2LK2A

Solution nmr structure of homeobox domain (171-248) of human homeobox protein tgif1, northeast structural genomics consortium target hr4411b
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
MGHHHHHHSHMLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Homeobox protein TGIF1
publication title Solution NMR structure of homeobox domain (171-248) of human homeobox protein TGIF1, Northeast Structural Genomics Consortium Target HR4411B.
rcsb
source organism Homo sapiens
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lk2A01
4M3GA 1BL0A 1MBKA 2XPWA 1JGGA 3JRIA 1W0UA 1GV5A 3BT9A 2TRTA 3BQYA 1ETWA 1MBGA 2M9HA 4QIWN 4CYCB 1P7IA 1X58A 1O4XA 2CU7A 3S15J 1U9OA 3GTGJ 4MIMA 2Y0SN 4ABZA 5F0HA 5EZGA 3PM1A 5C4XJ 4C3JJ 1RETA 1WH5A 2NOGA 2E2HJ 2JA6J 1IC8A 3BG9A 4J19A 1GVDA 3MKLA 5IYCJ 5IOZA 4BY7J 5J1UA 2LY9A 1B72A 2M0CA 1TWHJ 4NDLA 3RZDJ 1VNDA 1TWFJ 2R5ZB 4D5CA 3G1MA 2NVYJ 2FQ4A 4XICA 1LE8A 2DMQA 1JUPA 1NK3P 2NVXJ 3HKZN 1IDZA 3BQZA 2LTPA 1VI0A 1E3OC 1B8IA 2FD5A 3CCYA 2HQ5A 2OF7A 2GM4A 3S1MJ 3TW7A 2HXIA 2DTZA 3W6VA 2DA5A 3WHBA 4A3IJ 2LVSA 2R7ZJ 3BR6A 1A6IA 3K7AJ 1AHDP 2WAQN 1UG2A 1ENHA 1H89C 4BXXJ 5DTDA 1GV2A 4JX5A 3I4NJ 2P81A 3JRFA 5FLMJ 1OCTC 1IUFA 5J1YA 3BTIA 1JKOC 2ID6A 1RKWA 1JT0A 1LFBA 4C2MJ 5K7FA 2DMTA 4I6ZA 1R9TJ 4RDUA 2E2IJ 3S1NJ 5C3EJ 4M3BA 3S1RJ 3BR0A 2KT0A 2JMWA 3LNQA 2R92J 3GTQJ 2LP0A 3ZQCA 4UUSB 3CDLA 5J3LA 1GT0C 2E2JJ 3B6CA 3A01B 1K61A 2D5VA 3FKIJ 3IH2A 5GPAA 3ZQGA 3NAUA 4X1EA 4A93J 2EH3A 5EG0A 2KDZA 1ZTRA 2CUEA 4IHWA 3JRCA 2MG4A 3GBGA 5K7HA 3G1OA 3QPLA 3CQZJ 4V2GA 4IHYA 5IOYA 4A3KJ 1OFCX 1RKTA 1FIAA 5M5WJ 1APLC 4Y52J 2X48A 5E3OA 2R5YA 2M8GX 1K83J 2HOAA 1QRYA 3JRDA 4EEFG 5FKLA 1JJ6C 2DMUA 1FTTA 2AO9A 5E3MA 3QPSA 4FCYA 3S16J 2ZB9A 2R93J 3BG5A 1PUFB 3ZQFA 2RAEA 4IHVA 3RZOJ 5GPCA 2HXOA 3HM5A 3FISA 3D1NI 1SANA 1IJWC 3HOYJ 3S14J 3S17J 2XGDA 4W97A 1X2NA 1HDPA 2Y2ZA 4D5FA 2CQQA 1T33A 2FX0A 3O8GA 2E19A 2M34A 4JYKA 4UUTA 2LK2A 3RQIA 3H3VK 2MGQA 1YRNA 4DZPA 3GTOJ 1WI3A 1I3QJ 4DZJA 2DN0A 3LSPA 1FJLA 2K9SA 3FK6A 3BR5A 2ID3A 5EEAA 4XRSG 3TEDA 5HODA 4QSHA 4A3DJ 3MN2A 4AC0A 2XSDC 4MFEA 2DA3A 1QPIA 1DU6A 3CMYA 2Y31A 2DA2A 1HCRA 2GBYA 3Q0UA 5F27A 3HGYA 1A5JA 1P7JA 2DA4A 3I4MJ 1TWCJ 3HOXJ 4M6VA 3HB9A 3L1PA 4DYCA 1U9NA 3JREA 1TC3C 3VPRA 1JT6A 3FIWA 1BW6A 3Q0WA 1MBEA 4S0HB 2XGEA 3C2BA 1W0TA 1OJLA 3HBLA 4W1UA 2L7FP 3LSGA 5FKOA 5M5XJ 4GFBA 1AKHA 5IPAA 2G0EA 2H1KA 2K9NA 3JRGA 3A03A 3S1QJ 5IYBJ 5FKKA 3IH4A 1TWAJ 4BBRJ 1ETVA 2L7ZA 4I76A 1Z77A 3JRBA 9ANTA 1HF0A 5EGOB 2IBDA 3ZQHA 3HDDA 2ME6A 2XPUA 1H88C 2CUFA 1MNMC 4A3CJ 1POGA 2O7OA 5FLVA 1D5YA 3MVPA 5BNGA 3B6AA 1FEXA 2XRLA 3G1LA 5EDNA 4AUXA 2O9LA 4IHXA 1IRZA 3JRHA 4D7NA 3GTJJ 1IDYA 4Y7NJ 2WV1A 2JA5J 4B3AA 4XIDA 1ETYA 2EZKA 1B72B 2K9QA 3K2AA 2NVTJ 1ZR2A 3BR3A 1MBJA 3BR1A 1IGNA 4BKXA 5EF6A 1XG1A 2WB1N 1UHSA 1ZGWA 2VI6A 2L7MP 4CYCA 1FTZA 1MH3A 5JLWA 2N8GA 2VKVA 3HGGA 3LOCA 1LE8B 1MSFC 1ZQ3P 2LLKA 4HNVA 2MSYA 4QTRA 5M3MJ 5FJ8J 5GP9A 1B8IB 5K7ZA 1Q1VA 2XPVA 4AYBN 3DCFA 2NS8A 1ETOA 3BG3A 1XC5A 4FISA 2LKXA 3F0CA 1DU0A 3JR9A 5IP6A 2R5ZA 2EQRA 2EZLA 1ITYA 3TP0A 5EZHA 1T56A 2AHQA 3QQAA 3PO2J 2OPTA 1JUMA 4MLOA 4JP0A 2X6OA 4IEJA 2ELKA 3M3YJ 3BTJA 3ZOBA 4A3GJ 3FK7A 1AU7A 2L9RA 2MW8A 3IH3A 3GTMJ 4DYQA 3Q3SA 3HOUJ 2LR8A 4B4CA 2NVQJ 2L0KA 2PMZN 5EYRA 4A69C 4JX6A 1RR7A 3S2HJ 4C3HJ 2DMNA 2LFBA 5JLXA 1XS9A 3HOWJ 5EG0B 1I50J 1ZKGA 3DEWA 3RKQA 2CJJA 5E3LA 2NS7A 1RPWA 1WGXA 4A3JJ 4MFDA 2ECCA 2JN6A 1VF9A 3OSFA 5F0CA 3SFIA 3PO3J 1WCMJ 4UUSA 3NARA 1VFCA 3A01A 2ECBA 2R5YB 2QF7A 2VKEA 3SDGA 4XRSA 1OCPA 2Y30A 5IP7J 1LFUP 3LSRA 4X6AJ 5F1JA 5IP9J 4M3EA 2EZIA 2E1OA 3TW6A 1ORKA 2EBIA 1HLVA 2DA6A 1JKPC 2FJ1A 5F04A 2HOTA 4FE7A 1MSEC 1CQTA 2IAIA 1HDDC 4BBSJ 5FKMA 4M3FA 5F0FA 2X9DA 5M5YJ 4XK4A 2W48A 1BW5A 1X2MA 1SFOJ 1QVUA 2IEKA 3TP3A 2HYJA 2QCOA 3JRAA 1JKQC 2R0QC 5E3NA 2XB5A 3BTCA 2JA7J 1JKRC 4JX4A 1YRNB 1ETXA 1ZK8A 2HOSA 5C4JJ 2HI3A 1PUFA 1WPKA 3GTKJ 2Y9YA 1IV6A 1ETKA 2Y9ZA 2CRGA 2GLOA 1ETQA 3E7LA 1GUUA 3HOZJ 1JTXA 1RESA 2TCTA 5C44J 3UKGA 3OOUA 5F08A 4BY1J 2LD5A 4LOCA 1F36A 2XB0X 3GTLJ 2JWTA 2EZHA 1U8BA 2COBA 1NTCA 2VUMJ 1GDTA 3S2DJ 3HOVJ 3BR2A 4DW6A 4A3MJ 2I10A 3OSGA 2H8RA 3SJMA 3IV5A 2DA7A 1WH7A 2YUSA 3LSJA 2YU9J 1HOMA 1FIPA 2DMPA 2O8KA 1UMQA 1NK2P 4FE4A 2JA8J 1TWGJ 3WHCA 2YS9A 3HEFA 1S7EA 2JK3A 1ZR4A 1IG7A 1AKHB 3ZQIA 1G2HA 5DS9A 4FTHA 4A3EJ 2K40A 5J1RA 3O8HA 3Q0VA 4A3FJ 4D7MA 1MBHA 4M3DA 1U78A 2HDDA 4RBOA 1JJ8C 2M2EA 4G12A 4A3LJ 3BTLA 1BA5A 1EF4A 3GTPJ 1H8AC 4B1RA 2VPRA 4V2FA 5M3FJ 3H0GJ 2JJ7A 3ZQLA 4DYRA 1Y1VJ 1Z0XA 3A02A 2ME0A 2CQXA 1MH4A 5FKNA 5IYDJ 4MO7A 1I6HJ 1QVTA 1BJZA 1JTYA 4A3BJ 2DA1A 2XGCA 4XRMA 3M4OJ 2DJNA 4L5EA 4C3IJ 1MBFA 3OIOA 1Y1WJ 5EGOA 2B63J 1F43A 1JUSA
chains in the Genus database with same CATH superfamily
1BL0A 1NG7A 1K78A 2GXAA 2NOJB 2F5EA 4RS8A 1BM9A 4PGGA 1JGGA 1W0UA 1GV5A 2Z99A 3BQYA 5DM6F 4KMUX 2M9HA 1X58A 4FX0A 3S15J 1N75A 3GTGJ 3CUQA 3PM1A 4LIUA 4C3JJ 4LK1F 4CYDA 3HIFA 4Q4ZF 1RETA 1WH5A 4M73A 2NOGA 3FXOA 2E2HJ 1PDNC 1XGNA 3OYHA 2FBKA 1YW9A 3MKLA 4S04A 3ROUA 1QPMA 1W5TA 5BQTA 2LY9A 4XLNF 1SVMA 2O3FA 2B0LA 1TWHJ 3K4MA 4E7ZA 5LLQA 1C0WA 2R5ZB 4GYIA 3HPHA 4M6XA 3GXOA 2CGPA 2EIJH 2VBZA 4XICA 1NH3A 1LE8A 1TNSA 1IDZA 2BVLA 3A0BC 3BQZA 3CCVI 2F5FA 2VASA 1B8IA 3H36A 2GZWA 3GZNB 4PZJA 4PFPA 2HQ5A 3KP4A 1K7AA 4LG0A 2O61A 2V9KA 2GM4A 3TW7A 2DTZA 4A3IJ 2R7ZJ 1ENHA 3FXJA 2FXAA 1XB4A 4KITB 4HAMA 1ZHFA 3JRFA 4YFKF 2DPUA 5D6EA 3BTIA 3ZGKA 2ID6A 5DD8A 3U21A 3J7ZI 1LDDA 1RKWA 4ZTJA 4PJ0C 3QYEA 4U0WA 4C2MJ 2PMHA 1R9TJ 1S72I 2E2IJ 1VQKI 2IJLA 4IOAF 3IRRA 3A01B 3PNVA 2EFNA 2NAZA 2YU3A 2BHYA 3IH2A 5GPAA 2PX9A 3ZQGA 2WWYA 5LHGA 3NAUA 2LOOA 3KP2A 1VQMI 1USTA 2E7WA 3JTHA 1SMTA 2CFXA 1N77A 2HEOA 4CUGA 1FSEA 5E20A 3F6VA 1G4DA 4WK8F 2H94A 3OYGA 3FXQA 4FQGA 4HLYA 2DK8A 3BCBA 4QWQA 4RMNA 3I59B 4B43A 4A3KJ 3CC4I 1E0EA 3S2WA 2Y69H 2DLLA 3RCOA 4KIGA 1ZGAA 2X48A 4HV5A 5E3OA 2HGCA 2BXYA 2ZMEB 1QRYA 3JRDA 4LD5A 1UELB 4HA8A 5FB2A 2L7KA 1YYVA 2BHZA 2AO9A 2F2EA 4FCYA 3CCJI 2ZB9A 5HDGA 2ISZA 3FXKA 1REPC 4KUMA 2HDWA 2B9SA 2M0MA 2RAEA 4PDKA 5J4VA 5GPCA 1WQ2A 3BZ6A 1YLFA 4C30A 3L2VA 2HXOA 4FT8A 2UXXA 4A0XA 3HM5A 3LSIA 3FHZA 4UY8I 3MQ0A 1RC9A 1IJWC 1QQIA 4W97A 3S17J 3QYFA 1HDPA 1WJDA 1R23A 2HR3A 2Y2ZA 3OYJA 5ILSA 3RJPA 2CQQA 1K4SA 1FYKA 1O7FA 2LBFB 2VODA 1MMDA 2CQNA 4LMYA 1GVJA 2H1LA 2V1DA 3NQOA 3EUKL 4DZJA 1HSTA 3WU1B 4GO1A 4F7ZA 2P7CB 1FOXA 1FOWA 1QBJA 2DFHA 2OUMA 4XM3A 3BLYA 3TEDA 4G7HF 3I53A 3PUFA 2VQLA 4H4KC 1YIJI 1GLNA 2DA3A 4BHCA 2RDPA 2MBFA 4PJMA 1QPIA 4B48A 2KIMA 2Y31A 1HCRA 4OAYA 1FP2A 5HLGA 5BS6A 2EA2A 3I4MJ 4UV8A 3HOXJ 4M6VA 4A0ZA 1S6LA 1SD4A 4DYCA 1U9NA 3N97A 2LF7A 3J7YJ 4UVBA 3CCRI 3GZ5A 2XGEA 4ZDOA 3HBLA 1J2XA 2L7FP 1G3TA 4G9YA 3HL2A 2VKHA 2E1MB 3PNTA 5E8IA 5KHDA 2ZBKA 1AKHA 1I1SA 4IX7A 4II3A 3M8JA 1V5EA 1MJ9A 3WE3A 2KKOA 3BROA 2WV0A 3SFZA 2E5ZA 4I76A 3F6OA 3OL4A 3JRBA 1SAUA 2K02A 4UB6C 1HW1A 1HF0A 2IBDA 1HSJA 4I02A 4EVIA 4I99C 1H88C 2PMZA 2RNGA 5D6FA 1ZARA 3J7AO 2L9VA 2EB7A 2K4JA 3ELKA 3KX2A 4KISA 2DFIA 2R4GA 3LL7A 4YRVA 4BDYA 1T39A 1ZAOA 1IRZA 1WJEA 1D8KA 5B5EC 2Z3YA 4E6KG 1I39A 3MKWB 4OIOF 1FPQA 4AU7A 3AG4H 1ULYA 1A35A 3BY6A 1ODDA 1B72B 2XIGA 5KCMA 3S32A 2WB1N 1HW2A 2VQCA 2QLZA 3MZ8A 2WAEA 4D0PA 3KLOA 1FTZA 1MH3A 2VKVA 2QWWA 2E5NA 4RB3C 3TO7A 4HNVA 3ZMDA 2L54A 3VB2A 5FFZA 3I0TA 1AA7A 5H6QA 3RKXA 3G6EI 3ZPLA 3CZ6A 1SD6A 3UNGC 5BPIA 2NRAC 2A5WA 1Y8RB 2CSOA 4FISA 1EJ9A 2W4SA 4BHBA 2LKXA 3KIOA 3OYKA 1MGTA 4EJUA 1R71A 4EV0A 2ESNA 2PBIA 2QQBA 4ZYAA 4F92B 4E7SA 4I09A 3KFWX 3ZOBA 3HZJA 1EH7A 2OU2A 5B3SH 1IRGA 1FBSA 4GCVA 2L9RA 5EEGA 3IH3A 3GTMJ 1TW3A 1WKMA 4Y17A 1X1BA 2Q0OA 5CVRA 3BPVA 4B4CA 2WBMA 1XPXA 4XKVA 4DNCA 1FSHA 3FWEA 5EYRA 4A69C 3WGIA 5FGMA 2UZKA 2DOEA 2X6WA 3CCLI 4LK0F 1IN5A 2LFBA 2Z2SB 4RAZA 1BBYA 4LJZF 1H9TA 4II2A 1TQIA 3DEUA 2VJ5A 1UHMA 1NG6A 1W1WE 2MH9A 5DCMB 3RKQA 1J09A 2ELHA 4MFDA 1SFUA 1MJAA 1QHHD 1FC3A 4CHUA 1VF9A 3OSFA 5F0CA 3MKYB 2IVMA 2GA1A 1VFCA 1YJWI 2R5YB 1R4MB 3WTTC 2VKEA 2D2WA 5TISC 3H3ZA 2JA2A 5IP7J 4ESJA 2M5WA 2EJRA 3A2KA 2A61A 2E1OA 2VJIA 5AONA 4XSZF 4QLCU 5CLSA 2FJ1A 3QWLA 1BC8C 3J80K 2DDAA 1Z21A 1ZG5A 1CQTA 1TQPA 1KYWA 1TW2A 2IAIA 1HDDC 4BBSJ 5F0FA 4MTEA 3IKTA 5M5YJ 4L9NA 1YQAA 1X2MA 1SFOJ 1QVUA 2IP2A 3W6JB 1TNTA 1KQ0A 2K7LA 2IEKA 2HYJA 2UUZA 3RI4A 3ABUA 3MFKA 1JKQC 2ZJRF 2OCEA 3F8BA 2VT2A 3BTCA 2G7UA 2RVCA 3SZGA 1J59A 2FMLA 1RI7A 5C4JJ 1PYVA 3RPQA 1ZYRF 4WCGA 2HQAA 2C6YA 5LHHA 3AFHA 3KP3A 2EA4A 2RNJA 4B44A 3I56I 4KN4X 1S29A 1GXQA 1KU7A 1GUUA 1HW5A 2IS1A 2FF4A 2TCTA 5C44J 2X1CA 3UKGA 3OOUA 2DTRA 3DPLC 3BJOA 2DO7A 2PJRB 1F36A 1RZ4A 3R4KA 4XLHA 3C7JA 2GXGA 2COBA 2VUMJ 2XF6A 1GDTA 2A5YB 1DPRA 4G6DA 2IRFG 3S2DJ 