3TGNA

Crystal structure of the zinc-dependent marr family transcriptional regulator adcr in the zn(ii)-bound state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
135
Chain Sequence
MRQLAKDINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSEESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETFYQLTDLARPIAEEHHHHHEHTLLTYEQVATQFTPNEQKVIQRFLTALVGEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adc operon repressor AdcR
publication title Crystal Structure of the Zinc-Dependent MarR Family Transcriptional Regulator AdcR in the Zn(II)-Bound State.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription
total genus 49
structure length 135
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tgnA02
2E7XA 3Q9VA 3P9KA 3GYHX 3W6KB 1JXSA 2DPUA 1I6XA 1T0FA 3KCCA 1FYMA 4L9TA 5F1RA 5JFRA 3KP7A 4ESFA 1FT9A 4BAYA 2Y0MA 2NYXA 4OIQF 3D0SA 3DFGA 2M5WA 1R5GA 3F6OA 1F4KA 1USSA 4AD9A 5FLXZ 1IRGA 5E1WA 4EGZA 1B9NA 1XGSA 4IF4A 3T5XA 3RIRA 2X0LA 4BQAA 2FF4A 4MEYF 5E1XA 2EFPA 4KIBA 5CVIA 1EV7A 5D6EA 3WU0A 2BE5F 3N97A 3F8MA 1FSHA 2JSCA 4WXCA 5DEQA 2ZNZA 3W6JB 4BHBA 3KEOA 2CYYA 1LQ1A 4M6XA 3LA2A 3K1NA 1MJ9A 1YG2A 3ULQB 2FRHA 5E20A 1LJ9A 2IA2A 4RGUA 2QLZA 3AAFA 4EJOA 4HQMA 3JSPA 4IRGA 1K7AA 4BNCA 1KGSA 4BH9A 4U0WA 1AWCA 1W7PD 3EQLF 4B09A 5BMZA 2Z5UA 4HA8A 2EB7A 4WXHA 2XIGA 3BJAA 4I0AA 4YIIA 1EH7A 1ZG1A 3DKWA 4P96A 1R22A 2VOPA 2VE9A 2YPRA 2Z33A 3ECOA 2G9WA 4RB2C 4G7OF 4FHTA 1T2KA 1G4DA 3TOBA 5LGUA 1YIOA 2R3SA 3HUGA 4G94A 2COMA 4HQEA 3TO6A 3T8TA 2EA2A 1XD7A 1P2FA 3F72A 4IPAA 5ILSA 2ZJ2A 2PMHA 1XSXA 1L3LA 3IRQA 3I0TA 2BV6A 4NQWA 1FSEA 5D5WB 1ZG5A 1B9MA 2HTJA 3Q9SA 1SD7A 5HDNA 2RQPA 2EFQA 2HYFA 3I71A 1HKTA 2A6EF 3E6DA 1LDJA 1HXDA 2EV6A 2YSRA 1XGOA 4UXNA 1QBJA 5KVRA 3HSRA 1FNNA 3R0JA 3K0LA 2K02A 2QZ8A 4IRHA 3QP5A 1B1BA 3BP8A 1KQ9A 3WTUC 4U7DA 2ESNA 2HR3A 2VC0A 3WTTC 1B4AA 4MTEA 3CO7C 1YW9A 2OBPA 2VODA 1QZZA 4P5OA 3WTZA 1O3RA 5DCMA 3P9CA 2GXGA 3FXUA 2CWEA 3F23A 2C6YA 2FXAA 3F8CA 1O3SA 4KDPA 5HDKA 4YFNF 2E1CA 1PP8F 3BPVA 3GFIA 4FX4A 1S3JA 2HZTA 4ZZLA 1FYKA 2W25A 2IA1A 5LEJA 5DUIA 2NNYA 5TRDA 2L4AA 4Z2YA 1GXQA 4IHSA 5JHUA 3T1BA 3I58A 3FM3A 5L3BA 4LGWA 2JTVA 2FU4A 4HBLA 4S05A 1XSDA 2ISZA 1LEBA 1F1ZA 3REOA 4IVNA 3TDUC 4UHTA 2D1VA 3F3XA 1R1UA 3CUQA 5JVTA 3KP2A 3L2CA 1HQCA 1F5TA 3ZMVA 3HRUA 1KU2A 5E8GA 2P7CB 1E17A 1P4XA 3WGHA 3KFWX 2BYVE 5E17F 2O61A 3RDIA 3LSTA 5JR3A 2NNNA 5D8KB 1R1TA 1W4MA 3V8LA 4XSXF 5KK1A 2EFNA 4Q47A 4HLYA 3FHZA 4IJAA 5D4SA 5BPIA 3IWZA 3T8RA 3HTUA 1XMAA 1TNSA 4M71A 3DP7A 1YW7A 5E1ZB 3DPTA 4MQ9F 2DQRA 3J80K 3SHFA 1I27A 3M8FA 4A5NA 4RB1A 2K7LA 4KN4X 4LG0A 3PFIA 2DI3A 4L18B 3E5XA 5HS7A 4GXOA 1QPMA 5J8FA 5HOOA 3BY6A 2MA3A 3J81K 1P4WA 4OIRF 4OMZA 2P6SA 5DV5A 2GIVA 3F8BA 3L9FA 1FBUA 5ILUA 3PQJA 4YFXF 3ZP5A 3FMRA 4BHPA 1ZREA 1FP1D 3LQRA 2IA0A 4UVAA 2DW4A 3I59A 3HOSA 2UXXA 1R7JA 2WWYA 3SXYA 3DV8A 4KFCA 4P9UA 5ICGA 3GZ6A 1RUOA 5HLIA 1D8KA 3GW2A 4JK1X 2B0LA 5K5RA 3BJ6A 3FF5A 3L7WA 4M72A 1XN7A 2EA4A 4HF0A 2ZNYA 2Q8KA 1T39A 5D5VB 2HKXA 4KICA 1J5YA 3CUQB 1R36A 4O6JA 4EM1A 3KEQA 2W57A 2XASA 4R1HA 1D3YA 4ENNA 5CVJA 2PEXA 1J0RA 3F8NA 3R60A 3GLXA 2D1HA 3E97A 5HVQC 1USTA 4N9IA 4M9ZA 2BGCA 2LDUA 3KP4A 4ETSA 1SFEA 4ZZDA 4M6YA 2J5OA 5J8CA 4JQFA 1K78B 1O3QA 4Y15A 3COAC 3ISPA 4KT5C 2M8EA 1HW5A 2FEZA 5IT9K 2L01A 1EH6A 2PFBA 6PAXA 1IF1A 2OU2A 4RS8A 1XGMA 3IWFA 3G73A 3IRRA 4H0EA 2VBZA 2XAGA 4A6EA 5E8IA 2HKOA 1HBXG 3PQKA 4ZYHA 5LBQA 2VN2A 3EDPA 1L0OC 3I53A 4O3MA 2Y48A 3E3VA 5DYMA 1G3YA 5DUKA 2ETHA 4UUVA 1DPUA 4ENMA 3E5UA 3IL2A 2LKPA 3P9IA 2P8TA 4LK0F 4RB3C 2EV0A 4U0YA 1O7LA 3RTRA 2HS5A 5A2QZ 2HTSA 1R23A 5AIQA 4HX8A 2F5CA 2HGCA 5FGMA 1TW2A 2WC2A 3L09A 1DPRA 3J81Z 1IW7F 3E6MA 2V1UA 4A12A 3GF2A 2DK8A 1FC3A 4P9FA 4KMFA 1XGNA 1ZRFA 2ZKZA 2IT0A 2KKOA 1BJAA 3C18A 4I7HA 3I4PA 5FD6A 3ML6A 1OR7A 3FXRA 3ZMZA 2CGPA 4WK8F 3CLOA 1TW3A 1HKQA 2ZBKA 3VFZA 4EJTA 1UFMA 3RKWA 2VONA 1MD0A 2L02A 1G6NA 3HIFA 1J59A 1JHHA 3LA3A 2MLKA 1YFHA 2V6CA 3LAJA 4LJZF 5DCFA 2OZ6A 1SMYF 2LSOA 3EYIA 4N9HA 2EJRA 2PLYA 1Z91A 5BOXA 1R58A 1X3UA 2XGXA 3T0YA 4UVBA 3O3KA 4A2UA 2EFWA 3ERED 2CQKA 4QWQA 1ODDA 1HSTA 3VODA 3LQQA 3IHUA 2RN7A 2QBYB 5D4RA 3ZMTA 3K69A 4LB6B 1A04A 2MC3A 3QP6A 3HTSB 1P4AA 3O2PE 2VBWA 4U7BA 2NS0A 3RKYA 1F9NA 4FX0A 3BOQA 1U78A 2KIUA 5IT9Z 1CGPA 3WE3A 2ACJA 3C7JA 1XCVA 2IJLA 3F21A 4BYYA 3U2RA 1Z1DA 1V3FA 3WODF 1KU3A 2JPCA 1U2WA 3U9GA 5LEKA 2P7VB 1T6SA 5LRRA 4EM0B 3WGGA 2ZO4A 3I5UA 3ZMSA 5BS6A 2RDPA 4A6DA 2XV4S 4HW0A 1BI2A 2Z3YA 3JAMK 2E1NA 3MAJA 1STZA 5L3DA 4CXFA 3LAPA 4M9SA 4ZYGA 3GX4X 2TDXA 1QO0D 2XVCA 1XDUA 5JI6A 1ZGAA 4D0PA 3FMQA 3DQVC 1YQAA 2P5KA 3BDDA 5ERIA 1OMIA 2O6GE 5HS9A 5BPDA 1ON1A 2IRFG 2JRTA 2ELHA 4U0VA 1S29A 2IW5A 2XAHA 4FT8A 4WX9A 4L0ZB 2EK5A 3V7RA 3CUQC 3B73A 1FBQA 2GWRA 4A0XA 3TGNA 2X4HA 2Z9OA 2QENA 2HQRA 1KYZA 3GZ5A 3NRVA 2DK5A 4AIJA 5TJJA 1KU9A 4S04A 4B8XA 3HYIA 3R6SA 2FNAA 4EV0A 1MZBA 2K27A 2CW0F 4MNUA 2QUFA 4CDGA 1IAWA 3F22A 5FFXA 2PG4A 1ZAOA 3KP3A 1J7KA 3GFMA 3K1MA 2L4MA 1JGSA 3GFLA 4Y13A 4P55A 3RPUA 1K6OA 2O0YA 2RNJA 3WG9A 2Q0OA 3BROA 4IXAA 3NEUA 4QLCU 4L9JA 3WTSC 1BI3A 3ECHA 5D8LB 3CDHA 3ABTA 5H6QA 3LFKA 4I2OA 3WE2A 2LF8A 4IHTA 3V7CA 1TLHB 4AVPA 2IPQX 1IUYA 4OIOF 2BEOA 3CUOA 4HOBA 4JBAA 2OQRA 2UZKA 1LDKB 1ULYA 3M8EA 2DBBA 1SD5A 2PBIA 3WGIA 5D5XB 3JAMZ 1XMKA 4RB0A 2VBYA 2V1XA 1IN4A 1P6RA 4G9YA 1K78A 3TQNA 4L5IA 4ASNA 3GEZA 2Y75A 2HDCA 4OMYA 4CO8A 1J2XA 4G8XA 4XSZF 1ZRCA 1Q1HA 1E2XA 1BN5A 4Q4ZF 1SAXA 2O3FA 4O5VA 1NHAA 2P4WA 2VXZA 5LRSA 2F2EA 3BPXA 1S7AA 3I64A 5DDGA 5A2QK 1LVAA 5ED4A 1IXRC 2P6TA 2L54A 3MFKA 4PGHA 4XLNF 3QRFF 3B02A 1EH8A 3CTAA 1LDDA 2DTRA 3DEUA 1IRFA 2JZYA 1OPCA 3FX3A 2FBKA 2FE3A 4EJWA 3GXOA 2A5YB 3E6CC 2PQ8A 5L3FA 3L00A 1S8NA 3KE2A 4NB5A 1IXCA 4AIKA 2W85A 4GYGA 4HV5A 3KZYA 2YX7A 1TBXA 1SD4A 4LK1F 3JSOA 2M87A 2ESHA 3R4KA 1T98A 3FWEA 1GVJA 1Z9CA 3FMSA 4GYIA 5DD4A 4WF2A 1W5TA 5LGNA 3FM5A 1W7PA 1BIBA 3SQNA 1G3SA 1MKMA 4A0ZA 1GHCA 5HLHA 1CF7A 1T38A 4EJVA 3SZPA 4A5MA 1U5TB 4KYWA 4HDVA 4OIPF 3M1EA 4CICA 4F7ZA 3FZVA 3M9AA 3TOAA 2FA5A 2MH2A 2DO7A 1C0WA 3M7GA 2AS5F 2PN6A 1JE8A 3EETA 3F8FA 5HDGA 5AONA 5H6RA 5EEHA 3MCZA 1QQIA 1XCBA 5FO5A 3R0AA 2P5LC 1ON2A 2XROA 4HDUA 2WV0A 1RIOH 5F64A 2NRAC 2QBYA 4MEXF 2V9VA 2J5PA 4MQVA 1IZ1A 1V4RA 2FQ3A 2AXLA 1GXPA 4CGZA 2OAZA 1TQMA 2HYGD 1IXSB 3MQ0A 3MWMA 3H92A 4DQ2A 1J9IA 1BBYA 2XAFA 1VTNC 3WTXC 3GO5A 3H3ZA 3ABUA 3QPTA 2HEOA 4OINF 3P7NA 4A0YA 4LB5A 3BZ6A 4DNCA 2OD5A 2GAUA 1ZGJA 4M73A 4LLNA 4HAMA 3ZN1A 5ILVA 2ISYA 2RVCA 4PDKA 4WWCA 2G7UA 1W7PB 2V1DA 4BXUA 2ZMEB 4KNYA 4N0BA 2PJPA 4HX4A 2L3DA 1WQ2A 3JTGA 1CF7B 1RUNA 2QVOA 2GXBA 2MH9A 5D6FA 2A3SA 3JTHA 1YYVA 3O6BB 1Z7UA 2XUBA 2EFOA 4G6DA 5EEGA 3VEPA 4MGRA 1ZN2A 4L9VA 3TDZC 1WKMA 5L3GA 2DPDA 1FWZA 1R5HA 1XB4A 4RAYA 4LD5A 1H9TA 3KLOA 2QQ9A 4KUMA 3MZHA 2M1BA 1OKRA 3I54A 1J75A 1PP7U 3V8JA 1SFXA 4HX7A 4AIHA 2NAZA 4RGXA 2DLLA 5LGTA 1QZYA 2O03A 3RKXA 2WTEA 2DT5A 2G7HA 1UHWA 5CVUA 1UCRA 2GQQA 3RYRA 4IRIA 2Q2EA 3WTWC 1FYLA 4GCVA 4HF2A 4G7ZF 1U6GA 3GFJA 3RPQA 3SZTA 3CO6C 4AWXB 4UV8A 1MDMB 1BIAA 3K1PA 3JW4A 5ICCA 5L3EA 3HRSA 1PUEE 1IN8A 4HV6A 1G3WA 1FZPB 2OA4A 2ADUA 2CG4A 1TQIA 3C1DA 2KJCA 2QWWA 5K5OA 3E5QA 2EWNA 3QAHA 1Z6RA 5ICFA 4OOIA 3BWGA 1IN7A 5CVVA 4G6QA 2RV8A 1IN6A 1DDNA 1WRJA 3F6VA 1QNTA 2VBXA 5CVRA 3V8KA 5E18F 2H27A 3HOTA 2A61A 3GUDA 3DXJF 4I09A 4E70A 2GA2A 2DU9A 1XDSA 4R79A 1AOYA 3V4GA 5FFZA 5HS8A 3D5LA 1R1VA 5F6FA 1KQ0A 2HOEA 1BC7C 4YIFA 1SD6A 2W84A 3HHGA 2H09A 1BM9A 1U3EM 1BOAA 2FBIA 4I0BA 2GA1A 3KLNA 4EVIA 1TTYA 2W24A 5ICEA 2Z99A 1UB9A 3VOEA 4G7HF 2XRNA 4OU0A 3GWZA 1U5TC 5FB2A 3HRMA 4WCGA 2A6HF 2FNPA 4KIFA 2K4BA 3CJNA 1YW8A 4LLGF 1YO5C 4WXDA 3QPHA 5AIPA 3SFZA 2YR2A 1ZHFA 4ON0A 1YS7A 2GZWA 2MD5A 5LHIA 1LNWA 3WTVC 4HYEA 2KRFA 5DD8A 1S7OA 2FSWA 4ZYDA 1FY7A 1KQ8A 3TO9A 4MHGA 1LB2A 1IN5A 1Y0UA 3G3ZA 3RJPA 3HRTA 2DQLA 2M30A 1RZ4A 4KN7X 3QU6A 2F5FA 2F5DA 4I01A 3S2WA 2VC1A 2MLGA 2YU3A 3MEXA 1WWXA 3R61A 3ZN0A 3Q5FA 1KA8A 1XSVA 3LA7A 1FLIA 3ZMUA 3LWFA 4KIGA 3RI4A 1OYYA 2R7DA 5K1YA 5LHHA 3FXQA 4CHUA 2KIMA 4GGGA 4XBFA 4M74A 5FD5A 3TO7A 4EM2A 1U5TA 4RGRA 5LLQA 1MJBA 4ZH4F 1OYIA 2XAJA 1REPC 3WTYC 2FMYA 2RKHA 4LMYA 2LF7A 1I5ZA 4U88A 2STWA 2FBHA 1D5VA 1I1SA 5J6XA 2BBYA 3ZQ7A 2ZFWA 3BJOA 2JPBA 2M45A 1Z6TA 2OZUA 3J7AO 3ROUA 3IC7A 1UHMA 4I98B 3OOPA 3HHHA 3K9TA 5L3CA 4YG2F 4KA4A 1HKSA 4L9NA 2PI0A 2UWMA 3KP5A 1D8JA 2DAOA 4RGSA 1K79A 4XLPF 1FP2A 5H20A 4I02A 2IP2A 1FX7A 1O57A 2PMUA 3IKVA 4TV7A 5HLGA 2A69F 3U1DA 4XRFA 1DP7P 2O8XA 3QU3A 4K2EA 5DCMB 1QGPA 4NHJA 2DFIA 3NQOA 2MBFA 3ZMDA 4UNOA 4ZYEA 1BC8C 1I1GA 1ZH5A 2D45A 1ZG3A 2JT1A 3MZYA 1KU7A 2E7WA 3C3WA 1KYWA 2VT2A 2FOKA 3H3UA 4Q5SF 1O7FA 4ENJA 3HSFA 2RC4A 3ELKA 4R8HA 3N4MA 2VE8A 2ZMEA 4EMSA 1FOKA 1RNLA 2H6BA 2QQBA 5FLXK 4HLXA 4EQQA 2HQNA 2EV5A 1Z05A 2ZXJA 1U8RA 1DUXC 2FMLA 2IVMA 3TKYA 1TQPA 4L5JA 1H0MA 4EGYA 2K86A 1JHFA 4PCQA 2D2WA 3GVAA 2V79A 5IT3A 4Y17A 1B6AA 5BQTA 3KETA 4GO1A 4M9XA 1ZYRF 3EYYA 1S6LA 1ONVA 4LFUA 1SMTA 4CYDA 1PDNC 3DPLC 1HW1A 2P5VA 1MJAA 1ZLKA 4YFKF 2CO5A 1SFUA 5D5UB 2KJBA 4BHCA 2OQGA 3KP6A 3RYPA 3VB2A 1P92A 5CYVA 1ZLJA 4HF1A 2VT3A 3V7SA 4KMUX 1B59A 2CSOA 2YX4A 4PZJA 5LHGA 5CJ9A 1YLFA 1WI9A 5K5QA 4LLLA 2QQAA 1ZARA 4ENKA 4MTDA 4RAZA 2CFXA 4CZZA 3EUHA 1MDMA 2A68F 2VOOA 1RI7A 4ESJA 1BI1A 4UVCA 1WSUA 2XKPA 2LNBA 2XKOA 1ZRDA 3OV8A 3DF8A 1BI0A 3K2ZA 4HZFA 1MGTA 3HSEA 1OYWA 2H94A 4LG0B 1YTYA 1G3TA 2K4JA 5CLSA 4Q48A 2RGVA 4EJUA 1H9GA 2STTA 1FPQA 1W5SA 1HW2A 2H6CA 1HSJA 3QOPA 2UXNA 1FBSA 1YS6A 2XHKA 1O3TA 3KZZA 3WU1B 4L0YB 1R00A 2ZCWA 2QM3A 3J80Z 1LEAA 3I59B 2QYOA 3E6BA 2XAQA 3ZPLA 4ESBA 2HFHA 4PGGA 3IKTA 2HWVA 1TNTA 2R7FA 2F5EA 2KIFA 2A07F 4UV9A
chains in the Genus database with same CATH superfamily
2E7XA 3Q9VA 3P9KA 4OWRB 3GYHX 4Y33A 3W6KB 5IP6A 1N77A 1JXSA 1SANA 3G1LA 3QOEA 2DPUA 1I6XA 1T0FA 3KCCA 1FYMA 1V5FA 4L9TA 5F1RA 4FE4A 5J4VA 1OCTC 5JFRA 3KP7A 4ESFA 3RKQA 1FT9A 4BAYA 2Y0MA 2NYXA 1E0EA 2HDDA 2EZKA 4FISA 4OIQF 3H9QA 3D0SA 3DFGA 3S17J 2M5WA 1R5GA 2A05A 3F6OA 4BE2A 1F4KA 3NWSA 4XONA 2DOAA 1USSA 4AD9A 1UG2A 5FLXZ 1GV5A 1PVEA 5FROA 1IRGA 5E1WA 3J7ZI 4EGZA 1B9NA 1XGSA 1IGNA 2CFOA 4IF4A 3T5XA 1PUFA 2E5NA 3RIRA 5EG0A 2X0LA 4BQAA 2FF4A 4MEYF 5E1XA 2EFPA 4KIBA 5CVIA 4GFBA 1EV7A 2R7QA 5D6EA 2H1LA 2XF7A 3WU0A 3HJEA 2IGOA 2BE5F 5J1YA 2R4GA 3N97A 3F8MA 4U87A 1FSHA 2JSCA 4WXCA 3TW6A 4A3DJ 5DEQA 2R7RA 2ZNZA 3W6JB 4BHBA 3KEOA 3AG3H 2CYYA 1LQ1A 2AQFA 4M6XA 3LA2A 3K1NA 2JA6J 1MJ9A 1YG2A 2ME0A 4HEA2 2FRHA 1OFCX 5E20A 3ULQB 1OCPA 1LJ9A 1IV6A 2IA2A 3TP3A 4RGUA 1OCOH 4FETA 2QLZA 2O7OA 4BDZA 2LTPA 3AAFA 1G8XA 4EJOA 2WY8Q 4HQMA 3QPSA 3JSPA 4IRGA 3A2KA 1K7AA 4BNCA 1KGSA 3EUAA 5EZHA 4BH9A 4U0WA 1JKOC 1AWCA 1MH3A 4XLAA 1B72A 2MD0A 3H0GJ 4JP0A 1W7PD 3EQLF 2OCEA 4B09A 3SZGA 1ERDA 5KCMA 5BMZA 2CQNA 2Z5UA 4HA8A 2EB7A 4WXHA 1A31A 3OS1A 3S2HJ 2ZJRF 2VJIA 4IX7A 2LBFA 2XIGA 3BJAA 3LSHA 1U0JA 4I0AA 1QHGA 1TP4A 4YIIA 1EH7A 3HM5A 2E19A 1ZG1A 3DKWA 4P96A 3S1QJ 2DJIA 1R22A 2VOPA 2VE9A 2YPRA 1VQMI 2LLKA 2OF7A 1Y8RB 1MNDA 1YOVB 2Y0SN 5E3OA 2Z33A 2EIKH 3O8GA 2V1NA 2G9WA 3ECOA 4RB2C 3BR3A 4G7OF 2DA2A 2Z1DA 2XGEA 2CU7A 4FHTA 1T2KA 1G4DA 3K70C 1VQKI 3TOBA 5LGUA 1MH4A 1YIOA 3PNTA 4M3GA 2R3SA 3HUGA 1OLTA 4G94A 2COMA 4HQEA 3V42A 1BW5A 1R6RA 3TO6A 3QQAA 3T8TA 2EA2A 1RC9A 1XD7A 1P2FA 2Y0SA 4XOTA 1VQ6I 3F72A 4IPAA 5E79C 5ILSA 4F52A 1W36D 1MBEA 5EZGA 3FIWA 5GP9A 5HLTA 1IJWC 5FLVA 2ZJ2A 2PMHA 1XSXA 1L3LA 5IYBJ 2L9SA 3IRQA 3I0TA 2I10A 2BV6A 4NQWA 2JWTA 1FSEA 2DCEA 2GIZA 5D5WB 2XSDC 3HEFA 1ZG5A 4XN0A 1B9MA 2HTJA 1VQNI 4PFPA 3Q9SA 1SD7A 5HDNA 1JKRC 2RQPA 2EFQA 4PUSA 3E0JB 2HYFA 1SVOA 2WAFA 3I71A 4OAZA 1HKTA 2A6EF 3E6DA 2JMWA 3FKIJ 1LDJA 5M5WJ 1HXDA 2EV6A 1PUFB 