2JWTA

Solution structure of engrailed homeodomain wt
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
61
structure length
61
Chain Sequence
MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Segmentation polarity homeobox protein engrailed
publication title Comparison of multiple crystal structures with NMR data for engrailed homeodomain
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 17
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2jwtA00
4M3GA 4JYKA 3ZOBA 3HBLA 4A3DJ 1JJ6C 5M5YJ 2NVYJ 1JJ8C 3M4OJ 2LR8A 3BG3A 2R7ZJ 2VUMJ 4XRSG 3G1OA 2XB5A 1JT0A 2MSYA 3TW6A 3LNQA 2EH3A 4W1UA 4I6ZA 2LTPA 2XPVA 3IH2A 1B72A 2K9SA 3ZQIA 3ZQHA 4A3FJ 4B3AA 2HOTA 1Z0XA 2DMPA 1ETXA 4QIWN 3D1NI 2LLKA 2XGDA 1ETOA 5IOZA 2R5ZB 1HDPA 2K9NA 1K61A 4BY7J 4M3EA 3WHBA 1G2HA 4FISA 1TWFJ 1BW5A 1RR7A 2CUFA 1K83J 2AHQA 4X6AJ 1GT0C 2NS8A 3A02A 4M3BA 5GPAA 4RDUA 5FKKA 2ID6A 4XRMA 4A93J 2X48A 2O8KA 1QPIA 3BT9A 2L7ZA 3RKQA 4C3JJ 3S15J 5M3MJ 5E3MA 4NDLA 3QPLA 3K2AA 1ETKA 3HOZJ 2NS7A 3F0CA 2YU9J 2HOSA 4A3BJ 1WCMJ 2VKVA 5J3LA 1Y1WJ 5IYDJ 3JRFA 2I10A 4C3IJ 5FLVA 3JR9A 2M9HA 3O8HA 4JP0A 2JWTA 2GLOA 2O9LA 4A3LJ 4BBSJ 2EZLA 1AKHB 2XB0X 2LFBA 1ITYA 1GUUA 3Q0WA 5EYRA 3C2BA 5EG0A 5K7HA 5J1YA 2LP0A 2DMUA 1MSFC 1SANA 3G1MA 2M2EA 2DA7A 4W97A 4A3GJ 4MFEA 3GTOJ 4JX4A 5E3OA 2VPRA 2NVQJ 1I6HJ 1UG2A 2HYJA 1MBGA 4XICA 4BY1J 1A5JA 2EZIA 4HNVA 2R5YB 4IHVA 4BXXJ 2CU7A 2JK3A 1EF4A 1H8AC 2E1OA 4B4CA 1IG7A 2NVXJ 3BTCA 2EQRA 2B63J 4A3JJ 4UUTA 1WI3A 5FKOA 1ZGWA 1CQTA 1MBEA 5IYBJ 3TEDA 2LD5A 3RQIA 2HXOA 2HI3A 2MGQA 5IYCJ 3L1PA 2IAIA 5FJ8J 1JKPC 2DA4A 2KT0A 2JA7J 3TP3A 2O7OA 4A3MJ 2ECBA 5M5XJ 1NK3P 2DJNA 3JREA 3ZQCA 1I3QJ 1MSEC 5EDNA 3RZOJ 1B72B 1MH4A 1F36A 3BTIA 1P7JA 5DS9A 3UKGA 1IV6A 1JTYA 9ANTA 1IUFA 3FKIJ 1IDZA 4Y7NJ 2JA6J 2XPWA 4DYQA 1VI0A 2DA6A 1GV2A 1HCRA 4ABZA 5DTDA 2Y9ZA 2P81A 1TWHJ 2OF7A 3BR5A 3GTJJ 2JMWA 1NK2P 2JA8J 5EF6A 2E2IJ 1JTXA 3MN2A 3A03A 3BTLA 3FK7A 1QVUA 4M3DA 3G1LA 5FKMA 3K7AJ 2TRTA 1ZR2A 2Y9YA 3DCFA 3CDLA 1ZK8A 2Y0SN 1MH3A 2E2JJ 2DA3A 2K40A 2R93J 3CMYA 2L9RA 3VPRA 3BR3A 2M34A 1LE8B 3ZQLA 1Q1VA 3FIWA 1IDYA 4FE7A 2R0QC 3BR0A 5JLWA 1VF9A 5C4JJ 2CUEA 1U9OA 4X1EA 2N8GA 4C2MJ 4RBOA 3HM5A 1JUMA 1DU6A 2WV1A 1BL0A 3IV5A 1W0UA 1T33A 5J1UA 4JX6A 5K7FA 5IPAA 1YRNA 2JJ7A 5F27A 1IGNA 4IEJA 5EG0B 4D7NA 2TCTA 4G12A 3BQZA 5F04A 3WHCA 3HOXJ 4EEFG 1JKOC 4DZPA 1A6IA 1LE8A 4V2GA 1X58A 2DMNA 1O4XA 1UMQA 5BNGA 1U78A 2ME6A 4BBRJ 2NOGA 3H3VK 2E19A 1JT6A 2G0EA 1BW6A 3BR2A 1ETWA 2K9QA 3A01A 3JRHA 2VI6A 3ZQFA 1E3OC 1OCTC 2ME0A 4MIMA 5F0HA 1S7EA 3E7LA 1D5YA 2DMTA 3B6CA 2IBDA 2HOAA 1U8BA 4C3HJ 4Y52J 2EZHA 2CJJA 2FQ4A 1JKRC 1ZKGA 3Q0UA 1X2NA 4A3CJ 3S1QJ 3HEFA 2Y2ZA 2JA5J 2L7MP 2LK2A 1VNDA 3PO3J 2HQ5A 1OCPA 4MLOA 4MFDA 4J19A 4A69C 4M6VA 3RZDJ 3JRGA 3BR1A 4CYCA 1ZR4A 3S14J 4AC0A 2LKXA 4FCYA 1GV5A 5F0FA 2LY9A 3HKZN 3SDGA 1MBJA 5E3LA 4IHYA 3NARA 2COBA 3GTPJ 3FK6A 3GBGA 3I4NJ 3MVPA 4DW6A 3DEWA 2FX0A 5FKNA 3SJMA 1B8IA 2ECCA 3PM1A 5E3NA 3W6VA 2GBYA 5JLXA 3S16J 2MG4A 5EEAA 1H88C 2EBIA 2EZKA 2CQXA 2JN6A 1PUFB 5HODA 4GFBA 3LSJA 4UUSB 1OJLA 2DA1A 3Q3SA 1APLC 4M3FA 3BG5A 2L0KA 3MKLA 1HLVA 3JRIA 1Y1VJ 1AU7A 1P7IA 2DA2A 3I4MJ 5F1JA 1XS9A 1ETQA 2KDZA 1JKQC 1TC3C 3FISA 2Y31A 3JRDA 1GDTA 2IEKA 3O8GA 1JUSA 1PUFA 1ETYA 1YRNB 2R92J 5C44J 2E2HJ 5FLMJ 1IJWC 4UUSA 3S2HJ 2XGCA 1FTTA 3CCYA 3BR6A 5M5WJ 3TW7A 2CRGA 5C4XJ 3QQAA 5EZGA 1ETVA 3GTKJ 3BQYA 2XGEA 4JX5A 2NVTJ 4XIDA 2ID3A 3Q0VA 4FTHA 4S0HB 2LVSA 4L5EA 5GPCA 3S1RJ 1TWCJ 3A01B 5EGOB 3JRCA 3B6AA 1H89C 3S17J 1UHSA 2DMQA 2VKEA 4A3IJ 4B1RA 1IC8A 3LSRA 3BTJA 1JUPA 5J1RA 2L7FP 4AUXA 1MNMC 4D5CA 1I50J 2FJ1A 1TWGJ 2HDDA 3HGYA 3CQZJ 3HOYJ 2YS9A 4A3KJ 1WPKA 3HOWJ 4D7MA 1RESA 1FIAA 1HF0A 2M8GX 1JGGA 3GTMJ 5EGOA 2RAEA 5FKLA 1LFBA 4V2FA 2GM4A 1GVDA 3TP0A 4CYCB 2WB1N 5EZHA 2QF7A 3GTGJ 3LSPA 4IHWA 3HB9A 2R5ZA 4A3EJ 3OIOA 2AO9A 2WAQN 1DU0A 1RPWA 3IH3A 2H1KA 3ZQGA 4DZJA 1R9TJ 1POGA 4FE4A 1IRZA 1FTZA 1NTCA 2PMZN 1B8IB 1WH5A 2M0CA 1U9NA 1ENHA 2FD5A 4QSHA 3S2DJ 4XRSA 2XPUA 5K7ZA 3HOUJ 1RKWA 1X2MA 1FIPA 1SFOJ 1HDDC 2MW8A 2D5VA 3PO2J 1FEXA 5F08A 3JRAA 5IP9J 3LSGA 2OPTA 2X6OA 1ORKA 5IP7J 4MO7A 3M3YJ 3S1MJ 5M3FJ 2ZB9A 1XC5A 1RKTA 1RETA 3OSFA 1T56A 3GTQJ 5F0CA 2QCOA 4IHXA 1AKHA 1BA5A 4XK4A 3SFIA 4DYCA 4QTRA 1ZQ3P 1W0TA 1QVTA 3OSGA 1MBFA 2DA5A 2ELKA 3HGGA 4D5FA 3S1NJ 3BG9A 1LFUP 4DYRA 1XG1A 2W48A 2Y30A 2XRLA 1FJLA 1WH7A 1MBKA 1WGXA 2DN0A 1HOMA 2DTZA 4I76A 3H0GJ 2YUSA 1AHDP 1VFCA 1TWAJ 4LOCA 3IH4A 3HOVJ 2XSDC 1QRYA 2X9DA 2H8RA 3HDDA 1BJZA 3OOUA 3QPSA 4AYBN 5IOYA 2R5YA 1OFCX 5IP6A 1F43A 3GTLJ 3LOCA 1Z77A 3NAUA 2CQQA 3JRBA 4BKXA 1ZTRA 5GP9A 5C3EJ 1MBHA 2HXIA
chains in the Genus database with same CATH superfamily
1OMIA 4M3GA 4JYKA 4XLEA 3ZOBA 4UV8A 2EFWA 3CCUI 1JJ6C 1PDNC 4IZZA 4II3A 3M4OJ 2GZWA 1W36D 2OJED 1JT0A 5E8GA 3LNQA 4I2OA 1HSTA 1Z3XA 3IAM2 4I6ZA 4CGZA 2DW4A 3DU6A 3FMQA 2XPVA 1B72A 2GQQA 2K9SA 4M72A 3E1SA 3V42A 3ZQHA 1YTYA 5HLTA 5E1ZB 4B3AA 3DBRB 2R7SA 1Z0XA 3O2PE 4QIWN 1ETXA 5ERIA 1HSJA 1ETOA 4MEXF 1WRJA 2Z33A 1HDPA 2RGVA 4KMUX 1R5GA 2FSWA 3BP8A 4ZYEA 1TWFJ 3E6DA 5JVTA 1BW5A 3BPVA 1RR7A 3CCLI 4ENKA 5FLXZ 2A05A 1K83J 2VQGA 3L7WA 4EV0A 1DP3A 3A02A 4M3BA 5GPAA 2RVCA 2XAJA 3F21A 1IAWA 3L2RA 4A93J 1MW7A 2X48A 4PDKA 4AIKA 4XQFA 2KRHA 5L3FA 4PSWA 1R36A 2AQFA 3K2AA 4YG2F 3M9AA 3F0CA 2HOSA 3ZMTA 2Q2EA 2VKVA 5J3LA 5FROA 1J0RA 5LGTA 4HNUA 3FBIB 1K4SA 2AXLA 3JRFA 4P1WA 3JR9A 3O8HA 4JP0A 2JWTA 4A3LJ 1I1SA 2RQQA 3MMYB 4M71A 1IN5A 3CC2I 3HUGB 1ZREA 4CZZA 1Z1DA 2ZMEC 1ITYA 2XGXA 3CCVI 4HX8A 1G3YA 2CV0A 3ULQB 1HKSA 4OIPF 3L2UA 2VOOA 3M8FA 1SFEA 3HYIA 3F72A 4OU0A 2CG4A 1I1GA 2LREA 2OA4A 2RV8A 4EM2A 3G1MA 1VQ4I 3OS0A 3F8NA 2DOFA 5DV5A 3WU2C 1TT5B 4MFEA 3OYJA 3G3ZA 3GTOJ 1SVMA 4HX7A 2NVQJ 1U5TC 4II2A 1O3RA 2ZBKA 4KYWA 2CQKA 2HU9A 4CSWA 3HSFA 3HUGA 2CW8A 2EZIA 2ZFWA 4L5IA 2E1OA 2IJLA 2YU3A 4B4CA 1U8RA 6PAXA 2B63J 4PZJA 2QEXI 2V9VA 3RKYA 2MA3A 4OAYA 5FKOA 4BQNA 1N77A 1BI1A 1MJAA 1MGTA 2DO7A 1LDJA 2MH9A 3ABLH 1JKPC 1G4DA 3EETA 2JA7J 3NRVA 3BOQA 3K4BA 5BPIA 2Z2SB 4EJVA 4HYEA 3J7ZI 1NK3P 2KDOA 3BROA 2NAZA 4E7LA 3CMAI 1ZH5A 1NG6A 1EA3A 1LDKB 3KIOA 1XGOA 4IF4A 5EDNA 2XKOA 1Y8QB 3RZOJ 4ON0A 1F36A 2VQHA 1BN5A 5DS9A 1BIAA 5DDGA 9ANTA 3F9KA 1O57A 3WTUC 1K6OA 2FE3A 5KCMA 3FKIJ 4EJUA 3IRRA 2XPWA 4DYQA 3OYBA 3K6GA 2DTRA 5HNHA 1T2KA 3MWMA 4UVAA 2W24A 2Y9ZA 1G3SA 3DV8A 3BR5A 2JMWA 2L9NA 2V9KA 2XAHA 2EV6A 3GO5A 3WTYC 2ESNA 4RB2C 1FNNA 3OL4A 3K7AJ 4AM3A 3I54A 4B48A 2Y9YA 3CESA 3IUOA 4BNCA 3LSHA 2Y0SN 1FSEA 4OMYA 4ENJA 2W7NA 2H09A 4RLQA 3CTAA 1FBUA 3VYTB 2L9RA 3VPRA 5ED4A 1ZELA 2HQAA 1QZEA 2J5PA 4YFXF 2A61A 1D0XA 3FIWA 1IDYA 2H1LA 4FE7A 5JLWA 1YJWI 5DYMA 5B1AH 2M4KA 1SVOA 3E5XA 4X1EA 1R6RA 3ABTA 5F64A 5LEJA 4GYIA 4M73A 2IS6A 1DP7P 2PMZA 1VQKI 2K9MA 4XOTA 2BY0A 1R71A 5J1UA 2VOPA 5IPAA 1B6AA 5F27A 3IKVA 4IEJA 2DT7B 2OCCH 3MCZA 5FFXA 5CVIA 4G12A 3BQZA 2ZKZA 5F04A 4ESBA 5EG0B 3OYEA 3HOXJ 2CV1A 4PJLA 1JKOC 5J6XA 2QUFA 2VODA 3K70C 1X58A 1O4XA 3UR3C 1SEUA 4BACA 4FETA 3H3VK 2PN6A 2K02A 4UNOA 2CWEA 1Y8RB 1UZCA 3DEEA 4S04A 2E60A 2VBYA 2DAOA 3A01A 1VQ9I 1M1EB 1JXSA 2W25A 5A2QZ 2ICWG 1OCTC 2ME0A 1Y0NA 3LL7A 4HQEA 1S7EA 2ACJA 2E7XA 2NVUB 2DMTA 4ZYAA 3B6CA 2F5DA 2IBDA 1MIJA 4Y3OA 3MD2A 3QRFF 2EZHA 1D5VA 3BJOA 4NC8A 1ZKGA 3Q0UA 1VQLI 2O61A 1J7KA 4A3CJ 1QNTA 2JA5J 1TQPA 1LVAA 3VFZA 1I6XA 2O03A 4DNCA 2OC6A 1QHGA 1VNDA 2LK2A 2ZJQF 2XC7A 3PO3J 4MLOA 3LFUA 4BJ6C 5K5QA 3DBLB 4J19A 1UELB 3KP2A 5CVRA 5KHDA 1ZR4A 3S14J 4AC0A 1XMXA 4AIJA 3P9IA 1P4WA 3DF8A 3PNYA 3V8LA 1HXDA 4MEYF 1N75A 1UG0A 1V5GA 1BBYA 5D4RA 3J7AY 1MBJA 3N05A 4OIOF 1WI9A 1Y56A 2K9LA 3NARA 2BZTA 1MNEA 2ZXHA 1BM9A 1R5HA 2FMYA 5F1RA 3MVPA 2FX0A 1RNLA 4YFKF 5HVQC 1P92A 2ECCA 2IA2A 4HF2A 3W6VA 3FHZA 5JLXA 2A6TA 3PL8A 1B1BA 2MG4A 3QAHA 4F91B 5EEAA 2EBIA 2JA2A 4RAYA 2VBWA 3HZJA 2ISYA 3B02A 5HODA 5J4VA 4OWRB 3LSJA 3C1DA 5J40A 1ONVA 4AU7A 4IRHA 2F2EA 2Y48A 2F5VA 3MKLA 1YI2I 3CLQA 1VTNC 3HRSA 4E7HA 4BDYA 4XN3A 2IRFG 3I4MJ 2DQRA 5F1JA 1T6SA 1ETQA 1V5FA 1Y0UA 3JSOA 2DDBA 2R3SA 2RDPA 4J01A 3JRDA 1XSVA 2IEKA 3O8GA 1G59A 5C44J 2E2HJ 1RIOH 1PP8F 2XGCA 3RDIA 3KP5A 3TW7A 2JT1A 1P6RA 3KYLA 3ZQQA 2HTSA 3TO6A 3E5UA 2VE9A 2VT3A 4JX5A 2NVTJ 1VQ5I 2ZJ2A 3L00A 2V6CA 2V6EA 2TDXA 1K6YA 2BHZA 1E3PA 1TWCJ 3G4SI 3MQ0A 4HRIA 4UB6C 1OYIA 3S17J 2F48A 4AD9A 2DMQA 3RYPA 4BH9A 1O3QA 2CMPA 2B0LA 3RSNA 3R0AA 1PP7U 1IC8A 2A68F 2UUZA 3LSRA 2VE8A 5K5RA 1JUPA 4ZDOA 2VC0A 2YS9A 5CPRB 1WPKA 2XF5A 4NUBA 4BYYA 3IL2A 3BWGA 3CMMA 3SDBA 2M8GX 3GTMJ 5LEKA 5TISC 2BHYA 2EFOA 1LFBA 3CUOA 4H4KC 4ZC3A 3OL3A 2WB1N 3CO7C 3J7YJ 3AG4H 3LSPA 2GA1A 2ZXJA 1HW5A 1ZN2A 3H1CA 1BOAA 1QGPA 4HOBA 4RM2A 3VODA 3WU1B 2AO9A 1VQMI 1DU0A 1RPWA 2GOXB 