5M3MJ

Free monomeric rna polymerase i at 4.0a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m3mJ00
3OSFA 3JRBA 2X48A 1ZK8A 1IDZA 5M5YJ 3A01A 3TW6A 2GLOA 2DN0A 2XGCA 1XG1A 5GPCA 5C3EJ 1MH4A 1LE8A 2E2HJ 3JRFA 2LLKA 1ZGWA 2LTPA 2XGDA 3BR1A 1G2HA 1DU0A 3FK7A 3RKQA 3FISA 3S15J 1SFOJ 3ZQFA 2NVXJ 5F1JA 3HGGA 4QTRA 2JN6A 4D5FA 1IGNA 2NS7A 5M3FJ 3GBGA 1TWCJ 2VI6A 5C4JJ 4IHVA 2NOGA 1RPWA 4DYRA 3TP3A 2DMUA 1GDTA 2LKXA 1D5YA 1VI0A 2KT0A 2EZKA 1AKHB 3WHBA 2D5VA 2EZIA 3MKLA 2CU7A 1JT6A 2YUSA 2NS8A 4FTHA 4X1EA 1QRYA 5IPAA 3HOWJ 3BQZA 4FE4A 2HDDA 4A3BJ 5IOYA 3TP0A 1JUSA 2CRGA 4IHXA 1JKRC 3GTOJ 1OCPA 3S14J 2LK2A 4XRMA 1O4XA 1WCMJ 4QIWN 2L0KA 5FKOA 4IHWA 4XRSA 1NK3P 5EGOA 2ID6A 1ZR4A 1E3OC 2IAIA 3HKZN 2JA8J 3B6CA 1GVDA 5E3OA 3LSRA 3BR5A 1X2MA 3HGYA 4Y7NJ 2HXOA 3H3VK 4C3IJ 1JTYA 1Z0XA 3MN2A 5C4XJ 3CQZJ 3NARA 1UHSA 1NTCA 1JUPA 3IH2A 4C3HJ 5M5XJ 2R5ZB 3QQAA 2H8RA 2FQ4A 5F27A 3HM5A 1ETKA 1T33A 2TCTA 5K7ZA 3HEFA 4C3JJ 3H0GJ 3E7LA 2IEKA 2DA1A 4A3FJ 4A3CJ 2Y9YA 2CJJA 1TC3C 3JRDA 1NK2P 2QCOA 3BR6A 1ZKGA 1CQTA 2XB5A 1FJLA 1I3QJ 1MNMC 3GTLJ 5F0FA 1X2NA 1JKOC 2MG4A 1JJ8C 3IH4A 1B8IA 2R7ZJ 1ZTRA 5IYBJ 4D7NA 4M3EA 5EG0A 3OSGA 2JA7J 2O9LA 1WI3A 5FLMJ 1MBEA 3JRHA 3I4NJ 4D7MA 2FJ1A 2JMWA 2Y31A 1B72A 3S16J 4M3GA 1JTXA 1VF9A 1P7JA 1SANA 1BL0A 1IJWC 3HOXJ 4JX4A 4XIDA 1HCRA 5FLVA 4A93J 2CQXA 4ABZA 1K83J 2EBIA 5M5WJ 2LR8A 2E1OA 3TW7A 3IH3A 1PUFB 4HNVA 2JWTA 3L1PA 1WH5A 2R5ZA 3K7AJ 3HOVJ 3UKGA 1A6IA 1X58A 4DYCA 3GTMJ 4C2MJ 2Y9ZA 1ITYA 4AUXA 1RKTA 5J1YA 3JREA 4NDLA 1W0UA 4B4CA 3Q3SA 3BTIA 4S0HB 3S17J 4X6AJ 2MSYA 2N8GA 3JRIA 3ZQGA 4A3KJ 5EF6A 4A3EJ 2M8GX 3BT9A 2HOTA 2LY9A 1LFBA 3VPRA 4BBRJ 4J19A 3JR9A 3QPLA 2ELKA 1FTTA 5EEAA 3HOZJ 3SJMA 5IYDJ 2FD5A 2LVSA 4XK4A 4A69C 1I50J 2DMQA 3HB9A 1MH3A 3LSPA 2LP0A 2R93J 4DYQA 2AHQA 3JRAA 1YRNA 2OPTA 2XGEA 5K7HA 3BR0A 2R5YB 2Y30A 3QPSA 4A3GJ 4EEFG 3RZOJ 3G1OA 5GP9A 4D5CA 4A3LJ 1ETQA 2OF7A 3PO2J 1JT0A 5FKLA 1ETOA 3D1NI 1K61A 1IDYA 3CDLA 1U78A 1HF0A 5E3LA 2VKVA 3ZOBA 4M3BA 5IYCJ 3GTJJ 3OOUA 1WH7A 3LSGA 1ENHA 2NVTJ 2QF7A 1WPKA 1IC8A 1HLVA 2HOSA 1UMQA 2WAQN 3F0CA 2DJNA 2AO9A 5FJ8J 5F0HA 2ME0A 2PMZN 1ETYA 5E3MA 1U9OA 3FK6A 5GPAA 3BG3A 1U8BA 2ZB9A 2ECCA 5IP7J 2R0QC 1HOMA 3LSJA 1W0TA 1IRZA 1I6HJ 3A03A 2RAEA 2DA2A 2VPRA 3Q0UA 5M3MJ 5FKMA 1ORKA 3ZQIA 5DS9A 5EDNA 1AKHA 1ETWA 5J3LA 3M4OJ 4BKXA 3A01B 1GV2A 4UUTA 1TWAJ 1LE8B 3HBLA 2GBYA 5E3NA 2CQQA 3JRGA 5F04A 1Y1WJ 2EH3A 1MBKA 3BTCA 2R5YA 3JRCA 1BW6A 3GTQJ 2K9NA 3B6AA 4DZJA 1FTZA 2EQRA 4XRSG 1VFCA 4AYBN 1JGGA 2XPVA 2E2JJ 3I4MJ 4AC0A 3RZDJ 1F36A 4MFDA 1TWFJ 1EF4A 4W97A 1IV6A 3BR2A 2NVYJ 2CUFA 2Y0SN 5C44J 2HQ5A 4CYCB 3S2HJ 2G0EA 1BW5A 4QSHA 1HDDC 5IP6A 3BTJA 5K7FA 3CCYA 3S1NJ 2DA5A 2M34A 5F0CA 4A3DJ 5JLWA 5F08A 1ETVA 2VKEA 1RR7A 3RQIA 1DU6A 3SFIA 1A5JA 1GUUA 2FX0A 1JKQC 2O8KA 2IBDA 5EGOB 2DMNA 1BJZA 1MBGA 5EYRA 2LFBA 1WGXA 3S1RJ 4M3FA 4W1UA 4JX5A 1ZR2A 4BY1J 3GTKJ 2CUEA 1MBHA 2W48A 2WV1A 5HODA 3DEWA 2O7OA 4A3JJ 1H8AC 2X6OA 1MSFC 4GFBA 4UUSB 3IV5A 3FKIJ 3HOYJ 2DA7A 4JP0A 2H1KA 4FCYA 1QVUA 3S1QJ 4LOCA 4L5EA 1HDPA 5J1UA 2I10A 4B3AA 1ETXA 2Y2ZA 2XB0X 3K2AA 1P7IA 2HI3A 4RBOA 3PM1A 2DMPA 3OIOA 5DTDA 2JK3A 3LNQA 2XPUA 4M3DA 1VNDA 5FKKA 3TEDA 2JA6J 4IEJA 2JA5J 2K9QA 1H88C 2JJ7A 1H89C 1IG7A 1R9TJ 1XS9A 5EZHA 1S7EA 5IP9J 1Q1VA 4XICA 4CYCA 3Q0WA 3BG5A 1B8IB 1OJLA 2DMTA 2L7FP 4MIMA 4RDUA 2E2IJ 3S1MJ 3HOUJ 1TWHJ 4MO7A 4V2GA 5EG0B 4A3IJ 1PUFA 1MSEC 3W6VA 2L7ZA 3LOCA 3GTPJ 1RESA 3BQYA 1QPIA 5BNGA 4JYKA 2MGQA 2X9DA 1MBJA 2M0CA 2DA6A 1B72B 2HOAA 2ECBA 2WB1N 4Y52J 2NVQJ 4M6VA 3NAUA 1FIAA 2L9RA 3BG9A 1APLC 2GM4A 2K9SA 4B1RA 4V2FA 4DW6A 4G12A 2EZLA 1IUFA 3O8GA 4UUSA 2YU9J 2MW8A 1Y1VJ 2E19A 4MFEA 1RKWA 3BR3A 3MVPA 2DA4A 2L7MP 4A3MJ 3PO3J 1QVTA 2VUMJ 4IHYA 2M2EA 3ZQCA 2P81A 1Z77A 2HYJA 4I76A 4FE7A 1POGA 4DZPA 1ZQ3P 2EZHA 2XRLA 4BY7J 3DCFA 1LFUP 1TWGJ 3S2DJ 5IOZA 2K40A 1BA5A 1GT0C 3BTLA 1JKPC 1UG2A 3C2BA 1AHDP 1OFCX 3ZQHA 5EZGA 1JJ6C 1XC5A 2B63J 2HXIA 3A02A 4BBSJ 2YS9A 2ID3A 1RETA 2DA3A 2KDZA 1FIPA 4MLOA 1MBFA 5JLXA 4JX6A 1YRNB 2TRTA 4BXXJ 1JUMA 4I6ZA 2XPWA 3SDGA 1OCTC 2LD5A 1FEXA 2COBA 2XSDC 3FIWA 1F43A 2M9HA 3M3YJ 4FISA 2DTZA 3HDDA 1AU7A 1U9NA 2R92J 3CMYA 5FKNA 3GTGJ 9ANTA 5J1RA 1GV5A 3WHCA 3G1LA 3G1MA 1T56A 3ZQLA 2ME6A 3Q0VA 3O8HA
chains in the Genus database with same CATH superfamily
1UHWA 5IT9K 3V8KA 2A5YB 3KPHA 1FOKA 4M6XA 3S3OA 1IDZA 1TZLA 2EV5A 2DXIA 2LF7A 5M5YJ 2GLOA 2DN0A 2V26A 1XG1A 1A04A 4MEYF 1MH4A 4A0YA 5GPCA 1LE8A 2E2HJ 2XGDA 1V54H 3L00A 4N4NB 4DIQA 2V6EA 1YI2I 2CSOA 4RAZA 3RYPA 4XQFA 4RB1A 3KIOA 3LSKA 4CGZA 2EWNA 1FOXA 1V3FA 5D5XB 2VI6A 4IHVA 2E35A 2NOGA 5CLSA 2DDAA 1GDTA 2VN2A 1I5ZA 4ZYEA 1U5TB 4ZDPA 3ZMSA 3K6GA 1BC8C 2H8WA 2KT0A 2O8XA 3T5XA 2K02A 1SVOA 3CP2A 1BC7C 2XVCA 2KL4A 3K10A 2D5VA 3A2KA 4XMYA 1OKRA 2YUSA 4IKFA 1XTAA 4BE0A 5IPAA 1K79A 5IT3A 1LDJA 4E6KG 3MMYB 4QPOA 1R1VA 1B9NA 2CRGA 4IHXA 4UVBA 2ZMEC 1O4XA 3ERED 3TGNA 5DDGA 4Y3OA 5HDNA 3GZ6A 5FKOA 5LGNA 4B44A 5EGOA 2ID6A 3RKYA 1UJ8A 2ZXWH 1R5HA 4PDKA 3CMAI 1IRGA 3RPUA 1E3OC 3HKZN 2QSFX 4A5MA 2JA8J 2P5VA 4CA0A 1GVDA 2F5EA 4QPQA 3BR5A 2DBBA 3R0JA 2QGUA 1G3SA 2DFHA 3M7GA 5E8GA 1WJCA 3RKWA 3N4MA 1T0FA 2HXOA 1ZRFA 2COMA 4C3IJ 4AWXB 4LFUA 3MN2A 3LAJA 5C4XJ 3DPTA 1O3SA 2V4JC 4C2TA 1W7PB 3HJEA 4HSTA 3VEPA 2GIVA 3R6SA 3IH2A 4C3HJ 4R79A 3V8JA 3QQAA 1STZA 1R4NB 1LVAA 1ETKA 3F72A 3ZMZA 4RM3A 1U8RA 4CDGA 4G7HF 3HUGB 2CW8A 2NS0A 3H0GJ 3QYBA 1WJAA 5FB2A 2IEKA 2DA1A 3RPQA 2LOOA 1MDMA 2CJJA 4ENMA 4G7OF 2X1CA 1TC3C 5LHIA 1NK2P 3SXYA 2QCOA 2FMLA 2W57A 2QSGX 2V1XA 1CQTA 5ILVA 1SAXA 4ON0A 1WKMA 3MKYB 3DEUA 2BGCA 2W82A 4UV9A 5F0FA 2DQLA 2M4KA 4ZZDA 3CCRI 5IYBJ 1Z21A 4PK4A 1VQ8I 2CG4A 3AAFA 2FSWA 4M3EA 5EG0A 2DQRA 4ZZLA 3QOEA 2R7WA 4M71A 4YIIA 4OWRB 5D8LB 1WI3A 2KRCA 4XLEA 3JRHA 3W6KB 2FJ1A 2Y31A 2W85A 4XLNF 3ZRGA 1KQ0A 4EM2A 2RKHA 1VF9A 2FU4A 1P7JA 1SANA 3LQRA 1WFXA 1ZGJA 1IJWC 4BU2A 3DV8A 4I0AA 4I99C 2IGNA 3FM3A 4XIDA 5FLVA 4A93J 1UZCA 3TBIA 2CQXA 4ABZA 3U21A 3BPVA 3FZVA 2UV1A 4AYBA 5E1XA 3TW7A 1W36C 4HNVA 2JWTA 2Q8KA 1WH5A 2FF4A 3UKGA 5DYMA 4UB8C 2VLAA 3GTMJ 4C2MJ 2O61A 2W84A 4DGWB 2Y9ZA 3HUGA 3DFGA 1W7PD 4HNUA 5J1YA 3JREA 2BXZA 4C2UA 4NDLA 1W0UA 3OOPA 3P9KA 4IX7A 5CVVA 1ZN2A 3GX4X 2V7FA 2KPMA 3S17J 5JFRA 4RLFA 4A3KJ 5EF6A 2WV0A 4KITB 4HSRA 1LFBA 3CDIA 1K4TA 1YE9A 4J19A 4OIQF 1DP3A 3UR3C 2ELKA 3KYDB 3QRFF 3B02A 4KT5C 1ULYA 1HC8A 3PUBA 3BCBA 2FD5A 1RI7A 4XK4A 4A6EA 1RRJA 2IS4A 2GZWA 4GYGA 4BXFA 1QGPA 3GF2A 2DMQA 1G59A 3LSPA 1YRNA 1DGRM 2R5YB 2EA2A 4EEFG 2IS6A 1G3WA 1G8XA 2R7DA 2EIMH 4OINF 2EFPA 4A3LJ 3ESWB 1ETQA 3EUHC 3GVAA 3E0JB 3RYRA 1QBJA 4NNJA 1ETOA 3D1NI 2CV1A 2QQAA 1HF0A 2OA4A 2GXBA 5FD6A 5E3LA 4OIRF 3GLXA 2B9SA 2LF8A 3ZOBA 2OUMA 4BEHB 3GTJJ 2Q0OA 4E7SA 3DU6A 4R1HA 1ENHA 3BY6A 1YITI 1WPKA 4IJAA 3K1PA 3F0CA 5FROA 1USSA 2DJNA 3K4MA 2L01A 5F0HA 1ZHFA 4ZTJA 3P9CA 4DOZA 2IS2A 2EFNA 2MD0A 3I58A 2P5KA 3WE3A 2CV0A 1QHGA 1TP4A 3PQJA 4L0YB 2PLYA 2ECCA 1BR2A 1FZPB 4N4OB 1IW7F 2W24A 3REOA 3U1KA 5FRMA 2PMHA 2YU3A 1I27A 2VPRA 1TW2A 1XMAA 2O0YA 4XBFA 1ORKA 2V9VA 5EDNA 1AKHA 2LRDA 3CUQC 1XSDA 2Y48A 1L0OC 5B1BH 3LL7A 5LRSA 1TWAJ 3HTUA 3HBLA 1LNWA 1KGSA 3HTSB 2H94A 2LREA 3DPUA 1V4RA 1Y1WJ 1D1AA 1XPXA 3H92A 4AIDA 1MBKA 3OYNA 3AG2H 2LKSA 2QUFA 3K0LA 2R5YA 4OMZA 2L9SA 2IVMA 2BY1A 4I09A 3FBNB 4DZJA 1FPQA 2EQRA 3NWSA 4XRSG 4EGZA 4IQ4A 1KU2A 5ICGA 4AYBN 2JQ7A 2FOWA 5KNLA 3I4MJ 2ZXHA 4MFDA 2STWA 2ZMEA 4BEHA 4BNCA 3IUOA 2NVUB 3ROUA 1S7AA 2FE3A 4HW0A 3BR2A 5C44J 4FASD 2G0EA 1BW5A 4CYDA 1X3UA 1VQMI 4I7HA 4OAYA 3CCYA 2DA5A 3E6DA 5CQEA 4AU7A 3QP5A 5F08A 1XB4A 4EJWA 1SD4A 3SFIA 3DLLF 4HF0A 2RN7A 2V9PA 2ZSHB 2FX0A 2Z33A 1JKQC 2OC6A 3LAPA 2OJED 2DMNA 3AFHA 5J47A 4IL6C 2PJRA 2F4OB 2VBYA 3BC8A 2HYFA 2HZTA 4JX5A 2KRFA 4W1UA 1ZR2A 1O3QA 2PI0A 4BY1J 2Z2SB 2P0WA 3KZZA 1Y39A 3U2RA 4MTEA 4EATA 1V55H 3T1BA 1N25A 1IN6A 2IW5A 3SYTA 4HQMA 4IQJA 1A31A 2JT1A 1J75A 2R7XA 5HOOA 3M8EA 5E79C 4WK8F 4DJAA 1SC7A 3TDZC 1R7JA 4EJVA 1EKEA 2XF5A 2IPQX 5J1UA 5D4SA 3K2AA 3JAMZ 3HOTA 4GRIA 1PP8F 1GVJA 1FMVA 2DMPA 1SAUA 2FEZA 3K4LA 3RDIA 5E1WA 2A6TA 3MCZA 2XPUA 2A6HF 1YFHA 2DDBA 3TEDA 1TL8A 1H88C 2JJ7A 2Z3YA 3AG1H 2X6WA 5JHUA 1IG7A 5EZHA 2R7QA 2JTVA 1PVEA 5ILUA 3EETA 2STTA 3HL2A 2DMTA 4MIMA 2FA5A 2X4HA 2JVHA 2PBIA 4A3IJ 1HW1A 1TLHB 5LD2C 5KHDA 3GTPJ 1I1GA 4NC6A 6PAXA 4BS9A 3I53A 2M0MA 3BQYA 1QPIA 1QU3A 3V7SA 4UB6C 4UXNA 4Y13A 1YQAA 4LGWA 1B72B 1D8KA 2JPCA 2ECBA 1Y56A 4Y52J 1ONVA 2F48A 2QQ8A 1FIAA 1APLC 2QBYB 2W7NA 2K9SA 4NQWB 4F92B 3D5SC 3QYEA 4DW6A 4BXUA 3W2VA 4G12A 2EZLA 1IUFA 3O8GA 2QKMB 1G4DA 4Q48A 1ZG1A 3MVPA 3BR3A 1ACIA 2DA4A 1KYZA 3HRSA 4XORA 5LEKA 1OPCA 4HZFA 1W36D 