2LK2A

Solution nmr structure of homeobox domain (171-248) of human homeobox protein tgif1, northeast structural genomics consortium target hr4411b
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
MGHHHHHHSHMLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of homeobox domain (171-248) of human homeobox protein TGIF1, Northeast Structural Genomics Consortium Target HR4411B.
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein TGIF1
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lk2A01
3E7LA 2MSYA 1PUFB 2O9LA 2DA6A 3JRBA 3BG5A 1XS9A 1PUFA 4LOCA 1OJLA 5F0CA 1IV6A 1Z77A 3JRIA 3S1QJ 4MFDA 3GTGJ 3BR0A 4CYCA 5M5WJ 2JWTA 4D5CA 1QRYA 1OFCX 5GPCA 1LE8B 1S7EA 3GTJJ 2KT0A 3OSFA 3S1NJ 3BR1A 1MBKA 3DEWA 1ZGWA 1AKHA 2QF7A 3LSRA 3L1PA 1LE8A 4A93J 3BR6A 5FKOA 3GTOJ 5J1RA 3GBGA 3SFIA 2EZKA 1LFBA 4X6AJ 2LTPA 3HOZJ 4IHVA 2WAQN 1RETA 2NS7A 2XPUA 1ETWA 2VKVA 1JKQC 1VFCA 1U9NA 4XICA 3HEFA 1MH3A 3TP0A 1B72B 4C3HJ 2ECCA 1WCMJ 5FJ8J 5GP9A 4FCYA 4UUSA 4XRSG 2CRGA 3JRHA 3MVPA 4JP0A 1BL0A 3BTLA 5DS9A 1D5YA 2AO9A 4A3LJ 2HDDA 2NS8A 4DW6A 3LSGA 1JT6A 2ZB9A 2M8GX 4DYCA 2Y0SN 1Q1VA 3HOVJ 1AKHB 2OPTA 2EH3A 3JRAA 2GM4A 3JRDA 2HXOA 3IH4A 2LR8A 5EF6A 3W6VA 1MBGA 4M3EA 1B72A 2H8RA 3BR2A 1EF4A 4XIDA 2CUFA 1A5JA 3HKZN 2DMQA 2VUMJ 3OOUA 4M6VA 4M3GA 2GBYA 1K83J 5M5YJ 4RBOA 3VPRA 3CMYA 5IOZA 2ME0A 3MKLA 3D1NI 3MN2A 2JA8J 3TW7A 5FKNA 5EEAA 1HDDC 1B8IA 5FKKA 2JA5J 1HCRA 5M3MJ 4A69C 2JN6A 3WHBA 5F27A 3K2AA 2L7ZA 1SFOJ 4RDUA 3JREA 1OCTC 4BY7J 1WPKA 2G0EA 1JUMA 1I50J 2HI3A 5F04A 2L9RA 1MBHA 2X48A 1IC8A 2IBDA 1IRZA 3BG9A 2M0CA 4QIWN 2I10A 1JJ8C 1JKPC 1TWAJ 2VKEA 2DTZA 3S2HJ 1ZR2A 5EDNA 5EG0A 4FISA 5E3OA 1RR7A 2CQQA 1FJLA 1ZQ3P 5DTDA 3LSJA 2DA1A 4MLOA 3A02A 3H0GJ 4L5EA 1Y1WJ 1SANA 3S1RJ 3OIOA 3FIWA 3QQAA 4C3IJ 1IUFA 2XGCA 3WHCA 4XRSA 3HOXJ 3ZOBA 1TWFJ 2YS9A 5J1YA 1NK3P 4XK4A 3HDDA 3A03A 1O4XA 2E1OA 4AUXA 5IYBJ 3CCYA 2O7OA 1POGA 2M2EA 4A3DJ 2DMUA 4MFEA 2CUEA 4JX6A 5K7FA 5JLXA 1IDZA 2K9SA 2XB0X 4QSHA 3FK7A 3JR9A 4V2GA 1R9TJ 1MBFA 1HDPA 3BR3A 2HOSA 2GLOA 2LP0A 1H89C 1MBEA 1AU7A 2L7FP 2D5VA 3HOUJ 5C4XJ 4DYQA 2X6OA 2XRLA 4C3JJ 2E2JJ 2LY9A 4A3IJ 1ETKA 1MH4A 3ZQHA 1E3OC 3PO2J 3BTCA 2PMZN 1CQTA 3BG3A 2ID6A 1WGXA 1JUSA 1JKOC 2WB1N 3JRGA 3HGYA 3S15J 3S2DJ 1ZK8A 2VI6A 3Q0WA 5IP9J 4IHYA 3NARA 2DJNA 3S14J 4X1EA 3LNQA 4D7NA 5EYRA 2JA7J 2R5ZB 3GTQJ 1X58A 2XGDA 2AHQA 1QPIA 4IHWA 2WV1A 3NAUA 3G1MA 2H1KA 3HOWJ 2LK2A 1RESA 3G1LA 1XG1A 1ETQA 2EBIA 2ECBA 4D7MA 2EZIA 2Y30A 1IG7A 1VI0A 3GTLJ 2LVSA 3B6AA 2DA2A 3K7AJ 4BBRJ 2XB5A 3A01A 3I4MJ 2QCOA 2CQXA 1FIAA 4B4CA 3CDLA 1WI3A 4G12A 1I3QJ 3BQYA 2R93J 1XC5A 1RPWA 1VNDA 3BTJA 2HXIA 2W48A 1Z0XA 3S1MJ 1FTZA 5IP7J 1FIPA 2E2IJ 2R5ZA 4A3EJ 5F08A 1H8AC 3TW6A 1GV5A 3ZQGA 1FTTA 3JRCA 3HBLA 1U8BA 4M3BA 3LSPA 5IP6A 3Q0VA 5EG0B 4DYRA 4A3GJ 5C4JJ 1ORKA 4V2FA 1DU6A 1ENHA 2TCTA 4IEJA 3DCFA 5E3LA 2YUSA 3M3YJ 1GT0C 1NK2P 1TWHJ 3RQIA 1WH7A 2LD5A 1GUUA 3RZOJ 4D5FA 5E3NA 3ZQCA 4DZJA 2NVYJ 2FX0A 5JLWA 1U9OA 3HGGA 4FTHA 3PO3J 1APLC 1OCPA 3H3VK 2MGQA 4UUTA 5E3MA 3M4OJ 2TRTA 3RKQA 2B63J 3A01B 2EQRA 4NDLA 2DA5A 2XSDC 3OSGA 5F0FA 3GTMJ 2O8KA 1JTYA 5M3FJ 2JA6J 4M3DA 2HQ5A 2LKXA 1JT0A 3I4NJ 5EZGA 1LFUP 1ZTRA 2R5YB 4A3MJ 2FQ4A 1UG2A 3PM1A 3ZQFA 4HNVA 1G2HA 1BW6A 2ID3A 2COBA 2M9HA 2E2HJ 2R92J 3IH3A 4JX5A 3C2BA 4BKXA 2LFBA 5F0HA 4XRMA 4B1RA 1H88C 3SJMA 4B3AA 3JRFA 1X2NA 1W0TA 1JKRC 1MNMC 1BW5A 1U78A 5F1JA 4IHXA 1F36A 3BTIA 1ZR4A 4MIMA 2K40A 2Y9YA 2CU7A 2DN0A 4UUSB 5FKLA 4S0HB 4A3JJ 5IYDJ 4GFBA 1JUPA 2HOTA 1HF0A 4W1UA 3GTKJ 5C3EJ 1MBJA 2R5YA 3QPLA 4M3FA 4Y52J 2OF7A 2HOAA 2ME6A 1ETVA 4I6ZA 2R0QC 2NVTJ 3S17J 1GV2A 5IYCJ 3CQZJ 1RKTA 5J3LA 3ZQLA 1P7JA 1BJZA 1T33A 3RZDJ 4Y7NJ 4A3BJ 2EZHA 1RKWA 2P81A 1W0UA 4FE4A 1I6HJ 1BA5A 3Q0UA 2DA7A 1F43A 4BBSJ 1WH5A 1VF9A 4ABZA 9ANTA 2JK3A 3FK6A 2DMPA 1FEXA 2YU9J 4EEFG 3UKGA 2KDZA 5J1UA 1JGGA 1TC3C 2NVQJ 2JMWA 2L0KA 2Y31A 4A3CJ 2MG4A 2RAEA 4W97A 3HM5A 1K61A 1ITYA 2K9NA 3TP3A 3S16J 2E19A 1Y1VJ 5C44J 1IGNA 1B8IB 4C2MJ 1IJWC 2LLKA 1IDYA 2R7ZJ 1NTCA 3G1OA 1ETYA 1AHDP 2IAIA 5BNGA 3FKIJ 2ELKA 4JYKA 5EGOB 1GVDA 2FD5A 4BY1J 3GTPJ 1ETXA 1YRNA 4AC0A 2N8GA 1DU0A 5IPAA 1QVTA 2EZLA 2DMNA 3QPSA 4J19A 4BXXJ 4QTRA 2Y9ZA 1JJ6C 1UMQA 1MSEC 5FLMJ 4MO7A 3O8HA 4FE7A 2CJJA 4DZPA 3HOYJ 3TEDA 2X9DA 1A6IA 1QVUA 3O8GA 5K7HA 1UHSA 3BR5A 1HLVA 1JTXA 1GDTA 4A3KJ 1X2MA 5EZHA 3IH2A 1HOMA 2M34A 5HODA 2DA3A 2FJ1A 3F0CA 5EGOA 2MW8A 2NVXJ 5M5XJ 1P7IA 1T56A 2DMTA 1MSFC 4CYCB 2IEKA 3Q3SA 2HYJA 1YRNB 5FLVA 5FKMA 3ZQIA 3LOCA 2XPWA 3B6CA 5GPAA 1TWCJ 5K7ZA 2NOGA 2XGEA 3IV5A 3SDGA 2XPVA 2JJ7A 2VPRA 4JX4A 1ETOA 4AYBN 4I76A 4A3FJ 2Y2ZA 2DA4A 1ZKGA 2L7MP 3HB9A 5IOYA 2K9QA 3FISA 1TWGJ 3BT9A 3BQZA
chains in the Genus database with same CATH superfamily
1R1TA 4X0GA 1PUFB 1P9QC 4NC7A 1OR7C 2O9LA 2DA6A 2OUMA 3V8KA 2XC7A 3JRBA 1RC9A 3PNYA 3I4PA 4LOCA 2JPBA 1SAXA 1XPXA 2JSPA 3CUQC 1K4SA 3ZMVA 1WRJA 3BR0A 2DPUA 2E5NA 1W1WE 1G3TA 1R5ID 2JWTA 1EKEA 2LSOA 3K1PA 4RLFA 5GPCA 2FNAA 3MAJA 2BY1A 2KT0A 1M1EB 4XOPA 1R6RA 3OSFA 3FXJA 2ESHA 4PJMA 3GWZA 1MBKA 3W2VA 2QF7A 4EV0A 3LSRA 1FBSA 3GTOJ 2JTVA 5J1RA 3GBGA 4EGYA 4WX9A 2XGXA 5A2QZ 4B3XA 3OIPA 4RGRA 1LFBA 2WB1A 4IHVA 4E70A 4RS8A 3ZQ7A 1RETA 2NS7A 3HUGB 3LA3A 1NG7A 2VKVA 1JKQC 2V9KA 3AKZA 4BACA 1B72B 1MZBA 2PJPA 2VQHA 2IJLA 2VB6A 2HVRA 4BGDA 2V1XA 3OYCA 1QNTA 4UUSA 2LNBA 3H0DA 3MQ0A 1K4TA 2Z2SB 2PLYA 1RR8C 4ZC3A 2JVHA 1KQ8A 5H2FC 3BTLA 5DS9A 1D5YA 3L2QA 4KN7X 3OL4A 4A3LJ 2VJJA 3DBHB 2BHYA 1J09A 4E7KA 1PDNC 2VIXA 2HDDA 4NNJA 2DI3A 2ZB9A 3ZN0A 2M8GX 4A5NA 4BJ6C 4BS9A 4DYCA 1RIOH 4UY8I 2XSJC 4LG0A 2GM4A 2WC2A 2HXOA 1BR1A 2LR8A 3K9TA 2DDAA 1MBGA 3TQNA 2P7CB 3T0YA 1DPRA 1RUOA 5AIPA 2G7HA 1UJ8A 4N4OB 2JUGA 2ZC2A 5L3DA 2DMQA 4IX7A 2VUMJ 3QYBA 3OYJA 4AD9A 4R8HA 5F6FA 2QKMB 3I53A 5M5YJ 2OQRA 5LEJA 2DOAA 5GAGJ 5J8CA 5IOZA 2VLAA 3D1NI 5FKNA 2EFOA 2L2OA 3TBIA 4KNYA 1FX7A 1HSJA 2H6CA 2WAQA 3RYPA 3E6BA 4CCLA 1W7PD 2JSCA 1WKMA 2IXSA 1SEUA 2HFHA 2XAQA 5F04A 1AA7A 1X1PA 2L9RA 2X48A 5DM7F 3FXLA 3F8CA 2EFPA 3KE2A 1IRZA 1MIJA 4I02A 1TT5B 2VL8A 2DTRA 2EIMH 1WJAA 2I10A 2BW3B 2DFFA 1ZR2A 2AQEA 1T38A 5EDNA 5EG0A 4XKWA 2QYOA 4XLHA 1K6YA 1FJLA 5AIQA 4C9YA 3K4LA 5DTDA 2DA1A 1FOXA 2R7VA 2DFHA 2LKSA 5TRDA 4F7ZA 4A2UA 4OINF 4CO8A 4QLCU 4LGWA 1P6RA 4GXOA 5HLTA 2V4JC 3WU0A 1KU7A 4C3IJ 2V1NA 4WK8F 1FBUA 2K5CA 2Q8KA 2CG4A 4CCJA 2YS9A 2QSGX 4XK4A 2OU2A 3E6CC 1EV7A 1O4XA 2M4KA 1G59A 5IYBJ 3H35A 3AG4H 2M2EA 3JSOA 1OKRA 2M1BA 2DFIA 1LB2A 4L9TA 4ZDOA 2KMUA 2KZGA 4KDPA 2ZSIB 4QSHA 1R9TJ 2KIQA 3BR3A 2HOSA 3F21A 2GLOA 2CYYA 3P9CA 2LP0A 2D5VA 4U88A 4YEJA 1HKSA 4HSTA 1TP4A 3UNGC 3CDIA 3PIOF 1JXSA 3GYHX 4L9JA 4RMNA 5KHDA 4A3IJ 1ETKA 2F6CA 2HNHA 3PO2J 1LDJA 3BTCA 4BE0A 2E1NA 1H0MA 3CC2I 2LC2A 3MD2A 4V19K 3FZVA 4GYGA 3JRGA 3S15J 5ERIA 5EEHA 4O6JA 4HV6A 4IHYA 3NARA 5LFAA 3S14J 2VQCA 3FHNA 5GTHC 5EYRA 1ZRFA 4G9YA 1TLHB 2R5ZB 3ZQQA 1PJRA 3LSKA 3VEPA 3S3MA 3KYCB 3HTUA 2XGDA 2AHQA 2YX7A 4IHWA 3NAUA 1Y8QB 1YW7A 1ZHFA 3QOEA 1XSDA 2LK2A 1YTYA 1XG1A 4BHCA 4A6EA 2LVSA 5LEKA 5BS6A 1Z6TA 2MD0A 3K7AJ 3A01A 2FBIA 3LQRA 4XN3A 1GVJA 2QM3A 2IS6A 2BHZA 2HQRA 2E5ZA 4G12A 1ZRCA 1FMWA 5HNHA 3V8LA 2R93J 2R4GA 3KP2A 3Q9SA 1XC5A 3I9V2 1RPWA 4AU7A 3K1MA 2W4SA 2PMZA 3E6DA 5DM6F 5IP7J 5CVUA 1SD6A 3BJ6A 4U7BA 4XLAA 1U0JA 3HBLA 3LSPA 3V7CA 1R58A 4A0XA 1TNSA 4DYRA 3GO5A 3D5RC 3M9AA 3DF8A 1R71A 1DU6A 2TCTA 2AS5F 1U6GA 3J7ZI 2KHMA 4BXFA 1VQMI 5FFXA 4HZFA 5EJCA 5E17F 5JR3A 3H3ZA 1ERDA 1XB4A 3ZQCA 4DZJA 2CO5A 1U9OA 3DEEA 3W6JB 1DGRM 4ESJA 2UV1A 2L01A 5E3MA 3RKQA 4UV9A 2B63J 3A01B 3I64A 4MTDA 2M45A 4OIQF 2FEZA 3RKXA 4HLYA 3EUKL 3KX2A 1FP2A 2VT3A 4G6QA 4BEHA 3JTHA 4OAZA 1JTYA 1FY7A 2LKXA 1JT0A 2K4JA 5DEQA 2PBIA 2F4OB 1KYZA 4HBLA 4AIJA 1OCCH 3CLOA 4OIOF 4A3MJ 1HQCA 4Y15A 2EA4A 3ZQFA 5FRMA 2GXAA 4WXHA 2E2HJ 1I27A 2J5PA 4I0AA 4JX5A 4WXCA 2YPRA 3C2BA 2VE9A 2LFBA 3DEUA 2MD5A 4B3AA 1BIBA 1DQUA 4RAFA 2GIVA 3AG2H 3FXOA 3RPUD 1JKRC 1BW5A 3BCAA 2VBWA 3GCMA 3W3CA 4D9JA 3F8FA 1F36A 4ZDPA 4KISA 3BZCA 2A5WA 3HSFA 2G9WA 4YELA 2CU7A 1S8NA 1MJ9A 2BY3A 2DN0A 2H94A 4XMYA 5FKLA 1JUPA 2BV6A 2HOTA 1UFMA 3DLLF 1W5CC 3MMYB 2ZMEA 2R5YA 4M3FA 1Z1DA 1KQ9A 5D8LB 3Q9VA 2M7AA 3ZRGA 4NB5A 4Z6YA 4I6ZA 2NVTJ 2A61A 5JFRA 1JHFA 1GV2A 1X3UA 1TT0A 2FBHA 3CQZJ 4XNFA 5IYCJ 3CF5F 2WAFA 2R7DA 3IP4B 5J3LA 4BNCA 4NBQA 5CVVA 1ZGJA 2HVSA 3RZDJ 2EZHA 1IN5A 4FE4A 1T2KA 1W0UA 1DPUA 3Q0UA 4BQAA 3NWSA 5DV5A 3TOBA 5HVQC 2JK3A 1IO2A 1YW8A 4M71A 5D4RA 4HX8A 2FOKA 3LSIA 6PAXA 4NC8A 4NUBA 5B1AH 4DNCA 3UKGA 3OYLA 2EJRA 3HPHA 1J9IA 1FP1D 3N97A 3GF2A 2JMWA 2L0KA 1FLIA 2Y31A 2KRCA 4A3CJ 2VC0A 2W85A 2MG4A 2RAEA 4G6DA 3DTIA 4CGZA 1UZCA 5LBQA 3TP3A 5D4SA 4B47A 2FE3A 4MEXF 1S7AA 4HQMA 5AONA 4ZTFA 