2ZXJA

Crystal structure of yycf dna-binding domain from staphylococcus aureus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
NEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcriptional regulatory protein walR
publication title Novel Antibiotics Target Protein of Gram-positive Pathogens: X-ray Crystal Structures and Search of Potential Drug-Binding Sites
rcsb
source organism Staphylococcus aureus
total genus 31
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zxjA00
2CFXA 2RVCA 1BC7C 3ISPA 3CUQA 4I0BA 4UXNA 3GYHX 2EFOA 4UVBA 2A07F 4HZFA 2HGCA 2JZYA 1QBJA 3JW4A 1R1UA 1ON2A 3GLXA 1ODDA 2FU4A 1Z91A 1HBXG 1FYLA 2QBYA 2GA1A 3LA2A 3N97A 4KMUX 2J5OA 4PZJA 3ZQ7A 4G94A 2QQ9A 3QP5A 1QZZA 2Z9OA 3FM3A 2XV4S 1FYKA 4P55A 4RS8A 3DEUA 2K02A 4M73A 5HDKA 4WF2A 4UNOA 2EA2A 1K78A 1IW7F 2BBYA 2IP2A 2HYGD 3EETA 3W6KB 2VT2A 1F1ZA 3TO9A 2GXGA 3BY6A 1ONVA 2VE9A 4BHBA 2FBIA 1ZYRF 4EMSA 2GWRA 4BAYA 3DPLC 3MZHA 1Q1HA 3OV8A 1U3EM 4OMYA 1BIAA 4WWCA 3EYIA 4A5MA 1I5ZA 2WV0A 4YIIA 4A5NA 5DUIA 3ZMTA 2GZWA 2D1VA 4JQFA 4GYIA 5CVVA 2HZTA 2ETHA 6PAXA 1ZREA 4XBFA 2XAFA 2RKHA 1GXQA 1SFXA 2EJRA 1UFMA 1BIBA 1B59A 4P9UA 1B6AA 2X0LA 4IRIA 4G8XA 2OZ6A 4UHTA 4I01A 1GXPA 3DQVC 4ZYGA 3MCZA 1EH7A 1ZLKA 2MLGA 1FLIA 2LSOA 4WCGA 1LNWA 2EFPA 3W6JB 4CDGA 4KMFA 1XCVA 5HS9A 3RPUA 3WTVC 1UCRA 3P9IA 1Z05A 4PDKA 2DQLA 1TQIA 3M7GA 4RAZA 4KN4X 5JHUA 2P6TA 4EQQA 5D5VB 2W25A 3E6BA 4LD5A 1AOYA 2KIUA 5JI6A 5E18F 4AIKA 4IPAA 3ZMSA 2Q0OA 2HKOA 2RGVA 2ZXJA 4ZZDA 3TQNA 3LSTA 1PDNC 3L7WA 4HLYA 3IKTA 4BHCA 3P9CA 2HQRA 4XSZF 4UVCA 3BROA 2F5EA 3EYYA 2FNAA 1YO5C 3QU6A 4NB5A 3HTUA 4M9SA 1XB4A 3FXUA 2WC2A 3J81Z 3L09A 1TNTA 1BC8C 2EV5A 4YFXF 2CO5A 5BPIA 2PBIA 4OIOF 3S2WA 4L9NA 3WE2A 3K69A 4MEYF 5BOXA 1Z1DA 3IKVA 4ESJA 1YW7A 4HX4A 1ZRFA 2DT5A 1TBXA 2D2WA 2FMLA 4P96A 5E1XA 3EQLF 1IXSB 2P7VB 5EEHA 1QGPA 5E1ZB 2O6GE 5K5OA 2STTA 3JAMZ 1H9GA 4O3MA 5ED4A 1RI7A 3IHUA 1J59A 2VC0A 2QVOA 1YFHA 2VT3A 5FLXK 3P7NA 4L9VA 5ILSA 2HS5A 3MQ0A 1JGSA 4CYDA 2KJBA 3AAFA 5DDGA 1QQIA 4R79A 1R5HA 2QLZA 3JTGA 1BJAA 1O3RA 4XLNF 5LEKA 1IN5A 3V4GA 5DV5A 2ZO4A 3GEZA 4FX0A 3ML6A 2KJCA 2M8EA 3QU3A 1JE8A 1D5VA 3WGHA 1VTNC 5D5WB 5IT9Z 1ZRCA 4QLCU 2MC3A 5CVRA 2FA5A 2IA2A 1MKMA 3CDHA 2CYYA 5ICGA 3FF5A 1T6SA 1SD4A 3OOPA 2DW4A 1CF7A 3WTXC 5HLHA 1IXCA 2PI0A 5LBQA 3BOQA 4KDPA 4HF2A 1WSUA 2L3DA 1OYIA 2HTJA 1IF1A 2M1BA 2M30A 1K7AA 1FC3A 3BDDA 3LWFA 5KK1A 4FHTA 4M6XA 2NAZA 4HQEA 1H0MA 2G7UA 2CG4A 4ENJA 5L3DA 4ENNA 5L3CA 2XAQA 3TO6A 4CICA 5DUKA 2ESHA 3RDIA 1SD6A 1W7PA 3F8MA 4GCVA 1P4WA 4BXUA 1SMTA 4I09A 3GWZA 4HDUA 3I59B 1FOKA 1R1VA 2ZNZA 1R22A 3RYRA 4ZZLA 4Q47A 2HWVA 4M9XA 2VN2A 4HX8A 2FBKA 1S8NA 5K5QA 1B1BA 2BYVE 2EK5A 1T98A 2RDPA 1LQ1A 3FXRA 4M6YA 3RKYA 1IN8A 3QP6A 5FLXZ 5JVTA 3I53A 3R61A 1RUNA 2H09A 1S7OA 1R5GA 3I54A 4MNUA 1W7PD 3KZZA 1KU3A 2FSWA 1HW1A 3F8CA 3ZP5A 5K1YA 2NS0A 3CUQC 3IRRA 2XHKA 1WRJA 2KKOA 4EGYA 1R58A 1W4MA 4RGRA 4BYYA 3F6OA 1U6GA 2WWYA 4N9IA 4JK1X 3PFIA 1FNNA 4Y15A 1RUOA 4IHSA 4Y17A 5CYVA 2OBPA 4CZZA 1USSA 3BPXA 3NEUA 5BS6A 3FHZA 5FD5A 2ZNYA 5AONA 4GXOA 5LRRA 4UVAA 3HOSA 2XUBA 3U9GA 4OOIA 4EM2A 3VOEA 4LB6B 5LEJA 2EA4A 4LK1F 1ZGAA 2IA0A 2HKXA 3E6MA 1O3TA 4G7OF 1XMKA 2X4HA 4CGZA 1PP7U 1U5TB 4KNYA 1J0RA 4O5VA 5E8IA 3WODF 1MDMB 2QWWA 2FEZA 5HDNA 2XAGA 1SMYF 2ZJ2A 3KETA 3DF8A 4U7DA 4OIPF 5DD8A 2VOPA 1D3YA 1F9NA 1BOAA 2V9VA 1TW3A 5BQTA 2F5DA 2MLKA 5F6FA 3HHHA 4RAYA 3ZMDA 3RKXA 2YR2A 1FWZA 3HSRA 5LHIA 3G73A 3Q9SA 1QZYA 1RZ4A 4M9ZA 2DU9A 1ON1A 2EFNA 3C3WA 1GHCA 4H0EA 5LGTA 3I5UA 3L2CA 4M72A 3Q5FA 2YX7A 2NNNA 5D5XB 1G3WA 3E5QA 4KICA 3CO6C 2GIVA 2LKPA 3SXYA 4Y13A 2DLLA 2UXNA 2ZBKA 1OKRA 2YU3A 3GZ5A 3HRSA 2HYFA 4S05A 3LQRA 3WTZA 3TDUC 3BJAA 2FMYA 4HF1A 2P5LC 4O6JA 4AIHA 3HSFA 4PGGA 1FPQA 1HKQA 4RB2C 3GFLA 4IF4A 2MD5A 1DDNA 1OMIA 5D8LB 2AS5F 5FFZA 5E8GA 1FX7A 1LDJA 3SQNA 4A0XA 5EEGA 1TW2A 4R8HA 3U2RA 1D8KA 3K1NA 1O7LA 4BQAA 2IW5A 3SZPA 5DYMA 2VBZA 1OYWA 2M87A 2HTSA 3KP7A 3WE3A 3ZN1A 1MD0A 2CQKA 4D0PA 2D1HA 3I0TA 4K2EA 2XKOA 1RIOH 3F8NA 1XSXA 2Q8KA 1FSHA 4IRGA 3ECHA 1R00A 3REOA 4L5JA 1I6XA 2HFHA 1S6LA 2CW0F 3TOBA 2W85A 3LA3A 3C1DA 3F22A 4M71A 2UXXA 2EFQA 1LEAA 2OAZA 2P6SA 1ZG5A 1KU7A 3ROUA 3IL2A 2LF7A 2QQAA 3GFIA 3GF2A 1ZAOA 3DKWA 1STZA 1DUXC 4LK0F 1SD5A 2BGCA 4Z2YA 2ZMEA 3K9TA 4XLPF 2XIGA 5E17F 1YW8A 5H20A 1L0OC 2K7LA 1UHMA 2V79A 4OIRF 3MWMA 2P5KA 4WXHA 2UWMA 2QUFA 3M9AA 1FY7A 4B09A 1BBYA 1KA8A 2O3FA 1IUYA 2IPQX 4WXCA 4FT8A 2H94A 2EB7A 4EV0A 3R0JA 3L00A 5D6FA 3O2PE 2FNPA 1OR7A 1DPUA 2DI3A 2Y0MA 4ZYEA 2LNBA 3KLNA 3M8EA 1YS7A 4ETSA 3F6VA 1UHWA 2VONA 5F1RA 2JRTA 3WTYC 4EJUA 1ZH5A 3KP5A 1AWCA 5K5RA 5L3EA 2ZCWA 3ELKA 3L9FA 3WTTC 1FBUA 2D45A 4XSXF 2V1XA 3I58A 4WX9A 4RB3C 4PGHA 3V8LA 5JFRA 2JPCA 2RQPA 2MA3A 2OU2A 2XAHA 1JXSA 2VODA 3WGGA 2PFBA 2RN7A 4LB5A 3FMSA 2OA4A 4MHGA 4LG0B 3R6SA 1FYMA 1YIOA 2L4MA 1FP1D 4EJTA 3GX4X 4YG2F 2V1UA 1A04A 4KUMA 1IN6A 1K78B 2H6BA 3GUDA 1P2FA 4YFNF 1HW5A 1HW2A 1PP8F 5FD6A 3V8KA 4A12A 1S29A 5KVRA 1PUEE 2HOEA 3F21A 3J7AO 5FGMA 1TQPA 1DP7P 4A2UA 4MQVA 2MH2A 1EV7A 2L02A 3I64A 3EUHA 4LGWA 1IRGA 1SD7A 1LJ9A 4ESFA 2HR3A 4I0AA 3LAJA 1HKSA 3E3VA 1WWXA 3B73A 1YLFA 4A0ZA 2M45A 3ERED 1FZPB 5HLIA 2Y75A 4DQ2A 2A3SA 2O03A 3PQKA 2CWEA 4B8XA 4KA4A 2ISYA 3MFKA 1XDSA 3JSPA 3RPQA 1FBQA 1U5TA 3F72A 4KIBA 4OINF 1FSEA 4CHUA 2IVMA 3RIRA 1JHFA 5J8CA 3R4KA 5ILUA 3RYPA 1BI0A 3WU0A 2NRAC 2UZKA 3HOTA 4HOBA 5CVJA 1P4XA 2PMUA 3WTWC 3NQOA 5LGNA 2EWNA 1Z6TA 3BJ6A 1YYVA 3ABTA 4EM1A 1BI1A 3T8RA 1O7FA 4MTEA 4MGRA 1T2KA 4G7HF 3ABUA 3FX3A 3E5XA 5DCFA 2DTRA 1IN7A 4RB1A 5HS8A 1XDUA 3HIFA 3E6DA 1QNTA 2QQBA 2PLYA 4YFKF 3K1MA 4MQ9F 4L5IA 3NRVA 3GO5A 5DCMB 4EM0B 3KCCA 4L0YB 3F8BA 3FZVA 2FE3A 3ECOA 3V7CA 5BPDA 5D8KB 4XRFA 1BI2A 2J5PA 2Q2EA 1SFUA 2JT1A 1E17A 4ZYDA 3TOAA 1TTYA 1Z7UA 3VB2A 4ESBA 4G9YA 4UV8A 4EJOA 3LFKA 2JTVA 2L01A 2IT0A 2PJPA 4HF0A 5ICCA 1DPRA 4L18B 1WQ2A 1O3SA 5LLQA 2VBWA 3COAC 3KP6A 1CGPA 2R7FA 2Z99A 3E97A 2TDXA 3GXOA 1P6RA 4N9HA 2VBYA 3D5LA 1I1SA 3V7SA 3HRMA 1Z9CA 2P4WA 1REPC 1B9MA 1FT9A 1TLHB 3M8FA 4LJZF 4P5OA 3KP3A 4ENMA 3WG9A 5LHGA 5D4RA 4KT5C 5D4SA 3KZYA 5LRSA 1R7JA 1W5TA 3HUGA 1L3LA 1KQ0A 3C18A 5ILVA 4G7ZF 3KLOA 3SFZA 2MBFA 4WK8F 5HLGA 2R3SA 1U8RA 1T0FA 4KIGA 2C6YA 2V1DA 3ZN0A 1Z6RA 2O0YA 3PQJA 5ICEA 2A6HF 5A2QK 4KYWA 2OQGA 2HDCA 1QPMA 2K4JA 3FWEA 1CF7B 2DPDA 4ON0A 4NQWA 3IWZA 1S7AA 3K2ZA 1YW9A 3P9KA 2V6CA 2H6CA 1IXRC 1YG2A 3BZ6A 4G6DA 4LLNA 3WTUC 2GQQA 1GVJA 5J6XA 3M1EA 1I27A 2LF8A 5D6EA 5ERIA 1KYWA 2YX4A 1ZG1A 2E7WA 2XRNA 5DEQA 1OYYA 2ZFWA 4JBAA 3JSOA 2XROA 4LLLA 2VOOA 1F5TA 4FX4A 1W7PB 3HYIA 5LHHA 1EH6A 2PMHA 1FBSA 2O8XA 1HSTA 3KEQA 3HSEA 3F23A 2QENA 2ESNA 4OU0A 3B02A 2LDUA 3SHFA 1SFEA 3ZMUA 2RC4A 5L3FA 3ZMVA 5TRDA 4LG0A 4L9TA 5FB2A 4KFCA 2VBXA 1HKTA 1HSJA 1TQMA 4KN7X 4L0ZB 2ELHA 3R60A 3IC7A 3J81K 2EFWA 4U0VA 3QAHA 1KQ9A 3WGIA 4N0BA 1XGSA 2GAUA 3H3UA 4L9JA 3KFWX 1J9IA 2JSCA 2E7XA 3WTSC 1RNLA 2DO7A 3SZTA 2P8TA 1USTA 1YS6A 5A2QZ 5E1WA 5L3BA 1ZARA 1ZHFA 2ACJA 3DPTA 4LLGF 4G6QA 3CJNA 1KGSA 1J2XA 2L54A 2Y48A 3QPHA 3RJPA 2CSOA 3TO7A 3JAMK 5CVIA 2DQRA 2MH9A 3EDPA 3H3ZA 2VXZA 2A6EF 4U7BA 1EH8A 2FXAA 4IRHA 4HA8A 3BWGA 4ENKA 2FF4A 4U88A 1J75A 2K86A 2G7HA 1Y0UA 2YSRA 1FP2A 4I02A 2JPBA 4HBLA 3VEPA 3DP7A 1V4RA 2KIMA 4AWXB 5DD4A 1LDKB 4BNCA 3KP4A 2FOKA 3T5XA 1G4DA 2E1NA 2GXBA 3RKWA 2GA2A 2KRFA 4PCQA 1IRFA 5IT9K 2Z3YA 2AXLA 3MAJA 4R1HA 3K1PA 1IAWA 4A6EA 2DK8A 2CGPA 3GZ6A 1P92A 3ZMZA 1H9TA 3DFGA 3HTSB 1R1TA 3GW2A 3CUQB 4ZYHA 1B9NA 4RGUA 1U5TC 1P4AA 4HQMA 3I59A 4CXFA 2DBBA 5DCMA 2F2EA 3ZPLA 1R23A 5IT3A 2PQ8A 2RV8A 1J5YA 2OZUA 3K0LA 5L3GA 4IHTA 4S04A 1X3UA 4EJVA 2ADUA 4HDVA 2QBYB 4GO1A 3GFMA 4BHPA 3J80K 1SAXA 4AVPA 1U2WA 2NYXA 4IXAA 3O6BB 1G3YA 3BPVA 4E70A 3N4MA 2Z5UA 5H6RA 2A61A 4HW0A 1XN7A 3ULQB 2PG4A 3MEXA 1T39A 1ULYA 1W5SA 1G6NA 4IJAA 1ZG3A 4UUVA 2PN6A 2IJLA 5D5UB 2W24A 5FO5A 4F7ZA 1B4AA 2OQRA 3LA7A 5HOOA 2XKPA 1K79A 1V3FA 4U0WA 1XSDA 1IN4A 3C7JA 2BV6A 4A0YA 2HQNA 1MJ9A 4AIJA 1O57A 1KU9A 4RGSA 3TKYA 2E1CA 1BN5A 3VFZA 4QWQA 2XVCA 5HVQC 2P7CB 3QOPA 3DV8A 3KEOA 3LAPA 2ISZA 2WTEA 2K4BA 4I2OA 1MZBA 1BM9A 1MDMA 1JHHA 2QYOA 2RNJA 2BEOA 5HDGA 4HAMA 2STWA 3FMQA 1LEBA 3TGNA 2F5CA 2W84A 3IRQA 4P9FA 4GYGA 2A68F 4KIFA 5HS7A 3HHGA 1YTYA 1OPCA 2A5YB 2ZMEB 1G3TA 3T0YA 2FRHA 1ZN2A 2YPRA 3G3ZA 1LDDA 2DK5A 3FXQA 3IWFA 2IA1A 3CO7C 1XGMA 1K6OA 4OMZA 2P5VA 4M74A 1ZGJA 2PEXA 4HV5A 3I71A 1J7KA 3BJOA 3J80Z 3FMRA 3FM5A 3U1DA 2W57A 2K27A 1MGTA 3CUOA 4A6DA 4MTDA 1KQ8A 2H27A 4HLXA 1C0WA 3HRUA 1BI3A 1ZRDA 3R0AA 5CVUA 1E2XA 2IRFG 2XGXA 2VC1A 3RI4A 1NHAA 2VE8A 3MZYA 4TV7A 4U0YA 4GGGA 5H6QA 4Q48A 5LGUA 3CTAA 4AD9A 3RTRA 5AIQA 4LFUA 4RB0A 4WXDA 4OIQF 3T8TA 4RGXA 3CLOA 3TDZC 3QPTA 2L4AA 1WKMA 1XCBA 4DNCA 3GFJA 3O3KA 3LQQA 4Q5SF 2A69F 5CLSA 4HX7A 3E6CC 1WI9A 3V8JA 1I1GA 1LB2A 2FBHA 5JR3A 2DAOA 1G3SA 4CO8A 1LVAA 3E5UA 3QRFF 5ICFA 2NNYA 1QO0D 3V7RA 2M5WA 2O61A 4EJWA 2HEOA 3KE2A 1F4KA 4IVNA 2Z33A 1XGOA 4MEXF 4HV6A 3I4PA 1TNSA 2BE5F 1XGNA 2KIFA 5FFXA 3T1BA 1XSVA 3JTHA 5CJ9A 1XMAA 2DPUA 2B0LA 1HXDA 2EV0A 4I98B 5TJJA 4YIFA 3F8FA 1O3QA 1UB9A 4LMYA 4ZH4F 3BP8A 1S3JA 3VODA 1XD7A 4I7HA 5E20A 5J8FA 2F5FA 5BMZA 4NHJA 2QM3A 1YQAA 2ZKZA 1T38A 1KU2A 3D0SA 4UV9A 3WU1B 1U78A 2G9WA 2DFIA 3HRTA 4BH9A 3Q9VA 4Q4ZF 2XAJA 1ZLJA 3DXJF 1IZ1A 3H92A 2QZ8A 4ASNA 1D8JA 3KP2A 5F64A 1R36A 1HQCA 1KYZA 2COMA 2OD5A 4EVIA 2FQ3A 3F3XA 1MJBA 2XASA 4EGZA 5AIPA 4HYEA 1MJAA 2R7DA 3GVAA 2EV6A
chains in the Genus database with same CATH superfamily
2CFXA 1T56A 2RVCA 3DCFA 4AU7A 3BLYA 1IUFA 1XMXA 1AKHB 3CJTB 5B1AH 1XX5A 2MFZA 2E1MC 1BC7C 3ISPA 3OS2A 4A3CJ 3CUQA 2DT7B 1E0EA 4CCMA 3DLLF 4I0BA 1VQ6I 3FK6A 4UXNA 1AA7A 2ELJA 3GYHX 1GV5A 2EFOA 4UVBA 1LFBA 2MC4A 3FXLA 2A07F 2CQNA 1IC8A 1IRXA 2PJRA 4AIDA 4HZFA 2HGCA 4DZPA 2W7NA 2JZYA 2BY2A 2EZHA 1GV2A 4A3FJ 1QBJA 3JW4A 1R1UA 4XONA 1W0UA 4A3GJ 3BR0A 4CH7A 3SDGA 1ON2A 3GLXA 1ODDA 3S3OA 2FU4A 4UUSB 1Z91A 1HBXG 4YIRX 4QSHA 1FYLA 2QBYA 2V26A 4JYKA 3LSIA 1MMDA 2GA1A 2DCEA 3LA2A 5FKLA 2CW7A 3N97A 4KMUX 2J5OA 4PZJA 3ZQ7A 3G6EI 1IO2A 4G94A 3DBHB 2VJIA 1FIPA 2QQ9A 4A93J 3BG7A 3QP5A 1QZZA 2Z9OA 2K40A 3FM3A 2CV1A 2XV4S 1FYKA 2LK2A 2OC6A 4P55A 3K4MA 4RS8A 1HDDC 3BTCA 2WAQA 2R92J 3DEUA 3RCOA 3ASOH 2PX9A 2K02A 4M73A 5HDKA 4WF2A 4UNOA 4YRVA 1V5EA 2EA2A 1IW7F 2BBYA 2IP2A 1K78A 2HYGD 3N05A 2Y9YA 3OL4A 4BQNA 2ZXIA 3EETA 2CV0A 4BQQA 3W6KB 1JKOC 5B3SH 3DU5A 3JRFA 1D1AA 2H1KA 2VT2A 1F1ZA 3TO9A 2JUGA 2GXGA 3BY6A 3ESWB 1ONVA 3OYEA 2VE9A 4BHBA 2FBIA 3HOVJ 1ZYRF 2JN6A 4EMSA 1DGWY 2GWRA 1QZEA 1ZR4A 4BAYA 3DPLC 3MZHA 3LSHA 4OAZA 1Q1HA 2QSHX 3OV8A 1U3EM 4DOZA 3CCLI 2XF5A 4OMYA 1GVDA 4FETA 2WADA 4RM3A 2K5CA 1BIAA 4JX6A 4S0HB 5E3LA 3CF2A 3HOZJ 5J3LA 4WWCA 3EYIA 4A5MA 3S3MA 1TWAJ 3BZKA 3DEWA 1I5ZA 2WV0A 2CQQA 4YIIA 4A5NA 2DMPA 2KZVA 2K9SA 5DUIA 3ZMTA 1X19A 2D1VA 2GZWA 4JQFA 3UNGC 4GYIA 5CVVA 2HZTA 2ETHA 4E7SA 3CC7I 6PAXA 1ZREA 1D0YA 3HUGB 4XBFA 2XAFA 3SFIA 3AG3H 2RKHA 1P9QC 1GXQA 1SFXA 4FISA 5M5YJ 2EJRA 1I3QJ 1UFMA 5FKKA 2X6XA 1BIBA 1B59A 4P9UA 5M3MJ 1RR7A 1B6AA 1N25A 5JHFA 3A4CA 3HOUJ 4BACA 2IS2A 2LREA 1JGGA 1B8IB 1Y8RB 2X0LA 4IRIA 1Y6IA 4G8XA 1W0TA 2OZ6A 3PIPF 4UHTA 5IP9J 1OCCH 4A3LJ 1BR4A 4I01A 2E71A 1V5GA 1GXPA 3PNTA 3DQVC 4ZYGA 3MCZA 4D7MA 1EH7A 2FJ1A 2MLGA 1ZLKA 1FLIA 2L9SA 2LSOA 4WCGA 2KFDA 1LNWA 2EFPA 3W6JB 4CDGA 5B5EC 1XCVA 4KMFA 2QSFX 1MBGA 3S17J 4Z6YA 5HS9A 3RPUA 1AHDP 3I4NJ 1MNMC 4CCOA 3WTVC 1XG1A 3DKXA 1UCRA 4HRIA 1W36C 4E6KG 3CMYA 3P9IA 1Z05A 4PDKA 3UKGA 2DQLA 1TQIA 2FUG2 3M7GA 4IOAF 4PSWA 2KL4A 3K4NA 4RAZA 3E1SA 4KN4X 5JHUA 2P6TA 4EQQA 4MO7A 1X3ZB 2Y0SN 2W25A 5D5VB 3OYMA 3E6BA 3EUAA 4BE2A 4LD5A 1AOYA 2E5ZA 2KIUA 5JI6A 1OCPA 5E18F 3K70C 