1MDMB

Inhibited fragment of ets-1 and paired domain of pax5 bound to dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
RDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords PAX5/ETS BINDING SITE ON THE MB-1 PROMOTER
publication title STRUCTURAL ANALYSIS OF THE AUTOINHIBITION OF ETS-1 AND ITS ROLE IN PROTEIN PARTNERSHIPS
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmB00
3QP6A 5CYVA 1UHWA 3I0TA 3BOQA 3MCZA 2VBWA 5LBQA 2L4AA 3WGGA 4UNOA 2LKPA 3DQVC 2E1NA 2H27A 5ICGA 2P6SA 1SD6A 4GGGA 5D5XB 2DBBA 3GWZA 2W24A 1FNNA 1ZG1A 3RPQA 1BN5A 4YIFA 3CUQC 4CGZA 1XGNA 5HS7A 3MQ0A 2F5DA 3ROUA 2BEOA 2QBYA 3P9KA 3IKTA 3ULQB 2Y48A 1D5VA 2KIUA 2YX7A 1U5TC 1WQ2A 5CLSA 3RKWA 4EJTA 4ENJA 4KNYA 5J8CA 2HTSA 2O03A 3VB2A 2E1CA 3T0YA 4QLCU 1S3JA 4Y15A 4DQ2A 1EH6A 3QOPA 4G6QA 3RYRA 3C3WA 4HW0A 5FFZA 1FYMA 3J81K 3K1MA 1YYVA 1A04A 1YQAA 4P5OA 1D3YA 2FE3A 1XSDA 1EV7A 4LD5A 1PP7U 2XIGA 2CQKA 1TTYA 4L9NA 4L5IA 1KU9A 4EV0A 2V1UA 2QQAA 3R60A 1U8RA 3M9AA 2RN7A 4NB5A 3L7WA 3LQRA 4CICA 3RIRA 2P8TA 1USTA 4XLPF 4MNUA 4PGGA 2ZNZA 1MJAA 4U7BA 2IRFG 3WTXC 1AWCA 2GA2A 3WE3A 5D5UB 3QPTA 3D0SA 1L3LA 4MQVA 4I0AA 1I1SA 4JK1X 4BHCA 4HLXA 1W7PA 3L09A 4E70A 3GW2A 3RI4A 1W5SA 5D5WB 1FBUA 4MTEA 2K02A 4ZYDA 1W4MA 2A5YB 3K0LA 3DPLC 2LSOA 1RI7A 2CYYA 1CF7A 4UHTA 1U2WA 1I6XA 3KP4A 3RYPA 1XGSA 1C0WA 4LLLA 4JBAA 5FLXZ 4HQEA 2DAOA 3I58A 5H6RA 1ZG3A 5DCMB 5LGUA 2EA2A 1P4WA 5K5OA 5A2QK 2L02A 2L3DA 2QVOA 4TV7A 1YS6A 2LDUA 4HV6A 2HGCA 3KZYA 1SFXA 2RVCA 1FWZA 1FC3A 4N0BA 3KFWX 1TNTA 4AVPA 5LHIA 3P9IA 3ZMTA 2H6BA 4XSZF 2ESNA 2DW4A 3ABUA 3VEPA 2VBZA 4M9XA 1HQCA 1R36A 3TOAA 3CTAA 2XAGA 2DI3A 2P5KA 3LAPA 3M1EA 3SXYA 4OINF 4EMSA 2IA2A 2ISYA 3DEUA 2M87A 3G73A 3E6DA 3SZPA 1XCBA 1YW9A 2WC2A 2XGXA 2IVMA 2TDXA 2VE9A 4OIPF 3CUQB 1IN4A 3JAMK 3IKVA 2CG4A 4N9HA 3P9CA 1VTNC 4XSXF 2CSOA 3KEOA 5E18F 4EGZA 4RB1A 3CDHA 1REPC 3L00A 1O3SA 3IHUA 3KP2A 2F5CA 1FSHA 1U5TB 1G6NA 3FWEA 3TGNA 4U0WA 4G8XA 2MC3A 1BI1A 1HXDA 2OAZA 3EDPA 2GIVA 1R22A 3DF8A 1ZLJA 1Y0UA 4HV5A 1FSEA 1ZLKA 2JRTA 5DEQA 3E5XA 3HTSB 5ICEA 1R1TA 2EK5A 3FZVA 1K79A 4L0YB 3GFMA 4LLGF 4RAZA 2O6GE 1KU3A 4ZYEA 4KMUX 2QZ8A 3DKWA 4YIIA 4L18B 3WGHA 4R1HA 3FXQA 1U6GA 2PJPA 2MBFA 3ZP5A 3MZYA 1JHHA 4HOBA 3TQNA 5D8KB 2NNNA 2RV8A 4WWCA 1IRGA 3BJAA 1QBJA 2CGPA 3DV8A 3ABTA 2VODA 1KQ9A 3DP7A 4ENMA 4YFNF 2DTRA 4U0VA 4P9FA 2L54A 1MJBA 4ON0A 1OYIA 5E8GA 3QPHA 3VFZA 3F21A 3JW4A 3H3ZA 2PMUA 3O6BB 4A0ZA 1RUOA 1IRFA 1HSTA 1B6AA 1O7LA 3E6CC 2ELHA 1PDNC 2STWA 2V6CA 1LQ1A 3WTVC 1FOKA 2BV6A 3I54A 1MDMB 4PZJA 1S8NA 1XSVA 1MJ9A 1QZYA 3WE2A 4CDGA 4PCQA 2GXGA 5FD5A 2BE5F 2FBHA 2ZKZA 3BJ6A 3HIFA 4LG0B 4HA8A 4AIHA 4CYDA 4DNCA 1ONVA 3T8RA 4WXCA 3ECHA 5IT3A 2OZUA 1U78A 3K69A 3EQLF 1YG2A 4ENNA 2IW5A 4M73A 3F22A 3GO5A 3ZQ7A 3ZMVA 3RKYA 1B1BA 2VOOA 3EUHA 1F9NA 3R0JA 2NAZA 1ZGAA 4KMFA 3J80K 4B09A 4XRFA 5JR3A 1NHAA 4G7OF 4MQ9F 2FA5A 5HS9A 1LB2A 3PFIA 4GYIA 1ZHFA 3DXJF 4L9VA 1SFUA 1FBQA 5DCFA 1WKMA 1FP2A 3V7CA 4R8HA 2R3SA 1R7JA 3OV8A 4IRIA 1XB4A 2HYFA 2XUBA 4IVNA 1E2XA 5ILVA 3F6VA 2A6EF 2PFBA 1XGOA 5H20A 4KFCA 4HLYA 5L3EA 3EETA 5E1ZB 1F1ZA 3FF5A 2HKXA 3CO6C 3GEZA 2PEXA 1IN8A 2X0LA 3FMSA 1JHFA 5DYMA 1KGSA 3IC7A 1EH8A 4FX0A 4BAYA 3V7RA 3WU1B 4CO8A 5DUIA 3KP6A 3E6BA 2QQBA 3FMRA 1CGPA 2MA3A 3D5LA 3K9TA 2Z5UA 3V8JA 3CO7C 5HLGA 3GZ5A 4CHUA 2HEOA 4L9TA 1OYWA 3HSRA 1T98A 1YO5C 1DDNA 2IT0A 2DU9A 3V7SA 3V8KA 5AIQA 4YFXF 3W6JB 1QNTA 2ZXJA 3FXRA 2FF4A 3KEQA 1F4KA 2RGVA 2D2WA 1ZYRF 4M9ZA 2XROA 1YFHA 4M72A 5ICCA 1SFEA 4BNCA 1ZH5A 4XBFA 4S05A 3FM3A 5DD8A 1BOAA 2D1VA 3M8FA 3IL2A 2DQLA 4HX8A 1JGSA 5F6FA 2NRAC 1FZPB 4M74A 5IT9Z 1ULYA 1KYWA 1K78B 5L3CA 4AD9A 5J8FA 1XMKA 5HDNA 5D6FA 4BQAA 1TW3A 3K1PA 2YPRA 4ZZLA 1OR7A 5LGNA 2STTA 4G6DA 3J7AO 1GXPA 4EJUA 5D4SA 2QENA 4IRGA 2NNYA 2XAJA 4EM2A 3NRVA 2HWVA 2GXBA 2WWYA 4KIGA 5DD4A 5E20A 2HQRA 3E5UA 3HRMA 4GO1A 1G4DA 3B02A 4KDPA 1FT9A 1SD5A 1BC7C 3ZN1A 3WTUC 2RKHA 2FEZA 3ISPA 1KA8A 2FSWA 2O61A 1TNSA 1WI9A 3FXUA 3TDUC 1BC8C 2PQ8A 2RC4A 1XCVA 2HQNA 2ZJ2A 5LRSA 1ZN2A 6PAXA 4B8XA 2W85A 1P92A 2GZWA 2EWNA 2KIFA 2JZYA 1GHCA 4KT5C 5HS8A 2GA1A 2V1DA 4KUMA 5DCMA 2XV4S 2BGCA 1XDSA 1HKTA 2XAQA 3I59A 4K2EA 1LEBA 3TDZC 2K7LA 3KZZA 4AWXB 4QWQA 2PBIA 1FX7A 1ON2A 2VXZA 2F2EA 4PGHA 5BS6A 2PN6A 3WTSC 4OIOF 2DFIA 2XKOA 2D1HA 3MFKA 1RZ4A 1SD7A 1UB9A 2JTVA 1O57A 3K2ZA 3GUDA 2XKPA 3GLXA 5FLXK 3FM5A 3TO7A 1FY7A 3NEUA 3U9GA 5L3BA 1LDDA 3HSEA 2A61A 4KN7X 1ZRDA 4HDVA 3BPXA 2GQQA 2MH2A 2HYGD 4LJZF 4F7ZA 3LWFA 4A5MA 4RGSA 5FD6A 1RIOH 2EV5A 4RAYA 4G7HF 3QP5A 4I0BA 2KJCA 4ZYHA 5L3FA 1DPUA 3DPTA 4HF0A 2KJBA 1I5ZA 4Y17A 1FYLA 2UWMA 1S29A 3SFZA 3C1DA 2Q2EA 5E17F 2IPQX 2RDPA 2JPCA 3U1DA 2KRFA 1TBXA 3IRQA 1IZ1A 2W84A 5D6EA 2CWEA 2RQPA 1W5TA 1W7PB 1WSUA 1P6RA 3HHGA 3M7GA 5FFXA 4Q47A 1AOYA 3ZMSA 4LGWA 3KLNA 1BIBA 3S2WA 4L0ZB 3FHZA 2P7CB 4UV8A 1FYKA 5HVQC 4L5JA 5HLHA 2QM3A 1S7AA 1R1VA 1T0FA 2W57A 2NYXA 2ISZA 2G7UA 2FMYA 2P5LC 4WF2A 1V4RA 1MD0A 1HKSA 4ASNA 4A2UA 1LJ9A 5CVVA 3HOSA 3QU3A 5JI6A 3QAHA 2B0LA 2ZMEA 4IJAA 5J6XA 3SQNA 2O8XA 2XASA 3L9FA 1IUYA 1GVJA 4IHTA 1Z6TA 3GFJA 2VBXA 4ETSA 4WK8F 3ERED 3ZMZA 1FPQA 4EJWA 2A6HF 2MLKA 3O2PE 3ELKA 3WG9A 2DLLA 3OOPA 4RS8A 2R7DA 2J5PA 1S7OA 5KK1A 3WTYC 3HTUA 2EB7A 3KE2A 2DK8A 1I1GA 1ZRCA 1BBYA 1KU7A 3PQJA 3RPUA 1MZBA 4OIRF 3ZMDA 2EFPA 1KQ8A 2D45A 1P4XA 3M8EA 3H92A 1ODDA 4BHPA 3H3UA 1J59A 4LG0A 1LNWA 3ZPLA 3C7JA 2IJLA 2DPUA 4LB6B 3F8NA 2H6CA 1J2XA 1RUNA 2Q8KA 1YW7A 2CO5A 3BPVA 3GVAA 4JQFA 2FMLA 3LA2A 4WXHA 2K4JA 1R1UA 4KYWA 3LA3A 3GZ6A 2Z33A 1D8KA 3WU0A 1Z6RA 2PI0A 2F5EA 4H0EA 1TLHB 2EFOA 2OQGA 5BOXA 2DQRA 3HSFA 4Y13A 4U0YA 1TW2A 1BI2A 2KIMA 2M45A 4HF2A 2FU4A 2EFNA 2FOKA 4BHBA 2QLZA 5JVTA 2IA0A 2FXAA 4ESFA 4NQWA 1J9IA 4FX4A 2ZBKA 4MEXF 5AONA 1HSJA 1B4AA 3FX3A 4FT8A 1IN6A 1B59A 4KN4X 1W7PD 2L01A 3GFIA 3JTGA 1UFMA 3ML6A 5E8IA 1O7FA 1DPRA 2KKOA 1T38A 3F8CA 1WRJA 1I27A 1EH7A 2P5VA 2HS5A 4LB5A 4MHGA 2P7VB 1SMTA 1UCRA 5LHGA 2XVCA 4HDUA 4KA4A 4O6JA 1K7AA 1YLFA 1T39A 1ZRFA 1MGTA 4D0PA 4YFKF 1BIAA 3TOBA 1IW7F 3Q9SA 2UXXA 2GAUA 4KIFA 3GX4X 4G7ZF 4WCGA 4RB3C 1R00A 2ZNYA 1H9GA 5BQTA 1G3YA 3E5QA 5BMZA 1X3UA 2HTJA 1YS7A 4M6XA 1S6LA 3V4GA 3L2CA 2M8EA 2XAHA 2IA1A 4LFUA 1R23A 1H9TA 3LQQA 2EV6A 4RB0A 1OPCA 2HOEA 2VOPA 3KP5A 3GYHX 2VN2A 2MLGA 2YX4A 5JHUA 1OKRA 2H09A 3MAJA 2VC1A 3T1BA 4G9YA 2FBIA 4OMYA 3CUOA 2WTEA 4A0YA 2PG4A 4PDKA 4HX4A 1HW5A 2K4BA 1Z9CA 1IAWA 2GWRA 4Z2YA 1J75A 3LA7A 2QWWA 2FNPA 2ADUA 2UXNA 5CVJA 3TO9A 1E17A 1V3FA 1BJAA 3W6KB 4M9SA 1MKMA 2HDCA 2G7HA 4MGRA 3R0AA 1ZAOA 4IXAA 2O3FA 1P4AA 2QYOA 2ETHA 3HHHA 1BI3A 4I09A 4ESJA 4RB2C 4IHSA 4I01A 4GXOA 5CVRA 1HKQA 5IT9K 2EJRA 4A6DA 2CFXA 4EQQA 1Z7UA 5LEKA 3FMQA 1O3RA 5ILUA 2E7XA 3LSTA 1G3WA 1USSA 1FBSA 3V8LA 2WV0A 1Z91A 2G9WA 5E1WA 5K5RA 4LK1F 1B9MA 2CW0F 1XGMA 5KVRA 5ICFA 3HRTA 5H6QA 5HLIA 1HBXG 4I02A 1ZARA 4I98B 2W25A 1BI0A 1STZA 3I4PA 1ZG5A 2OD5A 3RJPA 2E7WA 5ED4A 2F5FA 1OMIA 2OQRA 4MTDA 2VONA 2Q0OA 3E97A 2XAFA 4S04A 4KICA 4BYYA 3F72A 2LF8A 5D8LB 3WTZA 5FO5A 1P2FA 1SAXA 2A3SA 2NS0A 2PLYA 4WXDA 3J81Z 3QU6A 1T6SA 5BPIA 4EGYA 4UVBA 3R6SA 4LMYA 4UUVA 1B9NA 5TRDA 2DO7A 3DFGA 3R61A 3T8TA 4ENKA 2QBYB 2YU3A 2XRNA 2Y75A 2Y0MA 2Z3YA 2O0YA 3KCCA 3I5UA 2DPDA 5LLQA 4Q48A 5ILSA 1YIOA 3EYYA 3LFKA 4GYGA 5LRRA 3HRUA 1ZGJA 2HR3A 3N97A 2XHKA 4IF4A 2V79A 4OIQF 5JFRA 1IXRC 2DK5A 4HAMA 2MD5A 2P6TA 4HX7A 1XDUA 1HW2A 4YG2F 3B73A 5F1RA 3GXOA 3PQKA 3BP8A 2Z9OA 1IN5A 2HZTA 2K86A 1DP7P 2HFHA 1SMYF 4OMZA 4N9IA 2OZ6A 4UVAA 3CUQA 2EV0A 2FNAA 3O3KA 4U88A 2MH9A 1KQ0A 5ERIA 4WX9A 3F8FA 2FRHA 2JPBA 3BDDA 1RNLA 4RGUA 4BXUA 4I7HA 4HYEA 4P96A 1U5TA 5AIPA 1JXSA 2LNBA 3QRFF 2RNJA 3HRSA 5HDGA 4ZYGA 3I59B 3LAJA 4UXNA 4P55A 4HF1A 5TJJA 3MZHA 1J7KA 2M1BA 5A2QZ 3VODA 2FBKA 4ZH4F 2ZFWA 3Q9VA 4U7DA 1IXCA 3JSOA 3CJNA 5EEHA 1ZREA 1G3SA 5E1XA 2P4WA 5CVUA 5HOOA 4A6EA 2M5WA 2ZCWA 3BWGA 3F6OA 1L0OC 3F8MA 5K1YA 1CF7B 1JE8A 1J5YA 2OBPA 3SHFA 4R79A 1LDJA 3WTTC 3IRRA 5K5QA 3HOTA 2QUFA 1IXSB 1LVAA 4UV9A 2VT3A 1UHMA 2JT1A 1TQIA 2BBYA 3MEXA 4CZZA 3E6MA 3KP7A 3ZMUA 3SZTA 1WWXA 1H0MA 5HDKA 4G94A 1TQPA 3EYIA 1XSXA 3JAMZ 4L9JA 1XN7A 5DUKA 4KIBA 1D8JA 2HKOA 1MDMA 4HQMA 3COAC 1QZZA 1IN7A 4OU0A 4P9UA 4GCVA 5D5VB 2AS5F 2COMA 2ESHA 1FP1D 2LF7A 3BROA 1F5TA 3K1NA 5LHHA 3AAFA 1R5GA 2VBYA 4NHJA 3CLOA 4ESBA 2EA4A 4EVIA 2DT5A 3ECOA 3R4KA 3Q5FA 4CXFA 2EFQA 3VOEA 3I64A 2ZO4A 3RDIA 2ZMEB 4IPAA 3TO6A 2VE8A 2UZKA 1OYYA 2BYVE 3I53A 4XLNF 3WODF 1QGPA 4LK0F 3BZ6A 4RGXA 3U2RA 2AXLA 4A5NA 3WTWC 3G3ZA 1PP8F 4EJOA 1YW8A 4M6YA 5DV5A 1DUXC 4UVCA 2A68F 2A07F 2R7FA 1HW1A 1Z05A 4RGRA 1Z1DA 1O3TA 2V1XA 1XD7A 1XMAA 2YR2A 1U3EM 1SD4A 3KETA 1YTYA 5F64A 3RTRA 4FHTA 4HZFA 1QQIA 1PUEE 2ACJA 3C18A 1O3QA 3GF2A 4M71A 2OU2A 4EJVA 2IP2A 2X4HA 2C6YA 4MEYF 3KP3A 3MWMA 2PMHA 1LDKB 3RKXA 5LEJA 3F23A 1R58A 2JSCA 4EM0B 3IWZA 3BY6A 3E3VA 1KU2A 5FGMA 1BM9A 5BPDA 2A69F 5CVIA 5L3GA 3BJOA 4ZZDA 3GFLA 4AIJA 1TQMA 5CJ9A 1QPMA 1FLIA 3TKYA 5FB2A 3P7NA 4O3MA 2K27A 2Z99A 3F8BA 2L4MA 3N4MA 2VC0A 3J80Z 1G3TA 4O5VA 3ZN0A 4A0XA 5LGTA 1KYZA 4LLNA 2V9VA 4A12A 1QO0D 1Q1HA 3F3XA 3I71A 5D4RA 2EFWA 4IRHA 3T5XA 3HYIA 1LEAA 3HUGA 3NQOA 4AIKA 2FQ3A 1ON1A 2OA4A 1T2KA 2YSRA 3JTHA 2M30A 1K78A 1R5HA 3IWFA 3KLOA 4OOIA 2VT2A 1IF1A 1K6OA 2H94A 4HBLA 4I2OA 5L3DA 4BH9A 3REOA 3WGIA 1J0RA 5DDGA 2QQ9A 1GXQA 5EEGA 2J5OA 4Q4ZF 4EM1A 4Q5SF 3JSPA
chains in the Genus database with same CATH superfamily
3NARA 2DFEA 2VIXA 3QP6A 4HNUA 3RKQA 2OF7A 5CYVA 1UHWA 4CCLA 5IY5H 3JCUC 3I0TA 3BOQA 3GCMA 3MCZA 2VBWA 1H8AC 5LBQA 2KHMA 3O8GA 2L4AA 3WGGA 4UNOA 3GBGA 2LKPA 3DQVC 2E1NA 2H27A 4RLFA 5ICGA 2ZSHB 2P6SA 1SD6A 4GGGA 1JUSA 5D5XB 4KJZA 2OPTA 2M8GX 2DBBA 3CCVI 3J7ZI 1ZELA 3GWZA 2W24A 3K4KA 1PYVA 3K10A 2M0CA 4LOCA 1FNNA 1ZG1A 3RPQA 1BN5A 4YIFA 3CUQC 4CGZA 3PM1A 1XGNA 5HS7A 3MQ0A 2KDZA 2DFFA 2F5DA 3ROUA 2BEOA 1XMXA 2X1DA 2YUSA 4MLOA 2QBYA 4W97A 5FLMJ 3RPUD 4L5EA 4CA0A 3P9KA 3IKTA 2HPMA 4BEHB 1YRNA 3ULQB 2Y48A 1D5VA 2KIUA 2R93J 1LKXA 5F0CA 2X51A 3CCEI 2WBMA 1AKHB 2YX7A 1A6IA 3OIOA 2QKLB 1U5TC 1WQ2A 3RCOA 1RPWA 3FK6A 5CLSA 3RKWA 4A3IJ 3FDYA 4EJTA 2CQQA 4ENJA 4AC0A 1XTAA 1P7JA 1R9TJ 2E2HJ 3SEZA 5J8CA 1W5CC 4KNYA 2HTSA 2O03A 3VB2A 2E1CA 1VQ6I 3T0YA 4QLCU 1S3JA 4Y15A 4DQ2A 1EH6A 3QOPA 4G6QA 3RYRA 3C3WA 3LSHA 4HW0A 1LFUP 1IDYA 4BL0B 1DGWY 2R7SA 1YJNI 1IDZA 5FFZA 1FYMA 4PJJA 1A31A 3J81K 2R7TA 3K1MA 3L2RA 3HPGA 5EJCA 1I3AA 1YYVA 3MKZA 1A04A 1ZR4A 5JLWA 1YQAA 3FBIB 4P5OA 1D3YA 2FE3A 4XKWA 4JP0A 1XSDA 1LFBA 1EV7A 5FROA 4LD5A 2YU9J 1PP7U 1MNMC 2K9SA 1TWHJ 2FOWA 1LPQA 2Y31A 2XIGA 3DTEA 1SVOA 2TCTA 1D1BA 2CQKA 1RC9A 1TTYA 2B7EA 3HGGA 1KU9A 4L5IA 4L9NA 1JKPC 4EV0A 2V1UA 1ETXA 2QQAA 2W1OA 3KYLA 3R60A 1WGXA 1YI2I 1U8RA 3M9AA 4BKXA 2RN7A 4NB5A 3L7WA 3DBRB 3LQRA 5DTDA 4CICA 3RIRA 3W2VA 2P8TA 2JN6A 1RR7A 1USTA 4XLPF 4MNUA 3ZOBA 4PGGA 4BY7J 5H2FC 1VI0A 3OYGA 2ZNZA 1MJAA 3E7LA 4U7BA 2IRFG 3WTXC 1AWCA 2GA2A 1S7EA 3WE3A 1HDDC 4IHYA 5D5UB 3QPTA 3BR6A 3HDDA 3D0SA 1L3LA 1HOMA 4MQVA 1ENHA 1NTCA 3CCRI 1AA7A 4I0AA 3S1RJ 3VSLA 1I1SA 4GFBA 1ZKGA 2WB1N 2K3FA 4HPQA 4XRSA 4JK1X 4BHCA 4HLXA 3PL8A 3S3OA 1W7PA 1Y0NA 3L09A 4E70A 3FXKA 2DMNA 4A3JJ 3GW2A 3CJTB 3LSRA 4CCNA 3RI4A 1I3QJ 1W5SA 3OMYA 5D5WB 1FBUA 4MTEA 3FISA 1R5ID 2K02A 4QPOA 1TC3C 4AYBA 9ANTA 4ZYDA 1W4MA 3GMEA 1Y39A 1MBHA 2A5YB 3K0LA 3DPLC 2JK3A 1ITYA 2XF7A 2LSOA 1RI7A 1OFCX 2EZIA 2CYYA 4CSWA 3ABLH 3VWBA 1VZ0A 1BOBA 5IYBJ 3KIOA 3ZXSA 4DBRA 4UHTA 1CF7A 1U2WA 4RLQA 1LUJB 1I6XA 3KP4A 1MBFA 3RYPA 1XGSA 4A3FJ 2OUMA 1C0WA 5CQEA 4LLLA 2HOSA 4JBAA 4RMNA 2M7BA 1GV2A 2W4SA 5FLXZ 1TZLA 4HQEA 3H5AA 4C2MJ 2DAOA 3IAM2 3I58A 4I6ZA 5H6RA 1ZG3A 2Y9ZA 5DCMB 5LGUA 2EA2A 2HYJA 3I56I 4BACA 1OISA 1P4WA 5K5OA 