2W85A 5GTIC 4A3MJ 3OSGA 1CGPA 1V5FA 2HQNA 4IL6C 3PQJA 1UZCA 3SZPA 3QAHA 3LSJA 2PFBA 4B8XA 2JUGA 3VWBA 1R58A 2VJ4A 1NK2P 2IS4A 2KDOA 1TWGJ 2VQHA 2EPFA 2JK3A 1IN4A 1FT9A 3BWGA 4HLXA 3TOAA 3ZQIA 1ZR4A 3E6CC 2HNHA 2K40A 5GADJ 3H5NA 3O8HA 1UG0A 2R7QA 3L09A 4A3FJ 2X6YA 4NBQA 2OQRA 4A6DA 2HDDA 2GQQA 3SHFA 2K27A 2LREA 1FWZA 1X4OA 4G12A 2YX4A 1LQ1A 4DIQA 4UHTA 1BA5A 1E3PA 1EF4A 1H8AC 1MW7A 5H20A 2V1XA 4XOTA 1O57A 5M3FJ 2A69F 1SFKA 2BBYA 3ZMTA 4Y33A 4DYRA 1Z0XA 2CQXA 2E71A 5FKNA 3RPUD 4MO7A 3KYLA 3K9TA 3BC8A 1QVTA 1WWXA 1OR7A 4GRIA 1JTYA 4UB8C 5DDGA 2XGCA 4G7ZF 1F5TA 2IGMA 4Y15A 4I7HA 2DJNA 3LMMA 5J8FA 2XAFA 4M74A 2MLGA 4C3IJ 3M4OJ 4GYGA 1MBFA 4G6TB 3VDXA 2IT0A 3D5LA 1U5TA 2WADA 3U1DA 4KJZA 2WAFA 3JSPA 4WX9A 5A2QK 2MC4A 3CMMA 1QA6A 3BT9A 2QM3A 2ESHA 3HUGA 5LEKA 3W6KB 1YW8A 2KRHA 3ABTA 4U0VA 3X2QH 3K1MA 1IXRC 2Y0SN 3T1BA 1HKQA 2QQ9A 1IAWA 3AKZA 3IC7A 1ERDA 1P4AA 5ED4A 4OAZA 1WJAA 2ZJQF 5TRDA 1U2WA 4RGRA 1OYIA 3J7AY 3CUQC 3ISPA 3FXUA 5HS9A 5IYCJ 2ZXIA 5FD6A 3CLQA 3CJTB 2M0CA 3DPUA 1R49A 3E1SA 5JHFA 4L9TA 4NDLA 3RZDJ 4MQVA 3ASOH 1W7PB 1FOKA 2E34A 3MMYB 4D5CA 3G2BA 3FXRA 3G1MA 2ICWG 2PQ8A 2QQAA 2XF5A 2NVXJ 3HKZN 2LTPA 4ZDLA 1E3OC 3DP7A 3QOPA 3CCYA 2A6HF 5A2QZ 2OF7A 3OR2C 1Z7UA 1MNEA 3L2WA 2KZGA 4BL0B 3GWZA 2ZMEC 2W25A 3CCSI 1JE8A 2NS0A 3W3CA 3BR6A 1A6IA 3K7AJ 4BAYA 1H89C 1JHFA 5CJ9A 1PVEA 1BR4A 1GV2A 2HKOA 3RKWA 2LG4A 2ISYA 5HOOA 2L9SA 5K5QA 1OCTC 1JKOC 3H35A 3KZZA 4NQWA 2R7DA 1UJ8A 3V8LA 4A5MA 3PIOF 4A12A 1LFBA 2ADUA 3AAFA 2KHMA 3H0DA 4XQFA 2P0WA 3ABKH 1MMGA 3HTSB 1ZRFA 3TMOA 4M3BA 5C3EJ 2M7BA 2R7OA 2Y0SA 5E79C 1MJBA 2KT0A 3LNQA 1DDNA 1BR1A 4XKBA 3OYDA 3A1YA 4UUSB 4KMFA 3CDLA 1GT0C 2K85A 3O3KA 1O3QA 2YPRA 1K61A 1E17A 2F5CA 4ENJA 5D4RA 4RA2A 3FKIJ 3ZMVA 5B66C 4HEA2 3S8PA 3F8CA 4X1EA 3TKYA 5HDKA 2JTVA 3RSNA 5EG0A 5ERIA 4B3XA 1ZTRA 5J40A 2IXSA 3E3VA 4JK1X 4IHWA 3RQ4A 2ZSIB 1R36A 3HKZA 4BQOA 3GBGA 3IWZA 2M4GA 3CD6I 3CQZJ 4V2GA 3P9IA 1SD7A 3T0YA 1OFCX 1RKTA 2BE5F 4Q5SF 3JCUC 3AG3H 4Y52J 4F93B 3BDDA 3Q9SA 1W5CC 2QKLB 3SDBA 2ZC2A 1R6RA 5FKLA 4YIFA 4IHSA 3F3XA 4UXNA 5E3MA 2XAQA 3AL0B 4CCMA 3S16J 3S93A 2P7VB 1ZLKA 4C2TA 1PUFB 1OYYA 4IHVA 3RZOJ 5LBQA 3J81Z 1YO5C 1GXPA 1HKSA 1RIOH 1LUJB 3K4KA 2R7VA 2LH9A 5FLXK 4E7KA 1X1PA 2QSFX 2E35A 2NNNA 2VXZA 1LEAA 4D5FA 5L3CA 3O8GA 2IS2A 2HTJA 2M34A 2F5VA 4UUTA 2LK2A 4BQQA 4D9JA 2RREA 4IO9F 4NUBA 1YRNA 2O5RA 4DZPA 1I3QJ 1IRFA 1XSVA 1Z91A 1FJLA 2K9SA 2MA3A 2BW3A 3L7WA 1O3TA 3KP7A 3KCCA 1KQ9A 2GIVA 1MMSA 3VODA 3QP5A 5HODA 4AM3A 3ERED 4A3DJ 1KA8A 1FBUA 4L9VA 3IRQA 4AC0A 2XSDC 4MFEA 1BC7C 1AWCA 3D5SC 2O6GE 3MCZA 1ON1A 3K70C 3CMYA 1DU6A 4XLEA 2VBXA 5FLXZ 2GBYA 3Q0UA 3C3WA 2DA4A 4HRIA 5JI6A 4AIKA 2XC7A 3HB9A 2HVQA 3L1PA 4WXDA 4KDPA 2BEOA 5IT3A 5LGNA 4FETA 3MWMA 3W2AA 2IS6A 1BW6A 5GAEJ 3V8JA 4OWRB 1YFHA 1Z05A 4YELA 4S0HB 1W0TA 4IRIA 3LSGA 2PG4A 5M5XJ 1UCRA 5HLTA 4I2OA 2H1KA 1WI9A 2RQPA 4BNCA 2DJIA 5BPDA 5IYBJ 5CVJA 1ETVA 2GAUA 5CKTA 4V19K 3DTEA 5EGOB 3DFGA 2FU4A 1WRJA 2JPBA 2CUFA 2CW8A 3LQRA 4WWCA 1K78B 2EFOA 1POGA 3L2QA 2RQQA 1T08B 2O7OA 5J47A 1D5YA 5FLVA 4BXUA 1D5VA 3EYYA 4E70A 2QKMB 3B6AA 5IT9K 2W82A 1FEXA 3CCUI 3CUQB 3G1LA 1WJBA 4EM1A 3GLXA 2OJED 4PJLA 3WG9A 4ESBA 3JRHA 4U88A 3HYIA 3I58A 3HHGA 3KZYA 2CS3A 1YX3A 3WTYC 2BV6A 5K5RA 4XIDA 1B4AA 1ETYA 2L5QA 1U6GA 1ZR2A 1MBJA 1IGNA 5EF6A 3BJAA 1BIAA 3DQVC 4N0BA 4RLFA 4XMYA 4HX7A 4HBLA 2VI6A 2UXNA 5BOXA 2JRMA 4CYCA 1WHUA 1D8JA 1OKRA 1LE8B 2KJBA 3WU0A 2LLKA 4RB0A 1D1BA 4QTRA 4I0BA 5FJ8J 1G59A 1X1AA 3QU3A 5GP9A 1B8IB 5D4SA 5K5OA 1Q1VA 2VL8A 4LG0B 2OTJI 2M4KA 3DCFA 2O8XA 4HW0A 3IAM2 3CMEI 1ETOA 2FNAA 3DXJF 2BY0A 2IGKA 3OYIA 2B7EA 2FE3A 5IT9Z 2Y75A 4IQ4A 4R1HA 2DFFA 2J5OA 1STZA 1DU0A 1W5SA 3CJRB 5IP6A 1OLTA 2F4OB 3GVAA 3ZRGA 3PJRA 1ITYA 3TP0A 2Z5UA 3SQNA 2ZCWA 2A05A 1OCZH 2LSOA 4IEJA 2QENA 2A6EF 2O03A 1YITI 4O6JA 3C1DA 3TQNA 3S3OA 3FK7A 4A3GJ 3K2ZA 1AU7A 2ZJPF 3REOA 1FMWA 5KAIC 1BIBA 2NXNB 2ZNYA 3DKYA 2CYYA 1QZYA 1FYMA 2BY2A 2VONA 2PMZN 2EK5A 4JX6A 4B09A 5F1RA 1T6SA 3S2HJ 1L0OC 4C3HJ 4XRFA 3DLAA 1H0MA 2QSGX 4F52A 1I50J 1FOYA 2DW4A 2L9NA 4F91B 3R60A 1WGXA 2YR2A 4A3JJ 2HTSA 2DT6A 3WE2A 4IJAA 3SFIA 3PO3J 2PI0A 1R22A 1B6AA 3BP8A 2XAHA 2KMUA 2QF7A 1MNDA 2Y0MA 3GFLA 3SDGA 5GTHC 2Y30A 2BY3A 1LFUP 4HF1A 5IP9J 3R0JA 3CO6C 4M3EA 1Y56A 5CYVA 3TW6A 1D0YA 2P6TA 2RGVA 2X6XA 1YJNI 1K6YA 1MSEC 2NYXA 3K4CA 1VQ9I 5FKMA 1P2FA 2R7RA 1G6NA 3IWFA 1FLIA 1KQ8A 1TBXA 5DEQA 4XBFA 4RAYA 1XD7A 4JQFA 1DGWY 2WTEA 3M1EA 3TP3A 4DJAA 2QCOA 2JSPA 3JRAA 2R0QC 1YOVB 5E3NA 4AIJA 2XB5A 2JA7J 2ZKZA 2QGUA 1JKRC 1LDKB 4UNOA 1ETXA 2JUCA 1YTYA 4BS9A 4HNUA 1EKEA 3B73A 2A6TA 2VE8A 1ETKA 2X0LA 1YHQI 1MD0A 1ETQA 3HSFA 2HS5A 1RESA 5F08A 2HFHA 4UVAA 3VSKA 5CQEA 3VYUB 3OIQA 2KQRA 1TZLA 2EZHA 2LC2A 3VOEA 5L3GA 1Y0NA 2QBYA 3BR2A 1L3LA 4IKFA 2DXIA 2L02A 1VQLI 4OU0A 2ZSHB 5D8LB 1UB9A 3SJMA 3OR1C 3IV5A 1W36C 3HXLA 5ICEA 2DA7A 2Y48A 2LYCA 2YUSA 2G9WA 2IA2A 3GO5A 2YX7A 3E5QA 4BJ6C 5HVQC 1SEUA 2DMPA 4LITA 2OAZA 1IUYA 3HTUA 2FMYA 3WHCA 3WGHA 4CDGA 2QVOA 4BHPA 2HOEA 1G2HA 1AKHB 4IXAA 1WJ5A 2CW0F 3PNYA 2HYFA 3U2RA 1WZ2A 4AIHA 3ML6A 2JZYA 1RUNA 2VPLA 2MYSA 4XOPA 1JJ8C 3IL2A 3K4BA 2K4BA 2WAQA 2KIUA 3F72A 3V42A 2KRFA 3C2GA 1XCBA 3E6DA 1LEBA 4HX8A 3H0GJ 3FX3A 1DGRM 1Z6RA 1YIOA 1SAXA 3A02A 3ASNH 2A68F 3T8TA 2H8WA 1IF1A 4OMZA 4U7BA 3M8FA 1D1CA 2STWA 4DGWB 1G3SA 2FUG2 1D0ZA 3TGNA 3MZYA 4GGGA 4XRMA 1OR7C 2F48A 1E3HA 2CUZA 2FSWA 5CVVA 4XSXF 3PL8A 1BI2A 1VQNI 2WY8Q 3H9GA 1M1EB 1XMXA 1Z1DA 2KFDA 1QU3A 1XTAA 2XPWA 3ECHA 1PUEE 3EYIA 4Q47A 2TRTA 2VJJA 1ETWA 1J7KA 2XDVA 1ON2A 1P7IA 4YG2F 3IHUA 2CU7A 2LF8A 1U9OA 2FQ3A 2R7FA 4MIMA 5C4XJ 5EZGA 2V4JC 1EH6A 2X4HA 1V3FA 4PGHA 4RAGA 2V79A 4XR6A 3BG9A 4BE1A 2CO5A 1GVDA 4ZJZA 1P4WA 1XDUA 4PJNA 2CV2A 1SMYF 3V7SA 1R5ID 4HF2A 1PP8F 2XRNA 3OV8A 1VNDA 1SFEA 4G7OF 3ABLH 5J8CA 1NK3P 1JUPA 2GOXB 5L3DA 2VBYA 3H1CA 1MMAA 3OYEA 2K86A 1VI0A 4F3QA 1SVOA 4MNUA 3G71I 2G7HA 1LPQA 2JVGA 4M9XA 2Z1DA 2CW7A 2OCCH 2AQEA 3M1CA 4EM2A 2HXIA 2Z33A 3W6VA 2DA5A 2LVSA 3CESA 1KONA 1FP1D 1AHDP 4RLQA 5GAGJ 4OINF 1R1VA 4BXXJ 2XROA 1OCOH 4KN7X 3AL0C 2HYGD 3I4NJ 3EUHC 4JBAA 5DV5A 5J1YA 4EMSA 1P6RA 2CFOA 3GCMA 1IN6A 3V7CA 1TQMA 1JT0A 1VQ7I 1RR8C 3CF2A 4RDUA 1MDMA 2IGNA 3G4SI 3S1NJ 1SFXA 1KU3A 2JVHA 1VQ4I 2R92J 3GTQJ 3ZQCA 1J75A 2LNBA 3A0HC 5D5WB 3TO9A 2E2JJ 3WODF 2KISA 3NRVA 2D5VA 2QZ8A 3KP5A 1D0XA 2DU9A 5ICGA 1WJFA 3I9V2 2CG4A 2ZXWH 2EH3A 4NB5A 4ENKA 2KDZA 4A6EA 3QPTA 3G3ZA 3EETA 3DLLF 1SVLA 3JRCA 4QPOA 3OYFA 2CH0A 2CUJA 5K7HA 1OYWA 3G1OA 1T0FA 3QPLA 2BZTA 4U7DA 2WC2A 5IOYA 1QNTA 3BZKA 2XF7A 1XX5A 1FIAA 3WTSC 5M5WJ 4YIIA 4XLPF 3I71A 1LFPA 2M8GX 1K83J 1TP4A 2FA5A 2HOAA 4S05A 1IN8A 4L5IA 1JXSA 1JJ6C 2DMUA 1XMKA 1FTTA 3PQKA 4XNFA 4CGZA 2R93J 3BG5A 3WTZA 1ZN2A 4ZH4F 4OMYA 3ZQFA 1WFXA 2Q1ZB 1FX7A 3NWSA 3CF5F 3D1NI 2EFPA 4DQ2A 4ZDPA 4J00A 1SANA 2DYSH 3HOYJ 3S14J 1ONVA 2D1HA 2XGDA 2JT1A 4NC7A 2R7UA 5HNFA 1X2NA 1Z3XA 1VZ0A 1X4PA 1U8RA 2Q8KA 2PLYA 4ASNA 1LVAA 2FX0A 1LDJA 2E19A 1V5GA 5E1WA 4OIPF 2V1NA 4Z6YA 3C2HA 3GTOJ 1CF7A 1WVRA 1RUOA 4BEHA 5CVIA 5JVTA 3LSPA 1QHGA 1Y6IA 5HDNA 4PSXA 4ZTFA 2ID3A 4UUVA 4XRSG 1HBXG 4QSHA 2WY7Q 4E7JA 4CZCA 4EGZA 1ACIA 3MN2A 4ZYDA 5LRSA 4TV7A 4HV6A 4DOZA 1QZZA 3K4LA 3K1NA 1IV8A 2HPIA 5F27A 2JPCA 1P7JA 2X51A 3D5RC 3M7GA 1TWCJ 3CTAA 1LJ9A 4KFCA 1EH8A 1S5LC 4E4HA 2CV0A 3FBNB 3BZCA 2IA1A 2KZVA 1TC3C 5IY5H 1BI0A 1JT6A 3FIWA 5FO5A 4UVCA 1MBEA 2ZFWA 1OJLA 2UV1A 3I4PA 4W1UA 2VLAA 4L0ZB 5HS7A 3EUAA 3U9GA 5FRMA 5IPAA 2CQKA 3P7NA 3OOPA 2W57A 2K9NA 1ZLJA 1V54H 2V9VA 1T8IA 5LGTA 3CC7I 3BJ6A 3JRGA 5FKKA 4J01A 3IH4A 3K6GA 1TWAJ 4HYEA 4BBRJ 3DKWA 1Z77A 2XHKA 9ANTA 2FOWA 1MIJA 4ANJA 3ZQHA 2ME6A 5JHUA 2XPUA 4PCQA 1U5TB 2LMDA 4HQEA 1MNMC 2ZXJA 4A3CJ 4LFUA 4I98B 1I5ZA 3HUGB 2F4MB 3H5RA 2JQ7A 3QU6A 3W2VA 4XLAA 1LKXA 2XRLA 3E0JB 5EDNA 1OQYA 4MEXF 4C9YA 4IHXA 4RGUA 3J81K 2L2OA 3ZN0A 3FZVA 3I3LA 3JAMZ 2LDUA 1IDYA 2WV1A 2DCEA 1R7JA 4B3AA 2BGCA 1S8NA 3PFYA 4XLFA 4L9JA 2NVTJ 3BR3A 1ZGWA 4PFOA 2OC6A 2RV8A 4AD9A 5F64A 1YG2A 4NC6A 1VTNC 5JLWA 4BGDA 3HGGA 3MD2A 4CZZA 3LOCA 3C18A 2EFWA 3MEXA 3TDZC 3ERMA 2R7WA 4P1WA 5K7ZA 4HSTA 2KPMA 2MD0A 2XPVA 1K4TA 2XASA 1VQ6I 4AYBN 3P9KA 4BYYA 3E5UA 1D1AA 2RKHA 3HOTA 3V7RA 3WU2C 1X3UA 4DBQA 2NVUB 5AIQA 4LIVA 2X1EA 1IZ1A 1V4RA 4LGWA 2AQFA 3BCAA 2W24A 2R5ZA 4KIFA 2EZLA 3GFMA 2DK5A 1ZG1A 5LD2C 4NQWB 4LB5A 2PJPA 2OPTA 3PO2J 2XGXA 4MLOA 2X6OA 2ELKA 2A07F 3BTJA 5DCFA 5KVRA 3CCMI 3DU5A 1Y8QB 4ON0A 5JFRA 4IRGA 2K3FA 4U87A 3RTRA 4EQQA 2R7TA 4DYQA 2IPQX 2ZO4A 3Q3SA 5H2FC 5LFAA 2NNYA 2GXBA 2LR8A 1BJAA 2XV4S 2NVQJ 2L0KA 1HA8A 5E1ZB 3L9FA 1HKTA 5DM7F 2XVCA 2R7XA 1UHWA 4HG2A 1RR7A 2P6SA 2TDXA 5AIPA 3OS0A 5HLIA 5EG0B 1YS6A 3FDYA 3DEWA 2MH2A 2CJJA 4P5OA 