2VI6A

Crystal structure of the nanog homeodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOBOX PROTEIN NANOG
publication title Crystal Structure and DNA Binding of the Homeodomain of the Stem Cell Transcription Factor Nanog.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 17
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2vi6A00
1OCTC 2EZHA 2TRTA 2CQXA 1POGA 3OOUA 4M3GA 1FIAA 3F0CA 1RESA 3B6CA 1AKHB 4BBSJ 3BR0A 1XC5A 2MSYA 3S1RJ 4IEJA 5DS9A 1BW5A 2ID6A 1JKRC 2LVSA 4FCYA 4V2FA 1RETA 1ZR4A 1I3QJ 2HXOA 1NK2P 5FKKA 2ZB9A 4HNVA 2KDZA 2CRGA 3CQZJ 5FKOA 3SDGA 1T33A 4DZJA 4FISA 5F0HA 3GBGA 3Q0VA 3I4MJ 2DMQA 1UHSA 3LSRA 3OSFA 3JRDA 5C44J 4A3FJ 2LTPA 5EYRA 4FE7A 5E3OA 2NVTJ 5GPCA 1IJWC 1RKWA 3GTPJ 3GTLJ 5K7ZA 2NS7A 1ETXA 2D5VA 4A3GJ 2EZLA 2VKVA 5F27A 1U9NA 3IH4A 1VF9A 2DMTA 2K9QA 2L7ZA 3BG9A 3QPSA 2K9SA 3FK6A 3IV5A 2R5YB 1W0UA 1BW6A 1H8AC 2DMNA 5M5YJ 1WPKA 5F0CA 1EF4A 3BR1A 2HOTA 3JRIA 1TWFJ 5EGOA 1JT6A 2HOAA 1T56A 3DCFA 3S2DJ 2DA1A 2E19A 2B63J 1B8IB 3IH2A 2HDDA 2W48A 2NVYJ 1DU0A 4EEFG 4XRSA 3HGYA 2P81A 2XB0X 1W0TA 2HI3A 3D1NI 2Y9ZA 3K2AA 2NVXJ 2O7OA 4IHXA 5JLXA 2OPTA 1MH4A 2WAQN 2CJJA 1JGGA 2GM4A 2Y2ZA 3M3YJ 1FEXA 4LOCA 3FIWA 1JKQC 2M8GX 5M3FJ 4JX5A 4A3DJ 3SJMA 2K9NA 5IOZA 1G2HA 1U78A 2LLKA 3ZQHA 5GP9A 2LFBA 3O8GA 2ELKA 5JLWA 3S1MJ 4GFBA 3Q0WA 1QPIA 2MG4A 3TP3A 1Y1VJ 4UUTA 5E3MA 1MBKA 5K7FA 4DYRA 3S2HJ 5IP6A 2I10A 2YS9A 4D5FA 1FTZA 4MFDA 2HXIA 4JX4A 3QPLA 4AYBN 2H1KA 4G12A 2XPWA 5EGOB 1ETVA 2H8RA 3FISA 1U8BA 2AHQA 2L7MP 3TP0A 4C3JJ 2X6OA 2DA7A 1ORKA 5F08A 1GT0C 4AC0A 1VI0A 4JX6A 4AUXA 4Y7NJ 1ETQA 2LKXA 1LE8A 5F0FA 3HOYJ 4B1RA 4XICA 5IOYA 2FJ1A 1MBJA 3LSJA 1FIPA 3NAUA 3BQZA 2K40A 5EG0A 3ZOBA 3PM1A 3RZDJ 1WH5A 4QSHA 2QCOA 4XRSG 3Q0UA 2COBA 2RAEA 2DN0A 2AO9A 3G1MA 4M3BA 5J1UA 4UUSA 2R5ZA 2GLOA 2CUFA 1ETYA 5GPAA 5EEAA 4MIMA 1IDYA 3L1PA 1ZKGA 3HKZN 4DYQA 2Y31A 3ZQCA 4M3FA 4A3MJ 2DA3A 1H89C 1BJZA 3K7AJ 1JTXA 4BKXA 3GTQJ 4B4CA 3O8HA 1GUUA 2DMPA 3BR6A 4QTRA 4M3DA 1HLVA 4IHWA 2N8GA 1A6IA 2M0CA 3UKGA 2JA7J 3C2BA 5FKLA 1H88C 1QRYA 2IEKA 1X58A 4NDLA 3JRGA 2FX0A 4W1UA 3JRFA 4XIDA 3S14J 2NS8A 2ME6A 4A69C 1LE8B 3WHCA 2WB1N 1UG2A 1ZTRA 1RPWA 3TW6A 2E2IJ 3OIOA 4A3EJ 1MNMC 1B72A 4Y52J 2PMZN 5FKMA 2EH3A 2O8KA 3S1NJ 3B6AA 5EG0B 1XS9A 4RDUA 4IHYA 2O9LA 5IYBJ 3MKLA 3IH3A 4M3EA 2DA2A 2MW8A 3CCYA 1ITYA 4DZPA 1MBHA 4UUSB 2R5ZB 3OSGA 2TCTA 1WH7A 2X48A 4BXXJ 1LFBA 5IYDJ 1BA5A 1NK3P 1TWGJ 1GV5A 3Q3SA 2XSDC 5J3LA 1MBEA 5FLMJ 3MN2A 3DEWA 1F36A 1IC8A 2E2HJ 4C3HJ 3JRHA 2FQ4A 3RKQA 4D7MA 1HF0A 3TEDA 4A3BJ 4MO7A 3JRCA 2DA6A 4BBRJ 3RZOJ 5BNGA 2XPVA 3E7LA 3JRAA 2IBDA 2VUMJ 3I4NJ 3HM5A 1IG7A 4FE4A 2CQQA 3H3VK 4QIWN 5M5XJ 3W6VA 2YUSA 3A01A 1TWCJ 5FKNA 3LSPA 1JUMA 3PO3J 4XK4A 4A3CJ 5HODA 3NARA 1ENHA 1B72B 1UMQA 1ZK8A 4M6VA 3GTOJ 1RR7A 3S16J 4JP0A 5DTDA 5E3LA 4S0HB 4A3LJ 2VPRA 2LK2A 2EZIA 2JA5J 3LOCA 3BR5A 2XGCA 3A02A 2XB5A 3TW7A 2YU9J 3HGGA 3HB9A 2JJ7A 5EZHA 3G1LA 4XRMA 4A3KJ 1JTYA 3A03A 2M9HA 4I76A 1APLC 4FTHA 3HOZJ 4L5EA 4V2GA 1IV6A 1QVTA 1IUFA 1O4XA 5K7HA 1GDTA 2FD5A 1Z77A 5C3EJ 3WHBA 1PUFA 2E2JJ 3ZQIA 1U9OA 5IP9J 2E1OA 3HOWJ 3BTLA 1JJ8C 2R93J 9ANTA 1SANA 2JWTA 2DA5A 2NVQJ 1S7EA 5C4JJ 3S1QJ 2DA4A 1HDPA 2M34A 1LFUP 1HCRA 2Y30A 3A01B 1JJ6C 4CYCA 3GTKJ 1DU6A 2XPUA 1AHDP 4A3IJ 3CDLA 1Y1WJ 3HBLA 5EZGA 2CU7A 2XGEA 2XGDA 1MH3A 2IAIA 4D7NA 1JUSA 2LD5A 2EBIA 3S15J 1R9TJ 4BY1J 3ZQGA 3GTJJ 1MSFC 3BT9A 4B3AA 2JA6J 2DJNA 4C3IJ 5EDNA 3HOVJ 1P7IA 1CQTA 1MSEC 4C2MJ 1F43A 1MBFA 4A93J 5EF6A 2JMWA 3H0GJ 2HYJA 3HEFA 1SFOJ 1TWAJ 3BG3A 3BR2A 3ZQFA 2CUEA 3LNQA 4RBOA 1MBGA 3BTCA 4DW6A 4MFEA 1IDZA 2Y0SN 1OJLA 2Y9YA 2LR8A 5J1RA 1P7JA 1WGXA 2L9RA 5IPAA 5IP7J 2LY9A 3MVPA 5F1JA 1JKOC 1ZGWA 2VI6A 3QQAA 1JT0A 3FK7A 4JYKA 2LP0A 5J1YA 1PUFB 1JKPC 3BR3A 2XRLA 1I6HJ 4ABZA 2GBYA 4DYCA 3BG5A 2EQRA 2DTZA 1A5JA 5FLVA 3BQYA 3PO2J 2NOGA 1OFCX 3FKIJ 5FJ8J 5F04A 3M4OJ 3HOUJ 4CYCB 1YRNA 2EZKA 2JA8J 1TC3C 1VNDA 2R92J 2R0QC 3JREA 3JRBA 2M2EA 3HOXJ 4IHVA 1Q1VA 4J19A 2JN6A 2WV1A 2L0KA 5M5WJ 4W97A 2G0EA 1FTTA 4MLOA 3BTJA 4I6ZA 2L7FP 1AKHA 4D5CA 2ID3A 2QF7A 1D5YA 2HOSA 3LSGA 1I50J 2ECBA 1NTCA 3S17J 3JR9A 5E3NA 2R7ZJ 1K61A 1OCPA 3HDDA 1ZQ3P 4A3JJ 1VFCA 1X2NA 1HOMA 4BY7J 2ME0A 4X6AJ 2KT0A 3GTMJ 1RKTA 1BL0A 1GVDA 5C4XJ 1FJLA 3ZQLA 1Z0XA 1QVUA 2DMUA 1HDDC 2JK3A 3G1OA 3CMYA 2VKEA 1K83J 1AU7A 5M3MJ 2X9DA 3GTGJ 2HQ5A 1WCMJ 1TWHJ 1E3OC 1B8IA 1IRZA 2R5YA 1YRNB 1IGNA 1ETOA 1GV2A 3RQIA 1ETWA 3BTIA 5IYCJ 1ETKA 1JUPA 1WI3A 2ECCA 1XG1A 2MGQA 4X1EA 1X2MA 1ZR2A 3SFIA 2OF7A 3VPRA
chains in the Genus database with same CATH superfamily
4QWQA 1R58A 5DUIA 2OA4A 2HKOA 1FYLA 1AKHB 2CQNA 3KEOA 5F64A 5DS9A 1WQ2A 3K70C 4M9SA 3AL0C 2QSGX 2VKHA 4Z2YA 5E20A 4KIGA 3VEPA 3H5NA 5F1RA 4AYBA 1ON1A 2FF4A 5LRRA 1XCBA 2OQGA 4B09A 4HBLA 4I98B 3I54A 1B59A 2DTRA 3GBGA 4XN0A 1LFPA 3T8TA 1R4NB 3JTHA 5E3OA 1RKWA 1ZRFA 3H9JA 1G3WA 1FP2A 3R0JA 3J7YJ 1IF1A 2P5LC 1IUYA 4RB3C 1O7LA 5EEHA 3OYAA 4A3GJ 2HOEA 5E1XA 1X1DA 2HKXA 3BG9A 1H8AC 2VE8A 3TBIA 3D0SA 2BGCA 5BPDA 3K4BA 1EF4A 2HOTA 3FZVA 3G71I 5EGOA 1RR8C 1JT6A 1AWCA 2PJPA 2HOAA 3LMMA 5CQGA 1T56A 2VBXA 3S2DJ 3BOQA 1EH6A 2FQ3A 3HKZA 4CXFA 3OL4A 1B8IB 2W48A 4M73A 2KIUA 4BE2A 4EEFG 4Q47A 4BYYA 4XRSA 2OCCH 1S29A 1FBSA 4UY8I 2XB0X 1WJCA 2FOKA 3M07A 1KQ0A 1Y39A 1NG7A 3F22A 3AG4H 2PFBA 1BJAA 3LQQA 1FY7A 3MMYB 2NRAC 4NQWB 2K27A 3B73A 2Y2ZA 4PDKA 1SFXA 1FEXA 4KFCA 4H0EA 3FIWA 3G3ZA 2NAZA 4F92B 5J6XA 2X85A 2VT2A 2K9MA 1U78A 4A0XA 1EV7A 2LLKA 2F5VA 3OYIA 5B66C 4OIPF 5H6QA 5JHUA 3Q0WA 3SDBA 2MG4A 3TP3A 2DCEA 3T0YA 3WODF 1KQ9A 1HW1A 3GZNB 3K4JA 3S2HJ 2K02A 2PMZA 1F5TA 3RYPA 4G94A 1Y8RB 3V42A 1ZN2A 4OMYA 2BE5F 1FTZA 3OS1A 4MFDA 4MTDA 3QPLA 1GHCA 2Q2EA 2VBZA 2ZXHA 2DBBA 2L7MP 3HRSA 4XSXF 2DA7A 1ORKA 2DK8A 2XDVA 1GT0C 1FOWA 2E35A 2KIMA 3COAC 4JX6A 2K4JA 2NXNB 4Y7NJ 1LE8A 2B9SA 1IZ1A 4B1RA 4XICA 2DU9A 2L4MA 2DYRH 3LAPA 3NAUA 2YSRA 3GWZA 1SVLA 1GXQA 3NQOA 4V19K 5L3FA 4XRSG 4BQAA 4LMYA 2O5RA 1YIJI 4A5MA 2HGCA 2KRCA 1E17A 5FROA 2GLOA 2CUFA 3L2VA 2ZKZA 4FETA 4G6QA 5HDNA 1IDYA 4B47A 1P4XA 1FT9A 3PL8A 4E4HA 3DPLC 1ZKGA 4N9IA 3ABMH 5GAGJ 1LEAA 3KP2A 5DUKA 3ZQCA 4A3MJ 5FRMA 4UUVA 4E70A 3K7AJ 1KU3A 3GTQJ 3I53A 2O3FA 4RM3A 4XBFA 3CF2A 5E79C 4QTRA 4HF1A 4LITA 4M3DA 2QQ8A 3C7JA 1HLVA 3EDPA 3ROUA 3DKWA 2JA7J 2H09A 1S6LA 3DEUA 2K9LA 1W7PD 2GAUA 5FKLA 1H88C 3DBRB 3CP2A 4RMNA 3TO7A 2IEKA 4OMZA 5D4SA 4RB2C 3HOTA 4IHSA 2Q8KA 2GXGA 4R79A 2ZJRF 1P6RA 2ME6A 1VQ8I 3M8FA 5FLXZ 4IF4A 5LBQA 4Q4ZF 3MEXA 1SFKA 4Q5SF 5B1BH 3OIOA 1JE8A 1MNMC 1B72A 1FWZA 5FKMA 2EH3A 4CCMA 3CJTB 4IHYA 2O9LA 2KZGA 5IYBJ 5ICEA 3MKLA 3DF8A 1BC8C 3PNYA 1SAXA 3K10A 3CCYA 1QO0D 2K86A 3HOSA 2R7WA 2R5ZB 1MW7A 1MIJA 2F5FA 3R4KA 1LPQA 2PJRB 3KP6A 4L5IA 1WFXA 1TTYA 3HYIA 3X2QH 3Q3SA 2XSDC 1W7PB 4CGZA 1RC9A 2Z3YA 3BJOA 3M1EA 1F36A 1YW9A 5E8IA 4D1QA 1IC8A 2R7SA 4L9VA 2E36A 2VC0A 1WI9A 4D7MA 3FX3A 1HF0A 4OIQF 4EGZA 2VQCA 5D8LB 2IS1A 2ESNA 3IWZA 1YFHA 1OCCH 3GW2A 5BS6A 3JRAA 2QA4I 4HX7A 4IJAA 2KISA 4R1HA 1QHGA 4FE4A 1QA6A 4ZDOA 5A2QK 3A01A 1JUMA 3W2AA 2F2EA 4XK4A 2IJLA 2VLAA 3OIQA 2DW4A 2A07F 2CWEA 2W1OA 5AONA 5KK1A 4F7ZA 1USSA 2A69F 1BR1A 2OZ6A 1N77A 3AAFA 3C2HA 1RR7A 1SVOA 4AIDA 1ZAOA 1UELB 4KN7X 2WAFA 4WXDA 2HU9A 1G3YA 4YEJA 2DT7B 1X19A 2EILH 1MZBA 2M30A 4M74A 4I0BA 4S0HB 3R0AA 2VPRA 4XR6A 4E6KG 2F4IA 3LOCA 4HQEA 2XGCA 2MD5A 3OYKA 3A02A 4XLEA 2XB5A 2XUBA 4JQFA 2YU9J 3HGGA 3DKXA 4DBQA 4G6DA 2CO5A 3TOAA 1UJ8A 1FSEA 2B0LA 4MGRA 4ZDLA 5L3BA 3JTGA 1FNNA 2KZVA 3V7RA 1MMNA 4TV7A 1F4KA 5KAFC 4AIJA 2GOXB 4HF0A 2E1MB 3IHUA 2H1LA 1YW8A 1QVTA 1V3FA 4M6YA 4N0BA 4OOIA 2KHMA 1Z77A 4Y15A 3DBLB 2E1OA 4KDPA 1MNEA 3HUGB 3KYDB 1SANA 4JK1X 4EJTA 3CCSI 4ZYDA 2NVQJ 2ZJQF 3LQRA 3G4SI 2R3SA 2ZFWA 4ON0A 3HHHA 4B44A 3TMOA 3MCZA 5LEJA 3CTAA 1PP7U 1Z3YA 4L5JA 4MEYF 4P1WA 3CUQB 4DGWB 2M3AA 3M8EA 1QGPA 4CSWA 3HBLA 2IAIA 4D7NA 1Y8QB 1GXPA 2EBIA 2YU3A 2XF5A 4BS9A 4BY1J 1MSFC 4JOMA 5A2QZ 3F23A 2PBIA 2CG4A 3OYEA 3OYGA 3FBIB 2JSCA 2XHKA 3GF2A 3MFKA 3WTUC 1T8IA 1ZH5A 2MYSA 3IL2A 1J7KA 3HRTA 4UVBA 4A93J 2D1HA 3H3ZA 3H0GJ 2DODA 2HYJA 1SFOJ 3C18A 4B3XA 1Z6TA 1EKEA 4RBOA 2VJIA 2MD0A 2WV0A 1KU2A 4ZTFA 5BQTA 4DW6A 1IDZA 2E60A 3KIOA 1W5SA 4HLXA 4AD9A 2EIMH 2VI6A 2W84A 2X6XA 3W2WA 1JT0A 2QSFX 3FK7A 5TRDA 2V26A 4LGWA 5J1YA 3IP4B 4EJWA 2HVSA 1WZ2A 2CW7A 1ZLKA 1P4WA 3GUDA 2EQRA 3K4CA 3ZCOA 4EV0A 1TT5B 3FKIJ 1PVEA 4PZJA 2L9NA 3DBHB 5F04A 5HNFA 1XPXA 1MGTA 3LFUA 4BJ5C 2CMPA 1WJ5A 4IKFA 3HOUJ 1YRNA 3N4MA 2EZKA 2JA8J 3LAJA 1TC3C 3G2BA 3DLAA 2WTEA 2R92J 2R0QC 4G7ZF 2F48A 1X1AA 1K6OA 1T0FA 3IAM2 4IHVA 1J09A 4I09A 3WGHA 4HG2A 2JN6A 4XLPF 2L0KA 5D5VB 4LG0B 4BUPA 3K2ZA 2OTJI 4G7HF 1Z7LA 4MLOA 1RIOH 3BTJA 2ZMEB 4D5CA 3ULQB 