2ZXJA

Crystal structure of yycf dna-binding domain from staphylococcus aureus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
NEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein walR
publication title Novel Antibiotics Target Protein of Gram-positive Pathogens: X-ray Crystal Structures and Search of Potential Drug-Binding Sites
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 31
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zxjA00
3P9CA 3GUDA 1JGSA 2ACJA 4EV0A 3GWZA 1U8RA 3FM5A 2XAJA 4HAMA 1XGSA 3R60A 2FBHA 3E97A 3KE2A 1REPC 5FLXK 1R5GA 3DQVC 3ZQ7A 3R0JA 1Z91A 3HOSA 3EQLF 2OQGA 3KETA 2IT0A 1UCRA 3QAHA 4PZJA 4G8XA 1YLFA 2GWRA 3FMRA 4Y17A 2F5CA 1I6XA 4IJAA 2UWMA 2E1NA 1KU3A 3F8NA 3RKXA 2MA3A 5HDKA 1BC7C 4P5OA 1STZA 1W5SA 3HRSA 2QQBA 1V4RA 3BDDA 2FMLA 4KMUX 2O3FA 4JQFA 5L3FA 2L4AA 1SMYF 4RS8A 2M8EA 1GHCA 2QQ9A 2A69F 3KZYA 3F8FA 3R4KA 3WTSC 1OYWA 1KGSA 3MEXA 4WXHA 4KIFA 4HOBA 2IRFG 4ZZDA 3DF8A 2A6HF 4QLCU 3W6KB 1IN8A 2IP2A 4ZZLA 4IHSA 2L3DA 2FQ3A 2KJBA 2EFWA 1SMTA 3E5QA 4ENJA 4N9IA 3SZPA 3FHZA 2CYYA 1BC8C 3FZVA 5F64A 2MC3A 1U5TA 1ZREA 3J7AO 4EMSA 4N0BA 2P4WA 2Q2EA 5HOOA 3F8CA 4WK8F 2BBYA 2HYGD 1O3RA 2BEOA 3T1BA 5E8GA 1G3WA 2UXNA 1L0OC 1Z6RA 2E7WA 1KQ8A 3JAMZ 2PQ8A 3LWFA 2EFNA 3K1MA 2D1HA 1XN7A 2JRTA 1IZ1A 2DLLA 5LRRA 4YIFA 4EVIA 2FE3A 3WTZA 2O61A 1J2XA 1HKSA 5E1ZB 1HQCA 5LGNA 4P96A 4M9XA 3C7JA 3CO6C 3HTSB 4EGYA 4EM2A 1E2XA 4KUMA 1C0WA 5HLIA 2L01A 3ULQB 4I7HA 1YW7A 5H20A 3MWMA 4CO8A 1HKTA 1QZZA 4AIJA 1K7AA 2JZYA 2PLYA 4A5MA 1ZHFA 3GZ6A 3ML6A 4OMZA 1XSVA 1ON2A 5E1WA 2VOOA 4IRGA 3MZHA 3RI4A 1LQ1A 3KLNA 1PP7U 2EJRA 2M1BA 2JSCA 1QNTA 1FYLA 4G9YA 5FD5A 3LA7A 2FNPA 2FXAA 4GO1A 1JHFA 3HRUA 1EH7A 1F4KA 5DV5A 4OU0A 2HYFA 4PGHA 4HF1A 2PN6A 4XRFA 3T8RA 1PP8F 2OZ6A 2Z33A 5LGUA 3F3XA 2ZNYA 3ZMZA 1YYVA 2YR2A 2G7HA 1OPCA 3RJPA 5HS8A 3REOA 2ESNA 3IWFA 3LA3A 3COAC 1I27A 4G6QA 2OD5A 1ZGAA 3WE2A 1ODDA 2F5EA 4XLPF 1FC3A 1WKMA 3C3WA 4HF0A 2ZKZA 4UXNA 1TW2A 3OOPA 4IF4A 1ZYRF 5BOXA 1HXDA 5K5QA 3GX4X 1KU7A 1P92A 4I01A 4RB1A 2IVMA 2O03A 1RI7A 3C18A 3CUQA 4UVAA 1DDNA 4B8XA 3N97A 3L2CA 2Y75A 4I09A 1G4DA 4NHJA 4U7BA 2HKOA 4HLXA 2HFHA 4WXDA 2ETHA 1XGMA 1YS6A 4EM0B 1H9TA 4UVBA 5TJJA 2DAOA 4BYYA 5E20A 4RAYA 2HTSA 5IT9K 3WGIA 1LEAA 3F22A 1ZGJA 4DQ2A 1EV7A 1T98A 2Z99A 1P4WA 2XAGA 4HYEA 6PAXA 4IVNA 3VB2A 3DXJF 3QPTA 2QBYB 1F1ZA 2STWA 4CZZA 2H6CA 1KYWA 4RGUA 1T39A 1LDDA 3CLOA 3LAPA 2M45A 1O3QA 4ON0A 2HGCA 3HUGA 4ENNA 2A68F 2M5WA 4YFNF 3LSTA 2QYOA 2KIMA 1HBXG 2VONA 5D5UB 1O57A 1BM9A 1BJAA 2UXXA 4A6EA 1L3LA 1VTNC 2ZMEA 4RB0A 1XMKA 1H0MA 1U5TC 2DI3A 1IXSB 3WU1B 4FHTA 3V8KA 4FT8A 2QWWA 3PFIA 4A2UA 2HKXA 2XRNA 1MZBA 3BZ6A 1QZYA 1EH8A 2FNAA 2X0LA 2PFBA 2PG4A 2DQLA 2VODA 4OOIA 2QM3A 3RYRA 3M1EA 1IXRC 1P6RA 4RAZA 5D5XB 3ABTA 4K2EA 1ZRDA 4HQMA 1S7OA 2F5FA 2EFQA 3B02A 1A04A 3ZMUA 2W25A 4HW0A 3NRVA 1T0FA 5J8FA 2GAUA 1J59A 4Q4ZF 1QO0D 4XSZF 2FA5A 4EGZA 4BHCA 2JPBA 4WWCA 1YW8A 4HV5A 2VBYA 3D5LA 1ZARA 5AIQA 3WGGA 3QP6A 3RKYA 1FP1D 3IC7A 3LQQA 3H3ZA 2GZWA 4RGXA 3I64A 3TQNA 1IRGA 1OYIA 2QUFA 1O7FA 2HDCA 3I5UA 3KP6A 1ULYA 1FZPB 5DEQA 2Z9OA 3M8EA 2DFIA 3T5XA 2CQKA 3GYHX 2UZKA 2G9WA 2QENA 2ELHA 4CICA 4IRHA 1UB9A 3C1DA 3MAJA 3ZN0A 4Z2YA 1U6GA 1IN7A 4JK1X 1F5TA 1MD0A 4BXUA 3R0AA 5CVIA 4IRIA 2J5OA 2QLZA 2RQPA 4AIKA 2G7UA 1BI3A 1ONVA 1TTYA 3ZMDA 4ZYGA 4CXFA 3P7NA 2H27A 5ILSA 1B4AA 5LBQA 3RPUA 3IWZA 4O6JA 1LDJA 4OIRF 3WTVC 1XDSA 4BH9A 2NYXA 2F2EA 2A07F 2XKPA 2RVCA 4EJVA 2GA1A 1FSHA 3IKTA 4IXAA 1U5TB 1R36A 4BAYA 2KRFA 1JE8A 3JTGA 2CO5A 5JI6A 3J80K 1P4AA 2MH9A 3CUQC 3HSRA 4L5JA 3F8BA 2LF8A 2A5YB 3F6VA 1GVJA 3QP5A 5E1XA 2HWVA 2DO7A 3P9IA 1YFHA 3DKWA 3D0SA 4OIOF 4LG0A 4P55A 1WWXA 3E5UA 1NHAA 2P5LC 4LLLA 1OMIA 2DPDA 2Q8KA 1D5VA 1H9GA 4HDVA 3NEUA 3EETA 1W7PD 2HEOA 5FB2A 1XB4A 3MFKA 5DDGA 3K2ZA 2EV5A 4B09A 1MJBA 3SQNA 3I0TA 5ERIA 3J81Z 1J5YA 3RTRA 4L9VA 1D8KA 3B73A 4RGSA 3TDUC 4O3MA 3BJOA 2DT5A 1BI1A 2BGCA 1IUYA 1S29A 2XAQA 2VXZA 1ZN2A 3RPQA 1R23A 4BHBA 3DV8A 2HTJA 3L09A 1YO5C 3HHGA 4U0VA 1PDNC 5LEJA 3FM3A 3U2RA 3I71A 4D0PA 4F7ZA 4LFUA 2YX4A 1T2KA 2Y0MA 3RIRA 5E18F 2P7CB 1B59A 5HDNA 3QPHA 1ZH5A 4L18B 3H3UA 4OMYA 1K78A 4HZFA 1ZAOA 3WTWC 2D2WA 4ZYHA 4KYWA 2H94A 3M7GA 5HS9A 3GW2A 2EWNA 5IT3A 3BY6A 2VE9A 2IA2A 4MEXF 3O6BB 2TDXA 2KKOA 2YPRA 3HTUA 3QU6A 2FSWA 3QOPA 3VODA 1FBQA 5DCFA 3TOBA 3FMSA 3ERED 2A61A 2B0LA 2ISYA 2V1XA 5H6RA 3K1NA 5DCMA 3FWEA 3HSFA 3M9AA 3WGHA 3F21A 2J5PA 4XBFA 2FF4A 4UNOA 1TBXA 2IA0A 1HW1A 2RDPA 2VC1A 2HS5A 2K02A 1JHHA 1QPMA 3IRRA 3WG9A 3HSEA 2EV0A 2F5DA 1ZLJA 2CG4A 1XSXA 1KQ0A 5EEHA 3CUQB 4U7DA 3HRTA 1FOKA 1F9NA 3GFJA 1IAWA 1R5HA 2A6EF 5K1YA 2M87A 3V8LA 4KT5C 1OYYA 2H6BA 4BHPA 2O6GE 5ED4A 5ICFA 1LNWA 3E3VA 3DFGA 4Q5SF 1E17A 3TO6A 2CSOA 4E70A 3HRMA 3EYIA 4MTDA 4KN7X 3KP2A 4LGWA 3WTYC 4A12A 4GGGA 4CDGA 4MQ9F 4AVPA 2M30A 3R61A 4KNYA 3RDIA 1MKMA 4QWQA 2LNBA 4RB2C 3FXRA 1Z1DA 3L7WA 3GZ5A 2A3SA 4L0YB 2L02A 4M73A 5L3CA 4EJWA 5FGMA 3GF2A 1XD7A 3QU3A 5H6QA 1LB2A 1TW3A 1FSEA 4LB6B 1BOAA 3U9GA 2ZMEB 2K4JA 2WC2A 2KIUA 1Z6TA 1AWCA 2NNNA 1D3YA 4ESJA 2ZJ2A 2XROA 5ICEA 3WTUC 3KZZA 4Y13A 5LRSA 2E7XA 3IRQA 2Q0OA 3JSPA 3KP7A 3V7CA 4G6DA 3WU0A 3AAFA 2EB7A 3EDPA 4IHTA 5CJ9A 4WF2A 4HF2A 1SD5A 1ZG1A 3W6JB 5HS7A 5HLHA 3TDZC 3O2PE 5L3BA 2VBWA 1R7JA 2Y48A 1R00A 1V3FA 3T8TA 3TGNA 4YIIA 1UFMA 1CF7A 3Q9SA 4EJTA 1FX7A 4M6YA 4L9NA 4LD5A 3MCZA 2E1CA 1I5ZA 1RNLA 4S05A 4KFCA 1U3EM 1KU9A 2O8XA 5CVJA 4FX4A 1TNSA 1O3SA 5E17F 2ZXJA 1I1GA 5CVRA 1MJ9A 4Y15A 4EQQA 1ZLKA 1FY7A 1TQIA 5ICGA 3TKYA 2XASA 3V4GA 3VOEA 4NB5A 1XGNA 3S2WA 2K7LA 4M71A 4HX4A 3PQKA 4XSXF 3FF5A 1IN6A 2ADUA 2R3SA 1JXSA 1HSJA 1DUXC 3KEQA 3CTAA 5A2QZ 3ABUA 1YG2A 4ZH4F 1K6OA 3ISPA 4U0WA 5FFXA 5L3EA 3Q9VA 3IHUA 4H0EA 1SD6A 4ESBA 2DBBA 2RV8A 4FX0A 2X4HA 2JT1A 3F6OA 1ON1A 3KP3A 3JAMK 1ZRCA 2Z5UA 4ASNA 2XKOA 3JW4A 1G3YA 5LLQA 3O3KA 1KQ9A 1BN5A 2OA4A 2VE8A 2IJLA 2XHKA 3MQ0A 1G3TA 3MZYA 1B9NA 1YIOA 1BIBA 4WX9A 1RUNA 4RB3C 2P6TA 1J7KA 1UHMA 4KICA 4PDKA 4A0YA 4DNCA 4M9SA 3KP5A 4M6XA 1XGOA 4LK1F 4A0XA 2FEZA 3I4PA 2MH2A 4ESFA 3RYPA 3CJNA 4OIQF 4P9UA 2ZBKA 5HDGA 4HLYA 1RUOA 3DPTA 5L3DA 2VT2A 2NRAC 3L9FA 4EJUA 1WQ2A 2ESHA 3I59A 4UV9A 5K5RA 2GXGA 4LG0B 1W7PA 4LB5A 2RN7A 3TOAA 3DPLC 3L00A 2MLKA 3I58A 3P9KA 4O5VA 1ZRFA 1BI0A 2XAHA 1T6SA 4R79A 4EJOA 4I0AA 4BQAA 3ZMSA 4KN4X 2AXLA 4ZYEA 2RKHA 2DK8A 3SXYA 4U88A 4YFXF 3K1PA 4HX7A 1O3TA 3IL2A 1FNNA 3LAJA 1X3UA 4JBAA 4P9FA 2HQNA 1EH6A 5DUIA 4N9HA 2BE5F 5BMZA 1R22A 1QQIA 3VFZA 3BJ6A 1U2WA 3GXOA 1T38A 1R58A 4M72A 2RC4A 3G3ZA 3FXUA 1G6NA 3OV8A 2YSRA 5D4RA 1IXCA 3BROA 3EUHA 4XLNF 4LJZF 2ZFWA 2V79A 5IT9Z 2BYVE 5BPIA 2FRHA 4G7ZF 3RKWA 1XCVA 4A5NA 5D8KB 1G3SA 3SHFA 1IRFA 5EEGA 1K78B 1BBYA 2WWYA 3JSOA 1J0RA 3G73A 2EFPA 2KIFA 3VEPA 2V1UA 3HYIA 2L54A 2VBZA 3FX3A 4GCVA 3R6SA 3T0YA 2FBKA 3KEOA 2DW4A 2VC0A 2WV0A 1WI9A 5K5OA 1YS7A 5E8IA 2C6YA 1DPUA 4KA4A 5LHHA 1BI2A 5AIPA 2D45A 3HIFA 2ISZA 5DYMA 5F6FA 5DCMB 2STTA 2NNYA 3FXQA 5FFZA 2PJPA 4ENKA 1J75A 4RGRA 2YX7A 3E6BA 2OU2A 5TRDA 1ZG5A 4WCGA 2DQRA 5J6XA 1BIAA 2R7FA 4UV8A 5JR3A 1FYKA 5DD8A 2OZUA 4HA8A 1MJAA 3CUOA 4L0ZB 4GXOA 5JVTA 1QBJA 4OINF 3TO9A 1KYZA 3CDHA 1B6AA 2EA2A 4MEYF 4HV6A 2JTVA 4S04A 2YU3A 5DUKA 3V8JA 2OBPA 4IPAA 3BJAA 5FO5A 3H92A 4HDUA 2DTRA 3WODF 2COMA 5A2QK 3N4MA 4HBLA 4KDPA 5D4SA 1R1VA 2L4MA 2XVCA 2NS0A 2CFXA 3E5XA 4A0ZA 4CGZA 3M8FA 4MNUA 3IKVA 1GXPA 1B9MA 4G94A 2VN2A 1WSUA 2W24A 1XCBA 1I1SA 4GYIA 3K69A 3V7RA 2H09A 4I02A 1YW9A 3KP4A 5CLSA 2CW0F 1K79A 4L9TA 3ZPLA 4YG2F 1XSDA 1LJ9A 4PCQA 1J9IA 1QGPA 1USTA 2EA4A 4ETSA 1S8NA 2W57A 5LHIA 1YTYA 1W4MA 3F72A 1HW2A 5BPDA 1HKQA 2XV4S 3HHHA 3ECOA 2P5VA 1S7AA 5AONA 3ZN1A 1TQMA 2VT3A 1Z9CA 3BPVA 2VBXA 3I53A 3WTXC 2MLGA 3U1DA 3DEUA 2K4BA 3F23A 3WTTC 5L3GA 2AS5F 1FWZA 1PUEE 2XAFA 5CYVA 4HQEA 2HR3A 2V1DA 3ROUA 1IF1A 1Z7UA 1RZ4A 5FLXZ 3LFKA 1FBUA 2DU9A 2EV6A 2LDUA 3ELKA 2FMYA 2HZTA 2ZNZA 1CF7B 2VOPA 4KMFA 4HX8A 3SFZA 4BNCA 4CHUA 3BWGA 4ZYDA 4MQVA 3TO7A 3E6CC 3K9TA 4TV7A 4MTEA 3J80Z 2EFOA 3BP8A 2HOEA 3GFMA 4UVCA 4ENMA 2XIGA 2WTEA 1LEBA 3ECHA 3KLOA 4MHGA 5D5VB 3E6DA 2QQAA 5D8LB 2PEXA 5BQTA 1IN4A 5DD4A 4OIPF 4LLNA 2GIVA 4MGRA 1OR7A 3SZTA 4Q48A 1AOYA 3V7SA 4R1HA 2ZCWA 2GXBA 2DPUA 1DPRA 4Q47A 4L9JA 2P8TA 1MGTA 4R8HA 4I2OA 5ILVA 3F8MA 5JHUA 4M74A 4G7OF 5BS6A 4PGGA 1FP2A 2RGVA 1W5TA 4A6DA 1S6LA 2PMHA 2LSOA 1Y0UA 5D6FA 5ICCA 4KIGA 2FU4A 1HW5A 2R7DA 3LQRA 4I0BA 1FLIA 3GVAA 2ZO4A 2CGPA 1FYMA 1LDKB 1TLHB 2PMUA 4CYDA 1S3JA 1D8JA 1R1UA 1P4XA 2V9VA 1MDMB 4LK0F 3BOQA 1TNTA 1TQPA 3J81K 1Q1HA 1WRJA 5HLGA 2QVOA 4UHTA 3E6MA 1DP7P 3KFWX 2HQRA 4G7HF 5LGTA 2IW5A 3I54A 1SAXA 3Q5FA 2IA1A 1CGPA 1U78A 2GA2A 2PBIA 3WE3A 2FBIA 1YQAA 3PQJA 3CO7C 1FT9A 4AWXB 3GO5A 4AIHA 1IW7F 4NQWA 3EYYA 1KU2A 2K86A 2OQRA 2XUBA 1USSA 3I59B 1Z05A 1W7PB 5LEKA 5CVUA 4LLGF 1IN5A 1HSTA 3LA2A 4I98B 3NQOA 2QBYA 1R1TA 3HOTA 1LVAA 3DP7A 4AD9A 1FBSA 4GYGA 5D6EA 1KA8A 2W84A 2V6CA 2W85A 1SFUA 1MDMA 1XDUA 1SFEA 1XMAA 1O7LA 1OKRA 2CWEA 3ZMVA 2P6SA 3QRFF 2LKPA 2NAZA 4LMYA 5JFRA 5CVVA 1GXQA 2GQQA 1B1BA 3ZMTA 2Z3YA 3FMQA 2K27A 2RNJA 2FOKA 3K0LA 4L5IA 3BPXA 5J8CA 3GFLA 2XGXA 2OAZA 2EK5A 3JTHA 3KCCA 2P5KA 3GFIA 1SFXA 1SD7A 5D5WB 4M9ZA 2O0YA 1UHWA 3GEZA 1P2FA 2D1VA 5KK1A 2KJCA 2MD5A 2P7VB 2JPCA 5KVRA 5ILUA 5F1RA 4UUVA 1RIOH 4KIBA 4WXCA 2BV6A 2MBFA 2DK5A 5FD6A 4U0YA 5LHGA 3GLXA 2LF7A 1ZG3A 2QZ8A 4YFKF 2PI0A 4EM1A 2IPQX 1SD4A 3ZP5A 5HVQC 1FPQA
chains in the Genus database with same CATH superfamily
3P9CA 2DA1A 2L7FP 3GUDA 1MBKA 1JGSA 2ACJA 2E2HJ 4EV0A 3GWZA 4XQFA 1JTXA 3LSMA 3FM5A 1U8RA 2XAJA 4XICA 1YRNA 2WADA 3K4LA 4HAMA 5TISC 1X1PA 1XGSA 3LOCA 1XG1A 4PJNA 1TWCJ 3QPLA 3R60A 2G0EA 2DA3A 2FBHA 3E97A 2EIKH 2XDVA 3BT9A 3KE2A 4HNVA 2MABA 1TWGJ 2JUGA 1REPC 4F93B 2M8GX 5FLXK 5F04A 1R5GA 3OWTA 3DQVC 3WHCA 1QVTA 3GCMA 3ZQ7A 2JQ7A 3R0JA 3E1SA 2HDDA 4V19K 1Z91A 3TW6A 4HG2A 3HOSA 3EQLF 3I55I 1VQLI 2OQGA 3KETA 2FJ1A 2IT0A 3ESWB 3DEEA 2Y30A 1UCRA 1VZ0A 3QAHA 5BNGA 4D7MA 1BR1A 2JSPA 4BQNA 2QEXI 2NVXJ 1WJFA 4C2MJ 4ZC3A 2KRCA 3OYDA 4PZJA 4BJ5C 4G8XA 1IO2A 2B7EA 2DYRH 5B66C 1YLFA 2GWRA 3FMRA 4Y17A 1VQOI 2F5CA 2Q2EB 2K9NA 1I6XA 3ASOH 4IJAA 3S2DJ 3K4CA 2UWMA 4CCJA 2E1NA 1KU3A 3S32A 3F8NA 3RKXA 5IYCJ 1TT0A 2MA3A 5HDKA 3B6AA 1OR7C 4P5OA 1BC7C 2BXZA 1STZA 3QYBA 1W5SA 3RKQA 3HRSA 3S16J 2QQBA 1V4RA 2F5VA 3BDDA 3PUBA 4A3GJ 2ID6A 2FMLA 4KMUX 4P1WA 2O3FA 4JQFA 5L3FA 2L4AA 1SMYF 2M4KA 2XGCA 3G1OA 4RS8A 2M8EA 2LKSA 1GHCA 2QQ9A 3A02A 3HOWJ 2A69F 3KZYA 3F8FA 3R4KA 3WTSC 1OYWA 2Z2SB 1KGSA 2DFFA 5GPCA 5FJ8J 2HU9A 3MEXA 4WXHA 3W2VA 3BCBA 4KIFA 4HOBA 5CQEA 2IRFG 2RAEA 3ZQHA 3DF8A 4ZZDA 2A6HF 4QLCU 1QRYA 3CQZJ 3W6KB 1IN8A 4A69C 3WG7H 2IP2A 5B5EC 5E3MA 4ZZLA 3I56I 4IHSA 2L7MP 4XLAA 2L3DA 2FQ3A 1WHUA 2KJBA 1QZEA 2VLAA 4FCYA 3D5RC 2EFWA 5M3FJ 3RPUD 1SMTA 2E1OA 2W82A 3E5QA 4ENJA 4JYKA 4N9IA 3SZPA 3FHZA 2CYYA 2LD5A 4RAFA 1YHQI 2IGNA 1BC8C 3FZVA 5F64A 2CFOA 4UUSB 3S15J 1MBEA 1HDPA 4IEJA 4XMYA 2F4OB 5DS9A 1E3OC 2MC3A 4KT6A 1U5TA 3B6CA 1ZREA 5J1UA 3J7AO 4EMSA 4N0BA 2P4WA 2Q2EA 2EPFA 3PM1A 5HOOA 3PL8A 3JRFA 1SC7A 3A01A 1O4XA 4XLEA 3F8CA 3DBRB 2E1MB 2BBYA 2HYGD 4WK8F 1ZGWA 1LKXA 1O3RA 2BEOA 3T1BA 4C3HJ 1IGNA 5E8GA 2LVSA 2LYCA 2R7VA 1G3WA 2UXNA 5IP9J 1L0OC 1DQUA 1Z6RA 2VUMJ 5EZHA 3CCMI 2E7WA 1KQ8A 1X58A 4ZDOA 3JAMZ 1JGGA 1SAUA 2PQ8A 4XR6A 3CC7I 3LWFA 2EFNA 4HRIA 2JRMA 4J01A 3K1MA 2R7TA 2D1HA 1ETWA 1XN7A 2JRTA 3ABKH 1IZ1A 2DLLA 3O8GA 1BA5A 1J09A 2R7QA 3BTCA 2M0MA 5LRRA 1FJLA 4LG3A 4YIFA 5GADJ 2R7UA 4OAZA 4EVIA 1FMVA 4AM3A 2FE3A 4JX6A 3WTZA 2O61A 1J2XA 1HKSA 5E1ZB 1HQCA 5LGNA 2GLOA 4IKFA 4P96A 4M9XA 3C7JA 3CO6C 3WHBA 3HTSB 4Y52J 4EGYA 4EM2A 3OYMA 1E2XA 4KUMA 1C0WA 3OOUA 5HLIA 2L01A 