3TGNA

Crystal structure of the zinc-dependent marr family transcriptional regulator adcr in the zn(ii)-bound state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
135
Chain Sequence
MRQLAKDINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSEESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETFYQLTDLARPIAEEHHHHHEHTLLTYEQVATQFTPNEQKVIQRFLTALVGEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adc operon repressor AdcR
publication title Crystal Structure of the Zinc-Dependent MarR Family Transcriptional Regulator AdcR in the Zn(II)-Bound State.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription
total genus 49
structure length 135
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tgnA02
2O6GE 3LQRA 5DD8A 3T1BA 5LGUA 3ZQ7A 5ICGA 2V1UA 2EFNA 5HS9A 4I0AA 2XAGA 2XRNA 3FZVA 4R8HA 2VE8A 5K5RA 5A2QK 1FWZA 3HHGA 1P6RA 2K02A 2XGXA 1JE8A 1U8RA 2IW5A 3BP8A 1MKMA 2H6CA 3ISPA 3HTSB 4WXHA 2HS5A 1S6LA 1XMKA 1V4RA 2MLKA 5FLXK 1L0OC 1EH8A 1F5TA 1D8JA 4KIFA 2BV6A 1OMIA 5E17F 4L9JA 2WC2A 5F6FA 4OIRF 3CUOA 3JAMK 3ELKA 3SZTA 2HWVA 4PDKA 2QQAA 4R79A 2ZKZA 4A5NA 4EGZA 2GA1A 2HOEA 2LSOA 1ZGAA 2ZCWA 5D5WB 2CQKA 3ZMDA 4PZJA 3E6MA 1P2FA 3FM3A 1QNTA 1T6SA 5LHHA 1KYWA 1DDNA 4KIGA 1AWCA 3RDIA 2DPDA 1BI2A 3DQVC 3DPLC 1H9GA 1USSA 2HKOA 3I53A 4G6QA 2EFPA 2OD5A 4LB5A 1UCRA 2A6HF 1T2KA 1G3YA 2OBPA 3E6DA 4XRFA 2JPCA 1YO5C 2DBBA 3TOAA 3KZYA 3V8JA 4ESJA 3ZN0A 3GXOA 2XAQA 2STWA 4U0VA 2YSRA 3LA7A 2PN6A 6PAXA 3GW2A 4HQEA 2FMYA 3M8FA 5E20A 3O3KA 3L7WA 1ZH5A 1ZHFA 5D5XB 5IT3A 1O7LA 4NQWA 4EM1A 1IZ1A 2OZ6A 3J80K 1RUOA 1YYVA 5L3BA 4HZFA 4LLLA 1IN8A 4HX7A 4HA8A 4XLPF 1SFUA 3LQQA 2K4BA 2IP2A 2B0LA 2ZO4A 3TO7A 1XSDA 1G3TA 3GEZA 3NEUA 3HRTA 1TBXA 5TRDA 2VT2A 5EEGA 3WGHA 1KU2A 1I6XA 5D5UB 3ZPLA 1MDMA 2XASA 4HDVA 4MEXF 3C18A 4KUMA 1TW2A 5LGTA 4WX9A 1DUXC 1QZZA 2L3DA 1RZ4A 3O6BB 4EJUA 4I7HA 4M73A 2MA3A 3P9KA 4AVPA 3M1EA 2O61A 2MBFA 5L3FA 1G3WA 1XDSA 5J8CA 5CLSA 5DUIA 3WTSC 1XGNA 3WE3A 3KP2A 4BHPA 4HLXA 1SD5A 3N97A 2WWYA 2G7UA 4DNCA 2O8XA 4A0YA 2F2EA 2CW0F 4L0YB 1MJ9A 1C0WA 4HAMA 2OU2A 1W7PD 3DPTA 4YIIA 2ELHA 2EK5A 3HSRA 5DUKA 1LEAA 2UXXA 3L00A 1W7PA 2P4WA 2HFHA 4RGSA 4S05A 2DTRA 4HOBA 5A2QZ 2CGPA 2DO7A 3VODA 1S7AA 4CXFA 3EYYA 3SXYA 3HTUA 1LVAA 4Q47A 2IA0A 2W57A 1ON2A 2HQRA 2W24A 3TKYA 4LG0B 5ILVA 2BGCA 4GGGA 4XBFA 3TGNA 4NHJA 5FLXZ 2YX4A 4GCVA 4HX4A 5CYVA 1H9TA 3BWGA 5K5QA 3W6KB 2OQGA 3KLNA 3IL2A 4XSXF 3RIRA 1IRGA 2M8EA 1J7KA 1ON1A 4WXCA 3LFKA 4I09A 2PQ8A 4HF0A 2QQBA 1V3FA 2ESHA 1GXPA 4A0ZA 4RB1A 5BPIA 1IN7A 5FO5A 3C3WA 1B9NA 2K86A 1YG2A 3RI4A 2V79A 3QOPA 3MCZA 1RIOH 1ZLKA 4G7ZF 2IPQX 1MD0A 3DKWA 3RKXA 3F6OA 3DV8A 3JW4A 5HS7A 4HF1A 4YFXF 1T0FA 1I5ZA 2XUBA 2IA2A 3I54A 4ZYGA 2ZJ2A 3KZZA 4WK8F 4DQ2A 4Q4ZF 2RKHA 3CUQB 3REOA 2FU4A 1ONVA 2H09A 1MJBA 2M30A 3LWFA 3I59B 1K78B 2D1HA 1IW7F 2XKOA 5ILSA 3EETA 3ECHA 4MHGA 1FYKA 3KE2A 2HTSA 4L5JA 4RGRA 1FLIA 1TTYA 5E18F 4LK1F 1B1BA 1IRFA 1OYYA 4MTEA 1QGPA 3HRMA 4WCGA 4N9IA 4A0XA 4IF4A 3J80Z 5BPDA 2QM3A 2DU9A 4EJOA 2NYXA 2NNNA 4JK1X 1Z1DA 3MQ0A 1YFHA 2M1BA 1YQAA 4IJAA 3TQNA 3D0SA 4PGGA 3V8KA 1U78A 3MFKA 2WV0A 1SMTA 4K2EA 3U1DA 5DCMB 2XAHA 3VEPA 1D8KA 2XKPA 2PG4A 1FOKA 2K7LA 4QWQA 3I4PA 3K9TA 3K1PA 3D5LA 1YIOA 4O3MA 5CVIA 3MWMA 2P7CB 3HYIA 1YW9A 1XGMA 3QP6A 2F5FA 3WU0A 3R0JA 4ON0A 3OOPA 2QZ8A 5D4SA 3IRRA 1J75A 2R3SA 2XHKA 1T98A 2NAZA 3GFMA 4ENMA 2LDUA 1FSEA 1KA8A 4KYWA 2O0YA 3QU3A 3GWZA 3I71A 1MJAA 4LGWA 1TNTA 4RAZA 5FFZA 4BH9A 1EV7A 4BNCA 2CG4A 3FWEA 2FSWA 3EYIA 1U5TA 3NQOA 1WWXA 3P9CA 4EJTA 2XROA 3B73A 2DLLA 2Z3YA 2E1NA 4ESBA 2VBYA 4N9HA 3JSPA 2FBHA 2H27A 3GYHX 1U5TC 1A04A 4A6EA 2K27A 1HW2A 2BBYA 2EFQA 1S29A 4BXUA 5D5VB 2H6BA 4P5OA 1SFXA 3CO6C 4M9XA 2V6CA 1GVJA 3OV8A 1FNNA 3BPVA 1BC7C 1ZG5A 4YIFA 1XN7A 1REPC 3COAC 2FBKA 2STTA 4IRGA 2EFOA 4IHSA 2DFIA 3TDZC 3LA3A 4HV6A 3G73A 2VC1A 5HLIA 3J81K 2QYOA 2PBIA 1S8NA 2M45A 3ROUA 3F22A 1W4MA 5ILUA 3Q5FA 1TLHB 4G6DA 3ZMTA 2VXZA 3F8NA 1W5SA 3ZP5A 1B4AA 1FY7A 1IAWA 3R6SA 1USTA 3CDHA 2DT5A 1WSUA 3BJOA 2CWEA 1B9MA 1I1SA 2D45A 2ZMEA 2HTJA 1FC3A 3U9GA 2XAJA 4Y15A 2DQRA 3Q9VA 2VONA 3CO7C 1O3RA 4G7OF 2EA4A 5H20A 1U2WA 2OA4A 2XVCA 2DK8A 4ZZLA 3WTXC 4LG0A 2ETHA 3FMSA 2KJBA 4L0ZB 3L2CA 2DPUA 3WTUC 5F1RA 2YPRA 3FMRA 3K0LA 4MNUA 3R4KA 3WTYC 3HRSA 4KNYA 1KU7A 3BDDA 3KP5A 1B6AA 3DF8A 3W6JB 4UV8A 1BIBA 1R1VA 4CZZA 2MH2A 4IHTA 2NS0A 5K1YA 2JSCA 3I5UA 3K1MA 1MGTA 2QLZA 2KJCA 3FXQA 2Q8KA 1SD6A 2LNBA 2ZBKA 2RGVA 1PP7U 2V1DA 2JTVA 3ML6A 4B09A 3FX3A 2ADUA 1YW8A 2FOKA 3QPTA 3HSEA 4JBAA 5BOXA 1R5HA 2KIFA 1HXDA 4EGYA 2QBYB 2OQRA 2P5LC 4A2UA 4PGHA 2QVOA 2V1XA 1F4KA 3CLOA 4Q5SF 1Q1HA 4OIOF 5E1ZB 1K7AA 3VOEA 1HKQA 3BZ6A 1FP1D 4KT5C 1P4AA 1CF7B 4OMYA 4RGUA 1S7OA 3B02A 3GZ5A 1RI7A 2P6TA 5L3DA 1ZRDA 1BI0A 4EJVA 1XGOA 1YTYA 4IRHA 2Y0MA 2D1VA 1BM9A 3F8FA 4F7ZA 2W25A 1HKTA 3S2WA 5HLGA 1LDDA 1W5TA 5HDNA 1R22A 3RTRA 2E7XA 1D3YA 5DCMA 5D6FA 2FMLA 3WODF 2UWMA 3E5XA 5ICFA 3JTGA 4TV7A 5DYMA 2O03A 3T0YA 2J5PA 1ZRCA 4ZYEA 4M9SA 1J59A 2Z99A 1RUNA 4GYGA 3GO5A 2QENA 1FX7A 5L3GA 2VOOA 1Z7UA 2BYVE 4KA4A 5HDGA 3P9IA 5FB2A 1E2XA 1D5VA 1JXSA 2C6YA 1UFMA 4UVCA 4RB2C 2A69F 3J81Z 2FNAA 1HSJA 3LAPA 3KEQA 4CICA 3HIFA 2P7VB 4U7BA 2JPBA 4I98B 3F8MA 5FD6A 3SFZA 1DPUA 4UXNA 2DAOA 2FXAA 4G9YA 3F6VA 3E97A 3K1NA 5ERIA 3WG9A 3ERED 4EJWA 3H92A 1QZYA 3Q9SA 2L4MA 4UV9A 5F64A 2UXNA 4CHUA 1DPRA 4HLYA 4ZYDA 4LLNA 1ZRFA 1U6GA 3I64A 3JSOA 3IWFA 3WTWC 4D0PA 2OAZA 3F21A 1DP7P 4KMFA 1HKSA 2VBZA 3EDPA 2JRTA 3HOTA 1HBXG 2AXLA 1KQ8A 4L9NA 4P96A 4L9VA 3SZPA 5ICEA 3RPUA 2G9WA 4HBLA 3I58A 4Y17A 5LHIA 5DD4A 2IT0A 1KGSA 3V4GA 5J6XA 2MC3A 3I0TA 1PUEE 3C1DA 3KP6A 1WRJA 2ACJA 1JGSA 4LD5A 1SAXA 4ZZDA 2LKPA 2VE9A 1MDMB 3F8BA 1R5GA 3M8EA 3MZHA 1TW3A 3V8LA 1BOAA 4O6JA 2P5VA 1OR7A 4MGRA 2NRAC 1AOYA 4NB5A 2FA5A 2AS5F 4I01A 2VOPA 2F5EA 2Y48A 3FXRA 2COMA 1XMAA 4GXOA 1LJ9A 4M6XA 2EV0A 5H6QA 4WXDA 3M7GA 3ZMZA 4XSZF 2VBXA 3FXUA 3VB2A 3WE2A 2VN2A 4I0BA 4BHBA 4HF2A 3WGIA 1FBUA 1Z6RA 2E7WA 2RNJA 1ZYRF 3RYPA 3IC7A 2FRHA 4AWXB 1ZG3A 5D4RA 2CFXA 1LDKB 4MQ9F 2EV5A 2R7FA 2XV4S 3NRVA 3SQNA 3MZYA 3V7CA 4EVIA 1J0RA 5JFRA 3F23A 2A5YB 5EEHA 3DP7A 2VT3A 5LRRA 1U3EM 1XCBA 2GZWA 5AONA 1W7PB 4HQMA 5HDKA 1UHWA 4OIPF 3T5XA 2GIVA 1LNWA 5LEKA 3E6CC 2J5OA 4L9TA 2EB7A 3KP3A 4HYEA 4JQFA 4KN7X 2A61A 2Q2EA 1JHHA 3EUHA 2VBWA 2PEXA 4EV0A 2PI0A 4A6DA 3G3ZA 4MEYF 3MAJA 1HW1A 2X0LA 2RN7A 3LA2A 2OZUA 1R00A 1ODDA 1STZA 2QBYA 4MTDA 2FE3A 2Z33A 1Z6TA 3LSTA 3TOBA 2UZKA 4A12A 2KIMA 5LLQA 1BN5A 5LEJA 3DFGA 2BE5F 2DW4A 1X3UA 2ISZA 2ZNYA 1FYLA 3ULQB 1CF7A 4YFNF 4CDGA 5HLHA 4FX4A 4L5IA 3WTVC 3QP5A 3HHHA 3TO6A 2W85A 2L01A 1FPQA 2WTEA 1WKMA 5ED4A 1I27A 4HV5A 4PCQA 5D6EA 1Z05A 4MQVA 3KCCA 5DV5A 1ZG1A 4P9FA 2HYFA 3V7RA 1IF1A 1O7FA 4UVBA 4OIQF 4FT8A 3ZMSA 2FF4A 3RYRA 3C7JA 3BPXA 2IA1A 3WTZA 1KU9A 3O2PE 3PFIA 1BIAA 5LGNA 3PQJA 2RV8A 2JT1A 2ZFWA 4RS8A 3KLOA 4M74A 4CO8A 1TNSA 4GYIA 5KVRA 1XGSA 2IJLA 5CVUA 4Z2YA 2M87A 2A68F 3KFWX 5JHUA 1ZAOA 2LF8A 4KDPA 4GO1A 1IXRC 4S04A 1YW7A 4LFUA 4P9UA 5CVRA 3SHFA 1XSXA 2MH9A 3H3UA 5K5OA 3VFZA 4P55A 3BOQA 3ZN1A 2PMUA 5TJJA 1B59A 2YR2A 3RKYA 4IRIA 2QWWA 2EA2A 2EJRA 4YG2F 2V9VA 4G8XA 1KYZA 2DI3A 4EM2A 2R7DA 2FBIA 3GLXA 1XB4A 2EWNA 2PMHA 4HX8A 4OINF 5KK1A 1XD7A 2HYGD 3L09A 3JTHA 3E5UA 1LB2A 3V7SA 5FD5A 4AD9A 1R58A 3GVAA 3HUGA 4LMYA 1NHAA 4LLGF 3ZMUA 3K2ZA 4KFCA 4KN4X 4IPAA 3IHUA 4Q48A 2ZNZA 1Z91A 5CVJA 1LDJA 5CJ9A 2Q0OA 3T8RA 3RJPA 1KQ0A 3KETA 1FBQA 2HGCA 2A3SA 3HSFA 2P6SA 4OOIA 1K79A 4BYYA 1U5TB 3CUQA 4AIJA 2W84A 3I59A 4EMSA 1K78A 3KEOA 1F9NA 3FHZA 3BJ6A 2VODA 4A5MA 4YFKF 1PP8F 3CUQC 1OPCA 3F3XA 3DEUA 4G7HF 1E17A 2MD5A 4L18B 1G4DA 5ICCA 1KU3A 2EV6A 4R1HA 2VC0A 4OMZA 3FMQA 2KIUA 5IT9K 4KICA 1BI3A 4BHCA 4QLCU 2HKXA 3CTAA 4BQAA 2FEZA 1K6OA 1XCVA 4U0WA 2HDCA 4U0YA 3BY6A 1HQCA 4AIHA 4IVNA 1O57A 2XIGA 3GZ6A 4OU0A 4RGXA 1RNLA 3KP7A 1Z9CA 2P8TA 4I2OA 2G7HA 1SD4A 5AIPA 1ZREA 2O3FA 3GF2A 4XLNF 2ISYA 4M71A 1FZPB 2L02A 1L3LA 2PJPA 5DDGA 1ZGJA 1YLFA 4ZH4F 3M9AA 5JVTA 3GUDA 5E8GA 4UHTA 2DQLA 2NNYA 5LRSA 1O3SA 3MEXA 2X4HA 2ZMEB 1ULYA 1IN5A 4BAYA 1HW5A 5LBQA 4LJZF 3H3ZA 1P4XA 2YX7A 4RAYA 2CSOA 1H0MA 2EFWA 2CO5A 4H0EA 4UVAA 5L3CA 3IKTA 2HR3A 3K69A 3E5QA 1J9IA 4RB3C 5JI6A 3ABTA 2QQ9A 1G3SA 4G94A 1BC8C 1XDUA 1J2XA 4B8XA 2E1CA 2BEOA 5D8LB 2LF7A 2IRFG 5HS8A 4RB0A 2M5WA 1BBYA 1FBSA 3KP4A 5HOOA 5DCFA 2L54A 1ZLJA 4ASNA 1VTNC 5E1XA 4LK0F 3EQLF 1UB9A 4KIBA 1O3TA 1EH7A 1R1TA 1I1GA 1R23A 3JAMZ 3F72A 1S3JA 1IXSB 2IVMA 5BQTA 4O5VA 3RKWA 3N4MA 2GWRA 3GFJA 1IN4A 2K4JA 2H94A 4Y13A 2GQQA 3R0AA 4FX0A 1WI9A 1FYMA 1J5YA 1R1UA 3QPHA 5LHGA 4U7DA 1GHCA 5D8KB 3HRUA 3WGGA 2GA2A 1GXQA 3WU1B 5JR3A 2PLYA 2F5DA 3BJAA 5BS6A 1ZARA 4U88A 2RC4A 1Y0UA 2DK5A 4EQQA 3ECOA 1SD7A 4M6YA 1BJAA 3DXJF 3GFIA 4EM0B 1F1ZA 3E3VA 3AAFA 2HZTA 4ESFA 1TQIA 3QAHA 4HW0A 1OYWA 2A6EF 3TDUC 4HDUA 1KQ9A 5FFXA 1XSVA 2HEOA 3IWZA 5L3EA 5J8FA 1OYIA 1FP2A 3PQKA 1R7JA 1HSTA 1JHFA 4ZYHA 1LEBA 2RDPA 2GAUA 1LQ1A 1IUYA 3P7NA 3ABUA 1SMYF 2TDXA 1O3QA 2P5KA 3FF5A 3E6BA 4IXAA 3BROA 1G6NA 1IN6A 2Y75A 1OKRA 4FHTA 3RPQA 2JZYA 3FM5A 1PDNC 1WQ2A 2KKOA 5E1WA 1QQIA 2ESNA 3ZMVA 2Z5UA 5HVQC 1TQMA 1YS7A 3T8TA 3R60A 2FNPA 2RVCA 1FSHA 4M72A 1P4WA 1TQPA 4LB6B 3R61A 1QO0D 2CYYA 4ETSA 4M9ZA 5FGMA 4ENJA 2YU3A 5CVVA 2L4AA 1IXCA 1UHMA 4WF2A 1QBJA 2GXGA 2KRFA 2XAFA 2RQPA 2GXBA 4WWCA 3L9FA 3F8CA 4E70A 3GX4X 5IT9Z 1R36A 5BMZA 4UUVA 2PFBA 4CYDA 2F5CA 2MLGA 3WTTC 5H6RA 2ZXJA 3QU6A 5E8IA 3GFLA 1MZBA 4I02A 4KMUX 3LAJA 1CGPA 4CGZA 5AIQA 5DEQA 3IRQA 1T39A 2QUFA 3J7AO 1QPMA 1ZN2A 1FT9A 1YS6A 3CJNA 4N0BA 2D2WA 1BI1A 4UNOA 3IKVA 1EH6A 2Z9OA 3U2RA 1P92A 4ENKA 2A07F 1T38A 3TO9A 3HOSA 4ENNA 4AIKA 3QRFF 2HQNA 2FQ3A 1SFEA
chains in the Genus database with same CATH superfamily
2O6GE 5IP7J 2RREA 1VI0A 3BCBA 3LQRA 1LKXA 1XTAA 4B1RA 1N25A 5DD8A 2VPLA 3T1BA 3S3MA 1A36A 5LGUA 5CQEA 3KYLA 2YU9J 3ZQ7A 5ICGA 2V1UA 4X1EA 2EFNA 5HS9A 3UNGC 3OYBA 4I0AA 2XAGA 2XRNA 3FZVA 3BTCA 4GRIA 3HOVJ 4R8HA 4AM3A 1MBKA 1JI8A 2VE8A 5K5RA 4L5EA 5A2QK 1FWZA 2XPUA 3HHGA 5GTHC 1P6RA 2K02A 2XGXA 3BZCA 3OYMA 1JE8A 1U8RA 3C2GA 2IW5A 2M0CA 1TC3C 3BP8A 1MKMA 2H6CA 3ISPA 3HTSB 2F6CA 4YEJA 4BQOA 3GTPJ 4WXHA 2HS5A 1S6LA 1XMKA 2VJIA 3BTJA 1V4RA 2MLKA 3BR1A 3S1MJ 2XB5A 4XLAA 5IOYA 5FLXK 2VL8A 1L0OC 1EH8A 1F5TA 1D8JA 1MMNA 3DBHB 4KIFA 1VNDA 3I56I 2BV6A 1LUJB 1RESA 1OMIA 2AQFA 2VKVA 2XC7A 2QKMB 4DBQA 5E17F 4L9JA 2WC2A 2QQ8A 4XOTA 5F6FA 4OIRF 3CUOA 3JAMK 1WJBA 3ELKA 3SZTA 2HWVA 2MYSA 1ETYA 4PDKA 2QQAA 1WPKA 4LITA 4R79A 4BQQA 3DPUA 4OWRB 2OV7A 2ZKZA 4FCYA 4JX6A 4A5NA 4EGZA 2DTZA 2GA1A 4BL0B 3CF5F 4BE0A 2HOEA 1SFOJ 2LSOA 4IHVA 1ZGAA 2ZCWA 2LY1A 3OR1C 2CUJA 5D5WB 2CQKA 3Q3SA 3ZMDA 2JA8J 2M3AA 5EF6A 2E34A 4PZJA 3BC8A 1P2FA 1IV8A 3E6MA 3HC7A 3FM3A 1QNTA 1H8AC 1T6SA 5LHHA 1KYWA 3G1OA 4F93B 1DDNA 4KIGA 1AWCA 1WJCA 3RDIA 1D0XA 2R5YA 1BI2A 2DPDA 3DQVC 3AG4H 1H9GA 1USSA 2HKOA 3DPLC 2X1EA 3FK6A 3I53A 4G6QA 4PUSA 2EFPA 2OD5A 4LB5A 1UCRA 4BJ5C 2ZJQF 2A6HF 4A3FJ 1T2KA 2HQ5A 1G3YA 2W4SA 5M5WJ 2OBPA 3E6DA 4XRFA 2JPCA 2GBYA 2OC6A 1YO5C 2DBBA 2M7AA 1RETA 2K9MA 3TOAA 3KZYA 3V8JA 4ESJA 3ZN0A 1KZHA 3OOUA 1YOVB 2KISA 4IZZA 4E7SA 2R7TA 3GXOA 3DTEA 2XAQA 2STWA 4U0VA 5IPAA 2DCEA 2YSRA 3LA7A 2PN6A 3HOXJ 6PAXA 3GW2A 4ZDPA 2KHMA 4HQEA 2IXSA 1ENHA 1QRYA 2MFZA 2FMYA 4XICA 3M8FA 5E20A 1JT6A 3WHBA 3O3KA 2DMTA 3BR0A 3L7WA 3O8GA 1ZH5A 2CRGA 1ZHFA 5D5XB 5IT3A 1O7LA 4NQWA 3QWLA 4EM1A 3AKZA 1IZ1A 2OZ6A 3J80K 2MABA 1OCRH 1RUOA 1YYVA 5L3BA 4HZFA 4LLLA 3OYFA 1IN8A 4HX7A 4HA8A 4XLPF 1QZEA 2E5ZA 1SFUA 3LQQA 2K4BA 2IP2A 2B0LA 2ZO4A 3H5AA 3TO7A 4DYQA 3CMAI 1XSDA 1G3TA 3OYNA 2Q2EB 4RAGA 5JLWA 4IOCF 3GEZA 3NEUA 2IS4A 3X2QH 3HRTA 1BA5A 2XGEA 3G2BA 1MW7A 2P0WA 3EUAA 3S15J 2EZHA 