2LY1A 2M2EA 2VJ5A 3ZQCA 1IAWA 1WZ2A 2QENA 2FOKA 2JUGA 3LMMA 1ZQ3P 3ABUA 4BY7J 4L9NA 1FY7A 2VT3A 2KISA 1PDNC 3BDDA 3ZMTA 1TWGJ 2MBFA 3CJRB 3V8LA 1N77A 4PGGA 5J4VA 2XC7A 1GT0C 1X1PA 3C2BA 4YG2F 1YHQI 5J6XA 3PFIA 5EZGA 1VQKI 1R5GA 3KP3A 3Q9SA 3K69A 2XIGA 1JJ6C 2HXIA 4ZYAA 4BBSJ 2YS9A 4A5NA 2P7VB 1LDKB 4TV7A 1RETA 1HKSA 4AVZA 5D5VB 5BOXA 4KYWA 2EB7A 4MLOA 3IHUA 3EUHA 4IOAF 4JX6A 5LHHA 5HLHA 2BW3B 1B9MA 3KYLA 4FETA 3QODA 3ASNH 3I59B 3SDGA 2COBA 5HS8A 3FIWA 4ZYHA 3CCLI 4M72A 1CF7A 4FISA 3CLQA 2BHZA 3QP6A 2HQRA 5GADJ 5HNHA 4AIJA 2OV7A 1AU7A 3CMYA 5FKNA 4DQ2A 3OS1A 9ANTA 1GV5A 2H09A 1JI8A 1T95A 2V1NA 4BDYA 1T56A 3BP8A 2KHMA 2GXGA 4BL0B 3GEZA 2DTRA 3Q0VA 1LB2A 4CCMA 3OSFA 2X48A 5GAGJ 2XAQA 4KN7X 4OOIA 5J4YA 5E17F 2EIKH 3O2PE 4M9SA 3A01A 3FMSA 3TW6A 5F64A 3HRMA 4MQ9F 3JRFA 1ZGWA 2KMUA 3HPGA 3J81Z 3BR1A 4PJMA 5KAFC 4WX9A 3FISA 3WU0A 1Z6RA 4ZTFA 3S15J 1E0EA 3ZQFA 5HLTA 2NVXJ 3HGGA 2JN6A 1OYWA 5E1ZB 1IGNA 3CUQA 3FBIB 5A2QZ 3H3UA 2NS7A 3C7JA 5M3FJ 1KU7A 2LBFA 2X85A 3CZ6A 2Z99A 1B59A 1LKXA 1FX7A 3TP3A 3T8RA 5ICFA 2VBWA 4DBRA 3C2GA 1Z67A 2X6XA 1VI0A 1QA6A 2EZKA 3DU5A 4UHTA 3WHBA 2HKOA 3BZ6A 3QAHA 3MKLA 3VODA 2CU7A 3J81K 4XOPA 4IXAA 3CC7I 1VQPI 4X1EA 1QRYA 4L5JA 3CC4I 3HOWJ 3W2AA 2Z5UA 4BE2A 2HVSA 1FBUA 5A2QK 2BW3A 2W25A 1ZAOA 2HU9A 2QSHX 1EA3A 3TQNA 2LK2A 5HLIA 2E60A 4XRMA 3P5JA 1QHHD 1S8NA 1WCMJ 3HG9A 2DCEA 2L0KA 2ZJPF 2HDCA 3A0BC 4IHWA 4XRSA 2DLLA 3OYAA 1UB9A 2IAIA 4LK1F 2DFEA 2IGMA 2KQRA 2XAHA 4P55A 4RM2A 1FYMA 2EPFA 1X19A 3LSRA 1X1AA 3FDYA 3KP4A 4LG0B 4B8XA 4DNCA 5D5WB 4G6QA 3HRTA 3H3VK 1XCVA 3CQZJ 4HDUA 3NARA 1VTNC 1MMNA 1ERDA 1K6YA 3E6CC 4KT6A 2FUG2 1TW3A 4ZDLA 3VYSB 2FQ4A 5F27A 2HPMA 5J40A 5BPDA 4U0WA 4EM1A 1T2KA 3OMYA 2VE9A 3HEFA 2X6YA 3WGGA 1G3TA 4A3FJ 4OU0A 2WAQA 3EUKL 4A3CJ 3FHNA 2JRMA 3JRDA 2DT7B 4CHUA 2LKPA 3BR6A 5DCFA 3K1MA 4RGXA 5FLXZ 3AL0C 2FNAA 4XKCA 2F2EA 5FGMA 1I3QJ 1GHCA 3QU6A 1MNMC 3GTLJ 2EK5A 2G7HA 4XOTA 4WCGA 2L02A 3ZQ7A 4ENKA 1X2NA 5DEQA 2MG4A 4CH7A 3SEZA 1B8IA 3J7AY 3CCSI 5HVQC 1SEUA 4YFNF 3A4CA 1FP1D 3SQNA 4D1QA 3L2VA 1HSJA 2BXYA 3KZYA 4ENJA 4O5VA 3HIFA 4XLPF 1LUJB 3FWEA 4I2OA 2P6SA 4D7MA 3DF8A 1MZBA 4IVNA 4PJJA 2HS5A 3CUOA 1MKMA 1ODDA 2E1NA 3J7AO 2AXTC 2RQPA 2ISYA 4O3MA 5BQTA 5L3EA 4RB2C 2CGPA 2K4BA 3FXKA 1IXRC 2A69F 4BH9A 2HWVA 3FXMA 2AXLA 1FBSA 2CUJA 2FBIA 1PUFB 2G7UA 1S9HA 4B47A 3FHZA 3OYKA 3AKZA 1BIBA 3JSOA 2X1EA 4Q4ZF 1T6SA 4MHGA 1PP7U 4E70A 4XM3A 1YJ9I 4DYCA 1W5CC 2HR3A 2LY2A 1YJWI 4HQEA 4ZYDA 1D3YA 3S93A 4B4CA 3Q3SA 2F5VA 3VFZA 4S0HB 1R00A 3PNYA 4LLGF 2XV4S 2N8GA 2CW7A 3K4BA 4AD9A 4RGSA 4XLHA 1WI9A 2HOTA 3JR9A 5D5UB 2OD5A 3DTEA 3BLYA 3JTHA 1FTTA 3I0TA 5EEAA 2VQHA 4V19K 3TMOA 3OS2A 4HLYA 1KU9A 4A69C 4ZYGA 3KX2A 3OYCA 1MH3A 3MKZA 2KLOA 2O6GE 2CYYA 4I98B 2X1DA 5GP9A 4D5CA 1F4KA 3KP6A 3OY9A 4I0BA 1JT0A 2V9KA 2P8TA 4KNYA 2WTEA 1Z1DA 2VKHA 3GFIA 1U78A 3W6JB 3OYIA 4S04A 4A0XA 1M1EB 3FF5A 5CVIA 1K4SA 3HXLA 4KMFA 1HQCA 4YELA 3PQKA 1DDNA 4BJ6C 4J00A 2VBXA 5D6EA 4PFOA 2QF7A 4BQQA 4EQQA 1UMQA 2WAQN 3P7NA 2AO9A 4CCNA 1SFXA 1VQNI 2VODA 3V42A 4G7ZF 1ETYA 2F5CA 3ML6A 3FK6A 3DP7A 4G9YA 4EVIA 3ABTA 2ZB9A 1BBYA 5ILSA 4CZCA 2R0QC 2K9MA 2OTLI 1W4MA 1MIJA 3ABKH 4PUSA 1AA7A 4YIFA 4WWCA 4UNOA 4ESBA 1J5YA 1NH3A 1U5TA 5M3MJ 1X4OA 5DS9A 2Z1DA 4ZJZA 5J3LA 3I56I 3HC7A 4BKXA 1E3PA 1GV2A 2VT2A 1R22A 2JRTA 4HG2A 3BJAA 2O03A 3WTXC 5CJ9A 2L5QA 3C3WA 4E7KA 1XGMA 3PUFA 4ANJA 3FMQA 2HGCA 3H1CA 5HS7A 1OISA 4G6DA 2BV6A 3VYTB 3JRCA 3WU2C 1OMIA 2K9NA 3B6AA 3AL0B 3L2CA 2KDOA 3OYFA 4MQVA 3ZP5A 3N97A 1VFCA 3F6VA 2XDVA 4Q47A 4AC0A 3RZDJ 4JOMA 2KIUA 2WBMA 4ASNA 3HHGA 2DK5A 2X51A 1YTYA 5EEHA 3VSKA 2HVRA 3VYUB 2FMYA 2CUFA 2NVYJ 4KIFA 4LK0F 1OCRH 3LSMA 4XONA 3ZPLA 3M1CA 2DI3A 3BTJA 4YFKF 1BI0A 1W7PA 2Y69H 2M34A 4A3DJ 5K5RA 1WJDA 5JLWA 4GCVA 4QLCU 3KLOA 2CO5A 4CICA 4HRIA 3RQIA 1A6QA 1GUUA 1N75A 1MBGA 5EYRA 2LFBA 1YS6A 1WGXA 3S1RJ 2W00A 4M3FA 2W48A 3F9KA 3G2BA 3OR2C 3R0AA 2X6OA 1MSFC 2BY2A 4Q5SF 2GA2A 1OCOH 2EJRA 2DA7A 1MNEA 1P9QC 3BWGA 4UVAA 5CVJA 4L18B 1Z7UA 2OTJI 2HTJA 2VXZA 3GUDA 5ERIA 3GZNB 4HNTA 4NC7A 1HDPA 1U0JA 2I10A 2JVGA 4P5OA 2Y2ZA 1NG6A 4D0PA 2HI3A 2DPDA 3E5UA 3HSFA 4HLXA 1R36A 3PM1A 4P9UA 2ZNZA 2FRHA 3DKYA 1J7KA 2M1BA 2IGKA 2M7AA 1FYLA 2JK3A 2H6BA 3AG4H 2OCEA 1VNDA 5CQGA 4LB6B 4AM3A 1HSTA 1KONA 2ZSIB 3NWTA 2WA0A 4IEJA 2EINH 2K9QA 2D45A 3DEEA 1H89C 3E5QA 3MZ8A 1XS9A 3TKYA 3BROA 2V6CA 1I1SA 1VQ7I 1B1BA 4IOCF 4II2A 3S1MJ 1MGTA 4R8HA 1SMYF 1EH8A 1IF1A 4OMYA 2ZKZA 2PMUA 5BNGA 1W5SA 4JYKA 5AIQA 1MBJA 2DA6A 4HOBA 3WTVC 2HOAA 4HEA2 2MLKA 4E7LA 1JGSA 2NVQJ 2IA2A 2V1UA 4LLLA 1BR1A 2AQEA 2FBKA 3EUAA 3KYCB 4LIVA 4M73A 4B1RA 1ZYRF 4IPAA 2DOAA 2NOJB 3LWFA 1A36A 1MMGA 3H5AA 2JZYA 2VJJA 2E19A 2MA3A 1V5GA 1YJNI 4LD5A 1RKWA 1LEBA 2HYGD 1S29A 2KZGA 3WG9A 1KQ8A 4FE7A 1POGA 4NBQA 1YW7A 4B3XA 1RC9A 1D0ZA 2RV8A 2P4WA 3Q9VA 4P1WA 1AWCA 1YG2A 3D0SA 5IOZA 5EJCA 3T8TA 2QVOA 2HOEA 1BA5A 4UUVA 1UG2A 1AHDP 2QYOA 1OFCX 2K85A 3FXQA 1WWXA 2LDUA 3KEOA 5DM6F 2FNPA 1FLIA 3RIRA 2VBZA 2HTSA 1D0YA 2IS1A 3CCMI 1UELB 1O3RA 5JLXA 2E34A 3TOAA 4BHPA 1XGOA 1JUMA 3WTWC 4I6ZA 2A07F 5B5EC 1OCTC 4HBLA 3ZN1A 5ICEA 1S72I 4XSZF 1D5VA 1F43A 1KZHA 4WXHA 2M9HA 1SVLA 4CCJA 4XKVA 2OQGA 3HDDA 2WAFA 2ETHA 3KP5A 1WRJA 2NRAC 3V7RA 3WHCA 4JK1X 1ZH5A 5JHFA 3COAC 1AOYA 1NG7A 1QZEA 2XRNA 3IL2A 2P7CB 3O8HA 2M30A 4HF1A 2F5DA 3JRBA 1TT5B 1Z91A 1ZK8A 3I5UA 2V1DA 3L2QA 1LDDA 4XSXF 2XGCA 3ZGKA 5C3EJ 2HVQA 3ZMUA 3S3NA 2E1CA 2LTPA 2PEXA 1G2HA 3RKQA 5CVUA 4XLFA 1SFOJ 5F1JA 4QTRA 1YW8A 3K4CA 3GBGA 2ZFUA 1D1CA 2Y75A 1TWCJ 2X0LA 5C4JJ 1VQ4I 3H9GA 4DYRA 5E8IA 2Y0MA 3VWBA 4KDPA 2R7UA 4PZJA 2O5RA 1D5YA 3CP8A 3X2QH 1IO2A 1XMKA 2EZIA 1BJAA 3K1NA 2CMPA 2MH2A 3HHHA 1O3TA 1WJFA 4IF4A 3BQZA 3JSPA 2VOOA 4FE4A 2HDDA 2K4JA 4A3BJ 5FO5A 4BYYA 2P6TA 1JUSA 2BY3A 3CCQI 1IXSB 3OYEA 2J5OA 3JAMK 1XSVA 4KN4X 4QIWN 1ZG3A 4F91B 2I5UA 3FKJA 3SZTA 2VJIA 1NK3P 3CJNA 4BHBA 3BJ6A 4KMUX 3B6CA 1WJBA 5HLGA 5E3OA 3R4KA 1I39A 3FXOA 5GAHJ 4BQAA 4Y7NJ 4CCKA 2EFWA 3FXRA 2KZVA 5H2FC 1XSXA 1OR7C 5L3BA 1NTCA 1JUPA 1TT0A 2B0LA 3MAJA 4HYEA 1WJ5A 4YFXF 2LNBA 1Y8QB 4L9VA 2CW0F 1OQYA 2MD5A 2UZKA 3WTZA 4N0BA 1J59A 4ETSA 4BUPA 3HM5A 3F8BA 1T33A 4LMYA 3ZXSA 2TCTA 4LG3A 4N9HA 3ABLH 4C3JJ 5CVRA 4U88A 3F8FA 4BQOA 3DPLC 3MQ0A 2Y9YA 2Q2EB 3ERMA 2L3DA 2AQFA 1ZKGA 3K4JA 3M9AA 4O6JA 1VQ6I 1XGSA 4ZDOA 2A3SA 2XHKA 1FOYA 2F6CA 2BEOA 1K6OA 4M9XA 2R3SA 3HRUA 1JKOC 3MKWB 2ELJA 1MMAA 1ZRCA 2E1MC 2GXAA 1JJ8C 3Q5FA 2R7ZJ 5AIPA 3I3LA 2HKXA 4D7NA 2R7TA 3R61A 2EILH 2CFXA 4ESFA 3SZPA 4RLQA 3OYMA 1LQ1A 2CQKA 3E1SA 3OSGA 2VQCA 2OBPA 1X1DA 2ZXJA 4HX8A 2VB6A 3TL4X 2O9LA 3CCVI 5FFZA 3M8FA 4FT8A 1X3ZB 2UWMA 4Y17A 3GWZA 1B72A 2EV6A 2C6YA 4M3GA 1JTXA 3WG7H 4ENNA 1B6AA 4BACA 2QBYA 4GGGA 4NQWA 3G6EI 2H27A 3ECOA 2Z16A 2WAEA 1BR4A 3PSFA 2K5CA 4F52A 3ZQQA 1J0RA 5M5WJ 1QNTA 2E1OA 3O6BB 3IH3A 3KP2A 2ZO4A 3L1PA 1RZ4A 4IO9F 1T0FC 4XN3A 2QZ8A 4KUMA 3BZKA 3ISPA 1X58A 1ON2A 2VE8A 4GXOA 2DODA 3MWMA 3MD2A 4RGUA 2IA1A 4HV6A 3TO9A 2XAFA 2W1OA 4HX4A 1OLTA 3ZN0A 2CV2A 4FHTA 1UFMA 2M87A 1F9NA 2RNJA 3PL8A 1P6RA 2L54A 4AVPA 1S5LC 2BVLA 3JRIA 2WWYA 3ZQGA 4A3EJ 2DFFA 4HF2A 3BT9A 2YX7A 4L5IA 3GCMA 2R4GA 4BJ5C 4PJLA 1DPRA 3HOZJ 2Q1ZB 1XN7A 3IKTA 5D8KB 4Y33A 3CCJI 5LEJA 3OR1C 2VL8A 1IN8A 2ESNA 1JXSA 3IWZA 3HB9A 4D9JA 3OS0A 2R93J 2GOXB 1DPUA 3FM5A 3I59A 1QZYA 2EV0A 2Y30A 4A3GJ 1P2FA 2ISZA 2K9LA 3BJOA 3OYGA 2WY7Q 3DLAA 3JCUC 3PO2J 3OV8A 5FKLA 4BHCA 1K61A 1C0WA 1IDYA 3CDLA 3DKXA 3K9TA 1BI2A 2XUBA 2VKVA 1T8IA 2FQ3A 4M3BA 2J5PA 2EFQA 3OOUA 5GAEJ 1WH7A 2CFOA 3OYHA 2M8EA 4JQFA 2ZJRF 1K78B 3S32A 2HOSA 3ABMH 5FD5A 3H5NA 3OIQA 3FXLA 5FJ8J 3W2WA 4NC8A 5E3MA 5GPAA 3BG3A 3WTTC 2K86A 1U8BA 3OIPA 4I01A 2VJ4A 3J80Z 4G6TB 3S3MA 1HOMA 3LSJA 3B73A 2W4SA 1W0TA 1IRZA 1I6HJ 4BDZA 2DU9A 2RAEA 2DA2A 2DJIA 4F55A 1G6NA 3Q0UA 5FKMA 4RMNA 2D1VA 1H9GA 2DT6A 2GQQA 3G73A 1YYVA 4BGDA 3IAM2 1U2WA 3HSRA 4U87A 1LE8B 2NYXA 4BE1A 3EYYA 2WB1A 3OWTA 1LFPA 4PJ0C 5E3NA 2QKLB 3VSLA 5F04A 2MABA 4KIGA 3N05A 1Q1HA 1S6LA 2EH3A 2KIFA 1VQLI 3CCEI 2BVMA 4PJNA 3BTCA 4CCLA 1X4PA 1MNDA 1KYWA 5BMZA 3BOQA 4XLAA 4LLNA 2DW4A 4P96A 5FFXA 2DFIA 3E5XA 5FLXK 5FRNA 3O3KA 1J2XA 1WHUA 2E1MB 1Z6TA 1F36A 2BY0A 4FX0A 5L3GA 3GFJA 4W97A 3JTGA 1RUOA 4LG0A 2E7XA 2OU2A 3QPTA 1N78A 4QWQA 4L0ZB 1K78A 4Z6YA 4CYCB 2VQLA 5IT9Z 3F6OA 2ZNYA 4QSHA 1YS7A 1HDDC 5IP6A 2BYVE 5K7FA 1XX5A 4EJTA 1IXCA 2UXXA 2RGVA 3S1NJ 1T39A 1PJRA 2F5FA 1ETVA 2VKEA 3OYLA 1RR7A 1F5TA 1DU6A 3KEYA 1HXDA 3D5RC 5EGOB 1Y0NA 1VQ9I 2F4IA 2GOMA 1UCRA 4LIUA 5CKTA 1OR7A 1BIAA 2DPUA 2WV1A 3OL3A 5HODA 5JVGF 3DEWA 4U0YA 3RSNA 3SEQA 2RREA 4GFBA 1R49A 3LSHA 3GFLA 3IV5A 4X0GA 1YOVB 3BG6A 4B48A 5LLQA 