5A2QK 1A6QA 2L02A 2L3DA 1ZQ3P 2QVOA 4TV7A 1YS6A 2LDUA 4RDUA 4HV6A 2HGCA 2DA1A 2H1KA 2CMPA 4ZC3A 2PMZN 3KZYA 3OR2C 1SFXA 2IGKA 1R4NB 4C3JJ 3FXOA 2CFOA 3DWLE 2RVCA 2VUMJ 3HOXJ 3QYBA 1FWZA 4FQGA 1FC3A 2NOJB 4N0BA 3A01B 3A4CA 3TEDA 3IAS2 3S2HJ 2K5CA 3LSPA 3KFWX 3BR2A 2M0MA 2XPUA 1BL0A 1TNTA 3KYDB 4F92B 2FX0A 3BQZA 4AVPA 3BR5A 5LHIA 3P9IA 3IUOA 3ZMTA 2H6BA 2B63J 1E0EA 4XSZF 2ESNA 2DW4A 3ABUA 3VEPA 2VBZA 1HQCA 1R36A 4M9XA 3TOAA 3CTAA 1UHSA 4NC8A 1OLTA 2XAGA 2DI3A 1A36A 2P5KA 3LAPA 3M1EA 1UJ8A 3SXYA 4OINF 5FKOA 3OIQA 4EMSA 4CYCB 2CUZA 2IA2A 3JRBA 2HXOA 2R7UA 3DEUA 2ISYA 2ICWG 2NXNB 2VQGA 2M87A 3G73A 3BZCA 3E6DA 4DBQA 3SZPA 2P81A 1XCBA 3S3NA 2OTLI 3GTQJ 1YW9A 1WHUA 3HKZN 1M1EB 2WC2A 3S17J 2XGXA 2IVMA 3M1CA 2TDXA 2Z16A 4BUPA 2VE9A 2VJJA 4M3DA 3PO2J 4OIPF 1PVEA 4XLCA 4BJTA 3CUQB 1IN4A 3JAMK 2CU7A 3AG4H 3IKVA 5C3EJ 2ID3A 1YJ9I 2CG4A 3TW7A 4N9HA 3P9CA 1SEUA 4IHWA 3SEQA 1U0JA 5GTIC 3QYFA 1TT5B 3ABKH 1VTNC 4XSXF 4XRSG 2QKMB 2CSOA 3KEOA 5E18F 3CCJI 3WHCA 4EGZA 4RB1A 3CDHA 1REPC 1YJWI 3L00A 3HXLA 4EEFG 3IHUA 1O3SA 3KP2A 3VSKA 2F5CA 5F08A 1FSHA 4CCMA 1U5TB 3I3LA 1G6NA 1E3PA 3FWEA 4XONA 5GP9A 5E3MA 1B8IB 4M3FA 3TGNA 3BTIA 4X6AJ 4U0WA 4G8XA 1XC5A 2BW3A 2MC3A 3PO3J 1BI1A 1HXDA 2HI3A 2E1OA 2GIVA 2OAZA 3EDPA 5E79C 4Y7NJ 1E3OC 1R22A 3DF8A 2CV2A 1ZLJA 1Y0UA 3MD2A 4HNTA 1FEXA 4HV5A 4C9YA 1FSEA 1D0YA 3DTIA 1ZLKA 2JRTA 5DEQA 4UY8I 3E5XA 3HBLA 3HTSB 5ICEA 1R1TA 2IS4A 2EK5A 3FZVA 1K79A 4L0YB 3GFMA 5J1RA 4LLGF 1ZTRA 3PSFA 5B1AH 3OYBA 4RAZA 2O6GE 3OYKA 2KRCA 1KU3A 3AG1H 4KMUX 4ZYEA 1QHGA 2HOTA 1LVKA 2QZ8A 2XPWA 2E1MC 3DKWA 3CMMA 4YIIA 4KT6A 4L18B 3K2AA 3WGHA 4DIQA 4R1HA 3FXQA 2OV7A 1U6GA 2PJPA 3U21A 2PJRB 2MBFA 3ZP5A 2DFHA 1VQLI 3MZYA 1JHHA 1WI3A 4HOBA 3TQNA 5D8KB 2NNNA 2RV8A 1X1CA 4WWCA 2H8WA 3FXJA 2R0QC 1IRGA 4G6TB 3BJAA 1QBJA 2CGPA 3DV8A 3ABTA 2VODA 4OAZA 1KQ9A 3DP7A 5EF6A 3M4OJ 2EZLA 3LFUA 4ENMA 4YFNF 1Y8RB 2DTRA 4D7MA 4U0VA 4P9FA 1VQKI 3VYSB 4BU2A 1B72B 2L54A 1SFKA 1MJBA 4ON0A 1OYIA 5E8GA 3QPHA 3VFZA 1VQ9I 3F21A 3JW4A 3H3ZA 2PMUA 3O6BB 4A0ZA 1RUOA 1IRFA 1HSTA 3DU6A 4YRVA 1B6AA 1O7LA 3E6CC 2ELHA 1PDNC 3PUFA 4XN3A 4DYQA 2STWA 2V6CA 3A03A 1LQ1A 3WTVC 1Z3XA 1FOKA 3BR1A 3ZR8X 3AG3H 3K6GA 4JYKA 3K4NA 3DLAA 2QQ8A 2FUG2 2BV6A 1X1PA 3I54A 3IH3A 1MDMB 4PZJA 3L2UA 3JRCA 1S8NA 3M3YJ 2JA7J 1XSVA 1MJ9A 1FOWA 2DA6A 1QZYA 3WE2A 3W2WA 1K83J 2HVRA 1XX5A 3HEFA 4CDGA 1BR4A 4PCQA 1WCMJ 2GXGA 2DA7A 5FD5A 2BE5F 1MBKA 2FBHA 4XK4A 2ZKZA 3BJ6A 3HIFA 1WJAA 2AQEA 3IH4A 4LG0B 4HA8A 4AIHA 4CYDA 4DNCA 4CUGA 1K4TA 3HZJA 3S32A 1IRXA 3BR0A 3H5NA 1RESA 4M3GA 1ONVA 4DYCA 2VKVA 3T8RA 2VQCA 4WXCA 4C2UA 3ECHA 5IT3A 2DJIA 2EIKH 4HSRA 4XN0A 2L7MP 2OZUA 3K69A 1U78A 1IJWC 3EQLF 2XDVA 1QVTA 1YG2A 4ENNA 3VDXA 2IW5A 4M73A 3F22A 4ANJA 2M34A 2MC4A 3GO5A 4D9JA 3ZQ7A 3ZMVA 3RKYA 1B1BA 1X58A 3C2BA 4AIDA 3EUHA 2VOOA 2AHQA 4C30A 1ZGWA 2WY8Q 1F9NA 3R0JA 2WAQN 4XORA 3UR3C 1OQYA 5KNLA 4ZTJA 1BW5A 3TP0A 2NAZA 4ZDLA 2COBA 1ZGAA 3CC2I 1P9QC 3K70C 4KMFA 1W36C 5KCMA 3OSFA 3J80K 3U1KA 4B09A 4XRFA 1FIAA 5JR3A 1UELB 1FOXA 1NHAA 2MW8A 4E7IA 1DGRM 1F36A 4G7OF 3OL4A 2M2EA 2F48A 4MQ9F 2FA5A 2EQRA 4P1WA 5HS9A 2H1LA 1LB2A 3PFIA 5FKMA 2LVSA 4LIUA 2OTJI 4DW6A 3SDGA 2A5WA 1J09A 4GYIA 3CCLI 3JRAA 2VJIA 2HDDA 1ZHFA 2LMDA 2NOGA 3DXJF 4L9VA 3ZQQA 1FBQA 2FD5A 5DCFA 1WKMA 2X1CA 3CCSI 4UUSA 4A3MJ 1FP2A 3AL0C 1G59A 3CP8A 1MIJA 3V7CA 1FMWA 4R8HA 2R3SA 1R7JA 4J19A 2IXSA 3OV8A 4IRIA 1QRYA 1TWCJ 1XB4A 2EPFA 2HYFA 2XUBA 1ETVA 3LNQA 4IVNA 1E2XA 5M5YJ 5ILVA 3H0GJ 3F6VA 1QU3A 1S9HA 2A6EF 1WZ2A 2PFBA 3BTCA 4BJ5C 2E35A 1XGOA 2DA4A 2VKHA 4B44A 5H20A 3SDBA 4KFCA 4HLYA 5L3EA 3EETA 5E1ZB 2V1NA 1F1ZA 3FF5A 2HKXA 3CO6C 4XQFA 3GEZA 2MSYA 2PEXA 3HM5A 1IN8A 2V4JC 2X0LA 3FMSA 3OR1C 4F91B 1JHFA 5DYMA 5DM7F 4M3BA 4LG3A 1KGSA 3IC7A 1EH8A 2YS9A 4FX0A 3OYCA 4BAYA 3V7RA 3WU1B 4CO8A 2DOAA 2JA5J 5DUIA 5IYCJ 3KP6A 1IO2A 4BXFA 3OS0A 4RBOA 4C3HJ 1BA5A 3E6BA 2QQBA 2NVYJ 4CZCA 1HCRA 5TGTA 3FMRA 3A0BC 1CGPA 2MA3A 3D5LA 2VPRA 3K9TA 1IC8A 2M9HA 2Z5UA 3GZNB 4PFOA 1E3HA 3V8JA 5EG0B 1O4XA 2KLOA 3CO7C 2TRTA 2R5YA 4XNFA 5E3LA 1U8BA 5HLGA 3GZ5A 4CHUA 3OYMA 4L9TA 3ZQGA 2HEOA 2RQQA 5EGOB 1OYWA 3HSRA 1T98A 1YO5C 1DDNA 2IT0A 2DU9A 3V7SA 2P0WA 3MKYB 3V8KA 2ZJRF 5C4JJ 4S0HB 4PUSA 3BC8A 5AIQA 1SAUA 4YFXF 5E3NA 3W6JB 1QNTA 2ZXJA 3BG3A 3FXRA 2IS1A 2EIMH 5EZGA 1ETKA 2FF4A 3KEQA 1F4KA 2CQXA 2RGVA 3WHBA 5DM6F 2D2WA 3AFHA 1ZYRF 2E1MB 1QA6A 2QGUA 4M9ZA 2XROA 1YFHA 4M72A 2VJ5A 5ICCA 1SFEA 3D5RC 1D5YA 4B3AA 2ECBA 4CCJA 3DEEA 3FK7A 4XBFA 4S05A 1X19A 4BNCA 3FM3A 1SVMA 5DD8A 1BOAA 2D1VA 3CCYA 3M8FA 3IL2A 1R49A 2DQLA 4HX8A 2NS7A 1JGSA 1NG6A 5F04A 5F6FA 4Y33A 1GT0C 1MNDA 2NRAC 1FZPB 2BZTA 2MG4A 4M74A 3E0JB 5IT9Z 1G2HA 3K4JA 3ZQIA 1ULYA 1KYWA 2CV1A 1K78B 5L3CA 2LP0A 4AD9A 5J8FA 3WU2C 1XMKA 5HDNA 5D6FA 4BQAA 2DDBA 1SFOJ 1TW3A 3K1PA 4V2FA 2YPRA 4AUXA 4ZZLA 3NWTA 1OR7A 5LGNA 4IEJA 4G6DA 2STTA 4CCOA 5B5EC 4BDYA 2R7QA 1GXPA 3J7AO 2O5RA 4EJUA 2VASA 5D4SA 1LE8A 2K9QA 3DBHB 2W00A 1SVLA 2QENA 2AO9A 1YX3A 2DODA 3QOEA 4IRGA 4ZDOA 4YIRX 3ZGKA 2NNYA 2R4GA 5CPRB 2XAJA 4EM2A 2EIJH 3NRVA 2LY1A 1S5LC 2CJJA 2HWVA 3P5JA 1A35A 2GXBA 2WWYA 2VKDA 3QPLA 4KIGA 5DD4A 2O8KA 3IP4B 5E20A 2HQRA 3KYCB 3E5UA 3HRMA 2L9SA 4GO1A 1G4DA 2FJ1A 3B02A 2L9RA 4I99C 4KDPA 1FT9A 1SD5A 3LSGA 5FKLA 2XB5A 1MW7A 1BC7C 4HNVA 2AXTC 2ELKA 3ZN1A 4FETA 3WTUC 2RKHA 4IQJA 2FEZA 4IOAF 5CQGA 3ISPA 1KA8A 2FSWA 5GAGJ 2DT6A 4FTHA 2O61A 3HG9A 1TNSA 1WI9A 3FXUA 2K9MA 3ASNH 3TDUC 4A69C 2PQ8A 4IZZA 1BC8C 2RC4A 1XCVA 2HQNA 2ZJ2A 5LRSA 1ZN2A 3JR9A 6PAXA 4B8XA 2W85A 1WFXA 1P92A 2GZWA 2CW7A 3LSIA 2MD0A 2LLKA 2EWNA 2KIFA 2JZYA 2ZFUA 4ZDPA 1EF4A 2VI6A 4KT5C 5HS8A 1GHCA 2ZSIB 2GA1A 2V1DA 4KUMA 1T95A 5DCMA 4BE1A 2XV4S 2BGCA 1XDSA 2GXAA 5FJ8J 1HKTA 3M07A 2EBIA 2XAQA 5IOYA 1PUFA 1VQ8I 1Z0XA 3GTGJ 3I59A 1VF9A 4K2EA 2IS2A 1LEBA 1YE9A 3CMYA 5J4VA 3TDZC 2K7LA 1YRNB 3AG2H 1HF0A 3KZZA 5M3MJ 3CC4I 3W2AA 4AWXB 1MBEA 2XC7A 4QWQA 2PBIA 1FX7A 3QPSA 1ON2A 1Z67A 2VXZA 3S1MJ 2F2EA 4PGHA 3CCUI 2LFBA 5BS6A 2PN6A 3WTSC 4OIOF 2DFIA 2XKOA 4FCYA 2D1HA 3WG7H 3MFKA 5FKNA 3JRHA 4DJAA 4N4NB 1TWAJ 4XLHA 3I4NJ 5B3SH 1RZ4A 3S2DJ 1SD7A 1UB9A 1TWGJ 2JTVA 4YELA 2RNGA 1O57A 3K2ZA 3GUDA 2XKPA 3CD6I 3GLXA 3MMYB 3FM5A 3TO7A 5FLXK 3AL0B 1FY7A 2LKSA 3NEUA 3U9GA 5L3BA 1LDDA 3HSEA 3HOVJ 4X0GA 2F4IA 2A61A 2KMUA 4KN7X 2BXZA 4HDVA 1ZRDA 3BPXA 3TL4X 2XF5A 3N05A 2GQQA 2EZHA 2LTPA 3DKXA 2MH2A 4M6VA 5KAIC 2HYGD 1YIJI 4LJZF 1VQNI 4F7ZA 3LWFA 3S93A 4A5MA 4RGSA 5FD6A 2GOXB 3L1PA 1RIOH 2EV5A 4RAYA 2ME6A 3QODA 4IX7A 5LD2C 4D1QA 2A05A 2ZXWH 4E7SA 4G7HF 4HRIA 3QP5A 4I0BA 2KJCA 2IEKA 4ZYHA 3PJRA 4OAYA 5L3FA 3FKJA 1DPUA 3DPTA 4HF0A 3ZQCA 2KJBA 1I5ZA 4Y17A 1FYLA 1IG7A 2LR8A 1JTYA 3PIOF 1FTZA 2UWMA 4RAFA 3K7AJ 1X3WB 1S29A 3SFZA 2X9DA 3A0HC 3C1DA 4NNJA 2Q2EA 1B8IA 5E17F 2VKEA 2IPQX 3OS1A 2KISA 2JPCA 2RDPA 3U1DA 2KRFA 3H36A 1TBXA 3IRQA 2VXDA 2WV1A 1IZ1A 2W84A 5D6EA 3H1CA 2CWEA 2RQPA 2R5ZA 1W5TA 1W7PB 3CF2A 5BNGA 1JT0A 1WSUA 3BCAA 1P6RA 3HHGA 3M7GA 2LD5A 3K4BA 4Q47A 5FFXA 5M5WJ 1AOYA 4E6KG 3ZMSA 1YITI 1EJ9A 3IV5A 2M7AA 4LGWA 3KLNA 1BIBA 5C4XJ 3S2WA 5GPAA 3FHZA 2P7CB 4L0ZB 2CUJA 1FJLA 4HG2A 4UV8A 3K4LA 2DA5A 1FYKA 5HVQC 4RM2A 4II2A 1OCZH 4V19K 4L5JA 2HPIA 2QSFX 5HLHA 2QM3A 1S7AA 5JVGF 1R1VA 3OYHA 1T0FA 2W57A 3LOCA 2NYXA 3ERMA 3LSJA 2ISZA 2DN0A 2G7UA 2FMYA 2P5LC 4WF2A 1SC7A 1V4RA 1MD0A 2CQ7A 2Y0SA 1HKSA 4ASNA 2L7KA 4A3CJ 1H89C 5F27A 4A2UA 4NBQA 1LJ9A 2JVGA 3BTJA 4XLEA 1WJBA 5CVVA 3AKZA 3HOSA 3QU3A 5JI6A 3QAHA 2LBFA 2E2IJ 2B0LA 2R7ZJ 1K4SA 3RZDJ 4IHXA 2ZMEA 5M5XJ 1TP4A 4DZPA 4IJAA 5IP7J 1T8IA 5J6XA 1F43A 3SQNA 1KONA 2O8XA 2XASA 3L9FA 5GTHC 5LFAA 1IUYA 1GVJA 1WVRA 4IHTA 1ZK8A 4IHVA 1Z6TA 2V6EA 1OCOH 3GFJA 2VBXA 4ETSA 4WK8F 4PSXA 3ERED 3ZMZA 4FISA 1FPQA 3EUHC 4CCKA 4EJWA 3A1YA 3UKGA 2A6HF 2MLKA 2CV0A 5IOZA 3S15J 3O2PE 3ELKA 3WG9A 3G71I 2DLLA 2LYCA 3OOPA 4RS8A 2R7DA 3ZQLA 2QA4I 2J5PA 1S7OA 3DEWA 4E7HA 3RSNA 1N75A 2V9PA 5KK1A 3WTYC 3HTUA 2EB7A 2I5UA 3KE2A 4XMYA 2DK8A 4JX5A 2K9LA 1I1GA 2K40A 1ZRCA 1BBYA 1AHDP 3OY9A 1KU7A 3PQJA 3RPUA 2VLAA 1MZBA 1VQMI 2H8RA 4OIRF 2DXIA 2DTZA 3ZMDA 3H9GA 4LITA 5F0HA 2EFPA 1KQ8A 2JA6J 2D45A 2N8GA 5EEAA 4BS9A 1P4XA 3M8EA 4IO9F 1Z7LA 1N78A 3H92A 1ODDA 4BHPA 1WPKA 2DYRH 4MO7A 3BCBA 3TW6A 3H3UA 3K70D 1J59A 1NH3A 1W36D 4LG0A 3KEYA 1LNWA 2R7OA 2BY2A 3H35A 2MABA 3ZPLA 3C7JA 4XLFA 4ABZA 2KPMA 3IH2A 2IJLA 4DZJA 2DPUA 4LB6B 3G4SI 3F8NA 2H6CA 3J7AY 1J2XA 5GPCA 1RUNA 1EA3A 3G1OA 4RAGA 3GTMJ 2Q8KA 3PNYA 5J1YA 1YW7A 2CO5A 2HVSA 3BPVA 4XOPA 4F52A 3GVAA 2ZXIA 4Y4RA 4JQFA 2FMLA 3LA2A 3G6EI 4WXHA 2K4JA 3CESA 1R1UA 4KYWA 3LA3A 3OL3A 3CF5F 5IYDJ 3H9QA 3GZ6A 2Z33A 1I39A 1D8KA 4E7JA 3WU0A 4PSWA 3HOYJ 1Z6RA 2OC6A 4FE7A 2X6YA 1KZHA 1VQ5I 4QTRA 3DLLF 2QEXI 2JMWA 3Q0UA 2PI0A 2F5EA 3MN2A 4AYBN 3HL2A 3J7YJ 1ERDA 2ZJQF 2KL4A 2JSPA 4H0EA 1TLHB 2EFOA 2OQGA 1IRZA 1Z3YA 5BOXA 1BR1A 3MKLA 2DQRA 2DOEA 3HSFA 2BW3B 4Y13A 1VFCA 4XL9A 4U0YA 2V9KA 1CQTA 1TW2A 3LMMA 1BI2A 2L5QA 2KIMA 2M45A 4HF2A 2FU4A 2EFNA 2FOKA 4BHBA 2QLZA 5JVTA 1MMGA 1XPXA 3C2HA 1BR2A 2IA0A 2E2JJ 3KPHA 2FXAA 3CDIA 3LSKA 4ESFA 2CUEA 3JRIA 4NQWA 2KT0A 1J9IA 4XOTA 4BDZA 1Q1VA 3KZIC 4FX4A 3EPZA 2BXYA 2ZBKA 4MEXF 5AONA 1HSJA 1B4AA 3RQ4A 3FX3A 2EINH 4J00A 1DU0A 4QSHA 2BVMA 4FT8A 4PFPA 1VQ4I 1JGGA 1IN6A 4YEJA 1B59A 4IKFA 2L2OA 2HQAA 4KN4X 1W7PD 2L01A 3I9V2 3GFIA 3JTGA 1UFMA 4B1RA 3ML6A 5E8IA 1O7FA 2LH9A 3E1SA 3A2KA 1DPRA 2KKOA 3Q0VA 2KP6A 1VQPI 1HLVA 1TL8A 3ZQFA 1T38A 3F8CA 1WRJA 1I27A 2Q1ZB 3NAUA 2DJNA 1EH7A 2P5VA 2HS5A 3FIWA 4LB5A 4MHGA 2P7VB 1SMTA 1UCRA 1V55H 4ITVA 5LHGA 3G1MA 2XVCA 3HOUJ 1GVDA 3CZ6A 4HDUA 4KA4A 4B47A 4O6JA 1K7AA 1YLFA 3I4MJ 1T39A 1I50J 2MGQA 1JUPA 1MGTA 4D0PA 1ZRFA 3CJRB 3FKIJ 2NVTJ 1UG2A 3KX2A 4YFKF 1OR7C 1BIAA 1ETYA 2XGEA 3TOBA 3B6CA 1IW7F 4FASD 3Q9SA 2UXXA 2GAUA 4KIFA 2ZXHA 3GX4X 4G7ZF 3K4CA 3Q0WA 4WCGA 4RB3C 1R00A 2L9NA 1W0TA 1NK2P 2WB1A 3PSIA 2ZNYA 3S8PA 1H9GA 5BQTA 3Q3SA 1G3YA 4BBSJ 4D5FA 3E5QA 2PX9A 1X3UA 5BMZA 2JVHA 4B43A 2HTJA 1YS7A 3SJMA 4M6XA 1S6LA 4E7ZA 4PJLA 1X1AA 3V4GA 1UAAA 2BOLA 3L2CA 4B4CA 2M8EA 5K7ZA 2R7XA 1V5EA 2XAHA 3OYDA 4PJMA 1Y6IA 2IA1A 4LFUA 5JLXA 2M4GA 3PUBA 1R23A 3BG7A 2E5NA 1GDTA 2QCOA 2HDWA 3TMOA 2XRLA 3LQQA 4W1UA 2EV6A 4BE2A 1H9TA 5J3LA 4RB0A 1OPCA 1T33A 2HOEA 2IGNA 1Y56A 2VOPA 3CQZJ 1QPIA 3KP5A 1ETOA 2VN2A 3GYHX 3GTKJ 3OYLA 2YX4A 2MLGA 5GAEJ 4XRMA 1OKRA 2H09A 4BEHA 3MAJA 5JHUA 1DU6A 1LFPA 2VC1A 3PFYA 4Y3OA 3T1BA 2A6TA 4G9YA 2FBIA 3CCQI 4OMYA 3CUOA 2WTEA 4A0YA 4B48A 1AKHA 2PG4A 4PDKA 5B1BH 5EZHA 3CCMI 2LRDA 4HX4A 1HW5A 2K4BA 1Z9CA 1IAWA 2JA2A 1OJLA 2GWRA 4UB6C 4Z2YA 5E3OA 1J75A 3LA7A 2QWWA 2FNPA 2ADUA 2UXNA 5CVJA 1X1DA 3TO9A 1E17A 1V3FA 1BJAA 2DA3A 2PMZA 3VYRB 3W6KB 5HNFA 1IV8A 4M9SA 5GAHJ 3JRDA 3H3VK 1MKMA 4C3IJ 3ABMH 2HDCA 2EZKA 2G7HA 4MGRA 3R0AA 3NWSA 1N77A 1ZAOA 2R7VA 4IXAA 1FTTA 3BR3A 2O3FA 1P4AA 2QYOA 2ETHA 2ZB9A 2CRGA 3HHHA 2DDAA 1BI3A 4GRIA 4I09A 4ESJA 4RB2C 4IHSA 3HB9A 4GXOA 2BHZA 2HVQA 3MVPA 1HKQA 3PNTA 4I01A 5CVRA 4UUSB 3BZKA 4N4OB 2EJRA 4A6DA 3B6AA 5IT9K 3OYNA 1YHQI 2CFXA 4Z6YA 2VPLA 5M3FJ 4EQQA 1Z7UA 5LEKA 5F1JA 3FMQA 3HUGB 3M8JA 2JQ7A 1O3RA 5ILUA 3LSMA 2E7XA 3LSTA 1G3WA 3OYEA 1D1AA 1USSA 4IQ4A 1FBSA 3HKZA 1BW6A 1GV5A 3V8LA 2WV0A 2XSDC 2DMUA 1Z91A 3X2QH 2G9WA 4NC6A 2CH0A 5E1WA 4DGWB 5K5RA 4LK1F 3L2QA 1B9MA 2CW0F 1XGMA 3H5RA 5KVRA 2ME0A 3H0DA 5ICFA 3CC7I 3OS2A 4C2TA 2VQLA 4BQNA 2B9SA 3HRTA 5H6QA 5HLIA 1HBXG 3FHNA 1UZCA 1ZARA 4I02A 4MIMA 1RETA 4I98B 2ZC2A 3ESWB 2W25A 1BI0A 4F55A 4BY1J 5J1UA 1STZA 1U9OA 3I4PA 1Z77A 3CJQB 2WY7Q 4JX6A 1ZG5A 4BXXJ 2Y2ZA 1QVUA 2OD5A 4X1EA 3RJPA 2E7WA 3OSGA 2CUFA 2R5YB 1GUUA 5ED4A 2HQ5A 2F5FA 1OMIA 2OQRA 4MTDA 2RAEA 2VONA 2Q0OA 