2LK2A

Solution nmr structure of homeobox domain (171-248) of human homeobox protein tgif1, northeast structural genomics consortium target hr4411b
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
MGHHHHHHSHMLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein TGIF1
publication title Solution NMR structure of homeobox domain (171-248) of human homeobox protein TGIF1, Northeast Structural Genomics Consortium Target HR4411B.
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lk2A01
5J1UA 1A5JA 1JKOC 1IG7A 3LNQA 2NS8A 2MW8A 4LOCA 2CU7A 4IEJA 4Y7NJ 3BR1A 4M3FA 2LFBA 3BTIA 3ZQCA 1ZQ3P 2COBA 2XPWA 4BY7J 1QPIA 3BR5A 3DEWA 3JRDA 1YRNA 3M3YJ 3A01A 3S17J 2EQRA 3K2AA 2VPRA 3O8GA 1RESA 4GFBA 1QRYA 2ZB9A 1JJ8C 3TP0A 2IAIA 1UHSA 3CDLA 5DS9A 1HDDC 4XRMA 3GTOJ 1BW5A 3S2HJ 1ZR2A 3JRBA 1ETXA 2NOGA 3BQYA 4V2FA 3JRIA 3M4OJ 3MKLA 4IHVA 2M0CA 2XPUA 4MFEA 1MBHA 2Y9YA 2E1OA 1W0TA 3BT9A 2JA5J 4D5FA 1XS9A 3GTJJ 2ID3A 3QPLA 1Q1VA 3B6AA 2K40A 1IV6A 2CUFA 4XK4A 5FLMJ 2EZLA 2GM4A 2CQXA 3NAUA 3Q0VA 3S1QJ 4B3AA 1JKPC 2R5ZB 1MNMC 3UKGA 5EGOB 1X2NA 1U78A 2K9NA 3BTLA 1TWAJ 1JT0A 1AU7A 3HOVJ 2LY9A 2DMNA 2DMUA 2OF7A 1H8AC 2NVXJ 2L7FP 5IOYA 5FJ8J 1MBFA 4W97A 1MSEC 3HEFA 2L0KA 1FIPA 2DMTA 3L1PA 2DMPA 3BR2A 2X6OA 4A3DJ 1JUSA 1IDZA 1APLC 1QVTA 4HNVA 3JRAA 5C4JJ 3TP3A 4B1RA 2DN0A 4Y52J 3S1MJ 3BR0A 2XB5A 4XICA 3MVPA 4J19A 5EDNA 2HQ5A 5GPCA 2TRTA 2R5ZA 2Y0SN 3E7LA 3LSRA 3OSFA 1U8BA 1TWHJ 3NARA 3A03A 4MO7A 1VF9A 2EZKA 5EGOA 3S1RJ 1BL0A 2D5VA 3CMYA 3IH4A 1K61A 3HOWJ 2Y31A 2PMZN 3O8HA 4FTHA 5J3LA 1JTYA 3ZQGA 5M5YJ 2DMQA 4AC0A 1GUUA 1K83J 2ECBA 3BR3A 3G1LA 2L7MP 2MG4A 4JX4A 5C3EJ 5BNGA 2CRGA 1TWCJ 1BW6A 2VKEA 3JRFA 3SJMA 1ZGWA 3PO3J 4D5CA 2YS9A 2LLKA 4I76A 2XB0X 4A3KJ 4DZJA 1ETKA 2XGEA 3BTJA 4MLOA 1B72B 1MBEA 4L5EA 2M8GX 2E2HJ 2P81A 4A3IJ 5F08A 2HOAA 5M3FJ 2DA3A 4XRSG 1SFOJ 1Z77A 1RPWA 1BJZA 1Z0XA 2CQQA 2R5YB 2YU9J 9ANTA 2ME6A 3GTMJ 1LE8B 2WV1A 4UUTA 1ZR4A 5F0FA 4M3BA 5E3LA 3RZDJ 2RAEA 3BG5A 4IHYA 1POGA 3CQZJ 2ELKA 1I50J 4A3CJ 5K7HA 3WHCA 5IP9J 4A3LJ 2AHQA 2O8KA 3HOZJ 2YUSA 5C4XJ 1WGXA 1RKWA 3MN2A 4QTRA 2E2IJ 3GBGA 3VPRA 5J1YA 1EF4A 4EEFG 4A3BJ 2GLOA 1JGGA 5IP6A 1JUPA 4RBOA 1NK2P 1ZTRA 2I10A 1OFCX 3DCFA 3HKZN 1ZKGA 1A6IA 1ETWA 2H1KA 3W6VA 5F0HA 1B72A 4FE4A 4I6ZA 2M9HA 5FKMA 4B4CA 5JLXA 2E19A 3H0GJ 3WHBA 3JR9A 2IEKA 1AHDP 3GTQJ 5F1JA 2H8RA 2TCTA 3LSGA 1FTZA 2R92J 3OOUA 2KDZA 2R5YA 2FJ1A 2WAQN 3ZQIA 5EF6A 2ME0A 5F0CA 4BXXJ 1LE8A 4BY1J 1RETA 2X9DA 2NVYJ 2EZIA 2JJ7A 1MBKA 1ENHA 2ID6A 3IH2A 2XGCA 4DZPA 5IPAA 3Q3SA 4QIWN 3S15J 3JRCA 5DTDA 2LTPA 1D5YA 1IGNA 5E3MA 1HOMA 1W0UA 1RKTA 1IC8A 4NDLA 4A3MJ 3FK7A 2JA6J 2HOSA 1AKHB 4M3EA 3GTGJ 1UMQA 4IHXA 3FISA 2GBYA 1NK3P 1DU0A 3HOUJ 4M3GA 1MBJA 1TWGJ 5M3MJ 4BBSJ 5F04A 4A3JJ 3SFIA 3S16J 1OCTC 2L9RA 1Y1VJ 4A3EJ 3HGYA 2DA7A 2B63J 3Q0WA 1JT6A 5J1RA 2FX0A 3C2BA 2MSYA 3BR6A 3B6CA 3HGGA 4D7MA 1OJLA 5M5XJ 1FTTA 3RZOJ 2HI3A 2ECCA 2HXOA 3BG9A 3D1NI 1UG2A 3ZQFA 4DW6A 5GPAA 5IP7J 3OIOA 4D7NA 4BBRJ 2LKXA 1P7JA 4C3IJ 2R7ZJ 2R93J 4FCYA 4JP0A 4XIDA 2OPTA 1AKHA 1ORKA 3PM1A 3GTLJ 5FKKA 2XGDA 4CYCB 3PO2J 1JTXA 5IYDJ 4RDUA 1ETQA 4X1EA 3JREA 3GTKJ 1F43A 5E3OA 4X6AJ 3BTCA 2K9SA 4AUXA 5C44J 2XPVA 4C3HJ 2VI6A 1U9NA 1U9OA 2Y2ZA 1GDTA 1IRZA 3HBLA 4UUSB 5EZHA 3G1OA 5JLWA 1BA5A 1F36A 1E3OC 1HF0A 3SDGA 5FKLA 1GVDA 4BKXA 1MH3A 1ZK8A 2DA2A 3ZQHA 2CJJA 3RQIA 1NTCA 4A3FJ 1ITYA 2M34A 2N8GA 2W48A 2X48A 2O9LA 4JX5A 3LSJA 1JKQC 5K7FA 4XRSA 1JKRC 5F27A 2DA1A 3LSPA 2HXIA 1WI3A 2LK2A 2Y9ZA 4W1UA 4JYKA 4CYCA 1HCRA 5K7ZA 1G2HA 1T33A 3FIWA 3RKQA 5IOZA 2EZHA 1LFBA 1IUFA 4UUSA 1FIAA 5IYBJ 2XRLA 5EEAA 1XC5A 3HB9A 5E3NA 3G1MA 4QSHA 2JK3A 1XG1A 3IV5A 1FEXA 1LFUP 2IBDA 2QF7A 2JA7J 1FJLA 3JRHA 2HDDA 2WB1N 1WPKA 3HOXJ 1IDYA 1GV5A 1SANA 2LR8A 4DYCA 4AYBN 1VNDA 5M5WJ 1IJWC 1HLVA 2K9QA 2AO9A 2O7OA 4M6VA 1CQTA 2G0EA 2EH3A 3QQAA 1B8IB 1OCPA 1VI0A 5EZGA 4MIMA 1X58A 2R0QC 3IH3A 3BG3A 3ZOBA 1MH4A 1T56A 4G12A 3JRGA 1H88C 2M2EA 3HM5A 5IYCJ 3TEDA 1X2MA 1TC3C 3S2DJ 2DA6A 3S14J 4A69C 5EYRA 1DU6A 2NS7A 2FD5A 3HOYJ 5FKOA 3TW7A 3Q0UA 4S0HB 2FQ4A 5FLVA 1S7EA 1P7IA 2HYJA 2LP0A 1ETVA 3I4MJ 2LD5A 2KT0A 1MSFC 2LVSA 1PUFB 1WH5A 4DYQA 3QPSA 2DA4A 4C2MJ 1I6HJ 5EG0B 3FK6A 2NVQJ 2Y30A 3BQZA 5FKNA 1ETYA 3F0CA 4FE7A 1B8IA 1O4XA 1JUMA 1WCMJ 1H89C 1GV2A 1MBGA 2CUEA 1JJ6C 2DA5A 1YRNB 1I3QJ 3I4NJ 2VKVA 5GP9A 2MGQA 3A01B 4MFDA 3HDDA 4ABZA 3S1NJ 4FISA 3H3VK 3A02A 3GTPJ 1RR7A 2NVTJ 1HDPA 2EBIA 2JN6A 4JX6A 1ETOA 4A93J 1Y1WJ 3LOCA 5HODA 3ZQLA 2HOTA 2E2JJ 1WH7A 3FKIJ 1TWFJ 4M3DA 2DJNA 2QCOA 2XSDC 4A3GJ 2JMWA 4V2GA 1R9TJ 1GT0C 3CCYA 2JWTA 4IHWA 3K7AJ 1VFCA 4DYRA 2DTZA 3TW6A 3OSGA 2JA8J 1PUFA 2VUMJ 1QVUA 4C3JJ 5EG0A 2L7ZA
chains in the Genus database with same CATH superfamily
3FDYA 2QVOA 4A12A 1JKOC 1FP2A 2GAUA 5ED4A 2M3AA 2MW8A 3IC7A 4IEJA 2JRTA 4BXUA 3BR1A 2LFBA 3ZQCA 3CZ6A 3LQRA 1D3YA 1OYIA 4RAFA 2Y69H 2Z1DA 3DEWA 2X51A 3JRDA 3BP8A 3A01A 3S17J 3A2KA 4XSXF 3K2AA 4LD5A 4I2OA 2YU3A 2MFZA 2ZB9A 4E7LA 1UHSA 1WFXA 3OL4A 4K2EA 4Q47A 1D8KA 3NEUA 5L3FA 2VJIA 2X6YA 3S2HJ 3KIOA 1GVJA 5D5XB 3FXMA 4BE2A 3BQYA 2AS5F 2V1NA 2J5PA 3MKLA 4IHVA 2JVHA 2M0CA 2XPUA 5DD8A 2RVCA 2E1OA 1W0TA 4D5FA 1XS9A 1I1GA 4EM0B 3H9GA 1Q1VA 3BPVA 1PP7U 1FNNA 3DWLE 2PFBA 1WI9A 3FXOA 2DOAA 4KYWA 4N0BA 3W6JB 3ZMZA 2DOFA 4XORA 3ABUA 3Q0VA 3E97A 1K6YA 2G9WA 3Q5FA 4AVZA 3OYMA 1P2FA 1LB2A 3ULQB 2RNJA 2R7WA 3VWBA 1AU7A 3KLOA 1T0FA 4BU2A 3HHHA 2HOEA 3CTAA 4X0GA 4NB5A 5FJ8J 4W97A 4C9YA 5E1XA 4RGUA 1YJ9I 2HWVA 2VIXA 4XLAA 2F4OB 4LFUA 5A2QK 2PLYA 1HA8A 3A4CA 2HDCA 1JGSA 1QVTA 4D9JA 5C4JJ 1VQPI 2DN0A 4HEA2 4Y52J 2STTA 2LKPA 3BR0A 3SZPA 4YG2F 4FETA 2P5LC 1J9IA 3H36A 5ERIA 3DQVC 2ZCWA 2BE5F 4XNFA 5AONA 4L0YB 1B9MA 3DEEA 3GVAA 2HQ5A 5KCMA 1B6AA 1UG0A 3I71A 2OTJI 1S29A 3WGIA 4B47A 4CA0A 1FSEA 2W82A 2EZKA 2VB6A 4PDKA 1BL0A 2LY2A 1DQUA 2XSJC 3FXQA 3IH4A 3LSTA 3LFUA 4G6DA 2BGCA 2XF6A 3BJ6A 3K1MA 1V5FA 1LKXA 1JTYA 3ZQGA 4CCOA 3IRQA 5BS6A 2DMQA 4AC0A 3BR3A 2V9PA 5FO5A 1BOBA 2V26A 1QGPA 4JX4A 3RIRA 5C3EJ 1BW6A 3C7JA 1ZGWA 3WTWC 4J01A 2YS9A 2HYFA 2M8EA 2Z9OA 3MWMA 2DYSH 4A6DA 1XSXA 4DZJA 2ZMEC 3BTJA 3F6VA 2M8GX 3I5UA 5F08A 3KFWX 3IAS2 4KT5C 2XF7A 1D8JA 4DBRA 4XRSG 1MD0A 2LY1A 2VE9A 5GTHC 1BJZA 3TOAA 3EDPA 5DCMA 1X19A 1QZZA 1BOAA 9ANTA 2XROA 5JVGF 3GTMJ 5E17F 2NS0A 2XAHA 2QBYA 1U0JA 1UHMA 3CQZJ 4A3CJ 4NQWA 5K7HA 2GXAA 4A3LJ 2O8KA 3RKYA 4KICA 3HOZJ 2CFXA 3GXOA 1ZG1A 4QTRA 3MKYB 2O03A 5J1YA 5HDGA 2K3PA 4E7KA 3HSRA 2W4SA 1H0MA 1YS6A 2A07F 5HS9A 4XKWA 2HYGD 4OU0A 1RI7A 2PI0A 3DCFA 3PNVA 5FB2A 3B73A 3F8BA 3GYHX 2H8WA 3ESWB 1B72A 3CMEI 4I6ZA 4B4CA 3T8RA 3CO7C 4IX7A 1Z1DA 2FXAA 3HPGA 1X4PA 3LSGA 1TBXA 4KITB 4KIBA 1FP1D 3TKYA 1QO0D 2Y0SA 2JRMA 3I0TA 3PIPF 4CH7A 5EF6A 2ME0A 1LEBA 4BXXJ 3RI4A 2DOEA 1RETA 4DOZA 2X9DA 2Z5UA 4ENKA 2M30A 4BY1J 3K4KA 1MNDA 2R7FA 3NQOA 3BZKA 1HXDA 2PMZA 2GZWA 2X1CA 1ENHA 2FBIA 3VYUB 3IH2A 2FU4A 2H94A 2J5OA 3ZMUA 2EV6A 1X1CA 1IXCA 2LTPA 2VN2A 2QQBA 1HOMA 1W0UA 2CS3A 3DU5A 1RKTA 2MC4A 4A3MJ 1SVMA 2HOSA 4M3EA 2Z3YA 3BZ6A 1J5YA 1ZYRF 3FISA 4YIRX 2KMUA 4BJTA 2R7RA 1DU0A 4XLEA 5GAEJ 5L3EA 1MBJA 1D0XA 4LLGF 1YLFA 1GXPA 2BVMA 2XASA 4BHBA 3ML6A 2QM3A 3OYFA 1Z21A 2JSCA 4G7OF 1K4SA 2FX0A 4ZYGA 1Z05A 5DM7F 4LG0B 2HQRA 5M5XJ 3FXRA 1LDDA 3HRSA 3RYPA 4P96A 3LA3A 3BG9A 4EVIA 3OY9A 1YG2A 1I3AA 1SD6A 5AIQA 3OIPA 3F8CA 1KQ0A 2LKXA 2W00A 4XMYA 5BMZA 4PFPA 2DT5A 2R93J 4OIRF 4M6YA 1K78A 3GFLA 3M8EA 2XDVA 1Y56A 3PM1A 3BCAA 4OAZA 4XQFA 1ACIA 2P4WA 1OR7C 3BCBA 5FD5A 4F3QA 4CZZA 5IYDJ 4RDUA 2IS1A 1UZCA 4X1EA 3JREA 1F43A 2JTVA 1I5ZA 2ELHA 2K7LA 4J00A 5E1ZB 3BTCA 2K9LA 5A2QZ 1FMWA 2ZC2A 1XCBA 1T38A 2VI6A 1U9OA 2Y2ZA 1GDTA 1IRZA 5J47A 3G1OA 4M9SA 2KLOA 4HF0A 1ZLJA 1TL8A 3I58A 5J4YA 1YTYA 3AKZA 2QKMB 3MQ0A 2YSRA 1TNSA 2BXZA 2QSFX 5TRDA 1ZK8A 1R49A 3I55I 2DA2A 2XKPA 1USTA 5HS8A 3LWFA 1ITYA 3HUGA 2W48A 4JX5A 4KN7X 1JKQC 4HG2A 1N25A 1VQ6I 3L09A 1ZARA 4HX4A 2VPLA 4N4OB 1FT9A 2QSGX 3PUBA 2O5RA 3I9V2 3OYHA 4Z6YA 1WJAA 5LEKA 4GRIA 3DTIA 4JYKA 2M7AA 3SXYA 2R7OA 3EYYA 3QPTA 4HF2A 2ZMEB 4AM3A 3IUOA 3DKXA 3MEXA 4UVCA 2I5UA 4EGYA 3N97A 4EJOA 3RKQA 3G3ZA 2D45A 1SMTA 1BC7C 1Z3XA 2ACJA 1OCZH 2PMHA 1Q1HA 5AIPA 5IYBJ 3IAM2 3JTGA 2DCEA 3RYRA 1BM9A 2JSPA 2JK3A 1Z6TA 4RLQA 3BDDA 4AVPA 2O0YA 2HDDA 2HPIA 2WB1N 5K5OA 1WQ2A 2DJIA 4AIDA 1YIJI 1XGMA 2BY3A 1IZ1A 2OTLI 1VNDA 2LH9A 1IF1A 1Z3YA 3DKYA 2LREA 1J2XA 4KISA 3FWEA 5E8IA 4XKCA 2DODA 1VQ9I 2O7OA 3H35A 3PUFA 5L3CA 1CQTA 2PEXA 3OIQA 1ZLKA 1QA6A 2OQGA 3VSLA 1MJ9A 5EZGA 3HPHA 3RPQA 1X58A 3WE2A 2ZXWH 3AG2H 1BC8C 2ZJPF 2R0QC 3BG3A 1ZN2A 4IPAA 3DLAA 1ON2A 3JRGA 3S2DJ 1I27A 3HYIA 4U88A 2JUCA 4ZYEA 2HEOA 4PJ0C 2LG4A 4NNJA 3J7YJ 3LAJA 2DPUA 2E1NA 1XGNA 1X1DA 3LSHA 2NNYA 5L3BA 