3TGNA

Crystal structure of the zinc-dependent marr family transcriptional regulator adcr in the zn(ii)-bound state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
135
Chain Sequence
MRQLAKDINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSEESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETFYQLTDLARPIAEEHHHHHEHTLLTYEQVATQFTPNEQKVIQRFLTALVGEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Adc operon repressor AdcR
publication title Crystal Structure of the Zinc-Dependent MarR Family Transcriptional Regulator AdcR in the Zn(II)-Bound State.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 49
structure length 135
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tgnA02
4H0EA 5E1ZB 1R58A 5BOXA 3GO5A 3MAJA 3CO6C 2FQ3A 1DP7P 4IRHA 1IN4A 3TO6A 5D8KB 2FU4A 5CVJA 2FMYA 3V7RA 5FLXZ 3ZMTA 1KGSA 3DV8A 3LA2A 1F9NA 3M9AA 2HWVA 3KP7A 2PI0A 2EFNA 2A68F 3C7JA 3R0AA 5E1XA 1BI0A 2A6HF 5LRSA 2ZNZA 2GQQA 1Z7UA 5F1RA 3QPHA 4B8XA 4UVAA 1TQPA 2XAHA 2VT3A 1IN7A 5LHGA 2QBYA 2G9WA 2O6GE 1USTA 2LNBA 3WTVC 2OU2A 3KP6A 2IRFG 1P2FA 4LD5A 4EM1A 1QQIA 3WTSC 4CO8A 3RYPA 4D0PA 2ZKZA 4ENMA 3W6JB 1R22A 1F4KA 4ESBA 4I0AA 2DAOA 2FF4A 2O0YA 1GVJA 4IVNA 4KMFA 3ERED 1Z91A 2RGVA 3KP2A 3FZVA 2WTEA 4JBAA 3E5QA 3WG9A 3T5XA 3F6OA 3WODF 5H6QA 4ZH4F 3T1BA 4KMUX 4MTDA 1O7LA 2FA5A 3RKYA 1R5HA 1YQAA 4U7DA 2XUBA 1R00A 1HKSA 2E7WA 2HZTA 3ABTA 5E8IA 1U5TA 2FNAA 5HS7A 1RI7A 4WXCA 3PQJA 3EYIA 1BJAA 4HF2A 3J80K 3TO7A 2A69F 1AWCA 1EH7A 5HLGA 5ILUA 2MLKA 1W7PB 1DPRA 1YTYA 3HIFA 4M9XA 1L3LA 3KZYA 2DTRA 1B4AA 2A6EF 3HSEA 3JTHA 3KP3A 3JTGA 5L3BA 5L3CA 1FYKA 1B6AA 4HBLA 1QO0D 1SD4A 2VOPA 4M6XA 3D0SA 4YFNF 2DI3A 1LEBA 3WE2A 4LB6B 4OIQF 1EH6A 4I02A 1KA8A 3AAFA 2VONA 3FMRA 3JSOA 1E17A 4E70A 4XSXF 3J7AO 3HOTA 3CDHA 1R1VA 3WTYC 1OPCA 3P7NA 2HQRA 4A5NA 3O3KA 1RIOH 3RYRA 4PDKA 3HRSA 1ZGJA 1HW1A 2LSOA 2BV6A 3QAHA 1I6XA 2VBXA 3R60A 3GFMA 1S29A 2LF7A 2YPRA 2V1DA 3BOQA 3R61A 5FB2A 2ESNA 3K1MA 4UV8A 3JAMK 2ZO4A 1TW2A 2P5LC 3WGHA 1FX7A 4HA8A 3RIRA 1Z9CA 3R4KA 3IWFA 1D5VA 1LVAA 1MGTA 3TGNA 2KIFA 1FY7A 1G4DA 4L18B 4P55A 4OIPF 2EV6A 2FBHA 4OMYA 2UWMA 4I2OA 1T2KA 3M1EA 5HLHA 2M87A 2GA1A 2Y48A 4EJWA 1RUNA 3KP4A 3IWZA 3TQNA 5LRRA 4HAMA 1TNSA 3CO7C 3HRUA 1IW7F 2X0LA 1IN6A 4LFUA 3DP7A 1GXQA 2ZBKA 5ICCA 4DNCA 1TTYA 1XDUA 2CQKA 2FBIA 1KQ8A 1BM9A 3HHGA 4HF1A 1EV7A 2RKHA 2A07F 2DQLA 1RNLA 5LGNA 1DDNA 4CXFA 2LF8A 3I0TA 2HKOA 3ZPLA 1R7JA 4G9YA 2P6TA 3GFIA 3KEQA 1YW9A 3P9KA 1T39A 5HS8A 3DQVC 1T0FA 3KEOA 4WK8F 2D1VA 4HDVA 3H3UA 2C6YA 1W7PD 5E17F 2RVCA 3WTXC 3QP5A 5L3FA 3HOSA 2FEZA 2EFWA 3FMSA 2HTJA 1KYZA 3ZMDA 4G6QA 4M6YA 4ZZLA 1FWZA 5JFRA 2DK5A 2FBKA 3RKXA 1U2WA 3WGIA 2RV8A 3K69A 2MLGA 2IJLA 1Z6RA 5ED4A 2OQRA 3B02A 5DDGA 3CUQC 2QBYB 1KU3A 2YX4A 1YS7A 3MEXA 2HFHA 3WTUC 2PEXA 1IUYA 1LQ1A 4BH9A 3L00A 1TNTA 5F6FA 5D5VB 2VBWA 3LWFA 1JHFA 1ZG3A 1BC8C 2EK5A 3NQOA 2A61A 4MTEA 3C1DA 1FBSA 4OU0A 4OINF 5FGMA 2JPCA 2D2WA 5DCMA 2ZNYA 1SAXA 2NRAC 5FD6A 3OV8A 4NHJA 3ECHA 3GFLA 2BYVE 3RKWA 3TO9A 1K78A 2GXBA 3M7GA 2ISZA 2OD5A 2MC3A 1BIBA 3E6MA 5A2QK 1QZYA 3DF8A 3FXUA 3S2WA 3GZ6A 5ICGA 2Q0OA 2H94A 1F1ZA 4HV6A 5AIPA 2DO7A 3GLXA 4U0WA 1MDMA 1SFEA 1XMKA 2RNJA 3VODA 3K1PA 2XVCA 1C0WA 2TDXA 2O03A 2HOEA 4A0ZA 4S05A 2YR2A 4WWCA 2V79A 5BS6A 2UZKA 3KE2A 3R0JA 4N0BA 3DKWA 4KDPA 1T38A 3IRQA 3SZTA 3MZHA 1G3TA 4HZFA 3JAMZ 1NHAA 2NNNA 5ILVA 2VXZA 1IF1A 2OZUA 2QZ8A 1KYWA 4BXUA 2QENA 2D45A 1WSUA 4MGRA 3LAJA 3F23A 4YG2F 1IAWA 1YW7A 4RB1A 2CW0F 2W57A 2EA4A 2IA2A 2GIVA 4HX4A 2DBBA 5FO5A 3IC7A 3GFJA 4M9SA 1OR7A 2QWWA 2DW4A 5L3DA 4RB2C 5D4SA 4HDUA 2NYXA 2STWA 5ICEA 4U88A 1OKRA 2IA0A 1UB9A 2NNYA 5FFZA 3E5XA 2P5VA 4HV5A 4I0BA 1WRJA 2G7HA 5D5WB 1ZGAA 4EJVA 3EETA 4P9FA 1PUEE 4WF2A 5FD5A 1YO5C 3GF2A 2LKPA 4BAYA 1I27A 3WE3A 5CJ9A 2OA4A 3BY6A 2Z5UA 5HDGA 2Z99A 2Q8KA 4PCQA 1WWXA 2DPUA 3SFZA 4LG0A 3GEZA 4BHCA 4U0VA 3BJ6A 2PJPA 1B1BA 1BI2A 1TBXA 2KIUA 4KN4X 2CO5A 4KIGA 5HDKA 3CUQA 1YIOA 4Q47A 2PG4A 4BNCA 4KYWA 4PZJA 1HKQA 4UNOA 1YLFA 1IXCA 3HTSB 2GXGA 5D8LB 1S8NA 3QP6A 3P9CA 1A04A 3U2RA 4I09A 2UXXA 1TLHB 1IN8A 4TV7A 2L4AA 5HVQC 2FE3A 2EA2A 4LLLA 4RGRA 1D8KA 1ZRCA 3WTWC 4AVPA 5J8CA 3TOAA 1ZLKA 4LMYA 4ON0A 2DFIA 3HRMA 2IPQX 4L5IA 2V1XA 4O5VA 4WX9A 3SQNA 3H3ZA 3IKVA 4O3MA 3WU0A 1ZREA 4HOBA 5D6EA 1GXPA 3TDZC 2IP2A 2QUFA 3GUDA 2PBIA 2K02A 1YYVA 2IVMA 2M5WA 1STZA 1FOKA 3K2ZA 3HTUA 2L54A 4GXOA 2VBYA 1P92A 4Y17A 4L9JA 1XCBA 1IXRC 2HKXA 2JTVA 4EM0B 2NS0A 1XGNA 2P6SA 4A5MA 3FMQA 4KIFA 5DV5A 3WU1B 1FPQA 2GAUA 4UXNA 3COAC 4AIJA 3F22A 3T8TA 2Q2EA 2EV0A 2A5YB 2K4JA 5DYMA 4A0YA 3RI4A 2XKOA 4MQ9F 5A2QZ 3VOEA 2KJBA 5DUKA 4RB3C 4L5JA 1HKTA 4HQEA 1HQCA 4L9TA 3C3WA 4G7OF 3LQQA 1KQ9A 3ZN0A 3FF5A 5K5QA 3GXOA 3E5UA 2B0LA 1BOAA 5KK1A 2Y0MA 1CGPA 1MJBA 2O3FA 4M73A 3VFZA 3MZYA 2FSWA 5DCMB 2XAQA 4GO1A 4XLPF 1KU7A 4BYYA 3N97A 4GGGA 3CTAA 5H6RA 1K78B 4A12A 4S04A 5BPIA 2M45A 3QRFF 3GYHX 2JPBA 3K0LA 1J2XA 3ZMUA 5DCFA 1B59A 1LNWA 4CDGA 1XGMA 2QQ9A 1TQIA 5EEGA 2XHKA 4P5OA 1R1TA 1Z6TA 5K5RA 4EJOA 2ACJA 1BIAA 4EJUA 2RC4A 4RGUA 4UUVA 3GW2A 4YFXF 1OYIA 2CFXA 4HLYA 2OBPA 1W5TA 1IZ1A 3HRTA 2ESHA 5K5OA 3ML6A 1T98A 3RTRA 4KNYA 1U3EM 2COMA 3N4MA 1R1UA 4M9ZA 4ENJA 3SXYA 3GZ5A 1LJ9A 2XAFA 3E3VA 2K86A 4WXDA 1UHMA 2J5PA 3OOPA 1ULYA 2J5OA 3KZZA 1XSXA 1O7FA 1D3YA 1BC7C 4GYGA 4UVCA 3RPUA 1OYWA 3GX4X 4KIBA 2FOKA 3FHZA 1USSA 2GZWA 1Z1DA 2YX7A 2EFPA 1PDNC 3I58A 2XIGA 2AS5F 2V6CA 4QWQA 4DQ2A 2YU3A 5CVVA 2G7UA 3LQRA 5BPDA 1MJAA 4XBFA 4HX8A 1G3YA 2EWNA 4O6JA 2V1UA 1FSHA 1IXSB 1XSDA 2MBFA 3TDUC 2ZMEA 1UCRA 3ZMZA 1O3QA 4FX4A 1R36A 3O6BB 1SD6A 1ZLJA 4I7HA 2PN6A 2OQGA 4EGYA 2O61A 5CYVA 2CG4A 1I1SA 1V3FA 2VN2A 2HS5A 5TRDA 3FM3A 2DLLA 3FWEA 1BBYA 5TJJA 1LDDA 3ULQB 4LG0B 1YG2A 2H6BA 3D5LA 5KVRA 3F72A 4CHUA 5JHUA 1RUOA 1HBXG 4LLNA 2BBYA 4Q48A 1J9IA 2HEOA 3L2CA 3ROUA 1LDJA 1PP7U 4RS8A 2R7DA 1FP2A 2F5CA 1SMYF 2H6CA 4ZYGA 2VBZA 4L9VA 1T6SA 3J80Z 4MNUA 1J7KA 4KA4A 5DD4A 3ZQ7A 4G6DA 4WCGA 3M8FA 4WXHA 1H0MA 4Q4ZF 1KU2A 1S7OA 1FBQA 3VEPA 4IHTA 3J81K 3T8RA 1IN5A 1B9MA 2EFQA 2GWRA 3O2PE 4ENNA 4HW0A 2RQPA 1XSVA 4YIIA 5BMZA 2IA1A 3FXQA 5J8FA 2K7LA 4EQQA 4UV9A 1JGSA 3NRVA 3E6BA 1BI1A 4A6DA 4LJZF 5D5UB 5JR3A 4A0XA 1MZBA 2EJRA 2F5EA 2RN7A 1U5TB 4CYDA 1SFUA 3IKTA 3JSPA 2VE8A 3DFGA 2EV5A 5HDNA 2UXNA 4B09A 4AWXB 3E6DA 2XAGA 3QOPA 2W85A 1K79A 1ZRDA 2A3SA 4IF4A 1P6RA 5E18F 3F8CA 3T0YA 3REOA 2STTA 1P4XA 5HS9A 2P8TA 2JT1A 2PQ8A 4NB5A 1ZHFA 4EV0A 1VTNC 3ZMVA 4EM2A 3ELKA 3GVAA 2PLYA 3I59A 4KFCA 2Y75A 3ISPA 2DK8A 1YS6A 3WTTC 1S6LA 5LHHA 4LK0F 2L02A 3ABUA 1LDKB 4A6EA 1TQMA 2Z9OA 5LLQA 5JI6A 1O3TA 1EH8A 2L01A 5J6XA 1P4AA 1B9NA 3RPQA 3EQLF 2H27A 2VC1A 3JW4A 5D4RA 4MEYF 3WTZA 3F6VA 1JE8A 2XAJA 3FM5A 3KP5A 4R79A 1Q1HA 4G7ZF 2F2EA 4ZYHA 4XLNF 1LB2A 5L3EA 4GYIA 2F5FA 5LEJA 3G73A 1X3UA 1UHWA 1HSJA 3I4PA 2CWEA 3L7WA 4U0YA 5K1YA 1QGPA 2ADUA 1FNNA 3ZMSA 1ODDA 2DT5A 1O3RA 3RDIA 1RZ4A 3KETA 4Z2YA 4OOIA 2VODA 5EEHA 4I98B 4ESJA 1PP8F 1IRGA 5F64A 5H20A 5AIQA 4PGGA 2P5KA 1FYLA 1J0RA 2W25A 4K2EA 3V7SA 4G7HF 3LFKA 5ERIA 1R5GA 1WKMA 2R7FA 2K4BA 1W4MA 4Y13A 3I71A 1XB4A 2HTSA 1SFXA 2VT2A 2P4WA 1HW2A 5IT9K 5CLSA 2ZFWA 2MD5A 3F21A 5D6FA 3V4GA 1XCVA 1JXSA 3DXJF 1E2XA 4P96A 2R3SA 5CVIA 3TKYA 1ZARA 3LSTA 3SZPA 2KIMA 4ZZDA 4BHPA 2HYGD 3HSRA 2Z33A 4XRFA 2MA3A 1U8RA 3U1DA 1XD7A 2ZMEB 5DD8A 5DEQA 1CF7A 1W5SA 3EYYA 4M74A 5L3GA 5IT3A 4GCVA 2ZJ2A 3B73A 2O8XA 3J81Z 2HQNA 5FFXA 2K27A 4BHBA 4U7BA 5BQTA 3M8EA 1FLIA 3K1NA 1H9TA 2BE5F 1UFMA 4YFKF 3KLOA 5HLIA 4HLXA 3CJNA 2Z3YA 4ASNA 1S3JA 4CZZA 2XROA 3BJOA 4MHGA 4RGSA 5E8GA 3KCCA 1F5TA 4P9UA 3L9FA 4MQVA 4OIOF 1D8JA 2GA2A 2MH9A 3I54A 1QPMA 5LGUA 1J59A 3QPTA 4IJAA 1OMIA 3MWMA 2DU9A 4LB5A 3V8KA 4Q5SF 4M72A 4R1HA 4JQFA 4ZYEA 4AD9A 2QLZA 1QBJA 4AIKA 4IXAA 3BZ6A 3Q9SA 2QQAA 3BPVA 4F7ZA 1FP1D 3RJPA 4OIRF 1SD5A 3ZP5A 5LHIA 1G6NA 1ONVA 3KFWX 1XMAA 3IHUA 1Z05A 1BI3A 1GHCA 2OZ6A 3F8FA 2FXAA 4KUMA 4HQMA 4IHSA 4ETSA 2AXLA 4PGHA 3MFKA 4JK1X 5DUIA 2V9VA 3QU6A 2H09A 2W84A 4CICA 1FT9A 1G3SA 1MDMB 2XASA 4RGXA 4EVIA 3Q5FA 4RAYA 4RB0A 1FYMA 1U6GA 3R6SA 1S7AA 3WGGA 6PAXA 5CVRA 2CGPA 4FX0A 3VB2A 2DQRA 3V7CA 5AONA 3FXRA 1YFHA 4ZYDA 3W6KB 1ON1A 4XSZF 2E1CA 5E20A 4HYEA 3I5UA 3TOBA 3F8NA 1HW5A 1DPUA 4EMSA 1OYYA 3I59B 2PFBA 3C18A 3IRRA 3Q9VA 2P7CB 3LAPA 5JVTA 1KU9A 3HHHA 1KQ0A 1HSTA 2HYFA 5LGTA 2KKOA 5ILSA 1O57A 1SMTA 3DPLC 3SHFA 2OAZA 4BQAA 3BJAA 2NAZA 3FX3A 3P9IA 3IL2A 5FLXK 2X4HA 3DPTA 2JZYA 1FBUA 3G3ZA 1Y0UA 4OMZA 1REPC 2M8EA 2ELHA 3E6CC 2VC0A 2IT0A 3F3XA 4FT8A 1K7AA 3QU3A 5IT9Z 2VE9A 4Y15A 1FZPB 1XGSA 2JRTA 3PQKA 1WI9A 3BWGA 1ON2A 4KICA 3E97A 4HF0A 4L0ZB 2QM3A 3V8JA 2FNPA 1MD0A 2HDCA 2VOOA 3CLOA 2P7VB 4KT5C 3H92A 1IRFA 2WWYA 2EFOA 3BPXA 3GWZA 3L09A 4EGZA 1WQ2A 1XN7A 3HSFA 4UHTA 4YIFA 2KJCA 3ZN1A 4G94A 1W7PA 2RDPA 4RAZA 4FHTA 1J75A 3CUQB 5E1WA 1H9GA 2D1HA 3NEUA 1G3WA 2KRFA 4N9IA 3V8LA 2XRNA 1ZYRF 2QQBA 1QNTA 3EUHA 1MJ9A 1JHHA 4MEXF 2E1NA 1ZG5A 3HYIA 2ZXJA 1TW3A 3BDDA 2ETHA 1LEAA 4KN7X 4ESFA 3KLNA 4L0YB 2XV4S 2XGXA 4ENKA 4G8XA 2L3DA 4IRGA 2ZCWA 3HUGA 1R23A 1ZN2A 2EB7A 4M71A 2PMHA 3F8BA 2QYOA 5LEKA 2HGCA 1ZH5A 4NQWA 4UVBA 1HXDA 1ZG1A 2CYYA 4I01A 4QLCU 3DEUA 3LA7A 1DUXC 1FSEA 1MKMA 2WC2A 2DPDA 1L0OC 1CF7B 1I5ZA 5CVUA 4LK1F 4L9NA 4R8HA 1AOYA 4A2UA 1BN5A 4HX7A 1P4WA 3K9TA 1O3SA 2CSOA 2XKPA 1U5TC 4IPAA 3ECOA 3CUOA 2M30A 2FMLA 2YSRA 3I64A 1YW8A 2M1BA 2BGCA 3F8MA 3I53A 3EDPA 1J5YA 2W24A 2JSCA 4EJTA 4CGZA 1ZAOA 2IW5A 2MH2A 4LLGF 3MCZA 1XGOA 2WV0A 5LBQA 1XDSA 3BP8A 1K6OA 2FRHA 2E7XA 4AIHA 1U78A 1V4RA 3PFIA 2ISYA 1SD7A 2PMUA 2F5DA 2L4MA 1QZZA 5D5XB 1ZRFA 4N9HA 3BROA 4IRIA 2BEOA 2HR3A 2LDUA 1I1GA 3U9GA 4LGWA 1FC3A 5ICFA 3LA3A 5HOOA 2QVOA 3MQ0A
chains in the Genus database with same CATH superfamily
3OYEA 1VQ4I 4XKVA 5HNFA 3I4MJ 4H0EA 5K7ZA 2B9SA 4S0HB 1A31A 5E1ZB 3IP4B 1R58A 3IAS2 5BOXA 3GO5A 4UUSA 5M3FJ 1NTCA 1W1WE 2VUMJ 3MAJA 3CO6C 2FQ3A 1LE8B 1DP7P 1FIPA 1IN4A 4IRHA 3TO6A 4BQOA 5D8KB 2FU4A 5J4VA 5CVJA 1UMQA 2DOAA 3BG6A 1LFBA 2FMYA 2B7EA 3AFHA 3V7RA 3CCYA 2CS3A 5FLXZ 4XMYA 1Z77A 3ZMTA 1XG1A 1KGSA 3DV8A 3LA2A 2VJJA 1PUFA 1F9NA 2E36A 3K10A 3CCMI 3M9AA 2CUJA 2HWVA 3KP7A 2PI0A 4FTHA 3HOUJ 2EFNA 2GLOA 3GBGA 2K9NA 4BDZA 3PL8A 2A68F 3C7JA 2Y0SA 3R0AA 1K83J 5E1XA 1BI0A 2A6HF 5LRSA 2ZNZA 3F9KA 2GQQA 2ZSHB 1Z7UA 3E0JB 5F1RA 3QPHA 5FKLA 2XGCA 2Y9ZA 3TP3A 4B8XA 4UVAA 2DMPA 1TQPA 2XAHA 4RAGA 3IH4A 5IOYA 5FLVA 1MBHA 4M3FA 1YOVB 2VT3A 1IN7A 5F0HA 5LHGA 2Z16A 2QBYA 2G9WA 2O6GE 3DKXA 1USTA 4BGDA 3IUOA 2LNBA 2VASA 3QYBA 3WTVC 2ME6A 2OU2A 2ME0A 3KP6A 5EGOA 2BY0A 2IRFG 1P2FA 4LD5A 1WJBA 2AQEA 2DMQA 4EM1A 1QQIA 3WTSC 1WJEA 1E3OC 2MFZA 4CO8A 3LMMA 2F4MB 3RYPA 3ZQFA 4D0PA 2ZKZA 3CF5F 4ENMA 1JTYA 3M3YJ 3OSFA 3W2AA 3W6JB 3DBLB 4BQNA 1R22A 1F4KA 2LP0A 2ID6A 4ESBA 5E3LA 2MG4A 2BHZA 4I0AA 2DAOA 2FF4A 2O0YA 1D1AA 1GVJA 4IVNA 3S2HJ 1RPWA 4KMFA 3ERED 5FRNA 2P81A 1Z91A 2RGVA 3KP2A 3PUFA 3FZVA 3ZQIA 2WTEA 4JBAA 3MKWB 3CCJI 2CV2A 1RR8C 3E5QA 1JKPC 1WI3A 1T56A 3WG9A 2EBIA 3T5XA 2H8RA 3F6OA 1IJWC 5EDNA 3ZQCA 3WODF 4RM2A 2H1LA 5H6QA 2HVSA 4ZH4F 4GDFA 3T1BA 4KMUX 4MTDA 2EIMH 1O7LA 1T0FC 2FA5A 3CCSI 3RKYA 1X19A 1TWHJ 1R5HA 1YQAA 4U7DA 1XC5A 2XUBA 1R00A 3EUKL 1HKSA 3HM5A 2E7WA 2HZTA 3ABTA 3FXMA 2JA6J 5E8IA 1U5TA 2FNAA 5HS7A 5JHFA 4PJNA 2KRHA 1RI7A 4WXCA 3VYRB 3PQJA 1V5GA 2CUFA 2QGUA 3EYIA 3PNYA 5B3SH 1BJAA 4V19K 4XLFA 4HF2A 3J80K 3TO7A 2A69F 4HPQA 1AWCA 2HDWA 1EH7A 4ZDLA 5HLGA 2KDZA 5ILUA 2MLKA 1W7PB 3C2GA 1DPRA 1OCRH 1YTYA 3HIFA 1OCCH 2EILH 2QF7A 4M9XA 1L3LA 3KZYA 4X0GA 2DTRA 3BLYA 2LRDA 1M1EB 1B4AA 2A6EF 3HSEA 3JTHA 3LSGA 3KP3A 4ITVA 5IPAA 3JTGA 1YJNI 3BG5A 5L3BA 5L3CA 2X85A 3G1MA 1FYKA 3CCUI 1X3WB 2GOMA 1R9TJ 1B6AA 5EJCA 4HBLA 1O4XA 3EPZA 1QO0D 1SD4A 2TCTA 