5LGTA 2YR2A 4JP0A 3WU1B 1QVUA 4FCYA 3EYIA 1T08B 3ONQA 1V5FA 1XD7A 3ZMDA 5IY5H 1RIOH 1ZELA 4HV5A 2A05A 1D0XA 3JW4A 2L2OA 1FOWA 1Y8RB 2OZUA 2RQQA 2XB0X 2VPLA 1P7IA 2YPRA 5D4RA 4RBOA 1MMDA 2DYSH 1OYYA 2M5WA 4XL9A 3F21A 3M8JA 3LA7A 1MDMB 4NHJA 2QA4I 2VONA 2DOFA 5DTDA 1K7AA 4HAMA 4RS8A 5E20A 2CQNA 1LVKA 2P5LC 3H36A 2ZC2A 3FXJA 4PGHA 2RVCA 1Y0UA 2PFBA 1U6GA 2XKPA 1XMXA 3KLNA 4IRIA 1MD0A 1S7EA 1Q1VA 1R5ID 4XICA 3LSTA 3ULQB 4EJOA 3Q0WA 4CYCA 1HKTA 1OJLA 2LG4A 2R7VA 3A1YA 2L7FP 3ELKA 5DUIA 1R4MB 4A2UA 3FMRA 1TWHJ 4Z2YA 4V2GA 5EG0B 4KJZA 3CJQB 1PUFA 2NNNA 1MSEC 4UV8A 1DP7P 3OYJA 3T0YA 1RESA 3GZ5A 1NHAA 2BOLA 5LFAA 2X9DA 2M0CA 2WB1N 1S7OA 4XRFA 2B7EA 3H3ZA 1ZGAA 2NXNB 3NAUA 2GM4A 3C2HA 2HPIA 1FMWA 2MC3A 4V2FA 5DD8A 3EDPA 5L3DA 4KISA 3RPUD 2CUZA 2LYCA 5DV5A 4JBAA 5E18F 2MW8A 3PO3J 3F8CA 3TOBA 4EM0B 1QVTA 4IHYA 1R1UA 3J7ZI 1MMSA 1S3JA 2HYJA 1JHHA 1P92A 2ADUA 3G4SI 2KJCA 1KU3A 4DZPA 4YRVA 2EZHA 5L3CA 4M74A 3UNGC 5J8CA 3S2DJ 1JKPC 3HZJA 3GW2A 1P4XA 1R71A 3ZQHA 3EQLF 2EFOA 3CTAA 5H6QA 2ICWG 1XC5A 2B63J 3A02A 2HZDA 1F1ZA 3CF5F 4B43A 2DA3A 1FSEA 4MNUA 2KDZA 1FIPA 5JR3A 1O7LA 4IRGA 1IUYA 2KFDA 4LJZF 4Y15A 1JHFA 2PN6A 2XAUA 1YRNB 2TRTA 2ZJQF 1P4WA 2OAZA 2ZBKA 1MW7A 5BS6A 2LD5A 2XSDC 3M3YJ 2OQRA 2JA2A 1WSUA 5HS9A 1U9NA 3PNVA 3S2WA 3ECHA 1PUEE 5J1RA 4E7HA 2DK8A 2IGOA 4IRHA 1Z05A 3SFZA 4BJTA 2XASA 2XGXA 1R6RA 1R1TA 2VXDA 1O7FA 2HDWA 3PJRA 2DO7A 2FXAA 3I9V2 3LA3A 3RCOA 2DYRH 2QM3A 3HSEA 3IAS2 3SDBA 1TNTA 4F93B 1ZRDA 5JVTA 2LLKA 3EPZA 3C1DA 3CMEI 4RGRA 1U3EM 2OZ6A 4EJUA 1DU0A 2R7FA 3FK7A 3W3CA 3RQ4A 3OYBA 3VB2A 4D5FA 5K5QA 5KK1A 5H20A 3HOSA 1WQ2A 1RPWA 1VZ0A 3L2WA 2DMUA 2ZCWA 1MJBA 1YX3A 2M4GA 2LKXA 1UAAA 3GYHX 1AKHB 4RAYA 1LPQA 1TBXA 3E6MA 2M45A 1YO5C 2GA1A 1RR8C 3CO7C 1JT6A 1UHMA 2NS8A 4FTHA 3V7CA 1SFUA 2D2WA 1REPC 3H9JA 1ON1A 3BG7A 2L9NA 5DD4A 3MZHA 5IOYA 2KIQA 1FBQA 3I4PA 4LITA 3PFYA 3TP0A 3I54A 2CH0A 2HQAA 2XAJA 1JKRC 3GTOJ 1OCPA 2ZFWA 3S14J 3L09A 2PQ8A 1HW2A 4UY8I 4U7DA 2L4AA 4OIOF 1ZR4A 3DTIA 2F4MB 4XN0A 2O3FA 2V79A 4BQNA 3H0DA 2IJLA 4G94A 2ZMEB 3DBLB 2XF7A 3L7WA 2ELHA 1ZG5A 1X2MA 1ZLJA 3G3ZA 3HGYA 3LFUA 1JTYA 1Z0XA 1QQIA 1Z9CA 1SD7A 1UHSA 3LA2A 3GXOA 1O57A 3U9GA 2HQNA 4B09A 4E7ZA 4E7IA 3RJPA 2D1HA 5M5XJ 2R5ZB 2H8RA 2DOEA 2H1LA 4FX4A 3OYDA 2PJRB 5K7ZA 4RAGA 4EGYA 2M7BA 3P9IA 3E7LA 3CF2A 4AIKA 1FP2A 3LQQA 3ZR8X 5H6RA 3DQVC 2PMZA 3I64A 1IRFA 2XB5A 4RAFA 2WADA 1FJLA 5TGTA 4H4KC 5KAIC 5LHGA 2RC4A 1FNNA 1EJ9A 3WODF 3IH4A 4U7BA 1ZTRA 4C9YA 3I55I 1QPMA 3ZCOA 3WGIA 3WE2A 5TJJA 1RNLA 2JA7J 3QU3A 4XLCA 5FLMJ 1Y6IA 4IZZA 1MBEA 3I4NJ 2JSPA 4CXFA 2JMWA 3K4NA 3S16J 3E6BA 3E97A 3L9FA 3IC7A 1BL0A 4L9JA 4EV0A 5HNFA 1X1CA 3HPHA 3HOXJ 4JX4A 2JPBA 3J7YJ 1FWZA 1HCRA 4G8XA 3MZYA 1WVRA 2ESHA 1K83J 2EBIA 3CC2I 1GXQA 3NQOA 2VIXA 3D5LA 2LR8A 1E17A 1MJ9A 2R5ZA 3K7AJ 1E2XA 5DUKA 3HOVJ 2ZXIA 1A6IA 1XDUA 2KKOA 3DWLE 4BAYA 1LJ9A 4H0EA 1ITYA 2VASA 3IWFA 4DBQA 1EV7A 4AUXA 1RKTA 2Y0SA 1IN7A 3CMMA 5AONA 4C30A 2XSJC 3ASOH 1BOAA 4P9FA 3WGHA 5B1AH 1BM9A 3BTIA 3V4GA 1H0MA 4X6AJ 4WXCA 2MSYA 5GTIC 4PSWA 1FC3A 3NRVA 2M8GX 4HA8A 1J09A 3DBRB 4N9IA 2LY9A 3VPRA 2UXNA 4BBRJ 3QPLA 2K7LA 1G3YA 4KFCA 4HX7A 3VYRB 2AS5F 4NUBA 1IZ1A 4GO1A 3SJMA 5IYDJ 2LVSA 3KZIC 2L4MA 1I50J 2L7KA 3CJTB 3FXUA 2LP0A 4DYQA 2AHQA 3I71A 2IXSA 2OPTA 2XGEA 3JRAA 5K7HA 1SFKA 1TQIA 2RNGA 3BR0A 4KA4A 1P4AA 3QPSA 3RZOJ 3BZCA 3CO6C 3G1OA 4ZH4F 2KJBA 5GTHC 2OF7A 4A0ZA 1VQOI 3K70C 2FBHA 2MC4A 3HYIA 4LB5A 4XNFA 5TRDA 3QPHA 5EEGA 1A35A 4K2EA 5IYCJ 4XKBA 3CLOA 3KFWX 4GDFA 3LSGA 3KE2A 2NVTJ 3TDUC 2OCCH 1IC8A 1HLVA 4GYIA 1XDSA 1J9IA 2EA4A 2KP6A 1GLNA 1XCBA 1T98A 3QWLA 1IRXA 2ACJA 2ME0A 4J01A 2PMZN 3DKWA 1UG0A 4A6DA 1CF7B 1U9OA 1YIOA 4OAZA 1JE8A 3GMEA 5DM7F 4WXDA 5IP7J 5LBQA 4ITVA 2GAUA 1I3AA 3DTKA 4CCOA 3A03A 1KA8A 5JI6A 5BPIA 3FX3A 4CSWA 2JSCA 3ZQIA 4E4HA 4MTDA 1ETWA 3CDHA 3WTSC 2A68F 3M4OJ 3IRQA 1HW5A 5L3FA 2BE5F 1R23A 3A01B 1GXPA 4UUTA 5CPRB 1E3HA 4YIRX 1YIJI 2GBYA 1PYVA 1OCCH 5CYVA 2CQQA 3JRGA 2ZJ2A 1ZARA 2VC1A 1SD6A 5B3SH 5KCMA 1T38A 2E5ZA 3CUQB 4EMSA 3F22A 1BW6A 3CCUI 2LBFB 3GTQJ 2E5NA 1USTA 2NAZA 2E71A 5K1YA 1FTZA 4IHTA 2HFHA 2A61A 2KIMA 1Z7LA 1BN5A 1JGGA 2XPVA 2E2JJ 1HBXG 1TTYA 2DT5A 2M3AA 2EIJH 1WJEA 1D1BA 1TWFJ 3CD6I 1IV6A 1EF4A 4II3A 4A12A 3OL4A 5B66C 3SHFA 2G9WA 2GIZA 2IP2A 5ICCA 1TNSA 2Y0SN 2A6EF 2HQ5A 3S2HJ 1SD5A 4RA2A 3F8MA 1RUNA 1X1BA 1YLFA 2KRHA 1ZREA 3IP4B 5F0CA 3NEUA 2MFZA 2NNYA 5KVRA 1CGPA 2XAGA 1VQ5I 2K3FA 3KEQA 1DUXC 2XKOA 3GLLA 5HDGA 3IRRA 2O8KA 1A5JA 2IBDA 5LGUA 1BJZA 1B4AA 2LC2A 5DCMB 3S8PA 3WTUC 4RB3C 3LSIA 1I6XA 2R7RA 1DQUA 3GTKJ 2IT0A 2CUEA 1MBHA 2PG4A 1FSHA 3DBHB 2E7WA 2MH9A 1X3WB 2XF6A 2O7OA 2Q2EA 3F8NA 4A3JJ 1LEAA 1H8AC 2LMDA 5TISC 3G71I 4UUSB 3FKIJ 3PIPF 4PFPA 3HOYJ 3GFMA 1U5TC 2H1KA 2DAOA 3RKXA 3CESA 3ZMVA 4CZZA 5F1RA 4LOCA 2LSOA 5K5OA 3S1QJ 4L5EA 1BI3A 1D8JA 2PX9A 1YW9A 3PSIA 1Z3YA 3KCCA 4B3AA 4ESJA 3L2UA 1ETXA 3F3XA 4XR6A 2VKDA 1IN5A 2R7OA 3PNTA 1EH7A 1W5TA 2LH9A 1R58A 3OIOA 3QYFA 3LNQA 1V5EA 3M1EA 4HPQA 3K2ZA 4M3DA 2I8DA 2BHYA 5FKKA 2JA6J 1IN4A 2JA5J 3TO7A 2UUZA 4M9ZA 1QZZA 1R9TJ 5IP9J 1OCZH 4XKWA 3BG5A 4I02A 1B8IB 3KETA 1BOBA 2E2IJ 4RDUA 4CO8A 3HOUJ 2H6CA 4MO7A 3GO5A 5LRRA 3VOEA 2L7ZA 1IV8A 3LOCA 5ED4A 3W6VA 1TQPA 2CQ7A 2E36A 1KQ9A 4IHSA 4ZC3A 3PIOF 2MGQA 1YX5A 5DCMA 3VDXA 4YEJA 4PSXA 1W1WE 4NB5A 4M6VA 4M6YA 3H35A 2MLGA 2L9RA 3BG9A 3DXJF 2JUCA 4KICA 2VQGA 5D6FA 3F23A 2CWEA 4Y4RA 1XGNA 1SMTA 3C18A 4UUSA 2VOPA 2YU9J 2BZTA 1Y1VJ 4MFEA 5HDKA 2HEOA 2IA0A 2MYSA 2L7MP 4CUGA 3MFKA 3KP7A 4A3MJ 4OIPF 2WC2A 3HKZA 2VUMJ 1DGWY 3A0HC 2P81A 1Z77A 3J80K 2QWWA 4F7ZA 2QEXI 4I76A 3TO6A 4PCQA 1L3LA 4KIBA 1MJAA 2K27A 3BCAA 1SFEA 2GWRA 2QLZA 2XRLA 2YX4A 4U0VA 3DCFA 4S05A 1LFUP 2IRFG 2VC0A 3R60A 1HA8A 2BBYA 2K3PA 2WY8Q 2YSRA 1H9TA 2K40A 3BTLA 4F3QA 1TQMA 2TDXA 2R7SA 2QQ9A 4FQGA 1FT9A 2ID3A 3RTRA 3SZGA 1Z3XA 3U1DA 1FYKA 1OYIA 3IKVA 5J8FA 2HNHA 3H9QA 1ZLKA 3LFKA 1MBFA 1BI1A 3BPXA 3WTYC 4MEXF 3L2RA 4BXXJ 3H5RA 2XPWA 4UVCA 3M07A 1FEXA 4HDVA 1QO0D 1EH6A 3AG3H 2Z9OA 3K4KA 4AIHA 4E7JA 4WF2A 2DTZA 2QQBA 3MEXA 3E3VA 1HKQA 2R92J 2RDPA 3GTGJ 3K70D 4RB0A 3G1LA 2PJPA 2L9VA 2XROA 3G1MA 4L9TA 3RI4A 3QOPA 2A5WA 2CS3A 3ZQLA 2ME6A 1SVMA 4MGRA 5F6FA
chains in the Genus database with same CATH topology
3OSFA 3JRBA 2X48A 1ZK8A 1IDZA 5M5YJ 3A01A 3TW6A 2GLOA 2DN0A 2XGCA 1XG1A 5GPCA 5C3EJ 1MH4A 1LE8A 2E2HJ 3JRFA 2LLKA 1ZGWA 2LTPA 2XGDA 3BR1A 1G2HA 1DU0A 3FK7A 3RKQA 3FISA 3S15J 1SFOJ 3ZQFA 2NVXJ 5F1JA 3HGGA 4QTRA 2JN6A 4D5FA 1IGNA 2NS7A 5M3FJ 3GBGA 1TWCJ 2VI6A 5C4JJ 4IHVA 2NOGA 1RPWA 4DYRA 3TP3A 2DMUA 1GDTA 2LKXA 1D5YA 1VI0A 2KT0A 2EZKA 1AKHB 3WHBA 2D5VA 2EZIA 3MKLA 2CU7A 1JT6A 2YUSA 2NS8A 4FTHA 4X1EA 1QRYA 5IPAA 3HOWJ 3BQZA 4FE4A 2HDDA 4A3BJ 5IOYA 3TP0A 1JUSA 2CRGA 4IHXA 1JKRC 3GTOJ 1OCPA 3S14J 2LK2A 4XRMA 1O4XA 1WCMJ 4QIWN 2L0KA 5FKOA 4IHWA 4XRSA 1NK3P 5EGOA 2ID6A 1ZR4A 1E3OC 2IAIA 3HKZN 2JA8J 3B6CA 1GVDA 5E3OA 3LSRA 3BR5A 1X2MA 3HGYA 4Y7NJ 2HXOA 3H3VK 4C3IJ 1JTYA 1Z0XA 3MN2A 5C4XJ 3CQZJ 3NARA 1UHSA 1NTCA 1JUPA 3IH2A 4C3HJ 5M5XJ 2R5ZB 3QQAA 2H8RA 2FQ4A 5F27A 3HM5A 1ETKA 1T33A 2TCTA 5K7ZA 3HEFA 4C3JJ 3H0GJ 3E7LA 2IEKA 2DA1A 4A3FJ 4A3CJ 2Y9YA 2CJJA 1TC3C 3JRDA 1NK2P 2QCOA 3BR6A 1ZKGA 1CQTA 2XB5A 1FJLA 1I3QJ 1MNMC 3GTLJ 5F0FA 1X2NA 1JKOC 2MG4A 1JJ8C 3IH4A 1B8IA 2R7ZJ 1ZTRA 5IYBJ 4D7NA 4M3EA 5EG0A 3OSGA 2JA7J 2O9LA 1WI3A 5FLMJ 1MBEA 3JRHA 3I4NJ 4D7MA 2FJ1A 2JMWA 2Y31A 1B72A 3S16J 4M3GA 1JTXA 1VF9A 1P7JA 1SANA 1BL0A 1IJWC 3HOXJ 4JX4A 4XIDA 1HCRA 5FLVA 4A93J 2CQXA 4ABZA 1K83J 2EBIA 5M5WJ 2LR8A 2E1OA 3TW7A 3IH3A 1PUFB 4HNVA 2JWTA 3L1PA 1WH5A 2R5ZA 3K7AJ 3HOVJ 3UKGA 1A6IA 1X58A 4DYCA 3GTMJ 4C2MJ 2Y9ZA 1ITYA 4AUXA 1RKTA 5J1YA 3JREA 4NDLA 1W0UA 4B4CA 3Q3SA 3BTIA 4S0HB 3S17J 4X6AJ 2MSYA 2N8GA 3JRIA 3ZQGA 4A3KJ 5EF6A 4A3EJ 2M8GX 3BT9A 2HOTA 2LY9A 1LFBA 3VPRA 4BBRJ 4J19A 3JR9A 3QPLA 2ELKA 1FTTA 5EEAA 3HOZJ 3SJMA 5IYDJ 2FD5A 2LVSA 4XK4A 4A69C 1I50J 2DMQA 3HB9A 1MH3A 3LSPA 2LP0A 2R93J 4DYQA 2AHQA 3JRAA 1YRNA 2OPTA 2XGEA 5K7HA 3BR0A 2R5YB 2Y30A 3QPSA 4A3GJ 4EEFG 3RZOJ 3G1OA 5GP9A 4D5CA 4A3LJ 1ETQA 2OF7A 3PO2J 1JT0A 5FKLA 1ETOA 3D1NI 1K61A 1IDYA 3CDLA 1U78A 1HF0A 5E3LA 2VKVA 3ZOBA 4M3BA 5IYCJ 3GTJJ 3OOUA 1WH7A 3LSGA 1ENHA 2NVTJ 2QF7A 1WPKA 1IC8A 1HLVA 2HOSA 1UMQA 2WAQN 3F0CA 2DJNA 2AO9A 5FJ8J 5F0HA 2ME0A 2PMZN 1ETYA 5E3MA 1U9OA 3FK6A 5GPAA 3BG3A 1U8BA 2ZB9A 2ECCA 5IP7J 2R0QC 1HOMA 3LSJA 1W0TA 1IRZA 1I6HJ 3A03A 2RAEA 2DA2A 2VPRA 3Q0UA 5M3MJ 5FKMA 1ORKA 3ZQIA 5DS9A 5EDNA 1AKHA 1ETWA 5J3LA 3M4OJ 4BKXA 3A01B 1GV2A 4UUTA 1TWAJ 1LE8B 3HBLA 2GBYA 5E3NA 2CQQA 3JRGA 5F04A 1Y1WJ 2EH3A 1MBKA 3BTCA 2R5YA 3JRCA 1BW6A 3GTQJ 2K9NA 3B6AA 