5M3MJ

Free monomeric rna polymerase i at 4.0a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m3mJ00
1JUSA 1GUUA 2EZKA 1MBFA 2ME0A 2XGEA 5EG0A 4XRMA 4JX4A 1ETQA 1U9OA 5FKOA 2ID6A 5JLXA 2O8KA 3SJMA 3K2AA 2DJNA 1ETOA 2LKXA 2EQRA 3ZOBA 2K9NA 3BR0A 3JRIA 1BA5A 3B6CA 4BY1J 4XICA 3RZOJ 4X1EA 2XSDC 1JJ8C 1APLC 3BR3A 3RZDJ 1O4XA 5M5YJ 1JT6A 3OSFA 1LFUP 2NVTJ 2YS9A 3TW6A 1Z77A 5IYDJ 1RETA 1QPIA 2X48A 2COBA 1AU7A 5F0CA 5F08A 2L0KA 5EYRA 2ECBA 1PUFA 4DZJA 1FTZA 5EZGA 4DZPA 2HXOA 4FISA 2MG4A 4QIWN 2FD5A 5C4JJ 1FJLA 3W6VA 1T33A 3K7AJ 5F04A 3LSJA 4DYCA 3Q3SA 3Q0UA 3QPSA 4RDUA 2PMZN 1B8IB 2M8GX 2CJJA 1JKRC 2JA5J 3A03A 5C4XJ 1LE8B 5E3MA 4EEFG 4A93J 4QTRA 1WH5A 4NDLA 1TWCJ 5GPCA 1R9TJ 2RAEA 1W0UA 4BXXJ 1TWGJ 4A3KJ 5C44J 1I6HJ 5EF6A 3S2DJ 3HBLA 3OOUA 1YRNB 4DW6A 4IEJA 2XPUA 2YU9J 9ANTA 2JJ7A 5IP7J 1MBGA 4XRSA 1TWAJ 3UKGA 2GLOA 2ECCA 3BR6A 1TC3C 1RR7A 5FKNA 1NK2P 1S7EA 4D5CA 4D7MA 3QPLA 1ZK8A 4CYCB 1FEXA 4DYRA 4L5EA 4C3JJ 3ZQHA 1NK3P 2DMNA 3PM1A 3GTMJ 3C2BA 1AKHB 3FKIJ 4DYQA 4A3FJ 3S14J 1FTTA 2JK3A 1MH4A 2VPRA 3HEFA 1ETWA 2M34A 2DA2A 4B3AA 1OCPA 2QCOA 3IV5A 4BY7J 1P7JA 1VNDA 3HOUJ 4M3GA 1Y1WJ 2ME6A 2Y30A 5EGOA 4LOCA 1OJLA 2Y0SN 3RQIA 1JKPC 3JRBA 1H88C 5K7ZA 3JR9A 1JGGA 2E2JJ 2K9QA 3RKQA 5J1YA 2DMQA 2JMWA 1A6IA 2CRGA 3HGGA 2MSYA 1F43A 1DU0A 2AHQA 2R5ZA 1AKHA 2R93J 4A3CJ 2E1OA 4FE4A 1ZR4A 3FK6A 2CQXA 3MVPA 2ELKA 1MSFC 1WGXA 2WV1A 2JA8J 4A3BJ 3BTIA 3H0GJ 3SFIA 3ZQGA 1F36A 2QF7A 3LNQA 2H8RA 3BQYA 2E2IJ 1WH7A 1ZKGA 2IBDA 2IAIA 3IH3A 3O8GA 3OSGA 1ZQ3P 3ZQIA 2XGCA 1W0TA 1JUMA 1CQTA 3F0CA 5EEAA 4C2MJ 1X58A 2P81A 2M0CA 3B6AA 1SANA 2HOSA 