1Y0UA

Crystal structure of the putative arsenical resistance operon repressor from archaeoglobus fulgidus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
GHMSLEEWIKADSLEKADEYHKRYNYAVTNPVRRKILRMLDKGRSEEEIMQTLSLSKKQLDYHLKVLEAGFCIERVGERWVVTDAGKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor
molecule keywords arsenical resistance operon repressor, putative
publication title Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
total genus 29
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1y0uA00
4PZJA 5D4RA 1ZG5A 3HRSA 2MH9A 1Z6TA 1C0WA 1USSA 1PUEE 1KQ0A 4KIFA 1FC3A 3HRMA 2CSOA 1A04A 1S8NA 5DV5A 5DYMA 1XMKA 5KVRA 5E17F 3E5QA 3TDUC 5FLXK 5BPIA 1SMYF 2FRHA 3EQLF 3B02A 1ZH5A 2P5LC 2EB7A 3J7AO 2JZYA 4M73A 3MFKA 3P7NA 1Y0UA 1V3FA 5DDGA 3WU0A 5E1ZB 1U3EM 1ON1A 4MNUA 1R5GA 3C18A 2R3SA 4N9IA 3EYIA 1HW5A 2ELHA 3FWEA 2A69F 4Y13A 3IL2A 3KP5A 4HYEA 2A5YB 3IWFA 3J80Z 1RZ4A 1IN4A 4G6DA 5BS6A 1IZ1A 4IF4A 2VOPA 4A0YA 4EQQA 1FNNA 2XKOA 3MQ0A 4YFKF 1ZARA 4XSZF 3WTYC 1ZG1A 2HTJA 1G3YA 3PQJA 4KICA 1ON2A 1FP1D 3SXYA 5BPDA 2EFPA 2XKPA 3B73A 3ECOA 3T1BA 1ZLKA 2JPBA 1U5TC 3Q9SA 3J81Z 3E6MA 3IHUA 3HTSB 2D45A 3WGGA 4G9YA 5D5WB 2V79A 1KA8A 1UFMA 5LGTA 1J7KA 2OBPA 2HDCA 2HZTA 3I0TA 4P96A 3M1EA 1ZGAA 4OMYA 2JPCA 5DCMA 5LHHA 3HUGA 1OPCA 1W4MA 2J5OA 3RJPA 4EMSA 5D6FA 5J6XA 2IW5A 1KU2A 1IXCA 3GLXA 3MWMA 3FMRA 4GXOA 4MQVA 2VC1A 5DCFA 2YPRA 3F8CA 3U2RA 2H6CA 2DI3A 5D4SA 2FA5A 1R5HA 1ZREA 1MDMB 3WE2A 3JTGA 4GYGA 3GFMA 1ZLJA 3WG9A 3D0SA 5JVTA 2V1DA 3TDZC 4OIPF 2L01A 5CVUA 4I7HA 5K5QA 1XD7A 4RGSA 1SD6A 1B6AA 2JSCA 5ILUA 1K78B 3F8NA 4MQ9F 3G3ZA 4Q4ZF 4IPAA 1BI2A 4A6DA 2QQBA 1LDDA 1KU9A 3RPQA 3HTUA 4I0AA 4M74A 4WWCA 4BH9A 1ZRDA 4L0ZB 1IRGA 3LA7A 3ZN0A 2V1XA 2GIVA 2ZMEB 4M6XA 4WXDA 5LEKA 2XAJA 2FBHA 4RB2C 3M9AA 5HOOA 2H27A 1T98A 2PMHA 2RC4A 2YX4A 5D8LB 4BHPA 2QYOA 3Q5FA 1BI3A 3PQKA 2XHKA 4YFNF 1BM9A 3I64A 1W7PB 2IA0A 3GO5A 1I6XA 3HOTA 3KP6A 1LVAA 3FXRA 1O3SA 3R0AA 2K27A 1U5TA 3I53A 1J0RA 2RGVA 2W25A 1FP2A 1U78A 1T6SA 2IVMA 2WV0A 4FX4A 4M6YA 1O7LA 3JW4A 5ILSA 4HV5A 3Q9VA 2BYVE 2A6HF 2O3FA 4KIGA 1RUOA 2CG4A 1YLFA 2FBKA 4GCVA 2GXBA 2L4AA 3K1MA 4KNYA 2VE9A 2PMUA 2PFBA 2CW0F 1GXQA 2FMLA 5IT9K 4L0YB 5DD4A 3DKWA 4CGZA 3EUHA 1BC7C 4R1HA 2NAZA 5H6RA 4JQFA 3LAJA 1UCRA 4PDKA 4WCGA 3VOEA 5A2QK 2XAHA 3FM5A 2PJPA 2DTRA 5L3BA 1LQ1A 3LQRA 2BBYA 3SQNA 4OINF 4RB0A 5L3GA 1YIOA 2BE5F 4KIBA 5HLIA 2DPDA 3CUOA 5JFRA 1IN5A 2OU2A 3NEUA 1T38A 2GZWA 4I98B 5FGMA 2UXXA 5FFXA 1JXSA 4ZYDA 1ZYRF 3LQQA 3MEXA 2NYXA 4ZYEA 4HQEA 2FU4A 1B9NA 2PI0A 2HKXA 4GYIA 1LDJA 3TO7A 1D5VA 4LB5A 1YFHA 3V8JA 2HYGD 5L3FA 3WGIA 3TKYA 5DUKA 3VODA 4KUMA 2K4JA 1QZZA 5DCMB 4AIKA 1P92A 5AIQA 2HGCA 2STWA 4A5NA 2DFIA 4HDUA 3U9GA 3CLOA 3ZP5A 1MKMA 1V4RA 2STTA 2Q0OA 2UXNA 4ETSA 3K1NA 5CLSA 1J5YA 2QM3A 4GGGA 4U0YA 1P4XA 3RKXA 1QNTA 4U7BA 3KCCA 1KYWA 2EA2A 1IN6A 4I02A 1NHAA 3DQVC 2XVCA 1XSVA 3L09A 2A68F 4FT8A 3S2WA 4ZYHA 3JTHA 3M7GA 3E6CC 4L18B 1R23A 1K7AA 3BWGA 1IRFA 2O8XA 2B0LA 4KDPA 5F1RA 4CXFA 1STZA 3GFIA 2DO7A 1BC8C 1XCVA 5K5RA 5LRRA 1REPC 4YIIA 1YO5C 3ELKA 4L9VA 3N4MA 1MDMA 1WSUA 3RI4A 2K02A 4EM0B 3DXJF 3F23A 2JRTA 2VXZA 2HQRA 4UXNA 1TNSA 4WK8F 4ESJA 2NS0A 4AIHA 2ZJ2A 5CVRA 3DV8A 4WXHA 3MCZA 2DAOA 2MD5A 4OIQF 1LEAA 1S29A 1QBJA 2M8EA 3DPLC 5LHIA 4IHTA 1B4AA 3V7CA 2LSOA 2GAUA 2ESHA 2BV6A 5L3CA 4ENNA 3KE2A 3T5XA 4OIOF 1SD5A 3WTVC 3CO6C 1BBYA 2L54A 1TLHB 3T8TA 2DLLA 4HOBA 2ZMEA 5JR3A 1U5TB 2IA2A 5ICGA 4A2UA 1WWXA 2DPUA 2PN6A 1AOYA 4O5VA 5F6FA 1XDSA 3COAC 1W7PA 4HBLA 4M72A 2NRAC 3HHHA 2O0YA 2HWVA 1UHMA 5LGUA 2IPQX 1BN5A 4MEYF 5E1XA 3RPUA 3HOSA 3KP7A 3RIRA 5ILVA 4I01A 3BJ6A 4MTEA 4L5JA 4KMUX 1TBXA 4RGRA 5BOXA 4KN7X 3HSFA 1YS6A 4LGWA 2E7XA 1HKTA 3T0YA 1I27A 4HX8A 4IHSA 2M1BA 2DK8A 4XLNF 4LK1F 3E5UA 2R7DA 3QU3A 2RN7A 3KLNA 4M9ZA 2XRNA 4HA8A 1IAWA 2JTVA 4CDGA 4YFXF 2KIMA 4MHGA 3RDIA 2XROA 5FD5A 3F72A 4LLGF 3DF8A 1K79A 3HYIA 3GEZA 2TDXA 2HKOA 1D3YA 3KFWX 4M71A 4FHTA 5ICFA 4KT5C 1FZPB 1J2XA 1YW9A 2G9WA 5LHGA 4L5IA 2MBFA 3ZQ7A 3QP6A 1S6LA 2RKHA 2MLGA 1YW7A 1T39A 3BZ6A 1R36A 3BJAA 2OQRA 4HQMA 3GX4X 1IN7A 5ERIA 3IWZA 3QP5A 4P55A 3F8MA 3NRVA 4ESBA 4DNCA 1EV7A 1YYVA 1HQCA 4OIRF 2PBIA 1OYYA 4Q47A 2A61A 3W6KB 4G7OF 2LF7A 3OV8A 1R22A 2CYYA 2FOKA 1BIAA 5CJ9A 3LA2A 2LKPA 2ZNZA 3DEUA 1RUNA 3MZYA 2L4MA 2V9VA 2QWWA 1KQ8A 5CVVA 2VT2A 2NNYA 2V1UA 2DU9A 2EFQA 4HX7A 4HAMA 1J9IA 4EM2A 1T2KA 1KYZA 2C6YA 1U6GA 2XGXA 2ETHA 4TV7A 5KK1A 3ZMZA 1P4WA 2FEZA 4AWXB 2QVOA 2O61A 3BJOA 5E18F 1O3TA 2DQLA 2OD5A 2XAFA 2KRFA 2Y48A 2VBXA 1XGSA 1F1ZA 3KEOA 1H9TA 4B09A 3SHFA 1XDUA 4UUVA 3I71A 1S3JA 2UZKA 5CVIA 5H20A 3V7SA 2OZ6A 3HRTA 3V7RA 4IRIA 4LK0F 3W6JB 3E5XA 3DFGA 4CHUA 3H92A 5DEQA 2ZFWA 3NQOA 3ABUA 3ISPA 5IT3A 1TW3A 2E7WA 4L9JA 1XSXA 1P4AA 2ACJA 2COMA 3JAMK 4UHTA 1KQ9A 2DK5A 3WTZA 2EWNA 2RVCA 2OZUA 2Q8KA 3FXQA 1L3LA 4L9NA 2ZBKA 3RKYA 2HS5A 2P8TA 1FBQA 1QPMA 1SFEA 3TQNA 5H6QA 5HLGA 1XSDA 2HQNA 4IVNA 2MH2A 5FLXZ 2DQRA 3KETA 2P6SA 3L2CA 3KP3A 1JGSA 2Z3YA 3GXOA 3F6VA 4NHJA 1ZN2A 2RQPA 1XN7A 5AONA 1LNWA 4EGZA 3REOA 4UV9A 1E2XA 3FXUA 2QQ9A 1JE8A 4KFCA 2FNAA 2R7FA 4JK1X 3LSTA 3JSPA 3ZMSA 1B1BA 1OYIA 5TJJA 3I58A 3TOBA 2G7HA 4LMYA 2KIFA 3KP2A 4HF2A 3P9IA 4PCQA 3WODF 3H3UA 1SFUA 2LDUA 5E1WA 2EFWA 1GVJA 1YTYA 1FX7A 2VBWA 3K9TA 1BOAA 4IXAA 4EVIA 3M8FA 1WQ2A 3ML6A 4KA4A 4BYYA 1KU3A 3BOQA 2XAGA 3C3WA 4MEXF 1MGTA 3RTRA 2GQQA 3F8BA 2P7CB 2CQKA 1GXPA 1IXRC 5D5VB 3AAFA 5L3DA 4BAYA 4D0PA 5LBQA 4Q5SF 3FX3A 1MJ9A 5J8FA 2VE8A 3CJNA 2M87A 4U0VA 4BXUA 3LWFA 1HKQA 4G6QA 1SD7A 4N0BA 2EFNA 1ZRCA 5F64A 3MAJA 3OOPA 3T8RA 1W5TA 5HS9A 1EH6A 2FMYA 2ZNYA 3LAPA 4MGRA 1HSTA 3L9FA 4KN4X 2ISZA 5HDNA 3QPTA 3J80K 1JHHA 1RNLA 3V8KA 3H3ZA 2Y0MA 2QQAA 1KU7A 5EEHA 3BPXA 4R8HA 1H9GA 3SFZA 2O03A 3TO6A 4HZFA 3I59B 5EEGA 3KZYA 4LLNA 1LJ9A 5BMZA 2XUBA 4RGXA 2AS5F 2E1NA 1Z1DA 4UVAA 5FO5A 2G7UA 1OR7A 3J81K 1HBXG 1ZGJA 4A5MA 3PFIA 2KJCA 4OOIA 1FBSA 3CUQC 1R7JA 1PDNC 3CDHA 3SZTA 5LEJA 2ZCWA 3F8FA 3ROUA 5CYVA 3WTXC 3WTSC 3U1DA 2IRFG 5ICEA 3KEQA 4B8XA 3O2PE 2VODA 5JHUA 5L3EA 4P9UA 1S7OA 2FNPA 2LNBA 2DT5A 2A07F 4K2EA 2MLKA 2EJRA 2XV4S 3KLOA 2K7LA 3I4PA 2W24A 4HDVA 4UV8A 4HLXA 4EJWA 4RS8A 2FE3A 3MZHA 3FM3A 1SAXA 1YG2A 3WE3A 4H0EA 1LDKB 4EGYA 3HRUA 1O7FA 2L3DA 1I1SA 1J59A 1G3WA 1TQPA 4G7ZF 2FSWA 3F6OA 1MJBA 1USTA 1TW2A 2YU3A 2FQ3A 2MA3A 4LG0A 5D8KB 2WC2A 4G94A 2EV5A 2FBIA 1FT9A 1FSHA 4ASNA 3FHZA 3N97A 5LGNA 5IT9Z 2Z33A 1FBUA 1DUXC 1QGPA 3HSRA 1T0FA 2VOOA 2D1HA 2X0LA 1ULYA 4S04A 2EV6A 2PQ8A 2NNNA 3BPVA 3RKWA 3DP7A 5E8GA 2QBYB 4GO1A 5A2QZ 3GZ6A 4KMFA 3G73A 1DPUA 4A0XA 4I09A 1YS7A 3ABTA 4CZZA 2F5DA 3R61A 2OAZA 3QRFF 5TRDA 1HSJA 3IC7A 1Q1HA 5HDKA 3ERED 4ESFA 1D8JA 1UB9A 2QLZA 5K1YA 2IA1A 1RI7A 5HS8A 2QENA 3KZZA 3ZN1A 2QUFA 1FOKA 1IW7F 3L00A 1BIBA 2MC3A 4A6EA 2ZXJA 3O6BB 3R0JA 2DW4A 4F7ZA 2M5WA 4ENKA 4ZZDA 3GZ5A 4FX0A 4HF1A 3TOAA 4XLPF 2ZKZA 2FXAA 5HLHA 3CUQA 1ONVA 1S7AA 1IUYA 2IJLA 5D5UB 3R6SA 2M30A 2KIUA 2RNJA 3WTUC 1F4KA 2HOEA 1SFXA 4P9FA 1Z7UA 2JT1A 4BQAA 5D5XB 1XMAA 4Y17A 4U7DA 1ZHFA 2PG4A 1F9NA 1L0OC 4LB6B 4IJAA 3BDDA 2Z5UA 4QWQA 2HEOA 3O3KA 1O3QA 2A3SA 2H6BA 2OQGA 2P4WA 2ISYA 2XIGA 2VN2A 2KKOA 2M45A 2CFXA 1U8RA 3JSOA 4N9HA 4UVCA 3TO9A 2X4HA 1B9MA 1FY7A 4S05A 5J8CA 1OMIA 4M9XA 4LJZF 3VB2A 2HFHA 5LRSA 1AWCA 1SD4A 2GA1A 4JBAA 4PGGA 2XAQA 1ZG3A 1Z05A 4OU0A 4EJTA 3V8LA 1RIOH 3E6BA 3CTAA 2LF8A 1XCBA 2J5PA 4UVBA 1MJAA 3WGHA 1YQAA 2XASA 2IT0A 3E3VA 3I5UA 1P6RA 3IKTA 1Z91A 2F5FA 2GXGA 4QLCU 3GW2A 1OKRA 2H09A 1PP8F 3I59A 3HIFA 2ZO4A 4M9SA 5CVJA 4AVPA 1IF1A 4DQ2A 1FYMA 4LD5A 1TQIA 1I1GA 3TGNA 4NB5A 1E17A 2P5VA 4P5OA 4A12A 1WKMA 4RB1A 3QU6A 3KP4A 1R00A 5BQTA 2GA2A 4ZZLA 4XRFA 3F3XA 4CICA 2VT3A 1CF7A 3GF2A 4R79A 2DBBA 3WU1B 1J75A 1BJAA 1XGOA 4LG0B 1EH7A 1BI0A 2ESNA 4XBFA 3GUDA 4ZYGA 2F5CA 5ICCA 4I0BA 2UWMA 1WI9A 2EA4A 1QQIA 5DD8A 3WTWC 2P7VB 4WX9A 2CO5A 1EH8A 3BY6A 2VONA 4I2OA 3VFZA 3GFJA 1PP7U 1G6NA 3LA3A 2K86A 3IKVA 1H0MA 1MD0A 1FSEA 3D5LA 2H94A 5AIPA 2VBZA 3L7WA 1DP7P 2EV0A 2A6EF 3GWZA 3VEPA 2W84A 3V4GA 4EV0A 2HYFA 5LLQA 1F5TA 1CGPA 1OYWA 2YSRA 1HKSA 3QOPA 6PAXA 1IXSB 1HXDA 3FF5A 1W7PD 4Y15A 2W57A 4Z2YA 4BHCA 4ZH4F 1UHWA 2ADUA 3ZMDA 2D1VA 1LB2A 3M8EA 2QBYA 4MTDA 4EJVA 3LFKA 5FB2A 4XSXF 5ED4A 2QZ8A 3GYHX 2Z9OA 4OMZA 2F2EA 5FD6A 5E8IA 3RYRA 2YX7A 3CUQB 4IRHA 3FMSA 3F21A 4UNOA 1FPQA 2O6GE 1Z9CA 4HX4A 2GWRA 1FYLA 5D6EA 3QAHA 3P9CA 2PLYA 1IN8A 3ZMUA 2K4BA 4AD9A 4KYWA 2EFOA 3IRQA 2P6TA 1U2WA 1SMTA 2VBYA 1X3UA 2HR3A 4AIJA 4HW0A 1R58A 4RAZA 3P9KA 1G3TA 3HSEA 3F22A 2HTSA 4ENMA 5HS7A 4CYDA 4LFUA 2RDPA 4YG2F 3EDPA 2AXLA 5DUIA 5HDGA 1O57A 1BI1A 3QPHA 3K0LA 2PEXA 4CO8A 3ZPLA 3C1DA 2EK5A 2Q2EA 3EETA 4O6JA 2V6CA 2IP2A 2W85A 2E1CA 4G7HF 2BGCA 1HW1A 2FF4A 1XGNA 3C7JA 1TNTA 1W5SA 4WF2A 1I5ZA 3ZMTA 4BHBA 3DPTA 4U0WA 1K6OA 3BROA 1G4DA 3IRRA 5E20A 2WWYA 3K2ZA 2CGPA 1FLIA 3R60A 4Q48A 3RYPA 1HW2A 3FMQA 1YW8A 2Z99A 2L02A 2OA4A 1G3SA 1B59A 4RAYA 4O3MA 3JAMZ 4PGHA 4EJOA 2D2WA 2KJBA 1Z6RA 1VTNC 4EM1A 4LLLA 1CF7B 4RGUA 1QZYA 4ENJA 1WRJA 1XGMA 2P5KA 3ZMVA 5HVQC 2WTEA 5FFZA 1LEBA 1D8KA 4NQWA 4U88A 2VC0A 3K69A 3I54A 4HLYA 1KGSA 2Y75A 3BP8A 2YR2A 3WTTC 1QO0D 3EYYA 1FWZA 2F5EA 4IRGA 2CWEA 3E6DA 1MZBA 4HV6A 1ZAOA 4WXCA 3K1PA 1K78A 2BEOA 1JHFA 1XB4A 3ULQB 1P2FA 4G8XA 4BNCA 1DDNA 1ZRFA 5JI6A 3GFLA 1GHCA 1DPRA 4YIFA 3CO7C 3GVAA 1FYKA 4L9TA 2RV8A 3ECHA 3HHGA 1R1TA 3E97A 3SZPA 5K5OA 4HF0A 3R4KA 1TQMA 4RB3C 4EJUA 1R1VA 4A0ZA 4E70A 1R1UA 1TTYA 4ON0A 3FZVA 1ODDA 1O3RA
chains in the Genus database with same CATH superfamily
4XKBA 4J19A 1I39A 2IS2A 4PFOA 4PZJA 5GTHC 2F4MB 2EZHA 1R71A 3CCJI 5D4RA 1ZG5A 1X3WB 2L0KA 3HRSA 5EF6A 2MH9A 2EINH 1IUFA 1Z6TA 2XDVA 1USSA 1C0WA 4BE2A 1KQ0A 1PUEE 1QU3A 1V55H 4KIFA 1FC3A 3HRMA 4CZCA 2CSOA 2EQRA 1Z3XA 5FJ8J 1A04A 3H5RA 3Q0UA 4OAZA 1S8NA 5DV5A 2OV7A 5DYMA 1RETA 1XMKA 3TMOA 2CV2A 5KVRA 3E0JB 5E17F 3E5QA 3TDUC 3CCRI 4RMNA 5FLXK 1JTYA 1DU0A 3L1PA 5JVGF 5BPIA 1SMYF 2FRHA 3EQLF 1JTXA 3B02A 1ZH5A 2L7ZA 3ZQIA 4RM3A 2EH3A 2P5LC 1SC7A 1Z3YA 3NARA 2EB7A 3TEDA 9ANTA 1ORKA 3D5SC 2JZYA 3J7AO 1Z7LA 4MO7A 2X1DA 2LP0A 4M73A 3MFKA 3P7NA 1Y0UA 5M3MJ 1XX5A 1V3FA 5DDGA 3WU0A 3VYSB 2DFFA 5E1ZB 1U3EM 1ON1A 4MNUA 1PJRA 1R5GA 3SJMA 3C18A 3DTEA 1BR4A 3OL3A 1ENHA 2MSYA 2R3SA 3G71I 4N9IA 2RQQA 4A3MJ 3DKXA 5IP9J 3EYIA 2CUZA 2TCTA 3CF2A 2R7ZJ 1I3QJ 1HW5A 2ELHA 2KT0A 1BW5A 4F3QA 1Y0NA 3FWEA 2A69F 1OCZH 3IH2A 2K9NA 4Y13A 3IL2A 2KP6A 3KP5A 3OYFA 4BE1A 4HYEA 4F91B 2A5YB 3IWFA 5EG0B 3J80Z 1RZ4A 3PO2J 1NG6A 1Z0XA 1IN4A 2K5CA 4G6DA 5BS6A 3QOEA 1IZ1A 2ME0A 3S2DJ 4IF4A 2VOPA 5F1JA 4A0YA 4EQQA 1FNNA 4OWRB 2XKOA 3MQ0A 4YFKF 1ZARA 2W4SA 1X2MA 4XSZF 3WTYC 1ZG1A 2X1CA 2HTJA 2LY1A 1FTZA 1G3YA 3PQJA 3QYEA 4BY7J 4KICA 2E2IJ 1ON2A 1FP1D 3SXYA 5BPDA 2I10A 3PNTA 1RR8C 2EFPA 3PIOF 1IO2A 2XKPA 3B73A 3ECOA 1D1CA 3TP0A 3T1BA 1Y1WJ 1QVTA 3ZCOA 1AHDP 3JRIA 1P7JA 3AFHA 1ZLKA 2Q2EB 2JPBA 1U5TC 2HU9A 3Q9SA 3J81Z 3K70D 2Z1DA 3E6MA 2CMPA 3IHUA 1S72I 2Q1ZB 3HTSB 2D45A 2VPRA 3WGGA 2HVRA 4G9YA 5D5WB 3I4MJ 2V79A 1KA8A 1UFMA 2P0WA 1KONA 5LGTA 1J7KA 2OBPA 1VQ5I 2HDCA 3HDDA 2HZTA 3I0TA 4P96A 3M1EA 3HZJA 1ZGAA 4OMYA 2JPCA 2GIZA 3OWTA 5DCMA 1B72A 4D5CA 1WJEA 5LHHA 3HUGA 3DEWA 1OPCA 1W4MA 2J5OA 3CJTB 3RJPA 2V9PA 4EMSA 5D6FA 1XTAA 3K4BA 1FOYA 5FLVA 2QGUA 5J6XA 3CDLA 1Y56A 2IW5A 1E3HA 1KU2A 1IXCA 3GLXA 1AKHA 2QSHX 3MWMA 3FMRA 2UUZA 3CCEI 2OCCH 4J00A 4GXOA 2LD5A 2KMUA 4MQVA 2VC1A 5DCFA 2YPRA 3F8CA 3U2RA 2H6CA 2F6CA 4CCOA 2DI3A 3EUHC 5D4SA 2FA5A 4E4HA 1R5HA 2MFZA 4AYBN 1ZREA 2A05A 2BW3B 1MDMB 4JX4A 2IBDA 4NQWB 1VQNI 3WE2A 5K7ZA 3JTGA 4M3GA 4GYGA 3GFMA 1ZLJA 3JREA 3GTPJ 3WG9A 3D0SA 2R93J 4ABZA 2DYSH 2V9KA 3VSKA 3DTKA 5JVTA 2V1DA 3TDZC 4OIPF 4IZZA 2DA5A 