3CCLI 2YSRA 3DKXA 1ZGWA 2KL4A 4CCNA 2M4KA 4XLEA 4F93B 2CH0A 1XGOA 4UXNA 1QBJA 4ABZA 1ETWA 5KVRA 3HSRA 1FNNA 3R0JA 3K0LA 1DP3A 1U9OA 3O8HA 2K02A 1CQTA 2QZ8A 3PIOF 4OAYA 3HOZJ 4IRHA 3QP5A 1B1BA 3BP8A 3PUBA 3VSLA 1KQ9A 5C4JJ 3WTUC 3DBLB 4U7DA 2L9VA 2ESNA 2HR3A 2VC0A 3BR5A 3WTTC 1B4AA 1TWAJ 4MTEA 3CO7C 4RLFA 1YW9A 2F6CA 2F5VA 2OBPA 2X48A 3ZCOA 2LKXA 1LKXA 2VODA 1QZZA 1OISA 4P5OA 3WTZA 1HDDC 1O3RA 5DCMA 3VWBA 3P9CA 3CD6I 2GXGA 3FXUA 1ETXA 2FQ4A 2CWEA 3F23A 4ZDOA 2KHMA 2C6YA 2OJED 2DYRH 3CESA 1N78A 3LSKA 2FXAA 3U21A 1I3QJ 3RCOA 3EPZA 3K4CA 2CW8A 3F8CA 3L1PA 1O3SA 4HG2A 3Q0VA 3GMEA 4KDPA 1HA8A 3NAUA 4PSWA 5HDKA 3H5NA 4YFNF 2E1CA 1PP8F 3ZQIA 3BPVA 3GFIA 2HOSA 1WHUA 4FCYA 1W1WE 4FX4A 1B8IA 1S3JA 2HZTA 3OR2C 1LUJB 2R7TA 4ZZLA 2F4OB 2K9SA 4NC8A 4CCMA 1FYKA 2W25A 2IA1A 4XK4A 4XRMA 4UUSA 5LEJA 2W48A 5DUIA 2JVHA 2XSJC 4XM3A 2NNYA 5TRDA 2L4AA 1JI8A 4Z2YA 1GXQA 2BY0A 4IHSA 5JHUA 3T1BA 3I58A 2DFFA 2XDVA 3GTGJ 1WJAA 3FM3A 5L3BA 4LGWA 2JTVA 2FU4A 4HBLA 4S05A 1XSDA 3ZQCA 2ISZA 1YI2I 1LEBA 3F9KA 3OIQA 1F1ZA 4A69C 2JK3A 5CKTA 3ABLH 3REOA 4IVNA 3TDUC 3OR1C 4UHTA 3CLQA 1K83J 1A5JA 4ZTJA 2D1VA 3F3XA 1R1UA 3CUQA 5IY5H 5JVTA 2MFZA 1DQUA 1EJ9A 3KP2A 3L2CA 1HQCA 4C2UA 1F5TA 2IS6A 4YEJA 3ZMVA 3A02A 3K6GA 2ELKA 3HRUA 1KU2A 4ZC3A 3CCYA 2OCCH 2H1KA 1GV2A 1PYVA 1BOBA 1K6YA 5IYDJ 5E8GA 2P7CB 1ZTRA 3WU2C 2VPRA 1DGWY 4NQWB 1E17A 1P4XA 2BW3B 3KFWX 3WGHA 3IP4B 2IS4A 2BYVE 5E17F 3W2AA 2ECCA 2IGMA 2ZMEC 2O61A 3RDIA 3LSTA 5JR3A 2JN6A 5B1BH 1N25A 1X19A 3S32A 4BU2A 2NNNA 3ZQFA 3OYAA 5D8KB 4XKBA 3CCQI 2ZB9A 4B3XA 3G6EI 4JOMA 2Y2ZA 2MABA 4M3DA 3OYEA 3JRHA 1R1TA 4QPQA 4W1UA 1W4MA 3V8LA 4XSXF 5KK1A 1TZLA 2X51A 1MBHA 2EFNA 2OV7A 4Q47A 3IV5A 4IJAA 3FHZA 5D4SA 4HLYA 3IWZA 3T8RA 5BPIA 4A3GJ 3HTUA 1WGXA 1XMAA 1Y0NA 1TNSA 1VQ8I 2VKEA 2HQ5A 4M71A 4DYRA 2LKSA 3DP7A 1YW7A 2V4JC 3LMMA 1MIJA 3HG9A 4N4NB 5E1ZB 5FKKA 3DPTA 4MQ9F 2DQRA 3J80K 1LE8B 1P9QC 3SHFA 4ZYAA 1X58A 3JR9A 1I27A 1TWHJ 4NBQA 1JTXA 2FJ1A 4XMYA 1RKTA 3M8FA 4A5NA 4RB1A 1IDYA 2V9KA 2K7LA 4KN4X 4LG0A 2VASA 2DI3A 3PFIA 5B66C 5M5XJ 4A3EJ 4L18B 1HLVA 3E5XA 5HS7A 5LFAA 3LSPA 2ZFUA 1J09A 1QPMA 4GXOA 5J8FA 3BY6A 2DOEA 3CMMA 2XF5A 5HOOA 3OS0A 3FK7A 5IYCJ 3J7YJ 2MA3A 3J81K 1P4WA 3OYJA 4OIRF 4OMZA 2P6SA 4PJMA 4XLFA 2RNGA 4B43A 5DV5A 2GIVA 3F8BA 3CF2A 3L9FA 1FBUA 5ILUA 5F1JA 5IOYA 3PQJA 4YFXF 3ZP5A 3FMRA 4BHPA 1ZREA 2KMUA 2X85A 1FP1D 5EGOB 4HRIA 3LQRA 2IA0A 4UVAA 2DW4A 3I59A 4FE7A 2UXXA 4UUSB 3HOSA 1R7JA 3EUHC 3SXYA 3DV8A 3OYLA 4DYQA 2WWYA 4F55A 2IS1A 3JREA 4CSWA 4P9UA 4KFCA 5ICGA 3ZQLA 3GZ6A 1RUOA 4BL0B 3L2QA 5HLIA 3H9GA 1D8KA 3GW2A 4D9JA 4JK1X 3OSFA 2QSFX 2WY7Q 5J47A 2B0LA 1GT0C 5K5RA 3BJ6A 4KT6A 2HXOA 3FF5A 4PFOA 3L7WA 3AFHA 4M72A 4HNUA 3OYHA 1A36A 2M2EA 1XN7A 2EA4A 2K3PA 4HF0A 2ZNYA 3B6AA 3VYUB 2Q8KA 1T39A 2DA4A 4CYCB 4MIMA 2B63J 2VPLA 5JLXA 2KQRA 5D5VB 2HKXA 4KICA 1J5YA 3CUQB 1R36A 1EF4A 3FISA 4O6JA 4EM1A 3IH2A 3KEQA 2HYJA 2BXZA 1JTYA 4BXFA 2W57A 2XASA 4R1HA 1D3YA 4ENNA 4A3IJ 4C3JJ 5CVJA 1JUSA 1FOXA 2PEXA 1J0RA 3F8NA 3TP0A 3R60A 3MKZA 3GLXA 2D1HA 4G6TB 1NK3P 3E97A 5HVQC 1KONA 1USTA 1YIJI 3DTEA 4N9IA 2KIQA 4PJJA 1X3WB 2LMDA 4M9ZA 2BGCA 2LDUA 3KP4A 1LFPA 5CQEA 2HVRA 3ASNH 4ETSA 1SFEA 2ELJA 1NTCA 4ZZDA 4M6YA 2XPWA 3BTLA 2J5OA 3OL3A 5J8CA 2W7NA 4JQFA 3J7AY 1K78B 4D7MA 2XGDA 1RR7A 2V9PA 3FDYA 1O3QA 5GPAA 2HNHA 4AYBN 4BE1A 4Y15A 3COAC 3ERMA 3ISPA 4II3A 3G4SI 2OTLI 4KT5C 2HU9A 3K2AA 4XRSA 2M8EA 5E3MA 1HW5A 2FEZA 5IT9K 3HOXJ 1WI3A 2L01A 2B7EA 3S16J 2R7VA 1EH6A 2PFBA 4ZTFA 6PAXA 1IF1A 2OU2A 4BY1J 4RS8A 4YELA 1XGMA 3IWFA 4G12A 3G73A 1OR7C 2H8RA 3IRRA 3CCVI 4H0EA 2VBZA 3S3NA 2XAGA 1U8BA 4A6EA 1Y39A 3OIPA 3PNYA 1VFCA 5E8IA 4AYBA 2HKOA 1HBXG 4I99C 3PQKA 4ZYHA 5LBQA 5DM7F 2VN2A 1WH7A 3W2VA 2X6YA 4ITVA 1D5YA 3EDPA 2VUMJ 1L0OC 2V26A 3I53A 4O3MA 2Y48A 2QF7A 1E3OC 1MMDA 1QZEA 3E3VA 5DYMA 1G3YA 3BTCA 2E36A 5DUKA 2ETHA 1JKPC 4UUVA 3AG2H 3D5RC 1DGRM 1DPUA 3PIPF 2NXNB 3ONQA 1WVRA 4ENMA 2VJ4A 3E5UA 3GBGA 4UB6C 3IL2A 1H89C 1NK2P 3JRCA 2MSYA 4B44A 4IL6C 3F0CA 3I55I 2LKPA 3CCRI 3VSKA 3P9IA 2P8TA 4LK0F 5K7FA 4RB3C 2EV0A 4U0YA 1I39A 1O7LA 2A5WA 4CA0A 3RTRA 1ZQ3P 5H2FC 2HS5A 5A2QZ 2HTSA 1R23A 5AIQA 4HX8A 2F5CA 2HGCA 3CC4I 5FGMA 1TW2A 3K4MA 2WC2A 3L09A 1DPRA 1O4XA 3DWLE 3X2QH 3J81Z 1IW7F 1WJDA 3E6MA 3JRFA 3PUFA 1WJEA 4XKWA 2V1UA 4A12A 3GTQJ 4CCOA 4XICA 3GF2A 3CMAI 4BQOA 2DK8A 2GM4A 1FC3A 1MMGA 2IGKA 4P9FA 2L2OA 3PSIA 4KMFA 1XGNA 1ZRFA 2ZKZA 5C3EJ 2XB5A 1F43A 2IT0A 2L9NA 3FBNB 3Q3SA 2KKOA 1BL0A 1BJAA 2DT7B 3C18A 4I7HA 2EZHA 3I4PA 5FD6A 1Z67A 3ML6A 1OR7A 1R5ID 3FXRA 4HSTA 3BR2A 2CMPA 3JRDA 2EQRA 3ZMZA 4LG3A 2CGPA 4WK8F 2R7SA 3CLOA 5M3FJ 1TW3A 1MBKA 1HKQA 2ZBKA 3M8JA 3CMYA 4BE0A 3PM1A 3VFZA 1UFMA 2DODA 4EJTA 1FJLA 3RKWA 5IOZA 2AXTC 2VONA 1MD0A 2L02A 1AKHA 1G6NA 3HIFA 1J59A 1JHHA 3LA3A 2MLKA 1YFHA 3GLLA 3M1CA 3HC7A 2HVQA 2R5YA 2LY9A 3AG1H 1A6IA 2M9HA 2V6CA 3LAJA 5J1UA 3HL2A 4LJZF 4NNJA 3KYDB 5DCFA 2E2IJ 3K4NA 2OZ6A 2ZJQF 2CV1A 1SMYF 3H35A 2LSOA 3DKYA 3EYIA 4AC0A 3JRGA 4N9HA 3FK6A 3LL7A 1T33A 2EJRA 5TISC 1MBJA 4BS9A 2PLYA 3SDBA 4W97A 1Z91A 5DTDA 5BOXA 4IHYA 5EDNA 1JUPA 1R58A 1X3UA 2XGXA 3T0YA 2M0MA 1E3PA 2RQQA 4UVBA 1WJCA 3O3KA 4A2UA 2EFWA 3ERED 1AHDP 1UHSA 2Z2SB 2CQKA 4QWQA 1ODDA 4E7LA 1HSTA 4A3FJ 3VODA 3ASOH 3LQQA 1SFKA 3IHUA 2CV2A 2L7KA 2RN7A 3DEEA 3H0DA 2QBYB 2NVYJ 1MW7A 3LNQA 3KPHA 3W3CA 5D4RA 2PJRB 3HOVJ 1S9HA 1EKEA 3ZMTA 2LG4A 3K69A 4LB6B 4A3BJ 1A04A 3HPGA 2MC3A 2QCOA 3QP6A 3HTSB 1P4AA 3O2PE 2VBWA 4U7BA 4IOAF 2NS0A 3RKYA 2E1OA 1ETQA 1F9NA 4FX0A 3VDXA 3BOQA 2KP6A 2KIUA 1U78A 5IT9Z 2IBDA 2E60A 1ETVA 3WE3A 1CGPA 2ACJA 1X1CA 3C7JA 3ZR8X 1XCVA 3PO2J 3A03A 2IJLA 3F21A 1FOWA 3DPUA 4BYYA 1W0TA 3U2RA 1Z1DA 4XIDA 3FXMA 1V3FA 2DMNA 1ACIA 3WODF 1KU3A 5JLWA 3MVPA 2JPCA 1U2WA 3U9GA 3OYGA 5LEKA 1XTAA 2P7VB 1T6SA 5LRRA 4GDFA 1X4PA 3QODA 4KJZA 4EM0B 1ZR2A 3WGGA 2ZO4A 3I5UA 3ZMSA 3JRIA 3ZOBA 5GAGJ 5BS6A 2RDPA 2Y69H 4A6DA 3ABMH 2XV4S 1K4SA 4HW0A 2DMQA 3DLAA 3A1YA 1BI2A 2Z3YA 3JAMK 2E1NA 3M07A 3MAJA 4Y3OA 4B47A 1STZA 5L3DA 4CXFA 3LAPA 4M9SA 1GVDA 4ZYGA 1R4MB 3GX4X 1WCMJ 3HXLA 2W00A 2QKLB 3U1KA 2TDXA 1FIPA 1QO0D 1NH3A 2XVCA 1XDUA 2VKDA 1BA5A 5JI6A 1ZGAA 4D0PA 1IO2A 3FMQA 3DQVC 5IP7J 1YQAA 4LIVA 2X6WA 3KYLA 2P5KA 3BDDA 3UNGC 4BJTA 3DU5A 5ERIA 5FRMA 3MD2A 3W6VA 2R5ZA 1OMIA 2O6GE 2DA5A 5HS9A 5BPDA 1ON1A 2BW3A 3FKJA 1APLC 2L7ZA 2M7BA 4CZCA 2R93J 2CUJA 4BGDA 2IRFG 5K7ZA 2JRTA 2ELHA 4U0VA 3PSFA 2JA2A 3TL4X 1AKHB 2JSPA 1S29A 2IW5A 3RQIA 3B6CA 2R5YB 1YRNB 4EATA 2XAHA 4FT8A 4WX9A 4L0ZB 2EK5A 3V7RA 4BKXA 1OCRH 4II2A 3CUQC 4FTHA 3C2GA 3B73A 1FBQA 3BCBA 4P1WA 2VQHA 2GWRA 4X0GA 4A0XA 1TWCJ 2ID3A 3DEWA 3TGNA 2TCTA 3G1OA 2X4HA 2Z9OA 1JGGA 2QENA 2HQRA 1KYZA 4C30A 3HOUJ 2P0WA 4HNVA 2NS8A 1LE8A 1A6QA 2M0CA 4Y52J 1T56A 3RQ4A 1MMAA 3GZ5A 1H8AC 3NRVA 2DK5A 4AIJA 2Q2EB 5TJJA 2ZXHA 4C2MJ 3RZDJ 1KU9A 3GTLJ 2ZSIB 4S04A 3MKLA 1R4NB 4B8XA 3HYIA 1S7EA 5M5YJ 1XC5A 4KITB 3SEZA 3R6SA 1TL8A 3HPHA 2FNAA 4EV0A 1MZBA 2K27A 4F92B 1FOYA 2CW0F 2QA4I 3VYRB 2I5UA 2IXSA 1SAUA 1XPXA 3S2DJ 2HDWA 4MNUA 2QUFA 2DFEA 3LSRA 4CDGA 1IAWA 3F22A 2VKHA 5EGOA 5FFXA 1I3AA 4JYKA 2PG4A 1ZAOA 2E35A 3AL0C 2JRMA 4DZJA 1QVUA 1VZ0A 2MC4A 3KP3A 5E3NA 1SEUA 1J7KA 2R7OA 3GFMA 3MKWB 2CW7A 3K1MA 2L4MA 1JGSA 3GFLA 4P55A 4Y13A 3RPUA 1FMVA 4LITA 1K6OA 3CMEI 4B3AA 3S8PA 3GTMJ 2O0YA 2RNJA 1GDTA 2Y31A 3WG9A 2Q0OA 3BROA 4IXAA 2LK2A 3NEUA 4QLCU 1T95A 5GTHC 4L9JA 3E1SA 1Z77A 2COBA 3BG5A 3WTSC 1BI3A 3ECHA 4DBRA 4CYCA 5D8LB 3FXKA 1YJNI 3CDHA 3ABTA 4N4OB 4XN3A 5H6QA 3LFKA 2GOXB 2M34A 2ID6A 4I2OA 3WE2A 4QSHA 2DA1A 1MNMC 2LF8A 4IHTA 3L2WA 3V7CA 3L2UA 1MSEC 1TLHB 4AVPA 4IQ4A 2IPQX 1IUYA 4OIOF 1EA3A 2BEOA 1IDZA 1IUFA 1YX3A 3S1RJ 3DU6A 3CUOA 4HOBA 3TBIA 5K7HA 1VNDA 4JBAA 2OQRA 2UZKA 1ITYA 1LDKB 1ULYA 1X3ZB 3M8EA 2DBBA 1JKQC 3M3YJ 1SD5A 2R5ZB 2PBIA 3WGIA 5D5XB 5EYRA 3JAMZ 2DA7A 2D5VA 4JX4A 1G59A 4E4HA 3TW7A 1XMKA 1MMNA 4RB0A 4IZZA 2VBYA 2V1XA 1X1DA 1IN4A 1P6RA 4JX5A 2AQEA 2L7MP 1GUUA 4G9YA 1K78A 1D0ZA 3KZIC 1VQ5I 4E7HA 3WG7H 3TQNA 5M3MJ 4L5IA 3ZRGA 2CQXA 2CUEA 3BQYA 1F36A 3LFUA 1YJWI 4AM3A 4ASNA 1QVTA 1K4TA 2AHQA 4ZDLA 2WA0A 1TC3C 3GEZA 2Y75A 4DGWB 2XAUA 2CRGA 2HDCA 3W2WA 4C3HJ 4OMYA 4CO8A 3OL4A 2VKVA 3GTKJ 1J2XA 3CCJI 4G8XA 4XSZF 1ZRCA 1Q1HA 1E2XA 1BN5A 4Q4ZF 1SAXA 2KZVA 2O3FA 3CJRB 5KAFC 1HOMA 4O5VA 4BEHB 1NHAA 1MNEA 2P4WA 2VXZA 5LRSA 1SC7A 2F2EA 2VB6A 3BPXA 1S7AA 3I64A 5DDGA 2WV1A 4HPQA 5A2QK 1LVAA 5ED4A 1YHQI 3QPLA 1IXRC 2P6TA 4B4CA 1Y8QB 1GLNA 2L54A 5HODA 1WZ2A 2ICWG 4LOCA 2X1DA 3MFKA 1ORKA 4PGHA 4XLNF 3JRBA 3QRFF 2WB1A 2HZDA 2KDZA 3B02A 2F48A 2NVXJ 2F4IA 3BC8A 1EH8A 3CTAA 1LDDA 1D0YA 2DTRA 2BY2A 1IRFA 1D1AA 3DEUA 2JZYA 5TGTA 1OPCA 2OTJI 3FX3A 2E34A 2FBKA 1Y1WJ 2FE3A 4EJWA 2DOFA 3GXOA 4S0HB 2A5YB 3E6CC 3TEDA 5CPRB 2PQ8A 5L3FA 3L00A 1S8NA 3KE2A 3BR0A 4NB5A 1IXCA 4AIKA 4A3LJ 2W85A 4GYGA 4HV5A 3KZYA 2E1MB 2YX7A 1TBXA 2YS9A 3ZGKA 1SD4A 4LK1F 1Z0XA 3JSOA 4CCJA 5EF6A 2M87A 2ESHA 3S1NJ 3R4KA 1T98A 3FWEA 1IC8A 3K7AJ 1GVJA 4M6VA 1Z9CA 4C9YA 3FMSA 3A01B 2MW8A 4GRIA 4C3IJ 3OS2A 2BY1A 3KYCB 4GYIA 1UAAA 5DD4A 2K9MA 4WF2A 1W5TA 1MMSA 5LGNA 1V5GA 3FM5A 2X6XA 2BZTA 3PL8A 1W7PA 4PSXA 3OYNA 3GTOJ 3SEQA 5DS9A 1BIBA 2XRLA 4J00A 3SQNA 1G3SA 1MKMA 4A0ZA 4M3FA 1POGA 1GHCA 5HLHA 2O8KA 3OSGA 1CF7A 1T38A 4EJVA 3SZPA 4A5MA 5EJCA 1U5TB 4KYWA 2CS3A 1RESA 4HDVA 4OIPF 4LIUA 3M1EA 4CICA 5IP9J 2LOOA 2PX9A 4F7ZA 2EH3A 1IRZA 3FZVA 3L2RA 3CQZJ 3K4KA 3M9AA 3TMOA 4UY8I 3TOAA 2LR8A 3HB9A 2FA5A 2MH2A 3K4JA 2DO7A 1C0WA 3M7GA 3QYBA 3OYMA 2JJ7A 1QHHD 2R7XA 4CUGA 1OCZH 4D1QA 2AS5F 2PN6A 1NG7A 2RAEA 1D1CA 1JE8A 1HF0A 3LSJA 4MFDA 3DBRB 1SVMA 2EZLA 2HXIA 2Z16A 3EETA 3F8FA 1QU3A 5HDGA 5AONA 1UG0A 5H6RA 2WADA 2X1EA 4L5EA 4BDYA 3BZKA 3K70D 4F3QA 5EEHA 3PO3J 3MCZA 1UZCA 4MLOA 1QQIA 4RDUA 1XCBA 1AA7A 5FO5A 4AIDA 3RZOJ 1P7IA 3G1MA 3VYTB 5GAHJ 2ECBA 3K4BA 3R0AA 2JA8J 2P5LC 2LY2A 1ON2A 4RAFA 2XROA 4HDUA 2WV0A 5B3SH 1FIAA 2CJJA 1RIOH 1ETOA 2ME6A 4A3MJ 1IG7A 5F64A 5IPAA 2NRAC 2QBYA 4MEXF 4M3BA 2LP0A 2V9VA 1S72I 1V55H 2PJRA 2J5PA 1SFOJ 2JA7J 4MQVA 1IZ1A 1V4RA 2FQ3A 3I9V2 2UV1A 1TWFJ 2AXLA 1FMWA 1NG6A 5F04A 1GXPA 3K4LA 3G71I 4CGZA 2OAZA 4QIWN 3I4NJ 2LC2A 4XKVA 2ZC2A 1MBFA 1TQMA 3CP2A 2HYGD 3S15J 4A93J 1IXSB 3MQ0A 5F27A 2LVSA 3MWMA 3H92A 4DQ2A 1J9IA 1JT6A 1BBYA 3Q0WA 2XAFA 1VTNC 1X2MA 3WTXC 1XG1A 2EIMH 2K40A 5JHFA 3SYTA 1H88C 3BCAA 3GO5A 3H3ZA 1BJZA 3CCEI 3MKYB 2CV0A 1HDPA 3ABUA 1QPIA 5C4XJ 2N8GA 3QPTA 2HEOA 2O5RA 4OINF 3H9JA 3P7NA 4A0YA 4LB5A 3BTJA 3AKZA 2K85A 1Z3XA 4A3KJ 3N05A 2KLOA 3BZ6A 4DNCA 2OD5A 2GAUA 1ZGJA 4M73A 4LLNA 1Z3YA 4HAMA 3ZN1A 5ILVA 2ISYA 2RVCA 3GZNB 2NVUB 1WJBA 1X4OA 4CCLA 4PDKA 1WPKA 4WWCA 4ANJA 2IAIA 2G7UA 4BY7J 1W7PB 2V1DA 3BT9A 4BXUA 2ZMEB 4KNYA 4N0BA 1JT0A 2PJPA 4HX4A 3Q0UA 2L3DA 1WQ2A 5HNFA 1A35A 3MN2A 3OYCA 1ZK8A 3JTGA 1CF7B 3HBLA 1RUNA 2QVOA 2GXBA 2MH9A 5D6FA 2A3SA 2DMTA 3JTHA 1YYVA 2OUMA 3O6BB 3L2VA 1W5CC 1Z7UA 2AO9A 2IGNA 2XUBA 3QYFA 5F0CA 2EFOA 4G6DA 5EEGA 4Z6YA 2HPIA 3UKGA 1WJFA 5JVGF 3VEPA 3FXOA 4MGRA 1ZN2A 2X6OA 4L9VA 3TDZC 1WKMA 5L3GA 2DPDA 1FWZA 1R5HA 1XB4A 2HQAA 3LOCA 4RAYA 3P5JA 2DMUA 1Q1VA 2VQGA 4LD5A 4XNFA 1H9TA 3KLOA 3S3OA 2QQ9A 4IHWA 3CJQB 4I76A 4KUMA 2W82A 3DTKA 3OYFA 2XC7A 3MZHA 2M1BA 1OKRA 1YE9A 5FKMA 3I54A 5HNHA 1J75A 2DTZA 1PP7U 3V8JA 1BR4A 1SFXA 2DA3A 4QPOA 4HX7A 4AIHA 2NAZA 4DW6A 4RGXA 2DLLA 4J01A 2VJJA 2BVMA 1I6HJ 5LGTA 1QZYA 2O03A 2M4GA 4EEFG 3RKXA 2WTEA 4CH7A 2DT5A 2G7HA 4YRVA 2ZJPF 1XX5A 1UHWA 4J19A 5CVUA 1UCRA 2GQQA 2P81A 3FBIB 3RYRA 4IRIA 3OWTA 2Q2EA 4D7NA 2ZXWH 4ZJZA 3WTWC 1FYLA 4GCVA 4HF2A 4G7ZF 3GCMA 1N75A 2QSHX 3KIOA 3OY9A 4BBRJ 4FASD 2DN0A 3PFYA 4PK4A 1U6GA 3GFJA 3RPQA 3DBHB 1I50J 3SZTA 3CO6C 3DLLF 2QQ8A 4AWXB 4UV8A 5B5EC 1MDMB 4E7IA 