2EQRA

Solution structure of the first sant domain from human nuclear receptor corepressor 1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
GSSGSSGDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear receptor corepressor 1
publication title Solution structure of the first SANT domain from human nuclear receptor corepressor 1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eqrA01
5C44J 2JN6A 2Y31A 4D5CA 2Y9YA 1VF9A 2FD5A 1Z77A 2XGCA 1U9OA 2R93J 2WB1N 3RZOJ 1ETVA 4FE7A 1RPWA 3A01B 2HOTA 5M5YJ 3LSJA 5FKNA 2HOAA 1P7IA 3HOYJ 2CRGA 3HGGA 3FISA 3JR9A 3MKLA 2EH3A 1XG1A 2LFBA 4IHWA 1RESA 1ZTRA 3B6CA 4A93J 4C3JJ 5IOYA 3A01A 2LLKA 3BQZA 2HXOA 1XS9A 1G2HA 2OF7A 2VUMJ 1I6HJ 4V2FA 1QPIA 2YUSA 4I6ZA 3BR3A 3DEWA 3UKGA 4IEJA 1TC3C 1FTZA 2ME0A 2VKEA 3BR6A 2JA7J 3BG5A 4DYRA 2AHQA 3BQYA 1U78A 2ID6A 3HGYA 1RKTA 1JTYA 5EYRA 2LP0A 2AO9A 3Q0WA 1JKOC 2IBDA 2E2HJ 5IYDJ 4A3LJ 5BNGA 2XGEA 3GTQJ 3JRCA 1JTXA 4C3HJ 2LR8A 1MBEA 1WI3A 5E3LA 1Y1WJ 1LE8B 2O9LA 1A5JA 2HI3A 3TEDA 1BL0A 2GBYA 4M3EA 3SDGA 1GDTA 1FEXA 5FKMA 2NVQJ 2DA4A 3CMYA 4A3FJ 4G12A 2L7MP 5EZGA 3JRIA 1IJWC 3BTIA 2NVYJ 2ID3A 1IDZA 1PUFB 3S16J 3B6AA 3RQIA 1LE8A 1NK2P 3GBGA 1VI0A 2P81A 3M3YJ 3G1LA 4BBRJ 1F36A 4V2GA 1UMQA 3BTLA 4IHXA 5EEAA 3HEFA 1ZR2A 3H3VK 2MGQA 2MSYA 1JT0A 1MBJA 2JMWA 2DN0A 1JJ8C 3GTGJ 1JUPA 5EZHA 4DYQA 2ME6A 4DZPA 1P7JA 5GPAA 1POGA 3BR0A 5J1RA 1K61A 4W1UA 3IH2A 4XRSA 2ELKA 3SFIA 3A02A 3K2AA 3WHCA 1FIAA 1BW5A 4XRMA 2CUFA 1CQTA 4RBOA 2R5ZB 1BJZA 1TWGJ 4MIMA 3A03A 5IP6A 2VKVA 2ECBA 5K7HA 3Q0VA 2E1OA 1ETKA 2GLOA 1DU0A 3TP3A 5J1UA 2D5VA 1K83J 1ORKA 2L0KA 2DA6A 4UUTA 2FQ4A 3JRAA 2KT0A 2YU9J 5J3LA 4QTRA 2K9NA 2R5ZA 1B72B 5F04A 4L5EA 5EDNA 1IDYA 1B8IB 1Y1VJ 1JKQC 2LTPA 1MBGA 4JYKA 3PO2J 5F27A 1GT0C 1VNDA 3S14J 4IHYA 2EZHA 1B72A 1MH3A 1B8IA 4JP0A 3H0GJ 3S1NJ 2CJJA 2FX0A 1HOMA 3K7AJ 1R9TJ 1YRNB 5GPCA 2CU7A 3SJMA 3GTKJ 4I76A 1JJ6C 3LSPA 5IOZA 2JA5J 1ZK8A 1NK3P 3ZQCA 3LOCA 1SANA 5M5WJ 3VPRA 1YRNA 1HF0A 3BTCA 2NS7A 1OFCX 2Y2ZA 3JRGA 1JKPC 1RR7A 1BA5A 2DMPA 1BW6A 1MBFA 2LD5A 1IC8A 4AYBN 4BXXJ 1DU6A 3IV5A 5JLXA 1O4XA 1AHDP 3GTJJ 2JA8J 3JRHA 3BTJA 4J19A 1TWAJ 1WH5A 5K7FA 2WAQN 1JKRC 1IRZA 1OJLA 4AC0A 2M34A 2JK3A 3HB9A 5FLMJ 1T56A 2XSDC 2H1KA 2G0EA 2K9SA 4XRSG 5DS9A 3S2HJ 2HYJA 2MG4A 1TWFJ 2HOSA 2Y0SN 3OSFA 2K9QA 2H8RA 1ZKGA 3HOXJ 3JREA 2N8GA 1ZR4A 1F43A 4XK4A 5HODA 4W97A 4BY7J 1ETWA 3E7LA 3MVPA 4A3BJ 5E3OA 2I10A 1PUFA 1QVTA 3Q3SA 4Y7NJ 4UUSB 3S17J 1H8AC 3O8GA 5E3MA 1AU7A 2DA3A 1ZQ3P 2COBA 4JX6A 1I50J 2O7OA 4A3IJ 3D1NI 2EZKA 3F0CA 1FTTA 2L7ZA 2VI6A 4M3BA 3I4NJ 4DZJA 5FJ8J 1HCRA 4M3DA 2E2JJ 1RKWA 3FKIJ 2QCOA 3FIWA 2R5YB 1X2NA 3BR5A 2E2IJ 1GV5A 1IGNA 2FJ1A 3WHBA 2K40A 1AKHB 2XB5A 1HDDC 4IHVA 1Z0XA 4LOCA 4Y52J 2Y9ZA 4GFBA 3CDLA 2DA2A 1U9NA 5M3FJ 5FKKA 1RETA 3S1RJ 5M3MJ 5EF6A 2R5YA 1MH4A 1GUUA 3BR1A 2DA5A 3PO3J 2M2EA 2R7ZJ 1AKHA 3GTOJ 1QRYA 1OCPA 2EZIA 3PM1A 1H89C 1MBHA 1ETQA 2YS9A 2LY9A 4A3EJ 2TRTA 3JRFA 2CQQA 3JRDA 3M4OJ 1TWCJ 3LSRA 9ANTA 5IP7J 4B4CA 2OPTA 2X9DA 5JLWA 2B63J 1T33A 2HXIA 1TWHJ 5F0CA 3CQZJ 4FISA 1JUSA 2XPUA 3G1MA 1W0TA 4M3GA 4M3FA 2LVSA 1MSFC 1ZGWA 2KDZA 1JUMA 4B1RA 4A69C 1OCTC 2E19A 2JA6J 1LFUP 4JX5A 2IAIA 1X58A 1JT6A 3HOUJ 2TCTA 4A3DJ 2LK2A 3RKQA 5K7ZA 2MW8A 1ETXA 3TW7A 1QVUA 2DTZA 3G1OA 3ZQIA 2M8GX 4FTHA 1WH7A 3ZQFA 2ZB9A 5E3NA 4XIDA 4MLOA 4QSHA 1ETOA 3GTPJ 1GVDA 5IYCJ 1IV6A 2M0CA 4CYCB 4FE4A 2JJ7A 1MSEC 3HOVJ 2L9RA 4ABZA 2DMUA 3S2DJ 1MBKA 3W6VA 1W0UA 2WV1A 3IH3A 1LFBA 4DW6A 2IEKA 2RAEA 4CYCA 2X48A 3HBLA 4X1EA 2NVXJ 1NTCA 4B3AA 1S7EA 5DTDA 4C2MJ 5J1YA 3HOZJ 5C4XJ 4A3JJ 5FKOA 1IG7A 1WGXA 1X2MA 1VFCA 4HNVA 3QQAA 3BG3A 3HDDA 4BY1J 3ZOBA 4A3GJ 4X6AJ 5GP9A 3QPLA 1FIPA 5F08A 3BG9A 5FKLA 2CUEA 2XGDA 3HM5A 3IH4A 2EQRA 4XICA 1UG2A 5IPAA 3OIOA 4A3KJ 1E3OC 4MFEA 5F0HA 4EEFG 2HQ5A 2VPRA 1WPKA 4JX4A 1D5YA 4MFDA 4D7MA 2DMTA 4MO7A 4QIWN 2NVTJ 3S15J 4NDLA 3L1PA 1HDPA 5IYBJ 3ZQGA 3NAUA 2HDDA 2DA7A 4AUXA 5F1JA 3I4MJ 3LSGA 2R92J 1WCMJ 3TP0A 4M6VA 2W48A 2L7FP 1IUFA 3RZDJ 1I3QJ 2PMZN 3ZQHA 5EG0B 2DMNA 2DMQA 3S1MJ 2NS8A 3HOWJ 4D7NA 3GTLJ 4UUSA 3LNQA 2CQXA 4RDUA 3Q0UA 1A6IA 4DYCA 3BT9A 3C2BA 2JWTA 3BR2A 1XC5A 1APLC 2M9HA 3GTMJ 1ENHA 2XB0X 5EGOB 1FJLA 5EG0A 3TW6A 2DA1A 1EF4A 2NOGA 3ZQLA 2R0QC 3FK6A 1Q1VA 1ITYA 5M5XJ 4FCYA 3FK7A 2EZLA 3NARA 5C3EJ 1H88C 4BBSJ 4A3CJ 2EBIA 2ECCA 5EGOA 1U8BA 5C4JJ 3O8HA 1GV2A 3CCYA 3HKZN 2LKXA 3OOUA 3S1QJ 5IP9J 1UHSA 2QF7A 3JRBA 4S0HB 2XPVA 2DJNA 2Y30A 2O8KA 1MNMC 3MN2A 1HLVA 1SFOJ 4A3MJ 3DCFA 2XRLA 4D5FA 3OSGA 4BKXA 2X6OA 4C3IJ 1JGGA 2GM4A 3QPSA 5FLVA 2XPWA 5F0FA 1ETYA
chains in the Genus database with same CATH superfamily
5E8IA 2FF4A 3FX3A 3I64A 2JN6A 2XAGA 2PJPA 2O61A 2LG4A 1EH8A 2Y9YA 2CYYA 2BV6A 3F8MA 1VZ0A 2WB1N 3M7GA 4U0WA 3OV8A 3WODF 4DOZA 1VQ8I 1RPWA 3GO5A 5TGTA 4E7ZA 3A01B 1RRJA 2HOTA 5M5YJ 3BJ6A 2XDVA 2UXNA 2P5VA 5KK1A 3JR9A 4IHWA 1L0OC 2PMUA 3H5RA 2KKOA 2F5DA 3DPTA 4ZYHA 2IXSA 3AL0C 4G7ZF 4EMSA 4A93J 2QQAA 3O6BB 4AVPA 2LLKA 5IOYA 3BQZA 4YIIA 3X2QH 3BP8A 3KP3A 4GO1A 2JVGA 3K1NA 2YUSA 4RGUA 2C6YA 3EYIA 3UKGA 2V26A 3GUDA 4IEJA 1TC3C 3F6OA 1P6RA 2IPQX 1KZHA 1YS7A 3BR6A 5D6EA 3OYFA 2JTVA 3HRSA 3BQYA 2FOWA 4R79A 3CP8A 5E1XA 2OZ6A 4RM2A 3OYEA 1RKTA 1JTYA 5EYRA 5CVIA 2PBIA 2LP0A 1SFXA 5FB2A 3CMMA 3RPUD 1IW7F 2IBDA 2XC7A 3ABKH 5J40A 2HZTA 5JVGF 1JKOC 5B5EC 3FXJA 5KNLA 3OR2C 4CZCA 2R7SA 2KISA 1FYMA 4A3LJ 1JTXA 5ICEA 1YOVB 5HLIA 2KRCA 3T0YA 1ZRFA 2K4BA 2HPMA 2O9LA 4A0XA 3K4BA 4B3XA 2HI3A 1YYVA 3CCRI 2GBYA 5FRMA 2V79A 5FKMA 2ZNYA 1FYLA 3V8KA 4UV9A 1SD6A 2DA4A 3JSOA 5EZGA 1XCBA 4P1WA 1VQOI 2WAEA 3TKYA 2BYVE 3RCOA 1KU3A 5F6FA 2JZYA 4YFNF 1U6GA 3FHNA 1IV8A 3OYJA 3G1LA 2H6CA 5TRDA 3WTYC 1UMQA 1ZH5A 4IHXA 4N4NB 3OYAA 3B73A 1VQNI 2VKDA 2V9KA 2JQ7A 1VQ6I 2GA2A 2MGQA 2MSYA 2EIJH 3E6MA 5EEHA 1OQYA 2JMWA 4U0VA 1YO5C 2A68F 3BZCA 1JJ8C 4LJZF 2VODA 5EZHA 4GCVA 3E1SA 4DYQA 4ZYDA 5GPAA 3HSFA 5DV5A 1FP2A 1TT5B 3IH2A 4XRSA 4XBFA 3RKWA 5GTIC 2CS3A 2LNBA 3FMQA 3K4NA 4YRVA 1BW5A 5E20A 4QPQA 3AG3H 3VFZA 4PDKA 5GADJ 4RBOA 5IP6A 2CW8A 2BY3A 3C18A 3FXOA 4HLXA 2R7WA 1FOWA 2L9NA 4KMUX 5FD5A 1P2FA 4S05A 3TP3A 1IZ1A 3R60A 1K83J 3CJTB 5J3LA 4KICA 1OCZH 4OIQF 2E71A 4HZFA 1W7PD 3W2VA 4HF0A 2R5ZA 1G4DA 5DYMA 5L3FA 5EDNA 1G3TA 1B8IB 4RS8A 1R22A 2LTPA 1MBGA 4JYKA 4R1HA 5F27A 1GT0C 2X0LA 3EUHC 2L2OA 3S14J 2K27A 2EZHA 4IHYA 5CVUA 1MH3A 3OS1A 3LSTA 2ZFUA 3S1NJ 1R00A 1HOMA 1WWXA 2PJRB 2FA5A 5GPCA 4RGXA 2VLAA 4MGRA 1V55H 3HRUA 4XSXF 3SJMA 1F5TA 4BDYA 4C30A 4IOAF 3RPQA 1DGWY 1YW7A 2VXZA 3PUFA 2A61A 2WA0A 5IOZA 2IGKA 4KUMA 4XQFA 1ZK8A 1NK3P 2NVUB 5M5WJ 2R7FA 3ZCOA 4HNTA 3BG7A 3W3CA 1LDDA 4DBQA 4I0BA 4NQWA 2NS7A 1QQIA 3FXKA 3D5SC 2CFXA 2FQ3A 1TQPA 1OFCX 3HXLA 2GA1A 3ZN0A 3N97A 2CW7A 3JRGA 5BPDA 1S29A 1R6RA 2GIVA 4M73A 4AIKA 1EV7A 2DMPA 3BWGA 3L7WA 2KPMA 4E6KG 3DWLE 3EYYA 1K79A 3PQJA 4AYBN 4BXXJ 3FBIB 5EEGA 1MIJA 1WQ2A 3SZPA 1BIAA 2AS5F 3OYHA 3IV5A 3EPZA 4BJ5C 2KQRA 4BL0B 2OTJI 3J7AY 1W5CC 3P7NA 3FXMA 4L9NA 4XLFA 3DU6A 3I5UA 4G7OF 1T08B 4AC0A 2M34A 2JK3A 2ZXJA 4XM3A 2COMA 2XSDC 2H1KA 1UFMA 1PVEA 1D8JA 2G0EA 1YIOA 2LDUA 5JHUA 2K9SA 2HYGD 5DS9A 1ULYA 4HG2A 2HYJA 2MG4A 3K9TA 2PFBA 3OSFA 4BUPA 4II3A 2ZJ2A 1PP8F 2WV0A 1HXDA 3WG7H 1Y8RB 2LRDA 4U7BA 2M87A 3MAJA 2FRHA 2KZGA 2DU9A 3DFGA 2HDCA 4BY7J 2PEXA 1ETWA 3E7LA 2R7VA 1ODDA 1PUFA 2QSHX 1IN7A 4Y7NJ 4HDUA 1QHHD 2Z2SB 2EILH 2VONA 1S8NA 3WU2C 3WE2A 2QM3A 2M1BA 2DA3A 1ZQ3P 3DTKA 1A04A 2IS1A 2P7VB 3D1NI 2WC2A 1P9QC 4PSXA 1R7JA 4M3BA 5FRNA 5FJ8J 4XLEA 5GAGJ 2LYCA 2L01A 2W57A 1YHQI 2VE8A 2ADUA 2PX9A 2KDOA 2HTSA 3BR5A 1OCCH 3MCZA 4IOCF 3ABTA 3VWBA 2OZUA 4GYIA 4ESBA 2FJ1A 1NG7A 2XB5A 3L2CA 4LLGF 3PNYA 1Z0XA 5FROA 1IXCA 1Y0UA 2EA2A 3P9CA 2R7XA 3S1RJ 2Y69H 3BLYA 1B4AA 1S9HA 2R5YA 3F21A 2E34A 2WBMA 3BR1A 3FXLA 1LJ9A 4XSZF 2R7ZJ 4NC6A 3PFYA 4IPAA 1AKHA 2CV2A 5AIQA 1FOKA 2F5EA 4OIRF 1JXSA 1ETQA 4CCNA 4RM3A 3RTRA 5J47A 3ZMDA 4GYGA 4M9ZA 1TWCJ 3LSRA 5HLGA 2B63J 3KYCB 1T33A 2HXIA 2RREA 4CGZA 2JA2A 2VJ4A 2XPUA 5B1BH 4B47A 4M3FA 1MSFC 4WF2A 2DK5A 3G3ZA 1ZRCA 4BGDA 2XAHA 1JUMA 2KZVA 3PSFA 1U0JA 4A69C 1MD0A 1EH7A 5D5XB 2JA6J 4Q5SF 4JX5A 3OYNA 2PLYA 3HPHA 3U9GA 4KN4X 1OPCA 1JT6A 2M3AA 1HW1A 1KU7A 5DM6F 1K78A 4A3DJ 4YFKF 2MW8A 4ANJA 1ETXA 3S3MA 1T2KA 3TW7A 2DYRH 2EA4A 1O7LA 2BHYA 1ETOA 1P4WA 2HFHA 1KU2A 2FUG2 3RPUA 1LDKB 1IV6A 3ERMA 2Z33A 4KJZA 3OYLA 4MEYF 1F1ZA 2JJ7A 1WI9A 2Q0OA 2BY2A 2M8EA 4QWQA 1J5YA 4ABZA 2DMUA 1MSEC 5E1ZB 1R23A 3D5RC 1E17A 2R7TA 1UHMA 2A3SA 2DOAA 2IEKA 1O3RA 2JUCA 4HV6A 2RGVA 1S7EA 5C4XJ 2AXLA 3H0DA 4CCJA 1A31A 4NC7A 1IG7A 4V19K 1TBXA 1VFCA 4P9UA 3ISPA 5DD8A 4BQQA 4HNVA 5JI6A 2VB6A 1B9NA 5HLHA 3I58A 3DEUA 2V9VA 1LPQA 1FBQA 3QPLA 3K4CA 3H5NA 3GZ6A 4UY8I 1FIPA 