2EQRA

Solution structure of the first sant domain from human nuclear receptor corepressor 1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
GSSGSSGDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Nuclear receptor corepressor 1
publication title Solution structure of the first SANT domain from human nuclear receptor corepressor 1
rcsb
source organism Homo sapiens
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eqrA01
3RQIA 2ID6A 3Q0UA 3OSGA 3TW6A 3HOXJ 2PMZN 1IUFA 2DN0A 1IDYA 1DU6A 4S0HB 3JRBA 2NVTJ 4AC0A 3BR1A 2KDZA 4UUTA 1MBEA 3ZQHA 4LOCA 3SDGA 4B1RA 2HQ5A 2K9SA 5M5WJ 1IDZA 5IP9J 4A3JJ 1MSFC 1BA5A 1AKHA 2D5VA 1UMQA 5J1UA 3GBGA 2ID3A 5FKOA 2JK3A 3QPLA 4A3BJ 3HKZN 3W6VA 1T33A 3A02A 4JYKA 4JX5A 1O4XA 1ZR4A 1B72B 4M3GA 1Y1VJ 5FLMJ 2JA7J 2TRTA 1ETWA 3TP3A 3H3VK 2MSYA 3G1OA 3LSGA 2GLOA 2GM4A 2OF7A 2DMTA 4Y52J 1FIAA 2XGEA 5IOZA 2XPWA 1JJ8C 1JKPC 2AO9A 1IC8A 4GFBA 1WPKA 4Y7NJ 4BBRJ 1MBKA 3HDDA 5K7ZA 3ZQFA 4FE7A 3ZQGA 2XB5A 3QPSA 3LOCA 1POGA 4A3DJ 1F36A 2EZLA 2JN6A 1ZR2A 1IJWC 1ETQA 5IP7J 1TWAJ 4JP0A 1JUSA 2GBYA 3BR2A 1WI3A 1LE8A 2RAEA 5HODA 1JKRC 1QVTA 1NK2P 3S2DJ 2M2EA 5J1YA 3TEDA 2FD5A 1JJ6C 1SFOJ 3HBLA 1BJZA 2NVQJ 1LFBA 3JRHA 4W97A 1MNMC 3DEWA 3CMYA 3IV5A 1DU0A 3OOUA 2IEKA 2I10A 5FKNA 2E2JJ 4D7MA 2HYJA 3BT9A 5EF6A 2JA6J 3O8HA 4MLOA 1LFUP 1QPIA 2TCTA 1ETVA 2QCOA 3K2AA 1AKHB 1ETYA 5F0HA 3BTCA 1OFCX 3HGYA 3S1QJ 5EDNA 4FCYA 5F0CA 3PO3J 5F08A 2DMUA 2EH3A 3RZDJ 2JWTA 1ETKA 2Y9YA 2NS7A 4BY7J 3LSPA 2E2IJ 1FJLA 3FIWA 3M3YJ 1P7JA 3BG5A 2LD5A 1A5JA 5J1RA 4BBSJ 1D5YA 3IH2A 5IP6A 2LR8A 2MG4A 1BW6A 1TWGJ 1BL0A 2M8GX 2DA4A 1XC5A 2HI3A 1IRZA 2ME6A 3TP0A 1X2NA 4FE4A 4X1EA 4IEJA 1Z0XA 4A3CJ 1LE8B 3GTPJ 2Y30A 2VPRA 2WV1A 4X6AJ 2FX0A 1TC3C 1ZK8A 1UHSA 4QIWN 1P7IA 2VKEA 2L7FP 2X9DA 3Q0VA 3HM5A 3HOVJ 3FISA 4NDLA 1SANA 5K7HA 3BR0A 1MSEC 5EZHA 2FJ1A 4XICA 2DA7A 2LFBA 3ZQCA 1IV6A 2HOTA 2EZKA 4AYBN 4IHYA 2ELKA 3BQZA 2AHQA 2YU9J 2IBDA 1JKQC 4M3FA 1BW5A 5C4XJ 1QVUA 5FKMA 2HXOA 4I6ZA 2N8GA 4A3GJ 2Y0SN 4W1UA 2R7ZJ 1HF0A 1RKWA 2DMPA 1GV2A 4IHVA 2X6OA 3CDLA 2XSDC 2DMQA 3BTIA 3BG3A 2M34A 5DS9A 1IGNA 1WCMJ 2XGCA 1OCPA 5JLXA 3JRIA 5F04A 1YRNB 3PO2J 3GTQJ 2XRLA 2R5ZA 1G2HA 4RBOA 5JLWA 2DTZA 2FQ4A 5BNGA 3HB9A 4B3AA 4C3IJ 1ZKGA 2DA2A 2IAIA 2VI6A 4MO7A 3SFIA 2Y2ZA 1WH7A 4FTHA 1U9OA 1ETOA 3LSRA 4XIDA 4A69C 5EG0B 2M0CA 3OSFA 3C2BA 3FK7A 2YS9A 3E7LA 2HOSA 1H8AC 3BR5A 4JX6A 2K9QA 4QSHA 2L7ZA 2LP0A 4B4CA 1Q1VA 1ORKA 5E3NA 2XB0X 2X48A 1PUFA 1K61A 1ZGWA 3M4OJ 3IH4A 4IHWA 5IYDJ 1TWFJ 3FK6A 2NVXJ 2CQQA 3GTOJ 3A01A 3CCYA 4UUSA 1VFCA 4XRSA 3MKLA 1ENHA 4A3KJ 1F43A 2LLKA 2W48A 1RPWA 1AHDP 4C3HJ 2L7MP 2JA8J 3HEFA 3UKGA 5E3OA 3ZQLA 1TWCJ 2WB1N 3O8GA 1B8IA 4MFEA 5IPAA 2LTPA 3S17J 2M9HA 5GP9A 2LK2A 2XGDA 1HDPA 3K7AJ 3WHBA 1QRYA 3HOUJ 2G0EA 4C2MJ 2O7OA 1K83J 2CU7A 1JUPA 4HNVA 4A3FJ 1W0TA 1JT0A 4M3BA 3G1LA 2CJJA 1YRNA 2VUMJ 1MH3A 4D5CA 1VNDA 1I50J 5C4JJ 1JTYA 4JX4A 1X2MA 1X58A 2DA5A 2EQRA 4DZPA 2O8KA 5C3EJ 1VF9A 2B63J 2H8RA 5K7FA 3S1MJ 2OPTA 3NARA 4DYCA 1GUUA 5F1JA 2ME0A 4A3LJ 3JRDA 3JRGA 4V2FA 2R5ZB 5EG0A 4RDUA 3BR6A 5C44J 1I3QJ 3BTLA 5EGOA 3Q3SA 1UG2A 5M5YJ 1JGGA 2XPVA 1MBGA 1WGXA 3BTJA 1WH5A 4CYCA 3HOZJ 3MN2A 4EEFG 3LNQA 2R92J 2CRGA 2ZB9A 3S1NJ 1APLC 2R5YB 2EZIA 1E3OC 1NTCA 4IHXA 4BKXA 3HOWJ 3D1NI 1XG1A 1FTZA 5EEAA 1XS9A 1PUFB 3IH3A 4XK4A 2ECBA 1H88C 3S16J 2DJNA 5J3LA 3I4MJ 1HDDC 3NAUA 4XRMA 3A01B 1ITYA 3JRFA 4UUSB 1OCTC 1RESA 1FEXA 1H89C 2HDDA 5DTDA 3JRAA 5GPCA 2COBA 2KT0A 4QTRA 3OIOA 2K9NA 3HOYJ 1S7EA 5F27A 2R0QC 1B8IB 3S15J 5FJ8J 3SJMA 4C3JJ 5M5XJ 3BQYA 1ETXA 5M3MJ 2L9RA 1GDTA 4M3EA 2LY9A 4A3EJ 3S1RJ 2L0KA 2CUEA 2DA3A 1HOMA 5IOYA 1MH4A 1JUMA 2HOAA 4A3IJ 2E2HJ 5GPAA 1FTTA 3GTLJ 3QQAA 4D7NA 1U8BA 3ZOBA 2Y31A 1GVDA 5IYBJ 1TWHJ 3Q0WA 2R93J 1GV5A 4ABZA 1NK3P 5EZGA 3HGGA 3GTKJ 5F0FA 1JKOC 2EBIA 4A3MJ 1CQTA 2R5YA 2WAQN 4M6VA 1MBHA 2JJ7A 5FKLA 2O9LA 5EGOB 3TW7A 3DCFA 3A03A 4BXXJ 4D5FA 4DW6A 1JTXA 5E3MA 1MBFA 3ZQIA 4DYRA 1FIPA 3JREA 4CYCB 3GTMJ 5FKKA 1VI0A 2DA1A 2MGQA 5IYCJ 4DYQA 2CUFA 1IG7A 1RETA 5M3FJ 1Y1WJ 1ZQ3P 1GT0C 3MVPA 2JA5J 3F0CA 2MW8A 4DZJA 1EF4A 3RKQA 1U78A 2LVSA 1W0UA 1U9NA 4J19A 3S2HJ 4L5EA 3WHCA 1MBJA 2DA6A 2QF7A 1ZTRA 4M3DA 3JR9A 1R9TJ 2EZHA 3LSJA 1T56A 1B72A 5EYRA 2H1KA 2E1OA 3FKIJ 3S14J 1HCRA 1RKTA 4FISA 2VKVA 4MIMA 1RR7A 3B6AA 2NS8A 2XPUA 2ECCA 3H0GJ 4AUXA 5FLVA 3CQZJ 4V2GA 3I4NJ 1AU7A 4I76A 2NVYJ 4MFDA 9ANTA 1HLVA 2DMNA 1Z77A 2E19A 2YUSA 4XRSG 3VPRA 3JRCA 2JMWA 2Y9ZA 5E3LA 4BY1J 3GTGJ 4G12A 3B6CA 2LKXA 2HXIA 3BG9A 2CQXA 2NOGA 3RZOJ 1OJLA 3G1MA 2P81A 1JT6A 3BR3A 3GTJJ 1I6HJ 2K40A 3PM1A 4A93J 1A6IA 3L1PA
chains in the Genus database with same CATH superfamily
4ZJZA 2L02A 3HPGA 2ID6A 5HDNA 1A04A 2CFXA 2PX9A 1R1UA 3BJOA 4KT5C 3WODF 3HOXJ 2ESNA 3ONQA 1XB4A 4F91B 2V9KA 4LLGF 1Z3YA 5E1XA 5J47A 1ZRFA 1B6AA 4KDPA 3QPHA 5GAHJ 4UUTA 3GCMA 4A0YA 3ZQHA 3SDGA 4F3QA 3CUOA 3K1PA 1FYMA 2LYCA 3H5AA 3WTXC 1D5VA 4M72A 5IP9J 1ZREA 5K1YA 1UMQA 5J1UA 2H6BA 3GBGA 2QBYB 3V8LA 2DO7A 5FKOA 4D9JA 3QPLA 3HKZN 2HKXA 3A02A 4UXNA 4JYKA 4JX5A 2GAUA 4HNTA 1B72B 2ZMEA 1R00A 1Y1VJ 4HQEA 1ETWA 4AIHA 1ONVA 1R4NB 3EYYA 4E7JA 4E70A 4GYGA 2GLOA 2EFQA 1FX7A 1WQ2A 2XGEA 3JSOA 1YFHA 1JKPC 2VE8A 2AO9A 2HS5A 5IT9K 4GFBA 2X6WA 3CUQC 3L7WA 3IL2A 2BZTA 3E5QA 1MBKA 1KU7A 4XR6A 3CLQA 4FE7A 2XB5A 3VOEA 1L0OC 4BQOA 1OYWA 3LOCA 4A3DJ 4G8XA 5J40A 4AIKA 1E3HA 3TBIA 2JN6A 3FXQA 1Y56A 3HOTA 1IJWC 1TWAJ 1KYZA 1KZHA 5HLHA 2M45A 1WI3A 4C2UA 2RN7A 3PNYA 5D4SA 1QVTA 1DGRM 3S2DJ 3N4MA 5B1AH 2A69F 3OYAA 4EM0B 1UHMA 5J1YA 3TEDA 3K70C 1OQYA 2WV0A 3PNTA 1WRJA 3DKYA 1JJ6C 4HF1A 4C30A 1BJZA 2NS0A 3JRHA 3CMYA 3FMQA 3BJAA 2KRCA 1Z91A 3H5NA 2VBWA 3WE3A 2GZWA 3H9GA 2LREA 3IP4B 4A6DA 2KZGA 2HYJA 5DEQA 1YS6A 3BT9A 2JA6J 2DT6A 3WGGA 4MLOA 1LFUP 1J7KA 1TZLA 1FBQA 2HZTA 3RKXA 3ISPA 3S3NA 3DWLE 1AKHB 3J7AY 1LKXA 5HS9A 3I71A 5L3CA 3M8EA 3PO3J 2P7CB 3RZDJ 5DCMB 2IA0A 2B9SA 3LA3A 3BPXA 3M1CA 4LB6B 3S32A 3MAJA 5KAIC 4RS8A 4CDGA 2OQGA 2ETHA 2VT3A 3QOPA 2JRMA 1G3YA 3KX2A 3NRVA 1AWCA 3FIWA 2JQ7A 1NG6A 4IXAA 1P7JA 2FXAA 3HKZA 2LD5A 3CD6I 3GZ6A 5H6RA 2OTJI 2F48A 4AM3A 2EIJH 2CUJA 2DJIA 2MD0A 1PJRA 3CC7I 3V8KA 4N0BA 1X4PA 2QM3A 2VC0A 1DP3A 1KQ8A 4XSXF 3FM5A 3L09A 5IP6A 1ZARA 2LR8A 2MG4A 1BW6A 4BHBA 1TWGJ 4O3MA 3CUQB 1WJAA 4R1HA 2HZDA 1BL0A 5D4RA 1XC5A 2HI3A 1IRZA 1X2NA 1J9IA 4XSZF 4BACA 3OYCA 3PQKA 3GTPJ 3KP5A 2LH9A 3OY9A 2VPRA 4X6AJ 1TC3C 2FBKA 2YX7A 4EJOA 3RSNA 4G7OF 4D1QA 4B44A 2A6TA 4XN0A 4U87A 1SANA 4E7KA 4HDUA 5K7HA 5HS7A 2VODA 5ILUA 2EFPA 3H5RA 4ZZDA 1MSEC 2FJ1A 4XLHA 2ELJA 3HRUA 4XICA 2DA7A 3ZQCA 2M1BA 3OL4A 3KYCB 2PLYA 5LGUA 3LSKA 3BQZA 3I9V2 2AHQA 5K5RA 2YU9J 4HSRA 1JKQC 1BW5A 2ZNZA 1QVUA 2HGCA 2NOJB 1XDUA 4KYWA 5JI6A 1IXCA 2VBXA 4YIIA 2IXSA 4Z6YA 4OWRB 4NC6A 4W1UA 4XLPF 1K4TA 2A05A 1SFUA 4B47A 5H2FC 3HUGB 4M6XA 4M71A 4GDFA 1KU3A 3CDLA 6PAXA 2XSDC 2PFBA 1ZH5A 3BTIA 1IXSB 5D5XB 4ZDPA 2UV1A 3EUHC 4E7LA 2WBMA 2XGCA 3G6EI 3HYIA 4L9JA 2Q2EB 2CV1A 4HDVA 2AS5F 1YRNB 4I09A 2XRLA 5FD6A 3I59A 1MJAA 2DTZA 5BNGA 4EGYA 2E71A 2DA2A 3K4NA 3LA2A 2WADA 5HLIA 4FX0A 3DBHB 4FTHA 2O6GE 3CTAA 1D8KA 2LY1A 1R23A 4A69C 3L2VA 2M0CA 2K4BA 5CQGA 4ENMA 4D0PA 3CLOA 5FRMA 2YS9A 3E7LA 2HOSA 2IRFG 1H8AC 3BR5A 5FRNA 1RI7A 1KU9A 2DCEA 5E3NA 2X48A 5DUKA 1P4WA 3M4OJ 3IH4A 4II2A 2GOMA 2NVXJ 3CCYA 4UUSA 4BUPA 4CO8A 1VFCA 3FM3A 3GFIA 2B7EA 1ENHA 4UY8I 4RB0A 3GZNB 4EGZA 1RPWA 3KP6A 2L7MP 4RA2A 5E3OA 1UB9A 3FBNB 3ZQLA 2WB1N 3O8GA 1B8IA 2K02A 3S17J 2LK2A 3WHBA 5FLXZ 3KP2A 4C2MJ 2O7OA 1JUPA 3BLYA 3Q9VA 4LITA 2MBFA 4HNVA 1W0TA 1JT0A 4M3BA 4UVAA 3J81Z 2RDPA 4HA8A 3GFLA 2ZCWA 4XKVA 4BEHB 4CCOA 2XGXA 3DPTA 3DU6A 1K78A 1IG7A 5JFRA 4BE1A 1X2MA 3R60A 5CVJA 2DA5A 1VF9A 4YG2F 3CC2I 3T8RA 2B63J 5GAGJ 3CF5F 2LF8A 4IRIA 4LD5A 4DYCA 1HSJA 1BI0A 2R7QA 2ME0A 5F1JA 1Y39A 2V7FA 3BCBA 5CQEA 4S04A 2HDCA 1E17A 3QYEA 4UHTA 5HNHA 1N77A 2DFFA 2ZJPF 2L5QA 4ENNA 1W7PB 3GO5A 4RAFA 2GOXB 3IHUA 3RKWA 2HQNA 5D8KB 3S3OA 4IQJA 2IW5A 2WA0A 5C44J 2H27A 5EEHA 3L2CA 1R6RA 1XGNA 2LRDA 5EGOA 4ZC3A 1LQ1A 3Q3SA 1LEAA 4QLCU 3HIFA 5M5YJ 2K85A 2XPVA 4EMSA 1VQ9I 2R7FA 2HWVA 3IWFA 2VBYA 2VJIA 2CRGA 2ZB9A 4PGGA 3S1NJ 1R49A 2Z16A 4HRIA 2M4GA 4IVNA 2R5YB 3HZJA 1E3OC 3CJNA 4IHXA 4BKXA 4BHPA 3D1NI 2STWA 3RPUA 1FTZA 2F6CA 1ZG1A 1ZYRF 3IH3A 1YI2I 4EV0A 1H9GA 3VYUB 2ECBA 1H88C 3F8NA 3D5LA 3CZ6A 1FOKA 2CG4A 1EV7A 4XOPA 3JRFA 5HLTA 3DEUA 1MDMA 2OTLI 1FEXA 5BOXA 2Q8KA 3O6BB 4RAZA 4B48A 2HDDA 5DTDA 2GXGA 5GPCA 2FOKA 1TBXA 3OIOA 5HLGA 1S72I 1S7EA 5CKTA 5F27A 4HBLA 3RYRA 5D5VB 2ZNYA 4NQWB 4MTDA 3K1NA 2Z33A 3C18A 4F92B 2M87A 3V7SA 3HC7A 2JTVA 4NNJA 4A0XA 4BHCA 1GDTA 2VT2A 3EQLF 3F8BA 3GLLA 4M3EA 2LY9A 4BQNA 3J80K 4A3EJ 3S1RJ 3OYGA 2GQQA 