2VI6A

Crystal structure of the nanog homeodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HOMEOBOX PROTEIN NANOG
publication title Crystal Structure and DNA Binding of the Homeodomain of the Stem Cell Transcription Factor Nanog.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2vi6A00
2CUEA 2G0EA 2IBDA 4XRSA 4W1UA 1ZKGA 3BQYA 2JA8J 1WI3A 2GBYA 1IGNA 1K61A 2Y31A 2Y30A 3FIWA 1AKHA 1F43A 5K7ZA 5EGOA 2KDZA 4BY7J 4IEJA 1JJ8C 4B4CA 1A6IA 3TEDA 2L9RA 2OF7A 2TCTA 1K83J 3HGYA 3NAUA 3FKIJ 3F0CA 2DA7A 2JMWA 1FIAA 1Y1VJ 3M4OJ 1ZTRA 3IH2A 1YRNA 1OCTC 4D7MA 2YUSA 3RZDJ 1F36A 2DA1A 2XB5A 5F1JA 1BL0A 2VI6A 1H89C 5FKMA 5EF6A 3A01B 1U9OA 2ME0A 2JA7J 3IV5A 2VKEA 4J19A 1BW5A 1BJZA 1HF0A 3LOCA 4BBSJ 4DZJA 1LE8A 3PO2J 2EH3A 2XPWA 2WB1N 2D5VA 2ECCA 3QPLA 1R9TJ 5GPAA 3ZQFA 2RAEA 4FTHA 2XGDA 3SJMA 3HBLA 2HOTA 2JN6A 2DMTA 2FJ1A 3TP0A 5J1YA 2AHQA 3ZQHA 5IYBJ 5FKLA 1TWHJ 1QVUA 1IDZA 1IDYA 2DN0A 2K9NA 1JKRC 3BR6A 1I3QJ 5IP9J 4IHVA 3ZQCA 2M8GX 2L7FP 2LK2A 2H1KA 2LP0A 1T33A 3QQAA 1NTCA 4FCYA 1A5JA 3JRFA 2R0QC 3BTCA 2M0CA 2NS8A 4IHYA 1B72B 1ETXA 3WHBA 3ZQIA 4HNVA 3HB9A 1FJLA 2DMPA 1GT0C 1TC3C 2HDDA 5FKOA 2O7OA 5E3NA 1VNDA 1U8BA 3TW7A 1ETKA 4AUXA 5IOYA 1WPKA 1SANA 3DCFA 1P7JA 1JUSA 2R5YA 3ZQLA 1MBKA 1NK2P 4M6VA 1Q1VA 5C4JJ 3OSGA 5FLMJ 2JJ7A 3SDGA 1X2NA 2XGCA 2TRTA 2NVQJ 3BT9A 3G1MA 3TP3A 4QSHA 4A3IJ 1GDTA 1G2HA 4A3LJ 4BKXA 4JX6A 5IPAA 3C2BA 1MNMC 5J1RA 2H8RA 3PM1A 4MFDA 3S1QJ 2K9QA 2JK3A 3E7LA 9ANTA 2E19A 2EZKA 1HLVA 1IV6A 3HEFA 2LD5A 1RR7A 1MSEC 1ETOA 1ETVA 2ID3A 1YRNB 5JLWA 4GFBA 2EBIA 4X6AJ 1ENHA 5E3OA 2NVTJ 4NDLA 2M9HA 4M3FA 5BNGA 2CRGA 1O4XA 1DU0A 1LFBA 1IRZA 1VF9A 1PUFA 3S16J 3I4NJ 1RETA 4MFEA 1P7IA 4FISA 2EZHA 2E2JJ 1FIPA 3LSRA 1LE8B 1POGA 4JX5A 5F0FA 3DEWA 2W48A 4DYQA 2EZIA 2YS9A 3LSJA 3GBGA 2HOAA 2JA6J 3HOVJ 1QPIA 1ETQA 4UUSA 3GTPJ 1S7EA 3JRGA 2LY9A 2WAQN 2COBA 1W0TA 2CUFA 5EZHA 3FK6A 5C3EJ 2LR8A 1UHSA 1TWFJ 4XIDA 1IG7A 3I4MJ 4M3DA 2YU9J 1MH4A 1GVDA 3B6CA 5DTDA 2JA5J 3RZOJ 2VPRA 2HQ5A 2GLOA 4B3AA 2M2EA 3MKLA 3BTIA 1MBGA 5GPCA 3Q0VA 1GUUA 3BR0A 4A3CJ 5K7HA 2HOSA 3BTJA 3Q0UA 2R7ZJ 3CCYA 4XRMA 2FX0A 3L1PA 2WV1A 4M3GA 1VFCA 1MBHA 2XPVA 2R92J 1BA5A 1APLC 4BXXJ 4BBRJ 2E2IJ 2R5ZA 2DJNA 5C4XJ 3H0GJ 1AU7A 4IHXA 2R93J 2EZLA 2DMUA 3HGGA 2LKXA 2R5YB 3NARA 1T56A 3A02A 2XSDC 1RESA 3PO3J 3ZQGA 2ME6A 3GTLJ 1MH3A 3FISA 5EYRA 3HDDA 4I6ZA 4I76A 4IHWA 4A3GJ 1WH7A 1JKQC 4FE7A 5M5WJ 2X6OA 3BR2A 4B1RA 4A3JJ 2XB0X 1X2MA 3JRCA 1SFOJ 2LVSA 2Y9YA 2CU7A 1HOMA 3GTOJ 4MO7A 1XG1A 3LNQA 4AYBN 1IJWC 1OCPA 1JTXA 2QCOA 5K7FA 5M5YJ 3K7AJ 5IOZA 4MIMA 2KT0A 5M5XJ 1VI0A 3W6VA 2HI3A 5EDNA 1BW6A 4RBOA 1RKTA 2M34A 3CQZJ 1U78A 1ETYA 5GP9A 1JJ6C 2LFBA 2O9LA 3LSGA 3OSFA 5DS9A 2NOGA 1PUFB 5J1UA 4ABZA 3LSPA 2MG4A 1AHDP 5IYDJ 2VKVA 3S15J 3G1LA 3A03A 4JYKA 4L5EA 3GTQJ 5J3LA 3GTJJ 2B63J 4D5CA 1GV2A 2K40A 3S1RJ 1HDPA 4A3EJ 3MVPA 3HOXJ 4UUSB 1IUFA 1JUMA 1I6HJ 3O8HA 1Z77A 2L0KA 3RQIA 3O8GA 2Y2ZA 3JRAA 1H8AC 5HODA 3JR9A 4A3DJ 4UUTA 4XICA 2DA3A 1B8IA 1MBJA 1HCRA 1NK3P 1FTTA 5F04A 2MSYA 1MBEA 4V2FA 2DMQA 1LFUP 2O8KA 2L7ZA 4C3IJ 1UG2A 4W97A 2JWTA 5F27A 5M3FJ 4M3BA 3GTMJ 2HXOA 1XS9A 3S17J 3S2DJ 3QPSA 3BR1A 2X9DA 5FLVA 1D5YA 2R5ZB 3BG5A 5FKNA 5FJ8J 3GTGJ 3ZOBA 3S2HJ 4QIWN 4A3MJ 3HKZN 1HDDC 1ZR2A 1EF4A 2MW8A 3HOYJ 3IH4A 3FK7A 2ID6A 2I10A 4MLOA 5JLXA 5F0HA 3UKGA 1MSFC 3GTKJ 5EEAA 3JRIA 2EQRA 3B6AA 2VUMJ 3M3YJ 2NVYJ 5E3LA 2OPTA 1JKPC 4C3JJ 3IH3A 1RKWA 4A3KJ 1OJLA 3RKQA 1E3OC 3S1MJ 3WHCA 1Z0XA 4G12A 4S0HB 1JT0A 1TWAJ 2HYJA 3Q0WA 2LTPA 4M3EA 4RDUA 3BQZA 3MN2A 1CQTA 5EZGA 4BY1J 4LOCA 4C2MJ 2K9SA 2DA6A 1RPWA 3G1OA 3VPRA 1JT6A 1OFCX 2DTZA 3CDLA 1FTZA 1GV5A 2FD5A 3BTLA 1TWGJ 4A93J 2L7MP 4QTRA 4A3FJ 1WH5A 2NS7A 4A3BJ 4JP0A 1MBFA 1I50J 3H3VK 2IAIA 1WCMJ 3JREA 4Y52J 2FQ4A 2PMZN 3A01A 1FEXA 2DMNA 2ZB9A 3CMYA 2Y9ZA 1WGXA 2ELKA 3D1NI 3S14J 1ZR4A 1H88C 3S1NJ 1ZQ3P 2IEKA 4X1EA 4EEFG 2MGQA 5F0CA 4DZPA 2E2HJ 1B8IB 1UMQA 5EG0B 1DU6A 1ETWA 2P81A 2DA2A 4FE4A 3K2AA 2GM4A 1QRYA 4DYCA 2Y0SN 1X58A 2CJJA 3Q3SA 1Y1WJ 3HOWJ 1JTYA 5FKKA 4D7NA 2CQXA 4DYRA 3JRBA 4D5FA 4CYCB 1ITYA 3HOUJ 2DA5A 4V2GA 4AC0A 1ZK8A 1XC5A 4A69C 3BR3A 3OOUA 1JGGA 3TW6A 2AO9A 2XRLA 1B72A 1AKHB 5EGOB 5EG0A 2XPUA 3BR5A 2NVXJ 1U9NA 3HM5A 3JRHA 2XGEA 3SFIA 4Y7NJ 4C3HJ 1JUPA 3BG9A 5C44J 1QVTA 5IYCJ 2DA4A 4JX4A 1TWCJ 3BG3A 3OIOA 2LLKA 5M3MJ 2CQQA 4DW6A 5F08A 5E3MA 4CYCA 4XRSG 3HOZJ 2N8GA 1ORKA 2ECBA 1ZGWA 2E1OA 2X48A 4XK4A 1W0UA 5IP6A 5IP7J 2HXIA 1IC8A 2QF7A 1JKOC 3JRDA
chains in the Genus database with same CATH superfamily
5GTIC 2CUEA 4H4KC 1VTNC 1MDMA 3BZKA 4XRSA 3HTSB 4W1UA 2XKOA 2K85A 5CVUA 3HHGA 2GQQA 1K61A 1D1AA 2VQCA 3BG7A 4UB6C 4C9YA 4I0BA 3LAPA 3CC7I 2CFXA 2R7QA 2HEOA 2VONA 3KX2A 2XUBA 3E5QA 1JGSA 4A5MA 3FXOA 1E2XA 3G3ZA 2R7DA 2HVRA 3S93A 3FKIJ 1SC7A 2DA7A 3CUQA 1OPCA 2DQLA 3C7JA 3I53A 2QYOA 3I0TA 4G7HF 4AIKA 2M45A 4XL9A 1F36A 3DPLC 2XB5A 2VI6A 1F9NA 1H89C 1H9TA 3C18A 3A01B 2CFOA 1SVOA 1NG6A 3FXMA 3DLAA 1X4PA 3IV5A 4A6DA 4EJUA 1V5FA 2XROA 1K4TA 1R1VA 1BJZA 3OYFA 4BBSJ 3KYCB 4LITA 3V7RA 2QSFX 1OYWA 1TW3A 2WAQA 4JQFA 2EH3A 3BZ6A 2XPWA 5KHDA 2D5VA 2ECCA 3C1DA 1R9TJ 4ZDOA 3FDYA 4QPOA 4DBQA 2LBFB 5GPAA 3ZQFA 4ZYDA 3WTVC 2L01A 3LAJA 2RAEA 2W00A 3CP2A 2HOTA 2ZMEB 3J81K 2JN6A 2V1DA 2X4HA 2FJ1A 2Q8KA 3TP0A 2ETHA 5J1YA 5LEJA 3HSRA 3OYLA 2Q0OA 1W7PA 1T08B 1J09A 2OD5A 1IDZA 4A0ZA 4IHVA 4XLFA 1MZBA 3WTWC 1T33A 1A5JA 3BTCA 4IHYA 1ETXA 3WHBA 1BI2A 4FASD 3GO5A 2R7SA 2FBKA 4XKVA 1REPC 2QUFA 4A2UA 1V55H 1FNNA 2DT5A 2HDDA 4ITVA 2Z9OA 1XSXA 2Q2EA 5IOYA 3D0SA 1SANA 3VSKA 3FF5A 1P7JA 2K9MA 2R5YA 2KL4A 3ZQLA 4E7HA 1LB2A 2UXNA 2MH9A 1RUOA 1BOAA 4AIDA 5C4JJ 1R5HA 3WTTC 3GFJA 4I09A 3FHZA 5AONA 3DFGA 2XGCA 5LEKA 1YOVB 3TP3A 1QA6A 4UVBA 5CKTA 3AL0C 4A3LJ 1X1PA 4JX6A 2LREA 1X1CA 2QSGX 4ZC3A 2L9SA 2KIQA 3SYTA 1VQ5I 3S1QJ 2D2WA 3E7LA 1QPMA 3WTXC 1LEAA 1SVMA 2EZKA 3GLLA 3HEFA 3SHFA 4RB3C 2W7NA 1T95A 2E35A 3L09A 4F93B 3NWTA 1KGSA 4NBQA 4MHGA 2ID3A 1HKSA 4S05A 5JLWA 4GFBA 2EBIA 2H94A 4CZCA 1ZG1A 2L9VA 3DP7A 4EVIA 1OQYA 1ON1A 5J4YA 1KU7A 2Z16A 5J6XA 1A31A 1LFBA 3S16J 3I4NJ 3DQVC 2EZHA 2E2JJ 2X1CA 4HQEA 1FIPA 3FXJA 3LSRA 1LE8B 2DK8A 5F0FA 1GHCA 4XR6A 3DEWA 2W48A 1E0EA 2BW3B 3GMEA 1QZEA 3I59A 3R4KA 3F23A 1U0JA 2HWVA 2EIKH 1BOBA 2JA6J 2KLOA 3CF5F 4YFKF 2E34A 1ETQA 3JRGA 3F3XA 1G3YA 2COBA 3KLNA 5E18F 2OV7A 3O3KA 5C3EJ 1ERDA 2W25A 4IHSA 2HZDA 4P55A 4LLLA 3RKYA 1IG7A 4WK8F 4ENKA 4ZYHA 2MLKA 3B6CA 3FBNB 2E36A 4LB6B 2GA2A 3HHHA 4WX9A 1E17A 3M7GA 2M2EA 5LHHA 2EIMH 3Q0VA 2L54A 2WTEA 3RKWA 1GUUA 4HSRA 3VWBA 2VL8A 3GF2A 4XLNF 4IQJA 4Y4RA 5K7HA 4A3CJ 3BTJA 3Q0UA 2R7VA 3DBLB 3U2RA 2DAOA 1TNSA 2IGNA 1UAAA 1ZH5A 5TRDA 2R7ZJ 1X3ZB 4U87A 1G8XA 3KEOA 2XPVA 1SEUA 1RNLA 4EV0A 2BYVE 3OMYA 4BXXJ 3BG6A 4BBRJ 5GADJ 2V1NA 1HW5A 1AU7A 3ZCOA 1X3UA 2VT2A 2X6YA 2DW4A 4XORA 2DMUA 1UHWA 4HAMA 3K4MA 2VC0A 4RGSA 2ZMEC 3LA7A 3OOPA 2K02A 1R5GA 1CF7B 1SD6A 4ZH4F 3CO7C 3ZQGA 4M6XA 3GTLJ 3OIPA 4BACA 5EYRA 2Z99A 3R61A 5J47A 1LQ1A 4IHWA 4A3GJ 4OIRF 2M30A 1G3SA 4KYWA 1JKQC 4FE7A 2F4OB 2A6HF 3WGGA 3CCUI 1IUYA 1O57A 4XM3A 1UHMA 1SFOJ 3W2VA 4B09A 5HNFA 1WJFA 3HXLA 3R0JA 3BCBA 3LNQA 4AYBN 1IJWC 2ZJ2A 4PJNA 3LSIA 1XSVA 1YS6A 3A0HC 5M5YJ 3OYIA 1HQCA 4OMYA 5M5XJ 5EDNA 3S8PA 2GOMA 3E5UA 1MMAA 2M34A 1A6QA 1X1DA 2HYGD 1ETYA 2XAQA 3EUAA 5CQEA 5GP9A 2PG4A 2ZO4A 2LFBA 4E70A 4XSZF 2ELHA 2ZJRF 1LDJA 1WZ2A 3ASOH 2IS4A 1R58A 5J8FA 4WCGA 2FU4A 4ABZA 4BQQA 2LH9A 4M9XA 2MG4A 1AHDP 1R23A 1X4OA 3CESA 1YQAA 3A03A 1A04A 4G8XA 4JYKA 4O6JA 5J3LA 2L7KA 2B63J 3I55I 2H27A 2P7CB 3VSLA 4CSWA 5DEQA 5KNLA 1MJAA 3F22A 1C0WA 2JRTA 1EA3A 3H5AA 3IC7A 5D8LB 2QQ9A 2XC7A 4BDYA 1K78A 1P2FA 4LFUA 4YIRX 3I64A 1QHHD 2KZGA 1LNWA 3O8GA 4P5OA 5HDGA 3V8LA 2XAJA 5LLQA 4A3DJ 5DD8A 2GXAA 1QBJA 2DA3A 5D5XB 3OYHA 1O3SA 3EYYA 5BMZA 4BHBA 1QU3A 1NK3P 4KUMA 4BQNA 2VLAA 3JTHA 2ACJA 5HLIA 1T0FC 3EQLF 1LFUP 4ON0A 2E60A 3DKXA 2DOAA 5F27A 5DDGA 2BHYA 1U2WA 3L9FA 4HDUA 4ENNA 2CV2A 4EJVA 3E6MA 2QKLB 4C2TA 4HV5A 3G2BA 1R36A 1DDNA 4CUGA 2HDWA 4R8HA 2R5ZB 5FKNA 3PNYA 5FJ8J 2FBHA 1TL8A 2V4JC 4E7ZA 2IA0A 4GGGA 1EF4A 4LG3A 3HOYJ 3TQNA 1YITI 2XIGA 5A2QK 1B9NA 2RV8A 1Y0NA 3C2GA 4HX7A 3UKGA 3SXYA 3WTUC 2WC2A 2EQRA 1YJ9I 3M3YJ 2EK5A 4B44A 1UJ8A 3J7ZI 4LG0A 3QP6A 4OOIA 3IH3A 4OIQF 2FUG2 2CS3A 4WWCA 3Q9SA 3GFLA 4QPQA 1OYIA 2PX9A 1XDUA 3PNTA 2XF5A 4PJMA 2HZTA 2A3SA 1K79A 5B5EC 5LGUA 5LHIA 1W5CC 1JT0A 3DKWA 1FSHA 4I2OA 3KEYA 1ONVA 4YIIA 2EILH 4HX4A 2EA2A 4E7LA 4LOCA 2D45A 4BAYA 4ETSA 2DA6A 2W1OA 2DK5A 3G1OA 2LMDA 5DD4A 2IW5A 3FXUA 3MMYB 3BDDA 1OFCX 3VB2A 3CDLA 4B43A 3RI4A 3DXJF 4DOZA 5JI6A 3PUFA 5BS6A 3L2QA 4XLCA 3GYHX 1XPXA 2LKPA 2JPCA 4BNCA 2DLLA 5FB2A 4JP0A 3I5UA 2LG4A 3CCLI 3V8JA 3WU0A 