3IH3A 1FBQA 3VYSB 2JPCA 3M7GA 1BC8C 2H1KA 5D5VB 2L5QA 1R58A 3HXLA 2WBMA 2HFHA 1B8IB 1YIOA 3COAC 1PJRA 1ENHA 4KMFA 2ZSIB 4HLXA 4MTDA 4QSHA 4G6TB 2QA4I 1G3WA 4G8XA 4LFUA 2OUMA 3GW2A 1ORKA 1IN6A 4LG3A 1ZG5A 1X1DA 2F5EA 4D0PA 1KU3A 2WA0A 2ZB9A 5HOOA 4KUMA 1NH3A 1V5EA 4IRGA 4XKBA 2FBHA 4HSTA 4RAGA 1BA5A 3RIRA 3T5XA 3RJPA 3TDZC 2QVOA 1Z7UA 4G94A 3QODA 4YFNF 5KVRA 5LHGA 1V4RA 4DYRA 4EATA 5LLQA 1R4MB 3OYLA 1FJLA 1HOMA 1WH7A 1MBKA 1ZRDA 3BG7A 2DTZA 4YIRX 3BZCA 3LAPA 2WAFA 3PSIA 5F6FA 1TL8A 3VYRB 2CV2A 3H5NA 4RB0A 4E7JA 1VFCA 3EQLF 1ZGJA 3W3CA 1JI8A 2WADA 4PSXA 2XSDC 1QRYA 4RLFA 4Q48A 4F52A 3OY9A 2P8TA 4AYBN 5IOYA 3KP7A 4KFCA 2KIQA 1F43A 3ZMDA 1ZRFA 4U87A 1LUJB 3NAUA 4U0YA 3JRBA 3DKYA 1ZTRA 4CCOA 4YIIA 1I5ZA 1SAXA 2PJRA 4U88A 3KYDB 3HBLA 4A3DJ 2KFDA 1W5SA 2B7EA 2NVYJ 3U21A 2VBZA 2D1VA 2LR8A 1OYYA 2FOKA 4CICA 4PCQA 2VLAA 1USTA 5EEHA 5KNLA 4U0VA 1REPC 1W1WE 2CFXA 3G1OA 3I59B 3CC7I 2MSYA 1S6LA 4N4NB 2DJIA 4EJOA 3I71A 3B73A 2FBIA 2LDUA 2HKXA 2YR2A 2HOTA 1ZRCA 2DMPA 3D1NI 3HPHA 5CQGA 2OTJI 2HZTA 2XGDA 3GZ6A 1ULYA 2XSJC 5IOZA 2R5ZB 1DPRA 4YIFA 3T0YA 2FXAA 5TRDA 3FWEA 3TL4X 3I58A 2K9NA 4PJJA 4BY7J 3HL2A 1TQMA 4DOZA 4M3EA 4F7ZA 2EPFA 3I59A 3WHBA 4OMZA 3KPHA 3IC7A 2ZC2A 4X6AJ 4A5MA 2NS8A 3IWZA 4XOPA 3FMRA 3QOEA 5LFAA 4NNJA 3BT9A 2L7ZA 5D5UB 4F93B 2KIFA 1IRGA 5E3MA 3QPLA 1ETKA 3HOZJ 4QPOA 2MYSA 2X4HA 3H3ZA 2IS4A 3I4PA 3SEQA 2QKMB 2YU9J 1B4AA 4XBFA 2VJ5A 3HKZA 2PEXA 3DFGA 2O3FA 4PGGA 4XSXF 1J9IA 2PX9A 2PG4A 3GCMA 2EFQA 4A0ZA 4Q4ZF 2VIXA 2DXIA 2M9HA 3VWBA 4BBSJ 3PUFA 4I01A 4CHUA 3LA3A 3L2QA 4Q47A 2CUZA 1BI0A 5EYRA 3OR2C 4LD5A 4HAMA 2X6YA 4G7OF 1A36A 2ZXWH 2KIUA 5D4SA 3LA7A 4W97A 4C2TA 1RUOA 2CSOA 4ZDLA 1UG2A 3ERMA 2JSPA 4BL0B 4FQGA 1OR7A 4XICA 3CCEI 4ZZDA 2QWWA 3QP5A 2GIVA 4WCGA 4HNVA 1ZG1A 4ZTFA 1KGSA 3OS1A 2HQRA 1IG7A 3BTCA 4Q5SF 2I5UA 4XKCA 2EIKH 5JHUA 3OYMA 4A3JJ 1WI3A 3GMEA 1MBEA 1TLHB 5IYBJ 3ZN1A 1WWXA 2WTEA 2KIMA 4N9IA 2CQNA 4N0BA 3LFKA 1YJ9I 4NC6A 3J81K 2O7OA 1P2FA 4RGXA 3LQQA 5M5XJ 3SYTA 4ZYHA 3HSRA 3OS2A 1T98A 2VKHA 3SXYA 1S3JA 2A6HF 1MSEC 2EFNA 1FSHA 1V54H 4XRFA 3H5RA 1PUEE 1B72B 1IV6A 4FT8A 5HLHA 3UKGA 4NHJA 1JTYA 2IA1A 1S5LC 4L9JA 2PI0A 1LB2A 4LLLA 2P6TA 2FMLA 3WTTC 2R7TA 1IUFA 1IDZA 4Y7NJ 1ODDA 1VI0A 1X4PA 4OAZA 1GV2A 2L4MA 3ECOA 5DTDA 1XDSA 2M7AA 4XMYA 3HTSB 1AWCA 2K5CA 4UV9A 4GYGA 3WTXC 3ZMSA 4J00A 3WTSC 1STZA 3BTLA 3FK7A 3MN2A 4M3DA 1QVUA 4PK4A 4XKVA 1FYLA 4LG0B 1IXRC 5E1XA 1KQ8A 4G7HF 2TRTA 3KP3A 5IT9K 2QYOA 4HW0A 3PUBA 2E2JJ 2E1MB 2KP6A 1OCZH 3HTUA 1USSA 1YS6A 4BS9A 3CMYA 1RI7A 5E17F 2NS0A 4X0GA 3Q9SA 4CCLA 2Q2EB 3ZQLA 1FMVA 1Q1VA 2R0QC 1BI2A 4CCJA 3BR0A 5C4JJ 3S3NA 3FX3A 2Z3YA 4HV6A 1BR2A 1U9OA 1BIBA 1YW9A 3KEYA 2BW3B 4LG0A 2V1UA 1W7PD 4RBOA 1NHAA 1DU6A 1BL0A 1W0UA 1T33A 2Q0OA 1SD5A 5FD6A 1EV7A 4HSRA 1YRNA 1R1TA 2XAQA 1EH6A 4L9VA 3U1KA 4EJWA 4B47A 4D7NA 2GWRA 4KA4A 4BJTA 4IOCF 4L5JA 2FBKA 1CGPA 2PJPA 4DZPA 1A6IA 2H6BA 2KRCA 3WTVC 2V1DA 4V2GA 3PSFA 2R7WA 2DMNA 5ICGA 1UMQA 4IJAA 1RZ4A 3UNGC 1QO0D 2EIJH 3WE3A 2OBPA 3GXOA 4ZH4F 4DQ2A 4B8XA 1JT6A 2BW3A 3DXJF 2L7KA 1O3TA 3JRHA 2VI6A 3ZQFA 3K70D 1FZPB 3GLXA 3TDUC 3OYHA 4GRIA 1D5YA 2E5NA 5FRMA 4F55A 4HF0A 3J80K 3V7SA 4NC7A 2OZUA 4A5NA 2X6WA 4C3HJ 3OIQA 2VN2A 1J2XA 3S1QJ 5EJCA 2K7LA 2IPQX 2R7QA 3K1MA 1TT0A 2HS5A 4HBLA 1YLFA 2HQ5A 4RGSA 4A69C 4AVZA 1MDMB 2ISZA 2CO5A 4M6XA 4D1QA 3BR1A 3QYFA 1IN4A 1IV8A 1DDNA 2LY9A 2X6XA 3E0JB 2DT6A 3PNTA 5E3LA 1Z3YA 1KONA 3MAJA 2COBA 2PFBA 4B43A 2P5VA 3GBGA 1VQ6I 1B9MA 4DW6A 3I5UA 3CZ6A 2R7XA 3QOPA 2QLZA 4XLNF 5E3NA 1UHWA 1DQUA 4XLFA 4P55A 3FXJA 3AG2H 1X1AA 1MDMA 3NQOA 4BE0A 3SZPA 2DOEA 2XVCA 5EEGA 2CQXA 4M9XA 2G9WA 1XGMA 3CJTB 3RPUD 2DFHA 2R4GA 4UUSB 1WJAA 2ZMEA 3JAMK 1OCOH 3BJ6A 2EA4A 1APLC 1W4MA 1DGWY 1XMKA 4XORA 4RMNA 1KYWA 4MGRA 5E8IA 1YHQI 3F8CA 3ECHA 2QQ9A 2ZCWA 2BEOA 4AIDA 2RREA 1P7IA 1MKMA 5KK1A 1AU7A 3ESWB 3X2QH 1MMGA 2X51A 3T1BA 1JKQC 4KIGA 3QYBA 3FISA 1Z67A 1TNTA 4KT5C 4IL6C 1JUSA 2PBIA 1ETYA 4RB1A 2D2WA 1O7FA 2BVMA 3V4GA 4UUSA 2MABA 3S2HJ 3AG1H 4I99C 3CCYA 3BR6A 3GUDA 4BEHB 2Y0MA 4HDUA 5C4XJ 2V9PA 1VQPI 3BQYA 4AIHA 4XIDA 2ID3A 3DQVC 3LAJA 2RN7A 2QQBA 3ONQA 3VSLA 4ITVA 2WWYA 3A01B 4HG2A 4RGRA 2BYVE 3ZR8X 4O3MA 1GVJA 2HR3A 3B6AA 1H89C 3QPHA 2HVRA 3W2WA 4HV5A 3HSEA 1OISA 2E35A 1R7JA 5L3EA 5JI6A 1S7OA 3S3OA 3BTJA 4BEHA 2LYCA 5BPDA 1XPXA 4ASNA 4D5CA 2Z5UA 2FJ1A 4IHTA 5J8CA 2QSFX 4Y15A 5B3SH 3CQZJ 3K1PA 3HOWJ 3RPQA 3EYIA 3ZQ7A 4D7MA 2K86A 4XN0A 1RESA 2BY3A 1FIAA 4CXFA 1HF0A 4A2UA 3K4KA 2RAEA 4RAZA 2DT5A 2RNJA 2GM4A 1SMYF 1GVDA 2VBXA 5EZHA 1G8XA 4RB3C 2UZKA 4PUSA 1F9NA 3KFWX 4L9TA 1V3FA 3AKZA 2CYYA 1R9TJ 1IRZA 3PFYA 2PMZN 1W7PA 2Z9OA 1U9NA 2ZJPF 2FD5A 3GZNB 1YFHA 1X2MA 1X1BA 3H92A 4AWXB 4L0YB 5F08A 1HC8A 3DKXA 5AIPA 1Z6RA 4IVNA 1BOBA 5FGMA 5IP9J 2L4AA 2X6OA 5IP7J 4MO7A 1D8JA 1XC5A 3GVAA 3H5AA 1RKTA 3WTZA 2IGNA 1X3WB 1WJCA 5GAEJ 2QCOA 1AKHA 2OV7A 3F22A 3H3UA 1KU7A 4R79A 3LQRA 3ZMVA 3C2GA 2VQCA 3IP4B 2A69F 3OYAA 1MBFA 1WFXA 4IQ4A 1EH7A 2DA5A 2ELKA 2J5OA 2IA0A 4D5FA 4QWQA 3DBHB 3S1NJ 3E6CC 2FF4A 2V79A 4KJZA 4BQAA 2Y69H 3C3WA 1MJ9A 2W48A 3PQJA 4N4OB 3I55I 2XRLA 2DN0A 1UFMA 4I76A 1EH8A 2IP2A 1AHDP 3D5SC 4LOCA 3WODF 3S2WA 2RC4A 3HC7A 3HOVJ 2CQ7A 1UJ8A 5GADJ 4F92B 2H8RA 3HG9A 3HDDA 2KMUA 3QPSA 4YRVA 3QU6A 2ZSHB 2R5YA 2H94A 3VDXA 5TGTA 2XAFA 4HNTA 3LOCA 4QLCU 3OYCA 3H9QA 3DU5A 2VPLA 2KL4A 3M07A 4M6YA 4BQOA 4FASD 2HZDA 5CLSA 5K5OA 3PFIA 2R7VA 2KLOA 4O5VA 4OINF 2BXZA 2L9VA 2ZFUA 1ZG3A 1X4OA 2KISA 1HKTA 3S3MA 3ROUA 2R7ZJ 2VUMJ 2KZVA 2I8DA 1TTYA 4A6DA 5D5WB 2XB5A 5HLIA 2DFFA 2M0MA 2QGUA 3CP2A 4HZFA 3TW6A 5HDGA 3CCSI 2GIZA 3G2BA 1D1AA 1R4NB 3CCRI 3OMYA 3DTKA 2LTPA 3IH2A 2VC1A 4IO9F 2V4JC 3ZQIA 1T8IA 3A1YA 3RPUA 2QENA 2P7VB 2LLKA 4K2EA 2HOEA 2CW0F 4E7KA 1IW7F 2BXYA 1AOYA 2XASA 1K61A 3ZPLA 3MKYB 1GLNA 1G2HA 4I0BA 4UVBA 1F5TA 1SAUA 5FD5A 2CUFA 1BR1A 4IQJA 2E1CA 4RDUA 2L01A 4HDVA 3CUQB 2KPMA 4XRMA 2VXDA 3MFKA 2O8KA 2X0LA 3A2KA 3RKQA 2F5CA 3GFJA 3S15J 5M3MJ 3NWSA 2M30A 1IN7A 1R1UA 3CMEI 1UCRA 1IXSB 1IN8A 2DFEA 3OYIA 1Y1WJ 4L0ZB 1D3YA 2I10A 2EV0A 3EUAA 5FLVA 4PFPA 2GLOA 2O9LA 3BC8A 2DU9A 2EZLA 3WG7H 2XB0X 1JE8A 2HNHA 1GUUA 5DM7F 3CUQA 4BHPA 3EUHA 3SZTA 4M9ZA 3MKWB 1Z9CA 4Y4RA 3MEXA 5D6FA 5K7HA 5J1YA 3ABUA 2DMUA 4E4HA 1MSFC 1SANA 3ASNH 1PYVA 1WVRA 4PFOA 3DTEA 4I98B 5E3OA 2VPRA 5JHFA 1ZARA 1MBGA 3TGNA 4BY1J 3U1DA 1TW3A 2HTJA 3KEQA 1P4XA 4LB6B 5FFZA 3GFMA 4BXXJ 2JTVA 2CU7A 2W85A 1X3ZB 3GWZA 2HQNA 4ENMA 5D6EA 1K78B 2GXBA 2AS5F 2LD5A 2PJRB 3AFHA 2HXOA 3RQIA 2HI3A 2DCEA 5DM6F 4WWCA 1RC9A 1X1PA 1P4AA 3R61A 1A04A 2IAIA 5IYCJ 3L1PA 5HNFA 2Z16A 1YS7A 2L54A 5FJ8J 2DA4A 3ZCOA 1Z91A 3FXUA 5HDNA 2GXGA 4A3MJ 3ISPA 3JREA 3ZQCA 1I3QJ 2WV0A 3FM5A 3GLLA 2K3FA 1KU2A 1IXCA 5KAFC 4U7DA 1XTAA 1VQOI 1MH4A 3BTIA 1P7JA 4CCMA 1T0FC 3TOAA 1K78A 3HJEA 4LGWA 4BE1A 1LFPA 2JA6J 1CF7B 2UWMA 5DCMA 4CH7A 3T8TA 2DA6A 1MNDA 4ABZA 2JQ7A 5H2FC 1JGSA 1LEBA 2P81A 1QU3A 3ASOH 5H20A 2XHKA 4WXDA 3GTJJ 2JA8J 4OIRF 1U3EM 2Y75A 3DPTA 5EF6A 3GZ5A 3RKXA 2KZGA 1UHMA 1ERDA 3G1LA 1SD7A 1OKRA 1LKXA 3ZMUA 2V1XA 3CDLA 3DCFA 2IXSA 1V55H 2DA3A 4BDZA 3S93A 3AAFA 4R1HA 1D0YA 2DK5A 1CF7A 4H0EA 1TBXA 5GAHJ 3I53A 3CF5F 2MC4A 2M34A 3BR3A 4NQWA 1LE8B 2WAQA 3G71I 1WJDA 1ZLJA 1QPMA 3LWFA 1IF1A 2K85A 1LNWA 2EFPA 5BMZA 1R1VA 4C2MJ 3LSKA 4CCKA 2LY1A 3WE2A 4EMSA 1HA8A 1OCRH 3G6EI 4YEJA 5B66C 1GHCA 2VB6A 4N9HA 5DCFA 1YG2A 4JX6A 3EUKL 5JVGF 5K7FA 1S72I 1KU9A 1OR7C 4I09A 1A31A 5IT9Z 2TCTA 1YW8A 3IAS2 5AONA 2X1EA 1LDDA 2VL8A 5DUKA 1FYKA 5D8LB 3LMMA 4YELA 1LE8A 4KIBA 1L0OC 3PIPF 3O3KA 1TW2A 1Z21A 4BBRJ 2P5LC 2QKLB 1TP4A 1ZLKA 2NOGA 3JCUC 2G0EA 1ETWA 2K9QA 3FF5A 4NBQA 4BXFA 4ANJA 3F8FA 4MHGA 1BJAA 1E3OC 1SC7A 4MIMA 1OCCH 1FC3A 3E7LA 4XSZF 5F0HA 2L02A 4XL9A 2D45A 4PGHA 1ON1A 3H35A 3OWTA 2HOAA 3P9CA 5D8KB 3M1CA 1O7LA 3FXLA 5DEQA 1JKRC 2CJJA 3ABKH 1OPCA 3QU3A 2BY2A 1X2NA 2ESHA 3MZHA 4IPAA 2E7WA 3HEFA 2Y2ZA 4EGZA 1MZBA 1UB9A 2L7MP 3PJRA 3KE2A 2NNNA 5CJ9A 2AQEA 1TZLA 2OTLI 2QSGX 4KN4X 1OCPA 4MFDA 3DWLE 3CLOA 3BLYA 4OIQF 2R7FA 3DKWA 4CYCA 2XUBA 4LITA 2LKXA 2FNPA 2IT0A 1GV5A 5F0FA 3K4LA 2MFZA 1X1CA 2K4JA 3HKZN 1F1ZA 3R6SA 3SDGA 3W6KB 3J80Z 3K0LA 4BE2A 5HLGA 3E6BA 3FK6A 2LNBA 2FOWA 3GEZA 3SJMA 4IOAF 5ICFA 2BV6A 3PM1A 2WC2A 3KZIC 4IRIA 2IS2A 4PJNA 4NB5A 2MBFA 1XSDA 3GX4X 4C2UA 3IWFA 4U0WA 3GYHX 2V26A 2EZKA 4UUVA 3T8RA 3LSMA 3OYNA 1J09A 1HW1A 2KHMA 4GFBA 3HRTA 2E1NA 1T38A 1IRFA 2E71A 5ILVA 3W6JB 4UVCA 2RKHA 5HS7A 2XV4S 3BG5A 2L0KA 3ZGKA 1Y1VJ 5LGUA 3V8KA 2OCEA 1ON2A 4CZCA 2BVLA 2E1MC 4BUPA 2VONA 2KDZA 1TC3C 3RTRA 2EIMH 1SFKA 2GOMA 2A5YB 1O3SA 3P5JA 1XMAA 2Y31A 1GDTA 2PQ8A 2ADUA 4HQMA 4BXUA 1VQ7I 1YRNB 2R92J 1IJWC 1FPQA 1WKMA 3U2RA 1IO2A 2PMHA 1VZ0A 5IY5H 