1B72B

Pbx1, homeobox protein hox-b1/dna ternary complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
RKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein/dna
molecule keywords DNA (5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*GP*AP*TP*CP*GP*G
publication title Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b72B00
2VI6A 3ZQHA 1K83J 5EYRA 4QTRA 1FIAA 1P7JA 1X2NA 2AO9A 2M0CA 4AYBN 2DMPA 1U8BA 2KT0A 4M3GA 1JUSA 2B63J 3HOWJ 1NTCA 3BQZA 4C2MJ 5EG0B 3JRIA 2HXIA 1ETOA 2ID6A 1Y1VJ 2GLOA 1A5JA 4B1RA 5E3MA 4IHVA 1I50J 1ZK8A 1PUFA 2DJNA 3HGYA 2M2EA 4UUTA 2ELKA 2CU7A 3H0GJ 1XC5A 2FJ1A 4A3CJ 1CQTA 2L7ZA 1BW5A 4GFBA 1JUMA 2WV1A 1W0TA 1GUUA 3CCYA 3HM5A 3HOVJ 4JP0A 2HYJA 1MH3A 3GTJJ 4BY1J 1MBKA 3ZQFA 4XRSG 2XPUA 1WH7A 2VUMJ 4BXXJ 2GBYA 2LFBA 1HLVA 3TP3A 5C3EJ 3S15J 1PUFB 2LVSA 2NVXJ 3FKIJ 1I3QJ 5IPAA 4LOCA 3Q0VA 2R5ZA 1ZTRA 4W1UA 1IGNA 4IEJA 1ITYA 1WCMJ 1ZGWA 4MFDA 3O8GA 5JLWA 3LSJA 1FTZA 3JRCA 3K7AJ 1NK3P 1Z0XA 2CQXA 3IH3A 4BBRJ 1F36A 2QCOA 3BTIA 1X2MA 4ABZA 3B6CA 5IYCJ 5GP9A 4Y52J 3GTOJ 4RBOA 5FKNA 2R7ZJ 5J1RA 2CUEA 3BR1A 4FE7A 2JMWA 2E1OA 1H8AC 4A3DJ 2R5ZB 4A3IJ 3HOXJ 4B3AA 3GTPJ 2Y9ZA 2ME6A 2N8GA 1TWFJ 1WI3A 2ECBA 2R5YA 3ZQLA 3GTKJ 2M34A 5M5XJ 2DA7A 2K40A 1VF9A 3IH2A 3TW7A 1G2HA 1ETWA 3B6AA 3JR9A 3S2DJ 2I10A 2L0KA 4JX5A 2HOSA 2XGDA 1P7IA 3LSGA 1POGA 3BQYA 2OPTA 3HKZN 4L5EA 4MFEA 2HXOA 5EZGA 1ZR4A 1NK2P 4FE4A 4M6VA 1U78A 4S0HB 2HQ5A 1WPKA 2DMNA 2DMQA 2NOGA 5EGOA 2YUSA 1QVTA 2X48A 2DA6A 4JYKA 2EBIA 2XPVA 1Y1WJ 2JA8J 2XPWA 3G1MA 2R5YB 2WAQN 2R93J 1U9NA 2Y31A 3HOZJ 1VFCA 2LD5A 2LP0A 2L9RA 1HCRA 5J1YA 4XICA 3NARA 4A93J 1VNDA 3NAUA 4A3FJ 2COBA 3CMYA 1JKRC 3S14J 1K61A 1JGGA 3QQAA 4X1EA 4A3EJ 3HDDA 4X6AJ 3LNQA 1XG1A 1IUFA 3RZDJ 2Y2ZA 3OSGA 1O4XA 2XRLA 1UHSA 1JKOC 4B4CA 1F43A 2XGCA 1B72B 5EGOB 1AU7A 3W6VA 5K7ZA 3SJMA 2Y30A 1AKHA 5F04A 2IBDA 2DMTA 1GVDA 2O7OA 2AHQA 2YU9J 3D1NI 3L1PA 1QRYA 3MVPA 2L7FP 2ID3A 5IYDJ 5K7FA 2LKXA 4MO7A 5EZHA 5JLXA 1JKPC 4BBSJ 2JK3A 1MSFC 2CJJA 4I6ZA 2DA5A 1E3OC 2IAIA 2WB1N 1B8IA 1HOMA 3QPSA 2H1KA 3A03A 4J19A 3ZQCA 2DMUA 1I6HJ 2RAEA 1AKHB 4A3BJ 1MBEA 3CQZJ 2CQQA 3O8HA 4JX6A 1JJ8C 3HB9A 2H8RA 1IV6A 2VKEA 3S16J 1SANA 1RKTA 2Y0SN 3IV5A 2GM4A 1TC3C 1FIPA 4W97A 3PO3J 5J3LA 4DW6A 3GTGJ 5BNGA 3HOYJ 3Q3SA 5E3OA 3FK7A 3A02A 1B8IB 3SFIA 3FK6A 1ZQ3P 3CDLA 3HGGA 1ETYA 3OIOA 2NS8A 5C44J 1BL0A 4DZPA 1ZKGA 1ETVA 1MNMC 2HDDA 1DU0A 2R92J 2JN6A 5FKLA 1JJ6C 2XB5A 4A3GJ 1TWGJ 4G12A 3JRGA 4D5CA 4V2FA 3BG5A 3TW6A 1UG2A 4D5FA 2MG4A 3Q0WA 2LY9A 3F0CA 2NVQJ 3PO2J 1JTYA 2X6OA 2M8GX 5F1JA 3I4NJ 1BA5A 2ECCA 2EQRA 4D7MA 2LK2A 1JKQC 3FIWA 1IC8A 3E7LA 4IHWA 1LFBA 3Q0UA 4AC0A 1Q1VA 3ZQIA 3UKGA 1ETQA 5K7HA 1JT6A 2CUFA 4M3BA 3LSRA 3I4MJ 4HNVA 3OOUA 3BG9A 4IHXA 1HDDC 1S7EA 2TCTA 2X9DA 1UMQA 2D5VA 1U9OA 2K9QA 1MSEC 3HOUJ 4EEFG 1ENHA 2JWTA 1MBHA 4M3DA 4RDUA 4IHYA 2QF7A 2XGEA 9ANTA 4FTHA 1ORKA 3LSPA 4AUXA 3BR2A 2ME0A 3G1OA 1MH4A 3DEWA 4DYRA 5IOZA 3C2BA 3RZOJ 3GTQJ 1IDZA 3SDGA 3ZQGA 5F0CA 3HBLA 3JRAA 2OF7A 4A3JJ 3FISA 2JA6J 2LR8A 1RPWA 5FJ8J 2Y9YA 5F27A 1ZR2A 1D5YA 1QPIA 2VKVA 2MSYA 2NVYJ 2O8KA 4BY7J 1FTTA 2HI3A 3IH4A 3A01A 3TP0A 5FKMA 1JT0A 3JREA 4QSHA 1TWHJ 3BR5A 1MBGA 2XB0X 1LE8A 5FLVA 2O9LA 1Z77A 1YRNA 3JRFA 4M3FA 1OJLA 4V2GA 3VPRA 3S2HJ 5EF6A 4XRSA 2DA3A 2K9SA 4DYQA 4Y7NJ 2L7MP 3LOCA 5M3MJ 3H3VK 5GPCA 5M5YJ 4A3KJ 2G0EA 1BW6A 3PM1A 1BJZA 1FEXA 2HOAA 2R0QC 5IYBJ 3HEFA 3A01B 2E2JJ 2JA7J 3M4OJ 2W48A 2DA1A 1T56A 3QPLA 1JTXA 1ETKA 4A69C 1LE8B 5EDNA 1YRNB 4MLOA 3G1LA 4M3EA 1TWAJ 1GV5A 2E19A 5C4JJ 4UUSA 2DA4A 4I76A 4XIDA 5E3LA 5J1UA 5M3FJ 4XK4A 3MKLA 1APLC 5HODA 4A3LJ 4C3HJ 5DS9A 2XSDC 1RKWA 1H88C 2EZHA 1IG7A 1SFOJ 3JRHA 1RR7A 2DTZA 1IRZA 3JRBA 3K2AA 1TWCJ 1R9TJ 3GTLJ 2LLKA 2EH3A 1H89C 3WHBA 3BTJA 4UUSB 3ZOBA 2PMZN 1WGXA 1LFUP 2MGQA 4A3MJ 2LTPA 2FD5A 4JX4A 3S1RJ 1FJLA 5FLMJ 1AHDP 3BTCA 3RKQA 3WHCA 2ZB9A 4CYCA 5M5WJ 3MN2A 2M9HA 5F08A 3JRDA 1MBJA 1GT0C 2VPRA 2CRGA 4DYCA 3BR0A 5GPAA 3GBGA 1GDTA 2E2HJ 1VI0A 2FX0A 1IDYA 1A6IA 5F0HA 2MW8A 3DCFA 2FQ4A 5C4XJ 1HDPA 4C3JJ 3S1MJ 1OCPA 2DA2A 1XS9A 5F0FA 2EZKA 4CYCB 4NDLA 5FKOA 1DU6A 2JA5J 3BG3A 3S1QJ 3RQIA 1HF0A 4QIWN 5IOYA 4C3IJ 3TEDA 3OSFA 4DZJA 4FISA 4FCYA 1W0UA 3GTMJ 3S17J 5IP6A 2YS9A 2JJ7A 2HOTA 1QVUA 5E3NA 1B72A 2K9NA 5EEAA 2IEKA 2E2IJ 5IP7J 2TRTA 3BR6A 2NS7A 3S1NJ 4XRMA 5DTDA 1T33A 2DN0A 3BR3A 1OCTC 3BTLA 3BT9A 3M3YJ 1X58A 4BKXA 2NVTJ 1IJWC 5EG0A 1ETXA 1JUPA 2P81A 2KDZA 1EF4A 5FKKA 5IP9J 1GV2A 1MBFA 4MIMA 1RESA 2EZIA 1OFCX 1WH5A 2EZLA 4D7NA 1RETA
chains in the Genus database with same CATH superfamily
3IAS2 3K6GA 3WODF 4CH7A 4V19K 2B0LA 2XDVA 1FIAA 1HBXG 1LDDA 1TT0A 4WX9A 3I64A 1JUSA 3OYKA 5FFZA 1SVLA 1FBQA 2L01A 3SYTA 5B66C 3QYFA 1UHWA 3TMOA 1YYVA 2HXIA 2ID6A 4L9JA 2GLOA 4B1RA 5E3MA 3KEQA 2Q2EA 4K2EA 2M4KA 3L2UA 2M2EA 2R7WA 3K70C 4BXUA 4IL6C 4PGHA 2ELKA 2EFNA 1O7FA 1BN5A 4IKFA 3EUKL 2ZMEA 1JUMA 1SVOA 3OYIA 3KZYA 2DAOA 2WV1A 1OR7C 2RQQA 2L9VA 3RKXA 1ZREA 2IRFG 2K02A 3WTWC 4OWRB 3GTJJ 2STWA 3ZQFA 4BY1J 4XRSG 4QPOA 4BXXJ 4LK0F 3S2WA 2LFBA 2KIFA 3SXYA 1D8KA 1TL8A 4M9ZA 2HEOA 4NC7A 2Y0SA 1FNNA 3S15J 3AG2H 1UB9A 4ZTJA 2NVXJ 3REOA 1I27A 3DEEA 3SEZA 4RAFA 2DODA 4BJTA 5DCMB 4W1UA 1YLFA 3AG3H 4ENJA 1WQ2A 3FKJA 4UY8I 1FTZA 1FLIA 3HRSA 3K7AJ 2CQXA 3DXJF 2PG4A 3IH3A 4MQ9F 3BTIA 5E79C 1X2MA 3GFIA 1YOVB 1Z6RA 1E3PA 1ZELA 2EB7A 1Y56A 4Q48A 3GTOJ 1T0FA 1Z91A 5FLXK 2VKDA 5LBQA 2R7ZJ 5J1RA 1O3RA 1J75A 4FE7A 1WJDA 4XM3A 5FROA 3GXOA 1D1BA 1H8AC 5DUKA 2LKPA 3CJQB 4A3DJ 4NQWB 3HOXJ 2F4MB 4KT6A 2Y9ZA 1RIOH 2N8GA 4RS8A 1TWFJ 2CWEA 5TISC 3ERED 2IS2A 3ZN0A 2LF8A 3ZQLA 3GTKJ 4LMYA 1ZLJA 3C2GA 2IS6A 3Q9VA 1R4NB 2DA7A 3I55I 2BOLA 2IVMA 4M73A 1KQ8A 2OUMA 4KFCA 3LSIA 3LSGA 1Z7LA 3SEQA 3BQYA 5CVUA 2NNNA 3BPXA 2ZJRF 1WSUA 4G7HF 1NK2P 4FE4A 1BOBA 1ZRCA 2BBYA 2V26A 3BWGA 4S0HB 1L0OC 3MAJA 4BU2A 4MGRA 3M1CA 1OYIA 5EGOA 2NOGA 1S9HA 2GA1A 4XKCA 3CCRI 2X48A 4JYKA 1QBJA 4YIRX 2CFXA 1NH3A 2JA8J 1QA6A 1YJNI 4C2TA 2XPWA 1BM9A 3DF8A 1MJ9A 5LEJA 2K4BA 2LP0A 3GVAA 2AXTC 5J1YA 4A93J 1R1UA 5B5EC 1E3HA 2COBA 2PMUA 1U5TA 3QQAA 1J0RA 4A3EJ 4WWCA 3LNQA 3ZR8X 3I59B 1IUFA 2M87A 2Y2ZA 1S5LC 2D1HA 3ASNH 2XF6A 1UHSA 3FMRA 3K4KA 5HDNA 2KMUA 2LH9A 1TNTA 1X3UA 2CSOA 5KCMA 3WGIA 4HF2A 1T08B 2XAFA 1USSA 4PK4A 3KYDB 3C1DA 1AKHA 5CVVA 2IBDA 5F04A 5IT9K 2DMTA 2P0WA 1GVDA 4J00A 3GWZA 4HA8A 2AHQA 2YU9J 2LREA 2A3SA 2L7FP 2ZSIB 1SVMA 2HQNA 3VYUB 1ZN2A 1DDNA 2LKXA 2K5CA 2LY1A 3GEZA 3JW4A 4AIHA 4BQNA 3FM5A 1W1WE 2DPDA 2CJJA 4N0BA 3DLLF 1E3OC 2WB1N 2OCEA 1HOMA 1RRJA 4KNYA 4J19A 3LA3A 2V6CA 2PLYA 2DMUA 1I6HJ 3BZ6A 3E5QA 4A3BJ 3CQZJ 2XAUA 2Q1ZB 2CQQA 3O8HA 1GXPA 3CCSI 4LG0B 4IHSA 3G4SI 1R6RA 2EINH 3EPZA 1TC3C 4OAZA 1FIPA 3PO3J 3M8EA 3A0HC 3GTGJ 3FK7A 2M5WA 2P5VA 3HPHA 5AIQA 3SFIA 1B8IB 1VQ9I 4L5JA 1ETYA 4E7ZA 3TDUC 3ZP5A 5C44J 4DZPA 4AIKA 1VQNI 2YR2A 3F3XA 1YJ9I 4DBRA 2MLKA 4L0ZB 1SD7A 1MNMC 1DU0A 5FRMA 1LB2A 2F4IA 2JN6A 4KT5C 2M4GA 3CESA 4LJZF 3R61A 3KZIC 3LMMA 2PQ8A 4XORA 4G12A 1R00A 3FXJA 4G8XA 3CZ6A 2JVGA 1R5HA 5DDGA 2IGOA 4HPQA 3TO6A 4CXFA 4RB0A 1T95A 4U0YA 2MG4A 3PQKA 1K6YA 3Q0WA 4IOCF 1GHCA 1SD4A 2LY9A 1J09A 1R7JA 4Y3OA 2P8TA 2PMZA 3ESWB 4E6KG 3DPLC 4JOMA 3FDYA 1S29A 5CVJA 1D5VA 3KEOA 1O3SA 2KP6A 1FPQA 2HQAA 1BA5A 5L3FA 3K2ZA 1U3EM 4YFKF 1DP3A 2H27A 2LK2A 5F64A 4O5VA 1K6OA 5L3DA 2UXXA 1LFBA 3Q0UA 1WJAA 3SZGA 1A35A 1ZGAA 3UKGA 1ETQA 5F1RA 4AIDA 2CUFA 4Z6YA 2DW4A 3W2VA 2ESNA 4HNVA 1IXRC 4OIPF 1H0MA 2NVUB 2HDWA 3OOUA 3BG9A 3L7WA 5ERIA 2W7NA 4I09A 1HDDC 1UFMA 4IVNA 3U2RA 2D5VA 3BCAA 4LGWA 2K9QA 2M3AA 2E1NA 1AA7A 5ILSA 4BDZA 3V7CA 2QF7A 2QSGX 1F1ZA 4LIUA 3HSFA 1JE8A 1ORKA 4ZDOA 1MNEA 3BR2A 3T8RA 2ME0A 4BEHB 2DQRA 5IOZA 2CV1A 1WJ5A 3OS2A 2DK5A 5LRSA 1LVAA 5F0CA 3HBLA 4HV5A 3ZMVA 5FJ8J 2Y9YA 4BQAA 1VQKI 3WTTC 1X19A 2JRMA 5E20A 3F8FA 1B4AA 1EH6A 2VL8A 3CJNA 2G9WA 3TP0A 2FOKA 3OYEA 1MJAA 4QSHA 1YI2I 3ABMH 3OIPA 1MBGA 1Y0UA 1ZH5A 1LE8A 5FLVA 3GZ6A 1Z77A 1VQ6I 4JBAA 1UAAA 3VPRA 1HXDA 1YO5C 2L5QA 2NYXA 4XRSA 4XKBA 1Z3XA 2W85A 4BXFA 2L7MP 2OC6A 4OMYA 3I4PA 1ACIA 5M3MJ 1BIBA 1S3JA 3ZMDA 4PSXA 4EM0B 2KPMA 2Q8KA 3TL4X 5JI6A 3CLQA 2VIXA 5DM6F 3JAMK 2A5WA 3PM1A 3ZGKA 1FEXA 2HOAA 2E2JJ 2JA7J 1FWZA 2IP2A 3KP3A 2HVRA 3M8FA 1T56A 2DFEA 1JTXA 3EUHA 3QPLA 4A69C 3BDDA 2GOXB 2KL4A 3DPUA 1MZBA 1YRNB 4MLOA 3G1LA 2HQRA 4PJ0C 1D0XA 1YW7A 4XQFA 3LSTA 5C4JJ 4UUSA 2RV8A 4HDUA 4CSWA 4I76A 5D5UB 4PCQA 2VC1A 3F6OA 1J7KA 1P4AA 4U0WA 2QQAA 2XSDC 4HQMA 1H88C 3IRQA 4RM3A 4KMUX 3G71I 4IHTA 2KISA 3PQJA 1SFOJ 3JRHA 3BOQA 1RR7A 1IRZA 1TQIA 1R9TJ 2VT2A 3F8CA 3GTLJ 2EH3A 2EA4A 3WHBA 5H2FC 2B7EA 3BJAA 4E7HA 3ZOBA 4A6EA 3DU5A 2LKSA 2MGQA 1AOYA 3TOBA 2M45A 2CQNA 1WZ2A 4LITA 5DD8A 3VOEA 1VQLI 2HPMA 