOJ 3A01A 3S2HJ 1QPMA 4GFBA 3GUDA 2JUCA 1VI0A 4GYGA 4ZYAA 2Q2EA 2LOOA 1WWXA 3VEPA 1VNDA 2NVUB 3HOXJ 4BXXJ 3K9TA 4PJ0C 2OV7A 2M45A 4R1HA 3VODA 2GOXB 5B1AH 1YRNB 2MH9A 1LPQA 3BP8A 2O0YA 3EUHA 3R61A 4JP0A 4B1RA 2JZYA 3RKQA 2DOEA 3L9FA 3FKIJ 1I6HJ 2DAOA 1JHHA 4IF4A 4F55A 5E20A 1YIOA 2K85A 5F08A 1NK2P 1D0XA 1E3HA 1G3SA 3ZMVA 4E4HA 3GF2A 3BJAA 3AAFA 1HQCA 3RSNA 5D5XB 3RI4A 1YRNA 1VQKI 2JTVA 3U21A 4CZCA 2VKHA 4LMYA 4A0ZA 4QTRA 4EGZA 1P7IA 1SD6A 2XV4S 5CVJA 2P6SA 1LVAA 4LD5A 2EZIA 4BEHB 2JA2A 1IXCA 2EA2A 3ZMUA 2R7UA 3K70C 1WI3A 3G1MA 3ZQ7A 3DKXA 4D0PA 4JX4A 1K6OA 2AS5F 2AHQA 2K3FA 1XB4A 1RPWA 2L0KA 4HQEA 4XSXF 1BW5A 2XF6A 1H9GA 1DPUA 2IJLA 3K2ZA 4Y3OA 3PJRA 4ZZLA 1R9TJ 4JOMA 1YOVB 4XN0A 3MZHA 1XTAA 2HQNA 2OCCH 3WHBA 2BVLA 2I8DA 3LSRA 1BR2A 3SDGA 4FETA 3L7WA 4NNJA 3WGIA 1XCBA 3VFZA 4ABZA 2H09A 4RAYA 3OYDA 4UNOA 3WE3A 4HV5A 1VQNI 5B66C 1WVRA 3CP2A 2YS9A 4QPOA 4RM2A 1LFBA 2ZXJA 5D6EA 3BDDA 4KN7X 1MMGA 5JVGF 4KMUX 2LBFB 4MGRA 5E3MA 2YSRA 4OAYA 1ZGAA 3U1KA 2MW8A 4KT5C 5E17F 2GA2A 4RGUA 1WCMJ 3PUBA 1FX7A 2XKPA 2GAUA 1E3PA 2TRTA 3R4KA 5M5XJ 2R0QC 5F04A 5HVQC 2DA1A 2VI6A 4UV9A 2EIKH 1GUUA 3IUOA 1TWCJ 1ITYA 3J7YJ 2M34A 3MKWB 2FEZA 1H89C 5A2QK 4PDKA 4ZTJA 1ZLJA 1W0UA 3A1YA 4XRMA 1IN8A 4M6XA 3DWLE 3LA7A 2WC2A 1R1VA 1TWGJ 2FQ4A 4WX9A 3DPTA 2VN2A 3A0BC 3L09A 2IS6A 3HZJA 3EGVB 2XASA 2OF7A 1R4NB 3CCUI 1E2XA 2CQQA 4DBRA 4MIMA 3MZYA 3OR1C 2R7ZJ 1P4XA 4E6KG 4N4OB 1QHHD 4F7ZA 2E1CA 4W97A 1IRGA 1O3SA 5TISC 1R1UA 2ESNA 3LA2A 2KIMA 2FUG2 5C44J 3NWTA 3KEQA 1J09A 3HUGA 3KLOA 4KYWA 5JFRA 5LEKA 4M6YA 3Q5FA 1UG2A 3BTCA 2NS7A 2CW7A 2H94A 4R79A 2QWWA 1XGOA 2WAQN 2KRCA 5CVUA 4L9NA 4YIIA 1ETWA 4HBLA 1MSFC 3WU0A 2ME6A 2EV5A 1YYVA 1HOMA 4JK1X 1XDSA 2CYYA 2IT0A 3S14J 2OZ6A 1S3JA 1FSHA 2ECCA 1ZARA 3TL4X 1U8RA 1G4DA 2XSDC 2YU9J 2DA5A 3E1SA 1TL8A 1VQ7I 2HXIA 1X2NA 3OV8A 4MO7A 1PUEE 2DQLA 3TEDA 4H0EA 2EK5A 2JSCA 1LE8B 5L3BA 2VQHA 2DMPA 2LREA 1ZRCA 1FYKA 2Z99A 4U0WA 4B8XA 1WJFA 4Y33A 3CUQA 2NNNA 4XK4A 4AUXA 2ACJA 1OMIA 3RIRA 1DP7P 1MBEA 4XLHA 5J40A 1A5JA 1T33A 3HC7A 1MIJA 4A0XA 1QVTA 2X51A 1XGSA 4FX4A 3FHZA 1ZAOA 1LNWA 1KA8A 3RKWA 3OOPA 1SFKA 3KZYA 3A2KA 3BR3A 5EG0A 2DMNA 4HPQA 3V8LA 5KK1A 3OIPA 4ENNA 1GT0C 1BI3A 2NVTJ 2K02A 2ZC2A 3GTGJ 4EVIA 2XPUA 3HTUA 4L9TA 2NOJB 5DS9A 2A68F 5KAIC 2HWVA 1TWAJ 3OMYA 2TCTA 3G1LA 5D5WB 3HL2A 1VFCA 2JQ7A 2GXAA 3K1PA 3S17J 4B4CA 2CV1A 3GXOA 5ICGA 2ETHA 5C4JJ 3CCLI 3FBIB 1LEBA 2PMUA 4MFEA 3VYUB 4DYRA 1XSVA 3Q9SA 4HF0A 2W85A 4HQMA 1ETQA 1XSXA 1T38A 4LB5A 3KLNA 2ELJA 1B8IB 2LNBA 1ZRDA 3VB2A 1X1AA 3JTGA 4V2FA 4M71A 3ZMZA 3JTHA 4NC6A 1PVEA 4FHTA 3OS1A 1UHMA 1W5CC 1FC3A 3WG7H 2MLKA 5FO5A 3ZQHA 2IAIA 3K70D 3EDPA 3O8HA 2XB0X 4BQNA 2F4OB 4KICA 3KP2A 3NQOA 3JRHA 3BPXA 2EFWA 4A93J 4AD9A 5DV5A 3WODF 1RRJA 3WE2A 3DPUA 1R5HA 4O3MA 5HS7A 4U7DA 1PUFB 2CFXA 3CLQA 1R7JA 2LVSA 3CCRI 3HKZN 2Q1ZB 2HVRA 1IJWC 5TGTA 2BW3A 2W00A 3DTEA 2ID6A 2K40A 3LFKA 4F91B 1MJ9A 5GAHJ 3FXQA 2EBIA 3S1RJ 2YR2A 4BJ5C 2XC7A 2CUJA 4EMSA 4OOIA 4IHSA 3BR6A 4RAZA 4XLAA 2DFHA 1BR4A 3SXYA 1K4TA 1B1BA 1UHSA 3QOEA 2M30A 1PUFA 4HSRA 2M5WA 3CESA 3WTVC 3BWGA 3EETA 4C9YA 2K86A 2CV2A 2ZO4A 2BZTA 2NVQJ 4BBRJ 1ON1A 1B6AA 4Y52J 1Z05A 3BCBA 1G2HA 2VBXA 1J0RA 2Y2ZA 2ISYA 2ZCWA 4LK1F 3PQKA 2A6TA 4I2OA 5EYRA 2GXBA 2BXZA 3G73A 1FJLA 3C18A 3PL8A 3O2PE 4CUGA 1FYLA 2H6BA 3K4CA 1MDMA 5F64A 1Z6RA 5L3FA 1YW7A 5E3OA 1OCTC 2KL4A 3IV5A 2E35A 2HXOA 3ESWB 2DFFA 2DOAA 3V8JA 1VQMI 3H9QA 3DBLB 4Q48A 4DW6A 5K7HA 2OQRA 2DT5A 3RKXA 1UFMA 3KFWX 5D4RA 4RLQA 3H9JA 1AHDP 3HOZJ 4IZZA 3C2HA 1PYVA 1DUXC 1VQOI 5HLTA 2RVCA 3QYBA 4DQ2A 1OCZH 3CJQB 3BTJA 3DEUA 1RETA 2UUZA 2KIQA 4JYKA 2OBPA 1A6IA 1Q1VA 2E1MB 2KZVA 4YFXF 2VBYA 4G6TB 3Q0VA 3SYTA 3OR2C 4AIDA 4XKWA 5J8CA 2XRNA 2IS4A 3IP4B 1LJ9A 5EG0B 3HDDA 1T2KA 3BZCA 2H1KA 1HBXG 2OTJI 2VOPA 1TTYA 1FWZA 2FE3A 1HW2A 1DDNA 2L02A 4HX8A 4OAZA 4CZZA 3HRUA 1SFEA 1XN7A 4G6QA 2QEXI 4BDZA 4I99C 4XM3A 2IGKA 4PGGA 1IZ1A 2RNGA 3Q3SA 2VODA 3HGGA 4GO1A 2CUEA 3I58A 4TV7A 3RDIA 2W4SA 1SD5A 3S3OA 5BPDA 3QRFF 2HZTA 1U5TA 4CDGA 3OL4A 3KYCB 1BC8C 4J19A 3DTKA 4KMFA 4N4NB 1HF0A 5LEJA 4RAFA 4AC0A 3C3WA 3KYLA 3W2AA 4IHWA 3CO6C 1HDDC 2XSJC 4Y4RA 5CYVA 4A3FJ 2HPMA 4FT8A 4P1WA 4D9JA 3WG9A 1W5TA 4G9YA 5HNFA 4BEHA 1GV5A 2Q2EB 1YW8A 2L5QA 1U5TB 4QIWN 2ZKZA 3D1NI 4CO8A 3ERMA 3SFIA 1DP3A 3H5RA 3FM3A 3S1QJ 2BEOA 2R4GA 3L2WA 4E7ZA 5DD4A 2XROA 2G7UA 3GCMA 3WTUC 4E7KA 2VIXA 3OYNA 2M8GX 4I76A 1V3FA 4M9SA 3ZQGA 4BQOA 2IPQX 2W57A 2ISZA 3RZDJ 3N05A 4UUVA 3J7AY 2QSFX 4BKXA 1R5ID 3LL7A 3LSTA 3QPSA 4L5JA 1WFXA 1MNMC 2F6CA 2FXAA 3BG7A 1M1EB 3J7ZI 1ON2A 4E7HA 2RQQA 4BAYA 3RPUD 1WJDA 1Z6TA 5BQTA 2EB7A 3JRFA 1ZK8A 2A05A 3T0YA 2DA6A 3FZVA 1LUJB 1FOXA 2DDAA 3BT9A 3IWZA 4ASNA 1ZG1A 2DFEA 4BY1J 3CDIA 3BR5A 4UXNA 2HQ5A 3VSKA 1JT0A 3W6JB 3DXJF 4RGRA 3QU6A 3W3CA 4P9UA 4HNUA 4BHCA 2IGOA 1Y8RB 3C7JA 2FBIA 5JLWA 3M7GA 1XGNA 5E8IA 1X2MA 2A3SA 1OCRH 1D1AA 3FKJA 3IHUA 3GTJJ 4XN3A 1BN5A 1BI1A 1JGGA 3NARA 5J1YA 2DODA 4IOCF 2O7OA 2WADA 4L9VA 1K79A 2JRMA 4U88A 3HPHA 4CCLA 3G6EI 