1BC8C

Structures of sap-1 bound to dna sequences from the e74 and c-fos promoters provide insights into how ets proteins discriminate between related dna targets
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
b'MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*CP*GP*GP*AP*AP*GP*T)-3')
publication title Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 25
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bc8C00
4PCQA 1XGOA 2FE3A 2L4AA 3I4PA 4HDUA 2Q2EA 4A5MA 5D6EA 3F21A 1FBQA 2EA4A 2DPUA 1S29A 2EV0A 2ZFWA 2XAFA 1SMYF 1K78B 1KQ8A 4FX4A 4PZJA 2VXZA 1SD6A 2OQRA 1IAWA 2DT5A 4LJZF 2QLZA 2Z99A 1F9NA 4L9NA 2GAUA 4H0EA 4QLCU 2HS5A 1T2KA 2Y48A 1GVJA 4R8HA 3MWMA 3BOQA 3TO7A 3T5XA 3QP6A 2VBZA 1G3TA 2QBYA 5DCMA 2HDCA 5BMZA 2GWRA 1RUOA 1R1UA 2KJBA 2PMHA 1ULYA 4P5OA 2HGCA 2OZ6A 4ZYDA 3CUOA 5LRSA 4K2EA 4LGWA 2V1XA 5KK1A 1MD0A 3BJAA 2EV5A 3U2RA 4L5IA 1IN8A 1WQ2A 1JHHA 2F2EA 4IHSA 4WXCA 1F5TA 1R36A 4I98B 4WK8F 2VE8A 2GXGA 2MLKA 2PN6A 3SZPA 3HSEA 4M9XA 2YX7A 3K0LA 5ILSA 3GO5A 3E6BA 2QUFA 2D1HA 1ZN2A 2EJRA 1XSXA 4A5NA 2D2WA 3KP4A 3K69A 1FT9A 2GZWA 2EFOA 2YPRA 1RNLA 3WU0A 2ZNZA 1IN7A 4MTDA 2YU3A 3E6DA 3MFKA 1EH8A 5ICGA 3BP8A 3RYRA 5BS6A 1S7OA 1LDKB 2GQQA 4UVAA 2L02A 3N4MA 3S2WA 1SD5A 4PGHA 3L2CA 3M8EA 4LB5A 3IKTA 4R1HA 2DLLA 3K1PA 4B09A 2XROA 1PUEE 2ZKZA 5LRRA 3KFWX 1DP7P 3KP7A 4IRIA 3F72A 4RGSA 1MJAA 3FX3A 4ETSA 2ACJA 3V7RA 2FMLA 1PDNC 3WTUC 1T38A 1UB9A 2IJLA 4HBLA 2V1DA 4LG0A 3IRRA 2JPBA 1XDUA 4N0BA 3WGHA 1MJBA 1C0WA 1X3UA 3QRFF 2HWVA 4I0AA 4AD9A 1ZLJA 1LVAA 3F22A 3BJOA 1LDDA 3B73A 2YX4A 4L9VA 3TO6A 2FRHA 2XAQA 1HBXG 4HF1A 2H6CA 2JPCA 1BI0A 3GFLA 2X4HA 2YR2A 5ED4A 3MAJA 1UCRA 4M71A 2LF7A 3F3XA 2BE5F 5LEKA 1TW3A 2ZO4A 1S7AA 3O2PE 4A6DA 4EMSA 2ISZA 2ZNYA 4IXAA 1W5TA 4G7OF 2V79A 1TW2A 2XVCA 4KUMA 3O3KA 3KE2A 1XB4A 1HQCA 3ZN1A 2PQ8A 1EH7A 4CO8A 3K1MA 1Z91A 1JGSA 1IUYA 4HV5A 4EM1A 4LMYA 3V8JA 2DBBA 1GXPA 2IA1A 2FBKA 1RZ4A 1E2XA 4Y15A 1BI3A 1LEAA 1YW7A 4GCVA 2P7VB 2OBPA 2Z3YA 1JXSA 1YQAA 2FEZA 4YFKF 3DQVC 3TGNA 2ELHA 5IT9K 5L3GA 2DK8A 3F8MA 1K78A 1IXSB 4OU0A 3WTTC 2A69F 5CJ9A 1O7FA 2ZJ2A 1UFMA 1FX7A 3IC7A 2CYYA 1DPUA 5BPDA 1K7AA 2FA5A 2E7WA 2VODA 3IWFA 1ZRCA 4HX7A 4I09A 2EFNA 4A0YA 1IN6A 2HQNA 1ZG5A 1O57A 3LWFA 1KA8A 4BQAA 3W6KB 1W7PD 2EFQA 4E70A 3GUDA 4HF2A 1LNWA 3E3VA 3WTYC 2DW4A 1ZYRF 4ESBA 3SHFA 3CUQB 1J5YA 5HS7A 4L9TA 2AS5F 1L3LA 3KZYA 3P9IA 1O3SA 5E1XA 1P2FA 4OIOF 4A2UA 4XSXF 5LHIA 5DD8A 6PAXA 1BI2A 2FXAA 2FNPA 1B9NA 1K6OA 3R61A 3R60A 1IRGA 1TQMA 1Z7UA 4IVNA 1S6LA 3ZPLA 5CVIA 3REOA 1I5ZA 3EYYA 1PP7U 1USTA 1TLHB 1O3TA 3HOTA 1ZH5A 5AIPA 2VBXA 1FYLA 5HS9A 3AAFA 2PI0A 4LB6B 1OR7A 1AWCA 2IW5A 1WSUA 3HIFA 1MJ9A 2A68F 2LF8A 2RQPA 3WTXC 3I0TA 5ICCA 1SD7A 5E20A 1HKSA 3FZVA 2PG4A 2MH2A 2FQ3A 3NEUA 2VOPA 1JE8A 2W24A 2RN7A 1TTYA 4LK0F 4RGUA 1XSVA 2LNBA 2P6SA 4UV8A 1YLFA 4G94A 3HSFA 1FP2A 2FU4A 3RPQA 3T0YA 3GFMA 3HRSA 4RB0A 4EJWA 1H9TA 5FLXZ 1KYZA 3DV8A 3BWGA 4KNYA 2P6TA 4KA4A 4KIGA 1Z1DA 2V9VA 4N9HA 5ERIA 4ZZDA 3GEZA 2F5EA 4ZH4F 3VODA 5L3CA 1WRJA 4U7BA 1U3EM 3T8RA 4RB2C 1MGTA 3LAJA 4UHTA 4YFNF 3JTGA 4CHUA 1IN5A 2EFPA 1REPC 1BIBA 2FBIA 2XKPA 3F8NA 2ISYA 1YW9A 4UNOA 4WX9A 2B0LA 4IHTA 3NRVA 1PP8F 1D8JA 2X0LA 2PEXA 3K1NA 2F5DA 5CLSA 1SAXA 1G4DA 3HRUA 3GF2A 1P6RA 4WF2A 4PGGA 5HDKA 1HW2A 1U6GA 3HYIA 4CGZA 1QO0D 1P4WA 3L00A 2A3SA 4HZFA 4L0ZB 3RPUA 5LGTA 3M8FA 3CUQC 2KRFA 3MZYA 2HFHA 5FFZA 1ON1A 4MEXF 5KVRA 2QWWA 3QAHA 1P4XA 3ERED 2YSRA 2RKHA 5J8CA 5CVUA 2O0YA 2L3DA 2OQGA 1T39A 1ZREA 1R1TA 4RAZA 1UHMA 5HLHA 1O3RA 2ZCWA 3VEPA 1B6AA 2UXXA 2O03A 1BC7C 2Q8KA 1ONVA 1R5GA 1RIOH 4Q5SF 1GXQA 2QM3A 1B1BA 1B59A 1FOKA 3QOPA 1QZYA 1RI7A 3JSOA 1ZRDA 4M74A 4I02A 3F8BA 1J7KA 2DFIA 2BBYA 4RB3C 2NYXA 2VBWA 3RKXA 5FLXK 2W84A 5E1ZB 1B4AA 3I54A 2UXNA 2NRAC 2LKPA 1STZA 1D5VA 3E5UA 5ILUA 4HOBA 5HVQC 1U2WA 4RB1A 5F64A 4LK1F 3GW2A 2H94A 3WGIA 3BPVA 3WG9A 3GWZA 2MC3A 3GYHX 3HTUA 3DPLC 3CUQA 4YG2F 1HW5A 5CVRA 3V7CA 2QQAA 1EV7A 4U7DA 3TOBA 2ZMEB 5H6QA 1OYIA 4HQEA 2CQKA 3TKYA 4HQMA 1YG2A 3F6VA 3KEOA 1BI1A 4XLPF 1G3SA 1ZGAA 5DCFA 3FXUA 2VN2A 2VBYA 1QNTA 2FSWA 3IL2A 1E17A 3DXJF 3FWEA 5D4SA 5L3EA 4M6YA 5LEJA 1HW1A 5E8IA 3JAMZ 2R7DA 3E5XA 4BHBA 4KMUX 4WXHA 2O3FA 4ENJA 3TDZC 1XGNA 1ZAOA 3WTZA 3DFGA 3RYPA 4BAYA 1XMAA 3R0JA 1R7JA 2P5VA 2H27A 4P96A 1AOYA 2KJCA 1J9IA 2HKOA 3KEQA 5E18F 3SFZA 3F6OA 2EWNA 3GZ6A 2RNJA 3ML6A 3C1DA 4RAYA 1GHCA 5BPIA 3DPTA 4EM2A 2A07F 2IVMA 2UWMA 3WTSC 2RV8A 1KQ0A 2CW0F 3BZ6A 1P92A 1SD4A 4P9UA 5E17F 4EV0A 1QGPA 3H3UA 2F5CA 1R5HA 3ECOA 5LBQA 3P7NA 4HYEA 4YIFA 3HRMA 1P4AA 1OYWA 1FY7A 4ZYEA 2W85A 2UZKA 4U0WA 4IPAA 5E8GA 1U5TC 5F1RA 1JHFA 3R6SA 4KIBA 1BN5A 5K5QA 1LB2A 1FPQA 3O6BB 4Q4ZF 2TDXA 1W4MA 1OKRA 2WC2A 1T98A 1FBUA 3R4KA 4G6DA 4S04A 3H3ZA 3QPTA 2K02A 4LLLA 5L3BA 4DNCA 1WWXA 3JAMK 4D0PA 3L9FA 4KIFA 1QBJA 2G7UA 5DD4A 3QPHA 2KKOA 2A5YB 1YFHA 2FBHA 3ZMSA 1O3QA 4A6EA 1KU9A 2MH9A 4MQ9F 3V8LA 2OA4A 4CICA 2MD5A 3RJPA 5LGNA 2BEOA 2DQRA 2L01A 4ASNA 3RTRA 2HR3A 4MHGA 2FMYA 4AIKA 5DDGA 2XAGA 3PQJA 2G9WA 1ZARA 1YS7A 4ENKA 2A6HF 4A0XA 2XHKA 4JK1X 5ICEA 3VFZA 3M1EA 5H20A 4UVBA 1FC3A 1OPCA 1YS6A 5LHHA 1YIOA 4NQWA 4PDKA 2EK5A 3FHZA 3ELKA 3ZMDA 1BOAA 3KCCA 1WKMA 3BPXA 1J0RA 1FYMA 3BDDA 2PBIA 5EEHA 2IT0A 5K5OA 2CG4A 2WTEA 5FD5A 3EQLF 4NHJA 3ZP5A 4Z2YA 2NS0A 5LLQA 1FZPB 3T8TA 4KMFA 2DO7A 3RIRA 1KGSA 4G8XA 3QU6A 1CGPA 2DI3A 3LAPA 2IPQX 4OINF 2F5FA 2Z9OA 4CZZA 2M87A 2D45A 3I64A 5DUIA 3HHGA 3BROA 4GYGA 3JSPA 3ISPA 1FNNA 3CLOA 5IT3A 4YFXF 2ZMEA 1TNSA 4XBFA 2ETHA 4HF0A 2ESHA 4A0ZA 3D0SA 2EA2A 4LLGF 1U8RA 1V3FA 1YO5C 2ZXJA 2PJPA 3RKWA 4G7HF 3RDIA 4UVCA 1I1SA 3FM5A 1SFUA 1SFXA 5L3FA 2E7XA 1A04A 3LA2A 4XRFA 3LFKA 3FF5A 3ZN0A 2K27A 2O6GE 2DAOA 5DYMA 3I58A 3TDUC 4M9SA 3JTHA 2PMUA 4L5JA 2HYFA 3PQKA 2HKXA 2GA2A 1ZLKA 4MEYF 2EB7A 2XUBA 2Z33A 1CF7B 3MEXA 2EFWA 3ECHA 1IW7F 1I27A 1R23A 1W7PB 4QWQA 5D8LB 4KYWA 4NB5A 2K4JA 3LA3A 3KETA 3KLOA 3V4GA 5TJJA 1Z6TA 4P55A 2QQBA 5K1YA 3GXOA 1HSTA 2M45A 4A12A 2QENA 3U9GA 4M6XA 2XASA 2STWA 2PFBA 4O6JA 3VB2A 3TOAA 2C6YA 3ULQB 4S05A 2BV6A 3HSRA 4HV6A 1FBSA 5LHGA 2XV4S 5JR3A 1L0OC 5TRDA 1FSEA 3KP6A 3GFIA 3C7JA 4KN4X 2J5PA 3GFJA 4EM0B 3Q9SA 1G6NA 2L54A 2IP2A 1K79A 2Z5UA 3E6MA 2P5KA 2Y0MA 2QQ9A 3U1DA 1TBXA 1DDNA 4U88A 1KU2A 2XIGA 2O8XA 4JBAA 2G7HA 3T1BA 3BY6A 4OIRF 2LDUA 3B02A 3WTWC 3WODF 1OYYA 2P5LC 5HDNA 4FHTA 3SZTA 3FXQA 2JTVA 4EQQA 5DEQA 3PFIA 2VT2A 4G6QA 3ZMVA 3EETA 3LA7A 1Z05A 2Q0OA 1ZRFA 3I5UA 3L09A 4ZZLA 4BYYA 2M1BA 3R0AA 4GXOA 1XGSA 2VC0A 2NAZA 4HAMA 2CGPA 4EJTA 1U5TB 1Y0UA 2JSCA 2K7LA 2W25A 4ZYGA 1TQPA 4UUVA 2XRNA 2QZ8A 4YIIA 4AVPA 3LQRA 2MA3A 5LGUA 2QYOA 5BQTA 1R1VA 4KDPA 5JFRA 5K5RA 2BGCA 3CTAA 2HTSA 4EJUA 1TQIA 2GIVA 3ABTA 3OV8A 4IF4A 2MBFA 3RKYA 3MCZA 3V8KA 1LJ9A 4XSZF 1IF1A 1BIAA 4UV9A 1XN7A 4MGRA 4FX0A 1OMIA 4LD5A 4MTEA 4AWXB 4GGGA 5D5WB 4FT8A 1U78A 3MZHA 4I01A 2NNYA 3K2ZA 4ZYHA 2Y75A 4EJVA 3Q5FA 4XLNF 2E1NA 1NHAA 3TQNA 1HKTA 1D3YA 2OZUA 4M9ZA 3I59B 4LLNA 2HEOA 3E6CC 5E1WA 1G3YA 4F7ZA 5FFXA 1KU3A 1UHWA 1QQIA 1RUNA 3MQ0A 1IN4A 3HRTA 1IZ1A 1YYVA 1BM9A 3QP5A 1XSDA 3WTVC 5FO5A 1ZGJA 4IRGA 2O61A 4MNUA 2M30A 4HLYA 1MDMB 4KICA 3QU3A 4OIQF 1R58A 1IXRC 3M7GA 1CF7A 1EH6A 2HTJA 3I71A 2P7CB 1MKMA 1LDJA 4CDGA 3KLNA 4IJAA 1W7PA 3RI4A 3OOPA 2IA0A 2FOKA 2VC1A 4B8XA 5IT9Z 1SMTA 1FLIA 1ON2A 4I0BA 1S3JA 3ROUA 3V7SA 3CO7C 4Y17A 5AIQA 1F1ZA 1V4RA 5FGMA 1O7LA 1J59A 3IKVA 4OMZA 2RC4A 1S8NA 2XGXA 4OMYA 2VT3A 2K4BA 5FB2A 1HSJA 4BHPA 1XCVA 3NQOA 3GVAA 3GLXA 2PLYA 4EGZA 2ESNA 3IWZA 1XCBA 2NNNA 2GA1A 2CO5A 3F8FA 2OU2A 2ZBKA 3TO9A 4AIHA 4GYIA 3N97A 1Q1HA 4BXUA 4ENMA 1WI9A 1W5SA 1YW8A 4CXFA 2J5OA 3KP2A 2LSOA 4ESJA 1ZG3A 1FSHA 4U0YA 2KIFA 4LFUA 1FWZA 4EVIA 4ESFA 5ICFA 4I2OA 5HLIA 4P9FA 3LQQA 5HLGA 2CWEA 3KP5A 2OAZA 4EJOA 4Q47A 5D6FA 4L18B 3G73A 3BJ6A 4RS8A 2M8EA 5FD6A 2AXLA 2P8TA 1H0MA 2FF4A 3J7AO 1LEBA 4JQFA 2DTRA 2IRFG 1HKQA 3P9KA 4BH9A 2EV6A 4MQVA 2WV0A 3WU1B 4KT5C 1HXDA 4L0YB 5J6XA 2M5WA 4HW0A 1XD7A 3FMSA 2HZTA 3GZ5A 1B9MA 3J81Z 2MLGA 3ZQ7A 1IRFA 1R00A 2KIMA 3SXYA 3WGGA 1Z9CA 1DPRA 1TNTA 3HTSB 3WE2A 2XAJA 1KU7A 4HLXA 5DV5A 5JVTA 3HUGA 4TV7A 2GXBA 2KIUA 3F8CA 1QPMA 3FMQA 1U5TA 3F23A 4RGXA 2XAHA 4KFCA 2P4WA 1SFEA 4RGRA 4HA8A 2CFXA 2QBYB 5DCMB 5JHUA 4BHCA 2L4MA 1ZHFA 2QVOA 1ODDA 2HYGD 3H92A 5HDGA 3KZZA 3Q9VA 4O3MA 2CSOA 2A6EF 2RGVA 4KN7X 3J80Z 5ILVA 2V1UA 4IRHA 2JRTA 2V6CA 5CYVA 5BOXA 5D5VB 3SQNA 1XDSA 5HS8A 1F4KA 4WWCA 1MZBA 4CYDA 4HX4A 4WXDA 1D8KA 4DQ2A 3K9TA 3HOSA 2VONA 2W57A 1KQ9A 3IRQA 2IA2A 4U0VA 2HOEA 5F6FA 5A2QZ 2D1VA 3I59A 3P9CA 5EEGA 3D5LA 1XGMA 3KP3A 1VTNC 1I1GA 3EUHA 3COAC 1IXCA 2DQLA 1T6SA 5H6RA 3VOEA 2R7FA 3DKWA 1FP1D 2STTA 4L9JA 2ADUA 3EDPA 1BJAA 1QZZA 4O5VA 5D8KB 4WCGA 3IHUA 2DU9A 3J81K 4EGYA 4G7ZF 5D4RA 4UXNA 4GO1A 2VE9A 3DEUA 1MDMA 5D5UB 2DPDA 2JT1A 1I6XA 2K86A 4ON0A 1ZG1A 4I7HA 1YTYA 3DP7A 3ZMZA 2RDPA 3C3WA 3C18A 2FNAA 3FXRA 4N9IA 3M9AA 2A61A 3I53A 3WE3A 2E1CA 4LG0B 4OOIA 3GX4X 2HQRA 3EYIA 2WWYA 3HHHA 3E5QA 3FMRA 2H09A 3FM3A 3LSTA 2COMA 4Y13A 4R79A 1LQ1A 4M73A 2DK5A 1Z6RA 5J8FA 1XMKA 3J80K 4Q48A 2RVCA 1G3WA 3JW4A 4ENNA 4AIJA 3L7WA 4HDVA 4HX8A 2JZYA 5DUKA 3ZMTA 5JI6A 1BC8C 5AONA 4BNCA 2H6BA 3CDHA 3W6JB 2R3SA 1J75A 1BBYA 1R22A 5D5XB 1FYKA 1USSA 3CJNA 5CVJA 1KYWA 5HOOA 2VOOA 5A2QK 1DUXC 1T0FA 2XKOA 1J2XA 5L3DA 4OIPF 3E97A 5CVVA 2BYVE 4G9YA 3G3ZA 3CO6C 3ABUA 2OD5A 3DF8A 1H9GA 3ZMUA 4M72A
chains in the Genus database with same CATH superfamily
5FKLA 3FKIJ 4PCQA 2LY9A 1XGOA 2FE3A 4BBRJ 2CUZA 1YRNA 2L4AA 1QVTA 3I4PA 4HDUA 1QHGA 2Q2EA 4A5MA 2NS8A 4RLFA 5D6EA 5J1YA 2VQHA 4II3A 3OOUA 3OYIA 3F21A 1FBQA 4PFOA 4FCYA 2LREA 2WB1N 4Y3OA 2EA4A 2DPUA 1S29A 2EV0A 1OISA 2ZFWA 2XAFA 4U87A 4J00A 3P5JA 1SMYF 1Y8QB 1K78B 4L5EA 1KQ8A 4B47A 4FX4A 4PZJA 1K6YA 1JTXA 2VXZA 4UUSA 3PIOF 4DBQA 1RKWA 1SD6A 2OQRA 5EG0B 1IAWA 2DT5A 4LJZF 4E4HA 5K7HA 3OYHA 5IOZA 3CCSI 2M7BA 2QLZA 2Z99A 1F9NA 4L9NA 4C9YA 1Y1VJ 2GAUA 3WG7H 4H0EA 3FIWA 4QLCU 2HS5A 1T2KA 2DMQA 1IDZA 2CRGA 4NQWB 5J40A 2Y48A 2BOLA 2GOMA 3VDXA 5KNLA 3A4CA 1GVJA 1NK3P 4R8HA 5EDNA 4IO9F 2HOTA 3MWMA 1IC8A 3BOQA 2E5NA 3RSNA 2E34A 2M0CA 3TO7A 3S32A 3T5XA 3QP6A 2XF6A 2VBZA 1TWAJ 1G3TA 3BG9A 2QBYA 5DCMA 2HDCA 5BMZA 2GWRA 2VKEA 1RUOA 1R1UA 5J4YA 4V2GA 2KJBA 2PMHA 1ETKA 2LY1A 1G4DA 1OFCX 1ULYA 2OV7A 4P5OA 2ZXHA 3BCBA 2HGCA 3CMYA 5KAIC 1D1BA 2OZ6A 4ZYDA 2IGKA 2QQ8A 3FBNB 3CUOA 5FKNA 3SDBA 1Y56A 3SEQA 3DTEA 5LRSA 4K2EA 3MD2A 4IHXA 2BHZA 3UNGC 1I6HJ 3HPGA 4LGWA 1WJEA 2V1XA 3HEFA 5KK1A 2VQCA 1MD0A 2BY2A 2CFOA 3BJAA 4GRIA 5GP9A 2EV5A 4LOCA 3U2RA 4L5IA 3Q0VA 4F93B 1IN8A 2ZXIA 1WQ2A 3ZQCA 1JHHA 4LITA 2F2EA 1X1PA 1LPQA 4WXCA 1F5TA 4IHSA 1R36A 4NUBA 4I98B 4WK8F 2VE8A 3OYJA 2GXGA 2MLKA 4V19K 2PN6A 1JT6A 3SZPA 1JKOC 3CP8A 3HSEA 2UUZA 4M9XA 2YX7A 3J7YJ 5KHDA 3OIOA 3K0LA 5ILSA 3GO5A 3E6BA 5KCMA 2QUFA 2D1HA 1ZN2A 3X2QH 2EJRA 1B72A 2R7RA 4X6AJ 1XSXA 3MKLA 3S2HJ 2Y69H 2XDVA 4A5NA 2D2WA 3KP4A 3QPSA 1X4PA 1FTZA 4BBSJ 3K69A 1FT9A 2GZWA 1I50J 4KISA 1X1BA 2EFOA 2X1EA 2VJ5A 1KONA 1RNLA 2YPRA 2ZNZA 1IN7A 3WU0A 2PMZN 2YU3A 3E6DA 5F0FA 4MTDA 3MFKA 1EH8A 4M3DA 4BL0B 5IPAA 1D0YA 4C3IJ 4II2A 2CUFA 4XN3A 1E3HA 5ICGA 3BP8A 2X51A 3RYRA 2R0QC 3TEDA 2AHQA 4YELA 2LOOA 4XR6A 2DOFA 5BS6A 1S7OA 1W36C 1LDKB 3OS0A 3S8PA 4A3BJ 2GQQA 4UVAA 5IY5H 3AG1H 2L02A 3N4MA 1VQLI 3M8JA 3S2WA 2XAUA 1SD5A 4PGHA 3L2CA 3M8EA 2P0WA 4LB5A 3K70D 3IKTA 4R1HA 2DLLA 2LY2A 2PJRA 3K1PA 3BR5A 1FOXA 2KZVA 4B09A 2XROA 4QPOA 3DBHB 1PUEE 5GAHJ 2ZKZA 2BY0A 1P7IA 3DBRB 3FXLA 1WJFA 5LRRA 2HXOA 3KFWX 1DP7P 3KP7A 4HRIA 4IRIA 4Y52J 3F72A 5EZGA 4RGSA 1MNMC 1MJAA 1VF9A 2BVMA 3CCRI 3BG7A 3FX3A 2X9DA 3SYTA 4ETSA 5F0CA 2ACJA 3PNVA 3V7RA 2FMLA 1PDNC 3WTUC 4Y7NJ 