1BC8C

Structures of sap-1 bound to dna sequences from the e74 and c-fos promoters provide insights into how ets proteins discriminate between related dna targets
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*CP*GP*GP*AP*AP*GP*T)-3')
publication title Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bc8C00
2KIMA 1USSA 5DD8A 1K79A 1OYYA 3E6DA 4EQQA 1PP7U 4M72A 1O57A 1YO5C 2CYYA 4MNUA 1YTYA 4HDUA 1AOYA 1RUNA 3PQKA 1R1TA 4MHGA 3ROUA 1D8KA 3BY6A 4IRHA 3F22A 1HKQA 4LD5A 4XRFA 1OKRA 1BOAA 2YX7A 3HOTA 1EH8A 1FSHA 4D0PA 1Z6TA 4EJVA 2JTVA 3LAJA 4G7OF 3QP6A 3ZN1A 4XBFA 2HYGD 5D5VB 4U7DA 4M6YA 2OBPA 1XCVA 1IRFA 3E6MA 2FNPA 1W7PB 4P96A 1P2FA 2RDPA 3J81Z 4EJTA 5EEGA 2NYXA 2EB7A 2PMHA 4A5NA 3E5XA 2A69F 2ESNA 1D8JA 1ODDA 3MEXA 4O3MA 3JAMZ 4EM2A 2XAJA 2MLKA 3RKWA 2OA4A 4HF2A 5ICEA 1XSXA 5D8LB 2OZ6A 2PJPA 1XDSA 5FD5A 4ENNA 2NRAC 4MTEA 2Z9OA 3S2WA 4EGYA 1P92A 5E18F 2F5FA 2FQ3A 1QZYA 5F1RA 5HS8A 1TBXA 3PQJA 3W6KB 1SD4A 2ZFWA 2PBIA 3GFIA 4BAYA 1B9MA 3C3WA 2UXXA 1R5HA 4A2UA 2QM3A 5HVQC 3ZP5A 3GUDA 5IT9K 1S3JA 1K6OA 4HBLA 3E6BA 4H0EA 5L3DA 3P7NA 2V79A 3FXQA 2F5DA 1R7JA 1CF7A 1IF1A 3O2PE 4MEYF 4IF4A 3QP5A 3T0YA 1O3RA 4UVAA 3BJOA 1YLFA 1R1VA 2MLGA 4L5IA 4P5OA 4Q5SF 3WE3A 3LA3A 1ZG1A 2J5PA 2P7VB 1XD7A 2G7HA 3Q9VA 3WTVC 1LJ9A 1J0RA 4MGRA 5KK1A 3G73A 4A0YA 1XGSA 2PG4A 2ISYA 4HA8A 1O3SA 5E8GA 2ZMEA 2ZJ2A 3VEPA 4IJAA 3WGIA 2WV0A 4BXUA 3CUQC 1RUOA 5J8FA 2DTRA 4KN4X 3ZMUA 2QQAA 2Z33A 3T5XA 2B0LA 4G6DA 1I1GA 3IWZA 3IWFA 4L0YB 5AIQA 4YG2F 3HHHA 4RGXA 2VOOA 1HKTA 1XCBA 1FP2A 1U5TC 5DDGA 3ABUA 3CTAA 1BJAA 4PZJA 3TOAA 3ERED 3LWFA 1U2WA 1BC7C 2K4BA 1IN7A 4EMSA 2L02A 2QBYA 4ENMA 1W5SA 1XGOA 3FWEA 2O61A 1XB4A 3H3ZA 1YFHA 5D4RA 4M9ZA 2A3SA 2PN6A 1HW1A 4EJUA 4G6QA 4MEXF 2A5YB 2Q8KA 3MAJA 4PGHA 2HEOA 1MGTA 2NNNA 1KQ8A 2MD5A 3FX3A 5IT3A 3DQVC 4G8XA 2EV6A 4I98B 4I02A 2HR3A 2IW5A 2YX4A 2ISZA 5DYMA 3BJAA 1RI7A 4CGZA 3E5UA 5CVRA 3IC7A 2FMLA 1FYLA 2VC0A 3BPVA 2VBZA 4OINF 4CICA 4IPAA 1HQCA 4LLGF 3VODA 5HDKA 5L3CA 5FFZA 3I0TA 3F21A 5D6FA 4ENKA 4M6XA 2EJRA 3WE2A 1I27A 5DCMB 4RS8A 1O7FA 4ENJA 2Z3YA 2FEZA 3ZMZA 4L9VA 4HQEA 2ETHA 5DEQA 2LF8A 3CUQB 3FXUA 3WTWC 4GGGA 2P5LC 2P5VA 3QPHA 4KUMA 4LK1F 1FYKA 3R0JA 3I58A 3F3XA 4KT5C 2OD5A 5L3GA 2HYFA 2FNAA 3W6JB 3RDIA 1A04A 3K69A 1IZ1A 5D4SA 3JW4A 5D8KB 1U5TB 5LHGA 4GYIA 5ERIA 2CO5A 2ZBKA 2CQKA 1DUXC 3ZMDA 3HRTA 3GWZA 4Q4ZF 5DCFA 2XKOA 2CW0F 2VONA 3L9FA 4G7ZF 4OIQF 2Z5UA 3MWMA 4WXCA 3GFMA 3GO5A 4JBAA 3F23A 3V8JA 1JE8A 1VTNC 2JPBA 2DI3A 3WTZA 1PUEE 5LEJA 1MDMB 5BMZA 1YYVA 4Y15A 5CVJA 5FO5A 5JI6A 3R0AA 4U7BA 2XROA 1IN5A 3HYIA 4WK8F 2XAFA 3R60A 2MC3A 4TV7A 2ZXJA 2O6GE 2G7UA 1FLIA 3L09A 4AIJA 3E3VA 5LHIA 2VN2A 3MFKA 4I7HA 2JPCA 2DU9A 2RV8A 2YSRA 2XVCA 1KU7A 1RZ4A 3K1PA 2HWVA 2QWWA 2BEOA 4ZZLA 3R6SA 2JT1A 1J7KA 1I5ZA 3KP2A 4IXAA 4A6DA 3FMRA 3DFGA 2M5WA 3K9TA 1HW2A 4GO1A 1TNSA 2J5OA 3CUOA 2WC2A 4YFKF 4M71A 5E20A 2EFQA 4U0VA 1QBJA 2L4MA 2L01A 2FOKA 1ZHFA 3KZZA 1HXDA 4RB2C 3FF5A 4RGUA 4I2OA 4LLLA 2EA2A 2BBYA 3B73A 1GVJA 5BQTA 3IKTA 2K02A 4U0WA 3ELKA 1P4XA 3SZPA 4LLNA 4F7ZA 4IRIA 1TW3A 4BNCA 5DV5A 4ZYDA 5ILSA 4WF2A 3BWGA 2O0YA 4FHTA 2DPUA 2IT0A 2CGPA 1KU9A 1FNNA 2IPQX 1W7PD 4HX8A 2STWA 1V3FA 1QZZA 4AWXB 1H9TA 2H09A 2HQRA 5E1WA 1F5TA 4A0XA 1DPRA 1FZPB 1B9NA 3KCCA 3DXJF 2XAQA 3TO9A 3DPTA 2CWEA 2VBXA 1B1BA 1J2XA 1ZH5A 4HX7A 4U88A 4ZYEA 4JK1X 5BPIA 4HLYA 2RNJA 2FBKA 4LB5A 3GFJA 3FM3A 1FX7A 3TO7A 1YW8A 1T6SA 4YIIA 1DP7P 1G3SA 1RNLA 3VB2A 2QVOA 3OV8A 1BIBA 3F72A 1B59A 1YIOA 2DQRA 1W7PA 2BE5F 2C6YA 5E17F 3WTUC 5LLQA 2CFXA 1S7AA 4RB3C 5D6EA 1C0WA 1IW7F 1D5VA 3M1EA 2GAUA 3JTGA 4ASNA 4HF0A 4P9FA 5FGMA 1LDKB 2BV6A 2VBYA 3GYHX 1S29A 2WTEA 4RAZA 2GIVA 2XUBA 1JHHA 3WGHA 1H0MA 1CGPA 1REPC 3ZPLA 2XGXA 2STTA 1IXRC 4PCQA 5JFRA 1ULYA 2MBFA 4OOIA 2YPRA 5EEHA 3DKWA 2D2WA 1EH6A 4L18B 3I5UA 1W5TA 2AXLA 4S04A 4EJWA 1OPCA 1UB9A 2GWRA 2M45A 4OU0A 2EV5A 2PEXA 1XSDA 2VBWA 5D5UB 3WTSC 2DK5A 2QQ9A 4WXHA 5HDGA 2WWYA 2FRHA 4Q47A 3LQQA 3REOA 3KETA 2DW4A 1XN7A 4HLXA 1FBUA 3HOSA 2FMYA 1J59A 4OIRF 1I1SA 3CJNA 1ZGJA 4NB5A 4ESJA 2D45A 2FBHA 2A07F 4Y17A 2OQRA 2XKPA 1Z7UA 2KJCA 1R23A 3QOPA 3EETA 4ZYGA 5JHUA 2HGCA 3BDDA 1O3TA 2L3DA 4HYEA 2QLZA 1FP1D 1XGNA 5D5WB 4I0AA 5E1XA 4QLCU 1HKSA 5HLIA 2O3FA 2K7LA 5HOOA 2OZUA 2BGCA 4YIFA 1DPUA 2ESHA 1SFXA 4I0BA 4HDVA 5JVTA 1R22A 3WGGA 3WODF 3HUGA 1IN4A 1QNTA 2W24A 2D1HA 4WX9A 3L2CA 4KYWA 4GXOA 1WI9A 2IA0A 4ON0A 4Y13A 3L7WA 2KIFA 1SD5A 5FLXK 3EDPA 1R00A 3KEOA 1ZREA 3M8FA 2A68F 1SD6A 1UFMA 1NHAA 5H6QA 3FZVA 3GZ6A 3F6OA 4S05A 1MD0A 2V1DA 3ZMSA 1G4DA 2P8TA 4EVIA 3C1DA 3KP4A 1L0OC 3LSTA 4N9HA 4RB0A 5LGTA 2PI0A 1ONVA 4ZYHA 4M74A 1LEBA 1FSEA 2Z99A 4M9SA 4L5JA 4DQ2A 4KN7X 1OMIA 3I53A 3K1MA 4A12A 4KDPA 2HKXA 3L00A 4A5MA 5DCMA 1H9GA 2XV4S 3WG9A 1D3YA 3RPQA 4CZZA 3V4GA 2D1VA 1DDNA 1XSVA 1SMYF 1YS6A 3I54A 2OU2A 1X3UA 2V9VA 4UV9A 3ECOA 3CUQA 2GZWA 3ISPA 2BYVE 3V8KA 3HTUA 1ZAOA 2CSOA 4CYDA 2IA1A 2HZTA 1Z6RA 4LMYA 1HW5A 1E2XA 4I01A 4LFUA 1LVAA 2IJLA 1R58A 1YW9A 5CVUA 4P55A 1B4AA 4GYGA 2FBIA 3K1NA 4CO8A 4CXFA 3M8EA 3BZ6A 4UUVA 2LDUA 4N0BA 4UV8A 3DPLC 1U5TA 3N97A 1SD7A 3IRRA 2UXNA 3O3KA 4O6JA 1HBXG 2QZ8A 1BI2A 1Z9CA 2DPDA 2XIGA 4DNCA 2RVCA 2VT2A 4WXDA 4ZZDA 1BN5A 2PMUA 4IHTA 3C7JA 1S8NA 2ZNYA 2ZNZA 3KP5A 3ZMTA 4UXNA 1Z1DA 3F8FA 1Y0UA 2HFHA 3I59B 3LAPA 3QU3A 3LFKA 2VE9A 1MDMA 2RC4A 2VE8A 3KZYA 5CVVA 1IRGA 5FB2A 3VOEA 2EK5A 2O03A 4HQMA 5TRDA 2FSWA 1JGSA 3TGNA 1FT9A 3VFZA 4ZH4F 1BI0A 5F6FA 2HTJA 3V7RA 1KYZA 2R7DA 1LEAA 3RYPA 3U2RA 5K5QA 2MH2A 5LRSA 4IRGA 1P6RA 1B6AA 1FOKA 2ADUA 5CYVA 4R79A 3ECHA 2DO7A 3COAC 3O6BB 3D5LA 3J80K 3HSFA 2F2EA 4NQWA 4EGZA 2P6TA 3HRMA 3QAHA 1ON2A 3J7AO 2P5KA 3EUHA 3FM5A 4G94A 2MA3A 4UHTA 2XHKA 1O3QA 3SQNA 1J9IA 4KMFA 1WRJA 2M30A 3KEQA 3E97A 1MZBA 1IXSB 2DFIA 2KJBA 3KP7A 5AIPA 2H94A 4Q48A 3V7CA 2E7WA 1MKMA 2E1NA 3FXRA 1ZGAA 3HRUA 2G9WA 1QGPA 2Y48A 1BM9A 1G6NA 3SZTA 2VT3A 2OQGA 4HOBA 2PFBA 2GA2A 3WTXC 1UCRA 1MJBA 3F8NA 3GLXA 3F6VA 4LGWA 5HLHA 3P9CA 5DD4A 3HSEA 4EV0A 2W84A 4OMZA 1KU3A 2LKPA 4PDKA 4O5VA 3V7SA 2M87A 4UVCA 4FT8A 4MQ9F 2W57A 4KFCA 3T8RA 4HF1A 2Q2EA 2ZCWA 3ULQB 4YFXF 2COMA 3CDHA 5A2QZ 1WSUA 4HV5A 3M9AA 4KIGA 2LNBA 1LB2A 2EV0A 4KNYA 4LG0B 3U9GA 4HW0A 2M1BA 3GXOA 4A0ZA 3KP3A 6PAXA 1P4AA 1LDDA 3K2ZA 1R1UA 4XLNF 3GF2A 1K78B 2XAHA 3K0LA 2H6BA 2X0LA 2P4WA 3GFLA 1G3WA 2FU4A 1QO0D 2MH9A 2P7CB 2HOEA 5ICFA 3HRSA 3J81K 4PGGA 1EH7A 3TDUC 5LEKA 3SFZA 3TOBA 1F4KA 1BIAA 2VC1A 2KRFA 4QWQA 4BHPA 1TQPA 2KKOA 3JAMK 3QPTA 4HAMA 5H6RA 3NEUA 4BHBA 1AWCA 1S7OA 1ZLKA 4WWCA 1U3EM 1R36A 3BPXA 1HSTA 2L4AA 3Q5FA 4ESFA 4XSXF 5L3BA 3G3ZA 1YW7A 3BJ6A 2QQBA 4N9IA 4EM1A 2NNYA 3ZQ7A 3EYYA 3TQNA 1F9NA 2YU3A 3DV8A 2UZKA 3QRFF 4AD9A 2GXBA 2RQPA 2DK8A 2K86A 2ZO4A 3HHGA 2JZYA 4BQAA 5FD6A 1J5YA 1G3YA 3KLNA 2Y75A 3LA7A 2FA5A 2VOPA 5D5XB 1P4WA 1XMKA 5K5OA 4OIOF 2A61A 2HTSA 2HKOA 2V6CA 2F5CA 4FX0A 1FPQA 3WU0A 1XMAA 2HS5A 4BHCA 1USTA 2IA2A 4HZFA 3IHUA 3IRQA 1SMTA 4RGRA 3P9KA 2YR2A 5ILVA 3CO6C 2NAZA 1I6XA 5JR3A 3RYRA 3DP7A 2RKHA 5IT9Z 4R1HA 2IVMA 2FXAA 1IN6A 3IKVA 1JHFA 2ELHA 3HIFA 5TJJA 1TTYA 4RAYA 2R3SA 1PDNC 2RN7A 2ACJA 5J6XA 1CF7B 1OR7A 3E5QA 3P9IA 2VODA 1OYWA 3IL2A 1W4MA 1IAWA 2K27A 2DT5A 4LJZF 3DF8A 2KIUA 4KMUX 2IP2A 3ML6A 3AAFA 3RTRA 1HSJA 1U8RA 2VXZA 1QQIA 3MZYA 4EM0B 5ICCA 5BPDA 1L3LA 3I64A 2M8EA 4L9TA 3RIRA 2ZMEB 5LHHA 3U1DA 1WWXA 2A6EF 3GX4X 5LGNA 1SFUA 1WKMA 1SAXA 2EFPA 2V1UA 1QPMA 2ZKZA 3KE2A 1KQ0A 4A6EA 5BOXA 4L9JA 5LRRA 1T2KA 2IRFG 1O7LA 5CJ9A 4KIFA 1Q1HA 2Y0MA 3GVAA 3N4MA 2W85A 3KP6A 5K5RA 2E7XA 4AVPA 4IHSA 5DUKA 3F8MA 1TLHB 3GEZA 5AONA 3SHFA 3TO6A 1KA8A 1MJAA 3FMQA 3JTHA 4RB1A 1Z05A 2P6SA 2DLLA 2QBYB 3BP8A 3M7GA 5FLXZ 4MTDA 3ZMVA 3B02A 5E8IA 2GA1A 2AS5F 5K1YA 3TKYA 5E1ZB 5FFXA 1IXCA 4JQFA 2X4HA 4U0YA 2QYOA 2TDXA 1SFEA 5KVRA 1FWZA 2EA4A 2JSCA 1YQAA 4OMYA 2EFWA 4Z2YA 1EV7A 3BOQA 4L9NA 2Q0OA 4UVBA 3OOPA 1T39A 1ZARA 3RI4A 2HDCA 1R5GA 4K2EA 2GXGA 4I09A 1KU2A 2QUFA 3I4PA 2PLYA 1OYIA 3I59A 3NRVA 1K7AA 1J75A 3MQ0A 1TQMA 5ILUA 1UHMA 1KYWA 3CO7C 3RKXA 4FX4A 1WQ2A 2EFNA 4L0ZB 3WTYC 4CDGA 1LQ1A 2W25A 1IN8A 4B09A 1TW2A 4KICA 3DEUA 3RJPA 1XGMA 1U78A 1U6GA 4KIBA 1LNWA 1TNTA 4LK0F 4AIHA 2V1XA 5ED4A 1UHWA 4BH9A 1E17A 5L3FA 4B8XA 4AIKA 1T98A 3JSPA 1S6LA 3MZHA 3FMSA 1PP8F 2GQQA 3T1BA 3H3UA 4XLPF 1G3TA 2H27A 1FYMA 3LA2A 1XDUA 4ESBA 1GXQA 3FHZA 1JXSA 4MQVA 1T0FA 3CLOA 5BS6A 3TDZC 5HLGA 3NQOA 3PFIA 2L54A 3RKYA 3C18A 3ZN0A 1ZYRF 3H92A 2EFOA 3HSRA 3R4KA 2LF7A 4ETSA 3HTSB 5L3EA 3E6CC 4LB6B 1ZN2A 2XRNA 3BROA 3QU6A 1FBQA 2R7FA 3MCZA 2LSOA 5CVIA 2RGVA 5HS9A 3F8CA 1KGSA 1KQ9A 1BI1A 5LGUA 1V4RA 3LQRA 5HS7A 1ZG5A 4HX4A 4KA4A 5LBQA 3R61A 3Q9SA 2H6CA 4IVNA 1BI3A 3D0SA 1LDJA 1ZRDA 2FE3A 4G7HF 2K4JA 4R8HA 2UWMA 2HQNA 4NHJA 5F64A 4HV6A 4EJOA 1FC3A 3T8TA 4UNOA 3V8LA 2QENA 2A6HF 4XSZF 1T38A 2OAZA 3J80Z 5J8CA 4WCGA 5HDNA 3GZ5A 1FBSA 5CLSA 2XASA 2CG4A 3I71A 1F1ZA 5ICGA 1MJ9A 4YFNF 1ZG3A 1YG2A 4M73A 2DBBA 2FF4A 1RIOH 3KLOA 3ABTA 1Z91A 2EWNA 2E1CA 4E70A 2O8XA 3GW2A 3JSOA 4CHUA 1GHCA 1STZA 2DQLA 3EYIA 2F5EA 3EQLF 1IUYA 1GXPA 3SXYA 1TQIA 3KFWX 1ZRFA 2XAGA 4BYYA 5A2QK 1ZLJA 4LG0A 5DUIA 3RPUA 3WU1B 1ON1A 1YS7A 3F8BA 4G9YA 3WTTC 4OIPF 1K78A 2DAOA 1BBYA 4GCVA 5H20A 4M9XA 2PQ8A 4P9UA 1FY7A 4RGSA 1ZRCA 2JRTA 1BC8C 2NS0A
chains in the Genus database with same CATH superfamily
5K7ZA 1G59A 2KIMA 5FKKA 1USSA 5DD8A 2XB5A 4HEA2 2HQ5A 1K79A 4AUXA 3PFYA 5HNHA 3G1MA 4PSXA 1MBHA 4JYKA 1OYYA 5K7HA 4IHWA 4N4NB 2AXTC 3E6DA 4EQQA 1PP7U 1U0JA 1WH5A 4M72A 3L2UA 1O57A 2VASA 1YO5C 3J7ZI 2GBYA 3HL2A 2CYYA 4MNUA 2JA8J 1YTYA 4C3HJ 4HDUA 1AOYA 4XKWA 1RUNA 1WFXA 2IGOA 4MFDA 3PQKA 3H0GJ 1NG7A 1R1TA 5J47A 2ZSIB 2DJNA 1J09A 2Y69H 4MHGA 3ROUA 5EF6A 2R92J 1D8KA 4BKXA 3BY6A 4IRHA 3F22A 1HKQA 2R4GA 1DGRM 4LD5A 4XRFA 2H1LA 1ZR2A 1EKEA 1X2MA 1OKRA 1BOAA 2YX7A 5FKOA 1FOXA 3HOTA 1EH8A 3OR1C 4D0PA 1FSHA 5JLXA 1Z6TA 3OYGA 4EJVA 1MNEA 2JTVA 3LAJA 4G7OF 1GV2A 3VYTB 2H1KA 1LFUP 1Z3YA 3QP6A 3ZN1A 4XBFA 2HYGD 2JA5J 5D5VB 4U7DA 2DT6A 4M6YA 1TL8A 2OBPA 1VQ6I 1XCVA 1TWHJ 1IRFA 3E6MA 2FNPA 2E60A 4FASD 1W7PB 1VQ7I 4P96A 1P2FA 5JVGF 1YJNI 3HPHA 2RDPA 3J81Z 1FIAA 1GV5A 5J1UA 4EJTA 5EEGA 2NYXA 2LK2A 2EB7A 4BGDA 4YELA 2M8GX 2PMHA 4A5NA 3E5XA 4XONA 3JRHA 2A69F 2ESNA 1D8JA 1ODDA 3MEXA 1I3QJ 4O3MA 4RAGA 3JAMZ 3IUOA 4EM2A 2KP6A 4XICA 2X1EA 4PJ0C 2XAJA 2MLKA 3HJEA 3RKWA 2OA4A 4HF2A 1U9OA 3BZKA 4CCOA 5ICEA 2JMWA 1W1WE 1XSXA 2W1OA 5D8LB 1MSEC 2OZ6A 3EPZA 2LY2A 4PUSA 3FDYA 2VPLA 2PJPA 2K5CA 1I50J 1XDSA 5FD5A 1MW7A 1VQPI 4ENNA 4PFPA 2NRAC 4E4HA 2KPMA 4C2TA 1LE8B 4MTEA 3HG9A 2NS7A 2Z9OA 2FX0A 4BQQA 2XC7A 4XLFA 4XOTA 3S2WA 4EGYA 1P92A 5E18F 2F5FA 2FQ3A 2NVYJ 1VZ0A 3TP0A 4MFEA 1BA5A 1QZYA 1BR4A 5EGOA 5F1RA 2E2JJ 3J7YJ 1B72B 1MIJA 5HS8A 1X1BA 4M3GA 1TBXA 1Z7LA 3PQJA 1BR2A 3W3CA 3W6KB 1K61A 1SD4A 3SJMA 5M5YJ 3BG9A 3OIQA 2ZFWA 2PBIA 3GFIA 2LMDA 4BAYA 1B9MA 3C3WA 1Z67A 3H5NA 5EEAA 3AL0C 1PYVA 2UXXA 1R5HA 4A2UA 2QM3A 5HVQC 3ZP5A 3GUDA 4A3IJ 4UY8I 3OOUA 5IT9K 1S3JA 1K6OA 4HBLA 2R7XA 1OCOH 3E6BA 1Z0XA 4H0EA 5L3DA 3P7NA 2V79A 3FXQA 2F5DA 1R7JA 1CF7A 1IF1A 4PJMA 3O2PE 4MEYF 2E2IJ 1DU6A 2O5RA 4IF4A 3QP5A 2R7TA 3ZQQA 3T0YA 1O3RA 4UVAA 2IGMA 3BJOA 1YLFA 3MVPA 3FKIJ 3A03A 1R1VA 5IYBJ 4CCLA 2MLGA 4L5IA 4P5OA 1D0ZA 4Q5SF 3WE3A 1R71A 2CJJA 4F55A 3LA3A 2VJIA 3RKQA 2X9DA 1ZG1A 4BQOA 2J5PA 2P7VB 1XD7A 1GDTA 2G7HA 3Q0WA 2R5YB 3H5RA 3Q9VA 4BXFA 3WTVC 1LJ9A 1J0RA 4MGRA 5KK1A 3G73A 4A0YA 2FOWA 1XGSA 3D5RC 3VYSB 3I55I 3A4CA 2PG4A 2ISYA 1ZTRA 4HA8A 1O3SA 5E8GA 2ZMEA 2ZJ2A 4XM3A 4PSWA 3VEPA 4BE1A 2KRHA 4IJAA 3WGIA 1QVTA 2WV0A 4HNVA 1XPXA 1WJEA 4BXUA 1ZELA 3CUQC 1RUOA 2BY3A 3OYDA 1ETVA 5J8FA 3CP8A 1FOYA 1LFPA 1T33A 