4EGYA 3F6VA 1HSJA 5FLMJ 1AHDP 3BTCA 2DOFA 2JUCA 2ZB9A 1PDNC 2CGPA 1G8XA 3HZJA 4D1QA 2P7VB 3P9CA 3M7GA 5F08A 3JRDA 4RGUA 1FOYA 3SQNA 3CCMI 2QKLB 3O6BB 3KLNA 1GDTA 3F21A 5B1BH 5CQGA 4N9HA 2E2HJ 4Y17A 2JTVA 1A6IA 3DCFA 2FQ4A 3NRVA 5BPDA 3E6DA 5J40A 4EM1A 1I5ZA 2DA2A 4UVAA 1LDKB 1XS9A 4MQVA 2EZKA 1JI8A 4PJNA 4CYCB 4ENMA 4NDLA 5FKOA 1YTYA 4PZJA 3FF5A 2V1XA 2RNJA 4EMSA 1ZG1A 4OMZA 4NNJA 3LWFA 4QIWN 2DXIA 4C3IJ 2ZXJA 3E97A 3CC4I 4DZJA 2KHMA 2KRCA 2NXNB 1KA8A 2CQKA 1E0EA 5D4RA 1FP1D 2K7LA 2VLAA 1FX7A 2IPQX 3CCLI 1K79A 2W82A 3S1NJ 5DTDA 1T33A 3BR3A 1HKSA 1IJWC 4LG3A 4KN4X 4R79A 5ICCA 1CF7A 2Q0OA 1ETXA 4E7IA 4D0PA 1TNSA 2MYSA 1TW3A 1GV2A 3WTSC 4CO8A 3K4JA 1N78A 4A6DA 4CICA 4YRVA 1DP7P 1KYWA 5LHIA 4Q4ZF 1ZG5A 2NOJB 4U7BA 5EYRA 2H6CA 2AO9A 2M0CA 4QTRA 3L00A 4M6XA 4LG0A 1OR7A 4RB1A 3RYPA 4BE0A 1B9MA 4E4HA 3JRIA 1G3YA 3CCEI 1A5JA 4P1WA 2CO5A 3GLLA 1I50J 2L9NA 1Z21A 1ZK8A 1PUFA 2DJNA 3BLYA 4UUTA 2IS4A 3A4CA 2FSWA 3G6EI 2I8DA 3SZPA 3WE2A 4ZYDA 4I0BA 4FHTA 4RLQA 1MMSA 1O3TA 1XC5A 2JSCA 2XAHA 3QRFF 1GLNA 2L7ZA 3OYHA 2WB1A 4GCVA 3CDHA 5TRDA 3S93A 2ZFWA 3OIQA 2X0LA 3WU1B 2AS5F 2W4SA 4JP0A 3ERMA 4E7LA 1XGMA 3PFYA 2ICWG 1F5TA 1WH7A 4S04A 4I2OA 2GBYA 1YQAA 2QQBA 1USTA 2A05A 1HLVA 1LEBA 2K4JA 3TP3A 5GAEJ 2LVSA 1P6RA 2DLLA 5IPAA 2EK5A 3Q0VA 4H4KC 1I1SA 2WAFA 1ITYA 1WCMJ 1ZGWA 3O8GA 3LSJA 1NK3P 2L4AA 3P9KA 2QM3A 4DBQA 1BI3A 4IOAF 1LJ9A 2VBYA 5FB2A 4E70A 5IYCJ 2EFQA 2OCCH 2PBIA 2X6WA 5FKNA 2J5PA 3PIOF 4XKWA 1QGPA 2HYGD 2CUEA 3BR1A 3C7JA 5BMZA 3OS1A 3ABKH 5H6QA 2R5ZB 1OISA 2NRAC 3FXUA 4Y33A 4IRGA 3RPUD 1FP2A 2BVMA 4EQQA 4F92B 2R5YA 1W7PA 5DYMA 2FQ3A 3VEPA 5M5XJ 1XB4A 3IH2A 1MDMA 1WJBA 1X4PA 1ETWA 3KCCA 3LFKA 4JX5A 5L3CA 2HOSA 4BE2A 1QHGA 1P7IA 1Z05A 2DFIA 3CDIA 4BEHA 2O5RA 4IRHA 2OPTA 4BAYA 1ZYRF 1IXCA 1ZR4A 1V55H 3HYIA 3PNYA 4PDKA 3L2CA 2CV2A 2DK8A 2DMQA 4CCOA 4HOBA 1QVTA 3IL2A 2OTLI 2A6HF 3F23A 1Y1WJ 5D6FA 1LVKA 3J7ZI 2WAQN 1U9NA 2Y31A 3E6BA 2R4GA 4MNUA 2P5KA 4MEYF 1VFCA 1HCRA 4XICA 5J47A 1R71A 2H1LA 1JKRC 3CMYA 3K0LA 5BOXA 2VOOA 3HSRA 1XMKA 1XG1A 2TDXA 5FGMA 2FF4A 3VYTB 3W2AA 1RZ4A 1BBYA 2PJRA 1JKOC 2R7DA 4YEJA 1F43A 4XRFA 4LLLA 2VASA 4A0ZA 4AWXB 3OR2C 1B72B 1AU7A 1B1BA 4P55A 3I71A 2W00A 2EV5A 2V6EA 2CW0F 3AKZA 3MEXA 2VODA 2IA1A 1X1CA 4KUMA 3OYBA 1LDJA 2V7FA 3MVPA 2RDPA 1A31A 2VQHA 4B3XA 5K7FA 2E60A 5ICGA 4HF0A 3GZ5A 1SMYF 4I6ZA 1MSFC 2XF7A 4ZYHA 2PJPA 2HZTA 3DTKA 3J81Z 3LSKA 1U2WA 1KGSA 3KFWX 1ONVA 2E35A 1XMAA 3AL0C 4FT8A 2EV0A 2HYFA 2VB6A 3SZTA 4MTDA 3A2KA 1N75A 1NG7A 1OYYA 4BS9A 3HB9A 2OZ6A 2VKHA 2BEOA 5KNLA 5CLSA 3F8NA 4P9FA 3UNGC 4QWQA 3IV5A 4B48A 3N4MA 3ASOH 1MMDA 4W97A 4DW6A 1K78B 2HZDA 3GZNB 5IT3A 1BI1A 3HOYJ 2Y75A 5E3OA 3HOSA 3SDBA 3VSLA 4AVPA 5JVTA 3S3NA 3OIOA 3GFLA 1R5ID 2JPCA 1BL0A 3LAPA 2XVCA 4IXAA 1XDUA 1ETVA 2BGCA 1B59A 1SFEA 3CF2A 2R92J 1V54H 2R7UA 2V1NA 5ILVA 1EA3A 4KIFA 3M8JA 1IN5A 1SD6A 2KQRA 4A3GJ 2A61A 5ILUA 4ESJA 4FX0A 4M9SA 4XONA 4V2FA 3BG5A 5H6RA 5E1WA 4D5FA 3PSIA 1D3YA 1PVEA 2EFPA 1DPUA 2OV7A 5B1AH 3K4MA 2CFOA 2NVQJ 4L5IA 1JTYA 2L9SA 3HHHA 3I54A 2HS5A 5F1JA 1MIJA 2XRNA 2E1MC 3BROA 1C0WA 4UV9A 1EJ9A 2ECCA 5L3GA 2VJIA 2HTJA 4D7MA 2DQLA 4PJLA 1JKQC 1Z3YA 3FIWA 4GO1A 2P4WA 2RVCA 2UUZA 2ZFUA 3E7LA 1WJFA 1IC8A 4AC0A 1Q1VA 4LFUA 3ZQIA 3KLOA 3RIRA 5K7HA 2R7TA 3RJPA 2QVOA 3K4BA 3TKYA 4XLNF 5K5OA 3I4MJ 4XLAA 3HTSB 2O6GE 2E36A 2ZXHA 2X9DA 5LGUA 3OS0A 1UMQA 2CW8A 2VXZA 2JSPA 2KJCA 4LB6B 2UZKA 3QPHA 2ZJ2A 3HOUJ 4IX7A 4PGGA 3H92A 1BOAA 3CP2A 3HJEA 2Y0MA 4NB5A 1J9IA 4RDUA 2KRFA 1XPXA 2RREA 2XGEA 4F93B 9ANTA 5F6FA 2ISYA 1QQIA 2QBYB 3OYJA 4AUXA 1UCRA 2UWMA 3BZCA 3A1YA 3G1OA 4X0GA 4RGXA 1HW5A 3ECHA 3V8KA 3Q9SA 3CCQI 3C2BA 3J7AY 1IDZA 2GXBA 2DCEA 3UR3C 1WVRA 2Z1DA 3DLAA 1DGRM 3AG1H 3QYEA 2LR8A 4KN7X 2V9KA 5JR3A 1ZR2A 2QSFX 1D1AA 3DQVC 2NVYJ 1FTTA 2M0MA 2IGMA 2FBKA 3V42A 3GFJA 1P9QC 3E6MA 5FKMA 1YS7A 3JREA 1I1GA 2F6CA 1TWHJ 2M1BA 5GAGJ 3BC8A 4HX8A 3IUOA 1FMWA 4M3FA 4IPAA 4AD9A 2P7CB 1VQPI 3S2HJ 1XSDA 3DWLE 2STTA 4Y7NJ 1KU2A 1WKMA 2A5YB 2XV4S 3H3VK 5GPCA 2BW3B 4II2A 4DOZA 1S8NA 3WGGA 3ZQQA 4CYDA 4EJUA 5TGTA 2MC4A 2JA2A 2QQ8A 2XAQA 3HHGA 2R0QC 3L2WA 3HEFA 3A01B 3V4GA 2G7UA 3PSFA 2W48A 4HNUA 4XN3A 1ETKA 2OTJI 3ROUA 1D1CA 5E1ZB 5L3BA 3AL0B 5EDNA 1XX5A 5KK1A 2Z16A 2ZO4A 3AG4H 5CVIA 2GWRA 2JPBA 3DTEA 3PJRA 1ODDA 1QPMA 3EQLF 4Y15A 3KIOA 3IWFA 4QLCU 3RKWA 4XIDA 1X1DA 1OCOH 5J1UA 1KONA 3GUDA 3N05A 3MKLA 3LSMA 4KIGA 1APLC 4A3LJ 3H5RA 2L02A 3IRRA 1RKWA 3Q5FA 3S32A 4ESBA 2KZVA 1IG7A 4I7HA 3R0JA 1XDSA 2OU2A 3DBRB 3K2AA 1I3AA 1TWCJ 3TQNA 1VQ8I 4UUVA 5KHDA 4C9YA 4J01A 2GXGA 3OYCA 4HDVA 3J80Z 1LFUP 4XLCA 4WXHA 1S72I 3DEUA 4G6QA 3C3WA 3CF5F 2LRDA 2FXAA 4ZTFA 4IRIA 3RKQA 1WJEA 3S3OA 4XR6A 5IY5H 4BQOA 2E1MB 3PL8A 3ULQB 3FX3A 1GT0C 2VPRA 1XGOA 2CRGA 1HKTA 4BL0B 1IN6A 3TO7A 4PUSA 4ZYGA 4A5NA 3MZ8A 3DPTA 3U1KA 3FWEA 3F9KA 2FU4A 3KEYA 3ZN1A 3CO7C 4BHCA 2FX0A 3GLXA 3F8BA 3NWSA 1WWXA 5J8CA 3RDIA 3CTAA 1EV7A 5ICFA 4UNOA 4JQFA 5C4XJ 3R4KA 3FBIB 3K4LA 2I5UA 3CLOA 4C3JJ 1OCPA 2CQ7A 2QA4I 3S1MJ 1YX5A 1LUJB 2BHYA 1QZEA 3JTGA 3JSOA 2GAUA 2NS0A 3KYCB 2C6YA 2JA5J 3BG3A 1T0FC 2MABA 5HLHA 3VFZA 1MMNA 3BY6A 1FOXA 4FISA 2O8XA 4XSZF 2JQ7A 4FX4A 1GVJA 1QVUA 5E3NA 4XMYA 1B72A 2O0YA 2LBFA 2K9NA 3L2QA 2TRTA 1JXSA 2HPIA 3D0SA 2DN0A 3OYNA 4U88A 4A12A 1OCTC 3BTLA 3KP7A 3BT9A 2DU9A 1H9TA 4BKXA 2WAQA 5A2QZ 3MQ0A 3P5JA 3RSNA 5LHGA 2CMPA 2PN6A 4XLEA 2CG4A 2P81A 4F52A 2KDZA 2XUBA 3I58A 4KA4A 1E2XA 4MIMA 3JCUC 4UB8C 1KQ0A 1OFCX 2GA2A 2HU9A 2EZLA 4D7NA 4RB3C 3DBLB 3RPQA 1BI2A 4CHUA 5ED4A 2EIKH 1O7LA 4ETSA 2HVQA 2VI6A 3CUQB 1MKMA 4L0YB 4CCJA 1K83J 2RGVA 3DBHB 4HBLA 1F9NA 1P7JA 3FZVA 5D8LB 5EJCA 2E71A 3K1PA 4AYBN 1U8BA 2KT0A 2R3SA 1A36A 4ENNA 1ERDA 3EETA 3HG9A 3HOWJ 4CZCA 1WFXA 5EG0B 2QLZA 1SEUA 4UHTA 4BE1A 4HW0A 1UHMA 2VQGA 4IZZA 2MFZA 3RTRA 1HW2A 3HGYA 1DGWY 4BYYA 3ZQ7A 1R1TA 3HUGB 4XLPF 2KFDA 2FJ1A 5DCMA 3OYGA 4KISA 4A3CJ 5GTIC 4ANJA 4MHGA 3ELKA 1W0TA 4KITB 2HOEA 3J7AO 4MEXF 4I02A 5CKTA 2X4HA 3CMEI 3HOVJ 4A0YA 2HYJA 4BUPA 4ZJZA 3H9GA 1MBKA 5HLGA 2XPUA 2VUMJ 2L3DA 1UG0A 2VJJA 4A0XA 4I0AA 3V7SA 2HWVA 3K1MA 2Q2EB 2EA2A 5C3EJ 4BACA 5LD2C 5EEHA 3DV8A 1BR1A 1I3QJ 1R4MB 3PFIA 4KICA 1K4SA 5JHUA 3WGHA 2BYVE 1RNLA 1ZTRA 4NQWA 3VYSB 2OAZA 4HSTA 3OYAA 1U0JA 2ZMEB 2VONA 3T0YA 3NEUA 1Z0XA 1RI7A 1XGNA 1T39A 4BBRJ 1ZGJA 1OKRA 1F36A 4ESFA 2QCOA 1X3WB 5E8GA 4ABZA 4G7ZF 5GP9A 4Y52J 4EJOA 5LLQA 5DCFA 1IRGA 5HLIA 1IXSB 3GYHX 2X6XA 2L2OA 4G9YA 2GZWA 3J81K 3FXMA 1QO0D 3E3VA 1ULYA 3HIFA 1KZHA 2QGUA 4B3AA 3GTPJ 2ZBKA 3EYIA 4DNCA 1WI3A 4LLGF 5DEQA 3M9AA 3FHNA 4XKVA 2M34A 2XC7A 3QAHA 1VF9A 3TW7A 4Q47A 1G2HA 3B6AA 3JR9A 2QWWA 3DTIA 2L0KA 1ON2A 1FOKA 2IJLA 3WTZA 1W4MA 4ZH4F 3ZCOA 4L5EA 4YELA 4MFEA 3I59A 2HXOA 2R7RA 4M6VA 2EJRA 1U78A 3JTHA 1YS6A 2HQ5A 2RN7A 3H36A 2DMNA 3E6CC 1YW8A 2EBIA 2EILH 2XPVA 1VQOI 2KJBA 2KDOA 4GGGA 3E1SA 3HOZJ 1VQ4I 2X85A 2CW7A 2LD5A 1JGSA 2L9RA 1VNDA 4II3A 1YE9A 1K61A 4X1EA 2YX7A 3HDDA 4HEA2 4RAGA 4X6AJ 1XCBA 3RZDJ 3ZMTA 3TOAA 2BY3A 2XRLA 3ONQA 2CH0A 1BC7C 5ICEA 1QZYA 3RYRA 1MD0A 2X6YA 3MFKA 2R7OA 5EGOB 3E5XA 1OPCA 4B47A 3W6VA 4ZDLA 3RCOA 3WU2C 3SJMA 1VZ0A 3ZXSA 1J59A 2V9VA 1TT5B 4EVIA 1W5TA 4WK8F 1ZRDA 2O7OA 3L1PA 4BNCA 4HZFA 2ELJA 4IF4A 1U5TB 4P5OA 5IYDJ 3TO9A 4A5MA 2A6TA 4MO7A 3EUAA 5JLXA 2FE3A 2DA5A 1B8IA 1SFKA 3MWMA 2V79A 3QPSA 4LD5A 2H1KA 3FHZA 3A03A 3ZQCA 4C2UA 1YIJI 2UV1A 3BG6A 2RAEA 1AKHB 1HW1A 3C18A 1FZPB 2EV6A 1X1BA 5JVGF 3QP5A 2H8RA 2K9MA 1KU9A 1TW2A 2K3FA 1ZARA 2R7FA 4ZZDA 3HRMA 4N4OB 5BNGA 4ZYAA 4CCMA 2WAEA 3LA7A 3Q3SA 1D0ZA 2A07F 3A02A 3KP2A 1MJBA 3FK6A 4HLYA 2DPUA 1ZQ3P 2LG4A 3CDLA 2WWYA 2NS8A 2W25A 2V4JC 3CD6I 1ZKGA 1YHQI 2Z99A 2XROA 1JJ6C 4KYWA 2XB5A 3ZMUA 1TWGJ 3JRGA 2VBWA 4D5CA 3MKYB 5HLTA 5CJ9A 2GIVA 2OA4A 1R58A 1UG2A 1STZA 4YFXF 1R5GA 2JVHA 1RUNA 1YFHA 2EPFA 4OINF 1X4OA 5DD4A 3PO2J 4L18B 2X6OA 2GIZA 3E5UA 4EJWA 4YIFA 4GYGA 3CJRB 4I99C 3I4NJ 4WCGA 5HDGA 5HVQC 3W2WA 2EQRA 3H35A 3K1NA 2KZGA 1KU7A 4IHWA 2ZCWA 3EDPA 2H09A 2WA0A 4N4NB 4HF1A 3LSRA 2ACJA 2F5VA 3IP4B 4IHXA 2R7QA 3DKYA 4RLFA 3QOEA 3VWBA 5E17F 4RGSA 5HNHA 1S7EA 2GQQA 2TCTA 3HRTA 3LSHA 4M6YA 6PAXA 3PUFA 1U9OA 1MSEC 4EEFG 1ENHA 2JWTA 1MBHA 3L9FA 1IRXA 2HNHA 4HSRA 1SFXA 4IHYA 2LY2A 1UELB 2ZC2A 1P4XA 4FTHA 4GDFA 3LSPA 5J6XA 2IA2A 2OZUA 1MH4A 1ZRFA 5FO5A 2FBHA 3KETA 3J80K 3K4CA 3GTQJ 2W84A 2P5LC 1OCCH 3SDGA 3ZQGA 2DT7B 3FISA 3KP4A 2JA6J 3I0TA 1G3TA 1FYKA 1EKEA 2BY0A 3BJOA 1QPIA 2VKVA 3BJ6A 3G2BA 5E1XA 2MSYA 4BY7J 4P96A 2ETHA 3U21A 4A2UA 2HI3A 3IAM2 4PJJA 3IH4A 2CUJA 2DT6A 2LDUA 1H9GA 4E7JA 4XN0A 3KX2A 5BS6A 3BR5A 2P6SA 2O9LA 1YRNA 4HX4A 4IQJA 1OJLA 4ZZLA 4UB6C 1Y8RB 1OLTA 3W6KB 2ZXWH 2DA3A 2K9SA 4DYQA 4RB2C 3OYLA 4ZYEA 