4DZJA 1FTZA 2EQRA 4XRSG 1VFCA 4AYBN 1JGGA 2XPVA 2E2JJ 3I4MJ 4AC0A 3RZDJ 1F36A 4MFDA 1TWFJ 1EF4A 4W97A 1IV6A 3BR2A 2NVYJ 2CUFA 2Y0SN 5C44J 2HQ5A 4CYCB 3S2HJ 2G0EA 1BW5A 4QSHA 1HDDC 5IP6A 3BTJA 5K7FA 3CCYA 3S1NJ 2DA5A 2M34A 5F0CA 4A3DJ 5JLWA 5F08A 1ETVA 2VKEA 1RR7A 3RQIA 1DU6A 3SFIA 1A5JA 1GUUA 2FX0A 1JKQC 2O8KA 2IBDA 5EGOB 2DMNA 1BJZA 1MBGA 5EYRA 2LFBA 1WGXA 3S1RJ 4M3FA 4W1UA 4JX5A 1ZR2A 4BY1J 3GTKJ 2CUEA 1MBHA 2W48A 2WV1A 5HODA 3DEWA 2O7OA 4A3JJ 1H8AC 2X6OA 1MSFC 4GFBA 4UUSB 3IV5A 3FKIJ 3HOYJ 2DA7A 4JP0A 2H1KA 4FCYA 1QVUA 3S1QJ 4LOCA 4L5EA 1HDPA 5J1UA 2I10A 4B3AA 1ETXA 2Y2ZA 2XB0X 3K2AA 1P7IA 2HI3A 4RBOA 3PM1A 2DMPA 3OIOA 5DTDA 2JK3A 3LNQA 2XPUA 4M3DA 1VNDA 5FKKA 3TEDA 2JA6J 4IEJA 2JA5J 2K9QA 1H88C 2JJ7A 1H89C 1IG7A 1R9TJ 1XS9A 5EZHA 1S7EA 5IP9J 1Q1VA 4XICA 4CYCA 3Q0WA 3BG5A 1B8IB 1OJLA 2DMTA 2L7FP 4MIMA 4RDUA 2E2IJ 3S1MJ 3HOUJ 1TWHJ 4MO7A 4V2GA 5EG0B 4A3IJ 1PUFA 1MSEC 3W6VA 2L7ZA 3LOCA 3GTPJ 1RESA 3BQYA 1QPIA 5BNGA 4JYKA 2MGQA 2X9DA 1MBJA 2M0CA 2DA6A 1B72B 2HOAA 2ECBA 2WB1N 4Y52J 2NVQJ 4M6VA 3NAUA 1FIAA 2L9RA 3BG9A 1APLC 2GM4A 2K9SA 4B1RA 4V2FA 4DW6A 4G12A 2EZLA 1IUFA 3O8GA 4UUSA 2YU9J 2MW8A 1Y1VJ 2E19A 4MFEA 1RKWA 3BR3A 3MVPA 2DA4A 2L7MP 4A3MJ 3PO3J 1QVTA 2VUMJ 4IHYA 2M2EA 3ZQCA 2P81A 1Z77A 2HYJA 4I76A 4FE7A 1POGA 4DZPA 1ZQ3P 2EZHA 2XRLA 4BY7J 3DCFA 1LFUP 1TWGJ 3S2DJ 5IOZA 2K40A 1BA5A 1GT0C 3BTLA 1JKPC 1UG2A 3C2BA 1AHDP 1OFCX 3ZQHA 5EZGA 1JJ6C 1XC5A 2B63J 2HXIA 3A02A 4BBSJ 2YS9A 2ID3A 1RETA 2DA3A 2KDZA 1FIPA 4MLOA 1MBFA 5JLXA 4JX6A 1YRNB 2TRTA 4BXXJ 1JUMA 4I6ZA 2XPWA 3SDGA 1OCTC 2LD5A 1FEXA 2COBA 2XSDC 3FIWA 1F43A 2M9HA 3M3YJ 4FISA 2DTZA 3HDDA 1AU7A 1U9NA 2R92J 3CMYA 5FKNA 3GTGJ 9ANTA 5J1RA 1GV5A 3WHCA 3G1LA 3G1MA 1T56A 3ZQLA 2ME6A 3Q0VA 3O8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSF A;  3JRB A;  2X48 A;  1ZK8 A;  1IDZ A;  5M5Y J;  3A01 A;  3TW6 A;  2GLO A;  2DN0 A;  2XGC A;  1XG1 A;  5GPC A;  5C3E J;  1MH4 A;  1LE8 A;  2E2H J;  3JRF A;  2LLK A;  1ZGW A;  2LTP A;  2XGD A;  3BR1 A;  1G2H A;  1DU0 A;  3FK7 A;  3RKQ A;  3FIS A;  3S15 J;  1SFO J;  3ZQF A;  2NVX J;  5F1J A;  3HGG A;  4QTR A;  2JN6 A;  4D5F A;  1IGN A;  2NS7 A;  5M3F J;  3GBG A;  1TWC J;  2VI6 A;  5C4J J;  4IHV A;  2NOG A;  1RPW A;  4DYR A;  3TP3 A;  2DMU A;  1GDT A;  2LKX A;  1D5Y A;  1VI0 A;  2KT0 A;  2EZK A;  1AKH B;  3WHB A;  2D5V A;  2EZI A;  3MKL A;  2CU7 A;  1JT6 A;  2YUS A;  2NS8 A;  4FTH A;  4X1E A;  1QRY A;  5IPA A;  3HOW J;  3BQZ A;  4FE4 A;  2HDD A;  4A3B J;  5IOY A;  3TP0 A;  1JUS A;  2CRG A;  4IHX A;  1JKR C;  3GTO J;  1OCP A;  3S14 J;  2LK2 A;  4XRM A;  1O4X A;  1WCM J;  4QIW N;  2L0K A;  5FKO A;  4IHW A;  4XRS A;  1NK3 P;  5EGO A;  2ID6 A;  1ZR4 A;  1E3O C;  2IAI A;  3HKZ N;  2JA8 J;  3B6C A;  1GVD A;  5E3O A;  3LSR A;  3BR5 A;  1X2M A;  3HGY A;  4Y7N J;  2HXO A;  3H3V K;  4C3I J;  1JTY A;  1Z0X A;  3MN2 A;  5C4X J;  3CQZ J;  3NAR A;  1UHS A;  1NTC A;  1JUP A;  3IH2 A;  4C3H J;  5M5X J;  2R5Z B;  3QQA A;  2H8R A;  2FQ4 A;  5F27 A;  3HM5 A;  1ETK A;  1T33 A;  2TCT A;  5K7Z A;  3HEF A;  4C3J J;  3H0G J;  3E7L A;  2IEK A;  2DA1 A;  4A3F J;  4A3C J;  2Y9Y A;  2CJJ A;  1TC3 C;  3JRD A;  1NK2 P;  2QCO A;  3BR6 A;  1ZKG A;  1CQT A;  2XB5 A;  1FJL A;  1I3Q J;  1MNM C;  3GTL J;  5F0F A;  1X2N A;  1JKO C;  2MG4 A;  1JJ8 C;  3IH4 A;  1B8I A;  2R7Z J;  1ZTR A;  5IYB J;  4D7N A;  4M3E A;  5EG0 A;  3OSG A;  2JA7 J;  2O9L A;  1WI3 A;  5FLM J;  1MBE A;  3JRH A;  3I4N J;  4D7M A;  2FJ1 A;  2JMW A;  2Y31 A;  1B72 A;  3S16 J;  4M3G A;  1JTX A;  1VF9 A;  1P7J A;  1SAN A;  1BL0 A;  1IJW C;  3HOX J;  4JX4 A;  4XID A;  1HCR A;  5FLV A;  4A93 J;  2CQX A;  4ABZ A;  1K83 J;  2EBI A;  5M5W J;  2LR8 A;  2E1O A;  3TW7 A;  3IH3 A;  1PUF B;  4HNV A;  2JWT A;  3L1P A;  1WH5 A;  2R5Z A;  3K7A J;  3HOV J;  3UKG A;  1A6I A;  1X58 A;  4DYC A;  3GTM J;  4C2M J;  2Y9Z A;  1ITY A;  4AUX A;  1RKT A;  5J1Y A;  3JRE A;  4NDL A;  1W0U A;  4B4C A;  3Q3S A;  3BTI A;  4S0H B;  3S17 J;  4X6A J;  2MSY A;  2N8G A;  3JRI A;  3ZQG A;  4A3K J;  5EF6 A;  4A3E J;  2M8G X;  3BT9 A;  2HOT A;  2LY9 A;  1LFB A;  3VPR A;  4BBR J;  4J19 A;  3JR9 A;  3QPL A;  2ELK A;  1FTT A;  5EEA A;  3HOZ J;  3SJM A;  5IYD J;  2FD5 A;  2LVS A;  4XK4 A;  4A69 C;  1I50 J;  2DMQ A;  3HB9 A;  1MH3 A;  3LSP A;  2LP0 A;  2R93 J;  4DYQ A;  2AHQ A;  3JRA A;  1YRN A;  2OPT A;  2XGE A;  5K7H A;  3BR0 A;  2R5Y B;  2Y30 A;  3QPS A;  4A3G J;  4EEF G;  3RZO J;  3G1O A;  5GP9 A;  4D5C A;  4A3L J;  1ETQ A;  2OF7 A;  3PO2 J;  1JT0 A;  5FKL A;  1ETO A;  3D1N I;  1K61 A;  1IDY A;  3CDL A;  1U78 A;  1HF0 A;  5E3L A;  2VKV A;  3ZOB A;  4M3B A;  5IYC J;  3GTJ J;  3OOU A;  1WH7 A;  3LSG A;  1ENH A;  2NVT J;  2QF7 A;  1WPK A;  1IC8 A;  1HLV A;  2HOS A;  1UMQ A;  2WAQ N;  3F0C A;  2DJN A;  2AO9 A;  5FJ8 J;  5F0H A;  2ME0 A;  2PMZ N;  1ETY A;  5E3M A;  1U9O A;  3FK6 A;  5GPA A;  3BG3 A;  1U8B A;  2ZB9 A;  2ECC A;  5IP7 J;  2R0Q C;  1HOM A;  3LSJ A;  1W0T A;  1IRZ A;  1I6H J;  3A03 A;  2RAE A;  2DA2 A;  2VPR A;  3Q0U A;  5M3M J;  5FKM A;  1ORK A;  3ZQI A;  5DS9 A;  5EDN A;  1AKH A;  1ETW A;  5J3L A;  3M4O J;  4BKX A;  3A01 B;  1GV2 A;  4UUT A;  1TWA J;  1LE8 B;  3HBL A;  2GBY A;  5E3N A;  2CQQ A;  3JRG A;  5F04 A;  1Y1W J;  2EH3 A;  1MBK A;  3BTC A;  2R5Y A;  3JRC A;  1BW6 A;  3GTQ J;  2K9N A;  3B6A A;  4DZJ A;  1FTZ A;  2EQR A;  4XRS G;  1VFC A;  4AYB N;  1JGG A;  2XPV A;  2E2J J;  3I4M J;  4AC0 A;  3RZD J;  1F36 A;  4MFD A;  1TWF J;  1EF4 A;  4W97 A;  1IV6 A;  3BR2 A;  2NVY J;  2CUF A;  2Y0S N;  5C44 J;  2HQ5 A;  4CYC B;  3S2H J;  2G0E A;  1BW5 A;  4QSH A;  1HDD C;  5IP6 A;  3BTJ A;  5K7F A;  3CCY A;  3S1N J;  2DA5 A;  2M34 A;  5F0C A;  4A3D J;  5JLW A;  5F08 A;  1ETV A;  2VKE A;  1RR7 A;  3RQI A;  1DU6 A;  3SFI A;  1A5J A;  1GUU A;  2FX0 A;  1JKQ C;  2O8K A;  2IBD A;  5EGO B;  2DMN A;  1BJZ A;  1MBG A;  5EYR A;  2LFB A;  1WGX A;  3S1R J;  4M3F A;  4W1U A;  4JX5 A;  1ZR2 A;  4BY1 J;  3GTK J;  2CUE A;  1MBH A;  2W48 A;  2WV1 A;  5HOD A;  3DEW A;  2O7O A;  4A3J J;  1H8A C;  2X6O A;  1MSF C;  4GFB A;  4UUS B;  3IV5 A;  3FKI J;  3HOY J;  2DA7 A;  4JP0 A;  2H1K A;  4FCY A;  1QVU A;  3S1Q J;  4LOC A;  4L5E A;  1HDP A;  5J1U A;  2I10 A;  4B3A A;  1ETX A;  2Y2Z A;  2XB0 X;  3K2A A;  1P7I A;  2HI3 A;  4RBO A;  3PM1 A;  2DMP A;  3OIO A;  5DTD A;  2JK3 A;  3LNQ A;  2XPU A;  4M3D A;  1VND A;  5FKK A;  3TED A;  2JA6 J;  4IEJ A;  2JA5 J;  2K9Q A;  1H88 C;  2JJ7 A;  1H89 C;  1IG7 A;  1R9T J;  1XS9 A;  5EZH A;  1S7E A;  5IP9 J;  1Q1V A;  4XIC A;  4CYC A;  3Q0W A;  3BG5 A;  1B8I B;  1OJL A;  2DMT A;  2L7F P;  4MIM A;  4RDU A;  2E2I J;  3S1M J;  3HOU J;  1TWH J;  4MO7 A;  4V2G A;  5EG0 B;  4A3I J;  1PUF A;  1MSE C;  3W6V A;  2L7Z A;  3LOC A;  3GTP J;  1RES A;  3BQY A;  1QPI A;  5BNG A;  4JYK A;  2MGQ A;  2X9D A;  1MBJ A;  2M0C A;  2DA6 A;  1B72 B;  2HOA A;  2ECB A;  2WB1 N;  4Y52 J;  2NVQ J;  4M6V A;  3NAU A;  1FIA A;  2L9R A;  3BG9 A;  1APL C;  2GM4 A;  2K9S A;  4B1R A;  4V2F A;  4DW6 A;  4G12 A;  2EZL A;  1IUF A;  3O8G A;  4UUS A;  2YU9 J;  2MW8 A;  1Y1V J;  2E19 A;  4MFE A;  1RKW A;  3BR3 A;  3MVP A;  2DA4 A;  2L7M P;  4A3M J;  3PO3 J;  1QVT A;  2VUM J;  4IHY A;  2M2E A;  3ZQC A;  2P81 A;  1Z77 A;  2HYJ A;  4I76 A;  4FE7 A;  1POG A;  4DZP A;  1ZQ3 P;  2EZH A;  2XRL A;  4BY7 J;  3DCF A;  1LFU P;  1TWG J;  3S2D J;  5IOZ A;  2K40 A;  1BA5 A;  1GT0 C;  3BTL A;  1JKP C;  1UG2 A;  3C2B A;  1AHD P;  1OFC X;  3ZQH A;  5EZG A;  1JJ6 C;  1XC5 A;  2B63 J;  2HXI A;  3A02 A;  4BBS J;  2YS9 A;  2ID3 A;  1RET A;  2DA3 A;  2KDZ A;  1FIP A;  4MLO A;  1MBF A;  5JLX A;  4JX6 A;  1YRN B;  2TRT A;  4BXX J;  1JUM A;  4I6Z A;  2XPW A;  3SDG A;  1OCT C;  2LD5 A;  1FEX A;  2COB A;  2XSD C;  3FIW A;  1F43 A;  2M9H A;  3M3Y J;  4FIS A;  2DTZ A;  3HDD A;  1AU7 A;  1U9N A;  2R92 J;  3CMY A;  5FKN A;  3GTG J;  9ANT A;  5J1R A;  1GV5 A;  3WHC A;  3G1L A;  3G1M A;  1T56 A;  3ZQL A;  2ME6 A;  3Q0V A;  3O8H A; 
#chains in the Genus database with same CATH topology