2TDXA 1DP3A 2X6WA 2CUEA 3ECOA 1D0XA 2HVSA 1EA3A 2IGOA 1HA8A 5IPAA 4DNCA 4A3KJ 1E3OC 3C1DA 1DGRM 4MFEA 1Z91A 4EEFG 2FU4A 1F4KA 3VB2A 2BEOA 4WXCA 5FFZA 2DMTA 4MO7A 1X4PA 2XVCA 1XMXA 2F6CA 2IA2A 5D4SA 1XMAA 2F5FA 2MD0A 4BS9A 5F1JA 3G4SI 2VKHA 1J75A 1YX3A 3LSGA 4PGGA 3BDDA 5F1RA 1H0MA 2OCCH 3V7SA 1NG6A 1YE9A 5HS7A 4BE0A 3M9AA 2DMNA 2DMQA 2V6CA 4D7NA 3GTLJ 2FBIA 1Y6IA 4RDUA 4BHCA 1HBXG 3KP5A 1PDNC 3TBIA 1ZLJA 4AWXB 1R5GA 1MJ9A 2DTRA 2ELJA 1C0WA 4BQNA 2BGCA 1IN6A 1APLC 2M9HA 3OIPA 3HKZA 3GTMJ 1S7OA 3QPTA 5L3EA 1FJLA 4LB5A 5H2FC 2B9SA 3TW6A 1E3PA 2XHKA 1TQIA 3I3LA 5ILVA 4XL9A 2STTA 1SC7A 3KEQA 2VBZA 2FOKA 1ITYA 5M5XJ 4B8XA 1T6SA 2LC2A 1H88C 1I3AA 4A3CJ 1IF1A 1Y0NA 4EGZA 2GOXB 2YR2A 4FX4A 3CCYA 2QBYA 5LGUA 1RI7A 3S93A 3PUBA 3JRBA 4WXDA 3R61A 5HS9A 2FBHA 1MMGA 3QP6A 2DJNA 2EIMH 2Y30A 4WXHA 3DBRB 3DCFA 2ZSIB 4D5FA 3PIPF 4BKXA 2VL8A 3F8NA 2EV0A 1JGSA 3QPSA 2E36A 2MABA 2XSJC 4LG0B 2XPWA 1MW7A 1RZ4A 5C44J 1X19A 2LBFA 4KFCA 2JSPA 1Z77A 3H9JA 1BIBA 4IF4A 4KIGA 3ZQQA 1FSEA 5KAIC 1G59A 1ETVA 4FE7A 2ZXWH 3E5UA 1V54H 1WKMA 4KDPA 3CZ6A 2A6HF 2ISYA 2IJLA 3HGGA 1VQPI 5LRRA 2EH3A 1XG1A 2LFBA 2QKLB 1T38A 2V1NA 3ONQA 1OISA 1J09A 4G7HF 1BOBA 3W6KB 2BOLA 1O7FA 5CVVA 2HXOA 4U7DA 3PL8A 2BW3A 3TO9A 1QPIA 4I6ZA 3BC8A 4UVCA 3BR3A 3CCJI 5L3CA 2F4MB 4D0PA 2M0MA 4DYRA 5LGTA 4E7LA 1U78A 3KP2A 3HGYA 2VASA 3AFHA 1QBJA 3F72A 4RLFA 5ERIA 4I2OA 5IT9Z 5LHGA 4G6DA 4CCLA 4XR6A 1W4MA 2QSFX 1HKTA 1S6LA 2BXZA 2VXDA 3FZVA 3L2QA 1LE8B 2CH0A 4HDVA 2R7UA 5DEQA 2FMLA 1BL0A 4EJVA 1O3SA 1FEXA 1SVLA 4G12A 2ACJA 1LNWA 3JRIA 1S5LC 1QU3A 5ICFA 3BTIA 1IDZA 2QWWA 4RGSA 1PUFB 3CDIA 2HEOA 3B6AA 1GXQA 1XDUA 1D1AA 1NK2P 2HWVA 5ICCA 4M6XA 4LK0F 1QO0D 2ZMEA 1X1AA 2BZTA 4U0YA 3IRQA 3REOA 2QVOA 1SD4A 4ENKA 3AG4H 1MDMA 1XGOA 2VC0A 3H3ZA 2W82A 1MZBA 1FYKA 3V7RA 1HW5A 2W24A 4RB1A 4OAZA 3OYBA 1BC8C 2GAUA 4M9SA 3KZYA 3ZXSA 3GTGJ 2VBYA 2QSGX 4DZPA 4M9XA 1P7JA 3T5XA 5J1RA 1K6YA 2K7LA 2VQLA 1AWCA 4LITA 5J8FA 5LHHA 1STZA 2X1DA 3EDPA 1Z6TA 2E5NA 2NXNB 4BQOA 2NNYA 2DK8A 4HX8A 4YIFA 1OYIA 1SVOA 3IUOA 3JTHA 1G3SA 4G8XA 1Z7UA 1BJZA 1FX7A 1UZCA 3A03A 5K7HA 2ZXIA 2ECBA 3HZJA 3M8EA 1ON1A 2E1OA 4BXFA 1ETKA 1ZG3A 3EQLF 2GLOA 4HSRA 1HC8A 3F9KA 1N25A 5J1UA 3OYDA 2D5VA 3FMRA 3SFZA 4KIBA 3LL7A 2V4JC 2FQ4A 4UXNA 4BACA 1Z6RA 2BVMA 4OMYA 4DGWB 4QTRA 2K9NA 4CYDA 2VT3A 1JHHA 3GMEA 3CLQA 4L5EA 3GFIA 4IRIA 1G8XA 2W4SA 4EVIA 2KRHA 3MEXA 2IRFG 5DCMA 1JKQC 5CVJA 2DPUA 1MNEA 1PYVA 3PO2J 4CUGA 1K78B 2FE3A 1VNDA 1R1TA 1D8KA 1ZELA 2KIUA 3E97A 1B72A 2LKSA 4HX4A 3Q9VA 3PSIA 2WY8Q 3H0GJ 2ELHA 2IA1A 2ZBKA 1U5TA 5D8LB 3KETA 1S7AA 1M1EB 1R9TJ 3H9GA 4KYWA 2WWYA 3J80K 3GF2A 2X4HA 1FWZA 3I59A 4CSWA 4I76A 4UVAA 4BEHA 1Y8QB 3LSPA 3AAFA 1VQ7I 3ABUA 2HPIA 3VPRA 2BXYA 1YRNA 2RQQA 4XKWA 2M7AA 2W00A 1X1DA 4HAMA 2CW0F 1LDJA 3E0JB 2RKHA 3A1YA 4HOBA 3HSRA 5H20A 3FF5A 3AG1H 2VE9A 3QU3A 3HPGA 2DT5A 1RR7A 3DPLC 4HQMA 4P96A 1MBFA 2ZO4A 4KA4A 1TLHB 2LKPA 1ZARA 3LWFA 3QP5A 3P9IA 4XLHA 5JLXA 5HVQC 4ZTJA 1NHAA 2FNAA 3K70D 3DTIA 3IP4B 2MD5A 1TWAJ 1WH5A 2H09A 5K7FA 1Y39A 1R58A 1OJLA 3PFIA 3H35A 2QQ9A 5EJCA 3CD6I 2K3PA 4XRSG 4IL6C 4EATA 3S2HJ 4S04A 1TWFJ 3WGGA 4RB0A 3D5LA 2H8RA 3HOXJ 2G7UA 3JREA 1F43A 2VJ5A 2DQRA 4W97A 2X1EA 4A3BJ 4P55A 2I10A 5JVTA 1QVTA 4O6JA 1MMAA 2LF8A 3LA3A 5E3MA 1BI1A 1CF7B 3K1MA 1DDNA 3U1DA 2COBA 3F22A 4A3IJ 2EZKA 3ZGKA 3F0CA 4BHPA 1FTTA 1W7PB 5FD6A 3I4NJ 2CGPA 2H94A 1RKWA 4PJJA 4N9IA 4LLLA 1LVAA 1RC9A 2YPRA 2QCOA 4QPOA 1WZ2A 4L9JA 1GV5A 4CA0A 2IS6A 4BJTA 4FASD 4BAYA 2K40A 3ELKA 4HX7A 1HDDC 5BPIA 4HF1A 2DFHA 4Y52J 1USTA 4CCKA 3F8FA 3OS0A 2KRFA 4IO9F 2ZC2A 1U9NA 2F2EA 3CCEI 3JW4A 1O3QA 2Q2EB 1ONVA 3SXYA 2DQLA 2DA5A 3PO3J 2L7KA 1V5FA 4B09A 3GTOJ 2EZIA 3HJEA 3WG9A 1H89C 2X6XA 4P9FA 3AL0B 1J9IA 2LY9A 4A3EJ 2DT7B 2CQQA 3DXJF 4Y33A 1K6OA 3M4OJ 4B4CA 3RI4A 2X9DA 4ZC3A 2K3FA 2ZNZA 3GFLA 3LFUA 5F0CA 1XMKA 3CQZJ 4M3GA 4GRIA 2E1CA 2L02A 2KDZA 2XV4S 4BDZA 1ZRDA 2W7NA 2QLZA 4F3QA 1W36D 2HKXA 2E19A 1LFUP 3BZKA 3KZIC 2FSWA 2EFWA 3RJPA 2DFFA 2MLGA 1ZHFA 3K10A 3K1PA 5TISC 1U8RA 1BJAA 2LY1A 1MKMA 2VPLA 2DODA 3IL2A 2M30A 1KA8A 2HR3A 1EH6A 3G1OA 4YG2F 3ZMSA 1QA6A 2KIFA 2ZB9A 5E3NA 2DDBA 3TL4X 4QSHA 4L9TA 4DBRA 3L2WA 2CQ7A 5IYCJ 2GXBA 5A2QK 4CYCB 1BI3A 2DCEA 3TQNA 2YSRA 3IWZA 1I1GA 2Y0MA 3S2DJ 1KU9A 2EV5A 3HOTA 4RAYA 3MKWB 3DKYA 1ZN2A 3IAS2 5D4RA 3H36A 1W0UA 5E18F 2WV1A 1KQ9A 1U5TC 3FDYA 3IH3A 4B48A 4DW6A 2A69F 4ZYEA 4E7IA 3VYTB 4D1QA 5K5QA 3CJNA 2RAEA 4XOTA 2XKPA 4X1EA 1BI0A 2Y0SA 1NTCA 4B3AA 5DTDA 5J1YA 2JVHA 1H9TA 4A3JJ 2KL4A 2MYSA 5FKOA 3L09A 4A5MA 1UJ8A 5CLSA 5F64A 1LB2A 3ASNH 1QHGA 1X2MA 3TGNA 1X4OA 3MD2A 3FXQA 3I4PA 2XASA 3BG3A 1YW9A 3MKYB 2NYXA 3A2KA 3J80Z 2BY0A 5ICGA 1KYZA 3TDUC 2CV1A 3BG9A 5BS6A 2XGDA 3FKJA 3IH4A 3OY9A 1S72I 3CUQA 2JSCA 1BI2A 4ZJZA 1UG2A 2DJIA 1GLNA 2FEZA 3I9V2 3OIOA 4G6QA 1E2XA 2RC4A 2VPRA 1WPKA 5LEKA 5K5RA 4QIWN 3DEEA 3KLOA 5HS8A 3I56I 2NVTJ 3S15J 4DJAA 3CDHA 2Y75A 1FBSA 1W5TA 1TZLA 3K4KA 3NAUA 4G94A 4BJ6C 4BE1A 3E6BA 4UNOA 2RNJA 1GXPA 2V7FA 4YELA 2PMZN 1FLIA 4L9VA 2DYSH 3LSIA 2LREA 4XN3A 1ERDA 2NS8A 2OC6A 1ZGAA 1FC3A 2CMPA 3EUKL 1TNSA 5FFXA 4BU2A 4II2A 2JUGA 3C2BA 2BE5F 3HL2A 1R1UA 1PP7U 2RNGA 5KAFC 1ENHA 4EQQA 5EGOB 5EG0A 3CTAA 4PJMA 2DOFA 1MJAA 3QOEA 1XSDA 2HQRA 3VYUB 3ZQLA 3FK6A 2OJED 3HTUA 3HUGB 1HQCA 4FCYA 1XSXA 4D9JA 5C4JJ 1N75A 2X6YA 3ABLH 2M4GA 4ESFA 2LKXA 3OOUA 1FZPB 1ZYRF 3WU1B 3HTSB 1BBYA 5CKTA 1MNMC 1JI8A 1SFOJ 1V3FA 3KFWX 1YI2I 4GXOA 1O57A 3WTSC 4HF2A 3WE3A 2MA3A 2XGXA 5BQTA 3SHFA 2DFIA 4G9YA 2DA6A 1X1BA 2GWRA 1ETYA 2MH9A 1RNLA 1DPRA 1LEAA 4IHTA 2Y31A 4D5CA 1XPXA 2XRNA 4EM1A 4U88A 1VF9A 2XGCA 2CO5A 2YX7A 1WJ5A 3RZOJ 4UV8A 4NUBA 3UNGC 4KMFA 3OOPA 3WTUC 3LSJA 5FKNA 5HNHA 1QZZA 3CESA 1P7IA 3FISA 4UB8C 5D8KB 2EFQA 2NS0A 1Z05A 3R4KA 3DLLF 1HSJA 4C3JJ 3A01A 3F3XA 3O2PE 1G2HA 2OF7A 2H6BA 4RB3C 1I6HJ 4AVZA 2O8XA 3ZR8X 3SEQA 2EPFA 2D1VA 3FWEA 4OU0A 1Q1HA 5AIPA 5FO5A 3SQNA 4EJUA 1FTZA 2ME0A 3DU5A 2JA7J 3GZ5A 4L0YB 3P5JA 2ID6A 1UELB 4M74A 3MZ8A 1P92A 3NEUA 4LG3A 1WJBA 3LAJA 1MNDA 2AO9A 1D5VA 5L3GA 3Q0WA 2FBKA 1K4SA 4A6DA 4K2EA 2UWMA 5ILSA 5BNGA 3DKWA 4GDFA 1E3HA 4BXUA 2E1NA 3J81K 4C3HJ 5D5VB 5E3LA 1MBEA 1Y1WJ 2ESNA 3H9QA 1SMYF 4XLAA 4L18B 1A5JA 4M3EA 2L9SA 4O5VA 3PNTA 1SAXA 5CQEA 2UUZA 2NVQJ 5A2QZ 1YQAA 4XORA 2L7MP 5DUKA 2XROA 3RIRA 3ERED 1IN8A 1DUXC 1IJWC 4ASNA 2BBYA 2H1LA 3R6SA 2NVYJ 2ID3A 2JRMA 3S16J 3P9KA 4EM2A 4BYYA 1ZGJA 2B0LA 4BE2A 4HYEA 4A6EA 4PFOA 4CDGA 4V2GA 3O3KA 1WVRA 3OL4A 3SZGA 5JHFA 3K4MA 3MWMA 2L5QA 3HEFA 3LSMA 3OIQA 3LSHA 1W5SA 3FXRA 5DM7F 1AA7A 3S32A 3WGIA 3LAPA 1D0YA 3CUQC 5HDGA 2R7OA 1IAWA 2ISZA 1LQ1A 4ENNA 3GLLA 3L9FA 3DBHB 2WTEA 2HNHA 4Y3OA 2NNNA 3I71A 2ME6A 4CH7A 1ZAOA 4OMZA 1K61A 3QWLA 2V1XA 3HC7A 4A2UA 2P8TA 5BMZA 2JPCA 3VYSB 2OV7A 2ELKA 3HSEA 4IXAA 3SFIA 5HDKA 3K2AA 1IRGA 3WHCA 1A36A 4XRMA 1CQTA 3LSKA 1ON2A 2R5ZB 4MIMA 2VKVA 2WADA 3TO7A 2R7QA 3FHZA 3OL3A 3BPXA 2VN2A 4CICA 4E4HA 1WFXA 3U21A 4ON0A 1ORKA 3BPVA 2KMUA 3EUAA 2KT0A 5CVRA 2PN6A 2YU9J 4OWRB 1BR1A 5F04A 2IA0A 1PUEE 1P4AA 2E7WA 3K4JA 4L0ZB 4NNJA 4FHTA 3MFKA 2J5OA 1JE8A 1TW2A 4I98B 1LUJB 2JRTA 2DI3A 1SD5A 2VQGA 3Q5FA 1QZEA 1B8IA 4JK1X 3KP6A 4JP0A 2CJJA 5JR3A 2FX0A 4WCGA 3K7AJ 4KT5C 1R36A 2X1CA 3CUOA 3OYCA 3ZMVA 4RLQA 4EM0B 1SFUA 4NQWB 3LA2A 2FMYA 3H3UA 1SVMA 3RSNA 2VT2A 4J01A 1FY7A 3GX4X 2G7HA 2DBBA 5E79C 2Q1ZB 4I02A 2OD5A 3LQQA 4Y17A 4IRHA 3ZQCA 5KCMA 2F5VA 3CCMI 1SANA 2DW4A 2PJRA 3PIOF 2Z9OA 3DP7A 1HF0A 3E6DA 3BTCA 4RA2A 3U2RA 1I1SA 1X3ZB 4CHUA 4LIUA 1A6QA 1EJ9A 2NOJB 4N0BA 2OTLI 4BHBA 2Y2ZA 3CJQB 2AQEA 4U87A 2FXAA 2ZCWA 1BA5A 1TP4A 1YIJI 1BW6A 2MC4A 2NRAC 2EK5A 1B1BA 3IRRA 5DDGA 1Z7LA 3FMSA 2L4MA 4HA8A 2ZJPF 4XKBA 1O4XA 1AHDP 3GTJJ 3K70C 1U3EM 3SEZA 2RV8A 3DLAA 3BTJA 4ITVA 4J19A 1ZLKA 1R49A 3J7YJ 4IRGA 4HQEA 1JKRC 1Y56A 1IRZA 4Q47A 1USSA 5GAEJ 1J59A 5FLMJ 1FOXA 1WHUA 1T56A 1KQ0A 4DIQA 1G6NA 2QZ8A 3BOQA 2HOSA 2IVMA 2Y0SN 4N9HA 3EETA 4RAGA 3OYGA 2M5WA 2DO7A 4XLCA 3HHHA 4OAYA 1BM9A 3IHUA 4KN7X 1BC7C 4HPQA 4L5JA 1HSTA 3VOEA 2VJIA 4NBQA 5E3OA 2K5CA 1F9NA 2K02A 3JCUC 2L54A 4X0GA 2XAQA 4KT6A 1H8AC 3O8GA 4C2TA 3S3OA 1AU7A 4N4OB 5TJJA 4NB5A 1LEBA 4JX6A 1I50J 2O7OA 4AIDA 2BVLA 2L7ZA 3M07A 5AONA 2R7RA 3BJOA 4M3DA 2E2JJ 4LK1F 2RDPA 4XKCA 3J81Z 2O5RA 2A6EF 2DXIA 3GYHX 1SEUA 2P6TA 2R5YB 2E2IJ 3CCVI 4F52A 1IGNA 2A05A 4MEXF 1AKHB 1HW2A 2XAFA 4XNFA 3W2WA 2QA4I 1OCOH 1TW3A 4BNCA 4LOCA 4IHVA 3VEPA 4I7HA 2Y9ZA 4GFBA 5CQGA 3CDLA 1H9GA 2F5CA 1VQKI 3G71I 3KZZA 5M3FJ 3BROA 5DCFA 1XX5A 5FKKA 4AIHA 3QRFF 3K0LA 3WTXC 5K5OA 1B59A 1SFKA 3KPHA 1GUUA 2M2EA 2JT1A 4MQVA 1OCPA 1QRYA 2UV1A 4LB6B 1RIOH 4PGHA 1MBHA 3LQRA 4RGRA 1Z67A 2YS9A 2TRTA 3JRFA 3WTTC 4E7KA 3AKZA 2OPTA 