4ZYGA 4L9NA 1AA7A 2CFOA 3DP7A 2BGCA 2A6EF 5ICEA 5M5WJ 3JAMZ 3I9V2 1ETVA 5HS9A 3I56I 2A07F 3BCBA 2VXZA 3GTKJ 1FBSA 3BZKA 2OZ6A 3Q0VA 3FDYA 2LVSA 1BR4A 2A5WA 2KKOA 2F6CA 3D5LA 5GPCA 1FOXA 3AG3H 4L18B 4XM3A 2DYSH 1MMAA 3JRCA 3H0DA 4KIFA 4EM1A 3FXQA 2VKEA 2QBYB 2DLLA 3GFLA 4B1RA 2Z1DA 2LKSA 1X3UA 1WZ2A 2OQGA 4Y13A 3W2VA 1U6GA 4WK8F 4EGYA 4IX7A 2UV1A 5GAGJ 2L7FP 2M3AA 4AUXA 1MNMC 1I50J 2HDDA 1TWGJ 2VKDA 3HGYA 1IZ1A 4JBAA 3HOYJ 2XROA 2ELJA 4JOMA 1FLIA 3F6OA 5KAIC 3WGIA 3CC4I 1JGGA 4O6JA 3DLAA 5FKLA 3U9GA 5LHHA 3EDPA 3OR1C 4KT6A 3TP0A 2QBYA 3TMOA 3HHGA 3JSPA 3D5RC 3HRMA 3F8MA 5HS8A 3HIFA 1R23A 3ELKA 4IHWA 2FQ3A 1X19A 2DQLA 3OIOA 5LRRA 2DK8A 5CKTA 5TJJA 4DBQA 4ENNA 1DUXC 1GXQA 2NXNB 2QM3A 3H9JA 2EILH 4CDGA 2M1BA 1POGA 1K79A 1QBJA 4FE4A 2LBFB 3REOA 3SZGA 4UHTA 3LSIA 3K4NA 3E97A 4BAYA 5GTHC 3M1EA 4XRSA 3HOUJ 2UXNA 4ETSA 1RKWA 1SFOJ 1JHFA 1FIPA 4LIVA 1HDDC 3S32A 5FB2A 2D5VA 1FEXA 2LY2A 2HPMA 5CQEA 3JRAA 2QSHX 1E3HA 5ILSA 2OPTA 2QQAA 4MNUA 4UY8I 2HDCA 2ZMEB 3S1MJ 3ABMH 5CYVA 2FA5A 1RETA 4KICA 3A0BC 2O8XA 3AL0C 1KQ0A 2LBFA 4IHXA 1YYVA 4E7IA 4XK4A 3SFIA 3F8BA 1ZQ3P 2G7UA 3F6VA 3CCQI 1QVTA 2EINH 1SFUA 3OSGA 3DEUA 1U5TB 2G7HA 2LMDA 3BG9A 3SQNA 2VQLA 3L2WA 3AL0B 2HVSA 1L3LA 1XG1A 2Y0SA 3BJAA 3RCOA 1ZYRF 2K3PA 4E70A 2R7UA 3FXRA 4E7SA 1B59A 2F4IA 2CGPA 1S29A 3A0HC 4M74A 2ELHA 1DPUA 4HLYA 1KZHA 2X9DA 1BJZA 2COMA 3OOUA 5LHIA 1WJ5A 4XLPF 2NRAC 2P0WA 4EJTA 1OFCX 2EWNA 3CCMI 3GTLJ 5ICCA 2O0YA 3KZYA 2IW5A 5CVJA 1U5TA 2CQQA 4HEA2 3V8JA 4BKXA 4R8HA 1A6QA 3I3LA 4GGGA 1D0ZA 1H9TA 1MBHA 2HXIA 4G6DA 4XLHA 5DUIA 5AIQA 3GFIA 2R7RA 1W36C 4XNFA 1LPQA 2LF7A 1S9HA 1XN7A 1FP2A 1ZHFA 3K4JA 5FO5A 5M5YJ 1JJ8C 4RM3A 2LF8A 5E1WA 5FLXK 1KQ9A 1TNSA 3BG3A 1G3TA 2JSCA 4XRSG 2X1DA 2FNAA 1QQIA 3L09A 2EH3A 4FX0A 4W1UA 1EKEA 3VB2A 3R60A 2XKPA 4GO1A 4A6EA 3M8JA 4XONA 2IGOA 2M8EA 4KN7X 5L3DA 3L2VA 2DDAA 4P9UA 4A3FJ 4Y17A 5CVUA 4F3QA 1WJBA 1XSXA 3WTWC 1YE9A 4DBRA 2DPUA 1WSUA 2BBYA 2FRHA 4LJZF 3EYYA 3DTIA 2LKPA 2W57A 3FHNA 3V7CA 1HW2A 1R00A 3HOTA 4FISA 3NEUA 2OU2A 3CJNA 4GCVA 2AHQA 1SD4A 1R49A 4KISA 2VJJA 1GT0C 1W7PB 2JRTA 4Z2YA 3CD6I 3SHFA 5FKKA 2ID6A 4PJ0C 1WHUA 3KX2A 3M8EA 3E3VA 3PQKA 2OAZA 1QPIA 3IHUA 4LLGF 4C3JJ 4NDLA 2IVMA 3C7JA 1YIJI 4Z6YA 2WY7Q 3CJRB 2NS7A 5LD2C 3K9TA 1W5CC 4JQFA 4A3BJ 1WCMJ 1LVKA 3K10A 2ZNYA 4LIUA 1YO5C 1SVLA 3CDIA 5IYDJ 1H0MA 3CDHA 2NNYA 4C3IJ 4D9JA 1YITI 1QZYA 2BE5F 2P7CB 1MMNA 1FWZA 2JZYA 3CCJI 1K7AA 1AKHB 1I3AA 2M87A 3FXMA 1N78A 3N4MA 2LFBA 1SMTA 3C2HA 2F5FA 5B1BH 4XKWA 1Z6TA 3Q0WA 3C2BA 5K1YA 2P4WA 3LSTA 5EG0A 1QZZA 4WF2A 3HPGA 2LP0A 2E36A 2RNGA 1MMDA 2JRMA 2M2EA 4A0XA 1XCVA 2HKOA 2DA7A 2CH0A 2O5RA 1K4TA 4A3GJ 2B9SA 1QA6A 2GXAA 4JX4A 1I6HJ 4IHSA 2M5WA 3KZZA 1J75A 1BC7C 2HYJA 5HDKA 1XDUA 2DI3A 1LEAA 2HWVA 2Q1ZB 4DJAA 1YX5A 5E79C 1FX7A 4BHBA 1A5JA 1E17A 1OYWA 2W1OA 2R5YB 4IHVA 5CVVA 2JUGA 2JK3A 1EF4A 1YX3A 3E6MA 1H8AC 1XGSA 4V19K 2XRNA 2NVXJ 3DPLC 2EQRA 4A12A 4G6QA 3K2ZA 4UUTA 1ZGWA 1CQTA 3WGGA 2EA2A 3WG9A 2MC3A 3TEDA 5FRNA 1A35A 2JUCA 2MGQA 3A4CA 2D1HA 1HBXG 2KT0A 5DD4A 3TP3A 2XDVA 1RR8C 3KLNA 1Y6IA 3JTGA 3N97A 2ECBA 1J5YA 5D5XB 2DJNA 3K69A 1XB4A 1SD6A 1UAAA 1KYZA 1BI3A 2DFIA 3SEZA 4LK1F 1FT9A 1T08B 1IRXA 1MD0A 1T39A 4P9FA 2MD0A 5J8FA 4I7HA 3V7RA 4I0AA 3KEOA 4UXNA 1EJ9A 3J7AO 2FEZA 5BS6A 2R7OA 1HCRA 3CJQB 4E6KG 3OV8A 2EB7A 3MZYA 1TWHJ 2OF7A 3EPZA 3PIOF 1LQ1A 3OYGA 2H6CA 4LMYA 1NK2P 2DBBA 5E20A 3GF2A 2DODA 2E2IJ 1JTXA 4WXHA 2LRDA 3A03A 3FBNB 2MLGA 2F4MB 3HHHA 2HVQA 5FKMA 3P9KA 4EQQA 1ZR2A 1E0EA 2KRFA 2LH9A 3BDDA 1ZK8A 1MH3A 2M45A 1XD7A 2R7DA 2L3DA 2BOLA 3LA2A 1S7AA 2K40A 2R93J 2WB1A 3K1NA 3KETA 2E34A 2KJCA 1FYMA 4IKFA 2HEOA 1I39A 3WGHA 1YJNI 1QHHD 1ZGAA 1WJEA 3CUQC 1XX5A 2CS3A 3EUHC 1VF9A 3BY6A 2CUEA 2GAUA 4B09A 1IUYA 3KLOA 2Q8KA 2N8GA 5A2QK 2HYFA 2P5KA 2IGKA 4WXCA 3HM5A 1JUMA 4AVPA 2WV1A 3IV5A 1I27A 3JW4A 3K4MA 2JJ7A 1Q1HA 4XLAA 2ETHA 3H9GA 1IGNA 3O6BB 2XIGA 2XAUA 1T95A 3WHCA 4BU2A 4C9YA 1JHHA 4EEFG 4RS8A 2XF6A 3E5QA 1R22A 4ZDPA 3ML6A 3KYCB 4JK1X 5BNGA 3QYEA 2LSOA 3FXKA 2ME6A 1U78A 4S05A 2NYXA 2E19A 2JPBA 3QPTA 2FUG2 1BW6A 3BR2A 1LJ9A 3SFZA 4CYDA 4DGWB 1MMSA 2VJ4A 2ZXIA 3F23A 3BZ6A 3RYRA 1P9QC 3ZP5A 1FOKA 3HOSA 3MKZA 1D1CA 1U8BA 1F4KA 2E5ZA 4Y52J 2FQ4A 3CO6C 1S8NA 4BJ5C 4KITB 1HKQA 3G73A 1B9NA 2PLYA 2IS1A 4PJMA 1J59A 3KCCA 3L9FA 3OYKA 4EM0B 4P5OA 3I0TA 2C6YA 2CUJA 2PMUA 4AYBA 2DOAA 4M6VA 5GTIC 3W2AA 3ZXSA 3FMSA 3RZDJ 3JRGA 4TV7A 1WJFA 2W84A 4RGUA 5H6RA 3TOBA 4ZTJA 1U0JA 2QZ8A 4BQQA 4HPQA 2KJBA 1XGNA 4FCYA 2JVHA 3BPXA 3R0JA 1KA8A 1SFXA 2LC2A 4IHYA 2LG4A 5DCMB 3FZVA 2HYGD 2ZNZA 3GTPJ 1N25A 4I02A 4UB8C 5L3CA 3I4NJ 5BQTA 4DIQA 4ZZLA 3TKYA 3DPUA 3DEWA 5FKNA 1B8IA 2KQRA 2DPDA 1U2WA 2AXTC 2K27A 4CCNA 2GBYA 3S16J 1H88C 4MTEA 2RQPA 1MJBA 2EJRA 2W4SA 2JN6A 1PUFB 5B5EC 3VYUB 3BG6A 1WQ2A 3OOPA 5IT3A 4U7BA 1OJLA 2O6GE 1ZAOA 2DA1A 3Q3SA 1FP1D 2MH2A 2EV5A 4QPQA 3OYFA 2HPIA 2M4GA 4M3FA 4C30A 1HLVA 4NQWB 4LLNA 2IGMA 3JRIA 2STWA 5L3GA 4IXAA 3RQ4A 2DA2A 1XCBA 4ESJA 1XS9A 4B3XA 4M9SA 3CP8A 3ERED 3J81Z 3Q9VA 3I64A 1FMWA 1PUFA 3S8PA 5JFRA 5FLMJ 1W5TA 4LK0F 3VOEA 1ACIA 3CF2A 1FTTA 2W00A 2ZJRF 4CO8A 2CRGA 3QQAA 5EZGA 2CW7A 4ZYDA 2XGEA 4FTHA 2H8WA 4S0HB 4L5EA 2YPRA 3L2CA 2ZO4A 3S1RJ 1NG7A 2VT2A 3PNVA 3QP6A 2L9SA 5EGOB 5DD8A 1Z7LA 5J4YA 2BY1A 1UHSA 3IKTA 3FKJA 4A3IJ 1Z05A 1GXPA 2NOJB 1DGRM 2L2OA 1H9GA 1FOWA 4GXOA 5J1RA 3ZRGA 1VQNI 1T0FA 2OD5A 5LRSA 4EVIA 2MLKA 3ZN0A 4FHTA 5LGNA 4A3KJ 5BOXA 3VSKA 4MQVA 2K4BA 2MD5A 3DLLF 4G9YA 5EGOA 3D0SA 2OQRA 3RKWA 4V2FA 2WY8Q 5H6QA 4P96A 2Z99A 5JR3A 4CYCB 4HX4A 1YW7A 2QF7A 3GTGJ 1YOVB 3NWTA 3HB9A 2R5ZA 4A3EJ 5ILUA 3KP4A 2F4OB 2WAQN 2VASA 4BGDA 5LBQA 4RAFA 1VQ8I 1TQIA 4CA0A 2H27A 3ZQGA 4DZJA 1D1BA 3F3XA 3TO9A 2XAGA 2JVGA 2W82A 3K4CA 2YX4A 1NTCA 1FTZA 1WH5A 2DYRH 2M0CA 4Y33A 2GA2A 3Q5FA 3QWLA 2UXXA 4XR6A 5L3BA 2QQ8A 3S2DJ 1HQCA 3TO7A 4ESFA 3OIPA 2XPUA 5K7ZA 5E18F 2MW8A 2WAEA 3JTHA 3R4KA 3PO2J 2VJIA 3LSGA 4KDPA 1OQYA 3WU0A 3M3YJ 5M3FJ 3FM3A 3ZMZA 3OYDA 2EK5A 2X85A 3TBIA 3MZ8A 4WX9A 1C0WA 2HGCA 3OSFA 1T56A 3BCAA 3GTQJ 5F0CA 4HF1A 4GDFA 2FU4A 4E7ZA 4DYCA 4QTRA 1YQAA 5J47A 1W0TA 1E2XA 1PVEA 1G6NA 3C18A 4A0YA 3HGGA 1RRJA 1FY7A 4BHCA 1LFUP 4XLCA 2P6SA 4FX4A 2Y30A 3P7NA 4G7ZF 1WGXA 1OLTA 3VEPA 4KNYA 3H0GJ 2YUSA 3HRUA 1R5ID 4OOIA 2XF7A 4B44A 1TWAJ 3IRQA 3KP6A 1Y39A 2YX7A 3IH4A 1RUNA 4LB5A 2YSRA 4HA8A 3RI4A 3H36A 2LOOA 4MQ9F 4CUGA 5IP6A 2V7FA 2A3SA 1Z77A 2HDWA 3FXOA 2X1CA 4RA2A 3TQNA 1D8KA 5GP9A 1FOYA 2M7BA 4ZJZA 5C3EJ 2STTA 2V1NA
chains in the Genus database with same CATH topology
4M3GA 4JYKA 3ZOBA 3HBLA 4A3DJ 1JJ6C 5M5YJ 2NVYJ 1JJ8C 3M4OJ 2LR8A 3BG3A 2R7ZJ 2VUMJ 4XRSG 3G1OA 2XB5A 1JT0A 2MSYA 3TW6A 3LNQA 2EH3A 4W1UA 4I6ZA 2LTPA 2XPVA 3IH2A 1B72A 2K9SA 3ZQIA 3ZQHA 4A3FJ 4B3AA 2HOTA 1Z0XA 2DMPA 1ETXA 4QIWN 3D1NI 2LLKA 2XGDA 1ETOA 5IOZA 2R5ZB 1HDPA 2K9NA 1K61A 4BY7J 4M3EA 3WHBA 1G2HA 4FISA 1TWFJ 1BW5A 1RR7A 2CUFA 1K83J 2AHQA 4X6AJ 1GT0C 2NS8A 3A02A 4M3BA 5GPAA 4RDUA 5FKKA 2ID6A 4XRMA 4A93J 2X48A 2O8KA 1QPIA 3BT9A 2L7ZA 3RKQA 4C3JJ 3S15J 5M3MJ 5E3MA 4NDLA 3QPLA 3K2AA 1ETKA 3HOZJ 2NS7A 3F0CA 2YU9J 2HOSA 4A3BJ 1WCMJ 2VKVA 5J3LA 1Y1WJ 5IYDJ 3JRFA 2I10A 4C3IJ 5FLVA 3JR9A 2M9HA 3O8HA 4JP0A 2JWTA 2GLOA 2O9LA 4A3LJ 4BBSJ 2EZLA 1AKHB 2XB0X 2LFBA 1ITYA 1GUUA 3Q0WA 5EYRA 3C2BA 5EG0A 5K7HA 5J1YA 2LP0A 2DMUA 1MSFC 1SANA 3G1MA 2M2EA 2DA7A 4W97A 4A3GJ 4MFEA 3GTOJ 4JX4A 5E3OA 2VPRA 2NVQJ 1I6HJ 1UG2A 2HYJA 1MBGA 4XICA 4BY1J 1A5JA 2EZIA 4HNVA 2R5YB 4IHVA 4BXXJ 2CU7A 2JK3A 1EF4A 1H8AC 2E1OA 4B4CA 1IG7A 2NVXJ 3BTCA 2EQRA 2B63J 4A3JJ 4UUTA 1WI3A 5FKOA 1ZGWA 1CQTA 1MBEA 5IYBJ 3TEDA 2LD5A 3RQIA 2HXOA 2HI3A 2MGQA 5IYCJ 3L1PA 2IAIA 5FJ8J 1JKPC 2DA4A 2KT0A 2JA7J 3TP3A 2O7OA 4A3MJ 2ECBA 5M5XJ 1NK3P 2DJNA 3JREA 3ZQCA 1I3QJ 1MSEC 5EDNA 3RZOJ 1B72B 1MH4A 1F36A 3BTIA 1P7JA 5DS9A 3UKGA 1IV6A 1JTYA 9ANTA 1IUFA 3FKIJ 1IDZA 4Y7NJ 2JA6J 2XPWA 4DYQA 1VI0A 2DA6A 1GV2A 1HCRA 4ABZA 5DTDA 2Y9ZA 2P81A 1TWHJ 2OF7A 3BR5A 3GTJJ 2JMWA 1NK2P 2JA8J 5EF6A 2E2IJ 1JTXA 3MN2A 3A03A 3BTLA 3FK7A 1QVUA 4M3DA 3G1LA 5FKMA 3K7AJ 2TRTA 1ZR2A 2Y9YA 3DCFA 3CDLA 1ZK8A 2Y0SN 1MH3A 2E2JJ 2DA3A 2K40A 2R93J 3CMYA 2L9RA 3VPRA 3BR3A 2M34A 1LE8B 3ZQLA 1Q1VA 3FIWA 1IDYA 4FE7A 2R0QC 3BR0A 5JLWA 1VF9A 5C4JJ 2CUEA 1U9OA 4X1EA 2N8GA 4C2MJ 4RBOA 3HM5A 1JUMA 1DU6A 2WV1A 1BL0A 3IV5A 1W0UA 1T33A 5J1UA 4JX6A 5K7FA 5IPAA 1YRNA 2JJ7A 5F27A 1IGNA 4IEJA 5EG0B 4D7NA 2TCTA 4G12A 3BQZA 5F04A 3WHCA 3HOXJ 4EEFG 1JKOC 4DZPA 1A6IA 1LE8A 4V2GA 1X58A 2DMNA 1O4XA 1UMQA 5BNGA 1U78A 2ME6A 4BBRJ 2NOGA 3H3VK 2E19A 1JT6A 2G0EA 1BW6A 3BR2A 1ETWA 2K9QA 3A01A 3JRHA 2VI6A 3ZQFA 1E3OC 1OCTC 2ME0A 4MIMA 5F0HA 1S7EA 3E7LA 1D5YA 2DMTA 3B6CA 2IBDA 2HOAA 1U8BA 4C3HJ 