4R1HA 2PMZN 2DMNA 2Y9ZA 2CMPA 2IGMA 3QOEA 4NUBA 3S14J 3W6JB 1X1AA 2QLZA 2XKPA 2WY8Q 3K10A 4FQGA 2MABA 5J4VA 1EJ9A 4EEFG 2BV6A 4DZPA 2E2HJ 1B8IB 3JSPA 4MGRA 4BH9A 3GXOA 5L3BA 2P81A 3P7NA 4FETA 1S8NA 2XV4S 4N9IA 2FXAA 1EV7A 1D1BA 1X58A 4LD5A 2D1HA 1LVKA 1D5VA 2RVCA 3EUHA 2DOFA 2QKMB 1SD4A 2L5QA 2DO7A 2XAFA 5E20A 4D7NA 3MZ8A 4DYRA 5L3GA 3ECHA 4CYCB 3PQJA 3OV8A 4XOPA 1ITYA 2PJRA 2E71A 4ZDPA 4L9TA 3IWZA 3FM3A 2OUMA 1ZK8A 4A69C 3FKJA 1IXCA 3BR3A 1JGGA 3I9V2 4LIVA 1MDMB 2AO9A 3M8EA 3ZMDA 2HVQA 3E97A 3WGIA 1B72A 1USTA 3J81Z 2AXTC 2XPUA 2DPDA 3JRHA 2VQHA 4UV9A 3TGNA 2XGEA 3J80K 2VQLA 4ZDLA 2JSPA 4C3HJ 3UNGC 1IN7A 2Z1DA 2GIZA 2CO5A 3BG3A 3OIOA 3CUQB 2DBBA 2AQFA 2CQQA 2PN6A 4Y13A 2QQ8A 1DQUA 4DW6A 2M0MA 2KIFA 3OWTA 4L9VA 5BOXA 1IN4A 3E6BA 1XDSA 5H20A 2M87A 1TT5B 2X48A 2M5WA 4A0XA 1W0UA 3HRUA 4KDPA 2QF7A 2DYRH 3N05A 2IBDA 1IRGA 1Z7LA 1EH7A 2QZ8A 1MMNA 3BQYA 1WI3A 2GBYA 2Y30A 1F43A 5K7ZA 2KDZA 2PLYA 1TQMA 4BUPA 3HUGA 3VYTB 4HBLA 3O2PE 1JJ8C 2QQBA 4QWQA 3TEDA 3RYRA 1HC8A 4HYEA 2P5KA 1MJBA 3CMMA 1Y56A 3FXRA 3ZMVA 4O5VA 3G4SI 3M07A 4M9SA 3OR2C 2EB7A 1XX5A 1YRNA 1OCTC 5CVJA 1MMSA 3HOSA 1W7PB 1XGMA 2Z3YA 1J75A 1B9MA 4XONA 4OU0A 2ZC2A 3R60A 2Z5UA 4J19A 1BW5A 4RA2A 4GDFA 2XGXA 3LQQA 4LLGF 2WA0A 1SMTA 3SEZA 1FMVA 2WB1N 3QPLA 4ESFA 1S9HA 5ICCA 2BY0A 1ZRDA 1R1TA 3HBLA 2NOJB 4UVAA 3U21A 4E7SA 3WU1B 3OS2A 3NWSA 2DT6A 5CYVA 3PSFA 2DMTA 3KZZA 3S32A 3KLOA 4IOAF 3ZQHA 5FKLA 2ZBKA 2HTJA 2H1LA 5EJCA 1J2XA 1LDKB 1IDYA 3P9KA 2DN0A 3NRVA 1VQ7I 1J0RA 1JHHA 5LGTA 2A05A 1SAUA 2LP0A 3DU6A 1QHGA 1Z3XA 5DCMA 3S3NA 3JRFA 2R0QC 2M0CA 4AM3A 3GZ6A 2NAZA 2ZJPF 3FXQA 3ZQIA 2JUGA 4BHCA 2MH2A 1KU3A 4AIHA 2A5YB 1LEBA 2F4MB 1XSDA 1GT0C 3DTEA 3LA2A 4KT5C 1TC3C 2LRDA 1OYYA 2HKOA 3H92A 4HRIA 1VNDA 1U8BA 1WJBA 2BY3A 2M1BA 2IS6A 3OYEA 1PP7U 2ESHA 3I4PA 5HLGA 4ANJA 2X0LA 3KEQA 1G3TA 3A0BC 1NK2P 3CCSI 4B47A 1Q1VA 3FBIB 3OSGA 3RPUD 1XGOA 5FLMJ 3S3MA 3CJRB 3OIQA 2JJ7A 1TP4A 3ROUA 3DKYA 1BI1A 1YX5A 3FMQA 1H9GA 2CW0F 1SMYF 3CTAA 4BKXA 3I59B 4ESBA 4HLYA 5FLXK 2HKXA 5J1RA 4MFDA 1Z67A 2JK3A 2XAGA 1RC9A 1A35A 9ANTA 2E19A 2LD5A 1OCOH 1D0XA 4IOCF 5BPDA 4PDKA 1LDDA 3E5XA 3F72A 1E3HA 2K4JA 1HA8A 4Z6YA 1F5TA 5TJJA 2Y0SA 2A61A 4X6AJ 2RQQA 2NVTJ 1KZHA 4M3FA 2CRGA 3CCQI 1DU0A 1IRZA 1YI2I 4KFCA 1PUFA 1RETA 2L02A 1P7IA 6PAXA 1T6SA 2K3PA 1MMGA 4B3XA 3HRMA 4EJOA 4AIJA 2KRHA 4CXFA 4JX5A 1BR1A 3OL4A 2NRAC 2BZTA 5D8KB 2KRCA 2R7TA 3HOVJ 2EFNA 4UUSA 1XMKA 2WAQN 3KIOA 4CGZA 1SD5A 5EZHA 3FK6A 1U5TC 2LR8A 1S7AA 3DTIA 1JE8A 1TWFJ 2RREA 4KT6A 3PFIA 3LSTA 1MH4A 1FOYA 1MNDA 2MD0A 3F8MA 4MQVA 3F21A 3OYMA 1FOWA 3BROA 3RZOJ 4RS8A 1F4KA 2GA1A 2JQ7A 3I56I 3BTIA 5DM6F 3GCMA 3MKWB 1YW7A 4RB2C 2RDPA 3HL2A 2VJ4A 2HOSA 1LKXA 3W2WA 4HA8A 1O7LA 1T8IA 3QYFA 1MBHA 3SZGA 4CZZA 3QRFF 4ZJZA 2KMUA 1APLC 3T1BA 4IHXA 2EZLA 5FRMA 2PFBA 4F3QA 1IN6A 1IZ1A 3BJAA 3HGGA 3A1YA 2FEZA 2BBYA 4MTDA 3KP2A 4AU7A 2XSDC 1RESA 2ICWG 4XKCA 1Y39A 2CQNA 3LWFA 1MH3A 1JHFA 3FISA 1KA8A 3HDDA 3V42A 5FFZA 2IA2A 4G6DA 4I76A 5HS8A 4PJ0C 3E0JB 3F6OA 1WH7A 1ZHFA 2YX4A 2BXYA 2F5VA 4XMYA 2X6OA 1SAXA 4XN0A 5FGMA 4A3JJ 2XB0X 3JRCA 4C30A 4F52A 2LVSA 3WE3A 3K1PA 2CU7A 4EM0B 5JVGF 3GTOJ 3L00A 2LKSA 4MO7A 2CUZA 3H5NA 2P7VB 4F55A 3QPTA 5K7FA 3ZPLA 2P5LC 4MIMA 4BXFA 4U0VA 2KT0A 4ZZLA 4PSXA 1BW6A 4RBOA 2FRHA 1RKTA 3IAS2 1U78A 3DBRB 2IGKA 3LFKA 4M73A 4ZZDA 3OSFA 3BJOA 2K3FA 5J1UA 4I99C 2CGPA 1XCVA 1L0OC 1ULYA 4A0YA 3VODA 2STTA 4PFOA 2JVGA 1SD7A 2VPLA 2LNBA 1IO2A 4BQOA 1GV2A 4D5CA 1DGRM 4YIFA 1P6RA 4E6KG 3TO9A 4A3EJ 2WBMA 3BP8A 2FNPA 3WTZA 3TMOA 2RN7A 3KE2A 3KPHA 5ILSA 2UV1A 1HBXG 2O3FA 2L0KA 2IVMA 4HF1A 1MW7A 1LVAA 1H8AC 3S3OA 1CGPA 3JR9A 2EINH 2MC4A 2O5RA 3CJQB 3HZJA 5IT3A 1HCRA 4BYYA 3TBIA 2I5UA 1FTTA 4RM2A 5F04A 3J7YJ 2DPUA 5D6FA 4V2FA 2DMQA 3GWZA 4LG0B 2L7ZA 3K4NA 4U88A 1W4MA 2XAHA 2HU9A 4XOTA 1UG2A 2F48A 3ABUA 4W97A 1K7AA 1O7FA 4L0YB 2XVCA 4M3BA 2GAUA 4XLPF 2X6WA 1MJ9A 4E7IA 3S2DJ 1N75A 2E7WA 3BR1A 1DP7P 2YR2A 4HPQA 3K1NA 3HKZN 3ZMSA 3ZMTA 2G7HA 2VASA 1XGSA 4BXUA 4FX0A 3EUKL 2ID6A 2I10A 4MLOA 5F0HA 4RAZA 3OYNA 3ZQQA 3L2CA 3HOTA 3M8FA 3JRIA 2B9SA 4KITB 2NVYJ 5E3LA 4C3JJ 3A4CA 1RKWA 2H8WA 3RKQA 5CVVA 3CLOA 5L3DA 4IRGA 1ODDA 3T5XA 4G12A 1FMWA 4HF0A 5EEGA 4N4NB 3Q0WA 2HYJA 2LTPA 4WXCA 1P4WA 3BQZA 3CC4I 3J80Z 1SFEA 1WFXA 3GVAA 4XNFA 4C2MJ 4KN4X 5GAGJ 2K9SA 1D0ZA 3RPUA 2Y0MA 1JT6A 2DTZA 2R7OA 3GLXA 2PI0A 1FTZA 2F5EA 3K6GA 1I27A 1R22A 3BY6A 2DFEA 5CPRB 5H6QA 1VQPI 4A3FJ 3OY9A 3QODA 4BE2A 2KFDA 3H9GA 4O3MA 1WCMJ 1VQ4I 3JREA 3ZGKA 3A01A 2R7FA 1FEXA 2ZB9A 2K86A 2ELKA 3B02A 3D1NI 3H3ZA 3S2WA 3D5SC 3LSKA 3FXLA 2VXZA 3S1NJ 2VJJA 2H09A 2CQ7A 2IEKA 4I01A 5LD2C 2MGQA 5E8GA 1D0YA 1V4RA 3BCAA 3QAHA 1DU6A 1R71A 2OAZA 2HS5A 1VQMI 2LY1A 5LFAA 2YU3A 2GM4A 1QRYA 4CYDA 2ZMEA 1FBSA 1XCBA 2VC1A 5L3CA 1R5ID 3SEQA 3U1DA 1KYWA 2CW7A 2HTSA 3CJNA 2CQXA 4G94A 2E1MB 4D5FA 2ZKZA 4TV7A 4MEYF 5K5QA 3AG1H 1ZREA 2ADUA 3K0LA 4RAFA 3TW6A 1FX7A 2FOWA 2EV0A 3K4CA 1S7OA 2NYXA 3R6SA 2FSWA 2WAFA 4AYBA 5BPIA 5EG0A 1TZLA 3LA3A 3HUGB 1GXQA 2DU9A 2F5DA 3QWLA 2ZNYA 3BPVA 3RPQA 1JUPA 5C44J 2IS2A 3IKVA 3F8FA 1TWCJ 2LLKA 1HW1A 4RM3A 2HVSA 3WU2C 3MWMA 4N0BA 3CP8A 4XRSG 3HOZJ 2VKDA 1ORKA 2E1OA 1VZ0A 3ECOA 5IP6A 3IRRA 3RIRA 1M1EB 3JRDA 2G0EA 2UWMA 3HC7A 3M8JA 5K1YA 2C6YA 4NQWB 4IJAA 2Y31A 2HQAA 3FIWA 3CMEI 3E3VA 1AKHA 5EGOA 2VOPA 1G59A 2X6XA 2PBIA 1FZPB 2M8EA 2L9RA 2L3DA 1KONA 3EETA 1FP2A 3HGYA 3NAUA 3ZP5A 3F0CA 1TLHB 4IF4A 1N25A 2K9LA 2KJBA 2JMWA 3CJTB 3PJRA 1EH6A 1Y1VJ 3M4OJ 1ZTRA 1QZZA 2VT3A 2YUSA 4RMNA 2ZXHA 4D9JA 3RZDJ 1T0FA 1R4NB 5BQTA 1BL0A 2STWA 5FKMA 1QZYA 1U9OA 4KIFA 2VKEA 4EQQA 2WV0A 5FLXZ 3GUDA 1HF0A 1BIAA 1P4XA 5DCMB 1O3TA 4Y17A 5E79C 3TKYA 5HVQC 1O3QA 5HS7A 1LE8A 1RI7A 3PO2J 3WE2A 3TDZC 1FY7A 4CA0A 4A12A 5F1RA 1WVRA 3LMMA 5HS9A 2V6CA 2QBYA 1KYZA 2HPMA 3ZR8X 3H1CA 1SVLA 1RRJA 2XGDA 3SJMA 4PFPA 4DIQA 4NHJA 3ERED 3AFHA 3CCVI 2AHQA 4CCLA 5FO5A 5IYBJ 4V19K 2FF4A 2F5FA 1STZA 1QVUA 1RUNA 4HEA2 1IXRC 4E7KA 3QYEA 2G9WA 3BR6A 1JKRC 1I3QJ 5IP9J 2R3SA 1OR7C 3ZQCA 1IAWA 2M8GX 2UUZA 2BY2A 4FT8A 4RAGA 2L7FP 2LK2A 2FE3A 1WJEA 4IRHA 2LOOA 2RKHA 1Z05A 2EFWA 2OU2A 2OC6A 4IVNA 5DCFA 4Z2YA 3BZCA 3MZHA 1FOKA 1H0MA 4HNVA 1YW9A 4GO1A 1SFUA 4ENJA 2GIVA 1FJLA 2DMPA 3ZXSA 3B73A 1PYVA 2VBYA 1YE9A 1N77A 2O7OA 3ONQA 3V7SA 3TW7A 1ETKA 5EEHA 2MD5A 4AUXA 5HLHA 2UZKA 4PZJA 3MZYA 4MEXF 3DCFA 2CV1A 1ZLJA 2CH0A 3KZIC 2ISZA 1Z6RA 2GWRA 2Y48A 2LF7A 1MBKA 2H6BA 4PGHA 3ESWB 4EM1A 4M72A 4M6VA 2DOEA 1S5LC 1VQOI 4BEHA 3X2QH 2HOEA 1I3AA 2HQRA 1NG7A 2O0YA 3DU5A 4RLQA 3SDGA 1X2NA 3M1CA 2JUCA 1QNTA 3KP3A 1BIBA 2NVQJ 2HR3A 4QSHA 3U9GA 4A3IJ 3WG9A 2BOLA 2R7UA 3TO6A 5IPAA 1V5GA 3C2BA 2A5WA 3VYRB 1MNMC 3ZN1A 3K69A 2G7UA 2H8RA 3PM1A 3DLLF 1QQIA 2K9QA 3T8RA 5KCMA 4NC7A 1HLVA 1TW2A 3KP6A 1IV6A 3T8TA 4II2A 3L2RA 1Z1DA 1DGWY 4EATA 4G7OF 1ETOA 1ETVA 4N4OB 3RJPA 2KDOA 4IO9F 2ELJA 1OLTA 1ENHA 4EJTA 2DFIA 2NS0A 4GYIA 4NDLA 1XTAA 2MLGA 3OYBA 1O4XA 4CCOA 1J7KA 2CQKA 4MFEA 3K2ZA 2A6EF 3VFZA 1UFMA 4ENMA 3J7AO 1BR2A 4DYQA 4I0AA 4OMZA 2EZIA 4Q47A 1HXDA 3LSJA 3P9CA 2WY7Q 2JT1A 3DF8A 2HOAA 1AA7A 4LJZF 1QPIA 5FD6A 2V79A 3GTPJ 2L4AA 1S7EA 1TNTA 2O03A 4GRIA 1W0TA 2HGCA 2GOXB 5LRSA 1X3WB 3IP4B 2A68F 4PUSA 1YIOA 1UHSA 4BJ6C 5JHFA 4LIUA 3I4MJ 1BN5A 4E7JA 1W1WE 4WXHA 1FSEA 3RSNA 3WTYC 2HQ5A 1MD0A 4UB8C 5HNHA 3MKLA 1XD7A 5GPCA 1O3RA 1S29A 2KJCA 3BR0A 4IX7A 2X1EA 1YO5C 2WV1A 1VFCA 1LFPA 3ISPA 3BLYA 3T0YA 4A5NA 1F1ZA 2R92J 3L2WA 1BA5A 4CCMA 3CLQA 3ZRGA 2R5ZA 2DJNA 4L9JA 2DXIA 3H0GJ 2Q2EB 1X19A 4XLEA 3VOEA 3OL3A 1UB9A 2R93J 3ABKH 1K4SA 4PSWA 4HDVA 4KIBA 2LKXA 2R5YB 2VJIA 2NNYA 5E1WA 1K6YA 3KCCA 5IT9K 2HPIA 5HDKA 1BM9A 1I39A 2ME6A 2EFOA 3WODF 4AWXB 1ZRFA 3HSFA 4BL0B 1FBQA 2MBFA 3P5JA 2HQNA 2P6TA 2RQPA 3LSMA 4XLAA 5K5OA 2L2OA 4EJWA 2FMYA 1EH8A 2JTVA 2VB6A 3DV8A 4KICA 2F5CA 2NNNA 1KQ0A 2Y9YA 4PJJA 1K6OA 1HOMA 2DI3A 2VBWA 2EA4A 4QLCU 3HIFA 1XG1A 3ABTA 5DUKA 1OCPA 1JTXA 2QCOA 3E6DA 5D6EA 3PIOF 3IKTA 3RQ4A 3OYGA 1P9QC 1W36D 2IT0A 3RCOA 1WHUA 3AG3H 3BJ6A 3W6VA 1T2KA 4HF2A 4U0WA 1DPRA 2Y75A 1R7JA 1JJ6C 1QO0D 3CCMI 2O9LA 4GYGA 3LSGA 2ZJQF 5DS9A 2W57A 3BPXA 4XSXF 3DEUA 3WTSC 3H36A 2VKVA 3S15J 4JK1X 3G1LA 3EDPA 1YLFA 4L5EA 3GTJJ 3PSIA 2P4WA 2HYFA 3L2UA 1YTYA 2K40A 1HDPA 1UCRA 1S6LA 3MVPA 4F92B 4XKWA 3MKYB 1IUFA 1JUMA 1DP3A 4F91B 2XHKA 1Y6IA 2WAEA 1YHQI 4DJAA 3AL0B 4CCJA 2A07F 3RQIA 1LJ9A 1D8JA 3PUBA 2Y2ZA 5HODA 2V6EA 4XICA 3GEZA 4HG2A 3CUQC 1B8IA 1N78A 1MBJA 5ERIA 3G71I 5FD5A 4CCKA 2KQRA 1GVJA 1V54H 4HNUA 1WJCA 1AOYA 2X1DA 2MSYA 1MBEA 1EKEA 1YX3A 1YW8A 2COMA 3F6VA 2XF7A 4G6TB 4Y33A 1IRXA 2E1CA 1HSJA 4HOBA 2XDVA 4OIPF 2EWNA 2VN2A 4RB0A 1XS9A 3S17J 1ZRCA 2PMUA 2OQRA 3HRTA 4XRFA 3QPSA 