1U0JA 4RLQA 3ULQB 1RKTA 3LSKA 4I7HA 4BU2A 1YW7A 1FIPA 2LY2A 5H20A 4E4HA 3MWMA 4XK4A 4CO8A 3Q3SA 1V5GA 4M3BA 3FK7A 4C30A 3OYLA 2OC6A 5E3LA 3OS2A 3L2RA 1HKTA 1QZZA 2BW3B 2FD5A 4AIJA 1K7AA 1AKHB 4XORA 2JZYA 1TZLA 4LIUA 4ZJZA 4A5MA 2HPMA 2PLYA 1ZHFA 3GZ6A 2OV7A 3ML6A 4OMZA 1OJLA 3S1RJ 1MBHA 3VDXA 1BOBA 3S1QJ 1SFKA 1ON2A 1XSVA 3FIWA 5E1WA 2VOOA 2WV1A 3BCAA 4IRGA 2R5YA 3MZHA 3CD6I 1MNMC 3RI4A 1LQ1A 3JREA 1R49A 3KLNA 2LK2A 1PP7U 2TRTA 3G6EI 2EJRA 2M1BA 1ZELA 4XKBA 2JSCA 2HDWA 1UG0A 1U8BA 3CC2I 1QNTA 4A3BJ 1FYLA 4G9YA 5FD5A 3LA7A 2FNPA 2FXAA 2IS2A 3H0DA 3CJQB 4GO1A 1JHFA 3HRUA 4XNFA 1EH7A 4IOAF 3CP8A 3OIOA 1HCRA 1F4KA 4A3JJ 3ZCOA 5DV5A 4OU0A 2IGKA 1MSEC 5J1RA 1JKQC 2HYFA 2IS1A 5JHFA 4XLHA 2QQ8A 4PGHA 4HF1A 3S17J 2E35A 1X3WB 2PN6A 4XRFA 3T8RA 1PP8F 2OZ6A 4DZPA 2Z33A 2F6CA 5LGUA 2DDBA 3HC7A 1QHHD 4E7JA 2DYSH 3PO2J 3F3XA 2AO9A 2ZNYA 3ZMZA 4LIVA 1YYVA 2YR2A 1VQ5I 1HC8A 2G7HA 2QGUA 1OPCA 3RJPA 4QIWN 5HS8A 3DBLB 3PNYA 3REOA 2EZKA 2ESNA 3IWFA 5EYRA 1MMAA 3TMOA 2HYJA 1GV2A 4D5CA 4RBOA 3LA3A 5J4VA 1I27A 4G6QA 3COAC 1RKWA 2OD5A 1ZGAA 2XF5A 3WE2A 2HQAA 2NOJB 2ZXHA 3KIOA 2OTJI 3BQYA 1ODDA 2F5EA 5EJCA 4OAYA 1MMDA 4XLPF 4XLFA 5B1AH 1FC3A 1WKMA 3C3WA 3JRCA 4HF0A 4CCNA 2ZKZA 3HDDA 4UXNA 4OWRB 1TW2A 3OOPA 4IF4A 4FISA 1ZYRF 5BOXA 1HXDA 1MBJA 1ZR4A 5K5QA 3GX4X 1RR7A 1KU7A 2XB0X 2H8WA 3FBNB 4AU7A 1WCMJ 1P92A 3AG1H 4I01A 4IOCF 4RB1A 1R4MB 1MBGA 4XOPA 2LY9A 2IVMA 2O03A 3MVPA 1RI7A 3C18A 3CUQA 1IRZA 3K4KA 4UVAA 1DDNA 1KZHA 1UMQA 3KEYA 4B8XA 3TW7A 2HNHA 1IDYA 3L2CA 2Y75A 2JVGA 3OYJA 3N97A 2V9PA 2ID3A 3MN2A 4G6TB 4I09A 1G4DA 1X1BA 2VPRA 4NHJA 1LE8B 4U7BA 2HKOA 3FXJA 4LOCA 1ZKGA 4HLXA 3FDYA 2HFHA 4WXDA 2ETHA 3K4JA 3NWSA 2XGEA 1XGMA 1YS6A 4EM0B 4DOZA 1H9TA 4UVBA 5TJJA 2PMZA 2DAOA 4W1UA 1WGXA 1D1AA 4BYYA 4H4KC 5E20A 2K9SA 1LFUP 1D0ZA 1Z21A 4RAYA 2HTSA 2X85A 2E5ZA 2M9HA 5IT9K 3WGIA 1GDTA 4PUSA 1LEAA 3F22A 2WAQN 5EG0B 3L2VA 3S3MA 1ZGJA 4NQWB 4DQ2A 2ME6A 1E3PA 4MFEA 3OYFA 1EV7A 3F0CA 4C3IJ 1T98A 1B8IB 1FIAA 2X6YA 2Z99A 1XMXA 1P4WA 1PJRA 2XAGA 4HYEA 4FETA 3MZ8A 4Y33A 4RAGA 2CUJA 1YJNI 6PAXA 2WAFA 4M3GA 4IVNA 3V42A 3VB2A 3CP2A 3DXJF 3QPTA 2QBYB 1F1ZA 2DODA 1QU3A 4IQ4A 2STWA 3IAM2 2EINH 2WAQA 4CZZA 1JUSA 5K7ZA 2VJJA 2H6CA 1KYWA 3W2AA 4BXFA 4RGUA 3RSNA 1T39A 5EGOA 2X1EA 1LDDA 3CLOA 3LAPA 1UAAA 2LG4A 2M45A 1O3QA 4ON0A 2HGCA 3HUGA 4XIDA 2P0WA 2BY2A 4ENNA 2A68F 2M5WA 4YFNF 3LSTA 3RQ4A 2QYOA 3OIQA 2KIMA 2DT7B 1HBXG 2VONA 2MGQA 3H36A 3GTMJ 2XPWA 3BQZA 3U1KA 5D5UB 1O57A 4B44A 3G2BA 1BM9A 1BJAA 1D1CA 1GVDA 3CJTB 2UXXA 4A6EA 1L3LA 3ZOBA 1VTNC 3H35A 2ZMEA 3SYTA 4RB0A 3DTKA 2XSJC 1GLNA 1XMKA 1H0MA 1U5TC 4E7HA 2DI3A 1IXSB 3WU1B 3E7LA 2BY0A 4FHTA 3V8KA 4FT8A 1D5YA 2QWWA 3PFIA 4A3FJ 2JMWA 2HKXA 2XRNA 4A2UA 1F43A 1MZBA 1MNDA 3UKGA 1AHDP 3BZ6A 1QZYA 2P81A 1EH8A 2FNAA 2LLKA 2X0LA 2PFBA 1FTZA 1WFXA 1I39A 1S5LC 2PG4A 2DQLA 2VODA 5FKOA 1K6YA 4LITA 3VSKA 4OOIA 2QM3A 3RYRA 1JKOC 1B8IA 5E3OA 3L2QA 3M1EA 1MMGA 1IXRC 1P6RA 4RAZA 5D5XB 4HNUA 1JI8A 3ABTA 1ETXA 4K2EA 1ZRDA 2L9NA 4HQMA 1OCRH 1S7OA 2F5FA 4XM3A 2EFQA 3B02A 1A04A 2FUG2 4IL6C 2LY1A 4PJJA 3ZMUA 2W25A 4HW0A 3NRVA 1T0FA 5J8FA 2GAUA 1J59A 4Q4ZF 3LL7A 3FKJA 1QO0D 4XSZF 4AUXA 2COBA 3IV5A 1VQPI 3M4OJ 2JVHA 2FA5A 4EGZA 1VQNI 1VQ4I 4BHCA 2JPBA 3SDBA 4WWCA 4X0GA 1YW8A 3L2UA 1Y8QB 4BXXJ 4PFOA 1YRNB 2LH9A 1MNEA 3BG9A 4HV5A 2VBYA 2DCEA 3PUFA 2HOSA 3D5LA 3S2HJ 1XX5A 1W5CC 1ZARA 1K61A 5AIQA 2EH3A 3WGGA 3QP6A 3RKYA 4IHXA 1FP1D 3A0HC 3DCFA 1IUFA 3IC7A 2XPUA 3LQQA 1YITI 3H3ZA 1Z67A 2ZSHB 1KONA 2GZWA 1TWHJ 4RGXA 3QQAA 3TEDA 1NG6A 3I64A 1WJAA 3TQNA 4CCKA 1IRGA 1WJDA 1OYIA 3CCYA 2QUFA 1O7FA 2HDCA 1JT0A 1H8AC 2OCEA 3I5UA 3KP6A 1ULYA 1FZPB 3EPZA 1PUFB 2XSDC 5DEQA 2Z9OA 4ZDLA 3M8EA 3IP4B 3ZXSA 1I3QJ 2BVLA 2DFIA 3T5XA 2CQKA 4I6ZA 3GYHX 2UZKA 4A3LJ 4BKXA 2G9WA 2QENA 2ELHA 2JWTA 3IH2A 3PNTA 4CICA 4IRHA 1A6QA 1UB9A 3C1DA 3MAJA 3ZN0A 1X4PA 1UELB 4Z2YA 4DW6A 1LPQA 4IHVA 1U6GA 5FKKA 2LC2A 2Z16A 1IN7A 4JK1X 1F5TA 1MD0A 4XKCA 3K70D 3NWTA 3Q0WA 1V54H 5M5XJ 2IEKA 3R0AA 4BXUA 5CVIA 4IRIA 5JLWA 2J5OA 2VIXA 1ENHA 1P7IA 2QLZA 2KFDA 2RQPA 4AIKA 2G7UA 1BI3A 1ONVA 1TTYA 1W36C 3QODA 4U87A 3ZMDA 4ZYGA 3CCJI 4XOTA 3OYCA 2MC4A 4CXFA 4PSWA 3P7NA 2H27A 3FBIB 5ILSA 3JR9A 1B4AA 5LBQA 2DA5A 3RPUA 2DMTA 2M7BA 3IWZA 4O6JA 2DFEA 1LDJA 1OCTC 4OIRF 3WTVC 2I8DA 1XDSA 4BH9A 4RMNA 1R9TJ 2NYXA 2F2EA 2A07F 2XKPA 3OS0A 2RVCA 4XRSA 3OYAA 5EZGA 3VYRB 4EJVA 3I9V2 2GA1A 2QF7A 2E5NA 1FSHA 1A36A 5KHDA 2HPIA 2V4JC 1ETVA 3CMAI 2HZDA 4L5EA 4BY1J 3IKTA 4NBQA 1PUFA 4IXAA 1T8IA 1U5TB 1R36A 3HXLA 3BC8A 4BAYA 3CJRB 2KRFA 1JE8A 3JTGA 1SVLA 3FXKA 2CO5A 2CQ7A 1EF4A 3OSFA 2KPMA 5JI6A 3J80K 1FTTA 3A01B 1P4AA 2MH9A 4XKWA 3CUQC 2ZFUA 3HSRA 2K85A 2A6TA 4L5JA 2B63J 3F8BA 4BE1A 2LF8A 3K4NA 2A5YB 3F6VA 4GDFA 1GVJA 3KX2A 2NS7A 1FMWA 2CRGA 2DFHA 3QP5A 5E1XA 2HWVA 2R7OA 2VASA 2DT6A 2DO7A 3P9IA 1YFHA 3DKWA 3D0SA 1F36A 4OIOF 4AIDA 4YELA 4LG0A 4G12A 4CCMA 1I50J 2KT0A 4P55A 1WWXA 4EEFG 3E5UA 4CYCA 4RA2A 1NHAA 2P5LC 2QKMB 2NVYJ 4LLLA 1OMIA 2DPDA 2Q8KA 3VYTB 1D5VA 3PFYA 1H9GA 4HDVA 1YIJI 3NEUA 3EETA 1W7PD 4F52A 2HEOA 4BGDA 4HSRA 3FXLA 5FB2A 1Y8RB 1Y39A 1XB4A 5GAEJ 2XGDA 4IHWA 2Y69H 3MFKA 5DDGA 1APLC 4DYCA 2ECBA 3K2ZA 2L0KA 5KAFC 2EV5A 2NXNB 1WJEA 1WPKA 1QPIA 4B09A 3DTEA 1MJBA 3SQNA 4B43A 2HVSA 3I0TA 3SEZA 5ERIA 3J81Z 2V7FA 1J5YA 3RTRA 3DTIA 2KDOA 1JUPA 1D8KA 3B73A 1RESA 3GLLA 4L9VA 4RGSA 3TDUC 4O3MA 4FE4A 3BJOA 3NARA 2DT5A 3LSRA 1BI1A 2BGCA 1IUYA 1PYVA 1S29A 2R5ZA 2X48A 2E34A 2IBDA 5FLMJ 2XAQA 2VXZA 1ZN2A 3RPQA 1R23A 4BHBA 3D5SC 2W48A 2KMUA 3DV8A 2HTJA 3L09A 2PJRA 1YO5C 3HHGA 4BY7J 2R5YB 2W4SA 2V9KA 4U0VA 2NS8A 1LFPA 1PDNC 1JKRC 1OCZH 2L7KA 5LEJA 3FM3A 3U2RA 3UNGC 2AQFA 3I71A 2W1OA 4D0PA 4F7ZA 4LFUA 1VNDA 2LOOA 3HBLA 9ANTA 3OYGA 3MD2A 2R93J 2YX4A 4QSHA 2QA4I 1T2KA 2ZMEC 2ZJQF 2JA6J 2Y0MA 1Y0NA 3RIRA 5E18F 2P7CB 5HLTA 1B59A 5HDNA 5FKMA 3FISA 3QPHA 4E7ZA 1ZH5A 4UB6C 3KYCB 3RZDJ 4L18B 3H3UA 1HLVA 4OMYA 1K78A 4HZFA 1D0YA 1ZAOA 3WTWC 3DKYA 2IGOA 1I6HJ 4JX5A 4A3MJ 2D2WA 5IP6A 2CUFA 4QPQA 4ZYHA 4BJTA 2DTZA 4KYWA 2H94A 3GTPJ 3M7GA 1E0EA 5HS9A 5TGTA 3GW2A 2EWNA 5IT3A 3BY6A 2VE9A 2IA2A 4MEXF 4HEA2 2ELJA 4BUPA 3O6BB 2E2JJ 2TDXA 2KKOA 2YPRA 3HTUA 3QU6A 2FSWA 3QOPA 1B72A 1OLTA 3VODA 1FBQA 3S3OA 5DCFA 3TOBA 3FMSA 3BR5A 3ERED 1X19A 2A61A 1YI2I 1T0FC 1FEXA 3DU5A 3D1NI 2B0LA 3BR6A 2ISYA 2V1XA 5H6RA 2EIJH 3K1NA 4W97A 4DBQA 5DCMA 3FWEA 3HSFA 3M9AA 1CQTA 3WGHA 3F21A 3M8JA 3LNQA 1RC9A 2J5PA 4XBFA 2FF4A 1BL0A 5IY5H 4UNOA 2EBIA 1TBXA 2IA0A 1DU0A 1HW1A 1U9NA 3JRGA 2RDPA 2VC1A 2HS5A 4XRSG 2K02A 1JHHA 2O8KA 1QPMA 3IRRA 3E0JB 3WG9A 3HSEA 2EV0A 2F5DA 1ZLJA 2CG4A 1XSXA 4NC6A 2HI3A 3QYEA 2DJNA 1KQ0A 5EEHA 3CUQB 4U7DA 3HOZJ 3HRTA 4BACA 5F0FA 3WU2C 3GTGJ 1ORKA 1FOKA 1F9NA 1VQ8I 3GFJA 3S8PA 1IAWA 3K2AA 1R5HA 2A6EF 1QVUA 2OPTA 2DA6A 2M87A 2VB6A 5K1YA 3JRAA 3FHNA 4ZTFA 2AXTC 1U9OA 2Y9YA 3V8LA 4KT5C 3ZQFA 3BR2A 2X6XA 1OYYA 2R7SA 3BTLA 2M0CA 2R92J 2H6BA 3QPSA 4BHPA 2O6GE 2L9SA 5ED4A 5ICFA 1TWFJ 3OIPA 2L7ZA 1FOWA 2ZJRF 3H1CA 2X6WA 2JJ7A 4NC7A 1LNWA 2VJIA 3E3VA 3F9KA 4C2TA 2DJIA 3DFGA 1V55H 2EQRA 1VFCA 4Q5SF 4ZYAA 3BG7A 4EATA 1E17A 1T33A 1YX5A 2EZLA 3TO6A 2CSOA 4E70A 2BY3A 4FTHA 2GXAA 3HRMA 1DU6A 3EYIA 3CDIA 2IS6A 2CUEA 2VKHA 4MTDA 3U21A 2CQXA 1T56A 5JVGF 4IX7A 2R7ZJ 2OCCH 4KN7X 3KP2A 4LGWA 2DOAA 1DGRM 5M5YJ 3WTYC 4A12A 3PSFA 3G1LA 4GGGA 3W2WA 2F48A 1Y6IA 4CDGA 2XF7A 3H9GA 3H3VK 1V5EA 3H5AA 3Q0UA 4MQ9F 5FRMA 3GTJJ 3G71I 3J7ZI 4AVPA 3OYHA 2M30A 1UZCA 5EGOB 1W0UA 1S9HA 2QSFX 5FLVA 1G2HA 3R61A 4AC0A 3CMYA 4KNYA 3ZR8X 1VQ6I 3RDIA 2DMQA 1MKMA 4QWQA 2LNBA 3HUGB 4RB2C 3FXRA 3PNVA 2PMZN 1ZTRA 1Z1DA 1IDZA 3L7WA 3GZ5A 2A3SA 4L0YB 3C2BA 3MKLA 2L02A 2XB5A 4M73A 5L3CA 4EJWA 5FGMA 2KDZA 3GF2A 1WJCA 2LRDA 1XD7A 3QU3A 4B3AA 4I99C 5H6QA 4J00A 1LB2A 2VQHA 3TBIA 1TW3A 1FSEA 2LR8A 4LB6B 3HGYA 1BOAA 3U9GA 2ZMEB 2K4JA 1IC8A 3DKXA 2WC2A 2KIUA 1Z6TA 3ERMA 5GPAA 1VQKI 1SANA 1AWCA 4PK4A 2NNNA 5GAHJ 1D3YA 1YX3A 4E7SA 2ZJ2A 4ESJA 2XROA 5ICEA 4KITB 5IOZA 3WTUC 3KZZA 4Y13A 5HODA 5LRSA 2E7XA 2ELKA 3JRDA 3IRQA 2I5UA 2Q0OA 3CCEI 2VL8A 3JSPA 3KP7A 3AL0C 3V7CA 4G6DA 3SFIA 1WJ5A 3Q0VA 3WU0A 3AAFA 2EB7A 3EDPA 2LFBA 4IHTA 1HOMA 1WH5A 5CJ9A 4WF2A 3TP3A 4HF2A 1SD5A 2HVQA 1ZG1A 3W6JB 3G4SI 5HS7A 5E79C 5HLHA 3TDZC 4JX4A 3O2PE 1MMSA 5L3BA 2VBWA 3CCRI 1R7JA 2Y48A 1R00A 1V3FA 3I4NJ 2R7RA 2K9QA 3T8TA 3TGNA 1W36D 4YIIA 1UFMA 1HDDC 1CF7A 1NG7A 3Q9SA 3BZCA 1OCOH 2JA5J 4EJTA 1FX7A 4M6YA 4L9NA 4LD5A 3MCZA 2E1CA 3HZJA 5K7HA 1I5ZA 1RNLA 5K7FA 4S05A 1T08B 4KFCA 1U3EM 1KU9A 1ITYA 3OYIA 3RZOJ 1FOYA 3HGGA 3HEFA 1RPWA 2O8XA 4A3DJ 5CVJA 3GTLJ 4FX4A 1TNSA 3CCLI 1O3SA 5E17F 2ZXJA 1I1GA 2O5RA 4IHYA 5CVRA 1MJ9A 4Y15A 4EQQA 1ZLKA 4UY8I 3IUOA 1FY7A 1IG7A 1TQIA 2JA8J 5FRNA 5ICGA 3TKYA 1X2NA 2XASA 3ONQA 2CW7A 4DZJA 2DA2A 3V4GA 3VOEA 4NB5A 1XGNA 3S2WA 2BZTA 2K7LA 1IRXA 2YUSA 4M71A 4HX4A 3DWLE 3PQKA 4XSXF 3FF5A 1IN6A 2ADUA 1VI0A 2R3SA 4NDLA 4D5FA 1VQMI 4QTRA 1JXSA 3PSIA 1HSJA 3DLLF 3CCVI 1DUXC 3KEQA 3CTAA 5A2QZ 3ABUA 4A3IJ 3GMEA 3JRBA 1YG2A 4ZH4F 1K6OA 3ISPA 4XLCA 4U0WA 5FFXA 5L3EA 3Q9VA 4A3EJ 3S93A 3IHUA 4H0EA 4XN3A 1SD6A 2K9MA 4YRVA 3CCUI 1NH3A 4ESBA 2DBBA 1SFOJ 2RV8A 2RNGA 3GZNB 4FX0A 3HOVJ 2X4HA 1JKPC 3CZ6A 3J7YJ 2JT1A 1BW6A 3F6OA 1ON1A 1NTCA 3KP3A 3JAMK 3M3YJ 2M2EA 1ZRCA 2Z5UA 2JK3A 4ASNA 1K4SA 2XKOA 2UV1A 3AG4H 3JW4A 1G3YA 5LLQA 4D1QA 3O3KA 1KQ9A 1BN5A 2CJJA 1LUJB 3QOEA 1A31A 3OYNA 4YIRX 4RM2A 3C2HA 2MSYA 5C44J 4Z6YA 2OA4A 1BR2A 4E7IA 3C2GA 2VE8A 4QPOA 2IJLA 2XHKA 1JT6A 3MQ0A 3ZRGA 3QWLA 1G3TA 2XF6A 3BZKA 1LFBA 3MZYA 1S72I 1P7JA 1B9NA 2WY8Q 5J40A 4XRMA 2O9LA 1YIOA 1BIBA 4WX9A 3BG6A 1RUNA 4RB3C 2P6TA 1MMNA 1J7KA 1UHMA 5JLXA 4KICA 4PDKA 2K3FA 1RRJA 1Y1VJ 4A0YA 2VI6A 4M9SA 4DNCA 3KP5A 1EJ9A 2L9RA 4M6XA 1IV6A 1XGOA 3CCQI 1ZK8A 4LK1F 3A0BC 4A0XA 2FEZA 3I4PA 2F4IA 2MH2A 3PO3J 1XS9A 3AFHA 1BR4A 1XPXA 4ESFA 2Y31A 2CQQA 1MH4A 3JCUC 1Z3XA 3RYPA 4BL0B 3CJNA 1GV5A 4OIQF 3W3CA 4P9UA 2ZBKA 2E19A 3FXOA 4I76A 5HDGA 3AL0B 4AYBN 2JA7J 4HLYA 1RUOA 3DPTA 5L3DA 3EUKL 1VQ7I 1V5FA 2VT2A 2NRAC 4FASD 3K4MA 2LBFA 3OYBA 2Z1DA 3L9FA 2K3PA 2MD0A 4EJUA 1WQ2A 1A5JA 4JP0A 2ESHA 3I59A 4UV9A 4ZTJA 4XL9A 5K5RA 2GXGA 4LG0B 1W7PA 4LB5A 2RN7A 2ECCA 3TOAA 1ERDA 2R7XA 1OCPA 3DPLC 3L00A 4CYCB 3BR1A 4GRIA 4A3KJ 2MLKA 3I58A 3P9KA 4AYBA 4GFBA 4F92B 3OYKA 3P5JA 3K4BA 4O5VA 1ZRFA 2IXSA 1BI0A 1UHSA 2XAHA 4CCOA 3LSPA 3KYDB 1T6SA 4UB8C 4R79A 1VQ9I 2JN6A 1X3ZB 1OFCX 4EJOA 4XONA 2MYSA 4I0AA 2ZXIA 3A1YA 1X1CA 4BQAA 3ZMSA 4KN4X 2AXLA 4ZYEA 2VJ4A 1JUMA 2RKHA 2DK8A 3SXYA 3CMMA 4U88A 4YFXF 3K1PA 2V26A 3HPHA 2EILH 4DYRA 4NC8A 4HX7A 5IYBJ 1O3TA 1YOVB 5GTIC 3IL2A 1FNNA 3M07A 2K9LA 4PSXA 3LAJA 2RQQA 1X3UA 2M34A 4JBAA 1G59A 4P9FA 1N75A 3O8HA 1Y1WJ 2HQNA 1EH6A 5DUIA 4N9HA 2ZC2A 4ANJA 2BE5F 5BMZA 1R22A 4J19A 2LP0A 2KZGA 1QQIA 1XC5A 3VFZA 3I4MJ 2R5ZB 2L9VA 3BJ6A 3SEQA 1U2WA 2TCTA 3GXOA 1T38A 1R58A 3J7AY 4M72A 4CUGA 2RC4A 1D0XA 3G3ZA 3FXUA 2BY1A 1G6NA 4BDZA 4M3FA 4A3CJ 3CF5F 3OV8A 2YSRA 5D4RA 1IXCA 3BROA 3EUHA 2PJRB 3ASNH 2CV0A 3A2KA 4XLNF 4V2FA 4LJZF 2ZFWA 4M3DA 2H1LA 2V79A 3A03A 2VKDA 4C2UA 5IT9Z 2BYVE 4CA0A 5BPIA 2FRHA 4G7ZF 3RKWA 1XCVA 4A5NA 5D8KB 1G3SA 1RETA 4F91B 1EA3A 2PX9A 2DA7A 2K5CA 1ACIA 3RCOA 4D9JA 2CH0A 2NOGA 3SHFA 1Z0XA 2DMPA 1IRFA 2ICWG 5EEGA 5EDNA 1Y56A 5B1BH 1K78B 1SVOA 1BBYA 2WWYA 3I3LA 3JSOA 1J0RA 3X2QH 3G73A 2EFPA 2KIFA 3KZIC 3L2WA 3S3NA 3VEPA 5IP7J 4CH7A 2V1UA 2CMPA 3HYIA 2Y0SN 2L54A 4C3JJ 4DGWB 2B9SA 2VBZA 3FX3A 4GCVA 2X6OA 3R6SA 2CV2A 3PIOF 2DOFA 1WZ2A 1R4NB 3T0YA 2FBKA 3SJMA 2VXDA 3KEOA 1G8XA 5GP9A 2DW4A 2VC0A 2WV0A 2NVQJ 3ZQLA 2DN0A 4E6KG 1B72B 1WI9A 3ZQIA 5K5OA 1IV8A 1YS7A 4DJAA 2W00A 5E8IA 2C6YA 1OQYA 1DPUA 2Y0SA 