4G8XA

G1 orf67 / staphyloccus aureus sigmaa domain 4 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
MKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase sigma factor rpoD
publication title Promoter-specific transcription inhibition in Staphylococcus aureus by a phage protein.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Dna binding protein
total genus 19
structure length 61
sequence length 61
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g8xA00
4P9FA 2HFHA 4CYDA 1SFEA 4M6XA 4M9ZA 1BI0A 2ISYA 3D0SA 1R58A 1FYKA 5D8LB 4I09A 3RKXA 1GXQA 2O61A 2R7FA 3T0YA 3JSPA 1MGTA 3LAJA 1XGMA 2YX4A 2XAFA 5TJJA 2BV6A 3DF8A 5CVUA 3CJNA 5H20A 2VT3A 3I64A 1J5YA 4Y15A 1FC3A 2FA5A 2IW5A 5ICCA 3KLNA 4Q48A 1Z7UA 4P96A 4YFKF 3LQRA 2WV0A 4I0BA 3DFGA 4QLCU 2PQ8A 3DPTA 4M73A 4UVAA 1XMAA 3LAPA 3BDDA 3KCCA 2DK8A 1FP2A 4RB0A 2P6SA 2O6GE 3LSTA 2ZKZA 3I71A 4AIJA 5A2QK 1TQMA 1ULYA 1YIOA 2ACJA 2MLGA 4OMYA 5FD6A 1FX7A 4ENNA 5JR3A 1G6NA 3TQNA 1E17A 4YIIA 5EEGA 4BYYA 5D5XB 4RB2C 1B9NA 4UVCA 2HYGD 3V4GA 1YS6A 4S04A 4KN7X 4OMZA 3RPUA 3T5XA 4A6EA 2H94A 4EGZA 1B59A 1HW2A 5FLXZ 4OIRF 2BYVE 1J75A 3WTWC 3VB2A 3K1NA 4ZYGA 4U7DA 2ZBKA 4OINF 2ELHA 4Z2YA 5E1XA 3GYHX 3K9TA 2Z5UA 4CGZA 4LGWA 3E3VA 1AWCA 4LLNA 2A68F 1P92A 2RN7A 1I27A 2M30A 3KP3A 3FX3A 4RAZA 1CF7B 3GEZA 3HTUA 2OA4A 1OYIA 2W25A 3DP7A 4HLXA 3IKTA 2NYXA 4BAYA 3K1MA 4R1HA 4YIFA 1U5TB 4NHJA 4BHCA 4MQ9F 4EVIA 1YW8A 2IA1A 5AONA 4M74A 4G8XA 5TRDA 3BWGA 4P5OA 2Y48A 4GYIA 2EV0A 2EFNA 4RB3C 2VODA 1U5TC 1PDNC 3BPXA 4U0WA 3N97A 5CLSA 1TW3A 4O6JA 4BH9A 2V6CA 3P9KA 3KEOA 1DDNA 5EEHA 2Q0OA 2VOOA 1ZAOA 4U0YA 2BBYA 3LA3A 1WSUA 5CVIA 2EV6A 4BQAA 2P4WA 1D8KA 2BGCA 3M9AA 3JTGA 4HDUA 2JRTA 1CF7A 3E5UA 2ISZA 3QPHA 3LA2A 4H0EA 1TTYA 2QZ8A 1U5TA 2DQRA 4WCGA 1XDSA 2P8TA 1J2XA 3LWFA 1G3TA 3KZYA 3GXOA 2L4MA 1K78B 2YPRA 3FM3A 3EQLF 3FZVA 1S8NA 4O5VA 1KQ0A 3CDHA 1LEBA 2XHKA 1LDKB 2V1DA 5IT9K 3V8JA 1KYZA 3HSRA 1IUYA 3K69A 1W7PB 4OIOF 4KFCA 3QU3A 5DCMB 4IF4A 1S7OA 1LDJA 2NRAC 1JHFA 4WXCA 3PQKA 3WTUC 1XCBA 3C18A 4HV6A 2DU9A 2FNAA 4KIFA 1SAXA 1O57A 2GZWA 2HDCA 2QWWA 5CVJA 4LD5A 1FT9A 2CFXA 4AWXB 4A0YA 2V1UA 4N0BA 2EA4A 5F64A 4R79A 3W6JB 4KN4X 3BJ6A 2CO5A 4UHTA 1R36A 3F8NA 5LGTA 1XGOA 4WF2A 2EFOA 2PJPA 2DBBA 1TBXA 2ESNA 1K78A 2CQKA 5LHGA 3MEXA 2VBYA 3T1BA 4MTDA 3WG9A 3PFIA 2EJRA 3VFZA 2V1XA 3KETA 1BC7C 1RUNA 2G7UA 3WE2A 4KA4A 3RJPA 1QZYA 3WTYC 4EJTA 5D4SA 3JSOA 5F6FA 5E1ZB 1BJAA 4PZJA 2JPBA 3SQNA 2VBZA 2P6TA 4OIPF 2XAHA 3DQVC 5DV5A 3HRTA 4EJOA 4K2EA 5ICEA 2L4AA 4HW0A 3BJOA 2P5LC 3ZPLA 2M8EA 1WI9A 1TNTA 1R7JA 1QZZA 3WTSC 1YTYA 4AIKA 3ZMZA 3VODA 4UNOA 3COAC 1UHMA 3F6VA 2VC1A 1IN5A 5D6FA 3F23A 2QYOA 1YW7A 2VE8A 3E6BA 2O03A 2FBKA 1HKSA 2XGXA 1QBJA 1JGSA 5BPIA 2LDUA 4DNCA 4U7BA 2EB7A 1HSTA 5LRRA 4BXUA 1J9IA 4I0AA 1EV7A 2F5DA 3ULQB 1LJ9A 4PCQA 1Z6TA 4HYEA 1XDUA 2V9VA 4Q5SF 5HDGA 1JE8A 2GAUA 2O0YA 3R61A 3QPTA 3QOPA 1S3JA 1CGPA 3KFWX 5IT3A 2H09A 3VOEA 2HYFA 3OOPA 2XKPA 5E17F 4KNYA 2NAZA 3TKYA 1DPUA 4RAYA 1G4DA 4F7ZA 3HRSA 4ZYDA 1WQ2A 2OQGA 4AD9A 1EH7A 2OBPA 4ASNA 1X3UA 4YG2F 1J0RA 3KEQA 3H3ZA 2PN6A 2Z99A 3HUGA 1R22A 3K1PA 2IPQX 2PMUA 4PGGA 1B1BA 1GXPA 1U78A 1IZ1A 2VXZA 1F1ZA 1ZGJA 2ZNZA 3KP2A 3SXYA 1C0WA 4MNUA 4U88A 1ZG3A 1ZN2A 4MEYF 5DCFA 4G9YA 3E6CC 3H92A 2W85A 3U9GA 4ENKA 4RGXA 2KIUA 3E5XA 4IPAA 2QENA 3V7SA 3ZN0A 5L3DA 2GXGA 1KYWA 1R1VA 3GO5A 2PEXA 1IW7F 2A6HF 1WKMA 3F72A 2FSWA 1K79A 3NEUA 2EWNA 5LLQA 2KIFA 2FMLA 4HQEA 3FF5A 2P5KA 4LB5A 3GLXA 1PP8F 4P9UA 1SD5A 1MDMB 1BN5A 4A12A 3F8BA 2EFQA 2A6EF 2GIVA 2WC2A 4HX8A 2DK5A 3GX4X 4M9XA 2UWMA 1BI3A 2D1HA 1TW2A 5A2QZ 4HQMA 3QP5A 3ZMSA 2E1NA 1STZA 1IXSB 3I53A 3Q9SA 1YLFA 3I59B 5J6XA 4CDGA 3L9FA 1ZARA 3IRRA 3WODF 2XKOA 2JTVA 2F5EA 4HBLA 4MHGA 5LEJA 2H27A 4D0PA 2O8XA 3TOBA 5BPDA 4CZZA 2D1VA 5HLGA 3BZ6A 4ON0A 4MEXF 1MDMA 4CICA 3GUDA 3GWZA 4KMFA 1ON2A 3FXUA 3GFLA 2HEOA 3TDZC 3ECHA 5ICFA 2A69F 1QNTA 3REOA 4GYGA 2XASA 2Y75A 3QAHA 3WTZA 1YFHA 3I59A 4RGUA 1I1GA 3P9CA 2DI3A 4MTEA 4EJVA 3FXQA 1YS7A 2DFIA 1FY7A 4L5IA 5BQTA 1SMYF 2XIGA 1IRGA 3O6BB 2X4HA 1V4RA 3CLOA 4ETSA 3N4MA 2B0LA 3BOQA 3ELKA 1FLIA 2FF4A 1O3RA 1SMTA 1OR7A 4G7OF 3BJAA 5L3BA 2K02A 3FWEA 2HS5A 4OIQF 2XROA 2W24A 4DQ2A 5AIQA 3IKVA 4I01A 1XGSA 2ETHA 4PGHA 2WWYA 3GVAA 4WX9A 1SD7A 2LF7A 4RGSA 1QQIA 3L00A 4IJAA 1T38A 3O2PE 5CYVA 5AIPA 1R5HA 5K5QA 3TOAA 3KZZA 2IA2A 5H6QA 4UUVA 4LFUA 3RKWA 1ODDA 3QU6A 4ZZLA 3HOTA 5IT9Z 2RQPA 2YU3A 4IRHA 1O7FA 2K86A 3R6SA 5ED4A 1FYLA 3MCZA 2OQRA 2P7CB 3G73A 5LHHA 1LEAA 5LGNA 4HOBA 3AAFA 3IC7A 1UB9A 1F4KA 4WXDA 3V8LA 3DEUA 1IN8A 2GA1A 2F2EA 2MA3A 2ESHA 2XAJA 2M45A 4FX0A 4BHPA 4G7HF 2M5WA 1HBXG 1XSVA 1P4WA 2P5VA 4UXNA 3FM5A 3ZMUA 5DD4A 3PQJA 4KICA 1REPC 2R3SA 2ZFWA 3JW4A 1D8JA 1QO0D 3E6MA 2VBXA 4HDVA 3B02A 4WK8F 4BHBA 2GXBA 1MJAA 1K6OA 3FXRA 3WGGA 4AVPA 4GCVA 3G3ZA 1BI2A 1XB4A 1FPQA 2PG4A 4LK1F 2WTEA 2BEOA 1W7PD 2E7WA 1BI1A 2ZO4A 3SHFA 3WGIA 3IL2A 5FFXA 3K2ZA 4L18B 3MWMA 4CO8A 1MJBA 3WU0A 3U2RA 2F5FA 5F1RA 1XSXA 5L3CA 2LF8A 4WXHA 1O7LA 2KIMA 3HSFA 2UXXA 5K5RA 4ESFA 5L3GA 4KT5C 2HWVA 4JBAA 1G3SA 2K27A 4KIGA 5HVQC 1S7AA 2M87A 4L9TA 5FO5A 2K4JA 2IT0A 1IAWA 1HSJA 3FMQA 4ENMA 1YW9A 1IXRC 3V7CA 4M6YA 2G9WA 4EM0B 4Y17A 3R4KA 2HOEA 1W7PA 4UVBA 5DCMA 1FYMA 2OZUA 1D3YA 5E20A 5LEKA 1RZ4A 3R0JA 4EJWA 1KU9A 1YO5C 3J7AO 1BIAA 3MAJA 3MFKA 2EFPA 1IXCA 3GW2A 1O3SA 3D5LA 1USTA 3F8MA 1Z9CA 1H9TA 3I54A 3SZPA 3WTXC 1USSA 2FBIA 1U2WA 3KP5A 3R60A 4JK1X 2YR2A 1W5SA 3IHUA 2V79A 3K0LA 2LKPA 1ZGAA 4XSXF 1LB2A 2IA0A 3I4PA 1TQIA 4FT8A 2A07F 3EDPA 1LQ1A 1XSDA 1XN7A 2XVCA 3P9IA 1R23A 4A0XA 3BROA 1QPMA 3I0TA 4XRFA 3KP4A 2KJCA 2A5YB 2RNJA 2MH9A 3KP7A 5JVTA 2JZYA 1HXDA 3QP6A 2STTA 5ILSA 4HF1A 2STWA 2LNBA 1LDDA 3GZ6A 4LK0F 2EA2A 1KQ8A 1UFMA 5HLHA 3IWZA 5FGMA 3MZYA 2W57A 4PDKA 1Z6RA 1Z91A 3E6DA 4M71A 3OV8A 2Q2EA 3M1EA 5E8GA 2Q8KA 1EH8A 4HF0A 1NHAA 2FMYA 4Q47A 4R8HA 2ZNYA 4ZH4F 2W84A 3L2CA 3M8FA 4KIBA 3V8KA 2J5PA 3HOSA 1T2KA 3FMSA 3RKYA 4FX4A 4HLYA 5E18F 3SZTA 1SFUA 5DEQA 1FBQA 2VONA 3GFMA 3H3UA 1I1SA 2DPDA 4KUMA 1XGNA 1HW1A 4QWQA 1RI7A 1HKQA 3KP6A 1DPRA 4XLNF 2DW4A 4EJUA 4EGYA 4HX4A 2NNNA 2G7HA 4G6DA 4HF2A 1ZRFA 5LRSA 1XMKA 4HV5A 2HQNA 4B09A 2FXAA 3C7JA 2OAZA 2A3SA 2H6CA 3CO7C 1U3EM 2KRFA 2AXLA 1Z05A 1WWXA 2AS5F 1KU3A 3ZP5A 2D45A 1U6GA 2IRFG 4IRGA 1RIOH 2PLYA 2HR3A 5FFZA 4Q4ZF 5HLIA 2ZMEB 1R5GA 3MZHA 2RDPA 1H9GA 2L02A 3VEPA 3EETA 2PFBA 2QUFA 3L09A 1DUXC 1HKTA 5JHUA 4WWCA 1BOAA 2VN2A 4GO1A 3DKWA 4LG0B 2HQRA 2QBYB 2XAQA 1ONVA 5BMZA 1ZRCA 4RGRA 1FSHA 1B6AA 2C6YA 4E70A 5BS6A 2FU4A 3ABUA 5LHIA 1QGPA 4GXOA 2JPCA 2Z33A 5D4RA 2Y0MA 1P4XA 3ZN1A 4AIHA 2UZKA 1LVAA 2OZ6A 3M8EA 3FHZA 2RV8A 4YFXF 1BM9A 2HKXA 5HDKA 2ZJ2A 2ZMEA 2DAOA 4O3MA 3J80K 3LA7A 1EH6A 3CUQB 4G94A 4RS8A 2F5CA 3KE2A 3KLOA 4LG0A 1FWZA 2QBYA 2ADUA 5ERIA 3ZQ7A 3ABTA 4P55A 2IVMA 4HA8A 3T8RA 2FQ3A 3CUQC 3ZMTA 2RGVA 1IF1A 4L5JA 1SD4A 3E97A 3ERED 4ESBA 1RUOA 1BC8C 1PUEE 2R7DA 1ZLKA 4XSZF 3J81Z 1RNLA 2COMA 5HS7A 1XD7A 2A61A 1ZLJA 2DPUA 3BP8A 2MH2A 4OOIA 4FHTA 2TDXA 2UXNA 3CUQA 2L01A 1O3QA 1IRFA 3C1DA 4NQWA 1IN4A 5ILVA 1FP1D 5ICGA 1JXSA 2RVCA 4NB5A 4B8XA 4IVNA 3HTSB 1GVJA 4L9JA 3ZMVA 3TO9A 3NQOA 1TQPA 1KQ9A 2HTSA 4A5NA 1MJ9A 2IJLA 3F22A 3WGHA 1S6LA 3V7RA 3Q5FA 2QQBA 2RC4A 3E5QA 3HRMA 2EV5A 2HTJA 2D2WA 2YSRA 1U8RA 2ZXJA 5K1YA 2MD5A 5D5WB 1LNWA 4CHUA 3F21A 1HW5A 2HKOA 2DO7A 4LLGF 3J81K 4EV0A 1IN7A 4LMYA 5HDNA 5D5VB 1YG2A 3GZ5A 4G6QA 3HRUA 5DUIA 4I2OA 1F9NA 4YFNF 1I6XA 3HIFA 4ENJA 1VTNC 2VC0A 1ZG5A 1Y0UA 2OU2A 2VOPA 2O3FA 5JFRA 2FOKA 4LLLA 5FLXK 1KGSA 5J8FA 4UV9A 2XUBA 2VBWA 5HOOA 4S05A 4BNCA 2XAGA 2FRHA 3LFKA 1ZYRF 3WE3A 2K4BA 4GGGA 2P7VB 4IHSA 5KK1A 1P6RA 3F6OA 3RTRA 1T0FA 3GFIA 5D6EA 4IHTA 1DP7P 1GHCA 2XRNA 5D5UB 3WU1B 1BIBA 3RYPA 5BOXA 4UV8A 3RI4A 2HGCA 3IWFA 1FZPB 3B73A 5CJ9A 3RIRA 2M1BA 2NNYA 3JAMZ 3TO6A 4LJZF 2HZTA 1WRJA 3LQQA 2VT2A 5DYMA 2KKOA 2XV4S 3BPVA 1E2XA 1MKMA 4XLPF 1PP7U 1OPCA 1XCVA 2LSOA 3HSEA 4M9SA 5E1WA 3BY6A 2E7XA 3RYRA 1ZG1A 4I7HA 5L3FA 1R1TA 1FSEA 4A5MA 4L0ZB 1FBSA 1SD6A 3I5UA 1OKRA 3CTAA 4HZFA 1D5VA 1JHHA 4RB1A 1H0MA 1UCRA 1J7KA 1W4MA 2DQLA 2DLLA 5FD5A 4L9VA 5LGUA 3U1DA 3WTVC 4KDPA 3F8CA 3L7WA 3C3WA 1S29A 3EYIA 2DTRA 2PBIA 2RKHA 3GF2A 4EM2A 4Y13A 5H6RA 3RPQA 2MBFA 1O3TA 2QLZA 1P4AA 2FBHA 2H6BA 1J59A 5DD8A 2Z3YA 1R00A 3NRVA 4XBFA 1OYWA 2BE5F 3HYIA 4KMUX 2KJBA 5CVRA 3JAMK 4TV7A 3P7NA 4ZYEA 5E8IA 1ZRDA 2QM3A 1ZH5A 1AOYA 4MGRA 3S2WA 4I98B 2JT1A 4EM1A 1ZHFA 3O3KA 4EQQA 1G3WA 3Q9VA 1B9MA 1FBUA 3WTTC 4A2UA 2CGPA 4LB6B 3TGNA 2VE9A 3QRFF 3ZMDA 4G7ZF 4L0YB 5HS9A 1IN6A 4U0VA 2L54A 4IRIA 2IP2A 4A0ZA 4M72A 2QQAA 2DT5A 2PI0A 1YYVA 1V3FA 5HS8A 5JI6A 3F8FA 4N9HA 4CXFA 1I5ZA 5KVRA 1L3LA 5FB2A 2CSOA 4OU0A 3EUHA 4EMSA 1ON1A 2Z9OA 3TDUC 5LBQA 5D8KB 2OD5A 1KU2A 2X0LA 1A04A 1T98A 2ZCWA 1UHWA 2GQQA 2PMHA 4ESJA 1T39A 1HQCA 3M7GA 3TO7A 3RDIA 3DV8A 2GA2A 1TNSA 3ECOA 3JTHA 3ROUA 1FOKA 3W6KB 1W5TA 1FNNA 1Q1HA 3CUOA 1MD0A 5L3EA 1P2FA 2L3DA 1MZBA 1T6SA 3DXJF 4N9IA 2MLKA 4ZZDA 5DDGA 1KU7A 1G3YA 3ISPA 3DPLC 1F5TA 3SFZA 1B4AA 3FMRA 4A6DA 1R1UA 2FEZA 3I58A 2NS0A 2EK5A 4HX7A 1TLHB 3R0AA 2QVOA 2EFWA 4ZYHA 2J5OA 3GFJA 3T8TA 2JSCA 2QQ9A 5K5OA 2GWRA 3J80Z 1YQAA 1BBYA 4L9NA 1Z1DA 4MQVA 1K7AA 4IXAA 3CO6C 5ILUA 4KYWA 1OMIA 2MC3A 3IRQA 3F3XA 1L0OC 4I02A 2K7LA 3MQ0A 2CWEA 5J8CA 2CG4A 3HHHA 1KA8A 6PAXA 2YX7A 2CW0F 1ZREA 5CVVA 3ML6A 4JQFA 2CYYA 4HAMA 1OYYA 2FNPA 3HHGA 3EYYA 2FE3A 2E1CA 5DUKA 1SFXA
chains in the Genus database with same CATH superfamily
1ERDA 4P9FA 2B7EA 3MKYB 2HFHA 4IHVA 2IS6A 2JA6J 4F3QA 4CYDA 1SFEA 4M6XA 4M9ZA 4OAZA 1BI0A 1T56A 2ISYA 4HNTA 3D0SA 1R58A 1FYKA 5D8LB 2MFZA 2N8GA 3OYJA 4I09A 3RKXA 1GXQA 2O61A 2R7FA 3T0YA 3GBGA 3HPHA 3D5RC 4B3XA 4BJ5C 1MBGA 4N4OB 3JSPA 4E7LA 1VQ7I 2CQQA 2QSFX 5KCMA 1MGTA 2JUGA 3KZIC 4D5CA 3LAJA 1G2HA 1XGMA 3OMYA 3IAM2 2P81A 2YX4A 2XAFA 3MKLA 4ZC3A 4IQJA 5TJJA 2BV6A 2M7AA 3DF8A 1YX3A 2XGDA 1X3WB 3GTOJ 5E3NA 4XKWA 3CCSI 5CVUA 2X48A 3CJNA 5H20A 2HOAA 2VT3A 3I64A 1J5YA 4Y15A 1FC3A 2FA5A 2IW5A 5ICCA 4OAYA 3G1OA 3HOXJ 3JRBA 3KLNA 3BLYA 2HDDA 2DYRH 4Q48A 1Z7UA 4P96A 4YFKF 4IEJA 5EYRA 4BDZA 3LQRA 2WV0A 4I0BA 1OR7C 3DFGA 3DTEA 3FIWA 1NTCA 4QLCU 2PQ8A 4CZCA 5JLWA 3DPTA 4M73A 2DA2A 4UVAA 1LPQA 1XMAA 4RM2A 3LAPA 2E34A 3BDDA 3KCCA 2EILH 2DK8A 1FP2A 4RB0A 2RNGA 2P6SA 4Y7NJ 1UELB 2O6GE 3LSTA 3ABLH 2ZKZA 3I71A 4AIJA 4XM3A 2EZHA 5A2QK 1TQMA 2JN6A 3NAUA 1RPWA 1ULYA 3E0JB 4M3FA 1YIOA 2ACJA 2MLGA 4OMYA 3PM1A 3K4CA 2KIQA 3HOWJ 1D0ZA 1E3HA 4P1WA 2ZJPF 5FD6A 1FX7A 4ENNA 4A3JJ 5JR3A 3OL3A 3W2AA 3OYBA 3AG2H 3BG3A 2EZKA 1DGRM 1G6NA 3TQNA 1E17A 5FLVA 4YIIA 4ZTJA 5EEGA 4BYYA 5D5XB 3M4OJ 4RB2C 1MNDA 1B9NA 2CV2A 4UVCA 2HYGD 3V4GA 1YS6A 2OCEA 4S04A 1YIJI 4KN7X 2KRCA 1M1EB 4OMZA 3RPUA 3T5XA 2X6OA 4A6EA 2H94A 3G6EI 5FLMJ 4EGZA 1B59A 4IZZA 1HW2A 5FLXZ 1MBKA 1TWCJ 4OIRF 2AQFA 3BR0A 2BYVE 1J75A 3WTWC 4ZDPA 3VB2A 1PVEA 3K1NA 4ZYGA 4HG2A 4U7DA 3C2BA 2ZBKA 2VKVA 1B8IB 3K4KA 3HBLA 5GAGJ 4OINF 2ELHA 3HGYA 3FISA 4Z2YA 2ICWG 5GPCA 3SEZA 5E1XA 3CMYA 2Y0SA 4MLOA 3GYHX 1VI0A 2L7ZA 4IKFA 4XKVA 3BR3A 3K9TA 2Z5UA 1X1DA 4CGZA 9ANTA 4RM3A 2R93J 4LGWA 3E3VA 1AWCA 4BU2A 4LLNA 2A68F 4QPOA 1P92A 2RN7A 1I27A 2M30A 1XTAA 3KP3A 3ZXSA 2NXNB 2GOMA 3A01B 3DBLB 3FX3A 4RAZA 1CF7B 3GEZA 3HTUA 2OA4A 1X1AA 3CZ6A 1OYIA 2LP0A 4KJZA 2W25A 3DP7A 4HLXA 2ZJQF 3IKTA 3CDLA 2NYXA 2R7ZJ 4BAYA 1WJBA 1RKTA 3K1MA 4R1HA 3VYRB 4YIFA 1U5TB 4NHJA 4V2FA 4BHCA 3CCLI 3S8PA 4MQ9F 4EVIA 1YW8A 2IA1A 4M3DA 3BZKA 3CMMA 3H9GA 3QPLA 5AONA 4M74A 4G8XA 5TRDA 2M8GX 3BWGA 1POGA 2Y48A 1OFCX 4GYIA 4P5OA 1IDZA 3PJRA 2EV0A 1A5JA 2EFNA 1X58A 3BG9A 4RB3C 3CC4I 2VODA 4G12A 2K9NA 1U5TC 4IX7A 1PDNC 3BPXA 4AYBA 4U0WA 4D5FA 3PL8A 