4IZZA 2E1NA 5FLVA 2VQGA 2VE9A 1D5YA 3BG5A 3GTGJ 1KU2A 1VQLI 3S2HJ 4A3MJ 4UVCA 3JW4A 3CO6C 1HDDC 2VIXA 4R79A 3MEXA 2CUJA 2MW8A 3IH4A 3FK7A 5KAFC 2OJED 3GTKJ 1OCCH 1G3WA 2W82A 5EEAA 2YSRA 3GFMA 2Z33A 4YFXF 2OPTA 3K9TA 1XN7A 1WJDA 3AG4H 1UELB 4LLNA 3S1MJ 4G7ZF 5ILVA 2KZVA 1Z0XA 3KZYA 5CQGA 4M3EA 4RDUA 3CCRI 3MN2A 3K70C 3JAMK 1CQTA 5EZGA 1IF1A 3SZPA 1BC8C 4BY1J 2K7LA 2VKHA 1U3EM 1D3YA 5B3SH 2EJRA 5ICGA 4IXAA 1U5TA 1W5SA 4HV6A 3R0AA 5ICEA 1NHAA 3IUOA 1GV5A 1Z3YA 3UR3C 3BTLA 3IWFA 1PP8F 4A93J 2XASA 2V7FA 2L7MP 3REOA 1V5EA 4UUVA 4OAZA 1VQ6I 1MBFA 1I50J 2DDAA 4RAYA 2I8DA 3H3VK 3RKXA 2L4MA 5JFRA 1T39A 2IAIA 4CDGA 4DNCA 1G4DA 4Y52J 4L5IA 1BBYA 1T98A 1MGTA 5A2QZ 3EPZA 3VDXA 2RNJA 3MCZA 1WGXA 3C2HA 3K4JA 4U7DA 3G73A 1Z21A 1ZELA 1K78B 3PNVA 1HSTA 4M71A 2CYYA 1J5YA 2P6SA 4JOMA 5GAHJ 2UXXA 1ZQ3P 3N97A 3HG9A 4MQ9F 3AKZA 5F0CA 3AAFA 2EV6A 2XRNA 5EG0B 3C3WA 3I54A 3BOQA 5B66C 2DA2A 1I1SA 3ABMH 3MQ0A 5H6RA 5B1BH 1JXSA 3CZ6A 1PDNC 1IXSB 2O8XA 5AIQA 4KMFA 2DCEA 2CJJA 3Q3SA 3KETA 3OS0A 4BJTA 2WWYA 1Y1WJ 1JTYA 4OAYA 1VQ9I 1BR4A 3JRBA 1IRFA 2JSCA 5KAIC 4KA4A 4P1WA 1FWZA 4RGUA 1SFKA 3HOUJ 2JZYA 4B8XA 2A6TA 4RB1A 4V2GA 5B1AH 2F4IA 4FHTA 4L9NA 2ISYA 3VEPA 3I71A 2ZXIA 3JCUC 2V26A 1JI8A 1I1GA 2JPBA 5CJ9A 4UY8I 2XAUA 2D1VA 1AKHB 5EGOB 3BR5A 2OTJI 2E5NA 2NVXJ 3HM5A 1TT0A 3HTUA 3FHNA 3SFIA 4Y7NJ 1Z6TA 3VYSB 2IP2A 2IRFG 3FXKA 1QVTA 5JVTA 1QGPA 1BJAA 3F8BA 2DA4A 2CWEA 4JX4A 1Y8RB 2RC4A 5LHGA 1W36C 2VOOA 4M9ZA 3ERMA 1WKMA 2ECBA 1ZGWA 4XK4A 1IN5A 3LQRA 4I7HA 5IP7J 2OTLI 2BVLA 2HXIA 3H9JA 1JKOC 3M9AA 4M6YA 2KKOA 2OA4A 3HPGA 3TO7A 5HDNA 3COAC 2OZUA 4Q5SF 4KNYA 1ZKGA 3FWEA 1LUJB 2X51A 2JA8J 3KP4A 4BJ5C 1IGNA 3SFZA 2VBXA 1Z7UA 2IJLA 3HSEA 5K5RA 4BU2A 3H0DA 1J59A 4HX8A 4ZYGA 2BVMA 2MYSA 4IEJA 4BY7J 3VYUB 4EM2A 1I6XA 5D5UB 4EGYA 4B4CA 1A6IA 2GXBA 1GLNA 2OF7A 4YEJA 2TCTA 2IA1A 2QBYB 1K83J 1ZYRF 4PK4A 3V8KA 3OYDA 3KYLA 1HKQA 3ULQB 3ML6A 3CD6I 4NC6A 1FIAA 3LFUA 2CG4A 3IH2A 2LDUA 3TDUC 4K2EA 2B7EA 1TTYA 2QGUA 4D7MA 4EGZA 3IRQA 2DA1A 2HFHA 5F1JA 5JHUA 5EF6A 5CLSA 4Y3OA 2IXSA 2DFFA 2ME0A 2JA7J 2BGCA 2P8TA 1ZGAA 3LOCA 4DZJA 1FOXA 5HOOA 4F7ZA 4KISA 5D5WB 4MTEA 1B4AA 2DTRA 3G6EI 2LYCA 1RZ4A 1YG2A 5LRRA 2FNAA 2HDCA 3HKZA 4KIGA 4FTHA 2QA4I 1Y8QB 2QQAA 4XLHA 5KK1A 1XMAA 3I3LA 5E8IA 1TWHJ 3TL4X 3V7CA 3QP5A 2K9NA 3DPUA 3GZ5A 1ZGJA 2PJRB 3DTKA 4P9FA 1FYKA 2IS1A 2V9KA 3ZMUA 2H1KA 2KP6A 4BEHB 3LL7A 4PGGA 1YJWI 3QQAA 1NTCA 4FCYA 2NS8A 1B72B 2QSHX 5DYMA 1A36A 1VQ8I 1G6NA 2LBFA 1I5ZA 3HB9A 4YRVA 2Q1ZB 3HYIA 4ZTFA 1MNEA 3K4LA 5FKOA 2QENA 2DDBA 5E3NA 1OISA 4UXNA 3AG2H 4YELA 3IHUA 1WPKA 3W2AA 2M4KA 3W6KB 1Y0UA 3Q9VA 2BE5F 1JUSA 1XB4A 1U6GA 2OZ6A 4CHUA 4HZFA 3WG7H 1L3LA 5D5VB 4S04A 3J7AY 1WI9A 2TRTA 3BT9A 3G1MA 1UZCA 2DT7B 3QYBA 1GDTA 5D4SA 2E7XA 2P0WA 4JBAA 1G2HA 5AIPA 1R6RA 3U1KA 2M4GA 3QU6A 1P92A 4X0GA 3D5RC 3ELKA 4BQAA 4UV8A 1RR8C 3QU3A 2F6CA 5TGTA 5L3EA 5D4RA 1RR7A 2ZFWA 1HW2A 5IT9Z 1TBXA 4OWRB 1MSEC 2ZXWH 2R7RA 1IV8A 1YRNB 5GTHC 5JR3A 4IQ4A 3OR1C 5E3OA 2W24A 2V9PA 1KQ8A 3H5RA 2Z2SB 2M9HA 3TOBA 5CVIA 5KVRA 5BNGA 1PJRA 3PQKA 1VF9A 5F64A 3M1EA 4XBFA 4FISA 4XQFA 1IN8A 5F6FA 2EPFA 2NVUB 1ZG3A 1POGA 2DJIA 3FX3A 2EFPA 1R00A 2K5CA 5GAEJ 2GZWA 2GXGA 3RYPA 2YS9A 2JVHA 2KHMA 2ZSHB 3GBGA 1OCRH 2PEXA 4IRIA 4AVZA 2X85A 4C2UA 2DODA 2LY9A 5HLTA 4P96A 2CUFA 2DFHA 2PMHA 3DPTA 2KISA 2DQRA 4XIDA 4M3DA 2YU9J 1Z91A 2JRMA 3O6BB 1GVDA 5DTDA 2JA5J 4BDZA 2VPRA 2L9NA 3HPHA 3QPHA 2GLOA 3DBHB 4B3AA 3MFKA 1MBGA 1OMIA 4GCVA 2QM3A 4HW0A 1KQ9A 1X1BA 1SFXA 1S72I 4KN7X 1KU9A 2BW3A 4U7BA 3BWGA 1YIJI 2AQEA 2O61A 3CCYA 3GZNB 4XRMA 2FX0A 2KIUA 3L1PA 4M3GA 2CSOA 1VQNI 4MNUA 3FMSA 3GFIA 3E1SA 5ILUA 2V1XA 2E2IJ 2EV5A 1ZG5A 5C4XJ 1D8KA 2AS5F 1BI3A 4II3A 1FBUA 2DYSH 4Q48A 1XMXA 4EMSA 2OCEA 4NB5A 2OQGA 2LC2A 2LSOA 2A69F 3ASNH 3NARA 4AVPA 2LY2A 1FC3A 1R49A 1T56A 3A02A 3PO3J 3EUHC 3TOAA 4I6ZA 4LGWA 4D1QA 2KIMA 2ZFUA 3F9KA 3A2KA 1AWCA 3H35A 1E3PA 5M5WJ 2AXLA 3BR2A 2IPQX 4B1RA 2VXDA 1MIJA 4I02A 4B48A 1X2MA 3PIPF 2RNGA 2J5PA 4YG2F 4CH7A 5ED4A 4ZYEA 1BC7C 4KMUX 5E17F 1ZARA 4RLFA 2F2EA 2RGVA 2ZNZA 1PVEA 2V9VA 1VQKI 2EIJH 3K7AJ 1TQPA 5IOZA 3CDHA 2CW8A 3F8CA 1VI0A 2EFQA 2HI3A 3LSHA 3H3UA 4E4HA 1DPUA 4RGXA 3CQZJ 5DUIA 1CF7A 3CDIA 2PJPA 1WJ5A 2E1MC 4ESJA 2NOGA 1WRJA 5DM7F 1PUFB 3SZTA 3CC2I 2TDXA 3LSPA 3OYAA 3FZVA 2VODA 5IYDJ 2PMZA 1OR7A 3K4KA 1ZN2A 3GTQJ 1USSA 3JAMZ 3S1RJ 2MA3A 2R4GA 3JTGA 3MD2A 3BC8A 3HOXJ 3W3CA 4XN3A 4UUSB 2QEXI 1W7PD 2Y69H 1WWXA 1FP1D 3OS1A 4UNOA 1I6HJ 3O8HA 1Z77A 2OCCH 1YJNI 1ACIA 4UHTA 3KP7A 5IY5H 1HKTA 3JRAA 1D1CA 4Q4ZF 4G9YA 4UUTA 1NH3A 4LMYA 3ZQ7A 5E1XA 1LPQA 4IKFA 2FBIA 2YPRA 2CV0A 5LBQA 3ZMZA 4ZTJA 2BY1A 4BHPA 2K27A 3H9QA 3K70D 3D5LA 4AD9A 4N9HA 3ZN0A 1XGNA 2O8KA 1FT9A 4C3IJ 3CMAI 3CUOA 2JWTA 1OKRA 5M3FJ 1UG0A 3GTMJ 1B6AA 1WSUA 4LB5A 2HXOA 5DV5A 4CO8A 4IL6C 4U0YA 3L7WA 1MMDA 2X9DA 1WQ2A 2V1UA 3E6CC 4M74A 2K4BA 3ZOBA 4BE0A 5FRNA 4QIWN 4IPAA 4LK1F 3OYJA 1ZR2A 5J40A 3GX4X 2VBZA 3HJEA 4PJLA 2FA5A 5JLXA 1FYLA 2ESNA 3FMRA 1WJAA 1MSFC 3MAJA 2ZXJA 1U5TB 4DGWB 2PQ8A 1ON2A 2FQ3A 2E5ZA 3B6AA 3JSOA 5LGNA 2VUMJ 4L5JA 1JKPC 2H6CA 4A6EA 4A3KJ 1B59A 1OJLA 4G6QA 1E3OC 1MKMA 2B0LA 4ZYAA 2ZSIB 3GW2A 3WHCA 5H2FC 3PFYA 4J01A 1FYMA 4S0HB 2YX7A 4J00A 1P4AA 2WADA 1TWAJ 4NC8A 3CCEI 1R4MB 1Q1HA 4D0PA 2J5OA 4NQWA 2BHZA 2M7BA 5FFXA 3CF2A 1RPWA 1TQIA 3SDBA 3VPRA 4P9UA 1ZLKA 5CVRA 2FD5A 1TWGJ 3Q5FA 3NEUA 1FPQA 4QTRA 1WH5A 2NS7A 2XSJC 2M7AA 1W5TA 4PCQA 4A3BJ 1RIOH 3OYKA 2W85A 2R7WA 3P9IA 4Y15A 2LF8A 3WGHA 3K1MA 2FQ4A 2P5VA 4KJZA 4RGRA 3KYDB 3CMYA 3CCJI 2W84A 2WB1A 1ZR4A 2VJ5A 2QVOA 1Z9CA 3DWLE 1H88C 2FMLA 4BS9A 5L3FA 4X1EA 2R7XA 4NNJA 1UMQA 2MFZA 1ETWA 4BE1A 4DQ2A 3N4MA 1FLIA 2M3AA 4HLXA 5TISC 4FE4A 3K2AA 2W4SA 4DYCA 2Y0SN 2BXZA 3QOPA 1T38A 1IW7F 3KFWX 4WF2A 5J8CA 2NXNB 4XKBA 3HOWJ 4H0EA 5FKKA 4OIOF 5ICFA 4FX4A 4OINF 2FOKA 2VE8A 3L2VA 4GXOA 2QWWA 3K4BA 4CICA 4L0ZB 1J9IA 3NQOA 2BEOA 1DUXC 1YFHA 2DA5A 1YYVA 4AC0A 3IAM2 4I98B 1XC5A 2MC3A 3OOUA 4HQMA 3PL8A 4HNTA 3KP5A 4IHTA 1YS7A 2XRLA 2KRFA 1BI0A 2OBPA 4LK0F 1U9NA 1GXPA 3I58A 2XF6A 3HRSA 4BGDA 5E1ZB 3DEEA 3BG9A 1ZAOA 2JA2A 2HNHA 4WXDA 5IYCJ 3EYIA 3IL2A 1V3FA 5M3MJ 2ZCWA 1U8RA 2KPMA 4CCNA 4L18B 2IGOA 5F08A 5E3MA 2O6GE 1R1UA 3F8NA 1PUEE 4CYCA 4DBRA 4HSTA 2N8GA 3ABLH 3MKZA 1S3JA 4ASNA 3OYCA 1OCZH 1B1BA 3FM5A 3RTRA 4YFNF 3RDIA 5FROA 1IC8A 3V4GA 3SQNA
chains in the Genus database with same CATH topology
2CUEA 2G0EA 2IBDA 4XRSA 4W1UA 1ZKGA 3BQYA 2JA8J 1WI3A 2GBYA 1IGNA 1K61A 2Y31A 2Y30A 3FIWA 1AKHA 1F43A 5K7ZA 5EGOA 2KDZA 4BY7J 4IEJA 1JJ8C 4B4CA 1A6IA 3TEDA 2L9RA 2OF7A 2TCTA 1K83J 3HGYA 3NAUA 3FKIJ 3F0CA 2DA7A 2JMWA 1FIAA 1Y1VJ 3M4OJ 1ZTRA 3IH2A 1YRNA 1OCTC 4D7MA 2YUSA 3RZDJ 1F36A 2DA1A 2XB5A 5F1JA 1BL0A 2VI6A 1H89C 5FKMA 5EF6A 3A01B 1U9OA 2ME0A 2JA7J 3IV5A 2VKEA 4J19A 1BW5A 1BJZA 1HF0A 3LOCA 4BBSJ 4DZJA 1LE8A 3PO2J 2EH3A 2XPWA 2WB1N 2D5VA 2ECCA 3QPLA 1R9TJ 5GPAA 3ZQFA 2RAEA 4FTHA 2XGDA 3SJMA 3HBLA 2HOTA 2JN6A 2DMTA 2FJ1A 3TP0A 5J1YA 2AHQA 3ZQHA 5IYBJ 5FKLA 1TWHJ 1QVUA 1IDZA 1IDYA 2DN0A 2K9NA 1JKRC 3BR6A 1I3QJ 5IP9J 4IHVA 3ZQCA 2M8GX 2L7FP 2LK2A 2H1KA 2LP0A 1T33A 3QQAA 1NTCA 4FCYA 1A5JA 3JRFA 2R0QC 3BTCA 2M0CA 2NS8A 4IHYA 1B72B 1ETXA 3WHBA 3ZQIA 4HNVA 3HB9A 1FJLA 2DMPA 1GT0C 1TC3C 2HDDA 5FKOA 2O7OA 5E3NA 1VNDA 1U8BA 3TW7A 1ETKA 4AUXA 5IOYA 1WPKA 1SANA 3DCFA 1P7JA 1JUSA 2R5YA 3ZQLA 1MBKA 1NK2P 4M6VA 1Q1VA 5C4JJ 3OSGA 5FLMJ 2JJ7A 3SDGA 1X2NA 2XGCA 2TRTA 2NVQJ 3BT9A 3G1MA 3TP3A 4QSHA 4A3IJ 1GDTA 1G2HA 4A3LJ 4BKXA 4JX6A 5IPAA 3C2BA 1MNMC 5J1RA 2H8RA 3PM1A 4MFDA 3S1QJ 2K9QA 2JK3A 3E7LA 9ANTA 2E19A 2EZKA 1HLVA 1IV6A 3HEFA 2LD5A 1RR7A 1MSEC 1ETOA 1ETVA 2ID3A 1YRNB 5JLWA 4GFBA 2EBIA 4X6AJ 1ENHA 5E3OA 2NVTJ 4NDLA 2M9HA 4M3FA 5BNGA 2CRGA 1O4XA 1DU0A 1LFBA 1IRZA 1VF9A 1PUFA 3S16J 3I4NJ 1RETA 4MFEA 1P7IA 4FISA 2EZHA 2E2JJ 1FIPA 3LSRA 1LE8B 1POGA 4JX5A 5F0FA 3DEWA 2W48A 4DYQA 2EZIA 2YS9A 3LSJA 3GBGA 2HOAA 2JA6J 3HOVJ 1QPIA 1ETQA 4UUSA 3GTPJ 1S7EA 3JRGA 2LY9A 2WAQN 2COBA 1W0TA 2CUFA 5EZHA 3FK6A 5C3EJ 2LR8A 1UHSA 1TWFJ 4XIDA 1IG7A 3I4MJ 4M3DA 2YU9J 1MH4A 1GVDA 3B6CA 5DTDA 2JA5J 3RZOJ 2VPRA 2HQ5A 2GLOA 4B3AA 2M2EA 3MKLA 3BTIA 1MBGA 5GPCA 3Q0VA 1GUUA 3BR0A 4A3CJ 5K7HA 2HOSA 3BTJA 3Q0UA 2R7ZJ 3CCYA 4XRMA 2FX0A 3L1PA 2WV1A 4M3GA 1VFCA 1MBHA 2XPVA 2R92J 1BA5A 1APLC 4BXXJ 4BBRJ 2E2IJ 2R5ZA 2DJNA 5C4XJ 3H0GJ 1AU7A 4IHXA 2R93J 2EZLA 2DMUA 3HGGA 2LKXA 2R5YB 3NARA 1T56A 3A02A 2XSDC 1RESA 3PO3J 3ZQGA 2ME6A 3GTLJ 1MH3A 3FISA 5EYRA 3HDDA 4I6ZA 4I76A 4IHWA 4A3GJ 1WH7A 1JKQC 4FE7A 5M5WJ 2X6OA 3BR2A 4B1RA 4A3JJ 2XB0X 1X2MA 3JRCA 1SFOJ 2LVSA 2Y9YA 2CU7A 1HOMA 3GTOJ 4MO7A 1XG1A 3LNQA 4AYBN 1IJWC 1OCPA 1JTXA 2QCOA 5K7FA 