5M3MJ

Free monomeric rna polymerase i at 4.0a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 15
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m3mJ00
3FKIJ 1MNMC 2KDZA 2ECBA 2CRGA 3WHBA 3BG3A 4MLOA 1PUFB 2WV1A 2R5ZB 5EEAA 3BR0A 4FCYA 1JTXA 2R92J 3M3YJ 1BA5A 1Z77A 2E2JJ 3NARA 3OSGA 2ZB9A 3LSJA 2JN6A 3S1MJ 4UUSB 1TC3C 4A3MJ 1SFOJ 3S16J 1SANA 5M5XJ 2CUEA 2Y0SN 2EBIA 5F0FA 5HODA 3H0GJ 4AC0A 5IP7J 1VI0A 3ZQHA 2QF7A 5EG0B 3JRCA 1RESA 2VPRA 1UHSA 1W0TA 3IH3A 3ZQGA 5DTDA 1BW5A 2OPTA 3ZQCA 3LSGA 3E7LA 5F04A 1ZKGA 1MH4A 4UUTA 2DA2A 4XRSG 1LE8A 3HKZN 3LNQA 2GM4A 3RZDJ 5M3MJ 1GT0C 3B6AA 2DA6A 3G1LA 2DJNA 3W6VA 2NS7A 4C3HJ 2X48A 2LFBA 3GTPJ 4DW6A 3BR5A 2MSYA 3BG5A 3SFIA 1IRZA 2R5ZA 4XRSA 1ORKA 3HGGA 1GDTA 1MSEC 3WHCA 3ZOBA 1MH3A 1XG1A 2XGCA 1FEXA 1Q1VA 2M9HA 5M5WJ 2AO9A 3D1NI 5FKLA 1IDZA 2XSDC 2Y9YA 4I6ZA 4L5EA 1QPIA 3OSFA 5F08A 1MBFA 2K9QA 4RDUA 4JX5A 1IUFA 1OCTC 2MGQA 3Q0VA 4QSHA 2NVYJ 1ZTRA 3BTCA 4FE4A 3BG9A 2M0CA 1MBGA 2TCTA 1A6IA 1R9TJ 3BT9A 1TWHJ 4XRMA 3OIOA 1WGXA 2QCOA 1E3OC 3S2DJ 1ITYA 4JP0A 1H88C 3Q0UA 2HOTA 2LKXA 1JUSA 5FLVA 4V2FA 2DA7A 2VUMJ 3NAUA 1X2NA 3GTGJ 1A5JA 4C2MJ 5EZHA 2JA8J 4FE7A 5EGOA 3CMYA 4BY1J 5EDNA 1U78A 3S2HJ 1WPKA 5F0HA 2R5YA 1ZR4A 1VFCA 1B72B 1WI3A 2K40A 4A3IJ 5GP9A 2M34A 2L0KA 2NS8A 4J19A 2EQRA 4IEJA 1EF4A 2O7OA 2JJ7A 1MBEA 2DA3A 3CDLA 4DYQA 2TRTA 2HOSA 4M6VA 1GUUA 5E3LA 3TEDA 1IV6A 5F27A 5FKMA 2EZIA 2CUFA 1NTCA 5IP6A 4M3FA 3TP0A 1QVTA 4MFDA 4DZPA 3LOCA 2JA6J 1F36A 4D5FA 2R7ZJ 2DA5A 1CQTA 2M2EA 1RETA 1W0UA 2DMQA 1IG7A 2EZHA 2YU9J 1ETWA 3SDGA 5EYRA 1FJLA 3CQZJ 4BXXJ 2DMNA 2IAIA 1X58A 1I50J 1P7IA 4JX6A 5C3EJ 2Y31A 3HOYJ 2JMWA 2CQQA 4MO7A 3G1MA 3HGYA 3GBGA 3JRDA 1FTZA 2KT0A 1QRYA 2R93J 2JA7J 2K9NA 3C2BA 3BR1A 2DN0A 2JK3A 3HDDA 3A03A 1T33A 5K7HA 4CYCB 2R5YB 2WAQN 3JRAA 1K83J 1ETQA 1HF0A 2E2HJ 1HLVA 1IC8A 1JT0A 2LD5A 1MSFC 1RPWA 3HOXJ 4M3GA 4DYCA 1MBJA 1BL0A 1ZK8A 3A02A 3ZQIA 5J3LA 1Z0XA 5F0CA 2YS9A 3BR6A 4IHVA 1GV2A 2O8KA 1ETVA 4JYKA 4NDLA 3K7AJ 2XPVA 1FIPA 4UUSA 3S17J 4A3LJ 4QTRA 2XB0X 4C3JJ 5IYBJ 1OFCX 1GVDA 3TW7A 4DZJA 1JTYA 4Y52J 1AHDP 2AHQA 2CU7A 3FISA 3RQIA 1B8IA 2HXIA 2CQXA 4GFBA 1AKHB 2ECCA 2GBYA 2NOGA 2HXOA 3FK7A 2EZLA 3JR9A 2MG4A 1JT6A 4M3BA 1OCPA 5J1UA 3RKQA 2XGDA 5J1RA 2PMZN 2XB5A 4A3FJ 5FKNA 3TP3A 3FIWA 4BBRJ 3A01B 5M5YJ 2Y30A 5F1JA 5EZGA 1YRNA 5BNGA 4AYBN 4I76A 5GPAA 1VF9A 2EZKA 1JUMA 3JREA 1I6HJ 5FLMJ 2E1OA 4G12A 1BJZA 2E2IJ 3S1NJ 1WCMJ 4XICA 2X6OA 1JKQC 2DMPA 4B4CA 4A3BJ 4X6AJ 5FJ8J 3JRHA 5DS9A 2DA1A 2R0QC 1JKRC 1TWGJ 3Q0WA 3G1OA 2DMTA 2XPWA 1HDDC 3S15J 4FISA 3GTLJ 1Y1VJ 4LOCA 3GTKJ 1MBKA 2LK2A 4W97A 5FKOA 3LSRA 3HB9A 1NK2P 5FKKA 1AU7A 2NVXJ 3LSPA 2LY9A 1AKHA 3HOZJ 4W1UA 4A69C 1H89C 1ETKA 1MBHA 3I4MJ 1HOMA 2WB1N 3HM5A 3IV5A 9ANTA 3QPLA 2H1KA 2RAEA 1WH5A 2HOAA 2H8RA 3BTLA 1OJLA 3S14J 2FJ1A 1QVUA 2G0EA 2LLKA 2VKVA 5IYCJ 1B8IB 4MFEA 4FTHA 5IPAA 2ELKA 1U9OA 4CYCA 4C3IJ 1ZR2A 1JUPA 2IEKA 3RZOJ 4A3DJ 4IHYA 3L1PA 2NVQJ 4BBSJ 1RR7A 2XRLA 1ETXA 1TWAJ 3GTJJ 1K61A 2B63J 3I4NJ 1H8AC 3UKGA 2JA5J 1G2HA 5J1YA 1FIAA 1P7JA 2L7ZA 4B1RA 5GPCA 1T56A 4AUXA 3MN2A 1F43A 2LP0A 2L9RA 2OF7A 2Y2ZA 5JLWA 3CCYA 1JGGA 1D5YA 3Q3SA 5E3OA 1UG2A 2HQ5A 4BY7J 3O8HA 5IOZA 1ZQ3P 1IGNA 4A3EJ 1ETYA 4Y7NJ 2E19A 4XK4A 1LFBA 5IOYA 3VPRA 1JJ8C 1RKTA 3BQYA 2HYJA 3A01A 1XC5A 3BR3A 4S0HB 4A3KJ 5M3FJ 2ME0A 1JKPC 1X2MA 2GLOA 2LR8A 2CJJA 2O9LA 1YRNB 3JRBA 3BQZA 3DCFA 2NVTJ 1HCRA 2XPUA 2I10A 3JRFA 2VI6A 3TW6A 4JX4A 1LE8B 3HOUJ 2EH3A 2P81A 5E3MA 1FTTA 1APLC 3B6CA 3BR2A 1ZGWA 3M4OJ 2VKEA 1IJWC 3HOVJ 2IBDA 2Y9ZA 2DMUA 1POGA 2FX0A 4V2GA 1NK3P 1XS9A 3PM1A 1HDPA 2LVSA 3O8GA 2FQ4A 3JRIA 2N8GA 3ZQFA 5EF6A 1LFUP 3IH4A 3HOWJ 3PO3J 1ENHA 1O4XA 3S1RJ 1PUFA 2HDDA 3GTQJ 5K7FA 4RBOA 1U8BA 4XIDA 3ZQLA 2K9SA 3BTIA 5JLXA 4QIWN 2JWTA 4A3GJ 3QQAA 5C4XJ 4IHWA 4MIMA 4B3AA 1Y1WJ 5C4JJ 2W48A 2ME6A 3GTMJ 3H3VK 2MW8A 2COBA 3FK6A 4D7MA 4BKXA 1TWCJ 1RKWA 4M3EA 2M8GX 3GTOJ 4DYRA 5E3NA 4X1EA 2HI3A 3SJMA 3BTJA 1GV5A 4D7NA 4HNVA 2FD5A 1U9NA 5EG0A 5IYDJ 1S7EA 2LTPA 1JKOC 2L7FP 3QPSA 1IDYA 5EGOB 4A3CJ 1DU0A 3JRGA 2DTZA 4A3JJ 1ETOA 3HEFA 5IP9J 3DEWA 3MVPA 1BW6A 1WH7A 1DU6A 1I3QJ 1VNDA 4A93J 3S1QJ 2XGEA 3IH2A 5C44J 3HBLA 4IHXA 1TWFJ 2X9DA 3MKLA 2D5VA 2ID3A 2L7MP 2DA4A 4EEFG 2ID6A 3F0CA 3K2AA 1UMQA 5K7ZA 1B72A 3PO2J 4D5CA 4M3DA 1JJ6C 4ABZA 3OOUA 2YUSA
chains in the Genus database with same CATH superfamily
1MNMC 4Q48A 2P7VB 2QQ9A 2CW7A 2HVRA 3LAJA 4IQJA 2HTJA 2F6CA 2FBIA 2F48A 2D1VA 1YG2A 2CMPA 2IXSA 5JHUA 4N4NB 3RTRA 5H6QA 3I59B 2R92J 1IF1A 2E2JJ 2XAGA 1UCRA 1EH6A 4UUVA 1QO0D 2ZB9A 5ICFA 2EJRA 3HRUA 4QLCU 2KIFA 3AL0C 2E7WA 3H1CA 2FA5A 2VJ4A 1SFOJ 3S16J 2F2EA 3KZZA 1B6AA 2KPMA 4CA0A 2X6XA 5FRMA 1LDJA 2EBIA 2PFBA 2ADUA 4I7HA 4YEJA 4PZJA 1Y0UA 3OYBA 5IP7J 1VI0A 3ZQHA 5EG0B 2LREA 2O03A 3CUQB 4RAYA 4KFCA 2XAJA 1W0TA 2KL4A 2X1DA 3IH3A 5DTDA 1S72I 3ZQCA 4ITVA 4NQWB 5B5EC 1MH4A 4UUTA 2VIXA 4XRSG 2YU3A 4OIOF 3QOEA 2K85A 1GT0C 5FROA 3B6AA 3OYAA 1P6RA 5KAIC 4BJTA 1IUYA 2QUFA 1VQ7I 2M7AA 5BS6A 5J8CA 2X48A 4YRVA 4EGYA 2GOMA 3H5NA 2XASA 1KYWA 4CHUA 4ZC3A 3I4PA 1IRZA 3TOBA 1GDTA 1MSEC 3WHCA 4AIHA 1XG1A 1FEXA 1WRJA 3D1NI 2IRFG 5FKLA 1IDZA 2UXNA 2Y9YA 2XSDC 2VQLA 5CKTA 1X4OA 1U5TB 1B1BA 1BC8C 4NC7A 3ZMSA 1WHUA 4LG3A 3V7CA 3IKVA 4QSHA 1ZHFA 1ZTRA 1UG0A 5E20A 4C2TA 3BG9A 1HKQA 5LFAA 1VQ5I 3MZYA 1A6IA 1UB9A 2JPCA 5E1WA 1FY7A 3U1KA 3S2DJ 1ITYA 4PSWA 1IN4A 2Z16A 3E6BA 3GVAA 3Q0UA 2LKXA 3NWSA 4HQEA 3SZTA 4V2FA 4E7KA 1DQUA 2DA7A 3GTGJ 3E0JB 2FBKA 2FF4A 5EZHA 1A5JA 1K4TA 2EB7A 3IP4B 5EGOA 4IJAA 2FNPA 4L9JA 2UWMA 2TDXA 3VEPA 4NQWA 4XL9A 4KICA 4YFXF 2K9MA 1WPKA 4Z6YA 2R5YA 2WY8Q 2DOFA 1T38A 2ZJ2A 2NS8A 1ZYRF 4J19A 1D0XA 3RPUD 2O7OA 1R1UA 5H6RA 2TRTA 2HOSA 3F8FA 3TEDA 1F1ZA 1HBXG 1YHQI 5J8FA 1T8IA 1X4PA 5EJCA 2LY2A 4MFDA 3FMRA 3R61A 3RCOA 3H35A 1UZCA 3OOPA 4DZPA 3CMAI 4WWCA 2VOPA 4AIKA 2CYYA 4HV5A 5FD5A 2EZHA 2YU9J 1JXSA 1EH7A 2O6GE 3SDGA 3CC4I 3HOTA 1FJLA 1D8KA 1J7KA 3CQZJ 4HF1A 5FLXK 2IAIA 1X58A 1I50J 1XPXA 1P7IA 3QPTA 2VE9A 3WGHA 3HOYJ 3WTUC 1K4SA 2HKOA 4PJNA 4G6DA 1MW7A 4MO7A 3G1MA 3HGYA 3GFIA 4EM0B 3C2BA 2DN0A 3BJOA 3BR1A 3PQKA 3FXKA 2GXGA 1T33A 2A05A 2Q1ZB 2R5YB 2ZMEC 4XONA 1K83J 1SFXA 1HF0A 1MSFC 1F4KA 1Q1HA 2VBZA 3ZR8X 1ZN2A 2CS3A 3HOXJ 2R7TA 1MNEA 4BJ6C 5J3LA 4ENNA 1D1CA 5F0CA 3IHUA 3AL0B 1IN6A 2Y0MA 3FBNB 2BOLA 2O8KA 4NDLA 1TLHB 5D5WB 1SVMA 2A5YB 1MDMB 3S17J 3GW2A 2DT7B 2R7QA 5TGTA 2KIUA 1STZA 4B44A 1KQ8A 3C3WA 3E6DA 3JW4A 3G2BA 5GAHJ 3FM5A 5H20A 4DOZA 3CMEI 1GVDA 5EEHA 5LHIA 2EFQA 1JTYA 3DLAA 1U5TA 1AHDP 2CU7A 2YPRA 2HXIA 2CQXA 1FWZA 2V7FA 2GBYA 1D3YA 1D1AA 2HXOA 5KCMA 3V8KA 3BZKA 1QGPA 5E1XA 5FB2A 4M3BA 4IHTA 4ETSA 3DTKA 2XGDA 1OCCH 2F4IA 2XB5A 5FKNA 2OTJI 5HNFA 1SAUA 2H6BA 3HUGA 4NC6A 2WBMA 2ISZA 4RMNA 1YRNA 3IRRA 3T8TA 3IAS2 3JREA 1JUMA 1I6HJ 3KYLA 2BV6A 2R7VA 3CUQA 4G12A 1WCMJ 1YIJI 2E34A 4F52A 1W7PD 3M8FA 3V42A 1A31A 3LA2A 1TWGJ 3EQLF 2VPLA 4KMUX 5ICEA 5L3GA 5JVTA 2XPWA 4R8HA 4HNTA 3GTLJ 4G6TB 1Y1VJ 4HLYA 4LOCA 1E3HA 2E71A 3LSRA 4PGGA 4W97A 1AWCA 3GTKJ 4L0YB 2FXAA 4G7ZF 2LY9A 1GLNA 1ETKA 4WXHA 4UV8A 3M7GA 3T1BA 3HM5A 4ZYDA 2E5ZA 2P6SA 2ETHA 3OR1C 1WH5A 4E7LA 2OAZA 3HIFA 2BE5F 2HS5A 5EEGA 5HS8A 2GXAA 4NBQA 2DBBA 3E97A 1QVUA 4XM3A 5IYCJ 3I0TA 2AS5F 1QHHD 3GF2A 3GLLA 5CYVA 3E5UA 2XGXA 4FTHA 4XN0A 3DXJF 2GAUA 3RYPA 4CYCA 2F5CA 4M6YA 1JUPA 3MD2A 3CC2I 2XF6A 4A3DJ 4IHYA 3L1PA 3HPHA 3RPQA 5ILVA 1KZHA 1T98A 1RR7A 1S6LA 4Y15A 1TWAJ 2CUZA 4KNYA 3E1SA 5IT9Z 2V6CA 2Y75A 3NEUA 2JA5J 4ZTFA 3DP7A 5J1YA 5ILSA 1ZRDA 1KU9A 3HRTA 1T56A 1LDDA 1ZRCA 1N25A 3HHHA 1XCBA 3FM3A 3OYCA 2A6TA 1XCVA 3LAPA 5DD4A 2Y2ZA 3K4LA 5JLWA 4IOAF 1JGGA 2G9WA 5E3OA 3K1NA 5ICGA 5FD6A 2KQRA 4K2EA 2HQ5A 3S2WA 3LQRA 3MKYB 3FZVA 2K5CA 3F8CA 3G3ZA 2DPDA 2E19A 4KN7X 4XK4A 3T8RA 3F6VA 4FASD 3VPRA 1LJ9A 1JJ8C 1RKTA 1X1AA 3CCUI 3GZNB 4A3KJ 1FSHA 2LF8A 3IWZA 4D9JA 2LR8A 4CSWA 2CSOA 2PG4A 2RQQA 1YRNB 3BQZA 1JGSA 1R49A 1E0EA 1LKXA 2MD0A 3G6EI 3EUAA 2CFXA 2H1LA 1UAAA 3BY6A 4L18B 3BR2A 1N75A 2M45A 1WJAA 3ASNH 1IJWC 2BHZA 3G73A 1Z05A 3EETA 1X3ZB 3Q9VA 3BLYA 4CCKA 5CVVA 2R7XA 1XS9A 4XSZF 2RDPA 4IVNA 5KAFC 1HDPA 3WTSC 1LVAA 1FYLA 1OR7C 2QGUA 2XIGA 3S1RJ 3GZ5A 1PUFA 1YITI 5K7FA 1TL8A 1BJAA 3RSNA 1U8BA 4XIDA 4A5NA 1U5TC 5HLIA 4LG0B 3BTIA 2EPFA 4PCQA 1VQOI 4A2UA 1X19A 5B66C 3FHNA 4A3GJ 4B3AA 1CF7B 4ZYHA 2W48A 3V7RA 2UV1A 2V79A 4LD5A 1XDUA 4E7ZA 4L9NA 4M9XA 2OCEA 3L2RA 1R1VA 3K1PA 4DIQA 4BKXA 1TWCJ 3DEUA 4MNUA 5HLHA 1U3EM 3RPUA 4M3EA 2M8GX 4HX4A 2IA1A 5HNHA 3BOQA 3GTOJ 2CV0A 2O5RA 2WY7Q 4X1EA 4CO8A 3BTJA 2GQQA 2MH9A 4HDVA 5CQEA 3PUBA 4D7NA 4HNVA 3E6CC 1U9NA 2HU9A 2QZ8A 3DBHB 4M71A 3ECHA 2Z2SB 3KIOA 2ZO4A 1DU0A 3JRGA 