 1UHW A;  5IT9 K;  3V8K A;  2A5Y B;  3KPH A;  1FOK A;  4M6X A;  3S3O A;  1IDZ A;  1TZL A;  2EV5 A;  2DXI A;  2LF7 A;  5M5Y J;  2GLO A;  2DN0 A;  2V26 A;  1XG1 A;  1A04 A;  4MEY F;  1MH4 A;  4A0Y A;  5GPC A;  1LE8 A;  2E2H J;  2XGD A;  1V54 H;  3L00 A;  4N4N B;  4DIQ A;  2V6E A;  1YI2 I;  2CSO A;  4RAZ A;  3RYP A;  4XQF A;  4RB1 A;  3KIO A;  3LSK A;  4CGZ A;  2EWN A;  1FOX A;  1V3F A;  5D5X B;  2VI6 A;  4IHV A;  2E35 A;  2NOG A;  5CLS A;  2DDA A;  1GDT A;  2VN2 A;  1I5Z A;  4ZYE A;  1U5T B;  4ZDP A;  3ZMS A;  3K6G A;  1BC8 C;  2H8W A;  2KT0 A;  2O8X A;  3T5X A;  2K02 A;  1SVO A;  3CP2 A;  1BC7 C;  2XVC A;  2KL4 A;  3K10 A;  2D5V A;  3A2K A;  4XMY A;  1OKR A;  2YUS A;  4IKF A;  1XTA A;  4BE0 A;  5IPA A;  1K79 A;  5IT3 A;  1LDJ A;  4E6K G;  3MMY B;  4QPO A;  1R1V A;  1B9N A;  2CRG A;  4IHX A;  4UVB A;  2ZME C;  1O4X A;  3ERE D;  3TGN A;  5DDG A;  4Y3O A;  5HDN A;  3GZ6 A;  5FKO A;  5LGN A;  4B44 A;  5EGO A;  2ID6 A;  3RKY A;  1UJ8 A;  2ZXW H;  1R5H A;  4PDK A;  3CMA I;  1IRG A;  3RPU A;  1E3O C;  3HKZ N;  2QSF X;  4A5M A;  2JA8 J;  2P5V A;  4CA0 A;  1GVD A;  2F5E A;  4QPQ A;  3BR5 A;  2DBB A;  3R0J A;  2QGU A;  1G3S A;  2DFH A;  3M7G A;  5E8G A;  1WJC A;  3RKW A;  3N4M A;  1T0F A;  2HXO A;  1ZRF A;  2COM A;  4C3I J;  4AWX B;  4LFU A;  3MN2 A;  3LAJ A;  5C4X J;  3DPT A;  1O3S A;  2V4J C;  4C2T A;  1W7P B;  3HJE A;  4HST A;  3VEP A;  2GIV A;  3R6S A;  3IH2 A;  4C3H J;  4R79 A;  3V8J A;  3QQA A;  1STZ A;  1R4N B;  1LVA A;  1ETK A;  3F72 A;  3ZMZ A;  4RM3 A;  1U8R A;  4CDG A;  4G7H F;  3HUG B;  2CW8 A;  2NS0 A;  3H0G J;  3QYB A;  1WJA A;  5FB2 A;  2IEK A;  2DA1 A;  3RPQ A;  2LOO A;  1MDM A;  2CJJ A;  4ENM A;  4G7O F;  2X1C A;  1TC3 C;  5LHI A;  1NK2 P;  3SXY A;  2QCO A;  2FML A;  2W57 A;  2QSG X;  2V1X A;  1CQT A;  5ILV A;  1SAX A;  4ON0 A;  1WKM A;  3MKY B;  3DEU A;  2BGC A;  2W82 A;  4UV9 A;  5F0F A;  2DQL A;  2M4K A;  4ZZD A;  3CCR I;  5IYB J;  1Z21 A;  4PK4 A;  1VQ8 I;  2CG4 A;  3AAF A;  2FSW A;  4M3E A;  5EG0 A;  2DQR A;  4ZZL A;  3QOE A;  2R7W A;  4M71 A;  4YII A;  4OWR B;  5D8L B;  1WI3 A;  2KRC A;  4XLE A;  3JRH A;  3W6K B;  2FJ1 A;  2Y31 A;  2W85 A;  4XLN F;  3ZRG A;  1KQ0 A;  4EM2 A;  2RKH A;  1VF9 A;  2FU4 A;  1P7J A;  1SAN A;  3LQR A;  1WFX A;  1ZGJ A;  1IJW C;  4BU2 A;  3DV8 A;  4I0A A;  4I99 C;  2IGN A;  3FM3 A;  4XID A;  5FLV A;  4A93 J;  1UZC A;  3TBI A;  2CQX A;  4ABZ A;  3U21 A;  3BPV A;  3FZV A;  2UV1 A;  4AYB A;  5E1X A;  3TW7 A;  1W36 C;  4HNV A;  2JWT A;  2Q8K A;  1WH5 A;  2FF4 A;  3UKG A;  5DYM A;  4UB8 C;  2VLA A;  3GTM J;  4C2M J;  2O61 A;  2W84 A;  4DGW B;  2Y9Z A;  3HUG A;  3DFG A;  1W7P D;  4HNU A;  5J1Y A;  3JRE A;  2BXZ A;  4C2U A;  4NDL A;  1W0U A;  3OOP A;  3P9K A;  4IX7 A;  5CVV A;  1ZN2 A;  3GX4 X;  2V7F A;  2KPM A;  3S17 J;  5JFR A;  4RLF A;  4A3K J;  5EF6 A;  2WV0 A;  4KIT B;  4HSR A;  1LFB A;  3CDI A;  1K4T A;  1YE9 A;  4J19 A;  4OIQ F;  1DP3 A;  3UR3 C;  2ELK A;  3KYD B;  3QRF F;  3B02 A;  4KT5 C;  1ULY A;  1HC8 A;  3PUB A;  3BCB A;  2FD5 A;  1RI7 A;  4XK4 A;  4A6E A;  1RRJ A;  2IS4 A;  2GZW A;  4GYG A;  4BXF A;  1QGP A;  3GF2 A;  2DMQ A;  1G59 A;  3LSP A;  1YRN A;  1DGR M;  2R5Y B;  2EA2 A;  4EEF G;  2IS6 A;  1G3W A;  1G8X A;  2R7D A;  2EIM H;  4OIN F;  2EFP A;  4A3L J;  3ESW B;  1ETQ A;  3EUH C;  3GVA A;  3E0J B;  3RYR A;  1QBJ A;  4NNJ A;  1ETO A;  3D1N I;  2CV1 A;  2QQA A;  1HF0 A;  2OA4 A;  2GXB A;  5FD6 A;  5E3L A;  4OIR F;  3GLX A;  2B9S A;  2LF8 A;  3ZOB A;  2OUM A;  4BEH B;  3GTJ J;  2Q0O A;  4E7S A;  3DU6 A;  4R1H A;  1ENH A;  3BY6 A;  1YIT I;  1WPK A;  4IJA A;  3K1P A;  3F0C A;  5FRO A;  1USS A;  2DJN A;  3K4M A;  2L01 A;  5F0H A;  1ZHF A;  4ZTJ A;  3P9C A;  4DOZ A;  2IS2 A;  2EFN A;  2MD0 A;  3I58 A;  2P5K A;  3WE3 A;  2CV0 A;  1QHG A;  1TP4 A;  3PQJ A;  4L0Y B;  2PLY A;  2ECC A;  1BR2 A;  1FZP B;  4N4O B;  1IW7 F;  2W24 A;  3REO A;  3U1K A;  5FRM A;  2PMH A;  2YU3 A;  1I27 A;  2VPR A;  1TW2 A;  1XMA A;  2O0Y A;  4XBF A;  1ORK A;  2V9V A;  5EDN A;  1AKH A;  2LRD A;  3CUQ C;  1XSD A;  2Y48 A;  1L0O C;  5B1B H;  3LL7 A;  5LRS A;  1TWA J;  3HTU A;  3HBL A;  1LNW A;  1KGS A;  3HTS B;  2H94 A;  2LRE A;  3DPU A;  1V4R A;  1Y1W J;  1D1A A;  1XPX A;  3H92 A;  4AID A;  1MBK A;  3OYN A;  3AG2 H;  2LKS A;  2QUF A;  3K0L A;  2R5Y A;  4OMZ A;  2L9S A;  2IVM A;  2BY1 A;  4I09 A;  3FBN B;  4DZJ A;  1FPQ A;  2EQR A;  3NWS A;  4XRS G;  4EGZ A;  4IQ4 A;  1KU2 A;  5ICG A;  4AYB N;  2JQ7 A;  2FOW A;  5KNL A;  3I4M J;  2ZXH A;  4MFD A;  2STW A;  2ZME A;  4BEH A;  4BNC A;  3IUO A;  2NVU B;  3ROU A;  1S7A A;  2FE3 A;  4HW0 A;  3BR2 A;  5C44 J;  4FAS D;  2G0E A;  1BW5 A;  4CYD A;  1X3U A;  1VQM I;  4I7H A;  4OAY A;  3CCY A;  2DA5 A;  3E6D A;  5CQE A;  4AU7 A;  3QP5 A;  5F08 A;  1XB4 A;  4EJW A;  1SD4 A;  3SFI A;  3DLL F;  4HF0 A;  2RN7 A;  2V9P A;  2ZSH B;  2FX0 A;  2Z33 A;  1JKQ C;  2OC6 A;  3LAP A;  2OJE D;  2DMN A;  3AFH A;  5J47 A;  4IL6 C;  2PJR A;  2F4O B;  2VBY A;  3BC8 A;  2HYF A;  2HZT A;  4JX5 A;  2KRF A;  4W1U A;  1ZR2 A;  1O3Q A;  2PI0 A;  4BY1 J;  2Z2S B;  2P0W A;  3KZZ A;  1Y39 A;  3U2R A;  4MTE A;  4EAT A;  1V55 H;  3T1B A;  1N25 A;  1IN6 A;  2IW5 A;  3SYT A;  4HQM A;  4IQJ A;  1A31 A;  2JT1 A;  1J75 A;  2R7X A;  5HOO A;  3M8E A;  5E79 C;  4WK8 F;  4DJA A;  1SC7 A;  3TDZ C;  1R7J A;  4EJV A;  1EKE A;  2XF5 A;  2IPQ X;  5J1U A;  5D4S A;  3K2A A;  3JAM Z;  3HOT A;  4GRI A;  1PP8 F;  1GVJ A;  1FMV A;  2DMP A;  1SAU A;  2FEZ A;  3K4L A;  3RDI A;  5E1W A;  2A6T A;  3MCZ A;  2XPU A;  2A6H F;  1YFH A;  2DDB A;  3TED A;  1TL8 A;  1H88 C;  2JJ7 A;  2Z3Y A;  3AG1 H;  2X6W A;  5JHU A;  1IG7 A;  5EZH A;  2R7Q A;  2JTV A;  1PVE A;  5ILU A;  3EET A;  2STT A;  3HL2 A;  2DMT A;  4MIM A;  2FA5 A;  2X4H A;  2JVH A;  2PBI A;  4A3I J;  1HW1 A;  1TLH B;  5LD2 C;  5KHD A;  3GTP J;  1I1G A;  4NC6 A;  6PAX A;  4BS9 A;  3I53 A;  2M0M A;  3BQY A;  1QPI A;  1QU3 A;  3V7S A;  4UB6 C;  4UXN A;  4Y13 A;  1YQA A;  4LGW A;  1B72 B;  1D8K A;  2JPC A;  2ECB A;  1Y56 A;  4Y52 J;  1ONV A;  2F48 A;  2QQ8 A;  1FIA A;  1APL C;  2QBY B;  2W7N A;  2K9S A;  4NQW B;  4F92 B;  3D5S C;  3QYE A;  4DW6 A;  4BXU A;  3W2V A;  4G12 A;  2EZL A;  1IUF A;  3O8G A;  2QKM B;  1G4D A;  4Q48 A;  1ZG1 A;  3MVP A;  3BR3 A;  1ACI A;  2DA4 A;  1KYZ A;  3HRS A;  4XOR A;  5LEK A;  1OPC A;  4HZF A;  1W36 D;  2LY1 A;  2M2E A;  2VJ5 A;  3ZQC A;  1IAW A;  1WZ2 A;  2QEN A;  2FOK A;  2JUG A;  3LMM A;  1ZQ3 P;  3ABU A;  4BY7 J;  4L9N A;  1FY7 A;  2VT3 A;  2KIS A;  1PDN C;  3BDD A;  3ZMT A;  1TWG J;  2MBF A;  3CJR B;  3V8L A;  1N77 A;  4PGG A;  5J4V A;  2XC7 A;  1GT0 C;  1X1P A;  3C2B A;  4YG2 F;  1YHQ I;  5J6X A;  3PFI A;  5EZG A;  1VQK I;  1R5G A;  3KP3 A;  3Q9S A;  3K69 A;  2XIG A;  1JJ6 C;  2HXI A;  4ZYA A;  4BBS J;  2YS9 A;  4A5N A;  2P7V B;  1LDK B;  4TV7 A;  1RET A;  1HKS A;  4AVZ A;  5D5V B;  5BOX A;  4KYW A;  2EB7 A;  4MLO A;  3IHU A;  3EUH A;  4IOA F;  4JX6 A;  5LHH A;  5HLH A;  2BW3 B;  1B9M A;  3KYL A;  4FET A;  3QOD A;  3ASN H;  3I59 B;  3SDG A;  2COB A;  5HS8 A;  3FIW A;  4ZYH A;  3CCL I;  4M72 A;  1CF7 A;  4FIS A;  3CLQ A;  2BHZ A;  3QP6 A;  2HQR A;  5GAD J;  5HNH A;  4AIJ A;  2OV7 A;  1AU7 A;  3CMY A;  5FKN A;  4DQ2 A;  3OS1 A;  9ANT A;  1GV5 A;  2H09 A;  1JI8 A;  1T95 A;  2V1N A;  4BDY A;  1T56 A;  3BP8 A;  2KHM A;  2GXG A;  4BL0 B;  3GEZ A;  2DTR A;  3Q0V A;  1LB2 A;  4CCM A;  3OSF A;  2X48 A;  5GAG J;  2XAQ A;  4KN7 X;  4OOI A;  5J4Y A;  5E17 F;  2EIK H;  3O2P E;  4M9S A;  3A01 A;  3FMS A;  3TW6 A;  5F64 A;  3HRM A;  4MQ9 F;  3JRF A;  1ZGW A;  2KMU A;  3HPG A;  3J81 Z;  3BR1 A;  4PJM A;  5KAF C;  4WX9 A;  3FIS A;  3WU0 A;  1Z6R A;  4ZTF A;  3S15 J;  1E0E A;  3ZQF A;  5HLT A;  2NVX J;  3HGG A;  2JN6 A;  1OYW A;  5E1Z B;  1IGN A;  3CUQ A;  3FBI B;  5A2Q Z;  3H3U A;  2NS7 A;  3C7J A;  5M3F J;  1KU7 A;  2LBF A;  2X85 A;  3CZ6 A;  2Z99 A;  1B59 A;  1LKX A;  1FX7 A;  3TP3 A;  3T8R A;  5ICF A;  2VBW A;  4DBR A;  3C2G A;  1Z67 A;  2X6X A;  1VI0 A;  1QA6 A;  2EZK A;  3DU5 A;  4UHT A;  3WHB A;  2HKO A;  3BZ6 A;  3QAH A;  3MKL A;  3VOD A;  2CU7 A;  3J81 K;  4XOP A;  4IXA A;  3CC7 I;  1VQP I;  4X1E A;  1QRY A;  4L5J A;  3CC4 I;  3HOW J;  3W2A A;  2Z5U A;  4BE2 A;  2HVS A;  1FBU A;  5A2Q K;  2BW3 A;  2W25 A;  1ZAO A;  2HU9 A;  2QSH X;  1EA3 A;  3TQN A;  2LK2 A;  5HLI A;  2E60 A;  4XRM A;  3P5J A;  1QHH D;  1S8N A;  1WCM J;  3HG9 A;  2DCE A;  2L0K A;  2ZJP F;  2HDC A;  3A0B C;  4IHW A;  4XRS A;  2DLL A;  3OYA A;  1UB9 A;  2IAI A;  4LK1 F;  2DFE A;  2IGM A;  2KQR A;  2XAH A;  4P55 A;  4RM2 A;  1FYM A;  2EPF A;  1X19 A;  3LSR A;  1X1A A;  3FDY A;  3KP4 A;  4LG0 B;  4B8X A;  4DNC A;  5D5W B;  4G6Q A;  3HRT A;  3H3V K;  1XCV A;  3CQZ J;  4HDU A;  3NAR A;  1VTN C;  1MMN A;  1ERD A;  1K6Y A;  3E6C C;  4KT6 A;  2FUG 2;  1TW3 A;  4ZDL A;  3VYS B;  2FQ4 A;  5F27 A;  2HPM A;  5J40 A;  5BPD A;  4U0W A;  4EM1 A;  1T2K A;  3OMY A;  2VE9 A;  3HEF A;  2X6Y A;  3WGG A;  1G3T A;  4A3F J;  4OU0 A;  2WAQ A;  3EUK L;  