2JWTA

Solution structure of engrailed homeodomain wt
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
61
structure length
61
Chain Sequence
MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Segmentation polarity homeobox protein engrailed
publication title Comparison of multiple crystal structures with NMR data for engrailed homeodomain
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 17
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2jwtA00
1GDTA 1BW6A 5FLVA 2DMPA 5M5XJ 1UMQA 1AU7A 2H8RA 2Y9YA 3SDGA 3A01B 3OOUA 1OFCX 1YRNA 2TCTA 5EDNA 2CUFA 2MW8A 2WV1A 3D1NI 2HDDA 1G2HA 1T56A 5F04A 1WI3A 3FKIJ 1FJLA 3QPLA 4QSHA 3LSGA 3QQAA 5C4JJ 1FIPA 2Y0SN 2TRTA 4M3EA 2FX0A 1VFCA 1ETWA 5EEAA 2NVQJ 2JJ7A 4AUXA 3TW6A 3NAUA 3M4OJ 1BA5A 1JKRC 5IYCJ 2FD5A 3JRCA 1WGXA 3G1OA 4JX4A 1HDDC 4MLOA 1JT6A 2KDZA 3UKGA 3Q0VA 1ENHA 2JA6J 5E3LA 5F0FA 4DZPA 3JREA 4DZJA 1VF9A 3TEDA 4FE4A 3CMYA 1FIAA 2K40A 3HOVJ 5DS9A 1LFUP 4G12A 4Y52J 3RKQA 3G1MA 2JMWA 4MFEA 2DA2A 3IH4A 3MN2A 4AYBN 3RQIA 1OCTC 1RR7A 2MG4A 4M6VA 5M3MJ 2O7OA 2DA6A 1WH7A 1MSFC 3PO3J 2EZKA 3BTJA 4JX5A 2VUMJ 2Y31A 2EBIA 5E3NA 3FISA 1TWGJ 2NOGA 2DA1A 5EGOB 5FKNA 1MH3A 1W0TA 1JKOC 2B63J 2MSYA 1SFOJ 2XGEA 3CCYA 5J3LA 1ETVA 3BR3A 2N8GA 3OIOA 5JLXA 2CRGA 4ABZA 2YU9J 3SJMA 1ETQA 1ETOA 1H8AC 3H3VK 1JUMA 4C3IJ 2LFBA 1P7JA 1POGA 4BBSJ 1MBFA 4JP0A 1FTTA 1ZGWA 3S17J 2AHQA 3BG9A 5K7FA 1U9OA 1LFBA 3WHBA 4CYCB 1OJLA 5M5YJ 5EF6A 5GP9A 5BNGA 4DYQA 5E3MA 3FK6A 1ZR4A 1PUFB 3S1NJ 4A3LJ 4QTRA 3JR9A 1QVUA 4A93J 1ZKGA 1BL0A 2LVSA 9ANTA 5HODA 5EGOA 1JKQC 1Z0XA 1B72B 3E7LA 2LP0A 1MBKA 3HB9A 5F0CA 3JRHA 1U8BA 2ECBA 3BR6A 1GVDA 1Y1WJ 4GFBA 1Z77A 1OCPA 4LOCA 2YUSA 5GPAA 2ME0A 2W48A 1HCRA 2EZHA 3IH2A 5EZHA 3OSGA 2HOSA 4DYRA 3HM5A 5DTDA 3O8HA 1XG1A 2M2EA 1IV6A 4V2GA 2NVYJ 3BTIA 3S1MJ 2X6OA 1WH5A 2VI6A 2LD5A 4CYCA 2HI3A 2L7ZA 2DA5A 1JKPC 1IDZA 4W97A 1PUFA 4UUTA 3S14J 2RAEA 5M5WJ 1CQTA 1I3QJ 2OPTA 1RKWA 2Y30A 2XPUA 4QIWN 3RZDJ 2AO9A 1R9TJ 1B72A 4BXXJ 5IPAA 4V2FA 2L7FP 2LK2A 3L1PA 4DW6A 4XK4A 3ZQIA 5FKKA 2DMTA 3FIWA 4IHWA 2DA7A 4RBOA 1IG7A 2EZIA 1UG2A 2R5ZA 3H0GJ 1T33A 2M9HA 2O9LA 1JGGA 2GM4A 1I6HJ 5C3EJ 2LKXA 2O8KA 1MSEC 1VI0A 2L9RA 1TWHJ 4D7NA 1ETKA 2VKVA 2JA7J 1P7IA 4A3IJ 3A01A 1TWFJ 3HGYA 5F0HA 4D5FA 3BTCA 1S7EA 2R0QC 1MBHA 2I10A 4M3FA 2COBA 1RKTA 1ETYA 1WPKA 3G1LA 4IHYA 2GBYA 3ZQGA 1JTXA 3C2BA 4M3DA 3JRFA 4W1UA 1X58A 3IV5A 3HOUJ 3GTQJ 2E2JJ 1IUFA 2ELKA 1F43A 1JUSA 1ZR2A 3HOZJ 4I6ZA 1ORKA 3K7AJ 2R93J 2WB1N 3IH3A 3LNQA 1X2MA 4NDLA 1A6IA 3JRGA 1QRYA 2NS8A 1ZTRA 1DU0A 3GTOJ 2DTZA 2E19A 4XRMA 3LSRA 1HLVA 1JT0A 2M0CA 3JRDA 1LE8B 4BY7J 3S2DJ 4X6AJ 3BQYA 1AKHB 4X1EA 1I50J 5F27A 3S1QJ 2LTPA 2X9DA 1W0UA 1BW5A 2NS7A 3MVPA 3BR2A 3ZQFA 1A5JA 2IEKA 2E2IJ 2D5VA 2VKEA 5EG0B 4A3CJ 5IYBJ 2VPRA 3DEWA 1JUPA 2JWTA 2K9NA 1TC3C 2JA8J 3PO2J 3ZQLA 2CQQA 1GT0C 3CQZJ 3HGGA 5IP9J 3M3YJ 5GPCA 4XRSA 4S0HB 4A3MJ 3JRIA 1XS9A 1LE8A 2NVXJ 2XPWA 1K61A 2DA3A 2DN0A 5EZGA 2OF7A 5JLWA 1AKHA 2L0KA 1JJ8C 5J1RA 2M34A 1BJZA 3OSFA 2CU7A 3GTGJ 3LOCA 2FQ4A 4M3GA 2H1KA 5F08A 1TWAJ 3NARA 3SFIA 5EG0A 5C4XJ 2ZB9A 3ZOBA 4FISA 3JRBA 2GLOA 2CQXA 3S15J 3I4NJ 1IJWC 3HOXJ 4A3DJ 2L7MP 3B6CA 5C44J 1FEXA 4Y7NJ 3JRAA 3HOYJ 2YS9A 1ITYA 3QPSA 3K2AA 2LY9A 2HXIA 1IRZA 4MFDA 1MBEA 4C3HJ 3GTJJ 3TW7A 2ID6A 2CUEA 2K9SA 3VPRA 5IYDJ 4XIDA 1Q1VA 3LSJA 1IDYA 2DJNA 3S16J 4XICA 3O8GA 2HXOA 2WAQN 2K9QA 3TP0A 5FJ8J 4B1RA 2JN6A 2MGQA 3I4MJ 2E1OA 5FKMA 5IP7J 3WHCA 2LLKA 1AHDP 3BG3A 2DA4A 1B8IB 4M3BA 3GTPJ 1ETXA 1MBGA 2R92J 4FCYA 1NK3P 1H88C 1F36A 2E2HJ 4C2MJ 4EEFG 2QCOA 2XB0X 1U9NA 1RESA 2DMUA 1RPWA 1H89C 4D5CA 2M8GX 2R5YB 3CDLA 3BTLA 1NTCA 1Y1VJ 1VNDA 5J1YA 5EYRA 5M3FJ 3B6AA 1K83J 1GUUA 2XGDA 3A03A 3Q0UA 1IC8A 1HF0A 1O4XA 3BR1A 3GBGA 4FE7A 4A3BJ 3BG5A 2ECCA 2IAIA 4I76A 3S1RJ 4IEJA 2DMQA 2NVTJ 2X48A 4HNVA 1B8IA 4MIMA 2G0EA 4B3AA 1FTZA 1UHSA 3GTLJ 2XRLA 1APLC 5E3OA 4A3JJ 4D7MA 4JYKA 3RZOJ 4UUSB 3GTKJ 1HOMA 4AC0A 1HDPA 3ZQHA 4IHXA 4MO7A 5FKLA 4A3EJ 1GV5A 1X2NA 3F0CA 1JTYA 1GV2A 3HKZN 2EZLA 4A69C 1U78A 1EF4A 2R5YA 2JK3A 2JA5J 3A02A 2XSDC 1MNMC 2HYJA 2XB5A 5IOYA 3HDDA 1SANA 4A3KJ 3MKLA 3TP3A 4RDUA 2KT0A 4BKXA 2XGCA 5K7ZA 4L5EA 4FTHA 3HOWJ 1D5YA 2LR8A 3ZQCA 2DMNA 4J19A 4B4CA 2P81A 2HQ5A 2EH3A 3FK7A 2IBDA 1RETA 5J1UA 2FJ1A 5K7HA 2Y2ZA 3S2HJ 4A3GJ 1QPIA 1MH4A 2CJJA 4A3FJ 2HOTA 5IOZA 1YRNB 4JX6A 4IHVA 4UUSA 1XC5A 4XRSG 2HOAA 2Y9ZA 1QVTA 5FLMJ 3PM1A 3BR0A 5FKOA 2PMZN 1TWCJ 2ID3A 3LSPA 1NK2P 2QF7A 1WCMJ 5IP6A 4BBRJ 3BT9A 2ME6A 2R5ZB 3DCFA 1DU6A 4C3JJ 3BQZA 4DYCA 3W6VA 1E3OC 3BR5A 2EQRA 2XPVA 1IGNA 1MBJA 5F1JA 4BY1J 3Q3SA 1ZK8A 3HBLA 3HEFA 1JJ6C 2R7ZJ 1ZQ3P 3GTMJ 3Q0WA
chains in the Genus database with same CATH superfamily
3V7CA 3E5UA 4U0WA 2BGCA 2M8EA 1OFCX 3CDHA 5EDNA 2ZXWH 4II2A 2F4MB 2XASA 2TDXA 2EA4A 1Z91A 2HDDA 2K86A 5F04A 1WI3A 1T6SA 3FKIJ 3RJPA 1OQYA 4D1QA 5LHIA 2GWRA 4HQMA 4QSHA 4KISA 4I7HA 3ONQA 3S3NA 5C4JJ 2Y0SN 3HSRA 2CYYA 4M3EA 1KU2A 4XBFA 2XV4S 3HSFA 3TW6A 1OLTA 4HBLA 4AUXA 1HQCA 4CCNA 5K5QA 2Z2SB 3GUDA 1BA5A 3IKTA 1OYWA 1IN6A 3JRCA 4L9NA 1OCCH 1WGXA 2VQCA 4I2OA 1JT6A 3UKGA 3N97A 2DFFA 2DO7A 2COMA 2W7NA 5CVRA 3FM5A 3KP4A 2H94A 5DS9A 1LFUP 3M7GA 3RKQA 2NRAC 2JMWA 2WAEA 3IH4A 3A4CA 3V8LA 5L3CA 2R3SA 3BCBA 1RR7A 3K0LA 2Y0SA 5BQTA 2VBXA 1R5HA 2VBYA 1W7PD 3LA7A 4UV8A 2OCEA 1I5ZA 2DI3A 1XB4A 2UXNA 2VUMJ 3V7RA 2QSGX 3S32A 3SHFA 3F8NA 3K69A 1AOYA 1KU3A 3W2AA 3NEUA 1MNEA 1QO0D 5FRNA 2B63J 4XN3A 5HLGA 3CC7I 1J0RA 3BR3A 3CD6I 4CCOA 2KP6A 3DKXA 1K4SA 3KX2A 2J5PA 3L00A 3JTGA 2VN2A 4LK0F 3CCJI 2LBFB 1V5EA 4BBSJ 4GCVA 5E1ZB 2XC7A 3HRSA 2H09A 3C3WA 1REPC 1ZGWA 2M7AA 2KMUA 2IA0A 2VJ4A 1IXCA 2KQRA 4EJTA 4AVZA 1RUOA 1W5CC 3CCVI 2FBKA 3K4CA 3WHBA 1Z9CA 4CYCB 2QKLB 3U1DA 3OV8A 4KIFA 2WAFA 1PUFB 3KEQA 1DPRA 2KDOA 4NQWB 1QVUA 3CLOA 2OCCH 3RDIA 1JKQC 1Z0XA 1B72B 2UV1A 3TQNA 1JXSA 4F52A 1MGTA 4RGSA 3JRHA 1WZ2A 4G6TB 3GFIA 3KLNA 4FX4A 2P5KA 2DXIA 1YE9A 4KITB 5A2QZ 2O5RA 3F6VA 3ABTA 5GPAA 2BW3B 3K70C 3ABKH 3T0YA 2EZHA 3IH2A 5EZHA 2LBFA 3FHZA 2V6EA 4DYRA 5DTDA 2I5UA 3RI4A 4IKFA 5KCMA 4A6EA 3G6EI 1USSA 1XCBA 1Y0NA 2JQ7A 2V79A 5FLXK 2BY0A 4KT6A 4IJAA 3P9IA 3S1MJ 2X6OA 3DLLF 3Q5FA 1STZA 3K10A 4AVPA 2H6CA 4ZYDA 4CYCA 4PJMA 3V8JA 5E8IA 2DA5A 3WU0A 4ANJA 1JKPC 1PUFA 4UUTA 1FOYA 1E3PA 2XF7A 5M5WJ 4NQWA 4DBRA 1CQTA 3AL0C 2XPUA 4RAZA 4ENJA 2HVSA 2AO9A 1TNSA 1B72A 4O6JA 5IPAA 4PK4A 5GAGJ 1Z6RA 1QZYA 1VZ0A 1O3RA 2KJCA 1UELB 2A6HF 4OINF 2BW3A 4XL9A 4X0GA 2ISZA 1IG7A 2BHYA 4IHWA 3E5QA 4ZC3A 2E36A 3FXLA 2OD5A 2NYXA 3CMAI 1IUYA 4E7SA 1IO2A 1ZHFA 3H0GJ 1T33A 1Z67A 2F2EA 2M9HA 1SFEA 1I6HJ 1PP7U 3NQOA 1ZGJA 1GXQA 2LKPA 5B3SH 2LYCA 4KUMA 1GVJA 1R5ID 3KETA 1MSEC 3WTXC 3ZGKA 2XDVA 2R7FA 1TWHJ 3BCAA 4D7NA 5D5UB 1RZ4A 5CKTA 2WC2A 1P7IA 3HG9A 2DOAA 1R7JA 4CH7A 1S7EA 2R0QC 1A36A 2JTVA 2I10A 2KISA 4P5OA 2CH0A 1WPKA 5HS7A 1R00A 3B02A 3ZQGA 3P5JA 2LRDA 3IV5A 1VQ6I 3I5UA 3FXJA 1FC3A 4FHTA 2E2JJ 1IUFA 1FP1D 2ELKA 1F43A 2NVUB 1JUSA 1Z21A 4E4HA 2K9MA 5EJCA 2HVQA 2A69F 2XVCA 4ZJZA 3HOZJ 1D8JA 1B9NA 3K7AJ 4B47A 2WB1N 3IWZA 1A6IA 3JRGA 4ENNA 1ZTRA 1DU0A 3R60A 2DTZA 3RPUD 3J7YJ 2VC0A 2ETHA 1BOAA 4N9HA 2XUBA 3FXUA 3IKVA 5J6XA 2D1HA 2ZXJA 2HQRA 1YJWI 3P7NA 1R71A 1LE8B 2CG4A 4L0YB 2DK5A 2EV5A 3BWGA 4BY7J 1BIAA 1H0MA 4EJUA 2C6YA 5HLTA 3G71I 1BR4A 4BNCA 4ITVA 1JGSA 3IAS2 1EH8A 4BHBA 2NS0A 3NRVA 3K1PA 4CDGA 2D5VA 3DWLE 5EG0B 4ESJA 3LSKA 3AG4H 3CO6C 2WB1A 1P4XA 2XF6A 3L7WA 5J4VA 4V19K 2BOLA 1TC3C 1FOKA 2JA8J 3PO2J 2K85A 2XAGA 3HGGA 2XSJC 2P6TA 2LG4A 4I99C 5GPCA 3GFLA 3FMRA 3F8BA 5L3DA 3JSPA 1MKMA 3CMMA 2GQQA 1F4KA 4P96A 1LE8A 1K61A 2DA3A 4HG2A 2DDBA 2V1UA 2QQ9A 1G3TA 3OSFA 4ESFA 2P7CB 2HDWA 4BQQA 3GTGJ 2M87A 2IGMA 1T8IA 1BC7C 2H1KA 3PUFA 5F08A 5C4XJ 5EG0A 1BJAA 3HYIA 5J8FA 4PJNA 3ZOBA 3V8KA 2VKDA 1B1BA 4AWXB 4BJ5C 3FXQA 2LF7A 3CUQC 4BDZA 2JRMA 3CJRB 3A2KA 1QPMA 1TW3A 1R1TA 4RLQA 4ZH4F 1FEXA 3FXMA 3F21A 3DPLC 4ENMA 1DGRM 1YIOA 2YS9A 1ITYA 1W36D 5AONA 3QPSA 2LY9A 1P6RA 3KPHA 1IRZA 1ZAOA 3CJQB 4HEA2 4C3HJ 2GXBA 3LA2A 4A5NA 1XGSA 4B09A 3MAJA 2CUEA 3WG7H 2LF8A 2ZNZA 4I02A 3VPRA 2VC1A 1ZLJA 3F8FA 3LSJA 1IDYA 3QOEA 3S16J 5JI6A 3FX3A 4GXOA 4XICA 3O8GA 3EYIA 4O5VA 2DT6A 2WAQN 1O3QA 3TP0A 4KYWA 2PJPA 1YW7A 2E7WA 2JN6A 4A0XA 5JVTA 5LGUA 3I4MJ 2E1OA 4MGRA 4M3BA 1ULYA 3GTPJ 2HKOA 5D4SA 4CCMA 1WJEA 2RVCA 1XPXA 3VSLA 2X4HA 2JVHA 4M74A 4FCYA 4NBQA 3QWLA 2WY7Q 4C2MJ 1R23A 4EEFG 1QNTA 2Y75A 3FM3A 3LSHA 2XB0X 3BLYA 1U9NA 3IP4B 3RYPA 4ZYHA 2M3AA 4ZYEA 4KIGA 2WV0A 3E6DA 4FQGA 2MC4A 1IZ1A 2G9WA 2VXZA 4OIPF 2M8GX 4NHJA 3OYBA 2WAQA 2ICWG 5J1YA 2XGDA 4HLYA 3MZHA 3EUHA 3Q0UA 1IC8A 5ILUA 1O4XA 2JA2A 3OOPA 1FMWA 2CW0F 3F9KA 4G6QA 3S1RJ 1LQ1A 2FEZA 3ABMH 2ZMEB 2ISYA 4HX4A 1PJRA 3PFIA 