1B72B

Pbx1, homeobox protein hox-b1/dna ternary complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
RKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein/dna
molecule keywords DNA (5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*GP*AP*TP*CP*GP*G
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b72B00
5IOYA 1AKHB 2H1KA 2E2IJ 1ZR4A 1HF0A 1E3OC 2B63J 1X58A 4AYBN 3GTJJ 2OPTA 4IEJA 2NS7A 2Y31A 3MN2A 4XRMA 3O8GA 4A3LJ 1A5JA 2TCTA 2M0CA 3HGYA 1WI3A 2M9HA 1XG1A 3G1LA 3JRIA 4XRSA 1FIPA 3HOWJ 2ECCA 4BY1J 2E2JJ 1WH7A 2K9QA 2DMTA 4A3IJ 5J1UA 4UUSA 3BTLA 3I4MJ 5J1YA 4I76A 3HB9A 2ELKA 2R5ZB 2LR8A 4JYKA 5J3LA 1MBFA 1Q1VA 5K7ZA 2Y2ZA 2LTPA 3JRAA 3SDGA 4J19A 5GPCA 5M3FJ 5E3NA 3BT9A 3QQAA 3GTOJ 3GTQJ 4D7MA 1VF9A 5C3EJ 2K40A 1O4XA 3WHCA 4DZJA 1Y1VJ 1U9NA 4Y52J 4JX5A 4M3EA 5EGOA 5FJ8J 3BTJA 1VI0A 4C3HJ 3GBGA 3E7LA 2PMZN 3OSGA 1JUMA 4JX4A 4A69C 3H0GJ 1FJLA 3BQZA 5GP9A 5FKKA 4BKXA 2FJ1A 1QVUA 4GFBA 2XB0X 4M3FA 5M5XJ 2NS8A 3S15J 1U9OA 4NDLA 2DA2A 1AKHA 3NAUA 5IYCJ 1HOMA 2XGCA 3FK7A 3TW6A 5DTDA 3S1NJ 2K9NA 4RDUA 2JK3A 2L7MP 1JT0A 2X9DA 2GBYA 4L5EA 1JTXA 1Z0XA 2W48A 2AO9A 1TWHJ 3TW7A 3RZDJ 1ZKGA 1TWCJ 2MGQA 3ZQFA 1MBGA 2EBIA 2P81A 3DCFA 3A03A 1POGA 2YU9J 4DYCA 2R93J 3ZQGA 3S1RJ 1TWGJ 5JLWA 2JA5J 5M5YJ 1A6IA 2DA7A 2EH3A 3BR2A 1U78A 2EZHA 2CRGA 2KDZA 1IV6A 1ETXA 3JRGA 4A3MJ 2EZLA 1RPWA 3GTGJ 1APLC 3LSGA 2CQQA 4IHXA 3CCYA 1R9TJ 2XRLA 3FK6A 2CQXA 4V2GA 3S2HJ 4D5FA 3FKIJ 2LVSA 2Y9ZA 3RKQA 2TRTA 2ZB9A 3Q0WA 4FISA 2L0KA 1WPKA 2VKVA 2HYJA 2DN0A 3QPSA 1PUFA 3FIWA 5FLVA 3IH4A 5EYRA 4FCYA 1XC5A 5IOZA 2DJNA 1ETWA 4DW6A 2CU7A 3HOXJ 5M5WJ 3A02A 5FKLA 2WB1N 1JKOC 3RQIA 5IP9J 1IUFA 3IV5A 1GDTA 3OIOA 4BY7J 2GLOA 2CUFA 1GUUA 1Z77A 2YUSA 3JRHA 1K61A 2ECBA 5EG0B 5FLMJ 1ZTRA 1BW5A 4MLOA 1ORKA 4CYCB 3JREA 4S0HB 1MNMC 2JA7J 3MKLA 3I4NJ 2CJJA 1UHSA 2DA6A 1VFCA 1LFUP 3A01B 1X2MA 2JMWA 4C3IJ 2G0EA 2JN6A 3HDDA 5F27A 3S16J 1ETYA 5C4JJ 2L7ZA 3BG5A 4XRSG 2EQRA 3GTLJ 1K83J 1ETQA 2QCOA 1JT6A 1EF4A 3HM5A 3G1MA 1HDPA 1PUFB 2Y0SN 3BR3A 3S14J 3PO3J 1I6HJ 1UMQA 1TWAJ 1ETOA 4B4CA 1W0TA 1MSFC 2M34A 3ZQCA 1GV5A 3BR6A 2OF7A 1FIAA 1JKQC 2HOSA 3GTMJ 1WGXA 1H88C 1LFBA 2YS9A 1FTZA 1IG7A 3HOUJ 2LK2A 4W97A 4IHWA 1U8BA 4QTRA 3OOUA 3ZQIA 4XICA 1NTCA 5HODA 1I50J 1MBKA 1ETVA 5IYBJ 5DS9A 4JX6A 3B6AA 1HCRA 1W0UA 1MBHA 1JJ6C 1NK2P 3TP0A 5EEAA 3W6VA 3G1OA 4QSHA 5FKMA 5EGOB 2WAQN 4G12A 1HDDC 4A3DJ 1QRYA 2RAEA 4BBRJ 2COBA 2DA4A 2ID3A 2NVYJ 2H8RA 3Q3SA 3LSRA 2FQ4A 2XPUA 1LE8B 1OCTC 1YRNA 2HXOA 3M3YJ 5E3MA 3MVPA 2K9SA 3VPRA 4A3JJ 4HNVA 2ME6A 5JLXA 1VNDA 2O7OA 2X6OA 1BW6A 2E19A 2IEKA 4D5CA 1MBEA 2L7FP 4A3BJ 2DMQA 3GTKJ 1ENHA 2EZIA 2R0QC 1FTTA 3ZOBA 2LY9A 2MSYA 1JKRC 1JJ8C 2VUMJ 3NARA 2QF7A 3O8HA 2DA3A 1T56A 5IPAA 1MH4A 5BNGA 1SFOJ 3UKGA 5F1JA 1HLVA 3JRBA 2HDDA 4A3GJ 4BBSJ 2JJ7A 3A01A 1AHDP 1ZQ3P 2CUEA 4I6ZA 3BR1A 1LE8A 5K7FA 2JWTA 3L1PA 2JA8J 2R92J 3WHBA 5E3LA 4C2MJ 4CYCA 1H89C 2HOTA 3HOYJ 1MSEC 3SJMA 2XB5A 2MW8A 4A93J 5IYDJ 2HOAA 2XPVA 5EG0A 3S1QJ 4MFEA 1RETA 2NVTJ 1G2HA 3TEDA 5F04A 3JRCA 1JKPC 2M2EA 3S17J 3C2BA 2XGEA 1IDZA 2XPWA 1WCMJ 2DA1A 1TWFJ 2GM4A 4UUTA 2NOGA 1OCPA 2I10A 1OJLA 5EDNA 5FKNA 4M6VA 4MIMA 1X2NA 3CQZJ 2R5ZA 4AC0A 4DZPA 3Q0UA 1JGGA 5J1RA 2JA6J 1GT0C 1MH3A 2FD5A 2Y30A 5F08A 3BR5A 2ME0A 4UUSB 1T33A 2DMNA 3FISA 4IHYA 1P7JA 1UG2A 3LNQA 2R5YA 1JUPA 3ZQHA 3HGGA 5GPAA 5E3OA 1SANA 4M3BA 2LKXA 3IH3A 1XS9A 1QVTA 5K7HA 3BG9A 4M3DA 2LD5A 1GV2A 2R7ZJ 3JR9A 4FTHA 1IRZA 1RKWA 3BTIA 1ZR2A 1B8IB 1S7EA 1D5YA 5F0FA 1YRNB 1CQTA 1F43A 3BTCA 3GTPJ 4XIDA 1H8AC 4JP0A 4V2FA 3TP3A 2XSDC 2NVQJ 4A3EJ 2E2HJ 2HQ5A 5C4XJ 1FEXA 2O9LA 1B72B 1B72A 3HKZN 3SFIA 2DMUA 4W1UA 4RBOA 3LSPA 3CMYA 3HEFA 4X6AJ 3IH2A 2FX0A 3BQYA 5M3MJ 4IHVA 1Y1WJ 2O8KA 1RKTA 4C3JJ 4B1RA 3RZOJ 5F0CA 1B8IA 2HI3A 2WV1A 1GVDA 3K2AA 1DU0A 1IGNA 2IAIA 3B6CA 2M8GX 5EZGA 2E1OA 1IDYA 2AHQA 2NVXJ 2D5VA 4EEFG 3BG3A 4X1EA 1ITYA 3HOVJ 4XK4A 2L9RA 1OFCX 1RESA 4MFDA 3ZQLA 1RR7A 3M4OJ 2HXIA 5IP7J 3PO2J 1JUSA 4MO7A 3BR0A 1ZGWA 4FE7A 2ID6A 3H3VK 1DU6A 2VKEA 3F0CA 2DMPA 3LSJA 3JRDA 1BA5A 5C44J 3OSFA 1BL0A 1WH5A 1F36A 3PM1A 4A3FJ 2KT0A 4B3AA 2LFBA 2MG4A 3DEWA 5IP6A 2Y9YA 2DA5A 4DYQA 3K7AJ 1IJWC 1IC8A 1NK3P 1I3QJ 4DYRA 4A3CJ 4ABZA 3HOZJ 1P7IA 1BJZA 4A3KJ 2LLKA 3CDLA 9ANTA 4QIWN 3S2DJ 1ETKA 2IBDA 1TC3C 2XGDA 1AU7A 1JTYA 4D7NA 2X48A 2R5YB 2VI6A 3Q0VA 2VPRA 2EZKA 2LP0A 3HBLA 5EZHA 1QPIA 3LOCA 1ZK8A 3JRFA 4Y7NJ 2N8GA 3S1MJ 4BXXJ 4AUXA 5EF6A 1MBJA 2DTZA 4FE4A 4LOCA 4M3GA 5FKOA 3QPLA 3D1NI 5F0HA
chains in the Genus database with same CATH superfamily
2W57A 1HKQA 1DPRA 3HSEA 2B63J 2XAUA 3WTVC 1X58A 3TO7A 3OYLA 3ESWB 2JRTA 1VQ8I 2NS7A 2VT2A 1A5JA 1IN8A 3OS0A 2TCTA 3HGYA 1WI3A 3A4CA 2FBIA 5JHFA 3VOEA 3KLOA 3U1DA 1FIPA 3HOWJ 1I3AA 1D0XA 2ZNYA 3VYUB 5LD2C 4UUSA 3I4MJ 5KCMA 2R7TA 5J1YA 4BS9A 3H0DA 3CMMA 1IXRC 2VB6A 4Y17A 2R5ZB 1TNSA 3F6OA 2R7QA 3J7AY 3K4NA 4PSWA 1ODDA 2GAUA 2Y2ZA 1J2XA 1QZYA 2LTPA 5H2FC 5ILVA 2ZMEB 3JRAA 4J19A 1D0ZA 3H92A 2Y0MA 4AWXB 2ZMEA 4PJ0C 5JVTA 3CD6I 4XKVA 2V6CA 4HOBA 3WHCA 1WJDA 4M9XA 1UHMA 4DZJA 5D4RA 4G9YA 4U0VA 3P5JA 4Y52J 1MNEA 5D5UB 1FX7A 4IVNA 2OTLI 2VASA 1VQOI 5EGOA 2X1DA 4UY8I 1MDMA 1I1SA 3GBGA 3HL2A 4IPAA 1YYVA 1I6XA 3SZGA 1BM9A 4BDYA 5BS6A 3FXOA 4BKXA 2FJ1A 1QVUA 5JHUA 1OCZH 1WHUA 2NS8A 5TISC 3WTSC 3S15J 1U9OA 2KIFA 4NDLA 1AKHA 4WX9A 3FF5A 5K1YA 5FLXZ 3SEQA 2OQRA 3QYFA 1P4XA 2XGCA 4KA4A 3FK7A 1MNDA 3AL0C 5DTDA 4RDUA 1Z91A 2L7MP 2JQ7A 1JTXA 1Z0XA 2FUG2 3W6KB 2AO9A 1XMXA 2FRHA 1TWCJ 2LBFB 5LFAA 4KIBA 2M0MA 1WJEA 3DCFA 1D8KA 3A03A 1POGA 1TWGJ 3CP8A 2Q0OA 4B44A 2YU3A 3PUBA 1B9NA 3EUHC 1BI2A 1I27A 2F6CA 2HKXA 2DA7A 2EH3A 4XRFA 4LB6B 1ZYRF 1YJWI 2KISA 2CRGA 2KDZA 4C30A 1ZG1A 3H36A 2HOEA 1VQ9I 3RTRA 2EZLA 1RPWA 1APLC 3GEZA 4ETSA 4ZJZA 4A0YA 3FK6A 2KDOA 4V2GA 1WWXA 3V8JA 3DBHB 2ACJA 2DFHA 3FKIJ 3RKQA 2TRTA 2NRAC 3Q0WA 1IZ1A 3CLQA 4FISA 1TBXA 2M7BA 3QPSA 2DN0A 1XGSA 5LRRA 4CCKA 2IGKA 4HV5A 4ANJA 4O6JA 4BJ5C 1D5VA 1LDJA 2ESNA 2OJED 5IOZA 3EUKL 2NYXA 4PCQA 1ZRDA 2BXZA 1ETWA 2DFIA 3CC2I 5K5OA 3E6DA 2BHYA 1OYYA 5KAFC 2MD0A 3IAS2 1T39A 3G4SI 3R60A 4BY7J 3D5SC 3CC7I 2XF5A 3SQNA 5FLMJ 3VYSB 5E8IA 1OMIA 3W6JB 3OYHA 1MNMC 2OA4A 2P4WA 5B5EC 3SZTA 2LF7A 2XAFA 4CZCA 3GFMA 4HYEA 1LFUP 3GXOA 1GHCA 4GRIA 3A01B 2JN6A 3BJAA 2V9VA 1R4MB 3OY9A 1XTAA 2KIQA 2XRNA 2EQRA 1CGPA 1K83J 1D8JA 2QCOA 3Q9VA 4BUPA 3DPLC 4YIIA 5J40A 1GLNA 3H35A 3BR3A 4CZZA 2FMYA 3S14J 1FWZA 4DBQA 2CV2A 1V5GA 3U21A 2E1NA 1ETOA 5IT3A 3OYFA 2LY2A 1WZ2A 2VBZA 1CF7B 1X1CA 1R49A 2I8DA 2M4GA 4I0AA 3BR6A 2AXLA 1FIAA 2H6BA 3F8CA 2HOSA 1XDSA 2D1HA 2YPRA 1WGXA 4KYWA 2LMDA 1HC8A 1D1AA 2JRMA 2YS9A 3LAJA 1FTZA 2ZSHB 3GF2A 4IHWA 3DP7A 3K69A 3ECHA 3KP5A 4XICA 1FBSA 1KQ0A 1NTCA 1H9GA 4AVZA 2K27A 2COMA 4JX6A 2M4KA 1LDKB 2QGUA 2QSHX 4E6KG 1HCRA 4EMSA 3COAC 1MBHA 1JJ6C 1OISA 1S5LC 3TP0A 5EEAA 3W6VA 3ZMVA 4JQFA 4CCLA 1W5TA 3HTUA 3UNGC 2GWRA 5F1RA 2KL4A 3BDDA 2KFDA 3W2AA 4BQQA 4D0PA 3ONQA 5J47A 4L0ZB 3Q3SA 1FY7A 2IA2A 1LE8B 1YRNA 4RB2C 4XLHA 4EATA 1IW7F 3H9QA 3VPRA 3WGGA 4Q48A 1V55H 2QBYA 2X6OA 2WAEA 3F8MA 3F8FA 3B02A 3IWZA 2ZJPF 2IEKA 2QQ8A 2VQLA 3M9AA 3KYCB 4D5CA 2L7FP 1YO5C 1YLFA 2BV6A 1V54H 4A3BJ 1YE9A 3FZVA 2R0QC 2M7AA 1HW1A 4CDGA 4I09A 3ZR8X 4DOZA 1JJ8C 1REPC 2LKPA 1AOYA 4HQEA 5GAEJ 2QWWA 2DA3A 1BR4A 1T56A 2VXZA 4P96A 1MH4A 2M5WA 1QU3A 2CFXA 1SFOJ 1XPXA 4OIPF 2P7VB 2JTVA 3FHNA 2QKMB 2A6TA 1PVEA 2CUEA 4EJUA 4I6ZA 1WJAA 5K7FA 5HLGA 1Q1HA 2Z16A 2H6CA 3L1PA 3ASNH 2UWMA 1X19A 3BCAA 1T0FC 2MYSA 3I59A 5CVJA 4Y33A 1MDMB 3TKYA 2HOAA 3L2WA 5L3EA 2W1OA 5EG0A 1R1UA 1JI8A 1RETA 2KJBA 3GYHX 1G2HA 4I7HA 3OYCA 3ERMA 4P5OA 1BI1A 1R6RA 2EA2A 4EJTA 1KZHA 4ZYDA 1TWFJ 1T0FA 2PN6A 3E1SA 4UUTA 3C2GA 4J01A 2ADUA 1OCPA 1I1GA 3JSOA 5DCFA 3V42A 4R8HA 1OJLA 3DPUA 2NOJB 3K1MA 3S32A 3PFYA 3CCRI 1J9IA 1RUNA 5GTHC 4MIMA 1X2NA 1HKSA 3CQZJ 2R5ZA 4AIHA 2FU4A 3R4KA 3Q0UA 3DV8A 1JGGA 4QWQA 1ZLJA 2FD5A 4BNCA 1W5SA 2ME0A 4UUSB 3OYKA 3VSLA 1T33A 2KRHA 1V3FA 1R5ID 5D5VB 1BR1A 3I55I 1KONA 4AVPA 5LHIA 3TQNA 1QHHD 3BPVA 4XR6A 1WJBA 3ZQHA 2VE9A 5GAGJ 4A2UA 1GVJA 2MC4A 2K4JA 1FC3A 3BG9A 2M87A 1K4TA 3VODA 1P4WA 4L0YB 2R7ZJ 3IP4B 4FTHA 2BHZA 5HVQC 4HX8A 1AA7A 2L7KA 4KMFA 1TQIA 4M9ZA 1F43A 4DQ2A 5TJJA 3ZQ7A 3BTCA 2IGOA 3KZYA 1TQMA 4HX7A 2DDAA 2K7LA 3K4KA 5DD4A 4A3EJ 2E2HJ 1FEXA 3IRRA 1B72B 3HKZN 3ZN0A 4BXFA 3MKZA 4H4KC 4RBOA 2JVHA 2ZXHA 3AKZA 5DCMA 3T0YA 4X6AJ 3MKYB 4IHVA 3FBNB 1Y1WJ 1RKTA 4C3JJ 2VN2A 5LBQA 2R7DA 3RZOJ 2YSRA 1NG7A 3TO6A 3PQKA 3FM5A 1GVDA 1IGNA 2J5OA 4HV6A 4LFUA 2O8XA 1C0WA 1LEBA 4HNUA 2FNPA 1TTYA 2E1OA 2ZJ2A 5GADJ 1D3YA 2DYSH 2WBMA 4TV7A 3MZHA 2D5VA 4EEFG 3MKWB 4XK4A 3N4MA 1OFCX 3ZQLA 4I2OA 1RR7A 4ZH4F 2HXIA 2CSOA 3P9KA 