4A3C J;  3FHN A;  2JRM A;  3JRD A;  2DT7 B;  4CHU A;  2LKP A;  3BR6 A;  5DCF A;  3K1M A;  4RGX A;  5FLX Z;  3AL0 C;  2FNA A;  4XKC A;  2F2E A;  5FGM A;  1I3Q J;  1GHC A;  3QU6 A;  1MNM C;  3GTL J;  2EK5 A;  2G7H A;  4XOT A;  4WCG A;  2L02 A;  3ZQ7 A;  4ENK A;  1X2N A;  5DEQ A;  2MG4 A;  4CH7 A;  3SEZ A;  1B8I A;  3J7A Y;  3CCS I;  5HVQ C;  1SEU A;  4YFN F;  3A4C A;  1FP1 D;  3SQN A;  4D1Q A;  3L2V A;  1HSJ A;  2BXY A;  3KZY A;  4ENJ A;  4O5V A;  3HIF A;  4XLP F;  1LUJ B;  3FWE A;  4I2O A;  2P6S A;  4D7M A;  3DF8 A;  1MZB A;  4IVN A;  4PJJ A;  2HS5 A;  3CUO A;  1MKM A;  1ODD A;  2E1N A;  3J7A O;  2AXT C;  2RQP A;  2ISY A;  4O3M A;  5BQT A;  5L3E A;  4RB2 C;  2CGP A;  2K4B A;  3FXK A;  1IXR C;  2A69 F;  4BH9 A;  2HWV A;  3FXM A;  2AXL A;  1FBS A;  2CUJ A;  2FBI A;  1PUF B;  2G7U A;  1S9H A;  4B47 A;  3FHZ A;  3OYK A;  3AKZ A;  1BIB A;  3JSO A;  2X1E A;  4Q4Z F;  1T6S A;  4MHG A;  1PP7 U;  4E70 A;  4XM3 A;  1YJ9 I;  4DYC A;  1W5C C;  2HR3 A;  2LY2 A;  1YJW I;  4HQE A;  4ZYD A;  1D3Y A;  3S93 A;  4B4C A;  3Q3S A;  2F5V A;  3VFZ A;  4S0H B;  1R00 A;  3PNY A;  4LLG F;  2XV4 S;  2N8G A;  2CW7 A;  3K4B A;  4AD9 A;  4RGS A;  4XLH A;  1WI9 A;  2HOT A;  3JR9 A;  5D5U B;  2OD5 A;  3DTE A;  3BLY A;  3JTH A;  1FTT A;  3I0T A;  5EEA A;  2VQH A;  4V19 K;  3TMO A;  3OS2 A;  4HLY A;  1KU9 A;  4A69 C;  4ZYG A;  3KX2 A;  3OYC A;  1MH3 A;  3MKZ A;  2KLO A;  2O6G E;  2CYY A;  4I98 B;  2X1D A;  5GP9 A;  4D5C A;  1F4K A;  3KP6 A;  3OY9 A;  4I0B A;  1JT0 A;  2V9K A;  2P8T A;  4KNY A;  2WTE A;  1Z1D A;  2VKH A;  3GFI A;  1U78 A;  3W6J B;  3OYI A;  4S04 A;  4A0X A;  1M1E B;  3FF5 A;  5CVI A;  1K4S A;  3HXL A;  4KMF A;  1HQC A;  4YEL A;  3PQK A;  1DDN A;  4BJ6 C;  4J00 A;  2VBX A;  5D6E A;  4PFO A;  2QF7 A;  4BQQ A;  4EQQ A;  1UMQ A;  2WAQ N;  3P7N A;  2AO9 A;  4CCN A;  1SFX A;  1VQN I;  2VOD A;  3V42 A;  4G7Z F;  1ETY A;  2F5C A;  3ML6 A;  3FK6 A;  3DP7 A;  4G9Y A;  4EVI A;  3ABT A;  2ZB9 A;  1BBY A;  5ILS A;  4CZC A;  2R0Q C;  2K9M A;  2OTL I;  1W4M A;  1MIJ A;  3ABK H;  4PUS A;  1AA7 A;  4YIF A;  4WWC A;  4UNO A;  4ESB A;  1J5Y A;  1NH3 A;  1U5T A;  5M3M J;  1X4O A;  5DS9 A;  2Z1D A;  4ZJZ A;  5J3L A;  3I56 I;  3HC7 A;  4BKX A;  1E3P A;  1GV2 A;  2VT2 A;  1R22 A;  2JRT A;  4HG2 A;  3BJA A;  2O03 A;  3WTX C;  5CJ9 A;  2L5Q A;  3C3W A;  4E7K A;  1XGM A;  3PUF A;  4ANJ A;  3FMQ A;  2HGC A;  3H1C A;  5HS7 A;  1OIS A;  4G6D A;  2BV6 A;  3VYT B;  3JRC A;  3WU2 C;  1OMI A;  2K9N A;  3B6A A;  3AL0 B;  3L2C A;  2KDO A;  3OYF A;  4MQV A;  3ZP5 A;  3N97 A;  1VFC A;  3F6V A;  2XDV A;  4Q47 A;  4AC0 A;  3RZD J;  4JOM A;  2KIU A;  2WBM A;  4ASN A;  3HHG A;  2DK5 A;  2X51 A;  1YTY A;  5EEH A;  3VSK A;  2HVR A;  3VYU B;  2FMY A;  2CUF A;  2NVY J;  4KIF A;  4LK0 F;  1OCR H;  3LSM A;  4XON A;  3ZPL A;  3M1C A;  2DI3 A;  3BTJ A;  4YFK F;  1BI0 A;  1W7P A;  2Y69 H;  2M34 A;  4A3D J;  5K5R A;  1WJD A;  5JLW A;  4GCV A;  4QLC U;  3KLO A;  2CO5 A;  4CIC A;  4HRI A;  3RQI A;  1A6Q A;  1GUU A;  1N75 A;  1MBG A;  5EYR A;  2LFB A;  1YS6 A;  1WGX A;  3S1R J;  2W00 A;  4M3F A;  2W48 A;  3F9K A;  3G2B A;  3OR2 C;  3R0A A;  2X6O A;  1MSF C;  2BY2 A;  4Q5S F;  2GA2 A;  1OCO H;  2EJR A;  2DA7 A;  1MNE A;  1P9Q C;  3BWG A;  4UVA A;  5CVJ A;  4L18 B;  1Z7U A;  2OTJ I;  2HTJ A;  2VXZ A;  3GUD A;  5ERI A;  3GZN B;  4HNT A;  4NC7 A;  1HDP A;  1U0J A;  2I10 A;  2JVG A;  4P5O A;  2Y2Z A;  1NG6 A;  4D0P A;  2HI3 A;  2DPD A;  3E5U A;  3HSF A;  4HLX A;  1R36 A;  3PM1 A;  4P9U A;  2ZNZ A;  2FRH A;  3DKY A;  1J7K A;  2M1B A;  2IGK A;  2M7A A;  1FYL A;  2JK3 A;  2H6B A;  3AG4 H;  2OCE A;  1VND A;  5CQG A;  4LB6 B;  4AM3 A;  1HST A;  1KON A;  2ZSI B;  3NWT A;  2WA0 A;  4IEJ A;  2EIN H;  2K9Q A;  2D45 A;  3DEE A;  1H89 C;  3E5Q A;  3MZ8 A;  1XS9 A;  3TKY A;  3BRO A;  2V6C A;  1I1S A;  1VQ7 I;  1B1B A;  4IOC F;  4II2 A;  3S1M J;  1MGT A;  4R8H A;  1SMY F;  1EH8 A;  1IF1 A;  4OMY A;  2ZKZ A;  2PMU A;  5BNG A;  1W5S A;  4JYK A;  5AIQ A;  1MBJ A;  2DA6 A;  4HOB A;  3WTV C;  2HOA A;  4HEA 2;  2MLK A;  4E7L A;  1JGS A;  2NVQ J;  2IA2 A;  2V1U A;  4LLL A;  1BR1 A;  2AQE A;  2FBK A;  3EUA A;  3KYC B;  4LIV A;  4M73 A;  4B1R A;  1ZYR F;  4IPA A;  2DOA A;  2NOJ B;  3LWF A;  1A36 A;  1MMG A;  3H5A A;  2JZY A;  2VJJ A;  2E19 A;  2MA3 A;  1V5G A;  1YJN I;  4LD5 A;  1RKW A;  1LEB A;  2HYG D;  1S29 A;  2KZG A;  3WG9 A;  1KQ8 A;  4FE7 A;  1POG A;  4NBQ A;  1YW7 A;  4B3X A;  1RC9 A;  1D0Z A;  2RV8 A;  2P4W A;  3Q9V A;  4P1W A;  1AWC A;  1YG2 A;  3D0S A;  5IOZ A;  5EJC A;  3T8T A;  2QVO A;  2HOE A;  1BA5 A;  4UUV A;  1UG2 A;  1AHD P;  2QYO A;  1OFC X;  2K85 A;  3FXQ A;  1WWX A;  2LDU A;  3KEO A;  5DM6 F;  2FNP A;  1FLI A;  3RIR A;  2VBZ A;  2HTS A;  1D0Y A;  2IS1 A;  3CCM I;  1UEL B;  1O3R A;  5JLX A;  2E34 A;  3TOA A;  4BHP A;  1XGO A;  1JUM A;  3WTW C;  4I6Z A;  2A07 F;  5B5E C;  1OCT C;  4HBL A;  3ZN1 A;  5ICE A;  1S72 I;  4XSZ F;  1D5V A;  1F43 A;  1KZH A;  4WXH A;  2M9H A;  1SVL A;  4CCJ A;  4XKV A;  2OQG A;  3HDD A;  2WAF A;  2ETH A;  3KP5 A;  1WRJ A;  2NRA C;  3V7R A;  3WHC A;  4JK1 X;  1ZH5 A;  5JHF A;  3COA C;  1AOY A;  1NG7 A;  1QZE A;  2XRN A;  3IL2 A;  2P7C B;  3O8H A;  2M30 A;  4HF1 A;  2F5D A;  3JRB A;  1TT5 B;  1Z91 A;  1ZK8 A;  3I5U A;  2V1D A;  3L2Q A;  1LDD A;  4XSX F;  2XGC A;  3ZGK A;  5C3E J;  2HVQ A;  3ZMU A;  3S3N A;  2E1C A;  2LTP A;  2PEX A;  1G2H A;  3RKQ A;  5CVU A;  4XLF A;  1SFO J;  5F1J A;  4QTR A;  1YW8 A;  3K4C A;  3GBG A;  2ZFU A;  1D1C A;  2Y75 A;  1TWC J;  2X0L A;  5C4J J;  1VQ4 I;  3H9G A;  4DYR A;  5E8I A;  2Y0M A;  3VWB A;  4KDP A;  2R7U A;  4PZJ A;  2O5R A;  1D5Y A;  3CP8 A;  3X2Q H;  1IO2 A;  1XMK A;  2EZI A;  1BJA A;  3K1N A;  2CMP A;  2MH2 A;  3HHH A;  1O3T A;  1WJF A;  4IF4 A;  3BQZ A;  3JSP A;  2VOO A;  4FE4 A;  2HDD A;  2K4J A;  4A3B J;  5FO5 A;  4BYY A;  2P6T A;  1JUS A;  2BY3 A;  3CCQ I;  1IXS B;  3OYE A;  2J5O A;  3JAM K;  1XSV A;  4KN4 X;  4QIW N;  1ZG3 A;  4F91 B;  2I5U A;  3FKJ A;  3SZT A;  2VJI A;  1NK3 P;  3CJN A;  4BHB A;  3BJ6 A;  4KMU X;  3B6C A;  1WJB A;  5HLG A;  5E3O A;  3R4K A;  1I39 A;  3FXO A;  5GAH J;  4BQA A;  4Y7N J;  4CCK A;  2EFW A;  3FXR A;  2KZV A;  5H2F C;  1XSX A;  1OR7 C;  5L3B A;  1NTC A;  1JUP A;  1TT0 A;  2B0L A;  3MAJ A;  4HYE A;  1WJ5 A;  4YFX F;  2LNB A;  1Y8Q B;  4L9V A;  2CW0 F;  1OQY A;  2MD5 A;  2UZK A;  3WTZ A;  4N0B A;  1J59 A;  4ETS A;  4BUP A;  3HM5 A;  3F8B A;  1T33 A;  4LMY A;  3ZXS A;  2TCT A;  4LG3 A;  4N9H A;  3ABL H;  4C3J J;  5CVR A;  4U88 A;  3F8F A;  4BQO A;  3DPL C;  3MQ0 A;  2Y9Y A;  2Q2E B;  3ERM A;  2L3D A;  2AQF A;  1ZKG A;  3K4J A;  3M9A A;  4O6J A;  1VQ6 I;  1XGS A;  4ZDO A;  2A3S A;  2XHK A;  1FOY A;  2F6C A;  2BEO A;  1K6O A;  4M9X A;  2R3S A;  3HRU A;  1JKO C;  3MKW B;  2ELJ A;  1MMA A;  1ZRC A;  2E1M C;  2GXA A;  1JJ8 C;  3Q5F A;  2R7Z J;  5AIP A;  3I3L A;  2HKX A;  4D7N A;  2R7T A;  3R61 A;  2EIL H;  2CFX A;  4ESF A;  3SZP A;  4RLQ A;  3OYM A;  1LQ1 A;  2CQK A;  3E1S A;  3OSG A;  2VQC A;  2OBP A;  1X1D A;  2ZXJ A;  4HX8 A;  2VB6 A;  3TL4 X;  2O9L A;  3CCV I;  5FFZ A;  3M8F A;  4FT8 A;  1X3Z B;  2UWM A;  4Y17 A;  3GWZ A;  1B72 A;  2EV6 A;  2C6Y A;  4M3G A;  1JTX A;  3WG7 H;  4ENN A;  1B6A A;  4BAC A;  2QBY A;  4GGG A;  4NQW A;  3G6E I;  2H27 A;  3ECO A;  2Z16 A;  2WAE A;  1BR4 A;  3PSF A;  2K5C A;  4F52 A;  3ZQQ A;  1J0R A;  5M5W J;  1QNT A;  2E1O A;  3O6B B;  3IH3 A;  3KP2 A;  2ZO4 A;  3L1P A;  1RZ4 A;  4IO9 F;  1T0F C;  4XN3 A;  2QZ8 A;  4KUM A;  3BZK A;  3ISP A;  1X58 A;  1ON2 A;  2VE8 A;  4GXO A;  2DOD A;  3MWM A;  3MD2 A;  4RGU A;  2IA1 A;  4HV6 A;  3TO9 A;  2XAF A;  2W1O A;  4HX4 A;  1OLT A;  3ZN0 A;  2CV2 A;  4FHT A;  1UFM A;  2M87 A;  1F9N A;  2RNJ A;  3PL8 A;  1P6R A;  2L54 A;  4AVP A;  1S5L C;  2BVL A;  3JRI A;  2WWY A;  3ZQG A;  4A3E J;  2DFF A;  4HF2 A;  3BT9 A;  2YX7 A;  4L5I A;  3GCM A;  2R4G A;  4BJ5 C;  4PJL A;  1DPR A;  3HOZ J;  2Q1Z B;  1XN7 A;  3IKT A;  5D8K B;  4Y33 A;  3CCJ I;  5LEJ A;  3OR1 C;  2VL8 A;  1IN8 A;  2ESN A;  1JXS A;  3IWZ A;  3HB9 A;  4D9J A;  3OS0 A;  2R93 J;  2GOX B;  1DPU A;  3FM5 A;  3I59 A;  1QZY A;  2EV0 A;  2Y30 A;  4A3G J;  1P2F A;  2ISZ A;  2K9L A;  3BJO A;  3OYG A;  2WY7 Q;  3DLA A;  3JCU C;  3PO2 J;  3OV8 A;  5FKL A;  4BHC A;  1K61 A;  1C0W A;  1IDY A;  3CDL A;  3DKX A;  3K9T A;  1BI2 A;  2XUB A;  2VKV A;  1T8I A;  2FQ3 A;  4M3B A;  2J5P A;  2EFQ A;  3OOU A;  5GAE J;  1WH7 A;  2CFO A;  3OYH A;  2M8E A;  4JQF A;  2ZJR F;  1K78 B;  