1W5TA 3MZ8A 5HLIA 2J5PA 2V6EA 3CCQI 3LSGA 2YX7A 3S17J 3FF5A 2VJ5A 4CDGA 1O3QA 2CW8A 4ESJA 4J01A 1ZQ3P 1WRJA 2F5CA 1J9IA 2CYYA 1HOMA 2GA1A 4XORA 1BI0A 3HPHA 2FUG2 3D5LA 3O2PE 2NNYA 2UWMA 3PSFA 1BL0A 1Z67A 2VIXA 2W24A 5JFRA 1FJLA 2KJCA 3KP7A 1KQ8A 1T2KA 4YFXF 3VFZA 1MKMA 2CQKA 3E5QA 1K83J 2HPIA 2EJRA 1FP1D 3KYLA 3QYBA 2HQ5A 3UR3C 4CUGA 2IGNA 5JHFA 2IP2A 1XSVA 3HSFA 1E3OC 2HTJA 5B1AH 2R5YA 2QBYB 1ETWA 3BTIA 3ZN1A 4RGRA 2IGOA 2XV4S 1JUPA 2YPRA 3K4KA 3WU1B 4RGXA 2QEXI 2XVCA 4GGGA 3RKWA 4ENJA 3TGNA 3BC8A 4CZCA 1X2MA 1ZR2A 2OF7A 2EZHA 1V5FA 4M3GA 1FIAA 2QKLB 5L3CA 3F0CA 1LDJA 1RESA 4EM2A 1BOBA 1FMVA 4BBSJ 1ZELA 1RUNA 3BR0A 4F55A 3T5XA 3S1RJ 4IEJA 1U2WA 1BW5A 1EH8A 1JKRC 2LVSA 4V2FA 2ZSIB 3ZRGA 1I3QJ 3B02A 5ICCA 5FKKA 4MQ9F 4HNVA 4HLYA 4G7OF 2R7QA 4GRIA 1MMGA 2OUMA 1FMWA 2CRGA 3CQZJ 4XOPA 3CCVI 2ICWG 3GFLA 4DZJA 1FX7A 4FISA 5F0HA 4EM0B 2K3FA 3Q0VA 5CLSA 1MD0A 1YTYA 3RTRA 3I4MJ 3LSRA 5IT9K 5C44J 1IAWA 2LTPA 5GPCA 1PYVA 1IJWC 5FD6A 1XX5A 1ZHFA 4RA2A 3HSRA 4XLFA 1T6SA 3FXRA 3GZ6A 1U9NA 4GDFA 3IH4A 1VF9A 2DMTA 4ESBA 1J5YA 3FK6A 3IV5A 1W0UA 1BW6A 3K4LA 5M5YJ 2A6HF 2EIKH 1S7OA 2K85A 2HYFA 2Z16A 3HPGA 2GIVA 3DCFA 3A4CA 3OYFA 2DA1A 2BY1A 3H3UA 1IN8A 2DDBA 2XSJC 1WSUA 3GO5A 3HGYA 3KYCB 3MD2A 5DCMA 1MMDA 2KIFA 5IT3A 2E1MC 4Z6YA 3ABKH 2NVXJ 4IHXA 1W5CC 5K5QA 2HQRA 4NNJA 2A5WA 1FLIA 3CCJI 2GM4A 2BY0A 3M3YJ 2HZDA 4LOCA 3V8KA 1JKQC 4BEHA 2M8GX 3OR2C 2CV0A 2RGVA 1DDNA 3R60A 4OIRF 5IOZA 5KHDA 1UAAA 2Z1DA 4KICA 5GP9A 1TLHB 3I0TA 2Z9OA 4II3A 2L4AA 2EV6A 3S1MJ 2PMHA 3ML6A 4WXCA 3SXYA 1DUXC 3J7ZI 3CUQC 2WB1A 4B8XA 2CUJA 3I59A 4DYRA 5LHHA 1VQPI 1K79A 4Y17A 2XGXA 1B1BA 1R6RA 1LJ9A 3RYRA 4PK4A 1XSXA 1V4RA 3ASOH 2HXIA 4BNCA 5IT9Z 4I2OA 2E71A 1XGMA 4D9JA 2XPWA 5EGOB 1V55H 4RLQA 4RAYA 4HW0A 4P9UA 3E5UA 1U8BA 4IPAA 3TP0A 4PJLA 3GMEA 3FBNB 3H35A 5F08A 1BR2A 3KZYA 4AC0A 1TNTA 4AUXA 3IKVA 2LKXA 2DO7A 4LIVA 5F0FA 1UFMA 3HOYJ 3Q9VA 3DPUA 1U8RA 2FJ1A 1WJDA 1VZ0A 2MLGA 2D2WA 3CLOA 2DT5A 3LSJA 1M1EB 3LSMA 4IZZA 2K40A 4M71A 4E7JA 5EG0A 3PM1A 1LQ1A 3L2WA 1LKXA 3FM3A 4HQMA 3Q0UA 2RAEA 3HIFA 5TGTA 1FBQA 2DN0A 4EMSA 3PIPF 1I1GA 3G1MA 5J1UA 4UUSA 5GPAA 1PJRA 4FT8A 4DOZA 1B9MA 2GWRA 4A0YA 2LF8A 4P96A 3L1PA 3K0LA 3P5JA 5LHGA 2P7CB 3DU5A 1IRXA 2OJED 2V6CA 3S3OA 2R7VA 1P4AA 1H89C 1RI7A 1E0EA 5HDKA 4B4CA 2B7EA 3O8HA 2L5QA 3OYNA 1GUUA 3ZMTA 2UZKA 1D1BA 3J81Z 2N8GA 1IRFA 1LVAA 5B5EC 2WADA 4RLFA 1ON2A 2ZMEC 1MJ9A 2OV7A 3DPTA 2Q2EB 1CF7A 2ISZA 2DXIA 3TL4X 5L3EA 1BOAA 2MC3A 5EEGA 5HS7A 3SZPA 4FX4A 3W2VA 4XIDA 2NS8A 3BCBA 1DGRM 1LE8B 4GYGA 3GZ5A 4G9YA 1UG2A 4KIFA 3BY6A 4CCNA 1RPWA 2E2IJ 4A3EJ 4MEXF 3B6AA 3HTUA 4EATA 4XN3A 2O03A 5BPIA 1XB4A 3QPHA 3SYTA 2QKMB 3IH3A 1MBHA 4YIFA 3SHFA 1C0WA 2TCTA 3ESWB 1Z6RA 4HX8A 4XMYA 4RAGA 1LFBA 3GFMA 3PJRA 4XNFA 1TWGJ 1ZG1A 5KNLA 2OCEA 5IY5H 4MTEA 3GYHX 5J3LA 1MBEA 3MN2A 4A0ZA 1IN4A 2ADUA 4WF2A 4ZYAA 3RDIA 2PMUA 2E2HJ 5TJJA 2A6EF 4EJUA 4LK0F 4C9YA 2FQ4A 1MNDA 3FMQA 4E7ZA 2XAFA 2XF7A 4A3BJ 4MO7A 4MQVA 3ZMZA 2QVOA 4F91B 1E3HA 4N4NB 3F8NA 4FQGA 1Z3XA 1U5TC 3OOPA 2VUMJ 5K5RA 3JCUC 5BOXA 1IG7A 2CQQA 3ZMSA 3OYMA 4KISA 5DEQA 3H3VK 3WG9A 4QIWN 5FKNA 3FWEA 5FLXK 3FXKA 3PO3J 2HVRA 5DD8A 3TQNA 2CSOA 2BY2A 3I5UA 2W4SA 1B72B 2ZNYA 3J80Z 1ZK8A 3GTOJ 3S16J 3KZIC 3W6KB 1AA7A 3MAJA 1YOVB 2KFDA 4A12A 1E3PA 4A3LJ 2WWYA 4B43A 2EZIA 1D1CA 2IW5A 3TW7A 3HB9A 3O6BB 3WE3A 2AXLA 1P2FA 3A03A 1MMAA 2M9HA 1G59A 1YG2A 2LREA 2LYCA 4PGGA 3R61A 2XIGA 1VQ9I 1OPCA 2JRMA 2X6YA 4A6EA 3HOZJ 1TP4A 4V2GA 1IV6A 1D1AA 2YX4A 3Q5FA 1GDTA 2FD5A 2EK5A 2BW3A 3PIOF 5C3EJ 1PUFA 1N75A 3ZQIA 4UXNA 3BTLA 2R93J 2CV2A 2JWTA 2X1CA 2EV5A 3ZXSA 5J8FA 1XGNA 1S7EA 3EUAA 3K1PA 3FXJA 1XD7A 2DA4A 2DFFA 4M6XA 1D8JA 1NG6A 1WJFA 2ZBKA 1Y0NA 2Y30A 3A01B 1JJ6C 2BYVE 3GTKJ 3FHZA 5CJ9A 4Q48A 4A3IJ 3LFKA 3WGIA 1UCRA 1VQ6I 2BV6A 5EZGA 5E18F 2HZTA 3I9V2 2JVGA 2XGDA 2LF7A 1GVJA 1JUSA 2XASA 3DEEA 2LD5A 1BC7C 2IS2A 2DLLA 3S15J 1R9TJ 3ZQGA 2JSPA 4B3AA 1T98A 2JVHA 5CVJA 4FASD 2JA6J 4C3IJ 4S04A 4KT5C 1YI2I 1F43A 1MBFA 5EF6A 3S2WA 4CYDA 4NUBA 3A0HC 3HEFA 1TWAJ 5LGTA 5H2FC 4BQQA 3ABTA 4PFPA 3E6DA 1MBGA 5J1RA 2LR8A 1P7JA 4A5NA 4C2TA 5IP7J 3BG7A 2G9WA 3K1NA 3M1CA 3QQAA 1IXRC 2F4MB 2KKOA 2IGKA 2JPCA 3I3LA 1K6YA 2LP0A 5HS8A 2XRLA 3IAS2 1YS7A 4HNUA 4HEA2 6PAXA 2OU2A 4ABZA 1QBJA 4YELA 1T38A 1ZARA 4UVCA 3VSKA 4BJTA 4DYCA 1BI2A 3DP7A 1R36A 3BG5A 3PFYA 1Y0UA 5FLVA 1DP7P 2KPMA 5FJ8J 1WKMA 4EJOA 3P9IA 2VQLA 3M4OJ 3I71A 2EFQA 1A36A 1G3SA 3HTSB 1ERDA 2UXNA 1VNDA 2V79A 3P9KA 2VE9A 2M2EA 3OR1C 4XLHA 5K5OA 3WTTC 1YE9A 2R4GA 1K4SA 1SEUA 4IXAA 1W36D 3WTWC 4AVZA 3VDXA 1FTTA 4BH9A 5JVGF 1FC3A 4PSXA 3N05A 3ECHA 3GLXA 2FRHA 2ID3A 2QF7A 3QU6A 1FSHA 1UB9A 2ECBA 1NTCA 4RGUA 4LFUA 2P0WA 1OQYA 1K61A 4AWXB 2FNPA 5GTHC 3F8FA 3RJPA 4A3JJ 1VFCA 2QGUA 4KUMA 1Y6IA 1X2NA 2VC1A 3A1YA 1R23A 1EJ9A 2LBFA 1RKTA 4FX0A 1J75A 4G6TB 4NHJA 2K5CA 2IA0A 3S3MA 3FXQA 1FYMA 1O7FA 2MABA 3A0BC 3FXLA 3G1OA 3CESA 1JGSA 2VKEA 1AU7A 2W82A 4LIUA 5M3MJ 2VQHA 3GTGJ 1J2XA 3OYCA 3OMYA 1TW2A 1D5VA 1TWHJ 5FD5A 4CO8A 4J00A 4E7LA 4L0YB 2YR2A 1YRNB 1IGNA 1ETOA 2IS4A 3V8JA 3RQIA 3AKZA 3CCUI 5DM6F 2DOAA 1ETKA 4E7KA 1SAUA 5J4YA 5HS9A 1XG1A 2O0YA 1OYIA 2L9SA 1TQMA 2PN6A 1HW5A 3ASNH 1QNTA 2WBMA 1OLTA 1OMIA 1OCTC 5F6FA 4RS8A 2TRTA 3MWMA 3H1CA 1RZ4A 1POGA 3OOUA 5FGMA 2GXBA 4NC7A 2BHYA 3B6CA 1R5GA 2EA2A 3PSIA 4IL6C 4DQ2A 1V54H 1XC5A 2MSYA 3RI4A 1SD5A 3WU0A 2W85A 2ID6A 1W4MA 4FCYA 1WWXA 2P5VA 4HOBA 2FE3A 2LKPA 1KGSA 1RETA 4IVNA 2ZB9A 5J4VA 4HX4A 2DYSH 2XAJA 3TDUC 3SFZA 4KNYA 3WG7H 2K7LA 2DT6A 3SDGA 1B4AA 2JT1A 3VYRB 2Z5UA 1F1ZA 1RRJA 1VQMI 4YIRX 1FZPB 1UHSA 1OR7C 3OSFA 3LA3A 4A3FJ 2DJIA 3HXLA 4FE7A 5TISC 3NEUA 4Y3OA 4WK8F 2NVTJ 2R7UA 1S3JA 5L3DA 3V4GA 4BDZA 4KJZA 1XTAA 3T1BA 3GTPJ 3GTLJ 5K7ZA 2M7AA 2DOEA 2EZLA 4BJ6C 4GO1A 1AOYA 1HXDA 1ZLJA 5DV5A 4HZFA 3A2KA 1FOXA 3TDZC 4F3QA 1O3RA 2EV0A 2L7ZA 3QPSA 1YITI 2BY3A 4U0VA 2R5YB 2P4WA 2DMNA 4P5OA 1JI8A 1USTA 1WPKA 2X4HA 5F0CA 3BR1A 1R1TA 3JRIA 1TWFJ 4KMFA 3PNVA 1QQIA 3S3NA 4LD5A 2ZXJA 1K78A 3F9KA 2KRHA 4A6DA 2QQ9A 2MFZA 1G8XA 2E19A 1Y56A 3U21A 2W7NA 4L9NA 4UV9A 4U0WA 5JR3A 1RNLA 1UG0A 4LLNA 2Y75A 2P81A 1HBXG 1R22A 4UB8C 2X51A 2Y0MA 2HI3A 3QP5A 2CS3A 2X1DA 3GCMA 4BGDA 1HQCA 3H92A 3BLYA 2OPTA 2WY7Q 2WAQN 3J7AO 2EA4A 2EPFA 2XAUA 1R4MB 3CZ6A 3KFWX 1H9GA 1XCVA 2LY2A 5M3FJ 4O5VA 4PSWA 3SJMA 1H0MA 1YJNI 3I4PA 1R5HA 5D4RA 3ZQHA 1TBXA 3T8RA 2IGMA 4GFBA 2GQQA 3QWLA 3OS2A 4P55A 1XGOA 2AQEA 2PEXA 1Y1VJ 2VN2A 2ZJ2A 3FXUA 2VQGA 2H8WA 5E3MA 1ACIA 2HDCA 4LLLA 1MBKA 3VB2A 2M8EA 2FMYA 3OIPA 3LSKA 4DJAA 1NHAA 5IP6A 1ZGJA 5ED4A 3MKZA 2R7XA 2LOOA 2R7DA 2RV8A 3F6OA 4RM2A 4D5FA 2ZNZA 3ABLH 4ESFA 4JX4A 1XDSA 4A2UA 4AYBN 2MLKA 4EVIA 4G12A 4L9JA 3HSEA 4PFOA 2H8RA 1SD6A 1SMYF 4GXOA 4CCJA 4IQJA 3PFIA 4KA4A 2LSOA 1VI0A 2HPMA 3PUFA 3FXOA 4XM3A 4ZZDA 4BHPA 1BI1A 5DCMB 4U0YA 1X1PA 3CP8A 3DXJF 3ZP5A 4HPQA 1MBJA 3QYEA 3L2CA 4L9TA 1KYZA 2CW0F 2FSWA 2VKDA 2V1XA 3FM5A 3RZDJ 1QHHD 2BHZA 4QSHA 2XAQA 2IA1A 3BZCA 2COBA 4D0PA 1X3UA 4BEHB 1MDMA 2KP6A 3H0DA 4M3BA 1OCOH 4ZH4F 1X1CA 1R7JA 3RQ4A 1RUOA 1YX3A 2CV1A 1S5LC 5LLQA 4OIOF 3HKZN 5ICGA 5LD2C 5J8CA 2Y31A 5CYVA 2DA3A 2P5KA 3DTEA 3LSIA 3I56I 1JTXA 4JBAA 3WU2C 4BKXA 3ELKA 3I59B 4H4KC 2V9PA 1KZHA 2LMDA 2DMPA 3G6EI 4XLAA 2M7BA 3EUHC 3BG6A 4IO9F 1XMXA 5DDGA 2DQRA 1Z05A 1U3EM 2RVCA 1A6IA 2M0CA 3M8JA 3C2BA 3LWFA 4LG3A 3F6VA 1QRYA 1X58A 2JPBA 3VODA 2FX0A 4W1UA 3JRGA 2JZYA 4BDYA 1K4TA 3CJNA 4U88A 2RN7A 4U7BA 3S14J 2QQAA 4A69C 4ZYHA 3OL3A 4HSTA 2ELJA 2BBYA 2XKPA 1ZTRA 4GCVA 2K3PA 2PMZN 5EG0B 1FPQA 4EJVA 2JRTA 4M3EA 2H94A 2MW8A 3IC7A 3ISPA 4DIQA 4OAYA 1ITYA 4UUSB 3FMRA 2CQ7A 1V5GA 2X48A 3BP8A 4BXXJ 5K1YA 4G8XA 5IYDJ 2DQLA 2XAGA 2KQRA 3K4NA 4ANJA 5ERIA 2HFHA 2JTVA 2HTSA 1IXSB 2P8TA 4HRIA 1YS6A 2W25A 2EFOA 1YJ9I 5KVRA 1XMKA 1T0FC 3RSNA 3J81K 1DPRA 3EUKL 3F8CA 3JRCA 3W3CA 2DA6A 5KCMA 4HV5A 3VSLA 4N9HA 3E7LA 3CO7C 1CF7B 3GVAA 1R5ID 3W6JB 3I4NJ 3HM5A 2VASA 1G4DA 1OCZH 2R7OA 3U9GA 3W6VA 4LLGF 1TWCJ 5CVIA 2EFNA 3ZGKA 3AG3H 4A3CJ 5HODA 1U5TA 4OAZA 2WAEA 2VB6A 3FDYA 1UMQA 2KMUA 4M6VA 3HJEA 4JP0A 3KP4A 4CH7A 4XKCA 5CPRB 2XF6A 3L00A 5DTDA 5E3LA 4AIHA 4IX7A 1ONVA 2JA5J 3QODA 1HKQA 1KU9A 4HAMA 3KPHA 3ZPLA 5B3SH 3EETA 2G7UA 2L3DA 3RPUA 1LVKA 2JJ7A 5EZHA 2RC4A 3BDDA 4YIIA 5JVTA 1OCRH 3VOEA 2XROA 2E1CA 3EYIA 2GZWA 4I76A 3CDHA 2C6YA 1Z1DA 1APLC 2OTLI 1REPC 3AG2H 4DNCA 4L5EA 4EM1A 3IWFA 4BL0B 1YYVA 1VQNI 1LB2A 2VONA 1IN6A 3E6MA 4XKWA 3M7GA 3WHBA 5DM7F 1FYKA 5D5XB 5IP9J 4PJJA 1JJ8C 3DU6A 9ANTA 4CCLA 4LJZF 1I27A 2DA5A 3H36A 2V4JC 4XRFA 2FBIA 2UXXA 5C4JJ 1R71A 1HCRA 2ACJA 1TZLA 1IW7F 2STTA 5LFAA 4CYCA 3WTZA 1SVMA 1DU6A 2J5OA 2IXSA 2XPUA 1PUEE 3GXOA 1PDNC 4XQFA 1AHDP 3CDLA 