1OLTA 3BR0A 1YS7A 1SFUA 5L3CA 1HXDA 2VODA 3EYYA 3KP7A 2DMPA 3HXLA 2RKHA 3LSJA 1BA5A 5C44J 1WH5A 2MBFA 1J7KA 2KT0A 4B3AA 1FOXA 2O61A 2MG4A 2Y9YA 3KYDB 3O2PE 4PDKA 2QZ8A 3LFUA 1YX3A 1W1WE 3HZJA 3K2ZA 3OYMA 1A36A 4A5MA 3BC8A 4GXOA 5B66C 3CMEI 3DFGA 4QIWN 9ANTA 2Y69H 4R1HA 2CG4A 2JUCA 2Z1DA 2EK5A 1TT5B 1MMGA 3KIOA 1X1BA 4UB6C 2LG4A 4BXXJ 3WTTC 3X2QH 1SFKA 3CJRB 3CP2A 2E35A 5J6XA 1QPMA 4LOCA 4M3GA 2TDXA 3FXMA 4XBFA 3D1NI 5LHGA 2FNAA 3ZCOA 1Z1DA 4LLNA 5IOYA 1AKHB 5GAHJ 5HDGA 3G73A 1FSEA 2E2IJ 1ZR4A 1B4AA 2K9LA 2OPTA 2XVCA 3U1KA 3QOEA 2Y31A 2EFNA 2K02A 4RAYA 3CO7C 4A3LJ 1XGMA 1Z7LA 4KFCA 4MQ9F 3K70D 3JRIA 4NB5A 2K5CA 5FFXA 4XRSA 4EM0B 2K3PA 3PSFA 4GCVA 4A6EA 1FOKA 2XV4S 2JUGA 2DMTA 4A3IJ 5J1UA 1WJFA 1YI2I 3OS1A 4YFXF 3QU3A 2M3AA 3CJQB 3I59B 1PP7U 2VKHA 2ZC2A 2LR8A 5J3LA 1FBUA 2G7HA 3CMAI 1IAWA 2ELHA 2FSWA 5K7ZA 3SDGA 5HLTA 3UR3C 1SD4A 5M3FJ 5EJCA 2STTA 2EPFA 1T38A 2MA3A 3OOPA 4KIFA 3GTOJ 3K4MA 3TGNA 3WTWC 1YJ9I 1XCBA 4RM3A 5C3EJ 1HBXG 1O4XA 3RI4A 3CUQA 2VL8A 1U9NA 2ZSIB 1MW7A 2WY7Q 5LEKA 1WKMA 4ZC3A 2DFFA 5FJ8J 4U7BA 5CVVA 2GIVA 2A05A 2PMZN 3OSGA 2B7EA 3DEUA 4KN4X 3I71A 4FETA 2HNHA 1MIJA 2L3DA 4RGUA 3BQZA 4IQ4A 5FKKA 3LAPA 2BGCA 2XB0X 3A0BC 3MAJA 4RAGA 4Y4RA 2DFEA 1Y6IA 4H0EA 2PI0A 1FLIA 3L2CA 2FEZA 4M3FA 3KEOA 1R7JA 3BWGA 3A0HC 4NC8A 2XROA 1HA8A 4UVAA 4IX7A 2X6XA 4RA2A 2EFPA 2IXSA 2DK8A 4XMYA 5D6FA 3I3LA 5IT9K 4XLFA 4BL0B 2L4AA 1JT0A 2X9DA 5JI6A 4BHCA 3B73A 3AAFA 3WTUC 2W48A 3RZDJ 3AFHA 3M8FA 1MBGA 2EBIA 1HW5A 1SMYF 4CICA 2FBHA 4DYCA 3J7YJ 5TRDA 3IKVA 2W7NA 3D5LA 2YU9J 4C2UA 2XASA 5F6FA 2G9WA 2Q8KA 2NS0A 1X3UA 4NC6A 4DJAA 3WGHA 1IV6A 2QQBA 2DI3A 4E7KA 5D8KB 1W7PB 1JE8A 1TW2A 2DAOA 1IXCA 4MEYF 2CQQA 2HVSA 1R9TJ 4IHXA 4N4OB 3AG3H 2CQXA 1D0YA 1W4MA 3ZMZA 1I39A 2V1UA 4FASD 1FYLA 2F5DA 3S2HJ 4D5FA 3Q9SA 2LVSA 2Y9ZA 3E97A 1W36D 2KKOA 1R22A 2WY8Q 4DBRA 1QHGA 2D1VA 1GXQA 1R23A 2BY1A 3FWEA 2K4BA 4FCYA 4BGDA 3ZGKA 4HQMA 5HS9A 3HUGA 2XHKA 1QZZA 1WSUA 4QPOA 5HLIA 1IRFA 4G6DA 2Z2SB 2WB1N 1JKOC 3VWBA 3EPZA 2HYGD 5IP9J 3GZ5A 1IUFA 1Y8QB 4L18B 3J7ZI 1T8IA 2P5VA 2RVCA 3R6SA 3OIOA 2GLOA 1UJ8A 2CUFA 1GUUA 2HR3A 4EJWA 2ECBA 3N05A 2WV0A 2GXGA 4ITVA 2E1MB 3GFLA 4CYCB 3I4NJ 1XSVA 2JA7J 3E6CC 5BPDA 4CCOA 1S29A 4LITA 3ZPLA 3NRVA 3E5QA 3OYNA 2JMWA 4C3IJ 3EDPA 4IL6C 3HDDA 3S16J 2EIKH 1J75A 3BY6A 3S93A 3F8NA 5C4JJ 1DPUA 1WRJA 1P92A 2R7VA 3F23A 3QRFF 4XRSG 5DM7F 1ETQA 1Y0UA 2WWYA 2CGPA 3AG1H 3PO3J 1I6HJ 1ZG5A 1UMQA 1Z3XA 1TWAJ 2E7XA 1OCCH 2HVRA 1ON1A 4CCJA 4B4CA 1W0TA 2VXDA 1OR7A 5KVRA 3IL2A 3MEXA 2M34A 1GV5A 1F4KA 1ZGAA 2OF7A 1JKQC 3RDIA 4XLNF 1SD5A 2RDPA 1LFBA 4EJVA 4C2TA 2DYRH 4YEJA 5HOOA 4AIKA 3BG6A 2EV0A 2DJIA 2HDWA 3I53A 1WFXA 3IHUA 4BHBA 5HODA 1N78A 2MLGA 4OAYA 1ETVA 4L9VA 3TOAA 1BR2A 1Z21A 5IYBJ 1SFXA 5DS9A 4F55A 2KLOA 3TO9A 1O3RA 3ZRGA 5J8FA 4EGZA 3L2QA 1YQAA 2IS1A 5FKMA 2E5ZA 2WAQN 4YELA 1HDDC 4Y13A 4A3DJ 1QRYA 1NG6A 2RAEA 4ZYEA 4PJMA 4UV9A 2COBA 1AWCA 3PL8A 4P9FA 2ID3A 2NVYJ 4Y15A 2IRFG 2E34A 2CQKA 1MMAA 1SC7A 3HTSB 2FQ4A 1FSHA 2A07F 2UXNA 1O7FA 2K9SA 2KRFA 3MFKA 2LYCA 2QYOA 5JLXA 4OOIA 3EQLF 2PFBA 4HSRA 1MMSA 1VNDA 3PFIA 4JBAA 1DUXC 2DPDA 1FMVA 3AG2H 3K4BA 3WG9A 4MEXF 2EINH 1MBEA 3KYLA 2DMQA 2IA1A 3K4LA 4O3MA 2DPUA 1MD0A 4L9NA 1IUYA 1FTTA 3OS2A 5E17F 1JKRC 2EB7A 2Z99A 2FXAA 3NARA 1YIOA 3EUAA 3PQJA 3ZMTA 1FPQA 3O8HA 3LSTA 1HSJA 2LF8A 2A68F 3L09A 1VQMI 5BNGA 5L3BA 4RM2A 2MABA 1DQUA 3UKGA 1SVMA 3C7JA 3CZ6A 2HDDA 1Y56A 4A3GJ 3ERED 1D1BA 2JJ7A 1UFMA 4GGGA 4I0BA 2V7FA 2R3SA 3LFKA 4PFOA 2JWTA 1UAAA 1VTNC 1S72I 3BCBA 1IRXA 2O0YA 2EA4A 4CYCA 2HOTA 3RPUD 2E1CA 3H3ZA 2V4JC 4A93J 2ZXWH 5IYDJ 4V19K 4MFEA 1FZPB 3IRQA 2NVTJ 4M73A 4GO1A 1YFHA 2H27A 1G8XA 2QQAA 3F72A 3RSNA 2R7XA 4ZDLA 3C2BA 1IDZA 1A6QA 2VQHA 2NOGA 3CLOA 2DXIA 3QAHA 1RC9A 1MJ9A 2I10A 2JT1A 3HUGB 1PP8F 3HOTA 1XMAA 2CW8A 3RYPA 3HJEA 5A2QZ 4UUVA 3OIPA 3QOPA 1EJ9A 5E8GA 2HQRA 1BOBA 4M6VA 1ZGJA 4ZZDA 2L01A 3J80Z 4HLXA 4P1WA 1GT0C 2M8EA 3PNTA 1UCRA 2WB1A 4CHUA 3GFJA 4OAZA 2XGXA 4BEHB 3FMQA 5LEJA 4OU0A 1UG2A 3LNQA 2QENA 1B59A 1V5EA 3FX3A 3U2RA 4UVCA 2R5YA 1VQ5I 3F9KA 1KYZA 2YR2A 2K85A 2KHMA 5GPAA 3LMMA 3QODA 2V6EA 3HSRA 2LKXA 5K7HA 4U0YA 4M3DA 1GV2A 2KIMA 1IRZA 2VLAA 3DU5A 3QU6A 4E7ZA 3H9JA 2QLZA 1B8IB 3FMRA 1S7EA 3QPTA 4RAZA 1O3QA 2XAJA 1D5YA 3I56I 1YRNB 3OYAA 3F22A 3GTPJ 2A3SA 4JP0A 1WJCA 1RI7A 4LG0A 4B47A 4KNYA 2NVQJ 4RB1A 1LB2A 2M45A 1G3WA 2E1MC 1ZLKA 3HIFA 3LA2A 3BPXA 3RYRA 3OYGA 1SEUA 1BC8C 3KP6A 3BQYA 1BOAA 1YOVB 3TMOA 3PJRA 4CGZA 4BQAA 2QEXI 5F0CA 1B8IA 2HQAA 3MWMA 3ISPA 3DU6A 4RB0A 1DU0A 3KZIC 1GXPA 4WXDA 4FQGA 5EZGA 1IDYA 2RN7A 1SD7A 1WQ2A 2XF7A 5B1AH 2HTSA 1U5TB 4X1EA 3C2HA 3OV8A 2H94A 3I58A 2HWVA 5IP7J 1T08B 3PO2J 1JUSA 2E36A 1DU6A 4FE7A 1OR7C 2OCCH 1QBJA 3VB2A 4PJJA 3JRDA 3OSFA 2R7FA 1F36A 2HQNA 5CJ9A 4A3FJ 4CSWA 3JAMK 1Z6RA 2LFBA 2ZXJA 3DEWA 2MH2A 5D5XB 1DP7P 1IJWC 1EH7A 1NK3P 4GYIA 1I3QJ 4ESFA 5KNLA 4A3CJ 5B1BH 2VJIA 1P7IA 1SVOA 1IO2A 1PUEE 1BJZA 5E20A 2EIJH 2LLKA 3CDLA 4IOCF 2L2OA 4FHTA 4Q47A 4B48A 1ETKA 3GFIA 4LJZF 1AU7A 4II3A 5HNFA 3U9GA 2PBIA 4LLLA 2VI6A 1IN5A 1KU3A 1B6AA 2GOXB 3BLYA 4UHTA 4EVIA 4E7LA 3DLAA 1XDUA 3JSPA 4FE4A 3CCQI 2VC1A 1S6LA 1E17A 1LEAA 5FKOA 2RNJA 3R0AA 4F3QA 2KPMA 2Z3YA 3HSFA 5F0HA 1S7AA 2H1KA 3MD2A 2ESHA 4KT5C 1O57A 3WTXC 3H9GA 4AYBN 1VQ7I 4IEJA 4G7ZF 4XRMA 2KZVA 1A04A 2LREA 2M0CA 2M9HA 1XG1A 2P6TA 1DGRM 4XOPA 4N4NB 4RGRA 2ECCA 3LSHA 1XCVA 4BY1J 3LA3A 1BBYA 1WH7A 1X3WB 2K9QA 3HC7A 2E2JJ 3HOSA 3BTLA 4IRGA 5CLSA 2GOMA 4I76A 5FLXK 1YTYA 2EFOA 2ELKA 2VJJA 2F48A 3WU0A 3RKXA 1ZELA 2AQEA 4ZDPA 3DKWA 1MBFA 1Q1VA 4XKBA 2IS4A 3BT9A 3QQAA 1XSDA 1Z6TA 2GQQA 2VE8A 5FB2A 5CKTA 4IZZA 3GLXA 2K40A 1A35A 1R5GA 4XNFA 3VYTB 2JPBA 2OTJI 1FBQA 3HPHA 2BZTA 1Y1VJ 2CYYA 3S3MA 4JX5A 1UG0A 3E3VA 4JOMA 3E5UA 4IO9F 3BTJA 3GO5A 4C3HJ 4DNCA 1N77A 1EKEA 5H20A 2Y75A 1ULYA 3P7NA 4LD5A 1JUMA 4JX4A 2CV1A 3H0GJ 5GP9A 4OIOF 2HZTA 3RKYA 4FX0A 1E0EA 3I9V2 2ZMEC 2LDUA 3JW4A 5M5XJ 3OYIA 4U7DA 3LL7A 3A1YA 3RPQA 2EV5A 3OYBA 1VQLI 2EJRA 2OC6A 2QA4I 5IYCJ 1HOMA 2DDBA 3TW6A 3E6MA 1K78B 2K9NA 5DUKA 2W25A 2GBYA 4YIRX 4JK1X 2CS3A 5ICGA 2MGQA 2P81A 1BIBA 2NAZA 3MZ8A 1YIJI 3S1RJ 2HFHA 4A5NA 2JA5J 4RS8A 5M5YJ 1A6IA 3CUQC 5E79C 3PIPF 3C18A 4RLFA 2ZJQF 2BOLA 4IF4A 4B43A 2OZUA 1U78A 4P55A 4RLQA 1PJRA 2VJ5A 2EZHA 4ZTFA 4M6XA 3OYJA 4RAFA 2PLYA 4RGXA 3LSMA 4XKCA 2BY3A 5GTIC 2CWEA 1LDDA 1O3TA 3GTGJ 3H5RA 4ZYGA 3DEEA 2X4HA 4M72A 3EYIA 4ESBA 4OIRF 1Y8RB 1P6RA 3CCMI 2RC4A 4LIVA 2PMZA 4XN3A 2RQQA 3S8PA 1I5ZA 3HYIA 2NVUB 4DGWB 1U0JA 2L0KA 3OMYA 1WI9A 1NH3A 1IN6A 4S05A 3FIWA 2Q2EB 3CCSI 1IN7A 3FM3A 5EYRA 2DQRA 1U3EM 1L0OC 5CPRB 3PSIA 2UZKA 4WF2A 2ZKZA 3O6BB 2CU7A 2OU2A 3CDIA 3K0LA 2G7UA 3BZKA 4EM2A 3HOXJ 5M5WJ 5HS7A 5ICFA 2ZNZA 1TQPA 5FKLA 3A2KA 1XN7A 4OMYA 1XMKA 2W82A 3RQIA 3BZ6A 3DQVC 3JTHA 1K79A 3RJPA 3IV5A 3CJTB 3KX2A 1J5YA 2YUSA 1SVLA 3ABTA 5EG0B 1FP2A 2QQ9A 2KJCA 5FROA 5AONA 4LG0B 1BW5A 2FQ3A 3C1DA 3G2BA 3JREA 3J7AO 1KA8A 1W7PD 3TBIA 1UHSA 3BP8A 5K5QA 4Z2YA 5E1ZB 3F3XA 1VFCA 3KEQA 4GYGA 2WADA 2G0EA 2VC0A 4XLPF 2F5EA 3ZN1A 1ETYA 2L7ZA 1USSA 3OR2C 4NQWB 3BG5A 6PAXA 1TLHB 3ECOA 4G94A 1LNWA 1JT6A 3AG4H 4BQOA 4DIQA 2V9PA 3HM5A 3G1MA 1HDPA 1PUFB 2PX9A 2Y0SN 2IJLA 1BI0A 1R71A 3DPTA 2XC7A 4HDUA 2O6GE 2F5VA 4CYDA 4BU2A 1G4DA 1LJ9A 5JFRA 2BYVE 2PJRA 1ZARA 3LQRA 3LA7A 4YRVA 1OYWA 4EV0A 4LB5A 5DUIA 3GTMJ 2VBYA 1R1TA 5L3GA 3K1NA 1UHWA 2HTJA 4HSTA 3WE2A 3V8KA 3I5UA 1IG7A 3HOUJ 1XGNA 1U8BA 1T98A 3ZQIA 2ZBKA 1FYMA 1IN4A 3BJ6A 4N9IA 1ZRCA 1ACIA 2UV1A 1J59A 2BE5F 2Q2EA 2D45A 1MMNA 5FRNA 2LC2A 4F92B 3OL4A 2L54A 1RR8C 5FRMA 3FXLA 3E0JB 4HF0A 4KDPA 4IHSA 2IVMA 3J81K 4FX4A 4F93B 2NNYA 3ABKH 3HRUA 1QNTA 4ENKA 2IS2A 4XN0A 4G12A 4ENJA 2DT5A 2I5UA 2CW7A 4XLCA 2CW0F 4HDVA 1X1AA 2OD5A 4ZZLA 3L2RA 2W84A 2H8RA 1G6NA 3S2WA 3KP4A 3H5NA 3IWFA 4D9JA 2OCEA 3JTGA 1OCTC 3CCVI 1YS6A 2HXOA 2V1XA 3DTIA 1QA6A 4WXCA 5E3MA 1JHFA 4HAMA 3ABUA 1VQ6I 4KIGA 2OZ6A 1HQCA 3LSIA 2ZFWA 1SFEA 1P2FA 2XAGA 2ME6A 1ON2A 1BW6A 2FE3A 2X1EA 2E19A 1V4RA 2NXNB 3FXUA 2BEOA 4OMZA 3F21A 1JGSA 1SAUA 2JVGA 4G8XA 5EEHA 3GTKJ 3O3KA 5ILSA 4IRIA 2K3FA 3DBLB 1USTA 3G6EI 1G59A 4KJZA 2LY9A 3W2VA 2MSYA 2XSJC 4G7HF 2VUMJ 1N75A 5DDGA 4YG2F 3EETA 1HKTA 2A6HF 3P9IA 4LK1F 1T2KA 2BW3A 5IPAA 3ZQQA 3M1CA 2IT0A 1ZHFA 5F1JA 4PK4A 3JRBA 4NBQA 4NUBA 2X0LA 2EFWA 4BBSJ 3CF5F 3A01A 1ZQ3P 1AHDP 3K4JA 5LRSA 5JR3A 4OWRB 1W5CC 4WXHA 4HRIA 3IAM2 4BJTA 1OKRA 5EEGA 2WC2A 1M1EB 2M30A 3IC7A 2LRDA 2JA8J 2R92J 4NNJA 5E3LA 4C2MJ 2WAQA 3HOYJ 1MSEC 1E3HA 3SJMA 5L3DA 2XB5A 3MZYA 1MMDA 4P9UA 3S1QJ 4ON0A 3TEDA 3S3OA 5F04A 3ABMH 3DKXA 3LSKA 1JKPC 5L3FA 1SMTA 4ZYHA 2XGEA 3CC4I 1WCMJ 4CH7A 2DA1A 5F64A 2GM4A 3MMYB 2MD5A 2EV6A 