4AIKA 5EDNA 4IPAA 1IJWC 4BQOA 4XICA 2HOSA 3ZMSA 2Q0OA 2HKOA 2JQ7A 3K7AJ 2RGVA 2ZXJA 3FK7A 4ZZDA 3TQNA 3LSTA 3Q0VA 1PDNC 3L7WA 4HLYA 3IKTA 4BHCA 2K3PA 3P9CA 2HQRA 3SDBA 2OTLI 4XSZF 4UVCA 2L9RA 1ZR2A 3BROA 2XPUA 1W5CC 5GAHJ 1TT0A 2AXTC 2F5EA 3EYYA 2FNAA 3OYDA 4PJLA 1YO5C 3QU6A 4NB5A 3HTUA 4EATA 4M9SA 1XB4A 1JT6A 4IEJA 2HVRA 3FXUA 2EQRA 2WC2A 3J81Z 3ZQLA 3L09A 1TNTA 3PNVA 3DTKA 1BC8C 4I99C 2EV5A 4GRIA 4YFXF 2CO5A 5BPIA 2PBIA 4XRSA 3QYFA 4OIOF 4ZYAA 3U21A 3S2WA 2QKMB 4L9NA 3WE2A 2VKDA 3BCAA 3K69A 1POGA 2DYRH 1Z1DA 3NWSA 3IKVA 4MEYF 3ZOBA 4ESJA 4J00A 3FXMA 5BOXA 5EF6A 1YW7A 4HX4A 4KITB 2E2IJ 2L9VA 1WCMJ 1B72A 2DT5A 1ZRFA 1TBXA 3M4OJ 2D2WA 2GM4A 2FMLA 3W2WA 4ZC3A 4P96A 3EQLF 1IXSB 5E1XA 5K7ZA 1A5JA 2P7VB 5EEHA 4RDUA 2BZTA 1UAAA 1QGPA 3AFHA 3H0DA 1YIJI 5E1ZB 2XB5A 3DKYA 2O6GE 3PNYA 5K5OA 2H8RA 2STTA 2XC7A 3LSPA 3JAMZ 1H9GA 3CP8A 4O3MA 5ED4A 1RI7A 3IHUA 1J59A 2VC0A 2QVOA 3CCYA 1YFHA 2VT3A 4II2A 1R49A 3OYIA 5FLXK 1R5ID 3P7NA 3RKQA 4L9VA 5ILSA 2HS5A 2EIMH 3MQ0A 1JGSA 4A3IJ 4CYDA 2JJ7A 4IOCF 2KJBA 3AAFA 1MW7A 2WY8Q 5DDGA 2R5YA 1MSEC 3JRCA 1QQIA 4R79A 1R5HA 2OCCH 3BG6A 2JWTA 1FOXA 3H5RA 4XLHA 2QLZA 3JTGA 1IV6A 1WJFA 1BJAA 1O3RA 3FBIB 4XLNF 5DM7F 4B48A 5LEKA 1IN5A 3V4GA 1QU3A 5DV5A 2ZO4A 3GEZA 4FX0A 3ML6A 2KJCA 2L7KA 2M8EA 3QU3A 4NUBA 1JE8A 4E7JA 3OYBA 1D5VA 3AL0C 1JKRC 3WGHA 1VTNC 5D5WB 5C44J 5IT9Z 1ZRCA 4QLCU 4CYCA 2EZKA 3HOWJ 1ERDA 2MC3A 5CVRA 3CD6I 2FA5A 3CMAI 2LD5A 2IA2A 2ELKA 1MKMA 3CDHA 2CYYA 2K9MA 5ICGA 1XC5A 1NK3P 3FF5A 2ZJRF 1T6SA 1HOMA 1SD4A 1YX3A 4NC6A 1Z3XA 3OOPA 4M3FA 2DW4A 1CF7A 3WTXC 4F3QA 5HLHA 3PUFA 1IXCA 1VQ7I 1Z21A 4XIDA 2PI0A 1MNEA 5TISC 5LBQA 3BOQA 2W4SA 4CSWA 4KDPA 4HF2A 2VJJA 1WSUA 2L3DA 2NOGA 1YJWI 2F4OB 1NH3A 2JVHA 2R7TA 3B6CA 3K70D 1OYIA 2HTJA 2WV1A 1IF1A 2M1BA 2M30A 1K7AA 1FC3A 2DT6A 4A69C 1D1CA 3BDDA 3LWFA 5KK1A 5GTHC 4FHTA 2UV1A 4V2FA 3ERMA 4YELA 1T08B 1FMWA 3EUKL 2VQLA 1SC7A 4M6XA 2NAZA 4HQEA 1H0MA 2G7UA 2CG4A 4ENJA 5FROA 1RRJA 2EIKH 5L3DA 2LG4A 4ENNA 2OV7A 5L3CA 1AKHA 2XAQA 3TO6A 3PFYA 5IOZA 4RLQA 4CICA 1IV8A 5DUKA 2ESHA 3D5SC 2R0QC 3F9KA 2XB0X 2M7AA 3RDIA 1SD6A 1W7PA 3F8MA 4GCVA 1P4WA 4BXUA 1SMTA 4I09A 2GOXB 3GWZA 4FQGA 1WJ5A 3I59B 1VZ0A 4HDUA 1FOKA 1VQKI 1R1VA 2ZNZA 2YS9A 1BW6A 1R22A 4YEJA 4DBRA 3RYRA 4ZZLA 1IDYA 4Q47A 2HWVA 3CP2A 4M9XA 2VN2A 4HX8A 2FBKA 1S8NA 5K5QA 1B1BA 3BTJA 1ETXA 2BYVE 4XMYA 2DJIA 1FIAA 2EK5A 3LSRA 2Z1DA 2K3FA 2VQHA 1T98A 2RDPA 3Q0WA 1LQ1A 3FXRA 4M6YA 4ZDPA 3PIOF 3RKYA 1IN8A 5KNLA 3QP6A 4HSRA 3G71I 5FLXZ 5CQGA 4RAGA 5JVTA 3W3CA 3I53A 1VNDA 3R61A 2EZIA 1RUNA 2H09A 1S7OA 1R5GA 3I54A 4MNUA 2IGMA 3BR3A 4ANJA 3OS1A 4DYRA 1W7PD 3KZZA 2R7OA 1X2NA 1EF4A 2ZFUA 2CQ7A 3FXJA 1KU3A 1X1BA 4C3IJ 3CF5F 3NARA 3I9V2 2FSWA 1HW1A 2M3AA 3H0GJ 1WJBA 3F8CA 3ZP5A 1RESA 2I8DA 5K1YA 2BHZA 2OPTA 2NS0A 3CUQC 3IRRA 2XHKA 5GAGJ 5JLXA 1WRJA 2KKOA 4EGYA 3VWBA 5FLVA 2M4KA 1R58A 1W4MA 4RGRA 4BYYA 2NVQJ 2F4IA 3F6OA 3HKZN 1U6GA 3SZGA 2WWYA 4N9IA 2DA6A 4JK1X 2KDOA 3PFIA 1FNNA 5M5XJ 3BT9A 4Y15A 2VL8A 3WHCA 3TMOA 1RUOA 4IHSA 4Y17A 5CYVA 5J40A 1JJ6C 2OBPA 2OCEA 4ABZA 4CZZA 1USSA 3BPXA 3NEUA 5BS6A 3FHZA 1NG7A 1WJAA 2EIJH 3K4CA 5FD5A 2ZNYA 5F1JA 2L0KA 5AONA 4GXOA 5LRRA 5EGOA 2FQ4A 4A3MJ 4CCKA 2HQAA 4UVAA 3A1YA 3HOSA 2XUBA 3U9GA 1WFXA 2Y30A 4OOIA 3W6VA 5F08A 2HDDA 4EM2A 3VOEA 4IHYA 2BW3B 4LB6B 5LEJA 2EA4A 1SEUA 4N4NB 4LK1F 1ZGAA 2IA0A 5B1BH 2VKHA 2CH0A 2M2EA 2HKXA 2LRDA 2L2OA 3E6MA 1HLVA 4N4OB 1O3TA 4D5CA 1JJ8C 4QIWN 5E3OA 4G7OF 1XMKA 2X4HA 4CGZA 1PP7U 1U5TB 2GIZA 1JKQC 4KNYA 1J0RA 4O5VA 5E8IA 3BR6A 3WODF 3RZOJ 1MDMB 2QWWA 2FEZA 5HDNA 3S2HJ 5C4JJ 3ZQGA 3VYTB 3CC4I 1YJ9I 2XAGA 1SMYF 3C2BA 2LP0A 2ZJ2A 3KETA 2K9QA 3GLLA 2ME6A 3DF8A 4U7DA 4OIPF 1OCTC 3MKZA 3QYEA 2HU9A 5DD8A 2DA7A 4MFDA 2VOPA 3FDYA 4ITVA 1D3YA 1F9NA 2XGCA 2COBA 1BOAA 2V9VA 4BEHA 1TW3A 2JRMA 4CZCA 3A01A 5BQTA 4BE1A 2F5DA 2MLKA 1JUMA 5F6FA 1Y39A 3HHHA 1FMVA 4RAYA 1I39A 1SAUA 3BC8A 4Y3OA 3ZMDA 1SFOJ 3RKXA 3OR1C 2F48A 2K9LA 2YR2A 1FWZA 3DWLE 3S32A 1N78A 2DTZA 3HSRA 5LHIA 3H9QA 3G73A 1G2HA 3CCEI 3Q9SA 5IP7J 1ZELA 1DQUA 4PUSA 2DFHA 1QZYA 1QPIA 5FKOA 1RZ4A 2E1OA 4M9ZA 2DU9A 1ON1A 2EFNA 1OCOH 3ZGKA 4IZZA 3C3WA 1GHCA 4H0EA 5J1UA 1JT0A 3QPLA 3G1OA 5LGTA 3I5UA 1WGXA 3L2CA 1A6QA 4AM3A 4M72A 2Z16A 3SEZA 3PJRA 3OMYA 3Q5FA 2TRTA 1IG7A 5FJ8J 2YX7A 2NNNA 4JP0A 5D5XB 2RAEA 1G3WA 3E5QA 2JK3A 2R7ZJ 4KICA 2O9LA 2VJ5A 3CO6C 2GIVA 4M6VA 2LKPA 3SXYA 4Y13A 2BVLA 2DLLA 2ECCA 2L7FP 3HB9A 1OFCX 2UXNA 2ZBKA 4U87A 2DA5A 3OSGA 4F52A 1OKRA 2YU3A 3GZ5A 3HRSA 2EH3A 3HL2A 4MIMA 2HYFA 3A2KA 4S05A 3LQRA 3WTZA 3OIPA 3TDUC 3BJAA 3H9JA 2CFOA 4XKCA 2FMYA 3OYHA 2Q2EB 3HGYA 3H35A 2CMPA 1MMGA 4PK4A 4QTRA 1ITYA 1SANA 3TP0A 4HF1A 1KONA 4PJMA 2DFEA 1VQ8I 2NVYJ 2P5LC 4O6JA 4AIHA 3HSFA 4LIVA 1WJCA 4PGGA 1PUFB 3BR2A 4LITA 4AYBA 1FPQA 2CUFA 3JRIA 3FHNA 1HKQA 4RB2C 3GFLA 3ZR8X 4IF4A 2WAEA 3AL0B 2MD5A 1DDNA 1OMIA 5D8LB 3TL4X 2CV2A 2AS5F 5FFZA 5E8GA 5HNHA 5C3EJ 1FX7A 2DOFA 3DU6A 2VIXA 4UB8C 1LDJA 3SQNA 1DP3A 4A0XA 2DMTA 4PFOA 1U8BA 2X6WA 5EEGA 1TW2A 4R8HA 3U2RA 1OR7C 1D8KA 3BR1A 3I55I 1VI0A 3HKZA 3K1NA 3BZCA 3GZNB 1O7LA 1P7IA 2W48A 2QA4I 2QCOA 4BQAA 2IW5A 2TCTA 3SZPA 5DYMA 2VBZA 3LFUA 2N8GA 4GFBA 2R7VA 1OYWA 2M87A 4XNFA 2HTSA 2O7OA 3KP7A 3WE3A 2B7EA 3ZN1A 1MD0A 2LY2A 2CQKA 4D0PA 2D1HA 3I0TA 2OJED 3JRAA 4K2EA 1OLTA 3ZXSA 2XKOA 2ECBA 1VQOI 1RIOH 1S5LC 3S1RJ 3F8NA 1XSXA 2Q8KA 1FSHA 4IRGA 3ECHA 4IL6C 1R00A 4BL0B 3REOA 3V42A 1X1AA 4L5JA 1I6XA 2HFHA 2JA5J 2QEXI 2BY3A 1E3PA 1S6LA 2CW0F 2LBFA 3K4BA 3TOBA 3G4SI 1X4OA 2W85A 3LA3A 3OYGA 3C1DA 1X2MA 2VB6A 3F22A 4M71A 2UXXA 4C30A 3AG1H 1H88C 5K7FA 1WI3A 2EFQA 2PMZA 4E4HA 2VKVA 2IBDA 3FIWA 3KZIC 1LEAA 1FOYA 2KPMA 2OAZA 5F0FA 4RLFA 2P6SA 1ZG5A 1KU7A 3ROUA 4XOTA 5TGTA 3BCBA 2EILH 3IL2A 2LF7A 2QQAA 3GFIA 3GF2A 1ZAOA 5EYRA 4NDLA 3DKWA 1STZA 2FD5A 1WH5A 1DUXC 3CMEI 3GMEA 4I6ZA 5IP6A 4BUPA 4LK0F 1SD5A 2BGCA 3IUOA 4Z2YA 2ZMEA 3K9TA 3HBLA 4XLPF 2XIGA 3CC2I 5E17F 2QSGX 2BY1A 5GP9A 1YW8A 4BDZA 2XRLA 5H20A 1L0OC 2K7LA 3C2GA 3S2DJ 1UHMA 4NQWB 3BTLA 1X1PA 2V79A 2DFFA 4MLOA 4OIRF 3MWMA 3NAUA 2P5KA 4WXHA 2UWMA 3L2RA 2QUFA 3M9AA 1FY7A 4B09A 1BBYA 1KA8A 2O3FA 4BS9A 1IUYA 1S7EA 2IPQX 4WXCA 5EZGA 2KRCA 4FT8A 3A02A 3JCUC 3S3NA 1WPKA 3BG9A 2H94A 2EB7A 3S16J 1GUUA 4EV0A 3R0JA 2GBYA 3L2VA 3L00A 5D6FA 4CUGA 1A6IA 3O2PE 2FNPA 1OR7A 5GTIC 1DPUA 3G1MA 1R4MB 2DI3A 2Y0MA 4ZYEA 2LNBA 3KLNA 3M8EA 2XDVA 4B1RA 1LFPA 4B47A 1YS7A 2M34A 4ETSA 1ETWA 3F6VA 2R7SA 1UHWA 4RAFA 2VONA 3TP3A 2JRTA 2F5VA 4BJTA 5F1RA 3J7ZI 3WTYC 2R7UA 4EJUA 4NBQA 5B66C 2MYSA 4RM2A 3O8HA 1YITI 1EA3A 5FKNA 1E3HA 1ZH5A 3RPUD 1PJRA 3KP5A 5EG0A 1AWCA 2LH9A 3MMYB 2AQEA 5K5RA 2PJRB 5L3EA 2XSJC 2ZCWA 2X1EA 3HPHA 3ELKA 3L9FA 3WTTC 1FBUA 2D45A 2LKXA 5E3NA 4XSXF 2F6CA 2V1XA 2KIQA 4CCLA 1HC8A 3I58A 4WX9A 4RB3C 2M0MA 4PGHA 4AVZA 3MD2A 1SVOA 3FKIJ 3V8LA 5JFRA 2JPCA 1QHGA 4D9JA 4IKFA 2H8WA 2VPRA 4E7IA 1SVLA 3PL8A 2RQPA 4W97A 2MA3A 2OU2A 2P0WA 2XAHA 1JXSA 1UELB 2VODA 5HODA 3WGGA 2PFBA 2V9KA 2RN7A 4LB5A 3FMSA 2OA4A 4MHGA 1U0JA 3QWLA 1T33A 1UZCA 4LG0B 1MBKA 2VXDA 3R6SA 1FYMA 2DDAA 3K6GA 4DGWB 2HOAA 3S14J 1YIOA 4PJ0C 2L4MA 1FP1D 4EJTA 3DLAA 3GX4X 4YG2F 2V1UA 1A04A 1EKEA 1IN6A 4KUMA 3H3VK 1R4NB 1K78B 2H1LA 1XTAA 2H6BA 1Y0NA 2VUMJ 1SFKA 4A3JJ 3GUDA 3ABMH 5IOYA 1HA8A 1P2FA 4F93B 3M07A 1HW5A 4YFNF 2LLKA 1K83J 4XM3A 1PP8F 1HW2A 1CQTA 5FD6A 3V8KA 4A12A 1S29A 2ID6A 5KVRA 5E79C 2RNGA 2HOEA 3F21A 1PUEE 4IHVA 5FGMA 3J7AO 1TQPA 1DP7P 5FKMA 4A2UA 4MQVA 2MH2A 4B3AA 3RZDJ 1EV7A 2L02A 4L5EA 3I64A 3EUHA 4X1EA 4LGWA 1IRGA 1GT0C 1RPWA 1LJ9A 1SD7A 4ESFA 2HR3A 4I0AA 3LAJA 2R5ZB 1HKSA 2Y9ZA 3E3VA 3W2AA 1MBFA 1WWXA 3OL3A 3B73A 3BQYA 2NS7A 1YLFA 4A0ZA 2M45A 5F04A 4CA0A 1YRNB 3ERED 4M3EA 1FZPB 5HLIA 2XF7A 2Y75A 4DQ2A 4IQ4A 1MBJA 2A3SA 2O03A 3DBLB 1QRYA 3PQKA 4F91B 2CWEA 4B8XA 4KA4A 1ACIA 2E1MB 2ISYA 2DMQA 3MFKA 1XDSA 4M3BA 3JSPA 3RPQA 3KEYA 1FBQA 3OS0A 2B9SA 1U5TA 3F72A 4KIBA 1W1WE 3PSIA 4OINF 1FSEA 4CHUA 2HPMA 4RMNA 2IVMA 3RIRA 4KJZA 1JHFA 1X1DA 2KZGA 2EZLA 3H9GA 2NVUB 4MFEA 2R93J 5J8CA 3R4KA 5ILUA 3RYPA 1BI0A 1WJDA 1D5YA 1ORKA 1K61A 1D1BA 3WU0A 2DYSH 3RQIA 2NRAC 2UZKA 4CCJA 2BVMA 3QPSA 3K4LA 3HOTA 2CRGA 1JI8A 3OOUA 4RBOA 1N77A 4HOBA 2WAFA 5CVJA 1P4XA 4DBQA 2VPLA 2PMUA 2X48A 3IV5A 4XKVA 2M7BA 3WTWC 2HPIA 3NQOA 2CQXA 1OJLA 1MMNA 3TEDA 5LGNA 1Y1VJ 2EWNA 1Z6TA 5GPCA 3BJ6A 2CU7A 1YYVA 1YX5A 3ABTA 2E60A 4EM1A 1BI1A 3HM5A 3IH3A 4XORA 2GXAA 3T8RA 1VQLI 2E2HJ 5GAEJ 3OIQA 4LG3A 1O7FA 1NG6A 3ZRGA 4MTEA 4I76A 1OCZH 4MGRA 5KAFC 1T2KA 4G7HF 3QODA 1ETQA 4UB6C 3ABUA 3FX3A 1APLC 3E5XA 5DCFA 2DTRA 3ABKH 1IN7A 3OYCA 4RB1A 3ZQHA 5HS8A 3CCUI 1XDUA 3HIFA 3E6DA 1QNTA 2QQBA 1Z3YA 2X1CA 1ETOA 3FXOA 4YFKF 2PLYA 3K1MA 5GADJ 4MQ9F 1ETKA 3NRVA 2P81A 2DN0A 3GO5A 4L5IA 3UR3C 5DCMB 2ZSIB 5DS9A 1MMSA 4EM0B 3KCCA 1J09A 1YE9A 4L0YB 2ZB9A 3F8BA 3FZVA 1LE8B 2RREA 1H89C 3TW6A 2DOAA 2FE3A 4CCNA 4UUSA 5IYCJ 2DA2A 2O5RA 3ECOA 1BA5A 3V7CA 5BPDA 5D8KB 4XRFA 3HDDA 1BI2A 2J5PA 4P1WA 2Q2EA 1SFUA 5FRNA 4D7NA 2JT1A 1E17A 4ZYDA 3BQZA 3CESA 3TOAA 1F36A 5JVGF 4BDYA 1TTYA 2KLOA 1Z7UA 3VB2A 1H8AC 4ESBA 4G9YA 4UV8A 4EJOA 3LFKA 3HOYJ 2JTVA 2L01A 3Q3SA 3OSFA 2IT0A 2VASA 4PJNA 2LFBA 2PJPA 4AYBN 1HCRA 2OTJI 3MKYB 1R71A 4HF0A 2BHYA 5ICCA 1OISA 3ONQA 1DPRA 3J7YJ 2V4JC 2Y31A 2VQGA 3VYSB 4L18B 4BU2A 3GTLJ 1WQ2A 4PFPA 1O3SA 5LLQA 3L2UA 2VBWA 3COAC 3KP6A 3M1CA 1CGPA 2LVSA 1GLNA 2DA1A 2X1DA 4XN3A 2ZJQF 3TBIA 1OCRH 2R7FA 2Z99A 3E97A 2TDXA 3M3YJ 4XR6A 3GXOA 3ZQQA 2G0EA 2IS4A 2W00A 1P6RA 3FISA 4N9HA 4Y4RA 5E3MA 2VBYA 1Z7LA 3D5LA 5GPAA 3MVPA 1I1SA 2I5UA 3V7SA 1TT5B 3HRMA 1Z9CA 3OIOA 1UG0A 2P4WA 1REPC 1B9MA 2CW8A 2ICWG 2NXNB 4UUTA 2VQCA 1FT9A 1TLHB 2M4GA 2EPFA 3M8FA 4LJZF 5HLTA 4P5OA 1TC3C 2JVGA 3KP3A 4ENMA 2R5YB 2EINH 3WG9A 2UUZA 5LHGA 5D4RA 4KT5C 3FKJA 5D4SA 2V1NA 3KZYA 4PJJA 1BL0A 5LRSA 3MKWB 2A05A 5IPAA 5LD2C 1FTTA 1P7JA 3LL7A 1R7JA 1W5TA 3HUGA 3HXLA 1L3LA 1KQ0A 2HI3A 3C18A 2PMZN 1N75A 3OYLA 5ILVA 4G7ZF 3KLOA 3SFZA 4W1UA 1YOVB 2MBFA 4WK8F 5HLGA 2R3SA 1U8RA 4CYCB 1T0FA 1Z67A 4KIGA 1NK2P 1B8IA 2C6YA 2V1DA 4BY1J 1IRZA 3ZN0A 3WU2C 1Z6RA 2O0YA 2XPVA 3S15J 3PQJA 5ICEA 1VQ9I 2LKSA 2A6HF 5A2QK 3DBRB 4KYWA 2WY7Q 4QPOA 2OQGA 2HDCA 1BOBA 1QPMA 2K4JA 3FWEA 4ZDLA 1CF7B 2DPDA 5DTDA 4ON0A 2CJJA 2LC2A 4NQWA 2NS8A 3IWZA 1S7AA 2L7ZA 3K2ZA 2KT0A 1YW9A 2LR8A 4BBRJ 3S1NJ 9ANTA 2FOWA 4M3GA 4FTHA 3P9KA 1YI2I 1HF0A 1V55H 1NTCA 2V6CA 2YU9J 1Y56A 2H6CA 2DDBA 1IXRC 1YG2A 3BZ6A 3LMMA 3GTQJ 3AG2H 4G6DA 4ZJZA 4LLNA 3ASNH 1KZHA 3WTUC 1MIJA 2GQQA 2HZDA 1GVJA 5J6XA 4BE0A 3M1EA 4FCYA 1I27A 4LIUA 2LF8A 3I56I 5D6EA 5ERIA 1KYWA 4C2MJ 1IDZA 2VI6A 2YX4A 3A0BC 1ZG1A 2E7WA 2XRNA 5DEQA 1OYYA 1JKPC 2ZFWA 3QOEA 4XN0A 4JBAA 2E36A 3JSOA 2XROA 2IGKA 4LLLA 1ZK8A 2VOOA 1ZKGA 5F0HA 1F5TA 4F92B 4FX4A 1W7PB 3HYIA 5LHHA 1X58A 1EH6A 3HOXJ 2PMHA 1FBSA 2O8XA 1XS9A 2M0CA 1FEXA 4DYCA 3W2VA 2ZMEC 2WB1A 1WZ2A 4B44A 1HSTA 2KISA 2DODA 4HNUA 3HEFA 2X51A 3KEQA 2GLOA 2XGDA 3HSEA 3F23A 2QENA 1QVTA 2ESNA 1K4SA 1JTXA 2MGQA 4OU0A 3B02A 4B3XA 2BXYA 2DJNA 5FRMA 1UG2A 1ETVA 2LDUA 3SYTA 2A5WA 5DM6F 3I3LA 3SHFA 2MSYA 1SFEA 4DZJA 4A3BJ 4BXFA 3ZMUA 1S9HA 2RC4A 5L3FA 3ZMVA 4G12A 2Q1ZB 4LOCA 3IH2A 5TRDA 5FLMJ 3PO3J 1FOWA 4LG0A 4L9TA 5FB2A 4KFCA 2VBXA 1HKTA 2M9HA 3EPZA 1R9TJ 5EEAA 2QKLB 2ZSHB 1HSJA 1TQMA 2ZXHA 4KN7X 4XLEA 2ELHA 4L0ZB 4DJAA 4XLCA 3R60A 3IC7A 5EJCA 3J81K 4V19K 2EFWA 4U0VA 3QAHA 4FE7A 1IGNA 4D1QA 1KQ9A 3WGIA 4J19A 2HVSA 4N0BA 1XGSA 1TP4A 2GAUA 3H3UA 4NNJA 4L9JA 3KFWX 1J9IA 2JSCA 3X2QH 2E7XA 3GBGA 3WTSC 2HXIA 1RNLA 1MH4A 2DO7A 5J4YA 4BJ6C 3SZTA 2P8TA 2OF7A 2R5ZA 1USTA 1YS6A 2MD0A 2MW8A 5A2QZ 1AU7A 1Z77A 5E1WA 4KT6A 5L3BA 3VSKA 1ZARA 2R7XA 2RQQA 3L1PA 4IHXA 5EGOB 