1D1BA 4E70A 2E7XA 5JLWA 1K7AA 2ZKZA 1TWHJ 3JTGA 3LMMA 4FISA 2I8DA 3F8BA 3G1MA 2LVSA 1WJCA 3HOSA 1IRXA 1IUYA 2KP6A 2QKMB 2XUBA 3IWFA 1W36C 2Z3YA 4AD9A 2VQCA 3VODA 1W1WE 2DLLA 3IC7A 1X58A 4Z6YA 3KX2A 1X1PA 2TCTA 4C9YA 2Z99A 5HOOA 3RKQA 1VQ5I 1QVUA 2DTZA 3ZQIA 2CSOA 5LD2C 1YITI 4XIDA 4MLOA 3E5QA 4F7ZA 1BR4A 1T95A 1D1CA 1E0EA 2R7DA 3OS2A 1GVDA 4XLPF 2M4KA 1Z3XA 2DAOA 1T0FA 1XTAA 1UG0A 4FE4A 4ZTFA 4YFXF 2MH2A 2VOPA 5L3DA 1MBKA 3KIOA 2CWEA 2P5KA 2WAQA 3VSLA 2HKOA 3DQVC 1FMVA 1UHWA 3DV8A 1U2WA 1LFBA 2EFOA 2OUMA 3KP4A 2XKOA 3IKTA 3T8TA 3CCUI 1VTNC 1I27A 5K1YA 1A35A 3GVAA 3FM5A 3HBLA 2D2WA 2PQ8A 2P5LC 1B6AA 2OQRA 4C2MJ 3HOZJ 3ABMH 3HYIA 4PCQA 1YW8A 3JAMK 1XSVA 4A0ZA 1RUNA 2X85A 4WWCA 1WGXA 3KE2A 2ESHA 3PNVA 3F6VA 4UHTA 2EINH 3V8JA 4OIOF 2D1HA 2MC3A 1JHFA 4BY1J 2DFEA 4EV0A 2EFNA 4UVBA 2GZWA 4G6TB 5GP9A 1IRFA 4RB2C 4IJAA 5F08A 1G3YA 3HM5A 3ULQB 2EQRA 4XICA 2A5WA 3CLOA 3TOBA 1BOAA 3E3VA 3A0BC 2HQ5A 5CYVA 1I6XA 4PJ0C 3CCLI 1D5YA 1XDSA 4PJNA 1Z21A 4JQFA 3H92A 1FBUA 4NDLA 4I99C 1HDPA 3CO6C 5J8CA 3ZQGA 2HDDA 3CF2A 4CCOA 3I4MJ 1RR8C 2Z16A 2Q8KA 2R92J 1WCMJ 3TP0A 3J7AO 2L7FP 4XRFA 4ENJA 1WSUA 1OR7A 4O3MA 1IUFA 2H27A 3RZDJ 1I3QJ 1SMTA 4HRIA 3SDBA 3OMYA 3G2BA 5L3BA 1CGPA 3HOWJ 3S1MJ 4UUSA 3J7ZI 1GHCA 3LNQA 2CQXA 2LOOA 3Q0UA 2YX4A 1A6IA 2O6GE 4GGGA 4DYCA 2P4WA 2ZMEC 3BR2A 1XC5A 2XB0X 3H1CA 3AG2H 3R0JA 3BJAA 3T8RA 3CMAI 2DA1A 2L9VA 2QBYB 4A5NA 4Y13A 2E35A 2HYFA 4M6YA 1EF4A 2NOGA 1FOYA 2RN7A 3NRVA 1Q1VA 2CG4A 3FK7A 2DOEA 4P5OA 2EZLA 3NARA 4HBLA 5C3EJ 4BBSJ 2EBIA 2XF6A 2EWNA 3ZN1A 1T8IA 3DTEA 1U8BA 4B43A 3A0HC 3O8HA 1GV2A 1VQ4I 1YS6A 3HKZN 3S1QJ 5IP9J 4HSTA 2MFZA 4EGYA 2KHMA 2XPVA 1HKSA 2O8KA 4JBAA 2OA4A 3GXOA 3MN2A 4MTEA 2LBFB 2IT0A 4A3MJ 3OSGA 2X6OA 4C3IJ 4IVNA 1JGGA 4FT8A 4KNYA 2DPDA 2EB7A 3OR1C 5F0FA 2W84A 3OYIA 1KQ8A 3D0SA 4HEA2 3CCQI 1WRJA 3GCMA 3TDZC 2FD5A 2R93J 4PFPA 1U9OA 1YG2A 2DT6A 2GIZA 3M1EA 1KYWA 4XMYA 2EFPA 4LG0A 2A07F 2HOAA 2BW3B 3GZNB 2LSOA 2CRGA 4MNUA 3HOYJ 1V4RA 3MKLA 3QOPA 1RESA 4CZZA 3A4CA 4PZJA 1MJBA 4ZYAA 3GFJA 4M72A 3MKZA 3KYLA 4ESJA 5ILUA 1VQ9I 1ZTRA 3B6CA 3V4GA 1XS9A 1SD7A 1YFHA 4V2FA 2VUMJ 3ZP5A 2QQBA 1J0RA 3DEWA 2QYOA 3FXUA 4HV5A 1B9MA 3OYMA 3IAM2 4E7HA 2VKEA 3BG5A 1R4MB 3K6GA 2AHQA 2HS5A 4WK8F 4KIFA 2QUFA 3WTZA 4HLYA 2XAUA 4QLCU 2LMDA 2IGNA 2UXXA 5J4VA 2E2HJ 1T0FC 5IYDJ 2ZSHB 3E6CC 2XGEA 3GTQJ 3JRCA 3L2UA 4LMYA 2LR8A 1WI3A 2E1MC 4XKVA 1FNNA 3N05A 4F92B 3QAHA 4LFUA 6PAXA 5GAHJ 2Z1DA 4IHSA 3TEDA 4YEJA 2GXGA 1GDTA 3DPUA 3SDGA 1WJAA 2KIQA 3CMYA 2ZMEB 4JOMA 4A3FJ 2CFOA 2M45A 1FP1D 1MDMB 2V9PA 3M1CA 3M8JA 2GOMA 4AIJA 2QEXI 1LE8A 3RQIA 2V6EA 2A6TA 3GBGA 3GEZA 1VI0A 2P6SA 2P81A 3M3YJ 1DPUA 2L4AA 4BBRJ 1F36A 4OINF 3BTLA 4L5IA 5EEAA 2CQNA 3K4LA 1ZR2A 4XLNF 4Y4RA 3H3VK 1XGSA 5FGMA 3I54A 2XF5A 1JT0A 3K2ZA 2O03A 1MBJA 4B44A 1FT9A 3JAMZ 4A12A 1LKXA 3DF8A 2R3SA 3ZPLA 2DN0A 5LLQA 3BZ6A 1ZREA 1JUPA 3C2GA 3TOAA 4NC8A 2ZJRF 1OKRA 3W2AA 1POGA 3BR0A 4W1UA 2AQFA 1QPMA 4WX9A 3OWTA 1Z1DA 2LH9A 2ZXHA 3A02A 1FIAA 1MMSA 5B1AH 2CUFA 5D5UB 1OR7C 2R4GA 1IN4A 2LF7A 3HHGA 2HU9A 1MMNA 1TWGJ 2B7EA 5H6QA 3RYRA 1N78A 3VSKA 2E5ZA 3Q0VA 4J00A 2DDAA 1ZG5A 3T1BA 5DCMB 1DU0A 2WB1A 2VC1A 4LD5A 3N4MA 1YJWI 1QGPA 2L0KA 4UUTA 3JRAA 5JFRA 5KHDA 3QYBA 3KCCA 1D0ZA 1T39A 1B72B 5LRSA 5LEJA 1SFEA 2CQKA 1IDYA 3Q9SA 1UCRA 1U5TB 1Y1VJ 2ZJQF 2H8WA 4MHGA 2IW5A 5BOXA 5J6XA 2E60A 4IQJA 3QODA 3BCAA 3I59B 3RYPA 4LLNA 3PJRA 4BEHB 4E7SA 1KGSA 2HDWA 4Q48A 5H6RA 4ZZLA 3CC4I 1YRNB 3NWTA 1WJFA 1ACIA 1R71A 1X3UA 3ZMZA 3GWZA 2CU7A 5IT9K 3ROUA 3WU0A 2WAFA 3ESWB 5HDNA 1YX5A 3GTKJ 2V1UA 5LFAA 3LFKA 1JJ6C 1R5HA 3CC2I 2JA5J 4RAZA 2E1MB 3LOCA 2K9LA 2PG4A 2W25A 1EKEA 2F48A 3K69A 4YIRX 1FMWA 3SYTA 4ETSA 4AM3A 4MQ9F 2IP2A 4ZDPA 1FSHA 5DD4A 3RDIA 4MTDA 1JKPC 4IZZA 1BR2A 2LD5A 5B3SH 1IC8A 1WJEA 1DU6A 1REPC 1YJ9I 1J2XA 5FLXK 2W1OA 4OIPF 2HOEA 2K86A 3CC7I 3JSPA 5LGNA 1K4TA 3C3WA 5LBQA 2JA8J 3JRHA 1UB9A 1OYWA 1O3TA 4FQGA 4IKFA 2WAQN 2ZFWA 2IGMA 5DUIA 3HB9A 1R1VA 4UB6C 1S3JA 3ZQ7A 3UR3C 4ZYGA 5J4YA 3F23A 2KIMA 4EJTA 4KISA 4BQAA 3CP2A 3V8LA 5E8GA 3DBLB 2K9QA 3L00A 3W6JB 1ZKGA 4CXFA 2N8GA 3G73A 1ZR4A 2L3DA 3KP7A 2WY7Q 2D45A 3TO6A 1DP7P 4XK4A 4FX0A 5HODA 3S3NA 3DKXA 3TMOA 2XF7A 4Y15A 1FPQA 4KITB 3CMEI 4H0EA 5E17F 1XGMA 3MVPA 4NHJA 3VYRB 4ZDOA 4I0AA 3Q3SA 3H5AA 4UUSB 3S17J 3FM3A 3C2HA 2G9WA 1TNTA 4TV7A 4XN0A 2VBWA 3QU6A 1RUOA 2HGCA 1T98A 2VI6A 3KEYA 3MZHA 4DZJA 1HCRA 1VQLI 1IN5A 4LIVA 4PK4A 4IQ4A 1VQMI 3FKIJ 3FIWA 1X2NA 4EJOA 2KLOA 3GFMA 1CF7A 3WHBA 2HTJA 1R5ID 1DQUA 3LA7A 2FNPA 2BHZA 3V7CA 1W7PA 2DA2A 3M8FA 2K85A 4DQ2A 4I01A 1RETA 1TQMA 5CJ9A 1NH3A 5M3MJ 5EF6A 4IX7A 1MH4A 5CPRB 1OYYA 3PM1A 4CO8A 1BN5A 2HZDA 2BY1A 2JPBA 2Q2EA 2OAZA 1LVKA 1I5ZA 1N77A 3S8PA 2V1DA 3F8CA 3JRDA 2GXAA 4OOIA 9ANTA 1LFPA 2K9MA 5IP7J 3WTVC 2M7BA 3GW2A 4FETA 4A0YA 3HRTA 2IS4A 4PSWA 3MZYA 3V42A 3NQOA 1JUSA 1W0TA 4M71A 2OBPA 5D5WB 1XD7A 4H4KC 1ZGWA 2KJBA 1IO2A 2OQGA 1L3LA 5ED4A 4B1RA 3KYDB 3B02A 1OCTC 2MLKA 2IAIA 2KFDA 3KLNA 2GQQA 1GVJA 4EJWA 3HOUJ 3CJRB 5E1WA 2LK2A 5K7ZA 3RQ4A 1I39A 2QGUA 1Z3YA 2M8GX 4FTHA 1WH7A 2F4IA 3ZQFA 4AYBA 1UAAA 1X3WB 4ZZDA 2MBFA 2F4OB 3QYEA 4I09A 4HW0A 3GTPJ 1YLFA 1Z9CA 2M0CA 4E7JA 4HNUA 3I53A 3HOVJ 2L9RA 1WJDA 4CCMA 1KONA 1TTYA 3QYFA 3W6VA 3NWSA 4XONA 2OCEA 1OCRH 3E5XA 2RQPA 2CV0A 4Z2YA 3ECHA 2VJJA 4CYCA 2J5PA 2X48A 2HQNA 2NVXJ 1D3YA 2QQ8A 1HKQA 2VIXA 5LHIA 2HQAA 3CUQB 2EV6A 2XIGA 2PI0A 1G3WA 1TT0A 2AXTC 3QQAA 3C7JA 5D6FA 4F91B 1V5EA 3CF5F 3HDDA 2Y48A 3ZOBA 4A3GJ 3CO7C 4X6AJ 2X51A 3HG9A 3U1KA 1X1CA 5FKLA 1MGTA 1R4NB 2UZKA 1XCVA 3SZTA 4Q4ZF 2O0YA 3VDXA 5F0HA 3ASOH 2PMZA 5KVRA 3COAC 3G6EI 3CCSI 4JX4A 3RKYA 4MFDA 1V5GA 1QZYA 2ICWG 4D7MA 3RKXA 3L1PA 1XB4A 5IYBJ 2IS2A 4R8HA 4AU7A 1PJRA 4LGWA 2DA7A 4AUXA 5IT3A 3IKVA 4PUSA 4ZH4F 2EIKH 4M6VA 4BH9A 2W48A 2A5YB 4F55A 1OMIA 3OYKA 3BG6A 2K4JA 3ZQHA 2KJCA 1P4XA 5FLXZ 5EG0B 2ETHA 2HVQA 2XAJA 5GTHC 2NAZA 3QPHA 4ZDLA 2I5UA 3HRMA 2O3FA 3BT9A 5HLTA 3WTWC 3L2RA 1ZG1A 2VOOA 2JWTA 3S2WA 3KEOA 3ML6A 4RAFA 4F93B 4C2UA 2CUZA 4RMNA 1AOYA 1SAUA 4XOPA 2VBXA 2Z5UA 2P0WA 3HIFA 1TL8A 1MMDA 1OLTA 1XGNA 3BY6A 2R0QC 2EJRA 2QENA 3L2VA 4UUVA 3I55I 3ZMTA 3PQKA 1IXRC 2OU2A 3MQ0A 3EUHA 2ECCA 3ZRGA 1YTYA 5EGOA 2W85A 5IY5H 3GLXA 2LY2A 1UHSA 2QF7A 2VQHA 3FBNB 2STWA 2CUJA 4S0HB 2PMHA 3I0TA 3HUGA 1HLVA 1XN7A 3MMYB 2RVCA 2XRLA 1YJNI 2HVRA 5B66C 4ENMA 3ZMUA 3WGHA 1IXSB 3R0AA 5HNFA 2GM4A 1J7KA 1QNTA 4PJLA 5FLVA 3BCBA 2YU3A 2P7CB
chains in the Genus database with same CATH topology
5C44J 2JN6A 2Y31A 4D5CA 2Y9YA 1VF9A 2FD5A 1Z77A 2XGCA 1U9OA 2R93J 2WB1N 3RZOJ 1ETVA 4FE7A 1RPWA 3A01B 2HOTA 5M5YJ 3LSJA 5FKNA 2HOAA 1P7IA 3HOYJ 2CRGA 3HGGA 3FISA 3JR9A 3MKLA 2EH3A 1XG1A 2LFBA 4IHWA 1RESA 1ZTRA 3B6CA 4A93J 4C3JJ 5IOYA 3A01A 2LLKA 3BQZA 2HXOA 1XS9A 1G2HA 2OF7A 2VUMJ 1I6HJ 4V2FA 1QPIA 2YUSA 4I6ZA 3BR3A 3DEWA 3UKGA 4IEJA 1TC3C 1FTZA 2ME0A 2VKEA 3BR6A 2JA7J 3BG5A 4DYRA 2AHQA 3BQYA 1U78A 2ID6A 3HGYA 1RKTA 1JTYA 5EYRA 2LP0A 2AO9A 3Q0WA 1JKOC 2IBDA 2E2HJ 5IYDJ 4A3LJ 5BNGA 2XGEA 3GTQJ 3JRCA 1JTXA 4C3HJ 2LR8A 1MBEA 1WI3A 5E3LA 1Y1WJ 1LE8B 2O9LA 1A5JA 2HI3A 3TEDA 1BL0A 2GBYA 4M3EA 3SDGA 1GDTA 1FEXA 5FKMA 2NVQJ 2DA4A 3CMYA 4A3FJ 4G12A 2L7MP 5EZGA 3JRIA 1IJWC 3BTIA 2NVYJ 2ID3A 1IDZA 1PUFB 3S16J 3B6AA 3RQIA 1LE8A 1NK2P 3GBGA 1VI0A 2P81A 3M3YJ 3G1LA 4BBRJ 1F36A 4V2GA 1UMQA 3BTLA 4IHXA 5EEAA 3HEFA 1ZR2A 3H3VK 2MGQA 2MSYA 1JT0A 1MBJA 2JMWA 2DN0A 1JJ8C 3GTGJ 1JUPA 5EZHA 4DYQA 2ME6A 4DZPA 1P7JA 5GPAA 1POGA 3BR0A 5J1RA 1K61A 4W1UA 3IH2A 4XRSA 2ELKA 3SFIA 3A02A 3K2AA 3WHCA 1FIAA 1BW5A 4XRMA 2CUFA 1CQTA 4RBOA 2R5ZB 1BJZA 1TWGJ 4MIMA 3A03A 5IP6A 2VKVA 2ECBA 5K7HA 3Q0VA 2E1OA 1ETKA 2GLOA 1DU0A 3TP3A 5J1UA 2D5VA 1K83J 1ORKA 2L0KA 2DA6A 4UUTA 2FQ4A 3JRAA 2KT0A 2YU9J 5J3LA 4QTRA 2K9NA 2R5ZA 1B72B 5F04A 4L5EA 5EDNA 1IDYA 1B8IB 1Y1VJ 1JKQC 2LTPA 1MBGA 4JYKA 3PO2J 5F27A 1GT0C 1VNDA 3S14J 4IHYA 2EZHA 1B72A 1MH3A 1B8IA 4JP0A 3H0GJ 3S1NJ 2CJJA 2FX0A 1HOMA 3K7AJ 1R9TJ 1YRNB 5GPCA 2CU7A 3SJMA 3GTKJ 4I76A 1JJ6C 3LSPA 5IOZA 2JA5J 1ZK8A 1NK3P 3ZQCA 3LOCA 1SANA 5M5WJ 3VPRA 1YRNA 1HF0A 3BTCA 2NS7A 1OFCX 2Y2ZA 3JRGA 1JKPC 1RR7A 1BA5A 2DMPA 1BW6A 1MBFA 2LD5A 1IC8A 4AYBN 4BXXJ 1DU6A 3IV5A 5JLXA 1O4XA 1AHDP 3GTJJ 2JA8J 3JRHA 3BTJA 4J19A 1TWAJ 1WH5A 5K7FA 2WAQN 1JKRC 1IRZA 1OJLA 4AC0A 2M34A 2JK3A 3HB9A 5FLMJ 1T56A 2XSDC 2H1KA 2G0EA 2K9SA 4XRSG 5DS9A 3S2HJ 2HYJA 2MG4A 1TWFJ 2HOSA 2Y0SN 3OSFA 2K9QA 2H8RA 1ZKGA 3HOXJ 3JREA 2N8GA 1ZR4A 1F43A 4XK4A 5HODA 4W97A 4BY7J 1ETWA 3E7LA 3MVPA 4A3BJ 5E3OA 2I10A 1PUFA 1QVTA 3Q3SA 4Y7NJ 4UUSB 3S17J 1H8AC 3O8GA 5E3MA 1AU7A 2DA3A 1ZQ3P 2COBA 4JX6A 1I50J 2O7OA 4A3IJ 3D1NI 2EZKA 3F0CA 1FTTA 2L7ZA 2VI6A 4M3BA 3I4NJ 4DZJA 5FJ8J 