1T38A 3L2UA 1QA6A 1UB9A 2OCCH 4ZTFA 2IJLA 3TW7A 4HBLA 3VSKA 2V1DA 4LG0A 3IRRA 2LD5A 3F9KA 3ZQLA 1NG6A 2JPBA 1XDUA 3LL7A 4N0BA 3WGHA 1MJBA 2XC7A 1C0WA 1X3UA 3QRFF 2HWVA 4I0AA 1R9TJ 4IHYA 4AD9A 1ZLJA 1LVAA 3F22A 2CQXA 3IAS2 3BJOA 1LDDA 4RAGA 2DMUA 3B73A 2YX4A 4L9VA 1JJ8C 1GUUA 2Y9YA 5M5YJ 3TO6A 5HNHA 5KAFC 2DN0A 2FRHA 3GTKJ 2XAQA 4D5FA 3ZXSA 1HBXG 4HF1A 2H6CA 2JPCA 1VQPI 2KLOA 4CCNA 1BI0A 3GFLA 2ELKA 2M8GX 1IO2A 2X4HA 3GTJJ 2YR2A 3PFYA 5ED4A 3MAJA 1UCRA 4M71A 2LF7A 2L7MP 2X1DA 3F3XA 4E7HA 2W4SA 2BE5F 2LRDA 3EUKL 2Y31A 5LEKA 3HC7A 2KFDA 4DGWB 2OTLI 2Y0SN 1TW3A 4CUGA 2ZO4A 1S7AA 3O2PE 4A6DA 4EMSA 2ISZA 2ZNYA 4IXAA 1W5TA 4G7OF 2EZIA 5EZHA 2M2EA 3K2AA 2N8GA 2CQ7A 2V79A 1TW2A 3MKWB 2XVCA 3OS1A 4A3CJ 3JRHA 4KUMA 1AA7A 3KE2A 3O3KA 5E3NA 3FK7A 3BTCA 1D1CA 2E2JJ 1XB4A 1HQCA 2VJIA 3ZN1A 1HC8A 2PQ8A 1EH7A 3VYSB 2DT7B 4CO8A 4E7KA 3K1MA 3BG3A 1XC5A 1JGSA 1Z91A 3ESWB 2KDOA 1IUYA 4HV5A 4EM1A 4LMYA 2K9NA 4Z6YA 2HDDA 3V8JA 3Q0WA 3D5SC 2BVLA 2DBBA 3DU5A 5FKKA 1GXPA 2IA1A 2FBKA 1FIAA 1Z7LA 1RZ4A 1Y0NA 2BY3A 4DIQA 1E2XA 4Y15A 1BI3A 2X1CA 4MO7A 1VQ9I 1LEAA 3OL4A 1YW7A 4GCVA 2H1LA 2OBPA 2P7VB 2Z3YA 3L2RA 1JXSA 1YQAA 2FEZA 2DMPA 4YFKF 2DTZA 3CZ6A 3DQVC 3LSMA 4XL9A 3TGNA 2ELHA 2F48A 5IT9K 1WJDA 2KMUA 5L3GA 2DK8A 3F8MA 1K78A 2DMTA 2ECBA 1IXSB 4OU0A 3H3VK 3G1LA 3WTTC 2A69F 1WJCA 4KT6A 5CJ9A 3H0DA 1O7FA 2ZJ2A 2HQ5A 4M3EA 5EG0A 3BR1A 1UFMA 1FX7A 5B1BH 1QVUA 3IUOA 3IC7A 2CYYA 1DPUA 3JREA 5BPDA 1K7AA 2FA5A 2FJ1A 2E7WA 2VODA 3IWFA 2Z16A 1ZRCA 4HX7A 1MBEA 3OYAA 4I09A 2MFZA 1E3OC 4M3GA 2EFNA 4P1WA 1Z21A 1WVRA 4A0YA 3I4NJ 1IN6A 2HQNA 2QKMB 1O57A 3LWFA 5E3OA 1ZG5A 1KA8A 4BQAA 3W6KB 1W7PD 2EFQA 4BE2A 4BE0A 4E70A 1T08B 3GUDA 4HF2A 3ZGKA 1LNWA 1UJ8A 4HNUA 2GLOA 3E3VA 3WTYC 2DW4A 5K7ZA 1ZYRF 4ESBA 3FXKA 4LIUA 3SHFA 2WADA 5E3LA 3CUQB 1J5YA 2XF5A 5HS7A 1Y39A 4L9TA 4B48A 3ABMH 2AS5F 1L3LA 3Q0UA 4J01A 3KZYA 3CJQB 3P9IA 1O3SA 4PJLA 5E1XA 4G6TB 1P2FA 4OIOF 3DBLB 2WV1A 2VLAA 4A2UA 4XSXF 1R49A 2DA6A 5LHIA 3LNQA 4YIRX 5DD8A 3HBLA 6PAXA 1BI2A 2FXAA 1MNDA 4C2TA 2DCEA 2FNPA 1B9NA 1K6OA 3R61A 3R60A 5IYCJ 1IRGA 2ID3A 1TQMA 2K9SA 1Z7UA 2V9KA 3A1YA 3CLQA 3O8GA 3N05A 4IVNA 3U21A 1S6LA 2E2HJ 5M3FJ 3ZPLA 2BW3B 4HSRA 4BKXA 5CVIA 3L2WA 3REOA 1I5ZA 3EYYA 2VPLA 3A03A 1PP7U 1USTA 1TLHB 1TL8A 2KL4A 3K4NA 1O3TA 3HOTA 1ZH5A 3RQIA 1TP4A 3DKYA 4ZYAA 3OIQA 5AIPA 1RR7A 1E0EA 2VBXA 2NXNB 1FYLA 2F4IA 1MBJA 1BR4A 2F5VA 4ZJZA 5HS9A 2DA1A 2NVQJ 2WY7Q 2R5ZB 3AAFA 5B1AH 2QKLB 4DYRA 4NNJA 2PI0A 4LB6B 4W97A 1GT0C 3CQZJ 4ZDPA 1OR7A 2EIMH 2BHYA 1YJWI 1AWCA 2IW5A 2KT0A 2HQAA 2CUJA 1WSUA 3HIFA 1FOWA 3RCOA 1MJ9A 2A68F 3S3MA 2WAEA 3M07A 1ZR4A 4NDLA 2K5CA 2LF8A 1MIJA 2RQPA 1MH3A 2MABA 4XN0A 3WTXC 3FKJA 3I0TA 2DA3A 4E7IA 5ICCA 3W2WA 2AQFA 2VPRA 3BTJA 1SD7A 2CH0A 5E20A 1HKSA 3OYKA 5F27A 2NVTJ 2XB5A 3FZVA 3S1NJ 2PG4A 2KIQA 2MH2A 2KDZA 2FQ3A 3NEUA 3ZCOA 4A93J 4I6ZA 2VOPA 1TWFJ 3OMYA 2K3FA 1JE8A 2W24A 2CQNA 2RN7A 1SFOJ 1IG7A 1TTYA 4LK0F 4RGUA 1XSVA 2JSPA 5EYRA 2LNBA 2P6SA 3D5RC 4UV8A 3CC2I 1YLFA 2WAQA 3MMYB 4G94A 3HSFA 1FP2A 2FU4A 3RPQA 3E0JB 3T0YA 3GFMA 2HDWA 3HRSA 4RB0A 4EJWA 2K9LA 2BY1A 1H9TA 5FLXZ 1KYZA 1MSFC 2X6WA 2IAIA 3DV8A 3BWGA 2R4GA 4KNYA 2P6TA 4KA4A 4KIGA 1Z1DA 2V9VA 4N9HA 5ERIA 2MC4A 3K4KA 4ZZDA 3GEZA 2F5EA 1V5FA 1W0TA 4ZH4F 1TT5B 2ZFUA 3VODA 1M1EB 1GVDA 5L3CA 1WRJA 4U7BA 3W6VA 1U3EM 1WJAA 3T8RA 3S14J 4RB2C 5HNFA 1MGTA 3LAJA 2HI3A 4UHTA 4FTHA 2AO9A 1YI2I 4YFNF 3OR1C 3JTGA 4C30A 3BT9A 4CHUA 3LSHA 2L7FP 1IN5A 1V5GA 2EFPA 5JHFA 1YIJI 1REPC 1DU0A 1BIBA 2ZC2A 2FBIA 2XKPA 2M9HA 3F8NA 3CCQI 1Y6IA 2ISYA 1YW9A 2GIZA 4WX9A 4B3AA 4UNOA 1T56A 2B0LA 4IHTA 3NRVA 1PP8F 1D8JA 2X0LA 2PEXA 1S7EA 1A6IA 2DJNA 2F5DA 3K1NA 2EILH 5CLSA 2LKXA 3HRUA 4ITVA 1SAXA 1N25A 3GF2A 1P6RA 2MD0A 2GOXB 4PGGA 4WF2A 5HDKA 4XRMA 5C3EJ 1MMGA 5TISC 1HW2A 1U6GA 3HYIA 4CGZA 1OCZH 1QO0D 1RR8C 1P4WA 3BR2A 3L00A 2A3SA 2M0MA 4HZFA 3H1CA 4L0ZB 4RM2A 3RPUA 5LGTA 1SVLA 3M8FA 4D1QA 3CUQC 1V5EA 2KRFA 3MZYA 2LTPA 2HFHA 5FFZA 1ON1A 3OL3A 4MEXF 2JA5J 4CCMA 1X1CA 1Z67A 2FD5A 2M4KA 5KVRA 2QWWA 3QAHA 1P4XA 3ERED 1IDYA 1ZR2A 2YSRA 1FMVA 4AYBN 2RKHA 5J8CA 5CVUA 2O0YA 2L3DA 4XICA 2K40A 2DJIA 3G1OA 1ERDA 2R7QA 2XPVA 3PNYA 4CYCB 2OQGA 3HM5A 3PUFA 1T39A 1ZREA 1R1TA 4RAZA 1UHMA 5HLHA 1O3RA 4ABZA 1X2MA 3OSFA 4CH7A 1LKXA 2ZCWA 1UAAA 2V1NA 3VEPA 3LOCA 4IEJA 1B6AA 2UXXA 1U9NA 2O03A 1MMAA 2IS4A 3SJMA 1BC7C 2Q8KA 1BW6A 2VJJA 1ONVA 3GTLJ 1ENHA 5J4VA 1R5GA 1RIOH 2RAEA 1LUJB 1GXQA 4Q5SF 3JRCA 2QM3A 1LFUP 3S93A 2M4GA 1B1BA 1B59A 1TWGJ 1FOKA 3QOPA 1QZYA 1RI7A 3JSOA 1ZRDA 1XMXA 4M74A 4AU7A 4I02A 3F8BA 1X2NA 1J7KA 1JT0A 2DFIA 2BBYA 1DU6A 4RB3C 1A6QA 2NYXA 2VBWA 3RKXA 5FLXK 2W84A 5E1ZB 2KRCA 1G8XA 1B4AA 3I54A 3QODA 4RMNA 2UXNA 2QA4I 2NRAC 2LKPA 4BJ5C 1QHHD 3S2DJ 1STZA 3VWBA 2JA6J 1D5VA 3JRAA 4FQGA 2KPMA 3E5UA 5ILUA 4HOBA 5HVQC 1EKEA 3VYRB 1U2WA 4UB8C 4RB1A 5F64A 1DGWY 1BJZA 4LK1F 2O7OA 3GW2A 1OCRH 5LFAA 4Y4RA 4HNTA 2H94A 2IGNA 2NOJB 4OWRB 3RZDJ 1GDTA 1ZELA 2K3PA 3BZCA 3WGIA 3BPVA 2LG4A 3GWZA 3WG9A 2EZLA 3HB9A 4YRVA 2MC3A 1U9OA 3BTIA 3GYHX 4BJ6C 3JRDA 4E7JA 3HTUA 2JJ7A 1XS9A 3DPLC 3CUQA 4YG2F 1HW5A 3OSGA 2QCOA 3JRGA 4J19A 5CVRA 2QGUA 4AIDA 4DBRA 3V7CA 2QQAA 2JQ7A 1YX5A 1V55H 1U8BA 1EV7A 4OAZA 4U7DA 2H8RA 3TOBA 2ZMEB 2JMWA 5H6QA 3RQ4A 2V4JC 2XGEA 1ETOA 1OYIA 3DTIA 4ANJA 4HQEA 3A0HC 2R92J 2R7TA 2CQKA 4BACA 1S9HA 2OUMA 3WHCA 4BQNA 3TKYA 4HQMA 2H1KA 4XLHA 1YG2A 5IP7J 3F6VA 3KEOA 1HF0A 1BI1A 3HKZA 4H4KC 4XLPF 3OYFA 1G3SA 1ZGAA 3AG3H 5DCFA 3FXUA 3VSLA 2M3AA 2IBDA 1DP3A 1JI8A 3BR3A 2BW3A 1JUMA 2HZDA 2VN2A 2VBYA 1QNTA 3B6CA 1ACIA 2FSWA 3IL2A 3AG2H 1E17A 2EZKA 3DXJF 3FWEA 3K7AJ 5D4SA 1P7JA 5L3EA 4M6YA 5LEJA 1HW1A 3DLLF 5E8IA 2E19A 4GDFA 3JAMZ 1V54H 5GPCA 2LYCA 2R5ZA 5FKOA 1OCCH 2R7DA 3E5XA 4BHBA 4KMUX 3TP3A 4WXHA 2O3FA 3K4BA 2LBFA 4XMYA 3KYDB 2WAFA 4QIWN 4ENJA 1K4SA 2G0EA 3TDZC 4XLCA 1XGNA 1ZAOA 4JX5A 1Z0XA 2BXYA 2ME0A 3H5AA 3RPUD 3WTZA 2EQRA 1I3AA 2TRTA 3DFGA 2E71A 1VQOI 3RYPA 4BAYA 1XMAA 3R0JA 3VYUB 1UZCA 2F4OB 1R7JA 2P5VA 3H35A 3HOXJ 2H27A 1ETVA 4P96A 3Q3SA 1FTTA 1AOYA 1WHUA 2KJCA 4OAYA 1J9IA 4XLEA 2CJJA 2HKOA 3KEQA 1F43A 5FROA 2VL8A 5BNGA 3SZGA 3WHBA 4EATA 5E18F 3SFZA 1GLNA 3F6OA 2EWNA 3GZ6A 2DOAA 3CF5F 1MMNA 4A3MJ 4IQ4A 2RNJA 3ML6A 3OYDA 3C1DA 4RAYA 3AFHA 1GHCA 5BPIA 3DPTA 5J3LA 1X3WB 4EM2A 4RAFA 2A07F 2X48A 2IVMA 2UWMA 2LFBA 2JRMA 2Y0SA 2EBIA 3WTSC 4XKWA 2RV8A 5FLMJ 1KQ0A 2CW0F 4IL6C 3BZ6A 1P92A 2DOEA 3CD6I 4HG2A 5B3SH 3IH4A 1SD4A 4P9UA 2HPMA 5E17F 4EV0A 1LFBA 4RM3A 1QGPA 3H3UA 2F5CA 3ABLH 3LMMA 2E60A 1R5HA 3ECOA 4KITB 5LBQA 1K61A 3CC4I 2W82A 3P7NA 4HYEA 4YIFA 3HRMA 1P4AA 2Y9ZA 1OYWA 1FY7A 4IQJA 4LG3A 4ZYEA 3G71I 2FOWA 2DMNA 2W85A 1WH5A 1O4XA 1RC9A 2UZKA 2V26A 1D5YA 4U0WA 3RKQA 1X58A 4XQFA 4IPAA 2CUEA 5E8GA 3B6AA 1U5TC 5F1RA 1JHFA 4D7MA 3R6SA 1IV8A 5J1UA 2BXZA 4KJZA 2I10A 1BN5A 4KIBA 5K5QA 1LB2A 1ETXA 1FPQA 3O6BB 2W7NA 2E1OA 2DA7A 2VXDA 1UMQA 1IV6A 3MKZA 4Q4ZF 2TDXA 1W4MA 1OKRA 2WC2A 5CQEA 1YOVB 1T98A 5HLTA 3OS2A 1FBUA 3UKGA 3OWTA 3R4KA 4G6DA 4S04A 2VKDA 4XRSG 5FRNA 3H3ZA 5JLWA 2K9MA 3QPTA 1D1AA 2K02A 2RQQA 1ORKA 4LLLA 5L3BA 4DNCA 1WWXA 3HOYJ 3WU2C 4XLAA 3JAMK 4D0PA 3W2AA 1Q1VA 5M5XJ 2HVRA 1WJ5A 3L9FA 2Z2SB 4KIFA 1WJBA 1QBJA 2G7UA 4XORA 2ZMEC 5DD4A 4M72A 3QPHA 3UR3C 2KKOA 2A5YB 2ME6A 2EINH 1YFHA 5H2FC 3MKYB 2FBHA 3ZMSA 4HSTA 1O3QA 4A6EA 4CYCA 1KU9A 2MH9A 2OF7A 4MQ9F 3V8LA 2OA4A 2E35A 4CICA 2MD5A 3RJPA 2QSHX 5LGNA 4JOMA 3BG5A 2BEOA 2DQRA 2L01A 4PK4A 2CV0A 4ASNA 3RTRA 2HR3A 4MHGA 4HPQA 2FMYA 4AIKA 1WPKA 2LKSA 5DDGA 2XAGA 3PQJA 2XSDC 2G9WA 3H0GJ 1ZARA 1YS7A 4ENKA 2E1MC 4RLQA 1T8IA 5GPAA 2A6HF 4A0XA 2XHKA 1OJLA 1VQNI 4A3DJ 4JK1X 3FXOA 5ICEA 3VFZA 3BZKA 3CESA 3C2BA 3M1EA 5H20A 3EUHC 4UVBA 1FJLA 1CQTA 1FC3A 3CJTB 1OPCA 1YS6A 5LHHA 1R5ID 1YIOA 3F0CA 2CS3A 5J47A 3L2VA 4IZZA 4NQWA 3A0BC 4PDKA 2HOSA 1NTCA 2ECCA 2EK5A 2MG4A 3G4SI 2AXTC 3FHZA 3ELKA 2LP0A 3ZMDA 1BOAA 3GTGJ 1LE8B 3E1SA 3KCCA 1WKMA 3BPXA 1RKTA 3TMOA 1J0RA 3FBIB 1FYMA 5HODA 3BDDA 2NVXJ 2KHMA 1R71A 3DU6A 3K4JA 4F91B 2PBIA 5EEHA 2IT0A 3ZQHA 5K5OA 3KZIC 2CG4A 2WTEA 1LFPA 5FD5A 2RNGA 3EQLF 3S1RJ 4NHJA 4E6KG 1VQ5I 3ZP5A 4Z2YA 2NS0A 4CZCA 5LLQA 1FZPB 3T8TA 4KMFA 2LLKA 2R7OA 3I56I 2DO7A 1EJ9A 1YJ9I 3RIRA 1KGSA 4PSWA 4G8XA 1VI0A 3QU6A 1CGPA 2DI3A 3LAPA 3LFUA 2IPQX 4OINF 1DQUA 2F5FA 2Z9OA 4CZZA 2M87A 4MFDA 2D45A 3I64A 4NC8A 3HHGA 5DUIA 3BROA 4GYGA 3JSPA 3VYTB 3ISPA 5C44J 1IGNA 3HOUJ 4X0GA 1FNNA 3IAM2 3HDDA 3CLOA 5IT3A 4YFXF 2ZMEA 3GTMJ 1D0ZA 2OTJI 3CCYA 1TNSA 4XBFA 2ETHA 4HF0A 3QYFA 4ZC3A 2ESHA 1APLC 2AQEA 3IH2A 3D0SA 2EA2A 4A0ZA 4LLGF 3LSGA 1U8RA 3KYCB 3GTOJ 1V3FA 1YO5C 2ZXJA 2PJPA 2XF7A 3RKWA 5DM7F 4NC6A 4G7HF 3RDIA 4UVCA 2CW7A 1I1SA 3FM5A 1SFUA 4B1RA 3PNTA 1SFXA 5L3FA 1G2HA 2MW8A 2L7KA 3CCVI 2E7XA 5J1RA 1A04A 4XRSA 2Q1ZB 3LA2A 4XRFA 3LFKA 3FF5A 2K27A 3ZN0A 1VQ4I 2DAOA 2O6GE 3PO2J 1YX3A 5DYMA 3BG6A 3I58A 4C2UA 3DEEA 3BTLA 3TDUC 4A3FJ 2DA2A 1K4TA 4FETA 4M9SA 4LIVA 4RBOA 3JTHA 4A3LJ 1RPWA 3S1MJ 4JX4A 4BY1J 2PMUA 2NOGA 1X3ZB 3OYBA 4L5JA 2HYFA 3PQKA 2HKXA 2GA2A 4I76A 2HYJA 1ZLKA 3CMEI 4MEYF 2EB7A 2KZGA 1PVEA 2XUBA 2JK3A 5IOYA 4IHVA 2Z33A 5JVGF 1CF7B 2PX9A 3MEXA 2EFWA 1AKHB 3S1QJ 3ECHA 2BZTA 2ZJQF 3CJRB 1IW7F 1I27A 4D5CA 3LSKA 1R23A 1W7PB 3CMMA 4QWQA 1UG0A 2CQQA 4DZJA 5D8LB 3PO3J 2HVSA 1NK2P 2EPFA 1MH4A 3K70C 3DEWA 4KYWA 2A05A 1MBFA 1YJNI 2MGQA 4NB5A 2K4JA 2ZSHB 3LA3A 3KETA 2XGCA 3H5RA 3KLOA 5TJJA 3V4GA 5GADJ 1Z6TA 5B5EC 4P55A 1A31A 2QQBA 2I5UA 5K1YA 3GXOA 5DM6F 1HSTA 2M45A 4A12A 2QENA 2M7AA 3U9GA 4M6XA 4CCLA 2XASA 2STWA 3PJRA 2PFBA 1OCPA 4O6JA 1F36A 2HNHA 2GBYA 9ANTA 1X1AA 3VB2A 2DT6A 2D5VA 3TOAA 1HDPA 2C6YA 3ULQB 1SVMA 4S05A 2BV6A 3HSRA 1QU3A 2CV2A 3ASNH 4HV6A 3M1CA 1AU7A 1FBSA 1UHSA 2HXIA 4F92B 4B3XA 2LR8A 4MLOA 2X6OA 4NBQA 1W1WE 3CCJI 3ZQIA 1VFCA 3ZRGA 5LHGA 2XV4S 5JR3A 1L0OC 3S16J 5TRDA 1FSEA 1SAUA 1Z3YA 2UV1A 1ZQ3P 3OYLA 3PIPF 1H89C 3ERMA 3KP6A 3GFIA 3C7JA 4FASD 4KN4X 2J5PA 3BC8A 3HJEA 3GFJA 2R7SA 4EM0B 2IEKA 3Q9SA 4PUSA 1UG2A 1G6NA 2L54A 3K4LA 2IP2A 3QOEA 1K79A 2Z5UA 3DKXA 3I4MJ 4BE1A 3DWLE 3E6MA 2P5KA 2XPUA 4A3JJ 3CP2A 4BU2A 2DYSH 2L9RA 2M34A 2Y0MA 2QQ9A 3CDIA 3K10A 3U1DA 3I55I 3L2QA 1A35A 3IH3A 4DYCA 2OJED 2WB1A 1TBXA 2KRHA 4F3QA 2CW8A 1DDNA 3LSIA 3GCMA 4U88A 1KU2A 2XIGA 4C2MJ 2ID6A 2W48A 2O8XA 1Z77A 4JBAA 1MMDA 2G7HA 3DLAA 3T1BA 1BR1A 3V42A 3BY6A 4OIRF 2LDUA 3S17J 3B02A 3WTWC 3WODF 1B8IB 1OYYA 4NC7A 5FJ8J 3BQYA 1ZK8A 1W0UA 2P5LC 5HDNA 4N4OB 2IXSA 5TGTA 2DDBA 1JKQC 2KP6A 2CV1A 4FHTA 1PUFB 3SZTA 3FXQA 5C4XJ 2JTVA 2EZHA 1OCOH 4B4CA 4EQQA 5DEQA 2DDAA 1JJ6C 3PFIA 4AVZA 2VT2A 1IRZA 4G6QA 1ITYA 3ZMVA 1VZ0A 3EETA 3LA7A 1Z05A 1ZTRA 5F04A 2V6EA 2JWTA 5FRMA 3W2VA 1VQ8I 2Q0OA 1ZRFA 2VKHA 3I5UA 3L09A 3BLYA 1BR2A 4ZZLA 3DPUA 3M3YJ 4BGDA 4XOPA 3KIOA 4BYYA 1YHQI 2M1BA 2YUSA 3R0AA 3JRFA 4GXOA 2B63J 2L5QA 2K85A 1XGSA 2VC0A 2OC6A 3HUGB 1S72I 2NAZA 4HAMA 2TCTA 3NARA 2CGPA 2XSJC 4EJTA 2VB6A 3A01B 1U5TB 2R7WA 1Y0UA 3MVPA 2JSCA 5E3MA 3ZQGA 3L1PA 2K7LA 2W25A 4ZYGA 1TQPA 4UUVA 4BEHB 1XG1A 2XRNA 2DA5A 3HOZJ 1SVOA 2QZ8A 3OY9A 2IS2A 3ZOBA 4YIIA 2LH9A 4F55A 3TW6A 3AG4H 4AVPA 3LQRA 3HG9A 4FISA 2MA3A 3NWTA 5LGUA 1K83J 3RZOJ 2QYOA 1LE8A 1VNDA 4BXXJ 5BQTA 1R1VA 4KDPA 4M3BA 5JFRA 5K5RA 2BGCA 2MYSA 3CTAA 2HTSA 2EIJH 4XIDA 2L9NA 1TQIA 4EJUA 2GIVA 2F6CA 3H5NA 2R7UA 3ABTA 2ZJPF 3OV8A 2VJ4A 4XOTA 4IF4A 2MBFA 4DOZA 2YU9J 5FLVA 3RKYA 2LVSA 3A02A 2PMZA 2O5RA 1HLVA 1RESA 1KZHA 3GBGA 3MCZA 3V8KA 1LJ9A 4XSZF 1IF1A 1BIAA 4UV9A 1S5LC 1XN7A 3K4CA 4MGRA 4CSWA 4FX0A 1OMIA 3HOVJ 4LD5A 1R6RA 4MTEA 2L7ZA 4GGGA 4AWXB 2O8KA 1X4OA 4BY7J 5D5WB 4FT8A 1U78A 4C3JJ 2V7FA 4N4NB 3MZHA 4I01A 5EGOB 2NNYA 3K2ZA 1N78A 1OLTA 1MNEA 4ZYHA 4BDYA 2HOAA 