1B72B

Pbx1, homeobox protein hox-b1/dna ternary complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
RKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*GP*AP*TP*CP*GP*G
publication title Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein/dna
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b72B00
3HOUJ 5M3MJ 2XGEA 3GTJJ 9ANTA 3FK6A 2GBYA 2DA6A 3BR6A 4AYBN 1U8BA 1WCMJ 5IYCJ 2DA1A 2GLOA 5JLWA 2KDZA 3BR1A 4S0HB 4EEFG 1RESA 4MO7A 5IP7J 3F0CA 3JRGA 3HOZJ 4NDLA 3HEFA 1E3OC 3D1NI 1SFOJ 1MSEC 2JN6A 2Y0SN 2K9QA 4JX6A 3BR3A 1YRNA 2MGQA 2RAEA 3GTMJ 2FX0A 4DZJA 3S1MJ 3IH3A 4MLOA 3LSRA 3CQZJ 3M3YJ 2WAQN 2R5ZB 1O4XA 1W0TA 4A3KJ 5FLVA 3I4MJ 1SANA 2O7OA 2QF7A 4A3DJ 2L7FP 1B72B 2OF7A 1G2HA 4IHWA 2FQ4A 2DN0A 4DYQA 1IDZA 3DEWA 3JRIA 1JTXA 2HDDA 3JRAA 3NARA 2O8KA 1JKOC 1X2MA 2R7ZJ 5J1YA 3OSGA 3BTCA 1GT0C 1FJLA 2NVTJ 5M5XJ 4CYCB 4A3BJ 4B1RA 3JRDA 2DMUA 1IGNA 3LSJA 1RETA 2NVXJ 5M5YJ 1OCPA 2G0EA 1BW6A 2IAIA 4UUSA 3S2HJ 1ZK8A 4JP0A 1OJLA 1IV6A 1I6HJ 2ID3A 2VUMJ 3IH4A 1ZQ3P 1U9NA 2OPTA 1IRZA 4DYCA 3TEDA 3TP3A 3BTIA 1IG7A 5EZGA 4BY1J 1B8IA 4MFDA 5EG0B 3JREA 2M8GX 3GTLJ 4W97A 4A3MJ 3GTKJ 5FKNA 2CUFA 3SFIA 5EGOB 4RBOA 1BW5A 2EZKA 5C44J 1A5JA 3QPSA 5IOZA 2CRGA 3HBLA 1JJ6C 2TCTA 3I4NJ 1QRYA 3S1RJ 2COBA 1JTYA 3RQIA 4M3EA 1H8AC 3PO3J 3QPLA 4XRSG 2X9DA 1UG2A 4V2FA 4A3LJ 2DA3A 4G12A 1MBKA 1ZR2A 2EZIA 3CDLA 1VFCA 4W1UA 1FIPA 3BTLA 4I76A 1AU7A 1GV5A 4IHYA 2DA5A 4C3JJ 5FJ8J 3JRFA 2L7MP 3QQAA 4A3JJ 1RKTA 3HOVJ 2E1OA 2AHQA 2NS7A 1PUFB 1XS9A 3TW7A 3WHBA 2JMWA 2R5YB 4DYRA 4XIDA 1AKHA 1F43A 3BTJA 1Z77A 3LSGA 2HOAA 3H0GJ 1D5YA 2ID6A 2ME6A 1ETYA 1DU0A 4XRMA 2X6OA 2LFBA 3Q0UA 4A3EJ 3A01B 4M3FA 3JRHA 2Y9YA 1LFUP 2DMQA 3BR0A 3K7AJ 1GDTA 2DA4A 3TP0A 1MBEA 4A3IJ 5F27A 5EYRA 5JLXA 4D5CA 1BJZA 2QCOA 3ZQFA 2L9RA 4BBRJ 2LKXA 3M4OJ 2P81A 3NAUA 1X58A 5GP9A 3B6AA 5E3MA 3S2DJ 1FTTA 5IOYA 1GUUA 3BR5A 2HXOA 3HGGA 1WPKA 1XG1A 3IH2A 4FE7A 2DMNA 2R5ZA 1HF0A 1MBHA 4A3FJ 2XPVA 4MFEA 2LLKA 4M3DA 3HKZN 3ZQCA 3UKGA 4RDUA 1WGXA 1B72A 1IJWC 1ETXA 3BG9A 5IYDJ 5E3OA 1DU6A 1JUPA 2XPUA 4A3CJ 3FIWA 4FTHA 1T33A 3A02A 4UUTA 1I50J 3TW6A 1IUFA 1HCRA 4I6ZA 3E7LA 2E19A 3LSPA 2O9LA 5DS9A 4D5FA 2NVQJ 4XRSA 1UMQA 1ZKGA 1QVTA 2DA7A 2EZHA 3BG3A 4FISA 2K9NA 2VPRA 1TWAJ 2XRLA 2CUEA 3MN2A 3ZQIA 1WH7A 4BKXA 2JA5J 4CYCA 3IV5A 1TWFJ 5EZHA 5BNGA 4QIWN 1MBJA 3PO2J 4Y52J 3MKLA 1K83J 1Y1WJ 5J1UA 1ETVA 4DZPA 2W48A 2R93J 5C4JJ 5F08A 5FLMJ 5K7FA 2CJJA 5E3NA 4BXXJ 2M9HA 2N8GA 2M34A 1CQTA 3RZDJ 3JRBA 3LNQA 2ECBA 1WI3A 1RR7A 4C2MJ 3FISA 2NVYJ 5EG0A 2Y2ZA 3HM5A 1U78A 1LE8B 3ZOBA 3SJMA 2YU9J 1ORKA 2L7ZA 4HNVA 3GTPJ 3Q0VA 2M2EA 2XB5A 3RZOJ 1HLVA 3HGYA 5EGOA 4Y7NJ 3A03A 1EF4A 5GPCA 1I3QJ 2CQXA 3BG5A 1NTCA 4BY7J 1QPIA 4C3IJ 4A3GJ 3G1OA 2HOTA 1VNDA 2GM4A 5M5WJ 2ZB9A 5FKKA 1VF9A 1NK3P 3LOCA 1T56A 3H3VK 3OSFA 4L5EA 1MH3A 3HOXJ 5IP9J 2B63J 3S14J 3MVPA 1OCTC 1XC5A 4BBSJ 3HOYJ 1JKRC 3W6VA 4QTRA 3ZQLA 1H88C 4M3BA 5FKLA 2HXIA 3GTOJ 3B6CA 5J1RA 1JUMA 3K2AA 5K7ZA 1IDYA 1JJ8C 2I10A 2LR8A 2MW8A 1JT0A 5IP6A 2IBDA 1PUFA 4AC0A 2MSYA 2R92J 2DMPA 1P7IA 1Q1VA 2LD5A 1GV2A 2R5YA 3OIOA 2WB1N 2AO9A 3GTGJ 2H1KA 1YRNB 4M6VA 1A6IA 3GTQJ 3ZQHA 5F04A 2NOGA 1TWHJ 2FJ1A 3A01A 1ZGWA 2NS8A 1P7JA 2Y31A 1S7EA 1ETKA 2VI6A 5FKOA 5F0CA 2K40A 1APLC 5FKMA 1MNMC 5F0HA 1FTZA 1ETQA 4QSHA 3G1LA 2ECCA 3RKQA 4X1EA 4A69C 4B4CA 4JYKA 3GBGA 3FK7A 5GPAA 5K7HA 2JA7J 1JGGA 5EDNA 4JX5A 5DTDA 2WV1A 2ELKA 4JX4A 2EH3A 3BT9A 2IEKA 3L1PA 4XK4A 2JWTA 2K9SA 4MIMA 1U9OA 3S1QJ 3SDGA 3OOUA 2E2JJ 1RKWA 1MSFC 3G1MA 3HB9A 4UUSB 1TC3C 1ETOA 2DA2A 4IHVA 2DJNA 1W0UA 1FIAA 4A93J 2EBIA 1JT6A 5C3EJ 3HDDA 1IC8A 3JRCA 2HOSA 2JJ7A 4FE4A 3FKIJ 4D7NA 4XICA 2VKVA 2YS9A 5J3LA 1UHSA 5IPAA 2Y9ZA 1B8IB 4AUXA 5EF6A 1GVDA 2FD5A 3HOWJ 1JKQC 2HI3A 2LP0A 2XPWA 4LOCA 2EZLA 3BQYA 3BQZA 1ZTRA 5IYBJ 1VI0A 4IHXA 1LFBA 1ENHA 3S15J 2ME0A 1H89C 4ABZA 2XSDC 1ITYA 1JUSA 3ZQGA 3BR2A 1OFCX 4IEJA 1POGA 1WH5A 1ETWA 1X2NA 1HOMA 2XB0X 4B3AA 3WHCA 3VPRA 1F36A 3Q3SA 5E3LA 4FCYA 5F1JA 1BA5A 2L0KA 2E2HJ 2XGCA 1JKPC 2HYJA 4V2GA 4X6AJ 3CMYA 1RPWA 5C4XJ 2LTPA 1AHDP 3O8HA 2TRTA 2DMTA 3C2BA 2CU7A 4J19A 3S17J 3DCFA 1LE8A 4GFBA 2H8RA 1Z0XA 5F0FA 1NK2P 2D5VA 5HODA 1TWCJ 3JR9A 1TWGJ 2JA6J 2HQ5A 2R0QC 5M3FJ 2LK2A 3Q0WA 2LVSA 1HDDC 1ZR4A 1FEXA 1R9TJ 2M0CA 1Y1VJ 2CQQA 2YUSA 4M3GA 3CCYA 2JK3A 2KT0A 1K61A 4DW6A 1QVUA 2E2IJ 2XGDA 1BL0A 2X48A 5EEAA 3S1NJ 1AKHB 4C3HJ 2LY9A 2VKEA 3PM1A 2MG4A 1MH4A 4D7MA 2Y30A 3S16J 2DTZA 1MBFA 2PMZN 1MBGA 1HDPA 2EQRA 2JA8J 3O8GA
chains in the Genus database with same CATH superfamily
3HOUJ 1DGWY 2XGEA 4V19K 9ANTA 2GBYA 2DA6A 3BR6A 2L7KA 2Z1DA 1X1AA 3IL2A 3BR1A 2E1MC 2NXNB 2CO5A 3OYEA 1WRJA 1LUJB 3JRGA 4NDLA 3EUKL 3D1NI 1SFOJ 1SD5A 2Y0SN 1HW2A 4CCLA 2MGQA 5CVJA 2RAEA 2HFHA 4UUVA 4NUBA 3ZMSA 4B44A 3A0HC 1FC3A 3BWGA 2L5QA 4MLOA 3V7SA 4M9SA 1YFHA 1BOBA 4A3KJ 1W0TA 3I4MJ 2O7OA 2DFEA 2QF7A 4NQWA 4IXAA 4WXCA 2EA4A 3AKZA 2Y75A 3QYFA 5HNFA 2RQPA 4E7KA 4OMZA 3KP7A 4XBFA 3CCLI 1BR2A 1KQ0A 1XCBA 3MAJA 4BE2A 3JRAA 3CTAA 4A6EA 2QSHX 4OWRB 1V5GA 1Y39A 3V8KA 3ABKH 3HRMA 3MKZA 3E1SA 3QU6A 1GT0C 3GZNB 4AIHA 1R5GA 3DU6A 3JRDA 3DLAA 4G6DA 4P5OA 1IGNA 4BDZA 2M87A 1J2XA 1BW6A 2GIVA 3O6BB 2OZ6A 2OU2A 4IF4A 5D4RA 2VT2A 5BMZA 4Y17A 1VQ5I 2A69F 1KONA 3QOEA 5DD8A 3FXLA 2X0LA 4LFUA 2VUMJ 3KP3A 5CQGA 4DYCA 3TP3A 1KU2A 3AG4H 1IG7A 4AM3A 1YJWI 3P7NA 4KIGA 1D1BA 2OBPA 1M1EB 3EPZA 4RB0A 3CJQB 4L9VA 5EG0B 2XC7A 3PIOF 4NC7A 4BQQA 1ZRFA 4W97A 3CMAI 1SMYF 5GTIC 1QZEA 3R4KA 1O57A 1LVAA 2CUFA 3SFIA 4Q5SF 2EZKA 1GLNA 3ECHA 3T1BA 5IOZA 5IT3A 3BJOA 4XKVA 2VE8A 2PMZA 5E1XA 5D5UB 1OYWA 2FQ3A 2GQQA 4B8XA 2AXLA 4M73A 4ESJA 3EYIA 3I4NJ 4Q4ZF 4MGRA 2CV0A 4EMSA 1JTYA 4UVBA 3ABMH 3VSLA 3TGNA 2ZJ2A 3J7AO 4IL6C 4XRSG 2HVRA 4ENKA 2NNYA 1VQNI 4I09A 2Y0SA 1Z6RA 5HDNA 2EJRA 1BOAA 4W1UA 2L2OA 1WHUA 4I76A 3KYCB 3SEZA 1WJAA 4IHYA 2E36A 4FHTA 3FXKA 4RLFA 3JRFA 2PEXA 1WFXA 3GX4X 1O3QA 2L7MP 3QQAA 4A3JJ 2ZMEC 5LHGA 3HOVJ 2E1OA 2X6YA 2DXIA 4C30A 5B5EC 1MMDA 3GYHX 2ZJQF 1FWZA 4GYGA 4MEXF 2WAEA 2HOAA 2E1CA 2LYCA 2STTA 2ID6A 3HUGA 2DW4A 1P2FA 4XRMA 2X6OA 4A5NA 2LFBA 3QYEA 5CKTA 3OIPA 4HOBA 1UELB 3KETA 3JRHA 3H1CA 2D1HA 1TQMA 2FSWA 2DMQA 1J5YA 1ZARA 3KEOA 4C2UA 1GDTA 3KFWX 2DA4A 4RA2A 3GXOA 1OYIA 1MBEA 1MNDA 3F6OA 4A3IJ 1T2KA 5F27A 3DF8A 2QCOA 3OYFA 3FXJA 3E6BA 4BJ6C 3HTSB 2VPLA 2LKXA 3M4OJ 1SAXA 3B6AA 1RC9A 3DTEA 1FLIA 1FOWA 2ZFWA 5DCMB 1TL8A 4YEJA 4PCQA 3OL4A 1LDDA 2Z2SB 4EGYA 3HGGA 3BLYA 1IAWA 2XAJA 4FE7A 2P5LC 1LKXA 1JE8A 1IW7F 1EH6A 2F4MB 2MD5A 2R5ZA 1RRJA 1MBHA 2H09A 4B43A 3QP5A 1X19A 4XKWA 1SVMA 3HKZN 4II2A 4UV9A 5LLQA 2EK5A 1B72A 3EUHC 1IZ1A 1TT5B 5KAFC 1T08B 4A3CJ 1I1SA 4AIDA 4HZFA 3A02A 1XN7A 3TW6A 1I50J 2XKOA 1FOYA 2V79A 3LSPA 3RYRA 5D8LB 2M4GA 1X1CA 4C2TA 4XRSA 1ZKGA 4RAYA 2BY3A 2MYSA 1MDMA 2VPRA 3TDUC 4CICA 2EV6A 2ZXJA 3IV5A 3DBLB 5EZHA 3K1MA 4Y52J 1K83J 3K1NA 1TP4A 4HF2A 4G94A 2BHYA 3F8CA 2V6EA 3E5UA 5J1UA 3S3OA 3AFHA 2R3SA 4L5IA 5C4JJ 1LJ9A 2CJJA 5E3NA 2M9HA 4CH7A 5CVVA 4CHUA 4JQFA 1CQTA 1W7PB 3JRBA 4I2OA 1ZAOA 3LNQA 1S8NA 5K5QA 4UXNA 4OIOF 4XSXF 3VODA 3HJEA 4KYWA 2NVYJ 5DD4A 3HM5A 4IRHA 3SJMA 4BACA 2Q0OA 2M2EA 1LEAA 2KKOA 2CUZA 2X6WA 1O3TA 3FZVA 4Y7NJ 2ISYA 1EF4A 1X3ZB 5GPCA 3J81Z 1NTCA 4YG2F 2TDXA 1Z7LA 3JSOA 2A68F 2ZXWH 4E7HA 1Z9CA 3E6DA 2HOTA 1VNDA 4HAMA 3JAMK 5LRRA 1O7LA 4A0ZA 1XMXA 3PJRA 1IXCA 1Z6TA 1JXSA 4ZYEA 4YFXF 4HX7A 2WY7Q 3LOCA 1UHMA 4PK4A 1T56A 3RPQA 1GVJA 3TDZC 2QM3A 2RNGA 2KQRA 4G6QA 2ZXHA 5CJ9A 3S14J 1OCTC 1Y0NA 5DYMA 1XC5A 3FM3A 5L3CA 5J4YA 3HOYJ 1JKRC 1OCOH 1K7AA 5FD6A 2B0LA 1ULYA 3H3ZA 1R1TA 4A12A 4ESBA 3GTOJ 2QWWA 1D3YA 5K7ZA 1JUMA 2V6CA 1EJ9A 1RUOA 5E1WA 4GXOA 3DEEA 2R7QA 2O61A 4XR6A 4XNFA 3CCQI 2FOWA 3C18A 4OINF 2LH9A 3SXYA 4RGXA 3RDIA 3HKZA 1SMTA 2LY2A 4AC0A 2R92J 2YX7A 1CF7A 4HLXA 4FQGA 3ML6A 1Z21A 3ULQB 2R5YA 1D8JA 1T6SA 3WG7H 1B6AA 2AO9A 3GTGJ 3SHFA 1P4XA 4C9YA 4M6VA 3K4JA 3GTQJ 1YJNI 5TISC 2JTVA 3VWBA 3GFLA 1TWHJ 3DPUA 2NS8A 2VJIA 4CA0A 1WQ2A 1ACIA 2H94A 3FXMA 4I0AA 1O7FA 2OAZA 3HRSA 2EB7A 5LGNA 5FGMA 2ZSHB 4WK8F 2K40A 1APLC 3OOPA 2F5FA 3T0YA 4GGGA 4YFKF 2ZO4A 4FX0A 1A35A 1FTZA 4QSHA 4B48A 4BYYA 1XDSA 3M7GA 2W25A 4ZDPA 3KYLA 1OCRH 4A69C 4G7ZF 2W1OA 4B4CA 3WTXC 5K7HA 5GPAA 2Q8KA 4L5JA 5EDNA 2P6TA 3SZGA 3S2WA 1IV8A 5D5XB 4KIBA 2JRMA 5DTDA 5DEQA 3S3NA 2QQ9A 4BNCA 3ZXSA 1N78A 5D4SA 2OUMA 4JX4A 3C2GA 3CCJI 3L1PA 1GHCA 4XK4A 2JWTA 2G9WA 3L09A 3FXQA 4LLGF 1G3YA 2EIJH 1MSFC 2GXGA 1ZRCA 4UUSB 2XAFA 1W0UA 3ZMTA 1ZREA 4A93J 1JT6A 3P9KA 4FX4A 2HOEA 3SEQA 2HOSA 1OPCA 1RZ4A 3FKIJ 4UVAA 4NC8A 5E79C 4P9FA 1ZELA 4D7NA 1YW9A 2VKVA 2YS9A 5LD2C 1GXPA 2BYVE 2CW7A 5EF6A 5GAEJ 2ZJRF 2R7XA 1O3RA 2KIFA 4G9YA 3ASOH 2HEOA 3U1KA 5FFXA 