1T98A 2KIFA 5FLVA 4DNCA 1R5HA 2HYJA 2EV0A 3CUQC 1ETVA 5ICCA 1V4RA 4I7HA 1RIOH 5K5QA 4C2MJ 1I6HJ 2DO7A 2Y0MA 2Y30A 4CO8A 3S3NA 1V5GA 2QWWA 4HSTA 3ZN1A 4FE7A 2QEXI 3FBNB 5E1WA 3TOBA 3QU3A 5BOXA 2ZFUA 3GFJA 4CCLA 3K4LA 1MBGA 4Q48A 1K6OA 2DA5A 1I3QJ 3HZJA 4AWXB 1ODDA 2VKVA 3U2RA 3ABMH 4ABZA 3S1NJ 3GLLA 2PJPA 4KMFA 5LD2C 2EBIA 1YW7A 3V4GA 3AL0C 2JN6A 1ETOA 4CXFA 3DKWA 5HODA 1W36D 2E2JJ 2MABA 3KETA 3FKIJ 3EPZA 2R7VA 1N75A 3KPHA 1TWFJ 3GF2A 2DJNA 3CDHA 4M3DA 2XSDC 2E1MC 4HAMA 4V2GA 1Z9CA 2BYVE 3OL3A 3RDIA 2EIMH 3CCYA 1WWXA 4IHWA 3K7AJ 2XAFA 4HYEA 4MEXF 3J80Z 3TW6A 4EGZA 2JA8J 4A5MA 4XOPA 1PUFA 2VUMJ 1QVUA 4L18B 4XLPF 3F9KA 1LQ1A 3EETA 4IOCF 5FGMA 3V8KA 1IG7A 1JHHA 3ZMDA 4LGWA 2CU7A 2ESNA 2HKOA 5B1BH 4Y7NJ 4PSWA 1W4MA 1ZQ3P 2COBA 2P7VB 1YW8A 2XPWA 4FASD 1EJ9A 4G6QA 3TDZC 1QPIA 3DP7A 2CV1A 2GOMA 4IRHA 1YQAA 1YITI 1FMVA 1RESA 4GFBA 3DV8A 2IAIA 2GOXB 3IKTA 4B44A 2LOOA 2PN6A 1HDDC 4RM3A 4A0YA 4E7SA 4ZDOA 1LVKA 1ZAOA 2L7KA 3JRBA 1O57A 2BZTA 1ETXA 2NOGA 2L9VA 3FMRA 4LJZF 4V2FA 3GX4X 3X2QH 1CF7B 1V3FA 4LMYA 4BNCA 3V42A 1MBHA 3BT9A 3ERMA 4D0PA 1XN7A 2ID3A 3QPLA 1YS7A 3K70D 1TTYA 2RDPA 1FYLA 1PJRA 1R1UA 1XGOA 3BROA 3K1NA 5FLMJ 1E0EA 2EZLA 1XMKA 2P0WA 2VKDA 2ADUA 4P9FA 5CKTA 2JPBA 1KU9A 4KIFA 2R5ZB 1JKPC 2CUJA 1MNMC 1N78A 2RNGA 4BXFA 2KQRA 1X2NA 2X85A 1U78A 2K9NA 3BTLA 3TO6A 1JT0A 2IRFG 1NHAA 5GADJ 4PSXA 2DMNA 3BY6A 2OF7A 4WWCA 1FOXA 1A04A 3E6MA 2NVXJ 2L7FP 2M4GA 1MBFA 2R7TA 1MSEC 1VZ0A 1IRFA 4XL9A 4FT8A 4UB6C 3OYDA 4NC7A 1FIPA 3FZVA 3JAMK 2M87A 2DMPA 3GMEA 4BACA 4GYGA 3NWSA 4A3DJ 3P7NA 2KFDA 1APLC 3QOPA 2YPRA 4AU7A 4HNVA 4HDVA 4NBQA 1TQMA 4IF4A 4B1RA 4UHTA 3QWLA 3SEQA 3CJQB 2IP2A 3SYTA 2LMDA 5DDGA 1BI2A 2Q8KA 3L2WA 4II3A 2W85A 3AG3H 3MVPA 1MMGA 5J8CA 4J19A 4Y13A 1RUNA 3WE3A 3F22A 5GPCA 3ASOH 5H6QA 3LSRA 2UZKA 4TV7A 4I01A 2IGKA 1U8BA 4MO7A 5EGOA 1VF9A 4N4NB 3IWZA 5K1YA 1G3YA 5HVQC 1Y39A 1XB4A 2X0LA 4MNUA 4YEJA 4BQOA 3HOWJ 4ZZDA 2Y48A 1A31A 1O7FA 4DJAA 3DBRB 4F52A 3CCVI 4XSZF 2ZNYA 1E3PA 5HLHA 1GUUA 3G1LA 4BJ6C 2L7MP 3WG9A 3RKXA 3I56I 1N77A 1J7KA 3QYBA 1WZ2A 4D5CA 1FBQA 2WAFA 2F4MB 1EV7A 2JZYA 5ICFA 3W3CA 2ZFWA 2XB0X 1ZGJA 1T08B 3L2UA 4CHUA 4YIIA 4HLYA 2E2HJ 3CUQB 1XSDA 4BHPA 2KRHA 4KFCA 2IS4A 3QP5A 2A6EF 1SFOJ 1AA7A 2UWMA 1Z77A 1RPWA 1VQLI 5JHFA 3CMAI 2UXXA 2K4JA 2R5YB 5FRNA 4LG0A 2YU9J 3EUHA 2D1VA 3H0DA 2ME6A 5KNLA 4BDZA 1LE8B 4M9XA 1ZR4A 5E3LA 4GO1A 3WGGA 2TDXA 2G7UA 4BHCA 4I0BA 1TNTA 3OS1A 2YUSA 1WGXA 1RKWA 2O8XA 3G4SI 3AL0B 1EF4A 3ISPA 3JSOA 3ELKA 5TISC 4YFKF 4ZYDA 1IXRC 4G6TB 1JUPA 4ETSA 5IP6A 2ISZA 2E1MB 3DPUA 4Y15A 3WGHA 2W57A 1GLNA 4RBOA 4B3XA 3OS0A 5LGTA 1YJNI 2LBFA 4EJTA 4BEHA 5F0HA 1ERDA 5FKMA 3KP2A 2QLZA 4PK4A 4S04A 2E19A 3WHBA 3JR9A 2IEKA 3AG1H 3GTQJ 5B5EC 4XM3A 1YJWI 2TCTA 5LFAA 5LBQA 2D2WA 3OOUA 4ESFA 2V1DA 2KDZA 3IWFA 3I59B 3W2VA 1QPMA 3K1PA 4BL0B 3ZQIA 5F0CA 2PJRA 5FROA 5HDNA 1OQYA 2VBYA 3VYRB 4DBQA 2PX9A 1OPCA 1OKRA 2IVMA 2NYXA 3N05A 2XGCA 1W7PA 1MDMA 5D8KB 2DPDA 3Q3SA 2ZXJA 3GZNB 1BI1A 5DTDA 2GA2A 2L01A 2ZXIA 4NDLA 3FK7A 2IS2A 1YX3A 3OMYA 5FFXA 5J8FA 4IRGA 1XDUA 1T2KA 3GTGJ 1EH6A 2EB7A 2GBYA 3CP8A 1NK3P 5LGUA 4ESBA 1JI8A 4MHGA 4BBSJ 5F04A 1O3TA 3E1SA 2STWA 3FF5A 2L9RA 1Y1VJ 1VQOI 3HGYA 1O3RA 1MGTA 3V7RA 4UB8C 2VOPA 4BDYA 4ZH4F 4HQMA 2EK5A 2MSYA 3BPXA 3BR6A 3B6CA 3HGGA 4G94A 4RM2A 1O3SA 5CVRA 3HRMA 2E7WA 3U9GA 4FQGA 3J81Z 2F5EA 2XRNA 3RZOJ 2LDUA 2X6WA 1ZHFA 1D1BA 2VBZA 1RZ4A 3D5LA 1KYZA 4CUGA 4CSWA 2V6EA 2A6TA 2VQCA 4BJ5C 2CW0F 1HC8A 1FLIA 2W84A 4XONA 1AOYA 5IT9K 1TT5B 4FCYA 3DPTA 4Y3OA 4XIDA 3LAPA 1LUJB 1ORKA 2DI3A 1FBSA 1UB9A 2ISYA 1AKHA 2Z2SB 1V54H 2V6CA 1MW7A 4LIUA 3OYAA 1JTXA 3JAMZ 4JBAA 3HC7A 3GTKJ 5E3OA 2CG4A 3OYIA 2E5ZA 2JVGA 4X6AJ 3M07A 3OYBA 1VQKI 3DBLB 1IN6A 2WC2A 4AUXA 2Q1ZB 5C44J 1U9NA 3MZYA 2E7XA 5D6EA 4CCMA 3H3ZA 2JPCA 1F36A 1R5GA 1E3OC 1HF0A 2BY2A 3UR3C 3SDGA 5BPDA 2EFOA 1X3WB 1QNTA 2XV4S 3KZIC 3ZQHA 1E2XA 2CJJA 4MTEA 4HDUA 5F64A 1NTCA 4A3FJ 1W36C 1HW2A 4CYDA 1YOVB 2N8GA 4A5NA 2WV0A 2X48A 2B9SA 2P5VA 2JQ7A 1S3JA 1TP4A 1Z91A 1U5TB 2BY0A 1JKRC 1RUOA 2X6XA 5F27A 3RSNA 3HTUA 3M7GA 4UXNA 4XLNF 3LSPA 1WI3A 4XLHA 3QP6A 2IW5A 1L3LA 3P9CA 4CYCA 2WY8Q 1HCRA 5CVJA 2BHYA 3S3OA 1REPC 1X3ZB 3ECOA 1T33A 3ECHA 3WU2C 2Q2EB 5KAFC 3FIWA 4OIOF 5L3DA 2DLLA 2E1CA 5DUKA 4U0VA 5IOZA 1PUEE 4XLFA 4UUSA 3A0BC 4XBFA 1XC5A 2CW7A 3SEZA 3HB9A 4QSHA 4XKBA 3IV5A 1J75A 1LFUP 2IBDA 4II2A 3K4BA 1GHCA 1FJLA 2DT7B 2ZNZA 1VQ7I 5DD4A 4EJVA 4WXCA 4DYCA 2LR8A 4AYBN 3HL2A 2BXYA 2OU2A 1EA3A 2EPFA 2EINH 5D6FA 5M5WJ 2ZJRF 1IJWC 1B1BA 2XF5A 3HJEA 5D4SA 3ZMVA 3K70C 1HLVA 2AO9A 3K4CA 2VLAA 5HNFA 2BW3B 2G0EA 2EH3A 3OYJA 1B8IB 3ONQA 4I09A 5E8GA 2VBXA 3HSEA 2NNNA 3FKJA 3LA7A 3OWTA 3KP6A 4AIHA 1ZREA 2ETHA 3OYLA 3B02A 3GFMA 4LG3A 4WXDA 1MH4A 4I99C 4G12A 2M2EA 1U6GA 3TEDA 1X2MA 2L9SA 2DA6A 2ZXHA 2HPMA 1D0ZA 4BH9A 4WX9A 5EYRA 1DGRM 4HW0A 2FNAA 1DU6A 2OZ6A 3HOSA 2HGCA 2DDAA 5GTIC 1SFEA 3QRFF 3WTUC 3Q0UA 1IRXA 5CVIA 2FQ4A 1S7EA 1XTAA 3JTHA 2LD5A 2RGVA 1XSVA 1MSFC 2CWEA 3EUKL 2Y75A 5EG0B 3RPUA 1QBJA 3FK6A 4DIQA 1D1AA 2L5QA 1LPQA 1F4KA 3WU1B 1VQMI 2PMUA 1IN5A 1JUMA 1AWCA 3H5AA 4CZCA 2QQ8A 5CVVA 3F3XA 4LK0F 1GV2A 1J59A 4OINF 4CCKA 2E60A 4BGDA 4MGRA 3HKZA 3I4NJ 1S9HA 2D1HA 3V7CA 1IAWA 3A01B 1Y8RB 5ILUA 3H9JA 3A02A 3H92A 3GTPJ 1RR7A 4MEYF 2NVTJ 3HHGA 3JW4A 4JX6A 2H6BA 4A93J 3LOCA 3H5RA 4PZJA 4B8XA 1KGSA 2X1DA 2VE8A 1KU2A 2L54A 4KJZA 5ICEA 1NH3A 4A3GJ 2JMWA 1R9TJ 1DDNA 1QZEA 3H1CA 2WB1A 5GAGJ 2GXBA 3EQLF 1R7JA 2XKOA 3PSIA 4A2UA 3K0LA 4IHTA 3CO6C 3BLYA 4C30A 3VSKA 2XAGA 3BZCA 4Z2YA 3K4JA 3PFYA 4HNUA 4YIFA 5CPRB 2K4BA 1STZA 2ELJA 3HRTA 3G71I 3VYTB 2RREA 3LNQA 2L2OA 4HV5A 2QA4I 4M3FA 2UV1A 3BTIA 1B59A 3MCZA 3FXJA 1IW7F 3ZQ7A 3I64A 2XC7A 1X1AA 2GIZA 2HKXA 3BR5A 3DPLC 4BY7J 3V8JA 4QPQA 3F23A 1YRNA 4IRIA 3M3YJ 4RAYA 5LEJA 5IT9Z 3CCRI 3O8GA 1BR2A 1X1BA 1QRYA 3TP0A 2OUMA 4ZTJA 1S7OA 3A0HC 4XRMA 1U8RA 3KCCA 1YIOA 5B1AH 2EIKH 4PCQA 1ZR2A 2HVSA 5JR3A 3M4OJ 2Y9YA 1M1EB 4IO9F 2JA5J 1FZPB 3GTJJ 1H9TA 2IJLA 3SDBA 3OS2A 1HQCA 4XKVA 2K40A 2CUFA 4XK4A 2GM4A 4MTDA 2QKLB 3S93A 4B09A 3NAUA 2MH2A 3NRVA 2MC3A 4UVBA 2F6CA 2CSOA 3J7AY 4Y4RA 3GWZA 3LSKA 5DCFA 5JHUA 2VJ4A 1R58A 1XPXA 1TZLA 2JA2A 4PJJA 2K02A 1TWAJ 2DMUA 1H8AC 3KEYA 2XAUA 3HEFA 1WSUA 1YFHA 4R8HA 2L0KA 1ZRDA 3L1PA 3D5SC 1SVLA 3DLLF 3K69A 3HSFA 3LFKA 2HR3A 2R3SA 3RCOA 3HOTA 3JRAA 4L5JA 2HNHA 3PQKA 2RV8A 4OIPF 2Z16A 4CCJA 1MMNA 2MYSA 2M0MA 5EDNA 3KP7A 3ABKH 3ROUA 4ZDLA 1S72I 2TRTA 1SAXA 3OSFA 5DCMB 1B4AA 1TWHJ 3NARA 5F6FA 5IY5H 3I54A 3VODA 3CMYA 1W7PD 4HSRA 1XGSA 3WTVC 3VOEA 2KIUA 1ULYA 2A5YB 3GW2A 5CVUA 4OIQF 3CCJI 2QBYB 5J3LA 4NQWB 5M5YJ 5LRSA 5DV5A 4XOTA 2K5CA 2MG4A 2GXGA 3DFGA 2KP6A 3HRUA 2IT0A 1YHQI 2CRGA 3E3VA 1TWCJ 2VKEA 4RA2A 3JRFA 3PO3J 2OCEA 4U7BA 3VEPA 3OYCA 1YYVA 4L0ZB 1OCRH 2LLKA 2HTJA 3M9AA 4KT6A 4I76A 1SD7A 2V1UA 4YRVA 1ETKA 2XGEA 3A1YA 1G59A 3CJNA 4MLOA 2W24A 1B72B 1MBEA 2F48A 4L5EA 2KZGA 2P81A 5FD6A 4U0WA 4M9ZA 2HOAA 4U0YA 5TGTA 2DAOA 2K85A 5TJJA 5EEGA 3VDXA 1EKEA 1MZBA 1Z0XA 2P6SA 3MAJA 5ILSA 4HQEA 4U87A 2IXSA 1LJ9A 3J7ZI 4FX0A 2WADA 3ZMSA 1SFKA 2E71A 3T0YA 3GFIA 3KP4A 2WV1A 4UUTA 1KYWA 3I3LA 4M3BA 5LGNA 4IHYA 4ASNA 2JT1A 3CP2A 2ZJ2A 5ICGA 1POGA 3WHCA 2CUZA 2AHQA 3M1CA 2A61A 4JK1X 3DXJF 3C18A 3RTRA 1R71A 1FOYA 4EEFG 4LLLA 5L3GA 2GLOA 1JGGA 1WKMA 2L9NA 2UUZA 3ZMTA 1LVAA 2CGPA 4Q4ZF 1X3UA 1ZTRA 2DFEA 1OFCX 1NK2P 1QU3A 1OYYA 1PP8F 1A6IA 1K4TA 1IUYA 2H1KA 3W6VA 3PQJA 3ZQQA 4P1WA 2NAZA 5JLXA 4CGZA 3H0GJ 1P4XA 3TBIA 4LIVA 4I02A 5F1JA 3V7SA 3QODA 3LMMA 2KIMA 5FFZA 4EQQA 2CV0A 4IQJA 1FSHA 3DF8A 2NOJB 2WWYA 1X4OA 1IXSB 4EM2A 2FJ1A 2MLKA 2WAQN 1S7AA 4BAYA 3K2ZA 5LHHA 1J0RA 4NC6A 1FOWA 3TQNA 4IXAA 3R4KA 3BG7A 3K6GA 1MBKA 1SMYF 4DZPA 3DU6A 2B7EA 3S15J 2LF8A 1S6LA 2QQAA 4ZYAA 5D5VB 2LF7A 3O6BB 2FMYA 1IGNA 2XAJA 4RB1A 2DQLA 3CCEI 2DYRH 3K4NA 4E6KG 4BQNA 1IC8A 4RS8A 3VB2A 3ERED 1UMQA 4IHXA 4OMYA 3ZN0A 2BV6A 2LC2A 2FOWA 2G7HA 2XAQA 1U3EM 4ENJA 1MJBA 3E5UA 1EH8A 2QZ8A 3HOUJ 4M3GA 5M3MJ 3D5RC 2ICWG 1W5SA 3FXUA 3CCSI 4A3JJ 4PJLA 5F1RA 3BJAA 4ENMA 3S16J 5LHGA 3MZ8A 2DA7A 1HKSA 3C1DA 4HF1A 2ESHA 2X1EA 2Z99A 3Q0WA 3MKZA 1JT6A 4HLXA 2OAZA 5D5UB 2KJCA 4BE0A 3C2BA 4OMZA 2FA5A 1Z7LA 4ZC3A 4D7MA 4O6JA 1FTTA 2CH0A 3LA2A 2DFFA 2HXOA 4UNOA 3ZQFA 3HUGB 3BG6A 4LB5A 5GPAA 3TDUC 1U5TC 5GAHJ 3C2HA 4C3IJ 1Z67A 3OV8A 3PFIA 4RB0A 5E18F 2VQLA 1VTNC 2R7ZJ 2H1LA 2KISA 4Y33A 1D5VA 1R4MB 2OPTA 5J40A 5KVRA 5FKKA 2RC4A 3SQNA 2OCCH 1G6NA 3C2GA 3FHNA 3KZYA 3S8PA 1JE8A 1DP7P 1ETQA 5DUIA 3GZ5A 4UVAA 1UJ8A 1S5LC 2MH9A 3CJTB 2K9SA 2X4HA 1WJEA 3F8NA 2XPVA 4IJAA 5ILVA 4CICA 4C3HJ 3HBLA 4PGGA 3W2WA 5JLWA 3L9FA 2NXNB 3LSIA 3REOA 3W6KB 1ZG3A 5FKLA 4F92B 3WODF 3KP3A 5H20A 5HS7A 2V7FA 2BY1A 