4OIQF 3WU2C 1B1BA 5H6RA 5CVRA 4A6DA 2FA5A 5BQTA 2DW4A 2RNGA 3FDYA 3M7GA 5KK1A 2WTEA 2GXBA 4XKWA 5DYMA 1KGSA 4AC0A 4DZPA 4MHGA 5E18F 3ULQB 2ZFUA 3DTKA 4PZJA 2JA6J 1Z7UA 3HPGA 3FMSA 1P4AA 1F9NA 4UNOA 1T95A 2LY1A 3WTYC 3FISA 4IHYA 3PNVA 4LLGF 3C3WA 3QYEA 4N0BA 3TDZC 2V79A 1G3YA 4HX4A 3K4CA 1U6GA 3HGGA 3VSKA 4WCGA 1K6OA 2A69F 1KQ8A 2PMHA 4M3BA 2Z9OA 2MC3A 3DLLF 1S8NA 5D4SA 1XS9A 5CQEA 2LD5A 3JR9A 4EQQA 1YJNI 4NHJA 2FBKA 1FP1D 1DDNA 3QP6A 1H9TA 3HG9A 4ENNA 2R7OA 1H8AC 2F2EA 3TP3A 2FF4A 5DCMB 4HBLA 1R58A 2ZXIA 2PMUA 4MTDA 3Q5FA 2PJPA 3K9TA 5C4XJ 2HQ5A 2XKPA 2O9LA 2X51A 1B72A 3SFIA 2DMUA 3DWLE 3FKJA 4HEA2 2LKSA 2UXXA 1YW7A 1KU2A 1OQYA 1LVAA 2X1CA 5M3MJ 4XSXF 5AIQA 2O8KA 2RQPA 2VONA 3CJNA 2HKOA 2JZYA 3FXJA 2KZGA 1LVKA 2DK5A 2DOAA 2F5CA 2OV7A 2X6YA 2XIGA 3CF2A 2VQCA 4IRHA 4F91B 3K2AA 4HLYA 1LPQA 2DTRA 2IAIA 3B6CA 2L9NA 2M8GX 4XSZF 4BXUA 1K7AA 2NVXJ 3PUFA 4XONA 1FMWA 1ZN2A 3BG3A 4UB8C 5K5RA 1ITYA 2DT6A 3HOVJ 3VFZA 2DU9A 4A0ZA 2JPCA 1RESA 2JSCA 1X1DA 2VBXA 1NHAA 1O3SA 2C6YA 2VKDA 3H3VK 1ZGWA 1X4OA 2ID6A 3KCCA 2P5KA 1LUJB 3GWZA 4BDZA 1FYKA 3ZP5A 4Q5SF 1W7PA 1BL0A 4EJOA 4HNTA 4BYYA 5A2QK 4U88A 2CUJA 1S7OA 3K70C 4AYBA 2BBYA 2UUZA 2B0LA 2DA5A 4DYQA 5ED4A 1S3JA 4CA0A 2QM3A 1LKXA 1IC8A 4DYRA 4Q4ZF 5D5WB 4PJNA 2Y0SA 1Z05A 3L2VA 2GXAA 4AD9A 2R4GA 1X3ZB 3HKZA 3NEUA 4PJLA 4CCNA 2IBDA 3CCJI 2XGDA 4KT6A 2A5YB 2F5FA 4D7NA 1Y39A 2MFZA 2X48A 3Q0VA 2EZKA 2LP0A 5EZHA 3ZMSA 1QPIA 4IHTA 1ZK8A 4KMUX 3JRFA 2XUBA 2N8GA 2ELJA 1MBJA 2DTZA 3L9FA 3F8BA 3GX4X 3QPLA 1XX5A 2E71A 3OR1C 5FD6A 2X6WA 1P9QC 1ZG3A 1HF0A 3K6GA 1E3OC 2YX7A 3PNYA 1TP4A 4B09A 3GTJJ 2CFOA 2XAQA 3IUOA 3MN2A 3O8GA 5DV5A 2EWNA 2DLLA 2L9SA 5J4VA 2W24A 3G1LA 1IF1A 1G3TA 3OYDA 5H6QA 1TW3A 5KHDA 3RKWA 4YIFA 4AIDA 4O5VA 4WWCA 1RZ4A 4UVBA 2KMUA 3HB9A 4HW0A 2QSGX 3T1BA 2L5QA 4WK8F 4JYKA 3H3UA 1VQPI 3CCUI 2VQGA 2RV8A 3FBIB 5GPCA 2CV0A 4E70A 5E3NA 4AM3A 3GTQJ 1VQKI 2BXYA 5DEQA 4D7MA 1VF9A 3E6BA 3V7SA 3WODF 4M74A 2E7WA 2BW3B 3D0SA 3EUHA 2Y48A 2V1DA 2H09A 4RGSA 5FGMA 4M3EA 2W4SA 2WA0A 3W2WA 4XLAA 1VI0A 4G7OF 3HRTA 4IQJA 2WAFA 3E7LA 3GCMA 1T6SA 2PEXA 1O7LA 2P6SA 3TL4X 4A69C 1R36A 4M71A 3JCUC 2XAHA 1FJLA 2DO7A 3WE3A 4F7ZA 4GFBA 3DTEA 2E5NA 4J00A 1L3LA 1DGWY 2B9SA 1IV8A 2AS5F 4C9YA 4S04A 1MZBA 5IY5H 3OL3A 2E60A 2DCEA 4KUMA 2DA2A 2L4MA 4XL9A 4E7SA 3NAUA 3WU1B 4U87A 1EA3A 3FXRA 5D6EA 4CCMA 3S1NJ 3LQQA 2JK3A 1CF7A 2ISZA 1Z67A 2MLKA 1KU9A 4L5EA 5E1XA 1EH6A 3K10A 1TWHJ 3TW7A 2IA0A 1ZKGA 3ZQFA 2LOOA 5LGNA 3GZ6A 1Z3YA 1VZ0A 4RMNA 2JA2A 4LG3A 5BPIA 4OINF 2R93J 3ZQGA 5ILUA 5JLWA 2R7RA 1FOWA 3BR2A 3KETA 4LIUA 2BY2A 4G6QA 1BC7C 2ETHA 4I01A 3MQ0A 1ETXA 2L02A 3DBRB 3FXKA 2FOWA 5D8LB 3JRGA 4A3MJ 1UZCA 3LSGA 1OCRH 3CCYA 3WG7H 4ASNA 2XRLA 3TOBA 2J5PA 1KQ9A 3ZXSA 1WJ5A 4ZDOA 5CVUA 2PJRB 1VQ4I 2ZB9A 1IXSB 1R00A 5J8CA 3R0JA 2IP2A 1WPKA 4XORA 1MKMA 2HYJA 1FOYA 2VKVA 4KN7X 4XLEA 1PUFA 5FLVA 2W00A 3E5XA 3IH4A 5CQGA 2HPMA 2H1LA 3DF8A 3ZMDA 2VOOA 1XC5A 5CYVA 3FXQA 2QKLB 3ASOH 3NWTA 1ZH5A 5IT9Z 2DJNA 4DW6A 3V8LA 2P5LC 4CXFA 2QSFX 3GMEA 2HZDA 3A02A 3VDXA 2L9VA 2BVLA 5HLHA 3L7WA 2K86A 4BACA 3NWSA 2Z33A 4L5IA 2Z5UA 1GDTA 2OBPA 3HRSA 5E1WA 4FT8A 4R79A 1Z77A 1HW2A 3JRHA 3OYEA 3T5XA 3IKTA 1K61A 2O3FA 2PG4A 3H5AA 4YFKF 3QPHA 2V26A 3LWFA 1ZTRA 3KE2A 4BJ6C 4MLOA 1ORKA 4S0HB 1V5FA 3MKLA 2CJJA 2DA6A 5LLQA 4XOTA 5HS8A 4E7IA 1PDNC 2A61A 1X2MA 3BJOA 4HG2A 3QWLA 5J4YA 3F6VA 5F27A 2P0WA 3CDHA 4KISA 1SAXA 4M9SA 2F4OB 2O5RA 4IJAA 4NC7A 3GTLJ 3K1PA 4MTEA 3W3CA 2EIMH 1EF4A 4L5JA 2FMLA 3SXYA 1FT9A 1YW8A 2YX4A 5CVIA 1D1CA 2IPQX 1H0MA 4BEHA 4GDFA 1BJAA 2ZJRF 1TL8A 1MSFC 4B3XA 3M1EA 3ZQCA 2IGNA 1JXSA 4B8XA 2O03A 4I98B 4X0GA 1H88C 3CUQB 4IOAF 1YW9A 2LH9A 2M1BA 4HZFA 5LGTA 3PIOF 2HS5A 2HYFA 2R7SA 3SEZA 4I02A 4XM3A 2LK2A 4W97A 4MGRA 4EGYA 4QTRA 3OOUA 3TDUC 2XDVA 1I50J 1MBKA 2OAZA 2STWA 3KPHA 2AXTC 2EILH 2HEOA 2XF6A 1F1ZA 1BI3A 3B6AA 4E7HA 3MCZA 1RRJA 1W0UA 1NK2P 1Z9CA 1YG2A 3VYRB 1RNLA 3G1OA 4QSHA 5EGOB 2IW5A 5DD8A 2CQNA 4BE2A 4BBRJ 2DA4A 2MH9A 2KIUA 3CTAA 4A0XA 3CO6C 4AIJA 1YX5A 2FOKA 1K78A 2NNNA 3V7RA 1KYWA 3LSRA 1E3PA 2LSOA 2XPUA 2ISYA 1LFPA 3M3YJ 1HSTA 3MVPA 3WGIA 1W36C 1N25A 4BQNA 4A3JJ 2ICWG 1U5TC 4HNVA 2XKOA 3ABLH 2HPIA 4MNUA 1X1PA 1S9HA 2O7OA 4M6YA 1R1VA 1F5TA 4HPQA 4HF2A 2DOEA 3GVAA 1TZLA 2GA1A 1STZA 1ENHA 2EZIA 4BH9A 1Y0NA 3BZCA 3NQOA 1YHQI 3ZOBA 4LGWA 5FD5A 5HNHA 5KAIC 4RB3C 3ROUA 3DKYA 3ML6A 2QF7A 2A6EF 3S3NA 1G3SA 2GA2A 2RGVA 4PFPA 5LGUA 4CO8A 3D5RC 1R4NB 5AIPA 2GIZA 4QLCU 1HLVA 2OQGA 3KLNA 3FHZA 4BAYA 3M8JA 2R7WA 1XSXA 5DM6F 3RIRA 1LE8A 3BR1A 2RREA 1X4PA 3I0TA 3RCOA 2CH0A 3L00A 4BE1A 1OPCA 2CO5A 1KU7A 3ZMUA 4XQFA 1ZAOA 2BVMA 3WHBA 1H89C 1A31A 3T8RA 4AU7A 1XB4A 2ZCWA 3SZPA 2VJ4A 1QQIA 3BROA 2MW8A 4ENMA 1ONVA 2XPVA 5FO5A 2F4IA 2R7UA 3V4GA 3L2UA 3VEPA 2PQ8A 1QGPA 3JRCA 2M2EA 3S17J 1UELB 3G71I 2XPWA 1MJAA 3GLLA 1FNNA 3BG7A 4UV8A 1QO0D 3CCLI 4A12A 1TT0A 5ERIA 4HA8A 4L9TA 5EDNA 5FKNA 2VOPA 2CQ7A 3H1CA 3GZNB 4K2EA 3KFWX 3SFZA 4KITB 2K9MA 4N9HA 5J1RA 2QVOA 1MH3A 2QUFA 1UB9A 2Y30A 3M8EA 2CMPA 3BR5A 5F08A 2DMNA 3GUDA 1P7JA 1TNTA 2DODA 3ELKA 2VT3A 1JUPA 1RIOH 5B3SH 3R61A 1OCOH 3I54A 5E3OA 5ICCA 3G3ZA 1SANA 1ZRFA 3IH3A 1QVTA 3QYBA 3HRMA 2JSPA 3CUOA 3T8TA 1K6YA 1RKWA 2VIXA 3BTIA 2D2WA 5BMZA 1ZR2A 2HDCA 5HDKA 4EM1A 1OYIA 3HHHA 3KEYA 4UXNA 5F0FA 3DXJF 1CQTA 1ZREA 4XIDA 3N97A 4V2FA 1XD7A 3JAMZ 1EH8A 3GW2A 2XSDC 2VBWA 3AL0B 3REOA 3M07A 1EV7A 3P9CA 5FFZA 5LHHA 4W1UA 4Y3OA 5HDNA 5BOXA 1B9MA 4U0WA 3LSPA 3CMYA 3HEFA 1QZEA 3SYTA 3WTZA 3IH2A 2FX0A 3QP5A 3KP3A 1YITI 1LQ1A 1U5TA 3SDBA 4LMYA 4Z6YA 4B1RA 3BOQA 3J81Z 2DBBA 2Q1ZB 2HI3A 4MQVA 1JHHA 3CESA 2WV1A 4ESJA 4PSXA 2DT7B 3RPUA 4E7JA 2KQRA 1DP3A 1J09A 1U2WA 1SD6A 3OIQA 4F52A 4G6TB 1R5HA 4ZYAA 2AHQA 2P7CB 2LNBA 3RQ4A 3KZZA 3V7CA 1ERDA 2L9RA 4MFDA 1XGOA 3M4OJ 2CUZA 3KP2A 2DOFA 2VPLA 1J0RA 2X85A 4BE0A 2OUMA 3SHFA 4MO7A 3J80K 4E4HA 4ZTJA 2VKEA 3F0CA 4QPQA 2GZWA 4IXAA 1E2XA 3PM1A 2HVQA 5TGTA 3OWTA 5ICEA 1WVRA 5IP6A 4NQWA 1BIAA 4D1QA 3K7AJ 2P8TA 4II2A 4BHPA 1K4SA 1BN5A 2IGMA 2AQFA 3HHGA 4PGHA 4ABZA 1MJBA 3HOZJ 2BY0A 4CUGA 1VQNI 4A3KJ 3I64A 4I99C 5JVGF 3S2DJ 1U8RA 2H8WA 2W85A 2F4MB 1TC3C 2A5WA 2LBFA 1JTYA 1MGTA 2R5YB 3I4PA 2V9KA 2VPRA 3HBLA 4KICA 4PUSA 3LOCA 2HU9A 2V1NA 4L9JA 4YFNF 2KP6A 4PGGA 4IKFA 4Y7NJ 3S1MJ 4HF1A 1PYVA 4AUXA 4LK0F 2KRCA 5EF6A 3CCEI 2EFQA 2ZO4A 1RUOA 2DQLA 1IRGA 2HGCA 2IS6A 2QBYB
chains in the Genus database with same CATH topology
5IOYA 1AKHB 2H1KA 2E2IJ 1ZR4A 1HF0A 1E3OC 2B63J 1X58A 4AYBN 3GTJJ 2OPTA 4IEJA 2NS7A 2Y31A 3MN2A 4XRMA 3O8GA 4A3LJ 1A5JA 2TCTA 2M0CA 3HGYA 1WI3A 2M9HA 1XG1A 3G1LA 3JRIA 4XRSA 1FIPA 3HOWJ 2ECCA 4BY1J 2E2JJ 1WH7A 2K9QA 2DMTA 4A3IJ 5J1UA 4UUSA 3BTLA 3I4MJ 5J1YA 4I76A 3HB9A 2ELKA 2R5ZB 2LR8A 4JYKA 5J3LA 1MBFA 1Q1VA 5K7ZA 2Y2ZA 2LTPA 3JRAA 3SDGA 4J19A 5GPCA 5M3FJ 5E3NA 3BT9A 3QQAA 3GTOJ 3GTQJ 4D7MA 1VF9A 5C3EJ 2K40A 1O4XA 3WHCA 4DZJA 1Y1VJ 1U9NA 4Y52J 4JX5A 4M3EA 5EGOA 5FJ8J 3BTJA 1VI0A 4C3HJ 3GBGA 3E7LA 2PMZN 3OSGA 1JUMA 4JX4A 4A69C 3H0GJ 1FJLA 3BQZA 5GP9A 5FKKA 4BKXA 2FJ1A 1QVUA 4GFBA 2XB0X 4M3FA 5M5XJ 2NS8A 3S15J 1U9OA 4NDLA 2DA2A 1AKHA 3NAUA 5IYCJ 1HOMA 2XGCA 3FK7A 3TW6A 5DTDA 3S1NJ 2K9NA 4RDUA 2JK3A 2L7MP 1JT0A 2X9DA 2GBYA 4L5EA 1JTXA 1Z0XA 2W48A 2AO9A 1TWHJ 3TW7A 3RZDJ 1ZKGA 1TWCJ 2MGQA 3ZQFA 1MBGA 2EBIA 2P81A 3DCFA 3A03A 1POGA 2YU9J 4DYCA 2R93J 3ZQGA 3S1RJ 1TWGJ 5JLWA 2JA5J 5M5YJ 1A6IA 2DA7A 2EH3A 3BR2A 1U78A 2EZHA 2CRGA 2KDZA 1IV6A 1ETXA 3JRGA 4A3MJ 2EZLA 1RPWA 3GTGJ 1APLC 3LSGA 2CQQA 4IHXA 3CCYA 1R9TJ 2XRLA 3FK6A 2CQXA 4V2GA 3S2HJ 4D5FA 3FKIJ 2LVSA 2Y9ZA 3RKQA 2TRTA 2ZB9A 3Q0WA 4FISA 2L0KA 1WPKA 2VKVA 2HYJA 2DN0A 3QPSA 1PUFA 3FIWA 5FLVA 3IH4A 5EYRA 4FCYA 1XC5A 5IOZA 2DJNA 1ETWA 4DW6A 2CU7A 3HOXJ 5M5WJ 3A02A 5FKLA 2WB1N 1JKOC 3RQIA 5IP9J 1IUFA 3IV5A 1GDTA 3OIOA 4BY7J 2GLOA 2CUFA 1GUUA 1Z77A 2YUSA 3JRHA 1K61A 2ECBA 5EG0B 5FLMJ 1ZTRA 1BW5A 4MLOA 1ORKA 4CYCB 3JREA 4S0HB 1MNMC 2JA7J 3MKLA 3I4NJ 2CJJA 1UHSA 2DA6A 1VFCA 1LFUP 3A01B 1X2MA 2JMWA 4C3IJ 2G0EA 2JN6A 3HDDA 5F27A 3S16J 1ETYA 5C4JJ 2L7ZA 3BG5A 4XRSG 2EQRA 3GTLJ 1K83J 1ETQA 2QCOA 1JT6A 1EF4A 3HM5A 3G1MA 1HDPA 1PUFB 2Y0SN 3BR3A 3S14J 3PO3J 1I6HJ 1UMQA 1TWAJ 1ETOA 4B4CA 1W0TA 1MSFC 2M34A 3ZQCA 1GV5A 3BR6A 2OF7A 1FIAA 1JKQC 2HOSA 3GTMJ 1WGXA 1H88C 1LFBA 2YS9A 1FTZA 1IG7A 3HOUJ 2LK2A 4W97A 4IHWA 1U8BA 4QTRA 3OOUA 3ZQIA 4XICA 1NTCA 5HODA 1I50J 1MBKA 1ETVA 5IYBJ 5DS9A 4JX6A 3B6AA 1HCRA 1W0UA 1MBHA 1JJ6C 1NK2P 3TP0A 5EEAA 3W6VA 3G1OA 4QSHA 5FKMA 5EGOB 2WAQN 4G12A 1HDDC 4A3DJ 1QRYA 2RAEA 4BBRJ 2COBA 2DA4A 2ID3A 2NVYJ 2H8RA 3Q3SA 3LSRA 2FQ4A 2XPUA 1LE8B 1OCTC 1YRNA 2HXOA 3M3YJ 5E3MA 3MVPA 2K9SA 3VPRA 4A3JJ 4HNVA 2ME6A 5JLXA 