2Y75A 4EJVA 3Q5FA 2E1MB 4XLNF 2E1NA 1NHAA 3TQNA 1HKTA 1D3YA 2OZUA 3OIPA 4M9ZA 3I59B 2X6YA 2W1OA 2WY8Q 4LLNA 2HEOA 1MW7A 3E6CC 5E1WA 1G3YA 2RREA 4S0HB 4F7ZA 2XB0X 5FFXA 4EEFG 3PL8A 5EF6A 1VQ7I 1KU3A 1MMSA 1UHWA 1N77A 1QQIA 1RUNA 4F52A 2A6TA 3NWSA 3MQ0A 1FEXA 4XM3A 1IN4A 3HRTA 2X85A 2KISA 1IZ1A 1YYVA 2WA0A 4UY8I 2E5ZA 1BM9A 3GTQJ 1YE9A 3QP5A 1XSDA 2CU7A 3WTVC 2ICWG 4X1EA 5FO5A 3E7LA 1ZGJA 4IRGA 2O61A 4MNUA 2M30A 4HLYA 1MDMB 4BQOA 3KX2A 3A2KA 3HKZN 1H8AC 4KICA 4MFEA 2HPIA 5E79C 2VQGA 3QU3A 4OIQF 1R58A 2R7VA 1IXRC 1W5CC 1H88C 3M7GA 1CF7A 1EH6A 1AKHA 2HTJA 1NG7A 1QZEA 3I71A 1MKMA 1LDJA 3K4MA 3KLNA 4CDGA 4IJAA 2P7CB 1W7PA 2V9PA 4ZDLA 5F0HA 3LSPA 1FOYA 3RI4A 4IHWA 4QTRA 3OOPA 3NAUA 2IA0A 3AL0B 3G1MA 2FOKA 2VC1A 5FKMA 4B8XA 2R5YB 5IT9Z 1SMTA 1FLIA 1ON2A 4I0BA 1S3JA 3ROUA 3FISA 3V7SA 4IX7A 2R7ZJ 3CO7C 2JUCA 4CCKA 4W1UA 4BDZA 3KEYA 4Y17A 5AIQA 1F1ZA 1V4RA 5FGMA 1O7LA 2IS1A 4PJMA 1J59A 3IKVA 3GLLA 4OMZA 2RC4A 1S8NA 2JA2A 3HZJA 3O8HA 2XGXA 4OMYA 3OYEA 3BR6A 2VT3A 3C2GA 2K4BA 2HVQA 3IP4B 5FB2A 2JVHA 5F08A 1HSJA 1BL0A 4BHPA 1XCVA 3I9V2 3NQOA 3GVAA 3SEZA 4QSHA 3GLXA 2DFFA 2PLYA 3HGYA 2XGDA 4EGZA 2ESNA 2HU9A 3IWZA 1XPXA 1XCBA 2NNNA 2GA1A 2CO5A 4B44A 2XRLA 3F8FA 2OU2A 2ZBKA 2Y30A 3TO9A 4AIHA 4QPQA 4GYIA 3N97A 1Q1HA 3DTKA 4BXUA 4ENMA 1WI9A 1W5SA 1YW8A 2W00A 4CXFA 2J5OA 3KP2A 3M4OJ 2LSOA 3S3NA 4ESJA 4C3HJ 1R4NB 2NVUB 1T33A 1ZG3A 1FSHA 4E7LA 3G2BA 3OYCA 2DODA 1D0XA 4U0YA 2KIFA 4LFUA 1FWZA 1TC3C 2WBMA 4EVIA 4ESFA 2O9LA 5ICFA 4I2OA 5HLIA 4P9FA 3J7ZI 2QF7A 1A5JA 5LD2C 3W3CA 3LQQA 5HLGA 3U1KA 2CWEA 3HXLA 3KP5A 3HL2A 1B8IA 2OAZA 4ZDOA 1IRXA 4EJOA 4IOCF 4D9JA 4Q47A 2IS6A 1MSEC 2L9SA 5D6FA 4L18B 1XX5A 5GAGJ 4FE4A 2IGOA 3BJ6A 2M8EA 4RS8A 5FD6A 3G73A 2AXLA 2P8TA 4V2FA 3FHNA 1YRNB 4BQQA 1H0MA 3TBIA 3ONQA 1PUFA 5IYDJ 1JUPA 1TWHJ 2FF4A 3J7AO 2Q2EB 4JQFA 2DTRA 1LEBA 2IRFG 2R7XA 1MBGA 1HKQA 2I8DA 3P9KA 4BH9A 2EV6A 3PUBA 4MQVA 2WV0A 3WU1B 2EIKH 3G6EI 4KT5C 1HXDA 3TP0A 1VQKI 1VQMI 4L0YB 1POGA 5J6XA 1FIPA 2M5WA 2KQRA 5F1JA 1WI3A 4HW0A 4XLFA 5GAEJ 3MN2A 1XD7A 2JA8J 3FMSA 5GTIC 3SDGA 4MIMA 2HZTA 3GZ5A 1B9MA 4M3FA 3ZQFA 3J81Z 3CMAI 4UUSB 2MLGA 3ZQ7A 4DZPA 1IRFA 1R00A 2KIMA 4HNVA 2OCEA 3SXYA 4UB6C 2FX0A 3WGGA 3H36A 1Z9CA 2MSYA 3GMEA 5EEAA 1DPRA 3JRIA 1TNTA 2L0KA 5IP6A 3HTSB 3WE2A 2XAJA 1MBKA 4UUTA 1KU7A 3TL4X 4HLXA 2JA7J 5DV5A 4CCJA 1BW5A 5JVTA 2LC2A 2ZJRF 3HUGA 4XKVA 1OR7C 4TV7A 2GXBA 2KIUA 2VASA 2Z1DA 3F8CA 1RETA 1QPMA 3FMQA 2VI6A 3A01A 1U5TA 3FXJA 4BXFA 3F23A 1JUSA 4RGXA 1AHDP 2XAHA 1HA8A 3EUAA 3JRBA 4KFCA 1IJWC 5EJCA 2P4WA 4BEHA 3GZNB 1SFEA 4RGRA 4HA8A 1ZGWA 1QPIA 2CFXA 3K6GA 3LSRA 1J09A 4G12A 4PJJA 2QBYB 5DCMB 5JHUA 3H9QA 2QSFX 4BHCA 3AKZA 2L4MA 4PSXA 1ZHFA 2L2OA 2F4MB 2QVOA 1ODDA 3QYEA 4CCOA 3I3LA 3ZR8X 4YEJA 3S15J 2CMPA 1HCRA 3FXMA 2HYGD 5CKTA 3CCMI 3H92A 5HDGA 1X1DA 3KZZA 4RA2A 3PSIA 4I99C 1LVKA 3CC7I 3Q9VA 4JYKA 1RRJA 1WCMJ 4O3MA 1EA3A 3AL0C 5CQGA 2CSOA 1UELB 2QEXI 5JLXA 4E7ZA 2A6EF 3J7AY 3PM1A 2RGVA 4KN7X 3J80Z 1JKRC 5ILVA 2V1UA 4IRHA 2JRTA 2V6CA 2ZXWH 1WH7A 3KPHA 5CYVA 3KYLA 5BOXA 5D5VB 3SQNA 1QRYA 1XDSA 2ELJA 1IUFA 5HS8A 1F4KA 3D1NI 4WWCA 2B9SA 1E3PA 2QSGX 2A5WA 4FE7A 3GTPJ 1MZBA 4CYDA 4HX4A 1ETYA 4WXDA 2ZB9A 4A69C 1D8KA 4DQ2A 3K9TA 5M3MJ 4A3KJ 1T95A 3HOSA 2VONA 2H8WA 3JCUC 5EGOA 1Y1WJ 1JGGA 2W57A 1KQ9A 4A3IJ 2FQ4A 4PJ0C 5CPRB 2ZSIB 1OQYA 1WGXA 3IRQA 2IA2A 1B72B 4U0VA 1BA5A 2HOEA 4AC0A 5F6FA 5IP9J 5A2QZ 2D1VA 3ZQQA 4Y33A 3I59A 3P9CA 5EEGA 3D5LA 1ETWA 2LK2A 1XGMA 3ABKH 3KP3A 5DS9A 1VTNC 2IGMA 1I1GA 2DYRH 3EUHA 4GFBA 3COAC 1IXCA 2DQLA 3SFIA 3BCAA 4AUXA 3OYGA 1G59A 4XKBA 1T6SA 3FDYA 5H6RA 4CA0A 2GXAA 3VOEA 3H9JA 2YS9A 2LBFB 2R7FA 1W36D 3CCEI 3DKWA 1FP1D 2STTA 4L9JA 2ADUA 1TWCJ 2X6XA 3EDPA 1BJAA 1QZZA 2VIXA 2E36A 1DGRM 4O5VA 5D8KB 4WCGA 2GM4A 3C2HA 1PJRA 3IHUA 2DU9A 4XK4A 5K7FA 3J81K 4DYQA 1T0FC 4JX6A 4RDUA 4EGYA 4G7ZF 1HDDC 5D4RA 2PJRB 1WZ2A 2OPTA 4UXNA 5B66C 4GO1A 2VE9A 3DEUA 1MDMA 3HOWJ 4DW6A 5D5UB 2DPDA 2VQLA 2JT1A 3JR9A 4ZTJA 1I6XA 2K86A 2P81A 2JUGA 2XPWA 4ON0A 1ZG1A 4I7HA 1YTYA 1MBHA 2DFEA 3DP7A 2NS7A 3ZMZA 2FUG2 2RDPA 3C3WA 1OCTC 3BQZA 1TT0A 3C18A 3FK6A 2FNAA 1SEUA 1R4MB 3FXRA 1BOBA 1Z3XA 4N9IA 1WFXA 2NVYJ 1VQ6I 3M9AA 3CF2A 2A61A 1I3QJ 3I53A 3WE3A 2R5YA 3VPRA 2E1CA 4B43A 2COBA 2EH3A 1GV2A 4LG0B 3CDLA 4XKCA 4XNFA 4BUPA 4OOIA 3GX4X 2HQRA 3DCFA 3EYIA 1SFKA 2WWYA 3QPLA 3HHHA 3E5QA 3FMRA 1ZKGA 2H09A 2VUMJ 3QQAA 2Y2ZA 1SANA 3FM3A 3CCLI 1HOMA 3LSTA 1YITI 1P9QC 2COMA 2L9VA 3OYNA 3QWLA 4HEA2 4AYBA 1ETQA 3BR0A 3IV5A 3ASOH 2DA4A 3HGGA 4Y13A 4R79A 1LQ1A 1EF4A 4M73A 2DK5A 3HPHA 1Z6RA 5J8FA 1XMKA 1NH3A 2DFHA 1X19A 3J80K 4Q48A 3QYBA 3EPZA 3OR2C 3PSFA 1FMWA 2B7EA 2RVCA 2WAQN 1JKPC 4JP0A 2E2IJ 2R93J 1G3WA 5DTDA 1SC7A 1JTYA 3JW4A 5M5WJ 4A3GJ 4ENNA 4E7SA 1GV5A 4AIJA 3S3OA 4D7NA 5GTHC 3OYMA 4IKFA 2JVGA 3L7WA 1U0JA 5C4JJ 3CCUI 2LMDA 4HDVA 4HX8A 2JZYA 5DUKA 3ZMTA 2K9QA 4XONA 5JI6A 1BC8C 1A36A 3MZ8A 5AONA 4BNCA 2H6BA 1N75A 1Y8RB 3CDHA 3W6JB 2R3SA 1J75A 1BBYA 1R22A 5D5XB 1FYKA 1I39A 2JN6A 1PYVA 5IYBJ 1USSA 3CJNA 4M6VA 1XTAA 4DJAA 5CVJA 4BJTA 1KYWA 4PFPA 5HOOA 2VOOA 5A2QK 1DUXC 4PJNA 1T0FA 3H9GA 2XKOA 1J2XA 5L3DA 3LSJA 3E97A 5CVVA 4OIPF 4AM3A 2BYVE 4G9YA 3G3ZA 3CO6C 1TZLA 3ABUA 2OD5A 4BS9A 4IOAF 3DF8A 1H9GA 4A3EJ 2DXIA 3ZMUA 2VKVA
chains in the Genus database with same CATH topology
4PCQA 1XGOA 2FE3A 2L4AA 3I4PA 4HDUA 2Q2EA 4A5MA 5D6EA 3F21A 1FBQA 2EA4A 2DPUA 1S29A 2EV0A 2ZFWA 2XAFA 1SMYF 1K78B 1KQ8A 4FX4A 4PZJA 2VXZA 1SD6A 2OQRA 1IAWA 2DT5A 4LJZF 2QLZA 2Z99A 1F9NA 4L9NA 2GAUA 4H0EA 4QLCU 2HS5A 1T2KA 2Y48A 1GVJA 4R8HA 3MWMA 3BOQA 3TO7A 3T5XA 3QP6A 2VBZA 1G3TA 2QBYA 5DCMA 2HDCA 5BMZA 2GWRA 1RUOA 1R1UA 2KJBA 2PMHA 1ULYA 4P5OA 2HGCA 2OZ6A 4ZYDA 3CUOA 5LRSA 4K2EA 4LGWA 2V1XA 5KK1A 1MD0A 3BJAA 2EV5A 3U2RA 4L5IA 1IN8A 1WQ2A 1JHHA 2F2EA 4IHSA 4WXCA 1F5TA 1R36A 4I98B 4WK8F 2VE8A 2GXGA 2MLKA 2PN6A 3SZPA 3HSEA 4M9XA 2YX7A 3K0LA 5ILSA 3GO5A 3E6BA 2QUFA 2D1HA 1ZN2A 2EJRA 1XSXA 4A5NA 2D2WA 3KP4A 3K69A 1FT9A 2GZWA 2EFOA 2YPRA 1RNLA 3WU0A 2ZNZA 1IN7A 4MTDA 2YU3A 3E6DA 3MFKA 1EH8A 5ICGA 3BP8A 3RYRA 5BS6A 1S7OA 1LDKB 2GQQA 4UVAA 2L02A 3N4MA 3S2WA 1SD5A 4PGHA 3L2CA 3M8EA 4LB5A 3IKTA 4R1HA 2DLLA 3K1PA 4B09A 2XROA 1PUEE 2ZKZA 5LRRA 3KFWX 1DP7P 3KP7A 4IRIA 3F72A 4RGSA 1MJAA 3FX3A 4ETSA 2ACJA 3V7RA 2FMLA 1PDNC 3WTUC 1T38A 1UB9A 2IJLA 4HBLA 2V1DA 4LG0A 3IRRA 2JPBA 1XDUA 4N0BA 3WGHA 1MJBA 1C0WA 1X3UA 3QRFF 2HWVA 4I0AA 4AD9A 1ZLJA 1LVAA 3F22A 3BJOA 1LDDA 3B73A 2YX4A 4L9VA 3TO6A 2FRHA 2XAQA 1HBXG 4HF1A 2H6CA 2JPCA 1BI0A 3GFLA 2X4HA 2YR2A 5ED4A 3MAJA 1UCRA 4M71A 2LF7A 3F3XA 2BE5F 5LEKA 1TW3A 2ZO4A 1S7AA 3O2PE 4A6DA 4EMSA 2ISZA 2ZNYA 4IXAA 1W5TA 4G7OF 2V79A 1TW2A 2XVCA 4KUMA 3O3KA 3KE2A 1XB4A 1HQCA 3ZN1A 2PQ8A 1EH7A 4CO8A 3K1MA 1Z91A 1JGSA 1IUYA 4HV5A 4EM1A 4LMYA 3V8JA 2DBBA 1GXPA 2IA1A 2FBKA 1RZ4A 1E2XA 4Y15A 1BI3A 1LEAA 1YW7A 4GCVA 2P7VB 2OBPA 2Z3YA 1JXSA 1YQAA 2FEZA 4YFKF 3DQVC 3TGNA 2ELHA 5IT9K 5L3GA 2DK8A 3F8MA 1K78A 1IXSB 4OU0A 3WTTC 2A69F 5CJ9A 1O7FA 2ZJ2A 1UFMA 1FX7A 3IC7A 2CYYA 1DPUA 5BPDA 1K7AA 2FA5A 2E7WA 2VODA 3IWFA 1ZRCA 4HX7A 4I09A 2EFNA 4A0YA 1IN6A 2HQNA 1ZG5A 1O57A 3LWFA 1KA8A 4BQAA 3W6KB 1W7PD 2EFQA 4E70A 3GUDA 4HF2A 1LNWA 3E3VA 3WTYC 2DW4A 1ZYRF 4ESBA 3SHFA 3CUQB 1J5YA 5HS7A 4L9TA 2AS5F 1L3LA 3KZYA 3P9IA 1O3SA 5E1XA 1P2FA 4OIOF 4A2UA 4XSXF 5LHIA 5DD8A 6PAXA 1BI2A 2FXAA 2FNPA 1B9NA 1K6OA 3R61A 3R60A 1IRGA 1TQMA 1Z7UA 4IVNA 1S6LA 3ZPLA 5CVIA 3REOA 1I5ZA 3EYYA 1PP7U 1USTA 1TLHB 1O3TA 3HOTA 1ZH5A 5AIPA 2VBXA 1FYLA 5HS9A 3AAFA 2PI0A 4LB6B 1OR7A 1AWCA 2IW5A 1WSUA 3HIFA 1MJ9A 2A68F 2LF8A 2RQPA 3WTXC 3I0TA 5ICCA 1SD7A 5E20A 1HKSA 3FZVA 2PG4A 2MH2A 2FQ3A 3NEUA 2VOPA 1JE8A 2W24A 2RN7A 1TTYA 4LK0F 4RGUA 1XSVA 2LNBA 2P6SA 4UV8A 1YLFA 4G94A 3HSFA 1FP2A 2FU4A 3RPQA 3T0YA 3GFMA 3HRSA 4RB0A 4EJWA 1H9TA 5FLXZ 1KYZA 3DV8A 3BWGA 4KNYA 2P6TA 4KA4A 4KIGA 1Z1DA 2V9VA 4N9HA 5ERIA 4ZZDA 3GEZA 2F5EA 4ZH4F 3VODA 5L3CA 1WRJA 4U7BA 1U3EM 3T8RA 4RB2C 1MGTA 3LAJA 4UHTA 4YFNF 3JTGA 4CHUA 1IN5A 2EFPA 1REPC 1BIBA 2FBIA 2XKPA 3F8NA 2ISYA 1YW9A 4UNOA 4WX9A 2B0LA 4IHTA 3NRVA 1PP8F 1D8JA 2X0LA 2PEXA 3K1NA 2F5DA 5CLSA 1SAXA 1G4DA 3HRUA 3GF2A 1P6RA 4WF2A 4PGGA 5HDKA 1HW2A 1U6GA 3HYIA 4CGZA 1QO0D 1P4WA 3L00A 2A3SA 4HZFA 4L0ZB 3RPUA 5LGTA 3M8FA 3CUQC 2KRFA 3MZYA 2HFHA 5FFZA 1ON1A 4MEXF 5KVRA 2QWWA 3QAHA 1P4XA 3ERED 2YSRA 2RKHA 5J8CA 5CVUA 2O0YA 2L3DA 2OQGA 1T39A 1ZREA 1R1TA 4RAZA 1UHMA 5HLHA 1O3RA 2ZCWA 3VEPA 1B6AA 2UXXA 2O03A 1BC7C 2Q8KA 1ONVA 1R5GA 1RIOH 4Q5SF 1GXQA 2QM3A 1B1BA 1B59A 1FOKA 3QOPA 1QZYA 1RI7A 3JSOA 1ZRDA 4M74A 4I02A 3F8BA 1J7KA 2DFIA 2BBYA 4RB3C 2NYXA 2VBWA 3RKXA 5FLXK 2W84A 5E1ZB 1B4AA 3I54A 2UXNA 2NRAC 2LKPA 1STZA 1D5VA 3E5UA 5ILUA 4HOBA 5HVQC 1U2WA 4RB1A 5F64A 4LK1F 3GW2A 2H94A 3WGIA 3BPVA 3WG9A 3GWZA 2MC3A 3GYHX 3HTUA 3DPLC 3CUQA 4YG2F 1HW5A 5CVRA 3V7CA 2QQAA 1EV7A 4U7DA 3TOBA 2ZMEB 5H6QA 1OYIA 4HQEA 2CQKA 3TKYA 4HQMA 1YG2A 3F6VA 3KEOA 1BI1A 4XLPF 1G3SA 1ZGAA 5DCFA 3FXUA 2VN2A 2VBYA 1QNTA 2FSWA 3IL2A 1E17A 3DXJF 3FWEA 5D4SA 5L3EA 4M6YA 5LEJA 1HW1A 5E8IA 3JAMZ 2R7DA 3E5XA 4BHBA 4KMUX 4WXHA 2O3FA 4ENJA 3TDZC 1XGNA 1ZAOA 3WTZA 3DFGA 3RYPA 4BAYA 1XMAA 3R0JA 1R7JA 2P5VA 2H27A 4P96A 1AOYA 2KJCA 1J9IA 2HKOA 3KEQA 5E18F 3SFZA 3F6OA 2EWNA 3GZ6A 2RNJA 3ML6A 3C1DA 4RAYA 1GHCA 5BPIA 3DPTA 4EM2A 2A07F 2IVMA 2UWMA 3WTSC 2RV8A 1KQ0A 2CW0F 3BZ6A 1P92A 1SD4A 4P9UA 5E17F 4EV0A 1QGPA 3H3UA 2F5CA 1R5HA 3ECOA 5LBQA 3P7NA 4HYEA 4YIFA 3HRMA 1P4AA 1OYWA 1FY7A 4ZYEA 2W85A 2UZKA 4U0WA 4IPAA 5E8GA 1U5TC 5F1RA 1JHFA 3R6SA 4KIBA 1BN5A 5K5QA 1LB2A 1FPQA 3O6BB 4Q4ZF 2TDXA 1W4MA 1OKRA 2WC2A 1T98A 1FBUA 3R4KA 4G6DA 4S04A 3H3ZA 3QPTA 2K02A 4LLLA 5L3BA 4DNCA 1WWXA 3JAMK 4D0PA 3L9FA 4KIFA 1QBJA 2G7UA 5DD4A 3QPHA 2KKOA 2A5YB 1YFHA 2FBHA 3ZMSA 1O3QA 4A6EA 1KU9A 2MH9A 4MQ9F 3V8LA 2OA4A 4CICA 2MD5A 3RJPA 5LGNA 2BEOA 2DQRA 2L01A 4ASNA 3RTRA 2HR3A 4MHGA 2FMYA 4AIKA 5DDGA 2XAGA 3PQJA 2G9WA 1ZARA 1YS7A 4ENKA 2A6HF 4A0XA 2XHKA 4JK1X 5ICEA 3VFZA 3M1EA 5H20A 4UVBA 1FC3A 1OPCA 1YS6A 5LHHA 1YIOA 4NQWA 4PDKA 2EK5A 3FHZA 3ELKA 3ZMDA 1BOAA 3KCCA 1WKMA 3BPXA 1J0RA 1FYMA 3BDDA 2PBIA 5EEHA 2IT0A 5K5OA 2CG4A 2WTEA 5FD5A 3EQLF 4NHJA 3ZP5A 4Z2YA 2NS0A 5LLQA 1FZPB 3T8TA 4KMFA 2DO7A 3RIRA 1KGSA 4G8XA 3QU6A 1CGPA 2DI3A 3LAPA 2IPQX 4OINF 2F5FA 2Z9OA 4CZZA 2M87A 2D45A 3I64A 5DUIA 3HHGA 3BROA 4GYGA 3JSPA 3ISPA 1FNNA 3CLOA 5IT3A 4YFXF 2ZMEA 1TNSA 4XBFA 2ETHA 4HF0A 2ESHA 4A0ZA 3D0SA 2EA2A 4LLGF 1U8RA 1V3FA 1YO5C 2ZXJA 2PJPA 3RKWA 4G7HF 3RDIA 4UVCA 1I1SA 3FM5A 1SFUA 1SFXA 5L3FA 2E7XA 1A04A 3LA2A 4XRFA 3LFKA 3FF5A 3ZN0A 2K27A 2O6GE 2DAOA 5DYMA 3I58A 3TDUC 4M9SA 3JTHA 2PMUA 4L5JA 2HYFA 3PQKA 2HKXA 2GA2A 1ZLKA 4MEYF 2EB7A 2XUBA 2Z33A 1CF7B 3MEXA 2EFWA 3ECHA 1IW7F 1I27A 1R23A 1W7PB 4QWQA 5D8LB 4KYWA 4NB5A 2K4JA 3LA3A 3KETA 3KLOA 3V4GA 5TJJA 1Z6TA 4P55A 2QQBA 5K1YA 3GXOA 1HSTA 2M45A 4A12A 2QENA 3U9GA 4M6XA 2XASA 2STWA 2PFBA 4O6JA 3VB2A 3TOAA 2C6YA 3ULQB 4S05A 2BV6A 3HSRA 4HV6A 1FBSA 5LHGA 2XV4S 5JR3A 1L0OC 5TRDA 1FSEA 3KP6A 3GFIA 3C7JA 4KN4X 2J5PA 3GFJA 4EM0B 3Q9SA 1G6NA 2L54A 2IP2A 1K79A 2Z5UA 3E6MA 2P5KA 2Y0MA 2QQ9A 3U1DA 1TBXA 1DDNA 4U88A 1KU2A 2XIGA 2O8XA 4JBAA 2G7HA 3T1BA 3BY6A 4OIRF 2LDUA 3B02A 3WTWC 3WODF 1OYYA 2P5LC 5HDNA 4FHTA 3SZTA 3FXQA 2JTVA 4EQQA 5DEQA 3PFIA 2VT2A 4G6QA 3ZMVA 3EETA 3LA7A 1Z05A 2Q0OA 1ZRFA 3I5UA 3L09A 4ZZLA 4BYYA 2M1BA 3R0AA 4GXOA 1XGSA 2VC0A 2NAZA 4HAMA 2CGPA 4EJTA 1U5TB 1Y0UA 2JSCA 2K7LA 2W25A 4ZYGA 1TQPA 4UUVA 2XRNA 2QZ8A 4YIIA 4AVPA 3LQRA 2MA3A 5LGUA 2QYOA 5BQTA 1R1VA 4KDPA 5JFRA 5K5RA 2BGCA 3CTAA 2HTSA 4EJUA 1TQIA 2GIVA 3ABTA 3OV8A 4IF4A 2MBFA 3RKYA 3MCZA 3V8KA 1LJ9A 4XSZF 1IF1A 1BIAA 4UV9A 