2L01A 5CVUA 3H5NA 4I7HA 5K5QA 5B5EC 1XD7A 2NS7A 4RGSA 1SD6A 2LG4A 1SANA 2IGOA 1W36D 1NTCA 5EZGA 1B6AA 2JSCA 4C3IJ 5ILUA 1K78B 3F8NA 4MQ9F 3G3ZA 1TT0A 2HQ5A 2H1LA 3OR2C 3VWBA 4Q4ZF 4IPAA 1BI2A 4XK4A 4A6DA 2QQBA 1LDDA 1KU9A 2JRMA 3RPQA 3ERMA 2MG4A 3HTUA 4I0AA 4M74A 4WWCA 2CUEA 3HG9A 4BH9A 3GCMA 5J4YA 1ZRDA 2WB1N 1MBKA 4L0ZB 2B9SA 3C2BA 3LA7A 4G12A 3ZN0A 1IRGA 2V1XA 4QPQA 2GOMA 2GIVA 2ZMEB 4M6XA 4WXDA 5LEKA 2XAJA 2HPMA 3G1OA 2DT7B 3LSPA 2FBHA 3M9AA 4RB2C 5HOOA 1EKEA 2YX4A 1T98A 2IGKA 2PMHA 3CJQB 2RC4A 5D8LB 4B44A 2H27A 5C4XJ 4BXFA 2HDWA 1QZEA 2W48A 4BHPA 2QYOA 3Q5FA 1BI3A 3PQKA 3HOYJ 4OAYA 2XHKA 4XOPA 4YFNF 2RAEA 1VQMI 1BM9A 3I64A 1A36A 2R92J 1W7PB 2IA0A 4NBQA 3GO5A 1T8IA 4H4KC 1I6XA 1U9NA 3QQAA 2KISA 4XOTA 3HOTA 4C2UA 3KP6A 1LVAA 2YUSA 3FXRA 5FRNA 2B7EA 1O3SA 1XMXA 3R0AA 2K27A 2IGNA 2X6WA 1UZCA 4PJNA 1U5TA 2EZIA 3I53A 3ZQHA 1J0RA 2RGVA 2W25A 1VF9A 1FP2A 3NWTA 2E1OA 3QODA 4M6VA 5GAHJ 5GTIC 2VL8A 4F92B 1U78A 2M2EA 1T6SA 2IS4A 2IVMA 3H1CA 4E6KG 2VKHA 3OMYA 1R6RA 2WV0A 3GBGA 4M6YA 1O7LA 3LNQA 4FX4A 3JW4A 5ILSA 4HV5A 1DU6A 3Q9VA 1I6HJ 3SFIA 5B66C 1GT0C 2BYVE 3C2GA 3KIOA 2A6HF 2O3FA 5B1AH 1QRYA 2Z16A 3Q3SA 1VQ9I 3A03A 4KIGA 1RUOA 2CG4A 1OR7C 5FKLA 1YLFA 2FBKA 2E1MB 4GCVA 2GXBA 1WI3A 3HPGA 2L4AA 2M0MA 3K1MA 4KNYA 2VE9A 2R7UA 2PMUA 2PFBA 1W1WE 3RKQA 3OSGA 1D0XA 1VI0A 3ZGKA 2CU7A 4GRIA 2CW0F 3BTJA 1GXQA 3PSIA 2FMLA 5IT9K 1X4PA 4V2GA 2M4KA 2X6OA 4L0YB 5DD4A 1ETVA 3DKWA 4CGZA 4I6ZA 3EUHA 4PSXA 2LR8A 3HOVJ 1BC7C 4R1HA 2NAZA 5H6RA 5BNGA 5K7FA 3BG3A 2HOSA 4JQFA 3LAJA 1RC9A 1UCRA 4PDKA 4WCGA 3VOEA 5IYDJ 2JA7J 5A2QK 2XAHA 3FM5A 5F04A 2KRHA 2PJPA 2XSDC 4E7LA 2DTRA 4YELA 5L3BA 1LQ1A 3LQRA 2BBYA 3SQNA 2ID3A 1T95A 4OINF 2F5VA 2LOOA 3U21A 4RB0A 4BJ6C 5L3GA 1YIOA 2BE5F 3DEEA 4KIBA 5HLIA 4D7MA 3FHNA 3CUOA 1WHUA 5JFRA 2DPDA 1IN5A 2OU2A 3NEUA 1T38A 1MNEA 4BEHA 4DIQA 2GZWA 4I98B 5E3OA 1AU7A 3F9KA 4B4CA 3OS1A 5FGMA 2UXXA 5FFXA 1MIJA 5IP6A 1JXSA 4ZYDA 1ZYRF 3K4NA 3LQQA 3MEXA 2NYXA 1KZHA 2OCEA 4ZYEA 4HQEA 2FU4A 1B9NA 2ZMEC 2PI0A 2HKXA 4DYCA 4A3LJ 4GYIA 1LDJA 3TO7A 1R5ID 1D5VA 5EG0A 4F52A 4FQGA 4LB5A 1YFHA 3V8JA 2EZKA 2HZDA 2KHMA 2HYGD 3ASOH 5L3FA 5FKNA 1FMWA 3WGIA 2E34A 3TW6A 4UUSA 4HNUA 3TKYA 1K6YA 1X1AA 3BR1A 5DUKA 3VODA 4KUMA 2K4JA 1QZZA 5DCMB 4AIKA 1P92A 5AIQA 1B72B 2HGCA 5DS9A 2STWA 2XC7A 1YI2I 4A5NA 3HUGB 2DFIA 2A6TA 2COBA 3X2QH 4HDUA 3U9GA 1CQTA 3CLOA 3ZP5A 1MKMA 1UAAA 1V4RA 2STTA 2Q0OA 2UXNA 4X0GA 4ETSA 2LVSA 4A93J 4FETA 3K1NA 2QQ8A 5CLSA 1WJFA 1J5YA 2QM3A 4GGGA 4U0YA 3AG3H 1D0ZA 3O8HA 1AKHB 2DJNA 1ZKGA 1P4XA 3RKXA 1QNTA 5EZHA 4U7BA 3KCCA 2DOAA 1DQUA 4AM3A 2R7WA 4D5FA 4ZDOA 1KYWA 2EA2A 4NC6A 1IN6A 4I02A 1NHAA 3DQVC 3MKYB 1VNDA 2XVCA 1XSVA 3L09A 2A68F 3WG7H 4FT8A 2K9MA 2X1EA 2XGCA 3DPUA 3JRDA 3ZRGA 3S2WA 4ZYHA 3HOWJ 2B63J 2K40A 3JTHA 1G8XA 3M7GA 4RBOA 3E6CC 4L18B 3C2HA 3GTMJ 3M4OJ 3HGYA 5FKKA 1V5FA 1R23A 1K7AA 3BWGA 2RNGA 5C4JJ 1IRFA 2O8XA 4MFEA 1IC8A 3JRGA 2JN6A 2FQ4A 4X1EA 1DP3A 2B0LA 4KDPA 5F1RA 4CXFA 2LLKA 3GTOJ 4D7NA 1Y39A 1STZA 3GFIA 3H3VK 2KL4A 2DO7A 3U1KA 1BC8C 4W1UA 2OTJI 5HNFA 1XCVA 3BLYA 5M5YJ 5K5RA 4ZDLA 5LRRA 1REPC 4YIIA 1YO5C 3ELKA 4L9VA 2BW3A 2R7RA 3N4MA 1MDMA 1WSUA 2PX9A 4HNTA 4XKCA 3RI4A 4M3EA 2BZTA 2K02A 4EM0B 3GTLJ 1X19A 2WAQN 3DXJF 4EEFG 3K4MA 1V54H 3F23A 2JRTA 3QYFA 5J40A 2KDOA 2VXZA 2HQRA 4UXNA 4LIVA 1TNSA 3HKZN 1A5JA 2IAIA 4WK8F 4ESJA 2BVLA 2K3PA 2NS0A 4AIHA 2FJ1A 4CYCB 3MVPA 2DCEA 1MNMC 2QKMB 2ZJ2A 4IO9F 3FK6A 5CVRA 3DV8A 3GTGJ 4WXHA 1D0YA 1VQ7I 1VQKI 1M1EB 2Y31A 3E7LA 4CCNA 4KITB 4BBSJ 3MCZA 1R4MB 4XRSG 3FXMA 4DZPA 2DAOA 2MD5A 3QPSA 1LEAA 4OIQF 1I3AA 2JVGA 1MMAA 1S29A 1QBJA 2M8EA 3DPLC 5LHIA 4IHTA 4B47A 1B4AA 4ZTFA 3V7CA 3IUOA 3BZKA 2LSOA 1MSFC 2GAUA 2ESHA 2BV6A 5L3CA 1N78A 4ENNA 5KCMA 4A3DJ 3KE2A 1GV2A 3T5XA 1RR7A 4BQOA 4OIOF 1SD5A 3WTVC 3CO6C 1BBYA 2DMPA 2L54A 1TLHB 2DMQA 3T8TA 2DLLA 4HOBA 1LVKA 1RKTA 2ZMEA 5JR3A 3OY9A 5EJCA 4XRSA 1U5TB 2IA2A 5ICGA 4A2UA 5EDNA 5KHDA 1MH4A 1OJLA 1WWXA 1IRZA 2DPUA 2PN6A 3CJRB 4XR6A 1AOYA 4O5VA 5F6FA 2NOGA 3OYAA 1XDSA 4PJ0C 3COAC 2E71A 1Y8QB 1JKRC 1IDYA 1W7PA 2FOWA 4HBLA 4M72A 1BW6A 3NAUA 2VXDA 3D1NI 2NRAC 1FOWA 3HHHA 1BA5A 1TZLA 2O0YA 1FJLA 1WJBA 2HWVA 1UHMA 3DU5A 4JX6A 1WJCA 3H9JA 2IPQX 1BN5A 5LGUA 2PMZA 2HVSA 4MEYF 3GMEA 4E7ZA 2VASA 5E1XA 3RPUA 3HOSA 2HNHA 3BT9A 3KP7A 3UNGC 3RIRA 4XLEA 5ILVA 4C3HJ 2VQCA 4I01A 3BJ6A 3DTIA 3HM5A 4MTEA 1I50J 2XSJC 4XKWA 3LSIA 4L5JA 4KMUX 1TBXA 2Y2ZA 2CQQA 4RGRA 4CH7A 2X85A 3K4JA 5BOXA 4KN7X 1TC3C 2LKSA 4E7SA 3ZQGA 3HSFA 3WHCA 1OCCH 4Z6YA 5FROA 1SVOA 1YS6A 4LGWA 4CCKA 2AQEA 4BJ5C 2E7XA 1HKTA 5IY5H 2CQXA 1E3OC 1NH3A 3T0YA 1T33A 3SZGA 2OJED 2KFDA 1I27A 1WPKA 4IHXA 4HX8A 4IHSA 2AHQA 2M1BA 1A31A 3PUBA 2DK8A 4XLNF 4LK1F 2JWTA 3E5UA 2R7DA 1OISA 3QU3A 4HPQA 2RN7A 3KLNA 4M9ZA 2XRNA 4HA8A 1IAWA 4IX7A 2JTVA 4CDGA 2DA3A 1WH7A 2QSFX 3I4NJ 4YFXF 2KIMA 4MHGA 3RDIA 1LE8A 1E0EA 2XROA 1BR2A 5FD5A 3F72A 4LLGF 3DF8A 3BCAA 3HXLA 4BEHB 3CDIA 1K79A 3HYIA 3SEZA 3GEZA 3J7ZI 2TDXA 2HKOA 1D3YA 3KFWX 3L2VA 4M71A 4FHTA 2WY8Q 5ICFA 4KT5C 1LFBA 1FZPB 1J2XA 2OPTA 1YW9A 2CS3A 2EBIA 2G9WA 3M1CA 4CCJA 2X48A 5LHGA 5DM6F 2ZXWH 4L5IA 2MBFA 3ZQ7A 3QP6A 3OYBA 1J09A 1JKOC 1S6LA 2IGMA 3ESWB 2JVHA 2RKHA 2Y9ZA 2MLGA 5LD2C 1YW7A 4NC8A 1JT6A 4LG3A 3S14J 1T39A 2IS6A 3BZ6A 1R36A 3BJAA 2OQRA 4HQMA 3GX4X 1MSEC 1IN7A 4UUSB 4ZC3A 3IH4A 5ERIA 2XF7A 3IWZA 3QP5A 4P55A 2ZJQF 4XQFA 1G2HA 3F8MA 3NRVA 4ESBA 2IEKA 4DNCA 5F08A 1H89C 1WZ2A 3A0BC 2KLOA 1EV7A 1YYVA 4D1QA 1YX3A 2M4GA 1HQCA 4PSWA 3MKWB 4M3DA 2LY9A 1MMGA 1APLC 4OIRF 1RESA 2PBIA 1OYYA 2NXNB 4Q47A 5E79C 4ZDPA 3N05A 3DBHB 2A61A 3W6KB 4G7OF 4E7HA 4B3XA 2LF7A 2ZC2A 3OV8A 1R22A 2CYYA 2FOKA 3BQYA 3S1MJ 1BIAA 5CJ9A 3JRHA 3AG2H 3LA2A 4P1WA 4RM2A 4IQJA 2ICWG 2LKPA 2KRCA 5C3EJ 1HA8A 3CC2I 2ZNZA 3IH3A 1NG7A 3DEUA 3KYLA 1RUNA 1BR1A 3MZYA 2L4MA 3BTLA 3K4CA 2I8DA 4BUPA 4X6AJ 1X4OA 3LSKA 2V9VA 1Z67A 2QWWA 1EA3A 4IEJA 1KQ8A 5CVVA 3H35A 3JRCA 4ZTJA 3FDYA 1SEUA 1TWAJ 4CSWA 2EPFA 2VT2A 2NNYA 2V1UA 2CH0A 2DU9A 4RLQA 2EFQA 4HX7A 4HAMA 1J9IA 4EM2A 4G6TB 3I9V2 1T2KA 2L7FP 1KYZA 2MGQA 3WU2C 2C6YA 1U6GA 3FXJA 2XGXA 3OIQA 2ETHA 1ETYA 4TV7A 5KK1A 1E3PA 2DA1A 3ZMZA 1BL0A 1P4WA 2ZXHA 4FCYA 2DA4A 4II3A 3CD6I 2FEZA 4AWXB 2QVOA 4XKVA 5JHFA 3L2WA 1N25A 4BU2A 2XPVA 4BS9A 2O61A 3KZIC 3BJOA 5E18F 1O3TA 2DQLA 2OD5A 2M9HA 2XAFA 3JCUC 2KRFA 2CUJA 2Y48A 2VBXA 1XGSA 1F1ZA 2H1KA 3KEOA 1D5YA 2O9LA 3BR3A 2E2HJ 1H9TA 1T56A 4B09A 3HC7A 3SHFA 1XDUA 4UUVA 3I71A 1S3JA 3AG1H 2UZKA 5CVIA 4BL0B 2IXSA 5H20A 3V7SA 2OZ6A 2VKVA 2R7XA 1P9QC 3HRTA 5DM7F 3V7RA 4LOCA 4RAGA 2XRLA 4A69C 4IRIA 3A01B 1WJDA 4LK0F 2ZJRF 3W6JB 1IV6A 3E5XA 1OFCX 1SVLA 3DFGA 4CHUA 3H92A 4LITA 5DEQA 2LK2A 2ZFWA 3NQOA 1YJNI 1WCMJ 3ABUA 3ISPA 3JRFA 1JUMA 1QHHD 5IT3A 1TW3A 4BY1J 2E7WA 3RZOJ 4L9JA 1ERDA 4CYCA 1XSXA 3K70C 2HOAA 2DXIA 1P4AA 2F4IA 2ACJA 2COMA 4XM3A 2LREA 3JAMK 4UHTA 1KQ9A 2AXTC 2DK5A 2K9LA 3WTZA 2RREA 5KNLA 2O7OA 1OCRH 2EWNA 1W0TA 2QF7A 3M3YJ 2W7NA 3S2HJ 2RVCA 2OZUA 2G0EA 4KJZA 2Q8KA 3FXQA 2R0QC 4L9NA 1L3LA 2ZBKA 2HVQA 4XLFA 3RKYA 3RQ4A 5GADJ 2HS5A 2P8TA 1TT5B 2KPMA 1FBQA 1ZELA 1NK3P 4KT6A 2HXIA 3BTIA 4IL6C 1QPMA 3OYDA 1SFEA 3TQNA 2XGDA 3G1LA 5H6QA 2M3AA 4C3JJ 5HLGA 1XSDA 2HQNA 4IVNA 3ZOBA 2MH2A 5FLXZ 4D9JA 2DQRA 3DWLE 2FX0A 3KETA 2DA2A 2P6SA 2X51A 2L2OA 5F0CA 2DFEA 3L2CA 3KP3A 3BR6A 1JGSA 2Z3YA 2EIKH 3GXOA 2NS8A 2QKLB 3F6VA 4NHJA 2F48A 1ZN2A 3GLLA 2RQPA 1XN7A 5AONA 5F0HA 4FISA 1LNWA 4EGZA 2KIQA 3REOA 4XRMA 2HQAA 4UV9A 1XS9A 1E2XA 3FXUA 1JJ8C 2QQ9A 1JE8A 3FXOA 4BQNA 4KFCA 3IP4B 2FNAA 2R7FA 4JK1X 5B1BH 3OIPA 3LSTA 3JSPA 1GVDA 3ZMSA 1B1BA 4UUTA 3G4SI 1OYIA 2JA5J 1YRNA 5TJJA 3OOUA 3OYJA 2DOFA 4A3EJ 3I58A 3TOBA 1QPIA 4BBRJ 2G7HA 1K83J 2DT6A 1FIPA 2JA2A 4ZYAA 4LMYA 3CMYA 1FMVA 2DMTA 2WV1A 2KIFA 2YU9J 3KP2A 1X58A 2CFOA 5E3NA 1YJ9I 3P9IA 4HF2A 1LE8B 1W36C 4PCQA 3WODF 2QSGX 1H8AC 3H3UA 1SFUA 5CQGA 3MMYB 4DOZA 1A6IA 1PYVA 2KQRA 5FKOA 5EEAA 2LDUA 2XF5A 4GFBA 2L9RA 3PL8A 2XB5A 5E1WA 2EFWA 4DYRA 4L5EA 1GVJA 2R7VA 1YTYA 1FX7A 4A3CJ 1MBJA 2VBWA 3L2UA 1N77A 2ECBA 3CCVI 4Y4RA 3LSHA 2JSPA 3K9TA 2VQHA 2GBYA 4YEJA 4AU7A 3HL2A 1BOAA 4IXAA 1U9OA 4EVIA 3M8FA 1WQ2A 3ML6A 4GDFA 1ETQA 4KA4A 4BYYA 1G59A 1KU3A 3BOQA 1A35A 2XAGA 1MW7A 3C3WA 4MEXF 1MGTA 3RTRA 2GQQA 3F8BA 2P7CB 2CQKA 4II2A 1GXPA 1IXRC 2XPUA 5D5VB 2DYRH 3OIOA 2AO9A 2O5RA 1OCPA 5L3DA 2XGEA 4BAYA 4D0PA 2X6YA 3FIWA 5LFAA 5LBQA 2CW7A 5M5XJ 4A3FJ 4Q5SF 2DOEA 2CRGA 5C44J 3KPHA 3FX3A 5JLXA 1MJ9A 5J8FA 2VE8A 2LMDA 3CJNA 2Y30A 2QEXI 1YE9A 3SDGA 2JQ7A 2M87A 1QVUA 3Q0VA 4U0VA 4RLFA 3LWFA 2L5QA 4BXUA 1HKQA 3GTQJ 3M07A 1B8IB 4E7JA 4FTHA 4XNFA 4XORA 3NWSA 3H9GA 3VDXA 4G6QA 4E7KA 2VPLA 1SD7A 2BHYA 3OYGA 4N0BA 2EFNA 5J3LA 1ZRCA 5F64A 3MAJA 3OOPA 1PUFA 4JYKA 1T0FC 3T8RA 1W5TA 5HS9A 1EH6A 2FMYA 2ID6A 4IQ4A 5F27A 2ZNYA 3OYHA 2DJIA 4MGRA 3LAPA 1HSTA 3L9FA 4KN4X 2ISZA 1GLNA 1DGWY 5HDNA 4NUBA 3OYKA 4BDZA 1EF4A 3QPTA 3J80K 1AA7A 4E7IA 3LFUA 5GAGJ 1JHHA 1RNLA 3QPLA 3V8KA 3H3ZA 1JT0A 3LMMA 1SVMA 2Y0MA 3BQZA 2MABA 2QQAA 3G1MA 1IV8A 1KU7A 5IYBJ 3F0CA 4XONA 5EEHA 1RPWA 1A6QA 3BG5A 3BPXA 3MKLA 1H9GA 4R8HA 3HPHA 4IOAF 3SFZA 3OS2A 2O03A 1X1CA 3TO6A 4HZFA 3I59B 5EEGA 4J01A 3KZYA 4LLNA 1LJ9A 5BMZA 2XUBA 2R5ZA 4PK4A 2MYSA 2E60A 4RGXA 2N8GA 2AS5F 2E1NA 1Z1DA 2Y69H 4BACA 4Y3OA 4JOMA 4UVAA 1LPQA 1OQYA 1YX5A 2WBMA 5FO5A 2G7UA 1OR7A 1IG7A 1BJZA 3HJEA 3J81K 1VQPI 1HBXG 2WY7Q 2LFBA 1PVEA 3LL7A 1ZGJA 1LUJB 3CCLI 4MFDA 4A5MA 2JA6J 2EZLA 3PFIA 2KJCA 3D5RC 4OOIA 1FBSA 3BR0A 3CUQC 4FE4A 1R7JA 4NC7A 4C30A 3B6AA 1PDNC 3CDHA 3SZTA 5LEJA 2ZCWA 1V5GA 1FTTA 3I3LA 1IJWC 3F8FA 4BKXA 3ROUA 3PNYA 2YS9A 5CYVA 3WTXC 3WTSC 3U1DA 2IRFG 5ICEA 5IP7J 3KEQA 4B8XA 3O2PE 2VODA 5JHUA 5L3EA 1S7EA 4P9UA 1S7OA 2FNPA 5GPAA 2X6XA 1HDDC 2LNBA 3DBRB 2GLOA 2DT5A 3OYLA 2A07F 4K2EA 3RQIA 2JJ7A 2BY1A 2MLKA 2EJRA 2XV4S 1U0JA 3TL4X 3KLOA 2K7LA 2Y0SA 3I4PA 3OYCA 1XC5A 2W24A 2DDAA 1W0UA 3A01A 4UV8A 4HLXA 4S0HB 4EJWA 4HDVA 4RS8A 2FE3A 3AG4H 3MZHA 2JA8J 1JI8A 2JUGA 3FM3A 1SAXA 1W5CC 1YG2A 3WE3A 4H0EA 1LDKB 3AKZA 4JP0A 4A3KJ 4EGYA 3HRUA 1O7FA 2L3DA 2NVUB 1I1SA 1J59A 3CMAI 1G3WA 3TW7A 1TQPA 2V4JC 2FSWA 3BG9A 4G7ZF 3F6OA 3CMMA 1MJBA 1USTA 1TW2A 5HNHA 2V26A 2YU3A 1XPXA 1K4SA 2FQ3A 2MA3A 4LG0A 4AVZA 4XMYA 1TWHJ 2PMZN 5D8KB 2WC2A 2VUMJ 2VJIA 1ZK8A 2VI6A 3CF5F 4BE0A 4G94A 5E3LA 2HOTA 2EV5A 2M34A 3JRAA 3IAM2 1YHQI 2FBIA 3G6EI 3CP8A 1FT9A 1FSHA 3AL0C 5E3MA 1MBFA 4ASNA 3FHZA 3N97A 1VQOI 1WGXA 1YIJI 4ITVA 2BOLA 5LGNA 5IT9Z 2Z33A 1FBUA 2MD0A 1DUXC 1IRXA 1QGPA 3HSRA 3VYUB 1T0FA 2VOOA 3ASNH 3LSGA 4MLOA 5EGOA 2VQGA 2D1HA 1YRNB 2X0LA 1ULYA 4S04A 2HPIA 2R7TA 2EV6A 2PQ8A 1SFOJ 3PSFA 2NNNA 1HCRA 3BPVA 3RKWA 3DP7A 5E8GA 2QBYB 4GO1A 2ZSHB 2VJJA 2PJRA 5A2QZ 1XG1A 3GZ6A 4IKFA 4KMFA 3G73A 1MNDA 3HBLA 1DPUA 5GAEJ 3OR1C 3HOZJ 4A0XA 4I09A 1YS7A 3ABTA 3H0GJ 3W2VA 2K3FA 2O8KA 1UHSA 4CZZA 3S93A 2F5DA 3R61A 2OAZA 3QRFF 2BHZA 5TRDA 1HSJA 3IC7A 2ZB9A 2W1OA 2DODA 1Q1HA 2L9SA 5HDKA 3ERED 2ZJPF 4ESFA 1D8JA 4FASD 1UB9A 2QLZA 5K1YA 4XLAA 1JUSA 3FKIJ 2IA1A 2BVMA 2WAFA 1RI7A 3W3CA 2CQ7A 2DFHA 2QENA 3KZZA 3ZN1A 5HS8A 3W6VA 3P5JA 2QUFA 3OL4A 4W97A 1O4XA 1FOKA 3W2AA 1IW7F 3L00A 2OF7A 1T08B 2CV0A 1BIBA 2MC3A 3FK7A 4A6EA 4MIMA 2ZXJA 3O6BB 2E19A 3R0JA 2DW4A 3J7AY 2F4OB 2NOJB 4F7ZA 2E5NA 4CCMA 2M5WA 2ELKA 4ENKA 4ZZDA 3GZ5A 3SYTA 4FX0A 1UG2A 4A3IJ 4U87A 3TOAA 4XLPF 2WA0A 2ZKZA 3DLAA 4HF1A 3A2KA 4B43A 1Z21A 2FXAA 5HLHA 3CUQA 1H88C 4UB6C 3UKGA 1JGGA 3ONQA 1MMNA 3L2RA 1ONVA 1EJ9A 2P81A 1S7AA 1OLTA 3QYBA 3OYNA 1IUYA 2IJLA 5D5UB 1R4NB 3CESA 3R6SA 2M30A 3O8GA 2KIUA 2RNJA 2LTPA 5F0FA 3WTUC 1F4KA 1D1AA 4DBQA 1UELB 2HOEA 4BDYA 4HEA2 1SFXA 1HC8A 2VJ5A 2M8GX 4QTRA 2WAEA 4P9FA 1IGNA 2Y9YA 4V19K 