4G8XA

G1 orf67 / staphyloccus aureus sigmaa domain 4 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
MKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords RNA polymerase sigma factor rpoD
publication title Promoter-specific transcription inhibition in Staphylococcus aureus by a phage protein.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 19
structure length 61
sequence length 61
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g8xA00
2OD5A 3I5UA 1G6NA 1SD7A 1XGMA 3NEUA 1ZYRF 3KP5A 2QQBA 1XCBA 4EVIA 4KIGA 3M8FA 5LLQA 1KGSA 3T0YA 1YQAA 4U7DA 3EYYA 4R1HA 1GXQA 1GXPA 2PMHA 2FBIA 5L3CA 3CLOA 3HOTA 1FBUA 5J8FA 4WCGA 3I4PA 4GCVA 2PQ8A 5DYMA 1KU3A 2KRFA 5HS8A 2EB7A 2RDPA 4IJAA 2V1DA 3O6BB 1JGSA 5BPDA 4YIFA 2M1BA 4XBFA 3CUOA 1MD0A 2QYOA 4UV9A 2M87A 1YW9A 5FO5A 3DF8A 3E6CC 3WG9A 2DO7A 4WXHA 5LRSA 2WWYA 4RAZA 2VN2A 2UXXA 1XSVA 3ZPLA 3RKYA 5HS7A 2ESNA 4I02A 2IA0A 4A0ZA 2Z99A 1XDUA 2O6GE 5BQTA 1ZN2A 1PP7U 1MZBA 1WRJA 3J80Z 2VBYA 4UUVA 1T38A 3FF5A 5TJJA 1O3TA 2F2EA 1TLHB 2IVMA 1FC3A 2J5OA 1XGOA 5D5UB 3AAFA 2ZNYA 3L9FA 1K78A 2EFQA 4I01A 1Z6TA 1BIBA 3Q5FA 1J59A 1RI7A 3K9TA 4U0WA 3JTGA 1F9NA 2DPDA 3JSPA 2Y75A 4IF4A 3C3WA 2VOOA 2ZBKA 3L00A 5KVRA 2YU3A 4L5JA 1S8NA 1ZLJA 2R3SA 2IA2A 3KP4A 3NRVA 2OQGA 5DUKA 4LG0B 3Q9VA 1SFXA 1F5TA 1BI0A 3IC7A 2ZJ2A 1S6LA 1FPQA 1XB4A 3WE2A 4O6JA 2C6YA 1HBXG 1V3FA 2DI3A 2B0LA 2FA5A 5CLSA 3HUGA 5K1YA 4EJTA 3DKWA 4EM0B 1T39A 4L9TA 3WTTC 1X3UA 4BYYA 1R7JA 4KIBA 2V9VA 4HDUA 3T1BA 1OYIA 2K86A 3WTUC 3COAC 1EH6A 2WC2A 4IRGA 1LDDA 3TQNA 4EGZA 2ESHA 4I09A 2IP2A 2IA1A 4ASNA 4XLNF 2FMYA 2QLZA 1IRGA 4M6YA 2FF4A 5DEQA 3U1DA 5ICFA 5F64A 1WI9A 4CGZA 3ZQ7A 4EJWA 4D0PA 2FRHA 3K69A 1AOYA 4AIHA 1ZREA 3WTZA 1BI3A 3H92A 1ZG1A 5J6XA 4RB1A 2DFIA 1PP8F 4HX4A 4MEYF 3RIRA 2A07F 2D2WA 2K02A 1B1BA 2GA1A 1O7LA 4AVPA 4WF2A 4N9HA 5DCMA 4RGSA 4H0EA 5D8KB 2ADUA 2YPRA 4LK0F 2BE5F 2HTSA 4N9IA 5CVUA 1XDSA 2ISYA 2Y0MA 5D5WB 1WQ2A 1OMIA 2KJBA 1P6RA 1QQIA 3IL2A 3E6MA 2KKOA 5H6RA 4NQWA 4K2EA 1I1GA 4BNCA 3C18A 1J7KA 1B9NA 1SD4A 3S2WA 1W7PA 4LB5A 5LGTA 1JXSA 3GFJA 5FD6A 1F4KA 4BHBA 4WXCA 5AIQA 1SFUA 1FBQA 4BXUA 1S7AA 2D45A 5L3BA 2NNNA 2E7XA 3HRTA 2Z9OA 1WWXA 4HQEA 3LA3A 1ZLKA 5HLIA 1ODDA 1XSDA 2PMUA 2XAGA 5D5XB 1CF7B 3GUDA 5LGUA 2GIVA 4FHTA 4BQAA 3DEUA 2RNJA 2ZNZA 4MNUA 1J9IA 3PQJA 3Q9SA 4IRHA 3GFIA 1S29A 2NNYA 1QBJA 4IHSA 4F7ZA 1R1TA 4GGGA 5AONA 2D1HA 2JT1A 1UCRA 3ULQB 1T0FA 3FHZA 1OYYA 3LQQA 4U0VA 1XMAA 3FMQA 1Y0UA 1Z05A 2JPBA 5DV5A 5ICEA 1B9MA 2OA4A 2F5EA 3M7GA 2EFNA 3F22A 1STZA 5L3DA 4BHPA 1FP2A 1U2WA 2KIUA 5DDGA 2KIFA 3K0LA 4ON0A 4KYWA 4HW0A 2O0YA 2MH9A 1QZYA 5FLXZ 2KJCA 3IRQA 3CUQA 2BV6A 1E17A 1BBYA 1IXSB 4LK1F 2QBYB 3U9GA 1UHMA 3D5LA 4KMFA 3VODA 1MDMA 3DPTA 3TO9A 3KE2A 3KP7A 4MQ9F 1FP1D 2EV5A 2VBWA 2IRFG 5HOOA 1B59A 4LJZF 4I2OA 2CYYA 3QRFF 2BEOA 2P6TA 1QO0D 4L9JA 1IZ1A 3WTYC 3I58A 3JW4A 3DV8A 3I64A 1UHWA 3FMSA 3CJNA 5CVRA 2PI0A 3ISPA 1L0OC 1ZHFA 4ZYGA 2MC3A 2O8XA 5CYVA 2CWEA 2HTJA 4RB0A 4L0YB 3L2CA 1IW7F 2DAOA 2HDCA 2EK5A 2XUBA 2XGXA 2DBBA 2RN7A 4NB5A 3CO6C 1I5ZA 1ON1A 3I59A 3MFKA 4U7BA 4KMUX 5ED4A 1IRFA 3R4KA 2YR2A 1F1ZA 3GW2A 2STWA 2ZKZA 3BPVA 4LD5A 3TO6A 5K5OA 1XGSA 1FZPB 2DT5A 3BWGA 4ENMA 1G4DA 3FXQA 2Z33A 2RGVA 1Z6RA 4PGHA 3N4MA 2FMLA 1HW2A 4A5NA 1ZH5A 4CICA 2K4JA 4BAYA 1BJAA 3RDIA 3DFGA 3KLOA 3MEXA 4HZFA 3GWZA 3GZ6A 2LF7A 5HLHA 2A68F 2HYFA 4WXDA 3FXUA 3RKXA 3KETA 4EJUA 1GVJA 3R0JA 2EFWA 4MGRA 1BIAA 4A12A 4L9VA 1XGNA 3KP2A 3BJ6A 3FWEA 3SQNA 4G7ZF 1BOAA 3V8LA 1JHHA 4I0BA 1YO5C 2EV0A 5H6QA 3QPTA 2LKPA 1IN5A 3G3ZA 3LA2A 3HTSB 4ENNA 3EQLF 4R8HA 3JAMK 2NYXA 1KQ9A 3KCCA 2OU2A 2ZFWA 3IRRA 5LEKA 4XLPF 4GYGA 4YIIA 2H09A 1KYZA 4MEXF 2DK8A 1REPC 5LRRA 3L09A 4G94A 2CGPA 4P9UA 1VTNC 4Q4ZF 1G3SA 2AS5F 1U5TB 4ZYEA 3PFIA 2FOKA 1R5HA 4P9FA 1D8JA 1U3EM 3E5XA 3TGNA 1IUYA 3BJOA 1YG2A 2GAUA 2LF8A 1TQMA 2HQRA 1MGTA 3KZYA 4EV0A 2HYGD 3V7SA 3H3ZA 2VT3A 3EUHA 1WKMA 2QWWA 5CVJA 3GLXA 1Z1DA 2LNBA 3P7NA 4A0XA 3CUQC 1FBSA 1HKSA 3RYRA 1SMTA 4G6DA 4ZH4F 5EEGA 3RPUA 2BGCA 2ACJA 3I71A 1BI2A 5E1WA 2E1CA 3R61A 4KN4X 2ZXJA 1E2XA 1TNSA 1R5GA 1CGPA 3K1NA 1W7PD 1ZG3A 5HDGA 1LDJA 3HSRA 1RZ4A 3ROUA 4G7OF 1TTYA 4LG0A 2FQ3A 3V8JA 4RGRA 3BPXA 4I7HA 5DCFA 4G9YA 5IT3A 3V8KA 5FB2A 2R7FA 2EV6A 5D4SA 3MQ0A 2A6EF 6PAXA 4Y17A 1MKMA 1P4XA 2CSOA 2W25A 1K78B 1R1UA 2EFPA 3HSEA 2MA3A 1T98A 2HEOA 2D1VA 1NHAA 4HDVA 3FM3A 2HGCA 5HVQC 4P96A 1O3RA 2RVCA 4GYIA 2HWVA 2P5VA 1HSJA 3BZ6A 4RAYA 4KICA 1H9GA 3WTSC 5K5QA 3GYHX 3P9CA 2M5WA 1R1VA 5KK1A 4G8XA 2EA2A 2CW0F 4YFXF 1Z9CA 4A6DA 3IHUA 1J5YA 1U6GA 1YLFA 3SZPA 1UB9A 4N0BA 2JZYA 1JE8A 4OU0A 1MJ9A 3TDZC 1FOKA 1HW1A 1KQ0A 1Q1HA 2VXZA 3ZP5A 1FYKA 3E5UA 1QNTA 2FBKA 1B6AA 3J7AO 1G3TA 2VONA 4KA4A 2MH2A 3KEOA 5F1RA 1BI1A 3GEZA 3HRMA 3REOA 2P6SA 2L02A 2G7HA 4IRIA 4HLYA 1TQPA 1KU2A 2H94A 1G3YA 4JBAA 3R0AA 4ZYHA 2DW4A 1P2FA 3ZMUA 3IKVA 1FYLA 4LFUA 1DPRA 1PUEE 3GXOA 2QVOA 4YG2F 1IF1A 2QQAA 2XV4S 3FM5A 3ECHA 2W85A 2GWRA 4M74A 2XKPA 5DCMB 2QZ8A 1AWCA 1YS7A 2JRTA 5H20A 2JTVA 2DPUA 2XAJA 1HXDA 3B02A 3L7WA 4KFCA 1PDNC 2R7DA 3E97A 3C7JA 1USSA 3PQKA 4A5MA 3QU3A 2ZMEB 4HOBA 3LFKA 3TOAA 4OMYA 4AIJA 5F6FA 3F6OA 2V1XA 3HHHA 1K6OA 3GZ5A 5CVVA 3F8FA 3I53A 4JK1X 1OPCA 1S7OA 5LHGA 3HTUA 1SMYF 1BC7C 1MJAA 3QU6A 4CHUA 1I6XA 3DP7A 3MZHA 2VE8A 3QP5A 1IN7A 4OIRF 1R22A 3M8EA 3DPLC 3HSFA 2NS0A 4ESJA 5E17F 3F23A 4AWXB 3QPHA 4PDKA 3MZYA 2DLLA 1XMKA 1FY7A 4OIPF 1FLIA 1J0RA 3V4GA 5BPIA 3QAHA 2FXAA 2NRAC 2VE9A 4XSXF 2PG4A 3RKWA 5E8GA 2XASA 5A2QZ 2QBYA 3SHFA 1RIOH 5D6FA 3T5XA 1TNTA 1EV7A 3E6DA 1DP7P 2DQRA 2VT2A 3HRSA 5D6EA 1HSTA 1ZG5A 2G7UA 4HX7A 4DNCA 2IPQX 1T6SA 3TKYA 3KLNA 5E18F 2V6CA 3ZN0A 2AXLA 2FBHA 2HR3A 4UV8A 2VC1A 5D8LB 3E5QA 1DPUA 4M9ZA 2Q0OA 2UWMA 2O61A 3FX3A 1UFMA 1LVAA 4KIFA 5HLGA 3K2ZA 2IJLA 3VEPA 4Y15A 3F21A 4OINF 4KNYA 2XAQA 4M9XA 5L3GA 4M72A 3ML6A 1LEBA 3C1DA 5E20A 2P5LC 3F6VA 3LAPA 4QLCU 5IT9Z 2WV0A 3BY6A 5JVTA 3KP6A 1MDMB 4UVAA 1ZGJA 5A2QK 3FXRA 4ESFA 4LLNA 3WU1B 5HS9A 2IT0A 1BM9A 1SFEA 2F5DA 1D8KA 4B09A 3HYIA 1KQ8A 4ENJA 3GFLA 5FFZA 4ZZDA 3WTVC 4M9SA 4EJOA 3JAMZ 4OIQF 3FZVA 2L4MA 1P92A 4WX9A 1JHFA 4OOIA 2K4BA 3SFZA 3GO5A 3LSTA 3K1PA 3HIFA 2FEZA 4LGWA 3HHGA 2Z3YA 2O03A 1GHCA 2FU4A 4HF0A 1R36A 2H27A 1LEAA 1YIOA 2W84A 2Q8KA 2H6BA 4P5OA 4IPAA 3ELKA 2W24A 4NHJA 2QENA 2O3FA 1RUOA 3OOPA 4ZYDA 2TDXA 2VC0A 3CDHA 2CQKA 5IT9K 3F8NA 4U88A 5ERIA 1OYWA 2P7VB 3H3UA 5DD8A 2DTRA 2YX4A 4HF1A 3HOSA 3LWFA 5LEJA 3TOBA 1YW8A 2OAZA 5FD5A 4O3MA 2P4WA 3WGGA 1ZRFA 2DU9A 4FX0A 1QPMA 1QZZA 2L54A 5AIPA 2GZWA 4HA8A 2QM3A 3E3VA 1U5TA 4YFNF 4EGYA 1I1SA 4UHTA 1Z91A 5E8IA 1HKTA 1ZGAA 4Q48A 1B4AA 5D5VB 5E1ZB 3IWZA 3P9IA 4MQVA 5LBQA 3BJAA 3ZN1A 4HX8A 1USTA 2STTA 4KDPA 4ENKA 1FSEA 1YS6A 1O3SA 5BS6A 3KFWX 1YFHA 1FWZA 2PEXA 5E1XA 2UXNA 2OBPA 2RC4A 1HW5A 3JTHA 3K1MA 4RGXA 4UNOA 1BC8C 1HQCA 5FGMA 4EM2A 4HV5A 2P5KA 2OQRA 4CYDA 3LAJA 4FT8A 2P8TA 2G9WA 2A5YB 4EQQA 3F8MA 4I98B 1FYMA 2GA2A 5LHHA 4TV7A 3CTAA 3SXYA 3ERED 2LSOA 1LDKB 4KT5C 2XKOA 3MAJA 3ABUA 1R00A 4RB3C 3R6SA 2FE3A 2VODA 3RPQA 1RNLA 4QWQA 2EFOA 1ON2A 1H9TA 4HAMA 2H6CA 1KU9A 2MLKA 4GXOA 4L9NA 4HV6A 4FX4A 3E6BA 3EDPA 2UZKA 3ZMDA 1ZARA 2K7LA 3DQVC 4CO8A 4UVBA 1J2XA 4A2UA 1EH7A 1TW2A 4RB2C 1R23A 4G6QA 2HKXA 1H0MA 3MCZA 1XN7A 2KIMA 1C0WA 1TBXA 1HKQA 2COMA 3SZTA 1ZRCA 1MJBA 3GF2A 1FNNA 1FT9A 3M1EA 4LLGF 1SD5A 2A6HF 3F8BA 5ILUA 1K7AA 5J8CA 3WGIA 2HFHA 2MLGA 2XRNA 1IN6A 3J80K 3EETA 3WTXC 1IN4A 1DDNA 2EJRA 3FMRA 4AD9A 2XVCA 2HKOA 5D4RA 5ICGA 2NAZA 3KZZA 1KYWA 4M6XA 4EMSA 2RV8A 2M30A 2VBZA 2GXBA 2HOEA 2V79A 2XIGA 3D0SA 1YTYA 4UXNA 1EH8A 4M73A 4ZZLA 3G73A 4MTEA 5JR3A 4EJVA 3VFZA 2L4AA 3WE3A 4LB6B 2BYVE 1SD6A 1U5TC 2BBYA 3LA7A 1OKRA 4CDGA 3IWFA 2IW5A 2CG4A 5JI6A 1L3LA 5K5RA 5DUIA 3KP3A 3IKTA 4G7HF 1CF7A 2V1UA 3N97A 4PZJA 2ZMEA 4U0YA 3M9AA 1O3QA 4XRFA 3U2RA 4WWCA 3T8TA 3JSOA 1S3JA 2PN6A 4Y13A 3TO7A 3GVAA 4AIKA 2Y48A 2MBFA 5FFXA 1WSUA 1W7PB 2E1NA 2K27A 3W6KB 3QP6A 3VB2A 2XAHA 5EEHA 4HLXA 2ZCWA 4S04A 2FNAA 4S05A 3BROA 2Z5UA 5CJ9A 2CO5A 3O3KA 4A6EA 3WTWC 2ISZA 2FNPA 4KN7X 3KEQA 5JFRA 4MHGA 1W5TA 2M45A 3WGHA 1ZRDA 5HDKA 4GO1A 3V7RA 2JPCA 2OZUA 1SAXA 2QUFA 4M71A 2Q2EA 4EM1A 3R60A 1V4RA 3J81Z 3HRUA 3F72A 4Q5SF 3O2PE 1OR7A 4CZZA 4L18B 3DXJF 4IVNA 3T8RA 3ZMVA 2MD5A 2HQNA 3RI4A 2ETHA 1TQIA 1W5SA 2X0LA 4L0ZB 1LB2A 2EA4A 3VOEA 5DD4A 4WK8F 4OMZA 1XD7A 5BOXA 2OZ6A 2YSRA 3NQOA 4BHCA 2E7WA 1LJ9A 2XAFA 2PBIA 2XROA 3GFMA 1KA8A 2ZO4A 4BH9A 3OV8A 2RQPA 3WODF 4MTDA 1IAWA 2PFBA 1D3YA 5HDNA 1LQ1A 4HQMA 1YYVA 2A61A 3CUQB 5CVIA 5L3EA 2DK5A 2GQQA 5ICCA 1IXRC 3ZMSA 3J81K 4A0YA 3EYIA 4RGUA 4LMYA 3MWMA 4L5IA 2M8EA 1D5VA 1J75A 2HZTA 1P4WA 1U78A 3I54A 1G3WA 4ESBA 4Q47A 2FSWA 3QOPA 3GX4X 1LNWA 4JQFA 4P55A 4PCQA 2LDUA 2F5FA 2L01A 1BN5A 1K79A 2A3SA 4HYEA 3ZMTA 1ONVA 2YX7A 1IN8A 2CFXA 3ECOA 1YW7A 2WTEA 4O5VA 5TRDA 2DQLA 2VOPA 4YFKF 5FLXK 4IXAA 4HF2A 1IXCA 1Z7UA 2P7CB 4LLLA 4OIOF 2A69F 1A04A 4R79A 3BP8A 2HS5A 3F8CA 3B73A 2RKHA 1R58A 4I0AA 1U8RA 4E70A 3RJPA 1P4AA 2QQ9A 3V7CA 4KUMA 1TW3A 2VBXA 3RYPA 3I59B 3I0TA 4B8XA 4HBLA 2J5PA 2EWNA 4IHTA 3W6JB 4XSZF 3WU0A 2GXGA 3ZMZA 3BOQA 1ZAOA 1O57A 1RUNA 3ABTA 2ELHA 5ILSA 4CXFA 1O7FA 2XHKA 2X4HA 2PLYA 4RS8A 3P9KA 1KU7A 2F5CA 4Z2YA 2PJPA 1QGPA 2JSCA 5BMZA 3RTRA 3LQRA 1FX7A 5L3FA 1I27A 3BDDA 1DUXC 3F3XA 1T2KA 2W57A 1XSXA 1XCVA 2L3DA 4UVCA 4ETSA 1FSHA 4PGGA 1W4MA 5JHUA 1ULYA 5LGNA 3TDUC 5ILVA 3CO7C 4DQ2A 5LHIA
chains in the Genus database with same CATH superfamily
2OD5A 2R7UA 4UB8C 3I5UA 4YIRX 2W7NA 2KIQA 1G6NA 1SD7A 3FIWA 1XGMA 2CJJA 3NEUA 1ZYRF 1VFCA 1RRJA 3KP5A 2HVRA 2X6OA 2QQBA 5EDNA 1XCBA 4XONA 4EVIA 2DMTA 4KIGA 3M8FA 5LLQA 1KGSA 3OYHA 2E2JJ 2DN0A 1A31A 1X4OA 3T0YA 1YQAA 3BZCA 3BR6A 4U7DA 2WV1A 4F55A 3EYYA 4R1HA 4II3A 1NK2P 5F0HA 4KISA 1GXQA 3DCFA 1GXPA 2PMHA 3L1PA 1WJDA 2DXIA 2Y9ZA 1VQNI 2FBIA 2N8GA 5L3CA 3CLOA 2LVSA 1F36A 3L2UA 4NUBA 3HOTA 1FBUA 5J8FA 1S7EA 3I4PA 1OR7C 2E1OA 2LY1A 2PQ8A 4GCVA 5DYMA 1KU3A 3RKQA 2KRFA 4Y4RA 5HS8A 2VPLA 2EB7A 2JRMA 2RDPA 1W0TA 2JUGA 4IJAA 2CS3A 2V1DA 3CMEI 3H9JA 3O6BB 5M5WJ 2MW8A 1JGSA 3H36A 5IOYA 5F1JA 2XSDC 3K70C 5BPDA 4YIFA 4RMNA 2G0EA 3M3YJ 2DA2A 3HOZJ 2E1MC 2K3PA 2M1BA 4XBFA 3CUOA 3HB9A 1MD0A 1GT0C 2QYOA 4UV9A 2M87A 1YW9A 5FO5A 4YRVA 3DF8A 3U21A 4DJAA 5BNGA 3VYTB 3WG9A 3E6CC 4IHVA 3EPZA 2DO7A 3VWBA 2KQRA 4WXHA 5IOZA 5E3MA 2DDBA 3PFYA 2PJRA 2VJ4A 5LRSA 1VQ5I 2WWYA 4RAZA 5J1UA 5GPAA 1IV6A 2VN2A 5EYRA 1JT0A 2DA7A 2UXXA 4AIDA 1XSVA 4FQGA 3RKYA 3ZPLA 5HS7A 2V4JC 2ESNA 1D1CA 4IO9F 4I02A 2IA0A 2O8KA 3G1MA 4F91B 5EGOA 3S15J 3SEQA 3K4KA 3BR2A 4A0ZA 1X3ZB 1KONA 2CQXA 3CC2I 3HOYJ 2Z99A 1XDUA 2O6GE 5BQTA 1ZN2A 5J1RA 1YI2I 1PP7U 3PO3J 1MZBA 2R7WA 2DOFA 2M7AA 1WRJA 2IGOA 3J80Z 1ERDA 1MBHA 4E7LA 1OFCX 1ZQ3P 3W2AA 2VBYA 4UUVA 5KCMA 1T38A 3FF5A 5TJJA 1O3TA 4IQ4A 2F2EA 1TLHB 2IVMA 2LLKA 1FC3A 2J5OA 1XGOA 1RKTA 5D5UB 4XRSG 2ZNYA 3AAFA 4RAFA 2QSGX 3L9FA 1K78A 2EFQA 4FISA 4I01A 1Z6TA 1BIBA 3Q5FA 2HVSA 2XPUA 1J59A 1RI7A 4D5FA 1MBGA 3K9TA 4U0WA 3JTGA 1F9NA 4D7MA 3K2AA 3NAUA 5KNLA 2DPDA 2DYRH 4JOMA 3JSPA 2Y75A 4IF4A 5FRNA 2E34A 5B1BH 2YUSA 2HVQA 1Q1VA 3C3WA 3DKXA 1TL8A 4XM3A 2VOOA 4A3CJ 2CUJA 2ZBKA 4FTHA 2NXNB 3L00A 5KVRA 2YU3A 4L5JA 1S8NA 1ZLJA 2BW3A 2CRGA 4BQOA 2R3SA 1JJ6C 2ECBA 2IA2A 3KP4A 3NRVA 2OQGA 4IEJA 5DUKA 4LG0B 1OLTA 3V42A 3Q9VA 3I9V2 3JR9A 1SFXA 1F5TA 1HLVA 1BI0A 2M9HA 1JI8A 3IC7A 5FKKA 2ZJ2A 1S6LA 1FPQA 1XB4A 3LSGA 4BQNA 3WE2A 2JA5J 4O6JA 2C6YA 3NARA 1HBXG 1V3FA 2DI3A 2B0LA 1Y8RB 2HDDA 3ZR8X 2FA5A 3SZGA 5CLSA 1MNEA 3HUGA 5K1YA 3H1CA 3DKWA 4EJTA 4EM0B 3BG9A 1T39A 4L9TA 3DBRB 2VQCA 1DGWY 3WTTC 1X3UA 1HOMA 3LOCA 4BYYA 1JKOC 1ETYA 1R7JA 2KZGA 4KIBA 2DMNA 3G71I 1BA5A 4ABZA 