1XN7A 4MGRA 4FX0A 1OMIA 4LD5A 4MTEA 4AWXB 4GGGA 5D5WB 4FT8A 1U78A 3MZHA 4I01A 2NNYA 3K2ZA 4ZYHA 2Y75A 4EJVA 3Q5FA 4XLNF 2E1NA 1NHAA 3TQNA 1HKTA 1D3YA 2OZUA 4M9ZA 3I59B 4LLNA 2HEOA 3E6CC 5E1WA 1G3YA 4F7ZA 5FFXA 1KU3A 1UHWA 1QQIA 1RUNA 3MQ0A 1IN4A 3HRTA 1IZ1A 1YYVA 1BM9A 3QP5A 1XSDA 3WTVC 5FO5A 1ZGJA 4IRGA 2O61A 4MNUA 2M30A 4HLYA 1MDMB 4KICA 3QU3A 4OIQF 1R58A 1IXRC 3M7GA 1CF7A 1EH6A 2HTJA 3I71A 2P7CB 1MKMA 1LDJA 4CDGA 3KLNA 4IJAA 1W7PA 3RI4A 3OOPA 2IA0A 2FOKA 2VC1A 4B8XA 5IT9Z 1SMTA 1FLIA 1ON2A 4I0BA 1S3JA 3ROUA 3V7SA 3CO7C 4Y17A 5AIQA 1F1ZA 1V4RA 5FGMA 1O7LA 1J59A 3IKVA 4OMZA 2RC4A 1S8NA 2XGXA 4OMYA 2VT3A 2K4BA 5FB2A 1HSJA 4BHPA 1XCVA 3NQOA 3GVAA 3GLXA 2PLYA 4EGZA 2ESNA 3IWZA 1XCBA 2NNNA 2GA1A 2CO5A 3F8FA 2OU2A 2ZBKA 3TO9A 4AIHA 4GYIA 3N97A 1Q1HA 4BXUA 4ENMA 1WI9A 1W5SA 1YW8A 4CXFA 2J5OA 3KP2A 2LSOA 4ESJA 1ZG3A 1FSHA 4U0YA 2KIFA 4LFUA 1FWZA 4EVIA 4ESFA 5ICFA 4I2OA 5HLIA 4P9FA 3LQQA 5HLGA 2CWEA 3KP5A 2OAZA 4EJOA 4Q47A 5D6FA 4L18B 3G73A 3BJ6A 4RS8A 2M8EA 5FD6A 2AXLA 2P8TA 1H0MA 2FF4A 3J7AO 1LEBA 4JQFA 2DTRA 2IRFG 1HKQA 3P9KA 4BH9A 2EV6A 4MQVA 2WV0A 3WU1B 4KT5C 1HXDA 4L0YB 5J6XA 2M5WA 4HW0A 1XD7A 3FMSA 2HZTA 3GZ5A 1B9MA 3J81Z 2MLGA 3ZQ7A 1IRFA 1R00A 2KIMA 3SXYA 3WGGA 1Z9CA 1DPRA 1TNTA 3HTSB 3WE2A 2XAJA 1KU7A 4HLXA 5DV5A 5JVTA 3HUGA 4TV7A 2GXBA 2KIUA 3F8CA 1QPMA 3FMQA 1U5TA 3F23A 4RGXA 2XAHA 4KFCA 2P4WA 1SFEA 4RGRA 4HA8A 2CFXA 2QBYB 5DCMB 5JHUA 4BHCA 2L4MA 1ZHFA 2QVOA 1ODDA 2HYGD 3H92A 5HDGA 3KZZA 3Q9VA 4O3MA 2CSOA 2A6EF 2RGVA 4KN7X 3J80Z 5ILVA 2V1UA 4IRHA 2JRTA 2V6CA 5CYVA 5BOXA 5D5VB 3SQNA 1XDSA 5HS8A 1F4KA 4WWCA 1MZBA 4CYDA 4HX4A 4WXDA 1D8KA 4DQ2A 3K9TA 3HOSA 2VONA 2W57A 1KQ9A 3IRQA 2IA2A 4U0VA 2HOEA 5F6FA 5A2QZ 2D1VA 3I59A 3P9CA 5EEGA 3D5LA 1XGMA 3KP3A 1VTNC 1I1GA 3EUHA 3COAC 1IXCA 2DQLA 1T6SA 5H6RA 3VOEA 2R7FA 3DKWA 1FP1D 2STTA 4L9JA 2ADUA 3EDPA 1BJAA 1QZZA 4O5VA 5D8KB 4WCGA 3IHUA 2DU9A 3J81K 4EGYA 4G7ZF 5D4RA 4UXNA 4GO1A 2VE9A 3DEUA 1MDMA 5D5UB 2DPDA 2JT1A 1I6XA 2K86A 4ON0A 1ZG1A 4I7HA 1YTYA 3DP7A 3ZMZA 2RDPA 3C3WA 3C18A 2FNAA 3FXRA 4N9IA 3M9AA 2A61A 3I53A 3WE3A 2E1CA 4LG0B 4OOIA 3GX4X 2HQRA 3EYIA 2WWYA 3HHHA 3E5QA 3FMRA 2H09A 3FM3A 3LSTA 2COMA 4Y13A 4R79A 1LQ1A 4M73A 2DK5A 1Z6RA 5J8FA 1XMKA 3J80K 4Q48A 2RVCA 1G3WA 3JW4A 4ENNA 4AIJA 3L7WA 4HDVA 4HX8A 2JZYA 5DUKA 3ZMTA 5JI6A 1BC8C 5AONA 4BNCA 2H6BA 3CDHA 3W6JB 2R3SA 1J75A 1BBYA 1R22A 5D5XB 1FYKA 1USSA 3CJNA 5CVJA 1KYWA 5HOOA 2VOOA 5A2QK 1DUXC 1T0FA 2XKOA 1J2XA 5L3DA 4OIPF 3E97A 5CVVA 2BYVE 4G9YA 3G3ZA 3CO6C 3ABUA 2OD5A 3DF8A 1H9GA 3ZMUA 4M72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PCQ A;  1XGO A;  2FE3 A;  2L4A A;  3I4P A;  4HDU A;  2Q2E A;  4A5M A;  5D6E A;  3F21 A;  1FBQ A;  2EA4 A;  2DPU A;  1S29 A;  2EV0 A;  2ZFW A;  2XAF A;  1SMY F;  1K78 B;  1KQ8 A;  4FX4 A;  4PZJ A;  2VXZ A;  1SD6 A;  2OQR A;  1IAW A;  2DT5 A;  4LJZ F;  2QLZ A;  2Z99 A;  1F9N A;  4L9N A;  2GAU A;  4H0E A;  4QLC U;  2HS5 A;  1T2K A;  2Y48 A;  1GVJ A;  4R8H A;  3MWM A;  3BOQ A;  3TO7 A;  3T5X A;  3QP6 A;  2VBZ A;  1G3T A;  2QBY A;  5DCM A;  2HDC A;  5BMZ A;  2GWR A;  1RUO A;  1R1U A;  2KJB A;  2PMH A;  1ULY A;  4P5O A;  2HGC A;  2OZ6 A;  4ZYD A;  3CUO A;  5LRS A;  4K2E A;  4LGW A;  2V1X A;  5KK1 A;  1MD0 A;  3BJA A;  2EV5 A;  3U2R A;  4L5I A;  1IN8 A;  1WQ2 A;  1JHH A;  2F2E A;  4IHS A;  4WXC A;  1F5T A;  1R36 A;  4I98 B;  4WK8 F;  2VE8 A;  2GXG A;  2MLK A;  2PN6 A;  3SZP A;  3HSE A;  4M9X A;  2YX7 A;  3K0L A;  5ILS A;  3GO5 A;  3E6B A;  2QUF A;  2D1H A;  1ZN2 A;  2EJR A;  1XSX A;  4A5N A;  2D2W A;  3KP4 A;  3K69 A;  1FT9 A;  2GZW A;  2EFO A;  2YPR A;  1RNL A;  3WU0 A;  2ZNZ A;  1IN7 A;  4MTD A;  2YU3 A;  3E6D A;  3MFK A;  1EH8 A;  5ICG A;  3BP8 A;  3RYR A;  5BS6 A;  1S7O A;  1LDK B;  2GQQ A;  4UVA A;  2L02 A;  3N4M A;  3S2W A;  1SD5 A;  4PGH A;  3L2C A;  3M8E A;  4LB5 A;  3IKT A;  4R1H A;  2DLL A;  3K1P A;  4B09 A;  2XRO A;  1PUE E;  2ZKZ A;  5LRR A;  3KFW X;  1DP7 P;  3KP7 A;  4IRI A;  3F72 A;  4RGS A;  1MJA A;  3FX3 A;  4ETS A;  2ACJ A;  3V7R A;  2FML A;  1PDN C;  3WTU C;  1T38 A;  1UB9 A;  2IJL A;  4HBL A;  2V1D A;  4LG0 A;  3IRR A;  2JPB A;  1XDU A;  4N0B A;  3WGH A;  1MJB A;  1C0W A;  1X3U A;  3QRF F;  2HWV A;  4I0A A;  4AD9 A;  1ZLJ A;  1LVA A;  3F22 A;  3BJO A;  1LDD A;  3B73 A;  2YX4 A;  4L9V A;  3TO6 A;  2FRH A;  2XAQ A;  1HBX G;  4HF1 A;  2H6C A;  2JPC A;  1BI0 A;  3GFL A;  2X4H A;  2YR2 A;  5ED4 A;  3MAJ A;  1UCR A;  4M71 A;  2LF7 A;  3F3X A;  2BE5 F;  5LEK A;  1TW3 A;  2ZO4 A;  1S7A A;  3O2P E;  4A6D A;  4EMS A;  2ISZ A;  2ZNY A;  4IXA A;  1W5T A;  4G7O F;  2V79 A;  1TW2 A;  2XVC A;  4KUM A;  3O3K A;  3KE2 A;  1XB4 A;  1HQC A;  3ZN1 A;  2PQ8 A;  1EH7 A;  4CO8 A;  3K1M A;  1Z91 A;  1JGS A;  1IUY A;  4HV5 A;  4EM1 A;  4LMY A;  3V8J A;  2DBB A;  1GXP A;  2IA1 A;  2FBK A;  1RZ4 A;  1E2X A;  4Y15 A;  1BI3 A;  1LEA A;  1YW7 A;  4GCV A;  2P7V B;  2OBP A;  2Z3Y A;  1JXS A;  1YQA A;  2FEZ A;  4YFK F;  3DQV C;  3TGN A;  2ELH A;  5IT9 K;  5L3G A;  2DK8 A;  3F8M A;  1K78 A;  1IXS B;  4OU0 A;  3WTT C;  2A69 F;  5CJ9 A;  1O7F A;  2ZJ2 A;  1UFM A;  1FX7 A;  3IC7 A;  2CYY A;  1DPU A;  5BPD A;  1K7A A;  2FA5 A;  2E7W A;  2VOD A;  3IWF A;  1ZRC A;  4HX7 A;  4I09 A;  2EFN A;  4A0Y A;  1IN6 A;  2HQN A;  1ZG5 A;  1O57 A;  3LWF A;  1KA8 A;  4BQA A;  3W6K B;  1W7P D;  2EFQ A;  4E70 A;  3GUD A;  4HF2 A;  1LNW A;  3E3V A;  3WTY C;  2DW4 A;  1ZYR F;  4ESB A;  3SHF A;  3CUQ B;  1J5Y A;  5HS7 A;  4L9T A;  2AS5 F;  1L3L A;  3KZY A;  3P9I A;  1O3S A;  5E1X A;  1P2F A;  4OIO F;  4A2U A;  4XSX F;  5LHI A;  5DD8 A;  6PAX A;  1BI2 A;  2FXA A;  2FNP A;  1B9N A;  1K6O A;  3R61 A;  3R60 A;  1IRG A;  1TQM A;  1Z7U A;  4IVN A;  1S6L A;  3ZPL A;  5CVI A;  3REO A;  1I5Z A;  3EYY A;  1PP7 U;  1UST A;  1TLH B;  1O3T A;  3HOT A;  1ZH5 A;  5AIP A;  2VBX A;  1FYL A;  5HS9 A;  3AAF A;  2PI0 A;  4LB6 B;  1OR7 A;  1AWC A;  2IW5 A;  1WSU A;  3HIF A;  1MJ9 A;  2A68 F;  2LF8 A;  2RQP A;  3WTX C;  3I0T A;  5ICC A;  1SD7 A;  5E20 A;  1HKS A;  3FZV A;  2PG4 A;  2MH2 A;  2FQ3 A;  3NEU A;  2VOP A;  1JE8 A;  2W24 A;  2RN7 A;  1TTY A;  4LK0 F;  4RGU A;  1XSV A;  2LNB A;  2P6S A;  4UV8 A;  1YLF A;  4G94 A;  3HSF A;  1FP2 A;  2FU4 A;  3RPQ A;  3T0Y A;  3GFM A;  3HRS A;  4RB0 A;  4EJW A;  1H9T A;  5FLX Z;  1KYZ A;  3DV8 A;  3BWG A;  4KNY A;  2P6T A;  4KA4 A;  4KIG A;  1Z1D A;  2V9V A;  4N9H A;  5ERI A;  4ZZD A;  3GEZ A;  2F5E A;  4ZH4 F;  3VOD A;  5L3C A;  1WRJ A;  4U7B A;  1U3E M;  3T8R A;  4RB2 C;  1MGT A;  3LAJ A;  4UHT A;  4YFN F;  3JTG A;  4CHU A;  1IN5 A;  2EFP A;  1REP C;  1BIB A;  2FBI A;  2XKP A;  3F8N A;  2ISY A;  1YW9 A;  4UNO A;  4WX9 A;  2B0L A;  4IHT A;  3NRV A;  1PP8 F;  1D8J A;  2X0L A;  2PEX A;  3K1N A;  2F5D A;  5CLS A;  1SAX A;  1G4D A;  3HRU A;  3GF2 A;  1P6R A;  4WF2 A;  4PGG A;  5HDK A;  1HW2 A;  1U6G A;  3HYI A;  4CGZ A;  1QO0 D;  1P4W A;  3L00 A;  2A3S A;  4HZF A;  4L0Z B;  3RPU A;  5LGT A;  3M8F A;  3CUQ C;  2KRF A;  3MZY A;  2HFH A;  5FFZ A;  1ON1 A;  4MEX F;  5KVR A;  2QWW A;  3QAH A;  1P4X A;  3ERE D;  2YSR A;  2RKH A;  5J8C A;  5CVU A;  2O0Y A;  2L3D A;  2OQG A;  1T39 A;  1ZRE A;  1R1T A;  4RAZ A;  1UHM A;  5HLH A;  1O3R A;  2ZCW A;  3VEP A;  1B6A A;  2UXX A;  2O03 A;  1BC7 C;  2Q8K A;  1ONV A;  1R5G A;  1RIO H;  4Q5S F;  1GXQ A;  2QM3 A;  1B1B A;  1B59 A;  1FOK A;  3QOP A;  1QZY A;  1RI7 A;  3JSO A;  1ZRD A;  4M74 A;  4I02 A;  3F8B A;  1J7K A;  2DFI A;  2BBY A;  4RB3 C;  2NYX A;  2VBW A;  3RKX A;  5FLX K;  2W84 A;  5E1Z B;  1B4A A;  3I54 A;  2UXN A;  2NRA C;  2LKP A;  1STZ A;  1D5V A;  3E5U A;  5ILU A;  4HOB A;  5HVQ C;  1U2W A;  4RB1 A;  5F64 A;  4LK1 F;  3GW2 A;  2H94 A;  3WGI A;  3BPV A;  3WG9 A;  3GWZ A;  2MC3 A;  3GYH X;  3HTU A;  3DPL C;  3CUQ A;  4YG2 F;  1HW5 A;  5CVR A;  3V7C A;  2QQA A;  1EV7 A;  4U7D A;  3TOB A;  2ZME B;  5H6Q A;  1OYI A;  4HQE A;  2CQK A;  3TKY A;  4HQM A;  1YG2 A;  3F6V A;  3KEO A;  1BI1 A;  4XLP F;  1G3S A;  1ZGA A;  5DCF A;  3FXU A;  2VN2 A;  2VBY A;  1QNT A;  2FSW A;  3IL2 A;  1E17 A;  3DXJ F;  3FWE A;  5D4S A;  5L3E A;  4M6Y A;  5LEJ A;  1HW1 A;  5E8I A;  3JAM Z;  2R7D A;  3E5X A;  4BHB A;  4KMU X;  4WXH A;  2O3F A;  4ENJ A;  3TDZ C;  1XGN A;  1ZAO A;  3WTZ A;  3DFG A;  3RYP A;  4BAY A;  1XMA A;  3R0J A;  1R7J A;  2P5V A;  2H27 A;  4P96 A;  1AOY A;  2KJC A;  1J9I A;  2HKO A;  3KEQ A;  5E18 F;  3SFZ A;  3F6O A;  2EWN A;  3GZ6 A;  2RNJ A;  3ML6 A;  3C1D A;  4RAY A;  1GHC A;  5BPI A;  3DPT A;  4EM2 A;  2A07 F;  2IVM A;  2UWM A;  3WTS C;  2RV8 A;  1KQ0 A;  2CW0 F;  3BZ6 A;  1P92 A;  1SD4 A;  4P9U A;  5E17 F;  4EV0 A;  1QGP A;  3H3U A;  2F5C A;  1R5H A;  3ECO A;  5LBQ A;  3P7N A;  4HYE A;  4YIF A;  3HRM A;  1P4A A;  1OYW A;  1FY7 A;  4ZYE A;  2W85 A;  2UZK A;  4U0W A;  4IPA A;  5E8G A;  1U5T C;  5F1R A;  1JHF A;  3R6S A;  4KIB A;  1BN5 A;  5K5Q A;  1LB2 A;  1FPQ A;  3O6B B;  4Q4Z F;  2TDX A;  1W4M A;  1OKR A;  2WC2 A;  1T98 A;  1FBU A;  3R4K A;  4G6D A;  4S04 A;  3H3Z A;  3QPT A;  2K02 A;  4LLL A;  5L3B A;  4DNC A;  1WWX A;  3JAM K;  4D0P A;  3L9F A;  4KIF A;  1QBJ A;  2G7U A;  5DD4 A;  3QPH A;  2KKO A;  2A5Y B;  1YFH A;  2FBH A;  3ZMS A;  1O3Q A;  4A6E A;  1KU9 A;  2MH9 A;  4MQ9 F;  3V8L A;  2OA4 A;  4CIC A;  2MD5 A;  3RJP A;  5LGN A;  2BEO A;  2DQR A;  2L01 A;  4ASN A;  3RTR A;  2HR3 A;  4MHG A;  2FMY A;  4AIK A;  5DDG A;  2XAG A;  3PQJ A;  2G9W A;  1ZAR A;  1YS7 A;  4ENK A;  2A6H F;  4A0X A;  2XHK A;  4JK1 X;  5ICE A;  3VFZ A;  3M1E A;  5H20 A;  4UVB A;  1FC3 A;  1OPC A;  1YS6 A;  5LHH A;  1YIO A;  4NQW A;  4PDK A;  2EK5 A;  3FHZ A;  3ELK A;  3ZMD A;  1BOA A;  3KCC A;  1WKM A;  3BPX A;  1J0R A;  1FYM A;  3BDD A;  2PBI A;  5EEH A;  2IT0 A;  5K5O A;  2CG4 A;  2WTE A;  5FD5 A;  3EQL F;  4NHJ A;  3ZP5 A;  4Z2Y A;  2NS0 A;  5LLQ A;  1FZP B;  3T8T A;  4KMF A;  2DO7 A;  3RIR A;  1KGS A;  4G8X A;  3QU6 A;  1CGP A;  2DI3 A;  3LAP A;  2IPQ X;  4OIN F;  2F5F A;  2Z9O A;  4CZZ A;  2M87 A;  2D45 A;  3I64 A;  5DUI A;  3HHG A;  3BRO A;  4GYG A;  3JSP A;  3ISP A;  1FNN A;  3CLO A;  5IT3 A;  4YFX F;  2ZME A;  1TNS A;  4XBF A;  2ETH A;  4HF0 A;  2ESH A;  4A0Z A;  3D0S A;  2EA2 A;  4LLG F;  1U8R A;  1V3F A;  1YO5 C;  2ZXJ A;  2PJP A;  3RKW A;  4G7H F;  3RDI A;  4UVC A;  1I1S A;  3FM5 A;  1SFU A;  1SFX A;  5L3F A;  2E7X A;  1A04 A;  3LA2 A;  4XRF A;  3LFK A;  3FF5 A;  3ZN0 A;  2K27 A;  2O6G E;  2DAO A;  5DYM A;  3I58 A;  3TDU C;  4M9S A;  3JTH A;  2PMU A;  4L5J A;  2HYF A;  3PQK A;  2HKX A;  2GA2 A;  1ZLK A;  4MEY F;  2EB7 A;  2XUB A;  2Z33 A;  1CF7 B;  3MEX A;  2EFW A;  3ECH A;  1IW7 F;  1I27 A;  1R23 A;  1W7P B;  4QWQ A;  5D8L B;  4KYW A;  4NB5 A;  2K4J A;  3LA3 A;  3KET A;  3KLO A;  3V4G A;  5TJJ A;  1Z6T A;  4P55 A;  2QQB A;  5K1Y A;  3GXO A;  1HST A;  2M45 A;  4A12 A;  2QEN A;  3U9G A;  4M6X A;  2XAS A;  2STW A;  2PFB A;  4O6J A;  3VB2 A;  3TOA A;  2C6Y A;  3ULQ B;  4S05 A;  2BV6 A;  3HSR A;  4HV6 A;  1FBS A;  5LHG A;  2XV4 S;  5JR3 A;  1L0O C;  5TRD A;  1FSE A;  3KP6 A;  3GFI A;  3C7J A;  4KN4 X;  2J5P A;  3GFJ A;  4EM0 B;  3Q9S A;  1G6N A;  2L54 A;  2IP2 A;  1K79 A;  2Z5U A;  3E6M A;  2P5K A;  2Y0M A;  2QQ9 A;  3U1D A;  1TBX A;  1DDN A;  4U88 A;  1KU2 A;  2XIG A;  2O8X A;  4JBA A;  2G7H A;  3T1B A;  3BY6 A;  4OIR F;  2LDU A;  3B02 A;  3WTW C;  3WOD F;  1OYY A;  2P5L C;  5HDN A;  4FHT A;  3SZT A;  3FXQ A;  2JTV A;  4EQQ A;  5DEQ A;  3PFI A;  2VT2 A;  4G6Q A;  3ZMV A;  3EET A;  3LA7 A;  1Z05 A;  2Q0O A;  1ZRF A;  3I5U A;  3L09 A;  4ZZL A;  