4Y52J 2EZHA 2CJJA 2FQ4A 1JKRC 1ZKGA 3Q0UA 1X2NA 4A3CJ 3S1QJ 3HEFA 2Y2ZA 2JA5J 2L7MP 2LK2A 1VNDA 3PO3J 2HQ5A 1OCPA 4MLOA 4MFDA 4J19A 4A69C 4M6VA 3RZDJ 3JRGA 3BR1A 4CYCA 1ZR4A 3S14J 4AC0A 2LKXA 4FCYA 1GV5A 5F0FA 2LY9A 3HKZN 3SDGA 1MBJA 5E3LA 4IHYA 3NARA 2COBA 3GTPJ 3FK6A 3GBGA 3I4NJ 3MVPA 4DW6A 3DEWA 2FX0A 5FKNA 3SJMA 1B8IA 2ECCA 3PM1A 5E3NA 3W6VA 2GBYA 5JLXA 3S16J 2MG4A 5EEAA 1H88C 2EBIA 2EZKA 2CQXA 2JN6A 1PUFB 5HODA 4GFBA 3LSJA 4UUSB 1OJLA 2DA1A 3Q3SA 1APLC 4M3FA 3BG5A 2L0KA 3MKLA 1HLVA 3JRIA 1Y1VJ 1AU7A 1P7IA 2DA2A 3I4MJ 5F1JA 1XS9A 1ETQA 2KDZA 1JKQC 1TC3C 3FISA 2Y31A 3JRDA 1GDTA 2IEKA 3O8GA 1JUSA 1PUFA 1ETYA 1YRNB 2R92J 5C44J 2E2HJ 5FLMJ 1IJWC 4UUSA 3S2HJ 2XGCA 1FTTA 3CCYA 3BR6A 5M5WJ 3TW7A 2CRGA 5C4XJ 3QQAA 5EZGA 1ETVA 3GTKJ 3BQYA 2XGEA 4JX5A 2NVTJ 4XIDA 2ID3A 3Q0VA 4FTHA 4S0HB 2LVSA 4L5EA 5GPCA 3S1RJ 1TWCJ 3A01B 5EGOB 3JRCA 3B6AA 1H89C 3S17J 1UHSA 2DMQA 2VKEA 4A3IJ 4B1RA 1IC8A 3LSRA 3BTJA 1JUPA 5J1RA 2L7FP 4AUXA 1MNMC 4D5CA 1I50J 2FJ1A 1TWGJ 2HDDA 3HGYA 3CQZJ 3HOYJ 2YS9A 4A3KJ 1WPKA 3HOWJ 4D7MA 1RESA 1FIAA 1HF0A 2M8GX 1JGGA 3GTMJ 5EGOA 2RAEA 5FKLA 1LFBA 4V2FA 2GM4A 1GVDA 3TP0A 4CYCB 2WB1N 5EZHA 2QF7A 3GTGJ 3LSPA 4IHWA 3HB9A 2R5ZA 4A3EJ 3OIOA 2AO9A 2WAQN 1DU0A 1RPWA 3IH3A 2H1KA 3ZQGA 4DZJA 1R9TJ 1POGA 4FE4A 1IRZA 1FTZA 1NTCA 2PMZN 1B8IB 1WH5A 2M0CA 1U9NA 1ENHA 2FD5A 4QSHA 3S2DJ 4XRSA 2XPUA 5K7ZA 3HOUJ 1RKWA 1X2MA 1FIPA 1SFOJ 1HDDC 2MW8A 2D5VA 3PO2J 1FEXA 5F08A 3JRAA 5IP9J 3LSGA 2OPTA 2X6OA 1ORKA 5IP7J 4MO7A 3M3YJ 3S1MJ 5M3FJ 2ZB9A 1XC5A 1RKTA 1RETA 3OSFA 1T56A 3GTQJ 5F0CA 2QCOA 4IHXA 1AKHA 1BA5A 4XK4A 3SFIA 4DYCA 4QTRA 1ZQ3P 1W0TA 1QVTA 3OSGA 1MBFA 2DA5A 2ELKA 3HGGA 4D5FA 3S1NJ 3BG9A 1LFUP 4DYRA 1XG1A 2W48A 2Y30A 2XRLA 1FJLA 1WH7A 1MBKA 1WGXA 2DN0A 1HOMA 2DTZA 4I76A 3H0GJ 2YUSA 1AHDP 1VFCA 1TWAJ 4LOCA 3IH4A 3HOVJ 2XSDC 1QRYA 2X9DA 2H8RA 3HDDA 1BJZA 3OOUA 3QPSA 4AYBN 5IOYA 2R5YA 1OFCX 5IP6A 1F43A 3GTLJ 3LOCA 1Z77A 3NAUA 2CQQA 3JRBA 4BKXA 1ZTRA 5GP9A 5C3EJ 1MBHA 2HXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3G A;  4JYK A;  3ZOB A;  3HBL A;  4A3D J;  1JJ6 C;  5M5Y J;  2NVY J;  1JJ8 C;  3M4O J;  2LR8 A;  3BG3 A;  2R7Z J;  2VUM J;  4XRS G;  3G1O A;  2XB5 A;  1JT0 A;  2MSY A;  3TW6 A;  3LNQ A;  2EH3 A;  4W1U A;  4I6Z A;  2LTP A;  2XPV A;  3IH2 A;  1B72 A;  2K9S A;  3ZQI A;  3ZQH A;  4A3F J;  4B3A A;  2HOT A;  1Z0X A;  2DMP A;  1ETX A;  4QIW N;  3D1N I;  2LLK A;  2XGD A;  1ETO A;  5IOZ A;  2R5Z B;  1HDP A;  2K9N A;  1K61 A;  4BY7 J;  4M3E A;  3WHB A;  1G2H A;  4FIS A;  1TWF J;  1BW5 A;  1RR7 A;  2CUF A;  1K83 J;  2AHQ A;  4X6A J;  1GT0 C;  2NS8 A;  3A02 A;  4M3B A;  5GPA A;  4RDU A;  5FKK A;  2ID6 A;  4XRM A;  4A93 J;  2X48 A;  2O8K A;  1QPI A;  3BT9 A;  2L7Z A;  3RKQ A;  4C3J J;  3S15 J;  5M3M J;  5E3M A;  4NDL A;  3QPL A;  3K2A A;  1ETK A;  3HOZ J;  2NS7 A;  3F0C A;  2YU9 J;  2HOS A;  4A3B J;  1WCM J;  2VKV A;  5J3L A;  1Y1W J;  5IYD J;  3JRF A;  2I10 A;  4C3I J;  5FLV A;  3JR9 A;  2M9H A;  3O8H A;  4JP0 A;  2JWT A;  2GLO A;  2O9L A;  4A3L J;  4BBS J;  2EZL A;  1AKH B;  2XB0 X;  2LFB A;  1ITY A;  1GUU A;  3Q0W A;  5EYR A;  3C2B A;  5EG0 A;  5K7H A;  5J1Y A;  2LP0 A;  2DMU A;  1MSF C;  1SAN A;  3G1M A;  2M2E A;  2DA7 A;  4W97 A;  4A3G J;  4MFE A;  3GTO J;  4JX4 A;  5E3O A;  2VPR A;  2NVQ J;  1I6H J;  1UG2 A;  2HYJ A;  1MBG A;  4XIC A;  4BY1 J;  1A5J A;  2EZI A;  4HNV A;  2R5Y B;  4IHV A;  4BXX J;  2CU7 A;  2JK3 A;  1EF4 A;  1H8A C;  2E1O A;  4B4C A;  1IG7 A;  2NVX J;  3BTC A;  2EQR A;  2B63 J;  4A3J J;  4UUT A;  1WI3 A;  5FKO A;  1ZGW A;  1CQT A;  1MBE A;  5IYB J;  3TED A;  2LD5 A;  3RQI A;  2HXO A;  2HI3 A;  2MGQ A;  5IYC J;  3L1P A;  2IAI A;  5FJ8 J;  1JKP C;  2DA4 A;  2KT0 A;  2JA7 J;  3TP3 A;  2O7O A;  4A3M J;  2ECB A;  5M5X J;  1NK3 P;  2DJN A;  3JRE A;  3ZQC A;  1I3Q J;  1MSE C;  5EDN A;  3RZO J;  1B72 B;  1MH4 A;  1F36 A;  3BTI A;  1P7J A;  5DS9 A;  3UKG A;  1IV6 A;  1JTY A;  9ANT A;  1IUF A;  3FKI J;  1IDZ A;  4Y7N J;  2JA6 J;  2XPW A;  4DYQ A;  1VI0 A;  2DA6 A;  1GV2 A;  1HCR A;  4ABZ A;  5DTD A;  2Y9Z A;  2P81 A;  1TWH J;  2OF7 A;  3BR5 A;  3GTJ J;  2JMW A;  1NK2 P;  2JA8 J;  5EF6 A;  2E2I J;  1JTX A;  3MN2 A;  3A03 A;  3BTL A;  3FK7 A;  1QVU A;  4M3D A;  3G1L A;  5FKM A;  3K7A J;  2TRT A;  1ZR2 A;  2Y9Y A;  3DCF A;  3CDL A;  1ZK8 A;  2Y0S N;  1MH3 A;  2E2J J;  2DA3 A;  2K40 A;  2R93 J;  3CMY A;  2L9R A;  3VPR A;  3BR3 A;  2M34 A;  1LE8 B;  3ZQL A;  1Q1V A;  3FIW A;  1IDY A;  4FE7 A;  2R0Q C;  3BR0 A;  5JLW A;  1VF9 A;  5C4J J;  2CUE A;  1U9O A;  4X1E A;  2N8G A;  4C2M J;  4RBO A;  3HM5 A;  1JUM A;  1DU6 A;  2WV1 A;  1BL0 A;  3IV5 A;  1W0U A;  1T33 A;  5J1U A;  4JX6 A;  5K7F A;  5IPA A;  1YRN A;  2JJ7 A;  5F27 A;  1IGN A;  4IEJ A;  5EG0 B;  4D7N A;  2TCT A;  4G12 A;  3BQZ A;  5F04 A;  3WHC A;  3HOX J;  4EEF G;  1JKO C;  4DZP A;  1A6I A;  1LE8 A;  4V2G A;  1X58 A;  2DMN A;  1O4X A;  1UMQ A;  5BNG A;  1U78 A;  2ME6 A;  4BBR J;  2NOG A;  3H3V K;  2E19 A;  1JT6 A;  2G0E A;  1BW6 A;  3BR2 A;  1ETW A;  2K9Q A;  3A01 A;  3JRH A;  2VI6 A;  3ZQF A;  1E3O C;  1OCT C;  2ME0 A;  4MIM A;  5F0H A;  1S7E A;  3E7L A;  1D5Y A;  2DMT A;  3B6C A;  2IBD A;  2HOA A;  1U8B A;  4C3H J;  4Y52 J;  2EZH A;  2CJJ A;  2FQ4 A;  1JKR C;  1ZKG A;  3Q0U A;  1X2N A;  4A3C J;  3S1Q J;  3HEF A;  2Y2Z A;  2JA5 J;  2L7M P;  2LK2 A;  1VND A;  3PO3 J;  2HQ5 A;  1OCP A;  4MLO A;  4MFD A;  4J19 A;  4A69 C;  4M6V A;  3RZD J;  3JRG A;  3BR1 A;  4CYC A;  1ZR4 A;  3S14 J;  4AC0 A;  2LKX A;  4FCY A;  1GV5 A;  5F0F A;  2LY9 A;  3HKZ N;  3SDG A;  1MBJ A;  5E3L A;  4IHY A;  3NAR A;  2COB A;  3GTP J;  3FK6 A;  3GBG A;  3I4N J;  3MVP A;  4DW6 A;  3DEW A;  2FX0 A;  5FKN A;  3SJM A;  1B8I A;  2ECC A;  3PM1 A;  5E3N A;  3W6V A;  2GBY A;  5JLX A;  3S16 J;  2MG4 A;  5EEA A;  1H88 C;  2EBI A;  2EZK A;  2CQX A;  2JN6 A;  1PUF B;  5HOD A;  4GFB A;  3LSJ A;  4UUS B;  1OJL A;  2DA1 A;  3Q3S A;  1APL C;  4M3F A;  3BG5 A;  2L0K A;  3MKL A;  1HLV A;  3JRI A;  1Y1V J;  1AU7 A;  1P7I A;  2DA2 A;  3I4M J;  5F1J A;  1XS9 A;  1ETQ A;  2KDZ A;  1JKQ C;  1TC3 C;  3FIS A;  2Y31 A;  3JRD A;  1GDT A;  2IEK A;  3O8G A;  1JUS A;  1PUF A;  1ETY A;  1YRN B;  2R92 J;  5C44 J;  2E2H J;  5FLM J;  1IJW C;  4UUS A;  3S2H J;  2XGC A;  1FTT A;  3CCY A;  3BR6 A;  5M5W J;  3TW7 A;  2CRG A;  5C4X J;  3QQA A;  5EZG A;  1ETV A;  3GTK J;  3BQY A;  2XGE A;  4JX5 A;  2NVT J;  4XID A;  2ID3 A;  3Q0V A;  4FTH A;  4S0H B;  2LVS A;  4L5E A;  5GPC A;  3S1R J;  1TWC J;  3A01 B;  5EGO B;  3JRC A;  3B6A A;  1H89 C;  3S17 J;  1UHS A;  2DMQ A;  2VKE A;  4A3I J;  4B1R A;  1IC8 A;  3LSR A;  3BTJ A;  1JUP A;  5J1R A;  2L7F P;  4AUX A;  1MNM C;  4D5C A;  1I50 J;  2FJ1 A;  1TWG J;  2HDD A;  3HGY A;  3CQZ J;  3HOY J;  2YS9 A;  4A3K J;  1WPK A;  3HOW J;  4D7M A;  1RES A;  1FIA A;  1HF0 A;  2M8G X;  1JGG A;  3GTM J;  5EGO A;  2RAE A;  5FKL A;  1LFB A;  4V2F A;  2GM4 A;  1GVD A;  3TP0 A;  4CYC B;  2WB1 N;  5EZH A;  2QF7 A;  3GTG J;  3LSP A;  4IHW A;  3HB9 A;  2R5Z A;  4A3E J;  3OIO A;  2AO9 A;  2WAQ N;  1DU0 A;  1RPW A;  3IH3 A;  2H1K A;  3ZQG A;  4DZJ A;  1R9T J;  1POG A;  4FE4 A;  1IRZ A;  1FTZ A;  1NTC A;  2PMZ N;  1B8I B;  1WH5 A;  2M0C A;  1U9N A;  1ENH A;  2FD5 A;  4QSH A;  3S2D J;  4XRS A;  2XPU A;  5K7Z A;  3HOU J;  1RKW A;  1X2M A;  1FIP A;  1SFO J;  1HDD C;  2MW8 A;  2D5V A;  3PO2 J;  1FEX A;  5F08 A;  3JRA A;  5IP9 J;  3LSG A;  2OPT A;  2X6O A;  1ORK A;  5IP7 J;  4MO7 A;  3M3Y J;  3S1M J;  5M3F J;  2ZB9 A;  1XC5 A;  1RKT A;  1RET A;  3OSF A;  1T56 A;  3GTQ J;  5F0C A;  2QCO A;  4IHX A;  1AKH A;  1BA5 A;  4XK4 A;  3SFI A;  4DYC A;  4QTR A;  1ZQ3 P;  1W0T A;  1QVT A;  3OSG A;  1MBF A;  2DA5 A;  2ELK A;  3HGG A;  4D5F A;  3S1N J;  3BG9 A;  1LFU P;  4DYR A;  1XG1 A;  2W48 A;  2Y30 A;  2XRL A;  1FJL A;  1WH7 A;  1MBK A;  1WGX A;  2DN0 A;  1HOM A;  2DTZ A;  4I76 A;  3H0G J;  2YUS A;  1AHD P;  1VFC A;  1TWA J;  4LOC A;  3IH4 A;  3HOV J;  2XSD C;  1QRY A;  2X9D A;  2H8R A;  3HDD A;  1BJZ A;  3OOU A;  3QPS A;  4AYB N;  5IOY A;  2R5Y A;  1OFC X;  5IP6 A;  1F43 A;  3GTL J;  3LOC A;  1Z77 A;  3NAU A;  2CQQ A;  3JRB A;  4BKX A;  1ZTR A;  5GP9 A;  5C3E J;  1MBH A;  2HXI A; 
#chains in the Genus database with same CATH topology