5DCFA 1ZTRA 2V9PA 2KPMA 1LFBA 4IHXA 1IRFA 5JHUA 5HNHA 3S15J 2ME0A 1SVLA 3I0TA 5HLGA 1PDNC 2EIMH 1UJ8A 3BR2A 3DQVC 4IEJA 4PJ0C 5E18F 3G73A 2KIQA 4B3AA 2XROA 3NQOA 2VBYA 3Q3SA 2IRFG 1EV7A 1HKTA 2R7UA 2KDOA 1PYVA 5F1JA 3GLLA 2PG4A 4V2GA 1PP7U 3HTUA 3R6SA 3OYKA 2KIUA 4N9HA 1E2XA 3BZ6A 2KRCA 3K9TA 1VQ7I 2M45A 2CU7A 1TTYA 2CFOA 2JPBA 3S17J 3DCFA 2LMDA 4FETA 1EH7A 2BE5F 2C6YA 2D5VA 5HODA 2VC0A 1Z3YA 1G8XA 2M3AA 4IRGA 3JR9A 2JA6J 2IS6A 2LK2A 2NS0A 1KA8A 2LVSA 1T39A 1Y0UA 1ZR4A 5E8IA 1Y1VJ 2YUSA 3RJPA 1MMSA 2V4JC 5ILVA 5FB2A 1PJRA 4ENMA 1YTYA 4Y3OA 2M5WA 4KIFA 3NWTA 2K4JA 2HQRA 2K27A 3A4CA 5CYVA 4KT6A 2PJPA 1G4DA 4ON0A 4QPQA 1MIJA 3OY9A 2OTJI 4CCNA 2EFPA 1BI2A 2CUJA 2Z9OA 3S16J 2EPFA 4HLYA 1A04A 3KP5A 1FT9A 4LLLA 1SD4A 4EV0A 1QZZA 1MBFA 1FOXA 2EQRA 2JA8J 3H5AA 2VC1A 4DOZA 3RPUD 3FK6A 4BJTA 2F5CA 2ZBKA 4AYBN 2JPCA 1WCMJ 1DPUA 3LWFA 3F8NA 2MH2A 1U5TA 4BXFA 1ZGAA 1NG6A 1P9QC 3GO5A 4RLQA 1VQOI 4EEFG 1FSHA 3H0DA 4MO7A 4P9UA 4RMNA 4L9NA 2BGCA 2K9QA 3EUAA 5B1AH 2YX4A 1YRNA 1VQ8I 4HPQA 3BC8A 3GW2A 3QU3A 4I7HA 1OYYA 3P9IA 3GTMJ 4DZJA 3CC4I 2A5WA 3S3MA 2BV6A 2GWRA 4HQEA 1F4KA 1SANA 4LB5A 4A3DJ 2GA1A 3Q9SA 2KP6A 4B47A 1L3LA 2I5UA 1SEUA 2VJ4A 5E8GA 3VDXA 2HKXA 4IHWA 1D0ZA 2L4MA 2XAGA 2P0WA 1IDZA 3DEWA 4IQJA 4R8HA 3C7JA 3IKTA 4ETSA 2OC6A 4JOMA 1JKOC 1YW7A 2ZC2A 5J1YA 3OSGA 3CF2A 1D1AA 3RPUA 3BTCA 4XLEA 2W24A 3KP6A 1FJLA 3AL0B 3CP8A 2HVQA 2WV0A 4BEHB 2DMUA 2QZ8A 1I39A 4IOCF 5J47A 1F5TA 2VQCA 3DV8A 2QQ8A 3QAHA 3L00A 2CW0F 5HDGA 2J5PA 3WTUC 1S3JA 1ON1A 1ZK8A 2HYFA 1R23A 2V1NA 3LAJA 5E1ZB 2DTRA 2O0YA 2ID3A 1KU7A 3IH4A 3B02A 3W6KB 5K5RA 1ZQ3P 4DBQA 2OPTA 3IWZA 4HNTA 2CW8A 1DUXC 5J40A 4UB8C 2ZKZA 4BY1J 1SD7A 5DM6F 2DT5A 2Z5UA 1ZG5A 1B8IA 1R5HA 3JREA 3GTLJ 3CCMI 2NYXA 2HVSA 5HS9A 4A3MJ 4OIQF 1BW5A 5C44J 3HIFA 3HSEA 4YFNF 4HV6A 1SVOA 4RS8A 3ISPA 4PUSA 2HPMA 5FROA 2CRGA 1JJ6C 1IN7A 2TCTA 2XF5A 2DPDA 2EFOA 2PX9A 3FKJA 5F1RA 1MKMA 2O8XA 2R7DA 1YI2I 4AYBA 1LDJA 3IUOA 2XAQA 2KIMA 3QPHA 4PJLA 2I8DA 3W2VA 3CCUI 4UNOA 1WI9A 1NG7A 4KNYA 3WTYC 3G2BA 3QRFF 3TMOA 4G12A 1SC7A 2JT1A 1R22A 2DU9A 2FNAA 3H9QA 1HSJA 2K4BA 1GV5A 2DA5A 4C3JJ 5J8FA 4M6XA 3D0SA 4RGUA 3H3UA 3FDYA 2ZJPF 2PBIA 2RV8A 3I4PA 4IHSA 2DCEA 3W2WA 2Z16A 3VSKA 4N4OB 1AKHA 4XIDA 3BTJA 4P96A 2F2EA 4A6DA 2GXBA 2ME6A 3KEYA 4Q47A 3OYJA 3H9JA 3H5NA 3Q0UA 3QODA 4A3EJ 2CV1A 4KICA 2HDCA 3ZMVA 5BPIA 4XMYA 3G6EI 1YIOA 4KUMA 1LFUP 4EJTA 3J81K 3U21A 3K69A 3PIPF 3N4MA 2ZSIB 3CMMA 3TP0A 1FBQA 3GEZA 2IVMA 1BJZA 2O5RA 2VOPA 4BBRJ 2DBBA 2WC2A 1ZN2A 3ASNH 4MTDA 3M1EA 3CUQB 4HX8A 1ZG1A 2DK8A 1X58A 1KQ8A 3FBIB 2LSOA 5IOYA 1GUUA 1UAAA 3QPTA 4BQOA 2VONA 3MMYB 1LNWA 2HXOA 1XG1A 2VJJA 2BW3B 1YX5A 1ZG3A 2DMNA 3OV8A 3BCAA 1HF0A 1SFEA 3KP2A 4MFEA 2L9SA 4E70A 2HS5A 3ZQ7A 4ZH4F 4ITVA 4M74A 3LAPA 1VTNC 5IYDJ 4EJWA 4LK1F 4E7LA 3WODF 1HCRA 1T33A 1K78B 4LLNA 3E7LA 2E19A 3H5RA 2E5NA 1R7JA 3L2VA 5DS9A 3I58A 1EKEA 1UMQA 3KZIC 2V1DA 3BG3A 4FISA 1ZH5A 2K9NA 2ELJA 2XRLA 2CUEA 3MN2A 4QPOA 4EGZA 1MMNA 3PO2J 1N75A 1TWFJ 1JGSA 2EIKH 1MBJA 4L9JA 5J8CA 2EV5A 2MLGA 3CCRI 2OCEA 4HQMA 2QKMB 2VJ5A 3VYRB 1Y1WJ 2QA4I 4KN7X 3KCCA 1GXQA 4DZPA 2HZDA 2W48A 4AD9A 2R93J 3BPVA 4G7OF 3HOSA 1XDUA 4ASNA 3PSFA 5K7FA 3CF5F 1QNTA 4KT5C 1ZHFA 1P4WA 4IPAA 2M34A 2DFIA 3CCEI 1FMWA 4RGSA 2MLKA 2P7CB 2OQGA 4XM3A 3IRRA 2ECBA 1WI3A 4C2MJ 3MWMA 2A07F 1XMAA 2CH0A 3A2KA 2HGCA 3LSTA 1FP1D 5EG0A 1LE8B 1Y6IA 3ZOBA 1ORKA 2IA1A 5KCMA 4HNVA 1YITI 3OYBA 3NRVA 3RZOJ 1HLVA 4HSRA 3HGYA 1YS7A 2CQXA 1P4AA 1V5EA 1LQ1A 4C3IJ 3WTTC 2AQFA 2G7UA 4GO1A 2EFNA 5J4VA 1ZLKA 4PSWA 2PN6A 3E3VA 4JK1X 5FKKA 2XF7A 4M9ZA 1NK3P 1YJ9I 5IT9Z 3RSNA 4EATA 5KK1A 1T0FA 5B1BH 2E34A 3DPLC 4Z6YA 1BIAA 4PFPA 1R5ID 3CCVI 2HZTA 4KITB 1TW3A 2L9NA 3DKYA 3F3XA 3IHUA 4HBLA 2A05A 4BBSJ 1XSXA 3HSRA 4QTRA 1FY7A 2KRHA 1H88C 4M3BA 4EVIA 4PFOA 5H6QA 3ZR8X 5J1RA 1H0MA 1HBXG 4XLCA 1C0WA 3CDHA 5F64A 3T5XA 4YIIA 2MBFA 4ZTJA 1YOVB 2HWVA 2ETHA 3LQQA 3ONQA 2MSYA 5GAHJ 1TBXA 1VQKI 2LD5A 3C3WA 3SDBA 2JVHA 3JTGA 3LA2A 3HPGA 1IO2A 4NC6A 1VQPI 3ZQHA 4WXDA 2NOGA 3V8LA 1B1BA 3D5LA 3IP4B 3ERMA 4G6TB 1S7OA 1ZGWA 4G7HF 4IVNA 3S8PA 4NHJA 1P7JA 3COAC 2Y31A 2A6EF 2IXSA 4DQ2A 5EEHA 1ETKA 4MNUA 4J00A 1QBJA 3OYNA 4YIRX 5KVRA 4HV5A 3LFUA 4A5MA 3ESWB 4UVCA 5F0HA 1D8KA 3EETA 2Y69H 2ECCA 3GZ5A 3MZHA 1BC7C 1KU3A 2XKPA 5DCMA 4JYKA 1H9TA 2JA7J 3JSPA 3I54A 1JGGA 2F5EA 2XAHA 3IAS2 4JX5A 2E60A 1QGPA 1W7PD 1MMAA 2EH3A 3BT9A 3KYDB 1W5TA 2K9SA 3MFKA 4S05A 2E2JJ 1BIBA 2O3FA 3J7ZI 3DXJF 3HB9A 3V7RA 1VQMI 1TC3C 2DA2A 3FHNA 2BHZA 2QBYB 3CJNA 4Y4RA 2K9MA 2KRFA 2QENA 2JJ7A 1W1WE 1Y56A 2PI0A 5BOXA 4LMYA 4CZZA 1UHSA 3RI4A 1QHGA 2EFQA 4AIJA 4AUXA 2DPUA 3LA3A 3TO6A 2VKDA 1U5TC 4ZDLA 1WJCA 3BQYA 2L01A 4KJZA 1E0EA 2E1MB 1XCVA 3C1DA 1N77A 2YU3A 4F92B 1D0XA 1ITYA 2GXAA 4XN3A 4ZYDA 1POGA 1WH5A 1HOMA 3WU2C 2XB0X 2UV1A 5E20A 3KE2A 3LSIA 1F36A 1VZ0A 1ZYRF 3G3ZA 3PUBA 1BI1A 1BA5A 2DK5A 2X51A 3GFMA 1K4TA 2KMUA 4YIFA 1JKPC 1W7PA 2V9VA 4KMUX 3CMYA 2LTPA 2RGVA 1FNNA 2YPRA 3C2BA 1SD6A 3HC7A 4EJOA 4F7ZA 3AG2H 3BG7A 3MD2A 3HHGA 4XN0A 1Z0XA 2X1EA 3WGHA 3J7YJ 3I59B 1R4MB 2P5VA 4QWQA 3DBHB 4K2EA 1IRGA 2FOKA 2R0QC 2OZUA 4BHPA 1XSDA 3W2AA 4CZCA 1FEXA 4RB1A 2W7NA 5JHFA 1R9TJ 2CQQA 3GCMA 2GIZA 1YE9A 2JK3A 2P6SA 4ENNA 1QZYA 4HG2A 4DW6A 3JW4A 1W5SA 1BL0A 5EEAA 4OU0A 5L3FA 2A5YB 2VBWA 4RM3A 2Q2EB 3OYGA 3TBIA 2CQKA 2LY9A 2VKEA 1Z1DA 3OYIA 3K4CA 2J5OA 2DTZA 2PLYA 2R7VA 1S7AA 2XASA 4CO8A 1FSEA 5JFRA 1FYMA 4F3QA 3I56I 3FMRA 4XOPA 1HC8A 5M3MJ 3PNTA 5DUKA 3GTJJ 2H6BA 3K4LA 2M0MA 3BCBA 4O6JA 2KLOA 3RKWA 5IYCJ 1FX7A 1MNEA 3CUOA 2GLOA 2VL8A 1S9HA 1WJ5A 2X4HA 4WXHA 5CQEA 3ZP5A 3HEFA 1E3OC 1MSEC 3HHHA 3ERED 1U8RA 2OCCH 4LB6B 2H8WA 4B09A 4LD5A 2FX0A 2W4SA 2XSJC 3S1MJ 3IH3A 4U0VA 4QLCU 3CQZJ 3M3YJ 2WAQN 1O4XA 2L7FP 2HQNA 5LFAA 1K79A 2CG4A 2EFWA 1J75A 1FBSA 5KNLA 2JA2A 3A0BC 1G2HA 4OAZA 1I27A 2LY1A 2FQ4A 5D5WB 4ZDOA 2DN0A 2P4WA 4DYQA 3JRIA 3HSFA 1JTXA 2OQRA 3VOEA 4CXFA 3ZPLA 1UZCA 4PGHA 1WWXA 2X85A 1RI7A 5BS6A 2Z3YA 3J7AY 2R7ZJ 2CQ7A 1FZPB 2NVTJ 2ZMEB 1FPQA 4CYCB 1B9NA 1FMVA 3FWEA 4A3BJ 4B1RA 1RETA 3BJAA 5JI6A 3BDDA 1OCPA 1MJ9A 3KIOA 2G0EA 3WGIA 4CUGA 1W4MA 3TOBA 4UUSA 3S2HJ 5GADJ 2RKHA 1OJLA 3ZMZA 2UZKA 3VB2A 4HNUA 5CVUA 2CGPA 1SAUA 1OQYA 1WZ2A 2E1NA 2WADA 3M07A 4CCMA 1A36A 1AWCA 3RQ4A 5AIQA 4MFDA 2R7OA 2M8GX 2W00A 4DIQA 3RKXA 2HR3A 2RC4A 3GTKJ 5FKNA 4S04A 5JVTA 5EGOB 4RBOA 5LHIA 3OIQA 2QQBA 3QPSA 3RYPA 3KPHA 4CCOA 2GZWA 4LIVA 5GTHC 4HDVA 4XONA 1BR1A 3F72A 3K1PA 1J09A 2CYYA 2E5ZA 1LVKA 3OMYA 2HU9A 4LG0B 1QRYA 3S1RJ 3WTWC 2COBA 3CUQC 4CGZA 4UY8I 4M3EA 1H8AC 3PO3J 3OYHA 2ISZA 4KN4X 4L18B 1HSTA 1O3SA 4A3LJ 2GAUA 1RR8C 3CDLA 1VFCA 3CMEI 3B73A 1FIPA 2DI3A 3CDIA 4EJVA 3E5QA 1AU7A 1G6NA 4BJ5C 2JUGA 2K5CA 5HLTA 5FJ8J 2WAQA 4TV7A 1RNLA 1RKTA 4BUPA 3FXRA 4IQ4A 2CS3A 2NS7A 3F21A 3SZTA 1PUFB 1XS9A 5H6RA 4BH9A 3TW7A 2F5VA 2IPQX 3E0JB 3F23A 4NB5A 4IX7A 4DYRA 1F43A 1ZGJA 3FF5A 3LSGA 3PFYA 2LBFB 1YX3A 4IJAA 1HW1A 1ETYA 2DFHA 2M7AA 1DU0A 2PFBA 2Y48A 5EEGA 1MJAA 2LF8A 1MD0A 2D45A 2VBZA 3M8FA 3A01B 2ELHA 3ZN0A 2QGUA 3U9GA 4BQAA 3T8RA 1Y8RB 2UWMA 3K7AJ 2LNBA 3BZCA 4ZZLA 2L02A 2VODA 4F91B 5JLXA 4D5CA 5ICGA 3IAM2 3ZQFA 2L9RA 2H27A 2ESHA 1F9NA 2Z99A 3OR1C 2P81A 2LKSA 5GP9A 3QWLA 5IT9K 3I9V2 3RIRA 3S2DJ 2V9KA 2DAOA 1MJBA 3R0JA 3OYDA 1MMGA 5FLXZ 3NWSA 3BR5A 3TKYA 1WPKA 3IH2A 4PJJA 2FRHA 4EM1A 4LG3A 2XPVA 1T0FC 2DDAA 4M3DA 1LB2A 5A2QZ 1G3SA 2B7EA 3PQKA 2JRTA 3OS2A 4DNCA 4II3A 2M4KA 3N05A 3BG9A 3L2UA 3F6VA 2RQQA 2XPUA 3R0AA 3MEXA 3J80Z 3K4MA 2IP2A 4I6ZA 1TZLA 1QHHD 2O9LA 2NVQJ 2K86A 2L4AA 1FP2A 1R6RA 1BN5A 2EZHA 1PVEA 3TOAA 4CCKA 3I55I 1X4PA 1XGNA 3WTVC 1VQ9I 1WH7A 3KX2A 4BEHA 2K85A 5BNGA 1F1ZA 3DU5A 2NVUB 4NNJA 3WU0A 4QIWN 4HDUA 1J59A 5ILSA 3W3CA 4H4KC 3WE2A 5HS7A 1ETVA 1NH3A 3R60A 5FO5A 2DQLA 5FLMJ 1R49A 2N8GA 5L3EA 5LGTA 3CCSI 3QYBA 1J9IA 3H92A 2UXNA 1S6LA 3FX3A 3ABUA 4KISA 3E6CC 4I01A 1DP3A 1RR7A 3PUFA 2V7FA 3SFZA 3FISA 3F8BA 3M9AA 4ESFA 4E7ZA 1U78A 2YU9J 2XDVA 3CLQA 2NNNA 4MHGA 3JTHA 1I3QJ 2HKOA 3BG5A 2VLAA 3O3KA 2E35A 3HYIA 3IWFA 1STZA 2DJIA 1QA6A 3KLOA 1QPIA 1X1PA 4A3GJ 2R7SA 3H35A 3BJ6A 3CESA 1KYWA 3KP4A 3CD6I 4UHTA 3LQRA 5LHHA 2FEZA 5M5WJ 2KHMA 2VXZA 2ZB9A 1VF9A 4A0YA 3OYAA 5JVGF 3BY6A 3TO7A 2KZVA 4U7DA 4MTEA 1MH3A 3I5UA 5ICCA 3HOXJ 3UR3C 3OYLA 3ECOA 2EWNA 2OA4A 1UB9A 3L7WA 3HG9A 2LOOA 5FKLA 1KZHA 1KQ9A 1N25A 1JJ8C 2BXZA 3PFIA 3WTSC 2I10A 1BR4A 1IUYA 3ZMUA 4L0YB 2MW8A 1P92A 5IP6A 4B3XA 2HQAA 1BBYA 2K02A 3RKYA 4EJUA 1WSUA 2FMYA 1DQUA 2DMPA 2GA2A 4BL0B 1GV2A 2JUCA 1TNTA 3OIOA 4I99C 5ILUA 1PP8F 4XLPF 2XUBA 4Z2YA 2WY8Q 2H1KA 1A6IA 1Y8QB 1K4SA 3HPHA 5F04A 1OCZH 4GRIA 4MQ9F 5H20A 5DM7F 3IKVA 2FJ1A 2EA2A 2HTSA 3NEUA 1SFUA 3EQLF 