3JAMK 4XONA 5HLGA 1WJEA 4LB5A 3J80K 1Y1WJ 1YJWI 5L3GA 1ULYA 2CU7A 2DPDA 2XGEA 1MH3A 3CF5F 3CC7I 2E7WA 2AXTC 2FBKA 2CFOA 3QRFF 3MZHA 3BT9A 5CVUA 2DJNA 4ENNA 5CQEA 2OD5A 1P7IA 5LGNA 1VQOI 4KT6A 1KONA 4ZYGA 1MSEC 3Q9SA 3KCCA 1JHFA 2HYGD 4C2MJ 3FXMA 2HEOA 3S8PA 3SQNA 3OYJA 3I55I 1VTNC 3BG3A 2CUEA 3LNQA 5LHIA 1SD4A 3PNTA 4I02A 3CD6I 2L01A 4EQQA 2Y9YA 2BEOA 1WGXA 2L9RA 3SEQA 5IPAA 3MVPA 5F1JA 3HC7A 1ZGWA 2BW3B 1PUFB 1JKPC 2Q1ZB 2FA5A 3BR3A 1I6HJ 2RQQA 2OQRA 4BXFA 5LRSA 1YX5A 2DFIA 3CLQA 4QPQA 3BQYA 3BWGA 3KZZA 3NRVA 4RGSA 1OFCX 2KLOA 4RB0A 1O3SA 1X3WB 3SEZA 4E7HA 4P9FA 4BAYA 3ZQ7A 5E8GA 2L02A 4IRIA 3BJ6A 2MC4A 1V5EA 3HOXJ 3ERMA 3H9QA 2EINH 1R49A 2E5NA 2KJBA 3MKWB 3KEYA 4NC6A 1Z7UA 5M5WJ 4W97A 3BZ6A 3QU3A 2JUCA 1ZRDA 4I6ZA 1MMSA 1AKHA 1STZA 1F9NA 2G7HA 2M45A 1YW7A 2Y0SA 3FMSA 2HOSA 2HDWA 1I50J 1QZZA 2EIJH 3S32A 3JAMZ 4O6JA 2FNAA 3JR9A 2MH9A 5E3NA 2R7ZJ 2LNBA 1OCPA 3MKYB 1CGPA 2QSHX 3HDDA 4YFNF 2LH9A 2A68F 2RKHA 1ZYRF 4IRGA 1X1BA 4PJMA 1ODDA 2HNHA 1IXCA 2ME0A 2Q0OA 3CC2I 3GFIA 2KT0A 3IRRA 2ELHA 3VYTB 5C4XJ 2STWA 2XAHA 1Z0XA 2E34A 3ZMVA 1QVUA 2DMUA 4M9XA 4ZJZA 3OYDA 3CMYA 4I0AA 3LA2A 3V8LA 3UNGC 2L54A 3ABUA 1IN5A 3KX2A 3DV8A 3I64A 4B48A 1HKSA 3ZMDA 3OS0A 2CFXA 1TW3A 3K69A 3BROA 3VWBA 3RPQA 3CCMI 2KDOA 1A04A 2IA2A 1A31A 3LSTA 2GA2A 1WI3A 2ZFUA 3QPTA 4KITB 3DLLF 3ZR8X 2ECCA 2MGQA 4X1EA 3TKYA 4ZYEA 4HYEA 5ILVA 3KP3A 3K4MA 3SFIA 2D5VA 1B8IA 1MJBA 2QM3A 5DYMA 5HVQC 2CQXA 2V7FA 2M4KA 2Y48A 4ENMA 3HRMA 2A61A 3U1DA 2ZO4A 3H5RA 2XRNA 2GXAA 2F5DA 4OINF 3DFGA 2FMLA 5LEKA 3CJQB 1YQAA 2R7TA 2V9KA 2E5ZA 3QAHA 2QYOA 4NQWA 1ZR4A 2FU4A 1U6GA 2HXOA 4HA8A 4E7SA 1NK2P 3CMAI 1G6NA 3CCEI 2KDZA 2ZJPF 5D5UB 5FKOA 1JXSA 1T33A 2Z2SB 3VYUB 1BI3A 2LBFB 3CCRI 1S72I 3D5RC 1VQ5I 2DMQA 3MZYA 3JRDA 4K2EA 5EYRA 1Z9CA 4IRHA 1WHUA 2F5EA 1J59A 2DI3A 2NS7A 1ETXA 1YO5C 2OAZA 4Y33A 2D45A 2VKVA 5F27A 2LG4A 1OR7A 1BIAA 1N25A 4PJ0C 3ONQA 2ESHA 3D5SC 4N4OB 2JQ7A 2K9QA 1OYWA 2K9SA 3WE2A 4BHCA 2DFEA 2FBHA 2O8XA 2OC6A 2M87A 4I01A 2FXAA 4CZZA 3PQKA 3AG1H 1BR4A 4XL9A 4F52A 3OYHA 3LSHA 2COMA 2Z99A 2B63J 2HDDA 2LY1A 3IH2A 4QPOA 2Y69H 5DCFA 2NVYJ 1DU0A 5D6FA 2D1VA 3C1DA 1O57A 1W0TA 3HZJA 3D1NI 2Y9ZA 1UZCA 3K2AA 2O7OA 5JLXA 3DTKA 2X6WA 1MH4A 4UB6C 2CJJA 2PX9A 3K1MA 1JGGA 1IRGA 2QUFA 1S7AA 3RKYA 3U1KA 2VPLA 3L09A 2EFPA 4JX5A 4A3DJ 2K9NA 1G2HA 4QLCU 2RQPA 2MA3A 3L2QA 4IOCF 4WXHA 3S93A 2LFBA 2RNJA 3V7CA 3O8GA 2DFHA 2ELKA 2ETHA 2R7FA 3U2RA 4Y13A 5JLWA 4RAFA 1FOKA 1QPIA 1BN5A 3WTXC 5ILUA 4UUTA 4PJNA 1DP3A 5K7FA 4MNUA 1D0YA 2DOFA 4O3MA 1I3AA 4UVAA 2I10A 2ISYA 3F3XA 3FHNA 2YS9A 4OU0A 2DAOA 5FFXA 2TDXA 1HA8A 1DPUA 2VOOA 1D0ZA 2H1KA 1X4OA 1R00A 5HNHA 3OV8A 1HSTA 4PGHA 2NS0A 3DWLE 4C30A 3CMEI 1ETVA 3FISA 3ZQQA 1SD7A 1K78B 1LNWA 2AHQA 2WA0A 1QZYA 4C3JJ 4UHTA 1L3LA 2QLZA 2X6OA 2BVLA 4BQOA 3WTYC 1ETQA 3KEQA 3K6GA 2HS5A 2RREA 3E5XA 1H9TA 5GAHJ 4L18B 5IOYA 2AQFA 1BM9A 2MBFA 3CJRB 1W1WE 4DBRA 1FIPA 1KA8A 3BQZA 3C3WA 4U87A 4S05A 2DPUA 2IRFG 3ZOBA 2M1BA 1WH5A 2W00A 2QCOA 2P6TA 3VYSB 4F93B 2AO9A 4MHGA 2R5ZA 1K7AA 2BXYA 1I39A 1ETYA 1I5ZA 5EEAA 4MIMA 3JSPA 2PJRA 1X3ZB 1X4PA 3BZKA 2P7VB 3O3KA 4IOAF 1HKTA 4DYQA 4ETSA 2VXZA 2CGPA 3IUOA 4Y4RA 1Z91A 2HQAA 4M3FA 3TOBA 1W7PA 1BJZA 1I1SA 3EYYA 1FBUA 2VT3A 1HSJA 3G73A 3GLLA 3ECOA 4ITVA 1WVRA 2HQNA 1VQKI 1SMTA 3BR6A 1HW2A 5HLHA 4LK1F 2ZXWH 4IHWA 3HG9A 3QP6A 3UKGA 5HOOA 4ZZLA 2KIQA 2VL8A 3L2UA 4KN4X 4NDLA 2PI0A 4AU7A 3EUHA 4KMUX 5CVRA 2IPQX 2EWNA 3JRFA 1QZEA 4BE1A 1LUJB 3K70D 1YLFA 2QQBA 3BPXA 3FKJA 5CKTA 2M0MA 1KU7A 3RIRA 1OYYA 2F4OB 2WB1N 3WHCA 4WX9A 3TW6A 1IO2A 1YHQI 4HDUA 4CA0A 2LC2A 4Y52J 3EQLF 2O8KA 3HHGA 3N97A 2ZSHB 3ZN0A 3S1NJ 1XS9A 4RDUA 2AS5F 1BBYA 2ZC2A 4OWRB 5AIPA 4E7IA 2JUGA 5J40A 2DA2A 1MDMB 2PLYA 3NWSA 2VJ4A 4U7DA 4DZPA 2EFWA 3OSGA 1TT0A 1YIOA 1J0RA 1WH7A 4UV8A 3E97A 4NC8A 2EB7A 1BA5A 1NK3P 4ZC3A 4BXUA 1QPMA 1GV5A 5FRNA 3OY9A 5HLTA 4M9ZA 5FLMJ 3DEWA 4KIBA 3WTSC 2H27A 1TQPA 2H6CA 3RCOA 2HWVA 4C3HJ 1VQ7I 3JRHA 1IN7A 4GYIA 3AL0B 4WWCA 3QYFA 3RKQA 3GX4X 3GFJA 3TEDA 3EPZA 4BBRJ 3PQJA 3RZOJ 2A6TA 5BNGA 3HUGA 2XPVA 1DQUA 1D8KA 1P9QC 4HNTA 2ZCWA 5HDGA 1HC8A 2IBDA 5DD4A 1QU3A 3DQVC 2OBPA 2R7RA 1FOYA 2QWWA 4PUSA 5M5XJ 2K4BA 2PG4A 2YUSA 4XOTA 3LSPA 2H6BA 3CUQA 3BPVA 2CH0A 2X0LA 3KP5A 3OYLA 3E6BA 3NARA 1ENHA 5FB2A 2FEZA 3BJAA 1T08B 5D5WB 3KETA 3E6CC 1PP8F 2VBWA 4CCKA 3CO6C 3JSOA 4FHTA 2LK2A 4KYWA 2NNNA 1SFEA 1EH7A 1XN7A 3BR5A 3ERED 1U0JA 3HRUA 1NH3A 4ENKA 1A35A 5GTIC 4A3KJ 3G1LA 4XRMA 4IHTA 1JTYA 2BVMA 2L2OA 5FO5A 3BCAA 2V9VA 1E2XA 2KRFA 3NWTA 4FTHA 2NOJB 3L7WA 2Z33A 3CDIA 1IUFA 5H20A 3J7AY 3KE2A 4AIKA 1O4XA 2A5YB 1UHWA 2W57A 5K7HA 4BU2A 4HF2A 1G3TA 2E2JJ 4XLNF 4C2UA 3RPUD 1U9OA 5BMZA 2UUZA 4XKBA 3HOWJ 2IT0A 2ZXIA 2LRDA 3I58A 3DTIA 3HL2A 1S9HA 3S1QJ 1Q1HA 4X0GA 1HDPA 1Z21A 2M34A 3P9CA 1LFUP 5GADJ 3R6SA 1T95A 2DDAA 1JHHA 2M4GA 1P92A 1KYWA 3QOEA 2O6GE 3LA7A 2VJJA 2KL4A 1GLNA 3M9AA 2HR3A 2VXDA 1U5TB 1ZGAA 3E1SA 4CCOA 1D0XA 1R1VA 2V1NA 2L9VA 3OWTA 4LG0A 1I6XA 3AFHA 3GTJJ 2PQ8A 2RDPA 5JI6A 5E1WA 5EDNA 3HOVJ 1VQ4I 2ZMEA 1B9NA 1CQTA 3ZMUA 4M72A 4YG2F 1WJBA 2NVUB 4AVPA 2L7KA 5CVVA 2LDUA 2F6CA 5ILSA 2I5UA 2JMWA 4HV6A 5H6RA 1OISA 1WJAA 2QZ8A 3ZQFA 3BR2A 1EA3A 2BOLA 2E1NA 1T39A 3BTCA 2M5WA 3H9GA 4MFEA 2Y0SN 1OJLA 1MJAA 4BQNA 2LY9A 5J47A 1JKOC 3SZGA 1LDDA 3F8MA 4NBQA 2WC2A 2DK5A 4JYKA 1ZG3A 4CICA 3L2RA 1O3TA 3CMMA 3IRQA 2MH2A 4ZDPA 2UV1A 1W36C 2GIZA 4NB5A 1UHMA 2IVMA 2GBYA 2JA2A 5ICFA 3JW4A 4XLCA 2A05A 1A5JA 2DTZA 4ZTJA 3PO2J 1DGWY 4RB1A 2LKSA 2NOGA 4RAZA 3P7NA 2XKOA 5FFZA 1TL8A 2V1UA 4L0ZB 2GOMA 3F21A 3GEZA 3E0JB 1ZG5A 2FOWA 4CYCB 2QBYA 2O61A 2P6SA 3KLNA 2VOPA 2IS6A 4II2A 3OYBA 3JREA 1LDKB 3MQ0A 3CUOA 3JRBA 1BIBA 3WTVC 1XDUA 1IV8A 5D8KB 1ZRCA 1Q1VA 2VBYA 1OKRA 4J19A 2WV1A 2E7XA 2I8DA 1VQLI 3SZTA 4HDVA 5E17F 1N78A 1A6QA 2G0EA 5KAIC 3IKTA 1B6AA 1L0OC 2L7FP 3CC4I 2CUZA 4WCGA 1D5YA 3V7SA 3RKXA 1XSDA 5EJCA 3F72A 1TNSA 4EGYA 1XGSA 4IQ4A 4I7HA 4BE0A 1XMAA 3DKYA 4BY7J 3F8BA 3TO9A 4X6AJ 3KLOA 2BZTA 1SC7A 3GTMJ 4HSRA 1D3YA 1SFUA 2X1EA 4XSZF 3LL7A 4I99C 4CHUA 3TO6A 3C2GA 1GVDA 4YFKF 3L9FA 2HVQA 1R1UA 4BACA 3ZQLA 1HDDC 3WGGA 2JK3A 3PUBA 5LGUA 2V1DA 2VODA 4PCQA 4YRVA 1ZREA 2WY8Q 4XKVA 4LB6B 2X9DA 2A3SA 1WCMJ 5E1ZB 5GAEJ 2BXZA 2WAQA 3REOA 2OZUA 4R8HA 5D6EA 1IRZA 1GV2A 2NYXA 3QOPA 4AM3A 5IYCJ 4UNOA 2XC7A 4ASNA 4BHBA 1TQIA 5AIQA 1S8NA 3E3VA 3CCLI 2QENA 3K9TA 3H5AA 2RNGA 1LEBA 3VPRA
chains in the Genus database with same CATH topology
1OCTC 2EZHA 2TRTA 2CQXA 1POGA 3OOUA 4M3GA 1FIAA 3F0CA 1RESA 3B6CA 1AKHB 4BBSJ 3BR0A 1XC5A 2MSYA 3S1RJ 4IEJA 5DS9A 1BW5A 2ID6A 1JKRC 2LVSA 4FCYA 4V2FA 1RETA 1ZR4A 1I3QJ 2HXOA 1NK2P 5FKKA 2ZB9A 4HNVA 2KDZA 2CRGA 3CQZJ 5FKOA 3SDGA 1T33A 4DZJA 4FISA 5F0HA 3GBGA 3Q0VA 3I4MJ 2DMQA 1UHSA 3LSRA 3OSFA 3JRDA 5C44J 4A3FJ 2LTPA 5EYRA 4FE7A 5E3OA 2NVTJ 5GPCA 1IJWC 1RKWA 3GTPJ 3GTLJ 5K7ZA 2NS7A 1ETXA 2D5VA 4A3GJ 2EZLA 2VKVA 5F27A 1U9NA 3IH4A 1VF9A 2DMTA 2K9QA 2L7ZA 3BG9A 3QPSA 2K9SA 3FK6A 3IV5A 2R5YB 1W0UA 1BW6A 1H8AC 2DMNA 5M5YJ 1WPKA 5F0CA 1EF4A 3BR1A 2HOTA 3JRIA 1TWFJ 5EGOA 1JT6A 2HOAA 1T56A 3DCFA 3S2DJ 2DA1A 2E19A 2B63J 1B8IB 3IH2A 2HDDA 2W48A 2NVYJ 1DU0A 4EEFG 4XRSA 3HGYA 2P81A 2XB0X 1W0TA 2HI3A 3D1NI 2Y9ZA 3K2AA 2NVXJ 2O7OA 4IHXA 5JLXA 2OPTA 1MH4A 2WAQN 2CJJA 1JGGA 2GM4A 2Y2ZA 3M3YJ 1FEXA 4LOCA 3FIWA 1JKQC 2M8GX 5M3FJ 4JX5A 4A3DJ 3SJMA 2K9NA 5IOZA 1G2HA 1U78A 2LLKA 3ZQHA 5GP9A 2LFBA 3O8GA 2ELKA 5JLWA 3S1MJ 4GFBA 3Q0WA 1QPIA 2MG4A 3TP3A 1Y1VJ 4UUTA 5E3MA 1MBKA 5K7FA 4DYRA 3S2HJ 5IP6A 2I10A 2YS9A 4D5FA 1FTZA 4MFDA 2HXIA 4JX4A 3QPLA 4AYBN 2H1KA 4G12A 2XPWA 5EGOB 1ETVA 2H8RA 3FISA 1U8BA 2AHQA 2L7MP 3TP0A 4C3JJ 2X6OA 2DA7A 1ORKA 5F08A 1GT0C 4AC0A 1VI0A 4JX6A 4AUXA 4Y7NJ 1ETQA 2LKXA 1LE8A 5F0FA 3HOYJ 4B1RA 4XICA 5IOYA 2FJ1A 1MBJA 3LSJA 1FIPA 3NAUA 3BQZA 2K40A 5EG0A 3ZOBA 3PM1A 3RZDJ 1WH5A 4QSHA 2QCOA 4XRSG 3Q0UA 2COBA 2RAEA 2DN0A 2AO9A 3G1MA 4M3BA 5J1UA 4UUSA 2R5ZA 2GLOA 2CUFA 1ETYA 5GPAA 5EEAA 4MIMA 1IDYA 3L1PA 1ZKGA 3HKZN 4DYQA 2Y31A 3ZQCA 4M3FA 4A3MJ 2DA3A 1H89C 1BJZA 3K7AJ 1JTXA 4BKXA 3GTQJ 4B4CA 3O8HA 1GUUA 2DMPA 3BR6A 4QTRA 4M3DA 1HLVA 4IHWA 2N8GA 1A6IA 2M0CA 3UKGA 2JA7J 3C2BA 5FKLA 1H88C 1QRYA 2IEKA 1X58A 4NDLA 3JRGA 2FX0A 4W1UA 3JRFA 4XIDA 3S14J 2NS8A 2ME6A 4A69C 1LE8B 3WHCA 2WB1N 1UG2A 1ZTRA 1RPWA 3TW6A 2E2IJ 3OIOA 4A3EJ 1MNMC 1B72A 4Y52J 2PMZN 5FKMA 2EH3A 2O8KA 3S1NJ 3B6AA 5EG0B 1XS9A 4RDUA 4IHYA 2O9LA 5IYBJ 3MKLA 3IH3A 4M3EA 2DA2A 2MW8A 3CCYA 1ITYA 4DZPA 1MBHA 4UUSB 2R5ZB 3OSGA 2TCTA 1WH7A 2X48A 4BXXJ 1LFBA 5IYDJ 1BA5A 1NK3P 1TWGJ 1GV5A 3Q3SA 2XSDC 5J3LA 1MBEA 5FLMJ 3MN2A 3DEWA 1F36A 1IC8A 2E2HJ 4C3HJ 3JRHA 2FQ4A 3RKQA 4D7MA 1HF0A 3TEDA 4A3BJ 4MO7A 3JRCA 2DA6A 