1JUSA 4M3EA 2VOPA 3W2VA 3OYMA 2KPMA 4M6XA 3D0SA 4YFNF 2DI3A 2R92J 1YX3A 1D5YA 1LEBA 3GZNB 3PO2J 3ASNH 1V5FA 3WE2A 4LB6B 4OIQF 1EH6A 1T8IA 3HC7A 3EUAA 4E7SA 1LFUP 5EG0B 3J7YJ 4I02A 2IS4A 1UG0A 1KA8A 3AAFA 3ZGKA 2VONA 3FMRA 3JSOA 5IYCJ 2HXIA 5GPAA 1MNDA 4IHXA 1E17A 4E70A 4XSXF 3H5AA 2MABA 3HUGB 3HOTA 3J7AO 2P0WA 3CDHA 1ZR2A 1R1VA 3WTYC 1OPCA 3P7NA 5EEAA 2HQRA 4A5NA 3HOXJ 4A3KJ 2QKLB 3O3KA 4NQWB 2QSGX 1RIOH 4HSRA 3RYRA 3OSGA 4PDKA 1GT0C 1VQLI 3HRSA 1ZGJA 1HW1A 2AXTC 2LSOA 5FLMJ 2BV6A 3QAHA 3HZJA 3TP0A 1W0UA 4XKCA 3OR1C 2KLOA 1I6XA 4MIMA 2NOGA 2WY8Q 2VBXA 4G6TB 1UJ8A 3H1CA 4IOCF 3GTJJ 3R60A 2X1DA 3GFMA 4C3JJ 2E2HJ 1MSEC 1S29A 2LF7A 2BVLA 2YPRA 1KONA 4CSWA 3AG3H 2V1DA 4AIDA 4NUBA 3JRHA 3CCLI 3BOQA 4MO7A 3R61A 3DLAA 3DBHB 3PJRA 4PJJA 5FB2A 5F0FA 2ESNA 3QPLA 2M7BA 3K1MA 2CJJA 4UV8A 3VWBA 1MNMC 3JAMK 3BTCA 2ZO4A 4RAFA 3CJRB 3SYTA 3PO3J 4JX5A 2X51A 1TW2A 3TW6A 2P5LC 2JA7J 5J1YA 3WGHA 1YRNB 1FX7A 2XAUA 1RETA 3Q3SA 4F92B 1YIJI 1RRJA 2DXIA 1GUUA 3CJTB 2DFFA 4HA8A 3VSLA 3G4SI 3RIRA 1Z9CA 1WZ2A 3R4KA 3IWFA 1D5VA 1Y56A 1LVAA 2DJNA 3U21A 1Z0XA 4FASD 3FXJA 4IX7A 1MGTA 3I56I 3TGNA 2VKVA 2KIFA 1FY7A 2ZXIA 4FISA 1MH4A 1G4DA 1Z21A 4L18B 4P55A 3OYLA 4OIPF 2K3PA 3UKGA 3DU6A 2EV6A 1X1DA 2FBHA 1LUJB 2L9NA 4OMYA 2UWMA 4XR6A 1GLNA 1T2KA 4I2OA 3M1EA 1T08B 2DMUA 4DBQA 2ZSIB 1X3ZB 5HLHA 4J00A 2M87A 1X2NA 2GA1A 2Y48A 4EJWA 3GMEA 2ZJRF 1VFCA 1RUNA 3KP4A 3IWZA 3TQNA 5LRRA 4HAMA 3OL3A 1TNSA 3ASOH 3CO7C 2E71A 2CQQA 3HRUA 1IW7F 2X0LA 1IN6A 4AYBN 4LFUA 3FHNA 3OS2A 2R7XA 3Q0UA 3DP7A 4ZDOA 1HF0A 1GXQA 1YJ9I 4LIVA 2ZBKA 4RLFA 4E7JA 4J19A 5ICCA 4DNCA 1TTYA 1XDUA 3MKYB 2CQKA 2FBIA 1KQ8A 1BM9A 3HHGA 1Z7LA 4HF1A 1PVEA 2RQQA 1JKOC 3G2BA 1EV7A 2RKHA 2A07F 2DQLA 1RNLA 5LGNA 1DDNA 4CXFA 2LF8A 1BJZA 3I0TA 2M0CA 2HKOA 1OR7C 3HPGA 1R7JA 4G9YA 3K2AA 5KHDA 2X1CA 2NOJB 1A35A 4BEHB 5KNLA 1SANA 1WJFA 3K4LA 2P6TA 2VJ4A 1MBFA 3GFIA 3VYSB 2Y30A 1JI8A 2BXYA 1Y1VJ 2IGMA 3KEQA 4PUSA 1YW9A 2HDDA 2HQ5A 3P9KA 3WG7H 3H9GA 4UUSB 5HS8A 1T39A 3DQVC 1T0FA 2QCOA 3KEOA 3CMYA 3DU5A 4WK8F 3SJMA 2BW3A 2D1VA 4HDVA 3H3UA 2C6YA 2F5VA 1W7PD 4BJ6C 2HI3A 2RVCA 3WTXC 5E17F 4CZCA 1W36C 3QP5A 1FTTA 5L3FA 3TL4X 3ZRGA 1HA8A 1GV2A 1D0YA 3HOSA 5B1AH 4DW6A 2FEZA 2EFWA 1PUFB 3FMSA 2HTJA 2FOWA 1ZKGA 2X1EA 2HVQA 1KYZA 2HOSA 2JJ7A 3ZMDA 2CQNA 4G6QA 3OYNA 4M6YA 4ZZLA 2YU9J 1WGXA 4HG2A 5DM6F 1FWZA 2IS6A 2O7OA 5JFRA 2DK5A 4D9JA 2NVXJ 3VYUB 2FBKA 3RKXA 2E19A 3LL7A 4D5FA 1U2WA 4IQJA 3VSKA 3WGIA 2W1OA 2RV8A 3K69A 2MLGA 1R49A 2IJLA 2CH0A 4A3FJ 1Z6RA 5ED4A 2OQRA 4KITB 3B02A 2PJRA 5DDGA 4ZTJA 3S93A 3CUQC 2QBYB 2DN0A 1KU3A 2YX4A 1YS7A 5EYRA 3MEXA 2HFHA 3A2KA 3BR3A 3WTUC 2PEXA 1IUYA 1LQ1A 2XGDA 4XN0A 4DOZA 3FISA 3P5JA 4XK4A 4BH9A 3L00A 1TNTA 4QPOA 4B1RA 2L7KA 5F6FA 2Z1DA 1KZHA 5D5VB 2VBWA 1N75A 3OYDA 4GFBA 3LWFA 1JHFA 1IV6A 3A4CA 3W2WA 4IKFA 1ZG3A 4QIWN 1BC8C 1TT5B 1TP4A 2EK5A 2A61A 2VQLA 3NQOA 1Q1VA 2LK2A 3RZDJ 3BG3A 4MTEA 5C44J 2LC2A 3C1DA 5JLWA 1FBSA 4OU0A 4E7IA 4OINF 5FGMA 2JPCA 2JK3A 2D2WA 5DCMA 3H9QA 2ZNYA 1SAXA 2NRAC 5FD6A 5JLXA 4PFPA 1U0JA 3DEWA 3OV8A 4NHJA 3ECHA 3GFLA 4IOAF 2BYVE 3RKWA 4FE7A 4XRSG 4N4NB 3TO9A 1K78A 2GXBA 3KX2A 3M7GA 2ISZA 3CDLA 1BL0A 3RSNA 2OD5A 2MC3A 1VQNI 2JN6A 4B44A 4AU7A 1BIBA 3E6MA 5A2QK 1QZYA 5E3MA 3BR0A 3DF8A 5KCMA 3WU2C 2XRLA 5FKOA 3FXUA 5F27A 1E0EA 3S2WA 3GZ6A 3H35A 1X2MA 2Q0OA 5ICGA 2DOFA 4BBRJ 2H94A 1F1ZA 4HV6A 3CC2I 5AIPA 4CYCA 2DO7A 3GLXA 3BG9A 4U0WA 2WV1A 1MDMA 1SFEA 1QU3A 2E1OA 1D1CA 1XMKA 2RNJA 5J3LA 4ZDPA 3VODA 2LBFA 3K4KA 1JTXA 3K1PA 1IRZA 2XVCA 3OIPA 4D7MA 1C0WA 2TDXA 3J7AY 3FXLA 2O03A 1G2HA 1W5CC 4B43A 3RKQA 2HOEA 3M8JA 4A0ZA 3FK6A 4S05A 2YR2A 2K3FA 3H9JA 4WWCA 3PIOF 2V79A 2QEXI 1MMSA 5BS6A 4F93B 3S17J 2UZKA 1FMWA 1R4NB 4LITA 4A3CJ 3KE2A 3R0JA 4N0BA 4D5CA 3HKZA 3DKWA 5TISC 4KDPA 3JRBA 1WJCA 2K85A 1T38A 3IRQA 3SZTA 3MZHA 1G3TA 4HZFA 4AVZA 4M6VA 3JAMZ 1NHAA 2NNNA 1ZELA 5ILVA 1DU6A 2VXZA 4DYQA 1IF1A 2OZUA 2QZ8A 3FIWA 2G0EA 1KYWA 4CCKA 4DGWB 4BXUA 2QENA 2D45A 3H0DA 1WSUA 4MGRA 3LAJA 4JOMA 2BY3A 4YG2F 3F23A 4JX6A 3J7ZI 3TEDA 2LD5A 1IAWA 2MYSA 1YW7A 2ELJA 2CQ7A 3HB9A 4QTRA 4RB1A 2CW0F 2W57A 5F0CA 4OAZA 3GTGJ 1P7JA 1ETKA 2EA4A 2XSDC 2EZKA 2IA2A 2L7MP 3FKJA 4W97A 2GIVA 4HX4A 2DBBA 5FO5A 3TW7A 3ZOBA 3IC7A 3GFJA 4M9SA 3IV5A 1OR7A 2QWWA 3B6CA 2DW4A 1XS9A 4J01A 5L3DA 4RB2C 5D4SA 4V2GA 4HDUA 2K9SA 2ZXHA 2NYXA 2STWA 2XPUA 3LSPA 1ENHA 2XC7A 5ICEA 4U88A 1OKRA 3FDYA 2KFDA 2IA0A 1UB9A 2NNYA 5FFZA 4PJ0C 3D5RC 3S3NA 3E5XA 2P5VA 4HV5A 2VI6A 5J40A 2HYJA 4I0BA 4RDUA 3OY9A 2M7AA 2VQCA 1WRJA 2G7HA 4OAYA 5D5WB 2WAQN 3BQYA 1ZGAA 3EETA 4P9FA 4EJVA 1PUEE 4WF2A 1QHHD 5FD5A 1YO5C 3GF2A 1S9HA 2LKPA 4BAYA 2E1MB 2XPVA 1I27A 4YIRX 1R6RA 4MFEA 4CA0A 3WE3A 5CJ9A 2OA4A 3BY6A 2Z5UA 5HDGA 2LH9A 3MMYB 2Z99A 2CUZA 2VJ5A 2VLAA 1P9QC 3ZQLA 3DPUA 2LR8A 4PCQA 1WWXA 2Q8KA 1Y0NA 3MKLA 1N25A 2DPUA 3BTLA 4LG3A 3SFZA 1ERDA 2F48A 2QA4I 4HNUA 4LG0A 1V5EA 3GEZA 4JYKA 4BHCA 4U0VA 3BJ6A 2PJPA 1B1BA 4EATA 1BI2A 1TBXA 5EZHA 2KIUA 2DFHA 1ORKA 4KN4X 3M07A 3OOUA 2CO5A 4KIGA 5HDKA 1VI0A 3CUQA 3HDDA 1YIOA 3O8HA 4Q47A 1X1BA 2PG4A 3PUBA 2B63J 4BU2A 4XNFA 4BNCA 4KYWA 1G8XA 4V2FA 4PZJA 1HKQA 1A6QA 4UNOA 1YLFA 1IGNA 1IXCA 4NC8A 2VJIA 3HTSB 2JSPA 2KL4A 3DTIA 2EPFA 2GXGA 2O8KA 5D8LB 1S8NA 3QP6A 3LSRA 3P9CA 1Y39A 1A04A 4I09A 3U2RA 2UXXA 1TLHB 1FOXA 1IN8A 4TV7A 3V42A 2L4AA 5HVQC 3BR5A 2FE3A 2EA2A 4LLLA 4PFOA 3HGGA 4RGRA 2R7OA 2CMPA 1D8KA 4D7NA 1ZRCA 4XRSA 3WTWC 5KAIC 4UB8C 4AVPA 5J8CA 1DQUA 3TOAA 1ZLKA 4II3A 1FIAA 4LMYA 4ON0A 2LY2A 2DFIA 3HRMA 3MVPA 2IPQX 4L5IA 3JRCA 2V1XA 4O5VA 4E7HA 2EH3A 2NVYJ 1UELB 2DTZA 3SQNA 4WX9A 3H3ZA 3IKVA 4O3MA 3WU0A 1E3PA 2R7QA 1ETQA 4I6ZA 1ZREA 2DT7B 3S32A 4HOBA 3UR3C 5D6EA 1GXPA 3TDZC 1SVOA 2IP2A 2QUFA 3GTOJ 1T95A 2PBIA 3GUDA 2K02A 5GPCA 1YYVA 2IVMA 2LYCA 1NG7A 5C3EJ 3TBIA 1BA5A 2M5WA 1STZA 3I3LA 1FOKA 3K2ZA 3HTUA 3HEFA 3OWTA 2BW3B 3GCMA 2L54A 3CLQA 4GXOA 2VBYA 1P92A 2DMTA 4IHVA 2CU7A 2WB1N 4Y17A 1WJ5A 4L9JA 2ZMEC 3H5NA 1XCBA 5IY5H 2HNHA 1IXRC 2HKXA 2JTVA 3OR2C 2IGKA 4EM0B 2NS0A 1XGNA 2P6SA 3OYAA 4A5MA 3FMQA 5B5EC 4KIFA 1ETWA 2JVHA 5DV5A 4CCNA 3WU1B 3G1OA 1FPQA 5GTHC 3GTQJ 4F91B 2GAUA 4UXNA 3COAC 2L2OA 2LREA 4AIJA 3F22A 3T8TA 2Q2EA 2DMNA 2EV0A 2A5YB 3G1LA 2K4JA 2JMWA 5E3NA 4RMNA 5DYMA 4A0YA 3OYCA 3RI4A 1ETVA 2MC4A 2XKOA 1QHGA 3K6GA 4MQ9F 5A2QZ 2HOTA 3NARA 3QQAA 3VOEA 2KJBA 5DUKA 4RB3C 1FOWA 4ZYAA 3JREA 4L5JA 1HKTA 4HQEA 3TMOA 3LSIA 1HQCA 4L9TA 3C3WA 2DA6A 1B8IA 4G7OF 3QPSA 1PYVA 3LQQA 3DLLF 3CCRI 1KQ9A 5B66C 3ZN0A 3FF5A 5K5QA 2COBA 3FBNB 3GXOA 1YE9A 2I5UA 1MMNA 5FKMA 1MNEA 3E5UA 1A36A 3HOYJ 2KIQA 3OYFA 2B0LA 1BOAA 5B1BH 5KK1A 3OS1A 3HOWJ 3JRDA 3SFIA 3L2UA 2OF7A 2Y0MA 2BXZA 1MJBA 3PNVA 2O3FA 4XLAA 1CGPA 1IDYA 4M73A 4IZZA 1WFXA 4IL6C 3VFZA 2Y9YA 3BZCA 3MZYA 2FSWA 2A6TA 5DCMB 2WAFA 2XAQA 1VQ9I 4GO1A 1VZ0A 1R71A 4XLPF 1KU7A 4BYYA 5J47A 5JVGF 3N97A 1RESA 2EIKH 2FJ1A 3QOEA 4GGGA 2UV1A 2K9LA 3CTAA 3HBLA 5H6RA 3OS0A 3K70D 4A12A 4S04A 5BPIA 1K78B 1V54H 2E5NA 2M45A 1X4PA 2ID3A 3QRFF 3GYHX 1A5JA 2JPBA 2Y0SN 3K0LA 1J2XA 4DYCA 4DBRA 4I99C 3ZMUA 1ETXA 5DCFA 3CMAI 3O8GA 4C2MJ 1B59A 3H36A 2VXDA 4CYCB 1LE8A 1LNWA 1WH7A 5F08A 1XGMA 4CDGA 3PIPF 2QQ9A 1TQIA 2FQ4A 3ERMA 2TRTA 5EEGA 2XHKA 2O5RA 4P5OA 5H2FC 2RAEA 3UNGC 1R1TA 2DYSH 1MBJA 1Z6TA 5J1UA 5K5RA 3ZPLA 4EJOA 3K4JA 1HC8A 2PMZA 2ACJA 1BIAA 2A5WA 4EJUA 2RC4A 2E60A 4RGUA 3BT9A 3CDIA 4C2TA 4IHWA 4U87A 4UUVA 3GW2A 4YFXF 1OYIA 1WCMJ 5EF6A 2CFXA 1N78A 1TWCJ 4HLYA 2OBPA 1W5TA 1IZ1A 1VF9A 3HRTA 1X1CA 2ESHA 5K5OA 4BACA 3JRAA 3ML6A 1T98A 3PSFA 3RTRA 1B72B 2OTLI 4KNYA 3LSMA 1E3HA 1U3EM 2COMA 3N4MA 1R1UA 2W4SA 3DWLE 4M9ZA 4ENJA 3SXYA 3HPHA 2WA0A 3GZ5A 1LJ9A 2OJED 1H88C 2W48A 4UY8I 1ETOA 2XAFA 2R7SA 3E3VA 2K86A 4IHYA 4WXDA 3S16J 1UHMA 2J5PA 3OOPA 1OLTA 1ULYA 2J5OA 2CV0A 3KZZA 5C4XJ 2LVSA 1RR7A 1XSXA 1O7FA 1D3YA 1BC7C 4GYGA 2V9KA 2LG4A 4UVCA 3RPUA 1OYWA 3GX4X 4KIBA 2FOKA 3IAM2 4QSHA 1USSA 3FHZA 2GZWA 1VQPI 1Z1DA 2QQ8A 1SVLA 2EFPA 2YX7A 5IOZA 1ZQ3P 4NBQA 1I6HJ 1PDNC 2JUCA 1WPKA 3VYTB 2LMDA 3I58A 3LSHA 2XIGA 2AS5F 5M5WJ 2VIXA 2V6CA 2UUZA 4QWQA 2LKXA 2LFBA 3A0HC 4DQ2A 2YU3A 5CVVA 1I50J 2G7UA 3LQRA 5HODA 1SFOJ 2BY2A 3QWLA 2RNGA 3A03A 3DEEA 2KZGA 3BR2A 5BPDA 2PX9A 1MJAA 2DDBA 4XBFA 4HX8A 3ONQA 1G3YA 2EWNA 3WHBA 4O6JA 2V1UA 1FSHA 5CKTA 1IXSB 1XSDA 2MBFA 3HJEA 3TDUC 2ZMEA 3K4CA 1XPXA 4I76A 1QA6A 1GV5A 2QKMB 1UCRA 4XM3A 3L2QA 1HOMA 1J09A 3ZMZA 1O3QA 4FX4A 3NAUA 2L7ZA 3OL4A 1R36A 3O6BB 1SD6A 1ZLJA 4I7HA 2MD0A 4BXXJ 2PN6A 3N05A 3A0BC 4C9YA 2OQGA 1EJ9A 4EGYA 2O61A 5CYVA 2ZFUA 3E7LA 2CG4A 4Y7NJ 1I1SA 1V3FA 3LFUA 2VN2A 2HS5A 5TRDA 3FM3A 2DLLA 1IC8A 2V7FA 3FWEA 3K4MA 4A69C 1BBYA 1BR2A 2W00A 5TJJA 4E6KG 3BTJA 1LDDA 2NS7A 3ULQB 3WHCA 4LG0B 2E2JJ 1YG2A 2H6BA 2OV7A 3D5LA 5KVRA 3CCEI 3F72A 4B3AA 2EZIA 4CHUA 2DYRH 1DGRM 5JHUA 1RUOA 2LY1A 5J4YA 1HBXG 4LLNA 1ITYA 2BBYA 2DDAA 4KJZA 4Q48A 4YRVA 2KMUA 1J9IA 2V6EA 1S7EA 4AC0A 3BG7A 4C2UA 2HEOA 3OYIA 3L2CA 3ROUA 2MGQA 1LDJA 4DYRA 1PP7U 4RS8A 1WHUA 2DA1A 1XX5A 2XPWA 2VPLA 2R7DA 1FP2A 1BOBA 2F5CA 2M0MA 1WJAA 1SC7A 1SMYF 2H6CA 4ZYGA 5EGOB 4MFDA 2OPTA 2VBZA 2E2IJ 4L9VA 1T6SA 3J80Z 3JR9A 4PSXA 2FX0A 3C2BA 4MNUA 1J7KA 4KA4A 5DD4A 3ZQ7A 5FROA 4HNTA 5LFAA 4G6DA 4WCGA 5M3MJ 3M8FA 5GAGJ 1GVDA 4WXHA 1H0MA 4Q4ZF 1KU2A 1S7OA 1FBQA 2DOEA 3VEPA 3AL0B 4IHTA 1TWAJ 3J81K 3T8RA 1IN5A 3HG9A 1B9MA 2X6OA 2W7NA 4XONA 2JUGA 4XQFA 2EFQA 2GWRA 3O2PE 1BW5A 4BKXA 2WAEA 4ENNA 2CW8A 4PK4A 4HW0A 3CC7I 2RQPA 1XSVA 4YIIA 5BMZA 2NS8A 1FMVA 2IA1A 2VKDA 3HGYA 1MSFC 3FXQA 5J8FA 2K7LA 1I3QJ 4EQQA 1DU0A 4UV9A 9ANTA 2DFEA 1IDZA 5EZGA 5IP9J 1JGSA 3NRVA 2XGEA 4E7ZA 3E6BA 1BI1A 4A6DA 2EZLA 4PSWA 4LJZF 5D5UB 5JR3A 1MZBA 2EJRA 2RN7A 2F5EA 4A0XA 1U5TB 4CYDA 3ABMH 1SFUA 5GP9A 3IKTA 3JSPA 1GDTA 1JT6A 2VE8A 3DFGA 1D0XA 2EV5A 5HDNA 2GBYA 2L9VA 2UXNA 2CV1A 4B09A 4AWXB 1X1PA 3E6DA 2XAGA 3CMEI 1LKXA 3KPHA 4II2A 3QOPA 2JVGA 4AUXA 2W85A 1K79A 1U9OA 1ZRDA 2LTPA 2OUMA 1PJRA 4DIQA 2A3SA 2Q2EB 4IF4A 2QSHX 2VQGA 1P6RA 5E18F 3F8CA 3T0YA 3SDGA 1QZEA 3REOA 1OJLA 3LOCA 2STTA 1P4XA 1DP3A 4BUPA 3OIQA 5HS9A 4L5EA 2P8TA 2JT1A 2PQ8A 4NB5A 3M4OJ 4XOPA 2Y69H 1ZHFA 4EV0A 1VTNC 3C2HA 2Y2ZA 1VQOI 3ZMVA 4EM2A 3ABLH 3B6AA 3K4NA 3ELKA 3GVAA 2PLYA 3I59A 4XKWA 4Y52J 3KYLA 1B8IB 4KFCA 4A3GJ 2HPIA 3BCBA 3PNTA 2Y75A 1VQKI 3ISPA 4QPQA 1HCRA 1K6YA 1YS6A 2DK8A 3WTTC 1S6LA 2HPMA 5LHHA 3FKIJ 4LK0F 2L02A 3ABUA 5C4JJ 1LDKB 2K9QA 1TQMA 4A6EA 2Z9OA 3RQIA 2VL8A 2K9MA 5LLQA 5JI6A 3ZXSA 1O3TA 1EH8A 2L01A 2E35A 2FUG2 5J6XA 1P4AA 1B9NA 3JRGA 1MH3A 3RPQA 1EA3A 1QVTA 4NC7A 2DODA 3EQLF 2BY1A 2H27A 2N8GA 2IS2A 2VC1A 2M8GX 1JUMA 3JW4A 1YITI 3FBIB 2VKHA 5D4RA 4MEYF 3S2DJ 3SEQA 3WTZA 1OCTC 3F6VA 1JE8A 2EQRA 1I3AA 2XAJA 3FM5A 1OCOH 3AG4H 2KQRA 2HVRA 1ZGWA 4B4CA 1JJ8C 2M9HA 3KP5A 3S8PA 3ZQQA 4ABZA 4R79A 1U9NA 1Q1HA 2V4JC 4RLQA 4G7ZF 2F2EA 2L5QA 1XTAA 4Z6YA 4ZYHA 4XLNF 4AM3A 1LB2A 5L3EA 3D1NI 2X9DA 4XRMA 2D5VA 4GYIA 2DA2A 2F5FA 5LEJA 3MD2A 3G73A 1X3UA 1UHWA 4BL0B 4GRIA 1HSJA 3I4PA 5GADJ 3BQZA 1HDPA 3A02A 2CWEA 3L7WA 3L1PA 4NDLA 2VB6A 4U0YA 4BE0A 5K1YA 1MBKA 1QGPA 2ADUA 4XN3A 4KISA 1FNNA 4XLEA 1SAUA 3ZMSA 4M3DA 1X58A 1ODDA 2DT5A 4A3BJ 3I55I 1O3RA 3QYEA 2E1MC 2O9LA 3RDIA 1RZ4A 1OFCX 4Z2YA 1OCZH 3KETA 4OOIA 2VODA 1RKWA 4IEJA 5EEHA 4I98B 3PM1A 2KT0A 5FKKA 3HL2A 4D1QA 4ESJA 1PP8F 3K70C 1Z67A 1IRGA 5F64A 2GXAA 5H20A 5AIQA 3ABKH 4PGGA 2P5KA 1FYLA 3CZ6A 5TGTA 4A3JJ 1J0RA 4LIUA 2W25A 1NK3P 4K2EA 1ZR4A 3V7SA 4G7HF 1Y6IA 3LFKA 1QVUA 1W0TA 1UZCA 5ERIA 1R5GA 1WKMA 4Y3OA 2R7FA 3L2VA 2K4BA 2VKEA 2R5YA 2DA4A 1D1BA 3CJQB 1W4MA 4Y13A 3I71A 1XB4A 2HTSA 2R7RA 4OWRB 2XB5A 1AU7A 1VQ8I 1SEUA 1SFXA 2VT2A 3SZGA 4FCYA 2CW7A 2P4WA 4XLHA 1VQ7I 2XB0X 3GTMJ 1IUFA 1HW2A 3G6EI 4CCJA 5IT9K 3RQ4A 