4OOIA 1VQ4I 3H9JA 4JYKA 3QOPA 5EGOB 2FD5A 4BY1J 3OS0A 3BC8A 3BP8A 3HSEA 3P9KA 1E0EA 1LPQA 1EH7A 2KQRA 3K70D 3COAC 3DTKA 2F5EA 2F4IA 3BCBA 4AC0A 4BHBA 1OR7A 4DIQA 5LHIA 4J00A 2EZLA 3KP7A 3REOA 1OISA 4PJNA 3PSIA 4G7ZF 4BXXJ 3WTUC 4HEA2 2D1VA 3ZMTA 2ZXHA 3MKZA 3DPLC 3HHGA 1CGPA 2D2WA 3F8BA 4Y4RA 4U0WA 3M07A 4DZPA 2X1DA 3C3WA 1HLVA 1JTXA 5FROA 1USSA 3ZMDA 3VFZA 4NC6A 5EZHA 3L9FA 2DK8A 1WHUA 2M34A 3F0CA 3M1EA 1L3LA 3A2KA 1P7IA 1FNNA 2L54A 2M0MA 3O3KA 1SVMA 5J8FA 2LH9A 1K78A 3ECHA 1YRNB 2LRDA 1WZ2A 5FLVA 1IW7F 2DYSH 5CVJA 3ZQIA 5A2QK 4U0YA 3B6CA 3O6BB 3G3ZA 2E35A 5BPIA 3VYUB 3HOSA 1XMKA 1OCOH 2KKOA 4JOMA 2NOGA 1QQIA 3JAMK 2WV0A 3SDGA 1BBYA 3DWLE 1HSTA 3WGIA 2E60A 1MD0A 5D8KB 3MZHA 3HRUA 2P6TA 3FHZA 3EQLF 2L9NA 2WADA 2VBXA 5HLIA 2K9SA 3BT9A 1Q1VA 1QZYA 3BQZA 2MSYA 3S8PA 1XGOA 2HGCA 2E71A 3I59B 3V7SA 1O3SA 4PGHA 1XS9A 1PUFA 2I5UA 1OJLA 2RQQA 1R1UA 4PJLA 1LKXA 2VONA 3S1QJ 2R7UA 3G6EI 4MFDA 3GTGJ 4CYCA 5M5WJ 4UVCA 3RTRA 4HOBA 1LE8B 1S7EA 1ZLJA 2NNYA 1Y8RB 1X4OA 4KIGA 4BQQA 3BR1A 3DEWA 5CVIA 1LE8A 3G71I 3BR6A 2HQNA 4PCQA 3VSKA 1P4WA 3S32A 1HW5A 5ICCA 5DCFA 1AWCA 4LFUA 3BJAA 3FBNB 3DFGA 2RGVA 5CLSA 4ANJA 2WY8Q 5ED4A 2LTPA 1Z7UA 3GX4X 3FXQA 5FFZA 4B43A 4BQNA 5DUIA 2XPUA 2BW3A 1ETWA 1DP3A 4DQ2A 2XIGA 4EJWA 2ELHA 3HEFA 1PUEE 1ZH5A 1IXSB 3H5RA 2X1CA 2ECCA 3KZZA 1WCMJ 2QKLB 5LGNA 1VZ0A 1W36C 4HRIA 3ZN1A 4I98B 4IRHA 2V9PA 4XRSG 2PI0A 2CRGA 1DUXC 1LJ9A 3JRHA 3K4JA 1FZPB 3MVPA 1UHWA 4M6YA 1W5SA 1BL0A 3HRMA 1YJ9I 4L0YB 1AOYA 2AO9A 3MKWB 2OA4A 3AG3H 2MLKA 2CV0A 4DW6A 1Z9CA 4EJTA 4LLLA 2XAJA 5DUKA 1KZHA 3HOVJ 2OPTA 2L4AA 4CDGA 2KP6A 1R4NB 2EH3A 3CC7I 4S05A 2P0WA 3JRAA 4C2UA 3ERMA 3IH4A 3N05A 4HF0A 4AVZA 3W6VA 5EF6A 1RRJA 2CH0A 3CJQB 1JGSA 1B72A 2VKHA 2H8RA 1EF4A 2XF7A 2K3PA 3K70C 1D8KA 2CUFA 1IF1A 4AM3A 2X51A 1J7KA 3E6MA 5D5WB 2JRTA 3L2CA 4M3GA 2QSFX 3HSRA 1BI0A 4XQFA 3GFJA 4L9NA 3K10A 2GBYA 1K83J 3BOQA 4LLNA 3DPTA 1I3AA 2JA8J 1Y0NA 5EEAA 2L3DA 1UAAA 3X2QH 1XMAA 5M3MJ 1V5GA 4IVNA 2JN6A 1SFKA 2KIFA 3WG7H 2WAEA 3K2AA 2CFOA 2L7ZA 3IC7A 1SFOJ 1V3FA 4H0EA 1OCTC 3AL0C 2G0EA 2X6YA 1I50J 4HAMA 2O6GE 2ZO4A 3LL7A 4LB5A 4QIWN 3DU6A 3V4GA 2QEXI 1TWAJ 4HQEA 2DTZA 3SYTA 2OZUA 2XASA 3DU5A 1BR4A 2ZFWA 1XGMA 3KFWX 4LJZF 4ESFA 3CCLI 3Q5FA 4EJOA 2CQQA 4B48A 2DT5A 3S3NA 3D0SA 4NQWB 1G3WA 2CGPA 1IV8A 2ADUA 2PG4A 5IT3A 3OYAA 2RC4A 3CDHA 3CJTB 5J40A 2XKOA 1SMYF 2V1DA 3OIOA 2BE5F 4EM2A 1QHHD 3FIWA 3QQAA 5JI6A 3J80Z 4XRSA 2IA2A 4PK4A 3MCZA 3MWMA 3ZOBA 3R0AA 1MGTA 1TWFJ 2BXZA 1NK3P 3PIPF 2KLOA 2JPCA 1YOVB 4F52A 5K1YA 3IRQA 1BI2A 1Z6RA 4WXDA 2P4WA 2A05A 3IRRA 2KRHA 4I7HA 2FQ3A 2HKXA 2P7VB 3HJEA 4CSWA 1IXRC 4I01A 3PQKA 5BPDA 3OV8A 1X1AA 1J2XA 3KIOA 2KDOA 1A04A 3TGNA 3DBRB 1XCVA 4NQWA 3KZIC 5ILVA 4II3A 4R1HA 5K7FA 2HWVA 1IDZA 3JR9A 1MBFA 1YIJI 2EK5A 1G6NA 1AU7A 4Q5SF 2L7FP 3IKVA 3L2VA 2Y48A 2E7WA 4GRIA 4DYQA 1OPCA 2X6OA 2XRLA 3KEOA 2E2JJ 2LY9A 2W25A 3H5AA 4LMYA 5B5EC 3ZQHA 3WTXC 2PMZN 1STZA 4UV8A 3BG3A 2ID6A 3I58A 4XSZF 2VASA 4LK1F 1J75A 3HGYA 3S2DJ 2GA2A 3LSHA 1ZK8A 5KAIC 4HX4A 4WF2A 4J01A 1FOWA 2HTSA 5KVRA 3SEQA 4D7NA 3ABLH 2P8TA 2X4HA 3FF5A 4RM2A 4EVIA 4WCGA 4M9ZA 4AWXB 2FRHA 2UXNA 3VYSB 2ZJ2A 5J4YA 1T0FA 3SDBA 4BDZA 2QENA 3M8FA 4Y33A 4ZH4F 3G1MA 3KP6A 2HZDA 2EBIA 1ETQA 5ICGA 2EZIA 2Y30A 3W6KB 3OS2A 2OBPA 3OR1C 2CV1A 3GTLJ 1A36A 3CD6I 2K7LA 1BC7C 4DGWB 3B6AA 2DA2A 5LRSA 5D6EA 4BBRJ 4ESBA 2QCOA 1FIAA 3CDLA 1WI3A 3ABTA 3W2AA 1I3QJ 3U21A 3QYFA 3OYKA 4A0ZA 1CF7B 3OYFA 1N78A 1QHGA 5L3GA 3OOPA 1JHHA 2W48A 5DCMA 1RUNA 3S1MJ 1FTZA 4KMUX 3JCUC 3TDZC 1VQ7I 3WG9A 1Y6IA 2HKOA 3QPHA 5L3BA 5ICEA 3A0HC 1FTTA 2HPMA 2AXTC 1W36D 3EUAA 3Q0VA 5HOOA 1K6OA 1MDMB 3TMOA 3RKYA 3VYRB 1SVLA 1U5TB 3CMMA 4AVPA 4KJZA 1NK2P 4ENJA 4GGGA 3CC4I 3CZ6A 2RQPA 1UG0A 4M9SA 4OIRF 3GZNB 4EJVA 1GUUA 2EIKH 2FX0A 5JLWA 3G2BA 2JA2A 2RKHA 4IKFA 5JHUA 5LD2C 3IAM2 3CCJI 2TRTA 2EQRA 4HG2A 5LGTA 3DP7A 3CMAI 2LY2A 4JQFA 3GTMJ 2CQNA 3BG7A 3PFYA 3VSLA 5M3FJ 1R23A 2M4GA 1IZ1A 1L0OC 5EZGA 2M5WA 5JVGF 5IT9K 1ZTRA 2WBMA 4HNUA 2FQ4A 1ZREA 1Y39A 4HNVA 4A6DA 1G2HA 2FMYA 1Z3XA 3GFIA 4OMYA 2J5OA 2HU9A 5E1XA 1ZG5A 2EILH 5F0HA 1DGWY 2GIZA 1TZLA 1RZ4A 2VPLA 4B1RA 5E20A 1J5YA 1U78A 3H9GA 2L9VA 4Q4ZF 4P96A 1LFPA 3U2RA 2EV5A 2L02A 4KITB 3ASOH 2I8DA 3HL2A 1SC7A 4MIMA 2Y9YA 5DYMA 3IAS2 3WU1B 4S0HB 1MMDA 2E36A 3RYRA 4HF1A 2BGCA 5FD6A 2ZNYA 4W1UA 3GTKJ 2ZJRF 2IA0A 5C3EJ 2BYVE 1YJWI 3J7AY 4Z2YA 1YLFA 2AXLA 2CMPA 2CWEA 3KLOA 3S17J 1O3TA 3KYLA 3MZYA 2JUCA 3PUFA 4HDVA 5CYVA 1LVAA 1P7JA 4Y7NJ 2LBFB 2M30A 2P81A 4M72A 1KQ0A 3A0BC 4Y17A 1QO0D 1F43A 2MFZA 1REPC 2XROA 2DYRH 3FK6A 5FB2A 2DMPA 3FM5A 1FEXA 4TV7A 4HPQA 3C2HA 3V7RA 4EEFG 5B3SH 4CYDA 4ZTJA 2DK5A 2EV6A 2Q0OA 1PP7U 3CMEI 2TDXA 2QBYB 2CW0F 2NVQJ 1VQ8I 1HW1A 3HG9A 3RQ4A 4C2TA 3P7NA 4UNOA 2VJ5A 1B6AA 1YQAA 4W97A 3WE3A 3AAFA 3GLLA 3KCCA 1ITYA 2K9NA 3C1DA 1K7AA 4E7HA 2PJRB 3S16J 1Y1VJ 1R5GA 4K2EA 1IN6A 1YW9A 2VQGA 4B44A 3OYEA 1B8IB 1IGNA 4C2MJ 1IDYA 2R7ZJ 2PQ8A 3CJNA 4IXAA 1MKMA 1Y56A 2BXYA 4Q47A 3V42A 5BNGA 3EETA 4ZYHA 1USTA 1XDSA 4O5VA 4B09A 4CH7A 3GTPJ 4LLGF 1YRNA 2V7FA 3PJRA 4ENKA 3OYMA 3AFHA 1TL8A 1WJ5A 2X6XA 1DU0A 4U87A 3SHFA 2V79A 5IY5H 1QVTA 2DMNA 2LDUA 5HS7A 3FKJA 5D5XB 1G8XA 2ICWG 4OMZA 3J7AO 3IWFA 2Y9ZA 2VQLA 3E5UA 1UMQA 2OJED 2W82A 4D1QA 1HKTA 1VQKI 2IGMA 4II2A 1NG6A 3HOYJ 1A6IA 1QVUA 5K7HA 1GDTA 2E34A 3R60A 5GAEJ 2EWNA 2DA3A 2MW8A 2Q2EB 2NVXJ 3EUHA 5M5XJ 3WGHA 3GUDA 2LOOA 4HLXA 2A07F 1ZLKA 1LDKB 1YX5A 4XLPF 2X1EA 1PP8F 1U5TC 3WU2C 2ZSHB 4XOTA 4FT8A 1TWCJ 2ISZA 2M7BA 2ZXJA 1T98A 3IV5A 2IRFG 2JJ7A 1C0WA 1U5TA 5GTIC 4AYBN 4A3FJ 3I71A 3TOAA 4CICA 2DA4A 4IOAF 4CCMA 2KL4A 1YHQI 2Y75A 4G8XA 1RI7A 1FPQA 2VKDA 3ERED 1P4XA 3I3LA 1XCBA 4P9FA 1XGSA 3BG5A 4BUPA 3QU3A 1LEAA 1Z7LA 1ON1A 5F0CA 1V5EA 4BE1A 3KEQA 4RGSA 1OCRH 2E1MC 4ZYDA 1IV6A 2LY1A 2XVCA 2WTEA 3QPTA 5F64A 1YI2I 3IHUA 2ZMEB 1BR2A 4OWRB 2O3FA 1VQ9I 4HSRA 3S1NJ 4G7OF 5LGUA 2IT0A 1T39A 1OCZH 4QWQA 4RAYA 3OYBA 3HPGA 3LMMA 2EZKA 2HS5A 2PX9A 3JW4A 2Y0MA 4MQVA 4HNTA 4U7DA 1VQPI 4X6AJ 2VXDA 3C18A 1F4KA 2WAQN 2MC3A 3CCUI 3K2ZA 1R22A 1W7PB 1B9MA 3PFIA 4ZYGA 5KCMA 1MH3A 3TP0A 3F6OA 4XKCA 5FJ8J 3F8NA 5GP9A 2B9SA 4FCYA 2VT2A 4CUGA 3FXUA 1LUJB 2K27A 3N4MA 3A1YA 3LQQA 1SMTA 4HA8A 3BDDA 3CUOA 3TDUC 2L5QA 1R1VA 3ZMSA 4QPOA 2ESNA 2KIMA 1JT6A 5TISC 1P2FA 3K1NA 3NQOA 2F5FA 2GQQA 1S5LC 3H1CA 4M6XA 1AKHB 1MMAA 4KA4A 1SD7A 3CCMI 2L7KA 5IT9Z 2K3FA 3JRDA 2H27A 2VOOA 3K6GA 1R5HA 1WJEA 3BR2A 1IN7A 3KETA 2DPDA 4HF2A 3FWEA 2F4MB 3BJOA 4AIKA 3HC7A 2QBYA 3OOUA 3WTWC 3BLYA 2NVUB 1BOBA 4RM3A 4RBOA 3CMYA 4BYYA 3MKLA 3MN2A 1XD7A 3ABKH 3TW7A 1B8IA 2O03A 1VQOI 4A69C 2NNNA 1Z91A 1LVKA 4KYWA 3T5XA 4PJJA 2V6EA 3KZYA 3TL4X 2HYGD 2RV8A 5CQGA 4RDUA 2FMLA 2QGUA 1WPKA 4IRGA 2VJ4A 3BZKA 3BPXA 2HI3A 2DDBA 2ZKZA 1MBHA 1EJ9A 1Q1HA 4PFPA 2IBDA 2FUG2 2K86A 2M0CA 2NXNB 1RNLA 2R7OA 2VKEA 4B8XA 1TW3A 3WODF 3S2HJ 1D0XA 4F93B 1JI8A 4E7IA 2CUZA 3OMYA 4FISA 1YS6A 2G7UA 4EM0B 3M1CA 1RR7A 2Z5UA 3M8JA 2CV2A 1D1BA 1ZQ3P 2H09A 4GYIA 4KMFA 1ZAOA 3L7WA 2IS2A 4XM3A 5L3CA 3AG1H 1R36A 4MLOA 4UXNA 2ZCWA 2FBKA 3H0GJ 4IQ4A 1SANA 1Y1WJ 2R7FA 2IS4A 3V8JA 3S1RJ 1QZZA 2QQ8A 4HX7A 3ZGKA 2W84A 3WTTC 1IUFA 3WHCA 2HR3A 1BC8C 4YG2F 3JSPA 5DDGA 3HDDA 1K79A 3A03A 3WTVC 4ASNA 2B7EA 4AUXA 4IOCF 3OL3A 3CCYA 4H4KC 3S2WA 2O7OA 3M7GA 1POGA 3RPUA 5HDNA 4P9UA 3CF2A 4M73A 5GADJ 1FSHA 4XONA 3CUQA 2DMUA 1E2XA 4RAZA 3TO9A 3CO6C 1R49A 2R7XA 3LFUA 3DQVC 3KP3A 4JX6A 3G4SI 4XLCA 3D5LA 1EH8A 4C30A 3ONQA 5FO5A 3FK7A 1HDPA 3HOTA 1BIAA 3L09A 1MBEA 3HOUJ 4Y13A 1IN8A 1P92A 3LAJA 3HIFA 3LA7A 3ZMZA 4XORA 1E3OC 3NRVA 5FGMA 1CQTA 4E7ZA 1UHMA 3CLQA 5D5UB 1JUSA 4F91B 3F9KA 2ACJA 2ZFUA 4BXUA 1KU9A 2FU4A 4N9HA 3CTAA 1F9NA 4CZCA 3GEZA 3Q0WA 5IP9J 1KONA 4X1EA 3ROUA 1OQYA 5L3FA 5K5OA 1I1SA 1IUYA 1WFXA 4GCVA 1S3JA 2M3AA 3H5NA 4BAYA 2JA7J 5CJ9A 3GTQJ 2DCEA 2EFWA 1QPIA 1GXPA 2WV1A 4KICA 4KN4X 1LEBA 3KPHA 3HOWJ 3CCQI 1RESA 3G1LA 1IG7A 2RN7A 1I1GA 1P4AA 2DW4A 2RVCA 4N0BA 2HEOA 4RLQA 2BZTA 4YIRX 2PFBA 1S7OA 1MNDA 1ZG3A 2EFQA 2DQLA 2CQXA 2XV4S 1B1BA 2F48A 4BEHB 2KISA 3OYHA 1ON2A 4LIVA 3C7JA 1VNDA 2XRNA 3BTJA 3DKWA 2VODA 1ULYA 5TGTA 1WJDA 3HXLA 1R4MB 1SFXA 4JK1X 1FIPA 2CSOA 2R5ZA 2DLLA 3VDXA 3TW6A 5HDKA 1BM9A 3JRCA 1U8BA 1ODDA 5FRNA 1D8JA 5ICFA 2E7XA 5JVTA 2MC4A 2EIJH 2Y69H 4YIIA 4FASD 2KJCA 2NAZA 2X6WA 5C4JJ 2ZNZA 4A0YA 5KK1A 1BI1A 4V2FA 1ENHA 4L5IA 4IEJA 3R0JA 3DCFA 2Z9OA 2PMUA 2YUSA 3GW2A 3M3YJ 1GT0C 2A68F 2H1LA 2IP2A 3F8MA 4P1WA 2EB7A 2LD5A 3WTYC 4BH9A 1FOKA 4LK0F 3HYIA 3RZOJ 3J7YJ 4L9VA 5HLHA 5E3NA 2NVYJ 5H20A 4FTHA 2DFEA 1OCPA 4UUTA 2P5LC 2XAFA 3R4KA 3T1BA 1MMNA 2Z3YA 5KAFC 2DA5A 3LSMA 1X19A 2DODA 5F0FA 5E1ZB 2O8KA 1EA3A 2DAOA 2XHKA 2W1OA 3PNTA 1Z21A 2HQ5A 4G6TB 3VOEA 