4NDLA 2VJ4A 1Y1WJ 3E97A 5HLTA 2XAFA 4S04A 3BLYA 4KICA 1QZEA 3S16J 2JA8J 4BYYA 3F72A 3EUAA 2LF8A 1R71A 5D8LB 3WTZA 5FO5A 1DQUA 2I10A 2G0EA 2GLOA 1P2FA 1SAXA 2A3SA 3ZRGA 4QIWN 2NS0A 3OYFA 2PLYA 1T0FC 2JRMA 4WXDA 3J81Z 3QU6A 1T6SA 5BPIA 4EGYA 2ZJPF 4I76A 1D1CA 4UVBA 5FKKA 3R6SA 2Y30A 4LMYA 4UUVA 2DT7B 1B9NA 5TRDA 1W0UA 5HNHA 2DO7A 3DKYA 3DFGA 3R61A 1MMAA 3T8TA 3C2GA 4ENKA 2ZMEC 2QBYB 1T56A 2YU3A 4UB8C 2XRNA 2DA2A 2Y75A 2Y0MA 2Z3YA 2O0YA 4JX4A 2IGOA 3FXMA 3BQYA 1Y1VJ 3KCCA 3I5UA 2DPDA 5LLQA 3A01A 2OCEA 4Q48A 1MH3A 1WH7A 1YIOA 3EYYA 3LFKA 4PK4A 5ILSA 4GYGA 5LRRA 3HRUA 1K6YA 1ZGJA 2HR3A 3N97A 3BG6A 2HZDA 1LE8B 2E71A 2XHKA 4IF4A 2LY2A 2V79A 1DP3A 4OIQF 5JFRA 1IXRC 2QF7A 2VQHA 4XKVA 2DK5A 3VYUB 4HAMA 2MD5A 2P6TA 3BTLA 4HX7A 1JKQC 1XDUA 1HW2A 4YG2F 3BT9A 3B73A 2Y69H 4CYCA 3SZGA 4Y52J 2BY1A 5F1RA 3GXOA 1FMVA 3BG5A 1ORKA 3PQKA 4D7NA 1JT6A 1WH5A 1XS9A 1V54H 2E5ZA 3BP8A 1ETWA 4DOZA 2NVUB 2Z9OA 1UG0A 3SFIA 1IN5A 2HZTA 2K86A 2NVQJ 1DP7P 2HFHA 3ZQHA 2K85A 1SMYF 2W7NA 4OWRB 4OMZA 2L9VA 4N9IA 1JI8A 3DBLB 2OZ6A 4UVAA 3HPHA 3CUQA 2EV0A 2FNAA 1JKOC 1MMNA 3O3KA 4U88A 4BBRJ 2MH9A 1KQ0A 5ERIA 3A02A 1SFUA 5FLVA 4WX9A 3F8FA 4A3DJ 4XM3A 2FRHA 3ONQA 2E60A 2EILH 2JPBA 3BDDA 1JUMA 1RNLA 4RGUA 4BXUA 4I7HA 2DMTA 5J47A 4RM3A 2KFDA 5GADJ 2KRHA 4A3KJ 4HYEA 2X48A 4P96A 1U5TA 1XG1A 5AIPA 3OIPA 1JXSA 3D1NI 2O7OA 2LNBA 3HJEA 3QRFF 3GLLA 1PUFB 2RNJA 2NVXJ 3HRSA 2L0KA 5HDGA 4ZYGA 3CMAI 3I59B 4BE0A 2DYSH 4E7LA 3LAJA 3RZOJ 2BY0A 4UXNA 2IAIA 2GBYA 4P55A 4HF1A 3BG9A 5TJJA 2WAQA 3MZHA 1J7KA 2M1BA 5A2QZ 4A3LJ 3VODA 2R7RA 2FBKA 4ZH4F 2ZFWA 3Q9VA 3ZCOA 4U7DA 1TWFJ 2CS3A 1MH4A 2UUZA 4XKCA 4NUBA 1ACIA 1IXCA 3JSOA 2DCEA 3CJNA 2LK2A 2OJED 5EEHA 1FOYA 1ZREA 1G3SA 2HOAA 4A93J 5E1XA 5CKTA 2P4WA 5CVUA 5HOOA 1RR8C 4A6EA 4U87A 2M5WA 3HGYA 3VPRA 4GDFA 2ZCWA 3BWGA 1IUFA 3F6OA 1L0OC 1MBGA 3F8MA 5K1YA 1CF7B 1JE8A 4V2GA 1J5YA 2OBPA 3SHFA 4R79A 4NC7A 1LDJA 1VQ7I 1HC8A 3F0CA 3WTTC 3IRRA 4ZJZA 4E4HA 5K5QA 3FBNB 1N25A 2LG4A 3HOTA 1PJRA 4AVZA 1HA8A 3OYJA 2AQFA 2QUFA 2PJRA 2Z2SB 1IXSB 2XPVA 1LVAA 4UV9A 1GLNA 1T08B 2ECCA 5KHDA 2ELJA 2IBDA 2KIQA 1NG7A 2E19A 2VT3A 1UHMA 2DMPA 1JKRC 2JT1A 4UUTA 1TQIA 2BBYA 3MEXA 5K7FA 4CZZA 1B72A 2KDOA 3E6MA 2CW8A 3KP7A 3V42A 3ZMUA 3SZTA 4HEA2 1WWXA 4MFDA 2XSJC 2QSGX 2VL8A 1H0MA 5HDKA 4G94A 1TQPA 2F4MB 2HU9A 1R4MB 2F4OB 3S1QJ 5C44J 2R92J 3EYIA 1VQOI 2KQRA 1XSXA 3JAMZ 4L9JA 1XN7A 2EH3A 3GTPJ 4A3EJ 2X6OA 5DUKA 4D5CA 4KIBA 1FIPA 1D8JA 2Q2EB 5K7HA 2HKOA 1MDMA 2F6CA 4HQMA 3COAC 1QZZA 3S14J 1IN7A 4OU0A 1Y8QB 3DU5A 3G1LA 1MMDA 4GCVA 4P9UA 4BGDA 5D5VB 2R5ZB 3OOUA 3CMEI 2LC2A 3O8HA 4F93B 2X6WA 1OCCH 2LY9A 1EKEA 4MFEA 1WJEA 2X1EA 5B66C 1G8XA 2AS5F 1I6HJ 2COMA 2ESHA 3JREA 1FP1D 2LF7A 3DPUA 4H4KC 3BROA 1F5TA 2WAFA 4DYRA 1POGA 1S72I 3K1NA 5LHHA 3AAFA 1R5GA 2VBYA 4NHJA 3CLOA 4A3BJ 4ESBA 4EATA 3PIPF 2EA4A 3W6VA 4XLAA 1JJ6C 2M4KA 4EVIA 1Z21A 1D0ZA 3TP3A 2DT5A 1U9NA 3ECOA 3R4KA 2QSHX 3Q5FA 2XGDA 3ASOH 4CXFA 4ZTFA 5JHFA 4IOCF 2EFQA 3VOEA 3I55I 1X4OA 1MSEC 3I64A 2ZO4A 3RDIA 3FXLA 2LBFB 3QYEA 2ZMEB 5EYRA 1BJZA 1WJDA 4IPAA 4E7KA 2Y9YA 4FE4A 1TT0A 2W82A 3TO6A 2GOMA 2XAUA 3SYTA 2VE8A 2UZKA 1OYYA 2BYVE 2GIZA 2LKXA 3GTOJ 1ETQA 3I53A 4XLNF 2ID6A 3QWLA 3WODF 4J01A 4A3GJ 1QGPA 1V5GA 4LK0F 4XIDA 3G2BA 3BZ6A 2WA0A 2XGCA 1ZR2A 4BQQA 4RGXA 2IS6A 1ZH5A 1H88C 2L7ZA 4CH7A 4JOMA 3U2RA 1WJ5A 2AXLA 3JRFA 1X3ZB 4A5NA 3WTWC 2K3PA 3G3ZA 2LREA 4EJOA 1YW8A 1PP8F 4M6YA 5DV5A 1DUXC 4UVCA 2A68F 2A07F 1WJFA 1MBJA 1V5FA 1X1BA 5J40A 2R7FA 1HW1A 1D0XA 3S1NJ 1Z05A 4RGRA 5DS9A 3LL7A 1Z1DA 2R7WA 3D5SC 1O3TA 3CDLA 4KITB 2V1XA 1XD7A 1XMAA 2YR2A 1U3EM 2MYSA 3GTLJ 1YOVB 4QPQA 1SD4A 2M3AA 3KETA 2JUGA 1R6RA 1YTYA 5TISC 5F64A 3RTRA 3L2WA 4FHTA 2BVLA 4ZYAA 4HZFA 1K61A 1QQIA 4RA2A 1PUEE 2LOOA 2ACJA 3DTKA 2E36A 2DMQA 2V26A 3C18A 1RRJA 2CQNA 2WAEA 1O3QA 2V7FA 3GF2A 2DOFA 4M71A 2OU2A 1JJ8C 1X2MA 4BQOA 4EJVA 3DCFA 3MKWB 1RKTA 2OCCH 1IV6A 1P7IA 2IP2A 3OWTA 2X4HA 2C6YA 4MEYF 1JTXA 3KP3A 3TBIA 1VNDA 3MWMA 5IP9J 3CP2A 2PMHA 1LDKB 2K9NA 3QQAA 3MZ8A 3RKXA 5LEJA 3F23A 3H9JA 4XR6A 1R58A 2E34A 2JSCA 4IL6C 4EM0B 3JRGA 3IWZA 1WJCA 3BY6A 3OYAA 1RKWA 1OCPA 3E3VA 4M3EA 1KU2A 3PNVA 2XB0X 4HSTA 2VB6A 2W48A 5FGMA 1BM9A 5BPDA 5EG0A 2A69F 3OYIA 5FRMA 2HNHA 5CVIA 1MMSA 2KZGA 5L3GA 5J4YA 5EGOA 4BJ6C 2I8DA 3BJOA 4ZZDA 4G12A 2Z1DA 3EUKL 3GFLA 2F5VA 4AIJA 1NK3P 1TQMA 5CJ9A 1QPMA 1FLIA 1YX5A 2JUCA 3TKYA 5IPAA 5FB2A 5KAFC 3P7NA 4O3MA 2K27A 1HDPA 2Z99A 3F8BA 2HXIA 2Y0SN 4XKBA 2L4MA 3RQIA 3N4MA 2VC0A 3UNGC 2L7FP 5IP6A 3J80Z 1G3TA 4XICA 2X6XA 1OCRH 2WADA 3CLQA 4O5VA 3ZN0A 4A0XA 1A5JA 5LGTA 2FQ4A 4PJNA 4AU7A 1X2NA 1KYZA 4LLNA 2BY3A 3L2VA 2V9VA 4A12A 1QO0D 1Q1HA 3F3XA 2BHYA 3I71A 4F3QA 4PJ0C 5D4RA 2EFWA 4IRHA 4NQWB 3T5XA 3HYIA 1LEAA 3HUGA 2GM4A 1IGNA 3NQOA 2O9LA 3HOZJ 4AIKA 1W1WE 2FQ3A 1APLC 5F0FA 1ON1A 2OA4A 2NS8A 1T2KA 2YSRA 3GTJJ 2RREA 3JTHA 2M30A 4LIVA 2IGMA 1K78A 1OCTC 1R5HA 1SANA 3IWFA 3KLOA 1MNEA 4OOIA 3VYTB 4KISA 2VT2A 1IF1A 5EDNA 1K6OA 2H94A 1UMQA 4HBLA 1QHHD 2X85A 3HOWJ 2UV1A 1MSFC 1X4PA 4I2OA 5L3DA 4BH9A 5FRNA 3K4MA 5HODA 3REOA 3WGIA 2MFZA 1J0RA 5DDGA 2KZVA 4B3XA 2QQ9A 3F9KA 3S3MA 4II3A 2JJ7A 1GXQA 2XF6A 5EEGA 2J5OA 4Q4ZF 4AM3A 3W3CA 4EM1A 4Q5SF 3JSPA 2JWTA 3HC7A 1AU7A 2D5VA
chains in the Genus database with same CATH topology
3QP6A 5CYVA 1UHWA 3I0TA 3BOQA 3MCZA 2VBWA 5LBQA 2L4AA 3WGGA 4UNOA 2LKPA 3DQVC 2E1NA 2H27A 5ICGA 2P6SA 1SD6A 4GGGA 5D5XB 2DBBA 3GWZA 2W24A 1FNNA 1ZG1A 3RPQA 1BN5A 4YIFA 3CUQC 4CGZA 1XGNA 5HS7A 3MQ0A 2F5DA 3ROUA 2BEOA 2QBYA 3P9KA 3IKTA 3ULQB 2Y48A 1D5VA 2KIUA 2YX7A 1U5TC 1WQ2A 5CLSA 3RKWA 4EJTA 4ENJA 4KNYA 5J8CA 2HTSA 2O03A 3VB2A 2E1CA 3T0YA 4QLCU 1S3JA 4Y15A 4DQ2A 1EH6A 3QOPA 4G6QA 3RYRA 3C3WA 4HW0A 5FFZA 1FYMA 3J81K 3K1MA 1YYVA 1A04A 1YQAA 4P5OA 1D3YA 2FE3A 1XSDA 1EV7A 4LD5A 1PP7U 2XIGA 2CQKA 1TTYA 4L9NA 4L5IA 1KU9A 4EV0A 2V1UA 2QQAA 3R60A 1U8RA 3M9AA 2RN7A 4NB5A 3L7WA 3LQRA 4CICA 3RIRA 2P8TA 1USTA 4XLPF 4MNUA 4PGGA 2ZNZA 1MJAA 4U7BA 2IRFG 3WTXC 1AWCA 2GA2A 3WE3A 5D5UB 3QPTA 3D0SA 1L3LA 4MQVA 4I0AA 1I1SA 4JK1X 4BHCA 4HLXA 1W7PA 3L09A 4E70A 3GW2A 3RI4A 1W5SA 5D5WB 1FBUA 4MTEA 2K02A 4ZYDA 1W4MA 2A5YB 3K0LA 3DPLC 2LSOA 1RI7A 2CYYA 1CF7A 4UHTA 1U2WA 1I6XA 3KP4A 3RYPA 1XGSA 1C0WA 4LLLA 4JBAA 5FLXZ 4HQEA 2DAOA 3I58A 5H6RA 1ZG3A 5DCMB 5LGUA 2EA2A 1P4WA 5K5OA 5A2QK 2L02A 2L3DA 2QVOA 4TV7A 1YS6A 2LDUA 4HV6A 2HGCA 3KZYA 1SFXA 2RVCA 1FWZA 1FC3A 4N0BA 3KFWX 1TNTA 4AVPA 5LHIA 3P9IA 3ZMTA 2H6BA 4XSZF 2ESNA 2DW4A 3ABUA 3VEPA 2VBZA 4M9XA 1HQCA 1R36A 3TOAA 3CTAA 2XAGA 2DI3A 2P5KA 3LAPA 3M1EA 3SXYA 4OINF 4EMSA 2IA2A 2ISYA 3DEUA 2M87A 3G73A 3E6DA 3SZPA 1XCBA 1YW9A 2WC2A 2XGXA 2IVMA 2TDXA 2VE9A 4OIPF 3CUQB 1IN4A 3JAMK 3IKVA 2CG4A 4N9HA 3P9CA 1VTNC 4XSXF 2CSOA 3KEOA 5E18F 4EGZA 4RB1A 3CDHA 1REPC 3L00A 1O3SA 3IHUA 3KP2A 2F5CA 1FSHA 1U5TB 1G6NA 3FWEA 3TGNA 4U0WA 4G8XA 2MC3A 1BI1A 1HXDA 2OAZA 3EDPA 2GIVA 1R22A 3DF8A 1ZLJA 1Y0UA 4HV5A 1FSEA 1ZLKA 2JRTA 5DEQA 3E5XA 3HTSB 5ICEA 1R1TA 2EK5A 3FZVA 1K79A 4L0YB 3GFMA 4LLGF 4RAZA 2O6GE 1KU3A 4ZYEA 4KMUX 2QZ8A 3DKWA 4YIIA 4L18B 3WGHA 4R1HA 3FXQA 1U6GA 2PJPA 2MBFA 3ZP5A 3MZYA 1JHHA 4HOBA 3TQNA 5D8KB 2NNNA 2RV8A 4WWCA 1IRGA 3BJAA 1QBJA 2CGPA 3DV8A 3ABTA 2VODA 1KQ9A 3DP7A 4ENMA 4YFNF 2DTRA 4U0VA 4P9FA 2L54A 1MJBA 4ON0A 1OYIA 5E8GA 3QPHA 3VFZA 3F21A 3JW4A 3H3ZA 2PMUA 3O6BB 4A0ZA 1RUOA 1IRFA 1HSTA 1B6AA 1O7LA 3E6CC 2ELHA 1PDNC 2STWA 2V6CA 1LQ1A 3WTVC 1FOKA 2BV6A 3I54A 1MDMB 4PZJA 1S8NA 1XSVA 1MJ9A 1QZYA 3WE2A 4CDGA 4PCQA 2GXGA 5FD5A 2BE5F 2FBHA 2ZKZA 3BJ6A 3HIFA 4LG0B 4HA8A 4AIHA 4CYDA 4DNCA 1ONVA 3T8RA 4WXCA 3ECHA 5IT3A 2OZUA 1U78A 3K69A 3EQLF 1YG2A 4ENNA 2IW5A 4M73A 3F22A 3GO5A 3ZQ7A 3ZMVA 3RKYA 1B1BA 2VOOA 3EUHA 1F9NA 3R0JA 2NAZA 1ZGAA 4KMFA 3J80K 4B09A 4XRFA 5JR3A 1NHAA 4G7OF 4MQ9F 2FA5A 5HS9A 1LB2A 3PFIA 4GYIA 1ZHFA 3DXJF 4L9VA 1SFUA 1FBQA 5DCFA 1WKMA 1FP2A 3V7CA 4R8HA 2R3SA 1R7JA 3OV8A 4IRIA 1XB4A 2HYFA 2XUBA 4IVNA 1E2XA 5ILVA 3F6VA 2A6EF 2PFBA 1XGOA 5H20A 4KFCA 4HLYA 5L3EA 3EETA 5E1ZB 1F1ZA 3FF5A 2HKXA 3CO6C 3GEZA 2PEXA 1IN8A 2X0LA 3FMSA 1JHFA 5DYMA 1KGSA 3IC7A 1EH8A 4FX0A 4BAYA 3V7RA 3WU1B 4CO8A 5DUIA 3KP6A 3E6BA 2QQBA 3FMRA 1CGPA 2MA3A 3D5LA 3K9TA 2Z5UA 3V8JA 3CO7C 5HLGA 3GZ5A 4CHUA 2HEOA 4L9TA 1OYWA 3HSRA 1T98A 1YO5C 1DDNA 2IT0A 2DU9A 3V7SA 3V8KA 5AIQA 4YFXF 3W6JB 1QNTA 2ZXJA 3FXRA 2FF4A 3KEQA 1F4KA 2RGVA 2D2WA 1ZYRF 4M9ZA 2XROA 1YFHA 4M72A 5ICCA 1SFEA 4BNCA 1ZH5A 4XBFA 4S05A 3FM3A 5DD8A 1BOAA 2D1VA 3M8FA 3IL2A 2DQLA 4HX8A 1JGSA 5F6FA 2NRAC 1FZPB 4M74A 5IT9Z 1ULYA 1KYWA 1K78B 5L3CA 4AD9A 5J8FA 1XMKA 5HDNA 5D6FA 4BQAA 1TW3A 3K1PA 2YPRA 4ZZLA 1OR7A 5LGNA 2STTA 4G6DA 3J7AO 1GXPA 4EJUA 5D4SA 2QENA 4IRGA 2NNYA 2XAJA 4EM2A 3NRVA 2HWVA 2GXBA 2WWYA 4KIGA 5DD4A 5E20A 2HQRA 3E5UA 3HRMA 4GO1A 1G4DA 3B02A 4KDPA 1FT9A 1SD5A 1BC7C 3ZN1A 3WTUC 2RKHA 2FEZA 3ISPA 1KA8A 2FSWA 2O61A 1TNSA 1WI9A 3FXUA 3TDUC 1BC8C 2PQ8A 2RC4A 1XCVA 2HQNA 2ZJ2A 5LRSA 1ZN2A 6PAXA 4B8XA 2W85A 1P92A 2GZWA 2EWNA 2KIFA 2JZYA 1GHCA 4KT5C 5HS8A 2GA1A 2V1DA 4KUMA 5DCMA 2XV4S 2BGCA 1XDSA 1HKTA 2XAQA 3I59A 4K2EA 1LEBA 3TDZC 2K7LA 3KZZA 4AWXB 4QWQA 2PBIA 1FX7A 1ON2A 2VXZA 2F2EA 4PGHA 5BS6A 2PN6A 3WTSC 4OIOF 2DFIA 2XKOA 2D1HA 3MFKA 1RZ4A 1SD7A 1UB9A 2JTVA 1O57A 3K2ZA 3GUDA 2XKPA 3GLXA 5FLXK 3FM5A 3TO7A 1FY7A 3NEUA 3U9GA 5L3BA 1LDDA 3HSEA 2A61A 4KN7X 1ZRDA 4HDVA 3BPXA 2GQQA 2MH2A 2HYGD 4LJZF 4F7ZA 3LWFA 4A5MA 4RGSA 5FD6A 1RIOH 2EV5A 4RAYA 4G7HF 3QP5A 4I0BA 2KJCA 4ZYHA 5L3FA 1DPUA 3DPTA 4HF0A 2KJBA 1I5ZA 4Y17A 1FYLA 2UWMA 1S29A 3SFZA 3C1DA 2Q2EA 5E17F 2IPQX 2RDPA 2JPCA 3U1DA 2KRFA 1TBXA 3IRQA 1IZ1A 2W84A 5D6EA 2CWEA 2RQPA 1W5TA 1W7PB 1WSUA 1P6RA 3HHGA 3M7GA 5FFXA 4Q47A 1AOYA 3ZMSA 4LGWA 3KLNA 1BIBA 3S2WA 4L0ZB 3FHZA 2P7CB 4UV8A 1FYKA 5HVQC 4L5JA 5HLHA 2QM3A 1S7AA 1R1VA 1T0FA 2W57A 2NYXA 2ISZA 2G7UA 2FMYA 2P5LC 4WF2A 1V4RA 1MD0A 1HKSA 4ASNA 4A2UA 1LJ9A 5CVVA 3HOSA 3QU3A 5JI6A 3QAHA 2B0LA 2ZMEA 4IJAA 5J6XA 3SQNA 2O8XA 2XASA 3L9FA 1IUYA 1GVJA 4IHTA 1Z6TA 3GFJA 2VBXA 4ETSA 4WK8F 3ERED 3ZMZA 1FPQA 4EJWA 2A6HF 2MLKA 3O2PE 3ELKA 3WG9A 2DLLA 3OOPA 4RS8A 2R7DA 2J5PA 1S7OA 5KK1A 3WTYC 3HTUA 2EB7A 3KE2A 2DK8A 1I1GA 1ZRCA 1BBYA 1KU7A 3PQJA 3RPUA 1MZBA 4OIRF 3ZMDA 2EFPA 1KQ8A 2D45A 1P4XA 3M8EA 3H92A 1ODDA 4BHPA 3H3UA 1J59A 4LG0A 1LNWA 3ZPLA 3C7JA 2IJLA 2DPUA 4LB6B 3F8NA 2H6CA 1J2XA 1RUNA 2Q8KA 1YW7A 2CO5A 3BPVA 3GVAA 4JQFA 2FMLA 3LA2A 4WXHA 2K4JA 1R1UA 4KYWA 3LA3A 3GZ6A 2Z33A 1D8KA 3WU0A 1Z6RA 2PI0A 2F5EA 4H0EA 1TLHB 2EFOA 2OQGA 5BOXA 2DQRA 3HSFA 4Y13A 4U0YA 1TW2A 1BI2A 2KIMA 2M45A 4HF2A 2FU4A 2EFNA 2FOKA 4BHBA 2QLZA 5JVTA 2IA0A 2FXAA 4ESFA 4NQWA 1J9IA 4FX4A 2ZBKA 4MEXF 5AONA 1HSJA 1B4AA 3FX3A 4FT8A 1IN6A 1B59A 4KN4X 1W7PD 2L01A 3GFIA 3JTGA 1UFMA 3ML6A 5E8IA 1O7FA 1DPRA 2KKOA 1T38A 3F8CA 1WRJA 1I27A 1EH7A 2P5VA 2HS5A 4LB5A 4MHGA 2P7VB 1SMTA 1UCRA 5LHGA 2XVCA 4HDUA 4KA4A 4O6JA 1K7AA 1YLFA 1T39A 1ZRFA 1MGTA 4D0PA 4YFKF 1BIAA 3TOBA 1IW7F 3Q9SA 2UXXA 2GAUA 4KIFA 3GX4X 4G7ZF 4WCGA 4RB3C 1R00A 2ZNYA 1H9GA 5BQTA 1G3YA 3E5QA 5BMZA 1X3UA 2HTJA 1YS7A 4M6XA 1S6LA 3V4GA 3L2CA 2M8EA 2XAHA 2IA1A 4LFUA 1R23A 1H9TA 3LQQA 2EV6A 4RB0A 1OPCA 2HOEA 2VOPA 3KP5A 3GYHX 2VN2A 2MLGA 2YX4A 5JHUA 1OKRA 2H09A 3MAJA 2VC1A 3T1BA 4G9YA 2FBIA 4OMYA 3CUOA 2WTEA 4A0YA 2PG4A 4PDKA 4HX4A 1HW5A 2K4BA 1Z9CA 1IAWA 2GWRA 4Z2YA 1J75A 3LA7A 2QWWA 2FNPA 2ADUA 2UXNA 5CVJA 3TO9A 1E17A 1V3FA 1BJAA 3W6KB 4M9SA 1MKMA 2HDCA 2G7HA 4MGRA 3R0AA 1ZAOA 4IXAA 2O3FA 1P4AA 2QYOA 2ETHA 3HHHA 1BI3A 4I09A 4ESJA 4RB2C 4IHSA 4I01A 4GXOA 5CVRA 1HKQA 5IT9K 2EJRA 4A6DA 2CFXA 4EQQA 1Z7UA 5LEKA 3FMQA 1O3RA 5ILUA 2E7XA 3LSTA 1G3WA 1USSA 1FBSA 3V8LA 2WV0A 1Z91A 2G9WA 5E1WA 5K5RA 