5DS9A 5CLSA 2ZFWA 4P1WA 1FEXA 1R5ID 2M4GA 1I39A 3OYKA 2MD5A 1FJLA 3CCQI 4UB6C 4BE2A 1TWGJ 1K4TA 1VQ6I 3F21A 5D6FA 2AO9A 2IEKA 4HRIA 3MKZA 3V4GA 1XCVA 1JXSA 3DXJF 1S72I 1OQYA 1AHDP 3HOVJ 1E2XA 4P96A 4A3MJ 2R3SA 5CVIA 1RC9A 2RREA 3DTKA 3TKYA 1ZARA 3LSTA 1S5LC 3KEYA 1OCPA 4H4KC 2KZVA 3PSIA 2M3AA 2V1NA 3SZPA 2V9PA 2KIMA 4BS9A 1SVMA 4ZZDA 3AKZA 2M34A 4BHPA 4AYBA 1APLC 4W1UA 2YS9A 5IP7J 2HYGD 3HSRA 2Z33A 2X6WA 4XRFA 4LOCA 2MA3A 4XLCA 1U8RA 4G12A 2ZJQF 3U1DA 1XD7A 2ZMEB 2IAIA 2R5ZA 3CMMA 5DD8A 4XICA 4NC6A 5DEQA 3CC4I 1CF7A 1V55H 1W5SA 2DJIA 3EYYA 4M74A 4DZPA 1NK2P 2JQ7A 3GTKJ 5L3GA 1ZTRA 2MSYA 5IT3A 1R4MB 2DA3A 4GCVA 2ZJ2A 3B73A 3L2WA 3W6VA 2O8XA 2GM4A 3J81Z 2VPRA 2HQNA 3HKZN 2K27A 5FFXA 4BHBA 1P7IA 2GOXB 4U7BA 5BQTA 3M8EA 1WH5A 1FLIA 3K1NA 1H9TA 2F4OB 2R0QC 2BE5F 4DZJA 1UFMA 4YFKF 1MBGA 2R4GA 4A3LJ 3KLOA 5HLIA 5DM7F 4HLXA 5IYBJ 3CJNA 2Z3YA 4B47A 4ASNA 1MMDA 1S3JA 4CZZA 3W3CA 2XROA 3JRFA 5CPRB 4B3XA 3BJOA 5FJ8J 4MHGA 4RGSA 5E8GA 3ZCOA 3KCCA 4BY7J 1LPQA 2NVQJ 1F5TA 4HNVA 2PJRB 4P9UA 3QODA 3L9FA 4MQVA 3A01A 1VNDA 5FKNA 4OIOF 1D8JA 2GA2A 2MH9A 3I54A 3M1CA 3VDXA 1QPMA 1LVKA 2DA7A 5LGUA 1J59A 3QPTA 4IJAA 1OMIA 3G71I 3MWMA 4CCLA 3S15J 2DU9A 5F1JA 4PJLA 4LB5A 4UUTA 3V8KA 2OCCH 1WVRA 1MMAA 4Y33A 3K4BA 4Q5SF 4M72A 3EUHC 4R1HA 3KYDB 4JQFA 4X1EA 5E3OA 4ZYEA 4XL9A 1AKHA 4AD9A 4M3GA 2QLZA 1QBJA 1EF4A 4CCMA 2ZJPF 4AIKA 4IXAA 1CQTA 3BZ6A 5DTDA 4B48A 3OYJA 3Q9SA 5KAFC 3IH2A 2QQAA 2LLKA 3BPVA 4ZC3A 4F7ZA 1FP1D 3RJPA 4OIRF 3PFYA 2XSJC 1SD5A 3ZP5A 4RBOA 5LHIA 3BC8A 1G6NA 4N4OB 5HLTA 4M3BA 2R7WA 1ONVA 3KFWX 1XMAA 3IHUA 1Z05A 3OIOA 1BI3A 4KT6A 1IV8A 3H3VK 1GHCA 3Q0WA 1VQ5I 3BR6A 3NWTA 2OZ6A 3F8FA 5M5XJ 1FTZA 4ANJA 2FXAA 4KUMA 4HQMA 4IHSA 2HQAA 3LNQA 4ETSA 3CD6I 1MBEA 2AXLA 4PGHA 3MFKA 3FXOA 4JK1X 5DUIA 2V9VA 3DKYA 2BZTA 1U8BA 1TC3C 3QU6A 2H09A 2JA5J 2W84A 3FK7A 3GLLA 3LSKA 4CICA 4FE4A 4IQ4A 5K7HA 3H0GJ 1FT9A 1G3SA 3Q0VA 2XASA 2AHQA 3I9V2 1MDMB 4RGXA 3ZQGA 4EVIA 3SEZA 4C30A 4RAYA 3Q5FA 2NVTJ 1UG2A 3S14J 2LBFB 3D5SC 4RB0A 3SDBA 3KZIC 1FYMA 1U6GA 3R6SA 1S7AA 2K40A 3WGGA 6PAXA 5CVRA 1Z3YA 1Z3XA 3OYGA 2CGPA 4F55A 4FX0A 3VB2A 3CP2A 2DQRA 3V7CA 5AONA 3FXRA 1TZLA 1YFHA 4ZYDA 3W6KB 1ON1A 1H89C 4XSZF 2E1CA 5E20A 1RKTA 4HSTA 2EINH 4HYEA 1F43A 3I5UA 3TOBA 1ZK8A 3ESWB 2DCEA 3F8NA 1K61A 3CCVI 1MW7A 1HW5A 3RPUD 4DJAA 1DPUA 5HNHA 1EKEA 1UHSA 4EMSA 3RZOJ 1OYYA 2OCEA 5M5YJ 3I59B 2IS1A 3OYBA 3AG1H 1FOYA 2PFBA 3C18A 5GTIC 3IRRA 1SFKA 4EEFG 2DA5A 3S3OA 2XF7A 3Q9VA 2P7CB 2CQXA 4JP0A 3LAPA 5JVTA 1KU9A 1A6IA 3KYCB 2EZHA 3HHHA 1KQ0A 3NWSA 2F4IA 1HSTA 2HYFA 5LGTA 2KKOA 3DBRB 5ILSA 1O57A 1SMTA 3DPLC 3SHFA 2OAZA 2DT6A 4BQAA 2X6YA 4RA2A 3BJAA 5IP6A 4RM3A 2W82A 3ZR8X 2NAZA 3FX3A 2NVUB 3P9IA 4A93J 1ACIA 2WBMA 3IL2A 2VQHA 2L7FP 5FLXK 4E7LA 2X4HA 2Y31A 3LSJA 1YJWI 3DPTA 1JUPA 1H8AC 2JZYA 1MMGA 1FBUA 3G3ZA 1Y0UA 4BJ5C 2L9RA 1OISA 2CUEA 2R7ZJ 2HU9A 1POGA 4OMZA 1REPC 2IBDA 3F0CA 3OYHA 2Z2SB 2M8EA 2ELHA 3DTEA 4E7KA 3E6CC 4IO9F 4BXFA 2VC0A 2IT0A 3F3XA 2I10A 3I4NJ 4FT8A 1K7AA 4C3HJ 3QU3A 4FQGA 5IT9Z 4BQQA 2VE9A 3E1SA 4Y15A 3X2QH 1XGSA 1FZPB 3MZ8A 2JRTA 3K7AJ 5E79C 2OTJI 3PQKA 1WI9A 3BWGA 1ON2A 4MLOA 4KICA 3E97A 3ZQHA 4ZJZA 2ECCA 2ZC2A 4HF0A 4L0ZB 2QM3A 3V8JA 1JKQC 2WY7Q 4BJTA 2FNPA 1MD0A 2WADA 2ZB9A 2HDCA 2VOOA 3CLOA 2P7VB 4KT5C 3H92A 1IRFA 2WWYA 2EFOA 3BPXA 3QYFA 3S1RJ 3GWZA 3L09A 4EGZA 3BZKA 1WQ2A 3DCFA 1TL8A 1XN7A 2KP6A 3S3MA 2M2EA 3HSFA 4UHTA 1D0ZA 4YIFA 2KJCA 3L2RA 2K5CA 3BTIA 3RCOA 4BDYA 5FRMA 4FETA 1NG6A 3ZN1A 4G94A 1T33A 4CH7A 1W7PA 2RDPA 4RAZA 3CP8A 4FHTA 4BE1A 3HOZJ 1J75A 3CESA 3CUQB 2WAQA 5E1WA 1X4OA 2YUSA 1H9GA 2NXNB 2D1HA 1Y1WJ 2A05A 3NEUA 1G3WA 2KRFA 4N9IA 2ECBA 1JGGA 2X6XA 2BHYA 3V8LA 2R5YB 4ZTFA 5CQGA 2XRNA 1JKRC 1NH3A 1F36A 4YEJA 1ZYRF 3VPRA 1IO2A 1QNTA 2QQBA 2R93J 1HLVA 3EUHA 2H1KA 1MJ9A 1JHHA 1TT0A 4MEXF 2E1NA 2FD5A 1ZG5A 3HYIA 1XMXA 2KRCA 2ZXJA 2R7VA 1TW3A 3BDDA 2IGOA 5GAEJ 2OC6A 2ETHA 1LEAA 4KN7X 4ESFA 3KLNA 2KDOA 4E4HA 4L0YB 2XV4S 4A3DJ 5EG0A 1Y8RB 5IYDJ 2XGXA 1X1AA 4ENKA 2BVMA 2QSFX 2E34A 2XF6A 4G8XA 2IXSA 2L3DA 2I8DA 4BBSJ 4C3IJ 2EIJH 4IRGA 2MW8A 2ZCWA 2LY9A 3AL0C 1ETYA 3HUGA 1R23A 1ZN2A 2EB7A 4M71A 5LD2C 5K7FA 2PMHA 3F8BA 4HEA2 2PMZN 2QYOA 2HGCA 5GAHJ 5LEKA 1ZH5A 3JCUC 2IGNA 4NQWA 4CUGA 4BY1J 4UVBA 1HXDA 1ZG1A 2CYYA 4I01A 4QLCU 3DEUA 3LA7A 3BCAA 2CRGA 1DUXC 1FSEA 4CCOA 1MKMA 3CQZJ 3IH3A 2HZDA 2WC2A 4NNJA 2R5ZB 2HXOA 1YHQI 2DPDA 1L0OC 1CF7B 3H5RA 3OMYA 1I5ZA 5CVUA 4XORA 4LK1F 4L9NA 4R8HA 1AOYA 4A2UA 3S1QJ 3KIOA 3JRIA 2ICWG 3GTLJ 1BN5A 4HX7A 5J1RA 1JT0A 3CF2A 1P4WA 3K9TA 1O3SA 2CSOA 2R7TA 2XKPA 1U5TC 4IPAA 2H8WA 3ECOA 3CUOA 2M30A 1HDDC 3MN2A 2FMLA 2YSRA 3I64A 1WJDA 5BNGA 1YW8A 1UAAA 4Y4RA 3S1MJ 1YRNA 5F04A 2M1BA 3HXLA 2BGCA 3F8MA 1YI2I 3I53A 2CFOA 3EDPA 4PJMA 1Y8QB 2BOLA 5CQEA 4F3QA 1QRYA 1J5YA 2ELKA 2JSCA 2LKSA 2W24A 4EJTA 2JWTA 4CGZA 1K4SA 2R7UA 3FXKA 2WB1A 1ZAOA 2IW5A 4XOTA 3A01B 2MH2A 4LLGF 1QPIA 2JA2A 3MCZA 1XGOA 3AG2H 2WV0A 5LBQA 1XDSA 3BP8A 4A3EJ 1N77A 4X6AJ 2XF5A 2L9SA 2M4KA 1K6OA 2FRHA 1IG7A 1B72A 2E7XA 4AIHA 1JJ6C 1U78A 1V4RA 3PFIA 2LOOA 2E5ZA 2ISYA 1SD7A 2Q1ZB 3U1KA 2ZXWH 1IRXA 1AKHB 1VQMI 4JX4A 2PMUA 2F5DA 2V26A 2JRMA 2L4MA 4A3IJ 2L0KA 1QZZA 5D5XB 4XKBA 1BR1A 4YELA 1ZRFA 1AA7A 2KISA 4N9HA 3BROA 4IRIA 1BW6A 3S1NJ 3A1YA 1LFPA 2BEOA 1W36D 2HOAA 2HR3A 2LDUA 4F52A 1I1GA 3U9GA 4LGWA 1G59A 2X48A 1BR4A 4XIDA 1TWFJ 1DGWY 1FC3A 5ICFA 3LA3A 2AQFA 2JA8J 2GIZA 2F6CA 1MIJA 2KHMA 5HOOA 2XDVA 2QVOA 4BEHA 3GTPJ 3BR1A 1YX5A 3MQ0A
chains in the Genus database with same CATH topology
4H0EA 5E1ZB 1R58A 5BOXA 3GO5A 3MAJA 3CO6C 2FQ3A 1DP7P 4IRHA 1IN4A 3TO6A 5D8KB 2FU4A 5CVJA 2FMYA 3V7RA 5FLXZ 3ZMTA 1KGSA 3DV8A 3LA2A 1F9NA 3M9AA 2HWVA 3KP7A 2PI0A 2EFNA 2A68F 3C7JA 3R0AA 5E1XA 1BI0A 2A6HF 5LRSA 2ZNZA 2GQQA 1Z7UA 5F1RA 3QPHA 4B8XA 4UVAA 1TQPA 2XAHA 2VT3A 1IN7A 5LHGA 2QBYA 2G9WA 2O6GE 1USTA 2LNBA 3WTVC 2OU2A 3KP6A 2IRFG 1P2FA 4LD5A 4EM1A 1QQIA 3WTSC 4CO8A 3RYPA 4D0PA 2ZKZA 4ENMA 3W6JB 1R22A 1F4KA 4ESBA 4I0AA 2DAOA 2FF4A 2O0YA 1GVJA 4IVNA 4KMFA 3ERED 1Z91A 2RGVA 3KP2A 3FZVA 2WTEA 4JBAA 3E5QA 3WG9A 3T5XA 3F6OA 3WODF 5H6QA 4ZH4F 3T1BA 4KMUX 4MTDA 1O7LA 2FA5A 3RKYA 1R5HA 1YQAA 4U7DA 2XUBA 1R00A 1HKSA 2E7WA 2HZTA 3ABTA 5E8IA 1U5TA 2FNAA 5HS7A 1RI7A 4WXCA 3PQJA 3EYIA 1BJAA 4HF2A 3J80K 3TO7A 2A69F 1AWCA 1EH7A 5HLGA 5ILUA 2MLKA 1W7PB 1DPRA 1YTYA 3HIFA 4M9XA 1L3LA 3KZYA 2DTRA 1B4AA 2A6EF 3HSEA 3JTHA 3KP3A 3JTGA 5L3BA 5L3CA 1FYKA 1B6AA 4HBLA 1QO0D 1SD4A 2VOPA 4M6XA 3D0SA 4YFNF 2DI3A 1LEBA 3WE2A 4LB6B 4OIQF 1EH6A 4I02A 1KA8A 3AAFA 2VONA 3FMRA 3JSOA 1E17A 4E70A 4XSXF 3J7AO 3HOTA 3CDHA 1R1VA 3WTYC 1OPCA 3P7NA 2HQRA 4A5NA 3O3KA 1RIOH 3RYRA 4PDKA 3HRSA 1ZGJA 1HW1A 2LSOA 2BV6A 3QAHA 1I6XA 2VBXA 3R60A 3GFMA 1S29A 2LF7A 2YPRA 2V1DA 3BOQA 3R61A 5FB2A 2ESNA 3K1MA 4UV8A 3JAMK 2ZO4A 1TW2A 2P5LC 3WGHA 1FX7A 4HA8A 3RIRA 1Z9CA 3R4KA 3IWFA 1D5VA 1LVAA 1MGTA 3TGNA 2KIFA 1FY7A 1G4DA 4L18B 4P55A 4OIPF 2EV6A 2FBHA 4OMYA 2UWMA 4I2OA 1T2KA 3M1EA 5HLHA 2M87A 2GA1A 2Y48A 4EJWA 1RUNA 3KP4A 3IWZA 3TQNA 5LRRA 4HAMA 1TNSA 3CO7C 3HRUA 1IW7F 2X0LA 1IN6A 4LFUA 3DP7A 1GXQA 2ZBKA 5ICCA 4DNCA 1TTYA 1XDUA 2CQKA 2FBIA 1KQ8A 1BM9A 3HHGA 4HF1A 1EV7A 2RKHA 2A07F 2DQLA 1RNLA 5LGNA 1DDNA 4CXFA 2LF8A 3I0TA 2HKOA 3ZPLA 1R7JA 4G9YA 2P6TA 3GFIA 3KEQA 1YW9A 3P9KA 1T39A 5HS8A 3DQVC 1T0FA 3KEOA 4WK8F 2D1VA 4HDVA 3H3UA 2C6YA 1W7PD 5E17F 2RVCA 3WTXC 3QP5A 5L3FA 3HOSA 2FEZA 2EFWA 3FMSA 2HTJA 1KYZA 3ZMDA 4G6QA 4M6YA 4ZZLA 1FWZA 5JFRA 2DK5A 2FBKA 3RKXA 1U2WA 3WGIA 2RV8A 3K69A 2MLGA 2IJLA 1Z6RA 5ED4A 2OQRA 3B02A 5DDGA 3CUQC 2QBYB 1KU3A 2YX4A 1YS7A 3MEXA 2HFHA 3WTUC 2PEXA 1IUYA 1LQ1A 4BH9A 3L00A 1TNTA 5F6FA 5D5VB 2VBWA 3LWFA 1JHFA 1ZG3A 1BC8C 2EK5A 3NQOA 2A61A 4MTEA 3C1DA 1FBSA 4OU0A 4OINF 5FGMA 2JPCA 2D2WA 5DCMA 2ZNYA 1SAXA 2NRAC 5FD6A 3OV8A 4NHJA 3ECHA 3GFLA 2BYVE 3RKWA 3TO9A 1K78A 2GXBA 3M7GA 2ISZA 2OD5A 2MC3A 1BIBA 3E6MA 5A2QK 1QZYA 3DF8A 3FXUA 3S2WA 3GZ6A 5ICGA 2Q0OA 2H94A 1F1ZA 4HV6A 5AIPA 2DO7A 3GLXA 4U0WA 1MDMA 1SFEA 1XMKA 2RNJA 3VODA 3K1PA 2XVCA 1C0WA 2TDXA 2O03A 2HOEA 4A0ZA 4S05A 2YR2A 4WWCA 2V79A 5BS6A 2UZKA 3KE2A 3R0JA 4N0BA 3DKWA 4KDPA 1T38A 3IRQA 3SZTA 3MZHA 1G3TA 4HZFA 3JAMZ 1NHAA 2NNNA 5ILVA 2VXZA 1IF1A 2OZUA 2QZ8A 1KYWA 4BXUA 2QENA 2D45A 1WSUA 4MGRA 3LAJA 3F23A 4YG2F 1IAWA 1YW7A 4RB1A 2CW0F 2W57A 2EA4A 2IA2A 2GIVA 4HX4A 2DBBA 5FO5A 3IC7A 3GFJA 4M9SA 1OR7A 2QWWA 2DW4A 5L3DA 4RB2C 5D4SA 4HDUA 2NYXA 2STWA 5ICEA 4U88A 1OKRA 2IA0A 1UB9A 2NNYA 5FFZA 3E5XA 2P5VA 4HV5A 4I0BA 1WRJA 2G7HA 5D5WB 1ZGAA 4EJVA 3EETA 4P9FA 1PUEE 4WF2A 5FD5A 1YO5C 3GF2A 2LKPA 4BAYA 1I27A 3WE3A 5CJ9A 2OA4A 3BY6A 2Z5UA 5HDGA 2Z99A 2Q8KA 4PCQA 1WWXA 2DPUA 3SFZA 4LG0A 3GEZA 4BHCA 4U0VA 3BJ6A 2PJPA 1B1BA 1BI2A 1TBXA 2KIUA 4KN4X 2CO5A 4KIGA 5HDKA 3CUQA 1YIOA 4Q47A 2PG4A 4BNCA 4KYWA 4PZJA 1HKQA 4UNOA 1YLFA 1IXCA 3HTSB 2GXGA 5D8LB 1S8NA 3QP6A 3P9CA 1A04A 3U2RA 4I09A 2UXXA 1TLHB 1IN8A 4TV7A 2L4AA 5HVQC 2FE3A 2EA2A 4LLLA 4RGRA 1D8KA 1ZRCA 3WTWC 4AVPA 5J8CA 3TOAA 1ZLKA 4LMYA 4ON0A 2DFIA 3HRMA 2IPQX 4L5IA 2V1XA 4O5VA 4WX9A 3SQNA 3H3ZA 3IKVA 4O3MA 3WU0A 1ZREA 4HOBA 5D6EA 1GXPA 3TDZC 2IP2A 2QUFA 3GUDA 2PBIA 2K02A 1YYVA 2IVMA 2M5WA 1STZA 1FOKA 3K2ZA 3HTUA 2L54A 4GXOA 2VBYA 1P92A 4Y17A 4L9JA 1XCBA 1IXRC 2HKXA 2JTVA 4EM0B 2NS0A 1XGNA 2P6SA 4A5MA 3FMQA 4KIFA 5DV5A 3WU1B 1FPQA 2GAUA 4UXNA 3COAC 4AIJA 3F22A 3T8TA 2Q2EA 2EV0A 2A5YB 2K4JA 5DYMA 4A0YA 3RI4A 2XKOA 4MQ9F 5A2QZ 3VOEA 2KJBA 5DUKA 4RB3C 4L5JA 1HKTA 4HQEA 1HQCA 4L9TA 3C3WA 4G7OF 3LQQA 1KQ9A 3ZN0A 3FF5A 5K5QA 3GXOA 3E5UA 2B0LA 1BOAA 5KK1A 2Y0MA 1CGPA 1MJBA 2O3FA 4M73A 3VFZA 3MZYA 2FSWA 5DCMB 2XAQA 4GO1A 4XLPF 1KU7A 4BYYA 3N97A 4GGGA 3CTAA 5H6RA 1K78B 4A12A 4S04A 5BPIA 2M45A 3QRFF 3GYHX 2JPBA 3K0LA 1J2XA 3ZMUA 5DCFA 1B59A 1LNWA 4CDGA 1XGMA 2QQ9A 1TQIA 5EEGA 2XHKA 4P5OA 1R1TA 1Z6TA 5K5RA 4EJOA 2ACJA 1BIAA 4EJUA 2RC4A 4RGUA 4UUVA 3GW2A 4YFXF 1OYIA 2CFXA 4HLYA 2OBPA 1W5TA 1IZ1A 3HRTA 2ESHA 5K5OA 3ML6A 1T98A 3RTRA 4KNYA 1U3EM 2COMA 3N4MA 1R1UA 4M9ZA 4ENJA 3SXYA 3GZ5A 1LJ9A 2XAFA 3E3VA 2K86A 4WXDA 1UHMA 2J5PA 3OOPA 1ULYA 2J5OA 3KZZA 1XSXA 1O7FA 1D3YA 1BC7C 4GYGA 4UVCA 3RPUA 1OYWA 3GX4X 4KIBA 2FOKA 3FHZA 1USSA 2GZWA 1Z1DA 2YX7A 2EFPA 1PDNC 3I58A 2XIGA 2AS5F 2V6CA 4QWQA 4DQ2A 2YU3A 5CVVA 2G7UA 3LQRA 5BPDA 1MJAA 4XBFA 4HX8A 1G3YA 2EWNA 4O6JA 2V1UA 1FSHA 1IXSB 1XSDA 2MBFA 3TDUC 2ZMEA 1UCRA 3ZMZA 1O3QA 4FX4A 1R36A 3O6BB 1SD6A 1ZLJA 4I7HA 2PN6A 2OQGA 4EGYA 2O61A 5CYVA 2CG4A 1I1SA 1V3FA 2VN2A 2HS5A 5TRDA 3FM3A 2DLLA 3FWEA 1BBYA 5TJJA 1LDDA 3ULQB 4LG0B 1YG2A 2H6BA 3D5LA 5KVRA 3F72A 4CHUA 5JHUA 1RUOA 1HBXG 4LLNA 2BBYA 4Q48A 1J9IA 2HEOA 3L2CA 3ROUA 1LDJA 1PP7U 4RS8A 2R7DA 1FP2A 2F5CA 1SMYF 2H6CA 4ZYGA 2VBZA 4L9VA 1T6SA 3J80Z 4MNUA 1J7KA 4KA4A 5DD4A 3ZQ7A 4G6DA 4WCGA 3M8FA 4WXHA 1H0MA 4Q4ZF 1KU2A 1S7OA 1FBQA 3VEPA 4IHTA 3J81K 3T8RA 1IN5A 1B9MA 2EFQA 2GWRA 3O2PE 4ENNA 4HW0A 2RQPA 1XSVA 4YIIA 5BMZA 2IA1A 3FXQA 5J8FA 2K7LA 4EQQA 4UV9A 1JGSA 3NRVA 3E6BA 1BI1A 4A6DA 4LJZF 5D5UB 5JR3A 4A0XA 1MZBA 2EJRA 2F5EA 2RN7A 1U5TB 4CYDA 1SFUA 3IKTA 3JSPA 2VE8A 3DFGA 2EV5A 5HDNA 2UXNA 4B09A 4AWXB 3E6DA 2XAGA 3QOPA 2W85A 1K79A 1ZRDA 2A3SA 4IF4A 1P6RA 5E18F 3F8CA 3T0YA 3REOA 2STTA 1P4XA 5HS9A 2P8TA 2JT1A 2PQ8A 4NB5A 1ZHFA 4EV0A 1VTNC 3ZMVA 4EM2A 3ELKA 3GVAA 2PLYA 3I59A 4KFCA 2Y75A 3ISPA 2DK8A 1YS6A 3WTTC 1S6LA 5LHHA 4LK0F 2L02A 3ABUA 1LDKB 4A6EA 1TQMA 2Z9OA 5LLQA 5JI6A 1O3TA 1EH8A 2L01A 5J6XA 1P4AA 1B9NA 3RPQA 3EQLF 2H27A 2VC1A 3JW4A 5D4RA 4MEYF 3WTZA 3F6VA 1JE8A 2XAJA 3FM5A 3KP5A 4R79A 1Q1HA 4G7ZF 2F2EA 4ZYHA 4XLNF 1LB2A 5L3EA 4GYIA 2F5FA 5LEJA 3G73A 1X3UA 1UHWA 1HSJA 3I4PA 2CWEA 3L7WA 4U0YA 5K1YA 1QGPA 2ADUA 1FNNA 3ZMSA 1ODDA 2DT5A 1O3RA 