4JQFA 3FXKA 2ZBKA 2VJ5A 3RQIA 4GGGA 3RPUD 2HU9A 2YX4A 4DQ2A 4O3MA 3OYNA 1Z6RA 2O9LA 1Y8QB 2AQFA 5E20A 3LSJA 3L00A 3WTYC 2P7CB 5K7FA 3KLNA 1F9NA 4XRSA 1BIAA 5FLXK 2E34A 2NRAC 4IVNA 3OYGA 4M71A 1RNLA 2EFWA 6PAXA 1V55H 3HXLA 5K7ZA 5HLGA 4ESJA 1BBYA 3IP4B 2HFHA 2LRDA 3S3MA 2DT6A 3RQ4A 2LYCA 2IPQX 3IRRA 4HPQA 5JVTA 2QGUA 1IUFA 3L2CA 1T8IA 1FIAA 3ZRGA 2XRLA 1EH7A 2KRCA 3O3KA 2VQGA 3LQQA 5E3NA 2RQPA 4E7HA 1WJCA 1XG1A 2DFIA 3CLOA 3CUOA 3AAFA 1MMAA 3JRHA 3PJRA 3RKWA 3MFKA 2E5NA 4B43A 4LITA 2VXZA 3HOXJ 4BQAA 3QYFA 1GV5A 3D0SA 2ZSHB 4V19K 3R0JA 1UHWA 2R7SA 3WTXC 3E5QA 1PYVA 2UXNA 2DBBA 4A0ZA 3T8TA 3ABTA 2HVRA 3N4MA 3LSMA 3MMYB 3QQAA 1SFXA 2GQQA 2O3FA 1HKQA 3EUHC 4M6XA 4IHSA 2EFNA 1VI0A 2KJBA 4MIMA 2VQHA 4P55A 3OOPA 1X1PA 3IH3A 2ZMEA 2OA4A 3DBHB 3FMQA 3MZHA 2F2EA 1MIJA 1H88C 2DXIA 3HM5A 3WTZA 2NVUB 1FYMA 5IYCJ 3PIOF 2A05A 1TQIA 3IL2A 4A69C 2DK8A 1WJDA 1NG7A 3SHFA 2HDWA 2FBHA 1DGWY 3TL4X 4I0AA 3R6SA 2NS7A 3FXLA 3QOEA 2FD5A 3CCQI 3HOYJ 4KN4X 3OYKA 2IGOA 3GEZA 1P7IA 1WHUA 3RJPA 2A6HF 1PVEA 4U7DA 1TLHB 1PUFB 3KYCB 4PFOA 3QPSA 4EJWA 1YE9A 3E0JB 3ZGKA 4E4HA 5BPIA 2NVQJ 1S8NA 1ETYA 2VC1A 1KONA 3GLXA 2B0LA 4XR6A 5D4RA 4UV8A 4F55A 2OZUA 3FBIB 3EUAA 1T0FC 1SD5A 2CUEA 2KPMA 3P9IA 1J09A 1T95A 1FYKA 4ZTFA 4MFDA 3CCLI 1USSA 2AXLA 1IN7A 4FISA 2V1XA 5D5WB 4WK8F 1ON1A 4HZFA 4MQVA 5D8LB 2WTEA 3PNYA 4KIGA 2K86A 3KZZA 3FM5A 3ZQLA 1HBXG 3KEQA 5E79C 1IV8A 4CDGA 4ZJZA 1WH7A 3WTTC 2VXDA 2JUGA 4G8XA 2L4MA 4L9VA 3SZTA 2M1BA 2EFQA 2M45A 3GO5A 3VYSB 4F93B 3MD2A 4NHJA 1P4AA 5KAIC 1VFCA 3E6DA 4DYRA 3U21A 3OSGA 4AYBA 1R00A 4C3JJ 4IKFA 2BHZA 4FHTA 2E36A 1WJBA 2L3DA 4RGRA 2L7ZA 4WXHA 5J1UA 2PG4A 5J4VA 2FQ3A 1A5JA 1P6RA 1RC9A 3L2RA 2EA2A 2VBWA 2NS8A 2F4IA 5B3SH 2M7BA 1WVRA 4LOCA 4L9JA 3SFZA 2VONA 4O5VA 1KQ8A 3FM3A 1I39A 1R4NB 2CYYA 2FMLA 2EQRA 3LL7A 2VPRA 3PL8A 3L7WA 1P4WA 3ZCOA 3HIFA 2EJRA 1JJ8C 1SFUA 1DPUA 1YX5A 3CDLA 5DS9A 3GTOJ 3CF5F 4S05A 1BW5A 1ONVA 5DM6F 3L2VA 3M8JA 3OYEA 3JRIA 1OLTA 1SD4A 3W2AA 4MFEA 1FBUA 1L0OC 4G7HF 4RGSA 3K4MA 3KYLA 2OC6A 2CMPA 5J6XA 3B6AA 2EIJH 1IV6A 3J7AO 1MMDA 3TGNA 2EFPA 3NWTA 2CQXA 2OV7A 1A36A 2L4AA 1R22A 3S1QJ 2FOKA 4B3AA 5CQGA 2IS6A 1UFMA 3UKGA 1U2WA 3PSFA 2P6TA 5EGOB 3ABLH 1Y0UA 4AD9A 1BN5A 3HOVJ 1OR7A 2LY9A 2OQRA 2HTSA 3FMSA 2QYOA 3UNGC 5FLXZ 1BR4A 4LB6B 5IOYA 4XN0A 4ZDPA 5K5RA 1C0WA 1ZH5A 2A68F 5FRMA 3JCUC 1YO5C 3ZR8X 5HOOA 2QENA 4KDPA 2DMTA 1F1ZA 3G2BA 2DW4A 3BR2A 2X6OA 2ZO4A 5HLIA 3F21A 2EA4A 1JUSA 1IDZA 4GYIA 1CF7A 2MD0A 1VQNI 4AIKA 3R0AA 4M72A 4HOBA 3T5XA 2WAEA 4RLFA 3TP3A 3KYDB 3S1MJ 1IN4A 2DU9A 2XB5A 3IKVA 1O7LA 4XICA 3DTEA 4NUBA 1ZELA 2ZSIB 1OCCH 2CFOA 4ITVA 1HSJA 3J80K 3ZPLA 2Q0OA 3V8LA 2Y0SN 3E7LA 2R5ZA 5B66C 1A6QA 3A03A 2XHKA 3M1EA 3S1RJ 2F5FA 1WJFA 1UELB 1G8XA 3AFHA 2D5VA 1K61A 1XDSA 2R7UA 1HSTA 1JXSA 4BS9A 2Y31A 2PMZN 2FNPA 1D0YA 2KRFA 4AIJA 5LHIA 3I4PA 3O8HA 3L2QA 4FTHA 4ZYHA 1MKMA 2BVLA 1DPRA 1K83J 1OISA 1E3HA 2ECBA 4RMNA 5KK1A 3CCMI 2KL4A 5BNGA 3KX2A 4MQ9F 1B9NA 3SJMA 4EJUA 2O6GE 3HTSB 4BUPA 1TT0A 4A3KJ 4HV6A 2R7QA 2H09A 1VQ5I 3P9KA 2LBFB 4BEHB 3F8MA 1R1TA 4A3IJ 4LLNA 2QSHX 2IA2A 4R79A 4BYYA 4HX7A 4RB2C 2W1OA 5M3FJ 4GDFA 3F72A 2DA3A 1KU3A 3H3UA 1FOKA 1BI3A 3G73A 2AXTC 2CQQA 1MMSA 1SEUA 3ZXSA 2DDBA 5H2FC 4UY8I 1E17A 3Q9SA 2RN7A 2VODA 4UV9A 1MNEA 2A69F 3KE2A 1I6XA 2PJRB 5F0FA 2DQRA 1VQ8I 3RZDJ 2RAEA 3BG5A 2ELKA 1I50J 4HNTA 1KQ9A 5IP9J 1W7PB 1YW9A 1MDMB 1RR8C 2MA3A 2HS5A 5C4XJ 3WG7H 3MN2A 1ZG5A 3GBGA 2K9MA 1XX5A 3VPRA 2IA0A 2A5WA 2P8TA 2A3SA 1YI2I 4A3BJ 2FF4A 4E7JA 4OAYA 5CJ9A 2I10A 1T39A 3HKZN 1ZKGA 1ETWA 1OYWA 2V79A 4FE4A 2ZJQF 5LLQA 3CUQA 2M9HA 3CLQA 3DEUA 1JHFA 4QWQA 4XLCA 1KU7A 1AHDP 1SVOA 2HQNA 4HBLA 2V9KA 1TW3A 2H8RA 1FTZA 2R92J 3CC7I 2CQ7A 3HG9A 2R5YA 2VOOA 2HZDA 4ZZLA 1LE8A 1R6RA 2XIGA 4HRIA 3R60A 1MJAA 1VQ4I 2NVYJ 2EZIA 2JJ7A 2PBIA 1LDKB 3WU0A 1DP3A 2BOLA 2ID6A 4EMSA 2IGMA 5IPAA 4QIWN 1V5EA 1QQIA 3JRCA 1D5YA 5E3MA 1IO2A 3SZGA 4KNYA 1R36A 2GIVA 2JA6J 5HNHA 2L02A 4NC8A 3R61A 1AKHB 4E70A 4IQ4A 3VFZA 5HLTA 4KUMA 4A0XA 3JSPA 4L9TA 1FC3A 3TO9A 4RB3C 1TWGJ 1BI0A 3SFIA 2HQAA 4KA4A 1OCTC 3E6CC 2W7NA 4A3EJ 3CD6I 4Q5SF 2B63J 1GXQA 2H27A 1ZGAA 4HX8A 1LNWA 3C3WA 2QQ9A 1XD7A 5CYVA 5J1RA 1KA8A 4YELA 1R23A 2VKHA 3I59A 1QZYA 1UCRA 1F5TA 2BEOA 4L9NA 1OJLA 3F8FA 3U1KA 2HI3A 2ECCA 2XUBA 3D1NI 1LFPA 4BQQA 1UG2A 4DW6A 3OR1C 2OD5A 2OBPA 2DTRA 3QAHA 1Y6IA 1TW2A 5IP7J 3CESA 2RKHA 3OIOA 4D7NA 4EM1A 4YFNF 4BBRJ 1ZRFA 3GCMA 2VL8A 3CF2A 1D1CA 1P7JA 2R7XA 2F5CA 1G3TA 2VASA 2WY7Q 4LK1F 4JP0A 3FHZA 3PNTA 3FX3A 4JOMA 4IOAF 4A6EA 3GTLJ 2P5KA 4YFXF 2F5VA 2RQQA 1FY7A 2VT3A 2XGDA 4CYCB 1NG6A 3PO2J 3TMOA 3Q9VA 4N9IA 2LSOA 3O2PE 3F6OA 1Y0NA 1CGPA 2KDOA 5EJCA 4CCNA 3COAC 3E5XA 4UUSB 5EZHA 2COMA 1BA5A 2MD5A 5BQTA 4F91B 5JI6A 2KIQA 4G7ZF 1RRJA 1GVDA 4BKXA 2WAQA 1MH3A 4KMUX 4C2UA 2E35A 3ASNH 4RAGA 3DTKA 2CV2A 2M5WA 2M34A 1IRGA 1XCVA 2R4GA 2YR2A 2ZKZA 2DFHA 2QUFA 3MKWB 1W5TA 2GA1A 3CC4I 4ENNA 2DA1A 1QHHD 3BOQA 2FUG2 2HXIA 1DUXC 1LDJA 2LK2A 2HZTA 4ON0A 1R5ID 4OWRB 3G6EI 4BE1A 4W1UA 2Y9ZA 3EYIA 1OMIA 1ZRCA 2MBFA 4B48A 2VC0A 5HDKA 4GCVA 4I98B 4FX4A 4RAZA 1G2HA 3BC8A 2HVQA 4IZZA 3K9TA 2IGNA 4WF2A 3H5NA 2R7DA 3GZ6A 2K27A 2I8DA 4PUSA 2K3FA 2EZHA 4OOIA 3S2WA 1LFBA 5IT3A 2C6YA 5EEAA 1HW5A 2WBMA 4E7IA 3G1MA 2FSWA 1XMXA 2BBYA 3QU6A 2W25A 2JA7J 1FEXA 2QF7A 4DGWB 3M8FA 4GXOA 4ANJA 4M73A 5KHDA 2FEZA 1WPKA 5H6RA 1R1VA 2PQ8A 1IDYA 1SANA 3J81K 1G3SA 1XMAA 2KHMA 2V4JC 3BWGA 2XVCA 1FX7A 3OR2C 4P5OA 1U5TA 4Y17A 2M4KA 5DYMA 4P9UA 1SC7A 1BJAA 2K9QA 3AG4H 1PDNC 4M6VA 1K78B 1K79A 4WCGA 1P92A 1OCPA 1LEAA 5EEHA 4H4KC 3QPHA 1W1WE 2V9VA 5CLSA 3CJRB 3ZOBA 3ZP5A 1T56A 3IHUA 1BIBA 2Q2EA 3CDIA 1WRJA 1IN8A 4RGXA 1SAUA 1TC3C 2DK5A 2F5DA 2KZVA 4F7ZA 4N9HA 3CCUI 3S14J 5CQEA 2LNBA 4HA8A 3CC2I 2EILH 1H9GA 4L5IA 4PJNA 1O3QA 3K10A 2KKOA 1UAAA 2YX7A 4XN3A 3T1BA 1HKTA 1BR1A 1TQPA 1Z7UA 5DEQA 5FKOA 4XRFA 3TW7A 4R1HA 2FRHA 4S0HB 2WA0A 2MLGA 2LP0A 2CQKA 3I4MJ 3BJOA 2KT0A 1WJ5A 4C2TA 2FE3A 1FWZA 1HW1A 1WH5A 2LVSA 2XGXA 4DYQA 2DA4A 2VT2A 2FBKA 3KP5A 3QYEA 1OCOH 3BQZA 4EATA 5FKNA 2BW3A 2CQNA 3CMMA 3F0CA 1I1SA 2EV5A 1B8IA 1O4XA 3KEOA 1WCMJ 3H9QA 1H89C 1G4DA 1A35A 2LKSA 1W5CC 2CW8A 4QPOA 5JFRA 2Z33A 1JJ6C 2EWNA 1YRNB 5GP9A 4PJMA 2MGQA 4D1QA 1P9QC 3HDDA 5LRRA 2O61A 3H3VK 2CO5A 1G3WA 3TO7A 1K7AA 1HDPA 2OJED 3S32A 1KZHA 2VJJA 1Y1WJ 2HOTA 4H0EA 4QLCU 2IA1A 2AQEA 2QCOA 3U1DA 3P5JA 1FPQA 1T6SA 3E6BA 3WTSC 1GT0C 4PGHA 2JWTA 4G9YA 4EV0A 4E7ZA 1QHGA 2H6CA 2GWRA 2DTZA 4UUVA 3GUDA 4M74A 4IL6C 5EG0A 3I53A 2E2IJ
chains in the Genus database with same CATH topology
5J1UA 1A5JA 1JKOC 1IG7A 3LNQA 2NS8A 2MW8A 4LOCA 2CU7A 4IEJA 4Y7NJ 3BR1A 4M3FA 2LFBA 3BTIA 3ZQCA 1ZQ3P 2COBA 2XPWA 4BY7J 1QPIA 3BR5A 3DEWA 3JRDA 1YRNA 3M3YJ 3A01A 3S17J 2EQRA 3K2AA 2VPRA 3O8GA 1RESA 4GFBA 1QRYA 2ZB9A 1JJ8C 3TP0A 2IAIA 1UHSA 3CDLA 5DS9A 1HDDC 4XRMA 3GTOJ 1BW5A 3S2HJ 1ZR2A 3JRBA 1ETXA 2NOGA 3BQYA 4V2FA 3JRIA 3M4OJ 3MKLA 4IHVA 2M0CA 2XPUA 4MFEA 1MBHA 2Y9YA 2E1OA 1W0TA 3BT9A 2JA5J 4D5FA 1XS9A 3GTJJ 2ID3A 3QPLA 1Q1VA 3B6AA 2K40A 1IV6A 2CUFA 4XK4A 5FLMJ 2EZLA 2GM4A 2CQXA 3NAUA 3Q0VA 3S1QJ 4B3AA 1JKPC 2R5ZB 1MNMC 3UKGA 5EGOB 1X2NA 1U78A 2K9NA 3BTLA 1TWAJ 1JT0A 1AU7A 3HOVJ 2LY9A 2DMNA 2DMUA 2OF7A 1H8AC 2NVXJ 2L7FP 5IOYA 5FJ8J 1MBFA 4W97A 1MSEC 3HEFA 2L0KA 1FIPA 2DMTA 3L1PA 2DMPA 3BR2A 2X6OA 4A3DJ 1JUSA 1IDZA 1APLC 1QVTA 4HNVA 3JRAA 5C4JJ 3TP3A 4B1RA 2DN0A 4Y52J 3S1MJ 3BR0A 2XB5A 4XICA 3MVPA 4J19A 5EDNA 2HQ5A 5GPCA 2TRTA 2R5ZA 2Y0SN 3E7LA 3LSRA 3OSFA 1U8BA 1TWHJ 3NARA 3A03A 4MO7A 1VF9A 2EZKA 5EGOA 3S1RJ 1BL0A 2D5VA 3CMYA 3IH4A 1K61A 3HOWJ 2Y31A 2PMZN 3O8HA 4FTHA 5J3LA 1JTYA 3ZQGA 5M5YJ 2DMQA 4AC0A 1GUUA 1K83J 2ECBA 3BR3A 3G1LA 2L7MP 2MG4A 4JX4A 5C3EJ 5BNGA 2CRGA 1TWCJ 1BW6A 2VKEA 3JRFA 3SJMA 1ZGWA 3PO3J 4D5CA 2YS9A 2LLKA 4I76A 2XB0X 4A3KJ 4DZJA 1ETKA 2XGEA 3BTJA 4MLOA 1B72B 1MBEA 4L5EA 2M8GX 2E2HJ 2P81A 4A3IJ 5F08A 2HOAA 5M3FJ 2DA3A 4XRSG 1SFOJ 1Z77A 1RPWA 1BJZA 1Z0XA 2CQQA 2R5YB 2YU9J 9ANTA 2ME6A 3GTMJ 1LE8B 2WV1A 4UUTA 1ZR4A 5F0FA 4M3BA 5E3LA 3RZDJ 2RAEA 3BG5A 4IHYA 1POGA 3CQZJ 2ELKA 1I50J 4A3CJ 5K7HA 3WHCA 5IP9J 4A3LJ 2AHQA 2O8KA 3HOZJ 2YUSA 5C4XJ 1WGXA 1RKWA 3MN2A 4QTRA 2E2IJ 3GBGA 3VPRA 5J1YA 1EF4A 4EEFG 4A3BJ 2GLOA 1JGGA 5IP6A 1JUPA 4RBOA 1NK2P 1ZTRA 2I10A 1OFCX 3DCFA 3HKZN 1ZKGA 1A6IA 1ETWA 2H1KA 3W6VA 5F0HA 1B72A 4FE4A 4I6ZA 2M9HA 5FKMA 4B4CA 5JLXA 2E19A 3H0GJ 3WHBA 3JR9A 2IEKA 1AHDP 3GTQJ 5F1JA 2H8RA 2TCTA 3LSGA 1FTZA 2R92J 3OOUA 2KDZA 2R5YA 2FJ1A 2WAQN 3ZQIA 5EF6A 2ME0A 5F0CA 4BXXJ 1LE8A 4BY1J 1RETA 2X9DA 2NVYJ 2EZIA 2JJ7A 1MBKA 1ENHA 2ID6A 3IH2A 2XGCA 4DZPA 5IPAA 3Q3SA 4QIWN 3S15J 3JRCA 5DTDA 2LTPA 1D5YA 1IGNA 5E3MA 1HOMA 1W0UA 1RKTA 1IC8A 4NDLA 