1HCRA 4M3DA 2E2JJ 1RKWA 3FKIJ 2QCOA 3FIWA 2R5YB 1X2NA 3BR5A 2E2IJ 1GV5A 1IGNA 2FJ1A 3WHBA 2K40A 1AKHB 2XB5A 1HDDC 4IHVA 1Z0XA 4LOCA 4Y52J 2Y9ZA 4GFBA 3CDLA 2DA2A 1U9NA 5M3FJ 5FKKA 1RETA 3S1RJ 5M3MJ 5EF6A 2R5YA 1MH4A 1GUUA 3BR1A 2DA5A 3PO3J 2M2EA 2R7ZJ 1AKHA 3GTOJ 1QRYA 1OCPA 2EZIA 3PM1A 1H89C 1MBHA 1ETQA 2YS9A 2LY9A 4A3EJ 2TRTA 3JRFA 2CQQA 3JRDA 3M4OJ 1TWCJ 3LSRA 9ANTA 5IP7J 4B4CA 2OPTA 2X9DA 5JLWA 2B63J 1T33A 2HXIA 1TWHJ 5F0CA 3CQZJ 4FISA 1JUSA 2XPUA 3G1MA 1W0TA 4M3GA 4M3FA 2LVSA 1MSFC 1ZGWA 2KDZA 1JUMA 4B1RA 4A69C 1OCTC 2E19A 2JA6J 1LFUP 4JX5A 2IAIA 1X58A 1JT6A 3HOUJ 2TCTA 4A3DJ 2LK2A 3RKQA 5K7ZA 2MW8A 1ETXA 3TW7A 1QVUA 2DTZA 3G1OA 3ZQIA 2M8GX 4FTHA 1WH7A 3ZQFA 2ZB9A 5E3NA 4XIDA 4MLOA 4QSHA 1ETOA 3GTPJ 1GVDA 5IYCJ 1IV6A 2M0CA 4CYCB 4FE4A 2JJ7A 1MSEC 3HOVJ 2L9RA 4ABZA 2DMUA 3S2DJ 1MBKA 3W6VA 1W0UA 2WV1A 3IH3A 1LFBA 4DW6A 2IEKA 2RAEA 4CYCA 2X48A 3HBLA 4X1EA 2NVXJ 1NTCA 4B3AA 1S7EA 5DTDA 4C2MJ 5J1YA 3HOZJ 5C4XJ 4A3JJ 5FKOA 1IG7A 1WGXA 1X2MA 1VFCA 4HNVA 3QQAA 3BG3A 3HDDA 4BY1J 3ZOBA 4A3GJ 4X6AJ 5GP9A 3QPLA 1FIPA 5F08A 3BG9A 5FKLA 2CUEA 2XGDA 3HM5A 3IH4A 2EQRA 4XICA 1UG2A 5IPAA 3OIOA 4A3KJ 1E3OC 4MFEA 5F0HA 4EEFG 2HQ5A 2VPRA 1WPKA 4JX4A 1D5YA 4MFDA 4D7MA 2DMTA 4MO7A 4QIWN 2NVTJ 3S15J 4NDLA 3L1PA 1HDPA 5IYBJ 3ZQGA 3NAUA 2HDDA 2DA7A 4AUXA 5F1JA 3I4MJ 3LSGA 2R92J 1WCMJ 3TP0A 4M6VA 2W48A 2L7FP 1IUFA 3RZDJ 1I3QJ 2PMZN 3ZQHA 5EG0B 2DMNA 2DMQA 3S1MJ 2NS8A 3HOWJ 4D7NA 3GTLJ 4UUSA 3LNQA 2CQXA 4RDUA 3Q0UA 1A6IA 4DYCA 3BT9A 3C2BA 2JWTA 3BR2A 1XC5A 1APLC 2M9HA 3GTMJ 1ENHA 2XB0X 5EGOB 1FJLA 5EG0A 3TW6A 2DA1A 1EF4A 2NOGA 3ZQLA 2R0QC 3FK6A 1Q1VA 1ITYA 5M5XJ 4FCYA 3FK7A 2EZLA 3NARA 5C3EJ 1H88C 4BBSJ 4A3CJ 2EBIA 2ECCA 5EGOA 1U8BA 5C4JJ 3O8HA 1GV2A 3CCYA 3HKZN 2LKXA 3OOUA 3S1QJ 5IP9J 1UHSA 2QF7A 3JRBA 4S0HB 2XPVA 2DJNA 2Y30A 2O8KA 1MNMC 3MN2A 1HLVA 1SFOJ 4A3MJ 3DCFA 2XRLA 4D5FA 3OSGA 4BKXA 2X6OA 4C3IJ 1JGGA 2GM4A 3QPSA 5FLVA 2XPWA 5F0FA 1ETYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 J;  2JN6 A;  2Y31 A;  4D5C A;  2Y9Y A;  1VF9 A;  2FD5 A;  1Z77 A;  2XGC A;  1U9O A;  2R93 J;  2WB1 N;  3RZO J;  1ETV A;  4FE7 A;  1RPW A;  3A01 B;  2HOT A;  5M5Y J;  3LSJ A;  5FKN A;  2HOA A;  1P7I A;  3HOY J;  2CRG A;  3HGG A;  3FIS A;  3JR9 A;  3MKL A;  2EH3 A;  1XG1 A;  2LFB A;  4IHW A;  1RES A;  1ZTR A;  3B6C A;  4A93 J;  4C3J J;  5IOY A;  3A01 A;  2LLK A;  3BQZ A;  2HXO A;  1XS9 A;  1G2H A;  2OF7 A;  2VUM J;  1I6H J;  4V2F A;  1QPI A;  2YUS A;  4I6Z A;  3BR3 A;  3DEW A;  3UKG A;  4IEJ A;  1TC3 C;  1FTZ A;  2ME0 A;  2VKE A;  3BR6 A;  2JA7 J;  3BG5 A;  4DYR A;  2AHQ A;  3BQY A;  1U78 A;  2ID6 A;  3HGY A;  1RKT A;  1JTY A;  5EYR A;  2LP0 A;  2AO9 A;  3Q0W A;  1JKO C;  2IBD A;  2E2H J;  5IYD J;  4A3L J;  5BNG A;  2XGE A;  3GTQ J;  3JRC A;  1JTX A;  4C3H J;  2LR8 A;  1MBE A;  1WI3 A;  5E3L A;  1Y1W J;  1LE8 B;  2O9L A;  1A5J A;  2HI3 A;  3TED A;  1BL0 A;  2GBY A;  4M3E A;  3SDG A;  1GDT A;  1FEX A;  5FKM A;  2NVQ J;  2DA4 A;  3CMY A;  4A3F J;  4G12 A;  2L7M P;  5EZG A;  3JRI A;  1IJW C;  3BTI A;  2NVY J;  2ID3 A;  1IDZ A;  1PUF B;  3S16 J;  3B6A A;  3RQI A;  1LE8 A;  1NK2 P;  3GBG A;  1VI0 A;  2P81 A;  3M3Y J;  3G1L A;  4BBR J;  1F36 A;  4V2G A;  1UMQ A;  3BTL A;  4IHX A;  5EEA A;  3HEF A;  1ZR2 A;  3H3V K;  2MGQ A;  2MSY A;  1JT0 A;  1MBJ A;  2JMW A;  2DN0 A;  1JJ8 C;  3GTG J;  1JUP A;  5EZH A;  4DYQ A;  2ME6 A;  4DZP A;  1P7J A;  5GPA A;  1POG A;  3BR0 A;  5J1R A;  1K61 A;  4W1U A;  3IH2 A;  4XRS A;  2ELK A;  3SFI A;  3A02 A;  3K2A A;  3WHC A;  1FIA A;  1BW5 A;  4XRM A;  2CUF A;  1CQT A;  4RBO A;  2R5Z B;  1BJZ A;  1TWG J;  4MIM A;  3A03 A;  5IP6 A;  2VKV A;  2ECB A;  5K7H A;  3Q0V A;  2E1O A;  1ETK A;  2GLO A;  1DU0 A;  3TP3 A;  5J1U A;  2D5V A;  1K83 J;  1ORK A;  2L0K A;  2DA6 A;  4UUT A;  2FQ4 A;  3JRA A;  2KT0 A;  2YU9 J;  5J3L A;  4QTR A;  2K9N A;  2R5Z A;  1B72 B;  5F04 A;  4L5E A;  5EDN A;  1IDY A;  1B8I B;  1Y1V J;  1JKQ C;  2LTP A;  1MBG A;  4JYK A;  3PO2 J;  5F27 A;  1GT0 C;  1VND A;  3S14 J;  4IHY A;  2EZH A;  1B72 A;  1MH3 A;  1B8I A;  4JP0 A;  3H0G J;  3S1N J;  2CJJ A;  2FX0 A;  1HOM A;  3K7A J;  1R9T J;  1YRN B;  5GPC A;  2CU7 A;  3SJM A;  3GTK J;  4I76 A;  1JJ6 C;  3LSP A;  5IOZ A;  2JA5 J;  1ZK8 A;  1NK3 P;  3ZQC A;  3LOC A;  1SAN A;  5M5W J;  3VPR A;  1YRN A;  1HF0 A;  3BTC A;  2NS7 A;  1OFC X;  2Y2Z A;  3JRG A;  1JKP C;  1RR7 A;  1BA5 A;  2DMP A;  1BW6 A;  1MBF A;  2LD5 A;  1IC8 A;  4AYB N;  4BXX J;  1DU6 A;  3IV5 A;  5JLX A;  1O4X A;  1AHD P;  3GTJ J;  2JA8 J;  3JRH A;  3BTJ A;  4J19 A;  1TWA J;  1WH5 A;  5K7F A;  2WAQ N;  1JKR C;  1IRZ A;  1OJL A;  4AC0 A;  2M34 A;  2JK3 A;  3HB9 A;  5FLM J;  1T56 A;  2XSD C;  2H1K A;  2G0E A;  2K9S A;  4XRS G;  5DS9 A;  3S2H J;  2HYJ A;  2MG4 A;  1TWF J;  2HOS A;  2Y0S N;  3OSF A;  2K9Q A;  2H8R A;  1ZKG A;  3HOX J;  3JRE A;  2N8G A;  1ZR4 A;  1F43 A;  4XK4 A;  5HOD A;  4W97 A;  4BY7 J;  1ETW A;  3E7L A;  3MVP A;  4A3B J;  5E3O A;  2I10 A;  1PUF A;  1QVT A;  3Q3S A;  4Y7N J;  4UUS B;  3S17 J;  1H8A C;  3O8G A;  5E3M A;  1AU7 A;  2DA3 A;  1ZQ3 P;  2COB A;  4JX6 A;  1I50 J;  2O7O A;  4A3I J;  3D1N I;  2EZK A;  3F0C A;  1FTT A;  2L7Z A;  2VI6 A;  4M3B A;  3I4N J;  4DZJ A;  5FJ8 J;  1HCR A;  4M3D A;  2E2J J;  1RKW A;  3FKI J;  2QCO A;  3FIW A;  2R5Y B;  1X2N A;  3BR5 A;  2E2I J;  1GV5 A;  1IGN A;  2FJ1 A;  3WHB A;  2K40 A;  1AKH B;  2XB5 A;  1HDD C;  4IHV A;  1Z0X A;  4LOC A;  4Y52 J;  2Y9Z A;  4GFB A;  3CDL A;  2DA2 A;  1U9N A;  5M3F J;  5FKK A;  1RET A;  3S1R J;  5M3M J;  5EF6 A;  2R5Y A;  1MH4 A;  1GUU A;  3BR1 A;  2DA5 A;  3PO3 J;  2M2E A;  2R7Z J;  1AKH A;  3GTO J;  1QRY A;  1OCP A;  2EZI A;  3PM1 A;  1H89 C;  1MBH A;  1ETQ A;  2YS9 A;  2LY9 A;  4A3E J;  2TRT A;  3JRF A;  2CQQ A;  3JRD A;  3M4O J;  1TWC J;  3LSR A;  9ANT A;  5IP7 J;  4B4C A;  2OPT A;  2X9D A;  5JLW A;  2B63 J;  1T33 A;  2HXI A;  1TWH J;  5F0C A;  3CQZ J;  4FIS A;  1JUS A;  2XPU A;  3G1M A;  1W0T A;  4M3G A;  4M3F A;  2LVS A;  1MSF C;  1ZGW A;  2KDZ A;  1JUM A;  4B1R A;  4A69 C;  1OCT C;  2E19 A;  2JA6 J;  1LFU P;  4JX5 A;  2IAI A;  1X58 A;  1JT6 A;  3HOU J;  2TCT A;  4A3D J;  2LK2 A;  3RKQ A;  5K7Z A;  2MW8 A;  1ETX A;  3TW7 A;  1QVU A;  2DTZ A;  3G1O A;  3ZQI A;  2M8G X;  4FTH A;  1WH7 A;  3ZQF A;  2ZB9 A;  5E3N A;  4XID A;  4MLO A;  4QSH A;  1ETO A;  3GTP J;  1GVD A;  5IYC J;  1IV6 A;  2M0C A;  4CYC B;  4FE4 A;  2JJ7 A;  1MSE C;  3HOV J;  2L9R A;  4ABZ A;  2DMU A;  3S2D J;  1MBK A;  3W6V A;  1W0U A;  2WV1 A;  3IH3 A;  1LFB A;  4DW6 A;  2IEK A;  2RAE A;  4CYC A;  2X48 A;  3HBL A;  4X1E A;  2NVX J;  1NTC A;  4B3A A;  1S7E A;  5DTD A;  4C2M J;  5J1Y A;  3HOZ J;  5C4X J;  4A3J J;  5FKO A;  1IG7 A;  1WGX A;  1X2M A;  1VFC A;  4HNV A;  3QQA A;  3BG3 A;  3HDD A;  4BY1 J;  3ZOB A;  4A3G J;  4X6A J;  5GP9 A;  3QPL A;  1FIP A;  5F08 A;  3BG9 A;  5FKL A;  2CUE A;  2XGD A;  3HM5 A;  3IH4 A;  2EQR A;  4XIC A;  1UG2 A;  5IPA A;  3OIO A;  4A3K J;  1E3O C;  4MFE A;  5F0H A;  4EEF G;  2HQ5 A;  2VPR A;  1WPK A;  4JX4 A;  1D5Y A;  4MFD A;  4D7M A;  2DMT A;  4MO7 A;  4QIW N;  2NVT J;  3S15 J;  4NDL A;  3L1P A;  1HDP A;  5IYB J;  3ZQG A;  3NAU A;  2HDD A;  2DA7 A;  4AUX A;  5F1J A;  3I4M J;  3LSG A;  2R92 J;  1WCM J;  3TP0 A;  4M6V A;  2W48 A;  2L7F P;  1IUF A;  3RZD J;  1I3Q J;  2PMZ N;  3ZQH A;  5EG0 B;  2DMN A;  2DMQ A;  3S1M J;  2NS8 A;  3HOW J;  4D7N A;  3GTL J;  4UUS A;  3LNQ A;  2CQX A;  4RDU A;  3Q0U A;  1A6I A;  4DYC A;  3BT9 A;  3C2B A;  2JWT A;  3BR2 A;  1XC5 A;  1APL C;  2M9H A;  3GTM J;  1ENH A;  2XB0 X;  5EGO B;  1FJL A;  5EG0 A;  3TW6 A;  2DA1 A;  1EF4 A;  2NOG A;  3ZQL A;  2R0Q C;  3FK6 A;  1Q1V A;  1ITY A;  5M5X J;  4FCY A;  3FK7 A;  2EZL A;  3NAR A;  5C3E J;  1H88 C;  4BBS J;  4A3C J;  2EBI A;  2ECC A;  5EGO A;  1U8B A;  5C4J J;  3O8H A;  1GV2 A;  3CCY A;  3HKZ N;  2LKX A;  3OOU A;  3S1Q J;  5IP9 J;  1UHS A;  2QF7 A;  3JRB A;  4S0H B;  2XPV A;  2DJN A;  2Y30 A;  2O8K A;  1MNM C;  3MN2 A;  1HLV A;  1SFO J;  4A3M J;  3DCF A;  2XRL A;  4D5F A;  3OSG A;  4BKX A;  2X6O A;  4C3I J;  1JGG A;  2GM4 A;  3QPS A;  5FLV A;  2XPW A;  5F0F A;  1ETY A; 
#chains in the Genus database with same CATH topology