1VNDA 2O7OA 2X6OA 1BW6A 2E19A 2IEKA 4D5CA 1MBEA 2L7FP 4A3BJ 2DMQA 3GTKJ 1ENHA 2EZIA 2R0QC 1FTTA 3ZOBA 2LY9A 2MSYA 1JKRC 1JJ8C 2VUMJ 3NARA 2QF7A 3O8HA 2DA3A 1T56A 5IPAA 1MH4A 5BNGA 1SFOJ 3UKGA 5F1JA 1HLVA 3JRBA 2HDDA 4A3GJ 4BBSJ 2JJ7A 3A01A 1AHDP 1ZQ3P 2CUEA 4I6ZA 3BR1A 1LE8A 5K7FA 2JWTA 3L1PA 2JA8J 2R92J 3WHBA 5E3LA 4C2MJ 4CYCA 1H89C 2HOTA 3HOYJ 1MSEC 3SJMA 2XB5A 2MW8A 4A93J 5IYDJ 2HOAA 2XPVA 5EG0A 3S1QJ 4MFEA 1RETA 2NVTJ 1G2HA 3TEDA 5F04A 3JRCA 1JKPC 2M2EA 3S17J 3C2BA 2XGEA 1IDZA 2XPWA 1WCMJ 2DA1A 1TWFJ 2GM4A 4UUTA 2NOGA 1OCPA 2I10A 1OJLA 5EDNA 5FKNA 4M6VA 4MIMA 1X2NA 3CQZJ 2R5ZA 4AC0A 4DZPA 3Q0UA 1JGGA 5J1RA 2JA6J 1GT0C 1MH3A 2FD5A 2Y30A 5F08A 3BR5A 2ME0A 4UUSB 1T33A 2DMNA 3FISA 4IHYA 1P7JA 1UG2A 3LNQA 2R5YA 1JUPA 3ZQHA 3HGGA 5GPAA 5E3OA 1SANA 4M3BA 2LKXA 3IH3A 1XS9A 1QVTA 5K7HA 3BG9A 4M3DA 2LD5A 1GV2A 2R7ZJ 3JR9A 4FTHA 1IRZA 1RKWA 3BTIA 1ZR2A 1B8IB 1S7EA 1D5YA 5F0FA 1YRNB 1CQTA 1F43A 3BTCA 3GTPJ 4XIDA 1H8AC 4JP0A 4V2FA 3TP3A 2XSDC 2NVQJ 4A3EJ 2E2HJ 2HQ5A 5C4XJ 1FEXA 2O9LA 1B72B 1B72A 3HKZN 3SFIA 2DMUA 4W1UA 4RBOA 3LSPA 3CMYA 3HEFA 4X6AJ 3IH2A 2FX0A 3BQYA 5M3MJ 4IHVA 1Y1WJ 2O8KA 1RKTA 4C3JJ 4B1RA 3RZOJ 5F0CA 1B8IA 2HI3A 2WV1A 1GVDA 3K2AA 1DU0A 1IGNA 2IAIA 3B6CA 2M8GX 5EZGA 2E1OA 1IDYA 2AHQA 2NVXJ 2D5VA 4EEFG 3BG3A 4X1EA 1ITYA 3HOVJ 4XK4A 2L9RA 1OFCX 1RESA 4MFDA 3ZQLA 1RR7A 3M4OJ 2HXIA 5IP7J 3PO2J 1JUSA 4MO7A 3BR0A 1ZGWA 4FE7A 2ID6A 3H3VK 1DU6A 2VKEA 3F0CA 2DMPA 3LSJA 3JRDA 1BA5A 5C44J 3OSFA 1BL0A 1WH5A 1F36A 3PM1A 4A3FJ 2KT0A 4B3AA 2LFBA 2MG4A 3DEWA 5IP6A 2Y9YA 2DA5A 4DYQA 3K7AJ 1IJWC 1IC8A 1NK3P 1I3QJ 4DYRA 4A3CJ 4ABZA 3HOZJ 1P7IA 1BJZA 4A3KJ 2LLKA 3CDLA 9ANTA 4QIWN 3S2DJ 1ETKA 2IBDA 1TC3C 2XGDA 1AU7A 1JTYA 4D7NA 2X48A 2R5YB 2VI6A 3Q0VA 2VPRA 2EZKA 2LP0A 3HBLA 5EZHA 1QPIA 3LOCA 1ZK8A 3JRFA 4Y7NJ 2N8GA 3S1MJ 4BXXJ 4AUXA 5EF6A 1MBJA 2DTZA 4FE4A 4LOCA 4M3GA 5FKOA 3QPLA 3D1NI 5F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOY A;  1AKH B;  2H1K A;  2E2I J;  1ZR4 A;  1HF0 A;  1E3O C;  2B63 J;  1X58 A;  4AYB N;  3GTJ J;  2OPT A;  4IEJ A;  2NS7 A;  2Y31 A;  3MN2 A;  4XRM A;  3O8G A;  4A3L J;  1A5J A;  2TCT A;  2M0C A;  3HGY A;  1WI3 A;  2M9H A;  1XG1 A;  3G1L A;  3JRI A;  4XRS A;  1FIP A;  3HOW J;  2ECC A;  4BY1 J;  2E2J J;  1WH7 A;  2K9Q A;  2DMT A;  4A3I J;  5J1U A;  4UUS A;  3BTL A;  3I4M J;  5J1Y A;  4I76 A;  3HB9 A;  2ELK A;  2R5Z B;  2LR8 A;  4JYK A;  5J3L A;  1MBF A;  1Q1V A;  5K7Z A;  2Y2Z A;  2LTP A;  3JRA A;  3SDG A;  4J19 A;  5GPC A;  5M3F J;  5E3N A;  3BT9 A;  3QQA A;  3GTO J;  3GTQ J;  4D7M A;  1VF9 A;  5C3E J;  2K40 A;  1O4X A;  3WHC A;  4DZJ A;  1Y1V J;  1U9N A;  4Y52 J;  4JX5 A;  4M3E A;  5EGO A;  5FJ8 J;  3BTJ A;  1VI0 A;  4C3H J;  3GBG A;  3E7L A;  2PMZ N;  3OSG A;  1JUM A;  4JX4 A;  4A69 C;  3H0G J;  1FJL A;  3BQZ A;  5GP9 A;  5FKK A;  4BKX A;  2FJ1 A;  1QVU A;  4GFB A;  2XB0 X;  4M3F A;  5M5X J;  2NS8 A;  3S15 J;  1U9O A;  4NDL A;  2DA2 A;  1AKH A;  3NAU A;  5IYC J;  1HOM A;  2XGC A;  3FK7 A;  3TW6 A;  5DTD A;  3S1N J;  2K9N A;  4RDU A;  2JK3 A;  2L7M P;  1JT0 A;  2X9D A;  2GBY A;  4L5E A;  1JTX A;  1Z0X A;  2W48 A;  2AO9 A;  1TWH J;  3TW7 A;  3RZD J;  1ZKG A;  1TWC J;  2MGQ A;  3ZQF A;  1MBG A;  2EBI A;  2P81 A;  3DCF A;  3A03 A;  1POG A;  2YU9 J;  4DYC A;  2R93 J;  3ZQG A;  3S1R J;  1TWG J;  5JLW A;  2JA5 J;  5M5Y J;  1A6I A;  2DA7 A;  2EH3 A;  3BR2 A;  1U78 A;  2EZH A;  2CRG A;  2KDZ A;  1IV6 A;  1ETX A;  3JRG A;  4A3M J;  2EZL A;  1RPW A;  3GTG J;  1APL C;  3LSG A;  2CQQ A;  4IHX A;  3CCY A;  1R9T J;  2XRL A;  3FK6 A;  2CQX A;  4V2G A;  3S2H J;  4D5F A;  3FKI J;  2LVS A;  2Y9Z A;  3RKQ A;  2TRT A;  2ZB9 A;  3Q0W A;  4FIS A;  2L0K A;  1WPK A;  2VKV A;  2HYJ A;  2DN0 A;  3QPS A;  1PUF A;  3FIW A;  5FLV A;  3IH4 A;  5EYR A;  4FCY A;  1XC5 A;  5IOZ A;  2DJN A;  1ETW A;  4DW6 A;  2CU7 A;  3HOX J;  5M5W J;  3A02 A;  5FKL A;  2WB1 N;  1JKO C;  3RQI A;  5IP9 J;  1IUF A;  3IV5 A;  1GDT A;  3OIO A;  4BY7 J;  2GLO A;  2CUF A;  1GUU A;  1Z77 A;  2YUS A;  3JRH A;  1K61 A;  2ECB A;  5EG0 B;  5FLM J;  1ZTR A;  1BW5 A;  4MLO A;  1ORK A;  4CYC B;  3JRE A;  4S0H B;  1MNM C;  2JA7 J;  3MKL A;  3I4N J;  2CJJ A;  1UHS A;  2DA6 A;  1VFC A;  1LFU P;  3A01 B;  1X2M A;  2JMW A;  4C3I J;  2G0E A;  2JN6 A;  3HDD A;  5F27 A;  3S16 J;  1ETY A;  5C4J J;  2L7Z A;  3BG5 A;  4XRS G;  2EQR A;  3GTL J;  1K83 J;  1ETQ A;  2QCO A;  1JT6 A;  1EF4 A;  3HM5 A;  3G1M A;  1HDP A;  1PUF B;  2Y0S N;  3BR3 A;  3S14 J;  3PO3 J;  1I6H J;  1UMQ A;  1TWA J;  1ETO A;  4B4C A;  1W0T A;  1MSF C;  2M34 A;  3ZQC A;  1GV5 A;  3BR6 A;  2OF7 A;  1FIA A;  1JKQ C;  2HOS A;  3GTM J;  1WGX A;  1H88 C;  1LFB A;  2YS9 A;  1FTZ A;  1IG7 A;  3HOU J;  2LK2 A;  4W97 A;  4IHW A;  1U8B A;  4QTR A;  3OOU A;  3ZQI A;  4XIC A;  1NTC A;  5HOD A;  1I50 J;  1MBK A;  1ETV A;  5IYB J;  5DS9 A;  4JX6 A;  3B6A A;  1HCR A;  1W0U A;  1MBH A;  1JJ6 C;  1NK2 P;  3TP0 A;  5EEA A;  3W6V A;  3G1O A;  4QSH A;  5FKM A;  5EGO B;  2WAQ N;  4G12 A;  1HDD C;  4A3D J;  1QRY A;  2RAE A;  4BBR J;  2COB A;  2DA4 A;  2ID3 A;  2NVY J;  2H8R A;  3Q3S A;  3LSR A;  2FQ4 A;  2XPU A;  1LE8 B;  1OCT C;  1YRN A;  2HXO A;  3M3Y J;  5E3M A;  3MVP A;  2K9S A;  3VPR A;  4A3J J;  4HNV A;  2ME6 A;  5JLX A;  1VND A;  2O7O A;  2X6O A;  1BW6 A;  2E19 A;  2IEK A;  4D5C A;  1MBE A;  2L7F P;  4A3B J;  2DMQ A;  3GTK J;  1ENH A;  2EZI A;  2R0Q C;  1FTT A;  3ZOB A;  2LY9 A;  2MSY A;  1JKR C;  1JJ8 C;  2VUM J;  3NAR A;  2QF7 A;  3O8H A;  2DA3 A;  1T56 A;  5IPA A;  1MH4 A;  5BNG A;  1SFO J;  3UKG A;  5F1J A;  1HLV A;  3JRB A;  2HDD A;  4A3G J;  4BBS J;  2JJ7 A;  3A01 A;  1AHD P;  1ZQ3 P;  2CUE A;  4I6Z A;  3BR1 A;  1LE8 A;  5K7F A;  2JWT A;  3L1P A;  2JA8 J;  2R92 J;  3WHB A;  5E3L A;  4C2M J;  4CYC A;  1H89 C;  2HOT A;  3HOY J;  1MSE C;  3SJM A;  2XB5 A;  2MW8 A;  4A93 J;  5IYD J;  2HOA A;  2XPV A;  5EG0 A;  3S1Q J;  4MFE A;  1RET A;  2NVT J;  1G2H A;  3TED A;  5F04 A;  3JRC A;  1JKP C;  2M2E A;  3S17 J;  3C2B A;  2XGE A;  1IDZ A;  2XPW A;  1WCM J;  2DA1 A;  1TWF J;  2GM4 A;  4UUT A;  2NOG A;  1OCP A;  2I10 A;  1OJL A;  5EDN A;  5FKN A;  4M6V A;  4MIM A;  1X2N A;  3CQZ J;  2R5Z A;  4AC0 A;  4DZP A;  3Q0U A;  1JGG A;  5J1R A;  2JA6 J;  1GT0 C;  1MH3 A;  2FD5 A;  2Y30 A;  5F08 A;  3BR5 A;  2ME0 A;  4UUS B;  1T33 A;  2DMN A;  3FIS A;  4IHY A;  1P7J A;  1UG2 A;  3LNQ A;  2R5Y A;  1JUP A;  3ZQH A;  3HGG A;  5GPA A;  5E3O A;  1SAN A;  4M3B A;  2LKX A;  3IH3 A;  1XS9 A;  1QVT A;  5K7H A;  3BG9 A;  4M3D A;  2LD5 A;  1GV2 A;  2R7Z J;  3JR9 A;  4FTH A;  1IRZ A;  1RKW A;  3BTI A;  1ZR2 A;  1B8I B;  1S7E A;  1D5Y A;  5F0F A;  1YRN B;  1CQT A;  1F43 A;  3BTC A;  3GTP J;  4XID A;  1H8A C;  4JP0 A;  4V2F A;  3TP3 A;  2XSD C;  2NVQ J;  4A3E J;  2E2H J;  2HQ5 A;  5C4X J;  1FEX A;  2O9L A;  1B72 B;  1B72 A;  3HKZ N;  3SFI A;  2DMU A;  4W1U A;  4RBO A;  3LSP A;  3CMY A;  3HEF A;  4X6A J;  3IH2 A;  2FX0 A;  3BQY A;  5M3M J;  4IHV A;  1Y1W J;  2O8K A;  1RKT A;  4C3J J;  4B1R A;  3RZO J;  5F0C A;  1B8I A;  2HI3 A;  2WV1 A;  1GVD A;  3K2A A;  1DU0 A;  1IGN A;  2IAI A;  3B6C A;  2M8G X;  5EZG A;  2E1O A;  1IDY A;  2AHQ A;  2NVX J;  2D5V A;  4EEF G;  3BG3 A;  4X1E A;  1ITY A;  3HOV J;  4XK4 A;  2L9R A;  1OFC X;  1RES A;  4MFD A;  3ZQL A;  1RR7 A;  3M4O J;  2HXI A;  5IP7 J;  3PO2 J;  1JUS A;  4MO7 A;  3BR0 A;  1ZGW A;  4FE7 A;  2ID6 A;  3H3V K;  1DU6 A;  2VKE A;  3F0C A;  2DMP A;  3LSJ A;  3JRD A;  1BA5 A;  5C44 J;  3OSF A;  1BL0 A;  1WH5 A;  1F36 A;  3PM1 A;  4A3F J;  2KT0 A;  4B3A A;  2LFB A;  2MG4 A;  3DEW A;  5IP6 A;  2Y9Y A;  2DA5 A;  4DYQ A;  3K7A J;  1IJW C;  1IC8 A;  1NK3 P;  1I3Q J;  4DYR A;  4A3C J;  4ABZ A;  3HOZ J;  1P7I A;  1BJZ A;  4A3K J;  2LLK A;  3CDL A;  9ANT A;  4QIW N;  3S2D J;  1ETK A;  2IBD A;  1TC3 C;  2XGD A;  1AU7 A;  1JTY A;  4D7N A;  2X48 A;  2R5Y B;  2VI6 A;  3Q0V A;  2VPR A;  2EZK A;  2LP0 A;  3HBL A;  5EZH A;  1QPI A;  3LOC A;  1ZK8 A;  3JRF A;  4Y7N J;  2N8G A;  3S1M J;  4BXX J;  4AUX A;  5EF6 A;  1MBJ A;  2DTZ A;  4FE4 A;  4LOC A;  4M3G A;  5FKO A;  3QPL A;  3D1N I;  5F0H A; 
#chains in the Genus database with same CATH topology