1S7EA 4NQWB 1V4RA 2VB6A 2VI6A 1USTA 5FKOA 2VQGA 5F0CA 3PL8A 2XAUA 2P7VB 1HKQA 5AONA 3L2QA 3V8JA 2GOMA 3CUQA 5FKMA 1ETQA 3RCOA 3RKQA 4X1EA 3WE3A 2IS1A 4RB2C 3GBGA 4HYEA 4FT8A 3K6GA 4BS9A 3GFJA 2BW3A 1XGSA 4LGWA 2WV1A 1X1DA 2ELKA 4GDFA 4XORA 5HLHA 3K0LA 3PNYA 3L2RA 3I64A 4J01A 4HF0A 3F22A 4IHVA 1U6GA 1FIAA 3DFGA 3MZYA 2EBIA 5C3EJ 4PDKA 1IC8A 3CC2I 1K78A 3BG6A 5HLIA 3K4BA 2BOLA 5TJJA 4IHTA 2Y0MA 4BU2A 1Q1HA 4ZJZA 5J3LA 1XGOA 5IPAA 1OR7A 4XKBA 3I3LA 1PUEE 3AG1H 2YSRA 1GVDA 1MW7A 5L3GA 2FD5A 3HOWJ 1R58A 2UUZA 2XPWA 3OL3A 4LOCA 3GFIA 3BQZA 2DQRA 2M30A 5CVIA 5IYBJ 6PAXA 4PJMA 3T8TA 1QPMA 1JI8A 1H89C 1JUSA 3ZQGA 4ZZDA 2XIGA 3I71A 1ETWA 2ZXIA 2F6CA 4GYIA 1ZRDA 1WVRA 1XB4A 4RM2A 3VPRA 5JR3A 4F52A 3GVAA 5GAGJ 4FCYA 2E2HJ 1OKRA 3ZGKA 2BVLA 3H9GA 1S5LC 1VQ4I 3E97A 3N97A 1Z7UA 2K9LA 3SQNA 3V4GA 5TGTA 2FU4A 4OOIA 2BVMA 1AHDP 3O8HA 5TRDA 2TRTA 2FBIA 4NBQA 3AAFA 5FFZA 1LE8A 2PQ8A 3OYMA 2H8RA 5F0FA 1ERDA 2NOJB 2VKHA 4WX9A 1ODDA 5J6XA 2HQ5A 3Q0WA 2LREA 4U0YA 1HDDC 2JSPA 1B4AA 1XGMA 3ABTA 2M0CA 4XL9A 2JQ7A 4U0WA 3PSIA 4M3GA 1E3HA 1U3EM 1WJEA 3BZKA 4RAGA 1VQLI 5HS8A 1QVUA 4CYDA 2K3FA 1OMIA 2X48A 2MFZA 1R71A 1HA8A 1X1BA 3S1NJ 3DTKA 1R36A 2A6TA 2IA2A 1YS6A 1A6QA 3HUGB 2DYSH 3GWZA 2MG4A 5FRMA 1MZBA 4ANJA 1TQPA 1G3WA 2HDWA 2LDUA 4AU7A 4D0PA 2M8EA 1H9GA 1MBGA 2ADUA 4BHCA 5B66C 1B9MA 4WCGA 3ELKA 1FYLA 3I53A 1BI0A 1NHAA 1TT0A 2F4OB 4HA8A 3WG9A 1MGTA 3X2QH 5DDGA 5BPDA 1U8BA 2DA1A 4AVPA 2R7WA 1IN6A 1USSA 5JLWA 4BGDA 2KDZA 4S0HB 1EH8A 1RESA 1Z3XA 5ICEA 3K2ZA 3GF2A 1V3FA 3F0CA 5IP7J 3HOZJ 5HOOA 2JN6A 1YQAA 3HL2A 1HXDA 4JX6A 1W36C 3BR3A 5FD5A 2P8TA 2UXXA 3FXUA 3JCUC 2W82A 4U87A 3K70D 2ZFUA 3BROA 3F8FA 4LJZF 1IF1A 3LSRA 1T98A 1IN4A 3PNVA 2R5ZB 2VIXA 3IC7A 4JBAA 3BP8A 2V26A 4AWXB 5K5OA 5FLVA 3LFKA 3VFZA 3MZ8A 1OLTA 2IA0A 2IJLA 2FE3A 4ENJA 2EV0A 1B72B 2V1UA 2MC3A 2OF7A 4E7SA 3GLXA 2WAFA 4EQQA 2L9VA 2WTEA 3PQJA 4XLHA 2ACJA 2DOAA 2VE9A 1UHWA 3F9KA 2CMPA 2LRDA 4IO9F 2HDDA 3DTIA 3NARA 2O8KA 3MQ0A 3VEPA 4UV8A 3VYSB 4ZYHA 1X2MA 1FOKA 1ON2A 2QVOA 1MDMB 4LK0F 5ED4A 1QO0D 5M5XJ 2L54A 2D2WA 2M7BA 2O03A 4P55A 3LSJA 2A61A 1R1VA 2NVXJ 2DDBA 5M5YJ 3GZ6A 4F93B 2B9SA 3CO7C 2AQEA 1IXSB 4HF1A 2IAIA 2P5KA 5DV5A 3VYUB 2JZYA 3FMQA 4JP0A 5LGUA 2XGXA 2LF7A 5L3DA 3UNGC 1IV6A 2QBYA 5D8KB 1I6HJ 5H2FC 2MH9A 1YW8A 1U9NA 1IRZA 4Y13A 3LSHA 3TEDA 2RNJA 3BTIA 5EZGA 5K1YA 1IRXA 2OD5A 3S93A 2HTJA 4IKFA 1SFKA 5FLXK 1TNSA 3R61A 3DP7A 4BHBA 1A5JA 2WWYA 2ICWG 1T95A 2LG4A 2EINH 5A2QK 4D9JA 2D1VA 3HBLA 4ZYGA 5D6FA 3OS1A 1DP7P 2OTLI 4GCVA 2BY1A 1XD7A 2STWA 3ABLH 1VQ6I 2JSCA 4M71A 3RQIA 1WJBA 3J80K 2XF6A 3P5JA 3FXOA 1G3TA 4E7IA 3M8EA 5CPRB 4H0EA 2DT7B 2QQAA 3QPLA 1ONVA 1V54H 2R4GA 5HVQC 2X9DA 3L2WA 1UG2A 4V2FA 2IGKA 1RUNA 1S72I 2DA3A 3I59A 1MBKA 1ZR2A 2EZIA 3Q5FA 3BTLA 1R1UA 1LDKB 2JVGA 1YIJI 3QP6A 2KJCA 4BE0A 2WBMA 3AL0C 4OIRF 4OMYA 2AHQA 4Y33A 2KISA 3U1DA 2IT0A 2VT3A 3DLLF 1CF7B 1P6RA 2W85A 3WHBA 2JMWA 1KGSA 2DOEA 2R5YB 3KLNA 5KHDA 2OJED 1Z77A 2Q2EA 2FMLA 1V5FA 3H0GJ 4I02A 1S29A 3G4SI 1D5YA 3FMSA 4IRIA 3LA7A 3WU1B 1WJFA 2A6HF 5LEKA 2IS2A 2QSFX 2XVCA 4PJNA 4FASD 1YLFA 3CLOA 3HZJA 1W5CC 2XV4S 4M3FA 2LKPA 2CV2A 2QEXI 4BDYA 1TQIA 1UFMA 1OCCH 2HPIA 2Y9YA 4IZZA 2MA3A 3BR0A 3E5XA 1J7KA 4OAYA 3F8MA 4IOAF 2RDPA 3SYTA 2VQLA 4N4NB 1OISA 1UG0A 5EYRA 3E6MA 4U88A 3C2HA 2IW5A 3NAUA 2DYRH 1T38A 1HQCA 4YRVA 5E3MA 1FTTA 1WJDA 1XX5A 3OYCA 2KZGA 4L0ZB 4XLNF 4D1QA 4R79A 3DEUA 2EILH 3VYTB 4A3FJ 2W57A 1HW5A 2BEOA 2X1CA 3ZMDA 2LLKA 3HRTA 5ICFA 3ZQQA 1AOYA 2FXAA 1IN8A 3ZQCA 3UKGA 1W36D 4U7BA 4RDUA 2NAZA 4HX4A 5DUIA 1WGXA 2QUFA 2VXDA 3LSKA 4R1HA 1IJWC 1ETXA 4G8XA 4AVZA 2KJBA 3V7CA 2BZTA 3FBNB 1LEBA 3EYYA 2MABA 5E3OA 3S32A 1DU6A 1JUPA 3FIWA 5ERIA 2BBYA 4FTHA 4UUTA 1IUFA 1RIOH 1B59A 2BY0A 4D5FA 2DT6A 4CCJA 1QVTA 3FHZA 2DA7A 2K7LA 4PGGA 2KFDA 1TWAJ 2ZMEA 2JA5J 3ZQIA 4BKXA 2RN7A 3U2RA 4CYCA 1V55H 5L3BA 4XSZF 3IRQA 2BY2A 3MKLA 3ZCOA 3M8JA 2E71A 4XLAA 3MCZA 4KDPA 4M72A 1XMKA 2VBXA 2RVCA 4XRFA 3WGGA 5F08A 1FBUA 1Z67A 4I98B 3ZRGA 4BXXJ 4F55A 2FNPA 2AXTC 4ZYAA 2FBHA 3RZDJ 1XSVA 1BM9A 5AIPA 2DOFA 2XHKA 2KL4A 1IXRC 2M1BA 2Y2ZA 4OIPF 2L7ZA 5B3SH 1XTAA 3GTPJ 3Q0VA 2XB5A 1X3WB 5EGOA 1SFXA 3DKWA 4N0BA 4A2UA 3A03A 1X3UA 1G59A 2R7FA 3H36A 4BY7J 3G1OA 4I0BA 2CSOA 3OR2C 3K4KA 4LG0A 3ROUA 2GM4A 1JHFA 2CFXA 1D1CA 5F6FA 1KYZA 1KU9A 5D6EA 1HKSA 2O6GE 3H3VK 3OSFA 1D0YA 4L5EA 3L9FA 5IP9J 2B63J 3MVPA 2DO7A 3TQNA 4HRIA 3D5RC 2ZNYA 3EUHA 3GMEA 1XPXA 4BQNA 2GOXB 3W6VA 3ZQLA 1REPC 3D5SC 3WTZA 3REOA 2HXIA 5KAIC 3K4NA 2MD0A 3B6CA 4MQVA 4XOTA 3K2AA 2X6XA 1IDYA 1I6XA 3TO9A 2XRNA 4BAYA 2CWEA 2PMUA 4DGWB 4EM0B 3CZ6A 2AS5F 1OR7C 2LR8A 3OS0A 1JT0A 4AIKA 3KZZA 2IBDA 4YELA 1PUFA 3L2CA 1U5TB 5HDKA 1P7IA 4KA4A 1Q1VA 4BXUA 3HOTA 1YG2A 5LRSA 2FF4A 4KFCA 1YO5C 2WB1N 2ESNA 2LBFA 5D5VB 2K3PA 2W84A 3FM5A 1YRNB 1QQIA 3P9CA 4LITA 1IN5A 4XKCA 3DPTA 3OWTA 3A01A 2ZNZA 3QOPA 3A1YA 2F5DA 4L9TA 5LEJA 1U2WA 3O2PE 2VOOA 3LSMA 2DODA 1DPRA 2QKLB 2WA0A 2FA5A 5LBQA 1TLHB 2DFFA 3K10A 1MNMC 2FBKA 2V1XA 1YHQI 1CGPA 3G1LA 1K6YA 4M9XA 2YR2A 3TL4X 4EM2A 4ZTFA 3HXLA 1TW2A 4N9IA 2H6CA 1X4OA 3FK7A 1J0RA 1LPQA 2E7XA 2F4IA 3V42A 1BC8C 3Q9VA 1EA3A 2CQNA 4O5VA 2IEKA 4MIMA 3S1QJ 1U9OA 3DWLE 3OOUA 3SDGA 3MKYB 1RKWA 3GUDA 1Z05A 2FUG2 4M6YA 1K6OA 3G1MA 1DGRM 3M1CA 4WF2A 1ETOA 3JAMZ 2DJNA 3KZYA 3AG3H 2VASA 3HDDA 2IGNA 5IY5H 2Z33A 2HNHA 4KMFA 4O3MA 4E6KG 2VN2A 4E4HA 1LFPA 3JRCA 3RTRA 4PZJA 4FE4A 2Q1ZB 2IGMA 1DDNA 4XICA 2LC2A 3G71I 1QU3A 2BXYA 2PJRB 2Y9ZA 1B8IB 2ZCWA 1T8IA 3BOQA 1JKQC 2HI3A 2LP0A 4RGRA 2EZLA 2MC4A 1E3PA 3CJRB 2R7RA 1VI0A 4UB6C 4RAFA 2A3SA 1ENHA 4ABZA 2XSDC 1E17A 4P1WA 1Z91A 1OFCX 1X2NA 5CVRA 1BI3A 2VQHA 3MKWB 2DLLA 3WHCA 4CDGA 2PJRA 5FRNA 2F48A 3DKXA 4ZC3A 5E3LA 5CLSA 4WWCA 2OV7A 2QSGX 1JHHA 2L0KA 3CC7I 2XGCA 1A31A 2E7WA 2HYJA 5E17F 2NRAC 4MEYF 4BE1A 3ZN1A 4X6AJ 1RPWA 5C4XJ 1U0JA 4Y15A 1FYKA 2X1DA 4X0GA 2DMTA 4J19A 4GFBA 4XQFA 2WB1A 5EJCA 3HRUA 3BPXA 1UCRA 1NK2P 1TWCJ 4A0XA 4PSXA 1TWGJ 2G7HA 3SZPA 4HEA2 3LL7A 5M3FJ 4DJAA 1I5ZA 1R4NB 4DBRA 3CCYA 4HW0A 1D5VA 2QLZA 1ZLJA 2KT0A 1YYVA 4LIUA 1K61A 3EDPA 2IS4A 2RREA 2L3DA 2E2IJ 2QYOA 2XGDA 1R00A 1AA7A 2R7TA 1I3AA 1L0OC 3CP2A 4XLFA 3KEQA 5BQTA 4HSTA 1WKMA 4RAZA 1AKHB 4RB3C 3CO6C 4C3HJ 3CJTB 3PM1A 2IGOA 1MH4A 4D7MA 3LMMA 3K70C 2Y30A 3W6JB 1I1GA 2COMA 2H1LA 4CSWA 2PMHA 4Q48A 3DBRB 2HYGD 1BJAA 4E7JA 2PMZN 1HDPA 3O8GA
chains in the Genus database with same CATH topology
3HOUJ 5M3MJ 2XGEA 3GTJJ 9ANTA 3FK6A 2GBYA 2DA6A 3BR6A 4AYBN 1U8BA 1WCMJ 5IYCJ 2DA1A 2GLOA 5JLWA 2KDZA 3BR1A 4S0HB 4EEFG 1RESA 4MO7A 5IP7J 3F0CA 3JRGA 3HOZJ 4NDLA 3HEFA 1E3OC 3D1NI 1SFOJ 1MSEC 2JN6A 2Y0SN 2K9QA 4JX6A 3BR3A 1YRNA 2MGQA 2RAEA 3GTMJ 2FX0A 4DZJA 3S1MJ 3IH3A 4MLOA 3LSRA 3CQZJ 3M3YJ 2WAQN 2R5ZB 1O4XA 1W0TA 4A3KJ 5FLVA 3I4MJ 1SANA 2O7OA 2QF7A 4A3DJ 2L7FP 1B72B 2OF7A 1G2HA 4IHWA 2FQ4A 2DN0A 4DYQA 1IDZA 3DEWA 3JRIA 1JTXA 2HDDA 3JRAA 3NARA 2O8KA 1JKOC 1X2MA 2R7ZJ 5J1YA 3OSGA 3BTCA 1GT0C 1FJLA 2NVTJ 5M5XJ 4CYCB 4A3BJ 4B1RA 3JRDA 2DMUA 1IGNA 3LSJA 1RETA 2NVXJ 5M5YJ 1OCPA 2G0EA 1BW6A 2IAIA 4UUSA 3S2HJ 1ZK8A 4JP0A 1OJLA 1IV6A 1I6HJ 2ID3A 2VUMJ 3IH4A 1ZQ3P 1U9NA 2OPTA 1IRZA 4DYCA 3TEDA 3TP3A 3BTIA 1IG7A 5EZGA 4BY1J 1B8IA 4MFDA 5EG0B 3JREA 2M8GX 3GTLJ 4W97A 4A3MJ 3GTKJ 5FKNA 2CUFA 3SFIA 5EGOB 4RBOA 1BW5A 2EZKA 5C44J 1A5JA 3QPSA 5IOZA 2CRGA 3HBLA 1JJ6C 2TCTA 3I4NJ 1QRYA 3S1RJ 2COBA 1JTYA 3RQIA 4M3EA 1H8AC 3PO3J 3QPLA 4XRSG 2X9DA 1UG2A 4V2FA 4A3LJ 2DA3A 4G12A 1MBKA 1ZR2A 2EZIA 3CDLA 1VFCA 4W1UA 1FIPA 3BTLA 4I76A 1AU7A 1GV5A 4IHYA 2DA5A 4C3JJ 5FJ8J 3JRFA 2L7MP 3QQAA 4A3JJ 1RKTA 3HOVJ 2E1OA 2AHQA 2NS7A 1PUFB 1XS9A 3TW7A 3WHBA 2JMWA 2R5YB 4DYRA 4XIDA 1AKHA 1F43A 3BTJA 1Z77A 3LSGA 2HOAA 3H0GJ 1D5YA 2ID6A 2ME6A 1ETYA 1DU0A 4XRMA 2X6OA 2LFBA 3Q0UA 4A3EJ 3A01B 4M3FA 3JRHA 2Y9YA 1LFUP 2DMQA 3BR0A 3K7AJ 1GDTA 2DA4A 3TP0A 1MBEA 4A3IJ 5F27A 5EYRA 5JLXA 4D5CA 1BJZA 2QCOA 3ZQFA 2L9RA 4BBRJ 2LKXA 3M4OJ 2P81A 3NAUA 1X58A 5GP9A 3B6AA 5E3MA 3S2DJ 1FTTA 5IOYA 1GUUA 3BR5A 2HXOA 3HGGA 1WPKA 1XG1A 3IH2A 4FE7A 2DMNA 2R5ZA 1HF0A 1MBHA 4A3FJ 2XPVA 4MFEA 2LLKA 4M3DA 3HKZN 3ZQCA 3UKGA 4RDUA 1WGXA 1B72A 1IJWC 1ETXA 3BG9A 5IYDJ 5E3OA 1DU6A 1JUPA 2XPUA 4A3CJ 3FIWA 4FTHA 1T33A 3A02A 4UUTA 1I50J 3TW6A 1IUFA 1HCRA 4I6ZA 3E7LA 2E19A 3LSPA 2O9LA 5DS9A 4D5FA 2NVQJ 4XRSA 1UMQA 1ZKGA 1QVTA 2DA7A 2EZHA 3BG3A 4FISA 2K9NA 2VPRA 1TWAJ 2XRLA 2CUEA 3MN2A 3ZQIA 1WH7A 4BKXA 2JA5J 4CYCA 3IV5A 1TWFJ 5EZHA 5BNGA 4QIWN 1MBJA 3PO2J 4Y52J 3MKLA 1K83J 1Y1WJ 5J1UA 1ETVA 4DZPA 2W48A 2R93J 5C4JJ 5F08A 5FLMJ 5K7FA 2CJJA 5E3NA 4BXXJ 2M9HA 2N8GA 2M34A 1CQTA 3RZDJ 3JRBA 3LNQA 2ECBA 1WI3A 1RR7A 4C2MJ 3FISA 2NVYJ 5EG0A 2Y2ZA 3HM5A 1U78A 