2V9VA 2JA2A 4HDUA 3T1BA 2DFFA 1F43A 2OJED 3UNGC 1JGGA 1OYIA 2K86A 3WTUC 3COAC 1OCRH 2EQRA 2K9NA 1EH6A 2WC2A 4IRGA 1LDDA 3TQNA 3CJTB 3OYKA 4EGZA 1HF0A 2ESHA 2GLOA 4I09A 1Y56A 2A05A 3IV5A 2IP2A 2IA1A 3H5RA 1Y8QB 5DS9A 3DTKA 3MD2A 2DYSH 4ASNA 4XLNF 2FMYA 3IUOA 2X9DA 4CA0A 5DM7F 2QLZA 4XLFA 3GTJJ 3GTGJ 1IRGA 4M6YA 2FF4A 1R5ID 5DEQA 3U1DA 5ICFA 2VKHA 4PSWA 2LR8A 5F64A 1WI9A 3BR5A 1UMQA 1JKPC 4CGZA 3ZQ7A 4EJWA 4D0PA 2FRHA 2KHMA 2IAIA 3K69A 1AOYA 4AIHA 1ZREA 1VQOI 3WTZA 2LFBA 4F92B 1BI3A 4X0GA 2IS2A 1T33A 2HU9A 3H92A 5J6XA 1ZG1A 4RB1A 4BACA 4ZTFA 2DFIA 1O4XA 1PP8F 4HX4A 4MEYF 3RIRA 2A07F 2D2WA 2XAUA 2K02A 3B6CA 1B1BA 2GA1A 3K4JA 5F0FA 4BXXJ 1O7LA 3BG7A 1HDDC 1SVMA 4AVPA 3S1QJ 2W00A 3CMMA 3ZQQA 3CC7I 1MIJA 4WF2A 2R5ZB 4XR6A 1D1AA 5IYBJ 4N9HA 4XN0A 5DCMA 4RGSA 3CCLI 4DBQA 4H0EA 5D8KB 2ADUA 2YPRA 4LK0F 2ZJRF 4AM3A 2BE5F 2HTSA 4MLOA 4LIUA 4N9IA 5CVUA 1XDSA 3EUKL 2ISYA 2Y0MA 5D5WB 2X6YA 3OYDA 1QHHD 2R7OA 1WQ2A 1OMIA 1WJFA 2X6WA 2KJBA 1P6RA 1QQIA 1WVRA 3IL2A 3E6MA 2R93J 3TP3A 4M3BA 1A5JA 4I99C 2KKOA 5H6RA 1ZR4A 4NQWA 4K2EA 2R7QA 1I1GA 2PMZN 3X2QH 4BNCA 3C18A 5C4XJ 3S93A 2KZVA 1J7KA 1B9NA 1SD4A 3S2WA 1W7PA 4LB5A 5LGTA 1JXSA 3GFJA 5FD6A 1F4KA 2MG4A 4BHBA 4WXCA 3CMYA 3A2KA 2VXDA 5AIQA 1SFUA 4PK4A 2Y30A 2JN6A 1FBQA 2NOJB 1QZEA 1AKHA 4CCKA 4BXUA 1S7AA 1X1PA 2D45A 5L3BA 2NNNA 4XKWA 2E7XA 3HRTA 2Z9OA 2QQ8A 1WWXA 4I6ZA 4XOTA 4HQEA 1XPXA 3LA3A 1Z67A 1ZLKA 3HM5A 2MC4A 3SFIA 5E3NA 5HLIA 1ODDA 1XSDA 3S8PA 2PMUA 1IDYA 2XAGA 4C3IJ 3IP4B 1XTAA 5D5XB 1NTCA 2F4OB 1CF7B 3GUDA 1MW7A 2ID6A 2GIVA 4B44A 5LGUA 4FHTA 3HOXJ 1N77A 3A03A 1WPKA 4A3EJ 3MMYB 2RNGA 4XMYA 3DEUA 4BQAA 2RNJA 2ZNZA 4MNUA 1J9IA 2M0CA 3PQJA 3Q9SA 4IRHA 3GFIA 1S29A 2DT6A 2CW7A 2NNYA 2P81A 1KZHA 2BY3A 1QBJA 4BL0B 4IHSA 4F7ZA 1BJZA 1R1TA 4GGGA 1DU6A 2WB1A 5AONA 3LL7A 2D1HA 2JT1A 4BJ5C 1UCRA 4BEHA 3ULQB 1T0FA 1X1DA 3FHZA 1OYYA 3FBNB 3LQQA 4U0VA 5JVGF 1ZR2A 5F08A 2NS8A 2EH3A 2NVUB 2R7XA 3CCRI 2KT0A 1XMAA 2WAEA 3FMQA 4G12A 2ZXWH 2MSYA 1Y0UA 1Z7LA 3CZ6A 1Z05A 3ZOBA 3GTKJ 2XF6A 2JPBA 3AL0C 5DV5A 5ICEA 1DQUA 2L0KA 1B9MA 2OA4A 2F5EA 3M7GA 2EFNA 5GTIC 3F22A 1STZA 5L3DA 4BHPA 2V9KA 1HDPA 2EZHA 1TWGJ 1FP2A 2JMWA 1U2WA 2KIUA 2COBA 2BOLA 2WY7Q 5DDGA 2KIFA 3PNVA 3K7AJ 1MMNA 2HPIA 1BL0A 3K0LA 2CH0A 1R71A 3BR3A 4ON0A 4HW0A 4KYWA 4BJ6C 2O0YA 3PIPF 2MH9A 1QZYA 3CQZJ 5FLXZ 2HYJA 2L5QA 2KJCA 4HRIA 3IRQA 3CUQA 2BV6A 1E17A 2FUG2 3QPSA 1BBYA 1IXSB 3H5AA 4LK1F 4QTRA 3S1NJ 2QBYB 4RLQA 3C2GA 3U9GA 3HGYA 3BG3A 3UKGA 1MH4A 2QSHX 2ZXHA 2ME6A 5FKLA 1UHMA 1FEXA 2IS1A 2IBDA 1DP3A 3ZQFA 2M4GA 3D5LA 1BOBA 3L2WA 1LFUP 2JQ7A 4KMFA 3VODA 1MDMA 3DPTA 3TO9A 3HG9A 3KE2A 3KP7A 3NWSA 4A3KJ 4MQ9F 1OCZH 1FP1D 5IP9J 2UV1A 2EV5A 2VBWA 2IRFG 5HOOA 1B59A 4LJZF 4PJLA 4I2OA 1VQPI 2CYYA 1YJWI 3QRFF 1N25A 2BEOA 4QSHA 2P6TA 1QO0D 4L9JA 1IZ1A 3WTYC 1WJEA 5K7ZA 2B63J 4BUPA 3I58A 5F27A 3JW4A 3DV8A 1A6IA 3I64A 1VQ4I 1UHWA 3FMSA 3CJNA 3BTLA 2OUMA 3JRAA 1U9NA 2K5CA 5CVRA 2PI0A 3ISPA 1L0OC 5CQEA 1VQ6I 3I4NJ 3DLLF 1MBJA 1WGXA 2VIXA 3OIPA 1VQ9I 1ZHFA 4ZYGA 2MC3A 2O8XA 5CYVA 4EEFG 1S9HA 5EG0A 1PVEA 2BZTA 2CWEA 2HTJA 4RB0A 4L0YB 3ASNH 3L2CA 4A3BJ 3OWTA 1IW7F 2A6TA 2DAOA 2HDCA 2EK5A 2XUBA 1Y39A 2CQ7A 1MMAA 2WADA 3PJRA 1X2NA 2XGXA 2ZC2A 3QQAA 2DBBA 2RN7A 4NB5A 4B3AA 1ZKGA 3CO6C 1I5ZA 1ON1A 4DBRA 3I59A 3LSKA 3CCMI 3MFKA 2OPTA 3S1MJ 1ACIA 4U7BA 2M0MA 2JSPA 2V6EA 4KMUX 5ED4A 1IRFA 1LE8B 9ANTA 3R4KA 3VYSB 2YR2A 1F1ZA 3GW2A 2STWA 2KISA 1FOWA 2ZKZA 2WAQA 1G59A 3BPVA 3FXKA 4LD5A 3I3LA 4U87A 2EPFA 3M4OJ 5EF6A 3TO6A 5K5OA 1IC8A 1XGSA 3Q0UA 1FZPB 4ZDPA 2DT5A 3BWGA 4ENMA 4XORA 1G4DA 3FXQA 3ZXSA 3FXJA 2Z33A 2RGVA 1YRNB 3LSJA 1Z6RA 3DKYA 4PGHA 3N4MA 2FMLA 1HW2A 4A5NA 2QEXI 2LG4A 1ZH5A 4CICA 2K4JA 4IOAF 4BAYA 1BJAA 3RDIA 1D1BA 3FXLA 3OS1A 3DFGA 3S3OA 3KLOA 3GTQJ 1OCTC 3MEXA 4HZFA 3GWZA 3GZ6A 2LF7A 3CESA 5HLHA 2A68F 3DPUA 2HYFA 4WXDA 3FXUA 3RKXA 3KETA 4EJUA 1X1AA 1GVJA 5JLXA 5FKOA 3R0JA 2EFWA 1FMWA 4MGRA 1BIAA 3JRCA 5GAHJ 2DA6A 2F6CA 1JJ8C 4A12A 5GP9A 1VQMI 2KP6A 4BDZA 1QPIA 4L9VA 1DGRM 2R5YB 3VPRA 2Y2ZA 3WU2C 1XGNA 3KP2A 3BJ6A 3FWEA 3SQNA 3MZ8A 4G7ZF 1BOAA 3V8LA 1JHHA 4I0BA 3CCQI 2DA5A 2Y31A 3L2VA 2XGCA 2DA4A 1YO5C 3OYEA 1OQYA 2EV0A 4C3JJ 5H6QA 3HPGA 1MH3A 2LKPA 3QPTA 1IN5A 2IGNA 3G3ZA 2PX9A 2E35A 2W48A 3LA2A 3H0GJ 3PSIA 3OYJA 4ENNA 1W36C 4N4NB 1POGA 3EQLF 1MMDA 1ENHA 4R8HA 3JAMK 5E3OA 2NYXA 1KQ9A 3BR0A 3KCCA 2OU2A 2ZFWA 4W97A 2LC2A 1Z77A 3IRRA 5LEKA 4XLPF 4GYGA 1V5GA 3HPHA 4YIIA 4Y7NJ 1X58A 2H09A 1KYZA 4MEXF 2DK8A 1REPC 2D5VA 3SEZA 5LRRA 3D5SC 3L09A 4G94A 4XLAA 2CGPA 1T0FC 2FD5A 2L9VA 4DIQA 4E7SA 4P9UA 4OAZA 1VTNC 4Q4ZF 1G3SA 2AS5F 1U5TB 4XICA 1I6HJ 4ZYEA 3PFIA 4H4KC 3RCOA 3I55I 3K4BA 2FOKA 1R5HA 4C2UA 2JA6J 1VQLI 4P9FA 2HOAA 1NG7A 4D9JA 1D8JA 1U3EM 4D5CA 3E5XA 3TGNA 4BJTA 1IUYA 1FOYA 3BJOA 1N78A 3DBLB 3CP8A 1YG2A 4E6KG 2GAUA 2LF8A 3LNQA 1TQMA 2HQRA 2OTJI 4A93J 1MGTA 3KZYA 1W0UA 3ESWB 2K9MA 4EV0A 2HYGD 3V7SA 3H3ZA 4OAYA 1J09A 3LFUA 1I50J 4C30A 2VT3A 3EUHA 4N4OB 4MIMA 4NC7A 2MABA 2VB6A 4B4CA 1WKMA 2QWWA 5CVJA 3FKJA 3GLXA 4CCMA 1Z1DA 1PJRA 2LNBA 3P7NA 4A0XA 3CUQC 1JTYA 1FBSA 1HKSA 1FTZA 1X3WB 1X1BA 2ZB9A 3RYRA 4CUGA 3LSHA 1SMTA 3OYNA 4G6DA 4ZH4F 5EEGA 3RPUA 2LD5A 1PUFA 1OCOH 4GFBA 1YJNI 2BGCA 2OF7A 4BXFA 2ACJA 3I71A 1BI2A 4BY1J 2HZDA 3DBHB 2EBIA 3DWLE 4NDLA 5GADJ 5E1WA 2E1CA 5TISC 1TWCJ 2ELJA 1MSFC 3OIQA 3R61A 4KN4X 2ZXJA 3HBLA 1IGNA 4ZTJA 3WG7H 1E2XA 2L7ZA 1TNSA 1R5GA 1CGPA 1IV8A 3KYCB 2KRHA 3CF5F 3K1NA 1W7PD 1K4SA 3LSPA 3W2VA 3ZGKA 1Y0NA 4MO7A 1UHSA 2EILH 1ZG3A 2OTLI 5HDGA 1LDJA 2BY2A 1QHGA 3S3NA 3HSRA 3HTSB 1RZ4A 1QA6A 3ROUA 4XKBA 4G7OF 3S1RJ 1TTYA 5B66C 3OYCA 2AO9A 4LG0A 2FQ3A 3V8JA 2DJIA 5IYDJ 2WY8Q 1EJ9A 3K6GA 3C2BA 3G1LA 1Z21A 4RGRA 1HA8A 2OV7A 2JVGA 3BPXA 2X1CA 4I7HA 5DCFA 3OR1C 3D5RC 4G9YA 5IT3A 1TC3C 3V8KA 4DOZA 5FB2A 3MKZA 2Z2SB 2ZXIA 2R7FA 2EV6A 3L2QA 2HQAA 1ETKA 5CKTA 2X6XA 5D4SA 3MQ0A 3G4SI 4E4HA 2A6EF 1VQ7I 2KDZA 6PAXA 4Y17A 1MKMA 4XLEA 5GAEJ 1WH7A 2H8WA 1P4XA 2CSOA 2W25A 1W36D 1R1UA 2X51A 1K78B 4RAGA 2EFPA 2VJIA 3HSEA 2MA3A 1LFPA 4YEJA 1T98A 3GLLA 2HEOA 2D1VA 1NHAA 4HDVA 1UG0A 1R49A 3J7YJ 3ZQLA 3FM3A 2HGCA 5HVQC 3CP2A 4P96A 1O3RA 2RVCA 2EZKA 4GYIA 2HWVA 2P5VA 1HSJA 3BZ6A 2K9SA 4RAYA 4B43A 3A01B 4KICA 1ORKA 3QOEA 3W2WA 1H9GA 3JRHA 2V9PA 3UR3C 3WTSC 5K5QA 4IX7A 3GYHX 4MFEA 5IP6A 2EIJH 1Y6IA 3P9CA 3S2DJ 2E60A 3K70D 2K40A 2M5WA 1R1VA 1TWAJ 2VI6A 5KK1A 3LSRA 5J40A 3ASOH 4G8XA 3FKIJ 3IAS2 1RR8C 2EA2A 1SVLA 2CW0F 4YFXF 1Z9CA 3ZQIA 4A6DA 2QKMB 3IAM2 2RAEA 3IHUA 1J5YA 1U6GA 1YLFA 3SZPA 1IDZA 3ABMH 1UB9A 4N0BA 4BE1A 1SFOJ 2JZYA 4LIVA 1JE8A 3SDBA 4OU0A 2LKSA 1MJ9A 3TDZC 1FOKA 3S17J 1VQ8I 1HW1A 1KQ0A 1Q1HA 1YOVB 1QVTA 1CQTA 2VXZA 5C44J 3ZP5A 2R0QC 3E5UA 1FYKA 1QNTA 2FBKA 1B6AA 3J7AO 1G3TA 2VONA 1WH5A 2VPRA 4KA4A 1RR7A 2M34A 2JUCA 4XRMA 2HDWA 1HC8A 2MH2A 3KEOA 5F1RA 1BI1A 5FLMJ 1G8XA 2CV2A 3GEZA 2X85A 3GMEA 3HRMA 5FKMA 3REOA 3ZQHA 2P6SA 4UUSB 2L02A 2VKDA 2G7HA 1FIAA 4IRIA 4HLYA 1TQPA 1KU2A 1JT6A 2H94A 2M8GX 2M2EA 1G3YA 3S16J 3C2HA 4JBAA 1MMSA 3R0AA 4NC6A 2DW4A 4ZYHA 1P2FA 1B8IA 4XOPA 2ZSHB 3ZMUA 4XRSA 5DTDA 3IKVA 1FYLA 4LFUA 1I3AA 1DPRA 4RDUA 1W5CC 3S3MA 3JRBA 1PUEE 4BDYA 3DU5A 1OJLA 2QVOA 3GXOA 1SC7A 4YG2F 4AYBA 2ZJPF 1IF1A 2QQAA 4QPOA 1VF9A 2XV4S 1WCMJ 4Y33A 2XGDA 3FM5A 4PJNA 3ZQCA 3ECHA 2W85A 2GWRA 3A0BC 4M74A 2W82A 2XKPA 5DCMB 2QZ8A 3TBIA 1AWCA 1YS7A 2JRTA 2LY2A 5IY5H 5H20A 2JTVA 4ITVA 4V2GA 2DPUA 3OSFA 1MNDA 2JWTA 2XAJA 2Y0SN 2YS9A 3CC4I 1HXDA 5F04A 3FISA 3B02A 3U1KA 3CJRB 3L7WA 4JYKA 4KFCA 2ZJQF 4F3QA 1S5LC 1SAUA 3BQZA 2EIKH 3HC7A 1PDNC 1JUPA 2R7DA 3E97A 3C7JA 1Y1VJ 1QRYA 3PUFA 1USSA 3PQKA 4XN3A 2FX0A 4XKVA 4A5MA 3QU3A 2KFDA 1WJCA 2ZMEB 4HOBA 4CSWA 1K61A 1UJ8A 3HKZN 3LFKA 1TWFJ 3TOAA 4OMYA 4AIJA 3H9QA 4AU7A 3EUHC 4BS9A 5F6FA 3F6OA 1YE9A 2V1XA 3SYTA 3HHHA 1K6OA 3GZ5A 5CVVA 2Y9YA 3F8FA 3I53A 4JK1X 1OPCA 1EA3A 1JUSA 2HPMA 1S7OA 5LHGA 4PJJA 3PUBA 5LFAA 2LTPA 5GPCA 1ZELA 3HTUA 1SMYF 2BVMA 1MJAA 3QU6A 1BC7C 2PMZA 3QYFA 4CHUA 1I6XA 3DP7A 4S0HB 5IYCJ 3BCAA 3MZHA 4XQFA 1I39A 1FMVA 2VE8A 3QP5A 2BXZA 1IN7A 4OIRF 1R22A 3M8EA 3DPLC 3HSFA 2NS0A 2XSJC 4ESJA 5E17F 1M1EB 3HZJA 3F23A 2H1KA 4AWXB 3QPHA 4PDKA 3MZYA 1LUJB 2DLLA 3LMMA 3PNTA 1XMKA 3K10A 1FY7A 5K7FA 1VQKI 3PO2J 4A3LJ 4OIPF 1FLIA 1J0RA 3V4GA 5BPIA 3G6EI 3TP0A 3QAHA 3OYLA 2Z16A 2FXAA 2NRAC 2Q2EB 4XSXF 2DFEA 2PG4A 3RKWA 5E8GA 2I10A 2XASA 2VE9A 5M5XJ 3AG2H 3W3CA 5A2QZ 3BTIA 2QBYA 4A69C 3SHFA 1UZCA 1R4NB 1RIOH 2GOXB 1BR1A 1P7IA 2MFZA 4Y52J 5D6FA 3DLAA 3T5XA 1TNTA 1EV7A 2KL4A 3OIOA 2R4GA 3E6DA 4G6TB 1DP7P 3H3VK 2DQRA 2VT2A 3HRSA 5D6EA 1HSTA 1ETXA 1ZG5A 3KZIC 4V2FA 4IL6C 2G7UA 4F93B 5CQGA 5C4JJ 4HX7A 1IUFA 4QPQA 2E5ZA 4DNCA 2IPQX 1T6SA 3TKYA 3PM1A 4CCLA 2E1MB 5JHFA 5M3MJ 3HL2A 4A3FJ 3KLNA 1LFBA 3HOWJ 5E18F 2V6CA 3ZN0A 2OCEA 2V26A 2AXLA 2RREA 2LH9A 2FBHA 2HR3A 4UV8A 2VC1A 3OMYA 1LPQA 2E2HJ 5HNHA 5D8LB 4DZPA 5EJCA 3E5QA 1DPUA 2L2OA 1B72B 4LITA 4M9ZA 2DDAA 2Q0OA 3OL4A 1QU3A 2UWMA 2O61A 2Y69H 2Q1ZB 3ABLH 3FX3A 1UFMA 3MN2A 1XC5A 1LVAA 4KIFA 2WBMA 2NVTJ 5HLGA 2IS6A 3K2ZA 1P9QC 2IJLA 3VEPA 2L9RA 4Y15A 2L7KA 3F21A 4OINF 4KNYA 1YX5A 4FCYA 3RQ4A 2XAQA 4M9XA 5L3GA 2O7OA 3SJMA 4M72A 1RKWA 1LKXA 1UG2A 3ML6A 2BXYA 1LEBA 3C1DA 2DOEA 3BTCA 3H35A 5E20A 5C3EJ 3OYBA 2P5LC 3F6VA 3SDGA 4IQJA 3LAPA 1XX5A 2CUFA 4QLCU 3IH4A 3DTEA 5IT9Z 1GDTA 2WV0A 3ABKH 2IS4A 3BY6A 5JVTA 3KP6A 1X2MA 2XPVA 2FJ1A 4J00A 1MDMB 4UVAA 1H89C 3ONQA 1ZGJA 3PIOF 3OS0A 5A2QK 4W1UA 3FXRA 5FKNA 4ESFA 4LLNA 1LE8A 3WU1B 3QYBA 4LOCA 2K9QA 4E7IA 5HS9A 2L9NA 3GTPJ 1FOXA 2IT0A 1BM9A 2DMPA 1SFEA 2F5DA 1D8KA 4B09A 2FQ4A 3HYIA 3FDYA 3TEDA 1KQ8A 4ENJA 4E7JA 3GFLA 1K83J 5FFZA 4ZZDA 3WTVC 4M9SA 4EJOA 3JAMZ 1YRNA 4OIQF 3FZVA 2L4MA 4M6VA 1P92A 3RPUD 4WX9A 1JHFA 2M7BA 2K4BA 3A1YA 4OOIA 3SFZA 4CYCA 3GO5A 3LSTA 2ICWG 3K1PA 3HIFA 2FEZA 4LGWA 3HHGA 4QIWN 2Z3YA 2O03A 1GHCA 4HG2A 2FU4A 4HF0A 5EG0B 1R36A 2H27A 1LEAA 1YIOA 4B48A 2W84A 5J1YA 3CJQB 1OISA 2Q8KA 2H6BA 2LBFB 4P5OA 3K4MA 5EEAA 4IPAA 3P5JA 3ELKA 2VQHA 1WHUA 2MGQA 2W24A 2QENA 4NHJA 2O3FA 4PJ0C 1RUOA 2E36A 3OOPA 2AHQA 2DT7B 4ZYDA 2K3FA 2LY9A 3WHCA 3MKYB 2TDXA 2VC0A 3CCUI 3CDHA 4D7NA 2CQKA 1I3QJ 3RSNA 4DYQA 3OYIA 2R5YA 3OOUA 4BKXA 5IT9K 3F8NA 3OYFA 2LP0A 2JK3A 4U88A 5ERIA 4BY7J 2R92J 2GBYA 1T8IA 1OYWA 1U8BA 2CMPA 2JJ7A 2LRDA 4CZCA 1NK3P 1N75A 2P7VB 2NVXJ 3E1SA 2YU9J 5FJ8J 1OCPA 2VKVA 3H3UA 4BE2A 5DD8A 4DYCA 2HOTA 2XF7A 3LSIA 2DTRA 2YX4A 4HF1A 3GTMJ 3LWFA 3HOSA 5LEJA 3TOBA 1YW8A 5H2FC 2OAZA 5FD5A 4O3MA 2CQQA 2P4WA 1K6YA 3WGGA 4CCNA 1WZ2A 1ZRFA 5IP7J 4JP0A 4NC8A 2DU9A 5TGTA 3OYAA 4FX0A 2Z1DA 1QPMA 1QZZA 2UUZA 2L54A 3PSFA 1V55H 5AIPA 4KITB 1GV5A 1ZTRA 2GZWA 4HA8A 2QM3A 2DOAA 1RC9A 3E3VA 1U5TA 1TWHJ 2I8DA 4YFNF 4EGYA 4UHTA 1I1SA 4A3GJ 4RLFA 2R7VA 2ME0A 5B1AH 3K4NA 1Z91A 5E8IA 1MMGA 4ZYAA 3BG5A 1HKTA 1ZGAA 4DZJA 1R4MB 4A3DJ 3IH2A 1T08B 4Q48A 2IEKA 3H0DA 2W4SA 4NNJA 4PFPA 1B4AA 2E5NA 5D5VB 2DODA 4BBRJ 1K4TA 2DCEA 5E1ZB 4IOCF 1H8AC 3IWZA 3P9IA 4MQVA 5LBQA 5M3FJ 3E7LA 3A02A 2R7TA 3BJAA 3ZN1A 3HGGA 3M07A 4HX8A 1JKQC 4B1RA 1USTA 2VLAA 2STTA 3HJEA 4KDPA 2XB0X 3GTLJ 2MYSA 4FETA 1FSEA 1YS6A 4ENKA 1O3SA 1IRXA 2EINH 5J47A 1YIJI 4HSTA 4BQQA 2L7FP 5BS6A 3FK6A 4IHXA 4IKFA 3KFWX 1YFHA 1FWZA 2PEXA 3F0CA 5E1XA 2RQQA 4A3MJ 2AQFA 2ECCA 2UXNA 2OBPA 2RC4A 1HW5A 2BHZA 1YITI 2XDVA 3JTHA 3K1MA 4RGXA 4UNOA 1BC8C 2R7SA 4M3EA 1HQCA 5FGMA 4RA2A 5LD2C 4EM2A 4HV5A 2P5KA 3TMOA 4JX5A 2OQRA 4CYDA 2L9SA 3LAJA 4FT8A 4AVZA 2P8TA 5EZGA 3QYEA 2G9WA 2EIMH 2VJJA 2A5YB 4EQQA 2I5UA 4DYRA 1GUUA 3O8GA 3F8MA 4I98B 1FYMA 3AG4H 2GA2A 5DM6F 5LHHA 4TV7A 3CTAA 2LYCA 3SXYA 3JRGA 2XGEA 2PJRB 1FJLA 3ERED 3KYLA 1T56A 4EATA 2LSOA 3I4MJ 4XLHA 1LDKB 