 1OMI A;  4M3G A;  4JYK A;  4XLE A;  3ZOB A;  4UV8 A;  2EFW A;  3CCU I;  1JJ6 C;  1PDN C;  4IZZ A;  4II3 A;  3M4O J;  2GZW A;  1W36 D;  2OJE D;  1JT0 A;  5E8G A;  3LNQ A;  4I2O A;  1HST A;  1Z3X A;  3IAM 2;  4I6Z A;  4CGZ A;  2DW4 A;  3DU6 A;  3FMQ A;  2XPV A;  1B72 A;  2GQQ A;  2K9S A;  4M72 A;  3E1S A;  3V42 A;  3ZQH A;  1YTY A;  5HLT A;  5E1Z B;  4B3A A;  3DBR B;  2R7S A;  1Z0X A;  3O2P E;  4QIW N;  1ETX A;  5ERI A;  1HSJ A;  1ETO A;  4MEX F;  1WRJ A;  2Z33 A;  1HDP A;  2RGV A;  4KMU X;  1R5G A;  2FSW A;  3BP8 A;  4ZYE A;  1TWF J;  3E6D A;  5JVT A;  1BW5 A;  3BPV A;  1RR7 A;  3CCL I;  4ENK A;  5FLX Z;  2A05 A;  1K83 J;  2VQG A;  3L7W A;  4EV0 A;  1DP3 A;  3A02 A;  4M3B A;  5GPA A;  2RVC A;  2XAJ A;  3F21 A;  1IAW A;  3L2R A;  4A93 J;  1MW7 A;  2X48 A;  4PDK A;  4AIK A;  4XQF A;  2KRH A;  5L3F A;  4PSW A;  1R36 A;  2AQF A;  3K2A A;  4YG2 F;  3M9A A;  3F0C A;  2HOS A;  3ZMT A;  2Q2E A;  2VKV A;  5J3L A;  5FRO A;  1J0R A;  5LGT A;  4HNU A;  3FBI B;  1K4S A;  2AXL A;  3JRF A;  4P1W A;  3JR9 A;  3O8H A;  4JP0 A;  2JWT A;  4A3L J;  1I1S A;  2RQQ A;  3MMY B;  4M71 A;  1IN5 A;  3CC2 I;  3HUG B;  1ZRE A;  4CZZ A;  1Z1D A;  2ZME C;  1ITY A;  2XGX A;  3CCV I;  4HX8 A;  1G3Y A;  2CV0 A;  3ULQ B;  1HKS A;  4OIP F;  3L2U A;  2VOO A;  3M8F A;  1SFE A;  3HYI A;  3F72 A;  4OU0 A;  2CG4 A;  1I1G A;  2LRE A;  2OA4 A;  2RV8 A;  4EM2 A;  3G1M A;  1VQ4 I;  3OS0 A;  3F8N A;  2DOF A;  5DV5 A;  3WU2 C;  1TT5 B;  4MFE A;  3OYJ A;  3G3Z A;  3GTO J;  1SVM A;  4HX7 A;  2NVQ J;  1U5T C;  4II2 A;  1O3R A;  2ZBK A;  4KYW A;  2CQK A;  2HU9 A;  4CSW A;  3HSF A;  3HUG A;  2CW8 A;  2EZI A;  2ZFW A;  4L5I A;  2E1O A;  2IJL A;  2YU3 A;  4B4C A;  1U8R A;  6PAX A;  2B63 J;  4PZJ A;  2QEX I;  2V9V A;  3RKY A;  2MA3 A;  4OAY A;  5FKO A;  4BQN A;  1N77 A;  1BI1 A;  1MJA A;  1MGT A;  2DO7 A;  1LDJ A;  2MH9 A;  3ABL H;  1JKP C;  1G4D A;  3EET A;  2JA7 J;  3NRV A;  3BOQ A;  3K4B A;  5BPI A;  2Z2S B;  4EJV A;  4HYE A;  3J7Z I;  1NK3 P;  2KDO A;  3BRO A;  2NAZ A;  4E7L A;  3CMA I;  1ZH5 A;  1NG6 A;  1EA3 A;  1LDK B;  3KIO A;  1XGO A;  4IF4 A;  5EDN A;  2XKO A;  1Y8Q B;  3RZO J;  4ON0 A;  1F36 A;  2VQH A;  1BN5 A;  5DS9 A;  1BIA A;  5DDG A;  9ANT A;  3F9K A;  1O57 A;  3WTU C;  1K6O A;  2FE3 A;  5KCM A;  3FKI J;  4EJU A;  3IRR A;  2XPW A;  4DYQ A;  3OYB A;  3K6G A;  2DTR A;  5HNH A;  1T2K A;  3MWM A;  4UVA A;  2W24 A;  2Y9Z A;  1G3S A;  3DV8 A;  3BR5 A;  2JMW A;  2L9N A;  2V9K A;  2XAH A;  2EV6 A;  3GO5 A;  3WTY C;  2ESN A;  4RB2 C;  1FNN A;  3OL4 A;  3K7A J;  4AM3 A;  3I54 A;  4B48 A;  2Y9Y A;  3CES A;  3IUO A;  4BNC A;  3LSH A;  2Y0S N;  1FSE A;  4OMY A;  4ENJ A;  2W7N A;  2H09 A;  4RLQ A;  3CTA A;  1FBU A;  3VYT B;  2L9R A;  3VPR A;  5ED4 A;  1ZEL A;  2HQA A;  1QZE A;  2J5P A;  4YFX F;  2A61 A;  1D0X A;  3FIW A;  1IDY A;  2H1L A;  4FE7 A;  5JLW A;  1YJW I;  5DYM A;  5B1A H;  2M4K A;  1SVO A;  3E5X A;  4X1E A;  1R6R A;  3ABT A;  5F64 A;  5LEJ A;  4GYI A;  4M73 A;  2IS6 A;  1DP7 P;  2PMZ A;  1VQK I;  2K9M A;  4XOT A;  2BY0 A;  1R71 A;  5J1U A;  2VOP A;  5IPA A;  1B6A A;  5F27 A;  3IKV A;  4IEJ A;  2DT7 B;  2OCC H;  3MCZ A;  5FFX A;  5CVI A;  4G12 A;  3BQZ A;  2ZKZ A;  5F04 A;  4ESB A;  5EG0 B;  3OYE A;  3HOX J;  2CV1 A;  4PJL A;  1JKO C;  5J6X A;  2QUF A;  2VOD A;  3K70 C;  1X58 A;  1O4X A;  3UR3 C;  1SEU A;  4BAC A;  4FET A;  3H3V K;  2PN6 A;  2K02 A;  4UNO A;  2CWE A;  1Y8R B;  1UZC A;  3DEE A;  4S04 A;  2E60 A;  2VBY A;  2DAO A;  3A01 A;  1VQ9 I;  1M1E B;  1JXS A;  2W25 A;  5A2Q Z;  2ICW G;  1OCT C;  2ME0 A;  1Y0N A;  3LL7 A;  4HQE A;  1S7E A;  2ACJ A;  2E7X A;  2NVU B;  2DMT A;  4ZYA A;  3B6C A;  2F5D A;  2IBD A;  1MIJ A;  4Y3O A;  3MD2 A;  3QRF F;  2EZH A;  1D5V A;  3BJO A;  4NC8 A;  1ZKG A;  3Q0U A;  1VQL I;  2O61 A;  1J7K A;  4A3C J;  1QNT A;  2JA5 J;  1TQP A;  1LVA A;  3VFZ A;  1I6X A;  2O03 A;  4DNC A;  2OC6 A;  1QHG A;  1VND A;  2LK2 A;  2ZJQ F;  2XC7 A;  3PO3 J;  4MLO A;  3LFU A;  4BJ6 C;  5K5Q A;  3DBL B;  4J19 A;  1UEL B;  3KP2 A;  5CVR A;  5KHD A;  1ZR4 A;  3S14 J;  4AC0 A;  1XMX A;  4AIJ A;  3P9I A;  1P4W A;  3DF8 A;  3PNY A;  3V8L A;  1HXD A;  4MEY F;  1N75 A;  1UG0 A;  1V5G A;  1BBY A;  5D4R A;  3J7A Y;  1MBJ A;  3N05 A;  4OIO F;  1WI9 A;  1Y56 A;  2K9L A;  3NAR A;  2BZT A;  1MNE A;  2ZXH A;  1BM9 A;  1R5H A;  2FMY A;  5F1R A;  3MVP A;  2FX0 A;  1RNL A;  4YFK F;  5HVQ C;  1P92 A;  2ECC A;  2IA2 A;  4HF2 A;  3W6V A;  3FHZ A;  5JLX A;  2A6T A;  3PL8 A;  1B1B A;  2MG4 A;  3QAH A;  4F91 B;  5EEA A;  2EBI A;  2JA2 A;  4RAY A;  2VBW A;  3HZJ A;  2ISY A;  3B02 A;  5HOD A;  5J4V A;  4OWR B;  3LSJ A;  3C1D A;  5J40 A;  1ONV A;  4AU7 A;  4IRH A;  2F2E A;  2Y48 A;  2F5V A;  3MKL A;  1YI2 I;  3CLQ A;  1VTN C;  3HRS A;  4E7H A;  4BDY A;  4XN3 A;  2IRF G;  3I4M J;  2DQR A;  5F1J A;  1T6S A;  1ETQ A;  1V5F A;  1Y0U A;  3JSO A;  2DDB A;  2R3S A;  2RDP A;  4J01 A;  3JRD A;  1XSV A;  2IEK A;  3O8G A;  1G59 A;  5C44 J;  2E2H J;  1RIO H;  1PP8 F;  2XGC A;  3RDI A;  3KP5 A;  3TW7 A;  2JT1 A;  1P6R A;  3KYL A;  3ZQQ A;  2HTS A;  3TO6 A;  3E5U A;  2VE9 A;  2VT3 A;  4JX5 A;  2NVT J;  1VQ5 I;  2ZJ2 A;  3L00 A;  2V6C A;  2V6E A;  2TDX A;  1K6Y A;  2BHZ A;  1E3P A;  1TWC J;  3G4S I;  3MQ0 A;  4HRI A;  4UB6 C;  1OYI A;  3S17 J;  2F48 A;  4AD9 A;  2DMQ A;  3RYP A;  4BH9 A;  1O3Q A;  2CMP A;  2B0L A;  3RSN A;  3R0A A;  1PP7 U;  1IC8 A;  2A68 F;  2UUZ A;  3LSR A;  2VE8 A;  5K5R A;  1JUP A;  4ZDO A;  2VC0 A;  2YS9 A;  5CPR B;  1WPK A;  2XF5 A;  4NUB A;  4BYY A;  3IL2 A;  3BWG A;  3CMM A;  3SDB A;  2M8G X;  3GTM J;  5LEK A;  5TIS C;  2BHY A;  2EFO A;  1LFB A;  3CUO A;  4H4K C;  4ZC3 A;  3OL3 A;  2WB1 N;  3CO7 C;  3J7Y J;  3AG4 H;  3LSP A;  2GA1 A;  2ZXJ A;  1HW5 A;  1ZN2 A;  3H1C A;  1BOA A;  1QGP A;  4HOB A;  4RM2 A;  3VOD A;  3WU1 B;  2AO9 A;  1VQM I;  1DU0 A;  1RPW A;  2GOX B;  3IH3 A;  1FBQ A;  3VYS B;  2JPC A;  3M7G A;  1BC8 C;  2H1K A;  5D5V B;  2L5Q A;  1R58 A;  3HXL A;  2WBM A;  2HFH A;  1B8I B;  1YIO A;  3COA C;  1PJR A;  1ENH A;  4KMF A;  2ZSI B;  4HLX A;  4MTD A;  4QSH A;  4G6T B;  2QA4 I;  1G3W A;  4G8X A;  4LFU A;  2OUM A;  3GW2 A;  1ORK A;  1IN6 A;  4LG3 A;  1ZG5 A;  1X1D A;  2F5E A;  4D0P A;  1KU3 A;  2WA0 A;  2ZB9 A;  5HOO A;  4KUM A;  1NH3 A;  1V5E A;  4IRG A;  4XKB A;  2FBH A;  4HST A;  4RAG A;  1BA5 A;  3RIR A;  3T5X A;  3RJP A;  3TDZ C;  2QVO A;  1Z7U A;  4G94 A;  3QOD A;  4YFN F;  5KVR A;  5LHG A;  1V4R A;  4DYR A;  4EAT A;  5LLQ A;  1R4M B;  3OYL A;  1FJL A;  1HOM A;  1WH7 A;  1MBK A;  1ZRD A;  3BG7 A;  2DTZ A;  4YIR X;  3BZC A;  3LAP A;  2WAF A;  3PSI A;  5F6F A;  1TL8 A;  3VYR B;  2CV2 A;  3H5N A;  4RB0 A;  4E7J A;  1VFC A;  3EQL F;  1ZGJ A;  3W3C A;  1JI8 A;  2WAD A;  4PSX A;  2XSD C;  1QRY A;  4RLF A;  4Q48 A;  4F52 A;  3OY9 A;  2P8T A;  4AYB N;  5IOY A;  3KP7 A;  4KFC A;  2KIQ A;  1F43 A;  3ZMD A;  1ZRF A;  4U87 A;  1LUJ B;  3NAU A;  4U0Y A;  3JRB A;  3DKY A;  1ZTR A;  4CCO A;  4YII A;  1I5Z A;  1SAX A;  2PJR A;  4U88 A;  3KYD B;  3HBL A;  4A3D J;  2KFD A;  1W5S A;  2B7E A;  2NVY J;  3U21 A;  2VBZ A;  2D1V A;  2LR8 A;  1OYY A;  2FOK A;  4CIC A;  4PCQ A;  2VLA A;  1UST A;  5EEH A;  5KNL A;  4U0V A;  1REP C;  1W1W E;  2CFX A;  3G1O A;  3I59 B;  3CC7 I;  2MSY A;  1S6L A;  4N4N B;  2DJI A;  4EJO A;  3I71 A;  3B73 A;  2FBI A;  2LDU A;  2HKX A;  2YR2 A;  2HOT A;  1ZRC A;  2DMP A;  3D1N I;  3HPH A;  5CQG A;  2OTJ I;  2HZT A;  2XGD A;  3GZ6 A;  1ULY A;  2XSJ C;  5IOZ A;  2R5Z B;  1DPR A;  4YIF A;  3T0Y A;  2FXA A;  5TRD A;  3FWE A;  3TL4 X;  3I58 A;  2K9N A;  4PJJ A;  4BY7 J;  3HL2 A;  1TQM A;  4DOZ A;  4M3E A;  4F7Z A;  2EPF A;  3I59 A;  3WHB A;  4OMZ A;  3KPH A;  3IC7 A;  2ZC2 A;  4X6A J;  4A5M A;  2NS8 A;  3IWZ A;  4XOP A;  3FMR A;  3QOE A;  5LFA A;  4NNJ A;  3BT9 A;  2L7Z A;  5D5U B;  4F93 B;  2KIF A;  1IRG A;  5E3M A;  3QPL A;  1ETK A;  3HOZ J;  4QPO A;  2MYS A;  2X4H A;  3H3Z A;  2IS4 A;  3I4P A;  3SEQ A;  2QKM B;  2YU9 J;  1B4A A;  4XBF A;  2VJ5 A;  3HKZ A;  2PEX A;  3DFG A;  2O3F A;  4PGG A;  4XSX F;  1J9I A;  2PX9 A;  2PG4 A;  3GCM A;  2EFQ A;  4A0Z A;  4Q4Z F;  2VIX A;  2DXI A;  2M9H A;  3VWB A;  4BBS J;  3PUF A;  4I01 A;  4CHU A;  3LA3 A;  3L2Q A;  4Q47 A;  2CUZ A;  1BI0 A;  5EYR A;  3OR2 C;  4LD5 A;  4HAM A;  2X6Y A;  4G7O F;  1A36 A;  2ZXW H;  2KIU A;  5D4S A;  3LA7 A;  4W97 A;  4C2T A;  1RUO A;  2CSO A;  4ZDL A;  1UG2 A;  3ERM A;  2JSP A;  4BL0 B;  4FQG A;  1OR7 A;  4XIC A;  3CCE I;  4ZZD A;  2QWW A;  3QP5 A;  2GIV A;  4WCG A;  4HNV A;  1ZG1 A;  4ZTF A;  1KGS A;  3OS1 A;  2HQR A;  1IG7 A;  3BTC A;  4Q5S F;  2I5U A;  4XKC A;  2EIK H;  5JHU A;  3OYM A;  4A3J J;  1WI3 A;  3GME A;  1MBE A;  1TLH B;  5IYB J;  3ZN1 A;  1WWX A;  2WTE A;  2KIM A;  4N9I A;  2CQN A;  4N0B A;  3LFK A;  1YJ9 I;  4NC6 A;  3J81 K;  2O7O A;  1P2F A;  4RGX A;  3LQQ A;  5M5X J;  3SYT A;  4ZYH A;  