1TBXA 5TRDA 3BQYA 2VT2A 1UHSA 5EEGA 3KPHA 3WGHA 1KU2A 3ZRGA 2FX0A 1I6XA 3L2QA 2JN6A 3CDLA 5D5UB 3ZPLA 2K3PA 2O9LA 1MDMA 2XASA 4KISA 3W2WA 2X51A 4FE7A 4RLFA 2KT0A 1ZQ3P 4HDVA 3LSHA 4XM3A 3AG1H 2ICWG 2XAUA 5JHFA 4MEXF 4P1WA 2QKLB 3C18A 4KUMA 4N4NB 1TW2A 2DOFA 1GLNA 5LGTA 4WX9A 4ANJA 1DUXC 2JJ7A 1QZZA 3BTIA 2L3DA 1RZ4A 4CUGA 4AC0A 2IS1A 1BOBA 3O6BB 2LFBA 1JKPC 3L2UA 3S1QJ 5EZHA 9ANTA 4EJUA 3AFHA 4I7HA 4M73A 1MH4A 2MA3A 5F0HA 2DOAA 3C2HA 3SZGA 3P9KA 4AVPA 2RAEA 5IP9J 4AVZA 2JRMA 3M1EA 2O61A 2MBFA 5JLXA 5L3FA 1G3WA 2HVQA 1VF9A 1XDSA 5J8CA 5CLSA 5DUIA 2GLOA 1SVMA 3WTSC 2XDVA 1XGNA 1RRJA 4MLOA 4ZDLA 3KP2A 3WE3A 1PUFA 1ETQA 2WAQA 2XSJC 3OL4A 4BHPA 4HLXA 1SD5A 3FK7A 3N97A 1APLC 2M34A 3BG7A 2WWYA 1LE8A 4M3BA 1MNEA 2ELJA 2JVHA 2G7UA 3JRCA 4DNCA 2M8GX 2O8XA 3QOEA 4A0YA 4DYCA 2EINH 4IO9F 2F2EA 4BY7J 3VYTB 1ORKA 4C2UA 4CA0A 2CW0F 4JYKA 3L2VA 4ZTFA 5FKLA 2JQ7A 4L0YB 3IV5A 2ZSIB 1MJ9A 1C0WA 4BBSJ 4HAMA 4DGWB 4E4HA 3TMOA 2OU2A 3LSJA 1W7PD 3DPTA 4OAYA 2HOTA 2JA6J 4YIIA 2ELHA 2EK5A 2DN0A 3HSRA 5DUKA 4BBRJ 4BJ6C 1OCPA 3MKWB 1LEAA 4J00A 2UXXA 3LL7A 3L00A 1W7PA 4XORA 2P4WA 2HFHA 2K9SA 2XPWA 4RGSA 1JJ6C 4S05A 3VYRB 2DTRA 4HOBA 3DBRB 2LY2A 5A2QZ 2CGPA 2DO7A 3VODA 1S7AA 2BVMA 4B3XA 4CXFA 3EYYA 1A6IA 2WV1A 3SXYA 3C2BA 3S2HJ 3HTUA 1LVAA 4Q47A 2IA0A 1OQYA 4IHWA 2W57A 2A6TA 4C3IJ 1ON2A 4I99C 3G6EI 4MO7A 2HQRA 2W24A 3TKYA 4J01A 4LG0B 5ILVA 2BGCA 2LG4A 4QPOA 5FRNA 2KL4A 1LVKA 3BT9A 4GGGA 1OISA 3TGNA 4XBFA 4NHJA 2DFEA 4BDZA 2VB6A 1B72B 5DM7F 5B5EC 3L2WA 3CCSI 5FLXZ 2YX4A 4GCVA 2Z2SB 4HX4A 2I5UA 4PJ0C 4DW6A 5CYVA 1H9TA 3BG5A 3PJRA 3PFYA 3BWGA 3K4MA 5K5QA 3W6KB 2OQGA 1V55H 3OYDA 3KLNA 3BLYA 2HNHA 3PM1A 4IQ4A 3IL2A 4XSXF 3RIRA 1IRGA 3NWSA 2M8EA 1J7KA 1UELB 1ON1A 4WXCA 3TW7A 2BY3A 3LFKA 3E1SA 4I09A 2PQ8A 4HF0A 4EEFG 1LPQA 2OJED 3DKYA 2QQBA 5J3LA 2ECCA 4W1UA 4FTHA 1V3FA 2ESHA 1GXPA 1UG2A 2R92J 4A0ZA 2CW7A 5F0CA 3UR3C 3HPGA 2Q1ZB 4RB1A 2OCCH 5BPIA 1IN7A 2CFOA 2CW8A 3HGGA 4HG2A 4IX7A 5FO5A 3C3WA 1R5ID 1JKQC 1Z77A 1B9NA 2K86A 1YG2A 3RI4A 5EEAA 2V79A 3QOPA 3MCZA 1TWGJ 5EG0B 1RIOH 2WB1N 4G7ZF 1ZLKA 1U9NA 2IPQX 1MD0A 3A0BC 3DKWA 1UZCA 3F6OA 3RKXA 3DV8A 3JW4A 5HS7A 5C3EJ 4HF1A 4YFXF 4X0GA 2G0EA 2QA4I 4A3DJ 1T0FA 1I5ZA 2XUBA 2ID6A 1MMDA 1FJLA 2Y0SA 1I50J 2IA2A 2L7FP 3I54A 4ZYGA 2NOJB 2ZJ2A 1BR2A 3KZZA 2ZB9A 4WK8F 1IC8A 3JRFA 3RPUD 2JK3A 2Y2ZA 1G8XA 4DQ2A 2L9SA 3BCAA 4Q4ZF 1T0FC 3P5JA 4KJZA 1YX5A 2RKHA 1D1BA 3CUQB 2F4OB 2DA2A 1WCMJ 4XN0A 3REOA 2FU4A 1ONVA 1PYVA 2H09A 1MJBA 2M30A 3LWFA 3LSGA 1SFKA 3I59B 1IV6A 1YRNB 1K78B 2D1HA 4N4OB 1IW7F 2XKOA 4PJMA 4V19K 5ILSA 3RZOJ 3EETA 3ECHA 4MHGA 1WH5A 2KRCA 1FYKA 3KE2A 2HTSA 3W6VA 4L5JA 1W5CC 4RGRA 1FLIA 1TTYA 1A6QA 2CS3A 3CJTB 4LK1F 4AIDA 5E18F 1B1BA 1IRFA 1OYYA 4DIQA 4MTEA 1AHDP 3DU5A 3OYEA 1QGPA 3HRMA 4WCGA 4N9IA 4A0XA 4IF4A 1MH3A 3J80Z 3GLLA 1WGXA 5BPDA 1X1PA 2QM3A 2Y69H 5J1YA 2DU9A 4EJOA 2NYXA 5HLTA 2XPVA 2NNNA 4JK1X 1Z1DA 5FRMA 3MQ0A 2R7XA 3KZIC 1YFHA 2B9SA 2M1BA 1YQAA 3H0GJ 4XKVA 4XIDA 4IJAA 3FXLA 3TQNA 1A35A 3D0SA 3OWTA 1I3QJ 4PGGA 3V8KA 1N77A 3ASOH 3CCUI 2L9VA 2EZIA 1U78A 3MFKA 3ZGKA 2WV0A 1SMTA 4K2EA 1FTTA 1EKEA 2GOMA 3B6CA 1IG7A 3CCJI 1IDZA 3U1DA 1DQUA 4RBOA 5DCMB 2CJJA 2XAHA 4RLQA 5K7ZA 3VEPA 1D8KA 3DEEA 2XKPA 2PG4A 1FOKA 4CYCA 2K7LA 4QWQA 2H1LA 3I4PA 4A3CJ 3K9TA 2R7SA 1WH7A 3K1PA 2E19A 3D5LA 5LFAA 3A01B 2NXNB 2DXIA 1YIOA 4O3MA 2Y30A 5CVIA 2DA3A 1J09A 2VQHA 3MWMA 1JT0A 2P7CB 3HYIA 1YW9A 1XGMA 4UY8I 3QP6A 2F5FA 3WU0A 3R0JA 1Z3YA 2M0MA 3TW6A 4ON0A 1RKTA 1V54H 3RKQA 1MBEA 3OOPA 2QZ8A 2VPRA 3DWLE 3FXJA 5D4SA 3IRRA 3GTKJ 1J75A 2EIMH 3A2KA 2QGUA 3K4BA 2R3SA 1ETKA 3Q0VA 3S16J 2XHKA 1DGWY 1T98A 2NAZA 3GFMA 3AL0B 2AO9A 1K83J 5B1AH 4ENMA 3GMEA 2LDUA 1FSEA 1KA8A 1V5EA 2F4IA 4KYWA 3UKGA 2O0YA 3QU3A 3LFUA 3GWZA 3I71A 3SEQA 3W2AA 1ZKGA 3A4CA 1MJAA 5LD2C 5E3LA 3I55I 4EATA 1QU3A 4LGWA 4BS9A 3CC7I 1TNTA 3ZQFA 4RAZA 4OAZA 1W1WE 2Y9YA 5FFZA 4BH9A 4JX5A 1UAAA 1EV7A 2MG4A 4BNCA 2CG4A 3FWEA 2FSWA 3EYIA 1ETWA 3QPLA 4A3LJ 1U5TA 3PNVA 2R5ZA 3NQOA 1WWXA 3BG6A 3ZQLA 3P9CA 4ABZA 3NARA 4EJTA 2XROA 3B73A 2DLLA 2Z3YA 2E1NA 2HVSA 1POGA 4ESBA 2VBYA 3CD6I 3J7AY 4N9HA 3JSPA 3CF2A 3Q0WA 1VQKI 2FBHA 2H27A 3GYHX 1U5TC 3IH3A 2BHZA 1A04A 2Y0SN 4A6EA 2NVQJ 2K27A 2M2EA 1HW2A 2R7ZJ 3BG3A 2BBYA 2EFQA 1S29A 2K40A 5FKNA 4BXUA 2Y31A 2VQCA 5D5VB 4GFBA 2H6BA 4P5OA 1SFXA 2W82A 1BR1A 5J1RA 4I6ZA 2DT7B 3CO6C 5EGOB 4M9XA 2V6CA 4BEHB 2KRHA 2VXDA 5E3OA 2CV2A 1GVJA 4Y4RA 1NG7A 5J4VA 1OFCX 3H9JA 3OV8A 2CMPA 1FNNA 3BPVA 3HKZA 1VQ5I 2JA5J 2JA7J 2Z16A 1H89C 2NOGA 3PSFA 5FKKA 1BC7C 3ZQQA 2MW8A 1SC7A 2R7VA 4BJTA 4CH7A 1ZG5A 2HOAA 2OUMA 4YIFA 1XN7A 1REPC 4XONA 3S3OA 1CQTA 3COAC 2FBKA 2STTA 5F04A 4IRGA 2EFOA 4IHSA 2DFIA 2VJ5A 4NC7A 1XS9A 4XN3A 3TDZC 2L7KA 2F5VA 3LA3A 4HV6A 3WU2C 2NVTJ 3G73A 2VC1A 5HLIA 3J81K 3ZOBA 5GTIC 2QYOA 2PBIA 2K85A 2M45A 1S8NA 3ROUA 3F22A 2UUZA 1W4MA 5ILUA 4G6DA 1TLHB 3Q5FA 3ZMTA 2VXZA 3F8NA 2MSYA 1W5SA 1D1CA 3FXKA 3ZP5A 1B4AA 2L9NA 5F27A 1FY7A 1IAWA 3R6SA 3OIQA 1USTA 1JJ8C 3CDHA 3H36A 1T56A 2DT5A 1WJ5A 2CV1A 5B66C 3H5RA 1WSUA 4PJLA 2V9KA 1X1AA 3BJOA 5EYRA 1GDTA 2CWEA 1R4MB 1B9MA 1I1SA 2OTLI 2D45A 1RKWA 2ZMEA 2ZXWH 1YIJI 2HTJA 1FC3A 3U9GA 4BDYA 2M9HA 2XAJA 1RR8C 4II2A 2IBDA 3MN2A 4Y15A 2DQRA 3Q9VA 4UB8C 2VONA 2DA7A 5E79C 3CO7C 1O3RA 4G7OF 1QPIA 2EA4A 1MBFA 3OR2C 2LC2A 3GBGA 5GAGJ 1XC5A 5H20A 1U2WA 2OA4A 2KFDA 4ZDOA 1A5JA 2XVCA 2ZMEC 2DK8A 4ZZLA 2K9LA 2IGOA 2OPTA 5FLVA 3WTXC 4LG0A 2EQRA 2ETHA 3FMSA 4JOMA 2WAFA 1ZR2A 2W7NA 3G1MA 3PL8A 2KJBA 4L0ZB 2LBFA 3HL2A 2BY2A 3L2CA 3DU6A 2DPUA 1B72A 1AKHB 3WTUC 4MIMA 1WJDA 5F1RA 2YPRA 3FMRA 4D1QA 3K0LA 4MNUA 3R4KA 3WTYC 3LNQA 3HRSA 2IS2A 3FBIB 4KNYA 1KU7A 4UUSA 4F52A 4HEA2 1Z21A 2DOEA 3BDDA 4RM2A 3KP5A 5FROA 2K3FA 1VQPI 4A3IJ 1B6AA 1F36A 4NBQA 1T95A 1B8IB 1FOYA 2CUEA 3DF8A 3OL3A 1VQ4I 3W6JB 1X2MA 2E5NA 4UV8A 1BIBA 1R1VA 3BR3A 2NS8A 4AU7A 4CZZA 2VUMJ 2ELKA 2DYRH 2MH2A 4IHTA 3H3VK 2NS0A 3VYSB 5IYCJ 4PK4A 2W48A 5K1YA 3TP3A 2CQ7A 2JSCA 2IGNA 3I5UA 4HSTA 3CC2I 3K1MA 1R9TJ 1MGTA 2BXYA 2KJCA 2QLZA 1WJEA 3FXQA 3AG2H 2Q8KA 2AQEA 1SD6A 2LNBA 4QPQA 2DA1A 3IP4B 2ZBKA 2JMWA 1TL8A 3GTQJ 2EIKH 1Z7LA 2RGVA 5GAHJ 5EG0A 1PP7U 1K4SA 2V1DA 3NAUA 2JTVA 3ML6A 2LLKA 4B09A 3FX3A 2ADUA 1YW8A 2GOXB 1FMVA 3MKYB 2FOKA 3QPTA 4BQNA 1VQ6I 2LY9A 3HSEA 2L2OA 4JBAA 3S14J 3S32A 1VZ0A 4C30A 5HODA 5BOXA 1R5HA 5K7FA 2WB1A 2KIFA 1HXDA 4KITB 4EGYA 2OQRA 2GM4A 2QBYB 1D0YA 3HOYJ 3HKZN 2P5LC 2PJRA 1IO2A 3QYEA 4A2UA 4PGHA 4DBRA 2QVOA 3ABMH 3OS0A 2V1XA 1F4KA 3CLOA 3PIPF 4Q5SF 2WY8Q 5CKTA 1Q1HA 4OIOF 5E1ZB 1NK2P 1K7AA 2Z1DA 3VOEA 1QHHD 1HKQA 1WVRA 3BZ6A 1FP1D 3J7YJ 4KT5C 1P4AA 2X6OA 1CF7B 4OMYA 4RGUA 1S7OA 3B02A 3GZ5A 1P9QC 1RI7A 4HNVA 2P6TA 5L3DA 1ZRDA 1BI0A 2IAIA 3DKXA 4EJVA 1ZTRA 1XGOA 3VPRA 4CCKA 4CCJA 1YTYA 4IRHA 2Y0MA 2D1VA 1BM9A 2X1CA 1LFUP 3AG3H 3F8FA 4BGDA 2E1MC 2E60A 1OCCH 4AYBA 4F7ZA 4PJJA 3KYDB 3CP2A 1VQMI 3K10A 1ETXA 2W25A 3S2WA 4BXFA 1HKTA 5HLGA 1K6YA 1LDDA 1DU0A 1Q1VA 3S93A 1Y56A 1W5TA 2M4KA 5HDNA 2R7QA 2ZJRF 2L7MP 4ZJZA 2ZXHA 2TRTA 1R22A 2QSFX 2N8GA 3K6GA 4C2TA 3RTRA 2E7XA 1OCZH 5F1JA 1D3YA 5DCMA 5K7HA 1HA8A 3CESA 5D6FA 3D1NI 2FMLA 3WODF 2WBMA 3CCQI 2UWMA 3E5XA 5ICFA 2DMQA 5JVGF 2E71A 4A3MJ 2R7OA 1PVEA 2E36A 3A01A 1OCOH 4NDLA 4TV7A 3JTGA 3HOWJ 5DYMA 2O03A 3TEDA 1SAUA 2LP0A 1Z3XA 2V7FA 3T0YA 1DU6A 2J5PA 1R71A 1ZRCA 1Y1WJ 4ZYEA 4M9SA 3S1RJ 1J59A 4U87A 2Z99A 1RUNA 4GYGA 1R49A 1N75A 1AU7A 3GO5A 2QENA 1FX7A 3H35A 3KEYA 3N05A 5L3GA 2VOOA 3MVPA 4BXXJ 2DMUA 2JA2A 1Z7UA 2WA0A 3I4MJ 2BYVE 4KA4A 1MIJA 4PJNA 5HDGA 3P9IA 4FETA 4HPQA 2B63J 3I9V2 2WY7Q 5FB2A 1E2XA 4DZJA 1D5VA 1JXSA 1XG1A 4D7MA 2KZGA 2BZTA 2EILH 1G2HA 4M3DA 2C6YA 1K61A 1UFMA 4QIWN 4II3A 4UVCA 4RB2C 2A69F 3SEZA 4PFPA 3J81Z 2FNAA 1HSJA 1TZLA 2KMUA 3LAPA 3KEQA 3DCFA 4CICA 3HIFA 2P7VB 3HOZJ 4UB6C 4U7BA 2JPBA 4I98B 3F8MA 2ZSHB 5FD6A 4G6TB 3SFZA 2JWTA 1KONA 3ZQGA 4XRSG 3ONQA 1DPUA 4XKBA 4UXNA 5M3FJ 2DAOA 2FXAA 4G9YA 3F6VA 2HU9A 1JUSA 1MNMC 1X19A 3E97A 3K1NA 5ERIA 3WG9A 1OLTA 3ERED 1E3HA 3DTKA 4EJWA 3H92A 5FLMJ 5KCMA 4FASD 1QZYA 3Q9SA 2YUSA 2L4MA 1HF0A 4XR6A 3HUGB 1UG0A 4UV9A 5F64A 2UXNA 4CHUA 4YIRX 4CZCA 5E3NA 1JTYA 1DPRA 4HLYA 4ZYDA 3LOCA 4LLNA 1ZRFA 4LG3A 5EGOA 3PUBA 4KT6A 1U6GA 5GP9A 3I64A 4BEHA 3JSOA 3IWFA 2V9PA 3WTWC 4NNJA 3M1CA 4D0PA 2DMPA 2XF5A 4A3BJ 2OAZA 3ASNH 2DDBA 1YITI 2VIXA 2ZXIA 3F21A 1DP7P 4KMFA 1HKSA 3A0HC 1HC8A 1JKRC 2VBZA 3EDPA 2O7OA 2JRTA 5EDNA 3H9GA 3RCOA 3HOTA 1WFXA 5B1BH 1HBXG 4F92B 2AXLA 2NVUB 4L9NA 1KQ8A 4LIVA 4P96A 5HNFA 1FTZA 1T33A 1HDDC 4L9VA 3SZPA 1MNDA 5ICEA 5HNHA 4Y33A 3RPUA 2G9WA 4HBLA 3I58A 5TISC 4Y17A 5LHIA 5DD4A 2V6EA 3CMEI 2IT0A 1KGSA 3V4GA 2I8DA 5J6XA 2MC3A 3VSKA 2EZKA 4AYBN 3I0TA 1PUEE 3BR5A 3C1DA 3KP6A 1WRJA 2ACJA 5M5YJ 3GTJJ 2M4GA 4MFEA 1JGSA 4LD5A 1SAXA 4ZZDA 4Z6YA 2LKPA 2VE9A 1MDMB 2LRDA 3F8BA 1R5GA 2CUFA 3M8EA 3MZHA 1TW3A 1GT0C 3W3CA 4XKWA 1BOAA 4O6JA 3V8LA 1MBHA 1QHGA 3D5RC 2K5CA 4ZC3A 1IRZA 3SJMA 3JRDA 4QSHA 2P5VA 1OR7A 4MGRA 2NRAC 2W1OA 1AOYA 3A1YA 2RQQA 1WZ2A 4ZYAA 4F91B 4NB5A 2FA5A 2AS5F 3E0JB 3CMMA 5IYBJ 3JREA 4I01A 2IS6A 2VOPA 2F5EA 2Y48A 3FXRA 2COMA 3S17J 1XMAA 1Y0NA 4GXOA 1K4TA 2LTPA 1LJ9A 4M6XA 4E7KA 1XMXA 2VKDA 2EV0A 2H1KA 5H6QA 3H0DA 1X1DA 4WXDA 1AA7A 3M7GA 1S7EA 1BL0A 2EPFA 3OYKA 3ZMZA 3V42A 4E7IA 1TT0A 4LIUA 2VBXA 4XSZF 3HB9A 3FXUA 2Y9ZA 1PUFB 1Y6IA 2D5VA 1QVTA 3VB2A 3WE2A 2VN2A 4I0BA 4BHBA 1AKHA 3PUFA 2O8KA 4HF2A 1W0UA 1LE8B 5FJ8J 2CUZA 3WGIA 2VKEA 3OYCA 1DGRM 1FBUA 1GUUA 2EH3A 1Z6RA 2PMZA 1MBGA 1ACIA 2CQXA 2E7WA 2RNJA 1ZYRF 3RYPA 3IC7A 2FRHA 1D0ZA 4AWXB 1X2NA 1ZG3A 3PO2J 4XKCA 5D4RA 2CFXA 1LDKB 5C4JJ 2EIJH 4MQ9F 2EV5A 2R7FA 3LSMA 2XV4S 5F08A 1HDPA 4YELA 3NRVA 1B8IA 1NK3P 5KHDA 3SQNA 1S72I 3MZYA 3V7CA 2VLAA 2HDDA 4EVIA 1J0RA 1YJNI 2X6YA 1SVOA 5JFRA 2BVLA 3F23A 4A3KJ 2A5YB 4E7ZA 2GIZA 5EEHA 3RSNA 3DP7A 3CZ6A 3HXLA 2VT3A 3KX2A 5LRRA 4B47A 3K4LA 1U3EM 1XCBA 2VQLA 2GZWA 2VJJA 1WJFA 5AONA 1W7PB 4HQMA 2I10A 5HDKA 1UHWA 2IGMA 5F0FA 4C9YA 2JUGA 4OIPF 4C2MJ 2CU7A 3T5XA 2GIVA 1LNWA 5LEKA 3E6CC 4GDFA 1Z0XA 2JSPA 1VQNI 4RM3A 2J5OA 4PSXA 2NS7A 4L9TA 3HBLA 1TWHJ 3GTLJ 3K4NA 2EB7A 3KP3A 1MMSA 2X9DA 4HYEA 2EBIA 4JQFA 4KN7X 3QYFA 2A61A 2F4MB 2Q2EA 1JHHA 3EUHA 2VBWA 1I3AA 3K4JA 2PEXA 1NH3A 2L5QA 2X6WA 4EV0A 2CH0A 5IOZA 2PI0A 4A6DA 3I3LA 2HXOA 3G3ZA 4MEYF 3MAJA 3LSIA 1HW1A 2X0LA 3EPZA 2RN7A 2OF7A 3CJRB 1H88C 3LA2A 1D5YA 3ZCOA 2OZUA 1R00A 1ODDA 1STZA 3ERMA 3TBIA 2QBYA 1FOWA 3CC4I 1Z67A 2ZC2A 3EUHC 4MTDA 2DA6A 2FE3A 2Z33A 3OYAA 1Z6TA 3LSTA 3TOBA 4Y7NJ 2UZKA 4A12A 2KIMA 5LLQA 3QPSA 1BN5A 5LEJA 4HRIA 3DFGA 2L7ZA 3G4SI 2BE5F 2HPIA 2DW4A 4XLEA 1X3UA 2ISZA 2E2JJ 1S5LC 3CCYA 2ZNYA 1FYLA 3ULQB 1RC9A 1EA3A 2DA4A 3ZXSA 4YFNF 4CDGA 1CF7A 1EF4A 3Q0UA 3SDGA 5HLHA 4FX4A 3ZQIA 4L5IA 1T08B 3CCRI 2V4JC 2E35A 3WTVC 2XGDA 1VQ8I 2XSDC 3QP5A 3HHHA 3TO6A 3HJEA 1E0EA 2DJNA 2EZLA 1XX5A 2VKHA 2W85A 2L01A 1BW5A 3HM5A 1JUMA 5IP6A 1FPQA 2WTEA 1WKMA 4DZPA 1TT5B 1UMQA 5ED4A 4X6AJ 1HLVA 1JUPA 3U1KA 1I27A 4M3GA 4HV5A 4PCQA 1YI2I 3OYIA 5D6EA 1BJZA 2DFFA 3ZQHA 3IUOA 1Z05A 3NWTA 1SVLA 4MQVA 3KCCA 5DV5A 1ZG1A 3F9KA 4P9FA 1FMWA 2HYFA 3V7RA 4RDUA 1IF1A 2DFHA 3PNTA 1O7FA 1M1EB 4A3EJ 1FOXA 2V1NA 1NG6A 4UVBA 2P81A 4FT8A 4OIQF 1ERDA 3DBLB 3ZMSA 3ZQCA 2FF4A 4CCOA 1WJAA 3RYRA 3HOUJ 3C7JA 4CCNA 4CSWA 1BW6A 3BPXA 3S1NJ 2IA1A 3WTZA 2KIQA 2RNGA 3IAM2 1KU9A 1I6HJ 3BQZA 3O2PE 5J1UA 3PFIA 1BIAA 3FHNA 2LK2A 5LGNA 3ESWB 2ME0A 3L2RA 5DTDA 3PQJA 3QODA 2COBA 2RV8A 2JT1A 3FXMA 5KAFC 2ZFWA 4RS8A 4E6KG 3KLOA 4BE1A 2BY1A 4M74A 4CO8A 3K70D 2HPMA 2XRLA 1TNSA 4GYIA 1X4PA 5KVRA 3MZ8A 3TP0A 3GTOJ 1XGSA 2IJLA 3FKIJ 3E7LA 1I39A 3CP8A 5CVUA 4Z2YA 3OS1A 1MMGA 2M87A 2LMDA 2E2IJ 2A68F 3JRGA 3KFWX 1V5FA 2PMZN 2KDOA 5JHUA 