4BBRJ 3RZOJ 5BNGA 2XPVA 3E7LA 3JRAA 2IBDA 2VUMJ 3I4NJ 3HM5A 1IG7A 4FE4A 2CQQA 3H3VK 4QIWN 5M5XJ 3W6VA 2YUSA 3A01A 1TWCJ 5FKNA 3LSPA 1JUMA 3PO3J 4XK4A 4A3CJ 5HODA 3NARA 1ENHA 1B72B 1UMQA 1ZK8A 4M6VA 3GTOJ 1RR7A 3S16J 4JP0A 5DTDA 5E3LA 4S0HB 4A3LJ 2VPRA 2LK2A 2EZIA 2JA5J 3LOCA 3BR5A 2XGCA 3A02A 2XB5A 3TW7A 2YU9J 3HGGA 3HB9A 2JJ7A 5EZHA 3G1LA 4XRMA 4A3KJ 1JTYA 3A03A 2M9HA 4I76A 1APLC 4FTHA 3HOZJ 4L5EA 4V2GA 1IV6A 1QVTA 1IUFA 1O4XA 5K7HA 1GDTA 2FD5A 1Z77A 5C3EJ 3WHBA 1PUFA 2E2JJ 3ZQIA 1U9OA 5IP9J 2E1OA 3HOWJ 3BTLA 1JJ8C 2R93J 9ANTA 1SANA 2JWTA 2DA5A 2NVQJ 1S7EA 5C4JJ 3S1QJ 2DA4A 1HDPA 2M34A 1LFUP 1HCRA 2Y30A 3A01B 1JJ6C 4CYCA 3GTKJ 1DU6A 2XPUA 1AHDP 4A3IJ 3CDLA 1Y1WJ 3HBLA 5EZGA 2CU7A 2XGEA 2XGDA 1MH3A 2IAIA 4D7NA 1JUSA 2LD5A 2EBIA 3S15J 1R9TJ 4BY1J 3ZQGA 3GTJJ 1MSFC 3BT9A 4B3AA 2JA6J 2DJNA 4C3IJ 5EDNA 3HOVJ 1P7IA 1CQTA 1MSEC 4C2MJ 1F43A 1MBFA 4A93J 5EF6A 2JMWA 3H0GJ 2HYJA 3HEFA 1SFOJ 1TWAJ 3BG3A 3BR2A 3ZQFA 2CUEA 3LNQA 4RBOA 1MBGA 3BTCA 4DW6A 4MFEA 1IDZA 2Y0SN 1OJLA 2Y9YA 2LR8A 5J1RA 1P7JA 1WGXA 2L9RA 5IPAA 5IP7J 2LY9A 3MVPA 5F1JA 1JKOC 1ZGWA 2VI6A 3QQAA 1JT0A 3FK7A 4JYKA 2LP0A 5J1YA 1PUFB 1JKPC 3BR3A 2XRLA 1I6HJ 4ABZA 2GBYA 4DYCA 3BG5A 2EQRA 2DTZA 1A5JA 5FLVA 3BQYA 3PO2J 2NOGA 1OFCX 3FKIJ 5FJ8J 5F04A 3M4OJ 3HOUJ 4CYCB 1YRNA 2EZKA 2JA8J 1TC3C 1VNDA 2R92J 2R0QC 3JREA 3JRBA 2M2EA 3HOXJ 4IHVA 1Q1VA 4J19A 2JN6A 2WV1A 2L0KA 5M5WJ 4W97A 2G0EA 1FTTA 4MLOA 3BTJA 4I6ZA 2L7FP 1AKHA 4D5CA 2ID3A 2QF7A 1D5YA 2HOSA 3LSGA 1I50J 2ECBA 1NTCA 3S17J 3JR9A 5E3NA 2R7ZJ 1K61A 1OCPA 3HDDA 1ZQ3P 4A3JJ 1VFCA 1X2NA 1HOMA 4BY7J 2ME0A 4X6AJ 2KT0A 3GTMJ 1RKTA 1BL0A 1GVDA 5C4XJ 1FJLA 3ZQLA 1Z0XA 1QVUA 2DMUA 1HDDC 2JK3A 3G1OA 3CMYA 2VKEA 1K83J 1AU7A 5M3MJ 2X9DA 3GTGJ 2HQ5A 1WCMJ 1TWHJ 1E3OC 1B8IA 1IRZA 2R5YA 1YRNB 1IGNA 1ETOA 1GV2A 3RQIA 1ETWA 3BTIA 5IYCJ 1ETKA 1JUPA 1WI3A 2ECCA 1XG1A 2MGQA 4X1EA 1X2MA 1ZR2A 3SFIA 2OF7A 3VPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCT C;  2EZH A;  2TRT A;  2CQX A;  1POG A;  3OOU A;  4M3G A;  1FIA A;  3F0C A;  1RES A;  3B6C A;  1AKH B;  4BBS J;  3BR0 A;  1XC5 A;  2MSY A;  3S1R J;  4IEJ A;  5DS9 A;  1BW5 A;  2ID6 A;  1JKR C;  2LVS A;  4FCY A;  4V2F A;  1RET A;  1ZR4 A;  1I3Q J;  2HXO A;  1NK2 P;  5FKK A;  2ZB9 A;  4HNV A;  2KDZ A;  2CRG A;  3CQZ J;  5FKO A;  3SDG A;  1T33 A;  4DZJ A;  4FIS A;  5F0H A;  3GBG A;  3Q0V A;  3I4M J;  2DMQ A;  1UHS A;  3LSR A;  3OSF A;  3JRD A;  5C44 J;  4A3F J;  2LTP A;  5EYR A;  4FE7 A;  5E3O A;  2NVT J;  5GPC A;  1IJW C;  1RKW A;  3GTP J;  3GTL J;  5K7Z A;  2NS7 A;  1ETX A;  2D5V A;  4A3G J;  2EZL A;  2VKV A;  5F27 A;  1U9N A;  3IH4 A;  1VF9 A;  2DMT A;  2K9Q A;  2L7Z A;  3BG9 A;  3QPS A;  2K9S A;  3FK6 A;  3IV5 A;  2R5Y B;  1W0U A;  1BW6 A;  1H8A C;  2DMN A;  5M5Y J;  1WPK A;  5F0C A;  1EF4 A;  3BR1 A;  2HOT A;  3JRI A;  1TWF J;  5EGO A;  1JT6 A;  2HOA A;  1T56 A;  3DCF A;  3S2D J;  2DA1 A;  2E19 A;  2B63 J;  1B8I B;  3IH2 A;  2HDD A;  2W48 A;  2NVY J;  1DU0 A;  4EEF G;  4XRS A;  3HGY A;  2P81 A;  2XB0 X;  1W0T A;  2HI3 A;  3D1N I;  2Y9Z A;  3K2A A;  2NVX J;  2O7O A;  4IHX A;  5JLX A;  2OPT A;  1MH4 A;  2WAQ N;  2CJJ A;  1JGG A;  2GM4 A;  2Y2Z A;  3M3Y J;  1FEX A;  4LOC A;  3FIW A;  1JKQ C;  2M8G X;  5M3F J;  4JX5 A;  4A3D J;  3SJM A;  2K9N A;  5IOZ A;  1G2H A;  1U78 A;  2LLK A;  3ZQH A;  5GP9 A;  2LFB A;  3O8G A;  2ELK A;  5JLW A;  3S1M J;  4GFB A;  3Q0W A;  1QPI A;  2MG4 A;  3TP3 A;  1Y1V J;  4UUT A;  5E3M A;  1MBK A;  5K7F A;  4DYR A;  3S2H J;  5IP6 A;  2I10 A;  2YS9 A;  4D5F A;  1FTZ A;  4MFD A;  2HXI A;  4JX4 A;  3QPL A;  4AYB N;  2H1K A;  4G12 A;  2XPW A;  5EGO B;  1ETV A;  2H8R A;  3FIS A;  1U8B A;  2AHQ A;  2L7M P;  3TP0 A;  4C3J J;  2X6O A;  2DA7 A;  1ORK A;  5F08 A;  1GT0 C;  4AC0 A;  1VI0 A;  4JX6 A;  4AUX A;  4Y7N J;  1ETQ A;  2LKX A;  1LE8 A;  5F0F A;  3HOY J;  4B1R A;  4XIC A;  5IOY A;  2FJ1 A;  1MBJ A;  3LSJ A;  1FIP A;  3NAU A;  3BQZ A;  2K40 A;  5EG0 A;  3ZOB A;  3PM1 A;  3RZD J;  1WH5 A;  4QSH A;  2QCO A;  4XRS G;  3Q0U A;  2COB A;  2RAE A;  2DN0 A;  2AO9 A;  3G1M A;  4M3B A;  5J1U A;  4UUS A;  2R5Z A;  2GLO A;  2CUF A;  1ETY A;  5GPA A;  5EEA A;  4MIM A;  1IDY A;  3L1P A;  1ZKG A;  3HKZ N;  4DYQ A;  2Y31 A;  3ZQC A;  4M3F A;  4A3M J;  2DA3 A;  1H89 C;  1BJZ A;  3K7A J;  1JTX A;  4BKX A;  3GTQ J;  4B4C A;  3O8H A;  1GUU A;  2DMP A;  3BR6 A;  4QTR A;  4M3D A;  1HLV A;  4IHW A;  2N8G A;  1A6I A;  2M0C A;  3UKG A;  2JA7 J;  3C2B A;  5FKL A;  1H88 C;  1QRY A;  2IEK A;  1X58 A;  4NDL A;  3JRG A;  2FX0 A;  4W1U A;  3JRF A;  4XID A;  3S14 J;  2NS8 A;  2ME6 A;  4A69 C;  1LE8 B;  3WHC A;  2WB1 N;  1UG2 A;  1ZTR A;  1RPW A;  3TW6 A;  2E2I J;  3OIO A;  4A3E J;  1MNM C;  1B72 A;  4Y52 J;  2PMZ N;  5FKM A;  2EH3 A;  2O8K A;  3S1N J;  3B6A A;  5EG0 B;  1XS9 A;  4RDU A;  4IHY A;  2O9L A;  5IYB J;  3MKL A;  3IH3 A;  4M3E A;  2DA2 A;  2MW8 A;  3CCY A;  1ITY A;  4DZP A;  1MBH A;  4UUS B;  2R5Z B;  3OSG A;  2TCT A;  1WH7 A;  2X48 A;  4BXX J;  1LFB A;  5IYD J;  1BA5 A;  1NK3 P;  1TWG J;  1GV5 A;  3Q3S A;  2XSD C;  5J3L A;  1MBE A;  5FLM J;  3MN2 A;  3DEW A;  1F36 A;  1IC8 A;  2E2H J;  4C3H J;  3JRH A;  2FQ4 A;  3RKQ A;  4D7M A;  1HF0 A;  3TED A;  4A3B J;  4MO7 A;  3JRC A;  2DA6 A;  4BBR J;  3RZO J;  5BNG A;  2XPV A;  3E7L A;  3JRA A;  2IBD A;  2VUM J;  3I4N J;  3HM5 A;  1IG7 A;  4FE4 A;  2CQQ A;  3H3V K;  4QIW N;  5M5X J;  3W6V A;  2YUS A;  3A01 A;  1TWC J;  5FKN A;  3LSP A;  1JUM A;  3PO3 J;  4XK4 A;  4A3C J;  5HOD A;  3NAR A;  1ENH A;  1B72 B;  1UMQ A;  1ZK8 A;  4M6V A;  3GTO J;  1RR7 A;  3S16 J;  4JP0 A;  5DTD A;  5E3L A;  4S0H B;  4A3L J;  2VPR A;  2LK2 A;  2EZI A;  2JA5 J;  3LOC A;  3BR5 A;  2XGC A;  3A02 A;  2XB5 A;  3TW7 A;  2YU9 J;  3HGG A;  3HB9 A;  2JJ7 A;  5EZH A;  3G1L A;  4XRM A;  4A3K J;  1JTY A;  3A03 A;  2M9H A;  4I76 A;  1APL C;  4FTH A;  3HOZ J;  4L5E A;  4V2G A;  1IV6 A;  1QVT A;  1IUF A;  1O4X A;  5K7H A;  1GDT A;  2FD5 A;  1Z77 A;  5C3E J;  3WHB A;  1PUF A;  2E2J J;  3ZQI A;  1U9O A;  5IP9 J;  2E1O A;  3HOW J;  3BTL A;  1JJ8 C;  2R93 J;  9ANT A;  1SAN A;  2JWT A;  2DA5 A;  2NVQ J;  1S7E A;  5C4J J;  3S1Q J;  2DA4 A;  1HDP A;  2M34 A;  1LFU P;  1HCR A;  2Y30 A;  3A01 B;  1JJ6 C;  4CYC A;  3GTK J;  1DU6 A;  2XPU A;  1AHD P;  4A3I J;  3CDL A;  1Y1W J;  3HBL A;  5EZG A;  2CU7 A;  2XGE A;  2XGD A;  1MH3 A;  2IAI A;  4D7N A;  1JUS A;  2LD5 A;  2EBI A;  3S15 J;  1R9T J;  4BY1 J;  3ZQG A;  3GTJ J;  1MSF C;  3BT9 A;  4B3A A;  2JA6 J;  2DJN A;  4C3I J;  5EDN A;  3HOV J;  1P7I A;  1CQT A;  1MSE C;  4C2M J;  1F43 A;  1MBF A;  4A93 J;  5EF6 A;  2JMW A;  3H0G J;  2HYJ A;  3HEF A;  1SFO J;  1TWA J;  3BG3 A;  3BR2 A;  3ZQF A;  2CUE A;  3LNQ A;  4RBO A;  1MBG A;  3BTC A;  4DW6 A;  4MFE A;  1IDZ A;  2Y0S N;  1OJL A;  2Y9Y A;  2LR8 A;  5J1R A;  1P7J A;  1WGX A;  2L9R A;  5IPA A;  5IP7 J;  2LY9 A;  3MVP A;  5F1J A;  1JKO C;  1ZGW A;  2VI6 A;  3QQA A;  1JT0 A;  3FK7 A;  4JYK A;  2LP0 A;  5J1Y A;  1PUF B;  1JKP C;  3BR3 A;  2XRL A;  1I6H J;  4ABZ A;  2GBY A;  4DYC A;  3BG5 A;  2EQR A;  2DTZ A;  1A5J A;  5FLV A;  3BQY A;  3PO2 J;  2NOG A;  1OFC X;  3FKI J;  5FJ8 J;  5F04 A;  3M4O J;  3HOU J;  4CYC B;  1YRN A;  2EZK A;  2JA8 J;  1TC3 C;  1VND A;  2R92 J;  2R0Q C;  3JRE A;  3JRB A;  2M2E A;  3HOX J;  4IHV A;  1Q1V A;  4J19 A;  2JN6 A;  2WV1 A;  2L0K A;  5M5W J;  4W97 A;  2G0E A;  1FTT A;  4MLO A;  3BTJ A;  4I6Z A;  2L7F P;  1AKH A;  4D5C A;  2ID3 A;  2QF7 A;  1D5Y A;  2HOS A;  3LSG A;  1I50 J;  2ECB A;  1NTC A;  3S17 J;  3JR9 A;  5E3N A;  2R7Z J;  1K61 A;  1OCP A;  3HDD A;  1ZQ3 P;  4A3J J;  1VFC A;  1X2N A;  1HOM A;  4BY7 J;  2ME0 A;  4X6A J;  2KT0 A;  3GTM J;  1RKT A;  1BL0 A;  1GVD A;  5C4X J;  1FJL A;  3ZQL A;  1Z0X A;  1QVU A;  2DMU A;  1HDD C;  2JK3 A;  3G1O A;  3CMY A;  2VKE A;  1K83 J;  1AU7 A;  5M3M J;  2X9D A;  3GTG J;  2HQ5 A;  1WCM J;  1TWH J;  1E3O C;  1B8I A;  1IRZ A;  2R5Y A;  1YRN B;  1IGN A;  1ETO A;  1GV2 A;  3RQI A;  1ETW A;  3BTI A;  5IYC J;  1ETK A;  1JUP A;  1WI3 A;  2ECC A;  1XG1 A;  2MGQ A;  4X1E A;  1X2M A;  1ZR2 A;  3SFI A;  2OF7 A;  3VPR A; 
#chains in the Genus database with same CATH topology