3RDIA 1RZ4A 3KETA 4Z2YA 4OOIA 2VODA 5EEHA 4I98B 4ESJA 1PP8F 1IRGA 5F64A 5H20A 5AIQA 4PGGA 2P5KA 1FYLA 1J0RA 2W25A 4K2EA 3V7SA 4G7HF 3LFKA 5ERIA 1R5GA 1WKMA 2R7FA 2K4BA 1W4MA 4Y13A 3I71A 1XB4A 2HTSA 1SFXA 2VT2A 2P4WA 1HW2A 5IT9K 5CLSA 2ZFWA 2MD5A 3F21A 5D6FA 3V4GA 1XCVA 1JXSA 3DXJF 1E2XA 4P96A 2R3SA 5CVIA 3TKYA 1ZARA 3LSTA 3SZPA 2KIMA 4ZZDA 4BHPA 2HYGD 3HSRA 2Z33A 4XRFA 2MA3A 1U8RA 3U1DA 1XD7A 2ZMEB 5DD8A 5DEQA 1CF7A 1W5SA 3EYYA 4M74A 5L3GA 5IT3A 4GCVA 2ZJ2A 3B73A 2O8XA 3J81Z 2HQNA 5FFXA 2K27A 4BHBA 4U7BA 5BQTA 3M8EA 1FLIA 3K1NA 1H9TA 2BE5F 1UFMA 4YFKF 3KLOA 5HLIA 4HLXA 3CJNA 2Z3YA 4ASNA 1S3JA 4CZZA 2XROA 3BJOA 4MHGA 4RGSA 5E8GA 3KCCA 1F5TA 4P9UA 3L9FA 4MQVA 4OIOF 1D8JA 2GA2A 2MH9A 3I54A 1QPMA 5LGUA 1J59A 3QPTA 4IJAA 1OMIA 3MWMA 2DU9A 4LB5A 3V8KA 4Q5SF 4M72A 4R1HA 4JQFA 4ZYEA 4AD9A 2QLZA 1QBJA 4AIKA 4IXAA 3BZ6A 3Q9SA 2QQAA 3BPVA 4F7ZA 1FP1D 3RJPA 4OIRF 1SD5A 3ZP5A 5LHIA 1G6NA 1ONVA 3KFWX 1XMAA 3IHUA 1Z05A 1BI3A 1GHCA 2OZ6A 3F8FA 2FXAA 4KUMA 4HQMA 4IHSA 4ETSA 2AXLA 4PGHA 3MFKA 4JK1X 5DUIA 2V9VA 3QU6A 2H09A 2W84A 4CICA 1FT9A 1G3SA 1MDMB 2XASA 4RGXA 4EVIA 3Q5FA 4RAYA 4RB0A 1FYMA 1U6GA 3R6SA 1S7AA 3WGGA 6PAXA 5CVRA 2CGPA 4FX0A 3VB2A 2DQRA 3V7CA 5AONA 3FXRA 1YFHA 4ZYDA 3W6KB 1ON1A 4XSZF 2E1CA 5E20A 4HYEA 3I5UA 3TOBA 3F8NA 1HW5A 1DPUA 4EMSA 1OYYA 3I59B 2PFBA 3C18A 3IRRA 3Q9VA 2P7CB 3LAPA 5JVTA 1KU9A 3HHHA 1KQ0A 1HSTA 2HYFA 5LGTA 2KKOA 5ILSA 1O57A 1SMTA 3DPLC 3SHFA 2OAZA 4BQAA 3BJAA 2NAZA 3FX3A 3P9IA 3IL2A 5FLXK 2X4HA 3DPTA 2JZYA 1FBUA 3G3ZA 1Y0UA 4OMZA 1REPC 2M8EA 2ELHA 3E6CC 2VC0A 2IT0A 3F3XA 4FT8A 1K7AA 3QU3A 5IT9Z 2VE9A 4Y15A 1FZPB 1XGSA 2JRTA 3PQKA 1WI9A 3BWGA 1ON2A 4KICA 3E97A 4HF0A 4L0ZB 2QM3A 3V8JA 2FNPA 1MD0A 2HDCA 2VOOA 3CLOA 2P7VB 4KT5C 3H92A 1IRFA 2WWYA 2EFOA 3BPXA 3GWZA 3L09A 4EGZA 1WQ2A 1XN7A 3HSFA 4UHTA 4YIFA 2KJCA 3ZN1A 4G94A 1W7PA 2RDPA 4RAZA 4FHTA 1J75A 3CUQB 5E1WA 1H9GA 2D1HA 3NEUA 1G3WA 2KRFA 4N9IA 3V8LA 2XRNA 1ZYRF 2QQBA 1QNTA 3EUHA 1MJ9A 1JHHA 4MEXF 2E1NA 1ZG5A 3HYIA 2ZXJA 1TW3A 3BDDA 2ETHA 1LEAA 4KN7X 4ESFA 3KLNA 4L0YB 2XV4S 2XGXA 4ENKA 4G8XA 2L3DA 4IRGA 2ZCWA 3HUGA 1R23A 1ZN2A 2EB7A 4M71A 2PMHA 3F8BA 2QYOA 5LEKA 2HGCA 1ZH5A 4NQWA 4UVBA 1HXDA 1ZG1A 2CYYA 4I01A 4QLCU 3DEUA 3LA7A 1DUXC 1FSEA 1MKMA 2WC2A 2DPDA 1L0OC 1CF7B 1I5ZA 5CVUA 4LK1F 4L9NA 4R8HA 1AOYA 4A2UA 1BN5A 4HX7A 1P4WA 3K9TA 1O3SA 2CSOA 2XKPA 1U5TC 4IPAA 3ECOA 3CUOA 2M30A 2FMLA 2YSRA 3I64A 1YW8A 2M1BA 2BGCA 3F8MA 3I53A 3EDPA 1J5YA 2W24A 2JSCA 4EJTA 4CGZA 1ZAOA 2IW5A 2MH2A 4LLGF 3MCZA 1XGOA 2WV0A 5LBQA 1XDSA 3BP8A 1K6OA 2FRHA 2E7XA 4AIHA 1U78A 1V4RA 3PFIA 2ISYA 1SD7A 2PMUA 2F5DA 2L4MA 1QZZA 5D5XB 1ZRFA 4N9HA 3BROA 4IRIA 2BEOA 2HR3A 2LDUA 1I1GA 3U9GA 4LGWA 1FC3A 5ICFA 3LA3A 5HOOA 2QVOA 3MQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0E A;  5E1Z B;  1R58 A;  5BOX A;  3GO5 A;  3MAJ A;  3CO6 C;  2FQ3 A;  1DP7 P;  4IRH A;  1IN4 A;  3TO6 A;  5D8K B;  2FU4 A;  5CVJ A;  2FMY A;  3V7R A;  5FLX Z;  3ZMT A;  1KGS A;  3DV8 A;  3LA2 A;  1F9N A;  3M9A A;  2HWV A;  3KP7 A;  2PI0 A;  2EFN A;  2A68 F;  3C7J A;  3R0A A;  5E1X A;  1BI0 A;  2A6H F;  5LRS A;  2ZNZ A;  2GQQ A;  1Z7U A;  5F1R A;  3QPH A;  4B8X A;  4UVA A;  1TQP A;  2XAH A;  2VT3 A;  1IN7 A;  5LHG A;  2QBY A;  2G9W A;  2O6G E;  1UST A;  2LNB A;  3WTV C;  2OU2 A;  3KP6 A;  2IRF G;  1P2F A;  4LD5 A;  4EM1 A;  1QQI A;  3WTS C;  4CO8 A;  3RYP A;  4D0P A;  2ZKZ A;  4ENM A;  3W6J B;  1R22 A;  1F4K A;  4ESB A;  4I0A A;  2DAO A;  2FF4 A;  2O0Y A;  1GVJ A;  4IVN A;  4KMF A;  3ERE D;  1Z91 A;  2RGV A;  3KP2 A;  3FZV A;  2WTE A;  4JBA A;  3E5Q A;  3WG9 A;  3T5X A;  3F6O A;  3WOD F;  5H6Q A;  4ZH4 F;  3T1B A;  4KMU X;  4MTD A;  1O7L A;  2FA5 A;  3RKY A;  1R5H A;  1YQA A;  4U7D A;  2XUB A;  1R00 A;  1HKS A;  2E7W A;  2HZT A;  3ABT A;  5E8I A;  1U5T A;  2FNA A;  5HS7 A;  1RI7 A;  4WXC A;  3PQJ A;  3EYI A;  1BJA A;  4HF2 A;  3J80 K;  3TO7 A;  2A69 F;  1AWC A;  1EH7 A;  5HLG A;  5ILU A;  2MLK A;  1W7P B;  1DPR A;  1YTY A;  3HIF A;  4M9X A;  1L3L A;  3KZY A;  2DTR A;  1B4A A;  2A6E F;  3HSE A;  3JTH A;  3KP3 A;  3JTG A;  5L3B A;  5L3C A;  1FYK A;  1B6A A;  4HBL A;  1QO0 D;  1SD4 A;  2VOP A;  4M6X A;  3D0S A;  4YFN F;  2DI3 A;  1LEB A;  3WE2 A;  4LB6 B;  4OIQ F;  1EH6 A;  4I02 A;  1KA8 A;  3AAF A;  2VON A;  3FMR A;  3JSO A;  1E17 A;  4E70 A;  4XSX F;  3J7A O;  3HOT A;  3CDH A;  1R1V A;  3WTY C;  1OPC A;  3P7N A;  2HQR A;  4A5N A;  3O3K A;  1RIO H;  3RYR A;  4PDK A;  3HRS A;  1ZGJ A;  1HW1 A;  2LSO A;  2BV6 A;  3QAH A;  1I6X A;  2VBX A;  3R60 A;  3GFM A;  1S29 A;  2LF7 A;  2YPR A;  2V1D A;  3BOQ A;  3R61 A;  5FB2 A;  2ESN A;  3K1M A;  4UV8 A;  3JAM K;  2ZO4 A;  1TW2 A;  2P5L C;  3WGH A;  1FX7 A;  4HA8 A;  3RIR A;  1Z9C A;  3R4K A;  3IWF A;  1D5V A;  1LVA A;  1MGT A;  3TGN A;  2KIF A;  1FY7 A;  1G4D A;  4L18 B;  4P55 A;  4OIP F;  2EV6 A;  2FBH A;  4OMY A;  2UWM A;  4I2O A;  1T2K A;  3M1E A;  5HLH A;  2M87 A;  2GA1 A;  2Y48 A;  4EJW A;  1RUN A;  3KP4 A;  3IWZ A;  3TQN A;  5LRR A;  4HAM A;  1TNS A;  3CO7 C;  3HRU A;  1IW7 F;  2X0L A;  1IN6 A;  4LFU A;  3DP7 A;  1GXQ A;  2ZBK A;  5ICC A;  4DNC A;  1TTY A;  1XDU A;  2CQK A;  2FBI A;  1KQ8 A;  1BM9 A;  3HHG A;  4HF1 A;  1EV7 A;  2RKH A;  2A07 F;  2DQL A;  1RNL A;  5LGN A;  1DDN A;  4CXF A;  2LF8 A;  3I0T A;  2HKO A;  3ZPL A;  1R7J A;  4G9Y A;  2P6T A;  3GFI A;  3KEQ A;  1YW9 A;  3P9K A;  1T39 A;  5HS8 A;  3DQV C;  1T0F A;  3KEO A;  4WK8 F;  2D1V A;  4HDV A;  3H3U A;  2C6Y A;  1W7P D;  5E17 F;  2RVC A;  3WTX C;  3QP5 A;  5L3F A;  3HOS A;  2FEZ A;  2EFW A;  3FMS A;  2HTJ A;  1KYZ A;  3ZMD A;  4G6Q A;  4M6Y A;  4ZZL A;  1FWZ A;  5JFR A;  2DK5 A;  2FBK A;  3RKX A;  1U2W A;  3WGI A;  2RV8 A;  3K69 A;  2MLG A;  2IJL A;  1Z6R A;  5ED4 A;  2OQR A;  3B02 A;  5DDG A;  3CUQ C;  2QBY B;  1KU3 A;  2YX4 A;  1YS7 A;  3MEX A;  2HFH A;  3WTU C;  2PEX A;  1IUY A;  1LQ1 A;  4BH9 A;  3L00 A;  1TNT A;  5F6F A;  5D5V B;  2VBW A;  3LWF A;  1JHF A;  1ZG3 A;  1BC8 C;  2EK5 A;  3NQO A;  2A61 A;  4MTE A;  3C1D A;  1FBS A;  4OU0 A;  4OIN F;  5FGM A;  2JPC A;  2D2W A;  5DCM A;  2ZNY A;  1SAX A;  2NRA C;  5FD6 A;  3OV8 A;  4NHJ A;  3ECH A;  3GFL A;  2BYV E;  3RKW A;  3TO9 A;  1K78 A;  2GXB A;  3M7G A;  2ISZ A;  2OD5 A;  2MC3 A;  1BIB A;  3E6M A;  5A2Q K;  1QZY A;  3DF8 A;  3FXU A;  3S2W A;  3GZ6 A;  5ICG A;  2Q0O A;  2H94 A;  1F1Z A;  4HV6 A;  5AIP A;  2DO7 A;  3GLX A;  4U0W A;  1MDM A;  1SFE A;  1XMK A;  2RNJ A;  3VOD A;  3K1P A;  2XVC A;  1C0W A;  2TDX A;  2O03 A;  2HOE A;  4A0Z A;  4S05 A;  2YR2 A;  4WWC A;  2V79 A;  5BS6 A;  2UZK A;  3KE2 A;  3R0J A;  4N0B A;  3DKW A;  4KDP A;  1T38 A;  3IRQ A;  3SZT A;  3MZH A;  1G3T A;  4HZF A;  3JAM Z;  1NHA A;  2NNN A;  5ILV A;  2VXZ A;  1IF1 A;  2OZU A;  2QZ8 A;  1KYW A;  4BXU A;  2QEN A;  2D45 A;  1WSU A;  4MGR A;  3LAJ A;  3F23 A;  4YG2 F;  1IAW A;  1YW7 A;  4RB1 A;  2CW0 F;  2W57 A;  2EA4 A;  2IA2 A;  2GIV A;  4HX4 A;  2DBB A;  5FO5 A;  3IC7 A;  3GFJ A;  4M9S A;  1OR7 A;  2QWW A;  2DW4 A;  5L3D A;  4RB2 C;  5D4S A;  4HDU A;  2NYX A;  2STW A;  5ICE A;  4U88 A;  1OKR A;  2IA0 A;  1UB9 A;  2NNY A;  5FFZ A;  3E5X A;  2P5V A;  4HV5 A;  4I0B A;  1WRJ A;  2G7H A;  5D5W B;  1ZGA A;  4EJV A;  3EET A;  4P9F A;  1PUE E;  4WF2 A;  5FD5 A;  1YO5 C;  3GF2 A;  2LKP A;  4BAY A;  1I27 A;  3WE3 A;  5CJ9 A;  2OA4 A;  3BY6 A;  2Z5U A;  5HDG A;  2Z99 A;  2Q8K A;  4PCQ A;  1WWX A;  2DPU A;  3SFZ A;  4LG0 A;  3GEZ A;  4BHC A;  4U0V A;  3BJ6 A;  2PJP A;  1B1B A;  1BI2 A;  1TBX A;  2KIU A;  4KN4 X;  2CO5 A;  4KIG A;  5HDK A;  3CUQ A;  1YIO A;  4Q47 A;  2PG4 A;  4BNC A;  4KYW A;  4PZJ A;  1HKQ A;  4UNO A;  1YLF A;  1IXC A;  3HTS B;  2GXG A;  5D8L B;  1S8N A;  3QP6 A;  3P9C A;  1A04 A;  3U2R A;  4I09 A;  2UXX A;  1TLH B;  1IN8 A;  4TV7 A;  2L4A A;  5HVQ C;  2FE3 A;  2EA2 A;  4LLL A;  4RGR A;  1D8K A;  1ZRC A;  3WTW C;  4AVP A;  5J8C A;  3TOA A;  1ZLK A;  4LMY A;  4ON0 A;  2DFI A;  3HRM A;  2IPQ X;  4L5I A;  2V1X A;  4O5V A;  4WX9 A;  3SQN A;  3H3Z A;  3IKV A;  4O3M A;  3WU0 A;  1ZRE A;  4HOB A;  5D6E A;  1GXP A;  3TDZ C;  2IP2 A;  2QUF A;  3GUD A;  2PBI A;  2K02 A;  1YYV A;  2IVM A;  2M5W A;  1STZ A;  1FOK A;  3K2Z A;  3HTU A;  2L54 A;  4GXO A;  2VBY A;  1P92 A;  4Y17 A;  4L9J A;  1XCB A;  1IXR C;  2HKX A;  2JTV A;  4EM0 B;  2NS0 A;  1XGN A;  2P6S A;  4A5M A;  3FMQ A;  4KIF A;  5DV5 A;  3WU1 B;  1FPQ A;  2GAU A;  4UXN A;  3COA C;  4AIJ A;  3F22 A;  3T8T A;  2Q2E A;  2EV0 A;  2A5Y B;  2K4J A;  5DYM A;  4A0Y A;  3RI4 A;  2XKO A;  4MQ9 F;  5A2Q Z;  3VOE A;  2KJB A;  5DUK A;  4RB3 C;  4L5J A;  1HKT A;  4HQE A;  1HQC A;  4L9T A;  3C3W A;  4G7O F;  3LQQ A;  1KQ9 A;  3ZN0 A;  3FF5 A;  5K5Q A;  3GXO A;  3E5U A;  2B0L A;  1BOA A;  5KK1 A;  2Y0M A;  1CGP A;  1MJB A;  2O3F A;  4M73 A;  3VFZ A;  3MZY A;  2FSW A;  5DCM B;  2XAQ A;  4GO1 A;  4XLP F;  1KU7 A;  4BYY A;  3N97 A;  4GGG A;  3CTA A;  5H6R A;  1K78 B;  4A12 A;  4S04 A;  5BPI A;  2M45 A;  3QRF F;  3GYH X;  2JPB A;  3K0L A;  1J2X A;  3ZMU A;  5DCF A;  1B59 A;  1LNW A;  4CDG A;  1XGM A;  2QQ9 A;  1TQI A;  5EEG A;  2XHK A;  4P5O A;  1R1T A;  1Z6T A;  5K5R A;  4EJO A;  2ACJ A;  1BIA A;  4EJU A;  2RC4 A;  4RGU A;  4UUV A;  3GW2 A;  4YFX F;  1OYI A;  2CFX A;  4HLY A;  2OBP A;  1W5T A;  1IZ1 A;  3HRT A;  2ESH A;  5K5O A;  3ML6 A;  1T98 A;  3RTR A;  4KNY A;  1U3E M;  2COM A;  3N4M A;  1R1U A;  4M9Z A;  4ENJ A;  3SXY A;  3GZ5 A;  1LJ9 A;  2XAF A;  3E3V A;  2K86 A;  4WXD A;  1UHM A;  2J5P A;  3OOP A;  1ULY A;  2J5O A;  3KZZ A;  1XSX A;  1O7F A;  1D3Y A;  1BC7 C;  4GYG A;  4UVC A;  3RPU A;  1OYW A;  3GX4 X;  4KIB A;  2FOK A;  3FHZ A;  1USS A;  2GZW A;  1Z1D A;  2YX7 A;  2EFP A;  1PDN C;  3I58 A;  2XIG A;  2AS5 F;  2V6C A;  4QWQ A;  4DQ2 A;  2YU3 A;  5CVV A;  2G7U A;  3LQR A;  5BPD A;  1MJA A;  4XBF A;  4HX8 A;  1G3Y A;  2EWN A;  4O6J A;  2V1U A;  1FSH A;  1IXS B;  1XSD A;  2MBF A;  3TDU C;  2ZME A;  1UCR A;  3ZMZ A;  1O3Q A;  4FX4 A;  1R36 A;  3O6B B;  1SD6 A;  1ZLJ A;  4I7H A;  2PN6 A;  2OQG A;  4EGY A;  2O61 A;  5CYV A;  2CG4 A;  1I1S A;  1V3F A;  2VN2 A;  2HS5 A;  5TRD A;  3FM3 A;  2DLL A;  3FWE A;  1BBY A;  5TJJ A;  1LDD A;  3ULQ B;  4LG0 B;  1YG2 A;  2H6B A;  3D5L A;  5KVR A;  3F72 A;  4CHU A;  5JHU A;  1RUO A;  1HBX G;  4LLN A;  2BBY A;  4Q48 A;  1J9I A;  2HEO A;  3L2C A;  3ROU A;  1LDJ A;  1PP7 U;  4RS8 A;  2R7D A;  1FP2 A;  2F5C A;  1SMY F;  2H6C A;  4ZYG A;  2VBZ A;  4L9V A;  1T6S A;  3J80 Z;  4MNU A;  1J7K A;  4KA4 A;  5DD4 A;  3ZQ7 A;  4G6D A;  4WCG A;  3M8F A;  4WXH A;  1H0M A;  4Q4Z F;  1KU2 A;  1S7O A;  1FBQ A;  3VEP A;  4IHT A;  3J81 K;  3T8R A;  1IN5 A;  1B9M A;  2EFQ A;  2GWR A;  3O2P E;  4ENN A;  4HW0 A;  2RQP A;  1XSV A;  4YII A;  5BMZ A;  2IA1 A;  3FXQ A;  5J8F A;  2K7L A;  4EQQ A;  4UV9 A;  1JGS A;  3NRV A;  3E6B A;  1BI1 A;  4A6D A;  4LJZ F;  5D5U B;  5JR3 A;  4A0X A;  1MZB A;  2EJR A;  2F5E A;  2RN7 A;  1U5T B;  4CYD A;  1SFU A;  3IKT A;  3JSP A;  2VE8 A;  3DFG A;  2EV5 A;  5HDN A;  2UXN A;  4B09 A;  4AWX B;  3E6D A;  2XAG A;  3QOP A;  2W85 A;  1K79 A;  1ZRD A;  2A3S A;  4IF4 A;  1P6R A;  5E18 F;  3F8C A;  3T0Y A;  3REO A;  2STT A;  1P4X A;  5HS9 A;  2P8T A;  2JT1 A;  2PQ8 A;  4NB5 A;  1ZHF A;  4EV0 A;  1VTN C;  3ZMV A;  4EM2 A;  3ELK A;  3GVA A;  2PLY A;  3I59 A;  4KFC A;  2Y75 A;  3ISP A;  2DK8 A;  1YS6 A;  3WTT C;  1S6L A;  5LHH A;  4LK0 F;  2L02 A;  3ABU A;  1LDK B;  4A6E A;  1TQM A;  2Z9O A;  5LLQ A;  5JI6 A;  1O3T A;  1EH8 A;  2L01 A;  5J6X A;  1P4A A;  1B9N A;  3RPQ A;  3EQL F;  2H27 A;  2VC1 A;  3JW4 A;  