1WVRA 1LFUP 3IL2A 1W4MA 2HTJA 2DXIA 1XX5A 3PM1A 2HPIA 4N4NB 1BW6A 4IF4A 4ZYEA 4NHJA 2COBA 2M9HA 2R92J 4BKXA 4EATA 1ZN2A 2BY2A 1U3EM 1MDMA 2W00A 3FMQA 1XMXA 1EH6A 3JRFA 1O7LA 1X2NA 3FBIB 3K4KA 4XL9A 1W0TA 1LQ1A 2MLGA 1WSUA 1R7JA 5F1JA 2LF7A 4RA2A 3B73A 2B0LA 5CVRA 5J47A 3BTIA 1SFUA 1LDDA 1ZR4A 3OY9A 5BOXA 2Z99A 3BROA 2K40A 2P5VA 1OYYA 3LAPA 4UUSB 1S29A 4WWCA 5K5QA 4IL6C 2Q2EA 4PZJA 1ZG1A 1TQIA 2IGNA 3SZTA 2IS1A 4Y52J 2OF7A 4PFOA 3PNVA 3MKYB 3ZPLA 4I09A 4IHTA 2R0QC 4BU2A 3OS1A 4P5OA 2MH9A 2A5YB 4U0VA 5E18F 1RKTA 1X1BA 2FF4A 1V54H 2VJIA 3ZQLA 3OR2C 1BJZA 1T33A 3TO7A 4MQ9F 2DQRA 1RKWA 4IJAA 1BA5A 1I6HJ 2V26A 4PUSA 3K4MA 1WH5A 1VF9A 4ABZA 4BBSJ 9ANTA 3NEUA 3FXRA 3PUBA 5D5VB 2BY0A 1ZRDA 4FQGA 5J1UA 2ZXIA 2V6CA 1JGGA 1H9TA 5LLQA 4L18B 3PQJA 2AQFA 3FXMA 1SD4A 4OU0A 3VYTB 1WI9A 3HM5A 4BJ5C 2VOPA 3CO7C 2NS0A 2A3SA 4YRVA 1LNWA 2E19A 3I55I 2ETHA 1E3HA 3DXJF 1KA8A 1B4AA 3QU6A 3T8TA 3S3OA 2D1HA 1IJWC 2LLKA 3CCEI 2XF5A 1J0RA 4RAGA 2ZJQF 1D0ZA 1R00A 3DTEA 3QP5A 3QRFF 1AHDP 4GO1A 2YR2A 1WQ2A 3FKIJ 3EDPA 3SEZA 2JZYA 1QU3A 1ETXA 3WGGA 3SQNA 4RB3C 2UZKA 2CW7A 5H6QA 4ON0A 2A6EF 1MW7A 4PDKA 3CP8A 4ETSA 2PN6A 2N8GA 5IPAA 4E7SA 3QPSA 4J19A 4FETA 3U1KA 3ABMH 1MNEA 4QTRA 2DJIA 5J4VA 2W57A 4PGGA 1IRFA 2M87A 5FLMJ 1MSEC 1NH3A 2Q1ZB 2MABA 4FE7A 2CJJA 3TEDA 5CKTA 3F72A 1YX3A 3VB2A 3RJPA 1J59A 1X2MA 3ESWB 5HODA 2RREA 5EGOA 1QBJA 2K02A 4I2OA 5HDGA 2D45A 2DMTA 3K4NA 4ENMA 2OZ6A 1MSFC 4CYCB 1B9NA 2CFXA 2LBFA 2ZBKA 2HYJA 4S04A 4IO9F 3WTZA 5FKMA 3SFZA 3LOCA 4EMSA 5GPAA 3P9IA 1GXQA 3VODA 3FX3A 3GLXA 2YU3A 4RB2C 3J81K 4ZZLA 4BDYA 4D0PA 1QA6A 2L9SA 5JHFA 1FC3A 1FYKA 4I76A 1GHCA 2JVGA 3SZPA 1ZKGA 2L7MP 5DD8A 5IOYA 1E17A 3FISA 3ABUA 4LG3A 3E7LA 1FWZA 2R7SA 1D5VA 3FM3A 3GFMA 1G3YA 3KP5A 5FD5A 3RI4A 1Y0UA 3K4CA 1BOAA 4EQQA 4M74A 3FXKA 3U1DA 1TNTA 4MGRA 4CZZA 1T8IA 1Z77A 3JRIA 4XLEA 1QGPA 1K78B 1XTAA 2O61A 1D1CA 4D5CA 1QRYA 1OFCX 3MFKA 3RPQA 3GTJJ 2O5RA 1XN7A 3L2WA 1VQ6I 4BJTA 1AKHA 1ZGWA 2LG4A 4E4HA 3L1PA 4A93J 1UB9A 1SVOA 3I56I 5FKOA 3RSNA 4ZZDA 3SFIA 1T08B 3WTSC 2DU9A 1IXCA 1XSVA 1W7PA 2JRMA 3ASNH 2K9MA 3BWGA 3H36A 3SXYA 3HOZJ 5BQTA 3IUOA 2WY7Q 2GWRA 3R6SA 4G94A 4KT6A 1U2WA 5B66C 1VFCA 4YFKF 1U9NA 4AIHA 4XICA 2CW8A 3HRSA 2PMHA 4KIFA 1DDNA 4C3HJ 1TQPA 2R7TA 3F22A 2VBYA 1YFHA 4R79A 4DOZA 3DKXA 3LA2A 4JP0A 2XF6A 5ILUA 2MA3A 2O0YA 1VQLI 1ACIA 1YYVA 3HRTA 1ZELA 4I0BA 2ZMEC 1OMIA 2NS8A 3LSGA 4ENNA 4OIPF 3ZMUA 2Y0SN 5BMZA 3HTSB 4UB6C 1T95A 4F92B 1HW2A 4AIDA 2CQKA 4YFXF 1N25A 4YIFA 2GOXB 4M3EA 1HA8A 4G7HF 4LIUA 2KJBA 4XIDA 3ZXSA 3ECOA 1Z05A 2XAGA 2XKPA 1GLNA 1A5JA 2K85A 2QVOA 3HKZN 4IRIA 4M6VA 4PSXA 4DBQA 3QWLA 4XBFA 2GA1A 5L3EA 3GMEA 2CS3A 5E8IA 4RGUA 3DLAA 4A12A 4ITVA 2IVMA 5LHHA 3VPRA 5HNFA 4LB6B 1SAUA 1FYMA 2ME0A 2K4BA 2RDPA 2OV7A 1XDUA 1HDDC 5FKKA 2JA5J 1HCRA 5TJJA 4RB0A 2C6YA 1X3ZB 3WHBA 5F27A 4XLNF 1ZARA 1D0YA 3WE2A 5J6XA 4BE2A 3JREA 2COMA 1Z67A 4UHTA 4BY7J 4YFNF 4HDUA 1JUMA 4KUMA 1MJAA 2O8XA 1YIOA 1IC8A 2R7RA 1OYWA 3GFLA 4KIBA 1TTYA 1S72I 2RNGA 2Z16A 3BG9A 2F5VA 3S93A 1JJ8C 1JKPC 2VXZA 3ZCOA 3QAHA 5E3OA 1N75A 2VN2A 4KT5C 3EYYA 3LSJA 2A6HF 3A02A 4L5EA 4UB8C 5E8GA 1F1ZA 3CP2A 3ULQB 2LYCA 3GZ5A 3CCSI 2GZWA 2UXXA 1TQMA 3O2PE 3SZGA 2XGCA 2QLZA 3BPVA 4Q48A 3HOXJ 1JE8A 5J1YA 1DP7P 2YX4A 4CA0A 4ZDLA 2K9LA 2E1OA 1FBQA 4MNUA 1O7FA 1A6QA 3HUGA 2DBBA 5HS9A 3QODA 1WJCA 2DT7B 2H8WA 2YSRA 4A3DJ 4BHPA 3KLNA 3RIRA 2CQ7A 2MH2A 3QP6A 4MFEA 3QYEA 2CUEA 2E1CA 3CUQB 1T0FC 2E1MB 2Y0SA 2GXGA 2KFDA 3LFKA 5JLXA 3GXOA 3OYNA 2XB0X 2LREA 4V2GA 3W2WA 3E97A 1H89C 5E79C 5F1RA 5C4XJ 4C3JJ 1A35A 5EEGA 1X4PA 1MH4A 3ZR8X 1OLTA 2UUZA 3ZP5A 4O3MA 3F3XA 1FYLA 2CUJA 2WWYA 4M9XA 2DOFA 2PJRA 1WGXA 3HZJA 1MMSA 1IRXA 4E7LA 1JKOC 2WB1N 1X1CA 4LITA 1PVEA 3EUHC 2VI6A 2DJNA 4DJAA 3E0JB 3PL8A 2STWA 3LNQA 2BEOA 3E5QA 5FLXK 3HHHA 3HKZA 4UVAA 3D5SC 5E1WA 3U9GA 4XR6A 2R7QA 2FNPA 1X58A 3C2GA 4IHSA 3GVAA 3LWFA 5FLXZ 2KZVA 4A5MA 2W24A 2XDVA 2OAZA 2QUFA 2IPQX 3FDYA 2KPMA 4MEYF 2IA1A 4EGZA 1IAWA 3K4BA 2ECBA 2VC1A 4BL0B 4D7MA 3L00A 4CCOA 3F6VA 1IN4A 2FA5A 1VI0A 1O3RA 1FT9A 4E6KG 5D6FA 3I5UA 3IWZA 4MHGA 2QQBA 2XB5A 2LF8A 3H9QA 3P5JA 4XLFA 3I4MJ 3CESA 1ONVA 3I59A 4B4CA 1QZEA 2LKPA 3ELKA 4KFCA 3ML6A 2OD5A 1UELB 3BQYA 1HBXG 4CHUA 2V9VA 2F5DA 1G3SA 1YS7A 2HXIA 4RGXA 1BJAA 3AL0B 1WJBA 1Z0XA 4RB1A 2M8EA 1VTNC 3K0LA 1E3PA 4F3QA 2E2IJ 4UVBA 1SD5A 4A3EJ 5F08A 3GZ6A 1H8AC 2LMDA 1GV5A 2F2EA 3ZQGA 2JQ7A 2EA2A 1W5TA 2XAUA 4M3BA 3F23A 1I6XA 5H6RA 1O57A 2VBZA 4CCKA 3BZ6A 5IP6A 3OWTA 5EG0B 4A3GJ 2ISYA 1YITI 2NOJB 1ORKA 1WJFA 3H92A 3H3UA 4XRFA 5E3LA 3KYDB 1Z3YA 1TWHJ 2OCEA 3RQIA 1WH7A 2UWMA 3I0TA 3NWTA 4N9IA 3ISPA 2DT6A 2R3SA 3I54A 1VQNI 2H1KA 2HDWA 4D5FA 3BY6A 4XKBA 1CF7A 4MTEA 3HGGA 1F5TA 4BQOA 2A6TA 1APLC 3E5XA 3T8RA 2EV0A 2MGQA 3H3VK 3PO3J 3BG6A 3M4OJ 1X1DA 1VQ5I 4NDLA 2RNJA 1XSXA 2XSDC 4LG0B 4UUVA 3OSGA 1D1AA 4FHTA 3PSFA 2JA6J 5CPRB 4IQJA 1HXDA 2JT1A 4M3DA 1UCRA 2QQ9A 5LRRA 5DD4A 2STTA 2BOLA 3I4NJ 4IZZA 3CCVI 2QSHX 2R5YB 1UG2A 3KP4A 2XAHA 3DBLB 2ID3A 5HS8A 1MJBA 4PJ0C 4I99C 1YE9A 3OYGA 3IH3A 3JAMZ 4LD5A 4XRMA 2KRFA 1H88C 3SJMA 1BN5A 4HYEA 4CCNA 1TW2A 1MNMC 1G4DA 4IHXA 2W7NA 2Z1DA 1YG2A 2IGOA 3FMRA 1BI3A 2FSWA 2XUBA 1HKQA 3MEXA 3KEYA 4GDFA 3B02A 2IGKA 4IPAA 1FSEA 2GXBA 5DCMB 2P6SA 4A3JJ 5LHGA 5IYDJ 4GFBA 2F5CA 1HF0A 2QA4I 1FOYA 4F55A 1B59A 1MBJA 1S6LA 2NYXA 3QPLA 1S9HA 2HOAA 3M8EA 2ME6A 4DBRA 3FMSA 2PEXA 4ZJZA 1ETVA 2EINH 1NHAA 3G73A 2OCCH 2MYSA 1H9GA 1YO5C 3IKTA 5ILSA 1KYWA 3L2RA 2BVLA 3UR3C 3J81Z 2FXAA 4A3BJ 1WWXA 1QPMA 4FX4A 2QZ8A 4L5JA 2DA7A 2WA0A 2OQGA 3OYDA 2X85A 2YU9J 2HQAA 3RKWA 3L2UA 1U8RA 2KDZA 4HW0A 4HV5A 1TC3C 2MBFA 1X3WB 2IW5A 2QQAA 2Z33A 2H6BA 4AYBA 2HYFA 1A31A 1IRGA 1V55H 3E1SA 1K61A 4XN0A 5GAHJ 3J80K 5C44J 4XKVA 3VWBA 3DV8A 2BVMA 2ELJA 1YJNI 1V5FA 1NTCA 2QWWA 3G1OA 5CQEA 1ETYA 2IAIA 3RCOA 1OYIA 2OTLI 2ELKA 1GVDA 1MMGA 1KGSA 1ZYRF 2BBYA 3OYIA 1V4RA 5K5RA 1KU2A 3LSTA 1TBXA 5KNLA 2NRAC 3DPUA 3JTGA 4XSXF 3DKYA 1XGNA 4P55A 1I39A 3MZ8A 2VE8A 2ZJPF 1HC8A 2A69F 2EFNA 3OIQA 4E7JA 2OC6A 4JBAA 1JJ6C 2OTJI 2L4MA 3E3VA 4QPQA 1SFEA 3CCRI 4MO7A 1PYVA 3EPZA 3O8HA 4L0ZB 2ZXWH 4OAYA 2X9DA 3O8GA 4FX0A 1KU3A 1UHSA 3BR5A 1FMVA 2FOWA 4A3KJ 2GAUA 3IH2A 1HOMA 2FJ1A 2R7WA 1N77A 1T56A 5B1BH 2IEKA 3TO6A 3Q3SA 3EYIA 1ZGAA 2HZTA 2XPWA 2DOEA 4ZYAA 2P5KA 3TKYA 1T6SA 2V1UA 3CJRB 2GOMA 5K7ZA 2XGEA 4PSWA 4CXFA 5HLGA 2XPVA 1D3YA 3R61A 2VPRA 4JX4A 4Y3OA 1I5ZA 1O3QA 1ETOA 2X0LA 2HOEA 3K69A 2EPFA 2Y2ZA 3A4CA 3RDIA 2DO7A 2HVQA 4EJUA 3HB9A 2HDCA 4EM1A 2K9QA 2KIUA 1TWGJ
chains in the Genus database with same CATH topology
3E7LA 2MSYA 1PUFB 2O9LA 2DA6A 3JRBA 3BG5A 1XS9A 1PUFA 4LOCA 1OJLA 5F0CA 1IV6A 1Z77A 3JRIA 3S1QJ 4MFDA 3GTGJ 3BR0A 4CYCA 5M5WJ 2JWTA 4D5CA 1QRYA 1OFCX 5GPCA 1LE8B 1S7EA 3GTJJ 2KT0A 3OSFA 3S1NJ 3BR1A 1MBKA 3DEWA 1ZGWA 1AKHA 2QF7A 3LSRA 3L1PA 1LE8A 4A93J 3BR6A 5FKOA 3GTOJ 5J1RA 3GBGA 3SFIA 2EZKA 1LFBA 4X6AJ 2LTPA 3HOZJ 4IHVA 2WAQN 1RETA 2NS7A 2XPUA 1ETWA 2VKVA 1JKQC 1VFCA 1U9NA 4XICA 3HEFA 1MH3A 3TP0A 1B72B 4C3HJ 2ECCA 1WCMJ 5FJ8J 5GP9A 4FCYA 4UUSA 4XRSG 2CRGA 3JRHA 3MVPA 4JP0A 1BL0A 3BTLA 5DS9A 1D5YA 2AO9A 4A3LJ 2HDDA 2NS8A 4DW6A 3LSGA 1JT6A 2ZB9A 2M8GX 4DYCA 2Y0SN 1Q1VA 3HOVJ 1AKHB 2OPTA 2EH3A 3JRAA 2GM4A 3JRDA 2HXOA 3IH4A 2LR8A 5EF6A 3W6VA 1MBGA 4M3EA 1B72A 2H8RA 3BR2A 1EF4A 4XIDA 2CUFA 1A5JA 3HKZN 2DMQA 2VUMJ 3OOUA 4M6VA 4M3GA 2GBYA 1K83J 5M5YJ 4RBOA 3VPRA 3CMYA 5IOZA 2ME0A 3MKLA 3D1NI 3MN2A 2JA8J 3TW7A 5FKNA 5EEAA 1HDDC 1B8IA 5FKKA 2JA5J 1HCRA 5M3MJ 4A69C 2JN6A 3WHBA 5F27A 3K2AA 2L7ZA 1SFOJ 4RDUA 3JREA 1OCTC 4BY7J 1WPKA 2G0EA 1JUMA 1I50J 2HI3A 5F04A 2L9RA 1MBHA 2X48A 1IC8A 2IBDA 1IRZA 3BG9A 2M0CA 4QIWN 2I10A 1JJ8C 1JKPC 1TWAJ 2VKEA 2DTZA 3S2HJ 1ZR2A 5EDNA 5EG0A 4FISA 5E3OA 1RR7A 2CQQA 1FJLA 1ZQ3P 5DTDA 3LSJA 2DA1A 4MLOA 3A02A 3H0GJ 4L5EA 1Y1WJ 1SANA 3S1RJ 3OIOA 3FIWA 3QQAA 4C3IJ 1IUFA 2XGCA 3WHCA 4XRSA 3HOXJ 3ZOBA 1TWFJ 2YS9A 5J1YA 1NK3P 4XK4A 3HDDA 3A03A 1O4XA 2E1OA 4AUXA 5IYBJ 3CCYA 2O7OA 1POGA 2M2EA 4A3DJ 2DMUA 4MFEA 2CUEA 4JX6A 5K7FA 5JLXA 1IDZA 2K9SA 2XB0X 4QSHA 3FK7A 3JR9A 4V2GA 1R9TJ 1MBFA 1HDPA 3BR3A 2HOSA 2GLOA 2LP0A 1H89C 1MBEA 1AU7A 2L7FP 2D5VA 3HOUJ 5C4XJ 4DYQA 2X6OA 2XRLA 4C3JJ 2E2JJ 2LY9A 4A3IJ 1ETKA 1MH4A 3ZQHA 1E3OC 3PO2J 3BTCA 2PMZN 1CQTA 3BG3A 2ID6A 1WGXA 1JUSA 1JKOC 2WB1N 3JRGA 3HGYA 3S15J 3S2DJ 1ZK8A 2VI6A 3Q0WA 5IP9J 4IHYA 3NARA 2DJNA 3S14J 4X1EA 3LNQA 4D7NA 5EYRA 2JA7J 2R5ZB 3GTQJ 1X58A 2XGDA 2AHQA 1QPIA 4IHWA 2WV1A 3NAUA 3G1MA 2H1KA 3HOWJ 2LK2A 1RESA 3G1LA 1XG1A 1ETQA 2EBIA 2ECBA 4D7MA 2EZIA 2Y30A 1IG7A 1VI0A 3GTLJ 2LVSA 3B6AA 2DA2A 3K7AJ 4BBRJ 2XB5A 3A01A 3I4MJ 2QCOA 2CQXA 1FIAA 4B4CA 3CDLA 1WI3A 4G12A 1I3QJ 3BQYA 2R93J 1XC5A 1RPWA 