1Z7UA 2NVQJ 3H0DA 2JT1A 1WVRA 4BQAA 2LBFB 4B3AA 2QA4I 5D5XB 1XMAA 3EUKL 5FLMJ 1OCTC 3HEFA 4Y17A 1YITI 4Y7NJ 1PUFB 4U7DA 4XICA 1ZHFA 1VQ4I 2PG4A 1F9NA 3K4KA 2DN0A 3SDBA 4B1RA 5IPAA 1L0OC 1X1PA 4LB6B 3UR3C 4IJAA 3BDDA 3TP3A 2Z5UA 4QWQA 2HEOA 3O3KA 1FIAA 1O3QA 2A3SA 2H6BA 2OQGA 2P4WA 2ISYA 3EPZA 1Y1VJ 2XIGA 2FUG2 2VN2A 1UJ8A 2E35A 3GTJJ 2KKOA 2M45A 2CFXA 1SFKA 2I5UA 1U8RA 1ACIA 3JSOA 2GXAA 4N9HA 4UVCA 2FD5A 1B8IA 3TO9A 4IHWA 3L2QA 1JUPA 2X4HA 3DCFA 3S32A 1B9MA 1FY7A 4S05A 5J8CA 1GDTA 1OMIA 4M9XA 4LJZF 3VB2A 2NVTJ 2HFHA 2D5VA 5LRSA 2EILH 1WJAA 4XN3A 3K2AA 3CMEI 1AWCA 3FBNB 1SD4A 1ETOA 2GA1A 2CJJA 2L9VA 4JBAA 4PGGA 2R5ZB 2XAQA 1ZG3A 1Z05A 2VKDA 2V1NA 4OU0A 4EJTA 2H8RA 2M7AA 1VQLI 3V8LA 3H5AA 3PM1A 1RRJA 4BQQA 1S5LC 1RIOH 3TBIA 3E6BA 3CTAA 4XIDA 2MC4A 2LF8A 2R5YA 2XF6A 1XCBA 2DDBA 2J5PA 4UVBA 1HOMA 1MJAA 2JUCA 3WGHA 1YQAA 4C2TA 2XASA 2IT0A 2W82A 3CCYA 3E3VA 3I5UA 1P6RA 4C2MJ 1Z91A 2DMNA 2F5FA 2GXGA 4QLCU 3IKTA 2L7MP 5M5WJ 3GW2A 1OKRA 2H09A 3PIPF 1PP8F 3E1SA 5TGTA 4BXXJ 3I59A 3HIFA 2ZO4A 1LFUP 5FRMA 2OC6A 4M9SA 3VYTB 1TWCJ 1HF0A 5CVJA 4AVPA 1X1DA 1IF1A 2HI3A 3CZ6A 4DQ2A 4CA0A 1Y8RB 2BXYA 1FYMA 4LD5A 1TQIA 1I1GA 1VQ6I 3B6CA 4DGWB 3TGNA 5TISC 4NB5A 1ZR4A 3BCBA 1E17A 2VIXA 2P5VA 4M3FA 4P5OA 3JR9A 4A12A 1X2NA 2L9NA 2LH9A 5B3SH 1WKMA 4IHVA 4RB1A 3OYMA 3QU6A 3KP4A 5CKTA 1R00A 5BQTA 2GA2A 4UB8C 5CQEA 4AUXA 1FEXA 2NVYJ 4ZZLA 4XRFA 3F3XA 4CICA 2VT3A 2K9SA 4AYBA 1CF7A 2BY3A 2X9DA 3GF2A 4R79A 2DBBA 2E2JJ 3J7YJ 2TRTA 4DZJA 3W2WA 4AIDA 2Z2SB 3WU1B 1J75A 1X3ZB 1BJAA 2KZVA 1XGOA 1R49A 4LG0B 1LKXA 1ETKA 1EH7A 1BI0A 5HODA 2ESNA 4XBFA 3GUDA 4ZYGA 2F5CA 5IYCJ 5ICCA 4N4OB 4I0BA 2UWMA 1WI9A 2BXZA 3LSJA 2EA4A 3MD2A 4PFPA 1ZGWA 1QQIA 3K10A 3K7AJ 4HSRA 3S17J 1Q1VA 5DD8A 1TWFJ 3WTWC 4QSHA 3LSRA 4IOCF 2P7VB 4WX9A 2CO5A 3A0HC 1EH8A 1WFXA 3BY6A 4QIWN 2K9QA 2VONA 4I2OA 1P7IA 3VFZA 3HB9A 3GFJA 4QPOA 1G6NA 1PP7U 1N75A 1YJWI 3LA3A 2K86A 3IKVA 4Y33A 1H0MA 4I76A 3DU6A 5EGOB 4XN0A 1MD0A 3CC7I 1GV5A 4F55A 4CUGA 1FSEA 2MW8A 1WH5A 4CCLA 4BGDA 3D5LA 4BJTA 2H94A 2WB1A 5AIPA 2PJRB 2VBZA 1POGA 3L7WA 1DP7P 2EIMH 2EV0A 2R4GA 2A6EF 3GWZA 3VEPA 2W84A 3V4GA 4EV0A 2HYFA 5LLQA 2ME6A 2VLAA 3KX2A 3K6GA 1CGPA 1OYWA 1ETWA 5FKMA 1F5TA 3PNVA 2YSRA 1HKSA 1MBEA 3QOPA 6PAXA 1IXSB 5KAFC 4V2FA 1HXDA 3FF5A 1W7PD 4Y15A 2W57A 4Z2YA 1SAUA 2ZFUA 3A4CA 4BHCA 2QCOA 4ZH4F 1ZTRA 5J1YA 5CPRB 3IV5A 3CCSI 2OTLI 4A3GJ 1UHWA 4AC0A 2ADUA 2LKXA 3ZMDA 2M7BA 2ZSIB 2D1VA 1IDZA 2V6EA 3HGGA 1LB2A 3M8EA 5GPCA 2KDZA 3RZDJ 3FXKA 4ZJZA 4MTDA 3S3NA 2QBYA 3RPUD 5M3FJ 4EJVA 2LRDA 3LFKA 4C9YA 4NNJA 5FB2A 4XSXF 3S1RJ 5ED4A 2QZ8A 3IAS2 3CCQI 3FXLA 4N4NB 5J1RA 1OCOH 3GYHX 2Z9OA 4OMZA 2F2EA 3FBIB 4DW6A 5FD6A 5H2FC 5E8IA 1UG0A 5J1UA 3RYRA 4B48A 2YX7A 3CUQB 4A3JJ 4IRHA 5J47A 2JMWA 3FMSA 3F21A 4IHYA 4UNOA 2R7SA 3CCMI 1FPQA 2CUFA 3RCOA 3CQZJ 4XLHA 2O6GE 2ECCA 1K4TA 1Z9CA 4HX4A 1HDPA 1Z77A 1R9TJ 2CW8A 4PJJA 2M0CA 2GWRA 4RA2A 4HG2A 1FYLA 5D6EA 1GUUA 3QAHA 1K61A 3P9CA 4ANJA 2PLYA 1F36A 1IN8A 4M3BA 3ZMUA 2OUMA 2K4BA 4AD9A 1QA6A 4KYWA 2EFOA 3IRQA 2P6TA 1U2WA 3PJRA 2DMUA 5DTDA 3KYCB 1MMDA 2CQNA 3BG6A 3CLQA 1SMTA 2HXOA 2VBYA 3JRBA 1DGRM 1X3UA 2NVXJ 2HR3A 4AIJA 4HSTA 4HW0A 1R58A 4RDUA 3H36A 1BOBA 4RAZA 3OSFA 3P9KA 3KEYA 1G3TA 4XL9A 3S1QJ 4YIRX 3HSEA 3F22A 3BTCA 3S3OA 2HTSA 2HYJA 4EATA 4ENMA 3I55I 5HS7A 3PFYA 4CYDA 3VPRA 4LFUA 4PJLA 4RAFA 4JX5A 1JKPC 3OYIA 1JJ6C 1F43A 3PUFA 3PO3J 2RDPA 3KYDB 4NDLA 2LBFA 4YG2F 2VB6A 1S9HA 3EDPA 3SEQA 2AXLA 2XAUA 3GZNB 3OS0A 3AL0B 1MMSA 5DUIA 3ABLH 2AQFA 3K4LA 3DLLF 5HDGA 2WADA 1O57A 1BI1A 2L7KA 2A5WA 3A1YA 3EUAA 2R5YB 2HDDA 1Y6IA 3Q0WA 3S8PA 3QPHA 4FE7A 5IOYA 5IOZA 2UV1A 2R7OA 3ZQCA 3S1NJ 1LFPA 3K0LA 2PEXA 3BG7A 4CO8A 3ZQFA 5EYRA 3ZXSA 3ZPLA 3C1DA 1VZ0A 2EK5A 2Q2EA 3EETA 3LSMA 4O6JA 1QHGA 2VJ4A 2V6CA 2IP2A 2W85A 2E1CA 4G7HF 2BGCA 1HW1A 4DBRA 4KISA 2FF4A 1XGNA 1ZR2A 3C7JA 3MN2A 1TNTA 1W5SA 2W00A 4WF2A 1I5ZA 2KZGA 3ZMTA 3DPTA 4U0WA 4BHBA 1K6OA 2E36A 1YOVB 3BROA 1G4DA 3MZ8A 3IRRA 5E20A 2WWYA 3BZCA 3K2ZA 2E1MC 4HNVA 3DBLB 2CGPA 2DA6A 2BY2A 1FLIA 3R60A 4Q48A 2BY0A 3H9QA 3G2BA 2H8WA 3S15J 4DYQA 3RYPA 1HW2A 3FMQA 1YW8A 2Z99A 2L02A 4I99C 2OA4A 1G3SA 1B59A 4RAYA 1JKQC 4O3MA 1X1BA 3LOCA 2Y0SN 3JAMZ 1ZQ3P 4PGHA 3BC8A 2D2WA 2KJBA 4EJOA 1Z6RA 1VTNC 1TWGJ 4EM1A 5J4VA 4LLLA 1CF7B 3QWLA 4RGUA 2IS1A 1QZYA 5KAIC 4ENJA 1WRJA 3M8JA 2E5ZA 5HLTA 3AAFA 1XGMA 2P5KA 3ZMVA 5HVQC 3CP2A 3ZQLA 2WTEA 1MBHA 5FFZA 1LEBA 1D8KA 4NQWA 4F93B 3FKJA 2GOXB 4U88A 1VFCA 3S16J 2VQLA 2ZXIA 2GM4A 3HOUJ 2K85A 2VC0A 2VKEA 3K69A 3I54A 5JLWA 4HLYA 1KGSA 2Y75A 1V5EA 2V7FA 1ITYA 1TL8A 2XPWA 2LYCA 3BP8A 3CC4I 2YR2A 3WTTC 1QO0D 2XB0X 4A3BJ 2R7QA 3EYYA 3ABKH 1FWZA 2EIJH 2F5EA 3OYEA 2DA7A 4LIUA 1MH3A 4IRGA 3ZR8X 4DJAA 3BR5A 1D1BA 3ZQQA 2CWEA 3E6DA 1U8BA 3HOXJ 1MZBA 4HV6A 1ZAOA 2WAQA 4WXCA 1WJ5A 3RSNA 3K1PA 2LY2A 3WHBA 3MKZA 1K78A 1TP4A 5GP9A 2BEOA 1VQ8I 1JHFA 1XB4A 3ULQB 1P2FA 4G8XA 4BNCA 3HKZA 3VSLA 1DDNA 1RKWA 3S3MA 3CCUI 5JI6A 1NK2P 1ZRFA 3VYRB 5K7HA 3GFLA 4UY8I 1GHCA 3GTKJ 3DKYA 1DPRA 4YIFA 3GVAA 3I56I 3CO7C 4HRIA 1FYKA 2ELJA 4L9TA 3FISA 2RV8A 1UMQA 3ABMH 3ECHA 3HHGA 1R1TA 4Y52J 3E97A 3SZPA 4YRVA 5K5OA 4HF0A 3R4KA 1TQMA 4XLCA 1HLVA 4RB3C 4EJUA 2DTZA 2LC2A 4PUSA 1R1VA 4A0ZA 1MBGA 2JK3A 4E70A 1FOXA 1R1UA 1TTYA 3V42A 1ETXA 3A02A 2CV1A 3BR2A 4PJMA 3FZVA 4ON0A 1ODDA 1O3RA
chains in the Genus database with same CATH topology
4PZJA 5D4RA 1ZG5A 3HRSA 2MH9A 1Z6TA 1C0WA 1USSA 1PUEE 1KQ0A 4KIFA 1FC3A 3HRMA 2CSOA 1A04A 1S8NA 5DV5A 5DYMA 1XMKA 5KVRA 5E17F 3E5QA 3TDUC 5FLXK 5BPIA 1SMYF 2FRHA 3EQLF 3B02A 1ZH5A 2P5LC 2EB7A 3J7AO 2JZYA 4M73A 3MFKA 3P7NA 1Y0UA 1V3FA 5DDGA 3WU0A 5E1ZB 1U3EM 1ON1A 4MNUA 1R5GA 3C18A 2R3SA 4N9IA 3EYIA 1HW5A 2ELHA 3FWEA 2A69F 4Y13A 3IL2A 3KP5A 4HYEA 2A5YB 3IWFA 3J80Z 1RZ4A 1IN4A 4G6DA 5BS6A 1IZ1A 4IF4A 2VOPA 4A0YA 4EQQA 1FNNA 2XKOA 3MQ0A 4YFKF 1ZARA 4XSZF 3WTYC 1ZG1A 2HTJA 1G3YA 3PQJA 4KICA 1ON2A 1FP1D 3SXYA 5BPDA 2EFPA 2XKPA 3B73A 3ECOA 3T1BA 1ZLKA 2JPBA 1U5TC 3Q9SA 3J81Z 3E6MA 3IHUA 3HTSB 2D45A 3WGGA 4G9YA 5D5WB 2V79A 1KA8A 1UFMA 5LGTA 1J7KA 2OBPA 2HDCA 2HZTA 3I0TA 4P96A 3M1EA 1ZGAA 4OMYA 2JPCA 5DCMA 5LHHA 3HUGA 1OPCA 1W4MA 2J5OA 3RJPA 4EMSA 5D6FA 5J6XA 2IW5A 1KU2A 1IXCA 3GLXA 3MWMA 3FMRA 4GXOA 4MQVA 2VC1A 5DCFA 2YPRA 3F8CA 3U2RA 2H6CA 2DI3A 5D4SA 2FA5A 1R5HA 1ZREA 1MDMB 3WE2A 3JTGA 4GYGA 3GFMA 1ZLJA 3WG9A 3D0SA 5JVTA 2V1DA 3TDZC 4OIPF 2L01A 5CVUA 4I7HA 5K5QA 1XD7A 4RGSA 1SD6A 1B6AA 2JSCA 5ILUA 1K78B 3F8NA 4MQ9F 3G3ZA 4Q4ZF 4IPAA 1BI2A 4A6DA 2QQBA 1LDDA 1KU9A 3RPQA 3HTUA 4I0AA 4M74A 4WWCA 4BH9A 1ZRDA 4L0ZB 1IRGA 3LA7A 3ZN0A 2V1XA 2GIVA 2ZMEB 4M6XA 4WXDA 5LEKA 2XAJA 2FBHA 4RB2C 3M9AA 5HOOA 2H27A 1T98A 2PMHA 2RC4A 2YX4A 5D8LB 4BHPA 2QYOA 3Q5FA 1BI3A 3PQKA 2XHKA 4YFNF 1BM9A 3I64A 1W7PB 2IA0A 3GO5A 1I6XA 3HOTA 3KP6A 1LVAA 3FXRA 1O3SA 3R0AA 2K27A 1U5TA 3I53A 1J0RA 2RGVA 2W25A 1FP2A 1U78A 1T6SA 2IVMA 2WV0A 4FX4A 4M6YA 1O7LA 3JW4A 5ILSA 4HV5A 3Q9VA 2BYVE 2A6HF 2O3FA 4KIGA 1RUOA 2CG4A 1YLFA 2FBKA 4GCVA 2GXBA 2L4AA 3K1MA 4KNYA 2VE9A 2PMUA 2PFBA 2CW0F 1GXQA 2FMLA 5IT9K 4L0YB 5DD4A 3DKWA 4CGZA 3EUHA 1BC7C 4R1HA 2NAZA 5H6RA 4JQFA 3LAJA 1UCRA 4PDKA 4WCGA 3VOEA 5A2QK 2XAHA 3FM5A 2PJPA 2DTRA 5L3BA 1LQ1A 3LQRA 2BBYA 3SQNA 4OINF 4RB0A 5L3GA 1YIOA 2BE5F 4KIBA 5HLIA 2DPDA 3CUOA 5JFRA 1IN5A 2OU2A 3NEUA 1T38A 2GZWA 4I98B 5FGMA 2UXXA 5FFXA 1JXSA 4ZYDA 1ZYRF 3LQQA 3MEXA 2NYXA 4ZYEA 4HQEA 2FU4A 1B9NA 2PI0A 2HKXA 4GYIA 1LDJA 3TO7A 1D5VA 4LB5A 1YFHA 3V8JA 2HYGD 5L3FA 3WGIA 3TKYA 5DUKA 3VODA 4KUMA 2K4JA 1QZZA 5DCMB 4AIKA 1P92A 5AIQA 2HGCA 2STWA 4A5NA 2DFIA 4HDUA 3U9GA 3CLOA 3ZP5A 1MKMA 1V4RA 2STTA 2Q0OA 2UXNA 4ETSA 3K1NA 5CLSA 1J5YA 2QM3A 4GGGA 4U0YA 1P4XA 3RKXA 1QNTA 4U7BA 3KCCA 1KYWA 2EA2A 1IN6A 4I02A 1NHAA 3DQVC 2XVCA 1XSVA 3L09A 2A68F 4FT8A 3S2WA 4ZYHA 3JTHA 3M7GA 3E6CC 4L18B 1R23A 1K7AA 3BWGA 1IRFA 2O8XA 2B0LA 4KDPA 5F1RA 4CXFA 1STZA 3GFIA 2DO7A 1BC8C 1XCVA 5K5RA 5LRRA 1REPC 4YIIA 1YO5C 3ELKA 4L9VA 3N4MA 1MDMA 1WSUA 3RI4A 2K02A 4EM0B 3DXJF 3F23A 2JRTA 2VXZA 2HQRA 4UXNA 1TNSA 4WK8F 4ESJA 2NS0A 4AIHA 2ZJ2A 5CVRA 3DV8A 4WXHA 3MCZA 2DAOA 2MD5A 4OIQF 1LEAA 1S29A 1QBJA 2M8EA 3DPLC 5LHIA 4IHTA 1B4AA 3V7CA 2LSOA 2GAUA 2ESHA 2BV6A 5L3CA 4ENNA 3KE2A 3T5XA 4OIOF 1SD5A 3WTVC 3CO6C 1BBYA 2L54A 1TLHB 3T8TA 2DLLA 4HOBA 2ZMEA 5JR3A 1U5TB 2IA2A 5ICGA 4A2UA 1WWXA 2DPUA 2PN6A 1AOYA 4O5VA 5F6FA 1XDSA 3COAC 1W7PA 4HBLA 4M72A 2NRAC 3HHHA 2O0YA 2HWVA 1UHMA 5LGUA 2IPQX 1BN5A 4MEYF 5E1XA 3RPUA 3HOSA 3KP7A 3RIRA 5ILVA 4I01A 3BJ6A 4MTEA 4L5JA 4KMUX 1TBXA 4RGRA 5BOXA 4KN7X 3HSFA 1YS6A 4LGWA 2E7XA 1HKTA 3T0YA 1I27A 4HX8A 4IHSA 2M1BA 2DK8A 4XLNF 4LK1F 3E5UA 2R7DA 3QU3A 2RN7A 3KLNA 4M9ZA 2XRNA 4HA8A 1IAWA 2JTVA 4CDGA 4YFXF 2KIMA 4MHGA 3RDIA 2XROA 5FD5A 3F72A 4LLGF 3DF8A 1K79A 3HYIA 3GEZA 2TDXA 2HKOA 1D3YA 3KFWX 4M71A 4FHTA 5ICFA 4KT5C 1FZPB 1J2XA 1YW9A 2G9WA 5LHGA 4L5IA 2MBFA 3ZQ7A 3QP6A 1S6LA 2RKHA 2MLGA 1YW7A 1T39A 3BZ6A 1R36A 3BJAA 2OQRA 4HQMA 3GX4X 1IN7A 5ERIA 3IWZA 3QP5A 4P55A 3F8MA 3NRVA 4ESBA 4DNCA 1EV7A 1YYVA 1HQCA 4OIRF 2PBIA 1OYYA 4Q47A 2A61A 3W6KB 4G7OF 2LF7A 3OV8A 1R22A 2CYYA 2FOKA 1BIAA 5CJ9A 3LA2A 2LKPA 2ZNZA 3DEUA 1RUNA 3MZYA 2L4MA 2V9VA 2QWWA 1KQ8A 5CVVA 2VT2A 2NNYA 2V1UA 2DU9A 2EFQA 4HX7A 4HAMA 1J9IA 4EM2A 1T2KA 1KYZA 2C6YA 1U6GA 2XGXA 2ETHA 4TV7A 5KK1A 3ZMZA 1P4WA 2FEZA 4AWXB 2QVOA 2O61A 3BJOA 5E18F 1O3TA 2DQLA 2OD5A 2XAFA 2KRFA 2Y48A 2VBXA 1XGSA 1F1ZA 3KEOA 1H9TA 4B09A 3SHFA 1XDUA 4UUVA 3I71A 1S3JA 2UZKA 5CVIA 5H20A 3V7SA 2OZ6A 3HRTA 3V7RA 4IRIA 4LK0F 3W6JB 3E5XA 3DFGA 4CHUA 3H92A 5DEQA 2ZFWA 3NQOA 3ABUA 3ISPA 5IT3A 1TW3A 2E7WA 4L9JA 1XSXA 1P4AA 2ACJA 2COMA 3JAMK 4UHTA 1KQ9A 2DK5A 3WTZA 2EWNA 2RVCA 2OZUA 2Q8KA 3FXQA 1L3LA 4L9NA 2ZBKA 3RKYA 2HS5A 2P8TA 1FBQA 1QPMA 1SFEA 3TQNA 5H6QA 5HLGA 1XSDA 2HQNA 4IVNA 2MH2A 5FLXZ 2DQRA 3KETA 2P6SA 3L2CA 3KP3A 1JGSA 2Z3YA 3GXOA 3F6VA 4NHJA 1ZN2A 2RQPA 1XN7A 5AONA 1LNWA 4EGZA 3REOA 4UV9A 1E2XA 3FXUA 2QQ9A 1JE8A 4KFCA 2FNAA 2R7FA 4JK1X 3LSTA 3JSPA 3ZMSA 1B1BA 1OYIA 5TJJA 3I58A 3TOBA 2G7HA 4LMYA 2KIFA 3KP2A 4HF2A 3P9IA 4PCQA 3WODF 3H3UA 1SFUA 2LDUA 5E1WA 2EFWA 1GVJA 1YTYA 1FX7A 2VBWA 3K9TA 1BOAA 4IXAA 4EVIA 3M8FA 1WQ2A 3ML6A 4KA4A 4BYYA 1KU3A 3BOQA 2XAGA 3C3WA 4MEXF 1MGTA 3RTRA 2GQQA 3F8BA 2P7CB 2CQKA 1GXPA 1IXRC 5D5VB 3AAFA 5L3DA 4BAYA 4D0PA 5LBQA 4Q5SF 3FX3A 1MJ9A 5J8FA 2VE8A 3CJNA 2M87A 4U0VA 4BXUA 3LWFA 1HKQA 4G6QA 1SD7A 4N0BA 2EFNA 1ZRCA 5F64A 3MAJA 3OOPA 3T8RA 1W5TA 5HS9A 1EH6A 2FMYA 2ZNYA 3LAPA 4MGRA 1HSTA 3L9FA 4KN4X 2ISZA 5HDNA 3QPTA 3J80K 1JHHA 1RNLA 3V8KA 3H3ZA 2Y0MA 2QQAA 1KU7A 5EEHA 3BPXA 4R8HA 1H9GA 3SFZA 2O03A 3TO6A 4HZFA 3I59B 5EEGA 3KZYA 4LLNA 1LJ9A 5BMZA 2XUBA 4RGXA 2AS5F 2E1NA 1Z1DA 4UVAA 5FO5A 2G7UA 1OR7A 3J81K 1HBXG 1ZGJA 4A5MA 3PFIA 2KJCA 4OOIA 1FBSA 3CUQC 1R7JA 1PDNC 3CDHA 3SZTA 5LEJA 2ZCWA 3F8FA 3ROUA 5CYVA 3WTXC 3WTSC 3U1DA 2IRFG 5ICEA 3KEQA 4B8XA 3O2PE 2VODA 5JHUA 5L3EA 4P9UA 1S7OA 2FNPA 2LNBA 2DT5A 2A07F 4K2EA 2MLKA 2EJRA 2XV4S 3KLOA 2K7LA 3I4PA 2W24A 4HDVA 4UV8A 4HLXA 4EJWA 4RS8A 2FE3A 3MZHA 3FM3A 1SAXA 1YG2A 3WE3A 4H0EA 1LDKB 4EGYA 3HRUA 1O7FA 2L3DA 1I1SA 1J59A 1G3WA 1TQPA 4G7ZF 2FSWA 3F6OA 1MJBA 1USTA 1TW2A 2YU3A 2FQ3A 2MA3A 4LG0A 5D8KB 2WC2A 4G94A 2EV5A 2FBIA 1FT9A 1FSHA 4ASNA 3FHZA 3N97A 5LGNA 5IT9Z 2Z33A 1FBUA 1DUXC 1QGPA 3HSRA 1T0FA 2VOOA 2D1HA 2X0LA 1ULYA 4S04A 2EV6A 2PQ8A 2NNNA 3BPVA 3RKWA 3DP7A 5E8GA 2QBYB 4GO1A 5A2QZ 3GZ6A 4KMFA 3G73A 1DPUA 4A0XA 4I09A 1YS7A 3ABTA 4CZZA 2F5DA 3R61A 2OAZA 3QRFF 5TRDA 1HSJA 3IC7A 1Q1HA 5HDKA 3ERED 4ESFA 1D8JA 1UB9A 2QLZA 5K1YA 2IA1A 1RI7A 5HS8A 2QENA 3KZZA 3ZN1A 2QUFA 1FOKA 1IW7F 3L00A 1BIBA 2MC3A 4A6EA 2ZXJA 3O6BB 3R0JA 2DW4A 