1YIJI 1FTZA 1ZN2A 3TOAA 1HKQA 1APLC 4IOAF 2YR2A 2L4MA 3MKZA 2KJBA 3TO7A 2PN6A 2YX7A 4ESBA 5LBQA 2P4WA 3WTUC 3HHHA 3LMMA 3KP2A 4MO7A 2X6XA 2RC4A 4B43A 1X2NA 3F0CA 2W1OA 1JTYA 1ZG1A 3FBIB 4HYEA 4N4OB 3GZ6A 1UAAA 3WE3A 4MEYF 2JK3A 1ZRDA 3SYTA 2DPDA 2JA5J 1R5GA 3I64A 1S29A 2HYJA 3DXJF 1XGNA 1FZPB 4KT5C 3MKLA 3TP3A 1FBUA 3BG7A 2KT0A 3L2UA 5B1BH 2HEOA 1YS6A 3CCUI 3BC8A 3ZP5A 3SEZA 1X3UA 2M1BA 4A0ZA 2ZMEA 2UUZA 1SD4A 2AQEA 4UB8C 1RETA 1XTAA 3C18A 3LQRA 5D5XB 3OYAA 1MD0A 5AIQA 5AIPA 1U8RA 5HDNA 5HLIA 1XC5A 3LA3A 1YJ9I 1QA6A 1HSJA 3CF2A 4XRSG 1Q1HA 2HOAA 1R4MB 4BJ6C 4E7JA 3ZN0A 3PIPF 2MA3A 1U5TC 3BR0A 2EFOA 3R0AA 5FKOA 3W3CA 3C7JA 2PMZN 2EIMH 1TWCJ 2Z99A 2HPMA 3DBRB 2EFQA 2MLGA 4YEJA 1T98A 2LDUA 4OU0A 4AIHA 3TL4X 2A5WA 4C3JJ 3FF5A 2ZNYA 4Q5SF 3BR5A 2QQAA 2E1CA 2XPVA 4IRHA 3PQKA 1IGNA 2M30A 1LEBA 1UHMA 3OYCA 1PDNC 5GTIC 2NXNB 5JHUA 3KP3A 1SD7A 2K02A 1SVOA 5E18F 1ZLKA 1BW6A 1P4AA 2M4KA 1J09A 5M5XJ 1T08B 2L7KA 2Z5UA 2H8RA 3A01B 1UZCA 3VSKA 5CPRB 5HNFA 1XMXA 2DFHA 4IRGA 3EUAA 5LD2C 1OYIA 4IOCF 1D3YA 2PMZA 4D9JA 1MDMB 1G2HA 2PMHA 2CFXA 4NUBA 1K79A 1E3HA 3QQAA 1XSXA 4KICA 2TRTA 3LFKA 1BIBA 3LL7A 2W25A 3UNGC 2LSOA 2QWWA 4HA8A 3NAUA 1VQ8I 4HW0A 3M4OJ 2CMPA 1JKRC 2X6WA 3WG9A 1NG6A 1OCRH 4ZTJA 4MLOA 4IO9F 2JT1A 4F92B 1ENHA 3AKZA 3JSOA 5F0FA 4DZPA 2E60A 3OYIA 3GMEA 1VF9A 2GA1A 1D8KA 1BI1A 1FIAA 2K40A 3HOVJ 1SAUA 4XM3A 1N25A 2HDCA 4Y52J 1TTYA 2GOXB 3MN2A 3MQ0A 4WXCA 2L9NA 4AYBN 2R4GA 2MBFA 1MDMA 1KYZA 1OCTC 1EKEA 3W2VA 4FASD 5M3MJ 2P6SA 2STWA 1WH7A 1Y8RB 1S6LA 3I71A 4UB6C 4F91B 5L3BA 2Y31A 3KYCB 1W5SA 1G8XA 3AG2H 1TWGJ 1I6XA 3R61A 1I27A 5FKNA 5DM7F 4GYGA 1TT0A 4IQJA 1MH3A 3DU5A 2DYSH 2VQGA 4B48A 5DEQA 5LRRA 1WJAA 1SFOJ 4UNOA 3EETA 1ETVA 5H20A 3S8PA 2N8GA 3OIOA 4WF2A 4BGDA 5JFRA 3OS1A 1A31A 1QU3A 4ABZA 1LB2A 2YU9J 4ZDOA 1X1PA 4QPQA 1ETQA 4BE0A 1JUMA 1X4PA 2BHZA 1KU7A 1POGA 1TT5B 4CCJA 3BROA 5KK1A 1TLHB 3LWFA 4AYBA 1E17A 3BJOA 4L18B 1IV8A 3MMYB 5E1XA 3G4SI 4C30A 2BV6A 4Q4ZF 4BAYA 5K7FA 3SFZA 3J81Z 4S04A 4NC7A 4EMSA 5B1AH 5BNGA 3FK6A 4QTRA 2E35A 3JCUC 3PNYA 1HSTA 3JR9A 2QZ8A 9ANTA 1ZKGA 2B7EA 2LVSA 4QPOA 2QYOA 3H36A 5HODA 1S72I 4XKWA 5F0CA 1IW7F 2ECBA 3PIOF 4GFBA 2IS2A 2QENA 1SEUA 4LOCA 4WK8F 1VQ4I 2PQ8A 4NB5A 2ME0A 2W48A 2ZKZA 1ERDA 2AQFA 4BDYA 3F8MA 3HM5A 3TDUC 2L02A 3O8HA 1J7KA 3WGIA 3KYDB 4N4NB 1XG1A 5JVGF 1D5VA 3I59B 2HYGD 1IV6A 4V2GA 2X1DA 3BTIA 2HYFA 1CF7B 2JPBA 2VI6A 2LD5A 1MJBA 3FDYA 1CGPA 1TQIA 2L7ZA 2Q2EB 2WWYA 2H8WA 1T39A 4PZJA 2RAEA 4U88A 2OPTA 1YLFA 3FMQA 3OYHA 1WWXA 1K4TA 4RB1A 5BOXA 2UWMA 1V54H 3WTVC 4V2FA 2L7FP 2LK2A 3JAMZ 1RRJA 1MJ9A 3ZQIA 5FKKA 5DDGA 3MKYB 1OPCA 3FIWA 4ASNA 3HIFA 2DA7A 4H0EA 1C0WA 2LKSA 4E70A 2IA1A 3H1CA 1MIJA 2OA4A 4MNUA 3ZMVA 1Y8QB 1LKXA 1UG2A 1XGOA 1YI2I 1AA7A 2R7OA 3MKWB 1DDNA 2X6YA 4I98B 2E34A 3I59A 2R5ZA 1JGGA 3M8EA 1O7FA 1CF7A 4M6XA 4PCQA 5A2QK 1VI0A 2Q2EA 2W84A 1ETKA 4O3MA 1R22A 4UVAA 2JA7J 4BYYA 3ML6A 4A3IJ 3L2WA 4A6DA 2KL4A 3N4MA 1MMAA 1IXRC 2VT2A 2QLZA 3F23A 1RKTA 2CV2A 4RAGA 4Y3OA 3KCCA 3OYLA 1XMAA 4R8HA 4PFPA 3SDBA 1JE8A 3HOUJ 2NOJB 1W36C 3ZPLA 2GZWA 3M1EA 2Y0MA 2AXTC 5ICEA 1SC7A 2HQAA 2QSFX 2R93J 2VKHA 5HS8A 1X2MA 2DPUA 3QPHA 4PGHA 2NS8A 4LLLA 1F9NA 4YIFA 1KQ0A 3GFJA 2B0LA 4UHTA 3LSRA 1HLVA 4ZZDA 1TNTA 3CCLI 2HFHA 2M0CA 2VXDA 1OISA 4LK1F 3JRDA 4BH9A 4EV0A 4X6AJ 4E7HA 3NWTA 2DT5A 1MNDA 1I50J 1MMSA 3KYLA 3S1QJ 2LTPA 2X9DA 4XRFA 1W0UA 1VQMI 3MVPA 2NNYA 3IRQA 2JVGA 4R79A 5KNLA 2DQLA 4CCLA 4Z2YA 1QQIA 4N9IA 2VKEA 1IRXA 1FYLA 1JUPA 2JWTA 5FFXA 2FSWA 1X4OA 2EILH 2OQGA 1FYKA 2VJJA 4II3A 1Y56A 4HAMA 5IP9J 1FYMA 5LEKA 5CJ9A 3ZQ7A 1RUNA 1VQ5I 2OV7A 1D1CA 3C2HA 4Y17A 5TISC 3SQNA 3BJAA 4S0HB 3W6KB 2AXLA 2JUCA 2RV8A 3JRIA 4BE2A 3I54A 3QRFF 3QYEA 5FGMA 4EM2A 2DN0A 2Y48A 3KE2A 2OUMA 3RPUA 4HF1A 5FB2A 5JLWA 3BG6A 2M34A 3VOEA 2P7VB 2CU7A 5JR3A 3LOCA 2VE9A 3GF2A 2OQRA 1MW7A 1TWAJ 3SFIA 2IW5A 2R7VA 1XGMA 2ZB9A 3J80Z 1OYYA 3S15J 2Y69H 1IJWC 2LREA 2STTA 4A3DJ 2KRCA 2P8TA 3IL2A 1UJ8A 3ZMUA 3LSTA 2RQPA 1FPQA 5C44J 2CS3A 1NH3A 3VODA 1I1SA 2WA0A 3S93A 3VEPA 3MZYA 5IT3A 3HOYJ 4R1HA 3L2RA 1GXPA 4BUPA 1S5LC 2OTJI 1D0YA 2PMUA 2IGNA 1MBEA 3F8CA 4YFNF 2E1NA 3H5RA 5KHDA 2XROA 2K3FA 5DV5A 5J40A 1HA8A 4BU2A 2XAUA 4Q48A 1XDUA 3BY6A 5DCMB 4RA2A 1WJBA 3H35A 1Q1VA 3U1KA 3LAPA 1S9HA 4L5JA 4IHSA 1PVEA 5FD6A 5K5RA 1DQUA 3HOSA 1OR7A 3DFGA 3MCZA 5IP7J 4OIRF 2VB6A 3H9JA 3K4NA 3LQQA 4F93B 3CMEI 1AHDP 3ESWB 2QA4I 4HNTA 4PDKA 5D6EA 3CESA 5DD4A 3RTRA 5CQGA 1ETXA 1SMYF 3FHNA 4PGGA 1XSVA 1K6OA 2R92J 1NK3P 1H88C 1VQPI 4UV9A 5GADJ 4UXNA 3U9GA 4LB5A 4HSRA 1ZGAA 1JI8A 3CP8A 4GGGA 2JZYA 3ERED 3I4PA 2OBPA 3CDLA 5DCMA 4LLNA 3BTLA 1JHHA 3EUHC 1Y1VJ 2HNHA 1XSDA 5B5EC 3E97A 3A1YA 4L5IA 3BG5A 2ECCA 4I76A 2XAQA 3OYGA 2EINH 2JSCA 3DF8A 2DMQA 4BQNA 2QSHX 1XN7A 2IRFG 4BACA 5E1WA 4B3AA 3B73A 1BR1A 4NC8A 4A3JJ 3O2PE 2BZTA 3ROUA 1HDPA 1N75A 1XMKA 3ZQHA 3ISPA 2DQRA 4I0AA 1GV5A 4PJLA 3HHGA 4RGUA 2A6EF 2JPCA 4BXUA 3HKZN 4XLAA 2X1CA 2EZLA 3EYYA 2ZXIA 5DUIA 3E6MA 2X51A 3K2ZA 4A69C 1U78A 1EF4A 2QQBA 3T5XA 3A02A 4A5MA 2XSDC 2HTJA 1VQOI 4MQ9F 3QAHA 1SAXA 1IRGA 5ICGA 4XSZF 2DYRH 1T0FA 2ZMEC 2CW7A 3M1CA 4L5EA 4FTHA 3GCMA 3ZQCA 2Z16A 3OR1C 3D5SC 4YELA 1IN5A 2CO5A 2P81A 4B4CA 3M8FA 5K7HA 2EIKH 3OWTA 2DTRA 3E1SA 1MH4A 2KHMA 3MWMA 4DGWB 4XQFA 3H5AA 4P9UA 1X1DA 2CUZA 4QWQA 4U7DA 3HKZA 3WTTC 3H3UA 4N0BA 2V9PA 2RDPA 4UY8I 1S7OA 1O3SA 3M07A 1B4AA 2ID3A 4XKBA 1B6AA 1I3AA 2K7LA 2HKXA 3I53A 4XOPA 3PJRA 4BBRJ 3QODA 5FROA 1DU6A 2O8XA 3HOTA 4CGZA 2IA2A 3F72A 4E6KG 4PSXA 2FNPA 2EQRA 4Y4RA 3JW4A 4LIUA 2MC3A 3Q3SA 5DD8A 1FX7A 1ZQ3P 2JJ7A 5FLVA 3TKYA 5D8LB 1IRFA 1UMQA 1K6YA 1AU7A 4OIQF 5HVQC 1HW1A 4C2UA 3OOUA 2F4OB 4EM1A 4G8XA 4DQ2A 4Z6YA 4L0ZB 5TRDA 4MEXF 5KAFC 3GYHX 2CUFA 3MEXA 2DBBA 3AG1H 3OIPA 4P1WA 5JHFA 4ZTFA 4J01A 2W85A 3D1NI 4DJAA 5GAHJ 4RAFA 3EQLF 4JBAA 3DTKA 3QPLA 3FMSA 4OWRB 3AFHA 3H92A 2IVMA 3A0HC 2V6CA 2ZBKA 3H9QA 2FX0A 1VFCA 1ETWA 4EQQA 1AWCA 3CC4I 1SD5A 2NVQJ 3BPXA 1G3WA 4OOIA 4M71A 5IYCJ 4XLEA 4HV6A 4E7IA 2ADUA 3G1OA 3ZMSA 1HDDC 3Q0VA 3EDPA 3RKWA 4J00A 2R7WA 3D5RC 2JA6J 4F55A 3TEDA 4U0YA 4IF4A 1TQPA 4FE4A 1W1WE 3CMYA 4HZFA 3GO5A 3VFZA 1J9IA 4LIVA 5CVUA 3CJNA 2OJED 2L4AA 4MFEA 2DA2A 2MG4A 3R0JA 3HTUA 1WI9A 2O7OA 2DA6A 3G2BA 2WTEA 3PO3J 2EZKA 2QM3A 3BTJA 1ODDA 1WKMA 3ABLH 3FXRA 2EBIA 3DPUA 5E3NA 3FISA 1RR8C 2E71A 2NOGA 2DA1A 3BDDA 4RAYA 3VDXA 5EGOB 5ICFA 5D5VB 4RS8A 2KKOA 2MSYA 2XGEA 3KP5A 5GAEJ 5D5WB 5J3LA 4XLCA 1YITI 1YX5A 1M1EB 2CRGA 3X2QH 3SJMA 1DP3A 3O6BB 1K78B 1VTNC 3H3VK 2HTSA 3P9KA 2LFBA 5LHGA 2OAZA 3GLXA 2HGCA 3CLQA 1FTTA 1EH7A 3OYFA 3PUBA 3S17J 3FZVA 3MFKA 4HX8A 2AHQA 1XD7A 1SFUA 2GA2A 3C1DA 4HF2A 2R7QA 3RQ4A 2VPLA 4ON0A 2JSPA 4DYQA 2GAUA 1YW9A 3S1NJ 4A3LJ 4P55A 2OZ6A 3CCSI 2L5QA 2OC6A 1BL0A 1LUJB 2PJRB 5IT9Z 1IN8A 3GFMA 5EGOA 3CCMI 1KGSA 3E7LA 2V7FA 1OMIA 1MBKA 2EFNA 2Q1ZB 3HB9A 3MD2A 3BR6A 1GVDA 1K7AA 1Z77A 1OCPA 4ETSA 2RNGA 5LLQA 4F3QA 1QGPA 4MTDA 2DDAA 1HCRA 4AD9A 4A0YA 4U7BA 1K78A 4OMZA 2OU2A 3OSGA 2HOSA 1X1BA 1Z6TA 3T8RA 2IS6A 3P9CA 2M2EA 3ECOA 2RQQA 4XLFA 3WTWC 3LAJA 2LY2A 2CV0A 4LB6B 1HBXG 2F5CA 4AIKA 2HI3A 1YX3A 1FNNA 4CZZA 2KZVA 3COAC 4IQ4A 4W97A 5E79C 2L9VA 2PLYA 5ERIA 4WXHA 1IAWA 2G7UA 1Y0UA 2BY1A 1S8NA 2FRHA 2ZSIB 4LFUA 2KRHA 4RLFA 1P4WA 2KPMA 3TBIA 3RZDJ 2PJRA 4FX0A 4CUGA 4BXXJ 3Q9SA 2W82A 2DW4A 3L1PA 2BVLA 2DMTA 1ZARA 2R7TA 3VYTB 5F6FA 2WY8Q 3J81K 4RBOA 2EFPA 5F1RA 2CQKA 4RMNA 1HW2A 4YRVA 1J59A 1ONVA 2LOOA 1UHWA 1ZG3A 2KIQA 2O9LA 3H0DA 4EGYA 5C3EJ 3CCEI 2LKXA 2O8KA 1A04A 5HS9A 4UUVA 4KN7X 3REOA 4ZZLA 4PUSA 2VONA 3FXKA 3HC7A 1J5YA 2L2OA 2EB7A 1Y6IA 3A01A 1TWFJ 3HGYA 4HOBA 2BXZA 4LITA 4D5FA 1VQLI 1MBHA 2IS1A 4KJZA 3HXLA 2COBA 3G1LA 4HDUA 1SVMA 2UXXA 2A68F 3QP6A 4KA4A 4FETA 3C2BA 3OL4A 5FFZA 4G7HF 4B8XA 3SZTA 1ZR2A 3RKYA 4I6ZA 4C2TA 1WSUA 3LNQA 2ZJPF 5E20A 1FP2A 3QU3A 2J5OA 2A05A 3DEUA 3GEZA 4ZYAA 3JAMK 1O3TA 3GTOJ 2E19A 4XRMA 2XIGA 1JT0A 3LSIA 2V9VA 4DOZA 3E0JB 3L09A 3EPZA 3HJEA 3BQYA 1L3LA 5H6RA 4EATA 1DUXC 4I0BA 5F27A 1Z3XA 2IT0A 2W00A 1GHCA 4HRIA 2F48A 4LMYA 1KU9A 2HU9A 4G7OF 3BR2A 3IC7A 1A5JA 3QPTA 3DP7A 5BPIA 4GDFA 4B3XA 2IEKA 2E2IJ 2MLKA 1T2KA 4WCGA 2VIXA 2IP2A 3ZXSA 1U3EM 3BZ6A 1FOXA 3WE2A 2VPRA 2ZJ2A 3DEWA 2VBWA 3RYRA 3S3OA 5CVJA 3L2QA 3ZQLA 1FBQA 2H27A 3IUOA 2VODA 5HDKA 5ICCA 5HOOA 4EJOA 2E5ZA 3ZRGA 1TZLA 3S3MA 4IZZA 1ZREA 4XRSA 3OYJA 2QEXI 4A3MJ 2DU9A 1XS9A 2V4JC 4BJTA 1LEAA 1RNLA 1G3YA 2XPWA 4LG3A 1I1GA 3ZMTA 3IHUA 5EZGA 2OF7A 4YFXF 1LDJA 4EGZA 4BXFA 5J1RA 2DLLA 4HNUA 1BJZA 1XX5A 4WWCA 4UVBA 3WU2C 3GLLA 4M3GA 1Z7UA 1FMVA 2YX4A 4OAYA 4BS9A 3F22A 1P92A 1SD6A 1YOVB 2E7XA 2E1MB 3I4NJ 3ASNH 3ZN1A 3M9AA 5FD5A 2O03A 2L7MP 4BQAA 2UZKA 2EPFA 2ZSHB 2BEOA 4Y7NJ 