 5E8I A;  2FF4 A;  3FX3 A;  3I64 A;  2JN6 A;  2XAG A;  2PJP A;  2O61 A;  2LG4 A;  1EH8 A;  2Y9Y A;  2CYY A;  2BV6 A;  3F8M A;  1VZ0 A;  2WB1 N;  3M7G A;  4U0W A;  3OV8 A;  3WOD F;  4DOZ A;  1VQ8 I;  1RPW A;  3GO5 A;  5TGT A;  4E7Z A;  3A01 B;  1RRJ A;  2HOT A;  5M5Y J;  3BJ6 A;  2XDV A;  2UXN A;  2P5V A;  5KK1 A;  3JR9 A;  4IHW A;  1L0O C;  2PMU A;  3H5R A;  2KKO A;  2F5D A;  3DPT A;  4ZYH A;  2IXS A;  3AL0 C;  4G7Z F;  4EMS A;  4A93 J;  2QQA A;  3O6B B;  4AVP A;  2LLK A;  5IOY A;  3BQZ A;  4YII A;  3X2Q H;  3BP8 A;  3KP3 A;  4GO1 A;  2JVG A;  3K1N A;  2YUS A;  4RGU A;  2C6Y A;  3EYI A;  3UKG A;  2V26 A;  3GUD A;  4IEJ A;  1TC3 C;  3F6O A;  1P6R A;  2IPQ X;  1KZH A;  1YS7 A;  3BR6 A;  5D6E A;  3OYF A;  2JTV A;  3HRS A;  3BQY A;  2FOW A;  4R79 A;  3CP8 A;  5E1X A;  2OZ6 A;  4RM2 A;  3OYE A;  1RKT A;  1JTY A;  5EYR A;  5CVI A;  2PBI A;  2LP0 A;  1SFX A;  5FB2 A;  3CMM A;  3RPU D;  1IW7 F;  2IBD A;  2XC7 A;  3ABK H;  5J40 A;  2HZT A;  5JVG F;  1JKO C;  5B5E C;  3FXJ A;  5KNL A;  3OR2 C;  4CZC A;  2R7S A;  2KIS A;  1FYM A;  4A3L J;  1JTX A;  5ICE A;  1YOV B;  5HLI A;  2KRC A;  3T0Y A;  1ZRF A;  2K4B A;  2HPM A;  2O9L A;  4A0X A;  3K4B A;  4B3X A;  2HI3 A;  1YYV A;  3CCR I;  2GBY A;  5FRM A;  2V79 A;  5FKM A;  2ZNY A;  1FYL A;  3V8K A;  4UV9 A;  1SD6 A;  2DA4 A;  3JSO A;  5EZG A;  1XCB A;  4P1W A;  1VQO I;  2WAE A;  3TKY A;  2BYV E;  3RCO A;  1KU3 A;  5F6F A;  2JZY A;  4YFN F;  1U6G A;  3FHN A;  1IV8 A;  3OYJ A;  3G1L A;  2H6C A;  5TRD A;  3WTY C;  1UMQ A;  1ZH5 A;  4IHX A;  4N4N B;  3OYA A;  3B73 A;  1VQN I;  2VKD A;  2V9K A;  2JQ7 A;  1VQ6 I;  2GA2 A;  2MGQ A;  2MSY A;  2EIJ H;  3E6M A;  5EEH A;  1OQY A;  2JMW A;  4U0V A;  1YO5 C;  2A68 F;  3BZC A;  1JJ8 C;  4LJZ F;  2VOD A;  5EZH A;  4GCV A;  3E1S A;  4DYQ A;  4ZYD A;  5GPA A;  3HSF A;  5DV5 A;  1FP2 A;  1TT5 B;  3IH2 A;  4XRS A;  4XBF A;  3RKW A;  5GTI C;  2CS3 A;  2LNB A;  3FMQ A;  3K4N A;  4YRV A;  1BW5 A;  5E20 A;  4QPQ A;  3AG3 H;  3VFZ A;  4PDK A;  5GAD J;  4RBO A;  5IP6 A;  2CW8 A;  2BY3 A;  3C18 A;  3FXO A;  4HLX A;  2R7W A;  1FOW A;  2L9N A;  4KMU X;  5FD5 A;  1P2F A;  4S05 A;  3TP3 A;  1IZ1 A;  3R60 A;  1K83 J;  3CJT B;  5J3L A;  4KIC A;  1OCZ H;  4OIQ F;  2E71 A;  4HZF A;  1W7P D;  3W2V A;  4HF0 A;  2R5Z A;  1G4D A;  5DYM A;  5L3F A;  5EDN A;  1G3T A;  1B8I B;  4RS8 A;  1R22 A;  2LTP A;  1MBG A;  4JYK A;  4R1H A;  5F27 A;  1GT0 C;  2X0L A;  3EUH C;  2L2O A;  3S14 J;  2K27 A;  2EZH A;  4IHY A;  5CVU A;  1MH3 A;  3OS1 A;  3LST A;  2ZFU A;  3S1N J;  1R00 A;  1HOM A;  1WWX A;  2PJR B;  2FA5 A;  5GPC A;  4RGX A;  2VLA A;  4MGR A;  1V55 H;  3HRU A;  4XSX F;  3SJM A;  1F5T A;  4BDY A;  4C30 A;  4IOA F;  3RPQ A;  1DGW Y;  1YW7 A;  2VXZ A;  3PUF A;  2A61 A;  2WA0 A;  5IOZ A;  2IGK A;  4KUM A;  4XQF A;  1ZK8 A;  1NK3 P;  2NVU B;  5M5W J;  2R7F A;  3ZCO A;  4HNT A;  3BG7 A;  3W3C A;  1LDD A;  4DBQ A;  4I0B A;  4NQW A;  2NS7 A;  1QQI A;  3FXK A;  3D5S C;  2CFX A;  2FQ3 A;  1TQP A;  1OFC X;  3HXL A;  2GA1 A;  3ZN0 A;  3N97 A;  2CW7 A;  3JRG A;  5BPD A;  1S29 A;  1R6R A;  2GIV A;  4M73 A;  4AIK A;  1EV7 A;  2DMP A;  3BWG A;  3L7W A;  2KPM A;  4E6K G;  3DWL E;  3EYY A;  1K79 A;  3PQJ A;  4AYB N;  4BXX J;  3FBI B;  5EEG A;  1MIJ A;  1WQ2 A;  3SZP A;  1BIA A;  2AS5 F;  3OYH A;  3IV5 A;  3EPZ A;  4BJ5 C;  2KQR A;  4BL0 B;  2OTJ I;  3J7A Y;  1W5C C;  3P7N A;  3FXM A;  4L9N A;  4XLF A;  3DU6 A;  3I5U A;  4G7O F;  1T08 B;  4AC0 A;  2M34 A;  2JK3 A;  2ZXJ A;  4XM3 A;  2COM A;  2XSD C;  2H1K A;  1UFM A;  1PVE A;  1D8J A;  2G0E A;  1YIO A;  2LDU A;  5JHU A;  2K9S A;  2HYG D;  5DS9 A;  1ULY A;  4HG2 A;  2HYJ A;  2MG4 A;  3K9T A;  2PFB A;  3OSF A;  4BUP A;  4II3 A;  2ZJ2 A;  1PP8 F;  2WV0 A;  1HXD A;  3WG7 H;  1Y8R B;  2LRD A;  4U7B A;  2M87 A;  3MAJ A;  2FRH A;  2KZG A;  2DU9 A;  3DFG A;  2HDC A;  4BY7 J;  2PEX A;  1ETW A;  3E7L A;  2R7V A;  1ODD A;  1PUF A;  2QSH X;  1IN7 A;  4Y7N J;  4HDU A;  1QHH D;  2Z2S B;  2EIL H;  2VON A;  1S8N A;  3WU2 C;  3WE2 A;  2QM3 A;  2M1B A;  2DA3 A;  1ZQ3 P;  3DTK A;  1A04 A;  2IS1 A;  2P7V B;  3D1N I;  2WC2 A;  1P9Q C;  4PSX A;  1R7J A;  4M3B A;  5FRN A;  5FJ8 J;  4XLE A;  5GAG J;  2LYC A;  2L01 A;  2W57 A;  1YHQ I;  2VE8 A;  2ADU A;  2PX9 A;  2KDO A;  2HTS A;  3BR5 A;  1OCC H;  3MCZ A;  4IOC F;  3ABT A;  3VWB A;  2OZU A;  4GYI A;  4ESB A;  2FJ1 A;  1NG7 A;  2XB5 A;  3L2C A;  4LLG F;  3PNY A;  1Z0X A;  5FRO A;  1IXC A;  1Y0U A;  2EA2 A;  3P9C A;  2R7X A;  3S1R J;  2Y69 H;  3BLY A;  1B4A A;  1S9H A;  2R5Y A;  3F21 A;  2E34 A;  2WBM A;  3BR1 A;  3FXL A;  1LJ9 A;  4XSZ F;  2R7Z J;  4NC6 A;  3PFY A;  4IPA A;  1AKH A;  2CV2 A;  5AIQ A;  1FOK A;  2F5E A;  4OIR F;  1JXS A;  1ETQ A;  4CCN A;  4RM3 A;  3RTR A;  5J47 A;  3ZMD A;  4GYG A;  4M9Z A;  1TWC J;  3LSR A;  5HLG A;  2B63 J;  3KYC B;  1T33 A;  2HXI A;  2RRE A;  4CGZ A;  2JA2 A;  2VJ4 A;  2XPU A;  5B1B H;  4B47 A;  4M3F A;  1MSF C;  4WF2 A;  2DK5 A;  3G3Z A;  1ZRC A;  4BGD A;  2XAH A;  1JUM A;  2KZV A;  3PSF A;  1U0J A;  4A69 C;  1MD0 A;  1EH7 A;  5D5X B;  2JA6 J;  4Q5S F;  4JX5 A;  3OYN A;  2PLY A;  3HPH A;  3U9G A;  4KN4 X;  1OPC A;  1JT6 A;  2M3A A;  1HW1 A;  1KU7 A;  5DM6 F;  1K78 A;  4A3D J;  4YFK F;  2MW8 A;  4ANJ A;  1ETX A;  3S3M A;  1T2K A;  3TW7 A;  2DYR H;  2EA4 A;  1O7L A;  2BHY A;  1ETO A;  1P4W A;  2HFH A;  1KU2 A;  2FUG 2;  3RPU A;  1LDK B;  1IV6 A;  3ERM A;  2Z33 A;  4KJZ A;  3OYL A;  4MEY F;  1F1Z A;  2JJ7 A;  1WI9 A;  2Q0O A;  2BY2 A;  2M8E A;  4QWQ A;  1J5Y A;  4ABZ A;  2DMU A;  1MSE C;  5E1Z B;  1R23 A;  3D5R C;  1E17 A;  2R7T A;  1UHM A;  2A3S A;  2DOA A;  2IEK A;  1O3R A;  2JUC A;  4HV6 A;  2RGV A;  1S7E A;  5C4X J;  2AXL A;  3H0D A;  4CCJ A;  1A31 A;  4NC7 A;  1IG7 A;  4V19 K;  1TBX A;  1VFC A;  4P9U A;  3ISP A;  5DD8 A;  4BQQ A;  4HNV A;  5JI6 A;  2VB6 A;  1B9N A;  5HLH A;  3I58 A;  3DEU A;  2V9V A;  1LPQ A;  1FBQ A;  3QPL A;  3K4C A;  3H5N A;  3GZ6 A;  4UY8 I;  1FIP A;  2TDX A;  1DP3 A;  2X6W A;  2CUE A;  3ECO A;  1D0X A;  2HVS A;  1EA3 A;  2IGO A;  1HA8 A;  5IPA A;  4DNC A;  4A3K J;  1E3O C;  3C1D A;  1DGR M;  4MFE A;  1Z91 A;  4EEF G;  2FU4 A;  1F4K A;  3VB2 A;  2BEO A;  4WXC A;  5FFZ A;  2DMT A;  4MO7 A;  1X4P A;  2XVC A;  1XMX A;  2F6C A;  2IA2 A;  5D4S A;  1XMA A;  2F5F A;  2MD0 A;  4BS9 A;  5F1J A;  3G4S I;  2VKH A;  1J75 A;  1YX3 A;  3LSG A;  4PGG A;  3BDD A;  5F1R A;  1H0M A;  2OCC H;  3V7S A;  1NG6 A;  1YE9 A;  5HS7 A;  4BE0 A;  3M9A A;  2DMN A;  2DMQ A;  2V6C A;  4D7N A;  3GTL J;  2FBI A;  1Y6I A;  4RDU A;  4BHC A;  1HBX G;  3KP5 A;  1PDN C;  3TBI A;  1ZLJ A;  4AWX B;  1R5G A;  1MJ9 A;  2DTR A;  2ELJ A;  1C0W A;  4BQN A;  2BGC A;  1IN6 A;  1APL C;  2M9H A;  3OIP A;  3HKZ A;  3GTM J;  1S7O A;  3QPT A;  5L3E A;  1FJL A;  4LB5 A;  5H2F C;  2B9S A;  3TW6 A;  1E3P A;  2XHK A;  1TQI A;  3I3L A;  5ILV A;  4XL9 A;  2STT A;  1SC7 A;  3KEQ A;  2VBZ A;  2FOK A;  1ITY A;  5M5X J;  4B8X A;  1T6S A;  2LC2 A;  1H88 C;  1I3A A;  4A3C J;  1IF1 A;  1Y0N A;  4EGZ A;  2GOX B;  2YR2 A;  4FX4 A;  3CCY A;  2QBY A;  5LGU A;  1RI7 A;  3S93 A;  3PUB A;  3JRB A;  4WXD A;  3R61 A;  5HS9 A;  2FBH A;  1MMG A;  3QP6 A;  2DJN A;  2EIM H;  2Y30 A;  4WXH A;  3DBR B;  3DCF A;  2ZSI B;  4D5F A;  3PIP F;  4BKX A;  2VL8 A;  3F8N A;  2EV0 A;  1JGS A;  3QPS A;  2E36 A;  2MAB A;  2XSJ C;  4LG0 B;  2XPW A;  1MW7 A;  1RZ4 A;  5C44 J;  1X19 A;  2LBF A;  4KFC A;  2JSP A;  1Z77 A;  3H9J A;  1BIB A;  4IF4 A;  4KIG A;  3ZQQ A;  1FSE A;  5KAI C;  1G59 A;  1ETV A;  4FE7 A;  2ZXW H;  3E5U A;  1V54 H;  1WKM A;  4KDP A;  3CZ6 A;  2A6H F;  2ISY A;  2IJL A;  3HGG A;  1VQP I;  5LRR A;  2EH3 A;  1XG1 A;  2LFB A;  2QKL B;  1T38 A;  2V1N A;  3ONQ A;  1OIS A;  1J09 A;  4G7H F;  1BOB A;  3W6K B;  2BOL A;  1O7F A;  5CVV A;  2HXO A;  4U7D A;  3PL8 A;  2BW3 A;  3TO9 A;  1QPI A;  4I6Z A;  3BC8 A;  4UVC A;  3BR3 A;  3CCJ I;  5L3C A;  2F4M B;  4D0P A;  2M0M A;  4DYR A;  5LGT A;  4E7L A;  1U78 A;  3KP2 A;  3HGY A;  2VAS A;  3AFH A;  1QBJ A;  3F72 A;  4RLF A;  5ERI A;  4I2O A;  5IT9 Z;  5LHG A;  4G6D A;  4CCL A;  4XR6 A;  1W4M A;  2QSF X;  1HKT A;  1S6L A;  2BXZ A;  2VXD A;  3FZV A;  3L2Q A;  1LE8 B;  2CH0 A;  4HDV A;  2R7U A;  5DEQ A;  2FML A;  1BL0 A;  4EJV A;  1O3S A;  1FEX A;  1SVL A;  4G12 A;  2ACJ A;  1LNW A;  3JRI A;  1S5L C;  1QU3 A;  5ICF A;  3BTI A;  1IDZ A;  2QWW A;  4RGS A;  1PUF B;  3CDI A;  2HEO A;  3B6A A;  1GXQ A;  1XDU A;  1D1A A;  1NK2 P;  2HWV A;  5ICC A;  4M6X A;  4LK0 F;  1QO0 D;  2ZME A;  1X1A A;  2BZT A;  4U0Y A;  3IRQ A;  3REO A;  2QVO A;  1SD4 A;  4ENK A;  3AG4 H;  1MDM A;  1XGO A;  2VC0 A;  3H3Z A;  2W82 A;  1MZB A;  1FYK A;  3V7R A;  1HW5 A;  2W24 A;  4RB1 A;  4OAZ A;  3OYB A;  1BC8 C;  2GAU A;  4M9S A;  3KZY A;  3ZXS A;  3GTG J;  2VBY A;  2QSG X;  4DZP A;  4M9X A;  1P7J A;  3T5X A;  5J1R A;  1K6Y A;  2K7L A;  2VQL A;  1AWC A;  4LIT A;  5J8F A;  5LHH A;  