4F7ZA 2M5WA 4ENKA 4ZZDA 3GZ5A 4FX0A 4HF1A 3TOAA 4XLPF 2ZKZA 2FXAA 5HLHA 3CUQA 1ONVA 1S7AA 1IUYA 2IJLA 5D5UB 3R6SA 2M30A 2KIUA 2RNJA 3WTUC 1F4KA 2HOEA 1SFXA 4P9FA 1Z7UA 2JT1A 4BQAA 5D5XB 1XMAA 4Y17A 4U7DA 1ZHFA 2PG4A 1F9NA 1L0OC 4LB6B 4IJAA 3BDDA 2Z5UA 4QWQA 2HEOA 3O3KA 1O3QA 2A3SA 2H6BA 2OQGA 2P4WA 2ISYA 2XIGA 2VN2A 2KKOA 2M45A 2CFXA 1U8RA 3JSOA 4N9HA 4UVCA 3TO9A 2X4HA 1B9MA 1FY7A 4S05A 5J8CA 1OMIA 4M9XA 4LJZF 3VB2A 2HFHA 5LRSA 1AWCA 1SD4A 2GA1A 4JBAA 4PGGA 2XAQA 1ZG3A 1Z05A 4OU0A 4EJTA 3V8LA 1RIOH 3E6BA 3CTAA 2LF8A 1XCBA 2J5PA 4UVBA 1MJAA 3WGHA 1YQAA 2XASA 2IT0A 3E3VA 3I5UA 1P6RA 3IKTA 1Z91A 2F5FA 2GXGA 4QLCU 3GW2A 1OKRA 2H09A 1PP8F 3I59A 3HIFA 2ZO4A 4M9SA 5CVJA 4AVPA 1IF1A 4DQ2A 1FYMA 4LD5A 1TQIA 1I1GA 3TGNA 4NB5A 1E17A 2P5VA 4P5OA 4A12A 1WKMA 4RB1A 3QU6A 3KP4A 1R00A 5BQTA 2GA2A 4ZZLA 4XRFA 3F3XA 4CICA 2VT3A 1CF7A 3GF2A 4R79A 2DBBA 3WU1B 1J75A 1BJAA 1XGOA 4LG0B 1EH7A 1BI0A 2ESNA 4XBFA 3GUDA 4ZYGA 2F5CA 5ICCA 4I0BA 2UWMA 1WI9A 2EA4A 1QQIA 5DD8A 3WTWC 2P7VB 4WX9A 2CO5A 1EH8A 3BY6A 2VONA 4I2OA 3VFZA 3GFJA 1PP7U 1G6NA 3LA3A 2K86A 3IKVA 1H0MA 1MD0A 1FSEA 3D5LA 2H94A 5AIPA 2VBZA 3L7WA 1DP7P 2EV0A 2A6EF 3GWZA 3VEPA 2W84A 3V4GA 4EV0A 2HYFA 5LLQA 1F5TA 1CGPA 1OYWA 2YSRA 1HKSA 3QOPA 6PAXA 1IXSB 1HXDA 3FF5A 1W7PD 4Y15A 2W57A 4Z2YA 4BHCA 4ZH4F 1UHWA 2ADUA 3ZMDA 2D1VA 1LB2A 3M8EA 2QBYA 4MTDA 4EJVA 3LFKA 5FB2A 4XSXF 5ED4A 2QZ8A 3GYHX 2Z9OA 4OMZA 2F2EA 5FD6A 5E8IA 3RYRA 2YX7A 3CUQB 4IRHA 3FMSA 3F21A 4UNOA 1FPQA 2O6GE 1Z9CA 4HX4A 2GWRA 1FYLA 5D6EA 3QAHA 3P9CA 2PLYA 1IN8A 3ZMUA 2K4BA 4AD9A 4KYWA 2EFOA 3IRQA 2P6TA 1U2WA 1SMTA 2VBYA 1X3UA 2HR3A 4AIJA 4HW0A 1R58A 4RAZA 3P9KA 1G3TA 3HSEA 3F22A 2HTSA 4ENMA 5HS7A 4CYDA 4LFUA 2RDPA 4YG2F 3EDPA 2AXLA 5DUIA 5HDGA 1O57A 1BI1A 3QPHA 3K0LA 2PEXA 4CO8A 3ZPLA 3C1DA 2EK5A 2Q2EA 3EETA 4O6JA 2V6CA 2IP2A 2W85A 2E1CA 4G7HF 2BGCA 1HW1A 2FF4A 1XGNA 3C7JA 1TNTA 1W5SA 4WF2A 1I5ZA 3ZMTA 4BHBA 3DPTA 4U0WA 1K6OA 3BROA 1G4DA 3IRRA 5E20A 2WWYA 3K2ZA 2CGPA 1FLIA 3R60A 4Q48A 3RYPA 1HW2A 3FMQA 1YW8A 2Z99A 2L02A 2OA4A 1G3SA 1B59A 4RAYA 4O3MA 3JAMZ 4PGHA 4EJOA 2D2WA 2KJBA 1Z6RA 1VTNC 4EM1A 4LLLA 1CF7B 4RGUA 1QZYA 4ENJA 1WRJA 1XGMA 2P5KA 3ZMVA 5HVQC 2WTEA 5FFZA 1LEBA 1D8KA 4NQWA 4U88A 2VC0A 3K69A 3I54A 4HLYA 1KGSA 2Y75A 3BP8A 2YR2A 3WTTC 1QO0D 3EYYA 1FWZA 2F5EA 4IRGA 2CWEA 3E6DA 1MZBA 4HV6A 1ZAOA 4WXCA 3K1PA 1K78A 2BEOA 1JHFA 1XB4A 3ULQB 1P2FA 4G8XA 4BNCA 1DDNA 1ZRFA 5JI6A 3GFLA 1GHCA 1DPRA 4YIFA 3CO7C 3GVAA 1FYKA 4L9TA 2RV8A 3ECHA 3HHGA 1R1TA 3E97A 3SZPA 5K5OA 4HF0A 3R4KA 1TQMA 4RB3C 4EJUA 1R1VA 4A0ZA 4E70A 1R1UA 1TTYA 4ON0A 3FZVA 1ODDA 1O3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZJ A;  5D4R A;  1ZG5 A;  3HRS A;  2MH9 A;  1Z6T A;  1C0W A;  1USS A;  1PUE E;  1KQ0 A;  4KIF A;  1FC3 A;  3HRM A;  2CSO A;  1A04 A;  1S8N A;  5DV5 A;  5DYM A;  1XMK A;  5KVR A;  5E17 F;  3E5Q A;  3TDU C;  5FLX K;  5BPI A;  1SMY F;  2FRH A;  3EQL F;  3B02 A;  1ZH5 A;  2P5L C;  2EB7 A;  3J7A O;  2JZY A;  4M73 A;  3MFK A;  3P7N A;  1Y0U A;  1V3F A;  5DDG A;  3WU0 A;  5E1Z B;  1U3E M;  1ON1 A;  4MNU A;  1R5G A;  3C18 A;  2R3S A;  4N9I A;  3EYI A;  1HW5 A;  2ELH A;  3FWE A;  2A69 F;  4Y13 A;  3IL2 A;  3KP5 A;  4HYE A;  2A5Y B;  3IWF A;  3J80 Z;  1RZ4 A;  1IN4 A;  4G6D A;  5BS6 A;  1IZ1 A;  4IF4 A;  2VOP A;  4A0Y A;  4EQQ A;  1FNN A;  2XKO A;  3MQ0 A;  4YFK F;  1ZAR A;  4XSZ F;  3WTY C;  1ZG1 A;  2HTJ A;  1G3Y A;  3PQJ A;  4KIC A;  1ON2 A;  1FP1 D;  3SXY A;  5BPD A;  2EFP A;  2XKP A;  3B73 A;  3ECO A;  3T1B A;  1ZLK A;  2JPB A;  1U5T C;  3Q9S A;  3J81 Z;  3E6M A;  3IHU A;  3HTS B;  2D45 A;  3WGG A;  4G9Y A;  5D5W B;  2V79 A;  1KA8 A;  1UFM A;  5LGT A;  1J7K A;  2OBP A;  2HDC A;  2HZT A;  3I0T A;  4P96 A;  3M1E A;  1ZGA A;  4OMY A;  2JPC A;  5DCM A;  5LHH A;  3HUG A;  1OPC A;  1W4M A;  2J5O A;  3RJP A;  4EMS A;  5D6F A;  5J6X A;  2IW5 A;  1KU2 A;  1IXC A;  3GLX A;  3MWM A;  3FMR A;  4GXO A;  4MQV A;  2VC1 A;  5DCF A;  2YPR A;  3F8C A;  3U2R A;  2H6C A;  2DI3 A;  5D4S A;  2FA5 A;  1R5H A;  1ZRE A;  1MDM B;  3WE2 A;  3JTG A;  4GYG A;  3GFM A;  1ZLJ A;  3WG9 A;  3D0S A;  5JVT A;  2V1D A;  3TDZ C;  4OIP F;  2L01 A;  5CVU A;  4I7H A;  5K5Q A;  1XD7 A;  4RGS A;  1SD6 A;  1B6A A;  2JSC A;  5ILU A;  1K78 B;  3F8N A;  4MQ9 F;  3G3Z A;  4Q4Z F;  4IPA A;  1BI2 A;  4A6D A;  2QQB A;  1LDD A;  1KU9 A;  3RPQ A;  3HTU A;  4I0A A;  4M74 A;  4WWC A;  4BH9 A;  1ZRD A;  4L0Z B;  1IRG A;  3LA7 A;  3ZN0 A;  2V1X A;  2GIV A;  2ZME B;  4M6X A;  4WXD A;  5LEK A;  2XAJ A;  2FBH A;  4RB2 C;  3M9A A;  5HOO A;  2H27 A;  1T98 A;  2PMH A;  2RC4 A;  2YX4 A;  5D8L B;  4BHP A;  2QYO A;  3Q5F A;  1BI3 A;  3PQK A;  2XHK A;  4YFN F;  1BM9 A;  3I64 A;  1W7P B;  2IA0 A;  3GO5 A;  1I6X A;  3HOT A;  3KP6 A;  1LVA A;  3FXR A;  1O3S A;  3R0A A;  2K27 A;  1U5T A;  3I53 A;  1J0R A;  2RGV A;  2W25 A;  1FP2 A;  1U78 A;  1T6S A;  2IVM A;  2WV0 A;  4FX4 A;  4M6Y A;  1O7L A;  3JW4 A;  5ILS A;  4HV5 A;  3Q9V A;  2BYV E;  2A6H F;  2O3F A;  4KIG A;  1RUO A;  2CG4 A;  1YLF A;  2FBK A;  4GCV A;  2GXB A;  2L4A A;  3K1M A;  4KNY A;  2VE9 A;  2PMU A;  2PFB A;  2CW0 F;  1GXQ A;  2FML A;  5IT9 K;  4L0Y B;  5DD4 A;  3DKW A;  4CGZ A;  3EUH A;  1BC7 C;  4R1H A;  2NAZ A;  5H6R A;  4JQF A;  3LAJ A;  1UCR A;  4PDK A;  4WCG A;  3VOE A;  5A2Q K;  2XAH A;  3FM5 A;  2PJP A;  2DTR A;  5L3B A;  1LQ1 A;  3LQR A;  2BBY A;  3SQN A;  4OIN F;  4RB0 A;  5L3G A;  1YIO A;  2BE5 F;  4KIB A;  5HLI A;  2DPD A;  3CUO A;  5JFR A;  1IN5 A;  2OU2 A;  3NEU A;  1T38 A;  2GZW A;  4I98 B;  5FGM A;  2UXX A;  5FFX A;  1JXS A;  4ZYD A;  1ZYR F;  3LQQ A;  3MEX A;  2NYX A;  4ZYE A;  4HQE A;  2FU4 A;  1B9N A;  2PI0 A;  2HKX A;  4GYI A;  1LDJ A;  3TO7 A;  1D5V A;  4LB5 A;  1YFH A;  3V8J A;  2HYG D;  5L3F A;  3WGI A;  3TKY A;  5DUK A;  3VOD A;  4KUM A;  2K4J A;  1QZZ A;  5DCM B;  4AIK A;  1P92 A;  5AIQ A;  2HGC A;  2STW A;  4A5N A;  2DFI A;  4HDU A;  3U9G A;  3CLO A;  3ZP5 A;  1MKM A;  1V4R A;  2STT A;  2Q0O A;  2UXN A;  4ETS A;  3K1N A;  5CLS A;  1J5Y A;  2QM3 A;  4GGG A;  4U0Y A;  1P4X A;  3RKX A;  1QNT A;  4U7B A;  3KCC A;  1KYW A;  2EA2 A;  1IN6 A;  4I02 A;  1NHA A;  3DQV C;  2XVC A;  1XSV A;  3L09 A;  2A68 F;  4FT8 A;  3S2W A;  4ZYH A;  3JTH A;  3M7G A;  3E6C C;  4L18 B;  1R23 A;  1K7A A;  3BWG A;  1IRF A;  2O8X A;  2B0L A;  4KDP A;  5F1R A;  4CXF A;  1STZ A;  3GFI A;  2DO7 A;  1BC8 C;  1XCV A;  5K5R A;  5LRR A;  1REP C;  4YII A;  1YO5 C;  3ELK A;  4L9V A;  3N4M A;  1MDM A;  1WSU A;  3RI4 A;  2K02 A;  4EM0 B;  3DXJ F;  3F23 A;  2JRT A;  2VXZ A;  2HQR A;  4UXN A;  1TNS A;  4WK8 F;  4ESJ A;  2NS0 A;  4AIH A;  2ZJ2 A;  5CVR A;  3DV8 A;  4WXH A;  3MCZ A;  2DAO A;  2MD5 A;  4OIQ F;  1LEA A;  1S29 A;  1QBJ A;  2M8E A;  3DPL C;  5LHI A;  4IHT A;  1B4A A;  3V7C A;  2LSO A;  2GAU A;  2ESH A;  2BV6 A;  5L3C A;  4ENN A;  3KE2 A;  3T5X A;  4OIO F;  1SD5 A;  3WTV C;  3CO6 C;  1BBY A;  2L54 A;  1TLH B;  3T8T A;  2DLL A;  4HOB A;  2ZME A;  5JR3 A;  1U5T B;  2IA2 A;  5ICG A;  4A2U A;  1WWX A;  2DPU A;  2PN6 A;  1AOY A;  4O5V A;  5F6F A;  1XDS A;  3COA C;  1W7P A;  4HBL A;  4M72 A;  2NRA C;  3HHH A;  2O0Y A;  2HWV A;  1UHM A;  5LGU A;  2IPQ X;  1BN5 A;  4MEY F;  5E1X A;  3RPU A;  3HOS A;  3KP7 A;  3RIR A;  5ILV A;  4I01 A;  3BJ6 A;  4MTE A;  4L5J A;  4KMU X;  1TBX A;  4RGR A;  5BOX A;  4KN7 X;  3HSF A;  1YS6 A;  4LGW A;  2E7X A;  1HKT A;  3T0Y A;  1I27 A;  4HX8 A;  4IHS A;  2M1B A;  2DK8 A;  4XLN F;  4LK1 F;  3E5U A;  2R7D A;  3QU3 A;  2RN7 A;  3KLN A;  4M9Z A;  2XRN A;  4HA8 A;  1IAW A;  2JTV A;  4CDG A;  4YFX F;  2KIM A;  4MHG A;  3RDI A;  2XRO A;  5FD5 A;  3F72 A;  4LLG F;  3DF8 A;  1K79 A;  3HYI A;  3GEZ A;  2TDX A;  2HKO A;  1D3Y A;  3KFW X;  4M71 A;  4FHT A;  5ICF A;  4KT5 C;  1FZP B;  1J2X A;  1YW9 A;  2G9W A;  5LHG A;  4L5I A;  2MBF A;  3ZQ7 A;  3QP6 A;  1S6L A;  2RKH A;  2MLG A;  1YW7 A;  1T39 A;  3BZ6 A;  1R36 A;  3BJA A;  2OQR A;  4HQM A;  3GX4 X;  1IN7 A;  5ERI A;  3IWZ A;  3QP5 A;  4P55 A;  3F8M A;  3NRV A;  4ESB A;  4DNC A;  1EV7 A;  1YYV A;  1HQC A;  4OIR F;  2PBI A;  1OYY A;  4Q47 A;  2A61 A;  3W6K B;  4G7O F;  2LF7 A;  3OV8 A;  1R22 A;  2CYY A;  2FOK A;  1BIA A;  5CJ9 A;  3LA2 A;  2LKP A;  2ZNZ A;  3DEU A;  1RUN A;  3MZY A;  2L4M A;  2V9V A;  2QWW A;  1KQ8 A;  5CVV A;  2VT2 A;  2NNY A;  2V1U A;  2DU9 A;  2EFQ A;  4HX7 A;  4HAM A;  1J9I A;  4EM2 A;  1T2K A;  1KYZ A;  2C6Y A;  1U6G A;  2XGX A;  2ETH A;  4TV7 A;  5KK1 A;  3ZMZ A;  1P4W A;  2FEZ A;  4AWX B;  2QVO A;  2O61 A;  3BJO A;  5E18 F;  1O3T A;  2DQL A;  2OD5 A;  2XAF A;  2KRF A;  2Y48 A;  2VBX A;  1XGS A;  1F1Z A;  3KEO A;  1H9T A;  4B09 A;  3SHF A;  1XDU A;  4UUV A;  3I71 A;  1S3J A;  2UZK A;  5CVI A;  5H20 A;  3V7S A;  2OZ6 A;  3HRT A;  3V7R A;  4IRI A;  4LK0 F;  3W6J B;  3E5X A;  3DFG A;  4CHU A;  3H92 A;  5DEQ A;  2ZFW A;  3NQO A;  3ABU A;  3ISP A;  5IT3 A;  1TW3 A;  2E7W A;  4L9J A;  1XSX A;  1P4A A;  2ACJ A;  2COM A;  3JAM K;  4UHT A;  1KQ9 A;  2DK5 A;  3WTZ A;  2EWN A;  2RVC A;  2OZU A;  2Q8K A;  3FXQ A;  1L3L A;  4L9N A;  2ZBK A;  3RKY A;  2HS5 A;  2P8T A;  1FBQ A;  1QPM A;  1SFE A;  3TQN A;  5H6Q A;  5HLG A;  1XSD A;  2HQN A;  4IVN A;  2MH2 A;  5FLX Z;  2DQR A;  3KET A;  2P6S A;  3L2C A;  3KP3 A;  1JGS A;  2Z3Y A;  3GXO A;  3F6V A;  4NHJ A;  1ZN2 A;  2RQP A;  1XN7 A;  5AON A;  1LNW A;  4EGZ A;  3REO A;  4UV9 A;  1E2X A;  3FXU A;  2QQ9 A;  1JE8 A;  4KFC A;  2FNA A;  2R7F A;  4JK1 X;  3LST A;  3JSP A;  3ZMS A;  1B1B A;  1OYI A;  5TJJ A;  3I58 A;  3TOB A;  2G7H A;  4LMY A;  2KIF A;  3KP2 A;  4HF2 A;  3P9I A;  4PCQ A;  3WOD F;  3H3U A;  1SFU A;  2LDU A;  5E1W A;  2EFW A;  1GVJ A;  1YTY A;  1FX7 A;  2VBW A;  3K9T A;  1BOA A;  4IXA A;  4EVI A;  3M8F A;  1WQ2 A;  3ML6 A;  4KA4 A;  4BYY A;  1KU3 A;  3BOQ A;  2XAG A;  3C3W A;  4MEX F;  1MGT A;  3RTR A;  2GQQ A;  3F8B A;  2P7C B;  2CQK A;  1GXP A;  1IXR C;  5D5V B;  3AAF A;  5L3D A;  4BAY A;  4D0P A;  5LBQ A;  4Q5S F;  3FX3 A;  1MJ9 A;  5J8F A;  2VE8 A;  3CJN A;  2M87 A;  4U0V A;  4BXU A;  3LWF A;  1HKQ A;  4G6Q A;  1SD7 A;  4N0B A;  2EFN A;  1ZRC A;  5F64 A;  3MAJ A;  3OOP A;  3T8R A;  1W5T A;  5HS9 A;  1EH6 A;  2FMY A;  2ZNY A;  3LAP A;  4MGR A;  1HST A;  3L9F A;  4KN4 X;  2ISZ A;  5HDN A;  3QPT A;  3J80 K;  1JHH A;  1RNL A;  3V8K A;  3H3Z A;  2Y0M A;  2QQA A;  1KU7 A;  5EEH A;  3BPX A;  4R8H A;  1H9G A;  3SFZ A;  2O03 A;  3TO6 A;  4HZF A;  3I59 B;  5EEG A;  3KZY A;  4LLN A;  1LJ9 A;  5BMZ A;  2XUB A;  4RGX A;  2AS5 F;  2E1N A;  1Z1D A;  4UVA A;  5FO5 A;  2G7U A;  1OR7 A;  3J81 K;  1HBX G;  1ZGJ A;  4A5M A;  3PFI A;  2KJC A;  4OOI A;  1FBS A;  3CUQ C;  1R7J A;  1PDN C;  3CDH A;  3SZT A;  5LEJ A;  2ZCW A;  3F8F A;  3ROU A;  5CYV A;  3WTX C;  3WTS C;  3U1D A;  2IRF G;  5ICE A;  3KEQ A;  4B8X A;  3O2P E;  2VOD A;  5JHU A;  5L3E A;  4P9U A;  1S7O A;  2FNP A;  2LNB A;  2DT5 A;  2A07 F;  4K2E A;  2MLK A;  2EJR A;  2XV4 S;  3KLO A;  2K7L A;  3I4P A;  2W24 A;  4HDV A;  4UV8 A;  4HLX A;  4EJW A;  4RS8 A;  2FE3 A;  3MZH A;  3FM3 A;  1SAX A;  1YG2 A;  3WE3 A;  4H0E A;  1LDK B;  4EGY A;  3HRU A;  1O7F A;  2L3D A;  1I1S A;  1J59 A;  1G3W A;  1TQP A;  4G7Z F;  2FSW A;  3F6O A;  1MJB A;  1UST A;  1TW2 A;  2YU3 A;  2FQ3 A;  2MA3 A;  4LG0 A;  5D8K B;  2WC2 A;  4G94 A;  2EV5 A;  2FBI A;  1FT9 A;  1FSH A;  4ASN A;  3FHZ A;  3N97 A;  5LGN A;  5IT9 Z;  2Z33 A;  1FBU A;  1DUX C;  1QGP A;  3HSR A;  1T0F A;  2VOO A;  2D1H A;  2X0L A;  1ULY A;  4S04 A;  2EV6 A;  2PQ8 A;  2NNN A;  3BPV A;  3RKW A;  3DP7 A;  5E8G