4LK1F 1B9MA 2CW0F 1XGMA 5KVRA 5ICFA 3HRTA 5H6QA 5HLIA 1HBXG 4I02A 1ZARA 4I98B 2W25A 1BI0A 1STZA 3I4PA 1ZG5A 2OD5A 3RJPA 2E7WA 5ED4A 2F5FA 1OMIA 2OQRA 4MTDA 2VONA 2Q0OA 3E97A 2XAFA 4S04A 4KICA 4BYYA 3F72A 2LF8A 5D8LB 3WTZA 5FO5A 1P2FA 1SAXA 2A3SA 2NS0A 2PLYA 4WXDA 3J81Z 3QU6A 1T6SA 5BPIA 4EGYA 4UVBA 3R6SA 4LMYA 4UUVA 1B9NA 5TRDA 2DO7A 3DFGA 3R61A 3T8TA 4ENKA 2QBYB 2YU3A 2XRNA 2Y75A 2Y0MA 2Z3YA 2O0YA 3KCCA 3I5UA 2DPDA 5LLQA 4Q48A 5ILSA 1YIOA 3EYYA 3LFKA 4GYGA 5LRRA 3HRUA 1ZGJA 2HR3A 3N97A 2XHKA 4IF4A 2V79A 4OIQF 5JFRA 1IXRC 2DK5A 4HAMA 2MD5A 2P6TA 4HX7A 1XDUA 1HW2A 4YG2F 3B73A 5F1RA 3GXOA 3PQKA 3BP8A 2Z9OA 1IN5A 2HZTA 2K86A 1DP7P 2HFHA 1SMYF 4OMZA 4N9IA 2OZ6A 4UVAA 3CUQA 2EV0A 2FNAA 3O3KA 4U88A 2MH9A 1KQ0A 5ERIA 4WX9A 3F8FA 2FRHA 2JPBA 3BDDA 1RNLA 4RGUA 4BXUA 4I7HA 4HYEA 4P96A 1U5TA 5AIPA 1JXSA 2LNBA 3QRFF 2RNJA 3HRSA 5HDGA 4ZYGA 3I59B 3LAJA 4UXNA 4P55A 4HF1A 5TJJA 3MZHA 1J7KA 2M1BA 5A2QZ 3VODA 2FBKA 4ZH4F 2ZFWA 3Q9VA 4U7DA 1IXCA 3JSOA 3CJNA 5EEHA 1ZREA 1G3SA 5E1XA 2P4WA 5CVUA 5HOOA 4A6EA 2M5WA 2ZCWA 3BWGA 3F6OA 1L0OC 3F8MA 5K1YA 1CF7B 1JE8A 1J5YA 2OBPA 3SHFA 4R79A 1LDJA 3WTTC 3IRRA 5K5QA 3HOTA 2QUFA 1IXSB 1LVAA 4UV9A 2VT3A 1UHMA 2JT1A 1TQIA 2BBYA 3MEXA 4CZZA 3E6MA 3KP7A 3ZMUA 3SZTA 1WWXA 1H0MA 5HDKA 4G94A 1TQPA 3EYIA 1XSXA 3JAMZ 4L9JA 1XN7A 5DUKA 4KIBA 1D8JA 2HKOA 1MDMA 4HQMA 3COAC 1QZZA 1IN7A 4OU0A 4P9UA 4GCVA 5D5VB 2AS5F 2COMA 2ESHA 1FP1D 2LF7A 3BROA 1F5TA 3K1NA 5LHHA 3AAFA 1R5GA 2VBYA 4NHJA 3CLOA 4ESBA 2EA4A 4EVIA 2DT5A 3ECOA 3R4KA 3Q5FA 4CXFA 2EFQA 3VOEA 3I64A 2ZO4A 3RDIA 2ZMEB 4IPAA 3TO6A 2VE8A 2UZKA 1OYYA 2BYVE 3I53A 4XLNF 3WODF 1QGPA 4LK0F 3BZ6A 4RGXA 3U2RA 2AXLA 4A5NA 3WTWC 3G3ZA 1PP8F 4EJOA 1YW8A 4M6YA 5DV5A 1DUXC 4UVCA 2A68F 2A07F 2R7FA 1HW1A 1Z05A 4RGRA 1Z1DA 1O3TA 2V1XA 1XD7A 1XMAA 2YR2A 1U3EM 1SD4A 3KETA 1YTYA 5F64A 3RTRA 4FHTA 4HZFA 1QQIA 1PUEE 2ACJA 3C18A 1O3QA 3GF2A 4M71A 2OU2A 4EJVA 2IP2A 2X4HA 2C6YA 4MEYF 3KP3A 3MWMA 2PMHA 1LDKB 3RKXA 5LEJA 3F23A 1R58A 2JSCA 4EM0B 3IWZA 3BY6A 3E3VA 1KU2A 5FGMA 1BM9A 5BPDA 2A69F 5CVIA 5L3GA 3BJOA 4ZZDA 3GFLA 4AIJA 1TQMA 5CJ9A 1QPMA 1FLIA 3TKYA 5FB2A 3P7NA 4O3MA 2K27A 2Z99A 3F8BA 2L4MA 3N4MA 2VC0A 3J80Z 1G3TA 4O5VA 3ZN0A 4A0XA 5LGTA 1KYZA 4LLNA 2V9VA 4A12A 1QO0D 1Q1HA 3F3XA 3I71A 5D4RA 2EFWA 4IRHA 3T5XA 3HYIA 1LEAA 3HUGA 3NQOA 4AIKA 2FQ3A 1ON1A 2OA4A 1T2KA 2YSRA 3JTHA 2M30A 1K78A 1R5HA 3IWFA 3KLOA 4OOIA 2VT2A 1IF1A 1K6OA 2H94A 4HBLA 4I2OA 5L3DA 4BH9A 3REOA 3WGIA 1J0RA 5DDGA 2QQ9A 1GXQA 5EEGA 2J5OA 4Q4ZF 4EM1A 4Q5SF 3JSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP6 A;  5CYV A;  1UHW A;  3I0T A;  3BOQ A;  3MCZ A;  2VBW A;  5LBQ A;  2L4A A;  3WGG A;  4UNO A;  2LKP A;  3DQV C;  2E1N A;  2H27 A;  5ICG A;  2P6S A;  1SD6 A;  4GGG A;  5D5X B;  2DBB A;  3GWZ A;  2W24 A;  1FNN A;  1ZG1 A;  3RPQ A;  1BN5 A;  4YIF A;  3CUQ C;  4CGZ A;  1XGN A;  5HS7 A;  3MQ0 A;  2F5D A;  3ROU A;  2BEO A;  2QBY A;  3P9K A;  3IKT A;  3ULQ B;  2Y48 A;  1D5V A;  2KIU A;  2YX7 A;  1U5T C;  1WQ2 A;  5CLS A;  3RKW A;  4EJT A;  4ENJ A;  4KNY A;  5J8C A;  2HTS A;  2O03 A;  3VB2 A;  2E1C A;  3T0Y A;  4QLC U;  1S3J A;  4Y15 A;  4DQ2 A;  1EH6 A;  3QOP A;  4G6Q A;  3RYR A;  3C3W A;  4HW0 A;  5FFZ A;  1FYM A;  3J81 K;  3K1M A;  1YYV A;  1A04 A;  1YQA A;  4P5O A;  1D3Y A;  2FE3 A;  1XSD A;  1EV7 A;  4LD5 A;  1PP7 U;  2XIG A;  2CQK A;  1TTY A;  4L9N A;  4L5I A;  1KU9 A;  4EV0 A;  2V1U A;  2QQA A;  3R60 A;  1U8R A;  3M9A A;  2RN7 A;  4NB5 A;  3L7W A;  3LQR A;  4CIC A;  3RIR A;  2P8T A;  1UST A;  4XLP F;  4MNU A;  4PGG A;  2ZNZ A;  1MJA A;  4U7B A;  2IRF G;  3WTX C;  1AWC A;  2GA2 A;  3WE3 A;  5D5U B;  3QPT A;  3D0S A;  1L3L A;  4MQV A;  4I0A A;  1I1S A;  4JK1 X;  4BHC A;  4HLX A;  1W7P A;  3L09 A;  4E70 A;  3GW2 A;  3RI4 A;  1W5S A;  5D5W B;  1FBU A;  4MTE A;  2K02 A;  4ZYD A;  1W4M A;  2A5Y B;  3K0L A;  3DPL C;  2LSO A;  1RI7 A;  2CYY A;  1CF7 A;  4UHT A;  1U2W A;  1I6X A;  3KP4 A;  3RYP A;  1XGS A;  1C0W A;  4LLL A;  4JBA A;  5FLX Z;  4HQE A;  2DAO A;  3I58 A;  5H6R A;  1ZG3 A;  5DCM B;  5LGU A;  2EA2 A;  1P4W A;  5K5O A;  5A2Q K;  2L02 A;  2L3D A;  2QVO A;  4TV7 A;  1YS6 A;  2LDU A;  4HV6 A;  2HGC A;  3KZY A;  1SFX A;  2RVC A;  1FWZ A;  1FC3 A;  4N0B A;  3KFW X;  1TNT A;  4AVP A;  5LHI A;  3P9I A;  3ZMT A;  2H6B A;  4XSZ F;  2ESN A;  2DW4 A;  3ABU A;  3VEP A;  2VBZ A;  4M9X A;  1HQC A;  1R36 A;  3TOA A;  3CTA A;  2XAG A;  2DI3 A;  2P5K A;  3LAP A;  3M1E A;  3SXY A;  4OIN F;  4EMS A;  2IA2 A;  2ISY A;  3DEU A;  2M87 A;  3G73 A;  3E6D A;  3SZP A;  1XCB A;  1YW9 A;  2WC2 A;  2XGX A;  2IVM A;  2TDX A;  2VE9 A;  4OIP F;  3CUQ B;  1IN4 A;  3JAM K;  3IKV A;  2CG4 A;  4N9H A;  3P9C A;  1VTN C;  4XSX F;  2CSO A;  3KEO A;  5E18 F;  4EGZ A;  4RB1 A;  3CDH A;  1REP C;  3L00 A;  1O3S A;  3IHU A;  3KP2 A;  2F5C A;  1FSH A;  1U5T B;  1G6N A;  3FWE A;  3TGN A;  4U0W A;  4G8X A;  2MC3 A;  1BI1 A;  1HXD A;  2OAZ A;  3EDP A;  2GIV A;  1R22 A;  3DF8 A;  1ZLJ A;  1Y0U A;  4HV5 A;  1FSE A;  1ZLK A;  2JRT A;  5DEQ A;  3E5X A;  3HTS B;  5ICE A;  1R1T A;  2EK5 A;  3FZV A;  1K79 A;  4L0Y B;  3GFM A;  4LLG F;  4RAZ A;  2O6G E;  1KU3 A;  4ZYE A;  4KMU X;  2QZ8 A;  3DKW A;  4YII A;  4L18 B;  3WGH A;  4R1H A;  3FXQ A;  1U6G A;  2PJP A;  2MBF A;  3ZP5 A;  3MZY A;  1JHH A;  4HOB A;  3TQN A;  5D8K B;  2NNN A;  2RV8 A;  4WWC A;  1IRG A;  3BJA A;  1QBJ A;  2CGP A;  3DV8 A;  3ABT A;  2VOD A;  1KQ9 A;  3DP7 A;  4ENM A;  4YFN F;  2DTR A;  4U0V A;  4P9F A;  2L54 A;  1MJB A;  4ON0 A;  1OYI A;  5E8G A;  3QPH A;  3VFZ A;  3F21 A;  3JW4 A;  3H3Z A;  2PMU A;  3O6B B;  4A0Z A;  1RUO A;  1IRF A;  1HST A;  1B6A A;  1O7L A;  3E6C C;  2ELH A;  1PDN C;  2STW A;  2V6C A;  1LQ1 A;  3WTV C;  1FOK A;  2BV6 A;  3I54 A;  1MDM B;  4PZJ A;  1S8N A;  1XSV A;  1MJ9 A;  1QZY A;  3WE2 A;  4CDG A;  4PCQ A;  2GXG A;  5FD5 A;  2BE5 F;  2FBH A;  2ZKZ A;  3BJ6 A;  3HIF A;  4LG0 B;  4HA8 A;  4AIH A;  4CYD A;  4DNC A;  1ONV A;  3T8R A;  4WXC A;  3ECH A;  5IT3 A;  2OZU A;  1U78 A;  3K69 A;  3EQL F;  1YG2 A;  4ENN A;  2IW5 A;  4M73 A;  3F22 A;  3GO5 A;  3ZQ7 A;  3ZMV A;  3RKY A;  1B1B A;  2VOO A;  3EUH A;  1F9N A;  3R0J A;  2NAZ A;  1ZGA A;  4KMF A;  3J80 K;  4B09 A;  4XRF A;  5JR3 A;  1NHA A;  4G7O F;  4MQ9 F;  2FA5 A;  5HS9 A;  1LB2 A;  3PFI A;  4GYI A;  1ZHF A;  3DXJ F;  4L9V A;  1SFU A;  1FBQ A;  5DCF A;  1WKM A;  1FP2 A;  3V7C A;  4R8H A;  2R3S A;  1R7J A;  3OV8 A;  4IRI A;  1XB4 A;  2HYF A;  2XUB A;  4IVN A;  1E2X A;  5ILV A;  3F6V A;  2A6E F;  2PFB A;  1XGO A;  5H20 A;  4KFC A;  4HLY A;  5L3E A;  3EET A;  5E1Z B;  1F1Z A;  3FF5 A;  2HKX A;  3CO6 C;  3GEZ A;  2PEX A;  1IN8 A;  2X0L A;  3FMS A;  1JHF A;  5DYM A;  1KGS A;  3IC7 A;  1EH8 A;  4FX0 A;  4BAY A;  3V7R A;  3WU1 B;  4CO8 A;  5DUI A;  3KP6 A;  3E6B A;  2QQB A;  3FMR A;  1CGP A;  2MA3 A;  3D5L A;  3K9T A;  2Z5U A;  3V8J A;  3CO7 C;  5HLG A;  3GZ5 A;  4CHU A;  2HEO A;  4L9T A;  1OYW A;  3HSR A;  1T98 A;  1YO5 C;  1DDN A;  2IT0 A;  2DU9 A;  3V7S A;  3V8K A;  5AIQ A;  4YFX F;  3W6J B;  1QNT A;  2ZXJ A;  3FXR A;  2FF4 A;  3KEQ A;  1F4K A;  2RGV A;  2D2W A;  1ZYR F;  4M9Z A;  2XRO A;  1YFH A;  4M72 A;  5ICC A;  1SFE A;  4BNC A;  1ZH5 A;  4XBF A;  4S05 A;  3FM3 A;  5DD8 A;  1BOA A;  2D1V A;  3M8F A;  3IL2 A;  2DQL A;  4HX8 A;  1JGS A;  5F6F A;  2NRA C;  1FZP B;  4M74 A;  5IT9 Z;  1ULY A;  1KYW A;  1K78 B;  5L3C A;  4AD9 A;  5J8F A;  1XMK A;  5HDN A;  5D6F A;  4BQA A;  1TW3 A;  3K1P A;  2YPR A;  4ZZL A;  1OR7 A;  5LGN A;  2STT A;  4G6D A;  3J7A O;  1GXP A;  4EJU A;  5D4S A;  2QEN A;  4IRG A;  2NNY A;  2XAJ A;  4EM2 A;  3NRV A;  2HWV A;  2GXB A;  2WWY A;  4KIG A;  5DD4 A;  5E20 A;  2HQR A;  3E5U A;  3HRM A;  4GO1 A;  1G4D A;  3B02 A;  4KDP A;  1FT9 A;  1SD5 A;  1BC7 C;  3ZN1 A;  3WTU C;  2RKH A;  2FEZ A;  3ISP A;  1KA8 A;  2FSW A;  2O61 A;  1TNS A;  1WI9 A;  3FXU A;  3TDU C;  1BC8 C;  2PQ8 A;  2RC4 A;  1XCV A;  2HQN A;  2ZJ2 A;  5LRS A;  1ZN2 A;  6PAX A;  4B8X A;  2W85 A;  1P92 A;  2GZW A;  2EWN A;  2KIF A;  2JZY A;  1GHC A;  4KT5 C;  5HS8 A;  2GA1 A;  2V1D A;  4KUM A;  5DCM A;  2XV4 S;  2BGC A;  1XDS A;  1HKT A;  2XAQ A;  3I59 A;  4K2E A;  1LEB A;  3TDZ C;  2K7L A;  3KZZ A;  4AWX B;  4QWQ A;  2PBI A;  1FX7 A;  1ON2 A;  2VXZ A;  2F2E A;  4PGH A;  5BS6 A;  2PN6 A;  3WTS C;  4OIO F;  2DFI A;  2XKO A;  2D1H A;  3MFK A;  1RZ4 A;  1SD7 A;  1UB9 A;  2JTV A;  1O57 A;  3K2Z A;  3GUD A;  2XKP A;  3GLX A;  5FLX K;  3FM5 A;  3TO7 A;  1FY7 A;  3NEU A;  3U9G A;  5L3B A;  1LDD A;  3HSE A;  2A61 A;  4KN7 X;  1ZRD A;  4HDV A;  3BPX A;  2GQQ A;  2MH2 A;  2HYG D;  4LJZ F;  4F7Z A;  3LWF A;  4A5M A;  4RGS A;  5FD6 A;  1RIO H;  2EV5 A;  4RAY A;  4G7H F;  3QP5 A;  4I0B A;  2KJC A;  4ZYH A;  5L3F A;  1DPU A;  3DPT A;  4HF0 A;  2KJB A;  1I5Z A;  4Y17 A;  1FYL A;  2UWM A;  1S29 A;  3SFZ A;  3C1D A;  2Q2E A;  5E17 F;  2IPQ X;  2RDP A;  2JPC A;  3U1D A;  2KRF A;  1TBX A;  3IRQ A;  1IZ1 A;  2W84 A;  5D6E A;  2CWE A;  2RQP A;  1W5T A;  1W7P B;  1WSU A;  1P6R A;  3HHG A;  3M7G A;  5FFX A;  4Q47 A;  1AOY A;  3ZMS A;  4LGW A;  3KLN A;  1BIB A;  3S2W A;  4L0Z B;  3FHZ A;  2P7C B;  4UV8 A;  1FYK A;  5HVQ C;  4L5J A;  5HLH A;  2QM3 A;  1S7A A;  1R1V A;  1T0F A;  2W57 A;  2NYX A;  2ISZ A;  2G7U A;  2FMY A;  2P5L C;  4WF2 A;  1V4R A;  1MD0 A;  1HKS A;  4ASN A;  4A2U A;  1LJ9 A;  5CVV A;  3HOS A;  3QU3 A;  5JI6 A;  3QAH A;  2B0L A;  2ZME A;  4IJA A;  5J6X A;  3SQN A;  2O8X A;  2XAS A;  3L9F A;  1IUY A;  1GVJ A;  4IHT A;  1Z6T A;  3GFJ A;  2VBX A;  4ETS A;  4WK8 F;  3ERE D;  3ZMZ A;  1FPQ A;  4EJW A;  2A6H F;  2MLK A;  3O2P E;  3ELK A;  3WG9 A;  2DLL A;  3OOP A;  4RS8 A;  2R7D A;  2J5P A;  1S7O A;  5KK1 A;  3WTY C;  3HTU A;  2EB7 A;  3KE2 A;  2DK8 A;  1I1G A;  1ZRC A;  1BBY A;  1KU7 A;  3PQJ A;  3RPU A;  1MZB A;  4OIR F;  3ZMD A;  2EFP A;  1KQ8 A;  2D45 A;  1P4X A;  3M8E A;  3H92 A;  1ODD A;  4BHP A;  3H3U A;  1J59 A;  4LG0 A;  1LNW A;  3ZPL A;  3C7J A;  2IJL A;  2DPU A;  4LB6 B;  3F8N A;  2H6C A;  1J2X A;  1RUN A;  2Q8K A;  1YW7 A;  2CO5 A;  3BPV A;  3GVA A;  4JQF A;  2FML A;  3LA2 A;  4WXH A;  2K4J A;  1R1U A;  4KYW A;  3LA3 A;  3GZ6 A;  2Z33 A;  1D8K A;  3WU0 A;  1Z6R A;  2PI0 A;  2F5E A;  4H0E A;  1TLH B;  2EFO A;  2OQG A;  5BOX A;  2DQR A;  3HSF A;  4Y13 A;  4U0Y A;  1TW2 A;  1BI2 A;  2KIM A;  2M45 A;  4HF2 A;  2FU4 A;  2EFN A;  2FOK A;  4BHB A;  2QLZ A;  5JVT A;  2IA0 A;  2FXA A;  4ESF A;  4NQW A;  1J9I A;  4FX4 A;  2ZBK A;  4MEX F;  5AON A;  1HSJ A;  1B4A A;  3FX3 A;  4FT8 A;  1IN6 A;  1B59 A;  4KN4 X;  1W7P D;  2L01 A;  3GFI A;  3JTG A;  1UFM A;  3ML6 A;  5E8I A;  1O7F A;  1DPR A;  2KKO A;  1T38 A;  3F8C A;  1WRJ A;  1I27 A;  1EH7 A;  2P5V A;  2HS5 A;  4LB5 A;  4MHG A;  2P7V B;  1SMT A;  1UCR A;  5LHG A;  2XVC A;  4HDU A;  4KA4 A;  4O6J A;  1K7A A;  1YLF A;  1T39 A;  1ZRF A;  1MGT A;  4D0P A;  4YFK F;  1BIA A;  3TOB A;  1IW7 F;  3Q9S A;  2UXX A;  2GAU A;  4KIF A;  3GX4 X;  4G7Z F;  4WCG A;  4RB3 C;  1R00 A;  2ZNY A;  1H9G A;  5BQT A;  1G3Y A;  3E5Q A;  5BMZ A;  1X3U A;  2HTJ A;  1YS7 A;  4M6X A;  1S6L A;  3V4G A;  3L2C A;  2M8E A;  2XAH A;  2IA1 A;  4LFU A;  1R23 A;  1H9T A;  3LQQ A;  2EV6 A;  4RB0 A;  1OPC A;  2HOE A;  2VOP A;  3KP5 A;  3GYH X;  2VN2 A;  2MLG A;  2YX4 A;  5JHU A;  1OKR A;  2H09 A;  3MAJ A;  2VC1 A;  3T1B A;  4G9Y A;  2FBI A;  4OMY A;  3CUO A;  2WTE A;  4A0Y A;  2PG4 A;  4PDK A;  4HX4 A;  1HW5 A;  2K4B A;  1Z9C A;  1IAW A;  2GWR A;  4Z2Y A;  1J75 A;  3LA7 A;  2QWW A;  2FNP A;  