4KT5C 2XKOA 3MAJA 4E7ZA 2X1EA 3FHNA 3ABUA 1IRZA 4RBOA 4C9YA 1WJAA 3MKWB 2VUMJ 1R00A 5F0CA 4RB3C 3R6SA 4UY8I 5HNFA 2FE3A 2O5RA 5EGOB 2QKLB 2VJ5A 4XLCA 2B7EA 1WI3A 1BW6A 1VI0A 2A5WA 5KAIC 3H9GA 2VODA 3RPQA 1RNLA 3E0JB 2LOOA 4QWQA 1PUFB 1AU7A 2EFOA 1SVOA 1ON2A 1H9TA 4HAMA 2H6CA 1KU9A 2MLKA 4GXOA 1V54H 4IHYA 4ANJA 2HNHA 2QGUA 4L9NA 4HV6A 2CUZA 2CW8A 4FX4A 3E6BA 3AL0B 2ID3A 3EDPA 4B3XA 2UZKA 4JX4A 4XL9A 3CCSI 4FE4A 3ZMDA 1ZARA 2K7LA 3DQVC 2K9LA 4CO8A 4BGDA 4UVBA 2WAFA 1X4PA 3RZDJ 1MSEC 1J2XA 3GBGA 3DU6A 4A2UA 3IH3A 1EH7A 3A01A 1NH3A 1GV2A 1TW2A 4RB2C 2CUEA 1R23A 3NWTA 2DA1A 4Y3OA 1APLC 1W1WE 3H5NA 4C3HJ 3JRIA 4G6QA 2HKXA 5J4VA 3S14J 1H0MA 3MCZA 2GOMA 1XN7A 2KIMA 1OCCH 3VYRB 1C0WA 2E71A 3OY9A 1TBXA 1HKQA 2COMA 5FLVA 2TRTA 1NG6A 2BW3B 3OYMA 4AUXA 3S2HJ 3SZTA 1MBFA 1WJBA 3PL8A 1ZRCA 1MJBA 3GF2A 2CV0A 1FNNA 1FT9A 3M1EA 3RZOJ 4LLGF 1D0YA 4X1EA 4HEA2 4ZDLA 1SD5A 2A6HF 2W1OA 3F8BA 3KPHA 4IHWA 5ILUA 1XG1A 1AHDP 1UELB 4YELA 3CCEI 1K7AA 4ZDOA 3FXOA 4C2TA 5J8CA 2R7RA 5FRMA 5IPAA 2AQEA 3WGIA 3G2BA 1MBEA 4B47A 2HFHA 4L5EA 4CCOA 2MLGA 2XRNA 1IN6A 1U0JA 2IXSA 4PFOA 3J80K 2QA4I 1GVDA 3EETA 3J7AY 1EKEA 3WTXC 3HUGB 1IN4A 4BU2A 1DDNA 2EJRA 3KX2A 1BR4A 1T95A 3FMRA 3DEWA 3DTIA 3QWLA 4AD9A 2XVCA 3AG1H 4UUTA 2HKOA 3PNYA 5D4RA 2R5ZA 5ICGA 4UUSA 4AYBN 2NAZA 3KZZA 1KYWA 4M6XA 4EMSA 2H8RA 3ERMA 2RV8A 2M30A 3CMAI 1BW5A 1JUMA 2VBZA 2GXBA 2V7FA 3BZKA 2HOEA 2V79A 5FROA 1S72I 2HOSA 2ELKA 2XIGA 4XK4A 1YHQI 1UAAA 3D0SA 1FTTA 1TZLA 2V1NA 1YTYA 4UXNA 3CF2A 1EH8A 4M3DA 2QF7A 4M73A 4ZZLA 3G73A 2BHYA 2VL8A 1WFXA 4MTEA 5JR3A 4J19A 2L7MP 1DU0A 4HPQA 2LREA 4KT6A 4EJVA 1HCRA 3VFZA 1IO2A 2L4AA 1QVUA 2DMUA 3WE3A 1BR2A 4LB6B 4E7HA 3OR2C 3OYGA 2BYVE 1SD6A 3MKLA 4GDFA 2OCCH 3GCMA 1U5TC 2BBYA 5B3SH 3LA7A 4BE0A 1OKRA 2DMQA 4CDGA 3OSGA 4CCJA 3DEEA 2LKXA 3TL4X 3IWFA 2IW5A 2CG4A 5JI6A 4JX6A 2TCTA 4D1QA 1L3LA 2WB1N 5K5RA 2VASA 5HLTA 2E2IJ 5DUIA 3KP3A 3AG3H 3JCUC 1JKRC 3IKTA 4G7HF 1CF7A 2V1UA 1EF4A 3N97A 4PZJA 2ZMEA 4U0YA 3M9AA 1XMXA 5E3LA 4WCGA 2KDOA 4HNVA 1O3QA 1B8IB 4XRFA 3U2RA 4FASD 2CQNA 4WWCA 2HXOA 2F4MB 3T8TA 3ZRGA 3JSOA 1GLNA 2ZSIB 1Z0XA 1S3JA 4NQWB 4PSXA 2PN6A 4Y13A 4V19K 3M8JA 3RQIA 3TO7A 3GVAA 3CCJI 4AIKA 2Y48A 3HEFA 2MBFA 4P1WA 5FFXA 1WSUA 3GTOJ 1W7PB 2E1NA 1D0XA 2K27A 3W6KB 3QP6A 3KIOA 2JA7J 3VB2A 4UB6C 2XAHA 5EEHA 4HLXA 2CU7A 2ZCWA 3FBIB 4S04A 2FNAA 4S05A 1YX3A 1AKHB 1D0ZA 3BROA 4DW6A 2Z5UA 4I76A 5CJ9A 2CO5A 2K85A 3O3KA 4RM3A 4RM2A 4A6EA 5J4YA 3WTWC 2ISZA 2FNPA 4KN7X 3KEQA 5JFRA 4MHGA 4Z6YA 1JTXA 1W5TA 2M45A 3CD6I 3BR1A 3I56I 3WGHA 4E7KA 1ZRDA 1XS9A 1VZ0A 5HDKA 4GO1A 3OL3A 3D1NI 3V7RA 5M5YJ 2JPCA 2OZUA 2M4KA 1SAXA 3W6VA 2HI3A 2NVYJ 1E3HA 2QUFA 1IG7A 3M1CA 2R7ZJ 4M71A 4CH7A 2IGKA 2Q2EA 4EM1A 3R60A 1V4RA 3J81Z 1A35A 3HRUA 4DGWB 3F72A 4Q5SF 3Q0WA 3O2PE 3ZQGA 1OR7A 4CZZA 4L18B 3DXJF 1ETOA 4IVNA 3T8RA 4AC0A 3BLYA 3MVPA 3ZMVA 2JVHA 2BY1A 2Y0SA 2MD5A 2LK2A 2HQNA 3RI4A 3JRFA 2ETHA 2GIZA 1TQIA 1W5SA 2X0LA 4L0ZB 3FXMA 4BEHB 3BT9A 1LB2A 3HOUJ 2EA4A 3VOEA 4KJZA 1ZGWA 2EZLA 4MFDA 1R9TJ 2VQLA 3CDIA 3Q3SA 5DD4A 4WK8F 4OMZA 1XD7A 2IGMA 3JRDA 5BOXA 2BY0A 3HKZA 2B9SA 2HXIA 5GAGJ 2OZ6A 2YSRA 1B72A 2WA0A 2QCOA 4HSRA 3A4CA 3NQOA 3FK7A 1TT5B 3A0HC 1LJ9A 2E7WA 4BHCA 2XAFA 4XNFA 2KMUA 5J3LA 1V5EA 2PBIA 3Q0VA 2XROA 3GFMA 4C2MJ 1RESA 4IZZA 2AXTC 1KA8A 2GM4A 4HNTA 2OC6A 2O9LA 1P7JA 4GRIA 2ZO4A 4BH9A 3OV8A 3F9KA 2JA8J 2X1DA 2RQPA 5GTHC 3HXLA 5CPRB 1SEUA 3HOVJ 3BQYA 3WODF 2FOWA 3VSLA 3S32A 1E3PA 1WJ5A 2F48A 4MTDA 1IAWA 1TT0A 1D3YA 2PFBA 5B5EC 3B6AA 2BVLA 3ZCOA 4PUSA 2NS7A 5HDNA 1LQ1A 3HDDA 1FIPA 4HQMA 1A36A 1YYVA 2A61A 2DTZA 1G2HA 3CUQB 3BC8A 5CVIA 4PJMA 5L3EA 2DK5A 1ETWA 2GQQA 5ICCA 1IXRC 2F4IA 3ZMSA 3VYUB 2E19A 3J81K 4A0YA 1E3OC 2WAQN 4XIDA 3EYIA 4RGUA 2GXAA 4LMYA 3CCYA 3MWMA 2QSFX 4L5IA 2VQGA 3OS2A 2M8EA 3VDXA 1D5VA 1Z3YA 1J75A 2HZTA 1AA7A 1TP4A 1P4WA 5JLWA 1U78A 3I54A 1G3WA 4ESBA 4Q47A 2FSWA 3TW7A 1RETA 2DA3A 3QOPA 2LMDA 3GX4X 3CDLA 1LNWA 1Z3XA 4OWRB 4BBSJ 5HODA 4JQFA 4P55A 4PCQA 2LDUA 1V5FA 2F5FA 2DFHA 1X19A 2L01A 3VSKA 5KAFC 5EZHA 3AKZA 1ETQA 4HNUA 5E79C 1BN5A 1MNMC 3J7ZI 3WHBA 3QPLA 1K79A 2A3SA 2XB5A 3EUAA 4HYEA 3ZMTA 1ONVA 2YX7A 1IN8A 2CFXA 3ECOA 2NOGA 3AFHA 1H88C 2F5VA 4F52A 1YW7A 2WTEA 4O5VA 4M3FA 2DQLA 5TRDA 2VOPA 4YFKF 3K4CA 5FLXK 3O8HA 4IXAA 4A3IJ 4HF2A 3GZNB 1IXCA 1Z7UA 2LBFA 2CV1A 2P7CB 4LLLA 4OIOF 2A69F 2XPWA 3BG6A 3CLQA 3KYDB 4J01A 3QODA 2CFOA 1A04A 4R79A 3BP8A 2DJNA 1U9OA 2HS5A 3F8CA 3B73A 2RKHA 3TW6A 1A6QA 1E0EA 1R58A 4A3JJ 1ZK8A 4I0AA 2MD0A 1U8RA 4E70A 3RJPA 1P4AA 3G1OA 2QQ9A 3V7CA 4ZJZA 4KUMA 4II2A 1RPWA 1TW3A 2VBXA 3RYPA 3I59B 3I0TA 4FE7A 3JREA 4B8XA 4HBLA 2J5PA 4NBQA 3BTJA 3CCVI 2NVQJ 2EWNA 4IHTA 3W6JB 4XSZF 3WU0A 2GXGA 3L2RA 1MBKA 3ZMZA 1LVKA 2VKEA 3BOQA 1ETVA 1ZAOA 1O57A 1D5YA 1ITYA 4CYCB 2XC7A 1Y1WJ 1RUNA 2XF5A 3ABTA 2H1LA 2ELHA 5ILSA 4CXFA 3LSMA 1O7FA 4M3GA 2XHKA 2X4HA 2PLYA 2XRLA 4RS8A 3P9KA 1KU7A 4XKCA 2F5CA 4X6AJ 1SANA 2HQ5A 2ZMEC 3BCBA 2EZIA 2KLOA 2KRCA 4Z2YA 2PJPA 1SFKA 3KEYA 1QGPA 2X48A 2JSCA 5K7HA 5BMZA 3RTRA 3LQRA 1FX7A 5L3FA 1I27A 3BDDA 1DUXC 3K4LA 3N05A 1PYVA 2P0WA 2ZFUA 3F3XA 1T2KA 5KHDA 2W57A 4LG3A 1XSXA 2KPMA 1XCVA 2L3DA 4UVCA 4ETSA 1X1CA 1FSHA 1IJWC 1VNDA 1YJ9I 1R6RA 4PGGA 1W4MA 5JHUA 1ULYA 2M3AA 3TDUC 5LGNA 5ILVA 4ZC3A 3CO7C 4DQ2A 5LHIA
chains in the Genus database with same CATH topology
2OD5A 3I5UA 1G6NA 1SD7A 1XGMA 3NEUA 1ZYRF 3KP5A 2QQBA 1XCBA 4EVIA 4KIGA 3M8FA 5LLQA 1KGSA 3T0YA 1YQAA 4U7DA 3EYYA 4R1HA 1GXQA 1GXPA 2PMHA 2FBIA 5L3CA 3CLOA 3HOTA 1FBUA 5J8FA 4WCGA 3I4PA 4GCVA 2PQ8A 5DYMA 1KU3A 2KRFA 5HS8A 2EB7A 2RDPA 4IJAA 2V1DA 3O6BB 1JGSA 5BPDA 4YIFA 2M1BA 4XBFA 3CUOA 1MD0A 2QYOA 4UV9A 2M87A 1YW9A 5FO5A 3DF8A 3E6CC 3WG9A 2DO7A 4WXHA 5LRSA 2WWYA 4RAZA 2VN2A 2UXXA 1XSVA 3ZPLA 3RKYA 5HS7A 2ESNA 4I02A 2IA0A 4A0ZA 2Z99A 1XDUA 2O6GE 5BQTA 1ZN2A 1PP7U 1MZBA 1WRJA 3J80Z 2VBYA 4UUVA 1T38A 3FF5A 5TJJA 1O3TA 2F2EA 1TLHB 2IVMA 1FC3A 2J5OA 1XGOA 5D5UB 3AAFA 2ZNYA 3L9FA 1K78A 2EFQA 4I01A 1Z6TA 1BIBA 3Q5FA 1J59A 1RI7A 3K9TA 4U0WA 3JTGA 1F9NA 2DPDA 3JSPA 2Y75A 4IF4A 3C3WA 2VOOA 2ZBKA 3L00A 5KVRA 2YU3A 4L5JA 1S8NA 1ZLJA 2R3SA 2IA2A 3KP4A 3NRVA 2OQGA 5DUKA 4LG0B 3Q9VA 1SFXA 1F5TA 1BI0A 3IC7A 2ZJ2A 1S6LA 1FPQA 1XB4A 3WE2A 4O6JA 2C6YA 1HBXG 1V3FA 2DI3A 2B0LA 2FA5A 5CLSA 3HUGA 5K1YA 4EJTA 3DKWA 4EM0B 1T39A 4L9TA 3WTTC 1X3UA 4BYYA 1R7JA 4KIBA 2V9VA 4HDUA 3T1BA 1OYIA 2K86A 3WTUC 3COAC 1EH6A 2WC2A 4IRGA 1LDDA 3TQNA 4EGZA 2ESHA 4I09A 2IP2A 2IA1A 4ASNA 4XLNF 2FMYA 2QLZA 1IRGA 4M6YA 2FF4A 5DEQA 3U1DA 5ICFA 5F64A 1WI9A 4CGZA 3ZQ7A 4EJWA 4D0PA 2FRHA 3K69A 1AOYA 4AIHA 1ZREA 3WTZA 1BI3A 3H92A 1ZG1A 5J6XA 4RB1A 2DFIA 1PP8F 4HX4A 4MEYF 3RIRA 2A07F 2D2WA 2K02A 1B1BA 2GA1A 1O7LA 4AVPA 4WF2A 4N9HA 5DCMA 4RGSA 4H0EA 5D8KB 2ADUA 2YPRA 4LK0F 2BE5F 2HTSA 4N9IA 5CVUA 1XDSA 2ISYA 2Y0MA 5D5WB 1WQ2A 1OMIA 2KJBA 1P6RA 1QQIA 3IL2A 3E6MA 2KKOA 5H6RA 4NQWA 4K2EA 1I1GA 4BNCA 3C18A 1J7KA 1B9NA 1SD4A 3S2WA 1W7PA 4LB5A 5LGTA 1JXSA 3GFJA 5FD6A 1F4KA 4BHBA 4WXCA 5AIQA 1SFUA 1FBQA 4BXUA 1S7AA 2D45A 5L3BA 2NNNA 2E7XA 3HRTA 2Z9OA 1WWXA 4HQEA 3LA3A 1ZLKA 5HLIA 1ODDA 1XSDA 2PMUA 2XAGA 5D5XB 1CF7B 3GUDA 5LGUA 2GIVA 4FHTA 4BQAA 3DEUA 2RNJA 2ZNZA 4MNUA 1J9IA 3PQJA 3Q9SA 4IRHA 3GFIA 1S29A 2NNYA 1QBJA 4IHSA 4F7ZA 1R1TA 4GGGA 5AONA 2D1HA 2JT1A 1UCRA 3ULQB 1T0FA 3FHZA 1OYYA 3LQQA 4U0VA 1XMAA 3FMQA 1Y0UA 1Z05A 2JPBA 5DV5A 5ICEA 1B9MA 2OA4A 2F5EA 3M7GA 2EFNA 3F22A 1STZA 5L3DA 4BHPA 1FP2A 1U2WA 2KIUA 5DDGA 2KIFA 3K0LA 4ON0A 4KYWA 4HW0A 2O0YA 2MH9A 1QZYA 5FLXZ 2KJCA 3IRQA 3CUQA 2BV6A 1E17A 1BBYA 1IXSB 4LK1F 2QBYB 3U9GA 1UHMA 3D5LA 4KMFA 3VODA 1MDMA 3DPTA 3TO9A 3KE2A 3KP7A 4MQ9F 1FP1D 2EV5A 2VBWA 2IRFG 5HOOA 1B59A 4LJZF 4I2OA 2CYYA 3QRFF 2BEOA 2P6TA 1QO0D 4L9JA 1IZ1A 3WTYC 3I58A 3JW4A 3DV8A 3I64A 1UHWA 3FMSA 3CJNA 5CVRA 2PI0A 3ISPA 1L0OC 1ZHFA 4ZYGA 2MC3A 2O8XA 5CYVA 2CWEA 2HTJA 4RB0A 4L0YB 3L2CA 1IW7F 2DAOA 2HDCA 2EK5A 2XUBA 2XGXA 2DBBA 2RN7A 4NB5A 3CO6C 1I5ZA 1ON1A 3I59A 3MFKA 4U7BA 4KMUX 5ED4A 1IRFA 3R4KA 2YR2A 1F1ZA 3GW2A 2STWA 2ZKZA 3BPVA 4LD5A 3TO6A 5K5OA 1XGSA 1FZPB 2DT5A 3BWGA 4ENMA 1G4DA 3FXQA 2Z33A 2RGVA 1Z6RA 4PGHA 3N4MA 2FMLA 1HW2A 4A5NA 1ZH5A 4CICA 2K4JA 4BAYA 1BJAA 3RDIA 3DFGA 3KLOA 3MEXA 4HZFA 3GWZA 3GZ6A 2LF7A 5HLHA 2A68F 2HYFA 4WXDA 3FXUA 3RKXA 3KETA 4EJUA 1GVJA 3R0JA 2EFWA 4MGRA 1BIAA 4A12A 4L9VA 1XGNA 3KP2A 3BJ6A 3FWEA 3SQNA 4G7ZF 1BOAA 3V8LA 1JHHA 4I0BA 1YO5C 2EV0A 5H6QA 3QPTA 2LKPA 1IN5A 3G3ZA 3LA2A 3HTSB 4ENNA 3EQLF 4R8HA 3JAMK 2NYXA 1KQ9A 3KCCA 2OU2A 2ZFWA 3IRRA 5LEKA 4XLPF 4GYGA 4YIIA 2H09A 1KYZA 4MEXF 2DK8A 1REPC 5LRRA 3L09A 4G94A 2CGPA 4P9UA 1VTNC 4Q4ZF 1G3SA 2AS5F 1U5TB 4ZYEA 3PFIA 2FOKA 1R5HA 4P9FA 1D8JA 1U3EM 3E5XA 3TGNA 1IUYA 3BJOA 1YG2A 2GAUA 2LF8A 1TQMA 2HQRA 1MGTA 3KZYA 4EV0A 2HYGD 3V7SA 3H3ZA 2VT3A 3EUHA 1WKMA 2QWWA 5CVJA 3GLXA 1Z1DA 2LNBA 3P7NA 4A0XA 3CUQC 1FBSA 1HKSA 3RYRA 1SMTA 4G6DA 4ZH4F 5EEGA 3RPUA 2BGCA 2ACJA 3I71A 1BI2A 5E1WA 2E1CA 3R61A 4KN4X 2ZXJA 1E2XA 1TNSA 1R5GA 1CGPA 3K1NA 1W7PD 1ZG3A 5HDGA 1LDJA 3HSRA 1RZ4A 3ROUA 4G7OF 1TTYA 4LG0A 2FQ3A 3V8JA 4RGRA 3BPXA 4I7HA 5DCFA 4G9YA 5IT3A 3V8KA 5FB2A 2R7FA 2EV6A 5D4SA 3MQ0A 2A6EF 6PAXA 4Y17A 1MKMA 1P4XA 2CSOA 2W25A 1K78B 1R1UA 2EFPA 3HSEA 2MA3A 1T98A 2HEOA 2D1VA 1NHAA 4HDVA 3FM3A 2HGCA 5HVQC 4P96A 1O3RA 2RVCA 4GYIA 2HWVA 2P5VA 1HSJA 3BZ6A 4RAYA 4KICA 1H9GA 3WTSC 5K5QA 3GYHX 3P9CA 2M5WA 1R1VA 5KK1A 4G8XA 2EA2A 2CW0F 4YFXF 1Z9CA 4A6DA 3IHUA 1J5YA 1U6GA 1YLFA 3SZPA 1UB9A 4N0BA 2JZYA 1JE8A 4OU0A 1MJ9A 3TDZC 1FOKA 1HW1A 1KQ0A 1Q1HA 2VXZA 3ZP5A 1FYKA 3E5UA 1QNTA 2FBKA 1B6AA 3J7AO 1G3TA 2VONA 4KA4A 2MH2A 3KEOA 5F1RA 1BI1A 3GEZA 3HRMA 3REOA 2P6SA 2L02A 2G7HA 4IRIA 4HLYA 1TQPA 1KU2A 2H94A 1G3YA 4JBAA 3R0AA 4ZYHA 2DW4A 1P2FA 3ZMUA 3IKVA 1FYLA 4LFUA 1DPRA 1PUEE 3GXOA 2QVOA 4YG2F 1IF1A 2QQAA 2XV4S 3FM5A 3ECHA 2W85A 2GWRA 4M74A 2XKPA 5DCMB 2QZ8A 1AWCA 1YS7A 2JRTA 5H20A 2JTVA 2DPUA 2XAJA 1HXDA 3B02A 3L7WA 4KFCA 1PDNC 2R7DA 3E97A 3C7JA 1USSA 3PQKA 4A5MA 3QU3A 2ZMEB 4HOBA 3LFKA 3TOAA 4OMYA 4AIJA 5F6FA 3F6OA 2V1XA 3HHHA 1K6OA 3GZ5A 5CVVA 3F8FA 3I53A 4JK1X 1OPCA 1S7OA 5LHGA 3HTUA 1SMYF 1BC7C 1MJAA 3QU6A 4CHUA 1I6XA 3DP7A 3MZHA 2VE8A 3QP5A 1IN7A 4OIRF 1R22A 3M8EA 3DPLC 3HSFA 2NS0A 4ESJA 5E17F 3F23A 4AWXB 3QPHA 4PDKA 3MZYA 2DLLA 1XMKA 1FY7A 4OIPF 1FLIA 1J0RA 3V4GA 5BPIA 3QAHA 2FXAA 2NRAC 2VE9A 4XSXF 2PG4A 3RKWA 5E8GA 2XASA 5A2QZ 2QBYA 3SHFA 1RIOH 5D6FA 3T5XA 1TNTA 1EV7A 3E6DA 1DP7P 2DQRA 2VT2A 3HRSA 5D6EA 1HSTA 1ZG5A 2G7UA 4HX7A 4DNCA 2IPQX 1T6SA 3TKYA 3KLNA 5E18F 2V6CA 3ZN0A 2AXLA 2FBHA 2HR3A 4UV8A 2VC1A 5D8LB 3E5QA 1DPUA 4M9ZA 2Q0OA 2UWMA 2O61A 3FX3A 1UFMA 1LVAA 4KIFA 5HLGA 3K2ZA 2IJLA 3VEPA 4Y15A 3F21A 4OINF 4KNYA 2XAQA 4M9XA 5L3GA 4M72A 3ML6A 1LEBA 3C1DA 5E20A 2P5LC 3F6VA 3LAPA 4QLCU 5IT9Z 2WV0A 3BY6A 5JVTA 3KP6A 1MDMB 4UVAA 1ZGJA 5A2QK 3FXRA 4ESFA 4LLNA 3WU1B 5HS9A 2IT0A 1BM9A 1SFEA 2F5DA 1D8KA 4B09A 3HYIA 1KQ8A 4ENJA 3GFLA 5FFZA 4ZZDA 3WTVC 4M9SA 4EJOA 3JAMZ 4OIQF 3FZVA 2L4MA 1P92A 4WX9A 1JHFA 4OOIA 2K4BA 3SFZA 3GO5A 3LSTA 3K1PA 3HIFA 2FEZA 4LGWA 3HHGA 2Z3YA 2O03A 1GHCA 2FU4A 4HF0A 1R36A 2H27A 1LEAA 1YIOA 2W84A 2Q8KA 2H6BA 4P5OA 4IPAA 3ELKA 2W24A 4NHJA 2QENA 2O3FA 1RUOA 3OOPA 4ZYDA 2TDXA 2VC0A 3CDHA 2CQKA 5IT9K 3F8NA 4U88A 5ERIA 1OYWA 2P7VB 3H3UA 5DD8A 2DTRA 2YX4A 4HF1A 3HOSA 3LWFA 5LEJA 3TOBA 1YW8A 2OAZA 5FD5A 4O3MA 2P4WA 3WGGA 1ZRFA 2DU9A 4FX0A 1QPMA 1QZZA 2L54A 5AIPA 2GZWA 4HA8A 2QM3A 3E3VA 1U5TA 4YFNF 4EGYA 1I1SA 4UHTA 1Z91A 5E8IA 1HKTA 1ZGAA 4Q48A 1B4AA 5D5VB 5E1ZB 3IWZA 3P9IA 4MQVA 5LBQA 3BJAA 3ZN1A 4HX8A 1USTA 2STTA 4KDPA 4ENKA 1FSEA 1YS6A 1O3SA 5BS6A 3KFWX 1YFHA 1FWZA 2PEXA 5E1XA 2UXNA 2OBPA 2RC4A 