A;  2QBY B;  4GO1 A;  5A2Q Z;  3GZ6 A;  4KMF A;  3G73 A;  1DPU A;  4A0X A;  4I09 A;  1YS7 A;  3ABT A;  4CZZ A;  2F5D A;  3R61 A;  2OAZ A;  3QRF F;  5TRD A;  1HSJ A;  3IC7 A;  1Q1H A;  5HDK A;  3ERE D;  4ESF A;  1D8J A;  1UB9 A;  2QLZ A;  5K1Y A;  2IA1 A;  1RI7 A;  5HS8 A;  2QEN A;  3KZZ A;  3ZN1 A;  2QUF A;  1FOK A;  1IW7 F;  3L00 A;  1BIB A;  2MC3 A;  4A6E A;  2ZXJ A;  3O6B B;  3R0J A;  2DW4 A;  4F7Z A;  2M5W A;  4ENK A;  4ZZD A;  3GZ5 A;  4FX0 A;  4HF1 A;  3TOA A;  4XLP F;  2ZKZ A;  2FXA A;  5HLH A;  3CUQ A;  1ONV A;  1S7A A;  1IUY A;  2IJL A;  5D5U B;  3R6S A;  2M30 A;  2KIU A;  2RNJ A;  3WTU C;  1F4K A;  2HOE A;  1SFX A;  4P9F A;  1Z7U A;  2JT1 A;  4BQA A;  5D5X B;  1XMA A;  4Y17 A;  4U7D A;  1ZHF A;  2PG4 A;  1F9N A;  1L0O C;  4LB6 B;  4IJA A;  3BDD A;  2Z5U A;  4QWQ A;  2HEO A;  3O3K A;  1O3Q A;  2A3S A;  2H6B A;  2OQG A;  2P4W A;  2ISY A;  2XIG A;  2VN2 A;  2KKO A;  2M45 A;  2CFX A;  1U8R A;  3JSO A;  4N9H A;  4UVC A;  3TO9 A;  2X4H A;  1B9M A;  1FY7 A;  4S05 A;  5J8C A;  1OMI A;  4M9X A;  4LJZ F;  3VB2 A;  2HFH A;  5LRS A;  1AWC A;  1SD4 A;  2GA1 A;  4JBA A;  4PGG A;  2XAQ A;  1ZG3 A;  1Z05 A;  4OU0 A;  4EJT A;  3V8L A;  1RIO H;  3E6B A;  3CTA A;  2LF8 A;  1XCB A;  2J5P A;  4UVB A;  1MJA A;  3WGH A;  1YQA A;  2XAS A;  2IT0 A;  3E3V A;  3I5U A;  1P6R A;  3IKT A;  1Z91 A;  2F5F A;  2GXG A;  4QLC U;  3GW2 A;  1OKR A;  2H09 A;  1PP8 F;  3I59 A;  3HIF A;  2ZO4 A;  4M9S A;  5CVJ A;  4AVP A;  1IF1 A;  4DQ2 A;  1FYM A;  4LD5 A;  1TQI A;  1I1G A;  3TGN A;  4NB5 A;  1E17 A;  2P5V A;  4P5O A;  4A12 A;  1WKM A;  4RB1 A;  3QU6 A;  3KP4 A;  1R00 A;  5BQT A;  2GA2 A;  4ZZL A;  4XRF A;  3F3X A;  4CIC A;  2VT3 A;  1CF7 A;  3GF2 A;  4R79 A;  2DBB A;  3WU1 B;  1J75 A;  1BJA A;  1XGO A;  4LG0 B;  1EH7 A;  1BI0 A;  2ESN A;  4XBF A;  3GUD A;  4ZYG A;  2F5C A;  5ICC A;  4I0B A;  2UWM A;  1WI9 A;  2EA4 A;  1QQI A;  5DD8 A;  3WTW C;  2P7V B;  4WX9 A;  2CO5 A;  1EH8 A;  3BY6 A;  2VON A;  4I2O A;  3VFZ A;  3GFJ A;  1PP7 U;  1G6N A;  3LA3 A;  2K86 A;  3IKV A;  1H0M A;  1MD0 A;  1FSE A;  3D5L A;  2H94 A;  5AIP A;  2VBZ A;  3L7W A;  1DP7 P;  2EV0 A;  2A6E F;  3GWZ A;  3VEP A;  2W84 A;  3V4G A;  4EV0 A;  2HYF A;  5LLQ A;  1F5T A;  1CGP A;  1OYW A;  2YSR A;  1HKS A;  3QOP A;  6PAX A;  1IXS B;  1HXD A;  3FF5 A;  1W7P D;  4Y15 A;  2W57 A;  4Z2Y A;  4BHC A;  4ZH4 F;  1UHW A;  2ADU A;  3ZMD A;  2D1V A;  1LB2 A;  3M8E A;  2QBY A;  4MTD A;  4EJV A;  3LFK A;  5FB2 A;  4XSX F;  5ED4 A;  2QZ8 A;  3GYH X;  2Z9O A;  4OMZ A;  2F2E A;  5FD6 A;  5E8I A;  3RYR A;  2YX7 A;  3CUQ B;  4IRH A;  3FMS A;  3F21 A;  4UNO A;  1FPQ A;  2O6G E;  1Z9C A;  4HX4 A;  2GWR A;  1FYL A;  5D6E A;  3QAH A;  3P9C A;  2PLY A;  1IN8 A;  3ZMU A;  2K4B A;  4AD9 A;  4KYW A;  2EFO A;  3IRQ A;  2P6T A;  1U2W A;  1SMT A;  2VBY A;  1X3U A;  2HR3 A;  4AIJ A;  4HW0 A;  1R58 A;  4RAZ A;  3P9K A;  1G3T A;  3HSE A;  3F22 A;  2HTS A;  4ENM A;  5HS7 A;  4CYD A;  4LFU A;  2RDP A;  4YG2 F;  3EDP A;  2AXL A;  5DUI A;  5HDG A;  1O57 A;  1BI1 A;  3QPH A;  3K0L A;  2PEX A;  4CO8 A;  3ZPL A;  3C1D A;  2EK5 A;  2Q2E A;  3EET A;  4O6J A;  2V6C A;  2IP2 A;  2W85 A;  2E1C A;  4G7H F;  2BGC A;  1HW1 A;  2FF4 A;  1XGN A;  3C7J A;  1TNT A;  1W5S A;  4WF2 A;  1I5Z A;  3ZMT A;  4BHB A;  3DPT A;  4U0W A;  1K6O A;  3BRO A;  1G4D A;  3IRR A;  5E20 A;  2WWY A;  3K2Z A;  2CGP A;  1FLI A;  3R60 A;  4Q48 A;  3RYP A;  1HW2 A;  3FMQ A;  1YW8 A;  2Z99 A;  2L02 A;  2OA4 A;  1G3S A;  1B59 A;  4RAY A;  4O3M A;  3JAM Z;  4PGH A;  4EJO A;  2D2W A;  2KJB A;  1Z6R A;  1VTN C;  4EM1 A;  4LLL A;  1CF7 B;  4RGU A;  1QZY A;  4ENJ A;  1WRJ A;  1XGM A;  2P5K A;  3ZMV A;  5HVQ C;  2WTE A;  5FFZ A;  1LEB A;  1D8K A;  4NQW A;  4U88 A;  2VC0 A;  3K69 A;  3I54 A;  4HLY A;  1KGS A;  2Y75 A;  3BP8 A;  2YR2 A;  3WTT C;  1QO0 D;  3EYY A;  1FWZ A;  2F5E A;  4IRG A;  2CWE A;  3E6D A;  1MZB A;  4HV6 A;  1ZAO A;  4WXC A;  3K1P A;  1K78 A;  2BEO A;  1JHF A;  1XB4 A;  3ULQ B;  1P2F A;  4G8X A;  4BNC A;  1DDN A;  1ZRF A;  5JI6 A;  3GFL A;  1GHC A;  1DPR A;  4YIF A;  3CO7 C;  3GVA A;  1FYK A;  4L9T A;  2RV8 A;  3ECH A;  3HHG A;  1R1T A;  3E97 A;  3SZP A;  5K5O A;  4HF0 A;  3R4K A;  1TQM A;  4RB3 C;  4EJU A;  1R1V A;  4A0Z A;  4E70 A;  1R1U A;  1TTY A;  4ON0 A;  3FZV A;  1ODD A;  1O3R A; 
#chains in the Genus database with same CATH topology
 4XKB A;  4J19 A;  1I39 A;  2IS2 A;  4PFO A;  4PZJ A;  5GTH C;  2F4M B;  2EZH A;  1R71 A;  3CCJ I;  5D4R A;  1ZG5 A;  1X3W B;  2L0K A;  3HRS A;  5EF6 A;  2MH9 A;  2EIN H;  1IUF A;  1Z6T A;  2XDV A;  1USS A;  1C0W A;  4BE2 A;  1KQ0 A;  1PUE E;  1QU3 A;  1V55 H;  4KIF A;  1FC3 A;  3HRM A;  4CZC A;  2CSO A;  2EQR A;  1Z3X A;  5FJ8 J;  1A04 A;  3H5R A;  3Q0U A;  4OAZ A;  1S8N A;  5DV5 A;  2OV7 A;  5DYM A;  1RET A;  1XMK A;  3TMO A;  2CV2 A;  5KVR A;  3E0J B;  5E17 F;  3E5Q A;  3TDU C;  3CCR I;  4RMN A;  5FLX K;  1JTY A;  1DU0 A;  3L1P A;  5JVG F;  5BPI A;  1SMY F;  2FRH A;  3EQL F;  1JTX A;  3B02 A;  1ZH5 A;  2L7Z A;  3ZQI A;  4RM3 A;  2EH3 A;  2P5L C;  1SC7 A;  1Z3Y A;  3NAR A;  2EB7 A;  3TED A;  9ANT A;  1ORK A;  3D5S C;  2JZY A;  3J7A O;  1Z7L A;  4MO7 A;  2X1D A;  2LP0 A;  4M73 A;  3MFK A;  3P7N A;  1Y0U A;  5M3M J;  1XX5 A;  1V3F A;  5DDG A;  3WU0 A;  3VYS B;  2DFF A;  5E1Z B;  1U3E M;  1ON1 A;  4MNU A;  1PJR A;  1R5G A;  3SJM A;  3C18 A;  3DTE A;  1BR4 A;  3OL3 A;  1ENH A;  2MSY A;  2R3S A;  3G71 I;  4N9I A;  2RQQ A;  4A3M J;  3DKX A;  5IP9 J;  3EYI A;  2CUZ A;  2TCT A;  3CF2 A;  2R7Z J;  1I3Q J;  1HW5 A;  2ELH A;  2KT0 A;  1BW5 A;  4F3Q A;  1Y0N A;  3FWE A;  2A69 F;  1OCZ H;  3IH2 A;  2K9N A;  4Y13 A;  3IL2 A;  2KP6 A;  3KP5 A;  3OYF A;  4BE1 A;  4HYE A;  4F91 B;  2A5Y B;  3IWF A;  5EG0 B;  3J80 Z;  1RZ4 A;  3PO2 J;  1NG6 A;  1Z0X A;  1IN4 A;  2K5C A;  4G6D A;  5BS6 A;  3QOE A;  1IZ1 A;  2ME0 A;  3S2D J;  4IF4 A;  2VOP A;  5F1J A;  4A0Y A;  4EQQ A;  1FNN A;  4OWR B;  2XKO A;  3MQ0 A;  4YFK F;  1ZAR A;  2W4S A;  1X2M A;  4XSZ F;  3WTY C;  1ZG1 A;  2X1C A;  2HTJ A;  2LY1 A;  1FTZ A;  1G3Y A;  3PQJ A;  3QYE A;  4BY7 J;  4KIC A;  2E2I J;  1ON2 A;  1FP1 D;  3SXY A;  5BPD A;  2I10 A;  3PNT A;  1RR8 C;  2EFP A;  3PIO F;  1IO2 A;  2XKP A;  3B73 A;  3ECO A;  1D1C A;  3TP0 A;  3T1B A;  1Y1W J;  1QVT A;  3ZCO A;  1AHD P;  3JRI A;  1P7J A;  3AFH A;  1ZLK A;  2Q2E B;  2JPB A;  1U5T C;  2HU9 A;  3Q9S A;  3J81 Z;  3K70 D;  2Z1D A;  3E6M A;  2CMP A;  3IHU A;  1S72 I;  2Q1Z B;  3HTS B;  2D45 A;  2VPR A;  3WGG A;  2HVR A;  4G9Y A;  5D5W B;  3I4M J;  2V79 A;  1KA8 A;  1UFM A;  2P0W A;  1KON A;  5LGT A;  1J7K A;  2OBP A;  1VQ5 I;  2HDC A;  3HDD A;  2HZT A;  3I0T A;  4P96 A;  3M1E A;  3HZJ A;  1ZGA A;  4OMY A;  2JPC A;  2GIZ A;  3OWT A;  5DCM A;  1B72 A;  4D5C A;  1WJE A;  5LHH A;  3HUG A;  3DEW A;  1OPC A;  1W4M A;  2J5O A;  3CJT B;  3RJP A;  2V9P A;  4EMS A;  5D6F A;  1XTA A;  3K4B A;  1FOY A;  5FLV A;  2QGU A;  5J6X A;  3CDL A;  1Y56 A;  2IW5 A;  1E3H A;  1KU2 A;  1IXC A;  3GLX A;  1AKH A;  2QSH X;  3MWM A;  3FMR A;  2UUZ A;  3CCE I;  2OCC H;  4J00 A;  4GXO A;  2LD5 A;  2KMU A;  4MQV A;  2VC1 A;  5DCF A;  2YPR A;  3F8C A;  3U2R A;  2H6C A;  2F6C A;  4CCO A;  2DI3 A;  3EUH C;  5D4S A;  2FA5 A;  4E4H A;  1R5H A;  2MFZ A;  4AYB N;  1ZRE A;  2A05 A;  2BW3 B;  1MDM B;  4JX4 A;  2IBD A;  4NQW B;  1VQN I;  3WE2 A;  5K7Z A;  3JTG A;  4M3G A;  4GYG A;  3GFM A;  1ZLJ A;  3JRE A;  3GTP J;  3WG9 A;  3D0S A;  2R93 J;  4ABZ A;  2DYS H;  2V9K A;  3VSK A;  3DTK A;  5JVT A;  2V1D A;  3TDZ C;  4OIP F;  4IZZ A;  2DA5 A;  2L01 A;  5CVU A;  3H5N A;  4I7H A;  5K5Q A;  5B5E C;  1XD7 A;  2NS7 A;  4RGS A;  1SD6 A;  2LG4 A;  1SAN A;  2IGO A;  1W36 D;  1NTC A;  5EZG A;  1B6A A;  2JSC A;  4C3I J;  5ILU A;  1K78 B;  3F8N A;  4MQ9 F;  3G3Z A;  1TT0 A;  2HQ5 A;  2H1L A;  3OR2 C;  3VWB A;  4Q4Z F;  4IPA A;  1BI2 A;  4XK4 A;  4A6D A;  2QQB A;  1LDD A;  1KU9 A;  2JRM A;  3RPQ A;  3ERM A;  2MG4 A;  3HTU A;  4I0A A;  4M74 A;  4WWC A;  2CUE A;  3HG9 A;  4BH9 A;  3GCM A;  5J4Y A;  1ZRD A;  2WB1 N;  1MBK A;  4L0Z B;  2B9S A;  3C2B A;  3LA7 A;  4G12 A;  3ZN0 A;  1IRG A;  2V1X A;  4QPQ A;  2GOM A;  2GIV A;  2ZME B;  4M6X A;  4WXD A;  5LEK A;  2XAJ A;  2HPM A;  3G1O A;  2DT7 B;  3LSP A;  2FBH A;  3M9A A;  4RB2 C;  5HOO A;  1EKE A;  2YX4 A;  1T98 A;  2IGK A;  2PMH A;  3CJQ B;  2RC4 A;  5D8L B;  4B44 A;  2H27 A;  5C4X J;  4BXF A;  2HDW A;  1QZE A;  2W48 A;  4BHP A;  2QYO A;  3Q5F A;  1BI3 A;  3PQK A;  3HOY J;  4OAY A;  2XHK A;  4XOP A;  4YFN F;  2RAE A;  1VQM I;  1BM9 A;  3I64 A;  1A36 A;  2R92 J;  1W7P B;  2IA0 A;  4NBQ A;  3GO5 A;  1T8I A;  4H4K C;  1I6X A;  1U9N A;  3QQA A;  2KIS A;  4XOT A;  3HOT A;  4C2U A;  3KP6 A;  1LVA A;  2YUS A;  3FXR A;  5FRN A;  2B7E A;  1O3S A;  1XMX A;  3R0A A;  2K27 A;  2IGN A;  2X6W A;  1UZC A;  4PJN A;  1U5T A;  2EZI A;  3I53 A;  3ZQH A;  1J0R A;  2RGV A;  2W25 A;  1VF9 A;  1FP2 A;  3NWT A;  2E1O A;  3QOD A;  4M6V A;  5GAH J;  5GTI C;  2VL8 A;  4F92 B;  1U78 A;  2M2E A;  1T6S A;  2IS4 A;  2IVM A;  3H1C A;  4E6K G;  2VKH A;  3OMY A;  1R6R A;  2WV0 A;  3GBG A;  4M6Y A;  1O7L A;  3LNQ A;  4FX4 A;  3JW4 A;  5ILS A;  4HV5 A;  1DU6 A;  3Q9V A;  1I6H J;  3SFI A;  5B66 C;  1GT0 C;  2BYV E;  3C2G A;  3KIO A;  2A6H F;  2O3F A;  5B1A H;  1QRY A;  2Z16 A;  3Q3S A;  1VQ9 I;  3A03 A;  4KIG A;  1RUO A;  2CG4 A;  1OR7 C;  5FKL A;  1YLF A;  2FBK A;  2E1M B;  4GCV A;  2GXB A;  1WI3 A;  3HPG A;  2L4A A;  2M0M A;  3K1M A;  4KNY A;  2VE9 A;  2R7U A;  2PMU A;  2PFB A;  1W1W E;  3RKQ A;  3OSG A;  1D0X A;  1VI0 A;  3ZGK A;  2CU7 A;  4GRI A;  2CW0 F;  3BTJ A;  1GXQ A;  3PSI A;  2FML A;  5IT9 K;  1X4P A;  4V2G A;  2M4K A;  2X6O A;  4L0Y B;  5DD4 A;  1ETV A;  3DKW A;  4CGZ A;  4I6Z A;  3EUH A;  4PSX A;  2LR8 A;  3HOV J;  1BC7 C;  4R1H A;  2NAZ A;  5H6R A;  5BNG A;  5K7F A;  3BG3 A;  2HOS A;  4JQF A;  3LAJ A;  1RC9 A;  1UCR A;  4PDK A;  4WCG A;  3VOE A;  5IYD J;  2JA7 J;  5A2Q K;  2XAH A;  3FM5 A;  5F04 A;  2KRH A;  2PJP A;  2XSD C;  4E7L A;  2DTR A;  4YEL A;  5L3B A;  1LQ1 A;  3LQR A;  2BBY A;  3SQN A;  2ID3 A;  1T95 A;  4OIN F;  2F5V A;  2LOO A;  3U21 A;  4RB0 A;  4BJ6 C;  5L3G A;  1YIO A;  2BE5 F;  3DEE A;  4KIB A;  5HLI A;  4D7M A;  3FHN A;  3CUO A;  1WHU A;  5JFR A;  2DPD A;  1IN5 A;  2OU2 A;  3NEU A;  1T38 A;  1MNE A;  4BEH A;  4DIQ A;  2GZW A;  4I98 B;  5E3O A;  1AU7 A;  3F9K A;  4B4C A;  3OS1 A;  5FGM A;  2UXX A;  5FFX A;  1MIJ A;  5IP6 A;  1JXS A;  4ZYD A;  1ZYR F;  3K4N A;  3LQQ A;  3MEX A;  2NYX A;  1KZH A;  2OCE A;  4ZYE A;  4HQE A;  2FU4 A;  1B9N A;  2ZME C;  2PI0 A;  2HKX A;  4DYC A;  4A3L J;  4GYI A;  1LDJ A;  3TO7 A;  1R5I D;  1D5V A;  5EG0 A;  4F52 A;  4FQG A;  4LB5 A;  1YFH A;  3V8J A;  2EZK A;  2HZD A;  2KHM A;  2HYG D;  3ASO H;  5L3F A;  5FKN A;  1FMW A;  3WGI A;  2E34 A;  3TW6 A;  4UUS A;  4HNU A;  3TKY A;  1K6Y A;  1X1A A;  3BR1 A;  5DUK A;  3VOD A;  4KUM A;  2K4J A;  1QZZ A;  5DCM B;  4AIK A;  1P92 A;  5AIQ A;  1B72 B;  2HGC A;  5DS9 A;  2STW A;  2XC7 A;  1YI2 I;  4A5N A;  3HUG B;  2DFI A;  2A6T A;  2COB A;  3X2Q H;  4HDU A;  3U9G A;  1CQT A;  3CLO A;  3ZP5 A;  1MKM A;  1UAA A;  1V4R A;  2STT A;  2Q0O A;  2UXN A;  4X0G A;  4ETS A;  2LVS A;  4A93 J;  4FET A;  3K1N A;  2QQ8 A;  5CLS A;  1WJF A;  1J5Y A;  2QM3 A;  4GGG A;  4U0Y A;  3AG3 H;  1D0Z A;  3O8H A;  1AKH B;  2DJN A;  1ZKG A;  1P4X A;  3RKX A;  1QNT A;  5EZH A;  4U7B A;  3KCC A;  2DOA A;  1DQU A;  4AM3 A;  2R7W A;  4D5F A;  4ZDO A;  1KYW A;  2EA2 