2IPQX 4BHPA 2ZCWA 1YO5C 2L9SA 3K2AA 3CF5F 2HXIA 4MFDA 4Y13A 3GTJJ 3LSMA 5TGTA 3TW7A 2RKHA 1F5TA 1O7LA 4M9XA 5HDGA 4CXFA 3I55I 4CA0A 4AM3A 2K27A 4D0PA 5IYDJ 4MHGA 4XIDA 3KIOA 2PG4A 3K4JA 2XRNA 2L54A 2HXOA 4XNFA 3FBNB 3ELKA 4EVIA 1OR7C 5FJ8J 4B1RA 4XORA 2M45A 2MH9A 3CCRI 3PSFA 5EEGA 2M0MA 3WHCA 2P5LC 4QLCU 3V42A 1B8IB 1UB9A 2CQNA 2VQLA 3H3ZA 3ZMDA 1FWZA 1MBGA 3E5XA 2BY2A 5KAIC 4KIBA 1Z1DA 4RM2A 1S7AA 4EJWA 3D0SA 1QBJA 4C9YA 2HVRA 3OL3A 3AG3H 1YS7A 3V4GA 2LMDA 3KZIC 1RESA 4KN4X 3J80K 2OTLI 1V5GA 1S3JA 1RPWA 4G94A 1U2WA 4D5CA 1WRJA 2BYVE 5BMZA 3DTIA 1ON1A 3WGHA 1V55H 2FUG2 1OCOH 1NTCA 3UR3C 3KFWX 5DCFA 5EYRA 3DBLB 4CCKA 3KEOA 2Z3YA 1GUUA 5H6QA 2W24A 3OYMA 1HF0A 3BR1A 3DLAA 4E7ZA 2F5EA 2D2WA 3GBGA 3DEEA 3QYFA 4IEJA 3MZ8A 3CC2I 2BBYA 3FXOA 1FY7A 2NVTJ 2X48A 4HNVA 1B8IA 2G0EA 3U21A 3GTLJ 2XRLA 1BI3A 2Z1DA 4F7ZA 1YW8A 4D7MA 1NHAA 1UG0A 4BEHB 5K5OA 3GTKJ 1HOMA 4AC0A 1LNWA 1R58A 3EUKL 4A3EJ 2XAHA 1HW5A 2V1DA 1GV2A 3OS2A 1D1BA 4RB0A 3CCQI 3RIRA 2WBMA 4RGXA 2ZFUA 3K4BA 1IF1A 1J2XA 1T0FC 5IOYA 2M4GA 5LFAA 1R1VA 3HDDA 1TW2A 1N78A 3I0TA 4A3KJ 3J7AY 3O3KA 1YQAA 4RDUA 3E3VA 1ZYRF 1FSHA 3VYRB 2XGCA 2F5FA 5HNHA 1E2XA 1D5YA 2OZUA 4J19A 1I39A 3DU6A 1DGWY 2HQ5A 3M8JA 3TDZC 2EH3A 3FK7A 2VOOA 2K4BA 5J1UA 2FJ1A 2EA2A 3Q9VA 4M73A 3RSNA 1QPIA 3S2HJ 3KP6A 4A3FJ 3I58A 1FBSA 5IOZA 1YRNB 4JX6A 4BEHA 1WJDA 3GW2A 2Y9ZA 5L3GA 4HF0A 1ON2A 2CSOA 2XAJA 1T38A 2DODA 3PM1A 4YIRX 2FMYA 3PSIA 2L01A 1NK2P 2QF7A 4TV7A 1YHQI 2CV1A 1BBYA 1WCMJ 5IP6A 3L2CA 3BT9A 3HRUA 2DJIA 2EV0A 2F4IA 5F64A 2ME6A 2VE8A 3DCFA 4DYCA 3BPVA 2YSRA 1D0ZA 4JOMA 1HKSA 1EA3A 2FOWA 3IAM2 3ECHA 2GOMA 5H2FC 1P9QC 1FLIA 2R7ZJ 1JJ6C 5LEJA 1E0EA 2O6GE 2KIUA 1GDTA 2DMPA 2VJIA 2Y9YA 3SDGA 3T8TA 3IRRA 3RCOA 1YRNA 4MQVA 4RB2C 2TCTA 3IWFA 2MW8A 2HZDA 3HPGA 1Z05A 2WV1A 3PNTA 2F5DA 4KFCA 1T56A 2EFWA 4CICA 1FOWA 4HSTA 1FJLA 1VQ9I 2X1EA 4G6DA 3LSGA 1RI7A 5D4RA 3K9TA 1FIPA 1X1AA 3I3LA 3TO9A 5EEAA 3HUGB 3WGGA 4BE1A 3KZZA 2MH2A 2GIZA 2MYSA 4IVNA 4OAZA 4M6YA 1LJ9A 2FD5A 2KIMA 3GWZA 4RM3A 4JX4A 4XLHA 2KDZA 2BXYA 2HQNA 5E3LA 3AAFA 1IXSB 2QKMB 3JREA 3OY9A 1X1CA 4DZJA 1ACIA 1EH6A 2EIJH 6PAXA 2HWVA 1KQ9A 3K6GA 4G12A 4XSXF 4HPQA 2W57A 3G1MA 5GTHC 2R7DA 3OMYA 3OIQA 1WJ5A 3RQIA 3S2WA 2FU4A 4B44A 2M5WA 2V1NA 4ZDLA 1KQ8A 4M6VA 3VYUB 1MSFC 2MFZA 4JX5A 1QZZA 2ZXHA 1USTA 4IPAA 5L3EA 1H9TA 2CW8A 1LPQA 1BI0A 3HUGA 2PBIA 5FLXZ 4KNYA 5CLSA 1W0TA 4XR6A 1JKOC 1BN5A 3CCYA 4DNCA 5JLXA 4CSWA 4NC6A 1U0JA 4CZCA 5LRSA 2CUJA 2DOEA 3PNVA 3PQJA 5FO5A 4AU7A 1ETOA 1R49A 1H8AC 4C3IJ 4XKCA 1P7JA 4LJZF 2QUFA 1MBFA 3W2WA 3DQVC 4JP0A 3TO6A 3SEQA 4M9SA 4PJ0C 4ZDPA 1L0OC 5ILVA 5CQEA 3ZCOA 3BG9A 3PL8A 1U9OA 2FQ3A 1LFBA 1OJLA 5LGTA 5M5YJ 5E8GA 5EF6A 5GP9A 1ZR4A 5E3MA 3HL2A 2ELJA 2GXGA 3DKWA 3DTEA 5DM6F 4A93J 4P9FA 1KA8A 2GIVA 3OYEA 3E6CC 2JRTA 4CYDA 2A6TA 5FRMA 2LP0A 3NWSA 5CVIA 2QQ8A 1U8BA 3AL0B 2QBYB 2CFOA 3QOPA 4I09A 1YJNI 1Y1WJ 2R7UA 3K1NA 1DPUA 2YUSA 1WJCA 5LHHA 4CHUA 5EEHA 2KZGA 2LH9A 3L9FA 3TGNA 4IX7A 3ASOH 1EV7A 1LFPA 1HC8A 2IGOA 3QP5A 2KFDA 2NVYJ 4IXAA 1KZHA 3QYBA 4K2EA 1WH5A 3BZKA 2ESNA 3WU1B 2VJ5A 3ERMA 1IDZA 4IL6C 3L2VA 3I9V2 3GX4X 3S14J 4H4KC 1I3QJ 1RKWA 2Y30A 3C2GA 1B59A 1RC9A 2X0LA 4QIWN 2QVOA 1R9TJ 5J4YA 4M9ZA 2QBYA 5BS6A 4DW6A 4XK4A 2K3PA 4OIOF 2VQHA 1TP4A 3GTMJ 2EZIA 2RGVA 2B9SA 4XN0A 5J8CA 3KP7A 1R4NB 1W5TA 2M7BA 4HV5A 5IT9K 2DT7B 4PJJA 1UFMA 4YG2F 2GM4A 1ZRFA 4PFOA 2F6CA 2A61A 2XAFA 4XLNF 3OYNA 2ZJQF 2L9RA 5IY5H 2VKVA 2XKOA 5DUKA 2CWEA 4EM0B 4XMYA 2P5VA 3WTZA 5F0HA 1V3FA 1FT9A 3BTCA 4M3FA 2ZJRF 3RKXA 1F1ZA 1ETYA 3ULQB 4BL0B 4IHYA 2GBYA 2O61A 2K5CA 1MZBA 2VBZA 5B66C 1JTXA 4M3DA 3JRFA 4W1UA 1X58A 4U0VA 3GTQJ 2LY1A 1DP7P 4Y33A 3ZQQA 1KYWA 1R36A 5BPDA 2FNAA 1H9GA 4E7LA 1G3SA 1WQ2A 2CQ7A 2O3FA 5TJJA 1ORKA 3G3ZA 4L9JA 1SFKA 1ZH5A 2VT3A 1D0XA 1WHUA 2ELHA 3IH3A 2KRFA 4L9TA 4NDLA 1QRYA 2KLOA 2EWNA 3J7ZI 3BOQA 3K70D 1PP8F 4LG0B 2XHKA 4JK1X 3D5LA 2HPIA 2ZO4A 1G59A 2VLAA 1R1UA 1BI2A 4OMYA 3S2DJ 3FWEA 2BY3A 3I56I 3JTHA 1TL8A 1X3WB 1AKHB 3GVAA 4X1EA 4XONA 3BZCA 1P2FA 1OKRA 4E7KA 2ESHA 1BW5A 2NS7A 3H9GA 3ZQFA 4L9VA 5D6FA 2DFEA 3OR2C 3CDIA 1VQ7I 4WXDA 2EK5A 4HQEA 1ZELA 3CZ6A 2LNBA 4A3CJ 4ENKA 2GXAA 5IYBJ 5ED4A 2PEXA 2LC2A 1MMNA 2WADA 3CP2A 1YTYA 2K9NA 4JQFA 2Q0OA 1YYVA 1Z7LA 1PUEE 2CQQA 1GT0C 3CQZJ 4EJVA 3SZGA 1BR2A 4XLPF 2R7XA 3CTAA 2QGUA 3DBHB 3M3YJ 1FSEA 1XCVA 2K9LA 3CUQB 3ABUA 3DPTA 4BHCA 4LG0A 3N05A 3W6JB 4GO1A 4FT8A 1BOBA 2VASA 3R4KA 4YIIA 4LLGF 2NVXJ 3OYKA 1VQKI 1R6RA 4U87A 3J7AO 1RIOH 1AKHA 2L0KA 2VOPA 3HSEA 1JJ8C 3KZYA 3SXYA 5J47A 5CVVA 1SFXA 1T95A 2IXSA 2XKPA 2DOFA 2FQ4A 5LGNA 1HKTA 3NARA 3HPHA 3U2RA 3HRTA 1G4DA 4FISA 3TOBA 1O57A 3K4KA 3JRBA 2GLOA 2CQXA 3K4MA 4IHTA 3HOXJ 3G73A 2I8DA 2R7RA 3HTSB 4YFKF 2HR3A 2W4SA 3VYSB 1V5FA 3B6CA 2Z33A 2FBIA 3GZ5A 2RNJA 3WODF 2DCEA 3GXOA 2HOEA 3CUQA 1UCRA 2D1VA 4A2UA 3JRAA 1X19A 3HRMA 2XF5A 3A0BC 4A12A 2IGKA 2FE3A 2BVMA 2IS4A 2ID6A 5ILSA 4DBQA 2K9SA 4AIJA 1N77A 4LGWA 3ZMZA 2DJNA 3HZJA 2CGPA 4KMUX 2EV6A 1W4MA 2YPRA 2K9QA 2E1MC 1NG7A 1IN7A 5D8KB 2MGQA 1U6GA 2G7HA 1TBXA 1OCZH 1LVKA 2A5YB 2K4JA 4XKVA 4Y15A 3CO7C 3KEYA 2X85A 5FKMA 1J75A 1LVAA 1X3ZB 1EJ9A 4KMFA 3WTSC 2LLKA 1D1AA 3BG3A 2DA4A 2HZTA 5KVRA 4GRIA 4S05A 2R7SA 1SMTA 1ZRCA 3CUOA 2A07F 4LD5A 1F36A 1YFHA 2E2HJ 1QZEA 2QCOA 4DIQA 2Q8KA 2FXAA 4G7ZF 2HS5A 2H6BA 2D45A 3K4LA 2DMUA 2KIFA 1H89C 1BM9A 5HLHA 1WVRA 3GZNB 2MABA 1QHGA 2R5YB 3ZR8X 2V1XA 4ZYGA 1VNDA 5M3FJ 3B6AA 1Y39A 1K83J 1A6QA 3A03A 2DFIA 3WTYC 4G9YA 3F6OA 4FE7A 4A3BJ 2IAIA 2NAZA 4IRIA 1G6NA 1MJAA 4HDVA 4MTEA 3VB2A 4MIMA 4I01A 1TQMA 1LDDA 2MD5A 1UHSA 3E6BA 5E3OA 2PFBA 4JYKA 3RZOJ 4UUSB 2RN7A 2RREA 3BP8A 1W7PB 2Z9OA 4IHXA 4GYIA 3VWBA 5FKLA 3FKJA 3R6SA 4WX9A 2BE5F 3LFUA 3SZPA 2NNNA 2AS5F 5E17F 3K1MA 1BC8C 1Z3YA 1V4RA 5L3FA 2PI0A 1U5TB 2R5YA 4M72A 4AIDA 1MNMC 2XB5A 4HX7A 4BQOA 1SANA 4KDPA 1JHFA 1KONA 1WFXA 2L3DA 2MD0A 4BKXA 2EJRA 2P0WA 5K7ZA 2ACJA 3HOWJ 2H1LA 2JUGA 2LR8A 4NNJA 2A3SA 3OYDA 2DMNA 1A35A 1VQNI 1ZG5A 3DV8A 2IBDA 2Y2ZA 4A3GJ 2HOTA 2CJJA 3KLOA 2DK8A 1WJFA 3V7SA 3OS0A 4IHVA 2FBHA 4UUSA 1B9MA 2IJLA 1W7PA 5K1YA 4Q47A 1QVTA 5FLMJ 4PSWA 3TMOA 2VL8A 2FA5A 4XOTA 1PYVA 2V26A 3H5NA 1MMDA 5CYVA 1SVLA 1MMGA 3QU6A 3RPQA 1U5TA 3LSPA 1GLNA 3DKYA 3F3XA 2FF4A 1XDSA 1IN4A 1LDKB 2R5ZB 2FMLA 1YG2A 2V9KA 5DYMA 4CO8A 3BQZA 4RGRA 2PX9A 1E3OC 3T1BA 3W6VA 2ZFWA 2F5VA 2ZC2A 2DAOA 2O0YA 2E5NA 3PFYA 2XGXA 2YU3A 1HXDA 4HLXA 1MBJA 5F1JA 4BY1J 1ZK8A 3BJ6A 3HBLA 2FOKA 3HEFA 4RB3C 4UVCA 1QHHD 3Q0WA 3CJTB
chains in the Genus database with same CATH topology
1GDTA 1BW6A 5FLVA 2DMPA 5M5XJ 1UMQA 1AU7A 2H8RA 2Y9YA 3SDGA 3A01B 3OOUA 1OFCX 1YRNA 2TCTA 5EDNA 2CUFA 2MW8A 2WV1A 3D1NI 2HDDA 1G2HA 1T56A 5F04A 1WI3A 3FKIJ 1FJLA 3QPLA 4QSHA 3LSGA 3QQAA 5C4JJ 1FIPA 2Y0SN 2TRTA 4M3EA 2FX0A 1VFCA 1ETWA 5EEAA 2NVQJ 2JJ7A 4AUXA 3TW6A 3NAUA 3M4OJ 1BA5A 1JKRC 5IYCJ 2FD5A 3JRCA 1WGXA 3G1OA 4JX4A 1HDDC 4MLOA 1JT6A 2KDZA 3UKGA 3Q0VA 1ENHA 2JA6J 5E3LA 5F0FA 4DZPA 3JREA 4DZJA 1VF9A 3TEDA 4FE4A 3CMYA 1FIAA 2K40A 3HOVJ 5DS9A 1LFUP 4G12A 4Y52J 3RKQA 3G1MA 2JMWA 4MFEA 2DA2A 3IH4A 3MN2A 4AYBN 3RQIA 1OCTC 1RR7A 2MG4A 4M6VA 5M3MJ 2O7OA 2DA6A 1WH7A 1MSFC 3PO3J 2EZKA 3BTJA 4JX5A 2VUMJ 2Y31A 2EBIA 5E3NA 3FISA 1TWGJ 2NOGA 2DA1A 5EGOB 5FKNA 1MH3A 1W0TA 1JKOC 2B63J 2MSYA 1SFOJ 2XGEA 3CCYA 5J3LA 1ETVA 3BR3A 2N8GA 3OIOA 5JLXA 2CRGA 4ABZA 2YU9J 3SJMA 1ETQA 1ETOA 1H8AC 3H3VK 1JUMA 4C3IJ 2LFBA 1P7JA 1POGA 4BBSJ 1MBFA 4JP0A 1FTTA 1ZGWA 3S17J 2AHQA 3BG9A 5K7FA 1U9OA 1LFBA 3WHBA 4CYCB 1OJLA 5M5YJ 5EF6A 5GP9A 5BNGA 4DYQA 5E3MA 3FK6A 1ZR4A 1PUFB 3S1NJ 4A3LJ 4QTRA 3JR9A 1QVUA 4A93J 1ZKGA 1BL0A 2LVSA 9ANTA 5HODA 5EGOA 1JKQC 1Z0XA 1B72B 3E7LA 2LP0A 1MBKA 3HB9A 5F0CA 3JRHA 1U8BA 2ECBA 3BR6A 1GVDA 1Y1WJ 4GFBA 1Z77A 1OCPA 4LOCA 2YUSA 5GPAA 2ME0A 2W48A 1HCRA 2EZHA 3IH2A 5EZHA 3OSGA 2HOSA 4DYRA 3HM5A 5DTDA 3O8HA 1XG1A 2M2EA 1IV6A 4V2GA 2NVYJ 3BTIA 3S1MJ 2X6OA 1WH5A 2VI6A 2LD5A 4CYCA 2HI3A 2L7ZA 2DA5A 1JKPC 1IDZA 4W97A 1PUFA 4UUTA 3S14J 2RAEA 5M5WJ 1CQTA 1I3QJ 2OPTA 1RKWA 2Y30A 2XPUA 4QIWN 3RZDJ 2AO9A 1R9TJ 1B72A 4BXXJ 5IPAA 4V2FA 2L7FP 2LK2A 3L1PA 4DW6A 4XK4A 3ZQIA 5FKKA 2DMTA 3FIWA 4IHWA 2DA7A 4RBOA 1IG7A 2EZIA 1UG2A 2R5ZA 3H0GJ 1T33A 2M9HA 2O9LA 1JGGA 2GM4A 1I6HJ 5C3EJ 2LKXA 2O8KA 1MSEC 1VI0A 2L9RA 1TWHJ 4D7NA 1ETKA 2VKVA 2JA7J 1P7IA 4A3IJ 3A01A 1TWFJ 3HGYA 5F0HA 4D5FA 3BTCA 1S7EA 2R0QC 1MBHA 2I10A 4M3FA 2COBA 1RKTA 1ETYA 1WPKA 3G1LA 4IHYA 2GBYA 3ZQGA 1JTXA 3C2BA 4M3DA 3JRFA 4W1UA 1X58A 3IV5A 3HOUJ 3GTQJ 2E2JJ 1IUFA 2ELKA 1F43A 1JUSA 1ZR2A 3HOZJ 4I6ZA 1ORKA 3K7AJ 2R93J 2WB1N 3IH3A 3LNQA 1X2MA 4NDLA 1A6IA 3JRGA 1QRYA 2NS8A 1ZTRA 1DU0A 3GTOJ 2DTZA 2E19A 4XRMA 3LSRA 1HLVA 1JT0A 2M0CA 3JRDA 