1TP4A

Solution structure of the xpc binding domain of hhr23a protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
NPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna repair
molecule keywords UV excision repair protein RAD23 homolog A
publication title Structure of the XPC binding domain of hHR23A reveals hydrophobic patches for protein interaction
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1tp4A00
1X3WB 1QZEA 1X3ZB 4YIRX 2F4OB 2QSGX 1OQYA 1TP4A 3ESWB 2QSHX 2F4MB 2QSFX 1PVEA
chains in the Genus database with same CATH superfamily
1WCMJ 3CUOA 1BC8C 2A6EF 1WJAA 5E8GA 2Z5UA 3QU6A 3OS2A 5GAGJ 2L9NA 4BJ6C 2BW3B 2KIQA 4F91B 2DA4A 2XSJC 2DDAA 3BJ6A 5KK1A 1ZLKA 2FMYA 2XKPA 2M8EA 4XLEA 4KISA 1WWXA 2VJJA 2IPQX 5J4VA 2ZC2A 5BQTA 1IRXA 1WZ2A 1LJ9A 3IH4A 1J09A 2P6SA 1FMVA 3H92A 4ASNA 4QIWN 1WSUA 1IDZA 3W2VA 1G3YA 2EFOA 3DWLE 5DUKA 2CQ7A 2ZJPF 1YW8A 2MBFA 2UWMA 3H9GA 1Y6IA 5ILVA 2O6GE 4MQVA 2MGQA 1R9TJ 5HOOA 2KQRA 2R7FA 3R0JA 1X4PA 4PUSA 3C2BA 2IS4A 5FLVA 4BXXJ 3PO2J 1LDKB 2F5EA 3G3ZA 1X3ZB 5B1BH 2F2EA 3U21A 2AXTC 4PJJA 3R6SA 1LEAA 2KP6A 5L3CA 2XAJA 4DYQA 3ISPA 1I1GA 2J5OA 1EH7A 1VQLI 3KIOA 2BVLA 3PQJA 1Z6TA 4L5IA 3FBNB 1A31A 4L0YB 5JLWA 2LSOA 2WTEA 2HVQA 1O7LA 2CH0A 1WVRA 2VL8A 4LK0F 3CUQC 1IN7A 1IAWA 2K3FA 2UZKA 2Y48A 1R7JA 4MNUA 4A6DA 5B1AH 2VQLA 1YIOA 2ID3A 5J1RA 2YU3A 1HKTA 4YELA 3H5AA 3OR1C 3FHNA 2ZNYA 1VQ8I 2VOPA 1ZGJA 3RQ4A 3E5UA 4XKVA 1Z6RA 3CO6C 1A35A 2CW7A 2XKOA 1R23A 1IV8A 4IOCF 1TNTA 3BJAA 3ZGKA 1G4DA 3EETA 4F93B 2CFXA 1U3EM 2R92J 2JK3A 2HOEA 5F27A 3TEDA 2NVTJ 4UV8A 2PEXA 3NWTA 3H0DA 2PI0A 4MO7A 1RIOH 4W1UA 3S17J 4XIDA 2M3AA 3KP7A 2X6YA 3LOCA 1J5YA 2L7MP 1LB2A 5JHFA 2A07F 2VODA 2HDWA 2FOKA 2KISA 4PCQA 2EB7A 2HR3A 5F1JA 4RA2A 1Y0UA 3A01A 1MNMC 2OAZA 5D5UB 1XSXA 4BHCA 3OYGA 1FTZA 2Y9ZA 1P6RA 2VJ4A 2A6TA 4UB6C 3KP5A 3F0CA 2IRFG 1IUYA 1DP3A 2DODA 5DDGA 2V7FA 2H6CA 5DD4A 3CLQA 1DGRM 1XDUA 4X1EA 3RPQA 2YS9A 3JRFA 3BTJA 1R22A 1DQUA 4IXAA 4E7IA 2K4BA 2V9PA 5D5VB 2W1OA 3TOBA 1B8IB 2K5CA 2CWEA 3WTUC 1UHWA 1PYVA 5LGUA 1TQMA 2HI3A 1DPUA 1TLHB 5LEJA 3K10A 2RGVA 3I53A 4HNTA 5K5RA 3A1YA 2W4SA 1I1SA 4BJTA 4YFKF 2O8XA 3CC4I 1D8KA 3RKXA 2Q0OA 2DA2A 4B09A 1HQCA 1ZELA 4MHGA 3S3NA 3HTSB 4P1WA 3SFZA 1LQ1A 2LY2A 1Z77A 2E71A 2ECBA 2XSDC 3WG7H 4C2MJ 1OYIA 1WH5A 1A6IA 3P5JA 2KIUA 4XK4A 4E7HA 2CU7A 2E1NA 2W25A 1K83J 3MQ0A 1FOWA 1Z21A 1D1CA 2QLZA 2UXXA 3OOPA 3I3LA 2X51A 1FTTA 1JHFA 3E97A 3IRQA 2ZJQF 4XLNF 1K6YA 5ICEA 1XG1A 5CJ9A 1UFMA 2ZJ2A 2FMLA 1GV5A 3MZHA 4CCJA 2BVMA 4B3AA 3DQVC 2RKHA 3KCCA 5DM7F 4DZPA 2P5LC 1YJ9I 2QQAA 2RVCA 1LFUP 4BEHA 5HDNA 2ZSHB 3HRMA 3S2WA 2QEXI 1FP2A 4EJOA 3ZP5A 2XB0X 1MMSA 1XMKA 3KZZA 4PGGA 1HKQA 5M5YJ 2P7CB 2KL4A 2PMZN 3TL4X 2M30A 2CV1A 1WJEA 3H3VK 4DBQA 1XDSA 1X3UA 5IYDJ 5D8LB 2YX4A 2A61A 4M9XA 1YO5C 2ISYA 2MG4A 3IKTA 3BOQA 2LP0A 2VT2A 4RAZA 4EJTA 5FLXZ 4LLNA 3ZMTA 1ON2A 2K85A 1YW7A 4LG0A 1ZGWA 4UUVA 1ZK8A 4ETSA 3M7GA 1A5JA 3HGGA 4I0BA 2QENA 2QQ8A 3ELKA 3IRRA 5IYBJ 4ZYHA 2KT0A 1U8BA 4RLFA 5LHGA 3T0YA 1BJZA 2HOSA 5GTIC 1P7IA 1R6RA 2E35A 2MH9A 1R5GA 3GFIA 3GYHX 2X0LA 3TDUC 4ZYDA 1YYVA 2E1MC 4IQJA 4NHJA 1T6SA 2V1UA 3AG2H 1NG7A 2LLKA 5A2QZ 1CQTA 1BR1A 2K40A 2ZXHA 1M1EB 2LFBA 2OZUA 1UG2A 3JR9A 2L9SA 1IJWC 1N77A 2V1NA 3JW4A 1JTXA 3VFZA 2XAQA 3FM3A 4F92B 5IT9Z 2BBYA 2LNBA 2W7NA 4ANJA 2HTSA 3OSFA 2KMUA 1USTA 2LOOA 3ZMUA 3KETA 2M2EA 5HS7A 1X1CA 1FT9A 2DO7A 3S93A 1ZARA 1R00A 3E0JB 1ETKA 4U0VA 2LF8A 4QLCU 3PIOF 4V2FA 1IN4A 2CG4A 4JK1X 1BI3A 4BL0B 4CSWA 1G3WA 1FIAA 2XASA 5K7HA 5E20A 1OMIA 3ML6A 3M8JA 5CVUA 2O8KA 3I58A 3C2HA 1RC9A 4GRIA 3Q3SA 2V6CA 4KN4X 1WH7A 2LC2A 4D7NA 1ZYRF 1YX5A 3OYEA 3OWTA 4UHTA 3QAHA 2IS6A 4PFOA 1ZG3A 3G2BA 2D45A 4PDKA 1VQ5I 3BTIA 3HUGB 5ICFA 3A0BC 1MD0A 2CQKA 2OF7A 4UNOA 4KT6A 5KCMA 3NARA 2XAHA 1VQ7I 5E1WA 4UUSA 3F8BA 2NVXJ 5E79C 3BPXA 4NBQA 4YIRX 2JPBA 2OBPA 1NTCA 3HBLA 4P9UA 1GT0C 1MKMA 5D5WB 3I54A 2M9HA 1JUPA 2MA3A 2ZKZA 3VYUB 3S14J 1P2FA 3GTLJ 1HSTA 3IWZA 4Y13A 3F23A 3JRDA 4M74A 2XGXA 4UY8I 1UELB 1ERDA 1CF7A 1ZG1A 1POGA 4WF2A 5EYRA 4OIRF 5GPCA 3RDIA 3K2ZA 1KQ8A 3IHUA 5DEQA 3GTJJ 1VQ6I 3V7CA 1OR7C 1J0RA 3HOZJ 1XCVA 1TWHJ 4CCOA 3H35A 3KEOA 3EUAA 2JA6J 5EZHA 1WJCA 3ZRGA 4PJ0C 5HLGA 1FX7A 4IO9F 2M34A 2CW8A 2XV4S 2R5YA 2A05A 3W6JB 2VC0A 1R49A 2IT0A 1RETA 4PJLA 1KU2A 1MBJA 1ZQ3P 3S16J 1BI0A 2IJLA 2Y0SN 2XGCA 4HOBA 3M07A 2EIMH 4ZYGA 2P0WA 2R4GA 4ZZDA 4L9JA 1JKOC 1SD7A 2V9VA 3K70D 3ZPLA 1TBXA 2VQGA 2VE8A 4XONA 5ILSA 3KYLA 1G6NA 4LIVA 2Z16A 4OOIA 4LITA 4ABZA 3FXKA 1Y8QB 2X1EA 3EYIA 5GAEJ 4O3MA 1D1AA 4IZZA 1Z91A 4HRIA 1XSVA 4NQWA 5FROA 2DMTA 1O3SA 1MSEC 2H6BA 1XC5A 3AFHA 2R7SA 4CZCA 2BY1A 4BJ5C 1E3HA 3AKZA 1IXCA 1O3RA 3V7RA 4KFCA 4X0GA 1BIAA 1HKSA 2KJCA 3OYDA 3LSPA 1JI8A 5FKNA 1X3WB 1YG2A 2L4MA 2XAUA 4N0BA 3ZN1A 3TBIA 1FBQA 1W0TA 5ICGA 1TP4A 2I8DA 2L01A 1WHUA 3OMYA 5EEGA 1MBEA 3S2HJ 3BR3A 1O3TA 4BBRJ 3HTUA 1J2XA 1OFCX 3LSIA 3GTGJ 2O7OA 5H20A 1VTNC 3D0SA 1S7OA 3VEPA 1R4NB 4OIQF 1RPWA 1UCRA 3F8CA 1VI0A 3KP4A 2E5NA 2X1DA 5HDGA 4IRHA 1JJ8C 4CCMA 2K4JA 2O0YA 3PUBA 4L0ZB 2KIFA 3F8NA 4P5OA 1EH8A 2WADA 2Z3YA 3ROUA 1XGSA 5D4SA 4AIKA 2XRNA 4XRSA 4YFNF 3BR6A 3OY9A 2HVSA 3NAUA 4I01A 1XS9A 2PG4A 1TWCJ 4YFXF 3OYIA 5FLMJ 2VQHA 3HPGA 3K1PA 3R60A 3E6BA 1T0FC 2YUSA 1U5TA 3BY6A 1G2HA 3DF8A 4WX9A 2ZXWH 4JP0A 2W00A 1V5GA 3EUHC 4F52A 1ULYA 1OCRH 3K2AA 4UUSB 2DA3A 3MAJA 5B3SH 1P4XA 3FDYA 3ZMDA 1F5TA 2L4AA 2EWNA 3RYRA 1IUFA 2XPVA 3PFIA 1TZLA 3T8TA 2NYXA 1MMAA 1I5ZA 3SZTA 2QWWA 3RQIA 2AXLA 1WRJA 4ZTJA 2FBKA 1R4MB 3ONQA 2M5WA 5H2FC 2H27A 5FFZA 4QWQA 1CF7B 4EATA 2P8TA 5DCMB 1MGTA 3X2QH 2CO5A 1MJBA 4RGRA 4XRMA 3DTEA 1QVTA 1SMTA 2X6WA 4K2EA 1LUJB 4A3EJ 1KYZA 3JTHA 3ZR8X 1J75A 1VQ4I 3CTAA 3TO9A 4LG3A 5L3GA 4BHPA 5IYCJ 2RAEA 1QZZA 3ABUA 4A3CJ 3JRIA 2OQGA 1S6LA 4M6XA 1EH6A 3DEWA 1R5ID 1W0UA 5K5OA 1N75A 2BHYA 3BLYA 5CLSA 1RKWA 3CJNA 2XUBA 5KHDA 3PM1A 3OSGA 3I9V2 3M1CA 3F8FA 1B59A 2CYYA 1W7PA 2DMPA 4LLGF 2FU4A 2H94A 2QUFA 2FA5A 1ZR2A 3KEYA 1V4RA 2HKXA 5E3LA 1ETXA 2OPTA 4L9VA 3WG9A 2JTVA 1YITI 3SHFA 1NK3P 4QTRA 2VBYA 3DEEA 3RKYA 5D4RA 2MC4A 2Z33A 4AM3A 1BOBA 3L9FA 4M73A 4AVZA 3S2DJ 