5LHHA 4KA4A 2GM4A 1BI2A 4II3A 5AIPA 2D45A 3HIFA 2ISZA 5DYMA 5F6FA 5DCMB 3BTIA 2STTA 1TT5B 2NNYA 3FXQA 5FFZA 2PJPA 1JTYA 4BEHB 4ENKA 1J75A 3UR3C 3S1NJ 4RGRA 2YX7A 2GOMA 3E6BA 2CS3A 4CSWA 2OU2A 2FX0A 2VQLA 3DEWA 5TRDA 1I3AA 2QSHX 1ZG5A 4WCGA 2DQRA 5J6XA 3CCSI 1BIAA 1W0TA 3OR2C 2R7FA 4UV8A 5JR3A 4RM3A 1FYKA 5DD8A 5C4JJ 2IAIA 2OZUA 4PJMA 4HA8A 5LFAA 4IO9F 3ZQGA 3LFUA 4ABZA 3H5NA 1MJAA 5M5WJ 5LD2C 3CUOA 2IS4A 3DU6A 4L0ZB 4GXOA 3LSJA 5JVTA 1QBJA 4B4CA 3BR0A 4FQGA 2R4GA 4OINF 3TO9A 1KYZA 2GIZA 2GOXB 3CDHA 3CESA 1B6AA 2A05A 2EA2A 3W6VA 2F4MB 3DLAA 3S1MJ 4MEYF 1HF0A 2BHZA 4HV6A 2JTVA 4S04A 2YU3A 5DUKA 3V8JA 2OBPA 4IPAA 3BJAA 3MKYB 5FO5A 3H92A 5F0HA 3K70C 5DM6F 4HDUA 1BJZA 4XKVA 2DTRA 4BBSJ 2NVUB 1A35A 1TP4A 1R5ID 2VKVA 3WODF 3OS1A 5HNHA 2COMA 5A2QK 2M7AA 3JRIA 4D7NA 3N4MA 1E3HA 2VJ5A 3CDLA 4HBLA 2V6EA 4KDPA 1Q1VA 5D4SA 4Y3OA 5FKNA 1X4OA 1R1VA 2KLOA 2L4MA 2XVCA 2NS0A 2CFXA 3SDGA 4AVZA 3OSGA 1X2MA 1N25A 3E5XA 4A0ZA 4CGZA 3M8FA 4MNUA 3IKVA 4N4NB 1R71A 1GXPA 1B9MA 4G94A 2VN2A 3OR1C 3OYEA 1WSUA 2W24A 1XCBA 1I1SA 2OF7A 4GYIA 2DXIA 3K69A 3V7RA 4BEHA 1K83J 2H09A 1Z77A 4I02A 3ZGKA 2VQCA 3KPHA 1YW9A 3IH3A 3KP4A 5CLSA 5J1YA 2X9DA 2CW0F 4UUSA 1K79A 4L9TA 3ZPLA 2O7OA 4YG2F 1XSDA 2M4GA 1LJ9A 2LREA 4PCQA 2A5WA 1J9IA 4CZCA 1QGPA 1USTA 2JUCA 2EA4A 5C4XJ 3HPGA 1A6IA 1M1EB 2YU9J 2CUZA 3ABLH 1WVRA 3LSIA 1VF9A 4ETSA 2KL4A 4UUTA 1S8NA 1WI3A 2W57A 2HVRA 5LHIA 1YTYA 1W4MA 3F72A 1HW2A 1WJBA 2OTLI 1MSFC 5BPDA 1HKQA 2XV4S 2LTPA 3HHHA 1FPQA 3MKZA 3RQIA 3ECOA 2P5VA 1S7AA 2NVTJ 3OMYA 5AONA 3ZN1A 4BS9A 3DBHB 2L2OA 1TQMA 5DM7F 2VT3A 4RDUA 1X1AA 2X1CA 1Z9CA 5CQGA 3BPVA 2E2IJ 1TC3C 2VBXA 3I53A 3WTXC 2MLGA 3U1DA 5KAIC 3DEUA 1NK2P 2XAUA 2K4BA 3F23A 2KP6A 3WTTC 4BE2A 5L3GA 3OL4A 2AS5F 2KIQA 3HKZN 1FWZA 1PUEE 2XAFA 3LMMA 5CYVA 4HQEA 3GTOJ 2E60A 3JRHA 2HR3A 2V1DA 3ROUA 3IAS2 1IF1A 1TWAJ 1Z7UA 3PJRA 1RZ4A 5FLXZ 1Z7LA 2DDAA 2XRLA 3M1CA 3LFKA 1AA7A 1FBUA 2DU9A 2EV6A 2LDUA 5F08A 2ZXWH 1GUUA 4FE7A 2MW8A 3BG5A 3ELKA 5KCMA 2FMYA 2FQ4A 2HZTA 2MFZA 1BW5A 2H8RA 1P9QC 2ZSIB 2ZB9A 5F1JA 2E36A 3SZGA 2ZNZA 1H89C 1CF7B 3HKZA 2VOPA 1ZQ3P 2R0QC 5IPAA 2BW3A 1AKHA 4KMFA 2N8GA 2QKLB 3N05A 2EIMH 4HX8A 2W7NA 2UUZA 2HQ5A 3SFZA 3HL2A 4BNCA 4CHUA 3BWGA 5J3LA 4ZYDA 5IOYA 3EUAA 4MQVA 1EKEA 3TO7A 3E6CC 3K9TA 4TV7A 4MTEA 2AQEA 3J80Z 4II2A 3NAUA 4BQOA 2EFOA 3BP8A 2HOEA 2KRHA 3GFMA 1NK3P 1K4TA 2Y2ZA 4UVCA 4ENMA 5HNFA 2XIGA 2WTEA 1LEBA 1HA8A 3ECHA 1R6RA 3KLOA 4E7KA 4MHGA 3LSHA 4CCLA 5D5VB 3E6DA 3OY9A 2QQAA 4RLFA 4HPQA 5D8LB 2PEXA 3DPUA 3ZQQA 5BQTA 1IN4A 1AU7A 5DD4A 4PJLA 4OIPF 2BVMA 4NNJA 4LLNA 1X1DA 2GIVA 3MKWB 3S14J 4MGRA 2FOWA 5E3NA 1OR7A 2RREA 5IYDJ 3SZTA 4Q48A 1AOYA 3V7SA 2HOTA 5CPRB 1ETKA 2CW8A 4DIQA 2IGMA 4XN0A 3EUHC 3HG9A 1OCCH 4R1HA 3CC4I 2ZCWA 2GXBA 2DPUA 3LSGA 1DPRA 3TL4X 4Q47A 2BOLA 4L9JA 2P8TA 3BTJA 1MGTA 2L5QA 4R8HA 3CLQA 2XC7A 1GT0C 4I2OA 5ILVA 3F8MA 5JHUA 1YJ9I 4M74A 1FOXA 4B1RA 3AKZA 3HOUJ 4G7OF 4JOMA 5GAGJ 1PVEA 5BS6A 4PGGA 1FP2A 3K7AJ 2KQRA 1W1WE 2RGVA 4HNTA 1W5TA 2BXYA 4A6DA 1S6LA 2PMHA 2DMUA 2KISA 2LSOA 2X1DA 4V2GA 2KZVA 4B3XA 1Y0UA 4M6VA 5D6FA 3CMEI 1N77A 4B47A 2DA4A 3HB9A 4Y7NJ 5ICCA 4KIGA 2FU4A 2CV1A 1HW5A 2R7DA 3LQRA 4I0BA 1POGA 2GBYA 2KHMA 3HOXJ 1FLIA 3GVAA 3CF2A 4BDYA 2ZO4A 2CGPA 1TL8A 1FYMA 1LDKB 1TLHB 2HOAA 2PMUA 4CYDA 4BQQA 3VYUB 3PIPF 1S3JA 4M3EA 5HVQC 1D8JA 4S0HB 1R1UA 5H2FC 1MIJA 1SVMA 1P4XA 3AG2H 4DBRA 2V9VA 2HXOA 2DMNA 5EF6A 4YEJA 1MDMB 2V1NA 2EZHA 4LK0F 3A4CA 3BOQA 4PFPA 1TNTA 3H0GJ 1TQPA 3J81K 1Q1HA 2CQNA 1WRJA 5HLGA 2QVOA 4UHTA 1LE8A 3E6MA 3G1MA 2LKXA 1DP7P 3KFWX 3BG3A 4MFDA 2CU7A 3KYLA 4E7LA 1XTAA 4IZZA 2HQRA 1H88C 4G7HF 5FKLA 1SEUA 3GTQJ 2JA2A 5M3MJ 5KNLA 5LGTA 2IW5A 1YJWI 3I54A 5DTDA 1SAXA 1JJ8C 4MO7A 2HXIA 3Q5FA 2IA1A 4F55A 1CGPA 1U78A 4KISA 4HSTA 2GA2A 2PBIA 3K10A 3WE3A 2FBIA 1YQAA 2VQGA 2WBMA 3AG3H 3PQJA 3CO7C 1FT9A 4AWXB 1ETOA 5EEAA 1Z3YA 2WAEA 1UJ8A 3GO5A 4AIHA 2LBFB 3GBGA 5EG0A 1IW7F 3FKIJ 3HJEA 4NQWA 2BHYA 3EYYA 2VPLA 1KU2A 1QHGA 2K86A 2XUBA 2OQRA 1USSA 3I59B 1WH7A 1UG2A 1Z05A 1W7PB 5LEKA 5CVUA 3BR3A 3VPRA 2WA0A 4LLGF 2YS9A 3BLYA 1IN5A 1HSTA 3LA2A 4I98B 2WY7Q 2EZIA 4DYQA 1MH3A 3NQOA 2QBYA 4PJ0C 2XPVA 3QYFA 2D5VA 1R1TA 3HOTA 4B48A 1DP3A 1LVAA 3DP7A 4AD9A 4IQJA 1FBSA 4Y4RA 1D1BA 1LVKA 4GYGA 5D6EA 4BJ6C 1KA8A 2W84A 1ETYA 5B3SH 4ZDPA 2V6CA 3H5RA 2W85A 1SFUA 1MDMA 1XDUA 1SFEA 1XMAA 1O7LA 1OKRA 2CWEA 5GTHC 1IJWC 2DOEA 3ZMVA 2P6SA 3QRFF 2LKPA 4BE0A 1MBFA 1OISA 2LMDA 5CKTA 2NAZA 2QCOA 3MMYB 4LMYA 5FROA 5C3EJ 4C9YA 5F0CA 5JFRA 5CVVA 3H9JA 1GXQA 2GQQA 1B1BA 1T95A 3ZMTA 2Z3YA 5J4YA 3FMQA 2K27A 2RNJA 2FOKA 1DGWY 3H9QA 3K0LA 4L5IA 2ZJPF 2AHQA 2M3AA 3BPXA 5J8CA 5J47A 3GFLA 3HM5A 3K6GA 1MW7A 1S7EA 2XGXA 2OAZA 4F3QA 3FK6A 2EK5A 3JTHA 2WB1N 3FXMA 2K40A 3KCCA 4MIMA 3ZQCA 2P5KA 2Y9ZA 2OUMA 3GFIA 1SFXA 2E1MC 1SD7A 4A93J 2I10A 3VSLA 4X6AJ 5D5WB 1RR8C 4M9ZA 2O0YA 1UHWA 3GEZA 1P2FA 4BBRJ 2D1VA 5KK1A 2KJCA 2MD5A 1ZR2A 2OJED 3L1PA 3IH4A 2P7VB 1YE9A 3ABMH 4NUBA 3GTKJ 4N4OB 5F27A 2JPCA 5KVRA 5ILUA 1QA6A 2QSGX 2H1KA 2WB1A 2X51A 5F1RA 1RIOH 4UUVA 3OL3A 3HOYJ 1JJ6C 3TP0A 2E71A 4ITVA 2VKEA 4KIBA 4WXCA 2BV6A 2MBFA 3VYSB 2DK5A 5FD6A 4U0YA 4KJZA 3GLXA 2LF7A 1ZG3A 5LHGA 2QZ8A 4YFKF 1ETQA 2PI0A 4EM1A 2R7WA 2MG4A 4X1EA 3VWBA 2IPQX 1N78A 1SD4A 3ZP5A 4MLOA 2Q1ZB 2ME0A
chains in the Genus database with same CATH topology
3P9CA 3GUDA 1JGSA 2ACJA 4EV0A 3GWZA 1U8RA 3FM5A 2XAJA 4HAMA 1XGSA 3R60A 2FBHA 3E97A 3KE2A 1REPC 5FLXK 1R5GA 3DQVC 3ZQ7A 3R0JA 1Z91A 3HOSA 3EQLF 2OQGA 3KETA 2IT0A 1UCRA 3QAHA 4PZJA 4G8XA 1YLFA 2GWRA 3FMRA 4Y17A 2F5CA 1I6XA 4IJAA 2UWMA 2E1NA 1KU3A 3F8NA 3RKXA 2MA3A 5HDKA 1BC7C 4P5OA 1STZA 1W5SA 3HRSA 2QQBA 1V4RA 3BDDA 2FMLA 4KMUX 2O3FA 4JQFA 5L3FA 2L4AA 1SMYF 4RS8A 2M8EA 1GHCA 2QQ9A 2A69F 3KZYA 3F8FA 3R4KA 3WTSC 1OYWA 1KGSA 3MEXA 4WXHA 4KIFA 4HOBA 2IRFG 4ZZDA 3DF8A 2A6HF 4QLCU 3W6KB 1IN8A 2IP2A 4ZZLA 4IHSA 2L3DA 2FQ3A 2KJBA 2EFWA 1SMTA 3E5QA 4ENJA 4N9IA 3SZPA 3FHZA 2CYYA 1BC8C 3FZVA 5F64A 2MC3A 1U5TA 1ZREA 3J7AO 4EMSA 4N0BA 2P4WA 2Q2EA 5HOOA 3F8CA 4WK8F 2BBYA 2HYGD 1O3RA 2BEOA 3T1BA 5E8GA 1G3WA 2UXNA 1L0OC 1Z6RA 2E7WA 1KQ8A 3JAMZ 2PQ8A 3LWFA 2EFNA 3K1MA 2D1HA 1XN7A 2JRTA 1IZ1A 2DLLA 5LRRA 4YIFA 4EVIA 2FE3A 3WTZA 2O61A 1J2XA 1HKSA 5E1ZB 1HQCA 5LGNA 4P96A 4M9XA 3C7JA 3CO6C 3HTSB 4EGYA 4EM2A 1E2XA 4KUMA 1C0WA 5HLIA 2L01A 3ULQB 4I7HA 1YW7A 5H20A 3MWMA 4CO8A 1HKTA 1QZZA 4AIJA 1K7AA 2JZYA 2PLYA 4A5MA 1ZHFA 3GZ6A 3ML6A 4OMZA 1XSVA 1ON2A 5E1WA 2VOOA 4IRGA 3MZHA 3RI4A 1LQ1A 3KLNA 1PP7U 2EJRA 2M1BA 2JSCA 1QNTA 1FYLA 4G9YA 5FD5A 3LA7A 2FNPA 2FXAA 4GO1A 1JHFA 3HRUA 1EH7A 1F4KA 5DV5A 4OU0A 2HYFA 4PGHA 4HF1A 2PN6A 4XRFA 3T8RA 1PP8F 2OZ6A 2Z33A 5LGUA 3F3XA 2ZNYA 3ZMZA 1YYVA 2YR2A 2G7HA 1OPCA 3RJPA 5HS8A 3REOA 2ESNA 3IWFA 3LA3A 3COAC 1I27A 4G6QA 2OD5A 1ZGAA 3WE2A 1ODDA 2F5EA 4XLPF 1FC3A 1WKMA 3C3WA 4HF0A 2ZKZA 4UXNA 1TW2A 3OOPA 4IF4A 1ZYRF 5BOXA 1HXDA 5K5QA 3GX4X 1KU7A 1P92A 4I01A 4RB1A 2IVMA 2O03A 1RI7A 3C18A 3CUQA 4UVAA 1DDNA 4B8XA 3N97A 3L2CA 2Y75A 4I09A 1G4DA 4NHJA 4U7BA 2HKOA 4HLXA 2HFHA 4WXDA 2ETHA 1XGMA 1YS6A 4EM0B 1H9TA 4UVBA 5TJJA 2DAOA 4BYYA 5E20A 4RAYA 2HTSA 5IT9K 3WGIA 1LEAA 3F22A 1ZGJA 4DQ2A 1EV7A 1T98A 2Z99A 1P4WA 2XAGA 4HYEA 6PAXA 4IVNA 3VB2A 3DXJF 3QPTA 2QBYB 1F1ZA 2STWA 4CZZA 2H6CA 1KYWA 4RGUA 1T39A 1LDDA 3CLOA 3LAPA 2M45A 1O3QA 4ON0A 2HGCA 3HUGA 4ENNA 2A68F 2M5WA 4YFNF 3LSTA 2QYOA 2KIMA 1HBXG 2VONA 5D5UB 1O57A 1BM9A 1BJAA 2UXXA 4A6EA 1L3LA 1VTNC 2ZMEA 4RB0A 1XMKA 1H0MA 1U5TC 2DI3A 1IXSB 3WU1B 4FHTA 3V8KA 4FT8A 2QWWA 3PFIA 4A2UA 2HKXA 2XRNA 1MZBA 3BZ6A 1QZYA 1EH8A 2FNAA 2X0LA 2PFBA 2PG4A 2DQLA 2VODA 4OOIA 2QM3A 3RYRA 3M1EA 1IXRC 1P6RA 4RAZA 5D5XB 3ABTA 4K2EA 1ZRDA 4HQMA 1S7OA 2F5FA 2EFQA 3B02A 1A04A 3ZMUA 2W25A 4HW0A 3NRVA 1T0FA 5J8FA 2GAUA 1J59A 4Q4ZF 1QO0D 4XSZF 2FA5A 4EGZA 4BHCA 2JPBA 4WWCA 1YW8A 4HV5A 2VBYA 3D5LA 1ZARA 5AIQA 3WGGA 3QP6A 3RKYA 1FP1D 3IC7A 3LQQA 3H3ZA 2GZWA 4RGXA 3I64A 3TQNA 1IRGA 1OYIA 2QUFA 1O7FA 2HDCA 3I5UA 3KP6A 1ULYA 1FZPB 5DEQA 2Z9OA 3M8EA 2DFIA 3T5XA 2CQKA 3GYHX 2UZKA 2G9WA 2QENA 2ELHA 4CICA 4IRHA 1UB9A 3C1DA 3MAJA 3ZN0A 4Z2YA 1U6GA 1IN7A 4JK1X 1F5TA 1MD0A 4BXUA 3R0AA 5CVIA 4IRIA 2J5OA 2QLZA 2RQPA 4AIKA 2G7UA 1BI3A 1ONVA 1TTYA 3ZMDA 4ZYGA 4CXFA 3P7NA 2H27A 5ILSA 1B4AA 5LBQA 3RPUA 3IWZA 4O6JA 1LDJA 4OIRF 3WTVC 1XDSA 4BH9A 2NYXA 2F2EA 2A07F 2XKPA 2RVCA 4EJVA 2GA1A 1FSHA 3IKTA 4IXAA 1U5TB 1R36A 4BAYA 2KRFA 1JE8A 3JTGA 2CO5A 5JI6A 3J80K 1P4AA 2MH9A 3CUQC 3HSRA 4L5JA 3F8BA 2LF8A 2A5YB 3F6VA 1GVJA 3QP5A 5E1XA 2HWVA 2DO7A 3P9IA 1YFHA 3DKWA 3D0SA 4OIOF 4LG0A 4P55A 1WWXA 3E5UA 1NHAA 2P5LC 4LLLA 1OMIA 2DPDA 2Q8KA 1D5VA 1H9GA 4HDVA 3NEUA 3EETA 1W7PD 2HEOA 5FB2A 1XB4A 3MFKA 5DDGA 3K2ZA 2EV5A 4B09A 1MJBA 3SQNA 3I0TA 5ERIA 3J81Z 1J5YA 3RTRA 4L9VA 1D8KA 3B73A 4RGSA 3TDUC 4O3MA 3BJOA 2DT5A 1BI1A 2BGCA 1IUYA 1S29A 2XAQA 2VXZA 1ZN2A 3RPQA 1R23A 4BHBA 3DV8A 2HTJA 3L09A 1YO5C 3HHGA 4U0VA 1PDNC 5LEJA 3FM3A 3U2RA 3I71A 4D0PA 4F7ZA 4LFUA 2YX4A 1T2KA 2Y0MA 3RIRA 5E18F 2P7CB 1B59A 5HDNA 3QPHA 1ZH5A 4L18B 3H3UA 4OMYA 1K78A 4HZFA 1ZAOA 3WTWC 2D2WA 4ZYHA 4KYWA 2H94A 3M7GA 5HS9A 3GW2A 2EWNA 5IT3A 3BY6A 2VE9A 2IA2A 4MEXF 3O6BB 2TDXA 2KKOA 2YPRA 3HTUA 3QU6A 2FSWA 3QOPA 3VODA 1FBQA 5DCFA 3TOBA 3FMSA 3ERED 2A61A 2B0LA 2ISYA 2V1XA 5H6RA 3K1NA 5DCMA 3FWEA 3HSFA 3M9AA 3WGHA 3F21A 2J5PA 4XBFA 2FF4A 4UNOA 1TBXA 2IA0A 1HW1A 2RDPA 2VC1A 2HS5A 2K02A 1JHHA 1QPMA 3IRRA 3WG9A 3HSEA 2EV0A 2F5DA 1ZLJA 2CG4A 1XSXA 1KQ0A 5EEHA 3CUQB 4U7DA 3HRTA 1FOKA 1F9NA 3GFJA 1IAWA 1R5HA 2A6EF 5K1YA 2M87A 3V8LA 4KT5C 1OYYA 2H6BA 4BHPA 2O6GE 5ED4A 5ICFA 1LNWA 3E3VA 3DFGA 4Q5SF 1E17A 3TO6A 2CSOA 4E70A 3HRMA 3EYIA 4MTDA 4KN7X 3KP2A 4LGWA 3WTYC 4A12A 4GGGA 4CDGA 4MQ9F 4AVPA 2M30A 3R61A 4KNYA 3RDIA 1MKMA 4QWQA 2LNBA 4RB2C 3FXRA 1Z1DA 3L7WA 3GZ5A 2A3SA 4L0YB 2L02A 4M73A 5L3CA 4EJWA 5FGMA 3GF2A 1XD7A 3QU3A 5H6QA 1LB2A 1TW3A 1FSEA 4LB6B 1BOAA 3U9GA 2ZMEB 2K4JA 2WC2A 2KIUA 1Z6TA 1AWCA 2NNNA 1D3YA 4ESJA 2ZJ2A 2XROA 5ICEA 3WTUC 3KZZA 4Y13A 5LRSA 2E7XA 3IRQA 2Q0OA 3JSPA 3KP7A 3V7CA 4G6DA 3WU0A 3AAFA 2EB7A 3EDPA 4IHTA 5CJ9A 4WF2A 4HF2A 1SD5A 1ZG1A 3W6JB 5HS7A 5HLHA 3TDZC 3O2PE 5L3BA 2VBWA 1R7JA 2Y48A 1R00A 1V3FA 3T8TA 3TGNA 4YIIA 1UFMA 1CF7A 3Q9SA 4EJTA 1FX7A 4M6YA 4L9NA 4LD5A 3MCZA 2E1CA 1I5ZA 1RNLA 4S05A 4KFCA 1U3EM 1KU9A 2O8XA 5CVJA 4FX4A 1TNSA 1O3SA 5E17F 2ZXJA 1I1GA 5CVRA 1MJ9A 4Y15A 4EQQA 1ZLKA 1FY7A 1TQIA 5ICGA 3TKYA 2XASA 3V4GA 3VOEA 4NB5A 1XGNA 3S2WA 2K7LA 4M71A 4HX4A 3PQKA 4XSXF 3FF5A 1IN6A 2ADUA 2R3SA 1JXSA 1HSJA 1DUXC 3KEQA 3CTAA 5A2QZ 3ABUA 1YG2A 4ZH4F 1K6OA 3ISPA 4U0WA 5FFXA 5L3EA 3Q9VA 3IHUA 4H0EA 1SD6A 4ESBA 2DBBA 2RV8A 4FX0A 2X4HA 2JT1A 3F6OA 1ON1A 3KP3A 3JAMK 1ZRCA 2Z5UA 4ASNA 2XKOA 3JW4A 1G3YA 5LLQA 3O3KA 1KQ9A 1BN5A 2OA4A 2VE8A 2IJLA 2XHKA 3MQ0A 1G3TA 3MZYA 1B9NA 1YIOA 1BIBA 4WX9A 1RUNA 4RB3C 2P6TA 1J7KA 1UHMA 4KICA 4PDKA 4A0YA 4DNCA 4M9SA 3KP5A 4M6XA 1XGOA 4LK1F 4A0XA 2FEZA 3I4PA 2MH2A 4ESFA 3RYPA 3CJNA 4OIQF 4P9UA 2ZBKA 5HDGA 4HLYA 1RUOA 3DPTA 5L3DA 2VT2A 2NRAC 3L9FA 4EJUA 1WQ2A 2ESHA 3I59A 4UV9A 5K5RA 2GXGA 4LG0B 1W7PA 4LB5A 2RN7A 3TOAA 3DPLC 3L00A 2MLKA 3I58A 3P9KA 4O5VA 1ZRFA 1BI0A 2XAHA 1T6SA 4R79A 4EJOA 4I0AA 4BQAA 3ZMSA 4KN4X 2AXLA 4ZYEA 2RKHA 2DK8A 3SXYA 4U88A 4YFXF 3K1PA 4HX7A 1O3TA 3IL2A 1FNNA 3LAJA 1X3UA 4JBAA 4P9FA 2HQNA 1EH6A 5DUIA 4N9HA 2BE5F 5BMZA 1R22A 1QQIA 3VFZA 3BJ6A 1U2WA 3GXOA 1T38A 1R58A 4M72A 2RC4A 3G3ZA 3FXUA 1G6NA 3OV8A 2YSRA 5D4RA 1IXCA 3BROA 3EUHA 4XLNF 4LJZF 2ZFWA 2V79A 5IT9Z 2BYVE 5BPIA 2FRHA 4G7ZF 3RKWA 1XCVA 4A5NA 5D8KB 1G3SA 3SHFA 1IRFA 5EEGA 1K78B 1BBYA 2WWYA 3JSOA 1J0RA 3G73A 2EFPA 2KIFA 3VEPA 2V1UA 3HYIA 2L54A 2VBZA 3FX3A 