1TP4A

Solution structure of the xpc binding domain of hhr23a protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
b'NPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UV excision repair protein RAD23 homolog A
publication title Structure of the XPC binding domain of hHR23A reveals hydrophobic patches for protein interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1tp4A00
1OQYA 2QSGX 2QSHX 2F4OB 2F4MB 3ESWB 1QZEA 4YIRX 2QSFX 1TP4A 1PVEA 1X3ZB 1X3WB
chains in the Genus database with same CATH superfamily
2ZFUA 2O0YA 5K7FA 2QGUA 2HVQA 2JUCA 3MZHA 1TW2A 1I6XA 3K2AA 3VSKA 3I9V2 3K1NA 4AU7A 5LFAA 3VWBA 3IH3A 3K1MA 2L9NA 3SXYA 2M4KA 3MKWB 5FLXK 4LD5A 4OMYA 2DU9A 3GTJJ 5J8FA 4N9HA 2ZJRF 4PJLA 4J01A 2FU4A 4ENNA 1ZG3A 3FMQA 1WH5A 1L3LA 1FX7A 2OTLI 2KT0A 1YIOA 2NVTJ 1UCRA 2ME6A 2VONA 2NNYA 3T5XA 4OAYA 1CF7A 1K79A 2F4MB 5AONA 5EJCA 1D1AA 2IA0A 1ZHFA 4KN4X 4ON0A 3CDHA 3KETA 3BOQA 2XB5A 1TQMA 4PFOA 1ZR4A 4CCJA 2HYGD 3WODF 1S6LA 3SZPA 3GTQJ 3F6VA 1MMGA 2ICWG 3KE2A 5DCFA 2LVSA 1QHHD 2AQEA 1FWZA 2GA2A 4LJZF 1J7KA 2NS7A 5BMZA 2DMTA 3TMOA 2STTA 5M5WJ 4Q48A 2QZ8A 5DM6F 1P6RA 4M9ZA 3S15J 5C3EJ 2ZMEA 3A03A 3DPLC 2LKSA 2EV6A 1I3AA 3PM1A 1ODDA 3H36A 2KZVA 3K4BA 5A2QK 3J7YJ 2IEKA 1VQ7I 2JVHA 4XKBA 5LEJA 4XR6A 3DKXA 2DPUA 4BNCA 2H94A 3FXKA 4Y3OA 2HOTA 3M8EA 1B72B 1RESA 3BPXA 5JFRA 3WHCA 3WGHA 1F4KA 3GFJA 2VJIA 1FYKA 3GBGA 2VODA 5ICGA 2Q1ZB 2O9LA 2HDCA 4AWXB 3JRBA 2Y69H 3V4GA 3BY6A 3CUQB 4PJMA 3RKYA 3COAC 3QYEA 3FXJA 3DBLB 1MNEA 2MH2A 4A93J 1LVAA 2RREA 1KZHA 2GIVA 3EQLF 3UKGA 4E4HA 4BXUA 2GM4A 3IWZA 2Y48A 3T8RA 2Q2EA 5LRRA 3OYHA 4M3DA 4M6XA 5JLWA 2WY8Q 3GFMA 1NG6A 2DA2A 4R1HA 5FKLA 3PIPF 4CZCA 1QBJA 2DMUA 1LNWA 2A3SA 3DU6A 2E1NA 3O8GA 5H2FC 1TZLA 4N4NB 2HOAA 1Y1WJ 2F2EA 5CKTA 5DD8A 2R92J 2DT5A 1HCRA 2B7EA 1VQ4I 3W6VA 2BXYA 2IP2A 5CVJA 3RTRA 2K9NA 2ZXIA 4QTRA 5M5XJ 1JGSA 2DLLA 2DTRA 4LGWA 4IQ4A 3DKWA 3A0HC 1MJBA 4HQMA 1LB2A 2Z9OA 3CJQB 5HLTA 1Y1VJ 3S16J 2MC3A 3U2RA 3HHHA 1YJ9I 1DU0A 3OY9A 3REOA 3GTMJ 1SFUA 2NNNA 3PNVA 3U1DA 2BW3B 1KU3A 3CCJI 2EWNA 5IY5H 4RAGA 5E8IA 5F1RA 5E3NA 2WWYA 3O2PE 2JMWA 3KX2A 9ANTA 2CJJA 1ZLKA 2E1MC 2E2IJ 3ABKH 2CV1A 4HDUA 2LLKA 2XRLA 1U5TC 4J00A 3MFKA 3K2ZA 4IRGA 2YR2A 3KEQA 4A3FJ 3BTCA 2K9QA 4OWRB 1JTYA 4XLCA 1W5CC 3H3UA 3LSMA 1T39A 2KRHA 2VJ5A 5GADJ 3GVAA 1X19A 1JE8A 1AA7A 2F5EA 1Z05A 1Y0NA 3TOBA 2QBYB 4M6VA 3WTWC 2K4BA 3GTLJ 4CGZA 3CO6C 2V7FA 1B72A 2JA8J 3JRCA 3BTIA 3KYLA 5IOZA 3DU5A 2CFOA 1IXCA 4WK8F 2KL4A 5FRNA 1S7AA 1G3TA 1J5YA 2OA4A 2CV0A 4HF2A 2QSFX 3RKXA 4A3CJ 2FEZA 4IO9F 1MGTA 2FBHA 3PSIA 3L2CA 4EVIA 2RQPA 3CUQA 3HOVJ 2VBZA 2XPVA 2RC4A 3ZMDA 1QPIA 2EPFA 4KYWA 2LF7A 3S3NA 3OOPA 4RS8A 2ZJPF 2E1CA 4RGXA 2A05A 3IRQA 1RUNA 4TV7A 4LOCA 1SAUA 5DUKA 2K40A 2V1XA 3HGGA 3L9FA 5TJJA 2H1KA 2X9DA 4KT6A 3PUFA 3KP4A 3CCQI 3H92A 5EDNA 2JA5J 1Y8QB 1YO5C 2LF8A 2KDZA 1OKRA 4KMFA 1ZGWA 2IPQX 1VQMI 2H8RA 5FFXA 3CCRI 4IHVA 2ISZA 2EIJH 2XRNA 3M4OJ 4QSHA 2K85A 1G6NA 1XGNA 2WY7Q 3OYIA 1U8RA 2LR8A 3G2BA 4EM1A 4BYYA 2PMZA 2EFWA 2ZC2A 1IXRC 3E5UA 1DPRA 2P0WA 3WHBA 4OU0A 4HV5A 1J2XA 2X0LA 3H5RA 2LYCA 2O8XA 5HNHA 1R36A 2MSYA 2BW3A 4IHWA 1JJ8C 3SJMA 1Q1VA 1FBQA 2CUFA 3AFHA 2X6YA 4CZZA 4ZYDA 1YYVA 3SZGA 3EUAA 4KIBA 2R0QC 2XROA 2E1MB 4GGGA 1ZLJA 3R60A 4UNOA 1U5TB 1X3ZB 2AQFA 2L7ZA 2HPIA 3P5JA 4UUVA 1A6IA 2XIGA 2R7QA 3VDXA 3K70D 4I02A 4LB6B 5D4SA 1G8XA 2QYOA 2W57A 1YI2I 1XMXA 5CYVA 2FBIA 4W97A 4RA2A 5ICEA 1SEUA 3OIQA 3FKJA 3J80Z 1MW7A 3RI4A 3O8HA 2JQ7A 1BJZA 3KLNA 3BDDA 4XKVA 2OCCH 2M4GA 4WXCA 3GTOJ 2GZWA 2YX7A 2QBYA 4XSZF 3GLXA 1R5GA 3BR1A 5FD5A 3RYRA 2EIMH 4S05A 1KQ0A 5CQEA 1QPMA 4FT8A 4GXOA 2JT1A 3K10A 4BY7J 2KIFA 3HEFA 5FJ8J 4WCGA 3CCVI 3JRIA 1IW7F 1Z7LA 2CH0A 2WAQN 2WAFA 3SDGA 5F1JA 3V8KA 2HQRA 1ZYRF 2E7WA 2YS9A 2YPRA 2Y9ZA 4KJZA 3H1CA 1T95A 3DPUA 5CVVA 1ULYA 5FO5A 2GA1A 1WH7A 5DTDA 1VFCA 2DO7A 2HI3A 1V54H 3QU3A 1XSVA 4GRIA 1GUUA 2ELHA 4EM0B 1D0ZA 4IJAA 2ECBA 3IH2A 1RETA 3FMSA 4EJUA 3TW6A 2OU2A 2B9SA 3X2QH 2ZJQF 4I7HA 1YS6A 2AXTC 4OOIA 1ZG5A 1WJDA 1MBHA 4QPOA 2EV5A 2COBA 1MD0A 5D5VB 4CDGA 5E1XA 4XRSA 3RQIA 1ZRCA 5CJ9A 1WI3A 2X6OA 4EQQA 5GPCA 2VXZA 1IN6A 3JW4A 1T0FC 2HQ5A 2I8DA 1PYVA 3MZYA 3RQ4A 1MMDA 4HX8A 4L5JA 2A5WA 1BI2A 4CA0A 3BCBA 4IVNA 2XSDC 1JI8A 4RAZA 4OINF 1UB9A 1MJ9A 4D5FA 1X3WB 3S8PA 2BGCA 3TDZC 2KMUA 1RC9A 1IG7A 3R0JA 1O3QA 1BBYA 4C3HJ 2NVYJ 5JVTA 1W36D 2J5PA 1NTCA 4E70A 2X51A 2F5FA 4I6ZA 4E7LA 2KISA 1XSXA 1JJ6C 1U5TA 2OCEA 4RGUA 5L3BA 2WC2A 2V4JC 1W7PB 3LQRA 3C2BA 3NQOA 3MMYB 2VT2A 3CLOA 2DQRA 3N4MA 4XLPF 2FF4A 5HDGA 4WXDA 1FYLA 3FXOA 2K9LA 5HS7A 4GFBA 5DS9A 4L0YB 3S1NJ 5HNFA 3CCUI 2ZNYA 2FD5A 2KIUA 1B8IB 4XNFA 4XMYA 1QRYA 1YW7A 2GIZA 3QOPA 1Z3YA 5J4VA 1JUMA 3TDUC 2V79A 4IL6C 4Y52J 4HW0A 5H6QA 1G3YA 1P4XA 1AHDP 3S2HJ 1S5LC 4H0EA 2RGVA 2AO9A 1VQKI 2DTZA 1K7AA 3HSEA 2W24A 3S1QJ 3C18A 4A0ZA 3GZ5A 1BR4A 2FNAA 3GTGJ 3UNGC 2CG4A 5IP6A 1EA3A 3BR0A 4ZH4F 3G4SI 3Q5FA 1QZZA 1B9NA 3ZP5A 5TISC 2O3FA 3FXLA 3IUOA 2WA0A 1FIAA 4I09A 1X4PA 2DMQA 2V6CA 3LSGA 4I0BA 4G8XA 4PUSA 3AG2H 2ZMEC 2EFPA 3MN2A 3RZOJ 2OF7A 4E7ZA 4YIRX 1X58A 2BZTA 1RKWA 2M34A 3E1SA 2MG4A 1A36A 1MZBA 3BG7A 4D0PA 4KIGA 2DK5A 1BI3A 1Z1DA 2CWEA 1IC8A 2A6TA 3PL8A 3ZOBA 3MZ8A 1MDMB 3KPHA 5LEKA 4KNYA 3F3XA 1WJAA 3NAUA 2HU9A 1R4MB 3OYFA 3ZMUA 5HLGA 1PJRA 3HBLA 3BZKA 4ZTFA 5BPIA 4EGZA 3KEOA 2VKVA 1WKMA 1FP2A 1TWGJ 4EM2A 1IN7A 4Z2YA 4I98B 2FQ4A 2P5VA 2L7KA 2DA4A 5J1YA 1FOKA 5EF6A 2P8TA 1VQ6I 4NUBA 3TKYA 3Q0UA 1SFOJ 2DA7A 3DEWA 4N4OB 4QIWN 2W1OA 5E8GA 3RCOA 1SAXA 4XRSG 1ACIA 3CJNA 1SD4A 2DI3A 2MABA 1TC3C 2RKHA 3NEUA 3CDIA 3TBIA 3CCYA 2VASA 5E3LA 2LC2A 1HA8A 2W7NA 1VZ0A 3I5UA 5IP7J 4XOPA 4FTHA 1SMTA 3JCUC 3BTLA 1YE9A 1IF1A 4XLFA 3DTKA 3TP3A 2IAIA 3LNQA 1W7PA 1MBFA 2LBFB 3OYMA 4A3KJ 4F92B 2X4HA 4LLLA 2FMYA 2KHMA 2EFNA 4IOCF 4X1EA 5KVRA 2QQ8A 2HGCA 4MHGA 2HS5A 3EUHC 3HSFA 3BJOA 1B8IA 2IJLA 1J9IA 5DV5A 4NC8A 2E35A 2K7LA 3BG5A 3S2WA 2DQLA 3FF5A 3HOWJ 1S3JA 1E17A 1VTNC 2KKOA 5CVRA 3DLAA 3FXUA 1YOVB 2RQQA 4MTDA 5A2QZ 4XONA 3BP8A 3L7WA 5ILVA 1QZYA 3ZQGA 4IRIA 4A0XA 4ZZLA 1WFXA 3L2RA 4G7OF 1USSA 1S8NA 3T8TA 2HTSA 1FMWA 3R6SA 3ZQ7A 