4NQWB 2MLGA 2ZBKA 1MJAA 1OCZH 1D0ZA 3LQRA 4HBLA 4HX8A 3DCFA 2O61A 1W7PD 2FBHA 1C0WA 2LD5A 2HDCA 2H8WA 1GLNA 2FUG2 2VIXA 3JSOA 2NS7A 3VDXA 2OD5A 4G8XA 4A0ZA 3WGHA 2CFOA 2A6HF 3ZMVA 2Y69H 2YR2A 4MFEA 5H6QA 1FC3A 1ZAOA 3ZQGA 3HG9A 4UVCA 3CC2I 4I6ZA 1E17A 2EA2A 2QQ9A 1FYMA 2F5VA 3J80K 1ENHA 1G8XA 5DM6F 2CQQA 3OYFA 5ICCA 3GZ5A 4CICA 4A3FJ 2BXYA 2ZMEA 3OIQA 3SZGA 2JVHA 3Q0UA 4FE7A 1OYYA 5F1RA 1RESA 3V7SA 2NS8A 3RKWA 3L1PA 1R1UA 3CMYA 3B6CA 1UZCA 2DMUA 4Q47A 1ZRDA 4CGZA 1O7FA 5B5EC 2OCCH 3DBHB 2DT7B 2E36A 2JSPA 2EV6A 3HJEA 3C3WA 4FQGA 4I76A 1I6HJ 1FBUA 2G9WA 2WBMA 3GEZA 3P9CA 2L7FP 2VBWA 4BQOA 2FE3A 5HLHA 2FOWA 3ZOBA 5IT3A 2WAEA 3OL3A 1Z05A 3ZQIA 2YX7A 4HW0A 1KQ0A 1H8AC 2EFWA 4P55A 3TP3A 2D5VA 1SANA 3GCMA 1D5YA 3I4MJ 4BDZA 4IHXA 5EGOB 3WU2C 1XX5A 3MZYA 4HSRA 2LK2A 3FXJA 1L3LA 3F72A 2ME6A 4EJVA 1TWGJ 2EH3A 4HA8A 4XMYA 2LKPA 2BE5F 2VUMJ 3JRAA 3JAMK 3DEUA 3TMOA 3G73A 2WAQN 4XBFA 3WODF 4AD9A 3IP4B 3CJTB 3IH2A 4AVPA 2HS5A 3LSHA 2X4HA 3K4BA 3CP8A 3GBGA 4D0PA 4G7HF 3E6CC 4M71A 3FK7A 3O3KA 1TQPA 1X19A 3H0GJ 2NRAC 1YLFA 2XAFA 1PP7U 4BE0A 1AA7A 4XSXF 3F9KA 2LMDA 2GM4A 4JQFA 3FXQA 5KNLA 4J19A 2MABA 3VOEA 3BT9A 1HBXG 5E3MA 2K9MA 2QBYB 2ZCWA 3HOSA 4L9NA 4NUBA 1T56A 1U2WA 3ULQB 3ERED 4XRSG 4DYRA 3MFKA 3CMEI 4N9IA 2OTJI 2M45A 4D7MA 2HFHA 4FE4A 2K86A 2PQ8A 4DOZA 1T98A 4U7BA 4H0EA 1VZ0A 2Z99A 3FISA 4QPQA 2JA7J 4E7JA 4W97A 4A69C 1MW7A 1S3JA 2CMPA 2V9KA 4U0WA 1IXSB 3W2AA 1FEXA 2W57A 1BN5A 2E7XA 3U1KA 2KHMA 3CJRB 2X1CA 4J01A 2JMWA 2N8GA 1BA5A 4PSXA 3A0HC 1SD5A 2A5WA 2TDXA 2DA7A 3GFMA 4XN0A 3ZMZA 3GXOA 3LMMA 4DYCA 1KGSA 1FJLA 4GYIA 3L09A 3BR5A 3F8MA 2IXSA 2ECCA 3J81K 5FD5A 3DKWA 5CVIA 4MTEA 2M87A 2AQEA 2L0KA 2VBZA 2XGDA 3PL8A 3CDHA 1VF9A 2LY1A 1OQYA 1W36C 5F0HA 4RGUA 2NVQJ 3SEZA 1UHSA 2LDUA 2ID6A 3B73A 3ZCOA 3HOXJ 4GYGA 3CCUI 5LRRA 2IGNA 1OPCA 5M3MJ 2GXAA 3PJRA 2D1VA 5JVTA 4GGGA 1RNLA 2E5ZA 4GO1A 3ABTA 1FIPA 4GCVA 5M5WJ 1F4KA 3LSKA 5JI6A 1X2NA 1YRNB 3F3XA 1A6QA 2MD0A 3GLXA 1ZRFA 4M9ZA 1LDJA 3E6MA 4XQFA 4HLXA 1K7AA 2LKXA 2EINH 1WFXA 2HQRA 3U9GA 4HNVA 2DOEA 3TW6A 2R7RA 5D6FA 3DBRB 3RPUA 1BC7C 4MLOA 2RV8A 2YSRA 2WB1A 3GVAA 1Z3XA 4CHUA 5JFRA 4EGZA 3WE3A 4N9HA 2XHKA 2IGKA 4R8HA 4B3XA 2KRCA 2EPFA 3HL2A 1UAAA 5D6EA 4Y7NJ 4OIPF 5FB2A 2AQFA 4L5EA 4IHTA 3ABLH 2VJIA 4C3JJ 2K9QA 3GZ6A 4S05A 3RPUD 1QNTA 1TNSA 2P7VB 5J47A 3GF2A 1JKPC 1JKRC 4LK1F 3GX4X 3GW2A 2VKHA 3OR2C 5JVGF 2GZWA 1OCCH 2QKLB 1W5TA 3FHZA 2VKEA 3M1EA 5IP9J 5LEKA 2DT5A 2FQ3A 3KX2A 3CD6I 1Z7UA 2LTPA 4FISA 4Z2YA 4PGHA 3VYTB 2FX0A 3PNYA 3TKYA 3ZMSA 3L00A 2BY0A 4DW6A 1SFEA 3Q5FA 5CVVA 1GHCA 4HV5A 5GPAA 5E3NA 1V5EA 3QODA 3CCEI 3TQNA 2DPDA 4Y52J 3ZQ7A 1QGPA 1BI1A 1FSHA 3VPRA 3VWBA 1IO2A 4E7ZA 5D5XB 2HU9A 2WAFA 1YS7A 3FIWA 3P9KA 1BW5A 2DA1A 3CDLA 3TO7A 4XN3A 2MH2A 4KDPA 3KLOA 4BH9A 3MN2A 1H0MA 1FOKA 2LVSA 5DUIA 2A69F 4BNCA 1FP1D 2E1OA 2XROA 1ETQA 2P5KA 3O2PE 2WA0A 2MC3A 1P7JA 1BM9A 2XC7A 3QQAA 1EKEA 2GIZA 2QZ8A 4CYCA 4C30A 3WTVC 5BOXA 5HNFA 1QHGA 2DPUA 2OZ6A 1XCBA 3HHHA 2IW5A 3VYRB 5HS9A 1GVDA 4HF0A 5KAIC 1JUSA 2CQXA 2EZHA 2KIMA 2X85A 1VQKI 1BR4A 4HZFA 4BXFA 2XPWA 1X1AA 2D2WA 3QPHA 3BZ6A 2VBXA 2DK5A 2M4GA 3CLOA 1I6XA 2HQNA 1I50J 1SD6A 3WE2A 1DGWY 1ZGAA 2UV1A 4YIIA 1NHAA 3MD2A 2JPCA 5DTDA 5J1YA 1WQ2A 2FNPA 3TW7A 2CRGA 3ZQCA 4RLQA 1VNDA 1U9NA 5HLTA 1KU9A 4LFUA 2DXIA 3PSFA 1ODDA 2W85A 2V6EA 5HVQC 2EIKH 5F04A 4AC0A 4BHBA 3DTIA 3SQNA 3A01B 1QHHD 3EDPA 2G7UA 4CO8A 3JRHA 3J7ZI 3SJMA 2HOTA 1BW6A 1KZHA 2Y9YA 3G1LA 4KMUX 1QRYA 4LOCA 1MH3A 2IEKA 2DFFA 4G6QA 3K4CA 5JLXA 2G7HA 1T2KA 4ESJA 1UB9A 2PN6A 1XGNA 4UVBA 2TCTA 5J40A 1REPC 1OYWA 2JRMA 5F0CA 4KJZA 4EJUA 2XRLA 4MQ9F 5LGTA 5HNHA 4EMSA 2XB5A 2ESHA 4P9FA 4IQ4A 4AIHA 1T95A 3D5RC 3CMAI 1FPQA 2WV0A 1GUUA 5B66C 3TOAA 2M1BA 4RM2A 3WTWC 5LBQA 3EPZA 3OIOA 4M3DA 2ELHA 2PX9A 1K4TA 4OU0A 1S7AA 4FCYA 3C7JA 3OYHA 2YPRA 1B6AA 3O6BB 1QPIA 1NG6A 2V26A 3DPTA 1MMNA 4HNUA 4KYWA 3G71I 1QA6A 4MIMA 3KP3A 4MEYF 5FKKA 4BDYA 1APLC 2ISZA 2A5YB 4ENKA 2UUZA 4XOTA 4A3DJ 1SVOA 1ZKGA 2PMHA 1R71A 3OS0A 3FMQA 2RN7A 2BXZA 1H9GA 3S1QJ 2GQQA 5C4XJ 4OWRB 4JYKA 4KMFA 4WK8F 3FX3A 4DGWB 3WTYC 1SEUA 2BHZA 1QQIA 2VXZA 3HXLA 1YOVB 4YG2F 4BAYA 1UJ8A 3OIPA 4BE2A 2FNAA 3HSFA 4BY1J 1JKQC 3I4NJ 3ECHA 3IL2A 3OV8A 2RNJA 1TT0A 4BEHB 3W2WA 4A3BJ 2KFDA 1B9MA 2Y0SA 1XGMA 2M4KA 5F64A 5IP6A 4BYYA 4EGYA 3RIRA 4IHWA 4CCKA 1PJRA 1SVLA 4KIGA 3OYJA 3IC7A 1WGXA 3FXMA 4HEA2 4PK4A 4NDLA 4CYCB 2XF7A 3DKYA 3LSGA 3MWMA 2ZFUA 2X6XA 4XKWA 1I3AA 1SFKA 3I59A 4OINF 2DQLA 3KPHA 4WXDA 3HOYJ 1V5FA 1U8RA 2W24A 2HWVA 4FASD 1HW5A 1ORKA 2OA4A 2GLOA 2R7DA 4KUMA 4XL9A 1D3YA 5CVJA 1ONVA 1SD4A 2H09A 4U0YA 4LG0B 1LVAA 5ED4A 3K0LA 4N4NB 1FYKA 4DIQA 2XIGA 4D1QA 1E3OC 3HYIA 2P4WA 2OC6A 4DNCA 2NS0A 3FM5A 4JX6A 2EFNA 3ZQLA 2R7TA 2ESNA 1XD7A 3DKXA 3LA2A 1YX3A 3OYKA 2F6CA 3L2VA 3AG1H 1OLTA 4OAYA 1IN5A 4ESFA 2CV0A 2VLAA 3IKVA 2JWTA 4BXUA 5E18F 2F4OB 1RI7A 2KPMA 3LSTA 5EZGA 1F36A 1PP8F 3K4JA 2R3SA 5FFXA 3I0TA 4AIDA 2OQRA 3ECOA 3QPSA 4LGWA 3RZOJ 4HYEA 1KONA 3GTQJ 4FX4A 3OYLA 4KITB 1Y39A 3CP2A 2XAGA 1A36A 1N25A 5C4JJ 2DFHA 4ESBA 1HF0A 3L2UA 3FXUA 3AG4H 5J4YA 3IUOA 3NRVA 4M3BA 2HZDA 5LGNA 2XVCA 1K78A 4QSHA 5FKLA 3Q9VA 3Q0WA 3SDGA 3V8KA 5FD6A 5IP7J 3DFGA 2HNHA 1FY7A 1LDDA 1XTAA 2ZNZA 4A5MA 1K79A 2COMA 4Q5SF 5CQEA 2I5UA 2BV6A 5TISC 1ZREA 2R7UA 5EEHA 3MEXA 2CW0F 5F6FA 2F5FA 2IS1A 3IAM2 1J59A 2L3DA 2F4IA 4ZYEA 2P5VA 4EQQA 2MW8A 4HQEA 3RTRA 2ZXJA 3RZDJ 2NNYA 2KDOA 3IH3A 3QRFF 3G6EI 3CO7C 4H4KC 2JN6A 1MNDA 4RAFA 4A3KJ 2OU2A 1N78A 3PUFA 1MZBA 2WV1A 2W82A 2M0MA 3WTZA 3FXOA 3H5RA 3E3VA 3L2RA 3BZCA 1QBJA 2BY3A 2STTA 2CQNA 2DOAA 3KLNA 5E3OA 2GOMA 1YQAA 4EM0B 2IBDA 3H9QA 2FQ4A 3MCZA 4BU2A 4CUGA 1B72A 1OCOH 4IKFA 3AL0C 3WGGA 3N4MA 1B4AA 2JA2A 4E7LA 4A6EA 2DCEA 4I7HA 2R7OA 3AL0B 2IA2A 4OMZA 2EV0A 1EF4A 1MH4A 2FXAA 2X48A 4ZJZA 2LRDA 3DPUA 3QU3A 1D8JA 2GXBA 4JX4A 5EJCA 2MYSA 2ZO4A 4ZC3A 1D0XA 4XLPF 4WCGA 2KJBA 4I09A 3NWSA 3HOTA 2IA1A 2QCOA 4L18B 1O3QA 4HV6A 3DTKA 4IRIA 2HPIA 2JUGA 1RKTA 1TWAJ 2DU9A 1ZH5A 2CUJA 2K27A 3A02A 3S15J 1IZ1A 3H5NA 4BE1A 4CCNA 4ENMA 2FF4A 2BW3A 2R5YB 3E5QA 1MBKA 1LVKA 3DP7A 1MJ9A 2E2JJ 2LY9A 4B48A 4D5CA 