1LE8B 3ZOBA 3SJMA 2YU9J 1ORKA 2L7ZA 4HNVA 3GTPJ 3Q0VA 2M2EA 2XB5A 3RZOJ 1HLVA 3HGYA 5EGOA 4Y7NJ 3A03A 1EF4A 5GPCA 1I3QJ 2CQXA 3BG5A 1NTCA 4BY7J 1QPIA 4C3IJ 4A3GJ 3G1OA 2HOTA 1VNDA 2GM4A 5M5WJ 2ZB9A 5FKKA 1VF9A 1NK3P 3LOCA 1T56A 3H3VK 3OSFA 4L5EA 1MH3A 3HOXJ 5IP9J 2B63J 3S14J 3MVPA 1OCTC 1XC5A 4BBSJ 3HOYJ 1JKRC 3W6VA 4QTRA 3ZQLA 1H88C 4M3BA 5FKLA 2HXIA 3GTOJ 3B6CA 5J1RA 1JUMA 3K2AA 5K7ZA 1IDYA 1JJ8C 2I10A 2LR8A 2MW8A 1JT0A 5IP6A 2IBDA 1PUFA 4AC0A 2MSYA 2R92J 2DMPA 1P7IA 1Q1VA 2LD5A 1GV2A 2R5YA 3OIOA 2WB1N 2AO9A 3GTGJ 2H1KA 1YRNB 4M6VA 1A6IA 3GTQJ 3ZQHA 5F04A 2NOGA 1TWHJ 2FJ1A 3A01A 1ZGWA 2NS8A 1P7JA 2Y31A 1S7EA 1ETKA 2VI6A 5FKOA 5F0CA 2K40A 1APLC 5FKMA 1MNMC 5F0HA 1FTZA 1ETQA 4QSHA 3G1LA 2ECCA 3RKQA 4X1EA 4A69C 4B4CA 4JYKA 3GBGA 3FK7A 5GPAA 5K7HA 2JA7J 1JGGA 5EDNA 4JX5A 5DTDA 2WV1A 2ELKA 4JX4A 2EH3A 3BT9A 2IEKA 3L1PA 4XK4A 2JWTA 2K9SA 4MIMA 1U9OA 3S1QJ 3SDGA 3OOUA 2E2JJ 1RKWA 1MSFC 3G1MA 3HB9A 4UUSB 1TC3C 1ETOA 2DA2A 4IHVA 2DJNA 1W0UA 1FIAA 4A93J 2EBIA 1JT6A 5C3EJ 3HDDA 1IC8A 3JRCA 2HOSA 2JJ7A 4FE4A 3FKIJ 4D7NA 4XICA 2VKVA 2YS9A 5J3LA 1UHSA 5IPAA 2Y9ZA 1B8IB 4AUXA 5EF6A 1GVDA 2FD5A 3HOWJ 1JKQC 2HI3A 2LP0A 2XPWA 4LOCA 2EZLA 3BQYA 3BQZA 1ZTRA 5IYBJ 1VI0A 4IHXA 1LFBA 1ENHA 3S15J 2ME0A 1H89C 4ABZA 2XSDC 1ITYA 1JUSA 3ZQGA 3BR2A 1OFCX 4IEJA 1POGA 1WH5A 1ETWA 1X2NA 1HOMA 2XB0X 4B3AA 3WHCA 3VPRA 1F36A 3Q3SA 5E3LA 4FCYA 5F1JA 1BA5A 2L0KA 2E2HJ 2XGCA 1JKPC 2HYJA 4V2GA 4X6AJ 3CMYA 1RPWA 5C4XJ 2LTPA 1AHDP 3O8HA 2TRTA 2DMTA 3C2BA 2CU7A 4J19A 3S17J 3DCFA 1LE8A 4GFBA 2H8RA 1Z0XA 5F0FA 1NK2P 2D5VA 5HODA 1TWCJ 3JR9A 1TWGJ 2JA6J 2HQ5A 2R0QC 5M3FJ 2LK2A 3Q0WA 2LVSA 1HDDC 1ZR4A 1FEXA 1R9TJ 2M0CA 1Y1VJ 2CQQA 2YUSA 4M3GA 3CCYA 2JK3A 2KT0A 1K61A 4DW6A 1QVUA 2E2IJ 2XGDA 1BL0A 2X48A 5EEAA 3S1NJ 1AKHB 4C3HJ 2LY9A 2VKEA 3PM1A 2MG4A 1MH4A 4D7MA 2Y30A 3S16J 2DTZA 1MBFA 2PMZN 1MBGA 1HDPA 2EQRA 2JA8J 3O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU J;  5M3M J;  2XGE A;  3GTJ J;  9ANT A;  3FK6 A;  2GBY A;  2DA6 A;  3BR6 A;  4AYB N;  1U8B A;  1WCM J;  5IYC J;  2DA1 A;  2GLO A;  5JLW A;  2KDZ A;  3BR1 A;  4S0H B;  4EEF G;  1RES A;  4MO7 A;  5IP7 J;  3F0C A;  3JRG A;  3HOZ J;  4NDL A;  3HEF A;  1E3O C;  3D1N I;  1SFO J;  1MSE C;  2JN6 A;  2Y0S N;  2K9Q A;  4JX6 A;  3BR3 A;  1YRN A;  2MGQ A;  2RAE A;  3GTM J;  2FX0 A;  4DZJ A;  3S1M J;  3IH3 A;  4MLO A;  3LSR A;  3CQZ J;  3M3Y J;  2WAQ N;  2R5Z B;  1O4X A;  1W0T A;  4A3K J;  5FLV A;  3I4M J;  1SAN A;  2O7O A;  2QF7 A;  4A3D J;  2L7F P;  1B72 B;  2OF7 A;  1G2H A;  4IHW A;  2FQ4 A;  2DN0 A;  4DYQ A;  1IDZ A;  3DEW A;  3JRI A;  1JTX A;  2HDD A;  3JRA A;  3NAR A;  2O8K A;  1JKO C;  1X2M A;  2R7Z J;  5J1Y A;  3OSG A;  3BTC A;  1GT0 C;  1FJL A;  2NVT J;  5M5X J;  4CYC B;  4A3B J;  4B1R A;  3JRD A;  2DMU A;  1IGN A;  3LSJ A;  1RET A;  2NVX J;  5M5Y J;  1OCP A;  2G0E A;  1BW6 A;  2IAI A;  4UUS A;  3S2H J;  1ZK8 A;  4JP0 A;  1OJL A;  1IV6 A;  1I6H J;  2ID3 A;  2VUM J;  3IH4 A;  1ZQ3 P;  1U9N A;  2OPT A;  1IRZ A;  4DYC A;  3TED A;  3TP3 A;  3BTI A;  1IG7 A;  5EZG A;  4BY1 J;  1B8I A;  4MFD A;  5EG0 B;  3JRE A;  2M8G X;  3GTL J;  4W97 A;  4A3M J;  3GTK J;  5FKN A;  2CUF A;  3SFI A;  5EGO B;  4RBO A;  1BW5 A;  2EZK A;  5C44 J;  1A5J A;  3QPS A;  5IOZ A;  2CRG A;  3HBL A;  1JJ6 C;  2TCT A;  3I4N J;  1QRY A;  3S1R J;  2COB A;  1JTY A;  3RQI A;  4M3E A;  1H8A C;  3PO3 J;  3QPL A;  4XRS G;  2X9D A;  1UG2 A;  4V2F A;  4A3L J;  2DA3 A;  4G12 A;  1MBK A;  1ZR2 A;  2EZI A;  3CDL A;  1VFC A;  4W1U A;  1FIP A;  3BTL A;  4I76 A;  1AU7 A;  1GV5 A;  4IHY A;  2DA5 A;  4C3J J;  5FJ8 J;  3JRF A;  2L7M P;  3QQA A;  4A3J J;  1RKT A;  3HOV J;  2E1O A;  2AHQ A;  2NS7 A;  1PUF B;  1XS9 A;  3TW7 A;  3WHB A;  2JMW A;  2R5Y B;  4DYR A;  4XID A;  1AKH A;  1F43 A;  3BTJ A;  1Z77 A;  3LSG A;  2HOA A;  3H0G J;  1D5Y A;  2ID6 A;  2ME6 A;  1ETY A;  1DU0 A;  4XRM A;  2X6O A;  2LFB A;  3Q0U A;  4A3E J;  3A01 B;  4M3F A;  3JRH A;  2Y9Y A;  1LFU P;  2DMQ A;  3BR0 A;  3K7A J;  1GDT A;  2DA4 A;  3TP0 A;  1MBE A;  4A3I J;  5F27 A;  5EYR A;  5JLX A;  4D5C A;  1BJZ A;  2QCO A;  3ZQF A;  2L9R A;  4BBR J;  2LKX A;  3M4O J;  2P81 A;  3NAU A;  1X58 A;  5GP9 A;  3B6A A;  5E3M A;  3S2D J;  1FTT A;  5IOY A;  1GUU A;  3BR5 A;  2HXO A;  3HGG A;  1WPK A;  1XG1 A;  3IH2 A;  4FE7 A;  2DMN A;  2R5Z A;  1HF0 A;  1MBH A;  4A3F J;  2XPV A;  4MFE A;  2LLK A;  4M3D A;  3HKZ N;  3ZQC A;  3UKG A;  4RDU A;  1WGX A;  1B72 A;  1IJW C;  1ETX A;  3BG9 A;  5IYD J;  5E3O A;  1DU6 A;  1JUP A;  2XPU A;  4A3C J;  3FIW A;  4FTH A;  1T33 A;  3A02 A;  4UUT A;  1I50 J;  3TW6 A;  1IUF A;  1HCR A;  4I6Z A;  3E7L A;  2E19 A;  3LSP A;  2O9L A;  5DS9 A;  4D5F A;  2NVQ J;  4XRS A;  1UMQ A;  1ZKG A;  1QVT A;  2DA7 A;  2EZH A;  3BG3 A;  4FIS A;  2K9N A;  2VPR A;  1TWA J;  2XRL A;  2CUE A;  3MN2 A;  3ZQI A;  1WH7 A;  4BKX A;  2JA5 J;  4CYC A;  3IV5 A;  1TWF J;  5EZH A;  5BNG A;  4QIW N;  1MBJ A;  3PO2 J;  4Y52 J;  3MKL A;  1K83 J;  1Y1W J;  5J1U A;  1ETV A;  4DZP A;  2W48 A;  2R93 J;  5C4J J;  5F08 A;  5FLM J;  5K7F A;  2CJJ A;  5E3N A;  4BXX J;  2M9H A;  2N8G A;  2M34 A;  1CQT A;  3RZD J;  3JRB A;  3LNQ A;  2ECB A;  1WI3 A;  1RR7 A;  4C2M J;  3FIS A;  2NVY J;  5EG0 A;  2Y2Z A;  3HM5 A;  1U78 A;  1LE8 B;  3ZOB A;  3SJM A;  2YU9 J;  1ORK A;  2L7Z A;  4HNV A;  3GTP J;  3Q0V A;  2M2E A;  2XB5 A;  3RZO J;  1HLV A;  3HGY A;  5EGO A;  4Y7N J;  3A03 A;  1EF4 A;  5GPC A;  1I3Q J;  2CQX A;  3BG5 A;  1NTC A;  4BY7 J;  1QPI A;  4C3I J;  4A3G J;  3G1O A;  2HOT A;  1VND A;  2GM4 A;  5M5W J;  2ZB9 A;  5FKK A;  1VF9 A;  1NK3 P;  3LOC A;  1T56 A;  3H3V K;  3OSF A;  4L5E A;  1MH3 A;  3HOX J;  5IP9 J;  2B63 J;  3S14 J;  3MVP A;  1OCT C;  1XC5 A;  4BBS J;  3HOY J;  1JKR C;  3W6V A;  4QTR A;  3ZQL A;  1H88 C;  4M3B A;  5FKL A;  2HXI A;  3GTO J;  3B6C A;  5J1R A;  1JUM A;  3K2A A;  5K7Z A;  1IDY A;  1JJ8 C;  2I10 A;  2LR8 A;  2MW8 A;  1JT0 A;  5IP6 A;  2IBD A;  1PUF A;  4AC0 A;  2MSY A;  2R92 J;  2DMP A;  1P7I A;  1Q1V A;  2LD5 A;  1GV2 A;  2R5Y A;  3OIO A;  2WB1 N;  2AO9 A;  3GTG J;  2H1K A;  1YRN B;  4M6V A;  1A6I A;  3GTQ J;  3ZQH A;  5F04 A;  2NOG A;  1TWH J;  2FJ1 A;  3A01 A;  1ZGW A;  2NS8 A;  1P7J A;  2Y31 A;  1S7E A;  1ETK A;  2VI6 A;  5FKO A;  5F0C A;  2K40 A;  1APL C;  5FKM A;  1MNM C;  5F0H A;  1FTZ A;  1ETQ A;  4QSH A;  3G1L A;  2ECC A;  3RKQ A;  4X1E A;  4A69 C;  4B4C A;  4JYK A;  3GBG A;  3FK7 A;  5GPA A;  5K7H A;  2JA7 J;  1JGG A;  5EDN A;  4JX5 A;  5DTD A;  2WV1 A;  2ELK A;  4JX4 A;  2EH3 A;  3BT9 A;  2IEK A;  3L1P A;  4XK4 A;  2JWT A;  2K9S A;  4MIM A;  1U9O A;  3S1Q J;  3SDG A;  3OOU A;  2E2J J;  1RKW A;  1MSF C;  3G1M A;  3HB9 A;  4UUS B;  1TC3 C;  1ETO A;  2DA2 A;  4IHV A;  2DJN A;  1W0U A;  1FIA A;  4A93 J;  2EBI A;  1JT6 A;  5C3E J;  3HDD A;  1IC8 A;  3JRC A;  2HOS A;  2JJ7 A;  4FE4 A;  3FKI J;  4D7N A;  4XIC A;  2VKV A;  2YS9 A;  5J3L A;  1UHS A;  5IPA A;  2Y9Z A;  1B8I B;  4AUX A;  5EF6 A;  1GVD A;  2FD5 A;  3HOW J;  1JKQ C;  2HI3 A;  2LP0 A;  2XPW A;  4LOC A;  2EZL A;  3BQY A;  3BQZ A;  1ZTR A;  5IYB J;  1VI0 A;  4IHX A;  1LFB A;  1ENH A;  3S15 J;  2ME0 A;  1H89 C;  4ABZ A;  2XSD C;  1ITY A;  1JUS A;  3ZQG A;  3BR2 A;  1OFC X;  4IEJ A;  1POG A;  1WH5 A;  1ETW A;  1X2N A;  1HOM A;  2XB0 X;  4B3A A;  3WHC A;  3VPR A;  1F36 A;  3Q3S A;  5E3L A;  4FCY A;  5F1J A;  1BA5 A;  2L0K A;  2E2H J;  2XGC A;  1JKP C;  2HYJ A;  4V2G A;  4X6A J;  3CMY A;  1RPW A;  5C4X J;  2LTP A;  1AHD P;  3O8H A;  2TRT A;  2DMT A;  3C2B A;  2CU7 A;  4J19 A;  3S17 J;  3DCF A;  1LE8 A;  4GFB A;  2H8R A;  1Z0X A;  5F0F A;  1NK2 P;  2D5V A;  5HOD A;  1TWC J;  3JR9 A;  1TWG J;  2JA6 J;  2HQ5 A;  2R0Q C;  5M3F J;  2LK2 A;  3Q0W A;  2LVS A;  1HDD C;  1ZR4 A;  1FEX A;  1R9T J;  2M0C A;  1Y1V J;  2CQQ A;  2YUS A;  4M3G A;  3CCY A;  2JK3 A;  2KT0 A;  1K61 A;  4DW6 A;  1QVU A;  2E2I J;  2XGD A;  1BL0 A;  2X48 A;  5EEA A;  3S1N J;  1AKH B;  4C3H J;  2LY9 A;  2VKE A;  3PM1 A;  2MG4 A;  1MH4 A;  4D7M A;  2Y30 A;  3S16 J;  2DTZ A;  1MBF A;  2PMZ N;  1MBG A;  1HDP A;  2EQR A;  2JA8 J;  3O8G A; 
#chains in the Genus database with same CATH topology