3BQZA 4BACA 1BIAA 3K1PA 3JW4A 4XOPA 5GAEJ 5ICCA 3H3VK 3JRAA 2QSGX 3SDGA 4E7ZA 5L3EA 3HRSA 4RM2A 2K3FA 3BZCA 1PUEE 1IN8A 2A6TA 1QA6A 4HV6A 4RM3A 1G3WA 1FZPB 2OA4A 1DU0A 2L5QA 2ADUA 2CG4A 3GTJJ 4XQFA 1TQIA 2Y9YA 2GOMA 4DBQA 2JVGA 3C1DA 2GBYA 2KJCA 2O9LA 2QWWA 5K5OA 4DIQA 3E5QA 3IH3A 4IEJA 2EWNA 4RBOA 3QAHA 3JCUC 1MSFC 1Z6RA 5ICFA 3D1NI 4OOIA 4XL9A 5GPCA 3BWGA 1IN7A 2KISA 3AG4H 5CVVA 2E71A 2EPFA 3IH4A 2BOLA 2X9DA 4G6QA 2LY1A 3CCMI 1XS9A 1XMXA 2V7FA 1D0XA 2RV8A 1IN6A 3OOUA 1DDNA 3QYEA 1WRJA 3F6VA 3MZ8A 1QNTA 5C44J 1VQ7I 2VBXA 5CVRA 3V8KA 3A4CA 5E18F 2H27A 3HOTA 3BG9A 2A61A 3E7LA 4UUTA 2MYSA 3GUDA 2X1CA 3BG6A 5DM6F 5BNGA 3DXJF 4I09A 5CQGA 4KISA 2E1MC 1HCRA 4V2FA 4E70A 2GA2A 2DU9A 1XDSA 2NOJB 3K10A 4R79A 1AOYA 4DOZA 3V4GA 5FFZA 2GLOA 3ZQHA 5HS8A 2EBIA 3D5LA 1R1VA 5F6FA 1KQ0A 1VQ9I 2HOEA 1BC7C 4FQGA 4H4KC 4YIFA 2CQ7A 4RLQA 1SD6A 1M1EB 2W84A 3HHGA 2LYCA 2H09A 1IV8A 2RREA 1BM9A 2BHZA 4NC6A 1WFXA 4E7SA 4AUXA 1U3EM 1BOAA 2FBIA 4X1EA 4I0BA 5GTIC 4Y7NJ 2H8WA 2GA1A 3KLNA 2W1OA 3A0HC 3HZJA 4EVIA 2CUFA 1TTYA 2M7AA 2Y9ZA 1WJ5A 2W24A 4AVZA 5ICEA 2K5CA 1W0UA 2L0KA 5EG0B 2VLAA 1VQLI 4V19K 2Z99A 1UB9A 3VOEA 1R71A 3HGYA 4G7HF 2XRNA 4OU0A 4A3JJ 3GWZA 1U5TC 3ABKH 3HRMA 5FB2A 4WCGA 4B1RA 4E7KA 1FEXA 4BEHA 5J1RA 2A6HF 2FNPA 3BG3A 2BXYA 5F0HA 4KIFA 2K4BA 3CJNA 1YW8A 4LLGF 3CDIA 4XLHA 1YO5C 4WXDA 3IAS2 3QPHA 4DYCA 5AIPA 4BJ5C 1D1BA 3SFZA 2YR2A 1ZHFA 1YRNA 4ON0A 2E2HJ 4PJLA 1YS7A 2ZSHB 4NUBA 2GZWA 2MD5A 5GADJ 5LHIA 1LNWA 3WTVC 3KX2A 2OC6A 4HYEA 2KRFA 5DD8A 1S7OA 5J40A 2FSWA 1RKWA 5LD2C 4ZYDA 1FY7A 2EIJH 1KQ8A 3TO9A 1T8IA 2BHYA 3H36A 1VI0A 3RSNA 1U9NA 2QKMB 1X1AA 4MHGA 5KHDA 1LVKA 4YIRX 2DJNA 1LB2A 1IN5A 1Y0UA 4XR6A 2DA6A 3G3ZA 3RJPA 3HRTA 2DQLA 1MBGA 1BW6A 2M30A 1K61A 1RZ4A 4KN7X 3CZ6A 3QU6A 1X2NA 2F5FA 2LFBA 2F5DA 5FLMJ 2QGUA 1B72B 4I01A 3S2WA 3I56I 1BR2A 2VC1A 4RMNA 4XLCA 3OIOA 4QTRA 4PJ0C 2HVSA 2MLGA 2YU3A 1ETYA 2I8DA 1WWXA 2VJ5A 3MEXA 3R61A 4MFEA 3ZN0A 2G0EA 3CF5F 1JJ6C 4IO9F 3Q5FA 3A01A 2LBFB 3ZXSA 1KA8A 1XSVA 2HPMA 3LA7A 1FLIA 2CQQA 3I3LA 3ZMUA 3LWFA 4KIGA 3RI4A 2NS7A 2NOGA 3OYBA 4D5FA 1OYYA 4XKCA 2R7DA 2VQLA 5K1YA 1BR1A 5LHHA 4XRSG 1X1PA 3CJTB 4IKFA 3FXQA 4CHUA 2KIMA 4GGGA 4JX6A 2R7ZJ 3LSGA 4XBFA 4M74A 1P7JA 4BBSJ 5FD5A 3NARA 1ZKGA 3TO7A 4EM2A 4HNTA 1U5TA 4RGRA 3HUGB 5LLQA 3OYIA 1MJBA 4ZH4F 1OYIA 1T08B 2XAJA 1LPQA 1REPC 3WTYC 4E7JA 3IUOA 2FMYA 3C2BA 2CUZA 2RKHA 4LMYA 2JA5J 2Q1ZB 1FTTA 1Y1VJ 3H5AA 1KZHA 2LF7A 1I5ZA 2K9LA 4U88A 2L7FP 4PJNA 4F91B 4IQJA 2STWA 5EEAA 2EZIA 3HGGA 4HSRA 2FBHA 1D5VA 2FD5A 3FXJA 2XGCA 5F08A 1I1SA 5J6XA 2FUG2 3HKZN 2BBYA 3ZQ7A 2ZFWA 5KNLA 3BJOA 1LFBA 2JPBA 2M45A 4MO7A 2R92J 1Z6TA 2OZUA 3J7AO 3ROUA 2KPMA 3IC7A 4AU7A 1UHMA 5KAIC 4I98B 3OOPA 1YITI 3HHHA 3K9TA 5L3CA 4YG2F 4KA4A 1HKSA 4BQNA 3CP8A 4L9NA 2PI0A 2KT0A 2UWMA 2HOAA 3KP5A 1D8JA 2DAOA 2KDOA 2LRDA 4RGSA 1K79A 2HOTA 1S5LC 2MG4A 2WB1N 2JQ7A 1TWGJ 4XLPF 3OYDA 1FP2A 5H20A 4I02A 3HKZA 3CCUI 3WHCA 2IP2A 3IAM2 4Y4RA 1FX7A 1O57A 3C2HA 4E6KG 3DTIA 2PMUA 3IKVA 4TV7A 3ESWB 5HLGA 2JUCA 3WHBA 4IHVA 2A69F 2NVQJ 2M3AA 3U1DA 4C2TA 4XRFA 1R9TJ 2FX0A 1DP7P 2O8XA 3QU3A 4CCKA 1ZR4A 4K2EA 1UELB 4V2GA 5DCMB 1QGPA 4NHJA 1UJ8A 2DFIA 3NQOA 3SFIA 2MBFA 9ANTA 3ZMDA 4UNOA 1AU7A 3GTPJ 4NDLA 4ZYEA 3LSMA 4I6ZA 1W36C 4RAGA 1BC8C 1I1GA 1ZH5A 1R49A 2NVTJ 1OCCH 2D45A 1G2HA 1ZG3A 2JT1A 3MZYA 3SJMA 3ZQQA 1KU7A 2UUZA 3DCFA 1VF9A 2E7WA 2DFHA 3C3WA 1Z7LA 1KYWA 2XPUA 2VT2A 1B8IB 3UR3C 4M3EA 2FOKA 2PMZN 3H3UA 4Q5SF 1O7FA 2ZXIA 3H1CA 1YX5A 4ENJA 3HSFA 2RC4A 1RR8C 3ELKA 4R8HA 3N4MA 2VE8A 3OYKA 2XB0X 5J4YA 3S14J 2BVLA 1OQYA 2M8GX 2W4SA 2ZMEA 4EMSA 1RNLA 2H6BA 1FOKA 2QQBA 5FLXK 2VI6A 1FTZA 2DT6A 4HLXA 2LREA 4EQQA 2VL8A 2L9RA 2PMZA 3BTIA 3PNVA 3S3MA 4BQQA 4UB8C 2HQNA 4D5CA 1Z05A 2EV5A 2ZXJA 2QEXI 1U8RA 1UMQA 1DUXC 2FMLA 2IVMA 2DMPA 3TKYA 3S1MJ 3VYSB 1TQPA 4BJ6C 2R7WA 2KRCA 3M4OJ 4L5JA 1H0MA 3BG7A 4EGYA 2K86A 1JHFA 4PCQA 2D2WA 2WAQN 3GVAA 1RPWA 2V79A 2FOWA 5IT3A 4Y17A 1B6AA 5BQTA 1OJLA 3KETA 2R7UA 1RRJA 5E3LA 2BY3A 4GO1A 2VQCA 3BR6A 4M9XA 1ZYRF 3EYYA 1S6LA 1ONVA 2E5ZA 4LFUA 1SMTA 1VQ4I 4BXXJ 1DU6A 2DDAA 3HOYJ 4CYDA 2LD5A 1RETA 1PDNC 3DPLC 1HW1A 2GXAA 2P5VA 1YJ9I 2IEKA 1TT5B 1MJAA 2YUSA 1ZLKA 5FKOA 4YFKF 1Z21A 2CO5A 5J3LA 1SFUA 5D5UB 2KJBA 3VPRA 4B48A 2WAQA 4BHCA 2OQGA 3KP6A 3RYPA 3VB2A 1P92A 2MGQA 2E2JJ 3EUKL 5CYVA 1ZLJA 4HF1A 3CCSI 1Y56A 2KRHA 2VT3A 3FXLA 4IOCF 3HDDA 1HC8A 3V7SA 1PJRA 1ZELA 4KMUX 4IHXA 1B59A 2CSOA 4DZPA 2LH9A 5B1AH 3H5RA 2YX4A 1T0FC 1VQPI 4PZJA 5LHGA 5CJ9A 2XPVA 1SVLA 1YLFA 2DXIA 1WI9A 5K5QA 4LLLA 2QQAA 1ZARA 2JUGA 2YU9J 4ENKA 1Y6IA 4MTDA 3AL0B 4RAZA 2CFXA 4CZZA 3EUHA 1MDMA 2A68F 3CC2I 3CDLA 3CC7I 3ZQGA 2VOOA 1RI7A 4ESJA 1BI1A 4UVCA 1WSUA 2WBMA 3G2BA 2XKPA 2R0QC 3RPUD 1IRXA 2LNBA 2XKOA 1ZRDA 3OV8A 3BLYA 3DF8A 1E3HA 1BI0A 1X1BA 3K2ZA 4HZFA 1JUMA 1MGTA 3HSEA 1LFUP 4A3CJ 4ZDPA 1OYWA 2DYSH 2H94A 4NC7A 4LG0B 1ETKA 2OPTA 1YTYA 1G3TA 2K4JA 5CLSA 4Q48A 2RGVA 1TT0A 4EJUA 1H9GA 3QWLA 2B9SA 2STTA 3S93A 1FPQA 1W5SA 2K9QA 1HW2A 2H6CA 1HSJA 3QOPA 1QRYA 1FBSA 2UXNA 5F0FA 2KFDA 2HI3A 1YS6A 2XHKA 1V54H 3KEYA 3KZZA 1O3TA 2DDBA 4X6AJ 2EILH 3WU1B 4L0YB 2VIXA 2EINH 3PJRA 3I4MJ 3NWTA 1R00A 2ZCWA 1JJ8C 2QM3A 2KZGA 4XORA 4BUPA 3J80Z 3D5SC 2WAEA 1LEAA 5FKLA 1WH5A 3I59B 2K9NA 2V6EA 2QYOA 3E6BA 2XAQA 5FKNA 2Y30A 2TRTA 3ZPLA 3HOWJ 1V5EA 3OMYA 2F4MB 4ESBA 1VQOI 3A0BC 2HFHA 4PGGA 3IKTA 3LSIA 3FHNA 3MMYB 5FJ8J 2HWVA 1TNTA 1ENHA 2R7FA 2F5EA 3BR1A 2VXDA 2KIFA 2XF6A 2A07F 5FRNA 2IS2A 4UV9A 4RA2A 4DJAA
chains in the Genus database with same CATH topology
2E7XA 3Q9VA 3P9KA 3GYHX 3W6KB 1JXSA 2DPUA 1I6XA 1T0FA 3KCCA 1FYMA 4L9TA 5F1RA 5JFRA 3KP7A 4ESFA 1FT9A 4BAYA 2Y0MA 2NYXA 4OIQF 3D0SA 3DFGA 2M5WA 1R5GA 3F6OA 1F4KA 1USSA 4AD9A 5FLXZ 1IRGA 5E1WA 4EGZA 1B9NA 1XGSA 4IF4A 3T5XA 3RIRA 2X0LA 4BQAA 2FF4A 4MEYF 5E1XA 2EFPA 4KIBA 5CVIA 1EV7A 5D6EA 3WU0A 2BE5F 3N97A 3F8MA 1FSHA 2JSCA 4WXCA 5DEQA 2ZNZA 3W6JB 4BHBA 3KEOA 2CYYA 1LQ1A 4M6XA 3LA2A 3K1NA 1MJ9A 1YG2A 3ULQB 2FRHA 5E20A 1LJ9A 2IA2A 4RGUA 2QLZA 3AAFA 4EJOA 4HQMA 3JSPA 4IRGA 1K7AA 4BNCA 1KGSA 4BH9A 4U0WA 1AWCA 1W7PD 3EQLF 4B09A 5BMZA 2Z5UA 4HA8A 2EB7A 4WXHA 2XIGA 3BJAA 4I0AA 4YIIA 1EH7A 1ZG1A 3DKWA 4P96A 1R22A 2VOPA 2VE9A 2YPRA 2Z33A 3ECOA 2G9WA 4RB2C 4G7OF 4FHTA 1T2KA 1G4DA 3TOBA 5LGUA 1YIOA 2R3SA 3HUGA 4G94A 2COMA 4HQEA 3TO6A 3T8TA 2EA2A 1XD7A 1P2FA 3F72A 4IPAA 5ILSA 2ZJ2A 2PMHA 1XSXA 1L3LA 3IRQA 3I0TA 2BV6A 4NQWA 1FSEA 5D5WB 1ZG5A 1B9MA 2HTJA 3Q9SA 1SD7A 5HDNA 2RQPA 2EFQA 2HYFA 3I71A 1HKTA 2A6EF 3E6DA 1LDJA 1HXDA 2EV6A 2YSRA 1XGOA 4UXNA 1QBJA 5KVRA 3HSRA 1FNNA 3R0JA 3K0LA 2K02A 2QZ8A 4IRHA 3QP5A 1B1BA 3BP8A 1KQ9A 3WTUC 4U7DA 2ESNA 2HR3A 2VC0A 3WTTC 1B4AA 4MTEA 3CO7C 1YW9A 2OBPA 2VODA 1QZZA 4P5OA 3WTZA 1O3RA 5DCMA 3P9CA 2GXGA 3FXUA 2CWEA 3F23A 2C6YA 2FXAA 3F8CA 1O3SA 4KDPA 5HDKA 4YFNF 2E1CA 1PP8F 3BPVA 3GFIA 4FX4A 1S3JA 2HZTA 4ZZLA 1FYKA 2W25A 2IA1A 5LEJA 5DUIA 2NNYA 5TRDA 2L4AA 4Z2YA 1GXQA 4IHSA 5JHUA 3T1BA 3I58A 3FM3A 5L3BA 4LGWA 2JTVA 2FU4A 4HBLA 4S05A 1XSDA 2ISZA 1LEBA 1F1ZA 3REOA 4IVNA 3TDUC 4UHTA 2D1VA 3F3XA 1R1UA 3CUQA 5JVTA 3KP2A 3L2CA 1HQCA 1F5TA 3ZMVA 3HRUA 1KU2A 5E8GA 2P7CB 1E17A 1P4XA 3WGHA 3KFWX 2BYVE 5E17F 2O61A 3RDIA 3LSTA 5JR3A 2NNNA 5D8KB 1R1TA 1W4MA 3V8LA 4XSXF 5KK1A 2EFNA 4Q47A 4HLYA 3FHZA 4IJAA 5D4SA 5BPIA 3IWZA 3T8RA 3HTUA 1XMAA 1TNSA 4M71A 3DP7A 1YW7A 5E1ZB 3DPTA 4MQ9F 2DQRA 3J80K 3SHFA 1I27A 3M8FA 4A5NA 4RB1A 2K7LA 4KN4X 4LG0A 3PFIA 2DI3A 4L18B 3E5XA 5HS7A 4GXOA 1QPMA 5J8FA 5HOOA 3BY6A 2MA3A 3J81K 1P4WA 4OIRF 4OMZA 2P6SA 5DV5A 2GIVA 3F8BA 3L9FA 1FBUA 5ILUA 3PQJA 4YFXF 3ZP5A 3FMRA 4BHPA 1ZREA 1FP1D 3LQRA 2IA0A 4UVAA 2DW4A 3I59A 3HOSA 2UXXA 1R7JA 2WWYA 3SXYA 3DV8A 4KFCA 4P9UA 5ICGA 3GZ6A 1RUOA 5HLIA 1D8KA 3GW2A 4JK1X 2B0LA 5K5RA 3BJ6A 3FF5A 3L7WA 4M72A 1XN7A 2EA4A 4HF0A 2ZNYA 2Q8KA 1T39A 5D5VB 2HKXA 4KICA 1J5YA 3CUQB 1R36A 4O6JA 4EM1A 3KEQA 2W57A 2XASA 4R1HA 1D3YA 4ENNA 5CVJA 2PEXA 1J0RA 3F8NA 3R60A 3GLXA 2D1HA 3E97A 5HVQC 1USTA 4N9IA 4M9ZA 2BGCA 2LDUA 3KP4A 4ETSA 1SFEA 4ZZDA 4M6YA 2J5OA 5J8CA 4JQFA 1K78B 1O3QA 4Y15A 3COAC 3ISPA 4KT5C 2M8EA 1HW5A 2FEZA 5IT9K 2L01A 1EH6A 2PFBA 6PAXA 1IF1A 2OU2A 4RS8A 1XGMA 3IWFA 3G73A 3IRRA 4H0EA 2VBZA 2XAGA 4A6EA 5E8IA 2HKOA 1HBXG 3PQKA 4ZYHA 5LBQA 2VN2A 3EDPA 1L0OC 3I53A 4O3MA 2Y48A 3E3VA 5DYMA 1G3YA 5DUKA 2ETHA 4UUVA 1DPUA 4ENMA 3E5UA 3IL2A 2LKPA 3P9IA 2P8TA 4LK0F 4RB3C 2EV0A 4U0YA 1O7LA 3RTRA 2HS5A 5A2QZ 2HTSA 1R23A 5AIQA 4HX8A 2F5CA 2HGCA 5FGMA 1TW2A 2WC2A 3L09A 1DPRA 3J81Z 1IW7F 3E6MA 2V1UA 4A12A 3GF2A 2DK8A 1FC3A 4P9FA 4KMFA 1XGNA 1ZRFA 2ZKZA 2IT0A 2KKOA 1BJAA 3C18A 4I7HA 3I4PA 5FD6A 3ML6A 1OR7A 3FXRA 3ZMZA 2CGPA 4WK8F 3CLOA 1TW3A 1HKQA 2ZBKA 3VFZA 4EJTA 1UFMA 3RKWA 2VONA 1MD0A 2L02A 1G6NA 3HIFA 1J59A 1JHHA 3LA3A 2MLKA 1YFHA 2V6CA 3LAJA 4LJZF 5DCFA 2OZ6A 1SMYF 2LSOA 3EYIA 4N9HA 2EJRA 2PLYA 1Z91A 5BOXA 1R58A 1X3UA 2XGXA 3T0YA 4UVBA 3O3KA 4A2UA 2EFWA 3ERED 2CQKA 4QWQA 1ODDA 1HSTA 3VODA 3LQQA 3IHUA 2RN7A 2QBYB 5D4RA 3ZMTA 3K69A 4LB6B 1A04A 2MC3A 3QP6A 3HTSB 1P4AA 3O2PE 2VBWA 4U7BA 2NS0A 3RKYA 1F9NA 4FX0A 3BOQA 1U78A 2KIUA 5IT9Z 1CGPA 3WE3A 2ACJA 3C7JA 1XCVA 2IJLA 3F21A 4BYYA 3U2RA 1Z1DA 1V3FA 3WODF 1KU3A 2JPCA 1U2WA 3U9GA 5LEKA 2P7VB 1T6SA 5LRRA 4EM0B 3WGGA 2ZO4A 3I5UA 3ZMSA 5BS6A 2RDPA 4A6DA 2XV4S 4HW0A 1BI2A 2Z3YA 3JAMK 2E1NA 3MAJA 1STZA 5L3DA 4CXFA 3LAPA 4M9SA 4ZYGA 3GX4X 2TDXA 1QO0D 2XVCA 1XDUA 5JI6A 1ZGAA 4D0PA 3FMQA 3DQVC 1YQAA 2P5KA 3BDDA 5ERIA 1OMIA 2O6GE 5HS9A 5BPDA 1ON1A 2IRFG 2JRTA 2ELHA 4U0VA 1S29A 2IW5A 2XAHA 4FT8A 4WX9A 4L0ZB 2EK5A 3V7RA 3CUQC 3B73A 1FBQA 2GWRA 4A0XA 3TGNA 2X4HA 2Z9OA 2QENA 2HQRA 1KYZA 3GZ5A 3NRVA 2DK5A 4AIJA 5TJJA 1KU9A 4S04A 4B8XA 3HYIA 3R6SA 2FNAA 4EV0A 1MZBA 2K27A 2CW0F 4MNUA 2QUFA 4CDGA 1IAWA 3F22A 5FFXA 2PG4A 1ZAOA 3KP3A 1J7KA 3GFMA 3K1MA 2L4MA 1JGSA 3GFLA 4Y13A 4P55A 3RPUA 1K6OA 2O0YA 2RNJA 3WG9A 2Q0OA 3BROA 4IXAA 3NEUA 4QLCU 4L9JA 3WTSC 1BI3A 3ECHA 5D8LB 3CDHA 3ABTA 5H6QA 3LFKA 4I2OA 3WE2A 2LF8A 4IHTA 3V7CA 1TLHB 4AVPA 2IPQX 1IUYA 4OIOF 2BEOA 3CUOA 4HOBA 4JBAA 2OQRA 2UZKA 1LDKB 1ULYA 3M8EA 2DBBA 1SD5A 2PBIA 3WGIA 5D5XB 3JAMZ 1XMKA 4RB0A 2VBYA 2V1XA 1IN4A 1P6RA 4G9YA 1K78A 3TQNA 4L5IA 4ASNA 3GEZA 2Y75A 2HDCA 4OMYA 4CO8A 1J2XA 4G8XA 4XSZF 1ZRCA 1Q1HA 1E2XA 1BN5A 4Q4ZF 1SAXA 2O3FA 4O5VA 1NHAA 2P4WA 2VXZA 5LRSA 2F2EA 3BPXA 1S7AA 3I64A 5DDGA 5A2QK 1LVAA 5ED4A 1IXRC 2P6TA 2L54A 3MFKA 4PGHA 4XLNF 3QRFF 3B02A 1EH8A 3CTAA 1LDDA 2DTRA 3DEUA 1IRFA 2JZYA 1OPCA 3FX3A 2FBKA 2FE3A 4EJWA 3GXOA 2A5YB 3E6CC 2PQ8A 5L3FA 3L00A 1S8NA 3KE2A 4NB5A 1IXCA 4AIKA 2W85A 4GYGA 4HV5A 3KZYA 2YX7A 1TBXA 1SD4A 4LK1F 3JSOA 2M87A 2ESHA 3R4KA 1T98A 3FWEA 1GVJA 1Z9CA 3FMSA 4GYIA 5DD4A 4WF2A 1W5TA 5LGNA 3FM5A 1W7PA 1BIBA 3SQNA 1G3SA 1MKMA 4A0ZA 1GHCA 5HLHA 1CF7A 1T38A 4EJVA 3SZPA 4A5MA 1U5TB 4KYWA 4HDVA 4OIPF 3M1EA 4CICA 4F7ZA 3FZVA 3M9AA 3TOAA 2FA5A 2MH2A 2DO7A 1C0WA 3M7GA 2AS5F 2PN6A 1JE8A 3EETA 3F8FA 5HDGA 5AONA 5H6RA 5EEHA 3MCZA 1QQIA 1XCBA 5FO5A 3R0AA 2P5LC 1ON2A 2XROA 4HDUA 2WV0A 1RIOH 5F64A 2NRAC 2QBYA 4MEXF 2V9VA 2J5PA 4MQVA 1IZ1A 1V4RA 2FQ3A 2AXLA 1GXPA 4CGZA 2OAZA 1TQMA 2HYGD 1IXSB 3MQ0A 3MWMA 3H92A 4DQ2A 1J9IA 1BBYA 2XAFA 1VTNC 3WTXC 3GO5A 3H3ZA 3ABUA 3QPTA 2HEOA 4OINF 3P7NA 4A0YA 4LB5A 3BZ6A 4DNCA 2OD5A 2GAUA 1ZGJA 4M73A 4LLNA 4HAMA 3ZN1A 5ILVA 2ISYA 2RVCA 4PDKA 4WWCA 2G7UA 1W7PB 2V1DA 4BXUA 2ZMEB 4KNYA 4N0BA 2PJPA 4HX4A 2L3DA 1WQ2A 3JTGA 1CF7B 1RUNA 2QVOA 2GXBA 2MH9A 5D6FA 2A3SA 3JTHA 1YYVA 3O6BB 1Z7UA 2XUBA 2EFOA 4G6DA 5EEGA 3VEPA 4MGRA 1ZN2A 4L9VA 3TDZC 1WKMA 5L3GA 2DPDA 1FWZA 1R5HA 1XB4A 4RAYA 4LD5A 1H9TA 3KLOA 2QQ9A 4KUMA 3MZHA 2M1BA 1OKRA 3I54A 1J75A 1PP7U 3V8JA 1SFXA 4HX7A 4AIHA 2NAZA 4RGXA 