1ZN2A 1HA8A 4NNJA 1WKMA 1XMXA 1SAXA 2LBFA 4Q4ZF 1JXSA 2WC2A 3ASOH 5DD8A 3Q0VA 3V8JA 5M5XJ 1FLIA 1YI2I 3K69A 1QZEA 2NVYJ 3RI4A 3CCJI 4KICA 5LHIA 3BG3A 2K3PA 3PSIA 2GAUA 4RB1A 3CCYA 3LSRA 2F5DA 3PIPF 2OUMA 2DK8A 2BYVE 2E19A 5CYVA 2NXNB 2ZJRF 2O9LA 1BL0A 3SDBA 3OYMA 5IY5H 3BP8A 3VYSB 4AYBN 1JGGA 4OAZA 2XPUA 3DPLC 3TO6A 2EV5A 1Q1HA 2XF6A 4XRFA 4Y4RA 2DBBA 3PNVA 4M9SA 2H1LA 2VT3A 4B47A 2VI6A 2Y31A 3HKZA 4HG2A 2M7BA 5DV5A 3GFJA 3ZQQA 1K78B 2DDBA 3UKGA 1QU3A 3W3CA 5LD2C 1IW7F 3K4MA 4A3LJ 3HC7A 4RB3C 2B0LA 1DP7P 1ZLJA 4BUPA 2FJ1A 2VONA 3T5XA 4WXCA 3E7LA 4G6TB 2GA1A 4A5NA 1S9HA 1LFBA 3CUQA 4BS9A 1XGOA 1OISA 2R7VA 5FRMA 2IS2A 2R7ZJ 3BZKA 5JHUA 3S3OA 2DAOA 3S32A 4BQNA 1U5TC 2R7QA 2Q8KA 1F43A 1ETWA 1HW1A 2FBIA 2HYGD 5J8FA 1UHMA 3C18A 1MIJA 1U5TB 2DTZA 2PFBA 3I64A 1KA8A 2BY2A 4RMNA 4X6AJ 4U7DA 2DA5A 4I2OA 4B44A 5IOZA 2O5RA 2HOAA 2JRTA 4F55A 3LFUA 2DN0A 1R1TA 2DFIA 3BWGA 4A0YA 2P6TA 4HF2A 1P9QC 1SVMA 1V54H 2R0QC 4XORA 5LHHA 1IC8A 3HRTA 4IVNA 4S04A 1HOMA 3H3ZA 2C6YA 1W36D 1HW2A 4CZZA 2IGOA 2GIVA 3KZIC 4XLAA 2GWRA 1JHHA 1U9OA 2L02A 2K9LA 1R5HA 3JSPA 1FMWA 4DZJA 1TWFJ 5HODA 4CCLA 2JJ7A 2JT1A 4HX4A 5EG0A 4OIOF 3N05A 3JTGA 4P96A 3LA3A 3GUDA 1TTYA 1B8IA 2NOJB 1TQIA 5K7FA 1QPMA 2L9RA 3U2RA 1S7EA 2CSOA 3HPHA 3GZNB 5BPDA 2HXIA 4MGRA 3CCLI 1K4SA 1JUMA 2HXOA 5J3LA 1IRFA 3CCVI 1G3TA 3D1NI 2DJNA 2RQQA 1HLVA 3OYCA 3ZN0A 6PAXA 2VC1A 2LBFB 4C3HJ 3O8HA 4M3EA 1W7PB 3G1OA 3QP6A 3BG6A 5ILUA 1X1PA 3GFLA 2VE9A 1X58A 4B1RA 3LFKA 3OOUA 3L7WA 4E70A 5GADJ 1DU0A 4R1HA 4EV0A 3OYAA 4A3MJ 2Y30A 2Z2SB 3PO3J 3N97A 2QSFX 1UMQA 3FXRA 1YIJI 5FRNA 1VQNI 3F21A 1Y0NA 2UXNA 3QPTA 4IPAA 2IGMA 5AONA 4HAMA 1EJ9A 2AO9A 3DLAA 4L9TA 2V1XA 1KU7A 4HLYA 2JZYA 2HQ5A 4RGSA 2KDZA 1MBHA 3R4KA 1X1DA 1JTYA 5BNGA 1G59A 2W48A 3NQOA 4II3A 5L3EA 3GTKJ 3TGNA 5CKTA 4LJZF 2LR8A 2DT6A 4G7OF 2E1CA 1WI9A 4RB2C 4RBOA 3K4KA 1ZTRA 1MSFC 3M3YJ 1OKRA 2GA2A 4IHVA 1ETOA 4AWXB 2ZMEC 5FLXK 2ELJA 1QO0D 2K7LA 3J80Z 3A2KA 4B43A 3CUQB 2COBA 1QZYA 4G9YA 2ZMEB 2E60A 2F48A 4JOMA 2DMNA 2RQPA 3CESA 5E1ZB 5J1UA 1FSEA 3BCAA 3K9TA 4XR6A 2DA6A 4TV7A 3CF2A 1FWZA 2HDDA 3KP2A 2JUCA 2FRHA 2DI3A 4AU7A 2VJ5A 1WPKA 2ZFWA 3FMRA 2RDPA 5A2QK 4ITVA 5F0FA 3PQKA 5CQGA 3CCSI 1T08B 1OCPA 1XN7A 1SFOJ 3LQQA 4Z6YA 2DQRA 2WY8Q 4J00A 1ZR4A 1H88C 1W4MA 4G94A 4KN7X 1FOXA 1QVUA 4O6JA 3WGIA 2G0EA 2K9NA 3W6KB 3W6VA 1RR7A 1S8NA 4D5FA 2L9VA 2LREA 1AOYA 2L54A 3CJQB 3BR0A 5IT9K 4DQ2A 1I27A 1E0EA 3LWFA 5BS6A 4BBSJ 3SEQA 4I98B 2QSGX 1O4XA 2L5QA 2KRFA 1BI2A 3S1NJ 3KFWX 3QWLA 1MDMA 1V3FA 5AIPA 3DXJF 4RB0A 3FZVA 1K6OA 3V8LA 2P81A 1T38A 3BC8A 3DV8A 3FKJA 4XKCA 2KRHA 3JAMZ 1KU3A 1H9TA 5CPRB 1R36A 3LSJA 5EG0B 3B02A 4Y33A 4LLLA 1ZHFA 1NH3A 3CF5F 2PJPA 1Z1DA 4I0AA 2RC4A 4UXNA 1SFUA 4ZDOA 2MFZA 2VKDA 2AHQA 3JREA 2XDVA 4DJAA 2R7WA 1W1WE 4RM3A 2KKOA 3CMMA 1WJFA 2PMZA 4M3FA 2VXDA 1FOYA 2ETHA 2WB1N 4IJAA 4CXFA 1XPXA 2LH9A 5LLQA 1Y1VJ 4NB5A 2JVGA 2PLYA 4E7KA 1YFHA 3AAFA 2ME0A 4ZH4F 3RCOA 1P4AA 3HRSA 3S3MA 4UV9A 1T33A 5E17F 3HUGA 2CS3A 5C44J 3K4LA 2NVUB 3HOUJ 3FK6A 3ERMA 1E2XA 2F4MB 2NAZA 4O5VA 3BJOA 3QPLA 4F3QA 3DLLF 4E6KG 1J9IA 2V4JC 4JX5A 2R7XA 3GTPJ 1YE9A 5AIQA 3HSEA 4KIBA 5HS8A 3DBLB 1LNWA 5EEAA 3RKQA 1F1ZA 1S29A 2QVOA 2RNGA 4V19K 4IF4A 3P9IA 4HSTA 3BG9A 1FNNA 1IN8A 1MBGA 3E1SA 1AU7A 2V79A 4F7ZA 2QA4I 1AHDP 1ZG5A 2Z9OA 5CVRA 1G3SA 2CUFA 2X9DA 3DU6A 1DU6A 2BGCA 4XKBA 4IHYA 4A12A 3J81Z 3HOVJ 1W5SA 3NEUA 1ACIA 2HTJA 4A0XA 2VPLA 1SAUA 3LAPA 3DU5A 3O8GA 4IX7A 2EZKA 3WU0A 1OR7A 3OYNA 4KNYA 1WI3A 4XLCA 1TW3A 2ADUA 5FO5A 3HGYA 3D5LA 2BOLA 4C9YA 3I56I 1J7KA 2HYFA 1DPRA 3J7AO 3KEQA 2CJJA 2LKSA 3VODA 4GFBA 4EVIA 3GLLA 4Q48A 2Z1DA 2L7KA 3BQYA 4C2UA 2VPRA 3HOWJ 2BEOA 3QOPA 4UB8C 1SFXA 3HM5A 1EA3A 3SZPA 2R5ZA 5F08A 1RUNA 4RDUA 5IOYA 3CZ6A 3BR1A 1LPQA 1LEBA 1OJLA 5TRDA 2XGEA 1S72I 4KA4A 2R93J 1HC8A 5DS9A 3BROA 3QYBA 1KQ9A 5LFAA 1DUXC 4FHTA 3F22A 5HLIA 2H1KA 2E1MB 4ZDPA 2IP2A 3KYCB 4BGDA 4V2GA 1JT0A 1D0YA 1PVEA 5K7ZA 4FT8A 1I3QJ 2DYRH 3JRCA 1ETYA 3RYPA 2D1HA 1GVJA 2OV7A 1HDPA 5K1YA 4IOAF 2ACJA 3ZQHA 2M7AA 2EA4A 5FKMA 5EF6A 1MDMB 1GXQA 4ZZLA 2JA8J 1YS6A 2NNNA 4RS8A 3J7YJ 1GXPA 1ZRCA 3T8RA 4XLHA 3KP6A 1YJNI 1GV2A 1O57A 4QPOA 3BTCA 2JQ7A 4ZDLA 4HDVA 3WU1B 1XB4A 4EEFG 1VQ9I 1BR2A 2YU9J 3A03A 2EZIA 2B63J 3GTMJ 4LB6B 4LD5A 4PSWA 3TP0A 3REOA 3KE2A 2KZGA 2PBIA 2ZB9A 2EBIA 2HEOA 2VOOA 1T39A 4MEXF 2XF5A 2EILH 1IRZA 3U1DA 3BDDA 3VSKA 3I5UA 1RRJA 1DDNA 2QGUA 3EQLF 1YTYA 1LFPA 3FMSA 4WXHA 3V42A 2VB6A 2LF7A 2VKVA 1UG0A 4KT5C 3H9JA 3WTXC 3HRUA 4M3GA 1T0FA 3LNQA 1AWCA 4I99C 1IN6A 3S8PA 1KYWA 1A04A 3C1DA 4ENNA 1MBFA 5GP9A 3VSLA 1PUEE 3QP5A 3EUHA 2FD5A 3FF5A 1SC7A 2M8GX 1WJBA 4U88A 1XSDA 3I4PA 2RREA 5FKOA 3FXLA 1V55H 3SXYA 3RSNA 4G7ZF 2EJRA 1Y56A 4EJWA 3HDDA 1JT6A 3GTOJ 2EQRA 3FWEA 2DW4A 3SFIA 4RAGA 4PJMA 1YW9A 1BJAA 3GO5A 2OCEA 4IL6C 2CGPA 3K1NA 2CV2A 5DCMA 2HYJA 1IXRC 2DYSH 3OYBA 2CUEA 2Q2EA 3ZQFA 2QQBA 2EFQA 4ZTFA 2I10A 4NC8A 1HDDC 4BY7J 4WWCA 4A3JJ 3MKLA 3M4OJ 3E6DA 3ESWB 1K61A 5KVRA 3BQZA 1VFCA 4LIUA 4DBRA 4B4CA 3BPVA 1ETVA 3CDIA 3HHGA 2QF7A 2IAIA 4HPQA 1MNEA 1USSA 5HDKA 3IAS2 4FETA 4L5JA 1IDYA 4AUXA 2QM3A 3MZ8A 2R5ZB 2VASA 3EUKL 3FBIB 2HPMA 3HB9A 1BOAA 1YJWI 3CCQI 1D5VA 3BG7A 1PDNC 2ELKA 2O03A 2K02A 4R79A 3K7AJ 4XOPA 3P7NA 4CH7A 2MLKA 3HZJA 4BQAA 1RZ4A 2DJIA 3R61A 5D8KB 3S1MJ 1I39A 1U0JA 4XM3A 3KZYA 1FBSA 1LE8A 2QKMB 4PZJA 3MKWB 5E1XA 5LRSA 2MSYA 3COAC 1H89C 3JCUC 3K6GA 3M9AA 2V1DA 2MD5A 1PUFA 1ITYA 4GXOA 2EZLA 3UR3C 1Z67A 2GBYA 1B1BA 2GXGA 1T8IA 4EM1A 2PJRA 5TGTA 3IWFA 3LL7A 4IEJA 3BTLA 3LA7A 1W5CC 2HKOA 3K4NA 2A68F 3B6AA 4PJNA 1STZA 3C2GA 4M6VA 1TL8A 2FSWA 4CYDA 3MKZA 4A3IJ 5EDNA 3TDZC 4A93J 3HEFA 4XNFA 2B9SA 2K9SA 5C3EJ 2AS5F 2L7ZA 2Y0MA 3QOEA 3VB2A 4ZYAA 1MMDA 4ENJA 5GAHJ 5H6RA 1P4WA 5BPIA 3JRBA 2Y2ZA 2DMQA 2DTRA 4Y17A 5J8CA 1OCTC 1GDTA 4KIFA 3BR2A 3RJPA 1JJ6C 4HF1A 1Z3YA 4IHSA 4HX7A 3ZXSA 4GDFA 5DYMA 3CCMI 3D5SC 3HIFA 2WY7Q 1JE8A 1XMAA 2JSCA 2E2HJ 1U6GA 2KZVA 4M72A 1X2MA 1S5LC 2ICWG 4ON0A 3SYTA 1Z7LA 2PMUA 1EV7A 1HSJA 3M8EA 5ERIA 1P92A 3K1MA 2F5CA 2FEZA 4XLFA 1IG7A 3K70C 2DLLA 9ANTA 3S1RJ 3BCBA 1Y8RB 3F6OA 1BIBA 2IVMA 3H36A 1U78A 2L2OA 1IRGA 3OL4A 4NC6A 1AKHA 4EM2A 1Z0XA 4Y3OA 2J5PA 3I55I 2M0CA 3WHCA 1VQOI 4II2A 5EGOA 5TJJA 2EK5A 4S0HB 3I59B 4LB5A 3GMEA 2HVRA 3IV5A 3KYDB 2Y75A 2QSHX 3A4CA 4U87A 2TRTA 4RAYA 5E8IA 1D1BA 2Q2EB 2A3SA 2HGCA 3CQZJ 3V4GA 3L2WA 4AYBA 2OTLI 3I71A 2EIJH 3WTTC 4NC7A 4LMYA 3EYYA 1TT5B 1X1BA 4C2TA 1HXDA 1YHQI 4B8XA 1MMGA 2NOGA 1Y1WJ 2IA0A 4G12A 4D9JA 5L3FA 3L2CA 2ZXIA 3PFYA 1HCRA 1JGSA 5FJ8J 4YEJA 4CA0A 3Q9SA 2QBYA 2E2IJ 1VQMI 1Z9CA 4XSZF 1BBYA 3R0AA 4A2UA 1FZPB 2LYCA 4HQMA 2DFEA 4MTDA 4FTHA 2HQAA 2ZSIB 4JBAA 4UVAA 5DCFA 1TW2A 1SMYF 3LAJA 2BZTA 2KLOA 2GOXB 3F6VA 4BKXA 4C3IJ 2LG4A 1RR8C 4UUTA 3JRGA 1CGPA 1LE8B 3WTSC 1IGNA 2OJED 4N4OB 4XICA 2H8RA 1F9NA 4YRVA 3MMYB 1X4OA 2W84A 1PUFB 1WJDA 4Y15A 4AIJA 5GTHC 4E7SA 3PNTA 3G1MA 1R58A 1RUOA 2PJRB 1Q1VA 3GWZA 1IF1A 4G6DA 2Q1ZB 2O3FA 4HDUA 3WHBA 4IRGA 3T1BA 2HZTA 1NK2P 2X6OA 3CCRI 4I02A 2QYOA 2VN2A 4FX0A 4M6YA 5M3FJ 3H1CA 3L2QA 2E34A 3ASNH 3AG3H 1ON1A 4BACA 1IV6A 1E3PA 4PFPA 1WJ5A 3H3UA 5JR3A 3UNGC 4OMYA 3BG5A 3QYEA 4BQQA 3G4SI 5BMZA 5IPAA 4YIFA 2JA5J 3ABKH 5FGMA 1LKXA 3CC7I 2WAQA 1L0OC 5KAFC 2B7EA 1B72B 1YRNA 3HKZN 2DOFA 3HSRA 4CDGA 2WWYA 3MKYB 3OS1A 3MVPA 3FKIJ 5L3DA 2VQCA 5J6XA 4E4HA 3ABMH 4RGXA 1B9NA 3LSMA 4MFDA 5L3BA 5K5QA 2STWA 3J7AY 2E7WA 1VQPI 2CUZA 4A3GJ 3QYFA 3M8FA 1FYLA 1AKHB 1R1VA 3E5XA 1TC3C 2EFPA
chains in the Genus database with same CATH topology
1X3WB 1QZEA 1X3ZB 4YIRX 2F4OB 2QSGX 1OQYA 1TP4A 3ESWB 2QSHX 2F4MB 2QSFX 1PVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3W B;  1QZE A;  1X3Z B;  4YIR X;  2F4O B;  2QSG X;  1OQY A;  1TP4 A;  3ESW B;  2QSH X;  2F4M B;  2QSF X;  1PVE A; 
#chains in the Genus database with same CATH topology
 1WCM J;  3CUO A;  1BC8 C;  2A6E F;  1WJA A;  5E8G A;  2Z5U A;  3QU6 A;  3OS2 A;  5GAG J;  2L9N A;  4BJ6 C;  2BW3 B;  2KIQ A;  4F91 B;  2DA4 A;  2XSJ C;  2DDA A;  3BJ6 A;  5KK1 A;  1ZLK A;  2FMY A;  2XKP A;  2M8E A;  4XLE A;  4KIS A;  1WWX A;  2VJJ A;  2IPQ X;  5J4V A;  2ZC2 A;  5BQT A;  1IRX A;  1WZ2 A;  1LJ9 A;  3IH4 A;  1J09 A;  2P6S A;  1FMV A;  3H92 A;  4ASN A;  4QIW N;  1WSU A;  1IDZ A;  3W2V A;  1G3Y A;  2EFO A;  3DWL E;  5DUK A;  2CQ7 A;  2ZJP F;  1YW8 A;  2MBF A;  2UWM A;  3H9G A;  1Y6I A;  5ILV A;  2O6G E;  4MQV A;  2MGQ A;  1R9T J;  5HOO A;  2KQR A;  2R7F A;  3R0J A;  1X4P A;  4PUS A;  3C2B A;  2IS4 A;  5FLV A;  4BXX J;  3PO2 J;  1LDK B;  2F5E A;  3G3Z A;  1X3Z B;  5B1B H;  2F2E A;  3U21 A;  2AXT C;  4PJJ A;  3R6S A;  1LEA A;  2KP6 A;  5L3C A;  2XAJ A;  4DYQ A;  3ISP A;  1I1G A;  2J5O A;  1EH7 A;  1VQL I;  3KIO A;  2BVL A;  3PQJ A;  1Z6T A;  4L5I A;  3FBN B;  1A31 A;  4L0Y B;  5JLW A;  2LSO A;  2WTE A;  2HVQ A;  1O7L A;  2CH0 A;  1WVR A;  2VL8 A;  4LK0 F;  3CUQ C;  1IN7 A;  1IAW A;  2K3F A;  2UZK A;  2Y48 A;  1R7J A;  4MNU A;  4A6D A;  5B1A H;  2VQL A;  1YIO A;  2ID3 A;  5J1R A;  2YU3 A;  1HKT A;  4YEL A;  3H5A A;  3OR1 C;  3FHN A;  2ZNY A;  1VQ8 I;  2VOP A;  1ZGJ A;  3RQ4 A;  3E5U A;  4XKV A;  1Z6R A;  3CO6 C;  1A35 A;  2CW7 A;  2XKO A;  1R23 A;  1IV8 A;  4IOC F;  1TNT A;  3BJA A;  3ZGK A;  1G4D A;  3EET A;  4F93 B;  2CFX A;  1U3E M;  2R92 J;  2JK3 A;  2HOE A;  5F27 A;  3TED A;  2NVT J;  4UV8 A;  2PEX A;  3NWT A;  3H0D A;  2PI0 A;  4MO7 A;  1RIO H;  4W1U A;  3S17 J;  4XID A;  2M3A A;  3KP7 A;  2X6Y A;  3LOC A;  1J5Y A;  2L7M P;  1LB2 A;  5JHF A;  2A07 F;  2VOD A;  2HDW A;  2FOK A;  2KIS A;  4PCQ A;  2EB7 A;  2HR3 A;  5F1J A;  4RA2 A;  1Y0U A;  3A01 A;  1MNM C;  2OAZ A;  5D5U B;  1XSX A;  4BHC A;  3OYG A;  1FTZ A;  2Y9Z A;  1P6R A;  2VJ4 A;  2A6T A;  4UB6 C;  3KP5 A;  3F0C A;  2IRF G;  1IUY A;  1DP3 A;  2DOD A;  5DDG A;  2V7F A;  2H6C A;  5DD4 A;  3CLQ A;  1DGR M;  1XDU A;  4X1E A;  3RPQ A;  2YS9 A;  3JRF A;  3BTJ A;  1R22 A;  1DQU A;  4IXA A;  4E7I A;  2K4B A;  2V9P A;  5D5V B;  2W1O A;  3TOB A;  1B8I B;  2K5C A;  2CWE A;  3WTU C;  1UHW A;  1PYV A;  5LGU A;  1TQM A;  2HI3 A;  1DPU A;  1TLH B;  5LEJ A;  3K10 A;  2RGV A;  3I53 A;  4HNT A;  5K5R A;  3A1Y A;  2W4S A;  1I1S A;  4BJT A;  4YFK F;  2O8X A;  3CC4 I;  1D8K A;  3RKX A;  2Q0O A;  2DA2 A;  4B09 A;  1HQC A;  1ZEL A;  4MHG A;  3S3N A;  3HTS B;  4P1W A;  3SFZ A;  1LQ1 A;  2LY2 A;  1Z77 A;  2E71 A;  2ECB A;  2XSD C;  3WG7 H;  4C2M J;  1OYI A;  1WH5 A;  1A6I A;  3P5J A;  2KIU A;  4XK4 A;  4E7H A;  2CU7 A;  2E1N A;  2W25 A;  1K83 J;  3MQ0 A;  1FOW A;  1Z21 A;  1D1C A;  2QLZ A;  2UXX A;  3OOP A;  3I3L A;  2X51 A;  1FTT A;  1JHF A;  3E97 A;  3IRQ A;  2ZJQ F;  4XLN F;  1K6Y A;  5ICE A;  1XG1 A;  5CJ9 A;  1UFM A;  2ZJ2 A;  2FML A;  1GV5 A;  3MZH A;  4CCJ A;  2BVM A;  4B3A A;  3DQV C;  2RKH A;  3KCC A;  5DM7 F;  4DZP A;  2P5L C;  1YJ9 I;  2QQA A;  2RVC A;  1LFU P;  4BEH A;  5HDN A;  2ZSH B;  3HRM A;  3S2W A;  2QEX I;  1FP2 A;  4EJO A;  3ZP5 A;  2XB0 X;  1MMS A;  1XMK A;  3KZZ A;  4PGG A;  1HKQ A;  5M5Y J;  2P7C B;  2KL4 A;  2PMZ N;  3TL4 X;  2M30 A;  2CV1 A;  1WJE A;  3H3V K;  4DBQ A;  1XDS A;  1X3U A;  5IYD J;  5D8L B;  2YX4 A;  2A61 A;  4M9X A;  1YO5 C;  2ISY A;  2MG4 A;  3IKT A;  3BOQ A;  2LP0 A;  2VT2 A;  4RAZ A;  4EJT A;  5FLX Z;  4LLN A;  3ZMT A;  1ON2 A;  2K85 A;  1YW7 A;  4LG0 A;  1ZGW A;  4UUV A;  1ZK8 A;  4ETS A;  3M7G A;  1A5J A;  3HGG A;  4I0B A;  2QEN A;  2QQ8 A;  3ELK A;  3IRR A;  5IYB J;  4ZYH A;  2KT0 A;  1U8B A;  4RLF A;  5LHG A;  3T0Y A;  1BJZ A;  2HOS A;  5GTI C;  1P7I A;  1R6R A;  2E35 A;  2MH9 A;  1R5G A;  3GFI A;  3GYH X;  2X0L A;  3TDU C;  4ZYD A;  1YYV A;  2E1M C;  4IQJ A;  4NHJ A;  1T6S A;  2V1U A;  3AG2 H;  1NG7 A;  2LLK A;  5A2Q Z;  1CQT A;  1BR1 A;  2K40 A;  2ZXH A;  1M1E B;  2LFB A;  2OZU A;  1UG2 A;  3JR9 A;  2L9S A;  1IJW C;  1N77 A;  2V1N A;  3JW4 A;  1JTX A;  3VFZ A;  2XAQ A;  3FM3 A;  4F92 B;  5IT9 Z;  2BBY A;  2LNB A;  2W7N A;  4ANJ A;  2HTS A;  3OSF A;  2KMU A;  1UST A;  2LOO A;  3ZMU A;  3KET A;  2M2E A;  5HS7 A;  1X1C A;  1FT9 A;  2DO7 A;  3S93 A;  1ZAR A;  1R00 A;  3E0J B;  1ETK A;  4U0V A;  2LF8 A;  4QLC U;  3PIO F;  4V2F A;  1IN4 A;  2CG4 A;  4JK1 X;  1BI3 A;  4BL0 B;  4CSW A;  1G3W A;  1FIA A;  2XAS