2DTRA 4KN4X 2FJ1A 3H0DA 3ZMUA 3A01A 2L9NA 2QQAA 2Z33A 1RKWA 5J40A 5F0CA 3PNTA 3E7LA 2Y2ZA 2R0QC 5F27A 3T5XA 2B0LA 4G6DA 1I1GA 4IHVA 3IWZA 3IWFA 3OIOA 4L0YB 2RNGA 2DCEA 4RA2A 5AIQA 4YG2F 1AU7A 4UUTA 3UR3C 1ETXA 3HHHA 1IV8A 4RGXA 2VOOA 1HKTA 3ABLH 1XCBA 1FP2A 1K6YA 1M1EB 3FBNB 1U5TC 5DDGA 2E1OA 3ABUA 4HG2A 3FBIB 3CTAA 1BJAA 4PZJA 3TOAA 3ERED 4XLCA 3LWFA 1U2WA 1RRJA 2NXNB 3DTIA 2VPRA 3G1OA 4QPQA 1BC7C 2K4BA 2NOJB 1GLNA 4B47A 3S32A 1IN7A 2Y30A 4EMSA 3LSRA 2L02A 2QBYA 5GPCA 4ENMA 1YRNB 1W5SA 1HOMA 1XGOA 3K2AA 3IP4B 3OSFA 1AKHA 4A3CJ 3FWEA 2WB1A 2O61A 1XB4A 4HSRA 1X3ZB 1YIJI 2Q1ZB 1MBGA 5GADJ 3ZQLA 1RPWA 4BUPA 3HUGB 1H89C 3WG7H 3H3ZA 2BHZA 3OS1A 1YFHA 3CF2A 1SANA 2WY8Q 5D4RA 4M9ZA 2A3SA 2PN6A 1HW1A 4EJUA 3PO3J 4XRMA 3KX2A 4G6QA 2NVQJ 4MEXF 2EZLA 2A5YB 2Q8KA 2Y9ZA 4LIVA 3MAJA 4PGHA 4ZYAA 2HEOA 1MGTA 2NNNA 3CCQI 4E6KG 1KQ8A 2MD5A 2L5QA 2VJJA 2ZB9A 3FX3A 3K4CA 2IGNA 3BZCA 4B3AA 3H9JA 5IT3A 2L9RA 3DQVC 4G8XA 2JA6J 2EV6A 3FIWA 1B8IA 4I98B 2EINH 3TW6A 3JR9A 5E3OA 4I02A 3A2KA 2CUFA 9ANTA 1ORKA 4X1EA 2HR3A 1PUFA 2BXYA 2IW5A 2L2OA 2IEKA 3AL0B 2YX4A 4XN0A 1WJ5A 2A5WA 3QPLA 4DBQA 5KHDA 2ISZA 5DYMA 1JGGA 4XLHA 1VF9A 1RI7A 2LRDA 3BJAA 4CGZA 3E5UA 5CVRA 4A3DJ 2DOEA 2BVLA 3IC7A 5CQEA 2FMLA 2O8KA 3CDLA 1FYLA 2VC0A 3MKLA 3BPVA 2VBZA 4OINF 2K9NA 2K9QA 4BE0A 3I56I 3A0HC 4CICA 5HODA 1VQ4I 4IPAA 2JUCA 2I10A 2K85A 1HQCA 4LLGF 3W2VA 3VODA 5HDKA 3SYTA 5L3CA 4IKFA 3DTEA 5FFZA 2JN6A 3I0TA 3F21A 5D6FA 4ENKA 2VIXA 1JKQC 5JHFA 4M6XA 2EJRA 3WE2A 2EZHA 3TEDA 1I27A 5DCMB 4RS8A 1O7FA 4ENJA 5C44J 3LSGA 2Z3YA 3DTKA 2FEZA 3ZMZA 2KZVA 3EUHC 3I3LA 3Q0VA 4L9VA 4HQEA 2ETHA 5DEQA 1X3WB 2LF8A 1SVMA 3CUQB 2DTZA 1W0TA 3LSJA 4MO7A 1UELB 3FXUA 3WTWC 4IHXA 4GGGA 3K7AJ 2P5LC 2P5VA 2R7OA 3QPHA 5B3SH 2HZDA 4KUMA 4LK1F 1NK2P 2VKDA 1FYKA 3R0JA 3I58A 3F3XA 2A05A 4KT5C 2L7KA 2OD5A 1ETQA 5L3GA 3K4KA 2HYFA 3I4NJ 2N8GA 2FNAA 2R7WA 4CH7A 4HNUA 3W6JB 3RDIA 1A04A 3ASNH 3HEFA 3K69A 1IZ1A 5D4SA 3JW4A 1A35A 5D8KB 3LSIA 1U5TB 5LHGA 2IS1A 4GYIA 5ERIA 5GAHJ 2CO5A 2ZBKA 2ZJPF 3PIPF 3OSGA 1WCMJ 3BQZA 2ZSHB 2CQKA 5IP6A 1DUXC 3ZMDA 2K9LA 3HRTA 3GWZA 4Q4ZF 5DCFA 5J3LA 4E7ZA 2XKOA 1D1BA 3HPGA 2CW0F 3S3OA 2VONA 3L9FA 4XL9A 4G7ZF 3BR1A 3OYMA 4OIQF 2Z5UA 4FCYA 3DLAA 3MWMA 4WXCA 2NVUB 4BEHA 3BG5A 2OUMA 3GFMA 1JUSA 2GIZA 4S0HB 2CQNA 3CZ6A 2HOTA 3GO5A 4JBAA 3F23A 3V8JA 1JE8A 2JPBA 2DI3A 1VTNC 2M9HA 3WTZA 1PUEE 5LEJA 3A02A 1MDMB 2DOAA 5BMZA 1YYVA 4Y15A 2LC2A 5CVJA 3CMMA 1FOWA 5FO5A 5JI6A 2NOGA 3R0AA 4B3XA 5EZHA 4U7BA 2XROA 3QQAA 1SEUA 4B43A 2L7FP 4B48A 1IN5A 5FKMA 4G12A 5FLVA 3BTIA 3HYIA 4BDZA 4WK8F 2XAFA 4B1RA 1WPKA 1GUUA 3R60A 4QIWN 5K7FA 2R5ZB 2MC3A 4BBSJ 4TV7A 2ZXJA 2WAQN 2ELKA 2O6GE 3JREA 2G7UA 2VI6A 1V5FA 2OV7A 1FJLA 1FLIA 2V6EA 3L09A 4AIJA 3E3VA 1QZEA 5LHIA 3K10A 2YU9J 2VN2A 3MFKA 4I7HA 2JPCA 2DU9A 2RV8A 4XKCA 2QSGX 2G0EA 2YSRA 3JRAA 2XVCA 1KU7A 1RZ4A 3K1PA 3OL4A 3ZXSA 2O9LA 4NBQA 1LUJB 2X51A 2M3AA 2HWVA 2VJ4A 2WY7Q 4A3FJ 2DYSH 2QWWA 2BEOA 2DA2A 4ZZLA 4I76A 3F0CA 3R6SA 2X6YA 2JT1A 3TBIA 1J7KA 3JRDA 1I5ZA 3KP2A 4IXAA 3W6VA 4A6DA 3FMRA 3DFGA 3H35A 3LSKA 2M5WA 3K9TA 1HW2A 4GO1A 2BW3A 1TNSA 2J5OA 4HRIA 3CUOA 2WC2A 4YFKF 4M71A 1R9TJ 2F4MB 5J4VA 1XTAA 5E20A 2LBFB 2EFQA 3KEYA 4U0VA 4CSWA 1MBEA 3C2GA 2ICWG 3V42A 3HC7A 1QBJA 2L4MA 5FROA 3HDDA 2L01A 3PUFA 2WAEA 2FOKA 1ZHFA 3EUKL 3KZZA 3P5JA 1HXDA 4C3IJ 4RB2C 3FF5A 3K4MA 5KAIC 4RGUA 4NQWB 4I2OA 4LLLA 2EA2A 1MMAA 2LOOA 3SDGA 2BBYA 3B73A 4XR6A 1GVJA 2DA5A 5BQTA 3IKTA 2DA4A 2K02A 2MYSA 2W7NA 4U0WA 3H3VK 3ELKA 1MBJA 1P4XA 3RZOJ 3OYBA 4JX5A 2CV0A 3SZPA 4LLNA 4XOPA 4BY1J 3EUAA 4F7ZA 4IRIA 1HF0A 3G6EI 1TW3A 4BNCA 2MW8A 5DV5A 4ZYDA 5B1AH 1VQOI 3FXKA 3HOUJ 5ILSA 4WF2A 2TCTA 3BWGA 2O0YA 2Y0SN 2F6CA 4LIUA 1Z77A 1W5CC 4FHTA 2HYJA 2DPUA 3BTJA 4F93B 1R49A 2JUGA 3C2HA 2IT0A 3CMAI 1KU9A 2CGPA 2RQQA 3GBGA 1FNNA 3OR2C 2IPQX 1W7PD 4HX8A 3FK7A 2STWA 1V3FA 2CMPA 1QZZA 4AWXB 1H9TA 3CESA 2KLOA 2H09A 2HQRA 2QGUA 3A0BC 1VQLI 4ZJZA 5E1WA 1D5YA 4D1QA 1F5TA 4A0XA 1DPRA 1FZPB 1PJRA 2VQLA 1WJCA 1B9NA 3KCCA 3DXJF 2XAQA 3TO9A 3DPTA 1U8BA 2CWEA 2VBXA 5GPAA 1B1BA 1J2XA 3W2WA 3S15J 1ZH5A 4HX7A 4NNJA 4U88A 4ZYEA 1Z21A 2OCEA 4JK1X 5BPIA 4UUSB 2EBIA 4HLYA 2QCOA 1RC9A 2RNJA 2FBKA 4LB5A 3GFJA 3FM3A 4XMYA 2E5ZA 1FX7A 3TO7A 2VL8A 3ZOBA 2UUZA 1YW8A 1T6SA 3HZJA 2E1MC 2DFFA 4YIIA 1Y1WJ 1DP7P 1G3SA 5JLWA 2XF5A 1RNLA 1SC7A 3VB2A 2QVOA 3OV8A 2R7VA 2Q2EB 1BIBA 3F72A 1B59A 5E3NA 1QRYA 1YIOA 2DQRA 1W7PA 3ERMA 1D0YA 3CMEI 3LFUA 4BQNA 2BE5F 1BR1A 1NK3P 2C6YA 2VQCA 4A69C 5E17F 3QOEA 1MNDA 3WTUC 5M3MJ 3K70D 5LLQA 2CFXA 4A3GJ 3FXMA 4RAFA 2L0KA 2DDAA 1TWFJ 1S7AA 5F0FA 3LSMA 4DIQA 4CZCA 2CV1A 1JTXA 3FXOA 4RB3C 4KT6A 4A93J 5D6EA 4E7KA 1C0WA 1AHDP 1IW7F 2B7EA 1D5VA 3M1EA 2GAUA 4X6AJ 3JTGA 3N05A 4ASNA 2OPTA 4XN3A 1VI0A 2E71A 4HF0A 4E7SA 4P9FA 4QSHA 5FGMA 1LE8A 1LDKB 2BV6A 5E3LA 2VBYA 3GYHX 5EZGA 1TP4A 2TRTA 4JX4A 1WZ2A 2ID3A 1S29A 2WTEA 3HKZN 4FETA 1MH4A 1B72A 4RAZA 2GIVA 4BY7J 1TT5B 1JHHA 2XUBA 3WGHA 4KJZA 4A3JJ 1H0MA 1CGPA 1REPC 1XX5A 2CQ7A 2I5UA 3ZPLA 1P7IA 2XGXA 2STTA 3CCRI 4RBOA 4J01A 1Z3XA 3ASOH 3CP2A 1E3PA 1IXRC 3TL4X 3ONQA 3CLQA 3ABKH 4PCQA 1ULYA 5JFRA 2MBFA 4OOIA 2YPRA 5EEHA 4C30A 2JWTA 1ETWA 3DKWA 2IS6A 2D2WA 1EH6A 2M4GA 2M34A 3BT9A 4L18B 3I5UA 3DPUA 4FE7A 2CFOA 1W5TA 2AXLA 1MBFA 3M07A 2HOAA 3I9V2 4S04A 2HPIA 3SZGA 1R4NB 4EJWA 1JI8A 1OPCA 2IGKA 2IS2A 3IAM2 1UB9A 5M3FJ 2GWRA 2M45A 4OU0A 2EV5A 2PEXA 1X1PA 2X6WA 1XSDA 3MKZA 2JA7J 5C4XJ 2VBWA 2R5YA 5FJ8J 5D5UB 3WTSC 3K6GA 3L2RA 2DK5A 2QQ9A 4WXHA 5HDGA 2WWYA 3BCAA 2FRHA 4Q47A 3E1SA 3LQQA 5C3EJ 4X0GA 5EYRA 3REOA 3GCMA 3KETA 3PO2J 2DW4A 1V55H 3OYFA 1XN7A 4HLXA 1FBUA 1LPQA 3HOSA 3DBHB 2FMYA 1J59A 1UMQA 2DMPA 4FE4A 4OIRF 4OAZA 1I1SA 2BY1A 1UHSA 3CJNA 4AIDA 1ZGJA 4NB5A 4ESJA 4DGWB 2D45A 1JJ8C 2FBHA 2A07F 3GTPJ 4Y17A 2W48A 2M7AA 2OQRA 2XKPA 1Z7UA 4M3DA 2KJCA 4BU2A 3BLYA 1R23A 3QOPA 3EETA 4ZYGA 1W36C 5JHUA 1ZKGA 1ZR4A 1HA8A 4NUBA 2HGCA 5TGTA 3BDDA 3SFIA 5DM6F 1O3TA 1JUMA 2L3DA 4HYEA 2QLZA 2E1MB 1FP1D 3HOZJ 1XGNA 5D5WB 4I0AA 1XMXA 1UJ8A 5F0HA 3K4BA 4M3EA 3CCLI 1HDPA 4RLFA 5E1XA 4QLCU 1HKSA 2X85A 5HLIA 2O3FA 3FHNA 2K7LA 2FQ4A 1YJ9I 2OZUA 5HOOA 2BGCA 2KT0A 4YIFA 1YRNA 1WJBA 1DPUA 3RSNA 4YIRX 2BVMA 2IBDA 2ESHA 1SFXA 4I0BA 4NC7A 3U1KA 4HDVA 4I6ZA 1YI2I 3B6AA 5JVTA 1A31A 5KNLA 2VUMJ 1R22A 3WGGA 1QPIA 2PJRB 3WODF 3HUGA 1IN4A 2DXIA 1TWAJ 4Y3OA 3LSPA 1QNTA 2E5NA 5DTDA 2W24A 1T95A 2D1HA 1MBKA 4WX9A 3K4JA 3L2CA 4KYWA 4AYBN 3AFHA 3D5SC 2KHMA 4GXOA 1WI9A 2IAIA 1VQMI 2IA0A 2VKHA 2E34A 1X2NA 3L2WA 4CA0A 2CQXA 4ON0A 3A1YA 4Y13A 3L7WA 1VFCA 3S3NA 2KIFA 2ME0A 1SD5A 4W1UA 5FLXK 2B9SA 3EDPA 3PIOF 1K83J 1R00A 3KEOA 2JA2A 1UZCA 3M8FA 1ZREA 2A68F 1SD6A 2LREA 2KIQA 2XPVA 1UFMA 1NHAA 5H6QA 2JRMA 1AA7A 3FZVA 1W36D 3NWTA 3GZ6A 1IRZA 4RM3A 3F6OA 4S05A 3DU6A 1MD0A 2V1DA 3ZMSA 1G4DA 2P8TA 1IGNA 1OISA 2A6TA 4EVIA 3PNVA 3C1DA 3KP4A 1L0OC 3LSTA 4N9HA 4RB0A 5LGTA 4IOCF 3HB9A 2E35A 2PI0A 1LFBA 1ONVA 4ZC3A 4ZYHA 3SEZA 3Q3SA 1QHGA 1HDDC 1O4XA 2BXZA 3FXJA 5CQGA 4M74A 1LEBA 1FSEA 2Z99A 5HLTA 1DU0A 4M9SA 4L5JA 4XK4A 1T0FC 3VYUB 4ANJA 3U21A 4ZTJA 3AG2H 1OLTA 4DQ2A 1MMNA 4KN7X 4DYQA 1OMIA 2QF7A 3I53A 3K1MA 1JXSA 2PMZN 3NARA 4A12A 2ZXHA 3TMOA 1JKRC 2HKXA 4KDPA 5CPRB 3L00A 4C2MJ 4A5MA 5DCMA 5FLMJ 4PJLA 1H9GA 2XV4S 3WG9A 1D3YA 3HM5A 3X2QH 3RPQA 2LR8A 1IRXA 2EIJH 2VJ5A 4CZZA 3V4GA 5GTHC 3CMYA 2D1VA 2EH3A 4CYCB 2F4OB 2DFHA 3CJQB 1DDNA 3G71I 4Y52J 1XSVA 1SMYF 1YS6A 3I54A 1NTCA 2OU2A 4BJ6C 1X3UA 2V9VA 4UV9A 3ECOA 2EQRA 3CUQA 2GZWA 3ISPA 2BYVE 2MFZA 3V8KA 1YE9A 1OCTC 1E0EA 3G2BA 3HTUA 1ZAOA 2MG4A 2L9SA 3CDIA 2CSOA 2EIMH 4CYDA 1X58A 4C3JJ 1WJDA 2IA1A 2HZTA 1Z6RA 2ELJA 4LMYA 4DOZA 1HW5A 1E2XA 4I01A 4LFUA 4BACA 2QEXI 5FRNA 1LVAA 2IJLA 1R58A 1A6IA 1YW9A 5CVUA 4DZJA 4IHYA 4P55A 2AQEA 1B4AA 2QKLB 2MD0A 3JRIA 4GYGA 2FBIA 2VB6A 3K1NA 3G4SI 2JSPA 4CO8A 4CXFA 2XF6A 2BY2A 2EZKA 3M8EA 3LL7A 3QWLA 3BZ6A 5IP7J 4UUVA 3L2VA 2ECCA 2LDUA 4N0BA 4UV8A 3DPLC 1U5TA 1GVDA 3N97A 3DCFA 1A6QA 1SD7A 1T56A 3IRRA 4XLEA 2UXNA 4IEJA 3O3KA 4O6JA 1HBXG 2RREA 1OJLA 2CUZA 2QZ8A 2HDDA 1BI2A 1JT6A 1Z9CA 2DPDA 2XIGA 4DNCA 2RVCA 1OCCH 2VT2A 4WXDA 4ZZDA 2V26A 1TWCJ 3ZQHA 4IQ4A 4UB8C 4YEJA 1DGWY 4BXXJ 1BN5A 2RAEA 2PMUA 3H1CA 4IHTA 3C7JA 1YX3A 1S8NA 1OQYA 2ZNYA 2ZNZA 3KP5A 2WAQA 3HGGA 3ZMTA 4UXNA 1Z1DA 3L2QA 3F8FA 1Y0UA 2HFHA 2K9MA 3I59B 3LAPA 1YOVB 3OMYA 3S2HJ 3QU3A 4H4KC 2Z2SB 3LFKA 2VE9A 1MDMA 2RC4A 3O8HA 2VE8A 3KZYA 5CVVA 2IS4A 1IRGA 5FB2A 3VOEA 1XG1A 3B6CA 3PSFA 4EATA 1KZHA 1IG7A 1QU3A 2EK5A 2O03A 4HQMA 4PK4A 5TRDA 2R5ZA 2X1DA 2D5VA 1BW5A 2HI3A 2LLKA 1ZK8A 2P0WA 2FSWA 1JGSA 3ZQCA 3TGNA 2MSYA 1YHQI 4AC0A 2CS3A 1FT9A 3CJRB 3VFZA 4ZH4F 1BI0A 2NVTJ 2EPFA 4W97A 2HTJA 5F6FA 3V7RA 2GOXB 2AHQA 1WVRA 1KYZA 4IZZA 2R7DA 5EG0B 3L1PA 1LEAA 4HSTA 3OYLA 5F1JA 4PFOA 3RYPA 3U2RA 3BCBA 5K5QA 2HVRA 2MH2A 2X48A 1YX5A 3VPRA 4B44A 3OIPA 4GFBA 1QVUA 2VQGA 5LRSA 4IRGA 1P6RA 1B6AA 2ZJRF 4LG3A 3GTOJ 1FOKA 2ADUA 2VXDA 1K4SA 5FRMA 2ECBA 1FEXA 2LBFA 3MMYB 1LKXA 1LVKA 4D5CA 5CYVA 2KL4A 2R93J 2H8WA 3FKJA 3DKXA 4R79A 3ECHA 4NC6A 2WADA 2DO7A 3DEEA 3COAC 3O6BB 3D5LA 3J80K 3HSFA 2F2EA 4NQWA 3GTJJ 2LY9A 2MABA 3WHCA 1MMDA 2HVSA 3C2BA 4RDUA 3AG4H 2Y0SA 3BTLA 4EGZA 2P6TA 3HRMA 3QAHA 1ON2A 1RESA 1Y6IA 2HXIA 1UAAA 4AVZA 3J7AO 2P5KA 3EUHA 3FM5A 5LFAA 1JT0A 3JCUC 4G94A 1E3OC 1SAUA 2MA3A 4UHTA 2XHKA 2COBA 1O3QA 3SQNA 5M5XJ 2MGQA 2WAFA 4IOAF 3VSLA 1RETA 3IH3A 2E2HJ 1WRJA 4KMFA 1J9IA 2DMUA 3G1LA 2M30A 3KEQA 3PSIA 4DYRA 1ETKA 1MZBA 3E97A 4CCMA 4XRSA 1IXSB 2DFIA 2KMUA 2HVQA 2KJBA 2KQRA 2JJ7A 2H94A 3KP7A 4Q48A 5AIPA 3V7CA 2E7WA 2W00A 2QA4I 1MKMA 3KZIC 3CQZJ 1JUPA 2E1NA 4YRVA 3FXRA 1KONA 1FMWA 1GT0C 2ZXWH 1F36A 1ZGAA 3HRUA 4D7MA 2G9WA 2OTJI 1YJWI 1QGPA 1P7JA 2Y48A 4QPOA 1MMSA 2VQHA 2GLOA 5KAFC 5C4JJ 1BM9A 4M6VA 1G6NA 2KZGA 3SZTA 2VT3A 2OQGA 4HOBA 2PFBA 2KDZA 2GA2A 3WTXC 1UCRA 3S17J 1VNDA 1MJBA 4JX6A 3F8NA 3GLXA 2R7UA 3F6VA 1EF4A 4LGWA 5HLHA 3P9CA 3M1CA 5DD4A 3HSEA 4EV0A 2W84A 1ZQ3P 2F5VA 4OMZA 2I8DA 1KU3A 4UUSA 2LKPA 4BJTA 3DU5A 4PDKA 4O5VA 2WBMA 3F9KA 2M87A 3V7SA 4F52A 1ZGWA 3BR3A 4UVCA 4FT8A 4MQ9F 3VDXA 3WU2C 2W57A 4KFCA 3T8RA 4HF1A 1IDZA 3PNYA 1HLVA 2Q2EA 1WGXA 5FKNA 2GM4A 1D1AA 2ZCWA 3ULQB 4YFXF 2COMA 4V2FA 2OCCH 3CDHA 5A2QZ 1WSUA 3KYCB 4HV5A 3OYKA 3M9AA 2R7RA 2NVXJ 4E7LA 3HXLA 4KIGA 3MZ8A 1DQUA 2XB0X 4JP0A 1FTZA 5B1BH 3E0JB 2LNBA 1FMVA 3LNQA 3FISA 1LB2A 1BL0A 2LFBA 2EV0A 4KNYA 2ZC2A 4LG0B 1JKOC 2DMQA 3CCMI 3U9GA 3BR5A 2UV1A 4HW0A 2M1BA 3GXOA 2AQFA 4A0ZA 3HKZA 5IYCJ 1G8XA 1VQKI 3KP3A 4GRIA 2LG4A 2H8RA 1TZLA 3OS2A 2HPMA 6PAXA 3D1NI 1P4AA 1LDDA 1IDYA 3K2ZA 1R1UA 3RCOA 4XRSG 2ME6A 4DYCA 1ITYA 3IH2A 4XLNF 3GF2A 2DN0A 1K78B 2XAHA 3KIOA 2H6BA 3GFLA 2X0LA 2P4WA 3K0LA 5CKTA 1G3WA 2FU4A 1QO0D 2X6OA 2MH9A 3ZRGA 2P7CB 4FQGA 4OWRB 3SEQA 1CQTA 2CW8A 2DMTA 2FD5A 2LH9A 2HOEA 5ICFA 3HRSA 3J81K 4PGGA 1EH7A 3TDUC 5LEKA 5IYDJ 3SFZA 1IC8A 1OR7C 3TOBA 1F4KA 3H9QA 1BIAA 2VC1A 2KRFA 4QWQA 4DW6A 1ACIA 4BHPA 3GTKJ 2ZMEC 2M2EA 1TQPA 2KKOA 3JAMK 2M4KA 3QPTA 1S7EA 4HAMA 5H6RA 1D0XA 1OCRH 4DZPA 3CCJI 3NEUA 4BHBA 2CUEA 1AWCA 1MNMC 4A3BJ 1S7OA 1ZLKA 4WWCA 1U3EM 1R36A 3BPXA 1HSTA 2L4AA 4D7NA 3Q5FA 4ESFA 2CV2A 4XSXF 5L3BA 2DJIA 3G3ZA 1YW7A 3BJ6A 3WHBA 2QQBA 4N4OB 4N9IA 4M3BA 3OY9A 3VSKA 3IV5A 1TC3C 4EM1A 1XC5A 2NNYA 1SVLA 4EEFG 2M0MA 3ZQ7A 2KRCA 3EYYA 3LSHA 5J1RA 3TQNA 1F9NA 3GTGJ 3Q0UA 4FISA 2YU3A 3DV8A 3NAUA 1S9HA 2QSFX 2UZKA 3QRFF 4AD9A 2HQAA 2GXBA 2RQPA 1NG6A 5M5WJ 2DK8A 2GXAA 2OTLI 2K86A 3FXLA 4E7HA 2ZO4A 3HHGA 2JZYA 4BQAA 4JOMA 3RQ4A 5FD6A 4XLAA 2DFEA 2V9KA 4Y7NJ 1J5YA 1G3YA 3KLNA 4CCJA 1VQNI 2Y75A 3LA7A 2FA5A 2VOPA 5D5XB 1I6HJ 3GLLA 5FKLA 1P4WA 3QODA 1V54H 4P1WA 