4B44A 4IOAF 2R7RA 1ZAOA 2LF8A 5DS9A 4W97A 4KDPA 3VYUB 4GO1A 3HZJA 1IXRC 2KZVA 3QYBA 3J7ZI 4S04A 1QVUA 1YW7A 3LSPA 1TP4A 3F0CA 4LFUA 4P9UA 4S0HB 5CVRA 4FISA 3SHFA 1XSXA 2MH9A 2DT6A 3H3UA 5K5OA 4V2FA 5GPAA 3K70C 3VFZA 3OMYA 4P55A 3BOQA 3ZN1A 2PMUA 5TJJA 1B59A 5GADJ 2YR2A 3CCLI 2LKXA 1ZR4A 2FD5A 3RKYA 4A93J 3DEWA 5CQGA 5GAEJ 4IRIA 2QWWA 2KP6A 4B43A 2EA2A 2EJRA 2IEKA 4YG2F 1IJWC 2MC4A 2LVSA 4D5FA 2V9VA 4CYCB 4G8XA 1KYZA 2DI3A 4EM2A 2FUG2 2R7DA 2FBIA 3GLXA 3CDIA 1XB4A 2EWNA 4MFDA 5M3MJ 3MKLA 3HPHA 3CJQB 1NTCA 2PMHA 4XK4A 3ZR8X 1TWCJ 4HX8A 4OINF 5KK1A 3IH2A 1XD7A 2LOOA 2DYSH 1TWFJ 2HYGD 3L09A 3JTHA 3E5UA 1LB2A 3LSRA 3V7SA 5FD5A 2LYCA 4AD9A 1R58A 2A5WA 2BW3B 3GVAA 3HUGA 2XGCA 3OY9A 4DJAA 1GV2A 4QTRA 1MSEC 2AXTC 4LMYA 1NHAA 4LLGF 2BY0A 1YJ9I 2R93J 5C4XJ 3ZMUA 2HOSA 1ZK8A 3K2ZA 4KFCA 1OJLA 4KN4X 4IPAA 3IHUA 4Q48A 2ZNZA 1Z91A 5CVJA 2OCEA 1FEXA 1LDJA 1ETOA 5CJ9A 1S9HA 2Q0OA 1QA6A 2GXAA 3T8RA 1IRXA 3RJPA 1KQ0A 3KETA 2L9RA 2YS9A 1ETVA 1FBQA 2HGCA 4XNFA 4XLHA 2A3SA 2FJ1A 3HSFA 2P6SA 4OOIA 5KAIC 1K79A 4NC6A 4BYYA 4V2GA 1U5TB 3CUQA 3CMYA 2R5ZB 4BE2A 4AIJA 3FXOA 4CCLA 1Y8QB 2W84A 2VASA 2E1OA 3I59A 4EMSA 1YRNA 2X1DA 1K78A 1R6RA 1Y39A 3KEOA 5KNLA 5B3SH 3VWBA 2WADA 1F43A 1F9NA 2TCTA 3BJ6A 3FHZA 2VODA 4A5MA 3PSIA 4YFKF 1D1AA 4XRMA 3OYHA 3G71I 3CUQC 1PP8F 1X3WB 1OPCA 3F3XA 3DEUA 3L1PA 2BHYA 3HGYA 2R7UA 4DOZA 4G7HF 1IGNA 1GV5A 1E17A 1DP3A 2MD5A 4L18B 1G4DA 5ICCA 1GVDA 4IQJA 1O4XA 3OS2A 2X48A 2H8RA 3PO3J 1KU3A 2EV6A 4R1HA 2VC0A 1HCRA 4OMZA 3FMQA 2KIUA 2XF6A 1JKOC 5IT9K 4KICA 1VFCA 2MD0A 1BI3A 3GTGJ 3B6AA 4BHCA 3A02A 4QLCU 2HKXA 3CTAA 4PSWA 4BQAA 3RQIA 3MD2A 4IHYA 1PJRA 3VDXA 2NVYJ 4HNTA 1EJ9A 2FEZA 1K6OA 4FQGA 1XCVA 4U0WA 2HDCA 4U0YA 3BY6A 1HQCA 4AIHA 1P7JA 1YX3A 3K2AA 4IVNA 3VSLA 1O57A 4ITVA 2XIGA 4NUBA 3GZ6A 2ZFUA 4OU0A 2O5RA 2QF7A 4RGXA 1YJWI 1RNLA 3KP7A 1Z9CA 2P8TA 4I2OA 3CLQA 2K9QA 1RR7A 2AHQA 3FBNB 1VQLI 2G7HA 2HXIA 1A31A 1SD4A 4BY1J 5AIPA 1ZREA 1MBJA 2O3FA 3GF2A 4XLNF 1E3OC 2ISYA 4M71A 4XRSA 1FZPB 4D5CA 3M3YJ 1X1BA 2L02A 1L3LA 4HNUA 2PJPA 3OYLA 5DDGA 1ZGJA 3FIWA 4D7NA 1YLFA 4BACA 3SDBA 4ZH4F 3M9AA 4A3JJ 5JVTA 3LMMA 3BR2A 3GUDA 1ZGWA 4J19A 1LFPA 4XOPA 5E8GA 4UHTA 2DQLA 2NNYA 3A03A 2VQGA 2H8WA 4HSRA 5LRSA 1O3SA 3MEXA 3JCUC 2X4HA 2CQNA 2ZMEB 1ULYA 3DLLF 1IN5A 4BAYA 1HW5A 5LBQA 1R4NB 4LJZF 2MGQA 4JP0A 2DJIA 2LR8A 3H3ZA 1P4XA 2YX7A 4RAYA 2CSOA 1H0MA 2FQ4A 3MKZA 2EFWA 2CO5A 4H0EA 1W0TA 3I4NJ 4UVAA 5L3CA 3IKTA 2CV0A 2HR3A 2QCOA 2R5YB 3K69A 3E5QA 4IL6C 1J9IA 1FIAA 4A69C 5EZGA 3AL0C 4RB3C 5JI6A 3K4KA 2FOWA 3ABTA 2QQ9A 1IDYA 1G3SA 5IY5H 4CCMA 3KIOA 4G94A 1BC8C 3M07A 1XDUA 3IAS2 1J2XA 5CPRB 4H4KC 4B8XA 3CCVI 2E1CA 1WHUA 2BEOA 5D8LB 4LOCA 2LF7A 2LBFB 2IRFG 5HS8A 3QQAA 4RB0A 2M5WA 1BBYA 1FBSA 5FKOA 3KP4A 5HOOA 3BR6A 5DCFA 2L54A 2HDWA 1ZLJA 4ASNA 4UUSB 3MMYB 1VTNC 3HDDA 3O8HA 3WHCA 4FE4A 5E1XA 4LK0F 4BKXA 3EQLF 1U0JA 1UB9A 4KIBA 1O3TA 2XB0X 1EH7A 3OIOA 4I76A 2PX9A 5J47A 1R1TA 3JRHA 1RPWA 3BTLA 2UV1A 1I1GA 1R23A 3OSGA 3JAMZ 3F72A 1S3JA 1IXSB 2HZDA 2IVMA 2QSHX 2HVRA 1ZELA 5BQTA 3OIPA 4O5VA 3BG9A 4F55A 3RKWA 2ECBA 3CCMI 2W00A 3N4MA 4NQWB 2GWRA 3WG7H 3GFJA 4BU2A 1IN4A 2M7BA 3OYGA 2K4JA 2H94A 4Y13A 1MMAA 1SEUA 4B3AA 4B4CA 5EJCA 2GQQA 3R0AA 4FX0A 3FDYA 1WI9A 1FYMA 1J5YA 1R1UA 3QPHA 4F3QA 5LHGA 3GZNB 2NVXJ 4U7DA 1GHCA 3KYCB 1G59A 5D8KB 2OTJI 4C3JJ 3HRUA 2IGKA 2V26A 3JRBA 3WGGA 4Y52J 2GA2A 1GXQA 4IEJA 3WU1B 5JR3A 2PLYA 3FKJA 2F5DA 3BJAA 5FKMA 3D5SC 2ME6A 1ZARA 4U88A 2RC4A 1SANA 3SFIA 5BS6A 3M4OJ 4M3FA 1X58A 1Y0UA 2DK5A 3GTMJ 3W2VA 4EQQA 1YHQI 3ECOA 1SD7A 4M6YA 2JVGA 1Y1VJ 1BJAA 3GCMA 1WI3A 3SYTA 4E7HA 3DXJF 3GFIA 3IH4A 2VI6A 4EM0B 1F1ZA 4NC8A 3E3VA 3AAFA 2HZTA 5C44J 2ID3A 2L0KA 4ESFA 4A3GJ 2BXZA 1TQIA 3QAHA 1U8BA 4HW0A 2PJRB 1OYWA 2A6EF 3TDUC 4HDUA 1KQ9A 3PNYA 5FFXA 2WAEA 4XLCA 1YE9A 5M5XJ 1XSVA 2HEOA 3TL4X 3IWZA 5L3EA 3H9QA 3EUKL 3LSKA 1OYIA 3ABLH 5J8FA 1FP2A 3PQKA 1R7JA 2LKSA 1HSTA 2E1MB 2KQRA 1JHFA 4ZYHA 5DM6F 3CCEI 2JUCA 4E7JA 1LEBA 2E2HJ 1X4OA 5IYDJ 2RDPA 2GAUA 4JX4A 1V5GA 2R7WA 1LQ1A 1E3PA 3S3NA 2WAQN 1IUYA 3ABUA 1P7IA 3P7NA 3PIOF 1SMYF 2TDXA 4RAFA 1O3QA 2P5KA 3FF5A 1OCTC 3K7AJ 2LD5A 3E6BA 1OR7C 4XMYA 4IXAA 5BNGA 3HG9A 3BROA 1G6NA 1TWAJ 1IN6A 1W36D 4DYRA 2Y75A 1OKRA 4FHTA 1Y8RB 3RPQA 2JZYA 3JRIA 1VQ9I 4G12A 3FM5A 4M3EA 1JTXA 4PFOA 5E3MA 1PDNC 1WQ2A 2KPMA 2KKOA 3K4CA 5E1WA 1QQIA 2ESNA 3ZMVA 3RZDJ 4M6VA 2Z5UA 5HVQC 2BOLA 1X1CA 2CQQA 1TQMA 1YS7A 2DA5A 4RA2A 3T8TA 3R60A 2DMNA 2FNPA 2RVCA 1HOMA 3HEFA 1FSHA 4M72A 1P4WA 1TQPA 4LB6B 3R61A 1QO0D 4ZTJA 2CYYA 2LREA 4M9ZA 4ETSA 5FGMA 1T8IA 2YU3A 4ENJA 5CVVA 2L4AA 1W36C 4BUPA 1IXCA 1LFBA 1UHMA 2LH9A 4WF2A 2KDZA 2GXGA 2QEXI 1QBJA 2KRFA 3OYJA 4IKFA 2XAFA 2RQPA 2GXBA 4WWCA 2R0QC 3L9FA 3F8CA 4E70A 2A05A 3GX4X 3DTIA 3S8PA 5IT9Z 1R36A 1VQ7I 5BMZA 3OSFA 4UUVA 2PFBA 4CYDA 2F5CA 2DODA 2MLGA 3WTTC 5H6RA 2QSGX 2X6XA 2BW3A 2ZXJA 4XL9A 2HQAA 3QU6A 4C3HJ 5E8IA 3BZKA 4YRVA 3G1LA 3GFLA 1FIPA 1MZBA 4I02A 4KMUX 3LAJA 1IUFA 1CGPA 4Y3OA 3CQZJ 4CGZA 5AIQA 5DEQA 3IRQA 3JRAA 5J4YA 1T39A 1UJ8A 2QUFA 3RQ4A 2ZJPF 3J7AO 1QPMA 2HYJA 1ZN2A 2X85A 1N78A 4UUTA 1FT9A 5J40A 1YS6A 5GPCA 3S2DJ 3CJNA 4N0BA 1BR4A 5TGTA 4XQFA 4IHXA 1U9OA 2D2WA 1BI1A 3M8JA 4UNOA 3IKVA 1XPXA 1EH6A 2Z9OA 1JGGA 4AUXA 3U2RA 1MSFC 3U21A 2B7EA 4XLFA 1P92A 4B48A 4E7LA 4RMNA 2XF7A 4ENKA 3H5NA 5H2FC 2A07F 1T38A 1VQOI 3ABKH 3TO9A 2K9NA 3HOSA 1X3ZB 3FISA 2VJ4A 4ENNA 2DDAA 2R4GA 4AIKA 2F48A 3H1CA 1ITYA 3DLAA 3QRFF 2HI3A 2HQNA 3JR9A 2FQ3A 4D9JA 1SFEA 2KLOA
chains in the Genus database with same CATH topology
2O6GE 3LQRA 5DD8A 3T1BA 5LGUA 3ZQ7A 5ICGA 2V1UA 2EFNA 5HS9A 4I0AA 2XAGA 2XRNA 3FZVA 4R8HA 2VE8A 5K5RA 5A2QK 1FWZA 3HHGA 1P6RA 2K02A 2XGXA 1JE8A 1U8RA 2IW5A 3BP8A 1MKMA 2H6CA 3ISPA 3HTSB 4WXHA 2HS5A 1S6LA 1XMKA 1V4RA 2MLKA 5FLXK 1L0OC 1EH8A 1F5TA 1D8JA 4KIFA 2BV6A 1OMIA 5E17F 4L9JA 2WC2A 5F6FA 4OIRF 3CUOA 3JAMK 3ELKA 3SZTA 2HWVA 4PDKA 2QQAA 4R79A 2ZKZA 4A5NA 4EGZA 2GA1A 2HOEA 2LSOA 1ZGAA 2ZCWA 5D5WB 2CQKA 3ZMDA 4PZJA 3E6MA 1P2FA 3FM3A 1QNTA 1T6SA 5LHHA 1KYWA 1DDNA 4KIGA 1AWCA 3RDIA 2DPDA 1BI2A 3DQVC 3DPLC 1H9GA 1USSA 2HKOA 3I53A 4G6QA 2EFPA 2OD5A 4LB5A 1UCRA 2A6HF 1T2KA 1G3YA 2OBPA 3E6DA 4XRFA 2JPCA 1YO5C 2DBBA 3TOAA 3KZYA 3V8JA 4ESJA 3ZN0A 3GXOA 2XAQA 2STWA 4U0VA 2YSRA 3LA7A 2PN6A 6PAXA 3GW2A 4HQEA 2FMYA 3M8FA 5E20A 3O3KA 3L7WA 1ZH5A 1ZHFA 5D5XB 5IT3A 1O7LA 4NQWA 4EM1A 1IZ1A 2OZ6A 3J80K 1RUOA 1YYVA 5L3BA 4HZFA 4LLLA 1IN8A 4HX7A 4HA8A 4XLPF 1SFUA 3LQQA 2K4BA 2IP2A 2B0LA 2ZO4A 3TO7A 1XSDA 1G3TA 3GEZA 3NEUA 3HRTA 1TBXA 5TRDA 2VT2A 5EEGA 3WGHA 1KU2A 1I6XA 5D5UB 3ZPLA 1MDMA 2XASA 4HDVA 4MEXF 3C18A 4KUMA 1TW2A 5LGTA 4WX9A 1DUXC 1QZZA 2L3DA 1RZ4A 3O6BB 4EJUA 4I7HA 4M73A 2MA3A 3P9KA 4AVPA 3M1EA 2O61A 2MBFA 5L3FA 1G3WA 1XDSA 5J8CA 5CLSA 5DUIA 3WTSC 1XGNA 3WE3A 3KP2A 4BHPA 4HLXA 1SD5A 3N97A 2WWYA 2G7UA 4DNCA 2O8XA 4A0YA 2F2EA 2CW0F 4L0YB 1MJ9A 1C0WA 4HAMA 2OU2A 1W7PD 3DPTA 4YIIA 2ELHA 2EK5A 3HSRA 5DUKA 1LEAA 2UXXA 3L00A 1W7PA 2P4WA 2HFHA 4RGSA 4S05A 2DTRA 4HOBA 5A2QZ 2CGPA 2DO7A 3VODA 1S7AA 4CXFA 3EYYA 3SXYA 3HTUA 1LVAA 4Q47A 2IA0A 2W57A 1ON2A 2HQRA 2W24A 3TKYA 4LG0B 5ILVA 2BGCA 4GGGA 4XBFA 3TGNA 4NHJA 5FLXZ 2YX4A 4GCVA 4HX4A 5CYVA 1H9TA 3BWGA 5K5QA 3W6KB 2OQGA 3KLNA 3IL2A 4XSXF 3RIRA 1IRGA 2M8EA 1J7KA 1ON1A 4WXCA 3LFKA 4I09A 2PQ8A 4HF0A 2QQBA 1V3FA 2ESHA 1GXPA 4A0ZA 4RB1A 5BPIA 1IN7A 5FO5A 3C3WA 1B9NA 2K86A 1YG2A 3RI4A 2V79A 3QOPA 3MCZA 1RIOH 1ZLKA 4G7ZF 2IPQX 1MD0A 3DKWA 3RKXA 3F6OA 3DV8A 3JW4A 5HS7A 4HF1A 4YFXF 1T0FA 1I5ZA 2XUBA 2IA2A 3I54A 4ZYGA 2ZJ2A 3KZZA 4WK8F 4DQ2A 4Q4ZF 2RKHA 3CUQB 3REOA 2FU4A 1ONVA 2H09A 1MJBA 2M30A 3LWFA 3I59B 1K78B 2D1HA 1IW7F 2XKOA 5ILSA 3EETA 3ECHA 4MHGA 1FYKA 3KE2A 2HTSA 4L5JA 4RGRA 1FLIA 1TTYA 5E18F 4LK1F 1B1BA 1IRFA 1OYYA 4MTEA 1QGPA 3HRMA 4WCGA 4N9IA 4A0XA 4IF4A 3J80Z 5BPDA 2QM3A 2DU9A 4EJOA 2NYXA 2NNNA 4JK1X 1Z1DA 3MQ0A 1YFHA 2M1BA 1YQAA 4IJAA 3TQNA 3D0SA 4PGGA 3V8KA 1U78A 3MFKA 2WV0A 1SMTA 4K2EA 3U1DA 5DCMB 2XAHA 3VEPA 1D8KA 2XKPA 2PG4A 1FOKA 2K7LA 4QWQA 3I4PA 3K9TA 3K1PA 3D5LA 1YIOA 4O3MA 5CVIA 3MWMA 2P7CB 3HYIA 1YW9A 1XGMA 3QP6A 2F5FA 3WU0A 3R0JA 4ON0A 3OOPA 2QZ8A 5D4SA 3IRRA 1J75A 2R3SA 2XHKA 1T98A 2NAZA 3GFMA 4ENMA 2LDUA 1FSEA 1KA8A 4KYWA 2O0YA 3QU3A 3GWZA 3I71A 1MJAA 4LGWA 1TNTA 4RAZA 5FFZA 4BH9A 1EV7A 4BNCA 2CG4A 3FWEA 2FSWA 3EYIA 1U5TA 3NQOA 1WWXA 3P9CA 4EJTA 2XROA 3B73A 2DLLA 2Z3YA 2E1NA 4ESBA 2VBYA 4N9HA 3JSPA 2FBHA 2H27A 3GYHX 1U5TC 1A04A 4A6EA 2K27A 1HW2A 2BBYA 2EFQA 1S29A 4BXUA 5D5VB 2H6BA 4P5OA 1SFXA 3CO6C 4M9XA 2V6CA 1GVJA 3OV8A 1FNNA 3BPVA 1BC7C 1ZG5A 4YIFA 1XN7A 1REPC 3COAC 2FBKA 2STTA 4IRGA 2EFOA 4IHSA 2DFIA 3TDZC 3LA3A 4HV6A 3G73A 2VC1A 5HLIA 3J81K 2QYOA 2PBIA 1S8NA 2M45A 3ROUA 3F22A 1W4MA 5ILUA 3Q5FA 1TLHB 4G6DA 3ZMTA 2VXZA 3F8NA 1W5SA 3ZP5A 1B4AA 1FY7A 1IAWA 3R6SA 1USTA 3CDHA 2DT5A 1WSUA 3BJOA 2CWEA 1B9MA 1I1SA 2D45A 2ZMEA 2HTJA 1FC3A 3U9GA 2XAJA 4Y15A 2DQRA 3Q9VA 2VONA 3CO7C 1O3RA 4G7OF 2EA4A 5H20A 1U2WA 2OA4A 2XVCA 2DK8A 4ZZLA 3WTXC 4LG0A 2ETHA 3FMSA 2KJBA 4L0ZB 3L2CA 2DPUA 3WTUC 5F1RA 2YPRA 3FMRA 3K0LA 4MNUA 3R4KA 3WTYC 3HRSA 4KNYA 1KU7A 3BDDA 3KP5A 1B6AA 3DF8A 3W6JB 4UV8A 1BIBA 1R1VA 4CZZA 2MH2A 4IHTA 2NS0A 5K1YA 2JSCA 3I5UA 3K1MA 1MGTA 2QLZA 2KJCA 3FXQA 2Q8KA 1SD6A 2LNBA 2ZBKA 2RGVA 1PP7U 2V1DA 2JTVA 3ML6A 4B09A 3FX3A 2ADUA 1YW8A 2FOKA 3QPTA 3HSEA 4JBAA 5BOXA 1R5HA 2KIFA 1HXDA 4EGYA 2QBYB 2OQRA 2P5LC 4A2UA 4PGHA 2QVOA 2V1XA 1F4KA 3CLOA 4Q5SF 1Q1HA 4OIOF 5E1ZB 1K7AA 3VOEA 1HKQA 3BZ6A 1FP1D 4KT5C 1P4AA 1CF7B 4OMYA 4RGUA 1S7OA 3B02A 3GZ5A 1RI7A 2P6TA 5L3DA 1ZRDA 1BI0A 4EJVA 1XGOA 1YTYA 4IRHA 2Y0MA 2D1VA 1BM9A 3F8FA 4F7ZA 2W25A 1HKTA 3S2WA 5HLGA 1LDDA 1W5TA 5HDNA 1R22A 3RTRA 2E7XA 1D3YA 5DCMA 5D6FA 2FMLA 3WODF 2UWMA 3E5XA 5ICFA 3JTGA 4TV7A 5DYMA 2O03A 3T0YA 2J5PA 1ZRCA 4ZYEA 4M9SA 1J59A 2Z99A 1RUNA 4GYGA 3GO5A 2QENA 1FX7A 5L3GA 2VOOA 1Z7UA 2BYVE 4KA4A 5HDGA 3P9IA 5FB2A 1E2XA 1D5VA 1JXSA 2C6YA 1UFMA 4UVCA 4RB2C 2A69F 3J81Z 2FNAA 1HSJA 3LAPA 3KEQA 4CICA 3HIFA 2P7VB 4U7BA 2JPBA 4I98B 3F8MA 5FD6A 3SFZA 1DPUA 4UXNA 2DAOA 2FXAA 4G9YA 3F6VA 3E97A 3K1NA 5ERIA 3WG9A 3ERED 4EJWA 3H92A 1QZYA 3Q9SA 2L4MA 4UV9A 5F64A 2UXNA 4CHUA 1DPRA 4HLYA 4ZYDA 4LLNA 1ZRFA 1U6GA 3I64A 3JSOA 3IWFA 3WTWC 4D0PA 2OAZA 3F21A 1DP7P 4KMFA 1HKSA 2VBZA 3EDPA 2JRTA 3HOTA 1HBXG 2AXLA 1KQ8A 4L9NA 4P96A 4L9VA 3SZPA 5ICEA 3RPUA 2G9WA 4HBLA 3I58A 4Y17A 5LHIA 5DD4A 2IT0A 1KGSA 3V4GA 5J6XA 2MC3A 3I0TA 1PUEE 3C1DA 3KP6A 1WRJA 2ACJA 1JGSA 4LD5A 1SAXA 4ZZDA 2LKPA 2VE9A 1MDMB 3F8BA 1R5GA 3M8EA 3MZHA 1TW3A 3V8LA 1BOAA 4O6JA 2P5VA 1OR7A 4MGRA 2NRAC 1AOYA 4NB5A 2FA5A 2AS5F 4I01A 2VOPA 2F5EA 2Y48A 3FXRA 2COMA 1XMAA 4GXOA 1LJ9A 4M6XA 2EV0A 5H6QA 4WXDA 3M7GA 3ZMZA 4XSZF 2VBXA 3FXUA 3VB2A 3WE2A 2VN2A 4I0BA 4BHBA 4HF2A 3WGIA 1FBUA 1Z6RA 2E7WA 2RNJA 1ZYRF 3RYPA 3IC7A 2FRHA 4AWXB 1ZG3A 5D4RA 2CFXA 1LDKB 4MQ9F 2EV5A 2R7FA 2XV4S 3NRVA 3SQNA 3MZYA 3V7CA 4EVIA 1J0RA 5JFRA 3F23A 2A5YB 5EEHA 3DP7A 2VT3A 5LRRA 1U3EM 1XCBA 2GZWA 5AONA 1W7PB 4HQMA 5HDKA 1UHWA 4OIPF 3T5XA 2GIVA 1LNWA 5LEKA 3E6CC 2J5OA 4L9TA 2EB7A 3KP3A 4HYEA 4JQFA 4KN7X 2A61A 2Q2EA 1JHHA 3EUHA 2VBWA 2PEXA 4EV0A 2PI0A 4A6DA 3G3ZA 4MEYF 3MAJA 1HW1A 2X0LA 2RN7A 3LA2A 2OZUA 1R00A 1ODDA 1STZA 2QBYA 4MTDA 2FE3A 2Z33A 1Z6TA 3LSTA 3TOBA 2UZKA 4A12A 2KIMA 5LLQA 1BN5A 5LEJA 3DFGA 2BE5F 2DW4A 1X3UA 2ISZA 2ZNYA 1FYLA 3ULQB 1CF7A 4YFNF 4CDGA 5HLHA 4FX4A 4L5IA 3WTVC 3QP5A 3HHHA 3TO6A 2W85A 2L01A 1FPQA 2WTEA 1WKMA 5ED4A 1I27A 4HV5A 4PCQA 5D6EA 1Z05A 4MQVA 3KCCA 5DV5A 1ZG1A 4P9FA 2HYFA 3V7RA 1IF1A 1O7FA 4UVBA 4OIQF 4FT8A 3ZMSA 2FF4A 3RYRA 3C7JA 3BPXA 2IA1A 3WTZA 1KU9A 3O2PE 3PFIA 1BIAA 5LGNA 3PQJA 2RV8A 2JT1A 2ZFWA 4RS8A 3KLOA 4M74A 