4A3MJ 3FK7A 2JA6J 2HOSA 1AKHB 4M3EA 3GTGJ 1UMQA 4IHXA 3FISA 2GBYA 1NK3P 1DU0A 3HOUJ 4M3GA 1MBJA 1TWGJ 5M3MJ 4BBSJ 5F04A 4A3JJ 3SFIA 3S16J 1OCTC 2L9RA 1Y1VJ 4A3EJ 3HGYA 2DA7A 2B63J 3Q0WA 1JT6A 5J1RA 2FX0A 3C2BA 2MSYA 3BR6A 3B6CA 3HGGA 4D7MA 1OJLA 5M5XJ 1FTTA 3RZOJ 2HI3A 2ECCA 2HXOA 3BG9A 3D1NI 1UG2A 3ZQFA 4DW6A 5GPAA 5IP7J 3OIOA 4D7NA 4BBRJ 2LKXA 1P7JA 4C3IJ 2R7ZJ 2R93J 4FCYA 4JP0A 4XIDA 2OPTA 1AKHA 1ORKA 3PM1A 3GTLJ 5FKKA 2XGDA 4CYCB 3PO2J 1JTXA 5IYDJ 4RDUA 1ETQA 4X1EA 3JREA 3GTKJ 1F43A 5E3OA 4X6AJ 3BTCA 2K9SA 4AUXA 5C44J 2XPVA 4C3HJ 2VI6A 1U9NA 1U9OA 2Y2ZA 1GDTA 1IRZA 3HBLA 4UUSB 5EZHA 3G1OA 5JLWA 1BA5A 1F36A 1E3OC 1HF0A 3SDGA 5FKLA 1GVDA 4BKXA 1MH3A 1ZK8A 2DA2A 3ZQHA 2CJJA 3RQIA 1NTCA 4A3FJ 1ITYA 2M34A 2N8GA 2W48A 2X48A 2O9LA 4JX5A 3LSJA 1JKQC 5K7FA 4XRSA 1JKRC 5F27A 2DA1A 3LSPA 2HXIA 1WI3A 2LK2A 2Y9ZA 4W1UA 4JYKA 4CYCA 1HCRA 5K7ZA 1G2HA 1T33A 3FIWA 3RKQA 5IOZA 2EZHA 1LFBA 1IUFA 4UUSA 1FIAA 5IYBJ 2XRLA 5EEAA 1XC5A 3HB9A 5E3NA 3G1MA 4QSHA 2JK3A 1XG1A 3IV5A 1FEXA 1LFUP 2IBDA 2QF7A 2JA7J 1FJLA 3JRHA 2HDDA 2WB1N 1WPKA 3HOXJ 1IDYA 1GV5A 1SANA 2LR8A 4DYCA 4AYBN 1VNDA 5M5WJ 1IJWC 1HLVA 2K9QA 2AO9A 2O7OA 4M6VA 1CQTA 2G0EA 2EH3A 3QQAA 1B8IB 1OCPA 1VI0A 5EZGA 4MIMA 1X58A 2R0QC 3IH3A 3BG3A 3ZOBA 1MH4A 1T56A 4G12A 3JRGA 1H88C 2M2EA 3HM5A 5IYCJ 3TEDA 1X2MA 1TC3C 3S2DJ 2DA6A 3S14J 4A69C 5EYRA 1DU6A 2NS7A 2FD5A 3HOYJ 5FKOA 3TW7A 3Q0UA 4S0HB 2FQ4A 5FLVA 1S7EA 1P7IA 2HYJA 2LP0A 1ETVA 3I4MJ 2LD5A 2KT0A 1MSFC 2LVSA 1PUFB 1WH5A 4DYQA 3QPSA 2DA4A 4C2MJ 1I6HJ 5EG0B 3FK6A 2NVQJ 2Y30A 3BQZA 5FKNA 1ETYA 3F0CA 4FE7A 1B8IA 1O4XA 1JUMA 1WCMJ 1H89C 1GV2A 1MBGA 2CUEA 1JJ6C 2DA5A 1YRNB 1I3QJ 3I4NJ 2VKVA 5GP9A 2MGQA 3A01B 4MFDA 3HDDA 4ABZA 3S1NJ 4FISA 3H3VK 3A02A 3GTPJ 1RR7A 2NVTJ 1HDPA 2EBIA 2JN6A 4JX6A 1ETOA 4A93J 1Y1WJ 3LOCA 5HODA 3ZQLA 2HOTA 2E2JJ 1WH7A 3FKIJ 1TWFJ 4M3DA 2DJNA 2QCOA 2XSDC 4A3GJ 2JMWA 4V2GA 1R9TJ 1GT0C 3CCYA 2JWTA 4IHWA 3K7AJ 1VFCA 4DYRA 2DTZA 3TW6A 3OSGA 2JA8J 1PUFA 2VUMJ 1QVUA 4C3JJ 5EG0A 2L7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1U A;  1A5J A;  1JKO C;  1IG7 A;  3LNQ A;  2NS8 A;  2MW8 A;  4LOC A;  2CU7 A;  4IEJ A;  4Y7N J;  3BR1 A;  4M3F A;  2LFB A;  3BTI A;  3ZQC A;  1ZQ3 P;  2COB A;  2XPW A;  4BY7 J;  1QPI A;  3BR5 A;  3DEW A;  3JRD A;  1YRN A;  3M3Y J;  3A01 A;  3S17 J;  2EQR A;  3K2A A;  2VPR A;  3O8G A;  1RES A;  4GFB A;  1QRY A;  2ZB9 A;  1JJ8 C;  3TP0 A;  2IAI A;  1UHS A;  3CDL A;  5DS9 A;  1HDD C;  4XRM A;  3GTO J;  1BW5 A;  3S2H J;  1ZR2 A;  3JRB A;  1ETX A;  2NOG A;  3BQY A;  4V2F A;  3JRI A;  3M4O J;  3MKL A;  4IHV A;  2M0C A;  2XPU A;  4MFE A;  1MBH A;  2Y9Y A;  2E1O A;  1W0T A;  3BT9 A;  2JA5 J;  4D5F A;  1XS9 A;  3GTJ J;  2ID3 A;  3QPL A;  1Q1V A;  3B6A A;  2K40 A;  1IV6 A;  2CUF A;  4XK4 A;  5FLM J;  2EZL A;  2GM4 A;  2CQX A;  3NAU A;  3Q0V A;  3S1Q J;  4B3A A;  1JKP C;  2R5Z B;  1MNM C;  3UKG A;  5EGO B;  1X2N A;  1U78 A;  2K9N A;  3BTL A;  1TWA J;  1JT0 A;  1AU7 A;  3HOV J;  2LY9 A;  2DMN A;  2DMU A;  2OF7 A;  1H8A C;  2NVX J;  2L7F P;  5IOY A;  5FJ8 J;  1MBF A;  4W97 A;  1MSE C;  3HEF A;  2L0K A;  1FIP A;  2DMT A;  3L1P A;  2DMP A;  3BR2 A;  2X6O A;  4A3D J;  1JUS A;  1IDZ A;  1APL C;  1QVT A;  4HNV A;  3JRA A;  5C4J J;  3TP3 A;  4B1R A;  2DN0 A;  4Y52 J;  3S1M J;  3BR0 A;  2XB5 A;  4XIC A;  3MVP A;  4J19 A;  5EDN A;  2HQ5 A;  5GPC A;  2TRT A;  2R5Z A;  2Y0S N;  3E7L A;  3LSR A;  3OSF A;  1U8B A;  1TWH J;  3NAR A;  3A03 A;  4MO7 A;  1VF9 A;  2EZK A;  5EGO A;  3S1R J;  1BL0 A;  2D5V A;  3CMY A;  3IH4 A;  1K61 A;  3HOW J;  2Y31 A;  2PMZ N;  3O8H A;  4FTH A;  5J3L A;  1JTY A;  3ZQG A;  5M5Y J;  2DMQ A;  4AC0 A;  1GUU A;  1K83 J;  2ECB A;  3BR3 A;  3G1L A;  2L7M P;  2MG4 A;  4JX4 A;  5C3E J;  5BNG A;  2CRG A;  1TWC J;  1BW6 A;  2VKE A;  3JRF A;  3SJM A;  1ZGW A;  3PO3 J;  4D5C A;  2YS9 A;  2LLK A;  4I76 A;  2XB0 X;  4A3K J;  4DZJ A;  1ETK A;  2XGE A;  3BTJ A;  4MLO A;  1B72 B;  1MBE A;  4L5E A;  2M8G X;  2E2H J;  2P81 A;  4A3I J;  5F08 A;  2HOA A;  5M3F J;  2DA3 A;  4XRS G;  1SFO J;  1Z77 A;  1RPW A;  1BJZ A;  1Z0X A;  2CQQ A;  2R5Y B;  2YU9 J;  9ANT A;  2ME6 A;  3GTM J;  1LE8 B;  2WV1 A;  4UUT A;  1ZR4 A;  5F0F A;  4M3B A;  5E3L A;  3RZD J;  2RAE A;  3BG5 A;  4IHY A;  1POG A;  3CQZ J;  2ELK A;  1I50 J;  4A3C J;  5K7H A;  3WHC A;  5IP9 J;  4A3L J;  2AHQ A;  2O8K A;  3HOZ J;  2YUS A;  5C4X J;  1WGX A;  1RKW A;  3MN2 A;  4QTR A;  2E2I J;  3GBG A;  3VPR A;  5J1Y A;  1EF4 A;  4EEF G;  4A3B J;  2GLO A;  1JGG A;  5IP6 A;  1JUP A;  4RBO A;  1NK2 P;  1ZTR A;  2I10 A;  1OFC X;  3DCF A;  3HKZ N;  1ZKG A;  1A6I A;  1ETW A;  2H1K A;  3W6V A;  5F0H A;  1B72 A;  4FE4 A;  4I6Z A;  2M9H A;  5FKM A;  4B4C A;  5JLX A;  2E19 A;  3H0G J;  3WHB A;  3JR9 A;  2IEK A;  1AHD P;  3GTQ J;  5F1J A;  2H8R A;  2TCT A;  3LSG A;  1FTZ A;  2R92 J;  3OOU A;  2KDZ A;  2R5Y A;  2FJ1 A;  2WAQ N;  3ZQI A;  5EF6 A;  2ME0 A;  5F0C A;  4BXX J;  1LE8 A;  4BY1 J;  1RET A;  2X9D A;  2NVY J;  2EZI A;  2JJ7 A;  1MBK A;  1ENH A;  2ID6 A;  3IH2 A;  2XGC A;  4DZP A;  5IPA A;  3Q3S A;  4QIW N;  3S15 J;  3JRC A;  5DTD A;  2LTP A;  1D5Y A;  1IGN A;  5E3M A;  1HOM A;  1W0U A;  1RKT A;  1IC8 A;  4NDL A;  4A3M J;  3FK7 A;  2JA6 J;  2HOS A;  1AKH B;  4M3E A;  3GTG J;  1UMQ A;  4IHX A;  3FIS A;  2GBY A;  1NK3 P;  1DU0 A;  3HOU J;  4M3G A;  1MBJ A;  1TWG J;  5M3M J;  4BBS J;  5F04 A;  4A3J J;  3SFI A;  3S16 J;  1OCT C;  2L9R A;  1Y1V J;  4A3E J;  3HGY A;  2DA7 A;  2B63 J;  3Q0W A;  1JT6 A;  5J1R A;  2FX0 A;  3C2B A;  2MSY A;  3BR6 A;  3B6C A;  3HGG A;  4D7M A;  1OJL A;  5M5X J;  1FTT A;  3RZO J;  2HI3 A;  2ECC A;  2HXO A;  3BG9 A;  3D1N I;  1UG2 A;  3ZQF A;  4DW6 A;  5GPA A;  5IP7 J;  3OIO A;  4D7N A;  4BBR J;  2LKX A;  1P7J A;  4C3I J;  2R7Z J;  2R93 J;  4FCY A;  4JP0 A;  4XID A;  2OPT A;  1AKH A;  1ORK A;  3PM1 A;  3GTL J;  5FKK A;  2XGD A;  4CYC B;  3PO2 J;  1JTX A;  5IYD J;  4RDU A;  1ETQ A;  4X1E A;  3JRE A;  3GTK J;  1F43 A;  5E3O A;  4X6A J;  3BTC A;  2K9S A;  4AUX A;  5C44 J;  2XPV A;  4C3H J;  2VI6 A;  1U9N A;  1U9O A;  2Y2Z A;  1GDT A;  1IRZ A;  3HBL A;  4UUS B;  5EZH A;  3G1O A;  5JLW A;  1BA5 A;  1F36 A;  1E3O C;  1HF0 A;  3SDG A;  5FKL A;  1GVD A;  4BKX A;  1MH3 A;  1ZK8 A;  2DA2 A;  3ZQH A;  2CJJ A;  3RQI A;  1NTC A;  4A3F J;  1ITY A;  2M34 A;  2N8G A;  2W48 A;  2X48 A;  2O9L A;  4JX5 A;  3LSJ A;  1JKQ C;  5K7F A;  4XRS A;  1JKR C;  5F27 A;  2DA1 A;  3LSP A;  2HXI A;  1WI3 A;  2LK2 A;  2Y9Z A;  4W1U A;  4JYK A;  4CYC A;  1HCR A;  5K7Z A;  1G2H A;  1T33 A;  3FIW A;  3RKQ A;  5IOZ A;  2EZH A;  1LFB A;  1IUF A;  4UUS A;  1FIA A;  5IYB J;  2XRL A;  5EEA A;  1XC5 A;  3HB9 A;  5E3N A;  3G1M A;  4QSH A;  2JK3 A;  1XG1 A;  3IV5 A;  1FEX A;  1LFU P;  2IBD A;  2QF7 A;  2JA7 J;  1FJL A;  3JRH A;  2HDD A;  2WB1 N;  1WPK A;  3HOX J;  1IDY A;  1GV5 A;  1SAN A;  2LR8 A;  4DYC A;  4AYB N;  1VND A;  5M5W J;  1IJW C;  1HLV A;  2K9Q A;  2AO9 A;  2O7O A;  4M6V A;  1CQT A;  2G0E A;  2EH3 A;  3QQA A;  1B8I B;  1OCP A;  1VI0 A;  5EZG A;  4MIM A;  1X58 A;  2R0Q C;  3IH3 A;  3BG3 A;  3ZOB A;  1MH4 A;  1T56 A;  4G12 A;  3JRG A;  1H88 C;  2M2E A;  3HM5 A;  5IYC J;  3TED A;  1X2M A;  1TC3 C;  3S2D J;  2DA6 A;  3S14 J;  4A69 C;  5EYR A;  1DU6 A;  2NS7 A;  2FD5 A;  3HOY J;  5FKO A;  3TW7 A;  3Q0U A;  4S0H B;  2FQ4 A;  5FLV A;  1S7E A;  1P7I A;  2HYJ A;  2LP0 A;  1ETV A;  3I4M J;  2LD5 A;  2KT0 A;  1MSF C;  2LVS A;  1PUF B;  1WH5 A;  4DYQ A;  3QPS A;  2DA4 A;  4C2M J;  1I6H J;  5EG0 B;  3FK6 A;  2NVQ J;  2Y30 A;  3BQZ A;  5FKN A;  1ETY A;  3F0C A;  4FE7 A;  1B8I A;  1O4X A;  1JUM A;  1WCM J;  1H89 C;  1GV2 A;  1MBG A;  2CUE A;  1JJ6 C;  2DA5 A;  1YRN B;  1I3Q J;  3I4N J;  2VKV A;  5GP9 A;  2MGQ A;  3A01 B;  4MFD A;  3HDD A;  4ABZ A;  3S1N J;  4FIS A;  3H3V K;  3A02 A;  3GTP J;  1RR7 A;  2NVT J;  1HDP A;  2EBI A;  2JN6 A;  4JX6 A;  1ETO A;  4A93 J;  1Y1W J;  3LOC A;  5HOD A;  3ZQL A;  2HOT A;  2E2J J;  1WH7 A;  3FKI J;  1TWF J;  4M3D A;  2DJN A;  2QCO A;  2XSD C;  4A3G J;  2JMW A;  4V2G A;  1R9T J;  1GT0 C;  3CCY A;  2JWT A;  4IHW A;  3K7A J;  1VFC A;  4DYR A;  2DTZ A;  3TW6 A;  3OSG A;  2JA8 J;  1PUF A;  2VUM J;  1QVU A;  4C3J J;  5EG0 A;  2L7Z A; 
#chains in the Genus database with same CATH topology