2HNHA 4RAFA 2RVCA 4M74A 4EMSA 5BOXA 1WVRA 3M07A 4AIKA 2LMDA 2L3DA 5GAGJ 2OQGA 2XF6A 1ZARA 2A61A 1ZN2A 2V1DA 4CCNA 4B47A 1EH8A 4YIIA 1R5ID 1SFEA 1LDDA 1W7PD 3U21A 3OYAA 4A3IJ 3SDBA 1QQIA 4EJTA 1WGXA 3IC7A 5J40A 5HLHA 1IJWC 2V6EA 1R23A 3DP7A 1W0UA 4XBFA 3F23A 2O61A 1P7JA 5JVGF 1G3WA 4ZJZA 2DBBA 4RM2A 1W0TA 1VQ5I 4KN7X 4E6KG 2QSHX 2P4WA 1IGNA 1MSFC 1I6HJ 3CUQC 1TW3A 3FM5A 1FNNA 4UVBA 1LJ9A 2JPCA 3G1OA 4XLHA 2A69F 3OR2C 4DGWB 1P92A 4EEFG 1XS9A 2JTVA 3PNYA 1RPWA 3WTSC 4HX4A 3RJPA 4ZYGA 2MFZA 3K70C 3E97A 1M1EB 1V3FA 3HZJA 4HSTA 1AWCA 2QF7A 1YJNI 4HYEA 1U6GA 3BQYA 1A31A 2GOXB 3CDLA 3FXMA 4HPQA 2OC6A 2HYFA 4JX6A 1K83J 3DQVC 1RNLA 3KFWX 3SQNA 2DT7B 1KU9A 3J7ZI 5E79C 5LHIA 2H8WA 5M5YJ 2LK2A 3WGIA 1MMSA 2OZ6A 1X1BA 5JR3A 4D9JA 1S29A 2KDOA 3HKZN 2LBFA 3ZMTA 2K3PA 4BDZA 4HNTA 3V42A 3HXLA 1SD5A 2ACJA 1JKRC 1ZRDA 4BBSJ 1A04A 4B3XA 5FROA 2FA5A 1XG1A 2GXBA 2DA1A 1SANA 2KQRA 3CCSI 3W2WA 3ECOA 4RBOA 1KU2A 1WJFA 4XSXF 1OR7A 5LHGA 1V5FA 2VUMJ 3S17J 2VXDA 1TNTA 1XGOA 2EFQA 2PQ8A 2R93J 3FXRA 4RM3A 2ZFWA 1Y39A 2NS0A 1JTXA 2XPUA 1K6YA 3OS2A 5IPAA 5J1UA 4BJ5C 3JSOA 4K2EA 3PJRA 1D8KA 2ECCA 1A5JA 4YFXF 3CF2A 3LFUA 3LSPA 4CCLA 5ICFA 1XCBA 3CJRB 2BY1A 2XDVA 4U7DA 2XAFA 3OYBA 2PLYA 2D5VA 2COMA 3GEZA 5F6FA 4UUSB 1IO2A 1BOAA 2RAEA 4ENMA 2BY3A 3L1PA 3S1RJ 2K5CA 1E2XA 1ORKA 3OYKA 3E6MA 4R79A 3CMEI 3Q9VA 2UXNA 4D7MA 1J75A 1TL8A 1W36C 5F0CA 5E20A 1R1VA 4KDPA 2P6TA 3HJEA 3BTJA 1O57A 3I4NJ 4BQNA 3BR5A 3ABMH 1IN4A 2L9VA 2TCTA 2IBDA 4XLEA 1XX5A 2F4IA 1R49A 4PSXA 1BW5A 1T56A 1D3YA 2E1OA 2CFXA 2EA4A 5DCMB 3TW7A 5F27A 3A2KA 3QP6A 2ID3A 5FFZA 4IHXA 2ESHA 1GV2A 3MKLA 3CMAI 3D5RC 3GZ6A 5L3EA 4EJVA 1UELB 1IAWA 1GVJA 1PVEA 3N97A 1WJ5A 4C2UA 4C2MJ 1P9QC 3BC8A 2X6XA 1QA6A 3GLLA 2R7SA 4NC7A 3VPRA 1HOMA 3ZQQA 2XB0X 5HS9A 1FTTA 2FBKA 1ERDA 1ZAOA 4CYCB 5FLVA 4KICA 3G6EI 3G3ZA 1MIJA 4LB5A 1FMVA 3EUHA 4C9YA 3ZCOA 3MAJA 3CUOA 1GT0C 1LKXA 1IV8A 1CQTA 3TO6A 4WX9A 1N25A 5DDGA 4YIFA 4YG2F 2LTPA 4E7KA 1YX5A 2CQNA 4ENJA 2JSPA 4LLNA 1V55H 1D0YA 1MBGA 1JUSA 1R4NB 1JHHA 4CHUA 3AL0C 3HOXJ 4C3JJ 4GDFA 2Y0SN 1NK3P 2NVQJ 1XN7A 3I56I 1LDKB 5HLIA 1MNMC 4X0GA 1BI0A 2MLGA 3R61A 4IHSA 3C3WA 2YU3A 4HSRA 2DOFA 2GXGA 1IXSB 3GZNB 2IS2A 2CV2A 3UR3C 2V1UA 1WJEA 4HG2A 3OS0A 2HFHA 5EZGA 4BDYA 3LL7A 5TRDA 2KZGA 2HQNA 1T38A 5KAIC 1FOWA 1NH3A 1YIJI 4HX7A 4DBRA 3OR1C 2Z2SB 4WXHA 3E6CC 3PO3J 2K3FA 3ERMA 2JZYA 3R4KA 4AYBN 2R7UA 4ZTJA 1UG0A 1ETKA 2WAQA 3IAM2 1B6AA 1YFHA 1D5YA 1VNDA 1R71A 4UUSA 4XORA 2K86A 4PFPA 3LA3A 4A3EJ 1B9MA 1MH3A 2KRFA 2E2JJ 2QSGX 4CYDA 2O6GE 3I4PA 4U88A 3MD2A 3PIOF 3MCZA 3SHFA 3R0AA 1AOYA 3MKZA 4A6DA 2D45A 3TEDA 3AG1H 1A35A 4EGYA 5AIQA 3M1EA 1ZTRA 3QOEA 1VF9A 1U2WA 2HEOA 2VC0A 3MQ0A 4HF0A 3CC4I 2LFBA 2BV6A 4LLGF 4DZPA 1JKOC 4ESJA 4MQVA 4M9SA 4D7NA 1LEAA 4V2GA 1FZPB 1HKSA 3CO7C 2K4JA 3LMMA 1O7FA 4BE0A 1X1DA 2UUZA 5IYCJ 2VE8A 1RR8C 5DCMA 1FEXA 1HLVA 6PAXA 3KYCB 2HKXA 2NOGA 2HKOA 2E2HJ 1DGRM 3ONQA 1X2MA 2V9PA 1YW9A 4L9TA 3KP6A 4C30A 2P5LC 1FBSA 3OS1A 2OPTA 4UV9A 4XK4A 1PP7U 3BPVA 2ISYA 1WJCA 2DOAA 1P4WA 2G9WA 1JKQC 1HXDA 5F0FA 2UXXA 3Q0WA 4C3IJ 3JRGA 4I99C 3PQJA 3F9KA 2NXNB 2BHZA 3ISPA 4M72A 2KFDA 1J09A 1B59A 5IYDJ 2XSJC 1LE8B 2XGEA 4QLCU 2HR3A 2LG4A 1ITYA 1Z0XA 3CF5F 2TDXA 2QA4I 2EBIA 2KIQA 3NARA 3VYRB 1TWAJ 1HQCA 4DIQA 1VQPI 3HOUJ 4BXFA 3AL0B 2XKPA 3AG3H 2H6BA 3L2UA 2AS5F 2LREA 3IP4B 2R7ZJ 1XB4A 3L09A 3QQAA 3S1MJ 2DN0A 3BZ6A 4B4CA 2H6CA 2FNPA 2Y75A 4S04A 2QQAA 3L2QA 3H9QA 3V7RA 4ESBA 4BJTA 2F48A 1MNDA 3WGGA 4WF2A 1WWXA 4Y33A 5FGMA 5LLQA 1MKMA 2WAEA 3RKWA 1IN5A 3FX3A 3JTHA 4YELA 1Z9CA 1B4AA 3EYYA 4B09A 1KQ9A 2ID6A 3DFGA 1UAAA 1D8JA 3F8CA 2L7MP 1QO0D 2O03A 2VL8A 4PJNA 2DA6A 3QYFA 5K5OA 3KYDB 2EZLA 1X1AA 5F64A 2XHKA 3HRUA 5D5XB 3FM3A 4CICA 3WTTC 1U9NA 3JRAA 4G12A 1HDDC 3VFZA 3HUGB 2R7OA 3M8FA 3ZQHA 3BT9A 4DZJA 5GAEJ 3ZMSA 4M3BA 1ETOA 1K4TA 2OQRA 2XPWA 4WWCA 1FIPA 2MD5A 1K78B 5IYBJ 1ZK8A 1C0WA 3GW2A 2P7VB 2M2EA 3KZIC 4EATA 2MBFA 4DQ2A 4W1UA 2A5YB 3DCFA 1XC5A 1HC8A 1O4XA 2EFOA 3EYIA 3JAMK 2FX0A 4GYIA 2DMPA 2XF7A 2R5ZB 1HDPA 1G2HA 3PQKA 2R7WA 1R9TJ 1HW2A 4G6DA 2M1BA 5CVUA 3ABUA 1H9GA 3W2AA 1NG7A 1FOXA 1MBKA 3GTPJ 4M3FA 1X2NA 3CMMA 3CC2I 2KJCA 5EYRA 2NVXJ 3OYLA 1SFKA 2A68F 1H0MA 1OCTC 1NHAA 2VQHA 5M3MJ 3Q3SA 4FASD 3CCEI 2AHQA 3ZXSA 1MBJA 1LE8A 3A1YA 4ESFA 2FJ1A 1X1PA 4JOMA 1HSJA 2VBWA 3ZN1A 3IWFA 2WTEA 4JX5A 4U0WA 2IA2A 1KGSA 1Z6RA 3RKQA 5K1YA 4A5NA 3LA2A 3DBHB 2MW8A 5J1RA 1UHSA 2ZSHB 3CTAA 2PJPA 3OMYA 3HRSA 3F21A 1XTAA 1QNTA 4R8HA 4JBAA 4P1WA 4BEHB 2LOOA 4ZYEA 5FKNA 4Y15A 3CESA 1U78A 2VI6A 3HC7A 1FY7A 2EQRA 2GXAA 3JRDA 4L0ZB 3PFIA 3GFLA 1IN8A 2B0LA 5J4YA 1QVTA 4Y13A 3GYHX 2CQ7A 5HDNA 2DYSH 1R5HA 2RV8A 5F08A 2IXSA 3M7GA 1LDJA 2R7VA 3FISA 1R1TA 3K4NA 1OR7C 2ZXJA 1X1CA 1KYZA 4B48A 4P9FA 3H3VK 4O5VA 4KT5C 1BW6A 1T6SA 3ASOH 4Z6YA 1BJAA 3LQQA 4M3EA 2FE3A 4OAZA 3BR2A 1ETQA 3HUGA 4A3LJ 4CCMA 5D8KB 3K4CA 1GDTA 2VJ4A 2DJNA 2JA6J 1W5SA 4XM3A 3V8LA 4G7HF 2JSCA 4AVPA 1HW1A 3SEZA 1KQ8A 4OMZA 1HW5A 2HZDA 1Q1HA 4NC6A 1K78A 1TQPA 1SMYF 3Q0VA 5AIPA 3RPQA 1SFXA 3BLYA 1FT9A 2QKMB 3GTKJ 4A0YA 5IT9Z 2BBYA 2HXOA 3K7AJ 3LSJA 1HSTA 5FKOA 3FHNA 1WHUA 5J6XA 2M30A 2Z33A 3PSFA 1JT6A 1IDYA 4N0BA 1ETWA 4A12A 4BACA 3DWLE 1T8IA 1OCOH 3F22A 4NHJA 4A6EA 2C6YA 3ELKA 3H9JA 4H4KC 3G73A 5K7ZA 2BHYA 2L01A 2OJED 2PFBA 1X3UA 3DEUA 3BQZA 3OIOA 3ABLH 5JHFA 4PCQA 3OYJA 3K0LA 1P2FA 5EGOB 1LFPA 3DTIA 4HEA2 2VT3A 4HAMA 2DFFA 4LG3A 4BAYA 1XMKA 4ASNA 2ZBKA 4BU2A 1OQYA 5K7HA 5EG0B 4M73A 1XGSA 4PK4A 3E5QA 1ZR2A 2OZUA 3KP5A 4QWQA 3I58A 2V26A 5LRSA 4B3AA 1IUFA 1Y0UA 2IGKA 1ZELA 5L3GA 2CUJA 4LMYA 2R7DA 3OV8A 2X1DA 1K61A 3HKZA 2X1EA 4DOZA 1BC7C 3W6KB 1FC3A 3VYSB 3RIRA 2DFHA 4L18B 2P6SA 2L4MA 3WTXC 1PP8F 2FOKA 5BS6A 2L54A 3QP5A 1RR7A 2MC4A 1OFCX 5B1AH 3OYEA 1AU7A 1ETYA 1YX3A 2WV1A 5CPRB 2N8GA 5E1WA 1QZEA 1AKHB 1TWFJ 3QPSA 3ERED 2R7XA 1OYIA 1TBXA 3HB9A 2CRGA 3KCCA 5CVIA 1IRXA 5F04A 5DUIA 1QGPA 2PBIA 4U87A 1UHMA 2DDBA 4BEHA 3WE3A 1E3HA 2L0KA 2LDUA 3QWLA 4HZFA 1IZ1A 3F72A 3G1MA 3HPHA 1A6QA 4JX4A 4F91B 2D1VA 3D5SC 1GXPA 2OBPA 4XL9A 3S3MA 5LGUA 3HL2A 3K1PA 4PJJA 3ZRGA 1GVDA 4Y7NJ 1OMIA 2Z16A 3SEQA 1DDNA 