3S32 A;  2HOS A;  3ABM H;  5FD5 A;  3H5N A;  3OIQ A;  3FXL A;  5FJ8 J;  3W2W A;  4NC8 A;  5E3M A;  5GPA A;  3BG3 A;  3WTT C;  2K86 A;  1U8B A;  3OIP A;  4I01 A;  2VJ4 A;  3J80 Z;  4G6T B;  3S3M A;  1HOM A;  3LSJ A;  3B73 A;  2W4S A;  1W0T A;  1IRZ A;  1I6H J;  4BDZ A;  2DU9 A;  2RAE A;  2DA2 A;  2DJI A;  4F55 A;  1G6N A;  3Q0U A;  5FKM A;  4RMN A;  2D1V A;  1H9G A;  2DT6 A;  2GQQ A;  3G73 A;  1YYV A;  4BGD A;  3IAM 2;  1U2W A;  3HSR A;  4U87 A;  1LE8 B;  2NYX A;  4BE1 A;  3EYY A;  2WB1 A;  3OWT A;  1LFP A;  4PJ0 C;  5E3N A;  2QKL B;  3VSL A;  5F04 A;  2MAB A;  4KIG A;  3N05 A;  1Q1H A;  1S6L A;  2EH3 A;  2KIF A;  1VQL I;  3CCE I;  2BVM A;  4PJN A;  3BTC A;  4CCL A;  1X4P A;  1MND A;  1KYW A;  5BMZ A;  3BOQ A;  4XLA A;  4LLN A;  2DW4 A;  4P96 A;  5FFX A;  2DFI A;  3E5X A;  5FLX K;  5FRN A;  3O3K A;  1J2X A;  1WHU A;  2E1M B;  1Z6T A;  1F36 A;  2BY0 A;  4FX0 A;  5L3G A;  3GFJ A;  4W97 A;  3JTG A;  1RUO A;  4LG0 A;  2E7X A;  2OU2 A;  3QPT A;  1N78 A;  4QWQ A;  4L0Z B;  1K78 A;  4Z6Y A;  4CYC B;  2VQL A;  5IT9 Z;  3F6O A;  2ZNY A;  4QSH A;  1YS7 A;  1HDD C;  5IP6 A;  2BYV E;  5K7F A;  1XX5 A;  4EJT A;  1IXC A;  2UXX A;  2RGV A;  3S1N J;  1T39 A;  1PJR A;  2F5F A;  1ETV A;  2VKE A;  3OYL A;  1RR7 A;  1F5T A;  1DU6 A;  3KEY A;  1HXD A;  3D5R C;  5EGO B;  1Y0N A;  1VQ9 I;  2F4I A;  2GOM A;  1UCR A;  4LIU A;  5CKT A;  1OR7 A;  1BIA A;  2DPU A;  2WV1 A;  3OL3 A;  5HOD A;  5JVG F;  3DEW A;  4U0Y A;  3RSN A;  3SEQ A;  2RRE A;  4GFB A;  1R49 A;  3LSH A;  3GFL A;  3IV5 A;  4X0G A;  1YOV B;  3BG6 A;  4B48 A;  5LLQ A;  5LGT A;  2YR2 A;  4JP0 A;  3WU1 B;  1QVU A;  4FCY A;  3EYI A;  1T08 B;  3ONQ A;  1V5F A;  1XD7 A;  3ZMD A;  5IY5 H;  1RIO H;  1ZEL A;  4HV5 A;  2A05 A;  1D0X A;  3JW4 A;  2L2O A;  1FOW A;  1Y8R B;  2OZU A;  2RQQ A;  2XB0 X;  2VPL A;  1P7I A;  2YPR A;  5D4R A;  4RBO A;  1MMD A;  2DYS H;  1OYY A;  2M5W A;  4XL9 A;  3F21 A;  3M8J A;  3LA7 A;  1MDM B;  4NHJ A;  2QA4 I;  2VON A;  2DOF A;  5DTD A;  1K7A A;  4HAM A;  4RS8 A;  5E20 A;  2CQN A;  1LVK A;  2P5L C;  3H36 A;  2ZC2 A;  3FXJ A;  4PGH A;  2RVC A;  1Y0U A;  2PFB A;  1U6G A;  2XKP A;  1XMX A;  3KLN A;  4IRI A;  1MD0 A;  1S7E A;  1Q1V A;  1R5I D;  4XIC A;  3LST A;  3ULQ B;  4EJO A;  3Q0W A;  4CYC A;  1HKT A;  1OJL A;  2LG4 A;  2R7V A;  3A1Y A;  2L7F P;  3ELK A;  5DUI A;  1R4M B;  4A2U A;  3FMR A;  1TWH J;  4Z2Y A;  4V2G A;  5EG0 B;  4KJZ A;  3CJQ B;  1PUF A;  2NNN A;  1MSE C;  4UV8 A;  1DP7 P;  3OYJ A;  3T0Y A;  1RES A;  3GZ5 A;  1NHA A;  2BOL A;  5LFA A;  2X9D A;  2M0C A;  2WB1 N;  1S7O A;  4XRF A;  2B7E A;  3H3Z A;  1ZGA A;  2NXN B;  3NAU A;  2GM4 A;  3C2H A;  2HPI A;  1FMW A;  2MC3 A;  4V2F A;  5DD8 A;  3EDP A;  5L3D A;  4KIS A;  3RPU D;  2CUZ A;  2LYC A;  5DV5 A;  4JBA A;  5E18 F;  2MW8 A;  3PO3 J;  3F8C A;  3TOB A;  4EM0 B;  1QVT A;  4IHY A;  1R1U A;  3J7Z I;  1MMS A;  1S3J A;  2HYJ A;  1JHH A;  1P92 A;  2ADU A;  3G4S I;  2KJC A;  1KU3 A;  4DZP A;  4YRV A;  2EZH A;  5L3C A;  4M74 A;  3UNG C;  5J8C A;  3S2D J;  1JKP C;  3HZJ A;  3GW2 A;  1P4X A;  1R71 A;  3ZQH A;  3EQL F;  2EFO A;  3CTA A;  5H6Q A;  2ICW G;  1XC5 A;  2B63 J;  3A02 A;  2HZD A;  1F1Z A;  3CF5 F;  4B43 A;  2DA3 A;  1FSE A;  4MNU A;  2KDZ A;  1FIP A;  5JR3 A;  1O7L A;  4IRG A;  1IUY A;  2KFD A;  4LJZ F;  4Y15 A;  1JHF A;  2PN6 A;  2XAU A;  1YRN B;  2TRT A;  2ZJQ F;  1P4W A;  2OAZ A;  2ZBK A;  1MW7 A;  5BS6 A;  2LD5 A;  2XSD C;  3M3Y J;  2OQR A;  2JA2 A;  1WSU A;  5HS9 A;  1U9N A;  3PNV A;  3S2W A;  3ECH A;  1PUE E;  5J1R A;  4E7H A;  2DK8 A;  2IGO A;  4IRH A;  1Z05 A;  3SFZ A;  4BJT A;  2XAS A;  2XGX A;  1R6R A;  1R1T A;  2VXD A;  1O7F A;  2HDW A;  3PJR A;  2DO7 A;  2FXA A;  3I9V 2;  3LA3 A;  3RCO A;  2DYR H;  2QM3 A;  3HSE A;  3IAS 2;  3SDB A;  1TNT A;  4F93 B;  1ZRD A;  5JVT A;  2LLK A;  3EPZ A;  3C1D A;  3CME I;  4RGR A;  1U3E M;  2OZ6 A;  4EJU A;  1DU0 A;  2R7F A;  3FK7 A;  3W3C A;  3RQ4 A;  3OYB A;  3VB2 A;  4D5F A;  5K5Q A;  5KK1 A;  5H20 A;  3HOS A;  1WQ2 A;  1RPW A;  1VZ0 A;  3L2W A;  2DMU A;  2ZCW A;  1MJB A;  1YX3 A;  2M4G A;  2LKX A;  1UAA A;  3GYH X;  1AKH B;  4RAY A;  1LPQ A;  1TBX A;  3E6M A;  2M45 A;  1YO5 C;  2GA1 A;  1RR8 C;  3CO7 C;  1JT6 A;  1UHM A;  2NS8 A;  4FTH A;  3V7C A;  1SFU A;  2D2W A;  1REP C;  3H9J A;  1ON1 A;  3BG7 A;  2L9N A;  5DD4 A;  3MZH A;  5IOY A;  2KIQ A;  1FBQ A;  3I4P A;  4LIT A;  3PFY A;  3TP0 A;  3I54 A;  2CH0 A;  2HQA A;  2XAJ A;  1JKR C;  3GTO J;  1OCP A;  2ZFW A;  3S14 J;  3L09 A;  2PQ8 A;  1HW2 A;  4UY8 I;  4U7D A;  2L4A A;  4OIO F;  1ZR4 A;  3DTI A;  2F4M B;  4XN0 A;  2O3F A;  2V79 A;  4BQN A;  3H0D A;  2IJL A;  4G94 A;  2ZME B;  3DBL B;  2XF7 A;  3L7W A;  2ELH A;  1ZG5 A;  1X2M A;  1ZLJ A;  3G3Z A;  3HGY A;  3LFU A;  1JTY A;  1Z0X A;  1QQI A;  1Z9C A;  1SD7 A;  1UHS A;  3LA2 A;  3GXO A;  1O57 A;  3U9G A;  2HQN A;  4B09 A;  4E7Z A;  4E7I A;  3RJP A;  2D1H A;  5M5X J;  2R5Z B;  2H8R A;  2DOE A;  2H1L A;  4FX4 A;  3OYD A;  2PJR B;  5K7Z A;  4RAG A;  4EGY A;  2M7B A;  3P9I A;  3E7L A;  3CF2 A;  4AIK A;  1FP2 A;  3LQQ A;  3ZR8 X;  5H6R A;  3DQV C;  2PMZ A;  3I64 A;  1IRF A;  2XB5 A;  4RAF A;  2WAD A;  1FJL A;  5TGT A;  4H4K C;  5KAI C;  5LHG A;  2RC4 A;  1FNN A;  1EJ9 A;  3WOD F;  3IH4 A;  4U7B A;  1ZTR A;  4C9Y A;  3I55 I;  1QPM A;  3ZCO A;  3WGI A;  3WE2 A;  5TJJ A;  1RNL A;  2JA7 J;  3QU3 A;  4XLC A;  5FLM J;  1Y6I A;  4IZZ A;  1MBE A;  3I4N J;  2JSP A;  4CXF A;  2JMW A;  3K4N A;  3S16 J;  3E6B A;  3E97 A;  3L9F A;  3IC7 A;  1BL0 A;  4L9J A;  4EV0 A;  5HNF A;  1X1C A;  3HPH A;  3HOX J;  4JX4 A;  2JPB A;  3J7Y J;  1FWZ A;  1HCR A;  4G8X A;  3MZY A;  1WVR A;  2ESH A;  1K83 J;  2EBI A;  3CC2 I;  1GXQ A;  3NQO A;  2VIX A;  3D5L A;  2LR8 A;  1E17 A;  1MJ9 A;  2R5Z A;  3K7A J;  1E2X A;  5DUK A;  3HOV J;  2ZXI A;  1A6I A;  1XDU A;  2KKO A;  3DWL E;  4BAY A;  1LJ9 A;  4H0E A;  1ITY A;  2VAS A;  3IWF A;  4DBQ A;  1EV7 A;  4AUX A;  1RKT A;  2Y0S A;  1IN7 A;  3CMM A;  5AON A;  4C30 A;  2XSJ C;  3ASO H;  1BOA A;  4P9F A;  3WGH A;  5B1A H;  1BM9 A;  3BTI A;  3V4G A;  1H0M A;  4X6A J;  4WXC A;  2MSY A;  5GTI C;  4PSW A;  1FC3 A;  3NRV A;  2M8G X;  4HA8 A;  1J09 A;  3DBR B;  4N9I A;  2LY9 A;  3VPR A;  2UXN A;  4BBR J;  3QPL A;  2K7L A;  1G3Y A;  4KFC A;  4HX7 A;  3VYR B;  2AS5 F;  4NUB A;  1IZ1 A;  4GO1 A;  3SJM A;  5IYD J;  2LVS A;  3KZI C;  2L4M A;  1I50 J;  2L7K A;  3CJT B;  3FXU A;  2LP0 A;  4DYQ A;  2AHQ A;  3I71 A;  2IXS A;  2OPT A;  2XGE A;  3JRA A;  5K7H A;  1SFK A;  1TQI A;  2RNG A;  3BR0 A;  4KA4 A;  1P4A A;  3QPS A;  3RZO J;  3BZC A;  3CO6 C;  3G1O A;  4ZH4 F;  2KJB A;  5GTH C;  2OF7 A;  4A0Z A;  1VQO I;  3K70 C;  2FBH A;  2MC4 A;  3HYI A;  4LB5 A;  4XNF A;  5TRD A;  3QPH A;  5EEG A;  1A35 A;  4K2E A;  5IYC J;  4XKB A;  3CLO A;  3KFW X;  4GDF A;  3LSG A;  3KE2 A;  2NVT J;  3TDU C;  2OCC H;  1IC8 A;  1HLV A;  4GYI A;  1XDS A;  1J9I A;  2EA4 A;  2KP6 A;  1GLN A;  1XCB A;  1T98 A;  3QWL A;  1IRX A;  2ACJ A;  2ME0 A;  4J01 A;  2PMZ N;  3DKW A;  1UG0 A;  4A6D A;  1CF7 B;  1U9O A;  1YIO A;  4OAZ A;  1JE8 A;  3GME A;  5DM7 F;  4WXD A;  5IP7 J;  5LBQ A;  4ITV A;  2GAU A;  1I3A A;  3DTK A;  4CCO A;  3A03 A;  1KA8 A;  5JI6 A;  5BPI A;  3FX3 A;  4CSW A;  2JSC A;  3ZQI A;  4E4H A;  4MTD A;  1ETW A;  3CDH A;  3WTS C;  2A68 F;  3M4O J;  3IRQ A;  1HW5 A;  5L3F A;  2BE5 F;  1R23 A;  3A01 B;  1GXP A;  4UUT A;  5CPR B;  1E3H A;  4YIR X;  1YIJ I;  2GBY A;  1PYV A;  1OCC H;  5CYV A;  2CQQ A;  3JRG A;  2ZJ2 A;  1ZAR A;  2VC1 A;  1SD6 A;  5B3S H;  5KCM A;  1T38 A;  2E5Z A;  3CUQ B;  4EMS A;  3F22 A;  1BW6 A;  3CCU I;  2LBF B;  3GTQ J;  2E5N A;  1UST A;  2NAZ A;  2E71 A;  5K1Y A;  1FTZ A;  4IHT A;  2HFH A;  2A61 A;  2KIM A;  1Z7L A;  1BN5 A;  1JGG A;  2XPV A;  2E2J J;  1HBX G;  1TTY A;  2DT5 A;  2M3A A;  2EIJ H;  1WJE A;  1D1B A;  1TWF J;  3CD6 I;  1IV6 A;  1EF4 A;  4II3 A;  4A12 A;  3OL4 A;  5B66 C;  3SHF A;  2G9W A;  2GIZ A;  2IP2 A;  5ICC A;  1TNS A;  2Y0S N;  2A6E F;  2HQ5 A;  3S2H J;  1SD5 A;  4RA2 A;  3F8M A;  1RUN A;  1X1B A;  1YLF A;  2KRH A;  1ZRE A;  3IP4 B;  5F0C A;  3NEU A;  2MFZ A;  2NNY A;  5KVR A;  1CGP A;  2XAG A;  1VQ5 I;  2K3F A;  3KEQ A;  1DUX C;  2XKO A;  3GLL A;  5HDG A;  3IRR A;  2O8K A;  1A5J A;  2IBD A;  5LGU A;  1BJZ A;  1B4A A;  2LC2 A;  5DCM B;  3S8P A;  3WTU C;  4RB3 C;  3LSI A;  1I6X A;  2R7R A;  1DQU A;  3GTK J;  2IT0 A;  2CUE A;  1MBH A;  2PG4 A;  1FSH A;  3DBH B;  2E7W A;  2MH9 A;  1X3W B;  2XF6 A;  2O7O A;  2Q2E A;  3F8N A;  