1XMKA 1OCPA 2X1CA 4GDFA 1ETYA 5K5OA 4OIOF 2A61A 2HTSA 2HKOA 3BG6A 2XSDC 3JRGA 1E3HA 2MC4A 2Z16A 2V6CA 2X6XA 1TT0A 1N78A 2F5CA 3GMEA 2F48A 2L7ZA 1FTTA 2L9VA 3KPHA 1ENHA 3QYFA 3OYJA 4FX0A 4BDYA 3CCSI 1Y0NA 1FPQA 3MKWB 1UG2A 3WU0A 1XMAA 2HS5A 4BHCA 2XDVA 1USTA 1V5EA 2EZIA 2IA2A 1MMGA 4HZFA 3IHUA 3IRQA 1SMTA 2DA6A 2K9SA 2LP0A 4BJ5C 4RGRA 4Y33A 3P9KA 3HOWJ 2QQ8A 4RMNA 1A36A 2YR2A 2CUJA 5IOYA 5ILVA 2P81A 3CO6C 3CD6I 2NAZA 1I6XA 5EGOB 5JR3A 3RYRA 4XORA 3DP7A 2RKHA 4PJNA 1R5ID 2L7MP 2LYCA 5IT9Z 4BL0B 4R1HA 2IVMA 1N25A 2FXAA 2ZJQF 4A3MJ 1IN6A 3IKVA 1JHFA 2ELHA 1EJ9A 4AYBA 3HIFA 5J4YA 5TJJA 1TTYA 4RAYA 2R3SA 1WI3A 1PDNC 2RN7A 4ZTFA 2ACJA 2V1NA 5J6XA 1CF7B 1OR7A 4L5EA 3E5QA 3HOVJ 1BW6A 1RR7A 2K3PA 3P9IA 3UKGA 1OYWA 2CQQA 2PJRA 3IL2A 2VODA 1QHHD 1W4MA 3BR0A 1IAWA 2K27A 2V4JC 2DT5A 4LJZF 2VKEA 3DF8A 2K3FA 2KIUA 4KMUX 4J19A 2IP2A 2DYRH 3PM1A 1SFKA 3ML6A 3AAFA 4V2GA 2LVSA 1Y8RB 1P9QC 3M8JA 3RTRA 1HSJA 1K4TA 3DLLF 1U8RA 4CCKA 3JRBA 1BJZA 2VXZA 1QQIA 3MZYA 4EM0B 5ICCA 2CH0A 4D5FA 5BPDA 1L3LA 3RQIA 3I64A 4II2A 4B4CA 3KYLA 3QYEA 2M8EA 4L9TA 2XAUA 3RIRA 2ZMEB 3AG3H 5LHHA 3OYIA 1MH3A 3JRCA 2W82A 3K4NA 1PVEA 5E3MA 1V5GA 3U1DA 1HCRA 1WWXA 2A6EF 3GX4X 5LGNA 1SFUA 1VQ5I 1WKMA 3OWTA 5F04A 1SAXA 1X4PA 2EFPA 5GTIC 2V1UA 1QPMA 2ZKZA 1FIPA 3H9GA 3KE2A 1KQ0A 1H8AC 3JRFA 1YITI 4A6EA 2KISA 4L9JA 1X1DA 5LRRA 5BOXA 1T2KA 2PMZA 2Y9YA 2IRFG 3A01B 1T08B 1O7LA 2E36A 4QTRA 1ETOA 3OYHA 1Y8QB 1APLC 1N75A 2EILH 5IP9J 1HC8A 4CUGA 5CJ9A 4KIFA 5TISC 2OF7A 1Q1HA 2Y0MA 4II3A 3GVAA 5DM7F 3N4MA 2W85A 3KP6A 5K5RA 2E7XA 4AVPA 4IHSA 1RKTA 5DUKA 3F8MA 1IJWC 2DODA 1S5LC 3DEWA 1X1CA 3LOCA 1TLHB 5IY5H 2XGDA 2JVGA 3GEZA 1W0UA 3KYDB 5AONA 2JQ7A 3GTLJ 3SHFA 3TO6A 1KA8A 1MJAA 2O7OA 3FMQA 3JTHA 3PUBA 4Y4RA 3DKYA 4RB1A 1IV6A 3DWLE 4CYCA 2GOMA 1Z05A 3LMMA 3MD2A 3MKYB 5LD2C 3GTQJ 4AM3A 3IH4A 5BNGA 2P6SA 2DLLA 3TP3A 2QBYB 3BP8A 3M7GA 5FLXZ 2BY0A 4MTDA 3HOXJ 1IO2A 3ZMVA 3ZGKA 5EDNA 3S1RJ 1AKHB 3B02A 3S1MJ 5E8IA 2GA1A 4BBRJ 3PJRA 4IX7A 2AS5F 1BOBA 5K1YA 4AU7A 3ESWB 3TKYA 2HNHA 5E1ZB 5FFXA 2M7BA 1IXCA 4E7IA 4ZDPA 3CJTB 4JQFA 1H88C 2X4HA 4G6TB 2JVHA 4U0YA 3BG7A 4F91B 2XPUA 2QYOA 2TDXA 3ZQIA 1SFEA 5KVRA 3DBRB 1FWZA 2EA4A 2JSCA 1YQAA 3H5AA 4OMYA 2VKVA 2WB1N 3BQYA 4Z2YA 1EV7A 2EFWA 3BOQA 1U9NA 4MLOA 4KISA 2VLAA 2B63J 4L9NA 1B8IB 4LITA 2Q0OA 4UVBA 3OYCA 5IOZA 3VWBA 3OOPA 1T39A 1ZARA 3TW7A 3M4OJ 1PUFB 3RI4A 1VQ9I 2HDCA 1R5GA 3VYRB 1VQ8I 4K2EA 2GXGA 3CC4I 4I09A 1KU2A 4A3KJ 2NS8A 4F92B 1R6RA 2QUFA 2XSJC 3I4PA 2PLYA 1OYIA 1POGA 3I59A 4M3FA 3NRVA 2Z1DA 1K7AA 3CCEI 4NDLA 1J75A 3QYBA 1Y56A 3CC7I 2LKSA 1WJAA 2ZFUA 3MQ0A 4I99C 3O8GA 1TQMA 5ILUA 1UHMA 1KYWA 2YS9A 1SVOA 2DDBA 1JJ6C 3CO7C 4IO9F 3BR6A 4XNFA 3M3YJ 1WHUA 3RKXA 4FX4A 1WQ2A 2EFNA 4L0ZB 3WTYC 4CDGA 1LQ1A 2W25A 1IN8A 3AG1H 4OAYA 2QSHX 4B09A 1TW2A 2K40A 5B5EC 4KICA 3DEUA 3RJPA 1XGMA 1U78A 1Y1VJ 2FUG2 1U6GA 3GZNB 4MIMA 3CCUI 1ERDA 3HGYA 4KIBA 3ZR8X 1G2HA 3ABMH 1LNWA 4D9JA 1TNTA 5EG0A 3OL3A 4CCNA 4LK0F 4AIHA 5IPAA 2V1XA 1F43A 5ED4A 1UHWA 4BH9A 3S93A 1E17A 5L3FA 1D1CA 2XF7A 4B8XA 4E7JA 3H36A 4NC8A 4AIKA 1T98A 3JSPA 3HOYJ 1N77A 3S1NJ 2Y31A 1S6LA 3MZHA 3FMSA 3UNGC 1PP8F 2GQQA 3T1BA 4XKVA 2XRLA 3H3UA 4XLPF 2DT7B 1G3TA 2H27A 1FYMA 2BOLA 3BG3A 2BZTA 1XDUA 3LA2A 1GXQA 4ESBA 3FHZA 4F3QA 1WJFA 1T0FA 3CLOA 2V7FA 3IAS2 4MQVA 3TDZC 5BS6A 1NH3A 2XPWA 1DP3A 4DJAA 1JKPC 5HLGA 3NQOA 3PFIA 2L54A 5EJCA 3C18A 3RKYA 3RZDJ 1UG0A 2HXOA 3ZN0A 3BC8A 1ZYRF 3NWSA 2JK3A 4ZDLA 3H92A 4HPQA 4XKBA 2EFOA 4V19K 3PL8A 3HSRA 2IXSA 3GTMJ 2OC6A 2DA3A 3R4KA 2E19A 2LF7A 1OFCX 4ETSA 3HTSB 1R4MB 5L3EA 3E6CC 4LB6B 1JTYA 1ZN2A 1Y39A 2XRNA 3BROA 3QU6A 5J1YA 2LD5A 4XIDA 2CW7A 3OYNA 4C9YA 1FBQA 2R7FA 3MCZA 2LSOA 5CVIA 4IQJA 2HU9A 2RGVA 3S1QJ 5HS9A 3F8CA 4A3LJ 1KGSA 1I39A 3CC2I 1KQ9A 1BI1A 5LGUA 4BEHB 1I3AA 1V4RA 3CF5F 4LOCA 4HNTA 1TWGJ 3DBLB 3LQRA 1S72I 5HS7A 3ZCOA 1ZG5A 4IL6C 3J7AY 2KDOA 4PJJA 2DA7A 4HX4A 4KA4A 2XGEA 5LBQA 3R61A 3Q9SA 4FTHA 2CRGA 2H6CA 4IVNA 1BI3A 2ID6A 3D0SA 1LDJA 4ITVA 1ZRDA 2R7QA 2FE3A 5H2FC 4G7HF 3S3MA 2XGCA 2CU7A 3HBLA 1IUFA 2M0CA 4RLQA 2K4JA 4R8HA 2UWMA 2WV1A 5GP9A 2V9PA 5F08A 1X1AA 4KITB 2HQNA 2WA0A 4NHJA 2PX9A 4HV6A 5F64A 1FC3A 4EJOA 4ZDOA 2KFDA 3T8TA 1OCZH 4UNOA 4RM2A 3K4LA 5GAEJ 2LY1A 2QENA 3RPUD 3V8LA 2A6HF 1Q1VA 4DBRA 4XSZF 4BS9A 1T38A 1X19A 2OAZA 3W2AA 4BE2A 3J80Z 3CCVI 5J8CA 4WCGA 5HDNA 3GZ5A 1FBSA 5CLSA 2XASA 1RR8C 2CG4A 3I71A 1F1ZA 5ICGA 1MJ9A 1SFOJ 4A3EJ 4YFNF 1ZG3A 1YG2A 4M73A 1T8IA 1MSFC 4ABZA 3OYAA 2DBBA 3BTCA 5KCMA 2FF4A 1RIOH 1A5JA 2HOSA 1EA3A 3KLOA 4XQFA 3ABTA 3BR2A 2AO9A 2DMNA 5E79C 1Z91A 1X4OA 2EWNA 2E1CA 4E70A 2LKXA 2O8XA 3CCYA 2BW3B 3GW2A 3FK6A 3S8PA 4C2UA 3JSOA 4CHUA 1GHCA 1STZA 1WH7A 3OYEA 2DA1A 2DQLA 2W4SA 3EYIA 2F5EA 3EQLF 3SDBA 3OS0A 5DS9A 3S14J 1IUYA 3ZQFA 1GXPA 4UB6C 3SXYA 5B66C 2R7SA 3AKZA 3K70C 1TQIA 3KFWX 1ZRFA 2HDWA 2XAGA 4BYYA 5A2QK 1ZLJA 4LG0A 2BHYA 5HNFA 5DUIA 2DOFA 2OJED 3RPUA 2EIKH 5GAGJ 3QPSA 3WU1B 1XS9A 1ON1A 1YS7A 2YUSA 3F8BA 4G9YA 4Z6YA 3WTTC 2F4IA 3MN2A 4J00A 2ZXIA 2R7ZJ 4OIPF 1K78A 2QKMB 2DAOA 1BBYA 2LTPA 4GCVA 5H20A 4M9XA 2PQ8A 4P9UA 3S16J 1FY7A 4RGSA 1ZRCA 3I4MJ 2JRTA 1BC8C 3S2DJ 1QA6A 4U87A 2NS0A 3ZQGA
chains in the Genus database with same CATH topology
2KIMA 1USSA 5DD8A 1K79A 1OYYA 3E6DA 4EQQA 1PP7U 4M72A 1O57A 1YO5C 2CYYA 4MNUA 1YTYA 4HDUA 1AOYA 1RUNA 3PQKA 1R1TA 4MHGA 3ROUA 1D8KA 3BY6A 4IRHA 3F22A 1HKQA 4LD5A 4XRFA 1OKRA 1BOAA 2YX7A 3HOTA 1EH8A 1FSHA 4D0PA 1Z6TA 4EJVA 2JTVA 3LAJA 4G7OF 3QP6A 3ZN1A 4XBFA 2HYGD 5D5VB 4U7DA 4M6YA 2OBPA 1XCVA 1IRFA 3E6MA 2FNPA 1W7PB 4P96A 1P2FA 2RDPA 3J81Z 4EJTA 5EEGA 2NYXA 2EB7A 2PMHA 4A5NA 3E5XA 2A69F 2ESNA 1D8JA 1ODDA 3MEXA 4O3MA 3JAMZ 4EM2A 2XAJA 2MLKA 3RKWA 2OA4A 4HF2A 5ICEA 1XSXA 5D8LB 2OZ6A 2PJPA 1XDSA 5FD5A 4ENNA 2NRAC 4MTEA 2Z9OA 3S2WA 4EGYA 1P92A 5E18F 2F5FA 2FQ3A 1QZYA 5F1RA 5HS8A 1TBXA 3PQJA 3W6KB 1SD4A 2ZFWA 2PBIA 3GFIA 4BAYA 1B9MA 3C3WA 2UXXA 1R5HA 4A2UA 2QM3A 5HVQC 3ZP5A 3GUDA 5IT9K 1S3JA 1K6OA 4HBLA 3E6BA 4H0EA 5L3DA 3P7NA 2V79A 3FXQA 2F5DA 1R7JA 1CF7A 1IF1A 3O2PE 4MEYF 4IF4A 3QP5A 3T0YA 1O3RA 4UVAA 3BJOA 1YLFA 1R1VA 2MLGA 4L5IA 4P5OA 4Q5SF 3WE3A 3LA3A 1ZG1A 2J5PA 2P7VB 1XD7A 2G7HA 3Q9VA 3WTVC 1LJ9A 1J0RA 4MGRA 5KK1A 3G73A 4A0YA 1XGSA 2PG4A 2ISYA 4HA8A 1O3SA 5E8GA 2ZMEA 2ZJ2A 3VEPA 4IJAA 3WGIA 2WV0A 4BXUA 3CUQC 1RUOA 5J8FA 2DTRA 4KN4X 3ZMUA 2QQAA 2Z33A 3T5XA 2B0LA 4G6DA 1I1GA 3IWZA 3IWFA 4L0YB 5AIQA 4YG2F 3HHHA 4RGXA 2VOOA 1HKTA 1XCBA 1FP2A 1U5TC 5DDGA 3ABUA 3CTAA 1BJAA 4PZJA 3TOAA 3ERED 3LWFA 1U2WA 1BC7C 2K4BA 1IN7A 4EMSA 2L02A 2QBYA 4ENMA 1W5SA 1XGOA 3FWEA 2O61A 1XB4A 3H3ZA 1YFHA 5D4RA 4M9ZA 2A3SA 2PN6A 1HW1A 4EJUA 4G6QA 4MEXF 2A5YB 2Q8KA 3MAJA 4PGHA 2HEOA 1MGTA 2NNNA 1KQ8A 2MD5A 3FX3A 5IT3A 3DQVC 4G8XA 2EV6A 4I98B 4I02A 2HR3A 2IW5A 2YX4A 2ISZA 5DYMA 3BJAA 1RI7A 4CGZA 3E5UA 5CVRA 3IC7A 2FMLA 1FYLA 2VC0A 3BPVA 2VBZA 4OINF 4CICA 4IPAA 1HQCA 4LLGF 3VODA 5HDKA 5L3CA 5FFZA 3I0TA 3F21A 5D6FA 4ENKA 4M6XA 2EJRA 3WE2A 1I27A 5DCMB 4RS8A 1O7FA 4ENJA 2Z3YA 2FEZA 3ZMZA 4L9VA 4HQEA 2ETHA 5DEQA 2LF8A 3CUQB 3FXUA 3WTWC 4GGGA 2P5LC 2P5VA 3QPHA 4KUMA 4LK1F 1FYKA 3R0JA 3I58A 3F3XA 4KT5C 2OD5A 5L3GA 2HYFA 2FNAA 3W6JB 3RDIA 1A04A 3K69A 1IZ1A 5D4SA 3JW4A 5D8KB 1U5TB 5LHGA 4GYIA 5ERIA 2CO5A 2ZBKA 2CQKA 1DUXC 3ZMDA 3HRTA 3GWZA 4Q4ZF 5DCFA 2XKOA 2CW0F 2VONA 3L9FA 4G7ZF 4OIQF 2Z5UA 3MWMA 4WXCA 3GFMA 3GO5A 4JBAA 3F23A 3V8JA 1JE8A 1VTNC 2JPBA 2DI3A 3WTZA 1PUEE 5LEJA 1MDMB 5BMZA 1YYVA 4Y15A 5CVJA 5FO5A 5JI6A 3R0AA 4U7BA 2XROA 1IN5A 3HYIA 4WK8F 2XAFA 3R60A 2MC3A 4TV7A 2ZXJA 2O6GE 2G7UA 1FLIA 3L09A 4AIJA 3E3VA 5LHIA 2VN2A 3MFKA 4I7HA 2JPCA 2DU9A 2RV8A 2YSRA 2XVCA 1KU7A 1RZ4A 3K1PA 2HWVA 2QWWA 2BEOA 4ZZLA 3R6SA 2JT1A 1J7KA 1I5ZA 3KP2A 4IXAA 4A6DA 3FMRA 3DFGA 2M5WA 3K9TA 1HW2A 4GO1A 1TNSA 2J5OA 3CUOA 2WC2A 4YFKF 4M71A 5E20A 2EFQA 4U0VA 1QBJA 2L4MA 2L01A 2FOKA 1ZHFA 3KZZA 1HXDA 4RB2C 3FF5A 4RGUA 4I2OA 4LLLA 2EA2A 2BBYA 3B73A 1GVJA 5BQTA 3IKTA 2K02A 4U0WA 3ELKA 1P4XA 3SZPA 4LLNA 4F7ZA 4IRIA 1TW3A 4BNCA 5DV5A 4ZYDA 5ILSA 4WF2A 3BWGA 2O0YA 4FHTA 2DPUA 2IT0A 2CGPA 1KU9A 1FNNA 2IPQX 1W7PD 4HX8A 2STWA 1V3FA 1QZZA 4AWXB 1H9TA 2H09A 2HQRA 5E1WA 1F5TA 4A0XA 1DPRA 1FZPB 1B9NA 3KCCA 3DXJF 2XAQA 3TO9A 3DPTA 2CWEA 2VBXA 1B1BA 1J2XA 1ZH5A 4HX7A 4U88A 4ZYEA 4JK1X 5BPIA 4HLYA 2RNJA 2FBKA 4LB5A 3GFJA 3FM3A 1FX7A 3TO7A 1YW8A 1T6SA 4YIIA 1DP7P 1G3SA 1RNLA 3VB2A 2QVOA 3OV8A 1BIBA 3F72A 1B59A 1YIOA 2DQRA 1W7PA 2BE5F 2C6YA 5E17F 3WTUC 5LLQA 2CFXA 1S7AA 4RB3C 5D6EA 1C0WA 1IW7F 1D5VA 3M1EA 2GAUA 3JTGA 4ASNA 4HF0A 4P9FA 5FGMA 1LDKB 2BV6A 2VBYA 3GYHX 1S29A 2WTEA 4RAZA 2GIVA 2XUBA 1JHHA 3WGHA 1H0MA 1CGPA 1REPC 3ZPLA 2XGXA 2STTA 1IXRC 4PCQA 5JFRA 1ULYA 2MBFA 4OOIA 2YPRA 5EEHA 3DKWA 2D2WA 1EH6A 4L18B 3I5UA 1W5TA 2AXLA 4S04A 4EJWA 1OPCA 1UB9A 2GWRA 2M45A 4OU0A 2EV5A 2PEXA 1XSDA 2VBWA 5D5UB 3WTSC 2DK5A 2QQ9A 4WXHA 5HDGA 2WWYA 2FRHA 4Q47A 3LQQA 3REOA 3KETA 2DW4A 1XN7A 4HLXA 1FBUA 3HOSA 2FMYA 1J59A 4OIRF 1I1SA 3CJNA 1ZGJA 4NB5A 4ESJA 2D45A 2FBHA 2A07F 4Y17A 2OQRA 2XKPA 1Z7UA 2KJCA 1R23A 3QOPA 3EETA 4ZYGA 5JHUA 2HGCA 3BDDA 1O3TA 2L3DA 4HYEA 2QLZA 1FP1D 1XGNA 5D5WB 4I0AA 5E1XA 4QLCU 1HKSA 5HLIA 2O3FA 2K7LA 5HOOA 2OZUA 2BGCA 4YIFA 1DPUA 2ESHA 1SFXA 4I0BA 4HDVA 5JVTA 1R22A 3WGGA 3WODF 3HUGA 1IN4A 1QNTA 2W24A 2D1HA 4WX9A 3L2CA 4KYWA 4GXOA 1WI9A 2IA0A 4ON0A 4Y13A 3L7WA 2KIFA 1SD5A 5FLXK 3EDPA 1R00A 3KEOA 1ZREA 3M8FA 2A68F 1SD6A 1UFMA 1NHAA 5H6QA 3FZVA 3GZ6A 3F6OA 4S05A 1MD0A 2V1DA 3ZMSA 1G4DA 2P8TA 4EVIA 3C1DA 3KP4A 1L0OC 3LSTA 4N9HA 4RB0A 5LGTA 2PI0A 1ONVA 4ZYHA 4M74A 1LEBA 1FSEA 2Z99A 4M9SA 4L5JA 4DQ2A 4KN7X 1OMIA 3I53A 3K1MA 4A12A 4KDPA 2HKXA 3L00A 4A5MA 5DCMA 1H9GA 2XV4S 3WG9A 1D3YA 3RPQA 4CZZA 3V4GA 2D1VA 1DDNA 1XSVA 1SMYF 1YS6A 3I54A 2OU2A 1X3UA 2V9VA 4UV9A 3ECOA 3CUQA 2GZWA 3ISPA 2BYVE 3V8KA 3HTUA 1ZAOA 2CSOA 4CYDA 2IA1A 2HZTA 1Z6RA 4LMYA 1HW5A 1E2XA 4I01A 4LFUA 1LVAA 2IJLA 1R58A 1YW9A 5CVUA 4P55A 1B4AA 4GYGA 2FBIA 3K1NA 4CO8A 4CXFA 3M8EA 3BZ6A 4UUVA 2LDUA 4N0BA 4UV8A 3DPLC 1U5TA 3N97A 1SD7A 3IRRA 2UXNA 3O3KA 4O6JA 1HBXG 2QZ8A 1BI2A 1Z9CA 2DPDA 2XIGA 4DNCA 2RVCA 2VT2A 4WXDA 4ZZDA 1BN5A 2PMUA 4IHTA 3C7JA 1S8NA 2ZNYA 2ZNZA 3KP5A 3ZMTA 4UXNA 1Z1DA 3F8FA 1Y0UA 2HFHA 3I59B 3LAPA 3QU3A 3LFKA 2VE9A 1MDMA 2RC4A 2VE8A 3KZYA 5CVVA 1IRGA 5FB2A 3VOEA 2EK5A 2O03A 4HQMA 5TRDA 2FSWA 1JGSA 3TGNA 1FT9A 3VFZA 4ZH4F 1BI0A 5F6FA 2HTJA 3V7RA 1KYZA 2R7DA 1LEAA 3RYPA 3U2RA 5K5QA 2MH2A 5LRSA 4IRGA 1P6RA 1B6AA 1FOKA 2ADUA 5CYVA 4R79A 3ECHA 2DO7A 3COAC 3O6BB 3D5LA 3J80K 3HSFA 2F2EA 4NQWA 4EGZA 2P6TA 3HRMA 3QAHA 1ON2A 3J7AO 2P5KA 3EUHA 3FM5A 4G94A 2MA3A 4UHTA 2XHKA 1O3QA 3SQNA 1J9IA 4KMFA 1WRJA 2M30A 3KEQA 3E97A 1MZBA 1IXSB 2DFIA 2KJBA 3KP7A 5AIPA 2H94A 4Q48A 3V7CA 2E7WA 1MKMA 2E1NA 3FXRA 1ZGAA 3HRUA 2G9WA 1QGPA 2Y48A 1BM9A 1G6NA 3SZTA 2VT3A 2OQGA 4HOBA 2PFBA 2GA2A 3WTXC 1UCRA 1MJBA 3F8NA 3GLXA 3F6VA 4LGWA 5HLHA 3P9CA 5DD4A 3HSEA 4EV0A 2W84A 4OMZA 1KU3A 2LKPA 4PDKA 4O5VA 3V7SA 2M87A 4UVCA 4FT8A 4MQ9F 2W57A 4KFCA 3T8RA 4HF1A 2Q2EA 2ZCWA 3ULQB 4YFXF 2COMA 3CDHA 5A2QZ 1WSUA 4HV5A 3M9AA 4KIGA 2LNBA 1LB2A 2EV0A 4KNYA 4LG0B 3U9GA 4HW0A 2M1BA 3GXOA 4A0ZA 3KP3A 6PAXA 1P4AA 1LDDA 3K2ZA 1R1UA 4XLNF 3GF2A 1K78B 2XAHA 3K0LA 2H6BA 2X0LA 2P4WA 3GFLA 1G3WA 2FU4A 1QO0D 2MH9A 2P7CB 2HOEA 5ICFA 3HRSA 3J81K 4PGGA 1EH7A 3TDUC 5LEKA 3SFZA 3TOBA 1F4KA 1BIAA 2VC1A 2KRFA 4QWQA 4BHPA 1TQPA 2KKOA 3JAMK 3QPTA 4HAMA 5H6RA 3NEUA 4BHBA 1AWCA 1S7OA 1ZLKA 4WWCA 1U3EM 1R36A 3BPXA 1HSTA 2L4AA 3Q5FA 4ESFA 4XSXF 5L3BA 3G3ZA 1YW7A 3BJ6A 2QQBA 4N9IA 4EM1A 2NNYA 3ZQ7A 3EYYA 3TQNA 1F9NA 2YU3A 3DV8A 2UZKA 3QRFF 4AD9A 2GXBA 2RQPA 2DK8A 2K86A 