2ADU A;  2UXN A;  5CVJ A;  3TO9 A;  1E17 A;  1V3F A;  1BJA A;  3W6K B;  4M9S A;  1MKM A;  2HDC A;  2G7H A;  4MGR A;  3R0A A;  1ZAO A;  4IXA A;  2O3F A;  1P4A A;  2QYO A;  2ETH A;  3HHH A;  1BI3 A;  4I09 A;  4ESJ A;  4RB2 C;  4IHS A;  4I01 A;  4GXO A;  5CVR A;  1HKQ A;  5IT9 K;  2EJR A;  4A6D A;  2CFX A;  4EQQ A;  1Z7U A;  5LEK A;  3FMQ A;  1O3R A;  5ILU A;  2E7X A;  3LST A;  1G3W A;  1USS A;  1FBS A;  3V8L A;  2WV0 A;  1Z91 A;  2G9W A;  5E1W A;  5K5R A;  4LK1 F;  1B9M A;  2CW0 F;  1XGM A;  5KVR A;  5ICF A;  3HRT A;  5H6Q A;  5HLI A;  1HBX G;  4I02 A;  1ZAR A;  4I98 B;  2W25 A;  1BI0 A;  1STZ A;  3I4P A;  1ZG5 A;  2OD5 A;  3RJP A;  2E7W A;  5ED4 A;  2F5F A;  1OMI A;  2OQR A;  4MTD A;  2VON A;  2Q0O A;  3E97 A;  2XAF A;  4S04 A;  4KIC A;  4BYY A;  3F72 A;  2LF8 A;  5D8L B;  3WTZ A;  5FO5 A;  1P2F A;  1SAX A;  2A3S A;  2NS0 A;  2PLY A;  4WXD A;  3J81 Z;  3QU6 A;  1T6S A;  5BPI A;  4EGY A;  4UVB A;  3R6S A;  4LMY A;  4UUV A;  1B9N A;  5TRD A;  2DO7 A;  3DFG A;  3R61 A;  3T8T A;  4ENK A;  2QBY B;  2YU3 A;  2XRN A;  2Y75 A;  2Y0M A;  2Z3Y A;  2O0Y A;  3KCC A;  3I5U A;  2DPD A;  5LLQ A;  4Q48 A;  5ILS A;  1YIO A;  3EYY A;  3LFK A;  4GYG A;  5LRR A;  3HRU A;  1ZGJ A;  2HR3 A;  3N97 A;  2XHK A;  4IF4 A;  2V79 A;  4OIQ F;  5JFR A;  1IXR C;  2DK5 A;  4HAM A;  2MD5 A;  2P6T A;  4HX7 A;  1XDU A;  1HW2 A;  4YG2 F;  3B73 A;  5F1R A;  3GXO A;  3PQK A;  3BP8 A;  2Z9O A;  1IN5 A;  2HZT A;  2K86 A;  1DP7 P;  2HFH A;  1SMY F;  4OMZ A;  4N9I A;  2OZ6 A;  4UVA A;  3CUQ A;  2EV0 A;  2FNA A;  3O3K A;  4U88 A;  2MH9 A;  1KQ0 A;  5ERI A;  4WX9 A;  3F8F A;  2FRH A;  2JPB A;  3BDD A;  1RNL A;  4RGU A;  4BXU A;  4I7H A;  4HYE A;  4P96 A;  1U5T A;  5AIP A;  1JXS A;  2LNB A;  3QRF F;  2RNJ A;  3HRS A;  5HDG A;  4ZYG A;  3I59 B;  3LAJ A;  4UXN A;  4P55 A;  4HF1 A;  5TJJ A;  3MZH A;  1J7K A;  2M1B A;  5A2Q Z;  3VOD A;  2FBK A;  4ZH4 F;  2ZFW A;  3Q9V A;  4U7D A;  1IXC A;  3JSO A;  3CJN A;  5EEH A;  1ZRE A;  1G3S A;  5E1X A;  2P4W A;  5CVU A;  5HOO A;  4A6E A;  2M5W A;  2ZCW A;  3BWG A;  3F6O A;  1L0O C;  3F8M A;  5K1Y A;  1CF7 B;  1JE8 A;  1J5Y A;  2OBP A;  3SHF A;  4R79 A;  1LDJ A;  3WTT C;  3IRR A;  5K5Q A;  3HOT A;  2QUF A;  1IXS B;  1LVA A;  4UV9 A;  2VT3 A;  1UHM A;  2JT1 A;  1TQI A;  2BBY A;  3MEX A;  4CZZ A;  3E6M A;  3KP7 A;  3ZMU A;  3SZT A;  1WWX A;  1H0M A;  5HDK A;  4G94 A;  1TQP A;  3EYI A;  1XSX A;  3JAM Z;  4L9J A;  1XN7 A;  5DUK A;  4KIB A;  1D8J A;  2HKO A;  1MDM A;  4HQM A;  3COA C;  1QZZ A;  1IN7 A;  4OU0 A;  4P9U A;  4GCV A;  5D5V B;  2AS5 F;  2COM A;  2ESH A;  1FP1 D;  2LF7 A;  3BRO A;  1F5T A;  3K1N A;  5LHH A;  3AAF A;  1R5G A;  2VBY A;  4NHJ A;  3CLO A;  4ESB A;  2EA4 A;  4EVI A;  2DT5 A;  3ECO A;  3R4K A;  3Q5F A;  4CXF A;  2EFQ A;  3VOE A;  3I64 A;  2ZO4 A;  3RDI A;  2ZME B;  4IPA A;  3TO6 A;  2VE8 A;  2UZK A;  1OYY A;  2BYV E;  3I53 A;  4XLN F;  3WOD F;  1QGP A;  4LK0 F;  3BZ6 A;  4RGX A;  3U2R A;  2AXL A;  4A5N A;  3WTW C;  3G3Z A;  1PP8 F;  4EJO A;  1YW8 A;  4M6Y A;  5DV5 A;  1DUX C;  4UVC A;  2A68 F;  2A07 F;  2R7F A;  1HW1 A;  1Z05 A;  4RGR A;  1Z1D A;  1O3T A;  2V1X A;  1XD7 A;  1XMA A;  2YR2 A;  1U3E M;  1SD4 A;  3KET A;  1YTY A;  5F64 A;  3RTR A;  4FHT A;  4HZF A;  1QQI A;  1PUE E;  2ACJ A;  3C18 A;  1O3Q A;  3GF2 A;  4M71 A;  2OU2 A;  4EJV A;  2IP2 A;  2X4H A;  2C6Y A;  4MEY F;  3KP3 A;  3MWM A;  2PMH A;  1LDK B;  3RKX A;  5LEJ A;  3F23 A;  1R58 A;  2JSC A;  4EM0 B;  3IWZ A;  3BY6 A;  3E3V A;  1KU2 A;  5FGM A;  1BM9 A;  5BPD A;  2A69 F;  5CVI A;  5L3G A;  3BJO A;  4ZZD A;  3GFL A;  4AIJ A;  1TQM A;  5CJ9 A;  1QPM A;  1FLI A;  3TKY A;  5FB2 A;  3P7N A;  4O3M A;  2K27 A;  2Z99 A;  3F8B A;  2L4M A;  3N4M A;  2VC0 A;  3J80 Z;  1G3T A;  4O5V A;  3ZN0 A;  4A0X A;  5LGT A;  1KYZ A;  4LLN A;  2V9V A;  4A12 A;  1QO0 D;  1Q1H A;  3F3X A;  3I71 A;  5D4R A;  2EFW A;  4IRH A;  3T5X A;  3HYI A;  1LEA A;  3HUG A;  3NQO A;  4AIK A;  2FQ3 A;  1ON1 A;  2OA4 A;  1T2K A;  2YSR A;  3JTH A;  2M30 A;  1K78 A;  1R5H A;  3IWF A;  3KLO A;  4OOI A;  2VT2 A;  1IF1 A;  1K6O A;  2H94 A;  4HBL A;  4I2O A;  5L3D A;  4BH9 A;  3REO A;  3WGI A;  1J0R A;  5DDG A;  2QQ9 A;  1GXQ A;  5EEG A;  2J5O A;  4Q4Z F;  4EM1 A;  4Q5S F;  3JSP A; 
#chains in the Genus database with same CATH topology
 3NAR A;  2DFE A;  2VIX A;  3QP6 A;  4HNU A;  3RKQ A;  2OF7 A;  5CYV A;  1UHW A;  4CCL A;  5IY5 H;  3JCU C;  3I0T A;  3BOQ A;  3GCM A;  3MCZ A;  2VBW A;  1H8A C;  5LBQ A;  2KHM A;  3O8G A;  2L4A A;  3WGG A;  4UNO A;  3GBG A;  2LKP A;  3DQV C;  2E1N A;  2H27 A;  4RLF A;  5ICG A;  2ZSH B;  2P6S A;  1SD6 A;  4GGG A;  1JUS A;  5D5X B;  4KJZ A;  2OPT A;  2M8G X;  2DBB A;  3CCV I;  3J7Z I;  1ZEL A;  3GWZ A;  2W24 A;  3K4K A;  1PYV A;  3K10 A;  2M0C A;  4LOC A;  1FNN A;  1ZG1 A;  3RPQ A;  1BN5 A;  4YIF A;  3CUQ C;  4CGZ A;  3PM1 A;  1XGN A;  5HS7 A;  3MQ0 A;  2KDZ A;  2DFF A;  2F5D A;  3ROU A;  2BEO A;  1XMX A;  2X1D A;  2YUS A;  4MLO A;  2QBY A;  4W97 A;  5FLM J;  3RPU D;  4L5E A;  4CA0 A;  3P9K A;  3IKT A;  2HPM A;  4BEH B;  1YRN A;  3ULQ B;  2Y48 A;  1D5V A;  2KIU A;  2R93 J;  1LKX A;  5F0C A;  2X51 A;  3CCE I;  2WBM A;  1AKH B;  2YX7 A;  1A6I A;  3OIO A;  2QKL B;  1U5T C;  1WQ2 A;  3RCO A;  1RPW A;  3FK6 A;  5CLS A;  3RKW A;  4A3I J;  3FDY A;  4EJT A;  2CQQ A;  4ENJ A;  4AC0 A;  1XTA A;  1P7J A;  1R9T J;  2E2H J;  3SEZ A;  5J8C A;  1W5C C;  4KNY A;  2HTS A;  2O03 A;  3VB2 A;  2E1C A;  1VQ6 I;  3T0Y A;  4QLC U;  1S3J A;  4Y15 A;  4DQ2 A;  1EH6 A;  3QOP A;  4G6Q A;  3RYR A;  3C3W A;  3LSH A;  4HW0 A;  1LFU P;  1IDY A;  4BL0 B;  1DGW Y;  2R7S A;  1YJN I;  1IDZ A;  5FFZ A;  1FYM A;  4PJJ A;  1A31 A;  3J81 K;  2R7T A;  3K1M A;  3L2R A;  3HPG A;  5EJC A;  1I3A A;  1YYV A;  3MKZ A;  1A04 A;  1ZR4 A;  5JLW A;  1YQA A;  3FBI B;  4P5O A;  1D3Y A;  2FE3 A;  4XKW A;  4JP0 A;  1XSD A;  1LFB A;  1EV7 A;  5FRO A;  4LD5 A;  2YU9 J;  1PP7 U;  1MNM C;  2K9S A;  1TWH J;  2FOW A;  1LPQ A;  2Y31 A;  2XIG A;  3DTE A;  1SVO A;  2TCT A;  1D1B A;  2CQK A;  1RC9 A;  1TTY A;  2B7E A;  3HGG A;  1KU9 A;  4L5I A;  4L9N A;  1JKP C;  4EV0 A;  2V1U A;  1ETX A;  2QQA A;  2W1O A;  3KYL A;  3R60 A;  1WGX A;  1YI2 I;  1U8R A;  3M9A A;  4BKX A;  2RN7 A;  4NB5 A;  3L7W A;  3DBR B;  3LQR A;  5DTD A;  4CIC A;  3RIR A;  3W2V A;  2P8T A;  2JN6 A;  1RR7 A;  1UST A;  4XLP F;  4MNU A;  3ZOB A;  4PGG A;  4BY7 J;  5H2F C;  1VI0 A;  3OYG A;  2ZNZ A;  1MJA A;  3E7L A;  4U7B A;  2IRF G;  3WTX C;  1AWC A;  2GA2 A;  1S7E A;  3WE3 A;  1HDD C;  4IHY A;  5D5U B;  3QPT A;  3BR6 A;  3HDD A;  3D0S A;  1L3L A;  1HOM A;  4MQV A;  1ENH A;  1NTC A;  3CCR I;  1AA7 A;  4I0A A;  3S1R J;  3VSL A;  1I1S A;  4GFB A;  1ZKG A;  2WB1 N;  2K3F A;  4HPQ A;  4XRS A;  4JK1 X;  4BHC A;  4HLX A;  3PL8 A;  3S3O A;  1W7P A;  1Y0N A;  3L09 A;  4E70 A;  3FXK A;  2DMN A;  4A3J J;  3GW2 A;  3CJT B;  3LSR A;  4CCN A;  3RI4 A;  1I3Q J;  1W5S A;  3OMY A;  5D5W B;  1FBU A;  4MTE A;  3FIS A;  1R5I D;  2K02 A;  4QPO A;  1TC3 C;  4AYB A;  9ANT A;  4ZYD A;  1W4M A;  3GME A;  1Y39 A;  1MBH A;  2A5Y B;  3K0L A;  3DPL C;  2JK3 A;  1ITY A;  2XF7 A;  2LSO A;  1RI7 A;  1OFC X;  2EZI A;  2CYY A;  4CSW A;  3ABL H;  3VWB A;  1VZ0 A;  1BOB A;  5IYB J;  3KIO A;  3ZXS A;  4DBR A;  4UHT A;  1CF7 A;  1U2W A;  4RLQ A;  1LUJ B;  1I6X A;  3KP4 A;  1MBF A;  3RYP A;  1XGS A;  4A3F J;  2OUM A;  1C0W A;  5CQE A;  4LLL A;  2HOS A;  4JBA A;  4RMN A;  2M7B A;  1GV2 A;  2W4S A;  5FLX Z;  1TZL A;  4HQE A;  3H5A A;  4C2M J;  2DAO A;  3IAM 2;  3I58 A;  4I6Z A;  5H6R A;  1ZG3 A;  2Y9Z A;  5DCM B;  5LGU A;  2EA2 A;  2HYJ A;  3I56 I;  4BAC A;  1OIS A;  1P4W A;  5K5O A;  5A2Q K;  1A6Q A;  2L02 A;  2L3D A;  1ZQ3 P;  2QVO A;  4TV7 A;  1YS6 A;  2LDU A;  4RDU A;  4HV6 A;  2HGC A;  2DA1 A;  2H1K A;  2CMP A;  4ZC3 A;  2PMZ N;  3KZY A;  3OR2 C;  1SFX A;  2IGK A;  1R4N B;  4C3J J;  3FXO A;  2CFO A;  3DWL E;  2RVC A;  2VUM J;  3HOX J;  3QYB A;  1FWZ A;  4FQG A;  1FC3 A;  2NOJ B;  4N0B A;  3A01 B;  3A4C A;  3TED A;  3IAS 2;  3S2H J;  2K5C A;  3LSP A;  3KFW X;  3BR2 A;  2M0M A;  2XPU A;  1BL0 A;  1TNT A;  3KYD B;  4F92 B;  2FX0 A;  3BQZ A;  4AVP A;  3BR5 A;  5LHI A;  3P9I A;  3IUO A;  3ZMT A;  2H6B A;  2B63 J;  1E0E A;  4XSZ F;  2ESN A;  2DW4 A;  3ABU A;  3VEP A;  2VBZ A;  1HQC A;  1R36 A;  4M9X A;  3TOA A;  3CTA A;  1UHS A;  4NC8 A;  1OLT A;  2XAG A;  2DI3 A;  1A36 A;  2P5K A;  3LAP A;  3M1E A;  1UJ8 A;  3SXY A;  4OIN F;  5FKO A;  3OIQ A;  4EMS A;  4CYC B;  2CUZ A;  2IA2 A;  3JRB A;  2HXO A;  2R7U A;  3DEU A;  2ISY A;  2ICW G;  2NXN B;  2VQG A;  2M87 A;  3G73 A;  3BZC A;  3E6D A;  4DBQ A;  3SZP A;  2P81 A;  1XCB A;  3S3N A;  2OTL I;  3GTQ J;  1YW9 A;  1WHU A;  3HKZ N;  1M1E B;  2WC2 A;  3S17 J;  2XGX A;  2IVM A;  3M1C A;  2TDX A;  2Z16 A;  4BUP A;  2VE9 A;  2VJJ A;  4M3D A;  3PO2 J;  4OIP F;  1PVE A;  4XLC A;  4BJT A;  3CUQ B;  1IN4 A;  3JAM K;  2CU7 A;  3AG4 H;  3IKV A;  5C3E J;  2ID3 A;  1YJ9 I;  2CG4 A;  3TW7 A;  4N9H A;  3P9C A;  1SEU A;  4IHW A;  3SEQ A;  1U0J A;  5GTI C;  3QYF A;  1TT5 B;  3ABK H;  1VTN C;  4XSX F;  4XRS G;  2QKM B;  2CSO A;  3KEO A;  5E18 F;  3CCJ I;  3WHC A;  4EGZ A;  4RB1 A;  3CDH A;  1REP C;  1YJW I;  3L00 A;  3HXL A;  4EEF G;  3IHU A;  1O3S A;  3KP2 A;  3VSK A;  2F5C A;  5F08 A;  1FSH A;  4CCM A;  1U5T B;  3I3L A;  1G6N A;  1E3P A;  3FWE A;  4XON A;  5GP9 A;  5E3M A;  1B8I B;  4M3F A;  3TGN A;  3BTI A;  4X6A J;  4U0W A;  4G8X A;  1XC5 A;  2BW3 A;  2MC3 A;  3PO3 J;  1BI1 A;  1HXD A;  2HI3 A;  2E1O A;  2GIV A;  2OAZ A;  3EDP A;  5E79 C;  4Y7N J;  1E3O C;  1R22 A;  3DF8 A;  2CV2 A;  1ZLJ A;  1Y0U A;  3MD2 A;  4HNT A;  1FEX A;  4HV5 A;  4C9Y A;  1FSE A;  1D0Y A;  3DTI A;  1ZLK A;  2JRT A;  5DEQ A;  4UY8 I;  3E5X A;  3HBL A;  3HTS B;  5ICE A;  1R1T A;  2IS4 A;  2EK5 A;  3FZV A;  1K79 A;  4L0Y B;  3GFM A;  5J1R A;  4LLG F;  1ZTR A;  3PSF A;  5B1A H;  3OYB A;  4RAZ A;  2O6G E;  3OYK A;  2KRC A;  1KU3 A;  3AG1 H;  4KMU X;  4ZYE A;  1QHG A;  2HOT A;  1LVK A;  2QZ8 A;  2XPW A;  2E1M C;  3DKW A;  3CMM A;  4YII A;  4KT6 A;  4L18 B;  3K2A A;  3WGH A;  4DIQ A;  4R1H A;  3FXQ A;  2OV7 A;  1U6G A;  2PJP A;  3U21 A;  2PJR B;  2MBF A;  3ZP5 A;  2DFH A;  1VQL I;  3MZY A;  1JHH A;  1WI3 A;  4HOB A;  3TQN A;  5D8K B;  2NNN A;  2RV8 A;  1X1C A;  4WWC A;  2H8W A;  3FXJ A;  2R0Q C;  1IRG A;  4G6T B;  3BJA A;  1QBJ A;  2CGP A;  3DV8 A;  3ABT A;  2VOD A;  4OAZ A;  1KQ9 A;  3DP7 A;  5EF6 A;  3M4O J;  2EZL A;  3LFU A;  4ENM A;  4YFN F;  1Y8R B;  2DTR A;  4D7M A;  4U0V A;  4P9F A;  1VQK I;  3VYS B;  4BU2 A;  1B72 B;  2L54 A;  1SFK A;  1MJB A;  4ON0 A;  1OYI A;  5E8G A;  3QPH A;  3VFZ A;  1VQ9 I;  3F21 A;  3JW4 A;  3H3Z A;  2PMU A;  3O6B B;  4A0Z A;  1RUO A;  1IRF A;  1HST A;  3DU6 A;  4YRV A;  1B6A A;  1O7L A;  3E6C C;  2ELH A;  1PDN C;  3PUF A;  4XN3 A;  4DYQ A;  2STW A;  2V6C A;  3A03 A;  1LQ1 A;  3WTV C;  1Z3X A;  1FOK A;  3BR1 A;  3ZR8 X;  3AG3 H;  3K6G A;  4JYK A;  3K4N A;  3DLA A;  2QQ8 A;  2FUG 2;  2BV6 A;  1X1P A;  3I54 A;  3IH3 A;  1MDM B;  4PZJ A;  3L2U A;  3JRC A;  1S8N A;  3M3Y J;  2JA7 J;  1XSV A;  1MJ9 A;  1FOW A;  2DA6 A;  1QZY A;  3WE2 A;  3W2W A;  1K83 J;  2HVR A;  1XX5 A;  3HEF A;  4CDG A;  1BR4 A;  4PCQ A;  1WCM J;  2GXG A;  2DA7 A;  5FD5 A;  2BE5 F;  1MBK A;  2FBH A;  4XK4 A;  2ZKZ A;  3BJ6 A;  3HIF A;  1WJA A;  2AQE A;  3IH4 A;  4LG0 B;  4HA8 A;  4AIH A;  4CYD A;  4DNC A;  4CUG A;  1K4T A;  3HZJ A;  3S32 A;  1IRX A;  3BR0 A;  3H5N