1STZ A;  2X1D A;  3EDP A;  1Z6T A;  2E5N A;  2NXN B;  4BQO A;  2NNY A;  2DK8 A;  4HX8 A;  4YIF A;  1OYI A;  1SVO A;  3IUO A;  3JTH A;  1G3S A;  4G8X A;  1Z7U A;  1BJZ A;  1FX7 A;  1UZC A;  3A03 A;  5K7H A;  2ZXI A;  2ECB A;  3HZJ A;  3M8E A;  1ON1 A;  2E1O A;  4BXF A;  1ETK A;  1ZG3 A;  3EQL F;  2GLO A;  4HSR A;  1HC8 A;  3F9K A;  1N25 A;  5J1U A;  3OYD A;  2D5V A;  3FMR A;  3SFZ A;  4KIB A;  3LL7 A;  2V4J C;  2FQ4 A;  4UXN A;  4BAC A;  1Z6R A;  2BVM A;  4OMY A;  4DGW B;  4QTR A;  2K9N A;  4CYD A;  2VT3 A;  1JHH A;  3GME A;  3CLQ A;  4L5E A;  3GFI A;  4IRI A;  1G8X A;  2W4S A;  4EVI A;  2KRH A;  3MEX A;  2IRF G;  5DCM A;  1JKQ C;  5CVJ A;  2DPU A;  1MNE A;  1PYV A;  3PO2 J;  4CUG A;  1K78 B;  2FE3 A;  1VND A;  1R1T A;  1D8K A;  1ZEL A;  2KIU A;  3E97 A;  1B72 A;  2LKS A;  4HX4 A;  3Q9V A;  3PSI A;  2WY8 Q;  3H0G J;  2ELH A;  2IA1 A;  2ZBK A;  1U5T A;  5D8L B;  3KET A;  1S7A A;  1M1E B;  1R9T J;  3H9G A;  4KYW A;  2WWY A;  3J80 K;  3GF2 A;  2X4H A;  1FWZ A;  3I59 A;  4CSW A;  4I76 A;  4UVA A;  4BEH A;  1Y8Q B;  3LSP A;  3AAF A;  1VQ7 I;  3ABU A;  2HPI A;  3VPR A;  2BXY A;  1YRN A;  2RQQ A;  4XKW A;  2M7A A;  2W00 A;  1X1D A;  4HAM A;  2CW0 F;  1LDJ A;  3E0J B;  2RKH A;  3A1Y A;  4HOB A;  3HSR A;  5H20 A;  3FF5 A;  3AG1 H;  2VE9 A;  3QU3 A;  3HPG A;  2DT5 A;  1RR7 A;  3DPL C;  4HQM A;  4P96 A;  1MBF A;  2ZO4 A;  4KA4 A;  1TLH B;  2LKP A;  1ZAR A;  3LWF A;  3QP5 A;  3P9I A;  4XLH A;  5JLX A;  5HVQ C;  4ZTJ A;  1NHA A;  2FNA A;  3K70 D;  3DTI A;  3IP4 B;  2MD5 A;  1TWA J;  1WH5 A;  2H09 A;  5K7F A;  1Y39 A;  1R58 A;  1OJL A;  3PFI A;  3H35 A;  2QQ9 A;  5EJC A;  3CD6 I;  2K3P A;  4XRS G;  4IL6 C;  4EAT A;  3S2H J;  4S04 A;  1TWF J;  3WGG A;  4RB0 A;  3D5L A;  2H8R A;  3HOX J;  2G7U A;  3JRE A;  1F43 A;  2VJ5 A;  2DQR A;  4W97 A;  2X1E A;  4A3B J;  4P55 A;  2I10 A;  5JVT A;  1QVT A;  4O6J A;  1MMA A;  2LF8 A;  3LA3 A;  5E3M A;  1BI1 A;  1CF7 B;  3K1M A;  1DDN A;  3U1D A;  2COB A;  3F22 A;  4A3I J;  2EZK A;  3ZGK A;  3F0C A;  4BHP A;  1FTT A;  1W7P B;  5FD6 A;  3I4N J;  2CGP A;  2H94 A;  1RKW A;  4PJJ A;  4N9I A;  4LLL A;  1LVA A;  1RC9 A;  2YPR A;  2QCO A;  4QPO A;  1WZ2 A;  4L9J A;  1GV5 A;  4CA0 A;  2IS6 A;  4BJT A;  4FAS D;  4BAY A;  2K40 A;  3ELK A;  4HX7 A;  1HDD C;  5BPI A;  4HF1 A;  2DFH A;  4Y52 J;  1UST A;  4CCK A;  3F8F A;  3OS0 A;  2KRF A;  4IO9 F;  2ZC2 A;  1U9N A;  2F2E A;  3CCE I;  3JW4 A;  1O3Q A;  2Q2E B;  1ONV A;  3SXY A;  2DQL A;  2DA5 A;  3PO3 J;  2L7K A;  1V5F A;  4B09 A;  3GTO J;  2EZI A;  3HJE A;  3WG9 A;  1H89 C;  2X6X A;  4P9F A;  3AL0 B;  1J9I A;  2LY9 A;  4A3E J;  2DT7 B;  2CQQ A;  3DXJ F;  4Y33 A;  1K6O A;  3M4O J;  4B4C A;  3RI4 A;  2X9D A;  4ZC3 A;  2K3F A;  2ZNZ A;  3GFL A;  3LFU A;  5F0C A;  1XMK A;  3CQZ J;  4M3G A;  4GRI A;  2E1C A;  2L02 A;  2KDZ A;  2XV4 S;  4BDZ A;  1ZRD A;  2W7N A;  2QLZ A;  4F3Q A;  1W36 D;  2HKX A;  2E19 A;  1LFU P;  3BZK A;  3KZI C;  2FSW A;  2EFW A;  3RJP A;  2DFF A;  2MLG A;  1ZHF A;  3K10 A;  3K1P A;  5TIS C;  1U8R A;  1BJA A;  2LY1 A;  1MKM A;  2VPL A;  2DOD A;  3IL2 A;  2M30 A;  1KA8 A;  2HR3 A;  1EH6 A;  3G1O A;  4YG2 F;  3ZMS A;  1QA6 A;  2KIF A;  2ZB9 A;  5E3N A;  2DDB A;  3TL4 X;  4QSH A;  4L9T A;  4DBR A;  3L2W A;  2CQ7 A;  5IYC J;  2GXB A;  5A2Q K;  4CYC B;  1BI3 A;  2DCE A;  3TQN A;  2YSR A;  3IWZ A;  1I1G A;  2Y0M A;  3S2D J;  1KU9 A;  2EV5 A;  3HOT A;  4RAY A;  3MKW B;  3DKY A;  1ZN2 A;  3IAS 2;  5D4R A;  3H36 A;  1W0U A;  5E18 F;  2WV1 A;  1KQ9 A;  1U5T C;  3FDY A;  3IH3 A;  4B48 A;  4DW6 A;  2A69 F;  4ZYE A;  4E7I A;  3VYT B;  4D1Q A;  5K5Q A;  3CJN A;  2RAE A;  4XOT A;  2XKP A;  4X1E A;  1BI0 A;  2Y0S A;  1NTC A;  4B3A A;  5DTD A;  5J1Y A;  2JVH A;  1H9T A;  4A3J J;  2KL4 A;  2MYS A;  5FKO A;  3L09 A;  4A5M A;  1UJ8 A;  5CLS A;  5F64 A;  1LB2 A;  3ASN H;  1QHG A;  1X2M A;  3TGN A;  1X4O A;  3MD2 A;  3FXQ A;  3I4P A;  2XAS A;  3BG3 A;  1YW9 A;  3MKY B;  2NYX A;  3A2K A;  3J80 Z;  2BY0 A;  5ICG A;  1KYZ A;  3TDU C;  2CV1 A;  3BG9 A;  5BS6 A;  2XGD A;  3FKJ A;  3IH4 A;  3OY9 A;  1S72 I;  3CUQ A;  2JSC A;  1BI2 A;  4ZJZ A;  1UG2 A;  2DJI A;  1GLN A;  2FEZ A;  3I9V 2;  3OIO A;  4G6Q A;  1E2X A;  2RC4 A;  2VPR A;  1WPK A;  5LEK A;  5K5R A;  4QIW N;  3DEE A;  3KLO A;  5HS8 A;  3I56 I;  2NVT J;  3S15 J;  4DJA A;  3CDH A;  2Y75 A;  1FBS A;  1W5T A;  1TZL A;  3K4K A;  3NAU A;  4G94 A;  4BJ6 C;  4BE1 A;  3E6B A;  4UNO A;  2RNJ A;  1GXP A;  2V7F A;  4YEL A;  2PMZ N;  1FLI A;  4L9V A;  2DYS H;  3LSI A;  2LRE A;  4XN3 A;  1ERD A;  2NS8 A;  2OC6 A;  1ZGA A;  1FC3 A;  2CMP A;  3EUK L;  1TNS A;  5FFX A;  4BU2 A;  4II2 A;  2JUG A;  3C2B A;  2BE5 F;  3HL2 A;  1R1U A;  1PP7 U;  2RNG A;  5KAF C;  1ENH A;  4EQQ A;  5EGO B;  5EG0 A;  3CTA A;  4PJM A;  2DOF A;  1MJA A;  3QOE A;  1XSD A;  2HQR A;  3VYU B;  3ZQL A;  3FK6 A;  2OJE D;  3HTU A;  3HUG B;  1HQC A;  4FCY A;  1XSX A;  4D9J A;  5C4J J;  1N75 A;  2X6Y A;  3ABL H;  2M4G A;  4ESF A;  2LKX A;  3OOU A;  1FZP B;  1ZYR F;  3WU1 B;  3HTS B;  1BBY A;  5CKT A;  1MNM C;  1JI8 A;  1SFO J;  1V3F A;  3KFW X;  1YI2 I;  4GXO A;  1O57 A;  3WTS C;  4HF2 A;  3WE3 A;  2MA3 A;  2XGX A;  5BQT A;  3SHF A;  2DFI A;  4G9Y A;  2DA6 A;  1X1B A;  2GWR A;  1ETY A;  2MH9 A;  1RNL A;  1DPR A;  1LEA A;  4IHT A;  2Y31 A;  4D5C A;  1XPX A;  2XRN A;  4EM1 A;  4U88 A;  1VF9 A;  2XGC A;  2CO5 A;  2YX7 A;  1WJ5 A;  3RZO J;  4UV8 A;  4NUB A;  3UNG C;  4KMF A;  3OOP A;  3WTU C;  3LSJ A;  5FKN A;  5HNH A;  1QZZ A;  3CES A;  1P7I A;  3FIS A;  4UB8 C;  5D8K B;  2EFQ A;  2NS0 A;  1Z05 A;  3R4K A;  3DLL F;  1HSJ A;  4C3J J;  3A01 A;  3F3X A;  3O2P E;  1G2H A;  2OF7 A;  2H6B A;  4RB3 C;  1I6H J;  4AVZ A;  2O8X A;  3ZR8 X;  3SEQ A;  2EPF A;  2D1V A;  3FWE A;  4OU0 A;  1Q1H A;  5AIP A;  5FO5 A;  3SQN A;  4EJU A;  1FTZ A;  2ME0 A;  3DU5 A;  2JA7 J;  3GZ5 A;  4L0Y B;  3P5J A;  2ID6 A;  1UEL B;  4M74 A;  3MZ8 A;  1P92 A;  3NEU A;  4LG3 A;  1WJB A;  3LAJ A;  1MND A;  2AO9 A;  1D5V A;  5L3G A;  3Q0W A;  2FBK A;  1K4S A;  4A6D A;  4K2E A;  2UWM A;  5ILS A;  5BNG A;  3DKW A;  4GDF A;  1E3H A;  4BXU A;  2E1N A;  3J81 K;  4C3H J;  5D5V B;  5E3L A;  1MBE A;  1Y1W J;  2ESN A;  3H9Q A;  1SMY F;  4XLA A;  4L18 B;  1A5J A;  4M3E A;  2L9S A;  4O5V A;  3PNT A;  1SAX A;  5CQE A;  2UUZ A;  2NVQ J;  5A2Q Z;  1YQA A;  4XOR A;  2L7M P;  5DUK A;  2XRO A;  3RIR A;  3ERE D;  1IN8 A;  1DUX C;  1IJW C;  4ASN A;  2BBY A;  2H1L A;  3R6S A;  2NVY J;  2ID3 A;  2JRM A;  3S16 J;  3P9K A;  4EM2 A;  4BYY A;  1ZGJ A;  2B0L A;  4BE2 A;  4HYE A;  4A6E A;  4PFO A;  4CDG A;  4V2G A;  3O3K A;  1WVR A;  3OL4 A;  3SZG A;  5JHF A;  3K4M A;  3MWM A;  2L5Q A;  3HEF A;  3LSM A;  3OIQ A;  3LSH A;  1W5S A;  3FXR A;  5DM7 F;  1AA7 A;  3S32 A;  3WGI A;  3LAP A;  1D0Y A;  3CUQ C;  5HDG A;  2R7O A;  1IAW A;  2ISZ A;  1LQ1 A;  4ENN A;  3GLL A;  3L9F A;  3DBH B;  2WTE A;  2HNH A;  4Y3O A;  2NNN A;  3I71 A;  2ME6 A;  4CH7 A;  1ZAO A;  4OMZ A;  1K61 A;  3QWL A;  2V1X A;  3HC7 A;  4A2U A;  2P8T A;  5BMZ A;  2JPC A;  3VYS B;  2OV7 A;  2ELK A;  3HSE A;  4IXA A;  3SFI A;  5HDK A;  3K2A A;  1IRG A;  3WHC A;  1A36 A;  4XRM A;  1CQT A;  3LSK A;  1ON2 A;  2R5Z B;  4MIM A;  2VKV A;  2WAD A;  3TO7 A;  2R7Q A;  3FHZ A;  3OL3 A;  3BPX A;  2VN2 A;  4CIC A;  4E4H A;  1WFX A;  3U21 A;  4ON0 A;  1ORK A;  3BPV A;  2KMU A;  3EUA A;  2KT0 A;  5CVR A;  2PN6 A;  2YU9 J;  4OWR B;  1BR1 A;  5F04 A;  2IA0 A;  1PUE E;  1P4A A;  2E7W A;  3K4J A;  4L0Z B;  4NNJ A;  4FHT A;  3MFK A;  2J5O A;  1JE8 A;  1TW2 A;  4I98 B;  1LUJ B;  2JRT A;  2DI3 A;  1SD5 A;  2VQG A;  3Q5F A;  1QZE A;  1B8I A;  4JK1 X;  3KP6 A;  4JP0 A;  2CJJ A;  5JR3 A;  2FX0 A;  4WCG A;  3K7A J;  4KT5 C;  1R36 A;  2X1C A;  3CUO A;  3OYC A;  3ZMV A;  4RLQ A;  4EM0 B;  1SFU A;  4NQW B;  3LA2 A;  2FMY A;  3H3U A;  1SVM A;  3RSN A;  2VT2 A;  4J01 A;  1FY7 A;  3GX4 X;  2G7H A;  2DBB A;  5E79 C;  2Q1Z B;  4I02 A;  2OD5 A;  3LQQ A;  4Y17 A;  4IRH A;  3ZQC A;  5KCM A;  2F5V A;  3CCM I;  1SAN A;  2DW4 A;  2PJR A;  3PIO F;  2Z9O A;  3DP7 A;  1HF0 A;  3E6D A;  3BTC A;  4RA2 A;  3U2R A;  1I1S A;  1X3Z B;  4CHU A;  4LIU A;  1A6Q A;  1EJ9 A;  2NOJ B;  4N0B A;  2OTL I;  4BHB A;  2Y2Z A;  3CJQ B;  2AQE A;  4U87 A;  2FXA A;  2ZCW A;  1BA5 A;  1TP4 A;  1YIJ I;  1BW6 A;  2MC4 A;  2NRA C;  2EK5 A;  1B1B A;  3IRR A;  5DDG A;  1Z7L A;  3FMS A;  2L4M A;  4HA8 A;  2ZJP F;  4XKB A;  1O4X A;  1AHD P;  3GTJ J;  3K70 C;  1U3E M;  3SEZ A;  2RV8 A;  3DLA A;  3BTJ A;  4ITV A;  4J19 A;  1ZLK A;  1R49 A;  3J7Y J;  4IRG A;  