5D4R A;  4MEY F;  3WTZ A;  3F6V A;  1JE8 A;  2XAJ A;  3FM5 A;  3KP5 A;  4R79 A;  1Q1H A;  4G7Z F;  2F2E A;  4ZYH A;  4XLN F;  1LB2 A;  5L3E A;  4GYI A;  2F5F A;  5LEJ A;  3G73 A;  1X3U A;  1UHW A;  1HSJ A;  3I4P A;  2CWE A;  3L7W A;  4U0Y A;  5K1Y A;  1QGP A;  2ADU A;  1FNN A;  3ZMS A;  1ODD A;  2DT5 A;  1O3R A;  3RDI A;  1RZ4 A;  3KET A;  4Z2Y A;  4OOI A;  2VOD A;  5EEH A;  4I98 B;  4ESJ A;  1PP8 F;  1IRG A;  5F64 A;  5H20 A;  5AIQ A;  4PGG A;  2P5K A;  1FYL A;  1J0R A;  2W25 A;  4K2E A;  3V7S A;  4G7H F;  3LFK A;  5ERI A;  1R5G A;  1WKM A;  2R7F A;  2K4B A;  1W4M A;  4Y13 A;  3I71 A;  1XB4 A;  2HTS A;  1SFX A;  2VT2 A;  2P4W A;  1HW2 A;  5IT9 K;  5CLS A;  2ZFW A;  2MD5 A;  3F21 A;  5D6F A;  3V4G A;  1XCV A;  1JXS A;  3DXJ F;  1E2X A;  4P96 A;  2R3S A;  5CVI A;  3TKY A;  1ZAR A;  3LST A;  3SZP A;  2KIM A;  4ZZD A;  4BHP A;  2HYG D;  3HSR A;  2Z33 A;  4XRF A;  2MA3 A;  1U8R A;  3U1D A;  1XD7 A;  2ZME B;  5DD8 A;  5DEQ A;  1CF7 A;  1W5S A;  3EYY A;  4M74 A;  5L3G A;  5IT3 A;  4GCV A;  2ZJ2 A;  3B73 A;  2O8X A;  3J81 Z;  2HQN A;  5FFX A;  2K27 A;  4BHB A;  4U7B A;  5BQT A;  3M8E A;  1FLI A;  3K1N A;  1H9T A;  2BE5 F;  1UFM A;  4YFK F;  3KLO A;  5HLI A;  4HLX A;  3CJN A;  2Z3Y A;  4ASN A;  1S3J A;  4CZZ A;  2XRO A;  3BJO A;  4MHG A;  4RGS A;  5E8G A;  3KCC A;  1F5T A;  4P9U A;  3L9F A;  4MQV A;  4OIO F;  1D8J A;  2GA2 A;  2MH9 A;  3I54 A;  1QPM A;  5LGU A;  1J59 A;  3QPT A;  4IJA A;  1OMI A;  3MWM A;  2DU9 A;  4LB5 A;  3V8K A;  4Q5S F;  4M72 A;  4R1H A;  4JQF A;  4ZYE A;  4AD9 A;  2QLZ A;  1QBJ A;  4AIK A;  4IXA A;  3BZ6 A;  3Q9S A;  2QQA A;  3BPV A;  4F7Z A;  1FP1 D;  3RJP A;  4OIR F;  1SD5 A;  3ZP5 A;  5LHI A;  1G6N A;  1ONV A;  3KFW X;  1XMA A;  3IHU A;  1Z05 A;  1BI3 A;  1GHC A;  2OZ6 A;  3F8F A;  2FXA A;  4KUM A;  4HQM A;  4IHS A;  4ETS A;  2AXL A;  4PGH A;  3MFK A;  4JK1 X;  5DUI A;  2V9V A;  3QU6 A;  2H09 A;  2W84 A;  4CIC A;  1FT9 A;  1G3S A;  1MDM B;  2XAS A;  4RGX A;  4EVI A;  3Q5F A;  4RAY A;  4RB0 A;  1FYM A;  1U6G A;  3R6S A;  1S7A A;  3WGG A;  6PAX A;  5CVR A;  2CGP A;  4FX0 A;  3VB2 A;  2DQR A;  3V7C A;  5AON A;  3FXR A;  1YFH A;  4ZYD A;  3W6K B;  1ON1 A;  4XSZ F;  2E1C A;  5E20 A;  4HYE A;  3I5U A;  3TOB A;  3F8N A;  1HW5 A;  1DPU A;  4EMS A;  1OYY A;  3I59 B;  2PFB A;  3C18 A;  3IRR A;  3Q9V A;  2P7C B;  3LAP A;  5JVT A;  1KU9 A;  3HHH A;  1KQ0 A;  1HST A;  2HYF A;  5LGT A;  2KKO A;  5ILS A;  1O57 A;  1SMT A;  3DPL C;  3SHF A;  2OAZ A;  4BQA A;  3BJA A;  2NAZ A;  3FX3 A;  3P9I A;  3IL2 A;  5FLX K;  2X4H A;  3DPT A;  2JZY A;  1FBU A;  3G3Z A;  1Y0U A;  4OMZ A;  1REP C;  2M8E A;  2ELH A;  3E6C C;  2VC0 A;  2IT0 A;  3F3X A;  4FT8 A;  1K7A A;  3QU3 A;  5IT9 Z;  2VE9 A;  4Y15 A;  1FZP B;  1XGS A;  2JRT A;  3PQK A;  1WI9 A;  3BWG A;  1ON2 A;  4KIC A;  3E97 A;  4HF0 A;  4L0Z B;  2QM3 A;  3V8J A;  2FNP A;  1MD0 A;  2HDC A;  2VOO A;  3CLO A;  2P7V B;  4KT5 C;  3H92 A;  1IRF A;  2WWY A;  2EFO A;  3BPX A;  3GWZ A;  3L09 A;  4EGZ A;  1WQ2 A;  1XN7 A;  3HSF A;  4UHT A;  4YIF A;  2KJC A;  3ZN1 A;  4G94 A;  1W7P A;  2RDP A;  4RAZ A;  4FHT A;  1J75 A;  3CUQ B;  5E1W A;  1H9G A;  2D1H A;  3NEU A;  1G3W A;  2KRF A;  4N9I A;  3V8L A;  2XRN A;  1ZYR F;  2QQB A;  1QNT A;  3EUH A;  1MJ9 A;  1JHH A;  4MEX F;  2E1N A;  1ZG5 A;  3HYI A;  2ZXJ A;  1TW3 A;  3BDD A;  2ETH A;  1LEA A;  4KN7 X;  4ESF A;  3KLN A;  4L0Y B;  2XV4 S;  2XGX A;  4ENK A;  4G8X A;  2L3D A;  4IRG A;  2ZCW A;  3HUG A;  1R23 A;  1ZN2 A;  2EB7 A;  4M71 A;  2PMH A;  3F8B A;  2QYO A;  5LEK A;  2HGC A;  1ZH5 A;  4NQW A;  4UVB A;  1HXD A;  1ZG1 A;  2CYY A;  4I01 A;  4QLC U;  3DEU A;  3LA7 A;  1DUX C;  1FSE A;  1MKM A;  2WC2 A;  2DPD A;  1L0O C;  1CF7 B;  1I5Z A;  5CVU A;  4LK1 F;  4L9N A;  4R8H A;  1AOY A;  4A2U A;  1BN5 A;  4HX7 A;  1P4W A;  3K9T A;  1O3S A;  2CSO A;  2XKP A;  1U5T C;  4IPA A;  3ECO A;  3CUO A;  2M30 A;  2FML A;  2YSR A;  3I64 A;  1YW8 A;  2M1B A;  2BGC A;  3F8M A;  3I53 A;  3EDP A;  1J5Y A;  2W24 A;  2JSC A;  4EJT A;  4CGZ A;  1ZAO A;  2IW5 A;  2MH2 A;  4LLG F;  3MCZ A;  1XGO A;  2WV0 A;  5LBQ A;  1XDS A;  3BP8 A;  1K6O A;  2FRH A;  2E7X A;  4AIH A;  1U78 A;  1V4R A;  3PFI A;  2ISY A;  1SD7 A;  2PMU A;  2F5D A;  2L4M A;  1QZZ A;  5D5X B;  1ZRF A;  4N9H A;  3BRO A;  4IRI A;  2BEO A;  2HR3 A;  2LDU A;  1I1G A;  3U9G A;  4LGW A;  1FC3 A;  5ICF A;  3LA3 A;  5HOO A;  2QVO A;  3MQ0 A; 
#chains in the Genus database with same CATH topology
 3OYE A;  1VQ4 I;  4XKV A;  5HNF A;  3I4M J;  4H0E A;  5K7Z A;  2B9S A;  4S0H B;  1A31 A;  5E1Z B;  3IP4 B;  1R58 A;  3IAS 2;  5BOX A;  3GO5 A;  4UUS A;  5M3F J;  1NTC A;  1W1W E;  2VUM J;  3MAJ A;  3CO6 C;  2FQ3 A;  1LE8 B;  1DP7 P;  1FIP A;  1IN4 A;  4IRH A;  3TO6 A;  4BQO A;  5D8K B;  2FU4 A;  5J4V A;  5CVJ A;  1UMQ A;  2DOA A;  3BG6 A;  1LFB A;  2FMY A;  2B7E A;  3AFH A;  3V7R A;  3CCY A;  2CS3 A;  5FLX Z;  4XMY A;  1Z77 A;  3ZMT A;  1XG1 A;  1KGS A;  3DV8 A;  3LA2 A;  2VJJ A;  1PUF A;  1F9N A;  2E36 A;  3K10 A;  3CCM I;  3M9A A;  2CUJ A;  2HWV A;  3KP7 A;  2PI0 A;  4FTH A;  3HOU J;  2EFN A;  2GLO A;  3GBG A;  2K9N A;  4BDZ A;  3PL8 A;  2A68 F;  3C7J A;  2Y0S A;  3R0A A;  1K83 J;  5E1X A;  1BI0 A;  2A6H F;  5LRS A;  2ZNZ A;  3F9K A;  2GQQ A;  2ZSH B;  1Z7U A;  3E0J B;  5F1R A;  3QPH A;  5FKL A;  2XGC A;  2Y9Z A;  3TP3 A;  4B8X A;  4UVA A;  2DMP A;  1TQP A;  2XAH A;  4RAG A;  3IH4 A;  5IOY A;  5FLV A;  1MBH A;  4M3F A;  1YOV B;  2VT3 A;  1IN7 A;  5F0H A;  5LHG A;  2Z16 A;  2QBY A;  2G9W A;  2O6G E;  3DKX A;  1UST A;  4BGD A;  3IUO A;  2LNB A;  2VAS A;  3QYB A;  3WTV C;  2ME6 A;  2OU2 A;  2ME0 A;  3KP6 A;  5EGO A;  2BY0 A;  2IRF G;  1P2F A;  4LD5 A;  1WJB A;  2AQE A;  2DMQ A;  4EM1 A;  1QQI A;  3WTS C;  1WJE A;  1E3O C;  2MFZ A;  4CO8 A;  3LMM A;  2F4M B;  3RYP A;  3ZQF A;  4D0P A;  2ZKZ A;  3CF5 F;  4ENM A;  1JTY A;  3M3Y J;  3OSF A;  3W2A A;  3W6J B;  3DBL B;  4BQN A;  1R22 A;  1F4K A;  2LP0 A;  2ID6 A;  4ESB A;  5E3L A;  2MG4 A;  2BHZ A;  4I0A A;  2DAO A;  2FF4 A;  2O0Y A;  1D1A A;  1GVJ A;  4IVN A;  3S2H J;  1RPW A;  4KMF A;  3ERE D;  5FRN A;  2P81 A;  1Z91 A;  2RGV A;  3KP2 A;  3PUF A;  3FZV A;  3ZQI A;  2WTE A;  4JBA A;  3MKW B;  3CCJ I;  2CV2 A;  1RR8 C;  3E5Q A;  1JKP C;  1WI3 A;  1T56 A;  3WG9 A;  2EBI A;  3T5X A;  2H8R A;  3F6O A;  1IJW C;  5EDN A;  3ZQC A;  3WOD F;  4RM2 A;  2H1L A;  5H6Q A;  2HVS A;  4ZH4 F;  4GDF A;  3T1B A;  4KMU X;  4MTD A;  2EIM H;  1O7L A;  1T0F C;  2FA5 A;  3CCS I;  3RKY A;  1X19 A;  1TWH J;  1R5H A;  1YQA A;  4U7D A;  1XC5 A;  2XUB A;  1R00 A;  3EUK L;  1HKS A;  3HM5 A;  2E7W A;  2HZT A;  3ABT A;  3FXM A;  2JA6 J;  5E8I A;  1U5T A;  2FNA A;  5HS7 A;  5JHF A;  4PJN A;  2KRH A;  1RI7 A;  4WXC A;  3VYR B;  3PQJ A;  1V5G A;  2CUF A;  2QGU A;  3EYI A;  3PNY A;  5B3S H;  1BJA A;  4V19 K;  4XLF A;  4HF2 A;  3J80 K;  3TO7 A;  2A69 F;  4HPQ A;  1AWC A;  2HDW A;  1EH7 A;  4ZDL A;  5HLG A;  2KDZ A;  5ILU A;  2MLK A;  1W7P B;  3C2G A;  1DPR A;  1OCR H;  1YTY A;  3HIF A;  1OCC H;  2EIL H;  2QF7 A;  4M9X A;  1L3L A;  3KZY A;  4X0G A;  2DTR A;  3BLY A;  2LRD A;  1M1E B;  1B4A A;  2A6E F;  3HSE A;  3JTH A;  3LSG A;  3KP3 A;  4ITV A;  5IPA A;  3JTG A;  1YJN I;  3BG5 A;  5L3B A;  5L3C A;  2X85 A;  3G1M A;  1FYK A;  3CCU I;  1X3W B;  2GOM A;  1R9T J;  1B6A A;  5EJC A;  4HBL A;  1O4X A;  3EPZ A;  1QO0 D;  1SD4 A;  2TCT A;  1JUS A;  4M3E A;  2VOP A;  3W2V A;  3OYM A;  2KPM A;  4M6X A;  3D0S A;  4YFN F;  2DI3 A;  2R92 J;  1YX3 A;  1D5Y A;  1LEB A;  3GZN B;  3PO2 J;  3ASN H;  1V5F A;  3WE2 A;  4LB6 B;  4OIQ F;  1EH6 A;  1T8I A;  3HC7 A;  3EUA A;  4E7S A;  1LFU P;  5EG0 B;  3J7Y J;  4I02 A;  2IS4 A;  1UG0 A;  1KA8 A;  3AAF A;  3ZGK A;  2VON A;  3FMR A;  3JSO A;  5IYC J;  2HXI A;  5GPA A;  1MND A;  4IHX A;  1E17 A;  4E70 A;  4XSX F;  3H5A A;  2MAB A;  3HUG B;  3HOT A;  3J7A O;  2P0W A;  3CDH A;  1ZR2 A;  1R1V A;  3WTY C;  1OPC A;  3P7N A;  5EEA A;  2HQR A;  4A5N A;  3HOX J;  4A3K J;  2QKL B;  3O3K A;  4NQW B;  2QSG X;  1RIO H;  4HSR A;  3RYR A;  3OSG A;  4PDK A;  1GT0 C;  1VQL I;  3HRS A;  1ZGJ A;  1HW1 A;  2AXT C;  2LSO A;  5FLM J;  2BV6 A;  3QAH A;  3HZJ A;  3TP0 A;  1W0U A;  4XKC A;  3OR1 C;  2KLO A;  1I6X A;  4MIM A;  2NOG A;  2WY8 Q;  2VBX A;  4G6T B;  1UJ8 A;  3H1C A;  4IOC F;  3GTJ J;  3R60 A;  2X1D A;  3GFM A;  4C3J J;  2E2H J;  1MSE C;  1S29 A;  2LF7 A;  2BVL A;  2YPR A;  1KON A;  4CSW A;  3AG3 H;  2V1D A;  4AID A;  4NUB A;  3JRH A;  3CCL I;  3BOQ A;  4MO7 A;  3R61 A;  3DLA A;  3DBH B;  3PJR A;  4PJJ A;  5FB2 A;  5F0F A;  2ESN A;  3QPL A;  2M7B A;  3K1M A;  2CJJ A;  4UV8 A;  3VWB A;  1MNM C;  3JAM K;  3BTC A;  2ZO4 A;  4RAF A;  3CJR B;  3SYT A;  3PO3 J;  4JX5 A;  2X51 A;  1TW2 A;  3TW6 A;  2P5L C;  2JA7 J;  5J1Y A;  3WGH A;  1YRN B;  1FX7 A;  2XAU A;  1RET A;  3Q3S A;  4F92 B;  1YIJ I;  1RRJ A;  2DXI A;  1GUU A;  3CJT B;  2DFF A;  4HA8 A;  3VSL A;  3G4S I;  3RIR A;  1Z9C A;  1WZ2 A;  3R4K A;  3IWF A;  1D5V A;  1Y56 A;  1LVA A;  2DJN A;  3U21 A;  1Z0X A;  4FAS D;  3FXJ A;  4IX7 A;  1MGT A;  3I56 I;  3TGN A;  2VKV A;  2KIF A;  1FY7 A;  2ZXI A;  4FIS A;  1MH4 A;  1G4D A;  1Z21 A;  4L18 B;  4P55 A;  3OYL A;  4OIP F;  2K3P A;  3UKG A;  3DU6 A;  2EV6 A;  1X1D A;  2FBH A;  1LUJ B;  2L9N A;  4OMY A;  2UWM A;  4XR6 A;  1GLN A;  1T2K A;  4I2O A;  3M1E A;  1T08 B;  2DMU A;  4DBQ A;  2ZSI B;  1X3Z B;  5HLH A;  4J00 A;  2M87 A;  1X2N A;  2GA1 A;  2Y48 A;  4EJW A;  3GME A;  2ZJR F;  1VFC A;  1RUN A;  3KP4 A;  3IWZ A;  3TQN A;  5LRR A;  4HAM A;  3OL3 A;  1TNS A;  3ASO H;  3CO7 C;  2E71 A;  2CQQ A;  3HRU A;  1IW7 F;  2X0L A;  1IN6 A;  4AYB N;  4LFU A;  3FHN A;  3OS2 A;  2R7X A;  3Q0U A;  3DP7 A;  4ZDO A;  1HF0 A;  1GXQ A;  1YJ9 I;  4LIV A;  2ZBK A;  4RLF A;  4E7J A;  4J19 A;  5ICC A;  4DNC A;  1TTY A;  1XDU A;  3MKY B;  2CQK A;  2FBI A;  1KQ8 A;  1BM9 A;  3HHG A;  1Z7L A;  4HF1 A;  1PVE A;  2RQQ A;  1JKO C;  3G2B A;  1EV7 A;  2RKH A;  2A07 F;  2DQL A;  1RNL A;  5LGN A;  1DDN A;  4CXF A;  2LF8 A;  1BJZ A;  3I0T A;  2M0C A;  2HKO A;  1OR7 C;  3HPG A;  1R7J A;  4G9Y A;  3K2A A;  5KHD A;  2X1C A;  2NOJ B;  1A35 A;  4BEH B;  5KNL A;  1SAN A;  1WJF A;  3K4L A;  2P6T A;  2VJ4 A;  1MBF A;  3GFI A;  3VYS B;  2Y30 A;  1JI8 A;  2BXY A;  1Y1V J;  2IGM A;  3KEQ A;  4PUS A;  1YW9 A;  2HDD A;  2HQ5 A;  3P9K A;  3WG7 H;  3H9G A;  4UUS B;  5HS8 A;  1T39 A;  3DQV C;  1T0F A;  2QCO A;  3KEO A;  3CMY A;  3DU5 A;  4WK8 F;  3SJM A;  2BW3 A;  2D1V A;  4HDV A;  3H3U A;  2C6Y A;  2F5V A;  1W7P D;  4BJ6 C;  2HI3 A;  2RVC A;  3WTX C;  5E17 F;  4CZC A;  1W36 C;  3QP5 A;  1FTT A;  5L3F A;  3TL4 X;  3ZRG A;  1HA8 A;  1GV2 A;  1D0Y A;  3HOS A;  5B1A H;  4DW6 A;  2FEZ A;  2EFW A;  1PUF B;  3FMS A;  2HTJ A;  2FOW A;  1ZKG A;  2X1E A;  2HVQ A;  1KYZ A;  2HOS A;  2JJ7 A;  3ZMD A;  2CQN A;  4G6Q A;  3OYN A;  4M6Y A;  4ZZL A;  2YU9 J;  1WGX A;  4HG2 A;  5DM6 F;  1FWZ A;  2IS6 A;  2O7O A;  5JFR A;  2DK5 A;  4D9J A;  2NVX J;  3VYU B;  2FBK A;  3RKX A;  2E19 A;  3LL7 A;  4D5F A;  1U2W A;  4IQJ A;  3VSK A;  3WGI A;  2W1O A;  2RV8 A;  3K69 A;  2MLG A;  1R49 A;  2IJL A;  2CH0 A;  4A3F J;  1Z6R A;  5ED4 A;  2OQR A;  4KIT B;  3B02 A;  2PJR A;  5DDG A;  4ZTJ A;  3S93 A;  3CUQ C;  2QBY B;  2DN0 A;  1KU3 A;  2YX4 A;  1YS7 A;  5EYR A;  3MEX A;  2HFH A;  3A2K A;  3BR3 A;  3WTU C;  2PEX A;  1IUY A;  1LQ1 A;  2XGD A;  4XN0 A;  4DOZ A;  3FIS A;  3P5J A;  4XK4 A;  4BH9 A;  3L00 A;  1TNT A;  4QPO A;  4B1R A;  2L7K A;  5F6F A;  2Z1D A;  1KZH A;  5D5V