A;  4NC6 A;  1IN6 A;  4I02 A;  1NHA A;  3DQV C;  3MKY B;  1VND A;  2XVC A;  1XSV A;  3L09 A;  2A68 F;  3WG7 H;  4FT8 A;  2K9M A;  2X1E A;  2XGC A;  3DPU A;  3JRD A;  3ZRG A;  3S2W A;  4ZYH A;  3HOW J;  2B63 J;  2K40 A;  3JTH A;  1G8X A;  3M7G A;  4RBO A;  3E6C C;  4L18 B;  3C2H A;  3GTM J;  3M4O J;  3HGY A;  5FKK A;  1V5F A;  1R23 A;  1K7A A;  3BWG A;  2RNG A;  5C4J J;  1IRF A;  2O8X A;  4MFE A;  1IC8 A;  3JRG A;  2JN6 A;  2FQ4 A;  4X1E A;  1DP3 A;  2B0L A;  4KDP A;  5F1R A;  4CXF A;  2LLK A;  3GTO J;  4D7N A;  1Y39 A;  1STZ A;  3GFI A;  3H3V K;  2KL4 A;  2DO7 A;  3U1K A;  1BC8 C;  4W1U A;  2OTJ I;  5HNF A;  1XCV A;  3BLY A;  5M5Y J;  5K5R A;  4ZDL A;  5LRR A;  1REP C;  4YII A;  1YO5 C;  3ELK A;  4L9V A;  2BW3 A;  2R7R A;  3N4M A;  1MDM A;  1WSU A;  2PX9 A;  4HNT A;  4XKC A;  3RI4 A;  4M3E A;  2BZT A;  2K02 A;  4EM0 B;  3GTL J;  1X19 A;  2WAQ N;  3DXJ F;  4EEF G;  3K4M A;  1V54 H;  3F23 A;  2JRT A;  3QYF A;  5J40 A;  2KDO A;  2VXZ A;  2HQR A;  4UXN A;  4LIV A;  1TNS A;  3HKZ N;  1A5J A;  2IAI A;  4WK8 F;  4ESJ A;  2BVL A;  2K3P A;  2NS0 A;  4AIH A;  2FJ1 A;  4CYC B;  3MVP A;  2DCE A;  1MNM C;  2QKM B;  2ZJ2 A;  4IO9 F;  3FK6 A;  5CVR A;  3DV8 A;  3GTG J;  4WXH A;  1D0Y A;  1VQ7 I;  1VQK I;  1M1E B;  2Y31 A;  3E7L A;  4CCN A;  4KIT B;  4BBS J;  3MCZ A;  1R4M B;  4XRS G;  3FXM A;  4DZP A;  2DAO A;  2MD5 A;  3QPS A;  1LEA A;  4OIQ F;  1I3A A;  2JVG A;  1MMA A;  1S29 A;  1QBJ A;  2M8E A;  3DPL C;  5LHI A;  4IHT A;  4B47 A;  1B4A A;  4ZTF A;  3V7C A;  3IUO A;  3BZK A;  2LSO A;  1MSF C;  2GAU A;  2ESH A;  2BV6 A;  5L3C A;  1N78 A;  4ENN A;  5KCM A;  4A3D J;  3KE2 A;  1GV2 A;  3T5X A;  1RR7 A;  4BQO A;  4OIO F;  1SD5 A;  3WTV C;  3CO6 C;  1BBY A;  2DMP A;  2L54 A;  1TLH B;  2DMQ A;  3T8T A;  2DLL A;  4HOB A;  1LVK A;  1RKT A;  2ZME A;  5JR3 A;  3OY9 A;  5EJC A;  4XRS A;  1U5T B;  2IA2 A;  5ICG A;  4A2U A;  5EDN A;  5KHD A;  1MH4 A;  1OJL A;  1WWX A;  1IRZ A;  2DPU A;  2PN6 A;  3CJR B;  4XR6 A;  1AOY A;  4O5V A;  5F6F A;  2NOG A;  3OYA A;  1XDS A;  4PJ0 C;  3COA C;  2E71 A;  1Y8Q B;  1JKR C;  1IDY A;  1W7P A;  2FOW A;  4HBL A;  4M72 A;  1BW6 A;  3NAU A;  2VXD A;  3D1N I;  2NRA C;  1FOW A;  3HHH A;  1BA5 A;  1TZL A;  2O0Y A;  1FJL A;  1WJB A;  2HWV A;  1UHM A;  3DU5 A;  4JX6 A;  1WJC A;  3H9J A;  2IPQ X;  1BN5 A;  5LGU A;  2PMZ A;  2HVS A;  4MEY F;  3GME A;  4E7Z A;  2VAS A;  5E1X A;  3RPU A;  3HOS A;  2HNH A;  3BT9 A;  3KP7 A;  3UNG C;  3RIR A;  4XLE A;  5ILV A;  4C3H J;  2VQC A;  4I01 A;  3BJ6 A;  3DTI A;  3HM5 A;  4MTE A;  1I50 J;  2XSJ C;  4XKW A;  3LSI A;  4L5J A;  4KMU X;  1TBX A;  2Y2Z A;  2CQQ A;  4RGR A;  4CH7 A;  2X85 A;  3K4J A;  5BOX A;  4KN7 X;  1TC3 C;  2LKS A;  4E7S A;  3ZQG A;  3HSF A;  3WHC A;  1OCC H;  4Z6Y A;  5FRO A;  1SVO A;  1YS6 A;  4LGW A;  4CCK A;  2AQE A;  4BJ5 C;  2E7X A;  1HKT A;  5IY5 H;  2CQX A;  1E3O C;  1NH3 A;  3T0Y A;  1T33 A;  3SZG A;  2OJE D;  2KFD A;  1I27 A;  1WPK A;  4IHX A;  4HX8 A;  4IHS A;  2AHQ A;  2M1B A;  1A31 A;  3PUB A;  2DK8 A;  4XLN F;  4LK1 F;  2JWT A;  3E5U A;  2R7D A;  1OIS A;  3QU3 A;  4HPQ A;  2RN7 A;  3KLN A;  4M9Z A;  2XRN A;  4HA8 A;  1IAW A;  4IX7 A;  2JTV A;  4CDG A;  2DA3 A;  1WH7 A;  2QSF X;  3I4N J;  4YFX F;  2KIM A;  4MHG A;  3RDI A;  1LE8 A;  1E0E A;  2XRO A;  1BR2 A;  5FD5 A;  3F72 A;  4LLG F;  3DF8 A;  3BCA A;  3HXL A;  4BEH B;  3CDI A;  1K79 A;  3HYI A;  3SEZ A;  3GEZ A;  3J7Z I;  2TDX A;  2HKO A;  1D3Y A;  3KFW X;  3L2V A;  4M71 A;  4FHT A;  2WY8 Q;  5ICF A;  4KT5 C;  1LFB A;  1FZP B;  1J2X A;  2OPT A;  1YW9 A;  2CS3 A;  2EBI A;  2G9W A;  3M1C A;  4CCJ A;  2X48 A;  5LHG A;  5DM6 F;  2ZXW H;  4L5I A;  2MBF A;  3ZQ7 A;  3QP6 A;  3OYB A;  1J09 A;  1JKO C;  1S6L A;  2IGM A;  3ESW B;  2JVH A;  2RKH A;  2Y9Z A;  2MLG A;  5LD2 C;  1YW7 A;  4NC8 A;  1JT6 A;  4LG3 A;  3S14 J;  1T39 A;  2IS6 A;  3BZ6 A;  1R36 A;  3BJA A;  2OQR A;  4HQM A;  3GX4 X;  1MSE C;  1IN7 A;  4UUS B;  4ZC3 A;  3IH4 A;  5ERI A;  2XF7 A;  3IWZ A;  3QP5 A;  4P55 A;  2ZJQ F;  4XQF A;  1G2H A;  3F8M A;  3NRV A;  4ESB A;  2IEK A;  4DNC A;  5F08 A;  1H89 C;  1WZ2 A;  3A0B C;  2KLO A;  1EV7 A;  1YYV A;  4D1Q A;  1YX3 A;  2M4G A;  1HQC A;  4PSW A;  3MKW B;  4M3D A;  2LY9 A;  1MMG A;  1APL C;  4OIR F;  1RES A;  2PBI A;  1OYY A;  2NXN B;  4Q47 A;  5E79 C;  4ZDP A;  3N05 A;  3DBH B;  2A61 A;  3W6K B;  4G7O F;  4E7H A;  4B3X A;  2LF7 A;  2ZC2 A;  3OV8 A;  1R22 A;  2CYY A;  2FOK A;  3BQY A;  3S1M J;  1BIA A;  5CJ9 A;  3JRH A;  3AG2 H;  3LA2 A;  4P1W A;  4RM2 A;  4IQJ A;  2ICW G;  2LKP A;  2KRC A;  5C3E J;  1HA8 A;  3CC2 I;  2ZNZ A;  3IH3 A;  1NG7 A;  3DEU A;  3KYL A;  1RUN A;  1BR1 A;  3MZY A;  2L4M A;  3BTL A;  3K4C A;  2I8D A;  4BUP A;  4X6A J;  1X4O A;  3LSK A;  2V9V A;  1Z67 A;  2QWW A;  1EA3 A;  4IEJ A;  1KQ8 A;  5CVV A;  3H35 A;  3JRC A;  4ZTJ A;  3FDY A;  1SEU A;  1TWA J;  4CSW A;  2EPF A;  2VT2 A;  2NNY A;  2V1U A;  2CH0 A;  2DU9 A;  4RLQ A;  2EFQ A;  4HX7 A;  4HAM A;  1J9I A;  4EM2 A;  4G6T B;  3I9V 2;  1T2K A;  2L7F P;  1KYZ A;  2MGQ A;  3WU2 C;  2C6Y A;  1U6G A;  3FXJ A;  2XGX A;  3OIQ A;  2ETH A;  1ETY A;  4TV7 A;  5KK1 A;  1E3P A;  2DA1 A;  3ZMZ A;  1BL0 A;  1P4W A;  2ZXH A;  4FCY A;  2DA4 A;  4II3 A;  3CD6 I;  2FEZ A;  4AWX B;  2QVO A;  4XKV A;  5JHF A;  3L2W A;  1N25 A;  4BU2 A;  2XPV A;  4BS9 A;  2O61 A;  3KZI C;  3BJO A;  5E18 F;  1O3T A;  2DQL A;  2OD5 A;  2M9H A;  2XAF A;  3JCU C;  2KRF A;  2CUJ A;  2Y48 A;  2VBX A;  1XGS A;  1F1Z A;  2H1K A;  3KEO A;  1D5Y A;  2O9L A;  3BR3 A;  2E2H J;  1H9T A;  1T56 A;  4B09 A;  3HC7 A;  3SHF A;  1XDU A;  4UUV A;  3I71 A;  1S3J A;  3AG1 H;  2UZK A;  5CVI A;  4BL0 B;  2IXS A;  5H20 A;  3V7S A;  2OZ6 A;  2VKV A;  2R7X A;  1P9Q C;  3HRT A;  5DM7 F;  3V7R A;  4LOC A;  4RAG A;  2XRL A;  4A69 C;  4IRI A;  3A01 B;  1WJD A;  4LK0 F;  2ZJR F;  3W6J B;  1IV6 A;  3E5X A;  1OFC X;  1SVL A;  3DFG A;  4CHU A;  3H92 A;  4LIT A;  5DEQ A;  2LK2 A;  2ZFW A;  3NQO A;  1YJN I;  1WCM J;  3ABU A;  3ISP A;  3JRF A;  1JUM A;  1QHH D;  5IT3 A;  1TW3 A;  4BY1 J;  2E7W A;  3RZO J;  4L9J A;  1ERD A;  4CYC A;  1XSX A;  3K70 C;  2HOA A;  2DXI A;  1P4A A;  2F4I A;  2ACJ A;  2COM A;  4XM3 A;  2LRE A;  3JAM K;  4UHT A;  1KQ9 A;  2AXT C;  2DK5 A;  2K9L A;  3WTZ A;  2RRE A;  5KNL A;  2O7O A;  1OCR H;  2EWN A;  1W0T A;  2QF7 A;  3M3Y J;  2W7N A;  3S2H J;  2RVC A;  2OZU A;  2G0E A;  4KJZ A;  2Q8K A;  3FXQ A;  2R0Q C;  4L9N A;  1L3L A;  2ZBK A;  2HVQ A;  4XLF A;  3RKY A;  3RQ4 A;  5GAD J;  2HS5 A;  2P8T A;  1TT5 B;  2KPM A;  1FBQ A;  1ZEL A;  1NK3 P;  4KT6 A;  2HXI A;  3BTI A;  4IL6 C;  1QPM A;  3OYD A;  1SFE A;  3TQN A;  2XGD A;  3G1L A;  5H6Q A;  2M3A A;  4C3J J;  5HLG A;  1XSD A;  2HQN A;  4IVN A;  3ZOB A;  2MH2 A;  5FLX Z;  4D9J A;  2DQR A;  3DWL E;  2FX0 A;  3KET A;  2DA2 A;  2P6S A;  2X51 A;  2L2O A;  5F0C A;  2DFE A;  3L2C A;  3KP3 A;  3BR6 A;  1JGS A;  2Z3Y A;  2EIK H;  3GXO A;  2NS8 A;  2QKL B;  3F6V A;  4NHJ A;  2F48 A;  1ZN2 A;  3GLL A;  2RQP A;  1XN7 A;  5AON A;  5F0H A;  4FIS A;  1LNW A;  4EGZ A;  2KIQ A;  3REO A;  4XRM A;  2HQA A;  4UV9 A;  1XS9 A;  1E2X A;  3FXU A;  1JJ8 C;  2QQ9 A;  1JE8 A;  3FXO A;  4BQN A;  4KFC A;  3IP4 B;  2FNA A;  2R7F A;  4JK1 X;  5B1B H;  3OIP A;  3LST A;  3JSP A;  1GVD A;  3ZMS A;  1B1B A;  4UUT A;  3G4S I;  1OYI A;  2JA5 J;  1YRN A;  5TJJ A;  3OOU A;  3OYJ A;  2DOF A;  4A3E J;  3I58 A;  3TOB A;  1QPI A;  4BBR J;  2G7H A;  1K83 J;  2DT6 A;  1FIP A;  2JA2 A;  4ZYA A;  4LMY A;  3CMY A;  1FMV A;  2DMT A;  2WV1 A;  2KIF A;  2YU9 J;  3KP2 A;  1X58 A;  2CFO A;  5E3N A;  1YJ9 I;  3P9I A;  4HF2 A;  1LE8 B;  1W36 C;  4PCQ A;  3WOD F;  2QSG X;  1H8A C;  3H3U A;  1SFU A;  5CQG A;  3MMY B;  4DOZ A;  1A6I A;  1PYV A;  2KQR A;  5FKO A;  5EEA A;  2LDU A;  2XF5 A;  4GFB A;  2L9R A;  3PL8 A;  2XB5 A;  5E1W A;  2EFW A;  4DYR A;  4L5E A;  1GVJ A;  2R7V A;  1YTY A;  1FX7 A;  4A3C J;  1MBJ A;  2VBW A;  3L2U A;  1N77 A;  2ECB A;  3CCV I;  4Y4R A;  3LSH A;  2JSP A;  3K9T A;  2VQH A;  2GBY A;  4YEJ A;  4AU7 A;  3HL2 A;  1BOA A;  4IXA A;  1U9O A;  4EVI A;  3M8F A;  1WQ2 A;  3ML6 A;  4GDF A;  1ETQ A;  4KA4 A;  4BYY A;  1G59 A;  1KU3 A;  3BOQ A;  1A35 A;  2XAG A;  1MW7 A;  3C3W A;  4MEX F;  1MGT A;  3RTR A;  2GQQ A;  3F8B A;  2P7C B;  2CQK A;  4II2 A;  1GXP A;  1IXR C;  2XPU A;  5D5V B;  2DYR H;  3OIO A;  2AO9 A;  2O5R A;  1OCP A;  5L3D A;  2XGE A;  4BAY A;  4D0P A;  2X6Y A;  3FIW A;  5LFA A;  5LBQ A;  2CW7 A;  5M5X J;  4A3F J;  4Q5S F;  2DOE A;  2CRG A;  5C44 J;  3KPH A;  3FX3 A;  5JLX A;  1MJ9 A;  5J8F A;  2VE8 A;  2LMD A;  3CJN A;  2Y30 A;  2QEX I;  1YE9 A;  3SDG A;  2JQ7 A;  2M87 A;  1QVU A;  3Q0V A;  4U0V A;  4RLF A;  3LWF A;  2L5Q A;  4BXU A;  1HKQ A;  3GTQ J;  3M07 A;  1B8I B;  4E7J A;  4FTH A;  4XNF A;  4XOR A;  3NWS A;  3H9G A;  3VDX A;  4G6Q A;  4E7K A;  2VPL A;  1SD7 A;  2BHY A;  3OYG A;  4N0B A;  2EFN A;  5J3L A;  1ZRC A;  5F64 A;  3MAJ A;  3OOP A;  1PUF A;  4JYK A;  1T0F C;  3T8R A;  1W5T A;  5HS9 A;  1EH6 A;  2FMY A;  2ID6 A;  4IQ4 A;  5F27 A;  2ZNY A;  3OYH A;  2DJI A;  4MGR A;  3LAP A;  1HST A;  3L9F A;  4KN4 X;  2ISZ A;  1GLN A;  1DGW Y;  5HDN A;  4NUB A;  3OYK A;  4BDZ A;  1EF4 A;  3QPT A;  3J80 K;  1AA7 A;  4E7I A;  3LFU A;  5GAG J;  1JHH A;  1RNL A;  3QPL A;  3V8K A;  3H3Z A;  1JT0 A;  3LMM A;  1SVM A;  2Y0M A;  3BQZ A;  2MAB A;  2QQA A;  3G1M A;  1IV8 A;  1KU7 A;  5IYB J;  3F0C A;  4XON A;  5EEH A;  1RPW A;  1A6Q A;  3BG5 A;  3BPX A;  3MKL A;  1H9G A;  4R8H A;  3HPH A;  4IOA F;  3SFZ A;  3OS2 A;  2O03 A;  1X1C A;  3TO6 A;  4HZF A;  3I59 B;  5EEG A;  4J01 A;  3KZY A;  4LLN A;  1LJ9 A;  5BMZ A;  2XUB A;  2R5Z A;  4PK4 A;  2MYS A;  2E60 A;  4RGX A;  2N8G A;  2AS5 F;  2E1N A;  1Z1D A;  2Y69 H;  4BAC A;  4Y3O A;  4JOM A;  4UVA A;  1LPQ A;  1OQY A;  1YX5 A;  2WBM A;  5FO5 A;  2G7U A;  1OR7 A;  1IG7 A;  1BJZ A;  3HJE A;  3J81 K;  1VQP I;  1HBX G;  2WY7 Q;  2LFB A;  1PVE A;  3LL7 A;  1ZGJ A;  1LUJ B;  3CCL I;  4MFD A;  4A5M A;  2JA6 J;  2EZL A;  3PFI A;  2KJC A;  3D5R C;  4OOI A;  1FBS A;  3BR0 A;  3CUQ C;  4FE4 A;  1R7J A;  4NC7 A;  4C30 A;  3B6A A;  1PDN C;  3CDH A;  3SZT A;  5LEJ A;  2ZCW A;  1V5G A;  1FTT A;  3I3L A;  1IJW C;  3F8F A;  4BKX A;  3ROU A;  3PNY A;  2YS9 A;  5CYV A;  3WTX C;  3WTS C;  3U1D A;  2IRF G;  5ICE A;  5IP7 J;  3KEQ A;  4B8X A;  3O2P E;  2VOD A;  5JHU A;  5L3E A;  1S7E A;  4P9U A;  1S7O A;  2FNP A;  5GPA A;  2X6X A;  1HDD C;  2LNB A;  3DBR B;  2GLO A;  2DT5 A;  3OYL A;  2A07 F;  4K2E A;  3RQI A;  2JJ7 A;  2BY1 A;  2MLK A;  2EJR A;  2XV4 S;  1U0J A;  3TL4 X;  3KLO A;  2K7L A;  2Y0S A;  3I4P A;  3OYC A;  1XC5 A;  2W24 A;  2DDA A;  1W0U A;  3A01 A;  4UV8 A;  4HLX A;  4S0H B;  4EJW A;  4HDV A;  4RS8 A;  2FE3 A;  3AG4 H;  3MZH A;  2JA8 J;  1JI8 A;  2JUG A;  3FM3 A;  1SAX A;  1W5C C;  1YG2 A;  3WE3 A;  4H0E A;  1LDK B;  3AKZ A;  4JP0 A;  4A3K J;  4EGY A;  3HRU A;  1O7F A;  2L3D A;  2NVU B;  1I1S A;  1J59 A;  3CMA I;  1G3W A;  3TW7 A;  1TQP A;  2V4J C;  2FSW A;  3BG9 A;  4G7Z F;  3F6O A;  3CMM A;  1MJB A;  1UST A;  1TW2 A;  5HNH A;  2V26 A;  2YU3 A;  1XPX A;  1K4S A;  2FQ3 A;  2MA3 A;  4LG0 A;  4AVZ A;  4XMY A;  1TWH J;  2PMZ N;  5D8K B;  2WC2 A;  2VUM J;  2VJI A;  1ZK8 A;  2VI6 A;  3CF5 F;  4BE0 A;  4G94 A;  5E3L A;  2HOT A;  2EV5 A;  2M34 A;  3JRA A;  3IAM 2;  1YHQ I;  2FBI A;  3G6E I;  3CP8 A;  1FT9 A;  1FSH A;  3AL0 C;  5E3M A;  1MBF A;  4ASN A;  3FHZ A;  3N97 A;  1VQO I;  1WGX A;  1YIJ I;  4ITV A;  2BOL A;  