 3FDY A;  2QVO A;  4A12 A;  1JKO C;  1FP2 A;  2GAU A;  5ED4 A;  2M3A A;  2MW8 A;  3IC7 A;  4IEJ A;  2JRT A;  4BXU A;  3BR1 A;  2LFB A;  3ZQC A;  3CZ6 A;  3LQR A;  1D3Y A;  1OYI A;  4RAF A;  2Y69 H;  2Z1D A;  3DEW A;  2X51 A;  3JRD A;  3BP8 A;  3A01 A;  3S17 J;  3A2K A;  4XSX F;  3K2A A;  4LD5 A;  4I2O A;  2YU3 A;  2MFZ A;  2ZB9 A;  4E7L A;  1UHS A;  1WFX A;  3OL4 A;  4K2E A;  4Q47 A;  1D8K A;  3NEU A;  5L3F A;  2VJI A;  2X6Y A;  3S2H J;  3KIO A;  1GVJ A;  5D5X B;  3FXM A;  4BE2 A;  3BQY A;  2AS5 F;  2V1N A;  2J5P A;  3MKL A;  4IHV A;  2JVH A;  2M0C A;  2XPU A;  5DD8 A;  2RVC A;  2E1O A;  1W0T A;  4D5F A;  1XS9 A;  1I1G A;  4EM0 B;  3H9G A;  1Q1V A;  3BPV A;  1PP7 U;  1FNN A;  3DWL E;  2PFB A;  1WI9 A;  3FXO A;  2DOA A;  4KYW A;  4N0B A;  3W6J B;  3ZMZ A;  2DOF A;  4XOR A;  3ABU A;  3Q0V A;  3E97 A;  1K6Y A;  2G9W A;  3Q5F A;  4AVZ A;  3OYM A;  1P2F A;  1LB2 A;  3ULQ B;  2RNJ A;  2R7W A;  3VWB A;  1AU7 A;  3KLO A;  1T0F A;  4BU2 A;  3HHH A;  2HOE A;  3CTA A;  4X0G A;  4NB5 A;  5FJ8 J;  4W97 A;  4C9Y A;  5E1X A;  4RGU A;  1YJ9 I;  2HWV A;  2VIX A;  4XLA A;  2F4O B;  4LFU A;  5A2Q K;  2PLY A;  1HA8 A;  3A4C A;  2HDC A;  1JGS A;  1QVT A;  4D9J A;  5C4J J;  1VQP I;  2DN0 A;  4HEA 2;  4Y52 J;  2STT A;  2LKP A;  3BR0 A;  3SZP A;  4YG2 F;  4FET A;  2P5L C;  1J9I A;  3H36 A;  5ERI A;  3DQV C;  2ZCW A;  2BE5 F;  4XNF A;  5AON A;  4L0Y B;  1B9M A;  3DEE A;  3GVA A;  2HQ5 A;  5KCM A;  1B6A A;  1UG0 A;  3I71 A;  2OTJ I;  1S29 A;  3WGI A;  4B47 A;  4CA0 A;  1FSE A;  2W82 A;  2EZK A;  2VB6 A;  4PDK A;  1BL0 A;  2LY2 A;  1DQU A;  2XSJ C;  3FXQ A;  3IH4 A;  3LST A;  3LFU A;  4G6D A;  2BGC A;  2XF6 A;  3BJ6 A;  3K1M A;  1V5F A;  1LKX A;  1JTY A;  3ZQG A;  4CCO A;  3IRQ A;  5BS6 A;  2DMQ A;  4AC0 A;  3BR3 A;  2V9P A;  5FO5 A;  1BOB A;  2V26 A;  1QGP A;  4JX4 A;  3RIR A;  5C3E J;  1BW6 A;  3C7J A;  1ZGW A;  3WTW C;  4J01 A;  2YS9 A;  2HYF A;  2M8E A;  2Z9O A;  3MWM A;  2DYS H;  4A6D A;  1XSX A;  4DZJ A;  2ZME C;  3BTJ A;  3F6V A;  2M8G X;  3I5U A;  5F08 A;  3KFW X;  3IAS 2;  4KT5 C;  2XF7 A;  1D8J A;  4DBR A;  4XRS G;  1MD0 A;  2LY1 A;  2VE9 A;  5GTH C;  1BJZ A;  3TOA A;  3EDP A;  5DCM A;  1X19 A;  1QZZ A;  1BOA A;  9ANT A;  2XRO A;  5JVG F;  3GTM J;  5E17 F;  2NS0 A;  2XAH A;  2QBY A;  1U0J A;  1UHM A;  3CQZ J;  4A3C J;  4NQW A;  5K7H A;  2GXA A;  4A3L J;  2O8K A;  3RKY A;  4KIC A;  3HOZ J;  2CFX A;  3GXO A;  1ZG1 A;  4QTR A;  3MKY B;  2O03 A;  5J1Y A;  5HDG A;  2K3P A;  4E7K A;  3HSR A;  2W4S A;  1H0M A;  1YS6 A;  2A07 F;  5HS9 A;  4XKW A;  2HYG D;  4OU0 A;  1RI7 A;  2PI0 A;  3DCF A;  3PNV A;  5FB2 A;  3B73 A;  3F8B A;  3GYH X;  2H8W A;  3ESW B;  1B72 A;  3CME I;  4I6Z A;  4B4C A;  3T8R A;  3CO7 C;  4IX7 A;  1Z1D A;  2FXA A;  3HPG A;  1X4P A;  3LSG A;  1TBX A;  4KIT B;  4KIB A;  1FP1 D;  3TKY A;  1QO0 D;  2Y0S A;  2JRM A;  3I0T A;  3PIP F;  4CH7 A;  5EF6 A;  2ME0 A;  1LEB A;  4BXX J;  3RI4 A;  2DOE A;  1RET A;  4DOZ A;  2X9D A;  2Z5U A;  4ENK A;  2M30 A;  4BY1 J;  3K4K A;  1MND A;  2R7F A;  3NQO A;  3BZK A;  1HXD A;  2PMZ A;  2GZW A;  2X1C A;  1ENH A;  2FBI A;  3VYU B;  3IH2 A;  2FU4 A;  2H94 A;  2J5O A;  3ZMU A;  2EV6 A;  1X1C A;  1IXC A;  2LTP A;  2VN2 A;  2QQB A;  1HOM A;  1W0U A;  2CS3 A;  3DU5 A;  1RKT A;  2MC4 A;  4A3M J;  1SVM A;  2HOS A;  4M3E A;  2Z3Y A;  3BZ6 A;  1J5Y A;  1ZYR F;  3FIS A;  4YIR X;  2KMU A;  4BJT A;  2R7R A;  1DU0 A;  4XLE A;  5GAE J;  5L3E A;  1MBJ A;  1D0X A;  4LLG F;  1YLF A;  1GXP A;  2BVM A;  2XAS A;  4BHB A;  3ML6 A;  2QM3 A;  3OYF A;  1Z21 A;  2JSC A;  4G7O F;  1K4S A;  2FX0 A;  4ZYG A;  1Z05 A;  5DM7 F;  4LG0 B;  2HQR A;  5M5X J;  3FXR A;  1LDD A;  3HRS A;  3RYP A;  4P96 A;  3LA3 A;  3BG9 A;  4EVI A;  3OY9 A;  1YG2 A;  1I3A A;  1SD6 A;  5AIQ A;  3OIP A;  3F8C A;  1KQ0 A;  2LKX A;  2W00 A;  4XMY A;  5BMZ A;  4PFP A;  2DT5 A;  2R93 J;  4OIR F;  4M6Y A;  1K78 A;  3GFL A;  3M8E A;  2XDV A;  1Y56 A;  3PM1 A;  3BCA A;  4OAZ A;  4XQF A;  1ACI A;  2P4W A;  1OR7 C;  3BCB A;  5FD5 A;  4F3Q A;  4CZZ A;  5IYD J;  4RDU A;  2IS1 A;  1UZC A;  4X1E A;  3JRE A;  1F43 A;  2JTV A;  1I5Z A;  2ELH A;  2K7L A;  4J00 A;  5E1Z B;  3BTC A;  2K9L A;  5A2Q Z;  1FMW A;  2ZC2 A;  1XCB A;  1T38 A;  2VI6 A;  1U9O A;  2Y2Z A;  1GDT A;  1IRZ A;  5J47 A;  3G1O A;  4M9S A;  2KLO A;  4HF0 A;  1ZLJ A;  1TL8 A;  3I58 A;  5J4Y A;  1YTY A;  3AKZ A;  2QKM B;  3MQ0 A;  2YSR A;  1TNS A;  2BXZ A;  2QSF X;  5TRD A;  1ZK8 A;  1R49 A;  3I55 I;  2DA2 A;  2XKP A;  1UST A;  5HS8 A;  3LWF A;  1ITY A;  3HUG A;  2W48 A;  4JX5 A;  4KN7 X;  1JKQ C;  4HG2 A;  1N25 A;  1VQ6 I;  3L09 A;  1ZAR A;  4HX4 A;  2VPL A;  4N4O B;  1FT9 A;  2QSG X;  3PUB A;  2O5R A;  3I9V 2;  3OYH A;  4Z6Y A;  1WJA A;  5LEK A;  4GRI A;  3DTI A;  4JYK A;  2M7A A;  3SXY A;  2R7O A;  3EYY A;  3QPT A;  4HF2 A;  2ZME B;  4AM3 A;  3IUO A;  3DKX A;  3MEX A;  4UVC A;  2I5U A;  4EGY A;  3N97 A;  4EJO A;  3RKQ A;  3G3Z A;  2D45 A;  1SMT A;  1BC7 C;  1Z3X A;  2ACJ A;  1OCZ H;  2PMH A;  1Q1H A;  5AIP A;  5IYB J;  3IAM 2;  3JTG A;  2DCE A;  3RYR A;  1BM9 A;  2JSP A;  2JK3 A;  1Z6T A;  4RLQ A;  3BDD A;  4AVP A;  2O0Y A;  2HDD A;  2HPI A;  2WB1 N;  5K5O A;  1WQ2 A;  2DJI A;  4AID A;  1YIJ I;  1XGM A;  2BY3 A;  1IZ1 A;  2OTL I;  1VND A;  2LH9 A;  1IF1 A;  1Z3Y A;  3DKY A;  2LRE A;  1J2X A;  4KIS A;  3FWE A;  5E8I A;  4XKC A;  2DOD A;  1VQ9 I;  2O7O A;  3H35 A;  3PUF A;  5L3C A;  1CQT A;  2PEX A;  3OIQ A;  1ZLK A;  1QA6 A;  2OQG A;  3VSL A;  1MJ9 A;  5EZG A;  3HPH A;  3RPQ A;  1X58 A;  3WE2 A;  2ZXW H;  3AG2 H;  1BC8 C;  2ZJP F;  2R0Q C;  3BG3 A;  1ZN2 A;  4IPA A;  3DLA A;  1ON2 A;  3JRG A;  3S2D J;  1I27 A;  3HYI A;  4U88 A;  2JUC A;  4ZYE A;  2HEO A;  4PJ0 C;  2LG4 A;  4NNJ A;  3J7Y J;  3LAJ A;  2DPU A;  2E1N A;  1XGN A;  1X1D A;  3LSH A;  2NNY A;  5L3B A;  1T98 A;  2KIF A;  5FLV A;  4DNC A;  1R5H A;  2HYJ A;  2EV0 A;  3CUQ C;  1ETV A;  5ICC A;  1V4R A;  4I7H A;  1RIO H;  5K5Q A;  4C2M J;  1I6H J;  2DO7 A;  2Y0M A;  2Y30 A;  4CO8 A;  3S3N A;  1V5G A;  2QWW A;  4HST A;  3ZN1 A;  4FE7 A;  2QEX I;  3FBN B;  5E1W A;  3TOB A;  3QU3 A;  5BOX A;  2ZFU A;  3GFJ A;  4CCL A;  3K4L A;  1MBG A;  4Q48 A;  1K6O A;  2DA5 A;  1I3Q J;  3HZJ A;  4AWX B;  1ODD A;  2VKV A;  3U2R A;  3ABM H;  4ABZ A;  3S1N J;  3GLL A;  2PJP A;  4KMF A;  5LD2 C;  2EBI A;  1YW7 A;  3V4G A;  3AL0 C;  2JN6 A;  1ETO A;  4CXF A;  3DKW A;  5HOD A;  1W36 D;  2E2J J;  2MAB A;  3KET A;  3FKI J;  3EPZ A;  2R7V A;  1N75 A;  3KPH A;  1TWF J;  3GF2 A;  2DJN A;  3CDH A;  4M3D A;  2XSD C;  2E1M C;  4HAM A;  4V2G A;  1Z9C A;  2BYV E;  3OL3 A;  3RDI A;  2EIM H;  3CCY A;  1WWX A;  4IHW A;  3K7A J;  2XAF A;  4HYE A;  4MEX F;  3J80 Z;  3TW6 A;  4EGZ A;  2JA8 J;  4A5M A;  4XOP A;  1PUF A;  2VUM J;  1QVU A;  4L18 B;  4XLP F;  3F9K A;  1LQ1 A;  3EET A;  4IOC F;  5FGM A;  3V8K A;  1IG7 A;  1JHH A;  3ZMD A;  4LGW A;  2CU7 A;  2ESN A;  2HKO A;  5B1B H;  4Y7N J;  4PSW A;  1W4M A;  1ZQ3 P;  2COB A;  2P7V B;  1YW8 A;  2XPW A;  4FAS D;  1EJ9 A;  4G6Q A;  3TDZ C;  1QPI A;  3DP7 A;  2CV1 A;  2GOM A;  4IRH A;  1YQA A;  1YIT I;  1FMV A;  1RES A;  4GFB A;  3DV8 A;  2IAI A;  2GOX B;  3IKT A;  4B44 A;  2LOO A;  2PN6 A;  1HDD C;  4RM3 A;  4A0Y A;  4E7S A;  4ZDO A;  1LVK A;  1ZAO A;  2L7K A;  3JRB A;  1O57 A;  2BZT A;  1ETX A;  2NOG A;  2L9V A;  3FMR A;  4LJZ F;  4V2F A;  3GX4 X;  3X2Q H;  1CF7 B;  1V3F A;  4LMY A;  4BNC A;  3V42 A;  1MBH A;  3BT9 A;  3ERM A;  4D0P A;  1XN7 A;  2ID3 A;  3QPL A;  1YS7 A;  3K70 D;  1TTY A;  2RDP A;  1FYL A;  1PJR A;  1R1U A;  1XGO A;  3BRO A;  3K1N A;  5FLM J;  1E0E A;  2EZL A;  1XMK A;  2P0W A;  2VKD A;  2ADU A;  4P9F A;  5CKT A;  2JPB A;  1KU9 A;  4KIF A;  2R5Z B;  1JKP C;  2CUJ A;  1MNM C;  1N78 A;  2RNG A;  4BXF A;  2KQR A;  1X2N A;  2X85 A;  1U78 A;  2K9N A;  3BTL A;  3TO6 A;  1JT0 A;  2IRF G;  1NHA A;  5GAD J;  4PSX A;  2DMN A;  3BY6 A;  2OF7 A;  4WWC A;  1FOX A;  1A04 A;  3E6M A;  2NVX J;  2L7F P;  2M4G A;  1MBF A;  2R7T A;  1MSE C;  1VZ0 A;  1IRF A;  4XL9 A;  4FT8 A;  4UB6 C;  3OYD A;  4NC7 A;  1FIP A;  3FZV A;  3JAM K;  2M87 A;  2DMP A;  3GME A;  4BAC A;  4GYG A;  3NWS A;  4A3D J;  3P7N A;  2KFD A;  1APL C;  3QOP A;  2YPR A;  4AU7 A;  4HNV A;  4HDV A;  4NBQ A;  1TQM A;  4IF4 A;  4B1R A;  4UHT A;  3QWL A;  3SEQ A;  3CJQ B;  2IP2 A;  3SYT A;  2LMD A;  5DDG A;  1BI2 A;  2Q8K A;  3L2W A;  4II3 A;  2W85 A;  3AG3 H;  3MVP A;  1MMG A;  5J8C A;  4J19 A;  4Y13 A;  1RUN A;  3WE3 A;  3F22 A;  5GPC A;  3ASO H;  5H6Q A;  3LSR A;  2UZK A;  4TV7 A;  4I01 A;  2IGK A;  1U8B A;  4MO7 A;  5EGO A;  1VF9 A;  4N4N B;  3IWZ A;  5K1Y A;  1G3Y A;  5HVQ C;  1Y39 A;  1XB4 A;  2X0L A;  4MNU A;  4YEJ A;  4BQO A;  3HOW J;  4ZZD A;  2Y48 A;  1A31 A;  1O7F A;  4DJA A;  3DBR B;  4F52 A;  3CCV I;  4XSZ F;  2ZNY A;  1E3P A;  5HLH A;  1GUU A;  3G1L A;  4BJ6 C;  2L7M P;  3WG9 A;  