4BYY A;  2M1B A;  3R0A A;  4GXO A;  1XGS A;  2VC0 A;  2NAZ A;  4HAM A;  2CGP A;  4EJT A;  1U5T B;  1Y0U A;  2JSC A;  2K7L A;  2W25 A;  4ZYG A;  1TQP A;  4UUV A;  2XRN A;  2QZ8 A;  4YII A;  4AVP A;  3LQR A;  2MA3 A;  5LGU A;  2QYO A;  5BQT A;  1R1V A;  4KDP A;  5JFR A;  5K5R A;  2BGC A;  3CTA A;  2HTS A;  4EJU A;  1TQI A;  2GIV A;  3ABT A;  3OV8 A;  4IF4 A;  2MBF A;  3RKY A;  3MCZ A;  3V8K A;  1LJ9 A;  4XSZ F;  1IF1 A;  1BIA A;  4UV9 A;  1XN7 A;  4MGR A;  4FX0 A;  1OMI A;  4LD5 A;  4MTE A;  4AWX B;  4GGG A;  5D5W B;  4FT8 A;  1U78 A;  3MZH A;  4I01 A;  2NNY A;  3K2Z A;  4ZYH A;  2Y75 A;  4EJV A;  3Q5F A;  4XLN F;  2E1N A;  1NHA A;  3TQN A;  1HKT A;  1D3Y A;  2OZU A;  4M9Z A;  3I59 B;  4LLN A;  2HEO A;  3E6C C;  5E1W A;  1G3Y A;  4F7Z A;  5FFX A;  1KU3 A;  1UHW A;  1QQI A;  1RUN A;  3MQ0 A;  1IN4 A;  3HRT A;  1IZ1 A;  1YYV A;  1BM9 A;  3QP5 A;  1XSD A;  3WTV C;  5FO5 A;  1ZGJ A;  4IRG A;  2O61 A;  4MNU A;  2M30 A;  4HLY A;  1MDM B;  4KIC A;  3QU3 A;  4OIQ F;  1R58 A;  1IXR C;  3M7G A;  1CF7 A;  1EH6 A;  2HTJ A;  3I71 A;  2P7C B;  1MKM A;  1LDJ A;  4CDG A;  3KLN A;  4IJA A;  1W7P A;  3RI4 A;  3OOP A;  2IA0 A;  2FOK A;  2VC1 A;  4B8X A;  5IT9 Z;  1SMT A;  1FLI A;  1ON2 A;  4I0B A;  1S3J A;  3ROU A;  3V7S A;  3CO7 C;  4Y17 A;  5AIQ A;  1F1Z A;  1V4R A;  5FGM A;  1O7L A;  1J59 A;  3IKV A;  4OMZ A;  2RC4 A;  1S8N A;  2XGX A;  4OMY A;  2VT3 A;  2K4B A;  5FB2 A;  1HSJ A;  4BHP A;  1XCV A;  3NQO A;  3GVA A;  3GLX A;  2PLY A;  4EGZ A;  2ESN A;  3IWZ A;  1XCB A;  2NNN A;  2GA1 A;  2CO5 A;  3F8F A;  2OU2 A;  2ZBK A;  3TO9 A;  4AIH A;  4GYI A;  3N97 A;  1Q1H A;  4BXU A;  4ENM A;  1WI9 A;  1W5S A;  1YW8 A;  4CXF A;  2J5O A;  3KP2 A;  2LSO A;  4ESJ A;  1ZG3 A;  1FSH A;  4U0Y A;  2KIF A;  4LFU A;  1FWZ A;  4EVI A;  4ESF A;  5ICF A;  4I2O A;  5HLI A;  4P9F A;  3LQQ A;  5HLG A;  2CWE A;  3KP5 A;  2OAZ A;  4EJO A;  4Q47 A;  5D6F A;  4L18 B;  3G73 A;  3BJ6 A;  4RS8 A;  2M8E A;  5FD6 A;  2AXL A;  2P8T A;  1H0M A;  2FF4 A;  3J7A O;  1LEB A;  4JQF A;  2DTR A;  2IRF G;  1HKQ A;  3P9K A;  4BH9 A;  2EV6 A;  4MQV A;  2WV0 A;  3WU1 B;  4KT5 C;  1HXD A;  4L0Y B;  5J6X A;  2M5W A;  4HW0 A;  1XD7 A;  3FMS A;  2HZT A;  3GZ5 A;  1B9M A;  3J81 Z;  2MLG A;  3ZQ7 A;  1IRF A;  1R00 A;  2KIM A;  3SXY A;  3WGG A;  1Z9C A;  1DPR A;  1TNT A;  3HTS B;  3WE2 A;  2XAJ A;  1KU7 A;  4HLX A;  5DV5 A;  5JVT A;  3HUG A;  4TV7 A;  2GXB A;  2KIU A;  3F8C A;  1QPM A;  3FMQ A;  1U5T A;  3F23 A;  4RGX A;  2XAH A;  4KFC A;  2P4W A;  1SFE A;  4RGR A;  4HA8 A;  2CFX A;  2QBY B;  5DCM B;  5JHU A;  4BHC A;  2L4M A;  1ZHF A;  2QVO A;  1ODD A;  2HYG D;  3H92 A;  5HDG A;  3KZZ A;  3Q9V A;  4O3M A;  2CSO A;  2A6E F;  2RGV A;  4KN7 X;  3J80 Z;  5ILV A;  2V1U A;  4IRH A;  2JRT A;  2V6C A;  5CYV A;  5BOX A;  5D5V B;  3SQN A;  1XDS A;  5HS8 A;  1F4K A;  4WWC A;  1MZB A;  4CYD A;  4HX4 A;  4WXD A;  1D8K A;  4DQ2 A;  3K9T A;  3HOS A;  2VON A;  2W57 A;  1KQ9 A;  3IRQ A;  2IA2 A;  4U0V A;  2HOE A;  5F6F A;  5A2Q Z;  2D1V A;  3I59 A;  3P9C A;  5EEG A;  3D5L A;  1XGM A;  3KP3 A;  1VTN C;  1I1G A;  3EUH A;  3COA C;  1IXC A;  2DQL A;  1T6S A;  5H6R A;  3VOE A;  2R7F A;  3DKW A;  1FP1 D;  2STT A;  4L9J A;  2ADU A;  3EDP A;  1BJA A;  1QZZ A;  4O5V A;  5D8K B;  4WCG A;  3IHU A;  2DU9 A;  3J81 K;  4EGY A;  4G7Z F;  5D4R A;  4UXN A;  4GO1 A;  2VE9 A;  3DEU A;  1MDM A;  5D5U B;  2DPD A;  2JT1 A;  1I6X A;  2K86 A;  4ON0 A;  1ZG1 A;  4I7H A;  1YTY A;  3DP7 A;  3ZMZ A;  2RDP A;  3C3W A;  3C18 A;  2FNA A;  3FXR A;  4N9I A;  3M9A A;  2A61 A;  3I53 A;  3WE3 A;  2E1C A;  4LG0 B;  4OOI A;  3GX4 X;  2HQR A;  3EYI A;  2WWY A;  3HHH A;  3E5Q A;  3FMR A;  2H09 A;  3FM3 A;  3LST A;  2COM A;  4Y13 A;  4R79 A;  1LQ1 A;  4M73 A;  2DK5 A;  1Z6R A;  5J8F A;  1XMK A;  3J80 K;  4Q48 A;  2RVC A;  1G3W A;  3JW4 A;  4ENN A;  4AIJ A;  3L7W A;  4HDV A;  4HX8 A;  2JZY A;  5DUK A;  3ZMT A;  5JI6 A;  1BC8 C;  5AON A;  4BNC A;  2H6B A;  3CDH A;  3W6J B;  2R3S A;  1J75 A;  1BBY A;  1R22 A;  5D5X B;  1FYK A;  1USS A;  3CJN A;  5CVJ A;  1KYW A;  5HOO A;  2VOO A;  5A2Q K;  1DUX C;  1T0F A;  2XKO A;  1J2X A;  5L3D A;  4OIP F;  3E97 A;  5CVV A;  2BYV E;  4G9Y A;  3G3Z A;  3CO6 C;  3ABU A;  2OD5 A;  3DF8 A;  1H9G A;  3ZMU A;  4M72 A; 
#chains in the Genus database with same CATH topology
 5FKL A;  3FKI J;  4PCQ A;  2LY9 A;  1XGO A;  2FE3 A;  4BBR J;  2CUZ A;  1YRN A;  2L4A A;  1QVT A;  3I4P A;  4HDU A;  1QHG A;  2Q2E A;  4A5M A;  2NS8 A;  4RLF A;  5D6E A;  5J1Y A;  2VQH A;  4II3 A;  3OOU A;  3OYI A;  3F21 A;  1FBQ A;  4PFO A;  4FCY A;  2LRE A;  2WB1 N;  4Y3O A;  2EA4 A;  2DPU A;  1S29 A;  2EV0 A;  1OIS A;  2ZFW A;  2XAF A;  4U87 A;  4J00 A;  3P5J A;  1SMY F;  1Y8Q B;  1K78 B;  4L5E A;  1KQ8 A;  4B47 A;  4FX4 A;  4PZJ A;  1K6Y A;  1JTX A;  2VXZ A;  4UUS A;  3PIO F;  4DBQ A;  1RKW A;  1SD6 A;  2OQR A;  5EG0 B;  1IAW A;  2DT5 A;  4LJZ F;  4E4H A;  5K7H A;  3OYH A;  5IOZ A;  3CCS I;  2M7B A;  2QLZ A;  2Z99 A;  1F9N A;  4L9N A;  4C9Y A;  1Y1V J;  2GAU A;  3WG7 H;  4H0E A;  3FIW A;  4QLC U;  2HS5 A;  1T2K A;  2DMQ A;  1IDZ A;  2CRG A;  4NQW B;  5J40 A;  2Y48 A;  2BOL A;  2GOM A;  3VDX A;  5KNL A;  3A4C A;  1GVJ A;  1NK3 P;  4R8H A;  5EDN A;  4IO9 F;  2HOT A;  3MWM A;  1IC8 A;  3BOQ A;  2E5N A;  3RSN A;  2E34 A;  2M0C A;  3TO7 A;  3S32 A;  3T5X A;  3QP6 A;  2XF6 A;  2VBZ A;  1TWA J;  1G3T A;  3BG9 A;  2QBY A;  5DCM A;  2HDC A;  5BMZ A;  2GWR A;  2VKE A;  1RUO A;  1R1U A;  5J4Y A;  4V2G A;  2KJB A;  2PMH A;  1ETK A;  2LY1 A;  1G4D A;  1OFC X;  1ULY A;  2OV7 A;  4P5O A;  2ZXH A;  3BCB A;  2HGC A;  3CMY A;  5KAI C;  1D1B A;  2OZ6 A;  4ZYD A;  2IGK A;  2QQ8 A;  3FBN B;  3CUO A;  5FKN A;  3SDB A;  1Y56 A;  3SEQ A;  3DTE A;  5LRS A;  4K2E A;  3MD2 A;  4IHX A;  2BHZ A;  3UNG C;  1I6H J;  3HPG A;  4LGW A;  1WJE A;  2V1X A;  3HEF A;  5KK1 A;  2VQC A;  1MD0 A;  2BY2 A;  2CFO A;  3BJA A;  4GRI A;  5GP9 A;  2EV5 A;  4LOC A;  3U2R A;  4L5I A;  3Q0V A;  4F93 B;  1IN8 A;  2ZXI A;  1WQ2 A;  3ZQC A;  1JHH A;  4LIT A;  2F2E A;  1X1P A;  1LPQ A;  4WXC A;  1F5T A;  4IHS A;  1R36 A;  4NUB A;  4I98 B;  4WK8 F;  2VE8 A;  3OYJ A;  2GXG A;  2MLK A;  4V19 K;  2PN6 A;  1JT6 A;  3SZP A;  1JKO C;  3CP8 A;  3HSE A;  2UUZ A;  4M9X A;  2YX7 A;  3J7Y J;  5KHD A;  3OIO A;  3K0L A;  5ILS A;  3GO5 A;  3E6B A;  5KCM A;  2QUF A;  2D1H A;  1ZN2 A;  3X2Q H;  2EJR A;  1B72 A;  2R7R A;  4X6A J;  1XSX A;  3MKL A;  3S2H J;  2Y69 H;  2XDV A;  4A5N A;  2D2W A;  3KP4 A;  3QPS A;  1X4P A;  1FTZ A;  4BBS J;  3K69 A;  1FT9 A;  2GZW A;  1I50 J;  4KIS A;  1X1B A;  2EFO A;  2X1E A;  2VJ5 A;  1KON A;  1RNL A;  2YPR A;  2ZNZ A;  1IN7 A;  3WU0 A;  2PMZ N;  2YU3 A;  3E6D A;  5F0F A;  4MTD A;  3MFK A;  1EH8 A;  4M3D A;  4BL0 B;  5IPA A;  1D0Y A;  4C3I J;  4II2 A;  2CUF A;  4XN3 A;  1E3H A;  5ICG A;  3BP8 A;  2X51 A;  3RYR A;  2R0Q C;  3TED A;  2AHQ A;  4YEL A;  2LOO A;  4XR6 A;  2DOF A;  5BS6 A;  1S7O A;  1W36 C;  1LDK B;  3OS0 A;  3S8P A;  4A3B J;  2GQQ A;  4UVA A;  5IY5 H;  3AG1 H;  2L02 A;  3N4M A;  1VQL I;  3M8J A;  3S2W A;  2XAU A;  1SD5 A;  4PGH A;  3L2C A;  3M8E A;  2P0W A;  4LB5 A;  3K70 D;  3IKT A;  4R1H A;  2DLL A;  2LY2 A;  2PJR A;  3K1P A;  3BR5 A;  1FOX A;  2KZV A;  4B09 A;  2XRO A;  4QPO A;  3DBH B;  1PUE E;  5GAH J;  2ZKZ A;  2BY0 A;  1P7I A;  3DBR B;  3FXL A;  1WJF A;  5LRR A;  2HXO A;  3KFW X;  1DP7 P;  3KP7 A;  4HRI A;  4IRI A;  4Y52 J;  3F72 A;  5EZG A;  4RGS A;  1MNM C;  1MJA A;  1VF9 A;  2BVM A;  3CCR I;  3BG7 A;  3FX3 A;  2X9D A;  3SYT A;  4ETS A;  5F0C A;  2ACJ A;  3PNV A;  3V7R A;  2FML A;  1PDN C;  3WTU C;  4Y7N J;  1T38 A;  3L2U A;  1QA6 A;  1UB9 A;  2OCC H;  4ZTF A;  2IJL A;  3TW7 A;  4HBL A;  3VSK A;  2V1D A;  4LG0 A;  3IRR A;  2LD5 A;  3F9K A;  3ZQL A;  1NG6 A;  2JPB A;  1XDU A;  3LL7 A;  4N0B A;  3WGH A;  1MJB A;  2XC7 A;  1C0W A;  1X3U A;  3QRF F;  2HWV A;  4I0A A;  1R9T J;  4IHY A;  4AD9 A;  1ZLJ A;  1LVA A;  3F22 A;  2CQX A;  3IAS 2;  3BJO A;  1LDD A;  4RAG A;  2DMU A;  3B73 A;  2YX4 A;  4L9V A;  1JJ8 C;  1GUU A;  2Y9Y A;  5M5Y J;  3TO6 A;  5HNH A;  5KAF C;  2DN0 A;  2FRH A;  3GTK J;  2XAQ A;  4D5F A;  3ZXS A;  1HBX G;  4HF1 A;  2H6C A;  2JPC A;  1VQP I;  2KLO A;  4CCN A;  1BI0 A;  3GFL A;  2ELK A;  2M8G X;  1IO2 A;  2X4H A;  3GTJ J;  2YR2 A;  3PFY A;  5ED4 A;  3MAJ A;  1UCR A;  4M71 A;  2LF7 A;  2L7M P;  2X1D A;  3F3X A;  4E7H A;  2W4S A;  2BE5 F;  2LRD A;  3EUK L;  2Y31 A;  5LEK A;  3HC7 A;  2KFD A;  4DGW B;  2OTL I;  2Y0S N;  1TW3 A;  4CUG A;  2ZO4 A;  1S7A A;  3O2P E;  4A6D A;  4EMS A;  2ISZ A;  2ZNY A;  4IXA A;  1W5T A;  4G7O F;  2EZI A;  5EZH A;  2M2E A;  3K2A A;  2N8G A;  2CQ7 A;  2V79 A;  1TW2 A;  3MKW B;  2XVC A;  3OS1 A;  4A3C J;  3JRH A;  4KUM A;  1AA7 A;  3KE2 A;  3O3K A;  5E3N A;  3FK7 A;  3BTC A;  1D1C A;  2E2J J;  1XB4 A;  1HQC A;  2VJI A;  3ZN1 A;  1HC8 A;  2PQ8 A;  1EH7 A;  3VYS B;  2DT7 B;  4CO8 A;  4E7K A;  3K1M A;  3BG3 A;  1XC5 A;  1JGS A;  1Z91 A;  3ESW B;  2KDO A;  1IUY A;  4HV5 A;  4EM1 A;  4LMY A;  2K9N A;  4Z6Y A;  2HDD A;  3V8J A;  3Q0W A;  3D5S C;  2BVL A;  2DBB A;  3DU5 A;  5FKK A;  1GXP A;  2IA1 A;  2FBK A;  1FIA A;  1Z7L A;  1RZ4 A;  1Y0N A;  2BY3 A;  4DIQ A;  1E2X A;  4Y15 A;  1BI3 A;  2X1C A;  4MO7 A;  1VQ9 I;  1LEA A;  3OL4 A;  1YW7 A;  4GCV A;  2H1L A;  2OBP A;  2P7V B;  2Z3Y A;  3L2R A;  1JXS A;  1YQA A;  2FEZ A;  2DMP A;  4YFK F;  2DTZ A;  3CZ6 A;  3DQV C;  3LSM A;  4XL9 A;  3TGN A;  2ELH A;  2F48 A;  5IT9 K;  1WJD A;  2KMU A;  5L3G A;  2DK8 A;  3F8M A;  1K78 A;  2DMT A;  2ECB A;  1IXS B;  4OU0 A;  3H3V K;  3G1L A;  3WTT C;  2A69 F;  1WJC A;  4KT6 A;  5CJ9 A;  3H0D A;  1O7F A;  2ZJ2 A;  2HQ5 A;  4M3E A;  5EG0 A;  3BR1 A;  1UFM A;  1FX7 A;  5B1B H;  1QVU A;  3IUO A;  3IC7 A;  2CYY A;  1DPU A;  3JRE A;  5BPD A;  1K7A A;  2FA5 A;  2FJ1 A;  2E7W A;  2VOD A;  3IWF A;  2Z16 A;  1ZRC A;  4HX7 A;  1MBE A;  3OYA A;  4I09 A;  2MFZ A;  1E3O C;  4M3G A;  2EFN A;  4P1W A;  1Z21 A;  1WVR A;  4A0Y A;  3I4N J;  1IN6 A;  2HQN A;  2QKM B;  1O57 A;  3LWF A;  5E3O A;  1ZG5 A;  1KA8 A;  4BQA A;  3W6K B;  1W7P D;  2EFQ A;  4BE2 A;  4BE0 A;  4E70 A;  1T08 B;  3GUD A;  4HF2 A;  3ZGK A;  1LNW A;  1UJ8 A;  4HNU A;  2GLO A;  3E3V A;  3WTY C;  2DW4 A;  5K7Z A;  1ZYR F;  4ESB A;  3FXK A;  4LIU A;  3SHF A;  2WAD A;  5E3L A;  3CUQ B;  1J5Y A;  2XF5 A;  5HS7 A;  1Y39 A;  4L9T A;  4B48 A;  3ABM H;  2AS5 F;  1L3L A;  3Q0U A;  4J01 A;  3KZY A;  3CJQ B;  3P9I A;  1O3S A;  4PJL A;  5E1X A;  4G6T B;  1P2F A;  4OIO F;  3DBL B;  2WV1 A;  2VLA A;  4A2U A;  4XSX F;  1R49 A;  2DA6 A;  5LHI A;  3LNQ A;  4YIR X;  5DD8 A;  3HBL A;  6PAX A;  1BI2 A;  2FXA A;  1MND A;  4C2T A;  2DCE A;  2FNP A;  1B9N A;  1K6O A;  3R61 A;  3R60 A;  5IYC J;  1IRG A;  2ID3 A;  1TQM A;  2K9S A;  1Z7U A;  2V9K A;  3A1Y A;  3CLQ A;  3O8G A;  3N05 A;  4IVN A;  3U21 A;  1S6L A;  2E2H J;  5M3F J;  3ZPL A;  2BW3 B;  4HSR A;  4BKX A;  5CVI A;  3L2W A;  3REO A;  1I5Z A;  3EYY A;  2VPL A;  3A03 A;  1PP7 U;  1UST A;  1TLH B;  1TL8 A;  2KL4 A;  3K4N A;  1O3T A;  3HOT A;  1ZH5 A;  3RQI A;  1TP4 A;  3DKY A;  4ZYA A;  3OIQ A;  5AIP A;  1RR7 A;  1E0E A;  2VBX A;  2NXN B;  1FYL A;  2F4I A;  1MBJ A;  1BR4 A;  2F5V A;  4ZJZ A;  5HS9 A;  2DA1 A;  2NVQ J;  2WY7 Q;  2R5Z B;  3AAF A;  5B1A H;  2QKL B;  4DYR A;  4NNJ A;  2PI0 A;  4LB6 B;  4W97 A;  1GT0 C;  3CQZ J;  4ZDP A;  1OR7 A;  2EIM H;  2BHY A;  1YJW I;  1AWC A;  2IW5 A;  2KT0 A;  2HQA A;  2CUJ A;  1WSU A;  3HIF A;  