2DLLA 5LGTA 1QZYA 2O03A 3RKXA 2WTEA 2DT5A 2G7HA 1UHWA 5CVUA 1UCRA 2GQQA 3RYRA 4IRIA 2Q2EA 3WTWC 1FYLA 4GCVA 4HF2A 4G7ZF 1U6GA 3GFJA 3RPQA 3SZTA 3CO6C 4AWXB 4UV8A 1MDMB 1BIAA 3K1PA 3JW4A 5ICCA 5L3EA 3HRSA 1PUEE 1IN8A 4HV6A 1G3WA 1FZPB 2OA4A 2ADUA 2CG4A 1TQIA 3C1DA 2KJCA 2QWWA 5K5OA 3E5QA 2EWNA 3QAHA 1Z6RA 5ICFA 4OOIA 3BWGA 1IN7A 5CVVA 4G6QA 2RV8A 1IN6A 1DDNA 1WRJA 3F6VA 1QNTA 2VBXA 5CVRA 3V8KA 5E18F 2H27A 3HOTA 2A61A 3GUDA 3DXJF 4I09A 4E70A 2GA2A 2DU9A 1XDSA 4R79A 1AOYA 3V4GA 5FFZA 5HS8A 3D5LA 1R1VA 5F6FA 1KQ0A 2HOEA 1BC7C 4YIFA 1SD6A 2W84A 3HHGA 2H09A 1BM9A 1U3EM 1BOAA 2FBIA 4I0BA 2GA1A 3KLNA 4EVIA 1TTYA 2W24A 5ICEA 2Z99A 1UB9A 3VOEA 4G7HF 2XRNA 4OU0A 3GWZA 1U5TC 5FB2A 3HRMA 4WCGA 2A6HF 2FNPA 4KIFA 2K4BA 3CJNA 1YW8A 4LLGF 1YO5C 4WXDA 3QPHA 5AIPA 3SFZA 2YR2A 1ZHFA 4ON0A 1YS7A 2GZWA 2MD5A 5LHIA 1LNWA 3WTVC 4HYEA 2KRFA 5DD8A 1S7OA 2FSWA 4ZYDA 1FY7A 1KQ8A 3TO9A 4MHGA 1LB2A 1IN5A 1Y0UA 3G3ZA 3RJPA 3HRTA 2DQLA 2M30A 1RZ4A 4KN7X 3QU6A 2F5FA 2F5DA 4I01A 3S2WA 2VC1A 2MLGA 2YU3A 3MEXA 1WWXA 3R61A 3ZN0A 3Q5FA 1KA8A 1XSVA 3LA7A 1FLIA 3ZMUA 3LWFA 4KIGA 3RI4A 1OYYA 2R7DA 5K1YA 5LHHA 3FXQA 4CHUA 2KIMA 4GGGA 4XBFA 4M74A 5FD5A 3TO7A 4EM2A 1U5TA 4RGRA 5LLQA 1MJBA 4ZH4F 1OYIA 2XAJA 1REPC 3WTYC 2FMYA 2RKHA 4LMYA 2LF7A 1I5ZA 4U88A 2STWA 2FBHA 1D5VA 1I1SA 5J6XA 2BBYA 3ZQ7A 2ZFWA 3BJOA 2JPBA 2M45A 1Z6TA 2OZUA 3J7AO 3ROUA 3IC7A 1UHMA 4I98B 3OOPA 3HHHA 3K9TA 5L3CA 4YG2F 4KA4A 1HKSA 4L9NA 2PI0A 2UWMA 3KP5A 1D8JA 2DAOA 4RGSA 1K79A 4XLPF 1FP2A 5H20A 4I02A 2IP2A 1FX7A 1O57A 2PMUA 3IKVA 4TV7A 5HLGA 2A69F 3U1DA 4XRFA 1DP7P 2O8XA 3QU3A 4K2EA 5DCMB 1QGPA 4NHJA 2DFIA 3NQOA 2MBFA 3ZMDA 4UNOA 4ZYEA 1BC8C 1I1GA 1ZH5A 2D45A 1ZG3A 2JT1A 3MZYA 1KU7A 2E7WA 3C3WA 1KYWA 2VT2A 2FOKA 3H3UA 4Q5SF 1O7FA 4ENJA 3HSFA 2RC4A 3ELKA 4R8HA 3N4MA 2VE8A 2ZMEA 4EMSA 1FOKA 1RNLA 2H6BA 2QQBA 5FLXK 4HLXA 4EQQA 2HQNA 2EV5A 1Z05A 2ZXJA 1U8RA 1DUXC 2FMLA 2IVMA 3TKYA 1TQPA 4L5JA 1H0MA 4EGYA 2K86A 1JHFA 4PCQA 2D2WA 3GVAA 2V79A 5IT3A 4Y17A 1B6AA 5BQTA 3KETA 4GO1A 4M9XA 1ZYRF 3EYYA 1S6LA 1ONVA 4LFUA 1SMTA 4CYDA 1PDNC 3DPLC 1HW1A 2P5VA 1MJAA 1ZLKA 4YFKF 2CO5A 1SFUA 5D5UB 2KJBA 4BHCA 2OQGA 3KP6A 3RYPA 3VB2A 1P92A 5CYVA 1ZLJA 4HF1A 2VT3A 3V7SA 4KMUX 1B59A 2CSOA 2YX4A 4PZJA 5LHGA 5CJ9A 1YLFA 1WI9A 5K5QA 4LLLA 2QQAA 1ZARA 4ENKA 4MTDA 4RAZA 2CFXA 4CZZA 3EUHA 1MDMA 2A68F 2VOOA 1RI7A 4ESJA 1BI1A 4UVCA 1WSUA 2XKPA 2LNBA 2XKOA 1ZRDA 3OV8A 3DF8A 1BI0A 3K2ZA 4HZFA 1MGTA 3HSEA 1OYWA 2H94A 4LG0B 1YTYA 1G3TA 2K4JA 5CLSA 4Q48A 2RGVA 4EJUA 1H9GA 2STTA 1FPQA 1W5SA 1HW2A 2H6CA 1HSJA 3QOPA 2UXNA 1FBSA 1YS6A 2XHKA 1O3TA 3KZZA 3WU1B 4L0YB 1R00A 2ZCWA 2QM3A 3J80Z 1LEAA 3I59B 2QYOA 3E6BA 2XAQA 3ZPLA 4ESBA 2HFHA 4PGGA 3IKTA 2HWVA 1TNTA 2R7FA 2F5EA 2KIFA 2A07F 4UV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7X A;  3Q9V A;  3P9K A;  3GYH X;  3W6K B;  1JXS A;  2DPU A;  1I6X A;  1T0F A;  3KCC A;  1FYM A;  4L9T A;  5F1R A;  5JFR A;  3KP7 A;  4ESF A;  1FT9 A;  4BAY A;  2Y0M A;  2NYX A;  4OIQ F;  3D0S A;  3DFG A;  2M5W A;  1R5G A;  3F6O A;  1F4K A;  1USS A;  4AD9 A;  5FLX Z;  1IRG A;  5E1W A;  4EGZ A;  1B9N A;  1XGS A;  4IF4 A;  3T5X A;  3RIR A;  2X0L A;  4BQA A;  2FF4 A;  4MEY F;  5E1X A;  2EFP A;  4KIB A;  5CVI A;  1EV7 A;  5D6E A;  3WU0 A;  2BE5 F;  3N97 A;  3F8M A;  1FSH A;  2JSC A;  4WXC A;  5DEQ A;  2ZNZ A;  3W6J B;  4BHB A;  3KEO A;  2CYY A;  1LQ1 A;  4M6X A;  3LA2 A;  3K1N A;  1MJ9 A;  1YG2 A;  3ULQ B;  2FRH A;  5E20 A;  1LJ9 A;  2IA2 A;  4RGU A;  2QLZ A;  3AAF A;  4EJO A;  4HQM A;  3JSP A;  4IRG A;  1K7A A;  4BNC A;  1KGS A;  4BH9 A;  4U0W A;  1AWC A;  1W7P D;  3EQL F;  4B09 A;  5BMZ A;  2Z5U A;  4HA8 A;  2EB7 A;  4WXH A;  2XIG A;  3BJA A;  4I0A A;  4YII A;  1EH7 A;  1ZG1 A;  3DKW A;  4P96 A;  1R22 A;  2VOP A;  2VE9 A;  2YPR A;  2Z33 A;  3ECO A;  2G9W A;  4RB2 C;  4G7O F;  4FHT A;  1T2K A;  1G4D A;  3TOB A;  5LGU A;  1YIO A;  2R3S A;  3HUG A;  4G94 A;  2COM A;  4HQE A;  3TO6 A;  3T8T A;  2EA2 A;  1XD7 A;  1P2F A;  3F72 A;  4IPA A;  5ILS A;  2ZJ2 A;  2PMH A;  1XSX A;  1L3L A;  3IRQ A;  3I0T A;  2BV6 A;  4NQW A;  1FSE A;  5D5W B;  1ZG5 A;  1B9M A;  2HTJ A;  3Q9S A;  1SD7 A;  5HDN A;  2RQP A;  2EFQ A;  2HYF A;  3I71 A;  1HKT A;  2A6E F;  3E6D A;  1LDJ A;  1HXD A;  2EV6 A;  2YSR A;  1XGO A;  4UXN A;  1QBJ A;  5KVR A;  3HSR A;  1FNN A;  3R0J A;  3K0L A;  2K02 A;  2QZ8 A;  4IRH A;  3QP5 A;  1B1B A;  3BP8 A;  1KQ9 A;  3WTU C;  4U7D A;  2ESN A;  2HR3 A;  2VC0 A;  3WTT C;  1B4A A;  4MTE A;  3CO7 C;  1YW9 A;  2OBP A;  2VOD A;  1QZZ A;  4P5O A;  3WTZ A;  1O3R A;  5DCM A;  3P9C A;  2GXG A;  3FXU A;  2CWE A;  3F23 A;  2C6Y A;  2FXA A;  3F8C A;  1O3S A;  4KDP A;  5HDK A;  4YFN F;  2E1C A;  1PP8 F;  3BPV A;  3GFI A;  4FX4 A;  1S3J A;  2HZT A;  4ZZL A;  1FYK A;  2W25 A;  2IA1 A;  5LEJ A;  5DUI A;  2NNY A;  5TRD A;  2L4A A;  4Z2Y A;  1GXQ A;  4IHS A;  5JHU A;  3T1B A;  3I58 A;  3FM3 A;  5L3B A;  4LGW A;  2JTV A;  2FU4 A;  4HBL A;  4S05 A;  1XSD A;  2ISZ A;  1LEB A;  1F1Z A;  3REO A;  4IVN A;  3TDU C;  4UHT A;  2D1V A;  3F3X A;  1R1U A;  3CUQ A;  5JVT A;  3KP2 A;  3L2C A;  1HQC A;  1F5T A;  3ZMV A;  3HRU A;  1KU2 A;  5E8G A;  2P7C B;  1E17 A;  1P4X A;  3WGH A;  3KFW X;  2BYV E;  5E17 F;  2O61 A;  3RDI A;  3LST A;  5JR3 A;  2NNN A;  5D8K B;  1R1T A;  1W4M A;  3V8L A;  4XSX F;  5KK1 A;  2EFN A;  4Q47 A;  4HLY A;  3FHZ A;  4IJA A;  5D4S A;  5BPI A;  3IWZ A;  3T8R A;  3HTU A;  1XMA A;  1TNS A;  4M71 A;  3DP7 A;  1YW7 A;  5E1Z B;  3DPT A;  4MQ9 F;  2DQR A;  3J80 K;  3SHF A;  1I27 A;  3M8F A;  4A5N A;  4RB1 A;  2K7L A;  4KN4 X;  4LG0 A;  3PFI A;  2DI3 A;  4L18 B;  3E5X A;  5HS7 A;  4GXO A;  1QPM A;  5J8F A;  5HOO A;  3BY6 A;  2MA3 A;  3J81 K;  1P4W A;  4OIR F;  4OMZ A;  2P6S A;  5DV5 A;  2GIV A;  3F8B A;  3L9F A;  1FBU A;  5ILU A;  3PQJ A;  4YFX F;  3ZP5 A;  3FMR A;  4BHP A;  1ZRE A;  1FP1 D;  3LQR A;  2IA0 A;  4UVA A;  2DW4 A;  3I59 A;  3HOS A;  2UXX A;  1R7J A;  2WWY A;  3SXY A;  3DV8 A;  4KFC A;  4P9U A;  5ICG A;  3GZ6 A;  1RUO A;  5HLI A;  1D8K A;  3GW2 A;  4JK1 X;  2B0L A;  5K5R A;  3BJ6 A;  3FF5 A;  3L7W A;  4M72 A;  1XN7 A;  2EA4 A;  4HF0 A;  2ZNY A;  2Q8K A;  1T39 A;  5D5V B;  2HKX A;  4KIC A;  1J5Y A;  3CUQ B;  1R36 A;  4O6J A;  4EM1 A;  3KEQ A;  2W57 A;  2XAS A;  4R1H A;  1D3Y A;  4ENN A;  5CVJ A;  2PEX A;  1J0R A;  3F8N A;  3R60 A;  3GLX A;  2D1H A;  3E97 A;  5HVQ C;  1UST A;  4N9I A;  4M9Z A;  2BGC A;  2LDU A;  3KP4 A;  4ETS A;  1SFE A;  4ZZD A;  4M6Y A;  2J5O A;  5J8C A;  4JQF A;  1K78 B;  1O3Q A;  4Y15 A;  3COA C;  3ISP A;  4KT5 C;  2M8E A;  1HW5 A;  2FEZ A;  5IT9 K;  2L01 A;  1EH6 A;  2PFB A;  6PAX A;  1IF1 A;  2OU2 A;  4RS8 A;  1XGM A;  3IWF A;  3G73 A;  3IRR A;  4H0E A;  2VBZ A;  2XAG A;  4A6E A;  5E8I A;  2HKO A;  1HBX G;  3PQK A;  4ZYH A;  5LBQ A;  2VN2 A;  3EDP A;  1L0O C;  3I53 A;  4O3M A;  2Y48 A;  3E3V A;  5DYM A;  1G3Y A;  5DUK A;  2ETH A;  4UUV A;  1DPU A;  4ENM A;  3E5U A;  3IL2 A;  2LKP A;  3P9I A;  2P8T A;  4LK0 F;  4RB3 C;  2EV0 A;  4U0Y A;  1O7L A;  3RTR A;  2HS5 A;  5A2Q Z;  2HTS A;  1R23 A;  5AIQ A;  4HX8 A;  2F5C A;  2HGC A;  5FGM A;  1TW2 A;  2WC2 A;  3L09 A;  1DPR A;  3J81 Z;  1IW7 F;  3E6M A;  2V1U A;  4A12 A;  3GF2 A;  2DK8 A;  1FC3 A;  4P9F A;  4KMF A;  1XGN A;  1ZRF A;  2ZKZ A;  2IT0 A;  2KKO A;  1BJA A;  3C18 A;  4I7H A;  3I4P A;  5FD6 A;  3ML6 A;  1OR7 A;  3FXR A;  3ZMZ A;  2CGP A;  4WK8 F;  3CLO A;  1TW3 A;  1HKQ A;  2ZBK A;  3VFZ A;  4EJT A;  1UFM A;  3RKW A;  2VON A;  1MD0 A;  2L02 A;  1G6N A;  3HIF A;  1J59 A;  1JHH A;  3LA3 A;  2MLK A;  1YFH A;  2V6C A;  3LAJ A;  4LJZ F;  5DCF A;  2OZ6 A;  1SMY F;  2LSO A;  3EYI A;  4N9H A;  2EJR A;  2PLY A;  1Z91 A;  5BOX A;  1R58 A;  1X3U A;  2XGX A;  3T0Y A;  4UVB A;  3O3K A;  4A2U A;  2EFW A;  3ERE D;  2CQK A;  4QWQ A;  1ODD A;  1HST A;  3VOD A;  3LQQ A;  3IHU A;  2RN7 A;  2QBY B;  5D4R A;  3ZMT A;  3K69 A;  4LB6 B;  1A04 A;  2MC3 A;  3QP6 A;  3HTS B;  1P4A A;  3O2P E;  2VBW A;  4U7B A;  2NS0 A;  3RKY A;  1F9N A;  4FX0 A;  3BOQ A;  1U78 A;  2KIU A;  5IT9 Z;  1CGP A;  3WE3 A;  2ACJ A;  3C7J A;  1XCV A;  2IJL A;  3F21 A;  4BYY A;  3U2R A;  1Z1D A;  1V3F A;  3WOD F;  1KU3 A;  2JPC A;  1U2W A;  3U9G A;  5LEK A;  2P7V B;  1T6S A;  5LRR A;  4EM0 B;  3WGG A;  2ZO4 A;  3I5U A;  3ZMS A;  5BS6 A;  2RDP A;  4A6D A;  2XV4 S;  4HW0 A;  1BI2 A;  2Z3Y A;  3JAM K;  2E1N A;  3MAJ A;  1STZ A;  5L3D A;  4CXF A;  3LAP A;  4M9S A;  4ZYG A;  3GX4 X;  2TDX A;  1QO0 D;  2XVC A;  1XDU A;  5JI6 A;  1ZGA A;  4D0P A;  3FMQ A;  3DQV C;  1YQA A;  2P5K A;  3BDD A;  5ERI A;  1OMI A;  2O6G E;  5HS9 A;  5BPD A;  1ON1 A;  2IRF G;  2JRT A;  2ELH A;  4U0V A;  1S29 A;  2IW5 A;  2XAH A;  4FT8 A;  4WX9 A;  4L0Z B;  2EK5 A;  3V7R A;  3CUQ C;  3B73 A;  1FBQ A;  2GWR A;  4A0X A;  3TGN A;  2X4H A;  2Z9O A;  2QEN A;  2HQR A;  1KYZ A;  3GZ5 A;  3NRV A;  2DK5 A;  4AIJ A;  5TJJ A;  1KU9 A;  4S04 A;  4B8X A;  3HYI A;  3R6S A;  2FNA A;  4EV0 A;  1MZB A;  2K27 A;  2CW0 F;  4MNU A;  2QUF A;  4CDG A;  1IAW A;  3F22 A;  5FFX A;  2PG4 A;  1ZAO A;  3KP3 A;  1J7K A;  3GFM A;  3K1M A;  2L4M A;  1JGS A;  3GFL A;  4Y13 A;  4P55 A;  3RPU A;  1K6O A;  2O0Y A;  2RNJ A;  3WG9 A;  2Q0O A;  3BRO A;  4IXA A;  3NEU A;  4QLC U;  4L9J A;  3WTS C;  1BI3 A;  3ECH A;  5D8L B;  3CDH A;  3ABT A;  5H6Q A;  3LFK A;  4I2O A;  3WE2 A;  2LF8 A;  4IHT A;  3V7C A;  1TLH B;  4AVP A;  2IPQ X;  1IUY A;  4OIO F;  2BEO A;  3CUO A;  4HOB A;  4JBA A;  2OQR A;  2UZK A;  1LDK B;  1ULY A;  3M8E A;  2DBB A;  1SD5 A;  2PBI A;  3WGI A;  5D5X B;  3JAM Z;  1XMK A;  4RB0 A;  2VBY A;  2V1X A;  1IN4 A;  1P6R A;  4G9Y A;  1K78 A;  3TQN A;  4L5I A;  4ASN A;  3GEZ A;  2Y75 A;  2HDC A;  4OMY A;  4CO8 A;  1J2X A;  4G8X A;  4XSZ F;  1ZRC A;  1Q1H A;  1E2X A;  1BN5 A;  4Q4Z F;  1SAX A;  2O3F A;  4O5V A;  1NHA A;  2P4W A;  2VXZ A;  5LRS A;  2F2E A;  3BPX A;  1S7A A;  3I64 A;  5DDG A;  5A2Q K;  1LVA A;  5ED4 A;  1IXR C;  2P6T A;  2L54 A;  3MFK A;  4PGH A;  4XLN F;  3QRF F;  3B02 A;  1EH8 A;  3CTA A;  1LDD A;  2DTR A;  3DEU A;  1IRF A;  2JZY A;  1OPC A;  3FX3 A;  2FBK A;  2FE3 A;  4EJW A;  3GXO A;  2A5Y B;  3E6C C;  2PQ8 A;  5L3F A;  3L00 A;  1S8N A;  3KE2 A;  4NB5 A;  1IXC A;  4AIK A;  2W85 A;  4GYG A;  4HV5 A;  3KZY A;  2YX7 A;  1TBX A;  1SD4 A;  4LK1 F;  3JSO A;  2M87 A;  2ESH A;  3R4K A;  1T98 A;  3FWE A;  1GVJ A;  1Z9C A;  3FMS A;  4GYI A;  5DD4 A;  4WF2 A;  1W5T A;  5LGN A;  3FM5 A;  1W7P A;  1BIB A;  3SQN A;  1G3S A;  1MKM A;  4A0Z A;  1GHC A;  5HLH A;  1CF7 A;  1T38 A;  4EJV A;  3SZP A;  4A5M A;  1U5T B;  4KYW A;  4HDV A;  4OIP F;  3M1E A;  4CIC A;  4F7Z A;  3FZV A;  3M9A A;  3TOA A;  2FA5 A;  2MH2 A;  2DO7 A;  1C0W A;  3M7G A;  2AS5 F;  2PN6 A;  1JE8 A;  3EET A;  3F8F A;  5HDG A;  5AON A;  5H6R A;  5EEH A;  3MCZ A;  1QQI A;  1XCB A;  5FO5 A;  3R0A A;  2P5L C;  1ON2 A;  2XRO A;  4HDU A;  2WV0 A;  1RIO H;  5F64 A;  2NRA C;  2QBY A;  4MEX F;  2V9V A;  2J5P A;  4MQV A;  1IZ1 A;  1V4R A;  2FQ3 A;  2AXL A;  1GXP A;  4CGZ A;  2OAZ A;  1TQM A;  2HYG D;  1IXS B;  3MQ0 A;  3MWM A;  3H92 A;  4DQ2 A;  1J9I A;  1BBY A;  2XAF A;  1VTN C;  3WTX C;  3GO5 A;  3H3Z A;  3ABU A;  3QPT A;  2HEO A;  4OIN F;  3P7N A;  4A0Y A;  4LB5 A;  3BZ6 A;  4DNC A;  2OD5 A;  2GAU A;  1ZGJ A;  4M73 A;  4LLN A;  4HAM A;  3ZN1 A;  5ILV A;  2ISY A;  2RVC A;  4PDK A;  4WWC A;  2G7U A;  1W7P B;  2V1D A;  4BXU A;  2ZME B;  4KNY A;  4N0B A;  2PJP A;  4HX4 A;  2L3D A;  1WQ2 A;  3JTG A;  1CF7 B;  1RUN A;  2QVO A;  2GXB A;  2MH9 A;  5D6F A;  2A3S A;  3JTH A;  1YYV A;  3O6B B;  