 4QWQ A;  1R58 A;  5DUI A;  2OA4 A;  2HKO A;  1FYL A;  1AKH B;  2CQN A;  3KEO A;  5F64 A;  5DS9 A;  1WQ2 A;  3K70 C;  4M9S A;  3AL0 C;  2QSG X;  2VKH A;  4Z2Y A;  5E20 A;  4KIG A;  3VEP A;  3H5N A;  5F1R A;  4AYB A;  1ON1 A;  2FF4 A;  5LRR A;  1XCB A;  2OQG A;  4B09 A;  4HBL A;  4I98 B;  3I54 A;  1B59 A;  2DTR A;  3GBG A;  4XN0 A;  1LFP A;  3T8T A;  1R4N B;  3JTH A;  5E3O A;  1RKW A;  1ZRF A;  3H9J A;  1G3W A;  1FP2 A;  3R0J A;  3J7Y J;  1IF1 A;  2P5L C;  1IUY A;  4RB3 C;  1O7L A;  5EEH A;  3OYA A;  4A3G J;  2HOE A;  5E1X A;  1X1D A;  2HKX A;  3BG9 A;  1H8A C;  2VE8 A;  3TBI A;  3D0S A;  2BGC A;  5BPD A;  3K4B A;  1EF4 A;  2HOT A;  3FZV A;  3G71 I;  5EGO A;  1RR8 C;  1JT6 A;  1AWC A;  2PJP A;  2HOA A;  3LMM A;  5CQG A;  1T56 A;  2VBX A;  3S2D J;  3BOQ A;  1EH6 A;  2FQ3 A;  3HKZ A;  4CXF A;  3OL4 A;  1B8I B;  2W48 A;  4M73 A;  2KIU A;  4BE2 A;  4EEF G;  4Q47 A;  4BYY A;  4XRS A;  2OCC H;  1S29 A;  1FBS A;  4UY8 I;  2XB0 X;  1WJC A;  2FOK A;  3M07 A;  1KQ0 A;  1Y39 A;  1NG7 A;  3F22 A;  3AG4 H;  2PFB A;  1BJA A;  3LQQ A;  1FY7 A;  3MMY B;  2NRA C;  4NQW B;  2K27 A;  3B73 A;  2Y2Z A;  4PDK A;  1SFX A;  1FEX A;  4KFC A;  4H0E A;  3FIW A;  3G3Z A;  2NAZ A;  4F92 B;  5J6X A;  2X85 A;  2VT2 A;  2K9M A;  1U78 A;  4A0X A;  1EV7 A;  2LLK A;  2F5V A;  3OYI A;  5B66 C;  4OIP F;  5H6Q A;  5JHU A;  3Q0W A;  3SDB A;  2MG4 A;  3TP3 A;  2DCE A;  3T0Y A;  3WOD F;  1KQ9 A;  1HW1 A;  3GZN B;  3K4J A;  3S2H J;  2K02 A;  2PMZ A;  1F5T A;  3RYP A;  4G94 A;  1Y8R B;  3V42 A;  1ZN2 A;  4OMY A;  2BE5 F;  1FTZ A;  3OS1 A;  4MFD A;  4MTD A;  3QPL A;  1GHC A;  2Q2E A;  2VBZ A;  2ZXH A;  2DBB A;  2L7M P;  3HRS A;  4XSX F;  2DA7 A;  1ORK A;  2DK8 A;  2XDV A;  1GT0 C;  1FOW A;  2E35 A;  2KIM A;  3COA C;  4JX6 A;  2K4J A;  2NXN B;  4Y7N J;  1LE8 A;  2B9S A;  1IZ1 A;  4B1R A;  4XIC A;  2DU9 A;  2L4M A;  2DYR H;  3LAP A;  3NAU A;  2YSR A;  3GWZ A;  1SVL A;  1GXQ A;  3NQO A;  4V19 K;  5L3F A;  4XRS G;  4BQA A;  4LMY A;  2O5R A;  1YIJ I;  4A5M A;  2HGC A;  2KRC A;  1E17 A;  5FRO A;  2GLO A;  2CUF A;  3L2V A;  2ZKZ A;  4FET A;  4G6Q A;  5HDN A;  1IDY A;  4B47 A;  1P4X A;  1FT9 A;  3PL8 A;  4E4H A;  3DPL C;  1ZKG A;  4N9I A;  3ABM H;  5GAG J;  1LEA A;  3KP2 A;  5DUK A;  3ZQC A;  4A3M J;  5FRM A;  4UUV A;  4E70 A;  3K7A J;  1KU3 A;  3GTQ J;  3I53 A;  2O3F A;  4RM3 A;  4XBF A;  3CF2 A;  5E79 C;  4QTR A;  4HF1 A;  4LIT A;  4M3D A;  2QQ8 A;  3C7J A;  1HLV A;  3EDP A;  3ROU A;  3DKW A;  2JA7 J;  2H09 A;  1S6L A;  3DEU A;  2K9L A;  1W7P D;  2GAU A;  5FKL A;  1H88 C;  3DBR B;  3CP2 A;  4RMN A;  3TO7 A;  2IEK A;  4OMZ A;  5D4S A;  4RB2 C;  3HOT A;  4IHS A;  2Q8K A;  2GXG A;  4R79 A;  2ZJR F;  1P6R A;  2ME6 A;  1VQ8 I;  3M8F A;  5FLX Z;  4IF4 A;  5LBQ A;  4Q4Z F;  3MEX A;  1SFK A;  4Q5S F;  5B1B H;  3OIO A;  1JE8 A;  1MNM C;  1B72 A;  1FWZ A;  5FKM A;  2EH3 A;  4CCM A;  3CJT B;  4IHY A;  2O9L A;  2KZG A;  5IYB J;  5ICE A;  3MKL A;  3DF8 A;  1BC8 C;  3PNY A;  1SAX A;  3K10 A;  3CCY A;  1QO0 D;  2K86 A;  3HOS A;  2R7W A;  2R5Z B;  1MW7 A;  1MIJ A;  2F5F A;  3R4K A;  1LPQ A;  2PJR B;  3KP6 A;  4L5I A;  1WFX A;  1TTY A;  3HYI A;  3X2Q H;  3Q3S A;  2XSD C;  1W7P B;  4CGZ A;  1RC9 A;  2Z3Y A;  3BJO A;  3M1E A;  1F36 A;  1YW9 A;  5E8I A;  4D1Q A;  1IC8 A;  2R7S A;  4L9V A;  2E36 A;  2VC0 A;  1WI9 A;  4D7M A;  3FX3 A;  1HF0 A;  4OIQ F;  4EGZ A;  2VQC A;  5D8L B;  2IS1 A;  2ESN A;  3IWZ A;  1YFH A;  1OCC H;  3GW2 A;  5BS6 A;  3JRA A;  2QA4 I;  4HX7 A;  4IJA A;  2KIS A;  4R1H A;  1QHG A;  4FE4 A;  1QA6 A;  4ZDO A;  5A2Q K;  3A01 A;  1JUM A;  3W2A A;  2F2E A;  4XK4 A;  2IJL A;  2VLA A;  3OIQ A;  2DW4 A;  2A07 F;  2CWE A;  2W1O A;  5AON A;  5KK1 A;  4F7Z A;  1USS A;  2A69 F;  1BR1 A;  2OZ6 A;  1N77 A;  3AAF A;  3C2H A;  1RR7 A;  1SVO A;  4AID A;  1ZAO A;  1UEL B;  4KN7 X;  2WAF A;  4WXD A;  2HU9 A;  1G3Y A;  4YEJ A;  2DT7 B;  1X19 A;  2EIL H;  1MZB A;  2M30 A;  4M74 A;  4I0B A;  4S0H B;  3R0A A;  2VPR A;  4XR6 A;  4E6K G;  2F4I A;  3LOC A;  4HQE A;  2XGC A;  2MD5 A;  3OYK A;  3A02 A;  4XLE A;  2XB5 A;  2XUB A;  4JQF A;  2YU9 J;  3HGG A;  3DKX A;  4DBQ A;  4G6D A;  2CO5 A;  3TOA A;  1UJ8 A;  1FSE A;  2B0L A;  4MGR A;  4ZDL A;  5L3B A;  3JTG A;  1FNN A;  2KZV A;  3V7R A;  1MMN A;  4TV7 A;  1F4K A;  5KAF C;  4AIJ A;  2GOX B;  4HF0 A;  2E1M B;  3IHU A;  2H1L A;  1YW8 A;  1QVT A;  1V3F A;  4M6Y A;  4N0B A;  4OOI A;  2KHM A;  1Z77 A;  4Y15 A;  3DBL B;  2E1O A;  4KDP A;  1MNE A;  3HUG B;  3KYD B;  1SAN A;  4JK1 X;  4EJT A;  3CCS I;  4ZYD A;  2NVQ J;  2ZJQ F;  3LQR A;  3G4S I;  2R3S A;  2ZFW A;  4ON0 A;  3HHH A;  4B44 A;  3TMO A;  3MCZ A;  5LEJ A;  3CTA A;  1PP7 U;  1Z3Y A;  4L5J A;  4MEY F;  4P1W A;  3CUQ B;  4DGW B;  2M3A A;  3M8E A;  1QGP A;  4CSW A;  3HBL A;  2IAI A;  4D7N A;  1Y8Q B;  1GXP A;  2EBI A;  2YU3 A;  2XF5 A;  4BS9 A;  4BY1 J;  1MSF C;  4JOM A;  5A2Q Z;  3F23 A;  2PBI A;  2CG4 A;  3OYE A;  3OYG A;  3FBI B;  2JSC A;  2XHK A;  3GF2 A;  3MFK A;  3WTU C;  1T8I A;  1ZH5 A;  2MYS A;  3IL2 A;  1J7K A;  3HRT A;  4UVB A;  4A93 J;  2D1H A;  3H3Z A;  3H0G J;  2DOD A;  2HYJ A;  1SFO J;  3C18 A;  4B3X A;  1Z6T A;  1EKE A;  4RBO A;  2VJI A;  2MD0 A;  2WV0 A;  1KU2 A;  4ZTF A;  5BQT A;  4DW6 A;  1IDZ A;  2E60 A;  3KIO A;  1W5S A;  4HLX A;  4AD9 A;  2EIM H;  2VI6 A;  2W84 A;  2X6X A;  3W2W A;  1JT0 A;  2QSF X;  3FK7 A;  5TRD A;  2V26 A;  4LGW A;  5J1Y A;  3IP4 B;  4EJW A;  2HVS A;  1WZ2 A;  2CW7 A;  1ZLK A;  1P4W A;  3GUD A;  2EQR A;  3K4C A;  3ZCO A;  4EV0 A;  1TT5 B;  3FKI J;  1PVE A;  4PZJ A;  2L9N A;  3DBH B;  5F04 A;  5HNF A;  1XPX A;  1MGT A;  3LFU A;  4BJ5 C;  2CMP A;  1WJ5 A;  4IKF A;  3HOU J;  1YRN A;  3N4M A;  2EZK A;  2JA8 J;  3LAJ A;  1TC3 C;  3G2B A;  3DLA A;  2WTE A;  2R92 J;  2R0Q C;  4G7Z F;  2F48 A;  1X1A A;  1K6O A;  1T0F A;  3IAM 2;  4IHV A;  1J09 A;  4I09 A;  3WGH A;  4HG2 A;  2JN6 A;  4XLP F;  2L0K A;  5D5V B;  4LG0 B;  4BUP A;  3K2Z A;  2OTJ I;  4G7H F;  1Z7L A;  4MLO A;  1RIO H;  3BTJ A;  2ZME B;  4D5C A;  3ULQ B;  1W5T A;  3MZ8 A;  5HLI A;  2J5P A;  2V6E A;  3CCQ I;  3LSG A;  2YX7 A;  3S17 J;  3FF5 A;  2VJ5 A;  4CDG A;  1O3Q A;  2CW8 A;  4ESJ A;  4J01 A;  1ZQ3 P;  1WRJ A;  2F5C A;  1J9I A;  2CYY A;  1HOM A;  2GA1 A;  4XOR A;  1BI0 A;  3HPH A;  2FUG 2;  3D5L A;  3O2P E;  2NNY A;  2UWM A;  3PSF A;  1BL0 A;  1Z67 A;  2VIX A;  2W24 A;  5JFR A;  1FJL A;  2KJC A;  3KP7 A;  1KQ8 A;  1T2K A;  4YFX F;  3VFZ A;  1MKM A;  2CQK A;  3E5Q A;  1K83 J;  2HPI A;  2EJR A;  1FP1 D;  3KYL A;  3QYB A;  2HQ5 A;  3UR3 C;  4CUG A;  2IGN A;  5JHF A;  2IP2 A;  1XSV A;  3HSF A;  1E3O C;  2HTJ A;  5B1A H;  2R5Y A;  2QBY B;  1ETW A;  3BTI A;  3ZN1 A;  4RGR A;  2IGO A;  2XV4 S;  1JUP A;  2YPR A;  3K4K A;  3WU1 B;  4RGX A;  2QEX I;  2XVC A;  4GGG A;  3RKW A;  4ENJ A;  3TGN A;  3BC8 A;  4CZC A;  1X2M A;  1ZR2 A;  2OF7 A;  2EZH A;  1V5F A;  4M3G A;  1FIA A;  2QKL B;  5L3C A;  3F0C A;  1LDJ A;  1RES A;  4EM2 A;  1BOB A;  1FMV A;  4BBS J;  1ZEL A;  1RUN A;  3BR0 A;  4F55 A;  3T5X A;  3S1R J;  4IEJ A;  1U2W A;  1BW5 A;  1EH8 A;  1JKR C;  2LVS A;  4V2F A;  2ZSI B;  3ZRG A;  1I3Q J;  3B02 A;  5ICC A;  5FKK A;  4MQ9 F;  4HNV A;  4HLY A;  4G7O F;  2R7Q A;  4GRI A;  1MMG A;  2OUM A;  1FMW A;  2CRG A;  3CQZ J;  4XOP A;  3CCV I;  2ICW G;  3GFL A;  4DZJ A;  1FX7 A;  4FIS A;  5F0H A;  4EM0 B;  2K3F A;  3Q0V A;  5CLS A;  1MD0 A;  1YTY A;  3RTR A;  3I4M J;  3LSR A;  5IT9 K;  5C44 J;  1IAW A;  2LTP A;  5GPC A;  1PYV A;  1IJW C;  5FD6 A;  1XX5 A;  1ZHF A;  4RA2 A;  3HSR A;  4XLF A;  1T6S A;  3FXR A;  3GZ6 A;  1U9N A;  4GDF A;  3IH4 A;  1VF9 A;  2DMT A;  4ESB A;  1J5Y A;  3FK6 A;  3IV5 A;  1W0U A;  1BW6 A;  3K4L A;  5M5Y J;  2A6H F;  2EIK H;  1S7O A;  2K85 A;  2HYF A;  2Z16 A;  3HPG A;  2GIV A;  3DCF A;  3A4C A;  3OYF A;  2DA1 A;  2BY1 A;  3H3U A;  1IN8 A;  2DDB A;  2XSJ C;  1WSU A;  3GO5 A;  3HGY A;  3KYC B;  3MD2 A;  5DCM A;  1MMD A;  2KIF A;  5IT3 A;  2E1M C;  4Z6Y A;  3ABK H;  2NVX J;  4IHX A;  1W5C C;  5K5Q A;  2HQR A;  4NNJ A;  2A5W A;  1FLI A;  3CCJ I;  2GM4 A;  2BY0 A;  3M3Y J;  2HZD A;  4LOC A;  3V8K A;  1JKQ C;  4BEH A;  2M8G X;  3OR2 C;  2CV0 A;  2RGV A;  1DDN A;  3R60 A;  4OIR F;  5IOZ A;  5KHD A;  1UAA A;  2Z1D A;  4KIC A;  5GP9 A;  1TLH B;  3I0T A;  2Z9O A;  4II3 A;  2L4A A;  2EV6 A;  3S1M J;  2PMH A;  3ML6 A;  4WXC A;  3SXY A;  1DUX C;  3J7Z I;  3CUQ C;  2WB1 A;  4B8X A;  2CUJ A;  3I59 A;  4DYR A;  5LHH A;  1VQP I;  1K79 A;  4Y17 A;  2XGX A;  1B1B A;  1R6R A;  1LJ9 A;  3RYR A;  4PK4 A;  1XSX A;  1V4R A;  3ASO H;  2HXI A;  4BNC A;  5IT9 Z;  4I2O A;  2E71 A;  1XGM A;  4D9J A;  2XPW A;  5EGO B;  1V55 H;  4RLQ A;  4RAY A;  4HW0 A;  4P9U A;  3E5U A;  1U8B A;  4IPA A;  3TP0 A;  4PJL A;  3GME A;  3FBN B;  3H35 A;  5F08 A;  1BR2 A;  3KZY A;  4AC0 A;  1TNT A;  4AUX A;  3IKV A;  2LKX A;  2DO7 A;  4LIV A;  5F0F A;  1UFM A;  3HOY J;  3Q9V A;  3DPU A;  1U8R A;  2FJ1 A;  