2ZC2A 4OIQF 2QKLB 5A2QK 3HEFA 3DEWA 2HNHA 1DU6A 1WJEA 5D4RA 4IL6C 3S1QJ 2XGEA 3EUHC 1NG7A 2CG4A 1MNDA 4IHXA 4XQFA 5HS9A 3ECOA 2DT5A 1D0ZA 3K2AA 5LGUA 1CGPA 2ZXWH 1B72A 2VN2A 3J81Z 4RGSA 4M3DA 3OOUA 2YUSA 2DOEA 2RREA 2ECBA 3WGGA 3R60A 2CRGA 3BC8A 2VKDA 3I71A 3BG3A 4MLOA 3COAC 1I27A 1FNNA 2KIQA 2KJCA 2KZVA 5EEAA 3W2AA 3VDXA 2J5PA 4KDPA 1UJ8A 4PJJA 1RI7A 2YX4A 3MZHA 4KITB 3MCZA 2CGPA 5CVUA 4XLHA 3SEQA 3ONQA 4HRIA 2IPQX 2XROA 4UUSB 4UB6C 1Z3YA 4A3MJ 3I5UA 1FP1D 2VXDA 3KP5A 4PGHA 1XDSA 3DU6A 2CUEA 3VB2A 4E7HA 1SMYF 2IGKA 2P6TA 1JHHA 2NYXA 1KQ0A 4UVBA 1S5LC 2P7CB 3JRCA 2FQ3A 2IGOA 4U7DA 1UHSA 4XLFA 4XKVA 1PDNC 1TT0A 1G8XA 2KZGA 2DW4A 3K1MA 4CXFA 2ZFUA 2HYGD 2CQ7A 5F04A 3EUKL 2IS2A 2HZDA 2DA2A 2R7FA 1LE8A 1R7JA 4A5MA 1XN7A 3GLXA 3LNQA 3ZMTA 2COMA 4IX7A 1W36D 2EFWA 3HRSA 4BHCA 4RLFA 3CUQC 5FGMA 2FSWA 2DJNA 4KUMA 3J7ZI 4C3HJ 1Z67A 1HKTA 2LFBA 1L0OC 3KEQA 1ZG5A 3GTPJ 1SFEA 3PNTA 3LFKA 4XRSA 3HGGA 1BR1A 4A6EA 2R5ZA 3KZIC 3OWTA 3TMOA 3S3NA 4A6DA 3ZOBA 1MH3A 2VQCA 2XGCA 4RM3A 5DM7F 2NAZA 5BPIA 3K4JA 1R22A 1Q1VA 2K3FA 2OQGA 4BHBA 4DBQA 4I6ZA 4L5EA 2JQ7A 4Z2YA 2DT6A 1MBFA 2EV6A 3SQNA 3O3KA 2BYVE 2KMUA 2IS1A 1DDNA 4ANJA 4E6KG 3VWBA 1RR8C 4M9SA 1MBGA 2TCTA 4BL0B 3CCLI 1R9TJ 2HOEA 1MJAA 2QCOA 1E3OC 2QKMB 1I3AA 3WU1B 1H88C 2X0LA 3F22A 1XSXA 1PP7U 1DPRA 2MYSA 4YIFA 2VUMJ 4YIIA 5TJJA 3H5AA 1G3SA 2M3AA 4FE7A 1J09A 5EDNA 3DKXA 3H5RA 5D4SA 1U78A 2L02A 2ZMEA 4EVIA 1VFCA 2K40A 4AWXB 4RAFA 5D6FA 4BEHB 2EA2A 4HA8A 2QQAA 2DDBA 2YR2A 3DLLF 1TQMA 2DA3A 3CDLA 4DYQA 1RRJA 4G8XA 4M6VA 3J81K 1O3QA 3GYHX 2VJ5A 3LA7A 1YW8A 4RGRA 1NTCA 3HZJA 4M3FA 1QVTA 2WV0A 3LOCA 3JSOA 1Z21A 4D5FA 4ZDPA 4BQQA 2XHKA 2PI0A 2L01A 2M2EA 2MC4A 1Z1DA 3CO6C 3F8NA 3CLOA 1F9NA 1XMXA 4L9VA 1IG7A 1WJDA 3KE2A 1ZARA 3MQ0A 3D5RC 4BGDA 2PEXA 1B4AA 4CGZA 3VYUB 2W25A 4M73A 3WTXC 3WE3A 2CQQA 4EM1A 1IZ1A 3GBGA 2W57A 3E3VA 4WXDA 2KT0A 1QRYA 4ZYEA 2K9NA 2JK3A 2Z99A 2XAUA 4OIPF 4DNCA 5K7HA 5IY5H 4CYCB 1IXSB 3ABMH 3JRAA 2BY0A 3V8LA 3J7AY 2E2HJ 1HLVA 1W1WE 1IC8A 1JT0A 4A12A 3CMMA 1V5EA 2QQBA 3L2WA 5HLGA 5D8LB 1IRFA 1Z7UA 3HRMA 1BL0A 1ZK8A 2E5NA 3A02A 2WAFA 4ZYGA 1IV8A 1FX7A 2STTA 4IHVA 1GV2A 4LJZF 3W6KB 5L3EA 1VQ9I 4JYKA 3DBRB 4AU7A 2XUBA 4IPAA 4UUSA 1FIPA 3TDUC 3V7SA 4QTRA 4C3JJ 2DTRA 2O0YA 3HYIA 4XR6A 2F5DA 4HX8A 4MGRA 3TW7A 5KVRA 1RNLA 3ZMZA 2AHQA 1U0JA 2PX9A 3RQIA 3W6JB 2JRMA 3QPHA 4R1HA 3LSKA 4GFBA 2ECCA 1R4NB 2NOGA 3FK7A 2EZLA 3T0YA 2EA4A 3JAMZ 3K4BA 3R6SA 1MD0A 3L9FA 3U1DA 5J1RA 2PMZN 5D5UB 2Z9OA 3WU0A 3K70C 1IW7F 4NHJA 2DFIA 4II2A 3FIWA 4EJVA 4BBRJ 2MD5A 3A01B 4B43A 1Z91A 4HNUA 2KP6A 1R71A 3FXJA 4F7ZA 1YE9A 4I76A 4MTDA 1QZYA 5BPDA 4UB8C 5HS7A 3ZGKA 2W7NA 2LYCA 2Y0SA 2E2IJ 1BJZA 1DGRM 3S1NJ 4CCLA 3JTGA 4EJUA 5BMZA 4XKBA 3WTZA 1PP8F 3D5LA 4BUPA 2DMPA 4X6AJ 5DS9A 2HPIA 3Q0WA 4XNFA 1R58A 3SHFA 4BE2A 3G1OA 4C30A 1SC7A 5LLQA 1HDDC 4BQAA 4O3MA 1HC8A 3S15J 5D6EA 4EJTA 1KU3A 3DU5A 3CZ6A 2DCEA 4HW0A 1LFPA 1R23A 5LEJA 3OR2C 2NNYA 1Y56A 2QBYA 4I01A 2V9PA 1FC3A 2JUGA 3IAM2 1H89C 2L2OA 3CCVI 4KMFA 2JUCA 2UZKA 3HC7A 1V5FA 4E7JA 2WB1N 1HOMA 3IV5A 4HSTA 4JK1X 1HW5A 2HR3A 3QPLA 1X3WB 3W2VA 1PJRA 2LDUA 2HOAA 2H8RA 2MFZA 2BVLA 3BTLA 2LC2A 5LHHA 1TW3A 3S14J 2QWWA 2X4HA 2FOKA 2G0EA 2VKVA 1ZG3A 4MFEA 4HAMA 4U0WA 3G4SI 4LK0F 2QBYB 3CTAA 5JHFA 2VJJA 4IXAA 2FE3A 4BBSJ 5DYMA 1ETXA 3GTJJ 3I4NJ 1T0FA 3OYGA 1G2HA 5JI6A 2QSGX 1P7JA 1BR4A 4CCJA 2Q2EB 3MN2A 3JAMK 1VQMI 3PL8A 1V54H 3KCCA 4KJZA 3I53A 5K5OA 4UNOA 1QQIA 2W24A 2LP0A 1NG6A 3S3OA 2PJRA 2L9RA 5L3DA 2XAQA 4HYEA 1AA7A 2WAQA 1YLFA 2R7SA 1UG2A 4CZZA 3GUDA 5IT9K 3AG3H 2CQNA 1ZQ3P 2KRHA 3M1CA 3FX3A 4P9UA 3H92A 1KA8A 4MHGA 2AQEA 2QYOA 3MKZA 2HYJA 3SZGA 5LGTA 1XC5A 3BR3A 3FKJA 4S05A 3FXQA 2PBIA 3OYEA 2BXYA 2ME0A 1LEBA 3I55I 2OJED 1EH8A 1MMSA 1X2MA 2ICWG 2GLOA 1O3TA 1Z6RA 2VLAA 2GZWA 3I56I 2PMUA 2O9LA 4ESFA 3JRBA 4CICA 1TBXA 2NVTJ 1G3YA 3QU3A 1HCRA 2XPUA 2I10A 1J9IA 2VI6A 2KFDA 1BOAA 1APLC 1BIBA 2VKEA 3HOVJ 4BXFA 4EMSA 2B0LA 1POGA 3SYTA 4II3A 1R6RA 2W85A 3L2QA 4V2GA 4QPQA 3GMEA 3J80K 3PM1A 2LVSA 3O8GA 2FQ4A 1D1BA 2HQAA 2VXZA 5EF6A 2RGVA 3JRIA 1LFUP 4B3XA 2BHYA 4XORA 1MGTA 3HOWJ 1ENHA 2CUJA 4TV7A 3RYRA 3GTQJ 1K79A 2L9SA 1X3UA 4M6XA 4RBOA 3CCSI 4A0XA 4RB1A 3EYIA 3IUOA 3QQAA 5C4XJ 4MIMA 1W36C 2HEOA 3DF8A 4LLNA 1VQ6I 4LG0A 1B9NA 1T6SA 4CCMA 3K9TA 3AAFA 3H3VK 1SEUA 2H8WA 2AQFA 4HG2A 4M72A 2XAHA 4BAYA 4BNCA 3WG9A 4NNJA 1K6OA 2EFPA 2OZUA 2K02A 2ZXHA 1YYVA 2FUG2 3D0SA 1R5HA 3MKWB 3ELKA 2E1MC 1LPQA 2CV2A 3Q9SA 2G7UA 5E3NA 2Z5UA 1GV5A 4GDFA 2B7EA 5IYDJ 1S29A 1JKOC 1T08B 2L7FP 4M74A 3I58A 3PFYA 2D2WA 5EGOB 3BJAA 1MKMA 5JFRA 4EATA 2NRAC 2VBYA 1WH7A 3VYTB 2ZBKA 1I3QJ 3GCMA 4BU2A 2VONA 3DBLB 4CZCA 4A93J 4XLAA 3FXLA 3OL3A 5A2QZ 4PSXA 4KYWA 1WZ2A 3FXUA 1TWFJ 2EV5A 1LB2A 1A36A 2D5VA 4BYYA 2ID3A 2ZJPF 4LB5A 2CWEA 5K7ZA 3N4MA 1UMQA 4D5CA 4EQQA 3PSFA 3OYMA 4RB0A 1ZGJA 3BZ6A 2V26A 3FKIJ 3S93A 5GTHC 3JSPA 4PUSA 2W4SA 1FBQA 2KDZA 1K78B 4Y3OA 4AIJA 3WHBA 1RUOA 1J2XA 1R00A 2WV1A 5LRRA 4ZJZA 2R5ZB 1QZEA 2ZSHB 2QQ8A 3QWLA 3BR0A 3C2HA 3ABTA 4FCYA 3M3YJ 4F92B 1R5ID 4JQFA 2X6WA 4HSRA 1TP4A 4ASNA 2JN6A 1HW2A 2X1EA 5F64A 4HEA2 1TC3C 1IXRC 3J7AO 1SANA 5E8GA 5BQTA 3ZRGA 1R36A 3PQJA 5KHDA 3I54A 4KIBA 2DPUA 5M5XJ 1ERDA 2EV0A 2GA1A 2P0WA 2Y0SN 3ERED 2DFFA 5F0FA 2ZNYA 3RDIA 4ZDLA 1SD6A 3NQOA 2L5QA 4AC0A 2BW3A 3MAJA 4CH7A 5HDGA 1RESA 3K4MA 1Y8QB 2P5VA 2M1BA 1BW5A 2A6EF 4PJLA 5DUKA 3UR3C 3F23A 1VZ0A 2OPTA 1ON2A 3LSGA 1FOYA 1USSA 3E7LA 2EWNA 1SD7A 4WCGA 2JT1A 2CW0F 4L5JA 4D1QA 1ZKGA 3PIPF 1G59A 3WTYC 2NVUB 1REPC 4KIFA 3HL2A 2BY2A 5DCMA 3U2RA 3A2KA 1A6QA 1G3WA 3E5QA 3RZDJ 4MQ9F 5M3MJ 1QPMA 2LSOA 3R0AA 4IRGA 3HSRA 2DA6A 3RKYA 3FF5A 3QU6A 3K6GA 3G1LA 1TZLA 2XSJC 5HDNA 3W6VA 2NS7A 2PN6A 3VSLA 2RKHA 3P9CA 4DW6A 3BR5A 1IXCA 2E1CA 4P96A 2MSYA 2W84A 3BG7A 1ZRFA 3CDHA 3SFIA 2IGNA 3KP2A 1ORKA 4Q4ZF 2ZXJA 1HXDA 3OIPA 4N9HA 4U7BA 3V4GA 2X1CA 2VB6A 5D5VB 2M9HA 5AONA 5E79C 2HDWA 3C7JA 4LLGF 2M5WA 2QENA 1GVJA 2K9QA 4ZH4F 1XMAA 4RDUA 2JPBA 4JX5A 3Q0VA 1ZELA 3QRFF 2W00A 2NVYJ 3BTCA 4U0YA 4EJWA 3MFKA 3CJRB 2M8EA 1OQYA 1FOKA 1MZBA 3B02A 5DEQA 2CFOA 3BDDA 3FDYA 4GO1A 2OC6A 4DJAA 1X1CA 1UELB 3OIOA 3CF5F 1WGXA 1LNWA 3M8EA 4JP0A 3HJEA 1TNSA 5LRSA 2I8DA 2EFOA 2HQRA 2P8TA 1Y0NA 3EPZA 2FRHA 1WQ2A 1P4XA 1BN5A 1X1DA 2A3SA 2C6YA 1BR2A 5B3SH 2MLGA 3KFWX 1BIAA 4OAYA 3T5XA 5F0HA 2BXZA 1B72B 1WI3A 2HYFA 2M34A 1WVRA 2L0KA 2RC4A 2EQRA 4IEJA 5GADJ 4BACA 1E2XA 1BI2A 1SAXA 2J5OA 3MEXA 3BPXA 5F27A 3HUGB 3ISPA 3LL7A 2QLZA 3KPHA 1HA8A 1J59A 2CUFA 1Y39A 1IRXA 3TP0A 1I1GA 2WA0A 2JA6J 3NRVA 3H9JA 4PDKA 2R7ZJ 3VYSB 3I3LA 3P7NA 1W0UA 1RC9A 5LHGA 2MH2A 4HBLA 2DMQA 3ABKH 1XMKA 1DPUA 1RUNA 1I1SA 3CCRI 4BEHA 1QNTA 5EYRA 4Y33A 2LG4A 4P55A 4BXXJ 4XKWA 1USTA 2DMNA 3P9KA 4JX6A 3G71I 5C3EJ 1Z9CA 3CD6I 1T2KA 2O8XA 2W1OA 3LSHA 3F9KA 2R93J 4RB2C 2JA7J 4IRIA 4MTEA 3HDDA 3A03A 3NWTA 3CP8A 4EJOA 1JI8A 1WJ5A 3DEEA 1QHGA 3REOA 2CW8A 1S9HA 2IA2A 3HTUA 4XN3A 1RPWA 2RNGA 4M3GA 4P1WA 4DYCA 3H9QA 1MBJA 1ACIA 1Z0XA 1BI3A 1WJCA 2OCCH 1MDMA 4XRFA 3OMYA 1EKEA 4WXCA 4LITA 5TRDA 1ETVA 1OPCA 3K7AJ 1KGSA 1NHAA 4AD9A 2XB0X 4RLQA 4ZTJA 1KU2A 1Z3XA 2LRDA 3PSIA 5IYBJ 4F3QA 3LFUA 3F8BA 1G6NA 2L3DA 3I59A 1YW9A 4JBAA 4Y52J 4HDUA 5JVGF 1FLIA 5KNLA 3TO9A 3C2GA 3KP6A 4N4OB 1WWXA 4I98B 1AKHB 5LGNA 3JR9A 2HGCA 2MG4A 3ZMVA 4A3FJ 2R7RA 2R7UA 1M1EB 3QAHA 4F55A 3M07A 3R4KA 4FETA 3L2VA 4I2OA 1JHFA 4KN4X 3WTWC 2IS6A 4FX4A 4RM2A 2Y30A 4WF2A 5F1JA 1BC7C 2EIKH 4GRIA 3TO7A 4C9YA 1OYWA 2OUMA 3ZMUA 5BNGA 1VQ8I 3BJ6A 4AYBN 2FEZA 5BOXA 1O3SA 5E8IA 2DOAA 2EZKA 2R4GA 2XVCA 3DTEA 2E1OA 2F4MB 4A0ZA 4V19K 2VJIA 4PJMA 2QM3A 1O7FA 3PNVA 1VQLI 3ERMA 1PVEA 3FMSA 1XB4A 4BE0A 1XTAA 3JRHA 2DA1A 3UNGC 2NOJB 1JKRC 1MMNA 3AG2H 1ZAOA 4S04A 2M4GA 3P5JA 3TL4X 2A61A 3DPUA 2E36A 2ZFWA 4BJ5C 4IKFA 4NB5A 4GXOA 2DLLA 5E17F 3FBIB 1YJ9I 4P5OA 4A69C 5F1RA 2DDAA 3GZ6A 4RAZA 3KETA 2ZSIB 2WB1A 3I4MJ 3TO6A 3PIOF 1LEAA 1TTYA 1I39A 3OYFA 1N78A 2DJIA 3TBIA 3H0DA 3P9IA 2BZTA 1HKSA 4B8XA 2DFHA 4ON0A 3OL4A 2FJ1A 1B8IB 3M1EA 2ELKA 3RJPA 1U9OA 2L54A 4F91B 1UFMA 1WJBA 4C3IJ 1ZR2A 3CP2A 4Q5SF 2F5EA 1YTYA 4ENJA 2FNAA 3ZMDA 1HQCA 3WTVC 2X51A 1MJBA 2P4WA 3GXOA 1K61A 2KHMA 1IAWA 1LDKB 2KLOA 1H9TA 2B63J 4UXNA 2GA2A 3DTIA 3UKGA 4AYBA 2BY3A 1ONVA 3QYFA 1AOYA 2V1XA 4B1RA 5GPCA 3KP4A 4OOIA 2ESHA 4AUXA 4QWQA 3MWMA 4XOPA 1XSVA 2LMDA 3CCEI 1F43A 3CCQI 4LIUA 1A04A 4NC8A 2OF7A 4PK4A 3OYJA 1VQ4I 3IRQA 2F5FA 2K4JA 3N05A 1D5YA 1G4DA 1KQ9A 4BY7J 2WADA 3X2QH 4CYDA 3O8HA 4L5IA 1OCZH 1L3LA 4RB3C 4Y7NJ 4IOCF 1FBSA 5IOYA 1OCRH 2L4MA 2ZXIA 3BQYA 3CUOA 2HPMA 3A01A 1V4RA 4S0HB 2EK5A 1JKPC 1VTNC 2KRFA 3LQQA 2VODA 3VFZA 3QYBA 2L4AA 2A5WA 1TW2A 4BE1A 