3HSR A;  3OS2 A;  1T98 A;  2VKH A;  3SXY A;  1S3J A;  2A6H F;  1MSE C;  2EFN A;  1FSH A;  1V54 H;  4XRF A;  3H5R A;  1PUE E;  1B72 B;  1IV6 A;  4FT8 A;  5HLH A;  3UKG A;  4NHJ A;  1JTY A;  2IA1 A;  1S5L C;  4L9J A;  2PI0 A;  1LB2 A;  4LLL A;  2P6T A;  2FML A;  3WTT C;  2R7T A;  1IUF A;  1IDZ A;  4Y7N J;  1ODD A;  1VI0 A;  1X4P A;  4OAZ A;  1GV2 A;  2L4M A;  3ECO A;  5DTD A;  1XDS A;  2M7A A;  4XMY A;  3HTS B;  1AWC A;  2K5C A;  4UV9 A;  4GYG A;  3WTX C;  3ZMS A;  4J00 A;  3WTS C;  1STZ A;  3BTL A;  3FK7 A;  3MN2 A;  4M3D A;  1QVU A;  4PK4 A;  4XKV A;  1FYL A;  4LG0 B;  1IXR C;  5E1X A;  1KQ8 A;  4G7H F;  2TRT A;  3KP3 A;  5IT9 K;  2QYO A;  4HW0 A;  3PUB A;  2E2J J;  2E1M B;  2KP6 A;  1OCZ H;  3HTU A;  1USS A;  1YS6 A;  4BS9 A;  3CMY A;  1RI7 A;  5E17 F;  2NS0 A;  4X0G A;  3Q9S A;  4CCL A;  2Q2E B;  3ZQL A;  1FMV A;  1Q1V A;  2R0Q C;  1BI2 A;  4CCJ A;  3BR0 A;  5C4J J;  3S3N A;  3FX3 A;  2Z3Y A;  4HV6 A;  1BR2 A;  1U9O A;  1BIB A;  1YW9 A;  3KEY A;  2BW3 B;  4LG0 A;  2V1U A;  1W7P D;  4RBO A;  1NHA A;  1DU6 A;  1BL0 A;  1W0U A;  1T33 A;  2Q0O A;  1SD5 A;  5FD6 A;  1EV7 A;  4HSR A;  1YRN A;  1R1T A;  2XAQ A;  1EH6 A;  4L9V A;  3U1K A;  4EJW A;  4B47 A;  4D7N A;  2GWR A;  4KA4 A;  4BJT A;  4IOC F;  4L5J A;  2FBK A;  1CGP A;  2PJP A;  4DZP A;  1A6I A;  2H6B A;  2KRC A;  3WTV C;  2V1D A;  4V2G A;  3PSF A;  2R7W A;  2DMN A;  5ICG A;  1UMQ A;  4IJA A;  1RZ4 A;  3UNG C;  1QO0 D;  2EIJ H;  3WE3 A;  2OBP A;  3GXO A;  4ZH4 F;  4DQ2 A;  4B8X A;  1JT6 A;  2BW3 A;  3DXJ F;  2L7K A;  1O3T A;  3JRH A;  2VI6 A;  3ZQF A;  3K70 D;  1FZP B;  3GLX A;  3TDU C;  3OYH A;  4GRI A;  1D5Y A;  2E5N A;  5FRM A;  4F55 A;  4HF0 A;  3J80 K;  3V7S A;  4NC7 A;  2OZU A;  4A5N A;  2X6W A;  4C3H J;  3OIQ A;  2VN2 A;  1J2X A;  3S1Q J;  5EJC A;  2K7L A;  2IPQ X;  2R7Q A;  3K1M A;  1TT0 A;  2HS5 A;  4HBL A;  1YLF A;  2HQ5 A;  4RGS A;  4A69 C;  4AVZ A;  1MDM B;  2ISZ A;  2CO5 A;  4M6X A;  4D1Q A;  3BR1 A;  3QYF A;  1IN4 A;  1IV8 A;  1DDN A;  2LY9 A;  2X6X A;  3E0J B;  2DT6 A;  3PNT A;  5E3L A;  1Z3Y A;  1KON A;  3MAJ A;  2COB A;  2PFB A;  4B43 A;  2P5V A;  3GBG A;  1VQ6 I;  1B9M A;  4DW6 A;  3I5U A;  3CZ6 A;  2R7X A;  3QOP A;  2QLZ A;  4XLN F;  5E3N A;  1UHW A;  1DQU A;  4XLF A;  4P55 A;  3FXJ A;  3AG2 H;  1X1A A;  1MDM A;  3NQO A;  4BE0 A;  3SZP A;  2DOE A;  2XVC A;  5EEG A;  2CQX A;  4M9X A;  2G9W A;  1XGM A;  3CJT B;  3RPU D;  2DFH A;  2R4G A;  4UUS B;  1WJA A;  2ZME A;  3JAM K;  1OCO H;  3BJ6 A;  2EA4 A;  1APL C;  1W4M A;  1DGW Y;  1XMK A;  4XOR A;  4RMN A;  1KYW A;  4MGR A;  5E8I A;  1YHQ I;  3F8C A;  3ECH A;  2QQ9 A;  2ZCW A;  2BEO A;  4AID A;  2RRE A;  1P7I A;  1MKM A;  5KK1 A;  1AU7 A;  3ESW B;  3X2Q H;  1MMG A;  2X51 A;  3T1B A;  1JKQ C;  4KIG A;  3QYB A;  3FIS A;  1Z67 A;  1TNT A;  4KT5 C;  4IL6 C;  1JUS A;  2PBI A;  1ETY A;  4RB1 A;  2D2W A;  1O7F A;  2BVM A;  3V4G A;  4UUS A;  2MAB A;  3S2H J;  3AG1 H;  4I99 C;  3CCY A;  3BR6 A;  3GUD A;  4BEH B;  2Y0M A;  4HDU A;  5C4X J;  2V9P A;  1VQP I;  3BQY A;  4AIH A;  4XID A;  2ID3 A;  3DQV C;  3LAJ A;  2RN7 A;  2QQB A;  3ONQ A;  3VSL A;  4ITV A;  2WWY A;  3A01 B;  4HG2 A;  4RGR A;  2BYV E;  3ZR8 X;  4O3M A;  1GVJ A;  2HR3 A;  3B6A A;  1H89 C;  3QPH A;  2HVR A;  3W2W A;  4HV5 A;  3HSE A;  1OIS A;  2E35 A;  1R7J A;  5L3E A;  5JI6 A;  1S7O A;  3S3O A;  3BTJ A;  4BEH A;  2LYC A;  5BPD A;  1XPX A;  4ASN A;  4D5C A;  2Z5U A;  2FJ1 A;  4IHT A;  5J8C A;  2QSF X;  4Y15 A;  5B3S H;  3CQZ J;  3K1P A;  3HOW J;  3RPQ A;  3EYI A;  3ZQ7 A;  4D7M A;  2K86 A;  4XN0 A;  1RES A;  2BY3 A;  1FIA A;  4CXF A;  1HF0 A;  4A2U A;  3K4K A;  2RAE A;  4RAZ A;  2DT5 A;  2RNJ A;  2GM4 A;  1SMY F;  1GVD A;  2VBX A;  5EZH A;  1G8X A;  4RB3 C;  2UZK A;  4PUS A;  1F9N A;  3KFW X;  4L9T A;  1V3F A;  3AKZ A;  2CYY A;  1R9T J;  1IRZ A;  3PFY A;  2PMZ N;  1W7P A;  2Z9O A;  1U9N A;  2ZJP F;  2FD5 A;  3GZN B;  1YFH A;  1X2M A;  1X1B A;  3H92 A;  4AWX B;  4L0Y B;  5F08 A;  1HC8 A;  3DKX A;  5AIP A;  1Z6R A;  4IVN A;  1BOB A;  5FGM A;  5IP9 J;  2L4A A;  2X6O A;  5IP7 J;  4MO7 A;  1D8J A;  1XC5 A;  3GVA A;  3H5A A;  1RKT A;  3WTZ A;  2IGN A;  1X3W B;  1WJC A;  5GAE J;  2QCO A;  1AKH A;  2OV7 A;  3F22 A;  3H3U A;  1KU7 A;  4R79 A;  3LQR A;  3ZMV A;  3C2G A;  2VQC A;  3IP4 B;  2A69 F;  3OYA A;  1MBF A;  1WFX A;  4IQ4 A;  1EH7 A;  2DA5 A;  2ELK A;  2J5O A;  2IA0 A;  4D5F A;  4QWQ A;  3DBH B;  3S1N J;  3E6C C;  2FF4 A;  2V79 A;  4KJZ A;  4BQA A;  2Y69 H;  3C3W A;  1MJ9 A;  2W48 A;  3PQJ A;  4N4O B;  3I55 I;  2XRL A;  2DN0 A;  1UFM A;  4I76 A;  1EH8 A;  2IP2 A;  1AHD P;  3D5S C;  4LOC A;  3WOD F;  3S2W A;  2RC4 A;  3HC7 A;  3HOV J;  2CQ7 A;  1UJ8 A;  5GAD J;  4F92 B;  2H8R A;  3HG9 A;  3HDD A;  2KMU A;  3QPS A;  4YRV A;  3QU6 A;  2ZSH B;  2R5Y A;  2H94 A;  3VDX A;  5TGT A;  2XAF A;  4HNT A;  3LOC A;  4QLC U;  3OYC A;  3H9Q A;  3DU5 A;  2VPL A;  2KL4 A;  3M07 A;  4M6Y A;  4BQO A;  4FAS D;  2HZD A;  5CLS A;  5K5O A;  3PFI A;  2R7V A;  2KLO A;  4O5V A;  4OIN F;  2BXZ A;  2L9V A;  2ZFU A;  1ZG3 A;  1X4O A;  2KIS A;  1HKT A;  3S3M A;  3ROU A;  2R7Z J;  2VUM J;  2KZV A;  2I8D A;  1TTY A;  4A6D A;  5D5W B;  2XB5 A;  5HLI A;  2DFF A;  2M0M A;  2QGU A;  3CP2 A;  4HZF A;  3TW6 A;  5HDG A;  3CCS I;  2GIZ A;  3G2B A;  1D1A A;  1R4N B;  3CCR I;  3OMY A;  3DTK A;  2LTP A;  3IH2 A;  2VC1 A;  4IO9 F;  2V4J C;  3ZQI A;  1T8I A;  3A1Y A;  3RPU A;  2QEN A;  2P7V B;  2LLK A;  4K2E A;  2HOE A;  2CW0 F;  4E7K A;  1IW7 F;  2BXY A;  1AOY A;  2XAS A;  1K61 A;  3ZPL A;  3MKY B;  1GLN A;  1G2H A;  4I0B A;  4UVB A;  1F5T A;  1SAU A;  5FD5 A;  2CUF A;  1BR1 A;  4IQJ A;  2E1C A;  4RDU A;  2L01 A;  4HDV A;  3CUQ B;  2KPM A;  4XRM A;  2VXD A;  3MFK A;  2O8K A;  2X0L A;  3A2K A;  3RKQ A;  2F5C A;  3GFJ A;  3S15 J;  5M3M J;  3NWS A;  2M30 A;  1IN7 A;  1R1U A;  3CME I;  1UCR A;  1IXS B;  1IN8 A;  2DFE A;  3OYI A;  1Y1W J;  4L0Z B;  1D3Y A;  2I10 A;  2EV0 A;  3EUA A;  5FLV A;  4PFP A;  2GLO A;  2O9L A;  3BC8 A;  2DU9 A;  2EZL A;  3WG7 H;  2XB0 X;  1JE8 A;  2HNH A;  1GUU A;  5DM7 F;  3CUQ A;  4BHP A;  3EUH A;  3SZT A;  4M9Z A;  3MKW B;  1Z9C A;  4Y4R A;  3MEX A;  5D6F A;  5K7H A;  5J1Y A;  3ABU A;  2DMU A;  4E4H A;  1MSF C;  1SAN A;  3ASN H;  1PYV A;  1WVR A;  4PFO A;  3DTE A;  4I98 B;  5E3O A;  2VPR A;  5JHF A;  1ZAR A;  1MBG A;  3TGN A;  4BY1 J;  3U1D A;  1TW3 A;  2HTJ A;  3KEQ A;  1P4X A;  4LB6 B;  5FFZ A;  3GFM A;  4BXX J;  2JTV A;  2CU7 A;  2W85 A;  1X3Z B;  3GWZ A;  2HQN A;  4ENM A;  5D6E A;  1K78 B;  2GXB A;  2AS5 F;  2LD5 A;  2PJR B;  3AFH A;  2HXO A;  3RQI A;  2HI3 A;  2DCE A;  5DM6 F;  4WWC A;  1RC9 A;  1X1P A;  1P4A A;  3R61 A;  1A04 A;  2IAI A;  5IYC J;  3L1P A;  5HNF A;  2Z16 A;  1YS7 A;  2L54 A;  5FJ8 J;  2DA4 A;  3ZCO A;  1Z91 A;  3FXU A;  5HDN A;  2GXG A;  4A3M J;  3ISP A;  3JRE A;  3ZQC A;  1I3Q J;  2WV0 A;  3FM5 A;  3GLL A;  2K3F A;  1KU2 A;  1IXC A;  5KAF C;  4U7D A;  1XTA A;  1VQO I;  1MH4 A;  3BTI A;  1P7J A;  4CCM A;  1T0F C;  3TOA A;  1K78 A;  3HJE A;  4LGW A;  4BE1 A;  1LFP A;  2JA6 J;  1CF7 B;  2UWM A;  5DCM A;  4CH7 A;  3T8T A;  2DA6 A;  1MND A;  4ABZ A;  2JQ7 A;  5H2F C;  1JGS A;  1LEB A;  2P81 A;  1QU3 A;  3ASO H;  5H20 A;  2XHK A;  4WXD A;  3GTJ J;  2JA8 J;  4OIR F;  1U3E M;  2Y75 A;  3DPT A;  5EF6 A;  3GZ5 A;  3RKX A;  2KZG A;  1UHM A;  1ERD A;  3G1L A;  1SD7 A;  1OKR A;  1LKX A;  3ZMU A;  2V1X A;  3CDL A;  3DCF A;  2IXS A;  1V55 H;  2DA3 A;  4BDZ A;  3S93 A;  3AAF A;  4R1H A;  1D0Y A;  2DK5 A;  1CF7 A;  4H0E A;  1TBX A;  5GAH J;  3I53 A;  3CF5 F;  2MC4 A;  2M34 A;  3BR3 A;  4NQW A;  1LE8 B;  2WAQ A;  3G71 I;  1WJD A;  1ZLJ A;  1QPM A;  3LWF A;  1IF1 A;  2K85 A;  1LNW A;  2EFP A;  5BMZ A;  1R1V A;  4C2M J;  3LSK A;  4CCK A;  2LY1 A;  3WE2 A;  4EMS A;  1HA8 A;  1OCR H;  3G6E I;  4YEJ A;  5B66 C;  1GHC A;  2VB6 A;  4N9H A;  5DCF A;  1YG2 A;  4JX6 A;  3EUK L;  5JVG F;  5K7F A;  1S72 I;  1KU9 A;  1OR7 C;  4I09 A;  1A31 A;  5IT9 Z;  2TCT A;  1YW8 A;  3IAS 2;  5AON A;  2X1E A;  1LDD A;  2VL8 A;  5DUK A;  1FYK A;  5D8L B;  3LMM A;  4YEL A;  1LE8 A;  4KIB A;  1L0O C;  3PIP F;  3O3K A;  1TW2 A;  1Z21 A;  4BBR J;  2P5L C;  2QKL B;  1TP4 A;  1ZLK A;  2NOG A;  3JCU C;  2G0E A;  1ETW A;  2K9Q A;  3FF5 A;  4NBQ A;  4BXF A;  4ANJ A;  3F8F A;  4MHG A;  1BJA A;  1E3O C;  1SC7 A;  4MIM A;  1OCC H;  1FC3 A;  3E7L A;  4XSZ F;  5F0H A;  2L02 A;  4XL9 A;  2D45 A;  4PGH A;  1ON1 A;  3H35 A;  3OWT A;  2HOA A;  3P9C A;  5D8K B;  3M1C A;  1O7L A;  3FXL A;  5DEQ A;  1JKR C;  2CJJ A;  3ABK H;  1OPC A;  