1WJD A;  1VZ0 A;  2MLG A;  2D2W A;  3CLO A;  2DT5 A;  3LSJ A;  1M1E B;  3LSM A;  4IZZ A;  2K40 A;  4M71 A;  4E7J A;  5EG0 A;  3PM1 A;  1LQ1 A;  3L2W A;  1LKX A;  3FM3 A;  4HQM A;  3Q0U A;  2RAE A;  3HIF A;  5TGT A;  1FBQ A;  2DN0 A;  4EMS A;  3PIP F;  1I1G A;  3G1M A;  5J1U A;  4UUS A;  5GPA A;  1PJR A;  4FT8 A;  4DOZ A;  1B9M A;  2GWR A;  4A0Y A;  2LF8 A;  4P96 A;  3L1P A;  3K0L A;  3P5J A;  5LHG A;  2P7C B;  3DU5 A;  1IRX A;  2OJE D;  2V6C A;  3S3O A;  2R7V A;  1P4A A;  1H89 C;  1RI7 A;  1E0E A;  5HDK A;  4B4C A;  2B7E A;  3O8H A;  2L5Q A;  3OYN A;  1GUU A;  3ZMT A;  2UZK A;  1D1B A;  3J81 Z;  2N8G A;  1IRF A;  1LVA A;  5B5E C;  2WAD A;  4RLF A;  1ON2 A;  2ZME C;  1MJ9 A;  2OV7 A;  3DPT A;  2Q2E B;  1CF7 A;  2ISZ A;  2DXI A;  3TL4 X;  5L3E A;  1BOA A;  2MC3 A;  5EEG A;  5HS7 A;  3SZP A;  4FX4 A;  3W2V A;  4XID A;  2NS8 A;  3BCB A;  1DGR M;  1LE8 B;  4GYG A;  3GZ5 A;  4G9Y A;  1UG2 A;  4KIF A;  3BY6 A;  4CCN A;  1RPW A;  2E2I J;  4A3E J;  4MEX F;  3B6A A;  3HTU A;  4EAT A;  4XN3 A;  2O03 A;  5BPI A;  1XB4 A;  3QPH A;  3SYT A;  2QKM B;  3IH3 A;  1MBH A;  4YIF A;  3SHF A;  1C0W A;  2TCT A;  3ESW B;  1Z6R A;  4HX8 A;  4XMY A;  4RAG A;  1LFB A;  3GFM A;  3PJR A;  4XNF A;  1TWG J;  1ZG1 A;  5KNL A;  2OCE A;  5IY5 H;  4MTE A;  3GYH X;  5J3L A;  1MBE A;  3MN2 A;  4A0Z A;  1IN4 A;  2ADU A;  4WF2 A;  4ZYA A;  3RDI A;  2PMU A;  2E2H J;  5TJJ A;  2A6E F;  4EJU A;  4LK0 F;  4C9Y A;  2FQ4 A;  1MND A;  3FMQ A;  4E7Z A;  2XAF A;  2XF7 A;  4A3B J;  4MO7 A;  4MQV A;  3ZMZ A;  2QVO A;  4F91 B;  1E3H A;  4N4N B;  3F8N A;  4FQG A;  1Z3X A;  1U5T C;  3OOP A;  2VUM J;  5K5R A;  3JCU C;  5BOX A;  1IG7 A;  2CQQ A;  3ZMS A;  3OYM A;  4KIS A;  5DEQ A;  3H3V K;  3WG9 A;  4QIW N;  5FKN A;  3FWE A;  5FLX K;  3FXK A;  3PO3 J;  2HVR A;  5DD8 A;  3TQN A;  2CSO A;  2BY2 A;  3I5U A;  2W4S A;  1B72 B;  2ZNY A;  3J80 Z;  1ZK8 A;  3GTO J;  3S16 J;  3KZI C;  3W6K B;  1AA7 A;  3MAJ A;  1YOV B;  2KFD A;  4A12 A;  1E3P A;  4A3L J;  2WWY A;  4B43 A;  2EZI A;  1D1C A;  2IW5 A;  3TW7 A;  3HB9 A;  3O6B B;  3WE3 A;  2AXL A;  1P2F A;  3A03 A;  1MMA A;  2M9H A;  1G59 A;  1YG2 A;  2LRE A;  2LYC A;  4PGG A;  3R61 A;  2XIG A;  1VQ9 I;  1OPC A;  2JRM A;  2X6Y A;  4A6E A;  3HOZ J;  1TP4 A;  4V2G A;  1IV6 A;  1D1A A;  2YX4 A;  3Q5F A;  1GDT A;  2FD5 A;  2EK5 A;  2BW3 A;  3PIO F;  5C3E J;  1PUF A;  1N75 A;  3ZQI A;  4UXN A;  3BTL A;  2R93 J;  2CV2 A;  2JWT A;  2X1C A;  2EV5 A;  3ZXS A;  5J8F A;  1XGN A;  1S7E A;  3EUA A;  3K1P A;  3FXJ A;  1XD7 A;  2DA4 A;  2DFF A;  4M6X A;  1D8J A;  1NG6 A;  1WJF A;  2ZBK A;  1Y0N A;  2Y30 A;  3A01 B;  1JJ6 C;  2BYV E;  3GTK J;  3FHZ A;  5CJ9 A;  4Q48 A;  4A3I J;  3LFK A;  3WGI A;  1UCR A;  1VQ6 I;  2BV6 A;  5EZG A;  5E18 F;  2HZT A;  3I9V 2;  2JVG A;  2XGD A;  2LF7 A;  1GVJ A;  1JUS A;  2XAS A;  3DEE A;  2LD5 A;  1BC7 C;  2IS2 A;  2DLL A;  3S15 J;  1R9T J;  3ZQG A;  2JSP A;  4B3A A;  1T98 A;  2JVH A;  5CVJ A;  4FAS D;  2JA6 J;  4C3I J;  4S04 A;  4KT5 C;  1YI2 I;  1F43 A;  1MBF A;  5EF6 A;  3S2W A;  4CYD A;  4NUB A;  3A0H C;  3HEF A;  1TWA J;  5LGT A;  5H2F C;  4BQQ A;  3ABT A;  4PFP A;  3E6D A;  1MBG A;  5J1R A;  2LR8 A;  1P7J A;  4A5N A;  4C2T A;  5IP7 J;  3BG7 A;  2G9W A;  3K1N A;  3M1C A;  3QQA A;  1IXR C;  2F4M B;  2KKO A;  2IGK A;  2JPC A;  3I3L A;  1K6Y A;  2LP0 A;  5HS8 A;  2XRL A;  3IAS 2;  1YS7 A;  4HNU A;  4HEA 2;  6PAX A;  2OU2 A;  4ABZ A;  1QBJ A;  4YEL A;  1T38 A;  1ZAR A;  4UVC A;  3VSK A;  4BJT A;  4DYC A;  1BI2 A;  3DP7 A;  1R36 A;  3BG5 A;  3PFY A;  1Y0U A;  5FLV A;  1DP7 P;  2KPM A;  5FJ8 J;  1WKM A;  4EJO A;  3P9I A;  2VQL A;  3M4O J;  3I71 A;  2EFQ A;  1A36 A;  1G3S A;  3HTS B;  1ERD A;  2UXN A;  1VND A;  2V79 A;  3P9K A;  2VE9 A;  2M2E A;  3OR1 C;  4XLH A;  5K5O A;  3WTT C;  1YE9 A;  2R4G A;  1K4S A;  1SEU A;  4IXA A;  1W36 D;  3WTW C;  4AVZ A;  3VDX A;  1FTT A;  4BH9 A;  5JVG F;  1FC3 A;  4PSX A;  3N05 A;  3ECH A;  3GLX A;  2FRH A;  2ID3 A;  2QF7 A;  3QU6 A;  1FSH A;  1UB9 A;  2ECB A;  1NTC A;  4RGU A;  4LFU A;  2P0W A;  1OQY A;  1K61 A;  4AWX B;  2FNP A;  5GTH C;  3F8F A;  3RJP A;  4A3J J;  1VFC A;  2QGU A;  4KUM A;  1Y6I A;  1X2N A;  2VC1 A;  3A1Y A;  1R23 A;  1EJ9 A;  2LBF A;  1RKT A;  4FX0 A;  1J75 A;  4G6T B;  4NHJ A;  2K5C A;  2IA0 A;  3S3M A;  3FXQ A;  1FYM A;  1O7F A;  2MAB A;  3A0B C;  3FXL A;  3G1O A;  3CES A;  1JGS A;  2VKE A;  1AU7 A;  2W82 A;  4LIU A;  5M3M J;  2VQH A;  3GTG J;  1J2X A;  3OYC A;  3OMY A;  1TW2 A;  1D5V A;  1TWH J;  5FD5 A;  4CO8 A;  4J00 A;  4E7L A;  4L0Y B;  2YR2 A;  1YRN B;  1IGN A;  1ETO A;  2IS4 A;  3V8J A;  3RQI A;  3AKZ A;  3CCU I;  5DM6 F;  2DOA A;  1ETK A;  4E7K A;  1SAU A;  5J4Y A;  5HS9 A;  1XG1 A;  2O0Y A;  1OYI A;  2L9S A;  1TQM A;  2PN6 A;  1HW5 A;  3ASN H;  1QNT A;  2WBM A;  1OLT A;  1OMI A;  1OCT C;  5F6F A;  4RS8 A;  2TRT A;  3MWM A;  3H1C A;  1RZ4 A;  1POG A;  3OOU A;  5FGM A;  2GXB A;  4NC7 A;  2BHY A;  3B6C A;  1R5G A;  2EA2 A;  3PSI A;  4IL6 C;  4DQ2 A;  1V54 H;  1XC5 A;  2MSY A;  3RI4 A;  1SD5 A;  3WU0 A;  2W85 A;  2ID6 A;  1W4M A;  4FCY A;  1WWX A;  2P5V A;  4HOB A;  2FE3 A;  2LKP A;  1KGS A;  1RET A;  4IVN A;  2ZB9 A;  5J4V A;  4HX4 A;  2DYS H;  2XAJ A;  3TDU C;  3SFZ A;  4KNY A;  3WG7 H;  2K7L A;  2DT6 A;  3SDG A;  1B4A A;  2JT1 A;  3VYR B;  2Z5U A;  1F1Z A;  1RRJ A;  1VQM I;  4YIR X;  1FZP B;  1UHS A;  1OR7 C;  3OSF A;  3LA3 A;  4A3F J;  2DJI A;  3HXL A;  4FE7 A;  5TIS C;  3NEU A;  4Y3O A;  4WK8 F;  2NVT J;  2R7U A;  1S3J A;  5L3D A;  3V4G A;  4BDZ A;  4KJZ A;  1XTA A;  3T1B A;  3GTP J;  3GTL J;  5K7Z A;  2M7A A;  2DOE A;  2EZL A;  4BJ6 C;  4GO1 A;  1AOY A;  1HXD A;  1ZLJ A;  5DV5 A;  4HZF A;  3A2K A;  1FOX A;  3TDZ C;  4F3Q A;  1O3R A;  2EV0 A;  2L7Z A;  3QPS A;  1YIT I;  2BY3 A;  4U0V A;  2R5Y B;  2P4W A;  2DMN A;  4P5O A;  1JI8 A;  1UST A;  1WPK A;  2X4H A;  5F0C A;  3BR1 A;  1R1T A;  3JRI A;  1TWF J;  4KMF A;  3PNV A;  1QQI A;  3S3N A;  4LD5 A;  2ZXJ A;  1K78 A;  3F9K A;  2KRH A;  4A6D A;  2QQ9 A;  2MFZ A;  1G8X A;  2E19 A;  1Y56 A;  3U21 A;  2W7N A;  4L9N A;  4UV9 A;  4U0W A;  5JR3 A;  1RNL A;  1UG0 A;  4LLN A;  2Y75 A;  2P81 A;  1HBX G;  1R22 A;  4UB8 C;  2X51 A;  2Y0M A;  2HI3 A;  3QP5 A;  2CS3 A;  2X1D A;  3GCM A;  4BGD A;  1HQC A;  3H92 A;  3BLY A;  2OPT A;  2WY7 Q;  2WAQ N;  3J7A O;  2EA4 A;  2EPF A;  2XAU A;  1R4M B;  3CZ6 A;  3KFW X;  1H9G A;  1XCV A;  2LY2 A;  5M3F J;  4O5V A;  4PSW A;  3SJM A;  1H0M A;  1YJN I;  3I4P A;  1R5H A;  5D4R A;  3ZQH A;  1TBX A;  3T8R A;  2IGM A;  4GFB A;  2GQQ A;  3QWL A;  3OS2 A;  4P55 A;  1XGO A;  2AQE A;  2PEX A;  1Y1V J;  2VN2 A;  2ZJ2 A;  3FXU A;  2VQG A;  2H8W A;  5E3M A;  1ACI A;  2HDC A;  4LLL A;  1MBK A;  3VB2 A;  2M8E A;  2FMY A;  3OIP A;  3LSK A;  4DJA A;  1NHA A;  5IP6 A;  1ZGJ A;  5ED4 A;  3MKZ A;  2R7X A;  2LOO A;  2R7D A;  2RV8 A;  3F6O A;  4RM2 A;  4D5F A;  2ZNZ A;  3ABL H;  4ESF A;  4JX4 A;  1XDS A;  4A2U A;  4AYB N;  2MLK A;  4EVI A;  4G12 A;  4L9J A;  3HSE A;  4PFO A;  2H8R A;  1SD6 A;  1SMY F;  4GXO A;  4CCJ A;  4IQJ A;  3PFI A;  4KA4 A;  2LSO A;  1VI0 A;  2HPM A;  3PUF A;  3FXO A;  4XM3 A;  4ZZD A;  4BHP A;  1BI1 A;  5DCM B;  4U0Y A;  1X1P A;  3CP8 A;  3DXJ F;  3ZP5 A;  4HPQ A;  1MBJ A;  3QYE A;  3L2C A;  4L9T A;  1KYZ A;  2CW0 F;  2FSW A;  2VKD A;  2V1X A;  3FM5 A;  3RZD J;  1QHH D;  2BHZ A;  4QSH A;  2XAQ A;  2IA1 A;  3BZC A;  2COB A;  4D0P A;  1X3U A;  4BEH B;  1MDM A;  2KP6 A;  3H0D A;  4M3B A;  1OCO H;  4ZH4 F;  1X1C A;  1R7J A;  3RQ4 A;  1RUO A;  1YX3 A;  2CV1 A;  1S5L C;  5LLQ A;  4OIO F;  3HKZ N;  5ICG A;  5LD2 C;  5J8C A;  2Y31 A;  5CYV A;  2DA3 A;  2P5K A;  3DTE A;  3LSI A;  3I56 I;  1JTX A;  4JBA A;  3WU2 C;  4BKX A;  3ELK A;  3I59 B;  4H4K C;  2V9P A;  1KZH A;  2LMD A;  2DMP A;  3G6E I;  4XLA A;  2M7B A;  3EUH C;  3BG6 A;  4IO9 F;  1XMX A;  5DDG A;  2DQR A;  1Z05 A;  1U3E M;  2RVC A;  1A6I A;  2M0C A;  3M8J A;  3C2B A;  3LWF A;  4LG3 A;  3F6V A;  1QRY A;  1X58 A;  2JPB A;  3VOD A;  2FX0 A;  4W1U A;  3JRG A;  2JZY A;  4BDY A;  1K4T A;  3CJN A;  4U88 A;  2RN7 A;  4U7B A;  3S14 J;  2QQA A;  4A69 C;  4ZYH A;  3OL3 A;  4HST A;  2ELJ A;  2BBY A;  2XKP A;  1ZTR A;  4GCV A;  2K3P A;  2PMZ N;  5EG0 B;  1FPQ A;  4EJV A;  2JRT A;  4M3E A;  2H94 A;  2MW8 A;  3IC7 A;  3ISP A;  4DIQ A;  4OAY A;  1ITY A;  4UUS B;  3FMR A;  2CQ7 A;  1V5G A;  2X48 A;  3BP8 A;  4BXX J;  5K1Y A;  4G8X A;  5IYD J;  2DQL A;  2XAG A;  2KQR A;  3K4N A;  4ANJ A;  5ERI A;  2HFH A;  2JTV A;  2HTS A;  1IXS B;  2P8T A;  4HRI A;  