1FOW A;  3RCO A;  1MJ9 A;  2A68 F;  3S3M A;  2WAE A;  3M07 A;  1ZR4 A;  4NDL A;  2K5C A;  2LF8 A;  1MIJ A;  2RQP A;  1MH3 A;  2MAB A;  4XN0 A;  3WTX C;  3FKJ A;  3I0T A;  2DA3 A;  4E7I A;  5ICC A;  3W2W A;  2AQF A;  2VPR A;  3BTJ A;  1SD7 A;  2CH0 A;  5E20 A;  1HKS A;  3OYK A;  5F27 A;  2NVT J;  2XB5 A;  3FZV A;  3S1N J;  2PG4 A;  2KIQ A;  2MH2 A;  2KDZ A;  2FQ3 A;  3NEU A;  3ZCO A;  4A93 J;  4I6Z A;  2VOP A;  1TWF J;  3OMY A;  2K3F A;  1JE8 A;  2W24 A;  2CQN A;  2RN7 A;  1SFO J;  1IG7 A;  1TTY A;  4LK0 F;  4RGU A;  1XSV A;  2JSP A;  5EYR A;  2LNB A;  2P6S A;  3D5R C;  4UV8 A;  3CC2 I;  1YLF A;  2WAQ A;  3MMY B;  4G94 A;  3HSF A;  1FP2 A;  2FU4 A;  3RPQ A;  3E0J B;  3T0Y A;  3GFM A;  2HDW A;  3HRS A;  4RB0 A;  4EJW A;  2K9L A;  2BY1 A;  1H9T A;  5FLX Z;  1KYZ A;  1MSF C;  2X6W A;  2IAI A;  3DV8 A;  3BWG A;  2R4G A;  4KNY A;  2P6T A;  4KA4 A;  4KIG A;  1Z1D A;  2V9V A;  4N9H A;  5ERI A;  2MC4 A;  3K4K A;  4ZZD A;  3GEZ A;  2F5E A;  1V5F A;  1W0T A;  4ZH4 F;  1TT5 B;  2ZFU A;  3VOD A;  1M1E B;  1GVD A;  5L3C A;  1WRJ A;  4U7B A;  3W6V A;  1U3E M;  1WJA A;  3T8R A;  3S14 J;  4RB2 C;  5HNF A;  1MGT A;  3LAJ A;  2HI3 A;  4UHT A;  4FTH A;  2AO9 A;  1YI2 I;  4YFN F;  3OR1 C;  3JTG A;  4C30 A;  3BT9 A;  4CHU A;  3LSH A;  2L7F P;  1IN5 A;  1V5G A;  2EFP A;  5JHF A;  1YIJ I;  1REP C;  1DU0 A;  1BIB A;  2ZC2 A;  2FBI A;  2XKP A;  2M9H A;  3F8N A;  3CCQ I;  1Y6I A;  2ISY A;  1YW9 A;  2GIZ A;  4WX9 A;  4B3A A;  4UNO A;  1T56 A;  2B0L A;  4IHT A;  3NRV A;  1PP8 F;  1D8J A;  2X0L A;  2PEX A;  1S7E A;  1A6I A;  2DJN A;  2F5D A;  3K1N A;  2EIL H;  5CLS A;  2LKX A;  3HRU A;  4ITV A;  1SAX A;  1N25 A;  3GF2 A;  1P6R A;  2MD0 A;  2GOX B;  4PGG A;  4WF2 A;  5HDK A;  4XRM A;  5C3E J;  1MMG A;  5TIS C;  1HW2 A;  1U6G A;  3HYI A;  4CGZ A;  1OCZ H;  1QO0 D;  1RR8 C;  1P4W A;  3BR2 A;  3L00 A;  2A3S A;  2M0M A;  4HZF A;  3H1C A;  4L0Z B;  4RM2 A;  3RPU A;  5LGT A;  1SVL A;  3M8F A;  4D1Q A;  3CUQ C;  1V5E A;  2KRF A;  3MZY A;  2LTP A;  2HFH A;  5FFZ A;  1ON1 A;  3OL3 A;  4MEX F;  2JA5 J;  4CCM A;  1X1C A;  1Z67 A;  2FD5 A;  2M4K A;  5KVR A;  2QWW A;  3QAH A;  1P4X A;  3ERE D;  1IDY A;  1ZR2 A;  2YSR A;  1FMV A;  4AYB N;  2RKH A;  5J8C A;  5CVU A;  2O0Y A;  2L3D A;  4XIC A;  2K40 A;  2DJI A;  3G1O A;  1ERD A;  2R7Q A;  2XPV A;  3PNY A;  4CYC B;  2OQG A;  3HM5 A;  3PUF A;  1T39 A;  1ZRE A;  1R1T A;  4RAZ A;  1UHM A;  5HLH A;  1O3R A;  4ABZ A;  1X2M A;  3OSF A;  4CH7 A;  1LKX A;  2ZCW A;  1UAA A;  2V1N A;  3VEP A;  3LOC A;  4IEJ A;  1B6A A;  2UXX A;  1U9N A;  2O03 A;  1MMA A;  2IS4 A;  3SJM A;  1BC7 C;  2Q8K A;  1BW6 A;  2VJJ A;  1ONV A;  3GTL J;  1ENH A;  5J4V A;  1R5G A;  1RIO H;  2RAE A;  1LUJ B;  1GXQ A;  4Q5S F;  3JRC A;  2QM3 A;  1LFU P;  3S93 A;  2M4G A;  1B1B A;  1B59 A;  1TWG J;  1FOK A;  3QOP A;  1QZY A;  1RI7 A;  3JSO A;  1ZRD A;  1XMX A;  4M74 A;  4AU7 A;  4I02 A;  3F8B A;  1X2N A;  1J7K A;  1JT0 A;  2DFI A;  2BBY A;  1DU6 A;  4RB3 C;  1A6Q A;  2NYX A;  2VBW A;  3RKX A;  5FLX K;  2W84 A;  5E1Z B;  2KRC A;  1G8X A;  1B4A A;  3I54 A;  3QOD A;  4RMN A;  2UXN A;  2QA4 I;  2NRA C;  2LKP A;  4BJ5 C;  1QHH D;  3S2D J;  1STZ A;  3VWB A;  2JA6 J;  1D5V A;  3JRA A;  4FQG A;  2KPM A;  3E5U A;  5ILU A;  4HOB A;  5HVQ C;  1EKE A;  3VYR B;  1U2W A;  4UB8 C;  4RB1 A;  5F64 A;  1DGW Y;  1BJZ A;  4LK1 F;  2O7O A;  3GW2 A;  1OCR H;  5LFA A;  4Y4R A;  4HNT A;  2H94 A;  2IGN A;  2NOJ B;  4OWR B;  3RZD J;  1GDT A;  1ZEL A;  2K3P A;  3BZC A;  3WGI A;  3BPV A;  2LG4 A;  3GWZ A;  3WG9 A;  2EZL A;  3HB9 A;  4YRV A;  2MC3 A;  1U9O A;  3BTI A;  3GYH X;  4BJ6 C;  3JRD A;  4E7J A;  3HTU A;  2JJ7 A;  1XS9 A;  3DPL C;  3CUQ A;  4YG2 F;  1HW5 A;  3OSG A;  2QCO A;  3JRG A;  4J19 A;  5CVR A;  2QGU A;  4AID A;  4DBR A;  3V7C A;  2QQA A;  2JQ7 A;  1YX5 A;  1V55 H;  1U8B A;  1EV7 A;  4OAZ A;  4U7D A;  2H8R A;  3TOB A;  2ZME B;  2JMW A;  5H6Q A;  3RQ4 A;  2V4J C;  2XGE A;  1ETO A;  1OYI A;  3DTI A;  4ANJ A;  4HQE A;  3A0H C;  2R92 J;  2R7T A;  2CQK A;  4BAC A;  1S9H A;  2OUM A;  3WHC A;  4BQN A;  3TKY A;  4HQM A;  2H1K A;  4XLH A;  1YG2 A;  5IP7 J;  3F6V A;  3KEO A;  1HF0 A;  1BI1 A;  3HKZ A;  4H4K C;  4XLP F;  3OYF A;  1G3S A;  1ZGA A;  3AG3 H;  5DCF A;  3FXU A;  3VSL A;  2M3A A;  2IBD A;  1DP3 A;  1JI8 A;  3BR3 A;  2BW3 A;  1JUM A;  2HZD A;  2VN2 A;  2VBY A;  1QNT A;  3B6C A;  1ACI A;  2FSW A;  3IL2 A;  3AG2 H;  1E17 A;  2EZK A;  3DXJ F;  3FWE A;  3K7A J;  5D4S A;  1P7J A;  5L3E A;  4M6Y A;  5LEJ A;  1HW1 A;  3DLL F;  5E8I A;  2E19 A;  4GDF A;  3JAM Z;  1V54 H;  5GPC A;  2LYC A;  2R5Z A;  5FKO A;  1OCC H;  2R7D A;  3E5X A;  4BHB A;  4KMU X;  3TP3 A;  4WXH A;  2O3F A;  3K4B A;  2LBF A;  4XMY A;  3KYD B;  2WAF A;  4QIW N;  4ENJ A;  1K4S A;  2G0E A;  3TDZ C;  4XLC A;  1XGN A;  1ZAO A;  4JX5 A;  1Z0X A;  2BXY A;  2ME0 A;  3H5A A;  3RPU D;  3WTZ A;  2EQR A;  1I3A A;  2TRT A;  3DFG A;  2E71 A;  1VQO I;  3RYP A;  4BAY A;  1XMA A;  3R0J A;  3VYU B;  1UZC A;  2F4O B;  1R7J A;  2P5V A;  3H35 A;  3HOX J;  2H27 A;  1ETV A;  4P96 A;  3Q3S A;  1FTT A;  1AOY A;  1WHU A;  2KJC A;  4OAY A;  1J9I A;  4XLE A;  2CJJ A;  2HKO A;  3KEQ A;  1F43 A;  5FRO A;  2VL8 A;  5BNG A;  3SZG A;  3WHB A;  4EAT A;  5E18 F;  3SFZ A;  1GLN A;  3F6O A;  2EWN A;  3GZ6 A;  2DOA A;  3CF5 F;  1MMN A;  4A3M J;  4IQ4 A;  2RNJ A;  3ML6 A;  3OYD A;  3C1D A;  4RAY A;  3AFH A;  1GHC A;  5BPI A;  3DPT A;  5J3L A;  1X3W B;  4EM2 A;  4RAF A;  2A07 F;  2X48 A;  2IVM A;  2UWM A;  2LFB A;  2JRM A;  2Y0S A;  2EBI A;  3WTS C;  4XKW A;  2RV8 A;  5FLM J;  1KQ0 A;  2CW0 F;  4IL6 C;  3BZ6 A;  1P92 A;  2DOE A;  3CD6 I;  4HG2 A;  5B3S H;  3IH4 A;  1SD4 A;  4P9U A;  2HPM A;  5E17 F;  4EV0 A;  1LFB A;  4RM3 A;  1QGP A;  3H3U A;  2F5C A;  3ABL H;  3LMM A;  2E60 A;  1R5H A;  3ECO A;  4KIT B;  5LBQ A;  1K61 A;  3CC4 I;  2W82 A;  3P7N A;  4HYE A;  4YIF A;  3HRM A;  1P4A A;  2Y9Z A;  1OYW A;  1FY7 A;  4IQJ A;  4LG3 A;  4ZYE A;  3G71 I;  2FOW A;  2DMN A;  2W85 A;  1WH5 A;  1O4X A;  1RC9 A;  2UZK A;  2V26 A;  1D5Y A;  4U0W A;  3RKQ A;  1X58 A;  4XQF A;  4IPA A;  2CUE A;  5E8G A;  3B6A A;  1U5T C;  5F1R A;  1JHF A;  4D7M A;  3R6S A;  1IV8 A;  5J1U A;  2BXZ A;  4KJZ A;  2I10 A;  1BN5 A;  4KIB A;  5K5Q A;  1LB2 A;  1ETX A;  1FPQ A;  3O6B B;  2W7N A;  2E1O A;  2DA7 A;  2VXD A;  1UMQ A;  1IV6 A;  3MKZ A;  4Q4Z F;  2TDX A;  1W4M A;  1OKR A;  2WC2 A;  5CQE A;  1YOV B;  1T98 A;  5HLT A;  3OS2 A;  1FBU A;  3UKG A;  3OWT A;  3R4K A;  4G6D A;  4S04 A;  2VKD A;  4XRS G;  5FRN A;  3H3Z A;  5JLW A;  2K9M A;  3QPT A;  1D1A A;  2K02 A;  2RQQ A;  1ORK A;  4LLL A;  5L3B A;  4DNC A;  1WWX A;  3HOY J;  3WU2 C;  4XLA A;  3JAM K;  4D0P A;  3W2A A;  1Q1V A;  5M5X J;  2HVR A;  1WJ5 A;  3L9F A;  2Z2S B;  4KIF A;  1WJB A;  1QBJ A;  2G7U A;  4XOR A;  2ZME C;  5DD4 A;  4M72 A;  3QPH A;  3UR3 C;  2KKO A;  2A5Y B;  2ME6 A;  2EIN H;  1YFH A;  5H2F C;  3MKY B;  2FBH A;  3ZMS A;  4HST A;  1O3Q A;  4A6E A;  4CYC A;  1KU9 A;  2MH9 A;  2OF7 A;  4MQ9 F;  3V8L A;  2OA4 A;  2E35 A;  4CIC A;  2MD5 A;  3RJP A;  2QSH X;  5LGN A;  4JOM A;  3BG5 A;  2BEO A;  2DQR A;  2L01 A;  4PK4 A;  2CV0 A;  4ASN A;  3RTR A;  2HR3 A;  4MHG A;  4HPQ A;  2FMY A;  4AIK A;  1WPK A;  2LKS A;  5DDG A;  2XAG A;  3PQJ A;  2XSD C;  2G9W A;  3H0G J;  1ZAR A;  1YS7 A;  4ENK A;  2E1M C;  4RLQ A;  1T8I A;  5GPA A;  2A6H F;  4A0X A;  2XHK A;  1OJL A;  1VQN I;  4A3D J;  4JK1 X;  3FXO A;  5ICE A;  3VFZ A;  3BZK A;  3CES A;  3C2B A;  3M1E A;  5H20 A;  3EUH C;  4UVB A;  1FJL A;  1CQT A;  1FC3 A;  3CJT B;  1OPC A;  1YS6 A;  5LHH A;  1R5I D;  1YIO A;  3F0C A;  2CS3 A;  5J47 A;  3L2V A;  4IZZ A;  4NQW A;  3A0B C;  4PDK A;  2HOS A;  1NTC A;  2ECC A;  2EK5 A;  2MG4 A;  3G4S I;  2AXT C;  3FHZ A;  3ELK A;  2LP0 A;  3ZMD A;  1BOA A;  3GTG J;  1LE8 B;  3E1S A;  3KCC A;  1WKM A;  3BPX A;  1RKT A;  3TMO A;  1J0R A;  3FBI B;  1FYM A;  5HOD A;  3BDD A;  2NVX J;  2KHM A;  1R71 A;  3DU6 A;  3K4J A;  4F91 B;  2PBI A;  5EEH A;  2IT0 A;  3ZQH A;  5K5O A;  3KZI C;  2CG4 A;  2WTE A;  1LFP A;  5FD5 A;  2RNG A;  3EQL F;  3S1R J;  4NHJ A;  4E6K G;  1VQ5 I;  3ZP5 A;  4Z2Y A;  2NS0 A;  4CZC A;  5LLQ A;  1FZP B;  3T8T A;  4KMF A;  2LLK A;  2R7O A;  3I56 I;  2DO7 A;  1EJ9 A;  1YJ9 I;  3RIR A;  1KGS A;  4PSW A;  4G8X A;  1VI0 A;  3QU6 A;  1CGP A;  2DI3 A;  3LAP A;  3LFU A;  2IPQ X;  4OIN F;  1DQU A;  2F5F A;  2Z9O A;  4CZZ A;  2M87 A;  4MFD A;  2D45 A;  3I64 A;  4NC8 A;  3HHG A;  5DUI A;  3BRO A;  4GYG A;  3JSP A;  3VYT B;  3ISP A;  5C44 J;  1IGN A;  3HOU J;  4X0G A;  1FNN A;  3IAM 2;  3HDD A;  3CLO A;  5IT3 A;  4YFX F;  2ZME A;  3GTM J;  1D0Z A;  2OTJ I;  3CCY A;  1TNS A;  4XBF A;  2ETH A;  4HF0 A;  3QYF A;  4ZC3 A;  2ESH A;  1APL C;  2AQE A;  3IH2 A;  3D0S A;  2EA2 A;  4A0Z A;  4LLG F;  3LSG A;  1U8R A;  3KYC B;  3GTO J;  1V3F A;  1YO5 C;  2ZXJ A;  2PJP A;  2XF7 A;  3RKW A;  5DM7 F;  4NC6 A;  4G7H F;  3RDI A;  4UVC A;  2CW7 A;  1I1S A;  3FM5 A;  1SFU A;  4B1R A;  3PNT A;  1SFX A;  5L3F A;  1G2H A;  2MW8 A;  2L7K A;  3CCV I;  2E7X A;  5J1R A;  1A04 A;  4XRS A;  2Q1Z B;  3LA2 A;  4XRF A;  3LFK A;  3FF5 A;  2K27 A;  3ZN0 A;  1VQ4 I;  2DAO A;  2O6G E;  3PO2 J;  1YX3 A;  5DYM A;  3BG6 A;  3I58 A;  4C2U A;  3DEE A;  3BTL A;  3TDU C;  4A3F J;  2DA2 A;  1K4T A;  4FET A;  4M9S A;  4LIV A;  4RBO A;  3JTH A;  4A3L J;  1RPW A;  3S1M J;  4JX4 A;  4BY1 J;  2PMU A;  2NOG A;  1X3Z B;  3OYB A;  4L5J A;  2HYF A;  3PQK A;  2HKX A;  2GA2 A;  4I76 A;  2HYJ A;  1ZLK A;  3CME I;  4MEY F;  2EB7 A;  2KZG A;  1PVE A;  2XUB A;  2JK3 A;  5IOY A;  4IHV A;  2Z33 A;  5JVG F;  1CF7 B;  2PX9 A;  3MEX A;  2EFW A;  1AKH B;  3S1Q J;  3ECH A;  2BZT A;  2ZJQ F;  3CJR B;  1IW7 F;  1I27 A;  4D5C A;  3LSK A;  1R23 A;  1W7P B;  3CMM A;  4QWQ A;  1UG0 A;  2CQQ A;  4DZJ A;  5D8L B;  3PO3 J;  2HVS A;  1NK2 P;  2EPF A;  1MH4 A;  3K70 C;  3DEW A;  4KYW A;  2A05 A;  1MBF A;  1YJN I;  2MGQ A;  4NB5 A;  2K4J A;  2ZSH B;  3LA3 A;  3KET A;  2XGC A;  3H5R A;  3KLO A;  5TJJ A;  3V4G A;  5GAD J;  1Z6T A;  5B5E C;  4P55 A;  1A31 A;  2QQB A;  2I5U A;  5K1Y A;  3GXO A;  5DM6 F;  1HST A;  2M45 A;  4A12 A;  2QEN A;  2M7A A;  3U9G A;  4M6X A;  4CCL A;  2XAS A;  2STW A;  3PJR A;  2PFB A;  1OCP A;  4O6J A;  1F36 A;  2HNH A;  2GBY A;  9ANT A;  1X1A A;  3VB2 A;  2DT6 A;  2D5V A;  3TOA A;  1HDP A;  2C6Y A;  3ULQ B;  1SVM A;  4S05 A;  2BV6 A;  3HSR A;  1QU3 A;  2CV2 A;  3ASN H;  4HV6 A;  3M1C A;  1AU7 A;  1FBS A;  1UHS A;  2HXI A;  4F92 B;  4B3X A;  2LR8 A;  4MLO A;  2X6O A;  4NBQ A;  1W1W E;  3CCJ I;  3ZQI A;  1VFC A;  3ZRG A;  5LHG A;  2XV4 S;  5JR3 A;  1L0O C;  3S16 J;  5TRD A;  1FSE A;  1SAU A;  1Z3Y A;  2UV1 A;  1ZQ3 P;  3OYL A;  3PIP F;  1H89 C;  3ERM A;  3KP6 A;  3GFI A;  3C7J A;  4FAS D;  4KN4 X;  2J5P A;  3BC8 A;  3HJE A;  3GFJ A;  2R7S A;  4EM0 B;  2IEK A;  3Q9S A;  4PUS A;  1UG2 A;  1G6N A;  2L54 A;  3K4L A;  2IP2 A;  3QOE A;  1K79 A;  2Z5U A;  3DKX A;  3I4M J;  4BE1 A;  3DWL E;  3E6M A;  2P5K A;  2XPU A;  4A3J J;  3CP2 A;  4BU2 A;  2DYS H;  2L9R A;  2M34 A;  2Y0M A;  2QQ9 A;  3CDI A;  3K10 A;  3U1D A;  3I55 I;  3L2Q A;  1A35 A;  3IH3 A;  4DYC A;  2OJE D;  2WB1 A;  1TBX A;  2KRH A;  4F3Q A;  2CW8 A;  1DDN A;  3LSI A;  3GCM A;  4U88 A;  1KU2 A;  2XIG A;  4C2M J;  2ID6 A;  2W48 A;  2O8X A;  1Z77 A;  4JBA A;  1MMD A;  2G7H A;  3DLA A;  3T1B A;  1BR1 A;  3V42 A;  3BY6 A;  4OIR F;  2LDU A;  3S17 J;  3B02 A;  3WTW C;  3WOD F;  1B8I B;  1OYY A;  4NC7 A;  