3FX3A 1OQYA 4RDUA 2WWYA 3CD6I 2Z5UA 2Y9ZA 2M7AA 1ERDA 1IRXA 5LFAA 4BH9A 1TQPA 2K4BA 2LMDA 3NAUA 1QVUA 2XF5A 4LIUA 2ZFWA 3IH4A 5FKKA 2B9SA 1YS6A 1IC8A 3MZ8A 4KITB 3JRAA 2R93J 1N78A 2JRTA 2QENA 3BG3A 4F52A 5D5VB 5F1JA 1V55H 1VQ6I 3HGYA 4YRVA 3UR3C 1MJBA 5IPAA 5HNHA 3LSHA 5EEHA 5J3LA 2XAHA 3LSKA 2CMPA 4MFDA 1XMKA 1G3WA 2Y30A 2DLLA 2HR3A 3V4GA 3ECOA 2ID3A 1W0TA 1D1CA 3MKLA 2XRLA 2XPWA 1WI9A 3ZN0A 4A3DJ 1TBXA 2W7NA 2OD5A 3GTLJ 5DEQA 5EJCA 3TO7A 1XS9A 2KIFA 1K78B 3M8FA 1JHFA 2LKXA 3PNYA 2K9MA 3M3YJ 3TW7A 2K4JA 3V7SA 4B3AA 2GA1A 2VT2A 4XLEA 1U9NA 2Y9YA 3ABKH 5JHUA 1U6GA 3GTMJ 3CCJI 1J2XA 1I3QJ 1MW7A 3FXKA 3FHNA 3KYDB 4XRFA 3EQLF 5M5YJ 1BJZA 1OR7A 1JJ8C 5J8FA 4HF2A 2P8TA 2K9QA 2FSWA 2K27A 5K5OA 2M4GA 4M3FA 2K5CA 3MKYB 5LHGA 5FLXZ 4ZYEA 3H3UA 1ODDA 4CA0A 4II3A 4C2MJ 2HI3A 2DK5A 5LHHA 1ZQ3P 4A0YA 1NHAA 3G4SI 1BW6A 1OCPA 3U1DA 2E34A 1JTYA 1VTNC 3PSFA 4M9ZA 2V9VA 3WHCA 2CW8A 5F6FA 3I64A 3LSJA 4U87A 3E5UA 3ZXSA 3TKYA 2ZJQF 5DCMA 3HOWJ 2IW5A 1MSEC 2YX7A 4A3BJ 1RR7A 2A07F 4BJ6C 4UV8A 5LHIA 2VC0A 4XORA 4LLGF 4XKCA 2WB1A 5IYCJ 2GWRA 1QGPA 2QCOA 4R8HA 1X3ZB 2X6WA 2R7SA 1ETKA 2E1NA 2ZNZA 5F27A 5FD5A 2K9SA 4HDUA 1H0MA 1Y0UA 2PX9A 3E6MA 4ENKA 1Z77A 1S7OA 4L0ZB 4PJLA 3MD2A 1W4MA 3ZQFA 2VXZA 5JI6A 1HW5A 2L7ZA 3AL0B 2AQEA 1IRZA 2ZJRF 1XG1A 2P6TA 3S15J 1XCVA 2Q0OA 4N9HA 4CICA 5ERIA 3FXUA 3F21A 2LBFA 4WWCA 3N97A 3FXJA 5JR3A 3SHFA 1YITI 2CS3A 1ZREA 3G1OA 4EJUA 1RI7A 2E7WA 4GCVA 3FK7A 2Z3YA 2MABA 4LIVA 3BG9A 5E79C 4J01A 2HTSA 2QQ8A 3SJMA 4P96A 1TW3A 4A3CJ 3L2RA 4WK8F 4CGZA 5B1BH 3KE2A 4RB2C 5BMZA 3CDLA 4HG2A 1LFUP 2DPDA 3IKTA 2P5LC 2GOMA 3Q0WA 3QPHA 4A3LJ 4UB8C 3I4NJ 2YX4A 4F3QA 2E7XA 3I0TA 2VPRA 1OCCH 3Q9VA 3KETA 5JHFA 1WKMA 3G3ZA 3RTRA 2K3PA 2KFDA 5B5EC 1BI2A 5FB2A 2QF7A 3E6DA 3PM1A 2O9LA 2J5OA 3FIWA 4I0AA 2QM3A 1OR7C 2LD5A 3BZ6A 2R5ZB 5FJ8J 1YJWI 2VLAA 3HTSB 2STWA 3BROA 1KU7A 3SEZA 2EQRA 2RV8A 4CCNA 1ZLKA 1OPCA 2ZMEA 2XF7A 2L9VA 3H1CA 3MWMA 1MJAA 3GEZA 4I09A 3OY9A 5GAEJ 5LD2C 4AVZA 2HKOA 1SAUA 2XAGA 1JGSA 5ICCA 1AKHA 2X4HA 1XPXA 2VOOA 1R4MB 1P2FA 1I3AA 4Y17A 2P7CB 3M8EA 4B09A 4S04A 1WJCA 1UELB 4NDLA 1FBSA 5D8LB 2IVMA 2VJIA 2DN0A 4FX0A 1G3TA 3HHHA 4MLOA 2YU3A 1EF4A 2ZXIA 1W36D 3CF5F 5TRDA 2EINH 3D0SA 5GPAA 1VZ0A 5GPCA 2K9NA 3GX4X 4RLFA 3SFZA 4QPQA 1B72B 1APLC 2LLKA 3HSEA 3JAMK 2CGPA 2BY1A 4S05A 3F8CA 2CWEA 2FBHA 1MBKA 4IRGA 3S2DJ 4IOAF 3KP4A 5L3GA 4GYIA 4ZDPA 1QU3A 4NC8A 2OZUA 3F8FA 1A6QA 2NAZA 2V6EA 2MC4A 4G7OF 3QODA 1QPIA 1B59A 1T6SA 3C2BA 2KT0A 1FIPA 4W1UA 1OKRA 2BHYA 4G6DA 2UXNA 4HDVA 5J47A 2QLZA 1MZBA 1NH3A 3MAJA 4KN4X 1ZN2A 1U78A 2NVXJ 1UZCA 3B73A 5FLVA 1FOWA 4K2EA 3BG6A 2MG4A 1RUNA 4EQQA 1QA6A 1SVMA 1JKOC 2Z1DA 3P5JA 2WA0A 2ZXWH 1KYZA 1XDUA 5DD8A 1IXRC 4XOTA 4ZC3A 3QQAA 4D7NA 2D5VA 4IVNA 2GZWA 5D5UB 4EJWA 1YHQI 4HRIA 5FKNA 4Q47A 4LLLA 2PJRA 1F5TA 3JRGA 2XIGA 2CQNA 2O8XA 4YG2F 5KNLA 2RC4A 4A3MJ 1JJ6C 1BC7C 2EZLA 3GFJA 2L01A 2P4WA 2PMZN 3F0CA 2W1OA 5EZGA 1PDNC 2XUBA 3PO2J 1SEUA 3VOEA 3LSMA 1WRJA 3CCYA 2DK8A 3DLLF 3D5RC 2IA2A 4GXOA 3DFGA 1IXSB 2Y48A 2LRDA 5TJJA 3HOUJ 2Y75A 2RNJA 1QZEA 1XMXA 1Y8QB 5DCMB 2JSPA 3CMYA 4NC7A 1SVOA 4CCMA 2Z9OA 3F8MA 1GLNA 3BR2A 3F22A 3WTWC 2L7MP 4RAGA 2K9LA 3OYIA 1S5LC 2FF4A 2WB1N 5FD6A 1X1BA 1K61A 2W48A 3F6VA 1HSTA 4FQGA 1MGTA 4XLFA 2GIZA 2EV0A 5HLHA 1U8BA 1OFCX 3TP3A 4E7SA 3A4CA 3BG5A 2H27A 2OC6A 5GADJ 4PSXA 4JX5A 2COMA 3AG4H 1N77A 3CUOA 3GTKJ 3T8TA 1Y0NA 4XR6A 2JA6J 3PFIA 5J4VA 4HLYA 1TNSA 1IV6A 3RJPA 1O3RA 2FQ3A 4XBFA 2CG4A 4HV6A 1W7PB 3ULQB 1D5VA 3W2WA 4RS8A 5HDNA 2LFBA 1ORKA 3C2GA 1R00A 2OJED 1IO2A 5A2QZ 2IS1A 2D45A 2RGVA 1V5FA 2CUZA 2WAQA 3BR1A 2GQQA 1Z7UA 2MH2A 3OYBA 4ON0A 3MN2A 1SD7A 3BQYA 4LITA 2F4MB 1AA7A 4PSWA 4ZDOA 2PN6A 4LB6B 2PLYA 3IH3A 2FMYA 2QSGX 5FRNA 3OYEA 4A6EA 1O3QA 5GP9A 3I59B 2QQ9A 5LRRA 4XLNF 3VPRA 1QHGA 1DU6A 3L2QA 1NTCA 1WH7A 3BLYA 2HOTA 5E3NA 2XGXA 3EYYA 2DJNA 1S7EA 4BU2A 2X9DA 4M3BA 2DO7A 2WY8Q 3BC8A 2MGQA 2JWTA 1R5GA 2L9NA 5B3SH 2HEOA 5L3DA 2WY7Q 3LA3A
chains in the Genus database with same CATH topology
4IO9F 1VQNI 3CCMI 3CJTB 2OTLI 5JVGF 3DLLF 3CCJI 3G71I 3J7ZI 3CCEI 3I55I 2NXNB 1YJWI 3J7YJ 1FOYA 3CCSI 2E35A 3CJSB 1YIJI 1VQMI 1FOXA 3G4SI 5GAEJ 1VQ8I 2E34A 1VQOI 5GADJ 2JQ7A 3CJQB 3EGVB 1YI2I 1HC8A 3CCUI 3I56I 3CCLI 1YJNI 1ACIA 2ZJQF 3CC4I 3CJRB 3CCQI 3CF5F 2H8WA 3CMEI 2OTJI 3PIOF 5DM6F 2QEXI 4IOCF 2QA4I 3G6EI 1VQ5I 1VQKI 4IOAF 2E36A 3CD6I 1MMSA 3CC7I 1YJ9I 5GAGJ 1S72I 2ZJRF 2FOWA 4UY8I 1VQLI 1FOWA 2K3FA 1VQ9I 1YITI 1VQ7I 4V19K 3CCRI 1QA6A 1VQ6I 5DM7F 1WIBA 1Y39A 5GAHJ 1YHQI 3PIPF 1VQ4I 3CC2I 3CCVI 3CMAI 2ZJPF 1VQPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 F;  1VQN I;  3CCM I;  3CJT B;  2OTL I;  5JVG F;  3DLL F;  3CCJ I;  3G71 I;  3J7Z I;  3CCE I;  3I55 I;  2NXN B;  1YJW I;  3J7Y J;  1FOY A;  3CCS I;  2E35 A;  3CJS B;  1YIJ I;  1VQM I;  1FOX A;  3G4S I;  5GAE J;  1VQ8 I;  2E34 A;  1VQO I;  5GAD J;  2JQ7 A;  3CJQ B;  3EGV B;  1YI2 I;  1HC8 A;  3CCU I;  3I56 I;  3CCL I;  1YJN I;  1ACI A;  2ZJQ F;  3CC4 I;  3CJR B;  3CCQ I;  3CF5 F;  2H8W A;  3CME I;  2OTJ I;  3PIO F;  5DM6 F;  2QEX I;  4IOC F;  2QA4 I;  3G6E I;  1VQ5 I;  1VQK I;  4IOA F;  2E36 A;  3CD6 I;  1MMS A;  3CC7 I;  1YJ9 I;  5GAG J;  1S72 I;  2ZJR F;  2FOW A;  4UY8 I;  1VQL I;  1FOW A;  2K3F A;  1VQ9 I;  1YIT I;  1VQ7 I;  4V19 K;  3CCR I;  1QA6 A;  1VQ6 I;  5DM7 F;  1WIB A;  1Y39 A;  5GAH J;  1YHQ I;  3PIP F;  1VQ4 I;  3CC2 I;  3CCV I;  3CMA I;  2ZJP F;  1VQP I; 