2DXIA 2STWA 6PAXA 2V1UA 1KONA 2XAFA 2UUZA 3OYLA 5B1BH 3JRFA 5HLTA 2V4JC 1OR7A 4XBFA 2OD5A 2EH3A 3HOUJ 4YG2F 3F6OA 2P81A 5E3MA 2M4KA 3B6CA 2LOOA 2PMZA 3M4OJ 2VE8A 5KK1A 1QA6A 3CF2A 4KIGA 4AM3A 2FMLA 2DMUA 4HX7A 2RVCA 5LEKA 2GXBA 1QBJA 5FO5A 1NK3P 4BXUA 1OISA 3QOPA 4I0AA 2DK8A 4CCOA 2DK5A 1KYZA 3WGIA 1SVLA 4Y4RA 2V9KA 4HV6A 3IWFA 4WK8F 3IH4A 2KKOA 3F8MA 1O4XA 2HDDA 2HVSA 1P92A 3N97A 2IS4A 4OU0A 2VASA 3LA3A 1DP3A 1W5CC 2IP2A 2K9SA 4MQVA 3H3ZA 4UHTA 4IHWA 2HWVA 1Y1WJ 2VT3A 1BM9A 5K5RA 2ME6A 2LBFB 3BCAA 4MEYF 3GTMJ 2PLYA 4EM2A 5K1YA 3HKZA 4G7HF 2FOWA 2ZNZA 4P9FA 3ZP5A 3ZQ7A 2COBA 2M7BA 2LNBA 3FK6A 2H94A 4OIRF 3OY9A 4LMYA 2Z33A 2CV1A 1RKWA 2GWRA 4BQNA 2HZTA 2Q0OA 3ML6A 4OMZA 5HVQC 1HSJA 4MEXF 1F5TA 2HI3A 3SEZA 4HPQA 4AVZA 2BW3B 3HSFA 4FQGA 2Y69H 1OKRA 2FD5A 2O3FA 1S7EA 2E1MB 2ACJA 3QPSA 3GEZA 1IDYA 5L3BA 1QZZA 2HKXA 3OYHA 2DTZA 3A1YA 4FX0A 1P4AA 1TNTA 3HTSB 2XKOA 2CO5A 3LSIA 5FFZA 1U8RA 4UY8I 5HOOA 2L9NA 3MVPA 1BW6A 3WU2C 3A4CA 3OS0A 1S8NA 2QEXI 4BDYA 1GHCA 4DBRA 3IH2A 5C44J 3HBLA 1Y8RB 1WJFA 2EILH 2X9DA 2XDVA 2M30A 2MBFA 2ID6A 1V3FA 1W4MA 1HW1A 1V55H 1OLTA 4ABZA 3L7WA 2LY1A 1Y6IA 1J0RA 5TISC 2OTLI 2Z3YA 2MABA 1TT5B 1EA3A 3C18A 4CCNA 1FPQA 1BI1A 4RS8A 3DV8A 3D5SC 2LH9A 3K2ZA 3QP5A 4Y17A 1YO5C 2EIMH 1PUFB 2LKPA 3OS2A 4A0YA 5J47A 3ZPLA 4L0ZB 3QODA 3ULQB 5IT3A 5E18F 1JTXA 2GOXB 3CJNA 1Z77A 3PUFA 1BA5A 1P2FA 3CLQA 5J6XA 4EV0A 1Z7LA 3NARA 1FMWA 2OZ6A 4IQ4A 3OSGA 2IGMA 3ZCOA 3W3CA 2JRTA 3KX2A 3LSJA 3S1MJ 5GTIC 2KISA 5LD2C 2JZYA 3O6BB 3WG7H 1FT9A 1YS7A 1WFXA 4KT6A 3K4KA 3CCMI 4IO9F 2KDOA 1KU7A 2E60A 2BGCA 1FMVA 1P9QC 2H6CA 3TDZC 5HODA 4U0VA 2MA3A 2WTEA 3KP7A 3H0GJ 5DDGA 5H2FC 4XLPF 2OA4A 2LKSA 3E6MA 3ABUA 4ZZDA 1MMAA 2QF7A 3SDBA 4ZZLA 2HVQA 2VPRA 3GO5A 1T0FC 3ZQGA 5LBQA 1LQ1A 2M87A 3PJRA 1S7AA 1N77A 4O5VA 1ZG1A 5CQGA 1IRGA 3L2UA 4IZZA 2ZKZA 3HKZN 2IJLA 2QSFX 3PFIA 4QPOA 4DGWB 2EINH 2GM4A 3CDIA 4X0GA 1DP7P 1T95A 2Y48A 4YFNF 2VBXA 3DPTA 4UV9A 3JTHA 1SFUA 2BBYA 1YI2I 4RA2A 5DCMB 2EIJH 3TQNA 1BBYA 4PJ0C 2F4OB 3MZ8A 3OS1A 5J4VA 3RI4A 3F72A 1FYKA 3BG5A 3VYRB 3K4CA 1H9GA 3H9GA 2VC0A 3BZCA 1SMTA 2V9VA 1X1BA 2MLKA 3KP3A 4I09A 2A69F 1U6GA 1BOBA 3WTTC 3GFJA 2JSCA 2AO9A 5M5WJ 2A6HF 3HSEA 2R7WA 3TKYA 1FZPB 1QPIA 3OSFA 5F08A 1IN5A 2VKHA 2R7OA 3KYDB 4I02A 3B73A 1IUFA 3TGNA 1OCTC 4G7OF 2IW5A 2GIVA 2MGQA 2YSRA 3ZXSA 1ULYA 4BQOA 2Q2EA 5D5XB 1U2WA 4FE4A 2R3SA 2LF7A 2VC1A 2M0CA 2DI3A 3PNYA 1WI9A 4BHPA 1D8JA 3BT9A 1TWHJ 2H09A 4LK1F 4XRMA 3VOEA 2HOTA 4OAZA 1JUSA 4U88A 5FLVA 2XV4S 1YFHA 1OYIA 2WC2A 4AIDA 3NAUA 1X2NA 4C2MJ 2JVHA 5HDKA 1S7OA 3FWEA 3M8JA 3CMYA 2ZJQF 4BY1J 2JA8J 5AIPA 2DODA 2ELJA 2A68F 4JOMA 3KEOA 3S2HJ 3IL2A 1ZR4A 4A3IJ 5GP9A 4E7SA 2GIZA 1D5VA 1EF4A 3GFMA 3RQ4A 2RQPA 5J40A 4F93B 5DM6F 3BWGA 2JJ7A 2M0MA 1MBEA 2DYSH 2CQKA 3EDPA 3FXMA 2XKPA 2YX7A 1GUUA 5E3LA 3ZN0A 1IV6A 1W5SA 1XGNA 5FKMA 1D0YA 4O6JA 2EZIA 5K5QA 5IP6A 2QSHX 1SVOA 4G9YA 5CVJA 1F36A 4GCVA 4J00A 2DA5A 1CQTA 1XD7A 2O61A 3RKWA 2UXXA 4PFOA 1H0MA 1RETA 2XF5A 1OMIA 2ZMEB 3I64A 4IRHA 3SXYA 1ETWA 1MJ9A 3O2PE 5E1ZB 3QP6A 1R1TA 1MMGA 4ZYAA 1V5GA 4XLCA 1MIJA 2Y31A 4YIRX 1IN8A 2JMWA 1DGWY 5CPRB 1FTZA 1IN7A 4B47A 3JRDA 1ZH5A 3U21A 4R79A 5J4YA 2E35A 3ESWB 3AG4H 3ABLH 1JE8A 1K7AA 4EGZA 2WAQN 3FMQA 1ETQA 3Q5FA 2JA2A 2B9SA 2LD5A 4UVAA 5B1AH 5FLXZ 3HG9A 4FT8A 3L00A 3EUHA 4BH9A 3ZQIA 2YS9A 3BR6A 1E3PA 4ENKA 1YW7A 4H4KC 2E7XA 5CLSA 1CF7A 5DCFA 1VQKI 2XPVA 2BEOA 4A3LJ 1MMDA 3KZYA 1DUXC 2HFHA 2X6YA 3CJTB 1FBUA 4LB6B 4GYGA 1OFCX 4YELA 1OCOH 4DZJA 2RN7A 4N0BA 3WE2A 4KA4A 4HLXA 3FISA 4OWRB 4CUGA 1B8IA 3RKXA 2K4BA 2RV8A 5D8KB 1ZGAA 1JT6A 2MC3A 1OCPA 5J1UA 3RKQA 3J7YJ 1B59A 3OYNA 3E5XA 3TP3A 2NXNB 1FOXA 4IF4A 4C2UA 3DFGA 1LUJB 1XGOA 4DQ2A 2WWYA 3HHGA 1ODDA 5M5YJ 3K10A 2DAOA 3CO7C 4RAGA 5EZGA 1SFKA 2HDCA 1O3RA 3ASOH 5GPAA 1VF9A 4IHSA 3CCJI 2KRCA 5FLMJ 3OYIA 2WAEA 4GGGA 4Q47A 5AIQA 1HSTA 1FP2A 3BG6A 4XICA 2X6OA 5CJ9A 2KJBA 2PMHA 4B4CA 1JKQC 4A3BJ 3ROUA 5FJ8J 4U87A 2R0QC 3GX4X 3IC7A 4G94A 2A07F 2DQRA 1OYYA 2IVMA 2DMTA 3MMYB 3AKZA 1A35A 3SFZA 1XSDA 4FISA 2DFEA 3GFLA 4RGXA 1MBKA 2LK2A 2HQNA 5FKOA 5ED4A 3HB9A 4OINF 1NK2P 5FKKA 1AU7A 2NVXJ 3LSPA 1AKHA 3HOZJ 1O57A 1O7LA 4W1UA 3HPGA 1PYVA 2P5KA 1MBHA 2FBHA 3LWFA 1TQPA 1R4MB 3HXLA 4E4HA 1WKMA 2W82A 4HZFA 9ANTA 2H27A 5L3CA 1W5TA 4XLEA 2H1KA 2RAEA 2AXTC 4N9IA 3OYDA 2PQ8A 1OJLA 4UVCA 4J01A 1YOVB 3U9GA 2LLKA 2VT2A 5F6FA 3CC7I 5GAEJ 2DO7A 5IPAA 3FHZA 2CH0A 3OYKA 1SD5A 1C0WA 4H0EA 1YX3A 4LGWA 2IEKA 3H36A 3RZOJ 1J5YA 1R5GA 2V1NA 2NVQJ 1GXQA 1FYMA 2XRLA 3L09A 2X85A 5FFXA 2VQHA 1XX5A 1YX5A 4KT5C 1H8AC 2K86A 1K6YA 3I9V2 3LSMA 5CVIA 1FIAA 2L7ZA 1FSEA 5ERIA 1I6XA 1ON1A 3DWLE 4ZDOA 4XSXF 1WSUA 3SZPA 4AVPA 2NNNA 4HQMA 2VBWA 3IKTA 1T39A 3RIRA 4WX9A 3CCYA 2DQLA 2IT0A 2K27A 3Q3SA 2PJRB 3DKWA 4I0BA 4I99C 3H3UA 2E1NA 2ZCWA 3BROA 4B48A 4D0PA 3DQVC 5IOZA 4A3EJ 1IGNA 1YIOA 2RNJA 1ETYA 1RZ4A 3K0LA 4GYIA 2VOOA 2G7HA 1LFBA 3KEYA 3C1DA 3BCBA 4BDZA 2K3PA 2NS0A 4HF0A 5M3FJ 4BS9A 1FOWA 3L2CA 2XF7A 3S3MA 3K4NA 1EJ9A 2D1HA 2OBPA 2CJJA 1LVKA 2JVGA 3F3XA 2XC7A 3HOSA 4LLLA 1J75A 1I5ZA 3DCFA 2XRNA 4NUBA 2ESNA 3S32A 3TW6A 4JX4A 1LE8B 2DU9A 3ZQQA 1FTTA 3JCUC 3DPLC 1PUEE 2R7DA 5JR3A 2IA0A 1ZGWA 1BI0A 1TQIA 4ENMA 2ELHA 3VSKA 2V1DA 3LMMA 2IBDA 3J80Z 2Y9ZA 2L7KA 2AXLA 5CVRA 4CDGA 1ZLKA 2FX0A 4XOTA 3EYYA 4HF2A 3M9AA 1VQNI 2N8GA 2VL8A 3ZQFA 1K78A 1QU3A 1YS6A 2L9VA 4HOBA 2ISYA 3PO3J 1YJNI 3OV8A 2P5LC 5FRNA 1UHWA 3S8PA 4KISA 3ZQLA 2DYRH 3CJQB 2V6EA 1XGSA 1S3JA 1IO2A 5JLXA 4QIWN 3KLOA 3V8JA 4YFKF 2JWTA 3KLNA 4M9ZA 1E17A 3WODF 1UHMA 1EV7A 3BP8A 1B9MA 1RIOH 5C4JJ 4ESJA 4FHTA 3DKYA 3VODA 3F21A 1YJWI 2BVMA 3W2WA 2MW8A 2FU4A 2OV7A 1X1PA 4ESBA 5ICCA 4OMYA 2QA4I 1YQAA 2PJPA 3FXRA 4D7MA 4L9TA 1NH3A 2I5UA 2BY1A 2FMYA 3FXOA 3ZN1A 3QYEA 1Z6TA 3AFHA 4XLNF 1G3TA 3KYCB 3A0HC 3OIQA 1P4WA 4G6QA 4DYRA 3AG1H 3BPVA 1W7PB 3SJMA 5L3FA 1ZLJA 2Z1DA 4Y13A 3K69A 1ZREA 5EG0A 2LTPA 2QVOA 4PFPA 1W7PA 4A3CJ 2Q8KA 3CESA 1VQPI 3A0BC 2ZJRF 1ETOA 4A3JJ 5IP9J 3GWZA 4XKCA 2JSPA 4B09A 2KIMA 1VNDA 3K70D 2EFNA 3TOAA 4LFUA 2K7LA 2HTSA 3R0JA 4RGUA 2JTVA 5DD8A 4E70A 3MKLA 2VQGA 1XGMA 2F5VA 2K9LA 5DV5A 5ILUA 3LSTA 4EEFG 2DA4A 5DUIA 1GXPA 3F0CA 2OU2A 3PO2J 2D45A 4LIVA 4XMYA 2OQRA 5GAGJ 2LBFA 1JJ6C 2L7MP 1SD4A 4E7IA
chains in the Genus database with same CATH topology
3FKIJ 1MNMC 2KDZA 2ECBA 2CRGA 3WHBA 3BG3A 4MLOA 1PUFB 2WV1A 2R5ZB 5EEAA 3BR0A 4FCYA 1JTXA 2R92J 3M3YJ 1BA5A 1Z77A 2E2JJ 3NARA 3OSGA 2ZB9A 3LSJA 2JN6A 3S1MJ 4UUSB 1TC3C 4A3MJ 1SFOJ 3S16J 1SANA 5M5XJ 2CUEA 2Y0SN 2EBIA 5F0FA 5HODA 3H0GJ 4AC0A 5IP7J 1VI0A 3ZQHA 2QF7A 5EG0B 3JRCA 1RESA 2VPRA 1UHSA 1W0TA 3IH3A 3ZQGA 5DTDA 1BW5A 2OPTA 3ZQCA 3LSGA 3E7LA 5F04A 1ZKGA 1MH4A 4UUTA 2DA2A 4XRSG 1LE8A 3HKZN 3LNQA 2GM4A 3RZDJ 5M3MJ 1GT0C 3B6AA 2DA6A 3G1LA 2DJNA 3W6VA 2NS7A 4C3HJ 2X48A 2LFBA 3GTPJ 4DW6A 3BR5A 2MSYA 3BG5A 3SFIA 1IRZA 2R5ZA 4XRSA 1ORKA 3HGGA 1GDTA 1MSEC 3WHCA 3ZOBA 1MH3A 1XG1A 2XGCA 1FEXA 1Q1VA 2M9HA 5M5WJ 2AO9A 3D1NI 5FKLA 1IDZA 2XSDC 2Y9YA 4I6ZA 4L5EA 1QPIA 3OSFA 5F08A 1MBFA 2K9QA 4RDUA 4JX5A 1IUFA 1OCTC 2MGQA 3Q0VA 4QSHA 2NVYJ 1ZTRA 3BTCA 4FE4A 3BG9A 2M0CA 1MBGA 2TCTA 1A6IA 1R9TJ 3BT9A 1TWHJ 4XRMA 3OIOA 1WGXA 2QCOA 1E3OC 3S2DJ 1ITYA 4JP0A 1H88C 3Q0UA 2HOTA 2LKXA 1JUSA 5FLVA 4V2FA 2DA7A 2VUMJ 3NAUA 1X2NA 3GTGJ 1A5JA 4C2MJ 5EZHA 2JA8J 4FE7A 5EGOA 3CMYA 4BY1J 5EDNA 1U78A 3S2HJ 1WPKA 5F0HA 2R5YA 1ZR4A 1VFCA 1B72B 1WI3A 2K40A 4A3IJ 5GP9A 2M34A 2L0KA 2NS8A 4J19A 2EQRA 4IEJA 1EF4A 2O7OA 2JJ7A 1MBEA 2DA3A 3CDLA 4DYQA 2TRTA 2HOSA 4M6VA 1GUUA 5E3LA 3TEDA 1IV6A 5F27A 5FKMA 2EZIA 2CUFA 1NTCA 5IP6A 4M3FA 3TP0A 1QVTA 4MFDA 4DZPA 3LOCA 2JA6J 1F36A 4D5FA 2R7ZJ 2DA5A 1CQTA 2M2EA 1RETA 1W0UA 2DMQA 1IG7A 2EZHA 2YU9J 1ETWA 3SDGA 5EYRA 1FJLA 3CQZJ 4BXXJ 2DMNA 2IAIA 1X58A 1I50J 1P7IA 4JX6A 5C3EJ 2Y31A 3HOYJ 2JMWA 2CQQA 4MO7A 3G1MA 3HGYA 3GBGA 3JRDA 1FTZA 2KT0A 1QRYA 2R93J 2JA7J 2K9NA 3C2BA 3BR1A 2DN0A 2JK3A 3HDDA 3A03A 1T33A 5K7HA 4CYCB 2R5YB 2WAQN 3JRAA 1K83J 1ETQA 1HF0A 2E2HJ 1HLVA 1IC8A 1JT0A 2LD5A 1MSFC 1RPWA 3HOXJ 4M3GA 4DYCA 1MBJA 1BL0A 1ZK8A 3A02A 3ZQIA 5J3LA 1Z0XA 5F0CA 2YS9A 3BR6A 4IHVA 1GV2A 2O8KA 1ETVA 4JYKA 4NDLA 3K7AJ 2XPVA 1FIPA 4UUSA 3S17J 4A3LJ 4QTRA 2XB0X 4C3JJ 5IYBJ 1OFCX 1GVDA 3TW7A 4DZJA 1JTYA 4Y52J 1AHDP 2AHQA 2CU7A 3FISA 3RQIA 1B8IA 2HXIA 2CQXA 4GFBA 1AKHB 2ECCA 2GBYA 2NOGA 2HXOA 3FK7A 2EZLA 3JR9A 2MG4A 1JT6A 4M3BA 1OCPA 5J1UA 3RKQA 2XGDA 5J1RA 2PMZN 2XB5A 4A3FJ 5FKNA 3TP3A 3FIWA 4BBRJ 3A01B 5M5YJ 2Y30A 5F1JA 5EZGA 1YRNA 5BNGA 4AYBN 4I76A 5GPAA 1VF9A 2EZKA 1JUMA 3JREA 1I6HJ 5FLMJ 2E1OA 4G12A 1BJZA 2E2IJ 3S1NJ 1WCMJ 4XICA 2X6OA 1JKQC 2DMPA 4B4CA 4A3BJ 4X6AJ 5FJ8J 3JRHA 