 2W57 A;  1HKQ A;  1DPR A;  3HSE A;  2B63 J;  2XAU A;  3WTV C;  1X58 A;  3TO7 A;  3OYL A;  3ESW B;  2JRT A;  1VQ8 I;  2NS7 A;  2VT2 A;  1A5J A;  1IN8 A;  3OS0 A;  2TCT A;  3HGY A;  1WI3 A;  3A4C A;  2FBI A;  5JHF A;  3VOE A;  3KLO A;  3U1D A;  1FIP A;  3HOW J;  1I3A A;  1D0X A;  2ZNY A;  3VYU B;  5LD2 C;  4UUS A;  3I4M J;  5KCM A;  2R7T A;  5J1Y A;  4BS9 A;  3H0D A;  3CMM A;  1IXR C;  2VB6 A;  4Y17 A;  2R5Z B;  1TNS A;  3F6O A;  2R7Q A;  3J7A Y;  3K4N A;  4PSW A;  1ODD A;  2GAU A;  2Y2Z A;  1J2X A;  1QZY A;  2LTP A;  5H2F C;  5ILV A;  2ZME B;  3JRA A;  4J19 A;  1D0Z A;  3H92 A;  2Y0M A;  4AWX B;  2ZME A;  4PJ0 C;  5JVT A;  3CD6 I;  4XKV A;  2V6C A;  4HOB A;  3WHC A;  1WJD A;  4M9X A;  1UHM A;  4DZJ A;  5D4R A;  4G9Y A;  4U0V A;  3P5J A;  4Y52 J;  1MNE A;  5D5U B;  1FX7 A;  4IVN A;  2OTL I;  2VAS A;  1VQO I;  5EGO A;  2X1D A;  4UY8 I;  1MDM A;  1I1S A;  3GBG A;  3HL2 A;  4IPA A;  1YYV A;  1I6X A;  3SZG A;  1BM9 A;  4BDY A;  5BS6 A;  3FXO A;  4BKX A;  2FJ1 A;  1QVU A;  5JHU A;  1OCZ H;  1WHU A;  2NS8 A;  5TIS C;  3WTS C;  3S15 J;  1U9O A;  2KIF A;  4NDL A;  1AKH A;  4WX9 A;  3FF5 A;  5K1Y A;  5FLX Z;  3SEQ A;  2OQR A;  3QYF A;  1P4X A;  2XGC A;  4KA4 A;  3FK7 A;  1MND A;  3AL0 C;  5DTD A;  4RDU A;  1Z91 A;  2L7M P;  2JQ7 A;  1JTX A;  1Z0X A;  2FUG 2;  3W6K B;  2AO9 A;  1XMX A;  2FRH A;  1TWC J;  2LBF B;  5LFA A;  4KIB A;  2M0M A;  1WJE A;  3DCF A;  1D8K A;  3A03 A;  1POG A;  1TWG J;  3CP8 A;  2Q0O A;  4B44 A;  2YU3 A;  3PUB A;  1B9N A;  3EUH C;  1BI2 A;  1I27 A;  2F6C A;  2HKX A;  2DA7 A;  2EH3 A;  4XRF A;  4LB6 B;  1ZYR F;  1YJW I;  2KIS A;  2CRG A;  2KDZ A;  4C30 A;  1ZG1 A;  3H36 A;  2HOE A;  1VQ9 I;  3RTR A;  2EZL A;  1RPW A;  1APL C;  3GEZ A;  4ETS A;  4ZJZ A;  4A0Y A;  3FK6 A;  2KDO A;  4V2G A;  1WWX A;  3V8J A;  3DBH B;  2ACJ A;  2DFH A;  3FKI J;  3RKQ A;  2TRT A;  2NRA C;  3Q0W A;  1IZ1 A;  3CLQ A;  4FIS A;  1TBX A;  2M7B A;  3QPS A;  2DN0 A;  1XGS A;  5LRR A;  4CCK A;  2IGK A;  4HV5 A;  4ANJ A;  4O6J A;  4BJ5 C;  1D5V A;  1LDJ A;  2ESN A;  2OJE D;  5IOZ A;  3EUK L;  2NYX A;  4PCQ A;  1ZRD A;  2BXZ A;  1ETW A;  2DFI A;  3CC2 I;  5K5O A;  3E6D A;  2BHY A;  1OYY A;  5KAF C;  2MD0 A;  3IAS 2;  1T39 A;  3G4S I;  3R60 A;  4BY7 J;  3D5S C;  3CC7 I;  2XF5 A;  3SQN A;  5FLM J;  3VYS B;  5E8I A;  1OMI A;  3W6J B;  3OYH A;  1MNM C;  2OA4 A;  2P4W A;  5B5E C;  3SZT A;  2LF7 A;  2XAF A;  4CZC A;  3GFM A;  4HYE A;  1LFU P;  3GXO A;  1GHC A;  4GRI A;  3A01 B;  2JN6 A;  3BJA A;  2V9V A;  1R4M B;  3OY9 A;  1XTA A;  2KIQ A;  2XRN A;  2EQR A;  1CGP A;  1K83 J;  1D8J A;  2QCO A;  3Q9V A;  4BUP A;  3DPL C;  4YII A;  5J40 A;  1GLN A;  3H35 A;  3BR3 A;  4CZZ A;  2FMY A;  3S14 J;  1FWZ A;  4DBQ A;  2CV2 A;  1V5G A;  3U21 A;  2E1N A;  1ETO A;  5IT3 A;  3OYF A;  2LY2 A;  1WZ2 A;  2VBZ A;  1CF7 B;  1X1C A;  1R49 A;  2I8D A;  2M4G A;  4I0A A;  3BR6 A;  2AXL A;  1FIA A;  2H6B A;  3F8C A;  2HOS A;  1XDS A;  2D1H A;  2YPR A;  1WGX A;  4KYW A;  2LMD A;  1HC8 A;  1D1A A;  2JRM A;  2YS9 A;  3LAJ A;  1FTZ A;  2ZSH B;  3GF2 A;  4IHW A;  3DP7 A;  3K69 A;  3ECH A;  3KP5 A;  4XIC A;  1FBS A;  1KQ0 A;  1NTC A;  1H9G A;  4AVZ A;  2K27 A;  2COM A;  4JX6 A;  2M4K A;  1LDK B;  2QGU A;  2QSH X;  4E6K G;  1HCR A;  4EMS A;  3COA C;  1MBH A;  1JJ6 C;  1OIS A;  1S5L C;  3TP0 A;  5EEA A;  3W6V A;  3ZMV A;  4JQF A;  4CCL A;  1W5T A;  3HTU A;  3UNG C;  2GWR A;  5F1R A;  2KL4 A;  3BDD A;  2KFD A;  3W2A A;  4BQQ A;  4D0P A;  3ONQ A;  5J47 A;  4L0Z B;  3Q3S A;  1FY7 A;  2IA2 A;  1LE8 B;  1YRN A;  4RB2 C;  4XLH A;  4EAT A;  1IW7 F;  3H9Q A;  3VPR A;  3WGG A;  4Q48 A;  1V55 H;  2QBY A;  2X6O A;  2WAE A;  3F8M A;  3F8F A;  3B02 A;  3IWZ A;  2ZJP F;  2IEK A;  2QQ8 A;  2VQL A;  3M9A A;  3KYC B;  4D5C A;  2L7F P;  1YO5 C;  1YLF A;  2BV6 A;  1V54 H;  4A3B J;  1YE9 A;  3FZV A;  2R0Q C;  2M7A A;  1HW1 A;  4CDG A;  4I09 A;  3ZR8 X;  4DOZ A;  1JJ8 C;  1REP C;  2LKP A;  1AOY A;  4HQE A;  5GAE J;  2QWW A;  2DA3 A;  1BR4 A;  1T56 A;  2VXZ A;  4P96 A;  1MH4 A;  2M5W A;  1QU3 A;  2CFX A;  1SFO J;  1XPX A;  4OIP F;  2P7V B;  2JTV A;  3FHN A;  2QKM B;  2A6T A;  1PVE A;  2CUE A;  4EJU A;  4I6Z A;  1WJA A;  5K7F A;  5HLG A;  1Q1H A;  2Z16 A;  2H6C A;  3L1P A;  3ASN H;  2UWM A;  1X19 A;  3BCA A;  1T0F C;  2MYS A;  3I59 A;  5CVJ A;  4Y33 A;  1MDM B;  3TKY A;  2HOA A;  3L2W A;  5L3E A;  2W1O A;  5EG0 A;  1R1U A;  1JI8 A;  1RET A;  2KJB A;  3GYH X;  1G2H A;  4I7H A;  3OYC A;  3ERM A;  4P5O A;  1BI1 A;  1R6R A;  2EA2 A;  4EJT A;  1KZH A;  4ZYD A;  1TWF J;  1T0F A;  2PN6 A;  3E1S A;  4UUT A;  3C2G A;  4J01 A;  2ADU A;  1OCP A;  1I1G A;  3JSO A;  5DCF A;  3V42 A;  4R8H A;  1OJL A;  3DPU A;  2NOJ B;  3K1M A;  3S32 A;  3PFY A;  3CCR I;  1J9I A;  1RUN A;  5GTH C;  4MIM A;  1X2N A;  1HKS A;  3CQZ J;  2R5Z A;  4AIH A;  2FU4 A;  3R4K A;  3Q0U A;  3DV8 A;  1JGG A;  4QWQ A;  1ZLJ A;  2FD5 A;  4BNC A;  1W5S A;  2ME0 A;  4UUS B;  3OYK A;  3VSL A;  1T33 A;  2KRH A;  1V3F A;  1R5I D;  5D5V B;  1BR1 A;  3I55 I;  1KON A;  4AVP A;  5LHI A;  3TQN A;  1QHH D;  3BPV A;  4XR6 A;  1WJB A;  3ZQH A;  2VE9 A;  5GAG J;  4A2U A;  1GVJ A;  2MC4 A;  2K4J A;  1FC3 A;  3BG9 A;  2M87 A;  1K4T A;  3VOD A;  1P4W A;  4L0Y B;  2R7Z J;  3IP4 B;  4FTH A;  2BHZ A;  5HVQ C;  4HX8 A;  1AA7 A;  2L7K A;  4KMF A;  1TQI A;  4M9Z A;  1F43 A;  4DQ2 A;  5TJJ A;  3ZQ7 A;  3BTC A;  2IGO A;  3KZY A;  1TQM A;  4HX7 A;  2DDA A;  2K7L A;  3K4K A;  5DD4 A;  4A3E J;  2E2H J;  1FEX A;  3IRR A;  1B72 B;  3HKZ N;  3ZN0 A;  4BXF A;  3MKZ A;  4H4K C;  4RBO A;  2JVH A;  2ZXH A;  3AKZ A;  5DCM A;  3T0Y A;  4X6A J;  3MKY B;  4IHV A;  3FBN B;  1Y1W J;  1RKT A;  4C3J J;  2VN2 A;  5LBQ A;  2R7D A;  3RZO J;  2YSR A;  1NG7 A;  3TO6 A;  3PQK A;  3FM5 A;  1GVD A;  1IGN A;  2J5O A;  4HV6 A;  4LFU A;  2O8X A;  1C0W A;  1LEB A;  4HNU A;  2FNP A;  1TTY A;  2E1O A;  2ZJ2 A;  5GAD J;  1D3Y A;  2DYS H;  2WBM A;  4TV7 A;  3MZH A;  2D5V A;  4EEF G;  3MKW B;  4XK4 A;  3N4M A;  1OFC X;  3ZQL A;  4I2O A;  1RR7 A;  4ZH4 F;  2HXI A;  2CSO A;  3P9K A;  1OLT A;  3BR0 A;  1YS7 A;  1SFU A;  5L3C A;  1HXD A;  2VOD A;  3EYY A;  3KP7 A;  2DMP A;  3HXL A;  2RKH A;  3LSJ A;  1BA5 A;  5C44 J;  1WH5 A;  2MBF A;  1J7K A;  2KT0 A;  4B3A A;  1FOX A;  2O61 A;  2MG4 A;  2Y9Y A;  3KYD B;  3O2P E;  4PDK A;  2QZ8 A;  3LFU A;  1YX3 A;  1W1W E;  3HZJ A;  3K2Z A;  3OYM A;  1A36 A;  4A5M A;  3BC8 A;  4GXO A;  5B66 C;  3CME I;  3DFG A;  4QIW N;  9ANT A;  2Y69 H;  4R1H A;  2CG4 A;  2JUC A;  2Z1D A;  2EK5 A;  1TT5 B;  1MMG A;  3KIO A;  1X1B A;  4UB6 C;  2LG4 A;  4BXX J;  3WTT C;  3X2Q H;  1SFK A;  3CJR B;  3CP2 A;  2E35 A;  5J6X A;  1QPM A;  4LOC A;  4M3G A;  2TDX A;  3FXM A;  4XBF A;  3D1N I;  5LHG A;  2FNA A;  3ZCO A;  1Z1D A;  4LLN A;  5IOY A;  1AKH B;  5GAH J;  5HDG A;  3G73 A;  1FSE A;  2E2I J;  1ZR4 A;  1B4A A;  2K9L A;  2OPT A;  2XVC A;  3U1K A;  3QOE A;  2Y31 A;  2EFN A;  2K02 A;  4RAY A;  3CO7 C;  4A3L J;  1XGM A;  1Z7L A;  4KFC A;  4MQ9 F;  3K70 D;  3JRI A;  4NB5 A;  2K5C A;  5FFX A;  4XRS A;  4EM0 B;  2K3P A;  3PSF A;  4GCV A;  4A6E A;  1FOK A;  2XV4 S;  2JUG A;  2DMT A;  4A3I J;  5J1U A;  1WJF A;  1YI2 I;  3OS1 A;  4YFX F;  3QU3 A;  2M3A A;  3CJQ B;  3I59 B;  1PP7 U;  2VKH A;  2ZC2 A;  2LR8 A;  5J3L A;  1FBU A;  2G7H A;  3CMA I;  1IAW A;  2ELH A;  2FSW A;  5K7Z A;  3SDG A;  5HLT A;  3UR3 C;  1SD4 A;  5M3F J;  5EJC A;  2STT A;  2EPF A;  1T38 A;  2MA3 A;  3OOP A;  4KIF A;  3GTO J;  3K4M A;  3TGN A;  3WTW C;  1YJ9 I;  1XCB A;  4RM3 A;  5C3E J;  1HBX G;  1O4X A;  3RI4 A;  3CUQ A;  2VL8 A;  1U9N A;  2ZSI B;  1MW7 A;  2WY7 Q;  5LEK A;  1WKM A;  4ZC3 A;  2DFF A;  5FJ8 J;  4U7B A;  5CVV A;  2GIV A;  2A05 A;  2PMZ N;  3OSG A;  2B7E A;  3DEU A;  4KN4 X;  3I71 A;  4FET A;  2HNH A;  1MIJ A;  2L3D A;  4RGU A;  3BQZ A;  4IQ4 A;  5FKK A;  3LAP A;  2BGC A;  2XB0 X;  3A0B C;  3MAJ A;  4RAG A;  4Y4R A;  2DFE A;  1Y6I A;  4H0E A;  2PI0 A;  1FLI A;  3L2C A;  2FEZ A;  4M3F A;  3KEO A;  1R7J A;  3BWG A;  3A0H C;  4NC8 A;  2XRO A;  1HA8 A;  4UVA A;  4IX7 A;  2X6X A;  4RA2 A;  2EFP A;  2IXS A;  2DK8 A;  4XMY A;  5D6F A;  3I3L A;  5IT9 K;  4XLF A;  4BL0 B;  2L4A A;  1JT0 A;  2X9D A;  5JI6 A;  4BHC A;  3B73 A;  3AAF A;  3WTU C;  2W48 A;  3RZD J;  3AFH A;  3M8F A;  1MBG A;  2EBI A;  1HW5 A;  1SMY F;  4CIC A;  2FBH A;  4DYC A;  3J7Y J;  5TRD A;  3IKV A;  2W7N A;  3D5L A;  2YU9 J;  4C2U A;  2XAS A;  5F6F A;  2G9W A;  2Q8K A;  2NS0 A;  1X3U A;  4NC6 A;  4DJA A;  3WGH A;  1IV6 A;  2QQB A;  2DI3 A;  4E7K A;  5D8K B;  1W7P B;  1JE8 A;  1TW2 A;  2DAO A;  1IXC A;  4MEY F;  2CQQ A;  2HVS A;  1R9T J;  4IHX A;  4N4O B;  3AG3 H;  2CQX A;  1D0Y A;  1W4M A;  3ZMZ A;  1I39 A;  2V1U A;  4FAS D;  1FYL A;  2F5D A;  3S2H J;  4D5F A;  3Q9S A;  2LVS A;  2Y9Z A;  3E97 A;  1W36 D;  2KKO A;  1R22 A;  2WY8 Q;  4DBR A;  1QHG A;  2D1V A;  1GXQ A;  1R23 A;  2BY1 A;  3FWE A;  2K4B A;  4FCY A;  4BGD A;  3ZGK A;  