5M5YJ 3K7AJ 5IOZA 4MIMA 2KT0A 5M5XJ 1VI0A 3W6VA 2HI3A 5EDNA 1BW6A 4RBOA 1RKTA 2M34A 3CQZJ 1U78A 1ETYA 5GP9A 1JJ6C 2LFBA 2O9LA 3LSGA 3OSFA 5DS9A 2NOGA 1PUFB 5J1UA 4ABZA 3LSPA 2MG4A 1AHDP 5IYDJ 2VKVA 3S15J 3G1LA 3A03A 4JYKA 4L5EA 3GTQJ 5J3LA 3GTJJ 2B63J 4D5CA 1GV2A 2K40A 3S1RJ 1HDPA 4A3EJ 3MVPA 3HOXJ 4UUSB 1IUFA 1JUMA 1I6HJ 3O8HA 1Z77A 2L0KA 3RQIA 3O8GA 2Y2ZA 3JRAA 1H8AC 5HODA 3JR9A 4A3DJ 4UUTA 4XICA 2DA3A 1B8IA 1MBJA 1HCRA 1NK3P 1FTTA 5F04A 2MSYA 1MBEA 4V2FA 2DMQA 1LFUP 2O8KA 2L7ZA 4C3IJ 1UG2A 4W97A 2JWTA 5F27A 5M3FJ 4M3BA 3GTMJ 2HXOA 1XS9A 3S17J 3S2DJ 3QPSA 3BR1A 2X9DA 5FLVA 1D5YA 2R5ZB 3BG5A 5FKNA 5FJ8J 3GTGJ 3ZOBA 3S2HJ 4QIWN 4A3MJ 3HKZN 1HDDC 1ZR2A 1EF4A 2MW8A 3HOYJ 3IH4A 3FK7A 2ID6A 2I10A 4MLOA 5JLXA 5F0HA 3UKGA 1MSFC 3GTKJ 5EEAA 3JRIA 2EQRA 3B6AA 2VUMJ 3M3YJ 2NVYJ 5E3LA 2OPTA 1JKPC 4C3JJ 3IH3A 1RKWA 4A3KJ 1OJLA 3RKQA 1E3OC 3S1MJ 3WHCA 1Z0XA 4G12A 4S0HB 1JT0A 1TWAJ 2HYJA 3Q0WA 2LTPA 4M3EA 4RDUA 3BQZA 3MN2A 1CQTA 5EZGA 4BY1J 4LOCA 4C2MJ 2K9SA 2DA6A 1RPWA 3G1OA 3VPRA 1JT6A 1OFCX 2DTZA 3CDLA 1FTZA 1GV5A 2FD5A 3BTLA 1TWGJ 4A93J 2L7MP 4QTRA 4A3FJ 1WH5A 2NS7A 4A3BJ 4JP0A 1MBFA 1I50J 3H3VK 2IAIA 1WCMJ 3JREA 4Y52J 2FQ4A 2PMZN 3A01A 1FEXA 2DMNA 2ZB9A 3CMYA 2Y9ZA 1WGXA 2ELKA 3D1NI 3S14J 1ZR4A 1H88C 3S1NJ 1ZQ3P 2IEKA 4X1EA 4EEFG 2MGQA 5F0CA 4DZPA 2E2HJ 1B8IB 1UMQA 5EG0B 1DU6A 1ETWA 2P81A 2DA2A 4FE4A 3K2AA 2GM4A 1QRYA 4DYCA 2Y0SN 1X58A 2CJJA 3Q3SA 1Y1WJ 3HOWJ 1JTYA 5FKKA 4D7NA 2CQXA 4DYRA 3JRBA 4D5FA 4CYCB 1ITYA 3HOUJ 2DA5A 4V2GA 4AC0A 1ZK8A 1XC5A 4A69C 3BR3A 3OOUA 1JGGA 3TW6A 2AO9A 2XRLA 1B72A 1AKHB 5EGOB 5EG0A 2XPUA 3BR5A 2NVXJ 1U9NA 3HM5A 3JRHA 2XGEA 3SFIA 4Y7NJ 4C3HJ 1JUPA 3BG9A 5C44J 1QVTA 5IYCJ 2DA4A 4JX4A 1TWCJ 3BG3A 3OIOA 2LLKA 5M3MJ 2CQQA 4DW6A 5F08A 5E3MA 4CYCA 4XRSG 3HOZJ 2N8GA 1ORKA 2ECBA 1ZGWA 2E1OA 2X48A 4XK4A 1W0UA 5IP6A 5IP7J 2HXIA 1IC8A 2QF7A 1JKOC 3JRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUE A;  2G0E A;  2IBD A;  4XRS A;  4W1U A;  1ZKG A;  3BQY A;  2JA8 J;  1WI3 A;  2GBY A;  1IGN A;  1K61 A;  2Y31 A;  2Y30 A;  3FIW A;  1AKH A;  1F43 A;  5K7Z A;  5EGO A;  2KDZ A;  4BY7 J;  4IEJ A;  1JJ8 C;  4B4C A;  1A6I A;  3TED A;  2L9R A;  2OF7 A;  2TCT A;  1K83 J;  3HGY A;  3NAU A;  3FKI J;  3F0C A;  2DA7 A;  2JMW A;  1FIA A;  1Y1V J;  3M4O J;  1ZTR A;  3IH2 A;  1YRN A;  1OCT C;  4D7M A;  2YUS A;  3RZD J;  1F36 A;  2DA1 A;  2XB5 A;  5F1J A;  1BL0 A;  2VI6 A;  1H89 C;  5FKM A;  5EF6 A;  3A01 B;  1U9O A;  2ME0 A;  2JA7 J;  3IV5 A;  2VKE A;  4J19 A;  1BW5 A;  1BJZ A;  1HF0 A;  3LOC A;  4BBS J;  4DZJ A;  1LE8 A;  3PO2 J;  2EH3 A;  2XPW A;  2WB1 N;  2D5V A;  2ECC A;  3QPL A;  1R9T J;  5GPA A;  3ZQF A;  2RAE A;  4FTH A;  2XGD A;  3SJM A;  3HBL A;  2HOT A;  2JN6 A;  2DMT A;  2FJ1 A;  3TP0 A;  5J1Y A;  2AHQ A;  3ZQH A;  5IYB J;  5FKL A;  1TWH J;  1QVU A;  1IDZ A;  1IDY A;  2DN0 A;  2K9N A;  1JKR C;  3BR6 A;  1I3Q J;  5IP9 J;  4IHV A;  3ZQC A;  2M8G X;  2L7F P;  2LK2 A;  2H1K A;  2LP0 A;  1T33 A;  3QQA A;  1NTC A;  4FCY A;  1A5J A;  3JRF A;  2R0Q C;  3BTC A;  2M0C A;  2NS8 A;  4IHY A;  1B72 B;  1ETX A;  3WHB A;  3ZQI A;  4HNV A;  3HB9 A;  1FJL A;  2DMP A;  1GT0 C;  1TC3 C;  2HDD A;  5FKO A;  2O7O A;  5E3N A;  1VND A;  1U8B A;  3TW7 A;  1ETK A;  4AUX A;  5IOY A;  1WPK A;  1SAN A;  3DCF A;  1P7J A;  1JUS A;  2R5Y A;  3ZQL A;  1MBK A;  1NK2 P;  4M6V A;  1Q1V A;  5C4J J;  3OSG A;  5FLM J;  2JJ7 A;  3SDG A;  1X2N A;  2XGC A;  2TRT A;  2NVQ J;  3BT9 A;  3G1M A;  3TP3 A;  4QSH A;  4A3I J;  1GDT A;  1G2H A;  4A3L J;  4BKX A;  4JX6 A;  5IPA A;  3C2B A;  1MNM C;  5J1R A;  2H8R A;  3PM1 A;  4MFD A;  3S1Q J;  2K9Q A;  2JK3 A;  3E7L A;  9ANT A;  2E19 A;  2EZK A;  1HLV A;  1IV6 A;  3HEF A;  2LD5 A;  1RR7 A;  1MSE C;  1ETO A;  1ETV A;  2ID3 A;  1YRN B;  5JLW A;  4GFB A;  2EBI A;  4X6A J;  1ENH A;  5E3O A;  2NVT J;  4NDL A;  2M9H A;  4M3F A;  5BNG A;  2CRG A;  1O4X A;  1DU0 A;  1LFB A;  1IRZ A;  1VF9 A;  1PUF A;  3S16 J;  3I4N J;  1RET A;  4MFE A;  1P7I A;  4FIS A;  2EZH A;  2E2J J;  1FIP A;  3LSR A;  1LE8 B;  1POG A;  4JX5 A;  5F0F A;  3DEW A;  2W48 A;  4DYQ A;  2EZI A;  2YS9 A;  3LSJ A;  3GBG A;  2HOA A;  2JA6 J;  3HOV J;  1QPI A;  1ETQ A;  4UUS A;  3GTP J;  1S7E A;  3JRG A;  2LY9 A;  2WAQ N;  2COB A;  1W0T A;  2CUF A;  5EZH A;  3FK6 A;  5C3E J;  2LR8 A;  1UHS A;  1TWF J;  4XID A;  1IG7 A;  3I4M J;  4M3D A;  2YU9 J;  1MH4 A;  1GVD A;  3B6C A;  5DTD A;  2JA5 J;  3RZO J;  2VPR A;  2HQ5 A;  2GLO A;  4B3A A;  2M2E A;  3MKL A;  3BTI A;  1MBG A;  5GPC A;  3Q0V A;  1GUU A;  3BR0 A;  4A3C J;  5K7H A;  2HOS A;  3BTJ A;  3Q0U A;  2R7Z J;  3CCY A;  4XRM A;  2FX0 A;  3L1P A;  2WV1 A;  4M3G A;  1VFC A;  1MBH A;  2XPV A;  2R92 J;  1BA5 A;  1APL C;  4BXX J;  4BBR J;  2E2I J;  2R5Z A;  2DJN A;  5C4X J;  3H0G J;  1AU7 A;  4IHX A;  2R93 J;  2EZL A;  2DMU A;  3HGG A;  2LKX A;  2R5Y B;  3NAR A;  1T56 A;  3A02 A;  2XSD C;  1RES A;  3PO3 J;  3ZQG A;  2ME6 A;  3GTL J;  1MH3 A;  3FIS A;  5EYR A;  3HDD A;  4I6Z A;  4I76 A;  4IHW A;  4A3G J;  1WH7 A;  1JKQ C;  4FE7 A;  5M5W J;  2X6O A;  3BR2 A;  4B1R A;  4A3J J;  2XB0 X;  1X2M A;  3JRC A;  1SFO J;  2LVS A;  2Y9Y A;  2CU7 A;  1HOM A;  3GTO J;  4MO7 A;  1XG1 A;  3LNQ A;  4AYB N;  1IJW C;  1OCP A;  1JTX A;  2QCO A;  5K7F A;  5M5Y J;  3K7A J;  5IOZ A;  4MIM A;  2KT0 A;  5M5X J;  1VI0 A;  3W6V A;  2HI3 A;  5EDN A;  1BW6 A;  4RBO A;  1RKT A;  2M34 A;  3CQZ J;  1U78 A;  1ETY A;  5GP9 A;  1JJ6 C;  2LFB A;  2O9L A;  3LSG A;  3OSF A;  5DS9 A;  2NOG A;  1PUF B;  5J1U A;  4ABZ A;  3LSP A;  2MG4 A;  1AHD P;  5IYD J;  2VKV A;  3S15 J;  3G1L A;  3A03 A;  4JYK A;  4L5E A;  3GTQ J;  5J3L A;  3GTJ J;  2B63 J;  4D5C A;  1GV2 A;  2K40 A;  3S1R J;  1HDP A;  4A3E J;  3MVP A;  3HOX J;  4UUS B;  1IUF A;  1JUM A;  1I6H J;  3O8H A;  1Z77 A;  2L0K A;  3RQI A;  3O8G A;  2Y2Z A;  3JRA A;  1H8A C;  5HOD A;  3JR9 A;  4A3D J;  4UUT A;  4XIC A;  2DA3 A;  1B8I A;  1MBJ A;  1HCR A;  1NK3 P;  1FTT A;  5F04 A;  2MSY A;  1MBE A;  4V2F A;  2DMQ A;  1LFU P;  2O8K A;  2L7Z A;  4C3I J;  1UG2 A;  4W97 A;  2JWT A;  5F27 A;  5M3F J;  4M3B A;  3GTM J;  2HXO A;  1XS9 A;  3S17 J;  3S2D J;  3QPS A;  3BR1 A;  2X9D A;  5FLV A;  1D5Y A;  2R5Z B;  3BG5 A;  5FKN A;  5FJ8 J;  3GTG J;  3ZOB A;  3S2H J;  4QIW N;  4A3M J;  3HKZ N;  1HDD C;  1ZR2 A;  1EF4 A;  2MW8 A;  3HOY J;  3IH4 A;  3FK7 A;  2ID6 A;  2I10 A;  4MLO A;  5JLX A;  5F0H A;  3UKG A;  1MSF C;  3GTK J;  5EEA A;  3JRI A;  2EQR A;  3B6A A;  2VUM J;  3M3Y J;  2NVY J;  5E3L A;  2OPT A;  1JKP C;  4C3J J;  3IH3 A;  1RKW A;  4A3K J;  1OJL A;  3RKQ A;  1E3O C;  3S1M J;  3WHC A;  1Z0X A;  4G12 A;  4S0H B;  1JT0 A;  1TWA J;  2HYJ A;  3Q0W A;  2LTP A;  4M3E A;  4RDU A;  3BQZ A;  3MN2 A;  1CQT A;  5EZG A;  4BY1 J;  4LOC A;  4C2M J;  2K9S A;  2DA6 A;  1RPW A;  3G1O A;  3VPR A;  1JT6 A;  1OFC X;  2DTZ A;  3CDL A;  1FTZ A;  1GV5 A;  2FD5 A;  3BTL A;  1TWG J;  4A93 J;  2L7M P;  4QTR A;  4A3F J;  1WH5 A;  2NS7 A;  4A3B J;  4JP0 A;  1MBF A;  1I50 J;  3H3V K;  2IAI A;  1WCM J;  3JRE A;  4Y52 J;  2FQ4 A;  2PMZ N;  3A01 A;  1FEX A;  2DMN A;  2ZB9 A;  3CMY A;  2Y9Z A;  1WGX A;  2ELK A;  3D1N I;  3S14 J;  1ZR4 A;  1H88 C;  3S1N J;  1ZQ3 P;  2IEK A;  4X1E A;  4EEF G;  2MGQ A;  5F0C A;  4DZP A;  2E2H J;  1B8I B;  1UMQ A;  5EG0 B;  1DU6 A;  1ETW A;  2P81 A;  2DA2 A;  4FE4 A;  3K2A A;  2GM4 A;  1QRY A;  4DYC A;  2Y0S N;  1X58 A;  2CJJ A;  3Q3S A;  1Y1W J;  3HOW J;  1JTY A;  5FKK A;  4D7N A;  2CQX A;  4DYR A;  3JRB A;  4D5F A;  4CYC B;  1ITY A;  3HOU J;  2DA5 A;  4V2G A;  4AC0 A;  1ZK8 A;  1XC5 A;  4A69 C;  3BR3 A;  3OOU A;  1JGG A;  3TW6 A;  2AO9 A;  2XRL A;  1B72 A;  1AKH B;  5EGO B;  5EG0 A;  2XPU A;  3BR5 A;  2NVX J;  1U9N A;  3HM5 A;  3JRH A;  2XGE A;  3SFI A;  4Y7N J;  4C3H J;  1JUP A;  3BG9 A;  5C44 J;  1QVT A;  5IYC J;  2DA4 A;  4JX4 A;  1TWC J;  3BG3 A;  3OIO A;  2LLK A;  5M3M J;  2CQQ A;  4DW6 A;  5F08 A;  5E3M A;  4CYC A;  4XRS G;  3HOZ J;  2N8G A;  1ORK A;  2ECB A;  1ZGW A;  2E1O A;  2X48 A;  4XK4 A;  1W0U A;  5IP6 A;  5IP7 J;  2HXI A;  1IC8 A;  2QF7 A;  1JKO C;  3JRD A; 
#chains in the Genus database with same CATH topology