 3HOU J;  1DGW Y;  2XGE A;  4V19 K;  9ANT A;  2GBY A;  2DA6 A;  3BR6 A;  2L7K A;  2Z1D A;  1X1A A;  3IL2 A;  3BR1 A;  2E1M C;  2NXN B;  2CO5 A;  3OYE A;  1WRJ A;  1LUJ B;  3JRG A;  4NDL A;  3EUK L;  3D1N I;  1SFO J;  1SD5 A;  2Y0S N;  1HW2 A;  4CCL A;  2MGQ A;  5CVJ A;  2RAE A;  2HFH A;  4UUV A;  4NUB A;  3ZMS A;  4B44 A;  3A0H C;  1FC3 A;  3BWG A;  2L5Q A;  4MLO A;  3V7S A;  4M9S A;  1YFH A;  1BOB A;  4A3K J;  1W0T A;  3I4M J;  2O7O A;  2DFE A;  2QF7 A;  4NQW A;  4IXA A;  4WXC A;  2EA4 A;  3AKZ A;  2Y75 A;  3QYF A;  5HNF A;  2RQP A;  4E7K A;  4OMZ A;  3KP7 A;  4XBF A;  3CCL I;  1BR2 A;  1KQ0 A;  1XCB A;  3MAJ A;  4BE2 A;  3JRA A;  3CTA A;  4A6E A;  2QSH X;  4OWR B;  1V5G A;  1Y39 A;  3V8K A;  3ABK H;  3HRM A;  3MKZ A;  3E1S A;  3QU6 A;  1GT0 C;  3GZN B;  4AIH A;  1R5G A;  3DU6 A;  3JRD A;  3DLA A;  4G6D A;  4P5O A;  1IGN A;  4BDZ A;  2M87 A;  1J2X A;  1BW6 A;  2GIV A;  3O6B B;  2OZ6 A;  2OU2 A;  4IF4 A;  5D4R A;  2VT2 A;  5BMZ A;  4Y17 A;  1VQ5 I;  2A69 F;  1KON A;  3QOE A;  5DD8 A;  3FXL A;  2X0L A;  4LFU A;  2VUM J;  3KP3 A;  5CQG A;  4DYC A;  3TP3 A;  1KU2 A;  3AG4 H;  1IG7 A;  4AM3 A;  1YJW I;  3P7N A;  4KIG A;  1D1B A;  2OBP A;  1M1E B;  3EPZ A;  4RB0 A;  3CJQ B;  4L9V A;  5EG0 B;  2XC7 A;  3PIO F;  4NC7 A;  4BQQ A;  1ZRF A;  4W97 A;  3CMA I;  1SMY F;  5GTI C;  1QZE A;  3R4K A;  1O57 A;  1LVA A;  2CUF A;  3SFI A;  4Q5S F;  2EZK A;  1GLN A;  3ECH A;  3T1B A;  5IOZ A;  5IT3 A;  3BJO A;  4XKV A;  2VE8 A;  2PMZ A;  5E1X A;  5D5U B;  1OYW A;  2FQ3 A;  2GQQ A;  4B8X A;  2AXL A;  4M73 A;  4ESJ A;  3EYI A;  3I4N J;  4Q4Z F;  4MGR A;  2CV0 A;  4EMS A;  1JTY A;  4UVB A;  3ABM H;  3VSL A;  3TGN A;  2ZJ2 A;  3J7A O;  4IL6 C;  4XRS G;  2HVR A;  4ENK A;  2NNY A;  1VQN I;  4I09 A;  2Y0S A;  1Z6R A;  5HDN A;  2EJR A;  1BOA A;  4W1U A;  2L2O A;  1WHU A;  4I76 A;  3KYC B;  3SEZ A;  1WJA A;  4IHY A;  2E36 A;  4FHT A;  3FXK A;  4RLF A;  3JRF A;  2PEX A;  1WFX A;  3GX4 X;  1O3Q A;  2L7M P;  3QQA A;  4A3J J;  2ZME C;  5LHG A;  3HOV J;  2E1O A;  2X6Y A;  2DXI A;  4C30 A;  5B5E C;  1MMD A;  3GYH X;  2ZJQ F;  1FWZ A;  4GYG A;  4MEX F;  2WAE A;  2HOA A;  2E1C A;  2LYC A;  2STT A;  2ID6 A;  3HUG A;  2DW4 A;  1P2F A;  4XRM A;  2X6O A;  4A5N A;  2LFB A;  3QYE A;  5CKT A;  3OIP A;  4HOB A;  1UEL B;  3KET A;  3JRH A;  3H1C A;  2D1H A;  1TQM A;  2FSW A;  2DMQ A;  1J5Y A;  1ZAR A;  3KEO A;  4C2U A;  1GDT A;  3KFW X;  2DA4 A;  4RA2 A;  3GXO A;  1OYI A;  1MBE A;  1MND A;  3F6O A;  4A3I J;  1T2K A;  5F27 A;  3DF8 A;  2QCO A;  3OYF A;  3FXJ A;  3E6B A;  4BJ6 C;  3HTS B;  2VPL A;  2LKX A;  3M4O J;  1SAX A;  3B6A A;  1RC9 A;  3DTE A;  1FLI A;  1FOW A;  2ZFW A;  5DCM B;  1TL8 A;  4YEJ A;  4PCQ A;  3OL4 A;  1LDD A;  2Z2S B;  4EGY A;  3HGG A;  3BLY A;  1IAW A;  2XAJ A;  4FE7 A;  2P5L C;  1LKX A;  1JE8 A;  1IW7 F;  1EH6 A;  2F4M B;  2MD5 A;  2R5Z A;  1RRJ A;  1MBH A;  2H09 A;  4B43 A;  3QP5 A;  1X19 A;  4XKW A;  1SVM A;  3HKZ N;  4II2 A;  4UV9 A;  5LLQ A;  2EK5 A;  1B72 A;  3EUH C;  1IZ1 A;  1TT5 B;  5KAF C;  1T08 B;  4A3C J;  1I1S A;  4AID A;  4HZF A;  3A02 A;  1XN7 A;  3TW6 A;  1I50 J;  2XKO A;  1FOY A;  2V79 A;  3LSP A;  3RYR A;  5D8L B;  2M4G A;  1X1C A;  4C2T A;  4XRS A;  1ZKG A;  4RAY A;  2BY3 A;  2MYS A;  1MDM A;  2VPR A;  3TDU C;  4CIC A;  2EV6 A;  2ZXJ A;  3IV5 A;  3DBL B;  5EZH A;  3K1M A;  4Y52 J;  1K83 J;  3K1N A;  1TP4 A;  4HF2 A;  4G94 A;  2BHY A;  3F8C A;  2V6E A;  3E5U A;  5J1U A;  3S3O A;  3AFH A;  2R3S A;  4L5I A;  5C4J J;  1LJ9 A;  2CJJ A;  5E3N A;  2M9H A;  4CH7 A;  5CVV A;  4CHU A;  4JQF A;  1CQT A;  1W7P B;  3JRB A;  4I2O A;  1ZAO A;  3LNQ A;  1S8N A;  5K5Q A;  4UXN A;  4OIO F;  4XSX F;  3VOD A;  3HJE A;  4KYW A;  2NVY J;  5DD4 A;  3HM5 A;  4IRH A;  3SJM A;  4BAC A;  2Q0O A;  2M2E A;  1LEA A;  2KKO A;  2CUZ A;  2X6W A;  1O3T A;  3FZV A;  4Y7N J;  2ISY A;  1EF4 A;  1X3Z B;  5GPC A;  3J81 Z;  1NTC A;  4YG2 F;  2TDX A;  1Z7L A;  3JSO A;  2A68 F;  2ZXW H;  4E7H A;  1Z9C A;  3E6D A;  2HOT A;  1VND A;  4HAM A;  3JAM K;  5LRR A;  1O7L A;  4A0Z A;  1XMX A;  3PJR A;  1IXC A;  1Z6T A;  1JXS A;  4ZYE A;  4YFX F;  4HX7 A;  2WY7 Q;  3LOC A;  1UHM A;  4PK4 A;  1T56 A;  3RPQ A;  1GVJ A;  3TDZ C;  2QM3 A;  2RNG A;  2KQR A;  4G6Q A;  2ZXH A;  5CJ9 A;  3S14 J;  1OCT C;  1Y0N A;  5DYM A;  1XC5 A;  3FM3 A;  5L3C A;  5J4Y A;  3HOY J;  1JKR C;  1OCO H;  1K7A A;  5FD6 A;  2B0L A;  1ULY A;  3H3Z A;  1R1T A;  4A12 A;  4ESB A;  3GTO J;  2QWW A;  1D3Y A;  5K7Z A;  1JUM A;  2V6C A;  1EJ9 A;  1RUO A;  5E1W A;  4GXO A;  3DEE A;  2R7Q A;  2O61 A;  4XR6 A;  4XNF A;  3CCQ I;  2FOW A;  3C18 A;  4OIN F;  2LH9 A;  3SXY A;  4RGX A;  3RDI A;  3HKZ A;  1SMT A;  2LY2 A;  4AC0 A;  2R92 J;  2YX7 A;  1CF7 A;  4HLX A;  4FQG A;  3ML6 A;  1Z21 A;  3ULQ B;  2R5Y A;  1D8J A;  1T6S A;  3WG7 H;  1B6A A;  2AO9 A;  3GTG J;  3SHF A;  1P4X A;  4C9Y A;  4M6V A;  3K4J A;  3GTQ J;  1YJN I;  5TIS C;  2JTV A;  3VWB A;  3GFL A;  1TWH J;  3DPU A;  2NS8 A;  2VJI A;  4CA0 A;  1WQ2 A;  1ACI A;  2H94 A;  3FXM A;  4I0A A;  1O7F A;  2OAZ A;  3HRS A;  2EB7 A;  5LGN A;  5FGM A;  2ZSH B;  4WK8 F;  2K40 A;  1APL C;  3OOP A;  2F5F A;  3T0Y A;  4GGG A;  4YFK F;  2ZO4 A;  4FX0 A;  1A35 A;  1FTZ A;  4QSH A;  4B48 A;  4BYY A;  1XDS A;  3M7G A;  2W25 A;  4ZDP A;  3KYL A;  1OCR H;  4A69 C;  4G7Z F;  2W1O A;  4B4C A;  3WTX C;  5K7H A;  5GPA A;  2Q8K A;  4L5J A;  5EDN A;  2P6T A;  3SZG A;  3S2W A;  1IV8 A;  5D5X B;  4KIB A;  2JRM A;  5DTD A;  5DEQ A;  3S3N A;  2QQ9 A;  4BNC A;  3ZXS A;  1N78 A;  5D4S A;  2OUM A;  4JX4 A;  3C2G A;  3CCJ I;  3L1P A;  1GHC A;  4XK4 A;  2JWT A;  2G9W A;  3L09 A;  3FXQ A;  4LLG F;  1G3Y A;  2EIJ H;  1MSF C;  2GXG A;  1ZRC A;  4UUS B;  2XAF A;  1W0U A;  3ZMT A;  1ZRE A;  4A93 J;  1JT6 A;  3P9K A;  4FX4 A;  2HOE A;  3SEQ A;  2HOS A;  1OPC A;  1RZ4 A;  3FKI J;  4UVA A;  4NC8 A;  5E79 C;  4P9F A;  1ZEL A;  4D7N A;  1YW9 A;  2VKV A;  2YS9 A;  5LD2 C;  1GXP A;  2BYV E;  2CW7 A;  5EF6 A;  5GAE J;  2ZJR F;  2R7X A;  1O3R A;  2KIF A;  4G9Y A;  3ASO H;  2HEO A;  3U1K A;  5FFX A;  5DCF A;  1ZTR A;  2V9P A;  2KPM A;  1LFB A;  4IHX A;  1IRF A;  5JHU A;  5HNH A;  3S15 J;  2ME0 A;  1SVL A;  3I0T A;  5HLG A;  1PDN C;  2EIM H;  1UJ8 A;  3BR2 A;  3DQV C;  4IEJ A;  4PJ0 C;  5E18 F;  3G73 A;  2KIQ A;  4B3A A;  2XRO A;  3NQO A;  2VBY A;  3Q3S A;  2IRF G;  1EV7 A;  1HKT A;  2R7U A;  2KDO A;  1PYV A;  5F1J A;  3GLL A;  2PG4 A;  4V2G A;  1PP7 U;  3HTU A;  3R6S A;  3OYK A;  2KIU A;  4N9H A;  1E2X A;  3BZ6 A;  2KRC A;  3K9T A;  1VQ7 I;  2M45 A;  2CU7 A;  1TTY A;  2CFO A;  2JPB A;  3S17 J;  3DCF A;  2LMD A;  4FET A;  1EH7 A;  2BE5 F;  2C6Y A;  2D5V A;  5HOD A;  2VC0 A;  1Z3Y A;  1G8X A;  2M3A A;  4IRG A;  3JR9 A;  2JA6 J;  2IS6 A;  2LK2 A;  2NS0 A;  1KA8 A;  2LVS A;  1T39 A;  1Y0U A;  1ZR4 A;  5E8I A;  1Y1V J;  2YUS A;  3RJP A;  1MMS A;  2V4J C;  5ILV A;  5FB2 A;  1PJR A;  4ENM A;  1YTY A;  4Y3O A;  2M5W A;  4KIF A;  3NWT A;  2K4J A;  2HQR A;  2K27 A;  3A4C A;  5CYV A;  4KT6 A;  2PJP A;  1G4D A;  4ON0 A;  4QPQ A;  1MIJ A;  3OY9 A;  2OTJ I;  4CCN A;  2EFP A;  1BI2 A;  2CUJ A;  2Z9O A;  3S16 J;  2EPF A;  4HLY A;  1A04 A;  3KP5 A;  1FT9 A;  4LLL A;  1SD4 A;  4EV0 A;  1QZZ A;  1MBF A;  1FOX A;  2EQR A;  2JA8 J;  3H5A A;  2VC1 A;  4DOZ A;  3RPU D;  3FK6 A;  4BJT A;  2F5C A;  2ZBK A;  4AYB N;  2JPC A;  1WCM J;  1DPU A;  3LWF A;  3F8N A;  2MH2 A;  1U5T A;  4BXF A;  1ZGA A;  1NG6 A;  1P9Q C;  3GO5 A;  4RLQ A;  1VQO I;  4EEF G;  1FSH A;  3H0D A;  4MO7 A;  4P9U A;  4RMN A;  4L9N A;  2BGC A;  2K9Q A;  3EUA A;  5B1A H;  2YX4 A;  1YRN A;  1VQ8 I;  4HPQ A;  3BC8 A;  3GW2 A;  3QU3 A;  4I7H A;  1OYY A;  3P9I A;  3GTM J;  4DZJ A;  3CC4 I;  2A5W A;  3S3M A;  2BV6 A;  2GWR A;  4HQE A;  1F4K A;  1SAN A;  4LB5 A;  4A3D J;  2GA1 A;  3Q9S A;  2KP6 A;  4B47 A;  1L3L A;  2I5U A;  1SEU A;  2VJ4 A;  5E8G A;  3VDX A;  2HKX A;  4IHW A;  1D0Z A;  2L4M A;  2XAG A;  2P0W A;  1IDZ A;  3DEW A;  4IQJ A;  4R8H A;  3C7J A;  3IKT A;  4ETS A;  2OC6 A;  4JOM A;  1JKO C;  1YW7 A;  2ZC2 A;  5J1Y A;  3OSG A;  3CF2 A;  1D1A A;  3RPU A;  3BTC A;  4XLE A;  2W24 A;  3KP6 A;  1FJL A;  3AL0 B;  3CP8 A;  2HVQ A;  2WV0 A;  4BEH B;  2DMU A;  2QZ8 A;  1I39 A;  4IOC F;  5J47 A;  1F5T A;  2VQC A;  3DV8 A;  2QQ8 A;  3QAH A;  3L00 A;  2CW0 F;  5HDG A;  2J5P A;  3WTU C;  1S3J A;  1ON1 A;  1ZK8 A;  2HYF A;  1R23 A;  2V1N A;  3LAJ A;  5E1Z B;  2DTR A;  2O0Y A;  2ID3 A;  1KU7 A;  3IH4 A;  3B02 A;  3W6K B;  5K5R A;  1ZQ3 P;  4DBQ A;  2OPT A;  3IWZ A;  4HNT A;  2CW8 A;  1DUX C;  5J40 A;  4UB8 C;  2ZKZ A;  4BY1 J;  1SD7 A;  5DM6 F;  2DT5 A;  2Z5U A;  1ZG5 A;  1B8I A;  1R5H A;  3JRE A;  3GTL J;  3CCM I;  2NYX A;  2HVS A;  5HS9 A;  4A3M J;  4OIQ F;  1BW5 A;  5C44 J;  3HIF A;  3HSE A;  4YFN F;  4HV6 A;  1SVO A;  4RS8 A;  3ISP A;  4PUS A;  2HPM A;  5FRO A;  2CRG A;  1JJ6 C;  1IN7 A;  2TCT A;  2XF5 A;  2DPD A;  2EFO A;  2PX9 A;  3FKJ A;  5F1R A;  1MKM