1LE8B 4BY7J 3S2DJ 4X6AJ 3BQYA 1AKHB 4X1EA 1I50J 5F27A 3S1QJ 2LTPA 2X9DA 1W0UA 1BW5A 2NS7A 3MVPA 3BR2A 3ZQFA 1A5JA 2IEKA 2E2IJ 2D5VA 2VKEA 5EG0B 4A3CJ 5IYBJ 2VPRA 3DEWA 1JUPA 2JWTA 2K9NA 1TC3C 2JA8J 3PO2J 3ZQLA 2CQQA 1GT0C 3CQZJ 3HGGA 5IP9J 3M3YJ 5GPCA 4XRSA 4S0HB 4A3MJ 3JRIA 1XS9A 1LE8A 2NVXJ 2XPWA 1K61A 2DA3A 2DN0A 5EZGA 2OF7A 5JLWA 1AKHA 2L0KA 1JJ8C 5J1RA 2M34A 1BJZA 3OSFA 2CU7A 3GTGJ 3LOCA 2FQ4A 4M3GA 2H1KA 5F08A 1TWAJ 3NARA 3SFIA 5EG0A 5C4XJ 2ZB9A 3ZOBA 4FISA 3JRBA 2GLOA 2CQXA 3S15J 3I4NJ 1IJWC 3HOXJ 4A3DJ 2L7MP 3B6CA 5C44J 1FEXA 4Y7NJ 3JRAA 3HOYJ 2YS9A 1ITYA 3QPSA 3K2AA 2LY9A 2HXIA 1IRZA 4MFDA 1MBEA 4C3HJ 3GTJJ 3TW7A 2ID6A 2CUEA 2K9SA 3VPRA 5IYDJ 4XIDA 1Q1VA 3LSJA 1IDYA 2DJNA 3S16J 4XICA 3O8GA 2HXOA 2WAQN 2K9QA 3TP0A 5FJ8J 4B1RA 2JN6A 2MGQA 3I4MJ 2E1OA 5FKMA 5IP7J 3WHCA 2LLKA 1AHDP 3BG3A 2DA4A 1B8IB 4M3BA 3GTPJ 1ETXA 1MBGA 2R92J 4FCYA 1NK3P 1H88C 1F36A 2E2HJ 4C2MJ 4EEFG 2QCOA 2XB0X 1U9NA 1RESA 2DMUA 1RPWA 1H89C 4D5CA 2M8GX 2R5YB 3CDLA 3BTLA 1NTCA 1Y1VJ 1VNDA 5J1YA 5EYRA 5M3FJ 3B6AA 1K83J 1GUUA 2XGDA 3A03A 3Q0UA 1IC8A 1HF0A 1O4XA 3BR1A 3GBGA 4FE7A 4A3BJ 3BG5A 2ECCA 2IAIA 4I76A 3S1RJ 4IEJA 2DMQA 2NVTJ 2X48A 4HNVA 1B8IA 4MIMA 2G0EA 4B3AA 1FTZA 1UHSA 3GTLJ 2XRLA 1APLC 5E3OA 4A3JJ 4D7MA 4JYKA 3RZOJ 4UUSB 3GTKJ 1HOMA 4AC0A 1HDPA 3ZQHA 4IHXA 4MO7A 5FKLA 4A3EJ 1GV5A 1X2NA 3F0CA 1JTYA 1GV2A 3HKZN 2EZLA 4A69C 1U78A 1EF4A 2R5YA 2JK3A 2JA5J 3A02A 2XSDC 1MNMC 2HYJA 2XB5A 5IOYA 3HDDA 1SANA 4A3KJ 3MKLA 3TP3A 4RDUA 2KT0A 4BKXA 2XGCA 5K7ZA 4L5EA 4FTHA 3HOWJ 1D5YA 2LR8A 3ZQCA 2DMNA 4J19A 4B4CA 2P81A 2HQ5A 2EH3A 3FK7A 2IBDA 1RETA 5J1UA 2FJ1A 5K7HA 2Y2ZA 3S2HJ 4A3GJ 1QPIA 1MH4A 2CJJA 4A3FJ 2HOTA 5IOZA 1YRNB 4JX6A 4IHVA 4UUSA 1XC5A 4XRSG 2HOAA 2Y9ZA 1QVTA 5FLMJ 3PM1A 3BR0A 5FKOA 2PMZN 1TWCJ 2ID3A 3LSPA 1NK2P 2QF7A 1WCMJ 5IP6A 4BBRJ 3BT9A 2ME6A 2R5ZB 3DCFA 1DU6A 4C3JJ 3BQZA 4DYCA 3W6VA 1E3OC 3BR5A 2EQRA 2XPVA 1IGNA 1MBJA 5F1JA 4BY1J 3Q3SA 1ZK8A 3HBLA 3HEFA 1JJ6C 2R7ZJ 1ZQ3P 3GTMJ 3Q0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GDT A;  1BW6 A;  5FLV A;  2DMP A;  5M5X J;  1UMQ A;  1AU7 A;  2H8R A;  2Y9Y A;  3SDG A;  3A01 B;  3OOU A;  1OFC X;  1YRN A;  2TCT A;  5EDN A;  2CUF A;  2MW8 A;  2WV1 A;  3D1N I;  2HDD A;  1G2H A;  1T56 A;  5F04 A;  1WI3 A;  3FKI J;  1FJL A;  3QPL A;  4QSH A;  3LSG A;  3QQA A;  5C4J J;  1FIP A;  2Y0S N;  2TRT A;  4M3E A;  2FX0 A;  1VFC A;  1ETW A;  5EEA A;  2NVQ J;  2JJ7 A;  4AUX A;  3TW6 A;  3NAU A;  3M4O J;  1BA5 A;  1JKR C;  5IYC J;  2FD5 A;  3JRC A;  1WGX A;  3G1O A;  4JX4 A;  1HDD C;  4MLO A;  1JT6 A;  2KDZ A;  3UKG A;  3Q0V A;  1ENH A;  2JA6 J;  5E3L A;  5F0F A;  4DZP A;  3JRE A;  4DZJ A;  1VF9 A;  3TED A;  4FE4 A;  3CMY A;  1FIA A;  2K40 A;  3HOV J;  5DS9 A;  1LFU P;  4G12 A;  4Y52 J;  3RKQ A;  3G1M A;  2JMW A;  4MFE A;  2DA2 A;  3IH4 A;  3MN2 A;  4AYB N;  3RQI A;  1OCT C;  1RR7 A;  2MG4 A;  4M6V A;  5M3M J;  2O7O A;  2DA6 A;  1WH7 A;  1MSF C;  3PO3 J;  2EZK A;  3BTJ A;  4JX5 A;  2VUM J;  2Y31 A;  2EBI A;  5E3N A;  3FIS A;  1TWG J;  2NOG A;  2DA1 A;  5EGO B;  5FKN A;  1MH3 A;  1W0T A;  1JKO C;  2B63 J;  2MSY A;  1SFO J;  2XGE A;  3CCY A;  5J3L A;  1ETV A;  3BR3 A;  2N8G A;  3OIO A;  5JLX A;  2CRG A;  4ABZ A;  2YU9 J;  3SJM A;  1ETQ A;  1ETO A;  1H8A C;  3H3V K;  1JUM A;  4C3I J;  2LFB A;  1P7J A;  1POG A;  4BBS J;  1MBF A;  4JP0 A;  1FTT A;  1ZGW A;  3S17 J;  2AHQ A;  3BG9 A;  5K7F A;  1U9O A;  1LFB A;  3WHB A;  4CYC B;  1OJL A;  5M5Y J;  5EF6 A;  5GP9 A;  5BNG A;  4DYQ A;  5E3M A;  3FK6 A;  1ZR4 A;  1PUF B;  3S1N J;  4A3L J;  4QTR A;  3JR9 A;  1QVU A;  4A93 J;  1ZKG A;  1BL0 A;  2LVS A;  9ANT A;  5HOD A;  5EGO A;  1JKQ C;  1Z0X A;  1B72 B;  3E7L A;  2LP0 A;  1MBK A;  3HB9 A;  5F0C A;  3JRH A;  1U8B A;  2ECB A;  3BR6 A;  1GVD A;  1Y1W J;  4GFB A;  1Z77 A;  1OCP A;  4LOC A;  2YUS A;  5GPA A;  2ME0 A;  2W48 A;  1HCR A;  2EZH A;  3IH2 A;  5EZH A;  3OSG A;  2HOS A;  4DYR A;  3HM5 A;  5DTD A;  3O8H A;  1XG1 A;  2M2E A;  1IV6 A;  4V2G A;  2NVY J;  3BTI A;  3S1M J;  2X6O A;  1WH5 A;  2VI6 A;  2LD5 A;  4CYC A;  2HI3 A;  2L7Z A;  2DA5 A;  1JKP C;  1IDZ A;  4W97 A;  1PUF A;  4UUT A;  3S14 J;  2RAE A;  5M5W J;  1CQT A;  1I3Q J;  2OPT A;  1RKW A;  2Y30 A;  2XPU A;  4QIW N;  3RZD J;  2AO9 A;  1R9T J;  1B72 A;  4BXX J;  5IPA A;  4V2F A;  2L7F P;  2LK2 A;  3L1P A;  4DW6 A;  4XK4 A;  3ZQI A;  5FKK A;  2DMT A;  3FIW A;  4IHW A;  2DA7 A;  4RBO A;  1IG7 A;  2EZI A;  1UG2 A;  2R5Z A;  3H0G J;  1T33 A;  2M9H A;  2O9L A;  1JGG A;  2GM4 A;  1I6H J;  5C3E J;  2LKX A;  2O8K A;  1MSE C;  1VI0 A;  2L9R A;  1TWH J;  4D7N A;  1ETK A;  2VKV A;  2JA7 J;  1P7I A;  4A3I J;  3A01 A;  1TWF J;  3HGY A;  5F0H A;  4D5F A;  3BTC A;  1S7E A;  2R0Q C;  1MBH A;  2I10 A;  4M3F A;  2COB A;  1RKT A;  1ETY A;  1WPK A;  3G1L A;  4IHY A;  2GBY A;  3ZQG A;  1JTX A;  3C2B A;  4M3D A;  3JRF A;  4W1U A;  1X58 A;  3IV5 A;  3HOU J;  3GTQ J;  2E2J J;  1IUF A;  2ELK A;  1F43 A;  1JUS A;  1ZR2 A;  3HOZ J;  4I6Z A;  1ORK A;  3K7A J;  2R93 J;  2WB1 N;  3IH3 A;  3LNQ A;  1X2M A;  4NDL A;  1A6I A;  3JRG A;  1QRY A;  2NS8 A;  1ZTR A;  1DU0 A;  3GTO J;  2DTZ A;  2E19 A;  4XRM A;  3LSR A;  1HLV A;  1JT0 A;  2M0C A;  3JRD A;  1LE8 B;  4BY7 J;  3S2D J;  4X6A J;  3BQY A;  1AKH B;  4X1E A;  1I50 J;  5F27 A;  3S1Q J;  2LTP A;  2X9D A;  1W0U A;  1BW5 A;  2NS7 A;  3MVP A;  3BR2 A;  3ZQF A;  1A5J A;  2IEK A;  2E2I J;  2D5V A;  2VKE A;  5EG0 B;  4A3C J;  5IYB J;  2VPR A;  3DEW A;  1JUP A;  2JWT A;  2K9N A;  1TC3 C;  2JA8 J;  3PO2 J;  3ZQL A;  2CQQ A;  1GT0 C;  3CQZ J;  3HGG A;  5IP9 J;  3M3Y J;  5GPC A;  4XRS A;  4S0H B;  4A3M J;  3JRI A;  1XS9 A;  1LE8 A;  2NVX J;  2XPW A;  1K61 A;  2DA3 A;  2DN0 A;  5EZG A;  2OF7 A;  5JLW A;  1AKH A;  2L0K A;  1JJ8 C;  5J1R A;  2M34 A;  1BJZ A;  3OSF A;  2CU7 A;  3GTG J;  3LOC A;  2FQ4 A;  4M3G A;  2H1K A;  5F08 A;  1TWA J;  3NAR A;  3SFI A;  5EG0 A;  5C4X J;  2ZB9 A;  3ZOB A;  4FIS A;  3JRB A;  2GLO A;  2CQX A;  3S15 J;  3I4N J;  1IJW C;  3HOX J;  4A3D J;  2L7M P;  3B6C A;  5C44 J;  1FEX A;  4Y7N J;  3JRA A;  3HOY J;  2YS9 A;  1ITY A;  3QPS A;  3K2A A;  2LY9 A;  2HXI A;  1IRZ A;  4MFD A;  1MBE A;  4C3H J;  3GTJ J;  3TW7 A;  2ID6 A;  2CUE A;  2K9S A;  3VPR A;  5IYD J;  4XID A;  1Q1V A;  3LSJ A;  1IDY A;  2DJN A;  3S16 J;  4XIC A;  3O8G A;  2HXO A;  2WAQ N;  2K9Q A;  3TP0 A;  5FJ8 J;  4B1R A;  2JN6 A;  2MGQ A;  3I4M J;  2E1O A;  5FKM A;  5IP7 J;  3WHC A;  2LLK A;  1AHD P;  3BG3 A;  2DA4 A;  1B8I B;  4M3B A;  3GTP J;  1ETX A;  1MBG A;  2R92 J;  4FCY A;  1NK3 P;  1H88 C;  1F36 A;  2E2H J;  4C2M J;  4EEF G;  2QCO A;  2XB0 X;  1U9N A;  1RES A;  2DMU A;  1RPW A;  1H89 C;  4D5C A;  2M8G X;  2R5Y B;  3CDL A;  3BTL A;  1NTC A;  1Y1V J;  1VND A;  5J1Y A;  5EYR A;  5M3F J;  3B6A A;  1K83 J;  1GUU A;  2XGD A;  3A03 A;  3Q0U A;  1IC8 A;  1HF0 A;  1O4X A;  3BR1 A;  3GBG A;  4FE7 A;  4A3B J;  3BG5 A;  2ECC A;  2IAI A;  4I76 A;  3S1R J;  4IEJ A;  2DMQ A;  2NVT J;  2X48 A;  4HNV A;  1B8I A;  4MIM A;  2G0E A;  4B3A A;  1FTZ A;  1UHS A;  3GTL J;  2XRL A;  1APL C;  5E3O A;  4A3J J;  4D7M A;  4JYK A;  3RZO J;  4UUS B;  3GTK J;  1HOM A;  4AC0 A;  1HDP A;  3ZQH A;  4IHX A;  4MO7 A;  5FKL A;  4A3E J;  1GV5 A;  1X2N A;  3F0C A;  1JTY A;  1GV2 A;  3HKZ N;  2EZL A;  4A69 C;  1U78 A;  1EF4 A;  2R5Y A;  2JK3 A;  2JA5 J;  3A02 A;  2XSD C;  1MNM C;  2HYJ A;  2XB5 A;  5IOY A;  3HDD A;  1SAN A;  4A3K J;  3MKL A;  3TP3 A;  4RDU A;  2KT0 A;  4BKX A;  2XGC A;  5K7Z A;  4L5E A;  4FTH A;  3HOW J;  1D5Y A;  2LR8 A;  3ZQC A;  2DMN A;  4J19 A;  4B4C A;  2P81 A;  2HQ5 A;  2EH3 A;  3FK7 A;  2IBD A;  1RET A;  5J1U A;  2FJ1 A;  5K7H A;  2Y2Z A;  3S2H J;  4A3G J;  1QPI A;  1MH4 A;  2CJJ A;  4A3F J;  2HOT A;  5IOZ A;  1YRN B;  4JX6 A;  4IHV A;  4UUS A;  1XC5 A;  4XRS G;  2HOA A;  2Y9Z A;  1QVT A;  5FLM J;  3PM1 A;  3BR0 A;  5FKO A;  2PMZ N;  1TWC J;  2ID3 A;  3LSP A;  1NK2 P;  2QF7 A;  1WCM J;  5IP6 A;  4BBR J;  3BT9 A;  2ME6 A;  2R5Z B;  3DCF A;  1DU6 A;  4C3J J;  3BQZ A;  4DYC A;  3W6V A;  1E3O C;  3BR5 A;  2EQR A;  2XPV A;  1IGN A;  1MBJ A;  5F1J A;  4BY1 J;  3Q3S A;  1ZK8 A;  3HBL A;  3HEF A;  1JJ6 C;  2R7Z J;  1ZQ3 P;  3GTM J;  3Q0W A; 
#chains in the Genus database with same CATH topology