3QU3 A;  2BY2 A;  1X2N A;  2ESH A;  3MZH A;  4IPA A;  2E7W A;  3HEF A;  2Y2Z A;  4EGZ A;  1MZB A;  1UB9 A;  2L7M P;  3PJR A;  3KE2 A;  2NNN A;  5CJ9 A;  2AQE A;  1TZL A;  2OTL I;  2QSG X;  4KN4 X;  1OCP A;  4MFD A;  3DWL E;  3CLO A;  3BLY A;  4OIQ F;  2R7F A;  3DKW A;  4CYC A;  2XUB A;  4LIT A;  2LKX A;  2FNP A;  2IT0 A;  1GV5 A;  5F0F A;  3K4L A;  2MFZ A;  1X1C A;  2K4J A;  3HKZ N;  1F1Z A;  3R6S A;  3SDG A;  3W6K B;  3J80 Z;  3K0L A;  4BE2 A;  5HLG A;  3E6B A;  3FK6 A;  2LNB A;  2FOW A;  3GEZ A;  3SJM A;  4IOA F;  5ICF A;  2BV6 A;  3PM1 A;  2WC2 A;  3KZI C;  4IRI A;  2IS2 A;  4PJN A;  4NB5 A;  2MBF A;  1XSD A;  3GX4 X;  4C2U A;  3IWF A;  4U0W A;  3GYH X;  2V26 A;  2EZK A;  4UUV A;  3T8R A;  3LSM A;  3OYN A;  1J09 A;  1HW1 A;  2KHM A;  4GFB A;  3HRT A;  2E1N A;  1T38 A;  1IRF A;  2E71 A;  5ILV A;  3W6J B;  4UVC A;  2RKH A;  5HS7 A;  2XV4 S;  3BG5 A;  2L0K A;  3ZGK A;  1Y1V J;  5LGU A;  3V8K A;  2OCE A;  1ON2 A;  4CZC A;  2BVL A;  2E1M C;  4BUP A;  2VON A;  2KDZ A;  1TC3 C;  3RTR A;  2EIM H;  1SFK A;  2GOM A;  2A5Y B;  1O3S A;  3P5J A;  1XMA A;  2Y31 A;  1GDT A;  2PQ8 A;  2ADU A;  4HQM A;  4BXU A;  1VQ7 I;  1YRN B;  2R92 J;  1IJW C;  1FPQ A;  1WKM A;  3U2R A;  1IO2 A;  2PMH A;  1VZ0 A;  5IY5 H;  4ZYG A;  4L9N A;  1AA7 A;  2CFO A;  3DP7 A;  2BGC A;  2A6E F;  5ICE A;  5M5W J;  3JAM Z;  3I9V 2;  1ETV A;  5HS9 A;  3I56 I;  2A07 F;  3BCB A;  2VXZ A;  3GTK J;  1FBS A;  3BZK A;  2OZ6 A;  3Q0V A;  3FDY A;  2LVS A;  1BR4 A;  2A5W A;  2KKO A;  2F6C A;  3D5L A;  5GPC A;  1FOX A;  3AG3 H;  4L18 B;  4XM3 A;  2DYS H;  1MMA A;  3JRC A;  3H0D A;  4KIF A;  4EM1 A;  3FXQ A;  2VKE A;  2QBY B;  2DLL A;  3GFL A;  4B1R A;  2Z1D A;  2LKS A;  1X3U A;  1WZ2 A;  2OQG A;  4Y13 A;  3W2V A;  1U6G A;  4WK8 F;  4EGY A;  4IX7 A;  2UV1 A;  5GAG J;  2L7F P;  2M3A A;  4AUX A;  1MNM C;  1I50 J;  2HDD A;  1TWG J;  2VKD A;  3HGY A;  1IZ1 A;  4JBA A;  3HOY J;  2XRO A;  2ELJ A;  4JOM A;  1FLI A;  3F6O A;  5KAI C;  3WGI A;  3CC4 I;  1JGG A;  4O6J A;  3DLA A;  5FKL A;  3U9G A;  5LHH A;  3EDP A;  3OR1 C;  4KT6 A;  3TP0 A;  2QBY A;  3TMO A;  3HHG A;  3JSP A;  3D5R C;  3HRM A;  3F8M A;  5HS8 A;  3HIF A;  1R23 A;  3ELK A;  4IHW A;  2FQ3 A;  1X19 A;  2DQL A;  3OIO A;  5LRR A;  2DK8 A;  5CKT A;  5TJJ A;  4DBQ A;  4ENN A;  1DUX C;  1GXQ A;  2NXN B;  2QM3 A;  3H9J A;  2EIL H;  4CDG A;  2M1B A;  1POG A;  1K79 A;  1QBJ A;  4FE4 A;  2LBF B;  3REO A;  3SZG A;  4UHT A;  3LSI A;  3K4N A;  3E97 A;  4BAY A;  5GTH C;  3M1E A;  4XRS A;  3HOU J;  2UXN A;  4ETS A;  1RKW A;  1SFO J;  1JHF A;  1FIP A;  4LIV A;  1HDD C;  3S32 A;  5FB2 A;  2D5V A;  1FEX A;  2LY2 A;  2HPM A;  5CQE A;  3JRA A;  2QSH X;  1E3H A;  5ILS A;  2OPT A;  2QQA A;  4MNU A;  4UY8 I;  2HDC A;  2ZME B;  3S1M J;  3ABM H;  5CYV A;  2FA5 A;  1RET A;  4KIC A;  3A0B C;  2O8X A;  3AL0 C;  1KQ0 A;  2LBF A;  4IHX A;  1YYV A;  4E7I A;  4XK4 A;  3SFI A;  3F8B A;  1ZQ3 P;  2G7U A;  3F6V A;  3CCQ I;  1QVT A;  2EIN H;  1SFU A;  3OSG A;  3DEU A;  1U5T B;  2G7H A;  2LMD A;  3BG9 A;  3SQN A;  2VQL A;  3L2W A;  3AL0 B;  2HVS A;  1L3L A;  1XG1 A;  2Y0S A;  3BJA A;  3RCO A;  1ZYR F;  2K3P A;  4E70 A;  2R7U A;  3FXR A;  4E7S A;  1B59 A;  2F4I A;  2CGP A;  1S29 A;  3A0H C;  4M74 A;  2ELH A;  1DPU A;  4HLY A;  1KZH A;  2X9D A;  1BJZ A;  2COM A;  3OOU A;  5LHI A;  1WJ5 A;  4XLP F;  2NRA C;  2P0W A;  4EJT A;  1OFC X;  2EWN A;  3CCM I;  3GTL J;  5ICC A;  2O0Y A;  3KZY A;  2IW5 A;  5CVJ A;  1U5T A;  2CQQ A;  4HEA 2;  3V8J A;  4BKX A;  4R8H A;  1A6Q A;  3I3L A;  4GGG A;  1D0Z A;  1H9T A;  1MBH A;  2HXI A;  4G6D A;  4XLH A;  5DUI A;  5AIQ A;  3GFI A;  2R7R A;  1W36 C;  4XNF A;  1LPQ A;  2LF7 A;  1S9H A;  1XN7 A;  1FP2 A;  1ZHF A;  3K4J A;  5FO5 A;  5M5Y J;  1JJ8 C;  4RM3 A;  2LF8 A;  5E1W A;  5FLX K;  1KQ9 A;  1TNS A;  3BG3 A;  1G3T A;  2JSC A;  4XRS G;  2X1D A;  2FNA A;  1QQI A;  3L09 A;  2EH3 A;  4FX0 A;  4W1U A;  1EKE A;  3VB2 A;  3R60 A;  2XKP A;  4GO1 A;  4A6E A;  3M8J A;  4XON A;  2IGO A;  2M8E A;  4KN7 X;  5L3D A;  3L2V A;  2DDA A;  4P9U A;  4A3F J;  4Y17 A;  5CVU A;  4F3Q A;  1WJB A;  1XSX A;  3WTW C;  1YE9 A;  4DBR A;  2DPU A;  1WSU A;  2BBY A;  2FRH A;  4LJZ F;  3EYY A;  3DTI A;  2LKP A;  2W57 A;  3FHN A;  3V7C A;  1HW2 A;  1R00 A;  3HOT A;  4FIS A;  3NEU A;  2OU2 A;  3CJN A;  4GCV A;  2AHQ A;  1SD4 A;  1R49 A;  4KIS A;  2VJJ A;  1GT0 C;  1W7P B;  2JRT A;  4Z2Y A;  3CD6 I;  3SHF A;  5FKK A;  2ID6 A;  4PJ0 C;  1WHU A;  3KX2 A;  3M8E A;  3E3V A;  3PQK A;  2OAZ A;  1QPI A;  3IHU A;  4LLG F;  4C3J J;  4NDL A;  2IVM A;  3C7J A;  1YIJ I;  4Z6Y A;  2WY7 Q;  3CJR B;  2NS7 A;  5LD2 C;  3K9T A;  1W5C C;  4JQF A;  4A3B J;  1WCM J;  1LVK A;  3K10 A;  2ZNY A;  4LIU A;  1YO5 C;  1SVL A;  3CDI A;  5IYD J;  1H0M A;  3CDH A;  2NNY A;  4C3I J;  4D9J A;  1YIT I;  1QZY A;  2BE5 F;  2P7C B;  1MMN A;  1FWZ A;  2JZY A;  3CCJ I;  1K7A A;  1AKH B;  1I3A A;  2M87 A;  3FXM A;  1N78 A;  3N4M A;  2LFB A;  1SMT A;  3C2H A;  2F5F A;  5B1B H;  4XKW A;  1Z6T A;  3Q0W A;  3C2B A;  5K1Y A;  2P4W A;  3LST A;  5EG0 A;  1QZZ A;  4WF2 A;  3HPG A;  2LP0 A;  2E36 A;  2RNG A;  1MMD A;  2JRM A;  2M2E A;  4A0X A;  1XCV A;  2HKO A;  2DA7 A;  2CH0 A;  2O5R A;  1K4T A;  4A3G J;  2B9S A;  1QA6 A;  2GXA A;  4JX4 A;  1I6H J;  4IHS A;  2M5W A;  3KZZ A;  1J75 A;  1BC7 C;  2HYJ A;  5HDK A;  1XDU A;  2DI3 A;  1LEA A;  2HWV A;  2Q1Z B;  4DJA A;  1YX5 A;  5E79 C;  1FX7 A;  4BHB A;  1A5J A;  1E17 A;  1OYW A;  2W1O A;  2R5Y B;  4IHV A;  5CVV A;  2JUG A;  2JK3 A;  1EF4 A;  1YX3 A;  3E6M A;  1H8A C;  1XGS A;  4V19 K;  2XRN A;  2NVX J;  3DPL C;  2EQR A;  4A12 A;  4G6Q A;  3K2Z A;  4UUT A;  1ZGW A;  1CQT A;  3WGG A;  2EA2 A;  3WG9 A;  2MC3 A;  3TED A;  5FRN A;  1A35 A;  2JUC A;  2MGQ A;  3A4C A;  2D1H A;  1HBX G;  2KT0 A;  5DD4 A;  3TP3 A;  2XDV A;  1RR8 C;  3KLN A;  1Y6I A;  3JTG A;  3N97 A;  2ECB A;  1J5Y A;  5D5X B;  2DJN A;  3K69 A;  1XB4 A;  1SD6 A;  1UAA A;  1KYZ A;  1BI3 A;  2DFI A;  3SEZ A;  4LK1 F;  1FT9 A;  1T08 B;  1IRX A;  1MD0 A;  1T39 A;  4P9F A;  2MD0 A;  5J8F A;  4I7H A;  3V7R A;  4I0A A;  3KEO A;  4UXN A;  1EJ9 A;  3J7A O;  2FEZ A;  5BS6 A;  2R7O A;  1HCR A;  3CJQ B;  4E6K G;  3OV8 A;  2EB7 A;  3MZY A;  1TWH J;  2OF7 A;  3EPZ A;  3PIO F;  1LQ1 A;  3OYG A;  2H6C A;  4LMY A;  1NK2 P;  2DBB A;  5E20 A;  3GF2 A;  2DOD A;  2E2I J;  1JTX A;  4WXH A;  2LRD A;  3A03 A;  3FBN B;  2MLG A;  2F4M B;  3HHH A;  2HVQ A;  5FKM A;  3P9K A;  4EQQ A;  1ZR2 A;  1E0E A;  2KRF A;  2LH9 A;  3BDD A;  1ZK8 A;  1MH3 A;  2M45 A;  1XD7 A;  2R7D A;  2L3D A;  2BOL A;  3LA2 A;  1S7A A;  2K40 A;  2R93 J;  2WB1 A;  3K1N A;  3KET A;  2E34 A;  2KJC A;  1FYM A;  4IKF A;  2HEO A;  1I39 A;  3WGH A;  1YJN I;  1QHH D;  1ZGA A;  1WJE A;  3CUQ C;  1XX5 A;  2CS3 A;  3EUH C;  1VF9 A;  3BY6 A;  2CUE A;  2GAU A;  4B09 A;  1IUY A;  3KLO A;  2Q8K A;  2N8G A;  5A2Q K;  2HYF A;  2P5K A;  2IGK A;  4WXC A;  3HM5 A;  1JUM A;  4AVP A;  2WV1 A;  3IV5 A;  1I27 A;  3JW4 A;  3K4M A;  2JJ7 A;  1Q1H A;  4XLA A;  2ETH A;  3H9G A;  1IGN A;  3O6B B;  2XIG A;  2XAU A;  1T95 A;  3WHC A;  4BU2 A;  4C9Y A;  1JHH A;  4EEF G;  4RS8 A;  2XF6 A;  3E5Q A;  1R22 A;  4ZDP A;  3ML6 A;  3KYC B;  4JK1 X;  5BNG A;  3QYE A;  2LSO A;  3FXK A;  2ME6 A;  1U78 A;  4S05 A;  2NYX A;  2E19 A;  2JPB A;  3QPT A;  2FUG 2;  1BW6 A;  3BR2 A;  1LJ9 A;  3SFZ A;  4CYD A;  4DGW B;  1MMS A;  2VJ4 A;  2ZXI A;  3F23 A;  3BZ6 A;  3RYR A;  1P9Q C;  3ZP5 A;  1FOK A;  3HOS A;  3MKZ A;  1D1C A;  1U8B A;  1F4K A;  2E5Z A;  4Y52 J;  2FQ4 A;  3CO6 C;  1S8N A;  4BJ5 C;  4KIT B;  1HKQ A;  3G73 A;  1B9N A;  2PLY A;  2IS1 A;  4PJM A;  1J59 A;  3KCC A;  3L9F A;  3OYK A;  4EM0 B;  4P5O A;  3I0T A;  2C6Y A;  2CUJ A;  2PMU A;  4AYB A;  2DOA A;  4M6V A;  5GTI C;  3W2A A;  3ZXS A;  3FMS A;  3RZD J;  3JRG A;  4TV7 A;  1WJF A;  2W84 A;  4RGU A;  5H6R A;  3TOB A;  4ZTJ A;  1U0J A;  2QZ8 A;  4BQQ A;  4HPQ A;  2KJB A;  1XGN A;  4FCY A;  2JVH A;  3BPX A;  3R0J A;  1KA8 A;  1SFX A;  2LC2 A;  4IHY A;  2LG4 A;  5DCM B;  3FZV A;  2HYG D;  2ZNZ A;  3GTP J;  1N25 A;  4I02 A;  4UB8 C;  5L3C A;  3I4N J;  5BQT A;  4DIQ A;  4ZZL A;  3TKY A;  3DPU A;  3DEW A;  5FKN A;  1B8I A;  2KQR A;  2DPD A;  1U2W A;  2AXT C;  2K27 A;  4CCN A;  2GBY A;  3S16 J;  1H88 C;  4MTE A;  2RQP A;  1MJB A;  2EJR A;  2W4S A;  2JN6 A;  1PUF B;  5B5E C;  3VYU B;  3BG6 A;  1WQ2 A;  3OOP A;  5IT3 A;  4U7B A;  1OJL A;  2O6G E;  1ZAO A;  2DA1 A;  3Q3S A;  1FP1 D;  2MH2 A;  2EV5 A;  4QPQ A;  3OYF A;  2HPI A;  2M4G A;  4M3F A;  4C30 A;  1HLV A;  4NQW B;  