2WB1A 4BGDA 1N25A 2CUEA 3SEQA 3WG9A 1W36C 4I7HA 4A12A 1X3UA 4BNCA 1K4SA 2E2HJ 3OR2C 3GTLJ 1U8BA 2Y31A 2X6XA 1TWHJ 3K4BA 3Q0WA 2R93J 3E6BA 2ZXWH 5KNLA 5L3EA 4ABZA 4ASNA 1JKOC 3K70D 3DKWA 2YX4A 4M6VA 2HQAA 5FKLA 2CMPA 4CYDA 3DCFA 3A03A 4BXXJ 4D5FA 3L2RA 2QSHX 5E3MA 1KQ0A 5LFAA 1FIPA 3JREA 4CYCB 1SVMA 3S93A 2RQQA 5TGTA 1FMWA 3K4KA 3QP5A 2EPFA 2R7VA 5LRSA 2ISYA 4DZJA 2A5YB 3MKWB 4U0VA 4Y17A 4JK1X 1MNDA 2OQRA 4BYYA 1X1CA 2ZKZA 3WHCA 4LIVA 5K5QA 1A35A 1MBJA 2DYSH 5F1RA 2FSWA 4EJVA 1B1BA 1ZTRA 4OMYA 2CUZA 4KUMA 3REOA 1T56A 1WJEA 3TO9A 5EYRA 3ZP5A 3PJRA 2H1KA 4AYBA 1T8IA 5LHIA 5DCFA 3DFGA 1RKTA 2PMUA 2LG4A 1R22A 2VKVA 3ASOH 4FISA 2OUMA 4OIQF 4MIMA 2F5CA 1JHHA 2EA4A 2XPUA 2RV8A 1ZLJA 3CCUI 2ZMEB 2BVLA 5FLVA 3CQZJ 1WI9A 1XDSA 2QZ8A 1JHFA 2I8DA 1X3WB 1HLVA 2DMNA 1Z77A 1G59A 2ACJA 3P9CA 3VPRA 4XLNF 1P9QC 1P6RA 2X1DA 3BDDA 3ROUA 4G12A 3B6CA 1XGOA 2LF7A 4A6EA 3M7GA 3BR3A 2K40A 3PM1A 1SVOA 3L1PA 2IS6A 3Q0UA 4OAZA 4OINF 3S8PA 3TW6A 1OLTA 1Y8QB 2DBBA 1IUFA 1IDYA 2P4WA 4S0HB 3SZGA 2A3SA 2PQ8A 3QU6A 2JSPA 3JRBA 1USTA 2NNNA 1DPUA 4RGXA 2BHYA 2E7WA 3DTIA 4LOCA 5KVRA 4B1RA 3FXLA 4IRHA 2HR3A 4M9ZA 4QPOA 3QYFA 5E8IA 4CZCA 4P9UA 4A3JJ 1D0ZA 5TRDA 3RJPA 3MMYB 4BQQA 3JW4A 3AL0B 3OYMA 1K6YA 2WWYA 3W6VA 5ICEA 4PJMA 2Y75A 2ZO4A 2EV6A 1ZR4A 3PNVA 2K3FA 4G9YA 2DOEA 4L0YB 3IKVA 3ZCOA 5BPIA 3H3VK 2DOFA 1DP7P 5L3GA 1HKQA 2IPQX 2MSYA 3G1OA 3KIOA 3LSGA 2PBIA 4Y52J 3GMEA 2VQLA 1M1EB 3EUHA 4MQ9F 5IOZA 4E7IA 2BXZA 4YIRX 1QGPA 3PUBA 4X0GA 1WJDA 2O0YA 4Y7NJ 3RTRA 4BBRJ 1B9MA 1TW2A 3BG6A 3GLXA 3ZQFA 1C0WA 2FEZA 2KDOA 2KRFA 3QPSA 1P92A 3ZXSA 4BQAA 2VLAA 2KZVA 1ZR2A 2O8XA 2JZYA 1XTAA 2P6SA 5IP7J 2MYSA 4JP0A 4EVIA 1GXQA 1XCVA 2X85A 2GBYA 1QQIA 3T1BA 1LE8A 5HODA 1JKRC 2P6TA 1BR1A 2E60A 4A0ZA 4GO1A 4DGWB 2E34A 1LFBA 4W97A 2W1OA 3DKXA 3H36A 1UG0A 3DEWA 5DM7F 4CICA 1SFKA 1DU0A 4E4HA 3OOUA 2GIVA 4ZYAA 2OV7A 3HJEA 2I10A 1MMNA 3TOAA 3V7CA 1MJBA 2FOWA 4XQFA 3P9IA 1HW2A 2BY3A 5IT3A 1K6OA 3B73A 2TCTA 3PIOF 1ETVA 3FXJA 5BMZA 4MQVA 4CXFA 3NWSA 2MFZA 4FHTA 1O3SA 1YJNI 5DYMA 3F8FA 3HGYA 4J00A 1U5TB 1YLFA 5EDNA 5H6QA 2EH3A 4HPQA 1D3YA 4H0EA 1MNEA 2STTA 2NS7A 2KIFA 3UR3C 1R1VA 4BY7J 1W4MA 2X1EA 3LSPA 1A36A 2IS2A 3M9AA 3CCJI 3M3YJ 3JTGA 4PGHA 2W24A 2VN2A 3BG5A 1ZN2A 3O3KA 3I3LA 2HEOA 4KT6A 2KQRA 4IOAF 4MGRA 5HOOA 2EINH 3WTWC 2HTJA 4RM2A 3CO6C 3OYNA 4PDKA 4XRFA 4HG2A 2M8GX 3CMEI 2LBFB 2F4OB 4IO9F 3LFUA 4MNUA 3TP0A 1SC7A 3N97A 3QYBA 4IEJA 1CF7A 1Z0XA 2CW7A 4ZTJA 4A3CJ 2Z1DA 2DYRH 4EM1A 3PIPF 5F6FA 2HVRA 2WV1A 2EWNA 2XF7A 2R7WA 1ZK8A 3LQRA 1P7IA 4RGUA 2VKEA 2L7FP 4YEJA 2HTSA 4DJAA 3HM5A 1TQIA 1MGTA 5B3SH 1HC8A 5EZHA 1WZ2A 3L2UA 2JRTA 4ESJA 2IVMA 2MD5A 1G3TA 2Q1ZB 2UXXA 3MKYB 3KYDB 3HRMA 1SVLA 2EZKA 2ELKA 1AOYA 4LK1F 3ZMUA 3G3ZA 1X1BA 3MQ0A 2HXOA 3DLLF 5J8CA 1Z9CA 3VEPA 2N8GA 2D1HA 3RI4A 4BE2A 2Y0SN 2R7TA 3P5JA 2F4MB 4XNFA 2XDVA 1HF0A 1W36D 1QNTA 4HV6A 5LD2C 2X6OA 2QA4I 3OYFA 2M34A 4B3XA 1IGNA 1OCPA 2X0LA 3NEUA 5JLXA 1H0MA 3VWBA 4XM3A 3K10A 4KMUX 3JCUC 2VBZA 5A2QK 4UB8C 3MKZA 3BCAA 1K78B 3GXOA 2UZKA 1G2HA 3HB9A 5LRRA 1K79A 3RIRA 4F7ZA 4RB1A 2Y2ZA 2BW3A 3K1MA 1U9OA 2LKPA 2WC2A 2WTEA 2KIUA 3LAPA 3DXJF 3IRQA 1ON1A 4TV7A 2JVHA 3PFYA 2L9NA 5E8GA 3FK7A 2D2WA 2X6YA 3CP2A 3LFKA 4LMYA 4HX8A 2L7ZA 3I54A 3ZQQA 2JSCA 3K69A 1PUFA 1TLHB 4HV5A 2BBYA 5IYDJ 1TWFJ 3BZKA 3DF8A 3FK6A 3C2GA 2WAFA 4XN3A 3GTOJ 4QPQA 2QUFA 4KICA 2W4SA 3I4PA 3MKLA 3WTUC 5KCMA 4A3KJ 1F43A 2QYOA 2DODA 1QO0D 1AHDP 3FKJA 5LGTA 1EH6A 5LHHA 4XOTA 3TO7A 2DFHA 2M9HA 4OMZA 5GP9A 5AIQA 3HOUJ 2GIZA 4N4NB 2R7XA 4EJUA 3A4CA 1K83J 4HSTA 2PJPA 3AFHA 1ZELA 2DT7B 2HU9A 1YIOA 2XSJC 2DDAA 3E6DA 3HSFA 4U7BA 4LB5A 3FBIB 3G1LA 2VUMJ 2R4GA 3E6MA 1FJLA 1VNDA 1RUNA 2EQRA 3ZMTA 3KEQA 2E1MC 3H1CA 2F4IA 5CJ9A 2DLLA 4PSWA 2H8RA 5K7FA 3WE2A 3NARA 4M74A 1FSHA 3WTVC 3OS0A 2Y0SA 1IO2A 3WTSC 1Z67A 1PVEA 3ZRGA 4ESBA 1T08B 5E1WA 1YOVB 3W2WA 3JRGA 2PN6A 4A3LJ 2JPCA 2R5ZB 3HXLA 4RB2C 2FA5A 4CCKA 3DBRB 3HL2A 3BR6A 1BI1A 2KJCA 2JPBA 3BTLA 3JAMZ 4AU7A 1FWZA 1Y6IA 4O6JA 1JGGA 1XGSA 1WGXA 5DM6F 4EJWA 1HXDA 3CF2A 1HQCA 3F8MA 2QKMB 4HF0A 2V6EA 1APLC 1WSUA 3E5XA 2EZIA 4OU0A 4MHGA 4B43A 2IS4A 5CVIA 1WJBA 3HOWJ 1T39A 1X1AA 2L54A 4XLEA 1XS9A 2O61A 4GGGA 5TJJA 1QU3A 3S16J 2DJNA 3OYEA 1MMSA 4XKCA 4I01A 1HDDC 2PG4A 3I4MJ 4OOIA 3O2PE 3A01B 1K7AA 1Z7UA 3TDZC 4EATA 3V7RA 5LBQA 2NRAC 1RESA 1FYKA 5D6FA 3F21A 4JQFA 2CS3A 1I27A 3RDIA 3VB2A 3T0YA 3HOYJ 3SQNA 2XAQA 3ZMDA 5J4VA 3OR1C 5M5XJ 5JVTA 4KFCA 2IGNA 1VQ5I 2CGPA 1ETXA 3GZ5A 2DW4A 5JHFA 2VOPA 2EA2A 2OBPA 3K4JA 3CJRB 4RGSA 2CQNA 1KONA 2L0KA 2Z5UA 1HOMA 4DBRA 2OZ6A 3X2QH 2AXTC 4Q47A 5IOYA 1JUMA 2RGVA 2HOAA 3NQOA 2DI3A 2L01A 3GVAA 1YO5C 1GXPA 3CCLI 1Y0NA 2EFNA 3F23A 1GV5A 3DTEA 3KPHA 1UZCA 1NK3P 1HKTA 5F0FA 1FP1D 1KGSA 1HBXG 3DTKA 4DBQA 4A3MJ 3OYHA 3VDXA 1MBHA 3QOEA 3K9TA 3GEZA 4LK0F 4MEXF 1F9NA 3QAHA 1TT5B 3ELKA 1JTXA 2ZJQF 3ZQIA 2K9MA 4LG0A 3WG7H 2DA1A 3BROA 1V5EA 4DYQA 2ZC2A 1IRXA 2MA3A 3ZR8X 2JVGA 1WHUA 3OYDA 5M3FJ 2V9PA 3MVPA 1VQNI 3F0CA 2MW8A 1VQ8I 1EF4A 1XSXA 4RLQA 3MZHA 1DPRA 4HX4A 3QPTA 1I3AA 3HG9A 4L5EA 4BU2A 2DA6A 3QRFF 4IHTA 4AVPA 3CESA 2KRHA 3MD2A 2EZHA 2XASA 1B72A 2XF6A 3CDHA 2O3FA 2E1OA 3M8JA 4EQQA 3FKIJ 1X1DA 1FPQA 3S14J 5E17F 1V5GA 3FZVA 5ILSA 2BEOA 1YYVA 3RCOA 4FQGA 4HOBA 3WGHA 5D5WB 1RR7A 3B6AA 4BDYA 2BYVE 4WXDA 2KJBA 1QZZA 3H0GJ 4UUVA 3C7JA 4G7HF 2QENA 1AU7A 2NVYJ 4I0BA 2NAZA 9ANTA 5LEJA 2P5KA 3G2BA 4L18B 2VL8A 2JMWA 3RPQA 3BC8A 1T38A 3BG7A 1YJ9I 3GTGJ 2R7OA 3IWZA 3I55I 3TMOA 2OC6A 1RZ4A 4YFXF 2LKXA 1SFXA 3HPHA 4XKWA 3TO6A 3FMSA 1ZGAA 3RPUD 4BAYA 2X4HA 2P81A 4L9NA 4CCNA 2G7UA 2Z99A 2LC2A 4G6DA 1B4AA 5CVVA 2RQPA 1V5FA 2PMZN 3MCZA 2DN0A 5F64A 1DU6A 1X4OA 3P7NA 5DD4A 3W2AA 4XLCA 3HSEA 4P96A 1ZGJA 2X51A 2NVTJ 4AC0A 3BR1A 1MBEA 4M9SA 2K9SA 2VQHA 3OOPA 1BOBA 2BY1A 3SDBA 2F5EA 1AKHA 4MTEA 3KP3A 1RC9A 4YELA 2E1CA 1XN7A 1FSEA 3K4LA 1WKMA 2E35A 2JK3A 2Y48A 3G71I 2PJRA 4A3BJ 2O03A 5DCMA 4ZZLA 1T33A 4Y4RA 1QHGA 2B0LA 4UB6C 1E2XA 5FLMJ 2JA7J 3U1DA 5CVUA 3WTZA 3MFKA 2GM4A 3FWEA 1FIAA 1JJ8C 2XPWA 2R3SA 1Z3XA 4I0AA 1WPKA 1X19A 1DQUA 1YQAA 3ABKH 3ULQB 5K5OA 4C9YA 3HDDA 4ZDOA 5K7ZA 3COAC 2JT1A 1LDKB 2QLZA 2V6CA 3ZQGA 3MZYA 2A6HF 2P5VA 5IY5H 3KETA 4Q48A 2DPDA 2DQRA 3FF5A 2QGUA 3Q5FA 4L5IA 1JUSA 4HW0A 1USSA 3BR2A 2CW0F 4XORA 4JOMA 3AG2H 3ECOA 3S2WA 4NBQA 1KQ9A 3M8FA 1TNTA 3WTTC 2FD5A 4Y13A 2EFOA 3C3WA 5ICCA 3HOSA 1IRFA 1SFOJ 2BY2A 1T95A 5KK1A 2VE9A 3HBLA 3LSMA 3TOBA 1CF7B 1MNMC 3MWMA 3H9QA 5D5UB 1V4RA 3OWTA 1ZRCA 2VJ5A 3ERED 1TL8A 3W6KB 2IEKA 3OIPA 5FKNA 2E2JJ 1SFEA 3F6VA 3AG3H 4D7MA 1HW1A 1Z6RA 5IT9Z 3GX4X 2PMZA 3E1SA 1QPIA 2BOLA 1QZEA 2W84A 2ZBKA 1QA6A 3K2AA 4P9FA 1SD6A 1ETYA 1YW7A 3J7AO 2JUCA 3BTCA 1OCOH 3TKYA 2DK8A 3ABLH 1OFCX 1ULYA 3IRRA 3S1QJ 1D0XA 5L3FA 3E5UA 2DMUA 5F08A 4KA4A 1MIJA 2EIKH 2ZFUA 2JWTA 1ETKA 4PJ0C 3ZMSA 2K86A 3PSFA 4GXOA 3WTYC 1VZ0A 1MKMA 4RM3A 5AIPA 3FXUA 2Q2EA 3P9KA 1YHQI 3OS2A 3V8JA 1EA3A 2HYGD 3AG4H 3U2RA 4BL0B 1VQPI 1PP7U 1DUXC 2KMUA 5DUIA 1BM9A 5E18F 3DP7A 5J1RA 4B8XA 2C6YA 2ZXIA 1O7LA 3IH2A 1JE8A 3LWFA 1I5ZA 3HRTA 1G4DA 2KP6A 3KE2A 1U6GA 1S5LC 1SD4A 3HTUA 4ANJA 3ABUA 3H35A 1PDNC 2GXAA 2K3PA 1W5CC 5J6XA 3DV8A 4CSWA 4FE4A 3VYTB 1J0RA 2VXZA 2OZUA 4L9VA 2ZJRF 2Y30A 5J8FA 5EEGA 3DU5A 3UNGC 2HVQA 5FB2A 2FF4A 2FNAA 2Q0OA 2IJLA 4G6TB 5HVQC 3OS1A 1UHSA 1Z05A 2DU9A 3VFZA 1BBYA 2X9DA 3Q0VA 3HOVJ 2P5LC 1J5YA 2I5UA 2AQEA 3BR0A 4G7ZF 3GFMA 3W6JB 3TDUC 4P5OA 1IV6A 1FBSA 4XBFA 4IHYA 1ZLKA 3KEYA 4PUSA 4WK8F 2IBDA 2XIGA 2RNJA 4GCVA 2OD5A 4KIBA 4A5MA 5HNFA 4I6ZA 1BR2A 4F52A 4B09A 1R36A 1I1SA 2OJED 4BEHA 1RKWA 2DMPA 1GVJA 3KZZA 4L0ZB 5H20A 3A0BC 3IAS2 4IX7A 2HYFA 2DMQA 4M73A 4BJ5C 4P1WA 5DV5A 3RKYA 1T98A 1EKEA 2FNPA 1E3PA 4ENJA 2IS1A 1IRGA 2FE3A 3FDYA 1MD0A 5F04A 3PO2J 1S9HA 4J01A 3GTQJ 2ELHA 1D1CA 5FLXK 1W7PA 1Z6TA 2DTRA 3I64A 4N9HA 4RMNA 4PJJA 4C3IJ 2L9VA 2W85A 3J81K 1T6SA 2VI6A 2FMYA 3SFIA 3GWZA 3BOQA 3E3VA 2J5OA 5JHUA 1XMKA 2VQCA 2AQFA 4QWQA 2XAUA 3LSIA 3JTHA 1ZG3A 3VODA 1IN4A 4CGZA 4OIOF 3CCMI 4JX6A 3BY6A 3U1KA 3ZQ7A 1Q1VA 3IKTA 5LHGA 1ORKA 3J7ZI 1N78A 2XB0X 3R6SA 2COMA 2NYXA 4BE0A 2VKHA 1OCZH 2RKHA 2FU4A 2DOAA 5GADJ 4ZH4F 1BN5A 4KNYA 2VONA 5ICGA 1OYIA 2LLKA 1FT9A 2W48A 4C3HJ 3E0JB 2DPUA 2JA8J 3HEFA 3UKGA 2EFWA 2R7SA 1TW3A 2PMHA 1H9TA 2A5WA 4G6QA 4MFEA 3ZN1A 5IPAA 4NQWA 3M07A 1G3WA 2XGDA 3EUAA 1QRYA 4AVZA 4Y15A 2G0EA 3LL7A 1T0FA 3SEZA 2XKOA 1YTYA 5GAEJ 2P0WA 4LG3A 1W1WE 1I39A 1Z7LA 2KISA 1BI2A 3ABMH 2W7NA 1MH3A 3VSKA 2QQ8A 4JX4A 4UV9A 4CUGA 4DZPA 2KHMA 1SAXA 2O8KA 4E7SA 5GTHC 2KIMA 2OPTA 1GUUA 3BPVA 4G94A 1S8NA 3IAM2 4WCGA 4KN7X 1SD7A 2L3DA 4V2FA 4NB5A 3I59B 3E97A 5EG0A 1UCRA 1A6QA 1FOXA 2R7DA 1YG2A 1I3QJ 1P4XA 2KKOA 5HDKA 3KLOA 