1Z7U A;  2XUB A;  2EFO A;  4G6D A;  5EEG A;  3VEP A;  4MGR A;  1ZN2 A;  4L9V A;  3TDZ C;  1WKM A;  5L3G A;  2DPD A;  1FWZ A;  1R5H A;  1XB4 A;  4RAY A;  4LD5 A;  1H9T A;  3KLO A;  2QQ9 A;  4KUM A;  3MZH A;  2M1B A;  1OKR A;  3I54 A;  1J75 A;  1PP7 U;  3V8J A;  1SFX A;  4HX7 A;  4AIH A;  2NAZ A;  4RGX A;  2DLL A;  5LGT A;  1QZY A;  2O03 A;  3RKX A;  2WTE A;  2DT5 A;  2G7H A;  1UHW A;  5CVU A;  1UCR A;  2GQQ A;  3RYR A;  4IRI A;  2Q2E A;  3WTW C;  1FYL A;  4GCV A;  4HF2 A;  4G7Z F;  1U6G A;  3GFJ A;  3RPQ A;  3SZT A;  3CO6 C;  4AWX B;  4UV8 A;  1MDM B;  1BIA A;  3K1P A;  3JW4 A;  5ICC A;  5L3E A;  3HRS A;  1PUE E;  1IN8 A;  4HV6 A;  1G3W A;  1FZP B;  2OA4 A;  2ADU A;  2CG4 A;  1TQI A;  3C1D A;  2KJC A;  2QWW A;  5K5O A;  3E5Q A;  2EWN A;  3QAH A;  1Z6R A;  5ICF A;  4OOI A;  3BWG A;  1IN7 A;  5CVV A;  4G6Q A;  2RV8 A;  1IN6 A;  1DDN A;  1WRJ A;  3F6V A;  1QNT A;  2VBX A;  5CVR A;  3V8K A;  5E18 F;  2H27 A;  3HOT A;  2A61 A;  3GUD A;  3DXJ F;  4I09 A;  4E70 A;  2GA2 A;  2DU9 A;  1XDS A;  4R79 A;  1AOY A;  3V4G A;  5FFZ A;  5HS8 A;  3D5L A;  1R1V A;  5F6F A;  1KQ0 A;  2HOE A;  1BC7 C;  4YIF A;  1SD6 A;  2W84 A;  3HHG A;  2H09 A;  1BM9 A;  1U3E M;  1BOA A;  2FBI A;  4I0B A;  2GA1 A;  3KLN A;  4EVI A;  1TTY A;  2W24 A;  5ICE A;  2Z99 A;  1UB9 A;  3VOE A;  4G7H F;  2XRN A;  4OU0 A;  3GWZ A;  1U5T C;  5FB2 A;  3HRM A;  4WCG A;  2A6H F;  2FNP A;  4KIF A;  2K4B A;  3CJN A;  1YW8 A;  4LLG F;  1YO5 C;  4WXD A;  3QPH A;  5AIP A;  3SFZ A;  2YR2 A;  1ZHF A;  4ON0 A;  1YS7 A;  2GZW A;  2MD5 A;  5LHI A;  1LNW A;  3WTV C;  4HYE A;  2KRF A;  5DD8 A;  1S7O A;  2FSW A;  4ZYD A;  1FY7 A;  1KQ8 A;  3TO9 A;  4MHG A;  1LB2 A;  1IN5 A;  1Y0U A;  3G3Z A;  3RJP A;  3HRT A;  2DQL A;  2M30 A;  1RZ4 A;  4KN7 X;  3QU6 A;  2F5F A;  2F5D A;  4I01 A;  3S2W A;  2VC1 A;  2MLG A;  2YU3 A;  3MEX A;  1WWX A;  3R61 A;  3ZN0 A;  3Q5F A;  1KA8 A;  1XSV A;  3LA7 A;  1FLI A;  3ZMU A;  3LWF A;  4KIG A;  3RI4 A;  1OYY A;  2R7D A;  5K1Y A;  5LHH A;  3FXQ A;  4CHU A;  2KIM A;  4GGG A;  4XBF A;  4M74 A;  5FD5 A;  3TO7 A;  4EM2 A;  1U5T A;  4RGR A;  5LLQ A;  1MJB A;  4ZH4 F;  1OYI A;  2XAJ A;  1REP C;  3WTY C;  2FMY A;  2RKH A;  4LMY A;  2LF7 A;  1I5Z A;  4U88 A;  2STW A;  2FBH A;  1D5V A;  1I1S A;  5J6X A;  2BBY A;  3ZQ7 A;  2ZFW A;  3BJO A;  2JPB A;  2M45 A;  1Z6T A;  2OZU A;  3J7A O;  3ROU A;  3IC7 A;  1UHM A;  4I98 B;  3OOP A;  3HHH A;  3K9T A;  5L3C A;  4YG2 F;  4KA4 A;  1HKS A;  4L9N A;  2PI0 A;  2UWM A;  3KP5 A;  1D8J A;  2DAO A;  4RGS A;  1K79 A;  4XLP F;  1FP2 A;  5H20 A;  4I02 A;  2IP2 A;  1FX7 A;  1O57 A;  2PMU A;  3IKV A;  4TV7 A;  5HLG A;  2A69 F;  3U1D A;  4XRF A;  1DP7 P;  2O8X A;  3QU3 A;  4K2E A;  5DCM B;  1QGP A;  4NHJ A;  2DFI A;  3NQO A;  2MBF A;  3ZMD A;  4UNO A;  4ZYE A;  1BC8 C;  1I1G A;  1ZH5 A;  2D45 A;  1ZG3 A;  2JT1 A;  3MZY A;  1KU7 A;  2E7W A;  3C3W A;  1KYW A;  2VT2 A;  2FOK A;  3H3U A;  4Q5S F;  1O7F A;  4ENJ A;  3HSF A;  2RC4 A;  3ELK A;  4R8H A;  3N4M A;  2VE8 A;  2ZME A;  4EMS A;  1FOK A;  1RNL A;  2H6B A;  2QQB A;  5FLX K;  4HLX A;  4EQQ A;  2HQN A;  2EV5 A;  1Z05 A;  2ZXJ A;  1U8R A;  1DUX C;  2FML A;  2IVM A;  3TKY A;  1TQP A;  4L5J A;  1H0M A;  4EGY A;  2K86 A;  1JHF A;  4PCQ A;  2D2W A;  3GVA A;  2V79 A;  5IT3 A;  4Y17 A;  1B6A A;  5BQT A;  3KET A;  4GO1 A;  4M9X A;  1ZYR F;  3EYY A;  1S6L A;  1ONV A;  4LFU A;  1SMT A;  4CYD A;  1PDN C;  3DPL C;  1HW1 A;  2P5V A;  1MJA A;  1ZLK A;  4YFK F;  2CO5 A;  1SFU A;  5D5U B;  2KJB A;  4BHC A;  2OQG A;  3KP6 A;  3RYP A;  3VB2 A;  1P92 A;  5CYV A;  1ZLJ A;  4HF1 A;  2VT3 A;  3V7S A;  4KMU X;  1B59 A;  2CSO A;  2YX4 A;  4PZJ A;  5LHG A;  5CJ9 A;  1YLF A;  1WI9 A;  5K5Q A;  4LLL A;  2QQA A;  1ZAR A;  4ENK A;  4MTD A;  4RAZ A;  2CFX A;  4CZZ A;  3EUH A;  1MDM A;  2A68 F;  2VOO A;  1RI7 A;  4ESJ A;  1BI1 A;  4UVC A;  1WSU A;  2XKP A;  2LNB A;  2XKO A;  1ZRD A;  3OV8 A;  3DF8 A;  1BI0 A;  3K2Z A;  4HZF A;  1MGT A;  3HSE A;  1OYW A;  2H94 A;  4LG0 B;  1YTY A;  1G3T A;  2K4J A;  5CLS A;  4Q48 A;  2RGV A;  4EJU A;  1H9G A;  2STT A;  1FPQ A;  1W5S A;  1HW2 A;  2H6C A;  1HSJ A;  3QOP A;  2UXN A;  1FBS A;  1YS6 A;  2XHK A;  1O3T A;  3KZZ A;  3WU1 B;  4L0Y B;  1R00 A;  2ZCW A;  2QM3 A;  3J80 Z;  1LEA A;  3I59 B;  2QYO A;  3E6B A;  2XAQ A;  3ZPL A;  4ESB A;  2HFH A;  4PGG A;  3IKT A;  2HWV A;  1TNT A;  2R7F A;  2F5E A;  2KIF A;  2A07 F;  4UV9 A; 
#chains in the Genus database with same CATH topology
 2E7X A;  3Q9V A;  3P9K A;  4OWR B;  3GYH X;  4Y33 A;  3W6K B;  5IP6 A;  1N77 A;  1JXS A;  1SAN A;  3G1L A;  3QOE A;  2DPU A;  1I6X A;  1T0F A;  3KCC A;  1FYM A;  1V5F A;  4L9T A;  5F1R A;  4FE4 A;  5J4V A;  1OCT C;  5JFR A;  3KP7 A;  4ESF A;  3RKQ A;  1FT9 A;  4BAY A;  2Y0M A;  2NYX A;  1E0E A;  2HDD A;  2EZK A;  4FIS A;  4OIQ F;  3H9Q A;  3D0S A;  3DFG A;  3S17 J;  2M5W A;  1R5G A;  2A05 A;  3F6O A;  4BE2 A;  1F4K A;  3NWS A;  4XON A;  2DOA A;  1USS A;  4AD9 A;  1UG2 A;  5FLX Z;  1GV5 A;  1PVE A;  5FRO A;  1IRG A;  5E1W A;  3J7Z I;  4EGZ A;  1B9N A;  1XGS A;  1IGN A;  2CFO A;  4IF4 A;  3T5X A;  1PUF A;  2E5N A;  3RIR A;  5EG0 A;  2X0L A;  4BQA A;  2FF4 A;  4MEY F;  5E1X A;  2EFP A;  4KIB A;  5CVI A;  4GFB A;  1EV7 A;  2R7Q A;  5D6E A;  2H1L A;  2XF7 A;  3WU0 A;  3HJE A;  2IGO A;  2BE5 F;  5J1Y A;  2R4G A;  3N97 A;  3F8M A;  4U87 A;  1FSH A;  2JSC A;  4WXC A;  3TW6 A;  4A3D J;  5DEQ A;  2R7R A;  2ZNZ A;  3W6J B;  4BHB A;  3KEO A;  3AG3 H;  2CYY A;  1LQ1 A;  2AQF A;  4M6X A;  3LA2 A;  3K1N A;  2JA6 J;  1MJ9 A;  1YG2 A;  2ME0 A;  4HEA 2;  2FRH A;  1OFC X;  5E20 A;  3ULQ B;  1OCP A;  1LJ9 A;  1IV6 A;  2IA2 A;  3TP3 A;  4RGU A;  1OCO H;  4FET A;  2QLZ A;  2O7O A;  4BDZ A;  2LTP A;  3AAF A;  1G8X A;  4EJO A;  2WY8 Q;  4HQM A;  3QPS A;  3JSP A;  4IRG A;  3A2K A;  1K7A A;  4BNC A;  1KGS A;  3EUA A;  5EZH A;  4BH9 A;  4U0W A;  1JKO C;  1AWC A;  1MH3 A;  4XLA A;  1B72 A;  2MD0 A;  3H0G J;  4JP0 A;  1W7P D;  3EQL F;  2OCE A;  4B09 A;  3SZG A;  1ERD A;  5KCM A;  5BMZ A;  2CQN A;  2Z5U A;  4HA8 A;  2EB7 A;  4WXH A;  1A31 A;  3OS1 A;  3S2H J;  2ZJR F;  2VJI A;  4IX7 A;  2LBF A;  2XIG A;  3BJA A;  3LSH A;  1U0J A;  4I0A A;  1QHG A;  1TP4 A;  4YII A;  1EH7 A;  3HM5 A;  2E19 A;  1ZG1 A;  3DKW A;  4P96 A;  3S1Q J;  2DJI A;  1R22 A;  2VOP A;  2VE9 A;  2YPR A;  1VQM I;  2LLK A;  2OF7 A;  1Y8R B;  1MND A;  1YOV B;  2Y0S N;  5E3O A;  2Z33 A;  2EIK H;  3O8G A;  2V1N A;  2G9W A;  3ECO A;  4RB2 C;  3BR3 A;  4G7O F;  2DA2 A;  2Z1D A;  2XGE A;  2CU7 A;  4FHT A;  1T2K A;  1G4D A;  3K70 C;  1VQK I;  3TOB A;  5LGU A;  1MH4 A;  1YIO A;  3PNT A;  4M3G A;  2R3S A;  3HUG A;  1OLT A;  4G94 A;  2COM A;  4HQE A;  3V42 A;  1BW5 A;  1R6R A;  3TO6 A;  3QQA A;  3T8T A;  2EA2 A;  1RC9 A;  1XD7 A;  1P2F A;  2Y0S A;  4XOT A;  1VQ6 I;  3F72 A;  4IPA A;  5E79 C;  5ILS A;  4F52 A;  1W36 D;  1MBE A;  5EZG A;  3FIW A;  5GP9 A;  5HLT A;  1IJW C;  5FLV A;  2ZJ2 A;  2PMH A;  1XSX A;  1L3L A;  5IYB J;  2L9S A;  3IRQ A;  3I0T A;  2I10 A;  2BV6 A;  4NQW A;  2JWT A;  1FSE A;  2DCE A;  2GIZ A;  5D5W B;  2XSD C;  3HEF A;  1ZG5 A;  4XN0 A;  1B9M A;  2HTJ A;  1VQN I;  4PFP A;  3Q9S A;  1SD7 A;  5HDN A;  1JKR C;  2RQP A;  2EFQ A;  4PUS A;  3E0J B;  2HYF A;  1SVO A;  2WAF A;  3I71 A;  4OAZ A;  1HKT A;  2A6E F;  3E6D A;  2JMW A;  3FKI J;  1LDJ A;  5M5W J;  1HXD A;  2EV6 A;  1PUF B;  3CCL I;  2YSR A;  3DKX A;  1ZGW A;  2KL4 A;  4CCN A;  2M4K A;  4XLE A;  4F93 B;  2CH0 A;  1XGO A;  4UXN A;  1QBJ A;  4ABZ A;  1ETW A;  5KVR A;  3HSR A;  1FNN A;  3R0J A;  3K0L A;  1DP3 A;  1U9O A;  3O8H A;  2K02 A;  1CQT A;  2QZ8 A;  3PIO F;  4OAY A;  3HOZ J;  4IRH A;  3QP5 A;  1B1B A;  3BP8 A;  3PUB A;  3VSL A;  1KQ9 A;  5C4J J;  3WTU C;  3DBL B;  4U7D A;  2L9V A;  2ESN A;  2HR3 A;  2VC0 A;  3BR5 A;  3WTT C;  1B4A A;  1TWA J;  4MTE A;  3CO7 C;  4RLF A;  1YW9 A;  2F6C A;  2F5V A;  2OBP A;  2X48 A;  3ZCO A;  2LKX A;  1LKX A;  2VOD A;  1QZZ A;  1OIS A;  4P5O A;  3WTZ A;  1HDD C;  1O3R A;  5DCM A;  3VWB A;  3P9C A;  3CD6 I;  2GXG A;  3FXU A;  1ETX A;  2FQ4 A;  2CWE A;  3F23 A;  4ZDO A;  2KHM A;  2C6Y A;  2OJE D;  2DYR H;  3CES A;  1N78 A;  3LSK A;  2FXA A;  3U21 A;  1I3Q J;  3RCO A;  3EPZ A;  3K4C A;  2CW8 A;  3F8C A;  3L1P A;  1O3S A;  4HG2 A;  3Q0V A;  3GME A;  4KDP A;  1HA8 A;  3NAU A;  4PSW A;  5HDK A;  3H5N A;  4YFN F;  2E1C A;  1PP8 F;  3ZQI A;  3BPV A;  3GFI A;  2HOS A;  1WHU A;  4FCY A;  1W1W E;  4FX4 A;  1B8I A;  1S3J A;  2HZT A;  3OR2 C;  1LUJ B;  2R7T A;  4ZZL A;  2F4O B;  2K9S A;  4NC8 A;  4CCM A;  1FYK A;  2W25 A;  2IA1 A;  4XK4 A;  4XRM A;  4UUS A;  5LEJ A;  2W48 A;  5DUI A;  2JVH A;  2XSJ C;  4XM3 A;  2NNY A;  5TRD A;  2L4A A;  1JI8 A;  4Z2Y A;  1GXQ A;  2BY0 A;  4IHS A;  5JHU A;  3T1B A;  3I58 A;  2DFF A;  2XDV A;  3GTG J;  1WJA A;  3FM3 A;  5L3B A;  4LGW A;  2JTV A;  2FU4 A;  4HBL A;  4S05 A;  1XSD A;  3ZQC A;  2ISZ A;  1YI2 I;  1LEB A;  3F9K A;  3OIQ A;  1F1Z A;  4A69 C;  2JK3 A;  5CKT A;  3ABL H;  3REO A;  4IVN A;  3TDU C;  3OR1 C;  4UHT A;  3CLQ A;  1K83 J;  1A5J A;  4ZTJ A;  2D1V A;  3F3X A;  1R1U A;  3CUQ A;  5IY5 H;  5JVT A;  2MFZ A;  1DQU A;  1EJ9 A;  3KP2 A;  3L2C A;  1HQC A;  4C2U A;  1F5T A;  2IS6 A;  4YEJ A;  3ZMV A;  3A02 A;  3K6G A;  2ELK A;  3HRU A;  1KU2 A;  4ZC3 A;  3CCY A;  2OCC H;  2H1K A;  1GV2 A;  1PYV A;  1BOB A;  1K6Y A;  5IYD J;  5E8G A;  2P7C B;  1ZTR A;  3WU2 C;  2VPR A;  1DGW Y;  4NQW B;  1E17 A;  1P4X A;  2BW3 B;  3KFW X;  3WGH A;  3IP4 B;  2IS4 A;  2BYV E;  5E17 F;  3W2A A;  2ECC A;  2IGM A;  2ZME C;  2O61 A;  3RDI A;  3LST A;  5JR3 A;  2JN6 A;  5B1B H;  1N25 A;  1X19 A;  3S32 A;  4BU2 A;  2NNN A;  3ZQF A;  3OYA A;  5D8K B;  4XKB A;  3CCQ I;  2ZB9 A;  4B3X A;  3G6E I;  4JOM A;  2Y2Z A;  2MAB A;  4M3D A;  3OYE A;  3JRH A;  1R1T A;  4QPQ A;  4W1U A;  1W4M A;  3V8L A;  4XSX F;  5KK1 A;  1TZL A;  2X51 A;  1MBH A;  2EFN A;  2OV7 A;  4Q47 A;  3IV5 A;  4IJA A;  3FHZ A;  5D4S A;  4HLY A;  3IWZ A;  3T8R A;  5BPI A;  4A3G J;  3HTU A;  1WGX A;  1XMA A;  1Y0N A;  1TNS A;  1VQ8 I;  2VKE A;  2HQ5 A;  4M71 A;  4DYR A;  2LKS A;  3DP7 A;  1YW7 A;  2V4J C;  3LMM A;  1MIJ A;  3HG9 A;  4N4N B;  5E1Z B;  5FKK A;  3DPT A;  4MQ9 F;  2DQR A;  3J80 K;  1LE8 B;  1P9Q C;  3SHF A;  4ZYA A;  1X58 A;  3JR9 A;  1I27 A;  1TWH J;  4NBQ A;  1JTX A;  2FJ1 A;  4XMY A;  1RKT A;  3M8F A;  4A5N A;  4RB1 A;  1IDY A;  2V9K A;  2K7L A;  4KN4 X;  4LG0 A;  2VAS A;  2DI3 A;  3PFI A;  5B66 C;  5M5X J;  4A3E J;  4L18 B;  1HLV A;  3E5X A;  5HS7 A;  5LFA A;  3LSP A;  2ZFU A;  1J09 A;  1QPM A;  4GXO A;  5J8F A;  3BY6 A;  2DOE A;  3CMM A;  2XF5 A;  5HOO A;  3OS0 A;  3FK7 A;  5IYC J;  3J7Y J;  2MA3 A;  3J81 K;  1P4W A;  3OYJ A;  4OIR F;  4OMZ A;  2P6S A;  4PJM A;  4XLF A;  2RNG A;  4B43 A;  5DV5 A;  2GIV A;  3F8B A;  3CF2 A;  3L9F A;  1FBU A;  5ILU A;  5F1J A;  5IOY A;  3PQJ A;  4YFX F;  3ZP5 A;  3FMR A;  4BHP A;  1ZRE A;  2KMU A;  2X85 A;  1FP1 D;  5EGO B;  4HRI A;  3LQR A;  2IA0 A;  4UVA A;  2DW4 A;  3I59 A;  4FE7 A;  2UXX A;  4UUS B;  3HOS A;  1R7J A;  3EUH C;  3SXY A;  3DV8 A;  3OYL A;  4DYQ A;  2WWY A;  4F55 A;  2IS1 A;  3JRE A;  4CSW A;  4P9U A;  4KFC A;  5ICG A;  3ZQL A;  3GZ6 A;  1RUO A;  4BL0 B;  3L2Q A;  5HLI A;  3H9G A;  1D8K A;  3GW2 A;  4D9J A;  4JK1 X;  3OSF A;  2QSF X;  2WY7 Q;  5J47 A;  2B0L A;  1GT0 C;  5K5R A;  3BJ6 A;  4KT6 A;  2HXO A;  3FF5 A;  4PFO A;  3L7W A;  3AFH A;  4M72 A;  4HNU A;  3OYH A;  1A36 A;  2M2E A;  1XN7 A;  2EA4 A;  2K3P A;  4HF0 A;  2ZNY A;  3B6A A;  