4ABZA 3S15J 5DS9A 1IDZA 1JTXA 4J19A 2R5YB 1B72B 4IHXA 5IOYA 2HYJA 5FJ8J 5BNGA 2B63J 1I3QJ 2E2HJ 4IHVA 1UHSA 1ETXA 5C3EJ 1E3OC 1TWHJ 3GTQJ 3O8HA 1GT0C 2NVYJ 4AYBN 5GPAA 2EZIA 2K9SA 2DMPA 4XIDA 3CCYA 5E3LA 4AC0A 1K61A 3MN2A 2D5VA 1X2NA 3M3YJ 5IP9J 3MKLA 3HOZJ 3FISA 2Y9ZA 2IEKA 3GTKJ 2DA1A 1IV6A 2FJ1A 2DA4A 2WB1N 3GBGA 5IYBJ 3JRGA 1GV2A 2LVSA 2LK2A 5IYCJ 4IHWA 1FIPA 2EH3A 5EZHA 5DTDA 2FQ4A 2VI6A 5M3MJ 4A3GJ 1MNMC 2R0QC 4XRSG 1G2HA 4MFEA 5IPAA 1QVTA 1BJZA 1GV5A 3BG9A 1T56A 3NAUA 5FLVA 3HOXJ 3BR5A 2R7ZJ 4FTHA 1QVUA 2DA7A 2LR8A 1JKQC 2OPTA 3HKZN 4BBSJ 1B8IA 3G1MA 2LFBA 3JRHA 1LE8A 2M9HA 2KT0A 4AUXA 1JT0A 4A3LJ 1HLVA 2L9RA 4I6ZA 3HM5A 1K83J 2DTZA 3BR2A 2LD5A 5F27A 1LFBA 2JA7J 2XRLA 3S1MJ 4UUSB 2TRTA 2Y9YA 1ETKA 2NVXJ 1U9NA 1Z0XA 3QQAA 2NS7A 2VKEA 4B4CA 1ZGWA 2DMTA 3JRCA 1YRNA 2XPVA 3HGYA 1ENHA 3NARA 4M3BA 1X2MA 2LP0A 2I10A 3A01B 2MW8A 3CQZJ 5J1RA 1HCRA 5E3NA 5FLMJ 3BG3A 3D1NI 3HOYJ 2LTPA 4M3DA 4CYCA 4JX6A 3Q0VA 2XGDA 3L1PA 5FKMA 3FIWA 1ZTRA 4S0HB 2L7MP 2JA6J 3HDDA 3S1NJ 4XK4A 3IH2A 5EG0B 2CUFA 1IDYA 1DU6A 3BTCA 3DEWA 2HI3A 2YUSA 4MO7A 2OF7A 1ETVA 1H89C 4Y52J 4IHYA 1MH3A 3ZQFA 4BKXA 1WPKA 4W97A 1A5JA 5F0HA 2HOTA 2ID3A 3IH4A 3VPRA 4A3DJ 4C3HJ 3GTLJ 5K7FA 2M2EA 1BW5A 3HOVJ 1IRZA 4MFDA 4MLOA 1Q1VA 4I76A 1VFCA 4A3JJ 3S16J 3S1QJ 2LLKA 1JUPA 2NOGA 3TEDA 1RKWA 1HDDC 2XB5A 5IP6A 3G1LA 2L7ZA 3HB9A 1MBJA 3S1RJ 1OCTC 5HODA 2CU7A 4QSHA 1PUFB 2Y31A 3BQZA 5IOZA 5F0FA 3BTJA 1ETYA 5FKLA 2DN0A 4HNVA 1IGNA 2VKVA 2H1KA 1BW6A 3S2HJ 1XS9A 1QRYA 2G0EA 1U8BA 1MBHA 3Q0WA 2L7FP 1SFOJ 1BL0A 4W1UA 4D7NA 2AO9A 5J3LA 3A02A 3WHCA 2CUEA 3JRAA 5M5WJ 2HOAA 