1PUEE 2MBFA 5B3SH 5M5YJ 1OYWA 4A3KJ 2G0EA 3PNTA 2BY1A 3GFMA 4WXCA 2K9LA 2IW5A 3OYMA 1UZCA 3V8LA 3COAC 2F5EA 4R1HA 4B8XA 3GO5A 2GXAA 5IYBJ 4I98B 1HQCA 4YIIA 5D8KB 3X2QH 3V7RA 1NHAA 4AYBA 3MD2A 2M30A 4ZC3A 5K5QA 1LE8B 1TBXA 1XMXA 4I01A 5E8IA 3RI4A 1QNTA 1JHHA 3W3CA 1VQ5I 1G3SA 4UVBA 4ON0A 4Y13A 2DA4A 2Z33A 1T98A 1IW7F 4CZZA 2HDCA 3FM3A 4CA0A 5E3LA 3IWZA 1FSHA 2BVLA 2MLGA 5M3FJ 2VQLA 2CS3A 2WBMA 1Z9CA 1O3QA 4RM2A 4C3HJ 5DS9A 2KIUA 3H9JA 4OIOF 5LHHA 3HRUA 3B73A 4DIQA 5A2QK 2VXDA 2DTZA 4TV7A 2HTSA 3WG9A 2XSJC 5D4SA 4B43A 5J4VA 2COMA 4U7DA 3PUBA 2LLKA 4WXDA 1H89C 4XBFA 3OOPA 2ELHA 4UUSB 3QPTA 3I9V2 1WGXA 2XGXA 2HFHA 4IO9F 2KLOA 3LL7A 4DGWB 1XD7A 4A3MJ 3FXOA 4F7ZA 5H20A 3S1RJ 4CUGA 4B09A 2X1DA 1LKXA 2BZTA 3U1DA 3WHCA 4CYCA 5CYVA 3RQ4A 5FD6A 3MN2A 2M9HA 4MTEA 3L2VA 2DYRH 1MBJA 1FC3A 1OMIA 3CCJI 3FMSA 5D6EA 2AXLA 3HL2A 3W6JB 1BIAA 4KDPA 2CUZA 3BR0A 4CCKA 4HLXA 5GPAA 1R23A 3GBGA 5GTHC 2PEXA 2FUG2 2A68F 1B9NA 2F2EA 4KMFA 3R0AA 1IDYA 3K9TA 5KVRA 2MW8A 2BY2A 3CC2I 2IGKA 4XLHA 3WG7H 2XAJA 4AM3A 2YX4A 3T8TA 1V5FA 2HKOA 5F0FA 2FBIA 4FASD 2XF5A 5JFRA 2ZJQF 2A6EF 2EIMH 2NNYA 1HSTA 3S1QJ 5LGNA 3RQIA 3LA2A 2O3FA 1TQPA 1TZLA 2XKOA 4RGRA 3WE3A 2PMHA 2BXZA 2EFOA 4ZDPA 4FCYA 3GTMJ 1WI9A 2YS9A 1IF1A 3PNVA 3HXLA 4HAMA 2IGNA 2HOTA 3WU0A 2XIGA 4UV8A 2E1CA 4PFOA 2VPLA 2GOMA 2IEKA 3GX4X 1BR4A 3H3UA 4XRMA 2BXYA 4Y4RA 1YJWI 1HC8A 3H0DA 2WY8Q 3N97A 3DKXA 3IC7A 1Z67A 3M3YJ 2F5FA 1DQUA 3MZHA 4U87A 2DOAA 4AU7A 3AAFA 1EF4A 1UJ8A 5IP9J 3H1CA 1MBFA 1K4TA 1RESA 2K86A 2EFWA 1WH5A 1U8RA 2K85A 3CUQC 3C2HA 3HTUA 3IKTA 2Z5UA 1LQ1A 3ZQHA 3G73A 1S6LA 2WADA 1SMTA 1X2NA 2D1VA 2M7BA 2DYSH 1TLHB 1V4RA 1Y8QB 2DMPA 3L2RA 1SC7A 3WTVC 4M3GA 1IN7A 2B63J 2E7XA 4XNFA 1XSXA 3HC7A 1KQ9A 4HNTA 1NTCA 1CF7B 3BQZA 4C2MJ 2LF7A 4Z2YA 3SHFA 3CO6C 1W5SA 1ETOA 1DUXC 1Y1VJ 1MNDA 3FBNB 1WJCA 2HR3A 2JZYA 4OIRF 5HNFA 4IHVA 5K1YA 2WTEA 5FFXA 1FYMA 1FBUA 4JK1X 1NG6A 1V3FA 1WHUA 1T38A 5FRNA 3I53A 2XHKA 1HA8A 2CU7A 3H0GJ 4LLNA 1XTAA 3FMQA 1CQTA 3NQOA 1BW5A 3VDXA 4GFBA 4LB5A 1D8JA 1GUUA 1X1PA 2W57A 4NBQA 3CCYA 3HM5A 1TP4A 1RC9A 2RQPA 2KKOA 1MH3A 3ZMSA 1ZLKA 3CC7I 4EGZA 3S3MA 5EEGA 4RMNA 1ZHFA 1PUFB 5J8FA 2VT3A 3FKIJ 2BHZA 3M1EA 4LOCA 2W1OA 2ZMEC 5CPRB 2R5ZA 1IO2A 4WF2A 1IGNA 1FBSA 3D5LA 4IEJA 2E34A 1GXQA 4MFDA 4U0VA 2VN2A 5JLWA 3JRCA 1JHFA 5K5RA 4IQ4A 4YG2F 3TGNA 4Q5SF 2FNPA 3RKYA 5KAIC 2XAGA 2G7HA 3WTYC 4M74A 3B6CA 2H94A 3DFGA 4EV0A 5GAHJ 2VBXA 3K10A 3DU6A 4RBOA 1W36D 2X1CA 2HVSA 4LIVA 2VE8A 4N9IA 3G3ZA 1FT9A 1R36A 1YIOA 2JMWA 2OBPA 2E1OA 1I6XA 2KRHA 3FXKA 4L9NA 4A3IJ 2ZSHB 4NHJA 2ME6A 2DO7A 3OL4A 3VB2A 2ECBA 2VQCA 2E5NA 2M7AA 2K40A 4XOPA 5LRRA 2DFFA 3J7YJ 3S2DJ 2I10A 5CQEA 2QEXI 1REPC 3F22A 2XGDA 1X3ZB 2IS1A 1POGA 3WTXC 3HKZN 3HOTA 2AQEA 2X51A 2R7VA 1Q1HA 2DTRA 5EZGA 3QU3A 3P9IA 3QOPA 3FXRA 5DM7F 2M8EA 3OYDA 1K7AA 1QZZA 3KP5A 1T6SA 4BDYA 2LOOA 1WPKA 2XKPA 2YUSA 3S8PA 2DA6A 4E7SA 1IRFA 3GMEA 1ON1A 1Z6TA 1O57A 3G1MA 2R5YB 1W7PB 1OQYA 2R93J 3I56I 2ADUA 1MDMB 2V1DA 4OOIA 2QYOA 3JSPA 3NARA 2OQRA 3NAUA 4A3FJ 4DQ2A 2YSRA 3S14J 4NUBA 1JGGA 4H0EA 3OR1C 1QU3A 1S7AA 1YX3A 4L9TA 1N25A 1IN8A 3H5AA 3DP7A 3OSGA 1O4XA 2MD0A 1MMGA 2L54A 4XL9A 2ZKZA 4GRIA 4EJTA 4B4CA 2XGCA 4BHPA 5BQTA 3ABTA 5K7ZA 2Y30A 1J2XA 5HS7A 4PSWA 2CYYA 2FEZA 1Z1DA 2IXSA 4HRIA 4BH9A 1U5TC 2A69F 3D1NI 2DJIA 2VJ5A 4RAZA 1F4KA 2VC0A 1QRYA 1P92A 3LQQA 2ID3A 1IV8A 1K78A 3BCBA 5EZHA 1HKQA 5FLXZ 1JKPC 3ZRGA 4BBSJ 2PJRB 2JK3A 2IAIA 2QSHX 1OCRH 2WV0A 2R7XA 2V1UA 3EYYA 3I5UA 1W5CC 1L3LA 2YU3A 4GXOA 1MBEA 3IKVA 4JX6A 2V9PA 3KP6A 1JJ8C 1IV6A 2VKEA 5LFAA 1B6AA 3S16J 1SANA 1X1AA 1RKTA 2Y0SN 4G94A 2GM4A 3FXQA 5J3LA 2DBBA 1R49A 3QYBA 3P7NA 3MZYA 3CUOA 2QUFA 3TDZC 1P2FA 1T2KA 3CJTB 4HQEA 1KYZA 3CP8A 4NC6A 3H9QA 2IT0A 3HGGA 4UVCA 4BQQA 2DDAA 2JRTA 2X1EA 2B9SA 3OY9A 3ABUA 2HDDA 3F72A 4BGDA 3K4NA 3H3ZA 1J5YA 5FKLA 1IAWA 4OU0A 2LC2A 3ML6A 4G6DA 4OIQF 1SAXA 3TW6A 4CGZA 4F91B 1IN4A 2VOPA 4KIBA 1BC8C 3F0CA 5HDKA 2YPRA 1T8IA 2M8GX 1MMAA 3NWTA 2PX9A 1LNWA 1R22A 5E18F 2DI3A 4PJMA 4CCNA 3ZPLA 1RR8C 5IT9Z 1D0YA 2MC3A 3O3KA 1FSEA 2Z2SB 1DPRA 2Y69H 2QBYA 4G6TB 3AFHA 1SFUA 4M72A 3V8JA 4QPQA 1JT6A 2DFHA 2QZ8A 1EH7A 4M3BA 1EH8A 1Y6IA 2K3PA 4O3MA 2D2WA 3VODA 2O61A 1BR2A 3KYLA 4B44A 2LNBA 2F5CA 2QKMB 1BI0A 2LSOA 1LFPA 5DV5A 3I3LA 2FMYA 1KU3A 4M3DA 2OQGA 4DJAA 2AQFA 4HX7A 1CGPA 3F8MA 1PP7U 2F4OB 3DEWA 4DYRA 2KIMA 3K70D 3RZOJ 1W36C 1M1EB 2WC2A 3ECOA 4F55A 3KPHA 3R6SA 3JRAA 5TJJA 2OF7A 2BW3A 2OJED 3T1BA 4A3JJ 1RPWA 5F27A 1D5YA 4RA2A 4ASNA 2ISZA 2EWNA 4ENKA 5BPIA 4HV6A 2O8KA 1V5EA 2FNAA 1IZ1A 2ZXIA 4BJ6C 4M9XA 3A01A 4EM2A 1ZAOA 5KAFC 3MKZA 1JT0A 1R1VA 2MD5A 1XGSA 2JT1A 3CCUI 3DKWA 2XB0X 1AWCA 2J5OA 3LQRA 3JRFA 2HKXA 3LAJA 1MGTA 4V2GA 3FXLA 3LFUA 2L4MA 5EF6A 1VQMI 2UXNA 3LOCA 2HGCA 2FMLA 3VYRB 1BW6A 5D5XB 1FOWA 1BJZA 1Y39A 3M4OJ 4HG2A 2RKHA 2DA1A 5HS8A 3BG7A 2KIQA 2E5ZA 3GCMA 5AIPA 2H6BA 4M3EA 3KZZA 1TWAJ 1GV5A 2E19A 4BHBA 3O2PE 4YFNF 3L09A 2VE9A 2ZJPF 1XCVA 3SFZA 2CV0A 3MKWB 2E7WA 1Z7UA 4CDGA 1BJAA 1QHHD 3BP8A 4XK4A 1WRJA 5HODA 1G6NA 3MMYB 3QP6A 2EIJH 2Z9OA 3EUHC 1E17A 2ZNYA 4M71A 1U6GA 4UXNA 2WY7Q 2EZHA 3MCZA 2MH2A 3BZKA 3HPGA 3QU6A 3JRBA 2L7KA 3PIPF 3OWTA 3M07A 3E0JB 4EJVA 1SAUA 3BTJA 4EATA 4BJ5C 2XASA 2PMZN 1PYVA 3KE2A 1N77A 1PP8F 5HOOA 5DUIA 1G4DA 5AONA 4P9UA 3CMAI 4IJAA 1A04A 1W7PD 3R60A 2LTPA 4G7OF 2FD5A 4JX4A 3ISPA 1FJLA 3B02A 4KJZA 4L9VA 1XN7A 5M5WJ 5J4YA 2F48A 4E7KA 2FOWA 2QENA 3ZMZA 1Y0NA 3IHUA 2Z3YA 1PJRA 2ESHA 3GW2A 2O03A 1MW7A 2VJ4A 4DYCA 3OYFA 2QQ9A 2MA3A 1TTYA 2BV6A 3BPVA 1XSVA 5CVRA 5LEKA 5HS9A 3K69A 1VI0A 3CMMA 2P6TA 2DOEA 5F0HA 3D5RC 1RUOA 3H5NA 2RC4A 5D5WB 4D9JA 4XOTA 1HDPA 5JHFA 2ZNZA 4AVZA 1P4WA 2OD5A 4R8HA 2PFBA 4LK1F 4CCLA 5D5VB 3JAMZ 4AIJA 2MH9A 1DU6A 4F3QA 1G3WA 1SD5A 3ABLH 2DT5A 2FA5A 2RNGA 2Y48A 4S05A 2H8WA 5L3EA 1FY7A 1HF0A 5IOYA 3HSEA 4HYEA 3RPUA 1ZG3A 3TEDA 4C30A 2LYCA 2VBZA 3OSFA 1LEAA 3D5SC 1S7OA 2BE5F 2NAZA 3QODA 3U9GA 4PFPA 1W0UA 4ITVA 3S17J 2R7SA 5IP6A 3CCVI 1IUYA 2LMDA 5FD5A 2IA0A 3HKZA 4RAYA 2JJ7A 3OMYA 3A0BC 4NC8A 2F5DA 1VQ7I 2JUGA 5EEAA 3CUQA 1LPQA 2K27A 1FYLA 4FQGA 2E2IJ 5IP7J 3BR6A 2FRHA 2NS7A 1TQMA 1VTNC 3VSKA 1FMVA 3TBIA 1YITI 1A6QA 4GYIA 2W24A 3T5XA 5GADJ 4XLFA 1G59A 5LGTA 1X58A 4XSXF 3OL3A 2D45A 1YW9A 2NVTJ 5EG0A 4FETA 1V5GA 3WTUC 3QWLA 2PI0A 3OV8A 1JUPA 1I39A 1YG2A 4OAYA 5FKKA 4O6JA 1OCZH 2EZIA 2DDBA 3GF2A 1RETA 3HUGA 2LBFB
chains in the Genus database with same CATH topology
2VI6A 3ZQHA 1K83J 5EYRA 4QTRA 1FIAA 1P7JA 1X2NA 2AO9A 2M0CA 4AYBN 2DMPA 1U8BA 2KT0A 4M3GA 1JUSA 2B63J 3HOWJ 1NTCA 3BQZA 4C2MJ 5EG0B 3JRIA 2HXIA 1ETOA 2ID6A 1Y1VJ 2GLOA 1A5JA 4B1RA 5E3MA 4IHVA 1I50J 1ZK8A 1PUFA 2DJNA 3HGYA 2M2EA 4UUTA 2ELKA 2CU7A 3H0GJ 1XC5A 2FJ1A 4A3CJ 1CQTA 2L7ZA 1BW5A 4GFBA 1JUMA 2WV1A 1W0TA 1GUUA 3CCYA 3HM5A 3HOVJ 4JP0A 2HYJA 1MH3A 3GTJJ 4BY1J 1MBKA 3ZQFA 4XRSG 2XPUA 1WH7A 2VUMJ 4BXXJ 2GBYA 2LFBA 1HLVA 3TP3A 5C3EJ 3S15J 1PUFB 2LVSA 2NVXJ 3FKIJ 1I3QJ 5IPAA 4LOCA 3Q0VA 2R5ZA 1ZTRA 4W1UA 1IGNA 4IEJA 1ITYA 1WCMJ 1ZGWA 4MFDA 3O8GA 5JLWA 3LSJA 1FTZA 3JRCA 3K7AJ 1NK3P 1Z0XA 2CQXA 3IH3A 4BBRJ 1F36A 2QCOA 3BTIA 1X2MA 4ABZA 3B6CA 5IYCJ 5GP9A 4Y52J 3GTOJ 4RBOA 5FKNA 2R7ZJ 5J1RA 2CUEA 3BR1A 4FE7A 2JMWA 2E1OA 1H8AC 4A3DJ 2R5ZB 4A3IJ 3HOXJ 4B3AA 3GTPJ 2Y9ZA 2ME6A 2N8GA 1TWFJ 1WI3A 2ECBA 2R5YA 3ZQLA 3GTKJ 2M34A 5M5XJ 2DA7A 2K40A 1VF9A 3IH2A 3TW7A 1G2HA 1ETWA 3B6AA 3JR9A 3S2DJ 2I10A 2L0KA 4JX5A 2HOSA 2XGDA 1P7IA 3LSGA 1POGA 3BQYA 2OPTA 3HKZN 4L5EA 4MFEA 2HXOA 5EZGA 1ZR4A 1NK2P 4FE4A 4M6VA 1U78A 4S0HB 2HQ5A 1WPKA 2DMNA 2DMQA 2NOGA 5EGOA 2YUSA 1QVTA 2X48A 2DA6A 4JYKA 2EBIA 2XPVA 1Y1WJ 2JA8J 2XPWA 3G1MA 2R5YB 2WAQN 2R93J 1U9NA 2Y31A 3HOZJ 1VFCA 2LD5A 2LP0A 2L9RA 1HCRA 5J1YA 4XICA 3NARA 4A93J 1VNDA 3NAUA 4A3FJ 2COBA 3CMYA 1JKRC 3S14J 1K61A 1JGGA 3QQAA 4X1EA 4A3EJ 3HDDA 4X6AJ 3LNQA 1XG1A 1IUFA 3RZDJ 2Y2ZA 3OSGA 1O4XA 2XRLA 1UHSA 1JKOC 4B4CA 1F43A 2XGCA 1B72B 5EGOB 1AU7A 3W6VA 5K7ZA 3SJMA 2Y30A 1AKHA 5F04A 2IBDA 2DMTA 1GVDA 2O7OA 2AHQA 2YU9J 3D1NI 3L1PA 1QRYA 3MVPA 2L7FP 2ID3A 5IYDJ 5K7FA 2LKXA 4MO7A 5EZHA 5JLXA 1JKPC 4BBSJ 2JK3A 1MSFC 2CJJA 4I6ZA 2DA5A 1E3OC 2IAIA 2WB1N 1B8IA 1HOMA 3QPSA 2H1KA 3A03A 4J19A 3ZQCA 2DMUA 1I6HJ 2RAEA 1AKHB 4A3BJ 1MBEA 3CQZJ 2CQQA 3O8HA 4JX6A 1JJ8C 3HB9A 2H8RA 1IV6A 2VKEA 3S16J 1SANA 1RKTA 2Y0SN 3IV5A 2GM4A 1TC3C 1FIPA 4W97A 3PO3J 5J3LA 4DW6A 3GTGJ 5BNGA 3HOYJ 3Q3SA 5E3OA 3FK7A 3A02A 1B8IB 3SFIA 3FK6A 1ZQ3P 3CDLA 3HGGA 1ETYA 3OIOA 2NS8A 5C44J 1BL0A 4DZPA 1ZKGA 1ETVA 1MNMC 2HDDA 1DU0A 2R92J 2JN6A 5FKLA 1JJ6C 2XB5A 4A3GJ 1TWGJ 4G12A 3JRGA 4D5CA 4V2FA 3BG5A 3TW6A 1UG2A 4D5FA 2MG4A 3Q0WA 2LY9A 3F0CA 2NVQJ 3PO2J 1JTYA 2X6OA 2M8GX 5F1JA 