1VNDA 3BTJA 2HXIA 2W48A 1Z0XA 3S1MJ 1FTZA 5IP7J 1FIPA 2E2IJ 2R5ZA 4A3EJ 5F08A 1H8AC 3TW6A 1GV5A 3ZQGA 1FTTA 3JRCA 3HBLA 1U8BA 4M3BA 3LSPA 5IP6A 3Q0VA 5EG0B 4DYRA 4A3GJ 5C4JJ 1ORKA 4V2FA 1DU6A 1ENHA 2TCTA 4IEJA 3DCFA 5E3LA 2YUSA 3M3YJ 1GT0C 1NK2P 1TWHJ 3RQIA 1WH7A 2LD5A 1GUUA 3RZOJ 4D5FA 5E3NA 3ZQCA 4DZJA 2NVYJ 2FX0A 5JLWA 1U9OA 3HGGA 4FTHA 3PO3J 1APLC 1OCPA 3H3VK 2MGQA 4UUTA 5E3MA 3M4OJ 2TRTA 3RKQA 2B63J 3A01B 2EQRA 4NDLA 2DA5A 2XSDC 3OSGA 5F0FA 3GTMJ 2O8KA 1JTYA 5M3FJ 2JA6J 4M3DA 2HQ5A 2LKXA 1JT0A 3I4NJ 5EZGA 1LFUP 1ZTRA 2R5YB 4A3MJ 2FQ4A 1UG2A 3PM1A 3ZQFA 4HNVA 1G2HA 1BW6A 2ID3A 2COBA 2M9HA 2E2HJ 2R92J 3IH3A 4JX5A 3C2BA 4BKXA 2LFBA 5F0HA 4XRMA 4B1RA 1H88C 3SJMA 4B3AA 3JRFA 1X2NA 1W0TA 1JKRC 1MNMC 1BW5A 1U78A 5F1JA 4IHXA 1F36A 3BTIA 1ZR4A 4MIMA 2K40A 2Y9YA 2CU7A 2DN0A 4UUSB 5FKLA 4S0HB 4A3JJ 5IYDJ 4GFBA 1JUPA 2HOTA 1HF0A 4W1UA 3GTKJ 5C3EJ 1MBJA 2R5YA 3QPLA 4M3FA 4Y52J 2OF7A 2HOAA 2ME6A 1ETVA 4I6ZA 2R0QC 2NVTJ 3S17J 1GV2A 5IYCJ 3CQZJ 1RKTA 5J3LA 3ZQLA 1P7JA 1BJZA 1T33A 3RZDJ 4Y7NJ 4A3BJ 2EZHA 1RKWA 2P81A 1W0UA 4FE4A 1I6HJ 1BA5A 3Q0UA 2DA7A 1F43A 4BBSJ 1WH5A 1VF9A 4ABZA 9ANTA 2JK3A 3FK6A 2DMPA 1FEXA 2YU9J 4EEFG 3UKGA 2KDZA 5J1UA 1JGGA 1TC3C 2NVQJ 2JMWA 2L0KA 2Y31A 4A3CJ 2MG4A 2RAEA 4W97A 3HM5A 1K61A 1ITYA 2K9NA 3TP3A 3S16J 2E19A 1Y1VJ 5C44J 1IGNA 1B8IB 4C2MJ 1IJWC 2LLKA 1IDYA 2R7ZJ 1NTCA 3G1OA 1ETYA 1AHDP 2IAIA 5BNGA 3FKIJ 2ELKA 4JYKA 5EGOB 1GVDA 2FD5A 4BY1J 3GTPJ 1ETXA 1YRNA 4AC0A 2N8GA 1DU0A 5IPAA 1QVTA 2EZLA 2DMNA 3QPSA 4J19A 4BXXJ 4QTRA 2Y9ZA 1JJ6C 1UMQA 1MSEC 5FLMJ 4MO7A 3O8HA 4FE7A 2CJJA 4DZPA 3HOYJ 3TEDA 2X9DA 1A6IA 1QVUA 3O8GA 5K7HA 1UHSA 3BR5A 1HLVA 1JTXA 1GDTA 4A3KJ 1X2MA 5EZHA 3IH2A 1HOMA 2M34A 5HODA 2DA3A 2FJ1A 3F0CA 5EGOA 2MW8A 2NVXJ 5M5XJ 1P7IA 1T56A 2DMTA 1MSFC 4CYCB 2IEKA 3Q3SA 2HYJA 1YRNB 5FLVA 5FKMA 3ZQIA 3LOCA 2XPWA 3B6CA 5GPAA 1TWCJ 5K7ZA 2NOGA 2XGEA 3IV5A 3SDGA 2XPVA 2JJ7A 2VPRA 4JX4A 1ETOA 4AYBN 4I76A 4A3FJ 2Y2ZA 2DA4A 1ZKGA 2L7MP 3HB9A 5IOYA 2K9QA 3FISA 1TWGJ 3BT9A 3BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E7L A;  2MSY A;  1PUF B;  2O9L A;  2DA6 A;  3JRB A;  3BG5 A;  1XS9 A;  1PUF A;  4LOC A;  1OJL A;  5F0C A;  1IV6 A;  1Z77 A;  3JRI A;  3S1Q J;  4MFD A;  3GTG J;  3BR0 A;  4CYC A;  5M5W J;  2JWT A;  4D5C A;  1QRY A;  1OFC X;  5GPC A;  1LE8 B;  1S7E A;  3GTJ J;  2KT0 A;  3OSF A;  3S1N J;  3BR1 A;  1MBK A;  3DEW A;  1ZGW A;  1AKH A;  2QF7 A;  3LSR A;  3L1P A;  1LE8 A;  4A93 J;  3BR6 A;  5FKO A;  3GTO J;  5J1R A;  3GBG A;  3SFI A;  2EZK A;  1LFB A;  4X6A J;  2LTP A;  3HOZ J;  4IHV A;  2WAQ N;  1RET A;  2NS7 A;  2XPU A;  1ETW A;  2VKV A;  1JKQ C;  1VFC A;  1U9N A;  4XIC A;  3HEF A;  1MH3 A;  3TP0 A;  1B72 B;  4C3H J;  2ECC A;  1WCM J;  5FJ8 J;  5GP9 A;  4FCY A;  4UUS A;  4XRS G;  2CRG A;  3JRH A;  3MVP A;  4JP0 A;  1BL0 A;  3BTL A;  5DS9 A;  1D5Y A;  2AO9 A;  4A3L J;  2HDD A;  2NS8 A;  4DW6 A;  3LSG A;  1JT6 A;  2ZB9 A;  2M8G X;  4DYC A;  2Y0S N;  1Q1V A;  3HOV J;  1AKH B;  2OPT A;  2EH3 A;  3JRA A;  2GM4 A;  3JRD A;  2HXO A;  3IH4 A;  2LR8 A;  5EF6 A;  3W6V A;  1MBG A;  4M3E A;  1B72 A;  2H8R A;  3BR2 A;  1EF4 A;  4XID A;  2CUF A;  1A5J A;  3HKZ N;  2DMQ A;  2VUM J;  3OOU A;  4M6V A;  4M3G A;  2GBY A;  1K83 J;  5M5Y J;  4RBO A;  3VPR A;  3CMY A;  5IOZ A;  2ME0 A;  3MKL A;  3D1N I;  3MN2 A;  2JA8 J;  3TW7 A;  5FKN A;  5EEA A;  1HDD C;  1B8I A;  5FKK A;  2JA5 J;  1HCR A;  5M3M J;  4A69 C;  2JN6 A;  3WHB A;  5F27 A;  3K2A A;  2L7Z A;  1SFO J;  4RDU A;  3JRE A;  1OCT C;  4BY7 J;  1WPK A;  2G0E A;  1JUM A;  1I50 J;  2HI3 A;  5F04 A;  2L9R A;  1MBH A;  2X48 A;  1IC8 A;  2IBD A;  1IRZ A;  3BG9 A;  2M0C A;  4QIW N;  2I10 A;  1JJ8 C;  1JKP C;  1TWA J;  2VKE A;  2DTZ A;  3S2H J;  1ZR2 A;  5EDN A;  5EG0 A;  4FIS A;  5E3O A;  1RR7 A;  2CQQ A;  1FJL A;  1ZQ3 P;  5DTD A;  3LSJ A;  2DA1 A;  4MLO A;  3A02 A;  3H0G J;  4L5E A;  1Y1W J;  1SAN A;  3S1R J;  3OIO A;  3FIW A;  3QQA A;  4C3I J;  1IUF A;  2XGC A;  3WHC A;  4XRS A;  3HOX J;  3ZOB A;  1TWF J;  2YS9 A;  5J1Y A;  1NK3 P;  4XK4 A;  3HDD A;  3A03 A;  1O4X A;  2E1O A;  4AUX A;  5IYB J;  3CCY A;  2O7O A;  1POG A;  2M2E A;  4A3D J;  2DMU A;  4MFE A;  2CUE A;  4JX6 A;  5K7F A;  5JLX A;  1IDZ A;  2K9S A;  2XB0 X;  4QSH A;  3FK7 A;  3JR9 A;  4V2G A;  1R9T J;  1MBF A;  1HDP A;  3BR3 A;  2HOS A;  2GLO A;  2LP0 A;  1H89 C;  1MBE A;  1AU7 A;  2L7F P;  2D5V A;  3HOU J;  5C4X J;  4DYQ A;  2X6O A;  2XRL A;  4C3J J;  2E2J J;  2LY9 A;  4A3I J;  1ETK A;  1MH4 A;  3ZQH A;  1E3O C;  3PO2 J;  3BTC A;  2PMZ N;  1CQT A;  3BG3 A;  2ID6 A;  1WGX A;  1JUS A;  1JKO C;  2WB1 N;  3JRG A;  3HGY A;  3S15 J;  3S2D J;  1ZK8 A;  2VI6 A;  3Q0W A;  5IP9 J;  4IHY A;  3NAR A;  2DJN A;  3S14 J;  4X1E A;  3LNQ A;  4D7N A;  5EYR A;  2JA7 J;  2R5Z B;  3GTQ J;  1X58 A;  2XGD A;  2AHQ A;  1QPI A;  4IHW A;  2WV1 A;  3NAU A;  3G1M A;  2H1K A;  3HOW J;  2LK2 A;  1RES A;  3G1L A;  1XG1 A;  1ETQ A;  2EBI A;  2ECB A;  4D7M A;  2EZI A;  2Y30 A;  1IG7 A;  1VI0 A;  3GTL J;  2LVS A;  3B6A A;  2DA2 A;  3K7A J;  4BBR J;  2XB5 A;  3A01 A;  3I4M J;  2QCO A;  2CQX A;  1FIA A;  4B4C A;  3CDL A;  1WI3 A;  4G12 A;  1I3Q J;  3BQY A;  2R93 J;  1XC5 A;  1RPW A;  1VND A;  3BTJ A;  2HXI A;  2W48 A;  1Z0X A;  3S1M J;  1FTZ A;  5IP7 J;  1FIP A;  2E2I J;  2R5Z A;  4A3E J;  5F08 A;  1H8A C;  3TW6 A;  1GV5 A;  3ZQG A;  1FTT A;  3JRC A;  3HBL A;  1U8B A;  4M3B A;  3LSP A;  5IP6 A;  3Q0V A;  5EG0 B;  4DYR A;  4A3G J;  5C4J J;  1ORK A;  4V2F A;  1DU6 A;  1ENH A;  2TCT A;  4IEJ A;  3DCF A;  5E3L A;  2YUS A;  3M3Y J;  1GT0 C;  1NK2 P;  1TWH J;  3RQI A;  1WH7 A;  2LD5 A;  1GUU A;  3RZO J;  4D5F A;  5E3N A;  3ZQC A;  4DZJ A;  2NVY J;  2FX0 A;  5JLW A;  1U9O A;  3HGG A;  4FTH A;  3PO3 J;  1APL C;  1OCP A;  3H3V K;  2MGQ A;  4UUT A;  5E3M A;  3M4O J;  2TRT A;  3RKQ A;  2B63 J;  3A01 B;  2EQR A;  4NDL A;  2DA5 A;  2XSD C;  3OSG A;  5F0F A;  3GTM J;  2O8K A;  1JTY A;  5M3F J;  2JA6 J;  4M3D A;  2HQ5 A;  2LKX A;  1JT0 A;  3I4N J;  5EZG A;  1LFU P;  1ZTR A;  2R5Y B;  4A3M J;  2FQ4 A;  1UG2 A;  3PM1 A;  3ZQF A;  4HNV A;  1G2H A;  1BW6 A;  2ID3 A;  2COB A;  2M9H A;  2E2H J;  2R92 J;  3IH3 A;  4JX5 A;  3C2B A;  4BKX A;  2LFB A;  5F0H A;  4XRM A;  4B1R A;  1H88 C;  3SJM A;  4B3A A;  3JRF A;  1X2N A;  1W0T A;  1JKR C;  1MNM C;  1BW5 A;  1U78 A;  5F1J A;  4IHX A;  1F36 A;  3BTI A;  1ZR4 A;  4MIM A;  2K40 A;  2Y9Y A;  2CU7 A;  2DN0 A;  4UUS B;  5FKL A;  4S0H B;  4A3J J;  5IYD J;  4GFB A;  1JUP A;  2HOT A;  1HF0 A;  4W1U A;  3GTK J;  5C3E J;  1MBJ A;  2R5Y A;  3QPL A;  4M3F A;  4Y52 J;  2OF7 A;  2HOA A;  2ME6 A;  1ETV A;  4I6Z A;  2R0Q C;  2NVT J;  3S17 J;  1GV2 A;  5IYC J;  3CQZ J;  1RKT A;  5J3L A;  3ZQL A;  1P7J A;  1BJZ A;  1T33 A;  3RZD J;  4Y7N J;  4A3B J;  2EZH A;  1RKW A;  2P81 A;  1W0U A;  4FE4 A;  1I6H J;  1BA5 A;  3Q0U A;  2DA7 A;  1F43 A;  4BBS J;  1WH5 A;  1VF9 A;  4ABZ A;  9ANT A;  2JK3 A;  3FK6 A;  2DMP A;  1FEX A;  2YU9 J;  4EEF G;  3UKG A;  2KDZ A;  5J1U A;  1JGG A;  1TC3 C;  2NVQ J;  2JMW A;  2L0K A;  2Y31 A;  4A3C J;  2MG4 A;  2RAE A;  4W97 A;  3HM5 A;  1K61 A;  1ITY A;  2K9N A;  3TP3 A;  3S16 J;  2E19 A;  1Y1V J;  5C44 J;  1IGN A;  1B8I B;  4C2M J;  1IJW C;  2LLK A;  1IDY A;  2R7Z J;  1NTC A;  3G1O A;  1ETY A;  1AHD P;  2IAI A;  5BNG A;  3FKI J;  2ELK A;  4JYK A;  5EGO B;  1GVD A;  2FD5 A;  4BY1 J;  3GTP J;  1ETX A;  1YRN A;  4AC0 A;  2N8G A;  1DU0 A;  5IPA A;  1QVT A;  2EZL A;  2DMN A;  3QPS A;  4J19 A;  4BXX J;  4QTR A;  2Y9Z A;  1JJ6 C;  1UMQ A;  1MSE C;  5FLM J;  4MO7 A;  3O8H A;  4FE7 A;  2CJJ A;  4DZP A;  3HOY J;  3TED A;  2X9D A;  1A6I A;  1QVU A;  3O8G A;  5K7H A;  1UHS A;  3BR5 A;  1HLV A;  1JTX A;  1GDT A;  4A3K J;  1X2M A;  5EZH A;  3IH2 A;  1HOM A;  2M34 A;  5HOD A;  2DA3 A;  2FJ1 A;  3F0C A;  5EGO A;  2MW8 A;  2NVX J;  5M5X J;  1P7I A;  1T56 A;  2DMT A;  1MSF C;  4CYC B;  2IEK A;  3Q3S A;  2HYJ A;  1YRN B;  5FLV A;  5FKM A;  3ZQI A;  3LOC A;  2XPW A;  3B6C A;  5GPA A;  1TWC J;  5K7Z A;  2NOG A;  2XGE A;  3IV5 A;  3SDG A;  2XPV A;  2JJ7 A;  2VPR A;  4JX4 A;  1ETO A;  4AYB N;  4I76 A;  4A3F J;  2Y2Z A;  2DA4 A;  1ZKG A;  2L7M P;  3HB9 A;  5IOY A;  2K9Q A;  3FIS A;  1TWG J;  3BT9 A;  3BQZ A; 
#chains in the Genus database with same CATH topology