1YS6 A;  2W25 A;  2EFO A;  1YJ9 I;  5KVR A;  1XMK A;  1T0F C;  3RSN A;  3J81 K;  1DPR A;  3EUK L;  3F8C A;  3JRC A;  3W3C A;  2DA6 A;  5KCM A;  4HV5 A;  3VSL A;  4N9H A;  3E7L A;  3CO7 C;  1CF7 B;  3GVA A;  1R5I D;  3W6J B;  3I4N J;  3HM5 A;  2VAS A;  1G4D A;  1OCZ H;  2R7O A;  3U9G A;  3W6V A;  4LLG F;  1TWC J;  5CVI A;  2EFN A;  3ZGK A;  3AG3 H;  4A3C J;  5HOD A;  1U5T A;  4OAZ A;  2WAE A;  2VB6 A;  3FDY A;  1UMQ A;  2KMU A;  4M6V A;  3HJE A;  4JP0 A;  3KP4 A;  4CH7 A;  4XKC A;  5CPR B;  2XF6 A;  3L00 A;  5DTD A;  5E3L A;  4AIH A;  4IX7 A;  1ONV A;  2JA5 J;  3QOD A;  1HKQ A;  1KU9 A;  4HAM A;  3KPH A;  3ZPL A;  5B3S H;  3EET A;  2G7U A;  2L3D A;  3RPU A;  1LVK A;  2JJ7 A;  5EZH A;  2RC4 A;  3BDD A;  4YII A;  5JVT A;  1OCR H;  3VOE A;  2XRO A;  2E1C A;  3EYI A;  2GZW A;  4I76 A;  3CDH A;  2C6Y A;  1Z1D A;  1APL C;  2OTL I;  1REP C;  3AG2 H;  4DNC A;  4L5E A;  4EM1 A;  3IWF A;  4BL0 B;  1YYV A;  1VQN I;  1LB2 A;  2VON A;  1IN6 A;  3E6M A;  4XKW A;  3M7G A;  3WHB A;  5DM7 F;  1FYK A;  5D5X B;  5IP9 J;  4PJJ A;  1JJ8 C;  3DU6 A;  9ANT A;  4CCL A;  4LJZ F;  1I27 A;  2DA5 A;  3H36 A;  2V4J C;  4XRF A;  2FBI A;  2UXX A;  5C4J J;  1R71 A;  1HCR A;  2ACJ A;  1TZL A;  1IW7 F;  2STT A;  5LFA A;  4CYC A;  3WTZ A;  1SVM A;  1DU6 A;  2J5O A;  2IXS A;  2XPU A;  1PUE E;  3GXO A;  1PDN C;  4XQF A;  1AHD P;  3CDL A;  3JAM K;  4XON A;  5HLG A;  1WJE A;  4LB5 A;  3J80 K;  1Y1W J;  1YJW I;  5L3G A;  1ULY A;  2CU7 A;  2DPD A;  2XGE A;  1MH3 A;  3CF5 F;  3CC7 I;  2E7W A;  2AXT C;  2FBK A;  2CFO A;  3QRF F;  3MZH A;  3BT9 A;  5CVU A;  2DJN A;  4ENN A;  5CQE A;  2OD5 A;  1P7I A;  5LGN A;  1VQO I;  4KT6 A;  1KON A;  4ZYG A;  1MSE C;  3Q9S A;  3KCC A;  1JHF A;  2HYG D;  4C2M J;  3FXM A;  2HEO A;  3S8P A;  3SQN A;  3OYJ A;  3I55 I;  1VTN C;  3BG3 A;  2CUE A;  3LNQ A;  5LHI A;  1SD4 A;  3PNT A;  4I02 A;  3CD6 I;  2L01 A;  4EQQ A;  2Y9Y A;  2BEO A;  1WGX A;  2L9R A;  3SEQ A;  5IPA A;  3MVP A;  5F1J A;  3HC7 A;  1ZGW A;  2BW3 B;  1PUF B;  1JKP C;  2Q1Z B;  2FA5 A;  3BR3 A;  1I6H J;  2RQQ A;  2OQR A;  4BXF A;  5LRS A;  1YX5 A;  2DFI A;  3CLQ A;  4QPQ A;  3BQY A;  3BWG A;  3KZZ A;  3NRV A;  4RGS A;  1OFC X;  2KLO A;  4RB0 A;  1O3S A;  1X3W B;  3SEZ A;  4E7H A;  4P9F A;  4BAY A;  3ZQ7 A;  5E8G A;  2L02 A;  4IRI A;  3BJ6 A;  2MC4 A;  1V5E A;  3HOX J;  3ERM A;  3H9Q A;  2EIN H;  1R49 A;  2E5N A;  2KJB A;  3MKW B;  3KEY A;  4NC6 A;  1Z7U A;  5M5W J;  4W97 A;  3BZ6 A;  3QU3 A;  2JUC A;  1ZRD A;  4I6Z A;  1MMS A;  1AKH A;  1STZ A;  1F9N A;  2G7H A;  2M45 A;  1YW7 A;  2Y0S A;  3FMS A;  2HOS A;  2HDW A;  1I50 J;  1QZZ A;  2EIJ H;  3S32 A;  3JAM Z;  4O6J A;  2FNA A;  3JR9 A;  2MH9 A;  5E3N A;  2R7Z J;  2LNB A;  1OCP A;  3MKY B;  1CGP A;  2QSH X;  3HDD A;  4YFN F;  2LH9 A;  2A68 F;  2RKH A;  1ZYR F;  4IRG A;  1X1B A;  4PJM A;  1ODD A;  2HNH A;  1IXC A;  2ME0 A;  2Q0O A;  3CC2 I;  3GFI A;  2KT0 A;  3IRR A;  2ELH A;  3VYT B;  5C4X J;  2STW A;  2XAH A;  1Z0X A;  2E34 A;  3ZMV A;  1QVU A;  2DMU A;  4M9X A;  4ZJZ A;  3OYD A;  3CMY A;  4I0A A;  3LA2 A;  3V8L A;  3UNG C;  2L54 A;  3ABU A;  1IN5 A;  3KX2 A;  3DV8 A;  3I64 A;  4B48 A;  1HKS A;  3ZMD A;  3OS0 A;  2CFX A;  1TW3 A;  3K69 A;  3BRO A;  3VWB A;  3RPQ A;  3CCM I;  2KDO A;  1A04 A;  2IA2 A;  1A31 A;  3LST A;  2GA2 A;  1WI3 A;  2ZFU A;  3QPT A;  4KIT B;  3DLL F;  3ZR8 X;  2ECC A;  2MGQ A;  4X1E A;  3TKY A;  4ZYE A;  4HYE A;  5ILV A;  3KP3 A;  3K4M A;  3SFI A;  2D5V A;  1B8I A;  1MJB A;  2QM3 A;  5DYM A;  5HVQ C;  2CQX A;  2V7F A;  2M4K A;  2Y48 A;  4ENM A;  3HRM A;  2A61 A;  3U1D A;  2ZO4 A;  3H5R A;  2XRN A;  2GXA A;  2F5D A;  4OIN F;  3DFG A;  2FML A;  5LEK A;  3CJQ B;  1YQA A;  2R7T A;  2V9K A;  2E5Z A;  3QAH A;  2QYO A;  4NQW A;  1ZR4 A;  2FU4 A;  1U6G A;  2HXO A;  4HA8 A;  4E7S A;  1NK2 P;  3CMA I;  1G6N A;  3CCE I;  2KDZ A;  2ZJP F;  5D5U B;  5FKO A;  1JXS A;  1T33 A;  2Z2S B;  3VYU B;  1BI3 A;  2LBF B;  3CCR I;  1S72 I;  3D5R C;  1VQ5 I;  2DMQ A;  3MZY A;  3JRD A;  4K2E A;  5EYR A;  1Z9C A;  4IRH A;  1WHU A;  2F5E A;  1J59 A;  2DI3 A;  2NS7 A;  1ETX A;  1YO5 C;  2OAZ A;  4Y33 A;  2D45 A;  2VKV A;  5F27 A;  2LG4 A;  1OR7 A;  1BIA A;  1N25 A;  4PJ0 C;  3ONQ A;  2ESH A;  3D5S C;  4N4O B;  2JQ7 A;  2K9Q A;  1OYW A;  2K9S A;  3WE2 A;  4BHC A;  2DFE A;  2FBH A;  2O8X A;  2OC6 A;  2M87 A;  4I01 A;  2FXA A;  4CZZ A;  3PQK A;  3AG1 H;  1BR4 A;  4XL9 A;  4F52 A;  3OYH A;  3LSH A;  2COM A;  2Z99 A;  2B63 J;  2HDD A;  2LY1 A;  3IH2 A;  4QPO A;  2Y69 H;  5DCF A;  2NVY J;  1DU0 A;  5D6F A;  2D1V A;  3C1D A;  1O57 A;  1W0T A;  3HZJ A;  3D1N I;  2Y9Z A;  1UZC A;  3K2A A;  2O7O A;  5JLX A;  3DTK A;  2X6W A;  1MH4 A;  4UB6 C;  2CJJ A;  2PX9 A;  3K1M A;  1JGG A;  1IRG A;  2QUF A;  1S7A A;  3RKY A;  3U1K A;  2VPL A;  3L09 A;  2EFP A;  4JX5 A;  4A3D J;  2K9N A;  1G2H A;  4QLC U;  2RQP A;  2MA3 A;  3L2Q A;  4IOC F;  4WXH A;  3S93 A;  2LFB A;  2RNJ A;  3V7C A;  3O8G A;  2DFH A;  2ELK A;  2ETH A;  2R7F A;  3U2R A;  4Y13 A;  5JLW A;  4RAF A;  1FOK A;  1QPI A;  1BN5 A;  3WTX C;  5ILU A;  4UUT A;  4PJN A;  1DP3 A;  5K7F A;  4MNU A;  1D0Y A;  2DOF A;  4O3M A;  1I3A A;  4UVA A;  2I10 A;  2ISY A;  3F3X A;  3FHN A;  2YS9 A;  4OU0 A;  2DAO A;  5FFX A;  2TDX A;  1HA8 A;  1DPU A;  2VOO A;  1D0Z A;  2H1K A;  1X4O A;  1R00 A;  5HNH A;  3OV8 A;  1HST A;  4PGH A;  2NS0 A;  3DWL E;  4C30 A;  3CME I;  1ETV A;  3FIS A;  3ZQQ A;  1SD7 A;  1K78 B;  1LNW A;  2AHQ A;  2WA0 A;  1QZY A;  4C3J J;  4UHT A;  1L3L A;  2QLZ A;  2X6O A;  2BVL A;  4BQO A;  3WTY C;  1ETQ A;  3KEQ A;  3K6G A;  2HS5 A;  2RRE A;  3E5X A;  1H9T A;  5GAH J;  4L18 B;  5IOY A;  2AQF A;  1BM9 A;  2MBF A;  3CJR B;  1W1W E;  4DBR A;  1FIP A;  1KA8 A;  3BQZ A;  3C3W A;  4U87 A;  4S05 A;  2DPU A;  2IRF G;  3ZOB A;  2M1B A;  1WH5 A;  2W00 A;  2QCO A;  2P6T A;  3VYS B;  4F93 B;  2AO9 A;  4MHG A;  2R5Z A;  1K7A A;  2BXY A;  1I39 A;  1ETY A;  1I5Z A;  5EEA A;  4MIM A;  3JSP A;  2PJR A;  1X3Z B;  1X4P A;  3BZK A;  2P7V B;  3O3K A;  4IOA F;  1HKT A;  4DYQ A;  4ETS A;  2VXZ A;  2CGP A;  3IUO A;  4Y4R A;  1Z91 A;  2HQA A;  4M3F A;  3TOB A;  1W7P A;  1BJZ A;  1I1S A;  3EYY A;  1FBU A;  2VT3 A;  1HSJ A;  3G73 A;  3GLL A;  3ECO A;  4ITV A;  1WVR A;  2HQN A;  1VQK I;  1SMT A;  3BR6 A;  1HW2 A;  5HLH A;  4LK1 F;  2ZXW H;  4IHW A;  3HG9 A;  3QP6 A;  3UKG A;  5HOO A;  4ZZL A;  2KIQ A;  2VL8 A;  3L2U A;  4KN4 X;  4NDL A;  2PI0 A;  4AU7 A;  3EUH A;  4KMU X;  5CVR A;  2IPQ X;  2EWN A;  3JRF A;  1QZE A;  4BE1 A;  1LUJ B;  3K70 D;  1YLF A;  2QQB A;  3BPX A;  3FKJ A;  5CKT A;  2M0M A;  1KU7 A;  3RIR A;  1OYY A;  2F4O B;  2WB1 N;  3WHC A;  4WX9 A;  3TW6 A;  1IO2 A;  1YHQ I;  4HDU A;  4CA0 A;  2LC2 A;  4Y52 J;  3EQL F;  2O8K A;  3HHG A;  3N97 A;  2ZSH B;  3ZN0 A;  3S1N J;  1XS9 A;  4RDU A;  2AS5 F;  1BBY A;  2ZC2 A;  4OWR B;  5AIP A;  4E7I A;  2JUG A;  5J40 A;  2DA2 A;  1MDM B;  2PLY A;  3NWS A;  2VJ4 A;  4U7D A;  4DZP A;  2EFW A;  3OSG A;  1TT0 A;  1YIO A;  1J0R A;  1WH7 A;  4UV8 A;  3E97 A;  4NC8 A;  2EB7 A;  1BA5 A;  1NK3 P;  4ZC3 A;  4BXU A;  1QPM A;  1GV5 A;  5FRN A;  3OY9 A;  5HLT A;  4M9Z A;  5FLM J;  3DEW A;  4KIB A;  3WTS C;  2H27 A;  1TQP A;  2H6C A;  3RCO A;  2HWV A;  4C3H J;  1VQ7 I;  3JRH A;  1IN7 A;  4GYI A;  3AL0 B;  4WWC A;  3QYF A;  3RKQ A;  3GX4 X;  3GFJ A;  3TED A;  3EPZ A;  4BBR J;  3PQJ A;  3RZO J;  2A6T A;  5BNG A;  3HUG A;  2XPV A;  1DQU A;  1D8K A;  1P9Q C;  4HNT A;  2ZCW A;  5HDG A;  1HC8 A;  2IBD A;  5DD4 A;  1QU3 A;  3DQV C;  2OBP A;  2R7R A;  1FOY A;  2QWW A;  4PUS A;  5M5X J;  2K4B A;  2PG4 A;  2YUS A;  4XOT A;  3LSP A;  2H6B A;  3CUQ A;  3BPV A;  2CH0 A;  2X0L A;  3KP5 A;  3OYL A;  3E6B A;  3NAR A;  1ENH A;  5FB2 A;  2FEZ A;  3BJA A;  1T08 B;  5D5W B;  3KET A;  3E6C C;  1PP8 F;  2VBW A;  4CCK A;  3CO6 C;  3JSO A;  4FHT A;  2LK2 A;  4KYW A;  2NNN A;  1SFE A;  1EH7 A;  1XN7 A;  3BR5 A;  3ERE D;  1U0J A;  3HRU A;  1NH3 A;  4ENK A;  1A35 A;  5GTI C;  4A3K J;  3G1L A;  4XRM A;  4IHT A;  1JTY A;  2BVM A;  2L2O A;  5FO5 A;  3BCA A;  2V9V A;  1E2X A;  2KRF A;  3NWT A;  4FTH A;  2NOJ B;  3L7W A;  2Z33 A;  3CDI A;  1IUF A;  5H20 A;  3J7A Y;  3KE2 A;  4AIK A;  1O4X A;  2A5Y B;  1UHW A;  2W57 A;  5K7H A;  4BU2 A;  4HF2 A;  1G3T A;  2E2J J;  4XLN F;  4C2U A;  3RPU D;  1U9O A;  5BMZ A;  2UUZ A;  4XKB A;  3HOW J;  2IT0 A;  2ZXI A;  2LRD A;  3I58 A;  3DTI A;  3HL2 A;  1S9H A;  3S1Q J;  1Q1H A;  4X0G A;  1HDP A;  1Z21 A;  2M34 A;  3P9C A;  1LFU P;  5GAD J;  3R6S A;  1T95 A;  2DDA A;  1JHH A;  2M4G