3I4NJ 1BA5A 2ECCA 2EQRA 4D7MA 2LK2A 1JKQC 3FIWA 1IC8A 3E7LA 4IHWA 1LFBA 3Q0UA 4AC0A 1Q1VA 3ZQIA 3UKGA 1ETQA 5K7HA 1JT6A 2CUFA 4M3BA 3LSRA 3I4MJ 4HNVA 3OOUA 3BG9A 4IHXA 1HDDC 1S7EA 2TCTA 2X9DA 1UMQA 2D5VA 1U9OA 2K9QA 1MSEC 3HOUJ 4EEFG 1ENHA 2JWTA 1MBHA 4M3DA 4RDUA 4IHYA 2QF7A 2XGEA 9ANTA 4FTHA 1ORKA 3LSPA 4AUXA 3BR2A 2ME0A 3G1OA 1MH4A 3DEWA 4DYRA 5IOZA 3C2BA 3RZOJ 3GTQJ 1IDZA 3SDGA 3ZQGA 5F0CA 3HBLA 3JRAA 2OF7A 4A3JJ 3FISA 2JA6J 2LR8A 1RPWA 5FJ8J 2Y9YA 5F27A 1ZR2A 1D5YA 1QPIA 2VKVA 2MSYA 2NVYJ 2O8KA 4BY7J 1FTTA 2HI3A 3IH4A 3A01A 3TP0A 5FKMA 1JT0A 3JREA 4QSHA 1TWHJ 3BR5A 1MBGA 2XB0X 1LE8A 5FLVA 2O9LA 1Z77A 1YRNA 3JRFA 4M3FA 1OJLA 4V2GA 3VPRA 3S2HJ 5EF6A 4XRSA 2DA3A 2K9SA 4DYQA 4Y7NJ 2L7MP 3LOCA 5M3MJ 3H3VK 5GPCA 5M5YJ 4A3KJ 2G0EA 1BW6A 3PM1A 1BJZA 1FEXA 2HOAA 2R0QC 5IYBJ 3HEFA 3A01B 2E2JJ 2JA7J 3M4OJ 2W48A 2DA1A 1T56A 3QPLA 1JTXA 1ETKA 4A69C 1LE8B 5EDNA 1YRNB 4MLOA 3G1LA 4M3EA 1TWAJ 1GV5A 2E19A 5C4JJ 4UUSA 2DA4A 4I76A 4XIDA 5E3LA 5J1UA 5M3FJ 4XK4A 3MKLA 1APLC 5HODA 4A3LJ 4C3HJ 5DS9A 2XSDC 1RKWA 1H88C 2EZHA 1IG7A 1SFOJ 3JRHA 1RR7A 2DTZA 1IRZA 3JRBA 3K2AA 1TWCJ 1R9TJ 3GTLJ 2LLKA 2EH3A 1H89C 3WHBA 3BTJA 4UUSB 3ZOBA 2PMZN 1WGXA 1LFUP 2MGQA 4A3MJ 2LTPA 2FD5A 4JX4A 3S1RJ 1FJLA 5FLMJ 1AHDP 3BTCA 3RKQA 3WHCA 2ZB9A 4CYCA 5M5WJ 3MN2A 2M9HA 5F08A 3JRDA 1MBJA 1GT0C 2VPRA 2CRGA 4DYCA 3BR0A 5GPAA 3GBGA 1GDTA 2E2HJ 1VI0A 2FX0A 1IDYA 1A6IA 5F0HA 2MW8A 3DCFA 2FQ4A 5C4XJ 1HDPA 4C3JJ 3S1MJ 1OCPA 2DA2A 1XS9A 5F0FA 2EZKA 4CYCB 4NDLA 5FKOA 1DU6A 2JA5J 3BG3A 3S1QJ 3RQIA 1HF0A 4QIWN 5IOYA 4C3IJ 3TEDA 3OSFA 4DZJA 4FISA 4FCYA 1W0UA 3GTMJ 3S17J 5IP6A 2YS9A 2JJ7A 2HOTA 1QVUA 5E3NA 1B72A 2K9NA 5EEAA 2IEKA 2E2IJ 5IP7J 2TRTA 3BR6A 2NS7A 3S1NJ 4XRMA 5DTDA 1T33A 2DN0A 3BR3A 1OCTC 3BTLA 3BT9A 3M3YJ 1X58A 4BKXA 2NVTJ 1IJWC 5EG0A 1ETXA 1JUPA 2P81A 2KDZA 1EF4A 5FKKA 5IP9J 1GV2A 1MBFA 4MIMA 1RESA 2EZIA 1OFCX 1WH5A 2EZLA 4D7NA 1RETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VI6 A;  3ZQH A;  1K83 J;  5EYR A;  4QTR A;  1FIA A;  1P7J A;  1X2N A;  2AO9 A;  2M0C A;  4AYB N;  2DMP A;  1U8B A;  2KT0 A;  4M3G A;  1JUS A;  2B63 J;  3HOW J;  1NTC A;  3BQZ A;  4C2M J;  5EG0 B;  3JRI A;  2HXI A;  1ETO A;  2ID6 A;  1Y1V J;  2GLO A;  1A5J A;  4B1R A;  5E3M A;  4IHV A;  1I50 J;  1ZK8 A;  1PUF A;  2DJN A;  3HGY A;  2M2E A;  4UUT A;  2ELK A;  2CU7 A;  3H0G J;  1XC5 A;  2FJ1 A;  4A3C J;  1CQT A;  2L7Z A;  1BW5 A;  4GFB A;  1JUM A;  2WV1 A;  1W0T A;  1GUU A;  3CCY A;  3HM5 A;  3HOV J;  4JP0 A;  2HYJ A;  1MH3 A;  3GTJ J;  4BY1 J;  1MBK A;  3ZQF A;  4XRS G;  2XPU A;  1WH7 A;  2VUM J;  4BXX J;  2GBY A;  2LFB A;  1HLV A;  3TP3 A;  5C3E J;  3S15 J;  1PUF B;  2LVS A;  2NVX J;  3FKI J;  1I3Q J;  5IPA A;  4LOC A;  3Q0V A;  2R5Z A;  1ZTR A;  4W1U A;  1IGN A;  4IEJ A;  1ITY A;  1WCM J;  1ZGW A;  4MFD A;  3O8G A;  5JLW A;  3LSJ A;  1FTZ A;  3JRC A;  3K7A J;  1NK3 P;  1Z0X A;  2CQX A;  3IH3 A;  4BBR J;  1F36 A;  2QCO A;  3BTI A;  1X2M A;  4ABZ A;  3B6C A;  5IYC J;  5GP9 A;  4Y52 J;  3GTO J;  4RBO A;  5FKN A;  2R7Z J;  5J1R A;  2CUE A;  3BR1 A;  4FE7 A;  2JMW A;  2E1O A;  1H8A C;  4A3D J;  2R5Z B;  4A3I J;  3HOX J;  4B3A A;  3GTP J;  2Y9Z A;  2ME6 A;  2N8G A;  1TWF J;  1WI3 A;  2ECB A;  2R5Y A;  3ZQL A;  3GTK J;  2M34 A;  5M5X J;  2DA7 A;  2K40 A;  1VF9 A;  3IH2 A;  3TW7 A;  1G2H A;  1ETW A;  3B6A A;  3JR9 A;  3S2D J;  2I10 A;  2L0K A;  4JX5 A;  2HOS A;  2XGD A;  1P7I A;  3LSG A;  1POG A;  3BQY A;  2OPT A;  3HKZ N;  4L5E A;  4MFE A;  2HXO A;  5EZG A;  1ZR4 A;  1NK2 P;  4FE4 A;  4M6V A;  1U78 A;  4S0H B;  2HQ5 A;  1WPK A;  2DMN A;  2DMQ A;  2NOG A;  5EGO A;  2YUS A;  1QVT A;  2X48 A;  2DA6 A;  4JYK A;  2EBI A;  2XPV A;  1Y1W J;  2JA8 J;  2XPW A;  3G1M A;  2R5Y B;  2WAQ N;  2R93 J;  1U9N A;  2Y31 A;  3HOZ J;  1VFC A;  2LD5 A;  2LP0 A;  2L9R A;  1HCR A;  5J1Y A;  4XIC A;  3NAR A;  4A93 J;  1VND A;  3NAU A;  4A3F J;  2COB A;  3CMY A;  1JKR C;  3S14 J;  1K61 A;  1JGG A;  3QQA A;  4X1E A;  4A3E J;  3HDD A;  4X6A J;  3LNQ A;  1XG1 A;  1IUF A;  3RZD J;  2Y2Z A;  3OSG A;  1O4X A;  2XRL A;  1UHS A;  1JKO C;  4B4C A;  1F43 A;  2XGC A;  1B72 B;  5EGO B;  1AU7 A;  3W6V A;  5K7Z A;  3SJM A;  2Y30 A;  1AKH A;  5F04 A;  2IBD A;  2DMT A;  1GVD A;  2O7O A;  2AHQ A;  2YU9 J;  3D1N I;  3L1P A;  1QRY A;  3MVP A;  2L7F P;  2ID3 A;  5IYD J;  5K7F A;  2LKX A;  4MO7 A;  5EZH A;  5JLX A;  1JKP C;  4BBS J;  2JK3 A;  1MSF C;  2CJJ A;  4I6Z A;  2DA5 A;  1E3O C;  2IAI A;  2WB1 N;  1B8I A;  1HOM A;  3QPS A;  2H1K A;  3A03 A;  4J19 A;  3ZQC A;  2DMU A;  1I6H J;  2RAE A;  1AKH B;  4A3B J;  1MBE A;  3CQZ J;  2CQQ A;  3O8H A;  4JX6 A;  1JJ8 C;  3HB9 A;  2H8R A;  1IV6 A;  2VKE A;  3S16 J;  1SAN A;  1RKT A;  2Y0S N;  3IV5 A;  2GM4 A;  1TC3 C;  1FIP A;  4W97 A;  3PO3 J;  5J3L A;  4DW6 A;  3GTG J;  5BNG A;  3HOY J;  3Q3S A;  5E3O A;  3FK7 A;  3A02 A;  1B8I B;  3SFI A;  3FK6 A;  1ZQ3 P;  3CDL A;  3HGG A;  1ETY A;  3OIO A;  2NS8 A;  5C44 J;  1BL0 A;  4DZP A;  1ZKG A;  1ETV A;  1MNM C;  2HDD A;  1DU0 A;  2R92 J;  2JN6 A;  5FKL A;  1JJ6 C;  2XB5 A;  4A3G J;  1TWG J;  4G12 A;  3JRG A;  4D5C A;  4V2F A;  3BG5 A;  3TW6 A;  1UG2 A;  4D5F A;  2MG4 A;  3Q0W A;  2LY9 A;  3F0C A;  2NVQ J;  3PO2 J;  1JTY A;  2X6O A;  2M8G X;  5F1J A;  3I4N J;  1BA5 A;  2ECC A;  2EQR A;  4D7M A;  2LK2 A;  1JKQ C;  3FIW A;  1IC8 A;  3E7L A;  4IHW A;  1LFB A;  3Q0U A;  4AC0 A;  1Q1V A;  3ZQI A;  3UKG A;  1ETQ A;  5K7H A;  1JT6 A;  2CUF A;  4M3B A;  3LSR A;  3I4M J;  4HNV A;  3OOU A;  3BG9 A;  4IHX A;  1HDD C;  1S7E A;  2TCT A;  2X9D A;  1UMQ A;  2D5V A;  1U9O A;  2K9Q A;  1MSE C;  3HOU J;  4EEF G;  1ENH A;  2JWT A;  1MBH A;  4M3D A;  4RDU A;  4IHY A;  2QF7 A;  2XGE A;  9ANT A;  4FTH A;  1ORK A;  3LSP A;  4AUX A;  3BR2 A;  2ME0 A;  3G1O A;  1MH4 A;  3DEW A;  4DYR A;  5IOZ A;  3C2B A;  3RZO J;  3GTQ J;  1IDZ A;  3SDG A;  3ZQG A;  5F0C A;  3HBL A;  3JRA A;  2OF7 A;  4A3J J;  3FIS A;  2JA6 J;  2LR8 A;  1RPW A;  5FJ8 J;  2Y9Y A;  5F27 A;  1ZR2 A;  1D5Y A;  1QPI A;  2VKV A;  2MSY A;  2NVY J;  2O8K A;  4BY7 J;  1FTT A;  2HI3 A;  3IH4 A;  3A01 A;  3TP0 A;  5FKM A;  1JT0 A;  3JRE A;  4QSH A;  1TWH J;  3BR5 A;  1MBG A;  2XB0 X;  1LE8 A;  5FLV A;  2O9L A;  1Z77 A;  1YRN A;  3JRF A;  4M3F A;  1OJL A;  4V2G A;  3VPR A;  3S2H J;  5EF6 A;  4XRS A;  2DA3 A;  2K9S A;  4DYQ A;  4Y7N J;  2L7M P;  3LOC A;  5M3M J;  3H3V K;  5GPC A;  5M5Y J;  4A3K J;  2G0E A;  1BW6 A;  3PM1 A;  1BJZ A;  1FEX A;  2HOA A;  2R0Q C;  5IYB J;  3HEF A;  3A01 B;  2E2J J;  2JA7 J;  3M4O J;  2W48 A;  2DA1 A;  1T56 A;  3QPL A;  1JTX A;  1ETK A;  4A69 C;  1LE8 B;  5EDN A;  1YRN B;  4MLO A;  3G1L A;  4M3E A;  1TWA J;  1GV5 A;  2E19 A;  5C4J J;  4UUS A;  2DA4 A;  4I76 A;  4XID A;  5E3L A;  5J1U A;  5M3F J;  4XK4 A;  3MKL A;  1APL C;  5HOD A;  4A3L J;  4C3H J;  5DS9 A;  2XSD C;  1RKW A;  1H88 C;  2EZH A;  1IG7 A;  1SFO J;  3JRH A;  1RR7 A;  2DTZ A;  1IRZ A;  3JRB A;  3K2A A;  1TWC J;  1R9T J;  3GTL J;  2LLK A;  2EH3 A;  1H89 C;  3WHB A;  3BTJ A;  4UUS B;  3ZOB A;  2PMZ N;  1WGX A;  1LFU P;  2MGQ A;  4A3M J;  2LTP A;  2FD5 A;  4JX4 A;  3S1R J;  1FJL A;  5FLM J;  1AHD P;  3BTC A;  3RKQ A;  3WHC A;  2ZB9 A;  4CYC A;  5M5W J;  3MN2 A;  2M9H A;  5F08 A;  3JRD A;  1MBJ A;  1GT0 C;  2VPR A;  2CRG A;  4DYC A;  3BR0 A;  5GPA A;  3GBG A;  1GDT A;  2E2H J;  1VI0 A;  2FX0 A;  1IDY A;  1A6I A;  5F0H A;  2MW8 A;  3DCF A;  2FQ4 A;  5C4X J;  1HDP A;  4C3J J;  3S1M J;  1OCP A;  2DA2 A;  1XS9 A;  5F0F A;  2EZK A;  4CYC B;  4NDL A;  5FKO A;  1DU6 A;  2JA5 J;  3BG3 A;  3S1Q J;  3RQI A;  1HF0 A;  4QIW N;  5IOY A;  4C3I J;  3TED A;  3OSF A;  4DZJ A;  4FIS A;  4FCY A;  1W0U A;  3GTM J;  3S17 J;  5IP6 A;  2YS9 A;  2JJ7 A;  2HOT A;  1QVU A;  5E3N A;  1B72 A;  2K9N A;  5EEA A;  2IEK A;  2E2I J;  5IP7 J;  2TRT A;  3BR6 A;  2NS7 A;  3S1N J;  4XRM A;  5DTD A;  1T33 A;  2DN0 A;  3BR3 A;  1OCT C;  3BTL A;  3BT9 A;  3M3Y J;  1X58 A;  4BKX A;  2NVT J;  1IJW C;  5EG0 A;  1ETX A;  1JUP A;  2P81 A;  2KDZ A;  1EF4 A;  5FKK A;  5IP9 J;  1GV2 A;  1MBF A;  4MIM A;  1RES A;  2EZI A;  1OFC X;  1WH5 A;  2EZL A;  4D7N A;  1RET A; 
#chains in the Genus database with same CATH topology