2IRFG 4UVAA 1IRGA 2IGMA 3RSNA 4PZJA 3T1BA 5FRMA 2IS6A 2QUFA 1I3QJ 1MSEC 3ZQCA 2WB1N 2CSOA 3I64A 2YU9J 4RDUA 3N05A 4BQAA 5J3LA 5KCMA 2LY2A 4AVZA 4RB2C 1JXSA 5KK1A 3C1DA 4ANJA 3HDDA 3BCAA 3RYPA 3OIPA 1FOYA 4P96A 1JT0A 1F5TA 1H89C 3FXQA 5BPDA 5LGNA 3S3OA 4L9VA 4D5CA 5LHHA 1YHQI 2VBXA 1LUJB 2CQQA 2CW7A 4II2A 4J19A 1Z77A 4HRIA 1OCZH 4MEYF 3RZDJ 4FQGA 2WBMA 1SD6A 2XUBA 2ZJ2A 3L2WA 1DU6A 2JRTA 2E71A 4M6YA 2R4GA 2ZXHA 3IKVA 3E6DA 4QPQA 2A07F 2GLOA 3NRVA 4A69C 1MDMA 1ETVA 4C2TA 2Q0OA 3HM5A 2BOLA 2E60A 5EEGA 3J7AO 2W84A 2IA1A 2E19A 1NK2P 5DYMA 3M8JA 3RPUA 2XAHA 4HNVA 1XPXA 1Z7UA 5DM7F 3HG9A 1OLTA 2LY9A 5EGOA 1G3SA 1T08B 2DOEA 5IT9K 2LKXA 3W6JB 4B44A 3DPTA 5BQTA 3Q9SA 4RLQA 2XGXA 2E5ZA 3IHUA 2DCEA 3BJ6A 1USTA 3H35A 5H6RA 1OPCA 3B6AA 1F43A 2FSWA 1FPQA 3K4KA 3HYIA 4G6TB 2PN6A 5EEHA 3WTUC 4KITB 2OUMA 4L9NA 4LK0F 4IEJA 1YS7A 2CQKA 4DJAA 1WJBA 2H27A 2W00A 3HHGA 1MBEA 1PUEE 3L00A 4MFDA 2HVRA 1AKHA 4E7HA 4PGGA 5ILSA 5LBQA 1HKQA 3DBRB 1J59A 1TT0A 4UUTA 5E3OA 2ZNZA 5IT3A 5LGTA 2VPRA 3GFIA 2XASA 3ULQB 2ZXWH 1Z91A 3FK7A 3FWEA 2L4AA 2Y0SA 1MJAA 4AIDA 3DEEA 2XKOA 4ZC3A 2R3SA 3K4JA 2W48A 1VQOI 1UHWA 3H0DA 5ED4A 4IPAA 2A6EF 4HDVA 1EV7A 4XRMA 3RPUD 2HTJA 5J8CA 1R58A 1POGA 2LH9A 2HVSA 4UB6C 3ZQIA 5JLXA 1I27A 2ESNA 1ZH5A 2BYVE 3HOSA 4MIMA 3CZ6A 2DXIA 4JYKA 2M45A 2VBYA 3DLLF 2KRCA 4IZZA 5C4JJ 4YEJA 4NDLA 1F1ZA 2P5KA 2YUSA 1ZGJA 1BA5A 4AYBA 1TLHB 2PX9A 2Y30A 2JN6A 4UVCA 3P7NA 2NAZA 3E5XA 4YFKF 2BXZA 3VOEA 2JWTA 2J5OA 5KHDA 1G4DA 4HQEA 3MKYB 2LNBA 2F6CA 2BY0A 2DA3A 1T98A 2R7FA 2UWMA 5GTHC 3P9KA 4B43A 3S14J 4E7JA 1LVKA 3ECHA 3VYUB 4KFCA 4NNJA 1EH6A 2EA2A 4L5EA 5FB2A 3KZYA 3ZMVA 3EPZA 1O3TA 4BE2A 2VQCA 1FP1D 5ERIA 2VKEA 3D5LA 1IDZA 3JTGA 2KLOA 4I01A 1DQUA 1GV5A 3K9TA 4UB8C 4BHCA 2OAZA 3AKZA 2CU7A 1LEBA 1JGGA 2MA3A 3QU6A 2Z3YA 5TGTA 2JA7J 1OYWA 1OJLA 2Z5UA 1O7LA 5E3MA 2KP6A 3LAPA 2ZO4A 1EH7A 2HOSA 3WU2C 2M7AA 1J0RA 3FIWA 2KIMA 1W4MA 1SVMA 1PDNC 2RNGA 4CSWA 3G1LA 4XLAA 4UV8A 2CUEA 2XAUA 3MEXA 3JREA 1ETXA 4A3DJ 4RGRA 4EV0A 2A6HF 1APLC 1VQ9I 3OYCA 3BG3A 3SFIA 3B73A 2X6WA 5E1ZB 2DYRH 4CH7A 2OTJI 2GWRA 3HOYJ 4G7ZF 5B66C 2V9KA 2ME0A 5ILUA 1JHFA 1RI7A 1SVLA 3H5NA 1B1BA 2KJBA 5E18F 2IT0A 3F8FA 3TOAA 1H88C 3KLOA 2O5RA 5KAFC 3CJTB 1D1CA 3IL2A 1YTYA 2MH9A 3FDYA 1OYYA 3GF2A 2M7BA 3V7CA 1YRNB 4JQFA 2WV0A 3SZTA 4AIJA 3CD6I 3HRMA 2D1HA 1KU7A 4I76A 1EJ9A 3C2GA 4ITVA 3TGNA 1WI9A 2JVGA 1IRZA 2HDDA 2STWA 1LFUP 4HA8A 3HTSB 3FBNB 1YLFA 1FTZA 5J47A 3F6OA 2PJRB 4A3MJ 4EJOA 2HOEA 4Q47A 3OYGA 2ZKZA 4OIQF 1WZ2A 2DFEA 2IGNA 3KIOA 5L3FA 1FBUA 2VLAA 4HV6A 3W2VA 4BQOA 1DUXC 1R1UA 2VN2A 4HLXA 4ETSA 4GCVA 3OL4A 2HPMA 4X6AJ 3WU0A 2EH3A 1S72I 1GHCA 2L9SA 2XAJA 5L3DA 1IV6A 2CW8A 2HDWA 3EUKL 2G7UA 3HPGA 1GXQA 2ELJA 1KA8A 2GOMA 2ELKA 3LSIA 4D1QA 2GBYA 3S93A 1TNSA 4HOBA 3FKIJ 3LSTA 4FX4A 2MLKA 3CLQA 3PFYA 5GPAA 4BGDA 3KEYA 3SYTA 4BHPA 4MEXF 4LG0B 3GMEA 3I4MJ 1D0XA 3HRTA 4AUXA 4ZDLA 3JAMZ 4HBLA 2LP0A 4KMUX 1V4RA 4DYCA 1S7OA 3ZQLA 2M9HA 2JPBA 1EKEA 2ADUA 2LKPA 4BL0B 1LFBA 3OYNA 3CMYA 4A3GJ 1LPQA 1P4AA 4YRVA 1IUYA 1TP4A 3EETA 1DP7P 2EZIA 4O3MA 3WG9A 3LA7A 3IV5A 3VSLA 3LSHA 3E3VA 2TRTA 3QAHA 4F3QA 2XF5A 1UG2A 4P9UA 3I55I 1Z21A 2MD0A 1O3RA 2ETHA 4BHBA 1VI0A 2CGPA 3WTZA 3M9AA 1YW8A 4ZZDA 1XDSA 2HWVA 1H8AC 2P7CB 2K9SA 1MH4A 2H1LA 2FRHA 1DPUA 4MNUA 4IHTA 4CXFA 2RN7A 1RIOH 2BY2A 4HNUA 1Y56A 3J81Z 1OCPA 1ZRFA 2ZCWA 3OL3A 3LFKA 4CYCA 3D0SA 4ABZA 5K5RA 1EF4A 3BROA 1Z67A 4FE4A 2M3AA 3K6GA 1G59A 1VQLI 3HTUA 2XVCA 1KYWA 2DK8A 2KPMA 1ZQ3P 1RKTA 1I5ZA 2VJJA 4LIUA 1YRNA 3H3ZA 4BE1A 4MFEA 3WTYC 2EILH 1BC8C 3OSGA 3F8BA 1TQIA 4XN3A 1TWHJ 1D5VA 2LSOA 1QVUA 2BVLA 1REPC 2R7TA 1BN5A 5D6EA 4BH9A 3GUDA 3TL4X 3I54A 4MLOA 2MGQA 2XGCA 2EV0A 2PJRA 1UFMA 5D5WB 2JRMA 3QPHA 4RB0A 5D4RA 1Y8RB 5C44J 2PMUA 4DW6A 1WCMJ 1HF0A 3H9GA 2Z1DA 3LAJA 2HYJA 4BBRJ 1ONVA 1OCCH 4U7BA 2ZB9A 3JRHA 2M0CA 4CCOA 2QQBA 3G71I 1I39A 4F7ZA 2UZKA 4P5OA 3RDIA 3AG4H 3K4LA 3GXOA 1E3PA 2K9MA 3T0YA 2O8KA 3VB2A 2VE9A 4E7IA 3S2DJ 1TTYA 3QPTA 1MMAA 2FMLA 4LG0A 4GO1A 5B5EC 5BNGA 5FD6A 2L2OA 3BG6A 2IS1A 3PO2J 3OYDA 2W85A 2HZTA 2X85A 1XD7A 2BVMA 2WADA 1N78A 1HKTA 1HBXG 3HSRA 1I1SA 3FK6A 5HODA 3D1NI 4UHTA 3ML6A 2VB6A 3HOZJ 2Z99A 1BL0A 1WSUA 2E36A 3WG7H 3DXJF 3M1CA 3B6CA 4CUGA 2W82A 4IXAA 4MQ9F 3BG9A 4NQWB 2NS8A 5F0HA 1E0EA 3CC7I 4E7SA 4ZDPA 1JKPC 3ESWB 5GTIC 3M3YJ 2L5QA 1UZCA 4BS9A 1YITI 4LIVA 2QWWA 1K4SA 2W4SA 1OCRH 4IHYA 5L3CA 2EB7A 3DTEA 4OIRF 2JUGA 5CQGA 4ZDOA 2OV7A 4ZYHA 3E6BA 3S32A 1U3EM 2VQGA 2DJIA 1RRJA 2Y2ZA 4U0YA 3I59B 2H09A 3B02A 1BR1A 1TT5B 3LOCA 2O7OA 4MTEA 2YSRA 1DP3A 2OD5A 3ABTA 3V7SA 1ZG1A 4PGHA 4KA4A 2GAUA 3WE2A 1P7IA 3MVPA 4AD9A 2F5DA 2QM3A 1L0OC 2HQAA 1Y6IA 1S9HA 2EK5A 2IVMA 4I0AA 3V8JA 3KZZA 4II3A 4FHTA 1W1WE 3W3CA 2Y9YA 4PSWA 4XOTA 1F36A 1XSDA 1X4OA 3ASNH 3F8NA 2EJRA 5GAHJ 2D2WA 2BEOA 3E0JB 1XCVA 2YX4A 4L5IA 4RB3C 3J81K 3DF8A 5ICCA 3A4CA 1T2KA 2BE5F 4PDKA 1XDUA 3P9IA 1N75A 3AAFA 4FISA 3WTVC 4IKFA 1XMAA 2IS4A 2QLZA 5HVQC 4F93B 4RLFA 4OIPF 2NOJB 1I50J 2G0EA 4MO7A 4F52A 2VIXA 3CP8A 3GWZA 3BZCA 5IOYA 4M9XA 2PMZN 2WB1A 2Y0MA 4I2OA 2VKDA 4M3GA 4P55A 4MGRA 2ZSIB 3K4MA 2DMNA 1K6OA 3BJAA 3H5AA 1BOBA 1QU3A 4M71A 1D1BA 3QODA 2R7RA 3OOUA 3U9GA 3IRRA 2Q8KA 1Z3XA 4IRHA 4XKWA 5JI6A 3KP7A 2QVOA 2DODA 4G94A 4A5MA 5EZHA 2EZHA 4EJWA 2NRAC 2Y31A 3P9CA 2RDPA 4RAYA 1FSHA 4LK1F 3SFZA 1SVOA 4N9IA 5IP9J 4IOAF 3EDPA 3I71A 2LD5A 1U9OA 2DT6A 4XQFA 2CW0F 2E7XA 3ZMZA 1V5GA 4BKXA 4NBQA 5D8LB 2QCOA 2K02A 4FETA 4A3JJ 2VPLA 3FZVA 1TWCJ 4IQJA 3ZN0A 3FMRA 3H0GJ 3A02A 3L2VA 5FKMA 1ENHA 3GX4X 3GCMA 1WQ2A 5LD2C 5HS8A 4FX0A 3TQNA 4NQWA 4V19K 4KIFA 2EINH 1Z6TA 2V1NA 3ROUA 3QYBA 4AM3A 3C2HA 4IF4A 5DEQA 2XV4S 1WPKA 2NVUB 1QHGA 1BIBA 3J80K 2R5ZA 2DFIA 3F8MA 1VQ8I 1STZA 2XGDA 2XC7A 4OIOF 1WRJA 4LFUA 3O3KA 4G9YA 3LSRA 1ON2A 1O3SA 2RNJA 3O6BB 3FBIB 4GYGA 2FXAA 1S7EA 1UMQA 4XLNF 3JRFA 4XICA 4UY8I 3J7AY 4UXNA 1JUPA 2EIKH 3GO5A 3QRFF 3IAS2 3I59A 4XKCA 4KISA 4DYQA 3F0CA 4B8XA 2L7FP 3A01B 3CCMI 2JJ7A 4F55A 3VEPA 3TP0A 2R5YB 1IRFA 5C4XJ 4FCYA 5HOOA 3PNTA 2B63J 2MYSA 4NB5A 1YQAA 2IW5A 4KUMA 4XRFA 3DV8A 2XAGA 1RZ4A 4ENKA 1FJLA 2CO5A 4YFNF 2VOPA 