4MIMA 3I4MJ 3JRDA 2LY9A 2R5YA 1B72A 1ORKA 5EDNA 3PO3J 5E3OA 3TP3A 2DA6A 2DA3A 3I4NJ 5FKKA 1RKTA 1MBKA 2TCTA 4M3FA 2DMUA 2Y2ZA 1MSEC 3BG5A 2MGQA 4X6AJ 3WHBA 5GP9A 4V2GA 2O7OA 1MBEA 3LSGA 5JLWA 1HDPA 3TW7A 4GFBA 3E7LA 5K7HA 1TWFJ 3FK7A 1ZR2A 2JN6A 5M5XJ 2GBYA 2NS8A 3LSPA 2EZHA 4FE7A 4V2FA 4JYKA 2NVQJ 3ZQCA 3BTLA 1ITYA 1VI0A 4RBOA 2GM4A 2HDDA 1U78A 1IUFA 2W48A 1AHDP 1P7IA 3OIOA 1D5YA 3JRFA 2O9LA 5F1JA 1JTYA 5EGOB 2HXIA 4M3EA 3M4OJ 1FIAA 1I50J 3CMYA 1POGA 2DA5A 4FCYA 2VUMJ 4D5FA 3BR1A 2WAQN 4JX5A 2R92J 3GTOJ 1UMQA 4A3IJ 4B1RA 2CQQA 3LOCA 3G1OA 2R5ZB 1H8AC 1Y1VJ 1JKOC 4UUTA 1HF0A 3SDGA 3DCFA 1WCMJ 1UG2A 2ZB9A 1RPWA 3HOWJ 5M3FJ 1RESA 2N8GA 1JJ6C 4UUSA 2X6OA 2KDZA 1IG7A 3TP0A 1WI3A 1IJWC 2E19A 1VF9A 1NTCA 1OFCX 2EBIA 4A69C 4Y7NJ 3LSRA 3BT9A 2X9DA 4A3MJ 4BBRJ 2EZLA 4C3IJ 5J1UA 3PO2J 2JWTA 2HQ5A 2K40A 3H3VK 3GTPJ 2XB0X 4G12A 3S17J 3A01A 2XPWA 1EF4A 1XG1A 4JP0A 3JREA 3CDLA 4M6VA 2FX0A 4A3EJ 3GTGJ 3ZQLA 1GVDA 3GTJJ 1IC8A 1HOMA 1XC5A 1GDTA
chains in the Genus database with same CATH superfamily
4LB6B 1VQ6I 1IN5A 2EZKA 2H6CA 3DEEA 3PNYA 1IV8A 2Q8KA 5EG0A 4JX4A 1ETQA 3LAPA 3OYFA 2ID6A 3DKYA 3QWLA 2DYRH 5AIPA 2RVCA 2E1MB 2O8KA 5GAEJ 1UHMA 1XGOA 1X1AA 1IXCA 3HRTA 4AIHA 3AFHA 1OQYA 1UB9A 3BR0A 3B6CA 2KFDA 1O7FA 1IN4A 2RREA 4X1EA 1MDMB 1UAAA 5KHDA 1ZLKA 3BJOA 1JJ8C 2F2EA 2VBXA 1O4XA 2DFIA 1QZYA 4CCOA 2O8XA 5JHUA 2UXXA 2YS9A 1S7AA 2LRDA 2X48A 2COBA 3K0LA 1AU7A 2E7XA 1BIAA 2VC0A 2A07F 5EYRA 2EIJH 3B02A 4Q47A 4L9TA 2ISYA 3CLOA 3BG6A 2ZXIA 4NQWB 1QO0D 4GXOA 1FJLA 3J7AO 2R7DA 2FQ3A 3P9KA 5DUKA 2CFXA 5F04A 2ADUA 1WJBA 2DCEA 2JPBA 2PMZN 3ZQQA 