3RKX A;  3I56 I;  1N77 A;  1J7K A;  3QYB A;  1WZ2 A;  4D5C A;  1FBQ A;  2WAF A;  2F4M B;  1EV7 A;  2JZY A;  5ICF A;  3W3C A;  2ZFW A;  2XB0 X;  1ZGJ A;  1T08 B;  3L2U A;  4CHU A;  4YII A;  4HLY A;  2E2H J;  3CUQ B;  1XSD A;  4BHP A;  2KRH A;  4KFC A;  2IS4 A;  3QP5 A;  2A6E F;  1SFO J;  1AA7 A;  2UWM A;  1Z77 A;  1RPW A;  1VQL I;  5JHF A;  3CMA I;  2UXX A;  2K4J A;  2R5Y B;  5FRN A;  4LG0 A;  2YU9 J;  3EUH A;  2D1V A;  3H0D A;  2ME6 A;  5KNL A;  4BDZ A;  1LE8 B;  4M9X A;  1ZR4 A;  5E3L A;  4GO1 A;  3WGG A;  2TDX A;  2G7U A;  4BHC A;  4I0B A;  1TNT A;  3OS1 A;  2YUS A;  1WGX A;  1RKW A;  2O8X A;  3G4S I;  3AL0 B;  1EF4 A;  3ISP A;  3JSO A;  3ELK A;  5TIS C;  4YFK F;  4ZYD A;  1IXR C;  4G6T B;  1JUP A;  4ETS A;  5IP6 A;  2ISZ A;  2E1M B;  3DPU A;  4Y15 A;  3WGH A;  2W57 A;  1GLN A;  4RBO A;  4B3X A;  3OS0 A;  5LGT A;  1YJN I;  2LBF A;  4EJT A;  4BEH A;  5F0H A;  1ERD A;  5FKM A;  3KP2 A;  2QLZ A;  4PK4 A;  4S04 A;  2E19 A;  3WHB A;  3JR9 A;  2IEK A;  3AG1 H;  3GTQ J;  5B5E C;  4XM3 A;  1YJW I;  2TCT A;  5LFA A;  5LBQ A;  2D2W A;  3OOU A;  4ESF A;  2V1D A;  2KDZ A;  3IWF A;  3I59 B;  3W2V A;  1QPM A;  3K1P A;  4BL0 B;  3ZQI A;  5F0C A;  2PJR A;  5FRO A;  5HDN A;  1OQY A;  2VBY A;  3VYR B;  4DBQ A;  2PX9 A;  1OPC A;  1OKR A;  2IVM A;  2NYX A;  3N05 A;  2XGC A;  1W7P A;  1MDM A;  5D8K B;  2DPD A;  3Q3S A;  2ZXJ A;  3GZN B;  1BI1 A;  5DTD A;  2GA2 A;  2L01 A;  2ZXI A;  4NDL A;  3FK7 A;  2IS2 A;  1YX3 A;  3OMY A;  5FFX A;  5J8F A;  4IRG A;  1XDU A;  1T2K A;  3GTG J;  1EH6 A;  2EB7 A;  2GBY A;  3CP8 A;  1NK3 P;  5LGU A;  4ESB A;  1JI8 A;  4MHG A;  4BBS J;  5F04 A;  1O3T A;  3E1S A;  2STW A;  3FF5 A;  2L9R A;  1Y1V J;  1VQO I;  3HGY A;  1O3R A;  1MGT A;  3V7R A;  4UB8 C;  2VOP A;  4BDY A;  4ZH4 F;  4HQM A;  2EK5 A;  2MSY A;  3BPX A;  3BR6 A;  3B6C A;  3HGG A;  4G94 A;  4RM2 A;  1O3S A;  5CVR A;  3HRM A;  2E7W A;  3U9G A;  4FQG A;  3J81 Z;  2F5E A;  2XRN A;  3RZO J;  2LDU A;  2X6W A;  1ZHF A;  1D1B A;  2VBZ A;  1RZ4 A;  3D5L A;  1KYZ A;  4CUG A;  4CSW A;  2V6E A;  2A6T A;  2VQC A;  4BJ5 C;  2CW0 F;  1HC8 A;  1FLI A;  2W84 A;  4XON A;  1AOY A;  5IT9 K;  1TT5 B;  4FCY A;  3DPT A;  4Y3O A;  4XID A;  3LAP A;  1LUJ B;  1ORK A;  2DI3 A;  1FBS A;  1UB9 A;  2ISY A;  1AKH A;  2Z2S B;  1V54 H;  2V6C A;  1MW7 A;  4LIU A;  3OYA A;  1JTX A;  3JAM Z;  4JBA A;  3HC7 A;  3GTK J;  5E3O A;  2CG4 A;  3OYI A;  2E5Z A;  2JVG A;  4X6A J;  3M07 A;  3OYB A;  1VQK I;  3DBL B;  1IN6 A;  2WC2 A;  4AUX A;  2Q1Z B;  5C44 J;  1U9N A;  3MZY A;  2E7X A;  5D6E A;  4CCM A;  3H3Z A;  2JPC A;  1F36 A;  1R5G A;  1E3O C;  1HF0 A;  2BY2 A;  3UR3 C;  3SDG A;  5BPD A;  2EFO A;  1X3W B;  1QNT A;  2XV4 S;  3KZI C;  3ZQH A;  1E2X A;  2CJJ A;  4MTE A;  4HDU A;  5F64 A;  1NTC A;  4A3F J;  1W36 C;  1HW2 A;  4CYD A;  1YOV B;  2N8G A;  4A5N A;  2WV0 A;  2X48 A;  2B9S A;  2P5V A;  2JQ7 A;  1S3J A;  1TP4 A;  1Z91 A;  1U5T B;  2BY0 A;  1JKR C;  1RUO A;  2X6X A;  5F27 A;  3RSN A;  3HTU A;  3M7G A;  4UXN A;  4XLN F;  3LSP A;  1WI3 A;  4XLH A;  3QP6 A;  2IW5 A;  1L3L A;  3P9C A;  4CYC A;  2WY8 Q;  1HCR A;  5CVJ A;  2BHY A;  3S3O A;  1REP C;  1X3Z B;  3ECO A;  1T33 A;  3ECH A;  3WU2 C;  2Q2E B;  5KAF C;  3FIW A;  4OIO F;  5L3D A;  2DLL A;  2E1C A;  5DUK A;  4U0V A;  5IOZ A;  1PUE E;  4XLF A;  4UUS A;  3A0B C;  4XBF A;  1XC5 A;  2CW7 A;  3SEZ A;  3HB9 A;  4QSH A;  4XKB A;  3IV5 A;  1J75 A;  1LFU P;  2IBD A;  4II2 A;  3K4B A;  1GHC A;  1FJL A;  2DT7 B;  2ZNZ A;  1VQ7 I;  5DD4 A;  4EJV A;  4WXC A;  4DYC A;  2LR8 A;  4AYB N;  3HL2 A;  2BXY A;  2OU2 A;  1EA3 A;  2EPF A;  2EIN H;  5D6F A;  5M5W J;  2ZJR F;  1IJW C;  1B1B A;  2XF5 A;  3HJE A;  5D4S A;  3ZMV A;  3K70 C;  1HLV A;  2AO9 A;  3K4C A;  2VLA A;  5HNF A;  2BW3 B;  2G0E A;  2EH3 A;  3OYJ A;  1B8I B;  3ONQ A;  4I09 A;  5E8G A;  2VBX A;  3HSE A;  2NNN A;  3FKJ A;  3LA7 A;  3OWT A;  3KP6 A;  4AIH A;  1ZRE A;  2ETH A;  3OYL A;  3B02 A;  3GFM A;  4LG3 A;  4WXD A;  1MH4 A;  4I99 C;  4G12 A;  2M2E A;  1U6G A;  3TED A;  1X2M A;  2L9S A;  2DA6 A;  2ZXH A;  2HPM A;  1D0Z A;  4BH9 A;  4WX9 A;  5EYR A;  1DGR M;  4HW0 A;  2FNA A;  1DU6 A;  2OZ6 A;  3HOS A;  2HGC A;  2DDA A;  5GTI C;  1SFE A;  3QRF F;  3WTU C;  3Q0U A;  1IRX A;  5CVI A;  2FQ4 A;  1S7E A;  1XTA A;  3JTH A;  2LD5 A;  2RGV A;  1XSV A;  1MSF C;  2CWE A;  3EUK L;  2Y75 A;  5EG0 B;  3RPU A;  1QBJ A;  3FK6 A;  4DIQ A;  1D1A A;  2L5Q A;  1LPQ A;  1F4K A;  3WU1 B;  1VQM I;  2PMU A;  1IN5 A;  1JUM A;  1AWC A;  3H5A A;  4CZC A;  2QQ8 A;  5CVV A;  3F3X A;  4LK0 F;  1GV2 A;  1J59 A;  4OIN F;  4CCK A;  2E60 A;  4BGD A;  4MGR A;  3HKZ A;  3I4N J;  1S9H A;  2D1H A;  3V7C A;  1IAW A;  3A01 B;  1Y8R B;  5ILU A;  3H9J A;  3A02 A;  3H92 A;  3GTP J;  1RR7 A;  4MEY F;  2NVT J;  3HHG A;  3JW4 A;  4JX6 A;  2H6B A;  4A93 J;  3LOC A;  3H5R A;  4PZJ A;  4B8X A;  1KGS A;  2X1D A;  2VE8 A;  1KU2 A;  2L54 A;  4KJZ A;  5ICE A;  1NH3 A;  4A3G J;  2JMW A;  1R9T J;  1DDN A;  1QZE A;  3H1C A;  2WB1 A;  5GAG J;  2GXB A;  3EQL F;  1R7J A;  2XKO A;  3PSI A;  4A2U A;  3K0L A;  4IHT A;  3CO6 C;  3BLY A;  4C30 A;  3VSK A;  2XAG A;  3BZC A;  4Z2Y A;  3K4J A;  3PFY A;  4HNU A;  4YIF A;  5CPR B;  2K4B A;  1STZ A;  2ELJ A;  3HRT A;  3G71 I;  3VYT B;  2RRE A;  3LNQ A;  2L2O A;  4HV5 A;  2QA4 I;  4M3F A;  2UV1 A;  3BTI A;  1B59 A;  3MCZ A;  3FXJ A;  1IW7 F;  3ZQ7 A;  3I64 A;  2XC7 A;  1X1A A;  2GIZ A;  2HKX A;  3BR5 A;  3DPL C;  4BY7 J;  3V8J A;  4QPQ A;  3F23 A;  1YRN A;  4IRI A;  3M3Y J;  4RAY A;  5LEJ A;  5IT9 Z;  3CCR I;  3O8G A;  1BR2 A;  1X1B A;  1QRY A;  3TP0 A;  2OUM A;  4ZTJ A;  1S7O A;  3A0H C;  4XRM A;  1U8R A;  3KCC A;  1YIO A;  5B1A H;  2EIK H;  4PCQ A;  1ZR2 A;  2HVS A;  5JR3 A;  3M4O J;  2Y9Y A;  1M1E B;  4IO9 F;  2JA5 J;  1FZP B;  3GTJ J;  1H9T A;  2IJL A;  3SDB A;  3OS2 A;  1HQC A;  4XKV A;  2K40 A;  2CUF A;  4XK4 A;  2GM4 A;  4MTD A;  2QKL B;  3S93 A;  4B09 A;  3NAU A;  2MH2 A;  3NRV A;  2MC3 A;  4UVB A;  2F6C A;  2CSO A;  3J7A Y;  4Y4R A;  3GWZ A;  3LSK A;  5DCF A;  5JHU A;  2VJ4 A;  1R58 A;  1XPX A;  1TZL A;  2JA2 A;  4PJJ A;  2K02 A;  1TWA J;  2DMU A;  1H8A C;  3KEY A;  2XAU A;  3HEF A;  1WSU A;  1YFH A;  4R8H A;  2L0K A;  1ZRD A;  3L1P A;  3D5S C;  1SVL A;  3DLL F;  3K69 A;  3HSF A;  3LFK A;  2HR3 A;  2R3S A;  3RCO A;  3HOT A;  3JRA A;  4L5J A;  2HNH A;  3PQK A;  2RV8 A;  4OIP F;  2Z16 A;  4CCJ A;  1MMN A;  2MYS A;  2M0M A;  5EDN A;  3KP7 A;  3ABK H;  3ROU A;  4ZDL A;  1S72 I;  2TRT A;  1SAX A;  3OSF A;  5DCM B;  1B4A A;  1TWH J;  3NAR A;  5F6F A;  5IY5 H;  3I54 A;  3VOD A;  3CMY A;  1W7P D;  4HSR A;  1XGS A;  3WTV C;  3VOE A;  2KIU A;  1ULY A;  2A5Y B;  3GW2 A;  5CVU A;  4OIQ F;  3CCJ I;  2QBY B;  5J3L A;  4NQW B;  5M5Y J;  5LRS A;  5DV5 A;  4XOT A;  2K5C A;  2MG4 A;  2GXG A;  3DFG A;  2KP6 A;  3HRU A;  2IT0 A;  1YHQ I;  2CRG A;  3E3V A;  1TWC J;  2VKE A;  4RA2 A;  3JRF A;  3PO3 J;  2OCE A;  4U7B A;  3VEP A;  3OYC A;  1YYV A;  4L0Z B;  1OCR H;  2LLK A;  2HTJ A;  3M9A A;  4KT6 A;  4I76 A;  1SD7 A;  2V1U A;  4YRV A;  1ETK A;  2XGE A;  3A1Y A;  1G59 A;  3CJN A;  4MLO A;  2W24 A;  1B72 B;  1MBE A;  2F48 A;  4L5E A;  2KZG A;  2P81 A;  5FD6 A;  4U0W A;  4M9Z A;  2HOA A;  4U0Y A;  5TGT A;  2DAO A;  2K85 A;  5TJJ A;  5EEG A;  3VDX A;  1EKE A;  1MZB A;  1Z0X A;  2P6S A;  3MAJ A;  5ILS A;  4HQE A;  4U87 A;  2IXS A;  1LJ9 A;  3J7Z I;  4FX0 A;  2WAD A;  3ZMS A;  1SFK A;  2E71 A;  3T0Y A;  3GFI A;  3KP4 A;  2WV1 A;  4UUT A;  1KYW A;  3I3L A;  4M3B A;  5LGN A;  4IHY A;  4ASN A;  2JT1 A;  3CP2 A;  2ZJ2 A;  5ICG A;  1POG A;  3WHC A;  2CUZ A;  2AHQ A;  3M1C A;  2A61 A;  4JK1 X;  3DXJ F;  3C18 A;  3RTR A;  1R71 A;  1FOY A;  4EEF G;  4LLL A;  5L3G A;  2GLO A;  1JGG A;  1WKM A;  2L9N A;  2UUZ A;  3ZMT A;  1LVA A;  2CGP A;  4Q4Z F;  1X3U A;  1ZTR A;  2DFE A;  1OFC X;  1NK2 P;  1QU3 A;  1OYY A;  1PP8 F;  1A6I A;  1K4T A;  1IUY A;  2H1K A;  3W6V A;  3PQJ A;  3ZQQ A;  4P1W A;  2NAZ A;  5JLX A;  4CGZ A;  3H0G J;  1P4X A;  3TBI A;  4LIV A;  4I02 A;  5F1J A;  3V7S A;  3QOD A;  3LMM A;  2KIM A;  5FFZ A;  4EQQ A;  2CV0 A;  4IQJ A;  1FSH A;  3DF8 A;  2NOJ B;  2WWY A;  1X4O A;  1IXS B;  4EM2 A;  2FJ1 A;  2MLK A;  2WAQ N;  1S7A A;  4BAY A;  3K2Z A;  5LHH A;  1J0R A;  4NC6 A;  1FOW A;  3TQN A;  4IXA A;  3R4K A;  3BG7 A;  3K6G A;  1MBK A;  1SMY F;  4DZP A;  3DU6 A;  2B7E A;  3S15 J;  2LF8 A;  1S6L A;  2QQA A;  4ZYA A;  5D5V B;  2LF7 A;  3O6B B;  2FMY A;  1IGN A;  2XAJ A;  4RB1 A;  2DQL A;  3CCE I;  2DYR H;  3K4N A;  4E6K G;  4BQN A;  1IC8 A;  4RS8 A;  