 1R1T A;  4X0G A;  1PUF B;  1P9Q C;  4NC7 A;  1OR7 C;  2O9L A;  2DA6 A;  2OUM A;  3V8K A;  2XC7 A;  3JRB A;  1RC9 A;  3PNY A;  3I4P A;  4LOC A;  2JPB A;  1SAX A;  1XPX A;  2JSP A;  3CUQ C;  1K4S A;  3ZMV A;  1WRJ A;  3BR0 A;  2DPU A;  2E5N A;  1W1W E;  1G3T A;  1R5I D;  2JWT A;  1EKE A;  2LSO A;  3K1P A;  4RLF A;  5GPC A;  2FNA A;  3MAJ A;  2BY1 A;  2KT0 A;  1M1E B;  4XOP A;  1R6R A;  3OSF A;  3FXJ A;  2ESH A;  4PJM A;  3GWZ A;  1MBK A;  3W2V A;  2QF7 A;  4EV0 A;  3LSR A;  1FBS A;  3GTO J;  2JTV A;  5J1R A;  3GBG A;  4EGY A;  4WX9 A;  2XGX A;  5A2Q Z;  4B3X A;  3OIP A;  4RGR A;  1LFB A;  2WB1 A;  4IHV A;  4E70 A;  4RS8 A;  3ZQ7 A;  1RET A;  2NS7 A;  3HUG B;  3LA3 A;  1NG7 A;  2VKV A;  1JKQ C;  2V9K A;  3AKZ A;  4BAC A;  1B72 B;  1MZB A;  2PJP A;  2VQH A;  2IJL A;  2VB6 A;  2HVR A;  4BGD A;  2V1X A;  3OYC A;  1QNT A;  4UUS A;  2LNB A;  3H0D A;  3MQ0 A;  1K4T A;  2Z2S B;  2PLY A;  1RR8 C;  4ZC3 A;  2JVH A;  1KQ8 A;  5H2F C;  3BTL A;  5DS9 A;  1D5Y A;  3L2Q A;  4KN7 X;  3OL4 A;  4A3L J;  2VJJ A;  3DBH B;  2BHY A;  1J09 A;  4E7K A;  1PDN C;  2VIX A;  2HDD A;  4NNJ A;  2DI3 A;  2ZB9 A;  3ZN0 A;  2M8G X;  4A5N A;  4BJ6 C;  4BS9 A;  4DYC A;  1RIO H;  4UY8 I;  2XSJ C;  4LG0 A;  2GM4 A;  2WC2 A;  2HXO A;  1BR1 A;  2LR8 A;  3K9T A;  2DDA A;  1MBG A;  3TQN A;  2P7C B;  3T0Y A;  1DPR A;  1RUO A;  5AIP A;  2G7H A;  1UJ8 A;  4N4O B;  2JUG A;  2ZC2 A;  5L3D A;  2DMQ A;  4IX7 A;  2VUM J;  3QYB A;  3OYJ A;  4AD9 A;  4R8H A;  5F6F A;  2QKM B;  3I53 A;  5M5Y J;  2OQR A;  5LEJ A;  2DOA A;  5GAG J;  5J8C A;  5IOZ A;  2VLA A;  3D1N I;  5FKN A;  2EFO A;  2L2O A;  3TBI A;  4KNY A;  1FX7 A;  1HSJ A;  2H6C A;  2WAQ A;  3RYP A;  3E6B A;  4CCL A;  1W7P D;  2JSC A;  1WKM A;  2IXS A;  1SEU A;  2HFH A;  2XAQ A;  5F04 A;  1AA7 A;  1X1P A;  2L9R A;  2X48 A;  5DM7 F;  3FXL A;  3F8C A;  2EFP A;  3KE2 A;  1IRZ A;  1MIJ A;  4I02 A;  1TT5 B;  2VL8 A;  2DTR A;  2EIM H;  1WJA A;  2I10 A;  2BW3 B;  2DFF A;  1ZR2 A;  2AQE A;  1T38 A;  5EDN A;  5EG0 A;  4XKW A;  2QYO A;  4XLH A;  1K6Y A;  1FJL A;  5AIQ A;  4C9Y A;  3K4L A;  5DTD A;  2DA1 A;  1FOX A;  2R7V A;  2DFH A;  2LKS A;  5TRD A;  4F7Z A;  4A2U A;  4OIN F;  4CO8 A;  4QLC U;  4LGW A;  1P6R A;  4GXO A;  5HLT A;  2V4J C;  3WU0 A;  1KU7 A;  4C3I J;  2V1N A;  4WK8 F;  1FBU A;  2K5C A;  2Q8K A;  2CG4 A;  4CCJ A;  2YS9 A;  2QSG X;  4XK4 A;  2OU2 A;  3E6C C;  1EV7 A;  1O4X A;  2M4K A;  1G59 A;  5IYB J;  3H35 A;  3AG4 H;  2M2E A;  3JSO A;  1OKR A;  2M1B A;  2DFI A;  1LB2 A;  4L9T A;  4ZDO A;  2KMU A;  2KZG A;  4KDP A;  2ZSI B;  4QSH A;  1R9T J;  2KIQ A;  3BR3 A;  2HOS A;  3F21 A;  2GLO A;  2CYY A;  3P9C A;  2LP0 A;  2D5V A;  4U88 A;  4YEJ A;  1HKS A;  4HST A;  1TP4 A;  3UNG C;  3CDI A;  3PIO F;  1JXS A;  3GYH X;  4L9J A;  4RMN A;  5KHD A;  4A3I J;  1ETK A;  2F6C A;  2HNH A;  3PO2 J;  1LDJ A;  3BTC A;  4BE0 A;  2E1N A;  1H0M A;  3CC2 I;  2LC2 A;  3MD2 A;  4V19 K;  3FZV A;  4GYG A;  3JRG A;  3S15 J;  5ERI A;  5EEH A;  4O6J A;  4HV6 A;  4IHY A;  3NAR A;  5LFA A;  3S14 J;  2VQC A;  3FHN A;  5GTH C;  5EYR A;  1ZRF A;  4G9Y A;  1TLH B;  2R5Z B;  3ZQQ A;  1PJR A;  3LSK A;  3VEP A;  3S3M A;  3KYC B;  3HTU A;  2XGD A;  2AHQ A;  2YX7 A;  4IHW A;  3NAU A;  1Y8Q B;  1YW7 A;  1ZHF A;  3QOE A;  1XSD A;  2LK2 A;  1YTY A;  1XG1 A;  4BHC A;  4A6E A;  2LVS A;  5LEK A;  5BS6 A;  1Z6T A;  2MD0 A;  3K7A J;  3A01 A;  2FBI A;  3LQR A;  4XN3 A;  1GVJ A;  2QM3 A;  2IS6 A;  2BHZ A;  2HQR A;  2E5Z A;  4G12 A;  1ZRC A;  1FMW A;  5HNH A;  3V8L A;  2R93 J;  2R4G A;  3KP2 A;  3Q9S A;  1XC5 A;  3I9V 2;  1RPW A;  4AU7 A;  3K1M A;  2W4S A;  2PMZ A;  3E6D A;  5DM6 F;  5IP7 J;  5CVU A;  1SD6 A;  3BJ6 A;  4U7B A;  4XLA A;  1U0J A;  3HBL A;  3LSP A;  3V7C A;  1R58 A;  4A0X A;  1TNS A;  4DYR A;  3GO5 A;  3D5R C;  3M9A A;  3DF8 A;  1R71 A;  1DU6 A;  2TCT A;  2AS5 F;  1U6G A;  3J7Z I;  2KHM A;  4BXF A;  1VQM I;  5FFX A;  4HZF A;  5EJC A;  5E17 F;  5JR3 A;  3H3Z A;  1ERD A;  1XB4 A;  3ZQC A;  4DZJ A;  2CO5 A;  1U9O A;  3DEE A;  3W6J B;  1DGR M;  4ESJ A;  2UV1 A;  2L01 A;  5E3M A;  3RKQ A;  4UV9 A;  2B63 J;  3A01 B;  3I64 A;  4MTD A;  2M45 A;  4OIQ F;  2FEZ A;  3RKX A;  4HLY A;  3EUK L;  3KX2 A;  1FP2 A;  2VT3 A;  4G6Q A;  4BEH A;  3JTH A;  4OAZ A;  1JTY A;  1FY7 A;  2LKX A;  1JT0 A;  2K4J A;  5DEQ A;  2PBI A;  2F4O B;  1KYZ A;  4HBL A;  4AIJ A;  1OCC H;  3CLO A;  4OIO F;  4A3M J;  1HQC A;  4Y15 A;  2EA4 A;  3ZQF A;  5FRM A;  2GXA A;  4WXH A;  2E2H J;  1I27 A;  2J5P A;  4I0A A;  4JX5 A;  4WXC A;  2YPR A;  3C2B A;  2VE9 A;  2LFB A;  3DEU A;  2MD5 A;  4B3A A;  1BIB A;  1DQU A;  4RAF A;  2GIV A;  3AG2 H;  3FXO A;  3RPU D;  1JKR C;  1BW5 A;  3BCA A;  2VBW A;  3GCM A;  3W3C A;  4D9J A;  3F8F A;  1F36 A;  4ZDP A;  4KIS A;  3BZC A;  2A5W A;  3HSF A;  2G9W A;  4YEL A;  2CU7 A;  1S8N A;  1MJ9 A;  2BY3 A;  2DN0 A;  2H94 A;  4XMY A;  5FKL A;  1JUP A;  2BV6 A;  2HOT A;  1UFM A;  3DLL F;  1W5C C;  3MMY B;  2ZME A;  2R5Y A;  4M3F A;  1Z1D A;  1KQ9 A;  5D8L B;  3Q9V A;  2M7A A;  3ZRG A;  4NB5 A;  4Z6Y A;  4I6Z A;  2NVT J;  2A61 A;  5JFR A;  1JHF A;  1GV2 A;  1X3U A;  1TT0 A;  2FBH A;  3CQZ J;  4XNF A;  5IYC J;  3CF5 F;  2WAF A;  2R7D A;  3IP4 B;  5J3L A;  4BNC A;  4NBQ A;  5CVV A;  1ZGJ A;  2HVS A;  3RZD J;  2EZH A;  1IN5 A;  4FE4 A;  1T2K A;  1W0U A;  1DPU A;  3Q0U A;  4BQA A;  3NWS A;  5DV5 A;  3TOB A;  5HVQ C;  2JK3 A;  1IO2 A;  1YW8 A;  4M71 A;  5D4R A;  4HX8 A;  2FOK A;  3LSI A;  6PAX A;  4NC8 A;  4NUB A;  5B1A H;  4DNC A;  3UKG A;  3OYL A;  2EJR A;  3HPH A;  1J9I A;  1FP1 D;  3N97 A;  3GF2 A;  2JMW A;  2L0K A;  1FLI A;  2Y31 A;  2KRC A;  4A3C J;  2VC0 A;  2W85 A;  2MG4 A;  2RAE A;  4G6D A;  3DTI A;  4CGZ A;  1UZC A;  5LBQ A;  3TP3 A;  5D4S A;  4B47 A;  2FE3 A;  4MEX F;  1S7A A;  4HQM A;  5AON A;  4ZTF A;  4OOI A;  1VQ4 I;  3H9J A;  4JYK A;  3QOP A;  5EGO B;  2FD5 A;  4BY1 J;  3OS0 A;  3BC8 A;  3BP8 A;  3HSE A;  3P9K A;  1E0E A;  1LPQ A;  1EH7 A;  2KQR A;  3K70 D;  3COA C;  3DTK A;  2F5E A;  2F4I A;  3BCB A;  4AC0 A;  4BHB A;  1OR7 A;  4DIQ A;  5LHI A;  4J00 A;  2EZL A;  3KP7 A;  3REO A;  1OIS A;  4PJN A;  3PSI A;  4G7Z F;  4BXX J;  3WTU C;  4HEA 2;  2D1V A;  3ZMT A;  2ZXH A;  3MKZ A;  3DPL C;  3HHG A;  1CGP A;  2D2W A;  3F8B A;  4Y4R A;  4U0W A;  3M07 A;  4DZP A;  2X1D A;  3C3W A;  1HLV A;  1JTX A;  5FRO A;  1USS A;  3ZMD A;  3VFZ A;  4NC6 A;  5EZH A;  3L9F A;  2DK8 A;  1WHU A;  2M34 A;  3F0C A;  3M1E A;  1L3L A;  3A2K A;  1P7I A;  1FNN A;  2L54 A;  2M0M A;  3O3K A;  1SVM A;  5J8F A;  2LH9 A;  1K78 A;  3ECH A;  1YRN B;  2LRD A;  1WZ2 A;  5FLV A;  1IW7 F;  2DYS H;  5CVJ A;  3ZQI A;  5A2Q K;  4U0Y A;  3B6C A;  3O6B B;  3G3Z A;  2E35 A;  5BPI A;  3VYU B;  3HOS A;  1XMK A;  1OCO H;  2KKO A;  4JOM A;  2NOG A;  1QQI A;  3JAM K;  2WV0 A;  3SDG A;  1BBY A;  3DWL E;  1HST A;  3WGI A;  2E60 A;  1MD0 A;  5D8K B;  3MZH A;  3HRU A;  2P6T A;  3FHZ A;  3EQL F;  2L9N A;  2WAD A;  2VBX A;  5HLI A;  2K9S A;  3BT9 A;  1Q1V A;  1QZY A;  3BQZ A;  2MSY A;  3S8P A;  1XGO A;  2HGC A;  2E71 A;  3I59 B;  3V7S A;  1O3S A;  4PGH A;  1XS9 A;  1PUF A;  2I5U A;  1OJL A;  2RQQ A;  1R1U A;  4PJL A;  1LKX A;  2VON A;  3S1Q J;  2R7U A;  3G6E I;  4MFD A;  3GTG J;  4CYC A;  5M5W J;  4UVC A;  3RTR A;  4HOB A;  1LE8 B;  1S7E A;  1ZLJ A;  2NNY A;  1Y8R B;  1X4O A;  4KIG A;  4BQQ A;  3BR1 A;  3DEW A;  5CVI A;  1LE8 A;  3G71 I;  3BR6 A;  2HQN A;  4PCQ A;  3VSK A;  1P4W A;  3S32 A;  1HW5 A;  5ICC A;  5DCF A;  1AWC A;  4LFU A;  3BJA A;  3FBN B;  3DFG A;  2RGV A;  5CLS A;  4ANJ A;  2WY8 Q;  5ED4 A;  2LTP A;  1Z7U A;  3GX4 X;  3FXQ A;  5FFZ A;  4B43 A;  4BQN A;  5DUI A;  2XPU A;  2BW3 A;  1ETW A;  1DP3 A;  4DQ2 A;  2XIG A;  4EJW A;  2ELH A;  3HEF A;  1PUE E;  1ZH5 A;  1IXS B;  3H5R A;  2X1C A;  2ECC A;  3KZZ A;  1WCM J;  2QKL B;  5LGN A;  1VZ0 A;  1W36 C;  4HRI A;  3ZN1 A;  4I98 B;  4IRH A;  2V9P A;  4XRS G;  2PI0 A;  2CRG A;  1DUX C;  1LJ9 A;  3JRH A;  3K4J A;  1FZP B;  3MVP A;  1UHW A;  4M6Y A;  1W5S A;  1BL0 A;  3HRM A;  1YJ9 I;  4L0Y B;  1AOY A;  2AO9 A;  3MKW B;  2OA4 A;  3AG3 H;  2MLK A;  2CV0 A;  4DW6 A;  1Z9C A;  4EJT A;  4LLL A;  2XAJ A;  5DUK A;  1KZH A;  3HOV J;  2OPT A;  2L4A A;  4CDG A;  2KP6 A;  1R4N B;  2EH3 A;  3CC7 I;  4S05 A;  2P0W A;  3JRA A;  4C2U A;  3ERM A;  3IH4 A;  3N05 A;  4HF0 A;  4AVZ A;  3W6V A;  5EF6 A;  1RRJ A;  2CH0 A;  3CJQ B;  1JGS A;  1B72 A;  2VKH A;  2H8R A;  1EF4 A;  2XF7 A;  2K3P A;  3K70 C;  1D8K A;  2CUF A;  1IF1 A;  4AM3 A;  2X51 A;  1J7K A;  3E6M A;  5D5W B;  2JRT A;  3L2C A;  4M3G A;  2QSF X;  3HSR A;  1BI0 A;  4XQF A;  3GFJ A;  4L9N A;  3K10 A;  2GBY A;  1K83 J;  3BOQ A;  4LLN A;  3DPT A;  1I3A A;  2JA8 J;  1Y0N A;  5EEA A;  2L3D A;  1UAA A;  3X2Q H;  1XMA A;  5M3M J;  1V5G A;  4IVN A;  2JN6 A;  1SFK A;  2KIF A;  3WG7 H;  2WAE A;  3K2A A;  2CFO A;  2L7Z A;  3IC7 A;  1SFO