1T33A 1PUFB 3OSFA 3DKYA 4BY1J 2FQ3A 2PMHA 2QEXI 3CCLI 3ZPLA 2QQ9A 3VODA 3I53A 1LQ1A 5FLXZ 1FSEA 2PI0A 4AC0A 2L02A 3E7LA 3JR9A 2PG4A 2F4OB 3CP2A 1BI1A 3PUBA 2LRDA 2E34A 3I3LA 3U1KA 4S0HB 4BUPA 4CCKA 2VC1A 3ZR8X 4DYRA 4HF1A 2M8EA 3BR6A 1DGWY 2M0MA 1R7JA 4FE7A 2P81A 1U0JA 2V9VA 2AXLA 2K27A 3VYTB 1FLIA 2VKHA 4LITA 1V5EA 4RB1A 2CUZA 3NWSA 1F9NA 5FKKA 4RMNA 4JK1X 2DPDA 1OISA 4BJ6C 4A3BJ 2M5WA 3TO7A 1SC7A 4Q5SF 2X1CA 2CQXA 3I0TA 3IH4A 2F5CA 3BR3A 2JA2A 3NWTA 1CF7B 4Y4RA 3IKTA 4O6JA 1BIAA 1N77A 1YG2A 3ZGKA 2DA5A 2XAQA 2HXIA 2LY1A 1MMNA 2DW4A 3QPLA 4B1RA 4DBQA 1RUOA 3MWMA 2L9RA 4U0VA 4XN0A 3C7JA 5B1BH 1W5TA 4G6QA 3LSKA 4A2UA 2CS3A 5H20A 5CLSA 1I1GA 1SD7A 2I5UA 1H9TA 5FLMJ 4DNCA 3K69A 3TO9A 2UV1A 2ZMEB 2IGOA 5EEAA 3OWTA 3WU1B 1YJWI 4PJ0C 3CQZJ 5E17F 5GP9A 1R22A 1R6RA 2W25A 2F5VA 1U8BA 3LWFA 5D5UB 1R00A 4Y17A 3A01A 5B3SH 2R5YA 5EG0A 1FYMA 1ZREA 1BM9A 1KONA 3JSPA 1VQNI 4BXXJ 5HDKA 2JK3A 2NYXA 3ZQFA 4XIDA 3HIFA 5K5QA 1ZKGA 2GQQA 2FUG2 4RGSA 4HLYA 2QKLB 2CYYA 2M8GX 1CGPA 1XGMA 3A0BC 5JHUA 1PUFA 3HGYA 4BQQA 5KNLA 1GLNA 5M3FJ 2DDAA 1ZGAA 4L9JA 4IX7A 4Q4ZF 3FHZA 2E5NA 1T0FA 2G7HA 4ZYAA 3KP3A 4CO8A 1ON1A 1UJ8A 4JP0A 4V2FA 2VOOA 2CMPA 2Q2EB 2FOWA 2I10A 2QENA 2EZKA 5DD4A 2VQLA 2DAOA 2X48A 1E3OC 2M87A 2PEXA 4AIHA 3KP2A 3HOTA 1BR2A 3BWGA 5D6FA
chains in the Genus database with same CATH topology
1OQYA 2QSGX 2QSHX 2F4OB 2F4MB 3ESWB 1QZEA 4YIRX 2QSFX 1TP4A 1PVEA 1X3ZB 1X3WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  2QSG X;  2QSH X;  2F4O B;  2F4M B;  3ESW B;  1QZE A;  4YIR X;  2QSF X;  1TP4 A;  1PVE A;  1X3Z B;  1X3W B; 
#chains in the Genus database with same CATH topology
 2ZFU A;  2O0Y A;  5K7F A;  2QGU A;  2HVQ A;  2JUC A;  3MZH A;  1TW2 A;  1I6X A;  3K2A A;  3VSK A;  3I9V 2;  3K1N A;  4AU7 A;  5LFA A;  3VWB A;  3IH3 A;  3K1M A;  2L9N A;  3SXY A;  2M4K A;  3MKW B;  5FLX K;  4LD5 A;  4OMY A;  2DU9 A;  3GTJ J;  5J8F A;  4N9H A;  2ZJR F;  4PJL A;  4J01 A;  2FU4 A;  4ENN A;  1ZG3 A;  3FMQ A;  1WH5 A;  1L3L A;  1FX7 A;  2OTL I;  2KT0 A;  1YIO A;  2NVT J;  1UCR A;  2ME6 A;  2VON A;  2NNY A;  3T5X A;  4OAY A;  1CF7 A;  1K79 A;  2F4M B;  5AON A;  5EJC A;  1D1A A;  2IA0 A;  1ZHF A;  4KN4 X;  4ON0 A;  3CDH A;  3KET A;  3BOQ A;  2XB5 A;  1TQM A;  4PFO A;  1ZR4 A;  4CCJ A;  2HYG D;  3WOD F;  1S6L A;  3SZP A;  3GTQ J;  3F6V A;  1MMG A;  2ICW G;  3KE2 A;  5DCF A;  2LVS A;  1QHH D;  2AQE A;  1FWZ A;  2GA2 A;  4LJZ F;  1J7K A;  2NS7 A;  5BMZ A;  2DMT A;  3TMO A;  2STT A;  5M5W J;  4Q48 A;  2QZ8 A;  5DM6 F;  1P6R A;  4M9Z A;  3S15 J;  5C3E J;  2ZME A;  3A03 A;  3DPL C;  2LKS A;  2EV6 A;  1I3A A;  3PM1 A;  1ODD A;  3H36 A;  2KZV A;  3K4B A;  5A2Q K;  3J7Y J;  2IEK A;  1VQ7 I;  2JVH A;  4XKB A;  5LEJ A;  4XR6 A;  3DKX A;  2DPU A;  4BNC A;  2H94 A;  3FXK A;  4Y3O A;  2HOT A;  3M8E A;  1B72 B;  1RES A;  3BPX A;  5JFR A;  3WHC A;  3WGH A;  1F4K A;  3GFJ A;  2VJI A;  1FYK A;  3GBG A;  2VOD A;  5ICG A;  2Q1Z B;  2O9L A;  2HDC A;  4AWX B;  3JRB A;  2Y69 H;  3V4G A;  3BY6 A;  3CUQ B;  4PJM A;  3RKY A;  3COA C;  3QYE A;  3FXJ A;  3DBL B;  1MNE A;  2MH2 A;  4A93 J;  1LVA A;  2RRE A;  1KZH A;  2GIV A;  3EQL F;  3UKG A;  4E4H A;  4BXU A;  2GM4 A;  3IWZ A;  2Y48 A;  3T8R A;  2Q2E A;  5LRR A;  3OYH A;  4M3D A;  4M6X A;  5JLW A;  2WY8 Q;  3GFM A;  1NG6 A;  2DA2 A;  4R1H A;  5FKL A;  3PIP F;  4CZC A;  1QBJ A;  2DMU A;  1LNW A;  2A3S A;  3DU6 A;  2E1N A;  3O8G A;  5H2F C;  1TZL A;  4N4N B;  2HOA A;  1Y1W J;  2F2E A;  5CKT A;  5DD8 A;  2R92 J;  2DT5 A;  1HCR A;  2B7E A;  1VQ4 I;  3W6V A;  2BXY A;  2IP2 A;  5CVJ A;  3RTR A;  2K9N A;  2ZXI A;  4QTR A;  5M5X J;  1JGS A;  2DLL A;  2DTR A;  4LGW A;  4IQ4 A;  3DKW A;  3A0H C;  1MJB A;  4HQM A;  1LB2 A;  2Z9O A;  3CJQ B;  5HLT A;  1Y1V J;  3S16 J;  2MC3 A;  3U2R A;  3HHH A;  1YJ9 I;  1DU0 A;  3OY9 A;  3REO A;  3GTM J;  1SFU A;  2NNN A;  3PNV A;  3U1D A;  2BW3 B;  1KU3 A;  3CCJ I;  2EWN A;  5IY5 H;  4RAG A;  5E8I A;  5F1R A;  5E3N A;  2WWY A;  3O2P E;  2JMW A;  3KX2 A;  9ANT A;  2CJJ A;  1ZLK A;  2E1M C;  2E2I J;  3ABK H;  2CV1 A;  4HDU A;  2LLK A;  2XRL A;  1U5T C;  4J00 A;  3MFK A;  3K2Z A;  4IRG A;  2YR2 A;  3KEQ A;  4A3F J;  3BTC A;  2K9Q A;  4OWR B;  1JTY A;  4XLC A;  1W5C C;  3H3U A;  3LSM A;  1T39 A;  2KRH A;  2VJ5 A;  5GAD J;  3GVA A;  1X19 A;  1JE8 A;  1AA7 A;  2F5E A;  1Z05 A;  1Y0N A;  3TOB A;  2QBY B;  4M6V A;  3WTW C;  2K4B A;  3GTL J;  4CGZ A;  3CO6 C;  2V7F A;  1B72 A;  2JA8 J;  3JRC A;  3BTI A;  3KYL A;  5IOZ A;  3DU5 A;  2CFO A;  1IXC A;  4WK8 F;  2KL4 A;  5FRN A;  1S7A A;  1G3T A;  1J5Y A;  2OA4 A;  2CV0 A;  4HF2 A;  2QSF X;  3RKX A;  4A3C J;  2FEZ A;  4IO9 F;  1MGT A;  2FBH A;  3PSI A;  3L2C A;  4EVI A;  2RQP A;  3CUQ A;  3HOV J;  2VBZ A;  2XPV A;  2RC4 A;  3ZMD A;  1QPI A;  2EPF A;  4KYW A;  2LF7 A;  3S3N A;  3OOP A;  4RS8 A;  2ZJP F;  2E1C A;  4RGX A;  2A05 A;  3IRQ A;  1RUN A;  4TV7 A;  4LOC A;  1SAU A;  5DUK A;  2K40 A;  2V1X A;  3HGG A;  3L9F A;  5TJJ A;  2H1K A;  2X9D A;  4KT6 A;  3PUF A;  3KP4 A;  3CCQ I;  3H92 A;  5EDN A;  2JA5 J;  1Y8Q B;  1YO5 C;  2LF8 A;  2KDZ A;  1OKR A;  4KMF A;  1ZGW A;  2IPQ X;  1VQM I;  2H8R A;  5FFX A;  3CCR I;  4IHV A;  2ISZ A;  2EIJ H;  2XRN A;  3M4O J;  4QSH A;  2K85 A;  1G6N A;  1XGN A;  2WY7 Q;  3OYI A;  1U8R A;  2LR8 A;  3G2B A;  4EM1 A;  4BYY A;  2PMZ A;  2EFW A;  2ZC2 A;  1IXR C;  3E5U A;  1DPR A;  2P0W A;  3WHB A;  4OU0 A;  4HV5 A;  1J2X A;  2X0L A;  3H5R A;  2LYC A;  2O8X A;  5HNH A;  1R36 A;  2MSY A;  2BW3 A;  4IHW A;  1JJ8 C;  3SJM A;  1Q1V A;  1FBQ A;  2CUF A;  3AFH A;  2X6Y A;  4CZZ A;  4ZYD A;  1YYV A;  3SZG A;  3EUA A;  4KIB A;  2R0Q C;  2XRO A;  2E1M B;  4GGG A;  1ZLJ A;  3R60 A;  4UNO A;  1U5T B;  1X3Z B;  2AQF A;  2L7Z A;  2HPI A;  3P5J A;  4UUV A;  1A6I A;  2XIG A;  2R7Q A;  3VDX A;  3K70 D;  4I02 A;  4LB6 B;  5D4S A;  1G8X A;  2QYO A;  2W57 A;  1YI2 I;  1XMX A;  5CYV A;  2FBI A;  4W97 A;  4RA2 A;  5ICE A;  1SEU A;  3OIQ A;  3FKJ A;  3J80 Z;  1MW7 A;  3RI4 A;  3O8H A;  2JQ7 A;  1BJZ A;  3KLN A;  3BDD