4HQE A;  1JKR C;  1Y56 A;  1IRZ A;  4Q47 A;  1USS A;  5GAE J;  1J59 A;  5FLM J;  1FOX A;  1WHU A;  1T56 A;  1KQ0 A;  4DIQ A;  1G6N A;  2QZ8 A;  3BOQ A;  2HOS A;  2IVM A;  2Y0S N;  4N9H A;  3EET A;  4RAG A;  3OYG A;  2M5W A;  2DO7 A;  4XLC A;  3HHH A;  4OAY A;  1BM9 A;  3IHU A;  4KN7 X;  1BC7 C;  4HPQ A;  4L5J A;  1HST A;  3VOE A;  2VJI A;  4NBQ A;  5E3O A;  2K5C A;  1F9N A;  2K02 A;  3JCU C;  2L54 A;  4X0G A;  2XAQ A;  4KT6 A;  1H8A C;  3O8G A;  4C2T A;  3S3O A;  1AU7 A;  4N4O B;  5TJJ A;  4NB5 A;  1LEB A;  4JX6 A;  1I50 J;  2O7O A;  4AID A;  2BVL A;  2L7Z A;  3M07 A;  5AON A;  2R7R A;  3BJO A;  4M3D A;  2E2J J;  4LK1 F;  2RDP A;  4XKC A;  3J81 Z;  2O5R A;  2A6E F;  2DXI A;  3GYH X;  1SEU A;  2P6T A;  2R5Y B;  2E2I J;  3CCV I;  4F52 A;  1IGN A;  2A05 A;  4MEX F;  1AKH B;  1HW2 A;  2XAF A;  4XNF A;  3W2W A;  2QA4 I;  1OCO H;  1TW3 A;  4BNC A;  4LOC A;  4IHV A;  3VEP A;  4I7H A;  2Y9Z A;  4GFB A;  5CQG A;  3CDL A;  1H9G A;  2F5C A;  1VQK I;  3G71 I;  3KZZ A;  5M3F J;  3BRO A;  5DCF A;  1XX5 A;  5FKK A;  4AIH A;  3QRF F;  3K0L A;  3WTX C;  5K5O A;  1B59 A;  1SFK A;  3KPH A;  1GUU A;  2M2E A;  2JT1 A;  4MQV A;  1OCP A;  1QRY A;  2UV1 A;  4LB6 B;  1RIO H;  4PGH A;  1MBH A;  3LQR A;  4RGR A;  1Z67 A;  2YS9 A;  2TRT A;  3JRF A;  3WTT C;  4E7K A;  3AKZ A;  2OPT A;  1D1B A;  4E70 A;  2E7X A;  5JLW A;  1K7A A;  2ZKZ A;  1TWH J;  3JTG A;  3LMM A;  4FIS A;  2I8D A;  3F8B A;  3G1M A;  2LVS A;  1WJC A;  3HOS A;  1IRX A;  1IUY A;  2KP6 A;  2QKM B;  2XUB A;  3IWF A;  1W36 C;  2Z3Y A;  4AD9 A;  2VQC A;  3VOD A;  1W1W E;  2DLL A;  3IC7 A;  1X58 A;  4Z6Y A;  3KX2 A;  1X1P A;  2TCT A;  4C9Y A;  2Z99 A;  5HOO A;  3RKQ A;  1VQ5 I;  1QVU A;  2DTZ A;  3ZQI A;  2CSO A;  5LD2 C;  1YIT I;  4XID A;  4MLO A;  3E5Q A;  4F7Z A;  1BR4 A;  1T95 A;  1D1C A;  1E0E A;  2R7D A;  3OS2 A;  1GVD A;  4XLP F;  2M4K A;  1Z3X A;  2DAO A;  1T0F A;  1XTA A;  1UG0 A;  4FE4 A;  4ZTF A;  4YFX F;  2MH2 A;  2VOP A;  5L3D A;  1MBK A;  3KIO A;  2CWE A;  2P5K A;  2WAQ A;  3VSL A;  2HKO A;  3DQV C;  1FMV A;  1UHW A;  3DV8 A;  1U2W A;  1LFB A;  2EFO A;  2OUM A;  3KP4 A;  2XKO A;  3IKT A;  3T8T A;  3CCU I;  1VTN C;  1I27 A;  5K1Y A;  1A35 A;  3GVA A;  3FM5 A;  3HBL A;  2D2W A;  2PQ8 A;  2P5L C;  1B6A A;  2OQR A;  4C2M J;  3HOZ J;  3ABM H;  3HYI A;  4PCQ A;  1YW8 A;  3JAM K;  1XSV A;  4A0Z A;  1RUN A;  2X85 A;  4WWC A;  1WGX A;  3KE2 A;  2ESH A;  3PNV A;  3F6V A;  4UHT A;  2EIN H;  3V8J A;  4OIO F;  2D1H A;  2MC3 A;  1JHF A;  4BY1 J;  2DFE A;  4EV0 A;  2EFN A;  4UVB A;  2GZW A;  4G6T B;  5GP9 A;  1IRF A;  4RB2 C;  4IJA A;  5F08 A;  1G3Y A;  3HM5 A;  3ULQ B;  2EQR A;  4XIC A;  2A5W A;  3CLO A;  3TOB A;  1BOA A;  3E3V A;  3A0B C;  2HQ5 A;  5CYV A;  1I6X A;  4PJ0 C;  3CCL I;  1D5Y A;  1XDS A;  4PJN A;  1Z21 A;  4JQF A;  3H92 A;  1FBU A;  4NDL A;  4I99 C;  1HDP A;  3CO6 C;  5J8C A;  3ZQG A;  2HDD A;  3CF2 A;  4CCO A;  3I4M J;  1RR8 C;  2Z16 A;  2Q8K A;  2R92 J;  1WCM J;  3TP0 A;  3J7A O;  2L7F P;  4XRF A;  4ENJ A;  1WSU A;  1OR7 A;  4O3M A;  1IUF A;  2H27 A;  3RZD J;  1I3Q J;  1SMT A;  4HRI A;  3SDB A;  3OMY A;  3G2B A;  5L3B A;  1CGP A;  3HOW J;  3S1M J;  4UUS A;  3J7Z I;  1GHC A;  3LNQ A;  2CQX A;  2LOO A;  3Q0U A;  2YX4 A;  1A6I A;  2O6G E;  4GGG A;  4DYC A;  2P4W A;  2ZME C;  3BR2 A;  1XC5 A;  2XB0 X;  3H1C A;  3AG2 H;  3R0J A;  3BJA A;  3T8R A;  3CMA I;  2DA1 A;  2L9V A;  2QBY B;  4A5N A;  4Y13 A;  2E35 A;  2HYF A;  4M6Y A;  1EF4 A;  2NOG A;  1FOY A;  2RN7 A;  3NRV A;  1Q1V A;  2CG4 A;  3FK7 A;  2DOE A;  4P5O A;  2EZL A;  3NAR A;  4HBL A;  5C3E J;  4BBS J;  2EBI A;  2XF6 A;  2EWN A;  3ZN1 A;  1T8I A;  3DTE A;  1U8B A;  4B43 A;  3A0H C;  3O8H A;  1GV2 A;  1VQ4 I;  1YS6 A;  3HKZ N;  3S1Q J;  5IP9 J;  4HST A;  2MFZ A;  4EGY A;  2KHM A;  2XPV A;  1HKS A;  2O8K A;  4JBA A;  2OA4 A;  3GXO A;  3MN2 A;  4MTE A;  2LBF B;  2IT0 A;  4A3M J;  3OSG A;  2X6O A;  4C3I J;  4IVN A;  1JGG A;  4FT8 A;  4KNY A;  2DPD A;  2EB7 A;  3OR1 C;  5F0F A;  2W84 A;  3OYI A;  1KQ8 A;  3D0S A;  4HEA 2;  3CCQ I;  1WRJ A;  3GCM A;  3TDZ C;  2FD5 A;  2R93 J;  4PFP A;  1U9O A;  1YG2 A;  2DT6 A;  2GIZ A;  3M1E A;  1KYW A;  4XMY A;  2EFP A;  4LG0 A;  2A07 F;  2HOA A;  2BW3 B;  3GZN B;  2LSO A;  2CRG A;  4MNU A;  3HOY J;  1V4R A;  3MKL A;  3QOP A;  1RES A;  4CZZ A;  3A4C A;  4PZJ A;  1MJB A;  4ZYA A;  3GFJ A;  4M72 A;  3MKZ A;  3KYL A;  4ESJ A;  5ILU A;  1VQ9 I;  1ZTR A;  3B6C A;  3V4G A;  1XS9 A;  1SD7 A;  1YFH A;  4V2F A;  2VUM J;  3ZP5 A;  2QQB A;  1J0R A;  3DEW A;  2QYO A;  3FXU A;  4HV5 A;  1B9M A;  3OYM A;  3IAM 2;  4E7H A;  2VKE A;  3BG5 A;  1R4M B;  3K6G A;  2AHQ A;  2HS5 A;  4WK8 F;  4KIF A;  2QUF A;  3WTZ A;  4HLY A;  2XAU A;  4QLC U;  2LMD A;  2IGN A;  2UXX A;  5J4V A;  2E2H J;  1T0F C;  5IYD J;  2ZSH B;  3E6C C;  2XGE A;  3GTQ J;  3JRC A;  3L2U A;  4LMY A;  2LR8 A;  1WI3 A;  2E1M C;  4XKV A;  1FNN A;  3N05 A;  4F92 B;  3QAH A;  4LFU A;  6PAX A;  5GAH J;  2Z1D A;  4IHS A;  3TED A;  4YEJ A;  2GXG A;  1GDT A;  3DPU A;  3SDG A;  1WJA A;  2KIQ A;  3CMY A;  2ZME B;  4JOM A;  4A3F J;  2CFO A;  2M45 A;  1FP1 D;  1MDM B;  2V9P A;  3M1C A;  3M8J A;  2GOM A;  4AIJ A;  2QEX I;  1LE8 A;  3RQI A;  2V6E A;  2A6T A;  3GBG A;  3GEZ A;  1VI0 A;  2P6S A;  2P81 A;  3M3Y J;  1DPU A;  2L4A A;  4BBR J;  1F36 A;  4OIN F;  3BTL A;  4L5I A;  5EEA A;  2CQN A;  3K4L A;  1ZR2 A;  4XLN F;  4Y4R A;  3H3V K;  1XGS A;  5FGM A;  3I54 A;  2XF5 A;  1JT0 A;  3K2Z A;  2O03 A;  1MBJ A;  4B44 A;  1FT9 A;  3JAM Z;  4A12 A;  1LKX A;  3DF8 A;  2R3S A;  3ZPL A;  2DN0 A;  5LLQ A;  3BZ6 A;  1ZRE A;  1JUP A;  3C2G A;  3TOA A;  4NC8 A;  2ZJR F;  1OKR A;  3W2A A;  1POG A;  3BR0 A;  4W1U A;  2AQF A;  1QPM A;  4WX9 A;  3OWT A;  1Z1D A;  2LH9 A;  2ZXH A;  3A02 A;  1FIA A;  1MMS A;  5B1A H;  2CUF A;  5D5U B;  1OR7 C;  2R4G A;  1IN4 A;  2LF7 A;  3HHG A;  2HU9 A;  1MMN A;  1TWG J;  2B7E A;  5H6Q A;  3RYR A;  1N78 A;  3VSK A;  2E5Z A;  3Q0V A;  4J00 A;  2DDA A;  1ZG5 A;  3T1B A;  5DCM B;  1DU0 A;  2WB1 A;  2VC1 A;  4LD5 A;  3N4M A;  1YJW I;  1QGP A;  2L0K A;  4UUT A;  3JRA A;  5JFR A;  5KHD A;  3QYB A;  3KCC A;  1D0Z A;  1T39 A;  1B72 B;  5LRS A;  5LEJ A;  1SFE A;  2CQK A;  1IDY A;  3Q9S A;  1UCR A;  1U5T B;  1Y1V J;  2ZJQ F;  2H8W A;  4MHG A;  2IW5 A;  5BOX A;  5J6X A;  2E60 A;  4IQJ A;  3QOD A;  3BCA A;  3I59 B;  3RYP A;  4LLN A;  3PJR A;  4BEH B;  4E7S A;  1KGS A;  2HDW A;  4Q48 A;  5H6R A;  4ZZL A;  3CC4 I;  1YRN B;  3NWT A;  1WJF A;  1ACI A;  1R71 A;  1X3U A;  3ZMZ A;  3GWZ A;  2CU7 A;  5IT9 K;  3ROU A;  3WU0 A;  2WAF A;  3ESW B;  5HDN A;  1YX5 A;  3GTK J;  2V1U A;  5LFA A;  3LFK A;  1JJ6 C;  1R5H A;  3CC2 I;  2JA5 J;  4RAZ A;  2E1M B;  3LOC A;  2K9L A;  2PG4 A;  2W25 A;  1EKE A;  2F48 A;  3K69 A;  4YIR X;  1FMW A;  3SYT A;  4ETS A;  4AM3 A;  4MQ9 F;  2IP2 A;  4ZDP A;  1FSH A;  5DD4 A;  3RDI A;  4MTD A;  1JKP C;  4IZZ A;  1BR2 A;  2LD5 A;  5B3S H;  1IC8 A;  1WJE A;  1DU6 A;  1REP C;  1YJ9 I;  1J2X A;  5FLX K;  2W1O A;  4OIP F;  2HOE A;  2K86 A;  3CC7 I;  3JSP A;  5LGN A;  1K4T A;  3C3W A;  5LBQ A;  2JA8 J;  3JRH A;  1UB9 A;  1OYW A;  1O3T A;  4FQG A;  4IKF A;  2WAQ N;  2ZFW A;  2IGM A;  5DUI A;  3HB9 A;  1R1V A;  4UB6 C;  1S3J A;  3ZQ7 A;  3UR3 C;  4ZYG A;  5J4Y A;  3F23 A;  2KIM A;  4EJT A;  4KIS A;  4BQA A;  3CP2 A;  3V8L A;  5E8G A;  3DBL B;  2K9Q A;  3L00 A;  3W6J B;  1ZKG A;  4CXF A;  2N8G A;  3G73 A;  1ZR4 A;  2L3D A;  3KP7 A;  2WY7 Q;  2D45 A;  3TO6 A;  1DP7 P;  4XK4 A;  4FX0 A;  5HOD A;  3S3N A;  3DKX A;  3TMO A;  2XF7 A;  4Y15 A;  1FPQ A;  4KIT B;  3CME I;  4H0E A;  5E17 F;  1XGM A;  3MVP A;  4NHJ A;  3VYR B;  4ZDO A;  4I0A A;  3Q3S A;  3H5A A;  4UUS B;  3S17 J;  3FM3 A;  3C2H A;  2G9W A;  1TNT A;  4TV7 A;  4XN0 A;  2VBW A;  3QU6 A;  1RUO A;  2HGC A;  1T98 A;  2VI6 A;  3KEY A;  3MZH A;  4DZJ A;  1HCR A;  1VQL I;  1IN5 A;  4LIV A;  4PK4 A;  4IQ4 A;  1VQM I;  3FKI J;  3FIW A;  1X2N A;  4EJO A;  2KLO A;  3GFM A;  1CF7 A;  3WHB A;  2HTJ A;  1R5I D;  1DQU A;  3LA7 A;  2FNP A;  2BHZ A;  3V7C A;  1W7P A;  2DA2 A;  3M8F A;  2K85 A;  4DQ2 A;  4I01 A;  1RET A;  1TQM A;  5CJ9 A;  1NH3 A;  5M3M J;  5EF6 A;  4IX7 A;  1MH4 A;  5CPR B;  1OYY A;  3PM1 A;  4CO8 A;  1BN5 A;  2HZD A;  2BY1 A;  2JPB A;  2Q2E A;  2OAZ A;  1LVK A;  1I5Z A;  1N77 A;  3S8P A;  2V1D A;  3F8C A;  3JRD A;  2GXA A;  4OOI A;  9ANT A;  1LFP A;  2K9M A;  5IP7 J;  3WTV C;  2M7B A;  3GW2 A;  4FET A;  4A0Y A;  3HRT A;  2IS4 A;  4PSW A;  3MZY A;  3V42 A;  3NQO A;  1JUS A;  1W0T A;  4M71 A;  2OBP A;  