#chains in the Genus database with same CATH topology
 2QZ8 A;  3OS2 A;  1LQ1 A;  1AWC A;  3BOQ A;  1UJ8 A;  2CO5 A;  2DYR H;  3O6B B;  2L9R A;  2PFB A;  3QP5 A;  1ETY A;  4B47 A;  4IEJ A;  2ICW G;  2JA8 J;  1W1W E;  3I71 A;  2NNY A;  4PUS A;  3CMM A;  1KGS A;  2PI0 A;  1YTY A;  3QP6 A;  1H8A C;  4L9J A;  4X0G A;  1FLI A;  2LKP A;  2VJJ A;  3M07 A;  1O7L A;  1ZKG A;  4CYC A;  1GXP A;  3LAJ A;  1JKP C;  2CQK A;  3ASN H;  3OWT A;  2G0E A;  1BR1 A;  5J6X A;  3E97 A;  4JQF A;  2JVH A;  3QU3 A;  5FFX A;  3IC7 A;  1KON A;  1YS7 A;  1Z91 A;  2LDU A;  4N0B A;  4Y15 A;  1PP7 U;  1ZH5 A;  2BVM A;  2EPF A;  1RUO A;  1I50 J;  3F3X A;  2VKD A;  1O57 A;  5KCM A;  1UCR A;  3DU5 A;  2F48 A;  5IP6 A;  4CCO A;  3W6V A;  3OYK A;  3A01 B;  1QNT A;  2KZG A;  5E8G A;  4UHT A;  2HOA A;  5E18 F;  1MND A;  1UST A;  1SFO J;  1YO5 C;  4C30 A;  1FMV A;  3FXO A;  4PK4 A;  1YFH A;  2M0M A;  2ZXH A;  1MH4 A;  2A5Y B;  2CUF A;  2W24 A;  5J4Y A;  5FLX K;  3DTI A;  2QGU A;  4JX6 A;  2ELK A;  2E5Z A;  3CME I;  2R7R A;  2XGD A;  2KHM A;  3SZP A;  5DM6 F;  1DQU A;  2VQL A;  1R22 A;  1T39 A;  2X48 A;  4A3E J;  3GLX A;  3LFU A;  2DPU A;  3I4M J;  2EIM H;  3TDZ C;  1H9T A;  1YG2 A;  5FFZ A;  5L3E A;  2GXG A;  1EV7 A;  3E6C C;  3FXR A;  2M8E A;  3U2R A;  2DA4 A;  4YEJ A;  2XHK A;  3LSP A;  1YW9 A;  2VKE A;  2HOS A;  2IS2 A;  3UKG A;  2HTJ A;  1J5Y A;  3WTS C;  2FOW A;  1D1B A;  2EFN A;  3FDY A;  3HRT A;  1JI8 A;  2F5E A;  4D5F A;  4C3I J;  5JVT A;  4MHG A;  4ITV A;  2B0L A;  4PJM A;  5E1X A;  2F5C A;  4AM3 A;  3ZGK A;  2FOK A;  3H0G J;  2M1B A;  4O6J A;  2DXI A;  2GLO A;  2M2E A;  2VC1 A;  1O7F A;  1YE9 A;  3A02 A;  1IN6 A;  2X85 A;  4MEX F;  5DUI A;  3RCO A;  3S3M A;  4KT6 A;  4PCQ A;  4XNF A;  4E7I A;  2DDB A;  2V1N A;  3S3N A;  1YX5 A;  2IXS A;  3FMS A;  1JXS A;  4XID A;  3ZCO A;  4CYD A;  3DCF A;  4BHP A;  2ADU A;  4U0V A;  3CCM I;  2V1X A;  3B6A A;  3TGN A;  3IL2 A;  2OTL I;  1L0O C;  3H5A A;  4BHB A;  2H1L A;  1P6R A;  4KA4 A;  1J9I A;  2O03 A;  4FTH A;  1SAX A;  2VON A;  4D5C A;  2V9P A;  2Y69 H;  3AFH A;  3K4K A;  5H2F C;  1JKQ C;  1A31 A;  2DCE A;  1BOB A;  3X2Q H;  3CDH A;  2A6E F;  1R71 A;  4ESJ A;  4EAT A;  2JA7 J;  5HS8 A;  4EV0 A;  1K83 J;  3H35 A;  4IRH A;  3CCS I;  4BDY A;  1IG7 A;  2EWN A;  4DOZ A;  1KQ8 A;  1FP2 A;  1MMD A;  5LLQ A;  1QO0 D;  3R0A A;  4BJT A;  1P4W A;  1OYW A;  5CKT A;  4BY7 J;  1N25 A;  2BYV E;  3HM5 A;  2BY0 A;  3NEU A;  4M74 A;  1LDD A;  2EZH A;  4YEL A;  4YFN F;  2XKO A;  2HOE A;  4DYC A;  1ONV A;  1ACI A;  1MDM B;  3GTO J;  1WQ2 A;  4OMY A;  2VPL A;  1A04 A;  1P9Q C;  2NRA C;  3MVP A;  5E3L A;  1Z67 A;  3JR9 A;  3EPZ A;  2VJ4 A;  3TOA A;  4IRI A;  1LB2 A;  4P9F A;  2COB A;  1X4P A;  1T95 A;  3ML6 A;  2STT A;  3RQI A;  4BE1 A;  4BQQ A;  4LLN A;  4L0Y B;  4LGW A;  2BOL A;  3KZI C;  2VL8 A;  5FGM A;  1SMT A;  2PBI A;  3CZ6 A;  2QBY A;  4XLC A;  3GME A;  3JSO A;  4A69 C;  5CPR B;  5EDN A;  3J81 K;  1GXQ A;  4F93 B;  2MC3 A;  5CQG A;  4IHY A;  1BOA A;  3CQZ J;  2DT6 A;  1IUF A;  2V7F A;  3QYF A;  3PNT A;  3FM5 A;  3KP5 A;  1BIA A;  2P81 A;  2RRE A;  1TT5 B;  5IY5 H;  1ETV A;  4Q5S F;  4E70 A;  3CUQ C;  3QYE A;  1E0E A;  1KU9 A;  3BZK A;  3FXL A;  4MQ9 F;  4BNC A;  1IUY A;  2X6Y A;  4GRI A;  1VQ9 I;  2QKM B;  1DGR M;  1Y1V J;  3OYF A;  2QQB A;  4FE7 A;  2ZB9 A;  1WIB A;  2JPB A;  4PFP A;  2LF7 A;  3M9A A;  2VKV A;  3CUQ B;  4LJZ F;  4KUM A;  2PEX A;  2HDC A;  3K0L A;  4IXA A;  4MQV A;  3CC2 I;  5CJ9 A;  1BBY A;  5H6Q A;  4AYB N;  4S0H B;  1Z9C A;  5FRO A;  2BY3 A;  1C0W A;  1FT9 A;  2BXY A;  3DKY A;  3HRS A;  3VYS B;  2P7V B;  1ZG5 A;  1P4A A;  3BJ6 A;  3K1M A;  1I39 A;  2E60 A;  3E3V A;  2R7T A;  4ENJ A;  3ABM H;  4WXC A;  2FNP A;  3DEW A;  3LQR A;  3HSR A;  4M3G A;  1ZGJ A;  1MNE A;  3C1D A;  4XL9 A;  4J00 A;  1U3E M;  3K4M A;  3FIS A;  4ZZD A;  3S2W A;  4OIO F;  2G7H A;  4AYB A;  1W5S A;  3KZZ A;  4A2U A;  1WPK A;  3TMO A;  1CF7 B;  2B63 J;  4DJA A;  3E5Q A;  2HDD A;  4L5I A;  4CH7 A;  2ELH A;  1UG0 A;  2R7X A;  3BJO A;  2DMT A;  3M4O J;  2MYS A;  1MBG A;  2G9W A;  2X6X A;  4ESF A;  1V4R A;  4G12 A;  2R7W A;  2R7O A;  1W7P D;  4HZF A;  4PGH A;  3GFI A;  2VBW A;  2IP2 A;  4FCY A;  2KKO A;  4RB0 A;  1HDP A;  2DMQ A;  2H6C A;  3ELK A;  4B3X A;  1LKX A;  2MA3 A;  2O6G E;  1IDZ A;  3AG2 H;  1FBU A;  3Q0U A;  3DLA A;  2KPM A;  1X58 A;  3R0J A;  4HLX A;  2BHZ A;  1X19 A;  5E1Z B;  4Q4Z F;  1J75 A;  3WTY C;  1LFP A;  2B7E A;  4NB5 A;  4OIP F;  4HAM A;  3JRB A;  