A;  1RES A;  4M3G A;  1ONV A;  4DYC A;  2VKV A;  3T8R A;  2VQC A;  4WXC A;  4C2U A;  3ECH A;  5IT3 A;  2DJI A;  2EIK H;  4HSR A;  4XN0 A;  2L7M P;  2OZU A;  3K69 A;  1U78 A;  1IJW C;  3EQL F;  2XDV A;  1QVT A;  1YG2 A;  4ENN A;  3VDX A;  2IW5 A;  4M73 A;  3F22 A;  4ANJ A;  2M34 A;  2MC4 A;  3GO5 A;  4D9J A;  3ZQ7 A;  3ZMV A;  3RKY A;  1B1B A;  1X58 A;  3C2B A;  4AID A;  3EUH A;  2VOO A;  2AHQ A;  4C30 A;  1ZGW A;  2WY8 Q;  1F9N A;  3R0J A;  2WAQ N;  4XOR A;  3UR3 C;  1OQY A;  5KNL A;  4ZTJ A;  1BW5 A;  3TP0 A;  2NAZ A;  4ZDL A;  2COB A;  1ZGA A;  3CC2 I;  1P9Q C;  3K70 C;  4KMF A;  1W36 C;  5KCM A;  3OSF A;  3J80 K;  3U1K A;  4B09 A;  4XRF A;  1FIA A;  5JR3 A;  1UEL B;  1FOX A;  1NHA A;  2MW8 A;  4E7I A;  1DGR M;  1F36 A;  4G7O F;  3OL4 A;  2M2E A;  2F48 A;  4MQ9 F;  2FA5 A;  2EQR A;  4P1W A;  5HS9 A;  2H1L A;  1LB2 A;  3PFI A;  5FKM A;  2LVS A;  4LIU A;  2OTJ I;  4DW6 A;  3SDG A;  2A5W A;  1J09 A;  4GYI A;  3CCL I;  3JRA A;  2VJI A;  2HDD A;  1ZHF A;  2LMD A;  2NOG A;  3DXJ F;  4L9V A;  3ZQQ A;  1FBQ A;  2FD5 A;  5DCF A;  1WKM A;  2X1C A;  3CCS I;  4UUS A;  4A3M J;  1FP2 A;  3AL0 C;  1G59 A;  3CP8 A;  1MIJ A;  3V7C A;  1FMW A;  4R8H A;  2R3S A;  1R7J A;  4J19 A;  2IXS A;  3OV8 A;  4IRI A;  1QRY A;  1TWC J;  1XB4 A;  2EPF A;  2HYF A;  2XUB A;  1ETV A;  3LNQ A;  4IVN A;  1E2X A;  5M5Y J;  5ILV A;  3H0G J;  3F6V A;  1QU3 A;  1S9H A;  2A6E F;  1WZ2 A;  2PFB A;  3BTC A;  4BJ5 C;  2E35 A;  1XGO A;  2DA4 A;  2VKH A;  4B44 A;  5H20 A;  3SDB A;  4KFC A;  4HLY A;  5L3E A;  3EET A;  5E1Z B;  2V1N A;  1F1Z A;  3FF5 A;  2HKX A;  3CO6 C;  4XQF A;  3GEZ A;  2MSY A;  2PEX A;  3HM5 A;  1IN8 A;  2V4J C;  2X0L A;  3FMS A;  3OR1 C;  4F91 B;  1JHF A;  5DYM A;  5DM7 F;  4M3B A;  4LG3 A;  1KGS A;  3IC7 A;  1EH8 A;  2YS9 A;  4FX0 A;  3OYC A;  4BAY A;  3V7R A;  3WU1 B;  4CO8 A;  2DOA A;  2JA5 J;  5DUI A;  5IYC J;  3KP6 A;  1IO2 A;  4BXF A;  3OS0 A;  4RBO A;  4C3H J;  1BA5 A;  3E6B A;  2QQB A;  2NVY J;  4CZC A;  1HCR A;  5TGT A;  3FMR A;  3A0B C;  1CGP A;  2MA3 A;  3D5L A;  2VPR A;  3K9T A;  1IC8 A;  2M9H A;  2Z5U A;  3GZN B;  4PFO A;  1E3H A;  3V8J A;  5EG0 B;  1O4X A;  2KLO A;  3CO7 C;  2TRT A;  2R5Y A;  4XNF A;  5E3L A;  1U8B A;  5HLG A;  3GZ5 A;  4CHU A;  3OYM A;  4L9T A;  3ZQG A;  2HEO A;  2RQQ A;  5EGO B;  1OYW A;  3HSR A;  1T98 A;  1YO5 C;  1DDN A;  2IT0 A;  2DU9 A;  3V7S A;  2P0W A;  3MKY B;  3V8K A;  2ZJR F;  5C4J J;  4S0H B;  4PUS A;  3BC8 A;  5AIQ A;  1SAU A;  4YFX F;  5E3N A;  3W6J B;  1QNT A;  2ZXJ A;  3BG3 A;  3FXR A;  2IS1 A;  2EIM H;  5EZG A;  1ETK A;  2FF4 A;  3KEQ A;  1F4K A;  2CQX A;  2RGV A;  3WHB A;  5DM6 F;  2D2W A;  3AFH A;  1ZYR F;  2E1M B;  1QA6 A;  2QGU A;  4M9Z A;  2XRO A;  1YFH A;  4M72 A;  2VJ5 A;  5ICC A;  1SFE A;  3D5R C;  1D5Y A;  4B3A A;  2ECB A;  4CCJ A;  3DEE A;  3FK7 A;  4XBF A;  4S05 A;  1X19 A;  4BNC A;  3FM3 A;  1SVM A;  5DD8 A;  1BOA A;  2D1V A;  3CCY A;  3M8F A;  3IL2 A;  1R49 A;  2DQL A;  4HX8 A;  2NS7 A;  1JGS A;  1NG6 A;  5F04 A;  5F6F A;  4Y33 A;  1GT0 C;  1MND A;  2NRA C;  1FZP B;  2BZT A;  2MG4 A;  4M74 A;  3E0J B;  5IT9 Z;  1G2H A;  3K4J A;  3ZQI A;  1ULY A;  1KYW A;  2CV1 A;  1K78 B;  5L3C A;  2LP0 A;  4AD9 A;  5J8F A;  3WU2 C;  1XMK A;  5HDN A;  5D6F A;  4BQA A;  2DDB A;  1SFO J;  1TW3 A;  3K1P A;  4V2F A;  2YPR A;  4AUX A;  4ZZL A;  3NWT A;  1OR7 A;  5LGN A;  4IEJ A;  4G6D A;  2STT A;  4CCO A;  5B5E C;  4BDY A;  2R7Q A;  1GXP A;  3J7A O;  2O5R A;  4EJU A;  2VAS A;  5D4S A;  1LE8 A;  2K9Q A;  3DBH B;  2W00 A;  1SVL A;  2QEN A;  2AO9 A;  1YX3 A;  2DOD A;  3QOE A;  4IRG A;  4ZDO A;  4YIR X;  3ZGK A;  2NNY A;  2R4G A;  5CPR B;  2XAJ A;  4EM2 A;  2EIJ H;  3NRV A;  2LY1 A;  1S5L C;  2CJJ A;  2HWV A;  3P5J A;  1A35 A;  2GXB A;  2WWY A;  2VKD A;  3QPL A;  4KIG A;  5DD4 A;  2O8K A;  3IP4 B;  5E20 A;  2HQR A;  3KYC B;  3E5U A;  3HRM A;  2L9S A;  4GO1 A;  1G4D A;  2FJ1 A;  3B02 A;  2L9R A;  4I99 C;  4KDP A;  1FT9 A;  1SD5 A;  3LSG A;  5FKL A;  2XB5 A;  1MW7 A;  1BC7 C;  4HNV A;  2AXT C;  2ELK A;  3ZN1 A;  4FET A;  3WTU C;  2RKH A;  4IQJ A;  2FEZ A;  4IOA F;  5CQG A;  3ISP A;  1KA8 A;  2FSW A;  5GAG J;  2DT6 A;  4FTH A;  2O61 A;  3HG9 A;  1TNS A;  1WI9 A;  3FXU A;  2K9M A;  3ASN H;  3TDU C;  4A69 C;  2PQ8 A;  4IZZ A;  1BC8 C;  2RC4 A;  1XCV A;  2HQN A;  2ZJ2 A;  5LRS A;  1ZN2 A;  3JR9 A;  6PAX A;  4B8X A;  2W85 A;  1WFX A;  1P92 A;  2GZW A;  2CW7 A;  3LSI A;  2MD0 A;  2LLK A;  2EWN A;  2KIF A;  2JZY A;  2ZFU A;  4ZDP A;  1EF4 A;  2VI6 A;  4KT5 C;  5HS8 A;  1GHC A;  2ZSI B;  2GA1 A;  2V1D A;  4KUM A;  1T95 A;  5DCM A;  4BE1 A;  2XV4 S;  2BGC A;  1XDS A;  2GXA A;  5FJ8 J;  1HKT A;  3M07 A;  2EBI A;  2XAQ A;  5IOY A;  1PUF A;  1VQ8 I;  1Z0X A;  3GTG J;  3I59 A;  1VF9 A;  4K2E A;  2IS2 A;  1LEB A;  1YE9 A;  3CMY A;  5J4V A;  3TDZ C;  2K7L A;  1YRN B;  3AG2 H;  1HF0 A;  3KZZ A;  5M3M J;  3CC4 I;  3W2A A;  4AWX B;  1MBE A;  2XC7 A;  4QWQ A;  2PBI A;  1FX7 A;  3QPS A;  1ON2 A;  1Z67 A;  2VXZ A;  3S1M J;  2F2E A;  4PGH A;  3CCU I;  2LFB A;  5BS6 A;  2PN6 A;  3WTS C;  4OIO F;  2DFI A;  2XKO A;  4FCY A;  2D1H A;  3WG7 H;  3MFK A;  5FKN A;  3JRH A;  4DJA A;  4N4N B;  1TWA J;  4XLH A;  3I4N J;  5B3S H;  1RZ4 A;  3S2D J;  1SD7 A;  1UB9 A;  1TWG J;  2JTV A;  4YEL A;  2RNG A;  1O57 A;  3K2Z A;  3GUD A;  2XKP A;  3CD6 I;  3GLX A;  3MMY B;  3FM5 A;  3TO7 A;  5FLX K;  3AL0 B;  1FY7 A;  2LKS A;  3NEU A;  3U9G A;  5L3B A;  1LDD A;  3HSE A;  3HOV J;  4X0G A;  2F4I A;  2A61 A;  2KMU A;  4KN7 X;  2BXZ A;  4HDV A;  1ZRD A;  3BPX A;  3TL4 X;  2XF5 A;  3N05 A;  2GQQ A;  2EZH A;  2LTP A;  3DKX A;  2MH2 A;  4M6V A;  5KAI C;  2HYG D;  1YIJ I;  4LJZ F;  1VQN I;  4F7Z A;  3LWF A;  3S93 A;  4A5M A;  4RGS A;  5FD6 A;  2GOX B;  3L1P A;  1RIO H;  2EV5 A;  4RAY A;  2ME6 A;  3QOD A;  4IX7 A;  5LD2 C;  4D1Q A;  2A05 A;  2ZXW H;  4E7S A;  4G7H F;  4HRI A;  3QP5 A;  4I0B A;  2KJC A;  2IEK A;  4ZYH A;  3PJR A;  4OAY A;  5L3F A;  3FKJ A;  1DPU A;  3DPT A;  4HF0 A;  3ZQC A;  2KJB A;  1I5Z A;  4Y17 A;  1FYL A;  1IG7 A;  2LR8 A;  1JTY A;  3PIO F;  1FTZ A;  2UWM A;  4RAF A;  3K7A J;  1X3W B;  1S29 A;  3SFZ A;  2X9D A;  3A0H C;  3C1D A;  4NNJ A;  2Q2E A;  1B8I A;  5E17 F;  2VKE A;  2IPQ X;  3OS1 A;  2KIS A;  2JPC A;  2RDP A;  3U1D A;  2KRF A;  3H36 A;  1TBX A;  3IRQ A;  2VXD A;  2WV1 A;  1IZ1 A;  2W84 A;  5D6E A;  3H1C A;  2CWE A;  2RQP A;  2R5Z A;  1W5T A;  1W7P B;  3CF2 A;  5BNG A;  1JT0 A;  1WSU A;  3BCA A;  1P6R A;  3HHG A;  3M7G A;  2LD5 A;  3K4B A;  4Q47 A;  5FFX A;  5M5W J;  1AOY A;  4E6K G;  3ZMS A;  1YIT I;  1EJ9 A;  3IV5 A;  2M7A A;  4LGW A;  3KLN A;  1BIB A;  5C4X J;  3S2W A;  5GPA A;  3FHZ A;  2P7C B;  4L0Z B;  2CUJ A;  1FJL A;  4HG2 A;  4UV8 A;  3K4L A;  2DA5 A;  1FYK A;  5HVQ C;  4RM2 A;  4II2 A;  1OCZ H;  4V19 K;  4L5J A;  2HPI A;  2QSF X;  5HLH A;  2QM3 A;  1S7A A;  5JVG F;  1R1V A;  3OYH A;  1T0F A;  2W57 A;  3LOC A;  2NYX A;  3ERM A;  3LSJ A;  2ISZ A;  2DN0 A;  2G7U A;  2FMY A;  2P5L C;  4WF2 A;  1SC7 A;  1V4R A;  1MD0 A;  2CQ7 A;  2Y0S A;  1HKS A;  4ASN A;  2L7K A;  4A3C J;  1H89 C;  5F27 A;  4A2U A;  4NBQ A;  1LJ9 A;  2JVG A;  3BTJ A;  4XLE A;  1WJB A;  5CVV A;  3AKZ A;  3HOS A;  3QU3 A;  5JI6 A;  3QAH A;  2LBF A;  2E2I J;  2B0L A;  2R7Z J;  1K4S A;  3RZD J;  4IHX A;  2ZME A;  5M5X J;  1TP4 A;  4DZP A;  4IJA A;  5IP7 J;  1T8I A;  5J6X A;  1F43 A;  3SQN A;  1KON A;  2O8X A;  2XAS A;  3L9F A;  5GTH C;  5LFA A;  1IUY A;  1GVJ A;  1WVR A;  4IHT A;  1ZK8 A;  4IHV A;  1Z6T A;  2V6E A;  1OCO H;  3GFJ A;  2VBX A;  4ETS A;  4WK8 F;  4PSX A;  3ERE D;  3ZMZ A;  4FIS A;  1FPQ A;  3EUH C;  4CCK A;  4EJW A;  3A1Y A;  3UKG A;  2A6H F;  2MLK A;  2CV0 A;  5IOZ A;  3S15 J;  3O2P E;  3ELK A;  3WG9 A;  3G71 I;  2DLL A;  2LYC A;  3OOP A;  4RS8 A;  2R7D A;  3ZQL A;  2QA4 I;  2J5P A;  1S7O A;  3DEW A;  4E7H A;  3RSN A;  1N75 A;  2V9P A;  5KK1 A;  3WTY C;  3HTU A;  2EB7 A;  2I5U A;  3KE2 A;  4XMY A;  2DK8 A;  4JX5 A;  2K9L A;  1I1G A;  2K40 A;  1ZRC A;  1BBY A;  1AHD P;  3OY9 A;  1KU7 A;  3PQJ A;  3RPU A;  2VLA A;  1MZB A;  1VQM I;  2H8R A;  4OIR F;  2DXI A;  2DTZ A;  3ZMD A;  3H9G A;  4LIT A;  5F0H A;  2EFP A;  1KQ8 A;  2JA6 J;  2D45 A;  2N8G A;  5EEA A;  4BS9 A;  1P4X A;  3M8E A;  4IO9 F;  1Z7L A;  1N78 A;  3H92 A;  1ODD A;  4BHP A;  1WPK A;  2DYR H;  4MO7 A;  3BCB A;  3TW6 A;  3H3U A;  3K70 D;  1J59 A;  1NH3 A;  1W36 D;  4LG0 A;  3KEY A;  1LNW A;  2R7O A;  2BY2 A;  3H35 A;  2MAB A;  3ZPL A;  3C7J A;  4XLF A;  4ABZ A;  2KPM A;  3IH2 A;  2IJL A;  4DZJ A;  2DPU A;  4LB6 B;  3G4S I;  3F8N A;  2H6C A;  3J7A Y;  1J2X A;  5GPC A;  1RUN A;  1EA3 A;  3G1O A;  4RAG A;  3GTM J;  2Q8K A;  3PNY A;  5J1Y A;  1YW7 A;  2CO5 A;  2HVS A;  3BPV A;  4XOP A;  4F52 A;  3GVA A;  2ZXI A;  4Y4R A;  4JQF A;  2FML A;  3LA2 A;  3G6E I;  4WXH A;  2K4J A;  3CES A;  1R1U A;  4KYW A;  3LA3 A;  3OL3 A;  3CF5 F;  5IYD J;  3H9Q A;  3GZ6 A;  2Z33 A;  1I39 A;  1D8K A;  4E7J A;  3WU0 A;  4PSW A;  3HOY J;  1Z6R A;  2OC6 A;  4FE7 A;  2X6Y A;  1KZH A;  1VQ5 I;  4QTR A;  3DLL F;  2QEX I;  2JMW A;  3Q0U A;  2PI0 A;  2F5E A;  3MN2 A;  4AYB N;  3HL2 A;  3J7Y J;  1ERD A;  2ZJQ F;  2KL4 A;  2JSP A;  4H0E A;  1TLH B;  2EFO A;  2OQG A;  1IRZ A;  1Z3Y A;  5BOX A;  1BR1 A;  3MKL A;  2DQR A;  2DOE A;  3HSF A;  2BW3 B;  4Y13 A;  1VFC A;  4XL9 A;  4U0Y A;  2V9K A;  1CQT A;  1TW2 A;  3LMM A;  1BI2 A;  2L5Q A;  2KIM A;  2M45 A;  4HF2 A;  2FU4 A;  2EFN A;  2FOK A;  4BHB A;  2QLZ A;  5JVT A;  1MMG A;  1XPX A;  3C2H A;  1BR2 A;  2IA0 A;  2E2J J;  3KPH A;  2FXA A;  3CDI A;  3LSK A;  4ESF A;  2CUE A;  3JRI A;  4NQW A;  2KT0 A;  1J9I A;  4XOT A;  4BDZ A;  1Q1V A;  3KZI C;  4FX4 A;  3EPZ A;  2BXY A;  2ZBK A;  4MEX F;  5AON A;  1HSJ A;  1B4A A;  3RQ4 A;  3FX3 A;  2EIN H;  4J00 A;  1DU0 A;  4QSH A;  2BVM A;  4FT8 A;  4PFP A;  1VQ4 I;  1JGG A;  1IN6 A;  4YEJ A;  1B59 A;  4IKF A;  2L2O A;  2HQA A;  4KN4 X;  1W7P D;  2L01 A;  3I9V 2;  3GFI A;  3JTG A;  1UFM A;  4B1R A;  3ML6 A;  5E8I A;  1O7F A;  2LH9 A;  3E1S A;  3A2K A;  1DPR A;  2KKO A;  3Q0V A;  2KP6 A;  1VQP I;  1HLV A;  1TL8 A;  3ZQF A;  1T38 A;  3F8C A;  1WRJ A;  1I27 A;  2Q1Z B;  3NAU A;  2DJN A;  1EH7 A;  2P5V A;  2HS5 A;  3FIW A;  4LB5 A;  4MHG A;  2P7V B;  1SMT A;  1UCR A;  1V55 H;  4ITV A;  5LHG A;  3G1M A;  2XVC A;  3HOU J;  1GVD A;  3CZ6 A;  4HDU A;  4KA4 A;  4B47 A;  4O6J A;  1K7A A;  1YLF A;  3I4M J;  1T39 A;  1I50 J;  2MGQ A;  1JUP A;  1MGT A;  4D0P A;  1ZRF A;  3CJR B;  3FKI J;  2NVT J;  1UG2 A;  3KX2 A;  4YFK F;  1OR7 C;  1BIA A;  1ETY A;  2XGE A;  3TOB A;  3B6C A;  1IW7 F;  4FAS D;  3Q9S A;  2UXX A;  2GAU A;  4KIF A;  2ZXH A;  3GX4 X;  4G7Z F;  3K4C A;  3Q0W A;  4WCG A;  4RB3 C;  1R00 A;  2L9N A;  1W0T A;  1NK2 P;  2WB1 A;  3PSI A;  2ZNY A;  3S8P A;  1H9G A;  5BQT A;  3Q3S A;  1G3Y A;  4BBS J;  4D5F A;  3E5Q A;  2PX9 A;  1X3U A;  5BMZ A;  2JVH A;  4B43 A;  2HTJ A;  1YS7 A;  3SJM A;  4M6X A;  1S6L A;  4E7Z A;  4PJL A;  1X1A A;  3V4G A;  1UAA A;  2BOL A;  3L2C A;  4B4C A;  2M8E A;  5K7Z A;  2R7X A;  1V5E A;  2XAH A;  3OYD A;  4PJM A;  1Y6I A;  2IA1 A;  4LFU A;  5JLX A;  2M4G A;  3PUB A;  1R23 A;  3BG7 A;  2E5N A;  1GDT A;  2QCO A;  2HDW A;  3TMO A;  2XRL A;  3LQQ A;  4W1U A;  2EV6 A;  4BE2 A;  1H9T A;  5J3L A;  4RB0 A;  1OPC A;  1T33 A;  2HOE A;  2IGN A;  1Y56 A;  2VOP A;  3CQZ J;  1QPI A;  3KP5 A;  1ETO A;  2VN2 A;  3GYH X;  3GTK J;  3OYL A;  2YX4 A;  2MLG A;  5GAE J;  4XRM A;  1OKR A;  2H09 A;  4BEH