5DS9A 2DA1A 2R0QC 1JKRC 1TWGJ 3Q0WA 3G1OA 2DMTA 2XPWA 1HDDC 3S15J 4FISA 3GTLJ 1Y1VJ 4LOCA 3GTKJ 1MBKA 2LK2A 4W97A 5FKOA 3LSRA 3HB9A 1NK2P 5FKKA 1AU7A 2NVXJ 3LSPA 2LY9A 1AKHA 3HOZJ 4W1UA 4A69C 1H89C 1ETKA 1MBHA 3I4MJ 1HOMA 2WB1N 3HM5A 3IV5A 9ANTA 3QPLA 2H1KA 2RAEA 1WH5A 2HOAA 2H8RA 3BTLA 1OJLA 3S14J 2FJ1A 1QVUA 2G0EA 2LLKA 2VKVA 5IYCJ 1B8IB 4MFEA 4FTHA 5IPAA 2ELKA 1U9OA 4CYCA 4C3IJ 1ZR2A 1JUPA 2IEKA 3RZOJ 4A3DJ 4IHYA 3L1PA 2NVQJ 4BBSJ 1RR7A 2XRLA 1ETXA 1TWAJ 3GTJJ 1K61A 2B63J 3I4NJ 1H8AC 3UKGA 2JA5J 1G2HA 5J1YA 1FIAA 1P7JA 2L7ZA 4B1RA 5GPCA 1T56A 4AUXA 3MN2A 1F43A 2LP0A 2L9RA 2OF7A 2Y2ZA 5JLWA 3CCYA 1JGGA 1D5YA 3Q3SA 5E3OA 1UG2A 2HQ5A 4BY7J 3O8HA 5IOZA 1ZQ3P 1IGNA 4A3EJ 1ETYA 4Y7NJ 2E19A 4XK4A 1LFBA 5IOYA 3VPRA 1JJ8C 1RKTA 3BQYA 2HYJA 3A01A 1XC5A 3BR3A 4S0HB 4A3KJ 5M3FJ 2ME0A 1JKPC 1X2MA 2GLOA 2LR8A 2CJJA 2O9LA 1YRNB 3JRBA 3BQZA 3DCFA 2NVTJ 1HCRA 2XPUA 2I10A 3JRFA 2VI6A 3TW6A 4JX4A 1LE8B 3HOUJ 2EH3A 2P81A 5E3MA 1FTTA 1APLC 3B6CA 3BR2A 1ZGWA 3M4OJ 2VKEA 1IJWC 3HOVJ 2IBDA 2Y9ZA 2DMUA 1POGA 2FX0A 4V2GA 1NK3P 1XS9A 3PM1A 1HDPA 2LVSA 3O8GA 2FQ4A 3JRIA 2N8GA 3ZQFA 5EF6A 1LFUP 3IH4A 3HOWJ 3PO3J 1ENHA 1O4XA 3S1RJ 1PUFA 2HDDA 3GTQJ 5K7FA 4RBOA 1U8BA 4XIDA 3ZQLA 2K9SA 3BTIA 5JLXA 4QIWN 2JWTA 4A3GJ 3QQAA 5C4XJ 4IHWA 4MIMA 4B3AA 1Y1WJ 5C4JJ 2W48A 2ME6A 3GTMJ 3H3VK 2MW8A 2COBA 3FK6A 4D7MA 4BKXA 1TWCJ 1RKWA 4M3EA 2M8GX 3GTOJ 4DYRA 5E3NA 4X1EA 2HI3A 3SJMA 3BTJA 1GV5A 4D7NA 4HNVA 2FD5A 1U9NA 5EG0A 5IYDJ 1S7EA 2LTPA 1JKOC 2L7FP 3QPSA 1IDYA 5EGOB 4A3CJ 1DU0A 3JRGA 2DTZA 4A3JJ 1ETOA 3HEFA 5IP9J 3DEWA 3MVPA 1BW6A 1WH7A 1DU6A 1I3QJ 1VNDA 4A93J 3S1QJ 2XGEA 3IH2A 5C44J 3HBLA 4IHXA 1TWFJ 2X9DA 3MKLA 2D5VA 2ID3A 2L7MP 2DA4A 4EEFG 2ID6A 3F0CA 3K2AA 1UMQA 5K7ZA 1B72A 3PO2J 4D5CA 4M3DA 1JJ6C 4ABZA 3OOUA 2YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI J;  1MNM C;  2KDZ A;  2ECB A;  2CRG A;  3WHB A;  3BG3 A;  4MLO A;  1PUF B;  2WV1 A;  2R5Z B;  5EEA A;  3BR0 A;  4FCY A;  1JTX A;  2R92 J;  3M3Y J;  1BA5 A;  1Z77 A;  2E2J J;  3NAR A;  3OSG A;  2ZB9 A;  3LSJ A;  2JN6 A;  3S1M J;  4UUS B;  1TC3 C;  4A3M J;  1SFO J;  3S16 J;  1SAN A;  5M5X J;  2CUE A;  2Y0S N;  2EBI A;  5F0F A;  5HOD A;  3H0G J;  4AC0 A;  5IP7 J;  1VI0 A;  3ZQH A;  2QF7 A;  5EG0 B;  3JRC A;  1RES A;  2VPR A;  1UHS A;  1W0T A;  3IH3 A;  3ZQG A;  5DTD A;  1BW5 A;  2OPT A;  3ZQC A;  3LSG A;  3E7L A;  5F04 A;  1ZKG A;  1MH4 A;  4UUT A;  2DA2 A;  4XRS G;  1LE8 A;  3HKZ N;  3LNQ A;  2GM4 A;  3RZD J;  5M3M J;  1GT0 C;  3B6A A;  2DA6 A;  3G1L A;  2DJN A;  3W6V A;  2NS7 A;  4C3H J;  2X48 A;  2LFB A;  3GTP J;  4DW6 A;  3BR5 A;  2MSY A;  3BG5 A;  3SFI A;  1IRZ A;  2R5Z A;  4XRS A;  1ORK A;  3HGG A;  1GDT A;  1MSE C;  3WHC A;  3ZOB A;  1MH3 A;  1XG1 A;  2XGC A;  1FEX A;  1Q1V A;  2M9H A;  5M5W J;  2AO9 A;  3D1N I;  5FKL A;  1IDZ A;  2XSD C;  2Y9Y A;  4I6Z A;  4L5E A;  1QPI A;  3OSF A;  5F08 A;  1MBF A;  2K9Q A;  4RDU A;  4JX5 A;  1IUF A;  1OCT C;  2MGQ A;  3Q0V A;  4QSH A;  2NVY J;  1ZTR A;  3BTC A;  4FE4 A;  3BG9 A;  2M0C A;  1MBG A;  2TCT A;  1A6I A;  1R9T J;  3BT9 A;  1TWH J;  4XRM A;  3OIO A;  1WGX A;  2QCO A;  1E3O C;  3S2D J;  1ITY A;  4JP0 A;  1H88 C;  3Q0U A;  2HOT A;  2LKX A;  1JUS A;  5FLV A;  4V2F A;  2DA7 A;  2VUM J;  3NAU A;  1X2N A;  3GTG J;  1A5J A;  4C2M J;  5EZH A;  2JA8 J;  4FE7 A;  5EGO A;  3CMY A;  4BY1 J;  5EDN A;  1U78 A;  3S2H J;  1WPK A;  5F0H A;  2R5Y A;  1ZR4 A;  1VFC A;  1B72 B;  1WI3 A;  2K40 A;  4A3I J;  5GP9 A;  2M34 A;  2L0K A;  2NS8 A;  4J19 A;  2EQR A;  4IEJ A;  1EF4 A;  2O7O A;  2JJ7 A;  1MBE A;  2DA3 A;  3CDL A;  4DYQ A;  2TRT A;  2HOS A;  4M6V A;  1GUU A;  5E3L A;  3TED A;  1IV6 A;  5F27 A;  5FKM A;  2EZI A;  2CUF A;  1NTC A;  5IP6 A;  4M3F A;  3TP0 A;  1QVT A;  4MFD A;  4DZP A;  3LOC A;  2JA6 J;  1F36 A;  4D5F A;  2R7Z J;  2DA5 A;  1CQT A;  2M2E A;  1RET A;  1W0U A;  2DMQ A;  1IG7 A;  2EZH A;  2YU9 J;  1ETW A;  3SDG A;  5EYR A;  1FJL A;  3CQZ J;  4BXX J;  2DMN A;  2IAI A;  1X58 A;  1I50 J;  1P7I A;  4JX6 A;  5C3E J;  2Y31 A;  3HOY J;  2JMW A;  2CQQ A;  4MO7 A;  3G1M A;  3HGY A;  3GBG A;  3JRD A;  1FTZ A;  2KT0 A;  1QRY A;  2R93 J;  2JA7 J;  2K9N A;  3C2B A;  3BR1 A;  2DN0 A;  2JK3 A;  3HDD A;  3A03 A;  1T33 A;  5K7H A;  4CYC B;  2R5Y B;  2WAQ N;  3JRA A;  1K83 J;  1ETQ A;  1HF0 A;  2E2H J;  1HLV A;  1IC8 A;  1JT0 A;  2LD5 A;  1MSF C;  1RPW A;  3HOX J;  4M3G A;  4DYC A;  1MBJ A;  1BL0 A;  1ZK8 A;  3A02 A;  3ZQI A;  5J3L A;  1Z0X A;  5F0C A;  2YS9 A;  3BR6 A;  4IHV A;  1GV2 A;  2O8K A;  1ETV A;  4JYK A;  4NDL A;  3K7A J;  2XPV A;  1FIP A;  4UUS A;  3S17 J;  4A3L J;  4QTR A;  2XB0 X;  4C3J J;  5IYB J;  1OFC X;  1GVD A;  3TW7 A;  4DZJ A;  1JTY A;  4Y52 J;  1AHD P;  2AHQ A;  2CU7 A;  3FIS A;  3RQI A;  1B8I A;  2HXI A;  2CQX A;  4GFB A;  1AKH B;  2ECC A;  2GBY A;  2NOG A;  2HXO A;  3FK7 A;  2EZL A;  3JR9 A;  2MG4 A;  1JT6 A;  4M3B A;  1OCP A;  5J1U A;  3RKQ A;  2XGD A;  5J1R A;  2PMZ N;  2XB5 A;  4A3F J;  5FKN A;  3TP3 A;  3FIW A;  4BBR J;  3A01 B;  5M5Y J;  2Y30 A;  5F1J A;  5EZG A;  1YRN A;  5BNG A;  4AYB N;  4I76 A;  5GPA A;  1VF9 A;  2EZK A;  1JUM A;  3JRE A;  1I6H J;  5FLM J;  2E1O A;  4G12 A;  1BJZ A;  2E2I J;  3S1N J;  1WCM J;  4XIC A;  2X6O A;  1JKQ C;  2DMP A;  4B4C A;  4A3B J;  4X6A J;  5FJ8 J;  3JRH A;  5DS9 A;  2DA1 A;  2R0Q C;  1JKR C;  1TWG J;  3Q0W A;  3G1O A;  2DMT A;  2XPW A;  1HDD C;  3S15 J;  4FIS A;  3GTL J;  1Y1V J;  4LOC A;  3GTK J;  1MBK A;  2LK2 A;  4W97 A;  5FKO A;  3LSR A;  3HB9 A;  1NK2 P;  5FKK A;  1AU7 A;  2NVX J;  3LSP A;  2LY9 A;  1AKH A;  3HOZ J;  4W1U A;  4A69 C;  1H89 C;  1ETK A;  1MBH A;  3I4M J;  1HOM A;  2WB1 N;  3HM5 A;  3IV5 A;  9ANT A;  3QPL A;  2H1K A;  2RAE A;  1WH5 A;  2HOA A;  2H8R A;  3BTL A;  1OJL A;  3S14 J;  2FJ1 A;  1QVU A;  2G0E A;  2LLK A;  2VKV A;  5IYC J;  1B8I B;  4MFE A;  4FTH A;  5IPA A;  2ELK A;  1U9O A;  4CYC A;  4C3I J;  1ZR2 A;  1JUP A;  2IEK A;  3RZO J;  4A3D J;  4IHY A;  3L1P A;  2NVQ J;  4BBS J;  1RR7 A;  2XRL A;  1ETX A;  1TWA J;  3GTJ J;  1K61 A;  2B63 J;  3I4N J;  1H8A C;  3UKG A;  2JA5 J;  1G2H A;  5J1Y A;  1FIA A;  1P7J A;  2L7Z A;  4B1R A;  5GPC A;  1T56 A;  4AUX A;  3MN2 A;  1F43 A;  2LP0 A;  2L9R A;  2OF7 A;  2Y2Z A;  5JLW A;  3CCY A;  1JGG A;  1D5Y A;  3Q3S A;  5E3O A;  1UG2 A;  2HQ5 A;  4BY7 J;  3O8H A;  5IOZ A;  1ZQ3 P;  1IGN A;  4A3E J;  1ETY A;  4Y7N J;  2E19 A;  4XK4 A;  1LFB A;  5IOY A;  3VPR A;  1JJ8 C;  1RKT A;  3BQY A;  2HYJ A;  3A01 A;  1XC5 A;  3BR3 A;  4S0H B;  4A3K J;  5M3F J;  2ME0 A;  1JKP C;  1X2M A;  2GLO A;  2LR8 A;  2CJJ A;  2O9L A;  1YRN B;  3JRB A;  3BQZ A;  3DCF A;  2NVT J;  1HCR A;  2XPU A;  2I10 A;  3JRF A;  2VI6 A;  3TW6 A;  4JX4 A;  1LE8 B;  3HOU J;  2EH3 A;  2P81 A;  5E3M A;  1FTT A;  1APL C;  3B6C A;  3BR2 A;  1ZGW A;  3M4O J;  2VKE A;  1IJW C;  3HOV J;  2IBD A;  2Y9Z A;  2DMU A;  1POG A;  2FX0 A;  4V2G A;  1NK3 P;  1XS9 A;  3PM1 A;  1HDP A;  2LVS A;  3O8G A;  2FQ4 A;  3JRI A;  2N8G A;  3ZQF A;  5EF6 A;  1LFU P;  3IH4 A;  3HOW J;  3PO3 J;  1ENH A;  1O4X A;  3S1R J;  1PUF A;  2HDD A;  3GTQ J;  5K7F A;  4RBO A;  1U8B A;  4XID A;  3ZQL A;  2K9S A;  3BTI A;  5JLX A;  4QIW N;  2JWT A;  4A3G J;  3QQA A;  5C4X J;  4IHW A;  4MIM A;  4B3A A;  1Y1W J;  5C4J J;  2W48 A;  2ME6 A;  3GTM J;  3H3V K;  2MW8 A;  2COB A;  3FK6 A;  4D7M A;  4BKX A;  1TWC J;  1RKW A;  4M3E A;  2M8G X;  3GTO J;  4DYR A;  5E3N A;  4X1E A;  2HI3 A;  3SJM A;  3BTJ A;  1GV5 A;  4D7N A;  4HNV A;  2FD5 A;  1U9N A;  5EG0 A;  5IYD J;  1S7E A;  2LTP A;  1JKO C;  2L7F P;  3QPS A;  1IDY A;  5EGO B;  4A3C J;  1DU0 A;  3JRG A;  2DTZ A;  4A3J J;  1ETO A;  3HEF A;  5IP9 J;  3DEW A;  3MVP A;  1BW6 A;  1WH7 A;  1DU6 A;  1I3Q J;  1VND A;  4A93 J;  3S1Q J;  2XGE A;  3IH2 A;  5C44 J;  3HBL A;  4IHX A;  1TWF J;  2X9D A;  3MKL A;  2D5V A;  2ID3 A;  2L7M P;  2DA4 A;  4EEF G;  2ID6 A;  3F0C A;  3K2A A;  1UMQ A;  5K7Z A;  1B72 A;  3PO2 J;  4D5C A;  4M3D A;  1JJ6 C;  4ABZ A;  3OOU A;  2YUS A; 
#chains in the Genus database with same CATH topology