4CO8A 1TNSA 4GYIA 5KVRA 1XGSA 2IJLA 5CVUA 4Z2YA 2M87A 2A68F 3KFWX 5JHUA 1ZAOA 2LF8A 4KDPA 4GO1A 1IXRC 4S04A 1YW7A 4LFUA 4P9UA 5CVRA 3SHFA 1XSXA 2MH9A 3H3UA 5K5OA 3VFZA 4P55A 3BOQA 3ZN1A 2PMUA 5TJJA 1B59A 2YR2A 3RKYA 4IRIA 2QWWA 2EA2A 2EJRA 4YG2F 2V9VA 4G8XA 1KYZA 2DI3A 4EM2A 2R7DA 2FBIA 3GLXA 1XB4A 2EWNA 2PMHA 4HX8A 4OINF 5KK1A 1XD7A 2HYGD 3L09A 3JTHA 3E5UA 1LB2A 3V7SA 5FD5A 4AD9A 1R58A 3GVAA 3HUGA 4LMYA 1NHAA 4LLGF 3ZMUA 3K2ZA 4KFCA 4KN4X 4IPAA 3IHUA 4Q48A 2ZNZA 1Z91A 5CVJA 1LDJA 5CJ9A 2Q0OA 3T8RA 3RJPA 1KQ0A 3KETA 1FBQA 2HGCA 2A3SA 3HSFA 2P6SA 4OOIA 1K79A 4BYYA 1U5TB 3CUQA 4AIJA 2W84A 3I59A 4EMSA 1K78A 3KEOA 1F9NA 3FHZA 3BJ6A 2VODA 4A5MA 4YFKF 1PP8F 3CUQC 1OPCA 3F3XA 3DEUA 4G7HF 1E17A 2MD5A 4L18B 1G4DA 5ICCA 1KU3A 2EV6A 4R1HA 2VC0A 4OMZA 3FMQA 2KIUA 5IT9K 4KICA 1BI3A 4BHCA 4QLCU 2HKXA 3CTAA 4BQAA 2FEZA 1K6OA 1XCVA 4U0WA 2HDCA 4U0YA 3BY6A 1HQCA 4AIHA 4IVNA 1O57A 2XIGA 3GZ6A 4OU0A 4RGXA 1RNLA 3KP7A 1Z9CA 2P8TA 4I2OA 2G7HA 1SD4A 5AIPA 1ZREA 2O3FA 3GF2A 4XLNF 2ISYA 4M71A 1FZPB 2L02A 1L3LA 2PJPA 5DDGA 1ZGJA 1YLFA 4ZH4F 3M9AA 5JVTA 3GUDA 5E8GA 4UHTA 2DQLA 2NNYA 5LRSA 1O3SA 3MEXA 2X4HA 2ZMEB 1ULYA 1IN5A 4BAYA 1HW5A 5LBQA 4LJZF 3H3ZA 1P4XA 2YX7A 4RAYA 2CSOA 1H0MA 2EFWA 2CO5A 4H0EA 4UVAA 5L3CA 3IKTA 2HR3A 3K69A 3E5QA 1J9IA 4RB3C 5JI6A 3ABTA 2QQ9A 1G3SA 4G94A 1BC8C 1XDUA 1J2XA 4B8XA 2E1CA 2BEOA 5D8LB 2LF7A 2IRFG 5HS8A 4RB0A 2M5WA 1BBYA 1FBSA 3KP4A 5HOOA 5DCFA 2L54A 1ZLJA 4ASNA 1VTNC 5E1XA 4LK0F 3EQLF 1UB9A 4KIBA 1O3TA 1EH7A 1R1TA 1I1GA 1R23A 3JAMZ 3F72A 1S3JA 1IXSB 2IVMA 5BQTA 4O5VA 3RKWA 3N4MA 2GWRA 3GFJA 1IN4A 2K4JA 2H94A 4Y13A 2GQQA 3R0AA 4FX0A 1WI9A 1FYMA 1J5YA 1R1UA 3QPHA 5LHGA 4U7DA 1GHCA 5D8KB 3HRUA 3WGGA 2GA2A 1GXQA 3WU1B 5JR3A 2PLYA 2F5DA 3BJAA 5BS6A 1ZARA 4U88A 2RC4A 1Y0UA 2DK5A 4EQQA 3ECOA 1SD7A 4M6YA 1BJAA 3DXJF 3GFIA 4EM0B 1F1ZA 3E3VA 3AAFA 2HZTA 4ESFA 1TQIA 3QAHA 4HW0A 1OYWA 2A6EF 3TDUC 4HDUA 1KQ9A 5FFXA 1XSVA 2HEOA 3IWZA 5L3EA 5J8FA 1OYIA 1FP2A 3PQKA 1R7JA 1HSTA 1JHFA 4ZYHA 1LEBA 2RDPA 2GAUA 1LQ1A 1IUYA 3P7NA 3ABUA 1SMYF 2TDXA 1O3QA 2P5KA 3FF5A 3E6BA 4IXAA 3BROA 1G6NA 1IN6A 2Y75A 1OKRA 4FHTA 3RPQA 2JZYA 3FM5A 1PDNC 1WQ2A 2KKOA 5E1WA 1QQIA 2ESNA 3ZMVA 2Z5UA 5HVQC 1TQMA 1YS7A 3T8TA 3R60A 2FNPA 2RVCA 1FSHA 4M72A 1P4WA 1TQPA 4LB6B 3R61A 1QO0D 2CYYA 4ETSA 4M9ZA 5FGMA 4ENJA 2YU3A 5CVVA 2L4AA 1IXCA 1UHMA 4WF2A 1QBJA 2GXGA 2KRFA 2XAFA 2RQPA 2GXBA 4WWCA 3L9FA 3F8CA 4E70A 3GX4X 5IT9Z 1R36A 5BMZA 4UUVA 2PFBA 4CYDA 2F5CA 2MLGA 3WTTC 5H6RA 2ZXJA 3QU6A 5E8IA 3GFLA 1MZBA 4I02A 4KMUX 3LAJA 1CGPA 4CGZA 5AIQA 5DEQA 3IRQA 1T39A 2QUFA 3J7AO 1QPMA 1ZN2A 1FT9A 1YS6A 3CJNA 4N0BA 2D2WA 1BI1A 4UNOA 3IKVA 1EH6A 2Z9OA 3U2RA 1P92A 4ENKA 2A07F 1T38A 3TO9A 3HOSA 4ENNA 4AIKA 3QRFF 2HQNA 2FQ3A 1SFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6G E;  3LQR A;  5DD8 A;  3T1B A;  5LGU A;  3ZQ7 A;  5ICG A;  2V1U A;  2EFN A;  5HS9 A;  4I0A A;  2XAG A;  2XRN A;  3FZV A;  4R8H A;  2VE8 A;  5K5R A;  5A2Q K;  1FWZ A;  3HHG A;  1P6R A;  2K02 A;  2XGX A;  1JE8 A;  1U8R A;  2IW5 A;  3BP8 A;  1MKM A;  2H6C A;  3ISP A;  3HTS B;  4WXH A;  2HS5 A;  1S6L A;  1XMK A;  1V4R A;  2MLK A;  5FLX K;  1L0O C;  1EH8 A;  1F5T A;  1D8J A;  4KIF A;  2BV6 A;  1OMI A;  5E17 F;  4L9J A;  2WC2 A;  5F6F A;  4OIR F;  3CUO A;  3JAM K;  3ELK A;  3SZT A;  2HWV A;  4PDK A;  2QQA A;  4R79 A;  2ZKZ A;  4A5N A;  4EGZ A;  2GA1 A;  2HOE A;  2LSO A;  1ZGA A;  2ZCW A;  5D5W B;  2CQK A;  3ZMD A;  4PZJ A;  3E6M A;  1P2F A;  3FM3 A;  1QNT A;  1T6S A;  5LHH A;  1KYW A;  1DDN A;  4KIG A;  1AWC A;  3RDI A;  2DPD A;  1BI2 A;  3DQV C;  3DPL C;  1H9G A;  1USS A;  2HKO A;  3I53 A;  4G6Q A;  2EFP A;  2OD5 A;  4LB5 A;  1UCR A;  2A6H F;  1T2K A;  1G3Y A;  2OBP A;  3E6D A;  4XRF A;  2JPC A;  1YO5 C;  2DBB A;  3TOA A;  3KZY A;  3V8J A;  4ESJ A;  3ZN0 A;  3GXO A;  2XAQ A;  2STW A;  4U0V A;  2YSR A;  3LA7 A;  2PN6 A;  6PAX A;  3GW2 A;  4HQE A;  2FMY A;  3M8F A;  5E20 A;  3O3K A;  3L7W A;  1ZH5 A;  1ZHF A;  5D5X B;  5IT3 A;  1O7L A;  4NQW A;  4EM1 A;  1IZ1 A;  2OZ6 A;  3J80 K;  1RUO A;  1YYV A;  5L3B A;  4HZF A;  4LLL A;  1IN8 A;  4HX7 A;  4HA8 A;  4XLP F;  1SFU A;  3LQQ A;  2K4B A;  2IP2 A;  2B0L A;  2ZO4 A;  3TO7 A;  1XSD A;  1G3T A;  3GEZ A;  3NEU A;  3HRT A;  1TBX A;  5TRD A;  2VT2 A;  5EEG A;  3WGH A;  1KU2 A;  1I6X A;  5D5U B;  3ZPL A;  1MDM A;  2XAS A;  4HDV A;  4MEX F;  3C18 A;  4KUM A;  1TW2 A;  5LGT A;  4WX9 A;  1DUX C;  1QZZ A;  2L3D A;  1RZ4 A;  3O6B B;  4EJU A;  4I7H A;  4M73 A;  2MA3 A;  3P9K A;  4AVP A;  3M1E A;  2O61 A;  2MBF A;  5L3F A;  1G3W A;  1XDS A;  5J8C A;  5CLS A;  5DUI A;  3WTS C;  1XGN A;  3WE3 A;  3KP2 A;  4BHP A;  4HLX A;  1SD5 A;  3N97 A;  2WWY A;  2G7U A;  4DNC A;  2O8X A;  4A0Y A;  2F2E A;  2CW0 F;  4L0Y B;  1MJ9 A;  1C0W A;  4HAM A;  2OU2 A;  1W7P D;  3DPT A;  4YII A;  2ELH A;  2EK5 A;  3HSR A;  5DUK A;  1LEA A;  2UXX A;  3L00 A;  1W7P A;  2P4W A;  2HFH A;  4RGS A;  4S05 A;  2DTR A;  4HOB A;  5A2Q Z;  2CGP A;  2DO7 A;  3VOD A;  1S7A A;  4CXF A;  3EYY A;  3SXY A;  3HTU A;  1LVA A;  4Q47 A;  2IA0 A;  2W57 A;  1ON2 A;  2HQR A;  2W24 A;  3TKY A;  4LG0 B;  5ILV A;  2BGC A;  4GGG A;  4XBF A;  3TGN A;  4NHJ A;  5FLX Z;  2YX4 A;  4GCV A;  4HX4 A;  5CYV A;  1H9T A;  3BWG A;  5K5Q A;  3W6K B;  2OQG A;  3KLN A;  3IL2 A;  4XSX F;  3RIR A;  1IRG A;  2M8E A;  1J7K A;  1ON1 A;  4WXC A;  3LFK A;  4I09 A;  2PQ8 A;  4HF0 A;  2QQB A;  1V3F A;  2ESH A;  1GXP A;  4A0Z A;  4RB1 A;  5BPI A;  1IN7 A;  5FO5 A;  3C3W A;  1B9N A;  2K86 A;  1YG2 A;  3RI4 A;  2V79 A;  3QOP A;  3MCZ A;  1RIO H;  1ZLK A;  4G7Z F;  2IPQ X;  1MD0 A;  3DKW A;  3RKX A;  3F6O A;  3DV8 A;  3JW4 A;  5HS7 A;  4HF1 A;  4YFX F;  1T0F A;  1I5Z A;  2XUB A;  2IA2 A;  3I54 A;  4ZYG A;  2ZJ2 A;  3KZZ A;  4WK8 F;  4DQ2 A;  4Q4Z F;  2RKH A;  3CUQ B;  3REO A;  2FU4 A;  1ONV A;  2H09 A;  1MJB A;  2M30 A;  3LWF A;  3I59 B;  1K78 B;  2D1H A;  1IW7 F;  2XKO A;  5ILS A;  3EET A;  3ECH A;  4MHG A;  1FYK A;  3KE2 A;  2HTS A;  4L5J A;  4RGR A;  1FLI A;  1TTY A;  5E18 F;  4LK1 F;  1B1B A;  1IRF A;  1OYY A;  4MTE A;  1QGP A;  3HRM A;  4WCG A;  4N9I A;  4A0X A;  4IF4 A;  3J80 Z;  5BPD A;  2QM3 A;  2DU9 A;  4EJO A;  2NYX A;  2NNN A;  4JK1 X;  1Z1D A;  3MQ0 A;  1YFH A;  2M1B A;  1YQA A;  4IJA A;  3TQN A;  3D0S A;  4PGG A;  3V8K A;  1U78 A;  3MFK A;  2WV0 A;  1SMT A;  4K2E A;  3U1D A;  5DCM B;  2XAH A;  3VEP A;  1D8K A;  2XKP A;  2PG4 A;  1FOK A;  2K7L A;  4QWQ A;  3I4P A;  3K9T A;  3K1P A;  3D5L A;  1YIO A;  4O3M A;  5CVI A;  3MWM A;  2P7C B;  3HYI A;  1YW9 A;  1XGM A;  3QP6 A;  2F5F A;  3WU0 A;  3R0J A;  4ON0 A;  3OOP A;  2QZ8 A;  5D4S A;  3IRR A;  1J75 A;  2R3S A;  2XHK A;  1T98 A;  2NAZ A;  3GFM A;  4ENM A;  2LDU A;  1FSE A;  1KA8 A;  4KYW A;  2O0Y A;  3QU3 A;  3GWZ A;  3I71 A;  1MJA A;  4LGW A;  1TNT A;  4RAZ A;  5FFZ A;  4BH9 A;  1EV7 A;  4BNC A;  2CG4 A;  3FWE A;  2FSW A;  3EYI A;  1U5T A;  3NQO A;  1WWX A;  3P9C A;  4EJT A;  2XRO A;  3B73 A;  2DLL A;  2Z3Y A;  2E1N A;  4ESB A;  2VBY A;  4N9H A;  3JSP A;  2FBH A;  2H27 A;  3GYH X;  1U5T C;  1A04 A;  4A6E A;  2K27 A;  1HW2 A;  2BBY A;  2EFQ A;  1S29 A;  4BXU A;  5D5V B;  2H6B A;  4P5O A;  1SFX A;  3CO6 C;  4M9X A;  2V6C A;  1GVJ A;  3OV8 A;  1FNN A;  3BPV A;  1BC7 C;  1ZG5 A;  4YIF A;  1XN7 A;  1REP C;  3COA C;  2FBK A;  2STT A;  4IRG A;  2EFO A;  4IHS A;  2DFI A;  3TDZ C;  3LA3 A;  4HV6 A;  3G73 A;  2VC1 A;  5HLI A;  3J81 K;  2QYO A;  2PBI A;  1S8N A;  2M45 A;  3ROU A;  3F22 A;  1W4M A;  5ILU A;  3Q5F A;  1TLH B;  4G6D A;  3ZMT A;  2VXZ A;  3F8N A;  1W5S A;  3ZP5 A;  1B4A A;  1FY7 A;  1IAW A;  3R6S A;  1UST A;  3CDH A;  2DT5 A;  1WSU A;  3BJO A;  2CWE A;  1B9M A;  1I1S A;  2D45 A;  2ZME A;  2HTJ A;  1FC3 A;  3U9G A;  2XAJ A;  4Y15 A;  2DQR A;  3Q9V A;  2VON A;  3CO7 C;  1O3R A;  4G7O F;  2EA4 A;  5H20 A;  1U2W A;  2OA4 A;  2XVC A;  2DK8 A;  4ZZL A;  3WTX C;  4LG0 A;  2ETH A;  3FMS A;  2KJB A;  4L0Z B;  3L2C A;  2DPU A;  3WTU C;  5F1R A;  2YPR A;  3FMR A;  3K0L A;  4MNU A;  3R4K A;  3WTY C;  3HRS A;  4KNY A;  1KU7 A;  3BDD A;  3KP5 A;  1B6A A;  3DF8 A;  3W6J B;  4UV8 A;  1BIB A;  1R1V A;  4CZZ A;  2MH2 A;  4IHT A;  2NS0 A;  5K1Y A;  2JSC A;  3I5U A;  3K1M A;  1MGT A;  2QLZ A;  2KJC A;  3FXQ A;  2Q8K A;  1SD6 A;  2LNB A;  2ZBK A;  2RGV A;  1PP7 U;  2V1D A;  2JTV A;  3ML6 A;  4B09 A;  3FX3 A;  2ADU A;  1YW8 A;  2FOK A;  3QPT A;  3HSE A;  4JBA A;  5BOX A;  1R5H A;  2KIF A;  1HXD A;  4EGY A;  2QBY B;  2OQR A;  2P5L C;  4A2U A;  4PGH A;  2QVO A;  2V1X A;  1F4K A;  3CLO A;  4Q5S F;  1Q1H A;  4OIO F;  5E1Z B;  1K7A A;  3VOE A;  1HKQ A;  3BZ6 A;  1FP1 D;  4KT5 C;  1P4A A;  1CF7 B;  4OMY A;  4RGU A;  1S7O A;  3B02 A;  3GZ5 A;  1RI7 A;  2P6T A;  5L3D A;  1ZRD A;  1BI0 A;  4EJV A;  1XGO A;  1YTY A;  4IRH A;  2Y0M A;  2D1V A;  1BM9 A;  3F8F A;  4F7Z A;  2W25 A;  1HKT A;  3S2W A;  5HLG A;  1LDD A;  1W5T A;  5HDN A;  1R22 A;  3RTR A;  2E7X A;  1D3Y A;  5DCM A;  5D6F A;  2FML A;  3WOD F;  2UWM A;  3E5X A;  5ICF A;  3JTG A;  4TV7 A;  5DYM A;  2O03 A;  3T0Y A;  2J5P A;  1ZRC A;  4ZYE A;  4M9S A;  1J59 A;  2Z99 A;  1RUN A;  4GYG A;  3GO5 A;  2QEN A;  1FX7 A;  5L3G A;  2VOO A;  1Z7U A;  2BYV E;  4KA4 A;  5HDG A;  3P9I A;  5FB2 A;  1E2X A;  1D5V A;  1JXS A;  2C6Y A;  1UFM A;  4UVC A;  4RB2 C;  2A69 F;  3J81 Z;  2FNA A;  1HSJ A;  3LAP A;  3KEQ A;  4CIC A;  3HIF A;  2P7V B;  4U7B A;  2JPB A;  4I98 B;  3F8M A;  5FD6 A;  3SFZ A;  1DPU A;  4UXN A;  2DAO A;  2FXA A;  4G9Y A;  3F6V A;  3E97 A;  3K1N A;  5ERI A;  3WG9 A;  3ERE D;  4EJW A;  3H92 A;  1QZY A;  3Q9S A;  2L4M A;  4UV9 A;  5F64 A;  2UXN A;  4CHU A;  1DPR A;  4HLY A;  4ZYD A;  4LLN A;  1ZRF A;  1U6G A;  3I64 A;  3JSO A;  3IWF A;  3WTW C;  4D0P A;  2OAZ A;  3F21 A;  1DP7 P;  4KMF A;  1HKS A;  2VBZ A;  3EDP A;  2JRT A;  3HOT A;  1HBX G;  2AXL A;  1KQ8 A;  4L9N A;  4P96 A;  4L9V A;  3SZP A;  5ICE A;  3RPU A;  2G9W A;  4HBL A;  3I58 A;  4Y17 A;  5LHI A;  5DD4 A;  2IT0 A;  1KGS A;  3V4G A;  5J6X A;  2MC3 A;  3I0T A;  1PUE E;  3C1D A;  3KP6 A;  1WRJ A;  2ACJ A;  1JGS A;  4LD5 A;  1SAX A;  4ZZD A;  2LKP A;  2VE9 A;  1MDM B;  3F8B A;  1R5G A;  3M8E A;  3MZH A;  1TW3 A;  3V8L A;  1BOA A;  4O6J A;  2P5V A;  1OR7 A;  4MGR A;  2NRA C;  1AOY A;  4NB5 A;  2FA5 A;  2AS5 F;  4I01 A;  2VOP A;  2F5E A;  2Y48 A;  3FXR A;  2COM A;  1XMA A;  4GXO A;  1LJ9 A;  4M6X A;  2EV0 A;  5H6Q A;  4WXD A;  3M7G A;  3ZMZ A;  4XSZ F;  2VBX A;  3FXU A;  3VB2 A;  3WE2 A;  2VN2 A;  4I0B A;  4BHB A;  4HF2 A;  3WGI A;  1FBU A;  1Z6R A;  2E7W A;  2RNJ A;  1ZYR F;  3RYP A;  3IC7 A;  2FRH A;  4AWX B;  1ZG3 A;  5D4R A;  2CFX A;  1LDK B;  4MQ9 F;  2EV5 A;  2R7F A;  2XV4 S;  3NRV A;  3SQN A;  3MZY A;  3V7C A;  4EVI A;  1J0R A;  5JFR A;  3F23 A;  2A5Y B;  5EEH A;  3DP7 A;  2VT3 A;  5LRR A;  1U3E M;  1XCB A;  2GZW A;  5AON A;  1W7P B;  4HQM A;  5HDK A;  1UHW A;  4OIP F;  3T5X A;  2GIV A;  1LNW A;  5LEK A;  3E6C C;  2J5O A;  4L9T A;  2EB7 A;  3KP3 A;  4HYE A;  4JQF A;  4KN7 X;  2A61 A;  2Q2E A;  1JHH A;  3EUH A;  2VBW A;  2PEX A;  4EV0 A;  2PI0 A;  4A6D A;  3G3Z A;  4MEY F;  3MAJ A;  1HW1 A;  2X0L A;  2RN7 A;  3LA2 A;  2OZU A;  1R00 A;  1ODD A;  1STZ A;  2QBY A;  4MTD A;  2FE3 A;  2Z33 A;  1Z6T A;  3LST A;  3TOB A;  2UZK A;  4A12 A;  2KIM A;  5LLQ A;  1BN5 A;  5LEJ A;  3DFG A;  2BE5 F;  2DW4 A;  1X3U A;  2ISZ A;  2ZNY A;  1FYL A;  3ULQ B;  1CF7 A;  4YFN F;  4CDG A;  5HLH A;  4FX4 A;  4L5I A;  3WTV C;  3QP5 A;  3HHH A;  3TO6 A;  2W85 A;  2L01 A;  1FPQ A;  2WTE A;  1WKM A;  5ED4 A;  1I27 A;  4HV5 A;  4PCQ A;  5D6E A;  1Z05 A;  4MQV A;  3KCC A;  5DV5 A;  1ZG1 A;  4P9F A;  2HYF A;  3V7R A;  1IF1 A;  1O7F A;  4UVB A;  4OIQ F;  4FT8 A;  3ZMS A;  2FF4 A;  3RYR A;  3C7J A;  3BPX A;  2IA1 A;  3WTZ A;  1KU9 A;  3O2P E;  3PFI A;  1BIA A;  5LGN A;  3PQJ A;  2RV8 A;  2JT1 A;  2ZFW A;  4RS8 A;  3KLO A;  4M74 A;  4CO8 A;  1TNS A;  4GYI A;  5KVR A;  1XGS A;  2IJL A;  5CVU A;  4Z2Y A;  2M87 A;  2A68 F;  3KFW X;  5JHU A;  1ZAO A;  2LF8 A;  4KDP A;  4GO1 A;  1IXR C;  4S04 A;  1YW7 A;  4LFU A;  4P9U A;  5CVR A;  3SHF A;  1XSX A;  2MH9 A;  3H3U A;  5K5O A;  3VFZ A;  4P55 A;  3BOQ A;  3ZN1 A;  2PMU A;  5TJJ A;  1B59 A;  2YR2 A;  3RKY A;  4IRI A;  2QWW A;  2EA2 A;  2EJR A;  4YG2 F;  2V9V A;  4G8X A;  1KYZ A;  2DI3 A;  4EM2 A;  2R7D A;  2FBI A;  3GLX A;  1XB4 A;  2EWN A;  2PMH A;  4HX8 A;  4OIN F;  5KK1 A;  1XD7 A;  2HYG D;  3L09 A;  3JTH A;  3E5U A;  1LB2 A;  3V7S A;  5FD5 A;  4AD9 A;  1R58 A;  3GVA A;  3HUG A;  4LMY A;  1NHA A;  4LLG F;  3ZMU A;  3K2Z A;  4KFC A;  4KN4 X;  4IPA A;  3IHU A;  4Q48 A;  2ZNZ A;  1Z91 A;  5CVJ A;  1LDJ A;  5CJ9 A;  2Q0O A;  3T8R A;  3RJP A;  1KQ0 A;  3KET A;  1FBQ A;  2HGC A;  2A3S A;  3HSF A;  2P6S A;  4OOI A;  1K79 A;  4BYY A;  1U5T B;  3CUQ A;  4AIJ A;  2W84 A;  3I59 A;  4EMS A;  1K78 A;  3KEO A;  1F9N A;  3FHZ A;  3BJ6 A;  2VOD A;  4A5M A;  4YFK F;  1PP8 F;  3CUQ C;  1OPC A;  3F3X A;  3DEU A;  4G7H F;  1E17 A;  2MD5 A;  4L18 B;  1G4D A;  5ICC A;  1KU3 A;  2EV6 A;  4R1H A;  2VC0 A;  4OMZ A;  3FMQ A;  2KIU A;  5IT9 K;  4KIC A;  1BI3 A;  4BHC A;  4QLC U;  2HKX A;  3CTA A;  4BQA A;  2FEZ A;  1K6O A;  1XCV A;  4U0W A;  2HDC A;  4U0Y A;  3BY6 A;  1HQC A;  4AIH A;  4IVN A;  1O57 A;  2XIG A;  3GZ6 A;  4OU0 A;  4RGX A;  1RNL A;  3KP7 A;  1Z9C A;  2P8T A;  4I2O A;  2G7H A;  1SD4 A;  5AIP A;  1ZRE A;  2O3F A;  3GF2 A;  4XLN F;  2ISY A;  4M71 A;  1FZP B;  2L02 A;  1L3L A;  2PJP A;  5DDG A;  1ZGJ A;  1YLF A;  4ZH4 F;  3M9A A;  5JVT A;  3GUD A;  5E8G A;  4UHT A;  2DQL A;  2NNY A;  5LRS A;  1O3S A;  3MEX A;  2X4H A;  2ZME B;  1ULY A;  1IN5 A;  4BAY A;  1HW5 A;  5LBQ A;  4LJZ F;  3H3Z A;  1P4X A;  2YX7 A;  4RAY A;  2CSO A;  1H0M A;  2EFW A;  2CO5 A;  4H0E A;  4UVA A;  5L3C A;  3IKT A;  2HR3 A;  3K69 A;  3E5Q A;  1J9I A;  4RB3 C;  5JI6 A;  3ABT A;  2QQ9 A;  1G3S A;  4G94 A;  1BC8 C;  1XDU A;  1J2X A;  4B8X A;  2E1C A;  2BEO A;  5D8L B;  2LF7 A;  2IRF G;  5HS8 A;  4RB0 A;  2M5W A;  1BBY A;  1FBS A;  3KP4 A;  5HOO A;  5DCF A;  2L54 A;  1ZLJ A;  4ASN A;  1VTN C;  5E1X A;  4LK0 F;  3EQL F;  1UB9 A;  4KIB A;  1O3T A;  1EH7 A;  1R1T A;  1I1G A;  1R23 A;  3JAM Z;  3F72 A;  1S3J A;  1IXS B;  2IVM A;  5BQT A;  4O5V A;  3RKW A;  3N4M A;  2GWR A;  3GFJ A;  1IN4 A;  2K4J A;  2H94 A;  4Y13 A;  2GQQ A;  3R0A A;  4FX0 A;  1WI9 A;  1FYM A;  1J5Y A;  1R1U A;  3QPH A;  5LHG A;  4U7D A;  1GHC A;  5D8K B;  3HRU A;  3WGG A;  2GA2 A;  1GXQ A;  3WU1 B;  5JR3 A;  2PLY A;  2F5D A;  3BJA A;  5BS6 A;  1ZAR A;  4U88 A;  2RC4 A;  1Y0U A;  2DK5 A;  4EQQ A;  3ECO A;  1SD7 A;  4M6Y A;  1BJA A;  3DXJ F;  3GFI A;  4EM0 B;  1F1Z A;  3E3V A;  3AAF A;  2HZT A;  4ESF A;  1TQI A;  3QAH A;  4HW0 A;  1OYW A;  2A6E F;  3TDU C;  4HDU A;  1KQ9 A;  5FFX A;  1XSV A;  2HEO A;  3IWZ A;  5L3E A;  5J8F A;  1OYI A;  1FP2 A;  3PQK A;  1R7J A;  1HST A;  1JHF A;  4ZYH A;  1LEB A;  2RDP A;  2GAU A;  1LQ1 A;  1IUY A;  3P7N A;  3ABU A;  1SMY F;  2TDX A;  1O3Q A;  2P5K A;  3FF5 A;  3E6B A;  4IXA A;  3BRO A;  1G6N A;  1IN6 A;  2Y75 A;  1OKR A;  4FHT A;  3RPQ A;  2JZY A;  3FM5 A;  1PDN C;  1WQ2 A;  2KKO A;  5E1W A;  1QQI A;  2ESN A;  3ZMV A;  2Z5U A;  5HVQ C;  1TQM A;  1YS7 A;  3T8T A;  3R60 A;  2FNP A;  2RVC A;  1FSH A;  4M72 A;  1P4W A;  1TQP A;  4LB6 B;  3R61 A;  1QO0 D;  2CYY A;  4ETS A;  4M9Z A;  5FGM A;  4ENJ A;  2YU3 A;  5CVV A;  2L4A A;  1IXC A;  1UHM A;  4WF2 A;  1QBJ A;  2GXG A;  2KRF A;  2XAF A;  2RQP A;  2GXB A;  4WWC A;  3L9F A;  3F8C A;  4E70 A;  3GX4 X;  5IT9 Z;  1R36 A;  5BMZ A;  4UUV A;  2PFB A;  4CYD A;  2F5C A;  2MLG A;  3WTT C;  5H6R A;  2ZXJ A;  3QU6 A;  5E8I A;  3GFL A;  1MZB A;  4I02 A;  4KMU X;  3LAJ A;  1CGP A;  4CGZ A;  5AIQ A;  5DEQ A;  3IRQ A;  1T39 A;  2QUF A;  3J7A O;  1QPM A;  1ZN2 A;  1FT9 A;  1YS6 A;  3CJN A;  4N0B A;  2D2W A;  1BI1 A;  4UNO A;  3IKV A;  1EH6 A;  2Z9O A;  3U2R A;  1P92 A;  4ENK A;  2A07 F;  1T38 A;  3TO9 A;  3HOS A;  4ENN A;  4AIK A;  3QRF F;  2HQN A;  2FQ3 A;  1SFE A; 
#chains in the Genus database with same CATH topology
 2O6G E;  5IP7 J;  2RRE A;  1VI0 A;  3BCB A;  3LQR A;  1LKX A;  1XTA A;  4B1R A;  1N25 A;  5DD8 A;  2VPL A;  3T1B A;  3S3M A;  1A36 A;  5LGU A;  5CQE A;  3KYL A;  2YU9 J;  3ZQ7 A;  5ICG A;  2V1U A;  4X1E A;  2EFN A;  5HS9 A;  3UNG C;  3OYB A;  4I0A A;  2XAG A;  2XRN A;  3FZV A;  3BTC A;  4GRI A;  3HOV J;  4R8H A;  4AM3 A;  1MBK A;  1JI8 A;  2VE8 A;  5K5R A;  4L5E A;  5A2Q K;  1FWZ A;  2XPU A;  3HHG A;  5GTH C;  1P6R A;  2K02 A;  2XGX A;  3BZC A;  3OYM A;  1JE8 A;  1U8R A;  3C2G A;  2IW5 A;  2M0C A;  1TC3 C;  3BP8 A;  1MKM A;  2H6C A;  3ISP A;  3HTS B;  2F6C A;  4YEJ A;  4BQO A;  3GTP J;  4WXH A;  2HS5 A;  1S6L A;  1XMK A;  2VJI A;  3BTJ A;  1V4R A;  2MLK A;  3BR1 A;  3S1M J;  2XB5 A;  4XLA A;  5IOY A;  5FLX K;  2VL8 A;  1L0O C;  1EH8 A;  1F5T A;  1D8J A;  1MMN A;  3DBH B;  4KIF A;  1VND A;  3I56 I;  2BV6 A;  1LUJ B;  1RES A;  1OMI A;  2AQF A;  2VKV A;  2XC7 A;  2QKM B;  4DBQ A;  5E17 F;  4L9J A;  2WC2 A;  2QQ8 A;  4XOT A;  5F6F A;  4OIR F;  3CUO A;  3JAM K;  1WJB A;  3ELK A;  3SZT A;  2HWV A;  2MYS A;  1ETY A;  4PDK A;  2QQA A;  1WPK A;  4LIT A;  4R79 A;  4BQQ A;  3DPU A;  4OWR B;  2OV7 A;  2ZKZ A;  4FCY A;  4JX6 A;  4A5N A;  4EGZ A;  2DTZ A;  2GA1 A;  4BL0 B;  3CF5 F;  4BE0 A;  2HOE A;  1SFO J;  2LSO A;  4IHV A;  1ZGA A;  2ZCW A;  2LY1 A;  3OR1 C;  2CUJ A;  5D5W B;  2CQK A;  3Q3S A;  3ZMD A;  2JA8 J;  2M3A A;  5EF6 A;  2E34 A;  4PZJ A;  3BC8 A;  1P2F A;  1IV8 A;  3E6M A;  3HC7 A;  3FM3 A;  1QNT A;  1H8A C;  1T6S A;  5LHH A;  1KYW A;  3G1O A;  4F93 B;  1DDN A;  4KIG A;  1AWC A;  1WJC A;  3RDI A;  1D0X A;  2R5Y A;  1BI2 A;  2DPD A;  3DQV C;  3AG4 H;  1H9G A;  1USS A;  2HKO A;  3DPL C;  2X1E A;  3FK6 A;  3I53 A;  4G6Q A;  4PUS A;  2EFP A;  2OD5 A;  4LB5 A;  1UCR A;  4BJ5 C;  2ZJQ F;  2A6H F;  4A3F J;  1T2K A;  2HQ5 A;  1G3Y A;  2W4S A;  5M5W J;  2OBP A;  3E6D A;  4XRF A;  2JPC A;  2GBY A;  2OC6 A;  1YO5 C;  2DBB A;  2M7A A;  1RET A;  2K9M A;  3TOA A;  3KZY A;  3V8J A;  4ESJ A;  3ZN0 A;  1KZH A;  3OOU A;  1YOV B;  2KIS A;  4IZZ A;  4E7S A;  2R7T A;  3GXO A;  3DTE A;  2XAQ A;  2STW A;  4U0V A;  5IPA A;  2DCE A;  2YSR A;  3LA7 A;  2PN6 A;  3HOX J;  6PAX A;  3GW2 A;  4ZDP A;  2KHM A;  4HQE A;  2IXS A;  1ENH A;  1QRY A;  2MFZ A;  2FMY A;  4XIC A;  3M8F A;  5E20 A;  1JT6 A;  3WHB A;  3O3K A;  2DMT A;  3BR0 A;  3L7W A;  3O8G A;  1ZH5 A;  2CRG A;  1ZHF A;  5D5X B;  5IT3 A;  1O7L A;  4NQW A;  3QWL A;  4EM1 A;  3AKZ A;  1IZ1 A;  2OZ6 A;  3J80 K;  2MAB A;  1OCR H;  1RUO A;  1YYV A;  5L3B A;  4HZF A;  4LLL A;  3OYF A;  1IN8 A;  4HX7 A;  4HA8 A;  4XLP F;  1QZE A;  2E5Z A;  1SFU A;  3LQQ A;  2K4B A;  2IP2 A;  2B0L A;  2ZO4 A;  3H5A A;  3TO7 A;  4DYQ A;  3CMA I;  1XSD A;  1G3T A;  3OYN A;  2Q2E B;  4RAG A;  5JLW A;  4IOC F;  3GEZ A;  3NEU A;  2IS4 A;  3X2Q H;  3HRT A;  1BA5 A;  2XGE A;  3G2B A;  1MW7 A;  2P0W A;  3EUA A;  3S15 J;  2EZH A;  1TBX A;  5TRD A;  3BQY A;  2VT2 A;  1UHS A;  5EEG A;  3KPH A;  3WGH A;  1KU2 A;  3ZRG A;  2FX0 A;  1I6X A;  3L2Q A;  2JN6 A;  3CDL A;  5D5U B;  3ZPL A;  2K3P A;  2O9L A;  1MDM A;  2XAS A;  4KIS A;  3W2W A;  2X51 A;  4FE7 A;  4RLF A;  2KT0 A;  1ZQ3 P;  4HDV A;  3LSH A;  4XM3 A;  3AG1 H;  2ICW G;  2XAU A;  5JHF A;  4MEX F;  4P1W A;  2QKL B;  3C18 A;  4KUM A;  4N4N B;  1TW2 A;  2DOF A;  1GLN A;  5LGT A;  4WX9 A;  4ANJ A;  1DUX C;  2JJ7 A;  1QZZ A;  3BTI A;  2L3D A;  1RZ4 A;  4CUG A;  4AC0 A;  2IS1 A;  1BOB A;  3O6B B;  2LFB A;  1JKP C;  3L2U A;  3S1Q J;  5EZH A;  9ANT A;  4EJU A;  3AFH A;  4I7H A;  4M73 A;  1MH4 A;  2MA3 A;  5F0H A;  2DOA A;  3C2H A;  3SZG A;  3P9K A;  4AVP A;  2RAE A;  5IP9 J;  4AVZ A;  2JRM A;  3M1E A;  2O61 A;  2MBF A;  5JLX A;  5L3F A;  1G3W A;  2HVQ A;  1VF9 A;  1XDS A;  5J8C A;  5CLS A;  5DUI A;  2GLO A;  1SVM A;  3WTS C;  2XDV A;  1XGN A;  1RRJ A;  4MLO A;  4ZDL A;  3KP2 A;  3WE3 A;  1PUF A;  1ETQ A;  2WAQ A;  2XSJ C;  3OL4 A;  4BHP A;  4HLX A;  1SD5 A;  3FK7 A;  3N97 A;  1APL C;  2M34 A;  3BG7 A;  2WWY A;  1LE8 A;  4M3B A;  1MNE A;  2ELJ A;  2JVH A;  2G7U A;  3JRC A;  4DNC A;  2M8G X;  2O8X A;  3QOE A;  4A0Y A;  4DYC A;  2EIN H;  4IO9 F;  2F2E A;  4BY7 J;  3VYT B;  1ORK A;  4C2U A;  4CA0 A;  2CW0 F;  4JYK A;  3L2V A;  4ZTF A;  5FKL A;  2JQ7 A;  4L0Y B;  3IV5 A;  2ZSI B;  1MJ9 A;  1C0W A;  4BBS J;  4HAM A;  4DGW B;  4E4H A;  3TMO A;  2OU2 A;  3LSJ A;  1W7P D;  3DPT A;  4OAY A;  2HOT A;  2JA6 J;  4YII A;  2ELH A;  2EK5 A;  2DN0 A;  3HSR A;  5DUK A;  4BBR J;  4BJ6 C;  1OCP A;  3MKW B;  1LEA A;  4J00 A;  2UXX A;  3LL7 A;  3L00 A;  1W7P A;  4XOR A;  2P4W A;  2HFH A;  2K9S A;  2XPW A;  4RGS A;  1JJ6 C;  4S05 A;  3VYR B;  2DTR A;  4HOB A;  3DBR B;  2LY2 A;  5A2Q Z;  2CGP A;  2DO7 A;  3VOD A;  1S7A A;  2BVM A;  4B3X A;  4CXF A;  3EYY A;  1A6I A;  2WV1 A;  3SXY A;  3C2B A;  3S2H J;  3HTU A;  1LVA A;  4Q47 A;  2IA0 A;  1OQY A;  4IHW A;  2W57 A;  2A6T A;  4C3I J;  1ON2 A;  4I99 C;  3G6E I;  4MO7 A;  2HQR A;  2W24 A;  3TKY A;  4J01 A;  4LG0 B;  5ILV A;  2BGC A;  2LG4 A;  4QPO A;  5FRN A;  2KL4 A;  1LVK A;  3BT9 A;  4GGG A;  1OIS A;  3TGN A;  4XBF A;  4NHJ A;  2DFE A;  4BDZ A;  2VB6 A;  1B72 B;  5DM7 F;  5B5E C;  3L2W A;  3CCS I;  5FLX Z;  2YX4 A;  4GCV A;  2Z2S B;  4HX4 A;  2I5U A;  4PJ0 C;  4DW6 A;  5CYV A;  1H9T A;  3BG5 A;  3PJR A;  3PFY A;  3BWG A;  3K4M A;  5K5Q A;  3W6K B;  2OQG A;  1V55 H;  3OYD A;  3KLN A;  3BLY A;  2HNH A;  3PM1 A;  4IQ4 A;  3IL2 A;  4XSX F;  3RIR A;  1IRG A;  3NWS A;  2M8E A;  1J7K A;  1UEL B;  1ON1 A;  4WXC A;  3TW7 A;  2BY3 A;  3LFK A;  3E1S A;  4I09 A;  2PQ8 A;  4HF0 A;  4EEF G;  1LPQ A;  2OJE D;  3DKY A;  2QQB A;  5J3L A;  2ECC A;  4W1U A;  4FTH A;  1V3F A;  2ESH A;  1GXP A;  1UG2 A;  2R92 J;  4A0Z A;  2CW7 A;  5F0C A;  3UR3 C;  3HPG A;  2Q1Z B;  4RB1 A;  2OCC H;  5BPI A;  1IN7 A;  2CFO A;  2CW8 A;  3HGG A;  4HG2 A;  4IX7 A;  5FO5 A;  3C3W A;  1R5I D;  1JKQ C;  1Z77 A;  1B9N A;  2K86 A;  1YG2 A;  3RI4 A;  5EEA A;  2V79 A;  3QOP A;  3MCZ A;  1TWG J;  5EG0 B;  1RIO H;  2WB1 N;  4G7Z F;  1ZLK A;  1U9N A;  2IPQ X;  1MD0 A;  3A0B C;  3DKW A;  1UZC A;  3F6O A;  3RKX A;  3DV8 A;  3JW4 A;  5HS7 A;  5C3E J;  4HF1 A;  4YFX F;  4X0G A;  2G0E A;  2QA4 I;  4A3D J;  1T0F A;  1I5Z A;  2XUB A;  2ID6 A;  1MMD A;  1FJL A;  2Y0S A;  1I50 J;  2IA2 A;  2L7F P;  3I54 A;  4ZYG A;  2NOJ B;  2ZJ2 A;  1BR2 A;  3KZZ A;  2ZB9 A;  4WK8 F;  1IC8 A;  3JRF A;  3RPU D;  2JK3 A;  2Y2Z A;  1G8X A;  4DQ2 A;  2L9S A;  3BCA A;  4Q4Z F;  1T0F C;  3P5J A;  4KJZ A;  1YX5 A;  2RKH A;  1D1B A;  3CUQ B;  2F4O B;  2DA2 A;  1WCM J;  4XN0 A;  3REO A;  2FU4 A;  1ONV A;  1PYV A;  2H09 A;  1MJB A;  2M30 A;  3LWF A;  3LSG A;  1SFK A;  3I59 B;  1IV6 A;  1YRN B;  1K78 B;  2D1H A;  4N4O B;  1IW7 F;  2XKO A;  4PJM A;  4V19 K;  5ILS A;  3RZO J;  3EET A;  3ECH A;  4MHG A;  1WH5 A;  2KRC A;  1FYK A;  3KE2 A;  2HTS A;  3W6V A;  4L5J A;  1W5C C;  4RGR A;  1FLI A;  1TTY A;  1A6Q A;  2CS3 A;  3CJT B;  4LK1 F;  4AID A;  5E18 F;  1B1B A;  1IRF A;  1OYY A;  4DIQ A;  4MTE A;  1AHD P;  3DU5 A;  3OYE A;  