J;  1V3F A;  4H0E A;  1OCT C;  3AL0 C;  2G0E A;  2X6Y A;  1I50 J;  4HAM A;  2O6G E;  2ZO4 A;  3LL7 A;  4LB5 A;  4QIW N;  3DU6 A;  3V4G A;  2QEX I;  1TWA J;  4HQE A;  2DTZ A;  3SYT A;  2OZU A;  2XAS A;  3DU5 A;  1BR4 A;  2ZFW A;  1XGM A;  3KFW X;  4LJZ F;  4ESF A;  3CCL I;  3Q5F A;  4EJO A;  2CQQ A;  4B48 A;  2DT5 A;  3S3N A;  3D0S A;  4NQW B;  1G3W A;  2CGP A;  1IV8 A;  2ADU A;  2PG4 A;  5IT3 A;  3OYA A;  2RC4 A;  3CDH A;  3CJT B;  5J40 A;  2XKO A;  1SMY F;  2V1D A;  3OIO A;  2BE5 F;  4EM2 A;  1QHH D;  3FIW A;  3QQA A;  5JI6 A;  3J80 Z;  4XRS A;  2IA2 A;  4PK4 A;  3MCZ A;  3MWM A;  3ZOB A;  3R0A A;  1MGT A;  1TWF J;  2BXZ A;  1NK3 P;  3PIP F;  2KLO A;  2JPC A;  1YOV B;  4F52 A;  5K1Y A;  3IRQ A;  1BI2 A;  1Z6R A;  4WXD A;  2P4W A;  2A05 A;  3IRR A;  2KRH A;  4I7H A;  2FQ3 A;  2HKX A;  2P7V B;  3HJE A;  4CSW A;  1IXR C;  4I01 A;  3PQK A;  5BPD A;  3OV8 A;  1X1A A;  1J2X A;  3KIO A;  2KDO A;  1A04 A;  3TGN A;  3DBR B;  1XCV A;  4NQW A;  3KZI C;  5ILV A;  4II3 A;  4R1H A;  5K7F A;  2HWV A;  1IDZ A;  3JR9 A;  1MBF A;  1YIJ I;  2EK5 A;  1G6N A;  1AU7 A;  4Q5S F;  2L7F P;  3IKV A;  3L2V A;  2Y48 A;  2E7W A;  4GRI A;  4DYQ A;  1OPC A;  2X6O A;  2XRL A;  3KEO A;  2E2J J;  2LY9 A;  2W25 A;  3H5A A;  4LMY A;  5B5E C;  3ZQH A;  3WTX C;  2PMZ N;  1STZ A;  4UV8 A;  3BG3 A;  2ID6 A;  3I58 A;  4XSZ F;  2VAS A;  4LK1 F;  1J75 A;  3HGY A;  3S2D J;  2GA2 A;  3LSH A;  1ZK8 A;  5KAI C;  4HX4 A;  4WF2 A;  4J01 A;  1FOW A;  2HTS A;  5KVR A;  3SEQ A;  4D7N A;  3ABL H;  2P8T A;  2X4H A;  3FF5 A;  4RM2 A;  4EVI A;  4WCG A;  4M9Z A;  4AWX B;  2FRH A;  2UXN A;  3VYS B;  2ZJ2 A;  5J4Y A;  1T0F A;  3SDB A;  4BDZ A;  2QEN A;  3M8F A;  4Y33 A;  4ZH4 F;  3G1M A;  3KP6 A;  2HZD A;  2EBI A;  1ETQ A;  5ICG A;  2EZI A;  2Y30 A;  3W6K B;  3OS2 A;  2OBP A;  3OR1 C;  2CV1 A;  3GTL J;  1A36 A;  3CD6 I;  2K7L A;  1BC7 C;  4DGW B;  3B6A A;  2DA2 A;  5LRS A;  5D6E A;  4BBR J;  4ESB A;  2QCO A;  1FIA A;  3CDL A;  1WI3 A;  3ABT A;  3W2A A;  1I3Q J;  3U21 A;  3QYF A;  3OYK A;  4A0Z A;  1CF7 B;  3OYF A;  1N78 A;  1QHG A;  5L3G A;  3OOP A;  1JHH A;  2W48 A;  5DCM A;  1RUN A;  3S1M J;  1FTZ A;  4KMU X;  3JCU C;  3TDZ C;  1VQ7 I;  3WG9 A;  1Y6I A;  2HKO A;  3QPH A;  5L3B A;  5ICE A;  3A0H C;  1FTT A;  2HPM A;  2AXT C;  1W36 D;  3EUA A;  3Q0V A;  5HOO A;  1K6O A;  1MDM B;  3TMO A;  3RKY A;  3VYR B;  1SVL A;  1U5T B;  3CMM A;  4AVP A;  4KJZ A;  1NK2 P;  4ENJ A;  4GGG A;  3CC4 I;  3CZ6 A;  2RQP A;  1UG0 A;  4M9S A;  4OIR F;  3GZN B;  4EJV A;  1GUU A;  2EIK H;  2FX0 A;  5JLW A;  3G2B A;  2JA2 A;  2RKH A;  4IKF A;  5JHU A;  5LD2 C;  3IAM 2;  3CCJ I;  2TRT A;  2EQR A;  4HG2 A;  5LGT A;  3DP7 A;  3CMA I;  2LY2 A;  4JQF A;  3GTM J;  2CQN A;  3BG7 A;  3PFY A;  3VSL A;  5M3F J;  1R23 A;  2M4G A;  1IZ1 A;  1L0O C;  5EZG A;  2M5W A;  5JVG F;  5IT9 K;  1ZTR A;  2WBM A;  4HNU A;  2FQ4 A;  1ZRE A;  1Y39 A;  4HNV A;  4A6D A;  1G2H A;  2FMY A;  1Z3X A;  3GFI A;  4OMY A;  2J5O A;  2HU9 A;  5E1X A;  1ZG5 A;  2EIL H;  5F0H A;  1DGW Y;  2GIZ A;  1TZL A;  1RZ4 A;  2VPL A;  4B1R A;  5E20 A;  1J5Y A;  1U78 A;  3H9G A;  2L9V A;  4Q4Z F;  4P96 A;  1LFP A;  3U2R A;  2EV5 A;  2L02 A;  4KIT B;  3ASO H;  2I8D A;  3HL2 A;  1SC7 A;  4MIM A;  2Y9Y A;  5DYM A;  3IAS 2;  3WU1 B;  4S0H B;  1MMD A;  2E36 A;  3RYR A;  4HF1 A;  2BGC A;  5FD6 A;  2ZNY A;  4W1U A;  3GTK J;  2ZJR F;  2IA0 A;  5C3E J;  2BYV E;  1YJW I;  3J7A Y;  4Z2Y A;  1YLF A;  2AXL A;  2CMP A;  2CWE A;  3KLO A;  3S17 J;  1O3T A;  3KYL A;  3MZY A;  2JUC A;  3PUF A;  4HDV A;  5CYV A;  1LVA A;  1P7J A;  4Y7N J;  2LBF B;  2M30 A;  2P81 A;  4M72 A;  1KQ0 A;  3A0B C;  4Y17 A;  1QO0 D;  1F43 A;  2MFZ A;  1REP C;  2XRO A;  2DYR H;  3FK6 A;  5FB2 A;  2DMP A;  3FM5 A;  1FEX A;  4TV7 A;  4HPQ A;  3C2H A;  3V7R A;  4EEF G;  5B3S H;  4CYD A;  4ZTJ A;  2DK5 A;  2EV6 A;  2Q0O A;  1PP7 U;  3CME I;  2TDX A;  2QBY B;  2CW0 F;  2NVQ J;  1VQ8 I;  1HW1 A;  3HG9 A;  3RQ4 A;  4C2T A;  3P7N A;  4UNO A;  2VJ5 A;  1B6A A;  1YQA A;  4W97 A;  3WE3 A;  3AAF A;  3GLL A;  3KCC A;  1ITY A;  2K9N A;  3C1D A;  1K7A A;  4E7H A;  2PJR B;  3S16 J;  1Y1V J;  1R5G A;  4K2E A;  1IN6 A;  1YW9 A;  2VQG A;  4B44 A;  3OYE A;  1B8I B;  1IGN A;  4C2M J;  1IDY A;  2R7Z J;  2PQ8 A;  3CJN A;  4IXA A;  1MKM A;  1Y56 A;  2BXY A;  4Q47 A;  3V42 A;  5BNG A;  3EET A;  4ZYH A;  1UST A;  1XDS A;  4O5V A;  4B09 A;  4CH7 A;  3GTP J;  4LLG F;  1YRN A;  2V7F A;  3PJR A;  4ENK A;  3OYM A;  3AFH A;  1TL8 A;  1WJ5 A;  2X6X A;  1DU0 A;  4U87 A;  3SHF A;  2V79 A;  5IY5 H;  1QVT A;  2DMN A;  2LDU A;  5HS7 A;  3FKJ A;  5D5X B;  1G8X A;  2ICW G;  4OMZ A;  3J7A O;  3IWF A;  2Y9Z A;  2VQL A;  3E5U A;  1UMQ A;  2OJE D;  2W82 A;  4D1Q A;  1HKT A;  1VQK I;  2IGM A;  4II2 A;  1NG6 A;  3HOY J;  1A6I A;  1QVU A;  5K7H A;  1GDT A;  2E34 A;  3R60 A;  5GAE J;  2EWN A;  2DA3 A;  2MW8 A;  2Q2E B;  2NVX J;  3EUH A;  5M5X J;  3WGH A;  3GUD A;  2LOO A;  4HLX A;  2A07 F;  1ZLK A;  1LDK B;  1YX5 A;  4XLP F;  2X1E A;  1PP8 F;  1U5T C;  3WU2 C;  2ZSH B;  4XOT A;  4FT8 A;  1TWC J;  2ISZ A;  2M7B A;  2ZXJ A;  1T98 A;  3IV5 A;  2IRF G;  2JJ7 A;  1C0W A;  1U5T A;  5GTI C;  4AYB N;  4A3F J;  3I71 A;  3TOA A;  4CIC A;  2DA4 A;  4IOA F;  4CCM A;  2KL4 A;  1YHQ I;  2Y75 A;  4G8X A;  1RI7 A;  1FPQ A;  2VKD A;  3ERE D;  1P4X A;  3I3L A;  1XCB A;  4P9F A;  1XGS A;  3BG5 A;  4BUP A;  3QU3 A;  1LEA A;  1Z7L A;  1ON1 A;  5F0C A;  1V5E A;  4BE1 A;  3KEQ A;  4RGS A;  1OCR H;  2E1M C;  4ZYD A;  1IV6 A;  2LY1 A;  2XVC A;  2WTE A;  3QPT A;  5F64 A;  1YI2 I;  3IHU A;  2ZME B;  1BR2 A;  4OWR B;  2O3F A;  1VQ9 I;  4HSR A;  3S1N J;  4G7O F;  5LGU A;  2IT0 A;  1T39 A;  1OCZ H;  4QWQ A;  4RAY A;  3OYB A;  3HPG A;  3LMM A;  2EZK A;  2HS5 A;  2PX9 A;  3JW4 A;  2Y0M A;  4MQV A;  4HNT A;  4U7D A;  1VQP I;  4X6A J;  2VXD A;  3C18 A;  1F4K A;  2WAQ N;  2MC3 A;  3CCU I;  3K2Z A;  1R22 A;  1W7P B;  1B9M A;  3PFI A;  4ZYG A;  5KCM A;  1MH3 A;  3TP0 A;  3F6O A;  4XKC A;  5FJ8 J;  3F8N A;  5GP9 A;  2B9S A;  4FCY A;  2VT2 A;  4CUG A;  3FXU A;  1LUJ B;  2K27 A;  3N4M A;  3A1Y A;  3LQQ A;  1SMT A;  4HA8 A;  3BDD A;  3CUO A;  3TDU C;  2L5Q A;  1R1V A;  3ZMS A;  4QPO A;  2ESN A;  2KIM A;  1JT6 A;  5TIS C;  1P2F A;  3K1N A;  3NQO A;  2F5F A;  2GQQ A;  1S5L C;  3H1C A;  4M6X A;  1AKH B;  1MMA A;  4KA4 A;  1SD7 A;  3CCM I;  2L7K A;  5IT9 Z;  2K3F A;  3JRD A;  2H27 A;  2VOO A;  3K6G A;  1R5H A;  1WJE A;  3BR2 A;  1IN7 A;  3KET A;  2DPD A;  4HF2 A;  3FWE A;  2F4M B;  3BJO A;  4AIK A;  3HC7 A;  2QBY A;  3OOU A;  3WTW C;  3BLY A;  2NVU B;  1BOB A;  4RM3 A;  4RBO A;  3CMY A;  4BYY A;  3MKL A;  3MN2 A;  1XD7 A;  3ABK H;  3TW7 A;  1B8I A;  2O03 A;  1VQO I;  4A69 C;  2NNN A;  1Z91 A;  1LVK A;  4KYW A;  3T5X A;  4PJJ A;  2V6E A;  3KZY A;  3TL4 X;  2HYG D;  2RV8 A;  5CQG A;  4RDU A;  2FML A;  2QGU A;  1WPK A;  4IRG A;  2VJ4 A;  3BZK A;  3BPX A;  2HI3 A;  2DDB A;  2ZKZ A;  1MBH A;  1EJ9 A;  1Q1H A;  4PFP A;  2IBD A;  2FUG 2;  2K86 A;  2M0C A;  2NXN B;  1RNL A;  2R7O A;  2VKE A;  4B8X A;  1TW3 A;  3WOD F;  3S2H J;  1D0X A;  4F93 B;  1JI8 A;  4E7I A;  2CUZ A;  3OMY A;  4FIS A;  1YS6 A;  2G7U A;  4EM0 B;  3M1C A;  1RR7 A;  2Z5U A;  3M8J A;  2CV2 A;  1D1B A;  1ZQ3 P;  2H09 A;  4GYI A;  4KMF A;  1ZAO A;  3L7W A;  2IS2 A;  4XM3 A;  5L3C A;  3AG1 H;  1R36 A;  4MLO A;  4UXN A;  2ZCW A;  2FBK A;  3H0G J;  4IQ4 A;  1SAN A;  1Y1W J;  2R7F A;  2IS4 A;  3V8J A;  3S1R J;  1QZZ A;  2QQ8 A;  4HX7 A;  3ZGK A;  2W84 A;  3WTT C;  1IUF A;  3WHC A;  2HR3 A;  1BC8 C;  4YG2 F;  3JSP A;  5DDG A;  3HDD A;  1K79 A;  3A03 A;  3WTV C;  4ASN A;  2B7E A;  4AUX A;  4IOC F;  3OL3 A;  3CCY A;  4H4K C;  3S2W A;  2O7O A;  3M7G A;  1POG A;  3RPU A;  5HDN A;  4P9U A;  3CF2 A;  4M73 A;  5GAD J;  1FSH A;  4XON A;  3CUQ A;  2DMU A;  1E2X A;  4RAZ A;  3TO9 A;  3CO6 C;  1R49 A;  2R7X A;  3LFU A;  3DQV C;  3KP3 A;  4JX6 A;  3G4S I;  4XLC A;  3D5L A;  1EH8 A;  4C30 A;  3ONQ A;  5FO5 A;  3FK7 A;  1HDP A;  3HOT A;  1BIA A;  3L09 A;  1MBE A;  3HOU J;  4Y13 A;  1IN8 A;  1P92 A;  3LAJ A;  3HIF A;  3LA7 A;  3ZMZ A;  4XOR A;  1E3O C;  3NRV A;  5FGM A;  1CQT A;  4E7Z A;  1UHM A;  3CLQ A;  5D5U B;  1JUS A;  4F91 B;  3F9K A;  2ACJ A;  2ZFU A;  4BXU A;  1KU9 A;  2FU4 A;  4N9H A;  3CTA A;  1F9N A;  4CZC A;  3GEZ A;  3Q0W A;  5IP9 J;  1KON A;  4X1E A;  3ROU A;  1OQY A;  5L3F A;  5K5O A;  1I1S A;  1IUY A;  1WFX A;  4GCV A;  1S3J A;  2M3A A;  3H5N A;  4BAY A;  2JA7 J;  5CJ9 A;  3GTQ J;  2DCE A;  2EFW A;  1QPI A;  1GXP A;  2WV1 A;  4KIC A;  4KN4 X;  1LEB