4M3D A;  2ME0 A;  3K10 A;  2E5N A;  2DFI A;  3VWB A;  3KIO A;  4F92 B;  2PJR B;  3GZN B;  4Z2Y A;  2IGN A;  3JAM Z;  3PIO F;  2RQP A;  6PAX A;  2Y0M A;  4ZYG A;  3COA C;  1D5Y A;  3IKV A;  3RPU A;  2BW3 B;  4C3J J;  1POG A;  2CQ7 A;  3GLL A;  3LNQ A;  2O61 A;  3RYP A;  1DGW Y;  2QKL B;  1NG7 A;  2QA4 I;  3K4N A;  2JJ7 A;  4Z6Y A;  4I01 A;  5CVI A;  5IP7 J;  4BE2 A;  1W7P A;  4XON A;  1LVK A;  3OSF A;  3FMQ A;  2NVY J;  3GFL A;  3EUA A;  4M73 A;  1MKM A;  1IW7 F;  4L5E A;  3KX2 A;  5J1U A;  2ZSH B;  5HS9 A;  3N4M A;  2R7V A;  3JRE A;  1FP1 D;  4I98 B;  2L7F P;  3IH2 A;  2R3S A;  2VB6 A;  4A6D A;  4YFK F;  4D1Q A;  3FWE A;  3V7C A;  1IGN A;  2XVC A;  2FBK A;  1RKT A;  2EA4 A;  4A3J J;  5DDG A;  4XKV A;  4AIH A;  2LH9 A;  1X1C A;  2L4M A;  2W82 A;  5LGT A;  4RMN A;  4EJO A;  1HCR A;  3WGH A;  2KDZ A;  3O8G A;  4N9I A;  2CSO A;  4Y7N J;  3HOY J;  4PJJ A;  4ZYD A;  1Z7L A;  4ZTF A;  3CJN A;  4NHJ A;  1F4K A;  4DIQ A;  1UHW A;  2LTP A;  2W25 A;  1R49 A;  2EV6 A;  5KHD A;  4HNT A;  1IN7 A;  3ZR8 X;  1AKH B;  2DMU A;  3FBN B;  2H8R A;  5C4X J;  2QUF A;  3IRR A;  3HOS A;  4ZH4 F;  5DTD A;  3ZN1 A;  1REP C;  4OMZ A;  4D7M A;  4KIS A;  3KPH A;  1T08 B;  5DUK A;  4AVP A;  4IL6 C;  1GVJ A;  1SVL A;  3OSG A;  3TW6 A;  5BPI A;  4XSZ F;  2JVG A;  3T5X A;  3BPV A;  4DGW B;  5LBQ A;  2R5Y B;  4LFU A;  2VUM J;  1ZHF A;  1R1T A;  3S1N J;  4IHX A;  2DA7 A;  5HDG A;  2WBM A;  1FSE A;  3QPT A;  4ESB A;  1Y1W J;  1OYY A;  3T8R A;  3F23 A;  1JUP A;  2LR8 A;  1JTX A;  2ZFU A;  4IHV A;  3I5U A;  2LY2 A;  1RC9 A;  1GV2 A;  3SEQ A;  1KQ9 A;  4HW0 A;  4P5O A;  1QQI A;  4IQ4 A;  1W36 C;  4WXH A;  3L2V A;  1S7A A;  1IF1 A;  2ZSI B;  3HPG A;  2HYJ A;  1IV8 A;  1OCO H;  2P0W A;  3K7A J;  2XGE A;  4C2T A;  1OJL A;  2M9H A;  3V42 A;  3MEX A;  1BL0 A;  1BI0 A;  2HPI A;  3LSG A;  2O8K A;  2NS8 A;  1G3Y A;  5D4S A;  2E71 A;  3F8B A;  3KP6 A;  5FLM J;  1B8I A;  2ZBK A;  1EH7 A;  3AG1 H;  2TDX A;  5M3M J;  5IT9 Z;  5AON A;  3P9C A;  2DA2 A;  3H92 A;  4OIR F;  1UMQ A;  2MSY A;  1EJ9 A;  1JT6 A;  2CJJ A;  1J7K A;  5IOZ A;  2HQA A;  2P5V A;  2UV1 A;  2V26 A;  4LOC A;  3CC7 I;  4OIQ F;  2FU4 A;  2GIV A;  2IRF G;  2HS5 A;  3HHG A;  1S72 I;  2E2I J;  4KIG A;  3DU6 A;  1V5G A;  1FBQ A;  1I6X A;  2HVQ A;  2A61 A;  1A36 A;  3K1N A;  4KDP A;  4P55 A;  1ZYR F;  1J59 A;  3HEF A;  2KP6 A;  4XLP F;  2L54 A;  3JSP A;  2X1E A;  3OOU A;  2I5U A;  2FRH A;  4I02 A;  4CCJ A;  4A3I J;  3NWS A;  3S8P A;  1TZL A;  2LY1 A;  1YQA A;  4HF1 A;  5GTI C;  2KRF A;  4XOP A;  3I9V 2;  1BIB A;  2R7D A;  1HLV A;  5HLI A;  1FMW A;  4BBS J;  1R23 A;  1VQP I;  2D1V A;  3HKZ A;  5K1Y A;  3S16 J;  1I27 A;  1I1S A;  3GZ5 A;  2EFP A;  5K7F A;  3ZQL A;  1BJA A;  2EFO A;  2OCE A;  3BQZ A;  2O3F A;  4EM1 A;  4XQF A;  4RGX A;  3KCC A;  3H3V K;  4HX7 A;  2KJB A;  3DV8 A;  3KEY A;  5FKM A;  3LOC A;  3GBG A;  3MQ0 A;  4UVC A;  3TOB A;  2HU9 A;  1HKT A;  4EM2 A;  4BYY A;  4LG0 B;  4BQA A;  1I1G A;  5F0H A;  3ZMT A;  4B43 A;  5FKL A;  2Z2S B;  5EZH A;  3WTX C;  2K7L A;  2V6C A;  3L2C A;  5LGU A;  4B44 A;  1O4X A;  5F0C A;  3TP0 A;  1B9N A;  3ZPL A;  4IKF A;  4EEF G;  5HOD A;  3F72 A;  3DQV C;  2F2E A;  1KU3 A;  1T0F C;  3TDU C;  4G7H F;  2A69 F;  3K4J A;  2DT7 B;  1PJR A;  3JW4 A;  3ONQ A;  5FRM A;  5AIP A;  2R7Q A;  1KQ0 A;  3SDB A;  1MH3 A;  1OLT A;  1OIS A;  4FE4 A;  3V8K A;  2WAF A;  3JRC A;  1YI2 I;  2KRH A;  4UVA A;  4XRS A;  4O5V A;  1XX5 A;  3WTZ A;  3J81 Z;  1YX3 A;  2QBY B;  4IQJ A;  1XD7 A;  1FOK A;  3AKZ A;  3OIQ A;  4U0Y A;  1ZR4 A;  2XAF A;  1NG6 A;  2EJR A;  1F1Z A;  2WAE A;  1EH8 A;  3CC4 I;  2ZJ2 A;  2DBB A;  2JPC A;  4LG3 A;  3L1P A;  2LYC A;  4UB6 C;  1X3W B;  5EEA A;  5EGO B;  3QAH A;  3BY6 A;  1D8J A;  3ABT A;  4XMY A;  1K4S A;  2WV1 A;  1TC3 C;  3J7A O;  2AQF A;  2JMW A;  2CV0 A;  1OYI A;  2D2W A;  4G7Z F;  4DYQ A;  4A3K J;  4L18 B;  2MBF A;  3F8N A;  3GVA A;  4NBQ A;  3HYI A;  3VYT B;  1FYM A;  1TLH B;  4PJN A;  1MMS A;  4V2G A;  4QLC U;  1B4A A;  4II2 A;  2CH0 A;  2HVS A;  3HJE A;  3QPL A;  2LK2 A;  5K5R A;  3D5S C;  2IA0 A;  1K78 A;  3H36 A;  4DZJ A;  4RB3 C;  1Y6I A;  1CQT A;  3WU2 C;  1ZGW A;  2L9S A;  5BOX A;  1G6N A;  3ECH A;  4CYC B;  4YIF A;  3DKW A;  1Y39 A;  2KLO A;  4HST A;  1EA3 A;  3WGG A;  1SC7 A;  1VQ4 I;  1WJE A;  1JUS A;  3CCV I;  5J1R A;  2KDO A;  4UUS A;  2ZJP F;  1QZY A;  1E17 A;  1IN4 A;  2ZNY A;  3OYJ A;  4IHT A;  1S29 A;  2OU2 A;  4FIS A;  3L00 A;  5ILS A;  1X1D A;  1U2W A;  5IYB J;  3ZQC A;  1DU0 A;  1XC5 A;  4IJA A;  2ECB A;  3F6O A;  1NK3 P;  2EIJ H;  2VJ5 A;  1MBH A;  2MD5 A;  2HGC A;  4UVB A;  2O5R A;  1P92 A;  3HSF A;  3CTA A;  1TWF J;  1LEA A;  1XSD A;  3ZMD A;  3RPQ A;  1PP8 F;  3QOP A;  3NRV A;  1SAN A;  4CXF A;  1HA8 A;  1CGP A;  5JLX A;  3A03 A;  4AU7 A;  3CO7 C;  2ESH A;  3HOT A;  4A3G J;  3HG9 A;  3MFK A;  3OYG A;  2CU7 A;  5ILU A;  4ETS A;  2AXL A;  3AL0 C;  1LE8 A;  2KQR A;  1K7A A;  