4GCVA 3R6SA 3T0YA 2FBKA 3KEOA 2DW4A 2VC0A 2WV0A 1WI9A 5K5OA 1YS7A 5E8IA 2C6YA 1DPUA 4KA4A 5LHHA 1BI2A 5AIPA 2D45A 3HIFA 2ISZA 5DYMA 5F6FA 5DCMB 2STTA 2NNYA 3FXQA 5FFZA 2PJPA 4ENKA 1J75A 4RGRA 2YX7A 3E6BA 2OU2A 5TRDA 1ZG5A 4WCGA 2DQRA 5J6XA 1BIAA 2R7FA 4UV8A 5JR3A 1FYKA 5DD8A 2OZUA 4HA8A 1MJAA 3CUOA 4L0ZB 4GXOA 5JVTA 1QBJA 4OINF 3TO9A 1KYZA 3CDHA 1B6AA 2EA2A 4MEYF 4HV6A 2JTVA 4S04A 2YU3A 5DUKA 3V8JA 2OBPA 4IPAA 3BJAA 5FO5A 3H92A 4HDUA 2DTRA 3WODF 2COMA 5A2QK 3N4MA 4HBLA 4KDPA 5D4SA 1R1VA 2L4MA 2XVCA 2NS0A 2CFXA 3E5XA 4A0ZA 4CGZA 3M8FA 4MNUA 3IKVA 1GXPA 1B9MA 4G94A 2VN2A 1WSUA 2W24A 1XCBA 1I1SA 4GYIA 3K69A 3V7RA 2H09A 4I02A 1YW9A 3KP4A 5CLSA 2CW0F 1K79A 4L9TA 3ZPLA 4YG2F 1XSDA 1LJ9A 4PCQA 1J9IA 1QGPA 1USTA 2EA4A 4ETSA 1S8NA 2W57A 5LHIA 1YTYA 1W4MA 3F72A 1HW2A 5BPDA 1HKQA 2XV4S 3HHHA 3ECOA 2P5VA 1S7AA 5AONA 3ZN1A 1TQMA 2VT3A 1Z9CA 3BPVA 2VBXA 3I53A 3WTXC 2MLGA 3U1DA 3DEUA 2K4BA 3F23A 3WTTC 5L3GA 2AS5F 1FWZA 1PUEE 2XAFA 5CYVA 4HQEA 2HR3A 2V1DA 3ROUA 1IF1A 1Z7UA 1RZ4A 5FLXZ 3LFKA 1FBUA 2DU9A 2EV6A 2LDUA 3ELKA 2FMYA 2HZTA 2ZNZA 1CF7B 2VOPA 4KMFA 4HX8A 3SFZA 4BNCA 4CHUA 3BWGA 4ZYDA 4MQVA 3TO7A 3E6CC 3K9TA 4TV7A 4MTEA 3J80Z 2EFOA 3BP8A 2HOEA 3GFMA 4UVCA 4ENMA 2XIGA 2WTEA 1LEBA 3ECHA 3KLOA 4MHGA 5D5VB 3E6DA 2QQAA 5D8LB 2PEXA 5BQTA 1IN4A 5DD4A 4OIPF 4LLNA 2GIVA 4MGRA 1OR7A 3SZTA 4Q48A 1AOYA 3V7SA 4R1HA 2ZCWA 2GXBA 2DPUA 1DPRA 4Q47A 4L9JA 2P8TA 1MGTA 4R8HA 4I2OA 5ILVA 3F8MA 5JHUA 4M74A 4G7OF 5BS6A 4PGGA 1FP2A 2RGVA 1W5TA 4A6DA 1S6LA 2PMHA 2LSOA 1Y0UA 5D6FA 5ICCA 4KIGA 2FU4A 1HW5A 2R7DA 3LQRA 4I0BA 1FLIA 3GVAA 2ZO4A 2CGPA 1FYMA 1LDKB 1TLHB 2PMUA 4CYDA 1S3JA 1D8JA 1R1UA 1P4XA 2V9VA 1MDMB 4LK0F 3BOQA 1TNTA 1TQPA 3J81K 1Q1HA 1WRJA 5HLGA 2QVOA 4UHTA 3E6MA 1DP7P 3KFWX 2HQRA 4G7HF 5LGTA 2IW5A 3I54A 1SAXA 3Q5FA 2IA1A 1CGPA 1U78A 2GA2A 2PBIA 3WE3A 2FBIA 1YQAA 3PQJA 3CO7C 1FT9A 4AWXB 3GO5A 4AIHA 1IW7F 4NQWA 3EYYA 1KU2A 2K86A 2OQRA 2XUBA 1USSA 3I59B 1Z05A 1W7PB 5LEKA 5CVUA 4LLGF 1IN5A 1HSTA 3LA2A 4I98B 3NQOA 2QBYA 1R1TA 3HOTA 1LVAA 3DP7A 4AD9A 1FBSA 4GYGA 5D6EA 1KA8A 2W84A 2V6CA 2W85A 1SFUA 1MDMA 1XDUA 1SFEA 1XMAA 1O7LA 1OKRA 2CWEA 3ZMVA 2P6SA 3QRFF 2LKPA 2NAZA 4LMYA 5JFRA 5CVVA 1GXQA 2GQQA 1B1BA 3ZMTA 2Z3YA 3FMQA 2K27A 2RNJA 2FOKA 3K0LA 4L5IA 3BPXA 5J8CA 3GFLA 2XGXA 2OAZA 2EK5A 3JTHA 3KCCA 2P5KA 3GFIA 1SFXA 1SD7A 5D5WB 4M9ZA 2O0YA 1UHWA 3GEZA 1P2FA 2D1VA 5KK1A 2KJCA 2MD5A 2P7VB 2JPCA 5KVRA 5ILUA 5F1RA 4UUVA 1RIOH 4KIBA 4WXCA 2BV6A 2MBFA 2DK5A 5FD6A 4U0YA 5LHGA 3GLXA 2LF7A 1ZG3A 2QZ8A 4YFKF 2PI0A 4EM1A 2IPQX 1SD4A 3ZP5A 5HVQC 1FPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9C A;  3GUD A;  1JGS A;  2ACJ A;  4EV0 A;  3GWZ A;  1U8R A;  3FM5 A;  2XAJ A;  4HAM A;  1XGS A;  3R60 A;  2FBH A;  3E97 A;  3KE2 A;  1REP C;  5FLX K;  1R5G A;  3DQV C;  3ZQ7 A;  3R0J A;  1Z91 A;  3HOS A;  3EQL F;  2OQG A;  3KET A;  2IT0 A;  1UCR A;  3QAH A;  4PZJ A;  4G8X A;  1YLF A;  2GWR A;  3FMR A;  4Y17 A;  2F5C A;  1I6X A;  4IJA A;  2UWM A;  2E1N A;  1KU3 A;  3F8N A;  3RKX A;  2MA3 A;  5HDK A;  1BC7 C;  4P5O A;  1STZ A;  1W5S A;  3HRS A;  2QQB A;  1V4R A;  3BDD A;  2FML A;  4KMU X;  2O3F A;  4JQF A;  5L3F A;  2L4A A;  1SMY F;  4RS8 A;  2M8E A;  1GHC A;  2QQ9 A;  2A69 F;  3KZY A;  3F8F A;  3R4K A;  3WTS C;  1OYW A;  1KGS A;  3MEX A;  4WXH A;  4KIF A;  4HOB A;  2IRF G;  4ZZD A;  3DF8 A;  2A6H F;  4QLC U;  3W6K B;  1IN8 A;  2IP2 A;  4ZZL A;  4IHS A;  2L3D A;  2FQ3 A;  2KJB A;  2EFW A;  1SMT A;  3E5Q A;  4ENJ A;  4N9I A;  3SZP A;  3FHZ A;  2CYY A;  1BC8 C;  3FZV A;  5F64 A;  2MC3 A;  1U5T A;  1ZRE A;  3J7A O;  4EMS A;  4N0B A;  2P4W A;  2Q2E A;  5HOO A;  3F8C A;  4WK8 F;  2BBY A;  2HYG D;  1O3R A;  2BEO A;  3T1B A;  5E8G A;  1G3W A;  2UXN A;  1L0O C;  1Z6R A;  2E7W A;  1KQ8 A;  3JAM Z;  2PQ8 A;  3LWF A;  2EFN A;  3K1M A;  2D1H A;  1XN7 A;  2JRT A;  1IZ1 A;  2DLL A;  5LRR A;  4YIF A;  4EVI A;  2FE3 A;  3WTZ A;  2O61 A;  1J2X A;  1HKS A;  5E1Z B;  1HQC A;  5LGN A;  4P96 A;  4M9X A;  3C7J A;  3CO6 C;  3HTS B;  4EGY A;  4EM2 A;  1E2X A;  4KUM A;  1C0W A;  5HLI A;  2L01 A;  3ULQ B;  4I7H A;  1YW7 A;  5H20 A;  3MWM A;  4CO8 A;  1HKT A;  1QZZ A;  4AIJ A;  1K7A A;  2JZY A;  2PLY A;  4A5M A;  1ZHF A;  3GZ6 A;  3ML6 A;  4OMZ A;  1XSV A;  1ON2 A;  5E1W A;  2VOO A;  4IRG A;  3MZH A;  3RI4 A;  1LQ1 A;  3KLN A;  1PP7 U;  2EJR A;  2M1B A;  2JSC A;  1QNT A;  1FYL A;  4G9Y A;  5FD5 A;  3LA7 A;  2FNP A;  2FXA A;  4GO1 A;  1JHF A;  3HRU A;  1EH7 A;  1F4K A;  5DV5 A;  4OU0 A;  2HYF A;  4PGH A;  4HF1 A;  2PN6 A;  4XRF A;  3T8R A;  1PP8 F;  2OZ6 A;  2Z33 A;  5LGU A;  3F3X A;  2ZNY A;  3ZMZ A;  1YYV A;  2YR2 A;  2G7H A;  1OPC A;  3RJP A;  5HS8 A;  3REO A;  2ESN A;  3IWF A;  3LA3 A;  3COA C;  1I27 A;  4G6Q A;  2OD5 A;  1ZGA A;  3WE2 A;  1ODD A;  2F5E A;  4XLP F;  1FC3 A;  1WKM A;  3C3W A;  4HF0 A;  2ZKZ A;  4UXN A;  1TW2 A;  3OOP A;  4IF4 A;  1ZYR F;  5BOX A;  1HXD A;  5K5Q A;  3GX4 X;  1KU7 A;  1P92 A;  4I01 A;  4RB1 A;  2IVM A;  2O03 A;  1RI7 A;  3C18 A;  3CUQ A;  4UVA A;  1DDN A;  4B8X A;  3N97 A;  3L2C A;  2Y75 A;  4I09 A;  1G4D A;  4NHJ A;  4U7B A;  2HKO A;  4HLX A;  2HFH A;  4WXD A;  2ETH A;  1XGM A;  1YS6 A;  4EM0 B;  1H9T A;  4UVB A;  5TJJ A;  2DAO A;  4BYY A;  5E20 A;  4RAY A;  2HTS A;  5IT9 K;  3WGI A;  1LEA A;  3F22 A;  1ZGJ A;  4DQ2 A;  1EV7 A;  1T98 A;  2Z99 A;  1P4W A;  2XAG A;  4HYE A;  6PAX A;  4IVN A;  3VB2 A;  3DXJ F;  3QPT A;  2QBY B;  1F1Z A;  2STW A;  4CZZ A;  2H6C A;  1KYW A;  4RGU A;  1T39 A;  1LDD A;  3CLO A;  3LAP A;  2M45 A;  1O3Q A;  4ON0 A;  2HGC A;  3HUG A;  4ENN A;  2A68 F;  2M5W A;  4YFN F;  3LST A;  2QYO A;  2KIM A;  1HBX G;  2VON A;  5D5U B;  1O57 A;  1BM9 A;  1BJA A;  2UXX A;  4A6E A;  1L3L A;  1VTN C;  2ZME A;  4RB0 A;  1XMK A;  1H0M A;  1U5T C;  2DI3 A;  1IXS B;  3WU1 B;  4FHT A;  3V8K A;  4FT8 A;  2QWW A;  3PFI A;  4A2U A;  2HKX A;  2XRN A;  1MZB A;  3BZ6 A;  1QZY A;  1EH8 A;  2FNA A;  2X0L A;  2PFB A;  2PG4 A;  2DQL A;  2VOD A;  4OOI A;  2QM3 A;  3RYR A;  3M1E A;  1IXR C;  1P6R A;  4RAZ A;  5D5X B;  3ABT A;  4K2E A;  1ZRD A;  4HQM A;  1S7O A;  2F5F A;  2EFQ A;  3B02 A;  1A04 A;  3ZMU A;  2W25 A;  4HW0 A;  3NRV A;  1T0F A;  5J8F A;  2GAU A;  1J59 A;  4Q4Z F;  1QO0 D;  4XSZ F;  2FA5 A;  4EGZ A;  4BHC A;  2JPB A;  4WWC A;  1YW8 A;  4HV5 A;  2VBY A;  3D5L A;  1ZAR A;  5AIQ A;  3WGG A;  3QP6 A;  3RKY A;  1FP1 D;  3IC7 A;  3LQQ A;  3H3Z A;  2GZW A;  4RGX A;  3I64 A;  3TQN A;  1IRG A;  1OYI A;  2QUF A;  1O7F A;  2HDC A;  3I5U A;  3KP6 A;  1ULY A;  1FZP B;  5DEQ A;  2Z9O A;  3M8E A;  2DFI A;  3T5X A;  2CQK A;  3GYH X;  2UZK A;  2G9W A;  2QEN A;  2ELH A;  4CIC A;  4IRH A;  1UB9 A;  3C1D A;  3MAJ A;  3ZN0 A;  4Z2Y A;  1U6G A;  1IN7 A;  4JK1 X;  1F5T A;  1MD0 A;  4BXU A;  3R0A A;  5CVI A;  4IRI A;  2J5O A;  2QLZ A;  2RQP A;  4AIK A;  2G7U A;  1BI3 A;  1ONV A;  1TTY A;  3ZMD A;  4ZYG A;  4CXF A;  3P7N A;  2H27 A;  5ILS A;  1B4A A;  5LBQ A;  3RPU A;  3IWZ A;  4O6J A;  1LDJ A;  4OIR F;  3WTV C;  1XDS A;  4BH9 A;  2NYX A;  2F2E A;  2A07 F;  2XKP A;  2RVC A;  4EJV A;  2GA1 A;  1FSH A;  3IKT A;  4IXA A;  1U5T B;  1R36 A;  4BAY A;  2KRF A;  1JE8 A;  3JTG A;  2CO5 A;  5JI6 A;  3J80 K;  1P4A A;  2MH9 A;  3CUQ C;  3HSR A;  4L5J A;  3F8B A;  2LF8 A;  2A5Y B;  3F6V A;  1GVJ A;  3QP5 A;  5E1X A;  2HWV A;  2DO7 A;  3P9I A;  1YFH A;  3DKW A;  3D0S A;  4OIO F;  4LG0 A;  4P55 A;  1WWX A;  3E5U A;  1NHA A;  2P5L C;  4LLL A;  1OMI A;  2DPD A;  2Q8K A;  1D5V A;  1H9G A;  4HDV A;  3NEU A;  3EET A;  1W7P D;  2HEO A;  5FB2 A;  1XB4 A;  3MFK A;  5DDG A;  3K2Z A;  2EV5 A;  4B09 A;  1MJB A;  3SQN A;  3I0T A;  5ERI A;  3J81 Z;  1J5Y A;  3RTR A;  4L9V A;  1D8K A;  3B73 A;  4RGS A;  3TDU C;  4O3M A;  3BJO A;  2DT5 A;  1BI1 A;  2BGC A;  1IUY A;  1S29 A;  2XAQ A;  2VXZ A;  1ZN2 A;  3RPQ A;  1R23 A;  4BHB A;  3DV8 A;  2HTJ A;  3L09 A;  1YO5 C;  3HHG A;  4U0V A;  1PDN C;  5LEJ A;  3FM3 A;  3U2R A;  3I71 A;  4D0P A;  4F7Z A;  4LFU A;  2YX4 A;  1T2K A;  2Y0M A;  3RIR A;  5E18 F;  2P7C B;  1B59 A;  5HDN A;  3QPH A;  1ZH5 A;  4L18 B;  3H3U A;  4OMY A;  1K78 A;  4HZF A;  1ZAO A;  3WTW C;  2D2W A;  4ZYH A;  4KYW A;  2H94 A;  3M7G A;  5HS9 A;  3GW2 A;  2EWN A;  5IT3 A;  3BY6 A;  2VE9 A;  2IA2 A;  4MEX F;  3O6B B;  2TDX A;  2KKO A;  2YPR A;  3HTU A;  3QU6 A;  2FSW A;  3QOP A;  3VOD A;  1FBQ A;  5DCF A;  3TOB A;  3FMS A;  3ERE D;  2A61 A;  2B0L A;  2ISY A;  2V1X A;  5H6R A;  3K1N A;  5DCM A;  3FWE A;  3HSF A;  3M9A A;  3WGH A;  3F21 A;  2J5P A;  4XBF A;  2FF4 A;  4UNO A;  1TBX A;  2IA0 A;  1HW1 A;  2RDP A;  2VC1 A;  2HS5 A;  2K02 A;  1JHH A;  1QPM A;  3IRR A;  3WG9 A;  3HSE A;  2EV0 A;  2F5D A;  1ZLJ A;  2CG4 A;  1XSX A;  1KQ0 A;  5EEH A;  3CUQ B;  4U7D A;  3HRT A;  1FOK A;  1F9N A;  3GFJ A;  1IAW A;  1R5H A;  2A6E F;  5K1Y A;  2M87 A;  3V8L A;  4KT5 C;  1OYY A;  2H6B A;  4BHP A;  2O6G E;  5ED4 A;  5ICF A;  1LNW A;  3E3V A;  3DFG A;  4Q5S F;  1E17 A;  3TO6 A;  2CSO A;  4E70 A;  3HRM A;  3EYI A;  4MTD A;  4KN7 X;  3KP2 A;  4LGW A;  3WTY C;  4A12 A;  4GGG A;  4CDG A;  4MQ9 F;  4AVP A;  2M30 A;  3R61 A;  4KNY A;  3RDI A;  1MKM A;  4QWQ A;  2LNB A;  4RB2 C;  3FXR A;  1Z1D A;  3L7W A;  3GZ5 A;  2A3S A;  4L0Y B;  2L02 A;  4M73 A;  5L3C A;  4EJW A;  5FGM A;  3GF2 A;  1XD7 A;  3QU3 A;  5H6Q A;  1LB2 A;  1TW3 A;  1FSE A;  4LB6 B;  1BOA A;  3U9G A;  2ZME B;  2K4J A;  2WC2 A;  2KIU A;  1Z6T A;  1AWC A;  2NNN A;  1D3Y A;  4ESJ A;  2ZJ2 A;  2XRO A;  5ICE A;  3WTU C;  3KZZ A;  4Y13 A;  5LRS A;  2E7X A;  3IRQ A;  2Q0O A;  3JSP A;  3KP7 A;  3V7C A;  4G6D A;  3WU0 A;  3AAF A;  2EB7 A;  3EDP A;  4IHT A;  5CJ9 A;  4WF2 A;  4HF2 A;  1SD5 A;  1ZG1 A;  3W6J B;  5HS7 A;  5HLH A;  3TDZ C;  3O2P E;  5L3B A;  2VBW A;  1R7J A;  2Y48 A;  1R00 A;  1V3F A;  3T8T A;  3TGN A;  4YII A;  1UFM A;  1CF7 A;  3Q9S A;  4EJT A;  1FX7 A;  4M6Y A;  4L9N A;  4LD5 A;  3MCZ A;  2E1C A;  1I5Z A;  1RNL A;  4S05 A;  4KFC A;  1U3E M;  1KU9 A;  2O8X A;  5CVJ A;  4FX4 A;  1TNS A;  1O3S A;  5E17 F;  2ZXJ A;  1I1G A;  5CVR A;  1MJ9 A;  4Y15 A;  4EQQ A;  1ZLK A;  1FY7 A;  1TQI A;  5ICG A;  3TKY A;  2XAS A;  3V4G A;  3VOE A;  4NB5 A;  1XGN A;  3S2W A;  2K7L A;  4M71 A;  4HX4 A;  3PQK A;  4XSX F;  3FF5 A;  1IN6 A;  2ADU A;  2R3S A;  1JXS A;  1HSJ A;  1DUX C;  3KEQ A;  3CTA A;  5A2Q Z;  3ABU A;  1YG2 A;  4ZH4 F;  1K6O A;  3ISP A;  4U0W A;  5FFX A;  5L3E A;  3Q9V A;  3IHU A;  4H0E A;  1SD6 A;  4ESB A;  2DBB A;  2RV8 A;  4FX0 A;  2X4H A;  2JT1 A;  3F6O A;  1ON1 A;  3KP3 A;  3JAM K;  1ZRC A;  2Z5U A;  4ASN A;  2XKO A;  3JW4 A;  1G3Y A;  5LLQ A;  3O3K A;  1KQ9 A;  1BN5 A;  2OA4 A;  2VE8 A;  2IJL A;  2XHK A;  3MQ0 A;  1G3T A;  3MZY A;  1B9N A;  1YIO A;  1BIB A;  4WX9 A;  1RUN A;  4RB3 C;  2P6T A;  1J7K A;  1UHM A;  4KIC A;  4PDK A;  4A0Y A;  4DNC A;  4M9S A;  3KP5 A;  4M6X A;  1XGO A;  4LK1 F;  4A0X A;  2FEZ A;  3I4P A;  2MH2 A;  4ESF A;  3RYP A;  3CJN A;  4OIQ F;  4P9U A;  2ZBK A;  5HDG A;  4HLY A;  1RUO A;  3DPT A;  5L3D A;  2VT2 A;  2NRA C;  3L9F A;  4EJU A;  1WQ2 A;  2ESH A;  3I59 A;  4UV9 A;  5K5R A;  2GXG A;  4LG0 B;  1W7P A;  4LB5 A;  2RN7 A;  3TOA A;  3DPL C;  3L00 A;  2MLK A;  3I58 A;  3P9K A;  4O5V A;  1ZRF A;  1BI0 A;  2XAH A;  1T6S A;  4R79 A;  4EJO A;  4I0A A;  4BQA A;  3ZMS A;  4KN4 X;  2AXL A;  4ZYE A;  2RKH A;  2DK8 A;  3SXY A;  4U88 A;  4YFX F;  3K1P A;  4HX7 A;  1O3T A;  3IL2 A;  1FNN A;  3LAJ A;  1X3U A;  4JBA A;  4P9F A;  2HQN A;  1EH6 A;  5DUI A;  4N9H A;  2BE5 F;  5BMZ A;  1R22 A;  1QQI A;  3VFZ A;  3BJ6 A;  1U2W A;  3GXO A;  1T38 A;  1R58 A;  4M72 A;  2RC4 A;  3G3Z A;  3FXU A;  1G6N A;  3OV8 A;  2YSR A;  5D4R A;  1IXC A;  3BRO A;  3EUH A;  4XLN F;  4LJZ F;  2ZFW A;  2V79 A;  5IT9 Z;  2BYV E;  5BPI A;  2FRH A;  4G7Z F;  3RKW A;  1XCV A;  4A5N A;  5D8K B;  1G3S A;  3SHF A;  1IRF A;  5EEG A;  1K78 B;  1BBY A;  2WWY A;  3JSO A;  1J0R A;  3G73 A;  2EFP A;  2KIF A;  3VEP A;  2V1U A;  3HYI A;  2L54 A;  2VBZ A;  3FX3 A;  4GCV A;  3R6S A;  3T0Y A;  2FBK A;  3KEO A;  2DW4 A;  2VC0 A;  2WV0 A;  1WI9 A;  5K5O A;  1YS7 A;  5E8I A;  2C6Y A;  1DPU A;  4KA4 A;  5LHH A;  1BI2 A;  5AIP A;  2D45 A;  3HIF A;  2ISZ A;  5DYM A;  5F6F A;  5DCM B;  2STT A;  2NNY A;  3FXQ A;  5FFZ A;  2PJP A;  4ENK A;  1J75 A;  4RGR A;  2YX7 A;  3E6B A;  2OU2 A;  5TRD A;  1ZG5 A;  4WCG A;  2DQR A;  5J6X A;  1BIA A;  2R7F A;  4UV8 A;  5JR3 A;  1FYK A;  5DD8 A;  2OZU A;  4HA8 A;  1MJA A;  3CUO A;  4L0Z B;  4GXO A;  5JVT A;  1QBJ A;  4OIN F;  3TO9 A;  1KYZ A;  3CDH A;  1B6A A;  2EA2 A;  4MEY F;  4HV6 A;  2JTV A;  4S04 A;  2YU3 A;  5DUK A;  3V8J A;  2OBP A;  4IPA A;  3BJA A;  5FO5 A;  3H92 A;  4HDU A;  2DTR A;  3WOD F;  2COM A;  5A2Q K;  3N4M A;  4HBL A;  4KDP A;  5D4S A;  1R1V A;  2L4M A;  2XVC A;  2NS0 A;  2CFX A;  3E5X A;  4A0Z A;  4CGZ A;  3M8F A;  4MNU A;  3IKV A;  1GXP A;  1B9M A;  4G94 A;  2VN2 A;  1WSU A;  2W24 A;  1XCB A;  1I1S A;  4GYI A;  3K69 A;  3V7R A;  2H09 A;  4I02 A;  1YW9 A;  3KP4 A;  5CLS A;  2CW0 F;  1K79 A;  4L9T A;  3ZPL A;  4YG2 F;  1XSD A;  1LJ9 A;  4PCQ A;  1J9I A;  1QGP A;  1UST A;  2EA4 A;  4ETS A;  1S8N A;  2W57 A;  5LHI A;  1YTY A;  1W4M A;  3F72 A;  1HW2 A;  5BPD A;  1HKQ A;  2XV4 S;  3HHH A;  3ECO A;  2P5V A;  1S7A A;  5AON A;  3ZN1 A;  1TQM A;  2VT3 A;  1Z9C A;  3BPV A;  2VBX A;  3I53 A;  3WTX C;  2MLG A;  3U1D A;  3DEU A;  2K4B A;  3F23 A;  3WTT C;  5L3G A;  2AS5 F;  1FWZ A;  1PUE E;  2XAF A;  5CYV A;  4HQE A;  2HR3 A;  2V1D A;  3ROU A;  1IF1 A;  1Z7U A;  1RZ4 A;  5FLX Z;  3LFK A;  1FBU A;  2DU9 A;  2EV6 A;  2LDU A;  3ELK A;  2FMY A;  2HZT A;  2ZNZ A;  1CF7 B;  2VOP A;  4KMF A;  4HX8 A;  3SFZ A;  4BNC A;  4CHU A;  3BWG A;  4ZYD A;  4MQV A;  3TO7 A;  3E6C C;  3K9T A;  4TV7 A;  4MTE A;  3J80 Z;  2EFO A;  3BP8 A;  2HOE A;  3GFM A;  4UVC A;  4ENM A;  2XIG A;  2WTE A;  1LEB A;  3ECH A;  3KLO A;  4MHG A;  5D5V B;  3E6D A;  2QQA A;  5D8L B;  2PEX A;  5BQT A;  1IN4 A;  5DD4 A;  4OIP F;  4LLN A;  2GIV A;  4MGR A;  1OR7 A;  3SZT A;  4Q48 A;  1AOY A;  3V7S A;  4R1H A;  2ZCW A;  2GXB A;  2DPU A;  1DPR A;  4Q47 A;  4L9J A;  2P8T A;  1MGT A;  4R8H A;  4I2O A;  5ILV A;  3F8M A;  5JHU A;  4M74 A;  4G7O F;  5BS6 A;  4PGG A;  1FP2 A;  2RGV A;  1W5T A;  4A6D A;  1S6L A;  2PMH A;  2LSO A;  1Y0U A;  5D6F A;  5ICC A;  4KIG A;  2FU4 A;  1HW5 A;  2R7D A;  3LQR A;  4I0B A;  1FLI A;  3GVA A;  2ZO4 A;  2CGP A;  1FYM A;  1LDK B;  1TLH B;  2PMU A;  4CYD A;  1S3J A;  1D8J A;  1R1U A;  1P4X A;  2V9V A;  1MDM B;  4LK0 F;  3BOQ A;  1TNT A;  1TQP A;  3J81 K;  1Q1H A;  1WRJ A;  5HLG A;  2QVO A;  4UHT A;  3E6M A;  1DP7 P;  3KFW X;  2HQR A;  4G7H F;  5LGT A;  2IW5 A;  3I54 A;  1SAX A;  3Q5F A;  2IA1 A;  1CGP A;  1U78 A;  2GA2 A;  2PBI A;  3WE3 A;  2FBI A;  1YQA A;  3PQJ A;  3CO7 C;  1FT9 A;  4AWX B;  3GO5 A;  4AIH A;  1IW7 F;  4NQW A;  3EYY A;  1KU2 A;  2K86 A;  2OQR A;  2XUB A;  1USS A;  3I59 B;  1Z05 A;  1W7P B;  5LEK A;  5CVU A;  4LLG F;  1IN5 A;  1HST A;  3LA2 A;  4I98 B;  3NQO A;  2QBY A;  1R1T A;  3HOT A;  1LVA A;  3DP7 A;  4AD9 A;  1FBS A;  4GYG A;  5D6E A;  1KA8 A;  2W84 A;  2V6C A;  2W85 A;  1SFU A;  1MDM A;  1XDU A;  1SFE A;  1XMA A;  1O7L A;  1OKR A;  2CWE A;  3ZMV A;  2P6S A;  3QRF F;  2LKP A;  2NAZ A;  4LMY A;  5JFR A;  5CVV A;  1GXQ A;  2GQQ A;  1B1B A;  3ZMT A;  2Z3Y A;  3FMQ A;  2K27 A;  2RNJ A;  2FOK A;  3K0L A;  4L5I A;  3BPX A;  5J8C A;  3GFL A;  2XGX A;  2OAZ A;  2EK5 A;  3JTH A;  3KCC A;  2P5K A;  3GFI A;  1SFX A;  1SD7 A;  5D5W B;  4M9Z A;  2O0Y A;  1UHW A;  3GEZ A;  1P2F A;  2D1V A;  5KK1 A;  2KJC A;  2MD5 A;  2P7V B;  2JPC A;  5KVR A;  5ILU A;  5F1R A;  4UUV A;  1RIO H;  4KIB A;  4WXC A;  2BV6 A;  2MBF A;  2DK5 A;  5FD6 A;  4U0Y A;  5LHG A;  3GLX A;  2LF7 A;  1ZG3 A;  2QZ8 A;  4YFK F;  2PI0 A;  4EM1 A;  2IPQ X;  1SD4 A;  3ZP5 A;  5HVQ C;  1FPQ A; 
#chains in the Genus database with same CATH topology
 3P9C A;  2DA1 A;  2L7F P;  3GUD A;  1MBK A;  1JGS A;  2ACJ A;  2E2H J;  4EV0 A;  3GWZ A;  4XQF A;  1JTX A;  3LSM A;  3FM5 A;  1U8R A;  2XAJ A;  4XIC A;  1YRN A;  2WAD A;  3K4L A;  4HAM A;  5TIS C;  1X1P A;  1XGS A;  3LOC A;  1XG1 A;  4PJN A;  1TWC J;  3QPL A;  3R60 A;  2G0E A;  2DA3 A;  2FBH A;  3E97 A;  2EIK H;  2XDV A;  3BT9 A;  3KE2 A;  4HNV A;  2MAB A;  1TWG J;  2JUG A;  1REP C;  4F93 B;  2M8G X;  5FLX K;  5F04 A;  1R5G A;  3OWT A;  3DQV C;  3WHC A;  1QVT A;  3GCM A;  3ZQ7 A;  2JQ7 A;  3R0J A;  3E1S A;  2HDD A;  4V19 K;  1Z91 A;  3TW6 A;  4HG2 A;  3HOS A;  3EQL F;  3I55 I;  1VQL I;  2OQG A;  3KET A;  2FJ1 A;  2IT0 A;  3ESW B;  3DEE A;  2Y30 A;  1UCR A;  1VZ0 A;  3QAH A;  5BNG A;  4D7M A;  1BR1 A;  2JSP A;  4BQN A;  2QEX I;  2NVX J;  1WJF A;  4C2M J;  4ZC3 A;  2KRC A;  3OYD A;  4PZJ A;  4BJ5 C;  4G8X A;  1IO2 A;  2B7E A;  2DYR H;  5B66 C;  1YLF A;  2GWR A;  3FMR A;  4Y17 A;  1VQO I;  2F5C A;  2Q2E B;  2K9N A;  1I6X A;  3ASO H;  4IJA A;  3S2D J;  3K4C A;  2UWM A;  4CCJ A;  2E1N A;  1KU3 A;  3S32 A;  3F8N A;  3RKX A;  5IYC J;  1TT0 A;  2MA3 A;  5HDK A;  3B6A A;  1OR7 C;  4P5O A;  1BC7 C;  2BXZ A;  1STZ A;  3QYB A;  1W5S A;  3RKQ A;  3HRS A;  3S16 J;  2QQB A;  1V4R A;  2F5V A;  3BDD A;  3PUB A;  4A3G J;  2ID6 A;  2FML A;  4KMU X;  4P1W A;  2O3F A;  4JQF A;  5L3F A;  2L4A A;  1SMY F;  2M4K A;  2XGC A;  3G1O A;  4RS8 A;  2M8E A;  2LKS A;  1GHC A;  2QQ9 A;  3A02 A;  3HOW J;  2A69 F;  3KZY A;  3F8F A;  3R4K A;  3WTS C;  1OYW A;  2Z2S B;  1KGS A;  2DFF A;  5GPC A;  5FJ8 J;  2HU9 A;  3MEX A;  4WXH A;  3W2V A;  3BCB A;  4KIF A;  4HOB A;  5CQE A;  2IRF G;  2RAE A;  3ZQH A;  3DF8 A;  4ZZD A;  2A6H F;  4QLC U;  1QRY A;  3CQZ J;  3W6K B;  1IN8 A;  4A69 C;  3WG7 H;  2IP2 A;  5B5E C;  5E3M A;  4ZZL A;  3I56 I;  4IHS A;  2L7M P;  4XLA A;  2L3D A;  2FQ3 A;  1WHU A;  2KJB A;  1QZE A;  2VLA A;  4FCY A;  3D5R C;  2EFW A;  5M3F J;  3RPU D;  1SMT A;  2E1O A;  2W82 A;  3E5Q A;  4ENJ A;  4JYK A;  4N9I A;  3SZP A;  3FHZ A;  2CYY A;  2LD5 A;  4RAF A;  1YHQ I;  2IGN A;  1BC8 C;  3FZV A;  5F64 A;  2CFO A;  4UUS B;  3S15 J;  1MBE A;  1HDP A;  4IEJ A;  4XMY A;  2F4O B;  5DS9 A;  1E3O C;  2MC3 A;  4KT6 A;  1U5T A;  3B6C A;  1ZRE A;  5J1U A;  3J7A O;  4EMS A;  4N0B A;  2P4W A;  2Q2E A;  2EPF A;  3PM1 A;  5HOO A;  3PL8 A;  3JRF A;  1SC7 A;  3A01 A;  1O4X A;  4XLE A;  3F8C A;  3DBR B;  2E1M B;  2BBY A;  2HYG D;  4WK8 F;  1ZGW A;  1LKX A;  1O3R A;  2BEO A;  3T1B A;  4C3H J;  1IGN A;  5E8G A;  2LVS A;  2LYC A;  2R7V A;  1G3W A;  2UXN A;  5IP9 J;  1L0O C;  1DQU A;  1Z6R A;  2VUM J;  5EZH A;  3CCM I;  2E7W A;  1KQ8 A;  1X58 A;  4ZDO A;  3JAM Z;  1JGG A;  1SAU A;  2PQ8 A;  4XR6 A;  3CC7 I;  3LWF A;  2EFN A;  4HRI A;  2JRM A;  4J01 A;  3K1M A;  2R7T A;  2D1H A;  1ETW A;  1XN7 A;  2JRT A;  3ABK H;  1IZ1 A;  2DLL A;  3O8G A;  1BA5 A;  1J09 A;  2R7Q A;  3BTC A;  2M0M A;  5LRR A;  1FJL A;  4LG3 A;  4YIF A;  5GAD J;  2R7U A;  4OAZ A;  4EVI A;  1FMV A;  4AM3 A;  2FE3 A;  4JX6 A;  3WTZ A;  2O61 A;  1J2X A;  1HKS A;  5E1Z B;  1HQC A;  5LGN A;  2GLO A;  4IKF A;  4P96 A;  4M9X A;  3C7J A;  3CO6 C;  3WHB A;  3HTS B;  4Y52 J;  4EGY A;  4EM2 A;  3OYM A;  1E2X A;  4KUM A;  1C0W A;  3OOU A;  5HLI A;  2L01 A;  1U0J A;  4RLQ A;  3ULQ B;  1RKT A;  3LSK A;  4I7H A;  4BU2 A;  1YW7 A;  1FIP A;  2LY2 A;  5H20 A;  4E4H A;  3MWM A;  4XK4 A;  4CO8 A;  3Q3S A;  1V5G A;  4M3B A;  3FK7 A;  4C30 A;  3OYL A;  2OC6 A;  5E3L A;  3OS2 A;  3L2R A;  1HKT A;  1QZZ A;  2BW3 B;  2FD5 A;  4AIJ A;  1K7A A;  1AKH B;  4XOR A;  2JZY A;  1TZL A;  4LIU A;  4ZJZ A;  4A5M A;  2HPM A;  2PLY A;  1ZHF A;  3GZ6 A;  2OV7 A;  3ML6 A;  4OMZ A;  1OJL A;  3S1R J;  1MBH A;  3VDX A;  1BOB A;  3S1Q J;  1SFK A;  1ON2 A;  1XSV A;  3FIW A;  5E1W A;  2VOO A;  2WV1 A;  3BCA A;  4IRG A;  2R5Y A;  3MZH A;  3CD6 I;  1MNM C;  3RI4 A;  1LQ1 A;  3JRE A;  1R49 A;  3KLN A;  2LK2 A;  1PP7 U;  2TRT A;  3G6E I;  2EJR A;  2M1B A;  1ZEL A;  4XKB A;  2JSC A;  2HDW A;  1UG0 A;  1U8B A;  3CC2 I;  1QNT A;  4A3B J;  1FYL A;  4G9Y A;  5FD5 A;  3LA7 A;  2FNP A;  2FXA A;  2IS2 A;  3H0D A;  3CJQ B;  4GO1 A;  1JHF A;  3HRU A;  4XNF A;  1EH7 A;  4IOA F;  3CP8 A;  3OIO A;  1HCR A;  1F4K A;  4A3J J;  3ZCO A;  5DV5 A;  4OU0 A;  2IGK A;  1MSE C;  5J1R A;  1JKQ C;  2HYF A;  2IS1 A;  5JHF A;  4XLH A;  2QQ8 A;  4PGH A;  4HF1 A;  3S17 J;  2E35 A;  1X3W B;  2PN6 A;  4XRF A;  3T8R A;  1PP8 F;  2OZ6 A;  4DZP A;  2Z33 A;  2F6C A;  5LGU A;  2DDB A;  3HC7 A;  1QHH D;  4E7J A;  2DYS H;  3PO2 J;  3F3X A;  2AO9 A;  2ZNY A;  3ZMZ A;  4LIV A;  1YYV A;  2YR2 A;  1VQ5 I;  1HC8 A;  2G7H A;  2QGU A;  1OPC A;  3RJP A;  4QIW N;  5HS8 A;  3DBL B;  3PNY A;  3REO A;  2EZK A;  2ESN A;  3IWF A;  5EYR A;  1MMA A;  3TMO A;  2HYJ A;  1GV2 A;  4D5C A;  4RBO A;  3LA3 A;  5J4V A;  1I27 A;  4G6Q A;  3COA C;  1RKW A;  2OD5 A;  1ZGA A;  2XF5 A;  3WE2 A;  2HQA A;  2NOJ B;  2ZXH A;  3KIO A;  2OTJ I;  3BQY A;  1ODD A;  2F5E A;  5EJC A;  4OAY A;  1MMD A;  4XLP F;  4XLF A;  5B1A H;  1FC3 A;  1WKM A;  3C3W A;  3JRC A;  4HF0 A;  4CCN A;  2ZKZ A;  3HDD A;  4UXN A;  4OWR B;  1TW2 A;  3OOP A;  4IF4 A;  4FIS A;  1ZYR F;  5BOX A;  1HXD A;  1MBJ A;  1ZR4 A;  5K5Q A;  3GX4 X;  1RR7 A;  1KU7 A;  2XB0 X;  2H8W A;  3FBN B;  4AU7 A;  1WCM J;  1P92 A;  3AG1 H;  4I01 A;  4IOC F;  4RB1 A;  1R4M B;  1MBG A;  4XOP A;  2LY9 A;  2IVM A;  2O03 A;  3MVP A;  1RI7 A;  3C18 A;  3CUQ A;  1IRZ A;  3K4K A;  4UVA A;  1DDN A;  1KZH A;  1UMQ A;  3KEY A;  4B8X A;  3TW7 A;  2HNH A;  1IDY A;  3L2C A;  2Y75 A;  2JVG A;  3OYJ A;  3N97 A;  2V9P A;  2ID3 A;  3MN2 A;  4G6T B;  4I09 A;  1G4D A;  1X1B A;  2VPR A;  4NHJ A;  1LE8 B;  4U7B A;  2HKO A;  3FXJ A;  4LOC A;  1ZKG A;  4HLX A;  3FDY A;  2HFH A;  4WXD A;  2ETH A;  3K4J A;  3NWS A;  2XGE A;  1XGM A;  1YS6 A;  4EM0 B;  4DOZ A;  1H9T A;  4UVB A;  5TJJ A;  2PMZ A;  2DAO A;  4W1U A;  1WGX A;  1D1A A;  4BYY A;  4H4K C;  5E20 A;  2K9S A;  1LFU P;  1D0Z A;  1Z21 A;  4RAY A;  2HTS A;  2X85 A;  2E5Z A;  2M9H A;  5IT9 K;  3WGI A;  1GDT A;  4PUS A;  1LEA A;  3F22 A;  2WAQ N;  5EG0 B;  3L2V A;  3S3M A;  1ZGJ A;  4NQW B;  4DQ2 A;  2ME6 A;  1E3P A;  4MFE A;  3OYF A;  1EV7 A;  3F0C A;  4C3I J;  1T98 A;  1B8I B;  1FIA A;  2X6Y A;  2Z99 A;  1XMX A;  1P4W A;  1PJR A;  2XAG A;  4HYE A;  4FET A;  3MZ8 A;  4Y33 A;  4RAG A;  2CUJ A;  1YJN I;  6PAX A;  2WAF A;  4M3G A;  4IVN A;  3V42 A;  3VB2 A;  3CP2 A;  3DXJ F;  3QPT A;  2QBY B;  1F1Z A;  2DOD A;  1QU3 A;  4IQ4 A;  2STW A;  3IAM 2;  2EIN H;  2WAQ A;  4CZZ A;  1JUS A;  5K7Z A;  2VJJ A;  2H6C A;  1KYW A;  3W2A A;  4BXF A;  4RGU A;  3RSN A;  1T39 A;  5EGO A;  2X1E A;  1LDD A;  3CLO A;  3LAP A;  1UAA A;  2LG4 A;  2M45 A;  1O3Q A;  4ON0 A;  2HGC A;  3HUG A;  4XID A;  2P0W A;  2BY2 A;  4ENN A;  2A68 F;  2M5W A;  4YFN F;  3LST A;  3RQ4 A;  2QYO A;  3OIQ A;  2KIM A;  2DT7 B;  1HBX G;  2VON A;  2MGQ A;  3H36 A;  3GTM J;  2XPW A;  3BQZ A;  3U1K A;  5D5U B;  1O57 A;  4B44 A;  3G2B A;  1BM9 A;  1BJA A;  1D1C A;  1GVD A;  3CJT B;  2UXX A;  4A6E A;  1L3L A;  3ZOB A;  1VTN C;  3H35 A;  2ZME A;  3SYT A;  4RB0 A;  3DTK A;  2XSJ C;  