A;  3KPH A;  3HOW J;  3CCQ I;  1RES A;  3G1L A;  1IG7 A;  2RN7 A;  1I1G A;  1P4A A;  2DW4 A;  2RVC A;  4N0B A;  2HEO A;  4RLQ A;  2BZT A;  4YIR X;  2PFB A;  1S7O A;  1MND A;  1ZG3 A;  2EFQ A;  2DQL A;  2CQX A;  2XV4 S;  1B1B A;  2F48 A;  4BEH B;  2KIS A;  3OYH A;  1ON2 A;  4LIV A;  3C7J A;  1VND A;  2XRN A;  3BTJ A;  3DKW A;  2VOD A;  1ULY A;  5TGT A;  1WJD A;  3HXL A;  1R4M B;  1SFX A;  4JK1 X;  1FIP A;  2CSO A;  2R5Z A;  2DLL A;  3VDX A;  3TW6 A;  5HDK A;  1BM9 A;  3JRC A;  1U8B A;  1ODD A;  5FRN A;  1D8J A;  5ICF A;  2E7X A;  5JVT A;  2MC4 A;  2EIJ H;  2Y69 H;  4YII A;  4FAS D;  2KJC A;  2NAZ A;  2X6W A;  5C4J J;  2ZNZ A;  4A0Y A;  5KK1 A;  1BI1 A;  4V2F A;  1ENH A;  4L5I A;  4IEJ A;  3R0J A;  3DCF A;  2Z9O A;  2PMU A;  2YUS A;  3GW2 A;  3M3Y J;  1GT0 C;  2A68 F;  2H1L A;  2IP2 A;  3F8M A;  4P1W A;  2EB7 A;  2LD5 A;  3WTY C;  4BH9 A;  1FOK A;  4LK0 F;  3HYI A;  3RZO J;  3J7Y J;  4L9V A;  5HLH A;  5E3N A;  2NVY J;  5H20 A;  4FTH A;  2DFE A;  1OCP A;  4UUT A;  2P5L C;  2XAF A;  3R4K A;  3T1B A;  1MMN A;  2Z3Y A;  5KAF C;  2DA5 A;  3LSM A;  1X19 A;  2DOD A;  5F0F A;  5E1Z B;  2O8K A;  1EA3 A;  2DAO A;  2XHK A;  2W1O A;  3PNT A;  1Z21 A;  2HQ5 A;  4G6T B;  3VOE A;  1WVR A;  1LFU P;  3IL2 A;  1W4M A;  2HTJ A;  2DXI A;  1XX5 A;  3PM1 A;  2HPI A;  4N4N B;  1BW6 A;  4IF4 A;  4ZYE A;  4NHJ A;  2COB A;  2M9H A;  2R92 J;  4BKX A;  4EAT A;  1ZN2 A;  2BY2 A;  1U3E M;  1MDM A;  2W00 A;  3FMQ A;  1XMX A;  1EH6 A;  3JRF A;  1O7L A;  1X2N A;  3FBI B;  3K4K A;  4XL9 A;  1W0T A;  1LQ1 A;  2MLG A;  1WSU A;  1R7J A;  5F1J A;  2LF7 A;  4RA2 A;  3B73 A;  2B0L A;  5CVR A;  5J47 A;  3BTI A;  1SFU A;  1LDD A;  1ZR4 A;  3OY9 A;  5BOX A;  2Z99 A;  3BRO A;  2K40 A;  2P5V A;  1OYY A;  3LAP A;  4UUS B;  1S29 A;  4WWC A;  5K5Q A;  4IL6 C;  2Q2E A;  4PZJ A;  1ZG1 A;  1TQI A;  2IGN A;  3SZT A;  2IS1 A;  4Y52 J;  2OF7 A;  4PFO A;  3PNV A;  3MKY B;  3ZPL A;  4I09 A;  4IHT A;  2R0Q C;  4BU2 A;  3OS1 A;  4P5O A;  2MH9 A;  2A5Y B;  4U0V A;  5E18 F;  1RKT A;  1X1B A;  2FF4 A;  1V54 H;  2VJI A;  3ZQL A;  3OR2 C;  1BJZ A;  1T33 A;  3TO7 A;  4MQ9 F;  2DQR A;  1RKW A;  4IJA A;  1BA5 A;  1I6H J;  2V26 A;  4PUS A;  3K4M A;  1WH5 A;  1VF9 A;  4ABZ A;  4BBS J;  9ANT A;  3NEU A;  3FXR A;  3PUB A;  5D5V B;  2BY0 A;  1ZRD A;  4FQG A;  5J1U A;  2ZXI A;  2V6C A;  1JGG A;  1H9T A;  5LLQ A;  4L18 B;  3PQJ A;  2AQF A;  3FXM A;  1SD4 A;  4OU0 A;  3VYT B;  1WI9 A;  3HM5 A;  4BJ5 C;  2VOP A;  3CO7 C;  2NS0 A;  2A3S A;  4YRV A;  1LNW A;  2E19 A;  3I55 I;  2ETH A;  1E3H A;  3DXJ F;  1KA8 A;  1B4A A;  3QU6 A;  3T8T A;  3S3O A;  2D1H A;  1IJW C;  2LLK A;  3CCE I;  2XF5 A;  1J0R A;  4RAG A;  2ZJQ F;  1D0Z A;  1R00 A;  3DTE A;  3QP5 A;  3QRF F;  1AHD P;  4GO1 A;  2YR2 A;  1WQ2 A;  3FKI J;  3EDP A;  3SEZ A;  2JZY A;  1QU3 A;  1ETX A;  3WGG A;  3SQN A;  4RB3 C;  2UZK A;  2CW7 A;  5H6Q A;  4ON0 A;  2A6E F;  1MW7 A;  4PDK A;  3CP8 A;  4ETS A;  2PN6 A;  2N8G A;  5IPA A;  4E7S A;  3QPS A;  4J19 A;  4FET A;  3U1K A;  3ABM H;  1MNE A;  4QTR A;  2DJI A;  5J4V A;  2W57 A;  4PGG A;  1IRF A;  2M87 A;  5FLM J;  1MSE C;  1NH3 A;  2Q1Z B;  2MAB A;  4FE7 A;  2CJJ A;  3TED A;  5CKT A;  3F72 A;  1YX3 A;  3VB2 A;  3RJP A;  1J59 A;  1X2M A;  3ESW B;  5HOD A;  2RRE A;  5EGO A;  1QBJ A;  2K02 A;  4I2O A;  5HDG A;  2D45 A;  2DMT A;  3K4N A;  4ENM A;  2OZ6 A;  1MSF C;  4CYC B;  1B9N A;  2CFX A;  2LBF A;  2ZBK A;  2HYJ A;  4S04 A;  4IO9 F;  3WTZ A;  5FKM A;  3SFZ A;  3LOC A;  4EMS A;  5GPA A;  3P9I A;  1GXQ A;  3VOD A;  3FX3 A;  3GLX A;  2YU3 A;  4RB2 C;  3J81 K;  4ZZL A;  4BDY A;  4D0P A;  1QA6 A;  2L9S A;  5JHF A;  1FC3 A;  1FYK A;  4I76 A;  1GHC A;  2JVG A;  3SZP A;  1ZKG A;  2L7M P;  5DD8 A;  5IOY A;  1E17 A;  3FIS A;  3ABU A;  4LG3 A;  3E7L A;  1FWZ A;  2R7S A;  1D5V A;  3FM3 A;  3GFM A;  1G3Y A;  3KP5 A;  5FD5 A;  3RI4 A;  1Y0U A;  3K4C A;  1BOA A;  4EQQ A;  4M74 A;  3FXK A;  3U1D A;  1TNT A;  4MGR A;  4CZZ A;  1T8I A;  1Z77 A;  3JRI A;  4XLE A;  1QGP A;  1K78 B;  1XTA A;  2O61 A;  1D1C A;  4D5C A;  1QRY A;  1OFC X;  3MFK A;  3RPQ A;  3GTJ J;  2O5R A;  1XN7 A;  3L2W A;  1VQ6 I;  4BJT A;  1AKH A;  1ZGW A;  2LG4 A;  4E4H A;  3L1P A;  4A93 J;  1UB9 A;  1SVO A;  3I56 I;  5FKO A;  3RSN A;  4ZZD A;  3SFI A;  1T08 B;  3WTS C;  2DU9 A;  1IXC A;  1XSV A;  1W7P A;  2JRM A;  3ASN H;  2K9M A;  3BWG A;  3H36 A;  3SXY A;  3HOZ J;  5BQT A;  3IUO A;  2WY7 Q;  2GWR A;  3R6S A;  4G94 A;  4KT6 A;  1U2W A;  5B66 C;  1VFC A;  4YFK F;  1U9N A;  4AIH A;  4XIC A;  2CW8 A;  3HRS A;  2PMH A;  4KIF A;  1DDN A;  4C3H J;  1TQP A;  2R7T A;  3F22 A;  2VBY A;  1YFH A;  4R79 A;  4DOZ A;  3DKX A;  3LA2 A;  4JP0 A;  2XF6 A;  5ILU A;  2MA3 A;  2O0Y A;  1VQL I;  1ACI A;  1YYV A;  3HRT A;  1ZEL A;  4I0B A;  2ZME C;  1OMI A;  2NS8 A;  3LSG A;  4ENN A;  4OIP F;  3ZMU A;  2Y0S N;  5BMZ A;  3HTS B;  4UB6 C;  1T95 A;  4F92 B;  1HW2 A;  4AID A;  2CQK A;  4YFX F;  1N25 A;  4YIF A;  2GOX B;  4M3E A;  1HA8 A;  4G7H F;  4LIU A;  2KJB A;  4XID A;  3ZXS A;  3ECO A;  1Z05 A;  2XAG A;  2XKP A;  1GLN A;  1A5J A;  2K85 A;  2QVO A;  3HKZ N;  4IRI A;  4M6V A;  4PSX A;  4DBQ A;  3QWL A;  4XBF A;  2GA1 A;  5L3E A;  3GME A;  2CS3 A;  5E8I A;  4RGU A;  3DLA A;  4A12 A;  4ITV A;  2IVM A;  5LHH A;  3VPR A;  5HNF A;  4LB6 B;  1SAU A;  1FYM A;  2ME0 A;  2K4B A;  2RDP A;  2OV7 A;  1XDU A;  1HDD C;  5FKK A;  2JA5 J;  1HCR A;  5TJJ A;  4RB0 A;  2C6Y A;  1X3Z B;  3WHB A;  5F27 A;  4XLN F;  1ZAR A;  1D0Y A;  3WE2 A;  5J6X A;  4BE2 A;  3JRE A;  2COM A;  1Z67 A;  4UHT A;  4BY7 J;  4YFN F;  4HDU A;  1JUM A;  4KUM A;  1MJA A;  2O8X A;  1YIO A;  1IC8 A;  2R7R A;  1OYW A;  3GFL A;  4KIB A;  1TTY A;  1S72 I;  2RNG A;  2Z16 A;  3BG9 A;  2F5V A;  3S93 A;  1JJ8 C;  1JKP C;  2VXZ A;  3ZCO A;  3QAH A;  5E3O A;  1N75 A;  2VN2 A;  4KT5 C;  3EYY A;  3LSJ A;  2A6H F;  3A02 A;  4L5E A;  4UB8 C;  5E8G A;  1F1Z A;  3CP2 A;  3ULQ B;  2LYC A;  3GZ5 A;  3CCS I;  2GZW A;  2UXX A;  1TQM A;  3O2P E;  3SZG A;  2XGC A;  2QLZ A;  3BPV A;  4Q48 A;  3HOX J;  1JE8 A;  5J1Y A;  1DP7 P;  2YX4 A;  4CA0 A;  4ZDL A;  2K9L A;  2E1O A;  1FBQ A;  4MNU A;  1O7F A;  1A6Q A;  3HUG A;  2DBB A;  5HS9 A;  3QOD A;  1WJC A;  2DT7 B;  2H8W A;  2YSR A;  4A3D J;  4BHP A;  3KLN A;  3RIR A;  2CQ7 A;  2MH2 A;  3QP6 A;  4MFE A;  3QYE A;  2CUE A;  2E1C A;  3CUQ B;  1T0F C;  2E1M B;  2Y0S A;  2GXG A;  2KFD A;  3LFK A;  5JLX A;  3GXO A;  3OYN A;  2XB0 X;  2LRE A;  4V2G A;  3W2W A;  3E97 A;  1H89 C;  5E79 C;  5F1R A;  5C4X J;  4C3J J;  1A35 A;  5EEG A;  1X4P A;  1MH4 A;  3ZR8 X;  1OLT A;  2UUZ A;  3ZP5 A;  4O3M A;  3F3X A;  1FYL A;  2CUJ A;  2WWY A;  4M9X A;  2DOF A;  2PJR A;  1WGX A;  3HZJ A;  1MMS A;  1IRX A;  4E7L A;  1JKO C;  2WB1 N;  1X1C A;  4LIT A;  1PVE A;  3EUH C;  2VI6 A;  2DJN A;  4DJA A;  3E0J B;  3PL8 A;  2STW A;  3LNQ A;  2BEO A;  3E5Q A;  5FLX K;  3HHH A;  3HKZ A;  4UVA A;  3D5S C;  5E1W A;  3U9G A;  4XR6 A;  2R7Q A;  2FNP A;  1X58 A;  3C2G A;  4IHS A;  3GVA A;  3LWF A;  5FLX Z;  2KZV A;  4A5M A;  2W24 A;  2XDV A;  2OAZ A;  2QUF A;  2IPQ X;  3FDY A;  2KPM A;  4MEY F;  2IA1 A;  4EGZ A;  1IAW A;  3K4B A;  2ECB A;  2VC1 A;  4BL0 B;  4D7M A;  3L00 A;  4CCO A;  3F6V A;  1IN4 A;  2FA5 A;  1VI0 A;  1O3R A;  1FT9 A;  4E6K G;  5D6F A;  3I5U A;  3IWZ A;  4MHG A;  2QQB A;  2XB5 A;  2LF8 A;  3H9Q A;  3P5J A;  4XLF A;  3I4M J;  3CES A;  1ONV A;  3I59 A;  4B4C A;  1QZE A;  2LKP A;  3ELK A;  4KFC A;  3ML6 A;  2OD5 A;  1UEL B;  3BQY A;  1HBX G;  4CHU A;  2V9V A;  2F5D A;  1G3S A;  1YS7 A;  2HXI A;  4RGX A;  1BJA A;  3AL0 B;  1WJB A;  1Z0X A;  4RB1 A;  2M8E A;  1VTN C;  3K0L A;  1E3P A;  4F3Q A;  2E2I J;  4UVB A;  1SD5 A;  4A3E J;  5F08 A;  3GZ6 A;  1H8A C;  2LMD A;  1GV5 A;  2F2E A;  3ZQG A;  2JQ7 A;  2EA2 A;  1W5T A;  2XAU A;  4M3B A;  3F23 A;  1I6X A;  5H6R A;  1O57 A;  2VBZ A;  4CCK A;  3BZ6 A;  5IP6 A;  3OWT A;  5EG0 B;  4A3G J;  2ISY A;  1YIT I;  2NOJ B;  1ORK A;  1WJF A;  3H92 A;  3H3U A;  4XRF A;  5E3L A;  3KYD B;  1Z3Y A;  1TWH J;  2OCE A;  3RQI A;  1WH7 A;  2UWM A;  3I0T A;  3NWT A;  4N9I A;  3ISP A;  2DT6 A;  2R3S A;  3I54 A;  1VQN I;  2H1K A;  2HDW A;  4D5F A;  3BY6 A;  4XKB A;  1CF7 A;  4MTE A;  3HGG A;  1F5T A;  4BQO A;  2A6T A;  1APL C;  3E5X A;  3T8R A;  2EV0 A;  2MGQ A;  3H3V K;  3PO3 J;  3BG6 A;  3M4O J;  1X1D A;  1VQ5 I;  4NDL A;  2RNJ A;  1XSX A;  2XSD C;  4LG0 B;  4UUV A;  3OSG A;  1D1A A;  4FHT A;  3PSF A;  2JA6 J;  5CPR B;  4IQJ A;  1HXD A;  2JT1 A;  4M3D A;  1UCR A;  2QQ9 A;  5LRR A;  5DD4 A;  2STT A;  2BOL A;  3I4N J;  