1XSDA 2M8GX 3RKXA 5KK1A 2CJJA 4LIUA 3CDHA 1T98A 3F8NA 2K7LA 4NDLA 2LH9A 1STZA 1IO2A 3KLNA 4A12A 4P96A 3CCJI 2ZXJA 4XONA 3JTGA 4BXXJ 2L5QA 5C44J 1SFXA 4PFPA 1LPQA 2COMA 2ZNZA 3HBLA 3ROUA 4IEJA 2JJ7A 3KYCB 2F5CA 3GFIA 3JTHA 2ZC2A 3UKGA 1U5TC 4UNOA 1DGWY 3KX2A 4XR6A 4KITB 5FKNA 5ICFA 3HL2A 4D7MA 1K79A 4AIJA 3EYIA 4L9NA 3QPHA 1USTA 2K85A 5J6XA 3IHUA 3GTMJ 3OYAA 3GXOA 4HNTA 3FKIJ 2H27A 3L2QA 3I59A 3CCRI 3RTRA 4FASD 3LA3A 3GEZA 2JA2A 1TBXA 3DEUA 2YSRA 1ETWA 1P4XA 2M34A 3AG4H 4B3AA 1MIJA 2Q2EA 2A5YB 4OOIA 3IV5A 2O3FA 1LVAA 1FYKA 3KZYA 4XORA 3MFKA 1KZHA 5DD8A 3TGNA 2MABA 4EMSA 4IO9F 3MCZA 1F5TA 1SAUA 2Y0SN 1JKPC 5HLTA 5CPRB 1H88C 2FRHA 2X6XA 3AG1H 2PEXA 5K7ZA 1JGGA 4AWXB 5J1YA 2FEZA 2V79A 2XUBA 1VQ7I 2GIVA 3HGGA 2WWYA 2HDCA 3K6GA 2NNNA 3ABKH 1AA7A 3KZZA 1AKHA 3OR1C 4HV5A 2F6CA 3H36A 4FE4A 4XKBA 5CVJA 3REOA 3H0DA 3EDPA 2MFZA 4LITA 2ELKA 3ZMTA 1I6XA 5KAFC 1BI2A 4KDPA 4CA0A 2JA8J 4A3BJ 1PJRA 3OL3A 4HG2A 3HPGA 4A0YA 1F36A 2BVMA 2QF7A 3FX3A 3LNQA 3CCEI 2KJBA 2E2IJ 2IAIA 4IPAA 4LJZF 2LY2A 3V4GA 4ZYHA 3OSGA 1XGMA 1JUMA 2B0LA 5AONA 3OYKA 4YFKF 3F0CA 3OIQA 3OS1A 4C2MJ 5HLGA 1WVRA 1SANA 1H9GA 2XDVA 1KYZA 1R71A 1Z9CA 1BC8C 1IDZA 4IHXA 1XSVA 3R6SA 5BNGA 3FXJA 2B63J 2WB1A 3ZP5A 3SFZA 5IT9K 1UHSA 5F6FA 2HWVA 1E3OC 1TWHJ 4QPOA 2BHZA 1ACIA 2NVYJ 1WJCA 4G94A 2RV8A 4ZZDA 4AC0A 2ELHA 3E6CC 2Z2SB 3L7WA 4WXHA 3R60A 4ZTJA 2G7HA 3LWFA 4E70A 3U21A 3VFZA 3M3YJ 2BYVE 3RI4A 2IS4A 2X1DA 4AVPA 5H2FC 2UUZA 4N9IA 2Y9ZA 2RKHA 2IGKA 1FMVA 3BJ6A 1MDMA 2LC2A 1IV6A 4KIFA 4G7ZF 2X0LA 5J47A 2JVHA 4KICA 3GZNB 2XRNA 4BJTA 3MZYA 3JRGA 3TO6A 1W4MA 4PCQA 3CO6C 2W24A 