5LGN A;  5IT9 Z;  2Z33 A;  1FBU A;  2MD0 A;  1DUX C;  1IRX A;  1QGP A;  3HSR A;  3VYU B;  1T0F A;  2VOO A;  3ASN H;  3LSG A;  4MLO A;  5EGO A;  2VQG A;  2D1H A;  1YRN B;  2X0L A;  1ULY A;  4S04 A;  2HPI A;  2R7T A;  2EV6 A;  2PQ8 A;  1SFO J;  3PSF A;  2NNN A;  1HCR A;  3BPV A;  3RKW A;  3DP7 A;  5E8G A;  2QBY B;  4GO1 A;  2ZSH B;  2VJJ A;  2PJR A;  5A2Q Z;  1XG1 A;  3GZ6 A;  4IKF A;  4KMF A;  3G73 A;  1MND A;  3HBL A;  1DPU A;  5GAE J;  3OR1 C;  3HOZ J;  4A0X A;  4I09 A;  1YS7 A;  3ABT A;  3H0G J;  3W2V A;  2K3F A;  2O8K A;  1UHS A;  4CZZ A;  3S93 A;  2F5D A;  3R61 A;  2OAZ A;  3QRF F;  2BHZ A;  5TRD A;  1HSJ A;  3IC7 A;  2ZB9 A;  2W1O A;  2DOD A;  1Q1H A;  2L9S A;  5HDK A;  3ERE D;  2ZJP F;  4ESF A;  1D8J A;  4FAS D;  1UB9 A;  2QLZ A;  5K1Y A;  4XLA A;  1JUS A;  3FKI J;  2IA1 A;  2BVM A;  2WAF A;  1RI7 A;  3W3C A;  2CQ7 A;  2DFH A;  2QEN A;  3KZZ A;  3ZN1 A;  5HS8 A;  3W6V A;  3P5J A;  2QUF A;  3OL4 A;  4W97 A;  1O4X A;  1FOK A;  3W2A A;  1IW7 F;  3L00 A;  2OF7 A;  1T08 B;  2CV0 A;  1BIB A;  2MC3 A;  3FK7 A;  4A6E A;  4MIM A;  2ZXJ A;  3O6B B;  2E19 A;  3R0J A;  2DW4 A;  3J7A Y;  2F4O B;  2NOJ B;  4F7Z A;  2E5N A;  4CCM A;  2M5W A;  2ELK A;  4ENK A;  4ZZD A;  3GZ5 A;  3SYT A;  4FX0 A;  1UG2 A;  4A3I J;  4U87 A;  3TOA A;  4XLP F;  2WA0 A;  2ZKZ A;  3DLA A;  4HF1 A;  3A2K A;  4B43 A;  1Z21 A;  2FXA A;  5HLH A;  3CUQ A;  1H88 C;  4UB6 C;  3UKG A;  1JGG A;  3ONQ A;  1MMN A;  3L2R A;  1ONV A;  1EJ9 A;  2P81 A;  1S7A A;  1OLT A;  3QYB A;  3OYN A;  1IUY A;  2IJL A;  5D5U B;  1R4N B;  3CES A;  3R6S A;  2M30 A;  3O8G A;  2KIU A;  2RNJ A;  2LTP A;  5F0F A;  3WTU C;  1F4K A;  1D1A A;  4DBQ A;  1UEL B;  2HOE A;  4BDY A;  4HEA 2;  1SFX A;  1HC8 A;  2VJ5 A;  2M8G X;  4QTR A;  2WAE A;  4P9F A;  1IGN A;  2Y9Y A;  4V19 K;  1Z7U A;  2NVQ J;  3H0D A;  2JT1 A;  1WVR A;  4BQA A;  2LBF B;  4B3A A;  2QA4 I;  5D5X B;  1XMA A;  3EUK L;  5FLM J;  1OCT C;  3HEF A;  4Y17 A;  1YIT I;  4Y7N J;  1PUF B;  4U7D A;  4XIC A;  1ZHF A;  1VQ4 I;  2PG4 A;  1F9N A;  3K4K A;  2DN0 A;  3SDB A;  4B1R A;  5IPA A;  1L0O C;  1X1P A;  4LB6 B;  3UR3 C;  4IJA A;  3BDD A;  3TP3 A;  2Z5U A;  4QWQ A;  2HEO A;  3O3K A;  1FIA A;  1O3Q A;  2A3S A;  2H6B A;  2OQG A;  2P4W A;  2ISY A;  3EPZ A;  1Y1V J;  2XIG A;  2FUG 2;  2VN2 A;  1UJ8 A;  2E35 A;  3GTJ J;  2KKO A;  2M45 A;  2CFX A;  1SFK A;  2I5U A;  1U8R A;  1ACI A;  3JSO A;  2GXA A;  4N9H A;  4UVC A;  2FD5 A;  1B8I A;  3TO9 A;  4IHW A;  3L2Q A;  1JUP A;  2X4H A;  3DCF A;  3S32 A;  1B9M A;  1FY7 A;  4S05 A;  5J8C A;  1GDT A;  1OMI A;  4M9X A;  4LJZ F;  3VB2 A;  2NVT J;  2HFH A;  2D5V A;  5LRS A;  2EIL H;  1WJA A;  4XN3 A;  3K2A A;  3CME I;  1AWC A;  3FBN B;  1SD4 A;  1ETO A;  2GA1 A;  2CJJ A;  2L9V A;  4JBA A;  4PGG A;  2R5Z B;  2XAQ A;  1ZG3 A;  1Z05 A;  2VKD A;  2V1N A;  4OU0 A;  4EJT A;  2H8R A;  2M7A A;  1VQL I;  3V8L A;  3H5A A;  3PM1 A;  1RRJ A;  4BQQ A;  1S5L C;  1RIO H;  3TBI A;  3E6B A;  3CTA A;  4XID A;  2MC4 A;  2LF8 A;  2R5Y A;  2XF6 A;  1XCB A;  2DDB A;  2J5P A;  4UVB A;  1HOM A;  1MJA A;  2JUC A;  3WGH A;  1YQA A;  4C2T A;  2XAS A;  2IT0 A;  2W82 A;  3CCY A;  3E3V A;  3I5U A;  1P6R A;  4C2M J;  1Z91 A;  2DMN A;  2F5F A;  2GXG A;  4QLC U;  3IKT A;  2L7M P;  5M5W J;  3GW2 A;  1OKR A;  2H09 A;  3PIP F;  1PP8 F;  3E1S A;  5TGT A;  4BXX J;  3I59 A;  3HIF A;  2ZO4 A;  1LFU P;  5FRM A;  2OC6 A;  4M9S A;  3VYT B;  1TWC J;  1HF0 A;  5CVJ A;  4AVP A;  1X1D A;  1IF1 A;  2HI3 A;  3CZ6 A;  4DQ2 A;  4CA0 A;  1Y8R B;  2BXY A;  1FYM A;  4LD5 A;  1TQI A;  1I1G A;  1VQ6 I;  3B6C A;  4DGW B;  3TGN A;  5TIS C;  4NB5 A;  1ZR4 A;  3BCB A;  1E17 A;  2VIX A;  2P5V A;  4M3F A;  4P5O A;  3JR9 A;  4A12 A;  1X2N A;  2L9N A;  2LH9 A;  5B3S H;  1WKM A;  4IHV A;  4RB1 A;  3OYM A;  3QU6 A;  3KP4 A;  5CKT A;  1R00 A;  5BQT A;  2GA2 A;  4UB8 C;  5CQE A;  4AUX A;  1FEX A;  2NVY J;  4ZZL A;  4XRF A;  3F3X A;  4CIC A;  2VT3 A;  2K9S A;  4AYB A;  1CF7 A;  2BY3 A;  2X9D A;  3GF2 A;  4R79 A;  2DBB A;  2E2J J;  3J7Y J;  2TRT A;  4DZJ A;  3W2W A;  4AID A;  2Z2S B;  3WU1 B;  1J75 A;  1X3Z B;  1BJA A;  2KZV A;  1XGO A;  1R49 A;  4LG0 B;  1LKX A;  1ETK A;  1EH7 A;  1BI0 A;  5HOD A;  2ESN A;  4XBF A;  3GUD A;  4ZYG A;  2F5C A;  5IYC J;  5ICC A;  4N4O B;  4I0B A;  2UWM A;  1WI9 A;  2BXZ A;  3LSJ A;  2EA4 A;  3MD2 A;  4PFP A;  1ZGW A;  1QQI A;  3K10 A;  3K7A J;  4HSR A;  3S17 J;  1Q1V A;  5DD8 A;  1TWF J;  3WTW C;  4QSH A;  3LSR A;  4IOC F;  2P7V B;  4WX9 A;  2CO5 A;  3A0H C;  1EH8 A;  1WFX A;  3BY6 A;  4QIW N;  2K9Q A;  2VON A;  4I2O A;  1P7I A;  3VFZ A;  3HB9 A;  3GFJ A;  4QPO A;  1G6N A;  1PP7 U;  1N75 A;  1YJW I;  3LA3 A;  2K86 A;  3IKV A;  4Y33 A;  1H0M A;  4I76 A;  3DU6 A;  5EGO B;  4XN0 A;  1MD0 A;  3CC7 I;  1GV5 A;  4F55 A;  4CUG A;  1FSE A;  2MW8 A;  1WH5 A;  4CCL A;  4BGD A;  3D5L A;  4BJT A;  2H94 A;  2WB1 A;  5AIP A;  2PJR B;  2VBZ A;  1POG A;  3L7W A;  1DP7 P;  2EIM H;  2EV0 A;  2R4G A;  2A6E F;  3GWZ A;  3VEP A;  2W84 A;  3V4G A;  4EV0 A;  2HYF A;  5LLQ A;  2ME6 A;  2VLA A;  3KX2 A;  3K6G A;  1CGP A;  1OYW A;  1ETW A;  5FKM A;  1F5T A;  3PNV A;  2YSR A;  1HKS A;  1MBE A;  3QOP A;  6PAX A;  1IXS B;  5KAF C;  4V2F A;  1HXD A;  3FF5 A;  1W7P D;  4Y15 A;  2W57 A;  4Z2Y A;  1SAU A;  2ZFU A;  3A4C A;  4BHC A;  2QCO A;  4ZH4 F;  1ZTR A;  5J1Y A;  5CPR B;  3IV5 A;  3CCS I;  2OTL I;  4A3G J;  1UHW A;  4AC0 A;  2ADU A;  2LKX A;  3ZMD A;  2M7B A;  2ZSI B;  2D1V A;  1IDZ A;  2V6E A;  3HGG A;  1LB2 A;  3M8E A;  5GPC A;  2KDZ A;  3RZD J;  3FXK A;  4ZJZ A;  4MTD A;  3S3N A;  2QBY A;  3RPU D;  5M3F J;  4EJV A;  2LRD A;  3LFK A;  4C9Y A;  4NNJ A;  5FB2 A;  4XSX F;  3S1R J;  5ED4 A;  2QZ8 A;  3IAS 2;  3CCQ I;  3FXL A;  4N4N B;  5J1R A;  1OCO H;  3GYH X;  2Z9O A;  4OMZ A;  2F2E A;  3FBI B;  4DW6 A;  5FD6 A;  5H2F C;  5E8I A;  1UG0 A;  5J1U A;  3RYR A;  4B48 A;  2YX7 A;  3CUQ B;  4A3J J;  4IRH A;  5J47 A;  2JMW A;  3FMS A;  3F21 A;  4IHY A;  4UNO A;  2R7S A;  3CCM I;  1FPQ A;  2CUF A;  3RCO A;  3CQZ J;  4XLH A;  2O6G E;  2ECC A;  1K4T A;  1Z9C A;  4HX4 A;  1HDP A;  1Z77 A;  1R9T J;  2CW8 A;  4PJJ A;  2M0C A;  2GWR A;  4RA2 A;  4HG2 A;  1FYL A;  5D6E A;  1GUU A;  3QAH A;  1K61 A;  3P9C A;  4ANJ A;  2PLY A;  1F36 A;  1IN8 A;  4M3B A;  3ZMU A;  2OUM A;  2K4B A;  4AD9 A;  1QA6 A;  4KYW A;  2EFO A;  3IRQ A;  2P6T A;  1U2W A;  3PJR A;  2DMU A;  5DTD A;  3KYC B;  1MMD A;  2CQN A;  3BG6 A;  3CLQ A;  1SMT A;  2HXO A;  2VBY A;  3JRB A;  1DGR M;  1X3U A;  2NVX J;  2HR3 A;  4AIJ A;  4HST A;  4HW0 A;  1R58 A;  4RDU A;  3H36 A;  1BOB A;  4RAZ A;  3OSF A;  3P9K A;  3KEY A;  1G3T A;  4XL9 A;  3S1Q J;  4YIR X;  3HSE A;  3F22 A;  3BTC A;  3S3O A;  2HTS A;  2HYJ A;  4EAT A;  4ENM A;  3I55 I;  5HS7 A;  3PFY A;  4CYD A;  3VPR A;  4LFU A;  4PJL A;  4RAF A;  4JX5 A;  1JKP C;  3OYI A;  1JJ6 C;  1F43 A;  3PUF A;  3PO3 J;  2RDP A;  3KYD B;  4NDL A;  2LBF A;  4YG2 F;  2VB6 A;  1S9H A;  3EDP A;  3SEQ A;  2AXL A;  2XAU A;  3GZN B;  3OS0 A;  3AL0 B;  1MMS A;  5DUI A;  3ABL H;  2AQF A;  3K4L A;  3DLL F;  5HDG A;  2WAD A;  1O57 A;  1BI1 A;  2L7K A;  2A5W A;  3A1Y A;  3EUA A;  2R5Y B;  2HDD A;  1Y6I A;  3Q0W A;  3S8P A;  3QPH A;  4FE7 A;  5IOY A;  5IOZ A;  2UV1 A;  2R7O A;  3ZQC A;  3S1N J;  1LFP A;  3K0L A;  2PEX A;  3BG7 A;  4CO8 A;  3ZQF A;  5EYR A;  3ZXS A;  3ZPL A;  3C1D A;  1VZ0 A;  2EK5 A;  2Q2E A;  3EET A;  3LSM A;  4O6J A;  1QHG A;  2VJ4 A;  2V6C A;  2IP2 A;  2W85 A;  2E1C A;  4G7H F;  2BGC A;  1HW1 A;  4DBR A;  4KIS A;  2FF4 A;  1XGN A;  1ZR2 A;  3C7J A;  3MN2 A;  1TNT A;  1W5S A;  2W00 A;  4WF2 A;  1I5Z A;  2KZG A;  3ZMT A;  3DPT A;  4U0W A;  4BHB A;  1K6O A;  2E36 A;  1YOV B;  3BRO A;  1G4D A;  3MZ8 A;  3IRR A;  5E20 A;  2WWY A;  3BZC A;  3K2Z A;  2E1M C;  4HNV A;  3DBL B;  2CGP A;  2DA6 A;  2BY2 A;  1FLI A;  3R60 A;  4Q48 A;  2BY0 A;  3H9Q A;  3G2B A;  2H8W A;  3S15 J;  4DYQ A;  3RYP A;  1HW2 A;  3FMQ A;  1YW8 A;  2Z99 A;  2L02 A;  4I99 C;  2OA4 A;  1G3S A;  1B59 A;  4RAY A;  1JKQ C;  4O3M A;  1X1B A;  3LOC A;  2Y0S N;  3JAM Z;  1ZQ3 P;  4PGH A;  3BC8 A;  2D2W A;  2KJB A;  4EJO A;  1Z6R A;  1VTN C;  1TWG J;  4EM1 A;  5J4V A;  4LLL A;  1CF7 B;  3QWL A;  4RGU A;  2IS1 A;  1QZY A;  5KAI C;  4ENJ A;  1WRJ A;  3M8J A;  2E5Z A;  5HLT A;  3AAF A;  1XGM A;  2P5K A;  3ZMV A;  5HVQ C;  3CP2 A;  3ZQL A;  2WTE A;  1MBH A;  5FFZ A;  1LEB A;  1D8K A;  4NQW A;  4F93 B;  3FKJ A;  2GOX B;  4U88 A;  1VFC A;  3S16 J;  2VQL A;  2ZXI A;  2GM4 A;  3HOU J;  2K85 A;  2VC0 A;  2VKE A;  3K69 A;  3I54 A;  5JLW A;  4HLY A;  1KGS A;  2Y75 A;  1V5E A;  2V7F A;  1ITY A;  1TL8 A;  2XPW A;  2LYC A;  3BP8 A;  3CC4 I;  2YR2 A;  3WTT C;  1QO0 D;  2XB0 X;  4A3B J;  2R7Q A;  3EYY A;  3ABK H;  1FWZ A;  2EIJ H;  2F5E A;  3OYE A;  2DA7 A;  4LIU A;  1MH3 A;  4IRG A;  3ZR8 X;  4DJA A;  3BR5 A;  1D1B A;  3ZQQ A;  2CWE A;  3E6D A;  1U8B A;  3HOX J;  1MZB A;  4HV6 A;  1ZAO A;  2WAQ A;  4WXC A;  1WJ5 A;  3RSN A;  3K1P A;  2LY2 A;  3WHB A;  3MKZ A;  1K78 A;  1TP4 A;  5GP9 A;  2BEO A;  1VQ8 I;  1JHF A;  1XB4 A;  3ULQ B;  1P2F A;  4G8X A;  4BNC A;  3HKZ A;  3VSL A;  1DDN A;  1RKW A;  3S3M A;  3CCU I;  5JI6 A;  1NK2 P;  1ZRF A;  3VYR B;  5K7H A;  3GFL A;  4UY8 I;  1GHC A;  3GTK J;  3DKY A;  1DPR A;  4YIF A;  3GVA A;  3I56 I;  3CO7 C;  4HRI A;  1FYK A;  2ELJ A;  4L9T A;  3FIS A;  2RV8 A;  1UMQ A;  3ABM H;  3ECH A;  3HHG A;  1R1T A;  4Y52 J;  3E97 A;  3SZP A;  4YRV A;  5K5O A;  4HF0 A;  3R4K A;  1TQM A;  4XLC A;  1HLV A;  4RB3 C;  4EJU A;  2DTZ A;  2LC2 A;  4PUS A;  1R1V A;  4A0Z A;  1MBG A;  2JK3 A;  4E70 A;  1FOX A;  1R1U A;  1TTY A;  3V42 A;  1ETX A;  3A02 A;  2CV1 A;  3BR2 A;  4PJM A;  3FZV A;  4ON0 A;  1ODD A;  1O3R A; 
#chains in the Genus database with same CATH homology
 4PZJ A;  5D4R A;  1ZG5 A;  3HRS A;  2MH9 A;  1Z6T A;  1C0W A;  1USS A;  1PUE E;  1KQ0 A;  4KIF A;  1FC3 A;  3HRM A;  2CSO A;  1A04 A;  1S8N A;  5DV5 A;  5DYM A;  1XMK A;  5KVR A;  5E17 F;  3E5Q A;  3TDU C;  5FLX K;  5BPI A;  1SMY F;  2FRH A;  3EQL F;  3B02 A;  1ZH5 A;  2P5L C;  2EB7 A;  3J7A O;  2JZY A;  4M73 A;  3MFK A;  3P7N A;  1Y0U A;  1V3F A;  5DDG A;  3WU0 A;  5E1Z B;  1U3E M;  1ON1 A;  4MNU A;  1R5G A;  3C18 A;  2R3S A;  4N9I A;  3EYI A;  1HW5 A;  2ELH A;  3FWE A;  2A69 F;  4Y13 A;  3IL2 A;  3KP5 A;  4HYE A;  2A5Y B;  3IWF A;  3J80 Z;  1RZ4 A;  1IN4 A;  4G6D A;  5BS6 A;  1IZ1 A;  4IF4 A;  2VOP A;  4A0Y A;  4EQQ A;  1FNN A;  2XKO A;  3MQ0 A;  4YFK F;  1ZAR A;  4XSZ F;  3WTY C;  1ZG1 A;  2HTJ A;  1G3Y A;  3PQJ A;  4KIC A;  1ON2 A;  1FP1 D;  3SXY A;  5BPD A;  2EFP A;  2XKP A;  3B73 A;  3ECO A;  3T1B A;  1ZLK A;  2JPB A;  1U5T C;  3Q9S A;  3J81 Z;  3E6M A;  3IHU A;  3HTS B;  2D45 A;  3WGG A;  4G9Y A;  5D5W B;  2V79 A;  1KA8 A;  1UFM A;  5LGT A;  1J7K A;  2OBP A;  2HDC A;  2HZT A;  3I0T A;  4P96 A;  3M1E A;  1ZGA A;  4OMY A;  2JPC A;  5DCM A;  5LHH A;  3HUG A;  1OPC A;  1W4M A;  2J5O A;  3RJP A;  4EMS A;  5D6F A;  5J6X A;  2IW5 A;  1KU2 A;  1IXC A;  3GLX A;  3MWM A;  3FMR A;  4GXO A;  4MQV A;  2VC1 A;  5DCF A;  2YPR A;  3F8C A;  3U2R A;  2H6C A;  2DI3 A;  5D4S A;  2FA5 A;  1R5H A;  1ZRE A;  1MDM B;  3WE2 A;  3JTG A;  4GYG A;  3GFM A;  1ZLJ A;  3WG9 A;  3D0S A;  5JVT A;  2V1D A;  3TDZ C;  4OIP F;  2L01 A;  5CVU A;  4I7H A;  5K5Q A;  1XD7 A;  4RGS A;  1SD6 A;  1B6A A;  2JSC A;  5ILU A;  1K78 B;  3F8N A;  4MQ9 F;  3G3Z A;  4Q4Z F;  4IPA A;  1BI2 A;  4A6D A;  2QQB A;  1LDD A;  1KU9 A;  3RPQ A;  3HTU A;  4I0A A;  4M74 A;  