B;  2VBW A;  1N75 A;  3OYD A;  4GFB A;  3LWF A;  1JHF A;  1IV6 A;  3A4C A;  3W2W A;  4IKF A;  1ZG3 A;  4QIW N;  1BC8 C;  1TT5 B;  1TP4 A;  2EK5 A;  2A61 A;  2VQL A;  3NQO A;  1Q1V A;  2LK2 A;  3RZD J;  3BG3 A;  4MTE A;  5C44 J;  2LC2 A;  3C1D A;  5JLW A;  1FBS A;  4OU0 A;  4E7I A;  4OIN F;  5FGM A;  2JPC A;  2JK3 A;  2D2W A;  5DCM A;  3H9Q A;  2ZNY A;  1SAX A;  2NRA C;  5FD6 A;  5JLX A;  4PFP A;  1U0J A;  3DEW A;  3OV8 A;  4NHJ A;  3ECH A;  3GFL A;  4IOA F;  2BYV E;  3RKW A;  4FE7 A;  4XRS G;  4N4N B;  3TO9 A;  1K78 A;  2GXB A;  3KX2 A;  3M7G A;  2ISZ A;  3CDL A;  1BL0 A;  3RSN A;  2OD5 A;  2MC3 A;  1VQN I;  2JN6 A;  4B44 A;  4AU7 A;  1BIB A;  3E6M A;  5A2Q K;  1QZY A;  5E3M A;  3BR0 A;  3DF8 A;  5KCM A;  3WU2 C;  2XRL A;  5FKO A;  3FXU A;  5F27 A;  1E0E A;  3S2W A;  3GZ6 A;  3H35 A;  1X2M A;  2Q0O A;  5ICG A;  2DOF A;  4BBR J;  2H94 A;  1F1Z A;  4HV6 A;  3CC2 I;  5AIP A;  4CYC A;  2DO7 A;  3GLX A;  3BG9 A;  4U0W A;  2WV1 A;  1MDM A;  1SFE A;  1QU3 A;  2E1O A;  1D1C A;  1XMK A;  2RNJ A;  5J3L A;  4ZDP A;  3VOD A;  2LBF A;  3K4K A;  1JTX A;  3K1P A;  1IRZ A;  2XVC A;  3OIP A;  4D7M A;  1C0W A;  2TDX A;  3J7A Y;  3FXL A;  2O03 A;  1G2H A;  1W5C C;  4B43 A;  3RKQ A;  2HOE A;  3M8J A;  4A0Z A;  3FK6 A;  4S05 A;  2YR2 A;  2K3F A;  3H9J A;  4WWC A;  3PIO F;  2V79 A;  2QEX I;  1MMS A;  5BS6 A;  4F93 B;  3S17 J;  2UZK A;  1FMW A;  1R4N B;  4LIT A;  4A3C J;  3KE2 A;  3R0J A;  4N0B A;  4D5C A;  3HKZ A;  3DKW A;  5TIS C;  4KDP A;  3JRB A;  1WJC A;  2K85 A;  1T38 A;  3IRQ A;  3SZT A;  3MZH A;  1G3T A;  4HZF A;  4AVZ A;  4M6V A;  3JAM Z;  1NHA A;  2NNN A;  1ZEL A;  5ILV A;  1DU6 A;  2VXZ A;  4DYQ A;  1IF1 A;  2OZU A;  2QZ8 A;  3FIW A;  2G0E A;  1KYW A;  4CCK A;  4DGW B;  4BXU A;  2QEN A;  2D45 A;  3H0D A;  1WSU A;  4MGR A;  3LAJ A;  4JOM A;  2BY3 A;  4YG2 F;  3F23 A;  4JX6 A;  3J7Z I;  3TED A;  2LD5 A;  1IAW A;  2MYS A;  1YW7 A;  2ELJ A;  2CQ7 A;  3HB9 A;  4QTR A;  4RB1 A;  2CW0 F;  2W57 A;  5F0C A;  4OAZ A;  3GTG J;  1P7J A;  1ETK A;  2EA4 A;  2XSD C;  2EZK A;  2IA2 A;  2L7M P;  3FKJ A;  4W97 A;  2GIV A;  4HX4 A;  2DBB A;  5FO5 A;  3TW7 A;  3ZOB A;  3IC7 A;  3GFJ A;  4M9S A;  3IV5 A;  1OR7 A;  2QWW A;  3B6C A;  2DW4 A;  1XS9 A;  4J01 A;  5L3D A;  4RB2 C;  5D4S A;  4V2G A;  4HDU A;  2K9S A;  2ZXH A;  2NYX A;  2STW A;  2XPU A;  3LSP A;  1ENH A;  2XC7 A;  5ICE A;  4U88 A;  1OKR A;  3FDY A;  2KFD A;  2IA0 A;  1UB9 A;  2NNY A;  5FFZ A;  4PJ0 C;  3D5R C;  3S3N A;  3E5X A;  2P5V A;  4HV5 A;  2VI6 A;  5J40 A;  2HYJ A;  4I0B A;  4RDU A;  3OY9 A;  2M7A A;  2VQC A;  1WRJ A;  2G7H A;  4OAY A;  5D5W B;  2WAQ N;  3BQY A;  1ZGA A;  3EET A;  4P9F A;  4EJV A;  1PUE E;  4WF2 A;  1QHH D;  5FD5 A;  1YO5 C;  3GF2 A;  1S9H A;  2LKP A;  4BAY A;  2E1M B;  2XPV A;  1I27 A;  4YIR X;  1R6R A;  4MFE A;  4CA0 A;  3WE3 A;  5CJ9 A;  2OA4 A;  3BY6 A;  2Z5U A;  5HDG A;  2LH9 A;  3MMY B;  2Z99 A;  2CUZ A;  2VJ5 A;  2VLA A;  1P9Q C;  3ZQL A;  3DPU A;  2LR8 A;  4PCQ A;  1WWX A;  2Q8K A;  1Y0N A;  3MKL A;  1N25 A;  2DPU A;  3BTL A;  4LG3 A;  3SFZ A;  1ERD A;  2F48 A;  2QA4 I;  4HNU A;  4LG0 A;  1V5E A;  3GEZ A;  4JYK A;  4BHC A;  4U0V A;  3BJ6 A;  2PJP A;  1B1B A;  4EAT A;  1BI2 A;  1TBX A;  5EZH A;  2KIU A;  2DFH A;  1ORK A;  4KN4 X;  3M07 A;  3OOU A;  2CO5 A;  4KIG A;  5HDK A;  1VI0 A;  3CUQ A;  3HDD A;  1YIO A;  3O8H A;  4Q47 A;  1X1B A;  2PG4 A;  3PUB A;  2B63 J;  4BU2 A;  4XNF A;  4BNC A;  4KYW A;  1G8X A;  4V2F A;  4PZJ A;  1HKQ A;  1A6Q A;  4UNO A;  1YLF A;  1IGN A;  1IXC A;  4NC8 A;  2VJI A;  3HTS B;  2JSP A;  2KL4 A;  3DTI A;  2EPF A;  2GXG A;  2O8K A;  5D8L B;  1S8N A;  3QP6 A;  3LSR A;  3P9C A;  1Y39 A;  1A04 A;  4I09 A;  3U2R A;  2UXX A;  1TLH B;  1FOX A;  1IN8 A;  4TV7 A;  3V42 A;  2L4A A;  5HVQ C;  3BR5 A;  2FE3 A;  2EA2 A;  4LLL A;  4PFO A;  3HGG A;  4RGR A;  2R7O A;  2CMP A;  1D8K A;  4D7N A;  1ZRC A;  4XRS A;  3WTW C;  5KAI C;  4UB8 C;  4AVP A;  5J8C A;  1DQU A;  3TOA A;  1ZLK A;  4II3 A;  1FIA A;  4LMY A;  4ON0 A;  2LY2 A;  2DFI A;  3HRM A;  3MVP A;  2IPQ X;  4L5I A;  3JRC A;  2V1X A;  4O5V A;  4E7H A;  2EH3 A;  2NVY J;  1UEL B;  2DTZ A;  3SQN A;  4WX9 A;  3H3Z A;  3IKV A;  4O3M A;  3WU0 A;  1E3P A;  2R7Q A;  1ETQ A;  4I6Z A;  1ZRE A;  2DT7 B;  3S32 A;  4HOB A;  3UR3 C;  5D6E A;  1GXP A;  3TDZ C;  1SVO A;  2IP2 A;  2QUF A;  3GTO J;  1T95 A;  2PBI A;  3GUD A;  2K02 A;  5GPC A;  1YYV A;  2IVM A;  2LYC A;  1NG7 A;  5C3E J;  3TBI A;  1BA5 A;  2M5W A;  1STZ A;  3I3L A;  1FOK A;  3K2Z A;  3HTU A;  3HEF A;  3OWT A;  2BW3 B;  3GCM A;  2L54 A;  3CLQ A;  4GXO A;  2VBY A;  1P92 A;  2DMT A;  4IHV A;  2CU7 A;  2WB1 N;  4Y17 A;  1WJ5 A;  4L9J A;  2ZME C;  3H5N A;  1XCB A;  5IY5 H;  2HNH A;  1IXR C;  2HKX A;  2JTV A;  3OR2 C;  2IGK A;  4EM0 B;  2NS0 A;  1XGN A;  2P6S A;  3OYA A;  4A5M A;  3FMQ A;  5B5E C;  4KIF A;  1ETW A;  2JVH A;  5DV5 A;  4CCN A;  3WU1 B;  3G1O A;  1FPQ A;  5GTH C;  3GTQ J;  4F91 B;  2GAU A;  4UXN A;  3COA C;  2L2O A;  2LRE A;  4AIJ A;  3F22 A;  3T8T A;  2Q2E A;  2DMN A;  2EV0 A;  2A5Y B;  3G1L A;  2K4J A;  2JMW A;  5E3N A;  4RMN A;  5DYM A;  4A0Y A;  3OYC A;  3RI4 A;  1ETV A;  2MC4 A;  2XKO A;  1QHG A;  3K6G A;  4MQ9 F;  5A2Q Z;  2HOT A;  3NAR A;  3QQA A;  3VOE A;  2KJB A;  5DUK A;  4RB3 C;  1FOW A;  4ZYA A;  3JRE A;  4L5J A;  1HKT A;  4HQE A;  3TMO A;  3LSI A;  1HQC A;  4L9T A;  3C3W A;  2DA6 A;  1B8I A;  4G7O F;  3QPS A;  1PYV A;  3LQQ A;  3DLL F;  3CCR I;  1KQ9 A;  5B66 C;  3ZN0 A;  3FF5 A;  5K5Q A;  2COB A;  3FBN B;  3GXO A;  1YE9 A;  2I5U A;  1MMN A;  5FKM A;  1MNE A;  3E5U A;  1A36 A;  3HOY J;  2KIQ A;  3OYF A;  2B0L A;  1BOA A;  5B1B H;  5KK1 A;  3OS1 A;  3HOW J;  3JRD A;  3SFI A;  3L2U A;  2OF7 A;  2Y0M A;  2BXZ A;  1MJB A;  3PNV A;  2O3F A;  4XLA A;  1CGP A;  1IDY A;  4M73 A;  4IZZ A;  1WFX A;  4IL6 C;  3VFZ A;  2Y9Y A;  3BZC A;  3MZY A;  2FSW A;  2A6T A;  5DCM B;  2WAF A;  2XAQ A;  1VQ9 I;  4GO1 A;  1VZ0 A;  1R71 A;  4XLP F;  1KU7 A;  4BYY A;  5J47 A;  5JVG F;  3N97 A;  1RES A;  2EIK H;  2FJ1 A;  3QOE A;  4GGG A;  2UV1 A;  2K9L A;  3CTA A;  3HBL A;  5H6R A;  3OS0 A;  3K70 D;  4A12 A;  4S04 A;  5BPI A;  1K78 B;  1V54 H;  2E5N A;  2M45 A;  1X4P A;  2ID3 A;  3QRF F;  3GYH X;  1A5J A;  2JPB A;  2Y0S N;  3K0L A;  1J2X A;  4DYC A;  4DBR A;  4I99 C;  3ZMU A;  1ETX A;  5DCF A;  3CMA I;  3O8G A;  4C2M J;  1B59 A;  3H36 A;  2VXD A;  4CYC B;  1LE8 A;  1LNW A;  1WH7 A;  5F08 A;  1XGM A;  4CDG A;  3PIP F;  2QQ9 A;  1TQI A;  2FQ4 A;  3ERM A;  2TRT A;  5EEG A;  2XHK A;  2O5R A;  4P5O A;  5H2F C;  2RAE A;  3UNG C;  1R1T A;  2DYS H;  1MBJ A;  1Z6T A;  5J1U A;  5K5R A;  3ZPL A;  4EJO A;  3K4J A;  1HC8 A;  2PMZ A;  2ACJ A;  1BIA A;  2A5W A;  4EJU A;  2RC4 A;  2E60 A;  4RGU A;  3BT9 A;  3CDI A;  4C2T A;  4IHW A;  4U87 A;  4UUV A;  3GW2 A;  4YFX F;  1OYI A;  1WCM J;  5EF6 A;  2CFX A;  1N78 A;  1TWC J;  4HLY A;  2OBP A;  1W5T A;  1IZ1 A;  1VF9 A;  3HRT A;  1X1C A;  2ESH A;  5K5O A;  4BAC A;  3JRA A;  3ML6 A;  1T98 A;  3PSF A;  3RTR A;  1B72 B;  2OTL I;  4KNY A;  3LSM A;  1E3H A;  1U3E M;  2COM A;  3N4M A;  1R1U A;  2W4S A;  3DWL E;  4M9Z A;  4ENJ A;  3SXY A;  3HPH A;  2WA0 A;  3GZ5 A;  1LJ9 A;  2OJE D;  1H88 C;  2W48 A;  4UY8 I;  1ETO A;  2XAF A;  2R7S A;  3E3V A;  2K86 A;  4IHY A;  4WXD A;  3S16 J;  1UHM A;  2J5P A;  3OOP A;  1OLT A;  1ULY A;  2J5O A;  2CV0 A;  3KZZ A;  5C4X J;  2LVS A;  1RR7 A;  1XSX A;  1O7F A;  1D3Y A;  1BC7 C;  4GYG A;  2V9K A;  2LG4 A;  4UVC A;  3RPU A;  1OYW A;  3GX4 X;  4KIB A;  2FOK A;  3IAM 2;  4QSH A;  1USS A;  3FHZ A;  2GZW A;  1VQP I;  1Z1D A;  2QQ8 A;  1SVL A;  2EFP A;  2YX7 A;  5IOZ A;  1ZQ3 P;  4NBQ A;  1I6H J;  1PDN C;  2JUC A;  1WPK A;  3VYT B;  2LMD A;  3I58 A;  3LSH A;  2XIG A;  2AS5 F;  5M5W J;  2VIX A;  2V6C A;  2UUZ A;  4QWQ A;  2LKX A;  2LFB A;  3A0H C;  4DQ2 A;  2YU3 A;  5CVV A;  1I50 J;  2G7U A;  3LQR A;  5HOD A;  1SFO J;  2BY2 A;  3QWL A;  2RNG A;  3A03 A;  3DEE A;  2KZG A;  3BR2 A;  5BPD A;  2PX9 A;  1MJA A;  2DDB A;  4XBF A;  4HX8 A;  3ONQ A;  1G3Y A;  2EWN A;  3WHB A;  4O6J A;  2V1U A;  1FSH A;  5CKT A;  1IXS B;  1XSD A;  2MBF A;  3HJE A;  3TDU C;  2ZME A;  3K4C A;  1XPX A;  4I76 A;  1QA6 A;  1GV5 A;  2QKM B;  1UCR A;  4XM3 A;  3L2Q A;  1HOM A;  1J09 A;  3ZMZ A;  1O3Q A;  4FX4 A;  3NAU A;  2L7Z A;  3OL4 A;  1R36 A;  3O6B B;  1SD6 A;  1ZLJ A;  4I7H A;  2MD0 A;  4BXX J;  2PN6 A;  3N05 A;  3A0B C;  4C9Y A;  2OQG A;  1EJ9 A;  4EGY A;  2O61 A;  5CYV A;  2ZFU A;  3E7L A;  2CG4 A;  4Y7N J;  1I1S A;  1V3F A;  3LFU A;  2VN2 A;  2HS5 A;  5TRD A;  3FM3 A;  2DLL A;  1IC8 A;  2V7F A;  3FWE A;  3K4M A;  4A69 C;  1BBY A;  1BR2 A;  2W00 A;  5TJJ A;  4E6K G;  3BTJ A;  1LDD A;  2NS7 A;  3ULQ B;  3WHC A;  4LG0 B;  2E2J J;  1YG2 A;  2H6B A;  2OV7 A;  3D5L A;  5KVR A;  3CCE I;  3F72 A;  4B3A A;  2EZI A;  4CHU A;  2DYR H;  1DGR M;  5JHU A;  1RUO A;  2LY1 A;  5J4Y A;  1HBX G;  4LLN A;  1ITY A;  2BBY A;  2DDA A;  4KJZ A;  4Q48 A;  4YRV A;  2KMU A;  1J9I A;  2V6E A;  1S7E A;  4AC0 A;  3BG7 A;  4C2U A;  2HEO A;  3OYI A;  3L2C A;  3ROU A;  2MGQ A;  1LDJ A;  4DYR A;  1PP7 U;  4RS8 A;  1WHU A;  2DA1 A;  1XX5 A;  2XPW A;  2VPL A;  2R7D A;  1FP2 A;  1BOB A;  2F5C A;  2M0M A;  1WJA A;  1SC7 A;  1SMY F;  2H6C A;  4ZYG A;  5EGO B;  4MFD A;  2OPT A;  2VBZ A;  2E2I J;  4L9V A;  1T6S A;  3J80 Z;  3JR9 A;  4PSX A;  2FX0 A;  3C2B A;  4MNU A;  1J7K A;  4KA4 A;  5DD4 A;  3ZQ7 A;  5FRO A;  4HNT A;  5LFA A;  4G6D A;  4WCG A;  5M3M J;  3M8F A;  5GAG J;  1GVD A;  4WXH A;  1H0M A;  4Q4Z F;  1KU2 A;  1S7O A;  1FBQ A;  2DOE A;  3VEP A;  3AL0 B;  4IHT A;  1TWA J;  3J81 K;  3T8R A;  1IN5 A;  3HG9 A;  1B9M A;  2X6O A;  2W7N A;  4XON A;  2JUG A;  4XQF A;  2EFQ A;  2GWR A;  3O2P E;  1BW5 A;  4BKX A;  2WAE A;  4ENN A;  2CW8 A;  4PK4 A;  4HW0 A;  3CC7 I;  2RQP A;  1XSV A;  4YII A;  5BMZ A;  2NS8 A;  1FMV A;  2IA1 A;  2VKD A;  3HGY A;  1MSF C;  3FXQ A;  5J8F A;  2K7L A;  1I3Q J;  4EQQ A;  1DU0 A;  4UV9 A;  9ANT A;  2DFE A;  1IDZ A;  5EZG A;  5IP9 J;  1JGS A;  3NRV A;  2XGE A;  4E7Z A;  3E6B A;  1BI1 A;  4A6D A;  2EZL A;  4PSW A;  4LJZ F;  5D5U B;  5JR3 A;  1MZB A;  2EJR A;  2RN7 A;  2F5E A;  4A0X A;  1U5T B;  4CYD A;  3ABM H;  1SFU A;  5GP9 A;  3IKT A;  3JSP A;  1GDT A;  1JT6 A;  2VE8 A;  3DFG A;  1D0X A;  2EV5 A;  5HDN A;  2GBY A;  2L9V A;  2UXN A;  2CV1 A;  4B09 A;  4AWX B;  1X1P A;  3E6D A;  2XAG A;  3CME I;  1LKX A;  3KPH A;  4II2 A;  3QOP A;  2JVG A;  4AUX A;  2W85 A;  1K79 A;  1U9O A;  1ZRD A;  2LTP A;  2OUM A;  1PJR A;  4DIQ A;  2A3S A;  2Q2E B;  4IF4 A;  2QSH X;  2VQG A;  1P6R A;  5E18 F;  3F8C A;  3T0Y A;  3SDG A;  1QZE A;  3REO A;  1OJL A;  3LOC A;  2STT A;  1P4X A;  1DP3 A;  4BUP A;  3OIQ A;  5HS9 A;  4L5E A;  2P8T A;  2JT1 A;  2PQ8 A;  4NB5 A;  3M4O J;  4XOP A;  2Y69 H;  1ZHF A;  4EV0 A;  1VTN C;  3C2H A;  2Y2Z A;  1VQO I;  3ZMV A;  4EM2 A;  3ABL H;  3B6A A;  3K4N A;  3ELK A;  3GVA A;  2PLY A;  3I59 A;  4XKW A;  4Y52 J;  3KYL A;  1B8I B;  4KFC A;  4A3G J;  2HPI A;  3BCB A;  3PNT A;  2Y75 A;  1VQK I;  3ISP A;  4QPQ A;  1HCR A;  1K6Y A;  1YS6 A;  2DK8 A;  3WTT C;  1S6L A;  2HPM A;  5LHH A;  3FKI J;  4LK0 F;  2L02 A;  3ABU A;  5C4J J;  1LDK B;  2K9Q A;  1TQM A;  4A6E A;  2Z9O A;  3RQI A;  2VL8 A;  2K9M A;  5LLQ A;  5JI6 A;  3ZXS A;  1O3T A;  1EH8 A;  2L01 A;  2E35 A;  2FUG 2;  5J6X A;  1P4A A;  1B9N A;  3JRG A;  1MH3 A;  3RPQ A;  1EA3 A;  1QVT A;  4NC7 A;  2DOD A;  3EQL F;  2BY1 A;  2H27 A;  2N8G A;  2IS2 A;  2VC1 A;  2M8G X;  1JUM A;  3JW4 