2ZO4A 3HHGA 2JZYA 4BQAA 5FD6A 1J5YA 1G3YA 3KLNA 2Y75A 3LA7A 2FA5A 2VOPA 5D5XB 1P4WA 1XMKA 5K5OA 4OIOF 2A61A 2HTSA 2HKOA 2V6CA 2F5CA 4FX0A 1FPQA 3WU0A 1XMAA 2HS5A 4BHCA 1USTA 2IA2A 4HZFA 3IHUA 3IRQA 1SMTA 4RGRA 3P9KA 2YR2A 5ILVA 3CO6C 2NAZA 1I6XA 5JR3A 3RYRA 3DP7A 2RKHA 5IT9Z 4R1HA 2IVMA 2FXAA 1IN6A 3IKVA 1JHFA 2ELHA 3HIFA 5TJJA 1TTYA 4RAYA 2R3SA 1PDNC 2RN7A 2ACJA 5J6XA 1CF7B 1OR7A 3E5QA 3P9IA 2VODA 1OYWA 3IL2A 1W4MA 1IAWA 2K27A 2DT5A 4LJZF 3DF8A 2KIUA 4KMUX 2IP2A 3ML6A 3AAFA 3RTRA 1HSJA 1U8RA 2VXZA 1QQIA 3MZYA 4EM0B 5ICCA 5BPDA 1L3LA 3I64A 2M8EA 4L9TA 3RIRA 2ZMEB 5LHHA 3U1DA 1WWXA 2A6EF 3GX4X 5LGNA 1SFUA 1WKMA 1SAXA 2EFPA 2V1UA 1QPMA 2ZKZA 3KE2A 1KQ0A 4A6EA 5BOXA 4L9JA 5LRRA 1T2KA 2IRFG 1O7LA 5CJ9A 4KIFA 1Q1HA 2Y0MA 3GVAA 3N4MA 2W85A 3KP6A 5K5RA 2E7XA 4AVPA 4IHSA 5DUKA 3F8MA 1TLHB 3GEZA 5AONA 3SHFA 3TO6A 1KA8A 1MJAA 3FMQA 3JTHA 4RB1A 1Z05A 2P6SA 2DLLA 2QBYB 3BP8A 3M7GA 5FLXZ 4MTDA 3ZMVA 3B02A 5E8IA 2GA1A 2AS5F 5K1YA 3TKYA 5E1ZB 5FFXA 1IXCA 4JQFA 2X4HA 4U0YA 2QYOA 2TDXA 1SFEA 5KVRA 1FWZA 2EA4A 2JSCA 1YQAA 4OMYA 2EFWA 4Z2YA 1EV7A 3BOQA 4L9NA 2Q0OA 4UVBA 3OOPA 1T39A 1ZARA 3RI4A 2HDCA 1R5GA 4K2EA 2GXGA 4I09A 1KU2A 2QUFA 3I4PA 2PLYA 1OYIA 3I59A 3NRVA 1K7AA 1J75A 3MQ0A 1TQMA 5ILUA 1UHMA 1KYWA 3CO7C 3RKXA 4FX4A 1WQ2A 2EFNA 4L0ZB 3WTYC 4CDGA 1LQ1A 2W25A 1IN8A 4B09A 1TW2A 4KICA 3DEUA 3RJPA 1XGMA 1U78A 1U6GA 4KIBA 1LNWA 1TNTA 4LK0F 4AIHA 2V1XA 5ED4A 1UHWA 4BH9A 1E17A 5L3FA 4B8XA 4AIKA 1T98A 3JSPA 1S6LA 3MZHA 3FMSA 1PP8F 2GQQA 3T1BA 3H3UA 4XLPF 1G3TA 2H27A 1FYMA 3LA2A 1XDUA 4ESBA 1GXQA 3FHZA 1JXSA 4MQVA 1T0FA 3CLOA 5BS6A 3TDZC 5HLGA 3NQOA 3PFIA 2L54A 3RKYA 3C18A 3ZN0A 1ZYRF 3H92A 2EFOA 3HSRA 3R4KA 2LF7A 4ETSA 3HTSB 5L3EA 3E6CC 4LB6B 1ZN2A 2XRNA 3BROA 3QU6A 1FBQA 2R7FA 3MCZA 2LSOA 5CVIA 2RGVA 5HS9A 3F8CA 1KGSA 1KQ9A 1BI1A 5LGUA 1V4RA 3LQRA 5HS7A 1ZG5A 4HX4A 4KA4A 5LBQA 3R61A 3Q9SA 2H6CA 4IVNA 1BI3A 3D0SA 1LDJA 1ZRDA 2FE3A 4G7HF 2K4JA 4R8HA 2UWMA 2HQNA 4NHJA 5F64A 4HV6A 4EJOA 1FC3A 3T8TA 4UNOA 3V8LA 2QENA 2A6HF 4XSZF 1T38A 2OAZA 3J80Z 5J8CA 4WCGA 5HDNA 3GZ5A 1FBSA 5CLSA 2XASA 2CG4A 3I71A 1F1ZA 5ICGA 1MJ9A 4YFNF 1ZG3A 1YG2A 4M73A 2DBBA 2FF4A 1RIOH 3KLOA 3ABTA 1Z91A 2EWNA 2E1CA 4E70A 2O8XA 3GW2A 3JSOA 4CHUA 1GHCA 1STZA 2DQLA 3EYIA 2F5EA 3EQLF 1IUYA 1GXPA 3SXYA 1TQIA 3KFWX 1ZRFA 2XAGA 4BYYA 5A2QK 1ZLJA 4LG0A 5DUIA 3RPUA 3WU1B 1ON1A 1YS7A 3F8BA 4G9YA 3WTTC 4OIPF 1K78A 2DAOA 1BBYA 4GCVA 5H20A 4M9XA 2PQ8A 4P9UA 1FY7A 4RGSA 1ZRCA 2JRTA 1BC8C 2NS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIM A;  1USS A;  5DD8 A;  1K79 A;  1OYY A;  3E6D A;  4EQQ A;  1PP7 U;  4M72 A;  1O57 A;  1YO5 C;  2CYY A;  4MNU A;  1YTY A;  4HDU A;  1AOY A;  1RUN A;  3PQK A;  1R1T A;  4MHG A;  3ROU A;  1D8K A;  3BY6 A;  4IRH A;  3F22 A;  1HKQ A;  4LD5 A;  4XRF A;  1OKR A;  1BOA A;  2YX7 A;  3HOT A;  1EH8 A;  1FSH A;  4D0P A;  1Z6T A;  4EJV A;  2JTV A;  3LAJ A;  4G7O F;  3QP6 A;  3ZN1 A;  4XBF A;  2HYG D;  5D5V B;  4U7D A;  4M6Y A;  2OBP A;  1XCV A;  1IRF A;  3E6M A;  2FNP A;  1W7P B;  4P96 A;  1P2F A;  2RDP A;  3J81 Z;  4EJT A;  5EEG A;  2NYX A;  2EB7 A;  2PMH A;  4A5N A;  3E5X A;  2A69 F;  2ESN A;  1D8J A;  1ODD A;  3MEX A;  4O3M A;  3JAM Z;  4EM2 A;  2XAJ A;  2MLK A;  3RKW A;  2OA4 A;  4HF2 A;  5ICE A;  1XSX A;  5D8L B;  2OZ6 A;  2PJP A;  1XDS A;  5FD5 A;  4ENN A;  2NRA C;  4MTE A;  2Z9O A;  3S2W A;  4EGY A;  1P92 A;  5E18 F;  2F5F A;  2FQ3 A;  1QZY A;  5F1R A;  5HS8 A;  1TBX A;  3PQJ A;  3W6K B;  1SD4 A;  2ZFW A;  2PBI A;  3GFI A;  4BAY A;  1B9M A;  3C3W A;  2UXX A;  1R5H A;  4A2U A;  2QM3 A;  5HVQ C;  3ZP5 A;  3GUD A;  5IT9 K;  1S3J A;  1K6O A;  4HBL A;  3E6B A;  4H0E A;  5L3D A;  3P7N A;  2V79 A;  3FXQ A;  2F5D A;  1R7J A;  1CF7 A;  1IF1 A;  3O2P E;  4MEY F;  4IF4 A;  3QP5 A;  3T0Y A;  1O3R A;  4UVA A;  3BJO A;  1YLF A;  1R1V A;  2MLG A;  4L5I A;  4P5O A;  4Q5S F;  3WE3 A;  3LA3 A;  1ZG1 A;  2J5P A;  2P7V B;  1XD7 A;  2G7H A;  3Q9V A;  3WTV C;  1LJ9 A;  1J0R A;  4MGR A;  5KK1 A;  3G73 A;  4A0Y A;  1XGS A;  2PG4 A;  2ISY A;  4HA8 A;  1O3S A;  5E8G A;  2ZME A;  2ZJ2 A;  3VEP A;  4IJA A;  3WGI A;  2WV0 A;  4BXU A;  3CUQ C;  1RUO A;  5J8F A;  2DTR A;  4KN4 X;  3ZMU A;  2QQA A;  2Z33 A;  3T5X A;  2B0L A;  4G6D A;  1I1G A;  3IWZ A;  3IWF A;  4L0Y B;  5AIQ A;  4YG2 F;  3HHH A;  4RGX A;  2VOO A;  1HKT A;  1XCB A;  1FP2 A;  1U5T C;  5DDG A;  3ABU A;  3CTA A;  1BJA A;  4PZJ A;  3TOA A;  3ERE D;  3LWF A;  1U2W A;  1BC7 C;  2K4B A;  1IN7 A;  4EMS A;  2L02 A;  2QBY A;  4ENM A;  1W5S A;  1XGO A;  3FWE A;  2O61 A;  1XB4 A;  3H3Z A;  1YFH A;  5D4R A;  4M9Z A;  2A3S A;  2PN6 A;  1HW1 A;  4EJU A;  4G6Q A;  4MEX F;  2A5Y B;  2Q8K A;  3MAJ A;  4PGH A;  2HEO A;  1MGT A;  2NNN A;  1KQ8 A;  2MD5 A;  3FX3 A;  5IT3 A;  3DQV C;  4G8X A;  2EV6 A;  4I98 B;  4I02 A;  2HR3 A;  2IW5 A;  2YX4 A;  2ISZ A;  5DYM A;  3BJA A;  1RI7 A;  4CGZ A;  3E5U A;  5CVR A;  3IC7 A;  2FML A;  1FYL A;  2VC0 A;  3BPV A;  2VBZ A;  4OIN F;  4CIC A;  4IPA A;  1HQC A;  4LLG F;  3VOD A;  5HDK A;  5L3C A;  5FFZ A;  3I0T A;  3F21 A;  5D6F A;  4ENK A;  4M6X A;  2EJR A;  3WE2 A;  1I27 A;  5DCM B;  4RS8 A;  1O7F A;  4ENJ A;  2Z3Y A;  2FEZ A;  3ZMZ A;  4L9V A;  4HQE A;  2ETH A;  5DEQ A;  2LF8 A;  3CUQ B;  3FXU A;  3WTW C;  4GGG A;  2P5L C;  2P5V A;  3QPH A;  4KUM A;  4LK1 F;  1FYK A;  3R0J A;  3I58 A;  3F3X A;  4KT5 C;  2OD5 A;  5L3G A;  2HYF A;  2FNA A;  3W6J B;  3RDI A;  1A04 A;  3K69 A;  1IZ1 A;  5D4S A;  3JW4 A;  5D8K B;  1U5T B;  5LHG A;  4GYI A;  5ERI A;  2CO5 A;  2ZBK A;  2CQK A;  1DUX C;  3ZMD A;  3HRT A;  3GWZ A;  4Q4Z F;  5DCF A;  2XKO A;  2CW0 F;  2VON A;  3L9F A;  4G7Z F;  4OIQ F;  2Z5U A;  3MWM A;  4WXC A;  3GFM A;  3GO5 A;  4JBA A;  3F23 A;  3V8J A;  1JE8 A;  1VTN C;  2JPB A;  2DI3 A;  3WTZ A;  1PUE E;  5LEJ A;  1MDM B;  5BMZ A;  1YYV A;  4Y15 A;  5CVJ A;  5FO5 A;  5JI6 A;  3R0A A;  4U7B A;  2XRO A;  1IN5 A;  3HYI A;  4WK8 F;  2XAF A;  3R60 A;  2MC3 A;  4TV7 A;  2ZXJ A;  2O6G E;  2G7U A;  1FLI A;  3L09 A;  4AIJ A;  3E3V A;  5LHI A;  2VN2 A;  3MFK A;  4I7H A;  2JPC A;  2DU9 A;  2RV8 A;  2YSR A;  2XVC A;  1KU7 A;  1RZ4 A;  3K1P A;  2HWV A;  2QWW A;  2BEO A;  4ZZL A;  3R6S A;  2JT1 A;  1J7K A;  1I5Z A;  3KP2 A;  4IXA A;  4A6D A;  3FMR A;  3DFG A;  2M5W A;  3K9T A;  1HW2 A;  4GO1 A;  1TNS A;  2J5O A;  3CUO A;  2WC2 A;  4YFK F;  4M71 A;  5E20 A;  2EFQ A;  4U0V A;  1QBJ A;  2L4M A;  2L01 A;  2FOK A;  1ZHF A;  3KZZ A;  1HXD A;  4RB2 C;  3FF5 A;  4RGU A;  4I2O A;  4LLL A;  2EA2 A;  2BBY A;  3B73 A;  1GVJ A;  5BQT A;  3IKT A;  2K02 A;  4U0W A;  3ELK A;  1P4X A;  3SZP A;  4LLN A;  4F7Z A;  4IRI A;  1TW3 A;  4BNC A;  5DV5 A;  4ZYD A;  5ILS A;  4WF2 A;  3BWG A;  2O0Y A;  4FHT A;  2DPU A;  2IT0 A;  2CGP A;  1KU9 A;  1FNN A;  2IPQ X;  1W7P D;  4HX8 A;  2STW A;  1V3F A;  1QZZ A;  4AWX B;  1H9T A;  2H09 A;  2HQR A;  5E1W A;  1F5T A;  4A0X A;  1DPR A;  1FZP B;  1B9N A;  3KCC A;  3DXJ F;  2XAQ A;  3TO9 A;  3DPT A;  2CWE A;  2VBX A;  1B1B A;  1J2X A;  1ZH5 A;  4HX7 A;  4U88 A;  4ZYE A;  4JK1 X;  5BPI A;  4HLY A;  2RNJ A;  2FBK A;  4LB5 A;  3GFJ A;  3FM3 A;  1FX7 A;  3TO7 A;  1YW8 A;  1T6S A;  4YII A;  1DP7 P;  1G3S A;  1RNL A;  3VB2 A;  2QVO A;  3OV8 A;  1BIB A;  3F72 A;  1B59 A;  1YIO A;  2DQR A;  1W7P A;  2BE5 F;  2C6Y A;  5E17 F;  3WTU C;  5LLQ A;  2CFX A;  1S7A A;  4RB3 C;  5D6E A;  1C0W A;  1IW7 F;  1D5V A;  3M1E A;  2GAU A;  3JTG A;  4ASN A;  4HF0 A;  4P9F A;  5FGM A;  1LDK B;  2BV6 A;  2VBY A;  3GYH X;  1S29 A;  2WTE A;  4RAZ A;  2GIV A;  2XUB A;  1JHH A;  3WGH A;  1H0M A;  1CGP A;  1REP C;  3ZPL A;  2XGX A;  2STT A;  1IXR C;  4PCQ A;  5JFR A;  1ULY A;  2MBF A;  4OOI A;  2YPR A;  5EEH A;  3DKW A;  2D2W A;  1EH6 A;  4L18 B;  3I5U A;  1W5T A;  2AXL A;  4S04 A;  4EJW A;  1OPC A;  1UB9 A;  2GWR A;  2M45 A;  4OU0 A;  2EV5 A;  2PEX A;  1XSD A;  2VBW A;  5D5U B;  3WTS C;  2DK5 A;  2QQ9 A;  4WXH A;  5HDG A;  2WWY A;  2FRH A;  4Q47 A;  3LQQ A;  3REO A;  3KET A;  2DW4 A;  1XN7 A;  4HLX A;  1FBU A;  3HOS A;  2FMY A;  1J59 A;  4OIR F;  1I1S A;  3CJN A;  1ZGJ A;  4NB5 A;  4ESJ A;  2D45 A;  2FBH A;  2A07 F;  4Y17 A;  2OQR A;  2XKP A;  1Z7U A;  2KJC A;  1R23 A;  3QOP A;  3EET A;  4ZYG A;  5JHU A;  2HGC A;  3BDD A;  1O3T A;  2L3D A;  4HYE A;  2QLZ A;  1FP1 D;  1XGN A;  5D5W B;  4I0A A;  5E1X A;  4QLC U;  1HKS A;  5HLI A;  2O3F A;  2K7L A;  5HOO A;  2OZU A;  2BGC A;  4YIF A;  1DPU A;  2ESH A;  1SFX A;  4I0B A;  4HDV A;  5JVT A;  1R22 A;  3WGG A;  3WOD F;  3HUG A;  1IN4 A;  1QNT A;  2W24 A;  2D1H A;  4WX9 A;  3L2C A;  4KYW A;  4GXO A;  1WI9 A;  2IA0 A;  4ON0 A;  4Y13 A;  3L7W A;  2KIF A;  1SD5 A;  5FLX K;  3EDP A;  1R00 A;  3KEO A;  1ZRE A;  3M8F A;  2A68 F;  1SD6 A;  1UFM A;  1NHA A;  5H6Q A;  3FZV A;  3GZ6 A;  3F6O A;  4S05 A;  1MD0 A;  2V1D A;  3ZMS A;  1G4D A;  2P8T A;  4EVI A;  3C1D A;  3KP4 A;  1L0O C;  3LST A;  4N9H A;  4RB0 A;  5LGT A;  2PI0 A;  1ONV A;  4ZYH A;  4M74 A;  1LEB A;  1FSE A;  2Z99 A;  4M9S A;  4L5J A;  4DQ2 A;  4KN7 X;  1OMI A;  3I53 A;  3K1M A;  4A12 A;  4KDP A;  2HKX A;  3L00 A;  4A5M A;  5DCM A;  1H9G A;  2XV4 S;  3WG9 A;  1D3Y A;  3RPQ A;  4CZZ A;  3V4G A;  2D1V A;  1DDN A;  1XSV A;  1SMY F;  1YS6 A;  3I54 A;  2OU2 A;  1X3U A;  2V9V A;  4UV9 A;  3ECO A;  3CUQ A;  2GZW A;  3ISP A;  2BYV E;  3V8K A;  3HTU A;  1ZAO A;  2CSO A;  4CYD A;  2IA1 A;  2HZT A;  1Z6R A;  4LMY A;  1HW5 A;  1E2X A;  4I01 A;  4LFU A;  1LVA A;  2IJL A;  1R58 A;  1YW9 A;  5CVU A;  4P55 A;  1B4A A;  4GYG A;  2FBI A;  3K1N A;  4CO8 A;  4CXF A;  3M8E A;  3BZ6 A;  4UUV A;  2LDU A;  4N0B A;  4UV8 A;  3DPL C;  1U5T A;  3N97 A;  1SD7 A;  3IRR A;  2UXN A;  3O3K A;  4O6J A;  1HBX G;  2QZ8 A;  1BI2 A;  1Z9C A;  2DPD A;  2XIG A;  4DNC A;  2RVC A;  2VT2 A;  4WXD A;  4ZZD A;  1BN5 A;  2PMU A;  4IHT A;  3C7J A;  1S8N A;  2ZNY A;  2ZNZ A;  3KP5 A;  3ZMT A;  4UXN A;  1Z1D A;  3F8F A;  1Y0U A;  2HFH A;  3I59 B;  3LAP A;  3QU3 A;  3LFK A;  2VE9 A;  1MDM A;  2RC4 A;  2VE8 A;  3KZY A;  5CVV A;  1IRG A;  5FB2 A;  3VOE A;  2EK5 A;  2O03 A;  4HQM A;  5TRD A;  2FSW A;  1JGS A;  3TGN A;  1FT9 A;  3VFZ A;  4ZH4 F;  1BI0 A;  5F6F A;  2HTJ A;  3V7R A;  1KYZ A;  2R7D A;  1LEA A;  3RYP A;  3U2R A;  5K5Q A;  2MH2 A;  5LRS A;  4IRG A;  1P6R A;  1B6A A;  1FOK A;  2ADU A;  5CYV A;  4R79 A;  3ECH A;  2DO7 A;  3COA C;  3O6B B;  3D5L A;  3J80 K;  3HSF A;  2F2E A;  4NQW A;  4EGZ A;  2P6T A;  3HRM A;  3QAH A;  1ON2 A;  3J7A O;  2P5K A;  3EUH A;  3FM5 A;  4G94 A;  2MA3 A;  4UHT A;  2XHK A;  1O3Q A;  3SQN A;  1J9I A;  4KMF A;  1WRJ A;  2M30 A;  3KEQ A;  3E97 A;  1MZB A;  1IXS B;  2DFI A;  2KJB A;  3KP7 A;  5AIP A;  2H94 A;  4Q48 A;  3V7C A;  2E7W A;  1MKM A;  2E1N A;  3FXR A;  1ZGA A;  3HRU A;  2G9W A;  1QGP A;  2Y48 A;  1BM9 A;  1G6N A;  3SZT A;  2VT3 A;  2OQG A;  4HOB A;  2PFB A;  2GA2 A;  3WTX C;  1UCR A;  1MJB A;  3F8N A;  3GLX A;  3F6V A;  4LGW A;  5HLH A;  3P9C A;  5DD4 A;  3HSE A;  4EV0 A;  2W84 A;  4OMZ A;  1KU3 A;  2LKP A;  4PDK A;  4O5V A;  3V7S A;  2M87 A;  4UVC A;  4FT8 A;  4MQ9 F;  2W57 A;  4KFC A;  3T8R A;  4HF1 A;  2Q2E A;  2ZCW A;  3ULQ B;  4YFX F;  2COM A;  3CDH A;  5A2Q Z;  1WSU A;  4HV5 A;  3M9A A;  4KIG A;  2LNB A;  1LB2 A;  2EV0 A;  4KNY A;  4LG0 B;  3U9G A;  4HW0 A;  2M1B A;  3GXO A;  4A0Z A;  3KP3 A;  6PAX A;  1P4A A;  1LDD A;  3K2Z A;  1R1U A;  4XLN F;  3GF2 A;  1K78 B;  2XAH A;  3K0L A;  2H6B A;  2X0L A;  2P4W A;  3GFL A;  1G3W A;  2FU4 A;  1QO0 D;  2MH9 A;  2P7C B;  2HOE A;  5ICF A;  3HRS A;  