1ZHFA 2ACJA 1Q1VA 5F0CA 1YRNA 3HC7A 3DPTA 4LLGF 5LFAA 4G6QA 1TWCJ 5C4XJ 3CJNA 1KGSA 4BGDA 4QPQA 1J2XA 3CDIA 2XPWA 2L54A 2Y48A 1PYVA 3QPHA 3RJPA 2CSOA 1EJ9A 3TO7A 3JAMK 5CVIA 2DQRA 2MH9A 3EDPA 3GTKJ 3H3ZA 2VXZA 2A6EF 4U7BA 3H5AA 1ZGWA 1EH8A 2FXAA 4IRHA 4HA8A 3BWGA 4ENKA 2FF4A 4U88A 3CQZJ 1UJ8A 1J75A 3Q0UA 2K86A 2G7HA 1Y0UA 2YSRA 1FP2A 4I02A 1MBHA 2JPBA 3KYCB 4X0GA 3D1NI 4HBLA 3PO2J 1ZQ3P 1K6YA 3VEPA 3GTMJ 3DEEA 3DP7A 1V4RA 2KIMA 4AWXB 5DD4A 1LDKB 4BNCA 2LY9A 4XLFA 2VJ4A 2JA6J 3C2HA 3KP4A 2FOKA 3T5XA 3L2WA 1G4DA 2E1NA 2R7WA 3F0CA 1MNDA 2GXBA 1O4XA 2IS1A 2X6YA 3QQAA 3RKWA 2GA2A 1PVEA 4BEHB 4FASD 3A01B 2KRFA 4PCQA 5M5WJ 4PSXA 2ME0A 1D0ZA 1TZLA 5IYDJ 3ZQIA 3ABLH 1IRFA 3EUHC 5IT9K 3DTIA 2JSPA 2Z3YA 2DA4A 3DTEA 4Y33A 3LNQA 2AXLA 3MAJA 4R1HA 3KYLA 3IAM2 4GDFA 3FBNB 2KDZA 2ZJPF 3NWTA 3FXKA 3K1PA 1IAWA 3AKZA 1LFUP 4A6EA 3H36A 3IP4B 2DK8A 2CGPA 3GZ6A 1P92A 1QA6A 4E7HA 3ZMZA 3RSNA 1VQ5I 2E2JJ 2MG4A 1H9TA 3DFGA 3JRDA 3HTSB 1R1TA 2W1OA 2NOJB 3GW2A 3CUQB 1HDPA 1MBEA 4ZYHA 3TW7A 1B9NA 4RGUA 1I6HJ 1U5TC 1P4AA 3SEQA 4HQMA 3I59A 2B63J 4AUXA 4CXFA 3S93A 3CCRI 3OYAA 1LUJB 1UMQA 1WHUA 3CMMA 4C2TA 3CLQA 2DBBA 5DCMA 3LOCA 4Y52J 5BNGA 1TL8A 2F2EA 3MZ8A 3ZPLA 1R23A 5J1YA 1V5FA 5IT3A 2PQ8A 3CCVI 1RR8C 1LE8A 2RV8A 1J5YA 2OZUA 4XKBA 2OUMA 3K0LA 3ZCOA 3BG5A 5KCMA 5L3GA 4IHTA 4S04A 4ZTJA 3OY9A 3GTPJ 2DXIA 1X3UA 2M8GX 4EJVA 2ADUA 4HDVA 2QBYB 3BG3A 4GO1A 1I3AA 3GFMA 4BHPA 3J80K 1SAXA 4AVPA 1U2WA 2LYCA 2JA2A 3S1MJ 2E34A 1JTYA 1JUPA 2BXZA 1Y8QB 3HG9A 2NYXA 1F43A 2CUEA 4DYQA 4C2UA 4IXAA 3O6BB 1G3YA 3BPVA 3DPUA 3OR2C 4IHWA 4E70A 4X6AJ 2CS3A 2AQFA 5IYBJ 2WBMA 3N4MA 2L5QA 2Z5UA 5H6RA 2A61A 4HW0A 5J47A 1XN7A 3CCQI 3GTGJ 3LSMA 3ULQB 2PG4A 3MEXA 1U9OA 3K4KA 1T39A 3P5JA 1ULYA 3S1QJ 1W5SA 1G6NA 4IJAA 1ZG3A 4UUVA 5JLWA 2DOEA 2PN6A 1VF9A 2IXSA 2IJLA 5D5UB 1VQPI 2W24A 3B6AA 5FO5A 4F7ZA 1B4AA 4DIQA 2OQRA 3LA7A 1RETA 2HVQA 4XKWA 3VPRA 4HNVA 5H2FC 5HOOA 2XKPA 1K79A 1V3FA 4EEFG 4U0WA 1YJNI 1XSDA 1VFCA 3CJQB 1IN4A 2K9NA 3C7JA 2BV6A 1LPQA 4ZDOA 4A0YA 2HQNA 1MJ9A 3OWTA 4AIJA 3GTOJ 1O57A 1KU9A 3CZ6A 2NVTJ 2E19A 4G6TB 4RGSA 1T95A 3VSLA 4Y7NJ 3TKYA 2EBIA 2E1CA 3K4JA 2BW3A 2YUSA 3GCMA 1BN5A 1RKTA 1V54H 2ZC2A 3VFZA 4QWQA 3LSJA 1I50J 2XVCA 4XL9A 5J1RA 5HVQC 4J01A 2P7CB 3QOPA 3DV8A 3IAS2 3GTJJ 2IGOA 2K85A 3KEOA 3LAPA 3KIOA 2LBFB 1FTZA 3MKLA 2ISZA 2WTEA 2LOOA 1DGRM 2K4BA 1MZBA 4I2OA 1BM9A 3G1LA 2BY0A 5F27A 4A3EJ 2QF7A 1MDMA 2O8KA 1JHHA 2QYOA 4XOPA 2RNJA 4B43A 2BEOA 2BOLA 5HDGA 4HAMA 4B4CA 2STWA 3FMQA 1LEBA 3TGNA 2F5CA 2GOMA 2W84A 4BJ5C 2FX0A 1QHHD 2DMNA 2IS6A 4IX7A 1MH3A 3KYDB 2IAIA 3IRQA 3SJMA 4P9FA 4GYGA 2A68F 1QVUA 1LVKA 4KIFA 4E7LA 2I10A 5HS7A 2V9PA 3HHGA 1VQMI 1K4TA 1W36D 1YTYA 5M3FJ 1OPCA 2X85A 3K10A 2A5YB 2ZMEB 1G3TA 2HQ5A 3T0YA 2KQRA 2FRHA 5KAIC 2QGUA 1ZN2A 2YPRA 3G3ZA 5HNFA 1LDDA 4E7ZA 3QYBA 4XLAA 1G59A 2QQ8A 2D5VA 3KPHA 2DK5A 3CDLA 1WH7A 3FXQA 3PSFA 3IWFA 2IA1A 3CO7C 1XGMA 1K6OA 4OMZA 2P5VA 3D5RC 2JMWA 4M74A 4IQJA 4F55A 2Y0SA 3A0HC 3JR9A 1ZGJA 2Y69H 2PEXA 3WHBA 3MN2A 4HV5A 3I71A 1J7KA 2E35A 3BJOA 3J80Z 3FMRA 4HEA2 2JUCA 3WG7H 3FM5A 3U1DA 4A3KJ 2W57A 1A31A 2K27A 1MGTA 2W82A 3CUOA 4A6DA 2WA0A 4MTDA 2VKEA 1KQ8A 2H27A 1Y1WJ 3A03A 4H4KC 4HLXA 2E5NA 5CPRB 1C0WA 1T0FC 3HRUA 4XRSG 2X9DA 1BI3A 3E7LA 2LMDA 1ZRDA 3R0AA 5CVUA 1E2XA 5IY5H 4II3A 4HNTA 2IRFG 2XGXA 2VC1A 3JRGA 3RI4A 1NHAA 2VE8A 3MZYA 4BKXA 4TV7A 3PM1A 4U0YA 1VQNI 4GGGA 5H6QA 1X3WB 5EG0B 1MSFC 4Q48A 2HYJA 1VQ4I 5LGUA 2Y2ZA 2WB1N 3HGGA 4UY8I 3CTAA 3RQ4A 4AD9A 3RTRA 2XF6A 5AIQA 4LFUA 3H1CA 4RB0A 1UHSA 4WXDA 4OIQF 3T8TA 1D0XA 2HDWA 1WVRA 2LTPA 4RGXA 3CLOA 3TDZC 3VYRB 1PUFA 3QPTA 2L4AA 2XAUA 1WKMA 1XCBA 1ETYA 2KHMA 3BR5A 1BW5A 4M3DA 2DMUA 3LSKA 2R7QA 4DNCA 2L9NA 3ZQFA 1A35A 3CCMI 3G2BA 3GFJA 1B72B 2LY1A 3IH4A 4RA2A 4XQFA 3O3KA 4DW6A 3LQQA 4C3HJ 4Q5SF 2A69F 3CCSI 1BR2A 1T8IA 4BY7J 5CLSA 4HX7A 3E6CC 4JX5A 1WI9A 1XPXA 2CUZA 3V8JA 1I1GA 1A36A 1WJEA 1LB2A 1GDTA 1M1EB 1RC9A 2FBHA 2WAQN 2DAOA 5JR3A 1G3SA 3HJEA 4CO8A 1FJLA 1LVAA 3E5UA 3QRFF 4OAYA 5ICFA 3ZQCA 2NNYA 5CKTA 2V7FA 4HSTA 3I4MJ 1QO0D 3V7RA 2AHQA 2M5WA 4V2GA 1TWGJ 4EJWA 2O61A 3CCJI 2HEOA 2ID3A 2CUJA 1G8XA 3KE2A 1F4KA 4IVNA 2Z33A 3E0JB 3OYFA 1XGOA 4MEXF 4HV6A 2XGEA 2X6OA 3JRBA 4HPQA 3I4PA 1TNSA 2BE5F 1XGNA 2KIFA 1SVMA 2HNHA 4ZTFA 2VLAA 3JRHA 5FFXA 3AG4H 3OYKA 2A6TA 3T1BA 1S72I 2AO9A 2HXOA 1XSVA 3JTHA 5CJ9A 3OYNA 1XMAA 2DPUA 4OWRB 2B0LA 3PUBA 4BBSJ 3H5NA 1HXDA 4XRMA 2EV0A 2F4MB 3M8JA 3J7AY 4I98B 2IGNA 1BJZA 5TJJA 3F8FA 4C3JJ 4YIFA 1O3QA 1UB9A 3VDXA 3HPGA 4LMYA 4ZH4F 4JOMA 3L2QA 4KISA 3OYJA 2ZXWH 3BP8A 1S3JA 3K2AA 3VODA 1DU0A 2V6EA 1XD7A 4I7HA 2JA7J 3CJRB 5E20A 3BTIA 2DA3A 2NVXJ 3LSGA 5EZHA 2L7MP 4HG2A 5J8FA 2KRHA 2F5FA 5K7HA 1E3OC 1U9NA 5BMZA 4A3DJ 4NHJA 2QM3A 4NC7A 1YQAA 2MABA 2XSDC 1YHQI 2JA8J 2ZKZA 1T38A 1Z0XA 4D5FA 1KU2A 4C9YA 2R7RA 3D0SA 1X1CA 5J4VA 2HOTA 3O8GA 4UV9A 3WU1B 1LKXA 1U78A 2G9WA 1BR1A 1ENHA 2DFIA 3HRTA 4BH9A 3Q9VA 4Q4ZF 1TWHJ 1TWFJ 2XAJA 1R6RA 1ZLJA 3S8PA 4E7KA 1OQYA 1JUSA 1IZ1A 3DXJF 3H92A 2QZ8A 1MMAA 2IEKA 4FE4A 3HZJA 4ASNA 4BXXJ 1D8JA 4AC0A 2R4GA 3KX2A 3KP2A 2Z2SB 4XK4A 1ZTRA 5F64A 4JX4A 1R36A 1HQCA 1KYZA 4IO9F 1DU6A 2KP6A 2COMA 2OD5A 4EVIA 2FQ3A 5KHDA 5CQEA 1RKWA 3F3XA 1MJBA 2XASA 4EGZA 5AIPA 3VYUB 4HYEA 1X4PA 1MJAA 2R7DA 4NC8A 3U1KA 2KMUA 3JREA 3GVAA 2EV6A
chains in the Genus database with same CATH topology
2CFXA 2RVCA 1BC7C 3ISPA 3CUQA 4I0BA 4UXNA 3GYHX 2EFOA 4UVBA 2A07F 4HZFA 2HGCA 2JZYA 1QBJA 3JW4A 1R1UA 1ON2A 3GLXA 1ODDA 2FU4A 1Z91A 1HBXG 1FYLA 2QBYA 2GA1A 3LA2A 3N97A 4KMUX 2J5OA 4PZJA 3ZQ7A 4G94A 2QQ9A 3QP5A 1QZZA 2Z9OA 3FM3A 2XV4S 1FYKA 4P55A 4RS8A 3DEUA 2K02A 4M73A 5HDKA 4WF2A 4UNOA 2EA2A 1K78A 1IW7F 2BBYA 2IP2A 2HYGD 3EETA 3W6KB 2VT2A 1F1ZA 3TO9A 2GXGA 3BY6A 1ONVA 2VE9A 4BHBA 2FBIA 1ZYRF 4EMSA 2GWRA 4BAYA 3DPLC 3MZHA 1Q1HA 3OV8A 1U3EM 4OMYA 1BIAA 4WWCA 3EYIA 4A5MA 1I5ZA 2WV0A 4YIIA 4A5NA 5DUIA 3ZMTA 2GZWA 2D1VA 4JQFA 4GYIA 5CVVA 2HZTA 2ETHA 6PAXA 1ZREA 4XBFA 2XAFA 2RKHA 1GXQA 1SFXA 2EJRA 1UFMA 1BIBA 1B59A 4P9UA 1B6AA 2X0LA 4IRIA 4G8XA 2OZ6A 4UHTA 4I01A 1GXPA 3DQVC 4ZYGA 3MCZA 1EH7A 1ZLKA 2MLGA 1FLIA 2LSOA 4WCGA 1LNWA 2EFPA 3W6JB 4CDGA 4KMFA 1XCVA 5HS9A 3RPUA 3WTVC 1UCRA 3P9IA 1Z05A 4PDKA 2DQLA 1TQIA 3M7GA 4RAZA 4KN4X 5JHUA 2P6TA 4EQQA 5D5VB 2W25A 3E6BA 4LD5A 1AOYA 2KIUA 5JI6A 5E18F 4AIKA 4IPAA 3ZMSA 2Q0OA 2HKOA 2RGVA 2ZXJA 4ZZDA 3TQNA 3LSTA 1PDNC 3L7WA 4HLYA 3IKTA 4BHCA 3P9CA 2HQRA 4XSZF 4UVCA 3BROA 2F5EA 3EYYA 2FNAA 1YO5C 3QU6A 4NB5A 3HTUA 4M9SA 1XB4A 3FXUA 2WC2A 3J81Z 3L09A 1TNTA 1BC8C 2EV5A 4YFXF 2CO5A 5BPIA 2PBIA 4OIOF 3S2WA 4L9NA 3WE2A 3K69A 4MEYF 5BOXA 1Z1DA 3IKVA 4ESJA 1YW7A 4HX4A 1ZRFA 2DT5A 1TBXA 2D2WA 2FMLA 4P96A 5E1XA 3EQLF 1IXSB 2P7VB 5EEHA 1QGPA 5E1ZB 2O6GE 5K5OA 2STTA 3JAMZ 1H9GA 4O3MA 5ED4A 1RI7A 3IHUA 1J59A 2VC0A 2QVOA 1YFHA 2VT3A 5FLXK 3P7NA 4L9VA 5ILSA 2HS5A 3MQ0A 1JGSA 4CYDA 2KJBA 3AAFA 5DDGA 1QQIA 4R79A 1R5HA 2QLZA 3JTGA 1BJAA 1O3RA 4XLNF 5LEKA 1IN5A 3V4GA 5DV5A 2ZO4A 3GEZA 4FX0A 3ML6A 2KJCA 2M8EA 3QU3A 1JE8A 1D5VA 3WGHA 1VTNC 5D5WB 5IT9Z 1ZRCA 4QLCU 2MC3A 5CVRA 2FA5A 2IA2A 1MKMA 3CDHA 2CYYA 5ICGA 3FF5A 1T6SA 1SD4A 3OOPA 2DW4A 1CF7A 3WTXC 5HLHA 1IXCA 2PI0A 5LBQA 3BOQA 4KDPA 4HF2A 1WSUA 2L3DA 1OYIA 2HTJA 1IF1A 2M1BA 2M30A 1K7AA 1FC3A 3BDDA 3LWFA 5KK1A 4FHTA 4M6XA 2NAZA 4HQEA 1H0MA 2G7UA 2CG4A 4ENJA 5L3DA 4ENNA 5L3CA 2XAQA 3TO6A 4CICA 5DUKA 2ESHA 3RDIA 1SD6A 1W7PA 3F8MA 4GCVA 1P4WA 4BXUA 1SMTA 4I09A 3GWZA 4HDUA 3I59B 1FOKA 1R1VA 2ZNZA 1R22A 3RYRA 4ZZLA 4Q47A 2HWVA 4M9XA 2VN2A 4HX8A 2FBKA 1S8NA 5K5QA 1B1BA 2BYVE 2EK5A 1T98A 2RDPA 1LQ1A 3FXRA 4M6YA 3RKYA 1IN8A 3QP6A 5FLXZ 5JVTA 3I53A 3R61A 1RUNA 2H09A 1S7OA 1R5GA 3I54A 4MNUA 1W7PD 3KZZA 1KU3A 2FSWA 1HW1A 3F8CA 3ZP5A 5K1YA 2NS0A 3CUQC 3IRRA 2XHKA 1WRJA 2KKOA 4EGYA 1R58A 1W4MA 4RGRA 4BYYA 3F6OA 1U6GA 2WWYA 4N9IA 4JK1X 3PFIA 1FNNA 4Y15A 1RUOA 4IHSA 4Y17A 5CYVA 2OBPA 4CZZA 1USSA 3BPXA 3NEUA 5BS6A 3FHZA 5FD5A 2ZNYA 5AONA 4GXOA 5LRRA 4UVAA 3HOSA 2XUBA 3U9GA 4OOIA 4EM2A 3VOEA 4LB6B 5LEJA 2EA4A 4LK1F 1ZGAA 2IA0A 2HKXA 3E6MA 1O3TA 4G7OF 1XMKA 2X4HA 4CGZA 1PP7U 1U5TB 4KNYA 1J0RA 4O5VA 5E8IA 3WODF 1MDMB 2QWWA 2FEZA 5HDNA 2XAGA 1SMYF 2ZJ2A 3KETA 3DF8A 4U7DA 4OIPF 5DD8A 2VOPA 1D3YA 1F9NA 1BOAA 2V9VA 1TW3A 5BQTA 2F5DA 2MLKA 5F6FA 3HHHA 4RAYA 3ZMDA 3RKXA 2YR2A 1FWZA 3HSRA 5LHIA 3G73A 3Q9SA 1QZYA 1RZ4A 4M9ZA 2DU9A 1ON1A 2EFNA 3C3WA 1GHCA 4H0EA 5LGTA 3I5UA 3L2CA 4M72A 3Q5FA 2YX7A 2NNNA 5D5XB 1G3WA 3E5QA 4KICA 3CO6C 2GIVA 2LKPA 3SXYA 4Y13A 2DLLA 2UXNA 2ZBKA 1OKRA 2YU3A 3GZ5A 3HRSA 2HYFA 4S05A 3LQRA 3WTZA 3TDUC 3BJAA 2FMYA 4HF1A 2P5LC 4O6JA 4AIHA 3HSFA 4PGGA 1FPQA 1HKQA 4RB2C 3GFLA 4IF4A 2MD5A 1DDNA 1OMIA 5D8LB 2AS5F 5FFZA 5E8GA 1FX7A 1LDJA 3SQNA 4A0XA 5EEGA 1TW2A 4R8HA 3U2RA 1D8KA 3K1NA 1O7LA 4BQAA 2IW5A 3SZPA 5DYMA 2VBZA 1OYWA 2M87A 2HTSA 3KP7A 3WE3A 3ZN1A 1MD0A 2CQKA 4D0PA 2D1HA 3I0TA 4K2EA 2XKOA 1RIOH 3F8NA 1XSXA 2Q8KA 1FSHA 4IRGA 3ECHA 1R00A 3REOA 4L5JA 1I6XA 2HFHA 1S6LA 2CW0F 3TOBA 2W85A 3LA3A 3C1DA 3F22A 4M71A 2UXXA 2EFQA 1LEAA 2OAZA 2P6SA 1ZG5A 1KU7A 3ROUA 3IL2A 2LF7A 2QQAA 3GFIA 3GF2A 1ZAOA 3DKWA 1STZA 1DUXC 4LK0F 1SD5A 2BGCA 4Z2YA 2ZMEA 3K9TA 4XLPF 2XIGA 5E17F 1YW8A 5H20A 1L0OC 2K7LA 1UHMA 2V79A 4OIRF 3MWMA 2P5KA 4WXHA 2UWMA 2QUFA 3M9AA 1FY7A 4B09A 1BBYA 1KA8A 2O3FA 1IUYA 2IPQX 4WXCA 4FT8A 2H94A 2EB7A 4EV0A 3R0JA 3L00A 5D6FA 3O2PE 2FNPA 1OR7A 1DPUA 2DI3A 2Y0MA 4ZYEA 2LNBA 3KLNA 3M8EA 1YS7A 4ETSA 3F6VA 1UHWA 2VONA 5F1RA 2JRTA 3WTYC 4EJUA 1ZH5A 3KP5A 1AWCA 5K5RA 5L3EA 2ZCWA 3ELKA 3L9FA 3WTTC 1FBUA 2D45A 4XSXF 2V1XA 3I58A 4WX9A 4RB3C 4PGHA 3V8LA 5JFRA 2JPCA 2RQPA 2MA3A 2OU2A 2XAHA 1JXSA 2VODA 3WGGA 2PFBA 2RN7A 4LB5A 3FMSA 2OA4A 4MHGA 4LG0B 3R6SA 1FYMA 1YIOA 2L4MA 1FP1D 4EJTA 3GX4X 4YG2F 2V1UA 1A04A 4KUMA 1IN6A 1K78B 2H6BA 3GUDA 1P2FA 4YFNF 1HW5A 1HW2A 1PP8F 5FD6A 3V8KA 4A12A 1S29A 5KVRA 1PUEE 2HOEA 3F21A 3J7AO 5FGMA 1TQPA 1DP7P 4A2UA 4MQVA 2MH2A 1EV7A 2L02A 3I64A 3EUHA 4LGWA 1IRGA 1SD7A 1LJ9A 4ESFA 2HR3A 4I0AA 3LAJA 1HKSA 3E3VA 1WWXA 3B73A 1YLFA 4A0ZA 2M45A 3ERED 1FZPB 5HLIA 2Y75A 4DQ2A 2A3SA 2O03A 3PQKA 2CWEA 4B8XA 4KA4A 2ISYA 3MFKA 1XDSA 3JSPA 3RPQA 1FBQA 1U5TA 3F72A 4KIBA 4OINF 1FSEA 4CHUA 2IVMA 3RIRA 1JHFA 5J8CA 3R4KA 5ILUA 3RYPA 1BI0A 3WU0A 2NRAC 2UZKA 3HOTA 4HOBA 5CVJA 1P4XA 2PMUA 3WTWC 3NQOA 5LGNA 2EWNA 1Z6TA 3BJ6A 1YYVA 3ABTA 4EM1A 1BI1A 3T8RA 1O7FA 4MTEA 4MGRA 1T2KA 4G7HF 3ABUA 3FX3A 3E5XA 5DCFA 2DTRA 1IN7A 4RB1A 5HS8A 1XDUA 3HIFA 3E6DA 1QNTA 2QQBA 2PLYA 4YFKF 3K1MA 4MQ9F 4L5IA 3NRVA 3GO5A 5DCMB 4EM0B 3KCCA 4L0YB 3F8BA 3FZVA 2FE3A 3ECOA 3V7CA 5BPDA 5D8KB 4XRFA 1BI2A 2J5PA 2Q2EA 1SFUA 2JT1A 1E17A 4ZYDA 3TOAA 1TTYA 1Z7UA 3VB2A 4ESBA 4G9YA 4UV8A 4EJOA 3LFKA 2JTVA 2L01A 2IT0A 2PJPA 4HF0A 5ICCA 1DPRA 4L18B 1WQ2A 1O3SA 5LLQA 2VBWA 3COAC 3KP6A 1CGPA 2R7FA 2Z99A 3E97A 2TDXA 3GXOA 1P6RA 4N9HA 2VBYA 3D5LA 1I1SA 3V7SA 3HRMA 1Z9CA 2P4WA 1REPC 1B9MA 1FT9A 1TLHB 3M8FA 4LJZF 4P5OA 3KP3A 4ENMA 3WG9A 5LHGA 5D4RA 4KT5C 5D4SA 3KZYA 5LRSA 1R7JA 1W5TA 3HUGA 1L3LA 1KQ0A 3C18A 5ILVA 4G7ZF 3KLOA 3SFZA 2MBFA 4WK8F 5HLGA 2R3SA 1U8RA 1T0FA 4KIGA 2C6YA 2V1DA 3ZN0A 1Z6RA 2O0YA 3PQJA 5ICEA 2A6HF 5A2QK 4KYWA 2OQGA 2HDCA 1QPMA 2K4JA 3FWEA 1CF7B 2DPDA 4ON0A 4NQWA 3IWZA 1S7AA 3K2ZA 1YW9A 3P9KA 2V6CA 2H6CA 1IXRC 1YG2A 3BZ6A 4G6DA 4LLNA 3WTUC 2GQQA 1GVJA 5J6XA 3M1EA 1I27A 2LF8A 5D6EA 5ERIA 1KYWA 2YX4A 1ZG1A 2E7WA 2XRNA 5DEQA 1OYYA 2ZFWA 4JBAA 3JSOA 2XROA 4LLLA 2VOOA 1F5TA 4FX4A 1W7PB 3HYIA 5LHHA 1EH6A 2PMHA 1FBSA 2O8XA 1HSTA 3KEQA 3HSEA 3F23A 2QENA 2ESNA 4OU0A 3B02A 2LDUA 3SHFA 1SFEA 3ZMUA 2RC4A 5L3FA 3ZMVA 5TRDA 4LG0A 4L9TA 5FB2A 4KFCA 2VBXA 1HKTA 1HSJA 1TQMA 4KN7X 4L0ZB 2ELHA 