1QGP A;  3HRM A;  4WCG A;  4N9I A;  4A0X A;  4IF4 A;  1MH3 A;  3J80 Z;  3GLL A;  1WGX A;  5BPD A;  1X1P A;  2QM3 A;  2Y69 H;  5J1Y A;  2DU9 A;  4EJO A;  2NYX A;  5HLT A;  2XPV A;  2NNN A;  4JK1 X;  1Z1D A;  5FRM A;  3MQ0 A;  2R7X A;  3KZI C;  1YFH A;  2B9S A;  2M1B A;  1YQA A;  3H0G J;  4XKV A;  4XID A;  4IJA A;  3FXL A;  3TQN A;  1A35 A;  3D0S A;  3OWT A;  1I3Q J;  4PGG A;  3V8K A;  1N77 A;  3ASO H;  3CCU I;  2L9V A;  2EZI A;  1U78 A;  3MFK A;  3ZGK A;  2WV0 A;  1SMT A;  4K2E A;  1FTT A;  1EKE A;  2GOM A;  3B6C A;  1IG7 A;  3CCJ I;  1IDZ A;  3U1D A;  1DQU A;  4RBO A;  5DCM B;  2CJJ A;  2XAH A;  4RLQ A;  5K7Z A;  3VEP A;  1D8K A;  3DEE A;  2XKP A;  2PG4 A;  1FOK A;  4CYC A;  2K7L A;  4QWQ A;  2H1L A;  3I4P A;  4A3C J;  3K9T A;  2R7S A;  1WH7 A;  3K1P A;  2E19 A;  3D5L A;  5LFA A;  3A01 B;  2NXN B;  2DXI A;  1YIO A;  4O3M A;  2Y30 A;  5CVI A;  2DA3 A;  1J09 A;  2VQH A;  3MWM A;  1JT0 A;  2P7C B;  3HYI A;  1YW9 A;  1XGM A;  4UY8 I;  3QP6 A;  2F5F A;  3WU0 A;  3R0J A;  1Z3Y A;  2M0M A;  3TW6 A;  4ON0 A;  1RKT A;  1V54 H;  3RKQ A;  1MBE A;  3OOP A;  2QZ8 A;  2VPR A;  3DWL E;  3FXJ A;  5D4S A;  3IRR A;  3GTK J;  1J75 A;  2EIM H;  3A2K A;  2QGU A;  3K4B A;  2R3S A;  1ETK A;  3Q0V A;  3S16 J;  2XHK A;  1DGW Y;  1T98 A;  2NAZ A;  3GFM A;  3AL0 B;  2AO9 A;  1K83 J;  5B1A H;  4ENM A;  3GME A;  2LDU A;  1FSE A;  1KA8 A;  1V5E A;  2F4I A;  4KYW A;  3UKG A;  2O0Y A;  3QU3 A;  3LFU A;  3GWZ A;  3I71 A;  3SEQ A;  3W2A A;  1ZKG A;  3A4C A;  1MJA A;  5LD2 C;  5E3L A;  3I55 I;  4EAT A;  1QU3 A;  4LGW A;  4BS9 A;  3CC7 I;  1TNT A;  3ZQF A;  4RAZ A;  4OAZ A;  1W1W E;  2Y9Y A;  5FFZ A;  4BH9 A;  4JX5 A;  1UAA A;  1EV7 A;  2MG4 A;  4BNC A;  2CG4 A;  3FWE A;  2FSW A;  3EYI A;  1ETW A;  3QPL A;  4A3L J;  1U5T A;  3PNV A;  2R5Z A;  3NQO A;  1WWX A;  3BG6 A;  3ZQL A;  3P9C A;  4ABZ A;  3NAR A;  4EJT A;  2XRO A;  3B73 A;  2DLL A;  2Z3Y A;  2E1N A;  2HVS A;  1POG A;  4ESB A;  2VBY A;  3CD6 I;  3J7A Y;  4N9H A;  3JSP A;  3CF2 A;  3Q0W A;  1VQK I;  2FBH A;  2H27 A;  3GYH X;  1U5T C;  3IH3 A;  2BHZ A;  1A04 A;  2Y0S N;  4A6E A;  2NVQ J;  2K27 A;  2M2E A;  1HW2 A;  2R7Z J;  3BG3 A;  2BBY A;  2EFQ A;  1S29 A;  2K40 A;  5FKN A;  4BXU A;  2Y31 A;  2VQC A;  5D5V B;  4GFB A;  2H6B A;  4P5O A;  1SFX A;  2W82 A;  1BR1 A;  5J1R A;  4I6Z A;  2DT7 B;  3CO6 C;  5EGO B;  4M9X A;  2V6C A;  4BEH B;  2KRH A;  2VXD A;  5E3O A;  2CV2 A;  1GVJ A;  4Y4R A;  1NG7 A;  5J4V A;  1OFC X;  3H9J A;  3OV8 A;  2CMP A;  1FNN A;  3BPV A;  3HKZ A;  1VQ5 I;  2JA5 J;  2JA7 J;  2Z16 A;  1H89 C;  2NOG A;  3PSF A;  5FKK A;  1BC7 C;  3ZQQ A;  2MW8 A;  1SC7 A;  2R7V A;  4BJT A;  4CH7 A;  1ZG5 A;  2HOA A;  2OUM A;  4YIF A;  1XN7 A;  1REP C;  4XON A;  3S3O A;  1CQT A;  3COA C;  2FBK A;  2STT A;  5F04 A;  4IRG A;  2EFO A;  4IHS A;  2DFI A;  2VJ5 A;  4NC7 A;  1XS9 A;  4XN3 A;  3TDZ C;  2L7K A;  2F5V A;  3LA3 A;  4HV6 A;  3WU2 C;  2NVT J;  3G73 A;  2VC1 A;  5HLI A;  3J81 K;  3ZOB A;  5GTI C;  2QYO A;  2PBI A;  2K85 A;  2M45 A;  1S8N A;  3ROU A;  3F22 A;  2UUZ A;  1W4M A;  5ILU A;  4G6D A;  1TLH B;  3Q5F A;  3ZMT A;  2VXZ A;  3F8N A;  2MSY A;  1W5S A;  1D1C A;  3FXK A;  3ZP5 A;  1B4A A;  2L9N A;  5F27 A;  1FY7 A;  1IAW A;  3R6S A;  3OIQ A;  1UST A;  1JJ8 C;  3CDH A;  3H36 A;  1T56 A;  2DT5 A;  1WJ5 A;  2CV1 A;  5B66 C;  3H5R A;  1WSU A;  4PJL A;  2V9K A;  1X1A A;  3BJO A;  5EYR A;  1GDT A;  2CWE A;  1R4M B;  1B9M A;  1I1S A;  2OTL I;  2D45 A;  1RKW A;  2ZME A;  2ZXW H;  1YIJ I;  2HTJ A;  1FC3 A;  3U9G A;  4BDY A;  2M9H A;  2XAJ A;  1RR8 C;  4II2 A;  2IBD A;  3MN2 A;  4Y15 A;  2DQR A;  3Q9V A;  4UB8 C;  2VON A;  2DA7 A;  5E79 C;  3CO7 C;  1O3R A;  4G7O F;  1QPI A;  2EA4 A;  1MBF A;  3OR2 C;  2LC2 A;  3GBG A;  5GAG J;  1XC5 A;  5H20 A;  1U2W A;  2OA4 A;  2KFD A;  4ZDO A;  1A5J A;  2XVC A;  2ZME C;  2DK8 A;  4ZZL A;  2K9L A;  2IGO A;  2OPT A;  5FLV A;  3WTX C;  4LG0 A;  2EQR A;  2ETH A;  3FMS A;  4JOM A;  2WAF A;  1ZR2 A;  2W7N A;  3G1M A;  3PL8 A;  2KJB A;  4L0Z B;  2LBF A;  3HL2 A;  2BY2 A;  3L2C A;  3DU6 A;  2DPU A;  1B72 A;  1AKH B;  3WTU C;  4MIM A;  1WJD A;  5F1R A;  2YPR A;  3FMR A;  4D1Q A;  3K0L A;  4MNU A;  3R4K A;  3WTY C;  3LNQ A;  3HRS A;  2IS2 A;  3FBI B;  4KNY A;  1KU7 A;  4UUS A;  4F52 A;  4HEA 2;  1Z21 A;  2DOE A;  3BDD A;  4RM2 A;  3KP5 A;  5FRO A;  2K3F A;  1VQP I;  4A3I J;  1B6A A;  1F36 A;  4NBQ A;  1T95 A;  1B8I B;  1FOY A;  2CUE A;  3DF8 A;  3OL3 A;  1VQ4 I;  3W6J B;  1X2M A;  2E5N A;  4UV8 A;  1BIB A;  1R1V A;  3BR3 A;  2NS8 A;  4AU7 A;  4CZZ A;  2VUM J;  2ELK A;  2DYR H;  2MH2 A;  4IHT A;  3H3V K;  2NS0 A;  3VYS B;  5IYC J;  4PK4 A;  2W48 A;  5K1Y A;  3TP3 A;  2CQ7 A;  2JSC A;  2IGN A;  3I5U A;  4HST A;  3CC2 I;  3K1M A;  1R9T J;  1MGT A;  2BXY A;  2KJC A;  2QLZ A;  1WJE A;  3FXQ A;  3AG2 H;  2Q8K A;  2AQE A;  1SD6 A;  2LNB A;  4QPQ A;  2DA1 A;  3IP4 B;  2ZBK A;  2JMW A;  1TL8 A;  3GTQ J;  2EIK H;  1Z7L A;  2RGV A;  5GAH J;  5EG0 A;  1PP7 U;  1K4S A;  2V1D A;  3NAU A;  2JTV A;  3ML6 A;  2LLK A;  4B09 A;  3FX3 A;  2ADU A;  1YW8 A;  2GOX B;  1FMV A;  3MKY B;  2FOK A;  3QPT A;  4BQN A;  1VQ6 I;  2LY9 A;  3HSE A;  2L2O A;  4JBA A;  3S14 J;  3S32 A;  1VZ0 A;  4C30 A;  5HOD A;  5BOX A;  1R5H A;  5K7F A;  2WB1 A;  2KIF A;  1HXD A;  4KIT B;  4EGY A;  2OQR A;  2GM4 A;  2QBY B;  1D0Y A;  3HOY J;  3HKZ N;  2P5L C;  2PJR A;  1IO2 A;  3QYE A;  4A2U A;  4PGH A;  4DBR A;  2QVO A;  3ABM H;  3OS0 A;  2V1X A;  1F4K A;  3CLO A;  3PIP F;  4Q5S F;  2WY8 Q;  5CKT A;  1Q1H A;  4OIO F;  5E1Z B;  1NK2 P;  1K7A A;  2Z1D A;  3VOE A;  1QHH D;  1HKQ A;  1WVR A;  3BZ6 A;  1FP1 D;  3J7Y J;  4KT5 C;  1P4A A;  2X6O A;  1CF7 B;  4OMY A;  4RGU A;  1S7O A;  3B02 A;  3GZ5 A;  1P9Q C;  1RI7 A;  4HNV A;  2P6T A;  5L3D A;  1ZRD A;  1BI0 A;  2IAI A;  3DKX A;  4EJV A;  1ZTR A;  1XGO A;  3VPR A;  4CCK A;  4CCJ A;  1YTY A;  4IRH A;  2Y0M A;  2D1V A;  1BM9 A;  2X1C A;  1LFU P;  3AG3 H;  3F8F A;  4BGD A;  2E1M C;  2E60 A;  1OCC H;  4AYB A;  4F7Z A;  4PJJ A;  3KYD B;  3CP2 A;  1VQM I;  3K10 A;  1ETX A;  2W25 A;  3S2W A;  4BXF A;  1HKT A;  5HLG A;  1K6Y A;  1LDD A;  1DU0 A;  1Q1V A;  3S93 A;  1Y56 A;  1W5T A;  2M4K A;  5HDN A;  2R7Q A;  2ZJR F;  2L7M P;  4ZJZ A;  2ZXH A;  2TRT A;  1R22 A;  2QSF X;  2N8G A;  3K6G A;  4C2T A;  3RTR A;  2E7X A;  1OCZ H;  5F1J A;  1D3Y A;  5DCM A;  5K7H A;  1HA8 A;  3CES A;  5D6F A;  3D1N I;  2FML A;  3WOD F;  2WBM A;  3CCQ I;  2UWM A;  3E5X A;  5ICF A;  2DMQ A;  5JVG F;  2E71 A;  4A3M J;  2R7O A;  1PVE A;  2E36 A;  3A01 A;  1OCO H;  4NDL A;  4TV7 A;  3JTG A;  3HOW J;  5DYM A;  2O03 A;  3TED A;  1SAU A;  2LP0 A;  1Z3X A;  2V7F A;  3T0Y A;  1DU6 A;  2J5P A;  1R71 A;  1ZRC A;  1Y1W J;  4ZYE A;  4M9S A;  3S1R J;  1J59 A;  4U87 A;  2Z99 A;  1RUN A;  4GYG A;  1R49 A;  1N75 A;  1AU7 A;  3GO5 A;  2QEN A;  1FX7 A;  3H35 A;  3KEY A;  3N05 A;  5L3G A;  2VOO A;  3MVP A;  4BXX J;  2DMU A;  2JA2 A;  1Z7U A;  2WA0 A;  3I4M J;  2BYV E;  4KA4 A;  1MIJ A;  4PJN A;  5HDG A;  3P9I A;  4FET A;  4HPQ A;  2B63 J;  3I9V 2;  2WY7 Q;  5FB2 A;  1E2X A;  4DZJ A;  1D5V A;  1JXS A;  1XG1 A;  4D7M A;  2KZG A;  2BZT A;  2EIL H;  1G2H A;  4M3D A;  2C6Y A;  1K61 A;  1UFM A;  4QIW N;  4II3 A;  4UVC A;  4RB2 C;  2A69 F;  3SEZ A;  4PFP A;  3J81 Z;  2FNA A;  1HSJ A;  1TZL A;  2KMU A;  3LAP A;  3KEQ A;  3DCF A;  4CIC A;  3HIF A;  2P7V B;  3HOZ J;  4UB6 C;  4U7B A;  2JPB A;  4I98 B;  3F8M A;  2ZSH B;  5FD6 A;  4G6T B;  3SFZ A;  2JWT A;  1KON A;  3ZQG A;  4XRS G;  3ONQ A;  1DPU A;  4XKB A;  4UXN A;  5M3F J;  2DAO A;  2FXA A;  4G9Y A;  3F6V A;  2HU9 A;  1JUS A;  1MNM C;  1X19 A;  3E97 A;  3K1N A;  5ERI A;  3WG9 A;  1OLT A;  3ERE D;  1E3H A;  3DTK A;  4EJW A;  3H92 A;  5FLM J;  5KCM A;  4FAS D;  1QZY A;  3Q9S A;  2YUS A;  2L4M A;  1HF0 A;  4XR6 A;  3HUG B;  1UG0 A;  4UV9 A;  5F64 A;  2UXN A;  4CHU A;  4YIR X;  4CZC A;  5E3N A;  1JTY A;  1DPR A;  4HLY A;  4ZYD A;  3LOC A;  4LLN A;  1ZRF A;  4LG3 A;  5EGO A;  3PUB A;  4KT6 A;  1U6G A;  5GP9 A;  3I64 A;  4BEH A;  3JSO A;  3IWF A;  2V9P A;  3WTW C;  4NNJ A;  3M1C A;  4D0P A;  2DMP A;  2XF5 A;  4A3B J;  2OAZ A;  3ASN H;  2DDB A;  1YIT I;  2VIX A;  2ZXI A;  3F21 A;  1DP7 P;  4KMF A;  1HKS A;  3A0H C;  1HC8 A;  1JKR C;  2VBZ A;  3EDP A;  2O7O A;  2JRT A;  5EDN A;  3H9G A;  3RCO A;  3HOT A;  1WFX A;  5B1B H;  1HBX G;  4F92 B;  2AXL A;  2NVU B;  4L9N A;  1KQ8 A;  4LIV A;  4P96 A;  5HNF A;  1FTZ A;  1T33 A;  1HDD C;  4L9V A;  3SZP A;  1MND A;  5ICE A;  5HNH A;  4Y33 A;  3RPU A;  2G9W A;  4HBL A;  3I58 A;  5TIS C;  4Y17 A;  5LHI A;  5DD4 A;  2V6E A;  3CME I;  2IT0 A;  1KGS A;  3V4G A;  2I8D A;  5J6X A;  2MC3 A;  3VSK A;  2EZK A;  4AYB N;  3I0T A;  1PUE E;  3BR5 A;  3C1D A;  3KP6 A;  1WRJ A;  2ACJ A;  5M5Y J;  3GTJ J;  2M4G A;  4MFE A;  1JGS A;  4LD5 A;  1SAX A;  4ZZD A;  4Z6Y A;  2LKP A;  2VE9 A;  1MDM B;  2LRD A;  3F8B A;  1R5G A;  2CUF A;  3M8E A;  3MZH A;  1TW3 A;  1GT0 C;  3W3C A;  4XKW A;  1BOA A;  4O6J A;  3V8L A;  1MBH A;  1QHG A;  3D5R C;  2K5C A;  4ZC3 A;  1IRZ A;  3SJM A;  3JRD A;  4QSH A;  2P5V A;  1OR7 A;  4MGR A;  2NRA C;  2W1O A;  1AOY A;  3A1Y A;  2RQQ A;  1WZ2 A;  4ZYA A;  4F91 B;  4NB5 A;  2FA5 A;  2AS5 F;  3E0J B;  3CMM A;  5IYB J;  3JRE A;  4I01 A;  2IS6 A;  2VOP A;  2F5E A;  2Y48 A;  3FXR A;  2COM A;  3S17 J;  1XMA A;  1Y0N A;  4GXO A;  1K4T A;  2LTP A;  1LJ9 A;  4M6X A;  4E7K A;  1XMX A;  2VKD A;  2EV0 A;  2H1K A;  5H6Q A;  3H0D A;  1X1D A;  4WXD A;  1AA7 A;  3M7G A;  1S7E A;  1BL0 A;  2EPF A;  3OYK A;  3ZMZ A;  3V42 A;  4E7I A;  1TT0 A;  4LIU A;  2VBX A;  4XSZ F;  3HB9 A;  3FXU A;  2Y9Z A;  1PUF B;  1Y6I A;  2D5V A;  1QVT A;  3VB2 A;  3WE2 A;  2VN2 A;  4I0B A;  4BHB A;  1AKH A;  3PUF A;  2O8K A;  4HF2 A;  1W0U A;  1LE8 B;  5FJ8 J;  2CUZ A;  3WGI A;  2VKE A;  3OYC A;  1DGR M;  1FBU A;  1GUU A;  2EH3 A;  1Z6R A;  2PMZ A;  1MBG A;  1ACI A;  2CQX A;  2E7W A;  2RNJ A;  1ZYR F;  3RYP A;  3IC7 A;  2FRH A;  1D0Z A;  4AWX B;  1X2N A;  1ZG3 A;  3PO2 J;  4XKC A;  5D4R A;  2CFX A;  1LDK B;  5C4J J;  2EIJ H;  4MQ9 F;  2EV5 A;  2R7F A;  3LSM A;  2XV4 S;  5F08 A;  1HDP A;  4YEL A;  3NRV A;  1B8I A;  1NK3 P;  5KHD A;  3SQN A;  1S72 I;  3MZY A;  3V7C A;  2VLA A;  2HDD A;  4EVI A;  1J0R A;  1YJN I;  2X6Y A;  1SVO A;  5JFR A;  2BVL A;  3F23 A;  4A3K J;  2A5Y B;  4E7Z A;  2GIZ A;  5EEH A;  3RSN A;  3DP7 A;  3CZ6 A;  3HXL A;  2VT3 A;  3KX2 A;  5LRR A;  4B47 A;  3K4L A;  1U3E M;  1XCB A;  2VQL A;  2GZW A;  2VJJ A;  1WJF A;  5AON A;  1W7P B;  4HQM A;  2I10 A;  5HDK A;  1UHW A;  2IGM A;  5F0F A;  4C9Y A;  2JUG A;  4OIP F;  4C2M J;  2CU7 A;  3T5X A;  2GIV A;  1LNW A;  5LEK A;  3E6C C;  4GDF A;  1Z0X A;  2JSP A;  1VQN I;  4RM3 A;  2J5O A;  4PSX A;  2NS7 A;  4L9T A;  3HBL A;  1TWH J;  3GTL J;  3K4N A;  2EB7 A;  3KP3 A;  1MMS A;  2X9D A;  4HYE A;  2EBI A;  4JQF A;  4KN7 X;  3QYF A;  2A61 A;  2F4M B;  2Q2E A;  1JHH A;  3EUH A;  2VBW A;  1I3A A;  3K4J A;  2PEX A;  1NH3 A;  2L5Q A;  2X6W A;  4EV0 A;  2CH0 A;  5IOZ A;  2PI0 A;  4A6D A;  3I3L A;  2HXO A;  3G3Z A;  4MEY F;  3MAJ A;  3LSI A;  1HW1 A;  2X0L A;  3EPZ A;  2RN7 A;  2OF7 A;  3CJR B;  1H88 C;  3LA2 A;  1D5Y A;  3ZCO A;  2OZU A;  1R00 A;  1ODD A;  1STZ A;  3ERM A;  3TBI A;  2QBY A;  1FOW A;  3CC4 I;  1Z67 A;  2ZC2 A;  3EUH C;  4MTD A;  2DA6 A;  2FE3 A;  2Z33 A;  3OYA A;  1Z6T A;  3LST A;  3TOB A;  4Y7N J;  2UZK A;  4A12 A;  2KIM A;  5LLQ A;  3QPS A;  1BN5 A;  5LEJ A;  4HRI A;  3DFG A;  2L7Z A;  3G4S I;  2BE5 F;  2HPI A;  2DW4 A;  