 5GTI C;  2CUE A;  4H4K C;  1VTN C;  1MDM A;  3BZK A;  4XRS A;  3HTS B;  4W1U A;  2XKO A;  2K85 A;  5CVU A;  3HHG A;  2GQQ A;  1K61 A;  1D1A A;  2VQC A;  3BG7 A;  4UB6 C;  4C9Y A;  4I0B A;  3LAP A;  3CC7 I;  2CFX A;  2R7Q A;  2HEO A;  2VON A;  3KX2 A;  2XUB A;  3E5Q A;  1JGS A;  4A5M A;  3FXO A;  1E2X A;  3G3Z A;  2R7D A;  2HVR A;  3S93 A;  3FKI J;  1SC7 A;  2DA7 A;  3CUQ A;  1OPC A;  2DQL A;  3C7J A;  3I53 A;  2QYO A;  3I0T A;  4G7H F;  4AIK A;  2M45 A;  4XL9 A;  1F36 A;  3DPL C;  2XB5 A;  2VI6 A;  1F9N A;  1H89 C;  1H9T A;  3C18 A;  3A01 B;  2CFO A;  1SVO A;  1NG6 A;  3FXM A;  3DLA A;  1X4P A;  3IV5 A;  4A6D A;  4EJU A;  1V5F A;  2XRO A;  1K4T A;  1R1V A;  1BJZ A;  3OYF A;  4BBS J;  3KYC B;  4LIT A;  3V7R A;  2QSF X;  1OYW A;  1TW3 A;  2WAQ A;  4JQF A;  2EH3 A;  3BZ6 A;  2XPW A;  5KHD A;  2D5V A;  2ECC A;  3C1D A;  1R9T J;  4ZDO A;  3FDY A;  4QPO A;  4DBQ A;  2LBF B;  5GPA A;  3ZQF A;  4ZYD A;  3WTV C;  2L01 A;  3LAJ A;  2RAE A;  2W00 A;  3CP2 A;  2HOT A;  2ZME B;  3J81 K;  2JN6 A;  2V1D A;  2X4H A;  2FJ1 A;  2Q8K A;  3TP0 A;  2ETH A;  5J1Y A;  5LEJ A;  3HSR A;  3OYL A;  2Q0O A;  1W7P A;  1T08 B;  1J09 A;  2OD5 A;  1IDZ A;  4A0Z A;  4IHV A;  4XLF A;  1MZB A;  3WTW C;  1T33 A;  1A5J A;  3BTC A;  4IHY A;  1ETX A;  3WHB A;  1BI2 A;  4FAS D;  3GO5 A;  2R7S A;  2FBK A;  4XKV A;  1REP C;  2QUF A;  4A2U A;  1V55 H;  1FNN A;  2DT5 A;  2HDD A;  4ITV A;  2Z9O A;  1XSX A;  2Q2E A;  5IOY A;  3D0S A;  1SAN A;  3VSK A;  3FF5 A;  1P7J A;  2K9M A;  2R5Y A;  2KL4 A;  3ZQL A;  4E7H A;  1LB2 A;  2UXN A;  2MH9 A;  1RUO A;  1BOA A;  4AID A;  5C4J J;  1R5H A;  3WTT C;  3GFJ A;  4I09 A;  3FHZ A;  5AON A;  3DFG A;  2XGC A;  5LEK A;  1YOV B;  3TP3 A;  1QA6 A;  4UVB A;  5CKT A;  3AL0 C;  4A3L J;  1X1P A;  4JX6 A;  2LRE A;  1X1C A;  2QSG X;  4ZC3 A;  2L9S A;  2KIQ A;  3SYT A;  1VQ5 I;  3S1Q J;  2D2W A;  3E7L A;  1QPM A;  3WTX C;  1LEA A;  1SVM A;  2EZK A;  3GLL A;  3HEF A;  3SHF A;  4RB3 C;  2W7N A;  1T95 A;  2E35 A;  3L09 A;  4F93 B;  3NWT A;  1KGS A;  4NBQ A;  4MHG A;  2ID3 A;  1HKS A;  4S05 A;  5JLW A;  4GFB A;  2EBI A;  2H94 A;  4CZC A;  1ZG1 A;  2L9V A;  3DP7 A;  4EVI A;  1OQY A;  1ON1 A;  5J4Y A;  1KU7 A;  2Z16 A;  5J6X A;  1A31 A;  1LFB A;  3S16 J;  3I4N J;  3DQV C;  2EZH A;  2E2J J;  2X1C A;  4HQE A;  1FIP A;  3FXJ A;  3LSR A;  1LE8 B;  2DK8 A;  5F0F A;  1GHC A;  4XR6 A;  3DEW A;  2W48 A;  1E0E A;  2BW3 B;  3GME A;  1QZE A;  3I59 A;  3R4K A;  3F23 A;  1U0J A;  2HWV A;  2EIK H;  1BOB A;  2JA6 J;  2KLO A;  3CF5 F;  4YFK F;  2E34 A;  1ETQ A;  3JRG A;  3F3X A;  1G3Y A;  2COB A;  3KLN A;  5E18 F;  2OV7 A;  3O3K A;  5C3E J;  1ERD A;  2W25 A;  4IHS A;  2HZD A;  4P55 A;  4LLL A;  3RKY A;  1IG7 A;  4WK8 F;  4ENK A;  4ZYH A;  2MLK A;  3B6C A;  3FBN B;  2E36 A;  4LB6 B;  2GA2 A;  3HHH A;  4WX9 A;  1E17 A;  3M7G A;  2M2E A;  5LHH A;  2EIM H;  3Q0V A;  2L54 A;  2WTE A;  3RKW A;  1GUU A;  4HSR A;  3VWB A;  2VL8 A;  3GF2 A;  4XLN F;  4IQJ A;  4Y4R A;  5K7H A;  4A3C J;  3BTJ A;  3Q0U A;  2R7V A;  3DBL B;  3U2R A;  2DAO A;  1TNS A;  2IGN A;  1UAA A;  1ZH5 A;  5TRD A;  2R7Z J;  1X3Z B;  4U87 A;  1G8X A;  3KEO A;  2XPV A;  1SEU A;  1RNL A;  4EV0 A;  2BYV E;  3OMY A;  4BXX J;  3BG6 A;  4BBR J;  5GAD J;  2V1N A;  1HW5 A;  1AU7 A;  3ZCO A;  1X3U A;  2VT2 A;  2X6Y A;  2DW4 A;  4XOR A;  2DMU A;  1UHW A;  4HAM A;  3K4M A;  2VC0 A;  4RGS A;  2ZME C;  3LA7 A;  3OOP A;  2K02 A;  1R5G A;  1CF7 B;  1SD6 A;  4ZH4 F;  3CO7 C;  3ZQG A;  4M6X A;  3GTL J;  3OIP A;  4BAC A;  5EYR A;  2Z99 A;  3R61 A;  5J47 A;  1LQ1 A;  4IHW A;  4A3G J;  4OIR F;  2M30 A;  1G3S A;  4KYW A;  1JKQ C;  4FE7 A;  2F4O B;  2A6H F;  3WGG A;  3CCU I;  1IUY A;  1O57 A;  4XM3 A;  1UHM A;  1SFO J;  3W2V A;  4B09 A;  5HNF A;  1WJF A;  3HXL A;  3R0J A;  3BCB A;  3LNQ A;  4AYB N;  1IJW C;  2ZJ2 A;  4PJN A;  3LSI A;  1XSV A;  1YS6 A;  3A0H C;  5M5Y J;  3OYI A;  1HQC A;  4OMY A;  5M5X J;  5EDN A;  3S8P A;  2GOM A;  3E5U A;  1MMA A;  2M34 A;  1A6Q A;  1X1D A;  2HYG D;  1ETY A;  2XAQ A;  3EUA A;  5CQE A;  5GP9 A;  2PG4 A;  2ZO4 A;  2LFB A;  4E70 A;  4XSZ F;  2ELH A;  2ZJR F;  1LDJ A;  1WZ2 A;  3ASO H;  2IS4 A;  1R58 A;  5J8F A;  4WCG A;  2FU4 A;  4ABZ A;  4BQQ A;  2LH9 A;  4M9X A;  2MG4 A;  1AHD P;  1R23 A;  1X4O A;  3CES A;  1YQA A;  3A03 A;  1A04 A;  4G8X A;  4JYK A;  4O6J A;  5J3L A;  2L7K A;  2B63 J;  3I55 I;  2H27 A;  2P7C B;  3VSL A;  4CSW A;  5DEQ A;  5KNL A;  1MJA A;  3F22 A;  1C0W A;  2JRT A;  1EA3 A;  3H5A A;  3IC7 A;  5D8L B;  2QQ9 A;  2XC7 A;  4BDY A;  1K78 A;  1P2F A;  4LFU A;  4YIR X;  3I64 A;  1QHH D;  2KZG A;  1LNW A;  3O8G A;  4P5O A;  5HDG A;  3V8L A;  2XAJ A;  5LLQ A;  4A3D J;  5DD8 A;  2GXA A;  1QBJ A;  2DA3 A;  5D5X B;  3OYH A;  1O3S A;  3EYY A;  5BMZ A;  4BHB A;  1QU3 A;  1NK3 P;  4KUM A;  4BQN A;  2VLA A;  3JTH A;  2ACJ A;  5HLI A;  1T0F C;  3EQL F;  1LFU P;  4ON0 A;  2E60 A;  3DKX A;  2DOA A;  5F27 A;  5DDG A;  2BHY A;  1U2W A;  3L9F A;  4HDU A;  4ENN A;  2CV2 A;  4EJV A;  3E6M A;  2QKL B;  4C2T A;  4HV5 A;  3G2B A;  1R36 A;  1DDN A;  4CUG A;  2HDW A;  4R8H A;  2R5Z B;  5FKN A;  3PNY A;  5FJ8 J;  2FBH A;  1TL8 A;  2V4J C;  4E7Z A;  2IA0 A;  4GGG A;  1EF4 A;  4LG3 A;  3HOY J;  3TQN A;  1YIT I;  2XIG A;  5A2Q K;  1B9N A;  2RV8 A;  1Y0N A;  3C2G A;  4HX7 A;  3UKG A;  3SXY A;  3WTU C;  2WC2 A;  2EQR A;  1YJ9 I;  3M3Y J;  2EK5 A;  4B44 A;  1UJ8 A;  3J7Z I;  4LG0 A;  3QP6 A;  4OOI A;  3IH3 A;  4OIQ F;  2FUG 2;  2CS3 A;  4WWC A;  3Q9S A;  3GFL A;  4QPQ A;  1OYI A;  2PX9 A;  1XDU A;  3PNT A;  2XF5 A;  4PJM A;  2HZT A;  2A3S A;  1K79 A;  5B5E C;  5LGU A;  5LHI A;  1W5C C;  1JT0 A;  3DKW A;  1FSH A;  4I2O A;  3KEY A;  1ONV A;  4YII A;  2EIL H;  4HX4 A;  2EA2 A;  4E7L A;  4LOC A;  2D45 A;  4BAY A;  4ETS A;  2DA6 A;  2W1O A;  2DK5 A;  3G1O A;  2LMD A;  5DD4 A;  2IW5 A;  3FXU A;  3MMY B;  3BDD A;  1OFC X;  3VB2 A;  3CDL A;  4B43 A;  3RI4 A;  3DXJ F;  4DOZ A;  5JI6 A;  3PUF A;  5BS6 A;  3L2Q A;  4XLC A;  3GYH X;  1XPX A;  2LKP A;  2JPC A;  4BNC A;  2DLL A;  5FB2 A;  4JP0 A;  3I5U A;  2LG4 A;  3CCL I;  3V8J A;  3WU0 A;  4R1H A;  2PMZ N;  2DMN A;  2Y9Z A;  2CMP A;  2IGM A;  3QOE A;  4NUB A;  3S14 J;  3W6J B;  1X1A A;  2QLZ A;  2XKP A;  2WY8 Q;  3K10 A;  4FQG A;  2MAB A;  5J4V A;  1EJ9 A;  4EEF G;  2BV6 A;  4DZP A;  2E2H J;  1B8I B;  3JSP A;  4MGR A;  4BH9 A;  3GXO A;  5L3B A;  2P81 A;  3P7N A;  4FET A;  1S8N A;  2XV4 S;  4N9I A;  2FXA A;  1EV7 A;  1D1B A;  1X58 A;  4LD5 A;  2D1H A;  1LVK A;  1D5V A;  2RVC A;  3EUH A;  2DOF A;  2QKM B;  1SD4 A;  2L5Q A;  2DO7 A;  2XAF A;  5E20 A;  4D7N A;  3MZ8 A;  4DYR A;  5L3G A;  3ECH A;  4CYC B;  3PQJ A;  3OV8 A;  4XOP A;  1ITY A;  2PJR A;  2E71 A;  4ZDP A;  4L9T A;  3IWZ A;  3FM3 A;  2OUM A;  1ZK8 A;  4A69 C;  3FKJ A;  1IXC A;  3BR3 A;  1JGG A;  3I9V 2;  4LIV A;  1MDM B;  2AO9 A;  3M8E A;  3ZMD A;  2HVQ A;  3E97 A;  3WGI A;  1B72 A;  1UST A;  3J81 Z;  2AXT C;  2XPU A;  2DPD A;  3JRH A;  2VQH A;  4UV9 A;  3TGN A;  2XGE A;  3J80 K;  2VQL A;  4ZDL A;  2JSP A;  4C3H J;  3UNG C;  1IN7 A;  2Z1D A;  2GIZ A;  2CO5 A;  3BG3 A;  3OIO A;  3CUQ B;  2DBB A;  2AQF A;  2CQQ A;  2PN6 A;  4Y13 A;  2QQ8 A;  1DQU A;  4DW6 A;  2M0M A;  2KIF A;  3OWT A;  4L9V A;  5BOX A;  1IN4 A;  3E6B A;  1XDS A;  5H20 A;  2M87 A;  1TT5 B;  2X48 A;  2M5W A;  4A0X A;  1W0U A;  3HRU A;  4KDP A;  2QF7 A;  2DYR H;  3N05 A;  2IBD A;  1IRG A;  1Z7L A;  1EH7 A;  2QZ8 A;  1MMN A;  3BQY A;  1WI3 A;  2GBY A;  2Y30 A;  1F43 A;  5K7Z A;  2KDZ A;  2PLY A;  1TQM A;  4BUP A;  3HUG A;  3VYT B;  4HBL A;  3O2P E;  1JJ8 C;  2QQB A;  4QWQ A;  3TED A;  3RYR A;  1HC8 A;  4HYE A;  2P5K A;  1MJB A;  3CMM A;  1Y56 A;  3FXR A;  3ZMV A;  4O5V A;  3G4S I;  3M07 A;  4M9S A;  3OR2 C;  2EB7 A;  1XX5 A;  1YRN A;  1OCT C;  5CVJ A;  1MMS A;  3HOS A;  1W7P B;  1XGM A;  2Z3Y A;  1J75 A;  1B9M A;  4XON A;  4OU0 A;  2ZC2 A;  3R60 A;  2Z5U A;  4J19 A;  1BW5 A;  4RA2 A;  4GDF A;  2XGX A;  3LQQ A;  4LLG F;  2WA0 A;  1SMT A;  3SEZ A;  1FMV A;  2WB1 N;  3QPL A;  4ESF A;  1S9H A;  5ICC A;  2BY0 A;  1ZRD A;  1R1T A;  3HBL A;  2NOJ B;  4UVA A;  3U21 A;  4E7S A;  3WU1 B;  3OS2 A;  3NWS A;  2DT6 A;  5CYV A;  3PSF A;  2DMT A;  3KZZ A;  3S32 A;  3KLO A;  4IOA F;  3ZQH A;  5FKL A;  2ZBK A;  2HTJ A;  2H1L A;  5EJC A;  1J2X A;  1LDK B;  1IDY A;  3P9K A;  2DN0 A;  3NRV A;  1VQ7 I;  1J0R A;  1JHH A;  5LGT A;  2A05 A;  1SAU A;  2LP0 A;  3DU6 A;  1QHG A;  1Z3X A;  5DCM A;  3S3N A;  3JRF A;  2R0Q C;  2M0C A;  4AM3 A;  3GZ6 A;  2NAZ A;  2ZJP F;  3FXQ A;  3ZQI A;  2JUG A;  4BHC A;  2MH2 A;  1KU3 A;  4AIH A;  2A5Y B;  1LEB A;  2F4M B;  1XSD A;  1GT0 C;  3DTE A;  3LA2 A;  4KT5 C;  1TC3 C;  2LRD A;  1OYY A;  2HKO A;  3H92 A;  4HRI A;  1VND A;  1U8B A;  1WJB A;  2BY3 A;  2M1B A;  2IS6 A;  3OYE A;  1PP7 U;  2ESH A;  3I4P A;  5HLG A;  4ANJ A;  2X0L A;  3KEQ A;  1G3T A;  3A0B C;  1NK2 P;  3CCS I;  4B47 A;  1Q1V A;  3FBI B;  3OSG A;  3RPU D;  