4HQM A;  5HS9 A;  3HUG A;  2XHK A;  1QZZ A;  1WSU A;  4QPO A;  5HLI A;  1IRF A;  4G6D A;  2Z2S B;  2WB1 N;  1JKO C;  3VWB A;  3EPZ A;  2HYG D;  5IP9 J;  3GZ5 A;  1IUF A;  1Y8Q B;  4L18 B;  3J7Z I;  1T8I A;  2P5V A;  2RVC A;  3R6S A;  3OIO A;  2GLO A;  1UJ8 A;  2CUF A;  1GUU A;  2HR3 A;  4EJW A;  2ECB A;  3N05 A;  2WV0 A;  2GXG A;  4ITV A;  2E1M B;  3GFL A;  4CYC B;  3I4N J;  1XSV A;  2JA7 J;  3E6C C;  5BPD A;  4CCO A;  1S29 A;  4LIT A;  3ZPL A;  3NRV A;  3E5Q A;  3OYN A;  2JMW A;  4C3I J;  3EDP A;  4IL6 C;  3HDD A;  3S16 J;  2EIK H;  1J75 A;  3BY6 A;  3S93 A;  3F8N A;  5C4J J;  1DPU A;  1WRJ A;  1P92 A;  2R7V A;  3F23 A;  3QRF F;  4XRS G;  5DM7 F;  1ETQ A;  1Y0U A;  2WWY A;  2CGP A;  3AG1 H;  3PO3 J;  1I6H J;  1ZG5 A;  1UMQ A;  1Z3X A;  1TWA J;  2E7X A;  1OCC H;  2HVR A;  1ON1 A;  4CCJ A;  4B4C A;  1W0T A;  2VXD A;  1OR7 A;  5KVR A;  3IL2 A;  3MEX A;  2M34 A;  1GV5 A;  1F4K A;  1ZGA A;  2OF7 A;  1JKQ C;  3RDI A;  4XLN F;  1SD5 A;  2RDP A;  1LFB A;  4EJV A;  4C2T A;  2DYR H;  4YEJ A;  5HOO A;  4AIK A;  3BG6 A;  2EV0 A;  2DJI A;  2HDW A;  3I53 A;  1WFX A;  3IHU A;  4BHB A;  5HOD A;  1N78 A;  2MLG A;  4OAY A;  1ETV A;  4L9V A;  3TOA A;  1BR2 A;  1Z21 A;  5IYB J;  1SFX A;  5DS9 A;  4F55 A;  2KLO A;  3TO9 A;  1O3R A;  3ZRG A;  5J8F A;  4EGZ A;  3L2Q A;  1YQA A;  2IS1 A;  5FKM A;  2E5Z A;  2WAQ N;  4YEL A;  1HDD C;  4Y13 A;  4A3D J;  1QRY A;  1NG6 A;  2RAE A;  4ZYE A;  4PJM A;  4UV9 A;  2COB A;  1AWC A;  3PL8 A;  4P9F A;  2ID3 A;  2NVY J;  4Y15 A;  2IRF G;  2E34 A;  2CQK A;  1MMA A;  1SC7 A;  3HTS B;  2FQ4 A;  1FSH A;  2A07 F;  2UXN A;  1O7F A;  2K9S A;  2KRF A;  3MFK A;  2LYC A;  2QYO A;  5JLX A;  4OOI A;  3EQL F;  2PFB A;  4HSR A;  1MMS A;  1VND A;  3PFI A;  4JBA A;  1DUX C;  2DPD A;  1FMV A;  3AG2 H;  3K4B A;  3WG9 A;  4MEX F;  2EIN H;  1MBE A;  3KYL A;  2DMQ A;  2IA1 A;  3K4L A;  4O3M A;  2DPU A;  1MD0 A;  4L9N A;  1IUY A;  1FTT A;  3OS2 A;  5E17 F;  1JKR C;  2EB7 A;  2Z99 A;  2FXA A;  3NAR A;  1YIO A;  3EUA A;  3PQJ A;  3ZMT A;  1FPQ A;  3O8H A;  3LST A;  1HSJ A;  2LF8 A;  2A68 F;  3L09 A;  1VQM I;  5BNG A;  5L3B A;  4RM2 A;  2MAB A;  1DQU A;  3UKG A;  1SVM A;  3C7J A;  3CZ6 A;  2HDD A;  1Y56 A;  4A3G J;  3ERE D;  1D1B A;  2JJ7 A;  1UFM A;  4GGG A;  4I0B A;  2V7F A;  2R3S A;  3LFK A;  4PFO A;  2JWT A;  1UAA A;  1VTN C;  1S72 I;  3BCB A;  1IRX A;  2O0Y A;  2EA4 A;  4CYC A;  2HOT A;  3RPU D;  2E1C A;  3H3Z A;  2V4J C;  4A93 J;  2ZXW H;  5IYD J;  4V19 K;  4MFE A;  1FZP B;  3IRQ A;  2NVT J;  4M73 A;  4GO1 A;  1YFH A;  2H27 A;  1G8X A;  2QQA A;  3F72 A;  3RSN A;  2R7X A;  4ZDL A;  3C2B A;  1IDZ A;  1A6Q A;  2VQH A;  2NOG A;  3CLO A;  2DXI A;  3QAH A;  1RC9 A;  1MJ9 A;  2I10 A;  2JT1 A;  3HUG B;  1PP8 F;  3HOT A;  1XMA A;  2CW8 A;  3RYP A;  3HJE A;  5A2Q Z;  4UUV A;  3OIP A;  3QOP A;  1EJ9 A;  5E8G A;  2HQR A;  1BOB A;  4M6V A;  1ZGJ A;  4ZZD A;  2L01 A;  3J80 Z;  4HLX A;  4P1W A;  1GT0 C;  2M8E A;  3PNT A;  1UCR A;  2WB1 A;  4CHU A;  3GFJ A;  4OAZ A;  2XGX A;  4BEH B;  3FMQ A;  5LEJ A;  4OU0 A;  1UG2 A;  3LNQ A;  2QEN A;  1B59 A;  1V5E A;  3FX3 A;  3U2R A;  4UVC A;  2R5Y A;  1VQ5 I;  3F9K A;  1KYZ A;  2YR2 A;  2K85 A;  2KHM A;  5GPA A;  3LMM A;  3QOD A;  2V6E A;  3HSR A;  2LKX A;  5K7H A;  4U0Y A;  4M3D A;  1GV2 A;  2KIM A;  1IRZ A;  2VLA A;  3DU5 A;  3QU6 A;  4E7Z A;  3H9J A;  2QLZ A;  1B8I B;  3FMR A;  1S7E A;  3QPT A;  4RAZ A;  1O3Q A;  2XAJ A;  1D5Y A;  3I56 I;  1YRN B;  3OYA A;  3F22 A;  3GTP J;  2A3S A;  4JP0 A;  1WJC A;  1RI7 A;  4LG0 A;  4B47 A;  4KNY A;  2NVQ J;  4RB1 A;  1LB2 A;  2M45 A;  1G3W A;  2E1M C;  1ZLK A;  3HIF A;  3LA2 A;  3BPX A;  3RYR A;  3OYG A;  1SEU A;  1BC8 C;  3KP6 A;  3BQY A;  1BOA A;  1YOV B;  3TMO A;  3PJR A;  4CGZ A;  4BQA A;  2QEX I;  5F0C A;  1B8I A;  2HQA A;  3MWM A;  3ISP A;  3DU6 A;  4RB0 A;  1DU0 A;  3KZI C;  1GXP A;  4WXD A;  4FQG A;  5EZG A;  1IDY A;  2RN7 A;  1SD7 A;  1WQ2 A;  2XF7 A;  5B1A H;  2HTS A;  1U5T B;  4X1E A;  3C2H A;  3OV8 A;  2H94 A;  3I58 A;  2HWV A;  5IP7 J;  1T08 B;  3PO2 J;  1JUS A;  2E36 A;  1DU6 A;  4FE7 A;  1OR7 C;  2OCC H;  1QBJ A;  3VB2 A;  4PJJ A;  3JRD A;  3OSF A;  2R7F A;  1F36 A;  2HQN A;  5CJ9 A;  4A3F J;  4CSW A;  3JAM K;  1Z6R A;  2LFB A;  2ZXJ A;  3DEW A;  2MH2 A;  5D5X B;  1DP7 P;  1IJW C;  1EH7 A;  1NK3 P;  4GYI A;  1I3Q J;  4ESF A;  5KNL A;  4A3C J;  5B1B H;  2VJI A;  1P7I A;  1SVO A;  1IO2 A;  1PUE E;  1BJZ A;  5E20 A;  2EIJ H;  2LLK A;  3CDL A;  4IOC F;  2L2O A;  4FHT A;  4Q47 A;  4B48 A;  1ETK A;  3GFI A;  4LJZ F;  1AU7 A;  4II3 A;  5HNF A;  3U9G A;  2PBI A;  4LLL A;  2VI6 A;  1IN5 A;  1KU3 A;  1B6A A;  2GOX B;  3BLY A;  4UHT A;  4EVI A;  4E7L A;  3DLA A;  1XDU A;  3JSP A;  4FE4 A;  3CCQ I;  2VC1 A;  1S6L A;  1E17 A;  1LEA A;  5FKO A;  2RNJ A;  3R0A A;  4F3Q A;  2KPM A;  2Z3Y A;  3HSF A;  5F0H A;  1S7A A;  2H1K A;  3MD2 A;  2ESH A;  4KT5 C;  1O57 A;  3WTX C;  3H9G A;  4AYB N;  1VQ7 I;  4IEJ A;  4G7Z F;  4XRM A;  2KZV A;  1A04 A;  2LRE A;  2M0C A;  2M9H A;  1XG1 A;  2P6T A;  1DGR M;  4XOP A;  4N4N B;  4RGR A;  2ECC A;  3LSH A;  1XCV A;  4BY1 J;  3LA3 A;  1BBY A;  1WH7 A;  1X3W B;  2K9Q A;  3HC7 A;  2E2J J;  3HOS A;  3BTL A;  4IRG A;  5CLS A;  2GOM A;  4I76 A;  5FLX K;  1YTY A;  2EFO A;  2ELK A;  2VJJ A;  2F48 A;  3WU0 A;  3RKX A;  1ZEL A;  2AQE A;  4ZDP A;  3DKW A;  1MBF A;  1Q1V A;  4XKB A;  2IS4 A;  3BT9 A;  3QQA A;  1XSD A;  1Z6T A;  2GQQ A;  2VE8 A;  5FB2 A;  5CKT A;  4IZZ A;  3GLX A;  2K40 A;  1A35 A;  1R5G A;  4XNF A;  3VYT B;  2JPB A;  2OTJ I;  1FBQ A;  3HPH A;  2BZT A;  1Y1V J;  2CYY A;  3S3M A;  4JX5 A;  1UG0 A;  3E3V A;  4JOM A;  3E5U A;  4IO9 F;  3BTJ A;  3GO5 A;  4C3H J;  4DNC A;  1N77 A;  1EKE A;  5H20 A;  2Y75 A;  1ULY A;  3P7N A;  4LD5 A;  1JUM A;  4JX4 A;  2CV1 A;  3H0G J;  5GP9 A;  4OIO F;  2HZT A;  3RKY A;  4FX0 A;  1E0E A;  3I9V 2;  2ZME C;  2LDU A;  3JW4 A;  5M5X J;  3OYI A;  4U7D A;  3LL7 A;  3A1Y A;  3RPQ A;  2EV5 A;  3OYB A;  1VQL I;  2EJR A;  2OC6 A;  2QA4 I;  5IYC J;  1HOM A;  2DDB A;  3TW6 A;  3E6M A;  1K78 B;  2K9N A;  5DUK A;  2W25 A;  2GBY A;  4YIR X;  4JK1 X;  2CS3 A;  5ICG A;  2MGQ A;  2P81 A;  1BIB A;  2NAZ A;  3MZ8 A;  1YIJ I;  3S1R J;  2HFH A;  4A5N A;  2JA5 J;  4RS8 A;  5M5Y J;  1A6I A;  3CUQ C;  5E79 C;  3PIP F;  3C18 A;  4RLF A;  2ZJQ F;  2BOL A;  4IF4 A;  4B43 A;  2OZU A;  1U78 A;  4P55 A;  4RLQ A;  1PJR A;  2VJ5 A;  2EZH A;  4ZTF A;  4M6X A;  3OYJ A;  4RAF A;  2PLY A;  4RGX A;  3LSM A;  4XKC A;  2BY3 A;  5GTI C;  2CWE A;  1LDD A;  1O3T A;  3GTG J;  3H5R A;  4ZYG A;  3DEE A;  2X4H A;  4M72 A;  3EYI A;  4ESB A;  4OIR F;  1Y8R B;  1P6R A;  3CCM I;  2RC4 A;  4LIV A;  2PMZ A;  4XN3 A;  2RQQ A;  3S8P A;  1I5Z A;  3HYI A;  2NVU B;  4DGW B;  1U0J A;  2L0K A;  3OMY A;  1WI9 A;  1NH3 A;  1IN6 A;  4S05 A;  3FIW A;  2Q2E B;  3CCS I;  1IN7 A;  3FM3 A;  5EYR A;  2DQR A;  1U3E M;  1L0O C;  5CPR B;  3PSI A;  2UZK A;  4WF2 A;  2ZKZ A;  3O6B B;  2CU7 A;  2OU2 A;  3CDI A;  3K0L A;  2G7U A;  3BZK A;  4EM2 A;  3HOX J;  5M5W J;  5HS7 A;  5ICF A;  2ZNZ A;  1TQP A;  5FKL A;  3A2K A;  1XN7 A;  4OMY A;  1XMK A;  2W82 A;  3RQI A;  3BZ6 A;  3DQV C;  3JTH A;  1K79 A;  3RJP A;  3IV5 A;  3CJT B;  3KX2 A;  1J5Y A;  2YUS A;  1SVL A;  3ABT A;  5EG0 B;  1FP2 A;  2QQ9 A;  2KJC A;  5FRO A;  5AON A;  4LG0 B;  1BW5 A;  2FQ3 A;  3C1D A;  3G2B A;  3JRE A;  3J7A O;  1KA8 A;  1W7P D;  3TBI A;  1UHS A;  3BP8 A;  5K5Q A;  4Z2Y A;  5E1Z B;  3F3X A;  1VFC A;  3KEQ A;  4GYG A;  2WAD A;  2G0E A;  2VC0 A;  4XLP F;  2F5E A;  3ZN1 A;  1ETY A;  2L7Z A;  1USS A;  3OR2 C;  4NQW B;  3BG5 A;  6PAX A;  1TLH B;  3ECO A;  4G94 A;  1LNW A;  1JT6 A;  3AG4 H;  4BQO A;  4DIQ A;  2V9P A;  3HM5 A;  3G1M A;  1HDP A;  1PUF B;  2PX9 A;  2Y0S N;  2IJL A;  1BI0 A;  1R71 A;  3DPT A;  2XC7 A;  4HDU A;  2O6G E;  2F5V A;  4CYD A;  4BU2 A;  1G4D A;  1LJ9 A;  5JFR A;  2BYV E;  2PJR A;  1ZAR A;  3LQR A;  3LA7 A;  4YRV A;  1OYW A;  4EV0 A;  4LB5 A;  5DUI A;  3GTM J;  2VBY A;  1R1T A;  5L3G A;  3K1N A;  1UHW A;  2HTJ A;  4HST A;  3WE2 A;  3V8K A;  3I5U A;  1IG7 A;  3HOU J;  1XGN A;  1U8B A;  1T98 A;  3ZQI A;  2ZBK A;  1FYM A;  1IN4 A;  3BJ6 A;  4N9I A;  1ZRC A;  1ACI A;  2UV1 A;  1J59 A;  2BE5 F;  2Q2E A;  2D45 A;  1MMN A;  5FRN A;  2LC2 A;  4F92 B;  3OL4 A;  2L54 A;  1RR8 C;  5FRM A;  3FXL A;  3E0J B;  4HF0 A;  4KDP A;  4IHS A;  2IVM A;  3J81 K;  4FX4 A;  4F93 B;  2NNY A;  3ABK H;  3HRU A;  1QNT A;  4ENK A;  2IS2 A;  4XN0 A;  4G12 A;  4ENJ A;  2DT5 A;  2I5U A;  2CW7 A;  4XLC A;  2CW0 F;  