2MLKA 3LSKA 5ICCA 2DFEA 2ECCA 2JN6A 1S3JA 3GZ6A 3CO7C 4A2UA 1W36D 1WCMJ 5L3EA 3LAJA 3A01A 3FM5A 3M8EA 4AYBA 4I01A 3P5JA 4O3MA 3LFUA 2ZXHA 1OCPA 2V26A 4BE2A 3LSRA 4XKWA 2HVSA 1PP7U 3EQLF 2DQLA 1LNWA 3HPGA 4HZFA 3VYRB 2EBIA 2HU9A 1HLVA 2E1CA 2DA6A 1R4NB 1JKPC 3ZR8X 2DT7B 5F04A 4YFXF 5D5VB 1ZRDA 4ITVA 4BU2A 2X85A 1ZREA 1OCCH 3IP4B 2ELJA 2FBHA 1G8XA 4FHTA 4N4OB 3N4MA 2D45A 3I59A 1ZH5A 2X9DA 3LA2A 5HLHA 2VC1A 1MKMA 2W48A 1W7PD 3I5UA 1UFMA 3HSEA 3R61A 5JVGF 3H3UA 1SC7A 2ZMEA 4CH7A 4CXFA 3RDIA 2L01A 3DV8A 3OL3A 1G3YA 5DYMA 2OBPA 1QGPA 3ZMZA 3K0LA 2R3SA 1YRNB 4K2EA 1ZK8A 2HOSA 1FZPB 4IRHA 3VFZA 3ZMUA 1WPKA 2VC0A 3WGGA 3CP8A 2BW3B 2VIXA 3IAS2 3ULQB 2HZDA 3OYAA 4CCOA 4ESFA 1TLHB 1YI2I 1JTXA 1H9GA 1PJRA 3ZXSA 4P9FA 4BY1J 2LD5A 4LOCA 1UAAA 3LAPA 4FASD 3OYLA 3GTLJ 2JWTA 3CDHA 2A3SA 1I27A 1U8BA 2LBFA 1NTCA 2OD5A 3KEYA 3W2WA 1Z9CA 1Z67A 3E6MA 3HOVJ 1FBQA 4MEYF 1Z7LA 4DW6A 1I3AA 3GMEA 2BY1A 4HSRA 3QYBA 3BPXA 4RB1A 2IA0A 3TL4X 1ZGJA 3OS1A 4R79A 4DBRA 1KU2A 3WTVC 4CCKA 1IO2A 1FIPA 1DPUA 3KETA 2E36A 5H6RA 2O8KA 4FE4A 3HEFA 4N9IA 3QP6A 2HPMA 2D1VA 3K4NA 4A3EJ 4LLGF 5J1RA 3LSTA 5E1XA 2M87A 2XAJA 4D7MA 4P55A 1MBHA 2XAUA 2V9PA 1U78A 2V6EA 1XGMA 2EWNA 4XN3A 4RBOA 2QQ8A 4F55A 2OTLI 3BTLA 2H27A 3GTPJ 2JSCA 1W4MA 3TOBA 4B1RA 3LA3A 4ZYGA 3L00A 1FMVA 4KT5C 4RGSA 4BQAA 2VPRA 4V2FA 3CMAI 3F21A 5ILUA 3HC7A 1EA3A 3GW2A 1HXDA 1OPCA 2J5PA 1J9IA 2ME0A 2GIZA 1XGOA 1MH4A 2DBBA 4HX4A 1I6HJ 2DODA 4MTDA 4A3BJ 3M9AA 2DA1A 3R6SA 2UWMA 2M1BA 4L5EA 3E5XA 2P4WA 2W84A 1OCRH 4IF4A 3Q5FA 2K9MA 3OIOA 2VBWA 3HSRA 2AXLA 3KP6A 1Z3YA 2B63J 4AVZA 3R0AA 1F43A 1JUSA 4BE0A 1WJCA 3GX4X 4M3GA 2LY1A 1R1TA 4RM3A 1MBKA 1IXCA 3AG2H 4GXOA 1O3RA 1RNLA 4L5JA 2MABA 3GEZA 3JRIA 3RYRA 4JOMA 4ENNA 2VOPA 1MBGA 1B1BA 3EPZA 4A5NA 4QIWN 4CYCB 3K1PA 1O4XA 3WG7H 3GLLA 4ZZDA 4EJTA 3BOQA 4ABZA 5F0HA 3OS2A 4QPQA 2QYOA 3O2PE 3QOEA 3ZMSA 1T2KA 3M07A 2JA6J 4N9HA 2EIKH 3HG9A 5TJJA 1IC8A 4LLLA 2COMA 3K69A 4RAFA 4J19A 4HDUA 5DD4A 5IOZA 4PJJA 3DTIA 3F8MA 4BY7J 2M3AA 4OOIA 5J1UA 5CPRB 3U1KA 3GUDA 1B72A 3ZN1A 4G8XA 3KZIC 2PMUA 1S7OA 5FFXA 1TWFJ 1R5HA 3VYTB 2QUFA 4KIBA 2NVYJ 1I6XA 2FQ4A 1A31A 4M9ZA 1I1GA 2DMQA 2YSRA 4A0YA 5EJCA 6PAXA 1X3WB 5ICFA 5CQGA 2FD5A 5K1YA 2H09A 4H0EA 3S1MJ 1DP3A 4CICA 4GDFA 3WHBA 2E1NA 3BG6A 1S7AA 4OIRF 2H6BA 3RPUA 1XN7A 3TDUC 3L2RA 4IQJA 2WAQN 1UG2A 4Y13A 5D8KB 5HNHA 4NNJA 2KLOA 5DTDA 3LSMA 4JX5A 2DT5A 2P81A 5DUIA 2FRHA 3S3NA 5FLMJ 3FM3A 1XSDA 1IUFA 2P5KA 4EGYA 5K7FA 4G6QA 2DMTA 4MGRA 4I6ZA 5DUKA 1VQPI 1IW7F 2VT3A 3BR0A 4HPQA 3S1RJ 2JMWA 1ZRCA 3OYNA 2LP0A 4Y3OA 5LEJA 4ENMA 2KIFA 5J3LA 2GOMA 3B6CA 3N05A 4I0AA 3SZTA 2MD5A 2QSHX 2ETHA 1OISA 1U0JA 3LA7A 2W1OA 2DI3A 5CVUA 4A93J 3Q9VA 3FMRA 4ZYHA 4EM0B 4BQNA 1Z6TA 3E6BA 4OIQF 5DCMA 2CUEA 2GA2A 2HWVA 2MG4A 3GYHX 1DQUA 2EV5A 3HRUA 5GAHJ 4EJOA 1ZG3A 3SYTA 1KGSA 3ZP5A 4IHYA 4BXFA 2CWEA 3I64A 2EINH 1APLC 3OYMA 1T0FC 3HRSA 2R5YA 3RYPA 1G3WA 1FNNA 4XORA 2HKXA 3TO6A 2AS5F 4HNTA 1YE9A 3K4JA 4EEFG 3CCQI 4L18B 4PUSA 3QPSA 2HQRA 2VQGA 1DP7P 3SEZA 2PN6A 2DPDA 4Z2YA 3PFIA 3FISA 4MQ9F 1K79A 1DUXC 3DBRB 4Y4RA 2DOFA 4M6YA 2K5CA 4PK4A 3MZHA 3OWTA 4M72A 4ETSA 1GHCA 3CP2A 1T33A 4JYKA 2DAOA 2M45A 2QBYB 4YFNF 2H6CA 3RQIA 3H3VK 2MGQA 1U5TC 4C2UA 1WI3A 1BR2A 5KK1A 4IHTA 1F9NA 3V4GA 2DN0A 3ZQ7A 1R5GA 3PIPF 2OZUA 3FK6A 3BR5A 4CCLA 1XGSA 1A6QA 5EEAA 2WB1A 1KYZA 4RGXA 1A36A 2EV6A 3ECOA 3KYCB 1X1CA 1S9HA 2QA4I 5B1AH 2PJRA 1EV7A 4NC8A 4E7HA 4CCNA 2GWRA 2OQGA 3JSOA 2DA2A 2W7NA 5D5UB 2LKSA 2LKPA 1VQ8I 1LVKA 3HGYA 4RB2C 1A5JA 4Q48A 1BOAA 2STTA 4IVNA 5FD5A 4IOCF 3JREA 2K9LA 4EJWA 3VPRA 3Q0WA 2I8DA 1BN5A 4PSWA 2L4AA 3WTXC 5E8GA 2HZTA 3DF8A 2CMPA 2OZ6A 3C2BA 1T38A 2R7SA 3HOSA 3QPHA 5FKOA 4GFBA 3F23A 2JRTA 2G0EA 2Q2EA 1XDSA 2K3PA 4YEJA 4M9SA 3A03A 3S1QJ 3G73A 3PUBA 1YX5A 1BI1A 2VKDA 2L7ZA 3AG1H 1XMAA 3KPHA 3L2CA 1O3SA 3HDDA 2M8EA 2VOOA 1JI8A 5LGUA 1T98A 4D1QA 3CC2I 1VQ5I 3E97A 3CDIA 3O6BB 2V7FA 3MVPA 5BNGA 2IW5A 1XCVA 5ILVA 2O9LA 4AUXA 3CJQB 2FNPA 4BH9A 4D7NA 3GTJJ 3JW4A 3OYBA 4Y7NJ 2JA5J 5D5XB 5L3BA 4MHGA 2XUBA 2BYVE 3KE2A 5B1BH 3J80Z 1YW7A 3SXYA 2W00A 3NEUA 4WF2A 2PEXA 2L3DA 2EZKA 4EATA 1J5YA 1V55H 2K9QA 3K2AA 3K70D 3FXLA 3BR1A 4BKXA 2E60A 1XG1A 1UHSA 2F5DA 3F8FA 3FKJA 1KU9A 2P8TA 5FROA 4M71A 2V6CA 4KYWA 2ZNZA 2L7MP 1T95A 4ZC3A 2N8GA 1MSFC 2EILH 1ZQ3P 2FEZA 2MSYA 2XAGA 5M3MJ 2VE9A 1A04A 5KNLA 1J0RA 3PSIA 4CSWA 4ZZLA 4IZZA 3DKXA 4XONA 2P5VA 3LSHA 1E2XA 2NS8A 1K6OA 1USSA 3CLOA 3HRTA 5KAFC 4E7IA 4B47A 2Q2EB 1WSUA 5TGTA 1JHHA 3BG3A 1XC5A 2RC4A 3FXMA 4KICA 4KA4A 1B9NA 1R00A 1ZELA 4XL9A 2VN2A 3DEEA 3F0CA 2IGOA 3JR9A 4FX4A 1QO0D 4R8HA 5J4YA 1W7PA 2V1UA 3A4CA 3CUOA 2EQRA 2ZJ2A 3LWFA 5EZHA 1T56A 4AIDA 2AHQA 3QQAA 1JUMA 4JP0A 3M3YJ 1IRXA 3ABMH 3FBIB 3LQQA 3DU6A 2KL4A 4WXCA 1MDMB 3ZCOA 1F4KA 5LHIA 2MW8A 2L4MA 2E7XA 1X1DA 4UV9A 1HQCA 5FRNA 2MC3A 1TL8A 3HHHA 3GFJA 3HOUJ 3OMYA 3K10A 3F8NA 3IKVA 2OA4A 1P92A 2DMNA 4EJVA 5JLXA 4HDVA 1XS9A 3HOWJ 1Q1HA 1VQOI 1ZKGA 2OV7A 4P96A 3FMQA 5EEHA 2ACJA 4O5VA 5E3LA 2NS7A 1RPWA 3COAC 5BMZA 2EFQA 3QODA 2Z9OA 4WXHA 2XSJC 2RN7A 4XN0A 4CCJA 1IN7A 1Y39A 1KZHA 1R1UA 3EDPA 4UUSA 3ESWB 3NARA 3FF5A 2BVMA 1SD5A 2ECBA 3ONQA 1QZEA 3TBIA 1BI3A 2DOAA 2DQRA 3H5AA 4N4NB 4XRSA 4E7LA 4BJTA 1HC8A 3CJNA 3LFKA 5F1JA 2EV0A 3ZQQA 2P5LC 2QEXI 4X6AJ 3HRMA 1U3EM 2EZIA 5JR3A 3NWTA 1ORKA 3JAMK 3DTKA 5L3FA 2KIQA 2EIMH 4LB6B 4L0YB 1OMIA 3D0SA 2M7AA 1FYLA 3B02A 2HOTA 4FE7A 3WTUC 3VYSB 4AWXB 1D3YA 4M3FA 2M30A 4XK4A 1IXSB 2FOKA 1BW5A 1F1ZA 1TTYA 1JGSA 5E18F 3MKZA 1TT5B 1FY7A 3DPTA 4U0YA 4CA0A 1N25A 1YJ9I 1XSXA 1O7LA 3H92A 2I5UA 2XKPA 4AVPA 4HOBA 3SEQA 3DBLB 2BOLA 4JX4A 2HDCA 3P9CA 1RRJA 3EUHA 2DDBA 3OY9A 1CF7B 4LLNA 1X19A 2HI3A 2F4IA 1PUFA 4YIRX 2LRDA 2WA0A 3IUOA 4BEHB 3GTKJ 3H9JA 2Y9YA 1IV6A 4NHJA 2BXZA 2Y9ZA 2CRGA 3DBHB 2DYRH 3QRFF 2CV1A 4CO8A 2GLOA 3RIRA 3E7LA 3JTGA 3HOZJ 5E17F 4XKCA 3KYDB 1NHAA 4ZYEA 4KT6A 1MMNA 2LY2A 5F6FA 4IPAA 4KNYA 4G94A 2FBIA 5J6XA 1N78A 4XLCA 3L2UA 2XB0X 3T5XA 3DWLE 3GFIA 1LB2A 3MAJA 2I10A 3UR3C 4P9UA 2H8RA 3VSLA 3OYCA 3RKYA 4BDZA 1WH7A 2YU9J 3F9KA 1HOMA 3FMSA 1UMQA 2JA8J 1P9QC 2YS9A 5HS8A 1S7EA 1IG7A 2Z16A 2KP6A 2XKOA 3KLNA 5DS9A 4FTHA 3H9QA 4HF0A 3WTWC 3BG7A 1MZBA 2CQ7A 3Q0VA 3S3MA 2VB6A 2KJCA 3KEQA 2AXTC 4M3DA 1BOBA 4HQMA 4LG3A 2O0YA 4BJ5C 2X1DA 2F6CA 2MFZA 2M2EA 3KEOA 4A3LJ 1P4XA 3PSFA 1TT0A 1B9MA 1Y0UA 5LRRA 1B59A 1AOYA 3V8KA 3T8RA 3I54A 4X0GA 3CCEI 2JJ7A 3ZQLA 1Y1VJ 3OIPA 2KRCA 3VEPA 3HJEA 4BUPA 5IYDJ 1BJZA 2E1MC 4BACA 2ZFUA 1YS7A 1X3ZB 4RM2A 3I55I 2VXDA 1Y1WJ 3FHNA 5EGOA 3F22A 2HVRA 3GF2A
chains in the Genus database with same CATH topology
4M3GA 1BL0A 1MBKA 2XPWA 1JGGA 3JRIA 1W0UA 1GV5A 3BT9A 2TRTA 3BQYA 1ETWA 1MBGA 2M9HA 4QIWN 4CYCB 1P7IA 1X58A 1O4XA 2CU7A 3S15J 1U9OA 3GTGJ 4MIMA 2Y0SN 4ABZA 5F0HA 5EZGA 3PM1A 5C4XJ 4C3JJ 1RETA 1WH5A 2NOGA 2E2HJ 2JA6J 1IC8A 3BG9A 4J19A 1GVDA 3MKLA 5IYCJ 5IOZA 4BY7J 5J1UA 2LY9A 1B72A 2M0CA 1TWHJ 4NDLA 3RZDJ 1VNDA 1TWFJ 2R5ZB 4D5CA 3G1MA 2NVYJ 2FQ4A 4XICA 1LE8A 2DMQA 1JUPA 1NK3P 2NVXJ 3HKZN 1IDZA 3BQZA 2LTPA 1VI0A 1E3OC 1B8IA 2FD5A 3CCYA 2HQ5A 2OF7A 2GM4A 3S1MJ 3TW7A 2HXIA 2DTZA 3W6VA 2DA5A 3WHBA 4A3IJ 2LVSA 2R7ZJ 3BR6A 1A6IA 3K7AJ 1AHDP 2WAQN 1UG2A 1ENHA 1H89C 4BXXJ 5DTDA 1GV2A 4JX5A 3I4NJ 2P81A 3JRFA 5FLMJ 1OCTC 1IUFA 5J1YA 3BTIA 1JKOC 2ID6A 1RKWA 1JT0A 1LFBA 4C2MJ 5K7FA 2DMTA 4I6ZA 1R9TJ 4RDUA 2E2IJ 3S1NJ 5C3EJ 4M3BA 3S1RJ 3BR0A 2KT0A 2JMWA 3LNQA 2R92J 3GTQJ 2LP0A 3ZQCA 4UUSB 3CDLA 5J3LA 1GT0C 2E2JJ 3B6CA 3A01B 1K61A 2D5VA 3FKIJ 3IH2A 5GPAA 3ZQGA 3NAUA 4X1EA 4A93J 2EH3A 5EG0A 2KDZA 1ZTRA 2CUEA 4IHWA 3JRCA 2MG4A 3GBGA 5K7HA 3G1OA 3QPLA 3CQZJ 4V2GA 4IHYA 5IOYA 4A3KJ 1OFCX 1RKTA 1FIAA 5M5WJ 1APLC 4Y52J 2X48A 5E3OA 2R5YA 2M8GX 1K83J 2HOAA 1QRYA 3JRDA 4EEFG 5FKLA 1JJ6C 2DMUA 1FTTA 2AO9A 5E3MA 3QPSA 4FCYA 3S16J 2ZB9A 2R93J 3BG5A 1PUFB 3ZQFA 2RAEA 4IHVA 3RZOJ 5GPCA 2HXOA 3HM5A 3FISA 3D1NI 1SANA 1IJWC 3HOYJ 3S14J 3S17J 2XGDA 4W97A 1X2NA 1HDPA 2Y2ZA 4D5FA 2CQQA 1T33A 2FX0A 3O8GA 2E19A 2M34A 4JYKA 4UUTA 2LK2A 3RQIA 3H3VK 2MGQA 1YRNA 4DZPA 3GTOJ 1WI3A 1I3QJ 4DZJA 2DN0A 3LSPA 1FJLA 2K9SA 3FK6A 3BR5A 2ID3A 5EEAA 4XRSG 3TEDA 5HODA 4QSHA 4A3DJ 3MN2A 4AC0A 2XSDC 4MFEA 2DA3A 1QPIA 1DU6A 3CMYA 2Y31A 2DA2A 1HCRA 2GBYA 3Q0UA 5F27A 3HGYA 1A5JA 1P7JA 2DA4A 3I4MJ 1TWCJ 3HOXJ 4M6VA 3HB9A 3L1PA 4DYCA 1U9NA 3JREA 1TC3C 3VPRA 1JT6A 3FIWA 1BW6A 3Q0WA 1MBEA 4S0HB 2XGEA 3C2BA 1W0TA 1OJLA 3HBLA 4W1UA 2L7FP 3LSGA 5FKOA 5M5XJ 4GFBA 1AKHA 5IPAA 2G0EA 2H1KA 2K9NA 3JRGA 3A03A 3S1QJ 5IYBJ 5FKKA 3IH4A 1TWAJ 4BBRJ 1ETVA 2L7ZA 4I76A 1Z77A 3JRBA 9ANTA 1HF0A 5EGOB 2IBDA 3ZQHA 3HDDA 2ME6A 2XPUA 1H88C 2CUFA 1MNMC 4A3CJ 1POGA 2O7OA 5FLVA 1D5YA 3MVPA 5BNGA 3B6AA 1FEXA 2XRLA 3G1LA 