3R60A 3IC7A 3J81K 2EFWA 4U0VA 3QAHA 1KQ9A 3WGIA 4N0BA 1XGSA 2GAUA 3H3UA 4L9JA 3KFWX 1J9IA 2JSCA 2E7XA 3WTSC 1RNLA 2DO7A 3SZTA 2P8TA 1USTA 1YS6A 5A2QZ 5E1WA 5L3BA 1ZARA 1ZHFA 2ACJA 3DPTA 4LLGF 4G6QA 3CJNA 1KGSA 1J2XA 2L54A 2Y48A 3QPHA 3RJPA 2CSOA 3TO7A 3JAMK 5CVIA 2DQRA 2MH9A 3EDPA 3H3ZA 2VXZA 2A6EF 4U7BA 1EH8A 2FXAA 4IRHA 4HA8A 3BWGA 4ENKA 2FF4A 4U88A 1J75A 2K86A 2G7HA 1Y0UA 2YSRA 1FP2A 4I02A 2JPBA 4HBLA 3VEPA 3DP7A 1V4RA 2KIMA 4AWXB 5DD4A 1LDKB 4BNCA 3KP4A 2FOKA 3T5XA 1G4DA 2E1NA 2GXBA 3RKWA 2GA2A 2KRFA 4PCQA 1IRFA 5IT9K 2Z3YA 2AXLA 3MAJA 4R1HA 3K1PA 1IAWA 4A6EA 2DK8A 2CGPA 3GZ6A 1P92A 3ZMZA 1H9TA 3DFGA 3HTSB 1R1TA 3GW2A 3CUQB 4ZYHA 1B9NA 4RGUA 1U5TC 1P4AA 4HQMA 3I59A 4CXFA 2DBBA 5DCMA 2F2EA 3ZPLA 1R23A 5IT3A 2PQ8A 2RV8A 1J5YA 2OZUA 3K0LA 5L3GA 4IHTA 4S04A 1X3UA 4EJVA 2ADUA 4HDVA 2QBYB 4GO1A 3GFMA 4BHPA 3J80K 1SAXA 4AVPA 1U2WA 2NYXA 4IXAA 3O6BB 1G3YA 3BPVA 4E70A 3N4MA 2Z5UA 5H6RA 2A61A 4HW0A 1XN7A 3ULQB 2PG4A 3MEXA 1T39A 1ULYA 1W5SA 1G6NA 4IJAA 1ZG3A 4UUVA 2PN6A 2IJLA 5D5UB 2W24A 5FO5A 4F7ZA 1B4AA 2OQRA 3LA7A 5HOOA 2XKPA 1K79A 1V3FA 4U0WA 1XSDA 1IN4A 3C7JA 2BV6A 4A0YA 2HQNA 1MJ9A 4AIJA 1O57A 1KU9A 4RGSA 3TKYA 2E1CA 1BN5A 3VFZA 4QWQA 2XVCA 5HVQC 2P7CB 3QOPA 3DV8A 3KEOA 3LAPA 2ISZA 2WTEA 2K4BA 4I2OA 1MZBA 1BM9A 1MDMA 1JHHA 2QYOA 2RNJA 2BEOA 5HDGA 4HAMA 2STWA 3FMQA 1LEBA 3TGNA 2F5CA 2W84A 3IRQA 4P9FA 4GYGA 2A68F 4KIFA 5HS7A 3HHGA 1YTYA 1OPCA 2A5YB 2ZMEB 1G3TA 3T0YA 2FRHA 1ZN2A 2YPRA 3G3ZA 1LDDA 2DK5A 3FXQA 3IWFA 2IA1A 3CO7C 1XGMA 1K6OA 4OMZA 2P5VA 4M74A 1ZGJA 2PEXA 4HV5A 3I71A 1J7KA 3BJOA 3J80Z 3FMRA 3FM5A 3U1DA 2W57A 2K27A 1MGTA 3CUOA 4A6DA 4MTDA 1KQ8A 2H27A 4HLXA 1C0WA 3HRUA 1BI3A 1ZRDA 3R0AA 5CVUA 1E2XA 2IRFG 2XGXA 2VC1A 3RI4A 1NHAA 2VE8A 3MZYA 4TV7A 4U0YA 4GGGA 5H6QA 4Q48A 5LGUA 3CTAA 4AD9A 3RTRA 5AIQA 4LFUA 4RB0A 4WXDA 4OIQF 3T8TA 4RGXA 3CLOA 3TDZC 3QPTA 2L4AA 1WKMA 1XCBA 4DNCA 3GFJA 3O3KA 3LQQA 4Q5SF 2A69F 5CLSA 4HX7A 3E6CC 1WI9A 3V8JA 1I1GA 1LB2A 2FBHA 5JR3A 2DAOA 1G3SA 4CO8A 1LVAA 3E5UA 3QRFF 5ICFA 2NNYA 1QO0D 3V7RA 2M5WA 2O61A 4EJWA 2HEOA 3KE2A 1F4KA 4IVNA 2Z33A 1XGOA 4MEXF 4HV6A 3I4PA 1TNSA 2BE5F 1XGNA 2KIFA 5FFXA 3T1BA 1XSVA 3JTHA 5CJ9A 1XMAA 2DPUA 2B0LA 1HXDA 2EV0A 4I98B 5TJJA 4YIFA 3F8FA 1O3QA 1UB9A 4LMYA 4ZH4F 3BP8A 1S3JA 3VODA 1XD7A 4I7HA 5E20A 5J8FA 2F5FA 5BMZA 4NHJA 2QM3A 1YQAA 2ZKZA 1T38A 1KU2A 3D0SA 4UV9A 3WU1B 1U78A 2G9WA 2DFIA 3HRTA 4BH9A 3Q9VA 4Q4ZF 2XAJA 1ZLJA 3DXJF 1IZ1A 3H92A 2QZ8A 4ASNA 1D8JA 3KP2A 5F64A 1R36A 1HQCA 1KYZA 2COMA 2OD5A 4EVIA 2FQ3A 3F3XA 1MJBA 2XASA 4EGZA 5AIPA 4HYEA 1MJAA 2R7DA 3GVAA 2EV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFX A;  2RVC A;  1BC7 C;  3ISP A;  3CUQ A;  4I0B A;  4UXN A;  3GYH X;  2EFO A;  4UVB A;  2A07 F;  4HZF A;  2HGC A;  2JZY A;  1QBJ A;  3JW4 A;  1R1U A;  1ON2 A;  3GLX A;  1ODD A;  2FU4 A;  1Z91 A;  1HBX G;  1FYL A;  2QBY A;  2GA1 A;  3LA2 A;  3N97 A;  4KMU X;  2J5O A;  4PZJ A;  3ZQ7 A;  4G94 A;  2QQ9 A;  3QP5 A;  1QZZ A;  2Z9O A;  3FM3 A;  2XV4 S;  1FYK A;  4P55 A;  4RS8 A;  3DEU A;  2K02 A;  4M73 A;  5HDK A;  4WF2 A;  4UNO A;  2EA2 A;  1K78 A;  1IW7 F;  2BBY A;  2IP2 A;  2HYG D;  3EET A;  3W6K B;  2VT2 A;  1F1Z A;  3TO9 A;  2GXG A;  3BY6 A;  1ONV A;  2VE9 A;  4BHB A;  2FBI A;  1ZYR F;  4EMS A;  2GWR A;  4BAY A;  3DPL C;  3MZH A;  1Q1H A;  3OV8 A;  1U3E M;  4OMY A;  1BIA A;  4WWC A;  3EYI A;  4A5M A;  1I5Z A;  2WV0 A;  4YII A;  4A5N A;  5DUI A;  3ZMT A;  2GZW A;  2D1V A;  4JQF A;  4GYI A;  5CVV A;  2HZT A;  2ETH A;  6PAX A;  1ZRE A;  4XBF A;  2XAF A;  2RKH A;  1GXQ A;  1SFX A;  2EJR A;  1UFM A;  1BIB A;  1B59 A;  4P9U A;  1B6A A;  2X0L A;  4IRI A;  4G8X A;  2OZ6 A;  4UHT A;  4I01 A;  1GXP A;  3DQV C;  4ZYG A;  3MCZ A;  1EH7 A;  1ZLK A;  2MLG A;  1FLI A;  2LSO A;  4WCG A;  1LNW A;  2EFP A;  3W6J B;  4CDG A;  4KMF A;  1XCV A;  5HS9 A;  3RPU A;  3WTV C;  1UCR A;  3P9I A;  1Z05 A;  4PDK A;  2DQL A;  1TQI A;  3M7G A;  4RAZ A;  4KN4 X;  5JHU A;  2P6T A;  4EQQ A;  5D5V B;  2W25 A;  3E6B A;  4LD5 A;  1AOY A;  2KIU A;  5JI6 A;  5E18 F;  4AIK A;  4IPA A;  3ZMS A;  2Q0O A;  2HKO A;  2RGV A;  2ZXJ A;  4ZZD A;  3TQN A;  3LST A;  1PDN C;  3L7W A;  4HLY A;  3IKT A;  4BHC A;  3P9C A;  2HQR A;  4XSZ F;  4UVC A;  3BRO A;  2F5E A;  3EYY A;  2FNA A;  1YO5 C;  3QU6 A;  4NB5 A;  3HTU A;  4M9S A;  1XB4 A;  3FXU A;  2WC2 A;  3J81 Z;  3L09 A;  1TNT A;  1BC8 C;  2EV5 A;  4YFX F;  2CO5 A;  5BPI A;  2PBI A;  4OIO F;  3S2W A;  4L9N A;  3WE2 A;  3K69 A;  4MEY F;  5BOX A;  1Z1D A;  3IKV A;  4ESJ A;  1YW7 A;  4HX4 A;  1ZRF A;  2DT5 A;  1TBX A;  2D2W A;  2FML A;  4P96 A;  5E1X A;  3EQL F;  1IXS B;  2P7V B;  5EEH A;  1QGP A;  5E1Z B;  2O6G E;  5K5O A;  2STT A;  3JAM Z;  1H9G A;  4O3M A;  5ED4 A;  1RI7 A;  3IHU A;  1J59 A;  2VC0 A;  2QVO A;  1YFH A;  2VT3 A;  5FLX K;  3P7N A;  4L9V A;  5ILS A;  2HS5 A;  3MQ0 A;  1JGS A;  4CYD A;  2KJB A;  3AAF A;  5DDG A;  1QQI A;  4R79 A;  1R5H A;  2QLZ A;  3JTG A;  1BJA A;  1O3R A;  4XLN F;  5LEK A;  1IN5 A;  3V4G A;  5DV5 A;  2ZO4 A;  3GEZ A;  4FX0 A;  3ML6 A;  2KJC A;  2M8E A;  3QU3 A;  1JE8 A;  1D5V A;  3WGH A;  1VTN C;  5D5W B;  5IT9 Z;  1ZRC A;  4QLC U;  2MC3 A;  5CVR A;  2FA5 A;  2IA2 A;  1MKM A;  3CDH A;  2CYY A;  5ICG A;  3FF5 A;  1T6S A;  1SD4 A;  3OOP A;  2DW4 A;  1CF7 A;  3WTX C;  5HLH A;  1IXC A;  2PI0 A;  5LBQ A;  3BOQ A;  4KDP A;  4HF2 A;  1WSU A;  2L3D A;  1OYI A;  2HTJ A;  1IF1 A;  2M1B A;  2M30 A;  1K7A A;  1FC3 A;  3BDD A;  3LWF A;  5KK1 A;  4FHT A;  4M6X A;  2NAZ A;  4HQE A;  1H0M A;  2G7U A;  2CG4 A;  4ENJ A;  5L3D A;  4ENN A;  5L3C A;  2XAQ A;  3TO6 A;  4CIC A;  5DUK A;  2ESH A;  3RDI A;  1SD6 A;  1W7P A;  3F8M A;  4GCV A;  1P4W A;  4BXU A;  1SMT A;  4I09 A;  3GWZ A;  4HDU A;  3I59 B;  1FOK A;  1R1V A;  2ZNZ A;  1R22 A;  3RYR A;  4ZZL A;  4Q47 A;  2HWV A;  4M9X A;  2VN2 A;  4HX8 A;  2FBK A;  1S8N A;  5K5Q A;  1B1B A;  2BYV E;  2EK5 A;  1T98 A;  2RDP A;  1LQ1 A;  3FXR A;  4M6Y A;  3RKY A;  1IN8 A;  3QP6 A;  5FLX Z;  5JVT A;  3I53 A;  3R61 A;  1RUN A;  2H09 A;  1S7O A;  1R5G A;  3I54 A;  4MNU A;  1W7P D;  3KZZ A;  1KU3 A;  2FSW A;  1HW1 A;  3F8C A;  3ZP5 A;  5K1Y A;  2NS0 A;  3CUQ C;  3IRR A;  2XHK A;  1WRJ A;  2KKO A;  4EGY A;  1R58 A;  1W4M A;  4RGR A;  4BYY A;  3F6O A;  1U6G A;  2WWY A;  4N9I A;  4JK1 X;  3PFI A;  1FNN A;  4Y15 A;  1RUO A;  4IHS A;  4Y17 A;  5CYV A;  2OBP A;  4CZZ A;  1USS A;  3BPX A;  3NEU A;  5BS6 A;  3FHZ A;  5FD5 A;  2ZNY A;  5AON A;  4GXO A;  5LRR A;  4UVA A;  3HOS A;  2XUB A;  3U9G A;  4OOI A;  4EM2 A;  3VOE A;  4LB6 B;  5LEJ A;  2EA4 A;  4LK1 F;  1ZGA A;  2IA0 A;  2HKX A;  3E6M A;  1O3T A;  4G7O F;  1XMK A;  2X4H A;  4CGZ A;  1PP7 U;  1U5T B;  4KNY A;  1J0R A;  4O5V A;  5E8I A;  3WOD F;  1MDM B;  2QWW A;  2FEZ A;  5HDN A;  2XAG A;  1SMY F;  2ZJ2 A;  3KET A;  3DF8 A;  4U7D A;  4OIP F;  5DD8 A;  2VOP A;  1D3Y A;  1F9N A;  1BOA A;  2V9V A;  1TW3 A;  5BQT A;  2F5D A;  2MLK A;  5F6F A;  3HHH A;  4RAY A;  3ZMD A;  3RKX A;  2YR2 A;  1FWZ A;  3HSR A;  5LHI A;  3G73 A;  3Q9S A;  1QZY A;  1RZ4 A;  4M9Z A;  2DU9 A;  1ON1 A;  2EFN A;  3C3W A;  1GHC A;  4H0E A;  5LGT A;  3I5U A;  3L2C A;  4M72 A;  3Q5F A;  2YX7 A;  2NNN A;  5D5X B;  1G3W A;  3E5Q A;  4KIC A;  3CO6 C;  2GIV A;  2LKP A;  3SXY A;  4Y13 A;  2DLL A;  2UXN A;  2ZBK A;  1OKR A;  2YU3 A;  3GZ5 A;  3HRS A;  2HYF A;  4S05 A;  3LQR A;  3WTZ A;  3TDU C;  3BJA A;  2FMY A;  4HF1 A;  2P5L C;  4O6J A;  4AIH A;  3HSF A;  4PGG A;  1FPQ A;  1HKQ A;  4RB2 C;  3GFL A;  4IF4 A;  2MD5 A;  1DDN A;  1OMI A;  5D8L B;  2AS5 F;  5FFZ A;  5E8G A;  1FX7 A;  1LDJ A;  3SQN A;  4A0X A;  5EEG A;  1TW2 A;  4R8H A;  3U2R A;  1D8K A;  3K1N A;  1O7L A;  4BQA A;  2IW5 A;  3SZP A;  5DYM A;  2VBZ A;  1OYW A;  2M87 A;  2HTS A;  3KP7 A;  3WE3 A;  3ZN1 A;  1MD0 A;  2CQK A;  4D0P A;  2D1H A;  3I0T A;  4K2E A;  2XKO A;  1RIO H;  3F8N A;  1XSX A;  2Q8K A;  1FSH A;  4IRG A;  3ECH A;  1R00 A;  3REO A;  4L5J A;  1I6X A;  2HFH A;  1S6L A;  2CW0 F;  3TOB A;  2W85 A;  3LA3 A;  3C1D A;  3F22 A;  4M71 A;  2UXX A;  2EFQ A;  1LEA A;  2OAZ A;  2P6S A;  1ZG5 A;  1KU7 A;  3ROU A;  3IL2 A;  2LF7 A;  2QQA A;  3GFI A;  3GF2 A;  1ZAO A;  3DKW A;  1STZ A;  1DUX C;  4LK0 F;  1SD5 A;  2BGC A;  4Z2Y A;  2ZME A;  3K9T A;  4XLP F;  2XIG A;  5E17 F;  1YW8 A;  5H20 A;  1L0O C;  2K7L A;  1UHM A;  2V79 A;  4OIR F;  3MWM A;  2P5K A;  4WXH A;  2UWM A;  2QUF A;  3M9A A;  1FY7 A;  4B09 A;  1BBY A;  1KA8 A;  2O3F A;  1IUY A;  2IPQ X;  4WXC A;  4FT8 A;  2H94 A;  2EB7 A;  4EV0 A;  3R0J A;  3L00 A;  5D6F A;  3O2P E;  2FNP A;  1OR7 A;  1DPU A;  2DI3 A;  2Y0M A;  4ZYE A;  2LNB A;  3KLN A;  3M8E A;  1YS7 A;  4ETS A;  3F6V A;  1UHW A;  2VON A;  5F1R A;  2JRT A;  3WTY C;  4EJU A;  1ZH5 A;  3KP5 A;  1AWC A;  5K5R A;  5L3E A;  2ZCW A;  3ELK A;  3L9F A;  3WTT C;  1FBU A;  2D45 A;  4XSX F;  2V1X A;  3I58 A;  4WX9 A;  4RB3 C;  4PGH A;  3V8L A;  5JFR A;  2JPC A;  2RQP A;  2MA3 A;  2OU2 A;  2XAH A;  1JXS A;  2VOD A;  3WGG A;  2PFB A;  2RN7 A;  4LB5 A;  3FMS A;  2OA4 A;  4MHG A;  4LG0 B;  3R6S A;  1FYM A;  1YIO A;  2L4M A;  1FP1 D;  4EJT A;  3GX4 X;  4YG2 F;  2V1U A;  1A04 A;  4KUM A;  1IN6 A;  1K78 B;  2H6B A;  3GUD A;  1P2F A;  4YFN F;  1HW5 A;  1HW2 A;  1PP8 F;  5FD6 A;  3V8K A;  4A12 A;  1S29 A;  5KVR A;  1PUE E;  2HOE A;  3F21 A;  3J7A O;  5FGM A;  1TQP A;  1DP7 P;  4A2U A;  4MQV A;  2MH2 A;  1EV7 A;  2L02 A;  3I64 A;  3EUH A;  4LGW A;  1IRG A;  1SD7 A;  1LJ9 A;  4ESF A;  2HR3 A;  4I0A A;  3LAJ A;  1HKS A;  3E3V A;  1WWX A;  3B73 A;  1YLF A;  4A0Z A;  2M45 A;  3ERE D;  1FZP B;  5HLI A;  2Y75 A;  4DQ2 A;  2A3S A;  2O03 A;  3PQK A;  2CWE A;  4B8X A;  4KA4 A;  2ISY A;  3MFK A;  1XDS A;  3JSP A;  3RPQ A;  1FBQ A;  1U5T A;  3F72 A;  4KIB A;  4OIN F;  1FSE A;  4CHU A;  2IVM A;  3RIR A;  1JHF A;  5J8C A;  3R4K A;  5ILU A;  3RYP A;  1BI0 A;  3WU0 A;  2NRA C;  2UZK A;  3HOT A;  4HOB A;  5CVJ A;  1P4X A;  2PMU A;  3WTW C;  3NQO A;  5LGN A;  2EWN A;  1Z6T A;  3BJ6 A;  1YYV A;  3ABT A;  4EM1 A;  1BI1 A;  3T8R A;  1O7F A;  4MTE A;  4MGR A;  1T2K A;  4G7H F;  3ABU A;  3FX3 A;  3E5X A;  5DCF A;  2DTR A;  1IN7 A;  4RB1 A;  5HS8 A;  1XDU A;  3HIF A;  3E6D A;  1QNT A;  2QQB A;  2PLY A;  4YFK F;  3K1M A;  4MQ9 F;  4L5I A;  3NRV A;  3GO5 A;  5DCM B;  4EM0 B;  3KCC A;  4L0Y B;  3F8B A;  3FZV A;  2FE3 A;  3ECO A;  3V7C A;  5BPD A;  5D8K B;  4XRF A;  1BI2 A;  2J5P A;  2Q2E A;  1SFU A;  2JT1 A;  1E17 A;  4ZYD A;  3TOA A;  1TTY A;  1Z7U A;  3VB2 A;  4ESB A;  4G9Y A;  4UV8 A;  4EJO A;  3LFK A;  2JTV A;  2L01 A;  2IT0 A;  2PJP A;  4HF0 A;  5ICC A;  1DPR A;  4L18 B;  1WQ2 A;  1O3S A;  5LLQ A;  2VBW A;  3COA C;  3KP6 A;  1CGP A;  2R7F A;  2Z99 A;  3E97 A;  2TDX A;  3GXO A;  1P6R A;  4N9H A;  2VBY A;  3D5L A;  1I1S A;  3V7S A;  3HRM A;  1Z9C A;  2P4W A;  1REP C;  1B9M A;  1FT9 A;  1TLH B;  3M8F A;  4LJZ F;  4P5O A;  3KP3 A;  4ENM A;  3WG9 A;  5LHG A;  5D4R A;  4KT5 C;  5D4S A;  3KZY A;  5LRS A;  1R7J A;  1W5T A;  3HUG A;  1L3L A;  1KQ0 A;  3C18 A;  5ILV A;  4G7Z F;  3KLO A;  3SFZ A;  2MBF A;  4WK8 F;  5HLG A;  2R3S A;  1U8R A;  1T0F A;  4KIG A;  2C6Y A;  2V1D A;  3ZN0 A;  1Z6R A;  2O0Y A;  3PQJ A;  5ICE A;  2A6H F;  5A2Q K;  4KYW A;  2OQG A;  2HDC A;  1QPM A;  2K4J A;  3FWE A;  1CF7 B;  2DPD A;  4ON0 A;  4NQW A;  3IWZ A;  1S7A A;  3K2Z A;  1YW9 A;  3P9K A;  2V6C A;  2H6C A;  1IXR C;  1YG2 A;  3BZ6 A;  4G6D A;  4LLN A;  3WTU C;  2GQQ A;  1GVJ A;  5J6X A;  3M1E A;  1I27 A;  2LF8 A;  5D6E A;  5ERI A;  1KYW A;  2YX4 A;  1ZG1 A;  