4HDV A;  1X1A A;  2OD5 A;  4ZZL A;  3L2R A;  2W84 A;  2H8R A;  1G6N A;  3S2W A;  3KP4 A;  3H5N A;  3IWF A;  4D9J A;  2OCE A;  3JTG A;  1OCT C;  3CCV I;  1YS6 A;  2HXO A;  2V1X A;  3DTI A;  1QA6 A;  4WXC A;  5E3M A;  1JHF A;  4HAM A;  3ABU A;  1VQ6 I;  4KIG A;  2OZ6 A;  1HQC A;  3LSI A;  2ZFW A;  1SFE A;  1P2F A;  2XAG A;  2ME6 A;  1ON2 A;  1BW6 A;  2FE3 A;  2X1E A;  2E19 A;  1V4R A;  2NXN B;  3FXU A;  2BEO A;  4OMZ A;  3F21 A;  1JGS A;  1SAU A;  2JVG A;  4G8X A;  5EEH A;  3GTK J;  3O3K A;  5ILS A;  4IRI A;  2K3F A;  3DBL B;  1UST A;  3G6E I;  1G59 A;  4KJZ A;  2LY9 A;  3W2V A;  2MSY A;  2XSJ C;  4G7H F;  2VUM J;  1N75 A;  5DDG A;  4YG2 F;  3EET A;  1HKT A;  2A6H F;  3P9I A;  4LK1 F;  1T2K A;  2BW3 A;  5IPA A;  3ZQQ A;  3M1C A;  2IT0 A;  1ZHF A;  5F1J A;  4PK4 A;  3JRB A;  4NBQ A;  4NUB A;  2X0L A;  2EFW A;  4BBS J;  3CF5 F;  3A01 A;  1ZQ3 P;  1AHD P;  3K4J A;  5LRS A;  5JR3 A;  4OWR B;  1W5C C;  4WXH A;  4HRI A;  3IAM 2;  4BJT A;  1OKR A;  5EEG A;  2WC2 A;  1M1E B;  2M30 A;  3IC7 A;  2LRD A;  2JA8 J;  2R92 J;  4NNJ A;  5E3L A;  4C2M J;  2WAQ A;  3HOY J;  1MSE C;  1E3H A;  3SJM A;  5L3D A;  2XB5 A;  3MZY A;  1MMD A;  4P9U A;  3S1Q J;  4ON0 A;  3TED A;  3S3O A;  5F04 A;  3ABM H;  3DKX A;  3LSK A;  1JKP C;  5L3F A;  1SMT A;  4ZYH A;  2XGE A;  3CC4 I;  1WCM J;  4CH7 A;  2DA1 A;  5F64 A;  2GM4 A;  3MMY B;  2MD5 A;  2EV6 A;  4OIQ F;  3WU2 C;  1B1B A;  5H6R A;  5CVR A;  4A6D A;  2FA5 A;  5BQT A;  2DW4 A;  2RNG A;  3FDY A;  3M7G A;  5KK1 A;  2WTE A;  2GXB A;  4XKW A;  5DYM A;  1KGS A;  4AC0 A;  4DZP A;  4MHG A;  5E18 F;  3ULQ B;  2ZFU A;  3DTK A;  4PZJ A;  2JA6 J;  1Z7U A;  3HPG A;  3FMS A;  1P4A A;  1F9N A;  4UNO A;  1T95 A;  2LY1 A;  3WTY C;  3FIS A;  4IHY A;  3PNV A;  4LLG F;  3C3W A;  3QYE A;  4N0B A;  3TDZ C;  2V79 A;  1G3Y A;  4HX4 A;  3K4C A;  1U6G A;  3HGG A;  3VSK A;  4WCG A;  1K6O A;  2A69 F;  1KQ8 A;  2PMH A;  4M3B A;  2Z9O A;  2MC3 A;  3DLL F;  1S8N A;  5D4S A;  1XS9 A;  5CQE A;  2LD5 A;  3JR9 A;  4EQQ A;  1YJN I;  4NHJ A;  2FBK A;  1FP1 D;  1DDN A;  3QP6 A;  1H9T A;  3HG9 A;  4ENN A;  2R7O A;  1H8A C;  2F2E A;  3TP3 A;  2FF4 A;  5DCM B;  4HBL A;  1R58 A;  2ZXI A;  2PMU A;  4MTD A;  3Q5F A;  2PJP A;  3K9T A;  5C4X J;  2HQ5 A;  2XKP A;  2O9L A;  2X51 A;  1B72 A;  3SFI A;  2DMU A;  3DWL E;  3FKJ A;  4HEA 2;  2LKS A;  2UXX A;  1YW7 A;  1KU2 A;  1OQY A;  1LVA A;  2X1C A;  5M3M J;  4XSX F;  5AIQ A;  2O8K A;  2RQP A;  2VON A;  3CJN A;  2HKO A;  2JZY A;  3FXJ A;  2KZG A;  1LVK A;  2DK5 A;  2DOA A;  2F5C A;  2OV7 A;  2X6Y A;  2XIG A;  3CF2 A;  2VQC A;  4IRH A;  4F91 B;  3K2A A;  4HLY A;  1LPQ A;  2DTR A;  2IAI A;  3B6C A;  2L9N A;  2M8G X;  4XSZ F;  4BXU A;  1K7A A;  2NVX J;  3PUF A;  4XON A;  1FMW A;  1ZN2 A;  3BG3 A;  4UB8 C;  5K5R A;  1ITY A;  2DT6 A;  3HOV J;  3VFZ A;  2DU9 A;  4A0Z A;  2JPC A;  1RES A;  2JSC A;  1X1D A;  2VBX A;  1NHA A;  1O3S A;  2C6Y A;  2VKD A;  3H3V K;  1ZGW A;  1X4O A;  2ID6 A;  3KCC A;  2P5K A;  1LUJ B;  3GWZ A;  4BDZ A;  1FYK A;  3ZP5 A;  4Q5S F;  1W7P A;  1BL0 A;  4EJO A;  4HNT A;  4BYY A;  5A2Q K;  4U88 A;  2CUJ A;  1S7O A;  3K70 C;  4AYB A;  2BBY A;  2UUZ A;  2B0L A;  2DA5 A;  4DYQ A;  5ED4 A;  1S3J A;  4CA0 A;  2QM3 A;  1LKX A;  1IC8 A;  4DYR A;  4Q4Z F;  5D5W B;  4PJN A;  2Y0S A;  1Z05 A;  3L2V A;  2GXA A;  4AD9 A;  2R4G A;  1X3Z B;  3HKZ A;  3NEU A;  4PJL A;  4CCN A;  2IBD A;  3CCJ I;  2XGD A;  4KT6 A;  2A5Y B;  2F5F A;  4D7N A;  1Y39 A;  2MFZ A;  2X48 A;  3Q0V A;  2EZK A;  2LP0 A;  5EZH A;  3ZMS A;  1QPI A;  4IHT A;  1ZK8 A;  4KMU X;  3JRF A;  2XUB A;  2N8G A;  2ELJ A;  1MBJ A;  2DTZ A;  3L9F A;  3F8B A;  3GX4 X;  3QPL A;  1XX5 A;  2E71 A;  3OR1 C;  5FD6 A;  2X6W A;  1P9Q C;  1ZG3 A;  1HF0 A;  3K6G A;  1E3O C;  2YX7 A;  3PNY A;  1TP4 A;  4B09 A;  3GTJ J;  2CFO A;  2XAQ A;  3IUO A;  3MN2 A;  3O8G A;  5DV5 A;  2EWN A;  2DLL A;  2L9S A;  5J4V A;  2W24 A;  3G1L A;  1IF1 A;  1G3T A;  3OYD A;  5H6Q A;  1TW3 A;  5KHD A;  3RKW A;  4YIF A;  4AID A;  4O5V A;  4WWC A;  1RZ4 A;  4UVB A;  2KMU A;  3HB9 A;  4HW0 A;  2QSG X;  3T1B A;  2L5Q A;  4WK8 F;  4JYK A;  3H3U A;  1VQP I;  3CCU I;  2VQG A;  2RV8 A;  3FBI B;  5GPC A;  2CV0 A;  4E70 A;  5E3N A;  4AM3 A;  3GTQ J;  1VQK I;  2BXY A;  5DEQ A;  4D7M A;  1VF9 A;  3E6B A;  3V7S A;  3WOD F;  4M74 A;  2E7W A;  2BW3 B;  3D0S A;  3EUH A;  2Y48 A;  2V1D A;  2H09 A;  4RGS A;  5FGM A;  4M3E A;  2W4S A;  2WA0 A;  3W2W A;  4XLA A;  1VI0 A;  4G7O F;  3HRT A;  4IQJ A;  2WAF A;  3E7L A;  3GCM A;  1T6S A;  2PEX A;  1O7L A;  2P6S A;  3TL4 X;  4A69 C;  1R36 A;  4M71 A;  3JCU C;  2XAH A;  1FJL A;  2DO7 A;  3WE3 A;  4F7Z A;  4GFB A;  3DTE A;  2E5N A;  4J00 A;  1L3L A;  1DGW Y;  2B9S A;  1IV8 A;  2AS5 F;  4C9Y A;  4S04 A;  1MZB A;  5IY5 H;  3OL3 A;  2E60 A;  2DCE A;  4KUM A;  2DA2 A;  2L4M A;  4XL9 A;  4E7S A;  3NAU A;  3WU1 B;  4U87 A;  1EA3 A;  3FXR A;  5D6E A;  4CCM A;  3S1N J;  3LQQ A;  2JK3 A;  1CF7 A;  2ISZ A;  1Z67 A;  2MLK A;  1KU9 A;  4L5E A;  5E1X A;  1EH6 A;  3K10 A;  1TWH J;  3TW7 A;  2IA0 A;  1ZKG A;  3ZQF A;  2LOO A;  5LGN A;  3GZ6 A;  1Z3Y A;  1VZ0 A;  4RMN A;  2JA2 A;  4LG3 A;  5BPI A;  4OIN F;  2R93 J;  3ZQG A;  5ILU A;  5JLW A;  2R7R A;  1FOW A;  3BR2 A;  3KET A;  4LIU A;  2BY2 A;  4G6Q A;  1BC7 C;  2ETH A;  4I01 A;  3MQ0 A;  1ETX A;  2L02 A;  3DBR B;  3FXK A;  2FOW A;  5D8L B;  3JRG A;  4A3M J;  1UZC A;  3LSG A;  1OCR H;  3CCY A;  3WG7 H;  4ASN A;  2XRL A;  3TOB A;  2J5P A;  1KQ9 A;  3ZXS A;  1WJ5 A;  4ZDO A;  5CVU A;  2PJR B;  1VQ4 I;  2ZB9 A;  1IXS B;  1R00 A;  5J8C A;  3R0J A;  2IP2 A;  1WPK A;  4XOR A;  1MKM A;  2HYJ A;  1FOY A;  2VKV A;  4KN7 X;  4XLE A;  1PUF A;  5FLV A;  2W00 A;  3E5X A;  3IH4 A;  5CQG A;  2HPM A;  2H1L A;  3DF8 A;  3ZMD A;  2VOO A;  1XC5 A;  5CYV A;  3FXQ A;  2QKL B;  3ASO H;  3NWT A;  1ZH5 A;  5IT9 Z;  2DJN A;  4DW6 A;  3V8L A;  2P5L C;  4CXF A;  2QSF X;  3GME A;  2HZD A;  3A02 A;  3VDX A;  2L9V A;  2BVL A;  5HLH A;  3L7W A;  2K86 A;  4BAC A;  3NWS A;  2Z33 A;  4L5I A;  2Z5U A;  1GDT A;  2OBP A;  3HRS A;  5E1W A;  4FT8 A;  4R79 A;  1Z77 A;  1HW2 A;  3JRH A;  3OYE A;  3T5X A;  3IKT A;  1K61 A;  2O3F A;  2PG4 A;  3H5A A;  4YFK F;  3QPH A;  2V26 A;  3LWF A;  1ZTR A;  3KE2 A;  4BJ6 C;  4MLO A;  1ORK A;  4S0H B;  1V5F A;  3MKL A;  2CJJ A;  2DA6 A;  5LLQ A;  4XOT A;  5HS8 A;  4E7I A;  1PDN C;  2A61 A;  1X2M A;  3BJO A;  4HG2 A;  3QWL A;  5J4Y A;  3F6V A;  5F27 A;  2P0W A;  3CDH A;  4KIS A;  1SAX A;  4M9S A;  2F4O B;  2O5R A;  4IJA A;  4NC7 A;  3GTL J;  3K1P A;  4MTE A;  3W3C A;  2EIM H;  1EF4 A;  4L5J A;  2FML A;  3SXY A;  1FT9 A;  1YW8 A;  2YX4 A;  5CVI A;  1D1C A;  2IPQ X;  1H0M A;  4BEH A;  4GDF A;  1BJA A;  2ZJR F;  1TL8 A;  1MSF C;  4B3X A;  3M1E A;  3ZQC A;  2IGN A;  1JXS A;  4B8X A;  2O03 A;  4I98 B;  4X0G A;  1H88 C;  3CUQ B;  4IOA F;  1YW9 A;  2LH9 A;  2M1B A;  4HZF A;  5LGT A;  3PIO F;  2HS5 A;  2HYF A;  2R7S A;  3SEZ A;  4I02 A;  4XM3 A;  2LK2 A;  4W97 A;  4MGR A;  4EGY A;  4QTR A;  3OOU A;  3TDU C;  2XDV A;  1I50 J;  1MBK A;  2OAZ A;  2STW A;  3KPH A;  2AXT C;  2EIL H;  2HEO A;  2XF6 A;  1F1Z A;  1BI3 A;  3B6A A;  4E7H A;  3MCZ A;  1RRJ A;  1W0U A;  1NK2 P;  1Z9C A;  1YG2 A;  3VYR B;  1RNL A;  3G1O A;  4QSH A;  5EGO B;  2IW5 A;  5DD8 A;  2CQN A;  4BE2 A;  4BBR J;  2DA4 A;  2MH9 A;  2KIU A;  3CTA A;  4A0X A;  3CO6 C;  4AIJ A;  1YX5 A;  2FOK A;  1K78 A;  2NNN A;  3V7R A;  1KYW A;  3LSR A;  1E3P A;  2LSO A;  2XPU A;  2ISY A;  1LFP A;  3M3Y J;  1HST A;  3MVP A;  3WGI A;  1W36 C;  1N25 A;  4BQN A;  4A3J J;  2ICW G;  1U5T C;  4HNV A;  2XKO A;  3ABL H;  2HPI A;  4MNU A;  1X1P A;  1S9H A;  2O7O A;  4M6Y A;  1R1V A;  1F5T A;  4HPQ A;  4HF2 A;  2DOE A;  3GVA A;  1TZL A;  2GA1 A;  1STZ A;  1ENH A;  2EZI A;  4BH9 A;  1Y0N A;  3BZC A;  3NQO A;  1YHQ I;  3ZOB A;  4LGW A;  5FD5 A;  5HNH A;  5KAI C;  4RB3 C;  3ROU A;  3DKY A;  3ML6 A;  2QF7 A;  2A6E F;  3S3N A;  1G3S A;  2GA2 A;  2RGV A;  4PFP A;  5LGU A;  4CO8 A;  3D5R C;  1R4N B;  5AIP A;  2GIZ A;  4QLC U;  1HLV A;  2OQG A;  3KLN A;  3FHZ A;  4BAY A;  3M8J A;  2R7W A;  1XSX A;  5DM6 F;  3RIR A;  1LE8 A;  3BR1 A;  2RRE A;  1X4P A;  3I0T A;  3RCO A;  2CH0 A;  3L00 A;  4BE1 A;  1OPC A;  2CO5 A;  1KU7 A;  3ZMU A;  4XQF A;  1ZAO A;  2BVM A;  3WHB A;  1H89 C;  1A31 A;  3T8R A;  4AU7 A;  1XB4 A;  2ZCW A;  3SZP A;  2VJ4 A;  1QQI A;  3BRO A;  2MW8 A;  4ENM A;  1ONV A;  2XPV A;  5FO5 A;  2F4I A;  2R7U A;  3V4G A;  3L2U A;  3VEP A;  2PQ8 A;  1QGP A;  3JRC A;  2M2E A;  3S17 J;  1UEL B;  3G71 