 1MNM C;  4Q48 A;  2P7V B;  2QQ9 A;  2CW7 A;  2HVR A;  3LAJ A;  4IQJ A;  2HTJ A;  2F6C A;  2FBI A;  2F48 A;  2D1V A;  1YG2 A;  2CMP A;  2IXS A;  5JHU A;  4N4N B;  3RTR A;  5H6Q A;  3I59 B;  2R92 J;  1IF1 A;  2E2J J;  2XAG A;  1UCR A;  1EH6 A;  4UUV A;  1QO0 D;  2ZB9 A;  5ICF A;  2EJR A;  3HRU A;  4QLC U;  2KIF A;  3AL0 C;  2E7W A;  3H1C A;  2FA5 A;  2VJ4 A;  1SFO J;  3S16 J;  2F2E A;  3KZZ A;  1B6A A;  2KPM A;  4CA0 A;  2X6X A;  5FRM A;  1LDJ A;  2EBI A;  2PFB A;  2ADU A;  4I7H A;  4YEJ A;  4PZJ A;  1Y0U A;  3OYB A;  5IP7 J;  1VI0 A;  3ZQH A;  5EG0 B;  2LRE A;  2O03 A;  3CUQ B;  4RAY A;  4KFC A;  2XAJ A;  1W0T A;  2KL4 A;  2X1D A;  3IH3 A;  5DTD A;  1S72 I;  3ZQC A;  4ITV A;  4NQW B;  5B5E C;  1MH4 A;  4UUT A;  2VIX A;  4XRS G;  2YU3 A;  4OIO F;  3QOE A;  2K85 A;  1GT0 C;  5FRO A;  3B6A A;  3OYA A;  1P6R A;  5KAI C;  4BJT A;  1IUY A;  2QUF A;  1VQ7 I;  2M7A A;  5BS6 A;  5J8C A;  2X48 A;  4YRV A;  4EGY A;  2GOM A;  3H5N A;  2XAS A;  1KYW A;  4CHU A;  4ZC3 A;  3I4P A;  1IRZ A;  3TOB A;  1GDT A;  1MSE C;  3WHC A;  4AIH A;  1XG1 A;  1FEX A;  1WRJ A;  3D1N I;  2IRF G;  5FKL A;  1IDZ A;  2UXN A;  2Y9Y A;  2XSD C;  2VQL A;  5CKT A;  1X4O A;  1U5T B;  1B1B A;  1BC8 C;  4NC7 A;  3ZMS A;  1WHU A;  4LG3 A;  3V7C A;  3IKV A;  4QSH A;  1ZHF A;  1ZTR A;  1UG0 A;  5E20 A;  4C2T A;  3BG9 A;  1HKQ A;  5LFA A;  1VQ5 I;  3MZY A;  1A6I A;  1UB9 A;  2JPC A;  5E1W A;  1FY7 A;  3U1K A;  3S2D J;  1ITY A;  4PSW A;  1IN4 A;  2Z16 A;  3E6B A;  3GVA A;  3Q0U A;  2LKX A;  3NWS A;  4HQE A;  3SZT A;  4V2F A;  4E7K A;  1DQU A;  2DA7 A;  3GTG J;  3E0J B;  2FBK A;  2FF4 A;  5EZH A;  1A5J A;  1K4T A;  2EB7 A;  3IP4 B;  5EGO A;  4IJA A;  2FNP A;  4L9J A;  2UWM A;  2TDX A;  3VEP A;  4NQW A;  4XL9 A;  4KIC A;  4YFX F;  2K9M A;  1WPK A;  4Z6Y A;  2R5Y A;  2WY8 Q;  2DOF A;  1T38 A;  2ZJ2 A;  2NS8 A;  1ZYR F;  4J19 A;  1D0X A;  3RPU D;  2O7O A;  1R1U A;  5H6R A;  2TRT A;  2HOS A;  3F8F A;  3TED A;  1F1Z A;  1HBX G;  1YHQ I;  5J8F A;  1T8I A;  1X4P A;  5EJC A;  2LY2 A;  4MFD A;  3FMR A;  3R61 A;  3RCO A;  3H35 A;  1UZC A;  3OOP A;  4DZP A;  3CMA I;  4WWC A;  2VOP A;  4AIK A;  2CYY A;  4HV5 A;  5FD5 A;  2EZH A;  2YU9 J;  1JXS A;  1EH7 A;  2O6G E;  3SDG A;  3CC4 I;  3HOT A;  1FJL A;  1D8K A;  1J7K A;  3CQZ J;  4HF1 A;  5FLX K;  2IAI A;  1X58 A;  1I50 J;  1XPX A;  1P7I A;  3QPT A;  2VE9 A;  3WGH A;  3HOY J;  3WTU C;  1K4S A;  2HKO A;  4PJN A;  4G6D A;  1MW7 A;  4MO7 A;  3G1M A;  3HGY A;  3GFI A;  4EM0 B;  3C2B A;  2DN0 A;  3BJO A;  3BR1 A;  3PQK A;  3FXK A;  2GXG A;  1T33 A;  2A05 A;  2Q1Z B;  2R5Y B;  2ZME C;  4XON A;  1K83 J;  1SFX A;  1HF0 A;  1MSF C;  1F4K A;  1Q1H A;  2VBZ A;  3ZR8 X;  1ZN2 A;  2CS3 A;  3HOX J;  2R7T A;  1MNE A;  4BJ6 C;  5J3L A;  4ENN A;  1D1C A;  5F0C A;  3IHU A;  3AL0 B;  1IN6 A;  2Y0M A;  3FBN B;  2BOL A;  2O8K A;  4NDL A;  1TLH B;  5D5W B;  1SVM A;  2A5Y B;  1MDM B;  3S17 J;  3GW2 A;  2DT7 B;  2R7Q A;  5TGT A;  2KIU A;  1STZ A;  4B44 A;  1KQ8 A;  3C3W A;  3E6D A;  3JW4 A;  3G2B A;  5GAH J;  3FM5 A;  5H20 A;  4DOZ A;  3CME I;  1GVD A;  5EEH A;  5LHI A;  2EFQ A;  1JTY A;  3DLA A;  1U5T A;  1AHD P;  2CU7 A;  2YPR A;  2HXI A;  2CQX A;  1FWZ A;  2V7F A;  2GBY A;  1D3Y A;  1D1A A;  2HXO A;  5KCM A;  3V8K A;  3BZK A;  1QGP A;  5E1X A;  5FB2 A;  4M3B A;  4IHT A;  4ETS A;  3DTK A;  2XGD A;  1OCC H;  2F4I A;  2XB5 A;  5FKN A;  2OTJ I;  5HNF A;  1SAU A;  2H6B A;  3HUG A;  4NC6 A;  2WBM A;  2ISZ A;  4RMN A;  1YRN A;  3IRR A;  3T8T A;  3IAS 2;  3JRE A;  1JUM A;  1I6H J;  3KYL A;  2BV6 A;  2R7V A;  3CUQ A;  4G12 A;  1WCM J;  1YIJ I;  2E34 A;  4F52 A;  1W7P D;  3M8F A;  3V42 A;  1A31 A;  3LA2 A;  1TWG J;  3EQL F;  2VPL A;  4KMU X;  5ICE A;  5L3G A;  5JVT A;  2XPW A;  4R8H A;  4HNT A;  3GTL J;  4G6T B;  1Y1V J;  4HLY A;  4LOC A;  1E3H A;  2E71 A;  3LSR A;  4PGG A;  4W97 A;  1AWC A;  3GTK J;  4L0Y B;  2FXA A;  4G7Z F;  2LY9 A;  1GLN A;  1ETK A;  4WXH A;  4UV8 A;  3M7G A;  3T1B A;  3HM5 A;  4ZYD A;  2E5Z A;  2P6S A;  2ETH A;  3OR1 C;  1WH5 A;  4E7L A;  2OAZ A;  3HIF A;  2BE5 F;  2HS5 A;  5EEG A;  5HS8 A;  2GXA A;  4NBQ A;  2DBB A;  3E97 A;  1QVU A;  4XM3 A;  5IYC J;  3I0T A;  2AS5 F;  1QHH D;  3GF2 A;  3GLL A;  5CYV A;  3E5U A;  2XGX A;  4FTH A;  4XN0 A;  3DXJ F;  2GAU A;  3RYP A;  4CYC A;  2F5C A;  4M6Y A;  1JUP A;  3MD2 A;  3CC2 I;  2XF6 A;  4A3D J;  4IHY A;  3L1P A;  3HPH A;  3RPQ A;  5ILV A;  1KZH A;  1T98 A;  1RR7 A;  1S6L A;  4Y15 A;  1TWA J;  2CUZ A;  4KNY A;  3E1S A;  5IT9 Z;  2V6C A;  2Y75 A;  3NEU A;  2JA5 J;  4ZTF A;  3DP7 A;  5J1Y A;  5ILS A;  1ZRD A;  1KU9 A;  3HRT A;  1T56 A;  1LDD A;  1ZRC A;  1N25 A;  3HHH A;  1XCB A;  3FM3 A;  3OYC A;  2A6T A;  1XCV A;  3LAP A;  5DD4 A;  2Y2Z A;  3K4L A;  5JLW A;  4IOA F;  1JGG A;  2G9W A;  5E3O A;  3K1N A;  5ICG A;  5FD6 A;  2KQR A;  4K2E A;  2HQ5 A;  3S2W A;  3LQR A;  3MKY B;  3FZV A;  2K5C A;  3F8C A;  3G3Z A;  2DPD A;  2E19 A;  4KN7 X;  4XK4 A;  3T8R A;  3F6V A;  4FAS D;  3VPR A;  1LJ9 A;  1JJ8 C;  1RKT A;  1X1A A;  3CCU I;  3GZN B;  4A3K J;  1FSH A;  2LF8 A;  3IWZ A;  4D9J A;  2LR8 A;  4CSW A;  2CSO A;  2PG4 A;  2RQQ A;  1YRN B;  3BQZ A;  1JGS A;  1R49 A;  1E0E A;  1LKX A;  2MD0 A;  3G6E I;  3EUA A;  2CFX A;  2H1L A;  1UAA A;  3BY6 A;  4L18 B;  3BR2 A;  1N75 A;  2M45 A;  1WJA A;  3ASN H;  1IJW C;  2BHZ A;  3G73 A;  1Z05 A;  3EET A;  1X3Z B;  3Q9V A;  3BLY A;  4CCK A;  5CVV A;  2R7X A;  1XS9 A;  4XSZ F;  2RDP A;  4IVN A;  5KAF C;  1HDP A;  3WTS C;  1LVA A;  1FYL A;  1OR7 C;  2QGU A;  2XIG A;  3S1R J;  3GZ5 A;  1PUF A;  1YIT I;  5K7F A;  1TL8 A;  1BJA A;  3RSN A;  1U8B A;  4XID A;  4A5N A;  1U5T C;  5HLI A;  4LG0 B;  3BTI A;  2EPF A;  4PCQ A;  1VQO I;  4A2U A;  1X19 A;  5B66 C;  3FHN A;  4A3G J;  4B3A A;  1CF7 B;  4ZYH A;  2W48 A;  3V7R A;  2UV1 A;  2V79 A;  4LD5 A;  1XDU A;  4E7Z A;  4L9N A;  4M9X A;  2OCE A;  3L2R A;  1R1V A;  3K1P A;  4DIQ A;  4BKX A;  1TWC J;  3DEU A;  4MNU A;  5HLH A;  1U3E M;  3RPU A;  4M3E A;  2M8G X;  4HX4 A;  2IA1 A;  5HNH A;  3BOQ A;  3GTO J;  2CV0 A;  2O5R A;  2WY7 Q;  4X1E A;  4CO8 A;  3BTJ A;  2GQQ A;  2MH9 A;  4HDV A;  5CQE A;  3PUB A;  4D7N A;  4HNV A;  3E6C C;  1U9N A;  2HU9 A;  2QZ8 A;  3DBH B;  4M71 A;  3ECH A;  2Z2S B;  3KIO A;  2ZO4 A;  1DU0 A;  3JRG A;  2ZC2 A;  4OIQ F;  2QKL B;  5A2Q K;  3HEF A;  3DEW A;  2HNH A;  1DU6 A;  1WJE A;  5D4R A;  4IL6 C;  3S1Q J;  2XGE A;  3EUH C;  1NG7 A;  2CG4 A;  1MND A;  4IHX A;  4XQF A;  5HS9 A;  3ECO A;  2DT5 A;  1D0Z A;  3K2A A;  5LGU A;  1CGP A;  2ZXW H;  1B72 A;  2VN2 A;  3J81 Z;  4RGS A;  4M3D A;  3OOU A;  2YUS A;  2DOE A;  2RRE A;  2ECB A;  3WGG A;  3R60 A;  2CRG A;  3BC8 A;  2VKD A;  3I71 A;  3BG3 A;  4MLO A;  3COA C;  1I27 A;  1FNN A;  2KIQ A;  2KJC A;  2KZV A;  5EEA A;  3W2A A;  3VDX A;  2J5P A;  4KDP A;  1UJ8 A;  4PJJ A;  1RI7 A;  2YX4 A;  3MZH A;  4KIT B;  3MCZ A;  2CGP A;  5CVU A;  4XLH A;  3SEQ A;  3ONQ A;  4HRI A;  2IPQ X;  2XRO A;  4UUS B;  4UB6 C;  1Z3Y A;  4A3M J;  3I5U A;  1FP1 D;  2VXD A;  3KP5 A;  4PGH A;  1XDS A;  3DU6 A;  2CUE A;  3VB2 A;  4E7H A;  1SMY F;  2IGK A;  2P6T A;  1JHH A;  2NYX A;  1KQ0 A;  4UVB A;  1S5L C;  2P7C B;  3JRC A;  2FQ3 A;  2IGO A;  4U7D A;  1UHS A;  4XLF A;  4XKV A;  1PDN C;  1TT0 A;  1G8X A;  2KZG A;  2DW4 A;  3K1M A;  4CXF A;  2ZFU A;  2HYG D;  2CQ7 A;  5F04 A;  3EUK L;  2IS2 A;  2HZD A;  2DA2 A;  2R7F A;  1LE8 A;  1R7J A;  4A5M A;  1XN7 A;  3GLX A;  3LNQ A;  3ZMT A;  2COM A;  4IX7 A;  1W36 D;  2EFW A;  3HRS A;  4BHC A;  4RLF A;  3CUQ C;  5FGM A;  2FSW A;  2DJN A;  4KUM A;  3J7Z I;  4C3H J;  1Z67 A;  1HKT A;  2LFB A;  1L0O C;  3KEQ A;  1ZG5 A;  3GTP J;  1SFE A;  3PNT A;  3LFK A;  4XRS A;  3HGG A;  1BR1 A;  4A6E A;  2R5Z A;  3KZI C;  3OWT A;  3TMO A;  3S3N A;  4A6D A;  3ZOB A;  1MH3 A;  2VQC A;  2XGC A;  4RM3 A;  5DM7 F;  2NAZ A;  5BPI A;  3K4J A;  1R22 A;  1Q1V A;  2K3F A;  2OQG A;  4BHB A;  4DBQ A;  4I6Z A;  4L5E A;  2JQ7 A;  4Z2Y A;  2DT6 A;  1MBF A;  2EV6 A;  3SQN A;  3O3K A;  2BYV E;  2KMU A;  2IS1 A;  1DDN A;  4ANJ A;  4E6K G;  3VWB A;  1RR8 C;  4M9S A;  1MBG A;  2TCT A;  4BL0 B;  3CCL I;  1R9T J;  2HOE A;  1MJA A;  2QCO A;  1E3O C;  2QKM B;  1I3A A;  3WU1 B;  1H88 C;  2X0L A;  3F22 A;  1XSX A;  1PP7 U;  1DPR A;  2MYS A;  4YIF A;  2VUM J;  4YII A;  5TJJ A;  3H5A A;  1G3S A;  2M3A A;  4FE7 A;  1J09 A;  5EDN A;  3DKX A;  3H5R A;  5D4S A;  1U78 A;  2L02 A;  2ZME A;  4EVI A;  1VFC A;  2K40 A;  4AWX B;  4RAF A;  5D6F A;  4BEH B;  2EA2 A;  4HA8 A;  2QQA A;  2DDB A;  2YR2 A;  3DLL F;  1TQM A;  2DA3 A;  3CDL A;  4DYQ A;  1RRJ A;  4G8X A;  4M6V A;  3J81 K;  1O3Q A;  3GYH X;  2VJ5 A;  3LA7 A;  1YW8 A;  4RGR A;  1NTC A;  3HZJ A;  4M3F A;  1QVT A;  2WV0 A;  3LOC A;  3JSO A;  1Z21 A;  4D5F A;  4ZDP A;  4BQQ A;  2XHK A;  2PI0 A;  2L01 A;  2M2E A;  2MC4 A;  1Z1D A;  3CO6 C;  3F8N A;  3CLO A;  1F9N A;  1XMX A;  4L9V A;  1IG7 A;  1WJD A;  3KE2 A;  1ZAR A;  3MQ0 A;  3D5R C;  4BGD A;  2PEX A;  1B4A A;  4CGZ A;  3VYU B;  2W25 A;  