2E7W A;  2XRN A;  5DEQ A;  1OYY A;  2ZFW A;  4JBA A;  3JSO A;  2XRO A;  4LLL A;  2VOO A;  1F5T A;  4FX4 A;  1W7P B;  3HYI A;  5LHH A;  1EH6 A;  2PMH A;  1FBS A;  2O8X A;  1HST A;  3KEQ A;  3HSE A;  3F23 A;  2QEN A;  2ESN A;  4OU0 A;  3B02 A;  2LDU A;  3SHF A;  1SFE A;  3ZMU A;  2RC4 A;  5L3F A;  3ZMV A;  5TRD A;  4LG0 A;  4L9T A;  5FB2 A;  4KFC A;  2VBX A;  1HKT A;  1HSJ A;  1TQM A;  4KN7 X;  4L0Z B;  2ELH A;  3R60 A;  3IC7 A;  3J81 K;  2EFW A;  4U0V A;  3QAH A;  1KQ9 A;  3WGI A;  4N0B A;  1XGS A;  2GAU A;  3H3U A;  4L9J A;  3KFW X;  1J9I A;  2JSC A;  2E7X A;  3WTS C;  1RNL A;  2DO7 A;  3SZT A;  2P8T A;  1UST A;  1YS6 A;  5A2Q Z;  5E1W A;  5L3B A;  1ZAR A;  1ZHF A;  2ACJ A;  3DPT A;  4LLG F;  4G6Q A;  3CJN A;  1KGS A;  1J2X A;  2L54 A;  2Y48 A;  3QPH A;  3RJP A;  2CSO A;  3TO7 A;  3JAM K;  5CVI A;  2DQR A;  2MH9 A;  3EDP A;  3H3Z A;  2VXZ A;  2A6E F;  4U7B A;  1EH8 A;  2FXA A;  4IRH A;  4HA8 A;  3BWG A;  4ENK A;  2FF4 A;  4U88 A;  1J75 A;  2K86 A;  2G7H A;  1Y0U A;  2YSR A;  1FP2 A;  4I02 A;  2JPB A;  4HBL A;  3VEP A;  3DP7 A;  1V4R A;  2KIM A;  4AWX B;  5DD4 A;  1LDK B;  4BNC A;  3KP4 A;  2FOK A;  3T5X A;  1G4D A;  2E1N A;  2GXB A;  3RKW A;  2GA2 A;  2KRF A;  4PCQ A;  1IRF A;  5IT9 K;  2Z3Y A;  2AXL A;  3MAJ A;  4R1H A;  3K1P A;  1IAW A;  4A6E A;  2DK8 A;  2CGP A;  3GZ6 A;  1P92 A;  3ZMZ A;  1H9T A;  3DFG A;  3HTS B;  1R1T A;  3GW2 A;  3CUQ B;  4ZYH A;  1B9N A;  4RGU A;  1U5T C;  1P4A A;  4HQM A;  3I59 A;  4CXF A;  2DBB A;  5DCM A;  2F2E A;  3ZPL A;  1R23 A;  5IT3 A;  2PQ8 A;  2RV8 A;  1J5Y A;  2OZU A;  3K0L A;  5L3G A;  4IHT A;  4S04 A;  1X3U A;  4EJV A;  2ADU A;  4HDV A;  2QBY B;  4GO1 A;  3GFM A;  4BHP A;  3J80 K;  1SAX A;  4AVP A;  1U2W A;  2NYX A;  4IXA A;  3O6B B;  1G3Y A;  3BPV A;  4E70 A;  3N4M A;  2Z5U A;  5H6R A;  2A61 A;  4HW0 A;  1XN7 A;  3ULQ B;  2PG4 A;  3MEX A;  1T39 A;  1ULY A;  1W5S A;  1G6N A;  4IJA A;  1ZG3 A;  4UUV A;  2PN6 A;  2IJL A;  5D5U B;  2W24 A;  5FO5 A;  4F7Z A;  1B4A A;  2OQR A;  3LA7 A;  5HOO A;  2XKP A;  1K79 A;  1V3F A;  4U0W A;  1XSD A;  1IN4 A;  3C7J A;  2BV6 A;  4A0Y A;  2HQN A;  1MJ9 A;  4AIJ A;  1O57 A;  1KU9 A;  4RGS A;  3TKY A;  2E1C A;  1BN5 A;  3VFZ A;  4QWQ A;  2XVC A;  5HVQ C;  2P7C B;  3QOP A;  3DV8 A;  3KEO A;  3LAP A;  2ISZ A;  2WTE A;  2K4B A;  4I2O A;  1MZB A;  1BM9 A;  1MDM A;  1JHH A;  2QYO A;  2RNJ A;  2BEO A;  5HDG A;  4HAM A;  2STW A;  3FMQ A;  1LEB A;  3TGN A;  2F5C A;  2W84 A;  3IRQ A;  4P9F A;  4GYG A;  2A68 F;  4KIF A;  5HS7 A;  3HHG A;  1YTY A;  1OPC A;  2A5Y B;  2ZME B;  1G3T A;  3T0Y A;  2FRH A;  1ZN2 A;  2YPR A;  3G3Z A;  1LDD A;  2DK5 A;  3FXQ A;  3IWF A;  2IA1 A;  3CO7 C;  1XGM A;  1K6O A;  4OMZ A;  2P5V A;  4M74 A;  1ZGJ A;  2PEX A;  4HV5 A;  3I71 A;  1J7K A;  3BJO A;  3J80 Z;  3FMR A;  3FM5 A;  3U1D A;  2W57 A;  2K27 A;  1MGT A;  3CUO A;  4A6D A;  4MTD A;  1KQ8 A;  2H27 A;  4HLX A;  1C0W A;  3HRU A;  1BI3 A;  1ZRD A;  3R0A A;  5CVU A;  1E2X A;  2IRF G;  2XGX A;  2VC1 A;  3RI4 A;  1NHA A;  2VE8 A;  3MZY A;  4TV7 A;  4U0Y A;  4GGG A;  5H6Q A;  4Q48 A;  5LGU A;  3CTA A;  4AD9 A;  3RTR A;  5AIQ A;  4LFU A;  4RB0 A;  4WXD A;  4OIQ F;  3T8T A;  4RGX A;  3CLO A;  3TDZ C;  3QPT A;  2L4A A;  1WKM A;  1XCB A;  4DNC A;  3GFJ A;  3O3K A;  3LQQ A;  4Q5S F;  2A69 F;  5CLS A;  4HX7 A;  3E6C C;  1WI9 A;  3V8J A;  1I1G A;  1LB2 A;  2FBH A;  5JR3 A;  2DAO A;  1G3S A;  4CO8 A;  1LVA A;  3E5U A;  3QRF F;  5ICF A;  2NNY A;  1QO0 D;  3V7R A;  2M5W A;  2O61 A;  4EJW A;  2HEO A;  3KE2 A;  1F4K A;  4IVN A;  2Z33 A;  1XGO A;  4MEX F;  4HV6 A;  3I4P A;  1TNS A;  2BE5 F;  1XGN A;  2KIF A;  5FFX A;  3T1B A;  1XSV A;  3JTH A;  5CJ9 A;  1XMA A;  2DPU A;  2B0L A;  1HXD A;  2EV0 A;  4I98 B;  5TJJ A;  4YIF A;  3F8F A;  1O3Q A;  1UB9 A;  4LMY A;  4ZH4 F;  3BP8 A;  1S3J A;  3VOD A;  1XD7 A;  4I7H A;  5E20 A;  5J8F A;  2F5F A;  5BMZ A;  4NHJ A;  2QM3 A;  1YQA A;  2ZKZ A;  1T38 A;  1KU2 A;  3D0S A;  4UV9 A;  3WU1 B;  1U78 A;  2G9W A;  2DFI A;  3HRT A;  4BH9 A;  3Q9V A;  4Q4Z F;  2XAJ A;  1ZLJ A;  3DXJ F;  1IZ1 A;  3H92 A;  2QZ8 A;  4ASN A;  1D8J A;  3KP2 A;  5F64 A;  1R36 A;  1HQC A;  1KYZ A;  2COM A;  2OD5 A;  4EVI A;  2FQ3 A;  3F3X A;  1MJB A;  2XAS A;  4EGZ A;  5AIP A;  4HYE A;  1MJA A;  2R7D A;  3GVA A;  2EV6 A; 
#chains in the Genus database with same CATH topology
 2CFX A;  1T56 A;  2RVC A;  3DCF A;  4AU7 A;  3BLY A;  1IUF A;  1XMX A;  1AKH B;  3CJT B;  5B1A H;  1XX5 A;  2MFZ A;  2E1M C;  1BC7 C;  3ISP A;  3OS2 A;  4A3C J;  3CUQ A;  2DT7 B;  1E0E A;  4CCM A;  3DLL F;  4I0B A;  1VQ6 I;  3FK6 A;  4UXN A;  1AA7 A;  2ELJ A;  3GYH X;  1GV5 A;  2EFO A;  4UVB A;  1LFB A;  2MC4 A;  3FXL A;  2A07 F;  2CQN A;  1IC8 A;  1IRX A;  2PJR A;  4AID A;  4HZF A;  2HGC A;  4DZP A;  2W7N A;  2JZY A;  2BY2 A;  2EZH A;  1GV2 A;  4A3F J;  1QBJ A;  3JW4 A;  1R1U A;  4XON A;  1W0U A;  4A3G J;  3BR0 A;  4CH7 A;  3SDG A;  1ON2 A;  3GLX A;  1ODD A;  3S3O A;  2FU4 A;  4UUS B;  1Z91 A;  1HBX G;  4YIR X;  4QSH A;  1FYL A;  2QBY A;  2V26 A;  4JYK A;  3LSI A;  1MMD A;  2GA1 A;  2DCE A;  3LA2 A;  5FKL A;  2CW7 A;  3N97 A;  4KMU X;  2J5O A;  4PZJ A;  3ZQ7 A;  3G6E I;  1IO2 A;  4G94 A;  3DBH B;  2VJI A;  1FIP A;  2QQ9 A;  4A93 J;  3BG7 A;  3QP5 A;  1QZZ A;  2Z9O A;  2K40 A;  3FM3 A;  2CV1 A;  2XV4 S;  1FYK A;  2LK2 A;  2OC6 A;  4P55 A;  3K4M A;  4RS8 A;  1HDD C;  3BTC A;  2WAQ A;  2R92 J;  3DEU A;  3RCO A;  3ASO H;  2PX9 A;  2K02 A;  4M73 A;  5HDK A;  4WF2 A;  4UNO A;  4YRV A;  1V5E A;  2EA2 A;  1IW7 F;  2BBY A;  2IP2 A;  1K78 A;  2HYG D;  3N05 A;  2Y9Y A;  3OL4 A;  4BQN A;  2ZXI A;  3EET A;  2CV0 A;  4BQQ A;  3W6K B;  1JKO C;  5B3S H;  3DU5 A;  3JRF A;  1D1A A;  2H1K A;  2VT2 A;  1F1Z A;  3TO9 A;  2JUG A;  2GXG A;  3BY6 A;  3ESW B;  1ONV A;  3OYE A;  2VE9 A;  4BHB A;  2FBI A;  3HOV J;  1ZYR F;  2JN6 A;  4EMS A;  1DGW Y;  2GWR A;  1QZE A;  1ZR4 A;  4BAY A;  3DPL C;  3MZH A;  3LSH A;  4OAZ A;  1Q1H A;  2QSH X;  3OV8 A;  1U3E M;  4DOZ A;  3CCL I;  2XF5 A;  4OMY A;  1GVD A;  4FET A;  2WAD A;  4RM3 A;  2K5C A;  1BIA A;  4JX6 A;  4S0H B;  5E3L A;  3CF2 A;  3HOZ J;  5J3L A;  4WWC A;  3EYI A;  4A5M A;  3S3M A;  1TWA J;  3BZK A;  3DEW A;  1I5Z A;  2WV0 A;  2CQQ A;  4YII A;  4A5N A;  2DMP A;  2KZV A;  2K9S A;  5DUI A;  3ZMT A;  1X19 A;  2D1V A;  2GZW A;  4JQF A;  3UNG C;  4GYI A;  5CVV A;  2HZT A;  2ETH A;  4E7S A;  3CC7 I;  6PAX A;  1ZRE A;  1D0Y A;  3HUG B;  4XBF A;  2XAF A;  3SFI A;  3AG3 H;  2RKH A;  1P9Q C;  1GXQ A;  1SFX A;  4FIS A;  5M5Y J;  2EJR A;  1I3Q J;  1UFM A;  5FKK A;  2X6X A;  1BIB A;  1B59 A;  4P9U A;  5M3M J;  1RR7 A;  1B6A A;  1N25 A;  5JHF A;  3A4C A;  3HOU J;  4BAC A;  2IS2 A;  2LRE A;  1JGG A;  1B8I B;  1Y8R B;  2X0L A;  4IRI A;  1Y6I A;  4G8X A;  1W0T A;  2OZ6 A;  3PIP F;  4UHT A;  5IP9 J;  1OCC H;  4A3L J;  1BR4 A;  4I01 A;  2E71 A;  1V5G A;  1GXP A;  3PNT A;  3DQV C;  4ZYG A;  3MCZ A;  4D7M A;  1EH7 A;  2FJ1 A;  2MLG A;  1ZLK A;  1FLI A;  2L9S A;  2LSO A;  4WCG A;  2KFD A;  1LNW A;  2EFP A;  3W6J B;  4CDG A;  5B5E C;  1XCV A;  4KMF A;  2QSF X;  1MBG A;  3S17 J;  4Z6Y A;  5HS9 A;  3RPU A;  1AHD P;  3I4N J;  1MNM C;  4CCO A;  3WTV C;  1XG1 A;  3DKX A;  1UCR A;  4HRI A;  1W36 C;  4E6K G;  3CMY A;  3P9I A;  1Z05 A;  4PDK A;  3UKG A;  2DQL A;  1TQI A;  2FUG 2;  3M7G A;  4IOA F;  4PSW A;  2KL4 A;  3K4N A;  4RAZ A;  3E1S A;  4KN4 X;  5JHU A;  2P6T A;  4EQQ A;  4MO7 A;  1X3Z B;  2Y0S N;  2W25 A;  5D5V B;  3OYM A;  3E6B A;  3EUA A;  4BE2 A;  4LD5 A;  1AOY A;  2E5Z A;  2KIU A;  5JI6 A;  1OCP A;  5E18 F;  3K70 C;  4AIK A;  5EDN A;  4IPA A;  1IJW C;  4BQO A;  4XIC A;  2HOS A;  3ZMS A;  2Q0O A;  2HKO A;  2JQ7 A;  3K7A J;  2RGV A;  2ZXJ A;  3FK7 A;  4ZZD A;  3TQN A;  3LST A;  3Q0V A;  1PDN C;  3L7W A;  4HLY A;  3IKT A;  4BHC A;  2K3P A;  3P9C A;  2HQR A;  3SDB A;  2OTL I;  4XSZ F;  4UVC A;  2L9R A;  1ZR2 A;  3BRO A;  2XPU A;  1W5C C;  5GAH J;  1TT0 A;  2AXT C;  2F5E A;  3EYY A;  2FNA A;  3OYD A;  4PJL A;  1YO5 C;  3QU6 A;  4NB5 A;  3HTU A;  4EAT A;  4M9S A;  1XB4 A;  1JT6 A;  4IEJ A;  2HVR A;  3FXU A;  2EQR A;  2WC2 A;  3J81 Z;  3ZQL A;  3L09 A;  1TNT A;  3PNV A;  3DTK A;  1BC8 C;  4I99 C;  2EV5 A;  4GRI A;  4YFX F;  2CO5 A;  5BPI A;  2PBI A;  4XRS A;  3QYF A;  4OIO F;  4ZYA A;  3U21 A;  3S2W A;  2QKM B;  4L9N A;  3WE2 A;  2VKD A;  3BCA A;  3K69 A;  1POG A;  2DYR H;  1Z1D A;  3NWS A;  3IKV A;  4MEY F;  3ZOB A;  4ESJ A;  4J00 A;  3FXM A;  5BOX A;  5EF6 A;  1YW7 A;  4HX4 A;  4KIT B;  2E2I J;  2L9V A;  1WCM J;  1B72 A;  2DT5 A;  1ZRF A;  1TBX A;  3M4O J;  2D2W A;  2GM4 A;  2FML A;  3W2W A;  4ZC3 A;  4P96 A;  3EQL F;  1IXS B;  5E1X A;  5K7Z A;  1A5J A;  2P7V B;  5EEH A;  4RDU A;  2BZT A;  1UAA A;  1QGP A;  3AFH A;  3H0D A;  1YIJ I;  5E1Z B;  2XB5 A;  3DKY A;  2O6G E;  3PNY A;  5K5O A;  2H8R A;  2STT A;  2XC7 A;  3LSP A;  3JAM Z;  1H9G A;  3CP8 A;  4O3M A;  5ED4 A;  1RI7 A;  3IHU A;  1J59 A;  2VC0 A;  2QVO A;  3CCY A;  1YFH A;  2VT3 A;  4II2 A;  1R49 A;  3OYI A;  5FLX K;  1R5I D;  3P7N A;  3RKQ A;  4L9V A;  5ILS A;  2HS5 A;  2EIM H;  3MQ0 A;  1JGS A;  4A3I J;  4CYD A;  2JJ7 A;  4IOC F;  2KJB A;  3AAF A;  1MW7 A;  2WY8 Q;  5DDG A;  2R5Y A;  1MSE C;  3JRC A;  1QQI A;  4R79 A;  1R5H A;  2OCC H;  3BG6 A;  2JWT A;  1FOX A;  3H5R A;  4XLH A;  2QLZ A;  3JTG A;  1IV6 A;  1WJF A;  1BJA A;  1O3R A;  3FBI B;  4XLN F;  5DM7 F;  4B48 A;  5LEK A;  1IN5 A;  3V4G A;  1QU3 A;  5DV5 A;  2ZO4 A;  3GEZ A;  4FX0 A;  3ML6 A;  2KJC A;  2L7K A;  2M8E A;  3QU3 A;  4NUB A;  1JE8 A;  4E7J A;  3OYB A;  1D5V A;  3AL0 C;  1JKR C;  3WGH A;  1VTN C;  5D5W B;  5C44 J;  5IT9 Z;  1ZRC A;  4QLC U;  4CYC A;  2EZK A;  3HOW J;  1ERD A;  2MC3 A;  5CVR A;  3CD6 I;  2FA5 A;  3CMA I;  2LD5 A;  2IA2 A;  2ELK A;  1MKM A;  3CDH A;  2CYY A;  2K9M A;  5ICG A;  1XC5 A;  1NK3 P;  3FF5 A;  2ZJR F;  1T6S A;  1HOM A;  1SD4 A;  1YX3 A;  4NC6 A;  1Z3X A;  3OOP A;  4M3F A;  2DW4 A;  1CF7 A;  3WTX C;  4F3Q A;  5HLH A;  3PUF A;  1IXC A;  1VQ7 I;  1Z21 A;  4XID A;  2PI0 A;  1MNE A;  5TIS C;  5LBQ A;  3BOQ A;  2W4S A;  4CSW A;  4KDP A;  4HF2 A;  2VJJ A;  1WSU A;  2L3D A;  2NOG A;  1YJW I;  2F4O B;  1NH3 A;  2JVH A;  2R7T A;  3B6C A;  3K70 D;  1OYI A;  2HTJ A;  2WV1 A;  1IF1 A;  2M1B A;  2M30 A;  1K7A A;  1FC3 A;  2DT6 A;  4A69 C;  1D1C A;  3BDD A;  3LWF A;  5KK1 A;  5GTH C;  4FHT A;  2UV1 A;  4V2F A;  3ERM A;  4YEL A;  1T08 B;  1FMW A;  3EUK L;  2VQL A;  1SC7 A;  4M6X A;  2NAZ A;  4HQE A;  1H0M A;  2G7U A;  2CG4 A;  4ENJ A;  5FRO A;  1RRJ A;  2EIK H;  5L3D A;  2LG4 A;  4ENN A;  2OV7 A;  5L3C A;  1AKH A;  2XAQ A;  3TO6 A;  3PFY A;  5IOZ A;  4RLQ A;  4CIC A;  1IV8 A;  5DUK A;  2ESH A;  3D5S C;  2R0Q C;  3F9K A;  2XB0 X;  2M7A A;  3RDI A;  1SD6 A;  1W7P A;  3F8M A;  4GCV A;  1P4W A;  4BXU A;  1SMT A;  4I09 A;  2GOX B;  3GWZ A;  4FQG A;  1WJ5 A;  3I59 B;  1VZ0 A;  4HDU A;  1FOK A;  1VQK I;  1R1V A;  2ZNZ A;  2YS9 A;  1BW6 A;  1R22 A;  4YEJ A;  4DBR A;  3RYR A;  4ZZL A;  1IDY A;  4Q47 A;  2HWV A;  3CP2 A;  4M9X A;  2VN2 A;  4HX8 A;  2FBK A;  1S8N A;  5K5Q A;  1B1B A;  3BTJ A;  1ETX A;  2BYV E;  4XMY A;  2DJI A;  1FIA A;  2EK5 A;  3LSR A;  2Z1D A;  2K3F A;  2VQH A;  1T98 A;  2RDP A;  3Q0W A;  1LQ1 A;  3FXR A;  4M6Y A;  4ZDP A;  3PIO F;  3RKY A;  1IN8 A;  5KNL A;  3QP6 A;  4HSR A;  3G71 I;  5FLX Z;  5CQG A;  4RAG A;  5JVT A;  3W3C A;  3I53 A;  1VND A;  3R61 A;  2EZI A;  1RUN A;  2H09 A;  1S7O A;  1R5G A;  3I54 A;  4MNU A;  2IGM A;  3BR3 A;  4ANJ A;  