 3V7C A;  3E5U A;  4U0W A;  2BGC A;  2M8E A;  1OFC X;  3CDH A;  5EDN A;  2ZXW H;  4II2 A;  2F4M B;  2XAS A;  2TDX A;  2EA4 A;  1Z91 A;  2HDD A;  2K86 A;  5F04 A;  1WI3 A;  1T6S A;  3FKI J;  3RJP A;  1OQY A;  4D1Q A;  5LHI A;  2GWR A;  4HQM A;  4QSH A;  4KIS A;  4I7H A;  3ONQ A;  3S3N A;  5C4J J;  2Y0S N;  3HSR A;  2CYY A;  4M3E A;  1KU2 A;  4XBF A;  2XV4 S;  3HSF A;  3TW6 A;  1OLT A;  4HBL A;  4AUX A;  1HQC A;  4CCN A;  5K5Q A;  2Z2S B;  3GUD A;  1BA5 A;  3IKT A;  1OYW A;  1IN6 A;  3JRC A;  4L9N A;  1OCC H;  1WGX A;  2VQC A;  4I2O A;  1JT6 A;  3UKG A;  3N97 A;  2DFF A;  2DO7 A;  2COM A;  2W7N A;  5CVR A;  3FM5 A;  3KP4 A;  2H94 A;  5DS9 A;  1LFU P;  3M7G A;  3RKQ A;  2NRA C;  2JMW A;  2WAE A;  3IH4 A;  3A4C A;  3V8L A;  5L3C A;  2R3S A;  3BCB A;  1RR7 A;  3K0L A;  2Y0S A;  5BQT A;  2VBX A;  1R5H A;  2VBY A;  1W7P D;  3LA7 A;  4UV8 A;  2OCE A;  1I5Z A;  2DI3 A;  1XB4 A;  2UXN A;  2VUM J;  3V7R A;  2QSG X;  3S32 A;  3SHF A;  3F8N A;  3K69 A;  1AOY A;  1KU3 A;  3W2A A;  3NEU A;  1MNE A;  1QO0 D;  5FRN A;  2B63 J;  4XN3 A;  5HLG A;  3CC7 I;  1J0R A;  3BR3 A;  3CD6 I;  4CCO A;  2KP6 A;  3DKX A;  1K4S A;  3KX2 A;  2J5P A;  3L00 A;  3JTG A;  2VN2 A;  4LK0 F;  3CCJ I;  2LBF B;  1V5E A;  4BBS J;  4GCV A;  5E1Z B;  2XC7 A;  3HRS A;  2H09 A;  3C3W A;  1REP C;  1ZGW A;  2M7A A;  2KMU A;  2IA0 A;  2VJ4 A;  1IXC A;  2KQR A;  4EJT A;  4AVZ A;  1RUO A;  1W5C C;  3CCV I;  2FBK A;  3K4C A;  3WHB A;  1Z9C A;  4CYC B;  2QKL B;  3U1D A;  3OV8 A;  4KIF A;  2WAF A;  1PUF B;  3KEQ A;  1DPR A;  2KDO A;  4NQW B;  1QVU A;  3CLO A;  2OCC H;  3RDI A;  1JKQ C;  1Z0X A;  1B72 B;  2UV1 A;  3TQN A;  1JXS A;  4F52 A;  1MGT A;  4RGS A;  3JRH A;  1WZ2 A;  4G6T B;  3GFI A;  3KLN A;  4FX4 A;  2P5K A;  2DXI A;  1YE9 A;  4KIT B;  5A2Q Z;  2O5R A;  3F6V A;  3ABT A;  5GPA A;  2BW3 B;  3K70 C;  3ABK H;  3T0Y A;  2EZH A;  3IH2 A;  5EZH A;  2LBF A;  3FHZ A;  2V6E A;  4DYR A;  5DTD A;  2I5U A;  3RI4 A;  4IKF A;  5KCM A;  4A6E A;  3G6E I;  1USS A;  1XCB A;  1Y0N A;  2JQ7 A;  2V79 A;  5FLX K;  2BY0 A;  4KT6 A;  4IJA A;  3P9I A;  3S1M J;  2X6O A;  3DLL F;  3Q5F A;  1STZ A;  3K10 A;  4AVP A;  2H6C A;  4ZYD A;  4CYC A;  4PJM A;  3V8J A;  5E8I A;  2DA5 A;  3WU0 A;  4ANJ A;  1JKP C;  1PUF A;  4UUT A;  1FOY A;  1E3P A;  2XF7 A;  5M5W J;  4NQW A;  4DBR A;  1CQT A;  3AL0 C;  2XPU A;  4RAZ A;  4ENJ A;  2HVS A;  2AO9 A;  1TNS A;  1B72 A;  4O6J A;  5IPA A;  4PK4 A;  5GAG J;  1Z6R A;  1QZY A;  1VZ0 A;  1O3R A;  2KJC A;  1UEL B;  2A6H F;  4OIN F;  2BW3 A;  4XL9 A;  4X0G A;  2ISZ A;  1IG7 A;  2BHY A;  4IHW A;  3E5Q A;  4ZC3 A;  2E36 A;  3FXL A;  2OD5 A;  2NYX A;  3CMA I;  1IUY A;  4E7S A;  1IO2 A;  1ZHF A;  3H0G J;  1T33 A;  1Z67 A;  2F2E A;  2M9H A;  1SFE A;  1I6H J;  1PP7 U;  3NQO A;  1ZGJ A;  1GXQ A;  2LKP A;  5B3S H;  2LYC A;  4KUM A;  1GVJ A;  1R5I D;  3KET A;  1MSE C;  3WTX C;  3ZGK A;  2XDV A;  2R7F A;  1TWH J;  3BCA A;  4D7N A;  5D5U B;  1RZ4 A;  5CKT A;  2WC2 A;  1P7I A;  3HG9 A;  2DOA A;  1R7J A;  4CH7 A;  1S7E A;  2R0Q C;  1A36 A;  2JTV A;  2I10 A;  2KIS A;  4P5O A;  2CH0 A;  1WPK A;  5HS7 A;  1R00 A;  3B02 A;  3ZQG A;  3P5J A;  2LRD A;  3IV5 A;  1VQ6 I;  3I5U A;  3FXJ A;  1FC3 A;  4FHT A;  2E2J J;  1IUF A;  1FP1 D;  2ELK A;  1F43 A;  2NVU B;  1JUS A;  1Z21 A;  4E4H A;  2K9M A;  5EJC A;  2HVQ A;  2A69 F;  2XVC A;  4ZJZ A;  3HOZ J;  1D8J A;  1B9N A;  3K7A J;  4B47 A;  2WB1 N;  3IWZ A;  1A6I A;  3JRG A;  4ENN A;  1ZTR A;  1DU0 A;  3R60 A;  2DTZ A;  3RPU D;  3J7Y J;  2VC0 A;  2ETH A;  1BOA A;  4N9H A;  2XUB A;  3FXU A;  3IKV A;  5J6X A;  2D1H A;  2ZXJ A;  2HQR A;  1YJW I;  3P7N A;  1R71 A;  1LE8 B;  2CG4 A;  4L0Y B;  2DK5 A;  2EV5 A;  3BWG A;  4BY7 J;  1BIA A;  1H0M A;  4EJU A;  2C6Y A;  5HLT A;  3G71 I;  1BR4 A;  4BNC A;  4ITV A;  1JGS A;  3IAS 2;  1EH8 A;  4BHB A;  2NS0 A;  3NRV A;  3K1P A;  4CDG A;  2D5V A;  3DWL E;  5EG0 B;  4ESJ A;  3LSK A;  3AG4 H;  3CO6 C;  2WB1 A;  1P4X A;  2XF6 A;  3L7W A;  5J4V A;  4V19 K;  2BOL A;  1TC3 C;  1FOK A;  2JA8 J;  3PO2 J;  2K85 A;  2XAG A;  3HGG A;  2XSJ C;  2P6T A;  2LG4 A;  4I99 C;  5GPC A;  3GFL A;  3FMR A;  3F8B A;  5L3D A;  3JSP A;  1MKM A;  3CMM A;  2GQQ A;  1F4K A;  4P96 A;  1LE8 A;  1K61 A;  2DA3 A;  4HG2 A;  2DDB A;  2V1U A;  2QQ9 A;  1G3T A;  3OSF A;  4ESF A;  2P7C B;  2HDW A;  4BQQ A;  3GTG J;  2M87 A;  2IGM A;  1T8I A;  1BC7 C;  2H1K A;  3PUF A;  5F08 A;  5C4X J;  5EG0 A;  1BJA A;  3HYI A;  5J8F A;  4PJN A;  3ZOB A;  3V8K A;  2VKD A;  1B1B A;  4AWX B;  4BJ5 C;  3FXQ A;  2LF7 A;  3CUQ C;  4BDZ A;  2JRM A;  3CJR B;  3A2K A;  1QPM A;  1TW3 A;  1R1T A;  4RLQ A;  4ZH4 F;  1FEX A;  3FXM A;  3F21 A;  3DPL C;  4ENM A;  1DGR M;  1YIO A;  2YS9 A;  1ITY A;  1W36 D;  5AON A;  3QPS A;  2LY9 A;  1P6R A;  3KPH A;  1IRZ A;  1ZAO A;  3CJQ B;  4HEA 2;  4C3H J;  2GXB A;  3LA2 A;  4A5N A;  1XGS A;  4B09 A;  3MAJ A;  2CUE A;  3WG7 H;  2LF8 A;  2ZNZ A;  4I02 A;  3VPR A;  2VC1 A;  1ZLJ A;  3F8F A;  3LSJ A;  1IDY A;  3QOE A;  3S16 J;  5JI6 A;  3FX3 A;  4GXO A;  4XIC A;  3O8G A;  3EYI A;  4O5V A;  2DT6 A;  2WAQ N;  1O3Q A;  3TP0 A;  4KYW A;  2PJP A;  1YW7 A;  2E7W A;  2JN6 A;  4A0X A;  5JVT A;  5LGU A;  3I4M J;  2E1O A;  4MGR A;  4M3B A;  1ULY A;  3GTP J;  2HKO A;  5D4S A;  4CCM A;  1WJE A;  2RVC A;  1XPX A;  3VSL A;  2X4H A;  2JVH A;  4M74 A;  4FCY A;  4NBQ A;  3QWL A;  2WY7 Q;  4C2M J;  1R23 A;  4EEF G;  1QNT A;  2Y75 A;  3FM3 A;  3LSH A;  2XB0 X;  3BLY A;  1U9N A;  3IP4 B;  3RYP A;  4ZYH A;  2M3A A;  4ZYE A;  4KIG A;  2WV0 A;  3E6D A;  4FQG A;  2MC4 A;  1IZ1 A;  2G9W A;  2VXZ A;  4OIP F;  2M8G X;  4NHJ A;  3OYB A;  2WAQ A;  2ICW G;  5J1Y A;  2XGD A;  4HLY A;  3MZH A;  3EUH A;  3Q0U A;  1IC8 A;  5ILU A;  1O4X A;  2JA2 A;  3OOP A;  1FMW A;  2CW0 F;  3F9K A;  4G6Q A;  3S1R J;  1LQ1 A;  2FEZ A;  3ABM H;  2ZME B;  2ISY A;  4HX4 A;  1PJR A;  3PFI A;  1YIJ I;  1FTZ A;  1ZN2 A;  3TOA A;  1HKQ A;  1APL C;  4IOA F;  2YR2 A;  2L4M A;  3MKZ A;  2KJB A;  3TO7 A;  2PN6 A;  2YX7 A;  4ESB A;  5LBQ A;  2P4W A;  3WTU C;  3HHH A;  3LMM A;  3KP2 A;  4MO7 A;  2X6X A;  2RC4 A;  4B43 A;  1X2N A;  3F0C A;  2W1O A;  1JTY A;  1ZG1 A;  3FBI B;  4HYE A;  4N4O B;  3GZ6 A;  1UAA A;  3WE3 A;  4MEY F;  2JK3 A;  1ZRD A;  3SYT A;  2DPD A;  2JA5 J;  1R5G A;  3I64 A;  1S29 A;  2HYJ A;  3DXJ F;  1XGN A;  1FZP B;  4KT5 C;  3MKL A;  3TP3 A;  1FBU A;  3BG7 A;  2KT0 A;  3L2U A;  5B1B H;  2HEO A;  1YS6 A;  3CCU I;  3BC8 A;  3ZP5 A;  3SEZ A;  1X3U A;  2M1B A;  4A0Z A;  2ZME A;  2UUZ A;  1SD4 A;  2AQE A;  4UB8 C;  1RET A;  1XTA A;  3C18 A;  3LQR A;  5D5X B;  3OYA A;  1MD0 A;  5AIQ A;  5AIP A;  1U8R A;  5HDN A;  5HLI A;  1XC5 A;  3LA3 A;  1YJ9 I;  1QA6 A;  1HSJ A;  3CF2 A;  4XRS G;  1Q1H A;  2HOA A;  1R4M B;  4BJ6 C;  4E7J A;  3ZN0 A;  3PIP F;  2MA3 A;  1U5T C;  3BR0 A;  2EFO A;  3R0A A;  5FKO A;  3W3C A;  3C7J A;  2PMZ N;  2EIM H;  1TWC J;  2Z99 A;  2HPM A;  3DBR B;  2EFQ A;  2MLG A;  4YEJ A;  1T98 A;  2LDU A;  4OU0 A;  4AIH A;  3TL4 X;  2A5W A;  4C3J J;  3FF5 A;  2ZNY A;  4Q5S F;  3BR5 A;  2QQA A;  2E1C A;  2XPV A;  4IRH A;  3PQK A;  1IGN A;  2M30 A;  1LEB A;  1UHM A;  3OYC A;  1PDN C;  5GTI C;  2NXN B;  5JHU A;  3KP3 A;  1SD7 A;  2K02 A;  1SVO A;  5E18 F;  1ZLK A;  1BW6 A;  1P4A A;  2M4K A;  1J09 A;  5M5X J;  1T08 B;  2L7K A;  2Z5U A;  2H8R A;  3A01 B;  1UZC A;  3VSK A;  5CPR B;  5HNF A;  1XMX A;  2DFH A;  4IRG A;  3EUA A;  5LD2 C;  1OYI A;  4IOC F;  1D3Y A;  2PMZ A;  4D9J A;  1MDM B;  1G2H A;  2PMH A;  2CFX A;  4NUB A;  1K79 A;  1E3H A;  3QQA A;  1XSX A;  4KIC A;  2TRT A;  3LFK A;  1BIB A;  3LL7 A;  2W25 A;  3UNG C;  2LSO A;  2QWW A;  4HA8 A;  3NAU A;  1VQ8 I;  4HW0 A;  3M4O J;  2CMP A;  1JKR C;  2X6W A;  3WG9 A;  1NG6 A;  1OCR H;  4ZTJ A;  4MLO A;  4IO9 F;  2JT1 A;  4F92 B;  1ENH A;  3AKZ A;  3JSO A;  5F0F A;  4DZP A;  2E60 A;  3OYI A;  3GME A;  1VF9 A;  2GA1 A;  1D8K A;  1BI1 A;  1FIA A;  2K40 A;  3HOV J;  1SAU A;  4XM3 A;  1N25 A;  2HDC A;  4Y52 J;  1TTY A;  2GOX B;  3MN2 A;  3MQ0 A;  4WXC A;  2L9N A;  4AYB N;  2R4G A;  2MBF A;  1MDM A;  1KYZ A;  1OCT C;  1EKE A;  3W2V A;  4FAS D;  5M3M J;  2P6S A;  2STW A;  1WH7 A;  1Y8R B;  1S6L A;  3I71 A;  4UB6 C;  4F91 B;  5L3B A;  2Y31 A;  3KYC B;  1W5S A;  1G8X A;  3AG2 H;  1TWG J;  1I6X A;  3R61 A;  1I27 A;  5FKN A;  5DM7 F;  4GYG A;  1TT0 A;  4IQJ A;  1MH3 A;  3DU5 A;  2DYS H;  2VQG A;  4B48 A;  5DEQ A;  5LRR A;  1WJA A;  1SFO J;  4UNO A;  3EET A;  1ETV A;  5H20 A;  3S8P A;  2N8G A;  3OIO A;  4WF2 A;  4BGD A;  5JFR A;  3OS1 A;  1A31 A;  1QU3 A;  4ABZ A;  1LB2 A;  2YU9 J;  4ZDO A;  1X1P A;  4QPQ A;  1ETQ A;  4BE0 A;  1JUM A;  1X4P A;  2BHZ A;  1KU7 A;  1POG A;  1TT5 B;  4CCJ A;  3BRO A;  5KK1 A;  1TLH B;  3LWF A;  4AYB A;  1E17 A;  3BJO A;  4L18 B;  1IV8 A;  3MMY B;  5E1X A;  3G4S I;  4C30 A;  2BV6 A;  4Q4Z F;  4BAY A;  5K7F A;  3SFZ A;  3J81 Z;  4S04 A;  