A;  1YIT I;  3FBI B;  2VKH A;  5D4R A;  4MEY F;  3S2D J;  3SEQ A;  3WTZ A;  1OCT C;  3F6V A;  1JE8 A;  2EQR A;  1I3A A;  2XAJ A;  3FM5 A;  1OCO H;  3AG4 H;  2KQR A;  2HVR A;  1ZGW A;  4B4C A;  1JJ8 C;  2M9H A;  3KP5 A;  3S8P A;  3ZQQ A;  4ABZ A;  4R79 A;  1U9N A;  1Q1H A;  2V4J C;  4RLQ A;  4G7Z F;  2F2E A;  2L5Q A;  1XTA A;  4Z6Y A;  4ZYH A;  4XLN F;  4AM3 A;  1LB2 A;  5L3E A;  3D1N I;  2X9D A;  4XRM A;  2D5V A;  4GYI A;  2DA2 A;  2F5F A;  5LEJ A;  3MD2 A;  3G73 A;  1X3U A;  1UHW A;  4BL0 B;  4GRI A;  1HSJ A;  3I4P A;  5GAD J;  3BQZ A;  1HDP A;  3A02 A;  2CWE A;  3L7W A;  3L1P A;  4NDL A;  2VB6 A;  4U0Y A;  4BE0 A;  5K1Y A;  1MBK A;  1QGP A;  2ADU A;  4XN3 A;  4KIS A;  1FNN A;  4XLE A;  1SAU A;  3ZMS A;  4M3D A;  1X58 A;  1ODD A;  2DT5 A;  4A3B J;  3I55 I;  1O3R A;  3QYE A;  2E1M C;  2O9L A;  3RDI A;  1RZ4 A;  1OFC X;  4Z2Y A;  1OCZ H;  3KET A;  4OOI A;  2VOD A;  1RKW A;  4IEJ A;  5EEH A;  4I98 B;  3PM1 A;  2KT0 A;  5FKK A;  3HL2 A;  4D1Q A;  4ESJ A;  1PP8 F;  3K70 C;  1Z67 A;  1IRG A;  5F64 A;  2GXA A;  5H20 A;  5AIQ A;  3ABK H;  4PGG A;  2P5K A;  1FYL A;  3CZ6 A;  5TGT A;  4A3J J;  1J0R A;  4LIU A;  2W25 A;  1NK3 P;  4K2E A;  1ZR4 A;  3V7S A;  4G7H F;  1Y6I A;  3LFK A;  1QVU A;  1W0T A;  1UZC A;  5ERI A;  1R5G A;  1WKM A;  4Y3O A;  2R7F A;  3L2V A;  2K4B A;  2VKE A;  2R5Y A;  2DA4 A;  1D1B A;  3CJQ B;  1W4M A;  4Y13 A;  3I71 A;  1XB4 A;  2HTS A;  2R7R A;  4OWR B;  2XB5 A;  1AU7 A;  1VQ8 I;  1SEU A;  1SFX A;  2VT2 A;  3SZG A;  4FCY A;  2CW7 A;  2P4W A;  4XLH A;  1VQ7 I;  2XB0 X;  3GTM J;  1IUF A;  1HW2 A;  3G6E I;  4CCJ A;  5IT9 K;  3RQ4 A;  5DS9 A;  5CLS A;  2ZFW A;  4P1W A;  1FEX A;  1R5I D;  2M4G A;  1I39 A;  3OYK A;  2MD5 A;  1FJL A;  3CCQ I;  4UB6 C;  4BE2 A;  1TWG J;  1K4T A;  1VQ6 I;  3F21 A;  5D6F A;  2AO9 A;  2IEK A;  4HRI A;  3MKZ A;  3V4G A;  1XCV A;  1JXS A;  3DXJ F;  1S72 I;  1OQY A;  1AHD P;  3HOV J;  1E2X A;  4P96 A;  4A3M J;  2R3S A;  5CVI A;  1RC9 A;  2RRE A;  3DTK A;  3TKY A;  1ZAR A;  3LST A;  1S5L C;  3KEY A;  1OCP A;  4H4K C;  2KZV A;  3PSI A;  2M3A A;  2V1N A;  3SZP A;  2V9P A;  2KIM A;  4BS9 A;  1SVM A;  4ZZD A;  3AKZ A;  2M34 A;  4BHP A;  4AYB A;  1APL C;  4W1U A;  2YS9 A;  5IP7 J;  2HYG D;  3HSR A;  2Z33 A;  2X6W A;  4XRF A;  4LOC A;  2MA3 A;  4XLC A;  1U8R A;  4G12 A;  2ZJQ F;  3U1D A;  1XD7 A;  2ZME B;  2IAI A;  2R5Z A;  3CMM A;  5DD8 A;  4XIC A;  4NC6 A;  5DEQ A;  3CC4 I;  1CF7 A;  1V55 H;  1W5S A;  2DJI A;  3EYY A;  4M74 A;  4DZP A;  1NK2 P;  2JQ7 A;  3GTK J;  5L3G A;  1ZTR A;  2MSY A;  5IT3 A;  1R4M B;  2DA3 A;  4GCV A;  2ZJ2 A;  3B73 A;  3L2W A;  3W6V A;  2O8X A;  2GM4 A;  3J81 Z;  2VPR A;  2HQN A;  3HKZ N;  2K27 A;  5FFX A;  4BHB A;  1P7I A;  2GOX B;  4U7B A;  5BQT A;  3M8E A;  1WH5 A;  1FLI A;  3K1N A;  1H9T A;  2F4O B;  2R0Q C;  2BE5 F;  4DZJ A;  1UFM A;  4YFK F;  1MBG A;  2R4G A;  4A3L J;  3KLO A;  5HLI A;  5DM7 F;  4HLX A;  5IYB J;  3CJN A;  2Z3Y A;  4B47 A;  4ASN A;  1MMD A;  1S3J A;  4CZZ A;  3W3C A;  2XRO A;  3JRF A;  5CPR B;  4B3X A;  3BJO A;  5FJ8 J;  4MHG A;  4RGS A;  5E8G A;  3ZCO A;  3KCC A;  4BY7 J;  1LPQ A;  2NVQ J;  1F5T A;  4HNV A;  2PJR B;  4P9U A;  3QOD A;  3L9F A;  4MQV A;  3A01 A;  1VND A;  5FKN A;  4OIO F;  1D8J A;  2GA2 A;  2MH9 A;  3I54 A;  3M1C A;  3VDX A;  1QPM A;  1LVK A;  2DA7 A;  5LGU A;  1J59 A;  3QPT A;  4IJA A;  1OMI A;  3G71 I;  3MWM A;  4CCL A;  3S15 J;  2DU9 A;  5F1J A;  4PJL A;  4LB5 A;  4UUT A;  3V8K A;  2OCC H;  1WVR A;  1MMA A;  4Y33 A;  3K4B A;  4Q5S F;  4M72 A;  3EUH C;  4R1H A;  3KYD B;  4JQF A;  4X1E A;  5E3O A;  4ZYE A;  4XL9 A;  1AKH A;  4AD9 A;  4M3G A;  2QLZ A;  1QBJ A;  1EF4 A;  4CCM A;  2ZJP F;  4AIK A;  4IXA A;  1CQT A;  3BZ6 A;  5DTD A;  4B48 A;  3OYJ A;  3Q9S A;  5KAF C;  3IH2 A;  2QQA A;  2LLK A;  3BPV A;  4ZC3 A;  4F7Z A;  1FP1 D;  3RJP A;  4OIR F;  3PFY A;  2XSJ C;  1SD5 A;  3ZP5 A;  4RBO A;  5LHI A;  3BC8 A;  1G6N A;  4N4O B;  5HLT A;  4M3B A;  2R7W A;  1ONV A;  3KFW X;  1XMA A;  3IHU A;  1Z05 A;  3OIO A;  1BI3 A;  4KT6 A;  1IV8 A;  3H3V K;  1GHC A;  3Q0W A;  1VQ5 I;  3BR6 A;  3NWT A;  2OZ6 A;  3F8F A;  5M5X J;  1FTZ A;  4ANJ A;  2FXA A;  4KUM A;  4HQM A;  4IHS A;  2HQA A;  3LNQ A;  4ETS A;  3CD6 I;  1MBE A;  2AXL A;  4PGH A;  3MFK A;  3FXO A;  4JK1 X;  5DUI A;  2V9V A;  3DKY A;  2BZT A;  1U8B A;  1TC3 C;  3QU6 A;  2H09 A;  2JA5 J;  2W84 A;  3FK7 A;  3GLL A;  3LSK A;  4CIC A;  4FE4 A;  4IQ4 A;  5K7H A;  3H0G J;  1FT9 A;  1G3S A;  3Q0V A;  2XAS A;  2AHQ A;  3I9V 2;  1MDM B;  4RGX A;  3ZQG A;  4EVI A;  3SEZ A;  4C30 A;  4RAY A;  3Q5F A;  2NVT J;  1UG2 A;  3S14 J;  2LBF B;  3D5S C;  4RB0 A;  3SDB A;  3KZI C;  1FYM A;  1U6G A;  3R6S A;  1S7A A;  2K40 A;  3WGG A;  6PAX A;  5CVR A;  1Z3Y A;  1Z3X A;  3OYG A;  2CGP A;  4F55 A;  4FX0 A;  3VB2 A;  3CP2 A;  2DQR A;  3V7C A;  5AON A;  3FXR A;  1TZL A;  1YFH A;  4ZYD A;  3W6K B;  1ON1 A;  1H89 C;  4XSZ F;  2E1C A;  5E20 A;  1RKT A;  4HST A;  2EIN H;  4HYE A;  1F43 A;  3I5U A;  3TOB A;  1ZK8 A;  3ESW B;  2DCE A;  3F8N A;  1K61 A;  3CCV I;  1MW7 A;  1HW5 A;  3RPU D;  4DJA A;  1DPU A;  5HNH A;  1EKE A;  1UHS A;  4EMS A;  3RZO J;  1OYY A;  2OCE A;  5M5Y J;  3I59 B;  2IS1 A;  3OYB A;  3AG1 H;  1FOY A;  2PFB A;  3C18 A;  5GTI C;  3IRR A;  1SFK A;  4EEF G;  2DA5 A;  3S3O A;  2XF7 A;  3Q9V A;  2P7C B;  2CQX A;  4JP0 A;  3LAP A;  5JVT A;  1KU9 A;  1A6I A;  3KYC B;  2EZH A;  3HHH A;  1KQ0 A;  3NWS A;  2F4I A;  1HST A;  2HYF A;  5LGT A;  2KKO A;  3DBR B;  5ILS A;  1O57 A;  1SMT A;  3DPL C;  3SHF A;  2OAZ A;  2DT6 A;  4BQA A;  2X6Y A;  4RA2 A;  3BJA A;  5IP6 A;  4RM3 A;  2W82 A;  3ZR8 X;  2NAZ A;  3FX3 A;  2NVU B;  3P9I A;  4A93 J;  1ACI A;  2WBM A;  3IL2 A;  2VQH A;  2L7F P;  5FLX K;  4E7L A;  2X4H A;  2Y31 A;  3LSJ A;  1YJW I;  3DPT A;  1JUP A;  1H8A C;  2JZY A;  1MMG A;  1FBU A;  3G3Z A;  1Y0U A;  4BJ5 C;  2L9R A;  1OIS A;  2CUE A;  2R7Z J;  2HU9 A;  1POG A;  4OMZ A;  1REP C;  2IBD A;  3F0C A;  3OYH A;  2Z2S B;  2M8E A;  2ELH A;  3DTE A;  4E7K A;  3E6C C;  4IO9 F;  4BXF A;  2VC0 A;  2IT0 A;  3F3X A;  2I10 A;  3I4N J;  4FT8 A;  1K7A A;  4C3H J;  3QU3 A;  4FQG A;  5IT9 Z;  4BQQ A;  2VE9 A;  3E1S A;  4Y15 A;  3X2Q H;  1XGS A;  1FZP B;  3MZ8 A;  2JRT A;  3K7A J;  5E79 C;  2OTJ I;  3PQK A;  1WI9 A;  3BWG A;  1ON2 A;  4MLO A;  4KIC A;  3E97 A;  3ZQH A;  4ZJZ A;  2ECC A;  2ZC2 A;  4HF0 A;  4L0Z B;  2QM3 A;  3V8J A;  1JKQ C;  2WY7 Q;  4BJT A;  2FNP A;  1MD0 A;  2WAD A;  2ZB9 A;  2HDC A;  2VOO A;  3CLO A;  2P7V B;  4KT5 C;  3H92 A;  1IRF A;  2WWY A;  2EFO A;  3BPX A;  3QYF A;  3S1R J;  3GWZ A;  3L09 A;  4EGZ A;  3BZK A;  1WQ2 A;  3DCF A;  1TL8 A;  1XN7 A;  2KP6 A;  3S3M A;  2M2E A;  3HSF A;  4UHT A;  1D0Z A;  4YIF A;  2KJC A;  3L2R A;  2K5C A;  3BTI A;  3RCO A;  4BDY A;  5FRM A;  4FET A;  1NG6 A;  3ZN1 A;  4G94 A;  1T33 A;  4CH7 A;  1W7P A;  2RDP A;  4RAZ A;  3CP8 A;  4FHT A;  4BE1 A;  3HOZ J;  1J75 A;  3CES A;  3CUQ B;  2WAQ A;  5E1W A;  1X4O A;  2YUS A;  1H9G A;  2NXN B;  2D1H A;  1Y1W J;  2A05 A;  3NEU A;  1G3W A;  2KRF A;  4N9I A;  2ECB A;  1JGG A;  2X6X A;  2BHY A;  3V8L A;  2R5Y B;  4ZTF A;  5CQG A;  2XRN A;  1JKR C;  1NH3 A;  1F36 A;  4YEJ A;  1ZYR F;  3VPR A;  1IO2 A;  1QNT A;  2QQB A;  2R93 J;  1HLV A;  3EUH A;  2H1K A;  1MJ9 A;  1JHH A;  1TT0 A;  4MEX F;  2E1N A;  2FD5 A;  1ZG5 A;  3HYI A;  1XMX A;  2KRC A;  2ZXJ A;  2R7V A;  1TW3 A;  3BDD A;  2IGO A;  5GAE J;  2OC6 A;  2ETH A;  1LEA A;  4KN7 X;  4ESF A;  3KLN A;  2KDO A;  4E4H A;  4L0Y B;  2XV4 S;  4A3D J;  5EG0 A;  1Y8R B;  5IYD J;  2XGX A;  1X1A A;  4ENK A;  2BVM A;  2QSF X;  2E34 A;  2XF6 A;  4G8X A;  2IXS A;  2L3D A;  2I8D A;  4BBS J;  4C3I J;  2EIJ H;  4IRG A;  2MW8 A;  2ZCW A;  2LY9 A;  3AL0 C;  1ETY A;  3HUG A;  1R23 A;  1ZN2 A;  2EB7 A;  4M71 A;  5LD2 C;  5K7F A;  2PMH A;  3F8B A;  4HEA 2;  2PMZ N;  2QYO A;  2HGC A;  5GAH J;  5LEK A;  1ZH5 A;  3JCU C;  2IGN A;  4NQW A;  4CUG A;  4BY1 J;  4UVB A;  1HXD A;  1ZG1 A;  2CYY A;  4I01 A;  4QLC U;  3DEU A;  3LA7 A;  3BCA A;  2CRG A;  1DUX C;  1FSE A;  4CCO A;  1MKM A;  3CQZ J;  3IH3 A;  2HZD A;  2WC2 A;  4NNJ A;  2R5Z B;  2HXO A;  1YHQ I;  2DPD A;  1L0O C;  1CF7 B;  3H5R A;  3OMY A;  1I5Z A;  5CVU A;  4XOR A;  4LK1 F;  4L9N A;  4R8H A;  1AOY A;  4A2U A;  3S1Q J;  3KIO A;  3JRI A;  2ICW G;  3GTL J;  1BN5 A;  4HX7 A;  5J1R A;  1JT0 A;  3CF2 A;  1P4W A;  3K9T A;  1O3S A;  2CSO A;  2R7T A;  2XKP A;  1U5T C;  4IPA A;  2H8W A;  3ECO A;  3CUO A;  2M30 A;  1HDD C;  3MN2 A;  2FML A;  2YSR A;  3I64 A;  1WJD A;  5BNG A;  1YW8 A;  1UAA A;  4Y4R A;  3S1M J;  1YRN A;  5F04 A;  2M1B A;  3HXL A;  2BGC A;  3F8M A;  1YI2 I;  3I53 A;  2CFO A;  3EDP A;  4PJM A;  1Y8Q B;  2BOL A;  5CQE A;  4F3Q A;  1QRY A;  1J5Y A;  2ELK A;  2JSC A;  2LKS A;  2W24 A;  4EJT A;  2JWT A;  4CGZ A;  1K4S A;  2R7U A;  3FXK A;  2WB1 A;  1ZAO A;  2IW5 A;  4XOT A;  3A01 B;  2MH2 A;  4LLG F;  1QPI A;  2JA2 A;  3MCZ A;  1XGO A;  3AG2 H;  2WV0 A;  5LBQ A;  1XDS A;  3BP8 A;  4A3E J;  1N77 A;  4X6A J;  2XF5 A;  2L9S A;  2M4K A;  1K6O A;  2FRH A;  1IG7 A;  1B72 A;  2E7X A;  4AIH A;  1JJ6 C;  1U78 A;  1V4R A;  3PFI A;  2LOO A;  2E5Z A;  2ISY A;  1SD7 A;  2Q1Z B;  3U1K A;  2ZXW H;  1IRX A;  1AKH B;  1VQM I;  4JX4 A;  2PMU A;  2F5D A;  2V26 A;  2JRM A;  2L4M A;  4A3I J;  2L0K A;  1QZZ A;  5D5X B;  4XKB A;  1BR1 A;  4YEL A;  1ZRF A;  1AA7 A;  2KIS A;  4N9H A;  3BRO A;  4IRI A;  1BW6 A;  3S1N J;  3A1Y A;  1LFP A;  2BEO A;  1W36 D;  2HOA A;  2HR3 A;  2LDU A;  4F52 A;  1I1G A;  3U9G A;  4LGW A;  1G59 A;  2X48 A;  1BR4 A;  4XID A;  1TWF J;  1DGW Y;  1FC3 A;  5ICF A;  3LA3 A;  2AQF A;  2JA8 J;  2GIZ A;  2F6C A;  1MIJ A;  2KHM A;  5HOO A;  2XDV A;  2QVO A;  4BEH A;  3GTP J;  3BR1 A;  1YX5 A;  3MQ0 A; 
#chains in the Genus database with same CATH homology