3OS1 A;  4DYR A;  1W7P D;  3KZZ A;  2R7O A;  1X2N A;  1EF4 A;  2ZFU A;  2CQ7 A;  3FXJ A;  1KU3 A;  1X1B A;  4C3I J;  3CF5 F;  3NAR A;  3I9V 2;  2FSW A;  1HW1 A;  2M3A A;  3H0G J;  1WJB A;  3F8C A;  3ZP5 A;  1RES A;  2I8D A;  5K1Y A;  2BHZ A;  2OPT A;  2NS0 A;  3CUQ C;  3IRR A;  2XHK A;  5GAG J;  5JLX A;  1WRJ A;  2KKO A;  4EGY A;  3VWB A;  5FLV A;  2M4K A;  1R58 A;  1W4M A;  4RGR A;  4BYY A;  2NVQ J;  2F4I A;  3F6O A;  3HKZ N;  1U6G A;  3SZG A;  2WWY A;  4N9I A;  2DA6 A;  4JK1 X;  2KDO A;  3PFI A;  1FNN A;  5M5X J;  3BT9 A;  4Y15 A;  2VL8 A;  3WHC A;  3TMO A;  1RUO A;  4IHS A;  4Y17 A;  5CYV A;  5J40 A;  1JJ6 C;  2OBP A;  2OCE A;  4ABZ A;  4CZZ A;  1USS A;  3BPX A;  3NEU A;  5BS6 A;  3FHZ A;  1NG7 A;  1WJA A;  2EIJ H;  3K4C A;  5FD5 A;  2ZNY A;  5F1J A;  2L0K A;  5AON A;  4GXO A;  5LRR A;  5EGO A;  2FQ4 A;  4A3M J;  4CCK A;  2HQA A;  4UVA A;  3A1Y A;  3HOS A;  2XUB A;  3U9G A;  1WFX A;  2Y30 A;  4OOI A;  3W6V A;  5F08 A;  2HDD A;  4EM2 A;  3VOE A;  4IHY A;  2BW3 B;  4LB6 B;  5LEJ A;  2EA4 A;  1SEU A;  4N4N B;  4LK1 F;  1ZGA A;  2IA0 A;  5B1B H;  2VKH A;  2CH0 A;  2M2E A;  2HKX A;  2LRD A;  2L2O A;  3E6M A;  1HLV A;  4N4O B;  1O3T A;  4D5C A;  1JJ8 C;  4QIW N;  5E3O A;  4G7O F;  1XMK A;  2X4H A;  4CGZ A;  1PP7 U;  1U5T B;  2GIZ A;  1JKQ C;  4KNY A;  1J0R A;  4O5V A;  5E8I A;  3BR6 A;  3WOD F;  3RZO J;  1MDM B;  2QWW A;  2FEZ A;  5HDN A;  3S2H J;  5C4J J;  3ZQG A;  3VYT B;  3CC4 I;  1YJ9 I;  2XAG A;  1SMY F;  3C2B A;  2LP0 A;  2ZJ2 A;  3KET A;  2K9Q A;  3GLL A;  2ME6 A;  3DF8 A;  4U7D A;  4OIP F;  1OCT C;  3MKZ A;  3QYE A;  2HU9 A;  5DD8 A;  2DA7 A;  4MFD A;  2VOP A;  3FDY A;  4ITV A;  1D3Y A;  1F9N A;  2XGC A;  2COB A;  1BOA A;  2V9V A;  4BEH A;  1TW3 A;  2JRM A;  4CZC A;  3A01 A;  5BQT A;  4BE1 A;  2F5D A;  2MLK A;  1JUM A;  5F6F A;  1Y39 A;  3HHH A;  1FMV A;  4RAY A;  1I39 A;  1SAU A;  3BC8 A;  4Y3O A;  3ZMD A;  1SFO J;  3RKX A;  3OR1 C;  2F48 A;  2K9L A;  2YR2 A;  1FWZ A;  3DWL E;  3S32 A;  1N78 A;  2DTZ A;  3HSR A;  5LHI A;  3H9Q A;  3G73 A;  1G2H A;  3CCE I;  3Q9S A;  5IP7 J;  1ZEL A;  1DQU A;  4PUS A;  2DFH A;  1QZY A;  1QPI A;  5FKO A;  1RZ4 A;  2E1O A;  4M9Z A;  2DU9 A;  1ON1 A;  2EFN A;  1OCO H;  3ZGK A;  4IZZ A;  3C3W A;  1GHC A;  4H0E A;  5J1U A;  1JT0 A;  3QPL A;  3G1O A;  5LGT A;  3I5U A;  1WGX A;  3L2C A;  1A6Q A;  4AM3 A;  4M72 A;  2Z16 A;  3SEZ A;  3PJR A;  3OMY A;  3Q5F A;  2TRT A;  1IG7 A;  5FJ8 J;  2YX7 A;  2NNN A;  4JP0 A;  5D5X B;  2RAE A;  1G3W A;  3E5Q A;  2JK3 A;  2R7Z J;  4KIC A;  2O9L A;  2VJ5 A;  3CO6 C;  2GIV A;  4M6V A;  2LKP A;  3SXY A;  4Y13 A;  2BVL A;  2DLL A;  2ECC A;  2L7F P;  3HB9 A;  1OFC X;  2UXN A;  2ZBK A;  4U87 A;  2DA5 A;  3OSG A;  4F52 A;  1OKR A;  2YU3 A;  3GZ5 A;  3HRS A;  2EH3 A;  3HL2 A;  4MIM A;  2HYF A;  3A2K A;  4S05 A;  3LQR A;  3WTZ A;  3OIP A;  3TDU C;  3BJA A;  3H9J A;  2CFO A;  4XKC A;  2FMY A;  3OYH A;  2Q2E B;  3HGY A;  3H35 A;  2CMP A;  1MMG A;  4PK4 A;  4QTR A;  1ITY A;  1SAN A;  3TP0 A;  4HF1 A;  1KON A;  4PJM A;  2DFE A;  1VQ8 I;  2NVY J;  2P5L C;  4O6J A;  4AIH A;  3HSF A;  4LIV A;  1WJC A;  4PGG A;  1PUF B;  3BR2 A;  4LIT A;  4AYB A;  1FPQ A;  2CUF A;  3JRI A;  3FHN A;  1HKQ A;  4RB2 C;  3GFL A;  3ZR8 X;  4IF4 A;  2WAE A;  3AL0 B;  2MD5 A;  1DDN A;  1OMI A;  5D8L B;  3TL4 X;  2CV2 A;  2AS5 F;  5FFZ A;  5E8G A;  5HNH A;  5C3E J;  1FX7 A;  2DOF A;  3DU6 A;  2VIX A;  4UB8 C;  1LDJ A;  3SQN A;  1DP3 A;  4A0X A;  2DMT A;  4PFO A;  1U8B A;  2X6W A;  5EEG A;  1TW2 A;  4R8H A;  3U2R A;  1OR7 C;  1D8K A;  3BR1 A;  3I55 I;  1VI0 A;  3HKZ A;  3K1N A;  3BZC A;  3GZN B;  1O7L A;  1P7I A;  2W48 A;  2QA4 I;  2QCO A;  4BQA A;  2IW5 A;  2TCT A;  3SZP A;  5DYM A;  2VBZ A;  3LFU A;  2N8G A;  4GFB A;  2R7V A;  1OYW A;  2M87 A;  4XNF A;  2HTS A;  2O7O A;  3KP7 A;  3WE3 A;  2B7E A;  3ZN1 A;  1MD0 A;  2LY2 A;  2CQK A;  4D0P A;  2D1H A;  3I0T A;  2OJE D;  3JRA A;  4K2E A;  1OLT A;  3ZXS A;  2XKO A;  2ECB A;  1VQO I;  1RIO H;  1S5L C;  3S1R J;  3F8N A;  1XSX A;  2Q8K A;  1FSH A;  4IRG A;  3ECH A;  4IL6 C;  1R00 A;  4BL0 B;  3REO A;  3V42 A;  1X1A A;  4L5J A;  1I6X A;  2HFH A;  2JA5 J;  2QEX I;  2BY3 A;  1E3P A;  1S6L A;  2CW0 F;  2LBF A;  3K4B A;  3TOB A;  3G4S I;  1X4O A;  2W85 A;  3LA3 A;  3OYG A;  3C1D A;  1X2M A;  2VB6 A;  3F22 A;  4M71 A;  2UXX A;  4C30 A;  3AG1 H;  1H88 C;  5K7F A;  1WI3 A;  2EFQ A;  2PMZ A;  4E4H A;  2VKV A;  2IBD A;  3FIW A;  3KZI C;  1LEA A;  1FOY A;  2KPM A;  2OAZ A;  5F0F A;  4RLF A;  2P6S A;  1ZG5 A;  1KU7 A;  3ROU A;  4XOT A;  5TGT A;  3BCB A;  2EIL H;  3IL2 A;  2LF7 A;  2QQA A;  3GFI A;  3GF2 A;  1ZAO A;  5EYR A;  4NDL A;  3DKW A;  1STZ A;  2FD5 A;  1WH5 A;  1DUX C;  3CME I;  3GME A;  4I6Z A;  5IP6 A;  4BUP A;  4LK0 F;  1SD5 A;  2BGC A;  3IUO A;  4Z2Y A;  2ZME A;  3K9T A;  3HBL A;  4XLP F;  2XIG A;  3CC2 I;  5E17 F;  2QSG X;  2BY1 A;  5GP9 A;  1YW8 A;  4BDZ A;  2XRL A;  5H20 A;  1L0O C;  2K7L A;  3C2G A;  3S2D J;  1UHM A;  4NQW B;  3BTL A;  1X1P A;  2V79 A;  2DFF A;  4MLO A;  4OIR F;  3MWM A;  3NAU A;  2P5K A;  4WXH A;  2UWM A;  3L2R A;  2QUF A;  3M9A A;  1FY7 A;  4B09 A;  1BBY A;  1KA8 A;  2O3F A;  4BS9 A;  1IUY A;  1S7E A;  2IPQ X;  4WXC A;  5EZG A;  2KRC A;  4FT8 A;  3A02 A;  3JCU C;  3S3N A;  1WPK A;  3BG9 A;  2H94 A;  2EB7 A;  3S16 J;  1GUU A;  4EV0 A;  3R0J A;  2GBY A;  3L2V A;  3L00 A;  5D6F A;  4CUG A;  1A6I A;  3O2P E;  2FNP A;  1OR7 A;  5GTI C;  1DPU A;  3G1M A;  1R4M B;  2DI3 A;  2Y0M A;  4ZYE A;  2LNB A;  3KLN A;  3M8E A;  2XDV A;  4B1R A;  1LFP A;  4B47 A;  1YS7 A;  2M34 A;  4ETS A;  1ETW A;  3F6V A;  2R7S A;  1UHW A;  4RAF A;  2VON A;  3TP3 A;  2JRT A;  2F5V A;  4BJT A;  5F1R A;  3J7Z I;  3WTY C;  2R7U A;  4EJU A;  4NBQ A;  5B66 C;  2MYS A;  4RM2 A;  3O8H A;  1YIT I;  1EA3 A;  5FKN A;  1E3H A;  1ZH5 A;  3RPU D;  1PJR A;  3KP5 A;  5EG0 A;  1AWC A;  2LH9 A;  3MMY B;  2AQE A;  5K5R A;  2PJR B;  5L3E A;  2XSJ C;  2ZCW A;  2X1E A;  3HPH A;  3ELK A;  3L9F A;  3WTT C;  1FBU A;  2D45 A;  2LKX A;  5E3N A;  4XSX F;  2F6C A;  2V1X A;  2KIQ A;  4CCL A;  1HC8 A;  3I58 A;  4WX9 A;  4RB3 C;  2M0M A;  4PGH A;  4AVZ A;  3MD2 A;  1SVO A;  3FKI J;  3V8L A;  5JFR A;  2JPC A;  1QHG A;  4D9J A;  4IKF A;  2H8W A;  2VPR A;  4E7I A;  1SVL A;  3PL8 A;  2RQP A;  4W97 A;  2MA3 A;  2OU2 A;  2P0W A;  2XAH A;  1JXS A;  1UEL B;  2VOD A;  5HOD A;  3WGG A;  2PFB A;  2V9K A;  2RN7 A;  4LB5 A;  3FMS A;  2OA4 A;  4MHG A;  1U0J A;  3QWL A;  1T33 A;  1UZC A;  4LG0 B;  1MBK A;  2VXD A;  3R6S A;  1FYM A;  2DDA A;  3K6G A;  4DGW B;  2HOA A;  3S14 J;  1YIO A;  4PJ0 C;  2L4M A;  1FP1 D;  4EJT A;  3DLA A;  3GX4 X;  4YG2 F;  2V1U A;  1A04 A;  1EKE A;  1IN6 A;  4KUM A;  3H3V K;  1R4N B;  1K78 B;  2H1L A;  1XTA A;  2H6B A;  1Y0N A;  2VUM J;  1SFK A;  4A3J J;  3GUD A;  3ABM H;  5IOY A;  1HA8 A;  1P2F A;  4F93 B;  3M07 A;  1HW5 A;  4YFN F;  2LLK A;  1K83 J;  4XM3 A;  1PP8 F;  1HW2 A;  1CQT A;  5FD6 A;  3V8K A;  4A12 A;  1S29 A;  2ID6 A;  5KVR A;  5E79 C;  2RNG A;  2HOE A;  3F21 A;  1PUE E;  4IHV A;  5FGM A;  3J7A O;  1TQP A;  1DP7 P;  5FKM A;  4A2U A;  4MQV A;  2MH2 A;  4B3A A;  3RZD J;  1EV7 A;  2L02 A;  4L5E A;  3I64 A;  3EUH A;  4X1E A;  4LGW A;  1IRG A;  1GT0 C;  1RPW A;  1LJ9 A;  1SD7 A;  4ESF A;  2HR3 A;  4I0A A;  3LAJ A;  2R5Z B;  1HKS A;  2Y9Z A;  3E3V A;  3W2A A;  1MBF A;  1WWX A;  3OL3 A;  3B73 A;  3BQY A;  2NS7 A;  1YLF A;  4A0Z A;  2M45 A;  5F04 A;  4CA0 A;  1YRN B;  3ERE D;  4M3E A;  1FZP B;  5HLI A;  2XF7 A;  2Y75 A;  4DQ2 A;  4IQ4 A;  1MBJ A;  2A3S A;  2O03 A;  3DBL B;  1QRY A;  3PQK A;  4F91 B;  2CWE A;  4B8X A;  4KA4 A;  1ACI A;  2E1M B;  2ISY A;  2DMQ A;  3MFK A;  1XDS A;  4M3B A;  3JSP A;  3RPQ A;  3KEY A;  1FBQ A;  3OS0 A;  2B9S A;  1U5T A;  3F72 A;  4KIB A;  1W1W E;  3PSI A;  4OIN F;  1FSE A;  4CHU A;  2HPM A;  4RMN A;  2IVM A;  3RIR A;  4KJZ A;  1JHF A;  1X1D A;  2KZG A;  2EZL A;  3H9G A;  2NVU B;  4MFE A;  2R93 J;  5J8C A;  3R4K A;  5ILU A;  3RYP A;  1BI0 A;  1WJD A;  1D5Y A;  1ORK A;  1K61 A;  1D1B A;  3WU0 A;  2DYS H;  3RQI A;  2NRA C;  2UZK A;  4CCJ A;  2BVM A;  3QPS A;  3K4L A;  3HOT A;  2CRG A;  1JI8 A;  3OOU A;  4RBO A;  1N77 A;  4HOB A;  2WAF A;  5CVJ A;  1P4X A;  4DBQ A;  2VPL A;  2PMU A;  2X48 A;  3IV5 A;  4XKV A;  2M7B A;  3WTW C;  2HPI A;  3NQO A;  2CQX A;  1OJL A;  1MMN A;  3TED A;  5LGN A;  1Y1V J;  2EWN A;  1Z6T A;  5GPC A;  3BJ6 A;  2CU7 A;  1YYV A;  1YX5 A;  3ABT A;  2E60 A;  4EM1 A;  1BI1 A;  3HM5 A;  3IH3 A;  4XOR A;  2GXA A;  3T8R A;  1VQL I;  2E2H J;  5GAE J;  3OIQ A;  4LG3 A;  1O7F A;  1NG6 A;  3ZRG A;  4MTE A;  4I76 A;  1OCZ H;  4MGR A;  5KAF C;  1T2K A;  4G7H F;  3QOD A;  1ETQ A;  4UB6 C;  3ABU A;  3FX3 A;  1APL C;  3E5X A;  5DCF A;  2DTR A;  3ABK H;  1IN7 A;  3OYC A;  4RB1 A;  3ZQH A;  5HS8 A;  3CCU I;  1XDU A;  3HIF A;  3E6D A;  1QNT A;  2QQB A;  1Z3Y A;  2X1C A;  1ETO A;  3FXO A;  4YFK F;  2PLY A;  3K1M A;  5GAD J;  4MQ9 F;  1ETK A;  3NRV A;  2P81 A;  2DN0 A;  3GO5 A;  4L5I A;  3UR3 C;  5DCM B;  2ZSI B;  5DS9 A;  1MMS A;  4EM0 B;  3KCC A;  1J09 A;  1YE9 A;  4L0Y B;  2ZB9 A;  3F8B A;  3FZV A;  1LE8 B;  2RRE A;  1H89 C;  3TW6 A;  2DOA A;  2FE3 A;  4CCN A;  4UUS A;  5IYC J;  2DA2 A;  2O5R A;  3ECO A;  1BA5 A;  3V7C A;  5BPD A;  5D8K B;  4XRF A;  3HDD A;  1BI2 A;  2J5P A;  4P1W A;  2Q2E A;  1SFU A;  5FRN A;  4D7N A;  2JT1 A;  1E17 A;  4ZYD A;  3BQZ A;  3CES A;  3TOA A;  1F36 A;  5JVG F;  4BDY A;  1TTY A;  2KLO A;  1Z7U A;  3VB2 A;  1H8A C;  4ESB A;  4G9Y A;  4UV8 A;  4EJO A;  3LFK A;  3HOY J;  2JTV A;  2L01 A;  3Q3S A;  3OSF A;  2IT0 A;  2VAS A;  4PJN A;  2LFB A;  2PJP A;  4AYB N;  1HCR A;  2OTJ I;  3MKY B;  1R71 A;  4HF0 A;  2BHY A;  5ICC A;  1OIS A;  3ONQ A;  1DPR A;  3J7Y J;  2V4J C;  2Y31 A;  2VQG A;  3VYS B;  4L18 B;  4BU2 A;  3GTL J;  1WQ2 A;  4PFP A;  1O3S A;  5LLQ A;  3L2U A;  2VBW A;  3COA C;  3KP6 A;  3M1C A;  1CGP A;  2LVS A;  1GLN A;  2DA1 A;  2X1D A;  4XN3 A;  2ZJQ F;  3TBI A;  1OCR H;  2R7F A;  2Z99 A;  3E97 A;  2TDX A;  3M3Y J;  4XR6 A;  3GXO A;  3ZQQ A;  2G0E A;  2IS4 A;  2W00 A;  1P6R A;  3FIS A;  4N9H A;  4Y4R A;  5E3M A;  2VBY A;  1Z7L A;  3D5L A;  5GPA A;  3MVP A;  1I1S A;  2I5U A;  3V7S A;  1TT5 B;  3HRM A;  1Z9C A;  3OIO A;  1UG0 A;  2P4W A;  1REP C;  1B9M A;  2CW8 A;  2ICW G;  2NXN B;  4UUT A;  2VQC A;  1FT9 A;  1TLH B;  2M4G A;  2EPF A;  3M8F A;  4LJZ F;  5HLT A;  4P5O A;  1TC3 C;  2JVG A;  3KP3 A;  4ENM A;  2R5Y B;  2EIN H;  3WG9 A;  2UUZ A;  5LHG A;  5D4R A;  4KT5 C;  3FKJ A;  5D4S A;  2V1N A;  3KZY A;  4PJJ A;  1BL0 A;  5LRS A;  3MKW B;  2A05 A;  5IPA A;  5LD2 C;  1FTT A;  1P7J A;  3LL7 A;  1R7J A;  1W5T A;  3HUG A;  3HXL A;  1L3L A;  1KQ0 A;  2HI3 A;  3C18 A;  2PMZ N;  1N75 A;  3OYL A;  5ILV A;  4G7Z F;  3KLO A;  3SFZ A;  4W1U A;  1YOV B;  2MBF A;  4WK8 F;  5HLG A;  2R3S A;  1U8R A;  4CYC B;  1T0F A;  1Z67 A;  4KIG A;  1NK2 P;  1B8I A;  2C6Y A;  2V1D A;  4BY1 J;  1IRZ A;  3ZN0 A;  3WU2 C;  1Z6R A;  2O0Y A;  2XPV A;  3S15 J;  3PQJ A;  5ICE A;  1VQ9 I;  2LKS A;  2A6H F;  5A2Q K;  3DBR B;  4KYW A;  2WY7 Q;  4QPO A;  2OQG A;  2HDC A;  1BOB A;  1QPM A;  2K4J A;  3FWE A;  4ZDL A;  1CF7 B;  2DPD A;  5DTD A;  4ON0 A;  2CJJ A;  2LC2 A;  4NQW A;  2NS8 A;  3IWZ A;  1S7A A;  2L7Z A;  3K2Z A;  2KT0 A;  1YW9 A;  2LR8 A;  4BBR J;  3S1N J;  9ANT A;  2FOW A;  4M3G A;  4FTH A;  3P9K A;  1YI2 I;  1HF0 A;  1V55 H;  1NTC A;  2V6C A;  2YU9 J;  1Y56 A;  2H6C A;  2DDB A;  1IXR C;  1YG2 A;  3BZ6 