4NC7 A;  4EMS A;  5B1A H;  5BNG A;  3FK6 A;  4QTR A;  2E35 A;  3JCU C;  3PNY A;  1HST A;  3JR9 A;  2QZ8 A;  9ANT A;  1ZKG A;  2B7E A;  2LVS A;  4QPO A;  2QYO A;  3H36 A;  5HOD A;  1S72 I;  4XKW A;  5F0C A;  1IW7 F;  2ECB A;  3PIO F;  4GFB A;  2IS2 A;  2QEN A;  1SEU A;  4LOC A;  4WK8 F;  1VQ4 I;  2PQ8 A;  4NB5 A;  2ME0 A;  2W48 A;  2ZKZ A;  1ERD A;  2AQF A;  4BDY A;  3F8M A;  3HM5 A;  3TDU C;  2L02 A;  3O8H A;  1J7K A;  3WGI A;  3KYD B;  4N4N B;  1XG1 A;  5JVG F;  1D5V A;  3I59 B;  2HYG D;  1IV6 A;  4V2G A;  2X1D A;  3BTI A;  2HYF A;  1CF7 B;  2JPB A;  2VI6 A;  2LD5 A;  1MJB A;  3FDY A;  1CGP A;  1TQI A;  2L7Z A;  2Q2E B;  2WWY A;  2H8W A;  1T39 A;  4PZJ A;  2RAE A;  4U88 A;  2OPT A;  1YLF A;  3FMQ A;  3OYH A;  1WWX A;  1K4T A;  4RB1 A;  5BOX A;  2UWM A;  1V54 H;  3WTV C;  4V2F A;  2L7F P;  2LK2 A;  3JAM Z;  1RRJ A;  1MJ9 A;  3ZQI A;  5FKK A;  5DDG A;  3MKY B;  1OPC A;  3FIW A;  4ASN A;  3HIF A;  2DA7 A;  4H0E A;  1C0W A;  2LKS A;  4E70 A;  2IA1 A;  3H1C A;  1MIJ A;  2OA4 A;  4MNU A;  3ZMV A;  1Y8Q B;  1LKX A;  1UG2 A;  1XGO A;  1YI2 I;  1AA7 A;  2R7O A;  3MKW B;  1DDN A;  2X6Y A;  4I98 B;  2E34 A;  3I59 A;  2R5Z A;  1JGG A;  3M8E A;  1O7F A;  1CF7 A;  4M6X A;  4PCQ A;  5A2Q K;  1VI0 A;  2Q2E A;  2W84 A;  1ETK A;  4O3M A;  1R22 A;  4UVA A;  2JA7 J;  4BYY A;  3ML6 A;  4A3I J;  3L2W A;  4A6D A;  2KL4 A;  3N4M A;  1MMA A;  1IXR C;  2VT2 A;  2QLZ A;  3F23 A;  1RKT A;  2CV2 A;  4RAG A;  4Y3O A;  3KCC A;  3OYL A;  1XMA A;  4R8H A;  4PFP A;  3SDB A;  1JE8 A;  3HOU J;  2NOJ B;  1W36 C;  3ZPL A;  2GZW A;  3M1E A;  2Y0M A;  2AXT C;  5ICE A;  1SC7 A;  2HQA A;  2QSF X;  2R93 J;  2VKH A;  5HS8 A;  1X2M A;  2DPU A;  3QPH A;  4PGH A;  2NS8 A;  4LLL A;  1F9N A;  4YIF A;  1KQ0 A;  3GFJ A;  2B0L A;  4UHT A;  3LSR A;  1HLV A;  4ZZD A;  1TNT A;  3CCL I;  2HFH A;  2M0C A;  2VXD A;  1OIS A;  4LK1 F;  3JRD A;  4BH9 A;  4EV0 A;  4X6A J;  4E7H A;  3NWT A;  2DT5 A;  1MND A;  1I50 J;  1MMS A;  3KYL A;  3S1Q J;  2LTP A;  2X9D A;  4XRF A;  1W0U A;  1VQM I;  3MVP A;  2NNY A;  3IRQ A;  2JVG A;  4R79 A;  5KNL A;  2DQL A;  4CCL A;  4Z2Y A;  1QQI A;  4N9I A;  2VKE A;  1IRX A;  1FYL A;  1JUP A;  2JWT A;  5FFX A;  2FSW A;  1X4O A;  2EIL H;  2OQG A;  1FYK A;  2VJJ A;  4II3 A;  1Y56 A;  4HAM A;  5IP9 J;  1FYM A;  5LEK A;  5CJ9 A;  3ZQ7 A;  1RUN A;  1VQ5 I;  2OV7 A;  1D1C A;  3C2H A;  4Y17 A;  5TIS C;  3SQN A;  3BJA A;  4S0H B;  3W6K B;  2AXL A;  2JUC A;  2RV8 A;  3JRI A;  4BE2 A;  3I54 A;  3QRF F;  3QYE A;  5FGM A;  4EM2 A;  2DN0 A;  2Y48 A;  3KE2 A;  2OUM A;  3RPU A;  4HF1 A;  5FB2 A;  5JLW A;  3BG6 A;  2M34 A;  3VOE A;  2P7V B;  2CU7 A;  5JR3 A;  3LOC A;  2VE9 A;  3GF2 A;  2OQR A;  1MW7 A;  1TWA J;  3SFI A;  2IW5 A;  2R7V A;  1XGM A;  2ZB9 A;  3J80 Z;  1OYY A;  3S15 J;  2Y69 H;  1IJW C;  2LRE A;  2STT A;  4A3D J;  2KRC A;  2P8T A;  3IL2 A;  1UJ8 A;  3ZMU A;  3LST A;  2RQP A;  1FPQ A;  5C44 J;  2CS3 A;  1NH3 A;  3VOD A;  1I1S A;  2WA0 A;  3S93 A;  3VEP A;  3MZY A;  5IT3 A;  3HOY J;  4R1H A;  3L2R A;  1GXP A;  4BUP A;  1S5L C;  2OTJ I;  1D0Y A;  2PMU A;  2IGN A;  1MBE A;  3F8C A;  4YFN F;  2E1N A;  3H5R A;  5KHD A;  2XRO A;  2K3F A;  5DV5 A;  5J40 A;  1HA8 A;  4BU2 A;  2XAU A;  4Q48 A;  1XDU A;  3BY6 A;  5DCM B;  4RA2 A;  1WJB A;  3H35 A;  1Q1V A;  3U1K A;  3LAP A;  1S9H A;  4L5J A;  4IHS A;  1PVE A;  5FD6 A;  5K5R A;  1DQU A;  3HOS A;  1OR7 A;  3DFG A;  3MCZ A;  5IP7 J;  4OIR F;  2VB6 A;  3H9J A;  3K4N A;  3LQQ A;  4F93 B;  3CME I;  1AHD P;  3ESW B;  2QA4 I;  4HNT A;  4PDK A;  5D6E A;  3CES A;  5DD4 A;  3RTR A;  5CQG A;  1ETX A;  1SMY F;  3FHN A;  4PGG A;  1XSV A;  1K6O A;  2R92 J;  1NK3 P;  1H88 C;  1VQP I;  4UV9 A;  5GAD J;  4UXN A;  3U9G A;  4LB5 A;  4HSR A;  1ZGA A;  1JI8 A;  3CP8 A;  4GGG A;  2JZY A;  3ERE D;  3I4P A;  2OBP A;  3CDL A;  5DCM A;  4LLN A;  3BTL A;  1JHH A;  3EUH C;  1Y1V J;  2HNH A;  1XSD A;  5B5E C;  3E97 A;  3A1Y A;  4L5I A;  3BG5 A;  2ECC A;  4I76 A;  2XAQ A;  3OYG A;  2EIN H;  2JSC A;  3DF8 A;  2DMQ A;  4BQN A;  2QSH X;  1XN7 A;  2IRF G;  4BAC A;  5E1W A;  4B3A A;  3B73 A;  1BR1 A;  4NC8 A;  4A3J J;  3O2P E;  2BZT A;  3ROU A;  1HDP A;  1N75 A;  1XMK A;  3ZQH A;  3ISP A;  2DQR A;  4I0A A;  1GV5 A;  4PJL A;  3HHG A;  4RGU A;  2A6E F;  2JPC A;  4BXU A;  3HKZ N;  4XLA A;  2X1C A;  2EZL A;  3EYY A;  2ZXI A;  5DUI A;  3E6M A;  2X51 A;  3K2Z A;  4A69 C;  1U78 A;  1EF4 A;  2QQB A;  3T5X A;  3A02 A;  4A5M A;  2XSD C;  2HTJ A;  1VQO I;  4MQ9 F;  3QAH A;  1SAX A;  1IRG A;  5ICG A;  4XSZ F;  2DYR H;  1T0F A;  2ZME C;  2CW7 A;  3M1C A;  4L5E A;  4FTH A;  3GCM A;  3ZQC A;  2Z16 A;  3OR1 C;  3D5S C;  4YEL A;  1IN5 A;  2CO5 A;  2P81 A;  4B4C A;  3M8F A;  5K7H A;  2EIK H;  3OWT A;  2DTR A;  3E1S A;  1MH4 A;  2KHM A;  3MWM A;  4DGW B;  4XQF A;  3H5A A;  4P9U A;  1X1D A;  2CUZ A;  4QWQ A;  4U7D A;  3HKZ A;  3WTT C;  3H3U A;  4N0B A;  2V9P A;  2RDP A;  4UY8 I;  1S7O A;  1O3S A;  3M07 A;  1B4A A;  2ID3 A;  4XKB A;  1B6A A;  1I3A A;  2K7L A;  2HKX A;  3I53 A;  4XOP A;  3PJR A;  4BBR J;  3QOD A;  5FRO A;  1DU6 A;  2O8X A;  3HOT A;  4CGZ A;  2IA2 A;  3F72 A;  4E6K G;  4PSX A;  2FNP A;  2EQR A;  4Y4R A;  3JW4 A;  4LIU A;  2MC3 A;  3Q3S A;  5DD8 A;  1FX7 A;  1ZQ3 P;  2JJ7 A;  5FLV A;  3TKY A;  5D8L B;  1IRF A;  1UMQ A;  1K6Y A;  1AU7 A;  4OIQ F;  5HVQ C;  1HW1 A;  4C2U A;  3OOU A;  2F4O B;  4EM1 A;  4G8X A;  4DQ2 A;  4Z6Y A;  4L0Z B;  5TRD A;  4MEX F;  5KAF C;  3GYH X;  2CUF A;  3MEX A;  2DBB A;  3AG1 H;  3OIP A;  4P1W A;  5JHF A;  4ZTF A;  4J01 A;  2W85 A;  3D1N I;  4DJA A;  5GAH J;  4RAF A;  3EQL F;  4JBA A;  3DTK A;  3QPL A;  3FMS A;  4OWR B;  3AFH A;  3H92 A;  2IVM A;  3A0H C;  2V6C A;  2ZBK A;  3H9Q A;  2FX0 A;  1VFC A;  1ETW A;  4EQQ A;  1AWC A;  3CC4 I;  1SD5 A;  2NVQ J;  3BPX A;  1G3W A;  4OOI A;  4M71 A;  5IYC J;  4XLE A;  4HV6 A;  4E7I A;  2ADU A;  3G1O A;  3ZMS A;  1HDD C;  3Q0V A;  3EDP A;  3RKW A;  4J00 A;  2R7W A;  3D5R C;  2JA6 J;  4F55 A;  3TED A;  4U0Y A;  4IF4 A;  1TQP A;  4FE4 A;  1W1W E;  3CMY A;  4HZF A;  3GO5 A;  3VFZ A;  1J9I A;  4LIV A;  5CVU A;  3CJN A;  2OJE D;  2L4A A;  4MFE A;  2DA2 A;  2MG4 A;  3R0J A;  3HTU A;  1WI9 A;  2O7O A;  2DA6 A;  3G2B A;  2WTE A;  3PO3 J;  2EZK A;  2QM3 A;  3BTJ A;  1ODD A;  1WKM A;  3ABL H;  3FXR A;  2EBI A;  3DPU A;  5E3N A;  3FIS A;  1RR8 C;  2E71 A;  2NOG A;  2DA1 A;  3BDD A;  4RAY A;  3VDX A;  5EGO B;  5ICF A;  5D5V B;  4RS8 A;  2KKO A;  2MSY A;  2XGE A;  3KP5 A;  5GAE J;  5D5W B;  5J3L A;  4XLC A;  1YIT I;  1YX5 A;  1M1E B;  2CRG A;  3X2Q H;  3SJM A;  1DP3 A;  3O6B B;  1K78 B;  1VTN C;  3H3V K;  2HTS A;  3P9K A;  2LFB A;  5LHG A;  2OAZ A;  3GLX A;  2HGC A;  3CLQ A;  1FTT A;  1EH7 A;  3OYF A;  3PUB A;  3S17 J;  3FZV A;  3MFK A;  4HX8 A;  2AHQ A;  1XD7 A;  1SFU A;  2GA2 A;  3C1D A;  4HF2 A;  2R7Q A;  3RQ4 A;  2VPL A;  4ON0 A;  2JSP A;  4DYQ A;  2GAU A;  1YW9 A;  3S1N J;  4A3L J;  4P55 A;  2OZ6 A;  3CCS I;  2L5Q A;  2OC6 A;  1BL0 A;  1LUJ B;  2PJR B;  5IT9 Z;  1IN8 A;  3GFM A;  5EGO A;  3CCM I;  1KGS A;  3E7L A;  2V7F A;  1OMI A;  1MBK A;  2EFN A;  2Q1Z B;  3HB9 A;  3MD2 A;  3BR6 A;  1GVD A;  1K7A A;  1Z77 A;  1OCP A;  4ETS A;  2RNG A;  5LLQ A;  4F3Q A;  1QGP A;  4MTD A;  2DDA A;  1HCR A;  4AD9 A;  4A0Y A;  4U7B A;  1K78 A;  4OMZ A;  2OU2 A;  3OSG A;  2HOS A;  1X1B A;  1Z6T A;  3T8R A;  2IS6 A;  3P9C A;  2M2E A;  3ECO A;  2RQQ A;  4XLF A;  3WTW C;  3LAJ A;  2LY2 A;  2CV0 A;  4LB6 B;  1HBX G;  2F5C A;  4AIK A;  2HI3 A;  1YX3 A;  1FNN A;  4CZZ A;  2KZV A;  3COA C;  4IQ4 A;  4W97 A;  5E79 C;  2L9V A;  2PLY A;  5ERI A;  4WXH A;  1IAW A;  2G7U A;  1Y0U A;  2BY1 A;  1S8N A;  2FRH A;  2ZSI B;  4LFU A;  2KRH A;  4RLF A;  1P4W A;  2KPM A;  3TBI A;  3RZD J;  2PJR A;  4FX0 A;  4CUG A;  4BXX J;  3Q9S A;  2W82 A;  2DW4 A;  3L1P A;  2BVL A;  2DMT A;  1ZAR A;  2R7T A;  3VYT B;  5F6F A;  2WY8 Q;  3J81 K;  4RBO A;  2EFP A;  5F1R A;  2CQK A;  4RMN A;  1HW2 A;  4YRV A;  1J59 A;  1ONV A;  2LOO A;  1UHW A;  1ZG3 A;  2KIQ A;  2O9L A;  3H0D A;  4EGY A;  5C3E J;  3CCE I;  2LKX A;  2O8K A;  1A04 A;  5HS9 A;  4UUV A;  4KN7 X;  3REO A;  4ZZL A;  4PUS A;  2VON A;  3FXK A;  3HC7 A;  1J5Y A;  2L2O A;  2EB7 A;  1Y6I A;  3A01 A;  1TWF J;  3HGY A;  4HOB A;  2BXZ A;  4LIT A;  4D5F A;  1VQL I;  1MBH A;  2IS1 A;  4KJZ A;  3HXL A;  2COB A;  3G1L A;  4HDU A;  1SVM A;  2UXX A;  2A68 F;  3QP6 A;  4KA4 A;  4FET A;  3C2B A;  3OL4 A;  5FFZ A;  4G7H F;  4B8X A;  3SZT A;  1ZR2 A;  3RKY A;  4I6Z A;  4C2T A;  1WSU A;  3LNQ A;  2ZJP F;  5E20 A;  1FP2 A;  3QU3 A;  