1HW5A 3JTHA 3K1MA 4RGXA 4UNOA 1BC8C 1HQCA 5FGMA 4EM2A 4HV5A 2P5KA 2OQRA 4CYDA 3LAJA 4FT8A 2P8TA 2G9WA 2A5YB 4EQQA 3F8MA 4I98B 1FYMA 2GA2A 5LHHA 4TV7A 3CTAA 3SXYA 3ERED 2LSOA 1LDKB 4KT5C 2XKOA 3MAJA 3ABUA 1R00A 4RB3C 3R6SA 2FE3A 2VODA 3RPQA 1RNLA 4QWQA 2EFOA 1ON2A 1H9TA 4HAMA 2H6CA 1KU9A 2MLKA 4GXOA 4L9NA 4HV6A 4FX4A 3E6BA 3EDPA 2UZKA 3ZMDA 1ZARA 2K7LA 3DQVC 4CO8A 4UVBA 1J2XA 4A2UA 1EH7A 1TW2A 4RB2C 1R23A 4G6QA 2HKXA 1H0MA 3MCZA 1XN7A 2KIMA 1C0WA 1TBXA 1HKQA 2COMA 3SZTA 1ZRCA 1MJBA 3GF2A 1FNNA 1FT9A 3M1EA 4LLGF 1SD5A 2A6HF 3F8BA 5ILUA 1K7AA 5J8CA 3WGIA 2HFHA 2MLGA 2XRNA 1IN6A 3J80K 3EETA 3WTXC 1IN4A 1DDNA 2EJRA 3FMRA 4AD9A 2XVCA 2HKOA 5D4RA 5ICGA 2NAZA 3KZZA 1KYWA 4M6XA 4EMSA 2RV8A 2M30A 2VBZA 2GXBA 2HOEA 2V79A 2XIGA 3D0SA 1YTYA 4UXNA 1EH8A 4M73A 4ZZLA 3G73A 4MTEA 5JR3A 4EJVA 3VFZA 2L4AA 3WE3A 4LB6B 2BYVE 1SD6A 1U5TC 2BBYA 3LA7A 1OKRA 4CDGA 3IWFA 2IW5A 2CG4A 5JI6A 1L3LA 5K5RA 5DUIA 3KP3A 3IKTA 4G7HF 1CF7A 2V1UA 3N97A 4PZJA 2ZMEA 4U0YA 3M9AA 1O3QA 4XRFA 3U2RA 4WWCA 3T8TA 3JSOA 1S3JA 2PN6A 4Y13A 3TO7A 3GVAA 4AIKA 2Y48A 2MBFA 5FFXA 1WSUA 1W7PB 2E1NA 2K27A 3W6KB 3QP6A 3VB2A 2XAHA 5EEHA 4HLXA 2ZCWA 4S04A 2FNAA 4S05A 3BROA 2Z5UA 5CJ9A 2CO5A 3O3KA 4A6EA 3WTWC 2ISZA 2FNPA 4KN7X 3KEQA 5JFRA 4MHGA 1W5TA 2M45A 3WGHA 1ZRDA 5HDKA 4GO1A 3V7RA 2JPCA 2OZUA 1SAXA 2QUFA 4M71A 2Q2EA 4EM1A 3R60A 1V4RA 3J81Z 3HRUA 3F72A 4Q5SF 3O2PE 1OR7A 4CZZA 4L18B 3DXJF 4IVNA 3T8RA 3ZMVA 2MD5A 2HQNA 3RI4A 2ETHA 1TQIA 1W5SA 2X0LA 4L0ZB 1LB2A 2EA4A 3VOEA 5DD4A 4WK8F 4OMZA 1XD7A 5BOXA 2OZ6A 2YSRA 3NQOA 4BHCA 2E7WA 1LJ9A 2XAFA 2PBIA 2XROA 3GFMA 1KA8A 2ZO4A 4BH9A 3OV8A 2RQPA 3WODF 4MTDA 1IAWA 2PFBA 1D3YA 5HDNA 1LQ1A 4HQMA 1YYVA 2A61A 3CUQB 5CVIA 5L3EA 2DK5A 2GQQA 5ICCA 1IXRC 3ZMSA 3J81K 4A0YA 3EYIA 4RGUA 4LMYA 3MWMA 4L5IA 2M8EA 1D5VA 1J75A 2HZTA 1P4WA 1U78A 3I54A 1G3WA 4ESBA 4Q47A 2FSWA 3QOPA 3GX4X 1LNWA 4JQFA 4P55A 4PCQA 2LDUA 2F5FA 2L01A 1BN5A 1K79A 2A3SA 4HYEA 3ZMTA 1ONVA 2YX7A 1IN8A 2CFXA 3ECOA 1YW7A 2WTEA 4O5VA 5TRDA 2DQLA 2VOPA 4YFKF 5FLXK 4IXAA 4HF2A 1IXCA 1Z7UA 2P7CB 4LLLA 4OIOF 2A69F 1A04A 4R79A 3BP8A 2HS5A 3F8CA 3B73A 2RKHA 1R58A 4I0AA 1U8RA 4E70A 3RJPA 1P4AA 2QQ9A 3V7CA 4KUMA 1TW3A 2VBXA 3RYPA 3I59B 3I0TA 4B8XA 4HBLA 2J5PA 2EWNA 4IHTA 3W6JB 4XSZF 3WU0A 2GXGA 3ZMZA 3BOQA 1ZAOA 1O57A 1RUNA 3ABTA 2ELHA 5ILSA 4CXFA 1O7FA 2XHKA 2X4HA 2PLYA 4RS8A 3P9KA 1KU7A 2F5CA 4Z2YA 2PJPA 1QGPA 2JSCA 5BMZA 3RTRA 3LQRA 1FX7A 5L3FA 1I27A 3BDDA 1DUXC 3F3XA 1T2KA 2W57A 1XSXA 1XCVA 2L3DA 4UVCA 4ETSA 1FSHA 4PGGA 1W4MA 5JHUA 1ULYA 5LGNA 3TDUC 5ILVA 3CO7C 4DQ2A 5LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OD5 A;  3I5U A;  1G6N A;  1SD7 A;  1XGM A;  3NEU A;  1ZYR F;  3KP5 A;  2QQB A;  1XCB A;  4EVI A;  4KIG A;  3M8F A;  5LLQ A;  1KGS A;  3T0Y A;  1YQA A;  4U7D A;  3EYY A;  4R1H A;  1GXQ A;  1GXP A;  2PMH A;  2FBI A;  5L3C A;  3CLO A;  3HOT A;  1FBU A;  5J8F A;  4WCG A;  3I4P A;  4GCV A;  2PQ8 A;  5DYM A;  1KU3 A;  2KRF A;  5HS8 A;  2EB7 A;  2RDP A;  4IJA A;  2V1D A;  3O6B B;  1JGS A;  5BPD A;  4YIF A;  2M1B A;  4XBF A;  3CUO A;  1MD0 A;  2QYO A;  4UV9 A;  2M87 A;  1YW9 A;  5FO5 A;  3DF8 A;  3E6C C;  3WG9 A;  2DO7 A;  4WXH A;  5LRS A;  2WWY A;  4RAZ A;  2VN2 A;  2UXX A;  1XSV A;  3ZPL A;  3RKY A;  5HS7 A;  2ESN A;  4I02 A;  2IA0 A;  4A0Z A;  2Z99 A;  1XDU A;  2O6G E;  5BQT A;  1ZN2 A;  1PP7 U;  1MZB A;  1WRJ A;  3J80 Z;  2VBY A;  4UUV A;  1T38 A;  3FF5 A;  5TJJ A;  1O3T A;  2F2E A;  1TLH B;  2IVM A;  1FC3 A;  2J5O A;  1XGO A;  5D5U B;  3AAF A;  2ZNY A;  3L9F A;  1K78 A;  2EFQ A;  4I01 A;  1Z6T A;  1BIB A;  3Q5F A;  1J59 A;  1RI7 A;  3K9T A;  4U0W A;  3JTG A;  1F9N A;  2DPD A;  3JSP A;  2Y75 A;  4IF4 A;  3C3W A;  2VOO A;  2ZBK A;  3L00 A;  5KVR A;  2YU3 A;  4L5J A;  1S8N A;  1ZLJ A;  2R3S A;  2IA2 A;  3KP4 A;  3NRV A;  2OQG A;  5DUK A;  4LG0 B;  3Q9V A;  1SFX A;  1F5T A;  1BI0 A;  3IC7 A;  2ZJ2 A;  1S6L A;  1FPQ A;  1XB4 A;  3WE2 A;  4O6J A;  2C6Y A;  1HBX G;  1V3F A;  2DI3 A;  2B0L A;  2FA5 A;  5CLS A;  3HUG A;  5K1Y A;  4EJT A;  3DKW A;  4EM0 B;  1T39 A;  4L9T A;  3WTT C;  1X3U A;  4BYY A;  1R7J A;  4KIB A;  2V9V A;  4HDU A;  3T1B A;  1OYI A;  2K86 A;  3WTU C;  3COA C;  1EH6 A;  2WC2 A;  4IRG A;  1LDD A;  3TQN A;  4EGZ A;  2ESH A;  4I09 A;  2IP2 A;  2IA1 A;  4ASN A;  4XLN F;  2FMY A;  2QLZ A;  1IRG A;  4M6Y A;  2FF4 A;  5DEQ A;  3U1D A;  5ICF A;  5F64 A;  1WI9 A;  4CGZ A;  3ZQ7 A;  4EJW A;  4D0P A;  2FRH A;  3K69 A;  1AOY A;  4AIH A;  1ZRE A;  3WTZ A;  1BI3 A;  3H92 A;  1ZG1 A;  5J6X A;  4RB1 A;  2DFI A;  1PP8 F;  4HX4 A;  4MEY F;  3RIR A;  2A07 F;  2D2W A;  2K02 A;  1B1B A;  2GA1 A;  1O7L A;  4AVP A;  4WF2 A;  4N9H A;  5DCM A;  4RGS A;  4H0E A;  5D8K B;  2ADU A;  2YPR A;  4LK0 F;  2BE5 F;  2HTS A;  4N9I A;  5CVU A;  1XDS A;  2ISY A;  2Y0M A;  5D5W B;  1WQ2 A;  1OMI A;  2KJB A;  1P6R A;  1QQI A;  3IL2 A;  3E6M A;  2KKO A;  5H6R A;  4NQW A;  4K2E A;  1I1G A;  4BNC A;  3C18 A;  1J7K A;  1B9N A;  1SD4 A;  3S2W A;  1W7P A;  4LB5 A;  5LGT A;  1JXS A;  3GFJ A;  5FD6 A;  1F4K A;  4BHB A;  4WXC A;  5AIQ A;  1SFU A;  1FBQ A;  4BXU A;  1S7A A;  2D45 A;  5L3B A;  2NNN A;  2E7X A;  3HRT A;  2Z9O A;  1WWX A;  4HQE A;  3LA3 A;  1ZLK A;  5HLI A;  1ODD A;  1XSD A;  2PMU A;  2XAG A;  5D5X B;  1CF7 B;  3GUD A;  5LGU A;  2GIV A;  4FHT A;  4BQA A;  3DEU A;  2RNJ A;  2ZNZ A;  4MNU A;  1J9I A;  3PQJ A;  3Q9S A;  4IRH A;  3GFI A;  1S29 A;  2NNY A;  1QBJ A;  4IHS A;  4F7Z A;  1R1T A;  4GGG A;  5AON A;  2D1H A;  2JT1 A;  1UCR A;  3ULQ B;  1T0F A;  3FHZ A;  1OYY A;  3LQQ A;  4U0V A;  1XMA A;  3FMQ A;  1Y0U A;  1Z05 A;  2JPB A;  5DV5 A;  5ICE A;  1B9M A;  2OA4 A;  2F5E A;  3M7G A;  2EFN A;  3F22 A;  1STZ A;  5L3D A;  4BHP A;  1FP2 A;  1U2W A;  2KIU A;  5DDG A;  2KIF A;  3K0L A;  4ON0 A;  4KYW A;  4HW0 A;  2O0Y A;  2MH9 A;  1QZY A;  5FLX Z;  2KJC A;  3IRQ A;  3CUQ A;  2BV6 A;  1E17 A;  1BBY A;  1IXS B;  4LK1 F;  2QBY B;  3U9G A;  1UHM A;  3D5L A;  4KMF A;  3VOD A;  1MDM A;  3DPT A;  3TO9 A;  3KE2 A;  3KP7 A;  4MQ9 F;  1FP1 D;  2EV5 A;  2VBW A;  2IRF G;  5HOO A;  1B59 A;  4LJZ F;  4I2O A;  2CYY A;  3QRF F;  2BEO A;  2P6T A;  1QO0 D;  4L9J A;  1IZ1 A;  3WTY C;  3I58 A;  3JW4 A;  3DV8 A;  3I64 A;  1UHW A;  3FMS A;  3CJN A;  5CVR A;  2PI0 A;  3ISP A;  1L0O C;  1ZHF A;  4ZYG A;  2MC3 A;  2O8X A;  5CYV A;  2CWE A;  2HTJ A;  4RB0 A;  4L0Y B;  3L2C A;  1IW7 F;  2DAO A;  2HDC A;  2EK5 A;  2XUB A;  2XGX A;  2DBB A;  2RN7 A;  4NB5 A;  3CO6 C;  1I5Z A;  1ON1 A;  3I59 A;  3MFK A;  4U7B A;  4KMU X;  5ED4 A;  1IRF A;  3R4K A;  2YR2 A;  1F1Z A;  3GW2 A;  2STW A;  2ZKZ A;  3BPV A;  4LD5 A;  3TO6 A;  5K5O A;  1XGS A;  1FZP B;  2DT5 A;  3BWG A;  4ENM A;  1G4D A;  3FXQ A;  2Z33 A;  2RGV A;  1Z6R A;  4PGH A;  3N4M A;  2FML A;  1HW2 A;  4A5N A;  1ZH5 A;  4CIC A;  2K4J A;  4BAY A;  1BJA A;  3RDI A;  3DFG A;  3KLO A;  3MEX A;  4HZF A;  3GWZ A;  3GZ6 A;  2LF7 A;  5HLH A;  2A68 F;  2HYF A;  4WXD A;  3FXU A;  3RKX A;  3KET A;  4EJU A;  1GVJ A;  3R0J A;  2EFW A;  4MGR A;  1BIA A;  4A12 A;  4L9V A;  1XGN A;  3KP2 A;  3BJ6 A;  3FWE A;  3SQN A;  4G7Z F;  1BOA A;  3V8L A;  1JHH A;  4I0B A;  1YO5 C;  2EV0 A;  5H6Q A;  3QPT A;  2LKP A;  1IN5 A;  3G3Z A;  3LA2 A;  3HTS B;  4ENN A;  3EQL F;  4R8H A;  3JAM K;  2NYX A;  1KQ9 A;  3KCC A;  2OU2 A;  2ZFW A;  3IRR A;  5LEK A;  4XLP F;  4GYG A;  4YII A;  2H09 A;  1KYZ A;  4MEX F;  2DK8 A;  1REP C;  5LRR A;  3L09 A;  4G94 A;  2CGP A;  4P9U A;  1VTN C;  4Q4Z F;  1G3S A;  2AS5 F;  1U5T B;  4ZYE A;  3PFI A;  2FOK A;  1R5H A;  4P9F A;  1D8J A;  1U3E M;  3E5X A;  3TGN A;  1IUY A;  3BJO A;  1YG2 A;  2GAU A;  2LF8 A;  1TQM A;  2HQR A;  1MGT A;  3KZY A;  4EV0 A;  2HYG D;  3V7S A;  3H3Z A;  2VT3 A;  3EUH A;  1WKM A;  2QWW A;  5CVJ A;  3GLX A;  1Z1D A;  2LNB A;  3P7N A;  4A0X A;  3CUQ C;  1FBS A;  1HKS A;  3RYR A;  1SMT A;  4G6D A;  4ZH4 F;  5EEG A;  3RPU A;  2BGC A;  2ACJ A;  3I71 A;  1BI2 A;  5E1W A;  2E1C A;  3R61 A;  4KN4 X;  2ZXJ A;  1E2X A;  1TNS A;  1R5G A;  1CGP A;  3K1N A;  1W7P D;  1ZG3 A;  5HDG A;  1LDJ A;  3HSR A;  1RZ4 A;  3ROU A;  4G7O F;  1TTY A;  4LG0 A;  2FQ3 A;  3V8J A;  4RGR A;  3BPX A;  4I7H A;  5DCF A;  4G9Y A;  5IT3 A;  3V8K A;  5FB2 A;  2R7F A;  2EV6 A;  5D4S A;  3MQ0 A;  2A6E F;  6PAX A;  4Y17 A;  1MKM A;  1P4X A;  2CSO A;  2W25 A;  1K78 B;  1R1U A;  2EFP A;  3HSE A;  2MA3 A;  1T98 A;  2HEO A;  2D1V A;  1NHA A;  4HDV A;  3FM3 A;  2HGC A;  5HVQ C;  4P96 A;  1O3R A;  2RVC A;  4GYI A;  2HWV A;  2P5V A;  1HSJ A;  3BZ6 A;  4RAY A;  4KIC A;  1H9G A;  3WTS C;  5K5Q A;  3GYH X;  3P9C A;  2M5W A;  1R1V A;  5KK1 A;  4G8X A;  2EA2 A;  2CW0 F;  4YFX F;  1Z9C A;  4A6D A;  3IHU A;  1J5Y A;  1U6G A;  1YLF A;  3SZP A;  1UB9 A;  4N0B A;  2JZY A;  1JE8 A;  4OU0 A;  1MJ9 A;  3TDZ C;  1FOK A;  1HW1 A;  1KQ0 A;  1Q1H A;  2VXZ A;  3ZP5 A;  1FYK A;  3E5U A;  1QNT A;  2FBK A;  1B6A A;  3J7A O;  1G3T A;  2VON A;  4KA4 A;  2MH2 A;  3KEO A;  5F1R A;  1BI1 A;  3GEZ A;  3HRM A;  3REO A;  2P6S A;  2L02 A;  2G7H A;  4IRI A;  4HLY A;  1TQP A;  1KU2 A;  2H94 A;  1G3Y A;  4JBA A;  3R0A A;  4ZYH A;  2DW4 A;  1P2F A;  3ZMU A;  3IKV A;  1FYL A;  4LFU A;  1DPR A;  1PUE E;  3GXO A;  2QVO A;  4YG2 F;  1IF1 A;  2QQA A;  2XV4 S;  3FM5 A;  3ECH A;  2W85 A;  2GWR A;  4M74 A;  2XKP A;  5DCM B;  2QZ8 A;  1AWC A;  1YS7 A;  2JRT A;  5H20 A;  2JTV A;  2DPU A;  2XAJ A;  1HXD A;  3B02 A;  3L7W A;  4KFC A;  1PDN C;  2R7D A;  3E97 A;  3C7J A;  1USS A;  3PQK A;  4A5M A;  3QU3 A;  2ZME B;  4HOB A;  3LFK A;  3TOA A;  4OMY A;  4AIJ A;  5F6F A;  3F6O A;  2V1X A;  3HHH A;  1K6O A;  3GZ5 A;  5CVV A;  3F8F A;  3I53 A;  4JK1 X;  1OPC A;  1S7O A;  5LHG A;  3HTU A;  1SMY F;  1BC7 C;  1MJA A;  3QU6 A;  4CHU A;  1I6X A;  3DP7 A;  3MZH A;  2VE8 A;  3QP5 A;  1IN7 A;  4OIR F;  1R22 A;  3M8E A;  3DPL C;  3HSF A;  2NS0 A;  4ESJ A;  5E17 F;  3F23 A;  4AWX B;  3QPH A;  4PDK A;  3MZY A;  2DLL A;  1XMK A;  1FY7 A;  4OIP F;  1FLI A;  1J0R A;  3V4G A;  5BPI A;  3QAH A;  2FXA A;  2NRA C;  2VE9 A;  4XSX F;  2PG4 A;  3RKW A;  5E8G A;  2XAS A;  5A2Q Z;  2QBY A;  3SHF A;  1RIO H;  5D6F A;  3T5X A;  1TNT A;  1EV7 A;  3E6D A;  1DP7 P;  2DQR A;  2VT2 A;  3HRS A;  5D6E A;  1HST A;  1ZG5 A;  2G7U A;  4HX7 A;  4DNC A;  2IPQ X;  1T6S A;  3TKY A;  3KLN A;  5E18 F;  2V6C A;  3ZN0 A;  2AXL A;  2FBH A;  2HR3 A;  4UV8 A;  2VC1 A;  5D8L B;  3E5Q A;  1DPU A;  4M9Z A;  2Q0O A;  2UWM A;  2O61 A;  3FX3 A;  1UFM A;  1LVA A;  4KIF A;  5HLG A;  3K2Z A;  2IJL A;  3VEP A;  4Y15 A;  3F21 A;  4OIN F;  4KNY A;  2XAQ A;  4M9X A;  5L3G A;  4M72 A;  3ML6 A;  1LEB A;  3C1D A;  5E20 A;  2P5L C;  3F6V A;  3LAP A;  4QLC U;  5IT9 Z;  2WV0 A;  3BY6 A;  5JVT A;  3KP6 A;  1MDM B;  4UVA A;  1ZGJ A;  5A2Q K;  3FXR A;  4ESF A;  4LLN A;  3WU1 B;  5HS9 A;  2IT0 A;  1BM9 A;  1SFE A;  2F5D A;  1D8K A;  4B09 A;  3HYI A;  1KQ8 A;  4ENJ A;  3GFL A;  5FFZ A;  4ZZD A;  3WTV C;  4M9S A;  4EJO A;  3JAM Z;  4OIQ F;  3FZV A;  2L4M A;  1P92 A;  4WX9 A;  1JHF A;  4OOI A;  2K4B A;  3SFZ A;  3GO5 A;  3LST A;  3K1P A;  3HIF A;  2FEZ A;  4LGW A;  3HHG A;  2Z3Y A;  2O03 A;  1GHC A;  2FU4 A;  4HF0 A;  1R36 A;  2H27 A;  1LEA A;  1YIO A;  2W84 A;  2Q8K A;  2H6B A;  4P5O A;  4IPA A;  3ELK A;  2W24 A;  4NHJ A;  2QEN A;  2O3F A;  1RUO A;  3OOP A;  4ZYD A;  2TDX A;  2VC0 A;  3CDH A;  2CQK A;  5IT9 K;  3F8N A;  4U88 A;  5ERI A;  1OYW A;  2P7V B;  3H3U A;  5DD8 A;  2DTR A;  2YX4 A;  4HF1 A;  3HOS A;  3LWF A;  5LEJ A;  3TOB A;  1YW8 A;  2OAZ A;  5FD5 A;  4O3M A;  2P4W A;  