4IZZ A;  3CCV I;  2QSH X;  2R5Y B;  1UG2 A;  3KP4 A;  2XAH A;  3DBL B;  2ID3 A;  5HS8 A;  1MJB A;  4PJ0 C;  4I99 C;  1YE9 A;  3OYG A;  3IH3 A;  3JAM Z;  4LD5 A;  4XRM A;  2KRF A;  1H88 C;  3SJM A;  1BN5 A;  4HYE A;  4CCN A;  1TW2 A;  1MNM C;  1G4D A;  4IHX A;  2W7N A;  2Z1D A;  1YG2 A;  2IGO A;  3FMR A;  1BI3 A;  2FSW A;  2XUB A;  1HKQ A;  3MEX A;  3KEY A;  4GDF A;  3B02 A;  2IGK A;  4IPA A;  1FSE A;  2GXB A;  5DCM B;  2P6S A;  4A3J J;  5LHG A;  5IYD J;  4GFB A;  2F5C A;  1HF0 A;  2QA4 I;  1FOY A;  4F55 A;  1B59 A;  1MBJ A;  1S6L A;  2NYX A;  3QPL A;  1S9H A;  2HOA A;  3M8E A;  2ME6 A;  4DBR A;  3FMS A;  2PEX A;  4ZJZ A;  1ETV A;  2EIN H;  1NHA A;  3G73 A;  2OCC H;  2MYS A;  1H9G A;  1YO5 C;  3IKT A;  5ILS A;  1KYW A;  3L2R A;  2BVL A;  3UR3 C;  3J81 Z;  2FXA A;  4A3B J;  1WWX A;  1QPM A;  4FX4 A;  2QZ8 A;  4L5J A;  2DA7 A;  2WA0 A;  2OQG A;  3OYD A;  2X85 A;  2YU9 J;  2HQA A;  3RKW A;  3L2U A;  1U8R A;  2KDZ A;  4HW0 A;  4HV5 A;  1TC3 C;  2MBF A;  1X3W B;  2IW5 A;  2QQA A;  2Z33 A;  2H6B A;  4AYB A;  2HYF A;  1A31 A;  1IRG A;  1V55 H;  3E1S A;  1K61 A;  4XN0 A;  5GAH J;  3J80 K;  5C44 J;  4XKV A;  3VWB A;  3DV8 A;  2BVM A;  2ELJ A;  1YJN I;  1V5F A;  1NTC A;  2QWW A;  3G1O A;  5CQE A;  1ETY A;  2IAI A;  3RCO A;  1OYI A;  2OTL I;  2ELK A;  1GVD A;  1MMG A;  1KGS A;  1ZYR F;  2BBY A;  3OYI A;  1V4R A;  5K5R A;  1KU2 A;  3LST A;  1TBX A;  5KNL A;  2NRA C;  3DPU A;  3JTG A;  4XSX F;  3DKY A;  1XGN A;  4P55 A;  1I39 A;  3MZ8 A;  2VE8 A;  2ZJP F;  1HC8 A;  2A69 F;  2EFN A;  3OIQ A;  4E7J A;  2OC6 A;  4JBA A;  1JJ6 C;  2OTJ I;  2L4M A;  3E3V A;  4QPQ A;  1SFE A;  3CCR I;  4MO7 A;  1PYV A;  3EPZ A;  3O8H A;  4L0Z B;  2ZXW H;  4OAY A;  2X9D A;  3O8G A;  4FX0 A;  1KU3 A;  1UHS A;  3BR5 A;  1FMV A;  2FOW A;  4A3K J;  2GAU A;  3IH2 A;  1HOM A;  2FJ1 A;  2R7W A;  1N77 A;  1T56 A;  5B1B H;  2IEK A;  3TO6 A;  3Q3S A;  3EYI A;  1ZGA A;  2HZT A;  2XPW A;  2DOE A;  4ZYA A;  2P5K A;  3TKY A;  1T6S A;  2V1U A;  3CJR B;  2GOM A;  5K7Z A;  2XGE A;  4PSW A;  4CXF A;  5HLG A;  2XPV A;  1D3Y A;  3R61 A;  2VPR A;  4JX4 A;  4Y3O A;  1I5Z A;  1O3Q A;  1ETO A;  2X0L A;  2HOE A;  3K69 A;  2EPF A;  2Y2Z A;  3A4C A;  3RDI A;  2DO7 A;  2HVQ A;  4EJU A;  3HB9 A;  2HDC A;  4EM1 A;  2K9Q A;  2KIU A;  1TWG J; 
#chains in the Genus database with same CATH homology
 3E7L A;  2MSY A;  1PUF B;  2O9L A;  2DA6 A;  3JRB A;  3BG5 A;  1XS9 A;  1PUF A;  4LOC A;  1OJL A;  5F0C A;  1IV6 A;  1Z77 A;  3JRI A;  3S1Q J;  4MFD A;  3GTG J;  3BR0 A;  4CYC A;  5M5W J;  2JWT A;  4D5C A;  1QRY A;  1OFC X;  5GPC A;  1LE8 B;  1S7E A;  3GTJ J;  2KT0 A;  3OSF A;  3S1N J;  3BR1 A;  1MBK A;  3DEW A;  1ZGW A;  1AKH A;  2QF7 A;  3LSR A;  3L1P A;  1LE8 A;  4A93 J;  3BR6 A;  5FKO A;  3GTO J;  5J1R A;  3GBG A;  3SFI A;  2EZK A;  1LFB A;  4X6A J;  2LTP A;  3HOZ J;  4IHV A;  2WAQ N;  1RET A;  2NS7 A;  2XPU A;  1ETW A;  2VKV A;  1JKQ C;  1VFC A;  1U9N A;  4XIC A;  3HEF A;  1MH3 A;  3TP0 A;  1B72 B;  4C3H J;  2ECC A;  1WCM J;  5FJ8 J;  5GP9 A;  4FCY A;  4UUS A;  4XRS G;  2CRG A;  3JRH A;  3MVP A;  4JP0 A;  1BL0 A;  3BTL A;  5DS9 A;  1D5Y A;  2AO9 A;  4A3L J;  2HDD A;  2NS8 A;  4DW6 A;  3LSG A;  1JT6 A;  2ZB9 A;  2M8G X;  4DYC A;  2Y0S N;  1Q1V A;  3HOV J;  1AKH B;  2OPT A;  2EH3 A;  3JRA A;  2GM4 A;  3JRD A;  2HXO A;  3IH4 A;  2LR8 A;  5EF6 A;  3W6V A;  1MBG A;  4M3E A;  1B72 A;  2H8R A;  3BR2 A;  1EF4 A;  4XID A;  2CUF A;  1A5J A;  3HKZ N;  2DMQ A;  2VUM J;  3OOU A;  4M6V A;  4M3G A;  2GBY A;  1K83 J;  5M5Y J;  4RBO A;  3VPR A;  3CMY A;  5IOZ A;  2ME0 A;  3MKL A;  3D1N I;  3MN2 A;  2JA8 J;  3TW7 A;  5FKN A;  5EEA A;  1HDD C;  1B8I A;  5FKK A;  2JA5 J;  1HCR A;  5M3M J;  4A69 C;  2JN6 A;  3WHB A;  5F27 A;  3K2A A;  2L7Z A;  1SFO J;  4RDU A;  3JRE A;  1OCT C;  4BY7 J;  1WPK A;  2G0E A;  1JUM A;  1I50 J;  2HI3 A;  5F04 A;  2L9R A;  1MBH A;  2X48 A;  1IC8 A;  2IBD A;  1IRZ A;  3BG9 A;  2M0C A;  4QIW N;  2I10 A;  1JJ8 C;  1JKP C;  1TWA J;  2VKE A;  2DTZ A;  3S2H J;  1ZR2 A;  5EDN A;  5EG0 A;  4FIS A;  5E3O A;  1RR7 A;  2CQQ A;  1FJL A;  1ZQ3 P;  5DTD A;  3LSJ A;  2DA1 A;  4MLO A;  3A02 A;  3H0G J;  4L5E A;  1Y1W J;  1SAN A;  3S1R J;  3OIO A;  3FIW A;  3QQA A;  4C3I J;  1IUF A;  2XGC A;  3WHC A;  4XRS A;  3HOX J;  3ZOB A;  1TWF J;  2YS9 A;  5J1Y A;  1NK3 P;  4XK4 A;  3HDD A;  3A03 A;  1O4X A;  2E1O A;  4AUX A;  5IYB J;  3CCY A;  2O7O A;  1POG A;  2M2E A;  4A3D J;  2DMU A;  4MFE A;  2CUE A;  4JX6 A;  5K7F A;  5JLX A;  1IDZ A;  2K9S A;  2XB0 X;  4QSH A;  3FK7 A;  3JR9 A;  4V2G A;  1R9T J;  1MBF A;  1HDP A;  3BR3 A;  2HOS A;  2GLO A;  2LP0 A;  1H89 C;  1MBE A;  1AU7 A;  2L7F P;  2D5V A;  3HOU J;  5C4X J;  4DYQ A;  2X6O A;  2XRL A;  4C3J J;  2E2J J;  2LY9 A;  4A3I J;  1ETK A;  1MH4 A;  3ZQH A;  1E3O C;  3PO2 J;  3BTC A;  2PMZ N;  1CQT A;  3BG3 A;  2ID6 A;  1WGX A;  1JUS A;  1JKO C;  2WB1 N;  3JRG A;  3HGY A;  3S15 J;  3S2D J;  1ZK8 A;  2VI6 A;  3Q0W A;  5IP9 J;  4IHY A;  3NAR A;  2DJN A;  3S14 J;  4X1E A;  3LNQ A;  4D7N A;  5EYR A;  2JA7 J;  2R5Z B;  3GTQ J;  1X58 A;  2XGD A;  2AHQ A;  1QPI A;  4IHW A;  2WV1 A;  3NAU A;  3G1M A;  2H1K A;  3HOW J;  2LK2 A;  1RES A;  3G1L A;  1XG1 A;  1ETQ A;  2EBI A;  2ECB A;  4D7M A;  2EZI A;  2Y30 A;  1IG7 A;  1VI0 A;  3GTL J;  2LVS A;  3B6A A;  2DA2 A;  3K7A J;  4BBR J;  2XB5 A;  3A01 A;  3I4M J;  2QCO A;  2CQX A;  1FIA A;  4B4C A;  3CDL A;  1WI3 A;  4G12 A;  1I3Q J;  3BQY A;  2R93 J;  1XC5 A;  1RPW A;  1VND A;  3BTJ A;  2HXI A;  2W48 A;  1Z0X A;  3S1M J;  1FTZ A;  5IP7 J;  1FIP A;  2E2I J;  2R5Z A;  4A3E J;  5F08 A;  1H8A C;  3TW6 A;  1GV5 A;  3ZQG A;  1FTT A;  3JRC A;  3HBL A;  1U8B A;  4M3B A;  3LSP A;  5IP6 A;  3Q0V A;  5EG0 B;  4DYR A;  4A3G J;  5C4J J;  1ORK A;  4V2F A;  1DU6 A;  1ENH A;  2TCT A;  4IEJ A;  3DCF A;  5E3L A;  2YUS A;  3M3Y J;  1GT0 C;  1NK2 P;  1TWH J;  3RQI A;  1WH7 A;  2LD5 A;  1GUU A;  3RZO J;  4D5F A;  5E3N A;  3ZQC A;  4DZJ A;  2NVY J;  2FX0 A;  5JLW A;  1U9O A;  3HGG A;  4FTH A;  3PO3 J;  1APL C;  1OCP A;  3H3V K;  2MGQ A;  4UUT A;  5E3M A;  3M4O J;  2TRT A;  3RKQ A;  2B63 J;  3A01 B;  2EQR A;  4NDL A;  2DA5 A;  2XSD C;  3OSG A;  5F0F A;  3GTM J;  2O8K A;  1JTY A;  5M3F J;  2JA6 J;  4M3D A;  2HQ5 A;  2LKX A;  1JT0 A;  3I4N J;  5EZG A;  1LFU P;  1ZTR A;  2R5Y B;  4A3M J;  2FQ4 A;  1UG2 A;  3PM1 A;  3ZQF A;  4HNV A;  1G2H A;  1BW6 A;  2ID3 A;  2COB A;  2M9H A;  2E2H J;  2R92 J;  3IH3 A;  4JX5 A;  3C2B A;  4BKX A;  2LFB A;  5F0H A;  4XRM A;  4B1R A;  1H88 C;  3SJM A;  4B3A A;  3JRF A;  1X2N A;  1W0T A;  1JKR C;  1MNM C;  1BW5 A;  1U78 A;  5F1J A;  4IHX A;  1F36 A;  3BTI A;  1ZR4 A;  4MIM A;  2K40 A;  2Y9Y A;  2CU7 A;  2DN0 A;  4UUS B;  5FKL A;  4S0H B;  4A3J J;  5IYD J;  4GFB A;  1JUP A;  2HOT A;  1HF0 A;  4W1U A;  3GTK J;  5C3E J;  1MBJ A;  2R5Y A;  3QPL A;  4M3F A;  4Y52 J;  2OF7 A;  2HOA A;  2ME6 A;  1ETV A;  4I6Z A;  2R0Q C;  2NVT J;  3S17 J;  1GV2 A;  5IYC J;  3CQZ J;  1RKT A;  5J3L A;  3ZQL A;  1P7J A;  1BJZ A;  1T33 A;  3RZD J;  4Y7N J;  4A3B J;  2EZH A;  1RKW A;  2P81 A;  1W0U A;  4FE4 A;  1I6H J;  1BA5 A;  3Q0U A;  2DA7 A;  1F43 A;  4BBS J;  1WH5 A;  1VF9 A;  4ABZ A;  9ANT A;  2JK3 A;  3FK6 A;  2DMP A;  1FEX A;  2YU9 J;  4EEF G;  3UKG A;  2KDZ A;  5J1U A;  1JGG A;  1TC3 C;  2NVQ J;  2JMW A;  2L0K A;  2Y31 A;  4A3C J;  2MG4 A;  2RAE A;  4W97 A;  3HM5 A;  1K61 A;  1ITY A;  2K9N A;  3TP3 A;  3S16 J;  2E19 A;  1Y1V J;  5C44 J;  1IGN A;  1B8I B;  4C2M J;  1IJW C;  2LLK A;  1IDY A;  2R7Z J;  1NTC A;  3G1O A;  1ETY A;  1AHD P;  2IAI A;  5BNG A;  3FKI J;  2ELK A;  4JYK A;  5EGO B;  1GVD A;  2FD5 A;  4BY1 J;  3GTP J;  1ETX A;  1YRN A;  4AC0 A;  2N8G A;  1DU0 A;  5IPA A;  1QVT A;  2EZL A;  2DMN A;  3QPS A;  4J19 A;  4BXX J;  4QTR A;  2Y9Z A;  1JJ6 C;  1UMQ A;  1MSE C;  5FLM J;  4MO7 A;  3O8H A;  4FE7 A;  2CJJ A;  4DZP A;  3HOY J;  3TED A;  2X9D A;  1A6I A;  1QVU A;  3O8G A;  5K7H A;  1UHS A;  3BR5 A;  1HLV A;  1JTX A;  1GDT A;  4A3K J;  1X2M A;  5EZH A;  3IH2 A;  1HOM A;  2M34 A;  5HOD A;  2DA3 A;  2FJ1 A;  3F0C A;  5EGO A;  2MW8 A;  2NVX J;  5M5X J;  1P7I A;  1T56 A;  2DMT A;  1MSF C;  4CYC B;  2IEK A;  3Q3S A;  2HYJ A;  1YRN B;  5FLV A;  5FKM A;  3ZQI A;  3LOC A;  2XPW A;  3B6C A;  5GPA A;  1TWC J;  5K7Z A;  2NOG A;  2XGE A;  3IV5 A;  3SDG A;  2XPV A;  2JJ7 A;  2VPR A;  4JX4 A;  1ETO A;  4AYB N;  4I76 A;  4A3F J;  2Y2Z A;  2DA4 A;  1ZKG A;  2L7M P;  3HB9 A;  5IOY A;  2K9Q A;  3FIS A;  1TWG J;  3BT9 A;  3BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...