A;  3LMM A;  3GTQ J;  3AG2 H;  4G6D A;  4ZJZ A;  4LLN A;  3ASN H;  1KZH A;  3WTU C;  1MIJ A;  2GQQ A;  2HZD A;  1GVJ A;  5J6X A;  4BE0 A;  3M1E A;  4FCY A;  1I27 A;  4LIU A;  2LF8 A;  3I56 I;  5D6E A;  5ERI A;  1KYW A;  4C2M J;  1IDZ A;  2VI6 A;  2YX4 A;  3A0B C;  1ZG1 A;  2E7W A;  2XRN A;  5DEQ A;  1OYY A;  1JKP C;  2ZFW A;  3QOE A;  4XN0 A;  4JBA A;  2E36 A;  3JSO A;  2XRO A;  2IGK A;  4LLL A;  1ZK8 A;  2VOO A;  1ZKG A;  5F0H A;  1F5T A;  4F92 B;  4FX4 A;  1W7P B;  3HYI A;  5LHH A;  1X58 A;  1EH6 A;  3HOX J;  2PMH A;  1FBS A;  2O8X A;  1XS9 A;  2M0C A;  1FEX A;  4DYC A;  3W2V A;  2ZME C;  2WB1 A;  1WZ2 A;  4B44 A;  1HST A;  2KIS A;  2DOD A;  4HNU A;  3HEF A;  2X51 A;  3KEQ A;  2GLO A;  2XGD A;  3HSE A;  3F23 A;  2QEN A;  1QVT A;  2ESN A;  1K4S A;  1JTX A;  2MGQ A;  4OU0 A;  3B02 A;  4B3X A;  2BXY A;  2DJN A;  5FRM A;  1UG2 A;  1ETV A;  2LDU A;  3SYT A;  2A5W A;  5DM6 F;  3I3L A;  3SHF A;  2MSY A;  1SFE A;  4DZJ A;  4A3B J;  4BXF A;  3ZMU A;  1S9H A;  2RC4 A;  5L3F A;  3ZMV A;  4G12 A;  2Q1Z B;  4LOC A;  3IH2 A;  5TRD A;  5FLM J;  3PO3 J;  1FOW A;  4LG0 A;  4L9T A;  5FB2 A;  4KFC A;  2VBX A;  1HKT A;  2M9H A;  3EPZ A;  1R9T J;  5EEA A;  2QKL B;  2ZSH B;  1HSJ A;  1TQM A;  2ZXH A;  4KN7 X;  4XLE A;  2ELH A;  4L0Z B;  4DJA A;  4XLC A;  3R60 A;  3IC7 A;  5EJC A;  3J81 K;  4V19 K;  2EFW A;  4U0V A;  3QAH A;  4FE7 A;  1IGN A;  4D1Q A;  1KQ9 A;  3WGI A;  4J19 A;  2HVS A;  4N0B A;  1XGS A;  1TP4 A;  2GAU A;  3H3U A;  4NNJ A;  4L9J A;  3KFW X;  1J9I A;  2JSC A;  3X2Q H;  2E7X A;  3GBG A;  3WTS C;  2HXI A;  1RNL A;  1MH4 A;  2DO7 A;  5J4Y A;  4BJ6 C;  3SZT A;  2P8T A;  2OF7 A;  2R5Z A;  1UST A;  1YS6 A;  2MD0 A;  2MW8 A;  5A2Q Z;  1AU7 A;  1Z77 A;  5E1W A;  4KT6 A;  5L3B A;  3VSK A;  1ZAR A;  2R7X A;  2RQQ A;  3L1P A;  4IHX A;  5EGO B;  1ZHF A;  2ACJ A;  1Q1V A;  5F0C A;  1YRN A;  3HC7 A;  3DPT A;  4LLG F;  5LFA A;  4G6Q A;  1TWC J;  5C4X J;  3CJN A;  1KGS A;  4BGD A;  4QPQ A;  1J2X A;  3CDI A;  2XPW A;  2L54 A;  2Y48 A;  1PYV A;  3QPH A;  3RJP A;  2CSO A;  1EJ9 A;  3TO7 A;  3JAM K;  5CVI A;  2DQR A;  2MH9 A;  3EDP A;  3GTK J;  3H3Z A;  2VXZ A;  2A6E F;  4U7B A;  3H5A A;  1ZGW A;  1EH8 A;  2FXA A;  4IRH A;  4HA8 A;  3BWG A;  4ENK A;  2FF4 A;  4U88 A;  3CQZ J;  1UJ8 A;  1J75 A;  3Q0U A;  2K86 A;  2G7H A;  1Y0U A;  2YSR A;  1FP2 A;  4I02 A;  1MBH A;  2JPB A;  3KYC B;  4X0G A;  3D1N I;  4HBL A;  3PO2 J;  1ZQ3 P;  1K6Y A;  3VEP A;  3GTM J;  3DEE A;  3DP7 A;  1V4R A;  2KIM A;  4AWX B;  5DD4 A;  1LDK B;  4BNC A;  2LY9 A;  4XLF A;  2VJ4 A;  2JA6 J;  3C2H A;  3KP4 A;  2FOK A;  3T5X A;  3L2W A;  1G4D A;  2E1N A;  2R7W A;  3F0C A;  1MND A;  2GXB A;  1O4X A;  2IS1 A;  2X6Y A;  3QQA A;  3RKW A;  2GA2 A;  1PVE A;  4BEH B;  4FAS D;  3A01 B;  2KRF A;  4PCQ A;  5M5W J;  4PSX A;  2ME0 A;  1D0Z A;  1TZL A;  5IYD J;  3ZQI A;  3ABL H;  1IRF A;  3EUH C;  5IT9 K;  3DTI A;  2JSP A;  2Z3Y A;  2DA4 A;  3DTE A;  4Y33 A;  3LNQ A;  2AXL A;  3MAJ A;  4R1H A;  3KYL A;  3IAM 2;  4GDF A;  3FBN B;  2KDZ A;  2ZJP F;  3NWT A;  3FXK A;  3K1P A;  1IAW A;  3AKZ A;  1LFU P;  4A6E A;  3H36 A;  3IP4 B;  2DK8 A;  2CGP A;  3GZ6 A;  1P92 A;  1QA6 A;  4E7H A;  3ZMZ A;  3RSN A;  1VQ5 I;  2E2J J;  2MG4 A;  1H9T A;  3DFG A;  3JRD A;  3HTS B;  1R1T A;  2W1O A;  2NOJ B;  3GW2 A;  3CUQ B;  1HDP A;  1MBE A;  4ZYH A;  3TW7 A;  1B9N A;  4RGU A;  1I6H J;  1U5T C;  1P4A A;  3SEQ A;  4HQM A;  3I59 A;  2B63 J;  4AUX A;  4CXF A;  3S93 A;  3CCR I;  3OYA A;  1LUJ B;  1UMQ A;  1WHU A;  3CMM A;  4C2T A;  3CLQ A;  2DBB A;  5DCM A;  3LOC A;  4Y52 J;  5BNG A;  1TL8 A;  2F2E A;  3MZ8 A;  3ZPL A;  1R23 A;  5J1Y A;  1V5F A;  5IT3 A;  2PQ8 A;  3CCV I;  1RR8 C;  1LE8 A;  2RV8 A;  1J5Y A;  2OZU A;  4XKB A;  2OUM A;  3K0L A;  3ZCO A;  3BG5 A;  5KCM A;  5L3G A;  4IHT A;  4S04 A;  4ZTJ A;  3OY9 A;  3GTP J;  2DXI A;  1X3U A;  2M8G X;  4EJV A;  2ADU A;  4HDV A;  2QBY B;  3BG3 A;  4GO1 A;  1I3A A;  3GFM A;  4BHP A;  3J80 K;  1SAX A;  4AVP A;  1U2W A;  2LYC A;  2JA2 A;  3S1M J;  2E34 A;  1JTY A;  1JUP A;  2BXZ A;  1Y8Q B;  3HG9 A;  2NYX A;  1F43 A;  2CUE A;  4DYQ A;  4C2U A;  4IXA A;  3O6B B;  1G3Y A;  3BPV A;  3DPU A;  3OR2 C;  4IHW A;  4E70 A;  4X6A J;  2CS3 A;  2AQF A;  5IYB J;  2WBM A;  3N4M A;  2L5Q A;  2Z5U A;  5H6R A;  2A61 A;  4HW0 A;  5J47 A;  1XN7 A;  3CCQ I;  3GTG J;  3LSM A;  3ULQ B;  2PG4 A;  3MEX A;  1U9O A;  3K4K A;  1T39 A;  3P5J A;  1ULY A;  3S1Q J;  1W5S A;  1G6N A;  4IJA A;  1ZG3 A;  4UUV A;  5JLW A;  2DOE A;  2PN6 A;  1VF9 A;  2IXS A;  2IJL A;  5D5U B;  1VQP I;  2W24 A;  3B6A A;  5FO5 A;  4F7Z A;  1B4A A;  4DIQ A;  2OQR A;  3LA7 A;  1RET A;  2HVQ A;  4XKW A;  3VPR A;  4HNV A;  5H2F C;  5HOO A;  2XKP A;  1K79 A;  1V3F A;  4EEF G;  4U0W A;  1YJN I;  1XSD A;  1VFC A;  3CJQ B;  1IN4 A;  2K9N A;  3C7J A;  2BV6 A;  1LPQ A;  4ZDO A;  4A0Y A;  2HQN A;  1MJ9 A;  3OWT A;  4AIJ A;  3GTO J;  1O57 A;  1KU9 A;  3CZ6 A;  2NVT J;  2E19 A;  4G6T B;  4RGS A;  1T95 A;  3VSL A;  4Y7N J;  3TKY A;  2EBI A;  2E1C A;  3K4J A;  2BW3 A;  2YUS A;  3GCM A;  1BN5 A;  1RKT A;  1V54 H;  2ZC2 A;  3VFZ A;  4QWQ A;  3LSJ A;  1I50 J;  2XVC A;  4XL9 A;  5J1R A;  5HVQ C;  4J01 A;  2P7C B;  3QOP A;  3DV8 A;  3IAS 2;  3GTJ J;  2IGO A;  2K85 A;  3KEO A;  3LAP A;  3KIO A;  2LBF B;  1FTZ A;  3MKL A;  2ISZ A;  2WTE A;  2LOO A;  1DGR M;  2K4B A;  1MZB A;  4I2O A;  1BM9 A;  3G1L A;  2BY0 A;  5F27 A;  4A3E J;  2QF7 A;  1MDM A;  2O8K A;  1JHH A;  2QYO A;  4XOP A;  2RNJ A;  4B43 A;  2BEO A;  2BOL A;  5HDG A;  4HAM A;  4B4C A;  2STW A;  3FMQ A;  1LEB A;  3TGN A;  2F5C A;  2GOM A;  2W84 A;  4BJ5 C;  2FX0 A;  1QHH D;  2DMN A;  2IS6 A;  4IX7 A;  1MH3 A;  3KYD B;  2IAI A;  3IRQ A;  3SJM A;  4P9F A;  4GYG A;  2A68 F;  1QVU A;  1LVK A;  4KIF A;  4E7L A;  2I10 A;  5HS7 A;  2V9P A;  3HHG A;  1VQM I;  1K4T A;  1W36 D;  1YTY A;  5M3F J;  1OPC A;  2X85 A;  3K10 A;  2A5Y B;  2ZME B;  1G3T A;  2HQ5 A;  3T0Y A;  2KQR A;  2FRH A;  5KAI C;  2QGU A;  1ZN2 A;  2YPR A;  3G3Z A;  5HNF A;  1LDD A;  4E7Z A;  3QYB A;  4XLA A;  1G59 A;  2QQ8 A;  2D5V A;  3KPH A;  2DK5 A;  3CDL A;  1WH7 A;  3FXQ A;  3PSF A;  3IWF A;  2IA1 A;  3CO7 C;  1XGM A;  1K6O A;  4OMZ A;  2P5V A;  3D5R C;  2JMW A;  4M74 A;  4IQJ A;  4F55 A;  2Y0S A;  3A0H C;  3JR9 A;  1ZGJ A;  2Y69 H;  2PEX A;  3WHB A;  3MN2 A;  4HV5 A;  3I71 A;  1J7K A;  2E35 A;  3BJO A;  3J80 Z;  3FMR A;  4HEA 2;  2JUC A;  3WG7 H;  3FM5 A;  3U1D A;  4A3K J;  2W57 A;  1A31 A;  2K27 A;  1MGT A;  2W82 A;  3CUO A;  4A6D A;  2WA0 A;  4MTD A;  2VKE A;  1KQ8 A;  2H27 A;  1Y1W J;  3A03 A;  4H4K C;  4HLX A;  2E5N A;  5CPR B;  1C0W A;  1T0F C;  3HRU A;  4XRS G;  2X9D A;  1BI3 A;  3E7L A;  2LMD A;  1ZRD A;  3R0A A;  5CVU A;  1E2X A;  5IY5 H;  4II3 A;  4HNT A;  2IRF G;  2XGX A;  2VC1 A;  3JRG A;  3RI4 A;  1NHA A;  2VE8 A;  3MZY A;  4BKX A;  4TV7 A;  3PM1 A;  4U0Y A;  1VQN I;  4GGG A;  5H6Q A;  1X3W B;  5EG0 B;  1MSF C;  4Q48 A;  2HYJ A;  1VQ4 I;  5LGU A;  2Y2Z A;  2WB1 N;  3HGG A;  4UY8 I;  3CTA A;  3RQ4 A;  4AD9 A;  3RTR A;  2XF6 A;  5AIQ A;  4LFU A;  3H1C A;  4RB0 A;  1UHS A;  4WXD A;  4OIQ F;  3T8T A;  1D0X A;  2HDW A;  1WVR A;  2LTP A;  4RGX A;  3CLO A;  3TDZ C;  3VYR B;  1PUF A;  3QPT A;  2L4A A;  2XAU A;  1WKM A;  1XCB A;  1ETY A;  2KHM A;  3BR5 A;  1BW5 A;  4M3D A;  2DMU A;  3LSK A;  2R7Q A;  4DNC A;  2L9N A;  3ZQF A;  1A35 A;  3CCM I;  3G2B A;  3GFJ A;  1B72 B;  2LY1 A;  3IH4 A;  4RA2 A;  4XQF A;  3O3K A;  4DW6 A;  3LQQ A;  4C3H J;  4Q5S F;  2A69 F;  3CCS I;  1BR2 A;  1T8I A;  4BY7 J;  5CLS A;  4HX7 A;  3E6C C;  4JX5 A;  1WI9 A;  1XPX A;  2CUZ A;  3V8J A;  1I1G A;  1A36 A;  1WJE A;  1LB2 A;  1GDT A;  1M1E B;  1RC9 A;  2FBH A;  2WAQ N;  2DAO A;  5JR3 A;  1G3S A;  3HJE A;  4CO8 A;  1FJL A;  1LVA A;  3E5U A;  3QRF F;  4OAY A;  5ICF A;  3ZQC A;  2NNY A;  5CKT A;  2V7F A;  4HST A;  3I4M J;  1QO0 D;  3V7R A;  2AHQ A;  2M5W A;  4V2G A;  1TWG J;  4EJW A;  2O61 A;  3CCJ I;  2HEO A;  2ID3 A;  2CUJ A;  1G8X A;  3KE2 A;  1F4K A;  4IVN A;  2Z33 A;  3E0J B;  3OYF A;  1XGO A;  4MEX F;  4HV6 A;  2XGE A;  2X6O A;  3JRB A;  4HPQ A;  3I4P A;  1TNS A;  2BE5 F;  1XGN A;  2KIF A;  1SVM A;  2HNH A;  4ZTF A;  2VLA A;  3JRH A;  5FFX A;  3AG4 H;  3OYK A;  2A6T A;  3T1B A;  1S72 I;  2AO9 A;  2HXO A;  1XSV A;  3JTH A;  5CJ9 A;  3OYN A;  1XMA A;  2DPU A;  4OWR B;  2B0L A;  3PUB A;  4BBS J;  3H5N A;  1HXD A;  4XRM A;  2EV0 A;  2F4M B;  3M8J A;  3J7A Y;  4I98 B;  2IGN A;  1BJZ A;  5TJJ A;  3F8F A;  4C3J J;  4YIF A;  1O3Q A;  1UB9 A;  3VDX A;  3HPG A;  4LMY A;  4ZH4 F;  4JOM A;  3L2Q A;  4KIS A;  3OYJ A;  2ZXW H;  3BP8 A;  1S3J A;  3K2A A;  3VOD A;  1DU0 A;  2V6E A;  1XD7 A;  4I7H A;  2JA7 J;  3CJR B;  5E20 A;  3BTI A;  2DA3 A;  2NVX J;  3LSG A;  5EZH A;  2L7M P;  4HG2 A;  5J8F A;  2KRH A;  2F5F A;  5K7H A;  1E3O C;  1U9N A;  5BMZ A;  4A3D J;  4NHJ A;  2QM3 A;  4NC7 A;  1YQA A;  2MAB A;  2XSD C;  1YHQ I;  2JA8 J;  2ZKZ A;  1T38 A;  1Z0X A;  4D5F A;  1KU2 A;  4C9Y A;  2R7R A;  3D0S A;  1X1C A;  5J4V A;  2HOT A;  3O8G A;  4UV9 A;  3WU1 B;  1LKX A;  1U78 A;  2G9W A;  1BR1 A;  1ENH A;  2DFI A;  3HRT A;  4BH9 A;  3Q9V A;  4Q4Z F;  1TWH J;  1TWF J;  2XAJ A;  1R6R A;  1ZLJ A;  3S8P A;  4E7K A;  1OQY A;  1JUS A;  1IZ1 A;  3DXJ F;  3H92 A;  2QZ8 A;  1MMA A;  2IEK A;  4FE4 A;  3HZJ A;  4ASN A;  4BXX J;  1D8J A;  4AC0 A;  2R4G A;  3KX2 A;  3KP2 A;  2Z2S B;  4XK4 A;  1ZTR A;  5F64 A;  4JX4 A;  1R36 A;  1HQC A;  1KYZ A;  4IO9 F;  1DU6 A;  2KP6 A;  2COM A;  2OD5 A;  4EVI A;  2FQ3 A;  5KHD A;  5CQE A;  1RKW A;  3F3X A;  1MJB A;  2XAS A;  4EGZ A;  5AIP A;  3VYU B;  4HYE A;  1X4P A;  1MJA A;  2R7D A;  4NC8 A;  3U1K A;  2KMU A;  3JRE A;  3GVA A;  2EV6 A; 
#chains in the Genus database with same CATH homology
 2CFX A;  2RVC A;  1BC7 C;  3ISP A;  3CUQ A;  4I0B A;  4UXN A;  3GYH X;  2EFO A;  4UVB A;  2A07 F;  4HZF A;  2HGC A;  2JZY A;  1QBJ A;  3JW4 A;  1R1U A;  1ON2 A;  3GLX A;  1ODD A;  2FU4 A;  1Z91 A;  1HBX G;  1FYL A;  2QBY A;  2GA1 A;  3LA2 A;  3N97 A;  4KMU X;  2J5O A;  4PZJ A;  3ZQ7 A;  4G94 A;  2QQ9 A;  3QP5 A;  1QZZ A;  2Z9O A;  3FM3 A;  2XV4 S;  1FYK A;  4P55 A;  4RS8 A;  3DEU A;  2K02 A;  4M73 A;  5HDK A;  4WF2 A;  4UNO A;  2EA2 A;  1K78 A;  1IW7 F;  2BBY A;  2IP2 A;  2HYG D;  3EET A;  3W6K B;  2VT2 A;  1F1Z A;  3TO9 A;  2GXG A;  3BY6 A;  1ONV A;  2VE9 A;  4BHB A;  2FBI A;  1ZYR F;  4EMS A;  2GWR A;  4BAY A;  3DPL C;  3MZH A;  1Q1H A;  3OV8 A;  1U3E M;  4OMY A;  1BIA A;  4WWC A;  3EYI A;  4A5M A;  1I5Z A;  2WV0 A;  4YII A;  4A5N A;  5DUI A;  3ZMT A;  2GZW A;  2D1V A;  4JQF A;  4GYI A;  5CVV A;  2HZT A;  2ETH A;  6PAX A;  1ZRE A;  4XBF A;  2XAF A;  2RKH A;  1GXQ A;  1SFX A;  2EJR A;  1UFM A;  1BIB A;  1B59 A;  4P9U A;  1B6A A;  2X0L A;  4IRI A;  4G8X A;  2OZ6 A;  4UHT A;  4I01 A;  1GXP A;  3DQV C;  4ZYG A;  3MCZ A;  1EH7 A;  1ZLK A;  2MLG A;  1FLI A;  2LSO A;  4WCG A;  1LNW A;  2EFP A;  3W6J B;  4CDG A;  4KMF A;  1XCV A;  5HS9 A;  3RPU A;  3WTV C;  1UCR A;  3P9I A;  1Z05 A;  4PDK A;  2DQL A;  1TQI A;  3M7G A;  4RAZ A;  4KN4 X;  5JHU A;  2P6T A;  4EQQ A;  5D5V B;  2W25 A;  3E6B A;  4LD5 A;  1AOY A;  2KIU A;  5JI6 A;  5E18 F;  4AIK A;  4IPA A;  3ZMS A;  2Q0O A;  2HKO A;  2RGV A;  2ZXJ A;  4ZZD A;  3TQN A;  3LST A;  1PDN C;  3L7W A;  4HLY A;  3IKT A;  4BHC A;  3P9C A;  2HQR A;  4XSZ F;  4UVC A;  3BRO A;  2F5E A;  3EYY A;  2FNA A;  1YO5 C;  3QU6 A;  4NB5 A;  3HTU A;  4M9S A;  1XB4 A;  3FXU A;  2WC2 A;  3J81 Z;  3L09 A;  1TNT