3WGG A;  1ZRF A;  2DU9 A;  4FX0 A;  1QPM A;  1QZZ A;  2L54 A;  5AIP A;  2GZW A;  4HA8 A;  2QM3 A;  3E3V A;  1U5T A;  4YFN F;  4EGY A;  1I1S A;  4UHT A;  1Z91 A;  5E8I A;  1HKT A;  1ZGA A;  4Q48 A;  1B4A A;  5D5V B;  5E1Z B;  3IWZ A;  3P9I A;  4MQV A;  5LBQ A;  3BJA A;  3ZN1 A;  4HX8 A;  1UST A;  2STT A;  4KDP A;  4ENK A;  1FSE A;  1YS6 A;  1O3S A;  5BS6 A;  3KFW X;  1YFH A;  1FWZ A;  2PEX A;  5E1X A;  2UXN A;  2OBP A;  2RC4 A;  1HW5 A;  3JTH A;  3K1M A;  4RGX A;  4UNO A;  1BC8 C;  1HQC A;  5FGM A;  4EM2 A;  4HV5 A;  2P5K A;  2OQR A;  4CYD A;  3LAJ A;  4FT8 A;  2P8T A;  2G9W A;  2A5Y B;  4EQQ A;  3F8M A;  4I98 B;  1FYM A;  2GA2 A;  5LHH A;  4TV7 A;  3CTA A;  3SXY A;  3ERE D;  2LSO A;  1LDK B;  4KT5 C;  2XKO A;  3MAJ A;  3ABU A;  1R00 A;  4RB3 C;  3R6S A;  2FE3 A;  2VOD A;  3RPQ A;  1RNL A;  4QWQ A;  2EFO A;  1ON2 A;  1H9T A;  4HAM A;  2H6C A;  1KU9 A;  2MLK A;  4GXO A;  4L9N A;  4HV6 A;  4FX4 A;  3E6B A;  3EDP A;  2UZK A;  3ZMD A;  1ZAR A;  2K7L A;  3DQV C;  4CO8 A;  4UVB A;  1J2X A;  4A2U A;  1EH7 A;  1TW2 A;  4RB2 C;  1R23 A;  4G6Q A;  2HKX A;  1H0M A;  3MCZ A;  1XN7 A;  2KIM A;  1C0W A;  1TBX A;  1HKQ A;  2COM A;  3SZT A;  1ZRC A;  1MJB A;  3GF2 A;  1FNN A;  1FT9 A;  3M1E A;  4LLG F;  1SD5 A;  2A6H F;  3F8B A;  5ILU A;  1K7A A;  5J8C A;  3WGI A;  2HFH A;  2MLG A;  2XRN A;  1IN6 A;  3J80 K;  3EET A;  3WTX C;  1IN4 A;  1DDN A;  2EJR A;  3FMR A;  4AD9 A;  2XVC A;  2HKO A;  5D4R A;  5ICG A;  2NAZ A;  3KZZ A;  1KYW A;  4M6X A;  4EMS A;  2RV8 A;  2M30 A;  2VBZ A;  2GXB A;  2HOE A;  2V79 A;  2XIG A;  3D0S A;  1YTY A;  4UXN A;  1EH8 A;  4M73 A;  4ZZL A;  3G73 A;  4MTE A;  5JR3 A;  4EJV A;  3VFZ A;  2L4A A;  3WE3 A;  4LB6 B;  2BYV E;  1SD6 A;  1U5T C;  2BBY A;  3LA7 A;  1OKR A;  4CDG A;  3IWF A;  2IW5 A;  2CG4 A;  5JI6 A;  1L3L A;  5K5R A;  5DUI A;  3KP3 A;  3IKT A;  4G7H F;  1CF7 A;  2V1U A;  3N97 A;  4PZJ A;  2ZME A;  4U0Y A;  3M9A A;  1O3Q A;  4XRF A;  3U2R A;  4WWC A;  3T8T A;  3JSO A;  1S3J A;  2PN6 A;  4Y13 A;  3TO7 A;  3GVA A;  4AIK A;  2Y48 A;  2MBF A;  5FFX A;  1WSU A;  1W7P B;  2E1N A;  2K27 A;  3W6K B;  3QP6 A;  3VB2 A;  2XAH A;  5EEH A;  4HLX A;  2ZCW A;  4S04 A;  2FNA A;  4S05 A;  3BRO A;  2Z5U A;  5CJ9 A;  2CO5 A;  3O3K A;  4A6E A;  3WTW C;  2ISZ A;  2FNP A;  4KN7 X;  3KEQ A;  5JFR A;  4MHG A;  1W5T A;  2M45 A;  3WGH A;  1ZRD A;  5HDK A;  4GO1 A;  3V7R A;  2JPC A;  2OZU A;  1SAX A;  2QUF A;  4M71 A;  2Q2E A;  4EM1 A;  3R60 A;  1V4R A;  3J81 Z;  3HRU A;  3F72 A;  4Q5S F;  3O2P E;  1OR7 A;  4CZZ A;  4L18 B;  3DXJ F;  4IVN A;  3T8R A;  3ZMV A;  2MD5 A;  2HQN A;  3RI4 A;  2ETH A;  1TQI A;  1W5S A;  2X0L A;  4L0Z B;  1LB2 A;  2EA4 A;  3VOE A;  5DD4 A;  4WK8 F;  4OMZ A;  1XD7 A;  5BOX A;  2OZ6 A;  2YSR A;  3NQO A;  4BHC A;  2E7W A;  1LJ9 A;  2XAF A;  2PBI A;  2XRO A;  3GFM A;  1KA8 A;  2ZO4 A;  4BH9 A;  3OV8 A;  2RQP A;  3WOD F;  4MTD A;  1IAW A;  2PFB A;  1D3Y A;  5HDN A;  1LQ1 A;  4HQM A;  1YYV A;  2A61 A;  3CUQ B;  5CVI A;  5L3E A;  2DK5 A;  2GQQ A;  5ICC A;  1IXR C;  3ZMS A;  3J81 K;  4A0Y A;  3EYI A;  4RGU A;  4LMY A;  3MWM A;  4L5I A;  2M8E A;  1D5V A;  1J75 A;  2HZT A;  1P4W A;  1U78 A;  3I54 A;  1G3W A;  4ESB A;  4Q47 A;  2FSW A;  3QOP A;  3GX4 X;  1LNW A;  4JQF A;  4P55 A;  4PCQ A;  2LDU A;  2F5F A;  2L01 A;  1BN5 A;  1K79 A;  2A3S A;  4HYE A;  3ZMT A;  1ONV A;  2YX7 A;  1IN8 A;  2CFX A;  3ECO A;  1YW7 A;  2WTE A;  4O5V A;  5TRD A;  2DQL A;  2VOP A;  4YFK F;  5FLX K;  4IXA A;  4HF2 A;  1IXC A;  1Z7U A;  2P7C B;  4LLL A;  4OIO F;  2A69 F;  1A04 A;  4R79 A;  3BP8 A;  2HS5 A;  3F8C A;  3B73 A;  2RKH A;  1R58 A;  4I0A A;  1U8R A;  4E70 A;  3RJP A;  1P4A A;  2QQ9 A;  3V7C A;  4KUM A;  1TW3 A;  2VBX A;  3RYP A;  3I59 B;  3I0T A;  4B8X A;  4HBL A;  2J5P A;  2EWN A;  4IHT A;  3W6J B;  4XSZ F;  3WU0 A;  2GXG A;  3ZMZ A;  3BOQ A;  1ZAO A;  1O57 A;  1RUN A;  3ABT A;  2ELH A;  5ILS A;  4CXF A;  1O7F A;  2XHK A;  2X4H A;  2PLY A;  4RS8 A;  3P9K A;  1KU7 A;  2F5C A;  4Z2Y A;  2PJP A;  1QGP A;  2JSC A;  5BMZ A;  3RTR A;  3LQR A;  1FX7 A;  5L3F A;  1I27 A;  3BDD A;  1DUX C;  3F3X A;  1T2K A;  2W57 A;  1XSX A;  1XCV A;  2L3D A;  4UVC A;  4ETS A;  1FSH A;  4PGG A;  1W4M A;  5JHU A;  1ULY A;  5LGN A;  3TDU C;  5ILV A;  3CO7 C;  4DQ2 A;  5LHI A; 
#chains in the Genus database with same CATH topology
 2OD5 A;  2R7U A;  4UB8 C;  3I5U A;  4YIR X;  2W7N A;  2KIQ A;  1G6N A;  1SD7 A;  3FIW A;  1XGM A;  2CJJ A;  3NEU A;  1ZYR F;  1VFC A;  1RRJ A;  3KP5 A;  2HVR A;  2X6O A;  2QQB A;  5EDN A;  1XCB A;  4XON A;  4EVI A;  2DMT A;  4KIG A;  3M8F A;  5LLQ A;  1KGS A;  3OYH A;  2E2J J;  2DN0 A;  1A31 A;  1X4O A;  3T0Y A;  1YQA A;  3BZC A;  3BR6 A;  4U7D A;  2WV1 A;  4F55 A;  3EYY A;  4R1H A;  4II3 A;  1NK2 P;  5F0H A;  4KIS A;  1GXQ A;  3DCF A;  1GXP A;  2PMH A;  3L1P A;  1WJD A;  2DXI A;  2Y9Z A;  1VQN I;  2FBI A;  2N8G A;  5L3C A;  3CLO A;  2LVS A;  1F36 A;  3L2U A;  4NUB A;  3HOT A;  1FBU A;  5J8F A;  1S7E A;  3I4P A;  1OR7 C;  2E1O A;  2LY1 A;  2PQ8 A;  4GCV A;  5DYM A;  1KU3 A;  3RKQ A;  2KRF A;  4Y4R A;  5HS8 A;  2VPL A;  2EB7 A;  2JRM A;  2RDP A;  1W0T A;  2JUG A;  4IJA A;  2CS3 A;  2V1D A;  3CME I;  3H9J A;  3O6B B;  5M5W J;  2MW8 A;  1JGS A;  3H36 A;  5IOY A;  5F1J A;  2XSD C;  3K70 C;  5BPD A;  4YIF A;  4RMN A;  2G0E A;  3M3Y J;  2DA2 A;  3HOZ J;  2E1M C;  2K3P A;  2M1B A;  4XBF A;  3CUO A;  3HB9 A;  1MD0 A;  1GT0 C;  2QYO A;  4UV9 A;  2M87 A;  1YW9 A;  5FO5 A;  4YRV A;  3DF8 A;  3U21 A;  4DJA A;  5BNG A;  3VYT B;  3WG9 A;  3E6C C;  4IHV A;  3EPZ A;  2DO7 A;  3VWB A;  2KQR A;  4WXH A;  5IOZ A;  5E3M A;  2DDB A;  3PFY A;  2PJR A;  2VJ4 A;  5LRS A;  1VQ5 I;  2WWY A;  4RAZ A;  5J1U A;  5GPA A;  1IV6 A;  2VN2 A;  5EYR A;  1JT0 A;  2DA7 A;  2UXX A;  4AID A;  1XSV A;  4FQG A;  3RKY A;  3ZPL A;  5HS7 A;  2V4J C;  2ESN A;  1D1C A;  4IO9 F;  4I02 A;  2IA0 A;  2O8K A;  3G1M A;  4F91 B;  5EGO A;  3S15 J;  3SEQ A;  3K4K A;  3BR2 A;  4A0Z A;  1X3Z B;  1KON A;  2CQX A;  3CC2 I;  3HOY J;  2Z99 A;  1XDU A;  2O6G E;  5BQT A;  1ZN2 A;  5J1R A;  1YI2 I;  1PP7 U;  3PO3 J;  1MZB A;  2R7W A;  2DOF A;  2M7A A;  1WRJ A;  2IGO A;  3J80 Z;  1ERD A;  1MBH A;  4E7L A;  1OFC X;  1ZQ3 P;  3W2A A;  2VBY A;  4UUV A;  5KCM A;  1T38 A;  3FF5 A;  5TJJ A;  1O3T A;  4IQ4 A;  2F2E A;  1TLH B;  2IVM A;  2LLK A;  1FC3 A;  2J5O A;  1XGO A;  1RKT A;  5D5U B;  4XRS G;  2ZNY A;  3AAF A;  4RAF A;  2QSG X;  3L9F A;  1K78 A;  2EFQ A;  4FIS A;  4I01 A;  1Z6T A;  1BIB A;  3Q5F A;  2HVS A;  2XPU A;  1J59 A;  1RI7 A;  4D5F A;  1MBG A;  3K9T A;  4U0W A;  3JTG A;  1F9N A;  4D7M A;  3K2A A;  3NAU A;  5KNL A;  2DPD A;  2DYR H;  4JOM A;  3JSP A;  2Y75 A;  4IF4 A;  5FRN A;  2E34 A;  5B1B H;  2YUS A;  2HVQ A;  1Q1V A;  3C3W A;  3DKX A;  1TL8 A;  4XM3 A;  2VOO A;  4A3C J;  2CUJ A;  2ZBK A;  4FTH A;  2NXN B;  3L00 A;  5KVR A;  2YU3 A;  4L5J A;  1S8N A;  1ZLJ A;  2BW3 A;  2CRG A;  4BQO A;  2R3S A;  1JJ6 C;  2ECB A;  2IA2 A;  3KP4 A;  3NRV A;  2OQG A;  4IEJ A;  5DUK A;  4LG0 B;  1OLT A;  3V42 A;  3Q9V A;  3I9V 2;  3JR9 A;  1SFX A;  1F5T A;  1HLV A;  1BI0 A;  2M9H A;  1JI8 A;  3IC7 A;  5FKK A;  2ZJ2 A;  1S6L A;  1FPQ A;  1XB4 A;  3LSG A;  4BQN A;  3WE2 A;  2JA5 J;  4O6J A;  2C6Y A;  3NAR A;  1HBX G;  1V3F A;  2DI3 A;  2B0L A;  1Y8R B;  2HDD A;  3ZR8 X;  2FA5 A;  3SZG A;  5CLS A;  1MNE A;  3HUG A;  5K1Y A;  3H1C A;  3DKW A;  4EJT A;  4EM0 B;  3BG9 A;  1T39 A;  4L9T A;  3DBR B;  2VQC A;  1DGW Y;  3WTT C;  1X3U A;  1HOM A;  3LOC A;  4BYY A;  1JKO C;  1ETY A;  1R7J A;  2KZG A;  4KIB A;  2DMN A;  3G71 I;  1BA5 A;  4ABZ A;  2V9V A;  2JA2 A;  4HDU A;  3T1B A;  2DFF A;  1F43 A;  2OJE D;  3UNG C;  1JGG A;  1OYI A;  2K86 A;  3WTU C;  3COA C;  1OCR H;  2EQR A;  2K9N A;  1EH6 A;  2WC2 A;  4IRG A;  1LDD A;  3TQN A;  3CJT B;  3OYK A;  4EGZ A;  1HF0 A;  2ESH A;  2GLO A;  4I09 A;  1Y56 A;  2A05 A;  3IV5 A;  2IP2 A;  2IA1 A;  3H5R A;  1Y8Q B;  5DS9 A;  3DTK A;  3MD2 A;  2DYS H;  4ASN A;  4XLN F;  2FMY A;  3IUO A;  2X9D A;  4CA0 A;  5DM7 F;  2QLZ A;  4XLF A;  3GTJ J;  3GTG J;  1IRG A;  4M6Y A;  2FF4 A;  1R5I D;  5DEQ A;  3U1D A;  5ICF A;  2VKH A;  4PSW A;  2LR8 A;  5F64 A;  1WI9 A;  3BR5 A;  1UMQ A;  1JKP C;  4CGZ A;  3ZQ7 A;  4EJW A;  4D0P A;  2FRH A;  2KHM A;  2IAI A;  3K69 A;  1AOY A;  4AIH A;  1ZRE A;  1VQO I;  3WTZ A;  2LFB A;  4F92 B;  1BI3 A;  4X0G A;  2IS2 A;  1T33 A;  2HU9 A;  3H92 A;  5J6X A;  1ZG1 A;  4RB1 A;  4BAC A;  4ZTF A;  2DFI A;  1O4X A;  1PP8 F;  4HX4 A;  4MEY F;  3RIR A;  2A07 F;  2D2W A;  2XAU A;  2K02 A;  3B6C A;  1B1B A;  2GA1 A;  3K4J A;  5F0F A;  4BXX J;  1O7L A;  3BG7 A;  1HDD C;  1SVM A;  4AVP A;  3S1Q J;  2W00 A;  3CMM A;  3ZQQ A;  3CC7 I;  1MIJ A;  4WF2 A;  2R5Z B;  4XR6 A;  1D1A A;  5IYB J;  4N9H A;  4XN0 A;  5DCM A;  4RGS A;  3CCL I;  4DBQ A;  4H0E A;  5D8K B;  2ADU A;  2YPR A;  4LK0 F;  2ZJR F;  4AM3 A;  2BE5 F;  2HTS A;  4MLO A;  4LIU A;  4N9I A;  5CVU A;  1XDS A;  3EUK L;  2ISY A;  2Y0M A;  5D5W B;  2X6Y A;  3OYD A;  1QHH D;  2R7O A;  1WQ2 A;  1OMI A;  1WJF A;  2X6W A;  2KJB A;  1P6R A;  1QQI A;  1WVR A;  3IL2 A;  3E6M A;  2R93 J;  3TP3 A;  4M3B A;  1A5J A;  4I99 C;  2KKO A;  5H6R A;  1ZR4 A;  4NQW A;  4K2E A;  2R7Q A;  1I1G A;  2PMZ N;  3X2Q H;  4BNC A;  3C18 A;  5C4X J;  3S93 A;  2KZV A;  1J7K A;  1B9N A;  1SD4 A;  3S2W A;  1W7P A;  4LB5 A;  5LGT A;  1JXS A;  3GFJ A;  5FD6 A;  1F4K A;  2MG4 A;  4BHB A;  4WXC A;  3CMY A;  3A2K A;  2VXD A;  5AIQ A;  1SFU A;  4PK4 A;  2Y30 A;  2JN6 A;  1FBQ A;  2NOJ B;  1QZE A;  1AKH A;  4CCK A;  4BXU A;  1S7A A;  1X1P A;  2D45 A;  5L3B A;  2NNN A;  4XKW A;  2E7X A;  3HRT A;  2Z9O A;  2QQ8 A;  1WWX A;  4I6Z A;  4XOT A;  4HQE A;  1XPX A;  3LA3 A;  1Z67 A;  1ZLK A;  3HM5 A;  2MC4 A;  3SFI A;  5E3N A;  5HLI A;  1ODD A;  1XSD A;  3S8P A;  2PMU A;  1IDY A;  2XAG A;  4C3I J;  3IP4 B;  1XTA A;  5D5X B;  1NTC A;  2F4O B;  1CF7 B;  3GUD A;  1MW7 A;  2ID6 A;  2GIV A;  4B44 A;  5LGU A;  4FHT A;  3HOX J;  1N77 A;  3A03 A;  1WPK A;  4A3E J;  3MMY B;  2RNG A;  4XMY A;  3DEU A;  4BQA A;  2RNJ A;  2ZNZ A;  4MNU A;  1J9I A;  2M0C A;  3PQJ A;  3Q9S A;  4IRH A;  3GFI A;  1S29 A;  2DT6 A;  2CW7 A;  2NNY A;  2P81 A;  1KZH A;  2BY3 A;  1QBJ A;  4BL0 B;  4IHS A;  4F7Z A;  1BJZ A;  1R1T A;  4GGG A;  1DU6 A;  2WB1 A;  5AON A;  3LL7 A;  2D1H A;  2JT1 A;  4BJ5 C;  1UCR A;  4BEH A;  3ULQ B;  1T0F A;  1X1D A;  3FHZ A;  1OYY A;  3FBN B;  3LQQ A;  4U0V A;  5JVG F;  1ZR2 A;  5F08 A;  2NS8 A;  2EH3 A;  2NVU B;  2R7X A;  3CCR I;  2KT0 A;  1XMA A;  2WAE A;  3FMQ A;  4G12 A;  2ZXW H;  2MSY A;  1Y0U A;  1Z7L A;  3CZ6 A;  1Z05 A;  3ZOB A;  3GTK J;  2XF6 A;  2JPB A;  3AL0 C;  5DV5 A;  5ICE A;  1DQU A;  2L0K A;  1B9M A;  2OA4 A;  2F5E A;  3M7G A;  2EFN A;  5GTI C;  3F22 A;  1STZ A;  5L3D A;  4BHP A;  2V9K A;  1HDP A;  2EZH A;  1TWG J;  1FP2 A;  2JMW A;  1U2W A;  2KIU A;  2COB A;  2BOL A;  2WY7 Q;  5DDG A;  2KIF A;  3PNV A;  3K7A J;  1MMN A;  2HPI A;  1BL0 A;  3K0L A;  2CH0 A;  1R71 A;  3BR3 A;  4ON0 A;  4HW0 A;  4KYW A;  4BJ6 C;  2O0Y A;  3PIP F;  2MH9 A;  1QZY A;  3CQZ J;  5FLX Z;  2HYJ A;  2L5Q A;  2KJC A;  4HRI A;  3IRQ A;  3CUQ A;  2BV6 A;  1E17 A;  2FUG 2;  3QPS A;  1BBY A;  1IXS B;  3H5A A;  4LK1 F;  4QTR A;  3S1N J;  2QBY B;  4RLQ A;  3C2G A;  3U9G A;  3HGY A;  3BG3 A;  3UKG A;  1MH4 A;  2QSH X;  2ZXH A;  2ME6 A;  5FKL A;  1UHM A;  1FEX A;  2IS1 A;  2IBD A;  1DP3 A;  3ZQF A;  2M4G A;  3D5L A;  1BOB A;  3L2W A;  1LFU P;  2JQ7 A;  4KMF