 3IAS 2;  3K6G A;  3WOD F;  4CH7 A;  4V19 K;  2B0L A;  2XDV A;  1FIA A;  1HBX G;  1LDD A;  1TT0 A;  4WX9 A;  3I64 A;  1JUS A;  3OYK A;  5FFZ A;  1SVL A;  1FBQ A;  2L01 A;  3SYT A;  5B66 C;  3QYF A;  1UHW A;  3TMO A;  1YYV A;  2HXI A;  2ID6 A;  4L9J A;  2GLO A;  4B1R A;  5E3M A;  3KEQ A;  2Q2E A;  4K2E A;  2M4K A;  3L2U A;  2M2E A;  2R7W A;  3K70 C;  4BXU A;  4IL6 C;  4PGH A;  2ELK A;  2EFN A;  1O7F A;  1BN5 A;  4IKF A;  3EUK L;  2ZME A;  1JUM A;  1SVO A;  3OYI A;  3KZY A;  2DAO A;  2WV1 A;  1OR7 C;  2RQQ A;  2L9V A;  3RKX A;  1ZRE A;  2IRF G;  2K02 A;  3WTW C;  4OWR B;  3GTJ J;  2STW A;  3ZQF A;  4BY1 J;  4XRS G;  4QPO A;  4BXX J;  4LK0 F;  3S2W A;  2LFB A;  2KIF A;  3SXY A;  1D8K A;  1TL8 A;  4M9Z A;  2HEO A;  4NC7 A;  2Y0S A;  1FNN A;  3S15 J;  3AG2 H;  1UB9 A;  4ZTJ A;  2NVX J;  3REO A;  1I27 A;  3DEE A;  3SEZ A;  4RAF A;  2DOD A;  4BJT A;  5DCM B;  4W1U A;  1YLF A;  3AG3 H;  4ENJ A;  1WQ2 A;  3FKJ A;  4UY8 I;  1FTZ A;  1FLI A;  3HRS A;  3K7A J;  2CQX A;  3DXJ F;  2PG4 A;  3IH3 A;  4MQ9 F;  3BTI A;  5E79 C;  1X2M A;  3GFI A;  1YOV B;  1Z6R A;  1E3P A;  1ZEL A;  2EB7 A;  1Y56 A;  4Q48 A;  3GTO J;  1T0F A;  1Z91 A;  5FLX K;  2VKD A;  5LBQ A;  2R7Z J;  5J1R A;  1O3R A;  1J75 A;  4FE7 A;  1WJD A;  4XM3 A;  5FRO A;  3GXO A;  1D1B A;  1H8A C;  5DUK A;  2LKP A;  3CJQ B;  4A3D J;  4NQW B;  3HOX J;  2F4M B;  4KT6 A;  2Y9Z A;  1RIO H;  2N8G A;  4RS8 A;  1TWF J;  2CWE A;  5TIS C;  3ERE D;  2IS2 A;  3ZN0 A;  2LF8 A;  3ZQL A;  3GTK J;  4LMY A;  1ZLJ A;  3C2G A;  2IS6 A;  3Q9V A;  1R4N B;  2DA7 A;  3I55 I;  2BOL A;  2IVM A;  4M73 A;  1KQ8 A;  2OUM A;  4KFC A;  3LSI A;  3LSG A;  1Z7L A;  3SEQ A;  3BQY A;  5CVU A;  2NNN A;  3BPX A;  2ZJR F;  1WSU A;  4G7H F;  1NK2 P;  4FE4 A;  1BOB A;  1ZRC A;  2BBY A;  2V26 A;  3BWG A;  4S0H B;  1L0O C;  3MAJ A;  4BU2 A;  4MGR A;  3M1C A;  1OYI A;  5EGO A;  2NOG A;  1S9H A;  2GA1 A;  4XKC A;  3CCR I;  2X48 A;  4JYK A;  1QBJ A;  4YIR X;  2CFX A;  1NH3 A;  2JA8 J;  1QA6 A;  1YJN I;  4C2T A;  2XPW A;  1BM9 A;  3DF8 A;  1MJ9 A;  5LEJ A;  2K4B A;  2LP0 A;  3GVA A;  2AXT C;  5J1Y A;  4A93 J;  1R1U A;  5B5E C;  1E3H A;  2COB A;  2PMU A;  1U5T A;  3QQA A;  1J0R A;  4A3E J;  4WWC A;  3LNQ A;  3ZR8 X;  3I59 B;  1IUF A;  2M87 A;  2Y2Z A;  1S5L C;  2D1H A;  3ASN H;  2XF6 A;  1UHS A;  3FMR A;  3K4K A;  5HDN A;  2KMU A;  2LH9 A;  1TNT A;  1X3U A;  2CSO A;  5KCM A;  3WGI A;  4HF2 A;  1T08 B;  2XAF A;  1USS A;  4PK4 A;  3KYD B;  3C1D A;  1AKH A;  5CVV A;  2IBD A;  5F04 A;  5IT9 K;  2DMT A;  2P0W A;  1GVD A;  4J00 A;  3GWZ A;  4HA8 A;  2AHQ A;  2YU9 J;  2LRE A;  2A3S A;  2L7F P;  2ZSI B;  1SVM A;  2HQN A;  3VYU B;  1ZN2 A;  1DDN A;  2LKX A;  2K5C A;  2LY1 A;  3GEZ A;  3JW4 A;  4AIH A;  4BQN A;  3FM5 A;  1W1W E;  2DPD A;  2CJJ A;  4N0B A;  3DLL F;  1E3O C;  2WB1 N;  2OCE A;  1HOM A;  1RRJ A;  4KNY A;  4J19 A;  3LA3 A;  2V6C A;  2PLY A;  2DMU A;  1I6H J;  3BZ6 A;  3E5Q A;  4A3B J;  3CQZ J;  2XAU A;  2Q1Z B;  2CQQ A;  3O8H A;  1GXP A;  3CCS I;  4LG0 B;  4IHS A;  3G4S I;  1R6R A;  2EIN H;  3EPZ A;  1TC3 C;  4OAZ A;  1FIP A;  3PO3 J;  3M8E A;  3A0H C;  3GTG J;  3FK7 A;  2M5W A;  2P5V A;  3HPH A;  5AIQ A;  3SFI A;  1B8I B;  1VQ9 I;  4L5J A;  1ETY A;  4E7Z A;  3TDU C;  3ZP5 A;  5C44 J;  4DZP A;  4AIK A;  1VQN I;  2YR2 A;  3F3X A;  1YJ9 I;  4DBR A;  2MLK A;  4L0Z B;  1SD7 A;  1MNM C;  1DU0 A;  5FRM A;  1LB2 A;  2F4I A;  2JN6 A;  4KT5 C;  2M4G A;  3CES A;  4LJZ F;  3R61 A;  3KZI C;  3LMM A;  2PQ8 A;  4XOR A;  4G12 A;  1R00 A;  3FXJ A;  4G8X A;  3CZ6 A;  2JVG A;  1R5H A;  5DDG A;  2IGO A;  4HPQ A;  3TO6 A;  4CXF A;  4RB0 A;  1T95 A;  4U0Y A;  2MG4 A;  3PQK A;  1K6Y A;  3Q0W A;  4IOC F;  1GHC A;  1SD4 A;  2LY9 A;  1J09 A;  1R7J A;  4Y3O A;  2P8T A;  2PMZ A;  3ESW B;  4E6K G;  3DPL C;  4JOM A;  3FDY A;  1S29 A;  5CVJ A;  1D5V A;  3KEO A;  1O3S A;  2KP6 A;  1FPQ A;  2HQA A;  1BA5 A;  5L3F A;  3K2Z A;  1U3E M;  4YFK F;  1DP3 A;  2H27 A;  2LK2 A;  5F64 A;  4O5V A;  1K6O A;  5L3D A;  2UXX A;  1LFB A;  3Q0U A;  1WJA A;  3SZG A;  1A35 A;  1ZGA A;  3UKG A;  1ETQ A;  5F1R A;  4AID A;  2CUF A;  4Z6Y A;  2DW4 A;  3W2V A;  2ESN A;  4HNV A;  1IXR C;  4OIP F;  1H0M A;  2NVU B;  2HDW A;  3OOU A;  3BG9 A;  3L7W A;  5ERI A;  2W7N A;  4I09 A;  1HDD C;  1UFM A;  4IVN A;  3U2R A;  2D5V A;  3BCA A;  4LGW A;  2K9Q A;  2M3A A;  2E1N A;  1AA7 A;  5ILS A;  4BDZ A;  3V7C A;  2QF7 A;  2QSG X;  1F1Z A;  4LIU A;  3HSF A;  1JE8 A;  1ORK A;  4ZDO A;  1MNE A;  3BR2 A;  3T8R A;  2ME0 A;  4BEH B;  2DQR A;  5IOZ A;  2CV1 A;  1WJ5 A;  3OS2 A;  2DK5 A;  5LRS A;  1LVA A;  5F0C A;  3HBL A;  4HV5 A;  3ZMV A;  5FJ8 J;  2Y9Y A;  4BQA A;  1VQK I;  3WTT C;  1X19 A;  2JRM A;  5E20 A;  3F8F A;  1B4A A;  1EH6 A;  2VL8 A;  3CJN A;  2G9W A;  3TP0 A;  2FOK A;  3OYE A;  1MJA A;  4QSH A;  1YI2 I;  3ABM H;  3OIP A;  1MBG A;  1Y0U A;  1ZH5 A;  1LE8 A;  5FLV A;  3GZ6 A;  1Z77 A;  1VQ6 I;  4JBA A;  1UAA A;  3VPR A;  1HXD A;  1YO5 C;  2L5Q A;  2NYX A;  4XRS A;  4XKB A;  1Z3X A;  2W85 A;  4BXF A;  2L7M P;  2OC6 A;  4OMY A;  3I4P A;  1ACI A;  5M3M J;  1BIB A;  1S3J A;  3ZMD A;  4PSX A;  4EM0 B;  2KPM A;  2Q8K A;  3TL4 X;  5JI6 A;  3CLQ A;  2VIX A;  5DM6 F;  3JAM K;  2A5W A;  3PM1 A;  3ZGK A;  1FEX A;  2HOA A;  2E2J J;  2JA7 J;  1FWZ A;  2IP2 A;  3KP3 A;  2HVR A;  3M8F A;  1T56 A;  2DFE A;  1JTX A;  3EUH A;  3QPL A;  4A69 C;  3BDD A;  2GOX B;  2KL4 A;  3DPU A;  1MZB A;  1YRN B;  4MLO A;  3G1L A;  2HQR A;  4PJ0 C;  1D0X A;  1YW7 A;  4XQF A;  3LST A;  5C4J J;  4UUS A;  2RV8 A;  4HDU A;  4CSW A;  4I76 A;  5D5U B;  4PCQ A;  2VC1 A;  3F6O A;  1J7K A;  1P4A A;  4U0W A;  2QQA A;  2XSD C;  4HQM A;  1H88 C;  3IRQ A;  4RM3 A;  4KMU X;  3G71 I;  4IHT A;  2KIS A;  3PQJ A;  1SFO J;  3JRH A;  3BOQ A;  1RR7 A;  1IRZ A;  1TQI A;  1R9T J;  2VT2 A;  3F8C A;  3GTL J;  2EH3 A;  2EA4 A;  3WHB A;  5H2F C;  2B7E A;  3BJA A;  4E7H A;  3ZOB A;  4A6E A;  3DU5 A;  2LKS A;  2MGQ A;  1AOY A;  3TOB A;  2M45 A;  2CQN A;  1WZ2 A;  4LIT A;  5DD8 A;  3VOE A;  1VQL I;  2HPM A;  4EGY A;  3F6V A;  1HSJ A;  5FLM J;  1AHD P;  3BTC A;  2DOF A;  2JUC A;  2ZB9 A;  1PDN C;  2CGP A;  1G8X A;  3HZJ A;  4D1Q A;  2P7V B;  3P9C A;  3M7G A;  5F08 A;  3JRD A;  4RGU A;  1FOY A;  3SQN A;  3CCM I;  2QKL B;  3O6B B;  3KLN A;  1GDT A;  3F21 A;  5B1B H;  5CQG A;  4N9H A;  2E2H J;  4Y17 A;  2JTV A;  1A6I A;  3DCF A;  2FQ4 A;  3NRV A;  5BPD A;  3E6D A;  5J40 A;  4EM1 A;  1I5Z A;  2DA2 A;  4UVA A;  1LDK B;  1XS9 A;  4MQV A;  2EZK A;  1JI8 A;  4PJN A;  4CYC B;  4ENM A;  4NDL A;  5FKO A;  1YTY A;  4PZJ A;  3FF5 A;  2V1X A;  2RNJ A;  4EMS A;  1ZG1 A;  4OMZ A;  4NNJ A;  3LWF A;  4QIW N;  2DXI A;  4C3I J;  2ZXJ A;  3E97 A;  3CC4 I;  4DZJ A;  2KHM A;  2KRC A;  2NXN B;  1KA8 A;  2CQK A;  1E0E A;  5D4R A;  1FP1 D;  2K7L A;  2VLA A;  1FX7 A;  2IPQ X;  3CCL I;  1K79 A;  2W82 A;  3S1N J;  5DTD A;  1T33 A;  3BR3 A;  1HKS A;  1IJW C;  4LG3 A;  4KN4 X;  4R79 A;  5ICC A;  1CF7 A;  2Q0O A;  1ETX A;  4E7I A;  4D0P A;  1TNS A;  2MYS A;  1TW3 A;  1GV2 A;  3WTS C;  4CO8 A;  3K4J A;  1N78 A;  4A6D A;  4CIC A;  4YRV A;  1DP7 P;  1KYW A;  5LHI A;  4Q4Z F;  1ZG5 A;  2NOJ B;  4U7B A;  5EYR A;  2H6C A;  2AO9 A;  2M0C A;  4QTR A;  3L00 A;  4M6X A;  4LG0 A;  1OR7 A;  4RB1 A;  3RYP A;  4BE0 A;  1B9M A;  4E4H A;  3JRI A;  1G3Y A;  3CCE I;  1A5J A;  4P1W A;  2CO5 A;  3GLL A;  1I50 J;  2L9N A;  1Z21 A;  1ZK8 A;  1PUF A;  2DJN A;  3BLY A;  4UUT A;  2IS4 A;  3A4C A;  2FSW A;  3G6E I;  2I8D A;  3SZP A;  3WE2 A;  4ZYD A;  4I0B A;  4FHT A;  4RLQ A;  1MMS A;  1O3T A;  1XC5 A;  2JSC A;  2XAH A;  3QRF F;  1GLN A;  2L7Z A;  3OYH A;  2WB1 A;  4GCV A;  3CDH A;  5TRD A;  3S93 A;  2ZFW A;  3OIQ A;  2X0L A;  3WU1 B;  2AS5 F;  2W4S A;  4JP0 A;  3ERM A;  4E7L A;  1XGM A;  3PFY A;  2ICW G;  1F5T A;  1WH7 A;  4S04 A;  4I2O A;  2GBY A;  1YQA A;  2QQB A;  1UST A;  2A05 A;  1HLV A;  1LEB A;  2K4J A;  3TP3 A;  5GAE J;  2LVS A;  1P6R A;  2DLL A;  5IPA A;  2EK5 A;  3Q0V A;  4H4K C;  1I1S A;  2WAF A;  1ITY A;  1WCM J;  1ZGW A;  3O8G A;  3LSJ A;  1NK3 P;  2L4A A;  3P9K A;  2QM3 A;  4DBQ A;  1BI3 A;  4IOA F;  1LJ9 A;  2VBY A;  5FB2 A;  4E70 A;  5IYC J;  2EFQ A;  2OCC H;  2PBI A;  2X6W A;  5FKN A;  2J5P A;  3PIO F;  4XKW A;  1QGP A;  2HYG D;  2CUE A;  3BR1 A;  3C7J A;  5BMZ A;  3OS1 A;  3ABK H;  5H6Q A;  2R5Z B;  1OIS A;  2NRA C;  3FXU A;  4Y33 A;  4IRG A;  3RPU D;  1FP2 A;  2BVM A;  4EQQ A;  4F92 B;  2R5Y A;  1W7P A;  5DYM A;  2FQ3 A;  3VEP A;  5M5X J;  1XB4 A;  3IH2 A;  1MDM A;  1WJB A;  1X4P A;  1ETW A;  3KCC A;  3LFK A;  4JX5 A;  5L3C A;  2HOS A;  4BE2 A;  1QHG A;  1P7I A;  1Z05 A;  2DFI A;  3CDI A;  4BEH A;  2O5R A;  4IRH A;  2OPT A;  4BAY A;  1ZYR F;  1IXC A;  1ZR4 A;  1V55 H;  3HYI A;  3PNY A;  4PDK A;  3L2C A;  2CV2 A;  2DK8 A;  2DMQ A;  4CCO A;  4HOB A;  1QVT A;  3IL2 A;  2OTL I;  2A6H F;  3F23 A;  1Y1W J;  5D6F A;  1LVK A;  3J7Z I;  2WAQ N;  1U9N A;  