3N97A 5CLSA 1B8IA 3GTGJ 1TW3A 3OYEA 5FKMA 3DU5A 1NK2P 4O6JA 1Y8QB 4BH9A 2V6CA 3P9KA 3KEOA 1DDNA 1BL0A 3NWTA 5EEHA 4DYQA 2Q0OA 3AL0C 2QKMB 2VOOA 2VASA 1QVTA 1ZAOA 4II2A 4U0YA 2FJ1A 1PYVA 2BBYA 3LA3A 1WSUA 5CVIA 2EV6A 4BQAA 2P4WA 1D8KA 2BGCA 3M9AA 3A01A 3JTGA 4BBSJ 4HDUA 2JRTA 4ITVA 1CF7A 3E5UA 2V6EA 2ISZA 3HPGA 3QPHA 2ZC2A 3LA2A 3CCUI 2E1MC 3A0HC 4H0EA 1TTYA 4DZPA 2QZ8A 1U5TA 2DQRA 4WCGA 1XDSA 1FIAA 2P8TA 2QA4I 1J2XA 3LWFA 1I39A 1G3TA 5J1UA 4BUPA 4DJAA 3KZYA 1ETOA 3OYDA 4XN0A 3GXOA 4B47A 3L2UA 2L4MA 1K78B 1QHHD 2DA3A 3QWLA 2YPRA 3FM3A 3EQLF 3FZVA 4E7ZA 1S8NA 4O5VA 2Z1DA 1KQ0A 3CDHA 1LEBA 2MD0A 2VPRA 2XHKA 1LDKB 2V1DA 4XRMA 5EEAA 5IT9K 3V8JA 2JJ7A 4ZTFA 1KYZA 3K7AJ 3HSRA 1IUYA 2KMUA 4J00A 3K69A 2HU9A 5HNFA 1W7PB 4V2GA 1JKRC 1Y56A 1YHQI 4KFCA 3QU3A 4OIOF 5DCMB 4IF4A 1R5ID 2IEKA 2R7UA 1QHGA 3CJTB 1S7OA 1IRXA 1LDJA 3GLLA 2NRAC 5M5YJ 1JHFA 2R7RA 4WXCA 2QCOA 4Z6YA 3PQKA 5KAFC 2XGEA 1XCBA 3C18A 2EBIA 3WTUC 2MABA 4HV6A 1Z21A 1RR7A 2DU9A 2FNAA 4KIFA 1SAXA 1FMWA 1O57A 3PNYA 3DKXA 2GZWA 4II3A 2HDCA 2QWWA 5CVJA 4LD5A 1FT9A 2M34A 1JUSA 2CFXA 4AWXB 4A0YA 2V1UA 3DBRB 2JSPA 4N0BA 2EA4A 2EIKH 5F64A 3SDBA 4R79A 3W6JB 4KN4X 3AFHA 3BJ6A 2CO5A 2IS1A 4UHTA 1R36A 2OF7A 3F8NA 4Y52J 5LGTA 1XGOA 4WF2A 4E7SA 3DEEA 2EFOA 2PJPA 2E19A 2DBBA 3UNGC 2DODA 1TBXA 1TWFJ 2ESNA 2CQKA 5LHGA 4XQFA 4UUSB 3MEXA 1K78A 3M3YJ 2VBYA 3T1BA 4MTDA 2F4IA 3DKYA 3WG9A 5IOZA 2V9PA 3PFIA 2EJRA 2R4GA 2KP6A 3MN2A 2V1XA 3VFZA 4ABZA 3KETA 1EA3A 4J01A 4JX5A 2XRLA 3BTIA 1BC7C 1RUNA 2MSYA 2DT6A 2JVGA 4BJ6C 1VQMI 2G7UA 3WE2A 5IYBJ 4KA4A 3RJPA 1QZYA 3WTYC 3TW6A 4EJTA 1DU0A 5D4SA 3JSOA 1YJ9I 2WB1A 5F6FA 5E1ZB 1S72I 1BJAA 1ZTRA 3H0DA 4PZJA 1X19A 3OY9A 3CC7I 1YITI 2JPBA 3SQNA 1VQ8I 1RESA 1UG0A 2VBZA 2P6TA 4OIPF 4F93B 5M5XJ 2ID3A 2XAHA 3DQVC 2Y31A 3PSFA 3K10A 5DV5A 3HRTA 1Y8RB 3PSIA 4EJOA 4K2EA 5ICEA 3IP4B 1VQ9I 1RKWA 2L4AA 3IH4A 3S16J 4HW0A 3BJOA 2P5LC 3ZPLA 2M8EA 1WI9A 2K9LA 1TNTA 3GMEA 1R7JA 1QZZA 3WTSC 2WAFA 2CUFA 4UUSA 1EF4A 2ZSHB 1YTYA 2DA4A 4AIKA 3ZMZA 1R9TJ 2VJJA 2R5ZB 5DM6F 1TWGJ 3VODA 4UNOA 1SVLA 3COAC 1V5FA 4ZDOA 1UHMA 1SVMA 3F6VA 2VC1A 4XLEA 1IN5A 5D6FA 1X1PA 5FKOA 2CQXA 3F23A 3GTQJ 1R4MB 2QYOA 1OCRH 5F0FA 1YW7A 2VE8A 3E6BA 2O03A 4PJNA 3FKIJ 2M7BA 2W1OA 2FBKA 1HKSA 2F48A 2XGXA 2ZXWH 1QBJA 1JGSA 3M8JA 5BPIA 1XMXA 2LDUA 4DNCA 4U7BA 2EB7A 3J7YJ 1N78A 1HSTA 5FKLA 5LRRA 4BXUA 2VJ5A 1J9IA 4I0AA 4YIRX 1I6HJ 2Q1ZB 1EV7A 4S0HB 3JRGA 4XICA 1QPIA 2HVRA 2F5DA 3CLQA 3ULQB 1LJ9A 4PCQA 1Z6TA 2CW8A 4HYEA 1XDUA 2WV1A 3HUGB 2V9VA 3A1YA 4Q5SF 5HDGA 1JE8A 2L9VA 4C3HJ 2IXSA 1B72B 1MMAA 2GAUA 2O0YA 3R61A 2R5ZA 1FJLA 2ECBA 2KL4A 3QPTA 3QOPA 1W0UA 2W4SA 1S3JA 2QF7A 1CGPA 3HKZA 3KFWX 5DS9A 5IT3A 3K4LA 1GLNA 2DT7B 2H09A 3VOEA 1HDDC 3FHNA 2HXOA 2HYFA 1UJ8A 3BCBA 5BNGA 2XPUA 3OOPA 3SZGA 2XKPA 1O4XA 5E17F 4PJMA 1T08B 4UB6C 1GUUA 3OL4A 2ECCA 1WI3A 4KNYA 1YX5A 4IOAF 2NAZA 2DOFA 3TKYA 1JUPA 1DPUA 3RQIA 2NVTJ 1UG2A 5CPRB 4RAYA 1G4DA 2BHYA 2DYSH 1AA7A 4F7ZA 3HRSA 4ZYDA 4UB8C 2R5YB 1ACIA 2MG4A 1HA8A 1WQ2A 3BTCA 2OQGA 4AD9A 3F0CA 1EH7A 3S15J 2OBPA 2DA5A 4ASNA 2NVUB 1X3UA 4YG2F 1J0RA 3QQAA 3BTLA 5K7FA 4C2UA 3KEQA 2F4OB 3H3ZA 2PN6A 2Z99A 3HUGA 3G1LA 1R22A 3K1PA 2IPQX 4NUBA 2PMUA 4PK4A 4PGGA 1QU3A 2FOWA 1B1BA 1GXPA 3LSPA 1U78A 1B72A 1IZ1A 2VXZA 3KEYA 1MNMC 1F1ZA 1ZGJA 2ZNZA 3KP2A 1FOYA 3DLAA 3SXYA 3BT9A 5EZGA 4BL0B 3FK7A 1A31A 1C0WA 4MNUA 3EUKL 4U88A 3WU2C 1ZG3A 1VZ0A 4C2TA 3JREA 1ZN2A 4MEYF 5DCFA 4G9YA 4M3EA 3E6CC 2DN0A 4J19A 3H92A 2W85A 3U9GA 4ENKA 4RGXA 2KIUA 2CMPA 1ETQA 2L2OA 3E5XA 4IPAA 2QENA 3V7SA 1JKPC 3ZN0A 4DBRA 2WY8Q 5L3DA 2GXGA 1KYWA 1R1VA 1QVUA 3GO5A 1XX5A 3S93A 2PEXA 2BY3A 1EKEA 2CQ7A 5C44J 1IW7F 2A6HF 2R5YA 1WKMA 4RA2A 2LOOA 3F72A 2BVMA 3OYMA 3PNVA 2FSWA 1RR8C 1MMNA 1GT0C 1K79A 1U9OA 3NEUA 4XMYA 2EWNA 5LLQA 2KIFA 1LE8B 2FMLA 4HQEA 2H1KA 1VFCA 3OYAA 3KPHA 3L2QA 3FF5A 2P5KA 4LB5A 3GLXA 3LSMA 5J4VA 4P9UA 3JRCA 1PP8F 1SD5A 1MDMB 1BN5A 4A12A 3JCUC 2VJ4A 5FRMA 3F8BA 2EFQA 2A6EF 2GIVA 2WC2A 3BQZA 4HX8A 2DA6A 5KHDA 2IGMA 2DK5A 3GX4X 4M9XA 2UWMA 3LOCA 1K4TA 1BI3A 2D1HA 1TW2A 5A2QZ 4HQMA 1MSFC 4FETA 1MMDA 2VKDA 3O8HA 3QP5A 1JKOC 3ZMSA 2E1NA 3Q0UA 4BE0A 2HI3A 1F36A 1STZA 1IXSB 3I53A 3SFIA 3Q9SA 1HF0A 1YLFA 3I59B 4HNVA 5J6XA 1PJRA 4CDGA 3L9FA 1P9QC 1ZARA 3IRRA 3S1RJ 4D7NA 2IGKA 3S14J 2CH0A 3WODF 2XKOA 1TL8A 3FDYA 2JTVA 2F5EA 4HBLA 2H8WA 5EZHA 4MHGA 2ZMEC 3A0BC 5LEJA 3G4SI 2BOLA 2H27A 2LG4A 3OOUA 2AO9A 2CV0A 1BW5A 5M3FJ 4D0PA 2FQ4A 2O8XA 3TOBA 5BPDA 2UV1A 1X3ZB 2R7XA 2Y0SN 4CZZA 4DIQA 2D1VA 2IBDA 2F5VA 1LE8A 5EJCA 5GAEJ 5HLGA 3CCJI 3S2HJ 2WADA 3BZ6A 4ON0A 2W48A 1JKQC 1MDMA 4MEXF 3CC2I 4CICA 2CQNA 3GUDA 3GWZA 4JP0A 5IP7J 4KMFA 2LYCA 1MMGA 1IRZA 4D7MA 2L9SA 3PIPF 1ON2A 3FXUA 3GFLA 2HEOA 4IHXA 1WH5A 2KRHA 2KT0A 3TDZC 3ECHA 3RPUD 3ZQIA 3CMEI 4CCOA 5C4XJ 2CS3A 1BJZA 5ICFA 2A69F 1QNTA 3REOA 4A3CJ 4GYGA 1YRNB 2XASA 2V1NA 2EZIA 2Y75A 3QAHA 3WTZA 4DW6A 1YFHA 3I59A 3RCOA 2BY1A 4RGUA 1GV5A 1I1GA 3P9CA 2DI3A 4XK4A 4MTEA 4EJVA 2DFHA 3FXQA 5FJ8J 1YS7A 2DFIA 1FIPA 2R7QA 1FY7A 1OCZH 2K3FA 1U0JA 3OWTA 4PJ0C 4L5IA 2P0WA 1SMYF 3TMOA 2XIGA 5BQTA 1IRGA 3O6BB 4AYBN 5B1BH 2X4HA 1SANA 1V4RA 3CLOA 2KHMA 4ETSA 3D1NI 3N4MA 2B0LA 2ZXHA 3BOQA 4Y33A 2R7SA 3ELKA 1X4OA 4IOCF 2L7MP 4A3EJ 1FLIA 1LKXA 2NS7A 2FF4A 1D0XA 2GXAA 4RAFA 1O3RA 1IJWC 1SMTA 1V55H 3SYTA 1OR7A 4AU7A 3CCQI 4G7OF 3BJAA 2ME6A 3ZQQA 5GAHJ 1KONA 4PSWA 3G2BA 2DA1A 5L3BA 2K02A 1WJCA 1W1WE 3KIOA 5B5EC 1K61A 3FWEA 2HS5A 2KZGA 4OIQF 1YRNA 3S1MJ 2XROA 2W24A 3CCMI 4DQ2A 1WPKA 3IKVA 5AIQA 5TISC 3JR9A 4I01A 3O8GA 1XGSA 2ETHA 4C3JJ 4HRIA 4PGHA 4BE1A 2WWYA 3GVAA 4WX9A 1SD7A 2LF7A 2VQCA 2MYSA 2EQRA 2X9DA 3TEDA 2Z2SB 4RGSA 1QQIA 1H8AC 3L00A 3RZOJ 4IJAA 4DOZA 3O2PE 1T38A 5CYVA 1R4NB 2LKXA 5AIPA 1R5HA 1HOMA 5K5QA 3F9KA 3TOAA 3X2QH 2X51A 3KZZA 2VJIA 1CQTA 3OYGA 2IA2A 5H6QA 4UUVA 4LFUA 3RKWA 2R7WA 1JTYA 1ODDA 2XDVA 3QU6A 1YE9A 4ZZLA 3HOTA 4A3KJ 5IT9Z 3ASOH 4B4CA 5FRNA 2RQPA 2ME0A 2YU3A 4RLQA 4IRHA 2XPVA 1O7FA 1V5EA 2K86A 3CDIA 3KX2A 3BTJA 3R6SA 5ED4A 1FYLA 3MCZA 2ELJA 2E71A 3A2KA 2MW8A 2OQRA 2P7CB 1OQYA 3G73A 5LHHA 1VQ6I 1LEAA 2IGNA 5LGNA 4HOBA 2LTPA 3AAFA 3IC7A 4FE4A 3J7AY 3OIOA 1UB9A 4KITB 2VIXA 2COBA 1F4KA 4WXDA 3V8LA 2Z16A 3AL0B 3DEUA 1IN8A 2V9KA 4XNFA 2GA1A 4XLFA 2F2EA 3CD6I 3S3NA 2MA3A 3QYBA 2DMQA 2VLAA 2ESHA 4GRIA 2XAJA 3Q0VA 2M45A 1IO2A 4FX0A 5DTDA 2I10A 4BHPA 3H1CA 2CFOA 4G7HF 2M5WA 4XIDA 2E1MB 1HBXG 3QOEA 1XSVA 1SFKA 2DJNA 1P4WA 3ESWB 1E0EA 1R71A 2P5VA 3BG5A 4UXNA 5KAIC 3OS0A 3FM5A 1MBHA 2A5WA 5EF6A 3EUAA 3ZMUA 5DD4A 3PQJA 4KICA 1REPC 3DTKA 2R3SA 2ZFWA 5IYCJ 3JW4A 3K70C 1D8JA 1QO0D 3E6MA 2WB1N 3PUFA 4HNUA 2WAEA 2VBXA 3BG6A 4HDVA 2F6CA 2EPFA 3B02A 4LIUA 4WK8F 4BHBA 1I50J 2GXBA 1T0FC 3I56I 1TZLA 1MJAA 2EZLA 1K6OA 5B1AH 3FXRA 3WGGA 4AVPA 4GCVA 2YS9A 4C30A 3G3ZA 4CCMA 1BI2A 1XB4A 1FPQA 2ELKA 2PG4A 4LK1F 2WTEA 4QIWN 2BY0A 2BEOA 4JOMA 1W7PD 1APLC 1BI1A 2E7WA 3B6CA 2ZO4A 3SHFA 5F27A 3WGIA 3IL2A 5FFXA 1Y6IA 4M3BA 5EG0B 3K2ZA 4L18B 3MWMA 4CO8A 4X6AJ 4M6VA 1MJBA 3WU0A 1WVRA 4A93J 3U2RA 4A69C 1SVOA 2F5FA 5F1RA 2CUEA 2E2IJ 1XSXA 4PJJA 5L3CA 2LF8A 4JX4A 4WXHA 4I99C 1O7LA 3VYUB 3HXLA 2KIMA 4RMNA 3HSFA 4X0GA 2UXXA 3KYLA 4MFDA 3ASNH 5K5RA 5GP9A 5JHFA 4ESFA 3H5AA 5L3GA 4KT5C 2HWVA 3S17J 4JBAA 1G3SA 4DZJA 2K27A 4KIGA 4YELA 3FBNB 5HVQC 2LR8A 5K7HA 5F08A 2DMUA 2VPLA 1S7AA 2M87A 1ITYA 1D1CA 4NC6A 4L9TA 5FO5A 3ZQHA 2K4JA 1F43A 2IT0A 1IAWA 2CW7A 3MD2A 1HSJA 2RAEA 3FMQA 1K83J 4ENMA 1YW9A 1IXRC 2KDOA 3V7CA 1VF9A 4M6YA 2HYJA 2G9WA 4EM0B 1VQKI 4A3IJ 2LMDA 4Y17A 3R4KA 2HOEA 1VQ5I 2WY7Q 1XS9A 1V5GA 1V54H 1W7PA 5KNLA 2R7VA 2E2HJ 3HKZN 4HSRA 3HOVJ 4UVBA 5DCMA 2K40A 1FYMA 2JA8J 3U1KA 2OZUA 1D3YA 5E20A 4YEJA 5LEKA 2NVQJ 1YOVB 2X1CA 1RZ4A 3I55I 1IC8A 2OCCH 3R0JA 1OCOH 4EJWA 1KU9A 1YO5C 3H9JA 2DTZA 4IL6C 2L9RA 2L7FP 1WJDA 3J7AO 4PUSA 1KZHA 5E3LA 1BIAA 3MAJA 3MFKA 1WJAA 1Y1VJ 4BBRJ 2O8KA 2EFPA 3C2HA 1IXCA 3GW2A 1MBFA 1O3SA 3D5LA 4LOCA 1EJ9A 1USTA 3F8MA 1ETXA 3K2AA 2H8RA 3ZRGA 1Z9CA 2X85A 1H9TA 3ZGKA 1TWAJ 2JA5J 2X6YA 3I54A 1FTZA 4D1QA 1JUMA 3BR5A 3SZPA 2W82A 1USSA 3WTXC 2FBIA 4GDFA 2D5VA 1LFUP 1U2WA 2X1EA 2K5CA 3KP5A 3R60A 4JK1X 3PUBA 2YR2A 3L1PA 1W5SA 3IHUA 2AXTC 3BC8A 2V79A 3K0LA 2LKPA 1ZGAA 4XSXF 1LB2A 3HB9A 4AUXA 2CUJA 2IA0A 4XONA 3I4PA 4CCJA 1TQIA 4FT8A 1A36A 2Q2EB 2A07F 3EDPA 2DMTA 1XSDA 1LQ1A 1XN7A 2XVCA 3P9IA 5J3LA 1R23A 4A0XA 3BROA 1QPMA 1IG7A 3I0TA 5J1YA 5JVGF 4IHWA 3VYTB 4XRFA 4HSTA 1AKHB 3VPRA 3KP4A 2KJCA 1D0YA 2XB5A 4JX6A 3S1QJ 2WAQA 2A5YB 2Y30A 4H4KC 2RNJA 2MH9A 2RREA 3KP7A 5JVTA 2JZYA 2L7KA 3MKWB 1N77A 5GTHC 2BVLA 3JRDA 5DM7F 1QA6A 4FTHA 1HXDA 3QP6A 2STTA 5IYDJ 2VQGA 1UZCA 3P5JA 5ILSA 4HF1A 4XRSG 2E36A 2STWA 3CCVI 2LNBA 1FTTA 2HVQA 1LDDA 3GZ6A 2HPIA 2JUCA 4LK0F 2EA2A 1KQ8A 3QYEA 3ONQA 3W2WA 1UFMA 5HLHA 5HLTA 3IWZA 3ABKH 5FGMA 3MZYA 2LH9A 2W57A 1IV8A 4PDKA 1Z6RA 1Z91A 2LVSA 3E6DA 4M71A 3H35A 1LUJB 2Q2EA 3OV8A 3ERMA 3M1EA 5E8GA 2Q8KA 1EH8A 3TP3A 1WGXA 1ETYA 1NHAA 4HF0A 2FMYA 2OV7A 2LD5A 2WA0A 4Q47A 4BY7J 1FOWA 4R8HA 2ZNYA 4ZH4F 2W84A 2YUSA 3H3VK 3Q0WA 1AKHA 3L2CA 3IV5A 2TCTA 2XF6A 3M8FA 4KIBA 3V8KA 3RQ4A 3V42A 3KYCB 2J5PA 5J1RA 3OYKA 3HOSA 3CCEI 5E79C 3SJMA 1T2KA 1X1BA 2OTJI 3ABMH 3FMSA 2AHQA 1G8XA 3RKYA 3AKZA 2KFDA 3OSGA 2DJIA 4FX4A 1RRJA 1U9NA 4E4HA 4B43A 5E18F 4HLYA 3SZTA 1SFUA 4A3LJ 4ANJA 1R6RA 1AHDP 1E3OC 1TT5B 2Y2ZA 5DEQA 3BQYA 1FBQA 1HLVA 2VONA 3GFMA 3L2VA 3MMYB 2DFFA 1OCPA 2M3AA 3CF5F 3OS2A 2XF7A 1SEUA 4A3DJ 5JLXA 2XF5A 3H3UA 1R49A 1I1SA 2DPDA 4KUMA 1XGNA 3W3CA 5F0CA 1HW1A 4QWQA 1RI7A 4CCLA 3QPSA 3OYLA 1IV6A 5C4JJ 1UHSA 5F1JA 1HKQA 2LRDA 3KP6A 1DPRA 4XLNF 2DW4A 4EJUA 1BW6A 4EGYA 4HX4A 3AG1H 2H1LA 2NNNA 1T8IA 5EGOB 2G7HA 3M1CA 4G6DA 1BA5A 4BQOA 4HF2A 1Y39A 1ZRFA 1XG1A 3TW7A 5LRSA 3L2WA 1HDPA 3OR1C 3BZCA 1JI8A 1XMKA 4HV5A 4FQGA 2BXYA 2HQNA 4PSXA 4B09A 3NWSA 2FXAA 2HOTA 3TL4X 3C7JA 3D5SC 2OAZA 2CRGA 3FXKA 4Y3OA 3ZQLA 2QKLB 4DBQA 2DMPA 4C2MJ 2A3SA 2H6CA 3CO7C 4UY8I 2DOEA 1U3EM 4BGDA 2KRFA 2AXLA 3IH2A 2LKSA 3B6AA 1Z05A 1WWXA 2E2JJ 3QYFA 2Y9YA 2AS5F 4BE2A 1GVDA 3ZOBA 1KU3A 2QQ8A 3ZP5A 2DDBA 3OS1A 5E3OA 2CJJA 2D45A 1AU7A 4BDYA 1U6GA 2Y9ZA 1K6YA 2PMZA 3ZQCA 1T95A 3JRHA 1YJNI 5J40A 2IRFG 3HOZJ 1VQOI 2HZDA 3A02A 4IRGA 4MFEA 1U8BA 1RIOH 2PLYA 2HR3A 5FFZA 4Q4ZF 5HLIA 2ZMEB 1R5GA 2E35A 1WJFA 4ZJZA 1BOBA 4RAGA 3MZHA 2M0MA 1Z67A 1H9GA 2L02A 2RDPA 2V26A 3VEPA 4B1RA 3EETA 1LVKA 1JTXA 2PFBA 2QUFA 3GZNB 3L09A 2GOXB 1DUXC 3S2DJ 3NARA 1HKTA 2IS2A 5JHUA 4WWCA 3RSNA 1YJWI 1BOAA 2VN2A 4GO1A 3RZDJ 5E3MA 3DKWA 1K4SA 4LG0B 2HQRA 5HODA 2QBYB 2XAQA 1ONVA 1BR4A 4OWRB 1ETWA 2NVYJ 5BMZA 3H36A 1ZRCA 2DMNA 4V19K 3CP8A 4QTRA 2NVXJ 4L5EA 4RGRA 1FSHA 1B6AA 2C6YA 2PJRB 4E70A 5BS6A 2R7OA 4PJLA 2DXIA 2EINH 4BQQA 2FU4A 1DQUA 3ABUA 5FKKA 5LHIA 4XOPA 1QGPA 4GXOA 3H0GJ 2QSGX 2L9NA 2JPCA 2M2EA 2Z33A 1GV2A 5D4RA 1W36C 2EIJH 2Y0MA 1P4XA 3ZN1A 3CJQB 4AIHA 2UZKA 3CCRI 1LVAA 2OZ6A 3M8EA 4NNJA 1OISA 3FHZA 1ZR2A 2DDAA 2RV8A 4YFXF 1BM9A 3HJEA 2HKXA 3SEQA 5HDKA 2BW3B 2ZJ2A 2ZMEA 3S3OA 1LFBA 2K9MA 1WZ2A 3PIOF 2DAOA 1A6QA 1Q1VA 1MIJA 2BXZA 2R0QC 4O3MA 1S7EA 3J80K 4BQNA 3ZCOA 3MZ8A 3TBIA 3LA7A 2DCEA 2VB6A 5CQGA 1EH6A 1ZK8A 5J47A 3CUQB 4G94A 2RQQA 2MGQA 4RS8A 1N25A 2E5ZA 2F5CA 1TWHJ 3KE2A 3KLOA 4NQWB 4LG0A 1MSEC 1FWZA 2QBYA 3OIQA 4NC7A 2ADUA 5ERIA 5IP6A 1ZQ3P 3ZQ7A 1S5LC 1MH3A 1ZELA 3J7ZI 1MBJA 4CCKA 2PJRA 3ABTA 4P55A 2IVMA 4HA8A 1SAUA 3T8RA 2FQ3A 2JA7J 3CUQC 4BXXJ 1XC5A 3ZMTA 3I4MJ 3DBHB 2RGVA 1H88C 1IF1A 4L5JA 1SD4A 2LK2A 4W1UA 2XAUA 3RKQA 3E97A 3ZQFA 3HG9A 4AVZA 3ERED 1J09A 1X4PA 2QEXI 4ESBA 4CYCB 1RUOA 2OPTA 4DYCA 3A03A 3MVPA 3OIPA 2XC7A 1BC8C 1PUEE 4IQ4A 2R7DA 3LSKA 3DEWA 1ZLKA 4XSZF 3J81Z 2BW3A 1RNLA 2COMA 5HS7A 