4XLE A;  1X3U A;  2ISZ A;  2E2J J;  1S5L C;  3CCY A;  2ZNY A;  1FYL A;  3ULQ B;  1RC9 A;  1EA3 A;  2DA4 A;  3ZXS A;  4YFN F;  4CDG A;  1CF7 A;  1EF4 A;  3Q0U A;  3SDG A;  5HLH A;  4FX4 A;  3ZQI A;  4L5I A;  1T08 B;  3CCR I;  2V4J C;  2E35 A;  3WTV C;  2XGD A;  1VQ8 I;  2XSD C;  3QP5 A;  3HHH A;  3TO6 A;  3HJE A;  1E0E A;  2DJN A;  2EZL A;  1XX5 A;  2VKH A;  2W85 A;  2L01 A;  1BW5 A;  3HM5 A;  1JUM A;  5IP6 A;  1FPQ A;  2WTE A;  1WKM A;  4DZP A;  1TT5 B;  1UMQ A;  5ED4 A;  4X6A J;  1HLV A;  1JUP A;  3U1K A;  1I27 A;  4M3G A;  4HV5 A;  4PCQ A;  1YI2 I;  3OYI A;  5D6E A;  1BJZ A;  2DFF A;  3ZQH A;  3IUO A;  1Z05 A;  3NWT A;  1SVL A;  4MQV A;  3KCC A;  5DV5 A;  1ZG1 A;  3F9K A;  4P9F A;  1FMW A;  2HYF A;  3V7R A;  4RDU A;  1IF1 A;  2DFH A;  3PNT A;  1O7F A;  1M1E B;  4A3E J;  1FOX A;  2V1N A;  1NG6 A;  4UVB A;  2P81 A;  4FT8 A;  4OIQ F;  1ERD A;  3DBL B;  3ZMS A;  3ZQC A;  2FF4 A;  4CCO A;  1WJA A;  3RYR A;  3HOU J;  3C7J A;  4CCN A;  4CSW A;  1BW6 A;  3BPX A;  3S1N J;  2IA1 A;  3WTZ A;  2KIQ A;  2RNG A;  3IAM 2;  1KU9 A;  1I6H J;  3BQZ A;  3O2P E;  5J1U A;  3PFI A;  1BIA A;  3FHN A;  2LK2 A;  5LGN A;  3ESW B;  2ME0 A;  3L2R A;  5DTD A;  3PQJ A;  3QOD A;  2COB A;  2RV8 A;  2JT1 A;  3FXM A;  5KAF C;  2ZFW A;  4RS8 A;  4E6K G;  3KLO A;  4BE1 A;  2BY1 A;  4M74 A;  4CO8 A;  3K70 D;  2HPM A;  2XRL A;  1TNS A;  4GYI A;  1X4P A;  5KVR A;  3MZ8 A;  3TP0 A;  3GTO J;  1XGS A;  2IJL A;  3FKI J;  3E7L A;  1I39 A;  3CP8 A;  5CVU A;  4Z2Y A;  3OS1 A;  1MMG A;  2M87 A;  2LMD A;  2E2I J;  2A68 F;  3JRG A;  3KFW X;  1V5F A;  2PMZ N;  2KDO A;  5JHU A;  4B44 A;  4IOA F;  2R7R A;  1ZAO A;  2LF8 A;  5DS9 A;  4W97 A;  4KDP A;  3VYU B;  4GO1 A;  3HZJ A;  1IXR C;  2KZV A;  3QYB A;  3J7Z I;  4S04 A;  1QVU A;  1YW7 A;  3LSP A;  1TP4 A;  3F0C A;  4LFU A;  4P9U A;  4S0H B;  5CVR A;  4FIS A;  3SHF A;  1XSX A;  2MH9 A;  2DT6 A;  3H3U A;  5K5O A;  4V2F A;  5GPA A;  3K70 C;  3VFZ A;  3OMY A;  4P55 A;  3BOQ A;  3ZN1 A;  2PMU A;  5TJJ A;  1B59 A;  5GAD J;  2YR2 A;  3CCL I;  2LKX A;  1ZR4 A;  2FD5 A;  3RKY A;  4A93 J;  3DEW A;  5CQG A;  5GAE J;  4IRI A;  2QWW A;  2KP6 A;  4B43 A;  2EA2 A;  2EJR A;  2IEK A;  4YG2 F;  1IJW C;  2MC4 A;  2LVS A;  4D5F A;  2V9V A;  4CYC B;  4G8X A;  1KYZ A;  2DI3 A;  4EM2 A;  2FUG 2;  2R7D A;  2FBI A;  3GLX A;  3CDI A;  1XB4 A;  2EWN A;  4MFD A;  5M3M J;  3MKL A;  3HPH A;  3CJQ B;  1NTC A;  2PMH A;  4XK4 A;  3ZR8 X;  1TWC J;  4HX8 A;  4OIN F;  5KK1 A;  3IH2 A;  1XD7 A;  2LOO A;  2DYS H;  1TWF J;  2HYG D;  3L09 A;  3JTH A;  3E5U A;  1LB2 A;  3LSR A;  3V7S A;  5FD5 A;  2LYC A;  4AD9 A;  1R58 A;  2A5W A;  2BW3 B;  3GVA A;  3HUG A;  2XGC A;  3OY9 A;  4DJA A;  1GV2 A;  4QTR A;  1MSE C;  2AXT C;  4LMY A;  1NHA A;  4LLG F;  2BY0 A;  1YJ9 I;  2R93 J;  5C4X J;  3ZMU A;  2HOS A;  1ZK8 A;  3K2Z A;  4KFC A;  1OJL A;  4KN4 X;  4IPA A;  3IHU A;  4Q48 A;  2ZNZ A;  1Z91 A;  5CVJ A;  2OCE A;  1FEX A;  1LDJ A;  1ETO A;  5CJ9 A;  1S9H A;  2Q0O A;  1QA6 A;  2GXA A;  3T8R A;  1IRX A;  3RJP A;  1KQ0 A;  3KET A;  2L9R A;  2YS9 A;  1ETV A;  1FBQ A;  2HGC A;  4XNF A;  4XLH A;  2A3S A;  2FJ1 A;  3HSF A;  2P6S A;  4OOI A;  5KAI C;  1K79 A;  4NC6 A;  4BYY A;  4V2G A;  1U5T B;  3CUQ A;  3CMY A;  2R5Z B;  4BE2 A;  4AIJ A;  3FXO A;  4CCL A;  1Y8Q B;  2W84 A;  2VAS A;  2E1O A;  3I59 A;  4EMS A;  1YRN A;  2X1D A;  1K78 A;  1R6R A;  1Y39 A;  3KEO A;  5KNL A;  5B3S H;  3VWB A;  2WAD A;  1F43 A;  1F9N A;  2TCT A;  3BJ6 A;  3FHZ A;  2VOD A;  4A5M A;  3PSI A;  4YFK F;  1D1A A;  4XRM A;  3OYH A;  3G71 I;  3CUQ C;  1PP8 F;  1X3W B;  1OPC A;  3F3X A;  3DEU A;  3L1P A;  2BHY A;  3HGY A;  2R7U A;  4DOZ A;  4G7H F;  1IGN A;  1GV5 A;  1E17 A;  1DP3 A;  2MD5 A;  4L18 B;  1G4D A;  5ICC A;  1GVD A;  4IQJ A;  1O4X A;  3OS2 A;  2X48 A;  2H8R A;  3PO3 J;  1KU3 A;  2EV6 A;  4R1H A;  2VC0 A;  1HCR A;  4OMZ A;  3FMQ A;  2KIU A;  2XF6 A;  1JKO C;  5IT9 K;  4KIC A;  1VFC A;  2MD0 A;  1BI3 A;  3GTG J;  3B6A A;  4BHC A;  3A02 A;  4QLC U;  2HKX A;  3CTA A;  4PSW A;  4BQA A;  3RQI A;  3MD2 A;  4IHY A;  1PJR A;  3VDX A;  2NVY J;  4HNT A;  1EJ9 A;  2FEZ A;  1K6O A;  4FQG A;  1XCV A;  4U0W A;  2HDC A;  4U0Y A;  3BY6 A;  1HQC A;  4AIH A;  1P7J A;  1YX3 A;  3K2A A;  4IVN A;  3VSL A;  1O57 A;  4ITV A;  2XIG A;  4NUB A;  3GZ6 A;  2ZFU A;  4OU0 A;  2O5R A;  2QF7 A;  4RGX A;  1YJW I;  1RNL A;  3KP7 A;  1Z9C A;  2P8T A;  4I2O A;  3CLQ A;  2K9Q A;  1RR7 A;  2AHQ A;  3FBN B;  1VQL I;  2G7H A;  2HXI A;  1A31 A;  1SD4 A;  4BY1 J;  5AIP A;  1ZRE A;  1MBJ A;  2O3F A;  3GF2 A;  4XLN F;  1E3O C;  2ISY A;  4M71 A;  4XRS A;  1FZP B;  4D5C A;  3M3Y J;  1X1B A;  2L02 A;  1L3L A;  4HNU A;  2PJP A;  3OYL A;  5DDG A;  1ZGJ A;  3FIW A;  4D7N A;  1YLF A;  4BAC A;  3SDB A;  4ZH4 F;  3M9A A;  4A3J J;  5JVT A;  3LMM A;  3BR2 A;  3GUD A;  1ZGW A;  4J19 A;  1LFP A;  4XOP A;  5E8G A;  4UHT A;  2DQL A;  2NNY A;  3A03 A;  2VQG A;  2H8W A;  4HSR A;  5LRS A;  1O3S A;  3MEX A;  3JCU C;  2X4H A;  2CQN A;  2ZME B;  1ULY A;  3DLL F;  1IN5 A;  4BAY A;  1HW5 A;  5LBQ A;  1R4N B;  4LJZ F;  2MGQ A;  4JP0 A;  2DJI A;  2LR8 A;  3H3Z A;  1P4X A;  2YX7 A;  4RAY A;  2CSO A;  1H0M A;  2FQ4 A;  3MKZ A;  2EFW A;  2CO5 A;  4H0E A;  1W0T A;  3I4N J;  4UVA A;  5L3C A;  3IKT A;  2CV0 A;  2HR3 A;  2QCO A;  2R5Y B;  3K69 A;  3E5Q A;  4IL6 C;  1J9I A;  1FIA A;  4A69 C;  5EZG A;  3AL0 C;  4RB3 C;  5JI6 A;  3K4K A;  2FOW A;  3ABT A;  2QQ9 A;  1IDY A;  1G3S A;  5IY5 H;  4CCM A;  3KIO A;  4G94 A;  1BC8 C;  3M07 A;  1XDU A;  3IAS 2;  1J2X A;  5CPR B;  4H4K C;  4B8X A;  3CCV I;  2E1C A;  1WHU A;  2BEO A;  5D8L B;  4LOC A;  2LF7 A;  2LBF B;  2IRF G;  5HS8 A;  3QQA A;  4RB0 A;  2M5W A;  1BBY A;  1FBS A;  5FKO A;  3KP4 A;  5HOO A;  3BR6 A;  5DCF A;  2L54 A;  2HDW A;  1ZLJ A;  4ASN A;  4UUS B;  3MMY B;  1VTN C;  3HDD A;  3O8H A;  3WHC A;  4FE4 A;  5E1X A;  4LK0 F;  4BKX A;  3EQL F;  1U0J A;  1UB9 A;  4KIB A;  1O3T A;  2XB0 X;  1EH7 A;  3OIO A;  4I76 A;  2PX9 A;  5J47 A;  1R1T A;  3JRH A;  1RPW A;  3BTL A;  2UV1 A;  1I1G A;  1R23 A;  3OSG A;  3JAM Z;  3F72 A;  1S3J A;  1IXS B;  2HZD A;  2IVM A;  2QSH X;  2HVR A;  1ZEL A;  5BQT A;  3OIP A;  4O5V A;  3BG9 A;  4F55 A;  3RKW A;  2ECB A;  3CCM I;  2W00 A;  3N4M A;  4NQW B;  2GWR A;  3WG7 H;  3GFJ A;  4BU2 A;  1IN4 A;  2M7B A;  3OYG A;  2K4J A;  2H94 A;  4Y13 A;  1MMA A;  1SEU A;  4B3A A;  4B4C A;  5EJC A;  2GQQ A;  3R0A A;  4FX0 A;  3FDY A;  1WI9 A;  1FYM A;  1J5Y A;  1R1U A;  3QPH A;  4F3Q A;  5LHG A;  3GZN B;  2NVX J;  4U7D A;  1GHC A;  3KYC B;  1G59 A;  5D8K B;  2OTJ I;  4C3J J;  3HRU A;  2IGK A;  2V26 A;  3JRB A;  3WGG A;  4Y52 J;  2GA2 A;  1GXQ A;  4IEJ A;  3WU1 B;  5JR3 A;  2PLY A;  3FKJ A;  2F5D A;  3BJA A;  5FKM A;  3D5S C;  2ME6 A;  1ZAR A;  4U88 A;  2RC4 A;  1SAN A;  3SFI A;  5BS6 A;  3M4O J;  4M3F A;  1X58 A;  1Y0U A;  2DK5 A;  3GTM J;  3W2V A;  4EQQ A;  1YHQ I;  3ECO A;  1SD7 A;  4M6Y A;  2JVG A;  1Y1V J;  1BJA A;  3GCM A;  1WI3 A;  3SYT A;  4E7H A;  3DXJ F;  3GFI A;  3IH4 A;  2VI6 A;  4EM0 B;  1F1Z A;  4NC8 A;  3E3V A;  3AAF A;  2HZT A;  5C44 J;  2ID3 A;  2L0K A;  4ESF A;  4A3G J;  2BXZ A;  1TQI A;  3QAH A;  1U8B A;  4HW0 A;  2PJR B;  1OYW A;  2A6E F;  3TDU C;  4HDU A;  1KQ9 A;  3PNY A;  5FFX A;  2WAE A;  4XLC A;  1YE9 A;  5M5X J;  1XSV A;  2HEO A;  3TL4 X;  3IWZ A;  5L3E A;  3H9Q A;  3EUK L;  3LSK A;  1OYI A;  3ABL H;  5J8F A;  1FP2 A;  3PQK A;  1R7J A;  2LKS A;  1HST A;  2E1M B;  2KQR A;  1JHF A;  4ZYH A;  5DM6 F;  3CCE I;  2JUC A;  4E7J A;  1LEB A;  2E2H J;  1X4O A;  5IYD J;  2RDP A;  2GAU A;  4JX4 A;  1V5G A;  2R7W A;  1LQ1 A;  1E3P A;  3S3N A;  2WAQ N;  1IUY A;  3ABU A;  1P7I A;  3P7N A;  3PIO F;  1SMY F;  2TDX A;  4RAF A;  1O3Q A;  2P5K A;  3FF5 A;  1OCT C;  3K7A J;  2LD5 A;  3E6B A;  1OR7 C;  4XMY A;  4IXA A;  5BNG A;  3HG9 A;  3BRO A;  1G6N A;  1TWA J;  1IN6 A;  1W36 D;  4DYR A;  2Y75 A;  1OKR A;  4FHT A;  1Y8R B;  3RPQ A;  2JZY A;  3JRI A;  1VQ9 I;  4G12 A;  3FM5 A;  4M3E A;  1JTX A;  4PFO A;  5E3M A;  1PDN C;  1WQ2 A;  2KPM A;  2KKO A;  3K4C A;  5E1W A;  1QQI A;  2ESN A;  3ZMV A;  3RZD J;  4M6V A;  2Z5U A;  5HVQ C;  2BOL A;  1X1C A;  2CQQ A;  1TQM A;  1YS7 A;  2DA5 A;  4RA2 A;  3T8T A;  3R60 A;  2DMN A;  2FNP A;  2RVC A;  1HOM A;  3HEF A;  1FSH A;  4M72 A;  1P4W A;  1TQP A;  4LB6 B;  3R61 A;  1QO0 D;  4ZTJ A;  2CYY A;  2LRE A;  4M9Z A;  4ETS A;  5FGM A;  1T8I A;  2YU3 A;  4ENJ A;  5CVV A;  2L4A A;  1W36 C;  4BUP A;  1IXC A;  1LFB A;  1UHM A;  2LH9 A;  4WF2 A;  2KDZ A;  2GXG A;  2QEX I;  1QBJ A;  2KRF A;  3OYJ A;  4IKF A;  2XAF A;  2RQP A;  2GXB A;  4WWC A;  2R0Q C;  3L9F A;  3F8C A;  4E70 A;  2A05 A;  3GX4 X;  3DTI A;  3S8P A;  5IT9 Z;  1R36 A;  1VQ7 I;  5BMZ A;  3OSF A;  4UUV A;  2PFB A;  4CYD A;  2F5C A;  2DOD A;  2MLG A;  3WTT C;  5H6R A;  2QSG X;  2X6X A;  2BW3 A;  2ZXJ A;  4XL9 A;  2HQA A;  3QU6 A;  4C3H J;  5E8I A;  3BZK A;  4YRV A;  3G1L A;  3GFL A;  1FIP A;  1MZB A;  4I02 A;  4KMU X;  3LAJ A;  1IUF A;  1CGP A;  4Y3O A;  3CQZ J;  4CGZ A;  5AIQ A;  5DEQ A;  3IRQ A;  3JRA A;  5J4Y A;  1T39 A;  1UJ8 A;  2QUF A;  3RQ4 A;  2ZJP F;  3J7A O;  1QPM A;  2HYJ A;  1ZN2 A;  2X85 A;  1N78 A;  4UUT A;  1FT9 A;  5J40 A;  1YS6 A;  5GPC A;  3S2D J;  3CJN A;  4N0B A;  1BR4 A;  5TGT A;  4XQF A;  4IHX A;  1U9O A;  2D2W A;  1BI1 A;  3M8J A;  4UNO A;  3IKV A;  1XPX A;  1EH6 A;  2Z9O A;  1JGG A;  4AUX A;  3U2R A;  1MSF C;  3U21 A;  2B7E A;  4XLF A;  1P92 A;  4B48 A;  4E7L A;  4RMN A;  2XF7 A;  4ENK A;  3H5N A;  5H2F C;  2A07 F;  1T38 A;  1VQO I;  3ABK H;  3TO9 A;  2K9N A;  3HOS A;  1X3Z B;  3FIS A;  2VJ4 A;  4ENN A;  2DDA A;  2R4G A;  4AIK A;  2F48 A;  3H1C A;  1ITY A;  3DLA A;  3QRF F;  2HI3 A;  2HQN A;  3JR9 A;  2FQ3 A;  4D9J A;  1SFE A;  2KLO A; 
#chains in the Genus database with same CATH homology