A;  4XKV A;  2OCC H;  2M4G A;  4WXC A;  3GTO J;  2GZW A;  2YX7 A;  2QBY A;  4XSZ F;  3GLX A;  1R5G A;  3BR1 A;  5FD5 A;  3RYR A;  2EIM H;  4S05 A;  1KQ0 A;  5CQE A;  1QPM A;  4FT8 A;  4GXO A;  2JT1 A;  3K10 A;  4BY7 J;  2KIF A;  3HEF A;  5FJ8 J;  4WCG A;  3CCV I;  3JRI A;  1IW7 F;  1Z7L A;  2CH0 A;  2WAQ N;  2WAF A;  3SDG A;  5F1J A;  3V8K A;  2HQR A;  1ZYR F;  2E7W A;  2YS9 A;  2YPR A;  2Y9Z A;  4KJZ A;  3H1C A;  1T95 A;  3DPU A;  5CVV A;  1ULY A;  5FO5 A;  2GA1 A;  1WH7 A;  5DTD A;  1VFC A;  2DO7 A;  2HI3 A;  1V54 H;  3QU3 A;  1XSV A;  4GRI A;  1GUU A;  2ELH A;  4EM0 B;  1D0Z A;  4IJA A;  2ECB A;  3IH2 A;  1RET A;  3FMS A;  4EJU A;  3TW6 A;  2OU2 A;  2B9S A;  3X2Q H;  2ZJQ F;  4I7H A;  1YS6 A;  2AXT C;  4OOI A;  1ZG5 A;  1WJD A;  1MBH A;  4QPO A;  2EV5 A;  2COB A;  1MD0 A;  5D5V B;  4CDG A;  5E1X A;  4XRS A;  3RQI A;  1ZRC A;  5CJ9 A;  1WI3 A;  2X6O A;  4EQQ A;  5GPC A;  2VXZ A;  1IN6 A;  3JW4 A;  1T0F C;  2HQ5 A;  2I8D A;  1PYV A;  3MZY A;  3RQ4 A;  1MMD A;  4HX8 A;  4L5J A;  2A5W A;  1BI2 A;  4CA0 A;  3BCB A;  4IVN A;  2XSD C;  1JI8 A;  4RAZ A;  4OIN F;  1UB9 A;  1MJ9 A;  4D5F A;  1X3W B;  3S8P A;  2BGC A;  3TDZ C;  2KMU A;  1RC9 A;  1IG7 A;  3R0J A;  1O3Q A;  1BBY A;  4C3H J;  2NVY J;  5JVT A;  1W36 D;  2J5P A;  1NTC A;  4E70 A;  2X51 A;  2F5F A;  4I6Z A;  4E7L A;  2KIS A;  1XSX A;  1JJ6 C;  1U5T A;  2OCE A;  4RGU A;  5L3B A;  2WC2 A;  2V4J C;  1W7P B;  3LQR A;  3C2B A;  3NQO A;  3MMY B;  2VT2 A;  3CLO A;  2DQR A;  3N4M A;  4XLP F;  2FF4 A;  5HDG A;  4WXD A;  1FYL A;  3FXO A;  2K9L A;  5HS7 A;  4GFB A;  5DS9 A;  4L0Y B;  3S1N J;  5HNF A;  3CCU I;  2ZNY A;  2FD5 A;  2KIU A;  1B8I B;  4XNF A;  4XMY A;  1QRY A;  1YW7 A;  2GIZ A;  3QOP A;  1Z3Y A;  5J4V A;  1JUM A;  3TDU C;  2V79 A;  4IL6 C;  4Y52 J;  4HW0 A;  5H6Q A;  1G3Y A;  1P4X A;  1AHD P;  3S2H J;  1S5L C;  4H0E A;  2RGV A;  2AO9 A;  1VQK I;  2DTZ A;  1K7A A;  3HSE A;  2W24 A;  3S1Q J;  3C18 A;  4A0Z A;  3GZ5 A;  1BR4 A;  2FNA A;  3GTG J;  3UNG C;  2CG4 A;  5IP6 A;  1EA3 A;  3BR0 A;  4ZH4 F;  3G4S I;  3Q5F A;  1QZZ A;  1B9N A;  3ZP5 A;  5TIS C;  2O3F A;  3FXL A;  3IUO A;  2WA0 A;  1FIA A;  4I09 A;  1X4P A;  2DMQ A;  2V6C A;  3LSG A;  4I0B A;  4G8X A;  4PUS A;  3AG2 H;  2ZME C;  2EFP A;  3MN2 A;  3RZO J;  2OF7 A;  4E7Z A;  4YIR X;  1X58 A;  2BZT A;  1RKW A;  2M34 A;  3E1S A;  2MG4 A;  1A36 A;  1MZB A;  3BG7 A;  4D0P A;  4KIG A;  2DK5 A;  1BI3 A;  1Z1D A;  2CWE A;  1IC8 A;  2A6T A;  3PL8 A;  3ZOB A;  3MZ8 A;  1MDM B;  3KPH A;  5LEK A;  4KNY A;  3F3X A;  1WJA A;  3NAU A;  2HU9 A;  1R4M B;  3OYF A;  3ZMU A;  5HLG A;  1PJR A;  3HBL A;  3BZK A;  4ZTF A;  5BPI A;  4EGZ A;  3KEO A;  2VKV A;  1WKM A;  1FP2 A;  1TWG J;  4EM2 A;  1IN7 A;  4Z2Y A;  4I98 B;  2FQ4 A;  2P5V A;  2L7K A;  2DA4 A;  5J1Y A;  1FOK A;  5EF6 A;  2P8T A;  1VQ6 I;  4NUB A;  3TKY A;  3Q0U A;  1SFO J;  2DA7 A;  3DEW A;  4N4O B;  4QIW N;  2W1O A;  5E8G A;  3RCO A;  1SAX A;  4XRS G;  1ACI A;  3CJN A;  1SD4 A;  2DI3 A;  2MAB A;  1TC3 C;  2RKH A;  3NEU A;  3CDI A;  3TBI A;  3CCY A;  2VAS A;  5E3L A;  2LC2 A;  1HA8 A;  2W7N A;  1VZ0 A;  3I5U A;  5IP7 J;  4XOP A;  4FTH A;  1SMT A;  3JCU C;  3BTL A;  1YE9 A;  1IF1 A;  4XLF A;  3DTK A;  3TP3 A;  2IAI A;  3LNQ A;  1W7P A;  1MBF A;  2LBF B;  3OYM A;  4A3K J;  4F92 B;  2X4H A;  4LLL A;  2FMY A;  2KHM A;  2EFN A;  4IOC F;  4X1E A;  5KVR A;  2QQ8 A;  2HGC A;  4MHG A;  2HS5 A;  3EUH C;  3HSF A;  3BJO A;  1B8I A;  2IJL A;  1J9I A;  5DV5 A;  4NC8 A;  2E35 A;  2K7L A;  3BG5 A;  3S2W A;  2DQL A;  3FF5 A;  3HOW J;  1S3J A;  1E17 A;  1VTN C;  2KKO A;  5CVR A;  3DLA A;  3FXU A;  1YOV B;  2RQQ A;  4MTD A;  5A2Q Z;  4XON A;  3BP8 A;  3L7W A;  5ILV A;  1QZY A;  3ZQG A;  4IRI A;  4A0X A;  4ZZL A;  1WFX A;  3L2R A;  4G7O F;  1USS A;  1S8N A;  3T8T A;  2HTS A;  1FMW A;  3R6S A;  3ZQ7 A;  2HNH A;  4RAF A;  2RVC A;  4M74 A;  4EMS A;  5BOX A;  1WVR A;  3M07 A;  4AIK A;  2LMD A;  2L3D A;  5GAG J;  2OQG A;  2XF6 A;  1ZAR A;  2A61 A;  1ZN2 A;  2V1D A;  4CCN A;  4B47 A;  1EH8 A;  4YII A;  1R5I D;  1SFE A;  1LDD A;  1W7P D;  3U21 A;  3OYA A;  4A3I J;  3SDB A;  1QQI A;  4EJT A;  1WGX A;  3IC7 A;  5J40 A;  5HLH A;  1IJW C;  2V6E A;  1R23 A;  3DP7 A;  1W0U A;  4XBF A;  3F23 A;  2O61 A;  1P7J A;  5JVG F;  1G3W A;  4ZJZ A;  2DBB A;  4RM2 A;  1W0T A;  1VQ5 I;  4KN7 X;  4E6K G;  2QSH X;  2P4W A;  1IGN A;  1MSF C;  1I6H J;  3CUQ C;  1TW3 A;  3FM5 A;  1FNN A;  4UVB A;  1LJ9 A;  2JPC A;  3G1O A;  4XLH A;  2A69 F;  3OR2 C;  4DGW B;  1P92 A;  4EEF G;  1XS9 A;  2JTV A;  3PNY A;  1RPW A;  3WTS C;  4HX4 A;  3RJP A;  4ZYG A;  2MFZ A;  3K70 C;  3E97 A;  1M1E B;  1V3F A;  3HZJ A;  4HST A;  1AWC A;  2QF7 A;  1YJN I;  4HYE A;  1U6G A;  3BQY A;  1A31 A;  2GOX B;  3CDL A;  3FXM A;  4HPQ A;  2OC6 A;  2HYF A;  4JX6 A;  1K83 J;  3DQV C;  1RNL A;  3KFW X;  3SQN A;  2DT7 B;  1KU9 A;  3J7Z I;  5E79 C;  5LHI A;  2H8W A;  5M5Y J;  2LK2 A;  3WGI A;  1MMS A;  2OZ6 A;  1X1B A;  5JR3 A;  4D9J A;  1S29 A;  2KDO A;  3HKZ N;  2LBF A;  3ZMT A;  2K3P A;  4BDZ A;  4HNT A;  3V42 A;  3HXL A;  1SD5 A;  2ACJ A;  1JKR C;  1ZRD A;  4BBS J;  1A04 A;  4B3X A;  5FRO A;  2FA5 A;  1XG1 A;  2GXB A;  2DA1 A;  1SAN A;  2KQR A;  3CCS I;  3W2W A;  3ECO A;  4RBO A;  1KU2 A;  1WJF A;  4XSX F;  1OR7 A;  5LHG A;  1V5F A;  2VUM J;  3S17 J;  2VXD A;  1TNT A;  1XGO A;  2EFQ A;  2PQ8 A;  2R93 J;  3FXR A;  4RM3 A;  2ZFW A;  1Y39 A;  2NS0 A;  1JTX A;  2XPU A;  1K6Y A;  3OS2 A;  5IPA A;  5J1U A;  4BJ5 C;  3JSO A;  4K2E A;  3PJR A;  1D8K A;  2ECC A;  1A5J A;  4YFX F;  3CF2 A;  3LFU A;  3LSP A;  4CCL A;  5ICF A;  1XCB A;  3CJR B;  2BY1 A;  2XDV A;  4U7D A;  2XAF A;  3OYB A;  2PLY A;  2D5V A;  2COM A;  3GEZ A;  5F6F A;  4UUS B;  1IO2 A;  1BOA A;  2RAE A;  4ENM A;  2BY3 A;  3L1P A;  3S1R J;  2K5C A;  1E2X A;  1ORK A;  3OYK A;  3E6M A;  4R79 A;  3CME I;  3Q9V A;  2UXN A;  4D7M A;  1J75 A;  1TL8 A;  1W36 C;  5F0C A;  5E20 A;  1R1V A;  4KDP A;  2P6T A;  3HJE A;  3BTJ A;  1O57 A;  3I4N J;  4BQN A;  3BR5 A;  3ABM