4M73 A;  3WTX C;  3WE3 A;  2CQQ A;  4EM1 A;  1IZ1 A;  3GBG A;  2W57 A;  3E3V A;  4WXD A;  2KT0 A;  1QRY A;  4ZYE A;  2K9N A;  2JK3 A;  2Z99 A;  2XAU A;  4OIP F;  4DNC A;  5K7H A;  5IY5 H;  4CYC B;  1IXS B;  3ABM H;  3JRA A;  2BY0 A;  3V8L A;  3J7A Y;  2E2H J;  1HLV A;  1W1W E;  1IC8 A;  1JT0 A;  4A12 A;  3CMM A;  1V5E A;  2QQB A;  3L2W A;  5HLG A;  5D8L B;  1IRF A;  1Z7U A;  3HRM A;  1BL0 A;  1ZK8 A;  2E5N A;  3A02 A;  2WAF A;  4ZYG A;  1IV8 A;  1FX7 A;  2STT A;  4IHV A;  1GV2 A;  4LJZ F;  3W6K B;  5L3E A;  1VQ9 I;  4JYK A;  3DBR B;  4AU7 A;  2XUB A;  4IPA A;  4UUS A;  1FIP A;  3TDU C;  3V7S A;  4QTR A;  4C3J J;  2DTR A;  2O0Y A;  3HYI A;  4XR6 A;  2F5D A;  4HX8 A;  4MGR A;  3TW7 A;  5KVR A;  1RNL A;  3ZMZ A;  2AHQ A;  1U0J A;  2PX9 A;  3RQI A;  3W6J B;  2JRM A;  3QPH A;  4R1H A;  3LSK A;  4GFB A;  2ECC A;  1R4N B;  2NOG A;  3FK7 A;  2EZL A;  3T0Y A;  2EA4 A;  3JAM Z;  3K4B A;  3R6S A;  1MD0 A;  3L9F A;  3U1D A;  5J1R A;  2PMZ N;  5D5U B;  2Z9O A;  3WU0 A;  3K70 C;  1IW7 F;  4NHJ A;  2DFI A;  4II2 A;  3FIW A;  4EJV A;  4BBR J;  2MD5 A;  3A01 B;  4B43 A;  1Z91 A;  4HNU A;  2KP6 A;  1R71 A;  3FXJ A;  4F7Z A;  1YE9 A;  4I76 A;  4MTD A;  1QZY A;  5BPD A;  4UB8 C;  5HS7 A;  3ZGK A;  2W7N A;  2LYC A;  2Y0S A;  2E2I J;  1BJZ A;  1DGR M;  3S1N J;  4CCL A;  3JTG A;  4EJU A;  5BMZ A;  4XKB A;  3WTZ A;  1PP8 F;  3D5L A;  4BUP A;  2DMP A;  4X6A J;  5DS9 A;  2HPI A;  3Q0W A;  4XNF A;  1R58 A;  3SHF A;  4BE2 A;  3G1O A;  4C30 A;  1SC7 A;  5LLQ A;  1HDD C;  4BQA A;  4O3M A;  1HC8 A;  3S15 J;  5D6E A;  4EJT A;  1KU3 A;  3DU5 A;  3CZ6 A;  2DCE A;  4HW0 A;  1LFP A;  1R23 A;  5LEJ A;  3OR2 C;  2NNY A;  1Y56 A;  2QBY A;  4I01 A;  2V9P A;  1FC3 A;  2JUG A;  3IAM 2;  1H89 C;  2L2O A;  3CCV I;  4KMF A;  2JUC A;  2UZK A;  3HC7 A;  1V5F A;  4E7J A;  2WB1 N;  1HOM A;  3IV5 A;  4HST A;  4JK1 X;  1HW5 A;  2HR3 A;  3QPL A;  1X3W B;  3W2V A;  1PJR A;  2LDU A;  2HOA A;  2H8R A;  2MFZ A;  2BVL A;  3BTL A;  2LC2 A;  5LHH A;  1TW3 A;  3S14 J;  2QWW A;  2X4H A;  2FOK A;  2G0E A;  2VKV A;  1ZG3 A;  4MFE A;  4HAM A;  4U0W A;  3G4S I;  4LK0 F;  2QBY B;  3CTA A;  5JHF A;  2VJJ A;  4IXA A;  2FE3 A;  4BBS J;  5DYM A;  1ETX A;  3GTJ J;  3I4N J;  1T0F A;  3OYG A;  1G2H A;  5JI6 A;  2QSG X;  1P7J A;  1BR4 A;  4CCJ A;  2Q2E B;  3MN2 A;  3JAM K;  1VQM I;  3PL8 A;  1V54 H;  3KCC A;  4KJZ A;  3I53 A;  5K5O A;  4UNO A;  1QQI A;  2W24 A;  2LP0 A;  1NG6 A;  3S3O A;  2PJR A;  2L9R A;  5L3D A;  2XAQ A;  4HYE A;  1AA7 A;  2WAQ A;  1YLF A;  2R7S A;  1UG2 A;  4CZZ A;  3GUD A;  5IT9 K;  3AG3 H;  2CQN A;  1ZQ3 P;  2KRH A;  3M1C A;  3FX3 A;  4P9U A;  3H92 A;  1KA8 A;  4MHG A;  2AQE A;  2QYO A;  3MKZ A;  2HYJ A;  3SZG A;  5LGT A;  1XC5 A;  3BR3 A;  3FKJ A;  4S05 A;  3FXQ A;  2PBI A;  3OYE A;  2BXY A;  2ME0 A;  1LEB A;  3I55 I;  2OJE D;  1EH8 A;  1MMS A;  1X2M A;  2ICW G;  2GLO A;  1O3T A;  1Z6R A;  2VLA A;  2GZW A;  3I56 I;  2PMU A;  2O9L A;  4ESF A;  3JRB A;  4CIC A;  1TBX A;  2NVT J;  1G3Y A;  3QU3 A;  1HCR A;  2XPU A;  2I10 A;  1J9I A;  2VI6 A;  2KFD A;  1BOA A;  1APL C;  1BIB A;  2VKE A;  3HOV J;  4BXF A;  4EMS A;  2B0L A;  1POG A;  3SYT A;  4II3 A;  1R6R A;  2W85 A;  3L2Q A;  4V2G A;  4QPQ A;  3GME A;  3J80 K;  3PM1 A;  2LVS A;  3O8G A;  2FQ4 A;  1D1B A;  2HQA A;  2VXZ A;  5EF6 A;  2RGV A;  3JRI A;  1LFU P;  4B3X A;  2BHY A;  4XOR A;  1MGT A;  3HOW J;  1ENH A;  2CUJ A;  4TV7 A;  3RYR A;  3GTQ J;  1K79 A;  2L9S A;  1X3U A;  4M6X A;  4RBO A;  3CCS I;  4A0X A;  4RB1 A;  3EYI A;  3IUO A;  3QQA A;  5C4X J;  4MIM A;  1W36 C;  2HEO A;  3DF8 A;  4LLN A;  1VQ6 I;  4LG0 A;  1B9N A;  1T6S A;  4CCM A;  3K9T A;  3AAF A;  3H3V K;  1SEU A;  2H8W A;  2AQF A;  4HG2 A;  4M72 A;  2XAH A;  4BAY A;  4BNC A;  3WG9 A;  4NNJ A;  1K6O A;  2EFP A;  2OZU A;  2K02 A;  2ZXH A;  1YYV A;  2FUG 2;  3D0S A;  1R5H A;  3MKW B;  3ELK A;  2E1M C;  1LPQ A;  2CV2 A;  3Q9S A;  2G7U A;  5E3N A;  2Z5U A;  1GV5 A;  4GDF A;  2B7E A;  5IYD J;  1S29 A;  1JKO C;  1T08 B;  2L7F P;  4M74 A;  3I58 A;  3PFY A;  2D2W A;  5EGO B;  3BJA A;  1MKM A;  5JFR A;  4EAT A;  2NRA C;  2VBY A;  1WH7 A;  3VYT B;  2ZBK A;  1I3Q J;  3GCM A;  4BU2 A;  2VON A;  3DBL B;  4CZC A;  4A93 J;  4XLA A;  3FXL A;  3OL3 A;  5A2Q Z;  4PSX A;  4KYW A;  1WZ2 A;  3FXU A;  1TWF J;  2EV5 A;  1LB2 A;  1A36 A;  2D5V A;  4BYY A;  2ID3 A;  2ZJP F;  4LB5 A;  2CWE A;  5K7Z A;  3N4M A;  1UMQ A;  4D5C A;  4EQQ A;  3PSF A;  3OYM A;  4RB0 A;  1ZGJ A;  3BZ6 A;  2V26 A;  3FKI J;  3S93 A;  5GTH C;  3JSP A;  4PUS A;  2W4S A;  1FBQ A;  2KDZ A;  1K78 B;  4Y3O A;  4AIJ A;  3WHB A;  1RUO A;  1J2X A;  1R00 A;  2WV1 A;  5LRR A;  4ZJZ A;  2R5Z B;  1QZE A;  2ZSH B;  2QQ8 A;  3QWL A;  3BR0 A;  3C2H A;  3ABT A;  4FCY A;  3M3Y J;  4F92 B;  1R5I D;  4JQF A;  2X6W A;  4HSR A;  1TP4 A;  4ASN A;  2JN6 A;  1HW2 A;  2X1E A;  5F64 A;  4HEA 2;  1TC3 C;  1IXR C;  3J7A O;  1SAN A;  5E8G A;  5BQT A;  3ZRG A;  1R36 A;  3PQJ A;  5KHD A;  3I54 A;  4KIB A;  2DPU A;  5M5X J;  1ERD A;  2EV0 A;  2GA1 A;  2P0W A;  2Y0S N;  3ERE D;  2DFF A;  5F0F A;  2ZNY A;  3RDI A;  4ZDL A;  1SD6 A;  3NQO A;  2L5Q A;  4AC0 A;  2BW3 A;  3MAJ A;  4CH7 A;  5HDG A;  1RES A;  3K4M A;  1Y8Q B;  2P5V A;  2M1B A;  1BW5 A;  2A6E F;  4PJL A;  5DUK A;  3UR3 C;  3F23 A;  1VZ0 A;  2OPT A;  1ON2 A;  3LSG A;  1FOY A;  1USS A;  3E7L A;  2EWN A;  1SD7 A;  4WCG A;  2JT1 A;  2CW0 F;  4L5J A;  4D1Q A;  1ZKG A;  3PIP F;  1G59 A;  3WTY C;  2NVU B;  1REP C;  4KIF A;  3HL2 A;  2BY2 A;  5DCM A;  3U2R A;  3A2K A;  1A6Q A;  1G3W A;  3E5Q A;  3RZD J;  4MQ9 F;  5M3M J;  1QPM A;  2LSO A;  3R0A A;  4IRG A;  3HSR A;  2DA6 A;  3RKY A;  3FF5 A;  3QU6 A;  3K6G A;  3G1L A;  1TZL A;  2XSJ C;  5HDN A;  3W6V A;  2NS7 A;  2PN6 A;  3VSL A;  2RKH A;  3P9C A;  4DW6 A;  3BR5 A;  1IXC A;  2E1C A;  4P96 A;  2MSY A;  2W84 A;  3BG7 A;  1ZRF A;  3CDH A;  3SFI A;  2IGN A;  3KP2 A;  1ORK A;  4Q4Z F;  2ZXJ A;  1HXD A;  3OIP A;  4N9H A;  4U7B A;  3V4G A;  2X1C A;  2VB6 A;  5D5V B;  2M9H A;  5AON A;  5E79 C;  2HDW A;  3C7J A;  4LLG F;  2M5W A;  2QEN A;  1GVJ A;  2K9Q A;  4ZH4 F;  1XMA A;  4RDU A;  2JPB A;  4JX5 A;  3Q0V A;  1ZEL A;  3QRF F;  2W00 A;  2NVY J;  3BTC A;  4U0Y A;  4EJW A;  3MFK A;  3CJR B;  2M8E A;  1OQY A;  1FOK A;  1MZB A;  3B02 A;  5DEQ A;  2CFO A;  3BDD A;  3FDY A;  4GO1 A;  2OC6 A;  4DJA A;  1X1C A;  1UEL B;  3OIO A;  3CF5 F;  1WGX A;  1LNW A;  3M8E A;  4JP0 A;  3HJE A;  1TNS A;  5LRS A;  2I8D A;  2EFO A;  2HQR A;  2P8T A;  1Y0N A;  3EPZ A;  2FRH A;  1WQ2 A;  1P4X A;  1BN5 A;  1X1D A;  2A3S A;  2C6Y A;  1BR2 A;  5B3S H;  2MLG A;  3KFW X;  1BIA A;  4OAY A;  3T5X A;  5F0H A;  2BXZ A;  1B72 B;  1WI3 A;  2HYF A;  2M34 A;  1WVR A;  2L0K A;  2RC4 A;  2EQR A;  4IEJ A;  5GAD J;  4BAC A;  1E2X A;  1BI2 A;  1SAX A;  2J5O A;  3MEX A;  3BPX A;  5F27 A;  3HUG B;  3ISP A;  3LL7 A;  2QLZ A;  3KPH A;  1HA8 A;  1J59 A;  2CUF A;  1Y39 A;  1IRX A;  3TP0 A;  1I1G A;  2WA0 A;  2JA6 J;  3NRV A;  3H9J A;  4PDK A;  2R7Z J;  3VYS B;  3I3L A;  3P7N A;  1W0U A;  1RC9 A;  5LHG A;  2MH2 A;  4HBL A;  2DMQ A;  3ABK H;  1XMK A;  1DPU A;  1RUN A;  1I1S A;  3CCR I;  4BEH A;  1QNT A;  5EYR A;  4Y33 A;  2LG4 A;  4P55 A;  4BXX J;  4XKW A;  1UST A;  2DMN A;  3P9K A;  4JX6 A;  3G71 I;  5C3E J;  1Z9C A;  3CD6 I;  1T2K A;  2O8X A;  2W1O A;  3LSH A;  3F9K A;  2R93 J;  4RB2 C;  2JA7 J;  4IRI A;  4MTE A;  3HDD A;  3A03 A;  3NWT A;  3CP8 A;  4EJO A;  1JI8 A;  1WJ5 A;  3DEE A;  1QHG A;  3REO A;  2CW8 A;  1S9H A;  2IA2 A;  3HTU A;  4XN3 A;  1RPW A;  2RNG A;  4M3G A;  4P1W A;  4DYC A;  3H9Q A;  1MBJ A;  1ACI A;  1Z0X A;  1BI3 A;  1WJC A;  2OCC H;  1MDM A;  4XRF A;  3OMY A;  1EKE A;  4WXC A;  4LIT A;  5TRD A;  1ETV A;  1OPC A;  3K7A J;  1KGS A;  1NHA A;  4AD9 A;  2XB0 X;  4RLQ A;  4ZTJ A;  1KU2 A;  1Z3X A;  2LRD A;  3PSI A;  5IYB J;  4F3Q A;  3LFU A;  3F8B A;  1G6N A;  2L3D A;  3I59 A;  1YW9 A;  4JBA A;  4Y52 J;  4HDU A;  5JVG F;  1FLI A;  5KNL A;  3TO9 A;  3C2G A;  3KP6 A;  4N4O B;  1WWX A;  4I98 B;  1AKH B;  5LGN A;  3JR9 A;  2HGC A;  2MG4 A;  3ZMV A;  4A3F J;  2R7R A;  2R7U A;  1M1E B;  3QAH A;  4F55 A;  3M07 A;  3R4K A;  4FET A;  3L2V A;  4I2O A;  1JHF A;  4KN4 X;  3WTW C;  2IS6 A;  4FX4 A;  4RM2 A;  2Y30 A;  4WF2 A;  5F1J A;  1BC7 C;  2EIK H;  4GRI A;  3TO7 A;  4C9Y A;  1OYW A;  2OUM A;  3ZMU A;  5BNG A;  1VQ8 I;  3BJ6 A;  4AYB N;  2FEZ A;  5BOX A;  1O3S A;  5E8I A;  2DOA A;  2EZK A;  2R4G A;  2XVC A;  3DTE A;  2E1O A;  2F4M B;  4A0Z A;  4V19 K;  2VJI A;  4PJM A;  2QM3 