A;  2O8X A;  2R7D A;  1YI2 I;  4AYB A;  1LDJ A;  3IUO A;  2XAQ A;  2KIM A;  3QPH A;  4PJL A;  2I8D A;  3W2V A;  3CCU I;  4UNO A;  1WI9 A;  1NG7 A;  4KNY A;  3WTY C;  3G2B A;  3QRF F;  3TMO A;  4G12 A;  1SC7 A;  2JT1 A;  1R22 A;  2DU9 A;  2FNA A;  3H9Q A;  1HSJ A;  2K4B A;  1GV5 A;  2DA5 A;  4C3J J;  5J8F A;  4M6X A;  3D0S A;  4RGU A;  3H3U A;  3FDY A;  2ZJP F;  2PBI A;  2RV8 A;  3I4P A;  4IHS A;  2DCE A;  3W2W A;  2Z16 A;  3VSK A;  4N4O B;  1AKH A;  4XID A;  3BTJ A;  4P96 A;  2F2E A;  4A6D A;  2GXB A;  2ME6 A;  3KEY A;  4Q47 A;  3OYJ A;  3H9J A;  3H5N A;  3Q0U A;  3QOD A;  4A3E J;  2CV1 A;  4KIC A;  2HDC A;  3ZMV A;  5BPI A;  4XMY A;  3G6E I;  1YIO A;  4KUM A;  1LFU P;  4EJT A;  3J81 K;  3U21 A;  3K69 A;  3PIP F;  3N4M A;  2ZSI B;  3CMM A;  3TP0 A;  1FBQ A;  3GEZ A;  2IVM A;  1BJZ A;  2O5R A;  2VOP A;  4BBR J;  2DBB A;  2WC2 A;  1ZN2 A;  3ASN H;  4MTD A;  3M1E A;  3CUQ B;  4HX8 A;  1ZG1 A;  2DK8 A;  1X58 A;  1KQ8 A;  3FBI B;  2LSO A;  5IOY A;  1GUU A;  1UAA A;  3QPT A;  4BQO A;  2VON A;  3MMY B;  1LNW A;  2HXO A;  1XG1 A;  2VJJ A;  2BW3 B;  1YX5 A;  1ZG3 A;  2DMN A;  3OV8 A;  3BCA A;  1HF0 A;  1SFE A;  3KP2 A;  4MFE A;  2L9S A;  4E70 A;  2HS5 A;  3ZQ7 A;  4ZH4 F;  4ITV A;  4M74 A;  3LAP A;  1VTN C;  5IYD J;  4EJW A;  4LK1 F;  4E7L A;  3WOD F;  1HCR A;  1T33 A;  1K78 B;  4LLN A;  3E7L A;  2E19 A;  3H5R A;  2E5N A;  1R7J A;  3L2V A;  5DS9 A;  3I58 A;  1EKE A;  1UMQ A;  3KZI C;  2V1D A;  3BG3 A;  4FIS A;  1ZH5 A;  2K9N A;  2ELJ A;  2XRL A;  2CUE A;  3MN2 A;  4QPO A;  4EGZ A;  1MMN A;  3PO2 J;  1N75 A;  1TWF J;  1JGS A;  2EIK H;  1MBJ A;  4L9J A;  5J8C A;  2EV5 A;  2MLG A;  3CCR I;  2OCE A;  4HQM A;  2QKM B;  2VJ5 A;  3VYR B;  1Y1W J;  2QA4 I;  4KN7 X;  3KCC A;  1GXQ A;  4DZP A;  2HZD A;  2W48 A;  4AD9 A;  2R93 J;  3BPV A;  4G7O F;  3HOS A;  1XDU A;  4ASN A;  3PSF A;  5K7F A;  3CF5 F;  1QNT A;  4KT5 C;  1ZHF A;  1P4W A;  4IPA A;  2M34 A;  2DFI A;  3CCE I;  1FMW A;  4RGS A;  2MLK A;  2P7C B;  2OQG A;  4XM3 A;  3IRR A;  2ECB A;  1WI3 A;  4C2M J;  3MWM A;  2A07 F;  1XMA A;  2CH0 A;  3A2K A;  2HGC A;  3LST A;  1FP1 D;  5EG0 A;  1LE8 B;  1Y6I A;  3ZOB A;  1ORK A;  2IA1 A;  5KCM A;  4HNV A;  1YIT I;  3OYB A;  3NRV A;  3RZO J;  1HLV A;  4HSR A;  3HGY A;  1YS7 A;  2CQX A;  1P4A A;  1V5E A;  1LQ1 A;  4C3I J;  3WTT C;  2AQF A;  2G7U A;  4GO1 A;  2EFN A;  5J4V A;  1ZLK A;  4PSW A;  2PN6 A;  3E3V A;  4JK1 X;  5FKK A;  2XF7 A;  4M9Z A;  1NK3 P;  1YJ9 I;  5IT9 Z;  3RSN A;  4EAT A;  5KK1 A;  1T0F A;  5B1B H;  2E34 A;  3DPL C;  4Z6Y A;  1BIA A;  4PFP A;  1R5I D;  3CCV I;  2HZT A;  4KIT B;  1TW3 A;  2L9N A;  3DKY A;  3F3X A;  3IHU A;  4HBL A;  2A05 A;  4BBS J;  1XSX A;  3HSR A;  4QTR A;  1FY7 A;  2KRH A;  1H88 C;  4M3B A;  4EVI A;  4PFO A;  5H6Q A;  3ZR8 X;  5J1R A;  1H0M A;  1HBX G;  4XLC A;  1C0W A;  3CDH A;  5F64 A;  3T5X A;  4YII A;  2MBF A;  4ZTJ A;  1YOV B;  2HWV A;  2ETH A;  3LQQ A;  3ONQ A;  2MSY A;  5GAH J;  1TBX A;  1VQK I;  2LD5 A;  3C3W A;  3SDB A;  2JVH A;  3JTG A;  3LA2 A;  3HPG A;  1IO2 A;  4NC6 A;  1VQP I;  3ZQH A;  4WXD A;  2NOG A;  3V8L A;  1B1B A;  3D5L A;  3IP4 B;  3ERM A;  4G6T B;  1S7O A;  1ZGW A;  4G7H F;  4IVN A;  3S8P A;  4NHJ A;  1P7J A;  3COA C;  2Y31 A;  2A6E F;  2IXS A;  4DQ2 A;  5EEH A;  1ETK A;  4MNU A;  4J00 A;  1QBJ A;  3OYN A;  4YIR X;  5KVR A;  4HV5 A;  3LFU A;  4A5M A;  3ESW B;  4UVC A;  5F0H A;  1D8K A;  3EET A;  2Y69 H;  2ECC A;  3GZ5 A;  3MZH A;  1BC7 C;  1KU3 A;  2XKP A;  5DCM A;  4JYK A;  1H9T A;  2JA7 J;  3JSP A;  3I54 A;  1JGG A;  2F5E A;  2XAH A;  3IAS 2;  4JX5 A;  2E60 A;  1QGP A;  1W7P D;  1MMA A;  2EH3 A;  3BT9 A;  3KYD B;  1W5T A;  2K9S A;  3MFK A;  4S05 A;  2E2J J;  1BIB A;  2O3F A;  3J7Z I;  3DXJ F;  3HB9 A;  3V7R A;  1VQM I;  1TC3 C;  2DA2 A;  3FHN A;  2BHZ A;  2QBY B;  3CJN A;  4Y4R A;  2K9M A;  2KRF A;  2QEN A;  2JJ7 A;  1W1W E;  1Y56 A;  2PI0 A;  5BOX A;  4LMY A;  4CZZ A;  1UHS A;  3RI4 A;  1QHG A;  2EFQ A;  4AIJ A;  4AUX A;  2DPU A;  3LA3 A;  3TO6 A;  2VKD A;  1U5T C;  4ZDL A;  1WJC A;  3BQY A;  2L01 A;  4KJZ A;  1E0E A;  2E1M B;  1XCV A;  3C1D A;  1N77 A;  2YU3 A;  4F92 B;  1D0X A;  1ITY A;  2GXA A;  4XN3 A;  4ZYD A;  1POG A;  1WH5 A;  1HOM A;  3WU2 C;  2XB0 X;  2UV1 A;  5E20 A;  3KE2 A;  3LSI A;  1F36 A;  1VZ0 A;  1ZYR F;  3G3Z A;  3PUB A;  1BI1 A;  1BA5 A;  2DK5 A;  2X51 A;  3GFM A;  1K4T A;  2KMU A;  4YIF A;  1JKP C;  1W7P A;  2V9V A;  4KMU X;  3CMY A;  2LTP A;  2RGV A;  1FNN A;  2YPR A;  3C2B A;  1SD6 A;  3HC7 A;  4EJO A;  4F7Z A;  3AG2 H;  3BG7 A;  3MD2 A;  3HHG A;  4XN0 A;  1Z0X A;  2X1E A;  3WGH A;  3J7Y J;  3I59 B;  1R4M B;  2P5V A;  4QWQ A;  3DBH B;  4K2E A;  1IRG A;  2FOK A;  2R0Q C;  2OZU A;  4BHP A;  1XSD A;  3W2A A;  4CZC A;  1FEX A;  4RB1 A;  2W7N A;  5JHF A;  1R9T J;  2CQQ A;  3GCM A;  2GIZ A;  1YE9 A;  2JK3 A;  2P6S A;  4ENN A;  1QZY A;  4HG2 A;  4DW6 A;  3JW4 A;  1W5S A;  1BL0 A;  5EEA A;  4OU0 A;  5L3F A;  2A5Y B;  2VBW A;  4RM3 A;  2Q2E B;  3OYG A;  3TBI A;  2CQK A;  2LY9 A;  2VKE A;  1Z1D A;  3OYI A;  3K4C A;  2J5O A;  2DTZ A;  2PLY A;  2R7V A;  1S7A A;  2XAS A;  4CO8 A;  1FSE A;  5JFR A;  1FYM A;  4F3Q A;  3I56 I;  3FMR A;  4XOP A;  1HC8 A;  5M3M J;  3PNT A;  5DUK A;  3GTJ J;  2H6B A;  3K4L A;  2M0M A;  3BCB A;  4O6J A;  2KLO A;  3RKW A;  5IYC J;  1FX7 A;  1MNE A;  3CUO A;  2GLO A;  2VL8 A;  1S9H A;  1WJ5 A;  2X4H A;  4WXH A;  5CQE A;  3ZP5 A;  3HEF A;  1E3O C;  1MSE C;  3HHH A;  3ERE D;  1U8R A;  2OCC H;  4LB6 B;  2H8W A;  4B09 A;  4LD5 A;  2FX0 A;  2W4S A;  2XSJ C;  3S1M J;  3IH3 A;  4U0V A;  4QLC U;  3CQZ J;  3M3Y J;  2WAQ N;  1O4X A;  2L7F P;  2HQN A;  5LFA A;  1K79 A;  2CG4 A;  2EFW A;  1J75 A;  1FBS A;  5KNL A;  2JA2 A;  3A0B C;  1G2H A;  4OAZ A;  1I27 A;  2LY1 A;  2FQ4 A;  5D5W B;  4ZDO A;  2DN0 A;  2P4W A;  4DYQ A;  3JRI A;  3HSF A;  1JTX A;  2OQR A;  3VOE A;  4CXF A;  3ZPL A;  1UZC A;  4PGH A;  1WWX A;  2X85 A;  1RI7 A;  5BS6 A;  2Z3Y A;  3J7A Y;  2R7Z J;  2CQ7 A;  1FZP B;  2NVT J;  2ZME B;  1FPQ A;  4CYC B;  1B9N A;  1FMV A;  3FWE A;  4A3B J;  4B1R A;  1RET A;  3BJA A;  5JI6 A;  3BDD A;  1OCP A;  1MJ9 A;  3KIO A;  2G0E A;  3WGI A;  4CUG A;  1W4M A;  3TOB A;  4UUS A;  3S2H J;  5GAD J;  2RKH A;  1OJL A;  3ZMZ A;  2UZK A;  3VB2 A;  4HNU A;  5CVU A;  2CGP A;  1SAU A;  1OQY A;  1WZ2 A;  2E1N A;  2WAD A;  3M07 A;  4CCM A;  1A36 A;  1AWC A;  3RQ4 A;  5AIQ A;  4MFD A;  2R7O A;  2M8G X;  2W00 A;  4DIQ A;  3RKX A;  2HR3 A;  2RC4 A;  3GTK J;  5FKN A;  4S04 A;  5JVT A;  5EGO B;  4RBO A;  5LHI A;  3OIQ A;  2QQB A;  3QPS A;  3RYP A;  3KPH A;  4CCO A;  2GZW A;  4LIV A;  5GTH C;  4HDV A;  4XON A;  1BR1 A;  3F72 A;  3K1P A;  1J09 A;  2CYY A;  2E5Z A;  1LVK A;  3OMY A;  2HU9 A;  4LG0 B;  1QRY A;  3S1R J;  3WTW C;  2COB A;  3CUQ C;  4CGZ A;  4UY8 I;  4M3E A;  1H8A C;  3PO3 J;  3OYH A;  2ISZ A;  4KN4 X;  4L18 B;  1HST A;  1O3S A;  4A3L J;  2GAU A;  1RR8 C;  3CDL A;  1VFC A;  3CME I;  3B73 A;  1FIP A;  2DI3 A;  3CDI A;  4EJV A;  3E5Q A;  1AU7 A;  1G6N A;  4BJ5 C;  2JUG A;  2K5C A;  5HLT A;  5FJ8 J;  2WAQ A;  4TV7 A;  1RNL A;  1RKT A;  4BUP A;  3FXR A;  4IQ4 A;  2CS3 A;  2NS7 A;  3F21 A;  3SZT A;  1PUF B;  1XS9 A;  5H6R A;  4BH9 A;  3TW7 A;  2F5V A;  2IPQ X;  3E0J B;  3F23 A;  4NB5 A;  4IX7 A;  4DYR A;  1F43 A;  1ZGJ A;  3FF5 A;  3LSG A;  3PFY A;  2LBF B;  1YX3 A;  4IJA A;  1HW1 A;  1ETY A;  2DFH A;  2M7A A;  1DU0 A;  2PFB A;  2Y48 A;  5EEG A;  1MJA A;  2LF8 A;  1MD0 A;  2D45 A;  2VBZ A;  3M8F A;  3A01 B;  2ELH A;  3ZN0 A;  2QGU A;  3U9G A;  4BQA A;  3T8R A;  1Y8R B;  2UWM A;  3K7A J;  2LNB A;  3BZC A;  4ZZL A;  2L02 A;  2VOD A;  4F91 B;  5JLX A;  4D5C A;  5ICG A;  3IAM 2;  3ZQF A;  2L9R A;  2H27 A;  2ESH A;  1F9N A;  2Z99 A;  3OR1 C;  2P81 A;  2LKS A;  5GP9 A;  3QWL A;  5IT9 K;  3I9V 2;  3RIR A;  3S2D J;  2V9K A;  2DAO A;  1MJB A;  3R0J A;  3OYD A;  1MMG A;  5FLX Z;  3NWS A;  3BR5 A;  3TKY A;  1WPK A;  3IH2 A;  4PJJ A;  2FRH A;  4EM1 A;  4LG3 A;  2XPV A;  1T0F C;  2DDA A;  4M3D A;  1LB2 A;  5A2Q Z;  1G3S A;  2B7E A;  3PQK A;  2JRT A;  3OS2 A;  4DNC A;  4II3 A;  2M4K A;  3N05 A;  3BG9 A;  3L2U A;  3F6V A;  2RQQ A;  2XPU A;  3R0A A;  3MEX A;  3J80 Z;  3K4M A;  2IP2 A;  4I6Z A;  1TZL A;  1QHH D;  2O9L A;  2NVQ J;  2K86 A;  2L4A A;  1FP2 A;  1R6R A;  1BN5 A;  2EZH A;  1PVE A;  3TOA A;  4CCK A;  3I55 I;  1X4P A;  1XGN A;  3WTV C;  1VQ9 I;  1WH7 A;  3KX2 A;  4BEH A;  2K85 A;  5BNG A;  1F1Z A;  3DU5 A;  2NVU B;  4NNJ A;  3WU0 A;  4QIW N;  4HDU A;  1J59 A;  5ILS A;  3W3C A;  