4LLN A;  2IGM A;  3JRI A;  2STW A;  5L3G A;  4IXA A;  3RQ4 A;  2DA2 A;  1XCB A;  4ESJ A;  1XS9 A;  4B3X A;  4M9S A;  3CP8 A;  3ERE D;  3J81 Z;  3Q9V A;  3I64 A;  1FMW A;  1PUF A;  3S8P A;  5JFR A;  5FLM J;  1W5T A;  4LK0 F;  3VOE A;  1ACI A;  3CF2 A;  1FTT A;  2W00 A;  2ZJR F;  4CO8 A;  2CRG A;  3QQA A;  5EZG A;  2CW7 A;  4ZYD A;  2XGE A;  4FTH A;  2H8W A;  4S0H B;  4L5E A;  2YPR A;  3L2C A;  2ZO4 A;  3S1R J;  1NG7 A;  2VT2 A;  3PNV A;  3QP6 A;  2L9S A;  5EGO B;  5DD8 A;  1Z7L A;  5J4Y A;  2BY1 A;  1UHS A;  3IKT A;  3FKJ A;  4A3I J;  1Z05 A;  1GXP A;  2NOJ B;  1DGR M;  2L2O A;  1H9G A;  1FOW A;  4GXO A;  5J1R A;  3ZRG A;  1VQN I;  1T0F A;  2OD5 A;  5LRS A;  4EVI A;  2MLK A;  3ZN0 A;  4FHT A;  5LGN A;  4A3K J;  5BOX A;  3VSK A;  4MQV A;  2K4B A;  2MD5 A;  3DLL F;  4G9Y A;  5EGO A;  3D0S A;  2OQR A;  3RKW A;  4V2F A;  2WY8 Q;  5H6Q A;  4P96 A;  2Z99 A;  5JR3 A;  4CYC B;  4HX4 A;  1YW7 A;  2QF7 A;  3GTG J;  1YOV B;  3NWT A;  3HB9 A;  2R5Z A;  4A3E J;  5ILU A;  3KP4 A;  2F4O B;  2WAQ N;  2VAS A;  4BGD A;  5LBQ A;  4RAF A;  1VQ8 I;  1TQI A;  4CA0 A;  2H27 A;  3ZQG A;  4DZJ A;  1D1B A;  3F3X A;  3TO9 A;  2XAG A;  2JVG A;  2W82 A;  3K4C A;  2YX4 A;  1NTC A;  1FTZ A;  1WH5 A;  2DYR H;  2M0C A;  4Y33 A;  2GA2 A;  3Q5F A;  3QWL A;  2UXX A;  4XR6 A;  5L3B A;  2QQ8 A;  3S2D J;  1HQC A;  3TO7 A;  4ESF A;  3OIP A;  2XPU A;  5K7Z A;  5E18 F;  2MW8 A;  2WAE A;  3JTH A;  3R4K A;  3PO2 J;  2VJI A;  3LSG A;  4KDP A;  1OQY A;  3WU0 A;  3M3Y J;  5M3F J;  3FM3 A;  3ZMZ A;  3OYD A;  2EK5 A;  2X85 A;  3TBI A;  3MZ8 A;  4WX9 A;  1C0W A;  2HGC A;  3OSF A;  1T56 A;  3BCA A;  3GTQ J;  5F0C A;  4HF1 A;  4GDF A;  2FU4 A;  4E7Z A;  4DYC A;  4QTR A;  1YQA A;  5J47 A;  1W0T A;  1E2X A;  1PVE A;  1G6N A;  3C18 A;  4A0Y A;  3HGG A;  1RRJ A;  1FY7 A;  4BHC A;  1LFU P;  4XLC A;  2P6S A;  4FX4 A;  2Y30 A;  3P7N A;  4G7Z F;  1WGX A;  1OLT A;  3VEP A;  4KNY A;  3H0G J;  2YUS A;  3HRU A;  1R5I D;  4OOI A;  2XF7 A;  4B44 A;  1TWA J;  3IRQ A;  3KP6 A;  1Y39 A;  2YX7 A;  3IH4 A;  1RUN A;  4LB5 A;  2YSR A;  4HA8 A;  3RI4 A;  3H36 A;  2LOO A;  4MQ9 F;  4CUG A;  5IP6 A;  2V7F A;  2A3S A;  1Z77 A;  2HDW A;  3FXO A;  2X1C A;  4RA2 A;  3TQN A;  1D8K A;  5GP9 A;  1FOY A;  2M7B A;  4ZJZ A;  5C3E J;  2STT A;  2V1N A; 
#chains in the Genus database with same CATH homology
 4M3G A;  4JYK A;  3ZOB A;  3HBL A;  4A3D J;  1JJ6 C;  5M5Y J;  2NVY J;  1JJ8 C;  3M4O J;  2LR8 A;  3BG3 A;  2R7Z J;  2VUM J;  4XRS G;  3G1O A;  2XB5 A;  1JT0 A;  2MSY A;  3TW6 A;  3LNQ A;  2EH3 A;  4W1U A;  4I6Z A;  2LTP A;  2XPV A;  3IH2 A;  1B72 A;  2K9S A;  3ZQI A;  3ZQH A;  4A3F J;  4B3A A;  2HOT A;  1Z0X A;  2DMP A;  1ETX A;  4QIW N;  3D1N I;  2LLK A;  2XGD A;  1ETO A;  5IOZ A;  2R5Z B;  1HDP A;  2K9N A;  1K61 A;  4BY7 J;  4M3E A;  3WHB A;  1G2H A;  4FIS A;  1TWF J;  1BW5 A;  1RR7 A;  2CUF A;  1K83 J;  2AHQ A;  4X6A J;  1GT0 C;  2NS8 A;  3A02 A;  4M3B A;  5GPA A;  4RDU A;  5FKK A;  2ID6 A;  4XRM A;  4A93 J;  2X48 A;  2O8K A;  1QPI A;  3BT9 A;  2L7Z A;  3RKQ A;  4C3J J;  3S15 J;  5M3M J;  5E3M A;  4NDL A;  3QPL A;  3K2A A;  1ETK A;  3HOZ J;  2NS7 A;  3F0C A;  2YU9 J;  2HOS A;  4A3B J;  1WCM J;  2VKV A;  5J3L A;  1Y1W J;  5IYD J;  3JRF A;  2I10 A;  4C3I J;  5FLV A;  3JR9 A;  2M9H A;  3O8H A;  4JP0 A;  2JWT A;  2GLO A;  2O9L A;  4A3L J;  4BBS J;  2EZL A;  1AKH B;  2XB0 X;  2LFB A;  1ITY A;  1GUU A;  3Q0W A;  5EYR A;  3C2B A;  5EG0 A;  5K7H A;  5J1Y A;  2LP0 A;  2DMU A;  1MSF C;  1SAN A;  3G1M A;  2M2E A;  2DA7 A;  4W97 A;  4A3G J;  4MFE A;  3GTO J;  4JX4 A;  5E3O A;  2VPR A;  2NVQ J;  1I6H J;  1UG2 A;  2HYJ A;  1MBG A;  4XIC A;  4BY1 J;  1A5J A;  2EZI A;  4HNV A;  2R5Y B;  4IHV A;  4BXX J;  2CU7 A;  2JK3 A;  1EF4 A;  1H8A C;  2E1O A;  4B4C A;  1IG7 A;  2NVX J;  3BTC A;  2EQR A;  2B63 J;  4A3J J;  4UUT A;  1WI3 A;  5FKO A;  1ZGW A;  1CQT A;  1MBE A;  5IYB J;  3TED A;  2LD5 A;  3RQI A;  2HXO A;  2HI3 A;  2MGQ A;  5IYC J;  3L1P A;  2IAI A;  5FJ8 J;  1JKP C;  2DA4 A;  2KT0 A;  2JA7 J;  3TP3 A;  2O7O A;  4A3M J;  2ECB A;  5M5X J;  1NK3 P;  2DJN A;  3JRE A;  3ZQC A;  1I3Q J;  1MSE C;  5EDN A;  3RZO J;  1B72 B;  1MH4 A;  1F36 A;  3BTI A;  1P7J A;  5DS9 A;  3UKG A;  1IV6 A;  1JTY A;  9ANT A;  1IUF A;  3FKI J;  1IDZ A;  4Y7N J;  2JA6 J;  2XPW A;  4DYQ A;  1VI0 A;  2DA6 A;  1GV2 A;  1HCR A;  4ABZ A;  5DTD A;  2Y9Z A;  2P81 A;  1TWH J;  2OF7 A;  3BR5 A;  3GTJ J;  2JMW A;  1NK2 P;  2JA8 J;  5EF6 A;  2E2I J;  1JTX A;  3MN2 A;  3A03 A;  3BTL A;  3FK7 A;  1QVU A;  4M3D A;  3G1L A;  5FKM A;  3K7A J;  2TRT A;  1ZR2 A;  2Y9Y A;  3DCF A;  3CDL A;  1ZK8 A;  2Y0S N;  1MH3 A;  2E2J J;  2DA3 A;  2K40 A;  2R93 J;  3CMY A;  2L9R A;  3VPR A;  3BR3 A;  2M34 A;  1LE8 B;  3ZQL A;  1Q1V A;  3FIW A;  1IDY A;  4FE7 A;  2R0Q C;  3BR0 A;  5JLW A;  1VF9 A;  5C4J J;  2CUE A;  1U9O A;  4X1E A;  2N8G A;  4C2M J;  4RBO A;  3HM5 A;  1JUM A;  1DU6 A;  2WV1 A;  1BL0 A;  3IV5 A;  1W0U A;  1T33 A;  5J1U A;  4JX6 A;  5K7F A;  5IPA A;  1YRN A;  2JJ7 A;  5F27 A;  1IGN A;  4IEJ A;  5EG0 B;  4D7N A;  2TCT A;  4G12 A;  3BQZ A;  5F04 A;  3WHC A;  3HOX J;  4EEF G;  1JKO C;  4DZP A;  1A6I A;  1LE8 A;  4V2G A;  1X58 A;  2DMN A;  1O4X A;  1UMQ A;  5BNG A;  1U78 A;  2ME6 A;  4BBR J;  2NOG A;  3H3V K;  2E19 A;  1JT6 A;  2G0E A;  1BW6 A;  3BR2 A;  1ETW A;  2K9Q A;  3A01 A;  3JRH A;  2VI6 A;  3ZQF A;  1E3O C;  1OCT C;  2ME0 A;  4MIM A;  5F0H A;  1S7E A;  3E7L A;  1D5Y A;  2DMT A;  3B6C A;  2IBD A;  2HOA A;  1U8B A;  4C3H J;  4Y52 J;  2EZH A;  2CJJ A;  2FQ4 A;  1JKR C;  1ZKG A;  3Q0U A;  1X2N A;  4A3C J;  3S1Q J;  3HEF A;  2Y2Z A;  2JA5 J;  2L7M P;  2LK2 A;  1VND A;  3PO3 J;  2HQ5 A;  1OCP A;  4MLO A;  4MFD A;  4J19 A;  4A69 C;  4M6V A;  3RZD J;  3JRG A;  3BR1 A;  4CYC A;  1ZR4 A;  3S14 J;  4AC0 A;  2LKX A;  4FCY A;  1GV5 A;  5F0F A;  2LY9 A;  3HKZ N;  3SDG A;  1MBJ A;  5E3L A;  4IHY A;  3NAR A;  2COB A;  3GTP J;  3FK6 A;  3GBG A;  3I4N J;  3MVP A;  4DW6 A;  3DEW A;  2FX0 A;  5FKN A;  3SJM A;  1B8I A;  2ECC A;  3PM1 A;  5E3N A;  3W6V A;  2GBY A;  5JLX A;  3S16 J;  2MG4 A;  5EEA A;  1H88 C;  2EBI A;  2EZK A;  2CQX A;  2JN6 A;  1PUF B;  5HOD A;  4GFB A;  3LSJ A;  4UUS B;  1OJL A;  2DA1 A;  3Q3S A;  1APL C;  4M3F A;  3BG5 A;  2L0K A;  3MKL A;  1HLV A;  3JRI A;  1Y1V J;  1AU7 A;  1P7I A;  2DA2 A;  3I4M J;  5F1J A;  1XS9 A;  1ETQ A;  2KDZ A;  1JKQ C;  1TC3 C;  3FIS A;  2Y31 A;  3JRD A;  1GDT A;  2IEK A;  3O8G A;  1JUS A;  1PUF A;  1ETY A;  1YRN B;  2R92 J;  5C44 J;  2E2H J;  5FLM J;  1IJW C;  4UUS A;  3S2H J;  2XGC A;  1FTT A;  3CCY A;  3BR6 A;  5M5W J;  3TW7 A;  2CRG A;  5C4X J;  3QQA A;  5EZG A;  1ETV A;  3GTK J;  3BQY A;  2XGE A;  4JX5 A;  2NVT J;  4XID A;  2ID3 A;  3Q0V A;  4FTH A;  4S0H B;  2LVS A;  4L5E A;  5GPC A;  3S1R J;  1TWC J;  3A01 B;  5EGO B;  3JRC A;  3B6A A;  1H89 C;  3S17 J;  1UHS A;  2DMQ A;  2VKE A;  4A3I J;  4B1R A;  1IC8 A;  3LSR A;  3BTJ A;  1JUP A;  5J1R A;  2L7F P;  4AUX A;  1MNM C;  4D5C A;  1I50 J;  2FJ1 A;  1TWG J;  2HDD A;  3HGY A;  3CQZ J;  3HOY J;  2YS9 A;  4A3K J;  1WPK A;  3HOW J;  4D7M A;  1RES A;  1FIA A;  1HF0 A;  2M8G X;  1JGG A;  3GTM J;  5EGO A;  2RAE A;  5FKL A;  1LFB A;  4V2F A;  2GM4 A;  1GVD A;  3TP0 A;  4CYC B;  2WB1 N;  5EZH A;  2QF7 A;  3GTG J;  3LSP A;  4IHW A;  3HB9 A;  2R5Z A;  4A3E J;  3OIO A;  2AO9 A;  2WAQ N;  1DU0 A;  1RPW A;  3IH3 A;  2H1K A;  3ZQG A;  4DZJ A;  1R9T J;  1POG A;  4FE4 A;  1IRZ A;  1FTZ A;  1NTC A;  2PMZ N;  1B8I B;  1WH5 A;  2M0C A;  1U9N A;  1ENH A;  2FD5 A;  4QSH A;  3S2D J;  4XRS A;  2XPU A;  5K7Z A;  3HOU J;  1RKW A;  1X2M A;  1FIP A;  1SFO J;  1HDD C;  2MW8 A;  2D5V A;  3PO2 J;  1FEX A;  5F08 A;  3JRA A;  5IP9 J;  3LSG A;  2OPT A;  2X6O A;  1ORK A;  5IP7 J;  4MO7 A;  3M3Y J;  3S1M J;  5M3F J;  2ZB9 A;  1XC5 A;  1RKT A;  1RET A;  3OSF A;  1T56 A;  3GTQ J;  5F0C A;  2QCO A;  4IHX A;  1AKH A;  1BA5 A;  4XK4 A;  3SFI A;  4DYC A;  4QTR A;  1ZQ3 P;  1W0T A;  1QVT A;  3OSG A;  1MBF A;  2DA5 A;  2ELK A;  3HGG A;  4D5F A;  3S1N J;  3BG9 A;  1LFU P;  4DYR A;  1XG1 A;  2W48 A;  2Y30 A;  2XRL A;  1FJL A;  1WH7 A;  1MBK A;  1WGX A;  2DN0 A;  1HOM A;  2DTZ A;  4I76 A;  3H0G J;  2YUS A;  1AHD P;  1VFC A;  1TWA J;  4LOC A;  3IH4 A;  3HOV J;  2XSD C;  1QRY A;  2X9D A;  2H8R A;  3HDD A;  1BJZ A;  3OOU A;  3QPS A;  4AYB N;  5IOY A;  2R5Y A;  1OFC X;  5IP6 A;  1F43 A;  3GTL J;  3LOC A;  1Z77 A;  3NAU A;  2CQQ A;  3JRB A;  4BKX A;  1ZTR A;  5GP9 A;  5C3E J;  1MBH A;  2HXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...