1FSHA 4HX8A 2KL4A 5L3GA 4ENKA 5DTDA 2DYSH 1FBUA 1F4KA 2FQ4A 2WC2A 2UZKA 2R0QC 1G2HA 2PBIA 3DP7A 5HDGA 1MMNA 1YW8A 2WAQA 4E4HA 1R49A 2ACJA 4LLGF 1WI9A 1BI0A 1JI8A 1D8JA 1YS6A 2QM3A 2F48A 1FOXA 2M45A 4WK8F 1JKQC 4CICA 2OPTA 4M6XA 4BBSJ 3Q9VA 1B59A 4IZZA 2IA2A 4CYDA 1JT0A 2KT0A 4AUXA 3FZVA 2J5PA 2R7TA 2DTZA 5FFZA 3NWSA 5F27A 3LSMA 1LQ1A 2XROA 1ETKA 1LFPA 3OS0A 5JHFA 1U9NA 1Z0XA 2K9MA 2PN6A 4ANJA 3ZMVA 1VQ8I 2DMTA 5K5RA 3IL2A 2M0MA 2LOOA 1YLFA 3V7CA 4E6KG 3LFUA 1OLTA 4XQFA 2FOWA 5HLHA 3E5XA 3ZXSA 4BACA 5LFAA 1N25A 1X1BA 2MW8A 1B6AA 5D8LB 1OKRA 3HTUA 4BJ5C 3HOYJ 2LTPA 4M3DA 1FC3A 3DBRB 2ZMEC 3D0SA 2F5EA 3L1PA 1OMIA 4KJZA 1ODDA 1D1BA 2FBIA 2FF4A 4HRIA 2KIQA 1XMKA 1E2XA 1IDYA 3MMYB 3WTSC 3QYEA 4M9ZA 2HQAA 1PVEA 1YX5A 2OC6A 2DOFA 2M5WA 4IHYA 5JFRA 1WPKA 4W97A 2HOTA 1MMAA 2ID3A 3ABMH 3VPRA 3C2HA 4MEXF 2WY7Q 4DQ2A 4BGDA 2DU9A 1LEBA 3FM3A 3KPHA 1CGPA 3HHGA 1W7PB 1I5ZA 1UCRA 4CZCA 2E7WA 1IRZA 1Q1VA 2Z33A 4I76A 2RDPA 3K4KA 3M9AA 1VZ0A 4M71A 2K4JA 4UV8A 3CMEI 3L2WA 3PL8A 2KRHA 3DU6A 3M8JA 3C3WA 3TEDA 1V5EA 5GTIC 1HDDC 3LSHA 2XB5A 1X3ZB 3MWMA 4IXAA 1OCZH 3C7JA 4HLXA 3S1RJ 4CDGA 2CU7A 2CFOA 2Y31A 2VQLA 2DPUA 3BTJA 1ETYA 5D5XB 3S3OA 4OMYA 2FE3A 4A2UA 4EM0B 2CG4A 2VKVA 3PNVA 1QRYA 2V1DA 2OQRA 3SZPA 1U8BA 2MBFA 1KU3A 4W1UA 4D7NA 1BL0A 3CP8A 2V9PA 4LLNA 2DQLA 1XGNA 3RCOA 4XRFA 1RRJA 3I4MJ 3WG9A 3AG2H 2YX7A 3AG3H 5D6EA 1FWZA 2GIZA 4YIFA 2ZSHB 1I1SA 4FQGA 2Y2ZA 2VQHA 1X3UA 5EEGA 4F55A 5LGUA 2XVCA 2V1NA 3WHBA 1H9TA 2EPFA 3CLQA 4PSXA 1MBEA 4PJMA 1P2FA 1QA6A 4L18B 1L0OC 1A36A 3M1CA 5HS9A 4GFBA 4IHTA 1G6NA 4N0BA 3BJAA 5K7HA 1MMDA 1Y6IA 1TWFJ 