1FOWA 4NUBA 1MBGA 1KYWA 3BTJA 1QPMA 3K4MA 4CYCA 3CJTB 2GA2A 3PQJA 2L4MA 3HOZJ 4GRIA 5FROA 2XF5A 4EEFG 3KCCA 5TISC 2CWEA 1R58A 1Y0UA 4ZYDA 2ADUA 3AAFA 1NTCA 2EK5A 2ZXJA 4E7HA 2VPLA 2HPMA 2M0MA 3SZPA 3QWLA 2VASA 1ODDA 4LG0B 3L2WA 2V1XA 3OYKA 1S7AA 2QVOA 2W57A 3NAUA 2ESHA 3RQ4A 1ITYA 4CZZA 4UUSB 4XL9A 1OCTC 5BPDA 4UVCA 2LDUA 3BJ6A 3A1YA 4FETA 4QTRA 2COBA 2M30A 1RNLA 3CCSI 2DK5A 1Z1DA 2VB6A 1RR8C 2R0QC 1B8IB 5FJ8J 3HHGA 3FX3A 1NG7A 2Y69H 3BQYA 4OAYA 3V4GA 5M3MJ 2A07F 4XMYA 2LSOA 4ENKA 3EYIA 2V1DA 3B02A 4CA0A 1AA7A 1T2KA 2FRHA 1FY7A 4BJ6C 3CCEI 4Y3OA 2DA3A 1YITI 2XAHA 1IXRC 5E1ZB 1DDNA 2DQLA 2MH9A 1FMVA 3IUOA 3QQAA 2DT5A 2NVUB 1IF1A 2QQ9A 4ITVA 3LSTA 2QSFX 3HGGA 3NWTA 1D8JA 5FFZA 5CLSA 4KIGA 1UELB 1BJAA 3F3XA 3GTKJ 3ML6A 1CQTA 2QKLB 2GWRA 2WAQN 2JJ7A 3Q9SA 2O9LA 5EGOB 4GYIA 1WVRA 1PUEE 1MZBA 4DQ2A 3GTMJ 2HQRA 2RC4A 3T8TA 2MGQA 3ZPLA 2XC7A 5KAFC 2LMDA 1ZAOA 1WWXA 3GFJA 1V3FA 2CUFA 3DPUA 1VQLI 3EUKL 2V1UA 3WU0A 1PYVA 2KFDA 4BS9A 1RIOH 1BC8C 3FXRA 3CP8A 3H3UA 3FHZA 3RKQA 1U78A 3ABTA 3J80Z 2EV0A 4AD9A 1W0UA 2YU3A 4J19A 2Z2SB 2X1CA 2XVCA 2P8TA 4UNOA 1F1ZA 2QF7A 1MDMB 4M3DA 1R9TJ 3LSJA 5CVRA 4WF2A 3QP6A 5J4YA 1HCRA 2KPMA 2V4JC 3EETA 1G8XA 1GHCA 5FO5A 2PJRB 4Z2YA 1OKRA 4V19K 2MC3A 4HF2A 2VJJA 2VXDA 4BJTA 2ECCA 4AUXA 3I4NJ 4I76A 4MFDA 1KA8A 4YFNF 1P4AA 1B9NA 2EILH 4I2OA 5FFXA 3JRCA 2HFHA 2Y9ZA 2ZFWA 5AONA 2E36A 4BY1J 4R79A 3R0JA 2W82A 4HLYA 4Q4ZF 1YE9A 2OU2A 3BG9A 2CQXA 3HHHA 1MMGA 2H09A 2NOGA 3H0DA 2NNYA 2L4AA 3RZOJ 2CFOA 1OJLA 3G1MA 4KISA 1R5ID 1JT6A 2CW8A 3KZYA 1I6HJ 4NC7A 3RQIA 1FBUA 1VQ6I 2XUBA 3OSGA 3PUFA 4ZYGA 4JBAA 3E6CC 2D45A 4L9TA 2WAQA 4AIDA 2KDZA 3CC4I 5ERIA 1F4KA 4RLFA 1LPQA 2PEXA 2HQ5A 3DEEA 3SYTA 3CCQI 5M5WJ 1IDZA 1UHWA 4DOZA 1MSFC 1BA5A 4PJNA 1N75A 1R5GA 2FQ3A 2D5VA 5BS6A 4OIPF 1LNWA 3TQNA 2V26A 3WGIA 2ID3A 1U5TA 3C2HA 4LIUA 1CGPA 3PL8A 3OYIA 1O4XA 1SMYF 4I98B 4M3GA 2ZJ2A 4Y33A 2IA2A 2VJ4A 2TRTA 3TP3A 4HEA2 4M6YA 3FHNA 4HX7A 3L2QA 2OF7A 2DMTA 1UFMA 4IPAA 2CH0A 1I6XA 5ED4A 1WJCA 1VQ7I 1IC8A 4ON0A 1LUJB 3FXMA 2CV2A 3ZGKA 2BXYA 1SD5A 2YSRA 3CO7C 2H94A 4KITB 1XCBA 2E1MB 1REPC 3BWGA 4PCQA 1LDDA 1POGA 4IL6C 2XAJA 1F36A 2EZLA 1OCRH 4RAGA 3R61A 5BQTA 1ETQA 5LLQA 2UXNA 4K2EA 2LBFA 1IAWA 3EDPA 4U0YA 3IC7A 3F22A 2RAEA 1XSVA 1NK2P 1YX3A 1EJ9A 2M2EA 3D0SA 3OYJA 2Z3YA 2LNBA 2OA4A 3BZ6A 4HAMA 4FASD 1IV8A 1B59A 3GW2A 2YPRA 4P55A 4CCLA 1HA8A 1JXSA 3A0HC 1O3RA 5HS8A 1IN8A 2QWWA 1U8RA 2BHZA 2NVQJ 4F55A 2QEXI 1EH7A 2QBYA 3IV5A 5JR3A 4WX9A 3VYRB 4PK4A 1SEUA 2HOEA 3M1EA 2MC4A 5EF6A 4XLFA 4YRVA 3O8HA 2QCOA 2HNHA 4WWCA 1T0FC 2V1NA 4IKFA 2VOOA 2DAOA 1G3SA 2EB7A 5F0HA 4BH9A 1HW5A 1J2XA 4BXUA 1YW9A 1OCCH 3K4CA 4FCYA 4LLNA 5F0CA 4Q5SF 1FLIA 4BXFA 2EIMH 2XKPA 1EH8A 4II3A 1Y8RB 2HDWA 2Y9YA 1PP8F 3DLAA 3EPZA 1WJFA 4CH7A 2IGOA 1IUYA 1HKSA 4PJLA 3H92A 1LB2A 2E2IJ 1YS7A 1LEBA 2UWMA 1S29A 3GF2A 3V42A 2FUG2 5FD5A 1R5HA 3MEXA 1A5JA 1P2FA 2VC1A 4BBSJ 1ACIA 1D5YA 1L3LA 3D5RC 1R71A 2QSGX 4LJZF 3SXYA 2ZSIB 1MMDA 4NC8A 3D5SC 5JVGF 1S3JA 4HLXA 2G9WA 2RVCA 1VQ4I 2JUGA 2DA4A 4UVBA 2NXNB 2IP2A 2ME6A 2BE5F 3U9GA 1QZYA 1IN7A 4X1EA 3KYLA 4KN4X 1LE8B 1O57A 4U7DA 5B5EC 4PFPA 4C2TA 3WU1B 1IN5A 1W5TA 1OR7A 2FX0A 3SZTA 4QIWN 1XGMA 2W00A 1BIAA 4DNCA 2D1VA 2OAZA 1LVKA 3FISA 3FMRA 4NDLA 2IA1A 2E5ZA 1ON2A 2LFBA 1XX5A 3QODA 4R8HA 1BC7C 2JA2A 2HOTA 4IOCF 4AYBN 4YIFA 2H8WA 2DXIA 1DGWY 1FOYA 4KIFA 1MJ9A 2L9SA 3ESWB 4HYEA 4M3FA 2OCCH 5C4XJ 2XAGA 2F5VA 2ZXHA 2KIQA 5FKMA 2CSOA 4RGRA 4A3GJ 2M8EA 1IZ1A 3VYSB 3KP4A 4IF4A 1D0YA 3N05A 4YFKF 2R7ZJ 3HRSA 1GV2A 2M3AA 2ZMEC 1IW7F 3H3ZA 3G4SI 4IHVA 3C1DA 1U2WA 2P7VB 3SFZA 1O3TA 3R0AA 2HVSA 4N9IA 3BG3A 4CCJA 1VQMI 1WJ5A 5DS9A 1WCMJ 2K27A 1YX5A 2G7HA 1OYYA 4S05A 3KZIC 3JRIA 3CUQA 3DQVC 2R5ZA 4UV8A 3CCVI 5FGMA 2F5FA 4RBOA 5JLWA 2FQ4A 1R1TA 1V54H 4B3AA 1FYLA 1ZKGA 2IAIA 4N4OB 1V55H 3FXKA 2YR2A 4MO7A 4F93B 1WH7A 2LY2A 2L7KA 3PFIA 3I0TA 2HKOA 2K5CA 1ETOA 3LSRA 5GTIC 5E79C 4XIDA 2BV6A 3R4KA 5EG0B 1OMIA 1R7JA 3OSFA 3C2BA 3F9KA 3OMYA 3LA7A 3TL4X 2K9QA 4I02A 4KMFA 4AWXB 4QSHA 3JSPA 2LP0A 4B4CA 4PFOA 1F5TA 1K61A 2RREA 1ZGWA 1VQKI 4IHWA 2WY7Q 3ZN0A 5B1BH 2CQQA 2LKSA 1U3EM 1WFXA 3A01A 1TT0A 3JAMK 3AL0C 5L3DA 4XRSA 1BOAA 2A61A 2K4JA 3ASNH 4LFUA 4H4KC 3K2ZA 2KLOA 2O5RA 1SMTA 3A2KA 2H1LA 1D1AA 2WAEA 3HUGA 4A2UA 4EM2A 1I1GA 1TWCJ 5ILVA 1FC3A 2LTPA 5A2QZ 1HDPA 3K7AJ 3GYHX 3I53A 2CU7A 1R4MB 4LLLA 4E6KG 4RB3C 4A3FJ 5EJCA 1LFPA 3W2VA 1QHHD 5D8LB 1X3ZB 2CJJA 4XONA 1YRNA 2M4KA 4KJZA 2CYYA 3CJQB 4OIRF 4D5CA 1I50J 3ECHA 5C4JJ 1JTYA 1XSDA 1X58A 2V9VA 3AG1H 4CCMA 2J5PA 5C3EJ 1LDJA 2K7LA 2KL4A 2Y0MA 3S1MJ 3I58A 1RUOA 3F8CA 2PI0A 4ETSA 1XMAA 3ZMZA 1XD7A 3OIQA 4ESFA 4PSXA 5CYVA 3JRDA 4HZFA 4XLAA 1RRJA 2W25A 4U88A 4RDUA 5DDGA 1X1PA 1Q1HA 1W5SA 2BW3B 3ERMA 1UG2A 4DIQA 2F5DA 5L3BA 4WXCA 2XHKA 1WH5A 2E7XA 3I5UA 2VIXA 3T5XA 2ICWG 3MN2A 3W3CA 2XV4S 3K6GA 3LNQA 1ZHFA 1YJWI 2R92J 2ZSHB 1O3QA 3LAJA 4EJTA 2R7RA 1A31A 3BZCA 2WY8Q 3ZMVA 4O5VA 1XG1A 5EEAA 1PUFB 3DBLB 4XK4A 3KFWX 3KEOA 1GLNA 3HSRA 3OL3A 5J3LA 1UJ8A 1JI8A 4XRMA 3OV8A 1U5TC 2XAFA 1S6LA 2MLGA 1H89C 3U21A 3JRAA 2R7UA 2KT0A 1TQMA 1VTNC 2A6EF 2K9NA 1O7FA 1NHAA 3VSLA 2L2OA 4WXHA 3S15J 3SJMA 1E0EA 3RYPA 2MABA 1FZPB 4BDZA 5DD8A 1G6NA 2H6CA 2L9RA 1W7PD 5HDGA 4E7ZA 1YIJI 2RNGA 2UUZA 1XPXA 5ICFA 2TDXA 2DDBA 4RAYA 3GUDA 2IT0A 1BR4A 2MH2A 4IZZA 2E5NA 2VKDA 5B66C 2CQ7A 3I56I 2FBIA 1ERDA 4PZJA 3MZ8A 1MH4A 2V79A 2GA1A 1OPCA 2LOOA 4U0WA 5GPAA 4A3IJ 1FTTA 1TP4A 4A5NA 4D7NA 1NH3A 3ZOBA 1GVDA 2Z9OA 2HPIA 5IYBJ 4I99C 4L5JA 4AIJA 5EZGA 3CDIA 3F6OA 3OYBA 5E20A 2EBIA 2VQGA 2E1NA 2XROA 2R5YA 1S7OA 2M7BA 4LGWA 2DFEA 3LQQA 3LSHA 4M9XA 1QBJA 3TW7A 4DW6A 3KP7A 3SHFA 1MBFA 4MEYF 4ZTFA 4DYRA 1J75A 5CPRB 1TTYA 5FKKA 1VI0A 1HSTA 4FT8A 4ZYEA 2BY0A 5IYCJ 4IHSA 3CMAI 2QQBA 1JGSA 2CQKA 3HTSB 3S3MA 1ZRDA 2M7AA 1RETA 1UAAA 1Y1WJ 1ZQ3P 3J7YJ 3OYLA 5LGNA 1GT0C 1BIBA 2JA5J 1LJ9A 2FBHA 2LVSA 4XKBA 1MW7A 5D6EA 1U9NA 1D1BA 1U0JA 3CCRI 3S2HJ 3CMMA 4ZDLA 1J09A 1Z21A 2CO5A 4IRGA 3JR9A 2CV0A 4NHJA 3FXOA 1VQOI 2EJRA 3WU2C 3AKZA 4IQ4A 2M5WA 1IN6A 4HQMA 4HNUA 5KHDA 2ISZA 3KLNA 5LEKA 1MMAA 2EV5A 1SAUA 4IJAA 3DPLC 1FP2A 4FX4A 2NS8A 1KU2A 4CHUA 1TNSA 4ZYHA 3G73A 2K9LA 3L9FA 3LMMA 4V2GA 1YW8A 3K0LA 1J59A 1XMXA 2BGCA 2BVMA 3PSIA 2FMLA 1LVAA 3H9JA 2E19A 1BI3A 2YUSA 4XRSG 1OISA 3F72A 2GXBA 5E3LA 2IGKA 3TGNA 3QU3A 2AXLA 1TQPA 2OCEA 3BP8A 1ZG5A 2QQAA 2HXIA 2F2EA 2A68F 2DFIA 2XRNA 2IGMA 1STZA 1FNNA 3GTJJ 3L00A 1OR7C 4C3JJ 2MLKA 4A93J 1A6IA
chains in the Genus database with same CATH topology
3RQIA 2ID6A 3Q0UA 3OSGA 3TW6A 3HOXJ 2PMZN 1IUFA 2DN0A 1IDYA 1DU6A 4S0HB 3JRBA 2NVTJ 4AC0A 3BR1A 2KDZA 4UUTA 1MBEA 3ZQHA 4LOCA 3SDGA 4B1RA 2HQ5A 2K9SA 5M5WJ 1IDZA 5IP9J 4A3JJ 1MSFC 1BA5A 1AKHA 2D5VA 1UMQA 5J1UA 3GBGA 2ID3A 5FKOA 2JK3A 3QPLA 4A3BJ 3HKZN 3W6VA 1T33A 3A02A 4JYKA 4JX5A 1O4XA 1ZR4A 1B72B 4M3GA 1Y1VJ 5FLMJ 2JA7J 2TRTA 1ETWA 3TP3A 3H3VK 2MSYA 3G1OA 3LSGA 2GLOA 2GM4A 2OF7A 2DMTA 4Y52J 1FIAA 2XGEA 5IOZA 2XPWA 1JJ8C 1JKPC 2AO9A 1IC8A 4GFBA 1WPKA 4Y7NJ 4BBRJ 1MBKA 3HDDA 5K7ZA 3ZQFA 4FE7A 3ZQGA 2XB5A 3QPSA 3LOCA 1POGA 4A3DJ 1F36A 2EZLA 2JN6A 1ZR2A 1IJWC 1ETQA 5IP7J 1TWAJ 4JP0A 1JUSA 2GBYA 3BR2A 1WI3A 1LE8A 2RAEA 5HODA 1JKRC 1QVTA 1NK2P 3S2DJ 2M2EA 5J1YA 3TEDA 2FD5A 1JJ6C 1SFOJ 3HBLA 1BJZA 2NVQJ 1LFBA 3JRHA 4W97A 1MNMC 3DEWA 3CMYA 3IV5A 1DU0A 3OOUA 2IEKA 2I10A 5FKNA 2E2JJ 4D7MA 2HYJA 3BT9A 5EF6A 2JA6J 3O8HA 4MLOA 1LFUP 1QPIA 2TCTA 1ETVA 2QCOA 3K2AA 1AKHB 1ETYA 5F0HA 3BTCA 1OFCX 3HGYA 3S1QJ 5EDNA 4FCYA 5F0CA 3PO3J 5F08A 2DMUA 2EH3A 3RZDJ 2JWTA 1ETKA 2Y9YA 2NS7A 4BY7J 3LSPA 2E2IJ 1FJLA 3FIWA 3M3YJ 1P7JA 3BG5A 2LD5A 1A5JA 5J1RA 4BBSJ 1D5YA 3IH2A 5IP6A 2LR8A 2MG4A 1BW6A 1TWGJ 1BL0A 2M8GX 2DA4A 1XC5A 2HI3A 1IRZA 2ME6A 3TP0A 1X2NA 4FE4A 4X1EA 4IEJA 1Z0XA 4A3CJ 1LE8B 3GTPJ 2Y30A 2VPRA 2WV1A 4X6AJ 2FX0A 1TC3C 1ZK8A 1UHSA 4QIWN 1P7IA 2VKEA 2L7FP 2X9DA 3Q0VA 3HM5A 3HOVJ 3FISA 4NDLA 1SANA 5K7HA 3BR0A 1MSEC 5EZHA 2FJ1A 4XICA 2DA7A 2LFBA 3ZQCA 1IV6A 2HOTA 2EZKA 4AYBN 4IHYA 2ELKA 3BQZA 2AHQA 2YU9J 2IBDA 1JKQC 4M3FA 1BW5A 5C4XJ 1QVUA 5FKMA 2HXOA 4I6ZA 2N8GA 4A3GJ 2Y0SN 4W1UA 2R7ZJ 1HF0A 1RKWA 2DMPA 1GV2A 4IHVA 2X6OA 3CDLA 2XSDC 2DMQA 3BTIA 3BG3A 2M34A 5DS9A 1IGNA 1WCMJ 2XGCA 1OCPA 5JLXA 3JRIA 5F04A 1YRNB 3PO2J 3GTQJ 2XRLA 2R5ZA 1G2HA 4RBOA 5JLWA 2DTZA 2FQ4A 5BNGA 3HB9A 4B3AA 4C3IJ 1ZKGA 2DA2A 2IAIA 2VI6A 4MO7A 3SFIA 2Y2ZA 1WH7A 4FTHA 1U9OA 1ETOA 3LSRA 4XIDA 4A69C 5EG0B 2M0CA 3OSFA 3C2BA 3FK7A 2YS9A 3E7LA 2HOSA 1H8AC 3BR5A 4JX6A 2K9QA 4QSHA 2L7ZA 2LP0A 4B4CA 1Q1VA 1ORKA 5E3NA 2XB0X 2X48A 1PUFA 1K61A 1ZGWA 3M4OJ 3IH4A 4IHWA 5IYDJ 1TWFJ 3FK6A 2NVXJ 2CQQA 3GTOJ 3A01A 3CCYA 4UUSA 1VFCA 4XRSA 3MKLA 1ENHA 4A3KJ 1F43A 