2Y31 A;  3E6B A;  2R4G A;  4MNU A;  2P5K A;  4MEY F;  1VFC A;  1HCR A;  4XIC A;  5J47 A;  1R71 A;  2H1L A;  1JKR C;  3CMY A;  3K0L A;  5BOX A;  2VOO A;  3HSR A;  1XMK A;  1XG1 A;  2TDX A;  5FGM A;  2FF4 A;  3VYT B;  3W2A A;  1RZ4 A;  1BBY A;  2PJR A;  1JKO C;  2R7D A;  4YEJ A;  1F43 A;  4XRF A;  4LLL A;  2VAS A;  4A0Z A;  4AWX B;  3OR2 C;  1B72 B;  1AU7 A;  1B1B A;  4P55 A;  3I71 A;  2W00 A;  2EV5 A;  2V6E A;  2CW0 F;  3AKZ A;  3MEX A;  2VOD A;  2IA1 A;  1X1C A;  4KUM A;  3OYB A;  1LDJ A;  2V7F A;  3MVP A;  2RDP A;  1A31 A;  2VQH A;  4B3X A;  5K7F A;  2E60 A;  5ICG A;  4HF0 A;  3GZ5 A;  1SMY F;  4I6Z A;  1MSF C;  2XF7 A;  4ZYH A;  2PJP A;  2HZT A;  3DTK A;  3J81 Z;  3LSK A;  1U2W A;  1KGS A;  3KFW X;  1ONV A;  2E35 A;  1XMA A;  3AL0 C;  4FT8 A;  2EV0 A;  2HYF A;  2VB6 A;  3SZT A;  4MTD A;  3A2K A;  1N75 A;  1NG7 A;  1OYY A;  4BS9 A;  3HB9 A;  2OZ6 A;  2VKH A;  2BEO A;  5KNL A;  5CLS A;  3F8N A;  4P9F A;  3UNG C;  4QWQ A;  3IV5 A;  4B48 A;  3N4M A;  3ASO H;  1MMD A;  4W97 A;  4DW6 A;  1K78 B;  2HZD A;  3GZN B;  5IT3 A;  1BI1 A;  3HOY J;  2Y75 A;  5E3O A;  3HOS A;  3SDB A;  3VSL A;  4AVP A;  5JVT A;  3S3N A;  3OIO A;  3GFL A;  1R5I D;  2JPC A;  1BL0 A;  3LAP A;  2XVC A;  4IXA A;  1XDU A;  1ETV A;  2BGC A;  1B59 A;  1SFE A;  3CF2 A;  2R92 J;  1V54 H;  2R7U A;  2V1N A;  5ILV A;  1EA3 A;  4KIF A;  3M8J A;  1IN5 A;  1SD6 A;  2KQR A;  4A3G J;  2A61 A;  5ILU A;  4ESJ A;  4FX0 A;  4M9S A;  4XON A;  4V2F A;  3BG5 A;  5H6R A;  5E1W A;  4D5F A;  3PSI A;  1D3Y A;  1PVE A;  2EFP A;  1DPU A;  2OV7 A;  5B1A H;  3K4M A;  2CFO A;  2NVQ J;  4L5I A;  1JTY A;  2L9S A;  3HHH A;  3I54 A;  2HS5 A;  5F1J A;  1MIJ A;  2XRN A;  2E1M C;  3BRO A;  1C0W A;  4UV9 A;  1EJ9 A;  2ECC A;  5L3G A;  2VJI A;  2HTJ A;  4D7M A;  2DQL A;  4PJL A;  1JKQ C;  1Z3Y A;  3FIW A;  4GO1 A;  2P4W A;  2RVC A;  2UUZ A;  2ZFU A;  3E7L A;  1WJF A;  1IC8 A;  4AC0 A;  1Q1V A;  4LFU A;  3ZQI A;  3KLO A;  3RIR A;  5K7H A;  2R7T A;  3RJP A;  2QVO A;  3K4B A;  3TKY A;  4XLN F;  5K5O A;  3I4M J;  4XLA A;  3HTS B;  2O6G E;  2E36 A;  2ZXH A;  2X9D A;  5LGU A;  3OS0 A;  1UMQ A;  2CW8 A;  2VXZ A;  2JSP A;  2KJC A;  4LB6 B;  2UZK A;  3QPH A;  2ZJ2 A;  3HOU J;  4IX7 A;  4PGG A;  3H92 A;  1BOA A;  3CP2 A;  3HJE A;  2Y0M A;  4NB5 A;  1J9I A;  4RDU A;  2KRF A;  1XPX A;  2RRE A;  2XGE A;  4F93 B;  9ANT A;  5F6F A;  2ISY A;  1QQI A;  2QBY B;  3OYJ A;  4AUX A;  1UCR A;  2UWM A;  3BZC A;  3A1Y A;  3G1O A;  4X0G A;  4RGX A;  1HW5 A;  3ECH A;  3V8K A;  3Q9S A;  3CCQ I;  3C2B A;  3J7A Y;  1IDZ A;  2GXB A;  2DCE A;  3UR3 C;  1WVR A;  2Z1D A;  3DLA A;  1DGR M;  3AG1 H;  3QYE A;  2LR8 A;  4KN7 X;  2V9K A;  5JR3 A;  1ZR2 A;  2QSF X;  1D1A A;  3DQV C;  2NVY J;  1FTT A;  2M0M A;  2IGM A;  2FBK A;  3V42 A;  3GFJ A;  1P9Q C;  3E6M A;  5FKM A;  1YS7 A;  3JRE A;  1I1G A;  2F6C A;  1TWH J;  2M1B A;  5GAG J;  3BC8 A;  4HX8 A;  3IUO A;  1FMW A;  4M3F A;  4IPA A;  4AD9 A;  2P7C B;  1VQP I;  3S2H J;  1XSD A;  3DWL E;  2STT A;  4Y7N J;  1KU2 A;  1WKM A;  2A5Y B;  2XV4 S;  3H3V K;  5GPC A;  2BW3 B;  4II2 A;  4DOZ A;  1S8N A;  3WGG A;  3ZQQ A;  4CYD A;  4EJU A;  5TGT A;  2MC4 A;  2JA2 A;  2QQ8 A;  2XAQ A;  3HHG A;  2R0Q C;  3L2W A;  3HEF A;  3A01 B;  3V4G A;  2G7U A;  3PSF A;  2W48 A;  4HNU A;  4XN3 A;  1ETK A;  2OTJ I;  3ROU A;  1D1C A;  5E1Z B;  5L3B A;  3AL0 B;  5EDN A;  1XX5 A;  5KK1 A;  2Z16 A;  2ZO4 A;  3AG4 H;  5CVI A;  2GWR A;  2JPB A;  3DTE A;  3PJR A;  1ODD A;  1QPM A;  3EQL F;  4Y15 A;  3KIO A;  3IWF A;  4QLC U;  3RKW A;  4XID A;  1X1D A;  1OCO H;  5J1U A;  1KON A;  3GUD A;  3N05 A;  3MKL A;  3LSM A;  4KIG A;  1APL C;  4A3L J;  3H5R A;  2L02 A;  3IRR A;  1RKW A;  3Q5F A;  3S32 A;  4ESB A;  2KZV A;  1IG7 A;  4I7H A;  3R0J A;  1XDS A;  2OU2 A;  3DBR B;  3K2A A;  1I3A A;  1TWC J;  3TQN A;  1VQ8 I;  4UUV A;  5KHD A;  4C9Y A;  4J01 A;  2GXG A;  3OYC A;  4HDV A;  3J80 Z;  1LFU P;  4XLC A;  4WXH A;  1S72 I;  3DEU A;  4G6Q A;  3C3W A;  3CF5 F;  2LRD A;  2FXA A;  4ZTF A;  4IRI A;  3RKQ A;  1WJE A;  3S3O A;  4XR6 A;  5IY5 H;  4BQO A;  2E1M B;  3PL8 A;  3ULQ B;  3FX3 A;  1GT0 C;  2VPR A;  1XGO A;  2CRG A;  1HKT A;  4BL0 B;  1IN6 A;  3TO7 A;  4PUS A;  4ZYG A;  4A5N A;  3MZ8 A;  3DPT A;  3U1K A;  3FWE A;  3F9K A;  2FU4 A;  3KEY A;  3ZN1 A;  3CO7 C;  4BHC A;  2FX0 A;  3GLX A;  3F8B A;  3NWS A;  1WWX A;  5J8C A;  3RDI A;  3CTA A;  1EV7 A;  5ICF A;  4UNO A;  4JQF A;  5C4X J;  3R4K A;  3FBI B;  3K4L A;  2I5U A;  3CLO A;  4C3J J;  1OCP A;  2CQ7 A;  2QA4 I;  3S1M J;  1YX5 A;  1LUJ B;  2BHY A;  1QZE A;  3JTG A;  3JSO A;  2GAU A;  2NS0 A;  3KYC B;  2C6Y A;  2JA5 J;  3BG3 A;  1T0F C;  2MAB A;  5HLH A;  3VFZ A;  1MMN A;  3BY6 A;  1FOX A;  4FIS A;  2O8X A;  4XSZ F;  2JQ7 A;  4FX4 A;  1GVJ A;  1QVU A;  5E3N A;  4XMY A;  1B72 A;  2O0Y A;  2LBF A;  2K9N A;  3L2Q A;  2TRT A;  1JXS A;  2HPI A;  3D0S A;  2DN0 A;  3OYN A;  4U88 A;  4A12 A;  1OCT C;  3BTL A;  3KP7 A;  3BT9 A;  2DU9 A;  1H9T A;  4BKX A;  2WAQ A;  5A2Q Z;  3MQ0 A;  3P5J A;  3RSN A;  5LHG A;  2CMP A;  2PN6 A;  4XLE A;  2CG4 A;  2P81 A;  4F52 A;  2KDZ A;  2XUB A;  3I58 A;  4KA4 A;  1E2X A;  4MIM A;  3JCU C;  4UB8 C;  1KQ0 A;  1OFC X;  2GA2 A;  2HU9 A;  2EZL A;  4D7N A;  4RB3 C;  3DBL B;  3RPQ A;  1BI2 A;  4CHU A;  5ED4 A;  2EIK H;  1O7L A;  4ETS A;  2HVQ A;  2VI6 A;  3CUQ B;  1MKM A;  4L0Y B;  4CCJ A;  1K83 J;  2RGV A;  3DBH B;  4HBL A;  1F9N A;  1P7J A;  3FZV A;  5D8L B;  5EJC A;  2E71 A;  3K1P A;  4AYB N;  1U8B A;  2KT0 A;  2R3S A;  1A36 A;  4ENN A;  1ERD A;  3EET A;  3HG9 A;  3HOW J;  4CZC A;  1WFX A;  5EG0 B;  2QLZ A;  1SEU A;  4UHT A;  4BE1 A;  4HW0 A;  1UHM A;  2VQG A;  4IZZ A;  2MFZ A;  3RTR A;  1HW2 A;  3HGY A;  1DGW Y;  4BYY A;  3ZQ7 A;  1R1T A;  3HUG B;  4XLP F;  2KFD A;  2FJ1 A;  5DCM A;  3OYG A;  4KIS A;  4A3C J;  5GTI C;  4ANJ A;  4MHG A;  3ELK A;  1W0T A;  4KIT B;  2HOE A;  3J7A O;  4MEX F;  4I02 A;  5CKT A;  2X4H A;  3CME I;  3HOV J;  4A0Y A;  2HYJ A;  4BUP A;  4ZJZ A;  3H9G A;  1MBK A;  5HLG A;  2XPU A;  2VUM J;  2L3D A;  1UG0 A;  2VJJ A;  4A0X A;  4I0A A;  3V7S A;  2HWV A;  3K1M A;  2Q2E B;  2EA2 A;  5C3E J;  4BAC A;  5LD2 C;  5EEH A;  3DV8 A;  1BR1 A;  1I3Q J;  1R4M B;  3PFI A;  4KIC A;  1K4S A;  5JHU A;  3WGH A;  2BYV E;  1RNL A;  1ZTR A;  4NQW A;  3VYS B;  2OAZ A;  4HST A;  3OYA A;  1U0J A;  2ZME B;  2VON A;  3T0Y A;  3NEU A;  1Z0X A;  1RI7 A;  1XGN A;  1T39 A;  4BBR J;  1ZGJ A;  1OKR A;  1F36 A;  4ESF A;  2QCO A;  1X3W B;  5E8G A;  4ABZ A;  4G7Z F;  5GP9 A;  4Y52 J;  4EJO A;  5LLQ A;  5DCF A;  1IRG A;  5HLI A;  1IXS B;  3GYH X;  2X6X A;  2L2O A;  4G9Y A;  2GZW A;  3J81 K;  3FXM A;  1QO0 D;  3E3V A;  1ULY A;  3HIF A;  1KZH A;  2QGU A;  4B3A A;  3GTP J;  2ZBK A;  3EYI A;  4DNC A;  1WI3 A;  4LLG F;  5DEQ A;  3M9A A;  3FHN A;  4XKV A;  2M34 A;  2XC7 A;  3QAH A;  1VF9 A;  3TW7 A;  4Q47 A;  1G2H A;  3B6A A;  3JR9 A;  2QWW A;  3DTI A;  2L0K A;  1ON2 A;  1FOK A;  2IJL A;  3WTZ A;  1W4M A;  4ZH4 F;  3ZCO A;  4L5E A;  4YEL A;  4MFE A;  3I59 A;  2HXO A;  2R7R A;  4M6V A;  2EJR A;  1U78 A;  3JTH A;  1YS6 A;  2HQ5 A;  2RN7 A;  3H36 A;  2DMN A;  3E6C C;  1YW8 A;  2EBI A;  2EIL H;  2XPV A;  1VQO I;  2KJB A;  2KDO A;  4GGG A;  3E1S A;  3HOZ J;  1VQ4 I;  2X85 A;  2CW7 A;  2LD5 A;  1JGS A;  2L9R A;  1VND A;  4II3 A;  1YE9 A;  1K61 A;  4X1E A;  2YX7 A;  3HDD A;  4HEA 2;  4RAG A;  4X6A J;  1XCB A;  3RZD J;  3ZMT A;  3TOA A;  2BY3 A;  2XRL A;  3ONQ A;  2CH0 A;  1BC7 C;  5ICE A;  1QZY A;  3RYR A;  1MD0 A;  2X6Y A;  3MFK A;  2R7O A;  5EGO B;  3E5X A;  1OPC A;  4B47 A;  3W6V A;  4ZDL A;  3RCO A;  3WU2 C;  3SJM A;  1VZ0 A;  3ZXS A;  1J59 A;  2V9V A;  1TT5 B;  4EVI A;  1W5T A;  4WK8 F;  1ZRD A;  2O7O A;  3L1P A;  4BNC A;  4HZF A;  2ELJ A;  4IF4 A;  1U5T B;  4P5O A;  5IYD J;  3TO9 A;  4A5M A;  2A6T A;  4MO7 A;  3EUA A;  5JLX A;  2FE3 A;  2DA5 A;  1B8I A;  1SFK A;  3MWM A;  2V79 A;  3QPS A;  4LD5 A;  2H1K A;  3FHZ A;  3A03 A;  3ZQC A;  4C2U A;  1YIJ I;  2UV1 A;  3BG6 A;  2RAE A;  1AKH B;  1HW1 A;  3C18 A;  1FZP B;  2EV6 A;  1X1B A;  5JVG F;  3QP5 A;  2H8R A;  2K9M A;  1KU9 A;  1TW2 A;  2K3F A;  1ZAR A;  2R7F A;  4ZZD A;  3HRM A;  4N4O B;  5BNG A;  4ZYA A;  4CCM A;  2WAE A;  3LA7 A;  3Q3S A;  1D0Z A;  2A07 F;  3A02 A;  3KP2 A;  1MJB A;  3FK6 A;  4HLY A;  2DPU A;  1ZQ3 P;  2LG4 A;  3CDL A;  2WWY A;  2NS8 A;  2W25 A;  2V4J C;  3CD6 I;  1ZKG A;  1YHQ I;  2Z99 A;  2XRO A;  1JJ6 C;  4KYW A;  2XB5 A;  3ZMU A;  1TWG J;  3JRG A;  2VBW A;  4D5C A;  3MKY B;  5HLT A;  5CJ9 A;  2GIV A;  2OA4 A;  1R58 A;  1UG2 A;  1STZ A;  4YFX F;  1R5G A;  2JVH A;  1RUN A;  1YFH A;  2EPF A;  4OIN F;  1X4O A;  5DD4 A;  3PO2 J;  4L18 B;  2X6O A;  2GIZ A;  3E5U A;  4EJW A;  4YIF A;  4GYG A;  3CJR B;  4I99 C;  3I4N J;  4WCG A;  5HDG A;  5HVQ C;  3W2W A;  2EQR A;  3H35 A;  3K1N A;  2KZG A;  1KU7 A;  4IHW A;  2ZCW A;  3EDP A;  2H09 A;  2WA0 A;  4N4N B;  4HF1 A;  3LSR A;  2ACJ A;  2F5V A;  3IP4 B;  4IHX A;  2R7Q A;  3DKY A;  4RLF A;  3QOE A;  3VWB A;  5E17 F;  4RGS A;  5HNH A;  1S7E A;  2GQQ A;  2TCT A;  3HRT A;  3LSH A;  4M6Y A;  6PAX A;  3PUF A;  1U9O A;  1MSE C;  4EEF G;  1ENH A;  2JWT A;  1MBH A;  3L9F A;  1IRX A;  2HNH A;  4HSR A;  1SFX A;  4IHY A;  2LY2 A;  1UEL B;  2ZC2 A;  1P4X A;  4FTH A;  4GDF A;  3LSP A;  5J6X A;  2IA2 A;  2OZU A;  1MH4 A;  1ZRF A;  5FO5 A;  2FBH A;  3KET A;  3J80 K;  3K4C A;  3GTQ J;  2W84 A;  2P5L C;  1OCC H;  3SDG A;  3ZQG A;  2DT7 B;  3FIS A;  3KP4 A;  2JA6 J;  3I0T A;  1G3T A;  1FYK A;  1EKE A;  2BY0 A;  3BJO A;  1QPI A;  2VKV A;  3BJ6 A;  3G2B A;  5E1X A;  2MSY A;  4BY7 J;  4P96 A;  2ETH A;  3U21 A;  4A2U A;  2HI3 A;  3IAM 2;  4PJJ A;  3IH4 A;  2CUJ A;  2DT6 A;  2LDU A;  1H9G A;  4E7J A;  4XN0 A;  3KX2 A;  5BS6 A;  3BR5 A;  2P6S A;  2O9L A;  1YRN A;  4HX4 A;  4IQJ A;  1OJL A;  4ZZL A;  4UB6 C;  1Y8R B;  1OLT A;  3W6K B;  2ZXW H;  2DA3 A;  2K9S A;  4DYQ A;  4RB2 C;  3OYL A;  4ZYE A;  1PUE E;  2MBF A;  5B3S H;  5M5Y J;  1OYW A;  4A3K J;  2G0E A;  3PNT A;  2BY1 A;  3GFM A;  4WXC A;  2K9L A;  2IW5 A;  3OYM A;  1UZC A;  3V8L A;  3COA C;  2F5E A;  4R1H A;  4B8X A;  3GO5 A;  2GXA A;  5IYB J;  4I98 B;  1HQC A;  4YII A;  5D8K B;  3X2Q H;  3V7R A;  1NHA A;  4AYB A;  3MD2 A;  2M30 A;  4ZC3 A;  5K5Q A;  1LE8 B;  1TBX A;  1XMX A;  4I01 A;  5E8I A;  3RI4 A;  1QNT A;  1JHH A;  3W3C A;  1VQ5 I;  1G3S A;  4UVB A;  4ON0 A;  4Y13 A;  2DA4 A;  2Z33 A;  1T98 A;  1IW7 F;  4CZZ A;  2HDC A;  3FM3 A;  4CA0 A;  5E3L A;  3IWZ A;  1FSH A;  2BVL A;  2MLG A;  5M3F J;  2VQL A;  2CS3 A;  2WBM A;  1Z9C A;  1O3Q A;  4RM2 A;  4C3H J;  5DS9 A;  2KIU A;  3H9J A;  4OIO F;  5LHH A;  3HRU A;  3B73 A;  4DIQ A;  5A2Q K;  2VXD A;  2DTZ A;  4TV7 A;  2HTS A;  3WG9 A;  2XSJ C;  5D4S A;  4B43 A;  5J4V A;  2COM A;  4U7D A;  3PUB A;  2LLK A;  4WXD A;  1H89 C;  4XBF A;  3OOP A;  2ELH A;  4UUS B;  3QPT A;  3I9V 2;  1WGX A;  2XGX A;  2HFH A;  4IO9 F;  2KLO A;  3LL7 A;  4DGW B;  1XD7 A;  4A3M J;  3FXO A;  4F7Z A;  5H20 A;  3S1R J;  4CUG A;  4B09 A;  2X1D A;  1LKX A;  2BZT A;  3U1D A;  3WHC A;  4CYC A;  5CYV A;  3RQ4 A;  5FD6 A;  3MN2 A;  2M9H A;  4MTE A;  3L2V A;  2DYR H;  1MBJ A;  1FC3 A;  1OMI A;  3CCJ I;  3FMS A;  5D6E A;  2AXL A;  3HL2 A;  3W6J B;  1BIA A;  4KDP A;  2CUZ A;  3BR0 A;  4CCK A;  4HLX A;  5GPA A;  1R23 A;  3GBG A;  5GTH C;  2PEX A;  2FUG 2;  2A68 F;  1B9N A;  2F2E A;  4KMF A;  3R0A A;  1IDY A;  3K9T A;  5KVR A;  2MW8 A;  2BY2 A;  3CC2 I;  2IGK A;  4XLH A;  3WG7 H;  2XAJ A;  4AM3 A;  2YX4 A;  3T8T A;  1V5F A;  2HKO A;  5F0F A;  2FBI A;  4FAS D;  2XF5 A;  5JFR A;  2ZJQ F;  2A6E F;  2EIM H;  2NNY A;  1HST A;  3S1Q J;  5LGN A;  3RQI A;  3LA2 A;  2O3F A;  1TQP A;  1TZL A;  2XKO A;  4RGR A;  3WE3 A;  2PMH A;  2BXZ A;  2EFO A;  4ZDP A;  4FCY A;  3GTM J;  1WI9 A;  2YS9 A;  1IF1 A;  3PNV A;  3HXL A;  4HAM A;  2IGN A;  2HOT A;  3WU0 A;  2XIG A;  4UV8 A;  2E1C A;  4PFO A;  2VPL A;  2GOM A;  2IEK A;  3GX4 X;  1BR4 A;  3H3U A;  4XRM A;  2BXY A;  4Y4R A;  1YJW I;  1HC8 A;  3H0D A;  2WY8 Q;  3N97 A;  3DKX A;  3IC7 A;  1Z67 A;  3M3Y J;  2F5F A;  1DQU A;  3MZH A;  4U87 A;  2DOA A;  4AU7 A;  3AAF A;  1EF4 A;  1UJ8 A;  5IP9 J;  3H1C A;  1MBF A;  1K4T A;  1RES A;  2K86 A;  2EFW A;  1WH5 A;  1U8R A;  2K85 A;  3CUQ C;  3C2H A;  3HTU A;  3IKT A;  2Z5U A;  1LQ1 A;  3ZQH A;  3G73 A;  1S6L A;  2WAD A;  1SMT A;  1X2N A;  2D1V A;  2M7B A;  2DYS H;  1TLH B;  1V4R A;  1Y8Q B;  2DMP A;  3L2R A;  1SC7 A;  3WTV C;  4M3G A;  1IN7 A;  2B63 J;  2E7X A;  4XNF A;  1XSX A;  3HC7 A;  1KQ9 A;  4HNT A;  1NTC A;  1CF7 B;  3BQZ A;  4C2M J;  2LF7 A;  4Z2Y A;  3SHF A;  3CO6 C;  1W5S A;  1ETO A;  1DUX C;  1Y1V J;  1MND A;  3FBN B;  1WJC A;  2HR3 A;  2JZY A;  4OIR F;  5HNF A;  4IHV A;  5K1Y A;  2WTE A;  5FFX A;  1FYM A;  1FBU A;  4JK1 X;  1NG6 A;  1V3F A;  1WHU A;  1T38 A;  5FRN A;  3I53 A;  2XHK A;  1HA8 A;  2CU7 A;  3H0G J;  4LLN A;  1XTA A;  3FMQ A;  1CQT A;  3NQO A;  1BW5 A;  3VDX A;  4GFB A;  4LB5 A;  1D8J A;  1GUU A;  1X1P A;  2W57 A;  4NBQ A;  3CCY A;  3HM5 A;  1TP4 A;  1RC9 A;  2RQP A;  2KKO A;  1MH3 A;  3ZMS A;  1ZLK A;  3CC7 I;  4EGZ A;  3S3M A;  5EEG A;  4RMN A;  1ZHF A;  1PUF B;  5J8F A;  2VT3 A;  3FKI J;  2BHZ A;  3M1E A;  4LOC A;  2W1O A;  2ZME C;  5CPR B;  2R5Z A;  1IO2 A;  4WF2 A;  1IGN A;  1FBS A;  3D5L A;  4IEJ A;  2E34 A;  1GXQ A;  4MFD A;  4U0V A;  2VN2 A;  5JLW A;  3JRC A;  1JHF A;  5K5R A;  4IQ4 A;  4YG2 F;  3TGN A;  4Q5S F;  2FNP A;  3RKY A;  5KAI C;  2XAG A;  2G7H A;  3WTY C;  4M74 A;  3B6C A;  2H94 A;  3DFG A;  4EV0 A;  5GAH J;  2VBX A;  3K10 A;  3DU6 A;  4RBO A;  1W36 D;  2X1C A;  2HVS A;  4LIV A;  2VE8 A;  4N9I A;  3G3Z A;  1FT9 A;  1R36 A;  1YIO A;  2JMW A;  2OBP A;  2E1O A;  1I6X A;  2KRH A;  3FXK A;  4L9N A;  4A3I J;  2ZSH B;  4NHJ A;  2ME6 A;  2DO7 A;  3OL4 A;  3VB2 A;  2ECB A;  2VQC A;  2E5N A;  2M7A A;  2K40 A;  4XOP A;  5LRR A;  2DFF A;  3J7Y J;  3S2D J;  2I10 A;  5CQE A;  2QEX I;  1REP C;  3F22 A;  2XGD A;  1X3Z B;  2IS1 A;  1POG A;  3WTX C;  3HKZ N;  3HOT A;  2AQE A;  2X51 A;  2R7V A;  1Q1H A;  2DTR A;  5EZG A;  3QU3 A;  3P9I A;  3QOP A;  3FXR A;  5DM7 F;  2M8E A;  3OYD A;  1K7A A;  1QZZ A;  3KP5 A;  1T6S A;  4BDY A;  2LOO A;  1WPK A;  2XKP A;  2YUS A;  3S8P A;  2DA6 A;  4E7S A;  1IRF A;  3GME A;  1ON1 A;  1Z6T A;  1O57 A;  3G1M A;  2R5Y B;  1W7P B;  1OQY A;  2R93 J;  3I56 I;  2ADU A;  1MDM B;  2V1D A;  4OOI A;  2QYO A;  3JSP A;  3NAR A;  2OQR A;  3NAU A;  4A3F J;  4DQ2 A;  2YSR A;  3S14 J;  4NUB A;  1JGG A;  4H0E A;  3OR1 C;  1QU3 A;  1S7A A;  1YX3 A;  4L9T A;  1N25 A;  1IN8 A;  3H5A A;  3DP7 A;  3OSG A;  1O4X A;  2MD0 A;  1MMG A;  2L54 A;  4XL9 A;  2ZKZ A;  4GRI A;  4EJT A;  4B4C A;  2XGC A;  4BHP A;  5BQT A;  3ABT A;  5K7Z A;  2Y30 A;  1J2X A;  5HS7 A;  4PSW A;  2CYY A;  2FEZ A;  1Z1D A;  2IXS A;  4HRI A;  4BH9 A;  1U5T C;  2A69 F;  3D1N I;  2DJI A;  2VJ5 A;  4RAZ A;  1F4K A;  2VC0 A;  1QRY A;  1P92 A;  3LQQ A;  2ID3 A;  1IV8 A;  1K78 A;  3BCB A;  5EZH A;  1HKQ A;  5FLX Z;  1JKP C;  3ZRG A;  4BBS J;  2PJR B;  2JK3 A;  2IAI A;  2QSH X;  1OCR H;  2WV0 A;  2R7X A;  2V1U A;  3EYY A;  3I5U A;  1W5C C;  1L3L A;  2YU3 A;  4GXO A;  1MBE A;  3IKV A;  4JX6 A;  2V9P A;  3KP6 A;  1JJ8 C;  1IV6 A;  2VKE A;  5LFA A;  1B6A A;  3S16 J;  1SAN A;  1X1A A;  1RKT A;  2Y0S N;  4G94 A;  2GM4 A;  3FXQ A;  5J3L A;  2DBB A;  1R49 A;  3QYB A;  3P7N A;  3MZY A;  3CUO A;  2QUF A;  3TDZ C;  1P2F A;  1T2K A;  3CJT B;  4HQE A;  1KYZ A;  3CP8 A;  4NC6 A;  3H9Q A;  2IT0 A;  3HGG A;  4UVC A;  4BQQ A;  2DDA A;  2JRT A;  2X1E A;  2B9S A;  3OY9 A;  3ABU A;  2HDD A;  3F72 A;  4BGD A;  3K4N A;  3H3Z A;  1J5Y A;  5FKL A;  1IAW A;  4OU0 A;  2LC2 A;  3ML6 A;  4G6D A;  4OIQ F;  1SAX A;  3TW6 A;  4CGZ A;  4F91 B;  1IN4 A;  2VOP A;  4KIB A;  1BC8 C;  3F0C A;  5HDK A;  2YPR A;  1T8I A;  2M8G X;  1MMA A;  3NWT A;  2PX9 A;  1LNW A;  1R22 A;  5E18 F;  2DI3 A;  4PJM A;  4CCN A;  3ZPL A;  1RR8 C;  5IT9 Z;  1D0Y A;  2MC3 A;  3O3K A;  1FSE A;  2Z2S B;  1DPR A;  2Y69 H;  2QBY A;  4G6T B;  3AFH A;  1SFU A;  4M72 A;  3V8J A;  4QPQ A;  1JT6 A;  2DFH A;  2QZ8 A;  1EH7 A;  4M3B A;  1EH8 A;  1Y6I A;  2K3P A;  4O3M A;  2D2W A;  3VOD A;  2O61 A;  1BR2 A;  3KYL A;  4B44 A;  2LNB A;  2F5C A;  2QKM B;  1BI0 A;  2LSO A;  1LFP A;  5DV5 A;  3I3L A;  2FMY A;  1KU3 A;  4M3D A;  2OQG A;  4DJA A;  2AQF A;  4HX7 A;  1CGP A;  3F8M A;  1PP7 U;  2F4O B;  3DEW A;  4DYR A;  2KIM A;  3K70 D;  3RZO J;  1W36 C;  1M1E B;  2WC2 A;  3ECO A;  4F55 A;  3KPH A;  3R6S A;  3JRA A;  5TJJ A;  2OF7 A;  2BW3 A;  2OJE D;  3T1B A;  4A3J J;  1RPW A;  5F27 A;  1D5Y A;  4RA2 A;  4ASN A;  2ISZ A;  2EWN A;  4ENK A;  5BPI A;  4HV6 A;  2O8K A;  1V5E A;  2FNA A;  1IZ1 A;  2ZXI A;  4BJ6 C;  4M9X A;  3A01 A;  4EM2 A;  1ZAO A;  5KAF C;  3MKZ A;  1JT0 A;  1R1V A;  2MD5 A;  1XGS A;  2JT1 A;  3CCU I;  3DKW A;  2XB0 X;  1AWC A;  2J5O A;  3LQR A;  3JRF A;  2HKX A;  3LAJ A;  1MGT A;  4V2G A;  3FXL A;  3LFU A;  2L4M A;  5EF6 A;  1VQM I;  2UXN A;  3LOC A;  2HGC A;  2FML A;  3VYR B;  1BW6 A;  5D5X B;  1FOW A;  1BJZ A;  1Y39 A;  3M4O J;  4HG2 A;  2RKH