 4H0E A;  5E1Z B;  1R58 A;  5BOX A;  3GO5 A;  3MAJ A;  3CO6 C;  2FQ3 A;  1DP7 P;  4IRH A;  1IN4 A;  3TO6 A;  5D8K B;  2FU4 A;  5CVJ A;  2FMY A;  3V7R A;  5FLX Z;  3ZMT A;  1KGS A;  3DV8 A;  3LA2 A;  1F9N A;  3M9A A;  2HWV A;  3KP7 A;  2PI0 A;  2EFN A;  2A68 F;  3C7J A;  3R0A A;  5E1X A;  1BI0 A;  2A6H F;  5LRS A;  2ZNZ A;  2GQQ A;  1Z7U A;  5F1R A;  3QPH A;  4B8X A;  4UVA A;  1TQP A;  2XAH A;  2VT3 A;  1IN7 A;  5LHG A;  2QBY A;  2G9W A;  2O6G E;  1UST A;  2LNB A;  3WTV C;  2OU2 A;  3KP6 A;  2IRF G;  1P2F A;  4LD5 A;  4EM1 A;  1QQI A;  3WTS C;  4CO8 A;  3RYP A;  4D0P A;  2ZKZ A;  4ENM A;  3W6J B;  1R22 A;  1F4K A;  4ESB A;  4I0A A;  2DAO A;  2FF4 A;  2O0Y A;  1GVJ A;  4IVN A;  4KMF A;  3ERE D;  1Z91 A;  2RGV A;  3KP2 A;  3FZV A;  2WTE A;  4JBA A;  3E5Q A;  3WG9 A;  3T5X A;  3F6O A;  3WOD F;  5H6Q A;  4ZH4 F;  3T1B A;  4KMU X;  4MTD A;  1O7L A;  2FA5 A;  3RKY A;  1R5H A;  1YQA A;  4U7D A;  2XUB A;  1R00 A;  1HKS A;  2E7W A;  2HZT A;  3ABT A;  5E8I A;  1U5T A;  2FNA A;  5HS7 A;  1RI7 A;  4WXC A;  3PQJ A;  3EYI A;  1BJA A;  4HF2 A;  3J80 K;  3TO7 A;  2A69 F;  1AWC A;  1EH7 A;  5HLG A;  5ILU A;  2MLK A;  1W7P B;  1DPR A;  1YTY A;  3HIF A;  4M9X A;  1L3L A;  3KZY A;  2DTR A;  1B4A A;  2A6E F;  3HSE A;  3JTH A;  3KP3 A;  3JTG A;  5L3B A;  5L3C A;  1FYK A;  1B6A A;  4HBL A;  1QO0 D;  1SD4 A;  2VOP A;  4M6X A;  3D0S A;  4YFN F;  2DI3 A;  1LEB A;  3WE2 A;  4LB6 B;  4OIQ F;  1EH6 A;  4I02 A;  1KA8 A;  3AAF A;  2VON A;  3FMR A;  3JSO A;  1E17 A;  4E70 A;  4XSX F;  3J7A O;  3HOT A;  3CDH A;  1R1V A;  3WTY C;  1OPC A;  3P7N A;  2HQR A;  4A5N A;  3O3K A;  1RIO H;  3RYR A;  4PDK A;  3HRS A;  1ZGJ A;  1HW1 A;  2LSO A;  2BV6 A;  3QAH A;  1I6X A;  2VBX A;  3R60 A;  3GFM A;  1S29 A;  2LF7 A;  2YPR A;  2V1D A;  3BOQ A;  3R61 A;  5FB2 A;  2ESN A;  3K1M A;  4UV8 A;  3JAM K;  2ZO4 A;  1TW2 A;  2P5L C;  3WGH A;  1FX7 A;  4HA8 A;  3RIR A;  1Z9C A;  3R4K A;  3IWF A;  1D5V A;  1LVA A;  1MGT A;  3TGN A;  2KIF A;  1FY7 A;  1G4D A;  4L18 B;  4P55 A;  4OIP F;  2EV6 A;  2FBH A;  4OMY A;  2UWM A;  4I2O A;  1T2K A;  3M1E A;  5HLH A;  2M87 A;  2GA1 A;  2Y48 A;  4EJW A;  1RUN A;  3KP4 A;  3IWZ A;  3TQN A;  5LRR A;  4HAM A;  1TNS A;  3CO7 C;  3HRU A;  1IW7 F;  2X0L A;  1IN6 A;  4LFU A;  3DP7 A;  1GXQ A;  2ZBK A;  5ICC A;  4DNC A;  1TTY A;  1XDU A;  2CQK A;  2FBI A;  1KQ8 A;  1BM9 A;  3HHG A;  4HF1 A;  1EV7 A;  2RKH A;  2A07 F;  2DQL A;  1RNL A;  5LGN A;  1DDN A;  4CXF A;  2LF8 A;  3I0T A;  2HKO A;  3ZPL A;  1R7J A;  4G9Y A;  2P6T A;  3GFI A;  3KEQ A;  1YW9 A;  3P9K A;  1T39 A;  5HS8 A;  3DQV C;  1T0F A;  3KEO A;  4WK8 F;  2D1V A;  4HDV A;  3H3U A;  2C6Y A;  1W7P D;  5E17 F;  2RVC A;  3WTX C;  3QP5 A;  5L3F A;  3HOS A;  2FEZ A;  2EFW A;  3FMS A;  2HTJ A;  1KYZ A;  3ZMD A;  4G6Q A;  4M6Y A;  4ZZL A;  1FWZ A;  5JFR A;  2DK5 A;  2FBK A;  3RKX A;  1U2W A;  3WGI A;  2RV8 A;  3K69 A;  2MLG A;  2IJL A;  1Z6R A;  5ED4 A;  2OQR A;  3B02 A;  5DDG A;  3CUQ C;  2QBY B;  1KU3 A;  2YX4 A;  1YS7 A;  3MEX A;  2HFH A;  3WTU C;  2PEX A;  1IUY A;  1LQ1 A;  4BH9 A;  3L00 A;  1TNT A;  5F6F A;  5D5V B;  2VBW A;  3LWF A;  1JHF A;  1ZG3 A;  1BC8 C;  2EK5 A;  3NQO A;  2A61 A;  4MTE A;  3C1D A;  1FBS A;  4OU0 A;  4OIN F;  5FGM A;  2JPC A;  2D2W A;  5DCM A;  2ZNY A;  1SAX A;  2NRA C;  5FD6 A;  3OV8 A;  4NHJ A;  3ECH A;  3GFL A;  2BYV E;  3RKW A;  3TO9 A;  1K78 A;  2GXB A;  3M7G A;  2ISZ A;  2OD5 A;  2MC3 A;  1BIB A;  3E6M A;  5A2Q K;  1QZY A;  3DF8 A;  3FXU A;  3S2W A;  3GZ6 A;  5ICG A;  2Q0O A;  2H94 A;  1F1Z A;  4HV6 A;  5AIP A;  2DO7 A;  3GLX A;  4U0W A;  1MDM A;  1SFE A;  1XMK A;  2RNJ A;  3VOD A;  3K1P A;  2XVC A;  1C0W A;  2TDX A;  2O03 A;  2HOE A;  4A0Z A;  4S05 A;  2YR2 A;  4WWC A;  2V79 A;  5BS6 A;  2UZK A;  3KE2 A;  3R0J A;  4N0B A;  3DKW A;  4KDP A;  1T38 A;  3IRQ A;  3SZT A;  3MZH A;  1G3T A;  4HZF A;  3JAM Z;  1NHA A;  2NNN A;  5ILV A;  2VXZ A;  1IF1 A;  2OZU A;  2QZ8 A;  1KYW A;  4BXU A;  2QEN A;  2D45 A;  1WSU A;  4MGR A;  3LAJ A;  3F23 A;  4YG2 F;  1IAW A;  1YW7 A;  4RB1 A;  2CW0 F;  2W57 A;  2EA4 A;  2IA2 A;  2GIV A;  4HX4 A;  2DBB A;  5FO5 A;  3IC7 A;  3GFJ A;  4M9S A;  1OR7 A;  2QWW A;  2DW4 A;  5L3D A;  4RB2 C;  5D4S A;  4HDU A;  2NYX A;  2STW A;  5ICE A;  4U88 A;  1OKR A;  2IA0 A;  1UB9 A;  2NNY A;  5FFZ A;  3E5X A;  2P5V A;  4HV5 A;  4I0B A;  1WRJ A;  2G7H A;  5D5W B;  1ZGA A;  4EJV A;  3EET A;  4P9F A;  1PUE E;  4WF2 A;  5FD5 A;  1YO5 C;  3GF2 A;  2LKP A;  4BAY A;  1I27 A;  3WE3 A;  5CJ9 A;  2OA4 A;  3BY6 A;  2Z5U A;  5HDG A;  2Z99 A;  2Q8K A;  4PCQ A;  1WWX A;  2DPU A;  3SFZ A;  4LG0 A;  3GEZ A;  4BHC A;  4U0V A;  3BJ6 A;  2PJP A;  1B1B A;  1BI2 A;  1TBX A;  2KIU A;  4KN4 X;  2CO5 A;  4KIG A;  5HDK A;  3CUQ A;  1YIO A;  4Q47 A;  2PG4 A;  4BNC A;  4KYW A;  4PZJ A;  1HKQ A;  4UNO A;  1YLF A;  1IXC A;  3HTS B;  2GXG A;  5D8L B;  1S8N A;  3QP6 A;  3P9C A;  1A04 A;  3U2R A;  4I09 A;  2UXX A;  1TLH B;  1IN8 A;  4TV7 A;  2L4A A;  5HVQ C;  2FE3 A;  2EA2 A;  4LLL A;  4RGR A;  1D8K A;  1ZRC A;  3WTW C;  4AVP A;  5J8C A;  3TOA A;  1ZLK A;  4LMY A;  4ON0 A;  2DFI A;  3HRM A;  2IPQ X;  4L5I A;  2V1X A;  4O5V A;  4WX9 A;  3SQN A;  3H3Z A;  3IKV A;  4O3M A;  3WU0 A;  1ZRE A;  4HOB A;  5D6E A;  1GXP A;  3TDZ C;  2IP2 A;  2QUF A;  3GUD A;  2PBI A;  2K02 A;  1YYV A;  2IVM A;  2M5W A;  1STZ A;  1FOK A;  3K2Z A;  3HTU A;  2L54 A;  4GXO A;  2VBY A;  1P92 A;  4Y17 A;  4L9J A;  1XCB A;  1IXR C;  2HKX A;  2JTV A;  4EM0 B;  2NS0 A;  1XGN A;  2P6S A;  4A5M A;  3FMQ A;  4KIF A;  5DV5 A;  3WU1 B;  1FPQ A;  2GAU A;  4UXN A;  3COA C;  4AIJ A;  3F22 A;  3T8T A;  2Q2E A;  2EV0 A;  2A5Y B;  2K4J A;  5DYM A;  4A0Y A;  3RI4 A;  2XKO A;  4MQ9 F;  5A2Q Z;  3VOE A;  2KJB A;  5DUK A;  4RB3 C;  4L5J A;  1HKT A;  4HQE A;  1HQC A;  4L9T A;  3C3W A;  4G7O F;  3LQQ A;  1KQ9 A;  3ZN0 A;  3FF5 A;  5K5Q A;  3GXO A;  3E5U A;  2B0L A;  1BOA A;  5KK1 A;  2Y0M A;  1CGP A;  1MJB A;  2O3F A;  4M73 A;  3VFZ A;  3MZY A;  2FSW A;  5DCM B;  2XAQ A;  4GO1 A;  4XLP F;  1KU7 A;  4BYY A;  3N97 A;  4GGG A;  3CTA A;  5H6R A;  1K78 B;  4A12 A;  4S04 A;  5BPI A;  2M45 A;  3QRF F;  3GYH X;  2JPB A;  3K0L A;  1J2X A;  3ZMU A;  5DCF A;  1B59 A;  1LNW A;  4CDG A;  1XGM A;  2QQ9 A;  1TQI A;  5EEG A;  2XHK A;  4P5O A;  1R1T A;  1Z6T A;  5K5R A;  4EJO A;  2ACJ A;  1BIA A;  4EJU A;  2RC4 A;  4RGU A;  4UUV A;  3GW2 A;  4YFX F;  1OYI A;  2CFX A;  4HLY A;  2OBP A;  1W5T A;  1IZ1 A;  3HRT A;  2ESH A;  5K5O A;  3ML6 A;  1T98 A;  3RTR A;  4KNY A;  1U3E M;  2COM A;  3N4M A;  1R1U A;  4M9Z A;  4ENJ A;  3SXY A;  3GZ5 A;  1LJ9 A;  2XAF A;  3E3V A;  2K86 A;  4WXD A;  1UHM A;  2J5P A;  3OOP A;  1ULY A;  2J5O A;  3KZZ A;  1XSX A;  1O7F A;  1D3Y A;  1BC7 C;  4GYG A;  4UVC A;  3RPU A;  1OYW A;  3GX4 X;  4KIB A;  2FOK A;  3FHZ A;  1USS A;  2GZW A;  1Z1D A;  2YX7 A;  2EFP A;  1PDN C;  3I58 A;  2XIG A;  2AS5 F;  2V6C A;  4QWQ A;  4DQ2 A;  2YU3 A;  5CVV A;  2G7U A;  3LQR A;  5BPD A;  1MJA A;  4XBF A;  4HX8 A;  1G3Y A;  2EWN A;  4O6J A;  2V1U A;  1FSH A;  1IXS B;  1XSD A;  2MBF A;  3TDU C;  2ZME A;  1UCR A;  3ZMZ A;  1O3Q A;  4FX4 A;  1R36 A;  3O6B B;  1SD6 A;  1ZLJ A;  4I7H A;  2PN6 A;  2OQG A;  4EGY A;  2O61 A;  5CYV A;  2CG4 A;  1I1S A;  1V3F A;  2VN2 A;  2HS5 A;  5TRD A;  3FM3 A;  2DLL A;  3FWE A;  1BBY A;  5TJJ A;  1LDD A;  3ULQ B;  4LG0 B;  1YG2 A;  2H6B A;  3D5L A;  5KVR A;  3F72 A;  4CHU A;  5JHU A;  1RUO A;  1HBX G;  4LLN A;  2BBY A;  4Q48 A;  1J9I A;  2HEO A;  3L2C A;  3ROU A;  1LDJ A;  1PP7 U;  4RS8 A;  2R7D A;  1FP2 A;  2F5C A;  1SMY F;  2H6C A;  4ZYG A;  2VBZ A;  4L9V A;  1T6S A;  3J80 Z;  4MNU A;  1J7K A;  4KA4 A;  5DD4 A;  3ZQ7 A;  4G6D A;  4WCG A;  3M8F A;  4WXH A;  1H0M A;  4Q4Z F;  1KU2 A;  1S7O A;  1FBQ A;  3VEP A;  4IHT A;  3J81 K;  3T8R A;  1IN5 A;  1B9M A;  2EFQ A;  2GWR A;  3O2P E;  4ENN A;  4HW0 A;  2RQP A;  1XSV A;  4YII A;  5BMZ A;  2IA1 A;  3FXQ A;  5J8F A;  2K7L A;  4EQQ A;  4UV9 A;  1JGS A;  3NRV A;  3E6B A;  1BI1 A;  4A6D A;  4LJZ F;  5D5U B;  5JR3 A;  4A0X A;  1MZB A;  2EJR A;  2F5E A;  2RN7 A;  1U5T B;  4CYD A;  1SFU A;  3IKT A;  3JSP A;  2VE8 A;  3DFG A;  2EV5 A;  5HDN A;  2UXN A;  4B09 A;  4AWX B;  3E6D A;  2XAG A;  3QOP A;  2W85 A;  1K79 A;  1ZRD A;  2A3S A;  4IF4 A;  1P6R A;  5E18 F;  3F8C A;  3T0Y A;  3REO A;  2STT A;  1P4X A;  5HS9 A;  2P8T A;  2JT1 A;  2PQ8 A;  4NB5 A;  1ZHF A;  4EV0 A;  1VTN C;  3ZMV A;  4EM2 A;  3ELK A;  3GVA A;  2PLY A;  3I59 A;  4KFC A;  2Y75 A;  3ISP A;  2DK8 A;  1YS6 A;  3WTT C;  1S6L A;  5LHH A;  4LK0 F;  2L02 A;  3ABU A;  1LDK B;  4A6E A;  1TQM A;  2Z9O A;  5LLQ A;  5JI6 A;  1O3T A;  1EH8 A;  2L01 A;  5J6X A;  1P4A A;  1B9N A;  3RPQ A;  3EQL F;  2H27 A;  2VC1 A;  3JW4 A;  5D4R A;  4MEY F;  3WTZ A;  3F6V A;  1JE8 A;  2XAJ A;  3FM5 A;  3KP5 A;  4R79 A;  1Q1H A;  4G7Z F;  2F2E A;  4ZYH A;  4XLN F;  1LB2 A;  5L3E A;  4GYI A;  2F5F A;  5LEJ A;  3G73 A;  1X3U A;  1UHW A;  1HSJ A;  3I4P A;  2CWE A;  3L7W A;  4U0Y A;  5K1Y A;  1QGP A;  2ADU A;  1FNN A;  3ZMS A;  1ODD A;  2DT5 A;  1O3R A;  3RDI A;  1RZ4 A;  3KET A;  4Z2Y A;  4OOI A;  2VOD A;  5EEH A;  4I98 B;  4ESJ A;  1PP8 F;  1IRG A;  5F64 A;  5H20 A;  5AIQ A;  4PGG A;  2P5K A;  1FYL A;  1J0R A;  2W25 A;  4K2E A;  3V7S A;  4G7H F;  3LFK A;  5ERI A;  1R5G A;  1WKM A;  2R7F A;  2K4B A;  1W4M A;  4Y13 A;  3I71 A;  1XB4 A;  2HTS A;  1SFX A;  2VT2 A;  2P4W A;  1HW2 A;  5IT9 K;  5CLS A;  2ZFW A;  2MD5 A;  3F21 A;  5D6F A;  3V4G A;  1XCV A;  1JXS A;  3DXJ F;  1E2X A;  4P96 A;  2R3S A;  5CVI A;  3TKY A;  1ZAR A;  3LST A;  3SZP A;  2KIM A;  4ZZD A;  4BHP A;  2HYG D;  3HSR A;  2Z33 A;  4XRF A;  2MA3 A;  1U8R A;  3U1D A;  1XD7 A;  2ZME B;  5DD8 A;  5DEQ A;  1CF7 A;  1W5S A;  3EYY A;  4M74 A;  5L3G A;  5IT3 A;  4GCV A;  2ZJ2 A;  3B73 A;  2O8X A;  3J81 Z;  2HQN A;  5FFX A;  2K27 A;  4BHB A;  4U7B A;  5BQT A;  3M8E A;  1FLI A;  3K1N A;  1H9T A;  2BE5 F;  1UFM A;  4YFK F;  3KLO A;  5HLI A;  4HLX A;  3CJN A;  2Z3Y A;  4ASN A;  1S3J A;  4CZZ A;  2XRO A;  3BJO A;  4MHG A;  4RGS A;  5E8G A;  3KCC A;  1F5T A;  4P9U A;  3L9F A;  4MQV A;  4OIO F;  1D8J A;  2GA2 A;  2MH9 A;  3I54 A;  1QPM A;  5LGU A;  1J59 A;  3QPT A;  4IJA A;  1OMI A;  3MWM A;  2DU9 A;  4LB5 A;  3V8K A;  4Q5S F;  4M72 A;  4R1H A;  4JQF A;  4ZYE A;  4AD9 A;  2QLZ A;  1QBJ A;  4AIK A;  4IXA A;  3BZ6 A;  3Q9S A;  2QQA A;  3BPV A;  4F7Z A;  1FP1 D;  3RJP A;  4OIR F;  1SD5 A;  3ZP5 A;  5LHI A;  1G6N A;  1ONV A;  3KFW X;  1XMA A;  3IHU A;  1Z05 A;  1BI3 A;  1GHC A;  2OZ6 A;  3F8F A;  2FXA A;  4KUM A;  4HQM A;  4IHS A;  4ETS A;  2AXL A;  4PGH A;  3MFK A;  4JK1 X;  5DUI A;  2V9V A;  3QU6 A;  2H09 A;  2W84 A;  4CIC A;  1FT9 A;  1G3S A;  1MDM B;  2XAS A;  4RGX A;  4EVI A;  3Q5F A;  4RAY A;  4RB0 A;  1FYM A;  1U6G A;  3R6S A;  1S7A A;  3WGG A;  6PAX A;  5CVR A;  2CGP A;  4FX0 A;  3VB2 A;  2DQR A;  3V7C A;  5AON A;  3FXR A;  1YFH A;  4ZYD A;  3W6K B;  1ON1 A;  4XSZ F;  2E1C A;  5E20 A;  4HYE A;  3I5U A;  3TOB A;  3F8N A;  1HW5 A;  1DPU A;  4EMS A;  1OYY A;  3I59 B;  2PFB A;  3C18 A;  3IRR A;  3Q9V A;  2P7C B;  3LAP A;  5JVT A;  1KU9 A;  3HHH A;  1KQ0 A;  1HST A;  2HYF A;  5LGT A;  2KKO A;  5ILS A;  1O57 A;  1SMT A;  3DPL C;  3SHF A;  2OAZ A;  4BQA A;  3BJA A;  2NAZ A;  3FX3 A;  3P9I A;  3IL2 A;  5FLX K;  2X4H A;  3DPT A;  2JZY A;  1FBU A;  3G3Z A;  1Y0U A;  4OMZ A;  1REP C;  2M8E A;  2ELH A;  3E6C C;  2VC0 A;  2IT0 A;  3F3X A;  4FT8 A;  1K7A A;  3QU3 A;  5IT9 Z;  2VE9 A;  4Y15 A;  1FZP B;  1XGS A;  2JRT A;  3PQK A;  1WI9 A;  3BWG A;  1ON2 A;  4KIC A;  3E97 A;  4HF0 A;  4L0Z B;  2QM3 A;  3V8J A;  2FNP A;  1MD0 A;  2HDC A;  2VOO A;  3CLO A;  2P7V B;  4KT5 C;  3H92 A;  1IRF A;  2WWY A;  2EFO A;  3BPX A;  3GWZ A;  3L09 A;  4EGZ A;  1WQ2 A;  1XN7 A;  3HSF A;  4UHT A;  4YIF A;  2KJC A;  3ZN1 A;  4G94 A;  1W7P A;  2RDP A;  4RAZ A;  4FHT A;  1J75 A;  3CUQ B;  5E1W A;  1H9G A;  2D1H A;  3NEU A;  1G3W A;  2KRF A;  4N9I A;  3V8L A;  2XRN A;  1ZYR F;  2QQB A;  1QNT A;  3EUH A;  1MJ9 A;  1JHH A;  4MEX F;  2E1N A;  1ZG5 A;  3HYI A;  2ZXJ A;  1TW3 A;  3BDD A;  2ETH A;  1LEA A;  4KN7 X;  4ESF A;  3KLN A;  4L0Y B;  2XV4 S;  2XGX A;  4ENK A;  4G8X A;  2L3D A;  4IRG A;  2ZCW A;  3HUG A;  1R23 A;  1ZN2 A;  2EB7 A;  4M71 A;  2PMH A;  3F8B A;  2QYO A;  5LEK A;  2HGC A;  1ZH5 A;  4NQW A;  4UVB A;  1HXD A;  1ZG1 A;  2CYY A;  4I01 A;  4QLC U;  3DEU A;  3LA7 A;  1DUX C;  1FSE A;  1MKM A;  2WC2 A;  2DPD A;  1L0O C;  1CF7 B;  1I5Z A;  5CVU A;  4LK1 F;  4L9N A;  4R8H A;  1AOY A;  4A2U A;  1BN5 A;  4HX7 A;  1P4W A;  3K9T A;  1O3S A;  2CSO A;  2XKP A;  1U5T C;  4IPA A;  3ECO A;  3CUO A;  2M30 A;  2FML A;  2YSR A;  3I64 A;  1YW8 A;  2M1B A;  2BGC A;  3F8M A;  3I53 A;  3EDP A;  1J5Y A;  2W24 A;  2JSC A;  4EJT A;  4CGZ A;  1ZAO A;  2IW5 A;  2MH2 A;  4LLG F;  3MCZ A;  1XGO A;  2WV0 A;  5LBQ A;  1XDS A;  3BP8 A;  1K6O A;  2FRH A;  2E7X A;  4AIH A;  1U78 A;  1V4R A;  3PFI A;  2ISY A;  1SD7 A;  2PMU A;  2F5D A;  2L4M A;  1QZZ A;  5D5X B;  1ZRF A;  4N9H A;  3BRO A;  4IRI A;  2BEO A;  2HR3 A;  2LDU A;  1I1G A;  3U9G A;  4LGW A;  1FC3 A;  5ICF A;  3LA3 A;  5HOO A;  2QVO A;  3MQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...