1XGO A;  5FLM J;  3S3M A;  3CJR B;  3OIQ A;  2JJ7 A;  1TP4 A;  3ROU A;  3DKY A;  1BI1 A;  1YX5 A;  3FMQ A;  1H9G A;  2CW0 F;  1SMY F;  3CTA A;  4BKX A;  3I59 B;  4ESB A;  4HLY A;  5FLX K;  2HKX A;  5J1R A;  4MFD A;  1Z67 A;  2JK3 A;  2XAG A;  1RC9 A;  1A35 A;  9ANT A;  2E19 A;  2LD5 A;  1OCO H;  1D0X A;  4IOC F;  5BPD A;  4PDK A;  1LDD A;  3E5X A;  3F72 A;  1E3H A;  2K4J A;  1HA8 A;  4Z6Y A;  1F5T A;  5TJJ A;  2Y0S A;  2A61 A;  4X6A J;  2RQQ A;  2NVT J;  1KZH A;  4M3F A;  2CRG A;  3CCQ I;  1DU0 A;  1IRZ A;  1YI2 I;  4KFC A;  1PUF A;  1RET A;  2L02 A;  1P7I A;  6PAX A;  1T6S A;  2K3P A;  1MMG A;  4B3X A;  3HRM A;  4EJO A;  4AIJ A;  2KRH A;  4CXF A;  4JX5 A;  1BR1 A;  3OL4 A;  2NRA C;  2BZT A;  5D8K B;  2KRC A;  2R7T A;  3HOV J;  2EFN A;  4UUS A;  1XMK A;  2WAQ N;  3KIO A;  4CGZ A;  1SD5 A;  5EZH A;  3FK6 A;  1U5T C;  2LR8 A;  1S7A A;  3DTI A;  1JE8 A;  1TWF J;  2RRE A;  4KT6 A;  3PFI A;  3LST A;  1MH4 A;  1FOY A;  1MND A;  2MD0 A;  3F8M A;  4MQV A;  3F21 A;  3OYM A;  1FOW A;  3BRO A;  3RZO J;  4RS8 A;  1F4K A;  2GA1 A;  2JQ7 A;  3I56 I;  3BTI A;  5DM6 F;  3GCM A;  3MKW B;  1YW7 A;  4RB2 C;  2RDP A;  3HL2 A;  2VJ4 A;  2HOS A;  1LKX A;  3W2W A;  4HA8 A;  1O7L A;  1T8I A;  3QYF A;  1MBH A;  3SZG A;  4CZZ A;  3QRF F;  4ZJZ A;  2KMU A;  1APL C;  3T1B A;  4IHX A;  2EZL A;  5FRM A;  2PFB A;  4F3Q A;  1IN6 A;  1IZ1 A;  3BJA A;  3HGG A;  3A1Y A;  2FEZ A;  2BBY A;  4MTD A;  3KP2 A;  4AU7 A;  2XSD C;  1RES A;  2ICW G;  4XKC A;  1Y39 A;  2CQN A;  3LWF A;  1MH3 A;  1JHF A;  3FIS A;  1KA8 A;  3HDD A;  3V42 A;  5FFZ A;  2IA2 A;  4G6D A;  4I76 A;  5HS8 A;  4PJ0 C;  3E0J B;  3F6O A;  1WH7 A;  1ZHF A;  2YX4 A;  2BXY A;  2F5V A;  4XMY A;  2X6O A;  1SAX A;  4XN0 A;  5FGM A;  4A3J J;  2XB0 X;  3JRC A;  4C30 A;  4F52 A;  2LVS A;  3WE3 A;  3K1P A;  2CU7 A;  4EM0 B;  5JVG F;  3GTO J;  3L00 A;  2LKS A;  4MO7 A;  2CUZ A;  3H5N A;  2P7V B;  4F55 A;  3QPT A;  5K7F A;  3ZPL A;  2P5L C;  4MIM A;  4BXF A;  4U0V A;  2KT0 A;  4ZZL A;  4PSX A;  1BW6 A;  4RBO A;  2FRH A;  1RKT A;  3IAS 2;  1U78 A;  3DBR B;  2IGK A;  3LFK A;  4M73 A;  4ZZD A;  3OSF A;  3BJO A;  2K3F A;  5J1U A;  4I99 C;  2CGP A;  1XCV A;  1L0O C;  1ULY A;  4A0Y A;  3VOD A;  2STT A;  4PFO A;  2JVG A;  1SD7 A;  2VPL A;  2LNB A;  1IO2 A;  4BQO A;  1GV2 A;  4D5C A;  1DGR M;  4YIF A;  1P6R A;  4E6K G;  3TO9 A;  4A3E J;  2WBM A;  3BP8 A;  2FNP A;  3WTZ A;  3TMO A;  2RN7 A;  3KE2 A;  3KPH A;  5ILS A;  2UV1 A;  1HBX G;  2O3F A;  2L0K A;  2IVM A;  4HF1 A;  1MW7 A;  1LVA A;  1H8A C;  3S3O A;  1CGP A;  3JR9 A;  2EIN H;  2MC4 A;  2O5R A;  3CJQ B;  3HZJ A;  5IT3 A;  1HCR A;  4BYY A;  3TBI A;  2I5U A;  1FTT A;  4RM2 A;  5F04 A;  3J7Y J;  2DPU A;  5D6F A;  4V2F A;  2DMQ A;  3GWZ A;  4LG0 B;  2L7Z A;  3K4N A;  4U88 A;  1W4M A;  2XAH A;  2HU9 A;  4XOT A;  1UG2 A;  2F48 A;  3ABU A;  4W97 A;  1K7A A;  1O7F A;  4L0Y B;  2XVC A;  4M3B A;  2GAU A;  4XLP F;  2X6W A;  1MJ9 A;  4E7I A;  3S2D J;  1N75 A;  2E7W A;  3BR1 A;  1DP7 P;  2YR2 A;  4HPQ A;  3K1N A;  3HKZ N;  3ZMS A;  3ZMT A;  2G7H A;  2VAS A;  1XGS A;  4BXU A;  4FX0 A;  3EUK L;  2ID6 A;  2I10 A;  4MLO A;  5F0H A;  4RAZ A;  3OYN A;  3ZQQ A;  3L2C A;  3HOT A;  3M8F A;  3JRI A;  2B9S A;  4KIT B;  2NVY J;  5E3L A;  4C3J J;  3A4C A;  1RKW A;  2H8W A;  3RKQ A;  5CVV A;  3CLO A;  5L3D A;  4IRG A;  1ODD A;  3T5X A;  4G12 A;  1FMW A;  4HF0 A;  5EEG A;  4N4N B;  3Q0W A;  2HYJ A;  2LTP A;  4WXC A;  1P4W A;  3BQZ A;  3CC4 I;  3J80 Z;  1SFE A;  1WFX A;  3GVA A;  4XNF A;  4C2M J;  4KN4 X;  5GAG J;  2K9S A;  1D0Z A;  3RPU A;  2Y0M A;  1JT6 A;  2DTZ A;  2R7O A;  3GLX A;  2PI0 A;  1FTZ A;  2F5E A;  3K6G A;  1I27 A;  1R22 A;  3BY6 A;  2DFE A;  5CPR B;  5H6Q A;  1VQP I;  4A3F J;  3OY9 A;  3QOD A;  4BE2 A;  2KFD A;  3H9G A;  4O3M A;  1WCM J;  1VQ4 I;  3JRE A;  3ZGK A;  3A01 A;  2R7F A;  1FEX A;  2ZB9 A;  2K86 A;  2ELK A;  3B02 A;  3D1N I;  3H3Z A;  3S2W A;  3D5S C;  3LSK A;  3FXL A;  2VXZ A;  3S1N J;  2VJJ A;  2H09 A;  2CQ7 A;  2IEK A;  4I01 A;  5LD2 C;  2MGQ A;  5E8G A;  1D0Y A;  1V4R A;  3BCA A;  3QAH A;  1DU6 A;  1R71 A;  2OAZ A;  2HS5 A;  1VQM I;  2LY1 A;  5LFA A;  2YU3 A;  2GM4 A;  1QRY A;  4CYD A;  2ZME A;  1FBS A;  1XCB A;  2VC1 A;  5L3C A;  1R5I D;  3SEQ A;  3U1D A;  1KYW A;  2CW7 A;  2HTS A;  3CJN A;  2CQX A;  4G94 A;  2E1M B;  4D5F A;  2ZKZ A;  4TV7 A;  4MEY F;  5K5Q A;  3AG1 H;  1ZRE A;  2ADU A;  3K0L A;  4RAF A;  3TW6 A;  1FX7 A;  2FOW A;  2EV0 A;  3K4C A;  1S7O A;  2NYX A;  3R6S A;  2FSW A;  2WAF A;  4AYB A;  5BPI A;  5EG0 A;  1TZL A;  3LA3 A;  3HUG B;  1GXQ A;  2DU9 A;  2F5D A;  3QWL A;  2ZNY A;  3BPV A;  3RPQ A;  1JUP A;  5C44 J;  2IS2 A;  3IKV A;  3F8F A;  1TWC J;  2LLK A;  1HW1 A;  4RM3 A;  2HVS A;  3WU2 C;  3MWM A;  4N0B A;  3CP8 A;  4XRS G;  3HOZ J;  2VKD A;  1ORK A;  2E1O A;  1VZ0 A;  3ECO A;  5IP6 A;  3IRR A;  3RIR A;  1M1E B;  3JRD A;  2G0E A;  2UWM A;  3HC7 A;  3M8J A;  5K1Y A;  2C6Y A;  4NQW B;  4IJA A;  2Y31 A;  2HQA A;  3FIW A;  3CME I;  3E3V A;  1AKH A;  5EGO A;  2VOP A;  1G59 A;  2X6X A;  2PBI A;  1FZP B;  2M8E A;  2L9R A;  2L3D A;  1KON A;  3EET A;  1FP2 A;  3HGY A;  3NAU A;  3ZP5 A;  3F0C A;  1TLH B;  4IF4 A;  1N25 A;  2K9L A;  2KJB A;  2JMW A;  3CJT B;  3PJR A;  1EH6 A;  1Y1V J;  3M4O J;  1ZTR A;  1QZZ A;  2VT3 A;  2YUS A;  4RMN A;  2ZXH A;  4D9J A;  3RZD J;  1T0F A;  1R4N B;  5BQT A;  1BL0 A;  2STW A;  5FKM A;  1QZY A;  1U9O A;  4KIF A;  2VKE A;  4EQQ A;  2WV0 A;  5FLX Z;  3GUD A;  1HF0 A;  1BIA A;  1P4X A;  5DCM B;  1O3T A;  4Y17 A;  5E79 C;  3TKY A;  5HVQ C;  1O3Q A;  5HS7 A;  1LE8 A;  1RI7 A;  3PO2 J;  3WE2 A;  3TDZ C;  1FY7 A;  4CA0 A;  4A12 A;  5F1R A;  1WVR A;  3LMM A;  5HS9 A;  2V6C A;  2QBY A;  1KYZ A;  2HPM A;  3ZR8 X;  3H1C A;  1SVL A;  1RRJ A;  2XGD A;  3SJM A;  4PFP A;  4DIQ A;  4NHJ A;  3ERE D;  3AFH A;  3CCV I;  2AHQ A;  4CCL A;  5FO5 A;  5IYB J;  4V19 K;  2FF4 A;  2F5F A;  1STZ A;  1QVU A;  1RUN A;  4HEA 2;  1IXR C;  4E7K A;  3QYE A;  2G9W A;  3BR6 A;  1JKR C;  1I3Q J;  5IP9 J;  2R3S A;  1OR7 C;  3ZQC A;  1IAW A;  2M8G X;  2UUZ A;  2BY2 A;  4FT8 A;  4RAG A;  2L7F P;  2LK2 A;  2FE3 A;  1WJE A;  4IRH A;  2LOO A;  2RKH A;  1Z05 A;  2EFW A;  2OU2 A;  2OC6 A;  4IVN A;  5DCF A;  4Z2Y A;  3BZC A;  3MZH A;  1FOK A;  1H0M A;  4HNV A;  1YW9 A;  4GO1 A;  1SFU A;  4ENJ A;  2GIV A;  1FJL A;  2DMP A;  3ZXS A;  3B73 A;  1PYV A;  2VBY A;  1YE9 A;  1N77 A;  2O7O A;  3ONQ A;  3V7S A;  3TW7 A;  1ETK A;  5EEH A;  2MD5 A;  4AUX A;  5HLH A;  2UZK A;  4PZJ A;  3MZY A;  4MEX F;  3DCF A;  2CV1 A;  1ZLJ A;  2CH0 A;  3KZI C;  2ISZ A;  1Z6R A;  2GWR A;  2Y48 A;  2LF7 A;  1MBK A;  2H6B A;  4PGH A;  3ESW B;  4EM1 A;  4M72 A;  4M6V A;  2DOE A;  1S5L C;  1VQO I;  4BEH A;  3X2Q H;  2HOE A;  1I3A A;  2HQR A;  1NG7 A;  2O0Y A;  3DU5 A;  4RLQ A;  3SDG A;  1X2N A;  3M1C A;  2JUC A;  1QNT A;  3KP3 A;  1BIB A;  2NVQ J;  2HR3 A;  4QSH A;  3U9G A;  4A3I J;  3WG9 A;  2BOL A;  2R7U A;  3TO6 A;  5IPA A;  1V5G A;  3C2B A;  2A5W A;  3VYR B;  1MNM C;  3ZN1 A;  3K69 A;  2G7U A;  2H8R A;  3PM1 A;  3DLL F;  1QQI A;  2K9Q A;  3T8R A;  5KCM A;  4NC7 A;  1HLV A;  1TW2 A;  3KP6 A;  1IV6 A;  3T8T A;  4II2 A;  3L2R A;  1Z1D A;  1DGW Y;  4EAT A;  4G7O F;  1ETO A;  1ETV A;  4N4O B;  3RJP A;  2KDO A;  4IO9 F;  2ELJ A;  1OLT A;  1ENH A;  4EJT A;  2DFI A;  2NS0 A;  4GYI A;  4NDL A;  1XTA A;  2MLG A;  3OYB A;  1O4X A;  4CCO A;  1J7K A;  2CQK A;  4MFE A;  3K2Z A;  2A6E F;  3VFZ A;  1UFM A;  4ENM A;  3J7A O;  1BR2 A;  4DYQ A;  4I0A A;  4OMZ A;  2EZI A;  4Q47 A;  1HXD A;  3LSJ A;  3P9C A;  2WY7 Q;  2JT1 A;  3DF8 A;  2HOA A;  1AA7 A;  4LJZ F;  1QPI A;  5FD6 A;  2V79 A;  3GTP J;  2L4A A;  1S7E A;  1TNT A;  2O03 A;  4GRI A;  1W0T A;  2HGC A;  2GOX B;  5LRS A;  1X3W B;  3IP4 B;  2A68 F;  4PUS A;  1YIO A;  1UHS A;  4BJ6 C;  5JHF A;  4LIU A;  3I4M J;  1BN5 A;  4E7J A;  1W1W E;  4WXH A;  1FSE A;  3RSN A;  3WTY C;  2HQ5 A;  1MD0 A;  4UB8 C;  5HNH A;  3MKL A;  1XD7 A;  5GPC A;  1O3R A;  1S29 A;  2KJC A;  3BR0 A;  4IX7 A;  2X1E A;  1YO5 C;  2WV1 A;  1VFC A;  1LFP A;  3ISP A;  3BLY A;  3T0Y A;  4A5N A;  1F1Z A;  2R92 J;  3L2W A;  1BA5 A;  4CCM A;  3CLQ A;  3ZRG A;  2R5Z A;  2DJN A;  4L9J A;  2DXI A;  3H0G J;  2Q2E B;  1X19 A;  4XLE A;  3VOE A;  3OL3 A;  1UB9 A;  2R93 J;  3ABK H;  1K4S A;  4PSW A;  4HDV A;  4KIB A;  2LKX A;  2R5Y B;  2VJI A;  2NNY A;  5E1W A;  1K6Y A;  3KCC A;  5IT9 K;  2HPI A;  5HDK A;  1BM9 A;  1I39 A;  2ME6 A;  2EFO A;  3WOD F;  4AWX B;  1ZRF A;  3HSF A;  4BL0 B;  1FBQ A;  2MBF