A;  5K7H A;  5E20 A;  1OMI A;  3ML6 A;  3M8J A;  5CVU A;  2O8K A;  3I58 A;  3C2H A;  1RC9 A;  4GRI A;  3Q3S A;  2V6C A;  4KN4 X;  1WH7 A;  2LC2 A;  4D7N A;  1ZYR F;  1YX5 A;  3OYE A;  3OWT A;  4UHT A;  3QAH A;  2IS6 A;  4PFO A;  1ZG3 A;  3G2B A;  2D45 A;  4PDK A;  1VQ5 I;  3BTI A;  3HUG B;  5ICF A;  3A0B C;  1MD0 A;  2CQK A;  2OF7 A;  4UNO A;  4KT6 A;  5KCM A;  3NAR A;  2XAH A;  1VQ7 I;  5E1W A;  4UUS A;  3F8B A;  2NVX J;  5E79 C;  3BPX A;  4NBQ A;  4YIR X;  2JPB A;  2OBP A;  1NTC A;  3HBL A;  4P9U A;  1GT0 C;  1MKM A;  5D5W B;  3I54 A;  2M9H A;  1JUP A;  2MA3 A;  2ZKZ A;  3VYU B;  3S14 J;  1P2F A;  3GTL J;  1HST A;  3IWZ A;  4Y13 A;  3F23 A;  3JRD A;  4M74 A;  2XGX A;  4UY8 I;  1UEL B;  1ERD A;  1CF7 A;  1ZG1 A;  1POG A;  4WF2 A;  5EYR A;  4OIR F;  5GPC A;  3RDI A;  3K2Z A;  1KQ8 A;  3IHU A;  5DEQ A;  3GTJ J;  1VQ6 I;  3V7C A;  1OR7 C;  1J0R A;  3HOZ J;  1XCV A;  1TWH J;  4CCO A;  3H35 A;  3KEO A;  3EUA A;  2JA6 J;  5EZH A;  1WJC A;  3ZRG A;  4PJ0 C;  5HLG A;  1FX7 A;  4IO9 F;  2M34 A;  2CW8 A;  2XV4 S;  2R5Y A;  2A05 A;  3W6J B;  2VC0 A;  1R49 A;  2IT0 A;  1RET A;  4PJL A;  1KU2 A;  1MBJ A;  1ZQ3 P;  3S16 J;  1BI0 A;  2IJL A;  2Y0S N;  2XGC A;  4HOB A;  3M07 A;  2EIM H;  4ZYG A;  2P0W A;  2R4G A;  4ZZD A;  4L9J A;  1JKO C;  1SD7 A;  2V9V A;  3K70 D;  3ZPL A;  1TBX A;  2VQG A;  2VE8 A;  4XON A;  5ILS A;  3KYL A;  1G6N A;  4LIV A;  2Z16 A;  4OOI A;  4LIT A;  4ABZ A;  3FXK A;  1Y8Q B;  2X1E A;  3EYI A;  5GAE J;  4O3M A;  1D1A A;  4IZZ A;  1Z91 A;  4HRI A;  1XSV A;  4NQW A;  5FRO A;  2DMT A;  1O3S A;  1MSE C;  2H6B A;  1XC5 A;  3AFH A;  2R7S A;  4CZC A;  2BY1 A;  4BJ5 C;  1E3H A;  3AKZ A;  1IXC A;  1O3R A;  3V7R A;  4KFC A;  4X0G A;  1BIA A;  1HKS A;  2KJC A;  3OYD A;  3LSP A;  1JI8 A;  5FKN A;  1X3W B;  1YG2 A;  2L4M A;  2XAU A;  4N0B A;  3ZN1 A;  3TBI A;  1FBQ A;  1W0T A;  5ICG A;  1TP4 A;  2I8D A;  2L01 A;  1WHU A;  3OMY A;  5EEG A;  1MBE A;  3S2H J;  3BR3 A;  1O3T A;  4BBR J;  3HTU A;  1J2X A;  1OFC X;  3LSI A;  3GTG J;  2O7O A;  5H20 A;  1VTN C;  3D0S A;  1S7O A;  3VEP A;  1R4N B;  4OIQ F;  1RPW A;  1UCR A;  3F8C A;  1VI0 A;  3KP4 A;  2E5N A;  2X1D A;  5HDG A;  4IRH A;  1JJ8 C;  4CCM A;  2K4J A;  2O0Y A;  3PUB A;  4L0Z B;  2KIF A;  3F8N A;  4P5O A;  1EH8 A;  2WAD A;  2Z3Y A;  3ROU A;  1XGS A;  5D4S A;  4AIK A;  2XRN A;  4XRS A;  4YFN F;  3BR6 A;  3OY9 A;  2HVS A;  3NAU A;  4I01 A;  1XS9 A;  2PG4 A;  1TWC J;  4YFX F;  3OYI A;  5FLM J;  2VQH A;  3HPG A;  3K1P A;  3R60 A;  3E6B A;  1T0F C;  2YUS A;  1U5T A;  3BY6 A;  1G2H A;  3DF8 A;  4WX9 A;  2ZXW H;  4JP0 A;  2W00 A;  1V5G A;  3EUH C;  4F52 A;  1ULY A;  1OCR H;  3K2A A;  4UUS B;  2DA3 A;  3MAJ A;  5B3S H;  1P4X A;  3FDY A;  3ZMD A;  1F5T A;  2L4A A;  2EWN A;  3RYR A;  1IUF A;  2XPV A;  3PFI A;  1TZL A;  3T8T A;  2NYX A;  1MMA A;  1I5Z A;  3SZT A;  2QWW A;  3RQI A;  2AXL A;  1WRJ A;  4ZTJ A;  2FBK A;  1R4M B;  3ONQ A;  2M5W A;  5H2F C;  2H27 A;  5FFZ A;  4QWQ A;  1CF7 B;  4EAT A;  2P8T A;  5DCM B;  1MGT A;  3X2Q H;  2CO5 A;  1MJB A;  4RGR A;  4XRM A;  3DTE A;  1QVT A;  1SMT A;  2X6W A;  4K2E A;  1LUJ B;  4A3E J;  1KYZ A;  3JTH A;  3ZR8 X;  1J75 A;  1VQ4 I;  3CTA A;  3TO9 A;  4LG3 A;  5L3G A;  4BHP A;  5IYC J;  2RAE A;  1QZZ A;  3ABU A;  4A3C J;  3JRI A;  2OQG A;  1S6L A;  4M6X A;  1EH6 A;  3DEW A;  1R5I D;  1W0U A;  5K5O A;  1N75 A;  2BHY A;  3BLY A;  5CLS A;  1RKW A;  3CJN A;  2XUB A;  5KHD A;  3PM1 A;  3OSG A;  3I9V 2;  3M1C A;  3F8F A;  1B59 A;  2CYY A;  1W7P A;  2DMP A;  4LLG F;  2FU4 A;  2H94 A;  2QUF A;  2FA5 A;  1ZR2 A;  3KEY A;  1V4R A;  2HKX A;  5E3L A;  1ETX A;  2OPT A;  4L9V A;  3WG9 A;  2JTV A;  1YIT I;  3SHF A;  1NK3 P;  4QTR A;  2VBY A;  3DEE A;  3RKY A;  5D4R A;  2MC4 A;  2Z33 A;  4AM3 A;  1BOB A;  3L9F A;  4M73 A;  4AVZ A;  3S2D J;  4NQW B;  2MLG A;  2ZBK A;  1MJA A;  1OCZ H;  1D0Z A;  3LQR A;  4HBL A;  4HX8 A;  3DCF A;  2O61 A;  1W7P D;  2FBH A;  1C0W A;  2LD5 A;  2HDC A;  2H8W A;  1GLN A;  2FUG 2;  2VIX A;  3JSO A;  2NS7 A;  3VDX A;  2OD5 A;  4G8X A;  4A0Z A;  3WGH A;  2CFO A;  2A6H F;  3ZMV A;  2Y69 H;  2YR2 A;  4MFE A;  5H6Q A;  1FC3 A;  1ZAO A;  3ZQG A;  3HG9 A;  4UVC A;  3CC2 I;  4I6Z A;  1E17 A;  2EA2 A;  2QQ9 A;  1FYM A;  2F5V A;  3J80 K;  1ENH A;  1G8X A;  5DM6 F;  2CQQ A;  3OYF A;  5ICC A;  3GZ5 A;  4CIC A;  4A3F J;  2BXY A;  2ZME A;  3OIQ A;  3SZG A;  2JVH A;  3Q0U A;  4FE7 A;  1OYY A;  5F1R A;  1RES A;  3V7S A;  2NS8 A;  3RKW A;  3L1P A;  1R1U A;  3CMY A;  3B6C A;  1UZC A;  2DMU A;  4Q47 A;  1ZRD A;  4CGZ A;  1O7F A;  5B5E C;  2OCC H;  3DBH B;  2DT7 B;  2E36 A;  2JSP A;  2EV6 A;  3HJE A;  3C3W A;  4FQG A;  4I76 A;  1I6H J;  1FBU A;  2G9W A;  2WBM A;  3GEZ A;  3P9C A;  2L7F P;  2VBW A;  4BQO A;  2FE3 A;  5HLH A;  2FOW A;  3ZOB A;  5IT3 A;  2WAE A;  3OL3 A;  1Z05 A;  3ZQI A;  2YX7 A;  4HW0 A;  1KQ0 A;  1H8A C;  2EFW A;  4P55 A;  3TP3 A;  2D5V A;  1SAN A;  3GCM A;  1D5Y A;  3I4M J;  4BDZ A;  4IHX A;  5EGO B;  3WU2 C;  1XX5 A;  3MZY A;  4HSR A;  2LK2 A;  3FXJ A;  1L3L A;  3F72 A;  2ME6 A;  4EJV A;  1TWG J;  2EH3 A;  4HA8 A;  4XMY A;  2LKP A;  2BE5 F;  2VUM J;  3JRA A;  3JAM K;  3DEU A;  3TMO A;  3G73 A;  2WAQ N;  4XBF A;  3WOD F;  4AD9 A;  3IP4 B;  3CJT B;  3IH2 A;  4AVP A;  2HS5 A;  3LSH A;  2X4H A;  3K4B A;  3CP8 A;  3GBG A;  4D0P A;  4G7H F;  3E6C C;  4M71 A;  3FK7 A;  3O3K A;  1TQP A;  1X19 A;  3H0G J;  2NRA C;  1YLF A;  2XAF A;  1PP7 U;  4BE0 A;  1AA7 A;  4XSX F;  3F9K A;  2LMD A;  2GM4 A;  4JQF A;  3FXQ A;  5KNL A;  4J19 A;  2MAB A;  3VOE A;  3BT9 A;  1HBX G;  5E3M A;  2K9M A;  2QBY B;  2ZCW A;  3HOS A;  4L9N A;  4NUB A;  1T56 A;  1U2W A;  3ULQ B;  3ERE D;  4XRS G;  4DYR A;  3MFK A;  3CME I;  4N9I A;  2OTJ I;  2M45 A;  4D7M A;  2HFH A;  4FE4 A;  2K86 A;  2PQ8 A;  4DOZ A;  1T98 A;  4U7B A;  4H0E A;  1VZ0 A;  2Z99 A;  3FIS A;  4QPQ A;  2JA7 J;  4E7J A;  4W97 A;  4A69 C;  1MW7 A;  1S3J A;  2CMP A;  2V9K A;  4U0W A;  1IXS B;  3W2A A;  1FEX A;  2W57 A;  1BN5 A;  2E7X A;  3U1K A;  2KHM A;  3CJR B;  2X1C A;  4J01 A;  2JMW A;  2N8G A;  1BA5 A;  4PSX A;  3A0H C;  1SD5 A;  2A5W A;  2TDX A;  2DA7 A;  3GFM A;  4XN0 A;  3ZMZ A;  3GXO A;  3LMM A;  4DYC A;  1KGS A;  1FJL A;  4GYI A;  3L09 A;  3BR5 A;  3F8M A;  2IXS A;  2ECC A;  3J81 K;  5FD5 A;  3DKW A;  5CVI A;  4MTE A;  2M87 A;  2AQE A;  2L0K A;  2VBZ A;  2XGD A;  3PL8 A;  3CDH A;  1VF9 A;  2LY1 A;  1OQY A;  1W36 C;  5F0H A;  4RGU A;  2NVQ J;  3SEZ A;  1UHS A;  2LDU A;  2ID6 A;  3B73 A;  3ZCO A;  3HOX J;  4GYG A;  3CCU I;  5LRR A;  2IGN A;  1OPC A;  5M3M J;  2GXA A;  3PJR A;  2D1V A;  5JVT A;  4GGG A;  1RNL A;  2E5Z A;  4GO1 A;  3ABT A;  1FIP A;  4GCV A;  5M5W J;  1F4K A;  3LSK A;  5JI6 A;  1X2N A;  1YRN B;  3F3X A;  1A6Q A;  2MD0 A;  3GLX A;  1ZRF A;  4M9Z A;  1LDJ A;  3E6M A;  4XQF A;  4HLX A;  1K7A A;  2LKX A;  2EIN H;  1WFX A;  2HQR A;  3U9G A;  4HNV A;  2DOE A;  3TW6 A;  2R7R A;  5D6F A;  3DBR B;  3RPU A;  1BC7 C;  4MLO A;  2RV8 A;  2YSR A;  2WB1 A;  3GVA A;  1Z3X A;  4CHU A;  5JFR A;  4EGZ A;  3WE3 A;  4N9H A;  2XHK A;  2IGK A;  4R8H A;  4B3X A;  2KRC A;  2EPF A;  3HL2 A;  1UAA A;  5D6E A;  4Y7N J;  4OIP F;  5FB2 A;  2AQF A;  4L5E A;  4IHT A;  3ABL H;  2VJI A;  4C3J J;  2K9Q A;  3GZ6 A;  4S05 A;  3RPU D;  1QNT A;  1TNS A;  2P7V B;  5J47 A;  3GF2 A;  1JKP C;  1JKR C;  4LK1 F;  3GX4 X;  3GW2 A;  2VKH A;  3OR2 C;  5JVG F;  2GZW A;  1OCC H;  2QKL B;  1W5T A;  3FHZ A;  2VKE A;  3M1E A;  5IP9 J;  5LEK A;  2DT5 A;  2FQ3 A;  3KX2 A;  3CD6 I;  1Z7U A;  2LTP A;  4FIS A;  4Z2Y A;  4PGH A;  3VYT B;  2FX0 A;  3PNY A;  3TKY A;  3ZMS A;  3L00 A;  2BY0 A;  4DW6 A;  1SFE A;  3Q5F A;  5CVV A;  1GHC A;  4HV5 A;  5GPA A;  5E3N A;  1V5E A;  3QOD A;  3CCE I;  3TQN A;  2DPD A;  4Y52 J;  3ZQ7 A;  1QGP A;  1BI1 A;  1FSH A;  3VPR A;  3VWB A;  1IO2 A;  4E7Z A;  5D5X B;  2HU9 A;  2WAF A;  1YS7 A;  3FIW A;  3P9K A;  1BW5 A;  2DA1 A;  3CDL A;  3TO7 A;  4XN3 A;  2MH2 A;  4KDP A;  3KLO A;  4BH9 A;  3MN2 A;  1H0M A;  1FOK A;  2LVS A;  5DUI A;  2A69 F;  4BNC A;  1FP1 D;  2E1O A;  2XRO A;  1ETQ A;  2P5K A;  3O2P E;  2WA0 A;  2MC3 A;  1P7J A;  1BM9 A;  2XC7 A;  3QQA A;  1EKE A;  2GIZ A;  2QZ8 A;  4CYC A;  4C30 A;  3WTV C;  5BOX A;  5HNF A;  1QHG A;  2DPU A;  2OZ6 A;  1XCB A;  3HHH A;  2IW5 A;  3VYR B;  5HS9 A;  1GVD A;  4HF0 A;  5KAI C;  1JUS A;  2CQX A;  2EZH A;  2KIM A;  2X85 A;  1VQK I;  1BR4 A;  4HZF A;  4BXF A;  2XPW A;  1X1A A;  2D2W A;  3QPH A;  3BZ6 A;  2VBX A;  2DK5 A;  2M4G A;  3CLO A;  1I6X A;  2HQN A;  1I50 J;  1SD6 A;  3WE2 A;  1DGW Y;  1ZGA A;  2UV1 A;  4YII A;  1NHA A;  3MD2 A;  2JPC A;  5DTD A;  5J1Y A;  1WQ2 A;  2FNP A;  3TW7 A;  2CRG A;  3ZQC A;  4RLQ A;  1VND A;  1U9N A;  5HLT A;  1KU9 A;  4LFU A;  2DXI A;  3PSF A;  1ODD A;  2W85 A;  2V6E A;  5HVQ C;  2EIK H;  5F04 A;  4AC0 A;  4BHB A;  3DTI A;  3SQN A;  3A01 B;  1QHH D;  3EDP A;  2G7U A;  4CO8 A;  3JRH A;  3J7Z I;  3SJM A;  2HOT A;  1BW6 A;  1KZH A;  2Y9Y A;  3G1L A;  4KMU X;  1QRY A;  4LOC A;  1MH3 A;  2IEK A;  2DFF A;  4G6Q A;  3K4C A;  5JLX A;  2G7H A;  1T2K A;  4ESJ A;  1UB9 A;  2PN6 A;  1XGN A;  4UVB A;  2TCT A;  5J40 A;  1REP C;  1OYW A;  2JRM A;  5F0C A;  4KJZ A;  4EJU A;  2XRL A;  4MQ9 F;  5LGT A;  5HNH A;  4EMS A;  2XB5 A;  2ESH A;  4P9F A;  4IQ4 A;  4AIH A;  1T95 A;  3D5R C;  3CMA I;  1FPQ A;  2WV0 A;  1GUU A;  5B66 C;  3TOA A;  2M1B A;  4RM2 A;  3WTW C;  5LBQ A;  3EPZ A;  3OIO A;  4M3D A;  2ELH A;  2PX9 A;  1K4T A;  4OU0 A;  1S7A A;  4FCY A;  3C7J A;  3OYH A;  2YPR A;  1B6A A;  3O6B B;  1QPI A;  1NG6 A;  2V26 A;  3DPT A;  1MMN A;  4HNU A;  4KYW A;  3G71 I;  1QA6 A;  4MIM A;  3KP3 A;  4MEY F;  5FKK A;  4BDY A;  1APL C;  2ISZ A;  2A5Y B;  4ENK A;  2UUZ A;  4XOT A;  4A3D J;  1SVO A;  1ZKG A;  2PMH A;  1R71 A;  3OS0 A;  3FMQ A;  2RN7 A;  2BXZ A;  1H9G A;  3S1Q J;  2GQQ A;  5C4X J;  4OWR B;  4JYK A;  4KMF A;  4WK8 F;  3FX3 A;  4DGW B;  3WTY C;  1SEU A;  2BHZ A;  1QQI A;  2VXZ A;  3HXL A;  1YOV B;  4YG2 F;  4BAY A;  1UJ8 A;  3OIP A;  4BE2 A;  2FNA A;  3HSF A;  4BY1 J;  1JKQ C;  3I4N J;  3ECH A;  3IL2 A;  3OV8 A;  2RNJ A;  1TT0 A;  4BEH B;  3W2W A;  4A3B J;  2KFD A;  1B9M A;  2Y0S A;  1XGM A;  2M4K A;  5F64 A;  5IP6 A;  4BYY A;  4EGY A;  3RIR A;  4IHW A;  4CCK A;  1PJR A;  1SVL A;  4KIG A;  3OYJ A;  3IC7 A;  1WGX A;  3FXM A;  4HEA 2;  4PK4 A;  4NDL A;  4CYC B;  2XF7 A;  3DKY A;  3LSG A;  3MWM A;  2ZFU A;  2X6X A;  4XKW A;  1I3A A;  1SFK A;  3I59 A;  4OIN F;  2DQL A;  3KPH A;  4WXD A;  3HOY J;  1V5F A;  1U8R A;  2W24 A;  2HWV A;  4FAS D;  1HW5 A;  1ORK A;  2OA4 A;  2GLO A;  2R7D A;  4KUM A;  4XL9 A;  1D3Y A;  5CVJ A;  1ONV A;  1SD4 A;  2H09 A;  4U0Y A;  4LG0 B;  1LVA A;  5ED4 A;  3K0L A;  4N4N B;  1FYK A;  4DIQ A;  2XIG A;  4D1Q A;  1E3O C;  3HYI A;  2P4W A;  2OC6 A;  4DNC A;  2NS0 A;  3FM5 A;  4JX6 A;  2EFN A;  3ZQL A;  2R7T A;  2ESN A;  1XD7 A;  3DKX A;  3LA2 A;  1YX3 A;  3OYK A;  2F6C A;  3L2V A;  3AG1 H;  1OLT A;  4OAY A;  1IN5 A;  4ESF A;  2CV0 A;  2VLA A;  3IKV A;  2JWT A;  4BXU A;  5E18 F;  2F4O B;  1RI7 A;  2KPM A;  3LST A;  5EZG A;  1F36 A;  1PP8 F;  3K4J A;  2R3S A;  5FFX A;  3I0T A;  4AID A;  2OQR A;  3ECO A;  3QPS A;  4LGW A;  3RZO J;  4HYE A;  1KON A;  3GTQ J;  4FX4 A;  3OYL A;  4KIT B;  1Y39 A;  3CP2 A;  2XAG A;  1A36 A;  1N25 A;  5C4J J;  2DFH A;  4ESB A;  1HF0 A;  3L2U A;  3FXU A;  3AG4 H;  5J4Y A;  3IUO A;  3NRV A;  4M3B A;  2HZD A;  5LGN A;  2XVC A;  1K78 A;  4QSH A;  5FKL A;  3Q9V A;  3Q0W A;  3SDG A;  3V8K A;  5FD6 A;  5IP7 J;  3DFG A;  2HNH A;  1FY7 A;  1LDD A;  1XTA A;  2ZNZ A;  4A5M A;  1K79 A;  2COM A;  4Q5S F;  5CQE A;  2I5U A;  2BV6 A;  5TIS C;  1ZRE A;  2R7U A;  5EEH A;  3MEX A;  2CW0 F;  5F6F A;  2F5F A;  2IS1 A;  3IAM 2;  1J59 A;  2L3D A;  2F4I A;  4ZYE A;  2P5V A;  4EQQ A;  2MW8 A;  4HQE A;  3RTR A;  2ZXJ A;  3RZD J;  2NNY A;  2KDO A;  3IH3 A;  3QRF F;  3G6E I;  3CO7 C;  4H4K C;  2JN6 A;  1MND A;  4RAF A;  4A3K J;  2OU2 A;  1N78 A;  3PUF A;  1MZB A;  2WV1 A;  2W82 A;  2M0M A;  3WTZ A;  3FXO A;  3H5R A;  3E3V A;  3L2R A;  3BZC A;  1QBJ A;  2BY3 A;  2STT