4WWC A;  4BH9 A;  1ZRD A;  4L0Z B;  1IRG A;  3LA7 A;  3ZN0 A;  2V1X A;  2GIV A;  2ZME B;  4M6X A;  4WXD A;  5LEK A;  2XAJ A;  2FBH A;  4RB2 C;  3M9A A;  5HOO A;  2H27 A;  1T98 A;  2PMH A;  2RC4 A;  2YX4 A;  5D8L B;  4BHP A;  2QYO A;  3Q5F A;  1BI3 A;  3PQK A;  2XHK A;  4YFN F;  1BM9 A;  3I64 A;  1W7P B;  2IA0 A;  3GO5 A;  1I6X A;  3HOT A;  3KP6 A;  1LVA A;  3FXR A;  1O3S A;  3R0A A;  2K27 A;  1U5T A;  3I53 A;  1J0R A;  2RGV A;  2W25 A;  1FP2 A;  1U78 A;  1T6S A;  2IVM A;  2WV0 A;  4FX4 A;  4M6Y A;  1O7L A;  3JW4 A;  5ILS A;  4HV5 A;  3Q9V A;  2BYV E;  2A6H F;  2O3F A;  4KIG A;  1RUO A;  2CG4 A;  1YLF A;  2FBK A;  4GCV A;  2GXB A;  2L4A A;  3K1M A;  4KNY A;  2VE9 A;  2PMU A;  2PFB A;  2CW0 F;  1GXQ A;  2FML A;  5IT9 K;  4L0Y B;  5DD4 A;  3DKW A;  4CGZ A;  3EUH A;  1BC7 C;  4R1H A;  2NAZ A;  5H6R A;  4JQF A;  3LAJ A;  1UCR A;  4PDK A;  4WCG A;  3VOE A;  5A2Q K;  2XAH A;  3FM5 A;  2PJP A;  2DTR A;  5L3B A;  1LQ1 A;  3LQR A;  2BBY A;  3SQN A;  4OIN F;  4RB0 A;  5L3G A;  1YIO A;  2BE5 F;  4KIB A;  5HLI A;  2DPD A;  3CUO A;  5JFR A;  1IN5 A;  2OU2 A;  3NEU A;  1T38 A;  2GZW A;  4I98 B;  5FGM A;  2UXX A;  5FFX A;  1JXS A;  4ZYD A;  1ZYR F;  3LQQ A;  3MEX A;  2NYX A;  4ZYE A;  4HQE A;  2FU4 A;  1B9N A;  2PI0 A;  2HKX A;  4GYI A;  1LDJ A;  3TO7 A;  1D5V A;  4LB5 A;  1YFH A;  3V8J A;  2HYG D;  5L3F A;  3WGI A;  3TKY A;  5DUK A;  3VOD A;  4KUM A;  2K4J A;  1QZZ A;  5DCM B;  4AIK A;  1P92 A;  5AIQ A;  2HGC A;  2STW A;  4A5N A;  2DFI A;  4HDU A;  3U9G A;  3CLO A;  3ZP5 A;  1MKM A;  1V4R A;  2STT A;  2Q0O A;  2UXN A;  4ETS A;  3K1N A;  5CLS A;  1J5Y A;  2QM3 A;  4GGG A;  4U0Y A;  1P4X A;  3RKX A;  1QNT A;  4U7B A;  3KCC A;  1KYW A;  2EA2 A;  1IN6 A;  4I02 A;  1NHA A;  3DQV C;  2XVC A;  1XSV A;  3L09 A;  2A68 F;  4FT8 A;  3S2W A;  4ZYH A;  3JTH A;  3M7G A;  3E6C C;  4L18 B;  1R23 A;  1K7A A;  3BWG A;  1IRF A;  2O8X A;  2B0L A;  4KDP A;  5F1R A;  4CXF A;  1STZ A;  3GFI A;  2DO7 A;  1BC8 C;  1XCV A;  5K5R A;  5LRR A;  1REP C;  4YII A;  1YO5 C;  3ELK A;  4L9V A;  3N4M A;  1MDM A;  1WSU A;  3RI4 A;  2K02 A;  4EM0 B;  3DXJ F;  3F23 A;  2JRT A;  2VXZ A;  2HQR A;  4UXN A;  1TNS A;  4WK8 F;  4ESJ A;  2NS0 A;  4AIH A;  2ZJ2 A;  5CVR A;  3DV8 A;  4WXH A;  3MCZ A;  2DAO A;  2MD5 A;  4OIQ F;  1LEA A;  1S29 A;  1QBJ A;  2M8E A;  3DPL C;  5LHI A;  4IHT A;  1B4A A;  3V7C A;  2LSO A;  2GAU A;  2ESH A;  2BV6 A;  5L3C A;  4ENN A;  3KE2 A;  3T5X A;  4OIO F;  1SD5 A;  3WTV C;  3CO6 C;  1BBY A;  2L54 A;  1TLH B;  3T8T A;  2DLL A;  4HOB A;  2ZME A;  5JR3 A;  1U5T B;  2IA2 A;  5ICG A;  4A2U A;  1WWX A;  2DPU A;  2PN6 A;  1AOY A;  4O5V A;  5F6F A;  1XDS A;  3COA C;  1W7P A;  4HBL A;  4M72 A;  2NRA C;  3HHH A;  2O0Y A;  2HWV A;  1UHM A;  5LGU A;  2IPQ X;  1BN5 A;  4MEY F;  5E1X A;  3RPU A;  3HOS A;  3KP7 A;  3RIR A;  5ILV A;  4I01 A;  3BJ6 A;  4MTE A;  4L5J A;  4KMU X;  1TBX A;  4RGR A;  5BOX A;  4KN7 X;  3HSF A;  1YS6 A;  4LGW A;  2E7X A;  1HKT A;  3T0Y A;  1I27 A;  4HX8 A;  4IHS A;  2M1B A;  2DK8 A;  4XLN F;  4LK1 F;  3E5U A;  2R7D A;  3QU3 A;  2RN7 A;  3KLN A;  4M9Z A;  2XRN A;  4HA8 A;  1IAW A;  2JTV A;  4CDG A;  4YFX F;  2KIM A;  4MHG A;  3RDI A;  2XRO A;  5FD5 A;  3F72 A;  4LLG F;  3DF8 A;  1K79 A;  3HYI A;  3GEZ A;  2TDX A;  2HKO A;  1D3Y A;  3KFW X;  4M71 A;  4FHT A;  5ICF A;  4KT5 C;  1FZP B;  1J2X A;  1YW9 A;  2G9W A;  5LHG A;  4L5I A;  2MBF A;  3ZQ7 A;  3QP6 A;  1S6L A;  2RKH A;  2MLG A;  1YW7 A;  1T39 A;  3BZ6 A;  1R36 A;  3BJA A;  2OQR A;  4HQM A;  3GX4 X;  1IN7 A;  5ERI A;  3IWZ A;  3QP5 A;  4P55 A;  3F8M A;  3NRV A;  4ESB A;  4DNC A;  1EV7 A;  1YYV A;  1HQC A;  4OIR F;  2PBI A;  1OYY A;  4Q47 A;  2A61 A;  3W6K B;  4G7O F;  2LF7 A;  3OV8 A;  1R22 A;  2CYY A;  2FOK A;  1BIA A;  5CJ9 A;  3LA2 A;  2LKP A;  2ZNZ A;  3DEU A;  1RUN A;  3MZY A;  2L4M A;  2V9V A;  2QWW A;  1KQ8 A;  5CVV A;  2VT2 A;  2NNY A;  2V1U A;  2DU9 A;  2EFQ A;  4HX7 A;  4HAM A;  1J9I A;  4EM2 A;  1T2K A;  1KYZ A;  2C6Y A;  1U6G A;  2XGX A;  2ETH A;  4TV7 A;  5KK1 A;  3ZMZ A;  1P4W A;  2FEZ A;  4AWX B;  2QVO A;  2O61 A;  3BJO A;  5E18 F;  1O3T A;  2DQL A;  2OD5 A;  2XAF A;  2KRF A;  2Y48 A;  2VBX A;  1XGS A;  1F1Z A;  3KEO A;  1H9T A;  4B09 A;  3SHF A;  1XDU A;  4UUV A;  3I71 A;  1S3J A;  2UZK A;  5CVI A;  5H20 A;  3V7S A;  2OZ6 A;  3HRT A;  3V7R A;  4IRI A;  4LK0 F;  3W6J B;  3E5X A;  3DFG A;  4CHU A;  3H92 A;  5DEQ A;  2ZFW A;  3NQO A;  3ABU A;  3ISP A;  5IT3 A;  1TW3 A;  2E7W A;  4L9J A;  1XSX A;  1P4A A;  2ACJ A;  2COM A;  3JAM K;  4UHT A;  1KQ9 A;  2DK5 A;  3WTZ A;  2EWN A;  2RVC A;  2OZU A;  2Q8K A;  3FXQ A;  1L3L A;  4L9N A;  2ZBK A;  3RKY A;  2HS5 A;  2P8T A;  1FBQ A;  1QPM A;  1SFE A;  3TQN A;  5H6Q A;  5HLG A;  1XSD A;  2HQN A;  4IVN A;  2MH2 A;  5FLX Z;  2DQR A;  3KET A;  2P6S A;  3L2C A;  3KP3 A;  1JGS A;  2Z3Y A;  3GXO A;  3F6V A;  4NHJ A;  1ZN2 A;  2RQP A;  1XN7 A;  5AON A;  1LNW A;  4EGZ A;  3REO A;  4UV9 A;  1E2X A;  3FXU A;  2QQ9 A;  1JE8 A;  4KFC A;  2FNA A;  2R7F A;  4JK1 X;  3LST A;  3JSP A;  3ZMS A;  1B1B A;  1OYI A;  5TJJ A;  3I58 A;  3TOB A;  2G7H A;  4LMY A;  2KIF A;  3KP2 A;  4HF2 A;  3P9I A;  4PCQ A;  3WOD F;  3H3U A;  1SFU A;  2LDU A;  5E1W A;  2EFW A;  1GVJ A;  1YTY A;  1FX7 A;  2VBW A;  3K9T A;  1BOA A;  4IXA A;  4EVI A;  3M8F A;  1WQ2 A;  3ML6 A;  4KA4 A;  4BYY A;  1KU3 A;  3BOQ A;  2XAG A;  3C3W A;  4MEX F;  1MGT A;  3RTR A;  2GQQ A;  3F8B A;  2P7C B;  2CQK A;  1GXP A;  1IXR C;  5D5V B;  3AAF A;  5L3D A;  4BAY A;  4D0P A;  5LBQ A;  4Q5S F;  3FX3 A;  1MJ9 A;  5J8F A;  2VE8 A;  3CJN A;  2M87 A;  4U0V A;  4BXU A;  3LWF A;  1HKQ A;  4G6Q A;  1SD7 A;  4N0B A;  2EFN A;  1ZRC A;  5F64 A;  3MAJ A;  3OOP A;  3T8R A;  1W5T A;  5HS9 A;  1EH6 A;  2FMY A;  2ZNY A;  3LAP A;  4MGR A;  1HST A;  3L9F A;  4KN4 X;  2ISZ A;  5HDN A;  3QPT A;  3J80 K;  1JHH A;  1RNL A;  3V8K A;  3H3Z A;  2Y0M A;  2QQA A;  1KU7 A;  5EEH A;  3BPX A;  4R8H A;  1H9G A;  3SFZ A;  2O03 A;  3TO6 A;  4HZF A;  3I59 B;  5EEG A;  3KZY A;  4LLN A;  1LJ9 A;  5BMZ A;  2XUB A;  4RGX A;  2AS5 F;  2E1N A;  1Z1D A;  4UVA A;  5FO5 A;  2G7U A;  1OR7 A;  3J81 K;  1HBX G;  1ZGJ A;  4A5M A;  3PFI A;  2KJC A;  4OOI A;  1FBS A;  3CUQ C;  1R7J A;  1PDN C;  3CDH A;  3SZT A;  5LEJ A;  2ZCW A;  3F8F A;  3ROU A;  5CYV A;  3WTX C;  3WTS C;  3U1D A;  2IRF G;  5ICE A;  3KEQ A;  4B8X A;  3O2P E;  2VOD A;  5JHU A;  5L3E A;  4P9U A;  1S7O A;  2FNP A;  2LNB A;  2DT5 A;  2A07 F;  4K2E A;  2MLK A;  2EJR A;  2XV4 S;  3KLO A;  2K7L A;  3I4P A;  2W24 A;  4HDV A;  4UV8 A;  4HLX A;  4EJW A;  4RS8 A;  2FE3 A;  3MZH A;  3FM3 A;  1SAX A;  1YG2 A;  3WE3 A;  4H0E A;  1LDK B;  4EGY A;  3HRU A;  1O7F A;  2L3D A;  1I1S A;  1J59 A;  1G3W A;  1TQP A;  4G7Z F;  2FSW A;  3F6O A;  1MJB A;  1UST A;  1TW2 A;  2YU3 A;  2FQ3 A;  2MA3 A;  4LG0 A;  5D8K B;  2WC2 A;  4G94 A;  2EV5 A;  2FBI A;  1FT9 A;  1FSH A;  4ASN A;  3FHZ A;  3N97 A;  5LGN A;  5IT9 Z;  2Z33 A;  1FBU A;  1DUX C;  1QGP A;  3HSR A;  1T0F A;  2VOO A;  2D1H A;  2X0L A;  1ULY A;  4S04 A;  2EV6 A;  2PQ8 A;  2NNN A;  3BPV A;  3RKW A;  3DP7 A;  5E8G A;  2QBY B;  4GO1 A;  5A2Q Z;  3GZ6 A;  4KMF A;  3G73 A;  1DPU A;  4A0X A;  4I09 A;  1YS7 A;  3ABT A;  4CZZ A;  2F5D A;  3R61 A;  2OAZ A;  3QRF F;  5TRD A;  1HSJ A;  3IC7 A;  1Q1H A;  5HDK A;  3ERE D;  4ESF A;  1D8J A;  1UB9 A;  2QLZ A;  5K1Y A;  2IA1 A;  1RI7 A;  5HS8 A;  2QEN A;  3KZZ A;  3ZN1 A;  2QUF A;  1FOK A;  1IW7 F;  3L00 A;  1BIB A;  2MC3 A;  4A6E A;  2ZXJ A;  3O6B B;  3R0J A;  2DW4 A;  4F7Z A;  2M5W A;  4ENK A;  4ZZD A;  3GZ5 A;  4FX0 A;  4HF1 A;  3TOA A;  4XLP F;  2ZKZ A;  2FXA A;  5HLH A;  3CUQ A;  1ONV A;  1S7A A;  1IUY A;  2IJL A;  5D5U B;  3R6S A;  2M30 A;  2KIU A;  2RNJ A;  3WTU C;  1F4K A;  2HOE A;  1SFX A;  4P9F A;  1Z7U A;  2JT1 A;  4BQA A;  5D5X B;  1XMA A;  4Y17 A;  4U7D A;  1ZHF A;  2PG4 A;  1F9N A;  1L0O C;  4LB6 B;  4IJA A;  3BDD A;  2Z5U A;  4QWQ A;  2HEO A;  3O3K A;  1O3Q A;  2A3S A;  2H6B A;  2OQG A;  2P4W A;  2ISY A;  2XIG A;  2VN2 A;  2KKO A;  2M45 A;  2CFX A;  1U8R A;  3JSO A;  4N9H A;  4UVC A;  3TO9 A;  2X4H A;  1B9M A;  1FY7 A;  4S05 A;  5J8C A;  1OMI A;  4M9X A;  4LJZ F;  3VB2 A;  2HFH A;  5LRS A;  1AWC A;  1SD4 A;  2GA1 A;  4JBA A;  4PGG A;  2XAQ A;  1ZG3 A;  1Z05 A;  4OU0 A;  4EJT A;  3V8L A;  1RIO H;  3E6B A;  3CTA A;  2LF8 A;  1XCB A;  2J5P A;  4UVB A;  1MJA A;  3WGH A;  1YQA A;  2XAS A;  2IT0 A;  3E3V A;  3I5U A;  1P6R A;  3IKT A;  1Z91 A;  2F5F A;  2GXG A;  4QLC U;  3GW2 A;  1OKR A;  2H09 A;  1PP8 F;  3I59 A;  3HIF A;  2ZO4 A;  4M9S A;  5CVJ A;  4AVP A;  1IF1 A;  4DQ2 A;  1FYM A;  4LD5 A;  1TQI A;  1I1G A;  3TGN A;  4NB5 A;  1E17 A;  2P5V A;  4P5O A;  4A12 A;  1WKM A;  4RB1 A;  3QU6 A;  3KP4 A;  1R00 A;  5BQT A;  2GA2 A;  4ZZL A;  4XRF A;  3F3X A;  4CIC A;  2VT3 A;  1CF7 A;  3GF2 A;  4R79 A;  2DBB A;  3WU1 B;  1J75 A;  1BJA A;  1XGO A;  4LG0 B;  1EH7 A;  1BI0 A;  2ESN A;  4XBF A;  3GUD A;  4ZYG A;  2F5C A;  5ICC A;  4I0B A;  2UWM A;  1WI9 A;  2EA4 A;  1QQI A;  5DD8 A;  3WTW C;  2P7V B;  4WX9 A;  2CO5 A;  1EH8 A;  3BY6 A;  2VON A;  4I2O A;  3VFZ A;  3GFJ A;  1PP7 U;  1G6N A;  3LA3 A;  2K86 A;  3IKV A;  1H0M A;  1MD0 A;  1FSE A;  3D5L A;  2H94 A;  5AIP A;  2VBZ A;  3L7W A;  1DP7 P;  2EV0 A;  2A6E F;  3GWZ A;  3VEP A;  2W84 A;  3V4G A;  4EV0 A;  2HYF A;  5LLQ A;  1F5T A;  1CGP A;  1OYW A;  2YSR A;  1HKS A;  3QOP A;  6PAX A;  1IXS B;  1HXD A;  3FF5 A;  1W7P D;  4Y15 A;  2W57 A;  4Z2Y A;  4BHC A;  4ZH4 F;  1UHW A;  2ADU A;  3ZMD A;  2D1V A;  1LB2 A;  3M8E A;  2QBY A;  4MTD A;  4EJV A;  3LFK A;  5FB2 A;  4XSX F;  5ED4 A;  2QZ8 A;  3GYH X;  2Z9O A;  4OMZ A;  2F2E A;  5FD6 A;  5E8I A;  3RYR A;  2YX7 A;  3CUQ B;  4IRH A;  3FMS A;  3F21 A;  4UNO A;  1FPQ A;  2O6G E;  1Z9C A;  4HX4 A;  2GWR A;  1FYL A;  5D6E A;  3QAH A;  3P9C A;  2PLY A;  1IN8 A;  3ZMU A;  2K4B A;  4AD9 A;  4KYW A;  2EFO A;  3IRQ A;  2P6T A;  1U2W A;  1SMT A;  2VBY A;  1X3U A;  2HR3 A;  4AIJ A;  4HW0 A;  1R58 A;  4RAZ A;  3P9K A;  1G3T A;  3HSE A;  3F22 A;  2HTS A;  4ENM A;  5HS7 A;  4CYD A;  4LFU A;  2RDP A;  4YG2 F;  3EDP A;  2AXL A;  5DUI A;  5HDG A;  1O57 A;  1BI1 A;  3QPH A;  3K0L A;  2PEX A;  4CO8 A;  3ZPL A;  3C1D A;  2EK5 A;  2Q2E A;  3EET A;  4O6J A;  2V6C A;  2IP2 A;  2W85 A;  2E1C A;  4G7H F;  2BGC A;  1HW1 A;  2FF4 A;  1XGN A;  3C7J A;  1TNT A;  1W5S A;  4WF2 A;  1I5Z A;  3ZMT A;  4BHB A;  3DPT A;  4U0W A;  1K6O A;  3BRO A;  1G4D A;  3IRR A;  5E20 A;  2WWY A;  3K2Z A;  2CGP A;  1FLI A;  3R60 A;  4Q48 A;  3RYP A;  1HW2 A;  3FMQ A;  1YW8 A;  2Z99 A;  2L02 A;  2OA4 A;  1G3S A;  1B59 A;  4RAY A;  4O3M A;  3JAM Z;  4PGH A;  4EJO A;  2D2W A;  2KJB A;  1Z6R A;  1VTN C;  4EM1 A;  4LLL A;  1CF7 B;  4RGU A;  1QZY A;  4ENJ A;  1WRJ A;  1XGM A;  2P5K A;  3ZMV A;  5HVQ C;  2WTE A;  5FFZ A;  1LEB A;  1D8K A;  4NQW A;  4U88 A;  2VC0 A;  3K69 A;  3I54 A;  4HLY A;  1KGS A;  2Y75 A;  3BP8 A;  2YR2 A;  3WTT C;  1QO0 D;  3EYY A;  1FWZ A;  2F5E A;  4IRG A;  2CWE A;  3E6D A;  1MZB A;  4HV6 A;  1ZAO A;  4WXC A;  3K1P A;  1K78 A;  2BEO A;  1JHF A;  1XB4 A;  3ULQ B;  1P2F A;  4G8X A;  4BNC A;  1DDN A;  1ZRF A;  5JI6 A;  3GFL A;  1GHC A;  1DPR A;  4YIF A;  3CO7 C;  3GVA A;  1FYK A;  4L9T A;  2RV8 A;  3ECH A;  3HHG A;  1R1T A;  3E97 A;  3SZP A;  5K5O A;  4HF0 A;  3R4K A;  1TQM A;  4RB3 C;  4EJU A;  1R1V A;  4A0Z A;  4E70 A;  1R1U A;  1TTY A;  4ON0 A;  3FZV A;  1ODD A;  1O3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...