2JN6A 4BH9A 2GBYA 5DV5A 2EZHA 3U1DA 3JSPA 1JXSA 3F8CA 2DOEA 4I01A 4JYKA 1MMSA 1K78B 1WRJA 4BHPA 1FP1D 2HDDA 4II3A 2EFWA 3CMMA 2W48A 3HPHA 3C18A 2QZ8A 3QOEA 2EFQA 2I8DA 2B7EA 2M3AA 3CJNA 4XN3A 2Y0SA 1NHAA 3ZN1A 5B3SH 5F1JA 4CCNA 5D4SA 4D0PA 4B47A 2JUCA 1ZHFA 2FU4A 4AIDA 1LVKA 2WTEA 1RI7A 3DKXA 4DOZA 4AM3A 2MD0A 1D3YA 4D5FA 2LKPA 3BR1A 4JX5A 2X85A 4EM1A 4A3IJ 3A0HC 1NH3A 2IW5A 3T0YA 2CQQA 3SZGA 5CYVA 1H8AC 1G3WA 3HOTA 4NUBA 4DBRA 1VQ4I 4LD5A 4RGRA 3WODF 1E0EA 2R7UA 3RQ4A 1FT9A 3DCFA 3GW2A 1HF0A 2LNBA 4ENMA 4GYIA 4LMYA 4XSXF 1SD4A 1U8RA 1YIOA 2DOAA 4RS8A 2X6OA 3EETA 2Z9OA 2E19A 1MKMA 1U5TB 1NTCA 1F1ZA 4XMYA 2JSCA 2RNJA 4DNCA 2PI0A 3OL4A 3VDXA 2X9DA 4C3IJ 2ZXWH 2K40A 2OCCH 2CO5A 2L02A 4G12A 1WZ2A 2L2OA 1YG2A 3TOAA 1BR4A 4KMUX 1SFEA 2VT3A 1XCVA 2E1NA 2KP6A 4JP0A 1S8NA 2FX0A 2XSJC 4E7JA 3ZQLA 2X6YA 2QUFA 4L9VA 2RQPA 2VC1A 4IX7A 1T0FA 5D8KB 1FLIA 3Q9SA 4MTDA 1U9OA 5FKOA 1RUNA 5JLXA 2CQKA 1HKQA 1C0WA 2BOLA 2MLKA 2DJNA 2LKXA 5E8IA 2EQRA 3ZOBA 3ABTA 3E3VA 3GO5A 4NB5A 3JRIA 2W25A 4G9YA 1WJ5A 4YELA 2W7NA 1TL8A 3DBLB 4KIGA 5EEHA 4XICA 4IJAA 3RZOJ 3GLLA 2GXBA 1O3SA 1ZARA 1PP7U 4JK1X 3WGIA 3BLYA 2GWRA 2VB6A 1K4SA 4DGWB 3RZDJ 2D1HA 1MD0A 3I55I 2IS6A 2DFFA 1Z77A 1XDUA 1QPIA 2A5WA 4LLLA 1W5TA 3E6DA 2XAQA 3BCBA 5F08A 4BDZA 2L0KA 2IA0A 2L3DA 3IP4B 1ON1A 2ECBA 4OIRF 4EQQA 3ZPLA 1R4NB 2W84A 3FXUA 3HYIA 4EJWA 2DXIA 4DZPA 2CW7A 3K1MA 4FISA 2DODA 2MG4A 2VE9A 4J00A 2VJJA 4QIWN 5C4JJ 1O7LA 3TO7A 4H4KC 2E34A 3LSJA 1R1TA 2PJPA 2QKLB 4HX7A 4DYCA 4F93B 3Q0UA 3QPSA 2DLLA 4BE0A 1FPQA 3WU2C 1LE8B 5J8FA 3OV8A 1WH5A 4OIQF 1DPRA 2XASA 1GLNA 5IT9Z 2DJIA 