2LLKA 2W48A 1RPWA 1AHDP 4C3HJ 2L7MP 2JA8J 3HEFA 3UKGA 5E3OA 3ZQLA 1TWCJ 2WB1N 3O8GA 1B8IA 4MFEA 5IPAA 2LTPA 3S17J 2M9HA 5GP9A 2LK2A 2XGDA 1HDPA 3K7AJ 3WHBA 1QRYA 3HOUJ 2G0EA 4C2MJ 2O7OA 1K83J 2CU7A 1JUPA 4HNVA 4A3FJ 1W0TA 1JT0A 4M3BA 3G1LA 2CJJA 1YRNA 2VUMJ 1MH3A 4D5CA 1VNDA 1I50J 5C4JJ 1JTYA 4JX4A 1X2MA 1X58A 2DA5A 2EQRA 4DZPA 2O8KA 5C3EJ 1VF9A 2B63J 2H8RA 5K7FA 3S1MJ 2OPTA 3NARA 4DYCA 1GUUA 5F1JA 2ME0A 4A3LJ 3JRDA 3JRGA 4V2FA 2R5ZB 5EG0A 4RDUA 3BR6A 5C44J 1I3QJ 3BTLA 5EGOA 3Q3SA 1UG2A 5M5YJ 1JGGA 2XPVA 1MBGA 1WGXA 3BTJA 1WH5A 4CYCA 3HOZJ 3MN2A 4EEFG 3LNQA 2R92J 2CRGA 2ZB9A 3S1NJ 1APLC 2R5YB 2EZIA 1E3OC 1NTCA 4IHXA 4BKXA 3HOWJ 3D1NI 1XG1A 1FTZA 5EEAA 1XS9A 1PUFB 3IH3A 4XK4A 2ECBA 1H88C 3S16J 2DJNA 5J3LA 3I4MJ 1HDDC 3NAUA 4XRMA 3A01B 1ITYA 3JRFA 4UUSB 1OCTC 1RESA 1FEXA 1H89C 2HDDA 5DTDA 3JRAA 5GPCA 2COBA 2KT0A 4QTRA 3OIOA 2K9NA 3HOYJ 1S7EA 5F27A 2R0QC 1B8IB 3S15J 5FJ8J 3SJMA 4C3JJ 5M5XJ 3BQYA 1ETXA 5M3MJ 2L9RA 1GDTA 4M3EA 2LY9A 4A3EJ 3S1RJ 2L0KA 2CUEA 2DA3A 1HOMA 5IOYA 1MH4A 1JUMA 2HOAA 4A3IJ 2E2HJ 5GPAA 1FTTA 3GTLJ 3QQAA 4D7NA 1U8BA 3ZOBA 2Y31A 1GVDA 5IYBJ 1TWHJ 3Q0WA 2R93J 1GV5A 4ABZA 1NK3P 5EZGA 3HGGA 3GTKJ 5F0FA 1JKOC 2EBIA 4A3MJ 1CQTA 2R5YA 2WAQN 4M6VA 1MBHA 2JJ7A 5FKLA 2O9LA 5EGOB 3TW7A 3DCFA 3A03A 4BXXJ 4D5FA 4DW6A 1JTXA 5E3MA 1MBFA 3ZQIA 4DYRA 1FIPA 3JREA 4CYCB 3GTMJ 5FKKA 1VI0A 2DA1A 2MGQA 5IYCJ 4DYQA 2CUFA 1IG7A 1RETA 5M3FJ 1Y1WJ 1ZQ3P 1GT0C 3MVPA 2JA5J 3F0CA 2MW8A 4DZJA 1EF4A 3RKQA 1U78A 2LVSA 1W0UA 1U9NA 4J19A 3S2HJ 4L5EA 3WHCA 1MBJA 2DA6A 2QF7A 1ZTRA 4M3DA 3JR9A 1R9TJ 2EZHA 3LSJA 1T56A 1B72A 5EYRA 2H1KA 2E1OA 3FKIJ 3S14J 1HCRA 1RKTA 4FISA 2VKVA 4MIMA 1RR7A 3B6AA 2NS8A 2XPUA 2ECCA 3H0GJ 4AUXA 5FLVA 3CQZJ 4V2GA 3I4NJ 1AU7A 4I76A 2NVYJ 4MFDA 9ANTA 1HLVA 2DMNA 1Z77A 2E19A 2YUSA 4XRSG 3VPRA 3JRCA 2JMWA 2Y9ZA 5E3LA 4BY1J 3GTGJ 4G12A 3B6CA 2LKXA 2HXIA 3BG9A 2CQXA 2NOGA 3RZOJ 1OJLA 3G1MA 2P81A 1JT6A 3BR3A 3GTJJ 1I6HJ 2K40A 3PM1A 4A93J 1A6IA 3L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQI A;  2ID6 A;  3Q0U A;  3OSG A;  3TW6 A;  3HOX J;  2PMZ N;  1IUF A;  2DN0 A;  1IDY A;  1DU6 A;  4S0H B;  3JRB A;  2NVT J;  4AC0 A;  3BR1 A;  2KDZ A;  4UUT A;  1MBE A;  3ZQH A;  4LOC A;  3SDG A;  4B1R A;  2HQ5 A;  2K9S A;  5M5W J;  1IDZ A;  5IP9 J;  4A3J J;  1MSF C;  1BA5 A;  1AKH A;  2D5V A;  1UMQ A;  5J1U A;  3GBG A;  2ID3 A;  5FKO A;  2JK3 A;  3QPL A;  4A3B J;  3HKZ N;  3W6V A;  1T33 A;  3A02 A;  4JYK A;  4JX5 A;  1O4X A;  1ZR4 A;  1B72 B;  4M3G A;  1Y1V J;  5FLM J;  2JA7 J;  2TRT A;  1ETW A;  3TP3 A;  3H3V K;  2MSY A;  3G1O A;  3LSG A;  2GLO A;  2GM4 A;  2OF7 A;  2DMT A;  4Y52 J;  1FIA A;  2XGE A;  5IOZ A;  2XPW A;  1JJ8 C;  1JKP C;  2AO9 A;  1IC8 A;  4GFB A;  1WPK A;  4Y7N J;  4BBR J;  1MBK A;  3HDD A;  5K7Z A;  3ZQF A;  4FE7 A;  3ZQG A;  2XB5 A;  3QPS A;  3LOC A;  1POG A;  4A3D J;  1F36 A;  2EZL A;  2JN6 A;  1ZR2 A;  1IJW C;  1ETQ A;  5IP7 J;  1TWA J;  4JP0 A;  1JUS A;  2GBY A;  3BR2 A;  1WI3 A;  1LE8 A;  2RAE A;  5HOD A;  1JKR C;  1QVT A;  1NK2 P;  3S2D J;  2M2E A;  5J1Y A;  3TED A;  2FD5 A;  1JJ6 C;  1SFO J;  3HBL A;  1BJZ A;  2NVQ J;  1LFB A;  3JRH A;  4W97 A;  1MNM C;  3DEW A;  3CMY A;  3IV5 A;  1DU0 A;  3OOU A;  2IEK A;  2I10 A;  5FKN A;  2E2J J;  4D7M A;  2HYJ A;  3BT9 A;  5EF6 A;  2JA6 J;  3O8H A;  4MLO A;  1LFU P;  1QPI A;  2TCT A;  1ETV A;  2QCO A;  3K2A A;  1AKH B;  1ETY A;  5F0H A;  3BTC A;  1OFC X;  3HGY A;  3S1Q J;  5EDN A;  4FCY A;  5F0C A;  3PO3 J;  5F08 A;  2DMU A;  2EH3 A;  3RZD J;  2JWT A;  1ETK A;  2Y9Y A;  2NS7 A;  4BY7 J;  3LSP A;  2E2I J;  1FJL A;  3FIW A;  3M3Y J;  1P7J A;  3BG5 A;  2LD5 A;  1A5J A;  5J1R A;  4BBS J;  1D5Y A;  3IH2 A;  5IP6 A;  2LR8 A;  2MG4 A;  1BW6 A;  1TWG J;  1BL0 A;  2M8G X;  2DA4 A;  1XC5 A;  2HI3 A;  1IRZ A;  2ME6 A;  3TP0 A;  1X2N A;  4FE4 A;  4X1E A;  4IEJ A;  1Z0X A;  4A3C J;  1LE8 B;  3GTP J;  2Y30 A;  2VPR A;  2WV1 A;  4X6A J;  2FX0 A;  1TC3 C;  1ZK8 A;  1UHS A;  4QIW N;  1P7I A;  2VKE A;  2L7F P;  2X9D A;  3Q0V A;  3HM5 A;  3HOV J;  3FIS A;  4NDL A;  1SAN A;  5K7H A;  3BR0 A;  1MSE C;  5EZH A;  2FJ1 A;  4XIC A;  2DA7 A;  2LFB A;  3ZQC A;  1IV6 A;  2HOT A;  2EZK A;  4AYB N;  4IHY A;  2ELK A;  3BQZ A;  2AHQ A;  2YU9 J;  2IBD A;  1JKQ C;  4M3F A;  1BW5 A;  5C4X J;  1QVU A;  5FKM A;  2HXO A;  4I6Z A;  2N8G A;  4A3G J;  2Y0S N;  4W1U A;  2R7Z J;  1HF0 A;  1RKW A;  2DMP A;  1GV2 A;  4IHV A;  2X6O A;  3CDL A;  2XSD C;  2DMQ A;  3BTI A;  3BG3 A;  2M34 A;  5DS9 A;  1IGN A;  1WCM J;  2XGC A;  1OCP A;  5JLX A;  3JRI A;  5F04 A;  1YRN B;  3PO2 J;  3GTQ J;  2XRL A;  2R5Z A;  1G2H A;  4RBO A;  5JLW A;  2DTZ A;  2FQ4 A;  5BNG A;  3HB9 A;  4B3A A;  4C3I J;  1ZKG A;  2DA2 A;  2IAI A;  2VI6 A;  4MO7 A;  3SFI A;  2Y2Z A;  1WH7 A;  4FTH A;  1U9O A;  1ETO A;  3LSR A;  4XID A;  4A69 C;  5EG0 B;  2M0C A;  3OSF A;  3C2B A;  3FK7 A;  2YS9 A;  3E7L A;  2HOS A;  1H8A C;  3BR5 A;  4JX6 A;  2K9Q A;  4QSH A;  2L7Z A;  2LP0 A;  4B4C A;  1Q1V A;  1ORK A;  5E3N A;  2XB0 X;  2X48 A;  1PUF A;  1K61 A;  1ZGW A;  3M4O J;  3IH4 A;  4IHW A;  5IYD J;  1TWF J;  3FK6 A;  2NVX J;  2CQQ A;  3GTO J;  3A01 A;  3CCY A;  4UUS A;  1VFC A;  4XRS A;  3MKL A;  1ENH A;  4A3K J;  1F43 A;  2LLK A;  2W48 A;  1RPW A;  1AHD P;  4C3H J;  2L7M P;  2JA8 J;  3HEF A;  3UKG A;  5E3O A;  3ZQL A;  1TWC J;  2WB1 N;  3O8G A;  1B8I A;  4MFE A;  5IPA A;  2LTP A;  3S17 J;  2M9H A;  5GP9 A;  2LK2 A;  2XGD A;  1HDP A;  3K7A J;  3WHB A;  1QRY A;  3HOU J;  2G0E A;  4C2M J;  2O7O A;  1K83 J;  2CU7 A;  1JUP A;  4HNV A;  4A3F J;  1W0T A;  1JT0 A;  4M3B A;  3G1L A;  2CJJ A;  1YRN A;  2VUM J;  1MH3 A;  4D5C A;  1VND A;  1I50 J;  5C4J J;  1JTY A;  4JX4 A;  1X2M A;  1X58 A;  2DA5 A;  2EQR A;  4DZP A;  2O8K A;  5C3E J;  1VF9 A;  2B63 J;  2H8R A;  5K7F A;  3S1M J;  2OPT A;  3NAR A;  4DYC A;  1GUU A;  5F1J A;  2ME0 A;  4A3L J;  3JRD A;  3JRG A;  4V2F A;  2R5Z B;  5EG0 A;  4RDU A;  3BR6 A;  5C44 J;  1I3Q J;  3BTL A;  5EGO A;  3Q3S A;  1UG2 A;  5M5Y J;  1JGG A;  2XPV A;  1MBG A;  1WGX A;  3BTJ A;  1WH5 A;  4CYC A;  3HOZ J;  3MN2 A;  4EEF G;  3LNQ A;  2R92 J;  2CRG A;  2ZB9 A;  3S1N J;  1APL C;  2R5Y B;  2EZI A;  1E3O C;  1NTC A;  4IHX A;  4BKX A;  3HOW J;  3D1N I;  1XG1 A;  1FTZ A;  5EEA A;  1XS9 A;  1PUF B;  3IH3 A;  4XK4 A;  2ECB A;  1H88 C;  3S16 J;  2DJN A;  5J3L A;  3I4M J;  1HDD C;  3NAU A;  4XRM A;  3A01 B;  1ITY A;  3JRF A;  4UUS B;  1OCT C;  1RES A;  1FEX A;  1H89 C;  2HDD A;  5DTD A;  3JRA A;  5GPC A;  2COB A;  2KT0 A;  4QTR A;  3OIO A;  2K9N A;  3HOY J;  1S7E A;  5F27 A;  2R0Q C;  1B8I B;  3S15 J;  5FJ8 J;  3SJM A;  4C3J J;  5M5X J;  3BQY A;  1ETX A;  5M3M J;  2L9R A;  1GDT A;  4M3E A;  2LY9 A;  4A3E J;  3S1R J;  2L0K A;  2CUE A;  2DA3 A;  1HOM A;  5IOY A;  1MH4 A;  1JUM A;  2HOA A;  4A3I J;  2E2H J;  5GPA A;  1FTT A;  3GTL J;  3QQA A;  4D7N A;  1U8B A;  3ZOB A;  2Y31 A;  1GVD A;  5IYB J;  1TWH J;  3Q0W A;  2R93 J;  1GV5 A;  4ABZ A;  1NK3 P;  5EZG A;  3HGG A;  3GTK J;  5F0F A;  1JKO C;  2EBI A;  4A3M J;  1CQT A;  2R5Y A;  2WAQ N;  4M6V A;  1MBH A;  2JJ7 A;  5FKL A;  2O9L A;  5EGO B;  3TW7 A;  3DCF A;  3A03 A;  4BXX J;  4D5F A;  4DW6 A;  1JTX A;  5E3M A;  1MBF A;  3ZQI A;  4DYR A;  1FIP A;  3JRE A;  4CYC B;  3GTM J;  5FKK A;  1VI0 A;  2DA1 A;  2MGQ A;  5IYC J;  4DYQ A;  2CUF A;  1IG7 A;  1RET A;  5M3F J;  1Y1W J;  1ZQ3 P;  1GT0 C;  3MVP A;  2JA5 J;  3F0C A;  2MW8 A;  4DZJ A;  1EF4 A;  3RKQ A;  1U78 A;  2LVS A;  1W0U A;  1U9N A;  4J19 A;  3S2H J;  4L5E A;  3WHC A;  1MBJ A;  2DA6 A;  2QF7 A;  1ZTR A;  4M3D A;  3JR9 A;  1R9T J;  2EZH A;  3LSJ A;  1T56 A;  1B72 A;  5EYR A;  2H1K A;  2E1O A;  3FKI J;  3S14 J;  1HCR A;  1RKT A;  4FIS A;  2VKV A;  4MIM A;  1RR7 A;  3B6A A;  2NS8 A;  2XPU A;  2ECC A;  3H0G J;  4AUX A;  5FLV A;  3CQZ J;  4V2G A;  3I4N J;  1AU7 A;  4I76 A;  2NVY J;  4MFD A;  9ANT A;  1HLV A;  2DMN A;  1Z77 A;  2E19 A;  2YUS A;  4XRS G;  3VPR A;  3JRC A;  2JMW A;  2Y9Z A;  5E3L A;  4BY1 J;  3GTG J;  4G12 A;  3B6C A;  2LKX A;  2HXI A;  3BG9 A;  2CQX A;  2NOG A;  3RZO J;  1OJL A;  3G1M A;  2P81 A;  1JT6 A;  3BR3 A;  3GTJ J;  1I6H J;  2K40 A;  3PM1 A;  4A93 J;  1A6I A;  3L1P A; 
#chains in the Genus database with same CATH topology