3ZR8X 3WHBA 1MW7A 1I3QJ 1XD7A 2A61A 1ZLJA 2DPUA 3BP8A 2IGOA 2JQ7A 2MH2A 2IS4A 2BZTA 1ZR4A 2L5QA 4OOIA 4FHTA 3AG4H 2TDXA 2UXNA 3CUQA 1OJLA 2L01A 2M4GA 1O3QA 1IRFA 3C1DA 4BJTA 4NQWA 1IN4A 1P7JA 3N05A 1JGGA 5ILVA 1FP1D 1D5YA 4I6ZA 4XLHA 5M3MJ 2LBFB 3BR2A 1LFPA 1MBEA 3FKJA 2KLOA 4JYKA 4GFBA 2HQAA 2ID6A 5ICGA 1JXSA 4ZYAA 2RVCA 4RBOA 4NB5A 4B8XA 4IVNA 3HTSB 1GVJA 1P7IA 4L9JA 1A6IA 4IO9F 2VKHA 1Z77A 3LSIA 3FXMA 3ZMVA 1D1AA 3NQOA 3TO9A 1Y0NA 4BXFA 4CYCA 1TQPA 4F92B 1KQ9A 2HTSA 4A5NA 4E7JA 5GPAA 1MJ9A 2IJLA 2DFEA 3F22A 1UAAA 1FOXA 3WGHA 1WJEA 5FKNA 3E7LA 5B3SH 1W0TA 1DGWY 4AC0A 5LD2C 1Z0XA 3CP2A 1S6LA 2JWTA 3V7RA 5J4YA 3Q5FA 3W2VA 1VNDA 2KPMA 2QQBA 3VSKA 2RC4A 2ZFUA 3E5QA 4XN3A 4DGWB 2VI6A 3CMAI 3HRMA 1ETVA 2EV5A 3GTLJ 2HTJA 3K70D 5CQEA 1I3AA 2D2WA 2YSRA 4CSWA 2XSDC 1PUFB 3HEFA 2XGCA 1U8RA 2ZXJA 2CU7A 1BR2A 5K1YA 2MD5A 5D5WB 2LC2A 1LNWA 4CHUA 1JT0A 3GTKJ 2CUZA 3F21A 2LBFA 1OCTC 2E5NA 1HW5A 2HKOA 2DO7A 4LLGF 3J81K 2NOGA 1H89C 4EV0A 1IN7A 4LMYA 5HDNA 1JJ8C 5D5VB 2JA2A 1YG2A 2OUMA 1WCMJ 3GZ5A 3L2RA 4G6QA 3HRUA 5DUIA 1NG7A 4N4NB 4I2OA 1F9NA 4B44A 4C9YA 4YFNF 1I6XA 3CQZJ 3HIFA 4ENJA 1VTNC 2EH3A 4QPQA 2VC0A 4XL9A 1ZG5A 1G59A 3HC7A 1Y0UA 2OU2A 3BR1A 2VOPA 2FUG2 4XLCA 2O3FA 1RETA 2YU9J 5JFRA 2FOKA 4LLLA 4XRSA 5FLXK 3FK6A 1KGSA 5J8FA 3UKGA 4UV9A 2XUBA 2VBWA 2FX0A 5HOOA 4S05A 3GTJJ 1ENHA 2VXDA 1X2NA 4BNCA 2XAGA 1PUFA 2X6XA 2FRHA 3PNTA 1VQ4I 1WH7A 3LFKA 1MMSA 1ZYRF 3WE3A 2K4BA 4GGGA 2P7VB 3M07A 3SDGA 4IHSA 3DCFA 5KK1A 3HM5A 4DYRA 1P6RA 3F6OA 3S32A 4A3GJ 3RTRA 1T0FA 5B66C 2V7FA 3OYIA 2JRMA 2VL8A 5F0HA 3GFIA 2L0KA 1TP4A 1VQNI 5D6EA 1ZKGA 1WJ5A 4IHTA 1DP7P 1GHCA 4E7KA 2KQRA 1WHUA 2GLOA 2XRNA 3K4JA 5D5UB 1JJ6C 3H9QA 4XLAA 3G71I 2O7OA 2WAQN 3WU1B 1BIBA 4KISA 3RYPA 3K4BA 3LSRA 5BOXA 4UV8A 3RI4A 1DP3A 2HGCA 3IWFA 2B63J 1FZPB 3IH3A 3B73A 5CJ9A 1NK3P 3RIRA 4C3IJ 3KYDB 2M1BA 4HPQA 4HEA2 2NNYA 3HDDA 2A05A 4NDLA 3HOUJ 2DOAA 3VSLA 3JAMZ 3TO6A 1RC9A 4LJZF 2HZTA 3LNQA 1ZGWA 1WRJA 3GTPJ 3LQQA 2VT2A 1OCCH 3UR3C 4F91B 5DYMA 2KKOA 2XV4S 3BPVA 2HOSA 1E2XA 4XOTA 1MKMA 4XLPF 1PP7U 2HDWA 1OPCA 1XCVA 5EG0A 2LSOA 3HSEA 4M9SA 5FROA 3JRIA 5E1WA 2ZB9A 1VQPI 2GBYA 3H5NA 1TT0A 2XSJC 3BY6A 3S3MA 4CUGA 4MIMA 3PFYA 2VQHA 2E7XA 3RYRA 2LFBA 4BY1J 1ZG1A 2X6WA 4I7HA 5L3FA 2VUMJ 1D1BA 1R1TA 1FSEA 4A5MA 4L0ZB 4XORA 3PO3J 1FBSA 1SD6A 4PFOA 4E7HA 3CF2A 3I5UA 2EIMH 2WBMA 2ZJRF 3Q3SA 1E3PA 4LIVA 1OKRA 2HNHA 2O5RA 2OJED 3CTAA 4G6TB 4HZFA 1D5VA 4B3AA 1JHHA 3I9V2 5F04A 2VKEA 1NG6A 4FCYA 1SC7A 4RLFA 1DU6A 4RB1A 1X2MA 1H0MA 1UCRA 1J7KA 1W4MA 2R92J 3DPUA 1ETKA 2DQLA 2MC4A 2DLLA 5FD5A 4L9VA 5LGUA 3U1DA 3WTVC 1IGNA 2F4MB 4AIDA 4KDPA 3LMMA 3DTIA 3F8CA 3C2GA 3DU6A 3L7WA 4IHYA 3GCMA 3C3WA 1S29A 4BEHB 3EYIA 2DTRA 2PBIA 2RKHA 3GF2A 4UUTA 4EM2A 4Y13A 3VWBA 2KISA 2M9HA 2JMWA 3CJRB 5H6RA 2HVSA 2CV1A 3RPQA 4KT6A 2MBFA 1O3TA 2QLZA 1P4AA 3WHCA 4PFPA 2TRTA 2FBHA 2H6BA 5GTIC 1J59A 4RDUA 1Z7LA 2V4JC 3QODA 5DD8A 1A35A 2Z3YA 1R00A 3K6GA 3NRVA 4XBFA 1OYWA 2BE5F 3HYIA 4KMUX 2KJBA 5CVRA 4A3MJ 2JVHA 3JAMK 5IPAA 1BR1A 3HZJA 4TV7A 3P7NA 3A4CA 4ZYEA 5E8IA 1ZRDA 2QM3A 1ZH5A 1AOYA 1WFXA 4MGRA 3S2WA 2E60A 4I98B 4I76A 1X1CA 2G0EA 2JT1A 4EM1A 1ZHFA 3O3KA 4EQQA 1G3WA 2PX9A 4NBQA 2E1OA 3Q9VA 1B9MA 1FBUA 2K9SA 3WTTC 2LREA 4A2UA 2CGPA 3EUHC 4LB6B 1QRYA 3OR2C 1SFOJ 3TGNA 2VE9A 2B9SA 1GDTA 3I3LA 3BG7A 3QRFF 3ZMDA 4G7ZF 4L0YB 5HS9A 3HOYJ 4ZDLA 2O9LA 1MH4A 4FASD 3LFUA 3ZQGA 5GADJ 4YRVA 4BEHA 1IN6A 4U0VA 4BACA 2L54A 1Z3XA 4IRIA 3JRFA 4F55A 2IP2A 4A0ZA 4M72A 2QQAA 2DT5A 2PMZN 2PI0A 1YYVA 1V3FA 3TP0A 2ZSIB 5LFAA 4EEFG 3IUOA 3CESA 5HS8A 1NH3A 1JT6A 2R7TA 5JI6A 4XKBA 4FE7A 3F8FA 4XR6A 5CKTA 4N9HA 4CXFA 1I5ZA 2M0CA 5KVRA 4A3FJ 1L3LA 5FB2A 2CSOA 4OU0A 2I5UA 2NS8A 3EUHA 4EMSA 1ON1A 2Z9OA 3LSGA 3TDUC 5LBQA 5D8KB 2OD5A 3OYHA 1FMVA 1KU2A 2X0LA 4D9JA 1A04A 2IAIA 1T98A 2ZCWA 1UHWA 5IP9J 4CCNA 3JRAA 2GQQA 2GM4A 4M3GA 2PMHA 2KZVA 3OYNA 3GTMJ 4ESJA 4X1EA 1W5CC 1T39A 1HQCA 3M7GA 3TO7A 2FD5A 2VQLA 3DV8A 3RDIA 2GA2A 3AG3H 4EATA 1TNSA 3ECOA 3JTHA 3WG7H 5H2FC 3ROUA 1N75A 1FOKA 3H5RA 3CCYA 2DA7A 2UUZA 3W6KB 4E7IA 3BR6A 1W5TA 1FNNA 1Q1HA 3BCAA 3HL2A 5HNHA 3CUOA 2I8DA 2X1DA 3VYSB 1MD0A 2K85A 3G1MA 3HGGA 2LY9A 5L3EA 2Y69H 3W6VA 2LLKA 1P2FA 2L3DA 1MZBA 1T6SA 3DXJF 4N9IA 1HCRA 2MLKA 2HQ5A 4ZZDA 5DDGA 4U87A 1KU7A 4XKCA 1G3YA 1ORKA 4LITA 3ISPA 3DPLC 5TGTA 1F5TA 2M4KA 1HC8A 2AQEA 3SFZA 5EDNA 1B4AA 3FMRA 4A6DA 3FBIB 2NOJB 1T33A 3LSJA 4E6KG 5K7ZA 3LSHA 1R1UA 2K9QA 2BY2A 1Y1WJ 2OC6A 2FEZA 4A3BJ 4AM3A 4CA0A 1UMQA 3I58A 4BS9A 3LL7A 3K4MA 2NS0A 2EK5A 4HX7A 1TLHB 4B48A 1VQLI 3PO2J 3MKZA 3R0AA 2QVOA 2EFWA 4ZYHA 2K3PA 2OTLI 2J5OA 3GFJA 3T8TA 2JSCA 2QQ9A 5K5OA 2QSHX 2LY2A 2GWRA 4MO7A 1MNEA 3EPZA 3J80Z 4BKXA 4Y4RA 1IUFA 1YQAA 1BBYA 4L9NA 1S9HA 1Z1DA 4CH7A 2XB0X 3FXOA 4LG3A 4MQVA 1K7AA 4QSHA 3I4NJ 4IXAA 2GIZA 3CO6C 3OYFA 2W7NA 3VDXA 1IDYA 4F52A 2W00A 2JK3A 4NC8A 5ILUA 4KYWA 2LY1A 1OMIA 1QZEA 2MC3A 3IRQA 3F3XA 1YI2I 5IY5H 3DLLF 1L0OC 3FXJA 1Z3YA 2K7LA 3E1SA 2A6TA 3MQ0A 4I02A 3OYCA 2CWEA 1FEXA 5J8CA 2BHZA 2CG4A 3HHHA 3U21A 3S1NJ 3OSFA 1KA8A 6PAXA 2YX7A 2CW0F 3IAS2 5EGOA 1ZREA 5CVVA 2HXIA 2ZXIA 3ML6A 3DWLE 4JQFA 2KDZA 2CYYA 3K4NA 1W36D 4HAMA 1XPXA 1OLTA 4W97A 1OYYA 2QGUA 4FISA 2XPWA 2FNPA 5IOYA 1TC3C 3HHGA 3FXLA 3EYYA 2FE3A 5C3EJ 2HPMA 5M5WJ 2E1CA 5DUKA 1SFXA
chains in the Genus database with same CATH topology
4P9FA 2HFHA 4CYDA 1SFEA 4M6XA 4M9ZA 1BI0A 2ISYA 3D0SA 1R58A 1FYKA 5D8LB 4I09A 3RKXA 1GXQA 2O61A 2R7FA 3T0YA 3JSPA 1MGTA 3LAJA 1XGMA 2YX4A 2XAFA 5TJJA 2BV6A 3DF8A 5CVUA 3CJNA 5H20A 2VT3A 3I64A 1J5YA 4Y15A 1FC3A 2FA5A 2IW5A 5ICCA 3KLNA 4Q48A 1Z7UA 4P96A 4YFKF 3LQRA 2WV0A 4I0BA 3DFGA 4QLCU 2PQ8A 3DPTA 4M73A 4UVAA 1XMAA 3LAPA 3BDDA 3KCCA 2DK8A 1FP2A 4RB0A 2P6SA 2O6GE 3LSTA 2ZKZA 3I71A 4AIJA 5A2QK 1TQMA 1ULYA 1YIOA 2ACJA 2MLGA 4OMYA 5FD6A 1FX7A 4ENNA 5JR3A 1G6NA 3TQNA 1E17A 4YIIA 5EEGA 4BYYA 5D5XB 4RB2C 1B9NA 4UVCA 2HYGD 3V4GA 1YS6A 4S04A 4KN7X 4OMZA 3RPUA 3T5XA 4A6EA 2H94A 4EGZA 1B59A 1HW2A 5FLXZ 4OIRF 2BYVE 1J75A 3WTWC 3VB2A 3K1NA 4ZYGA 4U7DA 2ZBKA 4OINF 2ELHA 4Z2YA 5E1XA 3GYHX 3K9TA 2Z5UA 4CGZA 4LGWA 3E3VA 1AWCA 4LLNA 2A68F 1P92A 2RN7A 1I27A 2M30A 3KP3A 3FX3A 4RAZA 1CF7B 3GEZA 3HTUA 2OA4A 1OYIA 2W25A 3DP7A 4HLXA 3IKTA 2NYXA 4BAYA 3K1MA 4R1HA 4YIFA 1U5TB 4NHJA 4BHCA 4MQ9F 4EVIA 1YW8A 2IA1A 5AONA 4M74A 4G8XA 5TRDA 3BWGA 4P5OA 2Y48A 4GYIA 2EV0A 2EFNA 4RB3C 2VODA 1U5TC 1PDNC 3BPXA 4U0WA 3N97A 5CLSA 1TW3A 4O6JA 4BH9A 2V6CA 3P9KA 3KEOA 1DDNA 5EEHA 2Q0OA 2VOOA 1ZAOA 4U0YA 2BBYA 3LA3A 1WSUA 5CVIA 2EV6A 4BQAA 2P4WA 1D8KA 2BGCA 3M9AA 3JTGA 4HDUA 2JRTA 1CF7A 3E5UA 2ISZA 3QPHA 3LA2A 4H0EA 1TTYA 2QZ8A 1U5TA 2DQRA 4WCGA 1XDSA 2P8TA 1J2XA 3LWFA 1G3TA 3KZYA 3GXOA 2L4MA 1K78B 2YPRA 3FM3A 3EQLF 3FZVA 1S8NA 4O5VA 1KQ0A 3CDHA 1LEBA 2XHKA 1LDKB 2V1DA 5IT9K 3V8JA 1KYZA 3HSRA 1IUYA 3K69A 1W7PB 4OIOF 4KFCA 3QU3A 5DCMB 4IF4A 1S7OA 1LDJA 2NRAC 1JHFA 4WXCA 3PQKA 3WTUC 1XCBA 3C18A 4HV6A 2DU9A 2FNAA 4KIFA 1SAXA 1O57A 2GZWA 2HDCA 2QWWA 5CVJA 4LD5A 1FT9A 2CFXA 4AWXB 4A0YA 2V1UA 4N0BA 2EA4A 5F64A 4R79A 3W6JB 4KN4X 3BJ6A 2CO5A 4UHTA 1R36A 3F8NA 5LGTA 1XGOA 4WF2A 2EFOA 2PJPA 2DBBA 1TBXA 2ESNA 1K78A 2CQKA 5LHGA 3MEXA 2VBYA 3T1BA 4MTDA 3WG9A 3PFIA 2EJRA 3VFZA 2V1XA 3KETA 1BC7C 1RUNA 2G7UA 3WE2A 4KA4A 3RJPA 1QZYA 3WTYC 4EJTA 5D4SA 3JSOA 5F6FA 5E1ZB 1BJAA 4PZJA 2JPBA 3SQNA 2VBZA 2P6TA 4OIPF 2XAHA 3DQVC 5DV5A 3HRTA 4EJOA 4K2EA 5ICEA 2L4AA 4HW0A 3BJOA 2P5LC 3ZPLA 2M8EA 1WI9A 1TNTA 1R7JA 1QZZA 3WTSC 1YTYA 4AIKA 3ZMZA 3VODA 4UNOA 3COAC 1UHMA 3F6VA 2VC1A 1IN5A 5D6FA 3F23A 2QYOA 1YW7A 2VE8A 3E6BA 2O03A 2FBKA 1HKSA 2XGXA 1QBJA 1JGSA 5BPIA 2LDUA 4DNCA 4U7BA 2EB7A 1HSTA 5LRRA 4BXUA 1J9IA 4I0AA 1EV7A 2F5DA 3ULQB 1LJ9A 4PCQA 1Z6TA 4HYEA 1XDUA 2V9VA 4Q5SF 5HDGA 1JE8A 2GAUA 2O0YA 3R61A 3QPTA 3QOPA 1S3JA 1CGPA 3KFWX 5IT3A 2H09A 3VOEA 2HYFA 3OOPA 2XKPA 5E17F 4KNYA 2NAZA 3TKYA 1DPUA 4RAYA 1G4DA 4F7ZA 3HRSA 4ZYDA 1WQ2A 2OQGA 4AD9A 1EH7A 2OBPA 4ASNA 1X3UA 4YG2F 1J0RA 3KEQA 3H3ZA 2PN6A 2Z99A 3HUGA 1R22A 3K1PA 2IPQX 2PMUA 4PGGA 1B1BA 1GXPA 1U78A 1IZ1A 2VXZA 1F1ZA 1ZGJA 2ZNZA 3KP2A 3SXYA 1C0WA 4MNUA 4U88A 1ZG3A 1ZN2A 4MEYF 5DCFA 4G9YA 3E6CC 3H92A 2W85A 3U9GA 4ENKA 4RGXA 2KIUA 3E5XA 4IPAA 2QENA 3V7SA 3ZN0A 5L3DA 2GXGA 1KYWA 1R1VA 3GO5A 2PEXA 1IW7F 2A6HF 1WKMA 3F72A 2FSWA 1K79A 3NEUA 2EWNA 5LLQA 2KIFA 2FMLA 4HQEA 3FF5A 2P5KA 4LB5A 3GLXA 1PP8F 4P9UA 1SD5A 1MDMB 1BN5A 4A12A 3F8BA 2EFQA 2A6EF 2GIVA 2WC2A 4HX8A 2DK5A 3GX4X 4M9XA 2UWMA 1BI3A 2D1HA 1TW2A 5A2QZ 4HQMA 3QP5A 3ZMSA 2E1NA 1STZA 1IXSB 3I53A 3Q9SA 1YLFA 3I59B 5J6XA 4CDGA 3L9FA 1ZARA 3IRRA 3WODF 2XKOA 2JTVA 2F5EA 4HBLA 4MHGA 5LEJA 2H27A 4D0PA 2O8XA 3TOBA 5BPDA 4CZZA 2D1VA 5HLGA 3BZ6A 4ON0A 4MEXF 1MDMA 4CICA 3GUDA 3GWZA 4KMFA 1ON2A 3FXUA 3GFLA 2HEOA 3TDZC 3ECHA 5ICFA 2A69F 1QNTA 3REOA 4GYGA 2XASA 2Y75A 3QAHA 3WTZA 1YFHA 3I59A 4RGUA 1I1GA 3P9CA 2DI3A 4MTEA 4EJVA 3FXQA 1YS7A 2DFIA 1FY7A 4L5IA 5BQTA 1SMYF 2XIGA 1IRGA 3O6BB 2X4HA 1V4RA 3CLOA 4ETSA 3N4MA 2B0LA 3BOQA 3ELKA 1FLIA 2FF4A 1O3RA 1SMTA 1OR7A 4G7OF 3BJAA 5L3BA 2K02A 3FWEA 2HS5A 4OIQF 2XROA 2W24A 4DQ2A 5AIQA 3IKVA 4I01A 1XGSA 2ETHA 4PGHA 2WWYA 3GVAA 4WX9A 1SD7A 2LF7A 4RGSA 1QQIA 3L00A 4IJAA 1T38A 3O2PE 5CYVA 5AIPA 1R5HA 5K5QA 3TOAA 3KZZA 2IA2A 5H6QA 4UUVA 4LFUA 3RKWA 1ODDA 3QU6A 4ZZLA 3HOTA 5IT9Z 2RQPA 2YU3A 4IRHA 1O7FA 2K86A 3R6SA 5ED4A 1FYLA 3MCZA 2OQRA 2P7CB 3G73A 5LHHA 1LEAA 5LGNA 4HOBA 3AAFA 3IC7A 1UB9A 1F4KA 4WXDA 3V8LA 3DEUA 1IN8A 2GA1A 2F2EA 2MA3A 2ESHA 2XAJA 2M45A 4FX0A 4BHPA 4G7HF 2M5WA 1HBXG 1XSVA 1P4WA 2P5VA 4UXNA 3FM5A 3ZMUA 5DD4A 3PQJA 4KICA 1REPC 2R3SA 2ZFWA 3JW4A 1D8JA 1QO0D 3E6MA 2VBXA 4HDVA 3B02A 4WK8F 4BHBA 2GXBA 1MJAA 1K6OA 3FXRA 3WGGA 4AVPA 4GCVA 3G3ZA 1BI2A 1XB4A 1FPQA 2PG4A 4LK1F 2WTEA 2BEOA 1W7PD 2E7WA 1BI1A 2ZO4A 3SHFA 3WGIA 3IL2A 5FFXA 3K2ZA 4L18B 3MWMA 4CO8A 1MJBA 3WU0A 3U2RA 2F5FA 5F1RA 1XSXA 5L3CA 2LF8A 4WXHA 1O7LA 2KIMA 3HSFA 2UXXA 5K5RA 4ESFA 5L3GA 4KT5C 2HWVA 4JBAA 1G3SA 2K27A 4KIGA 5HVQC 1S7AA 2M87A 4L9TA 5FO5A 2K4JA 2IT0A 1IAWA 1HSJA 3FMQA 4ENMA 1YW9A 1IXRC 3V7CA 4M6YA 2G9WA 4EM0B 4Y17A 3R4KA 2HOEA 1W7PA 4UVBA 5DCMA 1FYMA 2OZUA 1D3YA 5E20A 5LEKA 1RZ4A 3R0JA 4EJWA 1KU9A 1YO5C 3J7AO 1BIAA 3MAJA 3MFKA 2EFPA 1IXCA 3GW2A 1O3SA 3D5LA 1USTA 3F8MA 1Z9CA 1H9TA 3I54A 3SZPA 3WTXC 1USSA 2FBIA 1U2WA 3KP5A 3R60A 4JK1X 2YR2A 1W5SA 3IHUA 2V79A 3K0LA 2LKPA 1ZGAA 4XSXF 1LB2A 2IA0A 3I4PA 1TQIA 4FT8A 2A07F 3EDPA 1LQ1A 1XSDA 1XN7A 2XVCA 3P9IA 1R23A 4A0XA 3BROA 1QPMA 3I0TA 4XRFA 3KP4A 2KJCA 2A5YB 2RNJA 2MH9A 3KP7A 5JVTA 2JZYA 1HXDA 3QP6A 2STTA 5ILSA 4HF1A 2STWA 2LNBA 1LDDA 3GZ6A 4LK0F 2EA2A 1KQ8A 1UFMA 5HLHA 3IWZA 5FGMA 3MZYA 2W57A 4PDKA 1Z6RA 1Z91A 3E6DA 4M71A 3OV8A 2Q2EA 3M1EA 5E8GA 2Q8KA 1EH8A 4HF0A 1NHAA 2FMYA 4Q47A 4R8HA 2ZNYA 4ZH4F 2W84A 3L2CA 3M8FA 4KIBA 3V8KA 2J5PA 3HOSA 1T2KA 3FMSA 3RKYA 4FX4A 4HLYA 5E18F 3SZTA 1SFUA 5DEQA 1FBQA 2VONA 3GFMA 3H3UA 1I1SA 2DPDA 4KUMA 1XGNA 1HW1A 4QWQA 1RI7A 1HKQA 3KP6A 1DPRA 4XLNF 2DW4A 4EJUA 4EGYA 4HX4A 2NNNA 2G7HA 4G6DA 4HF2A 1ZRFA 5LRSA 1XMKA 4HV5A 2HQNA 4B09A 2FXAA 3C7JA 2OAZA 2A3SA 2H6CA 3CO7C 1U3EM 2KRFA 2AXLA 1Z05A 1WWXA 2AS5F 1KU3A 3ZP5A 2D45A 1U6GA 2IRFG 4IRGA 1RIOH 2PLYA 2HR3A 5FFZA 4Q4ZF 5HLIA 2ZMEB 1R5GA 3MZHA 2RDPA 1H9GA 2L02A 3VEPA 3EETA 2PFBA 2QUFA 3L09A 1DUXC 1HKTA 5JHUA 4WWCA 1BOAA 2VN2A 4GO1A 3DKWA 4LG0B 2HQRA 2QBYB 2XAQA 1ONVA 5BMZA 1ZRCA 4RGRA 1FSHA 1B6AA 2C6YA 4E70A 5BS6A 2FU4A 3ABUA 5LHIA 1QGPA 4GXOA 2JPCA 2Z33A 5D4RA 2Y0MA 1P4XA 3ZN1A 4AIHA 2UZKA 1LVAA 2OZ6A 3M8EA 3FHZA 2RV8A 4YFXF 1BM9A 2HKXA 5HDKA 2ZJ2A 2ZMEA 2DAOA 4O3MA 3J80K 3LA7A 1EH6A 3CUQB 4G94A 4RS8A 2F5CA 3KE2A 3KLOA 4LG0A 1FWZA 2QBYA 2ADUA 