A;  2CQN A;  2DOA A;  3KLN A;  5E3O A;  2GOM A;  1YQA A;  4EM0 B;  2IBD A;  3H9Q A;  2FQ4 A;  3MCZ A;  4BU2 A;  4CUG A;  1B72 A;  1OCO H;  4IKF A;  3AL0 C;  3WGG A;  3N4M A;  1B4A A;  2JA2 A;  4E7L A;  4A6E A;  2DCE A;  4I7H A;  2R7O A;  3AL0 B;  2IA2 A;  4OMZ A;  2EV0 A;  1EF4 A;  1MH4 A;  2FXA A;  2X48 A;  4ZJZ A;  2LRD A;  3DPU A;  3QU3 A;  1D8J A;  2GXB A;  4JX4 A;  5EJC A;  2MYS A;  2ZO4 A;  4ZC3 A;  1D0X A;  4XLP F;  4WCG A;  2KJB A;  4I09 A;  3NWS A;  3HOT A;  2IA1 A;  2QCO A;  4L18 B;  1O3Q A;  4HV6 A;  3DTK A;  4IRI A;  2HPI A;  2JUG A;  1RKT A;  1TWA J;  2DU9 A;  1ZH5 A;  2CUJ A;  2K27 A;  3A02 A;  3S15 J;  1IZ1 A;  3H5N A;  4BE1 A;  4CCN A;  4ENM A;  2FF4 A;  2BW3 A;  2R5Y B;  3E5Q A;  1MBK A;  1LVK A;  3DP7 A;  1MJ9 A;  2E2J J;  2LY9 A;  4B48 A;  4D5C A;  1ZN2 A;  1HA8 A;  4NNJ A;  1WKM A;  1XMX A;  1SAX A;  2LBF A;  4Q4Z F;  1JXS A;  2WC2 A;  3ASO H;  5DD8 A;  3Q0V A;  3V8J A;  5M5X J;  1FLI A;  1YI2 I;  3K69 A;  1QZE A;  2NVY J;  3RI4 A;  3CCJ I;  4KIC A;  5LHI A;  3BG3 A;  2K3P A;  3PSI A;  2GAU A;  4RB1 A;  3CCY A;  3LSR A;  2F5D A;  3PIP F;  2OUM A;  2DK8 A;  2BYV E;  2E19 A;  5CYV A;  2NXN B;  2ZJR F;  2O9L A;  1BL0 A;  3SDB A;  3OYM A;  5IY5 H;  3BP8 A;  3VYS B;  4AYB N;  1JGG A;  4OAZ A;  2XPU A;  3DPL C;  3TO6 A;  2EV5 A;  1Q1H A;  2XF6 A;  4XRF A;  4Y4R A;  2DBB A;  3PNV A;  4M9S A;  2H1L A;  2VT3 A;  4B47 A;  2VI6 A;  2Y31 A;  3HKZ A;  4HG2 A;  2M7B A;  5DV5 A;  3GFJ A;  3ZQQ A;  1K78 B;  2DDB A;  3UKG A;  1QU3 A;  3W3C A;  5LD2 C;  1IW7 F;  3K4M A;  4A3L J;  3HC7 A;  4RB3 C;  2B0L A;  1DP7 P;  1ZLJ A;  4BUP A;  2FJ1 A;  2VON A;  3T5X A;  4WXC A;  3E7L A;  4G6T B;  2GA1 A;  4A5N A;  1S9H A;  1LFB A;  3CUQ A;  4BS9 A;  1XGO A;  1OIS A;  2R7V A;  5FRM A;  2IS2 A;  2R7Z J;  3BZK A;  5JHU A;  3S3O A;  2DAO A;  3S32 A;  4BQN A;  1U5T C;  2R7Q A;  2Q8K A;  1F43 A;  1ETW A;  1HW1 A;  2FBI A;  2HYG D;  5J8F A;  1UHM A;  3C18 A;  1MIJ A;  1U5T B;  2DTZ A;  2PFB A;  3I64 A;  1KA8 A;  2BY2 A;  4RMN A;  4X6A J;  4U7D A;  2DA5 A;  4I2O A;  4B44 A;  5IOZ A;  2O5R A;  2HOA A;  2JRT A;  4F55 A;  3LFU A;  2DN0 A;  1R1T A;  2DFI A;  3BWG A;  4A0Y A;  2P6T A;  4HF2 A;  1P9Q C;  1SVM A;  1V54 H;  2R0Q C;  4XOR A;  5LHH A;  1IC8 A;  3HRT A;  4IVN A;  4S04 A;  1HOM A;  3H3Z A;  2C6Y A;  1W36 D;  1HW2 A;  4CZZ A;  2IGO A;  2GIV A;  3KZI C;  4XLA A;  2GWR A;  1JHH A;  1U9O A;  2L02 A;  2K9L A;  1R5H A;  3JSP A;  1FMW A;  4DZJ A;  1TWF J;  5HOD A;  4CCL A;  2JJ7 A;  2JT1 A;  4HX4 A;  5EG0 A;  4OIO F;  3N05 A;  3JTG A;  4P96 A;  3LA3 A;  3GUD A;  1TTY A;  1B8I A;  2NOJ B;  1TQI A;  5K7F A;  1QPM A;  2L9R A;  3U2R A;  1S7E A;  2CSO A;  3HPH A;  3GZN B;  5BPD A;  2HXI A;  4MGR A;  3CCL I;  1K4S A;  1JUM A;  2HXO A;  5J3L A;  1IRF A;  3CCV I;  1G3T A;  3D1N I;  2DJN A;  2RQQ A;  1HLV A;  3OYC A;  3ZN0 A;  6PAX A;  2VC1 A;  2LBF B;  4C3H J;  3O8H A;  4M3E A;  1W7P B;  3G1O A;  3QP6 A;  3BG6 A;  5ILU A;  1X1P A;  3GFL A;  2VE9 A;  1X58 A;  4B1R A;  3LFK A;  3OOU A;  3L7W A;  4E70 A;  5GAD J;  1DU0 A;  4R1H A;  4EV0 A;  3OYA A;  4A3M J;  2Y30 A;  2Z2S B;  3PO3 J;  3N97 A;  2QSF X;  1UMQ A;  3FXR A;  1YIJ I;  5FRN A;  1VQN I;  3F21 A;  1Y0N A;  2UXN A;  3QPT A;  4IPA A;  2IGM A;  5AON A;  4HAM A;  1EJ9 A;  2AO9 A;  3DLA A;  4L9T A;  2V1X A;  1KU7 A;  4HLY A;  2JZY A;  2HQ5 A;  4RGS A;  2KDZ A;  1MBH A;  3R4K A;  1X1D A;  1JTY A;  5BNG A;  1G59 A;  2W48 A;  3NQO A;  4II3 A;  5L3E A;  3GTK J;  3TGN A;  5CKT A;  4LJZ F;  2LR8 A;  2DT6 A;  4G7O F;  2E1C A;  1WI9 A;  4RB2 C;  4RBO A;  3K4K A;  1ZTR A;  1MSF C;  3M3Y J;  1OKR A;  2GA2 A;  4IHV A;  1ETO A;  4AWX B;  2ZME C;  5FLX K;  2ELJ A;  1QO0 D;  2K7L A;  3J80 Z;  3A2K A;  4B43 A;  3CUQ B;  2COB A;  1QZY A;  4G9Y A;  2ZME B;  2E60 A;  2F48 A;  4JOM A;  2DMN A;  2RQP A;  3CES A;  5E1Z B;  5J1U A;  1FSE A;  3BCA A;  3K9T A;  4XR6 A;  2DA6 A;  4TV7 A;  3CF2 A;  1FWZ A;  2HDD A;  3KP2 A;  2JUC A;  2FRH A;  2DI3 A;  4AU7 A;  2VJ5 A;  1WPK A;  2ZFW A;  3FMR A;  2RDP A;  5A2Q K;  4ITV A;  5F0F A;  3PQK A;  5CQG A;  3CCS I;  1T08 B;  1OCP A;  1XN7 A;  1SFO J;  3LQQ A;  4Z6Y A;  2DQR A;  2WY8 Q;  4J00 A;  1ZR4 A;  1H88 C;  1W4M A;  4G94 A;  4KN7 X;  1FOX A;  1QVU A;  4O6J A;  3WGI A;  2G0E A;  2K9N A;  3W6K B;  3W6V A;  1RR7 A;  1S8N A;  4D5F A;  2L9V A;  2LRE A;  1AOY A;  2L54 A;  3CJQ B;  3BR0 A;  5IT9 K;  4DQ2 A;  1I27 A;  1E0E A;  3LWF A;  5BS6 A;  4BBS J;  3SEQ A;  4I98 B;  2QSG X;  1O4X A;  2L5Q A;  2KRF A;  1BI2 A;  3S1N J;  3KFW X;  3QWL A;  1MDM A;  1V3F A;  5AIP A;  3DXJ F;  4RB0 A;  3FZV A;  1K6O A;  3V8L A;  2P81 A;  1T38 A;  3BC8 A;  3DV8 A;  3FKJ A;  4XKC A;  2KRH A;  3JAM Z;  1KU3 A;  1H9T A;  5CPR B;  1R36 A;  3LSJ A;  5EG0 B;  3B02 A;  4Y33 A;  4LLL A;  1ZHF A;  1NH3 A;  3CF5 F;  2PJP A;  1Z1D A;  4I0A A;  2RC4 A;  4UXN A;  1SFU A;  4ZDO A;  2MFZ A;  2VKD A;  2AHQ A;  3JRE A;  2XDV A;  4DJA A;  2R7W A;  1W1W E;  4RM3 A;  2KKO A;  3CMM A;  1WJF A;  2PMZ A;  4M3F A;  2VXD A;  1FOY A;  2ETH A;  2WB1 N;  4IJA A;  4CXF A;  1XPX A;  2LH9 A;  5LLQ A;  1Y1V J;  4NB5 A;  2JVG A;  2PLY A;  4E7K A;  1YFH A;  3AAF A;  2ME0 A;  4ZH4 F;  3RCO A;  1P4A A;  3HRS A;  3S3M A;  4UV9 A;  1T33 A;  5E17 F;  3HUG A;  2CS3 A;  5C44 J;  3K4L A;  2NVU B;  3HOU J;  3FK6 A;  3ERM A;  1E2X A;  2F4M B;  2NAZ A;  4O5V A;  3BJO A;  3QPL A;  4F3Q A;  3DLL F;  4E6K G;  1J9I A;  2V4J C;  4JX5 A;  2R7X A;  3GTP J;  1YE9 A;  5AIQ A;  3HSE A;  4KIB A;  5HS8 A;  3DBL B;  1LNW A;  5EEA A;  3RKQ A;  1F1Z A;  1S29 A;  2QVO A;  2RNG A;  4V19 K;  4IF4 A;  3P9I A;  4HST A;  3BG9 A;  1FNN A;  1IN8 A;  1MBG A;  3E1S A;  1AU7 A;  2V79 A;  4F7Z A;  2QA4 I;  1AHD P;  1ZG5 A;  2Z9O A;  5CVR A;  1G3S A;  2CUF A;  2X9D A;  3DU6 A;  1DU6 A;  2BGC A;  4XKB A;  4IHY A;  4A12 A;  3J81 Z;  3HOV J;  1W5S A;  3NEU A;  1ACI A;  2HTJ A;  4A0X A;  2VPL A;  1SAU A;  3LAP A;  3DU5 A;  3O8G A;  4IX7 A;  2EZK A;  3WU0 A;  1OR7 A;  3OYN A;  4KNY A;  1WI3 A;  4XLC A;  1TW3 A;  2ADU A;  5FO5 A;  