2J5O A;  2A05 A;  3DEU A;  3GEZ A;  4ZYA A;  3JAM K;  1O3T A;  3GTO J;  2E19 A;  4XRM A;  2XIG A;  1JT0 A;  3LSI A;  2V9V A;  4DOZ A;  3E0J B;  3L09 A;  3EPZ A;  3HJE A;  3BQY A;  1L3L A;  5H6R A;  4EAT A;  1DUX C;  4I0B A;  5F27 A;  1Z3X A;  2IT0 A;  2W00 A;  1GHC A;  4HRI A;  2F48 A;  4LMY A;  1KU9 A;  2HU9 A;  4G7O F;  3BR2 A;  3IC7 A;  1A5J A;  3QPT A;  3DP7 A;  5BPI A;  4GDF A;  4B3X A;  2IEK A;  2E2I J;  2MLK A;  1T2K A;  4WCG A;  2VIX A;  2IP2 A;  3ZXS A;  1U3E M;  3BZ6 A;  1FOX A;  3WE2 A;  2VPR A;  2ZJ2 A;  3DEW A;  2VBW A;  3RYR A;  3S3O A;  5CVJ A;  3L2Q A;  3ZQL A;  1FBQ A;  2H27 A;  3IUO A;  2VOD A;  5HDK A;  5ICC A;  5HOO A;  4EJO A;  2E5Z A;  3ZRG A;  1TZL A;  3S3M A;  4IZZ A;  1ZRE A;  4XRS A;  3OYJ A;  2QEX I;  4A3M J;  2DU9 A;  1XS9 A;  2V4J C;  4BJT A;  1LEA A;  1RNL A;  1G3Y A;  2XPW A;  4LG3 A;  1I1G A;  3ZMT A;  3IHU A;  5EZG A;  2OF7 A;  4YFX F;  1LDJ A;  4EGZ A;  4BXF A;  5J1R A;  2DLL A;  4HNU A;  1BJZ A;  1XX5 A;  4WWC A;  4UVB A;  3WU2 C;  3GLL A;  4M3G A;  1Z7U A;  1FMV A;  2YX4 A;  4OAY A;  4BS9 A;  3F22 A;  1P92 A;  1SD6 A;  1YOV B;  2E7X A;  2E1M B;  3I4N J;  3ASN H;  3ZN1 A;  3M9A A;  5FD5 A;  2O03 A;  2L7M P;  4BQA A;  2UZK A;  2EPF A;  2ZSH B;  2BEO A;  4Y7N J;  2IPQ X;  4BHP A;  2ZCW A;  1YO5 C;  2L9S A;  3K2A A;  3CF5 F;  2HXI A;  4MFD A;  4Y13 A;  3GTJ J;  3LSM A;  5TGT A;  3TW7 A;  2RKH A;  1F5T A;  1O7L A;  4M9X A;  5HDG A;  4CXF A;  3I55 I;  4CA0 A;  4AM3 A;  2K27 A;  4D0P A;  5IYD J;  4MHG A;  4XID A;  3KIO A;  2PG4 A;  3K4J A;  2XRN A;  2L54 A;  2HXO A;  4XNF A;  3FBN B;  3ELK A;  4EVI A;  1OR7 C;  5FJ8 J;  4B1R A;  4XOR A;  2M45 A;  2MH9 A;  3CCR I;  3PSF A;  5EEG A;  2M0M A;  3WHC A;  2P5L C;  4QLC U;  3V42 A;  1B8I B;  1UB9 A;  2CQN A;  2VQL A;  3H3Z A;  3ZMD A;  1FWZ A;  1MBG A;  3E5X A;  2BY2 A;  5KAI C;  4KIB A;  1Z1D A;  4RM2 A;  1S7A A;  4EJW A;  3D0S A;  1QBJ A;  4C9Y A;  2HVR A;  3OL3 A;  3AG3 H;  1YS7 A;  3V4G A;  2LMD A;  3KZI C;  1RES A;  4KN4 X;  3J80 K;  2OTL I;  1V5G A;  1S3J A;  1RPW A;  4G94 A;  1U2W A;  4D5C A;  1WRJ A;  2BYV E;  5BMZ A;  3DTI A;  1ON1 A;  3WGH A;  1V55 H;  2FUG 2;  1OCO H;  1NTC A;  3UR3 C;  3KFW X;  5DCF A;  5EYR A;  3DBL B;  4CCK A;  3KEO A;  2Z3Y A;  1GUU A;  5H6Q A;  2W24 A;  3OYM A;  1HF0 A;  3BR1 A;  3DLA A;  4E7Z A;  2F5E A;  2D2W A;  3GBG A;  3DEE A;  3QYF A;  4IEJ A;  3MZ8 A;  3CC2 I;  2BBY A;  3FXO A;  1FY7 A;  2NVT J;  2X48 A;  4HNV A;  1B8I A;  2G0E A;  3U21 A;  3GTL J;  2XRL A;  1BI3 A;  2Z1D A;  4F7Z A;  1YW8 A;  4D7M A;  1NHA A;  1UG0 A;  4BEH B;  5K5O A;  3GTK J;  1HOM A;  4AC0 A;  1LNW A;  1R58 A;  3EUK L;  4A3E J;  2XAH A;  1HW5 A;  2V1D A;  1GV2 A;  3OS2 A;  1D1B A;  4RB0 A;  3CCQ I;  3RIR A;  2WBM A;  4RGX A;  2ZFU A;  3K4B A;  1IF1 A;  1J2X A;  1T0F C;  5IOY A;  2M4G A;  5LFA A;  1R1V A;  3HDD A;  1TW2 A;  1N78 A;  3I0T A;  4A3K J;  3J7A Y;  3O3K A;  1YQA A;  4RDU A;  3E3V A;  1ZYR F;  1FSH A;  3VYR B;  2XGC A;  2F5F A;  5HNH A;  1E2X A;  1D5Y A;  2OZU A;  4J19 A;  1I39 A;  3DU6 A;  1DGW Y;  2HQ5 A;  3M8J A;  3TDZ C;  2EH3 A;  3FK7 A;  2VOO A;  2K4B A;  5J1U A;  2FJ1 A;  2EA2 A;  3Q9V A;  4M73 A;  3RSN A;  1QPI A;  3S2H J;  3KP6 A;  4A3F J;  3I58 A;  1FBS A;  5IOZ A;  1YRN B;  4JX6 A;  4BEH A;  1WJD A;  3GW2 A;  2Y9Z A;  5L3G A;  4HF0 A;  1ON2 A;  2CSO A;  2XAJ A;  1T38 A;  2DOD A;  3PM1 A;  4YIR X;  2FMY A;  3PSI A;  2L01 A;  1NK2 P;  2QF7 A;  4TV7 A;  1YHQ I;  2CV1 A;  1BBY A;  1WCM J;  5IP6 A;  3L2C A;  3BT9 A;  3HRU A;  2DJI A;  2EV0 A;  2F4I A;  5F64 A;  2ME6 A;  2VE8 A;  3DCF A;  4DYC A;  3BPV A;  2YSR A;  1D0Z A;  4JOM A;  1HKS A;  1EA3 A;  2FOW A;  3IAM 2;  3ECH A;  2GOM A;  5H2F C;  1P9Q C;  1FLI A;  2R7Z J;  1JJ6 C;  5LEJ A;  1E0E A;  2O6G E;  2KIU A;  1GDT A;  2DMP A;  2VJI A;  2Y9Y A;  3SDG A;  3T8T A;  3IRR A;  3RCO A;  1YRN A;  4MQV A;  4RB2 C;  2TCT A;  3IWF A;  2MW8 A;  2HZD A;  3HPG A;  1Z05 A;  2WV1 A;  3PNT A;  2F5D A;  4KFC A;  1T56 A;  2EFW A;  4CIC A;  1FOW A;  4HST A;  1FJL A;  1VQ9 I;  2X1E A;  4G6D A;  3LSG A;  1RI7 A;  5D4R A;  3K9T A;  1FIP A;  1X1A A;  3I3L A;  3TO9 A;  5EEA A;  3HUG B;  3WGG A;  4BE1 A;  3KZZ A;  2MH2 A;  2GIZ A;  2MYS A;  4IVN A;  4OAZ A;  4M6Y A;  1LJ9 A;  2FD5 A;  2KIM A;  3GWZ A;  4RM3 A;  4JX4 A;  4XLH A;  2KDZ A;  2BXY A;  2HQN A;  5E3L A;  3AAF A;  1IXS B;  2QKM B;  3JRE A;  3OY9 A;  1X1C A;  4DZJ A;  1ACI A;  1EH6 A;  2EIJ H;  6PAX A;  2HWV A;  1KQ9 A;  3K6G A;  4G12 A;  4XSX F;  4HPQ A;  2W57 A;  3G1M A;  5GTH C;  2R7D A;  3OMY A;  3OIQ A;  1WJ5 A;  3RQI A;  3S2W A;  2FU4 A;  4B44 A;  2M5W A;  2V1N A;  4ZDL A;  1KQ8 A;  4M6V A;  3VYU B;  1MSF C;  2MFZ A;  4JX5 A;  1QZZ A;  2ZXH A;  1UST A;  4IPA A;  5L3E A;  1H9T A;  2CW8 A;  1LPQ A;  1BI0 A;  3HUG A;  2PBI A;  5FLX Z;  4KNY A;  5CLS A;  1W0T A;  4XR6 A;  1JKO C;  1BN5 A;  3CCY A;  4DNC A;  5JLX A;  4CSW A;  4NC6 A;  1U0J A;  4CZC A;  5LRS A;  2CUJ A;  2DOE A;  3PNV A;  3PQJ A;  5FO5 A;  4AU7 A;  1ETO A;  1R49 A;  1H8A C;  4C3I J;  4XKC A;  1P7J A;  4LJZ F;  2QUF A;  1MBF A;  3W2W A;  3DQV C;  4JP0 A;  3TO6 A;  3SEQ A;  4M9S A;  4PJ0 C;  4ZDP A;  1L0O C;  5ILV A;  5CQE A;  3ZCO A;  3BG9 A;  3PL8 A;  1U9O A;  2FQ3 A;  1LFB A;  1OJL A;  5LGT A;  5M5Y J;  5E8G A;  5EF6 A;  5GP9 A;  1ZR4 A;  5E3M A;  3HL2 A;  2ELJ A;  2GXG A;  3DKW A;  3DTE A;  5DM6 F;  4A93 J;  4P9F A;  1KA8 A;  2GIV A;  3OYE A;  3E6C C;  2JRT A;  4CYD A;  2A6T A;  5FRM A;  2LP0 A;  3NWS A;  5CVI A;  2QQ8 A;  1U8B A;  3AL0 B;  2QBY B;  2CFO A;  3QOP A;  4I09 A;  1YJN I;  1Y1W J;  2R7U A;  3K1N A;  1DPU A;  2YUS A;  1WJC A;  5LHH A;  4CHU A;  5EEH A;  2KZG A;  2LH9 A;  3L9F A;  3TGN A;  4IX7 A;  3ASO H;  1EV7 A;  1LFP A;  1HC8 A;  2IGO A;  3QP5 A;  2KFD A;  2NVY J;  4IXA A;  1KZH A;  3QYB A;  4K2E A;  1WH5 A;  3BZK A;  2ESN A;  3WU1 B;  2VJ5 A;  3ERM A;  1IDZ A;  4IL6 C;  3L2V A;  3I9V 2;  3GX4 X;  3S14 J;  4H4K C;  1I3Q J;  1RKW A;  2Y30 A;  3C2G A;  1B59 A;  1RC9 A;  2X0L A;  4QIW N;  2QVO A;  1R9T J;  5J4Y A;  4M9Z A;  2QBY A;  5BS6 A;  4DW6 A;  4XK4 A;  2K3P A;  4OIO F;  2VQH A;  1TP4 A;  3GTM J;  2EZI A;  2RGV A;  2B9S A;  4XN0 A;  5J8C A;  3KP7 A;  1R4N B;  1W5T A;  2M7B A;  4HV5 A;  5IT9 K;  2DT7 B;  4PJJ A;  1UFM A;  4YG2 F;  2GM4 A;  1ZRF A;  4PFO A;  2F6C A;  2A61 A;  2XAF A;  4XLN F;  3OYN A;  2ZJQ F;  2L9R A;  5IY5 H;  2VKV A;  2XKO A;  5DUK A;  2CWE A;  4EM0 B;  4XMY A;  2P5V A;  3WTZ A;  5F0H A;  1V3F A;  1FT9 A;  3BTC A;  4M3F A;  2ZJR F;  3RKX A;  1F1Z A;  1ETY A;  3ULQ B;  4BL0 B;  4IHY A;  2GBY A;  2O61 A;  2K5C A;  1MZB A;  2VBZ A;  5B66 C;  1JTX A;  4M3D A;  3JRF A;  4W1U A;  1X58 A;  4U0V A;  3GTQ J;  2LY1 A;  1DP7 P;  4Y33 A;  3ZQQ A;  1KYW A;  1R36 A;  5BPD A;  2FNA A;  1H9G A;  4E7L A;  1G3S A;  1WQ2 A;  2CQ7 A;  2O3F A;  5TJJ A;  1ORK A;  3G3Z A;  4L9J A;  1SFK A;  1ZH5 A;  2VT3 A;  1D0X A;  1WHU A;  2ELH A;  3IH3 A;  2KRF A;  4L9T A;  4NDL A;  1QRY A;  2KLO A;  2EWN A;  3J7Z I;  3BOQ A;  3K70 D;  1PP8 F;  4LG0 B;  2XHK A;  4JK1 X;  3D5L A;  2HPI A;  2ZO4 A;  1G59 A;  2VLA A;  1R1U A;  1BI2 A;  4OMY A;  3S2D J;  3FWE A;  2BY3 A;  3I56 I;  3JTH A;  1TL8 A;  1X3W B;  1AKH B;  3GVA A;  4X1E A;  4XON A;  3BZC A;  1P2F A;  1OKR A;  4E7K A;  2ESH A;  1BW5 A;  2NS7 A;  3H9G A;  3ZQF A;  4L9V A;  5D6F A;  2DFE A;  3OR2 C;  3CDI A;  1VQ7 I;  4WXD A;  2EK5 A;  4HQE A;  1ZEL A;  3CZ6 A;  2LNB A;  4A3C J;  4ENK A;  2GXA A;  5IYB J;  5ED4 A;  2PEX A;  2LC2 A;  1MMN A;  2WAD A;  3CP2 A;  1YTY A;  2K9N A;  4JQF A;  2Q0O A;  1YYV A;  1Z7L A;  1PUE E;  2CQQ A;  1GT0 C;  3CQZ J;  4EJV A;  3SZG A;  1BR2 A;  4XLP F;  2R7X A;  3CTA A;  2QGU A;  3DBH B;  3M3Y J;  1FSE A;  1XCV A;  2K9L A;  3CUQ B;  3ABU A;  3DPT A;  4BHC A;  4LG0 A;  3N05 A;  3W6J B;  4GO1 A;  4FT8 A;  1BOB A;  2VAS A;  3R4K A;  4YII A;  4LLG F;  2NVX J;  3OYK A;  1VQK I;  1R6R A;  4U87 A;  3J7A O;  1RIO H;  1AKH A;  2L0K A;  2VOP A;  3HSE A;  1JJ8 C;  3KZY A;  3SXY A;  5J47 A;  5CVV A;  1SFX A;  1T95 A;  2IXS A;  2XKP A;  2DOF A;  2FQ4 A;  5LGN A;  1HKT A;  3NAR A;  3HPH A;  3U2R A;  3HRT A;  1G4D A;  4FIS A;  3TOB A;  1O57 A;  3K4K A;  3JRB A;  2GLO A;  2CQX A;  3K4M A;  4IHT A;  3HOX J;  3G73 A;  2I8D A;  2R7R A;  3HTS B;  4YFK F;  2HR3 A;  2W4S A;  3VYS B;  1V5F A;  3B6C A;  2Z33 A;  2FBI A;  3GZ5 A;  2RNJ A;  3WOD F;  2DCE A;  3GXO A;  2HOE A;  3CUQ A;  1UCR A;  2D1V A;  4A2U A;  3JRA A;  1X19 A;  3HRM A;  2XF5 A;  3A0B C;  4A12 A;  2IGK A;  2FE3 A;  2BVM A;  2IS4 A;  2ID6 A;  5ILS A;  4DBQ A;  