A;  1P92 A;  1KYW A;  3QOE A;  2O6G E;  3LA7 A;  2VJJ A;  2KL4 A;  1GLN A;  3M9A A;  2HR3 A;  2VXD A;  1U5T B;  1ZGA A;  3E1S A;  4CCO A;  1D0X A;  1R1V A;  2V1N A;  2L9V A;  3OWT A;  4LG0 A;  1I6X A;  3AFH A;  3GTJ J;  2PQ8 A;  2RDP A;  5JI6 A;  5E1W A;  5EDN A;  3HOV J;  1VQ4 I;  2ZME A;  1B9N A;  1CQT A;  3ZMU A;  4M72 A;  4YG2 F;  1WJB A;  2NVU B;  4AVP A;  2L7K A;  5CVV A;  2LDU A;  2F6C A;  5ILS A;  2I5U A;  2JMW A;  4HV6 A;  5H6R A;  1OIS A;  1WJA A;  2QZ8 A;  3ZQF A;  3BR2 A;  1EA3 A;  2BOL A;  2E1N A;  1T39 A;  3BTC A;  2M5W A;  3H9G A;  4MFE A;  2Y0S N;  1OJL A;  1MJA A;  4BQN A;  2LY9 A;  5J47 A;  1JKO C;  3SZG A;  1LDD A;  3F8M A;  4NBQ A;  2WC2 A;  2DK5 A;  4JYK A;  1ZG3 A;  4CIC A;  3L2R A;  1O3T A;  3CMM A;  3IRQ A;  2MH2 A;  4ZDP A;  2UV1 A;  1W36 C;  2GIZ A;  4NB5 A;  1UHM A;  2IVM A;  2GBY A;  2JA2 A;  5ICF A;  3JW4 A;  4XLC A;  2A05 A;  1A5J A;  2DTZ A;  4ZTJ A;  3PO2 J;  1DGW Y;  4RB1 A;  2LKS A;  2NOG A;  4RAZ A;  3P7N A;  2XKO A;  5FFZ A;  1TL8 A;  2V1U A;  4L0Z B;  2GOM A;  3F21 A;  3GEZ A;  3E0J B;  1ZG5 A;  2FOW A;  4CYC B;  2QBY A;  2O61 A;  2P6S A;  3KLN A;  2VOP A;  2IS6 A;  4II2 A;  3OYB A;  3JRE A;  1LDK B;  3MQ0 A;  3CUO A;  3JRB A;  1BIB A;  3WTV C;  1XDU A;  1IV8 A;  5D8K B;  1ZRC A;  1Q1V A;  2VBY A;  1OKR A;  4J19 A;  2WV1 A;  2E7X A;  2I8D A;  1VQL I;  3SZT A;  4HDV A;  5E17 F;  1N78 A;  1A6Q A;  2G0E A;  5KAI C;  3IKT A;  1B6A A;  1L0O C;  2L7F P;  3CC4 I;  2CUZ A;  4WCG A;  1D5Y A;  3V7S A;  3RKX A;  1XSD A;  5EJC A;  3F72 A;  1TNS A;  4EGY A;  1XGS A;  4IQ4 A;  4I7H A;  4BE0 A;  1XMA A;  3DKY A;  4BY7 J;  3F8B A;  3TO9 A;  4X6A J;  3KLO A;  2BZT A;  1SC7 A;  3GTM J;  4HSR A;  1D3Y A;  1SFU A;  2X1E A;  4XSZ F;  3LL7 A;  4I99 C;  4CHU A;  3TO6 A;  3C2G A;  1GVD A;  4YFK F;  3L9F A;  2HVQ A;  1R1U A;  4BAC A;  3ZQL A;  1HDD C;  3WGG A;  2JK3 A;  3PUB A;  5LGU A;  2V1D A;  2VOD A;  4PCQ A;  4YRV A;  1ZRE A;  2WY8 Q;  4XKV A;  4LB6 B;  2X9D A;  2A3S A;  1WCM J;  5E1Z B;  5GAE J;  2BXZ A;  2WAQ A;  3REO A;  2OZU A;  4R8H A;  5D6E A;  1IRZ A;  1GV2 A;  2NYX A;  3QOP A;  4AM3 A;  5IYC J;  4UNO A;  2XC7 A;  4ASN A;  4BHB A;  1TQI A;  5AIQ A;  1S8N A;  3E3V A;  3CCL I;  2QEN A;  3K9T A;  3H5A A;  2RNG A;  1LEB A;  3VPR A; 
#chains in the Genus database with same CATH homology
 1OCT C;  2EZH A;  2TRT A;  2CQX A;  1POG A;  3OOU A;  4M3G A;  1FIA A;  3F0C A;  1RES A;  3B6C A;  1AKH B;  4BBS J;  3BR0 A;  1XC5 A;  2MSY A;  3S1R J;  4IEJ A;  5DS9 A;  1BW5 A;  2ID6 A;  1JKR C;  2LVS A;  4FCY A;  4V2F A;  1RET A;  1ZR4 A;  1I3Q J;  2HXO A;  1NK2 P;  5FKK A;  2ZB9 A;  4HNV A;  2KDZ A;  2CRG A;  3CQZ J;  5FKO A;  3SDG A;  1T33 A;  4DZJ A;  4FIS A;  5F0H A;  3GBG A;  3Q0V A;  3I4M J;  2DMQ A;  1UHS A;  3LSR A;  3OSF A;  3JRD A;  5C44 J;  4A3F J;  2LTP A;  5EYR A;  4FE7 A;  5E3O A;  2NVT J;  5GPC A;  1IJW C;  1RKW A;  3GTP J;  3GTL J;  5K7Z A;  2NS7 A;  1ETX A;  2D5V A;  4A3G J;  2EZL A;  2VKV A;  5F27 A;  1U9N A;  3IH4 A;  1VF9 A;  2DMT A;  2K9Q A;  2L7Z A;  3BG9 A;  3QPS A;  2K9S A;  3FK6 A;  3IV5 A;  2R5Y B;  1W0U A;  1BW6 A;  1H8A C;  2DMN A;  5M5Y J;  1WPK A;  5F0C A;  1EF4 A;  3BR1 A;  2HOT A;  3JRI A;  1TWF J;  5EGO A;  1JT6 A;  2HOA A;  1T56 A;  3DCF A;  3S2D J;  2DA1 A;  2E19 A;  2B63 J;  1B8I B;  3IH2 A;  2HDD A;  2W48 A;  2NVY J;  1DU0 A;  4EEF G;  4XRS A;  3HGY A;  2P81 A;  2XB0 X;  1W0T A;  2HI3 A;  3D1N I;  2Y9Z A;  3K2A A;  2NVX J;  2O7O A;  4IHX A;  5JLX A;  2OPT A;  1MH4 A;  2WAQ N;  2CJJ A;  1JGG A;  2GM4 A;  2Y2Z A;  3M3Y J;  1FEX A;  4LOC A;  3FIW A;  1JKQ C;  2M8G X;  5M3F J;  4JX5 A;  4A3D J;  3SJM A;  2K9N A;  5IOZ A;  1G2H A;  1U78 A;  2LLK A;  3ZQH A;  5GP9 A;  2LFB A;  3O8G A;  2ELK A;  5JLW A;  3S1M J;  4GFB A;  3Q0W A;  1QPI A;  2MG4 A;  3TP3 A;  1Y1V J;  4UUT A;  5E3M A;  1MBK A;  5K7F A;  4DYR A;  3S2H J;  5IP6 A;  2I10 A;  2YS9 A;  4D5F A;  1FTZ A;  4MFD A;  2HXI A;  4JX4 A;  3QPL A;  4AYB N;  2H1K A;  4G12 A;  2XPW A;  5EGO B;  1ETV A;  2H8R A;  3FIS A;  1U8B A;  2AHQ A;  2L7M P;  3TP0 A;  4C3J J;  2X6O A;  2DA7 A;  1ORK A;  5F08 A;  1GT0 C;  4AC0 A;  1VI0 A;  4JX6 A;  4AUX A;  4Y7N J;  1ETQ A;  2LKX A;  1LE8 A;  5F0F A;  3HOY J;  4B1R A;  4XIC A;  5IOY A;  2FJ1 A;  1MBJ A;  3LSJ A;  1FIP A;  3NAU A;  3BQZ A;  2K40 A;  5EG0 A;  3ZOB A;  3PM1 A;  3RZD J;  1WH5 A;  4QSH A;  2QCO A;  4XRS G;  3Q0U A;  2COB A;  2RAE A;  2DN0 A;  2AO9 A;  3G1M A;  4M3B A;  5J1U A;  4UUS A;  2R5Z A;  2GLO A;  2CUF A;  1ETY A;  5GPA A;  5EEA A;  4MIM A;  1IDY A;  3L1P A;  1ZKG A;  3HKZ N;  4DYQ A;  2Y31 A;  3ZQC A;  4M3F A;  4A3M J;  2DA3 A;  1H89 C;  1BJZ A;  3K7A J;  1JTX A;  4BKX A;  3GTQ J;  4B4C A;  3O8H A;  1GUU A;  2DMP A;  3BR6 A;  4QTR A;  4M3D A;  1HLV A;  4IHW A;  2N8G A;  1A6I A;  2M0C A;  3UKG A;  2JA7 J;  3C2B A;  5FKL A;  1H88 C;  1QRY A;  2IEK A;  1X58 A;  4NDL A;  3JRG A;  2FX0 A;  4W1U A;  3JRF A;  4XID A;  3S14 J;  2NS8 A;  2ME6 A;  4A69 C;  1LE8 B;  3WHC A;  2WB1 N;  1UG2 A;  1ZTR A;  1RPW A;  3TW6 A;  2E2I J;  3OIO A;  4A3E J;  1MNM C;  1B72 A;  4Y52 J;  2PMZ N;  5FKM A;  2EH3 A;  2O8K A;  3S1N J;  3B6A A;  5EG0 B;  1XS9 A;  4RDU A;  4IHY A;  2O9L A;  5IYB J;  3MKL A;  3IH3 A;  4M3E A;  2DA2 A;  2MW8 A;  3CCY A;  1ITY A;  4DZP A;  1MBH A;  4UUS B;  2R5Z B;  3OSG A;  2TCT A;  1WH7 A;  2X48 A;  4BXX J;  1LFB A;  5IYD J;  1BA5 A;  1NK3 P;  1TWG J;  1GV5 A;  3Q3S A;  2XSD C;  5J3L A;  1MBE A;  5FLM J;  3MN2 A;  3DEW A;  1F36 A;  1IC8 A;  2E2H J;  4C3H J;  3JRH A;  2FQ4 A;  3RKQ A;  4D7M A;  1HF0 A;  3TED A;  4A3B J;  4MO7 A;  3JRC A;  2DA6 A;  4BBR J;  3RZO J;  5BNG A;  2XPV A;  3E7L A;  3JRA A;  2IBD A;  2VUM J;  3I4N J;  3HM5 A;  1IG7 A;  4FE4 A;  2CQQ A;  3H3V K;  4QIW N;  5M5X J;  3W6V A;  2YUS A;  3A01 A;  1TWC J;  5FKN A;  3LSP A;  1JUM A;  3PO3 J;  4XK4 A;  4A3C J;  5HOD A;  3NAR A;  1ENH A;  1B72 B;  1UMQ A;  1ZK8 A;  4M6V A;  3GTO J;  1RR7 A;  3S16 J;  4JP0 A;  5DTD A;  5E3L A;  4S0H B;  4A3L J;  2VPR A;  2LK2 A;  2EZI A;  2JA5 J;  3LOC A;  3BR5 A;  2XGC A;  3A02 A;  2XB5 A;  3TW7 A;  2YU9 J;  3HGG A;  3HB9 A;  2JJ7 A;  5EZH A;  3G1L A;  4XRM A;  4A3K J;  1JTY A;  3A03 A;  2M9H A;  4I76 A;  1APL C;  4FTH A;  3HOZ J;  4L5E A;  4V2G A;  1IV6 A;  1QVT A;  1IUF A;  1O4X A;  5K7H A;  1GDT A;  2FD5 A;  1Z77 A;  5C3E J;  3WHB A;  1PUF A;  2E2J J;  3ZQI A;  1U9O A;  5IP9 J;  2E1O A;  3HOW J;  3BTL A;  1JJ8 C;  2R93 J;  9ANT A;  1SAN A;  2JWT A;  2DA5 A;  2NVQ J;  1S7E A;  5C4J J;  3S1Q J;  2DA4 A;  1HDP A;  2M34 A;  1LFU P;  1HCR A;  2Y30 A;  3A01 B;  1JJ6 C;  4CYC A;  3GTK J;  1DU6 A;  2XPU A;  1AHD P;  4A3I J;  3CDL A;  1Y1W J;  3HBL A;  5EZG A;  2CU7 A;  2XGE A;  2XGD A;  1MH3 A;  2IAI A;  4D7N A;  1JUS A;  2LD5 A;  2EBI A;  3S15 J;  1R9T J;  4BY1 J;  3ZQG A;  3GTJ J;  1MSF C;  3BT9 A;  4B3A A;  2JA6 J;  2DJN A;  4C3I J;  5EDN A;  3HOV J;  1P7I A;  1CQT A;  1MSE C;  4C2M J;  1F43 A;  1MBF A;  4A93 J;  5EF6 A;  2JMW A;  3H0G J;  2HYJ A;  3HEF A;  1SFO J;  1TWA J;  3BG3 A;  3BR2 A;  3ZQF A;  2CUE A;  3LNQ A;  4RBO A;  1MBG A;  3BTC A;  4DW6 A;  4MFE A;  1IDZ A;  2Y0S N;  1OJL A;  2Y9Y A;  2LR8 A;  5J1R A;  1P7J A;  1WGX A;  2L9R A;  5IPA A;  5IP7 J;  2LY9 A;  3MVP A;  5F1J A;  1JKO C;  1ZGW A;  2VI6 A;  3QQA A;  1JT0 A;  3FK7 A;  4JYK A;  2LP0 A;  5J1Y A;  1PUF B;  1JKP C;  3BR3 A;  2XRL A;  1I6H J;  4ABZ A;  2GBY A;  4DYC A;  3BG5 A;  2EQR A;  2DTZ A;  1A5J A;  5FLV A;  3BQY A;  3PO2 J;  2NOG A;  1OFC X;  3FKI J;  5FJ8 J;  5F04 A;  3M4O J;  3HOU J;  4CYC B;  1YRN A;  2EZK A;  2JA8 J;  1TC3 C;  1VND A;  2R92 J;  2R0Q C;  3JRE A;  3JRB A;  2M2E A;  3HOX J;  4IHV A;  1Q1V A;  4J19 A;  2JN6 A;  2WV1 A;  2L0K A;  5M5W J;  4W97 A;  2G0E A;  1FTT A;  4MLO A;  3BTJ A;  4I6Z A;  2L7F P;  1AKH A;  4D5C A;  2ID3 A;  2QF7 A;  1D5Y A;  2HOS A;  3LSG A;  1I50 J;  2ECB A;  1NTC A;  3S17 J;  3JR9 A;  5E3N A;  2R7Z J;  1K61 A;  1OCP A;  3HDD A;  1ZQ3 P;  4A3J J;  1VFC A;  1X2N A;  1HOM A;  4BY7 J;  2ME0 A;  4X6A J;  2KT0 A;  3GTM J;  1RKT A;  1BL0 A;  1GVD A;  5C4X J;  1FJL A;  3ZQL A;  1Z0X A;  1QVU A;  2DMU A;  1HDD C;  2JK3 A;  3G1O A;  3CMY A;  2VKE A;  1K83 J;  1AU7 A;  5M3M J;  2X9D A;  3GTG J;  2HQ5 A;  1WCM J;  1TWH J;  1E3O C;  1B8I A;  1IRZ A;  2R5Y A;  1YRN B;  1IGN A;  1ETO A;  1GV2 A;  3RQI A;  1ETW A;  3BTI A;  5IYC J;  1ETK A;  1JUP A;  1WI3 A;  2ECC A;  1XG1 A;  2MGQ A;  4X1E A;  1X2M A;  1ZR2 A;  3SFI A;  2OF7 A;  3VPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...