5EDNA 4AUXA 2O9LA 4IHXA 1IRZA 3JRHA 4D7NA 3GTJJ 1IDYA 4Y7NJ 2WV1A 2JA5J 4B3AA 4XIDA 1ETYA 2EZKA 1B72B 2K9QA 3K2AA 2NVTJ 1ZR2A 3BR3A 1MBJA 3BR1A 1IGNA 4BKXA 5EF6A 1XG1A 2WB1N 1UHSA 1ZGWA 2VI6A 2L7MP 4CYCA 1FTZA 1MH3A 5JLWA 2N8GA 2VKVA 3HGGA 3LOCA 1LE8B 1MSFC 1ZQ3P 2LLKA 4HNVA 2MSYA 4QTRA 5M3MJ 5FJ8J 5GP9A 1B8IB 5K7ZA 1Q1VA 2XPVA 4AYBN 3DCFA 2NS8A 1ETOA 3BG3A 1XC5A 4FISA 2LKXA 3F0CA 1DU0A 3JR9A 5IP6A 2R5ZA 2EQRA 2EZLA 1ITYA 3TP0A 5EZHA 1T56A 2AHQA 3QQAA 3PO2J 2OPTA 1JUMA 4MLOA 4JP0A 2X6OA 4IEJA 2ELKA 3M3YJ 3BTJA 3ZOBA 4A3GJ 3FK7A 1AU7A 2L9RA 2MW8A 3IH3A 3GTMJ 4DYQA 3Q3SA 3HOUJ 2LR8A 4B4CA 2NVQJ 2L0KA 2PMZN 5EYRA 4A69C 4JX6A 1RR7A 3S2HJ 4C3HJ 2DMNA 2LFBA 5JLXA 1XS9A 3HOWJ 5EG0B 1I50J 1ZKGA 3DEWA 3RKQA 2CJJA 5E3LA 2NS7A 1RPWA 1WGXA 4A3JJ 4MFDA 2ECCA 2JN6A 1VF9A 3OSFA 5F0CA 3SFIA 3PO3J 1WCMJ 4UUSA 3NARA 1VFCA 3A01A 2ECBA 2R5YB 2QF7A 2VKEA 3SDGA 4XRSA 1OCPA 2Y30A 5IP7J 1LFUP 3LSRA 4X6AJ 5F1JA 5IP9J 4M3EA 2EZIA 2E1OA 3TW6A 1ORKA 2EBIA 1HLVA 2DA6A 1JKPC 2FJ1A 5F04A 2HOTA 4FE7A 1MSEC 1CQTA 2IAIA 1HDDC 4BBSJ 5FKMA 4M3FA 5F0FA 2X9DA 5M5YJ 4XK4A 2W48A 1BW5A 1X2MA 1SFOJ 1QVUA 2IEKA 3TP3A 2HYJA 2QCOA 3JRAA 1JKQC 2R0QC 5E3NA 2XB5A 3BTCA 2JA7J 1JKRC 4JX4A 1YRNB 1ETXA 1ZK8A 2HOSA 5C4JJ 2HI3A 1PUFA 1WPKA 3GTKJ 2Y9YA 1IV6A 1ETKA 2Y9ZA 2CRGA 2GLOA 1ETQA 3E7LA 1GUUA 3HOZJ 1JTXA 1RESA 2TCTA 5C44J 3UKGA 3OOUA 5F08A 4BY1J 2LD5A 4LOCA 1F36A 2XB0X 3GTLJ 2JWTA 2EZHA 1U8BA 2COBA 1NTCA 2VUMJ 1GDTA 3S2DJ 3HOVJ 3BR2A 4DW6A 4A3MJ 2I10A 3OSGA 2H8RA 3SJMA 3IV5A 2DA7A 1WH7A 2YUSA 3LSJA 2YU9J 1HOMA 1FIPA 2DMPA 2O8KA 1UMQA 1NK2P 4FE4A 2JA8J 1TWGJ 3WHCA 2YS9A 3HEFA 1S7EA 2JK3A 1ZR4A 1IG7A 1AKHB 3ZQIA 1G2HA 5DS9A 4FTHA 4A3EJ 2K40A 5J1RA 3O8HA 3Q0VA 4A3FJ 4D7MA 1MBHA 4M3DA 1U78A 2HDDA 4RBOA 1JJ8C 2M2EA 4G12A 4A3LJ 3BTLA 1BA5A 1EF4A 3GTPJ 1H8AC 4B1RA 2VPRA 4V2FA 5M3FJ 3H0GJ 2JJ7A 3ZQLA 4DYRA 1Y1VJ 1Z0XA 3A02A 2ME0A 2CQXA 1MH4A 5FKNA 5IYDJ 4MO7A 1I6HJ 1QVTA 1BJZA 1JTYA 4A3BJ 2DA1A 2XGCA 4XRMA 3M4OJ 2DJNA 4L5EA 4C3IJ 1MBFA 3OIOA 1Y1WJ 5EGOA 2B63J 1F43A 1JUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3G A;  1BL0 A;  1MBK A;  2XPW A;  1JGG A;  3JRI A;  1W0U A;  1GV5 A;  3BT9 A;  2TRT A;  3BQY A;  1ETW A;  1MBG A;  2M9H A;  4QIW N;  4CYC B;  1P7I A;  1X58 A;  1O4X A;  2CU7 A;  3S15 J;  1U9O A;  3GTG J;  4MIM A;  2Y0S N;  4ABZ A;  5F0H A;  5EZG A;  3PM1 A;  5C4X J;  4C3J J;  1RET A;  1WH5 A;  2NOG A;  2E2H J;  2JA6 J;  1IC8 A;  3BG9 A;  4J19 A;  1GVD A;  3MKL A;  5IYC J;  5IOZ A;  4BY7 J;  5J1U A;  2LY9 A;  1B72 A;  2M0C A;  1TWH J;  4NDL A;  3RZD J;  1VND A;  1TWF J;  2R5Z B;  4D5C A;  3G1M A;  2NVY J;  2FQ4 A;  4XIC A;  1LE8 A;  2DMQ A;  1JUP A;  1NK3 P;  2NVX J;  3HKZ N;  1IDZ A;  3BQZ A;  2LTP A;  1VI0 A;  1E3O C;  1B8I A;  2FD5 A;  3CCY A;  2HQ5 A;  2OF7 A;  2GM4 A;  3S1M J;  3TW7 A;  2HXI A;  2DTZ A;  3W6V A;  2DA5 A;  3WHB A;  4A3I J;  2LVS A;  2R7Z J;  3BR6 A;  1A6I A;  3K7A J;  1AHD P;  2WAQ N;  1UG2 A;  1ENH A;  1H89 C;  4BXX J;  5DTD A;  1GV2 A;  4JX5 A;  3I4N J;  2P81 A;  3JRF A;  5FLM J;  1OCT C;  1IUF A;  5J1Y A;  3BTI A;  1JKO C;  2ID6 A;  1RKW A;  1JT0 A;  1LFB A;  4C2M J;  5K7F A;  2DMT A;  4I6Z A;  1R9T J;  4RDU A;  2E2I J;  3S1N J;  5C3E J;  4M3B A;  3S1R J;  3BR0 A;  2KT0 A;  2JMW A;  3LNQ A;  2R92 J;  3GTQ J;  2LP0 A;  3ZQC A;  4UUS B;  3CDL A;  5J3L A;  1GT0 C;  2E2J J;  3B6C A;  3A01 B;  1K61 A;  2D5V A;  3FKI J;  3IH2 A;  5GPA A;  3ZQG A;  3NAU A;  4X1E A;  4A93 J;  2EH3 A;  5EG0 A;  2KDZ A;  1ZTR A;  2CUE A;  4IHW A;  3JRC A;  2MG4 A;  3GBG A;  5K7H A;  3G1O A;  3QPL A;  3CQZ J;  4V2G A;  4IHY A;  5IOY A;  4A3K J;  1OFC X;  1RKT A;  1FIA A;  5M5W J;  1APL C;  4Y52 J;  2X48 A;  5E3O A;  2R5Y A;  2M8G X;  1K83 J;  2HOA A;  1QRY A;  3JRD A;  4EEF G;  5FKL A;  1JJ6 C;  2DMU A;  1FTT A;  2AO9 A;  5E3M A;  3QPS A;  4FCY A;  3S16 J;  2ZB9 A;  2R93 J;  3BG5 A;  1PUF B;  3ZQF A;  2RAE A;  4IHV A;  3RZO J;  5GPC A;  2HXO A;  3HM5 A;  3FIS A;  3D1N I;  1SAN A;  1IJW C;  3HOY J;  3S14 J;  3S17 J;  2XGD A;  4W97 A;  1X2N A;  1HDP A;  2Y2Z A;  4D5F A;  2CQQ A;  1T33 A;  2FX0 A;  3O8G A;  2E19 A;  2M34 A;  4JYK A;  4UUT A;  2LK2 A;  3RQI A;  3H3V K;  2MGQ A;  1YRN A;  4DZP A;  3GTO J;  1WI3 A;  1I3Q J;  4DZJ A;  2DN0 A;  3LSP A;  1FJL A;  2K9S A;  3FK6 A;  3BR5 A;  2ID3 A;  5EEA A;  4XRS G;  3TED A;  5HOD A;  4QSH A;  4A3D J;  3MN2 A;  4AC0 A;  2XSD C;  4MFE A;  2DA3 A;  1QPI A;  1DU6 A;  3CMY A;  2Y31 A;  2DA2 A;  1HCR A;  2GBY A;  3Q0U A;  5F27 A;  3HGY A;  1A5J A;  1P7J A;  2DA4 A;  3I4M J;  1TWC J;  3HOX J;  4M6V A;  3HB9 A;  3L1P A;  4DYC A;  1U9N A;  3JRE A;  1TC3 C;  3VPR A;  1JT6 A;  3FIW A;  1BW6 A;  3Q0W A;  1MBE A;  4S0H B;  2XGE A;  3C2B A;  1W0T A;  1OJL A;  3HBL A;  4W1U A;  2L7F P;  3LSG A;  5FKO A;  5M5X J;  4GFB A;  1AKH A;  5IPA A;  2G0E A;  2H1K A;  2K9N A;  3JRG A;  3A03 A;  3S1Q J;  5IYB J;  5FKK A;  3IH4 A;  1TWA J;  4BBR J;  1ETV A;  2L7Z A;  4I76 A;  1Z77 A;  3JRB A;  9ANT A;  1HF0 A;  5EGO B;  2IBD A;  3ZQH A;  3HDD A;  2ME6 A;  2XPU A;  1H88 C;  2CUF A;  1MNM C;  4A3C J;  1POG A;  2O7O A;  5FLV A;  1D5Y A;  3MVP A;  5BNG A;  3B6A A;  1FEX A;  2XRL A;  3G1L A;  5EDN A;  4AUX A;  2O9L A;  4IHX A;  1IRZ A;  3JRH A;  4D7N A;  3GTJ J;  1IDY A;  4Y7N J;  2WV1 A;  2JA5 J;  4B3A A;  4XID A;  1ETY A;  2EZK A;  1B72 B;  2K9Q A;  3K2A A;  2NVT J;  1ZR2 A;  3BR3 A;  1MBJ A;  3BR1 A;  1IGN A;  4BKX A;  5EF6 A;  1XG1 A;  2WB1 N;  1UHS A;  1ZGW A;  2VI6 A;  2L7M P;  4CYC A;  1FTZ A;  1MH3 A;  5JLW A;  2N8G A;  2VKV A;  3HGG A;  3LOC A;  1LE8 B;  1MSF C;  1ZQ3 P;  2LLK A;  4HNV A;  2MSY A;  4QTR A;  5M3M J;  5FJ8 J;  5GP9 A;  1B8I B;  5K7Z A;  1Q1V A;  2XPV A;  4AYB N;  3DCF A;  2NS8 A;  1ETO A;  3BG3 A;  1XC5 A;  4FIS A;  2LKX A;  3F0C A;  1DU0 A;  3JR9 A;  5IP6 A;  2R5Z A;  2EQR A;  2EZL A;  1ITY A;  3TP0 A;  5EZH A;  1T56 A;  2AHQ A;  3QQA A;  3PO2 J;  2OPT A;  1JUM A;  4MLO A;  4JP0 A;  2X6O A;  4IEJ A;  2ELK A;  3M3Y J;  3BTJ A;  3ZOB A;  4A3G J;  3FK7 A;  1AU7 A;  2L9R A;  2MW8 A;  3IH3 A;  3GTM J;  4DYQ A;  3Q3S A;  3HOU J;  2LR8 A;  4B4C A;  2NVQ J;  2L0K A;  2PMZ N;  5EYR A;  4A69 C;  4JX6 A;  1RR7 A;  3S2H J;  4C3H J;  2DMN A;  2LFB A;  5JLX A;  1XS9 A;  3HOW J;  5EG0 B;  1I50 J;  1ZKG A;  3DEW A;  3RKQ A;  2CJJ A;  5E3L A;  2NS7 A;  1RPW A;  1WGX A;  4A3J J;  4MFD A;  2ECC A;  2JN6 A;  1VF9 A;  3OSF A;  5F0C A;  3SFI A;  3PO3 J;  1WCM J;  4UUS A;  3NAR A;  1VFC A;  3A01 A;  2ECB A;  2R5Y B;  2QF7 A;  2VKE A;  3SDG A;  4XRS A;  1OCP A;  2Y30 A;  5IP7 J;  1LFU P;  3LSR A;  4X6A J;  5F1J A;  5IP9 J;  4M3E A;  2EZI A;  2E1O A;  3TW6 A;  1ORK A;  2EBI A;  1HLV A;  2DA6 A;  1JKP C;  2FJ1 A;  5F04 A;  2HOT A;  4FE7 A;  1MSE C;  1CQT A;  2IAI A;  1HDD C;  4BBS J;  5FKM A;  4M3F A;  5F0F A;  2X9D A;  5M5Y J;  4XK4 A;  2W48 A;  1BW5 A;  1X2M A;  1SFO J;  1QVU A;  2IEK A;  3TP3 A;  2HYJ A;  2QCO A;  3JRA A;  1JKQ C;  2R0Q C;  5E3N A;  2XB5 A;  3BTC A;  2JA7 J;  1JKR C;  4JX4 A;  1YRN B;  1ETX A;  1ZK8 A;  2HOS A;  5C4J J;  2HI3 A;  1PUF A;  1WPK A;  3GTK J;  2Y9Y A;  1IV6 A;  1ETK A;  2Y9Z A;  2CRG A;  2GLO A;  1ETQ A;  3E7L A;  1GUU A;  3HOZ J;  1JTX A;  1RES A;  2TCT A;  5C44 J;  3UKG A;  3OOU A;  5F08 A;  4BY1 J;  2LD5 A;  4LOC A;  1F36 A;  2XB0 X;  3GTL J;  2JWT A;  2EZH A;  1U8B A;  2COB A;  1NTC A;  2VUM J;  1GDT A;  3S2D J;  3HOV J;  3BR2 A;  4DW6 A;  4A3M J;  2I10 A;  3OSG A;  2H8R A;  3SJM A;  3IV5 A;  2DA7 A;  1WH7 A;  2YUS A;  3LSJ A;  2YU9 J;  1HOM A;  1FIP A;  2DMP A;  2O8K A;  1UMQ A;  1NK2 P;  4FE4 A;  2JA8 J;  1TWG J;  3WHC A;  2YS9 A;  3HEF A;  1S7E A;  2JK3 A;  1ZR4 A;  1IG7 A;  1AKH B;  3ZQI A;  1G2H A;  5DS9 A;  4FTH A;  4A3E J;  2K40 A;  5J1R A;  3O8H A;  3Q0V A;  4A3F J;  4D7M A;  1MBH A;  4M3D A;  1U78 A;  2HDD A;  4RBO A;  1JJ8 C;  2M2E A;  4G12 A;  4A3L J;  3BTL A;  1BA5 A;  1EF4 A;  3GTP J;  1H8A C;  4B1R A;  2VPR A;  4V2F A;  5M3F J;  3H0G J;  2JJ7 A;  3ZQL A;  4DYR A;  1Y1V J;  1Z0X A;  3A02 A;  2ME0 A;  2CQX A;  1MH4 A;  5FKN A;  5IYD J;  4MO7 A;  1I6H J;  1QVT A;  1BJZ A;  1JTY A;  4A3B J;  2DA1 A;  2XGC A;  4XRM A;  3M4O J;  2DJN A;  4L5E A;  4C3I J;  1MBF A;  3OIO A;  1Y1W J;  5EGO A;  2B63 J;  1F43 A;  1JUS A; 
#chains in the Genus database with same CATH topology