3J81 K;  4PGG A;  1EH7 A;  3TDU C;  5LEK A;  3SFZ A;  3TOB A;  1F4K A;  1BIA A;  2VC1 A;  2KRF A;  4QWQ A;  4BHP A;  1TQP A;  2KKO A;  3JAM K;  3QPT A;  4HAM A;  5H6R A;  3NEU A;  4BHB A;  1AWC A;  1S7O A;  1ZLK A;  4WWC A;  1U3E M;  1R36 A;  3BPX A;  1HST A;  2L4A A;  3Q5F A;  4ESF A;  4XSX F;  5L3B A;  3G3Z A;  1YW7 A;  3BJ6 A;  2QQB A;  4N9I A;  4EM1 A;  2NNY A;  3ZQ7 A;  3EYY A;  3TQN A;  1F9N A;  2YU3 A;  3DV8 A;  2UZK A;  3QRF F;  4AD9 A;  2GXB A;  2RQP A;  2DK8 A;  2K86 A;  2ZO4 A;  3HHG A;  2JZY A;  4BQA A;  5FD6 A;  1J5Y A;  1G3Y A;  3KLN A;  2Y75 A;  3LA7 A;  2FA5 A;  2VOP A;  5D5X B;  1P4W A;  1XMK A;  5K5O A;  4OIO F;  2A61 A;  2HTS A;  2HKO A;  2V6C A;  2F5C A;  4FX0 A;  1FPQ A;  3WU0 A;  1XMA A;  2HS5 A;  4BHC A;  1UST A;  2IA2 A;  4HZF A;  3IHU A;  3IRQ A;  1SMT A;  4RGR A;  3P9K A;  2YR2 A;  5ILV A;  3CO6 C;  2NAZ A;  1I6X A;  5JR3 A;  3RYR A;  3DP7 A;  2RKH A;  5IT9 Z;  4R1H A;  2IVM A;  2FXA A;  1IN6 A;  3IKV A;  1JHF A;  2ELH A;  3HIF A;  5TJJ A;  1TTY A;  4RAY A;  2R3S A;  1PDN C;  2RN7 A;  2ACJ A;  5J6X A;  1CF7 B;  1OR7 A;  3E5Q A;  3P9I A;  2VOD A;  1OYW A;  3IL2 A;  1W4M A;  1IAW A;  2K27 A;  2DT5 A;  4LJZ F;  3DF8 A;  2KIU A;  4KMU X;  2IP2 A;  3ML6 A;  3AAF A;  3RTR A;  1HSJ A;  1U8R A;  2VXZ A;  1QQI A;  3MZY A;  4EM0 B;  5ICC A;  5BPD A;  1L3L A;  3I64 A;  2M8E A;  4L9T A;  3RIR A;  2ZME B;  5LHH A;  3U1D A;  1WWX A;  2A6E F;  3GX4 X;  5LGN A;  1SFU A;  1WKM A;  1SAX A;  2EFP A;  2V1U A;  1QPM A;  2ZKZ A;  3KE2 A;  1KQ0 A;  4A6E A;  5BOX A;  4L9J A;  5LRR A;  1T2K A;  2IRF G;  1O7L A;  5CJ9 A;  4KIF A;  1Q1H A;  2Y0M A;  3GVA A;  3N4M A;  2W85 A;  3KP6 A;  5K5R A;  2E7X A;  4AVP A;  4IHS A;  5DUK A;  3F8M A;  1TLH B;  3GEZ A;  5AON A;  3SHF A;  3TO6 A;  1KA8 A;  1MJA A;  3FMQ A;  3JTH A;  4RB1 A;  1Z05 A;  2P6S A;  2DLL A;  2QBY B;  3BP8 A;  3M7G A;  5FLX Z;  4MTD A;  3ZMV A;  3B02 A;  5E8I A;  2GA1 A;  2AS5 F;  5K1Y A;  3TKY A;  5E1Z B;  5FFX A;  1IXC A;  4JQF A;  2X4H A;  4U0Y A;  2QYO A;  2TDX A;  1SFE A;  5KVR A;  1FWZ A;  2EA4 A;  2JSC A;  1YQA A;  4OMY A;  2EFW A;  4Z2Y A;  1EV7 A;  3BOQ A;  4L9N A;  2Q0O A;  4UVB A;  3OOP A;  1T39 A;  1ZAR A;  3RI4 A;  2HDC A;  1R5G A;  4K2E A;  2GXG A;  4I09 A;  1KU2 A;  2QUF A;  3I4P A;  2PLY A;  1OYI A;  3I59 A;  3NRV A;  1K7A A;  1J75 A;  3MQ0 A;  1TQM A;  5ILU A;  1UHM A;  1KYW A;  3CO7 C;  3RKX A;  4FX4 A;  1WQ2 A;  2EFN A;  4L0Z B;  3WTY C;  4CDG A;  1LQ1 A;  2W25 A;  1IN8 A;  4B09 A;  1TW2 A;  4KIC A;  3DEU A;  3RJP A;  1XGM A;  1U78 A;  1U6G A;  4KIB A;  1LNW A;  1TNT A;  4LK0 F;  4AIH A;  2V1X A;  5ED4 A;  1UHW A;  4BH9 A;  1E17 A;  5L3F A;  4B8X A;  4AIK A;  1T98 A;  3JSP A;  1S6L A;  3MZH A;  3FMS A;  1PP8 F;  2GQQ A;  3T1B A;  3H3U A;  4XLP F;  1G3T A;  2H27 A;  1FYM A;  3LA2 A;  1XDU A;  4ESB A;  1GXQ A;  3FHZ A;  1JXS A;  4MQV A;  1T0F A;  3CLO A;  5BS6 A;  3TDZ C;  5HLG A;  3NQO A;  3PFI A;  2L54 A;  3RKY A;  3C18 A;  3ZN0 A;  1ZYR F;  3H92 A;  2EFO A;  3HSR A;  3R4K A;  2LF7 A;  4ETS A;  3HTS B;  5L3E A;  3E6C C;  4LB6 B;  1ZN2 A;  2XRN A;  3BRO A;  3QU6 A;  1FBQ A;  2R7F A;  3MCZ A;  2LSO A;  5CVI A;  2RGV A;  5HS9 A;  3F8C A;  1KGS A;  1KQ9 A;  1BI1 A;  5LGU A;  1V4R A;  3LQR A;  5HS7 A;  1ZG5 A;  4HX4 A;  4KA4 A;  5LBQ A;  3R61 A;  3Q9S A;  2H6C A;  4IVN A;  1BI3 A;  3D0S A;  1LDJ A;  1ZRD A;  2FE3 A;  4G7H F;  2K4J A;  4R8H A;  2UWM A;  2HQN A;  4NHJ A;  5F64 A;  4HV6 A;  4EJO A;  1FC3 A;  3T8T A;  4UNO A;  3V8L A;  2QEN A;  2A6H F;  4XSZ F;  1T38 A;  2OAZ A;  3J80 Z;  5J8C A;  4WCG A;  5HDN A;  3GZ5 A;  1FBS A;  5CLS A;  2XAS A;  2CG4 A;  3I71 A;  1F1Z A;  5ICG A;  1MJ9 A;  4YFN F;  1ZG3 A;  1YG2 A;  4M73 A;  2DBB A;  2FF4 A;  1RIO H;  3KLO A;  3ABT A;  1Z91 A;  2EWN A;  2E1C A;  4E70 A;  2O8X A;  3GW2 A;  3JSO A;  4CHU A;  1GHC A;  1STZ A;  2DQL A;  3EYI A;  2F5E A;  3EQL F;  1IUY A;  1GXP A;  3SXY A;  1TQI A;  3KFW X;  1ZRF A;  2XAG A;  4BYY A;  5A2Q K;  1ZLJ A;  4LG0 A;  5DUI A;  3RPU A;  3WU1 B;  1ON1 A;  1YS7 A;  3F8B A;  4G9Y A;  3WTT C;  4OIP F;  1K78 A;  2DAO A;  1BBY A;  4GCV A;  5H20 A;  4M9X A;  2PQ8 A;  4P9U A;  1FY7 A;  4RGS A;  1ZRC A;  2JRT A;  1BC8 C;  2NS0 A; 
#chains in the Genus database with same CATH topology
 5K7Z A;  1G59 A;  2KIM A;  5FKK A;  1USS A;  5DD8 A;  2XB5 A;  4HEA 2;  2HQ5 A;  1K79 A;  4AUX A;  3PFY A;  5HNH A;  3G1M A;  4PSX A;  1MBH A;  4JYK A;  1OYY A;  5K7H A;  4IHW A;  4N4N B;  2AXT C;  3E6D A;  4EQQ A;  1PP7 U;  1U0J A;  1WH5 A;  4M72 A;  3L2U A;  1O57 A;  2VAS A;  1YO5 C;  3J7Z I;  2GBY A;  3HL2 A;  2CYY A;  4MNU A;  2JA8 J;  1YTY A;  4C3H J;  4HDU A;  1AOY A;  4XKW A;  1RUN A;  1WFX A;  2IGO A;  4MFD A;  3PQK A;  3H0G J;  1NG7 A;  1R1T A;  5J47 A;  2ZSI B;  2DJN A;  1J09 A;  2Y69 H;  4MHG A;  3ROU A;  5EF6 A;  2R92 J;  1D8K A;  4BKX A;  3BY6 A;  4IRH A;  3F22 A;  1HKQ A;  2R4G A;  1DGR M;  4LD5 A;  4XRF A;  2H1L A;  1ZR2 A;  1EKE A;  1X2M A;  1OKR A;  1BOA A;  2YX7 A;  5FKO A;  1FOX A;  3HOT A;  1EH8 A;  3OR1 C;  4D0P A;  1FSH A;  5JLX A;  1Z6T A;  3OYG A;  4EJV A;  1MNE A;  2JTV A;  3LAJ A;  4G7O F;  1GV2 A;  3VYT B;  2H1K A;  1LFU P;  1Z3Y A;  3QP6 A;  3ZN1 A;  4XBF A;  2HYG D;  2JA5 J;  5D5V B;  4U7D A;  2DT6 A;  4M6Y A;  1TL8 A;  2OBP A;  1VQ6 I;  1XCV A;  1TWH J;  1IRF A;  3E6M A;  2FNP A;  2E60 A;  4FAS D;  1W7P B;  1VQ7 I;  4P96 A;  1P2F A;  5JVG F;  1YJN I;  3HPH A;  2RDP A;  3J81 Z;  1FIA A;  1GV5 A;  5J1U A;  4EJT A;  5EEG A;  2NYX A;  2LK2 A;  2EB7 A;  4BGD A;  4YEL A;  2M8G X;  2PMH A;  4A5N A;  3E5X A;  4XON A;  3JRH A;  2A69 F;  2ESN A;  1D8J A;  1ODD A;  3MEX A;  1I3Q J;  4O3M A;  4RAG A;  3JAM Z;  3IUO A;  4EM2 A;  2KP6 A;  4XIC A;  2X1E A;  4PJ0 C;  2XAJ A;  2MLK A;  3HJE A;  3RKW A;  2OA4 A;  4HF2 A;  1U9O A;  3BZK A;  4CCO A;  5ICE A;  2JMW A;  1W1W E;  1XSX A;  2W1O A;  5D8L B;  1MSE C;  2OZ6 A;  3EPZ A;  2LY2 A;  4PUS A;  3FDY A;  2VPL A;  2PJP A;  2K5C A;  1I50 J;  1XDS A;  5FD5 A;  1MW7 A;  1VQP I;  4ENN A;  4PFP A;  2NRA C;  4E4H A;  2KPM A;  4C2T A;  1LE8 B;  4MTE A;  3HG9 A;  2NS7 A;  2Z9O A;  2FX0 A;  4BQQ A;  2XC7 A;  4XLF A;  4XOT A;  3S2W A;  4EGY A;  1P92 A;  5E18 F;  2F5F A;  2FQ3 A;  2NVY J;  1VZ0 A;  3TP0 A;  4MFE A;  1BA5 A;  1QZY A;  1BR4 A;  5EGO A;  5F1R A;  2E2J J;  3J7Y J;  1B72 B;  1MIJ A;  5HS8 A;  1X1B A;  4M3G A;  1TBX A;  1Z7L A;  3PQJ A;  1BR2 A;  3W3C A;  3W6K B;  1K61 A;  1SD4 A;  3SJM A;  5M5Y J;  3BG9 A;  3OIQ A;  2ZFW A;  2PBI A;  3GFI A;  2LMD A;  4BAY A;  1B9M A;  3C3W A;  1Z67 A;  3H5N A;  5EEA A;  3AL0 C;  1PYV A;  2UXX A;  1R5H A;  4A2U A;  2QM3 A;  5HVQ C;  3ZP5 A;  3GUD A;  4A3I J;  4UY8 I;  3OOU A;  5IT9 K;  1S3J A;  1K6O A;  4HBL A;  2R7X A;  1OCO H;  3E6B A;  1Z0X A;  4H0E A;  5L3D A;  3P7N A;  2V79 A;  3FXQ A;  2F5D A;  1R7J A;  1CF7 A;  1IF1 A;  4PJM A;  3O2P E;  4MEY F;  2E2I J;  1DU6 A;  2O5R A;  4IF4 A;  3QP5 A;  2R7T A;  3ZQQ A;  3T0Y A;  1O3R A;  4UVA A;  2IGM A;  3BJO A;  1YLF A;  3MVP A;  3FKI J;  3A03 A;  1R1V A;  5IYB J;  4CCL A;  2MLG A;  4L5I A;  4P5O A;  1D0Z A;  4Q5S F;  3WE3 A;  1R71 A;  2CJJ A;  4F55 A;  3LA3 A;  2VJI A;  3RKQ A;  2X9D A;  1ZG1 A;  4BQO A;  2J5P A;  2P7V B;  1XD7 A;  1GDT A;  2G7H A;  3Q0W A;  2R5Y B;  3H5R A;  3Q9V A;  4BXF A;  3WTV C;  1LJ9 A;  1J0R A;  4MGR A;  5KK1 A;  3G73 A;  4A0Y A;  2FOW A;  1XGS A;  3D5R C;  3VYS B;  3I55 I;  3A4C A;  2PG4 A;  2ISY A;  1ZTR A;  4HA8 A;  1O3S A;  5E8G A;  2ZME A;  2ZJ2 A;  4XM3 A;  4PSW A;  3VEP A;  4BE1 A;  2KRH A;  4IJA A;  3WGI A;  1QVT A;  2WV0 A;  4HNV A;  1XPX A;  1WJE A;  4BXU A;  1ZEL A;  3CUQ C;  1RUO A;  2BY3 A;  3OYD A;  1ETV A;  5J8F A;  3CP8 A;  1FOY A;  1LFP A;  1T33 A;  2DTR A;  4KN4 X;  2FJ1 A;  3H0D A;  3ZMU A;  3A01 A;  2L9N A;  2QQA A;  2Z33 A;  1RKW A;  5J40 A;  5F0C A;  3PNT A;  3E7L A;  2Y2Z A;  2R0Q C;  5F27 A;  3T5X A;  2B0L A;  4G6D A;  1I1G A;  4IHV A;  3IWZ A;  3IWF A;  3OIO A;  4L0Y B;  2RNG A;  2DCE A;  4RA2 A;  5AIQ A;  4YG2 F;  1AU7 A;  4UUT A;  3UR3 C;  1ETX A;  3HHH A;  1IV8 A;  4RGX A;  2VOO A;  1HKT A;  3ABL H;  1XCB A;  1FP2 A;  1K6Y A;  1M1E B;  3FBN B;  1U5T C;  5DDG A;  2E1O A;  3ABU A;  4HG2 A;  3FBI B;  3CTA A;  1BJA A;  4PZJ A;  3TOA A;  3ERE D;  4XLC A;  3LWF A;  1U2W A;  1RRJ A;  2NXN B;  3DTI A;  2VPR A;  3G1O A;  4QPQ A;  1BC7 C;  2K4B A;  2NOJ B;  1GLN A;  4B47 A;  3S32 A;  1IN7 A;  2Y30 A;  4EMS A;  3LSR A;  2L02 A;  2QBY A;  5GPC A;  4ENM A;  1YRN B;  1W5S A;  1HOM A;  1XGO A;  3K2A A;  3IP4 B;  3OSF A;  1AKH A;  4A3C J;  3FWE A;  2WB1 A;  2O61 A;  1XB4 A;  4HSR A;  1X3Z B;  1YIJ I;  2Q1Z B;  1MBG A;  5GAD J;  3ZQL A;  1RPW A;  4BUP A;  3HUG B;  1H89 C;  3WG7 H;  3H3Z A;  2BHZ A;  3OS1 A;  1YFH A;  3CF2 A;  1SAN A;  2WY8 Q;  5D4R A;  4M9Z A;  2A3S A;  2PN6 A;  1HW1 A;  4EJU A;  3PO3 J;  4XRM A;  3KX2 A;  4G6Q A;  2NVQ J;  4MEX F;  2EZL A;  2A5Y B;  2Q8K A;  2Y9Z A;  4LIV A;  3MAJ A;  4PGH A;  4ZYA A;  2HEO A;  1MGT A;  2NNN A;  3CCQ I;  4E6K G;  1KQ8 A;  2MD5 A;  2L5Q A;  2VJJ A;  2ZB9 A;  3FX3 A;  3K4C A;  2IGN A;  3BZC A;  4B3A A;  3H9J A;  5IT3 A;  2L9R A;  3DQV C;  4G8X A;  2JA6 J;  2EV6 A;  3FIW A;  1B8I A;  4I98 B;  2EIN H;  3TW6 A;  3JR9 A;  5E3O A;  4I02 A;  3A2K A;  2CUF A;  9ANT A;  1ORK A;  4X1E A;  2HR3 A;  1PUF A;  2BXY A;  2IW5 A;  2L2O A;  2IEK A;  3AL0 B;  2YX4 A;  4XN0 A;  1WJ5 A;  2A5W A;  3QPL A;  4DBQ A;  5KHD A;  2ISZ A;  5DYM A;  1JGG A;  4XLH A;  1VF9 A;  1RI7 A;  2LRD A;  3BJA A;  4CGZ A;  3E5U A;  5CVR A;  4A3D J;  2DOE A;  2BVL A;  3IC7 A;  5CQE A;  2FML A;  2O8K A;  3CDL A;  1FYL A;  2VC0 A;  3MKL A;  3BPV A;  2VBZ A;  4OIN F;  2K9N A;  2K9Q A;  4BE0 A;  3I56 I;  3A0H C;  4CIC A;  5HOD A;  1VQ4 I;  4IPA A;  2JUC A;  2I10 A;  2K85 A;  1HQC A;  4LLG F;  3W2V A;  3VOD A;  5HDK A;  3SYT A;  5L3C A;  4IKF A;  3DTE A;  5FFZ A;  2JN6 A;  3I0T A;  3F21 A;  5D6F A;  4ENK A;  2VIX A;  1JKQ C;  5JHF A;  4M6X A;  2EJR A;  3WE2 A;  2EZH A;  3TED A;  1I27 A;  5DCM B;  4RS8 A;  1O7F A;  4ENJ A;  5C44 J;  3LSG A;  2Z3Y A;  3DTK A;  2FEZ A;  3ZMZ A;  2KZV A;  3EUH C;  3I3L A;  3Q0V A;  4L9V A;  4HQE A;  2ETH A;  5DEQ A;  1X3W B;  2LF8 A;  1SVM A;  3CUQ B;  2DTZ A;  1W0T A;  3LSJ A;  4MO7 A;  1UEL B;  3FXU A;  3WTW C;  4IHX A;  4GGG A;  3K7A J;  2P5L C;  2P5V A;  2R7O A;  3QPH A;  5B3S H;  2HZD A;  4KUM A;  4LK1 F;  1NK2 P;  2VKD A;  1FYK A;  3R0J A;  3I58 A;  3F3X A;  2A05 A;  4KT5 C;  2L7K A;  2OD5 A;  1ETQ A;  5L3G A;  3K4K A;  2HYF A;  3I4N J;  2N8G A;  2FNA A;  2R7W A;  4CH7 A;  4HNU A;  3W6J B;  3RDI A;  1A04 A;  3ASN H;  3HEF A;  3K69 A;  1IZ1 A;  5D4S A;  3JW4 A;  1A35 A;  5D8K B;  3LSI A;  1U5T B;  5LHG A;  2IS1 A;  4GYI A;  5ERI A;  5GAH J;  2CO5 A;  2ZBK A;  2ZJP F;  3PIP F;  3OSG A;  1WCM J;  3BQZ A;  2ZSH B;  2CQK A;  5IP6 A;  1DUX C;  3ZMD A;  2K9L A;  3HRT A;  3GWZ A;  4Q4Z F;  5DCF A;  5J3L A;  4E7Z A;  2XKO A;  1D1B A;  3HPG A;  2CW0 F;  3S3O A;  2VON A;  3L9F A;  4XL9 A;  4G7Z F;  3BR1 A;  3OYM A;  4OIQ F;  2Z5U A;  4FCY A;  3DLA A;  3MWM A;  4WXC A;  2NVU B;  4BEH A;  3BG5 A;  2OUM A;  3GFM A;  1JUS A;  2GIZ A;  4S0H B;  2CQN A;  3CZ6 A;  2HOT A;  3GO5 A;  4JBA A;  3F23 A;  3V8J A;  1JE8 A;  2JPB A;  2DI3 A;  1VTN C;  2M9H A;  3WTZ A;  1PUE E;  5LEJ A;  3A02 A;  1MDM B;  2DOA A;  5BMZ A;  1YYV A;  4Y15 A;  2LC2 A;  5CVJ A;  3CMM A;  1FOW A;  5FO5 A;  5JI6 A;  2NOG A;  3R0A A;  4B3X A;  5EZH A;  4U7B A;  2XRO A;  3QQA A;  