A;  1BC8 C;  2EV5 A;  4YFX F;  2CO5 A;  5BPI A;  2PBI A;  4OIO F;  3S2W A;  4L9N A;  3WE2 A;  3K69 A;  4MEY F;  5BOX A;  1Z1D A;  3IKV A;  4ESJ A;  1YW7 A;  4HX4 A;  1ZRF A;  2DT5 A;  1TBX A;  2D2W A;  2FML A;  4P96 A;  5E1X A;  3EQL F;  1IXS B;  2P7V B;  5EEH A;  1QGP A;  5E1Z B;  2O6G E;  5K5O A;  2STT A;  3JAM Z;  1H9G A;  4O3M A;  5ED4 A;  1RI7 A;  3IHU A;  1J59 A;  2VC0 A;  2QVO A;  1YFH A;  2VT3 A;  5FLX K;  3P7N A;  4L9V A;  5ILS A;  2HS5 A;  3MQ0 A;  1JGS A;  4CYD A;  2KJB A;  3AAF A;  5DDG A;  1QQI A;  4R79 A;  1R5H A;  2QLZ A;  3JTG A;  1BJA A;  1O3R A;  4XLN F;  5LEK A;  1IN5 A;  3V4G A;  5DV5 A;  2ZO4 A;  3GEZ A;  4FX0 A;  3ML6 A;  2KJC A;  2M8E A;  3QU3 A;  1JE8 A;  1D5V A;  3WGH A;  1VTN C;  5D5W B;  5IT9 Z;  1ZRC A;  4QLC U;  2MC3 A;  5CVR A;  2FA5 A;  2IA2 A;  1MKM A;  3CDH A;  2CYY A;  5ICG A;  3FF5 A;  1T6S A;  1SD4 A;  3OOP A;  2DW4 A;  1CF7 A;  3WTX C;  5HLH A;  1IXC A;  2PI0 A;  5LBQ A;  3BOQ A;  4KDP A;  4HF2 A;  1WSU A;  2L3D A;  1OYI A;  2HTJ A;  1IF1 A;  2M1B A;  2M30 A;  1K7A A;  1FC3 A;  3BDD A;  3LWF A;  5KK1 A;  4FHT A;  4M6X A;  2NAZ A;  4HQE A;  1H0M A;  2G7U A;  2CG4 A;  4ENJ A;  5L3D A;  4ENN A;  5L3C A;  2XAQ A;  3TO6 A;  4CIC A;  5DUK A;  2ESH A;  3RDI A;  1SD6 A;  1W7P A;  3F8M A;  4GCV A;  1P4W A;  4BXU A;  1SMT A;  4I09 A;  3GWZ A;  4HDU A;  3I59 B;  1FOK A;  1R1V A;  2ZNZ A;  1R22 A;  3RYR A;  4ZZL A;  4Q47 A;  2HWV A;  4M9X A;  2VN2 A;  4HX8 A;  2FBK A;  1S8N A;  5K5Q A;  1B1B A;  2BYV E;  2EK5 A;  1T98 A;  2RDP A;  1LQ1 A;  3FXR A;  4M6Y A;  3RKY A;  1IN8 A;  3QP6 A;  5FLX Z;  5JVT A;  3I53 A;  3R61 A;  1RUN A;  2H09 A;  1S7O A;  1R5G A;  3I54 A;  4MNU A;  1W7P D;  3KZZ A;  1KU3 A;  2FSW A;  1HW1 A;  3F8C A;  3ZP5 A;  5K1Y A;  2NS0 A;  3CUQ C;  3IRR A;  2XHK A;  1WRJ A;  2KKO A;  4EGY A;  1R58 A;  1W4M A;  4RGR A;  4BYY A;  3F6O A;  1U6G A;  2WWY A;  4N9I A;  4JK1 X;  3PFI A;  1FNN A;  4Y15 A;  1RUO A;  4IHS A;  4Y17 A;  5CYV A;  2OBP A;  4CZZ A;  1USS A;  3BPX A;  3NEU A;  5BS6 A;  3FHZ A;  5FD5 A;  2ZNY A;  5AON A;  4GXO A;  5LRR A;  4UVA A;  3HOS A;  2XUB A;  3U9G A;  4OOI A;  4EM2 A;  3VOE A;  4LB6 B;  5LEJ A;  2EA4 A;  4LK1 F;  1ZGA A;  2IA0 A;  2HKX A;  3E6M A;  1O3T A;  4G7O F;  1XMK A;  2X4H A;  4CGZ A;  1PP7 U;  1U5T B;  4KNY A;  1J0R A;  4O5V A;  5E8I A;  3WOD F;  1MDM B;  2QWW A;  2FEZ A;  5HDN A;  2XAG A;  1SMY F;  2ZJ2 A;  3KET A;  3DF8 A;  4U7D A;  4OIP F;  5DD8 A;  2VOP A;  1D3Y A;  1F9N A;  1BOA A;  2V9V A;  1TW3 A;  5BQT A;  2F5D A;  2MLK A;  5F6F A;  3HHH A;  4RAY A;  3ZMD A;  3RKX A;  2YR2 A;  1FWZ A;  3HSR A;  5LHI A;  3G73 A;  3Q9S A;  1QZY A;  1RZ4 A;  4M9Z A;  2DU9 A;  1ON1 A;  2EFN A;  3C3W A;  1GHC A;  4H0E A;  5LGT A;  3I5U A;  3L2C A;  4M72 A;  3Q5F A;  2YX7 A;  2NNN A;  5D5X B;  1G3W A;  3E5Q A;  4KIC A;  3CO6 C;  2GIV A;  2LKP A;  3SXY A;  4Y13 A;  2DLL A;  2UXN A;  2ZBK A;  1OKR A;  2YU3 A;  3GZ5 A;  3HRS A;  2HYF A;  4S05 A;  3LQR A;  3WTZ A;  3TDU C;  3BJA A;  2FMY A;  4HF1 A;  2P5L C;  4O6J A;  4AIH A;  3HSF A;  4PGG A;  1FPQ A;  1HKQ A;  4RB2 C;  3GFL A;  4IF4 A;  2MD5 A;  1DDN A;  1OMI A;  5D8L B;  2AS5 F;  5FFZ A;  5E8G A;  1FX7 A;  1LDJ A;  3SQN A;  4A0X A;  5EEG A;  1TW2 A;  4R8H A;  3U2R A;  1D8K A;  3K1N A;  1O7L A;  4BQA A;  2IW5 A;  3SZP A;  5DYM A;  2VBZ A;  1OYW A;  2M87 A;  2HTS A;  3KP7 A;  3WE3 A;  3ZN1 A;  1MD0 A;  2CQK A;  4D0P A;  2D1H A;  3I0T A;  4K2E A;  2XKO A;  1RIO H;  3F8N A;  1XSX A;  2Q8K A;  1FSH A;  4IRG A;  3ECH A;  1R00 A;  3REO A;  4L5J A;  1I6X A;  2HFH A;  1S6L A;  2CW0 F;  3TOB A;  2W85 A;  3LA3 A;  3C1D A;  3F22 A;  4M71 A;  2UXX A;  2EFQ A;  1LEA A;  2OAZ A;  2P6S A;  1ZG5 A;  1KU7 A;  3ROU A;  3IL2 A;  2LF7 A;  2QQA A;  3GFI A;  3GF2 A;  1ZAO A;  3DKW A;  1STZ A;  1DUX C;  4LK0 F;  1SD5 A;  2BGC A;  4Z2Y A;  2ZME A;  3K9T A;  4XLP F;  2XIG A;  5E17 F;  1YW8 A;  5H20 A;  1L0O C;  2K7L A;  1UHM A;  2V79 A;  4OIR F;  3MWM A;  2P5K A;  4WXH A;  2UWM A;  2QUF A;  3M9A A;  1FY7 A;  4B09 A;  1BBY A;  1KA8 A;  2O3F A;  1IUY A;  2IPQ X;  4WXC A;  4FT8 A;  2H94 A;  2EB7 A;  4EV0 A;  3R0J A;  3L00 A;  5D6F A;  3O2P E;  2FNP A;  1OR7 A;  1DPU A;  2DI3 A;  2Y0M A;  4ZYE A;  2LNB A;  3KLN A;  3M8E A;  1YS7 A;  4ETS A;  3F6V A;  1UHW A;  2VON A;  5F1R A;  2JRT A;  3WTY C;  4EJU A;  1ZH5 A;  3KP5 A;  1AWC A;  5K5R A;  5L3E A;  2ZCW A;  3ELK A;  3L9F A;  3WTT C;  1FBU A;  2D45 A;  4XSX F;  2V1X A;  3I58 A;  4WX9 A;  4RB3 C;  4PGH A;  3V8L A;  5JFR A;  2JPC A;  2RQP A;  2MA3 A;  2OU2 A;  2XAH A;  1JXS A;  2VOD A;  3WGG A;  2PFB A;  2RN7 A;  4LB5 A;  3FMS A;  2OA4 A;  4MHG A;  4LG0 B;  3R6S A;  1FYM A;  1YIO A;  2L4M A;  1FP1 D;  4EJT A;  3GX4 X;  4YG2 F;  2V1U A;  1A04 A;  4KUM A;  1IN6 A;  1K78 B;  2H6B A;  3GUD A;  1P2F A;  4YFN F;  1HW5 A;  1HW2 A;  1PP8 F;  5FD6 A;  3V8K A;  4A12 A;  1S29 A;  5KVR A;  1PUE E;  2HOE A;  3F21 A;  3J7A O;  5FGM A;  1TQP A;  1DP7 P;  4A2U A;  4MQV A;  2MH2 A;  1EV7 A;  2L02 A;  3I64 A;  3EUH A;  4LGW A;  1IRG A;  1SD7 A;  1LJ9 A;  4ESF A;  2HR3 A;  4I0A A;  3LAJ A;  1HKS A;  3E3V A;  1WWX A;  3B73 A;  1YLF A;  4A0Z A;  2M45 A;  3ERE D;  1FZP B;  5HLI A;  2Y75 A;  4DQ2 A;  2A3S A;  2O03 A;  3PQK A;  2CWE A;  4B8X A;  4KA4 A;  2ISY A;  3MFK A;  1XDS A;  3JSP A;  3RPQ A;  1FBQ A;  1U5T A;  3F72 A;  4KIB A;  4OIN F;  1FSE A;  4CHU A;  2IVM A;  3RIR A;  1JHF A;  5J8C A;  3R4K A;  5ILU A;  3RYP A;  1BI0 A;  3WU0 A;  2NRA C;  2UZK A;  3HOT A;  4HOB A;  5CVJ A;  1P4X A;  2PMU A;  3WTW C;  3NQO A;  5LGN A;  2EWN A;  1Z6T A;  3BJ6 A;  1YYV A;  3ABT A;  4EM1 A;  1BI1 A;  3T8R A;  1O7F A;  4MTE A;  4MGR A;  1T2K A;  4G7H F;  3ABU A;  3FX3 A;  3E5X A;  5DCF A;  2DTR A;  1IN7 A;  4RB1 A;  5HS8 A;  1XDU A;  3HIF A;  3E6D A;  1QNT A;  2QQB A;  2PLY A;  4YFK F;  3K1M A;  4MQ9 F;  4L5I A;  3NRV A;  3GO5 A;  5DCM B;  4EM0 B;  3KCC A;  4L0Y B;  3F8B A;  3FZV A;  2FE3 A;  3ECO A;  3V7C A;  5BPD A;  5D8K B;  4XRF A;  1BI2 A;  2J5P A;  2Q2E A;  1SFU A;  2JT1 A;  1E17 A;  4ZYD A;  3TOA A;  1TTY A;  1Z7U A;  3VB2 A;  4ESB A;  4G9Y A;  4UV8 A;  4EJO A;  3LFK A;  2JTV A;  2L01 A;  2IT0 A;  2PJP A;  4HF0 A;  5ICC A;  1DPR A;  4L18 B;  1WQ2 A;  1O3S A;  5LLQ A;  2VBW A;  3COA C;  3KP6 A;  1CGP A;  2R7F A;  2Z99 A;  3E97 A;  2TDX A;  3GXO A;  1P6R A;  4N9H A;  2VBY A;  3D5L A;  1I1S A;  3V7S A;  3HRM A;  1Z9C A;  2P4W A;  1REP C;  1B9M A;  1FT9 A;  1TLH B;  3M8F A;  4LJZ F;  4P5O A;  3KP3 A;  4ENM A;  3WG9 A;  5LHG A;  5D4R A;  4KT5 C;  5D4S A;  3KZY A;  5LRS A;  1R7J A;  1W5T A;  3HUG A;  1L3L A;  1KQ0 A;  3C18 A;  5ILV A;  4G7Z F;  3KLO A;  3SFZ A;  2MBF A;  4WK8 F;  5HLG A;  2R3S A;  1U8R A;  1T0F A;  4KIG A;  2C6Y A;  2V1D A;  3ZN0 A;  1Z6R A;  2O0Y A;  3PQJ A;  5ICE A;  2A6H F;  5A2Q K;  4KYW A;  2OQG A;  2HDC A;  1QPM A;  2K4J A;  3FWE A;  1CF7 B;  2DPD A;  4ON0 A;  4NQW A;  3IWZ A;  1S7A A;  3K2Z A;  1YW9 A;  3P9K A;  2V6C A;  2H6C A;  1IXR C;  1YG2 A;  3BZ6 A;  4G6D A;  4LLN A;  3WTU C;  2GQQ A;  1GVJ A;  5J6X A;  3M1E A;  1I27 A;  2LF8 A;  5D6E A;  5ERI A;  1KYW A;  2YX4 A;  1ZG1 A;  2E7W A;  2XRN A;  5DEQ A;  1OYY A;  2ZFW A;  4JBA A;  3JSO A;  2XRO A;  4LLL A;  2VOO A;  1F5T A;  4FX4 A;  1W7P B;  3HYI A;  5LHH A;  1EH6 A;  2PMH A;  1FBS A;  2O8X A;  1HST A;  3KEQ A;  3HSE A;  3F23 A;  2QEN A;  2ESN A;  4OU0 A;  3B02 A;  2LDU A;  3SHF A;  1SFE A;  3ZMU A;  2RC4 A;  5L3F A;  3ZMV A;  5TRD A;  4LG0 A;  4L9T A;  5FB2 A;  4KFC A;  2VBX A;  1HKT A;  1HSJ A;  1TQM A;  4KN7 X;  4L0Z B;  2ELH A;  3R60 A;  3IC7 A;  3J81 K;  2EFW A;  4U0V A;  3QAH A;  1KQ9 A;  3WGI A;  4N0B A;  1XGS A;  2GAU A;  3H3U A;  4L9J A;  3KFW X;  1J9I A;  2JSC A;  2E7X A;  3WTS C;  1RNL A;  2DO7 A;  3SZT A;  2P8T A;  1UST A;  1YS6 A;  5A2Q Z;  5E1W A;  5L3B A;  1ZAR A;  1ZHF A;  2ACJ A;  3DPT A;  4LLG F;  4G6Q A;  3CJN A;  1KGS A;  1J2X A;  2L54 A;  2Y48 A;  3QPH A;  3RJP A;  2CSO A;  3TO7 A;  3JAM K;  5CVI A;  2DQR A;  2MH9 A;  3EDP A;  3H3Z A;  2VXZ A;  2A6E F;  4U7B A;  1EH8 A;  2FXA A;  4IRH A;  4HA8 A;  3BWG A;  4ENK A;  2FF4 A;  4U88 A;  1J75 A;  2K86 A;  2G7H A;  1Y0U A;  2YSR A;  1FP2 A;  4I02 A;  2JPB A;  4HBL A;  3VEP A;  3DP7 A;  1V4R A;  2KIM A;  4AWX B;  5DD4 A;  1LDK B;  4BNC A;  3KP4 A;  2FOK A;  3T5X A;  1G4D A;  2E1N A;  2GXB A;  3RKW A;  2GA2 A;  2KRF A;  4PCQ A;  1IRF A;  5IT9 K;  2Z3Y A;  2AXL A;  3MAJ A;  4R1H A;  3K1P A;  1IAW A;  4A6E A;  2DK8 A;  2CGP A;  3GZ6 A;  1P92 A;  3ZMZ A;  1H9T A;  3DFG A;  3HTS B;  1R1T A;  3GW2 A;  3CUQ B;  4ZYH A;  1B9N A;  4RGU A;  1U5T C;  1P4A A;  4HQM A;  3I59 A;  4CXF A;  2DBB A;  5DCM A;  2F2E A;  3ZPL A;  1R23 A;  5IT3 A;  2PQ8 A;  2RV8 A;  1J5Y A;  2OZU A;  3K0L A;  5L3G A;  4IHT A;  4S04 A;  1X3U A;  4EJV A;  2ADU A;  4HDV A;  2QBY B;  4GO1 A;  3GFM A;  4BHP A;  3J80 K;  1SAX A;  4AVP A;  1U2W A;  2NYX A;  4IXA A;  3O6B B;  1G3Y A;  3BPV A;  4E70 A;  3N4M A;  2Z5U A;  5H6R A;  2A61 A;  4HW0 A;  1XN7 A;  3ULQ B;  2PG4 A;  3MEX A;  1T39 A;  1ULY A;  1W5S A;  1G6N A;  4IJA A;  1ZG3 A;  4UUV A;  2PN6 A;  2IJL A;  5D5U B;  2W24 A;  5FO5 A;  4F7Z A;  1B4A A;  2OQR A;  3LA7 A;  5HOO A;  2XKP A;  1K79 A;  1V3F A;  4U0W A;  1XSD A;  1IN4 A;  3C7J A;  2BV6 A;  4A0Y A;  2HQN A;  1MJ9 A;  4AIJ A;  1O57 A;  1KU9 A;  4RGS A;  3TKY A;  2E1C A;  1BN5 A;  3VFZ A;  4QWQ A;  2XVC A;  5HVQ C;  2P7C B;  3QOP A;  3DV8 A;  3KEO A;  3LAP A;  2ISZ A;  2WTE A;  2K4B A;  4I2O A;  1MZB A;  1BM9 A;  1MDM A;  1JHH A;  2QYO A;  2RNJ A;  2BEO A;  5HDG A;  4HAM A;  2STW A;  3FMQ A;  1LEB A;  3TGN A;  2F5C A;  2W84 A;  3IRQ A;  4P9F A;  4GYG A;  2A68 F;  4KIF A;  5HS7 A;  3HHG A;  1YTY A;  1OPC A;  2A5Y B;  2ZME B;  1G3T A;  3T0Y A;  2FRH A;  1ZN2 A;  2YPR A;  3G3Z A;  1LDD A;  2DK5 A;  3FXQ A;  3IWF A;  2IA1 A;  3CO7 C;  1XGM A;  1K6O A;  4OMZ A;  2P5V A;  4M74 A;  1ZGJ A;  2PEX A;  4HV5 A;  3I71 A;  1J7K A;  3BJO A;  3J80 Z;  3FMR A;  3FM5 A;  3U1D A;  2W57 A;  2K27 A;  1MGT A;  3CUO A;  4A6D A;  4MTD A;  1KQ8 A;  2H27 A;  4HLX A;  1C0W A;  3HRU A;  1BI3 A;  1ZRD A;  3R0A A;  5CVU A;  1E2X A;  2IRF G;  2XGX A;  2VC1 A;  3RI4 A;  1NHA A;  2VE8 A;  3MZY A;  4TV7 A;  4U0Y A;  4GGG A;  5H6Q A;  4Q48 A;  5LGU A;  3CTA A;  4AD9 A;  3RTR A;  5AIQ A;  4LFU A;  4RB0 A;  4WXD A;  4OIQ F;  3T8T A;  4RGX A;  3CLO A;  3TDZ C;  3QPT A;  2L4A A;  1WKM A;  1XCB A;  4DNC A;  3GFJ A;  3O3K A;  3LQQ A;  4Q5S F;  2A69 F;  5CLS A;  4HX7 A;  3E6C C;  1WI9 A;  3V8J A;  1I1G A;  1LB2 A;  2FBH A;  5JR3 A;  2DAO A;  1G3S A;  4CO8 A;  1LVA A;  3E5U A;  3QRF F;  5ICF A;  2NNY A;  1QO0 D;  3V7R A;  2M5W A;  2O61 A;  4EJW A;  2HEO A;  3KE2 A;  1F4K A;  4IVN A;  2Z33 A;  1XGO A;  4MEX F;  4HV6 A;  3I4P A;  1TNS A;  2BE5 F;  1XGN A;  2KIF A;  5FFX A;  3T1B A;  1XSV A;  3JTH A;  5CJ9 A;  1XMA A;  2DPU A;  2B0L A;  1HXD A;  2EV0 A;  4I98 B;  5TJJ A;  4YIF A;  3F8F A;  1O3Q A;  1UB9 A;  4LMY A;  4ZH4 F;  3BP8 A;  1S3J A;  3VOD A;  1XD7 A;  4I7H A;  5E20 A;  5J8F A;  2F5F A;  5BMZ A;  4NHJ A;  2QM3 A;  1YQA A;  2ZKZ A;  1T38 A;  1KU2 A;  3D0S A;  4UV9 A;  3WU1 B;  1U78 A;  2G9W A;  2DFI A;  3HRT A;  4BH9 A;  3Q9V A;  4Q4Z F;  2XAJ A;  1ZLJ A;  3DXJ F;  1IZ1 A;  3H92 A;  2QZ8 A;  4ASN A;  1D8J A;  3KP2 A;  5F64 A;  1R36 A;  1HQC A;  1KYZ A;  2COM A;  2OD5 A;  4EVI A;  2FQ3 A;  3F3X A;  1MJB A;  2XAS A;  4EGZ A;  5AIP A;  4HYE A;  1MJA A;  2R7D A;  3GVA A;  2EV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...