5ERIA 3ZQ7A 3ABTA 4P55A 2IVMA 4HA8A 3T8RA 2FQ3A 3CUQC 3ZMTA 2RGVA 1IF1A 4L5JA 1SD4A 3E97A 3ERED 4ESBA 1RUOA 1BC8C 1PUEE 2R7DA 1ZLKA 4XSZF 3J81Z 1RNLA 2COMA 5HS7A 1XD7A 2A61A 1ZLJA 2DPUA 3BP8A 2MH2A 4OOIA 4FHTA 2TDXA 2UXNA 3CUQA 2L01A 1O3QA 1IRFA 3C1DA 4NQWA 1IN4A 5ILVA 1FP1D 5ICGA 1JXSA 2RVCA 4NB5A 4B8XA 4IVNA 3HTSB 1GVJA 4L9JA 3ZMVA 3TO9A 3NQOA 1TQPA 1KQ9A 2HTSA 4A5NA 1MJ9A 2IJLA 3F22A 3WGHA 1S6LA 3V7RA 3Q5FA 2QQBA 2RC4A 3E5QA 3HRMA 2EV5A 2HTJA 2D2WA 2YSRA 1U8RA 2ZXJA 5K1YA 2MD5A 5D5WB 1LNWA 4CHUA 3F21A 1HW5A 2HKOA 2DO7A 4LLGF 3J81K 4EV0A 1IN7A 4LMYA 5HDNA 5D5VB 1YG2A 3GZ5A 4G6QA 3HRUA 5DUIA 4I2OA 1F9NA 4YFNF 1I6XA 3HIFA 4ENJA 1VTNC 2VC0A 1ZG5A 1Y0UA 2OU2A 2VOPA 2O3FA 5JFRA 2FOKA 4LLLA 5FLXK 1KGSA 5J8FA 4UV9A 2XUBA 2VBWA 5HOOA 4S05A 4BNCA 2XAGA 2FRHA 3LFKA 1ZYRF 3WE3A 2K4BA 4GGGA 2P7VB 4IHSA 5KK1A 1P6RA 3F6OA 3RTRA 1T0FA 3GFIA 5D6EA 4IHTA 1DP7P 1GHCA 2XRNA 5D5UB 3WU1B 1BIBA 3RYPA 5BOXA 4UV8A 3RI4A 2HGCA 3IWFA 1FZPB 3B73A 5CJ9A 3RIRA 2M1BA 2NNYA 3JAMZ 3TO6A 4LJZF 2HZTA 1WRJA 3LQQA 2VT2A 5DYMA 2KKOA 2XV4S 3BPVA 1E2XA 1MKMA 4XLPF 1PP7U 1OPCA 1XCVA 2LSOA 3HSEA 4M9SA 5E1WA 3BY6A 2E7XA 3RYRA 1ZG1A 4I7HA 5L3FA 1R1TA 1FSEA 4A5MA 4L0ZB 1FBSA 1SD6A 3I5UA 1OKRA 3CTAA 4HZFA 1D5VA 1JHHA 4RB1A 1H0MA 1UCRA 1J7KA 1W4MA 2DQLA 2DLLA 5FD5A 4L9VA 5LGUA 3U1DA 3WTVC 4KDPA 3F8CA 3L7WA 3C3WA 1S29A 3EYIA 2DTRA 2PBIA 2RKHA 3GF2A 4EM2A 4Y13A 5H6RA 3RPQA 2MBFA 1O3TA 2QLZA 1P4AA 2FBHA 2H6BA 1J59A 5DD8A 2Z3YA 1R00A 3NRVA 4XBFA 1OYWA 2BE5F 3HYIA 4KMUX 2KJBA 5CVRA 3JAMK 4TV7A 3P7NA 4ZYEA 5E8IA 1ZRDA 2QM3A 1ZH5A 1AOYA 4MGRA 3S2WA 4I98B 2JT1A 4EM1A 1ZHFA 3O3KA 4EQQA 1G3WA 3Q9VA 1B9MA 1FBUA 3WTTC 4A2UA 2CGPA 4LB6B 3TGNA 2VE9A 3QRFF 3ZMDA 4G7ZF 4L0YB 5HS9A 1IN6A 4U0VA 2L54A 4IRIA 2IP2A 4A0ZA 4M72A 2QQAA 2DT5A 2PI0A 1YYVA 1V3FA 5HS8A 5JI6A 3F8FA 4N9HA 4CXFA 1I5ZA 5KVRA 1L3LA 5FB2A 2CSOA 4OU0A 3EUHA 4EMSA 1ON1A 2Z9OA 3TDUC 5LBQA 5D8KB 2OD5A 1KU2A 2X0LA 1A04A 1T98A 2ZCWA 1UHWA 2GQQA 2PMHA 4ESJA 1T39A 1HQCA 3M7GA 3TO7A 3RDIA 3DV8A 2GA2A 1TNSA 3ECOA 3JTHA 3ROUA 1FOKA 3W6KB 1W5TA 1FNNA 1Q1HA 3CUOA 1MD0A 5L3EA 1P2FA 2L3DA 1MZBA 1T6SA 3DXJF 4N9IA 2MLKA 4ZZDA 5DDGA 1KU7A 1G3YA 3ISPA 3DPLC 1F5TA 3SFZA 1B4AA 3FMRA 4A6DA 1R1UA 2FEZA 3I58A 2NS0A 2EK5A 4HX7A 1TLHB 3R0AA 2QVOA 2EFWA 4ZYHA 2J5OA 3GFJA 3T8TA 2JSCA 2QQ9A 5K5OA 2GWRA 3J80Z 1YQAA 1BBYA 4L9NA 1Z1DA 4MQVA 1K7AA 4IXAA 3CO6C 5ILUA 4KYWA 1OMIA 2MC3A 3IRQA 3F3XA 1L0OC 4I02A 2K7LA 3MQ0A 2CWEA 5J8CA 2CG4A 3HHHA 1KA8A 6PAXA 2YX7A 2CW0F 1ZREA 5CVVA 3ML6A 4JQFA 2CYYA 4HAMA 1OYYA 2FNPA 3HHGA 3EYYA 2FE3A 2E1CA 5DUKA 1SFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9F A;  2HFH A;  4CYD A;  1SFE A;  4M6X A;  4M9Z A;  1BI0 A;  2ISY A;  3D0S A;  1R58 A;  1FYK A;  5D8L B;  4I09 A;  3RKX A;  1GXQ A;  2O61 A;  2R7F A;  3T0Y A;  3JSP A;  1MGT A;  3LAJ A;  1XGM A;  2YX4 A;  2XAF A;  5TJJ A;  2BV6 A;  3DF8 A;  5CVU A;  3CJN A;  5H20 A;  2VT3 A;  3I64 A;  1J5Y A;  4Y15 A;  1FC3 A;  2FA5 A;  2IW5 A;  5ICC A;  3KLN A;  4Q48 A;  1Z7U A;  4P96 A;  4YFK F;  3LQR A;  2WV0 A;  4I0B A;  3DFG A;  4QLC U;  2PQ8 A;  3DPT A;  4M73 A;  4UVA A;  1XMA A;  3LAP A;  3BDD A;  3KCC A;  2DK8 A;  1FP2 A;  4RB0 A;  2P6S A;  2O6G E;  3LST A;  2ZKZ A;  3I71 A;  4AIJ A;  5A2Q K;  1TQM A;  1ULY A;  1YIO A;  2ACJ A;  2MLG A;  4OMY A;  5FD6 A;  1FX7 A;  4ENN A;  5JR3 A;  1G6N A;  3TQN A;  1E17 A;  4YII A;  5EEG A;  4BYY A;  5D5X B;  4RB2 C;  1B9N A;  4UVC A;  2HYG D;  3V4G A;  1YS6 A;  4S04 A;  4KN7 X;  4OMZ A;  3RPU A;  3T5X A;  4A6E A;  2H94 A;  4EGZ A;  1B59 A;  1HW2 A;  5FLX Z;  4OIR F;  2BYV E;  1J75 A;  3WTW C;  3VB2 A;  3K1N A;  4ZYG A;  4U7D A;  2ZBK A;  4OIN F;  2ELH A;  4Z2Y A;  5E1X A;  3GYH X;  3K9T A;  2Z5U A;  4CGZ A;  4LGW A;  3E3V A;  1AWC A;  4LLN A;  2A68 F;  1P92 A;  2RN7 A;  1I27 A;  2M30 A;  3KP3 A;  3FX3 A;  4RAZ A;  1CF7 B;  3GEZ A;  3HTU A;  2OA4 A;  1OYI A;  2W25 A;  3DP7 A;  4HLX A;  3IKT A;  2NYX A;  4BAY A;  3K1M A;  4R1H A;  4YIF A;  1U5T B;  4NHJ A;  4BHC A;  4MQ9 F;  4EVI A;  1YW8 A;  2IA1 A;  5AON A;  4M74 A;  4G8X A;  5TRD A;  3BWG A;  4P5O A;  2Y48 A;  4GYI A;  2EV0 A;  2EFN A;  4RB3 C;  2VOD A;  1U5T C;  1PDN C;  3BPX A;  4U0W A;  3N97 A;  5CLS A;  1TW3 A;  4O6J A;  4BH9 A;  2V6C A;  3P9K A;  3KEO A;  1DDN A;  5EEH A;  2Q0O A;  2VOO A;  1ZAO A;  4U0Y A;  2BBY A;  3LA3 A;  1WSU A;  5CVI A;  2EV6 A;  4BQA A;  2P4W A;  1D8K A;  2BGC A;  3M9A A;  3JTG A;  4HDU A;  2JRT A;  1CF7 A;  3E5U A;  2ISZ A;  3QPH A;  3LA2 A;  4H0E A;  1TTY A;  2QZ8 A;  1U5T A;  2DQR A;  4WCG A;  1XDS A;  2P8T A;  1J2X A;  3LWF A;  1G3T A;  3KZY A;  3GXO A;  2L4M A;  1K78 B;  2YPR A;  3FM3 A;  3EQL F;  3FZV A;  1S8N A;  4O5V A;  1KQ0 A;  3CDH A;  1LEB A;  2XHK A;  1LDK B;  2V1D A;  5IT9 K;  3V8J A;  1KYZ A;  3HSR A;  1IUY A;  3K69 A;  1W7P B;  4OIO F;  4KFC A;  3QU3 A;  5DCM B;  4IF4 A;  1S7O A;  1LDJ A;  2NRA C;  1JHF A;  4WXC A;  3PQK A;  3WTU C;  1XCB A;  3C18 A;  4HV6 A;  2DU9 A;  2FNA A;  4KIF A;  1SAX A;  1O57 A;  2GZW A;  2HDC A;  2QWW A;  5CVJ A;  4LD5 A;  1FT9 A;  2CFX A;  4AWX B;  4A0Y A;  2V1U A;  4N0B A;  2EA4 A;  5F64 A;  4R79 A;  3W6J B;  4KN4 X;  3BJ6 A;  2CO5 A;  4UHT A;  1R36 A;  3F8N A;  5LGT A;  1XGO A;  4WF2 A;  2EFO A;  2PJP A;  2DBB A;  1TBX A;  2ESN A;  1K78 A;  2CQK A;  5LHG A;  3MEX A;  2VBY A;  3T1B A;  4MTD A;  3WG9 A;  3PFI A;  2EJR A;  3VFZ A;  2V1X A;  3KET A;  1BC7 C;  1RUN A;  2G7U A;  3WE2 A;  4KA4 A;  3RJP A;  1QZY A;  3WTY C;  4EJT A;  5D4S A;  3JSO A;  5F6F A;  5E1Z B;  1BJA A;  4PZJ A;  2JPB A;  3SQN A;  2VBZ A;  2P6T A;  4OIP F;  2XAH A;  3DQV C;  5DV5 A;  3HRT A;  4EJO A;  4K2E A;  5ICE A;  2L4A A;  4HW0 A;  3BJO A;  2P5L C;  3ZPL A;  2M8E A;  1WI9 A;  1TNT A;  1R7J A;  1QZZ A;  3WTS C;  1YTY A;  4AIK A;  3ZMZ A;  3VOD A;  4UNO A;  3COA C;  1UHM A;  3F6V A;  2VC1 A;  1IN5 A;  5D6F A;  3F23 A;  2QYO A;  1YW7 A;  2VE8 A;  3E6B A;  2O03 A;  2FBK A;  1HKS A;  2XGX A;  1QBJ A;  1JGS A;  5BPI A;  2LDU A;  4DNC A;  4U7B A;  2EB7 A;  1HST A;  5LRR A;  4BXU A;  1J9I A;  4I0A A;  1EV7 A;  2F5D A;  3ULQ B;  1LJ9 A;  4PCQ A;  1Z6T A;  4HYE A;  1XDU A;  2V9V A;  4Q5S F;  5HDG A;  1JE8 A;  2GAU A;  2O0Y A;  3R61 A;  3QPT A;  3QOP A;  1S3J A;  1CGP A;  3KFW X;  5IT3 A;  2H09 A;  3VOE A;  2HYF A;  3OOP A;  2XKP A;  5E17 F;  4KNY A;  2NAZ A;  3TKY A;  1DPU A;  4RAY A;  1G4D A;  4F7Z A;  3HRS A;  4ZYD A;  1WQ2 A;  2OQG A;  4AD9 A;  1EH7 A;  2OBP A;  4ASN A;  1X3U A;  4YG2 F;  1J0R A;  3KEQ A;  3H3Z A;  2PN6 A;  2Z99 A;  3HUG A;  1R22 A;  3K1P A;  2IPQ X;  2PMU A;  4PGG A;  1B1B A;  1GXP A;  1U78 A;  1IZ1 A;  2VXZ A;  1F1Z A;  1ZGJ A;  2ZNZ A;  3KP2 A;  3SXY A;  1C0W A;  4MNU A;  4U88 A;  1ZG3 A;  1ZN2 A;  4MEY F;  5DCF A;  4G9Y A;  3E6C C;  3H92 A;  2W85 A;  3U9G A;  4ENK A;  4RGX A;  2KIU A;  3E5X A;  4IPA A;  2QEN A;  3V7S A;  3ZN0 A;  5L3D A;  2GXG A;  1KYW A;  1R1V A;  3GO5 A;  2PEX A;  1IW7 F;  2A6H F;  1WKM A;  3F72 A;  2FSW A;  1K79 A;  3NEU A;  2EWN A;  5LLQ A;  2KIF A;  2FML A;  4HQE A;  3FF5 A;  2P5K A;  4LB5 A;  3GLX A;  1PP8 F;  4P9U A;  1SD5 A;  1MDM B;  1BN5 A;  4A12 A;  3F8B A;  2EFQ A;  2A6E F;  2GIV A;  2WC2 A;  4HX8 A;  2DK5 A;  3GX4 X;  4M9X A;  2UWM A;  1BI3 A;  2D1H A;  1TW2 A;  5A2Q Z;  4HQM A;  3QP5 A;  3ZMS A;  2E1N A;  1STZ A;  1IXS B;  3I53 A;  3Q9S A;  1YLF A;  3I59 B;  5J6X A;  4CDG A;  3L9F A;  1ZAR A;  3IRR A;  3WOD F;  2XKO A;  2JTV A;  2F5E A;  4HBL A;  4MHG A;  5LEJ A;  2H27 A;  4D0P A;  2O8X A;  3TOB A;  5BPD A;  4CZZ A;  2D1V A;  5HLG A;  3BZ6 A;  4ON0 A;  4MEX F;  1MDM A;  4CIC A;  3GUD A;  3GWZ A;  4KMF A;  1ON2 A;  3FXU A;  3GFL A;  2HEO A;  3TDZ C;  3ECH A;  5ICF A;  2A69 F;  1QNT A;  3REO A;  4GYG A;  2XAS A;  2Y75 A;  3QAH A;  3WTZ A;  1YFH A;  3I59 A;  4RGU A;  1I1G A;  3P9C A;  2DI3 A;  4MTE A;  4EJV A;  3FXQ A;  1YS7 A;  2DFI A;  1FY7 A;  4L5I A;  5BQT A;  1SMY F;  2XIG A;  1IRG A;  3O6B B;  2X4H A;  1V4R A;  3CLO A;  4ETS A;  3N4M A;  2B0L A;  3BOQ A;  3ELK A;  1FLI A;  2FF4 A;  1O3R A;  1SMT A;  1OR7 A;  4G7O F;  3BJA A;  5L3B A;  2K02 A;  3FWE A;  2HS5 A;  4OIQ F;  2XRO A;  2W24 A;  4DQ2 A;  5AIQ A;  3IKV A;  4I01 A;  1XGS A;  2ETH A;  4PGH A;  2WWY A;  3GVA A;  4WX9 A;  1SD7 A;  2LF7 A;  4RGS A;  1QQI A;  3L00 A;  4IJA A;  1T38 A;  3O2P E;  5CYV A;  5AIP A;  1R5H A;  5K5Q A;  3TOA A;  3KZZ A;  2IA2 A;  5H6Q A;  4UUV A;  4LFU A;  3RKW A;  1ODD A;  3QU6 A;  4ZZL A;  3HOT A;  5IT9 Z;  2RQP A;  2YU3 A;  4IRH A;  1O7F A;  2K86 A;  3R6S A;  5ED4 A;  1FYL A;  3MCZ A;  2OQR A;  2P7C B;  3G73 A;  5LHH A;  1LEA A;  5LGN A;  4HOB A;  3AAF A;  3IC7 A;  1UB9 A;  1F4K A;  4WXD A;  3V8L A;  3DEU A;  1IN8 A;  2GA1 A;  2F2E A;  2MA3 A;  2ESH A;  2XAJ A;  2M45 A;  4FX0 A;  4BHP A;  4G7H F;  2M5W A;  1HBX G;  1XSV A;  1P4W A;  2P5V A;  4UXN A;  3FM5 A;  3ZMU A;  5DD4 A;  3PQJ A;  4KIC A;  1REP C;  2R3S A;  2ZFW A;  3JW4 A;  1D8J A;  1QO0 D;  3E6M A;  2VBX A;  4HDV A;  3B02 A;  4WK8 F;  4BHB A;  2GXB A;  1MJA A;  1K6O A;  3FXR A;  3WGG A;  4AVP A;  4GCV A;  3G3Z A;  1BI2 A;  1XB4 A;  1FPQ A;  2PG4 A;  4LK1 F;  2WTE A;  2BEO A;  1W7P D;  2E7W A;  1BI1 A;  2ZO4 A;  3SHF A;  3WGI A;  3IL2 A;  5FFX A;  3K2Z A;  4L18 B;  3MWM A;  4CO8 A;  1MJB A;  3WU0 A;  3U2R A;  2F5F A;  5F1R A;  1XSX A;  5L3C A;  2LF8 A;  4WXH A;  1O7L A;  2KIM A;  3HSF A;  2UXX A;  5K5R A;  4ESF A;  5L3G A;  4KT5 C;  2HWV A;  4JBA A;  1G3S A;  2K27 A;  4KIG A;  5HVQ C;  1S7A A;  2M87 A;  4L9T A;  5FO5 A;  2K4J A;  2IT0 A;  1IAW A;  1HSJ A;  3FMQ A;  4ENM A;  1YW9 A;  1IXR C;  3V7C A;  4M6Y A;  2G9W A;  4EM0 B;  4Y17 A;  3R4K A;  2HOE A;  1W7P A;  4UVB A;  5DCM A;  1FYM A;  2OZU A;  1D3Y A;  5E20 A;  5LEK A;  1RZ4 A;  3R0J A;  4EJW A;  1KU9 A;  1YO5 C;  3J7A O;  1BIA A;  3MAJ A;  3MFK A;  2EFP A;  1IXC A;  3GW2 A;  1O3S A;  3D5L A;  1UST A;  3F8M A;  1Z9C A;  1H9T A;  3I54 A;  3SZP A;  3WTX C;  1USS A;  2FBI A;  1U2W A;  3KP5 A;  3R60 A;  4JK1 X;  2YR2 A;  1W5S A;  3IHU A;  2V79 A;  3K0L A;  2LKP A;  1ZGA A;  4XSX F;  1LB2 A;  2IA0 A;  3I4P A;  1TQI A;  4FT8 A;  2A07 F;  3EDP A;  1LQ1 A;  1XSD A;  1XN7 A;  2XVC A;  3P9I A;  1R23 A;  4A0X A;  3BRO A;  1QPM A;  3I0T A;  4XRF A;  3KP4 A;  2KJC A;  2A5Y B;  2RNJ A;  2MH9 A;  3KP7 A;  5JVT A;  2JZY A;  1HXD A;  3QP6 A;  2STT A;  5ILS A;  4HF1 A;  2STW A;  2LNB A;  1LDD A;  3GZ6 A;  4LK0 F;  2EA2 A;  1KQ8 A;  1UFM A;  5HLH A;  3IWZ A;  5FGM A;  3MZY A;  2W57 A;  4PDK A;  1Z6R A;  1Z91 A;  3E6D A;  4M71 A;  3OV8 A;  2Q2E A;  3M1E A;  5E8G A;  2Q8K A;  1EH8 A;  4HF0 A;  1NHA A;  2FMY A;  4Q47 A;  4R8H A;  2ZNY A;  4ZH4 F;  2W84 A;  3L2C A;  3M8F A;  4KIB A;  3V8K A;  2J5P A;  3HOS A;  1T2K A;  3FMS A;  3RKY A;  4FX4 A;  4HLY A;  5E18 F;  3SZT A;  1SFU A;  5DEQ A;  1FBQ A;  2VON A;  3GFM A;  3H3U A;  1I1S A;  2DPD A;  4KUM A;  1XGN A;  1HW1 A;  4QWQ A;  1RI7 A;  1HKQ A;  3KP6 A;  1DPR A;  4XLN F;  2DW4 A;  4EJU A;  4EGY A;  4HX4 A;  2NNN A;  2G7H A;  4G6D A;  4HF2 A;  1ZRF A;  5LRS A;  1XMK A;  4HV5 A;  2HQN A;  4B09 A;  2FXA A;  3C7J A;  2OAZ A;  2A3S A;  2H6C A;  3CO7 C;  1U3E M;  2KRF A;  2AXL A;  1Z05 A;  1WWX A;  2AS5 F;  1KU3 A;  3ZP5 A;  2D45 A;  1U6G A;  2IRF G;  4IRG A;  1RIO H;  2PLY A;  2HR3 A;  5FFZ A;  4Q4Z F;  5HLI A;  2ZME B;  1R5G A;  3MZH A;  2RDP A;  1H9G A;  2L02 A;  3VEP A;  3EET A;  2PFB A;  2QUF A;  3L09 A;  1DUX C;  1HKT A;  5JHU A;  4WWC A;  1BOA A;  2VN2 A;  4GO1 A;  3DKW A;  4LG0 B;  2HQR A;  2QBY B;  2XAQ A;  1ONV A;  5BMZ A;  1ZRC A;  4RGR A;  1FSH A;  1B6A A;  2C6Y A;  4E70 A;  5BS6 A;  2FU4 A;  3ABU A;  5LHI A;  1QGP A;  4GXO A;  2JPC A;  2Z33 A;  5D4R A;  2Y0M A;  1P4X A;  3ZN1 A;  4AIH A;  2UZK A;  1LVA A;  2OZ6 A;  3M8E A;  3FHZ A;  2RV8 A;  4YFX F;  1BM9 A;  2HKX A;  5HDK A;  2ZJ2 A;  2ZME A;  2DAO A;  4O3M A;  3J80 K;  3LA7 A;  1EH6 A;  3CUQ B;  4G94 A;  4RS8 A;  2F5C A;  3KE2 A;  3KLO A;  4LG0 A;  1FWZ A;  2QBY A;  2ADU A;  5ERI A;  3ZQ7 A;  3ABT A;  4P55 A;  2IVM A;  4HA8 A;  3T8R A;  2FQ3 A;  3CUQ C;  3ZMT A;  2RGV A;  1IF1 A;  4L5J A;  1SD4 A;  3E97 A;  3ERE D;  4ESB A;  1RUO A;  1BC8 C;  1PUE E;  2R7D A;  1ZLK A;  4XSZ F;  3J81 Z;  1RNL A;  2COM A;  5HS7 A;  1XD7 A;  2A61 A;  1ZLJ A;  2DPU A;  3BP8 A;  2MH2 A;  4OOI A;  4FHT A;  2TDX A;  2UXN A;  3CUQ A;  2L01 A;  1O3Q A;  1IRF A;  3C1D A;  4NQW A;  1IN4 A;  5ILV A;  1FP1 D;  5ICG A;  1JXS A;  2RVC A;  4NB5 A;  4B8X A;  4IVN A;  3HTS B;  1GVJ A;  4L9J A;  3ZMV A;  3TO9 A;  3NQO A;  1TQP A;  1KQ9 A;  2HTS A;  4A5N A;  1MJ9 A;  2IJL A;  3F22 A;  3WGH A;  1S6L A;  3V7R A;  3Q5F A;  2QQB A;  2RC4 A;  3E5Q A;  3HRM A;  2EV5 A;  2HTJ A;  2D2W A;  2YSR A;  1U8R A;  2ZXJ A;  5K1Y A;  2MD5 A;  5D5W B;  1LNW A;  4CHU A;  3F21 A;  1HW5 A;  2HKO A;  2DO7 A;  4LLG F;  3J81 K;  4EV0 A;  1IN7 A;  4LMY A;  5HDN A;  5D5V B;  1YG2 A;  3GZ5 A;  4G6Q A;  3HRU A;  5DUI A;  4I2O A;  1F9N A;  4YFN F;  1I6X A;  3HIF A;  4ENJ A;  1VTN C;  2VC0 A;  1ZG5 A;  1Y0U A;  2OU2 A;  2VOP A;  2O3F A;  5JFR A;  2FOK A;  4LLL A;  5FLX K;  1KGS A;  5J8F A;  4UV9 A;  2XUB A;  2VBW A;  5HOO A;  4S05 A;  4BNC A;  2XAG A;  2FRH A;  3LFK A;  1ZYR F;  3WE3 A;  2K4B A;  4GGG A;  2P7V B;  4IHS A;  5KK1 A;  1P6R A;  3F6O A;  3RTR A;  1T0F A;  3GFI A;  5D6E A;  4IHT A;  1DP7 P;  1GHC A;  2XRN A;  5D5U B;  3WU1 B;  1BIB A;  3RYP A;  5BOX A;  4UV8 A;  3RI4 A;  2HGC A;  3IWF A;  1FZP B;  3B73 A;  5CJ9 A;  3RIR A;  2M1B A;  2NNY A;  3JAM Z;  3TO6 A;  4LJZ F;  2HZT A;  1WRJ A;  3LQQ A;  2VT2 A;  5DYM A;  2KKO A;  2XV4 S;  3BPV A;  1E2X A;  1MKM A;  4XLP F;  1PP7 U;  1OPC A;  1XCV A;  2LSO A;  3HSE A;  4M9S A;  5E1W A;  3BY6 A;  2E7X A;  3RYR A;  1ZG1 A;  4I7H A;  5L3F A;  1R1T A;  1FSE A;  4A5M A;  4L0Z B;  1FBS A;  1SD6 A;  3I5U A;  1OKR A;  3CTA A;  4HZF A;  1D5V A;  1JHH A;  4RB1 A;  1H0M A;  1UCR A;  1J7K A;  1W4M A;  2DQL A;  2DLL A;  5FD5 A;  4L9V A;  5LGU A;  3U1D A;  3WTV C;  4KDP A;  3F8C A;  3L7W A;  3C3W A;  1S29 A;  3EYI A;  2DTR A;  2PBI A;  2RKH A;  3GF2 A;  4EM2 A;  4Y13 A;  5H6R A;  3RPQ A;  2MBF A;  1O3T A;  2QLZ A;  1P4A A;  2FBH A;  2H6B A;  1J59 A;  5DD8 A;  2Z3Y A;  1R00 A;  3NRV A;  4XBF A;  1OYW A;  2BE5 F;  3HYI A;  4KMU X;  2KJB A;  5CVR A;  3JAM K;  4TV7 A;  3P7N A;  4ZYE A;  5E8I A;  1ZRD A;  2QM3 A;  1ZH5 A;  1AOY A;  4MGR A;  3S2W A;  4I98 B;  2JT1 A;  4EM1 A;  1ZHF A;  3O3K A;  4EQQ A;  1G3W A;  3Q9V A;  1B9M A;  1FBU A;  3WTT C;  4A2U A;  2CGP A;  4LB6 B;  3TGN A;  2VE9 A;  3QRF F;  3ZMD A;  4G7Z F;  4L0Y B;  5HS9 A;  1IN6 A;  4U0V A;  2L54 A;  4IRI A;  2IP2 A;  4A0Z A;  4M72 A;  2QQA A;  2DT5 A;  2PI0 A;  1YYV A;  1V3F A;  5HS8 A;  5JI6 A;  3F8F A;  4N9H A;  4CXF A;  1I5Z A;  5KVR A;  1L3L A;  5FB2 A;  2CSO A;  4OU0 A;  3EUH A;  4EMS A;  1ON1 A;  2Z9O A;  3TDU C;  5LBQ A;  5D8K B;  2OD5 A;  1KU2 A;  2X0L A;  1A04 A;  1T98 A;  2ZCW A;  1UHW A;  2GQQ A;  2PMH A;  4ESJ A;  1T39 A;  1HQC A;  3M7G A;  3TO7 A;  3RDI A;  3DV8 A;  2GA2 A;  1TNS A;  3ECO A;  3JTH A;  3ROU A;  1FOK A;  3W6K B;  1W5T A;  1FNN A;  1Q1H A;  3CUO A;  1MD0 A;  5L3E A;  1P2F A;  2L3D A;  1MZB A;  1T6S A;  3DXJ F;  4N9I A;  2MLK A;  4ZZD A;  5DDG A;  1KU7 A;  1G3Y A;  3ISP A;  3DPL C;  1F5T A;  3SFZ A;  1B4A A;  3FMR A;  4A6D A;  1R1U A;  2FEZ A;  3I58 A;  2NS0 A;  2EK5 A;  4HX7 A;  1TLH B;  3R0A A;  2QVO A;  2EFW A;  4ZYH A;  2J5O A;  3GFJ A;  3T8T A;  2JSC A;  2QQ9 A;  5K5O A;  2GWR A;  3J80 Z;  1YQA A;  1BBY A;  4L9N A;  1Z1D A;  4MQV A;  1K7A A;  4IXA A;  3CO6 C;  5ILU A;  4KYW A;  1OMI A;  2MC3 A;  3IRQ A;  3F3X A;  1L0O C;  4I02 A;  2K7L A;  3MQ0 A;  2CWE A;  5J8C A;  2CG4 A;  3HHH A;  1KA8 A;  6PAX A;  2YX7 A;  2CW0 F;  1ZRE A;  5CVV A;  3ML6 A;  4JQF A;  2CYY A;  4HAM A;  1OYY A;  2FNP A;  3HHG A;  3EYY A;  2FE3 A;  2E1C A;  5DUK A;  1SFX A; 
#chains in the Genus database with same CATH topology
 1ERD A;  4P9F A;  2B7E A;  3MKY B;  2HFH A;  4IHV A;  2IS6 A;  2JA6 J;  4F3Q A;  4CYD A;  1SFE A;  4M6X A;  4M9Z A;  4OAZ A;  1BI0 A;  1T56 A;  2ISY A;  4HNT A;  3D0S A;  1R58 A;  1FYK A;  5D8L B;  2MFZ A;  2N8G A;  3OYJ A;  4I09 A;  3RKX A;  1GXQ A;  2O61 A;  2R7F A;  3T0Y A;  3GBG A;  3HPH A;  3D5R C;  4B3X A;  4BJ5 C;  1MBG A;  4N4O B;  3JSP A;  4E7L A;  1VQ7 I;  2CQQ A;  2QSF X;  5KCM A;  1MGT A;  2JUG A;  3KZI C;  4D5C A;  3LAJ A;  1G2H A;  1XGM A;  3OMY A;  3IAM 2;  2P81 A;  2YX4 A;  2XAF A;  3MKL A;  4ZC3 A;  4IQJ A;  5TJJ A;  2BV6 A;  2M7A A;  3DF8 A;  1YX3 A;  2XGD A;  1X3W B;  3GTO J;  5E3N A;  4XKW A;  3CCS I;  5CVU A;  2X48 A;  3CJN A;  5H20 A;  2HOA A;  2VT3 A;  3I64 A;  1J5Y A;  4Y15 A;  1FC3 A;  2FA5 A;  2IW5 A;  5ICC A;  4OAY A;  3G1O A;  3HOX J;  3JRB A;  3KLN A;  3BLY A;  2HDD A;  2DYR H;  4Q48 A;  1Z7U A;  4P96 A;  4YFK F;  4IEJ A;  5EYR A;  4BDZ A;  3LQR A;  2WV0 A;  4I0B A;  1OR7 C;  3DFG A;  3DTE A;  3FIW A;  1NTC A;  4QLC U;  2PQ8 A;  4CZC A;  5JLW A;  3DPT A;  4M73 A;  2DA2 A;  4UVA A;  1LPQ A;  1XMA A;  4RM2 A;  3LAP A;  2E34 A;  3BDD A;  3KCC A;  2EIL H;  2DK8 A;  1FP2 A;  4RB0 A;  2RNG A;  2P6S A;  4Y7N J;  1UEL B;  2O6G E;  3LST A;  3ABL H;  2ZKZ A;  3I71 A;  4AIJ A;  4XM3 A;  2EZH A;  5A2Q K;  1TQM A;  2JN6 A;  3NAU A;  1RPW A;  1ULY A;  3E0J B;  4M3F A;  1YIO A;  2ACJ A;  2MLG A;  4OMY A;  3PM1 A;  3K4C A;  2KIQ A;  3HOW J;  1D0Z A;  1E3H A;  4P1W A;  2ZJP F;  5FD6 A;  1FX7 A;  4ENN A;  4A3J J;  5JR3 A;  3OL3 A;  3W2A A;  3OYB A;  3AG2 H;  3BG3 A;  2EZK A;  1DGR M;  1G6N A;  3TQN A;  1E17 A;  5FLV A;  4YII A;  4ZTJ A;  5EEG A;  4BYY A;  5D5X B;  3M4O J;  4RB2 C;  1MND A;  1B9N A;  2CV2 A;  4UVC A;  2HYG D;  3V4G A;  1YS6 A;  2OCE A;  4S04 A;  1YIJ I;  4KN7 X;  2KRC A;  1M1E B;  4OMZ A;  3RPU A;  3T5X A;  2X6O A;  4A6E A;  2H94 A;  3G6E I;  5FLM J;  4EGZ A;  1B59 A;  4IZZ A;  1HW2 A;  5FLX Z;  1MBK A;  1TWC J;  4OIR F;  2AQF A;  3BR0 A;  2BYV E;  1J75 A;  3WTW C;  4ZDP A;  3VB2 A;  1PVE A;  3K1N A;  4ZYG A;  4HG2 A;  4U7D A;  3C2B A;  2ZBK A;  2VKV A;  1B8I B;  3K4K A;  3HBL A;  5GAG J;  4OIN F;  2ELH A;  3HGY A;  3FIS A;  4Z2Y A;  2ICW G;  5GPC A;  3SEZ A;  5E1X A;  3CMY A;  2Y0S A;  4MLO A;  3GYH X;  1VI0 A;  2L7Z A;  4IKF A;  4XKV A;  3BR3 A;  3K9T A;  2Z5U A;  1X1D A;  4CGZ A;  9ANT A;  4RM3 A;  2R93 J;  4LGW A;  3E3V A;  1AWC A;  4BU2 A;  4LLN A;  2A68 F;  4QPO A;  1P92 A;  2RN7 A;  1I27 A;  2M30 A;  1XTA A;  3KP3 A;  3ZXS A;  2NXN B;  2GOM A;  3A01 B;  3DBL B;  3FX3 A;  4RAZ A;  1CF7 B;  3GEZ A;  3HTU A;  2OA4 A;  1X1A A;  3CZ6 A;  1OYI A;  2LP0 A;  4KJZ A;  2W25 A;  3DP7 A;  4HLX A;  2ZJQ F;  3IKT A;  3CDL A;  2NYX A;  2R7Z J;  4BAY A;  1WJB A;  1RKT A;  3K1M A;  4R1H A;  3VYR B;  4YIF A;  1U5T B;  4NHJ A;  4V2F A;  4BHC A;  3CCL I;  3S8P A;  4MQ9 F;  4EVI A;  1YW8 A;  2IA1 A;  4M3D A;  3BZK A;  3CMM A;  3H9G A;  3QPL A;  5AON A;  4M74 A;  4G8X A;  5TRD A;  2M8G X;  3BWG A;  1POG A;  2Y48 A;  1OFC X;  4GYI A;  4P5O A;  1IDZ A;  3PJR A;  2EV0 A;  1A5J A;  2EFN A;  1X58 A;  3BG9 A;  4RB3 C;  3CC4 I;  2VOD A;  4G12 A;  2K9N A;  1U5T C;  4IX7 A;  1PDN C;  3BPX A;  4AYB A;  4U0W A;  4D5F A;  3PL8 A;  3N97 A;  5CLS A;  1B8I A;  3GTG J;  1TW3 A;  3OYE A;  5FKM A;  3DU5 A;  1NK2 P;  4O6J A;  1Y8Q B;  4BH9 A;  2V6C A;  3P9K A;  3KEO A;  1DDN A;  1BL0 A;  3NWT A;  5EEH A;  4DYQ A;  2Q0O A;  3AL0 C;  2QKM B;  2VOO A;  2VAS A;  1QVT A;  1ZAO A;  4II2 A;  4U0Y A;  2FJ1 A;  1PYV A;  2BBY A;  3LA3 A;  1WSU A;  5CVI A;  2EV6 A;  4BQA A;  2P4W A;  1D8K A;  2BGC A;  3M9A A;  3A01 A;  3JTG A;  4BBS J;  4HDU A;  2JRT A;  4ITV A;  1CF7 A;  3E5U A;  2V6E A;  2ISZ A;  3HPG A;  3QPH A;  2ZC2 A;  3LA2 A;  3CCU I;  2E1M C;  3A0H C;  4H0E A;  1TTY A;  4DZP A;  2QZ8 A;  1U5T A;  2DQR A;  4WCG A;  1XDS A;  1FIA A;  2P8T A;  2QA4 I;  1J2X A;  3LWF A;  1I39 A;  1G3T A;  5J1U A;  4BUP A;  4DJA A;  3KZY A;  1ETO A;  3OYD A;  4XN0 A;  3GXO A;  4B47 A;  3L2U A;  2L4M A;  1K78 B;  1QHH D;  2DA3 A;  3QWL A;  2YPR A;  3FM3 A;  3EQL F;  3FZV A;  4E7Z A;  1S8N A;  4O5V A;  2Z1D A;  1KQ0 A;  3CDH A;  1LEB A;  2MD0 A;  2VPR A;  2XHK A;  1LDK B;  2V1D A;  4XRM A;  5EEA A;  5IT9 K;  3V8J A;  2JJ7 A;  4ZTF A;  1KYZ A;  3K7A J;  3HSR A;  1IUY A;  2KMU A;  4J00 A;  3K69 A;  2HU9 A;  5HNF A;  1W7P B;  4V2G A;  1JKR C;  1Y56 A;  1YHQ I;  4KFC A;  3QU3 A;  4OIO F;  5DCM B;  4IF4 A;  1R5I D;  2IEK A;  2R7U A;  1QHG A;  3CJT B;  1S7O A;  1IRX A;  1LDJ A;  3GLL A;  2NRA C;  5M5Y J;  1JHF A;  2R7R A;  4WXC A;  2QCO A;  4Z6Y A;  3PQK A;  5KAF C;  2XGE A;  1XCB A;  3C18 A;  2EBI A;  3WTU C;  2MAB A;  4HV6 A;  1Z21 A;  1RR7 A;  2DU9 A;  2FNA A;  4KIF A;  1SAX A;  1FMW A;  1O57 A;  3PNY A;  3DKX A;  2GZW A;  4II3 A;  2HDC A;  2QWW A;  5CVJ A;  4LD5 A;  1FT9 A;  2M34 A;  1JUS A;  2CFX A;  4AWX B;  4A0Y A;  2V1U A;  3DBR B;  2JSP A;  4N0B A;  2EA4 A;  2EIK H;  5F64 A;  3SDB A;  4R79 A;  3W6J B;  4KN4 X;  3AFH A;  3BJ6 A;  2CO5 A;  2IS1 A;  4UHT A;  1R36 A;  2OF7 A;  3F8N A;  4Y52 J;  5LGT A;  1XGO A;  4WF2 A;  4E7S A;  3DEE A;  2EFO A;  2PJP A;  2E19 A;  2DBB A;  3UNG C;  2DOD A;  1TBX A;  1TWF J;  2ESN A;  2CQK A;  5LHG A;  4XQF A;  4UUS B;  3MEX A;  1K78 A;  3M3Y J;  2VBY A;  3T1B A;  4MTD A;  2F4I A;  3DKY A;  3WG9 A;  5IOZ A;  2V9P A;  3PFI A;  2EJR A;  2R4G A;  2KP6 A;  3MN2 A;  2V1X A;  3VFZ A;  4ABZ A;  3KET A;  1EA3 A;  4J01 A;  4JX5 A;  2XRL A;  3BTI A;  1BC7 C;  1RUN A;  2MSY A;  2DT6 A;  2JVG A;  4BJ6 C;  1VQM I;  2G7U A;  3WE2 A;  5IYB J;  4KA4 A;  3RJP A;  1QZY A;  3WTY C;  3TW6 A;  4EJT A;  1DU0 A;  5D4S A;  3JSO A;  1YJ9 I;  2WB1 A;  5F6F A;  5E1Z B;  1S72 I;  1BJA A;  1ZTR A;  3H0D A;  4PZJ A;  1X19 A;  3OY9 A;  3CC7 I;  1YIT I;  2JPB A;  3SQN A;  1VQ8 I;  1RES A;  1UG0 A;  2VBZ A;  2P6T A;  4OIP F;  4F93 B;  5M5X J;  2ID3 A;  2XAH A;  3DQV C;  2Y31 A;  3PSF A;  3K10 A;  5DV5 A;  3HRT A;  1Y8R B;  3PSI A;  4EJO A;  4K2E A;  5ICE A;  3IP4 B;  1VQ9 I;  1RKW A;  2L4A A;  3IH4 A;  3S16 J;  4HW0 A;  3BJO A;  2P5L C;  3ZPL A;  2M8E A;  1WI9 A;  2K9L A;  1TNT A;  3GME A;  1R7J A;  1QZZ A;  3WTS C;  2WAF A;  2CUF A;  4UUS A;  1EF4 A;  2ZSH B;  1YTY A;  2DA4 A;  4AIK A;  3ZMZ A;  1R9T J;  2VJJ A;  2R5Z B;  5DM6 F;  1TWG J;  3VOD A;  4UNO A;  1SVL A;  3COA C;  1V5F A;  4ZDO A;  1UHM A;  1SVM A;  3F6V A;  2VC1 A;  4XLE A;  1IN5 A;  5D6F A;  1X1P A;  5FKO A;  2CQX A;  3F23 A;  3GTQ J;  1R4M B;  2QYO A;  1OCR H;  5F0F A;  1YW7 A;  2VE8 A;  3E6B A;  2O03 A;  4PJN A;  3FKI J;  2M7B A;  2W1O A;  2FBK A;  1HKS A;  2F48 A;  2XGX A;  2ZXW H;  1QBJ A;  1JGS A;  3M8J A;  5BPI A;  1XMX A;  2LDU A;  4DNC A;  4U7B A;  2EB7 A;  3J7Y J;  1N78 A;  1HST A;  5FKL A;  5LRR A;  4BXU A;  2VJ5 A;  1J9I A;  4I0A A;  4YIR X;  1I6H J;  2Q1Z B;  1EV7 A;  4S0H B;  3JRG A;  4XIC A;  1QPI A;  2HVR A;  2F5D A;  3CLQ A;  3ULQ B;  1LJ9 A;  4PCQ A;  1Z6T A;  2CW8 A;  4HYE A;  1XDU A;  2WV1 A;  3HUG B;  2V9V A;  3A1Y A;  4Q5S F;  5HDG A;  1JE8 A;  2L9V A;  4C3H J;  2IXS A;  1B72 B;  1MMA A;  2GAU A;  2O0Y A;  3R61 A;  2R5Z A;  1FJL A;  