1SEU A;  4B43 A;  2L7F P;  4B48 A;  1IN5 A;  5FKM A;  4G12 A;  5FLV A;  3BTI A;  3HYI A;  4BDZ A;  4WK8 F;  2XAF A;  4B1R A;  1WPK A;  1GUU A;  3R60 A;  4QIW N;  5K7F A;  2R5Z B;  2MC3 A;  4BBS J;  4TV7 A;  2ZXJ A;  2WAQ N;  2ELK A;  2O6G E;  3JRE A;  2G7U A;  2VI6 A;  1V5F A;  2OV7 A;  1FJL A;  1FLI A;  2V6E A;  3L09 A;  4AIJ A;  3E3V A;  1QZE A;  5LHI A;  3K10 A;  2YU9 J;  2VN2 A;  3MFK A;  4I7H A;  2JPC A;  2DU9 A;  2RV8 A;  4XKC A;  2QSG X;  2G0E A;  2YSR A;  3JRA A;  2XVC A;  1KU7 A;  1RZ4 A;  3K1P A;  3OL4 A;  3ZXS A;  2O9L A;  4NBQ A;  1LUJ B;  2X51 A;  2M3A A;  2HWV A;  2VJ4 A;  2WY7 Q;  4A3F J;  2DYS H;  2QWW A;  2BEO A;  2DA2 A;  4ZZL A;  4I76 A;  3F0C A;  3R6S A;  2X6Y A;  2JT1 A;  3TBI A;  1J7K A;  3JRD A;  1I5Z A;  3KP2 A;  4IXA A;  3W6V A;  4A6D A;  3FMR A;  3DFG A;  3H35 A;  3LSK A;  2M5W A;  3K9T A;  1HW2 A;  4GO1 A;  2BW3 A;  1TNS A;  2J5O A;  4HRI A;  3CUO A;  2WC2 A;  4YFK F;  4M71 A;  1R9T J;  2F4M B;  5J4V A;  1XTA A;  5E20 A;  2LBF B;  2EFQ A;  3KEY A;  4U0V A;  4CSW A;  1MBE A;  3C2G A;  2ICW G;  3V42 A;  3HC7 A;  1QBJ A;  2L4M A;  5FRO A;  3HDD A;  2L01 A;  3PUF A;  2WAE A;  2FOK A;  1ZHF A;  3EUK L;  3KZZ A;  3P5J A;  1HXD A;  4C3I J;  4RB2 C;  3FF5 A;  3K4M A;  5KAI C;  4RGU A;  4NQW B;  4I2O A;  4LLL A;  2EA2 A;  1MMA A;  2LOO A;  3SDG A;  2BBY A;  3B73 A;  4XR6 A;  1GVJ A;  2DA5 A;  5BQT A;  3IKT A;  2DA4 A;  2K02 A;  2MYS A;  2W7N A;  4U0W A;  3H3V K;  3ELK A;  1MBJ A;  1P4X A;  3RZO J;  3OYB A;  4JX5 A;  2CV0 A;  3SZP A;  4LLN A;  4XOP A;  4BY1 J;  3EUA A;  4F7Z A;  4IRI A;  1HF0 A;  3G6E I;  1TW3 A;  4BNC A;  2MW8 A;  5DV5 A;  4ZYD A;  5B1A H;  1VQO I;  3FXK A;  3HOU J;  5ILS A;  4WF2 A;  2TCT A;  3BWG A;  2O0Y A;  2Y0S N;  2F6C A;  4LIU A;  1Z77 A;  1W5C C;  4FHT A;  2HYJ A;  2DPU A;  3BTJ A;  4F93 B;  1R49 A;  2JUG A;  3C2H A;  2IT0 A;  3CMA I;  1KU9 A;  2CGP A;  2RQQ A;  3GBG A;  1FNN A;  3OR2 C;  2IPQ X;  1W7P D;  4HX8 A;  3FK7 A;  2STW A;  1V3F A;  2CMP A;  1QZZ A;  4AWX B;  1H9T A;  3CES A;  2KLO A;  2H09 A;  2HQR A;  2QGU A;  3A0B C;  1VQL I;  4ZJZ A;  5E1W A;  1D5Y A;  4D1Q A;  1F5T A;  4A0X A;  1DPR A;  1FZP B;  1PJR A;  2VQL A;  1WJC A;  1B9N A;  3KCC A;  3DXJ F;  2XAQ A;  3TO9 A;  3DPT A;  1U8B A;  2CWE A;  2VBX A;  5GPA A;  1B1B A;  1J2X A;  3W2W A;  3S15 J;  1ZH5 A;  4HX7 A;  4NNJ A;  4U88 A;  4ZYE A;  1Z21 A;  2OCE A;  4JK1 X;  5BPI A;  4UUS B;  2EBI A;  4HLY A;  2QCO A;  1RC9 A;  2RNJ A;  2FBK A;  4LB5 A;  3GFJ A;  3FM3 A;  4XMY A;  2E5Z A;  1FX7 A;  3TO7 A;  2VL8 A;  3ZOB A;  2UUZ A;  1YW8 A;  1T6S A;  3HZJ A;  2E1M C;  2DFF A;  4YII A;  1Y1W J;  1DP7 P;  1G3S A;  5JLW A;  2XF5 A;  1RNL A;  1SC7 A;  3VB2 A;  2QVO A;  3OV8 A;  2R7V A;  2Q2E B;  1BIB A;  3F72 A;  1B59 A;  5E3N A;  1QRY A;  1YIO A;  2DQR A;  1W7P A;  3ERM A;  1D0Y A;  3CME I;  3LFU A;  4BQN A;  2BE5 F;  1BR1 A;  1NK3 P;  2C6Y A;  2VQC A;  4A69 C;  5E17 F;  3QOE A;  1MND A;  3WTU C;  5M3M J;  3K70 D;  5LLQ A;  2CFX A;  4A3G J;  3FXM A;  4RAF A;  2L0K A;  2DDA A;  1TWF J;  1S7A A;  5F0F A;  3LSM A;  4DIQ A;  4CZC A;  2CV1 A;  1JTX A;  3FXO A;  4RB3 C;  4KT6 A;  4A93 J;  5D6E A;  4E7K A;  1C0W A;  1AHD P;  1IW7 F;  2B7E A;  1D5V A;  3M1E A;  2GAU A;  4X6A J;  3JTG A;  3N05 A;  4ASN A;  2OPT A;  4XN3 A;  1VI0 A;  2E71 A;  4HF0 A;  4E7S A;  4P9F A;  4QSH A;  5FGM A;  1LE8 A;  1LDK B;  2BV6 A;  5E3L A;  2VBY A;  3GYH X;  5EZG A;  1TP4 A;  2TRT A;  4JX4 A;  1WZ2 A;  2ID3 A;  1S29 A;  2WTE A;  3HKZ N;  4FET A;  1MH4 A;  1B72 A;  4RAZ A;  2GIV A;  4BY7 J;  1TT5 B;  1JHH A;  2XUB A;  3WGH A;  4KJZ A;  4A3J J;  1H0M A;  1CGP A;  1REP C;  1XX5 A;  2CQ7 A;  2I5U A;  3ZPL A;  1P7I A;  2XGX A;  2STT A;  3CCR I;  4RBO A;  4J01 A;  1Z3X A;  3ASO H;  3CP2 A;  1E3P A;  1IXR C;  3TL4 X;  3ONQ A;  3CLQ A;  3ABK H;  4PCQ A;  1ULY A;  5JFR A;  2MBF A;  4OOI A;  2YPR A;  5EEH A;  4C30 A;  2JWT A;  1ETW A;  3DKW A;  2IS6 A;  2D2W A;  1EH6 A;  2M4G A;  2M34 A;  3BT9 A;  4L18 B;  3I5U A;  3DPU A;  4FE7 A;  2CFO A;  1W5T A;  2AXL A;  1MBF A;  3M07 A;  2HOA A;  3I9V 2;  4S04 A;  2HPI A;  3SZG A;  1R4N B;  4EJW A;  1JI8 A;  1OPC A;  2IGK A;  2IS2 A;  3IAM 2;  1UB9 A;  5M3F J;  2GWR A;  2M45 A;  4OU0 A;  2EV5 A;  2PEX A;  1X1P A;  2X6W A;  1XSD A;  3MKZ A;  2JA7 J;  5C4X J;  2VBW A;  2R5Y A;  5FJ8 J;  5D5U B;  3WTS C;  3K6G A;  3L2R A;  2DK5 A;  2QQ9 A;  4WXH A;  5HDG A;  2WWY A;  3BCA A;  2FRH A;  4Q47 A;  3E1S A;  3LQQ A;  5C3E J;  4X0G A;  5EYR A;  3REO A;  3GCM A;  3KET A;  3PO2 J;  2DW4 A;  1V55 H;  3OYF A;  1XN7 A;  4HLX A;  1FBU A;  1LPQ A;  3HOS A;  3DBH B;  2FMY A;  1J59 A;  1UMQ A;  2DMP A;  4FE4 A;  4OIR F;  4OAZ A;  1I1S A;  2BY1 A;  1UHS A;  3CJN A;  4AID A;  1ZGJ A;  4NB5 A;  4ESJ A;  4DGW B;  2D45 A;  1JJ8 C;  2FBH A;  2A07 F;  3GTP J;  4Y17 A;  2W48 A;  2M7A A;  2OQR A;  2XKP A;  1Z7U A;  4M3D A;  2KJC A;  4BU2 A;  3BLY A;  1R23 A;  3QOP A;  3EET A;  4ZYG A;  1W36 C;  5JHU A;  1ZKG A;  1ZR4 A;  1HA8 A;  4NUB A;  2HGC A;  5TGT A;  3BDD A;  3SFI A;  5DM6 F;  1O3T A;  1JUM A;  2L3D A;  4HYE A;  2QLZ A;  2E1M B;  1FP1 D;  3HOZ J;  1XGN A;  5D5W B;  4I0A A;  1XMX A;  1UJ8 A;  5F0H A;  3K4B A;  4M3E A;  3CCL I;  1HDP A;  4RLF A;  5E1X A;  4QLC U;  1HKS A;  2X85 A;  5HLI A;  2O3F A;  3FHN A;  2K7L A;  2FQ4 A;  1YJ9 I;  2OZU A;  5HOO A;  2BGC A;  2KT0 A;  4YIF A;  1YRN A;  1WJB A;  1DPU A;  3RSN A;  4YIR X;  2BVM A;  2IBD A;  2ESH A;  1SFX A;  4I0B A;  4NC7 A;  3U1K A;  4HDV A;  4I6Z A;  1YI2 I;  3B6A A;  5JVT A;  1A31 A;  5KNL A;  2VUM J;  1R22 A;  3WGG A;  1QPI A;  2PJR B;  3WOD F;  3HUG A;  1IN4 A;  2DXI A;  1TWA J;  4Y3O A;  3LSP A;  1QNT A;  2E5N A;  5DTD A;  2W24 A;  1T95 A;  2D1H A;  1MBK A;  4WX9 A;  3K4J A;  3L2C A;  4KYW A;  4AYB N;  3AFH A;  3D5S C;  2KHM A;  4GXO A;  1WI9 A;  2IAI A;  1VQM I;  2IA0 A;  2VKH A;  2E34 A;  1X2N A;  3L2W A;  4CA0 A;  2CQX A;  4ON0 A;  3A1Y A;  4Y13 A;  3L7W A;  1VFC A;  3S3N A;  2KIF A;  2ME0 A;  1SD5 A;  4W1U A;  5FLX K;  2B9S A;  3EDP A;  3PIO F;  1K83 J;  1R00 A;  3KEO A;  2JA2 A;  1UZC A;  3M8F A;  1ZRE A;  2A68 F;  1SD6 A;  2LRE A;  2KIQ A;  2XPV A;  1UFM A;  1NHA A;  5H6Q A;  2JRM A;  1AA7 A;  3FZV A;  1W36 D;  3NWT A;  3GZ6 A;  1IRZ A;  4RM3 A;  3F6O A;  4S05 A;  3DU6 A;  1MD0 A;  2V1D A;  3ZMS A;  1G4D A;  2P8T A;  1IGN A;  1OIS A;  2A6T A;  4EVI A;  3PNV A;  3C1D A;  3KP4 A;  1L0O C;  3LST A;  4N9H A;  4RB0 A;  5LGT A;  4IOC F;  3HB9 A;  2E35 A;  2PI0 A;  1LFB A;  1ONV A;  4ZC3 A;  4ZYH A;  3SEZ A;  3Q3S A;  1QHG A;  1HDD C;  1O4X A;  2BXZ A;  3FXJ A;  5CQG A;  4M74 A;  1LEB A;  1FSE A;  2Z99 A;  5HLT A;  1DU0 A;  4M9S A;  4L5J A;  4XK4 A;  1T0F C;  3VYU B;  4ANJ A;  3U21 A;  4ZTJ A;  3AG2 H;  1OLT A;  4DQ2 A;  1MMN A;  4KN7 X;  4DYQ A;  1OMI A;  2QF7 A;  3I53 A;  3K1M A;  1JXS A;  2PMZ N;  3NAR A;  4A12 A;  2ZXH A;  3TMO A;  1JKR C;  2HKX A;  4KDP A;  5CPR B;  3L00 A;  4C2M J;  4A5M A;  5DCM A;  5FLM J;  4PJL A;  1H9G A;  2XV4 S;  3WG9 A;  1D3Y A;  3HM5 A;  3X2Q H;  3RPQ A;  2LR8 A;  1IRX A;  2EIJ H;  2VJ5 A;  4CZZ A;  3V4G A;  5GTH C;  3CMY A;  2D1V A;  2EH3 A;  4CYC B;  2F4O B;  2DFH A;  3CJQ B;  1DDN A;  3G71 I;  4Y52 J;  1XSV A;  1SMY F;  1YS6 A;  3I54 A;  1NTC A;  2OU2 A;  4BJ6 C;  1X3U A;  2V9V A;  4UV9 A;  3ECO A;  2EQR A;  3CUQ A;  2GZW A;  3ISP A;  2BYV E;  2MFZ A;  3V8K A;  1YE9 A;  1OCT C;  1E0E A;  3G2B A;  3HTU A;  1ZAO A;  2MG4 A;  2L9S A;  3CDI A;  2CSO A;  2EIM H;  4CYD A;  1X58 A;  4C3J J;  1WJD A;  2IA1 A;  2HZT A;  1Z6R A;  2ELJ A;  4LMY A;  4DOZ A;  1HW5 A;  1E2X A;  4I01 A;  4LFU A;  4BAC A;  2QEX I;  5FRN A;  1LVA A;  2IJL A;  1R58 A;  1A6I A;  1YW9 A;  5CVU A;  4DZJ A;  4IHY A;  4P55 A;  2AQE A;  1B4A A;  2QKL B;  2MD0 A;  3JRI A;  4GYG A;  2FBI A;  2VB6 A;  3K1N A;  3G4S I;  2JSP A;  4CO8 A;  4CXF A;  2XF6 A;  2BY2 A;  2EZK A;  3M8E A;  3LL7 A;  3QWL A;  3BZ6 A;  5IP7 J;  4UUV A;  3L2V A;  2ECC A;  2LDU A;  4N0B A;  4UV8 A;  3DPL C;  1U5T A;  1GVD A;  3N97 A;  3DCF A;  1A6Q A;  1SD7 A;  1T56 A;  3IRR A;  4XLE A;  2UXN A;  4IEJ A;  3O3K A;  4O6J A;  1HBX G;  2RRE A;  1OJL A;  2CUZ A;  2QZ8 A;  2HDD A;  1BI2 A;  1JT6 A;  1Z9C A;  2DPD A;  2XIG A;  4DNC A;  2RVC A;  1OCC H;  2VT2 A;  4WXD A;  4ZZD A;  2V26 A;  1TWC J;  3ZQH A;  4IQ4 A;  4UB8 C;  4YEJ A;  1DGW Y;  4BXX J;  1BN5 A;  2RAE A;  2PMU A;  3H1C A;  4IHT A;  3C7J A;  1YX3 A;  1S8N A;  1OQY A;  2ZNY A;  2ZNZ A;  3KP5 A;  2WAQ A;  3HGG A;  3ZMT A;  4UXN A;  1Z1D A;  3L2Q A;  3F8F A;  1Y0U A;  2HFH A;  2K9M A;  3I59 B;  3LAP A;  1YOV B;  3OMY A;  3S2H J;  3QU3 A;  4H4K C;  2Z2S B;  3LFK A;  2VE9 A;  1MDM A;  2RC4 A;  3O8H A;  2VE8 A;  3KZY A;  5CVV A;  2IS4 A;  1IRG A;  5FB2 A;  3VOE A;  1XG1 A;  3B6C A;  3PSF A;  4EAT A;  1KZH A;  1IG7 A;  1QU3 A;  2EK5 A;  2O03 A;  4HQM A;  4PK4 A;  5TRD A;  2R5Z A;  2X1D A;  2D5V A;  1BW5 A;  2HI3 A;  2LLK A;  1ZK8 A;  2P0W A;  2FSW A;  1JGS A;  3ZQC A;  3TGN A;  2MSY A;  1YHQ I;  4AC0 A;  2CS3 A;  1FT9 A;  3CJR B;  3VFZ A;  4ZH4 F;  1BI0 A;  2NVT J;  2EPF A;  4W97 A;  2HTJ A;  5F6F A;  3V7R A;  2GOX B;  2AHQ A;  1WVR A;  1KYZ A;  4IZZ A;  2R7D A;  5EG0 B;  3L1P A;  1LEA A;  4HST A;  3OYL A;  5F1J A;  4PFO A;  3RYP A;  3U2R A;  3BCB A;  5K5Q A;  2HVR A;  2MH2 A;  2X48 A;  1YX5 A;  3VPR A;  4B44 A;  3OIP A;  4GFB A;  1QVU A;  2VQG A;  5LRS A;  4IRG A;  1P6R A;  1B6A A;  2ZJR F;  4LG3 A;  3GTO J;  1FOK A;  2ADU A;  2VXD A;  1K4S A;  5FRM A;  2ECB A;  1FEX A;  2LBF A;  3MMY B;  1LKX A;  1LVK A;  4D5C A;  5CYV A;  2KL4 A;  2R93 J;  2H8W A;  3FKJ A;  3DKX A;  4R79 A;  3ECH A;  4NC6 A;  2WAD A;  2DO7 A;  3DEE A;  3COA C;  3O6B B;  3D5L A;  3J80 K;  3HSF A;  2F2E A;  4NQW A;  3GTJ J;  2LY9 A;  2MAB A;  3WHC A;  1MMD A;  2HVS A;  3C2B A;  4RDU A;  3AG4 H;  2Y0S A;  3BTL A;  4EGZ A;  2P6T A;  3HRM A;  3QAH A;  1ON2 A;  1RES A;  1Y6I A;  2HXI A;  1UAA A;  4AVZ A;  3J7A O;  2P5K A;  3EUH A;  3FM5 A;  5LFA A;  1JT0 A;  3JCU C;  4G94 A;  1E3O C;  1SAU A;  2MA3 A;  4UHT A;  2XHK A;  2COB A;  1O3Q A;  3SQN A;  5M5X J;  2MGQ A;  2WAF A;  4IOA F;  3VSL A;  1RET A;  3IH3 A;  2E2H J;  1WRJ A;  4KMF A;  1J9I A;  2DMU A;  3G1L A;  2M30 A;  3KEQ A;  3PSI A;  4DYR A;  1ETK A;  1MZB A;  3E97 A;  4CCM A;  4XRS A;  1IXS B;  2DFI A;  2KMU A;  2HVQ A;  2KJB A;  2KQR A;  2JJ7 A;  2H94 A;  3KP7 A;  4Q48 A;  5AIP A;  3V7C A;  2E7W A;  2W00 A;  2QA4 I;  1MKM A;  3KZI C;  3CQZ J;  1JUP A;  2E1N A;  4YRV A;  3FXR A;  1KON A;  1FMW A;  1GT0 C;  2ZXW H;  1F36 A;  1ZGA A;  3HRU A;  4D7M A;  2G9W A;  2OTJ I;  1YJW I;  1QGP A;  1P7J A;  2Y48 A;  4QPO A;  1MMS A;  2VQH A;  2GLO A;  5KAF C;  5C4J J;  1BM9 A;  4M6V A;  1G6N A;  2KZG A;  3SZT A;  2VT3 A;  2OQG A;  4HOB A;  2PFB A;  2KDZ A;  2GA2 A;  3WTX C;  1UCR A;  3S17 J;  1VND A;  1MJB A;  4JX6 A;  3F8N A;  3GLX A;  2R7U A;  3F6V A;  1EF4 A;  4LGW A;  5HLH A;  3P9C A;  3M1C A;  5DD4 A;  3HSE A;  4EV0 A;  2W84 A;  1ZQ3 P;  2F5V A;  4OMZ A;  2I8D A;  1KU3 A;  4UUS A;  2LKP A;  4BJT A;  3DU5 A;  4PDK A;  4O5V A;  2WBM A;  3F9K A;  2M87 A;  3V7S A;  4F52 A;  1ZGW A;  3BR3 A;  4UVC A;  4FT8 A;  4MQ9 F;  3VDX A;  3WU2 C;  2W57 A;  4KFC A;  3T8R A;  4HF1 A;  1IDZ A;  3PNY A;  1HLV A;  2Q2E A;  1WGX A;  5FKN A;  2GM4 A;  1D1A A;  2ZCW A;  3ULQ B;  4YFX F;  2COM A;  4V2F A;  2OCC H;  3CDH A;  5A2Q Z;  1WSU A;  3KYC B;  4HV5 A;  3OYK A;  3M9A A;  2R7R A;  2NVX J;  4E7L A;  3HXL A;  4KIG A;  3MZ8 A;  1DQU