2IA1 A;  2Z33 A;  3OS0 A;  5DYM A;  3FK6 A;  3L2U A;  1GVD A;  1Q1H A;  3ZMS A;  1FOY A;  4EM0 B;  2VE8 A;  3ISP A;  3G2B A;  1YIJ I;  2OUM A;  2XB5 A;  2M4K A;  2VBZ A;  1FEX A;  4KFC A;  5ICE A;  3IAS 2;  3P9K A;  4Y13 A;  1SFU A;  4BS9 A;  4AWX B;  2F5D A;  2OPT A;  2LC2 A;  3ABU A;  3R6S A;  1L3L A;  3ERE D;  4OU0 A;  1HC8 A;  2IBD A;  2GBY A;  2AO9 A;  1X3U A;  2HNH A;  2UXX A;  1STZ A;  4A5M A;  3GYH X;  5IT3 A;  3I53 A;  4WF2 A;  3CJR B;  1BA5 A;  4BL0 B;  1WJB A;  2CQX A;  2M3A A;  4ZJZ A;  4EGY A;  2R92 J;  5ICF A;  4WXD A;  2AXT C;  5LGN A;  3ZRG A;  4CSW A;  4I7H A;  1UAA A;  9ANT A;  1WHU A;  4UUT A;  4BGD A;  4BAC A;  5M3F J;  3TBI A;  1ETO A;  3PNV A;  2L7K A;  3TO6 A;  5E1W A;  4E7L A;  1D8K A;  2M0C A;  3I54 A;  1Z3X A;  4MEY F;  2XAQ A;  2FNA A;  3KP7 A;  2UZK A;  3VSL A;  4H4K C;  1TQM A;  5H6R A;  4PFO A;  3UNG C;  1CF7 A;  1WJ5 A;  4ZDL A;  1HW1 A;  2L4A A;  4MTE A;  2X1D A;  3OYH A;  3K2A A;  4C2U A;  2DOF A;  1E3O C;  2E2J J;  4UY8 I;  1WH5 A;  1VQL I;  3IAM 2;  2LY9 A;  2VT3 A;  1ZEL A;  4V19 K;  3A0H C;  1KZH A;  2EIL H;  2KIS A;  4KJZ A;  2LG4 A;  1U9O A;  4QWQ A;  1FPQ A;  2NS0 A;  2XAJ A;  3CLO A;  2Y0S N;  1F9N A;  4LG0 A;  1MMA A;  4LK0 F;  4AIK A;  2Z16 A;  3KP3 A;  3ABL H;  3SZG A;  3REO A;  5HDK A;  4HX4 A;  3H3Z A;  3QWL A;  3VDX A;  2L3D A;  3ZP5 A;  3GW2 A;  3K4L A;  2HYF A;  1IRF A;  1KYW A;  4BE0 A;  2F4I A;  5CLS A;  1LDK B;  1T98 A;  2J5P A;  3PUF A;  2V1U A;  1D0Z A;  2BY2 A;  2DA3 A;  3ROU A;  2QQA A;  1MBJ A;  2NYX A;  2DJI A;  2IEK A;  2DTZ A;  3AG3 H;  2A6H F;  1GDT A;  5ED4 A;  4CHU A;  2NOG A;  4DNC A;  4IX7 A;  1RIO H;  2F5F A;  5HLG A;  2XGC A;  3O3K A;  1XMA A;  3DBR B;  2MLG A;  1B9M A;  1HKS A;  1T56 A;  1EH6 A;  1S8N A;  3J80 K;  3WU1 B;  3I55 I;  4BUP A;  2LF8 A;  3TQN A;  1Y56 A;  1R6R A;  3OYL A;  3PO3 J;  1AOY A;  3K69 A;  3FF5 A;  1RKW A;  1XGM A;  4M72 A;  5M5W J;  2EFQ A;  3J80 Z;  2QSH X;  1B72 A;  4ZYH A;  2XAU A;  4NQW B;  2DTR A;  1VQ8 I;  1R36 A;  2KMU A;  3JRD A;  3LSI A;  2QVO A;  3OIO A;  1FNN A;  1WJA A;  4RBO A;  5ILV A;  4A12 A;  1TNT A;  5KVR A;  1MD0 A;  1YJN I;  2JK3 A;  3W2V A;  1FTZ A;  3E7L A;  4IPA A;  3PSI A;  2VXD A;  2XDV A;  2WV0 A;  2PQ8 A;  1SMY F;  1FTT A;  3HRM A;  2H8W A;  2YUS A;  3BR0 A;  3JCU C;  1TW2 A;  3M1C A;  1X4O A;  4E7J A;  5H20 A;  1RR8 C;  4NQW A;  4MTD A;  4KIF A;  5C3E J;  1S9H A;  2D1H A;  3IRQ A;  4AIJ A;  5GTH C;  2JUG A;  1U5T C;  3DPL C;  3P9I A;  5LRS A;  2E1O A;  3P7N A;  4DZP A;  2HDW A;  5CVR A;  5F1R A;  3KEO A;  3S93 A;  1WSU A;  5K5Q A;  3RKY A;  2OA4 A;  3W6K B;  1Z0X A;  2M87 A;  1YJ9 I;  2DI3 A;  1RNL A;  3M1E A;  4M6V A;  3H0D A;  2X0L A;  3CF2 A;  1HXD A;  3MCZ A;  5EF6 A;  2ZME B;  5BNG A;  1WZ2 A;  4XIC A;  3FMR A;  2RDP A;  1ZG3 A;  1G8X A;  3S32 A;  1T8I A;  2KIU A;  5IOY A;  5DM7 F;  2C6Y A;  3FXM A;  3DEE A;  1FZP B;  3E5X A;  1RES A;  2GM4 A;  3PIP F;  2ZME C;  2YPR A;  5BS6 A;  3CP8 A;  5KAF C;  2BGC A;  3LAP A;  3VYR B;  3CMA I;  1FY7 A;  1S6L A;  1SFX A;  2E1M C;  3PFY A;  4FAS D;  3ZQQ A;  1QRY A;  3H5N A;  2FA5 A;  2DYS H;  1F36 A;  1TQI A;  4IO9 F;  3GWZ A;  3ASO H;  2LSO A;  3CJT B;  1H88 C;  1IAW A;  4GDF A;  1T0F A;  5FKO A;  1JKR C;  4X6A J;  3HIF A;  2M7B A;  2FML A;  3HBL A;  4B48 A;  5D6F A;  3OYM A;  4KIB A;  1Z21 A;  1K6Y A;  2L2O A;  4RB1 A;  5CQE A;  3E0J B;  3LQQ A;  2HQR A;  5HOO A;  3DF8 A;  3E6B A;  4HA8 A;  4BXU A;  4CCK A;  2V4J C;  4DBQ A;  2HFH A;  2X6O A;  3T1B A;  4RGS A;  1R58 A;  2V1D A;  1MBF A;  2CW0 F;  2JN6 A;  3HXL A;  2DW4 A;  3R60 A;  3S1M J;  1QZZ A;  1Z1D A;  3CJS B;  3M8J A;  1ZR2 A;  3DBH B;  2LP0 A;  3U9G A;  4OIN F;  1N75 A;  3D5L A;  1ENH A;  1AU7 A;  3GFM A;  5F0F A;  3JRI A;  2N8G A;  1SD4 A;  5L3C A;  5EGO A;  1JUM A;  3F9K A;  3GZ6 A;  4ENM A;  2EZK A;  5IT9 K;  1MMN A;  3I56 I;  2W84 A;  1GHC A;  1V54 H;  4NUB A;  2RN7 A;  5D8K B;  3DP7 A;  3OYA A;  4XKB A;  2VE9 A;  4OWR B;  4I6Z A;  2RAE A;  3BCA A;  3CCQ I;  2P5K A;  1UB9 A;  5EEG A;  2R7F A;  3IWF A;  5DCF A;  1JE8 A;  3MKZ A;  2KJC A;  2MFZ A;  1U0J A;  1D3Y A;  4A5N A;  4U7B A;  2BE5 F;  2DU9 A;  1USS A;  1P7J A;  3EYI A;  1VQ5 I;  3H9G A;  2BBY A;  1O3T A;  2XPV A;  2E36 A;  2JT1 A;  1BM9 A;  2VQG A;  1V5E A;  3I4P A;  3EUH C;  2V79 A;  1ZTR A;  4XRS G;  4C3H J;  2RKH A;  1HKQ A;  3EUK L;  2E19 A;  1ZRF A;  3OYC A;  3GTP J;  4ANJ A;  5GAG J;  2VQC A;  4I0B A;  3GTQ J;  4EJV A;  2UWM A;  2HKX A;  3MMY B;  4X1E A;  1F43 A;  4HNV A;  3LWF A;  2BV6 A;  2Q8K A;  2I10 A;  2PMH A;  2PMZ A;  2Y31 A;  1WGX A;  2HYG D;  2PG4 A;  5IYD J;  3B6C A;  1I5Z A;  2X1C A;  1KU2 A;  3SZT A;  3I59 A;  2IGM A;  4KNY A;  1IN5 A;  2DQR A;  3B02 A;  5AIQ A;  1RZ4 A;  3TO9 A;  2OAZ A;  2FD5 A;  4M3E A;  4QSH A;  2R5Y A;  2FJ1 A;  2V9K A;  1D0Y A;  1VF9 A;  1QBJ A;  3HOV J;  1YLF A;  3V7R A;  4UUS B;  1ULY A;  3LMM A;  3RQ4 A;  2VAS A;  4EJT A;  4JBA A;  