 4ZJZ A;  2L02 A;  3HPG A;  2ID6 A;  5HDN A;  1A04 A;  2CFX A;  2PX9 A;  1R1U A;  3BJO A;  4KT5 C;  3WOD F;  3HOX J;  2ESN A;  3ONQ A;  1XB4 A;  4F91 B;  2V9K A;  4LLG F;  1Z3Y A;  5E1X A;  5J47 A;  1ZRF A;  1B6A A;  4KDP A;  3QPH A;  5GAH J;  4UUT A;  3GCM A;  4A0Y A;  3ZQH A;  3SDG A;  4F3Q A;  3CUO A;  3K1P A;  1FYM A;  2LYC A;  3H5A A;  3WTX C;  1D5V A;  4M72 A;  5IP9 J;  1ZRE A;  5K1Y A;  1UMQ A;  5J1U A;  2H6B A;  3GBG A;  2QBY B;  3V8L A;  2DO7 A;  5FKO A;  4D9J A;  3QPL A;  3HKZ N;  2HKX A;  3A02 A;  4UXN A;  4JYK A;  4JX5 A;  2GAU A;  4HNT A;  1B72 B;  2ZME A;  1R00 A;  1Y1V J;  4HQE A;  1ETW A;  4AIH A;  1ONV A;  1R4N B;  3EYY A;  4E7J A;  4E70 A;  4GYG A;  2GLO A;  2EFQ A;  1FX7 A;  1WQ2 A;  2XGE A;  3JSO A;  1YFH A;  1JKP C;  2VE8 A;  2AO9 A;  2HS5 A;  5IT9 K;  4GFB A;  2X6W A;  3CUQ C;  3L7W A;  3IL2 A;  2BZT A;  3E5Q A;  1MBK A;  1KU7 A;  4XR6 A;  3CLQ A;  4FE7 A;  2XB5 A;  3VOE A;  1L0O C;  4BQO A;  1OYW A;  3LOC A;  4A3D J;  4G8X A;  5J40 A;  4AIK A;  1E3H A;  3TBI A;  2JN6 A;  3FXQ A;  1Y56 A;  3HOT A;  1IJW C;  1TWA J;  1KYZ A;  1KZH A;  5HLH A;  2M45 A;  1WI3 A;  4C2U A;  2RN7 A;  3PNY A;  5D4S A;  1QVT A;  1DGR M;  3S2D J;  3N4M A;  5B1A H;  2A69 F;  3OYA A;  4EM0 B;  1UHM A;  5J1Y A;  3TED A;  3K70 C;  1OQY A;  2WV0 A;  3PNT A;  1WRJ A;  3DKY A;  1JJ6 C;  4HF1 A;  4C30 A;  1BJZ A;  2NS0 A;  3JRH A;  3CMY A;  3FMQ A;  3BJA A;  2KRC A;  1Z91 A;  3H5N A;  2VBW A;  3WE3 A;  2GZW A;  3H9G A;  2LRE A;  3IP4 B;  4A6D A;  2KZG A;  2HYJ A;  5DEQ A;  1YS6 A;  3BT9 A;  2JA6 J;  2DT6 A;  3WGG A;  4MLO A;  1LFU P;  1J7K A;  1TZL A;  1FBQ A;  2HZT A;  3RKX A;  3ISP A;  3S3N A;  3DWL E;  1AKH B;  3J7A Y;  1LKX A;  5HS9 A;  3I71 A;  5L3C A;  3M8E A;  3PO3 J;  2P7C B;  3RZD J;  5DCM B;  2IA0 A;  2B9S A;  3LA3 A;  3BPX A;  3M1C A;  4LB6 B;  3S32 A;  3MAJ A;  5KAI C;  4RS8 A;  4CDG A;  2OQG A;  2ETH A;  2VT3 A;  3QOP A;  2JRM A;  1G3Y A;  3KX2 A;  3NRV A;  1AWC A;  3FIW A;  2JQ7 A;  1NG6 A;  4IXA A;  1P7J A;  2FXA A;  3HKZ A;  2LD5 A;  3CD6 I;  3GZ6 A;  5H6R A;  2OTJ I;  2F48 A;  4AM3 A;  2EIJ H;  2CUJ A;  2DJI A;  2MD0 A;  1PJR A;  3CC7 I;  3V8K A;  4N0B A;  1X4P A;  2QM3 A;  2VC0 A;  1DP3 A;  1KQ8 A;  4XSX F;  3FM5 A;  3L09 A;  5IP6 A;  1ZAR A;  2LR8 A;  2MG4 A;  1BW6 A;  4BHB A;  1TWG J;  4O3M A;  3CUQ B;  1WJA A;  4R1H A;  2HZD A;  1BL0 A;  5D4R A;  1XC5 A;  2HI3 A;  1IRZ A;  1X2N A;  1J9I A;  4XSZ F;  4BAC A;  3OYC A;  3PQK A;  3GTP J;  3KP5 A;  2LH9 A;  3OY9 A;  2VPR A;  4X6A J;  1TC3 C;  2FBK A;  2YX7 A;  4EJO A;  3RSN A;  4G7O F;  4D1Q A;  4B44 A;  2A6T A;  4XN0 A;  4U87 A;  1SAN A;  4E7K A;  4HDU A;  5K7H A;  5HS7 A;  2VOD A;  5ILU A;  2EFP A;  3H5R A;  4ZZD A;  1MSE C;  2FJ1 A;  4XLH A;  2ELJ A;  3HRU A;  4XIC A;  2DA7 A;  3ZQC A;  2M1B A;  3OL4 A;  3KYC B;  2PLY A;  5LGU A;  3LSK A;  3BQZ A;  3I9V 2;  2AHQ A;  5K5R A;  2YU9 J;  4HSR A;  1JKQ C;  1BW5 A;  2ZNZ A;  1QVU A;  2HGC A;  2NOJ B;  1XDU A;  4KYW A;  5JI6 A;  1IXC A;  2VBX A;  4YII A;  2IXS A;  4Z6Y A;  4OWR B;  4NC6 A;  4W1U A;  4XLP F;  1K4T A;  2A05 A;  1SFU A;  4B47 A;  5H2F C;  3HUG B;  4M6X A;  4M71 A;  4GDF A;  1KU3 A;  3CDL A;  6PAX A;  2XSD C;  2PFB A;  1ZH5 A;  3BTI A;  1IXS B;  5D5X B;  4ZDP A;  2UV1 A;  3EUH C;  4E7L A;  2WBM A;  2XGC A;  3G6E I;  3HYI A;  4L9J A;  2Q2E B;  2CV1 A;  4HDV A;  2AS5 F;  1YRN B;  4I09 A;  2XRL A;  5FD6 A;  3I59 A;  1MJA A;  2DTZ A;  5BNG A;  4EGY A;  2E71 A;  2DA2 A;  3K4N A;  3LA2 A;  2WAD A;  5HLI A;  4FX0 A;  3DBH B;  4FTH A;  2O6G E;  3CTA A;  1D8K A;  2LY1 A;  1R23 A;  4A69 C;  3L2V A;  2M0C A;  2K4B A;  5CQG A;  4ENM A;  4D0P A;  3CLO A;  5FRM A;  2YS9 A;  3E7L A;  2HOS A;  2IRF G;  1H8A C;  3BR5 A;  5FRN A;  1RI7 A;  1KU9 A;  2DCE A;  5E3N A;  2X48 A;  5DUK A;  1P4W A;  3M4O J;  3IH4 A;  4II2 A;  2GOM A;  2NVX J;  3CCY A;  4UUS A;  4BUP A;  4CO8 A;  1VFC A;  3FM3 A;  3GFI A;  2B7E A;  1ENH A;  4UY8 I;  4RB0 A;  3GZN B;  4EGZ A;  1RPW A;  3KP6 A;  2L7M P;  4RA2 A;  5E3O A;  1UB9 A;  3FBN B;  3ZQL A;  2WB1 N;  3O8G A;  1B8I A;  2K02 A;  3S17 J;  2LK2 A;  3WHB A;  5FLX Z;  3KP2 A;  4C2M J;  2O7O A;  1JUP A;  3BLY A;  3Q9V A;  4LIT A;  2MBF A;  4HNV A;  1W0T A;  1JT0 A;  4M3B A;  4UVA A;  3J81 Z;  2RDP A;  4HA8 A;  3GFL A;  2ZCW A;  4XKV A;  4BEH B;  4CCO A;  2XGX A;  3DPT A;  3DU6 A;  1K78 A;  1IG7 A;  5JFR A;  4BE1 A;  1X2M A;  3R60 A;  5CVJ A;  2DA5 A;  1VF9 A;  4YG2 F;  3CC2 I;  3T8R A;  2B63 J;  5GAG J;  3CF5 F;  2LF8 A;  4IRI A;  4LD5 A;  4DYC A;  1HSJ A;  1BI0 A;  2R7Q A;  2ME0 A;  5F1J A;  1Y39 A;  2V7F A;  3BCB A;  5CQE A;  4S04 A;  2HDC A;  1E17 A;  3QYE A;  4UHT A;  5HNH A;  1N77 A;  2DFF A;  2ZJP F;  2L5Q A;  4ENN A;  1W7P B;  3GO5 A;  4RAF A;  2GOX B;  3IHU A;  3RKW A;  2HQN A;  5D8K B;  3S3O A;  4IQJ A;  2IW5 A;  2WA0 A;  5C44 J;  2H27 A;  5EEH A;  3L2C A;  1R6R A;  1XGN A;  2LRD A;  5EGO A;  4ZC3 A;  1LQ1 A;  3Q3S A;  1LEA A;  4QLC U;  3HIF A;  5M5Y J;  2K85 A;  2XPV A;  4EMS A;  1VQ9 I;  2R7F A;  2HWV A;  3IWF A;  2VBY A;  2VJI A;  2CRG A;  2ZB9 A;  4PGG A;  3S1N J;  1R49 A;  2Z16 A;  4HRI A;  2M4G A;  4IVN A;  2R5Y B;  3HZJ A;  1E3O C;  3CJN A;  4IHX A;  4BKX A;  4BHP A;  3D1N I;  2STW A;  3RPU A;  1FTZ A;  2F6C A;  1ZG1 A;  1ZYR F;  3IH3 A;  1YI2 I;  4EV0 A;  1H9G A;  3VYU B;  2ECB A;  1H88 C;  3F8N A;  3D5L A;  3CZ6 A;  1FOK A;  2CG4 A;  1EV7 A;  4XOP A;  3JRF A;  5HLT A;  3DEU A;  1MDM A;  2OTL I;  1FEX A;  5BOX A;  2Q8K A;  3O6B B;  4RAZ A;  4B48 A;  2HDD A;  5DTD A;  2GXG A;  5GPC A;  2FOK A;  1TBX A;  3OIO A;  5HLG A;  1S72 I;  1S7E A;  5CKT A;  5F27 A;  4HBL A;  3RYR A;  5D5V B;  2ZNY A;  4NQW B;  4MTD A;  3K1N A;  2Z33 A;  3C18 A;  4F92 B;  2M87 A;  3V7S A;  3HC7 A;  2JTV A;  4NNJ A;  4A0X A;  4BHC A;  1GDT A;  2VT2 A;  3EQL F;  3F8B A;  3GLL A;  4M3E A;  2LY9 A;  4BQN A;  3J80 K;  4A3E J;  3S1R J;  3OYG A;  2GQQ A;  2WB1 A;  4BGD A;  1N25 A;  2CUE A;  3SEQ A;  3WG9 A;  1W36 C;  4I7H A;  4A12 A;  1X3U A;  4BNC A;  1K4S A;  2E2H J;  3OR2 C;  3GTL J;  1U8B A;  2Y31 A;  2X6X A;  1TWH J;  3K4B A;  3Q0W A;  2R93 J;  3E6B A;  2ZXW H;  5KNL A;  5L3E A;  4ABZ A;  4ASN A;  1JKO C;  3K70 D;  3DKW A;  2YX4 A;  4M6V A;  2HQA A;  5FKL A;  2CMP A;  4CYD A;  3DCF A;  3A03 A;  4BXX J;  4D5F A;  3L2R A;  2QSH X;  5E3M A;  1KQ0 A;  5LFA A;  1FIP A;  3JRE A;  4CYC B;  1SVM A;  3S93 A;  2RQQ A;  5TGT A;  1FMW A;  3K4K A;  3QP5 A;  2EPF A;  2R7V A;  5LRS A;  2ISY A;  4DZJ A;  2A5Y B;  3MKW B;  4U0V A;  4Y17 A;  4JK1 X;  1MND A;  2OQR A;  4BYY A;  1X1C A;  2ZKZ A;  3WHC A;  4LIV A;  5K5Q A;  1A35 A;  1MBJ A;  2DYS H;  5F1R A;  2FSW A;  4EJV A;  1B1B A;  1ZTR A;  4OMY A;  2CUZ A;  4KUM A;  3REO A;  1T56 A;  1WJE A;  3TO9 A;  5EYR A;  3ZP5 A;  3PJR A;  2H1K A;  4AYB A;  1T8I A;  5LHI A;  5DCF A;  3DFG A;  1RKT A;  2PMU A;  2LG4 A;  1R22 A;  2VKV A;  3ASO H;  4FIS A;  2OUM A;  4OIQ F;  4MIM A;  2F5C A;  1JHH A;  2EA4 A;  2XPU A;  2RV8 A;  1ZLJ A;  3CCU I;  2ZME B;  2BVL A;  5FLV A;  3CQZ J;  1WI9 A;  1XDS A;  2QZ8 A;  1JHF A;  2I8D A;  1X3W B;  1HLV A;  2DMN A;  1Z77 A;  1G59 A;  2ACJ A;  3P9C A;  3VPR A;  4XLN F;  1P9Q C;  1P6R A;  2X1D A;  3BDD A;  3ROU A;  4G12 A;  3B6C A;  1XGO A;  2LF7 A;  4A6E A;  3M7G A;  3BR3 A;  2K40 A;  3PM1 A;  1SVO A;  3L1P A;  2IS6 A;  3Q0U A;  4OAZ A;  4OIN F;  3S8P A;  3TW6 A;  1OLT A;  1Y8Q B;  2DBB A;  1IUF A;  1IDY A;  2P4W A;  4S0H B;  3SZG A;  2A3S A;  2PQ8 A;  3QU6 A;  2JSP A;  3JRB A;  1UST A;  2NNN A;  1DPU A;  4RGX A;  2BHY A;  2E7W A;  3DTI A;  4LOC A;  5KVR A;  4B1R A;  3FXL A;  4IRH A;  2HR3 A;  4M9Z A;  4QPO A;  3QYF A;  5E8I A;  4CZC A;  4P9U A;  4A3J J;  1D0Z A;  5TRD A;  3RJP A;  3MMY B;  4BQQ A;  3JW4 A;  3AL0 B;  3OYM A;  1K6Y A;  2WWY A;  3W6V A;  5ICE A;  4PJM A;  2Y75 A;  2ZO4 A;  2EV6 A;  1ZR4 A;  3PNV A;  2K3F A;  4G9Y A;  2DOE A;  4L0Y B;  3IKV A;  3ZCO A;  5BPI A;  3H3V K;  2DOF A;  1DP7 P;  5L3G A;  1HKQ A;  2IPQ X;  2MSY A;  3G1O A;  3KIO A;  3LSG A;  2PBI A;  4Y52 J;  3GME A;  2VQL A;  1M1E B;  3EUH A;  4MQ9 F;  5IOZ A;  4E7I A;  2BXZ A;  4YIR X;  1QGP A;  3PUB A;  4X0G A;  1WJD A;  2O0Y A;  4Y7N J;  3RTR A;  4BBR J;  1B9M A;  1TW2 A;  3BG6 A;  3GLX A;  3ZQF A;  1C0W A;  2FEZ A;  2KDO A;  2KRF A;  3QPS A;  1P92 A;  3ZXS A;  4BQA A;  2VLA A;  2KZV A;  1ZR2 A;  2O8X A;  2JZY A;  1XTA A;  2P6S A;  5IP7 J;  2MYS A;  4JP0 A;  4EVI A;  1GXQ A;  1XCV A;  2X85 A;  2GBY A;  1QQI A;  3T1B A;  1LE8 A;  5HOD A;  1JKR C;  2P6T A;  1BR1 A;  2E60 A;  4A0Z A;  4GO1 A;  4DGW B;  2E34 A;  1LFB A;  4W97 A;  2W1O A;  3DKX A;  3H36 A;  1UG0 A;  3DEW A;  5DM7 F;  4CIC A;  1SFK A;  1DU0 A;  4E4H A;  3OOU A;  2GIV A;  4ZYA A;  2OV7 A;  3HJE A;  2I10 A;  1MMN A;  3TOA A;  3V7C A;  1MJB A;  2FOW A;  4XQF A;  3P9I A;  1HW2 A;  2BY3 A;  5IT3 A;  1K6O A;  3B73 A;  2TCT A;  3PIO F;  1ETV A;  3FXJ A;  5BMZ A;  4MQV A;  4CXF A;  3NWS A;  2MFZ A;  4FHT A;  1O3S A;  1YJN I;  5DYM A;  3F8F A;  3HGY A;  4J00 A;  1U5T B;  1YLF A;  5EDN A;  5H6Q A;  2EH3 A;  4HPQ A;  1D3Y A;  4H0E A;  1MNE A;  2STT A;  2NS7 A;  2KIF A;  3UR3 C;  1R1V A;  4BY7 J;  1W4M A;  2X1E A;  3LSP A;  1A36 A;  2IS2 A;  3M9A A;  3CCJ I;  3M3Y J;  3JTG A;  4PGH A;  2W24 A;  2VN2 A;  3BG5 A;  1ZN2 A;  3O3K A;  3I3L A;  2HEO A;  4KT6 A;  2KQR A;  4IOA F;  4MGR A;  5HOO A;  2EIN H;  3WTW C;  2HTJ A;  4RM2 A;  3CO6 C;  3OYN A;  4PDK A;  4XRF A;  4HG2 A;  2M8G X;  3CME I;  2LBF B;  2F4O B;  4IO9 F;  3LFU A;  4MNU A;  3TP0 A;  1SC7 A;  3N97 A;  3QYB A;  4IEJ A;  1CF7 A;  1Z0X A;  2CW7 A;  4ZTJ A;  4A3C J;  2Z1D A;  2DYR H;  4EM1 A;  3PIP F;  5F6F A;  2HVR A;  2WV1 A;  2EWN A;  2XF7 A;  2R7W A;  1ZK8 A;  3LQR A;  1P7I A;  4RGU A;  2VKE A;  2L7F P;  4YEJ A;  2HTS A;  4DJA A;  3HM5 A;  1TQI A;  1MGT A;  5B3S H;  1HC8 A;  5EZH A;  1WZ2 A;  3L2U A;  2JRT A;  4ESJ A;  2IVM A;  2MD5 A;  1G3T A;  2Q1Z B;  2UXX A;  3MKY B;  3KYD B;  3HRM A;  1SVL A;  2EZK A;  2ELK A;  1AOY A;  4LK1 F;  3ZMU A;  3G3Z A;  1X1B A;  3MQ0 A;  2HXO A;  3DLL F;  5J8C A;  1Z9C A;  3VEP A;  2N8G A;  2D1H A;  3RI4 A;  4BE2 A;  2Y0S N;  2R7T A;  3P5J A;  2F4M B;  4XNF A;  2XDV A;  1HF0 A;  1W36 D;  1QNT A;  4HV6 A;  5LD2 C;  2X6O A;  2QA4 I;  3OYF A;  2M34 A;  4B3X A;  1IGN A;  1OCP A;  2X0L A;  3NEU A;  5JLX A;  1H0M A;  3VWB A;  4XM3 A;  3K10 A;  4KMU X;  3JCU C;  2VBZ A;  5A2Q K;  4UB8 C;  3MKZ A;  3BCA A;  1K78 B;  3GXO A;  2UZK A;  1G2H A;  3HB9 A;  5LRR A;  1K79 A;  3RIR A;  4F7Z A;  4RB1 A;  2Y2Z A;  2BW3 A;  3K1M A;  1U9O A;  2LKP A;  2WC2 A;  2WTE A;  2KIU A;  3LAP A;  3DXJ F;  3IRQ A;  1ON1 A;  4TV7 A;  2JVH A;  3PFY A;  2L9N A;  5E8G A;  3FK7 A;  2D2W A;  2X6Y A;  3CP2 A;  3LFK A;  4LMY A;  4HX8 A;  2L7Z A;  3I54 A;  3ZQQ A;  2JSC A;  3K69 A;  1PUF A;  1TLH B;  4HV5 A;  2BBY A;  5IYD J;  1TWF J;  3BZK A;  3DF8 A;  3FK6 A;  3C2G A;  2WAF A;  4XN3 A;  3GTO J;  4QPQ A;  2QUF A;  4KIC A;  2W4S A;  3I4P A;  3MKL A;  3WTU C;  5KCM A;  4A3K J;  1F43 A;  2QYO A;  2DOD A;  1QO0 D;  1AHD P;  3FKJ A;  5LGT A;  1EH6 A;  5LHH A;  4XOT A;  3TO7 A;  2DFH A;  2M9H A;  4OMZ A;  5GP9 A;  5AIQ A;  3HOU J;  2GIZ A;  4N4N B;  2R7X A;  4EJU A;  3A4C A;  1K83 J;  4HST A;  2PJP A;  3AFH A;  1ZEL A;  2DT7 B;  2HU9 A;  1YIO A;  2XSJ C;  2DDA A;  3E6D A;  3HSF A;  4U7B A;  4LB5 A;  3FBI B;  3G1L A;  2VUM J;  2R4G A;  3E6M A;  1FJL A;  1VND A;  1RUN A;  2EQR A;  3ZMT A;  3KEQ A;  2E1M C;  3H1C A;  2F4I A;  5CJ9 A;  2DLL A;  4PSW A;  2H8R A;  5K7F A;  3WE2 A;  3NAR A;  4M74 A;  1FSH A;  3WTV C;  3OS0 A;  2Y0S A;  1IO2 A;  3WTS C;  1Z67 A;  1PVE A;  3ZRG A;  4ESB A;  1T08 B;  5E1W A;  1YOV B;  3W2W A;  3JRG A;  2PN6 A;  4A3L J;  2JPC A;  2R5Z B;  3HXL A;  4RB2 C;  2FA5 A;  4CCK A;  3DBR B;  3HL2 A;  3BR6 A;  1BI1 A;  2KJC A;  2JPB A;  3BTL A;  3JAM Z;  4AU7 A;  1FWZ A;  1Y6I A;  4O6J A;  1JGG A;  1XGS A;  1WGX A;  5DM6 F;  4EJW A;  1HXD A;  3CF2 A;  1HQC A;  3F8M A;  2QKM B;  4HF0 A;  2V6E A;  1APL C;  1WSU A;  3E5X A;  2EZI A;  4OU0 A;  4MHG A;  4B43 A;  2IS4 A;  5CVI A;  1WJB A;  3HOW J;  1T39 A;  1X1A A;  2L54 A;  4XLE A;  1XS9 A;  2O61 A;  4GGG A;  5TJJ A;  1QU3 A;  3S16 J;  2DJN A;  3OYE A;  1MMS A;  4XKC A;  4I01 A;  1HDD C;  2PG4 A;  3I4M J;  4OOI A;  3O2P E;  3A01 B;  1K7A A;  1Z7U A;  3TDZ C;  4EAT A;  3V7R A;  5LBQ A;  2NRA C;  1RES A;  1FYK A;  5D6F A;  3F21 A;  4JQF A;  2CS3 A;  1I27 A;  3RDI A;  3VB2 A;  3T0Y A;  3HOY J;  3SQN A;  2XAQ A;  3ZMD A;  5J4V A;  3OR1 C;  5M5X J;  5JVT A;  4KFC A;  2IGN A;  1VQ5 I;  2CGP A;  1ETX A;  3GZ5 A;  2DW4 A;  5JHF A;  2VOP A;  2EA2 A;  2OBP A;  3K4J A;  3CJR B;  4RGS A;  2CQN A;  1KON A;  2L0K A;  2Z5U A;  1HOM A;  4DBR A;  2OZ6 A;  3X2Q H;  2AXT C;  4Q47 A;  5IOY A;  1JUM A;  2RGV A;  2HOA A;  3NQO A;  2DI3 A;  2L01 A;  3GVA A;  1YO5 C;  1GXP A;  3CCL I;  1Y0N A;  2EFN A;  3F23 A;  1GV5 A;  3DTE A;  3KPH A;  1UZC A;  1NK3 P;  1HKT A;  5F0F A;  1FP1 D;  1KGS A;  1HBX G;  3DTK A;  4DBQ A;  4A3M J;  3OYH A;  3VDX A;  1MBH A;  3QOE A;  3K9T A;  3GEZ A;  4LK0 F;  4MEX F;  1F9N A;  3QAH A;  1TT5 B;  3ELK A;  1JTX A;  2ZJQ F;  3ZQI A;  2K9M A;  4LG0 A;  3WG7 H;  2DA1 A;  3BRO A;  1V5E A;  4DYQ A;  2ZC2 A;  1IRX A;  2MA3 A;  3ZR8 X;  2JVG A;  1WHU A;  3OYD A;  5M3F J;  2V9P A;  3MVP A;  1VQN I;  3F0C A;  2MW8 A;  1VQ8 I;  1EF4 A;  1XSX A;  4RLQ A;  3MZH A;  1DPR A;  4HX4 A;  3QPT A;  1I3A A;  3HG9 A;  4L5E A;  4BU2 A;  2DA6 A;  3QRF F;  4IHT A;  4AVP A;  3CES A;  2KRH A;  3MD2 A;  2EZH A;  2XAS A;  1B72 A;  2XF6 A;  3CDH A;  2O3F A;  2E1O A;  3M8J A;  4EQQ A;  3FKI J;  1X1D A;  1FPQ A;  3S14 J;  5E17 F;  1V5G A;  3FZV A;  5ILS A;  2BEO A;  1YYV A;  3RCO A;  4FQG A;  4HOB A;  3WGH A;  5D5W B;  1RR7 A;  3B6A A;  4BDY A;  2BYV E;  4WXD A;  2KJB A;  1QZZ A;  3H0G J;  4UUV A;  3C7J A;  4G7H F;  2QEN A;  1AU7 A;  2NVY J;  4I0B A;  2NAZ A;  9ANT A;  5LEJ A;  2P5K A;  3G2B A;  4L18 B;  2VL8 A;  2JMW A;  3RPQ A;  3BC8 A;  1T38 A;  3BG7 A;  1YJ9 I;  3GTG J;  2R7O A;  3IWZ A;  3I55 I;  3TMO A;  2OC6 A;  1RZ4 A;  4YFX F;  2LKX A;  1SFX A;  3HPH A;  4XKW A;  3TO6 A;  3FMS A;  1ZGA A;  3RPU D;  4BAY A;  2X4H A;  2P81 A;  4L9N A;  4CCN A;  2G7U A;  2Z99 A;  2LC2 A;  4G6D A;  1B4A A;  5CVV A;  2RQP A;  1V5F A;  2PMZ N;  3MCZ A;  2DN0 A;  5F64 A;  1DU6 A;  1X4O A;  3P7N A;  5DD4 A;  3W2A A;  4XLC A;  3HSE A;  4P96 A;  1ZGJ A;  2X51 A;  2NVT J;  4AC0 A;  3BR1 A;  1MBE A;  4M9S A;  2K9S A;  2VQH A;  3OOP A;  1BOB A;  2BY1 A;  3SDB A;  2F5E A;  1AKH A;  4MTE A;  3KP3 A;  1RC9 A;  4YEL A;  2E1C A;  1XN7 A;  1FSE A;  3K4L A;  1WKM A;  2E35 A;  2JK3 A;  2Y48 A;  3G71 I;  2PJR A;  4A3B J;  2O03 A;  5DCM A;  4ZZL A;  1T33 A;  4Y4R A;  1QHG A;  2B0L A;  4UB6 C;  1E2X A;  5FLM J;  2JA7 J;  3U1D A;  5CVU A;  3WTZ A;  3MFK A;  2GM4 A;  3FWE A;  1FIA A;  1JJ8 C;  2XPW A;  2R3S A;  1Z3X A;  4I0A A;  1WPK A;  1X19 A;  1DQU A;  1YQA A;  3ABK H;  3ULQ B;  5K5O A;  4C9Y A;  3HDD A;  4ZDO A;  5K7Z A;  3COA C;  2JT1 A;  1LDK B;  2QLZ A;  2V6C A;  3ZQG A;  3MZY A;  2A6H F;  2P5V A;  5IY5 H;  3KET A;  4Q48 A;  2DPD A;  2DQR A;  3FF5 A;  2QGU A;  3Q5F A;  4L5I A;  1JUS A;  4HW0 A;  1USS A;  3BR2 A;  2CW0 F;  4XOR A;  4JOM A;  3AG2 H;  3ECO A;  3S2W A;  4NBQ A;  1KQ9 A;  3M8F A;  1TNT A;  3WTT C;  2FD5 A;  4Y13 A;  2EFO A;  3C3W A;  5ICC A;  3HOS A;  1IRF A;  1SFO J;  2BY2 A;  1T95 A;  5KK1 A;  2VE9 A;  3HBL A;  3LSM A;  3TOB A;  1CF7 B;  1MNM C;  3MWM A;  3H9Q A;  5D5U B;  1V4R A;  3OWT A;  1ZRC A;  2VJ5 A;  3ERE D;  1TL8 A;  3W6K B;  2IEK A;  3OIP A;  5FKN A;  2E2J J;  1SFE A;  3F6V A;  3AG3 H;  4D7M A;  1HW1 A;  1Z6R A;  5IT9 Z;  3GX4 X;  2PMZ A;  3E1S A;  1QPI A;  2BOL A;  1QZE A;  2W84 A;  2ZBK A;  1QA6 A;  3K2A A;  4P9F A;  1SD6 A;  1ETY A;  1YW7 A;  3J7A O;  2JUC A;  3BTC A;  1OCO H;  3TKY A;  2DK8 A;  3ABL H;  1OFC X;  1ULY A;  3IRR A;  3S1Q J;  1D0X A;  5L3F A;  3E5U A;  2DMU A;  5F08 A;  4KA4 A;  1MIJ A;  2EIK H;  2ZFU A;  2JWT A;  1ETK A;  4PJ0 C;  3ZMS A;  2K86 A;  3PSF A;  4GXO A;  3WTY C;  1VZ0 A;  1MKM A;  4RM3 A;  5AIP A;  3FXU A;  2Q2E A;  3P9K A;  1YHQ I;  3OS2 A;  3V8J A;  1EA3 A;  2HYG D;  3AG4 H;  3U2R A;  4BL0 B;  1VQP I;  1PP7 U;  1DUX C;  2KMU A;  5DUI A;  1BM9 A;  5E18 F;  3DP7 A;  5J1R A;  4B8X A;  2C6Y A;  2ZXI A;  1O7L A;  3IH2 A;  1JE8 A;  3LWF A;  1I5Z A;  3HRT A;  1G4D A;  2KP6 A;  3KE2 A;  1U6G A;  1S5L C;  1SD4 A;  3HTU A;  4ANJ A;  3ABU A;  3H35 A;  1PDN C;  2GXA A;  2K3P A;  1W5C C;  5J6X A;  3DV8 A;  4CSW A;  4FE4 A;  3VYT B;  1J0R A;  2VXZ A;  2OZU A;  4L9V A;  2ZJR F;  2Y30 A;  5J8F A;  5EEG A;  3DU5 A;  3UNG C;  2HVQ A;  5FB2 A;  2FF4 A;  2FNA A;  2Q0O A;  2IJL A;  4G6T B;  5HVQ C;  3OS1 A;  1UHS A;  1Z05 A;  2DU9 A;  3VFZ A;  1BBY A;  2X9D A;  3Q0V A;  3HOV J;  2P5L C;  1J5Y A;  2I5U A;  2AQE A;  3BR0 A;  4G7Z F;  3GFM A;  3W6J B;  3TDU C;  4P5O A;  1IV6 A;  1FBS A;  4XBF A;  4IHY A;  1ZLK A;  3KEY A;  4PUS A;  4WK8 F;  2IBD A;  2XIG A;  2RNJ A;  4GCV A;  2OD5 A;  4KIB A;  4A5M A;  5HNF A;  4I6Z A;  1BR2 A;  4F52 A;  4B09 A;  1R36 A;  1I1S A;  2OJE D;  4BEH A;  1RKW A;  2DMP A;  1GVJ A;  3KZZ A;  4L0Z B;  5H20 A;  3A0B C;  3IAS 2;  4IX7 A;  2HYF A;  2DMQ A;  4M73 A;  4BJ5 C;  4P1W A;  5DV5 A;  3RKY A;  1T98 A;  1EKE A;  2FNP A;  1E3P A;  4ENJ A;  2IS1 A;  1IRG A;  2FE3 A;  3FDY A;  1MD0 A;  5F04 A;  3PO2 J;  1S9H A;  4J01 A;  3GTQ J;  2ELH A;  1D1C A;  5FLX K;  1W7P A;  1Z6T A;  2DTR