 1BL0 A;  1NG7 A;  1K78 A;  2GXA A;  2NOJ B;  2F5E A;  4RS8 A;  1BM9 A;  4PGG A;  1JGG A;  1W0U A;  1GV5 A;  2Z99 A;  3BQY A;  5DM6 F;  4KMU X;  2M9H A;  1X58 A;  4FX0 A;  3S15 J;  1N75 A;  3GTG J;  3CUQ A;  3PM1 A;  4LIU A;  4C3J J;  4LK1 F;  4CYD A;  3HIF A;  4Q4Z F;  1RET A;  1WH5 A;  4M73 A;  2NOG A;  3FXO A;  2E2H J;  1PDN C;  1XGN A;  3OYH A;  2FBK A;  1YW9 A;  3MKL A;  4S04 A;  3ROU A;  1QPM A;  1W5T A;  5BQT A;  2LY9 A;  4XLN F;  1SVM A;  2O3F A;  2B0L A;  1TWH J;  3K4M A;  4E7Z A;  5LLQ A;  1C0W A;  2R5Z B;  4GYI A;  3HPH A;  4M6X A;  3GXO A;  2CGP A;  2EIJ H;  2VBZ A;  4XIC A;  1NH3 A;  1LE8 A;  1TNS A;  1IDZ A;  2BVL A;  3A0B C;  3BQZ A;  3CCV I;  2F5F A;  2VAS A;  1B8I A;  3H36 A;  2GZW A;  3GZN B;  4PZJ A;  4PFP A;  2HQ5 A;  3KP4 A;  1K7A A;  4LG0 A;  2O61 A;  2V9K A;  2GM4 A;  3TW7 A;  2DTZ A;  4A3I J;  2R7Z J;  1ENH A;  3FXJ A;  2FXA A;  1XB4 A;  4KIT B;  4HAM A;  1ZHF A;  3JRF A;  4YFK F;  2DPU A;  5D6E A;  3BTI A;  3ZGK A;  2ID6 A;  5DD8 A;  3U21 A;  3J7Z I;  1LDD A;  1RKW A;  4ZTJ A;  4PJ0 C;  3QYE A;  4U0W A;  4C2M J;  2PMH A;  1R9T J;  1S72 I;  2E2I J;  1VQK I;  2IJL A;  4IOA F;  3IRR A;  3A01 B;  3PNV A;  2EFN A;  2NAZ A;  2YU3 A;  2BHY A;  3IH2 A;  5GPA A;  2PX9 A;  3ZQG A;  2WWY A;  5LHG A;  3NAU A;  2LOO A;  3KP2 A;  1VQM I;  1UST A;  2E7W A;  3JTH A;  1SMT A;  2CFX A;  1N77 A;  2HEO A;  4CUG A;  1FSE A;  5E20 A;  3F6V A;  1G4D A;  4WK8 F;  2H94 A;  3OYG A;  3FXQ A;  4FQG A;  4HLY A;  2DK8 A;  3BCB A;  4QWQ A;  4RMN A;  3I59 B;  4B43 A;  4A3K J;  3CC4 I;  1E0E A;  3S2W A;  2Y69 H;  2DLL A;  3RCO A;  4KIG A;  1ZGA A;  2X48 A;  4HV5 A;  5E3O A;  2HGC A;  2BXY A;  2ZME B;  1QRY A;  3JRD A;  4LD5 A;  1UEL B;  4HA8 A;  5FB2 A;  2L7K A;  1YYV A;  2BHZ A;  2AO9 A;  2F2E A;  4FCY A;  3CCJ I;  2ZB9 A;  5HDG A;  2ISZ A;  3FXK A;  1REP C;  4KUM A;  2HDW A;  2B9S A;  2M0M A;  2RAE A;  4PDK A;  5J4V A;  5GPC A;  1WQ2 A;  3BZ6 A;  1YLF A;  4C30 A;  3L2V A;  2HXO A;  4FT8 A;  2UXX A;  4A0X A;  3HM5 A;  3LSI A;  3FHZ A;  4UY8 I;  3MQ0 A;  1RC9 A;  1IJW C;  1QQI A;  4W97 A;  3S17 J;  3QYF A;  1HDP A;  1WJD A;  1R23 A;  2HR3 A;  2Y2Z A;  3OYJ A;  5ILS A;  3RJP A;  2CQQ A;  1K4S A;  1FYK A;  1O7F A;  2LBF B;  2VOD A;  1MMD A;  2CQN A;  4LMY A;  1GVJ A;  2H1L A;  2V1D A;  3NQO A;  3EUK L;  4DZJ A;  1HST A;  3WU1 B;  4GO1 A;  4F7Z A;  2P7C B;  1FOX A;  1FOW A;  1QBJ A;  2DFH A;  2OUM A;  4XM3 A;  3BLY A;  3TED A;  4G7H F;  3I53 A;  3PUF A;  2VQL A;  4H4K C;  1YIJ I;  1GLN A;  2DA3 A;  4BHC A;  2RDP A;  2MBF A;  4PJM A;  1QPI A;  4B48 A;  2KIM A;  2Y31 A;  1HCR A;  4OAY A;  1FP2 A;  5HLG A;  5BS6 A;  2EA2 A;  3I4M J;  4UV8 A;  3HOX J;  4M6V A;  4A0Z A;  1S6L A;  1SD4 A;  4DYC A;  1U9N A;  3N97 A;  2LF7 A;  3J7Y J;  4UVB A;  3CCR I;  3GZ5 A;  2XGE A;  4ZDO A;  3HBL A;  1J2X A;  2L7F P;  1G3T A;  4G9Y A;  3HL2 A;  2VKH A;  2E1M B;  3PNT A;  5E8I A;  5KHD A;  2ZBK A;  1AKH A;  1I1S A;  4IX7 A;  4II3 A;  3M8J A;  1V5E A;  1MJ9 A;  3WE3 A;  2KKO A;  3BRO A;  2WV0 A;  3SFZ A;  2E5Z A;  4I76 A;  3F6O A;  3OL4 A;  3JRB A;  1SAU A;  2K02 A;  4UB6 C;  1HW1 A;  1HF0 A;  2IBD A;  1HSJ A;  4I02 A;  4EVI A;  4I99 C;  1H88 C;  2PMZ A;  2RNG A;  5D6F A;  1ZAR A;  3J7A O;  2L9V A;  2EB7 A;  2K4J A;  3ELK A;  3KX2 A;  4KIS A;  2DFI A;  2R4G A;  3LL7 A;  4YRV A;  4BDY A;  1T39 A;  1ZAO A;  1IRZ A;  1WJE A;  1D8K A;  5B5E C;  2Z3Y A;  4E6K G;  1I39 A;  3MKW B;  4OIO F;  1FPQ A;  4AU7 A;  3AG4 H;  1ULY A;  1A35 A;  3BY6 A;  1ODD A;  1B72 B;  2XIG A;  5KCM A;  3S32 A;  2WB1 N;  1HW2 A;  2VQC A;  2QLZ A;  3MZ8 A;  2WAE A;  4D0P A;  3KLO A;  1FTZ A;  1MH3 A;  2VKV A;  2QWW A;  2E5N A;  4RB3 C;  3TO7 A;  4HNV A;  3ZMD A;  2L54 A;  3VB2 A;  5FFZ A;  3I0T A;  1AA7 A;  5H6Q A;  3RKX A;  3G6E I;  3ZPL A;  3CZ6 A;  1SD6 A;  3UNG C;  5BPI A;  2NRA C;  2A5W A;  1Y8R B;  2CSO A;  4FIS A;  1EJ9 A;  2W4S A;  4BHB A;  2LKX A;  3KIO A;  3OYK A;  1MGT A;  4EJU A;  1R71 A;  4EV0 A;  2ESN A;  2PBI A;  2QQB A;  4ZYA A;  4F92 B;  4E7S A;  4I09 A;  3KFW X;  3ZOB A;  3HZJ A;  1EH7 A;  2OU2 A;  5B3S H;  1IRG A;  1FBS A;  4GCV A;  2L9R A;  5EEG A;  3IH3 A;  3GTM J;  1TW3 A;  1WKM A;  4Y17 A;  1X1B A;  2Q0O A;  5CVR A;  3BPV A;  4B4C A;  2WBM A;  1XPX A;  4XKV A;  4DNC A;  1FSH A;  3FWE A;  5EYR A;  4A69 C;  3WGI A;  5FGM A;  2UZK A;  2DOE A;  2X6W A;  3CCL I;  4LK0 F;  1IN5 A;  2LFB A;  2Z2S B;  4RAZ A;  1BBY A;  4LJZ F;  1H9T A;  4II2 A;  1TQI A;  3DEU A;  2VJ5 A;  1UHM A;  1NG6 A;  1W1W E;  2MH9 A;  5DCM B;  3RKQ A;  1J09 A;  2ELH A;  4MFD A;  1SFU A;  1MJA A;  1QHH D;  1FC3 A;  4CHU A;  1VF9 A;  3OSF A;  5F0C A;  3MKY B;  2IVM A;  2GA1 A;  1VFC A;  1YJW I;  2R5Y B;  1R4M B;  3WTT C;  2VKE A;  2D2W A;  5TIS C;  3H3Z A;  2JA2 A;  5IP7 J;  4ESJ A;  2M5W A;  2EJR A;  3A2K A;  2A61 A;  2E1O A;  2VJI A;  5AON A;  4XSZ F;  4QLC U;  5CLS A;  2FJ1 A;  3QWL A;  1BC8 C;  3J80 K;  2DDA A;  1Z21 A;  1ZG5 A;  1CQT A;  1TQP A;  1KYW A;  1TW2 A;  2IAI A;  1HDD C;  4BBS J;  5F0F A;  4MTE A;  3IKT A;  5M5Y J;  4L9N A;  1YQA A;  1X2M A;  1SFO J;  1QVU A;  2IP2 A;  3W6J B;  1TNT A;  1KQ0 A;  2K7L A;  2IEK A;  2HYJ A;  2UUZ A;  3RI4 A;  3ABU A;  3MFK A;  1JKQ C;  2ZJR F;  2OCE A;  3F8B A;  2VT2 A;  3BTC A;  2G7U A;  2RVC A;  3SZG A;  1J59 A;  2FML A;  1RI7 A;  5C4J J;  1PYV A;  3RPQ A;  1ZYR F;  4WCG A;  2HQA A;  2C6Y A;  5LHH A;  3AFH A;  3KP3 A;  2EA4 A;  2RNJ A;  4B44 A;  3I56 I;  4KN4 X;  1S29 A;  1GXQ A;  1KU7 A;  1GUU A;  1HW5 A;  2IS1 A;  2FF4 A;  2TCT A;  5C44 J;  2X1C A;  3UKG A;  3OOU A;  2DTR A;  3DPL C;  3BJO A;  2DO7 A;  2PJR B;  1F36 A;  1RZ4 A;  3R4K A;  4XLH A;  3C7J A;  2GXG A;  2COB A;  2VUM J;  2XF6 A;  1GDT A;  2A5Y B;  1DPR A;  4G6D A;  2IRF G;  3S2D J;  2W85 A;  5GTI C;  4A3M J;  3OSG A;  1CGP A;  1V5F A;  2HQN A;  4IL6 C;  3PQJ A;  1UZC A;  3SZP A;  3QAH A;  3LSJ A;  2PFB A;  4B8X A;  2JUG A;  3VWB A;  1R58 A;  2VJ4 A;  1NK2 P;  2IS4 A;  2KDO A;  1TWG J;  2VQH A;  2EPF A;  2JK3 A;  1IN4 A;  1FT9 A;  3BWG A;  4HLX A;  3TOA A;  3ZQI A;  1ZR4 A;  3E6C C;  2HNH A;  2K40 A;  5GAD J;  3H5N A;  3O8H A;  1UG0 A;  2R7Q A;  3L09 A;  4A3F J;  2X6Y A;  4NBQ A;  2OQR A;  4A6D A;  2HDD A;  2GQQ A;  3SHF A;  2K27 A;  2LRE A;  1FWZ A;  1X4O A;  4G12 A;  2YX4 A;  1LQ1 A;  4DIQ A;  4UHT A;  1BA5 A;  1E3P A;  1EF4 A;  1H8A C;  1MW7 A;  5H20 A;  2V1X A;  4XOT A;  1O57 A;  5M3F J;  2A69 F;  1SFK A;  2BBY A;  3ZMT A;  4Y33 A;  4DYR A;  1Z0X A;  2CQX A;  2E71 A;  5FKN A;  3RPU D;  4MO7 A;  3KYL A;  3K9T A;  3BC8 A;  1QVT A;  1WWX A;  1OR7 A;  4GRI A;  1JTY A;  4UB8 C;  5DDG A;  2XGC A;  4G7Z F;  1F5T A;  2IGM A;  4Y15 A;  4I7H A;  2DJN A;  3LMM A;  5J8F A;  2XAF A;  4M74 A;  2MLG A;  4C3I J;  3M4O J;  4GYG A;  1MBF A;  4G6T B;  3VDX A;  2IT0 A;  3D5L A;  1U5T A;  2WAD A;  3U1D A;  4KJZ A;  2WAF A;  3JSP A;  4WX9 A;  5A2Q K;  2MC4 A;  3CMM A;  1QA6 A;  3BT9 A;  2QM3 A;  2ESH A;  3HUG A;  5LEK A;  3W6K B;  1YW8 A;  2KRH A;  3ABT A;  4U0V A;  3X2Q H;  3K1M A;  1IXR C;  2Y0S N;  3T1B A;  1HKQ A;  2QQ9 A;  1IAW A;  3AKZ A;  3IC7 A;  1ERD A;  1P4A A;  5ED4 A;  4OAZ A;  1WJA A;  2ZJQ F;  5TRD A;  1U2W A;  4RGR A;  1OYI A;  3J7A Y;  3CUQ C;  3ISP A;  3FXU A;  5HS9 A;  5IYC J;  2ZXI A;  5FD6 A;  3CLQ A;  3CJT B;  2M0C A;  3DPU A;  1R49 A;  3E1S A;  5JHF A;  4L9T A;  4NDL A;  3RZD J;  4MQV A;  3ASO H;  1W7P B;  1FOK A;  2E34 A;  3MMY B;  4D5C A;  3G2B A;  3FXR A;  3G1M A;  2ICW G;  2PQ8 A;  2QQA A;  2XF5 A;  2NVX J;  3HKZ N;  2LTP A;  4ZDL A;  1E3O C;  3DP7 A;  3QOP A;  3CCY A;  2A6H F;  5A2Q Z;  2OF7 A;  3OR2 C;  1Z7U A;  1MNE A;  3L2W A;  2KZG A;  4BL0 B;  3GWZ A;  2ZME C;  2W25 A;  3CCS I;  1JE8 A;  2NS0 A;  3W3C A;  3BR6 A;  1A6I A;  3K7A J;  4BAY A;  1H89 C;  1JHF A;  5CJ9 A;  1PVE A;  1BR4 A;  1GV2 A;  2HKO A;  3RKW A;  2LG4 A;  2ISY A;  5HOO A;  2L9S A;  5K5Q A;  1OCT C;  1JKO C;  3H35 A;  3KZZ A;  4NQW A;  2R7D A;  1UJ8 A;  3V8L A;  4A5M A;  3PIO F;  4A12 A;  1LFB A;  2ADU A;  3AAF A;  2KHM A;  3H0D A;  4XQF A;  2P0W A;  3ABK H;  1MMG A;  3HTS B;  1ZRF A;  3TMO A;  4M3B A;  5C3E J;  2M7B A;  2R7O A;  2Y0S A;  5E79 C;  1MJB A;  2KT0 A;  3LNQ A;  1DDN A;  1BR1 A;  4XKB A;  3OYD A;  3A1Y A;  4UUS B;  4KMF A;  3CDL A;  1GT0 C;  2K85 A;  3O3K A;  1O3Q A;  2YPR A;  1K61 A;  1E17 A;  2F5C A;  4ENJ A;  5D4R A;  4RA2 A;  3FKI J;  3ZMV A;  5B66 C;  4HEA 2;  3S8P A;  3F8C A;  4X1E A;  3TKY A;  5HDK A;  2JTV A;  3RSN A;  5EG0 A;  5ERI A;  4B3X A;  1ZTR A;  5J40 A;  2IXS A;  3E3V A;  4JK1 X;  4IHW A;  3RQ4 A;  2ZSI B;  1R36 A;  3HKZ A;  4BQO A;  3GBG A;  3IWZ A;  2M4G A;  3CD6 I;  3CQZ J;  4V2G A;  3P9I A;  1SD7 A;  3T0Y A;  1OFC X;  1RKT A;  2BE5 F;  4Q5S F;  3JCU C;  3AG3 H;  4Y52 J;  4F93 B;  3BDD A;  3Q9S A;  1W5C C;  2QKL B;  3SDB A;  2ZC2 A;  1R6R A;  5FKL A;  4YIF A;  4IHS A;  