5FJ8 J;  3BQY A;  1ZK8 A;  1W0U A;  2P5L C;  5HDN A;  4N4O B;  2IXS A;  5TGT A;  2DDB A;  1JKQ C;  2KP6 A;  2CV1 A;  4FHT A;  1PUF B;  3SZT A;  3FXQ A;  5C4X J;  2JTV A;  2EZH A;  1OCO H;  4B4C A;  4EQQ A;  5DEQ A;  2DDA A;  1JJ6 C;  3PFI A;  4AVZ A;  2VT2 A;  1IRZ A;  4G6Q A;  1ITY A;  3ZMV A;  1VZ0 A;  3EET A;  3LA7 A;  1Z05 A;  1ZTR A;  5F04 A;  2V6E A;  2JWT A;  5FRM A;  3W2V A;  1VQ8 I;  2Q0O A;  1ZRF A;  2VKH A;  3I5U A;  3L09 A;  3BLY A;  1BR2 A;  4ZZL A;  3DPU A;  3M3Y J;  4BGD A;  4XOP A;  3KIO A;  4BYY A;  1YHQ I;  2M1B A;  2YUS A;  3R0A A;  3JRF A;  4GXO A;  2B63 J;  2L5Q A;  2K85 A;  1XGS A;  2VC0 A;  2OC6 A;  3HUG B;  1S72 I;  2NAZ A;  4HAM A;  2TCT A;  3NAR A;  2CGP A;  2XSJ C;  4EJT A;  2VB6 A;  3A01 B;  1U5T B;  2R7W A;  1Y0U A;  3MVP A;  2JSC A;  5E3M A;  3ZQG A;  3L1P A;  2K7L A;  2W25 A;  4ZYG A;  1TQP A;  4UUV A;  4BEH B;  1XG1 A;  2XRN A;  2DA5 A;  3HOZ J;  1SVO A;  2QZ8 A;  3OY9 A;  2IS2 A;  3ZOB A;  4YII A;  2LH9 A;  4F55 A;  3TW6 A;  3AG4 H;  4AVP A;  3LQR A;  3HG9 A;  4FIS A;  2MA3 A;  3NWT A;  5LGU A;  1K83 J;  3RZO J;  2QYO A;  1LE8 A;  1VND A;  4BXX J;  5BQT A;  1R1V A;  4KDP A;  4M3B A;  5JFR A;  5K5R A;  2BGC A;  2MYS A;  3CTA A;  2HTS A;  2EIJ H;  4XID A;  2L9N A;  1TQI A;  4EJU A;  2GIV A;  2F6C A;  3H5N A;  2R7U A;  3ABT A;  2ZJP F;  3OV8 A;  2VJ4 A;  4XOT A;  4IF4 A;  2MBF A;  4DOZ A;  2YU9 J;  5FLV A;  3RKY A;  2LVS A;  3A02 A;  2PMZ A;  2O5R A;  1HLV A;  1RES A;  1KZH A;  3GBG A;  3MCZ A;  3V8K A;  1LJ9 A;  4XSZ F;  1IF1 A;  1BIA A;  4UV9 A;  1S5L C;  1XN7 A;  3K4C A;  4MGR A;  4CSW A;  4FX0 A;  1OMI A;  3HOV J;  4LD5 A;  1R6R A;  4MTE A;  2L7Z A;  4GGG A;  4AWX B;  2O8K A;  1X4O A;  4BY7 J;  5D5W B;  4FT8 A;  1U78 A;  4C3J J;  2V7F A;  4N4N B;  3MZH A;  4I01 A;  5EGO B;  2NNY A;  3K2Z A;  1N78 A;  1OLT A;  1MNE A;  4ZYH A;  4BDY A;  2HOA A;  2Y75 A;  4EJV A;  3Q5F A;  2E1M B;  4XLN F;  2E1N A;  1NHA A;  3TQN A;  1HKT A;  1D3Y A;  2OZU A;  3OIP A;  4M9Z A;  3I59 B;  2X6Y A;  2W1O A;  2WY8 Q;  4LLN A;  2HEO A;  1MW7 A;  3E6C C;  5E1W A;  1G3Y A;  2RRE A;  4S0H B;  4F7Z A;  2XB0 X;  5FFX A;  4EEF G;  3PL8 A;  5EF6 A;  1VQ7 I;  1KU3 A;  1MMS A;  1UHW A;  1N77 A;  1QQI A;  1RUN A;  4F52 A;  2A6T A;  3NWS A;  3MQ0 A;  1FEX A;  4XM3 A;  1IN4 A;  3HRT A;  2X85 A;  2KIS A;  1IZ1 A;  1YYV A;  2WA0 A;  4UY8 I;  2E5Z A;  1BM9 A;  3GTQ J;  1YE9 A;  3QP5 A;  1XSD A;  2CU7 A;  3WTV C;  2ICW G;  4X1E A;  5FO5 A;  3E7L A;  1ZGJ A;  4IRG A;  2O61 A;  4MNU A;  2M30 A;  4HLY A;  1MDM B;  4BQO A;  3KX2 A;  3A2K A;  3HKZ N;  1H8A C;  4KIC A;  4MFE A;  2HPI A;  5E79 C;  2VQG A;  3QU3 A;  4OIQ F;  1R58 A;  2R7V A;  1IXR C;  1W5C C;  1H88 C;  3M7G A;  1CF7 A;  1EH6 A;  1AKH A;  2HTJ A;  1NG7 A;  1QZE A;  3I71 A;  1MKM A;  1LDJ A;  3K4M A;  3KLN A;  4CDG A;  4IJA A;  2P7C B;  1W7P A;  2V9P A;  4ZDL A;  5F0H A;  3LSP A;  1FOY A;  3RI4 A;  4IHW A;  4QTR A;  3OOP A;  3NAU A;  2IA0 A;  3AL0 B;  3G1M A;  2FOK A;  2VC1 A;  5FKM A;  4B8X A;  2R5Y B;  5IT9 Z;  1SMT A;  1FLI A;  1ON2 A;  4I0B A;  1S3J A;  3ROU A;  3FIS A;  3V7S A;  4IX7 A;  2R7Z J;  3CO7 C;  2JUC A;  4CCK A;  4W1U A;  4BDZ A;  3KEY A;  4Y17 A;  5AIQ A;  1F1Z A;  1V4R A;  5FGM A;  1O7L A;  2IS1 A;  4PJM A;  1J59 A;  3IKV A;  3GLL A;  4OMZ A;  2RC4 A;  1S8N A;  2JA2 A;  3HZJ A;  3O8H A;  2XGX A;  4OMY A;  3OYE A;  3BR6 A;  2VT3 A;  3C2G A;  2K4B A;  2HVQ A;  3IP4 B;  5FB2 A;  2JVH A;  5F08 A;  1HSJ A;  1BL0 A;  4BHP A;  1XCV A;  3I9V 2;  3NQO A;  3GVA A;  3SEZ A;  4QSH A;  3GLX A;  2DFF A;  2PLY A;  3HGY A;  2XGD A;  4EGZ A;  2ESN A;  2HU9 A;  3IWZ A;  1XPX A;  1XCB A;  2NNN A;  2GA1 A;  2CO5 A;  4B44 A;  2XRL A;  3F8F A;  2OU2 A;  2ZBK A;  2Y30 A;  3TO9 A;  4AIH A;  4QPQ A;  4GYI A;  3N97 A;  1Q1H A;  3DTK A;  4BXU A;  4ENM A;  1WI9 A;  1W5S A;  1YW8 A;  2W00 A;  4CXF A;  2J5O A;  3KP2 A;  3M4O J;  2LSO A;  3S3N A;  4ESJ A;  4C3H J;  1R4N B;  2NVU B;  1T33 A;  1ZG3 A;  1FSH A;  4E7L A;  3G2B A;  3OYC A;  2DOD A;  1D0X A;  4U0Y A;  2KIF A;  4LFU A;  1FWZ A;  1TC3 C;  2WBM A;  4EVI A;  4ESF A;  2O9L A;  5ICF A;  4I2O A;  5HLI A;  4P9F A;  3J7Z I;  2QF7 A;  1A5J A;  5LD2 C;  3W3C A;  3LQQ A;  5HLG A;  3U1K A;  2CWE A;  3HXL A;  3KP5 A;  3HL2 A;  1B8I A;  2OAZ A;  4ZDO A;  1IRX A;  4EJO A;  4IOC F;  4D9J A;  4Q47 A;  2IS6 A;  1MSE C;  2L9S A;  5D6F A;  4L18 B;  1XX5 A;  5GAG J;  4FE4 A;  2IGO A;  3BJ6 A;  2M8E A;  4RS8 A;  5FD6 A;  3G73 A;  2AXL A;  2P8T A;  4V2F A;  3FHN A;  1YRN B;  4BQQ A;  1H0M A;  3TBI A;  3ONQ A;  1PUF A;  5IYD J;  1JUP A;  1TWH J;  2FF4 A;  3J7A O;  2Q2E B;  4JQF A;  2DTR A;  1LEB A;  2IRF G;  2R7X A;  1MBG A;  1HKQ A;  2I8D A;  3P9K A;  4BH9 A;  2EV6 A;  3PUB A;  4MQV A;  2WV0 A;  3WU1 B;  2EIK H;  3G6E I;  4KT5 C;  1HXD A;  3TP0 A;  1VQK I;  1VQM I;  4L0Y B;  1POG A;  5J6X A;  1FIP A;  2M5W A;  2KQR A;  5F1J A;  1WI3 A;  4HW0 A;  4XLF A;  5GAE J;  3MN2 A;  1XD7 A;  2JA8 J;  3FMS A;  5GTI C;  3SDG A;  4MIM A;  2HZT A;  3GZ5 A;  1B9M A;  4M3F A;  3ZQF A;  3J81 Z;  3CMA I;  4UUS B;  2MLG A;  3ZQ7 A;  4DZP A;  1IRF A;  1R00 A;  2KIM A;  4HNV A;  2OCE A;  3SXY A;  4UB6 C;  2FX0 A;  3WGG A;  3H36 A;  1Z9C A;  2MSY A;  3GME A;  5EEA A;  1DPR A;  3JRI A;  1TNT A;  2L0K A;  5IP6 A;  3HTS B;  3WE2 A;  2XAJ A;  1MBK A;  4UUT A;  1KU7 A;  3TL4 X;  4HLX A;  2JA7 J;  5DV5 A;  4CCJ A;  1BW5 A;  5JVT A;  2LC2 A;  2ZJR F;  3HUG A;  4XKV A;  1OR7 C;  4TV7 A;  2GXB A;  2KIU A;  2VAS A;  2Z1D A;  3F8C A;  1RET A;  1QPM A;  3FMQ A;  2VI6 A;  3A01 A;  1U5T A;  3FXJ A;  4BXF A;  3F23 A;  1JUS A;  4RGX A;  1AHD P;  2XAH A;  1HA8 A;  3EUA A;  3JRB A;  4KFC A;  1IJW C;  5EJC A;  2P4W A;  4BEH A;  3GZN B;  1SFE A;  4RGR A;  4HA8 A;  1ZGW A;  1QPI A;  2CFX A;  3K6G A;  3LSR A;  1J09 A;  4G12 A;  4PJJ A;  2QBY B;  5DCM B;  5JHU A;  3H9Q A;  2QSF X;  4BHC A;  3AKZ A;  2L4M A;  4PSX A;  1ZHF A;  2L2O A;  2F4M B;  2QVO A;  1ODD A;  3QYE A;  4CCO A;  3I3L A;  3ZR8 X;  4YEJ A;  3S15 J;  2CMP A;  1HCR A;  3FXM A;  2HYG D;  5CKT A;  3CCM I;  3H92 A;  5HDG A;  1X1D A;  3KZZ A;  4RA2 A;  3PSI A;  4I99 C;  1LVK A;  3CC7 I;  3Q9V A;  4JYK A;  1RRJ A;  1WCM J;  4O3M A;  1EA3 A;  3AL0 C;  5CQG A;  2CSO A;  1UEL B;  2QEX I;  5JLX A;  4E7Z A;  2A6E F;  3J7A Y;  3PM1 A;  2RGV A;  4KN7 X;  3J80 Z;  1JKR C;  5ILV A;  2V1U A;  4IRH A;  2JRT A;  2V6C A;  2ZXW H;  1WH7 A;  3KPH A;  5CYV A;  3KYL A;  5BOX A;  5D5V B;  3SQN A;  1QRY A;  1XDS A;  2ELJ A;  1IUF A;  5HS8 A;  1F4K A;  3D1N I;  4WWC A;  2B9S A;  1E3P A;  2QSG X;  2A5W A;  4FE7 A;  3GTP J;  1MZB A;  4CYD A;  4HX4 A;  1ETY A;  4WXD A;  2ZB9 A;  4A69 C;  1D8K A;  4DQ2 A;  3K9T A;  5M3M J;  4A3K J;  1T95 A;  3HOS A;  2VON A;  2H8W A;  3JCU C;  5EGO A;  1Y1W J;  1JGG A;  2W57 A;  1KQ9 A;  4A3I J;  2FQ4 A;  4PJ0 C;  5CPR B;  2ZSI B;  1OQY A;  1WGX A;  3IRQ A;  2IA2 A;  1B72 B;  4U0V A;  1BA5 A;  2HOE A;  4AC0 A;  5F6F A;  5IP9 J;  5A2Q Z;  2D1V A;  3ZQQ A;  4Y33 A;  3I59 A;  3P9C A;  5EEG A;  3D5L A;  1ETW A;  2LK2 A;  1XGM A;  3ABK H;  3KP3 A;  5DS9 A;  1VTN C;  2IGM A;  1I1G A;  2DYR H;  3EUH A;  4GFB A;  3COA C;  1IXC A;  2DQL A;  3SFI A;  3BCA A;  4AUX A;  3OYG A;  1G59 A;  4XKB A;  1T6S A;  3FDY A;  5H6R A;  4CA0 A;  2GXA A;  3VOE A;  3H9J A;  2YS9 A;  2LBF B;  2R7F A;  1W36 D;  3CCE I;  3DKW A;  1FP1 D;  2STT A;  4L9J A;  2ADU A;  1TWC J;  2X6X A;  3EDP A;  1BJA A;  1QZZ A;  2VIX A;  2E36 A;  1DGR M;  4O5V A;  5D8K B;  4WCG A;  2GM4 A;  3C2H A;  1PJR A;  3IHU A;  2DU9 A;  4XK4 A;  5K7F A;  3J81 K;  4DYQ A;  1T0F C;  4JX6 A;  4RDU A;  4EGY A;  4G7Z F;  1HDD C;  5D4R A;  2PJR B;  1WZ2 A;  2OPT A;  4UXN A;  5B66 C;  4GO1 A;  2VE9 A;  3DEU A;  1MDM A;  3HOW J;  4DW6 A;  5D5U B;  2DPD A;  2VQL A;  2JT1 A;  3JR9 A;  4ZTJ A;  1I6X A;  2K86 A;  2P81 A;  2JUG A;  2XPW A;  4ON0 A;  1ZG1 A;  4I7H A;  1YTY A;  1MBH A;  2DFE A;  3DP7 A;  2NS7 A;  3ZMZ A;  2FUG 2;  2RDP A;  3C3W A;  1OCT C;  3BQZ A;  1TT0 A;  3C18 A;  3FK6 A;  2FNA A;  1SEU A;  1R4M B;  3FXR A;  1BOB A;  1Z3X A;  4N9I A;  1WFX A;  2NVY J;  1VQ6 I;  3M9A A;  3CF2 A;  2A61 A;  1I3Q J;  3I53 A;  3WE3 A;  2R5Y A;  3VPR A;  2E1C A;  4B43 A;  2COB A;  2EH3 A;  1GV2 A;  4LG0 B;  3CDL A;  4XKC A;  4XNF A;  4BUP A;  4OOI A;  3GX4 X;  2HQR A;  3DCF A;  3EYI A;  1SFK A;  2WWY A;  3QPL A;  3HHH A;  3E5Q A;  3FMR A;  1ZKG A;  2H09 A;  2VUM J;  3QQA A;  2Y2Z A;  1SAN A;  3FM3 A;  3CCL I;  1HOM A;  3LST A;  1YIT I;  1P9Q C;  2COM A;  2L9V A;  3OYN A;  3QWL A;  4HEA 2;  4AYB A;  1ETQ A;  3BR0 A;  3IV5 A;  3ASO H;  2DA4 A;  3HGG A;  4Y13 A;  4R79 A;  1LQ1 A;  1EF4 A;  4M73 A;  2DK5 A;  3HPH A;  1Z6R A;  5J8F A;  1XMK A;  1NH3 A;  2DFH A;  1X19 A;  3J80 K;  4Q48 A;  3QYB A;  3EPZ A;  3OR2 C;  3PSF A;  1FMW A;  2B7E A;  2RVC A;  2WAQ N;  1JKP C;  4JP0 A;  2E2I J;  2R93 J;  1G3W A;  5DTD A;  1SC7 A;  1JTY A;  3JW4 A;  5M5W J;  4A3G J;  4ENN A;  4E7S A;  1GV5 A;  4AIJ A;  3S3O A;  4D7N A;  5GTH C;  3OYM A;  4IKF A;  2JVG A;  3L7W A;  1U0J A;  5C4J J;  3CCU I;  2LMD A;  4HDV A;  4HX8 A;  2JZY A;  5DUK A;  3ZMT A;  2K9Q A;  4XON A;  5JI6 A;  1BC8 C;  1A36 A;  3MZ8 A;  5AON A;  4BNC A;  2H6B A;  1N75 A;  1Y8R B;  3CDH A;  3W6J B;  2R3S A;  1J75 A;  1BBY A;  1R22 A;  5D5X B;  1FYK A;  1I39 A;  2JN6 A;  1PYV A;  5IYB J;  1USS A;  3CJN A;  4M6V A;  1XTA A;  4DJA A;  5CVJ A;  4BJT A;  1KYW A;  4PFP A;  5HOO A;  2VOO A;  5A2Q K;  1DUX C;  4PJN A;  1T0F A;  3H9G A;  2XKO A;  1J2X A;  5L3D A;  3LSJ A;  3E97 A;  5CVV A;  4OIP F;  4AM3 A;  2BYV E;  4G9Y A;  3G3Z A;  3CO6 C;  1TZL A;  3ABU A;  2OD5 A;  4BS9 A;  4IOA F;  3DF8 A;  1H9G A;  4A3E J;  2DXI A;  3ZMU A;  2VKV A; 
#chains in the Genus database with same CATH homology
 4PCQ A;  1XGO A;  2FE3 A;  2L4A A;  3I4P A;  4HDU A;  2Q2E A;  4A5M A;  5D6E A;  3F21 A;  1FBQ A;  2EA4 A;  2DPU A;  1S29 A;  2EV0 A;  2ZFW A;  2XAF A;  1SMY F;  1K78 B;  1KQ8 A;  4FX4 A;  4PZJ A;  2VXZ A;  1SD6 A;  2OQR A;  1IAW A;  2DT5 A;  4LJZ F;  2QLZ A;  2Z99 A;  1F9N A;  4L9N A;  2GAU A;  4H0E A;  4QLC U;  2HS5 A;  1T2K A;  2Y48 A;  1GVJ A;  4R8H A;  3MWM A;  3BOQ A;  3TO7 A;  3T5X A;  3QP6 A;  2VBZ A;  1G3T A;  2QBY A;  5DCM A;  2HDC A;  5BMZ A;  2GWR A;  1RUO A;  1R1U A;  2KJB A;  2PMH A;  1ULY A;  4P5O A;  2HGC A;  2OZ6 A;  4ZYD A;  3CUO A;  5LRS A;  4K2E A;  4LGW A;  2V1X A;  5KK1 A;  1MD0 A;  3BJA A;  2EV5 A;  3U2R A;  4L5I A;  1IN8 A;  1WQ2 A;  1JHH A;  2F2E A;  4IHS A;  4WXC A;  1F5T A;  1R36 A;  4I98 B;  4WK8 F;  2VE8 A;  2GXG A;  2MLK A;  2PN6 A;  3SZP A;  3HSE A;  4M9X A;  2YX7 A;  3K0L A;  5ILS A;  3GO5 A;  3E6B A;  2QUF A;  2D1H A;  1ZN2 A;  2EJR A;  1XSX A;  4A5N A;  2D2W A;  3KP4 A;  3K69 A;  1FT9 A;  2GZW A;  2EFO A;  2YPR A;  1RNL A;  3WU0 A;  2ZNZ A;  1IN7 A;  4MTD A;  2YU3 A;  3E6D A;  3MFK A;  1EH8 A;  5ICG A;  3BP8 A;  3RYR A;  5BS6 A;  1S7O A;  1LDK B;  2GQQ A;  4UVA A;  2L02 A;  3N4M A;  3S2W A;  1SD5 A;  4PGH A;  3L2C A;  3M8E A;  4LB5 A;  3IKT A;  4R1H A;  2DLL A;  3K1P A;  4B09 A;  2XRO A;  1PUE E;  2ZKZ A;  5LRR A;  3KFW X;  1DP7 P;  3KP7 A;  4IRI A;  3F72 A;  4RGS A;  1MJA A;  3FX3 A;  4ETS A;  2ACJ A;  3V7R A;  2FML A;  1PDN C;  3WTU C;  1T38 A;  1UB9 A;  2IJL A;  4HBL A;  2V1D A;  4LG0 A;  3IRR A;  2JPB A;  1XDU A;  4N0B A;  3WGH A;  1MJB A;  1C0W A;  1X3U A;  3QRF F;  2HWV A;  4I0A A;  4AD9 A;  1ZLJ A;  1LVA A;  3F22 A;  3BJO A;  1LDD A;  3B73 A;  2YX4 A;  4L9V A;  3TO6 A;  2FRH A;  2XAQ A;  1HBX