A;  2XB0 X;  4JP0 A;  1FTZ A;  5B1B H;  3E0J B;  2LNB A;  1FMV A;  3LNQ A;  3FIS A;  1LB2 A;  1BL0 A;  2LFB A;  2EV0 A;  4KNY A;  2ZC2 A;  4LG0 B;  1JKO C;  2DMQ A;  3CCM I;  3U9G A;  3BR5 A;  2UV1 A;  4HW0 A;  2M1B A;  3GXO A;  2AQF A;  4A0Z A;  3HKZ A;  5IYC J;  1G8X A;  1VQK I;  3KP3 A;  4GRI A;  2LG4 A;  2H8R A;  1TZL A;  3OS2 A;  2HPM A;  6PAX A;  3D1N I;  1P4A A;  1LDD A;  1IDY A;  3K2Z A;  1R1U A;  3RCO A;  4XRS G;  2ME6 A;  4DYC A;  1ITY A;  3IH2 A;  4XLN F;  3GF2 A;  2DN0 A;  1K78 B;  2XAH A;  3KIO A;  2H6B A;  3GFL A;  2X0L A;  2P4W A;  3K0L A;  5CKT A;  1G3W A;  2FU4 A;  1QO0 D;  2X6O A;  2MH9 A;  3ZRG A;  2P7C B;  4FQG A;  4OWR B;  3SEQ A;  1CQT A;  2CW8 A;  2DMT A;  2FD5 A;  2LH9 A;  2HOE A;  5ICF A;  3HRS A;  3J81 K;  4PGG A;  1EH7 A;  3TDU C;  5LEK A;  5IYD J;  3SFZ A;  1IC8 A;  1OR7 C;  3TOB A;  1F4K A;  3H9Q A;  1BIA A;  2VC1 A;  2KRF A;  4QWQ A;  4DW6 A;  1ACI A;  4BHP A;  3GTK J;  2ZME C;  2M2E A;  1TQP A;  2KKO A;  3JAM K;  2M4K A;  3QPT A;  1S7E A;  4HAM A;  5H6R A;  1D0X A;  1OCR H;  4DZP A;  3CCJ I;  3NEU A;  4BHB A;  2CUE A;  1AWC A;  1MNM C;  4A3B J;  1S7O A;  1ZLK A;  4WWC A;  1U3E M;  1R36 A;  3BPX A;  1HST A;  2L4A A;  4D7N A;  3Q5F A;  4ESF A;  2CV2 A;  4XSX F;  5L3B A;  2DJI A;  3G3Z A;  1YW7 A;  3BJ6 A;  3WHB A;  2QQB A;  4N4O B;  4N9I A;  4M3B A;  3OY9 A;  3VSK A;  3IV5 A;  1TC3 C;  4EM1 A;  1XC5 A;  2NNY A;  1SVL A;  4EEF G;  2M0M A;  3ZQ7 A;  2KRC A;  3EYY A;  3LSH A;  5J1R A;  3TQN A;  1F9N A;  3GTG J;  3Q0U A;  4FIS A;  2YU3 A;  3DV8 A;  3NAU A;  1S9H A;  2QSF X;  2UZK A;  3QRF F;  4AD9 A;  2HQA A;  2GXB A;  2RQP A;  1NG6 A;  5M5W J;  2DK8 A;  2GXA A;  2OTL I;  2K86 A;  3FXL A;  4E7H A;  2ZO4 A;  3HHG A;  2JZY A;  4BQA A;  4JOM A;  3RQ4 A;  5FD6 A;  4XLA A;  2DFE A;  2V9K A;  4Y7N J;  1J5Y A;  1G3Y A;  3KLN A;  4CCJ A;  1VQN I;  2Y75 A;  3LA7 A;  2FA5 A;  2VOP A;  5D5X B;  1I6H J;  3GLL A;  5FKL A;  1P4W A;  3QOD A;  1V54 H;  4P1W A;  1XMK A;  1OCP A;  2X1C A;  4GDF A;  1ETY A;  5K5O A;  4OIO F;  2A61 A;  2HTS A;  2HKO A;  3BG6 A;  2XSD C;  3JRG A;  1E3H A;  2MC4 A;  2Z16 A;  2V6C A;  2X6X A;  1TT0 A;  1N78 A;  2F5C A;  3GME A;  2F48 A;  2L7Z A;  1FTT A;  2L9V A;  3KPH A;  1ENH A;  3QYF A;  3OYJ A;  4FX0 A;  4BDY A;  3CCS I;  1Y0N A;  1FPQ A;  3MKW B;  1UG2 A;  3WU0 A;  1XMA A;  2HS5 A;  4BHC A;  2XDV A;  1UST A;  1V5E A;  2EZI A;  2IA2 A;  1MMG A;  4HZF A;  3IHU A;  3IRQ A;  1SMT A;  2DA6 A;  2K9S A;  2LP0 A;  4BJ5 C;  4RGR A;  4Y33 A;  3P9K A;  3HOW J;  2QQ8 A;  4RMN A;  1A36 A;  2YR2 A;  2CUJ A;  5IOY A;  5ILV A;  2P81 A;  3CO6 C;  3CD6 I;  2NAZ A;  1I6X A;  5EGO B;  5JR3 A;  3RYR A;  4XOR A;  3DP7 A;  2RKH A;  4PJN A;  1R5I D;  2L7M P;  2LYC A;  5IT9 Z;  4BL0 B;  4R1H A;  2IVM A;  1N25 A;  2FXA A;  2ZJQ F;  4A3M J;  1IN6 A;  3IKV A;  1JHF A;  2ELH A;  1EJ9 A;  4AYB A;  3HIF A;  5J4Y A;  5TJJ A;  1TTY A;  4RAY A;  2R3S A;  1WI3 A;  1PDN C;  2RN7 A;  4ZTF A;  2ACJ A;  2V1N A;  5J6X A;  1CF7 B;  1OR7 A;  4L5E A;  3E5Q A;  3HOV J;  1BW6 A;  1RR7 A;  2K3P A;  3P9I A;  3UKG A;  1OYW A;  2CQQ A;  2PJR A;  3IL2 A;  2VOD A;  1QHH D;  1W4M A;  3BR0 A;  1IAW A;  2K27 A;  2V4J C;  2DT5 A;  4LJZ F;  2VKE A;  3DF8 A;  2K3F A;  2KIU A;  4KMU X;  4J19 A;  2IP2 A;  2DYR H;  3PM1 A;  1SFK A;  3ML6 A;  3AAF A;  4V2G A;  2LVS A;  1Y8R B;  1P9Q C;  3M8J A;  3RTR A;  1HSJ A;  1K4T A;  3DLL F;  1U8R A;  4CCK A;  3JRB A;  1BJZ A;  2VXZ A;  1QQI A;  3MZY A;  4EM0 B;  5ICC A;  2CH0 A;  4D5F A;  5BPD A;  1L3L A;  3RQI A;  3I64 A;  4II2 A;  4B4C A;  3KYL A;  3QYE A;  2M8E A;  4L9T A;  2XAU A;  3RIR A;  2ZME B;  3AG3 H;  5LHH A;  3OYI A;  1MH3 A;  3JRC A;  2W82 A;  3K4N A;  1PVE A;  5E3M A;  1V5G A;  3U1D A;  1HCR A;  1WWX A;  2A6E F;  3GX4 X;  5LGN A;  1SFU A;  1VQ5 I;  1WKM A;  3OWT A;  5F04 A;  1SAX A;  1X4P A;  2EFP A;  5GTI C;  2V1U A;  1QPM A;  2ZKZ A;  1FIP A;  3H9G A;  3KE2 A;  1KQ0 A;  1H8A C;  3JRF A;  1YIT I;  4A6E A;  2KIS A;  4L9J A;  1X1D A;  5LRR A;  5BOX A;  1T2K A;  2PMZ A;  2Y9Y A;  2IRF G;  3A01 B;  1T08 B;  1O7L A;  2E36 A;  4QTR A;  1ETO A;  3OYH A;  1Y8Q B;  1APL C;  1N75 A;  2EIL H;  5IP9 J;  1HC8 A;  4CUG A;  5CJ9 A;  4KIF A;  5TIS C;  2OF7 A;  1Q1H A;  2Y0M A;  4II3 A;  3GVA A;  5DM7 F;  3N4M A;  2W85 A;  3KP6 A;  5K5R A;  2E7X A;  4AVP A;  4IHS A;  1RKT A;  5DUK A;  3F8M A;  1IJW C;  2DOD A;  1S5L C;  3DEW A;  1X1C A;  3LOC A;  1TLH B;  5IY5 H;  2XGD A;  2JVG A;  3GEZ A;  1W0U A;  3KYD B;  5AON A;  2JQ7 A;  3GTL J;  3SHF A;  3TO6 A;  1KA8 A;  1MJA A;  2O7O A;  3FMQ A;  3JTH A;  3PUB A;  4Y4R A;  3DKY A;  4RB1 A;  1IV6 A;  3DWL E;  4CYC A;  2GOM A;  1Z05 A;  3LMM A;  3MD2 A;  3MKY B;  5LD2 C;  3GTQ J;  4AM3 A;  3IH4 A;  5BNG A;  2P6S A;  2DLL A;  3TP3 A;  2QBY B;  3BP8 A;  3M7G A;  5FLX Z;  2BY0 A;  4MTD A;  3HOX J;  1IO2 A;  3ZMV A;  3ZGK A;  5EDN A;  3S1R J;  1AKH B;  3B02 A;  3S1M J;  5E8I A;  2GA1 A;  4BBR J;  3PJR A;  4IX7 A;  2AS5 F;  1BOB A;  5K1Y A;  4AU7 A;  3ESW B;  3TKY A;  2HNH A;  5E1Z B;  5FFX A;  2M7B A;  1IXC A;  4E7I A;  4ZDP A;  3CJT B;  4JQF A;  1H88 C;  2X4H A;  4G6T B;  2JVH A;  4U0Y A;  3BG7 A;  4F91 B;  2XPU A;  2QYO A;  2TDX A;  3ZQI A;  1SFE A;  5KVR A;  3DBR B;  1FWZ A;  2EA4 A;  2JSC A;  1YQA A;  3H5A A;  4OMY A;  2VKV A;  2WB1 N;  3BQY A;  4Z2Y A;  1EV7 A;  2EFW A;  3BOQ A;  1U9N A;  4MLO A;  4KIS A;  2VLA A;  2B63 J;  4L9N A;  1B8I B;  4LIT A;  2Q0O A;  4UVB A;  3OYC A;  5IOZ A;  3VWB A;  3OOP A;  1T39 A;  1ZAR A;  3TW7 A;  3M4O J;  1PUF B;  3RI4 A;  1VQ9 I;  2HDC A;  1R5G A;  3VYR B;  1VQ8 I;  4K2E A;  2GXG A;  3CC4 I;  4I09 A;  1KU2 A;  4A3K J;  2NS8 A;  4F92 B;  1R6R A;  2QUF A;  2XSJ C;  3I4P A;  2PLY A;  1OYI A;  1POG A;  3I59 A;  4M3F A;  3NRV A;  2Z1D A;  1K7A A;  3CCE I;  4NDL A;  1J75 A;  3QYB A;  1Y56 A;  3CC7 I;  2LKS A;  1WJA A;  2ZFU A;  3MQ0 A;  4I99 C;  3O8G A;  1TQM A;  5ILU A;  1UHM A;  1KYW A;  2YS9 A;  1SVO A;  2DDB A;  1JJ6 C;  3CO7 C;  4IO9 F;  3BR6 A;  4XNF A;  3M3Y J;  1WHU A;  3RKX A;  4FX4 A;  1WQ2 A;  2EFN A;  4L0Z B;  3WTY C;  4CDG A;  1LQ1 A;  2W25 A;  1IN8 A;  3AG1 H;  4OAY A;  2QSH X;  4B09 A;  1TW2 A;  2K40 A;  5B5E C;  4KIC A;  3DEU A;  3RJP A;  1XGM A;  1U78 A;  1Y1V J;  2FUG 2;  1U6G A;  3GZN B;  4MIM A;  3CCU I;  1ERD A;  3HGY A;  4KIB A;  3ZR8 X;  1G2H A;  3ABM H;  1LNW A;  4D9J A;  1TNT A;  5EG0 A;  3OL3 A;  4CCN A;  4LK0 F;  4AIH A;  5IPA A;  2V1X A;  1F43 A;  5ED4 A;  1UHW A;  4BH9 A;  3S93 A;  1E17 A;  5L3F A;  1D1C A;  2XF7 A;  4B8X A;  4E7J A;  3H36 A;  4NC8 A;  4AIK A;  1T98 A;  3JSP A;  3HOY J;  1N77 A;  3S1N J;  2Y31 A;  1S6L A;  3MZH A;  3FMS A;  3UNG C;  1PP8 F;  2GQQ A;  3T1B A;  4XKV A;  2XRL A;  3H3U A;  4XLP F;  2DT7 B;  1G3T A;  2H27 A;  1FYM A;  2BOL A;  3BG3 A;  2BZT A;  1XDU A;  3LA2 A;  1GXQ A;  4ESB A;  3FHZ A;  4F3Q A;  1WJF A;  1T0F A;  3CLO A;  2V7F A;  3IAS 2;  4MQV A;  3TDZ C;  5BS6 A;  1NH3 A;  2XPW A;  1DP3 A;  4DJA A;  1JKP C;  5HLG A;  3NQO A;  3PFI A;  2L54 A;  5EJC A;  3C18 A;  3RKY A;  3RZD J;  1UG0 A;  2HXO A;  3ZN0 A;  3BC8 A;  1ZYR F;  3NWS A;  2JK3 A;  4ZDL A;  3H92 A;  4HPQ A;  4XKB A;  2EFO A;  4V19 K;  3PL8 A;  3HSR A;  2IXS A;  3GTM J;  2OC6 A;  2DA3 A;  3R4K A;  2E19 A;  2LF7 A;  1OFC X;  4ETS A;  3HTS B;  1R4M B;  5L3E A;  3E6C C;  4LB6 B;  1JTY A;  1ZN2 A;  1Y39 A;  2XRN A;  3BRO A;  3QU6 A;  5J1Y A;  2LD5 A;  4XID A;  2CW7 A;  3OYN A;  4C9Y A;  1FBQ A;  2R7F A;  3MCZ A;  2LSO A;  5CVI A;  4IQJ A;  2HU9 A;  2RGV A;  3S1Q J;  5HS9 A;  3F8C A;  4A3L J;  1KGS A;  1I39 A;  3CC2 I;  1KQ9 A;  1BI1 A;  5LGU A;  4BEH B;  1I3A A;  1V4R A;  3CF5 F;  4LOC A;  4HNT A;  1TWG J;  3DBL B;  3LQR A;  1S72 I;  5HS7 A;  3ZCO A;  1ZG5 A;  4IL6 C;  3J7A Y;  2KDO A;  4PJJ A;  2DA7 A;  4HX4 A;  4KA4 A;  2XGE A;  5LBQ A;  3R61 A;  3Q9S A;  4FTH A;  2CRG A;  2H6C A;  4IVN A;  1BI3 A;  2ID6 A;  3D0S A;  1LDJ A;  4ITV A;  1ZRD A;  2R7Q A;  2FE3 A;  5H2F C;  4G7H F;  3S3M A;  2XGC A;  2CU7 A;  3HBL A;  1IUF A;  2M0C A;  4RLQ A;  2K4J A;  4R8H A;  2UWM A;  2WV1 A;  5GP9 A;  2V9P A;  5F08 A;  1X1A A;  4KIT B;  2HQN A;  2WA0 A;  4NHJ A;  2PX9 A;  4HV6 A;  5F64 A;  1FC3 A;  4EJO A;  4ZDO A;  2KFD A;  3T8T A;  1OCZ H;  4UNO A;  4RM2 A;  3K4L A;  5GAE J;  2LY1 A;  2QEN A;  3RPU D;  3V8L A;  2A6H F;  1Q1V A;  4DBR A;  4XSZ F;  4BS9 A;  1T38 A;  1X19 A;  2OAZ A;  3W2A A;  4BE2 A;  3J80 Z;  3CCV I;  5J8C A;  4WCG A;  5HDN A;  3GZ5 A;  1FBS A;  5CLS A;  2XAS A;  1RR8 C;  2CG4 A;  3I71 A;  1F1Z A;  5ICG A;  1MJ9 A;  1SFO J;  4A3E J;  4YFN F;  1ZG3 A;  1YG2 A;  4M73 A;  1T8I A;  1MSF C;  4ABZ A;  3OYA A;  2DBB A;  3BTC A;  5KCM A;  2FF4 A;  1RIO H;  1A5J A;  2HOS A;  1EA3 A;  3KLO A;  4XQF A;  3ABT A;  3BR2 A;  2AO9 A;  2DMN A;  5E79 C;  1Z91 A;  1X4O A;  2EWN A;  2E1C A;  4E70 A;  2LKX A;  2O8X A;  3CCY A;  2BW3 B;  3GW2 A;  3FK6 A;  3S8P A;  4C2U A;  3JSO A;  4CHU A;  1GHC A;  1STZ A;  1WH7 A;  3OYE A;  2DA1 A;  2DQL A;  2W4S A;  3EYI A;  2F5E A;  3EQL F;  3SDB A;  3OS0 A;  5DS9 A;  3S14 J;  1IUY A;  3ZQF A;  1GXP A;  4UB6 C;  3SXY A;  5B66 C;  2R7S A;  3AKZ A;  3K70 C;  1TQI A;  3KFW X;  1ZRF A;  2HDW A;  2XAG A;  4BYY A;  5A2Q K;  1ZLJ A;  4LG0 A;  2BHY A;  5HNF A;  5DUI A;  2DOF A;  2OJE D;  3RPU A;  2EIK H;  5GAG J;  3QPS A;  3WU1 B;  1XS9 A;  1ON1 A;  1YS7 A;  2YUS A;  3F8B A;  4G9Y A;  4Z6Y A;  3WTT C;  2F4I A;  3MN2 A;  4J00 A;  2ZXI A;  2R7Z J;  4OIP F;  1K78 A;  2QKM B;  2DAO A;  1BBY A;  2LTP A;  4GCV A;  5H20 A;  4M9X A;  2PQ8 A;  4P9U A;  3S16 J;  1FY7 A;  4RGS A;  1ZRC A;  3I4M J;  2JRT A;  1BC8 C;  3S2D J;  1QA6 A;  4U87 A;  2NS0 A;  3ZQG A; 
#chains in the Genus database with same CATH homology
 2KIM A;  1USS A;  5DD8 A;  1K79 A;  1OYY A;  3E6D A;  4EQQ A;  1PP7 U;  4M72 A;  1O57 A;  1YO5 C;  2CYY A;  4MNU A;  1YTY A;  4HDU A;  1AOY A;  1RUN A;  3PQK A;  1R1T A;  4MHG A;  3ROU A;  1D8K A;  3BY6 A;  4IRH A;  3F22 A;  1HKQ A;  4LD5 A;  4XRF A;  1OKR A;  1BOA A;  2YX7 A;  3HOT A;  1EH8 A;  1FSH A;  4D0P A;  1Z6T A;  4EJV A;  2JTV A;  3LAJ A;  4G7O F;  3QP6 A;  3ZN1 A;  4XBF A;  2HYG D;  5D5V B;  4U7D A;  4M6Y A;  2OBP A;  1XCV A;  1IRF A;  3E6M A;  2FNP A;  1W7P B;  4P96 A;  1P2F A;  2RDP A;  3J81 Z;  4EJT A;  5EEG A;  2NYX A;  2EB7 A;  2PMH A;  4A5N A;  3E5X A;  2A69 F;  2ESN A;  1D8J A;  1ODD A;  3MEX A;  4O3M A;  3JAM Z;  4EM2 A;  2XAJ A;  2MLK A;  3RKW A;  2OA4 A;  4HF2 A;  5ICE A;  1XSX A;  5D8L B;  2OZ6 A;  2PJP A;  1XDS A;  5FD5 A;  4ENN A;  2NRA C;  4MTE A;  2Z9O A;  3S2W A;  4EGY A;  1P92 A;  5E18 F;  2F5F A;  2FQ3 A;  1QZY A;  5F1R A;  5HS8 A;  1TBX A;  3PQJ A;  3W6K B;  1SD4 A;  2ZFW A;  2PBI A;  3GFI A;  4BAY A;  1B9M A;  3C3W A;  2UXX A;  1R5H A;  4A2U A;  2QM3 A;  5HVQ C;  3ZP5 A;  3GUD A;  5IT9 K;  1S3J A;  1K6O A;  4HBL A;  3E6B A;  4H0E A;  5L3D A;  3P7N A;  2V79 A;  3FXQ A;  2F5D A;  1R7J A;  1CF7 A;  1IF1 A;  3O2P E;  4MEY F;  4IF4 A;  3QP5 A;  3T0Y A;  1O3R A;  4UVA A;  3BJO A;  1YLF A;  1R1V A;  2MLG A;  4L5I A;  4P5O A;  4Q5S F;  3WE3 A;  3LA3 A;  1ZG1 A;  2J5P A;  2P7V B;  1XD7 A;  2G7H A;  3Q9V A;  3WTV C;  1LJ9 A;  1J0R A;  4MGR A;  5KK1 A;  3G73 A;  4A0Y A;  1XGS A;  2PG4 A;  2ISY A;  4HA8 A;  1O3S A;  5E8G A;  2ZME A;  2ZJ2 A;  3VEP A;  4IJA A;  3WGI A;  2WV0 A;  4BXU A;  3CUQ C;  1RUO A;  5J8F A;  2DTR A;  4KN4 X;  3ZMU A;  2QQA A;  2Z33 A;  3T5X A;  2B0L A;  4G6D A;  1I1G A;  3IWZ A;  3IWF A;  4L0Y B;  5AIQ A;  