3VYU B;  2Q8K A;  1T39 A;  2DA4 A;  4CYC B;  4MIM A;  2B63 J;  2VPL A;  5JLX A;  2KQR A;  5D5V B;  2HKX A;  4KIC A;  1J5Y A;  3CUQ B;  1R36 A;  1EF4 A;  3FIS A;  4O6J A;  4EM1 A;  3IH2 A;  3KEQ A;  2HYJ A;  2BXZ A;  1JTY A;  4BXF A;  2W57 A;  2XAS A;  4R1H A;  1D3Y A;  4ENN A;  4A3I J;  4C3J J;  5CVJ A;  1JUS A;  1FOX A;  2PEX A;  1J0R A;  3F8N A;  3TP0 A;  3R60 A;  3MKZ A;  3GLX A;  2D1H A;  4G6T B;  1NK3 P;  3E97 A;  5HVQ C;  1KON A;  1UST A;  1YIJ I;  3DTE A;  4N9I A;  2KIQ A;  4PJJ A;  1X3W B;  2LMD A;  4M9Z A;  2BGC A;  2LDU A;  3KP4 A;  1LFP A;  5CQE A;  2HVR A;  3ASN H;  4ETS A;  1SFE A;  2ELJ A;  1NTC A;  4ZZD A;  4M6Y A;  2XPW A;  3BTL A;  2J5O A;  3OL3 A;  5J8C A;  2W7N A;  4JQF A;  3J7A Y;  1K78 B;  4D7M A;  2XGD A;  1RR7 A;  2V9P A;  3FDY A;  1O3Q A;  5GPA A;  2HNH A;  4AYB N;  4BE1 A;  4Y15 A;  3COA C;  3ERM A;  3ISP A;  4II3 A;  3G4S I;  2OTL I;  4KT5 C;  2HU9 A;  3K2A A;  4XRS A;  2M8E A;  5E3M A;  1HW5 A;  2FEZ A;  5IT9 K;  3HOX J;  1WI3 A;  2L01 A;  2B7E A;  3S16 J;  2R7V A;  1EH6 A;  2PFB A;  4ZTF A;  6PAX A;  1IF1 A;  2OU2 A;  4BY1 J;  4RS8 A;  4YEL A;  1XGM A;  3IWF A;  4G12 A;  3G73 A;  1OR7 C;  2H8R A;  3IRR A;  3CCV I;  4H0E A;  2VBZ A;  3S3N A;  2XAG A;  1U8B A;  4A6E A;  1Y39 A;  3OIP A;  3PNY A;  1VFC A;  5E8I A;  4AYB A;  2HKO A;  1HBX G;  4I99 C;  3PQK A;  4ZYH A;  5LBQ A;  5DM7 F;  2VN2 A;  1WH7 A;  3W2V A;  2X6Y A;  4ITV A;  1D5Y A;  3EDP A;  2VUM J;  1L0O C;  2V26 A;  3I53 A;  4O3M A;  2Y48 A;  2QF7 A;  1E3O C;  1MMD A;  1QZE A;  3E3V A;  5DYM A;  1G3Y A;  3BTC A;  2E36 A;  5DUK A;  2ETH A;  1JKP C;  4UUV A;  3AG2 H;  3D5R C;  1DGR M;  1DPU A;  3PIP F;  2NXN B;  3ONQ A;  1WVR A;  4ENM A;  2VJ4 A;  3E5U A;  3GBG A;  4UB6 C;  3IL2 A;  1H89 C;  1NK2 P;  3JRC A;  2MSY A;  4B44 A;  4IL6 C;  3F0C A;  3I55 I;  2LKP A;  3CCR I;  3VSK A;  3P9I A;  2P8T A;  4LK0 F;  5K7F A;  4RB3 C;  2EV0 A;  4U0Y A;  1I39 A;  1O7L A;  2A5W A;  4CA0 A;  3RTR A;  1ZQ3 P;  5H2F C;  2HS5 A;  5A2Q Z;  2HTS A;  1R23 A;  5AIQ A;  4HX8 A;  2F5C A;  2HGC A;  3CC4 I;  5FGM A;  1TW2 A;  3K4M A;  2WC2 A;  3L09 A;  1DPR A;  1O4X A;  3DWL E;  3X2Q H;  3J81 Z;  1IW7 F;  1WJD A;  3E6M A;  3JRF A;  3PUF A;  1WJE A;  4XKW A;  2V1U A;  4A12 A;  3GTQ J;  4CCO A;  4XIC A;  3GF2 A;  3CMA I;  4BQO A;  2DK8 A;  2GM4 A;  1FC3 A;  1MMG A;  2IGK A;  4P9F A;  2L2O A;  3PSI A;  4KMF A;  1XGN A;  1ZRF A;  2ZKZ A;  5C3E J;  2XB5 A;  1F43 A;  2IT0 A;  2L9N A;  3FBN B;  3Q3S A;  2KKO A;  1BL0 A;  1BJA A;  2DT7 B;  3C18 A;  4I7H A;  2EZH A;  3I4P A;  5FD6 A;  1Z67 A;  3ML6 A;  1OR7 A;  1R5I D;  3FXR A;  4HST A;  3BR2 A;  2CMP A;  3JRD A;  2EQR A;  3ZMZ A;  4LG3 A;  2CGP A;  4WK8 F;  2R7S A;  3CLO A;  5M3F J;  1TW3 A;  1MBK A;  1HKQ A;  2ZBK A;  3M8J A;  3CMY A;  4BE0 A;  3PM1 A;  3VFZ A;  1UFM A;  2DOD A;  4EJT A;  1FJL A;  3RKW A;  5IOZ A;  2AXT C;  2VON A;  1MD0 A;  2L02 A;  1AKH A;  1G6N A;  3HIF A;  1J59 A;  1JHH A;  3LA3 A;  2MLK A;  1YFH A;  3GLL A;  3M1C A;  3HC7 A;  2HVQ A;  2R5Y A;  2LY9 A;  3AG1 H;  1A6I A;  2M9H A;  2V6C A;  3LAJ A;  5J1U A;  3HL2 A;  4LJZ F;  4NNJ A;  3KYD B;  5DCF A;  2E2I J;  3K4N A;  2OZ6 A;  2ZJQ F;  2CV1 A;  1SMY F;  3H35 A;  2LSO A;  3DKY A;  3EYI A;  4AC0 A;  3JRG A;  4N9H A;  3FK6 A;  3LL7 A;  1T33 A;  2EJR A;  5TIS C;  1MBJ A;  4BS9 A;  2PLY A;  3SDB A;  4W97 A;  1Z91 A;  5DTD A;  5BOX A;  4IHY A;  5EDN A;  1JUP A;  1R58 A;  1X3U A;  2XGX A;  3T0Y A;  2M0M A;  1E3P A;  2RQQ A;  4UVB A;  1WJC A;  3O3K A;  4A2U A;  2EFW A;  3ERE D;  1AHD P;  1UHS A;  2Z2S B;  2CQK A;  4QWQ A;  1ODD A;  4E7L A;  1HST A;  4A3F J;  3VOD A;  3ASO H;  3LQQ A;  1SFK A;  3IHU A;  2CV2 A;  2L7K A;  2RN7 A;  3DEE A;  3H0D A;  2QBY B;  2NVY J;  1MW7 A;  3LNQ A;  3KPH A;  3W3C A;  5D4R A;  2PJR B;  3HOV J;  1S9H A;  1EKE A;  3ZMT A;  2LG4 A;  3K69 A;  4LB6 B;  4A3B J;  1A04 A;  3HPG A;  2MC3 A;  2QCO A;  3QP6 A;  3HTS B;  1P4A A;  3O2P E;  2VBW A;  4U7B A;  4IOA F;  2NS0 A;  3RKY A;  2E1O A;  1ETQ A;  1F9N A;  4FX0 A;  3VDX A;  3BOQ A;  2KP6 A;  2KIU A;  1U78 A;  5IT9 Z;  2IBD A;  2E60 A;  1ETV A;  3WE3 A;  1CGP A;  2ACJ A;  1X1C A;  3C7J A;  3ZR8 X;  1XCV A;  3PO2 J;  3A03 A;  2IJL A;  3F21 A;  1FOW A;  3DPU A;  4BYY A;  1W0T A;  3U2R A;  1Z1D A;  4XID A;  3FXM A;  1V3F A;  2DMN A;  1ACI A;  3WOD F;  1KU3 A;  5JLW A;  3MVP A;  2JPC A;  1U2W A;  3U9G A;  3OYG A;  5LEK A;  1XTA A;  2P7V B;  1T6S A;  5LRR A;  4GDF A;  1X4P A;  3QOD A;  4KJZ A;  4EM0 B;  1ZR2 A;  3WGG A;  2ZO4 A;  3I5U A;  3ZMS A;  3JRI A;  3ZOB A;  5GAG J;  5BS6 A;  2RDP A;  2Y69 H;  4A6D A;  3ABM H;  2XV4 S;  1K4S A;  4HW0 A;  2DMQ A;  3DLA A;  3A1Y A;  1BI2 A;  2Z3Y A;  3JAM K;  2E1N A;  3M07 A;  3MAJ A;  4Y3O A;  4B47 A;  1STZ A;  5L3D A;  4CXF A;  3LAP A;  4M9S A;  1GVD A;  4ZYG A;  1R4M B;  3GX4 X;  1WCM J;  3HXL A;  2W00 A;  2QKL B;  3U1K A;  2TDX A;  1FIP A;  1QO0 D;  1NH3 A;  2XVC A;  1XDU A;  2VKD A;  1BA5 A;  5JI6 A;  1ZGA A;  4D0P A;  1IO2 A;  3FMQ A;  3DQV C;  5IP7 J;  1YQA A;  4LIV A;  2X6W A;  3KYL A;  2P5K A;  3BDD A;  3UNG C;  4BJT A;  3DU5 A;  5ERI A;  5FRM A;  3MD2 A;  3W6V A;  2R5Z A;  1OMI A;  2O6G E;  2DA5 A;  5HS9 A;  5BPD A;  1ON1 A;  2BW3 A;  3FKJ A;  1APL C;  2L7Z A;  2M7B A;  4CZC A;  2R93 J;  2CUJ A;  4BGD A;  2IRF G;  5K7Z A;  2JRT A;  2ELH A;  4U0V A;  3PSF A;  2JA2 A;  3TL4 X;  1AKH B;  2JSP A;  1S29 A;  2IW5 A;  3RQI A;  3B6C A;  2R5Y B;  1YRN B;  4EAT A;  2XAH A;  4FT8 A;  4WX9 A;  4L0Z B;  2EK5 A;  3V7R A;  4BKX A;  1OCR H;  4II2 A;  3CUQ C;  4FTH A;  3C2G A;  3B73 A;  1FBQ A;  3BCB A;  4P1W A;  2VQH A;  2GWR A;  4X0G A;  4A0X A;  1TWC J;  2ID3 A;  3DEW A;  3TGN A;  2TCT A;  3G1O A;  2X4H A;  2Z9O A;  1JGG A;  2QEN A;  2HQR A;  1KYZ A;  4C30 A;  3HOU J;  2P0W A;  4HNV A;  2NS8 A;  1LE8 A;  1A6Q A;  2M0C A;  4Y52 J;  1T56 A;  3RQ4 A;  1MMA A;  3GZ5 A;  1H8A C;  3NRV A;  2DK5 A;  4AIJ A;  2Q2E B;  5TJJ A;  2ZXH A;  4C2M J;  3RZD J;  1KU9 A;  3GTL J;  2ZSI B;  4S04 A;  3MKL A;  1R4N B;  4B8X A;  3HYI A;  1S7E A;  5M5Y J;  1XC5 A;  4KIT B;  3SEZ A;  3R6S A;  1TL8 A;  3HPH A;  2FNA A;  4EV0 A;  1MZB A;  2K27 A;  4F92 B;  1FOY A;  2CW0 F;  2QA4 I;  3VYR B;  2I5U A;  2IXS A;  1SAU A;  1XPX A;  3S2D J;  2HDW A;  4MNU A;  2QUF A;  2DFE A;  3LSR A;  4CDG A;  1IAW A;  3F22 A;  2VKH A;  5EGO A;  5FFX A;  1I3A A;  4JYK A;  2PG4 A;  1ZAO A;  2E35 A;  3AL0 C;  2JRM A;  4DZJ A;  1QVU A;  1VZ0 A;  2MC4 A;  3KP3 A;  5E3N A;  1SEU A;  1J7K A;  2R7O A;  3GFM A;  3MKW B;  2CW7 A;  3K1M A;  2L4M A;  1JGS A;  3GFL A;  4P55 A;  4Y13 A;  3RPU A;  1FMV A;  4LIT A;  1K6O A;  3CME I;  4B3A A;  3S8P A;  3GTM J;  2O0Y A;  2RNJ A;  1GDT A;  2Y31 A;  3WG9 A;  2Q0O A;  3BRO A;  4IXA A;  2LK2 A;  3NEU A;  4QLC U;  1T95 A;  5GTH C;  4L9J A;  3E1S A;  1Z77 A;  2COB A;  3BG5 A;  3WTS C;  1BI3 A;  3ECH A;  4DBR A;  4CYC A;  5D8L B;  3FXK A;  1YJN I;  3CDH A;  3ABT A;  4N4O B;  4XN3 A;  5H6Q A;  3LFK A;  2GOX B;  2M34 A;  2ID6 A;  4I2O A;  3WE2 A;  4QSH A;  2DA1 A;  1MNM C;  2LF8 A;  4IHT A;  3L2W A;  3V7C A;  3L2U A;  1MSE C;  1TLH B;  4AVP A;  4IQ4 A;  2IPQ X;  1IUY A;  4OIO F;  1EA3 A;  2BEO A;  1IDZ A;  1IUF A;  1YX3 A;  3S1R J;  3DU6 A;  3CUO A;  4HOB A;  3TBI A;  5K7H A;  1VND A;  4JBA A;  2OQR A;  2UZK A;  1ITY A;  1LDK B;  1ULY A;  1X3Z B;  3M8E A;  2DBB A;  1JKQ C;  3M3Y J;  1SD5 A;  2R5Z B;  2PBI A;  3WGI A;  5D5X B;  5EYR A;  3JAM Z;  2DA7 A;  2D5V A;  4JX4 A;  1G59 A;  4E4H A;  3TW7 A;  1XMK A;  1MMN A;  4RB0 A;  4IZZ A;  2VBY A;  2V1X A;  1X1D A;  1IN4 A;  1P6R A;  4JX5 A;  2AQE A;  2L7M P;  1GUU A;  4G9Y A;  1K78 A;  1D0Z A;  3KZI C;  1VQ5 I;  4E7H A;  3WG7 H;  3TQN A;  5M3M J;  4L5I A;  3ZRG A;  2CQX A;  2CUE A;  3BQY A;  1F36 A;  3LFU A;  1YJW I;  4AM3 A;  4ASN A;  1QVT A;  1K4T A;  2AHQ A;  4ZDL A;  2WA0 A;  1TC3 C;  3GEZ A;  2Y75 A;  4DGW B;  2XAU A;  2CRG A;  2HDC A;  3W2W A;  4C3H J;  4OMY A;  4CO8 A;  3OL4 A;  2VKV A;  3GTK J;  1J2X A;  3CCJ I;  4G8X A;  4XSZ F;  1ZRC A;  1Q1H A;  1E2X A;  1BN5 A;  4Q4Z F;  1SAX A;  2KZV A;  2O3F A;  3CJR B;  5KAF C;  1HOM A;  4O5V A;  4BEH B;  1NHA A;  1MNE A;  2P4W A;  2VXZ A;  5LRS A;  1SC7 A;  2F2E A;  2VB6 A;  3BPX A;  1S7A A;  3I64 A;  5DDG A;  2WV1 A;  4HPQ A;  5A2Q K;  1LVA A;  5ED4 A;  1YHQ I;  3QPL A;  1IXR C;  2P6T A;  4B4C A;  1Y8Q B;  1GLN A;  2L54 A;  5HOD A;  1WZ2 A;  2ICW G;  4LOC A;  2X1D A;  3MFK A;  1ORK A;  4PGH A;  4XLN F;  3JRB A;  3QRF F;  2WB1 A;  2HZD A;  2KDZ A;  3B02 A;  2F48 A;  2NVX J;  2F4I A;  3BC8 A;  1EH8 A;  3CTA A;  1LDD A;  1D0Y A;  2DTR A;  2BY2 A;  1IRF A;  1D1A A;  3DEU A;  2JZY A;  5TGT A;  1OPC A;  2OTJ I;  3FX3 A;  2E34 A;  2FBK A;  1Y1W J;  2FE3 A;  4EJW A;  2DOF A;  3GXO A;  4S0H B;  2A5Y B;  3E6C C;  3TED A;  5CPR B;  2PQ8 A;  5L3F A;  3L00 A;  1S8N A;  3KE2 A;  3BR0 A;  4NB5 A;  1IXC A;  4AIK A;  4A3L J;  2W85 A;  4GYG A;  4HV5 A;  3KZY A;  2E1M B;  2YX7 A;  1TBX A;  2YS9 A;  3ZGK A;  1SD4 A;  4LK1 F;  1Z0X A;  3JSO A;  4CCJ A;  5EF6 A;  2M87 A;  2ESH A;  3S1N J;  3R4K A;  1T98 A;  3FWE A;  1IC8 A;  3K7A J;  1GVJ A;  4M6V A;  1Z9C A;  4C9Y A;  3FMS A;  3A01 B;  2MW8 A;  4GRI A;  4C3I J;  3OS2 A;  2BY1 A;  3KYC B;  4GYI A;  1UAA A;  5DD4 A;  2K9M A;  4WF2 A;  1W5T A;  1MMS A;  5LGN A;  1V5G A;  3FM5 A;  2X6X A;  2BZT A;  3PL8 A;  1W7P A;  4PSX A;  3OYN A;  3GTO J;  3SEQ A;  5DS9 A;  1BIB A;  2XRL A;  4J00 A;  3SQN A;  1G3S A;  1MKM A;  4A0Z A;  4M3F A;  1POG A;  1GHC A;  5HLH A;  2O8K A;  3OSG A;  1CF7 A;  1T38 A;  4EJV A;  3SZP A;  4A5M A;  5EJC A;  1U5T B;  4KYW A;  2CS3 A;  1RES A;  4HDV A;  4OIP F;  4LIU A;  3M1E A;  4CIC A;  5IP9 J;  2LOO A;  2PX9 A;  4F7Z A;  2EH3 A;  1IRZ A;  3FZV A;  3L2R A;  3CQZ J;  3K4K A;  3M9A A;  3TMO A;  4UY8 I;  3TOA A;  2LR8 A;  3HB9 A;  2FA5 A;  2MH2 A;  3K4J A;  2DO7 A;  1C0W A;  3M7G A;  3QYB A;  3OYM A;  2JJ7 A;  1QHH D;  2R7X A;  4CUG A;  1OCZ H;  4D1Q A;  2AS5 F;  2PN6 A;  1NG7 A;  2RAE A;  1D1C A;  1JE8 A;  1HF0 A;  3LSJ A;  4MFD A;  3DBR B;  1SVM A;  2EZL A;  2HXI A;  2Z16 A;  3EET A;  3F8F A;  1QU3 A;  5HDG A;  5AON A;  1UG0 A;  5H6R A;  2WAD A;  2X1E A;  4L5E A;  4BDY A;  3BZK A;  3K70 D;  4F3Q A;  5EEH A;  3PO3 J;  3MCZ A;  1UZC A;  4MLO A;  1QQI A;  4RDU A;  1XCB A;  1AA7 A;  5FO5 A;  4AID A;  3RZO J;  1P7I A;  3G1M A;  3VYT B;  5GAH J;  2ECB A;  3K4B A;  3R0A A;  2JA8 J;  2P5L C;  2LY2 A;  1ON2 A;  4RAF A;  2XRO A;  4HDU A;  2WV0 A;  5B3S H;  1FIA A;  2CJJ A;  1RIO H;  1ETO A;  2ME6 A;  4A3M J;  1IG7 A;  5F64 A;  5IPA A;  2NRA C;  2QBY A;  4MEX F;  4M3B A;  2LP0 A;  2V9V A;  1S72 I;  1V55 H;  2PJR A;  2J5P A;  1SFO J;  2JA7 J;  4MQV A;  1IZ1 A;  1V4R A;  2FQ3 A;  3I9V 2;  2UV1 A;  1TWF J;  2AXL A;  1FMW A;  1NG6 A;  5F04 A;  1GXP A;  3K4L A;  3G71 I;  4CGZ A;  2OAZ A;  4QIW N;  3I4N J;  2LC2 A;  4XKV A;  2ZC2 A;  1MBF A;  1TQM A;  3CP2 A;  2HYG D;  3S15 J;  4A93 J;  1IXS B;  3MQ0 A;  5F27 A;  2LVS A;  3MWM A;  3H92 A;  4DQ2 A;  1J9I A;  1JT6 A;  1BBY A;  3Q0W A;  2XAF A;  1VTN C;  1X2M A;  3WTX C;  1XG1 A;  2EIM H;  2K40 A;  5JHF A;  3SYT A;  1H88 C;  3BCA A;  3GO5 A;  3H3Z A;  1BJZ A;  3CCE I;  3MKY B;  2CV0 A;  1HDP A;  3ABU A;  1QPI A;  5C4X J;  2N8G A;  3QPT A;  2HEO A;  2O5R A;  4OIN F;  3H9J A;  3P7N A;  4A0Y A;  4LB5 A;  3BTJ A;  3AKZ A;  2K85 A;  1Z3X A;  4A3K J;  3N05 A;  2KLO A;  3BZ6 A;  4DNC A;  2OD5 A;  2GAU A;  1ZGJ A;  4M73 A;  4LLN A;  1Z3Y A;  4HAM A;  3ZN1 A;  5ILV A;  2ISY A;  2RVC A;  3GZN B;  2NVU B;  1WJB A;  1X4O A;  4CCL A;  4PDK A;  1WPK A;  4WWC A;  4ANJ A;  2IAI A;  2G7U A;  4BY7 J;  1W7P B;  2V1D A;  3BT9 A;  4BXU A;  2ZME B;  4KNY A;  4N0B A;  1JT0 A;  2PJP A;  4HX4 A;  3Q0U A;  2L3D A;  1WQ2 A;  5HNF A;  1A35 A;  3MN2 A;  3OYC A;  1ZK8 A;  3JTG A;  1CF7 B;  3HBL A;  1RUN A;  2QVO A;  2GXB A;  2MH9 A;  5D6F A;  2A3S A;  2DMT A;  3JTH A;  1YYV A;  2OUM A;  3O6B B;  3L2V A;  1W5C C;  1Z7U A;  2AO9 A;  2IGN A;  2XUB A;  3QYF A;  5F0C A;  2EFO A;  4G6D A;  5EEG A;  4Z6Y A;  2HPI A;  3UKG A;  1WJF A;  5JVG F;  3VEP A;  3FXO A;  4MGR A;  1ZN2 A;  2X6O A;  4L9V A;  3TDZ C;  1WKM A;  5L3G A;  2DPD A;  1FWZ A;  1R5H A;  1XB4 A;  2HQA A;  3LOC A;  4RAY A;  3P5J A;  2DMU A;  1Q1V A;  2VQG A;  4LD5 A;  4XNF A;  1H9T A;  3KLO A;  3S3O A;  2QQ9 A;  4IHW A;  3CJQ B;  4I76 A;  4KUM A;  2W82 A;  3DTK A;  3OYF A;  2XC7 A;  3MZH A;  2M1B A;  1OKR A;  1YE9 A;  5FKM A;  3I54 A;  5HNH A;  1J75 A;  2DTZ A;  1PP7 U;  3V8J A;  1BR4 A;  1SFX A;  2DA3 A;  4QPO A;  4HX7 A;  4AIH A;  2NAZ A;  4DW6 A;  4RGX A;  2DLL A;  4J01 A;  2VJJ A;  2BVM A;  1I6H J;  5LGT A;  1QZY A;  2O03 A;  2M4G A;  4EEF G;  3RKX A;  2WTE A;  4CH7 A;  2DT5 A;  2G7H A;  4YRV A;  2ZJP F;  1XX5 A;  1UHW A;  4J19 A;  5CVU A;  1UCR A;  2GQQ A;  2P81 A;  3FBI B;  3RYR A;  4IRI A;  3OWT A;  2Q2E A;  4D7N A;  2ZXW H;  4ZJZ A;  3WTW C;  1FYL A;  4GCV A;  4HF2 A;  4G7Z F;  3GCM A;  1N75 A;  2QSH X;  3KIO A;  3OY9 A;  4BBR J;  4FAS D;  2DN0 A;  3PFY A;  4PK4 A;  1U6G A;  3GFJ A;  3RPQ A;  3DBH B;  1I50 J;  3SZT A;  3CO6 C;  3DLL F;  2QQ8 A;  4AWX B;  4UV8 A;  5B5E C;  1MDM B;  4E7I A;  3BQZ A;  4BAC A;  1BIA A;  3K1P A;  3JW4 A;  4XOP A;  5GAE J;  5ICC A;  3H3V K;  3JRA A;  2QSG X;  3SDG A;  4E7Z A;  5L3E A;  3HRS A;  4RM2 A;  2K3F A;  3BZC A;  1PUE E;  1IN8 A;  2A6T A;  1QA6 A;  4HV6 A;  4RM3 A;  1G3W A;  1FZP B;  2OA4 A;  1DU0 A;  2L5Q A;  2ADU A;  2CG4 A;  3GTJ J;  4XQF A;  1TQI A;  2Y9Y A;  2GOM A;  4DBQ A;  2JVG A;  3C1D A;  2GBY A;  2KJC A;  2O9L A;  2QWW A;  5K5O A;  4DIQ A;  3E5Q A;  3IH3 A;  4IEJ A;  2EWN A;  4RBO A;  3QAH A;  3JCU C;  1MSF C;  1Z6R A;  5ICF A;  3D1N I;  4OOI A;  4XL9 A;  5GPC A;  3BWG A;  1IN7 A;  2KIS A;  3AG4 H;  5CVV A;  2E71 A;  2EPF A;  3IH4 A;  2BOL A;  2X9D A;  4G6Q A;  2LY1 A;  3CCM I;  1XS9 A;  1XMX A;  2V7F A;  1D0X A;  2RV8 A;  1IN6 A;  3OOU A;  1DDN A;  3QYE A;  1WRJ A;  3F6V A;  3MZ8 A;  1QNT A;  5C44 J;  1VQ7 I;  2VBX A;  5CVR A;  3V8K A;  3A4C A;  5E18 F;  2H27 A;  3HOT A;  3BG9 A;  2A61 A;  3E7L A;  4UUT A;  2MYS A;  3GUD A;  2X1C A;  3BG6 A;  5DM6 F;  5BNG A;  3DXJ F;  4I09 A;  5CQG A;  4KIS A;  2E1M C;  1HCR A;  4V2F A;  4E70 A;  2GA2 A;  2DU9 A;  1XDS A;  2NOJ B;  3K10 A;  4R79 A;  1AOY A;  4DOZ A;  3V4G A;  5FFZ A;  2GLO A;  3ZQH A;  5HS8 A;  2EBI A;  3D5L A;  1R1V A;  5F6F A;  1KQ0 A;  1VQ9 I;  2HOE A;  1BC7 C;  4FQG A;  4H4K C;  4YIF A;  2CQ7 A;  4RLQ A;  1SD6 A;  1M1E B;  2W84 A;  3HHG A;  2LYC A;  2H09 A;  1IV8 A;  2RRE A;  1BM9 A;  2BHZ A;  4NC6 A;  1WFX A;  4E7S A;  4AUX A;  1U3E M;  1BOA A;  2FBI A;  4X1E A;  4I0B A;  5GTI C;  4Y7N J;  2H8W A;  2GA1 A;  3KLN A;  2W1O A;  3A0H C;  3HZJ A;  4EVI A;  2CUF A;  1TTY A;  2M7A A;  2Y9Z A;  1WJ5 A;  2W24 A;  4AVZ A;  5ICE A;  2K5C A;  1W0U A;  2L0K A;  5EG0 B;  2VLA A;  1VQL I;  4V19 K;  2Z99 A;  1UB9 A;  3VOE A;  1R71 A;  3HGY A;  4G7H F;  2XRN A;  4OU0 A;  4A3J J;  3GWZ A;  1U5T C;  3ABK H;  3HRM A;  5FB2 A;  4WCG A;  4B1R A;  4E7K A;  1FEX A;  4BEH A;  5J1R A;  2A6H F;  2FNP A;  3BG3 A;  2BXY A;  5F0H A;  4KIF A;  2K4B A;  3CJN A;  1YW8 A;  4LLG F;  3CDI A;  4XLH A;  1YO5 C;  4WXD A;  3IAS 2;  3QPH A;  4DYC A;  5AIP A;  4BJ5 C;  1D1B A;  3SFZ A;  2YR2 A;  1ZHF A;  1YRN A;  4ON0 A;  2E2H J;  4PJL A;  1YS7 A;  2ZSH B;  4NUB A;  2GZW A;  2MD5 A;  5GAD J;  5LHI A;  1LNW A;  3WTV C;  3KX2 A;  2OC6 A;  4HYE A;  2KRF A;  5DD8 A;  1S7O A;  5J40 A;  2FSW A;  1RKW A;  5LD2 C;  4ZYD A;  1FY7 A;  2EIJ H;  1KQ8 A;  3TO9 A;  1T8I A;  2BHY A;  3H36 A;  1VI0 A;  3RSN A;  1U9N A;  2QKM B;  1X1A A;  4MHG A;  5KHD A;  1LVK A;  4YIR X;  2DJN A;  1LB2 A;  1IN5 A;  1Y0U A;  4XR6 A;  2DA6 A;  3G3Z A;  3RJP A;  3HRT A;  2DQL A;  1MBG A;  1BW6 A;  2M30 A;  1K61 A;  1RZ4 A;  4KN7 X;  3CZ6 A;  3QU6 A;  1X2N A;  2F5F A;  2LFB A;  2F5D A;  5FLM J;  2QGU A;  1B72 B;  4I01 A;  3S2W A;  3I56 I;  1BR2 A;  2VC1 A;  4RMN A;  4XLC A;  3OIO A;  4QTR A;  4PJ0 C;  2HVS A;  2MLG A;  2YU3 A;  1ETY A;  2I8D A;  1WWX A;  2VJ5 A;  3MEX A;  3R61 A;  4MFE A;  3ZN0 A;  2G0E A;  3CF5 F;  1JJ6 C;  4IO9 F;  3Q5F A;  3A01 A;  2LBF B;  3ZXS A;  1KA8 A;  1XSV A;  2HPM A;  3LA7 A;  1FLI A;  2CQQ A;  3I3L A;  3ZMU A;  3LWF A;  4KIG A;  3RI4 A;  2NS7 A;  2NOG A;  3OYB A;  4D5F A;  1OYY A;  4XKC A;  2R7D A;  2VQL A;  5K1Y A;  1BR1 A;  5LHH A;  4XRS G;  1X1P A;  3CJT B;  4IKF A;  3FXQ A;  4CHU A;  2KIM A;  4GGG A;  4JX6 A;  2R7Z J;  3LSG A;  4XBF A;  4M74 A;  1P7J A;  4BBS J;  5FD5 A;  3NAR A;  1ZKG A;  3TO7 A;  4EM2 A;  4HNT A;  1U5T A;  4RGR A;  3HUG B;  5LLQ A;  3OYI A;  1MJB A;  4ZH4 F;  1OYI A;  1T08 B;  2XAJ A;  1LPQ A;  1REP C;  3WTY C;  4E7J A;  3IUO A;  2FMY A;  3C2B A;  2CUZ A;  2RKH A;  4LMY A;  2JA5 J;  2Q1Z B;  1FTT A;  1Y1V J;  3H5A A;  1KZH A;  2LF7 A;  1I5Z A;  2K9L A;  4U88 A;  2L7F P;  4PJN A;  4F91 B;  4IQJ A;  2STW A;  5EEA A;  2EZI A;  3HGG A;  4HSR A;  2FBH A;  1D5V A;  2FD5 A;  3FXJ A;  2XGC A;  5F08 A;  1I1S A;  5J6X A;  2FUG 2;  3HKZ N;  2BBY A;  3ZQ7 A;  2ZFW A;  5KNL A;  3BJO A;  1LFB A;  2JPB A;  2M45 A;  4MO7 A;  2R92 J;  1Z6T A;  2OZU A;  3J7A O;  3ROU A;  2KPM A;  3IC7 A;  4AU7 A;  1UHM A;  5KAI C;  4I98 B;  3OOP A;  1YIT I;  3HHH A;  3K9T A;  5L3C A;  4YG2 F;  4KA4 A;  1HKS A;  4BQN A;  3CP8 A;  4L9N A;  2PI0 A;  2KT0 A;  2UWM A;  2HOA A;  3KP5 A;  1D8J A;  2DAO A;  2KDO A;  2LRD A;  4RGS A;  1K79 A;  2HOT A;  1S5L C;  2MG4 A;  2WB1 N;  2JQ7 A;  1TWG J;  4XLP F;  3OYD A;  1FP2 A;  5H20 A;  4I02 A;  3HKZ A;  3CCU I;  3WHC A;  2IP2 A;  3IAM 2;  4Y4R A;  1FX7 A;  1O57 A;  3C2H A;  4E6K G;  3DTI A;  2PMU A;  3IKV A;  4TV7 A;  3ESW B;  5HLG A;  2JUC A;  3WHB A;  4IHV A;  2A69 F;  2NVQ J;  2M3A A;  3U1D A;  4C2T A;  4XRF A;  1R9T J;  2FX0 A;  1DP7 P;  2O8X A;  3QU3 A;  4CCK A;  1ZR4 A;  4K2E A;  1UEL B;  4V2G A;  5DCM B;  1QGP A;  4NHJ A;  1UJ8 A;  2DFI A;  3NQO A;  3SFI A;  2MBF A;  9ANT A;  3ZMD A;  4UNO A;  1AU7 A;  3GTP J;  4NDL A;  4ZYE A;  3LSM A;  4I6Z A;  1W36 C;  4RAG A;  1BC8 C;  1I1G A;  1ZH5 A;  1R49 A;  2NVT J;  1OCC H;  2D45 A;  1G2H A;  1ZG3 A;  2JT1 A;  3MZY A;  3SJM A;  3ZQQ A;  1KU7 A;  2UUZ A;  3DCF A;  1VF9 A;  2E7W A;  2DFH A;  3C3W A;  1Z7L A;  1KYW A;  2XPU A;  2VT2 A;  1B8I B;  3UR3 C;  4M3E A;  2FOK A;  2PMZ N;  3H3U A;  4Q5S F;  1O7F A;  2ZXI A;  3H1C A;  1YX5 A;  4ENJ A;  3HSF A;  2RC4 A;  1RR8 C;  3ELK A;  4R8H A;  3N4M A;  2VE8 A;  3OYK A;  2XB0 X;  5J4Y A;  3S14 J;  2BVL A;  1OQY A;  2M8G X;  2W4S A;  2ZME A;  4EMS A;  1RNL A;  2H6B A;  1FOK A;  2QQB A;  5FLX K;  2VI6 A;  1FTZ A;  2DT6 A;  4HLX A;  2LRE A;  4EQQ A;  2VL8 A;  2L9R A;  2PMZ A;  3BTI A;  3PNV A;  3S3M A;  4BQQ A;  4UB8 C;  2HQN A;  4D5C A;  1Z05 A;  2EV5 A;  2ZXJ A;  2QEX I;  1U8R A;  1UMQ A;  1DUX C;  2FML A;  2IVM A;  2DMP A;  3TKY A;  3S1M J;  3VYS B;  1TQP A;  4BJ6 C;  2R7W A;  2KRC A;  3M4O J;  4L5J A;  1H0M A;  3BG7 A;  4EGY A;  2K86 A;  1JHF A;  4PCQ A;  2D2W A;  2WAQ N;  3GVA A;  1RPW A;  2V79 A;  2FOW A;  5IT3 A;  4Y17 A;  1B6A A;  5BQT A;  1OJL A;  3KET A;  2R7U A;  1RRJ A;  5E3L A;  2BY3 A;  4GO1 A;  2VQC A;  3BR6 A;  4M9X A;  1ZYR F;  3EYY A;  1S6L A;  1ONV A;  2E5Z A;  4LFU A;  1SMT A;  1VQ4 I;  4BXX J;  1DU6 A;  2DDA A;  3HOY J;  4CYD A;  2LD5 A;  1RET A;  1PDN C;  3DPL C;  1HW1 A;  2GXA A;  2P5V A;  1YJ9 I;  2IEK A;  1TT5 B;  1MJA A;  2YUS A;  1ZLK A;  5FKO A;  4YFK F;  1Z21 A;  2CO5 A;  5J3L A;  1SFU A;  5D5U B;  2KJB A;  3VPR A;  4B48 A;  2WAQ A;  4BHC A;  2OQG A;  3KP6 A;  3RYP A;  3VB2 A;  1P92 A;  2MGQ A;  2E2J J;  3EUK L;  5CYV A;  1ZLJ A;  4HF1 A;  3CCS I;  1Y56 A;  2KRH A;  2VT3 A;  3FXL A;  4IOC F;  3HDD A;  1HC8 A;  3V7S A;  1PJR A;  1ZEL A;  4KMU X;  4IHX A;  1B59 A;  2CSO A;  4DZP A;  2LH9 A;  5B1A H;  3H5R A;  2YX4 A;  1T0F C;  1VQP I;  4PZJ A;  5LHG A;  5CJ9 A;  2XPV A;  1SVL A;  1YLF A;  2DXI A;  1WI9 A;  5K5Q A;  4LLL A;  2QQA A;  1ZAR A;  2JUG A;  2YU9 J;  4ENK A;  1Y6I A;  4MTD A;  3AL0 B;  4RAZ A;  2CFX A;  4CZZ A;  3EUH A;  1MDM A;  2A68 F;  3CC2 I;  3CDL A;  3CC7 I;  3ZQG A;  2VOO A;  1RI7 A;  4ESJ A;  1BI1 A;  4UVC A;  1WSU A;  2WBM A;  3G2B A;  2XKP A;  2R0Q C;  3RPU D;  1IRX A;  2LNB A;  2XKO A;  1ZRD A;  3OV8 A;  3BLY A;  3DF8 A;  1E3H A;  1BI0 A;  1X1B A;  3K2Z A;  4HZF A;  1JUM A;  1MGT A;  3HSE A;  1LFU P;  4A3C J;  4ZDP A;  1OYW A;  2DYS H;  2H94 A;  4NC7 A;  4LG0 B;  1ETK A;  2OPT A;  1YTY A;  1G3T A;  2K4J A;  5CLS A;  4Q48 A;  2RGV A;  1TT0 A;  4EJU A;  1H9G A;  3QWL A;  2B9S A;  2STT A;  3S93 A;  1FPQ A;  1W5S A;  2K9Q A;  1HW2 A;  2H6C A;  1HSJ A;  3QOP A;  1QRY A;  1FBS A;  2UXN A;  5F0F A;  2KFD A;  2HI3 A;  1YS6 A;  2XHK A;  1V54 H;  3KEY A;  3KZZ A;  1O3T A;  2DDB A;  4X6A J;  2EIL H;  3WU1 B;  4L0Y B;  2VIX A;  2EIN H;  3PJR A;  3I4M J;  3NWT A;  1R00 A;  2ZCW A;  1JJ8 C;  2QM3 A;  2KZG A;  4XOR A;  4BUP A;  3J80 Z;  3D5S C;  2WAE A;  1LEA A;  5FKL A;  1WH5 A;  3I59 B;  2K9N A;  2V6E A;  2QYO A;  3E6B A;  2XAQ A;  5FKN A;  2Y30 A;  2TRT A;  3ZPL A;  3HOW J;  1V5E A;  3OMY A;  2F4M B;  4ESB A;  1VQO I;  3A0B C;  2HFH A;  4PGG A;  3IKT A;  3LSI A;  3FHN A;  3MMY B;  5FJ8 J;  2HWV A;  1TNT A;  1ENH A;  2R7F A;  2F5E A;  3BR1 A;  2VXD A;  2KIF A;  2XF6 A;  2A07 F;  5FRN A;  2IS2 A;  4UV9 A;  4RA2 A;  4DJA A; 
#chains in the Genus database with same CATH homology