G;  4HF1 A;  2H6C A;  2JPC A;  1BI0 A;  3GFL A;  2X4H A;  2YR2 A;  5ED4 A;  3MAJ A;  1UCR A;  4M71 A;  2LF7 A;  3F3X A;  2BE5 F;  5LEK A;  1TW3 A;  2ZO4 A;  1S7A A;  3O2P E;  4A6D A;  4EMS A;  2ISZ A;  2ZNY A;  4IXA A;  1W5T A;  4G7O F;  2V79 A;  1TW2 A;  2XVC A;  4KUM A;  3O3K A;  3KE2 A;  1XB4 A;  1HQC A;  3ZN1 A;  2PQ8 A;  1EH7 A;  4CO8 A;  3K1M A;  1Z91 A;  1JGS A;  1IUY A;  4HV5 A;  4EM1 A;  4LMY A;  3V8J A;  2DBB A;  1GXP A;  2IA1 A;  2FBK A;  1RZ4 A;  1E2X A;  4Y15 A;  1BI3 A;  1LEA A;  1YW7 A;  4GCV A;  2P7V B;  2OBP A;  2Z3Y A;  1JXS A;  1YQA A;  2FEZ A;  4YFK F;  3DQV C;  3TGN A;  2ELH A;  5IT9 K;  5L3G A;  2DK8 A;  3F8M A;  1K78 A;  1IXS B;  4OU0 A;  3WTT C;  2A69 F;  5CJ9 A;  1O7F A;  2ZJ2 A;  1UFM A;  1FX7 A;  3IC7 A;  2CYY A;  1DPU A;  5BPD A;  1K7A A;  2FA5 A;  2E7W A;  2VOD A;  3IWF A;  1ZRC A;  4HX7 A;  4I09 A;  2EFN A;  4A0Y A;  1IN6 A;  2HQN A;  1ZG5 A;  1O57 A;  3LWF A;  1KA8 A;  4BQA A;  3W6K B;  1W7P D;  2EFQ A;  4E70 A;  3GUD A;  4HF2 A;  1LNW A;  3E3V A;  3WTY C;  2DW4 A;  1ZYR F;  4ESB A;  3SHF A;  3CUQ B;  1J5Y A;  5HS7 A;  4L9T A;  2AS5 F;  1L3L A;  3KZY A;  3P9I A;  1O3S A;  5E1X A;  1P2F A;  4OIO F;  4A2U A;  4XSX F;  5LHI A;  5DD8 A;  6PAX A;  1BI2 A;  2FXA A;  2FNP A;  1B9N A;  1K6O A;  3R61 A;  3R60 A;  1IRG A;  1TQM A;  1Z7U A;  4IVN A;  1S6L A;  3ZPL A;  5CVI A;  3REO A;  1I5Z A;  3EYY A;  1PP7 U;  1UST A;  1TLH B;  1O3T A;  3HOT A;  1ZH5 A;  5AIP A;  2VBX A;  1FYL A;  5HS9 A;  3AAF A;  2PI0 A;  4LB6 B;  1OR7 A;  1AWC A;  2IW5 A;  1WSU A;  3HIF A;  1MJ9 A;  2A68 F;  2LF8 A;  2RQP A;  3WTX C;  3I0T A;  5ICC A;  1SD7 A;  5E20 A;  1HKS A;  3FZV A;  2PG4 A;  2MH2 A;  2FQ3 A;  3NEU A;  2VOP A;  1JE8 A;  2W24 A;  2RN7 A;  1TTY A;  4LK0 F;  4RGU A;  1XSV A;  2LNB A;  2P6S A;  4UV8 A;  1YLF A;  4G94 A;  3HSF A;  1FP2 A;  2FU4 A;  3RPQ A;  3T0Y A;  3GFM A;  3HRS A;  4RB0 A;  4EJW A;  1H9T A;  5FLX Z;  1KYZ A;  3DV8 A;  3BWG A;  4KNY A;  2P6T A;  4KA4 A;  4KIG A;  1Z1D A;  2V9V A;  4N9H A;  5ERI A;  4ZZD A;  3GEZ A;  2F5E A;  4ZH4 F;  3VOD A;  5L3C A;  1WRJ A;  4U7B A;  1U3E M;  3T8R A;  4RB2 C;  1MGT A;  3LAJ A;  4UHT A;  4YFN F;  3JTG A;  4CHU A;  1IN5 A;  2EFP A;  1REP C;  1BIB A;  2FBI A;  2XKP A;  3F8N A;  2ISY A;  1YW9 A;  4UNO A;  4WX9 A;  2B0L A;  4IHT A;  3NRV A;  1PP8 F;  1D8J A;  2X0L A;  2PEX A;  3K1N A;  2F5D A;  5CLS A;  1SAX A;  1G4D A;  3HRU A;  3GF2 A;  1P6R A;  4WF2 A;  4PGG A;  5HDK A;  1HW2 A;  1U6G A;  3HYI A;  4CGZ A;  1QO0 D;  1P4W A;  3L00 A;  2A3S A;  4HZF A;  4L0Z B;  3RPU A;  5LGT A;  3M8F A;  3CUQ C;  2KRF A;  3MZY A;  2HFH A;  5FFZ A;  1ON1 A;  4MEX F;  5KVR A;  2QWW A;  3QAH A;  1P4X A;  3ERE D;  2YSR A;  2RKH A;  5J8C A;  5CVU A;  2O0Y A;  2L3D A;  2OQG A;  1T39 A;  1ZRE A;  1R1T A;  4RAZ A;  1UHM A;  5HLH A;  1O3R A;  2ZCW A;  3VEP A;  1B6A A;  2UXX A;  2O03 A;  1BC7 C;  2Q8K A;  1ONV A;  1R5G A;  1RIO H;  4Q5S F;  1GXQ A;  2QM3 A;  1B1B A;  1B59 A;  1FOK A;  3QOP A;  1QZY A;  1RI7 A;  3JSO A;  1ZRD A;  4M74 A;  4I02 A;  3F8B A;  1J7K A;  2DFI A;  2BBY A;  4RB3 C;  2NYX A;  2VBW A;  3RKX A;  5FLX K;  2W84 A;  5E1Z B;  1B4A A;  3I54 A;  2UXN A;  2NRA C;  2LKP A;  1STZ A;  1D5V A;  3E5U A;  5ILU A;  4HOB A;  5HVQ C;  1U2W A;  4RB1 A;  5F64 A;  4LK1 F;  3GW2 A;  2H94 A;  3WGI A;  3BPV A;  3WG9 A;  3GWZ A;  2MC3 A;  3GYH X;  3HTU A;  3DPL C;  3CUQ A;  4YG2 F;  1HW5 A;  5CVR A;  3V7C A;  2QQA A;  1EV7 A;  4U7D A;  3TOB A;  2ZME B;  5H6Q A;  1OYI A;  4HQE A;  2CQK A;  3TKY A;  4HQM A;  1YG2 A;  3F6V A;  3KEO A;  1BI1 A;  4XLP F;  1G3S A;  1ZGA A;  5DCF A;  3FXU A;  2VN2 A;  2VBY A;  1QNT A;  2FSW A;  3IL2 A;  1E17 A;  3DXJ F;  3FWE A;  5D4S A;  5L3E A;  4M6Y A;  5LEJ A;  1HW1 A;  5E8I A;  3JAM Z;  2R7D A;  3E5X A;  4BHB A;  4KMU X;  4WXH A;  2O3F A;  4ENJ A;  3TDZ C;  1XGN A;  1ZAO A;  3WTZ A;  3DFG A;  3RYP A;  4BAY A;  1XMA A;  3R0J A;  1R7J A;  2P5V A;  2H27 A;  4P96 A;  1AOY A;  2KJC A;  1J9I A;  2HKO A;  3KEQ A;  5E18 F;  3SFZ A;  3F6O A;  2EWN A;  3GZ6 A;  2RNJ A;  3ML6 A;  3C1D A;  4RAY A;  1GHC A;  5BPI A;  3DPT A;  4EM2 A;  2A07 F;  2IVM A;  2UWM A;  3WTS C;  2RV8 A;  1KQ0 A;  2CW0 F;  3BZ6 A;  1P92 A;  1SD4 A;  4P9U A;  5E17 F;  4EV0 A;  1QGP A;  3H3U A;  2F5C A;  1R5H A;  3ECO A;  5LBQ A;  3P7N A;  4HYE A;  4YIF A;  3HRM A;  1P4A A;  1OYW A;  1FY7 A;  4ZYE A;  2W85 A;  2UZK A;  4U0W A;  4IPA A;  5E8G A;  1U5T C;  5F1R A;  1JHF A;  3R6S A;  4KIB A;  1BN5 A;  5K5Q A;  1LB2 A;  1FPQ A;  3O6B B;  4Q4Z F;  2TDX A;  1W4M A;  1OKR A;  2WC2 A;  1T98 A;  1FBU A;  3R4K A;  4G6D A;  4S04 A;  3H3Z A;  3QPT A;  2K02 A;  4LLL A;  5L3B A;  4DNC A;  1WWX A;  3JAM K;  4D0P A;  3L9F A;  4KIF A;  1QBJ A;  2G7U A;  5DD4 A;  3QPH A;  2KKO A;  2A5Y B;  1YFH A;  2FBH A;  3ZMS A;  1O3Q A;  4A6E A;  1KU9 A;  2MH9 A;  4MQ9 F;  3V8L A;  2OA4 A;  4CIC A;  2MD5 A;  3RJP A;  5LGN A;  2BEO A;  2DQR A;  2L01 A;  4ASN A;  3RTR A;  2HR3 A;  4MHG A;  2FMY A;  4AIK A;  5DDG A;  2XAG A;  3PQJ A;  2G9W A;  1ZAR A;  1YS7 A;  4ENK A;  2A6H F;  4A0X A;  2XHK A;  4JK1 X;  5ICE A;  3VFZ A;  3M1E A;  5H20 A;  4UVB A;  1FC3 A;  1OPC A;  1YS6 A;  5LHH A;  1YIO A;  4NQW A;  4PDK A;  2EK5 A;  3FHZ A;  3ELK A;  3ZMD A;  1BOA A;  3KCC A;  1WKM A;  3BPX A;  1J0R A;  1FYM A;  3BDD A;  2PBI A;  5EEH A;  2IT0 A;  5K5O A;  2CG4 A;  2WTE A;  5FD5 A;  3EQL F;  4NHJ A;  3ZP5 A;  4Z2Y A;  2NS0 A;  5LLQ A;  1FZP B;  3T8T A;  4KMF A;  2DO7 A;  3RIR A;  1KGS A;  4G8X A;  3QU6 A;  1CGP A;  2DI3 A;  3LAP A;  2IPQ X;  4OIN F;  2F5F A;  2Z9O A;  4CZZ A;  2M87 A;  2D45 A;  3I64 A;  5DUI A;  3HHG A;  3BRO A;  4GYG A;  3JSP A;  3ISP A;  1FNN A;  3CLO A;  5IT3 A;  4YFX F;  2ZME A;  1TNS A;  4XBF A;  2ETH A;  4HF0 A;  2ESH A;  4A0Z A;  3D0S A;  2EA2 A;  4LLG F;  1U8R A;  1V3F A;  1YO5 C;  2ZXJ A;  2PJP A;  3RKW A;  4G7H F;  3RDI A;  4UVC A;  1I1S A;  3FM5 A;  1SFU A;  1SFX A;  5L3F A;  2E7X A;  1A04 A;  3LA2 A;  4XRF A;  3LFK A;  3FF5 A;  3ZN0 A;  2K27 A;  2O6G E;  2DAO A;  5DYM A;  3I58 A;  3TDU C;  4M9S A;  3JTH A;  2PMU A;  4L5J A;  2HYF A;  3PQK A;  2HKX A;  2GA2 A;  1ZLK A;  4MEY F;  2EB7 A;  2XUB A;  2Z33 A;  1CF7 B;  3MEX A;  2EFW A;  3ECH A;  1IW7 F;  1I27 A;  1R23 A;  1W7P B;  4QWQ A;  5D8L B;  4KYW A;  4NB5 A;  2K4J A;  3LA3 A;  3KET A;  3KLO A;  3V4G A;  5TJJ A;  1Z6T A;  4P55 A;  2QQB A;  5K1Y A;  3GXO A;  1HST A;  2M45 A;  4A12 A;  2QEN A;  3U9G A;  4M6X A;  2XAS A;  2STW A;  2PFB A;  4O6J A;  3VB2 A;  3TOA A;  2C6Y A;  3ULQ B;  4S05 A;  2BV6 A;  3HSR A;  4HV6 A;  1FBS A;  5LHG A;  2XV4 S;  5JR3 A;  1L0O C;  5TRD A;  1FSE A;  3KP6 A;  3GFI A;  3C7J A;  4KN4 X;  2J5P A;  3GFJ A;  4EM0 B;  3Q9S A;  1G6N A;  2L54 A;  2IP2 A;  1K79 A;  2Z5U A;  3E6M A;  2P5K A;  2Y0M A;  2QQ9 A;  3U1D A;  1TBX A;  1DDN A;  4U88 A;  1KU2 A;  2XIG A;  2O8X A;  4JBA A;  2G7H A;  3T1B A;  3BY6 A;  4OIR F;  2LDU A;  3B02 A;  3WTW C;  3WOD F;  1OYY A;  2P5L C;  5HDN A;  4FHT A;  3SZT A;  3FXQ A;  2JTV A;  4EQQ A;  5DEQ A;  3PFI A;  2VT2 A;  4G6Q A;  3ZMV A;  3EET A;  3LA7 A;  1Z05 A;  2Q0O A;  1ZRF A;  3I5U A;  3L09 A;  4ZZL A;  4BYY A;  2M1B A;  3R0A A;  4GXO A;  1XGS A;  2VC0 A;  2NAZ A;  4HAM A;  2CGP A;  4EJT A;  1U5T B;  1Y0U A;  2JSC A;  2K7L A;  2W25 A;  4ZYG A;  1TQP A;  4UUV A;  2XRN A;  2QZ8 A;  4YII A;  4AVP A;  3LQR A;  2MA3 A;  5LGU A;  2QYO A;  5BQT A;  1R1V A;  4KDP A;  5JFR A;  5K5R A;  2BGC A;  3CTA A;  2HTS A;  4EJU A;  1TQI A;  2GIV A;  3ABT A;  3OV8 A;  4IF4 A;  2MBF A;  3RKY A;  3MCZ A;  3V8K A;  1LJ9 A;  4XSZ F;  1IF1 A;  1BIA A;  4UV9 A;  1XN7 A;  4MGR A;  4FX0 A;  1OMI A;  4LD5 A;  4MTE A;  4AWX B;  4GGG A;  5D5W B;  4FT8 A;  1U78 A;  3MZH A;  4I01 A;  2NNY A;  3K2Z A;  4ZYH A;  2Y75 A;  4EJV A;  3Q5F A;  4XLN F;  2E1N A;  1NHA A;  3TQN A;  1HKT A;  1D3Y A;  2OZU A;  4M9Z A;  3I59 B;  4LLN A;  2HEO A;  3E6C C;  5E1W A;  1G3Y A;  4F7Z A;  5FFX A;  1KU3 A;  1UHW A;  1QQI A;  1RUN A;  3MQ0 A;  1IN4 A;  3HRT A;  1IZ1 A;  1YYV A;  1BM9 A;  3QP5 A;  1XSD A;  3WTV C;  5FO5 A;  1ZGJ A;  4IRG A;  2O61 A;  4MNU A;  2M30 A;  4HLY A;  1MDM B;  4KIC A;  3QU3 A;  4OIQ F;  1R58 A;  1IXR C;  3M7G A;  1CF7 A;  1EH6 A;  2HTJ A;  3I71 A;  2P7C B;  1MKM A;  1LDJ A;  4CDG A;  3KLN A;  4IJA A;  1W7P A;  3RI4 A;  3OOP A;  2IA0 A;  2FOK A;  2VC1 A;  4B8X A;  5IT9 Z;  1SMT A;  1FLI A;  1ON2 A;  4I0B A;  1S3J A;  3ROU A;  3V7S A;  3CO7 C;  4Y17 A;  5AIQ A;  1F1Z A;  1V4R A;  5FGM A;  1O7L A;  1J59 A;  3IKV A;  4OMZ A;  2RC4 A;  1S8N A;  2XGX A;  4OMY A;  2VT3 A;  2K4B A;  5FB2 A;  1HSJ A;  4BHP A;  1XCV A;  3NQO A;  3GVA A;  3GLX A;  2PLY A;  4EGZ A;  2ESN A;  3IWZ A;  1XCB A;  2NNN A;  2GA1 A;  2CO5 A;  3F8F A;  2OU2 A;  2ZBK A;  3TO9 A;  4AIH A;  4GYI A;  3N97 A;  1Q1H A;  4BXU A;  4ENM A;  1WI9 A;  1W5S A;  1YW8 A;  4CXF A;  2J5O A;  3KP2 A;  2LSO A;  4ESJ A;  1ZG3 A;  1FSH A;  4U0Y A;  2KIF A;  4LFU A;  1FWZ A;  4EVI A;  4ESF A;  5ICF A;  4I2O A;  5HLI A;  4P9F A;  3LQQ A;  5HLG A;  2CWE A;  3KP5 A;  2OAZ A;  4EJO A;  4Q47 A;  5D6F A;  4L18 B;  3G73 A;  3BJ6 A;  4RS8 A;  2M8E A;  5FD6 A;  2AXL A;  2P8T A;  1H0M A;  2FF4 A;  3J7A O;  1LEB A;  4JQF A;  2DTR A;  2IRF G;  1HKQ A;  3P9K A;  4BH9 A;  2EV6 A;  4MQV A;  2WV0 A;  3WU1 B;  4KT5 C;  1HXD A;  4L0Y B;  5J6X A;  2M5W A;  4HW0 A;  1XD7 A;  3FMS A;  2HZT A;  3GZ5 A;  1B9M A;  3J81 Z;  2MLG A;  3ZQ7 A;  1IRF A;  1R00 A;  2KIM A;  3SXY A;  3WGG A;  1Z9C A;  1DPR A;  1TNT A;  3HTS B;  3WE2 A;  2XAJ A;  1KU7 A;  4HLX A;  5DV5 A;  5JVT A;  3HUG A;  4TV7 A;  2GXB A;  2KIU A;  3F8C A;  1QPM A;  3FMQ A;  1U5T A;  3F23 A;  4RGX A;  2XAH A;  4KFC A;  2P4W A;  1SFE A;  4RGR A;  4HA8 A;  2CFX A;  2QBY B;  5DCM B;  5JHU A;  4BHC A;  2L4M A;  1ZHF A;  2QVO A;  1ODD A;  2HYG D;  3H92 A;  5HDG A;  3KZZ A;  3Q9V A;  4O3M A;  2CSO A;  2A6E F;  2RGV A;  4KN7 X;  3J80 Z;  5ILV A;  2V1U A;  4IRH A;  2JRT A;  2V6C A;  5CYV A;  5BOX A;  5D5V B;  3SQN A;  1XDS A;  5HS8 A;  1F4K A;  4WWC A;  1MZB A;  4CYD A;  4HX4 A;  4WXD A;  1D8K A;  4DQ2 A;  3K9T A;  3HOS A;  2VON A;  2W57 A;  1KQ9 A;  3IRQ A;  2IA2 A;  4U0V A;  2HOE A;  5F6F A;  5A2Q Z;  2D1V A;  3I59 A;  3P9C A;  5EEG A;  3D5L A;  1XGM A;  3KP3 A;  1VTN C;  1I1G A;  3EUH A;  3COA C;  1IXC A;  2DQL A;  1T6S A;  5H6R A;  3VOE A;  2R7F A;  3DKW A;  1FP1 D;  2STT A;  4L9J A;  2ADU A;  3EDP A;  1BJA A;  1QZZ A;  4O5V A;  5D8K B;  4WCG A;  3IHU A;  2DU9 A;  3J81 K;  4EGY A;  4G7Z F;  5D4R A;  4UXN A;  4GO1 A;  2VE9 A;  3DEU A;  1MDM A;  5D5U B;  2DPD A;  2JT1 A;  1I6X A;  2K86 A;  4ON0 A;  1ZG1 A;  4I7H A;  1YTY A;  3DP7 A;  3ZMZ A;  2RDP A;  3C3W A;  3C18 A;  2FNA A;  3FXR A;  4N9I A;  3M9A A;  2A61 A;  3I53 A;  3WE3 A;  2E1C A;  4LG0 B;  4OOI A;  3GX4 X;  2HQR A;  3EYI A;  2WWY A;  3HHH A;  3E5Q A;  3FMR A;  2H09 A;  3FM3 A;  3LST A;  2COM A;  4Y13 A;  4R79 A;  1LQ1 A;  4M73 A;  2DK5 A;  1Z6R A;  5J8F A;  1XMK A;  3J80 K;  4Q48 A;  2RVC A;  1G3W A;  3JW4 A;  4ENN A;  4AIJ A;  3L7W A;  4HDV A;  4HX8 A;  2JZY A;  5DUK A;  3ZMT A;  5JI6 A;  1BC8 C;  5AON A;  4BNC A;  2H6B A;  3CDH A;  3W6J B;  2R3S A;  1J75 A;  1BBY A;  1R22 A;  5D5X B;  1FYK A;  1USS A;  3CJN A;  5CVJ A;  1KYW A;  5HOO A;  2VOO A;  5A2Q K;  1DUX C;  1T0F A;  2XKO A;  1J2X A;  5L3D A;  4OIP F;  3E97 A;  5CVV A;  2BYV E;  4G9Y A;  3G3Z A;  3CO6 C;  3ABU A;  2OD5 A;  3DF8 A;  1H9G A;  3ZMU A;  4M72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...