1BI1A 4B44A 2HOEA 1Y56A 2BY3A 1IW7F 4RM3A 1IN6A 4BXFA 4LIVA 1B4AA 1T08B 1D0YA 2BVLA 2RAEA 1KU2A 3OYMA 1W0UA 4A3KJ 1DPUA 4UB6C 2HVQA 1YRNB 2ESHA 4DW6A 2Z99A 3VYRB 2YU9J 2HPMA 1YIJI 2EK5A 4C9YA 3AL0C 1TWAJ 1YW7A 1MJ9A 3KP6A 3J80K 1TC3C 1S7EA 2QBYA 3DLAA 3LAJA 3QPLA 1ZK8A 3N4MA 1V55H 2WAFA 4DYRA 3ZQHA 4HAMA 2A68F 4BAYA 1BR2A 5FD6A 1GXPA 3P7NA 3PUFA 1AKHB 1X1PA 3ERMA 1K78A 3E6MA 4A3FJ 2MLGA 1K6YA 4KUMA 3S14J 2R7QA 3TQNA 2DK8A 3FWEA 2OBPA 3MKYB 1FTTA 2JK3A 2Z5UA 2Y0MA 1DUXC 4F7ZA 2WA0A 4N4NB 5J4YA 1TNSA 1X1DA 1VNDA 5E18F 3V7RA 2ME6A 2Y30A 1GVJA 1IAWA 2PFBA 4R1HA 5ILSA 3JRBA 3V8KA 3JR9A 3K1PA 3OS2A 4DJAA 1T39A 4DBQA 4ZYDA 1TQPA 1QQIA 1ZELA 4HLYA 2Y48A 2CRGA 1S7OA 3CCMI 5BS6A 1FYLA 3SYTA 5ICGA 1DU0A 2AHQA 2AXTC 2XF5A 3BZ6A 1SVLA 1OR7C 1WHUA 2HVRA 2QQAA 2CQXA 4CXFA 2VKHA 1BIBA 3HRMA 4FHTA 3ASOH 4FETA 4P9UA 1WGXA 3VSLA 2FNPA 4KISA 2BGCA 1ZAOA 3SFIA 3ZQGA 2VQCA 2H8RA 3BQYA 3L2RA 4H0EA 1YFHA 1WH7A 1IRGA 4UY8I 1ZQ3P 1U5TA 2QVOA 3WE2A 2QA4I 1W0TA 4BXUA 3L2VA 3MAJA 3LMMA 1VQPI 2P81A 3DWLE 2M0CA 3T1BA 2HOSA 3FM5A 1SVOA 1VQNI 2ZMEB 4KT6A 4J19A 2R5YB 4KA4A 3WTXC 5LRRA 3DXJF 1ON2A 3B73A 3W2VA 2DBBA 3FKJA 1I3QJ 5ICCA 2E2HJ 4IHVA 2A05A 5BPIA 1MNDA 1ETXA 3H9GA 1HBXG 2XAGA 4XLEA 4BE1A 1MMGA 4XOPA 2FSWA 3LA7A 4RLQA 4AYBN 2P7CB 4XIDA 2DMPA 3IWZA 5E3LA 1N78A 1K61A 1A04A 3TMOA 3RKWA 1VQ5I 4CUGA 1O57A 5IP9J 4BHCA 2EIKH 3HOZJ 3K69A 4P1WA 5KAIC 4IQJA 1V3FA 3FISA 3HKZA 2LREA 1FOWA 5CVIA 3H92A 4S04A 4CH7A 5TGTA 2STWA 2VBWA 1D5VA 3GBGA 3OYCA 2AXLA 4CCMA 4KFCA 2LK2A 3CD6I 4IHWA 5B1BH 3CCVI 2E36A 1FIPA 4Y3OA 4AIKA 5EZHA 4IVNA 1U6GA 2CV0A 1TQMA 5CLSA 