4H4K C;  3WE2 A;  5HS7 A;  1ETV A;  1NH3 A;  3R60 A;  5FO5 A;  2DQL A;  5FLM J;  1R49 A;  2N8G A;  5L3E A;  5LGT A;  3CCS I;  3QYB A;  1J9I A;  3H92 A;  2UXN A;  1S6L A;  3FX3 A;  3ABU A;  4KIS A;  3E6C C;  4I01 A;  1DP3 A;  1RR7 A;  3PUF A;  2V7F A;  3SFZ A;  3FIS A;  3F8B A;  3M9A A;  4ESF A;  4E7Z A;  1U78 A;  2YU9 J;  2XDV A;  3CLQ A;  2NNN A;  4MHG A;  3JTH A;  1I3Q J;  2HKO A;  3BG5 A;  2VLA A;  3O3K A;  2E35 A;  3HYI A;  3IWF A;  1STZ A;  2DJI A;  1QA6 A;  3KLO A;  1QPI A;  1X1P A;  4A3G J;  2R7S A;  3H35 A;  3BJ6 A;  3CES A;  1KYW A;  3KP4 A;  3CD6 I;  4UHT A;  3LQR A;  5LHH A;  2FEZ A;  5M5W J;  2KHM A;  2VXZ A;  2ZB9 A;  1VF9 A;  4A0Y A;  3OYA A;  5JVG F;  3BY6 A;  3TO7 A;  2KZV A;  4U7D A;  4MTE A;  1MH3 A;  3I5U A;  5ICC A;  3HOX J;  3UR3 C;  3OYL A;  3ECO A;  2EWN A;  2OA4 A;  1UB9 A;  3L7W A;  3HG9 A;  2LOO A;  5FKL A;  1KZH A;  1KQ9 A;  1N25 A;  1JJ8 C;  2BXZ A;  3PFI A;  3WTS C;  2I10 A;  1BR4 A;  1IUY A;  3ZMU A;  4L0Y B;  2MW8 A;  1P92 A;  5IP6 A;  4B3X A;  2HQA A;  1BBY A;  2K02 A;  3RKY A;  4EJU A;  1WSU A;  2FMY A;  1DQU A;  2DMP A;  2GA2 A;  4BL0 B;  1GV2 A;  2JUC A;  1TNT A;  3OIO A;  4I99 C;  5ILU A;  1PP8 F;  4XLP F;  2XUB A;  4Z2Y A;  2WY8 Q;  2H1K A;  1A6I A;  1Y8Q B;  1K4S A;  3HPH A;  5F04 A;  1OCZ H;  4GRI A;  4MQ9 F;  5H20 A;  5DM7 F;  3IKV A;  2FJ1 A;  2EA2 A;  2HTS A;  3NEU A;  1SFU A;  3EQL F;  1S7E A;  4NQW B;  1V4R A;  2VB6 A;  2VI6 A;  1UST A;  5FKO A;  2VQG A;  5F0C A;  3PL8 A;  2XAU A;  2P7V B;  1HKQ A;  5AON A;  3L2Q A;  3V8J A;  2GOM A;  3CUQ A;  5FKM A;  1ETQ A;  3RCO A;  3RKQ A;  4X1E A;  3WE3 A;  2IS1 A;  4RB2 C;  3GBG A;  4HYE A;  4FT8 A;  3K6G A;  4BS9 A;  3GFJ A;  2BW3 A;  1XGS A;  4LGW A;  2WV1 A;  1X1D A;  2ELK A;  4GDF A;  4XOR A;  5HLH A;  3K0L A;  3PNY A;  3L2R A;  3I64 A;  4J01 A;  4HF0 A;  3F22 A;  4IHV A;  1U6G A;  1FIA A;  3DFG A;  3MZY A;  2EBI A;  5C3E J;  4PDK A;  1IC8 A;  3CC2 I;  1K78 A;  3BG6 A;  5HLI A;  3K4B A;  2BOL A;  5TJJ A;  4IHT A;  2Y0M A;  4BU2 A;  1Q1H A;  4ZJZ A;  5J3L A;  1XGO A;  5IPA A;  1OR7 A;  4XKB A;  3I3L A;  1PUE E;  3AG1 H;  2YSR A;  1GVD A;  1MW7 A;  5L3G A;  2FD5 A;  3HOW J;  1R58 A;  2UUZ A;  2XPW A;  3OL3 A;  4LOC A;  3GFI A;  3BQZ A;  2DQR A;  2M30 A;  5CVI A;  5IYB J;  6PAX A;  4PJM A;  3T8T A;  1QPM A;  1JI8 A;  1H89 C;  1JUS A;  3ZQG A;  4ZZD A;  2XIG A;  3I71 A;  1ETW A;  2ZXI A;  2F6C A;  4GYI A;  1ZRD A;  1WVR A;  1XB4 A;  4RM2 A;  3VPR A;  5JR3 A;  4F52 A;  3GVA A;  5GAG J;  4FCY A;  2E2H J;  1OKR A;  3ZGK A;  2BVL A;  3H9G A;  1S5L C;  1VQ4 I;  3E97 A;  3N97 A;  1Z7U A;  2K9L A;  3SQN A;  3V4G A;  5TGT A;  2FU4 A;  4OOI A;  2BVM A;  1AHD P;  3O8H A;  5TRD A;  2TRT A;  2FBI A;  4NBQ A;  3AAF A;  5FFZ A;  1LE8 A;  2PQ8 A;  3OYM A;  2H8R A;  5F0F A;  1ERD A;  2NOJ B;  2VKH A;  4WX9 A;  1ODD A;  5J6X A;  2HQ5 A;  3Q0W A;  2LRE A;  4U0Y A;  1HDD C;  2JSP A;  1B4A A;  1XGM A;  3ABT A;  2M0C A;  4XL9 A;  2JQ7 A;  4U0W A;  3PSI A;  4M3G A;  1E3H A;  1U3E M;  1WJE A;  3BZK A;  4RAG A;  1VQL I;  5HS8 A;  1QVU A;  4CYD A;  2K3F A;  1OMI A;  2X48 A;  2MFZ A;  1R71 A;  1HA8 A;  1X1B A;  3S1N J;  3DTK A;  1R36 A;  2A6T A;  2IA2 A;  1YS6 A;  1A6Q A;  3HUG B;  2DYS H;  3GWZ A;  2MG4 A;  5FRM A;  1MZB A;  4ANJ A;  1TQP A;  1G3W A;  2HDW A;  2LDU A;  4AU7 A;  4D0P A;  2M8E A;  1H9G A;  1MBG A;  2ADU A;  4BHC A;  5B66 C;  1B9M A;  4WCG A;  3ELK A;  1FYL A;  3I53 A;  1BI0 A;  1NHA A;  1TT0 A;  2F4O B;  4HA8 A;  3WG9 A;  1MGT A;  3X2Q H;  5DDG A;  5BPD A;  1U8B A;  2DA1 A;  4AVP A;  2R7W A;  1IN6 A;  1USS A;  5JLW A;  4BGD A;  2KDZ A;  4S0H B;  1EH8 A;  1RES A;  1Z3X A;  5ICE A;  3K2Z A;  3GF2 A;  1V3F A;  3F0C A;  5IP7 J;  3HOZ J;  5HOO A;  2JN6 A;  1YQA A;  3HL2 A;  1HXD A;  4JX6 A;  1W36 C;  3BR3 A;  5FD5 A;  2P8T A;  2UXX A;  3FXU A;  3JCU C;  2W82 A;  4U87 A;  3K70 D;  2ZFU A;  3BRO A;  3F8F A;  4LJZ F;  1IF1 A;  3LSR A;  1T98 A;  1IN4 A;  3PNV A;  2R5Z B;  2VIX A;  3IC7 A;  4JBA A;  3BP8 A;  2V26 A;  4AWX B;  5K5O A;  5FLV A;  3LFK A;  3VFZ A;  3MZ8 A;  1OLT A;  2IA0 A;  2IJL A;  2FE3 A;  4ENJ A;  2EV0 A;  1B72 B;  2V1U A;  2MC3 A;  2OF7 A;  4E7S A;  3GLX A;  2WAF A;  4EQQ A;  2L9V A;  2WTE A;  3PQJ A;  4XLH A;  2ACJ A;  2DOA A;  2VE9 A;  1UHW A;  3F9K A;  2CMP A;  2LRD A;  4IO9 F;  2HDD A;  3DTI A;  3NAR A;  2O8K A;  3MQ0 A;  3VEP A;  4UV8 A;  3VYS B;  4ZYH A;  1X2M A;  1FOK A;  1ON2 A;  2QVO A;  1MDM B;  4LK0 F;  5ED4 A;  1QO0 D;  5M5X J;  2L54 A;  2D2W A;  2M7B A;  2O03 A;  4P55 A;  3LSJ A;  2A61 A;  1R1V A;  2NVX J;  2DDB A;  5M5Y J;  3GZ6 A;  4F93 B;  2B9S A;  3CO7 C;  2AQE A;  1IXS B;  4HF1 A;  2IAI A;  2P5K A;  5DV5 A;  3VYU B;  2JZY A;  3FMQ A;  4JP0 A;  5LGU A;  2XGX A;  2LF7 A;  5L3D A;  3UNG C;  1IV6 A;  2QBY A;  5D8K B;  1I6H J;  5H2F C;  2MH9 A;  1YW8 A;  1U9N A;  1IRZ A;  4Y13 A;  3LSH A;  3TED A;  2RNJ A;  3BTI A;  5EZG A;  5K1Y A;  1IRX A;  2OD5 A;  3S93 A;  2HTJ A;  4IKF A;  1SFK A;  5FLX K;  1TNS A;  3R61 A;  3DP7 A;  4BHB A;  1A5J A;  2WWY A;  2ICW G;  1T95 A;  2LG4 A;  2EIN H;  5A2Q K;  4D9J A;  2D1V A;  3HBL A;  4ZYG A;  5D6F A;  3OS1 A;  1DP7 P;  2OTL I;  4GCV A;  2BY1 A;  1XD7 A;  2STW A;  3ABL H;  1VQ6 I;  2JSC A;  4M71 A;  3RQI A;  1WJB A;  3J80 K;  2XF6 A;  3P5J A;  3FXO A;  1G3T A;  4E7I A;  3M8E A;  5CPR B;  4H0E A;  2DT7 B;  2QQA A;  3QPL A;  1ONV A;  1V54 H;  2R4G A;  5HVQ C;  2X9D A;  3L2W A;  1UG2 A;  4V2F A;  2IGK A;  1RUN A;  1S72 I;  2DA3 A;  3I59 A;  1MBK A;  1ZR2 A;  2EZI A;  3Q5F A;  3BTL A;  1R1U A;  1LDK B;  2JVG A;  1YIJ I;  3QP6 A;  2KJC A;  4BE0 A;  2WBM A;  3AL0 C;  4OIR F;  4OMY A;  2AHQ A;  4Y33 A;  2KIS A;  3U1D A;  2IT0 A;  2VT3 A;  3DLL F;  1CF7 B;  1P6R A;  2W85 A;  3WHB A;  2JMW A;  1KGS A;  2DOE A;  2R5Y B;  3KLN A;  5KHD A;  2OJE D;  1Z77 A;  2Q2E A;  2FML A;  1V5F A;  3H0G J;  4I02 A;  1S29 A;  3G4S I;  1D5Y A;  3FMS A;  4IRI A;  3LA7 A;  3WU1 B;  1WJF A;  2A6H F;  5LEK A;  2IS2 A;  2QSF X;  2XVC A;  4PJN A;  4FAS D;  1YLF A;  3CLO A;  3HZJ A;  1W5C C;  2XV4 S;  4M3F A;  2LKP A;  2CV2 A;  2QEX I;  4BDY A;  1TQI A;  1UFM A;  1OCC H;  2HPI A;  2Y9Y A;  4IZZ A;  2MA3 A;  3BR0 A;  3E5X A;  1J7K A;  4OAY A;  3F8M A;  4IOA F;  2RDP A;  3SYT A;  2VQL A;  4N4N B;  1OIS A;  1UG0 A;  5EYR A;  3E6M A;  4U88 A;  3C2H A;  2IW5 A;  3NAU A;  2DYR H;  1T38 A;  1HQC A;  4YRV A;  5E3M A;  1FTT A;  1WJD A;  1XX5 A;  3OYC A;  2KZG A;  4L0Z B;  4XLN F;  4D1Q A;  4R79 A;  3DEU A;  2EIL H;  3VYT B;  4A3F J;  2W57 A;  1HW5 A;  2BEO A;  2X1C A;  3ZMD A;  2LLK A;  3HRT A;  5ICF A;  3ZQQ A;  1AOY A;  2FXA A;  1IN8 A;  3ZQC A;  3UKG A;  1W36 D;  4U7B A;  4RDU A;  2NAZ A;  4HX4 A;  5DUI A;  1WGX A;  2QUF A;  2VXD A;  3LSK A;  4R1H A;  1IJW C;  1ETX A;  4G8X A;  4AVZ A;  2KJB A;  3V7C A;  2BZT A;  3FBN B;  1LEB A;  3EYY A;  2MAB A;  5E3O A;  3S32 A;  1DU6 A;  1JUP A;  3FIW A;  5ERI A;  2BBY A;  4FTH A;  4UUT A;  1IUF A;  1RIO H;  1B59 A;  2BY0 A;  4D5F A;  2DT6 A;  4CCJ A;  1QVT A;  3FHZ A;  2DA7 A;  2K7L A;  4PGG A;  2KFD A;  1TWA J;  2ZME A;  2JA5 J;  3ZQI A;  4BKX A;  2RN7 A;  3U2R A;  4CYC A;  1V55 H;  5L3B A;  4XSZ F;  3IRQ A;  2BY2 A;  3MKL A;  3ZCO A;  3M8J A;  2E71 A;  4XLA A;  3MCZ A;  4KDP A;  4M72 A;  1XMK A;  2VBX A;  2RVC A;  4XRF A;  3WGG A;  5F08 A;  1FBU A;  1Z67 A;  4I98 B;  3ZRG A;  4BXX J;  4F55 A;  2FNP A;  2AXT C;  4ZYA A;  2FBH A;  3RZD J;  1XSV A;  1BM9 A;  5AIP A;  2DOF A;  2XHK A;  2KL4 A;  1IXR C;  2M1B A;  2Y2Z A;  4OIP F;  2L7Z A;  5B3S H;  1XTA A;  3GTP J;  3Q0V A;  2XB5 A;  1X3W B;  5EGO A;  1SFX A;  3DKW A;  4N0B A;  4A2U A;  3A03 A;  1X3U A;  1G59 A;  2R7F A;  3H36 A;  4BY7 J;  3G1O A;  4I0B A;  2CSO A;  3OR2 C;  3K4K A;  4LG0 A;  3ROU A;  2GM4 A;  1JHF A;  2CFX A;  1D1C A;  5F6F A;  1KYZ A;  1KU9 A;  5D6E A;  1HKS A;  2O6G E;  3H3V K;  3OSF A;  1D0Y A;  4L5E A;  3L9F A;  5IP9 J;  2B63 J;  3MVP A;  2DO7 A;  3TQN A;  4HRI A;  3D5R C;  2ZNY A;  3EUH A;  3GME A;  1XPX A;  4BQN A;  2GOX B;  3W6V A;  3ZQL A;  1REP C;  3D5S C;  3WTZ A;  3REO A;  2HXI A;  5KAI C;  3K4N A;  2MD0 A;  3B6C A;  4MQV A;  4XOT A;  3K2A A;  2X6X A;  1IDY A;  1I6X A;  3TO9 A;  2XRN A;  4BAY A;  2CWE A;  2PMU A;  4DGW B;  4EM0 B;  3CZ6 A;  2AS5 F;  1OR7 C;  2LR8 A;  3OS0 A;  1JT0 A;  4AIK A;  3KZZ A;  2IBD A;  4YEL A;  1PUF A;  3L2C A;  1U5T B;  5HDK A;  1P7I A;  4KA4 A;  1Q1V A;  4BXU A;  3HOT A;  1YG2 A;  5LRS A;  2FF4 A;  4KFC A;  1YO5 C;  2WB1 N;  2ESN A;  2LBF A;  5D5V B;  2K3P A;  2W84 A;  3FM5 A;  1YRN B;  