A;  1O7F A;  3PNV A;  1VQL I;  3ERM A;  1PVE A;  3FMS A;  1XB4 A;  4BE0 A;  1XTA A;  3JRH A;  2DA1 A;  3UNG C;  2NOJ B;  1JKR C;  1MMN A;  3AG2 H;  1ZAO A;  4S04 A;  2M4G A;  3P5J A;  3TL4 X;  2A61 A;  3DPU A;  2E36 A;  2ZFW A;  4BJ5 C;  4IKF A;  4NB5 A;  4GXO A;  2DLL A;  5E17 F;  3FBI B;  1YJ9 I;  4P5O A;  4A69 C;  5F1R A;  2DDA A;  3GZ6 A;  4RAZ A;  3KET A;  2ZSI B;  2WB1 A;  3I4M J;  3TO6 A;  3PIO F;  1LEA A;  1TTY A;  1I39 A;  3OYF A;  1N78 A;  2DJI A;  3TBI A;  3H0D A;  3P9I A;  2BZT A;  1HKS A;  4B8X A;  2DFH A;  4ON0 A;  3OL4 A;  2FJ1 A;  1B8I B;  3M1E A;  2ELK A;  3RJP A;  1U9O A;  2L54 A;  4F91 B;  1UFM A;  1WJB A;  4C3I J;  1ZR2 A;  3CP2 A;  4Q5S F;  2F5E A;  1YTY A;  4ENJ A;  2FNA A;  3ZMD A;  1HQC A;  3WTV C;  2X51 A;  1MJB A;  2P4W A;  3GXO A;  1K61 A;  2KHM A;  1IAW A;  1LDK B;  2KLO A;  1H9T A;  2B63 J;  4UXN A;  2GA2 A;  3DTI A;  3UKG A;  4AYB A;  2BY3 A;  1ONV A;  3QYF A;  1AOY A;  2V1X A;  4B1R A;  5GPC A;  3KP4 A;  4OOI A;  2ESH A;  4AUX A;  4QWQ A;  3MWM A;  4XOP A;  1XSV A;  2LMD A;  3CCE I;  1F43 A;  3CCQ I;  4LIU A;  1A04 A;  4NC8 A;  2OF7 A;  4PK4 A;  3OYJ A;  1VQ4 I;  3IRQ A;  2F5F A;  2K4J A;  3N05 A;  1D5Y A;  1G4D A;  1KQ9 A;  4BY7 J;  2WAD A;  3X2Q H;  4CYD A;  3O8H A;  4L5I A;  1OCZ H;  1L3L A;  4RB3 C;  4Y7N J;  4IOC F;  1FBS A;  5IOY A;  1OCR H;  2L4M A;  2ZXI A;  3BQY A;  3CUO A;  2HPM A;  3A01 A;  1V4R A;  4S0H B;  2EK5 A;  1JKP C;  1VTN C;  2KRF A;  3LQQ A;  2VOD A;  3VFZ A;  3QYB A;  2L4A A;  2A5W A;  1TW2 A;  4BE1 A;  2DXI A;  2STW A;  6PAX A;  2V1U A;  1KON A;  2XAF A;  2UUZ A;  3OYL A;  5B1B H;  3JRF A;  5HLT A;  2V4J C;  1OR7 A;  4XBF A;  2OD5 A;  2EH3 A;  3HOU J;  4YG2 F;  3F6O A;  2P81 A;  5E3M A;  2M4K A;  3B6C A;  2LOO A;  2PMZ A;  3M4O J;  2VE8 A;  5KK1 A;  1QA6 A;  3CF2 A;  4KIG A;  4AM3 A;  2FML A;  2DMU A;  4HX7 A;  2RVC A;  5LEK A;  2GXB A;  1QBJ A;  5FO5 A;  1NK3 P;  4BXU A;  1OIS A;  3QOP A;  4I0A A;  2DK8 A;  4CCO A;  2DK5 A;  1KYZ A;  3WGI A;  1SVL A;  4Y4R A;  2V9K A;  4HV6 A;  3IWF A;  4WK8 F;  3IH4 A;  2KKO A;  3F8M A;  1O4X A;  2HDD A;  2HVS A;  1P92 A;  3N97 A;  2IS4 A;  4OU0 A;  2VAS A;  3LA3 A;  1DP3 A;  1W5C C;  2IP2 A;  2K9S A;  4MQV A;  3H3Z A;  4UHT A;  4IHW A;  2HWV A;  1Y1W J;  2VT3 A;  1BM9 A;  5K5R A;  2ME6 A;  2LBF B;  3BCA A;  4MEY F;  3GTM J;  2PLY A;  4EM2 A;  5K1Y A;  3HKZ A;  4G7H F;  2FOW A;  2ZNZ A;  4P9F A;  3ZP5 A;  3ZQ7 A;  2COB A;  2M7B A;  2LNB A;  3FK6 A;  2H94 A;  4OIR F;  3OY9 A;  4LMY A;  2Z33 A;  2CV1 A;  1RKW A;  2GWR A;  4BQN A;  2HZT A;  2Q0O A;  3ML6 A;  4OMZ A;  5HVQ C;  1HSJ A;  4MEX F;  1F5T A;  2HI3 A;  3SEZ A;  4HPQ A;  4AVZ A;  2BW3 B;  3HSF A;  4FQG A;  2Y69 H;  1OKR A;  2FD5 A;  2O3F A;  1S7E A;  2E1M B;  2ACJ A;  3QPS A;  3GEZ A;  1IDY A;  5L3B A;  1QZZ A;  2HKX A;  3OYH A;  2DTZ A;  3A1Y A;  4FX0 A;  1P4A A;  1TNT A;  3HTS B;  2XKO A;  2CO5 A;  3LSI A;  5FFZ A;  1U8R A;  4UY8 I;  5HOO A;  2L9N A;  3MVP A;  1BW6 A;  3WU2 C;  3A4C A;  3OS0 A;  1S8N A;  2QEX I;  4BDY A;  1GHC A;  4DBR A;  3IH2 A;  5C44 J;  3HBL A;  1Y8R B;  1WJF A;  2EIL H;  2X9D A;  2XDV A;  2M30 A;  2MBF A;  2ID6 A;  1V3F A;  1W4M A;  1HW1 A;  1V55 H;  1OLT A;  4ABZ A;  3L7W A;  2LY1 A;  1Y6I A;  1J0R A;  5TIS C;  2OTL I;  2Z3Y A;  2MAB A;  1TT5 B;  1EA3 A;  3C18 A;  4CCN A;  1FPQ A;  1BI1 A;  4RS8 A;  3DV8 A;  3D5S C;  2LH9 A;  3K2Z A;  3QP5 A;  4Y17 A;  1YO5 C;  2EIM H;  1PUF B;  2LKP A;  3OS2 A;  4A0Y A;  5J47 A;  3ZPL A;  4L0Z B;  3QOD A;  3ULQ B;  5IT3 A;  5E18 F;  1JTX A;  2GOX B;  3CJN A;  1Z77 A;  3PUF A;  1BA5 A;  1P2F A;  3CLQ A;  5J6X A;  4EV0 A;  1Z7L A;  3NAR A;  1FMW A;  2OZ6 A;  4IQ4 A;  3OSG A;  2IGM A;  3ZCO A;  3W3C A;  2JRT A;  3KX2 A;  3LSJ A;  3S1M J;  5GTI C;  2KIS A;  5LD2 C;  2JZY A;  3O6B B;  3WG7 H;  1FT9 A;  1YS7 A;  1WFX A;  4KT6 A;  3K4K A;  3CCM I;  4IO9 F;  2KDO A;  1KU7 A;  2E60 A;  2BGC A;  1FMV A;  1P9Q C;  2H6C A;  3TDZ C;  5HOD A;  4U0V A;  2MA3 A;  2WTE A;  3KP7 A;  3H0G J;  5DDG A;  5H2F C;  4XLP F;  2OA4 A;  2LKS A;  3E6M A;  3ABU A;  4ZZD A;  1MMA A;  2QF7 A;  3SDB A;  4ZZL A;  2HVQ A;  2VPR A;  3GO5 A;  1T0F C;  3ZQG A;  5LBQ A;  1LQ1 A;  2M87 A;  3PJR A;  1S7A A;  1N77 A;  4O5V A;  1ZG1 A;  5CQG A;  1IRG A;  3L2U A;  4IZZ A;  2ZKZ A;  3HKZ N;  2IJL A;  2QSF X;  3PFI A;  4QPO A;  4DGW B;  2EIN H;  2GM4 A;  3CDI A;  4X0G A;  1DP7 P;  1T95 A;  2Y48 A;  4YFN F;  2VBX A;  3DPT A;  4UV9 A;  3JTH A;  1SFU A;  2BBY A;  1YI2 I;  4RA2 A;  5DCM B;  2EIJ H;  3TQN A;  1BBY A;  4PJ0 C;  2F4O B;  3MZ8 A;  3OS1 A;  5J4V A;  3RI4 A;  3F72 A;  1FYK A;  3BG5 A;  3VYR B;  3K4C A;  1H9G A;  3H9G A;  2VC0 A;  3BZC A;  1SMT A;  2V9V A;  1X1B A;  2MLK A;  3KP3 A;  4I09 A;  2A69 F;  1U6G A;  1BOB A;  3WTT C;  3GFJ A;  2JSC A;  2AO9 A;  5M5W J;  2A6H F;  3HSE A;  2R7W A;  3TKY A;  1FZP B;  1QPI A;  3OSF A;  5F08 A;  1IN5 A;  2VKH A;  2R7O A;  3KYD B;  4I02 A;  3B73 A;  1IUF A;  3TGN A;  1OCT C;  4G7O F;  2IW5 A;  2GIV A;  2MGQ A;  2YSR A;  3ZXS A;  1ULY A;  4BQO A;  2Q2E A;  5D5X B;  1U2W A;  4FE4 A;  2R3S A;  2LF7 A;  2VC1 A;  2M0C A;  2DI3 A;  3PNY A;  1WI9 A;  4BHP A;  1D8J A;  3BT9 A;  1TWH J;  2H09 A;  4LK1 F;  4XRM A;  3VOE A;  2HOT A;  4OAZ A;  1JUS A;  4U88 A;  5FLV A;  2XV4 S;  1YFH A;  1OYI A;  2WC2 A;  4AID A;  3NAU A;  1X2N A;  4C2M J;  2JVH A;  5HDK A;  1S7O A;  3FWE A;  3M8J A;  3CMY A;  2ZJQ F;  4BY1 J;  2JA8 J;  5AIP A;  2DOD A;  2ELJ A;  2A68 F;  4JOM A;  3KEO A;  3S2H J;  3IL2 A;  1ZR4 A;  4A3I J;  5GP9 A;  4E7S A;  2GIZ A;  1D5V A;  1EF4 A;  3GFM A;  3RQ4 A;  2RQP A;  5J40 A;  4F93 B;  5DM6 F;  3BWG A;  2JJ7 A;  2M0M A;  1MBE A;  2DYS H;  2CQK A;  3EDP A;  3FXM A;  2XKP A;  2YX7 A;  1GUU A;  5E3L A;  3ZN0 A;  1IV6 A;  1W5S A;  1XGN A;  5FKM A;  1D0Y A;  4O6J A;  2EZI A;  5K5Q A;  5IP6 A;  2QSH X;  1SVO A;  4G9Y A;  5CVJ A;  1F36 A;  4GCV A;  4J00 A;  2DA5 A;  1CQT A;  1XD7 A;  2O61 A;  3RKW A;  2UXX A;  4PFO A;  1H0M A;  1RET A;  2XF5 A;  1OMI A;  2ZME B;  3I64 A;  4IRH A;  3SXY A;  1ETW A;  1MJ9 A;  3O2P E;  5E1Z B;  3QP6 A;  1R1T A;  1MMG A;  4ZYA A;  1V5G A;  4XLC A;  1MIJ A;  2Y31 A;  4YIR X;  1IN8 A;  2JMW A;  1DGW Y;  5CPR B;  1FTZ A;  1IN7 A;  4B47 A;  3JRD A;  1ZH5 A;  3U21 A;  4R79 A;  5J4Y A;  2E35 A;  3ESW B;  3AG4 H;  3ABL H;  1JE8 A;  1K7A A;  4EGZ A;  2WAQ N;  3FMQ A;  1ETQ A;  3Q5F A;  2JA2 A;  2B9S A;  2LD5 A;  4UVA A;  5B1A H;  5FLX Z;  3HG9 A;  4FT8 A;  3L00 A;  3EUH A;  4BH9 A;  3ZQI A;  2YS9 A;  3BR6 A;  1E3P A;  4ENK A;  1YW7 A;  4H4K C;  2E7X A;  5CLS A;  1CF7 A;  5DCF A;  1VQK I;  2XPV A;  2BEO A;  4A3L J;  1MMD A;  3KZY A;  1DUX C;  2HFH A;  2X6Y A;  3CJT B;  1FBU A;  4LB6 B;  4GYG A;  1OFC X;  4YEL A;  1OCO H;  4DZJ A;  2RN7 A;  4N0B A;  3WE2 A;  4KA4 A;  4HLX A;  3FIS A;  4OWR B;  4CUG A;  1B8I A;  3RKX A;  2K4B A;  2RV8 A;  5D8K B;  1ZGA A;  1JT6 A;  2MC3 A;  1OCP A;  5J1U A;  3RKQ A;  3J7Y J;  1B59 A;  3OYN A;  3E5X A;  3TP3 A;  2NXN B;  1FOX A;  4IF4 A;  4C2U A;  3DFG A;  1LUJ B;  1XGO A;  4DQ2 A;  2WWY A;  3HHG A;  1ODD A;  5M5Y J;  3K10 A;  2DAO A;  3CO7 C;  4RAG A;  5EZG A;  1SFK A;  2HDC A;  1O3R A;  3ASO H;  5GPA A;  1VF9 A;  4IHS A;  3CCJ I;  2KRC A;  5FLM J;  3OYI A;  2WAE A;  4GGG A;  4Q47 A;  5AIQ A;  1HST A;  1FP2 A;  3BG6 A;  4XIC A;  2X6O A;  5CJ9 A;  2KJB A;  2PMH A;  4B4C A;  1JKQ C;  4A3B J;  3ROU A;  5FJ8 J;  4U87 A;  2R0Q C;  3GX4 X;  3IC7 A;  4G94 A;  2A07 F;  2DQR A;  1OYY A;  2IVM A;  2DMT A;  3MMY B;  3AKZ A;  1A35 A;  3SFZ A;  1XSD A;  4FIS A;  2DFE A;  3GFL A;  4RGX A;  1MBK A;  2LK2 A;  2HQN A;  5FKO A;  5ED4 A;  3HB9 A;  4OIN F;  1NK2 P;  5FKK A;  1AU7 A;  2NVX J;  3LSP A;  1AKH A;  3HOZ J;  1O57 A;  1O7L A;  4W1U A;  3HPG A;  1PYV A;  2P5K A;  1MBH A;  2FBH A;  3LWF A;  1TQP A;  1R4M B;  3HXL A;  4E4H A;  1WKM A;  2W82 A;  4HZF A;  9ANT A;  2H27 A;  5L3C A;  1W5T A;  4XLE A;  2H1K A;  2RAE A;  2AXT C;  4N9I A;  3OYD A;  2PQ8 A;  1OJL A;  4UVC A;  4J01 A;  1YOV B;  3U9G A;  2LLK A;  2VT2 A;  5F6F A;  3CC7 I;  5GAE J;  2DO7 A;  5IPA A;  3FHZ A;  2CH0 A;  3OYK A;  1SD5 A;  1C0W A;  4H0E A;  1YX3 A;  4LGW A;  2IEK A;  3H36 A;  3RZO J;  1J5Y A;  1R5G A;  2V1N A;  2NVQ J;  1GXQ A;  1FYM A;  2XRL A;  3L09 A;  2X85 A;  5FFX A;  2VQH A;  1XX5 A;  1YX5 A;  4KT5 C;  1H8A C;  2K86 A;  1K6Y A;  3I9V 2;  3LSM A;  5CVI A;  1FIA A;  2L7Z A;  1FSE A;  5ERI A;  1I6X A;  1ON1 A;  3DWL E;  4ZDO A;  4XSX F;  1WSU A;  3SZP A;  4AVP A;  2NNN A;  4HQM A;  2VBW A;  