A;  3I64 A;  4N9H A;  4RMN A;  4PJJ A;  4C3I J;  2L9V A;  2W85 A;  3J81 K;  1T6S A;  2VI6 A;  2FMY A;  3SFI A;  3GWZ A;  3BOQ A;  3E3V A;  2J5O A;  5JHU A;  1XMK A;  2VQC A;  2AQF A;  4QWQ A;  2XAU A;  3LSI A;  3JTH A;  1ZG3 A;  3VOD A;  1IN4 A;  4CGZ A;  4OIO F;  3CCM I;  4JX6 A;  3BY6 A;  3U1K A;  3ZQ7 A;  1Q1V A;  3IKT A;  5LHG A;  1ORK A;  3J7Z I;  1N78 A;  2XB0 X;  3R6S A;  2COM A;  2NYX A;  4BE0 A;  2VKH A;  1OCZ H;  2RKH A;  2FU4 A;  2DOA A;  5GAD J;  4ZH4 F;  1BN5 A;  4KNY A;  2VON A;  5ICG A;  1OYI A;  2LLK A;  1FT9 A;  2W48 A;  4C3H J;  3E0J B;  2DPU A;  2JA8 J;  3HEF A;  3UKG A;  2EFW A;  2R7S A;  1TW3 A;  2PMH A;  1H9T A;  2A5W A;  4G6Q A;  4MFE A;  3ZN1 A;  5IPA A;  4NQW A;  3M07 A;  1G3W A;  2XGD A;  3EUA A;  1QRY A;  4AVZ A;  4Y15 A;  2G0E A;  3LL7 A;  1T0F A;  3SEZ A;  2XKO A;  1YTY A;  5GAE J;  2P0W A;  4LG3 A;  1W1W E;  1I39 A;  1Z7L A;  2KIS A;  1BI2 A;  3ABM H;  2W7N A;  1MH3 A;  3VSK A;  2QQ8 A;  4JX4 A;  4UV9 A;  4CUG A;  4DZP A;  2KHM A;  1SAX A;  2O8K A;  4E7S A;  5GTH C;  2KIM A;  2OPT A;  1GUU A;  3BPV A;  4G94 A;  1S8N A;  3IAM 2;  4WCG A;  4KN7 X;  1SD7 A;  2L3D A;  4V2F A;  4NB5 A;  3I59 B;  3E97 A;  5EG0 A;  1UCR A;  1A6Q A;  1FOX A;  2R7D A;  1YG2 A;  1I3Q J;  1P4X A;  2KKO A;  5HDK A;  3KLO A;  1FOW A;  4NUB A;  1MBG A;  1KYW A;  3BTJ A;  1QPM A;  3K4M A;  4CYC A;  3CJT B;  2GA2 A;  3PQJ A;  2L4M A;  3HOZ J;  4GRI A;  5FRO A;  2XF5 A;  4EEF G;  3KCC A;  5TIS C;  2CWE A;  1R58 A;  1Y0U A;  4ZYD A;  2ADU A;  3AAF A;  1NTC A;  2EK5 A;  2ZXJ A;  4E7H A;  2VPL A;  2HPM A;  2M0M A;  3SZP A;  3QWL A;  2VAS A;  1ODD A;  4LG0 B;  3L2W A;  2V1X A;  3OYK A;  1S7A A;  2QVO A;  2W57 A;  3NAU A;  2ESH A;  3RQ4 A;  1ITY A;  4CZZ A;  4UUS B;  4XL9 A;  1OCT C;  5BPD A;  4UVC A;  2LDU A;  3BJ6 A;  3A1Y A;  4FET A;  4QTR A;  2COB A;  2M30 A;  1RNL A;  3CCS I;  2DK5 A;  1Z1D A;  2VB6 A;  1RR8 C;  2R0Q C;  1B8I B;  5FJ8 J;  3HHG A;  3FX3 A;  1NG7 A;  2Y69 H;  3BQY A;  4OAY A;  3V4G A;  5M3M J;  2A07 F;  4XMY A;  2LSO A;  4ENK A;  3EYI A;  2V1D A;  3B02 A;  4CA0 A;  1AA7 A;  1T2K A;  2FRH A;  1FY7 A;  4BJ6 C;  3CCE I;  4Y3O A;  2DA3 A;  1YIT I;  2XAH A;  1IXR C;  5E1Z B;  1DDN A;  2DQL A;  2MH9 A;  1FMV A;  3IUO A;  3QQA A;  2DT5 A;  2NVU B;  1IF1 A;  2QQ9 A;  4ITV A;  3LST A;  2QSF X;  3HGG A;  3NWT A;  1D8J A;  5FFZ A;  5CLS A;  4KIG A;  1UEL B;  1BJA A;  3F3X A;  3GTK J;  3ML6 A;  1CQT A;  2QKL B;  2GWR A;  2WAQ N;  2JJ7 A;  3Q9S A;  2O9L A;  5EGO B;  4GYI A;  1WVR A;  1PUE E;  1MZB A;  4DQ2 A;  3GTM J;  2HQR A;  2RC4 A;  3T8T A;  2MGQ A;  3ZPL A;  2XC7 A;  5KAF C;  2LMD A;  1ZAO A;  1WWX A;  3GFJ A;  1V3F A;  2CUF A;  3DPU A;  1VQL I;  3EUK L;  2V1U A;  3WU0 A;  1PYV A;  2KFD A;  4BS9 A;  1RIO H;  1BC8 C;  3FXR A;  3CP8 A;  3H3U A;  3FHZ A;  3RKQ A;  1U78 A;  3ABT A;  3J80 Z;  2EV0 A;  4AD9 A;  1W0U A;  2YU3 A;  4J19 A;  2Z2S B;  2X1C A;  2XVC A;  2P8T A;  4UNO A;  1F1Z A;  2QF7 A;  1MDM B;  4M3D A;  1R9T J;  3LSJ A;  5CVR A;  4WF2 A;  3QP6 A;  5J4Y A;  1HCR A;  2KPM A;  2V4J C;  3EET A;  1G8X A;  1GHC A;  5FO5 A;  2PJR B;  4Z2Y A;  1OKR A;  4V19 K;  2MC3 A;  4HF2 A;  2VJJ A;  2VXD A;  4BJT A;  2ECC A;  4AUX A;  3I4N J;  4I76 A;  4MFD A;  1KA8 A;  4YFN F;  1P4A A;  1B9N A;  2EIL H;  4I2O A;  5FFX A;  3JRC A;  2HFH A;  2Y9Z A;  2ZFW A;  5AON A;  2E36 A;  4BY1 J;  4R79 A;  3R0J A;  2W82 A;  4HLY A;  4Q4Z F;  1YE9 A;  2OU2 A;  3BG9 A;  2CQX A;  3HHH A;  1MMG A;  2H09 A;  2NOG A;  3H0D A;  2NNY A;  2L4A A;  3RZO J;  2CFO A;  1OJL A;  3G1M A;  4KIS A;  1R5I D;  1JT6 A;  2CW8 A;  3KZY A;  1I6H J;  4NC7 A;  3RQI A;  1FBU A;  1VQ6 I;  2XUB A;  3OSG A;  3PUF A;  4ZYG A;  4JBA A;  3E6C C;  2D45 A;  4L9T A;  2WAQ A;  4AID A;  2KDZ A;  3CC4 I;  5ERI A;  1F4K A;  4RLF A;  1LPQ A;  2PEX A;  2HQ5 A;  3DEE A;  3SYT A;  3CCQ I;  5M5W J;  1IDZ A;  1UHW A;  4DOZ A;  1MSF C;  1BA5 A;  4PJN A;  1N75 A;  1R5G A;  2FQ3 A;  2D5V A;  5BS6 A;  4OIP F;  1LNW A;  3TQN A;  2V26 A;  3WGI A;  2ID3 A;  1U5T A;  3C2H A;  4LIU A;  1CGP A;  3PL8 A;  3OYI A;  1O4X A;  1SMY F;  4I98 B;  4M3G A;  2ZJ2 A;  4Y33 A;  2IA2 A;  2VJ4 A;  2TRT A;  3TP3 A;  4HEA 2;  4M6Y A;  3FHN A;  4HX7 A;  3L2Q A;  2OF7 A;  2DMT A;  1UFM A;  4IPA A;  2CH0 A;  1I6X A;  5ED4 A;  1WJC A;  1VQ7 I;  1IC8 A;  4ON0 A;  1LUJ B;  3FXM A;  2CV2 A;  3ZGK A;  2BXY A;  1SD5 A;  2YSR A;  3CO7 C;  2H94 A;  4KIT B;  1XCB A;  2E1M B;  1REP C;  3BWG A;  4PCQ A;  1LDD A;  1POG A;  4IL6 C;  2XAJ A;  1F36 A;  2EZL A;  1OCR H;  4RAG A;  3R61 A;  5BQT A;  1ETQ A;  5LLQ A;  2UXN A;  4K2E A;  2LBF A;  1IAW A;  3EDP A;  4U0Y A;  3IC7 A;  3F22 A;  2RAE A;  1XSV A;  1NK2 P;  1YX3 A;  1EJ9 A;  2M2E A;  3D0S A;  3OYJ A;  2Z3Y A;  2LNB A;  2OA4 A;  3BZ6 A;  4HAM A;  4FAS D;  1IV8 A;  1B59 A;  3GW2 A;  2YPR A;  4P55 A;  4CCL A;  1HA8 A;  1JXS A;  3A0H C;  1O3R A;  5HS8 A;  1IN8 A;  2QWW A;  1U8R A;  2BHZ A;  2NVQ J;  4F55 A;  2QEX I;  1EH7 A;  2QBY A;  3IV5 A;  5JR3 A;  4WX9 A;  3VYR B;  4PK4 A;  1SEU A;  2HOE A;  3M1E A;  2MC4 A;  5EF6 A;  4XLF A;  4YRV A;  3O8H A;  2QCO A;  2HNH A;  4WWC A;  1T0F C;  2V1N A;  4IKF A;  2VOO A;  2DAO A;  1G3S A;  2EB7 A;  5F0H A;  4BH9 A;  1HW5 A;  1J2X A;  4BXU A;  1YW9 A;  1OCC H;  3K4C A;  4FCY A;  4LLN A;  5F0C A;  4Q5S F;  1FLI A;  4BXF A;  2EIM H;  2XKP A;  1EH8 A;  4II3 A;  1Y8R B;  2HDW A;  2Y9Y A;  1PP8 F;  3DLA A;  3EPZ A;  1WJF A;  4CH7 A;  2IGO A;  1IUY A;  1HKS A;  4PJL A;  3H92 A;  1LB2 A;  2E2I J;  1YS7 A;  1LEB A;  2UWM A;  1S29 A;  3GF2 A;  3V42 A;  2FUG 2;  5FD5 A;  1R5H A;  3MEX A;  1A5J A;  1P2F A;  2VC1 A;  4BBS J;  1ACI A;  1D5Y A;  1L3L A;  3D5R C;  1R71 A;  2QSG X;  4LJZ F;  3SXY A;  2ZSI B;  1MMD A;  4NC8 A;  3D5S C;  5JVG F;  1S3J A;  4HLX A;  2G9W A;  2RVC A;  1VQ4 I;  2JUG A;  2DA4 A;  4UVB A;  2NXN B;  2IP2 A;  2ME6 A;  2BE5 F;  3U9G A;  1QZY A;  1IN7 A;  4X1E A;  3KYL A;  4KN4 X;  1LE8 B;  1O57 A;  4U7D A;  5B5E C;  4PFP A;  4C2T A;  3WU1 B;  1IN5 A;  1W5T A;  1OR7 A;  2FX0 A;  3SZT A;  4QIW N;  1XGM A;  2W00 A;  1BIA A;  4DNC A;  2D1V A;  2OAZ A;  1LVK A;  3FIS A;  3FMR A;  4NDL A;  2IA1 A;  2E5Z A;  1ON2 A;  2LFB A;  1XX5 A;  3QOD A;  4R8H A;  1BC7 C;  2JA2 A;  2HOT A;  4IOC F;  4AYB N;  4YIF A;  2H8W A;  2DXI A;  1DGW Y;  1FOY A;  4KIF A;  1MJ9 A;  2L9S A;  3ESW B;  4HYE A;  4M3F A;  2OCC H;  5C4X J;  2XAG A;  2F5V A;  2ZXH A;  2KIQ A;  5FKM A;  2CSO A;  4RGR A;  4A3G J;  2M8E A;  1IZ1 A;  3VYS B;  3KP4 A;  4IF4 A;  1D0Y A;  3N05 A;  4YFK F;  2R7Z J;  3HRS A;  1GV2 A;  2M3A A;  2ZME C;  1IW7 F;  3H3Z A;  3G4S I;  4IHV A;  3C1D A;  1U2W A;  2P7V B;  3SFZ A;  1O3T A;  3R0A A;  2HVS A;  4N9I A;  3BG3 A;  4CCJ A;  1VQM I;  1WJ5 A;  5DS9 A;  1WCM J;  2K27 A;  1YX5 A;  2G7H A;  1OYY A;  4S05 A;  3KZI C;  3JRI A;  3CUQ A;  3DQV C;  2R5Z A;  4UV8 A;  3CCV I;  5FGM A;  2F5F A;  4RBO A;  5JLW A;  2FQ4 A;  1R1T A;  1V54 H;  4B3A A;  1FYL A;  1ZKG A;  2IAI A;  4N4O B;  1V55 H;  3FXK A;  2YR2 A;  4MO7 A;  4F93 B;  1WH7 A;  2LY2 A;  2L7K A;  3PFI A;  3I0T A;  2HKO A;  2K5C A;  1ETO A;  3LSR A;  5GTI C;  5E79 C;  4XID A;  2BV6 A;  3R4K A;  5EG0 B;  1OMI A;  1R7J A;  3OSF A;  3C2B A;  3F9K A;  3OMY A;  3LA7 A;  3TL4 X;  2K9Q A;  4I02 A;  4KMF A;  4AWX B;  4QSH A;  3JSP A;  2LP0 A;  4B4C A;  4PFO A;  1F5T A;  1K61 A;  2RRE A;  1ZGW A;  1VQK I;  4IHW A;  2WY7 Q;  3ZN0 A;  5B1B H;  2CQQ A;  2LKS A;  1U3E M;  1WFX A;  3A01 A;  1TT0 A;  3JAM K;  3AL0 C;  5L3D A;  4XRS A;  1BOA A;  2A61 A;  2K4J A;  3ASN H;  4LFU A;  4H4K C;  3K2Z A;  2KLO A;  2O5R A;  1SMT A;  3A2K A;  2H1L A;  1D1A A;  2WAE A;  3HUG A;  4A2U A;  4EM2 A;  1I1G A;  1TWC J;  5ILV A;  1FC3 A;  2LTP A;  5A2Q Z;  1HDP A;  3K7A J;  3GYH X;  3I53 A;  2CU7 A;  1R4M B;  4LLL A;  4E6K G;  4RB3 C;  4A3F J;  5EJC A;  1LFP A;  3W2V A;  1QHH D;  5D8L B;  1X3Z B;  2CJJ A;  4XON A;  1YRN A;  2M4K A;  4KJZ A;  2CYY A;  3CJQ B;  4OIR F;  4D5C A;  1I50 J;  3ECH A;  5C4J J;  1JTY A;  1XSD A;  1X58 A;  2V9V A;  3AG1 H;  4CCM A;  2J5P A;  5C3E J;  1LDJ A;  2K7L A;  2KL4 A;  2Y0M A;  3S1M J;  3I58 A;  1RUO A;  3F8C A;  2PI0 A;  4ETS A;  1XMA A;  3ZMZ A;  1XD7 A;  3OIQ A;  4ESF A;  4PSX A;  5CYV A;  3JRD A;  4HZF A;  4XLA A;  1RRJ A;  2W25 A;  4U88 A;  4RDU A;  5DDG A;  1X1P A;  1Q1H A;  1W5S A;  2BW3 B;  3ERM A;  1UG2 A;  4DIQ A;  2F5D A;  5L3B A;  4WXC A;  2XHK A;  1WH5 A;  2E7X A;  3I5U A;  2VIX A;  3T5X A;  2ICW G;  3MN2 A;  3W3C A;  2XV4 S;  3K6G A;  3LNQ A;  1ZHF A;  1YJW I;  2R92 J;  2ZSH B;  1O3Q A;  3LAJ A;  