2ECB A;  2KL4 A;  3QPT A;  3QOP A;  1W0U A;  2W4S A;  1S3J A;  2QF7 A;  1CGP A;  3HKZ A;  3KFW X;  5DS9 A;  5IT3 A;  3K4L A;  1GLN A;  2DT7 B;  2H09 A;  3VOE A;  1HDD C;  3FHN A;  2HXO A;  2HYF A;  1UJ8 A;  3BCB A;  5BNG A;  2XPU A;  3OOP A;  3SZG A;  2XKP A;  1O4X A;  5E17 F;  4PJM A;  1T08 B;  4UB6 C;  1GUU A;  3OL4 A;  2ECC A;  1WI3 A;  4KNY A;  1YX5 A;  4IOA F;  2NAZ A;  2DOF A;  3TKY A;  1JUP A;  1DPU A;  3RQI A;  2NVT J;  1UG2 A;  5CPR B;  4RAY A;  1G4D A;  2BHY A;  2DYS H;  1AA7 A;  4F7Z A;  3HRS A;  4ZYD A;  4UB8 C;  2R5Y B;  1ACI A;  2MG4 A;  1HA8 A;  1WQ2 A;  3BTC A;  2OQG A;  4AD9 A;  3F0C A;  1EH7 A;  3S15 J;  2OBP A;  2DA5 A;  4ASN A;  2NVU B;  1X3U A;  4YG2 F;  1J0R A;  3QQA A;  3BTL A;  5K7F A;  4C2U A;  3KEQ A;  2F4O B;  3H3Z A;  2PN6 A;  2Z99 A;  3HUG A;  3G1L A;  1R22 A;  3K1P A;  2IPQ X;  4NUB A;  2PMU A;  4PK4 A;  4PGG A;  1QU3 A;  2FOW A;  1B1B A;  1GXP A;  3LSP A;  1U78 A;  1B72 A;  1IZ1 A;  2VXZ A;  3KEY A;  1MNM C;  1F1Z A;  1ZGJ A;  2ZNZ A;  3KP2 A;  1FOY A;  3DLA A;  3SXY A;  3BT9 A;  5EZG A;  4BL0 B;  3FK7 A;  1A31 A;  1C0W A;  4MNU A;  3EUK L;  4U88 A;  3WU2 C;  1ZG3 A;  1VZ0 A;  4C2T A;  3JRE A;  1ZN2 A;  4MEY F;  5DCF A;  4G9Y A;  4M3E A;  3E6C C;  2DN0 A;  4J19 A;  3H92 A;  2W85 A;  3U9G A;  4ENK A;  4RGX A;  2KIU A;  2CMP A;  1ETQ A;  2L2O A;  3E5X A;  4IPA A;  2QEN A;  3V7S A;  1JKP C;  3ZN0 A;  4DBR A;  2WY8 Q;  5L3D A;  2GXG A;  1KYW A;  1R1V A;  1QVU A;  3GO5 A;  1XX5 A;  3S93 A;  2PEX A;  2BY3 A;  1EKE A;  2CQ7 A;  5C44 J;  1IW7 F;  2A6H F;  2R5Y A;  1WKM A;  4RA2 A;  2LOO A;  3F72 A;  2BVM A;  3OYM A;  3PNV A;  2FSW A;  1RR8 C;  1MMN A;  1GT0 C;  1K79 A;  1U9O A;  3NEU A;  4XMY A;  2EWN A;  5LLQ A;  2KIF A;  1LE8 B;  2FML A;  4HQE A;  2H1K A;  1VFC A;  3OYA A;  3KPH A;  3L2Q A;  3FF5 A;  2P5K A;  4LB5 A;  3GLX A;  3LSM A;  5J4V A;  4P9U A;  3JRC A;  1PP8 F;  1SD5 A;  1MDM B;  1BN5 A;  4A12 A;  3JCU C;  2VJ4 A;  5FRM A;  3F8B A;  2EFQ A;  2A6E F;  2GIV A;  2WC2 A;  3BQZ A;  4HX8 A;  2DA6 A;  5KHD A;  2IGM A;  2DK5 A;  3GX4 X;  4M9X A;  2UWM A;  3LOC A;  1K4T A;  1BI3 A;  2D1H A;  1TW2 A;  5A2Q Z;  4HQM A;  1MSF C;  4FET A;  1MMD A;  2VKD A;  3O8H A;  3QP5 A;  1JKO C;  3ZMS A;  2E1N A;  3Q0U A;  4BE0 A;  2HI3 A;  1F36 A;  1STZ A;  1IXS B;  3I53 A;  3SFI A;  3Q9S A;  1HF0 A;  1YLF A;  3I59 B;  4HNV A;  5J6X A;  1PJR A;  4CDG A;  3L9F A;  1P9Q C;  1ZAR A;  3IRR A;  3S1R J;  4D7N A;  2IGK A;  3S14 J;  2CH0 A;  3WOD F;  2XKO A;  1TL8 A;  3FDY A;  2JTV A;  2F5E A;  4HBL A;  2H8W A;  5EZH A;  4MHG A;  2ZME C;  3A0B C;  5LEJ A;  3G4S I;  2BOL A;  2H27 A;  2LG4 A;  3OOU A;  2AO9 A;  2CV0 A;  1BW5 A;  5M3F J;  4D0P A;  2FQ4 A;  2O8X A;  3TOB A;  5BPD A;  2UV1 A;  1X3Z B;  2R7X A;  2Y0S N;  4CZZ A;  4DIQ A;  2D1V A;  2IBD A;  2F5V A;  1LE8 A;  5EJC A;  5GAE J;  5HLG A;  3CCJ I;  3S2H J;  2WAD A;  3BZ6 A;  4ON0 A;  2W48 A;  1JKQ C;  1MDM A;  4MEX F;  3CC2 I;  4CIC A;  2CQN A;  3GUD A;  3GWZ A;  4JP0 A;  5IP7 J;  4KMF A;  2LYC A;  1MMG A;  1IRZ A;  4D7M A;  2L9S A;  3PIP F;  1ON2 A;  3FXU A;  3GFL A;  2HEO A;  4IHX A;  1WH5 A;  2KRH A;  2KT0 A;  3TDZ C;  3ECH A;  3RPU D;  3ZQI A;  3CME I;  4CCO A;  5C4X J;  2CS3 A;  1BJZ A;  5ICF A;  2A69 F;  1QNT A;  3REO A;  4A3C J;  4GYG A;  1YRN B;  2XAS A;  2V1N A;  2EZI A;  2Y75 A;  3QAH A;  3WTZ A;  4DW6 A;  1YFH A;  3I59 A;  3RCO A;  2BY1 A;  4RGU A;  1GV5 A;  1I1G A;  3P9C A;  2DI3 A;  4XK4 A;  4MTE A;  4EJV A;  2DFH A;  3FXQ A;  5FJ8 J;  1YS7 A;  2DFI A;  1FIP A;  2R7Q A;  1FY7 A;  1OCZ H;  2K3F A;  1U0J A;  3OWT A;  4PJ0 C;  4L5I A;  2P0W A;  1SMY F;  3TMO A;  2XIG A;  5BQT A;  1IRG A;  3O6B B;  4AYB N;  5B1B H;  2X4H A;  1SAN A;  1V4R A;  3CLO A;  2KHM A;  4ETS A;  3D1N I;  3N4M A;  2B0L A;  2ZXH A;  3BOQ A;  4Y33 A;  2R7S A;  3ELK A;  1X4O A;  4IOC F;  2L7M P;  4A3E J;  1FLI A;  1LKX A;  2NS7 A;  2FF4 A;  1D0X A;  2GXA A;  4RAF A;  1O3R A;  1IJW C;  1SMT A;  1V55 H;  3SYT A;  1OR7 A;  4AU7 A;  3CCQ I;  4G7O F;  3BJA A;  2ME6 A;  3ZQQ A;  5GAH J;  1KON A;  4PSW A;  3G2B A;  2DA1 A;  5L3B A;  2K02 A;  1WJC A;  1W1W E;  3KIO A;  5B5E C;  1K61 A;  3FWE A;  2HS5 A;  2KZG A;  4OIQ F;  1YRN A;  3S1M J;  2XRO A;  2W24 A;  3CCM I;  4DQ2 A;  1WPK A;  3IKV A;  5AIQ A;  5TIS C;  3JR9 A;  4I01 A;  3O8G A;  1XGS A;  2ETH A;  4C3J J;  4HRI A;  4PGH A;  4BE1 A;  2WWY A;  3GVA A;  4WX9 A;  1SD7 A;  2LF7 A;  2VQC A;  2MYS A;  2EQR A;  2X9D A;  3TED A;  2Z2S B;  4RGS A;  1QQI A;  1H8A C;  3L00 A;  3RZO J;  4IJA A;  4DOZ A;  3O2P E;  1T38 A;  5CYV A;  1R4N B;  2LKX A;  5AIP A;  1R5H A;  1HOM A;  5K5Q A;  3F9K A;  3TOA A;  3X2Q H;  2X51 A;  3KZZ A;  2VJI A;  1CQT A;  3OYG A;  2IA2 A;  5H6Q A;  4UUV A;  4LFU A;  3RKW A;  2R7W A;  1JTY A;  1ODD A;  2XDV A;  3QU6 A;  1YE9 A;  4ZZL A;  3HOT A;  4A3K J;  5IT9 Z;  3ASO H;  4B4C A;  5FRN A;  2RQP A;  2ME0 A;  2YU3 A;  4RLQ A;  4IRH A;  2XPV A;  1O7F A;  1V5E A;  2K86 A;  3CDI A;  3KX2 A;  3BTJ A;  3R6S A;  5ED4 A;  1FYL A;  3MCZ A;  2ELJ A;  2E71 A;  3A2K A;  2MW8 A;  2OQR A;  2P7C B;  1OQY A;  3G73 A;  5LHH A;  1VQ6 I;  1LEA A;  2IGN A;  5LGN A;  4HOB A;  2LTP A;  3AAF A;  3IC7 A;  4FE4 A;  3J7A Y;  3OIO A;  1UB9 A;  4KIT B;  2VIX A;  2COB A;  1F4K A;  4WXD A;  3V8L A;  2Z16 A;  3AL0 B;  3DEU A;  1IN8 A;  2V9K A;  4XNF A;  2GA1 A;  4XLF A;  2F2E A;  3CD6 I;  3S3N A;  2MA3 A;  3QYB A;  2DMQ A;  2VLA A;  2ESH A;  4GRI A;  2XAJ A;  3Q0V A;  2M45 A;  1IO2 A;  4FX0 A;  5DTD A;  2I10 A;  4BHP A;  3H1C A;  2CFO A;  4G7H F;  2M5W A;  4XID A;  2E1M B;  1HBX G;  3QOE A;  1XSV A;  1SFK A;  2DJN A;  1P4W A;  3ESW B;  1E0E A;  1R71 A;  2P5V A;  3BG5 A;  4UXN A;  5KAI C;  3OS0 A;  3FM5 A;  1MBH A;  2A5W A;  5EF6 A;  3EUA A;  3ZMU A;  5DD4 A;  3PQJ A;  4KIC A;  1REP C;  3DTK A;  2R3S A;  2ZFW A;  5IYC J;  3JW4 A;  3K70 C;  1D8J A;  1QO0 D;  3E6M A;  2WB1 N;  3PUF A;  4HNU A;  2WAE A;  2VBX A;  3BG6 A;  4HDV A;  2F6C A;  2EPF A;  3B02 A;  4LIU A;  4WK8 F;  4BHB A;  1I50 J;  2GXB A;  1T0F C;  3I56 I;  1TZL A;  1MJA A;  2EZL A;  1K6O A;  5B1A H;  3FXR A;  3WGG A;  4AVP A;  4GCV A;  2YS9 A;  4C30 A;  3G3Z A;  4CCM A;  1BI2 A;  1XB4 A;  1FPQ A;  2ELK A;  2PG4 A;  4LK1 F;  2WTE A;  4QIW N;  2BY0 A;  2BEO A;  4JOM A;  1W7P D;  1APL C;  1BI1 A;  2E7W A;  3B6C A;  2ZO4 A;  3SHF A;  5F27 A;  3WGI A;  3IL2 A;  5FFX A;  1Y6I A;  4M3B A;  5EG0 B;  3K2Z A;  4L18 B;  3MWM A;  4CO8 A;  4X6A J;  4M6V A;  1MJB A;  3WU0 A;  1WVR A;  4A93 J;  3U2R A;  4A69 C;  1SVO A;  2F5F A;  5F1R A;  2CUE A;  2E2I J;  1XSX A;  4PJJ A;  5L3C A;  2LF8 A;  4JX4 A;  4WXH A;  4I99 C;  1O7L A;  3VYU B;  3HXL A;  2KIM A;  4RMN A;  3HSF A;  4X0G A;  2UXX A;  3KYL A;  4MFD A;  3ASN H;  5K5R A;  5GP9 A;  5JHF A;  4ESF A;  3H5A A;  5L3G A;  4KT5 C;  2HWV A;  3S17 J;  4JBA A;  1G3S A;  4DZJ A;  2K27 A;  4KIG A;  4YEL A;  3FBN B;  5HVQ C;  2LR8 A;  5K7H A;  5F08 A;  2DMU A;  2VPL A;  1S7A A;  2M87 A;  1ITY A;  1D1C A;  4NC6 A;  4L9T A;  5FO5 A;  3ZQH A;  2K4J A;  1F43 A;  2IT0 A;  1IAW A;  2CW7 A;  3MD2 A;  1HSJ A;  2RAE A;  3FMQ A;  1K83 J;  4ENM A;  1YW9 A;  1IXR C;  2KDO A;  3V7C A;  1VF9 A;  4M6Y A;  2HYJ A;  2G9W A;  4EM0 B;  1VQK I;  4A3I J;  2LMD A;  4Y17 A;  3R4K A;  2HOE A;  1VQ5 I;  2WY7 Q;  1XS9 A;  1V5G A;  1V54 H;  1W7P A;  5KNL A;  2R7V A;  2E2H J;  3HKZ N;  4HSR A;  3HOV J;  4UVB A;  5DCM A;  2K40 A;  1FYM A;  2JA8 J;  3U1K A;  2OZU A;  1D3Y A;  5E20 A;  4YEJ A;  5LEK A;  2NVQ J;  1YOV B;  2X1C A;  1RZ4 A;  3I55 I;  1IC8 A;  2OCC H;  3R0J A;  1OCO H;  4EJW A;  1KU9 A;  1YO5 C;  3H9J A;  2DTZ A;  4IL6 C;  2L9R A;  2L7F P;  1WJD A;  3J7A O;  4PUS A;  1KZH A;  5E3L A;  1BIA A;  3MAJ A;  3MFK A;  1WJA A;  1Y1V J;  4BBR J;  2O8K A;  2EFP A;  3C2H A;  1IXC A;  3GW2 A;  1MBF A;  1O3S A;  3D5L A;  4LOC A;  1EJ9 A;  1UST A;  3F8M A;  1ETX A;  3K2A A;  2H8R A;  3ZRG A;  1Z9C A;  2X85 A;  1H9T A;  3ZGK A;  1TWA J;  2JA5 J;  2X6Y A;  3I54 A;  1FTZ A;  4D1Q A;  1JUM A;  3BR5 A;  3SZP A;  2W82 A;  1USS A;  3WTX C;  2FBI A;  4GDF A;  2D5V A;  1LFU P;  1U2W A;  2X1E A;  2K5C A;  3KP5 A;  3R60 A;  4JK1 X;  3PUB A;  2YR2 A;  3L1P A;  1W5S A;  3IHU A;  2AXT C;  3BC8 A;  2V79 A;  3K0L A;  2LKP A;  1ZGA A;  4XSX F;  1LB2 A;  3HB9 A;  4AUX A;  2CUJ A;  2IA0 A;  4XON A;  3I4P A;  4CCJ A;  1TQI A;  4FT8 A;  1A36 A;  2Q2E B;  2A07 F;  3EDP A;  2DMT A;  1XSD A;  1LQ1 A;  1XN7 A;  2XVC A;  3P9I A;  5J3L A;  1R23 A;  4A0X A;  3BRO A;  1QPM A;  1IG7 A;  3I0T A;  5J1Y A;  5JVG F;  4IHW A;  3VYT B;  4XRF A;  4HST A;  1AKH B;  3VPR A;  3KP4 A;  2KJC A;  1D0Y A;  2XB5 A;  4JX6 A;  3S1Q J;  2WAQ A;  2A5Y B;  2Y30 A;  4H4K C;  2RNJ A;  2MH9 A;  2RRE A;  3KP7 A;  5JVT A;  2JZY A;  2L7K A;  3MKW B;  1N77 A;  5GTH C;  2BVL A;  3JRD A;  5DM7 F;  1QA6 A;  4FTH A;  1HXD A;  3QP6 A;  2STT A;  5IYD J;  2VQG A;  1UZC A;  3P5J A;  5ILS A;  4HF1 A;  4XRS G;  2E36 A;  2STW A;  3CCV I;  2LNB A;  1FTT A;  2HVQ A;  1LDD A;  3GZ6 A;  2HPI A;  2JUC A;  4LK0 F;  2EA2 A;  1KQ8 A;  3QYE A;  3ONQ A;  3W2W A;  1UFM A;  5HLH A;  5HLT A;  3IWZ A;  3ABK H;  5FGM A;  3MZY A;  2LH9 A;  2W57 A;  1IV8 A;  4PDK A;  1Z6R A;  1Z91 A;  2LVS A;  3E6D A;  4M71 A;  3H35 A;  1LUJ B;  2Q2E A;  3OV8 A;  3ERM A;  3M1E A;  5E8G A;  2Q8K A;  1EH8 A;  3TP3 A;  1WGX A;  1ETY A;  1NHA A;  4HF0 A;  2FMY A;  2OV7 A;  2LD5 A;  2WA0 A;  4Q47 A;  4BY7 J;  1FOW A;  4R8H A;  2ZNY A;  4ZH4 F;  2W84 A;  2YUS A;  3H3V K;  3Q0W A;  1AKH A;  3L2C A;  3IV5 A;  2TCT A;  2XF6 A;  3M8F A;  4KIB A;  3V8K A;  3RQ4 A;  3V42 A;  3KYC B;  2J5P A;  5J1R A;  3OYK A;  3HOS A;  3CCE I;  5E79 C;  3SJM A;  1T2K A;  1X1B A;  2OTJ I;  3ABM H;  3FMS A;  2AHQ A;  1G8X A;  3RKY A;  3AKZ A;  2KFD A;  3OSG A;  2DJI A;  4FX4 A;  1RRJ A;  1U9N A;  4E4H A;  4B43 A;  5E18 F;  4HLY A;  3SZT A;  1SFU A;  4A3L J;  4ANJ A;  1R6R A;  1AHD P;  1E3O C;  1TT5 B;  2Y2Z A;  5DEQ A;  3BQY A;  1FBQ A;  1HLV A;  2VON A;  3GFM A;  3L2V A;  3MMY B;  2DFF A;  1OCP A;  2M3A A;  3CF5 F;  3OS2 A;  2XF7 A;  1SEU A;  4A3D J;  5JLX A;  2XF5 A;  3H3U A;  1R49 A;  1I1S A;  2DPD A;  4KUM A;  1XGN A;  3W3C A;  5F0C A;  1HW1 A;  4QWQ A;  1RI7 A;  4CCL A;  3QPS A;  3OYL A;  1IV6 A;  5C4J J;  1UHS A;  5F1J A;  1HKQ A;  2LRD A;  3KP6 A;  1DPR A;  4XLN F;  2DW4 A;  4EJU A;  1BW6 A;  4EGY A;  4HX4 A;  3AG1 H;  2H1L A;  2NNN A;  1T8I A;  5EGO B;  2G7H A;  3M1C A;  4G6D A;  1BA5 A;  4BQO A;  4HF2 A;  1Y39 A;  1ZRF A;  1XG1 A;  3TW7 A;  5LRS A;  3L2W A;  1HDP A;  3OR1 C;  3BZC A;  1JI8 A;  1XMK A;  4HV5 A;  4FQG A;  2BXY A;  2HQN A;  4PSX A;  4B09 A;  3NWS A;  2FXA A;  2HOT A;  3TL4 X;  3C7J A;  3D5S C;  2OAZ A;  2CRG A;  3FXK A;  4Y3O A;  3ZQL A;  2QKL B;  4DBQ A;  2DMP A;  4C2M J;  2A3S A;  2H6C A;  3CO7 C;  4UY8 I;  2DOE A;  1U3E M;  4BGD A;  2KRF A;  2AXL A;  3IH2 A;  2LKS A;  3B6A A;  1Z05 A;  1WWX A;  2E2J J;  3QYF A;  2Y9Y A;  2AS5 F;  4BE2 A;  1GVD A;  3ZOB A;  1KU3 A;  2QQ8 A;  3ZP5 A;  2DDB A;  3OS1 A;  5E3O A;  2CJJ A;  2D45 A;  1AU7 A;  4BDY A;  1U6G A;  2Y9Z A;  1K6Y A;  2PMZ A;  3ZQC A;  1T95 A;  3JRH A;  1YJN I;  5J40 A;  2IRF G;  3HOZ J;  1VQO I;  2HZD A;  3A02 A;  4IRG A;  4MFE A;  1U8B A;  1RIO H;  2PLY A;  2HR3 A;  5FFZ A;  4Q4Z F;  5HLI A;  2ZME B;  1R5G A;  2E35 A;  1WJF A;  4ZJZ A;  1BOB A;  4RAG A;  3MZH A;  2M0M A;  1Z67 A;  1H9G A;  2L02 A;  2RDP A;  2V26 A;  3VEP A;  4B1R A;  3EET A;  1LVK A;  1JTX A;  2PFB A;  2QUF A;  3GZN B;  3L09 A;  2GOX B;  1DUX C;  