A;  3VOD A;  1MDM A;  3DPT A;  3TO9 A;  3HG9 A;  3KE2 A;  3KP7 A;  3NWS A;  4A3K J;  4MQ9 F;  1OCZ H;  1FP1 D;  5IP9 J;  2UV1 A;  2EV5 A;  2VBW A;  2IRF G;  5HOO A;  1B59 A;  4LJZ F;  4PJL A;  4I2O A;  1VQP I;  2CYY A;  1YJW I;  3QRF F;  1N25 A;  2BEO A;  4QSH A;  2P6T A;  1QO0 D;  4L9J A;  1IZ1 A;  3WTY C;  1WJE A;  5K7Z A;  2B63 J;  4BUP A;  3I58 A;  5F27 A;  3JW4 A;  3DV8 A;  1A6I A;  3I64 A;  1VQ4 I;  1UHW A;  3FMS A;  3CJN A;  3BTL A;  2OUM A;  3JRA A;  1U9N A;  2K5C A;  5CVR A;  2PI0 A;  3ISP A;  1L0O C;  5CQE A;  1VQ6 I;  3I4N J;  3DLL F;  1MBJ A;  1WGX A;  2VIX A;  3OIP A;  1VQ9 I;  1ZHF A;  4ZYG A;  2MC3 A;  2O8X A;  5CYV A;  4EEF G;  1S9H A;  5EG0 A;  1PVE A;  2BZT A;  2CWE A;  2HTJ A;  4RB0 A;  4L0Y B;  3ASN H;  3L2C A;  4A3B J;  3OWT A;  1IW7 F;  2A6T A;  2DAO A;  2HDC A;  2EK5 A;  2XUB A;  1Y39 A;  2CQ7 A;  1MMA A;  2WAD A;  3PJR A;  1X2N A;  2XGX A;  2ZC2 A;  3QQA A;  2DBB A;  2RN7 A;  4NB5 A;  4B3A A;  1ZKG A;  3CO6 C;  1I5Z A;  1ON1 A;  4DBR A;  3I59 A;  3LSK A;  3CCM I;  3MFK A;  2OPT A;  3S1M J;  1ACI A;  4U7B A;  2M0M A;  2JSP A;  2V6E A;  4KMU X;  5ED4 A;  1IRF A;  1LE8 B;  9ANT A;  3R4K A;  3VYS B;  2YR2 A;  1F1Z A;  3GW2 A;  2STW A;  2KIS A;  1FOW A;  2ZKZ A;  2WAQ A;  1G59 A;  3BPV A;  3FXK A;  4LD5 A;  3I3L A;  4U87 A;  2EPF A;  3M4O J;  5EF6 A;  3TO6 A;  5K5O A;  1IC8 A;  1XGS A;  3Q0U A;  1FZP B;  4ZDP A;  2DT5 A;  3BWG A;  4ENM A;  4XOR A;  1G4D A;  3FXQ A;  3ZXS A;  3FXJ A;  2Z33 A;  2RGV A;  1YRN B;  3LSJ A;  1Z6R A;  3DKY A;  4PGH A;  3N4M A;  2FML A;  1HW2 A;  4A5N A;  2QEX I;  2LG4 A;  1ZH5 A;  4CIC A;  2K4J A;  4IOA F;  4BAY A;  1BJA A;  3RDI A;  1D1B A;  3FXL A;  3OS1 A;  3DFG A;  3S3O A;  3KLO A;  3GTQ J;  1OCT C;  3MEX A;  4HZF A;  3GWZ A;  3GZ6 A;  2LF7 A;  3CES A;  5HLH A;  2A68 F;  3DPU A;  2HYF A;  4WXD A;  3FXU A;  3RKX A;  3KET A;  4EJU A;  1X1A A;  1GVJ A;  5JLX A;  5FKO A;  3R0J A;  2EFW A;  1FMW A;  4MGR A;  1BIA A;  3JRC A;  5GAH J;  2DA6 A;  2F6C A;  1JJ8 C;  4A12 A;  5GP9 A;  1VQM I;  2KP6 A;  4BDZ A;  1QPI A;  4L9V A;  1DGR M;  2R5Y B;  3VPR A;  2Y2Z A;  3WU2 C;  1XGN A;  3KP2 A;  3BJ6 A;  3FWE A;  3SQN A;  3MZ8 A;  4G7Z F;  1BOA A;  3V8L A;  1JHH A;  4I0B A;  3CCQ I;  2DA5 A;  2Y31 A;  3L2V A;  2XGC A;  2DA4 A;  1YO5 C;  3OYE A;  1OQY A;  2EV0 A;  4C3J J;  5H6Q A;  3HPG A;  1MH3 A;  2LKP A;  3QPT A;  1IN5 A;  2IGN A;  3G3Z A;  2PX9 A;  2E35 A;  2W48 A;  3LA2 A;  3H0G J;  3PSI A;  3OYJ A;  4ENN A;  1W36 C;  4N4N B;  1POG A;  3EQL F;  1MMD A;  1ENH A;  4R8H A;  3JAM K;  5E3O A;  2NYX A;  1KQ9 A;  3BR0 A;  3KCC A;  2OU2 A;  2ZFW A;  4W97 A;  2LC2 A;  1Z77 A;  3IRR A;  5LEK A;  4XLP F;  4GYG A;  1V5G A;  3HPH A;  4YII A;  4Y7N J;  1X58 A;  2H09 A;  1KYZ A;  4MEX F;  2DK8 A;  1REP C;  2D5V A;  3SEZ A;  5LRR A;  3D5S C;  3L09 A;  4G94 A;  4XLA A;  2CGP A;  1T0F C;  2FD5 A;  2L9V A;  4DIQ A;  4E7S A;  4P9U A;  4OAZ A;  1VTN C;  4Q4Z F;  1G3S A;  2AS5 F;  1U5T B;  4XIC A;  1I6H J;  4ZYE A;  3PFI A;  4H4K C;  3RCO A;  3I55 I;  3K4B A;  2FOK A;  1R5H A;  4C2U A;  2JA6 J;  1VQL I;  4P9F A;  2HOA A;  1NG7 A;  4D9J A;  1D8J A;  1U3E M;  4D5C A;  3E5X A;  3TGN A;  4BJT A;  1IUY A;  1FOY A;  3BJO A;  1N78 A;  3DBL B;  3CP8 A;  1YG2 A;  4E6K G;  2GAU A;  2LF8 A;  3LNQ A;  1TQM A;  2HQR A;  2OTJ I;  4A93 J;  1MGT A;  3KZY A;  1W0U A;  3ESW B;  2K9M A;  4EV0 A;  2HYG D;  3V7S A;  3H3Z A;  4OAY A;  1J09 A;  3LFU A;  1I50 J;  4C30 A;  2VT3 A;  3EUH A;  4N4O B;  4MIM A;  4NC7 A;  2MAB A;  2VB6 A;  4B4C A;  1WKM A;  2QWW A;  5CVJ A;  3FKJ A;  3GLX A;  4CCM A;  1Z1D A;  1PJR A;  2LNB A;  3P7N A;  4A0X A;  3CUQ C;  1JTY A;  1FBS A;  1HKS A;  1FTZ A;  1X3W B;  1X1B A;  2ZB9 A;  3RYR A;  4CUG A;  3LSH A;  1SMT A;  3OYN A;  4G6D A;  4ZH4 F;  5EEG A;  3RPU A;  2LD5 A;  1PUF A;  1OCO H;  4GFB A;  1YJN I;  2BGC A;  2OF7 A;  4BXF A;  2ACJ A;  3I71 A;  1BI2 A;  4BY1 J;  2HZD A;  3DBH B;  2EBI A;  3DWL E;  4NDL A;  5GAD J;  5E1W A;  2E1C A;  5TIS C;  1TWC J;  2ELJ A;  1MSF C;  3OIQ A;  3R61 A;  4KN4 X;  2ZXJ A;  3HBL A;  1IGN A;  4ZTJ A;  3WG7 H;  1E2X A;  2L7Z A;  1TNS A;  1R5G A;  1CGP A;  1IV8 A;  3KYC B;  2KRH A;  3CF5 F;  3K1N A;  1W7P D;  1K4S A;  3LSP A;  3W2V A;  3ZGK A;  1Y0N A;  4MO7 A;  1UHS A;  2EIL H;  1ZG3 A;  2OTL I;  5HDG A;  1LDJ A;  2BY2 A;  1QHG A;  3S3N A;  3HSR A;  3HTS B;  1RZ4 A;  1QA6 A;  3ROU A;  4XKB A;  4G7O F;  3S1R J;  1TTY A;  5B66 C;  3OYC A;  2AO9 A;  4LG0 A;  2FQ3 A;  3V8J A;  2DJI A;  5IYD J;  2WY8 Q;  1EJ9 A;  3K6G A;  3C2B A;  3G1L A;  1Z21 A;  4RGR A;  1HA8 A;  2OV7 A;  2JVG A;  3BPX A;  2X1C A;  4I7H A;  5DCF A;  3OR1 C;  3D5R C;  4G9Y A;  5IT3 A;  1TC3 C;  3V8K A;  4DOZ A;  5FB2 A;  3MKZ A;  2Z2S B;  2ZXI A;  2R7F A;  2EV6 A;  3L2Q A;  2HQA A;  1ETK A;  5CKT A;  2X6X A;  5D4S A;  3MQ0 A;  3G4S I;  4E4H A;  2A6E F;  1VQ7 I;  2KDZ A;  6PAX A;  4Y17 A;  1MKM A;  4XLE A;  5GAE J;  1WH7 A;  2H8W A;  1P4X A;  2CSO A;  2W25 A;  1W36 D;  1R1U A;  2X51 A;  1K78 B;  4RAG A;  2EFP A;  2VJI A;  3HSE A;  2MA3 A;  1LFP A;  4YEJ A;  1T98 A;  3GLL A;  2HEO A;  2D1V A;  1NHA A;  4HDV A;  1UG0 A;  1R49 A;  3J7Y J;  3ZQL A;  3FM3 A;  2HGC A;  5HVQ C;  3CP2 A;  4P96 A;  1O3R A;  2RVC A;  2EZK A;  4GYI A;  2HWV A;  2P5V A;  1HSJ A;  3BZ6 A;  2K9S A;  4RAY A;  4B43 A;  3A01 B;  4KIC A;  1ORK A;  3QOE A;  3W2W A;  1H9G A;  3JRH A;  2V9P A;  3UR3 C;  3WTS C;  5K5Q A;  4IX7 A;  3GYH X;  4MFE A;  5IP6 A;  2EIJ H;  1Y6I A;  3P9C A;  3S2D J;  2E60 A;  3K70 D;  2K40 A;  2M5W A;  1R1V A;  1TWA J;  2VI6 A;  5KK1 A;  3LSR A;  5J40 A;  3ASO H;  4G8X A;  3FKI J;  3IAS 2;  1RR8 C;  2EA2 A;  1SVL A;  2CW0 F;  4YFX F;  1Z9C A;  3ZQI A;  4A6D A;  2QKM B;  3IAM 2;  2RAE A;  3IHU A;  1J5Y A;  1U6G A;  1YLF A;  3SZP A;  1IDZ A;  3ABM H;  1UB9 A;  4N0B A;  4BE1 A;  1SFO J;  2JZY A;  4LIV A;  1JE8 A;  3SDB A;  4OU0 A;  2LKS A;  1MJ9 A;  3TDZ C;  1FOK A;  3S17 J;  1VQ8 I;  1HW1 A;  1KQ0 A;  1Q1H A;  1YOV B;  1QVT A;  1CQT A;  2VXZ A;  5C44 J;  3ZP5 A;  2R0Q C;  3E5U A;  1FYK A;  1QNT A;  2FBK A;  1B6A A;  3J7A O;  1G3T A;  2VON A;  1WH5 A;  2VPR A;  4KA4 A;  1RR7 A;  2M34 A;  2JUC A;  4XRM A;  2HDW A;  1HC8 A;  2MH2 A;  3KEO A;  5F1R A;  1BI1 A;  5FLM J;  1G8X A;  2CV2 A;  3GEZ A;  2X85 A;  3GME A;  3HRM A;  5FKM A;  3REO A;  3ZQH A;  2P6S A;  4UUS B;  2L02 A;  2VKD A;  2G7H A;  1FIA A;  4IRI A;  4HLY A;  1TQP A;  1KU2 A;  1JT6 A;  2H94 A;  2M8G X;  2M2E A;  1G3Y A;  3S16 J;  3C2H A;  4JBA A;  1MMS A;  3R0A A;  4NC6 A;  2DW4 A;  4ZYH A;  1P2F A;  1B8I A;  4XOP A;  2ZSH B;  3ZMU A;  4XRS A;  5DTD A;  3IKV A;  1FYL A;  4LFU A;  1I3A A;  1DPR A;  4RDU A;  1W5C C;  3S3M A;  3JRB A;  1PUE E;  4BDY A;  3DU5 A;  1OJL A;  2QVO A;  3GXO A;  1SC7 A;  4YG2 F;  4AYB A;  2ZJP F;  1IF1 A;  2QQA A;  4QPO A;  1VF9 A;  2XV4 S;  1WCM J;  4Y33 A;  2XGD A;  3FM5 A;  4PJN A;  3ZQC A;  3ECH A;  2W85 A;  2GWR A;  3A0B C;  4M74 A;  2W82 A;  2XKP A;  5DCM B;  2QZ8 A;  3TBI A;  1AWC A;  1YS7 A;  2JRT A;  2LY2 A;  5IY5 H;  5H20 A;  2JTV A;  4ITV A;  4V2G A;  2DPU A;  3OSF A;  1MND A;  2JWT A;  2XAJ A;  2Y0S N;  2YS9 A;  3CC4 I;  1HXD A;  5F04 A;  3FIS A;  3B02 A;  3U1K A;  3CJR B;  3L7W A;  4JYK A;  4KFC A;  2ZJQ F;  4F3Q A;  1S5L C;  1SAU A;  3BQZ A;  2EIK H;  3HC7 A;  1PDN C;  1JUP A;  2R7D A;  3E97 A;  3C7J A;  1Y1V J;  1QRY A;  3PUF A;  1USS A;  3PQK A;  4XN3 A;  2FX0 A;  4XKV A;  4A5M A;  3QU3 A;  2KFD A;  1WJC A;  2ZME B;  4HOB A;  4CSW A;  1K61 A;  1UJ8 A;  3HKZ N;  3LFK A;  1TWF J;  3TOA A;  4OMY A;  4AIJ A;  3H9Q A;  4AU7 A;  3EUH C;  4BS9 A;  5F6F A;  3F6O A;  1YE9 A;  2V1X A;  3SYT A;  3HHH A;  1K6O A;  3GZ5 A;  5CVV A;  2Y9Y A;  3F8F A;  3I53 A;  4JK1 X;  1OPC A;  1EA3 A;  1JUS A;  2HPM A;  1S7O A;  5LHG A;  4PJJ A;  3PUB A;  5LFA A;  2LTP A;  5GPC A;  1ZEL A;  3HTU A;  1SMY F;  2BVM A;  1MJA A;  3QU6 A;  1BC7 C;  2PMZ A;  3QYF A;  4CHU A;  1I6X A;  3DP7 A;  4S0H B;  5IYC J;  3BCA A;  3MZH A;  4XQF A;  1I39 A;  1FMV A;  2VE8 A;  3QP5 A;  2BXZ A;  1IN7 A;  4OIR F;  1R22 A;  3M8E A;  3DPL C;  3HSF A;  2NS0 A;  2XSJ C;  4ESJ A;  5E17 F;  1M1E B;  3HZJ A;  3F23 A;  2H1K A;  4AWX B;  3QPH A;  4PDK A;  3MZY A;  1LUJ B;  2DLL A;  3LMM A;  3PNT A;  1XMK A;  3K10 A;  1FY7 A;  5K7F A;  1VQK I;  3PO2 J;  4A3L J;  4OIP F;  1FLI A;  1J0R A;  3V4G A;  5BPI A;  3G6E I;  3TP0 A;  3QAH A;  3OYL A;  2Z16 A;  2FXA A;  2NRA C;  2Q2E B;  4XSX F;  2DFE A;  2PG4 A;  3RKW A;  5E8G A;  2I10 A;  2XAS A;  2VE9 A;  5M5X J;  3AG2 H;  3W3C A;  5A2Q Z;  3BTI A;  2QBY A;  4A69 C;  3SHF A;  1UZC A;  1R4N B;  1RIO H;  2GOX B;  1BR1 A;  1P7I A;  2MFZ A;  4Y52 J;  5D6F A;  3DLA A;  3T5X A;  1TNT A;  1EV7 A;  2KL4 A;  3OIO A;  2R4G A;  3E6D A;  4G6T B;  1DP7 P;  3H3V K;  2DQR A;  2VT2 A;  3HRS A;  5D6E A;  1HST A;  1ETX A;  1ZG5 A;  3KZI C;  4V2F A;  4IL6 C;  2G7U A;  4F93 B;  5CQG A;  5C4J J;  4HX7 A;  1IUF A;  4QPQ A;  2E5Z A;  4DNC A;  2IPQ X;  1T6S A;  3TKY A;  3PM1 A;  4CCL A;  2E1M B;  5JHF A;  5M3M J;  3HL2 A;  4A3F J;  3KLN A;  1LFB A;  3HOW J;  5E18 F;  2V6C A;  3ZN0 A;  2OCE A;  2V26 A;  2AXL A;  2RRE A;  2LH9 A;  2FBH A;  2HR3 A;  4UV8 A;  2VC1 A;  3OMY A;  1LPQ A;  2E2H J;  5HNH A;  5D8L B;  4DZP A;  5EJC A;  3E5Q A;  1DPU A;  2L2O A;  1B72 B;  4LIT A;  4M9Z A;  2DDA A;  2Q0O A;  3OL4 A;  1QU3 A;  2UWM A;  2O61 A;  2Y69 H;  2Q1Z B;  3ABL H;  3FX3 A;  1UFM A;  3MN2 A;  1XC5 A;  1LVA A;  4KIF A;  2WBM A;  2NVT J;  5HLG A;  2IS6 A;  3K2Z A;  1P9Q C;  2IJL A;  3VEP A;  2L9R A;  4Y15 A;  2L7K A;  3F21 A;  4OIN F;  4KNY A;  1YX5 A;  4FCY A;  3RQ4 A;  2XAQ A;  4M9X A;  5L3G A;  2O7O A;  3SJM A;  4M72 A;  1RKW A;  1LKX A;  1UG2 A;  3ML6 A;  2BXY A;  1LEB A;  3C1D A;  2DOE A;  3BTC A;  3H35 A;  5E20 A;  5C3E J;  3OYB A;  2P5L C;  3F6V A;  3SDG A;  4IQJ A;  3LAP A;  1XX5 A;  2CUF A;  4QLC U;  3IH4 A;  3DTE A;  5IT9 Z;  1GDT A;  2WV0 A;  3ABK H;  2IS4 A;  3BY6 A;  5JVT A;  3KP6 A;  1X2M A;  2XPV A;  2FJ1 A;  4J00 A;  1MDM B;  4UVA A;  1H89 C;  3ONQ A;  1ZGJ A;  3PIO F;  3OS0 A;  5A2Q K;  4W1U A;  3FXR A;  5FKN A;  4ESF A;  4LLN A;  1LE8 A;  3WU1 B;  3QYB A;  4LOC A;  2K9Q A;  4E7I A;  5HS9 A;  2L9N A;  3GTP J;  1FOX A;  2IT0 A;  1BM9 A;  2DMP A;  1SFE A;  2F5D A;  1D8K A;  4B09 A;  2FQ4 A;  3HYI A;  3FDY A;  3TED A;  1KQ8 A;  4ENJ A;  4E7J A;  3GFL A;  1K83 J;  5FFZ A;  4ZZD A;  3WTV C;  4M9S A;  4EJO A;  3JAM Z;  1YRN A;  4OIQ F;  3FZV A;  2L4M A;  4M6V A;  1P92 A;  3RPU D;  4WX9 A;  1JHF A;  2M7B A;  2K4B A;  3A1Y A;  4OOI A;  3SFZ A;  4CYC A;  3GO5 A;  3LST A;  2ICW G;  3K1P A;  3HIF A;  2FEZ A;  4LGW A;  3HHG A;  4QIW N;  2Z3Y A;  2O03 A;  1GHC A;  4HG2 A;  2FU4 A;  4HF0 A;  5EG0 B;  1R36 A;  2H27 A;  1LEA A;  1YIO A;  4B48 A;  2W84 A;  5J1Y A;  3CJQ B;  1OIS A;  2Q8K A;  2H6B A;  2LBF B;  4P5O A;  3K4M A;  5EEA A;  4IPA A;  3P5J A;  3ELK A;  2VQH A;  1WHU A;  2MGQ A;  2W24 A;  2QEN A;  4NHJ A;  2O3F A;  4PJ0 C;  1RUO A;  2E36 A;  3OOP A;  2AHQ A;  2DT7 B;  4ZYD A;  2K3F A;  2LY9 A;  3WHC A;  3MKY B;  2TDX A;  2VC0 A;  3CCU I;  3CDH A;  4D7N A;  2CQK A;  1I3Q J;  3RSN A;  4DYQ A;  3OYI A;  2R5Y A;  3OOU A;  4BKX A;  5IT9 K;  3F8N A;  3OYF A;  2LP0 A;  2JK3 A;  4U88 A;  5ERI A;  4BY7 J;  2R92 J;  2GBY A;  1T8I A;  1OYW A;  1U8B A;  2CMP A;  2JJ7 A;  2LRD A;  4CZC A;  1NK3 P;  1N75 A;  2P7V B;  2NVX J;  3E1S A;  2YU9 J;  5FJ8 J;  1OCP A;  2VKV A;  3H3U A;  4BE2 A;  5DD8 A;  4DYC A;  2HOT A;  2XF7 A;  3LSI A;  2DTR