1GLN A;  1XMK A;  1H0M A;  1U5T C;  4E7H A;  2DI3 A;  1IXS B;  3WU1 B;  3E7L A;  2BY0 A;  4FHT A;  3V8K A;  4FT8 A;  1D5Y A;  2QWW A;  3PFI A;  4A3F J;  2JMW A;  2HKX A;  2XRN A;  4A2U A;  1F43 A;  1MZB A;  1MND A;  3UKG A;  1AHD P;  3BZ6 A;  1QZY A;  2P81 A;  1EH8 A;  2FNA A;  2LLK A;  2X0L A;  2PFB A;  1FTZ A;  1WFX A;  1I39 A;  1S5L C;  2PG4 A;  2DQL A;  2VOD A;  5FKO A;  1K6Y A;  4LIT A;  3VSK A;  4OOI A;  2QM3 A;  3RYR A;  1JKO C;  1B8I A;  5E3O A;  3L2Q A;  3M1E A;  1MMG A;  1IXR C;  1P6R A;  4RAZ A;  5D5X B;  4HNU A;  1JI8 A;  3ABT A;  1ETX A;  4K2E A;  1ZRD A;  2L9N A;  4HQM A;  1OCR H;  1S7O A;  2F5F A;  4XM3 A;  2EFQ A;  3B02 A;  1A04 A;  2FUG 2;  4IL6 C;  2LY1 A;  4PJJ A;  3ZMU A;  2W25 A;  4HW0 A;  3NRV A;  1T0F A;  5J8F A;  2GAU A;  1J59 A;  4Q4Z F;  3LL7 A;  3FKJ A;  1QO0 D;  4XSZ F;  4AUX A;  2COB A;  3IV5 A;  1VQP I;  3M4O J;  2JVH A;  2FA5 A;  4EGZ A;  1VQN I;  1VQ4 I;  4BHC A;  2JPB A;  3SDB A;  4WWC A;  4X0G A;  1YW8 A;  3L2U A;  1Y8Q B;  4BXX J;  4PFO A;  1YRN B;  2LH9 A;  1MNE A;  3BG9 A;  4HV5 A;  2VBY A;  2DCE A;  3PUF A;  2HOS A;  3D5L A;  3S2H J;  1XX5 A;  1W5C C;  1ZAR A;  1K61 A;  5AIQ A;  2EH3 A;  3WGG A;  3QP6 A;  3RKY A;  4IHX A;  1FP1 D;  3A0H C;  3DCF A;  1IUF A;  3IC7 A;  2XPU A;  3LQQ A;  1YIT I;  3H3Z A;  1Z67 A;  2ZSH B;  1KON A;  2GZW A;  1TWH J;  4RGX A;  3QQA A;  3TED A;  1NG6 A;  3I64 A;  1WJA A;  3TQN A;  4CCK A;  1IRG A;  1WJD A;  1OYI A;  3CCY A;  2QUF A;  1O7F A;  2HDC A;  1JT0 A;  1H8A C;  2OCE A;  3I5U A;  3KP6 A;  1ULY A;  1FZP B;  3EPZ A;  1PUF B;  2XSD C;  5DEQ A;  2Z9O A;  4ZDL A;  3M8E A;  3IP4 B;  3ZXS A;  1I3Q J;  2BVL A;  2DFI A;  3T5X A;  2CQK A;  4I6Z A;  3GYH X;  2UZK A;  4A3L J;  4BKX A;  2G9W A;  2QEN A;  2ELH A;  2JWT A;  3IH2 A;  3PNT A;  4CIC A;  4IRH A;  1A6Q A;  1UB9 A;  3C1D A;  3MAJ A;  3ZN0 A;  1X4P A;  1UEL B;  4Z2Y A;  4DW6 A;  1LPQ A;  4IHV A;  1U6G A;  5FKK A;  2LC2 A;  2Z16 A;  1IN7 A;  4JK1 X;  1F5T A;  1MD0 A;  4XKC A;  3K70 D;  3NWT A;  3Q0W A;  1V54 H;  5M5X J;  2IEK A;  3R0A A;  4BXU A;  5CVI A;  4IRI A;  5JLW A;  2J5O A;  2VIX A;  1ENH A;  1P7I A;  2QLZ A;  2KFD A;  2RQP A;  4AIK A;  2G7U A;  1BI3 A;  1ONV A;  1TTY A;  1W36 C;  3QOD A;  4U87 A;  3ZMD A;  4ZYG A;  3CCJ I;  4XOT A;  3OYC A;  2MC4 A;  4CXF A;  4PSW A;  3P7N A;  2H27 A;  3FBI B;  5ILS A;  3JR9 A;  1B4A A;  5LBQ A;  2DA5 A;  3RPU A;  2DMT A;  2M7B A;  3IWZ A;  4O6J A;  2DFE A;  1LDJ A;  1OCT C;  4OIR F;  3WTV C;  2I8D A;  1XDS A;  4BH9 A;  4RMN A;  1R9T J;  2NYX A;  2F2E A;  2A07 F;  2XKP A;  3OS0 A;  2RVC A;  4XRS A;  3OYA A;  5EZG A;  3VYR B;  4EJV A;  3I9V 2;  2GA1 A;  2QF7 A;  2E5N A;  1FSH A;  1A36 A;  5KHD A;  2HPI A;  2V4J C;  1ETV A;  3CMA I;  2HZD A;  4L5E A;  4BY1 J;  3IKT A;  4NBQ A;  1PUF A;  4IXA A;  1T8I A;  1U5T B;  1R36 A;  3HXL A;  3BC8 A;  4BAY A;  3CJR B;  2KRF A;  1JE8 A;  3JTG A;  1SVL A;  3FXK A;  2CO5 A;  2CQ7 A;  1EF4 A;  3OSF A;  2KPM A;  5JI6 A;  3J80 K;  1FTT A;  3A01 B;  1P4A A;  2MH9 A;  4XKW A;  3CUQ C;  2ZFU A;  3HSR A;  2K85 A;  2A6T A;  4L5J A;  2B63 J;  3F8B A;  4BE1 A;  2LF8 A;  3K4N A;  2A5Y B;  3F6V A;  4GDF A;  1GVJ A;  3KX2 A;  2NS7 A;  1FMW A;  2CRG A;  2DFH A;  3QP5 A;  5E1X A;  2HWV A;  2R7O A;  2VAS A;  2DT6 A;  2DO7 A;  3P9I A;  1YFH A;  3DKW A;  3D0S A;  1F36 A;  4OIO F;  4AID A;  4YEL A;  4LG0 A;  4G12 A;  4CCM A;  1I50 J;  2KT0 A;  4P55 A;  1WWX A;  4EEF G;  3E5U A;  4CYC A;  4RA2 A;  1NHA A;  2P5L C;  2QKM B;  2NVY J;  4LLL A;  1OMI A;  2DPD A;  2Q8K A;  3VYT B;  1D5V A;  3PFY A;  1H9G A;  4HDV A;  1YIJ I;  3NEU A;  3EET A;  1W7P D;  4F52 A;  2HEO A;  4BGD A;  4HSR A;  3FXL A;  5FB2 A;  1Y8R B;  1Y39 A;  1XB4 A;  5GAE J;  2XGD A;  4IHW A;  2Y69 H;  3MFK A;  5DDG A;  1APL C;  4DYC A;  2ECB A;  3K2Z A;  2L0K A;  5KAF C;  2EV5 A;  2NXN B;  1WJE A;  1WPK A;  1QPI A;  4B09 A;  3DTE A;  1MJB A;  3SQN A;  4B43 A;  2HVS A;  3I0T A;  3SEZ A;  5ERI A;  3J81 Z;  2V7F A;  1J5Y A;  3RTR A;  3DTI A;  2KDO A;  1JUP A;  1D8K A;  3B73 A;  1RES A;  3GLL A;  4L9V A;  4RGS A;  3TDU C;  4O3M A;  4FE4 A;  3BJO A;  3NAR A;  2DT5 A;  3LSR A;  1BI1 A;  2BGC A;  1IUY A;  1PYV A;  1S29 A;  2R5Z A;  2X48 A;  2E34 A;  2IBD A;  5FLM J;  2XAQ A;  2VXZ A;  1ZN2 A;  3RPQ A;  1R23 A;  4BHB A;  3D5S C;  2W48 A;  2KMU A;  3DV8 A;  2HTJ A;  3L09 A;  2PJR A;  1YO5 C;  3HHG A;  4BY7 J;  2R5Y B;  2W4S A;  2V9K A;  4U0V A;  2NS8 A;  1LFP A;  1PDN C;  1JKR C;  1OCZ H;  2L7K A;  5LEJ A;  3FM3 A;  3U2R A;  3UNG C;  2AQF A;  3I71 A;  2W1O A;  4D0P A;  4F7Z A;  4LFU A;  1VND A;  2LOO A;  3HBL A;  9ANT A;  3OYG A;  3MD2 A;  2R93 J;  2YX4 A;  4QSH A;  2QA4 I;  1T2K A;  2ZME C;  2ZJQ F;  2JA6 J;  2Y0M A;  1Y0N A;  3RIR A;  5E18 F;  2P7C B;  5HLT A;  1B59 A;  5HDN A;  5FKM A;  3FIS A;  3QPH A;  4E7Z A;  1ZH5 A;  4UB6 C;  3KYC B;  3RZD J;  4L18 B;  3H3U A;  1HLV A;  4OMY A;  1K78 A;  4HZF A;  1D0Y A;  1ZAO A;  3WTW C;  3DKY A;  2IGO A;  1I6H J;  4JX5 A;  4A3M J;  2D2W A;  5IP6 A;  2CUF A;  4QPQ A;  4ZYH A;  4BJT A;  2DTZ A;  4KYW A;  2H94 A;  3GTP J;  3M7G A;  1E0E A;  5HS9 A;  5TGT A;  3GW2 A;  2EWN A;  5IT3 A;  3BY6 A;  2VE9 A;  2IA2 A;  4MEX F;  4HEA 2;  2ELJ A;  4BUP A;  3O6B B;  2E2J J;  2TDX A;  2KKO A;  2YPR A;  3HTU A;  3QU6 A;  2FSW A;  3QOP A;  1B72 A;  1OLT A;  3VOD A;  1FBQ A;  3S3O A;  5DCF A;  3TOB A;  3FMS A;  3BR5 A;  3ERE D;  1X19 A;  2A61 A;  1YI2 I;  1T0F C;  1FEX A;  3DU5 A;  3D1N I;  2B0L A;  3BR6 A;  2ISY A;  2V1X A;  5H6R A;  2EIJ H;  3K1N A;  4W97 A;  4DBQ A;  5DCM A;  3FWE A;  3HSF A;  3M9A A;  1CQT A;  3WGH A;  3F21 A;  3M8J A;  3LNQ A;  1RC9 A;  2J5P A;  4XBF A;  2FF4 A;  1BL0 A;  5IY5 H;  4UNO A;  2EBI A;  1TBX A;  2IA0 A;  1DU0 A;  1HW1 A;  1U9N A;  3JRG A;  2RDP A;  2VC1 A;  2HS5 A;  4XRS G;  2K02 A;  1JHH A;  2O8K A;  1QPM A;  3IRR A;  3E0J B;  3WG9 A;  3HSE A;  2EV0 A;  2F5D A;  1ZLJ A;  2CG4 A;  1XSX A;  4NC6 A;  2HI3 A;  3QYE A;  2DJN A;  1KQ0 A;  5EEH A;  3CUQ B;  4U7D A;  3HOZ J;  3HRT A;  4BAC A;  5F0F A;  3WU2 C;  3GTG J;  1ORK A;  1FOK A;  1F9N A;  1VQ8 I;  3GFJ A;  3S8P A;  1IAW A;  3K2A A;  1R5H A;  2A6E F;  1QVU A;  2OPT A;  2DA6 A;  2M87 A;  2VB6 A;  5K1Y A;  3JRA A;  3FHN A;  4ZTF A;  2AXT C;  1U9O A;  2Y9Y A;  3V8L A;  4KT5 C;  3ZQF A;  3BR2 A;  2X6X A;  1OYY A;  2R7S A;  3BTL A;  2M0C A;  2R92 J;  2H6B A;  3QPS A;  4BHP A;  2O6G E;  2L9S A;  5ED4 A;  5ICF A;  1TWF J;  3OIP A;  2L7Z A;  1FOW A;  2ZJR F;  3H1C A;  2X6W A;  2JJ7 A;  4NC7 A;  1LNW A;  2VJI A;  3E3V A;  3F9K A;  4C2T A;  2DJI A;  3DFG A;  1V55 H;  2EQR A;  1VFC A;  4Q5S F;  4ZYA A;  3BG7 A;  4EAT A;  1E17 A;  1T33 A;  1YX5 A;  2EZL A;  3TO6 A;  2CSO A;  4E70 A;  2BY3 A;  4FTH A;  2GXA A;  3HRM A;  1DU6 A;  3EYI A;  3CDI A;  2IS6 A;  2CUE A;  2VKH A;  4MTD A;  3U21 A;  2CQX A;  1T56 A;  5JVG F;  4IX7 A;  2R7Z J;  2OCC H;  4KN7 X;  3KP2 A;  4LGW A;  2DOA A;  1DGR M;  5M5Y J;  3WTY C;  4A12 A;  3PSF A;  3G1L A;  4GGG A;  3W2W A;  2F48 A;  1Y6I A;  4CDG A;  2XF7 A;  3H9G A;  3H3V K;  1V5E A;  3H5A A;  3Q0U A;  4MQ9 F;  5FRM A;  3GTJ J;  3G71 I;  3J7Z I;  4AVP A;  3OYH A;  2M30 A;  1UZC A;  5EGO B;  1W0U A;  1S9H A;  2QSF X;  5FLV A;  1G2H A;  3R61 A;  4AC0 A;  3CMY A;  4KNY A;  3ZR8 X;  1VQ6 I;  3RDI A;  2DMQ A;  1MKM A;  4QWQ A;  2LNB A;  3HUG B;  4RB2 C;  3FXR A;  3PNV A;  2PMZ N;  1ZTR A;  1Z1D A;  1IDZ A;  3L7W A;  3GZ5 A;  2A3S A;  4L0Y B;  3C2B A;  3MKL A;  2L02 A;  2XB5 A;  4M73 A;  5L3C A;  4EJW A;  5FGM A;  2KDZ A;  3GF2 A;  1WJC A;  2LRD A;  1XD7 A;  3QU3 A;  4B3A A;  4I99 C;  5H6Q A;  4J00 A;  1LB2 A;  2VQH A;  3TBI A;  1TW3 A;  1FSE A;  2LR8 A;  4LB6 B;  3HGY A;  1BOA A;  3U9G A;  2ZME B;  2K4J A;  1IC8 A;  3DKX A;  2WC2 A;  2KIU A;  1Z6T A;  3ERM A;  5GPA A;  1VQK I;  1SAN A;  1AWC A;  4PK4 A;  2NNN A;  5GAH J;  1D3Y A;  1YX3 A;  4E7S A;  2ZJ2 A;  4ESJ A;  2XRO A;  5ICE A;  4KIT B;  5IOZ A;  3WTU C;  3KZZ A;  4Y13 A;  5HOD A;  5LRS A;  2E7X A;  2ELK A;  3JRD A;  3IRQ A;  2I5U A;  2Q0O A;  3CCE I;  2VL8 A;  3JSP A;  3KP7 A;  3AL0 C;  3V7C A;  4G6D A;  3SFI A;  1WJ5 A;  3Q0V A;  3WU0 A;  3AAF A;  2EB7 A;  3EDP A;  2LFB A;  4IHT A;  1HOM A;  1WH5 A;  5CJ9 A;  4WF2 A;  3TP3 A;  4HF2 A;  1SD5 A;  2HVQ A;  1ZG1 A;  3W6J B;  3G4S I;  5HS7 A;  5E79 C;  5HLH A;  3TDZ C;  4JX4 A;  3O2P E;  1MMS A;  5L3B A;  2VBW A;  3CCR I;  1R7J A;  2Y48 A;  1R00 A;  1V3F A;  3I4N J;  2R7R A;  2K9Q A;  3T8T A;  3TGN A;  1W36 D;  4YII A;  1UFM A;  1HDD C;  1CF7 A;  1NG7 A;  3Q9S A;  3BZC A;  1OCO H;  2JA5 J;  4EJT A;  1FX7 A;  4M6Y A;  4L9N A;  4LD5 A;  3MCZ A;  2E1C A;  3HZJ A;  5K7H A;  1I5Z A;  1RNL A;  5K7F A;  4S05 A;  1T08 B;  4KFC A;  1U3E M;  1KU9 A;  1ITY A;  3OYI A;  3RZO J;  1FOY A;  3HGG A;  3HEF A;  1RPW A;  2O8X A;  4A3D J;  5CVJ A;  3GTL J;  4FX4 A;  1TNS A;  3CCL I;  1O3S A;  5E17 F;  2ZXJ A;  1I1G A;  2O5R A;  4IHY A;  5CVR A;  1MJ9 A;  4Y15 A;  4EQQ A;  1ZLK A;  4UY8 I;  3IUO A;  1FY7 A;  1IG7 A;  1TQI A;  2JA8 J;  5FRN A;  5ICG A;  3TKY A;  1X2N A;  2XAS A;  3ONQ A;  2CW7 A;  4DZJ A;  2DA2 A;  3V4G A;  3VOE A;  4NB5 A;  1XGN A;  3S2W A;  2BZT A;  2K7L A;  1IRX A;  2YUS A;  4M71 A;  4HX4 A;  3DWL E;  3PQK A;  4XSX F;  3FF5 A;  1IN6 A;  2ADU A;  1VI0 A;  2R3S A;  4NDL A;  4D5F A;  1VQM I;  4QTR A;  1JXS A;  3PSI A;  1HSJ A;  3DLL F;  3CCV I;  1DUX C;  3KEQ A;  3CTA A;  5A2Q Z;  3ABU A;  4A3I J;  3GME A;  3JRB A;  1YG2 A;  4ZH4 F;  1K6O A;  3ISP A;  4XLC A;  4U0W A;  5FFX A;  5L3E A;  3Q9V A;  4A3E J;  3S93 A;  3IHU A;  4H0E A;  4XN3 A;  1SD6 A;  2K9M A;  4YRV A;  3CCU I;  1NH3 A;  4ESB A;  2DBB A;  1SFO J;  2RV8 A;  2RNG A;  3GZN B;  4FX0 A;  3HOV J;  2X4H A;  1JKP C;  3CZ6 A;  3J7Y J;  2JT1 A;  1BW6 A;  3F6O A;  1ON1 A;  1NTC A;  3KP3 A;  3JAM K;  3M3Y J;  2M2E A;  1ZRC A;  2Z5U A;  2JK3 A;  4ASN A;  1K4S A;  2XKO A;  2UV1 A;  3AG4 H;  3JW4 A;  1G3Y A;  5LLQ A;  4D1Q A;  3O3K A;  1KQ9 A;  1BN5 A;  2CJJ A;  1LUJ B;  3QOE A;  1A31 A;  3OYN A;  4YIR X;  4RM2 A;  3C2H A;  2MSY A;  5C44 J;  4Z6Y A;  2OA4 A;  1BR2 A;  4E7I A;  3C2G A;  2VE8 A;  4QPO A;  2IJL A;  2XHK A;  1JT6 A;  3MQ0 A;  3ZRG A;  3QWL A;  1G3T A;  2XF6 A;  3BZK A;  1LFB A;  3MZY A;  1S72 I;  1P7J A;  1B9N A;  2WY8 Q;  5J40 A;  4XRM A;  2O9L A;  1YIO A;  1BIB A;  4WX9 A;  3BG6 A;  1RUN A;  4RB3 C;  2P6T A;  1MMN A;  1J7K A;  1UHM A;  5JLX A;  4KIC A;  4PDK A;  2K3F A;  1RRJ A;  1Y1V J;  4A0Y A;  2VI6 A;  4M9S A;  4DNC A;  3KP5 A;  1EJ9 A;  2L9R A;  4M6X A;  1IV6 A;  1XGO A;  3CCQ I;  1ZK8 A;  4LK1 F;  3A0B C;  4A0X A;  2FEZ A;  3I4P A;  2F4I A;  2MH2 A;  3PO3 J;  1XS9 A;  3AFH A;  1BR4 A;  1XPX A;  4ESF A;  2Y31 A;  2CQQ A;  1MH4 A;  3JCU C;  1Z3X A;  3RYP A;  4BL0 B;  3CJN A;  1GV5 A;  4OIQ F;  3W3C A;  4P9U A;  2ZBK A;  2E19 A;  3FXO A;  4I76 A;  5HDG A;  3AL0 B;  4AYB N;  2JA7 J;  4HLY A;  1RUO A;  3DPT A;  5L3D A;  3EUK L;  1VQ7 I;  1V5F A;  2VT2 A;  2NRA C;  4FAS D;  3K4M A;  2LBF A;  3OYB A;  2Z1D A;  3L9F A;  2K3P A;  2MD0 A;  4EJU A;  1WQ2 A;  1A5J A;  4JP0 A;  2ESH A;  3I59 A;  4UV9 A;  4ZTJ A;  4XL9 A;  5K5R A;  2GXG A;  4LG0 B;  1W7P A;  4LB5 A;  2RN7 A;  2ECC A;  3TOA A;  1ERD A;  2R7X A;  1OCP A;  3DPL C;  3L00 A;  4CYC B;  3BR1 A;  4GRI A;  4A3K J;  2MLK A;  3I58 A;  3P9K A;  4AYB A;  4GFB A;  4F92 B;  3OYK A;  3P5J A;  3K4B A;  4O5V A;  1ZRF A;  2IXS A;  1BI0 A;  1UHS A;  2XAH A;  4CCO A;  3LSP A;  3KYD B;  1T6S A;  4UB8 C;  4R79 A;  1VQ9 I;  2JN6 A;  1X3Z