4A3J J;  1LEA A;  1H8A C;  2LMD A;  5TIS C;  3G71 I;  4UUS B;  3FKI J;  3PIP F;  4PFP A;  3HOY J;  3GFM A;  1U5T C;  2H1K A;  2DAO A;  3RKX A;  3CES A;  3ZMV A;  4CZZ A;  5F1R A;  4LOC A;  2LSO A;  5K5O A;  3S1Q J;  4L5E A;  1BI3 A;  1D8J A;  2PX9 A;  1YW9 A;  3PSI A;  1Z3Y A;  3KCC A;  4B3A A;  4ESJ A;  3L2U A;  1ETX A;  3F3X A;  4XR6 A;  2VKD A;  1IN5 A;  2R7O A;  3PNT A;  1EH7 A;  1W5T A;  2LH9 A;  1R58 A;  3OIO A;  3QYF A;  3LNQ A;  1V5E A;  3M1E A;  4HPQ A;  3K2Z A;  4M3D A;  2I8D A;  2BHY A;  5FKK A;  2JA6 J;  1IN4 A;  2JA5 J;  3TO7 A;  2UUZ A;  4M9Z A;  1QZZ A;  1R9T J;  5IP9 J;  1OCZ H;  4XKW A;  3BG5 A;  4I02 A;  1B8I B;  3KET A;  1BOB A;  2E2I J;  4RDU A;  4CO8 A;  3HOU J;  2H6C A;  4MO7 A;  3GO5 A;  5LRR A;  3VOE A;  2L7Z A;  1IV8 A;  3LOC A;  5ED4 A;  3W6V A;  1TQP A;  2CQ7 A;  2E36 A;  1KQ9 A;  4IHS A;  4ZC3 A;  3PIO F;  2MGQ A;  1YX5 A;  5DCM A;  3VDX A;  4YEJ A;  4PSX A;  1W1W E;  4NB5 A;  4M6V A;  4M6Y A;  3H35 A;  2MLG A;  2L9R A;  3BG9 A;  3DXJ F;  2JUC A;  4KIC A;  2VQG A;  5D6F A;  3F23 A;  2CWE A;  4Y4R A;  1XGN A;  1SMT A;  3C18 A;  4UUS A;  2VOP A;  2YU9 J;  2BZT A;  1Y1V J;  4MFE A;  5HDK A;  2HEO A;  2IA0 A;  2MYS A;  2L7M P;  4CUG A;  3MFK A;  3KP7 A;  4A3M J;  4OIP F;  2WC2 A;  3HKZ A;  2VUM J;  1DGW Y;  3A0H C;  2P81 A;  1Z77 A;  3J80 K;  2QWW A;  4F7Z A;  2QEX I;  4I76 A;  3TO6 A;  4PCQ A;  1L3L A;  4KIB A;  1MJA A;  2K27 A;  3BCA A;  1SFE A;  2GWR A;  2QLZ A;  2XRL A;  2YX4 A;  4U0V A;  3DCF A;  4S05 A;  1LFU P;  2IRF G;  2VC0 A;  3R60 A;  1HA8 A;  2BBY A;  2K3P A;  2WY8 Q;  2YSR A;  1H9T A;  2K40 A;  3BTL A;  4F3Q A;  1TQM A;  2TDX A;  2R7S A;  2QQ9 A;  4FQG A;  1FT9 A;  2ID3 A;  3RTR A;  3SZG A;  1Z3X A;  3U1D A;  1FYK A;  1OYI A;  3IKV A;  5J8F A;  2HNH A;  3H9Q A;  1ZLK A;  3LFK A;  1MBF A;  1BI1 A;  3BPX A;  3WTY C;  4MEX F;  3L2R A;  4BXX J;  3H5R A;  2XPW A;  4UVC A;  3M07 A;  1FEX A;  4HDV A;  1QO0 D;  1EH6 A;  3AG3 H;  2Z9O A;  3K4K A;  4AIH A;  4E7J A;  4WF2 A;  2DTZ A;  2QQB A;  3MEX A;  3E3V A;  1HKQ A;  2R92 J;  2RDP A;  3GTG J;  3K70 D;  4RB0 A;  3G1L A;  2PJP A;  2L9V A;  2XRO A;  3G1M A;  4L9T A;  3RI4 A;  3QOP A;  2A5W A;  2CS3 A;  3ZQL A;  2ME6 A;  1SVM A;  4MGR A;  5F6F A; 
#chains in the Genus database with same CATH homology
 3OSF A;  3JRB A;  2X48 A;  1ZK8 A;  1IDZ A;  5M5Y J;  3A01 A;  3TW6 A;  2GLO A;  2DN0 A;  2XGC A;  1XG1 A;  5GPC A;  5C3E J;  1MH4 A;  1LE8 A;  2E2H J;  3JRF A;  2LLK A;  1ZGW A;  2LTP A;  2XGD A;  3BR1 A;  1G2H A;  1DU0 A;  3FK7 A;  3RKQ A;  3FIS A;  3S15 J;  1SFO J;  3ZQF A;  2NVX J;  5F1J A;  3HGG A;  4QTR A;  2JN6 A;  4D5F A;  1IGN A;  2NS7 A;  5M3F J;  3GBG A;  1TWC J;  2VI6 A;  5C4J J;  4IHV A;  2NOG A;  1RPW A;  4DYR A;  3TP3 A;  2DMU A;  1GDT A;  2LKX A;  1D5Y A;  1VI0 A;  2KT0 A;  2EZK A;  1AKH B;  3WHB A;  2D5V A;  2EZI A;  3MKL A;  2CU7 A;  1JT6 A;  2YUS A;  2NS8 A;  4FTH A;  4X1E A;  1QRY A;  5IPA A;  3HOW J;  3BQZ A;  4FE4 A;  2HDD A;  4A3B J;  5IOY A;  3TP0 A;  1JUS A;  2CRG A;  4IHX A;  1JKR C;  3GTO J;  1OCP A;  3S14 J;  2LK2 A;  4XRM A;  1O4X A;  1WCM J;  4QIW N;  2L0K A;  5FKO A;  4IHW A;  4XRS A;  1NK3 P;  5EGO A;  2ID6 A;  1ZR4 A;  1E3O C;  2IAI A;  3HKZ N;  2JA8 J;  3B6C A;  1GVD A;  5E3O A;  3LSR A;  3BR5 A;  1X2M A;  3HGY A;  4Y7N J;  2HXO A;  3H3V K;  4C3I J;  1JTY A;  1Z0X A;  3MN2 A;  5C4X J;  3CQZ J;  3NAR A;  1UHS A;  1NTC A;  1JUP A;  3IH2 A;  4C3H J;  5M5X J;  2R5Z B;  3QQA A;  2H8R A;  2FQ4 A;  5F27 A;  3HM5 A;  1ETK A;  1T33 A;  2TCT A;  5K7Z A;  3HEF A;  4C3J J;  3H0G J;  3E7L A;  2IEK A;  2DA1 A;  4A3F J;  4A3C J;  2Y9Y A;  2CJJ A;  1TC3 C;  3JRD A;  1NK2 P;  2QCO A;  3BR6 A;  1ZKG A;  1CQT A;  2XB5 A;  1FJL A;  1I3Q J;  1MNM C;  3GTL J;  5F0F A;  1X2N A;  1JKO C;  2MG4 A;  1JJ8 C;  3IH4 A;  1B8I A;  2R7Z J;  1ZTR A;  5IYB J;  4D7N A;  4M3E A;  5EG0 A;  3OSG A;  2JA7 J;  2O9L A;  1WI3 A;  5FLM J;  1MBE A;  3JRH A;  3I4N J;  4D7M A;  2FJ1 A;  2JMW A;  2Y31 A;  1B72 A;  3S16 J;  4M3G A;  1JTX A;  1VF9 A;  1P7J A;  1SAN A;  1BL0 A;  1IJW C;  3HOX J;  4JX4 A;  4XID A;  1HCR A;  5FLV A;  4A93 J;  2CQX A;  4ABZ A;  1K83 J;  2EBI A;  5M5W J;  2LR8 A;  2E1O A;  3TW7 A;  3IH3 A;  1PUF B;  4HNV A;  2JWT A;  3L1P A;  1WH5 A;  2R5Z A;  3K7A J;  3HOV J;  3UKG A;  1A6I A;  1X58 A;  4DYC A;  3GTM J;  4C2M J;  2Y9Z A;  1ITY A;  4AUX A;  1RKT A;  5J1Y A;  3JRE A;  4NDL A;  1W0U A;  4B4C A;  3Q3S A;  3BTI A;  4S0H B;  3S17 J;  4X6A J;  2MSY A;  2N8G A;  3JRI A;  3ZQG A;  4A3K J;  5EF6 A;  4A3E J;  2M8G X;  3BT9 A;  2HOT A;  2LY9 A;  1LFB A;  3VPR A;  4BBR J;  4J19 A;  3JR9 A;  3QPL A;  2ELK A;  1FTT A;  5EEA A;  3HOZ J;  3SJM A;  5IYD J;  2FD5 A;  2LVS A;  4XK4 A;  4A69 C;  1I50 J;  2DMQ A;  3HB9 A;  1MH3 A;  3LSP A;  2LP0 A;  2R93 J;  4DYQ A;  2AHQ A;  3JRA A;  1YRN A;  2OPT A;  2XGE A;  5K7H A;  3BR0 A;  2R5Y B;  2Y30 A;  3QPS A;  4A3G J;  4EEF G;  3RZO J;  3G1O A;  5GP9 A;  4D5C A;  4A3L J;  1ETQ A;  2OF7 A;  3PO2 J;  1JT0 A;  5FKL A;  1ETO A;  3D1N I;  1K61 A;  1IDY A;  3CDL A;  1U78 A;  1HF0 A;  5E3L A;  2VKV A;  3ZOB A;  4M3B A;  5IYC J;  3GTJ J;  3OOU A;  1WH7 A;  3LSG A;  1ENH A;  2NVT J;  2QF7 A;  1WPK A;  1IC8 A;  1HLV A;  2HOS A;  1UMQ A;  2WAQ N;  3F0C A;  2DJN A;  2AO9 A;  5FJ8 J;  5F0H A;  2ME0 A;  2PMZ N;  1ETY A;  5E3M A;  1U9O A;  3FK6 A;  5GPA A;  3BG3 A;  1U8B A;  2ZB9 A;  2ECC A;  5IP7 J;  2R0Q C;  1HOM A;  3LSJ A;  1W0T A;  1IRZ A;  1I6H J;  3A03 A;  2RAE A;  2DA2 A;  2VPR A;  3Q0U A;  5M3M J;  5FKM A;  1ORK A;  3ZQI A;  5DS9 A;  5EDN A;  1AKH A;  1ETW A;  5J3L A;  3M4O J;  4BKX A;  3A01 B;  1GV2 A;  4UUT A;  1TWA J;  1LE8 B;  3HBL A;  2GBY A;  5E3N A;  2CQQ A;  3JRG A;  5F04 A;  1Y1W J;  2EH3 A;  1MBK A;  3BTC A;  2R5Y A;  3JRC A;  1BW6 A;  3GTQ J;  2K9N A;  3B6A A;  4DZJ A;  1FTZ A;  2EQR A;  4XRS G;  1VFC A;  4AYB N;  1JGG A;  2XPV A;  2E2J J;  3I4M J;  4AC0 A;  3RZD J;  1F36 A;  4MFD A;  1TWF J;  1EF4 A;  4W97 A;  1IV6 A;  3BR2 A;  2NVY J;  2CUF A;  2Y0S N;  5C44 J;  2HQ5 A;  4CYC B;  3S2H J;  2G0E A;  1BW5 A;  4QSH A;  1HDD C;  5IP6 A;  3BTJ A;  5K7F A;  3CCY A;  3S1N J;  2DA5 A;  2M34 A;  5F0C A;  4A3D J;  5JLW A;  5F08 A;  1ETV A;  2VKE A;  1RR7 A;  3RQI A;  1DU6 A;  3SFI A;  1A5J A;  1GUU A;  2FX0 A;  1JKQ C;  2O8K A;  2IBD A;  5EGO B;  2DMN A;  1BJZ A;  1MBG A;  5EYR A;  2LFB A;  1WGX A;  3S1R J;  4M3F A;  4W1U A;  4JX5 A;  1ZR2 A;  4BY1 J;  3GTK J;  2CUE A;  1MBH A;  2W48 A;  2WV1 A;  5HOD A;  3DEW A;  2O7O A;  4A3J J;  1H8A C;  2X6O A;  1MSF C;  4GFB A;  4UUS B;  3IV5 A;  3FKI J;  3HOY J;  2DA7 A;  4JP0 A;  2H1K A;  4FCY A;  1QVU A;  3S1Q J;  4LOC A;  4L5E A;  1HDP A;  5J1U A;  2I10 A;  4B3A A;  1ETX A;  2Y2Z A;  2XB0 X;  3K2A A;  1P7I A;  2HI3 A;  4RBO A;  3PM1 A;  2DMP A;  3OIO A;  5DTD A;  2JK3 A;  3LNQ A;  2XPU A;  4M3D A;  1VND A;  5FKK A;  3TED A;  2JA6 J;  4IEJ A;  2JA5 J;  2K9Q A;  1H88 C;  2JJ7 A;  1H89 C;  1IG7 A;  1R9T J;  1XS9 A;  5EZH A;  1S7E A;  5IP9 J;  1Q1V A;  4XIC A;  4CYC A;  3Q0W A;  3BG5 A;  1B8I B;  1OJL A;  2DMT A;  2L7F P;  4MIM A;  4RDU A;  2E2I J;  3S1M J;  3HOU J;  1TWH J;  4MO7 A;  4V2G A;  5EG0 B;  4A3I J;  1PUF A;  1MSE C;  3W6V A;  2L7Z A;  3LOC A;  3GTP J;  1RES A;  3BQY A;  1QPI A;  5BNG A;  4JYK A;  2MGQ A;  2X9D A;  1MBJ A;  2M0C A;  2DA6 A;  1B72 B;  2HOA A;  2ECB A;  2WB1 N;  4Y52 J;  2NVQ J;  4M6V A;  3NAU A;  1FIA A;  2L9R A;  3BG9 A;  1APL C;  2GM4 A;  2K9S A;  4B1R A;  4V2F A;  4DW6 A;  4G12 A;  2EZL A;  1IUF A;  3O8G A;  4UUS A;  2YU9 J;  2MW8 A;  1Y1V J;  2E19 A;  4MFE A;  1RKW A;  3BR3 A;  3MVP A;  2DA4 A;  2L7M P;  4A3M J;  3PO3 J;  1QVT A;  2VUM J;  4IHY A;  2M2E A;  3ZQC A;  2P81 A;  1Z77 A;  2HYJ A;  4I76 A;  4FE7 A;  1POG A;  4DZP A;  1ZQ3 P;  2EZH A;  2XRL A;  4BY7 J;  3DCF A;  1LFU P;  1TWG J;  3S2D J;  5IOZ A;  2K40 A;  1BA5 A;  1GT0 C;  3BTL A;  1JKP C;  1UG2 A;  3C2B A;  1AHD P;  1OFC X;  3ZQH A;  5EZG A;  1JJ6 C;  1XC5 A;  2B63 J;  2HXI A;  3A02 A;  4BBS J;  2YS9 A;  2ID3 A;  1RET A;  2DA3 A;  2KDZ A;  1FIP A;  4MLO A;  1MBF A;  5JLX A;  4JX6 A;  1YRN B;  2TRT A;  4BXX J;  1JUM A;  4I6Z A;  2XPW A;  3SDG A;  1OCT C;  2LD5 A;  1FEX A;  2COB A;  2XSD C;  3FIW A;  1F43 A;  2M9H A;  3M3Y J;  4FIS A;  2DTZ A;  3HDD A;  1AU7 A;  1U9N A;  2R92 J;  3CMY A;  5FKN A;  3GTG J;  9ANT A;  5J1R A;  1GV5 A;  3WHC A;  3G1L A;  3G1M A;  1T56 A;  3ZQL A;  2ME6 A;  3Q0V A;  3O8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...