A;  3P5J A;  2HQN A;  2P6T A;  2RQP A;  3LSM A;  4XLA A;  5K5O A;  2L2O A;  4EJW A;  2FMY A;  1EH8 A;  2JTV A;  2VB6 A;  3DV8 A;  4KIC A;  2F5C A;  2NNN A;  1KQ0 A;  2Y9Y A;  4PJJ A;  1K6O A;  1HOM A;  2DI3 A;  2VBW A;  2EA4 A;  4QLC U;  3HIF A;  1XG1 A;  3ABT A;  5DUK A;  1OCP A;  1JTX A;  2QCO A;  3E6D A;  5D6E A;  3PIO F;  3IKT A;  3RQ4 A;  3OYG A;  1P9Q C;  1W36 D;  2IT0 A;  3RCO A;  1WHU A;  3AG3 H;  3BJ6 A;  3W6V A;  1T2K A;  4HF2 A;  4U0W A;  1DPR A;  2Y75 A;  1R7J A;  1JJ6 C;  1QO0 D;  3CCM I;  2O9L A;  4GYG A;  3LSG A;  2ZJQ F;  5DS9 A;  2W57 A;  3BPX A;  4XSX F;  3DEU A;  3WTS C;  3H36 A;  2VKV A;  3S15 J;  4JK1 X;  3G1L A;  3EDP A;  1YLF A;  4L5E A;  3GTJ J;  3PSI A;  2P4W A;  2HYF A;  3L2U A;  1YTY A;  2K40 A;  1HDP A;  1UCR A;  1S6L A;  3MVP A;  4F92 B;  4XKW A;  3MKY B;  1IUF A;  1JUM A;  1DP3 A;  4F91 B;  2XHK A;  1Y6I A;  2WAE A;  1YHQ I;  4DJA A;  3AL0 B;  4CCJ A;  2A07 F;  3RQI A;  1LJ9 A;  1D8J A;  3PUB A;  2Y2Z A;  5HOD A;  2V6E A;  4XIC A;  3GEZ A;  4HG2 A;  3CUQ C;  1B8I A;  1N78 A;  1MBJ A;  5ERI A;  3G71 I;  5FD5 A;  4CCK A;  2KQR A;  1GVJ A;  1V54 H;  4HNU A;  1WJC A;  1AOY A;  2X1D A;  2MSY A;  1MBE A;  1EKE A;  1YX3 A;  1YW8 A;  2COM A;  3F6V A;  2XF7 A;  4G6T B;  4Y33 A;  1IRX A;  2E1C A;  1HSJ A;  4HOB A;  2XDV A;  4OIP F;  2EWN A;  2VN2 A;  4RB0 A;  1XS9 A;  3S17 J;  1ZRC A;  2PMU A;  2OQR A;  3HRT A;  4XRF A;  3QPS A;  4IZZ A;  2E1N A;  5FLV A;  2VQG A;  2VE9 A;  1D5Y A;  3BG5 A;  3GTG J;  1KU2 A;  1VQL I;  3S2H J;  4A3M J;  4UVC A;  3JW4 A;  3CO6 C;  1HDD C;  2VIX A;  4R79 A;  3MEX A;  2CUJ A;  2MW8 A;  3IH4 A;  3FK7 A;  5KAF C;  2OJE D;  3GTK J;  1OCC H;  1G3W A;  2W82 A;  5EEA A;  2YSR A;  3GFM A;  2Z33 A;  4YFX F;  2OPT A;  3K9T A;  1XN7 A;  1WJD A;  3AG4 H;  1UEL B;  4LLN A;  3S1M J;  4G7Z F;  5ILV A;  2KZV A;  1Z0X A;  3KZY A;  5CQG A;  4M3E A;  4RDU A;  3CCR I;  3MN2 A;  3K70 C;  3JAM K;  1CQT A;  5EZG A;  1IF1 A;  3SZP A;  1BC8 C;  4BY1 J;  2K7L A;  2VKH A;  1U3E M;  1D3Y A;  5B3S H;  2EJR A;  5ICG A;  4IXA A;  1U5T A;  1W5S A;  4HV6 A;  3R0A A;  5ICE A;  1NHA A;  3IUO A;  1GV5 A;  1Z3Y A;  3UR3 C;  3BTL A;  3IWF A;  1PP8 F;  4A93 J;  2XAS A;  2V7F A;  2L7M P;  3REO A;  1V5E A;  4UUV A;  4OAZ A;  1VQ6 I;  1MBF A;  1I50 J;  2DDA A;  4RAY A;  2I8D A;  3H3V K;  3RKX A;  2L4M A;  5JFR A;  1T39 A;  2IAI A;  4CDG A;  4DNC A;  1G4D A;  4Y52 J;  4L5I A;  1BBY A;  1T98 A;  1MGT A;  5A2Q Z;  3EPZ A;  3VDX A;  2RNJ A;  3MCZ A;  1WGX A;  3C2H A;  3K4J A;  4U7D A;  3G73 A;  1Z21 A;  1ZEL A;  1K78 B;  3PNV A;  1HST A;  4M71 A;  2CYY A;  1J5Y A;  2P6S A;  4JOM A;  5GAH J;  2UXX A;  1ZQ3 P;  3N97 A;  3HG9 A;  4MQ9 F;  3AKZ A;  5F0C A;  3AAF A;  2EV6 A;  2XRN A;  5EG0 B;  3C3W A;  3I54 A;  3BOQ A;  5B66 C;  2DA2 A;  1I1S A;  3ABM H;  3MQ0 A;  5H6R A;  5B1B H;  1JXS A;  3CZ6 A;  1PDN C;  1IXS B;  2O8X A;  5AIQ A;  4KMF A;  2DCE A;  2CJJ A;  3Q3S A;  3KET A;  3OS0 A;  4BJT A;  2WWY A;  1Y1W J;  1JTY A;  4OAY A;  1VQ9 I;  1BR4 A;  3JRB A;  1IRF A;  2JSC A;  5KAI C;  4KA4 A;  4P1W A;  1FWZ A;  4RGU A;  1SFK A;  3HOU J;  2JZY A;  4B8X A;  2A6T A;  4RB1 A;  4V2G A;  5B1A H;  2F4I A;  4FHT A;  4L9N A;  2ISY A;  3VEP A;  3I71 A;  2ZXI A;  3JCU C;  2V26 A;  1JI8 A;  1I1G A;  2JPB A;  5CJ9 A;  4UY8 I;  2XAU A;  2D1V A;  1AKH B;  5EGO B;  3BR5 A;  2OTJ I;  2E5N A;  2NVX J;  3HM5 A;  1TT0 A;  3HTU A;  3FHN A;  3SFI A;  4Y7N J;  1Z6T A;  3VYS B;  2IP2 A;  2IRF G;  3FXK A;  1QVT A;  5JVT A;  1QGP A;  1BJA A;  3F8B A;  2DA4 A;  2CWE A;  4JX4 A;  1Y8R B;  2RC4 A;  5LHG A;  1W36 C;  2VOO A;  4M9Z A;  3ERM A;  1WKM A;  2ECB A;  1ZGW A;  4XK4 A;  1IN5 A;  3LQR A;  4I7H A;  5IP7 J;  2OTL I;  2BVL A;  2HXI A;  3H9J A;  1JKO C;  3M9A A;  4M6Y A;  2KKO A;  2OA4 A;  3HPG A;  3TO7 A;  5HDN A;  3COA C;  2OZU A;  4Q5S F;  4KNY A;  1ZKG A;  3FWE A;  1LUJ B;  2X51 A;  2JA8 J;  3KP4 A;  4BJ5 C;  1IGN A;  3SFZ A;  2VBX A;  1Z7U A;  2IJL A;  3HSE A;  5K5R A;  4BU2 A;  3H0D A;  1J59 A;  4HX8 A;  4ZYG A;  2BVM A;  2MYS A;  4IEJ A;  4BY7 J;  3VYU B;  4EM2 A;  1I6X A;  5D5U B;  4EGY A;  4B4C A;  1A6I A;  2GXB A;  1GLN A;  2OF7 A;  4YEJ A;  2TCT A;  2IA1 A;  2QBY B;  1K83 J;  1ZYR F;  4PK4 A;  3V8K A;  3OYD A;  3KYL A;  1HKQ A;  3ULQ B;  3ML6 A;  3CD6 I;  4NC6 A;  1FIA A;  3LFU A;  2CG4 A;  3IH2 A;  2LDU A;  3TDU C;  4K2E A;  2B7E A;  1TTY A;  2QGU A;  4D7M A;  4EGZ A;  3IRQ A;  2DA1 A;  2HFH A;  5F1J A;  5JHU A;  5EF6 A;  5CLS A;  4Y3O A;  2IXS A;  2DFF A;  2ME0 A;  2JA7 J;  2BGC A;  2P8T A;  1ZGA A;  3LOC A;  4DZJ A;  1FOX A;  5HOO A;  4F7Z A;  4KIS A;  5D5W B;  4MTE A;  1B4A A;  2DTR A;  3G6E I;  2LYC A;  1RZ4 A;  1YG2 A;  5LRR A;  2FNA A;  2HDC A;  3HKZ A;  4KIG A;  4FTH A;  2QA4 I;  1Y8Q B;  2QQA A;  4XLH A;  5KK1 A;  1XMA A;  3I3L A;  5E8I A;  1TWH J;  3TL4 X;  3V7C A;  3QP5 A;  2K9N A;  3DPU A;  3GZ5 A;  1ZGJ A;  2PJR B;  3DTK A;  4P9F A;  1FYK A;  2IS1 A;  2V9K A;  3ZMU A;  2H1K A;  2KP6 A;  4BEH B;  3LL7 A;  4PGG A;  1YJW I;  3QQA A;  1NTC A;  4FCY A;  2NS8 A;  1B72 B;  2QSH X;  5DYM A;  1A36 A;  1VQ8 I;  1G6N A;  2LBF A;  1I5Z A;  3HB9 A;  4YRV A;  2Q1Z B;  3HYI A;  4ZTF A;  1MNE A;  3K4L A;  5FKO A;  2QEN A;  2DDB A;  5E3N A;  1OIS A;  4UXN A;  3AG2 H;  4YEL A;  3IHU A;  1WPK A;  3W2A A;  2M4K A;  3W6K B;  1Y0U A;  3Q9V A;  2BE5 F;  1JUS A;  1XB4 A;  1U6G A;  2OZ6 A;  4CHU A;  4HZF A;  3WG7 H;  1L3L A;  5D5V B;  4S04 A;  3J7A Y;  1WI9 A;  2TRT A;  3BT9 A;  3G1M A;  1UZC A;  2DT7 B;  3QYB A;  1GDT A;  5D4S A;  2E7X A;  2P0W A;  4JBA A;  1G2H A;  5AIP A;  1R6R A;  3U1K A;  2M4G A;  3QU6 A;  1P92 A;  4X0G A;  3D5R C;  3ELK A;  4BQA A;  4UV8 A;  1RR8 C;  3QU3 A;  2F6C A;  5TGT A;  5L3E A;  5D4R A;  1RR7 A;  2ZFW A;  1HW2 A;  5IT9 Z;  1TBX A;  4OWR B;  1MSE C;  2ZXW H;  2R7R A;  1IV8 A;  1YRN B;  5GTH C;  5JR3 A;  4IQ4 A;  3OR1 C;  5E3O A;  2W24 A;  2V9P A;  1KQ8 A;  3H5R A;  2Z2S B;  2M9H A;  3TOB A;  5CVI A;  5KVR A;  5BNG A;  1PJR A;  3PQK A;  1VF9 A;  5F64 A;  3M1E A;  4XBF A;  4FIS A;  4XQF A;  1IN8 A;  5F6F A;  2EPF A;  2NVU B;  1ZG3 A;  1POG A;  2DJI A;  3FX3 A;  2EFP A;  1R00 A;  2K5C A;  5GAE J;  2GZW A;  2GXG A;  3RYP A;  2YS9 A;  2JVH A;  2KHM A;  2ZSH B;  3GBG A;  1OCR H;  2PEX A;  4IRI A;  4AVZ A;  2X85 A;  4C2U A;  2DOD A;  2LY9 A;  5HLT A;  4P96 A;  2CUF A;  2DFH A;  2PMH A;  3DPT A;  2KIS A;  2DQR A;  4XID A;  4M3D A;  2YU9 J;  1Z91 A;  2JRM A;  3O6B B;  1GVD A;  5DTD A;  2JA5 J;  4BDZ A;  2VPR A;  2L9N A;  3HPH A;  3QPH A;  2GLO A;  3DBH B;  4B3A A;  3MFK A;  1MBG A;  1OMI A;  4GCV A;  2QM3 A;  4HW0 A;  1KQ9 A;  1X1B A;  1SFX A;  1S72 I;  4KN7 X;  1KU9 A;  2BW3 A;  4U7B A;  3BWG A;  1YIJ I;  2AQE A;  2O61 A;  3CCY A;  3GZN B;  4XRM A;  2FX0 A;  2KIU A;  3L1P A;  4M3G A;  2CSO A;  1VQN I;  4MNU A;  3FMS A;  3GFI A;  3E1S A;  5ILU A;  2V1X A;  2E2I J;  2EV5 A;  1ZG5 A;  5C4X J;  1D8K A;  2AS5 F;  1BI3 A;  4II3 A;  1FBU A;  2DYS H;  4Q48 A;  1XMX A;  4EMS A;  2OCE A;  4NB5 A;  2OQG A;  2LC2 A;  2LSO A;  2A69 F;  3ASN H;  3NAR A;  4AVP A;  2LY2 A;  1FC3 A;  1R49 A;  1T56 A;  3A02 A;  3PO3 J;  3EUH C;  3TOA A;  4I6Z A;  4LGW A;  4D1Q A;  2KIM A;  2ZFU A;  3F9K A;  3A2K A;  1AWC A;  3H35 A;  1E3P A;  5M5W J;  2AXL A;  3BR2 A;  2IPQ X;  4B1R A;  2VXD A;  1MIJ A;  4I02 A;  4B48 A;  1X2M A;  3PIP F;  2RNG A;  2J5P A;  4YG2 F;  4CH7 A;  5ED4 A;  4ZYE A;  1BC7 C;  4KMU X;  5E17 F;  1ZAR A;  4RLF A;  2F2E A;  2RGV A;  2ZNZ A;  1PVE A;  2V9V A;  1VQK I;  2EIJ H;  3K7A J;  1TQP A;  5IOZ A;  3CDH A;  2CW8 A;  3F8C A;  1VI0 A;  2EFQ A;  2HI3 A;  3LSH A;  3H3U A;  4E4H A;  1DPU A;  4RGX A;  3CQZ J;  5DUI A;  1CF7 A;  3CDI A;  2PJP A;  1WJ5 A;  2E1M C;  4ESJ A;  2NOG A;  1WRJ A;  5DM7 F;  1PUF B;  3SZT A;  3CC2 I;  2TDX A;  3LSP A;  3OYA A;  3FZV A;  2VOD A;  5IYD J;  2PMZ A;  1OR7 A;  3K4K A;  1ZN2 A;  3GTQ J;  1USS A;  3JAM Z;  3S1R J;  2MA3 A;  2R4G A;  3JTG A;  3MD2 A;  3BC8 A;  3HOX J;  3W3C A;  4XN3 A;  4UUS B;  2QEX I;  1W7P D;  2Y69 H;  1WWX A;  1FP1 D;  3OS1 A;  4UNO A;  1I6H J;  3O8H A;  1Z77 A;  2OCC H;  1YJN I;  1ACI A;  4UHT A;  3KP7 A;  5IY5 H;  1HKT A;  3JRA A;  1D1C A;  4Q4Z F;  4G9Y A;  4UUT A;  1NH3 A;  4LMY A;  3ZQ7 A;  5E1X A;  1LPQ A;  4IKF A;  2FBI A;  2YPR A;  2CV0 A;  5LBQ A;  3ZMZ A;  4ZTJ A;  2BY1 A;  4BHP A;  2K27 A;  3H9Q A;  3K70 D;  3D5L A;  4AD9 A;  4N9H A;  3ZN0 A;  1XGN A;  2O8K A;  1FT9 A;  4C3I J;  3CMA I;  3CUO A;  2JWT A;  1OKR A;  5M3F J;  1UG0 A;  3GTM J;  1B6A A;  1WSU A;  4LB5 A;  