B;  1OFC X;  4EJO A;  4XON A;  2MYS A;  4I0A A;  2ZXI A;  3A1Y A;  1X1C A;  4BQA A;  3ZMS A;  4KN4 X;  2AXL A;  4ZYE A;  2VJ4 A;  1JUM A;  2RKH A;  2DK8 A;  3SXY A;  3CMM A;  4U88 A;  4YFX F;  3K1P A;  2V26 A;  3HPH A;  2EIL H;  4DYR A;  4NC8 A;  4HX7 A;  5IYB J;  1O3T A;  1YOV B;  5GTI C;  3IL2 A;  1FNN A;  3M07 A;  2K9L A;  4PSX A;  3LAJ A;  2RQQ A;  1X3U A;  2M34 A;  4JBA A;  1G59 A;  4P9F A;  1N75 A;  3O8H A;  1Y1W J;  2HQN A;  1EH6 A;  5DUI A;  4N9H A;  2ZC2 A;  4ANJ A;  2BE5 F;  5BMZ A;  1R22 A;  4J19 A;  2LP0 A;  2KZG A;  1QQI A;  1XC5 A;  3VFZ A;  3I4M J;  2R5Z B;  2L9V A;  3BJ6 A;  3SEQ A;  1U2W A;  2TCT A;  3GXO A;  1T38 A;  1R58 A;  3J7A Y;  4M72 A;  4CUG A;  2RC4 A;  1D0X A;  3G3Z A;  3FXU A;  2BY1 A;  1G6N A;  4BDZ A;  4M3F A;  4A3C J;  3CF5 F;  3OV8 A;  2YSR A;  5D4R A;  1IXC A;  3BRO A;  3EUH A;  2PJR B;  3ASN H;  2CV0 A;  3A2K A;  4XLN F;  4V2F A;  4LJZ F;  2ZFW A;  4M3D A;  2H1L A;  2V79 A;  3A03 A;  2VKD A;  4C2U A;  5IT9 Z;  2BYV E;  4CA0 A;  5BPI A;  2FRH A;  4G7Z F;  3RKW A;  1XCV A;  4A5N A;  5D8K B;  1G3S A;  1RET A;  4F91 B;  1EA3 A;  2PX9 A;  2DA7 A;  2K5C A;  1ACI A;  3RCO A;  4D9J A;  2CH0 A;  2NOG A;  3SHF A;  1Z0X A;  2DMP A;  1IRF A;  2ICW G;  5EEG A;  5EDN A;  1Y56 A;  5B1B H;  1K78 B;  1SVO A;  1BBY A;  2WWY A;  3I3L A;  3JSO A;  1J0R A;  3X2Q H;  3G73 A;  2EFP A;  2KIF A;  3KZI C;  3L2W A;  3S3N A;  3VEP A;  5IP7 J;  4CH7 A;  2V1U A;  2CMP A;  3HYI A;  2Y0S N;  2L54 A;  4C3J J;  4DGW B;  2B9S A;  2VBZ A;  3FX3 A;  4GCV A;  2X6O A;  3R6S A;  2CV2 A;  3PIO F;  2DOF A;  1WZ2 A;  1R4N B;  3T0Y A;  2FBK A;  3SJM A;  2VXD A;  3KEO A;  1G8X A;  5GP9 A;  2DW4 A;  2VC0 A;  2WV0 A;  2NVQ J;  3ZQL A;  2DN0 A;  4E6K G;  1B72 B;  1WI9 A;  3ZQI A;  5K5O A;  1IV8 A;  1YS7 A;  4DJA A;  2W00 A;  5E8I A;  2C6Y A;  1OQY A;  1DPU A;  2Y0S A;  5LHH A;  4KA4 A;  2GM4 A;  1BI2 A;  4II3 A;  5AIP A;  2D45 A;  3HIF A;  2ISZ A;  5DYM A;  5F6F A;  5DCM B;  3BTI A;  2STT A;  1TT5 B;  2NNY A;  3FXQ A;  5FFZ A;  2PJP A;  1JTY A;  4BEH B;  4ENK A;  1J75 A;  3UR3 C;  3S1N J;  4RGR A;  2YX7 A;  2GOM A;  3E6B A;  2CS3 A;  4CSW A;  2OU2 A;  2FX0 A;  2VQL A;  3DEW A;  5TRD A;  1I3A A;  2QSH X;  1ZG5 A;  4WCG A;  2DQR A;  5J6X A;  3CCS I;  1BIA A;  1W0T A;  3OR2 C;  2R7F A;  4UV8 A;  5JR3 A;  4RM3 A;  1FYK A;  5DD8 A;  5C4J J;  2IAI A;  2OZU A;  4PJM A;  4HA8 A;  5LFA A;  4IO9 F;  3ZQG A;  3LFU A;  4ABZ A;  3H5N A;  1MJA A;  5M5W J;  5LD2 C;  3CUO A;  2IS4 A;  3DU6 A;  4L0Z B;  4GXO A;  3LSJ A;  5JVT A;  1QBJ A;  4B4C A;  3BR0 A;  4FQG A;  2R4G A;  4OIN F;  3TO9 A;  1KYZ A;  2GIZ A;  2GOX B;  3CDH A;  3CES A;  1B6A A;  2A05 A;  2EA2 A;  3W6V A;  2F4M B;  3DLA A;  3S1M J;  4MEY F;  1HF0 A;  2BHZ A;  4HV6 A;  2JTV A;  4S04 A;  2YU3 A;  5DUK A;  3V8J A;  2OBP A;  4IPA A;  3BJA A;  3MKY B;  5FO5 A;  3H92 A;  5F0H A;  3K70 C;  5DM6 F;  4HDU A;  1BJZ A;  4XKV A;  2DTR A;  4BBS J;  2NVU B;  1A35 A;  1TP4 A;  1R5I D;  2VKV A;  3WOD F;  3OS1 A;  5HNH A;  2COM A;  5A2Q K;  2M7A A;  3JRI A;  4D7N A;  3N4M A;  1E3H A;  2VJ5 A;  3CDL A;  4HBL A;  2V6E A;  4KDP A;  1Q1V A;  5D4S A;  4Y3O A;  5FKN A;  1X4O A;  1R1V A;  2KLO A;  2L4M A;  2XVC A;  2NS0 A;  2CFX A;  3SDG A;  4AVZ A;  3OSG A;  1X2M A;  1N25 A;  3E5X A;  4A0Z A;  4CGZ A;  3M8F A;  4MNU A;  3IKV A;  4N4N B;  1R71 A;  1GXP A;  1B9M A;  4G94 A;  2VN2 A;  3OR1 C;  3OYE A;  1WSU A;  2W24 A;  1XCB A;  1I1S A;  2OF7 A;  4GYI A;  2DXI A;  3K69 A;  3V7R A;  4BEH A;  1K83 J;  2H09 A;  1Z77 A;  4I02 A;  3ZGK A;  2VQC A;  3KPH A;  1YW9 A;  3IH3 A;  3KP4 A;  5CLS A;  5J1Y A;  2X9D A;  2CW0 F;  4UUS A;  1K79 A;  4L9T A;  3ZPL A;  2O7O A;  4YG2 F;  1XSD A;  2M4G A;  1LJ9 A;  2LRE A;  4PCQ A;  2A5W A;  1J9I A;  4CZC A;  1QGP A;  1UST A;  2JUC A;  2EA4 A;  5C4X J;  3HPG A;  1A6I A;  1M1E B;  2YU9 J;  2CUZ A;  3ABL H;  1WVR A;  3LSI A;  1VF9 A;  4ETS A;  2KL4 A;  4UUT A;  1S8N A;  1WI3 A;  2W57 A;  2HVR A;  5LHI A;  1YTY A;  1W4M A;  3F72 A;  1HW2 A;  1WJB A;  2OTL I;  1MSF C;  5BPD A;  1HKQ A;  2XV4 S;  2LTP A;  3HHH A;  1FPQ A;  3MKZ A;  3RQI A;  3ECO A;  2P5V A;  1S7A A;  2NVT J;  3OMY A;  5AON A;  3ZN1 A;  4BS9 A;  3DBH B;  2L2O A;  1TQM A;  5DM7 F;  2VT3 A;  4RDU A;  1X1A A;  2X1C A;  1Z9C A;  5CQG A;  3BPV A;  2E2I J;  1TC3 C;  2VBX A;  3I53 A;  3WTX C;  2MLG A;  3U1D A;  5KAI C;  3DEU A;  1NK2 P;  2XAU A;  2K4B A;  3F23 A;  2KP6 A;  3WTT C;  4BE2 A;  5L3G A;  3OL4 A;  2AS5 F;  2KIQ A;  3HKZ N;  1FWZ A;  1PUE E;  2XAF A;  3LMM A;  5CYV A;  4HQE A;  3GTO J;  2E60 A;  3JRH A;  2HR3 A;  2V1D A;  3ROU A;  3IAS 2;  1IF1 A;  1TWA J;  1Z7U A;  3PJR A;  1RZ4 A;  5FLX Z;  1Z7L A;  2DDA A;  2XRL A;  3M1C A;  3LFK A;  1AA7 A;  1FBU A;  2DU9 A;  2EV6 A;  2LDU A;  5F08 A;  2ZXW H;  1GUU A;  4FE7 A;  2MW8 A;  3BG5 A;  3ELK A;  5KCM A;  2FMY A;  2FQ4 A;  2HZT A;  2MFZ A;  1BW5 A;  2H8R A;  1P9Q C;  2ZSI B;  2ZB9 A;  5F1J A;  2E36 A;  3SZG A;  2ZNZ A;  1H89 C;  1CF7 B;  3HKZ A;  2VOP A;  1ZQ3 P;  2R0Q C;  5IPA A;  2BW3 A;  1AKH A;  4KMF A;  2N8G A;  2QKL B;  3N05 A;  2EIM H;  4HX8 A;  2W7N A;  2UUZ A;  2HQ5 A;  3SFZ A;  3HL2 A;  4BNC A;  4CHU A;  3BWG A;  5J3L A;  4ZYD A;  5IOY A;  3EUA A;  4MQV A;  1EKE A;  3TO7 A;  3E6C C;  3K9T A;  4TV7 A;  4MTE A;  2AQE A;  3J80 Z;  4II2 A;  3NAU A;  4BQO A;  2EFO A;  3BP8 A;  2HOE A;  2KRH A;  3GFM A;  1NK3 P;  1K4T A;  2Y2Z A;  4UVC A;  4ENM A;  5HNF A;  2XIG A;  2WTE A;  1LEB A;  1HA8 A;  3ECH A;  1R6R A;  3KLO A;  4E7K A;  4MHG A;  3LSH A;  4CCL A;  5D5V B;  3E6D A;  3OY9 A;  2QQA A;  4RLF A;  4HPQ A;  5D8L B;  2PEX A;  3DPU A;  3ZQQ A;  5BQT A;  1IN4 A;  1AU7 A;  5DD4 A;  4PJL A;  4OIP F;  2BVM A;  4NNJ A;  4LLN A;  1X1D A;  2GIV A;  3MKW B;  3S14 J;  4MGR A;  2FOW A;  5E3N A;  1OR7 A;  2RRE A;  5IYD J;  3SZT A;  4Q48 A;  1AOY A;  3V7S A;  2HOT A;  5CPR B;  1ETK A;  2CW8 A;  4DIQ A;  2IGM A;  4XN0 A;  3EUH C;  3HG9 A;  1OCC H;  4R1H A;  3CC4 I;  2ZCW A;  2GXB A;  2DPU A;  3LSG A;  1DPR A;  3TL4 X;  4Q47 A;  2BOL A;  4L9J A;  2P8T A;  3BTJ A;  1MGT A;  2L5Q A;  4R8H A;  3CLQ A;  2XC7 A;  1GT0 C;  4I2O A;  5ILV A;  3F8M A;  5JHU A;  1YJ9 I;  4M74 A;  1FOX A;  4B1R A;  3AKZ A;  3HOU J;  4G7O F;  4JOM A;  5GAG J;  1PVE A;  5BS6 A;  4PGG A;  1FP2 A;  3K7A J;  2KQR A;  1W1W E;  2RGV A;  4HNT A;  1W5T A;  2BXY A;  4A6D A;  1S6L A;  2PMH A;  2DMU A;  2KIS A;  2LSO A;  2X1D A;  4V2G A;  2KZV A;  4B3X A;  1Y0U A;  4M6V A;  5D6F A;  3CME I;  1N77 A;  4B47 A;  2DA4 A;  3HB9 A;  4Y7N J;  5ICC A;  4KIG A;  2FU4 A;  2CV1 A;  1HW5 A;  2R7D A;  3LQR A;  4I0B A;  1POG A;  2GBY A;  2KHM A;  3HOX J;  1FLI A;  3GVA A;  3CF2 A;  4BDY A;  2ZO4 A;  2CGP A;  1TL8 A;  1FYM A;  1LDK B;  1TLH B;  2HOA A;  2PMU A;  4CYD A;  4BQQ A;  3VYU B;  3PIP F;  1S3J A;  4M3E A;  5HVQ C;  1D8J A;  4S0H B;  1R1U A;  5H2F C;  1MIJ A;  1SVM A;  1P4X A;  3AG2 H;  4DBR A;  2V9V A;  2HXO A;  2DMN A;  5EF6 A;  4YEJ A;  1MDM B;  2V1N A;  2EZH A;  4LK0 F;  3A4C A;  3BOQ A;  4PFP A;  1TNT A;  3H0G J;  1TQP A;  3J81 K;  1Q1H A;  2CQN A;  1WRJ A;  5HLG A;  2QVO A;  4UHT A;  1LE8 A;  3E6M A;  3G1M A;  2LKX A;  1DP7 P;  3KFW X;  3BG3 A;  4MFD A;  2CU7 A;  3KYL A;  4E7L A;  1XTA A;  4IZZ A;  2HQR A;  1H88 C;  4G7H F;  5FKL A;  1SEU A;  3GTQ J;  2JA2 A;  5M3M J;  5KNL A;  5LGT A;  2IW5 A;  1YJW I;  3I54 A;  5DTD A;  1SAX A;  1JJ8 C;  4MO7 A;  2HXI A;  3Q5F A;  2IA1 A;  4F55 A;  1CGP A;  1U78 A;  4KIS A;  4HST A;  2GA2 A;  2PBI A;  3K10 A;  3WE3 A;  2FBI A;  1YQA A;  2VQG A;  2WBM A;  3AG3 H;  3PQJ A;  3CO7 C;  1FT9 A;  4AWX B;  1ETO A;  5EEA A;  1Z3Y A;  2WAE A;  1UJ8 A;  3GO5 A;  4AIH A;  2LBF B;  3GBG A;  5EG0 A;  1IW7 F;  3FKI J;  3HJE A;  4NQW A;  2BHY A;  3EYY A;  2VPL A;  1KU2 A;  1QHG A;  2K86 A;  2XUB A;  2OQR A;  1USS A;  3I59 B;  1WH7 A;  1UG2 A;  1Z05 A;  1W7P B;  5LEK A;  5CVU A;  3BR3 A;  3VPR A;  2WA0 A;  4LLG F;  2YS9 A;  3BLY A;  1IN5 A;  1HST A;  3LA2 A;  4I98 B;  2WY7 Q;  2EZI A;  4DYQ A;  1MH3 A;  3NQO A;  2QBY A;  4PJ0 C;  2XPV A;  3QYF A;  2D5V A;  1R1T A;  3HOT A;  4B48 A;  1DP3 A;  1LVA A;  3DP7 A;  4AD9 A;  4IQJ A;  1FBS A;  4Y4R A;  1D1B A;  1LVK A;  4GYG A;  5D6E A;  4BJ6 C;  1KA8 A;  2W84 A;  1ETY A;  5B3S H;  4ZDP A;  2V6C A;  3H5R A;  2W85 A;  1SFU A;  1MDM A;  1XDU A;  1SFE A;  1XMA A;  1O7L A;  1OKR A;  2CWE A;  5GTH C;  1IJW C;  2DOE A;  3ZMV A;  2P6S A;  3QRF F;  2LKP A;  4BE0 A;  1MBF A;  1OIS A;  2LMD A;  5CKT A;  2NAZ A;  2QCO A;  3MMY B;  4LMY A;  5FRO A;  5C3E J;  4C9Y A;  5F0C A;  5JFR A;  5CVV A;  3H9J A;  1GXQ A;  2GQQ A;  1B1B A;  1T95 A;  3ZMT A;  2Z3Y A;  5J4Y A;  3FMQ A;  2K27 A;  2RNJ A;  2FOK A;  1DGW Y;  3H9Q A;  3K0L A;  4L5I A;  2ZJP F;  2AHQ A;  2M3A A;  3BPX A;  5J8C A;  5J47 A;  3GFL A;  3HM5 A;  3K6G A;  1MW7 A;  1S7E A;  2XGX A;  2OAZ A;  4F3Q A;  3FK6 A;  2EK5 A;  3JTH A;  2WB1 N;  3FXM A;  2K40 A;  3KCC A;  4MIM A;  3ZQC A;  2P5K A;  2Y9Z A;  2OUM A;  3GFI A;  1SFX A;  2E1M C;  1SD7 A;  4A93 J;  2I10 A;  3VSL A;  4X6A J;  5D5W B;  1RR8 C;  4M9Z A;  2O0Y A;  1UHW A;  3GEZ A;  1P2F A;  4BBR J;  2D1V A;  5KK1 A;  2KJC A;  2MD5 A;  1ZR2 A;  2OJE D;  3L1P A;  3IH4 A;  2P7V B;  1YE9 A;  3ABM H;  4NUB A;  3GTK J;  4N4O B;  5F27 A;  2JPC A;  5KVR A;  5ILU A;  1QA6 A;  2QSG X;  2H1K A;  2WB1 A;  2X51 A;  5F1R A;  1RIO H;  4UUV A;  3OL3 A;  3HOY J;  1JJ6 C;  3TP0 A;  2E71 A;  4ITV A;  2VKE A;  4KIB A;  4WXC A;  2BV6 A;  2MBF A;  3VYS B;  2DK5 A;  5FD6 A;  4U0Y A;  4KJZ A;  3GLX A;  2LF7 A;  1ZG3 A;  5LHG A;  2QZ8 A;  4YFK F;  1ETQ A;  2PI0 A;  4EM1 A;  2R7W A;  2MG4 A;  4X1E A;  3VWB A;  2IPQ X;  1N78 A;  1SD4 A;  3ZP5 A;  4MLO A;  2Q1Z B;  2ME0 A; 
#chains in the Genus database with same CATH homology
 3P9C A;  3GUD A;  1JGS A;  2ACJ A;  4EV0 A;  3GWZ A;  1U8R A;  3FM5 A;  2XAJ A;  4HAM A;  1XGS A;  3R60 A;  2FBH A;  3E97 A;  3KE2 A;  1REP C;  5FLX K;  1R5G A;  3DQV C;  3ZQ7 A;  3R0J A;  1Z91 A;  3HOS A;  3EQL F;  2OQG A;  3KET A;  2IT0 A;  1UCR A;  3QAH A;  4PZJ A;  4G8X A;  1YLF A;  2GWR A;  3FMR A;  4Y17 A;  2F5C A;  1I6X A;  4IJA A;  2UWM A;  2E1N A;  1KU3 A;  3F8N A;  3RKX A;  2MA3 A;  5HDK A;  1BC7 C;  4P5O A;  1STZ A;  1W5S A;  3HRS A;  2QQB A;  1V4R A;  3BDD A;  2FML A;  4KMU X;  2O3F A;  4JQF A;  5L3F A;  2L4A A;  1SMY F;  4RS8 A;  2M8E A;  1GHC A;  2QQ9 A;  2A69 F;  3KZY A;  3F8F A;  3R4K A;  3WTS C;  1OYW A;  1KGS A;  3MEX A;  4WXH A;  4KIF A;  4HOB A;  2IRF G;  4ZZD A;  3DF8 A;  2A6H F;  4QLC U;  3W6K B;  1IN8 A;  2IP2 A;  4ZZL A;  4IHS A;  2L3D A;  2FQ3 A;  2KJB A;  2EFW A;  1SMT A;  3E5Q A;  4ENJ A;  4N9I A;  3SZP A;  3FHZ A;  2CYY A;  1BC8 C;  3FZV A;  5F64 A;  2MC3 A;  1U5T A;  1ZRE A;  3J7A O;  4EMS A;  4N0B A;  2P4W A;  2Q2E A;  5HOO A;  3F8C A;  4WK8 F;  2BBY A;  2HYG D;  1O3R A;  2BEO A;  3T1B A;  5E8G A;  1G3W A;  2UXN A;  1L0O C;  1Z6R A;  2E7W A;  1KQ8 A;  3JAM Z;  2PQ8 A;  3LWF A;  2EFN A;  3K1M A;  2D1H A;  1XN7 A;  2JRT A;  1IZ1 A;  2DLL A;  5LRR A;  4YIF A;  4EVI A;  2FE3 A;  3WTZ A;  2O61 A;  1J2X A;  1HKS A;  5E1Z B;  1HQC A;  5LGN A;  4P96 A;  4M9X A;  3C7J A;  3CO6 C;  3HTS B;  4EGY A;  4EM2 A;  1E2X A;  4KUM A;  1C0W A;  5HLI A;  2L01 A;  3ULQ B;  4I7H A;  1YW7 A;  5H20 A;  3MWM A;  4CO8 A;  1HKT A;  1QZZ A;  4AIJ A;  1K7A A;  2JZY A;  2PLY A;  4A5M A;  1ZHF A;  3GZ6 A;  3ML6 A;  4OMZ A;  1XSV A;  1ON2 A;  5E1W A;  2VOO A;  4IRG A;  3MZH A;  3RI4 A;  1LQ1 A;  3KLN A;  1PP7 U;  2EJR A;  2M1B A;  2JSC A;  1QNT A;  1FYL A;  4G9Y A;  5FD5 A;  3LA7 A;  2FNP A;  2FXA A;  4GO1 A;  1JHF A;  3HRU A;  1EH7 A;  1F4K A;  5DV5 A;  4OU0 A;  2HYF A;  4PGH A;  4HF1 A;  2PN6 A;  4XRF A;  3T8R A;  1PP8 F;  2OZ6 A;  2Z33 A;  5LGU A;  3F3X A;  2ZNY A;  3ZMZ A;  1YYV A;  2YR2 A;  2G7H A;  1OPC A;  3RJP A;  5HS8 A;  3REO A;  2ESN A;  3IWF A;  3LA3 A;  3COA C;  1I27 A;  4G6Q A;  2OD5 A;  1ZGA A;  3WE2 A;  1ODD A;  2F5E A;  4XLP F;  1FC3 A;  1WKM A;  3C3W A;  4HF0 A;  2ZKZ A;  4UXN A;  1TW2 A;  3OOP A;  4IF4 A;  1ZYR F;  5BOX A;  1HXD A;  5K5Q A;  3GX4 X;  1KU7 A;  1P92 A;  4I01 A;  4RB1 A;  2IVM A;  2O03 A;  1RI7 A;  3C18 A;  3CUQ A;  4UVA A;  1DDN A;  4B8X A;  3N97 A;  3L2C A;  2Y75 A;  4I09 A;  1G4D A;  4NHJ A;  4U7B A;  2HKO A;  4HLX A;  2HFH A;  4WXD A;  2ETH A;  1XGM A;  1YS6 A;  4EM0 B;  1H9T A;  4UVB A;  5TJJ A;  2DAO A;  4BYY A;  5E20 A;  4RAY A;  2HTS A;  5IT9 K;  3WGI A;  1LEA A;  3F22 A;  1ZGJ A;  4DQ2 A;  1EV7 A;  1T98 A;  2Z99 A;  1P4W A;  2XAG A;  4HYE A;  6PAX A;  4IVN A;  3VB2 A;  3DXJ F;  3QPT A;  2QBY B;  1F1Z A;  2STW A;  4CZZ A;  2H6C A;  1KYW A;  4RGU A;  1T39 A;  1LDD A;  3CLO A;  3LAP A;  2M45 A;  1O3Q A;  4ON0 A;  2HGC A;  3HUG A;  4ENN A;  2A68 F;  2M5W A;  4YFN F;  3LST A;  2QYO A;  2KIM A;  1HBX G;  2VON A;  5D5U B;  1O57 A;  1BM9 A;  1BJA A;  2UXX A;  4A6E A;  1L3L A;  1VTN C;  2ZME A;  4RB0 A;  1XMK A;  1H0M A;  1U5T C;  2DI3 A;  1IXS B;  3WU1 B;  4FHT A;  3V8K A;  4FT8 A;  2QWW A;  3PFI A;  4A2U A;  2HKX A;  2XRN A;  1MZB A;  3BZ6 A;  1QZY A;  1EH8 A;  2FNA A;  2X0L A;  2PFB A;  2PG4 A;  2DQL A;  2VOD A;  4OOI A;  2QM3 A;  3RYR A;  3M1E A;  1IXR C;  1P6R A;  4RAZ A;  5D5X B;  3ABT A;  4K2E A;  1ZRD A;  4HQM A;  1S7O A;  2F5F A;  2EFQ A;  3B02 A;  1A04 A;  3ZMU A;  2W25 A;  4HW0 A;  3NRV A;  1T0F A;  5J8F A;  2GAU A;  1J59 A;  4Q4Z F;  1QO0 D;  4XSZ F;  2FA5 A;  4EGZ A;  4BHC A;  2JPB A;  4WWC A;  1YW8 A;  4HV5 A;  2VBY A;  3D5L A;  1ZAR A;  5AIQ A;  3WGG A;  3QP6 A;  3RKY A;  1FP1 D;  3IC7 A;  3LQQ A;  3H3Z A;  2GZW A;  4RGX A;  3I64 A;  3TQN A;  1IRG A;  1OYI A;  2QUF A;  1O7F A;  2HDC A;  3I5U A;  3KP6 A;  1ULY A;  1FZP B;  5DEQ A;  2Z9O A;  3M8E A;  2DFI A;  3T5X A;  2CQK A;  3GYH X;  2UZK A;  2G9W A;  2QEN A;  2ELH A;  4CIC A;  4IRH A;  1UB9 A;  3C1D A;  3MAJ A;  3ZN0 A;  4Z2Y A;  1U6G A;  1IN7 A;  4JK1 X;  1F5T A;  1MD0 A;  4BXU A;  3R0A A;  5CVI A;  4IRI A;  2J5O A;  2QLZ A;  2RQP A;  4AIK A;  2G7U A;  1BI3 A;  1ONV A;  1TTY A;  3ZMD A;  4ZYG A;  4CXF A;  3P7N A;  2H27 A;  5ILS A;  1B4A A;  5LBQ A;  3RPU A;  3IWZ A;  4O6J A;  1LDJ A;  4OIR F;  3WTV C;  1XDS A;  4BH9 A;  2NYX A;  2F2E A;  2A07 F;  2XKP A;  2RVC A;  4EJV A;  2GA1 A;  1FSH A;  3IKT A;  4IXA A;  1U5T B;  1R36 A;  4BAY A;  2KRF A;  1JE8 A;  3JTG A;  2CO5 A;  5JI6 A;  3J80 K;  1P4A A;  2MH9 A;  3CUQ C;  3HSR A;  4L5J A;  3F8B A;  2LF8 A;  2A5Y B;  3F6V A;  1GVJ A;  3QP5 A;  5E1X A;  2HWV A;  2DO7 A;  3P9I A;  1YFH A;  3DKW A;  3D0S A;  4OIO F;  4LG0 A;  4P55 A;  1WWX A;  3E5U A;  1NHA A;  2P5L C;  4LLL A;  1OMI A;  2DPD A;  2Q8K A;  1D5V A;  1H9G A;  4HDV A;  3NEU A;  3EET A;  1W7P D;  2HEO A;  5FB2 A;  1XB4 A;  3MFK A;  5DDG A;  3K2Z A;  2EV5 A;  4B09 A;  1MJB A;  3SQN A;  3I0T A;  5ERI A;  3J81 Z;  1J5Y A;  3RTR A;  4L9V A;  1D8K A;  3B73 A;  4RGS A;  3TDU C;  4O3M A;  3BJO A;  2DT5 A;  1BI1 A;  2BGC A;  1IUY A;  1S29 A;  2XAQ A;  2VXZ A;  1ZN2 A;  3RPQ A;  1R23 A;  4BHB A;  3DV8 A;  2HTJ A;  3L09 A;  1YO5 C;  3HHG A;  4U0V A;  1PDN C;  5LEJ A;  3FM3 A;  3U2R A;  3I71 A;  4D0P A;  4F7Z A;  4LFU A;  2YX4 A;  1T2K A;  2Y0M A;  3RIR A;  5E18 F;  2P7C B;  1B59 A;  5HDN A;  3QPH A;  1ZH5 A;  4L18 B;  3H3U A;  4OMY A;  1K78 A;  4HZF A;  1ZAO A;  3WTW C;  2D2W A;  4ZYH A;  4KYW A;  2H94 A;  3M7G A;  5HS9 A;  3GW2 A;  2EWN A;  5IT3 A;  3BY6 A;  2VE9 A;  2IA2 A;  4MEX F;  3O6B B;  2TDX A;  2KKO A;  2YPR A;  3HTU A;  3QU6 A;  2FSW A;  3QOP A;  3VOD A;  1FBQ A;  5DCF A;  3TOB A;  3FMS A;  3ERE D;  2A61 A;  2B0L A;  2ISY A;  2V1X A;  5H6R A;  3K1N A;  5DCM A;  3FWE A;  3HSF A;  3M9A A;  3WGH A;  3F21 A;  2J5P A;  4XBF A;  2FF4 A;  4UNO A;  1TBX A;  2IA0 A;  1HW1 A;  2RDP A;  2VC1 A;  2HS5 A;  2K02 A;  1JHH A;  1QPM A;  3IRR A;  3WG9 A;  3HSE A;  2EV0 A;  2F5D A;  1ZLJ A;  2CG4 A;  1XSX A;  1KQ0 A;  5EEH A;  3CUQ B;  4U7D A;  3HRT A;  1FOK A;  1F9N A;  3GFJ A;  1IAW A;  1R5H A;  2A6E F;  5K1Y A;  2M87 A;  3V8L A;  4KT5 C;  1OYY A;  2H6B A;  4BHP A;  2O6G E;  5ED4 A;  5ICF A;  1LNW A;  3E3V A;  3DFG A;  4Q5S F;  1E17 A;  3TO6 A;  2CSO A;  4E70 A;  3HRM A;  3EYI A;  4MTD A;  4KN7 X;  3KP2 A;  4LGW A;  3WTY C;  4A12 A;  4GGG A;  4CDG A;  4MQ9 F;  4AVP A;  2M30 A;  3R61 A;  4KNY A;  3RDI A;  1MKM A;  4QWQ A;  2LNB A;  4RB2 C;  3FXR A;  1Z1D A;  3L7W A;  3GZ5 A;  2A3S A;  4L0Y B;  2L02 A;  4M73 A;  5L3C A;  4EJW A;  5FGM A;  3GF2 A;  1XD7 A;  3QU3 A;  5H6Q A;  1LB2 A;  1TW3 A;  1FSE A;  4LB6 B;  1BOA A;  3U9G A;  2ZME B;  2K4J A;  2WC2 A;  2KIU A;  1Z6T A;  1AWC A;  2NNN A;  1D3Y A;  4ESJ A;  2ZJ2 A;  2XRO A;  5ICE A;  3WTU C;  3KZZ A;  4Y13 A;  5LRS A;  2E7X A;  3IRQ A;  2Q0O A;  3JSP A;  3KP7 A;  3V7C A;  4G6D A;  3WU0 A;  3AAF A;  2EB7 A;  3EDP A;  4IHT A;  5CJ9 A;  4WF2 A;  4HF2 A;  1SD5 A;  1ZG1 A;  3W6J B;  5HS7 A;  5HLH A;  3TDZ C;  3O2P E;  5L3B A;  2VBW A;  1R7J A;  2Y48 A;  1R00 A;  1V3F A;  3T8T A;  3TGN A;  4YII A;  1UFM A;  1CF7 A;  3Q9S A;  4EJT A;  1FX7 A;  4M6Y A;  4L9N A;  4LD5 A;  3MCZ A;  2E1C A;  1I5Z A;  1RNL A;  4S05 A;  4KFC A;  1U3E M;  1KU9 A;  2O8X A;  5CVJ A;  4FX4 A;  1TNS A;  1O3S A;  5E17 F;  2ZXJ A;  1I1G A;  5CVR A;  1MJ9 A;  4Y15 A;  4EQQ A;  1ZLK A;  1FY7 A;  1TQI A;  5ICG A;  3TKY A;  2XAS A;  3V4G A;  3VOE A;  4NB5 A;  1XGN A;  3S2W A;  2K7L A;  4M71 A;  4HX4 A;  3PQK A;  4XSX F;  3FF5 A;  1IN6 A;  2ADU A;  2R3S A;  1JXS A;  1HSJ A;  1DUX C;  3KEQ A;  3CTA A;  5A2Q Z;  3ABU A;  1YG2 A;  4ZH4 F;  1K6O A;  3ISP A;  4U0W A;  5FFX A;  5L3E A;  3Q9V A;  3IHU A;  4H0E A;  1SD6 A;  4ESB A;  2DBB A;  2RV8 A;  4FX0 A;  2X4H A;  2JT1 A;  3F6O A;  1ON1 A;  3KP3 A;  3JAM K;  1ZRC A;  2Z5U A;  4ASN A;  2XKO A;  3JW4 A;  1G3Y A;  5LLQ A;  3O3K A;  1KQ9 A;  1BN5 A;  2OA4 A;  2VE8 A;  2IJL A;  2XHK A;  3MQ0 A;  1G3T A;  3MZY A;  1B9N A;  1YIO A;  1BIB A;  4WX9 A;  1RUN A;  4RB3 C;  2P6T A;  1J7K A;  1UHM A;  4KIC A;  4PDK A;  4A0Y A;  4DNC A;  4M9S A;  3KP5 A;  4M6X A;  1XGO A;  4LK1 F;  4A0X A;  2FEZ A;  3I4P A;  2MH2 A;  4ESF A;  3RYP A;  3CJN A;  4OIQ F;  4P9U A;  2ZBK A;  5HDG A;  4HLY A;  1RUO A;  3DPT A;  5L3D A;  2VT2 A;  2NRA C;  3L9F A;  4EJU A;  1WQ2 A;  2ESH A;  3I59 A;  4UV9 A;  5K5R A;  2GXG A;  4LG0 B;  1W7P A;  4LB5 A;  2RN7 A;  3TOA A;  3DPL C;  3L00 A;  2MLK A;  3I58 A;  3P9K A;  4O5V A;  1ZRF A;  1BI0 A;  2XAH A;  1T6S A;  4R79 A;  4EJO A;  4I0A A;  4BQA A;  3ZMS A;  4KN4 X;  2AXL A;  4ZYE A;  2RKH A;  2DK8 A;  3SXY A;  4U88 A;  4YFX F;  3K1P A;  4HX7 A;  1O3T A;  3IL2 A;  1FNN A;  3LAJ A;  1X3U A;  4JBA A;  4P9F A;  2HQN A;  1EH6 A;  5DUI A;  4N9H A;  2BE5 F;  5BMZ A;  1R22 A;  1QQI A;  3VFZ A;  3BJ6 A;  1U2W A;  3GXO A;  1T38 A;  1R58 A;  4M72 A;  2RC4 A;  3G3Z A;  3FXU A;  1G6N A;  3OV8 A;  2YSR A;  5D4R A;  1IXC A;  3BRO A;  3EUH A;  4XLN F;  4LJZ F;  2ZFW A;  2V79 A;  5IT9 Z;  2BYV E;  5BPI A;  2FRH A;  4G7Z F;  3RKW A;  1XCV A;  4A5N A;  5D8K B;  1G3S A;  3SHF A;  1IRF A;  5EEG A;  1K78 B;  1BBY A;  2WWY A;  3JSO A;  1J0R A;  3G73 A;  2EFP A;  2KIF A;  3VEP A;  2V1U A;  3HYI A;  2L54 A;  2VBZ A;  3FX3 A;  4GCV A;  3R6S A;  3T0Y A;  2FBK A;  3KEO A;  2DW4 A;  2VC0 A;  2WV0 A;  1WI9 A;  5K5O A;  1YS7 A;  5E8I A;  2C6Y A;  1DPU A;  4KA4 A;  5LHH A;  1BI2 A;  5AIP A;  2D45 A;  3HIF A;  2ISZ A;  5DYM A;  5F6F A;  5DCM B;  2STT A;  2NNY A;  3FXQ A;  5FFZ A;  2PJP A;  4ENK A;  1J75 A;  4RGR A;  2YX7 A;  3E6B A;  2OU2 A;  5TRD A;  1ZG5 A;  4WCG A;  2DQR A;  5J6X A;  1BIA A;  2R7F A;  4UV8 A;  5JR3 A;  1FYK A;  5DD8 A;  2OZU A;  4HA8 A;  1MJA A;  3CUO A;  4L0Z B;  4GXO A;  5JVT A;  1QBJ A;  4OIN F;  3TO9 A;  1KYZ A;  3CDH A;  1B6A A;  2EA2 A;  4MEY F;  4HV6 A;  2JTV A;  4S04 A;  2YU3 A;  5DUK A;  3V8J A;  2OBP A;  4IPA A;  3BJA A;  5FO5 A;  3H92 A;  4HDU A;  2DTR A;  3WOD F;  2COM A;  5A2Q K;  3N4M A;  4HBL A;  4KDP A;  5D4S A;  1R1V A;  2L4M A;  2XVC A;  2NS0 A;  2CFX A;  3E5X A;  4A0Z A;  4CGZ A;  3M8F A;  4MNU A;  3IKV A;  1GXP A;  1B9M A;  4G94 A;  2VN2 A;  1WSU A;  2W24 A;  1XCB A;  1I1S A;  4GYI A;  3K69 A;  3V7R A;  2H09 A;  4I02 A;  1YW9 A;  3KP4 A;  5CLS A;  2CW0 F;  1K79 A;  4L9T A;  3ZPL A;  4YG2 F;  1XSD A;  1LJ9 A;  4PCQ A;  1J9I A;  1QGP A;  1UST A;  2EA4 A;  4ETS A;  1S8N A;  2W57 A;  5LHI A;  1YTY A;  1W4M A;  3F72 A;  1HW2 A;  5BPD A;  1HKQ A;  2XV4 S;  3HHH A;  3ECO A;  2P5V A;  1S7A A;  5AON A;  3ZN1 A;  1TQM A;  2VT3 A;  1Z9C A;  3BPV A;  2VBX A;  3I53 A;  3WTX C;  2MLG A;  3U1D A;  3DEU A;  2K4B A;  3F23 A;  3WTT C;  5L3G A;  2AS5 F;  1FWZ A;  1PUE E;  2XAF A;  5CYV A;  4HQE A;  2HR3 A;  2V1D A;  3ROU A;  1IF1 A;  1Z7U A;  1RZ4 A;  5FLX Z;  3LFK A;  1FBU A;  2DU9 A;  2EV6 A;  2LDU A;  3ELK A;  2FMY A;  2HZT A;  2ZNZ A;  1CF7 B;  2VOP A;  4KMF A;  4HX8 A;  3SFZ A;  4BNC A;  4CHU A;  3BWG A;  4ZYD A;  4MQV A;  3TO7 A;  3E6C C;  3K9T A;  4TV7 A;  4MTE A;  3J80 Z;  2EFO A;  3BP8 A;  2HOE A;  3GFM A;  4UVC A;  4ENM A;  2XIG A;  2WTE A;  1LEB A;  3ECH A;  3KLO A;  4MHG A;  5D5V B;  3E6D A;  2QQA A;  5D8L B;  2PEX A;  5BQT A;  1IN4 A;  5DD4 A;  4OIP F;  4LLN A;  2GIV A;  4MGR A;  1OR7 A;  3SZT A;  4Q48 A;  1AOY A;  3V7S A;  4R1H A;  2ZCW A;  2GXB A;  2DPU A;  1DPR A;  4Q47 A;  4L9J A;  2P8T A;  1MGT A;  4R8H A;  4I2O A;  5ILV A;  3F8M A;  5JHU A;  4M74 A;  4G7O F;  5BS6 A;  4PGG A;  1FP2 A;  2RGV A;  1W5T A;  4A6D A;  1S6L A;  2PMH A;  2LSO A;  1Y0U A;  5D6F A;  5ICC A;  4KIG A;  2FU4 A;  1HW5 A;  2R7D A;  3LQR A;  4I0B A;  1FLI A;  3GVA A;  2ZO4 A;  2CGP A;  1FYM A;  1LDK B;  1TLH B;  2PMU A;  4CYD A;  1S3J A;  1D8J A;  1R1U A;  1P4X A;  2V9V A;  1MDM B;  4LK0 F;  3BOQ A;  1TNT A;  1TQP A;  3J81 K;  1Q1H A;  1WRJ A;  5HLG A;  2QVO A;  4UHT A;  3E6M A;  1DP7 P;  3KFW X;  2HQR A;  4G7H F;  5LGT A;  2IW5 A;  3I54 A;  1SAX A;  3Q5F A;  2IA1 A;  1CGP A;  1U78 A;  2GA2 A;  2PBI A;  3WE3 A;  2FBI A;  1YQA A;  3PQJ A;  3CO7 C;  1FT9 A;  4AWX B;  3GO5 A;  4AIH A;  1IW7 F;  4NQW A;  3EYY A;  1KU2 A;  2K86 A;  2OQR A;  2XUB A;  1USS A;  3I59 B;  1Z05 A;  1W7P B;  5LEK A;  5CVU A;  4LLG F;  1IN5 A;  1HST A;  3LA2 A;  4I98 B;  3NQO A;  2QBY A;  1R1T A;  3HOT A;  1LVA A;  3DP7 A;  4AD9 A;  1FBS A;  4GYG A;  5D6E A;  1KA8 A;  2W84 A;  2V6C A;  2W85 A;  1SFU A;  1MDM A;  1XDU A;  1SFE A;  1XMA A;  1O7L A;  1OKR A;  2CWE A;  3ZMV A;  2P6S A;  3QRF F;  2LKP A;  2NAZ A;  4LMY A;  5JFR A;  5CVV A;  1GXQ A;  2GQQ A;  1B1B A;  3ZMT A;  2Z3Y A;  3FMQ A;  2K27 A;  2RNJ A;  2FOK A;  3K0L A;  4L5I A;  3BPX A;  5J8C A;  3GFL A;  2XGX A;  2OAZ A;  2EK5 A;  3JTH A;  3KCC A;  2P5K A;  3GFI A;  1SFX A;  1SD7 A;  5D5W B;  4M9Z A;  2O0Y A;  1UHW A;  3GEZ A;  1P2F A;  2D1V A;  5KK1 A;  2KJC A;  2MD5 A;  2P7V B;  2JPC A;  5KVR A;  5ILU A;  5F1R A;  4UUV A;  1RIO H;  4KIB A;  4WXC A;  2BV6 A;  2MBF A;  2DK5 A;  5FD6 A;  4U0Y A;  5LHG A;  3GLX A;  2LF7 A;  1ZG3 A;  2QZ8 A;  4YFK F;  2PI0 A;  4EM1 A;  2IPQ X;  1SD4 A;  3ZP5 A;  5HVQ C;  1FPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...