5D5W B;  1XD7 A;  4H4K C;  1ZGW A;  2KJB A;  1IO2 A;  2OQG A;  1L3L A;  5ED4 A;  4B1R A;  3KYD B;  3B02 A;  1OCT C;  2MLK A;  2IAI A;  2KFD A;  3KLN A;  2GQQ A;  1GVJ A;  4EJW A;  3HOU J;  3CJR B;  5E1W A;  2LK2 A;  5K7Z A;  3RQ4 A;  1I39 A;  2QGU A;  1Z3Y A;  2M8G X;  4FTH A;  1WH7 A;  2F4I A;  3ZQF A;  4AYB A;  1UAA A;  1X3W B;  4ZZD A;  2MBF A;  2F4O B;  3QYE A;  4I09 A;  4HW0 A;  3GTP J;  1YLF A;  1Z9C A;  2M0C A;  4E7J A;  4HNU A;  3I53 A;  3HOV J;  2L9R A;  1WJD A;  4CCM A;  1KON A;  1TTY A;  3QYF A;  3W6V A;  3NWS A;  4XON A;  2OCE A;  1OCR H;  3E5X A;  2RQP A;  2CV0 A;  4Z2Y A;  3ECH A;  2VJJ A;  4CYC A;  2J5P A;  2X48 A;  2HQN A;  2NVX J;  1D3Y A;  2QQ8 A;  1HKQ A;  2VIX A;  5LHI A;  2HQA A;  3CUQ B;  2EV6 A;  2XIG A;  2PI0 A;  1G3W A;  1TT0 A;  2AXT C;  3QQA A;  3C7J A;  5D6F A;  4F91 B;  1V5E A;  3CF5 F;  3HDD A;  2Y48 A;  3ZOB A;  4A3G J;  3CO7 C;  4X6A J;  2X51 A;  3HG9 A;  3U1K A;  1X1C A;  5FKL A;  1MGT A;  1R4N B;  2UZK A;  1XCV A;  3SZT A;  4Q4Z F;  2O0Y A;  3VDX A;  5F0H A;  3ASO H;  2PMZ A;  5KVR A;  3COA C;  3G6E I;  3CCS I;  4JX4 A;  3RKY A;  4MFD A;  1V5G A;  1QZY A;  2ICW G;  4D7M A;  3RKX A;  3L1P A;  1XB4 A;  5IYB J;  2IS2 A;  4R8H A;  4AU7 A;  1PJR A;  4LGW A;  2DA7 A;  4AUX A;  5IT3 A;  3IKV A;  4PUS A;  4ZH4 F;  2EIK H;  4M6V A;  4BH9 A;  2W48 A;  2A5Y B;  4F55 A;  1OMI A;  3OYK A;  3BG6 A;  2K4J A;  3ZQH A;  2KJC A;  1P4X A;  5FLX Z;  5EG0 B;  2ETH A;  2HVQ A;  2XAJ A;  5GTH C;  2NAZ A;  3QPH A;  4ZDL A;  2I5U A;  3HRM A;  2O3F A;  3BT9 A;  5HLT A;  3WTW C;  3L2R A;  1ZG1 A;  2VOO A;  2JWT A;  3S2W A;  3KEO A;  3ML6 A;  4RAF A;  4F93 B;  4C2U A;  2CUZ A;  4RMN A;  1AOY A;  1SAU A;  4XOP A;  2VBX A;  2Z5U A;  2P0W A;  3HIF A;  1TL8 A;  1MMD A;  1OLT A;  1XGN A;  3BY6 A;  2R0Q C;  2EJR A;  2QEN A;  3L2V A;  4UUV A;  3I55 I;  3ZMT A;  3PQK A;  1IXR C;  2OU2 A;  3MQ0 A;  3EUH A;  2ECC A;  3ZRG A;  1YTY A;  5EGO A;  2W85 A;  5IY5 H;  3GLX A;  2LY2 A;  1UHS A;  2QF7 A;  2VQH A;  3FBN B;  2STW A;  2CUJ A;  4S0H B;  2PMH A;  3I0T A;  3HUG A;  1HLV A;  1XN7 A;  3MMY B;  2RVC A;  2XRL A;  1YJN I;  2HVR A;  5B66 C;  4ENM A;  3ZMU A;  3WGH A;  1IXS B;  3R0A A;  5HNF A;  2GM4 A;  1J7K A;  1QNT A;  4PJL A;  5FLV A;  3BCB A;  2YU3 A;  2P7C B; 
#chains in the Genus database with same CATH homology
 5C44 J;  2JN6 A;  2Y31 A;  4D5C A;  2Y9Y A;  1VF9 A;  2FD5 A;  1Z77 A;  2XGC A;  1U9O A;  2R93 J;  2WB1 N;  3RZO J;  1ETV A;  4FE7 A;  1RPW A;  3A01 B;  2HOT A;  5M5Y J;  3LSJ A;  5FKN A;  2HOA A;  1P7I A;  3HOY J;  2CRG A;  3HGG A;  3FIS A;  3JR9 A;  3MKL A;  2EH3 A;  1XG1 A;  2LFB A;  4IHW A;  1RES A;  1ZTR A;  3B6C A;  4A93 J;  4C3J J;  5IOY A;  3A01 A;  2LLK A;  3BQZ A;  2HXO A;  1XS9 A;  1G2H A;  2OF7 A;  2VUM J;  1I6H J;  4V2F A;  1QPI A;  2YUS A;  4I6Z A;  3BR3 A;  3DEW A;  3UKG A;  4IEJ A;  1TC3 C;  1FTZ A;  2ME0 A;  2VKE A;  3BR6 A;  2JA7 J;  3BG5 A;  4DYR A;  2AHQ A;  3BQY A;  1U78 A;  2ID6 A;  3HGY A;  1RKT A;  1JTY A;  5EYR A;  2LP0 A;  2AO9 A;  3Q0W A;  1JKO C;  2IBD A;  2E2H J;  5IYD J;  4A3L J;  5BNG A;  2XGE A;  3GTQ J;  3JRC A;  1JTX A;  4C3H J;  2LR8 A;  1MBE A;  1WI3 A;  5E3L A;  1Y1W J;  1LE8 B;  2O9L A;  1A5J A;  2HI3 A;  3TED A;  1BL0 A;  2GBY A;  4M3E A;  3SDG A;  1GDT A;  1FEX A;  5FKM A;  2NVQ J;  2DA4 A;  3CMY A;  4A3F J;  4G12 A;  2L7M P;  5EZG A;  3JRI A;  1IJW C;  3BTI A;  2NVY J;  2ID3 A;  1IDZ A;  1PUF B;  3S16 J;  3B6A A;  3RQI A;  1LE8 A;  1NK2 P;  3GBG A;  1VI0 A;  2P81 A;  3M3Y J;  3G1L A;  4BBR J;  1F36 A;  4V2G A;  1UMQ A;  3BTL A;  4IHX A;  5EEA A;  3HEF A;  1ZR2 A;  3H3V K;  2MGQ A;  2MSY A;  1JT0 A;  1MBJ A;  2JMW A;  2DN0 A;  1JJ8 C;  3GTG J;  1JUP A;  5EZH A;  4DYQ A;  2ME6 A;  4DZP A;  1P7J A;  5GPA A;  1POG A;  3BR0 A;  5J1R A;  1K61 A;  4W1U A;  3IH2 A;  4XRS A;  2ELK A;  3SFI A;  3A02 A;  3K2A A;  3WHC A;  1FIA A;  1BW5 A;  4XRM A;  2CUF A;  1CQT A;  4RBO A;  2R5Z B;  1BJZ A;  1TWG J;  4MIM A;  3A03 A;  5IP6 A;  2VKV A;  2ECB A;  5K7H A;  3Q0V A;  2E1O A;  1ETK A;  2GLO A;  1DU0 A;  3TP3 A;  5J1U A;  2D5V A;  1K83 J;  1ORK A;  2L0K A;  2DA6 A;  4UUT A;  2FQ4 A;  3JRA A;  2KT0 A;  2YU9 J;  5J3L A;  4QTR A;  2K9N A;  2R5Z A;  1B72 B;  5F04 A;  4L5E A;  5EDN A;  1IDY A;  1B8I B;  1Y1V J;  1JKQ C;  2LTP A;  1MBG A;  4JYK A;  3PO2 J;  5F27 A;  1GT0 C;  1VND A;  3S14 J;  4IHY A;  2EZH A;  1B72 A;  1MH3 A;  1B8I A;  4JP0 A;  3H0G J;  3S1N J;  2CJJ A;  2FX0 A;  1HOM A;  3K7A J;  1R9T J;  1YRN B;  5GPC A;  2CU7 A;  3SJM A;  3GTK J;  4I76 A;  1JJ6 C;  3LSP A;  5IOZ A;  2JA5 J;  1ZK8 A;  1NK3 P;  3ZQC A;  3LOC A;  1SAN A;  5M5W J;  3VPR A;  1YRN A;  1HF0 A;  3BTC A;  2NS7 A;  1OFC X;  2Y2Z A;  3JRG A;  1JKP C;  1RR7 A;  1BA5 A;  2DMP A;  1BW6 A;  1MBF A;  2LD5 A;  1IC8 A;  4AYB N;  4BXX J;  1DU6 A;  3IV5 A;  5JLX A;  1O4X A;  1AHD P;  3GTJ J;  2JA8 J;  3JRH A;  3BTJ A;  4J19 A;  1TWA J;  1WH5 A;  5K7F A;  2WAQ N;  1JKR C;  1IRZ A;  1OJL A;  4AC0 A;  2M34 A;  2JK3 A;  3HB9 A;  5FLM J;  1T56 A;  2XSD C;  2H1K A;  2G0E A;  2K9S A;  4XRS G;  5DS9 A;  3S2H J;  2HYJ A;  2MG4 A;  1TWF J;  2HOS A;  2Y0S N;  3OSF A;  2K9Q A;  2H8R A;  1ZKG A;  3HOX J;  3JRE A;  2N8G A;  1ZR4 A;  1F43 A;  4XK4 A;  5HOD A;  4W97 A;  4BY7 J;  1ETW A;  3E7L A;  3MVP A;  4A3B J;  5E3O A;  2I10 A;  1PUF A;  1QVT A;  3Q3S A;  4Y7N J;  4UUS B;  3S17 J;  1H8A C;  3O8G A;  5E3M A;  1AU7 A;  2DA3 A;  1ZQ3 P;  2COB A;  4JX6 A;  1I50 J;  2O7O A;  4A3I J;  3D1N I;  2EZK A;  3F0C A;  1FTT A;  2L7Z A;  2VI6 A;  4M3B A;  3I4N J;  4DZJ A;  5FJ8 J;  1HCR A;  4M3D A;  2E2J J;  1RKW A;  3FKI J;  2QCO A;  3FIW A;  2R5Y B;  1X2N A;  3BR5 A;  2E2I J;  1GV5 A;  1IGN A;  2FJ1 A;  3WHB A;  2K40 A;  1AKH B;  2XB5 A;  1HDD C;  4IHV A;  1Z0X A;  4LOC A;  4Y52 J;  2Y9Z A;  4GFB A;  3CDL A;  2DA2 A;  1U9N A;  5M3F J;  5FKK A;  1RET A;  3S1R J;  5M3M J;  5EF6 A;  2R5Y A;  1MH4 A;  1GUU A;  3BR1 A;  2DA5 A;  3PO3 J;  2M2E A;  2R7Z J;  1AKH A;  3GTO J;  1QRY A;  1OCP A;  2EZI A;  3PM1 A;  1H89 C;  1MBH A;  1ETQ A;  2YS9 A;  2LY9 A;  4A3E J;  2TRT A;  3JRF A;  2CQQ A;  3JRD A;  3M4O J;  1TWC J;  3LSR A;  9ANT A;  5IP7 J;  4B4C A;  2OPT A;  2X9D A;  5JLW A;  2B63 J;  1T33 A;  2HXI A;  1TWH J;  5F0C A;  3CQZ J;  4FIS A;  1JUS A;  2XPU A;  3G1M A;  1W0T A;  4M3G A;  4M3F A;  2LVS A;  1MSF C;  1ZGW A;  2KDZ A;  1JUM A;  4B1R A;  4A69 C;  1OCT C;  2E19 A;  2JA6 J;  1LFU P;  4JX5 A;  2IAI A;  1X58 A;  1JT6 A;  3HOU J;  2TCT A;  4A3D J;  2LK2 A;  3RKQ A;  5K7Z A;  2MW8 A;  1ETX A;  3TW7 A;  1QVU A;  2DTZ A;  3G1O A;  3ZQI A;  2M8G X;  4FTH A;  1WH7 A;  3ZQF A;  2ZB9 A;  5E3N A;  4XID A;  4MLO A;  4QSH A;  1ETO A;  3GTP J;  1GVD A;  5IYC J;  1IV6 A;  2M0C A;  4CYC B;  4FE4 A;  2JJ7 A;  1MSE C;  3HOV J;  2L9R A;  4ABZ A;  2DMU A;  3S2D J;  1MBK A;  3W6V A;  1W0U A;  2WV1 A;  3IH3 A;  1LFB A;  4DW6 A;  2IEK A;  2RAE A;  4CYC A;  2X48 A;  3HBL A;  4X1E A;  2NVX J;  1NTC A;  4B3A A;  1S7E A;  5DTD A;  4C2M J;  5J1Y A;  3HOZ J;  5C4X J;  4A3J J;  5FKO A;  1IG7 A;  1WGX A;  1X2M A;  1VFC A;  4HNV A;  3QQA A;  3BG3 A;  3HDD A;  4BY1 J;  3ZOB A;  4A3G J;  4X6A J;  5GP9 A;  3QPL A;  1FIP A;  5F08 A;  3BG9 A;  5FKL A;  2CUE A;  2XGD A;  3HM5 A;  3IH4 A;  2EQR A;  4XIC A;  1UG2 A;  5IPA A;  3OIO A;  4A3K J;  1E3O C;  4MFE A;  5F0H A;  4EEF G;  2HQ5 A;  2VPR A;  1WPK A;  4JX4 A;  1D5Y A;  4MFD A;  4D7M A;  2DMT A;  4MO7 A;  4QIW N;  2NVT J;  3S15 J;  4NDL A;  3L1P A;  1HDP A;  5IYB J;  3ZQG A;  3NAU A;  2HDD A;  2DA7 A;  4AUX A;  5F1J A;  3I4M J;  3LSG A;  2R92 J;  1WCM J;  3TP0 A;  4M6V A;  2W48 A;  2L7F P;  1IUF A;  3RZD J;  1I3Q J;  2PMZ N;  3ZQH A;  5EG0 B;  2DMN A;  2DMQ A;  3S1M J;  2NS8 A;  3HOW J;  4D7N A;  3GTL J;  4UUS A;  3LNQ A;  2CQX A;  4RDU A;  3Q0U A;  1A6I A;  4DYC A;  3BT9 A;  3C2B A;  2JWT A;  3BR2 A;  1XC5 A;  1APL C;  2M9H A;  3GTM J;  1ENH A;  2XB0 X;  5EGO B;  1FJL A;  5EG0 A;  3TW6 A;  2DA1 A;  1EF4 A;  2NOG A;  3ZQL A;  2R0Q C;  3FK6 A;  1Q1V A;  1ITY A;  5M5X J;  4FCY A;  3FK7 A;  2EZL A;  3NAR A;  5C3E J;  1H88 C;  4BBS J;  4A3C J;  2EBI A;  2ECC A;  5EGO A;  1U8B A;  5C4J J;  3O8H A;  1GV2 A;  3CCY A;  3HKZ N;  2LKX A;  3OOU A;  3S1Q J;  5IP9 J;  1UHS A;  2QF7 A;  3JRB A;  4S0H B;  2XPV A;  2DJN A;  2Y30 A;  2O8K A;  1MNM C;  3MN2 A;  1HLV A;  1SFO J;  4A3M J;  3DCF A;  2XRL A;  4D5F A;  3OSG A;  4BKX A;  2X6O A;  4C3I J;  1JGG A;  2GM4 A;  3QPS A;  5FLV A;  2XPW A;  5F0F A;  1ETY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...