A;  2YX4 A;  4HF1 A;  3GTM J;  3LWF A;  3HOS A;  5LEJ A;  3TOB A;  1YW8 A;  5H2F C;  2OAZ A;  5FD5 A;  4O3M A;  2CQQ A;  2P4W A;  1K6Y A;  3WGG A;  4CCN A;  1WZ2 A;  1ZRF A;  5IP7 J;  4JP0 A;  4NC8 A;  2DU9 A;  5TGT A;  3OYA A;  4FX0 A;  2Z1D A;  1QPM A;  1QZZ A;  2UUZ A;  2L54 A;  3PSF A;  1V55 H;  5AIP A;  4KIT B;  1GV5 A;  1ZTR A;  2GZW A;  4HA8 A;  2QM3 A;  2DOA A;  1RC9 A;  3E3V A;  1U5T A;  1TWH J;  2I8D A;  4YFN F;  4EGY A;  4UHT A;  1I1S A;  4A3G J;  4RLF A;  2R7V A;  2ME0 A;  5B1A H;  3K4N A;  1Z91 A;  5E8I A;  1MMG A;  4ZYA A;  3BG5 A;  1HKT A;  1ZGA A;  4DZJ A;  1R4M B;  4A3D J;  3IH2 A;  1T08 B;  4Q48 A;  2IEK A;  3H0D A;  2W4S A;  4NNJ A;  4PFP A;  1B4A A;  2E5N A;  5D5V B;  2DOD A;  4BBR J;  1K4T A;  2DCE A;  5E1Z B;  4IOC F;  1H8A C;  3IWZ A;  3P9I A;  4MQV A;  5LBQ A;  5M3F J;  3E7L A;  3A02 A;  2R7T A;  3BJA A;  3ZN1 A;  3HGG A;  3M07 A;  4HX8 A;  1JKQ C;  4B1R A;  1UST A;  2VLA A;  2STT A;  3HJE A;  4KDP A;  2XB0 X;  3GTL J;  2MYS A;  4FET A;  1FSE A;  1YS6 A;  4ENK A;  1O3S A;  1IRX A;  2EIN H;  5J47 A;  1YIJ I;  4HST A;  4BQQ A;  2L7F P;  5BS6 A;  3FK6 A;  4IHX A;  4IKF A;  3KFW X;  1YFH A;  1FWZ A;  2PEX A;  3F0C A;  5E1X A;  2RQQ A;  4A3M J;  2AQF A;  2ECC A;  2UXN A;  2OBP A;  2RC4 A;  1HW5 A;  2BHZ A;  1YIT I;  2XDV A;  3JTH A;  3K1M A;  4RGX A;  4UNO A;  1BC8 C;  2R7S A;  4M3E A;  1HQC A;  5FGM A;  4RA2 A;  5LD2 C;  4EM2 A;  4HV5 A;  2P5K A;  3TMO A;  4JX5 A;  2OQR A;  4CYD A;  2L9S A;  3LAJ A;  4FT8 A;  4AVZ A;  2P8T A;  5EZG A;  3QYE A;  2G9W A;  2EIM H;  2VJJ A;  2A5Y B;  4EQQ A;  2I5U A;  4DYR A;  1GUU A;  3O8G A;  3F8M A;  4I98 B;  1FYM A;  3AG4 H;  2GA2 A;  5DM6 F;  5LHH A;  4TV7 A;  3CTA A;  2LYC A;  3SXY A;  3JRG A;  2XGE A;  2PJR B;  1FJL A;  3ERE D;  3KYL A;  1T56 A;  4EAT A;  2LSO A;  3I4M J;  4XLH A;  1LDK B;  4KT5 C;  2XKO A;  3MAJ A;  4E7Z A;  2X1E A;  3FHN A;  3ABU A;  1IRZ A;  4RBO A;  4C9Y A;  1WJA A;  3MKW B;  2VUM J;  1R00 A;  5F0C A;  4RB3 C;  3R6S A;  4UY8 I;  5HNF A;  2FE3 A;  2O5R A;  5EGO B;  2QKL B;  2VJ5 A;  4XLC A;  2B7E A;  1WI3 A;  1BW6 A;  1VI0 A;  2A5W A;  5KAI C;  3H9G A;  2VOD A;  3RPQ A;  1RNL A;  3E0J B;  2LOO A;  4QWQ A;  1PUF B;  1AU7 A;  2EFO A;  1SVO A;  1ON2 A;  1H9T A;  4HAM A;  2H6C A;  1KU9 A;  2MLK A;  4GXO A;  1V54 H;  4IHY A;  4ANJ A;  2HNH A;  2QGU A;  4L9N A;  4HV6 A;  2CUZ A;  2CW8 A;  4FX4 A;  3E6B A;  3AL0 B;  2ID3 A;  3EDP A;  4B3X A;  2UZK A;  4JX4 A;  4XL9 A;  3CCS I;  4FE4 A;  3ZMD A;  1ZAR A;  2K7L A;  3DQV C;  2K9L A;  4CO8 A;  4BGD A;  4UVB A;  2WAF A;  1X4P A;  3RZD J;  1MSE C;  1J2X A;  3GBG A;  3DU6 A;  4A2U A;  3IH3 A;  1EH7 A;  3A01 A;  1NH3 A;  1GV2 A;  1TW2 A;  4RB2 C;  2CUE A;  1R23 A;  3NWT A;  2DA1 A;  4Y3O A;  1APL C;  1W1W E;  3H5N A;  4C3H J;  3JRI A;  4G6Q A;  2HKX A;  5J4V A;  3S14 J;  1H0M A;  3MCZ A;  2GOM A;  1XN7 A;  2KIM A;  1OCC H;  3VYR B;  1C0W A;  2E71 A;  3OY9 A;  1TBX A;  1HKQ A;  2COM A;  5FLV A;  2TRT A;  1NG6 A;  2BW3 B;  3OYM A;  4AUX A;  3S2H J;  3SZT A;  1MBF A;  1WJB A;  3PL8 A;  1ZRC A;  1MJB A;  3GF2 A;  2CV0 A;  1FNN A;  1FT9 A;  3M1E A;  3RZO J;  4LLG F;  1D0Y A;  4X1E A;  4HEA 2;  4ZDL A;  1SD5 A;  2A6H F;  2W1O A;  3F8B A;  3KPH A;  4IHW A;  5ILU A;  1XG1 A;  1AHD P;  1UEL B;  4YEL A;  3CCE I;  1K7A A;  4ZDO A;  3FXO A;  4C2T A;  5J8C A;  2R7R A;  5FRM A;  5IPA A;  2AQE A;  3WGI A;  3G2B A;  1MBE A;  4B47 A;  2HFH A;  4L5E A;  4CCO A;  2MLG A;  2XRN A;  1IN6 A;  1U0J A;  2IXS A;  4PFO A;  3J80 K;  2QA4 I;  1GVD A;  3EET A;  3J7A Y;  1EKE A;  3WTX C;  3HUG B;  1IN4 A;  4BU2 A;  1DDN A;  2EJR A;  3KX2 A;  1BR4 A;  1T95 A;  3FMR A;  3DEW A;  3DTI A;  3QWL A;  4AD9 A;  2XVC A;  3AG1 H;  4UUT A;  2HKO A;  3PNY A;  5D4R A;  2R5Z A;  5ICG A;  4UUS A;  4AYB N;  2NAZ A;  3KZZ A;  1KYW A;  4M6X A;  4EMS A;  2H8R A;  3ERM A;  2RV8 A;  2M30 A;  3CMA I;  1BW5 A;  1JUM A;  2VBZ A;  2GXB A;  2V7F A;  3BZK A;  2HOE A;  2V79 A;  5FRO A;  1S72 I;  2HOS A;  2ELK A;  2XIG A;  4XK4 A;  1YHQ I;  1UAA A;  3D0S A;  1FTT A;  1TZL A;  2V1N A;  1YTY A;  4UXN A;  3CF2 A;  1EH8 A;  4M3D A;  2QF7 A;  4M73 A;  4ZZL A;  3G73 A;  2BHY A;  2VL8 A;  1WFX A;  4MTE A;  5JR3 A;  4J19 A;  2L7M P;  1DU0 A;  4HPQ A;  2LRE A;  4KT6 A;  4EJV A;  1HCR A;  3VFZ A;  1IO2 A;  2L4A A;  1QVU A;  2DMU A;  3WE3 A;  1BR2 A;  4LB6 B;  4E7H A;  3OR2 C;  3OYG A;  2BYV E;  1SD6 A;  3MKL A;  4GDF A;  2OCC H;  3GCM A;  1U5T C;  2BBY A;  5B3S H;  3LA7 A;  4BE0 A;  1OKR A;  2DMQ A;  4CDG A;  3OSG A;  4CCJ A;  3DEE A;  2LKX A;  3TL4 X;  3IWF A;  2IW5 A;  2CG4 A;  5JI6 A;  4JX6 A;  2TCT A;  4D1Q A;  1L3L A;  2WB1 N;  5K5R A;  2VAS A;  5HLT A;  2E2I J;  5DUI A;  3KP3 A;  3AG3 H;  3JCU C;  1JKR C;  3IKT A;  4G7H F;  1CF7 A;  2V1U A;  1EF4 A;  3N97 A;  4PZJ A;  2ZME A;  4U0Y A;  3M9A A;  1XMX A;  5E3L A;  4WCG A;  2KDO A;  4HNV A;  1O3Q A;  1B8I B;  4XRF A;  3U2R A;  4FAS D;  2CQN A;  4WWC A;  2HXO A;  2F4M B;  3T8T A;  3ZRG A;  3JSO A;  1GLN A;  2ZSI B;  1Z0X A;  1S3J A;  4NQW B;  4PSX A;  2PN6 A;  4Y13 A;  4V19 K;  3M8J A;  3RQI A;  3TO7 A;  3GVA A;  3CCJ I;  4AIK A;  2Y48 A;  3HEF A;  2MBF A;  4P1W A;  5FFX A;  1WSU A;  3GTO J;  1W7P B;  2E1N A;  1D0X A;  2K27 A;  3W6K B;  3QP6 A;  3KIO A;  2JA7 J;  3VB2 A;  4UB6 C;  2XAH A;  5EEH A;  4HLX A;  2CU7 A;  2ZCW A;  3FBI B;  4S04 A;  2FNA A;  4S05 A;  1YX3 A;  1AKH B;  1D0Z A;  3BRO A;  4DW6 A;  2Z5U A;  4I76 A;  5CJ9 A;  2CO5 A;  2K85 A;  3O3K A;  4RM3 A;  4RM2 A;  4A6E A;  5J4Y A;  3WTW C;  2ISZ A;  2FNP A;  4KN7 X;  3KEQ A;  5JFR A;  4MHG A;  4Z6Y A;  1JTX A;  1W5T A;  2M45 A;  3CD6 I;  3BR1 A;  3I56 I;  3WGH A;  4E7K A;  1ZRD A;  1XS9 A;  1VZ0 A;  5HDK A;  4GO1 A;  3OL3 A;  3D1N I;  3V7R A;  5M5Y J;  2JPC A;  2OZU A;  2M4K A;  1SAX A;  3W6V A;  2HI3 A;  2NVY J;  1E3H A;  2QUF A;  1IG7 A;  3M1C A;  2R7Z J;  4M71 A;  4CH7 A;  2IGK A;  2Q2E A;  4EM1 A;  3R60 A;  1V4R A;  3J81 Z;  1A35 A;  3HRU A;  4DGW B;  3F72 A;  4Q5S F;  3Q0W A;  3O2P E;  3ZQG A;  1OR7 A;  4CZZ A;  4L18 B;  3DXJ F;  1ETO A;  4IVN A;  3T8R A;  4AC0 A;  3BLY A;  3MVP A;  3ZMV A;  2JVH A;  2BY1 A;  2Y0S A;  2MD5 A;  2LK2 A;  2HQN A;  3RI4 A;  3JRF A;  2ETH A;  2GIZ A;  1TQI A;  1W5S A;  2X0L A;  4L0Z B;  3FXM A;  4BEH B;  3BT9 A;  1LB2 A;  3HOU J;  2EA4 A;  3VOE A;  4KJZ A;  1ZGW A;  2EZL A;  4MFD A;  1R9T J;  2VQL A;  3CDI A;  3Q3S A;  5DD4 A;  4WK8 F;  4OMZ A;  1XD7 A;  2IGM A;  3JRD A;  5BOX A;  2BY0 A;  3HKZ A;  2B9S A;  2HXI A;  5GAG J;  2OZ6 A;  2YSR A;  1B72 A;  2WA0 A;  2QCO A;  4HSR A;  3A4C A;  3NQO A;  3FK7 A;  1TT5 B;  3A0H C;  1LJ9 A;  2E7W A;  4BHC A;  2XAF A;  4XNF A;  2KMU A;  5J3L A;  1V5E A;  2PBI A;  3Q0V A;  2XRO A;  3GFM A;  4C2M J;  1RES A;  4IZZ A;  2AXT C;  1KA8 A;  2GM4 A;  4HNT A;  2OC6 A;  2O9L A;  1P7J A;  4GRI A;  2ZO4 A;  4BH9 A;  3OV8 A;  3F9K A;  2JA8 J;  2X1D A;  2RQP A;  5GTH C;  3HXL A;  5CPR B;  1SEU A;  3HOV J;  3BQY A;  3WOD F;  2FOW A;  3VSL A;  3S32 A;  1E3P A;  1WJ5 A;  2F48 A;  4MTD A;  1IAW A;  1TT0 A;  1D3Y A;  2PFB A;  5B5E C;  3B6A A;  2BVL A;  3ZCO A;  4PUS A;  2NS7 A;  5HDN A;  1LQ1 A;  3HDD A;  1FIP A;  4HQM A;  1A36 A;  1YYV A;  2A61 A;  2DTZ A;  1G2H A;  3CUQ B;  3BC8 A;  5CVI A;  4PJM A;  5L3E A;  2DK5 A;  1ETW A;  2GQQ A;  5ICC A;  1IXR C;  2F4I A;  3ZMS A;  3VYU B;  2E19 A;  3J81 K;  4A0Y A;  1E3O C;  2WAQ N;  4XID A;  3EYI A;  4RGU A;  2GXA A;  4LMY A;  3CCY A;  3MWM A;  2QSF X;  4L5I A;  2VQG A;  3OS2 A;  2M8E A;  3VDX A;  1D5V A;  1Z3Y A;  1J75 A;  2HZT A;  1AA7 A;  1TP4 A;  1P4W A;  5JLW A;  1U78 A;  3I54 A;  1G3W A;  4ESB A;  4Q47 A;  2FSW A;  3TW7 A;  1RET A;  2DA3 A;  3QOP A;  2LMD A;  3GX4 X;  3CDL A;  1LNW A;  1Z3X A;  4OWR B;  4BBS J;  5HOD A;  4JQF A;  4P55 A;  4PCQ A;  2LDU A;  1V5F A;  2F5F A;  2DFH A;  1X19 A;  2L01 A;  3VSK A;  5KAF C;  5EZH A;  3AKZ A;  1ETQ A;  4HNU A;  5E79 C;  1BN5 A;  1MNM C;  3J7Z I;  3WHB A;  3QPL A;  1K79 A;  2A3S A;  2XB5 A;  3EUA A;  4HYE A;  3ZMT A;  1ONV A;  2YX7 A;  1IN8 A;  2CFX A;  3ECO A;  2NOG A;  3AFH A;  1H88 C;  2F5V A;  4F52 A;  1YW7 A;  2WTE A;  4O5V A;  4M3F A;  2DQL A;  5TRD A;  2VOP A;  4YFK F;  3K4C A;  5FLX K;  3O8H A;  4IXA A;  4A3I J;  4HF2 A;  3GZN B;  1IXC A;  1Z7U A;  2LBF A;  2CV1 A;  2P7C B;  4LLL A;  4OIO F;  2A69 F;  2XPW A;  3BG6 A;  3CLQ A;  3KYD B;  4J01 A;  3QOD A;  2CFO A;  1A04 A;  4R79 A;  3BP8 A;  2DJN A;  1U9O A;  2HS5 A;  3F8C A;  3B73 A;  2RKH A;  3TW6 A;  1A6Q A;  1E0E A;  1R58 A;  4A3J J;  1ZK8 A;  4I0A A;  2MD0 A;  1U8R A;  4E70 A;  3RJP A;  1P4A A;  3G1O A;  2QQ9 A;  3V7C A;  4ZJZ A;  4KUM A;  4II2 A;  1RPW A;  1TW3 A;  2VBX A;  3RYP A;  3I59 B;  3I0T A;  4FE7 A;  3JRE A;  4B8X A;  4HBL A;  2J5P A;  4NBQ A;  3BTJ A;  3CCV I;  2NVQ J;  2EWN A;  4IHT A;  3W6J B;  4XSZ F;  3WU0 A;  2GXG A;  3L2R A;  1MBK A;  3ZMZ A;  1LVK A;  2VKE A;  3BOQ A;  1ETV A;  1ZAO A;  1O57 A;  1D5Y A;  1ITY A;  4CYC B;  2XC7 A;  1Y1W J;  1RUN A;  2XF5 A;  3ABT A;  2H1L A;  2ELH A;  5ILS A;  4CXF A;  3LSM A;  1O7F A;  4M3G A;  2XHK A;  2X4H A;  2PLY A;  2XRL A;  4RS8 A;  3P9K A;  1KU7 A;  4XKC A;  2F5C A;  4X6A J;  1SAN A;  2HQ5 A;  2ZME C;  3BCB A;  2EZI A;  2KLO A;  2KRC A;  4Z2Y A;  2PJP A;  1SFK A;  3KEY A;  1QGP A;  2X48 A;  2JSC A;  5K7H A;  5BMZ A;  3RTR A;  3LQR A;  1FX7 A;  5L3F A;  1I27 A;  3BDD A;  1DUX C;  3K4L A;  3N05 A;  1PYV A;  2P0W A;  2ZFU A;  3F3X A;  1T2K A;  5KHD A;  2W57 A;  4LG3 A;  1XSX A;  2KPM A;  1XCV A;  2L3D A;  4UVC A;  4ETS A;  1X1C A;  1FSH A;  1IJW C;  1VND A;  1YJ9 I;  1R6R A;  4PGG A;  1W4M A;  5JHU A;  1ULY A;  2M3A A;  3TDU C;  5LGN A;  5ILV A;  4ZC3 A;  3CO7 C;  4DQ2 A;  5LHI A; 
#chains in the Genus database with same CATH homology
 2OD5 A;  3I5U A;  1G6N A;  1SD7 A;  1XGM A;  3NEU A;  1ZYR F;  3KP5 A;  2QQB A;  1XCB A;  4EVI A;  4KIG A;  3M8F A;  5LLQ A;  1KGS A;  3T0Y A;  1YQA A;  4U7D A;  3EYY A;  4R1H A;  1GXQ A;  1GXP A;  2PMH A;  2FBI A;  5L3C A;  3CLO A;  3HOT A;  1FBU A;  5J8F A;  4WCG A;  3I4P A;  4GCV A;  2PQ8 A;  5DYM A;  1KU3 A;  2KRF A;  5HS8 A;  2EB7 A;  2RDP A;  4IJA A;  2V1D A;  3O6B B;  1JGS A;  5BPD A;  4YIF A;  2M1B A;  4XBF A;  3CUO A;  1MD0 A;  2QYO A;  4UV9 A;  2M87 A;  1YW9 A;  5FO5 A;  3DF8 A;  3E6C C;  3WG9 A;  2DO7 A;  4WXH A;  5LRS A;  2WWY A;  4RAZ A;  2VN2 A;  2UXX A;  1XSV A;  3ZPL A;  3RKY A;  5HS7 A;  2ESN A;  4I02 A;  2IA0 A;  4A0Z A;  2Z99 A;  1XDU A;  2O6G E;  5BQT A;  1ZN2 A;  1PP7 U;  1MZB A;  1WRJ A;  3J80 Z;  2VBY A;  4UUV A;  1T38 A;  3FF5 A;  5TJJ A;  1O3T A;  2F2E A;  1TLH B;  2IVM A;  1FC3 A;  2J5O A;  1XGO A;  5D5U B;  3AAF A;  2ZNY A;  3L9F A;  1K78 A;  2EFQ A;  4I01 A;  1Z6T A;  1BIB A;  3Q5F A;  1J59 A;  1RI7 A;  3K9T A;  4U0W A;  3JTG A;  1F9N A;  2DPD A;  3JSP A;  2Y75 A;  4IF4 A;  3C3W A;  2VOO A;  2ZBK A;  3L00 A;  5KVR A;  2YU3 A;  4L5J A;  1S8N A;  1ZLJ A;  2R3S A;  2IA2 A;  3KP4 A;  3NRV A;  2OQG A;  5DUK A;  4LG0 B;  3Q9V A;  1SFX A;  1F5T A;  1BI0 A;  3IC7 A;  2ZJ2 A;  1S6L A;  1FPQ A;  1XB4 A;  3WE2 A;  4O6J A;  2C6Y A;  1HBX G;  1V3F A;  2DI3 A;  2B0L A;  2FA5 A;  5CLS A;  3HUG A;  5K1Y A;  4EJT A;  3DKW A;  4EM0 B;  1T39 A;  4L9T A;  3WTT C;  1X3U A;  4BYY A;  1R7J A;  4KIB A;  2V9V A;  4HDU A;  3T1B A;  1OYI A;  2K86 A;  3WTU C;  3COA C;  1EH6 A;  2WC2 A;  4IRG A;  1LDD A;  3TQN A;  4EGZ A;  2ESH A;  4I09 A;  2IP2 A;  2IA1 A;  4ASN A;  4XLN F;  2FMY A;  2QLZ A;  1IRG A;  4M6Y A;  2FF4 A;  5DEQ A;  