A;  3MAJ A;  5JHU A;  1DU6 A;  1LFP A;  2VC1 A;  3PFY A;  4Y3O A;  3T1B A;  2A6T A;  4G9Y A;  2FBI A;  3CCQ I;  4OMY A;  3CUO A;  2WTE A;  4A0Y A;  4B48 A;  1AKH A;  2PG4 A;  4PDK A;  5B1B H;  5EZH A;  3CCM I;  2LRD A;  4HX4 A;  1HW5 A;  2K4B A;  1Z9C A;  1IAW A;  2JA2 A;  1OJL A;  2GWR A;  4UB6 C;  4Z2Y A;  5E3O A;  1J75 A;  3LA7 A;  2QWW A;  2FNP A;  2ADU A;  2UXN A;  5CVJ A;  1X1D A;  3TO9 A;  1E17 A;  1V3F A;  1BJA A;  2DA3 A;  2PMZ A;  3VYR B;  3W6K B;  5HNF A;  1IV8 A;  4M9S A;  5GAH J;  3JRD A;  3H3V K;  1MKM A;  4C3I J;  3ABM H;  2HDC A;  2EZK A;  2G7H A;  4MGR A;  3R0A A;  3NWS A;  1N77 A;  1ZAO A;  2R7V A;  4IXA A;  1FTT A;  3BR3 A;  2O3F A;  1P4A A;  2QYO A;  2ETH A;  2ZB9 A;  2CRG A;  3HHH A;  2DDA A;  1BI3 A;  4GRI A;  4I09 A;  4ESJ A;  4RB2 C;  4IHS A;  3HB9 A;  4GXO A;  2BHZ A;  2HVQ A;  3MVP A;  1HKQ A;  3PNT A;  4I01 A;  5CVR A;  4UUS B;  3BZK A;  4N4O B;  2EJR A;  4A6D A;  3B6A A;  5IT9 K;  3OYN A;  1YHQ I;  2CFX A;  4Z6Y A;  2VPL A;  5M3F J;  4EQQ A;  1Z7U A;  5LEK A;  5F1J A;  3FMQ A;  3HUG B;  3M8J A;  2JQ7 A;  1O3R A;  5ILU A;  3LSM A;  2E7X A;  3LST A;  1G3W A;  3OYE A;  1D1A A;  1USS A;  4IQ4 A;  1FBS A;  3HKZ A;  1BW6 A;  1GV5 A;  3V8L A;  2WV0 A;  2XSD C;  2DMU A;  1Z91 A;  3X2Q H;  2G9W A;  4NC6 A;  2CH0 A;  5E1W A;  4DGW B;  5K5R A;  4LK1 F;  3L2Q A;  1B9M A;  2CW0 F;  1XGM A;  3H5R A;  5KVR A;  2ME0 A;  3H0D A;  5ICF A;  3CC7 I;  3OS2 A;  4C2T A;  2VQL A;  4BQN A;  2B9S A;  3HRT A;  5H6Q A;  5HLI A;  1HBX G;  3FHN A;  1UZC A;  1ZAR A;  4I02 A;  4MIM A;  1RET A;  4I98 B;  2ZC2 A;  3ESW B;  2W25 A;  1BI0 A;  4F55 A;  4BY1 J;  5J1U A;  1STZ A;  1U9O A;  3I4P A;  1Z77 A;  3CJQ B;  2WY7 Q;  4JX6 A;  1ZG5 A;  4BXX J;  2Y2Z A;  1QVU A;  2OD5 A;  4X1E A;  3RJP A;  2E7W A;  3OSG A;  2CUF A;  2R5Y B;  1GUU A;  5ED4 A;  2HQ5 A;  2F5F A;  1OMI A;  2OQR A;  4MTD A;  2RAE A;  2VON A;  2Q0O A;  4NDL A;  2VJ4 A;  1Y1W J;  3E97 A;  5HLT A;  2XAF A;  4S04 A;  3BLY A;  4KIC A;  1QZE A;  3S16 J;  2JA8 J;  4BYY A;  3F72 A;  3EUA A;  2LF8 A;  1R71 A;  5D8L B;  3WTZ A;  5FO5 A;  1DQU A;  2I10 A;  2G0E A;  2GLO A;  1P2F A;  1SAX A;  2A3S A;  3ZRG A;  4QIW N;  2NS0 A;  3OYF A;  2PLY A;  1T0F C;  2JRM A;  4WXD A;  3J81 Z;  3QU6 A;  1T6S A;  5BPI A;  4EGY A;  2ZJP F;  4I76 A;  1D1C A;  4UVB A;  5FKK A;  3R6S A;  2Y30 A;  4LMY A;  4UUV A;  2DT7 B;  1B9N A;  5TRD A;  1W0U A;  5HNH A;  2DO7 A;  3DKY A;  3DFG A;  3R61 A;  1MMA A;  3T8T A;  3C2G A;  4ENK A;  2ZME C;  2QBY B;  1T56 A;  2YU3 A;  4UB8 C;  2XRN A;  2DA2 A;  2Y75 A;  2Y0M A;  2Z3Y A;  2O0Y A;  4JX4 A;  2IGO A;  3FXM A;  3BQY A;  1Y1V J;  3KCC A;  3I5U A;  2DPD A;  5LLQ A;  3A01 A;  2OCE A;  4Q48 A;  1MH3 A;  1WH7 A;  1YIO A;  3EYY A;  3LFK A;  4PK4 A;  5ILS A;  4GYG A;  5LRR A;  3HRU A;  1K6Y A;  1ZGJ A;  2HR3 A;  3N97 A;  3BG6 A;  2HZD A;  1LE8 B;  2E71 A;  2XHK A;  4IF4 A;  2LY2 A;  2V79 A;  1DP3 A;  4OIQ F;  5JFR A;  1IXR C;  2QF7 A;  2VQH A;  4XKV A;  2DK5 A;  3VYU B;  4HAM A;  2MD5 A;  2P6T A;  3BTL A;  4HX7 A;  1JKQ C;  1XDU A;  1HW2 A;  4YG2 F;  3BT9 A;  3B73 A;  2Y69 H;  4CYC A;  3SZG A;  4Y52 J;  2BY1 A;  5F1R A;  3GXO A;  1FMV A;  3BG5 A;  1ORK A;  3PQK A;  4D7N A;  1JT6 A;  1WH5 A;  1XS9 A;  1V54 H;  2E5Z A;  3BP8 A;  1ETW A;  4DOZ A;  2NVU B;  2Z9O A;  1UG0 A;  3SFI A;  1IN5 A;  2HZT A;  2K86 A;  2NVQ J;  1DP7 P;  2HFH A;  3ZQH A;  2K85 A;  1SMY F;  2W7N A;  4OWR B;  4OMZ A;  2L9V A;  4N9I A;  1JI8 A;  3DBL B;  2OZ6 A;  4UVA A;  3HPH A;  3CUQ A;  2EV0 A;  2FNA A;  1JKO C;  1MMN A;  3O3K A;  4U88 A;  4BBR J;  2MH9 A;  1KQ0 A;  5ERI A;  3A02 A;  1SFU A;  5FLV A;  4WX9 A;  3F8F A;  4A3D J;  4XM3 A;  2FRH A;  3ONQ A;  2E60 A;  2EIL H;  2JPB A;  3BDD A;  1JUM A;  1RNL A;  4RGU A;  4BXU A;  4I7H A;  2DMT A;  5J47 A;  4RM3 A;  2KFD A;  5GAD J;  2KRH A;  4A3K J;  4HYE A;  2X48 A;  4P96 A;  1U5T A;  1XG1 A;  5AIP A;  3OIP A;  1JXS A;  3D1N I;  2O7O A;  2LNB A;  3HJE A;  3QRF F;  3GLL A;  1PUF B;  2RNJ A;  2NVX J;  3HRS A;  2L0K A;  5HDG A;  4ZYG A;  3CMA I;  3I59 B;  4BE0 A;  2DYS H;  4E7L A;  3LAJ A;  3RZO J;  2BY0 A;  4UXN A;  2IAI A;  2GBY A;  4P55 A;  4HF1 A;  3BG9 A;  5TJJ A;  2WAQ A;  3MZH A;  1J7K A;  2M1B A;  5A2Q Z;  4A3L J;  3VOD A;  2R7R A;  2FBK A;  4ZH4 F;  2ZFW A;  3Q9V A;  3ZCO A;  4U7D A;  1TWF J;  2CS3 A;  1MH4 A;  2UUZ A;  4XKC A;  4NUB A;  1ACI A;  1IXC A;  3JSO A;  2DCE A;  3CJN A;  2LK2 A;  2OJE D;  5EEH A;  1FOY A;  1ZRE A;  1G3S A;  2HOA A;  4A93 J;  5E1X A;  5CKT A;  2P4W A;  5CVU A;  5HOO A;  1RR8 C;  4A6E A;  4U87 A;  2M5W A;  3HGY A;  3VPR A;  4GDF A;  2ZCW A;  3BWG A;  1IUF A;  3F6O A;  1L0O C;  1MBG A;  3F8M A;  5K1Y A;  1CF7 B;  1JE8 A;  4V2G A;  1J5Y A;  2OBP A;  3SHF A;  4R79 A;  4NC7 A;  1LDJ A;  1VQ7 I;  1HC8 A;  3F0C A;  3WTT C;  3IRR A;  4ZJZ A;  4E4H A;  5K5Q A;  3FBN B;  1N25 A;  2LG4 A;  3HOT A;  1PJR A;  4AVZ A;  1HA8 A;  3OYJ A;  2AQF A;  2QUF A;  2PJR A;  2Z2S B;  1IXS B;  2XPV A;  1LVA A;  4UV9 A;  1GLN A;  1T08 B;  2ECC A;  5KHD A;  2ELJ A;  2IBD A;  2KIQ A;  1NG7 A;  2E19 A;  2VT3 A;  1UHM A;  2DMP A;  1JKR C;  2JT1 A;  4UUT A;  1TQI A;  2BBY A;  3MEX A;  5K7F A;  4CZZ A;  1B72 A;  2KDO A;  3E6M A;  2CW8 A;  3KP7 A;  3V42 A;  3ZMU A;  3SZT A;  4HEA 2;  1WWX A;  4MFD A;  2XSJ C;  2QSG X;  2VL8 A;  1H0M A;  5HDK A;  4G94 A;  1TQP A;  2F4M B;  2HU9 A;  1R4M B;  2F4O B;  3S1Q J;  5C44 J;  2R92 J;  3EYI A;  1VQO I;  2KQR A;  1XSX A;  3JAM Z;  4L9J A;  1XN7 A;  2EH3 A;  3GTP J;  4A3E J;  2X6O A;  5DUK A;  4D5C A;  4KIB A;  1FIP A;  1D8J A;  2Q2E B;  5K7H A;  2HKO A;  1MDM A;  2F6C A;  4HQM A;  3COA C;  1QZZ A;  3S14 J;  1IN7 A;  4OU0 A;  1Y8Q B;  3DU5 A;  3G1L A;  1MMD A;  4GCV A;  4P9U A;  4BGD A;  5D5V B;  2R5Z B;  3OOU A;  3CME I;  2LC2 A;  3O8H A;  4F93 B;  2X6W A;  1OCC H;  2LY9 A;  1EKE A;  4MFE A;  1WJE A;  2X1E A;  5B66 C;  1G8X A;  2AS5 F;  1I6H J;  2COM A;  2ESH A;  3JRE A;  1FP1 D;  2LF7 A;  3DPU A;  4H4K C;  3BRO A;  1F5T A;  2WAF A;  4DYR A;  1POG A;  1S72 I;  3K1N A;  5LHH A;  3AAF A;  1R5G A;  2VBY A;  4NHJ A;  3CLO A;  4A3B J;  4ESB A;  4EAT A;  3PIP F;  2EA4 A;  3W6V A;  4XLA A;  1JJ6 C;  2M4K A;  4EVI A;  1Z21 A;  1D0Z A;  3TP3 A;  2DT5 A;  1U9N A;  3ECO A;  3R4K A;  2QSH X;  3Q5F A;  2XGD A;  3ASO H;  4CXF A;  4ZTF A;  5JHF A;  4IOC F;  2EFQ A;  3VOE A;  3I55 I;  1X4O A;  1MSE C;  3I64 A;  2ZO4 A;  3RDI A;  3FXL A;  2LBF B;  3QYE A;  2ZME B;  5EYR A;  1BJZ A;  1WJD A;  4IPA A;  4E7K A;  2Y9Y A;  4FE4 A;  1TT0 A;  2W82 A;  3TO6 A;  2GOM A;  2XAU A;  3SYT A;  2VE8 A;  2UZK A;  1OYY A;  2BYV E;  2GIZ A;  2LKX A;  3GTO J;  1ETQ A;  3I53 A;  4XLN F;  2ID6 A;  3QWL A;  3WOD F;  4J01 A;  4A3G J;  1QGP A;  1V5G A;  4LK0 F;  4XID A;  3G2B A;  3BZ6 A;  2WA0 A;  2XGC A;  1ZR2 A;  4BQQ A;  4RGX A;  2IS6 A;  1ZH5 A;  1H88 C;  2L7Z A;  4CH7 A;  4JOM A;  3U2R A;  1WJ5 A;  2AXL A;  3JRF A;  1X3Z B;  4A5N A;  3WTW C;  2K3P A;  3G3Z A;  2LRE A;  4EJO A;  1YW8 A;  1PP8 F;  4M6Y A;  5DV5 A;  1DUX C;  4UVC A;  2A68 F;  2A07 F;  1WJF A;  1MBJ A;  1V5F A;  1X1B A;  5J40 A;  2R7F A;  1HW1 A;  1D0X A;  3S1N J;  1Z05 A;  4RGR A;  5DS9 A;  3LL7 A;  1Z1D A;  2R7W A;  3D5S C;  1O3T A;  3CDL A;  4KIT B;  2V1X A;  1XD7 A;  1XMA A;  2YR2 A;  1U3E M;  2MYS A;  3GTL J;  1YOV B;  4QPQ A;  1SD4 A;  2M3A A;  3KET A;  2JUG A;  1R6R A;  1YTY A;  5TIS C;  5F64 A;  3RTR A;  3L2W A;  4FHT A;  2BVL A;  4ZYA A;  4HZF A;  1K61 A;  1QQI A;  4RA2 A;  1PUE E;  2LOO A;  2ACJ A;  3DTK A;  2E36 A;  2DMQ A;  2V26 A;  3C18 A;  1RRJ A;  2CQN A;  2WAE A;  1O3Q A;  2V7F A;  3GF2 A;  2DOF A;  4M71 A;  2OU2 A;  1JJ8 C;  1X2M A;  4BQO A;  4EJV A;  3DCF A;  3MKW B;  1RKT A;  2OCC H;  1IV6 A;  1P7I A;  2IP2 A;  3OWT A;  2X4H A;  2C6Y A;  4MEY F;  1JTX A;  3KP3 A;  3TBI A;  1VND A;  3MWM A;  5IP9 J;  3CP2 A;  2PMH A;  1LDK B;  2K9N A;  3QQA A;  3MZ8 A;  3RKX A;  5LEJ A;  3F23 A;  3H9J A;  4XR6 A;  1R58 A;  2E34 A;  2JSC A;  4IL6 C;  4EM0 B;  3JRG A;  3IWZ A;  1WJC A;  3BY6 A;  3OYA A;  1RKW A;  1OCP A;  3E3V A;  4M3E A;  1KU2 A;  3PNV A;  2XB0 X;  4HST A;  2VB6 A;  2W48 A;  5FGM A;  1BM9 A;  5BPD A;  5EG0 A;  2A69 F;  3OYI A;  5FRM A;  2HNH A;  5CVI A;  1MMS A;  2KZG A;  5L3G A;  5J4Y A;  5EGO A;  4BJ6 C;  2I8D A;  3BJO A;  4ZZD A;  4G12 A;  2Z1D A;  3EUK L;  3GFL A;  2F5V A;  4AIJ A;  1NK3 P;  1TQM A;  5CJ9 A;  1QPM A;  1FLI A;  1YX5 A;  2JUC A;  3TKY A;  5IPA A;  5FB2 A;  5KAF C;  3P7N A;  4O3M A;  2K27 A;  1HDP A;  2Z99 A;  3F8B A;  2HXI A;  2Y0S N;  4XKB A;  2L4M A;  3RQI A;  3N4M A;  2VC0 A;  3UNG C;  2L7F P;  5IP6 A;  3J80 Z;  1G3T A;  4XIC A;  2X6X A;  1OCR H;  2WAD A;  3CLQ A;  4O5V A;  3ZN0 A;  4A0X A;  1A5J A;  5LGT A;  2FQ4 A;  4PJN A;  4AU7 A;  1X2N A;  1KYZ A;  4LLN A;  2BY3 A;  3L2V A;  2V9V A;  4A12 A;  1QO0 D;  1Q1H A;  3F3X A;  2BHY A;  3I71 A;  4F3Q A;  4PJ0 C;  5D4R A;  2EFW A;  4IRH A;  4NQW B;  3T5X A;  3HYI A;  1LEA A;  3HUG A;  2GM4 A;  1IGN A;  3NQO A;  2O9L A;  3HOZ J;  4AIK A;  1W1W E;  2FQ3 A;  1APL C;  5F0F A;  1ON1 A;  2OA4 A;  2NS8 A;  1T2K A;  2YSR A;  3GTJ J;  2RRE A;  3JTH A;  2M30 A;  4LIV A;  2IGM A;  1K78 A;  1OCT C;  1R5H A;  1SAN A;  3IWF A;  3KLO A;  1MNE A;  4OOI A;  3VYT B;  4KIS A;  2VT2 A;  1IF1 A;  5EDN A;  1K6O A;  2H94 A;  1UMQ A;  4HBL A;  1QHH D;  2X85 A;  3HOW J;  2UV1 A;  1MSF C;  1X4P A;  4I2O A;  5L3D A;  4BH9 A;  5FRN A;  3K4M A;  5HOD A;  3REO A;  3WGI A;  2MFZ A;  1J0R A;  5DDG A;  2KZV A;  4B3X A;  2QQ9 A;  3F9K A;  3S3M A;  4II3 A;  2JJ7 A;  1GXQ A;  2XF6 A;  5EEG A;  2J5O A;  4Q4Z F;  4AM3 A;  3W3C A;  4EM1 A;  4Q5S F;  3JSP A;  2JWT A;  3HC7 A;  1AU7 A;  2D5V A; 
#chains in the Genus database with same CATH homology
 3QP6 A;  5CYV A;  1UHW A;  3I0T A;  3BOQ A;  3MCZ A;  2VBW A;  5LBQ A;  2L4A A;  3WGG A;  4UNO A;  2LKP A;  3DQV C;  2E1N A;  2H27 A;  5ICG A;  2P6S A;  1SD6 A;  4GGG A;  5D5X B;  2DBB A;  3GWZ A;  2W24 A;  1FNN A;  1ZG1 A;  3RPQ A;  1BN5 A;  4YIF A;  3CUQ C;  4CGZ A;  1XGN A;  5HS7 A;  3MQ0 A;  2F5D A;  3ROU A;  2BEO A;  2QBY A;  3P9K A;  3IKT A;  3ULQ B;  2Y48 A;  1D5V A;  2KIU A;  2YX7 A;  1U5T C;  1WQ2 A;  5CLS A;  3RKW A;  4EJT A;  4ENJ A;  4KNY A;  5J8C A;  2HTS A;  2O03 A;  3VB2 A;  2E1C A;  3T0Y A;  4QLC U;  1S3J A;  4Y15 A;  4DQ2 A;  1EH6 A;  3QOP A;  4G6Q A;  3RYR A;  3C3W A;  4HW0 A;  5FFZ A;  1FYM A;  3J81 K;  3K1M A;  1YYV A;  1A04 A;  1YQA A;  4P5O A;  1D3Y A;  2FE3 A;  1XSD A;  1EV7 A;  4LD5 A;  1PP7 U;  2XIG A;  2CQK A;  1TTY A;  4L9N A;  4L5I A;  1KU9 A;  4EV0 A;  2V1U A;  2QQA A;  3R60 A;  1U8R A;  3M9A A;  2RN7 A;  4NB5 A;  3L7W A;  3LQR A;  4CIC A;  3RIR A;  2P8T A;  1UST A;  4XLP F;  4MNU A;  4PGG A;  2ZNZ A;  1MJA A;  4U7B A;  2IRF G;  3WTX C;  1AWC A;  2GA2 A;  3WE3 A;  5D5U B;  3QPT A;  3D0S A;  1L3L A;  4MQV A;  4I0A A;  1I1S A;  4JK1 X;  4BHC A;  4HLX A;  1W7P A;  3L09 A;  4E70 A;  3GW2 A;  3RI4 A;  1W5S A;  5D5W B;  1FBU A;  4MTE A;  2K02 A;  4ZYD A;  1W4M A;  2A5Y B;  3K0L A;  3DPL C;  2LSO A;  1RI7 A;  2CYY A;  1CF7 A;  4UHT A;  1U2W A;  1I6X A;  3KP4 A;  3RYP A;  1XGS A;  1C0W A;  4LLL A;  4JBA A;  5FLX Z;  4HQE A;  2DAO A;  3I58 A;  5H6R A;  1ZG3 A;  5DCM B;  5LGU A;  2EA2 A;  1P4W A;  5K5O A;  5A2Q K;  2L02 A;  2L3D A;  2QVO A;  4TV7 A;  1YS6 A;  2LDU A;  4HV6 A;  2HGC A;  3KZY A;  1SFX A;  2RVC A;  1FWZ A;  1FC3 A;  4N0B A;  3KFW X;  1TNT A;  4AVP A;  5LHI A;  3P9I A;  3ZMT A;  2H6B A;  4XSZ F;  2ESN A;  