2K9S A;  4AIJ A;  1N77 A;  4LGW A;  3ZMZ A;  2DJN A;  3HZJ A;  2CGP A;  4KMU X;  2EV6 A;  1W4M A;  2YPR A;  2K9Q A;  2E1M C;  1NG7 A;  1IN7 A;  5D8K B;  2MGQ A;  1U6G A;  2G7H A;  1TBX A;  1OCZ H;  1LVK A;  2A5Y B;  2K4J A;  4XKV A;  4Y15 A;  3CO7 C;  3KEY A;  2X85 A;  5FKM A;  1J75 A;  1LVA A;  1X3Z B;  1EJ9 A;  4KMF A;  3WTS C;  2LLK A;  1D1A A;  3BG3 A;  2DA4 A;  2HZT A;  5KVR A;  4GRI A;  4S05 A;  2R7S A;  1SMT A;  1ZRC A;  3CUO A;  2A07 F;  4LD5 A;  1F36 A;  1YFH A;  2E2H J;  1QZE A;  2QCO A;  4DIQ A;  2Q8K A;  2FXA A;  4G7Z F;  2HS5 A;  2H6B A;  2D45 A;  3K4L A;  2DMU A;  2KIF A;  1H89 C;  1BM9 A;  5HLH A;  1WVR A;  3GZN B;  2MAB A;  1QHG A;  2R5Y B;  3ZR8 X;  2V1X A;  4ZYG A;  1VND A;  5M3F J;  3B6A A;  1Y39 A;  1K83 J;  1A6Q A;  3A03 A;  2DFI A;  3WTY C;  4G9Y A;  3F6O A;  4FE7 A;  4A3B J;  2IAI A;  2NAZ A;  4IRI A;  1G6N A;  1MJA A;  4HDV A;  4MTE A;  3VB2 A;  4MIM A;  4I01 A;  1TQM A;  1LDD A;  2MD5 A;  1UHS A;  3E6B A;  5E3O A;  2PFB A;  4JYK A;  3RZO J;  4UUS B;  2RN7 A;  2RRE A;  3BP8 A;  1W7P B;  2Z9O A;  4IHX A;  4GYI A;  3VWB A;  5FKL A;  3FKJ A;  3R6S A;  4WX9 A;  2BE5 F;  3LFU A;  3SZP A;  2NNN A;  2AS5 F;  5E17 F;  3K1M A;  1BC8 C;  1Z3Y A;  1V4R A;  5L3F A;  2PI0 A;  1U5T B;  2R5Y A;  4M72 A;  4AID A;  1MNM C;  2XB5 A;  4HX7 A;  4BQO A;  1SAN A;  4KDP A;  1JHF A;  1KON A;  1WFX A;  2L3D A;  2MD0 A;  4BKX A;  2EJR A;  2P0W A;  5K7Z A;  2ACJ A;  3HOW J;  2H1L A;  2JUG A;  2LR8 A;  4NNJ A;  2A3S A;  3OYD A;  2DMN A;  1A35 A;  1VQN I;  1ZG5 A;  3DV8 A;  2IBD A;  2Y2Z A;  4A3G J;  2HOT A;  2CJJ A;  3KLO A;  2DK8 A;  1WJF A;  3V7S A;  3OS0 A;  4IHV A;  2FBH A;  4UUS A;  1B9M A;  2IJL A;  1W7P A;  5K1Y A;  4Q47 A;  1QVT A;  5FLM J;  4PSW A;  3TMO A;  2VL8 A;  2FA5 A;  4XOT A;  1PYV A;  2V26 A;  3H5N A;  1MMD A;  5CYV A;  1SVL A;  1MMG A;  3QU6 A;  3RPQ A;  1U5T A;  3LSP A;  1GLN A;  3DKY A;  3F3X A;  2FF4 A;  1XDS A;  1IN4 A;  1LDK B;  2R5Z B;  2FML A;  1YG2 A;  2V9K A;  5DYM A;  4CO8 A;  3BQZ A;  4RGR A;  2PX9 A;  1E3O C;  3T1B A;  3W6V A;  2ZFW A;  2F5V A;  2ZC2 A;  2DAO A;  2O0Y A;  2E5N A;  3PFY A;  2XGX A;  2YU3 A;  1HXD A;  4HLX A;  1MBJ A;  5F1J A;  4BY1 J;  1ZK8 A;  3BJ6 A;  3HBL A;  2FOK A;  3HEF A;  4RB3 C;  4UVC A;  1QHH D;  3Q0W A;  3CJT B; 
#chains in the Genus database with same CATH homology
 1GDT A;  1BW6 A;  5FLV A;  2DMP A;  5M5X J;  1UMQ A;  1AU7 A;  2H8R A;  2Y9Y A;  3SDG A;  3A01 B;  3OOU A;  1OFC X;  1YRN A;  2TCT A;  5EDN A;  2CUF A;  2MW8 A;  2WV1 A;  3D1N I;  2HDD A;  1G2H A;  1T56 A;  5F04 A;  1WI3 A;  3FKI J;  1FJL A;  3QPL A;  4QSH A;  3LSG A;  3QQA A;  5C4J J;  1FIP A;  2Y0S N;  2TRT A;  4M3E A;  2FX0 A;  1VFC A;  1ETW A;  5EEA A;  2NVQ J;  2JJ7 A;  4AUX A;  3TW6 A;  3NAU A;  3M4O J;  1BA5 A;  1JKR C;  5IYC J;  2FD5 A;  3JRC A;  1WGX A;  3G1O A;  4JX4 A;  1HDD C;  4MLO A;  1JT6 A;  2KDZ A;  3UKG A;  3Q0V A;  1ENH A;  2JA6 J;  5E3L A;  5F0F A;  4DZP A;  3JRE A;  4DZJ A;  1VF9 A;  3TED A;  4FE4 A;  3CMY A;  1FIA A;  2K40 A;  3HOV J;  5DS9 A;  1LFU P;  4G12 A;  4Y52 J;  3RKQ A;  3G1M A;  2JMW A;  4MFE A;  2DA2 A;  3IH4 A;  3MN2 A;  4AYB N;  3RQI A;  1OCT C;  1RR7 A;  2MG4 A;  4M6V A;  5M3M J;  2O7O A;  2DA6 A;  1WH7 A;  1MSF C;  3PO3 J;  2EZK A;  3BTJ A;  4JX5 A;  2VUM J;  2Y31 A;  2EBI A;  5E3N A;  3FIS A;  1TWG J;  2NOG A;  2DA1 A;  5EGO B;  5FKN A;  1MH3 A;  1W0T A;  1JKO C;  2B63 J;  2MSY A;  1SFO J;  2XGE A;  3CCY A;  5J3L A;  1ETV A;  3BR3 A;  2N8G A;  3OIO A;  5JLX A;  2CRG A;  4ABZ A;  2YU9 J;  3SJM A;  1ETQ A;  1ETO A;  1H8A C;  3H3V K;  1JUM A;  4C3I J;  2LFB A;  1P7J A;  1POG A;  4BBS J;  1MBF A;  4JP0 A;  1FTT A;  1ZGW A;  3S17 J;  2AHQ A;  3BG9 A;  5K7F A;  1U9O A;  1LFB A;  3WHB A;  4CYC B;  1OJL A;  5M5Y J;  5EF6 A;  5GP9 A;  5BNG A;  4DYQ A;  5E3M A;  3FK6 A;  1ZR4 A;  1PUF B;  3S1N J;  4A3L J;  4QTR A;  3JR9 A;  1QVU A;  4A93 J;  1ZKG A;  1BL0 A;  2LVS A;  9ANT A;  5HOD A;  5EGO A;  1JKQ C;  1Z0X A;  1B72 B;  3E7L A;  2LP0 A;  1MBK A;  3HB9 A;  5F0C A;  3JRH A;  1U8B A;  2ECB A;  3BR6 A;  1GVD A;  1Y1W J;  4GFB A;  1Z77 A;  1OCP A;  4LOC A;  2YUS A;  5GPA A;  2ME0 A;  2W48 A;  1HCR A;  2EZH A;  3IH2 A;  5EZH A;  3OSG A;  2HOS A;  4DYR A;  3HM5 A;  5DTD A;  3O8H A;  1XG1 A;  2M2E A;  1IV6 A;  4V2G A;  2NVY J;  3BTI A;  3S1M J;  2X6O A;  1WH5 A;  2VI6 A;  2LD5 A;  4CYC A;  2HI3 A;  2L7Z A;  2DA5 A;  1JKP C;  1IDZ A;  4W97 A;  1PUF A;  4UUT A;  3S14 J;  2RAE A;  5M5W J;  1CQT A;  1I3Q J;  2OPT A;  1RKW A;  2Y30 A;  2XPU A;  4QIW N;  3RZD J;  2AO9 A;  1R9T J;  1B72 A;  4BXX J;  5IPA A;  4V2F A;  2L7F P;  2LK2 A;  3L1P A;  4DW6 A;  4XK4 A;  3ZQI A;  5FKK A;  2DMT A;  3FIW A;  4IHW A;  2DA7 A;  4RBO A;  1IG7 A;  2EZI A;  1UG2 A;  2R5Z A;  3H0G J;  1T33 A;  2M9H A;  2O9L A;  1JGG A;  2GM4 A;  1I6H J;  5C3E J;  2LKX A;  2O8K A;  1MSE C;  1VI0 A;  2L9R A;  1TWH J;  4D7N A;  1ETK A;  2VKV A;  2JA7 J;  1P7I A;  4A3I J;  3A01 A;  1TWF J;  3HGY A;  5F0H A;  4D5F A;  3BTC A;  1S7E A;  2R0Q C;  1MBH A;  2I10 A;  4M3F A;  2COB A;  1RKT A;  1ETY A;  1WPK A;  3G1L A;  4IHY A;  2GBY A;  3ZQG A;  1JTX A;  3C2B A;  4M3D A;  3JRF A;  4W1U A;  1X58 A;  3IV5 A;  3HOU J;  3GTQ J;  2E2J J;  1IUF A;  2ELK A;  1F43 A;  1JUS A;  1ZR2 A;  3HOZ J;  4I6Z A;  1ORK A;  3K7A J;  2R93 J;  2WB1 N;  3IH3 A;  3LNQ A;  1X2M A;  4NDL A;  1A6I A;  3JRG A;  1QRY A;  2NS8 A;  1ZTR A;  1DU0 A;  3GTO J;  2DTZ A;  2E19 A;  4XRM A;  3LSR A;  1HLV A;  1JT0 A;  2M0C A;  3JRD A;  1LE8 B;  4BY7 J;  3S2D J;  4X6A J;  3BQY A;  1AKH B;  4X1E A;  1I50 J;  5F27 A;  3S1Q J;  2LTP A;  2X9D A;  1W0U A;  1BW5 A;  2NS7 A;  3MVP A;  3BR2 A;  3ZQF A;  1A5J A;  2IEK A;  2E2I J;  2D5V A;  2VKE A;  5EG0 B;  4A3C J;  5IYB J;  2VPR A;  3DEW A;  1JUP A;  2JWT A;  2K9N A;  1TC3 C;  2JA8 J;  3PO2 J;  3ZQL A;  2CQQ A;  1GT0 C;  3CQZ J;  3HGG A;  5IP9 J;  3M3Y J;  5GPC A;  4XRS A;  4S0H B;  4A3M J;  3JRI A;  1XS9 A;  1LE8 A;  2NVX J;  2XPW A;  1K61 A;  2DA3 A;  2DN0 A;  5EZG A;  2OF7 A;  5JLW A;  1AKH A;  2L0K A;  1JJ8 C;  5J1R A;  2M34 A;  1BJZ A;  3OSF A;  2CU7 A;  3GTG J;  3LOC A;  2FQ4 A;  4M3G A;  2H1K A;  5F08 A;  1TWA J;  3NAR A;  3SFI A;  5EG0 A;  5C4X J;  2ZB9 A;  3ZOB A;  4FIS A;  3JRB A;  2GLO A;  2CQX A;  3S15 J;  3I4N J;  1IJW C;  3HOX J;  4A3D J;  2L7M P;  3B6C A;  5C44 J;  1FEX A;  4Y7N J;  3JRA A;  3HOY J;  2YS9 A;  1ITY A;  3QPS A;  3K2A A;  2LY9 A;  2HXI A;  1IRZ A;  4MFD A;  1MBE A;  4C3H J;  3GTJ J;  3TW7 A;  2ID6 A;  2CUE A;  2K9S A;  3VPR A;  5IYD J;  4XID A;  1Q1V A;  3LSJ A;  1IDY A;  2DJN A;  3S16 J;  4XIC A;  3O8G A;  2HXO A;  2WAQ N;  2K9Q A;  3TP0 A;  5FJ8 J;  4B1R A;  2JN6 A;  2MGQ A;  3I4M J;  2E1O A;  5FKM A;  5IP7 J;  3WHC A;  2LLK A;  1AHD P;  3BG3 A;  2DA4 A;  1B8I B;  4M3B A;  3GTP J;  1ETX A;  1MBG A;  2R92 J;  4FCY A;  1NK3 P;  1H88 C;  1F36 A;  2E2H J;  4C2M J;  4EEF G;  2QCO A;  2XB0 X;  1U9N A;  1RES A;  2DMU A;  1RPW A;  1H89 C;  4D5C A;  2M8G X;  2R5Y B;  3CDL A;  3BTL A;  1NTC A;  1Y1V J;  1VND A;  5J1Y A;  5EYR A;  5M3F J;  3B6A A;  1K83 J;  1GUU A;  2XGD A;  3A03 A;  3Q0U A;  1IC8 A;  1HF0 A;  1O4X A;  3BR1 A;  3GBG A;  4FE7 A;  4A3B J;  3BG5 A;  2ECC A;  2IAI A;  4I76 A;  3S1R J;  4IEJ A;  2DMQ A;  2NVT J;  2X48 A;  4HNV A;  1B8I A;  4MIM A;  2G0E A;  4B3A A;  1FTZ A;  1UHS A;  3GTL J;  2XRL A;  1APL C;  5E3O A;  4A3J J;  4D7M A;  4JYK A;  3RZO J;  4UUS B;  3GTK J;  1HOM A;  4AC0 A;  1HDP A;  3ZQH A;  4IHX A;  4MO7 A;  5FKL A;  4A3E J;  1GV5 A;  1X2N A;  3F0C A;  1JTY A;  1GV2 A;  3HKZ N;  2EZL A;  4A69 C;  1U78 A;  1EF4 A;  2R5Y A;  2JK3 A;  2JA5 J;  3A02 A;  2XSD C;  1MNM C;  2HYJ A;  2XB5 A;  5IOY A;  3HDD A;  1SAN A;  4A3K J;  3MKL A;  3TP3 A;  4RDU A;  2KT0 A;  4BKX A;  2XGC A;  5K7Z A;  4L5E A;  4FTH A;  3HOW J;  1D5Y A;  2LR8 A;  3ZQC A;  2DMN A;  4J19 A;  4B4C A;  2P81 A;  2HQ5 A;  2EH3 A;  3FK7 A;  2IBD A;  1RET A;  5J1U A;  2FJ1 A;  5K7H A;  2Y2Z A;  3S2H J;  4A3G J;  1QPI A;  1MH4 A;  2CJJ A;  4A3F J;  2HOT A;  5IOZ A;  1YRN B;  4JX6 A;  4IHV A;  4UUS A;  1XC5 A;  4XRS G;  2HOA A;  2Y9Z A;  1QVT A;  5FLM J;  3PM1 A;  3BR0 A;  5FKO A;  2PMZ N;  1TWC J;  2ID3 A;  3LSP A;  1NK2 P;  2QF7 A;  1WCM J;  5IP6 A;  4BBR J;  3BT9 A;  2ME6 A;  2R5Z B;  3DCF A;  1DU6 A;  4C3J J;  3BQZ A;  4DYC A;  3W6V A;  1E3O C;  3BR5 A;  2EQR A;  2XPV A;  1IGN A;  1MBJ A;  5F1J A;  4BY1 J;  3Q3S A;  1ZK8 A;  3HBL A;  3HEF A;  1JJ6 C;  2R7Z J;  1ZQ3 P;  3GTM J;  3Q0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...