2HXO A;  5DV5 A;  4CO8 A;  4IL6 C;  4U0Y A;  3L7W A;  1MMD A;  2X9D A;  1WQ2 A;  2V1U A;  3E6C C;  4M74 A;  2K4B A;  3ZOB A;  4BE0 A;  5FRN A;  4QIW N;  4IPA A;  4LK1 F;  3OYJ A;  1ZR2 A;  5J40 A;  3GX4 X;  2VBZ A;  3HJE A;  4PJL A;  2FA5 A;  5JLX A;  1FYL A;  2ESN A;  3FMR A;  1WJA A;  1MSF C;  3MAJ A;  2ZXJ A;  1U5T B;  4DGW B;  2PQ8 A;  1ON2 A;  2FQ3 A;  2E5Z A;  3B6A A;  3JSO A;  5LGN A;  2VUM J;  4L5J A;  1JKP C;  2H6C A;  4A6E A;  4A3K J;  1B59 A;  1OJL A;  4G6Q A;  1E3O C;  1MKM A;  2B0L A;  4ZYA A;  2ZSI B;  3GW2 A;  3WHC A;  5H2F C;  3PFY A;  4J01 A;  1FYM A;  4S0H B;  2YX7 A;  4J00 A;  1P4A A;  2WAD A;  1TWA J;  4NC8 A;  3CCE I;  1R4M B;  1Q1H A;  4D0P A;  2J5O A;  4NQW A;  2BHZ A;  2M7B A;  5FFX A;  3CF2 A;  1RPW A;  1TQI A;  3SDB A;  3VPR A;  4P9U A;  1ZLK A;  5CVR A;  2FD5 A;  1TWG J;  3Q5F A;  3NEU A;  1FPQ A;  4QTR A;  1WH5 A;  2NS7 A;  2XSJ C;  2M7A A;  1W5T A;  4PCQ A;  4A3B J;  1RIO H;  3OYK A;  2W85 A;  2R7W A;  3P9I A;  4Y15 A;  2LF8 A;  3WGH A;  3K1M A;  2FQ4 A;  2P5V A;  4KJZ A;  4RGR A;  3KYD B;  3CMY A;  3CCJ I;  2W84 A;  2WB1 A;  1ZR4 A;  2VJ5 A;  2QVO A;  1Z9C A;  3DWL E;  1H88 C;  2FML A;  4BS9 A;  5L3F A;  4X1E A;  2R7X A;  4NNJ A;  1UMQ A;  2MFZ A;  1ETW A;  4BE1 A;  4DQ2 A;  3N4M A;  1FLI A;  2M3A A;  4HLX A;  5TIS C;  4FE4 A;  3K2A A;  2W4S A;  4DYC A;  2Y0S N;  2BXZ A;  3QOP A;  1T38 A;  1IW7 F;  3KFW X;  4WF2 A;  5J8C A;  2NXN B;  4XKB A;  3HOW J;  4H0E A;  5FKK A;  4OIO F;  5ICF A;  4FX4 A;  4OIN F;  2FOK A;  2VE8 A;  3L2V A;  4GXO A;  2QWW A;  3K4B A;  4CIC A;  4L0Z B;  1J9I A;  3NQO A;  2BEO A;  1DUX C;  1YFH A;  2DA5 A;  1YYV A;  4AC0 A;  3IAM 2;  4I98 B;  1XC5 A;  2MC3 A;  3OOU A;  4HQM A;  3PL8 A;  4HNT A;  3KP5 A;  4IHT A;  1YS7 A;  2XRL A;  2KRF A;  1BI0 A;  2OBP A;  4LK0 F;  1U9N A;  1GXP A;  3I58 A;  2XF6 A;  3HRS A;  4BGD A;  5E1Z B;  3DEE A;  3BG9 A;  1ZAO A;  2JA2 A;  2HNH A;  4WXD A;  5IYC J;  3EYI A;  3IL2 A;  1V3F A;  5M3M J;  2ZCW A;  1U8R A;  2KPM A;  4CCN A;  4L18 B;  2IGO A;  5F08 A;  5E3M A;  2O6G E;  1R1U A;  3F8N A;  1PUE E;  4CYC A;  4DBR A;  4HST A;  2N8G A;  3ABL H;  3MKZ A;  1S3J A;  4ASN A;  3OYC A;  1OCZ H;  1B1B A;  3FM5 A;  3RTR A;  4YFN F;  3RDI A;  5FRO A;  1IC8 A;  3V4G A;  3SQN A; 
#chains in the Genus database with same CATH homology
 2CUE A;  2G0E A;  2IBD A;  4XRS A;  4W1U A;  1ZKG A;  3BQY A;  2JA8 J;  1WI3 A;  2GBY A;  1IGN A;  1K61 A;  2Y31 A;  2Y30 A;  3FIW A;  1AKH A;  1F43 A;  5K7Z A;  5EGO A;  2KDZ A;  4BY7 J;  4IEJ A;  1JJ8 C;  4B4C A;  1A6I A;  3TED A;  2L9R A;  2OF7 A;  2TCT A;  1K83 J;  3HGY A;  3NAU A;  3FKI J;  3F0C A;  2DA7 A;  2JMW A;  1FIA A;  1Y1V J;  3M4O J;  1ZTR A;  3IH2 A;  1YRN A;  1OCT C;  4D7M A;  2YUS A;  3RZD J;  1F36 A;  2DA1 A;  2XB5 A;  5F1J A;  1BL0 A;  2VI6 A;  1H89 C;  5FKM A;  5EF6 A;  3A01 B;  1U9O A;  2ME0 A;  2JA7 J;  3IV5 A;  2VKE A;  4J19 A;  1BW5 A;  1BJZ A;  1HF0 A;  3LOC A;  4BBS J;  4DZJ A;  1LE8 A;  3PO2 J;  2EH3 A;  2XPW A;  2WB1 N;  2D5V A;  2ECC A;  3QPL A;  1R9T J;  5GPA A;  3ZQF A;  2RAE A;  4FTH A;  2XGD A;  3SJM A;  3HBL A;  2HOT A;  2JN6 A;  2DMT A;  2FJ1 A;  3TP0 A;  5J1Y A;  2AHQ A;  3ZQH A;  5IYB J;  5FKL A;  1TWH J;  1QVU A;  1IDZ A;  1IDY A;  2DN0 A;  2K9N A;  1JKR C;  3BR6 A;  1I3Q J;  5IP9 J;  4IHV A;  3ZQC A;  2M8G X;  2L7F P;  2LK2 A;  2H1K A;  2LP0 A;  1T33 A;  3QQA A;  1NTC A;  4FCY A;  1A5J A;  3JRF A;  2R0Q C;  3BTC A;  2M0C A;  2NS8 A;  4IHY A;  1B72 B;  1ETX A;  3WHB A;  3ZQI A;  4HNV A;  3HB9 A;  1FJL A;  2DMP A;  1GT0 C;  1TC3 C;  2HDD A;  5FKO A;  2O7O A;  5E3N A;  1VND A;  1U8B A;  3TW7 A;  1ETK A;  4AUX A;  5IOY A;  1WPK A;  1SAN A;  3DCF A;  1P7J A;  1JUS A;  2R5Y A;  3ZQL A;  1MBK A;  1NK2 P;  4M6V A;  1Q1V A;  5C4J J;  3OSG A;  5FLM J;  2JJ7 A;  3SDG A;  1X2N A;  2XGC A;  2TRT A;  2NVQ J;  3BT9 A;  3G1M A;  3TP3 A;  4QSH A;  4A3I J;  1GDT A;  1G2H A;  4A3L J;  4BKX A;  4JX6 A;  5IPA A;  3C2B A;  1MNM C;  5J1R A;  2H8R A;  3PM1 A;  4MFD A;  3S1Q J;  2K9Q A;  2JK3 A;  3E7L A;  9ANT A;  2E19 A;  2EZK A;  1HLV A;  1IV6 A;  3HEF A;  2LD5 A;  1RR7 A;  1MSE C;  1ETO A;  1ETV A;  2ID3 A;  1YRN B;  5JLW A;  4GFB A;  2EBI A;  4X6A J;  1ENH A;  5E3O A;  2NVT J;  4NDL A;  2M9H A;  4M3F A;  5BNG A;  2CRG A;  1O4X A;  1DU0 A;  1LFB A;  1IRZ A;  1VF9 A;  1PUF A;  3S16 J;  3I4N J;  1RET A;  4MFE A;  1P7I A;  4FIS A;  2EZH A;  2E2J J;  1FIP A;  3LSR A;  1LE8 B;  1POG A;  4JX5 A;  5F0F A;  3DEW A;  2W48 A;  4DYQ A;  2EZI A;  2YS9 A;  3LSJ A;  3GBG A;  2HOA A;  2JA6 J;  3HOV J;  1QPI A;  1ETQ A;  4UUS A;  3GTP J;  1S7E A;  3JRG A;  2LY9 A;  2WAQ N;  2COB A;  1W0T A;  2CUF A;  5EZH A;  3FK6 A;  5C3E J;  2LR8 A;  1UHS A;  1TWF J;  4XID A;  1IG7 A;  3I4M J;  4M3D A;  2YU9 J;  1MH4 A;  1GVD A;  3B6C A;  5DTD A;  2JA5 J;  3RZO J;  2VPR A;  2HQ5 A;  2GLO A;  4B3A A;  2M2E A;  3MKL A;  3BTI A;  1MBG A;  5GPC A;  3Q0V A;  1GUU A;  3BR0 A;  4A3C J;  5K7H A;  2HOS A;  3BTJ A;  3Q0U A;  2R7Z J;  3CCY A;  4XRM A;  2FX0 A;  3L1P A;  2WV1 A;  4M3G A;  1VFC A;  1MBH A;  2XPV A;  2R92 J;  1BA5 A;  1APL C;  4BXX J;  4BBR J;  2E2I J;  2R5Z A;  2DJN A;  5C4X J;  3H0G J;  1AU7 A;  4IHX A;  2R93 J;  2EZL A;  2DMU A;  3HGG A;  2LKX A;  2R5Y B;  3NAR A;  1T56 A;  3A02 A;  2XSD C;  1RES A;  3PO3 J;  3ZQG A;  2ME6 A;  3GTL J;  1MH3 A;  3FIS A;  5EYR A;  3HDD A;  4I6Z A;  4I76 A;  4IHW A;  4A3G J;  1WH7 A;  1JKQ C;  4FE7 A;  5M5W J;  2X6O A;  3BR2 A;  4B1R A;  4A3J J;  2XB0 X;  1X2M A;  3JRC A;  1SFO J;  2LVS A;  2Y9Y A;  2CU7 A;  1HOM A;  3GTO J;  4MO7 A;  1XG1 A;  3LNQ A;  4AYB N;  1IJW C;  1OCP A;  1JTX A;  2QCO A;  5K7F A;  5M5Y J;  3K7A J;  5IOZ A;  4MIM A;  2KT0 A;  5M5X J;  1VI0 A;  3W6V A;  2HI3 A;  5EDN A;  1BW6 A;  4RBO A;  1RKT A;  2M34 A;  3CQZ J;  1U78 A;  1ETY A;  5GP9 A;  1JJ6 C;  2LFB A;  2O9L A;  3LSG A;  3OSF A;  5DS9 A;  2NOG A;  1PUF B;  5J1U A;  4ABZ A;  3LSP A;  2MG4 A;  1AHD P;  5IYD J;  2VKV A;  3S15 J;  3G1L A;  3A03 A;  4JYK A;  4L5E A;  3GTQ J;  5J3L A;  3GTJ J;  2B63 J;  4D5C A;  1GV2 A;  2K40 A;  3S1R J;  1HDP A;  4A3E J;  3MVP A;  3HOX J;  4UUS B;  1IUF A;  1JUM A;  1I6H J;  3O8H A;  1Z77 A;  2L0K A;  3RQI A;  3O8G A;  2Y2Z A;  3JRA A;  1H8A C;  5HOD A;  3JR9 A;  4A3D J;  4UUT A;  4XIC A;  2DA3 A;  1B8I A;  1MBJ A;  1HCR A;  1NK3 P;  1FTT A;  5F04 A;  2MSY A;  1MBE A;  4V2F A;  2DMQ A;  1LFU P;  2O8K A;  2L7Z A;  4C3I J;  1UG2 A;  4W97 A;  2JWT A;  5F27 A;  5M3F J;  4M3B A;  3GTM J;  2HXO A;  1XS9 A;  3S17 J;  3S2D J;  3QPS A;  3BR1 A;  2X9D A;  5FLV A;  1D5Y A;  2R5Z B;  3BG5 A;  5FKN A;  5FJ8 J;  3GTG J;  3ZOB A;  3S2H J;  4QIW N;  4A3M J;  3HKZ N;  1HDD C;  1ZR2 A;  1EF4 A;  2MW8 A;  3HOY J;  3IH4 A;  3FK7 A;  2ID6 A;  2I10 A;  4MLO A;  5JLX A;  5F0H A;  3UKG A;  1MSF C;  3GTK J;  5EEA A;  3JRI A;  2EQR A;  3B6A A;  2VUM J;  3M3Y J;  2NVY J;  5E3L A;  2OPT A;  1JKP C;  4C3J J;  3IH3 A;  1RKW A;  4A3K J;  1OJL A;  3RKQ A;  1E3O C;  3S1M J;  3WHC A;  1Z0X A;  4G12 A;  4S0H B;  1JT0 A;  1TWA J;  2HYJ A;  3Q0W A;  2LTP A;  4M3E A;  4RDU A;  3BQZ A;  3MN2 A;  1CQT A;  5EZG A;  4BY1 J;  4LOC A;  4C2M J;  2K9S A;  2DA6 A;  1RPW A;  3G1O A;  3VPR A;  1JT6 A;  1OFC X;  2DTZ A;  3CDL A;  1FTZ A;  1GV5 A;  2FD5 A;  3BTL A;  1TWG J;  4A93 J;  2L7M P;  4QTR A;  4A3F J;  1WH5 A;  2NS7 A;  4A3B J;  4JP0 A;  1MBF A;  1I50 J;  3H3V K;  2IAI A;  1WCM J;  3JRE A;  4Y52 J;  2FQ4 A;  2PMZ N;  3A01 A;  1FEX A;  2DMN A;  2ZB9 A;  3CMY A;  2Y9Z A;  1WGX A;  2ELK A;  3D1N I;  3S14 J;  1ZR4 A;  1H88 C;  3S1N J;  1ZQ3 P;  2IEK A;  4X1E A;  4EEF G;  2MGQ A;  5F0C A;  4DZP A;  2E2H J;  1B8I B;  1UMQ A;  5EG0 B;  1DU6 A;  1ETW A;  2P81 A;  2DA2 A;  4FE4 A;  3K2A A;  2GM4 A;  1QRY A;  4DYC A;  2Y0S N;  1X58 A;  2CJJ A;  3Q3S A;  1Y1W J;  3HOW J;  1JTY A;  5FKK A;  4D7N A;  2CQX A;  4DYR A;  3JRB A;  4D5F A;  4CYC B;  1ITY A;  3HOU J;  2DA5 A;  4V2G A;  4AC0 A;  1ZK8 A;  1XC5 A;  4A69 C;  3BR3 A;  3OOU A;  1JGG A;  3TW6 A;  2AO9 A;  2XRL A;  1B72 A;  1AKH B;  5EGO B;  5EG0 A;  2XPU A;  3BR5 A;  2NVX J;  1U9N A;  3HM5 A;  3JRH A;  2XGE A;  3SFI A;  4Y7N J;  4C3H J;  1JUP A;  3BG9 A;  5C44 J;  1QVT A;  5IYC J;  2DA4 A;  4JX4 A;  1TWC J;  3BG3 A;  3OIO A;  2LLK A;  5M3M J;  2CQQ A;  4DW6 A;  5F08 A;  5E3M A;  4CYC A;  4XRS G;  3HOZ J;  2N8G A;  1ORK A;  2ECB A;  1ZGW A;  2E1O A;  2X48 A;  4XK4 A;  1W0U A;  5IP6 A;  5IP7 J;  2HXI A;  1IC8 A;  2QF7 A;  1JKO C;  3JRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...