 2E7X A;  3Q9V A;  3P9K A;  3GYH X;  3W6K B;  1JXS A;  2DPU A;  1I6X A;  1T0F A;  3KCC A;  1FYM A;  4L9T A;  5F1R A;  5JFR A;  3KP7 A;  4ESF A;  1FT9 A;  4BAY A;  2Y0M A;  2NYX A;  4OIQ F;  3D0S A;  3DFG A;  2M5W A;  1R5G A;  3F6O A;  1F4K A;  1USS A;  4AD9 A;  5FLX Z;  1IRG A;  5E1W A;  4EGZ A;  1B9N A;  1XGS A;  4IF4 A;  3T5X A;  3RIR A;  2X0L A;  4BQA A;  2FF4 A;  4MEY F;  5E1X A;  2EFP A;  4KIB A;  5CVI A;  1EV7 A;  5D6E A;  3WU0 A;  2BE5 F;  3N97 A;  3F8M A;  1FSH A;  2JSC A;  4WXC A;  5DEQ A;  2ZNZ A;  3W6J B;  4BHB A;  3KEO A;  2CYY A;  1LQ1 A;  4M6X A;  3LA2 A;  3K1N A;  1MJ9 A;  1YG2 A;  3ULQ B;  2FRH A;  5E20 A;  1LJ9 A;  2IA2 A;  4RGU A;  2QLZ A;  3AAF A;  4EJO A;  4HQM A;  3JSP A;  4IRG A;  1K7A A;  4BNC A;  1KGS A;  4BH9 A;  4U0W A;  1AWC A;  1W7P D;  3EQL F;  4B09 A;  5BMZ A;  2Z5U A;  4HA8 A;  2EB7 A;  4WXH A;  2XIG A;  3BJA A;  4I0A A;  4YII A;  1EH7 A;  1ZG1 A;  3DKW A;  4P96 A;  1R22 A;  2VOP A;  2VE9 A;  2YPR A;  2Z33 A;  3ECO A;  2G9W A;  4RB2 C;  4G7O F;  4FHT A;  1T2K A;  1G4D A;  3TOB A;  5LGU A;  1YIO A;  2R3S A;  3HUG A;  4G94 A;  2COM A;  4HQE A;  3TO6 A;  3T8T A;  2EA2 A;  1XD7 A;  1P2F A;  3F72 A;  4IPA A;  5ILS A;  2ZJ2 A;  2PMH A;  1XSX A;  1L3L A;  3IRQ A;  3I0T A;  2BV6 A;  4NQW A;  1FSE A;  5D5W B;  1ZG5 A;  1B9M A;  2HTJ A;  3Q9S A;  1SD7 A;  5HDN A;  2RQP A;  2EFQ A;  2HYF A;  3I71 A;  1HKT A;  2A6E F;  3E6D A;  1LDJ A;  1HXD A;  2EV6 A;  2YSR A;  1XGO A;  4UXN A;  1QBJ A;  5KVR A;  3HSR A;  1FNN A;  3R0J A;  3K0L A;  2K02 A;  2QZ8 A;  4IRH A;  3QP5 A;  1B1B A;  3BP8 A;  1KQ9 A;  3WTU C;  4U7D A;  2ESN A;  2HR3 A;  2VC0 A;  3WTT C;  1B4A A;  4MTE A;  3CO7 C;  1YW9 A;  2OBP A;  2VOD A;  1QZZ A;  4P5O A;  3WTZ A;  1O3R A;  5DCM A;  3P9C A;  2GXG A;  3FXU A;  2CWE A;  3F23 A;  2C6Y A;  2FXA A;  3F8C A;  1O3S A;  4KDP A;  5HDK A;  4YFN F;  2E1C A;  1PP8 F;  3BPV A;  3GFI A;  4FX4 A;  1S3J A;  2HZT A;  4ZZL A;  1FYK A;  2W25 A;  2IA1 A;  5LEJ A;  5DUI A;  2NNY A;  5TRD A;  2L4A A;  4Z2Y A;  1GXQ A;  4IHS A;  5JHU A;  3T1B A;  3I58 A;  3FM3 A;  5L3B A;  4LGW A;  2JTV A;  2FU4 A;  4HBL A;  4S05 A;  1XSD A;  2ISZ A;  1LEB A;  1F1Z A;  3REO A;  4IVN A;  3TDU C;  4UHT A;  2D1V A;  3F3X A;  1R1U A;  3CUQ A;  5JVT A;  3KP2 A;  3L2C A;  1HQC A;  1F5T A;  3ZMV A;  3HRU A;  1KU2 A;  5E8G A;  2P7C B;  1E17 A;  1P4X A;  3WGH A;  3KFW X;  2BYV E;  5E17 F;  2O61 A;  3RDI A;  3LST A;  5JR3 A;  2NNN A;  5D8K B;  1R1T A;  1W4M A;  3V8L A;  4XSX F;  5KK1 A;  2EFN A;  4Q47 A;  4HLY A;  3FHZ A;  4IJA A;  5D4S A;  5BPI A;  3IWZ A;  3T8R A;  3HTU A;  1XMA A;  1TNS A;  4M71 A;  3DP7 A;  1YW7 A;  5E1Z B;  3DPT A;  4MQ9 F;  2DQR A;  3J80 K;  3SHF A;  1I27 A;  3M8F A;  4A5N A;  4RB1 A;  2K7L A;  4KN4 X;  4LG0 A;  3PFI A;  2DI3 A;  4L18 B;  3E5X A;  5HS7 A;  4GXO A;  1QPM A;  5J8F A;  5HOO A;  3BY6 A;  2MA3 A;  3J81 K;  1P4W A;  4OIR F;  4OMZ A;  2P6S A;  5DV5 A;  2GIV A;  3F8B A;  3L9F A;  1FBU A;  5ILU A;  3PQJ A;  4YFX F;  3ZP5 A;  3FMR A;  4BHP A;  1ZRE A;  1FP1 D;  3LQR A;  2IA0 A;  4UVA A;  2DW4 A;  3I59 A;  3HOS A;  2UXX A;  1R7J A;  2WWY A;  3SXY A;  3DV8 A;  4KFC A;  4P9U A;  5ICG A;  3GZ6 A;  1RUO A;  5HLI A;  1D8K A;  3GW2 A;  4JK1 X;  2B0L A;  5K5R A;  3BJ6 A;  3FF5 A;  3L7W A;  4M72 A;  1XN7 A;  2EA4 A;  4HF0 A;  2ZNY A;  2Q8K A;  1T39 A;  5D5V B;  2HKX A;  4KIC A;  1J5Y A;  3CUQ B;  1R36 A;  4O6J A;  4EM1 A;  3KEQ A;  2W57 A;  2XAS A;  4R1H A;  1D3Y A;  4ENN A;  5CVJ A;  2PEX A;  1J0R A;  3F8N A;  3R60 A;  3GLX A;  2D1H A;  3E97 A;  5HVQ C;  1UST A;  4N9I A;  4M9Z A;  2BGC A;  2LDU A;  3KP4 A;  4ETS A;  1SFE A;  4ZZD A;  4M6Y A;  2J5O A;  5J8C A;  4JQF A;  1K78 B;  1O3Q A;  4Y15 A;  3COA C;  3ISP A;  4KT5 C;  2M8E A;  1HW5 A;  2FEZ A;  5IT9 K;  2L01 A;  1EH6 A;  2PFB A;  6PAX A;  1IF1 A;  2OU2 A;  4RS8 A;  1XGM A;  3IWF A;  3G73 A;  3IRR A;  4H0E A;  2VBZ A;  2XAG A;  4A6E A;  5E8I A;  2HKO A;  1HBX G;  3PQK A;  4ZYH A;  5LBQ A;  2VN2 A;  3EDP A;  1L0O C;  3I53 A;  4O3M A;  2Y48 A;  3E3V A;  5DYM A;  1G3Y A;  5DUK A;  2ETH A;  4UUV A;  1DPU A;  4ENM A;  3E5U A;  3IL2 A;  2LKP A;  3P9I A;  2P8T A;  4LK0 F;  4RB3 C;  2EV0 A;  4U0Y A;  1O7L A;  3RTR A;  2HS5 A;  5A2Q Z;  2HTS A;  1R23 A;  5AIQ A;  4HX8 A;  2F5C A;  2HGC A;  5FGM A;  1TW2 A;  2WC2 A;  3L09 A;  1DPR A;  3J81 Z;  1IW7 F;  3E6M A;  2V1U A;  4A12 A;  3GF2 A;  2DK8 A;  1FC3 A;  4P9F A;  4KMF A;  1XGN A;  1ZRF A;  2ZKZ A;  2IT0 A;  2KKO A;  1BJA A;  3C18 A;  4I7H A;  3I4P A;  5FD6 A;  3ML6 A;  1OR7 A;  3FXR A;  3ZMZ A;  2CGP A;  4WK8 F;  3CLO A;  1TW3 A;  1HKQ A;  2ZBK A;  3VFZ A;  4EJT A;  1UFM A;  3RKW A;  2VON A;  1MD0 A;  2L02 A;  1G6N A;  3HIF A;  1J59 A;  1JHH A;  3LA3 A;  2MLK A;  1YFH A;  2V6C A;  3LAJ A;  4LJZ F;  5DCF A;  2OZ6 A;  1SMY F;  2LSO A;  3EYI A;  4N9H A;  2EJR A;  2PLY A;  1Z91 A;  5BOX A;  1R58 A;  1X3U A;  2XGX A;  3T0Y A;  4UVB A;  3O3K A;  4A2U A;  2EFW A;  3ERE D;  2CQK A;  4QWQ A;  1ODD A;  1HST A;  3VOD A;  3LQQ A;  3IHU A;  2RN7 A;  2QBY B;  5D4R A;  3ZMT A;  3K69 A;  4LB6 B;  1A04 A;  2MC3 A;  3QP6 A;  3HTS B;  1P4A A;  3O2P E;  2VBW A;  4U7B A;  2NS0 A;  3RKY A;  1F9N A;  4FX0 A;  3BOQ A;  1U78 A;  2KIU A;  5IT9 Z;  1CGP A;  3WE3 A;  2ACJ A;  3C7J A;  1XCV A;  2IJL A;  3F21 A;  4BYY A;  3U2R A;  1Z1D A;  1V3F A;  3WOD F;  1KU3 A;  2JPC A;  1U2W A;  3U9G A;  5LEK A;  2P7V B;  1T6S A;  5LRR A;  4EM0 B;  3WGG A;  2ZO4 A;  3I5U A;  3ZMS A;  5BS6 A;  2RDP A;  4A6D A;  2XV4 S;  4HW0 A;  1BI2 A;  2Z3Y A;  3JAM K;  2E1N A;  3MAJ A;  1STZ A;  5L3D A;  4CXF A;  3LAP A;  4M9S A;  4ZYG A;  3GX4 X;  2TDX A;  1QO0 D;  2XVC A;  1XDU A;  5JI6 A;  1ZGA A;  4D0P A;  3FMQ A;  3DQV C;  1YQA A;  2P5K A;  3BDD A;  5ERI A;  1OMI A;  2O6G E;  5HS9 A;  5BPD A;  1ON1 A;  2IRF G;  2JRT A;  2ELH A;  4U0V A;  1S29 A;  2IW5 A;  2XAH A;  4FT8 A;  4WX9 A;  4L0Z B;  2EK5 A;  3V7R A;  3CUQ C;  3B73 A;  1FBQ A;  2GWR A;  4A0X A;  3TGN A;  2X4H A;  2Z9O A;  2QEN A;  2HQR A;  1KYZ A;  3GZ5 A;  3NRV A;  2DK5 A;  4AIJ A;  5TJJ A;  1KU9 A;  4S04 A;  4B8X A;  3HYI A;  3R6S A;  2FNA A;  4EV0 A;  1MZB A;  2K27 A;  2CW0 F;  4MNU A;  2QUF A;  4CDG A;  1IAW A;  3F22 A;  5FFX A;  2PG4 A;  1ZAO A;  3KP3 A;  1J7K A;  3GFM A;  3K1M A;  2L4M A;  1JGS A;  3GFL A;  4Y13 A;  4P55 A;  3RPU A;  1K6O A;  2O0Y A;  2RNJ A;  3WG9 A;  2Q0O A;  3BRO A;  4IXA A;  3NEU A;  4QLC U;  4L9J A;  3WTS C;  1BI3 A;  3ECH A;  5D8L B;  3CDH A;  3ABT A;  5H6Q A;  3LFK A;  4I2O A;  3WE2 A;  2LF8 A;  4IHT A;  3V7C A;  1TLH B;  4AVP A;  2IPQ X;  1IUY A;  4OIO F;  2BEO A;  3CUO A;  4HOB A;  4JBA A;  2OQR A;  2UZK A;  1LDK B;  1ULY A;  3M8E A;  2DBB A;  1SD5 A;  2PBI A;  3WGI A;  5D5X B;  3JAM Z;  1XMK A;  4RB0 A;  2VBY A;  2V1X A;  1IN4 A;  1P6R A;  4G9Y A;  1K78 A;  3TQN A;  4L5I A;  4ASN A;  3GEZ A;  2Y75 A;  2HDC A;  4OMY A;  4CO8 A;  1J2X A;  4G8X A;  4XSZ F;  1ZRC A;  1Q1H A;  1E2X A;  1BN5 A;  4Q4Z F;  1SAX A;  2O3F A;  4O5V A;  1NHA A;  2P4W A;  2VXZ A;  5LRS A;  2F2E A;  3BPX A;  1S7A A;  3I64 A;  5DDG A;  5A2Q K;  1LVA A;  5ED4 A;  1IXR C;  2P6T A;  2L54 A;  3MFK A;  4PGH A;  4XLN F;  3QRF F;  3B02 A;  1EH8 A;  3CTA A;  1LDD A;  2DTR A;  3DEU A;  1IRF A;  2JZY A;  1OPC A;  3FX3 A;  2FBK A;  2FE3 A;  4EJW A;  3GXO A;  2A5Y B;  3E6C C;  2PQ8 A;  5L3F A;  3L00 A;  1S8N A;  3KE2 A;  4NB5 A;  1IXC A;  4AIK A;  2W85 A;  4GYG A;  4HV5 A;  3KZY A;  2YX7 A;  1TBX A;  1SD4 A;  4LK1 F;  3JSO A;  2M87 A;  2ESH A;  3R4K A;  1T98 A;  3FWE A;  1GVJ A;  1Z9C A;  3FMS A;  4GYI A;  5DD4 A;  4WF2 A;  1W5T A;  5LGN A;  3FM5 A;  1W7P A;  1BIB A;  3SQN A;  1G3S A;  1MKM A;  4A0Z A;  1GHC A;  5HLH A;  1CF7 A;  1T38 A;  4EJV A;  3SZP A;  4A5M A;  1U5T B;  4KYW A;  4HDV A;  4OIP F;  3M1E A;  4CIC A;  4F7Z A;  3FZV A;  3M9A A;  3TOA A;  2FA5 A;  2MH2 A;  2DO7 A;  1C0W A;  3M7G A;  2AS5 F;  2PN6 A;  1JE8 A;  3EET A;  3F8F A;  5HDG A;  5AON A;  5H6R A;  5EEH A;  3MCZ A;  1QQI A;  1XCB A;  5FO5 A;  3R0A A;  2P5L C;  1ON2 A;  2XRO A;  4HDU A;  2WV0 A;  1RIO H;  5F64 A;  2NRA C;  2QBY A;  4MEX F;  2V9V A;  2J5P A;  4MQV A;  1IZ1 A;  1V4R A;  2FQ3 A;  2AXL A;  1GXP A;  4CGZ A;  2OAZ A;  1TQM A;  2HYG D;  1IXS B;  3MQ0 A;  3MWM A;  3H92 A;  4DQ2 A;  1J9I A;  1BBY A;  2XAF A;  1VTN C;  3WTX C;  3GO5 A;  3H3Z A;  3ABU A;  3QPT A;  2HEO A;  4OIN F;  3P7N A;  4A0Y A;  4LB5 A;  3BZ6 A;  4DNC A;  2OD5 A;  2GAU A;  1ZGJ A;  4M73 A;  4LLN A;  4HAM A;  3ZN1 A;  5ILV A;  2ISY A;  2RVC A;  4PDK A;  4WWC A;  2G7U A;  1W7P B;  2V1D A;  4BXU A;  2ZME B;  4KNY A;  4N0B A;  2PJP A;  4HX4 A;  2L3D A;  1WQ2 A;  3JTG A;  1CF7 B;  1RUN A;  2QVO A;  2GXB A;  2MH9 A;  5D6F A;  2A3S A;  3JTH A;  1YYV A;  3O6B B;  1Z7U A;  2XUB A;  2EFO A;  4G6D A;  5EEG A;  3VEP A;  4MGR A;  1ZN2 A;  4L9V A;  3TDZ C;  1WKM A;  5L3G A;  2DPD A;  1FWZ A;  1R5H A;  1XB4 A;  4RAY A;  4LD5 A;  1H9T A;  3KLO A;  2QQ9 A;  4KUM A;  3MZH A;  2M1B A;  1OKR A;  3I54 A;  1J75 A;  1PP7 U;  3V8J A;  1SFX A;  4HX7 A;  4AIH A;  2NAZ A;  4RGX A;  2DLL A;  5LGT A;  1QZY A;  2O03 A;  3RKX A;  2WTE A;  2DT5 A;  2G7H A;  1UHW A;  5CVU A;  1UCR A;  2GQQ A;  3RYR A;  4IRI A;  2Q2E A;  3WTW C;  1FYL A;  4GCV A;  4HF2 A;  4G7Z F;  1U6G A;  3GFJ A;  3RPQ A;  3SZT A;  3CO6 C;  4AWX B;  4UV8 A;  1MDM B;  1BIA A;  3K1P A;  3JW4 A;  5ICC A;  5L3E A;  3HRS A;  1PUE E;  1IN8 A;  4HV6 A;  1G3W A;  1FZP B;  2OA4 A;  2ADU A;  2CG4 A;  1TQI A;  3C1D A;  2KJC A;  2QWW A;  5K5O A;  3E5Q A;  2EWN A;  3QAH A;  1Z6R A;  5ICF A;  4OOI A;  3BWG A;  1IN7 A;  5CVV A;  4G6Q A;  2RV8 A;  1IN6 A;  1DDN A;  1WRJ A;  3F6V A;  1QNT A;  2VBX A;  5CVR A;  3V8K A;  5E18 F;  2H27 A;  3HOT A;  2A61 A;  3GUD A;  3DXJ F;  4I09 A;  4E70 A;  2GA2 A;  2DU9 A;  1XDS A;  4R79 A;  1AOY A;  3V4G A;  5FFZ A;  5HS8 A;  3D5L A;  1R1V A;  5F6F A;  1KQ0 A;  2HOE A;  1BC7 C;  4YIF A;  1SD6 A;  2W84 A;  3HHG A;  2H09 A;  1BM9 A;  1U3E M;  1BOA A;  2FBI A;  4I0B A;  2GA1 A;  3KLN A;  4EVI A;  1TTY A;  2W24 A;  5ICE A;  2Z99 A;  1UB9 A;  3VOE A;  4G7H F;  2XRN A;  4OU0 A;  3GWZ A;  1U5T C;  5FB2 A;  3HRM A;  4WCG A;  2A6H F;  2FNP A;  4KIF A;  2K4B A;  3CJN A;  1YW8 A;  4LLG F;  1YO5 C;  4WXD A;  3QPH A;  5AIP A;  3SFZ A;  2YR2 A;  1ZHF A;  4ON0 A;  1YS7 A;  2GZW A;  2MD5 A;  5LHI A;  1LNW A;  3WTV C;  4HYE A;  2KRF A;  5DD8 A;  1S7O A;  2FSW A;  4ZYD A;  1FY7 A;  1KQ8 A;  3TO9 A;  4MHG A;  1LB2 A;  1IN5 A;  1Y0U A;  3G3Z A;  3RJP A;  3HRT A;  2DQL A;  2M30 A;  1RZ4 A;  4KN7 X;  3QU6 A;  2F5F A;  2F5D A;  4I01 A;  3S2W A;  2VC1 A;  2MLG A;  2YU3 A;  3MEX A;  1WWX A;  3R61 A;  3ZN0 A;  3Q5F A;  1KA8 A;  1XSV A;  3LA7 A;  1FLI A;  3ZMU A;  3LWF A;  4KIG A;  3RI4 A;  1OYY A;  2R7D A;  5K1Y A;  5LHH A;  3FXQ A;  4CHU A;  2KIM A;  4GGG A;  4XBF A;  4M74 A;  5FD5 A;  3TO7 A;  4EM2 A;  1U5T A;  4RGR A;  5LLQ A;  1MJB A;  4ZH4 F;  1OYI A;  2XAJ A;  1REP C;  3WTY C;  2FMY A;  2RKH A;  4LMY A;  2LF7 A;  1I5Z A;  4U88 A;  2STW A;  2FBH A;  1D5V A;  1I1S A;  5J6X A;  2BBY A;  3ZQ7 A;  2ZFW A;  3BJO A;  2JPB A;  2M45 A;  1Z6T A;  2OZU A;  3J7A O;  3ROU A;  3IC7 A;  1UHM A;  4I98 B;  3OOP A;  3HHH A;  3K9T A;  5L3C A;  4YG2 F;  4KA4 A;  1HKS A;  4L9N A;  2PI0 A;  2UWM A;  3KP5 A;  1D8J A;  2DAO A;  4RGS A;  1K79 A;  4XLP F;  1FP2 A;  5H20 A;  4I02 A;  2IP2 A;  1FX7 A;  1O57 A;  2PMU A;  3IKV A;  4TV7 A;  5HLG A;  2A69 F;  3U1D A;  4XRF A;  1DP7 P;  2O8X A;  3QU3 A;  4K2E A;  5DCM B;  1QGP A;  4NHJ A;  2DFI A;  3NQO A;  2MBF A;  3ZMD A;  4UNO A;  4ZYE A;  1BC8 C;  1I1G A;  1ZH5 A;  2D45 A;  1ZG3 A;  2JT1 A;  3MZY A;  1KU7 A;  2E7W A;  3C3W A;  1KYW A;  2VT2 A;  2FOK A;  3H3U A;  4Q5S F;  1O7F A;  4ENJ A;  3HSF A;  2RC4 A;  3ELK A;  4R8H A;  3N4M A;  2VE8 A;  2ZME A;  4EMS A;  1FOK A;  1RNL A;  2H6B A;  2QQB A;  5FLX K;  4HLX A;  4EQQ A;  2HQN A;  2EV5 A;  1Z05 A;  2ZXJ A;  1U8R A;  1DUX C;  2FML A;  2IVM A;  3TKY A;  1TQP A;  4L5J A;  1H0M A;  4EGY A;  2K86 A;  1JHF A;  4PCQ A;  2D2W A;  3GVA A;  2V79 A;  5IT3 A;  4Y17 A;  1B6A A;  5BQT A;  3KET A;  4GO1 A;  4M9X A;  1ZYR F;  3EYY A;  1S6L A;  1ONV A;  4LFU A;  1SMT A;  4CYD A;  1PDN C;  3DPL C;  1HW1 A;  2P5V A;  1MJA A;  1ZLK A;  4YFK F;  2CO5 A;  1SFU A;  5D5U B;  2KJB A;  4BHC A;  2OQG A;  3KP6 A;  3RYP A;  3VB2 A;  1P92 A;  5CYV A;  1ZLJ A;  4HF1 A;  2VT3 A;  3V7S A;  4KMU X;  1B59 A;  2CSO A;  2YX4 A;  4PZJ A;  5LHG A;  5CJ9 A;  1YLF A;  1WI9 A;  5K5Q A;  4LLL A;  2QQA A;  1ZAR A;  4ENK A;  4MTD A;  4RAZ A;  2CFX A;  4CZZ A;  3EUH A;  1MDM A;  2A68 F;  2VOO A;  1RI7 A;  4ESJ A;  1BI1 A;  4UVC A;  1WSU A;  2XKP A;  2LNB A;  2XKO A;  1ZRD A;  3OV8 A;  3DF8 A;  1BI0 A;  3K2Z A;  4HZF A;  1MGT A;  3HSE A;  1OYW A;  2H94 A;  4LG0 B;  1YTY A;  1G3T A;  2K4J A;  5CLS A;  4Q48 A;  2RGV A;  4EJU A;  1H9G A;  2STT A;  1FPQ A;  1W5S A;  1HW2 A;  2H6C A;  1HSJ A;  3QOP A;  2UXN A;  1FBS A;  1YS6 A;  2XHK A;  1O3T A;  3KZZ A;  3WU1 B;  4L0Y B;  1R00 A;  2ZCW A;  2QM3 A;  3J80 Z;  1LEA A;  3I59 B;  2QYO A;  3E6B A;  2XAQ A;  3ZPL A;  4ESB A;  2HFH A;  4PGG A;  3IKT A;  2HWV A;  1TNT A;  2R7F A;  2F5E A;  2KIF A;  2A07 F;  4UV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...