3S2D J;  3NAR A;  1HKT A;  2IS2 A;  5JHU A;  4WWC A;  3RSN A;  1YJW I;  1BOA A;  2VN2 A;  4GO1 A;  3RZD J;  5E3M A;  3DKW A;  1K4S A;  4LG0 B;  2HQR A;  5HOD A;  2QBY B;  2XAQ A;  1ONV A;  1BR4 A;  4OWR B;  1ETW A;  2NVY J;  5BMZ A;  3H36 A;  1ZRC A;  2DMN A;  4V19 K;  3CP8 A;  4QTR A;  2NVX J;  4L5E A;  4RGR A;  1FSH A;  1B6A A;  2C6Y A;  2PJR B;  4E70 A;  5BS6 A;  2R7O A;  4PJL A;  2DXI A;  2EIN H;  4BQQ A;  2FU4 A;  1DQU A;  3ABU A;  5FKK A;  5LHI A;  4XOP A;  1QGP A;  4GXO A;  3H0G J;  2QSG X;  2L9N A;  2JPC A;  2M2E A;  2Z33 A;  1GV2 A;  5D4R A;  1W36 C;  2EIJ H;  2Y0M A;  1P4X A;  3ZN1 A;  3CJQ B;  4AIH A;  2UZK A;  3CCR I;  1LVA A;  2OZ6 A;  3M8E A;  4NNJ A;  1OIS A;  3FHZ A;  1ZR2 A;  2DDA A;  2RV8 A;  4YFX F;  1BM9 A;  3HJE A;  2HKX A;  3SEQ A;  5HDK A;  2BW3 B;  2ZJ2 A;  2ZME A;  3S3O A;  1LFB A;  2K9M A;  1WZ2 A;  3PIO F;  2DAO A;  1A6Q A;  1Q1V A;  1MIJ A;  2BXZ A;  2R0Q C;  4O3M A;  1S7E A;  3J80 K;  4BQN A;  3ZCO A;  3MZ8 A;  3TBI A;  3LA7 A;  2DCE A;  2VB6 A;  5CQG A;  1EH6 A;  1ZK8 A;  5J47 A;  3CUQ B;  4G94 A;  2RQQ A;  2MGQ A;  4RS8 A;  1N25 A;  2E5Z A;  2F5C A;  1TWH J;  3KE2 A;  3KLO A;  4NQW B;  4LG0 A;  1MSE C;  1FWZ A;  2QBY A;  3OIQ A;  4NC7 A;  2ADU A;  5ERI A;  5IP6 A;  1ZQ3 P;  3ZQ7 A;  1S5L C;  1MH3 A;  1ZEL A;  3J7Z I;  1MBJ A;  4CCK A;  2PJR A;  3ABT A;  4P55 A;  2IVM A;  4HA8 A;  1SAU A;  3T8R A;  2FQ3 A;  2JA7 J;  3CUQ C;  4BXX J;  1XC5 A;  3ZMT A;  3I4M J;  3DBH B;  2RGV A;  1H88 C;  1IF1 A;  4L5J A;  1SD4 A;  2LK2 A;  4W1U A;  2XAU A;  3RKQ A;  3E97 A;  3ZQF A;  3HG9 A;  4AVZ A;  3ERE D;  1J09 A;  1X4P A;  2QEX I;  4ESB A;  4CYC B;  1RUO A;  2OPT A;  4DYC A;  3A03 A;  3MVP A;  3OIP A;  2XC7 A;  1BC8 C;  1PUE E;  4IQ4 A;  2R7D A;  3LSK A;  3DEW A;  1ZLK A;  4XSZ F;  3J81 Z;  2BW3 A;  1RNL A;  2COM A;  5HS7 A;  3ZR8 X;  3WHB A;  1MW7 A;  1I3Q J;  1XD7 A;  2A61 A;  1ZLJ A;  2DPU A;  3BP8 A;  2IGO A;  2JQ7 A;  2MH2 A;  2IS4 A;  2BZT A;  1ZR4 A;  2L5Q A;  4OOI A;  4FHT A;  3AG4 H;  2TDX A;  2UXN A;  3CUQ A;  1OJL A;  2L01 A;  2M4G A;  1O3Q A;  1IRF A;  3C1D A;  4BJT A;  4NQW A;  1IN4 A;  1P7J A;  3N05 A;  1JGG A;  5ILV A;  1FP1 D;  1D5Y A;  4I6Z A;  4XLH A;  5M3M J;  2LBF B;  3BR2 A;  1LFP A;  1MBE A;  3FKJ A;  2KLO A;  4JYK A;  4GFB A;  2HQA A;  2ID6 A;  5ICG A;  1JXS A;  4ZYA A;  2RVC A;  4RBO A;  4NB5 A;  4B8X A;  4IVN A;  3HTS B;  1GVJ A;  1P7I A;  4L9J A;  1A6I A;  4IO9 F;  2VKH A;  1Z77 A;  3LSI A;  3FXM A;  3ZMV A;  1D1A A;  3NQO A;  3TO9 A;  1Y0N A;  4BXF A;  4CYC A;  1TQP A;  4F92 B;  1KQ9 A;  2HTS A;  4A5N A;  4E7J A;  5GPA A;  1MJ9 A;  2IJL A;  2DFE A;  3F22 A;  1UAA A;  1FOX A;  3WGH A;  1WJE A;  5FKN A;  3E7L A;  5B3S H;  1W0T A;  1DGW Y;  4AC0 A;  5LD2 C;  1Z0X A;  3CP2 A;  1S6L A;  2JWT A;  3V7R A;  5J4Y A;  3Q5F A;  3W2V A;  1VND A;  2KPM A;  2QQB A;  3VSK A;  2RC4 A;  2ZFU A;  3E5Q A;  4XN3 A;  4DGW B;  2VI6 A;  3CMA I;  3HRM A;  1ETV A;  2EV5 A;  3GTL J;  2HTJ A;  3K70 D;  5CQE A;  1I3A A;  2D2W A;  2YSR A;  4CSW A;  2XSD C;  1PUF B;  3HEF A;  2XGC A;  1U8R A;  2ZXJ A;  2CU7 A;  1BR2 A;  5K1Y A;  2MD5 A;  5D5W B;  2LC2 A;  1LNW A;  4CHU A;  1JT0 A;  3GTK J;  2CUZ A;  3F21 A;  2LBF A;  1OCT C;  2E5N A;  1HW5 A;  2HKO A;  2DO7 A;  4LLG F;  3J81 K;  2NOG A;  1H89 C;  4EV0 A;  1IN7 A;  4LMY A;  5HDN A;  1JJ8 C;  5D5V B;  2JA2 A;  1YG2 A;  2OUM A;  1WCM J;  3GZ5 A;  3L2R A;  4G6Q A;  3HRU A;  5DUI A;  1NG7 A;  4N4N B;  4I2O A;  1F9N A;  4B44 A;  4C9Y A;  4YFN F;  1I6X A;  3CQZ J;  3HIF A;  4ENJ A;  1VTN C;  2EH3 A;  4QPQ A;  2VC0 A;  4XL9 A;  1ZG5 A;  1G59 A;  3HC7 A;  1Y0U A;  2OU2 A;  3BR1 A;  2VOP A;  2FUG 2;  4XLC A;  2O3F A;  1RET A;  2YU9 J;  5JFR A;  2FOK A;  4LLL A;  4XRS A;  5FLX K;  3FK6 A;  1KGS A;  5J8F A;  3UKG A;  4UV9 A;  2XUB A;  2VBW A;  2FX0 A;  5HOO A;  4S05 A;  3GTJ J;  1ENH A;  2VXD A;  1X2N A;  4BNC A;  2XAG A;  1PUF A;  2X6X A;  2FRH A;  3PNT A;  1VQ4 I;  1WH7 A;  3LFK A;  1MMS A;  1ZYR F;  3WE3 A;  2K4B A;  4GGG A;  2P7V B;  3M07 A;  3SDG A;  4IHS A;  3DCF A;  5KK1 A;  3HM5 A;  4DYR A;  1P6R A;  3F6O A;  3S32 A;  4A3G J;  3RTR A;  1T0F A;  5B66 C;  2V7F A;  3OYI A;  2JRM A;  2VL8 A;  5F0H A;  3GFI A;  2L0K A;  1TP4 A;  1VQN I;  5D6E A;  1ZKG A;  1WJ5 A;  4IHT A;  1DP7 P;  1GHC A;  4E7K A;  2KQR A;  1WHU A;  2GLO A;  2XRN A;  3K4J A;  5D5U B;  1JJ6 C;  3H9Q A;  4XLA A;  3G71 I;  2O7O A;  2WAQ N;  3WU1 B;  1BIB A;  4KIS A;  3RYP A;  3K4B A;  3LSR A;  5BOX A;  4UV8 A;  3RI4 A;  1DP3 A;  2HGC A;  3IWF A;  2B63 J;  1FZP B;  3IH3 A;  3B73 A;  5CJ9 A;  1NK3 P;  3RIR A;  4C3I J;  3KYD B;  2M1B A;  4HPQ A;  4HEA 2;  2NNY A;  3HDD A;  2A05 A;  4NDL A;  3HOU J;  2DOA A;  3VSL A;  3JAM Z;  3TO6 A;  1RC9 A;  4LJZ F;  2HZT A;  3LNQ A;  1ZGW A;  1WRJ A;  3GTP J;  3LQQ A;  2VT2 A;  1OCC H;  3UR3 C;  4F91 B;  5DYM A;  2KKO A;  2XV4 S;  3BPV A;  2HOS A;  1E2X A;  4XOT A;  1MKM A;  4XLP F;  1PP7 U;  2HDW A;  1OPC A;  1XCV A;  5EG0 A;  2LSO A;  3HSE A;  4M9S A;  5FRO A;  3JRI A;  5E1W A;  2ZB9 A;  1VQP I;  2GBY A;  3H5N A;  1TT0 A;  2XSJ C;  3BY6 A;  3S3M A;  4CUG A;  4MIM A;  3PFY A;  2VQH A;  2E7X A;  3RYR A;  2LFB A;  4BY1 J;  1ZG1 A;  2X6W A;  4I7H A;  5L3F A;  2VUM J;  1D1B A;  1R1T A;  1FSE A;  4A5M A;  4L0Z B;  4XOR A;  3PO3 J;  1FBS A;  1SD6 A;  4PFO A;  4E7H A;  3CF2 A;  3I5U A;  2EIM H;  2WBM A;  2ZJR F;  3Q3S A;  1E3P A;  4LIV A;  1OKR A;  2HNH A;  2O5R A;  2OJE D;  3CTA A;  4G6T B;  4HZF A;  1D5V A;  4B3A A;  1JHH A;  3I9V 2;  5F04 A;  2VKE A;  1NG6 A;  4FCY A;  1SC7 A;  4RLF A;  1DU6 A;  4RB1 A;  1X2M A;  1H0M A;  1UCR A;  1J7K A;  1W4M A;  2R92 J;  3DPU A;  1ETK A;  2DQL A;  2MC4 A;  2DLL A;  5FD5 A;  4L9V A;  5LGU A;  3U1D A;  3WTV C;  1IGN A;  2F4M B;  4AID A;  4KDP A;  3LMM A;  3DTI A;  3F8C A;  3C2G A;  3DU6 A;  3L7W A;  4IHY A;  3GCM A;  3C3W A;  1S29 A;  4BEH B;  3EYI A;  2DTR A;  2PBI A;  2RKH A;  3GF2 A;  4UUT A;  4EM2 A;  4Y13 A;  3VWB A;  2KIS A;  2M9H A;  2JMW A;  3CJR B;  5H6R A;  2HVS A;  2CV1 A;  3RPQ A;  4KT6 A;  2MBF A;  1O3T A;  2QLZ A;  1P4A A;  3WHC A;  4PFP A;  2TRT A;  2FBH A;  2H6B A;  5GTI C;  1J59 A;  4RDU A;  1Z7L A;  2V4J C;  3QOD A;  5DD8 A;  1A35 A;  2Z3Y A;  1R00 A;  3K6G A;  3NRV A;  4XBF A;  1OYW A;  2BE5 F;  3HYI A;  4KMU X;  2KJB A;  5CVR A;  4A3M J;  2JVH A;  3JAM K;  5IPA A;  1BR1 A;  3HZJ A;  4TV7 A;  3P7N A;  3A4C A;  4ZYE A;  5E8I A;  1ZRD A;  2QM3 A;  1ZH5 A;  1AOY A;  1WFX A;  4MGR A;  3S2W A;  2E60 A;  4I98 B;  4I76 A;  1X1C A;  2G0E A;  2JT1 A;  4EM1 A;  1ZHF A;  3O3K A;  4EQQ A;  1G3W A;  2PX9 A;  4NBQ A;  2E1O A;  3Q9V A;  1B9M A;  1FBU A;  2K9S A;  3WTT C;  2LRE A;  4A2U A;  2CGP A;  3EUH C;  4LB6 B;  1QRY A;  3OR2 C;  1SFO J;  3TGN A;  2VE9 A;  2B9S A;  1GDT A;  3I3L A;  3BG7 A;  3QRF F;  3ZMD A;  4G7Z F;  4L0Y B;  5HS9 A;  3HOY J;  4ZDL A;  2O9L A;  1MH4 A;  4FAS D;  3LFU A;  3ZQG A;  5GAD J;  4YRV A;  4BEH A;  1IN6 A;  4U0V A;  4BAC A;  2L54 A;  1Z3X A;  4IRI A;  3JRF A;  4F55 A;  2IP2 A;  4A0Z A;  4M72 A;  2QQA A;  2DT5 A;  2PMZ N;  2PI0 A;  1YYV A;  1V3F A;  3TP0 A;  2ZSI B;  5LFA A;  4EEF G;  3IUO A;  3CES A;  5HS8 A;  1NH3 A;  1JT6 A;  2R7T A;  5JI6 A;  4XKB A;  4FE7 A;  3F8F A;  4XR6 A;  5CKT A;  4N9H A;  4CXF A;  1I5Z A;  2M0C A;  5KVR A;  4A3F J;  1L3L A;  5FB2 A;  2CSO A;  4OU0 A;  2I5U A;  2NS8 A;  3EUH A;  4EMS A;  1ON1 A;  2Z9O A;  3LSG A;  3TDU C;  5LBQ A;  5D8K B;  2OD5 A;  3OYH A;  1FMV A;  1KU2 A;  2X0L A;  4D9J A;  1A04 A;  2IAI A;  1T98 A;  2ZCW A;  1UHW A;  5IP9 J;  4CCN A;  3JRA A;  2GQQ A;  2GM4 A;  4M3G A;  2PMH A;  2KZV A;  3OYN A;  3GTM J;  4ESJ A;  4X1E A;  1W5C C;  1T39 A;  1HQC A;  3M7G A;  3TO7 A;  2FD5 A;  2VQL A;  3DV8 A;  3RDI A;  2GA2 A;  3AG3 H;  4EAT A;  1TNS A;  3ECO A;  3JTH A;  3WG7 H;  5H2F C;  3ROU A;  1N75 A;  1FOK A;  3H5R A;  3CCY A;  2DA7 A;  2UUZ A;  3W6K B;  4E7I A;  3BR6 A;  1W5T A;  1FNN A;  1Q1H A;  3BCA A;  3HL2 A;  5HNH A;  3CUO A;  2I8D A;  2X1D A;  3VYS B;  1MD0 A;  2K85 A;  3G1M A;  3HGG A;  2LY9 A;  5L3E A;  2Y69 H;  3W6V A;  2LLK A;  1P2F A;  2L3D A;  1MZB A;  1T6S A;  3DXJ F;  4N9I A;  1HCR A;  2MLK A;  2HQ5 A;  4ZZD A;  5DDG A;  4U87 A;  1KU7 A;  4XKC A;  1G3Y A;  1ORK A;  4LIT A;  3ISP A;  3DPL C;  5TGT A;  1F5T A;  2M4K A;  1HC8 A;  2AQE A;  3SFZ A;  5EDN A;  1B4A A;  3FMR A;  4A6D A;  3FBI B;  2NOJ B;  1T33 A;  3LSJ A;  4E6K G;  5K7Z A;  3LSH A;  1R1U A;  2K9Q A;  2BY2 A;  1Y1W J;  2OC6 A;  2FEZ A;  4A3B J;  4AM3 A;  4CA0 A;  1UMQ A;  3I58 A;  4BS9 A;  3LL7 A;  3K4M A;  2NS0 A;  2EK5 A;  4HX7 A;  1TLH B;  4B48 A;  1VQL I;  3PO2 J;  3MKZ A;  3R0A A;  2QVO A;  2EFW A;  4ZYH A;  2K3P A;  2OTL I;  2J5O A;  3GFJ A;  3T8T A;  2JSC A;  2QQ9 A;  5K5O A;  2QSH X;  2LY2 A;  2GWR A;  4MO7 A;  1MNE A;  3EPZ A;  3J80 Z;  4BKX A;  4Y4R A;  1IUF A;  1YQA A;  1BBY A;  4L9N A;  1S9H A;  1Z1D A;  4CH7 A;  2XB0 X;  3FXO A;  4LG3 A;  4MQV A;  1K7A A;  4QSH A;  3I4N J;  4IXA A;  2GIZ A;  3CO6 C;  3OYF A;  2W7N A;  3VDX A;  1IDY A;  4F52 A;  2W00 A;  2JK3 A;  4NC8 A;  5ILU A;  4KYW A;  2LY1 A;  1OMI A;  1QZE A;  2MC3 A;  3IRQ A;  3F3X A;  1YI2 I;  5IY5 H;  3DLL F;  1L0O C;  3FXJ A;  1Z3Y A;  2K7L A;  3E1S A;  2A6T A;  3MQ0 A;  4I02 A;  3OYC A;  2CWE A;  1FEX A;  5J8C A;  2BHZ A;  2CG4 A;  3HHH A;  3U21 A;  3S1N J;  3OSF A;  1KA8 A;  6PAX A;  2YX7 A;  2CW0 F;  3IAS 2;  5EGO A;  1ZRE A;  5CVV A;  2HXI A;  2ZXI A;  3ML6 A;  3DWL E;  4JQF A;  2KDZ A;  2CYY A;  3K4N A;  1W36 D;  4HAM A;  1XPX A;  1OLT A;  4W97 A;  1OYY A;  2QGU A;  4FIS A;  2XPW A;  2FNP A;  5IOY A;  1TC3 C;  3HHG A;  3FXL A;  3EYY A;  2FE3 A;  5C3E J;  2HPM A;  5M5W J;  2E1C A;  5DUK A;  1SFX A; 
#chains in the Genus database with same CATH homology
 4P9F A;  2HFH A;  4CYD A;  1SFE A;  4M6X A;  4M9Z A;  1BI0 A;  2ISY A;  3D0S A;  1R58 A;  1FYK A;  5D8L B;  4I09 A;  3RKX A;  1GXQ A;  2O61 A;  2R7F A;  3T0Y A;  3JSP A;  1MGT A;  3LAJ A;  1XGM A;  2YX4 A;  2XAF A;  5TJJ A;  2BV6 A;  3DF8 A;  5CVU A;  3CJN A;  5H20 A;  2VT3 A;  3I64 A;  1J5Y A;  4Y15 A;  1FC3 A;  2FA5 A;  2IW5 A;  5ICC A;  3KLN A;  4Q48 A;  1Z7U A;  4P96 A;  4YFK F;  3LQR A;  2WV0 A;  4I0B A;  3DFG A;  4QLC U;  2PQ8 A;  3DPT A;  4M73 A;  4UVA A;  1XMA A;  3LAP A;  3BDD A;  3KCC A;  2DK8 A;  1FP2 A;  4RB0 A;  2P6S A;  2O6G E;  3LST A;  2ZKZ A;  3I71 A;  4AIJ A;  5A2Q K;  1TQM A;  1ULY A;  1YIO A;  2ACJ A;  2MLG A;  4OMY A;  5FD6 A;  1FX7 A;  4ENN A;  5JR3 A;  1G6N A;  3TQN A;  1E17 A;  4YII A;  5EEG A;  4BYY A;  5D5X B;  4RB2 C;  1B9N A;  4UVC A;  2HYG D;  3V4G A;  1YS6 A;  4S04 A;  4KN7 X;  4OMZ A;  3RPU A;  3T5X A;  4A6E A;  2H94 A;  4EGZ A;  1B59 A;  1HW2 A;  5FLX Z;  4OIR F;  2BYV E;  1J75 A;  3WTW C;  3VB2 A;  3K1N A;  4ZYG A;  4U7D A;  2ZBK A;  4OIN F;  2ELH A;  4Z2Y A;  5E1X A;  3GYH X;  3K9T A;  2Z5U A;  4CGZ A;  4LGW A;  3E3V A;  1AWC A;  4LLN A;  2A68 F;  1P92 A;  2RN7 A;  1I27 A;  2M30 A;  3KP3 A;  3FX3 A;  4RAZ A;  1CF7 B;  3GEZ A;  3HTU A;  2OA4 A;  1OYI A;  2W25 A;  3DP7 A;  4HLX A;  3IKT A;  2NYX A;  4BAY A;  3K1M A;  4R1H A;  4YIF A;  1U5T B;  4NHJ A;  4BHC A;  4MQ9 F;  4EVI A;  1YW8 A;  2IA1 A;  5AON A;  4M74 A;  4G8X A;  5TRD A;  3BWG A;  4P5O A;  2Y48 A;  4GYI A;  2EV0 A;  2EFN A;  4RB3 C;  2VOD A;  1U5T C;  1PDN C;  3BPX A;  4U0W A;  3N97 A;  5CLS A;  1TW3 A;  4O6J A;  4BH9 A;  2V6C A;  3P9K A;  3KEO A;  1DDN A;  5EEH A;  2Q0O A;  2VOO A;  1ZAO A;  4U0Y A;  2BBY A;  3LA3 A;  1WSU A;  5CVI