1QQI A;  3P9C A;  4LIT A;  1IN5 A;  4XKC A;  3DPT A;  3OWT A;  3A01 A;  2ZNZ A;  3QOP A;  3A1Y A;  2F5D A;  4L9T A;  5LEJ A;  1U2W A;  3O2P E;  2VOO A;  3LSM A;  2DOD A;  1DPR A;  2QKL B;  2WA0 A;  2FA5 A;  5LBQ A;  1TLH B;  2DFF A;  3K10 A;  1MNM C;  2FBK A;  2V1X A;  1YHQ I;  1CGP A;  3G1L A;  1K6Y A;  4M9X A;  2YR2 A;  3TL4 X;  4EM2 A;  4ZTF A;  3HXL A;  1TW2 A;  4N9I A;  2H6C A;  1X4O A;  3FK7 A;  1J0R A;  1LPQ A;  2E7X A;  2F4I A;  3V42 A;  1BC8 C;  3Q9V A;  1EA3 A;  2CQN A;  4O5V A;  2IEK A;  4MIM A;  3S1Q J;  1U9O A;  3DWL E;  3OOU A;  3SDG A;  3MKY B;  1RKW A;  3GUD A;  1Z05 A;  2FUG 2;  4M6Y A;  1K6O A;  3G1M A;  1DGR M;  3M1C A;  4WF2 A;  1ETO A;  3JAM Z;  2DJN A;  3KZY A;  3AG3 H;  2VAS A;  3HDD A;  2IGN A;  5IY5 H;  2Z33 A;  2HNH A;  4KMF A;  4O3M A;  4E6K G;  2VN2 A;  4E4H A;  1LFP A;  3JRC A;  3RTR A;  4PZJ A;  4FE4 A;  2Q1Z B;  2IGM A;  1DDN A;  4XIC A;  2LC2 A;  3G71 I;  1QU3 A;  2BXY A;  2PJR B;  2Y9Z A;  1B8I B;  2ZCW A;  1T8I A;  3BOQ A;  1JKQ C;  2HI3 A;  2LP0 A;  4RGR A;  2EZL A;  2MC4 A;  1E3P A;  3CJR B;  2R7R A;  1VI0 A;  4UB6 C;  4RAF A;  2A3S A;  1ENH A;  4ABZ A;  2XSD C;  1E17 A;  4P1W A;  1Z91 A;  1OFC X;  1X2N A;  5CVR A;  1BI3 A;  2VQH A;  3MKW B;  2DLL A;  3WHC A;  4CDG A;  2PJR A;  5FRN A;  2F48 A;  3DKX A;  4ZC3 A;  5E3L A;  5CLS A;  4WWC A;  2OV7 A;  2QSG X;  1JHH A;  2L0K A;  3CC7 I;  2XGC A;  1A31 A;  2E7W A;  2HYJ A;  5E17 F;  2NRA C;  4MEY F;  4BE1 A;  3ZN1 A;  4X6A J;  1RPW A;  5C4X J;  1U0J A;  4Y15 A;  1FYK A;  2X1D A;  4X0G A;  2DMT A;  4J19 A;  4GFB A;  4XQF A;  2WB1 A;  5EJC A;  3HRU A;  3BPX A;  1UCR A;  1NK2 P;  1TWC J;  4A0X A;  4PSX A;  1TWG J;  2G7H A;  3SZP A;  4HEA 2;  3LL7 A;  5M3F J;  4DJA A;  1I5Z A;  1R4N B;  4DBR A;  3CCY A;  4HW0 A;  1D5V A;  2QLZ A;  1ZLJ A;  2KT0 A;  1YYV A;  4LIU A;  1K61 A;  3EDP A;  2IS4 A;  2RRE A;  2L3D A;  2E2I J;  2QYO A;  2XGD A;  1R00 A;  1AA7 A;  2R7T A;  1I3A A;  1L0O C;  3CP2 A;  4XLF A;  3KEQ A;  5BQT A;  4HST A;  1WKM A;  4RAZ A;  1AKH B;  4RB3 C;  3CO6 C;  4C3H J;  3CJT B;  3PM1 A;  2IGO A;  1MH4 A;  4D7M A;  3LMM A;  3K70 C;  2Y30 A;  3W6J B;  1I1G A;  2COM A;  2H1L A;  4CSW A;  2PMH A;  4Q48 A;  3DBR B;  2HYG D;  1BJA A;  4E7J A;  2PMZ N;  1HDP A;  3O8G A; 
#chains in the Genus database with same CATH homology
 3HOU J;  5M3M J;  2XGE A;  3GTJ J;  9ANT A;  3FK6 A;  2GBY A;  2DA6 A;  3BR6 A;  4AYB N;  1U8B A;  1WCM J;  5IYC J;  2DA1 A;  2GLO A;  5JLW A;  2KDZ A;  3BR1 A;  4S0H B;  4EEF G;  1RES A;  4MO7 A;  5IP7 J;  3F0C A;  3JRG A;  3HOZ J;  4NDL A;  3HEF A;  1E3O C;  3D1N I;  1SFO J;  1MSE C;  2JN6 A;  2Y0S N;  2K9Q A;  4JX6 A;  3BR3 A;  1YRN A;  2MGQ A;  2RAE A;  3GTM J;  2FX0 A;  4DZJ A;  3S1M J;  3IH3 A;  4MLO A;  3LSR A;  3CQZ J;  3M3Y J;  2WAQ N;  2R5Z B;  1O4X A;  1W0T A;  4A3K J;  5FLV A;  3I4M J;  1SAN A;  2O7O A;  2QF7 A;  4A3D J;  2L7F P;  1B72 B;  2OF7 A;  1G2H A;  4IHW A;  2FQ4 A;  2DN0 A;  4DYQ A;  1IDZ A;  3DEW A;  3JRI A;  1JTX A;  2HDD A;  3JRA A;  3NAR A;  2O8K A;  1JKO C;  1X2M A;  2R7Z J;  5J1Y A;  3OSG A;  3BTC A;  1GT0 C;  1FJL A;  2NVT J;  5M5X J;  4CYC B;  4A3B J;  4B1R A;  3JRD A;  2DMU A;  1IGN A;  3LSJ A;  1RET A;  2NVX J;  5M5Y J;  1OCP A;  2G0E A;  1BW6 A;  2IAI A;  4UUS A;  3S2H J;  1ZK8 A;  4JP0 A;  1OJL A;  1IV6 A;  1I6H J;  2ID3 A;  2VUM J;  3IH4 A;  1ZQ3 P;  1U9N A;  2OPT A;  1IRZ A;  4DYC A;  3TED A;  3TP3 A;  3BTI A;  1IG7 A;  5EZG A;  4BY1 J;  1B8I A;  4MFD A;  5EG0 B;  3JRE A;  2M8G X;  3GTL J;  4W97 A;  4A3M J;  3GTK J;  5FKN A;  2CUF A;  3SFI A;  5EGO B;  4RBO A;  1BW5 A;  2EZK A;  5C44 J;  1A5J A;  3QPS A;  5IOZ A;  2CRG A;  3HBL A;  1JJ6 C;  2TCT A;  3I4N J;  1QRY A;  3S1R J;  2COB A;  1JTY A;  3RQI A;  4M3E A;  1H8A C;  3PO3 J;  3QPL A;  4XRS G;  2X9D A;  1UG2 A;  4V2F A;  4A3L J;  2DA3 A;  4G12 A;  1MBK A;  1ZR2 A;  2EZI A;  3CDL A;  1VFC A;  4W1U A;  1FIP A;  3BTL A;  4I76 A;  1AU7 A;  1GV5 A;  4IHY A;  2DA5 A;  4C3J J;  5FJ8 J;  3JRF A;  2L7M P;  3QQA A;  4A3J J;  1RKT A;  3HOV J;  2E1O A;  2AHQ A;  2NS7 A;  1PUF B;  1XS9 A;  3TW7 A;  3WHB A;  2JMW A;  2R5Y B;  4DYR A;  4XID A;  1AKH A;  1F43 A;  3BTJ A;  1Z77 A;  3LSG A;  2HOA A;  3H0G J;  1D5Y A;  2ID6 A;  2ME6 A;  1ETY A;  1DU0 A;  4XRM A;  2X6O A;  2LFB A;  3Q0U A;  4A3E J;  3A01 B;  4M3F A;  3JRH A;  2Y9Y A;  1LFU P;  2DMQ A;  3BR0 A;  3K7A J;  1GDT A;  2DA4 A;  3TP0 A;  1MBE A;  4A3I J;  5F27 A;  5EYR A;  5JLX A;  4D5C A;  1BJZ A;  2QCO A;  3ZQF A;  2L9R A;  4BBR J;  2LKX A;  3M4O J;  2P81 A;  3NAU A;  1X58 A;  5GP9 A;  3B6A A;  5E3M A;  3S2D J;  1FTT A;  5IOY A;  1GUU A;  3BR5 A;  2HXO A;  3HGG A;  1WPK A;  1XG1 A;  3IH2 A;  4FE7 A;  2DMN A;  2R5Z A;  1HF0 A;  1MBH A;  4A3F J;  2XPV A;  4MFE A;  2LLK A;  4M3D A;  3HKZ N;  3ZQC A;  3UKG A;  4RDU A;  1WGX A;  1B72 A;  1IJW C;  1ETX A;  3BG9 A;  5IYD J;  5E3O A;  1DU6 A;  1JUP A;  2XPU A;  4A3C J;  3FIW A;  4FTH A;  1T33 A;  3A02 A;  4UUT A;  1I50 J;  3TW6 A;  1IUF A;  1HCR A;  4I6Z A;  3E7L A;  2E19 A;  3LSP A;  2O9L A;  5DS9 A;  4D5F A;  2NVQ J;  4XRS A;  1UMQ A;  1ZKG A;  1QVT A;  2DA7 A;  2EZH A;  3BG3 A;  4FIS A;  2K9N A;  2VPR A;  1TWA J;  2XRL A;  2CUE A;  3MN2 A;  3ZQI A;  1WH7 A;  4BKX A;  2JA5 J;  4CYC A;  3IV5 A;  1TWF J;  5EZH A;  5BNG A;  4QIW N;  1MBJ A;  3PO2 J;  4Y52 J;  3MKL A;  1K83 J;  1Y1W J;  5J1U A;  1ETV A;  4DZP A;  2W48 A;  2R93 J;  5C4J J;  5F08 A;  5FLM J;  5K7F A;  2CJJ A;  5E3N A;  4BXX J;  2M9H A;  2N8G A;  2M34 A;  1CQT A;  3RZD J;  3JRB A;  3LNQ A;  2ECB A;  1WI3 A;  1RR7 A;  4C2M J;  3FIS A;  2NVY J;  5EG0 A;  2Y2Z A;  3HM5 A;  1U78 A;  1LE8 B;  3ZOB A;  3SJM A;  2YU9 J;  1ORK A;  2L7Z A;  4HNV A;  3GTP J;  3Q0V A;  2M2E A;  2XB5 A;  3RZO J;  1HLV A;  3HGY A;  5EGO A;  4Y7N J;  3A03 A;  1EF4 A;  5GPC A;  1I3Q J;  2CQX A;  3BG5 A;  1NTC A;  4BY7 J;  1QPI A;  4C3I J;  4A3G J;  3G1O A;  2HOT A;  1VND A;  2GM4 A;  5M5W J;  2ZB9 A;  5FKK A;  1VF9 A;  1NK3 P;  3LOC A;  1T56 A;  3H3V K;  3OSF A;  4L5E A;  1MH3 A;  3HOX J;  5IP9 J;  2B63 J;  3S14 J;  3MVP A;  1OCT C;  1XC5 A;  4BBS J;  3HOY J;  1JKR C;  3W6V A;  4QTR A;  3ZQL A;  1H88 C;  4M3B A;  5FKL A;  2HXI A;  3GTO J;  3B6C A;  5J1R A;  1JUM A;  3K2A A;  5K7Z A;  1IDY A;  1JJ8 C;  2I10 A;  2LR8 A;  2MW8 A;  1JT0 A;  5IP6 A;  2IBD A;  1PUF A;  4AC0 A;  2MSY A;  2R92 J;  2DMP A;  1P7I A;  1Q1V A;  2LD5 A;  1GV2 A;  2R5Y A;  3OIO A;  2WB1 N;  2AO9 A;  3GTG J;  2H1K A;  1YRN B;  4M6V A;  1A6I A;  3GTQ J;  3ZQH A;  5F04 A;  2NOG A;  1TWH J;  2FJ1 A;  3A01 A;  1ZGW A;  2NS8 A;  1P7J A;  2Y31 A;  1S7E A;  1ETK A;  2VI6 A;  5FKO A;  5F0C A;  2K40 A;  1APL C;  5FKM A;  1MNM C;  5F0H A;  1FTZ A;  1ETQ A;  4QSH A;  3G1L A;  2ECC A;  3RKQ A;  4X1E A;  4A69 C;  4B4C A;  4JYK A;  3GBG A;  3FK7 A;  5GPA A;  5K7H A;  2JA7 J;  1JGG A;  5EDN A;  4JX5 A;  5DTD A;  2WV1 A;  2ELK A;  4JX4 A;  2EH3 A;  3BT9 A;  2IEK A;  3L1P A;  4XK4 A;  2JWT A;  2K9S A;  4MIM A;  1U9O A;  3S1Q J;  3SDG A;  3OOU A;  2E2J J;  1RKW A;  1MSF C;  3G1M A;  3HB9 A;  4UUS B;  1TC3 C;  1ETO A;  2DA2 A;  4IHV A;  2DJN A;  1W0U A;  1FIA A;  4A93 J;  2EBI A;  1JT6 A;  5C3E J;  3HDD A;  1IC8 A;  3JRC A;  2HOS A;  2JJ7 A;  4FE4 A;  3FKI J;  4D7N A;  4XIC A;  2VKV A;  2YS9 A;  5J3L A;  1UHS A;  5IPA A;  2Y9Z A;  1B8I B;  4AUX A;  5EF6 A;  1GVD A;  2FD5 A;  3HOW J;  1JKQ C;  2HI3 A;  2LP0 A;  2XPW A;  4LOC A;  2EZL A;  3BQY A;  3BQZ A;  1ZTR A;  5IYB J;  1VI0 A;  4IHX A;  1LFB A;  1ENH A;  3S15 J;  2ME0 A;  1H89 C;  4ABZ A;  2XSD C;  1ITY A;  1JUS A;  3ZQG A;  3BR2 A;  1OFC X;  4IEJ A;  1POG A;  1WH5 A;  1ETW A;  1X2N A;  1HOM A;  2XB0 X;  4B3A A;  3WHC A;  3VPR A;  1F36 A;  3Q3S A;  5E3L A;  4FCY A;  5F1J A;  1BA5 A;  2L0K A;  2E2H J;  2XGC A;  1JKP C;  2HYJ A;  4V2G A;  4X6A J;  3CMY A;  1RPW A;  5C4X J;  2LTP A;  1AHD P;  3O8H A;  2TRT A;  2DMT A;  3C2B A;  2CU7 A;  4J19 A;  3S17 J;  3DCF A;  1LE8 A;  4GFB A;  2H8R A;  1Z0X A;  5F0F A;  1NK2 P;  2D5V A;  5HOD A;  1TWC J;  3JR9 A;  1TWG J;  2JA6 J;  2HQ5 A;  2R0Q C;  5M3F J;  2LK2 A;  3Q0W A;  2LVS A;  1HDD C;  1ZR4 A;  1FEX A;  1R9T J;  2M0C A;  1Y1V J;  2CQQ A;  2YUS A;  4M3G A;  3CCY A;  2JK3 A;  2KT0 A;  1K61 A;  4DW6 A;  1QVU A;  2E2I J;  2XGD A;  1BL0 A;  2X48 A;  5EEA A;  3S1N J;  1AKH B;  4C3H J;  2LY9 A;  2VKE A;  3PM1 A;  2MG4 A;  1MH4 A;  4D7M A;  2Y30 A;  3S16 J;  2DTZ A;  1MBF A;  2PMZ N;  1MBG A;  1HDP A;  2EQR A;  2JA8 J;  3O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...