3K4B A;  2R5Z A;  4GGG A;  3K6G A;  1IDY A;  2FX0 A;  4MNU A;  4RA2 A;  4BXF A;  3GO5 A;  2LKS A;  1LDJ A;  2PJP A;  4RM3 A;  3ZOB A;  3OL3 A;  1HSJ A;  1Z3Y A;  4HOB A;  2CRG A;  3WTT C;  1FIA A;  2OQG A;  2E2H J;  5IP9 J;  2QYO A;  3SQN A;  2JA5 J;  3PQJ A;  1DPR A;  1X1P A;  3HB9 A;  4G94 A;  2EH3 A;  4YIR X;  2CFO A;  3G71 I;  5CVV A;  3RYR A;  5K7Z A;  2Y0S A;  2F5V A;  2HZD A;  3CCE I;  1TWH J;  1TT0 A;  3BTI A;  3I3L A;  2MD0 A;  4HEA 2;  2NXN B;  4PZJ A;  4HYE A;  3BTL A;  2WTE A;  1EKE A;  1A35 A;  3ZQI A;  1G59 A;  1ETX A;  2A5W A;  4M9X A;  3HUG B;  4G8X A;  1TP4 A;  4WCG A;  3RZO J;  3A01 A;  3S2H J;  1QPM A;  4GFB A;  3GUD A;  2JUC A;  1VI0 A;  4GYG A;  4ZYA A;  2Q2E A;  2LOO A;  1WWX A;  3VEP A;  1VND A;  2NVU B;  3HOX J;  4BXX J;  3K9T A;  4PJ0 C;  2OV7 A;  2M45 A;  4R1H A;  3VOD A;  2GOX B;  5B1A H;  1YRN B;  2MH9 A;  1LPQ A;  3BP8 A;  2O0Y A;  3EUH A;  3R61 A;  4JP0 A;  4B1R A;  2JZY A;  3RKQ A;  2DOE A;  3L9F A;  3FKI J;  1I6H J;  2DAO A;  1JHH A;  4IF4 A;  4F55 A;  5E20 A;  1YIO A;  2K85 A;  5F08 A;  1NK2 P;  1D0X A;  1E3H A;  1G3S A;  3ZMV A;  4E4H A;  3GF2 A;  3BJA A;  3AAF A;  1HQC A;  3RSN A;  5D5X B;  3RI4 A;  1YRN A;  1VQK I;  2JTV A;  3U21 A;  4CZC A;  2VKH A;  4LMY A;  4A0Z A;  4QTR A;  4EGZ A;  1P7I A;  1SD6 A;  2XV4 S;  5CVJ A;  2P6S A;  1LVA A;  4LD5 A;  2EZI A;  4BEH B;  2JA2 A;  1IXC A;  2EA2 A;  3ZMU A;  2R7U A;  3K70 C;  1WI3 A;  3G1M A;  3ZQ7 A;  3DKX A;  4D0P A;  4JX4 A;  1K6O A;  2AS5 F;  2AHQ A;  2K3F A;  1XB4 A;  1RPW A;  2L0K A;  4HQE A;  4XSX F;  1BW5 A;  2XF6 A;  1H9G A;  1DPU A;  2IJL A;  3K2Z A;  4Y3O A;  3PJR A;  4ZZL A;  1R9T J;  4JOM A;  1YOV B;  4XN0 A;  3MZH A;  1XTA A;  2HQN A;  2OCC H;  3WHB A;  2BVL A;  2I8D A;  3LSR A;  1BR2 A;  3SDG A;  4FET A;  3L7W A;  4NNJ A;  3WGI A;  1XCB A;  3VFZ A;  4ABZ A;  2H09 A;  4RAY A;  3OYD A;  4UNO A;  3WE3 A;  4HV5 A;  1VQN I;  5B66 C;  1WVR A;  3CP2 A;  2YS9 A;  4QPO A;  4RM2 A;  1LFB A;  2ZXJ A;  5D6E A;  3BDD A;  4KN7 X;  1MMG A;  5JVG F;  4KMU X;  2LBF B;  4MGR A;  5E3M A;  2YSR A;  4OAY A;  1ZGA A;  3U1K A;  2MW8 A;  4KT5 C;  5E17 F;  2GA2 A;  4RGU A;  1WCM J;  3PUB A;  1FX7 A;  2XKP A;  2GAU A;  1E3P A;  2TRT A;  3R4K A;  5M5X J;  2R0Q C;  5F04 A;  5HVQ C;  2DA1 A;  2VI6 A;  4UV9 A;  2EIK H;  1GUU A;  3IUO A;  1TWC J;  1ITY A;  3J7Y J;  2M34 A;  3MKW B;  2FEZ A;  1H89 C;  5A2Q K;  4PDK A;  4ZTJ A;  1ZLJ A;  1W0U A;  3A1Y A;  4XRM A;  1IN8 A;  4M6X A;  3DWL E;  3LA7 A;  2WC2 A;  1R1V A;  1TWG J;  2FQ4 A;  4WX9 A;  3DPT A;  2VN2 A;  3A0B C;  3L09 A;  2IS6 A;  3HZJ A;  3EGV B;  2XAS A;  2OF7 A;  1R4N B;  3CCU I;  1E2X A;  2CQQ A;  4DBR A;  4MIM A;  3MZY A;  3OR1 C;  2R7Z J;  1P4X A;  4E6K G;  4N4O B;  1QHH D;  4F7Z A;  2E1C A;  4W97 A;  1IRG A;  1O3S A;  5TIS C;  1R1U A;  2ESN A;  3LA2 A;  2KIM A;  2FUG 2;  5C44 J;  3NWT A;  3KEQ A;  1J09 A;  3HUG A;  3KLO A;  4KYW A;  5JFR A;  5LEK A;  4M6Y A;  3Q5F A;  1UG2 A;  3BTC A;  2NS7 A;  2CW7 A;  2H94 A;  4R79 A;  2QWW A;  1XGO A;  2WAQ N;  2KRC A;  5CVU A;  4L9N A;  4YII A;  1ETW A;  4HBL A;  1MSF C;  3WU0 A;  2ME6 A;  2EV5 A;  1YYV A;  1HOM A;  4JK1 X;  1XDS A;  2CYY A;  2IT0 A;  3S14 J;  2OZ6 A;  1S3J A;  1FSH A;  2ECC A;  1ZAR A;  3TL4 X;  1U8R A;  1G4D A;  2XSD C;  2YU9 J;  2DA5 A;  3E1S A;  1TL8 A;  1VQ7 I;  2HXI A;  1X2N A;  3OV8 A;  4MO7 A;  1PUE E;  2DQL A;  3TED A;  4H0E A;  2EK5 A;  2JSC A;  1LE8 B;  5L3B A;  2VQH A;  2DMP A;  2LRE A;  1ZRC A;  1FYK A;  2Z99 A;  4U0W A;  4B8X A;  1WJF A;  4Y33 A;  3CUQ A;  2NNN A;  4XK4 A;  4AUX A;  2ACJ A;  1OMI A;  3RIR A;  1DP7 P;  1MBE A;  4XLH A;  5J40 A;  1A5J A;  1T33 A;  3HC7 A;  1MIJ A;  4A0X A;  1QVT A;  2X51 A;  1XGS A;  4FX4 A;  3FHZ A;  1ZAO A;  1LNW A;  1KA8 A;  3RKW A;  3OOP A;  1SFK A;  3KZY A;  3A2K A;  3BR3 A;  5EG0 A;  2DMN A;  4HPQ A;  3V8L A;  5KK1 A;  3OIP A;  4ENN A;  1GT0 C;  1BI3 A;  2NVT J;  2K02 A;  2ZC2 A;  3GTG J;  4EVI A;  2XPU A;  3HTU A;  4L9T A;  2NOJ B;  5DS9 A;  2A68 F;  5KAI C;  2HWV A;  1TWA J;  3OMY A;  2TCT A;  3G1L A;  5D5W B;  3HL2 A;  1VFC A;  2JQ7 A;  2GXA A;  3K1P A;  3S17 J;  4B4C A;  2CV1 A;  3GXO A;  5ICG A;  2ETH A;  5C4J J;  3CCL I;  3FBI B;  1LEB A;  2PMU A;  4MFE A;  3VYU B;  4DYR A;  1XSV A;  3Q9S A;  4HF0 A;  2W85 A;  4HQM A;  1ETQ A;  1XSX A;  1T38 A;  4LB5 A;  3KLN A;  2ELJ A;  1B8I B;  2LNB A;  1ZRD A;  3VB2 A;  1X1A A;  3JTG A;  4V2F A;  4M71 A;  3ZMZ A;  3JTH A;  4NC6 A;  1PVE A;  4FHT A;  3OS1 A;  1UHM A;  1W5C C;  1FC3 A;  3WG7 H;  2MLK A;  5FO5 A;  3ZQH A;  2IAI A;  3K70 D;  3EDP A;  3O8H A;  2XB0 X;  4BQN A;  2F4O B;  4KIC A;  3KP2 A;  3NQO A;  3JRH A;  3BPX A;  2EFW A;  4A93 J;  4AD9 A;  5DV5 A;  3WOD F;  1RRJ A;  3WE2 A;  3DPU A;  1R5H A;  4O3M A;  5HS7 A;  4U7D A;  1PUF B;  2CFX A;  3CLQ A;  1R7J A;  2LVS A;  3CCR I;  3HKZ N;  2Q1Z B;  2HVR A;  1IJW C;  5TGT A;  2BW3 A;  2W00 A;  3DTE A;  2ID6 A;  2K40 A;  3LFK A;  4F91 