H;  1IN4 A;  2L9V A;  2TCT A;  2IBD A;  4XLE A;  1XX5 A;  2F4I A;  1R49 A;  4PSX A;  1BW5 A;  1T56 A;  1D3Y A;  2E1O A;  2CFX A;  2EA4 A;  5DCM B;  3TW7 A;  5F27 A;  3A2K A;  3QP6 A;  2ID3 A;  5FFZ A;  4IHX A;  2ESH A;  1GV2 A;  3MKL A;  3CMA I;  3D5R C;  3GZ6 A;  5L3E A;  4EJV A;  1UEL B;  1IAW A;  1GVJ A;  1PVE A;  3N97 A;  1WJ5 A;  4C2U A;  4C2M J;  1P9Q C;  3BC8 A;  2X6X A;  1QA6 A;  3GLL A;  2R7S A;  4NC7 A;  3VPR A;  1HOM A;  3ZQQ A;  2XB0 X;  5HS9 A;  1FTT A;  2FBK A;  1ERD A;  1ZAO A;  4CYC B;  5FLV A;  4KIC A;  3G6E I;  3G3Z A;  1MIJ A;  4LB5 A;  1FMV A;  3EUH A;  4C9Y A;  3ZCO A;  3MAJ A;  3CUO A;  1GT0 C;  1LKX A;  1IV8 A;  1CQT A;  3TO6 A;  4WX9 A;  1N25 A;  5DDG A;  4YIF A;  4YG2 F;  2LTP A;  4E7K A;  1YX5 A;  2CQN A;  4ENJ A;  2JSP A;  4LLN A;  1V55 H;  1D0Y A;  1MBG A;  1JUS A;  1R4N B;  1JHH A;  4CHU A;  3AL0 C;  3HOX J;  4C3J J;  4GDF A;  2Y0S N;  1NK3 P;  2NVQ J;  1XN7 A;  3I56 I;  1LDK B;  5HLI A;  1MNM C;  4X0G A;  1BI0 A;  2MLG A;  3R61 A;  4IHS A;  3C3W A;  2YU3 A;  4HSR A;  2DOF A;  2GXG A;  1IXS B;  3GZN B;  2IS2 A;  2CV2 A;  3UR3 C;  2V1U A;  1WJE A;  4HG2 A;  3OS0 A;  2HFH A;  5EZG A;  4BDY A;  3LL7 A;  5TRD A;  2KZG A;  2HQN A;  1T38 A;  5KAI C;  1FOW A;  1NH3 A;  1YIJ I;  4HX7 A;  4DBR A;  3OR1 C;  2Z2S B;  4WXH A;  3E6C C;  3PO3 J;  2K3F A;  3ERM A;  2JZY A;  3R4K A;  4AYB N;  2R7U A;  4ZTJ A;  1UG0 A;  1ETK A;  2WAQ A;  3IAM 2;  1B6A A;  1YFH A;  1D5Y A;  1VND A;  1R71 A;  4UUS A;  4XOR A;  2K86 A;  4PFP A;  3LA3 A;  4A3E J;  1B9M A;  1MH3 A;  2KRF A;  2E2J J;  2QSG X;  4CYD A;  2O6G E;  3I4P A;  4U88 A;  3MD2 A;  3PIO F;  3MCZ A;  3SHF A;  3R0A A;  1AOY A;  3MKZ A;  4A6D A;  2D45 A;  3TED A;  3AG1 H;  1A35 A;  4EGY A;  5AIQ A;  3M1E A;  1ZTR A;  3QOE A;  1VF9 A;  1U2W A;  2HEO A;  2VC0 A;  3MQ0 A;  4HF0 A;  3CC4 I;  2LFB A;  2BV6 A;  4LLG F;  4DZP A;  1JKO C;  4ESJ A;  4MQV A;  4M9S A;  4D7N A;  1LEA A;  4V2G A;  1FZP B;  1HKS A;  3CO7 C;  2K4J A;  3LMM A;  1O7F A;  4BE0 A;  1X1D A;  2UUZ A;  5IYC J;  2VE8 A;  1RR8 C;  5DCM A;  1FEX A;  1HLV A;  6PAX A;  3KYC B;  2HKX A;  2NOG A;  2HKO A;  2E2H J;  1DGR M;  3ONQ A;  1X2M A;  2V9P A;  1YW9 A;  4L9T A;  3KP6 A;  4C30 A;  2P5L C;  1FBS A;  3OS1 A;  2OPT A;  4UV9 A;  4XK4 A;  1PP7 U;  3BPV A;  2ISY A;  1WJC A;  2DOA A;  1P4W A;  2G9W A;  1JKQ C;  1HXD A;  5F0F A;  2UXX A;  3Q0W A;  4C3I J;  3JRG A;  4I99 C;  3PQJ A;  3F9K A;  2NXN B;  2BHZ A;  3ISP A;  4M72 A;  2KFD A;  1J09 A;  1B59 A;  5IYD J;  2XSJ C;  1LE8 B;  2XGE A;  4QLC U;  2HR3 A;  2LG4 A;  1ITY A;  1Z0X A;  3CF5 F;  2TDX A;  2QA4 I;  2EBI A;  2KIQ A;  3NAR A;  3VYR B;  1TWA J;  1HQC A;  4DIQ A;  1VQP I;  3HOU J;  4BXF A;  3AL0 B;  2XKP A;  3AG3 H;  2H6B A;  3L2U A;  2AS5 F;  2LRE A;  3IP4 B;  2R7Z J;  1XB4 A;  3L09 A;  3QQA A;  3S1M J;  2DN0 A;  3BZ6 A;  4B4C A;  2H6C A;  2FNP A;  2Y75 A;  4S04 A;  2QQA A;  3L2Q A;  3H9Q A;  3V7R A;  4ESB A;  4BJT A;  2F48 A;  1MND A;  3WGG A;  4WF2 A;  1WWX A;  4Y33 A;  5FGM A;  5LLQ A;  1MKM A;  2WAE A;  3RKW A;  1IN5 A;  3FX3 A;  3JTH A;  4YEL A;  1Z9C A;  1B4A A;  3EYY A;  4B09 A;  1KQ9 A;  2ID6 A;  3DFG A;  1UAA A;  1D8J A;  3F8C A;  2L7M P;  1QO0 D;  2O03 A;  2VL8 A;  4PJN A;  2DA6 A;  3QYF A;  5K5O A;  3KYD B;  2EZL A;  1X1A A;  5F64 A;  2XHK A;  3HRU A;  5D5X B;  3FM3 A;  4CIC A;  3WTT C;  1U9N A;  3JRA A;  4G12 A;  1HDD C;  3VFZ A;  3HUG B;  2R7O A;  3M8F A;  3ZQH A;  3BT9 A;  4DZJ A;  5GAE J;  3ZMS A;  4M3B A;  1ETO A;  1K4T A;  2OQR A;  2XPW A;  4WWC A;  1FIP A;  2MD5 A;  1K78 B;  5IYB J;  1ZK8 A;  1C0W A;  3GW2 A;  2P7V B;  2M2E A;  3KZI C;  4EAT A;  2MBF A;  4DQ2 A;  4W1U A;  2A5Y B;  3DCF A;  1XC5 A;  1HC8 A;  1O4X A;  2EFO A;  3EYI A;  3JAM K;  2FX0 A;  4GYI A;  2DMP A;  2XF7 A;  2R5Z B;  1HDP A;  1G2H A;  3PQK A;  2R7W A;  1R9T J;  1HW2 A;  4G6D A;  2M1B A;  5CVU A;  3ABU A;  1H9G A;  3W2A A;  1NG7 A;  1FOX A;  1MBK A;  3GTP J;  4M3F A;  1X2N A;  3CMM A;  3CC2 I;  2KJC A;  5EYR A;  2NVX J;  3OYL A;  1SFK A;  2A68 F;  1H0M A;  1OCT C;  1NHA A;  2VQH A;  5M3M J;  3Q3S A;  4FAS D;  3CCE I;  2AHQ A;  3ZXS A;  1MBJ A;  1LE8 A;  3A1Y A;  4ESF A;  2FJ1 A;  1X1P A;  4JOM A;  1HSJ A;  2VBW A;  3ZN1 A;  3IWF A;  2WTE A;  4JX5 A;  4U0W A;  2IA2 A;  1KGS A;  1Z6R A;  3RKQ A;  5K1Y A;  4A5N A;  3LA2 A;  3DBH B;  2MW8 A;  5J1R A;  1UHS A;  2ZSH B;  3CTA A;  2PJP A;  3OMY A;  3HRS A;  3F21 A;  1XTA A;  1QNT A;  4R8H A;  4JBA A;  4P1W A;  4BEH B;  2LOO A;  4ZYE A;  5FKN A;  4Y15 A;  3CES A;  1U78 A;  2VI6 A;  3HC7 A;  1FY7 A;  2EQR A;  2GXA A;  3JRD A;  4L0Z B;  3PFI A;  3GFL A;  1IN8 A;  2B0L A;  5J4Y A;  1QVT A;  4Y13 A;  3GYH X;  2CQ7 A;  5HDN A;  2DYS H;  1R5H A;  2RV8 A;  5F08 A;  2IXS A;  3M7G A;  1LDJ A;  2R7V A;  3FIS A;  1R1T A;  3K4N A;  1OR7 C;  2ZXJ A;  1X1C A;  1KYZ A;  4B48 A;  4P9F A;  3H3V K;  4O5V A;  4KT5 C;  1BW6 A;  1T6S A;  3ASO H;  4Z6Y A;  1BJA A;  3LQQ A;  4M3E A;  2FE3 A;  4OAZ A;  3BR2 A;  1ETQ A;  3HUG A;  4A3L J;  4CCM A;  5D8K B;  3K4C A;  1GDT A;  2VJ4 A;  2DJN A;  2JA6 J;  1W5S A;  4XM3 A;  3V8L A;  4G7H F;  2JSC A;  4AVP A;  1HW1 A;  3SEZ A;  1KQ8 A;  4OMZ A;  1HW5 A;  2HZD A;  1Q1H A;  4NC6 A;  1K78 A;  1TQP A;  1SMY F;  3Q0V A;  5AIP A;  3RPQ A;  1SFX A;  3BLY A;  1FT9 A;  2QKM B;  3GTK J;  4A0Y A;  5IT9 Z;  2BBY A;  2HXO A;  3K7A J;  3LSJ A;  1HST A;  5FKO A;  3FHN A;  1WHU A;  5J6X A;  2M30 A;  2Z33 A;  3PSF A;  1JT6 A;  1IDY A;  4N0B A;  1ETW A;  4A12 A;  4BAC A;  3DWL E;  1T8I A;  1OCO H;  3F22 A;  4NHJ A;  4A6E A;  2C6Y A;  3ELK A;  3H9J A;  4H4K C;  3G73 A;  5K7Z A;  2BHY A;  2L01 A;  2OJE D;  2PFB A;  1X3U A;  3DEU A;  3BQZ A;  3OIO A;  3ABL H;  5JHF A;  4PCQ A;  3OYJ A;  3K0L A;  1P2F A;  5EGO B;  1LFP A;  3DTI A;  4HEA 2;  2VT3 A;  4HAM A;  2DFF A;  4LG3 A;  4BAY A;  1XMK A;  4ASN A;  2ZBK A;  4BU2 A;  1OQY A;  5K7H A;  5EG0 B;  4M73 A;  1XGS A;  4PK4 A;  3E5Q A;  1ZR2 A;  2OZU A;  3KP5 A;  4QWQ A;  3I58 A;  2V26 A;  5LRS A;  4B3A A;  1IUF A;  1Y0U A;  2IGK