3VB2 A;  3ERE D;  1UMQ A;  4IHX A;  4OMY A;  3ZN0 A;  2BV6 A;  2LC2 A;  2FOW A;  2G7H A;  2XAQ A;  1U3E M;  4ENJ A;  1MJB A;  3E5U A;  1EH8 A;  2QZ8 A;  3HOU J;  4M3G A;  5M3M J;  3D5R C;  2ICW G;  1W5S A;  3FXU A;  3CCS I;  4A3J J;  4PJL A;  5F1R A;  3BJA A;  4ENM A;  3S16 J;  5LHG A;  3MZ8 A;  2DA7 A;  1HKS A;  3C1D A;  4HF1 A;  2ESH A;  2X1E A;  2Z99 A;  3Q0W A;  3MKZ A;  1JT6 A;  4HLX A;  2OAZ A;  5D5U B;  2KJC A;  4BE0 A;  3C2B A;  4OMZ A;  2FA5 A;  1Z7L A;  4ZC3 A;  4D7M A;  4O6J A;  1FTT A;  2CH0 A;  3LA2 A;  2DFF A;  2HXO A;  4UNO A;  3ZQF A;  3HUG B;  3BG6 A;  4LB5 A;  5GPA A;  3TDU C;  1U5T C;  5GAH J;  3C2H A;  4C3I J;  1Z67 A;  3OV8 A;  3PFI A;  4RB0 A;  5E18 F;  2VQL A;  1VTN C;  2R7Z J;  2H1L A;  2KIS A;  4Y33 A;  1D5V A;  1R4M B;  2OPT A;  5J40 A;  5KVR A;  5FKK A;  2RC4 A;  3SQN A;  2OCC H;  1G6N A;  3C2G A;  3FHN A;  3KZY A;  3S8P A;  1JE8 A;  1DP7 P;  1ETQ A;  5DUI A;  3GZ5 A;  4UVA A;  1UJ8 A;  1S5L C;  2MH9 A;  3CJT B;  2K9S A;  2X4H A;  1WJE A;  3F8N A;  2XPV A;  4IJA A;  5ILV A;  4CIC A;  4C3H J;  3HBL A;  4PGG A;  3W2W A;  5JLW A;  3L9F A;  2NXN B;  3LSI A;  3REO A;  3W6K B;  1ZG3 A;  5FKL A;  4F92 B;  3WOD F;  3KP3 A;  5H20 A;  5HS7 A;  2V7F A;  2BY1 A;  4JQF A;  3FXK A;  2ZBK A;  2VJ5 A;  3RQI A;  4GGG A;  3RPU D;  2HU9 A;  2YX4 A;  4DQ2 A;  4O3M A;  3OYN A;  1Z6R A;  2O9L A;  1Y8Q B;  2AQF A;  5E20 A;  3LSJ A;  3L00 A;  3WTY C;  2P7C B;  5K7F A;  3KLN A;  1F9N A;  4XRS A;  1BIA A;  5FLX K;  2E34 A;  2NRA C;  4IVN A;  3OYG A;  4M71 A;  1RNL A;  2EFW A;  6PAX A;  1V55 H;  3HXL A;  5K7Z A;  5HLG A;  4ESJ A;  1BBY A;  3IP4 B;  2HFH A;  2LRD A;  3S3M A;  2DT6 A;  3RQ4 A;  2LYC A;  2IPQ X;  3IRR A;  4HPQ A;  5JVT A;  2QGU A;  1IUF A;  3L2C A;  1T8I A;  1FIA A;  3ZRG A;  2XRL A;  1EH7 A;  2KRC A;  3O3K A;  2VQG A;  3LQQ A;  5E3N A;  2RQP A;  4E7H A;  1WJC A;  1XG1 A;  2DFI A;  3CLO A;  3CUO A;  3AAF A;  1MMA A;  3JRH A;  3PJR A;  3RKW A;  3MFK A;  2E5N A;  4B43 A;  4LIT A;  2VXZ A;  3HOX J;  4BQA A;  3QYF A;  1GV5 A;  3D0S A;  2ZSH B;  4V19 K;  3R0J A;  1UHW A;  2R7S A;  3WTX C;  3E5Q A;  1PYV A;  2UXN A;  2DBB A;  4A0Z A;  3T8T A;  3ABT A;  2HVR A;  3N4M A;  3LSM A;  3MMY B;  3QQA A;  1SFX A;  2GQQ A;  2O3F A;  1HKQ A;  3EUH C;  4M6X A;  4IHS A;  2EFN A;  1VI0 A;  2KJB A;  4MIM A;  2VQH A;  4P55 A;  3OOP A;  1X1P A;  3IH3 A;  2ZME A;  2OA4 A;  3DBH B;  3FMQ A;  3MZH A;  2F2E A;  1MIJ A;  1H88 C;  2DXI A;  3HM5 A;  3WTZ A;  2NVU B;  1FYM A;  5IYC J;  3PIO F;  2A05 A;  1TQI A;  3IL2 A;  4A69 C;  2DK8 A;  1WJD A;  1NG7 A;  3SHF A;  2HDW A;  2FBH A;  1DGW Y;  3TL4 X;  4I0A A;  3R6S A;  2NS7 A;  3FXL A;  3QOE A;  2FD5 A;  3CCQ I;  3HOY J;  4KN4 X;  3OYK A;  2IGO A;  3GEZ A;  1P7I A;  1WHU A;  3RJP A;  2A6H F;  1PVE A;  4U7D A;  1TLH B;  1PUF B;  3KYC B;  4PFO A;  3QPS A;  4EJW A;  1YE9 A;  3E0J B;  3ZGK A;  4E4H A;  5BPI A;  2NVQ J;  1S8N A;  1ETY A;  2VC1 A;  1KON A;  3GLX A;  2B0L A;  4XR6 A;  5D4R A;  4UV8 A;  4F55 A;  2OZU A;  3FBI B;  3EUA A;  1T0F C;  1SD5 A;  2CUE A;  2KPM A;  3P9I A;  1J09 A;  1T95 A;  1FYK A;  4ZTF A;  4MFD A;  3CCL I;  1USS A;  2AXL A;  1IN7 A;  4FIS A;  2V1X A;  5D5W B;  4WK8 F;  1ON1 A;  4HZF A;  4MQV A;  5D8L B;  2WTE A;  3PNY A;  4KIG A;  2K86 A;  3KZZ A;  3FM5 A;  3ZQL A;  1HBX G;  3KEQ A;  5E79 C;  1IV8 A;  4CDG A;  4ZJZ A;  1WH7 A;  3WTT C;  2VXD A;  2JUG A;  4G8X A;  2L4M A;  4L9V A;  3SZT A;  2M1B A;  2EFQ A;  2M45 A;  3GO5 A;  3VYS B;  4F93 B;  3MD2 A;  4NHJ A;  1P4A A;  5KAI C;  1VFC A;  3E6D A;  4DYR A;  3U21 A;  3OSG A;  4AYB A;  1R00 A;  4C3J J;  4IKF A;  2BHZ A;  4FHT A;  2E36 A;  1WJB A;  2L3D A;  4RGR A;  2L7Z A;  4WXH A;  5J1U A;  2PG4 A;  5J4V A;  2FQ3 A;  1A5J A;  1P6R A;  1RC9 A;  3L2R A;  2EA2 A;  2VBW A;  2NS8 A;  2F4I A;  5B3S H;  2M7B A;  1WVR A;  4LOC A;  4L9J A;  3SFZ A;  2VON A;  4O5V A;  1KQ8 A;  3FM3 A;  1I39 A;  1R4N B;  2CYY A;  2FML A;  2EQR A;  3LL7 A;  2VPR A;  3PL8 A;  3L7W A;  1P4W A;  3ZCO A;  3HIF A;  2EJR A;  1JJ8 C;  1SFU A;  1DPU A;  1YX5 A;  3CDL A;  5DS9 A;  3GTO J;  3CF5 F;  4S05 A;  1BW5 A;  1ONV A;  5DM6 F;  3L2V A;  3M8J A;  3OYE A;  3JRI A;  1OLT A;  1SD4 A;  3W2A A;  4MFE A;  1FBU A;  1L0O C;  4G7H F;  4RGS A;  3K4M A;  3KYL A;  2OC6 A;  2CMP A;  5J6X A;  3B6A A;  2EIJ H;  1IV6 A;  3J7A O;  1MMD A;  3TGN A;  2EFP A;  3NWT A;  2CQX A;  2OV7 A;  1A36 A;  2L4A A;  1R22 A;  3S1Q J;  2FOK A;  4B3A A;  5CQG A;  2IS6 A;  1UFM A;  3UKG A;  1U2W A;  3PSF A;  2P6T A;  5EGO B;  3ABL H;  1Y0U A;  4AD9 A;  1BN5 A;  3HOV J;  1OR7 A;  2LY9 A;  2OQR A;  2HTS A;  3FMS A;  2QYO A;  3UNG C;  5FLX Z;  1BR4 A;  4LB6 B;  5IOY A;  4XN0 A;  4ZDP A;  5K5R A;  1C0W A;  1ZH5 A;  2A68 F;  5FRM A;  3JCU C;  1YO5 C;  3ZR8 X;  5HOO A;  2QEN A;  4KDP A;  2DMT A;  1F1Z A;  3G2B A;  2DW4 A;  3BR2 A;  2X6O A;  2ZO4 A;  5HLI A;  3F21 A;  2EA4 A;  1JUS A;  1IDZ A;  4GYI A;  1CF7 A;  2MD0 A;  1VQN I;  4AIK A;  3R0A A;  4M72 A;  4HOB A;  3T5X A;  2WAE A;  4RLF A;  3TP3 A;  3KYD B;  3S1M J;  1IN4 A;  2DU9 A;  2XB5 A;  3IKV A;  1O7L A;  4XIC A;  3DTE A;  4NUB A;  1ZEL A;  2ZSI B;  1OCC H;  2CFO A;  4ITV A;  1HSJ A;  3J80 K;  3ZPL A;  2Q0O A;  3V8L A;  2Y0S N;  3E7L A;  2R5Z A;  5B66 C;  1A6Q A;  3A03 A;  2XHK A;  3M1E A;  3S1R J;  2F5F A;  1WJF A;  1UEL B;  1G8X A;  3AFH A;  2D5V A;  1K61 A;  1XDS A;  2R7U A;  1HST A;  1JXS A;  4BS9 A;  2Y31 A;  2PMZ N;  2FNP A;  1D0Y A;  2KRF A;  4AIJ A;  5LHI A;  3I4P A;  3O8H A;  3L2Q A;  4FTH A;  4ZYH A;  1MKM A;  2BVL A;  1DPR A;  1K83 J;  1OIS A;  1E3H A;  2ECB A;  4RMN A;  5KK1 A;  3CCM I;  2KL4 A;  5BNG A;  3KX2 A;  4MQ9 F;  1B9N A;  3SJM A;  4EJU A;  2O6G E;  3HTS B;  4BUP A;  1TT0 A;  4A3K J;  4HV6 A;  2R7Q A;  2H09 A;  1VQ5 I;  3P9K A;  2LBF B;  4BEH B;  3F8M A;  1R1T A;  4A3I J;  4LLN A;  2QSH X;  2IA2 A;  4R79 A;  4BYY A;  4HX7 A;  4RB2 C;  2W1O A;  5M3F J;  4GDF A;  3F72 A;  2DA3 A;  1KU3 A;  3H3U A;  1FOK A;  1BI3 A;  3G73 A;  2AXT C;  2CQQ A;  1MMS A;  1SEU A;  3ZXS A;  2DDB A;  5H2F C;  4UY8 I;  1E17 A;  3Q9S A;  2RN7 A;  2VOD A;  4UV9 A;  1MNE A;  2A69 F;  3KE2 A;  1I6X A;  2PJR B;  5F0F A;  2DQR A;  1VQ8 I;  3RZD J;  2RAE A;  3BG5 A;  2ELK A;  1I50 J;  4HNT A;  1KQ9 A;  5IP9 J;  1W7P B;  1YW9 A;  1MDM B;  1RR8 C;  2MA3 A;  2HS5 A;  5C4X J;  3WG7 H;  3MN2 A;  1ZG5 A;  3GBG A;  2K9M A;  1XX5 A;  3VPR A;  2IA0 A;  2A5W A;  2P8T A;  2A3S A;  1YI2 I;  4A3B J;  2FF4 A;  4E7J A;  4OAY A;  5CJ9 A;  2I10 A;  1T39 A;  3HKZ N;  1ZKG A;  1ETW A;  1OYW A;  2V79 A;  4FE4 A;  2ZJQ F;  5LLQ A;  3CUQ A;  2M9H A;  3CLQ A;  3DEU A;  1JHF A;  4QWQ A;  4XLC A;  1KU7 A;  1AHD P;  1SVO A;  2HQN A;  4HBL A;  2V9K A;  1TW3 A;  2H8R A;  1FTZ A;  2R92 J;  3CC7 I;  2CQ7 A;  3HG9 A;  2R5Y A;  2VOO A;  2HZD A;  4ZZL A;  1LE8 A;  1R6R A;  2XIG A;  4HRI A;  3R60 A;  1MJA A;  1VQ4 I;  2NVY J;  2EZI A;  2JJ7 A;  2PBI A;  1LDK B;  3WU0 A;  1DP3 A;  2BOL A;  2ID6 A;  4EMS A;  2IGM A;  5IPA A;  4QIW N;  1V5E A;  1QQI A;  3JRC A;  1D5Y A;  5E3M A;  1IO2 A;  3SZG A;  4KNY A;  1R36 A;  2GIV A;  2JA6 J;  5HNH A;  2L02 A;  4NC8 A;  3R61 A;  1AKH B;  4E70 A;  4IQ4 A;  3VFZ A;  5HLT A;  4KUM A;  4A0X A;  3JSP A;  4L9T A;  1FC3 A;  3TO9 A;  4RB3 C;  1TWG J;  1BI0 A;  3SFI A;  2HQA A;  4KA4 A;  1OCT C;  3E6C C;  2W7N A;  4A3E J;  3CD6 I;  4Q5S F;  2B63 J;  1GXQ A;  2H27 A;  1ZGA A;  4HX8 A;  1LNW A;  3C3W A;  2QQ9 A;  1XD7 A;  5CYV A;  5J1R A;  1KA8 A;  4YEL A;  1R23 A;  2VKH A;  3I59 A;  1QZY A;  1UCR A;  1F5T A;  2BEO A;  4L9N A;  1OJL A;  3F8F A;  3U1K A;  2HI3 A;  2ECC A;  2XUB A;  3D1N I;  1LFP A;  4BQQ A;  1UG2 A;  4DW6 A;  3OR1 C;  2OD5 A;  2OBP A;  2DTR A;  3QAH A;  1Y6I A;  1TW2 A;  5IP7 J;  3CES A;  2RKH A;  3OIO A;  4D7N A;  4EM1 A;  4YFN F;  4BBR J;  1ZRF A;  3GCM A;  2VL8 A;  3CF2 A;  1D1C A;  1P7J A;  2R7X A;  2F5C A;  1G3T A;  2VAS A;  2WY7 Q;  4LK1 F;  4JP0 A;  3FHZ A;  3PNT A;  3FX3 A;  4JOM A;  4IOA F;  4A6E A;  3GTL J;  2P5K A;  4YFX F;  2F5V A;  2RQQ A;  1FY7 A;  2VT3 A;  2XGD A;  4CYC B;  1NG6 A;  3PO2 J;  3TMO A;  3Q9V A;  4N9I A;  2LSO A;  3O2P E;  3F6O A;  1Y0N A;  1CGP A;  2KDO A;  5EJC A;  4CCN A;  3COA C;  3E5X A;  4UUS B;  5EZH A;  2COM A;  1BA5 A;  2MD5 A;  5BQT A;  4F91 B;  5JI6 A;  2KIQ A;  4G7Z F;  1RRJ A;  1GVD A;  4BKX A;  2WAQ A;  1MH3 A;  4KMU X;  4C2U A;  2E35 A;  3ASN H;  4RAG A;  3DTK A;  2CV2 A;  2M5W A;  2M34 A;  1IRG A;  1XCV A;  2R4G A;  2YR2 A;  2ZKZ A;  2DFH A;  2QUF A;  3MKW B;  1W5T A;  2GA1 A;  3CC4 I;  4ENN A;  2DA1 A;  1QHH D;  3BOQ A;  2FUG 2;  2HXI A;  1DUX C;  1LDJ A;  2LK2 A;  2HZT A;  4ON0 A;  1R5I D;  4OWR B;  3G6E I;  4BE1 A;  4W1U A;  2Y9Z A;  3EYI A;  1OMI A;  1ZRC A;  2MBF A;  4B48 A;  2VC0 A;  5HDK A;  4GCV A;  4I98 B;  4FX4 A;  4RAZ A;  1G2H A;  3BC8 A;  2HVQ A;  4IZZ A;  3K9T A;  2IGN A;  4WF2 A;  3H5N A;  2R7D A;  3GZ6 A;  2K27 A;  2I8D A;  4PUS A;  2K3F A;  2EZH A;  4OOI A;  3S2W A;  1LFB A;  5IT3 A;  2C6Y A;  5EEA A;  1HW5 A;  2WBM A;  4E7I A;  3G1M A;  2FSW A;  1XMX A;  2BBY A;  3QU6 A;  2W25 A;  2JA7 J;  1FEX A;  2QF7 A;  4DGW B;  3M8F A;  4GXO A;  4ANJ A;  4M73 A;  5KHD A;  2FEZ A;  1WPK A;  5H6R A;  1R1V A;  2PQ8 A;  1IDY A;  1SAN A;  3J81 K;  1G3S A;  1XMA A;  2KHM A;  2V4J C;  3BWG A;  2XVC A;  1FX7 A;  3OR2 C;  4P5O A;  1U5T A;  4Y17 A;  2M4K A;  5DYM A;  4P9U A;  1SC7 A;  1BJA A;  2K9Q A;  3AG4 H;  1PDN C;  4M6V A;  1K78 B;  1K79 A;  4WCG A;  1P92 A;  1OCP A;  1LEA A;  5EEH A;  4H4K C;  3QPH A;  1W1W E;  2V9V A;  5CLS A;  3CJR B;  3ZOB A;  3ZP5 A;  1T56 A;  3IHU A;  1BIB A;  2Q2E A;  3CDI A;  1WRJ A;  1IN8 A;  4RGX A;  1SAU A;  1TC3 C;  2DK5 A;  2F5D A;  2KZV A;  4F7Z A;  4N9H A;  3CCU I;  3S14 J;  5CQE A;  2LNB A;  4HA8 A;  3CC2 I;  2EIL H;  1H9G A;  4L5I A;  4PJN A;  1O3Q A;  3K10 A;  2KKO A;  1UAA A;  2YX7 A;  4XN3 A;  3T1B A;  1HKT A;  1BR1 A;  1TQP A;  1Z7U A;  5DEQ A;  5FKO A;  4XRF A;  3TW7 A;  4R1H A;  2FRH A;  4S0H B;  2WA0 A;  2MLG A;  2LP0 A;  2CQK A;  3I4M J;  3BJO A;  2KT0 A;  1WJ5 A;  4C2T A;  2FE3 A;  1FWZ A;  1HW1 A;  1WH5 A;  2LVS A;  2XGX A;  4DYQ A;  2DA4 A;  2VT2 A;  2FBK A;  3KP5 A;  3QYE A;  1OCO H;  3BQZ A;  4EAT A;  5FKN A;  2BW3 A;  2CQN A;  3CMM A;  3F0C A;  1I1S A;  2EV5 A;  1B8I A;  1O4X A;  3KEO A;  1WCM J;  3H9Q A;  1H89 C;  1G4D A;  1A35 A;  2LKS A;  1W5C C;  2CW8 A;  4QPO A;  5JFR A;  2Z33 A;  1JJ6 C;  2EWN A;  1YRN B;  5GP9 A;  4PJM A;  2MGQ A;  4D1Q A;  1P9Q C;  3HDD A;  5LRR A;  2O61 A;  3H3V K;  2CO5 A;  1G3W A;  3TO7 A;  1K7A A;  1HDP A;  2OJE D;  3S32 A;  1KZH A;  2VJJ A;  1Y1W J;  2HOT A;  4H0E A;  4QLC U;  2IA1 A;  2AQE A;  2QCO A;  3U1D A;  3P5J A;  1FPQ A;  1T6S A;  3E6B A;  3WTS C;  1GT0 C;  4PGH A;  2JWT A;  4G9Y A;  4EV0 A;  4E7Z A;  1QHG A;  2H6C A;  2GWR A;  2DTZ A;  4UUV A;  3GUD A;  4M74 A;  4IL6 C;  5EG0 A;  3I53 A;  2E2I J; 
#chains in the Genus database with same CATH homology
 5J1U A;  1A5J A;  1JKO C;  1IG7 A;  3LNQ A;  2NS8 A;  2MW8 A;  4LOC A;  2CU7 A;  4IEJ A;  4Y7N J;  3BR1 A;  4M3F A;  2LFB A;  3BTI A;  3ZQC A;  1ZQ3 P;  2COB A;  2XPW A;  4BY7 J;  1QPI A;  3BR5 A;  3DEW A;  3JRD A;  1YRN A;  3M3Y J;  3A01 A;  3S17 J;  2EQR A;  3K2A A;  2VPR A;  3O8G A;  1RES A;  4GFB A;  1QRY A;  2ZB9 A;  1JJ8 C;  3TP0 A;  2IAI A;  1UHS A;  3CDL A;  5DS9 A;  1HDD C;  4XRM A;  3GTO J;  1BW5 A;  3S2H J;  1ZR2 A;  3JRB A;  1ETX A;  2NOG A;  3BQY A;  4V2F A;  3JRI A;  3M4O J;  3MKL A;  4IHV A;  2M0C A;  2XPU A;  4MFE A;  1MBH A;  2Y9Y A;  2E1O A;  1W0T A;  3BT9 A;  2JA5 J;  4D5F A;  1XS9 A;  3GTJ J;  2ID3 A;  3QPL A;  1Q1V A;  3B6A A;  2K40 A;  1IV6 A;  2CUF A;  4XK4 A;  5FLM J;  2EZL A;  2GM4 A;  2CQX A;  3NAU A;  3Q0V A;  3S1Q J;  4B3A A;  1JKP C;  2R5Z B;  1MNM C;  3UKG A;  5EGO B;  1X2N A;  1U78 A;  2K9N A;  3BTL A;  1TWA J;  1JT0 A;  1AU7 A;  3HOV J;  2LY9 A;  2DMN A;  2DMU A;  2OF7 A;  1H8A C;  2NVX J;  2L7F P;  5IOY A;  5FJ8 J;  1MBF A;  4W97 A;  1MSE C;  3HEF A;  2L0K A;  1FIP A;  2DMT A;  3L1P A;  2DMP A;  3BR2 A;  2X6O A;  4A3D J;  1JUS A;  1IDZ A;  1APL C;  1QVT A;  4HNV A;  3JRA A;  5C4J J;  3TP3 A;  4B1R A;  2DN0 A;  4Y52 J;  3S1M J;  3BR0 A;  2XB5 A;  4XIC A;  3MVP A;  4J19 A;  5EDN A;  2HQ5 A;  5GPC A;  2TRT A;  2R5Z A;  2Y0S N;  3E7L A;  3LSR A;  3OSF A;  1U8B A;  1TWH J;  3NAR A;  3A03 A;  4MO7 A;  1VF9 A;  2EZK A;  5EGO A;  3S1R J;  1BL0 A;  2D5V A;  3CMY A;  3IH4 A;  1K61 A;  3HOW J;  2Y31 A;  2PMZ N;  3O8H A;  4FTH A;  5J3L A;  1JTY A;  3ZQG A;  5M5Y J;  2DMQ A;  4AC0 A;  1GUU A;  1K83 J;  2ECB A;  3BR3 A;  3G1L A;  2L7M P;  2MG4 A;  4JX4 A;  5C3E J;  5BNG A;  2CRG A;  1TWC J;  1BW6 A;  2VKE A;  3JRF A;  3SJM A;  1ZGW A;  3PO3 J;  4D5C A;  2YS9 A;  2LLK A;  4I76 A;  2XB0 X;  4A3K J;  4DZJ A;  1ETK A;  2XGE A;  3BTJ A;  4MLO A;  1B72 B;  1MBE A;  4L5E A;  2M8G X;  2E2H J;  2P81 A;  4A3I J;  5F08 A;  2HOA A;  5M3F J;  2DA3 A;  4XRS G;  1SFO J;  1Z77 A;  1RPW A;  1BJZ A;  1Z0X A;  2CQQ A;  2R5Y B;  2YU9 J;  9ANT A;  2ME6 A;  3GTM J;  1LE8 B;  2WV1 A;  4UUT A;  1ZR4 A;  5F0F A;  4M3B A;  5E3L A;  3RZD J;  2RAE A;  3BG5 A;  4IHY A;  1POG A;  3CQZ J;  2ELK A;  1I50 J;  4A3C J;  5K7H A;  3WHC A;  5IP9 J;  4A3L J;  2AHQ A;  2O8K A;  3HOZ J;  2YUS A;  5C4X J;  1WGX A;  1RKW A;  3MN2 A;  4QTR A;  2E2I J;  3GBG A;  3VPR A;  5J1Y A;  1EF4 A;  4EEF G;  4A3B J;  2GLO A;  1JGG A;  5IP6 A;  1JUP A;  4RBO A;  1NK2 P;  1ZTR A;  2I10 A;  1OFC X;  3DCF A;  3HKZ N;  1ZKG A;  1A6I A;  1ETW A;  2H1K A;  3W6V A;  5F0H A;  1B72 A;  4FE4 A;  4I6Z A;  2M9H A;  5FKM A;  4B4C A;  5JLX A;  2E19 A;  3H0G J;  3WHB A;  3JR9 A;  2IEK A;  1AHD P;  3GTQ J;  5F1J A;  2H8R A;  2TCT A;  3LSG A;  1FTZ A;  2R92 J;  3OOU A;  2KDZ A;  2R5Y A;  2FJ1 A;  2WAQ N;  3ZQI A;  5EF6 A;  2ME0 A;  5F0C A;  4BXX J;  1LE8 A;  4BY1 J;  1RET A;  2X9D A;  2NVY J;  2EZI A;  2JJ7 A;  1MBK A;  1ENH A;  2ID6 A;  3IH2 A;  2XGC A;  4DZP A;  5IPA A;  3Q3S A;  4QIW N;  3S15 J;  3JRC A;  5DTD A;  2LTP A;  1D5Y A;  1IGN A;  5E3M A;  1HOM A;  1W0U A;  1RKT A;  1IC8 A;  4NDL A;  4A3M J;  3FK7 A;  2JA6 J;  2HOS A;  1AKH B;  4M3E A;  3GTG J;  1UMQ A;  4IHX A;  3FIS A;  2GBY A;  1NK3 P;  1DU0 A;  3HOU J;  4M3G A;  1MBJ A;  1TWG J;  5M3M J;  4BBS J;  5F04 A;  4A3J J;  3SFI A;  3S16 J;  1OCT C;  2L9R A;  1Y1V J;  4A3E J;  3HGY A;  2DA7 A;  2B63 J;  3Q0W A;  1JT6 A;  5J1R A;  2FX0 A;  3C2B A;  2MSY A;  3BR6 A;  3B6C A;  3HGG A;  4D7M A;  1OJL A;  5M5X J;  1FTT A;  3RZO J;  2HI3 A;  2ECC A;  2HXO A;  3BG9 A;  3D1N I;  1UG2 A;  3ZQF A;  4DW6 A;  5GPA A;  5IP7 J;  3OIO A;  4D7N A;  4BBR J;  2LKX A;  1P7J A;  4C3I J;  2R7Z J;  2R93 J;  4FCY A;  4JP0 A;  4XID A;  2OPT A;  1AKH A;  1ORK A;  3PM1 A;  3GTL J;  5FKK A;  2XGD A;  4CYC B;  3PO2 J;  1JTX A;  5IYD J;  4RDU A;  1ETQ A;  4X1E A;  3JRE A;  3GTK J;  1F43 A;  5E3O A;  4X6A J;  3BTC A;  2K9S A;  4AUX A;  5C44 J;  2XPV A;  4C3H J;  2VI6 A;  1U9N A;  1U9O A;  2Y2Z A;  1GDT A;  1IRZ A;  3HBL A;  4UUS B;  5EZH A;  3G1O A;  5JLW A;  1BA5 A;  1F36 A;  1E3O C;  1HF0 A;  3SDG A;  5FKL A;  1GVD A;  4BKX A;  1MH3 A;  1ZK8 A;  2DA2 A;  3ZQH A;  2CJJ A;  3RQI A;  1NTC A;  4A3F J;  1ITY A;  2M34 A;  2N8G A;  2W48 A;  2X48 A;  2O9L A;  4JX5 A;  3LSJ A;  1JKQ C;  5K7F A;  4XRS A;  1JKR C;  5F27 A;  2DA1 A;  3LSP A;  2HXI A;  1WI3 A;  2LK2 A;  2Y9Z A;  4W1U A;  4JYK A;  4CYC A;  1HCR A;  5K7Z A;  1G2H A;  1T33 A;  3FIW A;  3RKQ A;  5IOZ A;  2EZH A;  1LFB A;  1IUF A;  4UUS A;  1FIA A;  5IYB J;  2XRL A;  5EEA A;  1XC5 A;  3HB9 A;  5E3N A;  3G1M A;  4QSH A;  2JK3 A;  1XG1 A;  3IV5 A;  1FEX A;  1LFU P;  2IBD A;  2QF7 A;  2JA7 J;  1FJL A;  3JRH A;  2HDD A;  2WB1 N;  1WPK A;  3HOX J;  1IDY A;  1GV5 A;  1SAN A;  2LR8 A;  4DYC A;  4AYB N;  1VND A;  5M5W J;  1IJW C;  1HLV A;  2K9Q A;  2AO9 A;  2O7O A;  4M6V A;  1CQT A;  2G0E A;  2EH3 A;  3QQA A;  1B8I B;  1OCP A;  1VI0 A;  5EZG A;  4MIM A;  1X58 A;  2R0Q C;  3IH3 A;  3BG3 A;  3ZOB A;  1MH4 A;  1T56 A;  4G12 A;  3JRG A;  1H88 C;  2M2E A;  3HM5 A;  5IYC J;  3TED A;  1X2M A;  1TC3 C;  3S2D J;  2DA6 A;  3S14 J;  4A69 C;  5EYR A;  1DU6 A;  2NS7 A;  2FD5 A;  3HOY J;  5FKO A;  3TW7 A;  3Q0U A;  4S0H B;  2FQ4 A;  5FLV A;  1S7E A;  1P7I A;  2HYJ A;  2LP0 A;  1ETV A;  3I4M J;  2LD5 A;  2KT0 A;  1MSF C;  2LVS A;  1PUF B;  1WH5 A;  4DYQ A;  3QPS A;  2DA4 A;  4C2M J;  1I6H J;  5EG0 B;  3FK6 A;  2NVQ J;  2Y30 A;  3BQZ A;  5FKN A;  1ETY A;  3F0C A;  4FE7 A;  1B8I A;  1O4X A;  1JUM A;  1WCM J;  1H89 C;  1GV2 A;  1MBG A;  2CUE A;  1JJ6 C;  2DA5 A;  1YRN B;  1I3Q J;  3I4N J;  2VKV A;  5GP9 A;  2MGQ A;  3A01 B;  4MFD A;  3HDD A;  4ABZ A;  3S1N J;  4FIS A;  3H3V K;  3A02 A;  3GTP J;  1RR7 A;  2NVT J;  1HDP A;  2EBI A;  2JN6 A;  4JX6 A;  1ETO A;  4A93 J;  1Y1W J;  3LOC A;  5HOD A;  3ZQL A;  2HOT A;  2E2J J;  1WH7 A;  3FKI J;  1TWF J;  4M3D A;  2DJN A;  2QCO A;  2XSD C;  4A3G J;  2JMW A;  4V2G A;  1R9T J;  1GT0 C;  3CCY A;  2JWT A;  4IHW A;  3K7A J;  1VFC A;  4DYR A;  2DTZ A;  3TW6 A;  3OSG A;  2JA8 J;  1PUF A;  2VUM J;  1QVU A;  4C3J J;  5EG0 A;  2L7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...