I;  2XPW A;  1MJA A;  3GLL A;  1FNN A;  3BG7 A;  4UV8 A;  1QO0 D;  3CCL I;  4A12 A;  1TT0 A;  5ERI A;  4HA8 A;  4L9T A;  5EDN A;  5FKN A;  2VOP A;  2CQ7 A;  3H1C A;  3GZN B;  4K2E A;  3KFW X;  3SFZ A;  4KIT B;  2K9M A;  4N9H A;  5J1R A;  2QVO A;  1MH3 A;  2QUF A;  1UB9 A;  2Y30 A;  3M8E A;  2CMP A;  3BR5 A;  5F08 A;  2DMN A;  3GUD A;  1P7J A;  1TNT A;  2DOD A;  3ELK A;  2VT3 A;  1JUP A;  1RIO H;  5B3S H;  3R61 A;  1OCO H;  3I54 A;  5E3O A;  5ICC A;  3G3Z A;  1SAN A;  1ZRF A;  3IH3 A;  1QVT A;  3QYB A;  3HRM A;  2JSP A;  3CUO A;  3T8T A;  1K6Y A;  1RKW A;  2VIX A;  3BTI A;  2D2W A;  5BMZ A;  1ZR2 A;  2HDC A;  5HDK A;  4EM1 A;  1OYI A;  3HHH A;  3KEY A;  4UXN A;  5F0F A;  3DXJ F;  1CQT A;  1ZRE A;  4XID A;  3N97 A;  4V2F A;  1XD7 A;  3JAM Z;  1EH8 A;  3GW2 A;  2XSD C;  2VBW A;  3AL0 B;  3REO A;  3M07 A;  1EV7 A;  3P9C A;  5FFZ A;  5LHH A;  4W1U A;  4Y3O A;  5HDN A;  5BOX A;  1B9M A;  4U0W A;  3LSP A;  3CMY A;  3HEF A;  1QZE A;  3SYT A;  3WTZ A;  3IH2 A;  2FX0 A;  3QP5 A;  3KP3 A;  1YIT I;  1LQ1 A;  1U5T A;  3SDB A;  4LMY A;  4Z6Y A;  4B1R A;  3BOQ A;  3J81 Z;  2DBB A;  2Q1Z B;  2HI3 A;  4MQV A;  1JHH A;  3CES A;  2WV1 A;  4ESJ A;  4PSX A;  2DT7 B;  3RPU A;  4E7J A;  2KQR A;  1DP3 A;  1J09 A;  1U2W A;  1SD6 A;  3OIQ A;  4F52 A;  4G6T B;  1R5H A;  4ZYA A;  2AHQ A;  2P7C B;  2LNB A;  3RQ4 A;  3KZZ A;  3V7C A;  1ERD A;  2L9R A;  4MFD A;  1XGO A;  3M4O J;  2CUZ A;  3KP2 A;  2DOF A;  2VPL A;  1J0R A;  2X85 A;  4BE0 A;  2OUM A;  3SHF A;  4MO7 A;  3J80 K;  4E4H A;  4ZTJ A;  2VKE A;  3F0C A;  4QPQ A;  2GZW A;  4IXA A;  1E2X A;  3PM1 A;  2HVQ A;  5TGT A;  3OWT A;  5ICE A;  1WVR A;  5IP6 A;  4NQW A;  1BIA A;  4D1Q A;  3K7A J;  2P8T A;  4II2 A;  4BHP A;  1K4S A;  1BN5 A;  2IGM A;  2AQF A;  3HHG A;  4PGH A;  4ABZ A;  1MJB A;  3HOZ J;  2BY0 A;  4CUG A;  1VQN I;  4A3K J;  3I64 A;  4I99 C;  5JVG F;  3S2D J;  1U8R A;  2H8W A;  2W85 A;  2F4M B;  1TC3 C;  2A5W A;  2LBF A;  1JTY A;  1MGT A;  2R5Y B;  3I4P A;  2V9K A;  2VPR A;  3HBL A;  4KIC A;  4PUS A;  3LOC A;  2HU9 A;  2V1N A;  4L9J A;  4YFN F;  2KP6 A;  4PGG A;  4IKF A;  4Y7N J;  3S1M J;  4HF1 A;  1PYV A;  4AUX A;  4LK0 F;  2KRC A;  5EF6 A;  3CCE I;  2EFQ A;  2ZO4 A;  1RUO A;  2DQL A;  1IRG A;  2HGC A;  2IS6 A;  2QBY B; 
#chains in the Genus database with same CATH homology
 5IOY A;  1AKH B;  2H1K A;  2E2I J;  1ZR4 A;  1HF0 A;  1E3O C;  2B63 J;  1X58 A;  4AYB N;  3GTJ J;  2OPT A;  4IEJ A;  2NS7 A;  2Y31 A;  3MN2 A;  4XRM A;  3O8G A;  4A3L J;  1A5J A;  2TCT A;  2M0C A;  3HGY A;  1WI3 A;  2M9H A;  1XG1 A;  3G1L A;  3JRI A;  4XRS A;  1FIP A;  3HOW J;  2ECC A;  4BY1 J;  2E2J J;  1WH7 A;  2K9Q A;  2DMT A;  4A3I J;  5J1U A;  4UUS A;  3BTL A;  3I4M J;  5J1Y A;  4I76 A;  3HB9 A;  2ELK A;  2R5Z B;  2LR8 A;  4JYK A;  5J3L A;  1MBF A;  1Q1V A;  5K7Z A;  2Y2Z A;  2LTP A;  3JRA A;  3SDG A;  4J19 A;  5GPC A;  5M3F J;  5E3N A;  3BT9 A;  3QQA A;  3GTO J;  3GTQ J;  4D7M A;  1VF9 A;  5C3E J;  2K40 A;  1O4X A;  3WHC A;  4DZJ A;  1Y1V J;  1U9N A;  4Y52 J;  4JX5 A;  4M3E A;  5EGO A;  5FJ8 J;  3BTJ A;  1VI0 A;  4C3H J;  3GBG A;  3E7L A;  2PMZ N;  3OSG A;  1JUM A;  4JX4 A;  4A69 C;  3H0G J;  1FJL A;  3BQZ A;  5GP9 A;  5FKK A;  4BKX A;  2FJ1 A;  1QVU A;  4GFB A;  2XB0 X;  4M3F A;  5M5X J;  2NS8 A;  3S15 J;  1U9O A;  4NDL A;  2DA2 A;  1AKH A;  3NAU A;  5IYC J;  1HOM A;  2XGC A;  3FK7 A;  3TW6 A;  5DTD A;  3S1N J;  2K9N A;  4RDU A;  2JK3 A;  2L7M P;  1JT0 A;  2X9D A;  2GBY A;  4L5E A;  1JTX A;  1Z0X A;  2W48 A;  2AO9 A;  1TWH J;  3TW7 A;  3RZD J;  1ZKG A;  1TWC J;  2MGQ A;  3ZQF A;  1MBG A;  2EBI A;  2P81 A;  3DCF A;  3A03 A;  1POG A;  2YU9 J;  4DYC A;  2R93 J;  3ZQG A;  3S1R J;  1TWG J;  5JLW A;  2JA5 J;  5M5Y J;  1A6I A;  2DA7 A;  2EH3 A;  3BR2 A;  1U78 A;  2EZH A;  2CRG A;  2KDZ A;  1IV6 A;  1ETX A;  3JRG A;  4A3M J;  2EZL A;  1RPW A;  3GTG J;  1APL C;  3LSG A;  2CQQ A;  4IHX A;  3CCY A;  1R9T J;  2XRL A;  3FK6 A;  2CQX A;  4V2G A;  3S2H J;  4D5F A;  3FKI J;  2LVS A;  2Y9Z A;  3RKQ A;  2TRT A;  2ZB9 A;  3Q0W A;  4FIS A;  2L0K A;  1WPK A;  2VKV A;  2HYJ A;  2DN0 A;  3QPS A;  1PUF A;  3FIW A;  5FLV A;  3IH4 A;  5EYR A;  4FCY A;  1XC5 A;  5IOZ A;  2DJN A;  1ETW A;  4DW6 A;  2CU7 A;  3HOX J;  5M5W J;  3A02 A;  5FKL A;  2WB1 N;  1JKO C;  3RQI A;  5IP9 J;  1IUF A;  3IV5 A;  1GDT A;  3OIO A;  4BY7 J;  2GLO A;  2CUF A;  1GUU A;  1Z77 A;  2YUS A;  3JRH A;  1K61 A;  2ECB A;  5EG0 B;  5FLM J;  1ZTR A;  1BW5 A;  4MLO A;  1ORK A;  4CYC B;  3JRE A;  4S0H B;  1MNM C;  2JA7 J;  3MKL A;  3I4N J;  2CJJ A;  1UHS A;  2DA6 A;  1VFC A;  1LFU P;  3A01 B;  1X2M A;  2JMW A;  4C3I J;  2G0E A;  2JN6 A;  3HDD A;  5F27 A;  3S16 J;  1ETY A;  5C4J J;  2L7Z A;  3BG5 A;  4XRS G;  2EQR A;  3GTL J;  1K83 J;  1ETQ A;  2QCO A;  1JT6 A;  1EF4 A;  3HM5 A;  3G1M A;  1HDP A;  1PUF B;  2Y0S N;  3BR3 A;  3S14 J;  3PO3 J;  1I6H J;  1UMQ A;  1TWA J;  1ETO A;  4B4C A;  1W0T A;  1MSF C;  2M34 A;  3ZQC A;  1GV5 A;  3BR6 A;  2OF7 A;  1FIA A;  1JKQ C;  2HOS A;  3GTM J;  1WGX A;  1H88 C;  1LFB A;  2YS9 A;  1FTZ A;  1IG7 A;  3HOU J;  2LK2 A;  4W97 A;  4IHW A;  1U8B A;  4QTR A;  3OOU A;  3ZQI A;  4XIC A;  1NTC A;  5HOD A;  1I50 J;  1MBK A;  1ETV A;  5IYB J;  5DS9 A;  4JX6 A;  3B6A A;  1HCR A;  1W0U A;  1MBH A;  1JJ6 C;  1NK2 P;  3TP0 A;  5EEA A;  3W6V A;  3G1O A;  4QSH A;  5FKM A;  5EGO B;  2WAQ N;  4G12 A;  1HDD C;  4A3D J;  1QRY A;  2RAE A;  4BBR J;  2COB A;  2DA4 A;  2ID3 A;  2NVY J;  2H8R A;  3Q3S A;  3LSR A;  2FQ4 A;  2XPU A;  1LE8 B;  1OCT C;  1YRN A;  2HXO A;  3M3Y J;  5E3M A;  3MVP A;  2K9S A;  3VPR A;  4A3J J;  4HNV A;  2ME6 A;  5JLX A;  1VND A;  2O7O A;  2X6O A;  1BW6 A;  2E19 A;  2IEK A;  4D5C A;  1MBE A;  2L7F P;  4A3B J;  2DMQ A;  3GTK J;  1ENH A;  2EZI A;  2R0Q C;  1FTT A;  3ZOB A;  2LY9 A;  2MSY A;  1JKR C;  1JJ8 C;  2VUM J;  3NAR A;  2QF7 A;  3O8H A;  2DA3 A;  1T56 A;  5IPA A;  1MH4 A;  5BNG A;  1SFO J;  3UKG A;  5F1J A;  1HLV A;  3JRB A;  2HDD A;  4A3G J;  4BBS J;  2JJ7 A;  3A01 A;  1AHD P;  1ZQ3 P;  2CUE A;  4I6Z A;  3BR1 A;  1LE8 A;  5K7F A;  2JWT A;  3L1P A;  2JA8 J;  2R92 J;  3WHB A;  5E3L A;  4C2M J;  4CYC A;  1H89 C;  2HOT A;  3HOY J;  1MSE C;  3SJM A;  2XB5 A;  2MW8 A;  4A93 J;  5IYD J;  2HOA A;  2XPV A;  5EG0 A;  3S1Q J;  4MFE A;  1RET A;  2NVT J;  1G2H A;  3TED A;  5F04 A;  3JRC A;  1JKP C;  2M2E A;  3S17 J;  3C2B A;  2XGE A;  1IDZ A;  2XPW A;  1WCM J;  2DA1 A;  1TWF J;  2GM4 A;  4UUT A;  2NOG A;  1OCP A;  2I10 A;  1OJL A;  5EDN A;  5FKN A;  4M6V A;  4MIM A;  1X2N A;  3CQZ J;  2R5Z A;  4AC0 A;  4DZP A;  3Q0U A;  1JGG A;  5J1R A;  2JA6 J;  1GT0 C;  1MH3 A;  2FD5 A;  2Y30 A;  5F08 A;  3BR5 A;  2ME0 A;  4UUS B;  1T33 A;  2DMN A;  3FIS A;  4IHY A;  1P7J A;  1UG2 A;  3LNQ A;  2R5Y A;  1JUP A;  3ZQH A;  3HGG A;  5GPA A;  5E3O A;  1SAN A;  4M3B A;  2LKX A;  3IH3 A;  1XS9 A;  1QVT A;  5K7H A;  3BG9 A;  4M3D A;  2LD5 A;  1GV2 A;  2R7Z J;  3JR9 A;  4FTH A;  1IRZ A;  1RKW A;  3BTI A;  1ZR2 A;  1B8I B;  1S7E A;  1D5Y A;  5F0F A;  1YRN B;  1CQT A;  1F43 A;  3BTC A;  3GTP J;  4XID A;  1H8A C;  4JP0 A;  4V2F A;  3TP3 A;  2XSD C;  2NVQ J;  4A3E J;  2E2H J;  2HQ5 A;  5C4X J;  1FEX A;  2O9L A;  1B72 B;  1B72 A;  3HKZ N;  3SFI A;  2DMU A;  4W1U A;  4RBO A;  3LSP A;  3CMY A;  3HEF A;  4X6A J;  3IH2 A;  2FX0 A;  3BQY A;  5M3M J;  4IHV A;  1Y1W J;  2O8K A;  1RKT A;  4C3J J;  4B1R A;  3RZO J;  5F0C A;  1B8I A;  2HI3 A;  2WV1 A;  1GVD A;  3K2A A;  1DU0 A;  1IGN A;  2IAI A;  3B6C A;  2M8G X;  5EZG A;  2E1O A;  1IDY A;  2AHQ A;  2NVX J;  2D5V A;  4EEF G;  3BG3 A;  4X1E A;  1ITY A;  3HOV J;  4XK4 A;  2L9R A;  1OFC X;  1RES A;  4MFD A;  3ZQL A;  1RR7 A;  3M4O J;  2HXI A;  5IP7 J;  3PO2 J;  1JUS A;  4MO7 A;  3BR0 A;  1ZGW A;  4FE7 A;  2ID6 A;  3H3V K;  1DU6 A;  2VKE A;  3F0C A;  2DMP A;  3LSJ A;  3JRD A;  1BA5 A;  5C44 J;  3OSF A;  1BL0 A;  1WH5 A;  1F36 A;  3PM1 A;  4A3F J;  2KT0 A;  4B3A A;  2LFB A;  2MG4 A;  3DEW A;  5IP6 A;  2Y9Y A;  2DA5 A;  4DYQ A;  3K7A J;  1IJW C;  1IC8 A;  1NK3 P;  1I3Q J;  4DYR A;  4A3C J;  4ABZ A;  3HOZ J;  1P7I A;  1BJZ A;  4A3K J;  2LLK A;  3CDL A;  9ANT A;  4QIW N;  3S2D J;  1ETK A;  2IBD A;  1TC3 C;  2XGD A;  1AU7 A;  1JTY A;  4D7N A;  2X48 A;  2R5Y B;  2VI6 A;  3Q0V A;  2VPR A;  2EZK A;  2LP0 A;  3HBL A;  5EZH A;  1QPI A;  3LOC A;  1ZK8 A;  3JRF A;  4Y7N J;  2N8G A;  3S1M J;  4BXX J;  4AUX A;  5EF6 A;  1MBJ A;  2DTZ A;  4FE4 A;  4LOC A;  4M3G A;  5FKO A;  3QPL A;  3D1N I;  5F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...