A;  1ZEL A;  5L3G A;  2CUJ A;  4LMY A;  2R7D A;  3OV8 A;  2X1D A;  1K61 A;  3HKZ A;  2X1E A;  4DOZ A;  1BC7 C;  3W6K B;  1FC3 A;  3VYS B;  3RIR A;  2DFH A;  4L18 B;  2P6S A;  2L4M A;  3WTX C;  1PP8 F;  2FOK A;  5BS6 A;  2L54 A;  3QP5 A;  1RR7 A;  2MC4 A;  1OFC X;  5B1A H;  3OYE A;  1AU7 A;  1ETY A;  1YX3 A;  2WV1 A;  5CPR B;  2N8G A;  5E1W A;  1QZE A;  1AKH B;  1TWF J;  3QPS A;  3ERE D;  2R7X A;  1OYI A;  1TBX A;  3HB9 A;  2CRG A;  3KCC A;  5CVI A;  1IRX A;  5F04 A;  5DUI A;  1QGP A;  2PBI A;  4U87 A;  1UHM A;  2DDB A;  4BEH A;  3WE3 A;  1E3H A;  2L0K A;  2LDU A;  3QWL A;  4HZF A;  1IZ1 A;  3F72 A;  3G1M A;  3HPH A;  1A6Q A;  4JX4 A;  4F91 B;  2D1V A;  3D5S C;  1GXP A;  2OBP A;  4XL9 A;  3S3M A;  5LGU A;  3HL2 A;  3K1P A;  4PJJ A;  3ZRG A;  1GVD A;  4Y7N J;  1OMI A;  2Z16 A;  3SEQ A;  1DDN A;  2IRF G;  4UVA A;  1IRG A;  2IGM A;  3RSN A;  4PZJ A;  3T1B A;  5FRM A;  2IS6 A;  2QUF A;  1I3Q J;  1MSE C;  3ZQC A;  2WB1 N;  2CSO A;  3I64 A;  2YU9 J;  4RDU A;  3N05 A;  4BQA A;  5J3L A;  5KCM A;  2LY2 A;  4AVZ A;  4RB2 C;  1JXS A;  5KK1 A;  3C1D A;  4ANJ A;  3HDD A;  3BCA A;  3RYP A;  3OIP A;  1FOY A;  4P96 A;  1JT0 A;  1F5T A;  1H89 C;  3FXQ A;  5BPD A;  5LGN A;  3S3O A;  4L9V A;  4D5C A;  5LHH A;  1YHQ I;  2VBX A;  1LUJ B;  2CQQ A;  2CW7 A;  4II2 A;  4J19 A;  1Z77 A;  4HRI A;  1OCZ H;  4MEY F;  3RZD J;  4FQG A;  2WBM A;  1SD6 A;  2XUB A;  2ZJ2 A;  3L2W A;  1DU6 A;  2JRT A;  2E71 A;  4M6Y A;  2R4G A;  2ZXH A;  3IKV A;  3E6D A;  4QPQ A;  2A07 F;  2GLO A;  3NRV A;  4A69 C;  1MDM A;  1ETV A;  4C2T A;  2Q0O A;  3HM5 A;  2BOL A;  2E60 A;  5EEG A;  3J7A O;  2W84 A;  2IA1 A;  2E19 A;  1NK2 P;  5DYM A;  3M8J A;  3RPU A;  2XAH A;  4HNV A;  1XPX A;  1Z7U A;  5DM7 F;  3HG9 A;  1OLT A;  2LY9 A;  5EGO A;  1G3S A;  1T08 B;  2DOE A;  5IT9 K;  2LKX A;  3W6J B;  4B44 A;  3DPT A;  5BQT A;  3Q9S A;  4RLQ A;  2XGX A;  2E5Z A;  3IHU A;  2DCE A;  3BJ6 A;  1UST A;  3H35 A;  5H6R A;  1OPC A;  3B6A A;  1F43 A;  2FSW A;  1FPQ A;  3K4K A;  3HYI A;  4G6T B;  2PN6 A;  5EEH A;  3WTU C;  4KIT B;  2OUM A;  4L9N A;  4LK0 F;  4IEJ A;  1YS7 A;  2CQK A;  4DJA A;  1WJB A;  2H27 A;  2W00 A;  3HHG A;  1MBE A;  1PUE E;  3L00 A;  4MFD A;  2HVR A;  1AKH A;  4E7H A;  4PGG A;  5ILS A;  5LBQ A;  1HKQ A;  3DBR B;  1J59 A;  1TT0 A;  4UUT A;  5E3O A;  2ZNZ A;  5IT3 A;  5LGT A;  2VPR A;  3GFI A;  2XAS A;  3ULQ B;  2ZXW H;  1Z91 A;  3FK7 A;  3FWE A;  2L4A A;  2Y0S A;  1MJA A;  4AID A;  3DEE A;  2XKO A;  4ZC3 A;  2R3S A;  3K4J A;  2W48 A;  1VQO I;  1UHW A;  3H0D A;  5ED4 A;  4IPA A;  2A6E F;  4HDV A;  1EV7 A;  4XRM A;  3RPU D;  2HTJ A;  5J8C A;  1R58 A;  1POG A;  2LH9 A;  2HVS A;  4UB6 C;  3ZQI A;  5JLX A;  1I27 A;  2ESN A;  1ZH5 A;  2BYV E;  3HOS A;  4MIM A;  3CZ6 A;  2DXI A;  4JYK A;  2M45 A;  2VBY A;  3DLL F;  2KRC A;  4IZZ A;  5C4J J;  4YEJ A;  4NDL A;  1F1Z A;  2P5K A;  2YUS A;  1ZGJ A;  1BA5 A;  4AYB A;  1TLH B;  2PX9 A;  2Y30 A;  2JN6 A;  4UVC A;  3P7N A;  2NAZ A;  3E5X A;  4YFK F;  2BXZ A;  3VOE A;  2JWT A;  2J5O A;  5KHD A;  1G4D A;  4HQE A;  3MKY B;  2LNB A;  2F6C A;  2BY0 A;  2DA3 A;  1T98 A;  2R7F A;  2UWM A;  5GTH C;  3P9K A;  4B43 A;  3S14 J;  4E7J A;  1LVK A;  3ECH A;  3VYU B;  4KFC A;  4NNJ A;  1EH6 A;  2EA2 A;  4L5E A;  5FB2 A;  3KZY A;  3ZMV A;  3EPZ A;  1O3T A;  4BE2 A;  2VQC A;  1FP1 D;  5ERI A;  2VKE A;  3D5L A;  1IDZ A;  3JTG A;  2KLO A;  4I01 A;  1DQU A;  1GV5 A;  3K9T A;  4UB8 C;  4BHC A;  2OAZ A;  3AKZ A;  2CU7 A;  1LEB A;  1JGG A;  2MA3 A;  3QU6 A;  2Z3Y A;  5TGT A;  2JA7 J;  1OYW A;  1OJL A;  2Z5U A;  1O7L A;  5E3M A;  2KP6 A;  3LAP A;  2ZO4 A;  1EH7 A;  2HOS A;  3WU2 C;  2M7A A;  1J0R A;  3FIW A;  2KIM A;  1W4M A;  1SVM A;  1PDN C;  2RNG A;  4CSW A;  3G1L A;  4XLA A;  4UV8 A;  2CUE A;  2XAU A;  3MEX A;  3JRE A;  1ETX A;  4A3D J;  4RGR A;  4EV0 A;  2A6H F;  1APL C;  1VQ9 I;  3OYC A;  3BG3 A;  3SFI A;  3B73 A;  2X6W A;  5E1Z B;  2DYR H;  4CH7 A;  2OTJ I;  2GWR A;  3HOY J;  4G7Z F;  5B66 C;  2V9K A;  2ME0 A;  5ILU A;  1JHF A;  1RI7 A;  1SVL A;  3H5N A;  1B1B A;  2KJB A;  5E18 F;  2IT0 A;  3F8F A;  3TOA A;  1H88 C;  3KLO A;  2O5R A;  5KAF C;  3CJT B;  1D1C A;  3IL2 A;  1YTY A;  2MH9 A;  3FDY A;  1OYY A;  3GF2 A;  2M7B A;  3V7C A;  1YRN B;  4JQF A;  2WV0 A;  3SZT A;  4AIJ A;  3CD6 I;  3HRM A;  2D1H A;  1KU7 A;  4I76 A;  1EJ9 A;  3C2G A;  4ITV A;  3TGN A;  1WI9 A;  2JVG A;  1IRZ A;  2HDD A;  2STW A;  1LFU P;  4HA8 A;  3HTS B;  3FBN B;  1YLF A;  1FTZ A;  5J47 A;  3F6O A;  2PJR B;  4A3M J;  4EJO A;  2HOE A;  4Q47 A;  3OYG A;  2ZKZ A;  4OIQ F;  1WZ2 A;  2DFE A;  2IGN A;  3KIO A;  5L3F A;  1FBU A;  2VLA A;  4HV6 A;  3W2V A;  4BQO A;  1DUX C;  1R1U A;  2VN2 A;  4HLX A;  4ETS A;  4GCV A;  3OL4 A;  2HPM A;  4X6A J;  3WU0 A;  2EH3 A;  1S72 I;  1GHC A;  2L9S A;  2XAJ A;  5L3D A;  1IV6 A;  2CW8 A;  2HDW A;  3EUK L;  2G7U A;  3HPG A;  1GXQ A;  2ELJ A;  1KA8 A;  2GOM A;  2ELK A;  3LSI A;  4D1Q A;  2GBY A;  3S93 A;  1TNS A;  4HOB A;  3FKI J;  3LST A;  4FX4 A;  2MLK A;  3CLQ A;  3PFY A;  5GPA A;  4BGD A;  3KEY A;  3SYT A;  4BHP A;  4MEX F;  4LG0 B;  3GME A;  3I4M J;  1D0X A;  3HRT A;  4AUX A;  4ZDL A;  3JAM Z;  4HBL A;  2LP0 A;  4KMU X;  1V4R A;  4DYC A;  1S7O A;  3ZQL A;  2M9H A;  2JPB A;  1EKE A;  2ADU A;  2LKP A;  4BL0 B;  1LFB A;  3OYN A;  3CMY A;  4A3G J;  1LPQ A;  1P4A A;  4YRV A;  1IUY A;  1TP4 A;  3EET A;  1DP7 P;  2EZI A;  4O3M A;  3WG9 A;  3LA7 A;  3IV5 A;  3VSL A;  3LSH A;  3E3V A;  2TRT A;  3QAH A;  4F3Q A;  2XF5 A;  1UG2 A;  4P9U A;  3I55 I;  1Z21 A;  2MD0 A;  1O3R A;  2ETH A;  4BHB A;  1VI0 A;  2CGP A;  3WTZ A;  3M9A A;  1YW8 A;  4ZZD A;  1XDS A;  2HWV A;  1H8A C;  2P7C B;  2K9S A;  1MH4 A;  2H1L A;  2FRH A;  1DPU A;  4MNU A;  4IHT A;  4CXF A;  2RN7 A;  1RIO H;  2BY2 A;  4HNU A;  1Y56 A;  3J81 Z;  1OCP A;  1ZRF A;  2ZCW A;  3OL3 A;  3LFK A;  4CYC A;  3D0S A;  4ABZ A;  5K5R A;  1EF4 A;  3BRO A;  1Z67 A;  4FE4 A;  2M3A A;  3K6G A;  1G59 A;  1VQL I;  3HTU A;  2XVC A;  1KYW A;  2DK8 A;  2KPM A;  1ZQ3 P;  1RKT