4YG2 F;  3HHH A;  4RGX A;  2VOO A;  1HKT A;  1XCB A;  1FP2 A;  1U5T C;  5DDG A;  3ABU A;  3CTA A;  1BJA A;  4PZJ A;  3TOA A;  3ERE D;  3LWF A;  1U2W A;  1BC7 C;  2K4B A;  1IN7 A;  4EMS A;  2L02 A;  2QBY A;  4ENM A;  1W5S A;  1XGO A;  3FWE A;  2O61 A;  1XB4 A;  3H3Z A;  1YFH A;  5D4R A;  4M9Z A;  2A3S A;  2PN6 A;  1HW1 A;  4EJU A;  4G6Q A;  4MEX F;  2A5Y B;  2Q8K A;  3MAJ A;  4PGH A;  2HEO A;  1MGT A;  2NNN A;  1KQ8 A;  2MD5 A;  3FX3 A;  5IT3 A;  3DQV C;  4G8X A;  2EV6 A;  4I98 B;  4I02 A;  2HR3 A;  2IW5 A;  2YX4 A;  2ISZ A;  5DYM A;  3BJA A;  1RI7 A;  4CGZ A;  3E5U A;  5CVR A;  3IC7 A;  2FML A;  1FYL A;  2VC0 A;  3BPV A;  2VBZ A;  4OIN F;  4CIC A;  4IPA A;  1HQC A;  4LLG F;  3VOD A;  5HDK A;  5L3C A;  5FFZ A;  3I0T A;  3F21 A;  5D6F A;  4ENK A;  4M6X A;  2EJR A;  3WE2 A;  1I27 A;  5DCM B;  4RS8 A;  1O7F A;  4ENJ A;  2Z3Y A;  2FEZ A;  3ZMZ A;  4L9V A;  4HQE A;  2ETH A;  5DEQ A;  2LF8 A;  3CUQ B;  3FXU A;  3WTW C;  4GGG A;  2P5L C;  2P5V A;  3QPH A;  4KUM A;  4LK1 F;  1FYK A;  3R0J A;  3I58 A;  3F3X A;  4KT5 C;  2OD5 A;  5L3G A;  2HYF A;  2FNA A;  3W6J B;  3RDI A;  1A04 A;  3K69 A;  1IZ1 A;  5D4S A;  3JW4 A;  5D8K B;  1U5T B;  5LHG A;  4GYI A;  5ERI A;  2CO5 A;  2ZBK A;  2CQK A;  1DUX C;  3ZMD A;  3HRT A;  3GWZ A;  4Q4Z F;  5DCF A;  2XKO A;  2CW0 F;  2VON A;  3L9F A;  4G7Z F;  4OIQ F;  2Z5U A;  3MWM A;  4WXC A;  3GFM A;  3GO5 A;  4JBA A;  3F23 A;  3V8J A;  1JE8 A;  1VTN C;  2JPB A;  2DI3 A;  3WTZ A;  1PUE E;  5LEJ A;  1MDM B;  5BMZ A;  1YYV A;  4Y15 A;  5CVJ A;  5FO5 A;  5JI6 A;  3R0A A;  4U7B A;  2XRO A;  1IN5 A;  3HYI A;  4WK8 F;  2XAF A;  3R60 A;  2MC3 A;  4TV7 A;  2ZXJ A;  2O6G E;  2G7U A;  1FLI A;  3L09 A;  4AIJ A;  3E3V A;  5LHI A;  2VN2 A;  3MFK A;  4I7H A;  2JPC A;  2DU9 A;  2RV8 A;  2YSR A;  2XVC A;  1KU7 A;  1RZ4 A;  3K1P A;  2HWV A;  2QWW A;  2BEO A;  4ZZL A;  3R6S A;  2JT1 A;  1J7K A;  1I5Z A;  3KP2 A;  4IXA A;  4A6D A;  3FMR A;  3DFG A;  2M5W A;  3K9T A;  1HW2 A;  4GO1 A;  1TNS A;  2J5O A;  3CUO A;  2WC2 A;  4YFK F;  4M71 A;  5E20 A;  2EFQ A;  4U0V A;  1QBJ A;  2L4M A;  2L01 A;  2FOK A;  1ZHF A;  3KZZ A;  1HXD A;  4RB2 C;  3FF5 A;  4RGU A;  4I2O A;  4LLL A;  2EA2 A;  2BBY A;  3B73 A;  1GVJ A;  5BQT A;  3IKT A;  2K02 A;  4U0W A;  3ELK A;  1P4X A;  3SZP A;  4LLN A;  4F7Z A;  4IRI A;  1TW3 A;  4BNC A;  5DV5 A;  4ZYD A;  5ILS A;  4WF2 A;  3BWG A;  2O0Y A;  4FHT A;  2DPU A;  2IT0 A;  2CGP A;  1KU9 A;  1FNN A;  2IPQ X;  1W7P D;  4HX8 A;  2STW A;  1V3F A;  1QZZ A;  4AWX B;  1H9T A;  2H09 A;  2HQR A;  5E1W A;  1F5T A;  4A0X A;  1DPR A;  1FZP B;  1B9N A;  3KCC A;  3DXJ F;  2XAQ A;  3TO9 A;  3DPT A;  2CWE A;  2VBX A;  1B1B A;  1J2X A;  1ZH5 A;  4HX7 A;  4U88 A;  4ZYE A;  4JK1 X;  5BPI A;  4HLY A;  2RNJ A;  2FBK A;  4LB5 A;  3GFJ A;  3FM3 A;  1FX7 A;  3TO7 A;  1YW8 A;  1T6S A;  4YII A;  1DP7 P;  1G3S A;  1RNL A;  3VB2 A;  2QVO A;  3OV8 A;  1BIB A;  3F72 A;  1B59 A;  1YIO A;  2DQR A;  1W7P A;  2BE5 F;  2C6Y A;  5E17 F;  3WTU C;  5LLQ A;  2CFX A;  1S7A A;  4RB3 C;  5D6E A;  1C0W A;  1IW7 F;  1D5V A;  3M1E A;  2GAU A;  3JTG A;  4ASN A;  4HF0 A;  4P9F A;  5FGM A;  1LDK B;  2BV6 A;  2VBY A;  3GYH X;  1S29 A;  2WTE A;  4RAZ A;  2GIV A;  2XUB A;  1JHH A;  3WGH A;  1H0M A;  1CGP A;  1REP C;  3ZPL A;  2XGX A;  2STT A;  1IXR C;  4PCQ A;  5JFR A;  1ULY A;  2MBF A;  4OOI A;  2YPR A;  5EEH A;  3DKW A;  2D2W A;  1EH6 A;  4L18 B;  3I5U A;  1W5T A;  2AXL A;  4S04 A;  4EJW A;  1OPC A;  1UB9 A;  2GWR A;  2M45 A;  4OU0 A;  2EV5 A;  2PEX A;  1XSD A;  2VBW A;  5D5U B;  3WTS C;  2DK5 A;  2QQ9 A;  4WXH A;  5HDG A;  2WWY A;  2FRH A;  4Q47 A;  3LQQ A;  3REO A;  3KET A;  2DW4 A;  1XN7 A;  4HLX A;  1FBU A;  3HOS A;  2FMY A;  1J59 A;  4OIR F;  1I1S A;  3CJN A;  1ZGJ A;  4NB5 A;  4ESJ A;  2D45 A;  2FBH A;  2A07 F;  4Y17 A;  2OQR A;  2XKP A;  1Z7U A;  2KJC A;  1R23 A;  3QOP A;  3EET A;  4ZYG A;  5JHU A;  2HGC A;  3BDD A;  1O3T A;  2L3D A;  4HYE A;  2QLZ A;  1FP1 D;  1XGN A;  5D5W B;  4I0A A;  5E1X A;  4QLC U;  1HKS A;  5HLI A;  2O3F A;  2K7L A;  5HOO A;  2OZU A;  2BGC A;  4YIF A;  1DPU A;  2ESH A;  1SFX A;  4I0B A;  4HDV A;  5JVT A;  1R22 A;  3WGG A;  3WOD F;  3HUG A;  1IN4 A;  1QNT A;  2W24 A;  2D1H A;  4WX9 A;  3L2C A;  4KYW A;  4GXO A;  1WI9 A;  2IA0 A;  4ON0 A;  4Y13 A;  3L7W A;  2KIF A;  1SD5 A;  5FLX K;  3EDP A;  1R00 A;  3KEO A;  1ZRE A;  3M8F A;  2A68 F;  1SD6 A;  1UFM A;  1NHA A;  5H6Q A;  3FZV A;  3GZ6 A;  3F6O A;  4S05 A;  1MD0 A;  2V1D A;  3ZMS A;  1G4D A;  2P8T A;  4EVI A;  3C1D A;  3KP4 A;  1L0O C;  3LST A;  4N9H A;  4RB0 A;  5LGT A;  2PI0 A;  1ONV A;  4ZYH A;  4M74 A;  1LEB A;  1FSE A;  2Z99 A;  4M9S A;  4L5J A;  4DQ2 A;  4KN7 X;  1OMI A;  3I53 A;  3K1M A;  4A12 A;  4KDP A;  2HKX A;  3L00 A;  4A5M A;  5DCM A;  1H9G A;  2XV4 S;  3WG9 A;  1D3Y A;  3RPQ A;  4CZZ A;  3V4G A;  2D1V A;  1DDN A;  1XSV A;  1SMY F;  1YS6 A;  3I54 A;  2OU2 A;  1X3U A;  2V9V A;  4UV9 A;  3ECO A;  3CUQ A;  2GZW A;  3ISP A;  2BYV E;  3V8K A;  3HTU A;  1ZAO A;  2CSO A;  4CYD A;  2IA1 A;  2HZT A;  1Z6R A;  4LMY A;  1HW5 A;  1E2X A;  4I01 A;  4LFU A;  1LVA A;  2IJL A;  1R58 A;  1YW9 A;  5CVU A;  4P55 A;  1B4A A;  4GYG A;  2FBI A;  3K1N A;  4CO8 A;  4CXF A;  3M8E A;  3BZ6 A;  4UUV A;  2LDU A;  4N0B A;  4UV8 A;  3DPL C;  1U5T A;  3N97 A;  1SD7 A;  3IRR A;  2UXN A;  3O3K A;  4O6J A;  1HBX G;  2QZ8 A;  1BI2 A;  1Z9C A;  2DPD A;  2XIG A;  4DNC A;  2RVC A;  2VT2 A;  4WXD A;  4ZZD A;  1BN5 A;  2PMU A;  4IHT A;  3C7J A;  1S8N A;  2ZNY A;  2ZNZ A;  3KP5 A;  3ZMT A;  4UXN A;  1Z1D A;  3F8F A;  1Y0U A;  2HFH A;  3I59 B;  3LAP A;  3QU3 A;  3LFK A;  2VE9 A;  1MDM A;  2RC4 A;  2VE8 A;  3KZY A;  5CVV A;  1IRG A;  5FB2 A;  3VOE A;  2EK5 A;  2O03 A;  4HQM A;  5TRD A;  2FSW A;  1JGS A;  3TGN A;  1FT9 A;  3VFZ A;  4ZH4 F;  1BI0 A;  5F6F A;  2HTJ A;  3V7R A;  1KYZ A;  2R7D A;  1LEA A;  3RYP A;  3U2R A;  5K5Q A;  2MH2 A;  5LRS A;  4IRG A;  1P6R A;  1B6A A;  1FOK A;  2ADU A;  5CYV A;  4R79 A;  3ECH A;  2DO7 A;  3COA C;  3O6B B;  3D5L A;  3J80 K;  3HSF A;  2F2E A;  4NQW A;  4EGZ A;  2P6T A;  3HRM A;  3QAH A;  1ON2 A;  3J7A O;  2P5K A;  3EUH A;  3FM5 A;  4G94 A;  2MA3 A;  4UHT A;  2XHK A;  1O3Q A;  3SQN A;  1J9I A;  4KMF A;  1WRJ A;  2M30 A;  3KEQ A;  3E97 A;  1MZB A;  1IXS B;  2DFI A;  2KJB A;  3KP7 A;  5AIP A;  2H94 A;  4Q48 A;  3V7C A;  2E7W A;  1MKM A;  2E1N A;  3FXR A;  1ZGA A;  3HRU A;  2G9W A;  1QGP A;  2Y48 A;  1BM9 A;  1G6N A;  3SZT A;  2VT3 A;  2OQG A;  4HOB A;  2PFB A;  2GA2 A;  3WTX C;  1UCR A;  1MJB A;  3F8N A;  3GLX A;  3F6V A;  4LGW A;  5HLH A;  3P9C A;  5DD4 A;  3HSE A;  4EV0 A;  2W84 A;  4OMZ A;  1KU3 A;  2LKP A;  4PDK A;  4O5V A;  3V7S A;  2M87 A;  4UVC A;  4FT8 A;  4MQ9 F;  2W57 A;  4KFC A;  3T8R A;  4HF1 A;  2Q2E A;  2ZCW A;  3ULQ B;  4YFX F;  2COM A;  3CDH A;  5A2Q Z;  1WSU A;  4HV5 A;  3M9A A;  4KIG A;  2LNB A;  1LB2 A;  2EV0 A;  4KNY A;  4LG0 B;  3U9G A;  4HW0 A;  2M1B A;  3GXO A;  4A0Z A;  3KP3 A;  6PAX A;  1P4A A;  1LDD A;  3K2Z A;  1R1U A;  4XLN F;  3GF2 A;  1K78 B;  2XAH A;  3K0L A;  2H6B A;  2X0L A;  2P4W A;  3GFL A;  1G3W A;  2FU4 A;  1QO0 D;  2MH9 A;  2P7C B;  2HOE A;  5ICF A;  3HRS A;  3J81 K;  4PGG A;  1EH7 A;  3TDU C;  5LEK A;  3SFZ A;  3TOB A;  1F4K A;  1BIA A;  2VC1 A;  2KRF A;  4QWQ A;  4BHP A;  1TQP A;  2KKO A;  3JAM K;  3QPT A;  4HAM A;  5H6R A;  3NEU A;  4BHB A;  1AWC A;  1S7O A;  1ZLK A;  4WWC A;  1U3E M;  1R36 A;  3BPX A;  1HST A;  2L4A A;  3Q5F A;  4ESF A;  4XSX F;  5L3B A;  3G3Z A;  1YW7 A;  3BJ6 A;  2QQB A;  4N9I A;  4EM1 A;  2NNY A;  3ZQ7 A;  3EYY A;  3TQN A;  1F9N A;  2YU3 A;  3DV8 A;  2UZK A;  3QRF F;  4AD9 A;  2GXB A;  2RQP A;  2DK8 A;  2K86 A;  2ZO4 A;  3HHG A;  2JZY A;  4BQA A;  5FD6 A;  1J5Y A;  1G3Y A;  3KLN A;  2Y75 A;  3LA7 A;  2FA5 A;  2VOP A;  5D5X B;  1P4W A;  1XMK A;  5K5O A;  4OIO F;  2A61 A;  2HTS A;  2HKO A;  2V6C A;  2F5C A;  4FX0 A;  1FPQ A;  3WU0 A;  1XMA A;  2HS5 A;  4BHC A;  1UST A;  2IA2 A;  4HZF A;  3IHU A;  3IRQ A;  1SMT A;  4RGR A;  3P9K A;  2YR2 A;  5ILV A;  3CO6 C;  2NAZ A;  1I6X A;  5JR3 A;  3RYR A;  3DP7 A;  2RKH A;  5IT9 Z;  4R1H A;  2IVM A;  2FXA A;  1IN6 A;  3IKV A;  1JHF A;  2ELH A;  3HIF A;  5TJJ A;  1TTY A;  4RAY A;  2R3S A;  1PDN C;  2RN7 A;  2ACJ A;  5J6X A;  1CF7 B;  1OR7 A;  3E5Q A;  3P9I A;  2VOD A;  1OYW A;  3IL2 A;  1W4M A;  1IAW A;  2K27 A;  2DT5 A;  4LJZ F;  3DF8 A;  2KIU A;  4KMU X;  2IP2 A;  3ML6 A;  3AAF A;  3RTR A;  1HSJ A;  1U8R A;  2VXZ A;  1QQI A;  3MZY A;  4EM0 B;  5ICC A;  5BPD A;  1L3L A;  3I64 A;  2M8E A;  4L9T A;  3RIR A;  2ZME B;  5LHH A;  3U1D A;  1WWX A;  2A6E F;  3GX4 X;  5LGN A;  1SFU A;  1WKM A;  1SAX A;  2EFP A;  2V1U A;  1QPM A;  2ZKZ A;  3KE2 A;  1KQ0 A;  4A6E A;  5BOX A;  4L9J A;  5LRR A;  1T2K A;  2IRF G;  1O7L A;  5CJ9 A;  4KIF A;  1Q1H A;  2Y0M A;  3GVA A;  3N4M A;  2W85 A;  3KP6 A;  5K5R A;  2E7X A;  4AVP A;  4IHS A;  5DUK A;  3F8M A;  1TLH B;  3GEZ A;  5AON A;  3SHF A;  3TO6 A;  1KA8 A;  1MJA A;  3FMQ A;  3JTH A;  4RB1 A;  1Z05 A;  2P6S A;  2DLL A;  2QBY B;  3BP8 A;  3M7G A;  5FLX Z;  4MTD A;  3ZMV A;  3B02 A;  5E8I A;  2GA1 A;  2AS5 F;  5K1Y A;  3TKY A;  5E1Z B;  5FFX A;  1IXC A;  4JQF A;  2X4H A;  4U0Y A;  2QYO A;  2TDX A;  1SFE A;  5KVR A;  1FWZ A;  2EA4 A;  2JSC A;  1YQA A;  4OMY A;  2EFW A;  4Z2Y A;  1EV7 A;  3BOQ A;  4L9N A;  2Q0O A;  4UVB A;  3OOP A;  1T39 A;  1ZAR A;  3RI4 A;  2HDC A;  1R5G A;  4K2E A;  2GXG A;  4I09 A;  1KU2 A;  2QUF A;  3I4P A;  2PLY A;  1OYI A;  3I59 A;  3NRV A;  1K7A A;  1J75 A;  3MQ0 A;  1TQM A;  5ILU A;  1UHM A;  1KYW A;  3CO7 C;  3RKX A;  4FX4 A;  1WQ2 A;  2EFN A;  4L0Z B;  3WTY C;  4CDG A;  1LQ1 A;  2W25 A;  1IN8 A;  4B09 A;  1TW2 A;  4KIC A;  3DEU A;  3RJP A;  1XGM A;  1U78 A;  1U6G A;  4KIB A;  1LNW A;  1TNT A;  4LK0 F;  4AIH A;  2V1X A;  5ED4 A;  1UHW A;  4BH9 A;  1E17 A;  5L3F A;  4B8X A;  4AIK A;  1T98 A;  3JSP A;  1S6L A;  3MZH A;  3FMS A;  1PP8 F;  2GQQ A;  3T1B A;  3H3U A;  4XLP F;  1G3T A;  2H27 A;  1FYM A;  3LA2 A;  1XDU A;  4ESB A;  1GXQ A;  3FHZ A;  1JXS A;  4MQV A;  1T0F A;  3CLO A;  5BS6 A;  3TDZ C;  5HLG A;  3NQO A;  3PFI A;  2L54 A;  3RKY A;  3C18 A;  3ZN0 A;  1ZYR F;  3H92 A;  2EFO A;  3HSR A;  3R4K A;  2LF7 A;  4ETS A;  3HTS B;  5L3E A;  3E6C C;  4LB6 B;  1ZN2 A;  2XRN A;  3BRO A;  3QU6 A;  1FBQ A;  2R7F A;  3MCZ A;  2LSO A;  5CVI A;  2RGV A;  5HS9 A;  3F8C A;  1KGS A;  1KQ9 A;  1BI1 A;  5LGU A;  1V4R A;  3LQR A;  5HS7 A;  1ZG5 A;  4HX4 A;  4KA4 A;  5LBQ A;  3R61 A;  3Q9S A;  2H6C A;  4IVN A;  1BI3 A;  3D0S A;  1LDJ A;  1ZRD A;  2FE3 A;  4G7H F;  2K4J A;  4R8H A;  2UWM A;  2HQN A;  4NHJ A;  5F64 A;  4HV6 A;  4EJO A;  1FC3 A;  3T8T A;  4UNO A;  3V8L A;  2QEN A;  2A6H F;  4XSZ F;  1T38 A;  2OAZ A;  3J80 Z;  5J8C A;  4WCG A;  5HDN A;  3GZ5 A;  1FBS A;  5CLS A;  2XAS A;  2CG4 A;  3I71 A;  1F1Z A;  5ICG A;  1MJ9 A;  4YFN F;  1ZG3 A;  1YG2 A;  4M73 A;  2DBB A;  2FF4 A;  1RIO H;  3KLO A;  3ABT A;  1Z91 A;  2EWN A;  2E1C A;  4E70 A;  2O8X A;  3GW2 A;  3JSO A;  4CHU A;  1GHC A;  1STZ A;  2DQL A;  3EYI A;  2F5E A;  3EQL F;  1IUY A;  1GXP A;  3SXY A;  1TQI A;  3KFW X;  1ZRF A;  2XAG A;  4BYY A;  5A2Q K;  1ZLJ A;  4LG0 A;  5DUI A;  3RPU A;  3WU1 B;  1ON1 A;  1YS7 A;  3F8B A;  4G9Y A;  3WTT C;  4OIP F;  1K78 A;  2DAO A;  1BBY A;  4GCV A;  5H20 A;  4M9X A;  2PQ8 A;  4P9U A;  1FY7 A;  4RGS A;  1ZRC A;  2JRT A;  1BC8 C;  2NS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...