3U1D A;  5ICF A;  5F64 A;  1WI9 A;  4CGZ A;  3ZQ7 A;  4EJW A;  4D0P A;  2FRH A;  3K69 A;  1AOY A;  4AIH A;  1ZRE A;  3WTZ A;  1BI3 A;  3H92 A;  1ZG1 A;  5J6X A;  4RB1 A;  2DFI A;  1PP8 F;  4HX4 A;  4MEY F;  3RIR A;  2A07 F;  2D2W A;  2K02 A;  1B1B A;  2GA1 A;  1O7L A;  4AVP A;  4WF2 A;  4N9H A;  5DCM A;  4RGS A;  4H0E A;  5D8K B;  2ADU A;  2YPR A;  4LK0 F;  2BE5 F;  2HTS A;  4N9I A;  5CVU A;  1XDS A;  2ISY A;  2Y0M A;  5D5W B;  1WQ2 A;  1OMI A;  2KJB A;  1P6R A;  1QQI A;  3IL2 A;  3E6M A;  2KKO A;  5H6R A;  4NQW A;  4K2E A;  1I1G A;  4BNC A;  3C18 A;  1J7K A;  1B9N A;  1SD4 A;  3S2W A;  1W7P A;  4LB5 A;  5LGT A;  1JXS A;  3GFJ A;  5FD6 A;  1F4K A;  4BHB A;  4WXC A;  5AIQ A;  1SFU A;  1FBQ A;  4BXU A;  1S7A A;  2D45 A;  5L3B A;  2NNN A;  2E7X A;  3HRT A;  2Z9O A;  1WWX A;  4HQE A;  3LA3 A;  1ZLK A;  5HLI A;  1ODD A;  1XSD A;  2PMU A;  2XAG A;  5D5X B;  1CF7 B;  3GUD A;  5LGU A;  2GIV A;  4FHT A;  4BQA A;  3DEU A;  2RNJ A;  2ZNZ A;  4MNU A;  1J9I A;  3PQJ A;  3Q9S A;  4IRH A;  3GFI A;  1S29 A;  2NNY A;  1QBJ A;  4IHS A;  4F7Z A;  1R1T A;  4GGG A;  5AON A;  2D1H A;  2JT1 A;  1UCR A;  3ULQ B;  1T0F A;  3FHZ A;  1OYY A;  3LQQ A;  4U0V A;  1XMA A;  3FMQ A;  1Y0U A;  1Z05 A;  2JPB A;  5DV5 A;  5ICE A;  1B9M A;  2OA4 A;  2F5E A;  3M7G A;  2EFN A;  3F22 A;  1STZ A;  5L3D A;  4BHP A;  1FP2 A;  1U2W A;  2KIU A;  5DDG A;  2KIF A;  3K0L A;  4ON0 A;  4KYW A;  4HW0 A;  2O0Y A;  2MH9 A;  1QZY A;  5FLX Z;  2KJC A;  3IRQ A;  3CUQ A;  2BV6 A;  1E17 A;  1BBY A;  1IXS B;  4LK1 F;  2QBY B;  3U9G A;  1UHM A;  3D5L A;  4KMF A;  3VOD A;  1MDM A;  3DPT A;  3TO9 A;  3KE2 A;  3KP7 A;  4MQ9 F;  1FP1 D;  2EV5 A;  2VBW A;  2IRF G;  5HOO A;  1B59 A;  4LJZ F;  4I2O A;  2CYY A;  3QRF F;  2BEO A;  2P6T A;  1QO0 D;  4L9J A;  1IZ1 A;  3WTY C;  3I58 A;  3JW4 A;  3DV8 A;  3I64 A;  1UHW A;  3FMS A;  3CJN A;  5CVR A;  2PI0 A;  3ISP A;  1L0O C;  1ZHF A;  4ZYG A;  2MC3 A;  2O8X A;  5CYV A;  2CWE A;  2HTJ A;  4RB0 A;  4L0Y B;  3L2C A;  1IW7 F;  2DAO A;  2HDC A;  2EK5 A;  2XUB A;  2XGX A;  2DBB A;  2RN7 A;  4NB5 A;  3CO6 C;  1I5Z A;  1ON1 A;  3I59 A;  3MFK A;  4U7B A;  4KMU X;  5ED4 A;  1IRF A;  3R4K A;  2YR2 A;  1F1Z A;  3GW2 A;  2STW A;  2ZKZ A;  3BPV A;  4LD5 A;  3TO6 A;  5K5O A;  1XGS A;  1FZP B;  2DT5 A;  3BWG A;  4ENM A;  1G4D A;  3FXQ A;  2Z33 A;  2RGV A;  1Z6R A;  4PGH A;  3N4M A;  2FML A;  1HW2 A;  4A5N A;  1ZH5 A;  4CIC A;  2K4J A;  4BAY A;  1BJA A;  3RDI A;  3DFG A;  3KLO A;  3MEX A;  4HZF A;  3GWZ A;  3GZ6 A;  2LF7 A;  5HLH A;  2A68 F;  2HYF A;  4WXD A;  3FXU A;  3RKX A;  3KET A;  4EJU A;  1GVJ A;  3R0J A;  2EFW A;  4MGR A;  1BIA A;  4A12 A;  4L9V A;  1XGN A;  3KP2 A;  3BJ6 A;  3FWE A;  3SQN A;  4G7Z F;  1BOA A;  3V8L A;  1JHH A;  4I0B A;  1YO5 C;  2EV0 A;  5H6Q A;  3QPT A;  2LKP A;  1IN5 A;  3G3Z A;  3LA2 A;  3HTS B;  4ENN A;  3EQL F;  4R8H A;  3JAM K;  2NYX A;  1KQ9 A;  3KCC A;  2OU2 A;  2ZFW A;  3IRR A;  5LEK A;  4XLP F;  4GYG A;  4YII A;  2H09 A;  1KYZ A;  4MEX F;  2DK8 A;  1REP C;  5LRR A;  3L09 A;  4G94 A;  2CGP A;  4P9U A;  1VTN C;  4Q4Z F;  1G3S A;  2AS5 F;  1U5T B;  4ZYE A;  3PFI A;  2FOK A;  1R5H A;  4P9F A;  1D8J A;  1U3E M;  3E5X A;  3TGN A;  1IUY A;  3BJO A;  1YG2 A;  2GAU A;  2LF8 A;  1TQM A;  2HQR A;  1MGT A;  3KZY A;  4EV0 A;  2HYG D;  3V7S A;  3H3Z A;  2VT3 A;  3EUH A;  1WKM A;  2QWW A;  5CVJ A;  3GLX A;  1Z1D A;  2LNB A;  3P7N A;  4A0X A;  3CUQ C;  1FBS A;  1HKS A;  3RYR A;  1SMT A;  4G6D A;  4ZH4 F;  5EEG A;  3RPU A;  2BGC A;  2ACJ A;  3I71 A;  1BI2 A;  5E1W A;  2E1C A;  3R61 A;  4KN4 X;  2ZXJ A;  1E2X A;  1TNS A;  1R5G A;  1CGP A;  3K1N A;  1W7P D;  1ZG3 A;  5HDG A;  1LDJ A;  3HSR A;  1RZ4 A;  3ROU A;  4G7O F;  1TTY A;  4LG0 A;  2FQ3 A;  3V8J A;  4RGR A;  3BPX A;  4I7H A;  5DCF A;  4G9Y A;  5IT3 A;  3V8K A;  5FB2 A;  2R7F A;  2EV6 A;  5D4S A;  3MQ0 A;  2A6E F;  6PAX A;  4Y17 A;  1MKM A;  1P4X A;  2CSO A;  2W25 A;  1K78 B;  1R1U A;  2EFP A;  3HSE A;  2MA3 A;  1T98 A;  2HEO A;  2D1V A;  1NHA A;  4HDV A;  3FM3 A;  2HGC A;  5HVQ C;  4P96 A;  1O3R A;  2RVC A;  4GYI A;  2HWV A;  2P5V A;  1HSJ A;  3BZ6 A;  4RAY A;  4KIC A;  1H9G A;  3WTS C;  5K5Q A;  3GYH X;  3P9C A;  2M5W A;  1R1V A;  5KK1 A;  4G8X A;  2EA2 A;  2CW0 F;  4YFX F;  1Z9C A;  4A6D A;  3IHU A;  1J5Y A;  1U6G A;  1YLF A;  3SZP A;  1UB9 A;  4N0B A;  2JZY A;  1JE8 A;  4OU0 A;  1MJ9 A;  3TDZ C;  1FOK A;  1HW1 A;  1KQ0 A;  1Q1H A;  2VXZ A;  3ZP5 A;  1FYK A;  3E5U A;  1QNT A;  2FBK A;  1B6A A;  3J7A O;  1G3T A;  2VON A;  4KA4 A;  2MH2 A;  3KEO A;  5F1R A;  1BI1 A;  3GEZ A;  3HRM A;  3REO A;  2P6S A;  2L02 A;  2G7H A;  4IRI A;  4HLY A;  1TQP A;  1KU2 A;  2H94 A;  1G3Y A;  4JBA A;  3R0A A;  4ZYH A;  2DW4 A;  1P2F A;  3ZMU A;  3IKV A;  1FYL A;  4LFU A;  1DPR A;  1PUE E;  3GXO A;  2QVO A;  4YG2 F;  1IF1 A;  2QQA A;  2XV4 S;  3FM5 A;  3ECH A;  2W85 A;  2GWR A;  4M74 A;  2XKP A;  5DCM B;  2QZ8 A;  1AWC A;  1YS7 A;  2JRT A;  5H20 A;  2JTV A;  2DPU A;  2XAJ A;  1HXD A;  3B02 A;  3L7W A;  4KFC A;  1PDN C;  2R7D A;  3E97 A;  3C7J A;  1USS A;  3PQK A;  4A5M A;  3QU3 A;  2ZME B;  4HOB A;  3LFK A;  3TOA A;  4OMY A;  4AIJ A;  5F6F A;  3F6O A;  2V1X A;  3HHH A;  1K6O A;  3GZ5 A;  5CVV A;  3F8F A;  3I53 A;  4JK1 X;  1OPC A;  1S7O A;  5LHG A;  3HTU A;  1SMY F;  1BC7 C;  1MJA A;  3QU6 A;  4CHU A;  1I6X A;  3DP7 A;  3MZH A;  2VE8 A;  3QP5 A;  1IN7 A;  4OIR F;  1R22 A;  3M8E A;  3DPL C;  3HSF A;  2NS0 A;  4ESJ A;  5E17 F;  3F23 A;  4AWX B;  3QPH A;  4PDK A;  3MZY A;  2DLL A;  1XMK A;  1FY7 A;  4OIP F;  1FLI A;  1J0R A;  3V4G A;  5BPI A;  3QAH A;  2FXA A;  2NRA C;  2VE9 A;  4XSX F;  2PG4 A;  3RKW A;  5E8G A;  2XAS A;  5A2Q Z;  2QBY A;  3SHF A;  1RIO H;  5D6F A;  3T5X A;  1TNT A;  1EV7 A;  3E6D A;  1DP7 P;  2DQR A;  2VT2 A;  3HRS A;  5D6E A;  1HST A;  1ZG5 A;  2G7U A;  4HX7 A;  4DNC A;  2IPQ X;  1T6S A;  3TKY A;  3KLN A;  5E18 F;  2V6C A;  3ZN0 A;  2AXL A;  2FBH A;  2HR3 A;  4UV8 A;  2VC1 A;  5D8L B;  3E5Q A;  1DPU A;  4M9Z A;  2Q0O A;  2UWM A;  2O61 A;  3FX3 A;  1UFM A;  1LVA A;  4KIF A;  5HLG A;  3K2Z A;  2IJL A;  3VEP A;  4Y15 A;  3F21 A;  4OIN F;  4KNY A;  2XAQ A;  4M9X A;  5L3G A;  4M72 A;  3ML6 A;  1LEB A;  3C1D A;  5E20 A;  2P5L C;  3F6V A;  3LAP A;  4QLC U;  5IT9 Z;  2WV0 A;  3BY6 A;  5JVT A;  3KP6 A;  1MDM B;  4UVA A;  1ZGJ A;  5A2Q K;  3FXR A;  4ESF A;  4LLN A;  3WU1 B;  5HS9 A;  2IT0 A;  1BM9 A;  1SFE A;  2F5D A;  1D8K A;  4B09 A;  3HYI A;  1KQ8 A;  4ENJ A;  3GFL A;  5FFZ A;  4ZZD A;  3WTV C;  4M9S A;  4EJO A;  3JAM Z;  4OIQ F;  3FZV A;  2L4M A;  1P92 A;  4WX9 A;  1JHF A;  4OOI A;  2K4B A;  3SFZ A;  3GO5 A;  3LST A;  3K1P A;  3HIF A;  2FEZ A;  4LGW A;  3HHG A;  2Z3Y A;  2O03 A;  1GHC A;  2FU4 A;  4HF0 A;  1R36 A;  2H27 A;  1LEA A;  1YIO A;  2W84 A;  2Q8K A;  2H6B A;  4P5O A;  4IPA A;  3ELK A;  2W24 A;  4NHJ A;  2QEN A;  2O3F A;  1RUO A;  3OOP A;  4ZYD A;  2TDX A;  2VC0 A;  3CDH A;  2CQK A;  5IT9 K;  3F8N A;  4U88 A;  5ERI A;  1OYW A;  2P7V B;  3H3U A;  5DD8 A;  2DTR A;  2YX4 A;  4HF1 A;  3HOS A;  3LWF A;  5LEJ A;  3TOB A;  1YW8 A;  2OAZ A;  5FD5 A;  4O3M A;  2P4W A;  3WGG A;  1ZRF A;  2DU9 A;  4FX0 A;  1QPM A;  1QZZ A;  2L54 A;  5AIP A;  2GZW A;  4HA8 A;  2QM3 A;  3E3V A;  1U5T A;  4YFN F;  4EGY A;  1I1S A;  4UHT A;  1Z91 A;  5E8I A;  1HKT A;  1ZGA A;  4Q48 A;  1B4A A;  5D5V B;  5E1Z B;  3IWZ A;  3P9I A;  4MQV A;  5LBQ A;  3BJA A;  3ZN1 A;  4HX8 A;  1UST A;  2STT A;  4KDP A;  4ENK A;  1FSE A;  1YS6 A;  1O3S A;  5BS6 A;  3KFW X;  1YFH A;  1FWZ A;  2PEX A;  5E1X A;  2UXN A;  2OBP A;  2RC4 A;  1HW5 A;  3JTH A;  3K1M A;  4RGX A;  4UNO A;  1BC8 C;  1HQC A;  5FGM A;  4EM2 A;  4HV5 A;  2P5K A;  2OQR A;  4CYD A;  3LAJ A;  4FT8 A;  2P8T A;  2G9W A;  2A5Y B;  4EQQ A;  3F8M A;  4I98 B;  1FYM A;  2GA2 A;  5LHH A;  4TV7 A;  3CTA A;  3SXY A;  3ERE D;  2LSO A;  1LDK B;  4KT5 C;  2XKO A;  3MAJ A;  3ABU A;  1R00 A;  4RB3 C;  3R6S A;  2FE3 A;  2VOD A;  3RPQ A;  1RNL A;  4QWQ A;  2EFO A;  1ON2 A;  1H9T A;  4HAM A;  2H6C A;  1KU9 A;  2MLK A;  4GXO A;  4L9N A;  4HV6 A;  4FX4 A;  3E6B A;  3EDP A;  2UZK A;  3ZMD A;  1ZAR A;  2K7L A;  3DQV C;  4CO8 A;  4UVB A;  1J2X A;  4A2U A;  1EH7 A;  1TW2 A;  4RB2 C;  1R23 A;  4G6Q A;  2HKX A;  1H0M A;  3MCZ A;  1XN7 A;  2KIM A;  1C0W A;  1TBX A;  1HKQ A;  2COM A;  3SZT A;  1ZRC A;  1MJB A;  3GF2 A;  1FNN A;  1FT9 A;  3M1E A;  4LLG F;  1SD5 A;  2A6H F;  3F8B A;  5ILU A;  1K7A A;  5J8C A;  3WGI A;  2HFH A;  2MLG A;  2XRN A;  1IN6 A;  3J80 K;  3EET A;  3WTX C;  1IN4 A;  1DDN A;  2EJR A;  3FMR A;  4AD9 A;  2XVC A;  2HKO A;  5D4R A;  5ICG A;  2NAZ A;  3KZZ A;  1KYW A;  4M6X A;  4EMS A;  2RV8 A;  2M30 A;  2VBZ A;  2GXB A;  2HOE A;  2V79 A;  2XIG A;  3D0S A;  1YTY A;  4UXN A;  1EH8 A;  4M73 A;  4ZZL A;  3G73 A;  4MTE A;  5JR3 A;  4EJV A;  3VFZ A;  2L4A A;  3WE3 A;  4LB6 B;  2BYV E;  1SD6 A;  1U5T C;  2BBY A;  3LA7 A;  1OKR A;  4CDG A;  3IWF A;  2IW5 A;  2CG4 A;  5JI6 A;  1L3L A;  5K5R A;  5DUI A;  3KP3 A;  3IKT A;  4G7H F;  1CF7 A;  2V1U A;  3N97 A;  4PZJ A;  2ZME A;  4U0Y A;  3M9A A;  1O3Q A;  4XRF A;  3U2R A;  4WWC A;  3T8T A;  3JSO A;  1S3J A;  2PN6 A;  4Y13 A;  3TO7 A;  3GVA A;  4AIK A;  2Y48 A;  2MBF A;  5FFX A;  1WSU A;  1W7P B;  2E1N A;  2K27 A;  3W6K B;  3QP6 A;  3VB2 A;  2XAH A;  5EEH A;  4HLX A;  2ZCW A;  4S04 A;  2FNA A;  4S05 A;  3BRO A;  2Z5U A;  5CJ9 A;  2CO5 A;  3O3K A;  4A6E A;  3WTW C;  2ISZ A;  2FNP A;  4KN7 X;  3KEQ A;  5JFR A;  4MHG A;  1W5T A;  2M45 A;  3WGH A;  1ZRD A;  5HDK A;  4GO1 A;  3V7R A;  2JPC A;  2OZU A;  1SAX A;  2QUF A;  4M71 A;  2Q2E A;  4EM1 A;  3R60 A;  1V4R A;  3J81 Z;  3HRU A;  3F72 A;  4Q5S F;  3O2P E;  1OR7 A;  4CZZ A;  4L18 B;  3DXJ F;  4IVN A;  3T8R A;  3ZMV A;  2MD5 A;  2HQN A;  3RI4 A;  2ETH A;  1TQI A;  1W5S A;  2X0L A;  4L0Z B;  1LB2 A;  2EA4 A;  3VOE A;  5DD4 A;  4WK8 F;  4OMZ A;  1XD7 A;  5BOX A;  2OZ6 A;  2YSR A;  3NQO A;  4BHC A;  2E7W A;  1LJ9 A;  2XAF A;  2PBI A;  2XRO A;  3GFM A;  1KA8 A;  2ZO4 A;  4BH9 A;  3OV8 A;  2RQP A;  3WOD F;  4MTD A;  1IAW A;  2PFB A;  1D3Y A;  5HDN A;  1LQ1 A;  4HQM A;  1YYV A;  2A61 A;  3CUQ B;  5CVI A;  5L3E A;  2DK5 A;  2GQQ A;  5ICC A;  1IXR C;  3ZMS A;  3J81 K;  4A0Y A;  3EYI A;  4RGU A;  4LMY A;  3MWM A;  4L5I A;  2M8E A;  1D5V A;  1J75 A;  2HZT A;  1P4W A;  1U78 A;  3I54 A;  1G3W A;  4ESB A;  4Q47 A;  2FSW A;  3QOP A;  3GX4 X;  1LNW A;  4JQF A;  4P55 A;  4PCQ A;  2LDU A;  2F5F A;  2L01 A;  1BN5 A;  1K79 A;  2A3S A;  4HYE A;  3ZMT A;  1ONV A;  2YX7 A;  1IN8 A;  2CFX A;  3ECO A;  1YW7 A;  2WTE A;  4O5V A;  5TRD A;  2DQL A;  2VOP A;  4YFK F;  5FLX K;  4IXA A;  4HF2 A;  1IXC A;  1Z7U A;  2P7C B;  4LLL A;  4OIO F;  2A69 F;  1A04 A;  4R79 A;  3BP8 A;  2HS5 A;  3F8C A;  3B73 A;  2RKH A;  1R58 A;  4I0A A;  1U8R A;  4E70 A;  3RJP A;  1P4A A;  2QQ9 A;  3V7C A;  4KUM A;  1TW3 A;  2VBX A;  3RYP A;  3I59 B;  3I0T A;  4B8X A;  4HBL A;  2J5P A;  2EWN A;  4IHT A;  3W6J B;  4XSZ F;  3WU0 A;  2GXG A;  3ZMZ A;  3BOQ A;  1ZAO A;  1O57 A;  1RUN A;  3ABT A;  2ELH A;  5ILS A;  4CXF A;  1O7F A;  2XHK A;  2X4H A;  2PLY A;  4RS8 A;  3P9K A;  1KU7 A;  2F5C A;  4Z2Y A;  2PJP A;  1QGP A;  2JSC A;  5BMZ A;  3RTR A;  3LQR A;  1FX7 A;  5L3F A;  1I27 A;  3BDD A;  1DUX C;  3F3X A;  1T2K A;  2W57 A;  1XSX A;  1XCV A;  2L3D A;  4UVC A;  4ETS A;  1FSH A;  4PGG A;  1W4M A;  5JHU A;  1ULY A;  5LGN A;  3TDU C;  5ILV A;  3CO7 C;  4DQ2 A;  5LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...