3F3X A;  4UXN A;  5E3M A;  2XAQ A;  3AL0 B;  4CCM A;  3S16 J;  3S93 A;  2P7V B;  1ZLK A;  4C2T A;  1PUF B;  1OYY A;  4IHV A;  3RZO J;  5LBQ A;  3J81 Z;  1YO5 C;  1GXP A;  1HKS A;  1RIO H;  1LUJ B;  3K4K A;  2R7V A;  2LH9 A;  5FLX K;  4E7K A;  1X1P A;  2QSF X;  2E35 A;  2NNN A;  2VXZ A;  1LEA A;  4D5F A;  5L3C A;  3O8G A;  2IS2 A;  2HTJ A;  2M34 A;  2F5V A;  4UUT A;  2LK2 A;  4BQQ A;  4D9J A;  2RRE A;  4IO9 F;  4NUB A;  1YRN A;  2O5R A;  4DZP A;  1I3Q J;  1IRF A;  1XSV A;  1Z91 A;  1FJL A;  2K9S A;  2MA3 A;  2BW3 A;  3L7W A;  1O3T A;  3KP7 A;  3KCC A;  1KQ9 A;  2GIV A;  1MMS A;  3VOD A;  3QP5 A;  5HOD A;  4AM3 A;  3ERE D;  4A3D J;  1KA8 A;  1FBU A;  4L9V A;  3IRQ A;  4AC0 A;  2XSD C;  4MFE A;  1BC7 C;  1AWC A;  3D5S C;  2O6G E;  3MCZ A;  1ON1 A;  3K70 C;  3CMY A;  1DU6 A;  4XLE A;  2VBX A;  5FLX Z;  2GBY A;  3Q0U A;  3C3W A;  2DA4 A;  4HRI A;  5JI6 A;  4AIK A;  2XC7 A;  3HB9 A;  2HVQ A;  3L1P A;  4WXD A;  4KDP A;  2BEO A;  5IT3 A;  5LGN A;  4FET A;  3MWM A;  3W2A A;  2IS6 A;  1BW6 A;  5GAE J;  3V8J A;  4OWR B;  1YFH A;  1Z05 A;  4YEL A;  4S0H B;  1W0T A;  4IRI A;  3LSG A;  2PG4 A;  5M5X J;  1UCR A;  5HLT A;  4I2O A;  2H1K A;  1WI9 A;  2RQP A;  4BNC A;  2DJI A;  5BPD A;  5IYB J;  5CVJ A;  1ETV A;  2GAU A;  5CKT A;  4V19 K;  3DTE A;  5EGO B;  3DFG A;  2FU4 A;  1WRJ A;  2JPB A;  2CUF A;  2CW8 A;  3LQR A;  4WWC A;  1K78 B;  2EFO A;  1POG A;  3L2Q A;  2RQQ A;  1T08 B;  2O7O A;  5J47 A;  1D5Y A;  5FLV A;  4BXU A;  1D5V A;  3EYY A;  4E70 A;  2QKM B;  3B6A A;  5IT9 K;  2W82 A;  1FEX A;  3CCU I;  3CUQ B;  3G1L A;  1WJB A;  4EM1 A;  3GLX A;  2OJE D;  4PJL A;  3WG9 A;  4ESB A;  3JRH A;  4U88 A;  3HYI A;  3I58 A;  3HHG A;  3KZY A;  2CS3 A;  1YX3 A;  3WTY C;  2BV6 A;  5K5R A;  4XID A;  1B4A A;  1ETY A;  2L5Q A;  1U6G A;  1ZR2 A;  1MBJ A;  1IGN A;  5EF6 A;  3BJA A;  1BIA A;  3DQV C;  4N0B A;  4RLF A;  4XMY A;  4HX7 A;  4HBL A;  2VI6 A;  2UXN A;  5BOX A;  2JRM A;  4CYC A;  1WHU A;  1D8J A;  1OKR A;  1LE8 B;  2KJB A;  3WU0 A;  2LLK A;  4RB0 A;  1D1B A;  4QTR A;  4I0B A;  5FJ8 J;  1G59 A;  1X1A A;  3QU3 A;  5GP9 A;  1B8I B;  5D4S A;  5K5O A;  1Q1V A;  2VL8 A;  4LG0 B;  2OTJ I;  2M4K A;  3DCF A;  2O8X A;  4HW0 A;  3IAM 2;  3CME I;  1ETO A;  2FNA A;  3DXJ F;  2BY0 A;  2IGK A;  3OYI A;  2B7E A;  2FE3 A;  5IT9 Z;  2Y75 A;  4IQ4 A;  4R1H A;  2DFF A;  2J5O A;  1STZ A;  1DU0 A;  1W5S A;  3CJR B;  5IP6 A;  1OLT A;  2F4O B;  3GVA A;  3ZRG A;  3PJR A;  1ITY A;  3TP0 A;  2Z5U A;  3SQN A;  2ZCW A;  2A05 A;  1OCZ H;  2LSO A;  4IEJ A;  2QEN A;  2A6E F;  2O03 A;  1YIT I;  4O6J A;  3C1D A;  3TQN A;  3S3O A;  3FK7 A;  4A3G J;  3K2Z A;  1AU7 A;  2ZJP F;  3REO A;  1FMW A;  5KAI C;  1BIB A;  2NXN B;  2ZNY A;  3DKY A;  2CYY A;  1QZY A;  1FYM A;  2BY2 A;  2VON A;  2PMZ N;  2EK5 A;  4JX6 A;  4B09 A;  5F1R A;  1T6S A;  3S2H J;  1L0O C;  4C3H J;  4XRF A;  3DLA A;  1H0M A;  2QSG X;  4F52 A;  1I50 J;  1FOY A;  2DW4 A;  2L9N A;  4F91 B;  3R60 A;  1WGX A;  2YR2 A;  4A3J J;  2HTS A;  2DT6 A;  3WE2 A;  4IJA A;  3SFI A;  3PO3 J;  2PI0 A;  1R22 A;  1B6A A;  3BP8 A;  2XAH A;  2KMU A;  2QF7 A;  1MND A;  2Y0M A;  3GFL A;  3SDG A;  5GTH C;  2Y30 A;  2BY3 A;  1LFU P;  4HF1 A;  5IP9 J;  3R0J A;  3CO6 C;  4M3E A;  1Y56 A;  5CYV A;  3TW6 A;  1D0Y A;  2P6T A;  2RGV A;  2X6X A;  1YJN I;  1K6Y A;  1MSE C;  2NYX A;  3K4C A;  1VQ9 I;  5FKM A;  1P2F A;  2R7R A;  1G6N A;  3IWF A;  1FLI A;  1KQ8 A;  1TBX A;  5DEQ A;  4XBF A;  4RAY A;  1XD7 A;  4JQF A;  1DGW Y;  2WTE A;  3M1E A;  3TP3 A;  4DJA A;  2QCO A;  2JSP A;  3JRA A;  2R0Q C;  1YOV B;  5E3N A;  4AIJ A;  2XB5 A;  2JA7 J;  2ZKZ A;  2QGU A;  1JKR C;  1LDK B;  4UNO A;  1ETX A;  2JUC A;  1YTY A;  4BS9 A;  4HNU A;  1EKE A;  3B73 A;  2A6T A;  2VE8 A;  1ETK A;  2X0L A;  1YHQ I;  1MD0 A;  1ETQ A;  3HSF A;  2HS5 A;  1RES A;  5F08 A;  2HFH A;  4UVA A;  3VSK A;  5CQE A;  3VYU B;  3OIQ A;  2KQR A;  1TZL A;  2EZH A;  2LC2 A;  3VOE A;  5L3G A;  1Y0N A;  2QBY A;  3BR2 A;  1L3L A;  4IKF A;  2DXI A;  2L02 A;  1VQL I;  4OU0 A;  2ZSH B;  5D8L B;  1UB9 A;  3SJM A;  3OR1 C;  3IV5 A;  1W36 C;  3HXL A;  5ICE A;  2DA7 A;  2Y48 A;  2LYC A;  2YUS A;  2G9W A;  2IA2 A;  3GO5 A;  2YX7 A;  3E5Q A;  4BJ6 C;  5HVQ C;  1SEU A;  2DMP A;  4LIT A;  2OAZ A;  1IUY A;  3HTU A;  2FMY A;  3WHC A;  3WGH A;  4CDG A;  2QVO A;  4BHP A;  2HOE A;  1G2H A;  1AKH B;  4IXA A;  1WJ5 A;  2CW0 F;  3PNY A;  2HYF A;  3U2R A;  1WZ2 A;  4AIH A;  3ML6 A;  2JZY A;  1RUN A;  2VPL A;  2MYS A;  4XOP A;  1JJ8 C;  3IL2 A;  3K4B A;  2K4B A;  2WAQ A;  2KIU A;  3F72 A;  3V42 A;  2KRF A;  3C2G A;  1XCB A;  3E6D A;  1LEB A;  4HX8 A;  3H0G J;  3FX3 A;  1DGR M;  1Z6R A;  1YIO A;  1SAX A;  3A02 A;  3ASN H;  2A68 F;  3T8T A;  2H8W A;  1IF1 A;  4OMZ A;  4U7B A;  3M8F A;  1D1C A;  2STW A;  4DGW B;  1G3S A;  2FUG 2;  1D0Z A;  3TGN A;  3MZY A;  4GGG A;  4XRM A;  1OR7 C;  2F48 A;  1E3H A;  2CUZ A;  2FSW A;  5CVV A;  4XSX F;  3PL8 A;  1BI2 A;  1VQN I;  2WY8 Q;  3H9G A;  1M1E B;  1XMX A;  1Z1D A;  2KFD A;  1QU3 A;  1XTA A;  2XPW A;  3ECH A;  1PUE E;  3EYI A;  4Q47 A;  2TRT A;  2VJJ A;  1ETW A;  1J7K A;  2XDV A;  1ON2 A;  1P7I A;  4YG2 F;  3IHU A;  2CU7 A;  2LF8 A;  1U9O A;  2FQ3 A;  2R7F A;  4MIM A;  5C4X J;  5EZG A;  2V4J C;  1EH6 A;  2X4H A;  1V3F A;  4PGH A;  4RAG A;  2V79 A;  4XR6 A;  3BG9 A;  4BE1 A;  2CO5 A;  1GVD A;  4ZJZ A;  1P4W A;  1XDU A;  4PJN A;  2CV2 A;  1SMY F;  3V7S A;  1R5I D;  4HF2 A;  1PP8 F;  2XRN A;  3OV8 A;  1VND A;  1SFE A;  4G7O F;  3ABL H;  5J8C A;  1NK3 P;  1JUP A;  2GOX B;  5L3D A;  2VBY A;  3H1C A;  1MMA A;  3OYE A;  2K86 A;  1VI0 A;  4F3Q A;  1SVO A;  4MNU A;  3G71 I;  2G7H A;  1LPQ A;  2JVG A;  4M9X A;  2Z1D A;  2CW7 A;  2OCC H;  2AQE A;  3M1C A;  4EM2 A;  2HXI A;  2Z33 A;  3W6V A;  2DA5 A;  2LVS A;  3CES A;  1KON A;  1FP1 D;  1AHD P;  4RLQ A;  5GAG J;  4OIN F;  1R1V A;  4BXX J;  2XRO A;  1OCO H;  4KN7 X;  3AL0 C;  2HYG D;  3I4N J;  3EUH C;  4JBA A;  5DV5 A;  5J1Y A;  4EMS A;  1P6R A;  2CFO A;  3GCM A;  1IN6 A;  3V7C A;  1TQM A;  1JT0 A;  1VQ7 I;  1RR8 C;  3CF2 A;  4RDU A;  1MDM A;  2IGN A;  3G4S I;  3S1N J;  1SFX A;  1KU3 A;  2JVH A;  1VQ4 I;  2R92 J;  3GTQ J;  3ZQC A;  1J75 A;  2LNB A;  3A0H C;  5D5W B;  3TO9 A;  2E2J J;  3WOD F;  2KIS A;  3NRV A;  2D5V A;  2QZ8 A;  3KP5 A;  1D0X A;  2DU9 A;  5ICG A;  1WJF A;  3I9V 2;  2CG4 A;  2ZXW H;  2EH3 A;  4NB5 A;  4ENK A;  2KDZ A;  4A6E A;  3QPT A;  3G3Z A;  3EET A;  3DLL F;  1SVL A;  3JRC A;  4QPO A;  3OYF A;  2CH0 A;  2CUJ A;  5K7H A;  1OYW A;  3G1O A;  1T0F A;  3QPL A;  2BZT A;  4U7D A;  2WC2 A;  5IOY A;  1QNT A;  3BZK A;  2XF7 A;  1XX5 A;  1FIA A;  3WTS C;  5M5W J;  4YII A;  4XLP F;  3I71 A;  1LFP A;  2M8G X;  1K83 J;  1TP4 A;  2FA5 A;  2HOA A;  4S05 A;  1IN8 A;  4L5I A;  1JXS A;  1JJ6 C;  2DMU A;  1XMK A;  1FTT A;  3PQK A;  4XNF A;  4CGZ A;  2R93 J;  3BG5 A;  3WTZ A;  1ZN2 A;  4ZH4 F;  4OMY A;  3ZQF A;  1WFX A;  2Q1Z B;  1FX7 A;  3NWS A;  3CF5 F;  3D1N I;  2EFP A;  4DQ2 A;  4ZDP A;  4J00 A;  1SAN A;  2DYS H;  3HOY J;  3S14 J;  1ONV A;  2D1H A;  2XGD A;  2JT1 A;  4NC7 A;  2R7U A;  5HNF A;  1X2N A;  1Z3X A;  1VZ0 A;  1X4P A;  1U8R A;  2Q8K A;  2PLY A;  4ASN A;  1LVA A;  2FX0 A;  1LDJ A;  2E19 A;  1V5G A;  5E1W A;  4OIP F;  2V1N A;  4Z6Y A;  3C2H A;  3GTO J;  1CF7 A;  1WVR A;  1RUO A;  4BEH A;  5CVI A;  5JVT A;  3LSP A;  1QHG A;  1Y6I A;  5HDN A;  4PSX A;  4ZTF A;  2ID3 A;  4UUV A;  4XRS G;  1HBX G;  4QSH A;  2WY7 Q;  4E7J A;  4CZC A;  4EGZ A;  1ACI A;  3MN2 A;  4ZYD A;  5LRS A;  4TV7 A;  4HV6 A;  4DOZ A;  1QZZ A;  3K4L A;  3K1N A;  1IV8 A;  2HPI A;  5F27 A;  2JPC A;  1P7J A;  2X51 A;  3D5R C;  3M7G A;  1TWC J;  3CTA A;  1LJ9 A;  4KFC A;  1EH8 A;  1S5L C;  4E4H A;  2CV0 A;  3FBN B;  3BZC A;  2IA1 A;  2KZV A;  1TC3 C;  5IY5 H;  1BI0 A;  1JT6 A;  3FIW A;  5FO5 A;  4UVC A;  1MBE A;  2ZFW A;  1OJL A;  2UV1 A;  3I4P A;  4W1U A;  2VLA A;  4L0Z B;  5HS7 A;  3EUA A;  3U9G A;  5FRM A;  5IPA A;  2CQK A;  3P7N A;  3OOP A;  2W57 A;  2K9N A;  1ZLJ A;  1V54 H;  2V9V A;  1T8I A;  5LGT A;  3CC7 I;  3BJ6 A;  3JRG A;  5FKK A;  4J01 A;  3IH4 A;  3K6G A;  1TWA J;  4HYE A;  4BBR J;  3DKW A;  1Z77 A;  2XHK A;  9ANT A;  2FOW A;  1MIJ A;  4ANJ A;  3ZQH A;  2ME6 A;  5JHU A;  2XPU A;  4PCQ A;  1U5T B;  2LMD A;  4HQE A;  1MNM C;  2ZXJ A;  4A3C J;  4LFU A;  4I98 B;  1I5Z A;  3HUG B;  2F4M B;  3H5R A;  2JQ7 A;  3QU6 A;  3W2V A;  4XLA A;  1LKX A;  2XRL A;  3E0J B;  5EDN A;  1OQY A;  4MEX F;  4C9Y A;  4IHX A;  4RGU A;  3J81 K;  2L2O A;  3ZN0 A;  3FZV A;  3I3L A;  3JAM Z;  2LDU A;  1IDY A;  