 2O6G E;  3LQR A;  5DD8 A;  3T1B A;  5LGU A;  3ZQ7 A;  5ICG A;  2V1U A;  2EFN A;  5HS9 A;  4I0A A;  2XAG A;  2XRN A;  3FZV A;  4R8H A;  2VE8 A;  5K5R A;  5A2Q K;  1FWZ A;  3HHG A;  1P6R A;  2K02 A;  2XGX A;  1JE8 A;  1U8R A;  2IW5 A;  3BP8 A;  1MKM A;  2H6C A;  3ISP A;  3HTS B;  4WXH A;  2HS5 A;  1S6L A;  1XMK A;  1V4R A;  2MLK A;  5FLX K;  1L0O C;  1EH8 A;  1F5T A;  1D8J A;  4KIF A;  2BV6 A;  1OMI A;  5E17 F;  4L9J A;  2WC2 A;  5F6F A;  4OIR F;  3CUO A;  3JAM K;  3ELK A;  3SZT A;  2HWV A;  4PDK A;  2QQA A;  4R79 A;  2ZKZ A;  4A5N A;  4EGZ A;  2GA1 A;  2HOE A;  2LSO A;  1ZGA A;  2ZCW A;  5D5W B;  2CQK A;  3ZMD A;  4PZJ A;  3E6M A;  1P2F A;  3FM3 A;  1QNT A;  1T6S A;  5LHH A;  1KYW A;  1DDN A;  4KIG A;  1AWC A;  3RDI A;  2DPD A;  1BI2 A;  3DQV C;  3DPL C;  1H9G A;  1USS A;  2HKO A;  3I53 A;  4G6Q A;  2EFP A;  2OD5 A;  4LB5 A;  1UCR A;  2A6H F;  1T2K A;  1G3Y A;  2OBP A;  3E6D A;  4XRF A;  2JPC A;  1YO5 C;  2DBB A;  3TOA A;  3KZY A;  3V8J A;  4ESJ A;  3ZN0 A;  3GXO A;  2XAQ A;  2STW A;  4U0V A;  2YSR A;  3LA7 A;  2PN6 A;  6PAX A;  3GW2 A;  4HQE A;  2FMY A;  3M8F A;  5E20 A;  3O3K A;  3L7W A;  1ZH5 A;  1ZHF A;  5D5X B;  5IT3 A;  1O7L A;  4NQW A;  4EM1 A;  1IZ1 A;  2OZ6 A;  3J80 K;  1RUO A;  1YYV A;  5L3B A;  4HZF A;  4LLL A;  1IN8 A;  4HX7 A;  4HA8 A;  4XLP F;  1SFU A;  3LQQ A;  2K4B A;  2IP2 A;  2B0L A;  2ZO4 A;  3TO7 A;  1XSD A;  1G3T A;  3GEZ A;  3NEU A;  3HRT A;  1TBX A;  5TRD A;  2VT2 A;  5EEG A;  3WGH A;  1KU2 A;  1I6X A;  5D5U B;  3ZPL A;  1MDM A;  2XAS A;  4HDV A;  4MEX F;  3C18 A;  4KUM A;  1TW2 A;  5LGT A;  4WX9 A;  1DUX C;  1QZZ A;  2L3D A;  1RZ4 A;  3O6B B;  4EJU A;  4I7H A;  4M73 A;  2MA3 A;  3P9K A;  4AVP A;  3M1E A;  2O61 A;  2MBF A;  5L3F A;  1G3W A;  1XDS A;  5J8C A;  5CLS A;  5DUI A;  3WTS C;  1XGN A;  3WE3 A;  3KP2 A;  4BHP A;  4HLX A;  1SD5 A;  3N97 A;  2WWY A;  2G7U A;  4DNC A;  2O8X A;  4A0Y A;  2F2E A;  2CW0 F;  4L0Y B;  1MJ9 A;  1C0W A;  4HAM A;  2OU2 A;  1W7P D;  3DPT A;  4YII A;  2ELH A;  2EK5 A;  3HSR A;  5DUK A;  1LEA A;  2UXX A;  3L00 A;  1W7P A;  2P4W A;  2HFH A;  4RGS A;  4S05 A;  2DTR A;  4HOB A;  5A2Q Z;  2CGP A;  2DO7 A;  3VOD A;  1S7A A;  4CXF A;  3EYY A;  3SXY A;  3HTU A;  1LVA A;  4Q47 A;  2IA0 A;  2W57 A;  1ON2 A;  2HQR A;  2W24 A;  3TKY A;  4LG0 B;  5ILV A;  2BGC A;  4GGG A;  4XBF A;  3TGN A;  4NHJ A;  5FLX Z;  2YX4 A;  4GCV A;  4HX4 A;  5CYV A;  1H9T A;  3BWG A;  5K5Q A;  3W6K B;  2OQG A;  3KLN A;  3IL2 A;  4XSX F;  3RIR A;  1IRG A;  2M8E A;  1J7K A;  1ON1 A;  4WXC A;  3LFK A;  4I09 A;  2PQ8 A;  4HF0 A;  2QQB A;  1V3F A;  2ESH A;  1GXP A;  4A0Z A;  4RB1 A;  5BPI A;  1IN7 A;  5FO5 A;  3C3W A;  1B9N A;  2K86 A;  1YG2 A;  3RI4 A;  2V79 A;  3QOP A;  3MCZ A;  1RIO H;  1ZLK A;  4G7Z F;  2IPQ X;  1MD0 A;  3DKW A;  3RKX A;  3F6O A;  3DV8 A;  3JW4 A;  5HS7 A;  4HF1 A;  4YFX F;  1T0F A;  1I5Z A;  2XUB A;  2IA2 A;  3I54 A;  4ZYG A;  2ZJ2 A;  3KZZ A;  4WK8 F;  4DQ2 A;  4Q4Z F;  2RKH A;  3CUQ B;  3REO A;  2FU4 A;  1ONV A;  2H09 A;  1MJB A;  2M30 A;  3LWF A;  3I59 B;  1K78 B;  2D1H A;  1IW7 F;  2XKO A;  5ILS A;  3EET A;  3ECH A;  4MHG A;  1FYK A;  3KE2 A;  2HTS A;  4L5J A;  4RGR A;  1FLI A;  1TTY A;  5E18 F;  4LK1 F;  1B1B A;  1IRF A;  1OYY A;  4MTE A;  1QGP A;  3HRM A;  4WCG A;  4N9I A;  4A0X A;  4IF4 A;  3J80 Z;  5BPD A;  2QM3 A;  2DU9 A;  4EJO A;  2NYX A;  2NNN A;  4JK1 X;  1Z1D A;  3MQ0 A;  1YFH A;  2M1B A;  1YQA A;  4IJA A;  3TQN A;  3D0S A;  4PGG A;  3V8K A;  1U78 A;  3MFK A;  2WV0 A;  1SMT A;  4K2E A;  3U1D A;  5DCM B;  2XAH A;  3VEP A;  1D8K A;  2XKP A;  2PG4 A;  1FOK A;  2K7L A;  4QWQ A;  3I4P A;  3K9T A;  3K1P A;  3D5L A;  1YIO A;  4O3M A;  5CVI A;  3MWM A;  2P7C B;  3HYI A;  1YW9 A;  1XGM A;  3QP6 A;  2F5F A;  3WU0 A;  3R0J A;  4ON0 A;  3OOP A;  2QZ8 A;  5D4S A;  3IRR A;  1J75 A;  2R3S A;  2XHK A;  1T98 A;  2NAZ A;  3GFM A;  4ENM A;  2LDU A;  1FSE A;  1KA8 A;  4KYW A;  2O0Y A;  3QU3 A;  3GWZ A;  3I71 A;  1MJA A;  4LGW A;  1TNT A;  4RAZ A;  5FFZ A;  4BH9 A;  1EV7 A;  4BNC A;  2CG4 A;  3FWE A;  2FSW A;  3EYI A;  1U5T A;  3NQO A;  1WWX A;  3P9C A;  4EJT A;  2XRO A;  3B73 A;  2DLL A;  2Z3Y A;  2E1N A;  4ESB A;  2VBY A;  4N9H A;  3JSP A;  2FBH A;  2H27 A;  3GYH X;  1U5T C;  1A04 A;  4A6E A;  2K27 A;  1HW2 A;  2BBY A;  2EFQ A;  1S29 A;  4BXU A;  5D5V B;  2H6B A;  4P5O A;  1SFX A;  3CO6 C;  4M9X A;  2V6C A;  1GVJ A;  3OV8 A;  1FNN A;  3BPV A;  1BC7 C;  1ZG5 A;  4YIF A;  1XN7 A;  1REP C;  3COA C;  2FBK A;  2STT A;  4IRG A;  2EFO A;  4IHS A;  2DFI A;  3TDZ C;  3LA3 A;  4HV6 A;  3G73 A;  2VC1 A;  5HLI A;  3J81 K;  2QYO A;  2PBI A;  1S8N A;  2M45 A;  3ROU A;  3F22 A;  1W4M A;  5ILU A;  3Q5F A;  1TLH B;  4G6D A;  3ZMT A;  2VXZ A;  3F8N A;  1W5S A;  3ZP5 A;  1B4A A;  1FY7 A;  1IAW A;  3R6S A;  1UST A;  3CDH A;  2DT5 A;  1WSU A;  3BJO A;  2CWE A;  1B9M A;  1I1S A;  2D45 A;  2ZME A;  2HTJ A;  1FC3 A;  3U9G A;  2XAJ A;  4Y15 A;  2DQR A;  3Q9V A;  2VON A;  3CO7 C;  1O3R A;  4G7O F;  2EA4 A;  5H20 A;  1U2W A;  2OA4 A;  2XVC A;  2DK8 A;  4ZZL A;  3WTX C;  4LG0 A;  2ETH A;  3FMS A;  2KJB A;  4L0Z B;  3L2C A;  2DPU A;  3WTU C;  5F1R A;  2YPR A;  3FMR A;  3K0L A;  4MNU A;  3R4K A;  3WTY C;  3HRS A;  4KNY A;  1KU7 A;  3BDD A;  3KP5 A;  1B6A A;  3DF8 A;  3W6J B;  4UV8 A;  1BIB A;  1R1V A;  4CZZ A;  2MH2 A;  4IHT A;  2NS0 A;  5K1Y A;  2JSC A;  3I5U A;  3K1M A;  1MGT A;  2QLZ A;  2KJC A;  3FXQ A;  2Q8K A;  1SD6 A;  2LNB A;  2ZBK A;  2RGV A;  1PP7 U;  2V1D A;  2JTV A;  3ML6 A;  4B09 A;  3FX3 A;  2ADU A;  1YW8 A;  2FOK A;  3QPT A;  3HSE A;  4JBA A;  5BOX A;  1R5H A;  2KIF A;  1HXD A;  4EGY A;  2QBY B;  2OQR A;  2P5L C;  4A2U A;  4PGH A;  2QVO A;  2V1X A;  1F4K A;  3CLO A;  4Q5S F;  1Q1H A;  4OIO F;  5E1Z B;  1K7A A;  3VOE A;  1HKQ A;  3BZ6 A;  1FP1 D;  4KT5 C;  1P4A A;  1CF7 B;  4OMY A;  4RGU A;  1S7O A;  3B02 A;  3GZ5 A;  1RI7 A;  2P6T A;  5L3D A;  1ZRD A;  1BI0 A;  4EJV A;  1XGO A;  1YTY A;  4IRH A;  2Y0M A;  2D1V A;  1BM9 A;  3F8F A;  4F7Z A;  2W25 A;  1HKT A;  3S2W A;  5HLG A;  1LDD A;  1W5T A;  5HDN A;  1R22 A;  3RTR A;  2E7X A;  1D3Y A;  5DCM A;  5D6F A;  2FML A;  3WOD F;  2UWM A;  3E5X A;  5ICF A;  3JTG A;  4TV7 A;  5DYM A;  2O03 A;  3T0Y A;  2J5P A;  1ZRC A;  4ZYE A;  4M9S A;  1J59 A;  2Z99 A;  1RUN A;  4GYG A;  3GO5 A;  2QEN A;  1FX7 A;  5L3G A;  2VOO A;  1Z7U A;  2BYV E;  4KA4 A;  5HDG A;  3P9I A;  5FB2 A;  1E2X A;  1D5V A;  1JXS A;  2C6Y A;  1UFM A;  4UVC A;  4RB2 C;  2A69 F;  3J81 Z;  2FNA A;  1HSJ A;  3LAP A;  3KEQ A;  4CIC A;  3HIF A;  2P7V B;  4U7B A;  2JPB A;  4I98 B;  3F8M A;  5FD6 A;  3SFZ A;  1DPU A;  4UXN A;  2DAO A;  2FXA A;  4G9Y A;  3F6V A;  3E97 A;  3K1N A;  5ERI A;  3WG9 A;  3ERE D;  4EJW A;  3H92 A;  1QZY A;  3Q9S A;  2L4M A;  4UV9 A;  5F64 A;  2UXN A;  4CHU A;  1DPR A;  4HLY A;  4ZYD A;  4LLN A;  1ZRF A;  1U6G A;  3I64 A;  3JSO A;  3IWF A;  3WTW C;  4D0P A;  2OAZ A;  3F21 A;  1DP7 P;  4KMF A;  1HKS A;  2VBZ A;  3EDP A;  2JRT A;  3HOT A;  1HBX G;  2AXL A;  1KQ8 A;  4L9N A;  4P96 A;  4L9V A;  3SZP A;  5ICE A;  3RPU A;  2G9W A;  4HBL A;  3I58 A;  4Y17 A;  5LHI A;  5DD4 A;  2IT0 A;  1KGS A;  3V4G A;  5J6X A;  2MC3 A;  3I0T A;  1PUE E;  3C1D A;  3KP6 A;  1WRJ A;  2ACJ A;  1JGS A;  4LD5 A;  1SAX A;  4ZZD A;  2LKP A;  2VE9 A;  1MDM B;  3F8B A;  1R5G A;  3M8E A;  3MZH A;  1TW3 A;  3V8L A;  1BOA A;  4O6J A;  2P5V A;  1OR7 A;  4MGR A;  2NRA C;  1AOY A;  4NB5 A;  2FA5 A;  2AS5 F;  4I01 A;  2VOP A;  2F5E A;  2Y48 A;  3FXR A;  2COM A;  1XMA A;  4GXO A;  1LJ9 A;  4M6X A;  2EV0 A;  5H6Q A;  4WXD A;  3M7G A;  3ZMZ A;  4XSZ F;  2VBX A;  3FXU A;  3VB2 A;  3WE2 A;  2VN2 A;  4I0B A;  4BHB A;  4HF2 A;  3WGI A;  1FBU A;  1Z6R A;  2E7W A;  2RNJ A;  1ZYR F;  3RYP A;  3IC7 A;  2FRH A;  4AWX B;  1ZG3 A;  5D4R A;  2CFX A;  1LDK B;  4MQ9 F;  2EV5 A;  2R7F A;  2XV4 S;  3NRV A;  3SQN A;  3MZY A;  3V7C A;  4EVI A;  1J0R A;  5JFR A;  3F23 A;  2A5Y B;  5EEH A;  3DP7 A;  2VT3 A;  5LRR A;  1U3E M;  1XCB A;  2GZW A;  5AON A;  1W7P B;  4HQM A;  5HDK A;  1UHW A;  4OIP F;  3T5X A;  2GIV A;  1LNW A;  5LEK A;  3E6C C;  2J5O A;  4L9T A;  2EB7 A;  3KP3 A;  4HYE A;  4JQF A;  4KN7 X;  2A61 A;  2Q2E A;  1JHH A;  3EUH A;  2VBW A;  2PEX A;  4EV0 A;  2PI0 A;  4A6D A;  3G3Z A;  4MEY F;  3MAJ A;  1HW1 A;  2X0L A;  2RN7 A;  3LA2 A;  2OZU A;  1R00 A;  1ODD A;  1STZ A;  2QBY A;  4MTD A;  2FE3 A;  2Z33 A;  1Z6T A;  3LST A;  3TOB A;  2UZK A;  4A12 A;  2KIM A;  5LLQ A;  1BN5 A;  5LEJ A;  3DFG A;  2BE5 F;  2DW4 A;  1X3U A;  2ISZ A;  2ZNY A;  1FYL A;  3ULQ B;  1CF7 A;  4YFN F;  4CDG A;  5HLH A;  4FX4 A;  4L5I A;  3WTV C;  3QP5 A;  3HHH A;  3TO6 A;  2W85 A;  2L01 A;  1FPQ A;  2WTE A;  1WKM A;  5ED4 A;  1I27 A;  4HV5 A;  4PCQ A;  5D6E A;  1Z05 A;  4MQV A;  3KCC A;  5DV5 A;  1ZG1 A;  4P9F A;  2HYF A;  3V7R A;  1IF1 A;  1O7F A;  4UVB A;  4OIQ F;  4FT8 A;  3ZMS A;  2FF4 A;  3RYR A;  3C7J A;  3BPX A;  2IA1 A;  3WTZ A;  1KU9 A;  3O2P E;  3PFI A;  1BIA A;  5LGN A;  3PQJ A;  2RV8 A;  2JT1 A;  2ZFW A;  4RS8 A;  3KLO A;  4M74 A;  4CO8 A;  1TNS A;  4GYI A;  5KVR A;  1XGS A;  2IJL A;  5CVU A;  4Z2Y A;  2M87 A;  2A68 F;  3KFW X;  5JHU A;  1ZAO A;  2LF8 A;  4KDP A;  4GO1 A;  1IXR C;  4S04 A;  1YW7 A;  4LFU A;  4P9U A;  5CVR A;  3SHF A;  1XSX A;  2MH9 A;  3H3U A;  5K5O A;  3VFZ A;  4P55 A;  3BOQ A;  3ZN1 A;  2PMU A;  5TJJ A;  1B59 A;  2YR2 A;  3RKY A;  4IRI A;  2QWW A;  2EA2 A;  2EJR A;  4YG2 F;  2V9V A;  4G8X A;  1KYZ A;  2DI3 A;  4EM2 A;  2R7D A;  2FBI A;  3GLX A;  1XB4 A;  2EWN A;  2PMH A;  4HX8 A;  4OIN F;  5KK1 A;  1XD7 A;  2HYG D;  3L09 A;  3JTH A;  3E5U A;  1LB2 A;  3V7S A;  5FD5 A;  4AD9 A;  1R58 A;  3GVA A;  3HUG A;  4LMY A;  1NHA A;  4LLG F;  3ZMU A;  3K2Z A;  4KFC A;  4KN4 X;  4IPA A;  3IHU A;  4Q48 A;  2ZNZ A;  1Z91 A;  5CVJ A;  1LDJ A;  5CJ9 A;  2Q0O A;  3T8R A;  3RJP A;  1KQ0 A;  3KET A;  1FBQ A;  2HGC A;  2A3S A;  3HSF A;  2P6S A;  4OOI A;  1K79 A;  4BYY A;  1U5T B;  3CUQ A;  4AIJ A;  2W84 A;  3I59 A;  4EMS A;  1K78 A;  3KEO A;  1F9N A;  3FHZ A;  3BJ6 A;  2VOD A;  4A5M A;  4YFK F;  1PP8 F;  3CUQ C;  1OPC A;  3F3X A;  3DEU A;  4G7H F;  1E17 A;  2MD5 A;  4L18 B;  1G4D A;  5ICC A;  1KU3 A;  2EV6 A;  4R1H A;  2VC0 A;  4OMZ A;  3FMQ A;  2KIU A;  5IT9 K;  4KIC A;  1BI3 A;  4BHC A;  4QLC U;  2HKX A;  3CTA A;  4BQA A;  2FEZ A;  1K6O A;  1XCV A;  4U0W A;  2HDC A;  4U0Y A;  3BY6 A;  1HQC A;  4AIH A;  4IVN A;  1O57 A;  2XIG A;  3GZ6 A;  4OU0 A;  4RGX A;  1RNL A;  3KP7 A;  1Z9C A;  2P8T A;  4I2O A;  2G7H A;  1SD4 A;  5AIP A;  1ZRE A;  2O3F A;  3GF2 A;  4XLN F;  2ISY A;  4M71 A;  1FZP B;  2L02 A;  1L3L A;  2PJP A;  5DDG A;  1ZGJ A;  1YLF A;  4ZH4 F;  3M9A A;  5JVT A;  3GUD A;  5E8G A;  4UHT A;  2DQL A;  2NNY A;  5LRS A;  1O3S A;  3MEX A;  2X4H A;  2ZME B;  1ULY A;  1IN5 A;  4BAY A;  1HW5 A;  5LBQ A;  4LJZ F;  3H3Z A;  1P4X A;  2YX7 A;  4RAY A;  2CSO A;  1H0M A;  2EFW A;  2CO5 A;  4H0E A;  4UVA A;  5L3C A;  3IKT A;  2HR3 A;  3K69 A;  3E5Q A;  1J9I A;  4RB3 C;  5JI6 A;  3ABT A;  2QQ9 A;  1G3S A;  4G94 A;  1BC8 C;  1XDU A;  1J2X A;  4B8X A;  2E1C A;  2BEO A;  5D8L B;  2LF7 A;  2IRF G;  5HS8 A;  4RB0 A;  2M5W A;  1BBY A;  1FBS A;  3KP4 A;  5HOO A;  5DCF A;  2L54 A;  1ZLJ A;  4ASN A;  1VTN C;  5E1X A;  4LK0 F;  3EQL F;  1UB9 A;  4KIB A;  1O3T A;  1EH7 A;  1R1T A;  1I1G A;  1R23 A;  3JAM Z;  3F72 A;  1S3J A;  1IXS B;  2IVM A;  5BQT A;  4O5V A;  3RKW A;  3N4M A;  2GWR A;  3GFJ A;  1IN4 A;  2K4J A;  2H94 A;  4Y13 A;  2GQQ A;  3R0A A;  4FX0 A;  1WI9 A;  1FYM A;  1J5Y A;  1R1U A;  3QPH A;  5LHG A;  4U7D A;  1GHC A;  5D8K B;  3HRU A;  3WGG A;  2GA2 A;  1GXQ A;  3WU1 B;  5JR3 A;  2PLY A;  2F5D A;  3BJA A;  5BS6 A;  1ZAR A;  4U88 A;  2RC4 A;  1Y0U A;  2DK5 A;  4EQQ A;  3ECO A;  1SD7 A;  4M6Y A;  1BJA A;  3DXJ F;  3GFI A;  4EM0 B;  1F1Z A;  3E3V A;  3AAF A;  2HZT A;  4ESF A;  1TQI A;  3QAH A;  4HW0 A;  1OYW A;  2A6E F;  3TDU C;  4HDU A;  1KQ9 A;  5FFX A;  1XSV A;  2HEO A;  3IWZ A;  5L3E A;  5J8F A;  1OYI A;  1FP2 A;  3PQK A;  1R7J A;  1HST A;  1JHF A;  4ZYH A;  1LEB A;  2RDP A;  2GAU A;  1LQ1 A;  1IUY A;  3P7N A;  3ABU A;  1SMY F;  2TDX A;  1O3Q A;  2P5K A;  3FF5 A;  3E6B A;  4IXA A;  3BRO A;  1G6N A;  1IN6 A;  2Y75 A;  1OKR A;  4FHT A;  3RPQ A;  2JZY A;  3FM5 A;  1PDN C;  1WQ2 A;  2KKO A;  5E1W A;  1QQI A;  2ESN A;  3ZMV A;  2Z5U A;  5HVQ C;  1TQM A;  1YS7 A;  3T8T A;  3R60 A;  2FNP A;  2RVC A;  1FSH A;  4M72 A;  1P4W A;  1TQP A;  4LB6 B;  3R61 A;  1QO0 D;  2CYY A;  4ETS A;  4M9Z A;  5FGM A;  4ENJ A;  2YU3 A;  5CVV A;  2L4A A;  1IXC A;  1UHM A;  4WF2 A;  1QBJ A;  2GXG A;  2KRF A;  2XAF A;  2RQP A;  2GXB A;  4WWC A;  3L9F A;  3F8C A;  4E70 A;  3GX4 X;  5IT9 Z;  1R36 A;  5BMZ A;  4UUV A;  2PFB A;  4CYD A;  2F5C A;  2MLG A;  3WTT C;  5H6R A;  2ZXJ A;  3QU6 A;  5E8I A;  3GFL A;  1MZB A;  4I02 A;  4KMU X;  3LAJ A;  1CGP A;  4CGZ A;  5AIQ A;  5DEQ A;  3IRQ A;  1T39 A;  2QUF A;  3J7A O;  1QPM A;  1ZN2 A;  1FT9 A;  1YS6 A;  3CJN A;  4N0B A;  2D2W A;  1BI1 A;  4UNO A;  3IKV A;  1EH6 A;  2Z9O A;  3U2R A;  1P92 A;  4ENK A;  2A07 F;  1T38 A;  3TO9 A;  3HOS A;  4ENN A;  4AIK A;  3QRF F;  2HQN A;  2FQ3 A;  1SFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...