A;  2EV6 A;  4BQA A;  2P4W A;  1D8K A;  2BGC A;  3M9A A;  3JTG A;  4HDU A;  2JRT A;  1CF7 A;  3E5U A;  2ISZ A;  3QPH A;  3LA2 A;  4H0E A;  1TTY A;  2QZ8 A;  1U5T A;  2DQR A;  4WCG A;  1XDS A;  2P8T A;  1J2X A;  3LWF A;  1G3T A;  3KZY A;  3GXO A;  2L4M A;  1K78 B;  2YPR A;  3FM3 A;  3EQL F;  3FZV A;  1S8N A;  4O5V A;  1KQ0 A;  3CDH A;  1LEB A;  2XHK A;  1LDK B;  2V1D A;  5IT9 K;  3V8J A;  1KYZ A;  3HSR A;  1IUY A;  3K69 A;  1W7P B;  4OIO F;  4KFC A;  3QU3 A;  5DCM B;  4IF4 A;  1S7O A;  1LDJ A;  2NRA C;  1JHF A;  4WXC A;  3PQK A;  3WTU C;  1XCB A;  3C18 A;  4HV6 A;  2DU9 A;  2FNA A;  4KIF A;  1SAX A;  1O57 A;  2GZW A;  2HDC A;  2QWW A;  5CVJ A;  4LD5 A;  1FT9 A;  2CFX A;  4AWX B;  4A0Y A;  2V1U A;  4N0B A;  2EA4 A;  5F64 A;  4R79 A;  3W6J B;  4KN4 X;  3BJ6 A;  2CO5 A;  4UHT A;  1R36 A;  3F8N A;  5LGT A;  1XGO A;  4WF2 A;  2EFO A;  2PJP A;  2DBB A;  1TBX A;  2ESN A;  1K78 A;  2CQK A;  5LHG A;  3MEX A;  2VBY A;  3T1B A;  4MTD A;  3WG9 A;  3PFI A;  2EJR A;  3VFZ A;  2V1X A;  3KET A;  1BC7 C;  1RUN A;  2G7U A;  3WE2 A;  4KA4 A;  3RJP A;  1QZY A;  3WTY C;  4EJT A;  5D4S A;  3JSO A;  5F6F A;  5E1Z B;  1BJA A;  4PZJ A;  2JPB A;  3SQN A;  2VBZ A;  2P6T A;  4OIP F;  2XAH A;  3DQV C;  5DV5 A;  3HRT A;  4EJO A;  4K2E A;  5ICE A;  2L4A A;  4HW0 A;  3BJO A;  2P5L C;  3ZPL A;  2M8E A;  1WI9 A;  1TNT A;  1R7J A;  1QZZ A;  3WTS C;  1YTY A;  4AIK A;  3ZMZ A;  3VOD A;  4UNO A;  3COA C;  1UHM A;  3F6V A;  2VC1 A;  1IN5 A;  5D6F A;  3F23 A;  2QYO A;  1YW7 A;  2VE8 A;  3E6B A;  2O03 A;  2FBK A;  1HKS A;  2XGX A;  1QBJ A;  1JGS A;  5BPI A;  2LDU A;  4DNC A;  4U7B A;  2EB7 A;  1HST A;  5LRR A;  4BXU A;  1J9I A;  4I0A A;  1EV7 A;  2F5D A;  3ULQ B;  1LJ9 A;  4PCQ A;  1Z6T A;  4HYE A;  1XDU A;  2V9V A;  4Q5S F;  5HDG A;  1JE8 A;  2GAU A;  2O0Y A;  3R61 A;  3QPT A;  3QOP A;  1S3J A;  1CGP A;  3KFW X;  5IT3 A;  2H09 A;  3VOE A;  2HYF A;  3OOP A;  2XKP A;  5E17 F;  4KNY A;  2NAZ A;  3TKY A;  1DPU A;  4RAY A;  1G4D A;  4F7Z A;  3HRS A;  4ZYD A;  1WQ2 A;  2OQG A;  4AD9 A;  1EH7 A;  2OBP A;  4ASN A;  1X3U A;  4YG2 F;  1J0R A;  3KEQ A;  3H3Z A;  2PN6 A;  2Z99 A;  3HUG A;  1R22 A;  3K1P A;  2IPQ X;  2PMU A;  4PGG A;  1B1B A;  1GXP A;  1U78 A;  1IZ1 A;  2VXZ A;  1F1Z A;  1ZGJ A;  2ZNZ A;  3KP2 A;  3SXY A;  1C0W A;  4MNU A;  4U88 A;  1ZG3 A;  1ZN2 A;  4MEY F;  5DCF A;  4G9Y A;  3E6C C;  3H92 A;  2W85 A;  3U9G A;  4ENK A;  4RGX A;  2KIU A;  3E5X A;  4IPA A;  2QEN A;  3V7S A;  3ZN0 A;  5L3D A;  2GXG A;  1KYW A;  1R1V A;  3GO5 A;  2PEX A;  1IW7 F;  2A6H F;  1WKM A;  3F72 A;  2FSW A;  1K79 A;  3NEU A;  2EWN A;  5LLQ A;  2KIF A;  2FML A;  4HQE A;  3FF5 A;  2P5K A;  4LB5 A;  3GLX A;  1PP8 F;  4P9U A;  1SD5 A;  1MDM B;  1BN5 A;  4A12 A;  3F8B A;  2EFQ A;  2A6E F;  2GIV A;  2WC2 A;  4HX8 A;  2DK5 A;  3GX4 X;  4M9X A;  2UWM A;  1BI3 A;  2D1H A;  1TW2 A;  5A2Q Z;  4HQM A;  3QP5 A;  3ZMS A;  2E1N A;  1STZ A;  1IXS B;  3I53 A;  3Q9S A;  1YLF A;  3I59 B;  5J6X A;  4CDG A;  3L9F A;  1ZAR A;  3IRR A;  3WOD F;  2XKO A;  2JTV A;  2F5E A;  4HBL A;  4MHG A;  5LEJ A;  2H27 A;  4D0P A;  2O8X A;  3TOB A;  5BPD A;  4CZZ A;  2D1V A;  5HLG A;  3BZ6 A;  4ON0 A;  4MEX F;  1MDM A;  4CIC A;  3GUD A;  3GWZ A;  4KMF A;  1ON2 A;  3FXU A;  3GFL A;  2HEO A;  3TDZ C;  3ECH A;  5ICF A;  2A69 F;  1QNT A;  3REO A;  4GYG A;  2XAS A;  2Y75 A;  3QAH A;  3WTZ A;  1YFH A;  3I59 A;  4RGU A;  1I1G A;  3P9C A;  2DI3 A;  4MTE A;  4EJV A;  3FXQ A;  1YS7 A;  2DFI A;  1FY7 A;  4L5I A;  5BQT A;  1SMY F;  2XIG A;  1IRG A;  3O6B B;  2X4H A;  1V4R A;  3CLO A;  4ETS A;  3N4M A;  2B0L A;  3BOQ A;  3ELK A;  1FLI A;  2FF4 A;  1O3R A;  1SMT A;  1OR7 A;  4G7O F;  3BJA A;  5L3B A;  2K02 A;  3FWE A;  2HS5 A;  4OIQ F;  2XRO A;  2W24 A;  4DQ2 A;  5AIQ A;  3IKV A;  4I01 A;  1XGS A;  2ETH A;  4PGH A;  2WWY A;  3GVA A;  4WX9 A;  1SD7 A;  2LF7 A;  4RGS A;  1QQI A;  3L00 A;  4IJA A;  1T38 A;  3O2P E;  5CYV A;  5AIP A;  1R5H A;  5K5Q A;  3TOA A;  3KZZ A;  2IA2 A;  5H6Q A;  4UUV A;  4LFU A;  3RKW A;  1ODD A;  3QU6 A;  4ZZL A;  3HOT A;  5IT9 Z;  2RQP A;  2YU3 A;  4IRH A;  1O7F A;  2K86 A;  3R6S A;  5ED4 A;  1FYL A;  3MCZ A;  2OQR A;  2P7C B;  3G73 A;  5LHH A;  1LEA A;  5LGN A;  4HOB A;  3AAF A;  3IC7 A;  1UB9 A;  1F4K A;  4WXD A;  3V8L A;  3DEU A;  1IN8 A;  2GA1 A;  2F2E A;  2MA3 A;  2ESH A;  2XAJ A;  2M45 A;  4FX0 A;  4BHP A;  4G7H F;  2M5W A;  1HBX G;  1XSV A;  1P4W A;  2P5V A;  4UXN A;  3FM5 A;  3ZMU A;  5DD4 A;  3PQJ A;  4KIC A;  1REP C;  2R3S A;  2ZFW A;  3JW4 A;  1D8J A;  1QO0 D;  3E6M A;  2VBX A;  4HDV A;  3B02 A;  4WK8 F;  4BHB A;  2GXB A;  1MJA A;  1K6O A;  3FXR A;  3WGG A;  4AVP A;  4GCV A;  3G3Z A;  1BI2 A;  1XB4 A;  1FPQ A;  2PG4 A;  4LK1 F;  2WTE A;  2BEO A;  1W7P D;  2E7W A;  1BI1 A;  2ZO4 A;  3SHF A;  3WGI A;  3IL2 A;  5FFX A;  3K2Z A;  4L18 B;  3MWM A;  4CO8 A;  1MJB A;  3WU0 A;  3U2R A;  2F5F A;  5F1R A;  1XSX A;  5L3C A;  2LF8 A;  4WXH A;  1O7L A;  2KIM A;  3HSF A;  2UXX A;  5K5R A;  4ESF A;  5L3G A;  4KT5 C;  2HWV A;  4JBA A;  1G3S A;  2K27 A;  4KIG A;  5HVQ C;  1S7A A;  2M87 A;  4L9T A;  5FO5 A;  2K4J A;  2IT0 A;  1IAW A;  1HSJ A;  3FMQ A;  4ENM A;  1YW9 A;  1IXR C;  3V7C A;  4M6Y A;  2G9W A;  4EM0 B;  4Y17 A;  3R4K A;  2HOE A;  1W7P A;  4UVB A;  5DCM A;  1FYM A;  2OZU A;  1D3Y A;  5E20 A;  5LEK A;  1RZ4 A;  3R0J A;  4EJW A;  1KU9 A;  1YO5 C;  3J7A O;  1BIA A;  3MAJ A;  3MFK A;  2EFP A;  1IXC A;  3GW2 A;  1O3S A;  3D5L A;  1UST A;  3F8M A;  1Z9C A;  1H9T A;  3I54 A;  3SZP A;  3WTX C;  1USS A;  2FBI A;  1U2W A;  3KP5 A;  3R60 A;  4JK1 X;  2YR2 A;  1W5S A;  3IHU A;  2V79 A;  3K0L A;  2LKP A;  1ZGA A;  4XSX F;  1LB2 A;  2IA0 A;  3I4P A;  1TQI A;  4FT8 A;  2A07 F;  3EDP A;  1LQ1 A;  1XSD A;  1XN7 A;  2XVC A;  3P9I A;  1R23 A;  4A0X A;  3BRO A;  1QPM A;  3I0T A;  4XRF A;  3KP4 A;  2KJC A;  2A5Y B;  2RNJ A;  2MH9 A;  3KP7 A;  5JVT A;  2JZY A;  1HXD A;  3QP6 A;  2STT A;  5ILS A;  4HF1 A;  2STW A;  2LNB A;  1LDD A;  3GZ6 A;  4LK0 F;  2EA2 A;  1KQ8 A;  1UFM A;  5HLH A;  3IWZ A;  5FGM A;  3MZY A;  2W57 A;  4PDK A;  1Z6R A;  1Z91 A;  3E6D A;  4M71 A;  3OV8 A;  2Q2E A;  3M1E A;  5E8G A;  2Q8K A;  1EH8 A;  4HF0 A;  1NHA A;  2FMY A;  4Q47 A;  4R8H A;  2ZNY A;  4ZH4 F;  2W84 A;  3L2C A;  3M8F A;  4KIB A;  3V8K A;  2J5P A;  3HOS A;  1T2K A;  3FMS A;  3RKY A;  4FX4 A;  4HLY A;  5E18 F;  3SZT A;  1SFU A;  5DEQ A;  1FBQ A;  2VON A;  3GFM A;  3H3U A;  1I1S A;  2DPD A;  4KUM A;  1XGN A;  1HW1 A;  4QWQ A;  1RI7 A;  1HKQ A;  3KP6 A;  1DPR A;  4XLN F;  2DW4 A;  4EJU A;  4EGY A;  4HX4 A;  2NNN A;  2G7H A;  4G6D A;  4HF2 A;  1ZRF A;  5LRS A;  1XMK A;  4HV5 A;  2HQN A;  4B09 A;  2FXA A;  3C7J A;  2OAZ A;  2A3S A;  2H6C A;  3CO7 C;  1U3E M;  2KRF A;  2AXL A;  1Z05 A;  1WWX A;  2AS5 F;  1KU3 A;  3ZP5 A;  2D45 A;  1U6G A;  2IRF G;  4IRG A;  1RIO H;  2PLY A;  2HR3 A;  5FFZ A;  4Q4Z F;  5HLI A;  2ZME B;  1R5G A;  3MZH A;  2RDP A;  1H9G A;  2L02 A;  3VEP A;  3EET A;  2PFB A;  2QUF A;  3L09 A;  1DUX C;  1HKT A;  5JHU A;  4WWC A;  1BOA A;  2VN2 A;  4GO1 A;  3DKW A;  4LG0 B;  2HQR A;  2QBY B;  2XAQ A;  1ONV A;  5BMZ A;  1ZRC A;  4RGR A;  1FSH A;  1B6A A;  2C6Y A;  4E70 A;  5BS6 A;  2FU4 A;  3ABU A;  5LHI A;  1QGP A;  4GXO A;  2JPC A;  2Z33 A;  5D4R A;  2Y0M A;  1P4X A;  3ZN1 A;  4AIH A;  2UZK A;  1LVA A;  2OZ6 A;  3M8E A;  3FHZ A;  2RV8 A;  4YFX F;  1BM9 A;  2HKX A;  5HDK A;  2ZJ2 A;  2ZME A;  2DAO A;  4O3M A;  3J80 K;  3LA7 A;  1EH6 A;  3CUQ B;  4G94 A;  4RS8 A;  2F5C A;  3KE2 A;  3KLO A;  4LG0 A;  1FWZ A;  2QBY A;  2ADU A;  5ERI A;  3ZQ7 A;  3ABT A;  4P55 A;  2IVM A;  4HA8 A;  3T8R A;  2FQ3 A;  3CUQ C;  3ZMT A;  2RGV A;  1IF1 A;  4L5J A;  1SD4 A;  3E97 A;  3ERE D;  4ESB A;  1RUO A;  1BC8 C;  1PUE E;  2R7D A;  1ZLK A;  4XSZ F;  3J81 Z;  1RNL A;  2COM A;  5HS7 A;  1XD7 A;  2A61 A;  1ZLJ A;  2DPU A;  3BP8 A;  2MH2 A;  4OOI A;  4FHT A;  2TDX A;  2UXN A;  3CUQ A;  2L01 A;  1O3Q A;  1IRF A;  3C1D A;  4NQW A;  1IN4 A;  5ILV A;  1FP1 D;  5ICG A;  1JXS A;  2RVC A;  4NB5 A;  4B8X A;  4IVN A;  3HTS B;  1GVJ A;  4L9J A;  3ZMV A;  3TO9 A;  3NQO A;  1TQP A;  1KQ9 A;  2HTS A;  4A5N A;  1MJ9 A;  2IJL A;  3F22 A;  3WGH A;  1S6L A;  3V7R A;  3Q5F A;  2QQB A;  2RC4 A;  3E5Q A;  3HRM A;  2EV5 A;  2HTJ A;  2D2W A;  2YSR A;  1U8R A;  2ZXJ A;  5K1Y A;  2MD5 A;  5D5W B;  1LNW A;  4CHU A;  3F21 A;  1HW5 A;  2HKO A;  2DO7 A;  4LLG F;  3J81 K;  4EV0 A;  1IN7 A;  4LMY A;  5HDN A;  5D5V B;  1YG2 A;  3GZ5 A;  4G6Q A;  3HRU A;  5DUI A;  4I2O A;  1F9N A;  4YFN F;  1I6X A;  3HIF A;  4ENJ A;  1VTN C;  2VC0 A;  1ZG5 A;  1Y0U A;  2OU2 A;  2VOP A;  2O3F A;  5JFR A;  2FOK A;  4LLL A;  5FLX K;  1KGS A;  5J8F A;  4UV9 A;  2XUB A;  2VBW A;  5HOO A;  4S05 A;  4BNC A;  2XAG A;  2FRH A;  3LFK A;  1ZYR F;  3WE3 A;  2K4B A;  4GGG A;  2P7V B;  4IHS A;  5KK1 A;  1P6R A;  3F6O A;  3RTR A;  1T0F A;  3GFI A;  5D6E A;  4IHT A;  1DP7 P;  1GHC A;  2XRN A;  5D5U B;  3WU1 B;  1BIB A;  3RYP A;  5BOX A;  4UV8 A;  3RI4 A;  2HGC A;  3IWF A;  1FZP B;  3B73 A;  5CJ9 A;  3RIR A;  2M1B A;  2NNY A;  3JAM Z;  3TO6 A;  4LJZ F;  2HZT A;  1WRJ A;  3LQQ A;  2VT2 A;  5DYM A;  2KKO A;  2XV4 S;  3BPV A;  1E2X A;  1MKM A;  4XLP F;  1PP7 U;  1OPC A;  1XCV A;  2LSO A;  3HSE A;  4M9S A;  5E1W A;  3BY6 A;  2E7X A;  3RYR A;  1ZG1 A;  4I7H A;  5L3F A;  1R1T A;  1FSE A;  4A5M A;  4L0Z B;  1FBS A;  1SD6 A;  3I5U A;  1OKR A;  3CTA A;  4HZF A;  1D5V A;  1JHH A;  4RB1 A;  1H0M A;  1UCR A;  1J7K A;  1W4M A;  2DQL A;  2DLL A;  5FD5 A;  4L9V A;  5LGU A;  3U1D A;  3WTV C;  4KDP A;  3F8C A;  3L7W A;  3C3W A;  1S29 A;  3EYI A;  2DTR A;  2PBI A;  2RKH A;  3GF2 A;  4EM2 A;  4Y13 A;  5H6R A;  3RPQ A;  2MBF A;  1O3T A;  2QLZ A;  1P4A A;  2FBH A;  2H6B A;  1J59 A;  5DD8 A;  2Z3Y A;  1R00 A;  3NRV A;  4XBF A;  1OYW A;  2BE5 F;  3HYI A;  4KMU X;  2KJB A;  5CVR A;  3JAM K;  4TV7 A;  3P7N A;  4ZYE A;  5E8I A;  1ZRD A;  2QM3 A;  1ZH5 A;  1AOY A;  4MGR A;  3S2W A;  4I98 B;  2JT1 A;  4EM1 A;  1ZHF A;  3O3K A;  4EQQ A;  1G3W A;  3Q9V A;  1B9M A;  1FBU A;  3WTT C;  4A2U A;  2CGP A;  4LB6 B;  3TGN A;  2VE9 A;  3QRF F;  3ZMD A;  4G7Z F;  4L0Y B;  5HS9 A;  1IN6 A;  4U0V A;  2L54 A;  4IRI A;  2IP2 A;  4A0Z A;  4M72 A;  2QQA A;  2DT5 A;  2PI0 A;  1YYV A;  1V3F A;  5HS8 A;  5JI6 A;  3F8F A;  4N9H A;  4CXF A;  1I5Z A;  5KVR A;  1L3L A;  5FB2 A;  2CSO A;  4OU0 A;  3EUH A;  4EMS A;  1ON1 A;  2Z9O A;  3TDU C;  5LBQ A;  5D8K B;  2OD5 A;  1KU2 A;  2X0L A;  1A04 A;  1T98 A;  2ZCW A;  1UHW A;  2GQQ A;  2PMH A;  4ESJ A;  1T39 A;  1HQC A;  3M7G A;  3TO7 A;  3RDI A;  3DV8 A;  2GA2 A;  1TNS A;  3ECO A;  3JTH A;  3ROU A;  1FOK A;  3W6K B;  1W5T A;  1FNN A;  1Q1H A;  3CUO A;  1MD0 A;  5L3E A;  1P2F A;  2L3D A;  1MZB A;  1T6S A;  3DXJ F;  4N9I A;  2MLK A;  4ZZD A;  5DDG A;  1KU7 A;  1G3Y A;  3ISP A;  3DPL C;  1F5T A;  3SFZ A;  1B4A A;  3FMR A;  4A6D A;  1R1U A;  2FEZ A;  3I58 A;  2NS0 A;  2EK5 A;  4HX7 A;  1TLH B;  3R0A A;  2QVO A;  2EFW A;  4ZYH A;  2J5O A;  3GFJ A;  3T8T A;  2JSC A;  2QQ9 A;  5K5O A;  2GWR A;  3J80 Z;  1YQA A;  1BBY A;  4L9N A;  1Z1D A;  4MQV A;  1K7A A;  4IXA A;  3CO6 C;  5ILU A;  4KYW A;  1OMI A;  2MC3 A;  3IRQ A;  3F3X A;  1L0O C;  4I02 A;  2K7L A;  3MQ0 A;  2CWE A;  5J8C A;  2CG4 A;  3HHH A;  1KA8 A;  6PAX A;  2YX7 A;  2CW0 F;  1ZRE A;  5CVV A;  3ML6 A;  4JQF A;  2CYY A;  4HAM A;  1OYY A;  2FNP A;  3HHG A;  3EYY A;  2FE3 A;  2E1C A;  5DUK A;  1SFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...