2WV1 A;  2DCE A;  1R7J A;  4B3A A;  2BGC A;  1S8N A;  3PFY A;  4XLF A;  4L9J A;  2NVT J;  3BR3 A;  1ZGW A;  4PFO A;  2OC6 A;  2RV8 A;  4AD9 A;  5F64 A;  1YG2 A;  4NC6 A;  1VTN C;  5JLW A;  4BGD A;  3HGG A;  3MD2 A;  4CZZ A;  3LOC A;  3C18 A;  2EFW A;  3MEX A;  3TDZ C;  3ERM A;  2R7W A;  4P1W A;  5K7Z A;  4HST A;  2KPM A;  2MD0 A;  2XPV A;  1K4T A;  2XAS A;  1VQ6 I;  4AYB N;  3P9K A;  4BYY A;  3E5U A;  1D1A A;  2RKH A;  3HOT A;  3V7R A;  3WU2 C;  1X3U A;  4DBQ A;  2NVU B;  5AIQ A;  4LIV A;  2X1E A;  1IZ1 A;  1V4R A;  4LGW A;  2AQF A;  3BCA A;  2W24 A;  2R5Z A;  4KIF A;  2EZL A;  3GFM A;  2DK5 A;  1ZG1 A;  5LD2 C;  4NQW B;  4LB5 A;  2PJP A;  2OPT A;  3PO2 J;  2XGX A;  4MLO A;  2X6O A;  2ELK A;  2A07 F;  3BTJ A;  5DCF A;  5KVR A;  3CCM I;  3DU5 A;  1Y8Q B;  4ON0 A;  5JFR A;  4IRG A;  2K3F A;  4U87 A;  3RTR A;  4EQQ A;  2R7T A;  4DYQ A;  2IPQ X;  2ZO4 A;  3Q3S A;  5H2F C;  5LFA A;  2NNY A;  2GXB A;  2LR8 A;  1BJA A;  2XV4 S;  2NVQ J;  2L0K A;  1HA8 A;  5E1Z B;  3L9F A;  1HKT A;  5DM7 F;  2XVC A;  2R7X A;  1UHW A;  4HG2 A;  1RR7 A;  2P6S A;  2TDX A;  5AIP A;  3OS0 A;  5HLI A;  5EG0 B;  1YS6 A;  3FDY A;  3DEW A;  2MH2 A;  2CJJ A;  4P5O A;  2MLK A;  3LSK A;  5ICC A;  2DFE A;  2ECC A;  2JN6 A;  1S3J A;  3GZ6 A;  3CO7 C;  4A2U A;  1W36 D;  1WCM J;  5L3E A;  3LAJ A;  3A01 A;  3FM5 A;  3M8E A;  4AYB A;  4I01 A;  3P5J A;  4O3M A;  3LFU A;  2ZXH A;  1OCP A;  2V26 A;  4BE2 A;  3LSR A;  4XKW A;  2HVS A;  1PP7 U;  3EQL F;  2DQL A;  1LNW A;  3HPG A;  4HZF A;  3VYR B;  2EBI A;  2HU9 A;  1HLV A;  2E1C A;  2DA6 A;  1R4N B;  1JKP C;  3ZR8 X;  2DT7 B;  5F04 A;  4YFX F;  5D5V B;  1ZRD A;  4ITV A;  4BU2 A;  2X85 A;  1ZRE A;  1OCC H;  3IP4 B;  2ELJ A;  2FBH A;  1G8X A;  4FHT A;  4N4O B;  3N4M A;  2D45 A;  3I59 A;  1ZH5 A;  2X9D A;  3LA2 A;  5HLH A;  2VC1 A;  1MKM A;  2W48 A;  1W7P D;  3I5U A;  1UFM A;  3HSE A;  3R61 A;  5JVG F;  3H3U A;  1SC7 A;  2ZME A;  4CH7 A;  4CXF A;  3RDI A;  2L01 A;  3DV8 A;  3OL3 A;  1G3Y A;  5DYM A;  2OBP A;  1QGP A;  3ZMZ A;  3K0L A;  2R3S A;  1YRN B;  4K2E A;  1ZK8 A;  2HOS A;  1FZP B;  4IRH A;  3VFZ A;  3ZMU A;  1WPK A;  2VC0 A;  3WGG A;  3CP8 A;  2BW3 B;  2VIX A;  3IAS 2;  3ULQ B;  2HZD A;  3OYA A;  4CCO A;  4ESF A;  1TLH B;  1YI2 I;  1JTX A;  1H9G A;  1PJR A;  3ZXS A;  4P9F A;  4BY1 J;  2LD5 A;  4LOC A;  1UAA A;  3LAP A;  4FAS D;  3OYL A;  3GTL J;  2JWT A;  3CDH A;  2A3S A;  1I27 A;  1U8B A;  2LBF A;  1NTC A;  2OD5 A;  3KEY A;  3W2W A;  1Z9C A;  1Z67 A;  3E6M A;  3HOV J;  1FBQ A;  4MEY F;  1Z7L A;  4DW6 A;  1I3A A;  3GME A;  2BY1 A;  4HSR A;  3QYB A;  3BPX A;  4RB1 A;  2IA0 A;  3TL4 X;  1ZGJ A;  3OS1 A;  4R79 A;  4DBR A;  1KU2 A;  3WTV C;  4CCK A;  1IO2 A;  1FIP A;  1DPU A;  3KET A;  2E36 A;  5H6R A;  2O8K A;  4FE4 A;  3HEF A;  4N9I A;  3QP6 A;  2HPM A;  2D1V A;  3K4N A;  4A3E J;  4LLG F;  5J1R A;  3LST A;  5E1X A;  2M87 A;  2XAJ A;  4D7M A;  4P55 A;  1MBH A;  2XAU A;  2V9P A;  1U78 A;  2V6E A;  1XGM A;  2EWN A;  4XN3 A;  4RBO A;  2QQ8 A;  4F55 A;  2OTL I;  3BTL A;  2H27 A;  3GTP J;  2JSC A;  1W4M A;  3TOB A;  4B1R A;  3LA3 A;  4ZYG A;  3L00 A;  1FMV A;  4KT5 C;  4RGS A;  4BQA A;  2VPR A;  4V2F A;  3CMA I;  3F21 A;  5ILU A;  3HC7 A;  1EA3 A;  3GW2 A;  1HXD A;  1OPC A;  2J5P A;  1J9I A;  2ME0 A;  2GIZ A;  1XGO A;  1MH4 A;  2DBB A;  4HX4 A;  1I6H J;  2DOD A;  4MTD A;  4A3B J;  3M9A A;  2DA1 A;  3R6S A;  2UWM A;  2M1B A;  4L5E A;  3E5X A;  2P4W A;  2W84 A;  1OCR H;  4IF4 A;  3Q5F A;  2K9M A;  3OIO A;  2VBW A;  3HSR A;  2AXL A;  3KP6 A;  1Z3Y A;  2B63 J;  4AVZ A;  3R0A A;  1F43 A;  1JUS A;  4BE0 A;  1WJC A;  3GX4 X;  4M3G A;  2LY1 A;  1R1T A;  4RM3 A;  1MBK A;  1IXC A;  3AG2 H;  4GXO A;  1O3R A;  1RNL A;  4L5J A;  2MAB A;  3GEZ A;  3JRI A;  3RYR A;  4JOM A;  4ENN A;  2VOP A;  1MBG A;  1B1B A;  3EPZ A;  4A5N A;  4QIW N;  4CYC B;  3K1P A;  1O4X A;  3WG7 H;  3GLL A;  4ZZD A;  4EJT A;  3BOQ A;  4ABZ A;  5F0H A;  3OS2 A;  4QPQ A;  2QYO A;  3O2P E;  3QOE A;  3ZMS A;  1T2K A;  3M07 A;  2JA6 J;  4N9H A;  2EIK H;  3HG9 A;  5TJJ A;  1IC8 A;  4LLL A;  2COM A;  3K69 A;  4RAF A;  4J19 A;  4HDU A;  5DD4 A;  5IOZ A;  4PJJ A;  3DTI A;  3F8M A;  4BY7 J;  2M3A A;  4OOI A;  5J1U A;  5CPR B;  3U1K A;  3GUD A;  1B72 A;  3ZN1 A;  4G8X A;  3KZI C;  2PMU A;  1S7O A;  5FFX A;  1TWF J;  1R5H A;  3VYT B;  2QUF A;  4KIB A;  2NVY J;  1I6X A;  2FQ4 A;  1A31 A;  4M9Z A;  1I1G A;  2DMQ A;  2YSR A;  4A0Y A;  5EJC A;  6PAX A;  1X3W B;  5ICF A;  5CQG A;  2FD5 A;  5K1Y A;  2H09 A;  4H0E A;  3S1M J;  1DP3 A;  4CIC A;  4GDF A;  3WHB A;  2E1N A;  3BG6 A;  1S7A A;  4OIR F;  2H6B A;  3RPU A;  1XN7 A;  3TDU C;  3L2R A;  4IQJ A;  2WAQ N;  1UG2 A;  4Y13 A;  5D8K B;  5HNH A;  4NNJ A;  2KLO A;  5DTD A;  3LSM A;  4JX5 A;  2DT5 A;  2P81 A;  5DUI A;  2FRH A;  3S3N A;  5FLM J;  3FM3 A;  1XSD A;  1IUF A;  2P5K A;  4EGY A;  5K7F A;  4G6Q A;  2DMT A;  4MGR A;  4I6Z A;  5DUK A;  1VQP I;  1IW7 F;  2VT3 A;  3BR0 A;  4HPQ A;  3S1R J;  2JMW A;  1ZRC A;  3OYN A;  2LP0 A;  4Y3O A;  5LEJ A;  4ENM A;  2KIF A;  5J3L A;  2GOM A;  3B6C A;  3N05 A;  4I0A A;  3SZT A;  2MD5 A;  2QSH X;  2ETH A;  1OIS A;  1U0J A;  3LA7 A;  2W1O A;  2DI3 A;  5CVU A;  4A93 J;  3Q9V A;  3FMR A;  4ZYH A;  4EM0 B;  4BQN A;  1Z6T A;  3E6B A;  4OIQ F;  5DCM A;  2CUE A;  2GA2 A;  2HWV A;  2MG4 A;  3GYH X;  1DQU A;  2EV5 A;  3HRU A;  5GAH J;  4EJO A;  1ZG3 A;  3SYT A;  1KGS A;  3ZP5 A;  4IHY A;  4BXF A;  2CWE A;  3I64 A;  2EIN H;  1APL C;  3OYM A;  1T0F C;  3HRS A;  2R5Y A;  3RYP A;  1G3W A;  1FNN A;  4XOR A;  2HKX A;  3TO6 A;  2AS5 F;  4HNT A;  1YE9 A;  3K4J A;  4EEF G;  3CCQ I;  4L18 B;  4PUS A;  3QPS A;  2HQR A;  2VQG A;  1DP7 P;  3SEZ A;  2PN6 A;  2DPD A;  4Z2Y A;  3PFI A;  3FIS A;  4MQ9 F;  1K79 A;  1DUX C;  3DBR B;  4Y4R A;  2DOF A;  4M6Y A;  2K5C A;  4PK4 A;  3MZH A;  3OWT A;  4M72 A;  4ETS A;  1GHC A;  3CP2 A;  1T33 A;  4JYK A;  2DAO A;  2M45 A;  2QBY B;  4YFN F;  2H6C A;  3RQI A;  3H3V K;  2MGQ A;  1U5T C;  4C2U A;  1WI3 A;  1BR2 A;  5KK1 A;  4IHT A;  1F9N A;  3V4G A;  2DN0 A;  3ZQ7 A;  1R5G A;  3PIP F;  2OZU A;  3FK6 A;  3BR5 A;  4CCL A;  1XGS A;  1A6Q A;  5EEA A;  2WB1 A;  1KYZ A;  4RGX A;  1A36 A;  2EV6 A;  3ECO A;  3KYC B;  1X1C A;  1S9H A;  2QA4 I;  5B1A H;  2PJR A;  1EV7 A;  4NC8 A;  4E7H A;  4CCN A;  2GWR A;  2OQG A;  3JSO A;  2DA2 A;  2W7N A;  5D5U B;  2LKS A;  2LKP A;  1VQ8 I;  1LVK A;  3HGY A;  4RB2 C;  1A5J A;  4Q48 A;  1BOA A;  2STT A;  4IVN A;  5FD5 A;  4IOC F;  3JRE A;  2K9L A;  4EJW A;  3VPR A;  3Q0W A;  2I8D A;  1BN5 A;  4PSW A;  2L4A A;  3WTX C;  5E8G A;  2HZT A;  3DF8 A;  2CMP A;  2OZ6 A;  3C2B A;  1T38 A;  2R7S A;  3HOS A;  3QPH A;  5FKO A;  4GFB A;  3F23 A;  2JRT A;  2G0E A;  2Q2E A;  1XDS A;  2K3P A;  4YEJ A;  4M9S A;  3A03 A;  3S1Q J;  3G73 A;  3PUB A;  1YX5 A;  1BI1 A;  2VKD A;  2L7Z A;  3AG1 H;  1XMA A;  3KPH A;  3L2C A;  1O3S A;  3HDD A;  2M8E A;  2VOO A;  1JI8 A;  5LGU A;  1T98 A;  4D1Q A;  3CC2 I;  1VQ5 I;  3E97 A;  3CDI A;  3O6B B;  2V7F A;  3MVP A;  5BNG A;  2IW5 A;  1XCV A;  5ILV A;  2O9L A;  4AUX A;  3CJQ B;  2FNP A;  4BH9 A;  4D7N A;  3GTJ J;  3JW4 A;  3OYB A;  4Y7N J;  2JA5 J;  5D5X B;  5L3B A;  4MHG A;  2XUB A;  2BYV E;  3KE2 A;  5B1B H;  3J80 Z;  1YW7 A;  3SXY A;  2W00 A;  3NEU A;  4WF2 A;  2PEX A;  2L3D A;  2EZK A;  4EAT A;  1J5Y A;  1V55 H;  2K9Q A;  3K2A A;  3K70 D;  3FXL A;  3BR1 A;  4BKX A;  2E60 A;  1XG1 A;  1UHS A;  2F5D A;  3F8F A;  3FKJ A;  1KU9 A;  2P8T A;  5FRO A;  4M71 A;  2V6C A;  4KYW A;  2ZNZ A;  2L7M P;  1T95 A;  4ZC3 A;  2N8G A;  1MSF C;  2EIL H;  1ZQ3 P;  2FEZ A;  2MSY A;  2XAG A;  5M3M J;  2VE9 A;  1A04 A;  5KNL A;  1J0R A;  3PSI A;  4CSW A;  4ZZL A;  4IZZ A;  3DKX A;  4XON A;  2P5V A;  3LSH A;  1E2X A;  2NS8 A;  1K6O A;  1USS A;  3CLO A;  3HRT A;  5KAF C;  4E7I A;  4B47 A;  2Q2E B;  1WSU A;  5TGT A;  1JHH A;  3BG3 A;  1XC5 A;  2RC4 A;  3FXM A;  4KIC A;  4KA4 A;  1B9N A;  1R00 A;  1ZEL A;  4XL9 A;  2VN2 A;  3DEE A;  3F0C A;  2IGO A;  3JR9 A;  4FX4 A;  1QO0 D;  4R8H A;  5J4Y A;  1W7P A;  2V1U A;  3A4C A;  3CUO A;  2EQR A;  2ZJ2 A;  3LWF A;  5EZH A;  1T56 A;  4AID A;  2AHQ A;  3QQA A;  1JUM A;  4JP0 A;  3M3Y J;  1IRX A;  3ABM H;  3FBI B;  3LQQ A;  3DU6 A;  2KL4 A;  4WXC A;  1MDM B;  3ZCO A;  1F4K A;  5LHI A;  2MW8 A;  2L4M A;  2E7X A;  1X1D A;  4UV9 A;  1HQC A;  5FRN A;  2MC3 A;  1TL8 A;  3HHH A;  3GFJ A;  3HOU J;  3OMY A;  3K10 A;  3F8N A;  3IKV A;  2OA4 A;  1P92 A;  2DMN A;  4EJV A;  5JLX A;  4HDV A;  1XS9 A;  3HOW J;  1Q1H A;  1VQO I;  1ZKG A;  2OV7 A;  4P96 A;  3FMQ A;  5EEH A;  2ACJ A;  4O5V A;  5E3L A;  2NS7 A;  1RPW A;  3COA C;  5BMZ A;  2EFQ A;  3QOD A;  2Z9O A;  4WXH A;  2XSJ C;  2RN7 A;  4XN0 A;  4CCJ A;  1IN7 A;  1Y39 A;  1KZH A;  1R1U A;  3EDP A;  4UUS A;  3ESW B;  3NAR A;  3FF5 A;  2BVM A;  1SD5 A;  2ECB A;  3ONQ A;  1QZE A;  3TBI A;  1BI3 A;  2DOA A;  2DQR A;  3H5A A;  4N4N B;  4XRS A;  4E7L A;  4BJT A;  1HC8 A;  3CJN A;  3LFK A;  5F1J A;  2EV0 A;  3ZQQ A;  2P5L C;  2QEX I;  4X6A J;  3HRM A;  1U3E M;  2EZI A;  5JR3 A;  3NWT A;  1ORK A;  3JAM K;  3DTK A;  5L3F A;  2KIQ A;  2EIM H;  4LB6 B;  4L0Y B;  1OMI A;  3D0S A;  2M7A A;  1FYL A;  3B02 A;  2HOT A;  4FE7 A;  3WTU C;  3VYS B;  4AWX B;  1D3Y A;  4M3F A;  2M30 A;  4XK4 A;  1IXS B;  2FOK A;  1BW5 A;  1F1Z A;  1TTY A;  1JGS A;  5E18 F;  3MKZ A;  1TT5 B;  1FY7 A;  3DPT A;  4U0Y A;  4CA0 A;  1N25 A;  1YJ9 I;  1XSX A;  1O7L A;  3H92 A;  2I5U A;  2XKP A;  4AVP A;  4HOB A;  3SEQ A;  3DBL B;  2BOL A;  4JX4 A;  2HDC A;  3P9C A;  1RRJ A;  3EUH A;  2DDB A;  3OY9 A;  1CF7 B;  4LLN A;  1X19 A;  2HI3 A;  2F4I A;  1PUF A;  4YIR X;  2LRD A;  2WA0 A;  3IUO A;  4BEH B;  3GTK J;  3H9J A;  2Y9Y A;  1IV6 A;  4NHJ A;  2BXZ A;  2Y9Z A;  2CRG A;  3DBH B;  2DYR H;  3QRF F;  2CV1 A;  4CO8 A;  2GLO A;  3RIR A;  3E7L A;  3JTG A;  3HOZ J;  5E17 F;  4XKC A;  3KYD B;  1NHA A;  4ZYE A;  4KT6 A;  1MMN A;  2LY2 A;  5F6F A;  4IPA A;  4KNY A;  4G94 A;  2FBI A;  5J6X A;  1N78 A;  4XLC A;  3L2U A;  2XB0 X;  3T5X A;  3DWL E;  3GFI A;  1LB2 A;  3MAJ A;  2I10 A;  3UR3 C;  4P9U A;  2H8R A;  3VSL A;  3OYC A;  3RKY A;  4BDZ A;  1WH7 A;  2YU9 J;  3F9K A;  1HOM A;  3FMS A;  1UMQ A;  2JA8 J;  1P9Q C;  2YS9 A;  5HS8 A;  1S7E A;  1IG7 A;  2Z16 A;  2KP6 A;  2XKO A;  3KLN A;  5DS9 A;  4FTH A;  3H9Q A;  4HF0 A;  3WTW C;  3BG7 A;  1MZB A;  2CQ7 A;  3Q0V A;  3S3M A;  2VB6 A;  2KJC A;  3KEQ A;  2AXT C;  4M3D A;  1BOB A;  4HQM A;  4LG3 A;  2O0Y A;  4BJ5 C;  2X1D A;  2F6C A;  2MFZ A;  2M2E A;  3KEO A;  4A3L J;  1P4X A;  3PSF A;  1TT0 A;  1B9M A;  1Y0U A;  5LRR A;  1B59 A;  1AOY A;  3V8K A;  3T8R A;  3I54 A;  4X0G A;  3CCE I;  2JJ7 A;  3ZQL A;  1Y1V J;  3OIP A;  2KRC A;  3VEP A;  3HJE A;  4BUP A;  5IYD J;  1BJZ A;  2E1M C;  4BAC A;  2ZFU A;  1YS7 A;  1X3Z B;  4RM2 A;  3I55 I;  2VXD A;  1Y1W J;  3FHN A;  5EGO A;  3F22 A;  2HVR A;  3GF2 A; 
#chains in the Genus database with same CATH homology
 4M3G A;  1BL0 A;  1MBK A;  2XPW A;  1JGG A;  3JRI A;  1W0U A;  1GV5 A;  3BT9 A;  2TRT A;  3BQY A;  1ETW A;  1MBG A;  2M9H A;  4QIW N;  4CYC B;  1P7I A;  1X58 A;  1O4X A;  2CU7 A;  3S15 J;  1U9O A;  3GTG J;  4MIM A;  2Y0S N;  4ABZ A;  5F0H A;  5EZG A;  3PM1 A;  5C4X J;  4C3J J;  1RET A;  1WH5 A;  2NOG A;  2E2H J;  2JA6 J;  1IC8 A;  3BG9 A;  4J19 A;  1GVD A;  3MKL A;  5IYC J;  5IOZ A;  4BY7 J;  5J1U A;  2LY9 A;  1B72 A;  2M0C A;  1TWH J;  4NDL A;  3RZD J;  1VND A;  1TWF J;  2R5Z B;  4D5C A;  3G1M A;  2NVY J;  2FQ4 A;  4XIC A;  1LE8 A;  2DMQ A;  1JUP A;  1NK3 P;  2NVX J;  3HKZ N;  1IDZ A;  3BQZ A;  2LTP A;  1VI0 A;  1E3O C;  1B8I A;  2FD5 A;  3CCY A;  2HQ5 A;  2OF7 A;  2GM4 A;  3S1M J;  3TW7 A;  2HXI A;  2DTZ A;  3W6V A;  2DA5 A;  3WHB A;  4A3I J;  2LVS A;  2R7Z J;  3BR6 A;  1A6I A;  3K7A J;  1AHD P;  2WAQ N;  1UG2 A;  1ENH A;  1H89 C;  4BXX J;  5DTD A;  1GV2 A;  4JX5 A;  3I4N J;  2P81 A;  3JRF A;  5FLM J;  1OCT C;  1IUF A;  5J1Y A;  3BTI A;  1JKO C;  2ID6 A;  1RKW A;  1JT0 A;  1LFB A;  4C2M J;  5K7F A;  2DMT A;  4I6Z A;  1R9T J;  4RDU A;  2E2I J;  3S1N J;  5C3E J;  4M3B A;  3S1R J;  3BR0 A;  2KT0 A;  2JMW A;  3LNQ A;  2R92 J;  3GTQ J;  2LP0 A;  3ZQC A;  4UUS B;  3CDL A;  5J3L A;  1GT0 C;  2E2J J;  3B6C A;  3A01 B;  1K61 A;  2D5V A;  3FKI J;  3IH2 A;  5GPA A;  3ZQG A;  3NAU A;  4X1E A;  4A93 J;  2EH3 A;  5EG0 A;  2KDZ A;  1ZTR A;  2CUE A;  4IHW A;  3JRC A;  2MG4 A;  3GBG A;  5K7H A;  3G1O A;  3QPL A;  3CQZ J;  4V2G A;  4IHY A;  5IOY A;  4A3K J;  1OFC X;  1RKT A;  1FIA A;  5M5W J;  1APL C;  4Y52 J;  2X48 A;  5E3O A;  2R5Y A;  2M8G X;  1K83 J;  2HOA A;  1QRY A;  3JRD A;  4EEF G;  5FKL A;  1JJ6 C;  2DMU A;  1FTT A;  2AO9 A;  5E3M A;  3QPS A;  4FCY A;  3S16 J;  2ZB9 A;  2R93 J;  3BG5 A;  1PUF B;  3ZQF A;  2RAE A;  4IHV A;  3RZO J;  5GPC A;  2HXO A;  3HM5 A;  3FIS A;  3D1N I;  1SAN A;  1IJW C;  3HOY J;  3S14 J;  3S17 J;  2XGD A;  4W97 A;  1X2N A;  1HDP A;  2Y2Z A;  4D5F A;  2CQQ A;  1T33 A;  2FX0 A;  3O8G A;  2E19 A;  2M34 A;  4JYK A;  4UUT A;  2LK2 A;  3RQI A;  3H3V K;  2MGQ A;  1YRN A;  4DZP A;  3GTO J;  1WI3 A;  1I3Q J;  4DZJ A;  2DN0 A;  3LSP A;  1FJL A;  2K9S A;  3FK6 A;  3BR5 A;  2ID3 A;  5EEA A;  4XRS G;  3TED A;  5HOD A;  4QSH A;  4A3D J;  3MN2 A;  4AC0 A;  2XSD C;  4MFE A;  2DA3 A;  1QPI A;  1DU6 A;  3CMY A;  2Y31 A;  2DA2 A;  1HCR A;  2GBY A;  3Q0U A;  5F27 A;  3HGY A;  1A5J A;  1P7J A;  2DA4 A;  3I4M J;  1TWC J;  3HOX J;  4M6V A;  3HB9 A;  3L1P A;  4DYC A;  1U9N A;  3JRE A;  1TC3 C;  3VPR A;  1JT6 A;  3FIW A;  1BW6 A;  3Q0W A;  1MBE A;  4S0H B;  2XGE A;  3C2B A;  1W0T A;  1OJL A;  3HBL A;  4W1U A;  2L7F P;  3LSG A;  5FKO A;  5M5X J;  4GFB A;  1AKH A;  5IPA A;  2G0E A;  2H1K A;  2K9N A;  3JRG A;  3A03 A;  3S1Q J;  5IYB J;  5FKK A;  3IH4 A;  1TWA J;  4BBR J;  1ETV A;  2L7Z A;  4I76 A;  1Z77 A;  3JRB A;  9ANT A;  1HF0 A;  5EGO B;  2IBD A;  3ZQH A;  3HDD A;  2ME6 A;  2XPU A;  1H88 C;  2CUF A;  1MNM C;  4A3C J;  1POG A;  2O7O A;  5FLV A;  1D5Y A;  3MVP A;  5BNG A;  3B6A A;  1FEX A;  2XRL A;  3G1L A;  5EDN A;  4AUX A;  2O9L A;  4IHX A;  1IRZ A;  3JRH A;  4D7N A;  3GTJ J;  1IDY A;  4Y7N J;  2WV1 A;  2JA5 J;  4B3A A;  4XID A;  1ETY A;  2EZK A;  1B72 B;  2K9Q A;  3K2A A;  2NVT J;  1ZR2 A;  3BR3 A;  1MBJ A;  3BR1 A;  1IGN A;  4BKX A;  5EF6 A;  1XG1 A;  2WB1 N;  1UHS A;  1ZGW A;  2VI6 A;  2L7M P;  4CYC A;  1FTZ A;  1MH3 A;  5JLW A;  2N8G A;  2VKV A;  3HGG A;  3LOC A;  1LE8 B;  1MSF C;  1ZQ3 P;  2LLK A;  4HNV A;  2MSY A;  4QTR A;  5M3M J;  5FJ8 J;  5GP9 A;  1B8I B;  5K7Z A;  1Q1V A;  2XPV A;  4AYB N;  3DCF A;  2NS8 A;  1ETO A;  3BG3 A;  1XC5 A;  4FIS A;  2LKX A;  3F0C A;  1DU0 A;  3JR9 A;  5IP6 A;  2R5Z A;  2EQR A;  2EZL A;  1ITY A;  3TP0 A;  5EZH A;  1T56 A;  2AHQ A;  3QQA A;  3PO2 J;  2OPT A;  1JUM A;  4MLO A;  4JP0 A;  2X6O A;  4IEJ A;  2ELK A;  3M3Y J;  3BTJ A;  3ZOB A;  4A3G J;  3FK7 A;  1AU7 A;  2L9R A;  2MW8 A;  3IH3 A;  3GTM J;  4DYQ A;  3Q3S A;  3HOU J;  2LR8 A;  4B4C A;  2NVQ J;  2L0K A;  2PMZ N;  5EYR A;  4A69 C;  4JX6 A;  1RR7 A;  3S2H J;  4C3H J;  2DMN A;  2LFB A;  5JLX A;  1XS9 A;  3HOW J;  5EG0 B;  1I50 J;  1ZKG A;  3DEW A;  3RKQ A;  2CJJ A;  5E3L A;  2NS7 A;  1RPW A;  1WGX A;  4A3J J;  4MFD A;  2ECC A;  2JN6 A;  1VF9 A;  3OSF A;  5F0C A;  3SFI A;  3PO3 J;  1WCM J;  4UUS A;  3NAR A;  1VFC A;  3A01 A;  2ECB A;  2R5Y B;  2QF7 A;  2VKE A;  3SDG A;  4XRS A;  1OCP A;  2Y30 A;  5IP7 J;  1LFU P;  3LSR A;  4X6A J;  5F1J A;  5IP9 J;  4M3E A;  2EZI A;  2E1O A;  3TW6 A;  1ORK A;  2EBI A;  1HLV A;  2DA6 A;  1JKP C;  2FJ1 A;  5F04 A;  2HOT A;  4FE7 A;  1MSE C;  1CQT A;  2IAI A;  1HDD C;  4BBS J;  5FKM A;  4M3F A;  5F0F A;  2X9D A;  5M5Y J;  4XK4 A;  2W48 A;  1BW5 A;  1X2M A;  1SFO J;  1QVU A;  2IEK A;  3TP3 A;  2HYJ A;  2QCO A;  3JRA A;  1JKQ C;  2R0Q C;  5E3N A;  2XB5 A;  3BTC A;  2JA7 J;  1JKR C;  4JX4 A;  1YRN B;  1ETX A;  1ZK8 A;  2HOS A;  5C4J J;  2HI3 A;  1PUF A;  1WPK A;  3GTK J;  2Y9Y A;  1IV6 A;  1ETK A;  2Y9Z A;  2CRG A;  2GLO A;  1ETQ A;  3E7L A;  1GUU A;  3HOZ J;  1JTX A;  1RES A;  2TCT A;  5C44 J;  3UKG A;  3OOU A;  5F08 A;  4BY1 J;  2LD5 A;  4LOC A;  1F36 A;  2XB0 X;  3GTL J;  2JWT A;  2EZH A;  1U8B A;  2COB A;  1NTC A;  2VUM J;  1GDT A;  3S2D J;  3HOV J;  3BR2 A;  4DW6 A;  4A3M J;  2I10 A;  3OSG A;  2H8R A;  3SJM A;  3IV5 A;  2DA7 A;  1WH7 A;  2YUS A;  3LSJ A;  2YU9 J;  1HOM A;  1FIP A;  2DMP A;  2O8K A;  1UMQ A;  1NK2 P;  4FE4 A;  2JA8 J;  1TWG J;  3WHC A;  2YS9 A;  3HEF A;  1S7E A;  2JK3 A;  1ZR4 A;  1IG7 A;  1AKH B;  3ZQI A;  1G2H A;  5DS9 A;  4FTH A;  4A3E J;  2K40 A;  5J1R A;  3O8H A;  3Q0V A;  4A3F J;  4D7M A;  1MBH A;  4M3D A;  1U78 A;  2HDD A;  4RBO A;  1JJ8 C;  2M2E A;  4G12 A;  4A3L J;  3BTL A;  1BA5 A;  1EF4 A;  3GTP J;  1H8A C;  4B1R A;  2VPR A;  4V2F A;  5M3F J;  3H0G J;  2JJ7 A;  3ZQL A;  4DYR A;  1Y1V J;  1Z0X A;  3A02 A;  2ME0 A;  2CQX A;  1MH4 A;  5FKN A;  5IYD J;  4MO7 A;  1I6H J;  1QVT A;  1BJZ A;  1JTY A;  4A3B J;  2DA1 A;  2XGC A;  4XRM A;  3M4O J;  2DJN A;  4L5E A;  4C3I J;  1MBF A;  3OIO A;  1Y1W J;  5EGO A;  2B63 J;  1F43 A;  1JUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...