A;  2DA1 A;  5HS8 A;  3BG7 A;  2KIQ A;  2E5Z A;  3GCM A;  5AIP A;  2H6B A;  4M3E A;  3KZZ A;  1TWA J;  1GV5 A;  2E19 A;  4BHB A;  3O2P E;  4YFN F;  3L09 A;  2VE9 A;  2ZJP F;  1XCV A;  3SFZ A;  2CV0 A;  3MKW B;  2E7W A;  1Z7U A;  4CDG A;  1BJA A;  1QHH D;  3BP8 A;  4XK4 A;  1WRJ A;  5HOD A;  1G6N A;  3MMY B;  3QP6 A;  2EIJ H;  2Z9O A;  3EUH C;  1E17 A;  2ZNY A;  4M71 A;  1U6G A;  4UXN A;  2WY7 Q;  2EZH A;  3MCZ A;  2MH2 A;  3BZK A;  3HPG A;  3QU6 A;  3JRB A;  2L7K A;  3PIP F;  3OWT A;  3M07 A;  3E0J B;  4EJV A;  1SAU A;  3BTJ A;  4EAT A;  4BJ5 C;  2XAS A;  2PMZ N;  1PYV A;  3KE2 A;  1N77 A;  1PP8 F;  5HOO A;  5DUI A;  1G4D A;  5AON A;  4P9U A;  3CMA I;  4IJA A;  1A04 A;  1W7P D;  3R60 A;  2LTP A;  4G7O F;  2FD5 A;  4JX4 A;  3ISP A;  1FJL A;  3B02 A;  4KJZ A;  4L9V A;  1XN7 A;  5M5W J;  5J4Y A;  2F48 A;  4E7K A;  2FOW A;  2QEN A;  3ZMZ A;  1Y0N A;  3IHU A;  2Z3Y A;  1PJR A;  2ESH A;  3GW2 A;  2O03 A;  1MW7 A;  2VJ4 A;  4DYC A;  3OYF A;  2QQ9 A;  2MA3 A;  1TTY A;  2BV6 A;  3BPV A;  1XSV A;  5CVR A;  5LEK A;  5HS9 A;  3K69 A;  1VI0 A;  3CMM A;  2P6T A;  2DOE A;  5F0H A;  3D5R C;  1RUO A;  3H5N A;  2RC4 A;  5D5W B;  4D9J A;  4XOT A;  1HDP A;  5JHF A;  2ZNZ A;  4AVZ A;  1P4W A;  2OD5 A;  4R8H A;  2PFB A;  4LK1 F;  4CCL A;  5D5V B;  3JAM Z;  4AIJ A;  2MH9 A;  1DU6 A;  4F3Q A;  1G3W A;  1SD5 A;  3ABL H;  2DT5 A;  2FA5 A;  2RNG A;  2Y48 A;  4S05 A;  2H8W A;  5L3E A;  1FY7 A;  1HF0 A;  5IOY A;  3HSE A;  4HYE A;  3RPU A;  1ZG3 A;  3TED A;  4C30 A;  2LYC A;  2VBZ A;  3OSF A;  1LEA A;  3D5S C;  1S7O A;  2BE5 F;  2NAZ A;  3QOD A;  3U9G A;  4PFP A;  1W0U A;  4ITV A;  3S17 J;  2R7S A;  5IP6 A;  3CCV I;  1IUY A;  2LMD A;  5FD5 A;  2IA0 A;  3HKZ A;  4RAY A;  2JJ7 A;  3OMY A;  3A0B C;  4NC8 A;  2F5D A;  1VQ7 I;  2JUG A;  5EEA A;  3CUQ A;  1LPQ A;  2K27 A;  1FYL A;  4FQG A;  2E2I J;  5IP7 J;  3BR6 A;  2FRH A;  2NS7 A;  1TQM A;  1VTN C;  3VSK A;  1FMV A;  3TBI A;  1YIT I;  1A6Q A;  4GYI A;  2W24 A;  3T5X A;  5GAD J;  4XLF A;  1G59 A;  5LGT A;  1X58 A;  4XSX F;  3OL3 A;  2D45 A;  1YW9 A;  2NVT J;  5EG0 A;  4FET A;  1V5G A;  3WTU C;  3QWL A;  2PI0 A;  3OV8 A;  1JUP A;  1I39 A;  1YG2 A;  4OAY A;  5FKK A;  4O6J A;  1OCZ H;  2EZI A;  2DDB A;  3GF2 A;  1RET A;  3HUG A;  2LBF B; 
#chains in the Genus database with same CATH homology
 2VI6 A;  3ZQH A;  1K83 J;  5EYR A;  4QTR A;  1FIA A;  1P7J A;  1X2N A;  2AO9 A;  2M0C A;  4AYB N;  2DMP A;  1U8B A;  2KT0 A;  4M3G A;  1JUS A;  2B63 J;  3HOW J;  1NTC A;  3BQZ A;  4C2M J;  5EG0 B;  3JRI A;  2HXI A;  1ETO A;  2ID6 A;  1Y1V J;  2GLO A;  1A5J A;  4B1R A;  5E3M A;  4IHV A;  1I50 J;  1ZK8 A;  1PUF A;  2DJN A;  3HGY A;  2M2E A;  4UUT A;  2ELK A;  2CU7 A;  3H0G J;  1XC5 A;  2FJ1 A;  4A3C J;  1CQT A;  2L7Z A;  1BW5 A;  4GFB A;  1JUM A;  2WV1 A;  1W0T A;  1GUU A;  3CCY A;  3HM5 A;  3HOV J;  4JP0 A;  2HYJ A;  1MH3 A;  3GTJ J;  4BY1 J;  1MBK A;  3ZQF A;  4XRS G;  2XPU A;  1WH7 A;  2VUM J;  4BXX J;  2GBY A;  2LFB A;  1HLV A;  3TP3 A;  5C3E J;  3S15 J;  1PUF B;  2LVS A;  2NVX J;  3FKI J;  1I3Q J;  5IPA A;  4LOC A;  3Q0V A;  2R5Z A;  1ZTR A;  4W1U A;  1IGN A;  4IEJ A;  1ITY A;  1WCM J;  1ZGW A;  4MFD A;  3O8G A;  5JLW A;  3LSJ A;  1FTZ A;  3JRC A;  3K7A J;  1NK3 P;  1Z0X A;  2CQX A;  3IH3 A;  4BBR J;  1F36 A;  2QCO A;  3BTI A;  1X2M A;  4ABZ A;  3B6C A;  5IYC J;  5GP9 A;  4Y52 J;  3GTO J;  4RBO A;  5FKN A;  2R7Z J;  5J1R A;  2CUE A;  3BR1 A;  4FE7 A;  2JMW A;  2E1O A;  1H8A C;  4A3D J;  2R5Z B;  4A3I J;  3HOX J;  4B3A A;  3GTP J;  2Y9Z A;  2ME6 A;  2N8G A;  1TWF J;  1WI3 A;  2ECB A;  2R5Y A;  3ZQL A;  3GTK J;  2M34 A;  5M5X J;  2DA7 A;  2K40 A;  1VF9 A;  3IH2 A;  3TW7 A;  1G2H A;  1ETW A;  3B6A A;  3JR9 A;  3S2D J;  2I10 A;  2L0K A;  4JX5 A;  2HOS A;  2XGD A;  1P7I A;  3LSG A;  1POG A;  3BQY A;  2OPT A;  3HKZ N;  4L5E A;  4MFE A;  2HXO A;  5EZG A;  1ZR4 A;  1NK2 P;  4FE4 A;  4M6V A;  1U78 A;  4S0H B;  2HQ5 A;  1WPK A;  2DMN A;  2DMQ A;  2NOG A;  5EGO A;  2YUS A;  1QVT A;  2X48 A;  2DA6 A;  4JYK A;  2EBI A;  2XPV A;  1Y1W J;  2JA8 J;  2XPW A;  3G1M A;  2R5Y B;  2WAQ N;  2R93 J;  1U9N A;  2Y31 A;  3HOZ J;  1VFC A;  2LD5 A;  2LP0 A;  2L9R A;  1HCR A;  5J1Y A;  4XIC A;  3NAR A;  4A93 J;  1VND A;  3NAU A;  4A3F J;  2COB A;  3CMY A;  1JKR C;  3S14 J;  1K61 A;  1JGG A;  3QQA A;  4X1E A;  4A3E J;  3HDD A;  4X6A J;  3LNQ A;  1XG1 A;  1IUF A;  3RZD J;  2Y2Z A;  3OSG A;  1O4X A;  2XRL A;  1UHS A;  1JKO C;  4B4C A;  1F43 A;  2XGC A;  1B72 B;  5EGO B;  1AU7 A;  3W6V A;  5K7Z A;  3SJM A;  2Y30 A;  1AKH A;  5F04 A;  2IBD A;  2DMT A;  1GVD A;  2O7O A;  2AHQ A;  2YU9 J;  3D1N I;  3L1P A;  1QRY A;  3MVP A;  2L7F P;  2ID3 A;  5IYD J;  5K7F A;  2LKX A;  4MO7 A;  5EZH A;  5JLX A;  1JKP C;  4BBS J;  2JK3 A;  1MSF C;  2CJJ A;  4I6Z A;  2DA5 A;  1E3O C;  2IAI A;  2WB1 N;  1B8I A;  1HOM A;  3QPS A;  2H1K A;  3A03 A;  4J19 A;  3ZQC A;  2DMU A;  1I6H J;  2RAE A;  1AKH B;  4A3B J;  1MBE A;  3CQZ J;  2CQQ A;  3O8H A;  4JX6 A;  1JJ8 C;  3HB9 A;  2H8R A;  1IV6 A;  2VKE A;  3S16 J;  1SAN A;  1RKT A;  2Y0S N;  3IV5 A;  2GM4 A;  1TC3 C;  1FIP A;  4W97 A;  3PO3 J;  5J3L A;  4DW6 A;  3GTG J;  5BNG A;  3HOY J;  3Q3S A;  5E3O A;  3FK7 A;  3A02 A;  1B8I B;  3SFI A;  3FK6 A;  1ZQ3 P;  3CDL A;  3HGG A;  1ETY A;  3OIO A;  2NS8 A;  5C44 J;  1BL0 A;  4DZP A;  1ZKG A;  1ETV A;  1MNM C;  2HDD A;  1DU0 A;  2R92 J;  2JN6 A;  5FKL A;  1JJ6 C;  2XB5 A;  4A3G J;  1TWG J;  4G12 A;  3JRG A;  4D5C A;  4V2F A;  3BG5 A;  3TW6 A;  1UG2 A;  4D5F A;  2MG4 A;  3Q0W A;  2LY9 A;  3F0C A;  2NVQ J;  3PO2 J;  1JTY A;  2X6O A;  2M8G X;  5F1J A;  3I4N J;  1BA5 A;  2ECC A;  2EQR A;  4D7M A;  2LK2 A;  1JKQ C;  3FIW A;  1IC8 A;  3E7L A;  4IHW A;  1LFB A;  3Q0U A;  4AC0 A;  1Q1V A;  3ZQI A;  3UKG A;  1ETQ A;  5K7H A;  1JT6 A;  2CUF A;  4M3B A;  3LSR A;  3I4M J;  4HNV A;  3OOU A;  3BG9 A;  4IHX A;  1HDD C;  1S7E A;  2TCT A;  2X9D A;  1UMQ A;  2D5V A;  1U9O A;  2K9Q A;  1MSE C;  3HOU J;  4EEF G;  1ENH A;  2JWT A;  1MBH A;  4M3D A;  4RDU A;  4IHY A;  2QF7 A;  2XGE A;  9ANT A;  4FTH A;  1ORK A;  3LSP A;  4AUX A;  3BR2 A;  2ME0 A;  3G1O A;  1MH4 A;  3DEW A;  4DYR A;  5IOZ A;  3C2B A;  3RZO J;  3GTQ J;  1IDZ A;  3SDG A;  3ZQG A;  5F0C A;  3HBL A;  3JRA A;  2OF7 A;  4A3J J;  3FIS A;  2JA6 J;  2LR8 A;  1RPW A;  5FJ8 J;  2Y9Y A;  5F27 A;  1ZR2 A;  1D5Y A;  1QPI A;  2VKV A;  2MSY A;  2NVY J;  2O8K A;  4BY7 J;  1FTT A;  2HI3 A;  3IH4 A;  3A01 A;  3TP0 A;  5FKM A;  1JT0 A;  3JRE A;  4QSH A;  1TWH J;  3BR5 A;  1MBG A;  2XB0 X;  1LE8 A;  5FLV A;  2O9L A;  1Z77 A;  1YRN A;  3JRF A;  4M3F A;  1OJL A;  4V2G A;  3VPR A;  3S2H J;  5EF6 A;  4XRS A;  2DA3 A;  2K9S A;  4DYQ A;  4Y7N J;  2L7M P;  3LOC A;  5M3M J;  3H3V K;  5GPC A;  5M5Y J;  4A3K J;  2G0E A;  1BW6 A;  3PM1 A;  1BJZ A;  1FEX A;  2HOA A;  2R0Q C;  5IYB J;  3HEF A;  3A01 B;  2E2J J;  2JA7 J;  3M4O J;  2W48 A;  2DA1 A;  1T56 A;  3QPL A;  1JTX A;  1ETK A;  4A69 C;  1LE8 B;  5EDN A;  1YRN B;  4MLO A;  3G1L A;  4M3E A;  1TWA J;  1GV5 A;  2E19 A;  5C4J J;  4UUS A;  2DA4 A;  4I76 A;  4XID A;  5E3L A;  5J1U A;  5M3F J;  4XK4 A;  3MKL A;  1APL C;  5HOD A;  4A3L J;  4C3H J;  5DS9 A;  2XSD C;  1RKW A;  1H88 C;  2EZH A;  1IG7 A;  1SFO J;  3JRH A;  1RR7 A;  2DTZ A;  1IRZ A;  3JRB A;  3K2A A;  1TWC J;  1R9T J;  3GTL J;  2LLK A;  2EH3 A;  1H89 C;  3WHB A;  3BTJ A;  4UUS B;  3ZOB A;  2PMZ N;  1WGX A;  1LFU P;  2MGQ A;  4A3M J;  2LTP A;  2FD5 A;  4JX4 A;  3S1R J;  1FJL A;  5FLM J;  1AHD P;  3BTC A;  3RKQ A;  3WHC A;  2ZB9 A;  4CYC A;  5M5W J;  3MN2 A;  2M9H A;  5F08 A;  3JRD A;  1MBJ A;  1GT0 C;  2VPR A;  2CRG A;  4DYC A;  3BR0 A;  5GPA A;  3GBG A;  1GDT A;  2E2H J;  1VI0 A;  2FX0 A;  1IDY A;  1A6I A;  5F0H A;  2MW8 A;  3DCF A;  2FQ4 A;  5C4X J;  1HDP A;  4C3J J;  3S1M J;  1OCP A;  2DA2 A;  1XS9 A;  5F0F A;  2EZK A;  4CYC B;  4NDL A;  5FKO A;  1DU6 A;  2JA5 J;  3BG3 A;  3S1Q J;  3RQI A;  1HF0 A;  4QIW N;  5IOY A;  4C3I J;  3TED A;  3OSF A;  4DZJ A;  4FIS A;  4FCY A;  1W0U A;  3GTM J;  3S17 J;  5IP6 A;  2YS9 A;  2JJ7 A;  2HOT A;  1QVU A;  5E3N A;  1B72 A;  2K9N A;  5EEA A;  2IEK A;  2E2I J;  5IP7 J;  2TRT A;  3BR6 A;  2NS7 A;  3S1N J;  4XRM A;  5DTD A;  1T33 A;  2DN0 A;  3BR3 A;  1OCT C;  3BTL A;  3BT9 A;  3M3Y J;  1X58 A;  4BKX A;  2NVT J;  1IJW C;  5EG0 A;  1ETX A;  1JUP A;  2P81 A;  2KDZ A;  1EF4 A;  5FKK A;  5IP9 J;  1GV2 A;  1MBF A;  4MIM A;  1RES A;  2EZI A;  1OFC X;  1WH5 A;  2EZL A;  4D7N A;  1RET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...