A;  1I5Z A;  2VJJ A;  4LIU A;  1YRN A;  3H3Z A;  4BE1 A;  4MFE A;  3WTY C;  2EIL H;  1BC8 C;  3OSG A;  3F8B A;  1TQI A;  4XN3 A;  1TWH J;  1D5V A;  2LSO A;  1QVU A;  2BVL A;  1REP C;  2R7T A;  1BN5 A;  5D6E A;  4BH9 A;  3GUD A;  3TL4 X;  3I54 A;  4MLO A;  2MGQ A;  2XGC A;  2EV0 A;  2PJR A;  1UFM A;  5D5W B;  2JRM A;  3QPH A;  4RB0 A;  5D4R A;  1Y8R B;  5C44 J;  2PMU A;  4DW6 A;  1WCM J;  1HF0 A;  3H9G A;  2Z1D A;  3LAJ A;  2HYJ A;  4BBR J;  1ONV A;  1OCC H;  4U7B A;  2ZB9 A;  3JRH A;  2M0C A;  4CCO A;  2QQB A;  3G71 I;  1I39 A;  4F7Z A;  2UZK A;  4P5O A;  3RDI A;  3AG4 H;  3K4L A;  3GXO A;  1E3P A;  2K9M A;  3T0Y A;  2O8K A;  3VB2 A;  2VE9 A;  4E7I A;  3S2D J;  1TTY A;  3QPT A;  1MMA A;  2FML A;  4LG0 A;  4GO1 A;  5B5E C;  5BNG A;  5FD6 A;  2L2O A;  3BG6 A;  2IS1 A;  3PO2 J;  3OYD A;  2W85 A;  2HZT A;  2X85 A;  1XD7 A;  2BVM A;  2WAD A;  1N78 A;  1HKT A;  1HBX G;  3HSR A;  1I1S A;  3FK6 A;  5HOD A;  3D1N I;  4UHT A;  3ML6 A;  2VB6 A;  3HOZ J;  2Z99 A;  1BL0 A;  1WSU A;  2E36 A;  3WG7 H;  3DXJ F;  3M1C A;  3B6C A;  4CUG A;  2W82 A;  4IXA A;  4MQ9 F;  3BG9 A;  4NQW B;  2NS8 A;  5F0H A;  1E0E A;  3CC7 I;  4E7S A;  4ZDP A;  1JKP C;  3ESW B;  5GTI C;  3M3Y J;  2L5Q A;  1UZC A;  4BS9 A;  1YIT I;  4LIV A;  2QWW A;  1K4S A;  2W4S A;  1OCR H;  4IHY A;  5L3C A;  2EB7 A;  3DTE A;  4OIR F;  2JUG A;  5CQG A;  4ZDO A;  2OV7 A;  4ZYH A;  3E6B A;  3S32 A;  1U3E M;  2VQG A;  2DJI A;  1RRJ A;  2Y2Z A;  4U0Y A;  3I59 B;  2H09 A;  3B02 A;  1BR1 A;  1TT5 B;  3LOC A;  2O7O A;  4MTE A;  2YSR A;  1DP3 A;  2OD5 A;  3ABT A;  3V7S A;  1ZG1 A;  4PGH A;  4KA4 A;  2GAU A;  3WE2 A;  1P7I A;  3MVP A;  4AD9 A;  2F5D A;  2QM3 A;  1L0O C;  2HQA A;  1Y6I A;  1S9H A;  2EK5 A;  2IVM A;  4I0A A;  3V8J A;  3KZZ A;  4II3 A;  4FHT A;  1W1W E;  3W3C A;  2Y9Y A;  4PSW A;  4XOT A;  1F36 A;  1XSD A;  1X4O A;  3ASN H;  3F8N A;  2EJR A;  5GAH J;  2D2W A;  2BEO A;  3E0J B;  1XCV A;  2YX4 A;  4L5I A;  4RB3 C;  3J81 K;  3DF8 A;  5ICC A;  3A4C A;  1T2K A;  2BE5 F;  4PDK A;  1XDU A;  3P9I A;  1N75 A;  3AAF A;  4FIS A;  3WTV C;  4IKF A;  1XMA A;  2IS4 A;  2QLZ A;  5HVQ C;  4F93 B;  4RLF A;  4OIP F;  2NOJ B;  1I50 J;  2G0E A;  4MO7 A;  4F52 A;  2VIX A;  3CP8 A;  3GWZ A;  3BZC A;  5IOY A;  4M9X A;  2PMZ N;  2WB1 A;  2Y0M A;  4I2O A;  2VKD A;  4M3G A;  4P55 A;  4MGR A;  2ZSI B;  3K4M A;  2DMN A;  1K6O A;  3BJA A;  3H5A A;  1BOB A;  1QU3 A;  4M71 A;  1D1B A;  3QOD A;  2R7R A;  3OOU A;  3U9G A;  3IRR A;  2Q8K A;  1Z3X A;  4IRH A;  4XKW A;  5JI6 A;  3KP7 A;  2QVO A;  2DOD A;  4G94 A;  4A5M A;  5EZH A;  2EZH A;  4EJW A;  2NRA C;  2Y31 A;  3P9C A;  2RDP A;  4RAY A;  1FSH A;  4LK1 F;  3SFZ A;  1SVO A;  4N9I A;  5IP9 J;  4IOA F;  3EDP A;  3I71 A;  2LD5 A;  1U9O A;  2DT6 A;  4XQF A;  2CW0 F;  2E7X A;  3ZMZ A;  1V5G A;  4BKX A;  4NBQ A;  5D8L B;  2QCO A;  2K02 A;  4FET A;  4A3J J;  2VPL A;  3FZV A;  1TWC J;  4IQJ A;  3ZN0 A;  3FMR A;  3H0G J;  3A02 A;  3L2V A;  5FKM A;  1ENH A;  3GX4 X;  3GCM A;  1WQ2 A;  5LD2 C;  5HS8 A;  4FX0 A;  3TQN A;  4NQW A;  4V19 K;  4KIF A;  2EIN H;  1Z6T A;  2V1N A;  3ROU A;  3QYB A;  4AM3 A;  3C2H A;  4IF4 A;  5DEQ A;  2XV4 S;  1WPK A;  2NVU B;  1QHG A;  1BIB A;  3J80 K;  2R5Z A;  2DFI A;  3F8M A;  1VQ8 I;  1STZ A;  2XGD A;  2XC7 A;  4OIO F;  1WRJ A;  4LFU A;  3O3K A;  4G9Y A;  3LSR A;  1ON2 A;  1O3S A;  2RNJ A;  3O6B B;  3FBI B;  4GYG A;  2FXA A;  1S7E A;  1UMQ A;  4XLN F;  3JRF A;  4XIC A;  4UY8 I;  3J7A Y;  4UXN A;  1JUP A;  2EIK H;  3GO5 A;  3QRF F;  3IAS 2;  3I59 A;  4XKC A;  4KIS A;  4DYQ A;  3F0C A;  4B8X A;  2L7F P;  3A01 B;  3CCM I;  2JJ7 A;  4F55 A;  3VEP A;  3TP0 A;  2R5Y B;  1IRF A;  5C4X J;  4FCY A;  5HOO A;  3PNT A;  2B63 J;  2MYS A;  4NB5 A;  1YQA A;  2IW5 A;  4KUM A;  4XRF A;  3DV8 A;  2XAG A;  1RZ4 A;  4ENK A;  1FJL A;  2CO5 A;  4YFN F;  2VOP A;  1T33 A;  1PUF B;  3OSF A;  3DKY A;  4BY1 J;  2FQ3 A;  2PMH A;  2QEX I;  3CCL I;  3ZPL A;  2QQ9 A;  3VOD A;  3I53 A;  1LQ1 A;  5FLX Z;  1FSE A;  2PI0 A;  4AC0 A;  2L02 A;  3E7L A;  3JR9 A;  2PG4 A;  2F4O B;  3CP2 A;  1BI1 A;  3PUB A;  2LRD A;  2E34 A;  3I3L A;  3U1K A;  4S0H B;  4BUP A;  4CCK A;  2VC1 A;  3ZR8 X;  4DYR A;  4HF1 A;  2M8E A;  3BR6 A;  1DGW Y;  2M0M A;  1R7J A;  4FE7 A;  2P81 A;  1U0J A;  2V9V A;  2AXL A;  2K27 A;  3VYT B;  1FLI A;  2VKH A;  4LIT A;  1V5E A;  4RB1 A;  2CUZ A;  3NWS A;  1F9N A;  5FKK A;  4RMN A;  4JK1 X;  2DPD A;  1OIS A;  4BJ6 C;  4A3B J;  2M5W A;  3TO7 A;  1SC7 A;  4Q5S F;  2X1C A;  2CQX A;  3I0T A;  3IH4 A;  2F5C A;  3BR3 A;  2JA2 A;  3NWT A;  1CF7 B;  4Y4R A;  3IKT A;  4O6J A;  1BIA A;  1N77 A;  1YG2 A;  3ZGK A;  2DA5 A;  2XAQ A;  2HXI A;  2LY1 A;  1MMN A;  2DW4 A;  3QPL A;  4B1R A;  4DBQ A;  1RUO A;  3MWM A;  2L9R A;  4U0V A;  4XN0 A;  3C7J A;  5B1B H;  1W5T A;  4G6Q A;  3LSK A;  4A2U A;  2CS3 A;  5H20 A;  5CLS A;  1I1G A;  1SD7 A;  2I5U A;  1H9T A;  5FLM J;  4DNC A;  3K69 A;  3TO9 A;  2UV1 A;  2ZME B;  2IGO A;  5EEA A;  3OWT A;  3WU1 B;  1YJW I;  4PJ0 C;  3CQZ J;  5E17 F;  5GP9 A;  1R22 A;  1R6R A;  2W25 A;  2F5V A;  1U8B A;  3LWF A;  5D5U B;  1R00 A;  4Y17 A;  3A01 A;  5B3S H;  2R5Y A;  5EG0 A;  1FYM A;  1ZRE A;  1BM9 A;  1KON A;  3JSP A;  1VQN I;  4BXX J;  5HDK A;  2JK3 A;  2NYX A;  3ZQF A;  4XID A;  3HIF A;  5K5Q A;  1ZKG A;  2GQQ A;  2FUG 2;  4RGS A;  4HLY A;  2QKL B;  2CYY A;  2M8G X;  1CGP A;  1XGM A;  3A0B C;  5JHU A;  1PUF A;  3HGY A;  4BQQ A;  5KNL A;  1GLN A;  5M3F J;  2DDA A;  1ZGA A;  4L9J A;  4IX7 A;  4Q4Z F;  3FHZ A;  2E5N A;  1T0F A;  2G7H A;  4ZYA A;  3KP3 A;  4CO8 A;  1ON1 A;  1UJ8 A;  4JP0 A;  4V2F A;  2VOO A;  2CMP A;  2Q2E B;  2FOW A;  2I10 A;  2QEN A;  2EZK A;  5DD4 A;  2VQL A;  2DAO A;  2X48 A;  1E3O C;  2M87 A;  2PEX A;  4AIH A;  3KP2 A;  3HOT A;  1BR2 A;  3BWG A;  5D6F A; 
#chains in the Genus database with same CATH homology
 1OQY A;  2QSG X;  2QSH X;  2F4O B;  2F4M B;  3ESW B;  1QZE A;  4YIR X;  2QSF X;  1TP4 A;  1PVE A;  1X3Z B;  1X3W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...