B;  1MJ9 A;  5GAH J;  3FXQ A;  2EBI A;  3S1R J;  2YR2 A;  4BJ5 C;  2XC7 A;  2CUJ A;  4EMS A;  4OOI A;  4IHS A;  3BR6 A;  4RAZ A;  4XLA A;  2DFH A;  1BR4 A;  3SXY A;  1K4T A;  1B1B A;  1UHS A;  3QOE A;  2M30 A;  1PUF A;  4HSR A;  2M5W A;  3CES A;  3WTV C;  3BWG A;  3EET A;  4C9Y A;  2K86 A;  2CV2 A;  2ZO4 A;  2BZT A;  2NVQ J;  4BBR J;  1ON1 A;  1B6A A;  4Y52 J;  1Z05 A;  3BCB A;  1G2H A;  2VBX A;  1J0R A;  2Y2Z A;  2ISY A;  2ZCW A;  4LK1 F;  3PQK A;  2A6T A;  4I2O A;  5EYR A;  2GXB A;  2BXZ A;  3G73 A;  1FJL A;  3C18 A;  3PL8 A;  3O2P E;  4CUG A;  1FYL A;  2H6B A;  3K4C A;  1MDM A;  5F64 A;  1Z6R A;  5L3F A;  1YW7 A;  5E3O A;  1OCT C;  2KL4 A;  3IV5 A;  2E35 A;  2HXO A;  3ESW B;  2DFF A;  2DOA A;  3V8J A;  1VQM I;  3H9Q A;  3DBL B;  4Q48 A;  4DW6 A;  5K7H A;  2OQR A;  2DT5 A;  3RKX A;  1UFM A;  3KFW X;  5D4R A;  4RLQ A;  3H9J A;  1AHD P;  3HOZ J;  4IZZ A;  3C2H A;  1PYV A;  1DUX C;  1VQO I;  5HLT A;  2RVC A;  3QYB A;  4DQ2 A;  1OCZ H;  3CJQ B;  3BTJ A;  3DEU A;  1RET A;  2UUZ A;  2KIQ A;  4JYK A;  2OBP A;  1A6I A;  1Q1V A;  2E1M B;  2KZV A;  4YFX F;  2VBY A;  4G6T B;  3Q0V A;  3SYT A;  3OR2 C;  4AID A;  4XKW A;  5J8C A;  2XRN A;  2IS4 A;  3IP4 B;  1LJ9 A;  5EG0 B;  3HDD A;  1T2K A;  3BZC A;  2H1K A;  1HBX G;  2OTJ I;  2VOP A;  1TTY A;  1FWZ A;  2FE3 A;  1HW2 A;  1DDN A;  2L02 A;  4HX8 A;  4OAZ A;  4CZZ A;  3HRU A;  1SFE A;  1XN7 A;  4G6Q A;  2QEX I;  4BDZ A;  4I99 C;  4XM3 A;  2IGK A;  4PGG A;  1IZ1 A;  2RNG A;  3Q3S A;  2VOD A;  3HGG A;  4GO1 A;  2CUE A;  3I58 A;  4TV7 A;  3RDI A;  2W4S A;  1SD5 A;  3S3O A;  5BPD A;  3QRF F;  2HZT A;  1U5T A;  4CDG A;  3OL4 A;  3KYC B;  1BC8 C;  4J19 A;  3DTK A;  4KMF A;  4N4N B;  1HF0 A;  5LEJ A;  4RAF A;  4AC0 A;  3C3W A;  3KYL A;  3W2A A;  4IHW A;  3CO6 C;  1HDD C;  2XSJ C;  4Y4R A;  5CYV A;  4A3F J;  2HPM A;  4FT8 A;  4P1W A;  4D9J A;  3WG9 A;  1W5T A;  4G9Y A;  5HNF A;  4BEH A;  1GV5 A;  2Q2E B;  1YW8 A;  2L5Q A;  1U5T B;  4QIW N;  2ZKZ A;  3D1N I;  4CO8 A;  3ERM A;  3SFI A;  1DP3 A;  3H5R A;  3FM3 A;  3S1Q J;  2BEO A;  2R4G A;  3L2W A;  4E7Z A;  5DD4 A;  2XRO A;  2G7U A;  3GCM A;  3WTU C;  4E7K A;  2VIX A;  3OYN A;  2M8G X;  4I76 A;  1V3F A;  4M9S A;  3ZQG A;  4BQO A;  2IPQ X;  2W57 A;  2ISZ A;  3RZD J;  3N05 A;  4UUV A;  3J7A Y;  2QSF X;  4BKX A;  1R5I D;  3LL7 A;  3LST A;  3QPS A;  4L5J A;  1WFX A;  1MNM C;  2F6C A;  2FXA A;  3BG7 A;  1M1E B;  3J7Z I;  1ON2 A;  4E7H A;  2RQQ A;  4BAY A;  3RPU D;  1WJD A;  1Z6T A;  5BQT A;  2EB7 A;  3JRF A;  1ZK8 A;  2A05 A;  3T0Y A;  2DA6 A;  3FZV A;  1LUJ B;  1FOX A;  2DDA A;  3BT9 A;  3IWZ A;  4ASN A;  1ZG1 A;  2DFE A;  4BY1 J;  3CDI A;  3BR5 A;  4UXN A;  2HQ5 A;  3VSK A;  1JT0 A;  3W6J B;  3DXJ F;  4RGR A;  3QU6 A;  3W3C A;  4P9U A;  4HNU A;  4BHC A;  2IGO A;  1Y8R B;  3C7J A;  2FBI A;  5JLW A;  3M7G A;  1XGN A;  5E8I A;  1X2M A;  2A3S A;  1OCR H;  1D1A A;  3FKJ A;  3IHU A;  3GTJ J;  4XN3 A;  1BN5 A;  1BI1 A;  1JGG A;  3NAR A;  5J1Y A;  2DOD A;  4IOC F;  2O7O A;  2WAD A;  4L9V A;  1K79 A;  2JRM A;  4U88 A;  3HPH A;  4CCL A;  3G6E I;  3FX3 A;  1OQY A;  4RDU A;  2WWY A;  3CD6 I;  2Z5U A;  2Y9Z A;  2M7A A;  1ERD A;  1IRX A;  5LFA A;  4BH9 A;  1TQP A;  2K4B A;  2LMD A;  3NAU A;  1QVU A;  2XF5 A;  4LIU A;  2ZFW A;  3IH4 A;  5FKK A;  2B9S A;  1YS6 A;  1IC8 A;  3MZ8 A;  4KIT B;  3JRA A;  2R93 J;  1N78 A;  2JRT A;  2QEN A;  3BG3 A;  4F52 A;  5D5V B;  5F1J A;  1V55 H;  1VQ6 I;  3HGY A;  4YRV A;  3UR3 C;  1MJB A;  5IPA A;  5HNH A;  3LSH A;  5EEH A;  5J3L A;  2XAH A;  3LSK A;  2CMP A;  4MFD A;  1XMK A;  1G3W A;  2Y30 A;  2DLL A;  2HR3 A;  3V4G A;  3ECO A;  2ID3 A;  1W0T A;  1D1C A;  3MKL A;  2XRL A;  2XPW A;  1WI9 A;  3ZN0 A;  4A3D J;  1TBX A;  2W7N A;  2OD5 A;  3GTL J;  5DEQ A;  5EJC A;  3TO7 A;  1XS9 A;  2KIF A;  1K78 B;  3M8F A;  1JHF A;  2LKX A;  3PNY A;  2K9M A;  3M3Y J;  3TW7 A;  2K4J A;  3V7S A;  4B3A A;  2GA1 A;  2VT2 A;  4XLE A;  1U9N A;  2Y9Y A;  3ABK H;  5JHU A;  1U6G A;  3GTM J;  3CCJ I;  1J2X A;  1I3Q J;  1MW7 A;  3FXK A;  3FHN A;  3KYD B;  4XRF A;  3EQL F;  5M5Y J;  1BJZ A;  1OR7 A;  1JJ8 C;  5J8F A;  4HF2 A;  2P8T A;  2K9Q A;  2FSW A;  2K27 A;  5K5O A;  2M4G A;  4M3F A;  2K5C A;  3MKY B;  5LHG A;  5FLX Z;  4ZYE A;  3H3U A;  1ODD A;  4CA0 A;  4II3 A;  4C2M J;  2HI3 A;  2DK5 A;  5LHH A;  1ZQ3 P;  4A0Y A;  1NHA A;  3G4S I;  1BW6 A;  1OCP A;  3U1D A;  2E34 A;  1JTY A;  1VTN C;  3PSF A;  4M9Z A;  2V9V A;  3WHC A;  2CW8 A;  5F6F A;  3I64 A;  3LSJ A;  4U87 A;  3E5U A;  3ZXS A;  3TKY A;  2ZJQ F;  5DCM A;  3HOW J;  2IW5 A;  1MSE C;  2YX7 A;  4A3B J;  1RR7 A;  2A07 F;  4BJ6 C;  4UV8 A;  5LHI A;  2VC0 A;  4XOR A;  4LLG F;  4XKC A;  2WB1 A;  5IYC J;  2GWR A;  1QGP A;  2QCO A;  4R8H A;  1X3Z B;  2X6W A;  2R7S A;  1ETK A;  2E1N A;  2ZNZ A;  5F27 A;  5FD5 A;  2K9S A;  4HDU A;  1H0M A;  1Y0U A;  2PX9 A;  3E6M A;  4ENK A;  1Z77 A;  1S7O A;  4L0Z B;  4PJL A;  3MD2 A;  1W4M A;  3ZQF A;  2VXZ A;  5JI6 A;  1HW5 A;  2L7Z A;  3AL0 B;  2AQE A;  1IRZ A;  2ZJR F;  1XG1 A;  2P6T A;  3S15 J;  1XCV A;  2Q0O A;  4N9H A;  4CIC A;  5ERI A;  3FXU A;  3F21 A;  2LBF A;  4WWC A;  3N97 A;  3FXJ A;  5JR3 A;  3SHF A;  1YIT I;  2CS3 A;  1ZRE A;  3G1O A;  4EJU A;  1RI7 A;  2E7W A;  4GCV A;  3FK7 A;  2Z3Y A;  2MAB A;  4LIV A;  3BG9 A;  5E79 C;  4J01 A;  2HTS A;  2QQ8 A;  3SJM A;  4P96 A;  1TW3 A;  4A3C J;  3L2R A;  4WK8 F;  4CGZ A;  5B1B H;  3KE2 A;  4RB2 C;  5BMZ A;  3CDL A;  4HG2 A;  1LFU P;  2DPD A;  3IKT A;  2P5L C;  2GOM A;  3Q0W A;  3QPH A;  4A3L J;  4UB8 C;  3I4N J;  2YX4 A;  4F3Q A;  2E7X A;  3I0T A;  2VPR A;  1OCC H;  3Q9V A;  3KET A;  5JHF A;  1WKM A;  3G3Z A;  3RTR A;  2K3P A;  2KFD A;  5B5E C;  1BI2 A;  5FB2 A;  2QF7 A;  3E6D A;  3PM1 A;  2O9L A;  2J5O A;  3FIW A;  4I0A A;  2QM3 A;  1OR7 C;  2LD5 A;  3BZ6 A;  2R5Z B;  5FJ8 J;  1YJW I;  2VLA A;  3HTS B;  2STW A;  3BRO A;  1KU7 A;  3SEZ A;  2EQR A;  2RV8 A;  4CCN A;  1ZLK A;  1OPC A;  2ZME A;  2XF7 A;  2L9V A;  3H1C A;  3MWM A;  1MJA A;  3GEZ A;  4I09 A;  3OY9 A;  5GAE J;  5LD2 C;  4AVZ A;  2HKO A;  1SAU A;  2XAG A;  1JGS A;  5ICC A;  1AKH A;  2X4H A;  1XPX A;  2VOO A;  1R4M B;  1P2F A;  1I3A A;  4Y17 A;  2P7C B;  3M8E A;  4B09 A;  4S04 A;  1WJC A;  1UEL B;  4NDL A;  1FBS A;  5D8L B;  2IVM A;  2VJI A;  2DN0 A;  4FX0 A;  1G3T A;  3HHH A;  4MLO A;  2YU3 A;  1EF4 A;  2ZXI A;  1W36 D;  3CF5 F;  5TRD A;  2EIN H;  3D0S A;  5GPA A;  1VZ0 A;  5GPC A;  2K9N A;  3GX4 X;  4RLF A;  3SFZ A;  4QPQ A;  1B72 B;  1APL C;  2LLK A;  3HSE A;  3JAM K;  2CGP A;  2BY1 A;  4S05 A;  3F8C A;  2CWE A;  2FBH A;  1MBK A;  4IRG A;  3S2D J;  4IOA F;  3KP4 A;  5L3G A;  4GYI A;  4ZDP A;  1QU3 A;  4NC8 A;  2OZU A;  3F8F A;  1A6Q A;  2NAZ A;  2V6E A;  2MC4 A;  4G7O F;  3QOD A;  1QPI A;  1B59 A;  1T6S A;  3C2B A;  2KT0 A;  1FIP A;  4W1U A;  1OKR A;  2BHY A;  4G6D A;  2UXN A;  4HDV A;  5J47 A;  2QLZ A;  1MZB A;  1NH3 A;  3MAJ A;  4KN4 X;  1ZN2 A;  1U78 A;  2NVX J;  1UZC A;  3B73 A;  5FLV A;  1FOW A;  4K2E A;  3BG6 A;  2MG4 A;  1RUN A;  4EQQ A;  1QA6 A;  1SVM A;  1JKO C;  2Z1D A;  3P5J A;  2WA0 A;  2ZXW H;  1KYZ A;  1XDU A;  5DD8 A;  1IXR C;  4XOT A;  4ZC3 A;  3QQA A;  4D7N A;  2D5V A;  4IVN A;  2GZW A;  5D5U B;  4EJW A;  1YHQ I;  4HRI A;  5FKN A;  4Q47 A;  4LLL A;  2PJR A;  1F5T A;  3JRG A;  2XIG A;  2CQN A;  2O8X A;  4YG2 F;  5KNL A;  2RC4 A;  4A3M J;  1JJ6 C;  1BC7 C;  2EZL A;  3GFJ A;  2L01 A;  2P4W A;  2PMZ N;  3F0C A;  2W1O A;  5EZG A;  1PDN C;  2XUB A;  3PO2 J;  1SEU A;  3VOE A;  3LSM A;  1WRJ A;  3CCY A;  2DK8 A;  3DLL F;  3D5R C;  2IA2 A;  4GXO A;  3DFG A;  1IXS B;  2Y48 A;  2LRD A;  5TJJ A;  3HOU J;  2Y75 A;  2RNJ A;  1QZE A;  1XMX A;  1Y8Q B;  5DCM B;  2JSP A;  3CMY A;  4NC7 A;  1SVO A;  4CCM A;  2Z9O A;  3F8M A;  1GLN A;  3BR2 A;  3F22 A;  3WTW C;  2L7M P;  4RAG A;  2K9L A;  3OYI A;  1S5L C;  2FF4 A;  2WB1 N;  5FD6 A;  1X1B A;  1K61 A;  2W48 A;  3F6V A;  1HST A;  4FQG A;  1MGT A;  4XLF A;  2GIZ A;  2EV0 A;  5HLH A;  1U8B A;  1OFC X;  3TP3 A;  4E7S A;  3A4C A;  3BG5 A;  2H27 A;  2OC6 A;  5GAD J;  4PSX A;  4JX5 A;  2COM A;  3AG4 H;  1N77 A;  3CUO A;  3GTK J;  3T8T A;  1Y0N A;  4XR6 A;  2JA6 J;  3PFI A;  5J4V A;  4HLY A;  1TNS A;  1IV6 A;  3RJP A;  1O3R A;  2FQ3 A;  4XBF A;  2CG4 A;  4HV6 A;  1W7P B;  3ULQ B;  1D5V A;  3W2W A;  4RS8 A;  5HDN A;  2LFB A;  1ORK A;  3C2G A;  1R00 A;  2OJE D;  1IO2 A;  5A2Q Z;  2IS1 A;  2D45 A;  2RGV A;  1V5F A;  2CUZ A;  2WAQ A;  3BR1 A;  2GQQ A;  1Z7U A;  2MH2 A;  3OYB A;  4ON0 A;  3MN2 A;  1SD7 A;  3BQY A;  4LIT A;  2F4M B;  1AA7 A;  4PSW A;  4ZDO A;  2PN6 A;  4LB6 B;  2PLY A;  3IH3 A;  2FMY A;  2QSG X;  5FRN A;  3OYE A;  4A6E A;  1O3Q A;  5GP9 A;  3I59 B;  2QQ9 A;  5LRR A;  4XLN F;  3VPR A;  1QHG A;  1DU6 A;  3L2Q A;  1NTC A;  1WH7 A;  3BLY A;  2HOT A;  5E3N A;  2XGX A;  3EYY A;  2DJN A;  1S7E A;  4BU2 A;  2X9D A;  4M3B A;  2DO7 A;  2WY8 Q;  3BC8 A;  2MGQ A;  2JWT A;  1R5G A;  2L9N A;  5B3S H;  2HEO A;  5L3D A;  2WY7 Q;  3LA3 A; 
#chains in the Genus database with same CATH homology
 4IO9 F;  1VQN I;  3CCM I;  3CJT B;  2OTL I;  5JVG F;  3DLL F;  3CCJ I;  3G71 I;  3J7Z I;  3CCE I;  3I55 I;  2NXN B;  1YJW I;  3J7Y J;  1FOY A;  3CCS I;  2E35 A;  3CJS B;  1YIJ I;  1VQM I;  1FOX A;  3G4S I;  5GAE J;  1VQ8 I;  2E34 A;  1VQO I;  5GAD J;  2JQ7 A;  3CJQ B;  3EGV B;  1YI2 I;  1HC8 A;  3CCU I;  3I56 I;  3CCL I;  1YJN I;  1ACI A;  2ZJQ F;  3CC4 I;  3CJR B;  3CCQ I;  3CF5 F;  2H8W A;  3CME I;  2OTJ I;  3PIO F;  5DM6 F;  2QEX I;  4IOC F;  2QA4 I;  3G6E I;  1VQ5 I;  1VQK I;  4IOA F;  2E36 A;  3CD6 I;  1MMS A;  3CC7 I;  1YJ9 I;  5GAG J;  1S72 I;  2ZJR F;  2FOW A;  4UY8 I;  1VQL I;  1FOW A;  2K3F A;  1VQ9 I;  1YIT I;  1VQ7 I;  4V19 K;  3CCR I;  1QA6 A;  1VQ6 I;  5DM7 F;  1WIB A;  1Y39 A;  5GAH J;  1YHQ I;  3PIP F;  1VQ4 I;  3CC2 I;  3CCV I;  3CMA I;  2ZJP F;  1VQP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...