4EJT A;  2R7R A;  1A31 A;  3BZC A;  2WY8 Q;  3ZMV A;  4O5V A;  1XG1 A;  5EEA A;  1PUF B;  3DBL B;  4XK4 A;  3KFW X;  3KEO A;  1GLN A;  3HSR A;  3OL3 A;  5J3L A;  1UJ8 A;  1JI8 A;  4XRM A;  3OV8 A;  1U5T C;  2XAF A;  1S6L A;  2MLG A;  1H89 C;  3U21 A;  3JRA A;  2R7U A;  2KT0 A;  1TQM A;  1VTN C;  2A6E F;  2K9N A;  1O7F A;  1NHA A;  3VSL A;  2L2O A;  4WXH A;  3S15 J;  3SJM A;  1E0E A;  3RYP A;  2MAB A;  1FZP B;  4BDZ A;  5DD8 A;  1G6N A;  2H6C A;  2L9R A;  1W7P D;  5HDG A;  4E7Z A;  1YIJ I;  2RNG A;  2UUZ A;  1XPX A;  5ICF A;  2TDX A;  2DDB A;  4RAY A;  3GUD A;  2IT0 A;  1BR4 A;  2MH2 A;  4IZZ A;  2E5N A;  2VKD A;  5B66 C;  2CQ7 A;  3I56 I;  2FBI A;  1ERD A;  4PZJ A;  3MZ8 A;  1MH4 A;  2V79 A;  2GA1 A;  1OPC A;  2LOO A;  4U0W A;  5GPA A;  4A3I J;  1FTT A;  1TP4 A;  4A5N A;  4D7N A;  1NH3 A;  3ZOB A;  1GVD A;  2Z9O A;  2HPI A;  5IYB J;  4I99 C;  4L5J A;  4AIJ A;  5EZG A;  3CDI A;  3F6O A;  3OYB A;  5E20 A;  2EBI A;  2VQG A;  2E1N A;  2XRO A;  2R5Y A;  1S7O A;  2M7B A;  4LGW A;  2DFE A;  3LQQ A;  3LSH A;  4M9X A;  1QBJ A;  3TW7 A;  4DW6 A;  3KP7 A;  3SHF A;  1MBF A;  4MEY F;  4ZTF A;  4DYR A;  1J75 A;  5CPR B;  1TTY A;  5FKK A;  1VI0 A;  1HST A;  4FT8 A;  4ZYE A;  2BY0 A;  5IYC J;  4IHS A;  3CMA I;  2QQB A;  1JGS A;  2CQK A;  3HTS B;  3S3M A;  1ZRD A;  2M7A A;  1RET A;  1UAA A;  1Y1W J;  1ZQ3 P;  3J7Y J;  3OYL A;  5LGN A;  1GT0 C;  1BIB A;  2JA5 J;  1LJ9 A;  2FBH A;  2LVS A;  4XKB A;  1MW7 A;  5D6E A;  1U9N A;  1D1B A;  1U0J A;  3CCR I;  3S2H J;  3CMM A;  4ZDL A;  1J09 A;  1Z21 A;  2CO5 A;  4IRG A;  3JR9 A;  2CV0 A;  4NHJ A;  3FXO A;  1VQO I;  2EJR A;  3WU2 C;  3AKZ A;  4IQ4 A;  2M5W A;  1IN6 A;  4HQM A;  4HNU A;  5KHD A;  2ISZ A;  3KLN A;  5LEK A;  1MMA A;  2EV5 A;  1SAU A;  4IJA A;  3DPL C;  1FP2 A;  4FX4 A;  2NS8 A;  1KU2 A;  4CHU A;  1TNS A;  4ZYH A;  3G73 A;  2K9L A;  3L9F A;  3LMM A;  4V2G A;  1YW8 A;  3K0L A;  1J59 A;  1XMX A;  2BGC A;  2BVM A;  3PSI A;  2FML A;  1LVA A;  3H9J A;  2E19 A;  1BI3 A;  2YUS A;  4XRS G;  1OIS A;  3F72 A;  2GXB A;  5E3L A;  2IGK A;  3TGN A;  3QU3 A;  2AXL A;  1TQP A;  2OCE A;  3BP8 A;  1ZG5 A;  2QQA A;  2HXI A;  2F2E A;  2A68 F;  2DFI A;  2XRN A;  2IGM A;  1STZ A;  1FNN A;  3GTJ J;  3L00 A;  1OR7 C;  4C3J J;  2MLK A;  4A93 J;  1A6I A; 
#chains in the Genus database with same CATH homology
 3RQI A;  2ID6 A;  3Q0U A;  3OSG A;  3TW6 A;  3HOX J;  2PMZ N;  1IUF A;  2DN0 A;  1IDY A;  1DU6 A;  4S0H B;  3JRB A;  2NVT J;  4AC0 A;  3BR1 A;  2KDZ A;  4UUT A;  1MBE A;  3ZQH A;  4LOC A;  3SDG A;  4B1R A;  2HQ5 A;  2K9S A;  5M5W J;  1IDZ A;  5IP9 J;  4A3J J;  1MSF C;  1BA5 A;  1AKH A;  2D5V A;  1UMQ A;  5J1U A;  3GBG A;  2ID3 A;  5FKO A;  2JK3 A;  3QPL A;  4A3B J;  3HKZ N;  3W6V A;  1T33 A;  3A02 A;  4JYK A;  4JX5 A;  1O4X A;  1ZR4 A;  1B72 B;  4M3G A;  1Y1V J;  5FLM J;  2JA7 J;  2TRT A;  1ETW A;  3TP3 A;  3H3V K;  2MSY A;  3G1O A;  3LSG A;  2GLO A;  2GM4 A;  2OF7 A;  2DMT A;  4Y52 J;  1FIA A;  2XGE A;  5IOZ A;  2XPW A;  1JJ8 C;  1JKP C;  2AO9 A;  1IC8 A;  4GFB A;  1WPK A;  4Y7N J;  4BBR J;  1MBK A;  3HDD A;  5K7Z A;  3ZQF A;  4FE7 A;  3ZQG A;  2XB5 A;  3QPS A;  3LOC A;  1POG A;  4A3D J;  1F36 A;  2EZL A;  2JN6 A;  1ZR2 A;  1IJW C;  1ETQ A;  5IP7 J;  1TWA J;  4JP0 A;  1JUS A;  2GBY A;  3BR2 A;  1WI3 A;  1LE8 A;  2RAE A;  5HOD A;  1JKR C;  1QVT A;  1NK2 P;  3S2D J;  2M2E A;  5J1Y A;  3TED A;  2FD5 A;  1JJ6 C;  1SFO J;  3HBL A;  1BJZ A;  2NVQ J;  1LFB A;  3JRH A;  4W97 A;  1MNM C;  3DEW A;  3CMY A;  3IV5 A;  1DU0 A;  3OOU A;  2IEK A;  2I10 A;  5FKN A;  2E2J J;  4D7M A;  2HYJ A;  3BT9 A;  5EF6 A;  2JA6 J;  3O8H A;  4MLO A;  1LFU P;  1QPI A;  2TCT A;  1ETV A;  2QCO A;  3K2A A;  1AKH B;  1ETY A;  5F0H A;  3BTC A;  1OFC X;  3HGY A;  3S1Q J;  5EDN A;  4FCY A;  5F0C A;  3PO3 J;  5F08 A;  2DMU A;  2EH3 A;  3RZD J;  2JWT A;  1ETK A;  2Y9Y A;  2NS7 A;  4BY7 J;  3LSP A;  2E2I J;  1FJL A;  3FIW A;  3M3Y J;  1P7J A;  3BG5 A;  2LD5 A;  1A5J A;  5J1R A;  4BBS J;  1D5Y A;  3IH2 A;  5IP6 A;  2LR8 A;  2MG4 A;  1BW6 A;  1TWG J;  1BL0 A;  2M8G X;  2DA4 A;  1XC5 A;  2HI3 A;  1IRZ A;  2ME6 A;  3TP0 A;  1X2N A;  4FE4 A;  4X1E A;  4IEJ A;  1Z0X A;  4A3C J;  1LE8 B;  3GTP J;  2Y30 A;  2VPR A;  2WV1 A;  4X6A J;  2FX0 A;  1TC3 C;  1ZK8 A;  1UHS A;  4QIW N;  1P7I A;  2VKE A;  2L7F P;  2X9D A;  3Q0V A;  3HM5 A;  3HOV J;  3FIS A;  4NDL A;  1SAN A;  5K7H A;  3BR0 A;  1MSE C;  5EZH A;  2FJ1 A;  4XIC A;  2DA7 A;  2LFB A;  3ZQC A;  1IV6 A;  2HOT A;  2EZK A;  4AYB N;  4IHY A;  2ELK A;  3BQZ A;  2AHQ A;  2YU9 J;  2IBD A;  1JKQ C;  4M3F A;  1BW5 A;  5C4X J;  1QVU A;  5FKM A;  2HXO A;  4I6Z A;  2N8G A;  4A3G J;  2Y0S N;  4W1U A;  2R7Z J;  1HF0 A;  1RKW A;  2DMP A;  1GV2 A;  4IHV A;  2X6O A;  3CDL A;  2XSD C;  2DMQ A;  3BTI A;  3BG3 A;  2M34 A;  5DS9 A;  1IGN A;  1WCM J;  2XGC A;  1OCP A;  5JLX A;  3JRI A;  5F04 A;  1YRN B;  3PO2 J;  3GTQ J;  2XRL A;  2R5Z A;  1G2H A;  4RBO A;  5JLW A;  2DTZ A;  2FQ4 A;  5BNG A;  3HB9 A;  4B3A A;  4C3I J;  1ZKG A;  2DA2 A;  2IAI A;  2VI6 A;  4MO7 A;  3SFI A;  2Y2Z A;  1WH7 A;  4FTH A;  1U9O A;  1ETO A;  3LSR A;  4XID A;  4A69 C;  5EG0 B;  2M0C A;  3OSF A;  3C2B A;  3FK7 A;  2YS9 A;  3E7L A;  2HOS A;  1H8A C;  3BR5 A;  4JX6 A;  2K9Q A;  4QSH A;  2L7Z A;  2LP0 A;  4B4C A;  1Q1V A;  1ORK A;  5E3N A;  2XB0 X;  2X48 A;  1PUF A;  1K61 A;  1ZGW A;  3M4O J;  3IH4 A;  4IHW A;  5IYD J;  1TWF J;  3FK6 A;  2NVX J;  2CQQ A;  3GTO J;  3A01 A;  3CCY A;  4UUS A;  1VFC A;  4XRS A;  3MKL A;  1ENH A;  4A3K J;  1F43 A;  2LLK A;  2W48 A;  1RPW A;  1AHD P;  4C3H J;  2L7M P;  2JA8 J;  3HEF A;  3UKG A;  5E3O A;  3ZQL A;  1TWC J;  2WB1 N;  3O8G A;  1B8I A;  4MFE A;  5IPA A;  2LTP A;  3S17 J;  2M9H A;  5GP9 A;  2LK2 A;  2XGD A;  1HDP A;  3K7A J;  3WHB A;  1QRY A;  3HOU J;  2G0E A;  4C2M J;  2O7O A;  1K83 J;  2CU7 A;  1JUP A;  4HNV A;  4A3F J;  1W0T A;  1JT0 A;  4M3B A;  3G1L A;  2CJJ A;  1YRN A;  2VUM J;  1MH3 A;  4D5C A;  1VND A;  1I50 J;  5C4J J;  1JTY A;  4JX4 A;  1X2M A;  1X58 A;  2DA5 A;  2EQR A;  4DZP A;  2O8K A;  5C3E J;  1VF9 A;  2B63 J;  2H8R A;  5K7F A;  3S1M J;  2OPT A;  3NAR A;  4DYC A;  1GUU A;  5F1J A;  2ME0 A;  4A3L J;  3JRD A;  3JRG A;  4V2F A;  2R5Z B;  5EG0 A;  4RDU A;  3BR6 A;  5C44 J;  1I3Q J;  3BTL A;  5EGO A;  3Q3S A;  1UG2 A;  5M5Y J;  1JGG A;  2XPV A;  1MBG A;  1WGX A;  3BTJ A;  1WH5 A;  4CYC A;  3HOZ J;  3MN2 A;  4EEF G;  3LNQ A;  2R92 J;  2CRG A;  2ZB9 A;  3S1N J;  1APL C;  2R5Y B;  2EZI A;  1E3O C;  1NTC A;  4IHX A;  4BKX A;  3HOW J;  3D1N I;  1XG1 A;  1FTZ A;  5EEA A;  1XS9 A;  1PUF B;  3IH3 A;  4XK4 A;  2ECB A;  1H88 C;  3S16 J;  2DJN A;  5J3L A;  3I4M J;  1HDD C;  3NAU A;  4XRM A;  3A01 B;  1ITY A;  3JRF A;  4UUS B;  1OCT C;  1RES A;  1FEX A;  1H89 C;  2HDD A;  5DTD A;  3JRA A;  5GPC A;  2COB A;  2KT0 A;  4QTR A;  3OIO A;  2K9N A;  3HOY J;  1S7E A;  5F27 A;  2R0Q C;  1B8I B;  3S15 J;  5FJ8 J;  3SJM A;  4C3J J;  5M5X J;  3BQY A;  1ETX A;  5M3M J;  2L9R A;  1GDT A;  4M3E A;  2LY9 A;  4A3E J;  3S1R J;  2L0K A;  2CUE A;  2DA3 A;  1HOM A;  5IOY A;  1MH4 A;  1JUM A;  2HOA A;  4A3I J;  2E2H J;  5GPA A;  1FTT A;  3GTL J;  3QQA A;  4D7N A;  1U8B A;  3ZOB A;  2Y31 A;  1GVD A;  5IYB J;  1TWH J;  3Q0W A;  2R93 J;  1GV5 A;  4ABZ A;  1NK3 P;  5EZG A;  3HGG A;  3GTK J;  5F0F A;  1JKO C;  2EBI A;  4A3M J;  1CQT A;  2R5Y A;  2WAQ N;  4M6V A;  1MBH A;  2JJ7 A;  5FKL A;  2O9L A;  5EGO B;  3TW7 A;  3DCF A;  3A03 A;  4BXX J;  4D5F A;  4DW6 A;  1JTX A;  5E3M A;  1MBF A;  3ZQI A;  4DYR A;  1FIP A;  3JRE A;  4CYC B;  3GTM J;  5FKK A;  1VI0 A;  2DA1 A;  2MGQ A;  5IYC J;  4DYQ A;  2CUF A;  1IG7 A;  1RET A;  5M3F J;  1Y1W J;  1ZQ3 P;  1GT0 C;  3MVP A;  2JA5 J;  3F0C A;  2MW8 A;  4DZJ A;  1EF4 A;  3RKQ A;  1U78 A;  2LVS A;  1W0U A;  1U9N A;  4J19 A;  3S2H J;  4L5E A;  3WHC A;  1MBJ A;  2DA6 A;  2QF7 A;  1ZTR A;  4M3D A;  3JR9 A;  1R9T J;  2EZH A;  3LSJ A;  1T56 A;  1B72 A;  5EYR A;  2H1K A;  2E1O A;  3FKI J;  3S14 J;  1HCR A;  1RKT A;  4FIS A;  2VKV A;  4MIM A;  1RR7 A;  3B6A A;  2NS8 A;  2XPU A;  2ECC A;  3H0G J;  4AUX A;  5FLV A;  3CQZ J;  4V2G A;  3I4N J;  1AU7 A;  4I76 A;  2NVY J;  4MFD A;  9ANT A;  1HLV A;  2DMN A;  1Z77 A;  2E19 A;  2YUS A;  4XRS G;  3VPR A;  3JRC A;  2JMW A;  2Y9Z A;  5E3L A;  4BY1 J;  3GTG J;  4G12 A;  3B6C A;  2LKX A;  2HXI A;  3BG9 A;  2CQX A;  2NOG A;  3RZO J;  1OJL A;  3G1M A;  2P81 A;  1JT6 A;  3BR3 A;  3GTJ J;  1I6H J;  2K40 A;  3PM1 A;  4A93 J;  1A6I A;  3L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...