3IKT A;  1T39 A;  3RIR A;  4WX9 A;  3CCY A;  2DQL A;  2IT0 A;  2K27 A;  3Q3S A;  2PJR B;  3DKW A;  4I0B A;  4I99 C;  3H3U A;  2E1N A;  2ZCW A;  3BRO A;  4B48 A;  4D0P A;  3DQV C;  5IOZ A;  4A3E J;  1IGN A;  1YIO A;  2RNJ A;  1ETY A;  1RZ4 A;  3K0L A;  4GYI A;  2VOO A;  2G7H A;  1LFB A;  3KEY A;  3C1D A;  3BCB A;  4BDZ A;  2K3P A;  2NS0 A;  4HF0 A;  5M3F J;  4BS9 A;  1FOW A;  3L2C A;  2XF7 A;  3S3M A;  3K4N A;  1EJ9 A;  2D1H A;  2OBP A;  2CJJ A;  1LVK A;  2JVG A;  3F3X A;  2XC7 A;  3HOS A;  4LLL A;  1J75 A;  1I5Z A;  3DCF A;  2XRN A;  4NUB A;  2ESN A;  3S32 A;  3TW6 A;  4JX4 A;  1LE8 B;  2DU9 A;  3ZQQ A;  1FTT A;  3JCU C;  3DPL C;  1PUE E;  2R7D A;  5JR3 A;  2IA0 A;  1ZGW A;  1BI0 A;  1TQI A;  4ENM A;  2ELH A;  3VSK A;  2V1D A;  3LMM A;  2IBD A;  3J80 Z;  2Y9Z A;  2L7K A;  2AXL A;  5CVR A;  4CDG A;  1ZLK A;  2FX0 A;  4XOT A;  3EYY A;  4HF2 A;  3M9A A;  1VQN I;  2N8G A;  2VL8 A;  3ZQF A;  1K78 A;  1QU3 A;  1YS6 A;  2L9V A;  4HOB A;  2ISY A;  3PO3 J;  1YJN I;  3OV8 A;  2P5L C;  5FRN A;  1UHW A;  3S8P A;  4KIS A;  3ZQL A;  2DYR H;  3CJQ B;  2V6E A;  1XGS A;  1S3J A;  1IO2 A;  5JLX A;  4QIW N;  3KLO A;  3V8J A;  4YFK F;  2JWT A;  3KLN A;  4M9Z A;  1E17 A;  3WOD F;  1UHM A;  1EV7 A;  3BP8 A;  1B9M A;  1RIO H;  5C4J J;  4ESJ A;  4FHT A;  3DKY A;  3VOD A;  3F21 A;  1YJW I;  2BVM A;  3W2W A;  2MW8 A;  2FU4 A;  2OV7 A;  1X1P A;  4ESB A;  5ICC A;  4OMY A;  2QA4 I;  1YQA A;  2PJP A;  3FXR A;  4D7M A;  4L9T A;  1NH3 A;  2I5U A;  2BY1 A;  2FMY A;  3FXO A;  3ZN1 A;  3QYE A;  1Z6T A;  3AFH A;  4XLN F;  1G3T A;  3KYC B;  3A0H C;  3OIQ A;  1P4W A;  4G6Q A;  4DYR A;  3AG1 H;  3BPV A;  1W7P B;  3SJM A;  5L3F A;  1ZLJ A;  2Z1D A;  4Y13 A;  3K69 A;  1ZRE A;  5EG0 A;  2LTP A;  2QVO A;  4PFP A;  1W7P A;  4A3C J;  2Q8K A;  3CES A;  1VQP I;  3A0B C;  2ZJR F;  1ETO A;  4A3J J;  5IP9 J;  3GWZ A;  4XKC A;  2JSP A;  4B09 A;  2KIM A;  1VND A;  3K70 D;  2EFN A;  3TOA A;  4LFU A;  2K7L A;  2HTS A;  3R0J A;  4RGU A;  2JTV A;  5DD8 A;  4E70 A;  3MKL A;  2VQG A;  1XGM A;  2F5V A;  2K9L A;  5DV5 A;  5ILU A;  3LST A;  4EEF G;  2DA4 A;  5DUI A;  1GXP A;  3F0C A;  2OU2 A;  3PO2 J;  2D45 A;  4LIV A;  4XMY A;  2OQR A;  5GAG J;  2LBF A;  1JJ6 C;  2L7M P;  1SD4 A;  4E7I A; 
#chains in the Genus database with same CATH homology
 3FKI J;  1MNM C;  2KDZ A;  2ECB A;  2CRG A;  3WHB A;  3BG3 A;  4MLO A;  1PUF B;  2WV1 A;  2R5Z B;  5EEA A;  3BR0 A;  4FCY A;  1JTX A;  2R92 J;  3M3Y J;  1BA5 A;  1Z77 A;  2E2J J;  3NAR A;  3OSG A;  2ZB9 A;  3LSJ A;  2JN6 A;  3S1M J;  4UUS B;  1TC3 C;  4A3M J;  1SFO J;  3S16 J;  1SAN A;  5M5X J;  2CUE A;  2Y0S N;  2EBI A;  5F0F A;  5HOD A;  3H0G J;  4AC0 A;  5IP7 J;  1VI0 A;  3ZQH A;  2QF7 A;  5EG0 B;  3JRC A;  1RES A;  2VPR A;  1UHS A;  1W0T A;  3IH3 A;  3ZQG A;  5DTD A;  1BW5 A;  2OPT A;  3ZQC A;  3LSG A;  3E7L A;  5F04 A;  1ZKG A;  1MH4 A;  4UUT A;  2DA2 A;  4XRS G;  1LE8 A;  3HKZ N;  3LNQ A;  2GM4 A;  3RZD J;  5M3M J;  1GT0 C;  3B6A A;  2DA6 A;  3G1L A;  2DJN A;  3W6V A;  2NS7 A;  4C3H J;  2X48 A;  2LFB A;  3GTP J;  4DW6 A;  3BR5 A;  2MSY A;  3BG5 A;  3SFI A;  1IRZ A;  2R5Z A;  4XRS A;  1ORK A;  3HGG A;  1GDT A;  1MSE C;  3WHC A;  3ZOB A;  1MH3 A;  1XG1 A;  2XGC A;  1FEX A;  1Q1V A;  2M9H A;  5M5W J;  2AO9 A;  3D1N I;  5FKL A;  1IDZ A;  2XSD C;  2Y9Y A;  4I6Z A;  4L5E A;  1QPI A;  3OSF A;  5F08 A;  1MBF A;  2K9Q A;  4RDU A;  4JX5 A;  1IUF A;  1OCT C;  2MGQ A;  3Q0V A;  4QSH A;  2NVY J;  1ZTR A;  3BTC A;  4FE4 A;  3BG9 A;  2M0C A;  1MBG A;  2TCT A;  1A6I A;  1R9T J;  3BT9 A;  1TWH J;  4XRM A;  3OIO A;  1WGX A;  2QCO A;  1E3O C;  3S2D J;  1ITY A;  4JP0 A;  1H88 C;  3Q0U A;  2HOT A;  2LKX A;  1JUS A;  5FLV A;  4V2F A;  2DA7 A;  2VUM J;  3NAU A;  1X2N A;  3GTG J;  1A5J A;  4C2M J;  5EZH A;  2JA8 J;  4FE7 A;  5EGO A;  3CMY A;  4BY1 J;  5EDN A;  1U78 A;  3S2H J;  1WPK A;  5F0H A;  2R5Y A;  1ZR4 A;  1VFC A;  1B72 B;  1WI3 A;  2K40 A;  4A3I J;  5GP9 A;  2M34 A;  2L0K A;  2NS8 A;  4J19 A;  2EQR A;  4IEJ A;  1EF4 A;  2O7O A;  2JJ7 A;  1MBE A;  2DA3 A;  3CDL A;  4DYQ A;  2TRT A;  2HOS A;  4M6V A;  1GUU A;  5E3L A;  3TED A;  1IV6 A;  5F27 A;  5FKM A;  2EZI A;  2CUF A;  1NTC A;  5IP6 A;  4M3F A;  3TP0 A;  1QVT A;  4MFD A;  4DZP A;  3LOC A;  2JA6 J;  1F36 A;  4D5F A;  2R7Z J;  2DA5 A;  1CQT A;  2M2E A;  1RET A;  1W0U A;  2DMQ A;  1IG7 A;  2EZH A;  2YU9 J;  1ETW A;  3SDG A;  5EYR A;  1FJL A;  3CQZ J;  4BXX J;  2DMN A;  2IAI A;  1X58 A;  1I50 J;  1P7I A;  4JX6 A;  5C3E J;  2Y31 A;  3HOY J;  2JMW A;  2CQQ A;  4MO7 A;  3G1M A;  3HGY A;  3GBG A;  3JRD A;  1FTZ A;  2KT0 A;  1QRY A;  2R93 J;  2JA7 J;  2K9N A;  3C2B A;  3BR1 A;  2DN0 A;  2JK3 A;  3HDD A;  3A03 A;  1T33 A;  5K7H A;  4CYC B;  2R5Y B;  2WAQ N;  3JRA A;  1K83 J;  1ETQ A;  1HF0 A;  2E2H J;  1HLV A;  1IC8 A;  1JT0 A;  2LD5 A;  1MSF C;  1RPW A;  3HOX J;  4M3G A;  4DYC A;  1MBJ A;  1BL0 A;  1ZK8 A;  3A02 A;  3ZQI A;  5J3L A;  1Z0X A;  5F0C A;  2YS9 A;  3BR6 A;  4IHV A;  1GV2 A;  2O8K A;  1ETV A;  4JYK A;  4NDL A;  3K7A J;  2XPV A;  1FIP A;  4UUS A;  3S17 J;  4A3L J;  4QTR A;  2XB0 X;  4C3J J;  5IYB J;  1OFC X;  1GVD A;  3TW7 A;  4DZJ A;  1JTY A;  4Y52 J;  1AHD P;  2AHQ A;  2CU7 A;  3FIS A;  3RQI A;  1B8I A;  2HXI A;  2CQX A;  4GFB A;  1AKH B;  2ECC A;  2GBY A;  2NOG A;  2HXO A;  3FK7 A;  2EZL A;  3JR9 A;  2MG4 A;  1JT6 A;  4M3B A;  1OCP A;  5J1U A;  3RKQ A;  2XGD A;  5J1R A;  2PMZ N;  2XB5 A;  4A3F J;  5FKN A;  3TP3 A;  3FIW A;  4BBR J;  3A01 B;  5M5Y J;  2Y30 A;  5F1J A;  5EZG A;  1YRN A;  5BNG A;  4AYB N;  4I76 A;  5GPA A;  1VF9 A;  2EZK A;  1JUM A;  3JRE A;  1I6H J;  5FLM J;  2E1O A;  4G12 A;  1BJZ A;  2E2I J;  3S1N J;  1WCM J;  4XIC A;  2X6O A;  1JKQ C;  2DMP A;  4B4C A;  4A3B J;  4X6A J;  5FJ8 J;  3JRH A;  5DS9 A;  2DA1 A;  2R0Q C;  1JKR C;  1TWG J;  3Q0W A;  3G1O A;  2DMT A;  2XPW A;  1HDD C;  3S15 J;  4FIS A;  3GTL J;  1Y1V J;  4LOC A;  3GTK J;  1MBK A;  2LK2 A;  4W97 A;  5FKO A;  3LSR A;  3HB9 A;  1NK2 P;  5FKK A;  1AU7 A;  2NVX J;  3LSP A;  2LY9 A;  1AKH A;  3HOZ J;  4W1U A;  4A69 C;  1H89 C;  1ETK A;  1MBH A;  3I4M J;  1HOM A;  2WB1 N;  3HM5 A;  3IV5 A;  9ANT A;  3QPL A;  2H1K A;  2RAE A;  1WH5 A;  2HOA A;  2H8R A;  3BTL A;  1OJL A;  3S14 J;  2FJ1 A;  1QVU A;  2G0E A;  2LLK A;  2VKV A;  5IYC J;  1B8I B;  4MFE A;  4FTH A;  5IPA A;  2ELK A;  1U9O A;  4CYC A;  4C3I J;  1ZR2 A;  1JUP A;  2IEK A;  3RZO J;  4A3D J;  4IHY A;  3L1P A;  2NVQ J;  4BBS J;  1RR7 A;  2XRL A;  1ETX A;  1TWA J;  3GTJ J;  1K61 A;  2B63 J;  3I4N J;  1H8A C;  3UKG A;  2JA5 J;  1G2H A;  5J1Y A;  1FIA A;  1P7J A;  2L7Z A;  4B1R A;  5GPC A;  1T56 A;  4AUX A;  3MN2 A;  1F43 A;  2LP0 A;  2L9R A;  2OF7 A;  2Y2Z A;  5JLW A;  3CCY A;  1JGG A;  1D5Y A;  3Q3S A;  5E3O A;  1UG2 A;  2HQ5 A;  4BY7 J;  3O8H A;  5IOZ A;  1ZQ3 P;  1IGN A;  4A3E J;  1ETY A;  4Y7N J;  2E19 A;  4XK4 A;  1LFB A;  5IOY A;  3VPR A;  1JJ8 C;  1RKT A;  3BQY A;  2HYJ A;  3A01 A;  1XC5 A;  3BR3 A;  4S0H B;  4A3K J;  5M3F J;  2ME0 A;  1JKP C;  1X2M A;  2GLO A;  2LR8 A;  2CJJ A;  2O9L A;  1YRN B;  3JRB A;  3BQZ A;  3DCF A;  2NVT J;  1HCR A;  2XPU A;  2I10 A;  3JRF A;  2VI6 A;  3TW6 A;  4JX4 A;  1LE8 B;  3HOU J;  2EH3 A;  2P81 A;  5E3M A;  1FTT A;  1APL C;  3B6C A;  3BR2 A;  1ZGW A;  3M4O J;  2VKE A;  1IJW C;  3HOV J;  2IBD A;  2Y9Z A;  2DMU A;  1POG A;  2FX0 A;  4V2G A;  1NK3 P;  1XS9 A;  3PM1 A;  1HDP A;  2LVS A;  3O8G A;  2FQ4 A;  3JRI A;  2N8G A;  3ZQF A;  5EF6 A;  1LFU P;  3IH4 A;  3HOW J;  3PO3 J;  1ENH A;  1O4X A;  3S1R J;  1PUF A;  2HDD A;  3GTQ J;  5K7F A;  4RBO A;  1U8B A;  4XID A;  3ZQL A;  2K9S A;  3BTI A;  5JLX A;  4QIW N;  2JWT A;  4A3G J;  3QQA A;  5C4X J;  4IHW A;  4MIM A;  4B3A A;  1Y1W J;  5C4J J;  2W48 A;  2ME6 A;  3GTM J;  3H3V K;  2MW8 A;  2COB A;  3FK6 A;  4D7M A;  4BKX A;  1TWC J;  1RKW A;  4M3E A;  2M8G X;  3GTO J;  4DYR A;  5E3N A;  4X1E A;  2HI3 A;  3SJM A;  3BTJ A;  1GV5 A;  4D7N A;  4HNV A;  2FD5 A;  1U9N A;  5EG0 A;  5IYD J;  1S7E A;  2LTP A;  1JKO C;  2L7F P;  3QPS A;  1IDY A;  5EGO B;  4A3C J;  1DU0 A;  3JRG A;  2DTZ A;  4A3J J;  1ETO A;  3HEF A;  5IP9 J;  3DEW A;  3MVP A;  1BW6 A;  1WH7 A;  1DU6 A;  1I3Q J;  1VND A;  4A93 J;  3S1Q J;  2XGE A;  3IH2 A;  5C44 J;  3HBL A;  4IHX A;  1TWF J;  2X9D A;  3MKL A;  2D5V A;  2ID3 A;  2L7M P;  2DA4 A;  4EEF G;  2ID6 A;  3F0C A;  3K2A A;  1UMQ A;  5K7Z A;  1B72 A;  3PO2 J;  4D5C A;  4M3D A;  1JJ6 C;  4ABZ A;  3OOU A;  2YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...