3HGY A;  3D5L A;  2BOL A;  4C9Y A;  3I56 I;  1J7K A;  2HYF A;  1DPR A;  3J7A O;  3KEQ A;  2CJJ A;  2LKS A;  3VOD A;  4GFB A;  4EVI A;  3GLL A;  4Q48 A;  2Z1D A;  2L7K A;  3BQY A;  4C2U A;  2VPR A;  3HOW J;  2BEO A;  3QOP A;  4UB8 C;  1SFX A;  3HM5 A;  1EA3 A;  3SZP A;  2R5Z A;  5F08 A;  1RUN A;  4RDU A;  5IOY A;  3CZ6 A;  3BR1 A;  1LPQ A;  1LEB A;  1OJL A;  5TRD A;  2XGE A;  1S72 I;  4KA4 A;  2R93 J;  1HC8 A;  5DS9 A;  3BRO A;  3QYB A;  1KQ9 A;  5LFA A;  1DUX C;  4FHT A;  3F22 A;  5HLI A;  2H1K A;  2E1M B;  4ZDP A;  2IP2 A;  3KYC B;  4BGD A;  4V2G A;  1JT0 A;  1D0Y A;  1PVE A;  5K7Z A;  4FT8 A;  1I3Q J;  2DYR H;  3JRC A;  1ETY A;  3RYP A;  2D1H A;  1GVJ A;  2OV7 A;  1HDP A;  5K1Y A;  4IOA F;  2ACJ A;  3ZQH A;  2M7A A;  2EA4 A;  5FKM A;  5EF6 A;  1MDM B;  1GXQ A;  4ZZL A;  2JA8 J;  1YS6 A;  2NNN A;  4RS8 A;  3J7Y J;  1GXP A;  1ZRC A;  3T8R A;  4XLH A;  3KP6 A;  1YJN I;  1GV2 A;  1O57 A;  4QPO A;  3BTC A;  2JQ7 A;  4ZDL A;  4HDV A;  3WU1 B;  1XB4 A;  4EEF G;  1VQ9 I;  1BR2 A;  2YU9 J;  3A03 A;  2EZI A;  2B63 J;  3GTM J;  4LB6 B;  4LD5 A;  4PSW A;  3TP0 A;  3REO A;  3KE2 A;  2KZG A;  2PBI A;  2ZB9 A;  2EBI A;  2HEO A;  2VOO A;  1T39 A;  4MEX F;  2XF5 A;  2EIL H;  1IRZ A;  3U1D A;  3BDD A;  3VSK A;  3I5U A;  1RRJ A;  1DDN A;  2QGU A;  3EQL F;  1YTY A;  1LFP A;  3FMS A;  4WXH A;  3V42 A;  2VB6 A;  2LF7 A;  2VKV A;  1UG0 A;  4KT5 C;  3H9J A;  3WTX C;  3HRU A;  4M3G A;  1T0F A;  3LNQ A;  1AWC A;  4I99 C;  1IN6 A;  3S8P A;  1KYW A;  1A04 A;  3C1D A;  4ENN A;  1MBF A;  5GP9 A;  3VSL A;  1PUE E;  3QP5 A;  3EUH A;  2FD5 A;  3FF5 A;  1SC7 A;  2M8G X;  1WJB A;  4U88 A;  1XSD A;  3I4P A;  2RRE A;  5FKO A;  3FXL A;  1V55 H;  3SXY A;  3RSN A;  4G7Z F;  2EJR A;  1Y56 A;  4EJW A;  3HDD A;  1JT6 A;  3GTO J;  2EQR A;  3FWE A;  2DW4 A;  3SFI A;  4RAG A;  4PJM A;  1YW9 A;  1BJA A;  3GO5 A;  2OCE A;  4IL6 C;  2CGP A;  3K1N A;  2CV2 A;  5DCM A;  2HYJ A;  1IXR C;  2DYS H;  3OYB A;  2CUE A;  2Q2E A;  3ZQF A;  2QQB A;  2EFQ A;  4ZTF A;  2I10 A;  4NC8 A;  1HDD C;  4BY7 J;  4WWC A;  4A3J J;  3MKL A;  3M4O J;  3E6D A;  3ESW B;  1K61 A;  5KVR A;  3BQZ A;  1VFC A;  4LIU A;  4DBR A;  4B4C A;  3BPV A;  1ETV A;  3CDI A;  3HHG A;  2QF7 A;  2IAI A;  4HPQ A;  1MNE A;  1USS A;  5HDK A;  3IAS 2;  4FET A;  4L5J A;  1IDY A;  4AUX A;  2QM3 A;  3MZ8 A;  2R5Z B;  2VAS A;  3EUK L;  3FBI B;  2HPM A;  3HB9 A;  1BOA A;  1YJW I;  3CCQ I;  1D5V A;  3BG7 A;  1PDN C;  2ELK A;  2O03 A;  2K02 A;  4R79 A;  3K7A J;  4XOP A;  3P7N A;  4CH7 A;  2MLK A;  3HZJ A;  4BQA A;  1RZ4 A;  2DJI A;  3R61 A;  5D8K B;  3S1M J;  1I39 A;  1U0J A;  4XM3 A;  3KZY A;  1FBS A;  1LE8 A;  2QKM B;  4PZJ A;  3MKW B;  5E1X A;  5LRS A;  2MSY A;  3COA C;  1H89 C;  3JCU C;  3K6G A;  3M9A A;  2V1D A;  2MD5 A;  1PUF A;  1ITY A;  4GXO A;  2EZL A;  3UR3 C;  1Z67 A;  2GBY A;  1B1B A;  2GXG A;  1T8I A;  4EM1 A;  2PJR A;  5TGT A;  3IWF A;  3LL7 A;  4IEJ A;  3BTL A;  3LA7 A;  1W5C C;  2HKO A;  3K4N A;  2A68 F;  3B6A A;  4PJN A;  1STZ A;  3C2G A;  4M6V A;  1TL8 A;  2FSW A;  4CYD A;  3MKZ A;  4A3I J;  5EDN A;  3TDZ C;  4A93 J;  3HEF A;  4XNF A;  2B9S A;  2K9S A;  5C3E J;  2AS5 F;  2L7Z A;  2Y0M A;  3QOE A;  3VB2 A;  4ZYA A;  1MMD A;  4ENJ A;  5GAH J;  5H6R A;  1P4W A;  5BPI A;  3JRB A;  2Y2Z A;  2DMQ A;  2DTR A;  4Y17 A;  5J8C A;  1OCT C;  1GDT A;  4KIF A;  3BR2 A;  3RJP A;  1JJ6 C;  4HF1 A;  1Z3Y A;  4IHS A;  4HX7 A;  3ZXS A;  4GDF A;  5DYM A;  3CCM I;  3D5S C;  3HIF A;  2WY7 Q;  1JE8 A;  1XMA A;  2JSC A;  2E2H J;  1U6G A;  2KZV A;  4M72 A;  1X2M A;  1S5L C;  2ICW G;  4ON0 A;  3SYT A;  1Z7L A;  2PMU A;  1EV7 A;  1HSJ A;  3M8E A;  5ERI A;  1P92 A;  3K1M A;  2F5C A;  2FEZ A;  4XLF A;  1IG7 A;  3K70 C;  2DLL A;  9ANT A;  3S1R J;  3BCB A;  1Y8R B;  3F6O A;  1BIB A;  2IVM A;  3H36 A;  1U78 A;  2L2O A;  1IRG A;  3OL4 A;  4NC6 A;  1AKH A;  4EM2 A;  1Z0X A;  4Y3O A;  2J5P A;  3I55 I;  2M0C A;  3WHC A;  1VQO I;  4II2 A;  5EGO A;  5TJJ A;  2EK5 A;  4S0H B;  3I59 B;  4LB5 A;  3GME A;  2HVR A;  3IV5 A;  3KYD B;  2Y75 A;  2QSH X;  3A4C A;  4U87 A;  2TRT A;  4RAY A;  5E8I A;  1D1B A;  2Q2E B;  2A3S A;  2HGC A;  3CQZ J;  3V4G A;  3L2W A;  4AYB A;  2OTL I;  3I71 A;  2EIJ H;  3WTT C;  4NC7 A;  4LMY A;  3EYY A;  1TT5 B;  1X1B A;  4C2T A;  1HXD A;  1YHQ I;  4B8X A;  1MMG A;  2NOG A;  1Y1W J;  2IA0 A;  4G12 A;  4D9J A;  5L3F A;  3L2C A;  2ZXI A;  3PFY A;  1HCR A;  1JGS A;  5FJ8 J;  4YEJ A;  4CA0 A;  3Q9S A;  2QBY A;  2E2I J;  1VQM I;  1Z9C A;  4XSZ F;  1BBY A;  3R0A A;  4A2U A;  1FZP B;  2LYC A;  4HQM A;  2DFE A;  4MTD A;  4FTH A;  2HQA A;  2ZSI B;  4JBA A;  4UVA A;  5DCF A;  1TW2 A;  1SMY F;  3LAJ A;  2BZT A;  2KLO A;  2GOX B;  3F6V A;  4BKX A;  4C3I J;  2LG4 A;  1RR8 C;  4UUT A;  3JRG A;  1CGP A;  1LE8 B;  3WTS C;  1IGN A;  2OJE D;  4N4O B;  4XIC A;  2H8R A;  1F9N A;  4YRV A;  3MMY B;  1X4O A;  2W84 A;  1PUF B;  1WJD A;  4Y15 A;  4AIJ A;  5GTH C;  4E7S A;  3PNT A;  3G1M A;  1R58 A;  1RUO A;  2PJR B;  1Q1V A;  3GWZ A;  1IF1 A;  4G6D A;  2Q1Z B;  2O3F A;  4HDU A;  3WHB A;  4IRG A;  3T1B A;  2HZT A;  1NK2 P;  2X6O A;  3CCR I;  4I02 A;  2QYO A;  2VN2 A;  4FX0 A;  4M6Y A;  5M3F J;  3H1C A;  3L2Q A;  2E34 A;  3ASN H;  3AG3 H;  1ON1 A;  4BAC A;  1IV6 A;  1E3P A;  4PFP A;  1WJ5 A;  3H3U A;  5JR3 A;  3UNG C;  4OMY A;  3BG5 A;  3QYE A;  4BQQ A;  3G4S I;  5BMZ A;  5IPA A;  4YIF A;  2JA5 J;  3ABK H;  5FGM A;  1LKX A;  3CC7 I;  2WAQ A;  1L0O C;  5KAF C;  2B7E A;  1B72 B;  1YRN A;  3HKZ N;  2DOF A;  3HSR A;  4CDG A;  2WWY A;  3MKY B;  3OS1 A;  3MVP A;  3FKI J;  5L3D A;  2VQC A;  5J6X A;  4E4H A;  3ABM H;  4RGX A;  1B9N A;  3LSM A;  4MFD A;  5L3B A;  5K5Q A;  2STW A;  3J7A Y;  2E7W A;  1VQP I;  2CUZ A;  4A3G J;  3QYF A;  3M8F A;  1FYL A;  1AKH B;  1R1V A;  3E5X A;  1TC3 C;  2EFP A; 
#chains in the Genus database with same CATH homology
 1X3W B;  1QZE A;  1X3Z B;  4YIR X;  2F4O B;  2QSG X;  1OQY A;  1TP4 A;  3ESW B;  2QSH X;  2F4M B;  2QSF X;  1PVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...