2DW4 A;  3ABU A;  3VEP A;  2VBZ A;  4M9X A;  1HQC A;  1R36 A;  3TOA A;  3CTA A;  2XAG A;  2DI3 A;  2P5K A;  3LAP A;  3M1E A;  3SXY A;  4OIN F;  4EMS A;  2IA2 A;  2ISY A;  3DEU A;  2M87 A;  3G73 A;  3E6D A;  3SZP A;  1XCB A;  1YW9 A;  2WC2 A;  2XGX A;  2IVM A;  2TDX A;  2VE9 A;  4OIP F;  3CUQ B;  1IN4 A;  3JAM K;  3IKV A;  2CG4 A;  4N9H A;  3P9C A;  1VTN C;  4XSX F;  2CSO A;  3KEO A;  5E18 F;  4EGZ A;  4RB1 A;  3CDH A;  1REP C;  3L00 A;  1O3S A;  3IHU A;  3KP2 A;  2F5C A;  1FSH A;  1U5T B;  1G6N A;  3FWE A;  3TGN A;  4U0W A;  4G8X A;  2MC3 A;  1BI1 A;  1HXD A;  2OAZ A;  3EDP A;  2GIV A;  1R22 A;  3DF8 A;  1ZLJ A;  1Y0U A;  4HV5 A;  1FSE A;  1ZLK A;  2JRT A;  5DEQ A;  3E5X A;  3HTS B;  5ICE A;  1R1T A;  2EK5 A;  3FZV A;  1K79 A;  4L0Y B;  3GFM A;  4LLG F;  4RAZ A;  2O6G E;  1KU3 A;  4ZYE A;  4KMU X;  2QZ8 A;  3DKW A;  4YII A;  4L18 B;  3WGH A;  4R1H A;  3FXQ A;  1U6G A;  2PJP A;  2MBF A;  3ZP5 A;  3MZY A;  1JHH A;  4HOB A;  3TQN A;  5D8K B;  2NNN A;  2RV8 A;  4WWC A;  1IRG A;  3BJA A;  1QBJ A;  2CGP A;  3DV8 A;  3ABT A;  2VOD A;  1KQ9 A;  3DP7 A;  4ENM A;  4YFN F;  2DTR A;  4U0V A;  4P9F A;  2L54 A;  1MJB A;  4ON0 A;  1OYI A;  5E8G A;  3QPH A;  3VFZ A;  3F21 A;  3JW4 A;  3H3Z A;  2PMU A;  3O6B B;  4A0Z A;  1RUO A;  1IRF A;  1HST A;  1B6A A;  1O7L A;  3E6C C;  2ELH A;  1PDN C;  2STW A;  2V6C A;  1LQ1 A;  3WTV C;  1FOK A;  2BV6 A;  3I54 A;  1MDM B;  4PZJ A;  1S8N A;  1XSV A;  1MJ9 A;  1QZY A;  3WE2 A;  4CDG A;  4PCQ A;  2GXG A;  5FD5 A;  2BE5 F;  2FBH A;  2ZKZ A;  3BJ6 A;  3HIF A;  4LG0 B;  4HA8 A;  4AIH A;  4CYD A;  4DNC A;  1ONV A;  3T8R A;  4WXC A;  3ECH A;  5IT3 A;  2OZU A;  1U78 A;  3K69 A;  3EQL F;  1YG2 A;  4ENN A;  2IW5 A;  4M73 A;  3F22 A;  3GO5 A;  3ZQ7 A;  3ZMV A;  3RKY A;  1B1B A;  2VOO A;  3EUH A;  1F9N A;  3R0J A;  2NAZ A;  1ZGA A;  4KMF A;  3J80 K;  4B09 A;  4XRF A;  5JR3 A;  1NHA A;  4G7O F;  4MQ9 F;  2FA5 A;  5HS9 A;  1LB2 A;  3PFI A;  4GYI A;  1ZHF A;  3DXJ F;  4L9V A;  1SFU A;  1FBQ A;  5DCF A;  1WKM A;  1FP2 A;  3V7C A;  4R8H A;  2R3S A;  1R7J A;  3OV8 A;  4IRI A;  1XB4 A;  2HYF A;  2XUB A;  4IVN A;  1E2X A;  5ILV A;  3F6V A;  2A6E F;  2PFB A;  1XGO A;  5H20 A;  4KFC A;  4HLY A;  5L3E A;  3EET A;  5E1Z B;  1F1Z A;  3FF5 A;  2HKX A;  3CO6 C;  3GEZ A;  2PEX A;  1IN8 A;  2X0L A;  3FMS A;  1JHF A;  5DYM A;  1KGS A;  3IC7 A;  1EH8 A;  4FX0 A;  4BAY A;  3V7R A;  3WU1 B;  4CO8 A;  5DUI A;  3KP6 A;  3E6B A;  2QQB A;  3FMR A;  1CGP A;  2MA3 A;  3D5L A;  3K9T A;  2Z5U A;  3V8J A;  3CO7 C;  5HLG A;  3GZ5 A;  4CHU A;  2HEO A;  4L9T A;  1OYW A;  3HSR A;  1T98 A;  1YO5 C;  1DDN A;  2IT0 A;  2DU9 A;  3V7S A;  3V8K A;  5AIQ A;  4YFX F;  3W6J B;  1QNT A;  2ZXJ A;  3FXR A;  2FF4 A;  3KEQ A;  1F4K A;  2RGV A;  2D2W A;  1ZYR F;  4M9Z A;  2XRO A;  1YFH A;  4M72 A;  5ICC A;  1SFE A;  4BNC A;  1ZH5 A;  4XBF A;  4S05 A;  3FM3 A;  5DD8 A;  1BOA A;  2D1V A;  3M8F A;  3IL2 A;  2DQL A;  4HX8 A;  1JGS A;  5F6F A;  2NRA C;  1FZP B;  4M74 A;  5IT9 Z;  1ULY A;  1KYW A;  1K78 B;  5L3C A;  4AD9 A;  5J8F A;  1XMK A;  5HDN A;  5D6F A;  4BQA A;  1TW3 A;  3K1P A;  2YPR A;  4ZZL A;  1OR7 A;  5LGN A;  2STT A;  4G6D A;  3J7A O;  1GXP A;  4EJU A;  5D4S A;  2QEN A;  4IRG A;  2NNY A;  2XAJ A;  4EM2 A;  3NRV A;  2HWV A;  2GXB A;  2WWY A;  4KIG A;  5DD4 A;  5E20 A;  2HQR A;  3E5U A;  3HRM A;  4GO1 A;  1G4D A;  3B02 A;  4KDP A;  1FT9 A;  1SD5 A;  1BC7 C;  3ZN1 A;  3WTU C;  2RKH A;  2FEZ A;  3ISP A;  1KA8 A;  2FSW A;  2O61 A;  1TNS A;  1WI9 A;  3FXU A;  3TDU C;  1BC8 C;  2PQ8 A;  2RC4 A;  1XCV A;  2HQN A;  2ZJ2 A;  5LRS A;  1ZN2 A;  6PAX A;  4B8X A;  2W85 A;  1P92 A;  2GZW A;  2EWN A;  2KIF A;  2JZY A;  1GHC A;  4KT5 C;  5HS8 A;  2GA1 A;  2V1D A;  4KUM A;  5DCM A;  2XV4 S;  2BGC A;  1XDS A;  1HKT A;  2XAQ A;  3I59 A;  4K2E A;  1LEB A;  3TDZ C;  2K7L A;  3KZZ A;  4AWX B;  4QWQ A;  2PBI A;  1FX7 A;  1ON2 A;  2VXZ A;  2F2E A;  4PGH A;  5BS6 A;  2PN6 A;  3WTS C;  4OIO F;  2DFI A;  2XKO A;  2D1H A;  3MFK A;  1RZ4 A;  1SD7 A;  1UB9 A;  2JTV A;  1O57 A;  3K2Z A;  3GUD A;  2XKP A;  3GLX A;  5FLX K;  3FM5 A;  3TO7 A;  1FY7 A;  3NEU A;  3U9G A;  5L3B A;  1LDD A;  3HSE A;  2A61 A;  4KN7 X;  1ZRD A;  4HDV A;  3BPX A;  2GQQ A;  2MH2 A;  2HYG D;  4LJZ F;  4F7Z A;  3LWF A;  4A5M A;  4RGS A;  5FD6 A;  1RIO H;  2EV5 A;  4RAY A;  4G7H F;  3QP5 A;  4I0B A;  2KJC A;  4ZYH A;  5L3F A;  1DPU A;  3DPT A;  4HF0 A;  2KJB A;  1I5Z A;  4Y17 A;  1FYL A;  2UWM A;  1S29 A;  3SFZ A;  3C1D A;  2Q2E A;  5E17 F;  2IPQ X;  2RDP A;  2JPC A;  3U1D A;  2KRF A;  1TBX A;  3IRQ A;  1IZ1 A;  2W84 A;  5D6E A;  2CWE A;  2RQP A;  1W5T A;  1W7P B;  1WSU A;  1P6R A;  3HHG A;  3M7G A;  5FFX A;  4Q47 A;  1AOY A;  3ZMS A;  4LGW A;  3KLN A;  1BIB A;  3S2W A;  4L0Z B;  3FHZ A;  2P7C B;  4UV8 A;  1FYK A;  5HVQ C;  4L5J A;  5HLH A;  2QM3 A;  1S7A A;  1R1V A;  1T0F A;  2W57 A;  2NYX A;  2ISZ A;  2G7U A;  2FMY A;  2P5L C;  4WF2 A;  1V4R A;  1MD0 A;  1HKS A;  4ASN A;  4A2U A;  1LJ9 A;  5CVV A;  3HOS A;  3QU3 A;  5JI6 A;  3QAH A;  2B0L A;  2ZME A;  4IJA A;  5J6X A;  3SQN A;  2O8X A;  2XAS A;  3L9F A;  1IUY A;  1GVJ A;  4IHT A;  1Z6T A;  3GFJ A;  2VBX A;  4ETS A;  4WK8 F;  3ERE D;  3ZMZ A;  1FPQ A;  4EJW A;  2A6H F;  2MLK A;  3O2P E;  3ELK A;  3WG9 A;  2DLL A;  3OOP A;  4RS8 A;  2R7D A;  2J5P A;  1S7O A;  5KK1 A;  3WTY C;  3HTU A;  2EB7 A;  3KE2 A;  2DK8 A;  1I1G A;  1ZRC A;  1BBY A;  1KU7 A;  3PQJ A;  3RPU A;  1MZB A;  4OIR F;  3ZMD A;  2EFP A;  1KQ8 A;  2D45 A;  1P4X A;  3M8E A;  3H92 A;  1ODD A;  4BHP A;  3H3U A;  1J59 A;  4LG0 A;  1LNW A;  3ZPL A;  3C7J A;  2IJL A;  2DPU A;  4LB6 B;  3F8N A;  2H6C A;  1J2X A;  1RUN A;  2Q8K A;  1YW7 A;  2CO5 A;  3BPV A;  3GVA A;  4JQF A;  2FML A;  3LA2 A;  4WXH A;  2K4J A;  1R1U A;  4KYW A;  3LA3 A;  3GZ6 A;  2Z33 A;  1D8K A;  3WU0 A;  1Z6R A;  2PI0 A;  2F5E A;  4H0E A;  1TLH B;  2EFO A;  2OQG A;  5BOX A;  2DQR A;  3HSF A;  4Y13 A;  4U0Y A;  1TW2 A;  1BI2 A;  2KIM A;  2M45 A;  4HF2 A;  2FU4 A;  2EFN A;  2FOK A;  4BHB A;  2QLZ A;  5JVT A;  2IA0 A;  2FXA A;  4ESF A;  4NQW A;  1J9I A;  4FX4 A;  2ZBK A;  4MEX F;  5AON A;  1HSJ A;  1B4A A;  3FX3 A;  4FT8 A;  1IN6 A;  1B59 A;  4KN4 X;  1W7P D;  2L01 A;  3GFI A;  3JTG A;  1UFM A;  3ML6 A;  5E8I A;  1O7F A;  1DPR A;  2KKO A;  1T38 A;  3F8C A;  1WRJ A;  1I27 A;  1EH7 A;  2P5V A;  2HS5 A;  4LB5 A;  4MHG A;  2P7V B;  1SMT A;  1UCR A;  5LHG A;  2XVC A;  4HDU A;  4KA4 A;  4O6J A;  1K7A A;  1YLF A;  1T39 A;  1ZRF A;  1MGT A;  4D0P A;  4YFK F;  1BIA A;  3TOB A;  1IW7 F;  3Q9S A;  2UXX A;  2GAU A;  4KIF A;  3GX4 X;  4G7Z F;  4WCG A;  4RB3 C;  1R00 A;  2ZNY A;  1H9G A;  5BQT A;  1G3Y A;  3E5Q A;  5BMZ A;  1X3U A;  2HTJ A;  1YS7 A;  4M6X A;  1S6L A;  3V4G A;  3L2C A;  2M8E A;  2XAH A;  2IA1 A;  4LFU A;  1R23 A;  1H9T A;  3LQQ A;  2EV6 A;  4RB0 A;  1OPC A;  2HOE A;  2VOP A;  3KP5 A;  3GYH X;  2VN2 A;  2MLG A;  2YX4 A;  5JHU A;  1OKR A;  2H09 A;  3MAJ A;  2VC1 A;  3T1B A;  4G9Y A;  2FBI A;  4OMY A;  3CUO A;  2WTE A;  4A0Y A;  2PG4 A;  4PDK A;  4HX4 A;  1HW5 A;  2K4B A;  1Z9C A;  1IAW A;  2GWR A;  4Z2Y A;  1J75 A;  3LA7 A;  2QWW A;  2FNP A;  2ADU A;  2UXN A;  5CVJ A;  3TO9 A;  1E17 A;  1V3F A;  1BJA A;  3W6K B;  4M9S A;  1MKM A;  2HDC A;  2G7H A;  4MGR A;  3R0A A;  1ZAO A;  4IXA A;  2O3F A;  1P4A A;  2QYO A;  2ETH A;  3HHH A;  1BI3 A;  4I09 A;  4ESJ A;  4RB2 C;  4IHS A;  4I01 A;  4GXO A;  5CVR A;  1HKQ A;  5IT9 K;  2EJR A;  4A6D A;  2CFX A;  4EQQ A;  1Z7U A;  5LEK A;  3FMQ A;  1O3R A;  5ILU A;  2E7X A;  3LST A;  1G3W A;  1USS A;  1FBS A;  3V8L A;  2WV0 A;  1Z91 A;  2G9W A;  5E1W A;  5K5R A;  4LK1 F;  1B9M A;  2CW0 F;  1XGM A;  5KVR A;  5ICF A;  3HRT A;  5H6Q A;  5HLI A;  1HBX G;  4I02 A;  1ZAR A;  4I98 B;  2W25 A;  1BI0 A;  1STZ A;  3I4P A;  1ZG5 A;  2OD5 A;  3RJP A;  2E7W A;  5ED4 A;  2F5F A;  1OMI A;  2OQR A;  4MTD A;  2VON A;  2Q0O A;  3E97 A;  2XAF A;  4S04 A;  4KIC A;  4BYY A;  3F72 A;  2LF8 A;  5D8L B;  3WTZ A;  5FO5 A;  1P2F A;  1SAX A;  2A3S A;  2NS0 A;  2PLY A;  4WXD A;  3J81 Z;  3QU6 A;  1T6S A;  5BPI A;  4EGY A;  4UVB A;  3R6S A;  4LMY A;  4UUV A;  1B9N A;  5TRD A;  2DO7 A;  3DFG A;  3R61 A;  3T8T A;  4ENK A;  2QBY B;  2YU3 A;  2XRN A;  2Y75 A;  2Y0M A;  2Z3Y A;  2O0Y A;  3KCC A;  3I5U A;  2DPD A;  5LLQ A;  4Q48 A;  5ILS A;  1YIO A;  3EYY A;  3LFK A;  4GYG A;  5LRR A;  3HRU A;  1ZGJ A;  2HR3 A;  3N97 A;  2XHK A;  4IF4 A;  2V79 A;  4OIQ F;  5JFR A;  1IXR C;  2DK5 A;  4HAM A;  2MD5 A;  2P6T A;  4HX7 A;  1XDU A;  1HW2 A;  4YG2 F;  3B73 A;  5F1R A;  3GXO A;  3PQK A;  3BP8 A;  2Z9O A;  1IN5 A;  2HZT A;  2K86 A;  1DP7 P;  2HFH A;  1SMY F;  4OMZ A;  4N9I A;  2OZ6 A;  4UVA A;  3CUQ A;  2EV0 A;  2FNA A;  3O3K A;  4U88 A;  2MH9 A;  1KQ0 A;  5ERI A;  4WX9 A;  3F8F A;  2FRH A;  2JPB A;  3BDD A;  1RNL A;  4RGU A;  4BXU A;  4I7H A;  4HYE A;  4P96 A;  1U5T A;  5AIP A;  1JXS A;  2LNB A;  3QRF F;  2RNJ A;  3HRS A;  5HDG A;  4ZYG A;  3I59 B;  3LAJ A;  4UXN A;  4P55 A;  4HF1 A;  5TJJ A;  3MZH A;  1J7K A;  2M1B A;  5A2Q Z;  3VOD A;  2FBK A;  4ZH4 F;  2ZFW A;  3Q9V A;  4U7D A;  1IXC A;  3JSO A;  3CJN A;  5EEH A;  1ZRE A;  1G3S A;  5E1X A;  2P4W A;  5CVU A;  5HOO A;  4A6E A;  2M5W A;  2ZCW A;  3BWG A;  3F6O A;  1L0O C;  3F8M A;  5K1Y A;  1CF7 B;  1JE8 A;  1J5Y A;  2OBP A;  3SHF A;  4R79 A;  1LDJ A;  3WTT C;  3IRR A;  5K5Q A;  3HOT A;  2QUF A;  1IXS B;  1LVA A;  4UV9 A;  2VT3 A;  1UHM A;  2JT1 A;  1TQI A;  2BBY A;  3MEX A;  4CZZ A;  3E6M A;  3KP7 A;  3ZMU A;  3SZT A;  1WWX A;  1H0M A;  5HDK A;  4G94 A;  1TQP A;  3EYI A;  1XSX A;  3JAM Z;  4L9J A;  1XN7 A;  5DUK A;  4KIB A;  1D8J A;  2HKO A;  1MDM A;  4HQM A;  3COA C;  1QZZ A;  1IN7 A;  4OU0 A;  4P9U A;  4GCV A;  5D5V B;  2AS5 F;  2COM A;  2ESH A;  1FP1 D;  2LF7 A;  3BRO A;  1F5T A;  3K1N A;  5LHH A;  3AAF A;  1R5G A;  2VBY A;  4NHJ A;  3CLO A;  4ESB A;  2EA4 A;  4EVI A;  2DT5 A;  3ECO A;  3R4K A;  3Q5F A;  4CXF A;  2EFQ A;  3VOE A;  3I64 A;  2ZO4 A;  3RDI A;  2ZME B;  4IPA A;  3TO6 A;  2VE8 A;  2UZK A;  1OYY A;  2BYV E;  3I53 A;  4XLN F;  3WOD F;  1QGP A;  4LK0 F;  3BZ6 A;  4RGX A;  3U2R A;  2AXL A;  4A5N A;  3WTW C;  3G3Z A;  1PP8 F;  4EJO A;  1YW8 A;  4M6Y A;  5DV5 A;  1DUX C;  4UVC A;  2A68 F;  2A07 F;  2R7F A;  1HW1 A;  1Z05 A;  4RGR A;  1Z1D A;  1O3T A;  2V1X A;  1XD7 A;  1XMA A;  2YR2 A;  1U3E M;  1SD4 A;  3KET A;  1YTY A;  5F64 A;  3RTR A;  4FHT A;  4HZF A;  1QQI A;  1PUE E;  2ACJ A;  3C18 A;  1O3Q A;  3GF2 A;  4M71 A;  2OU2 A;  4EJV A;  2IP2 A;  2X4H A;  2C6Y A;  4MEY F;  3KP3 A;  3MWM A;  2PMH A;  1LDK B;  3RKX A;  5LEJ A;  3F23 A;  1R58 A;  2JSC A;  4EM0 B;  3IWZ A;  3BY6 A;  3E3V A;  1KU2 A;  5FGM A;  1BM9 A;  5BPD A;  2A69 F;  5CVI A;  5L3G A;  3BJO A;  4ZZD A;  3GFL A;  4AIJ A;  1TQM A;  5CJ9 A;  1QPM A;  1FLI A;  3TKY A;  5FB2 A;  3P7N A;  4O3M A;  2K27 A;  2Z99 A;  3F8B A;  2L4M A;  3N4M A;  2VC0 A;  3J80 Z;  1G3T A;  4O5V A;  3ZN0 A;  4A0X A;  5LGT A;  1KYZ A;  4LLN A;  2V9V A;  4A12 A;  1QO0 D;  1Q1H A;  3F3X A;  3I71 A;  5D4R A;  2EFW A;  4IRH A;  3T5X A;  3HYI A;  1LEA A;  3HUG A;  3NQO A;  4AIK A;  2FQ3 A;  1ON1 A;  2OA4 A;  1T2K A;  2YSR A;  3JTH A;  2M30 A;  1K78 A;  1R5H A;  3IWF A;  3KLO A;  4OOI A;  2VT2 A;  1IF1 A;  1K6O A;  2H94 A;  4HBL A;  4I2O A;  5L3D A;  4BH9 A;  3REO A;  3WGI A;  1J0R A;  5DDG A;  2QQ9 A;  1GXQ A;  5EEG A;  2J5O A;  4Q4Z F;  4EM1 A;  4Q5S F;  3JSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...