4WCGA 1J59A 1HKSA 4OIOF 2RGVA 2DT6A 3G71I 4XRSG 2AQEA 1BJZA 2XAUA 3LSTA 4Y15A 1T56A 3NAUA 4LG0B 1S6LA 5JVTA 4Q4ZF 1W7PD 2IGMA 3KYDB 1EJ9A 2M87A 2O6GE 2P0WA 4ZYGA 1REPC 3G1MA 2LFBA 3TO9A 4UB8C 5DDGA 1LE8A 1UELB 4M9SA 1XTAA 2CH0A 4LFUA 1HLVA 2WADA 1G59A 5DEQA 3BR2A 1J7KA 5A2QK 2HKXA 3K4MA 2XRLA 4S05A 5KNLA 3JW4A 2TRTA 3D5LA 4WXDA 4IRIA 2M1BA 2LDUA 3ZQ7A 4B4CA 3JRCA 1YRNA 1NG6A 2E1CA 1KU9A 2FMLA 3HGYA 3DU5A 1EH6A 1IZ1A 1LEAA 1BOBA 2DQRA 4JOMA 1PUEE 2I10A 3I64A 2IT0A 5J1RA 1HCRA 5E3NA 3BG3A 4EJUA 4ZYAA 4AVZA 3I54A 2EINH 3A0BC 3WGHA 1FOYA 5CQEA 3VWBA 1ERDA 3LFKA 3FIWA 2KIFA 3S1NJ 3SEQA 5LGTA 1K4TA 3I4PA 4C2TA 2STTA 2DFEA 3FHZA 2YUSA 4XM3A 2OF7A 1ETVA 4ZC3A 1H89C 2DK5A 2NRAC 2BBYA 1MH3A 2W1OA 1A5JA 4QWQA 5HS7A 2L9SA 5TISC 4HBLA 5HDNA 3GTLJ 2M7BA 5D4RA 2M2EA 4KNYA 4Q48A 1JGSA 3HOVJ 2EFPA 1T2KA 3K4CA 3BPXA 4A3JJ 3ZN0A 3GFJA 1B9MA 1QGPA 1T38A 3CJTB 2FMYA 2ZXHA 3S1QJ 1BC7C 1JUPA 4I09A 2VQGA 2BY1A 1RKWA 1KQ8A 3RYRA 1S29A 1OYYA 4XKVA 2F4OB 3G1LA 4BUPA 1ZGJA 3HB9A 3ML6A 1MBJA 1OCTC 3KCCA 5HODA 4QSHA 1PUFB 2DDBA 3VYUB 1F9NA 2A6HF 3H5RA 1FYMA 4AU7A 1IXRC 3ZR8X 2DN0A 4HNVA 2DFHA 5LHHA 1IGNA 2Y75A 3I58A 3S2HJ 1XS9A 4ZTFA 2VBYA 3K4LA 2LF7A 1MBHA 3Q0WA 2L7FP 2LKSA 3IRRA 1SFOJ 4MEYF 2AO9A 3WHCA 3M1EA 2CUEA 3CF2A 3DKWA 1QZEA 5M5WJ 2E5NA 4MIMA 2GOMA 2ZMEA 3OY9A 4GRIA 1IRXA 5B66C 2R5YA 5EDNA 3IRQA 3OYJA 3MZ8A 3R0AA 4BQNA 2DA6A 2DA3A 3QRFF 2OZ6A 2EFOA 5FKKA 1MBKA 2TCTA 4LB5A 1RUOA 4KN4X 2DMUA 1PP8F 1CF7A 2OTJI 2MGQA 1TW3A 4X6AJ 2X1EA 2VT2A 3RPQA 3TW7A 2GA1A 1TLHB 3IWFA 2BXZA 2B9SA 3N05A 3HSEA 3E7LA 4ASNA 4BEHA 1BI3A 3DBHB 2BXYA 4A6EA 1ZR2A 2MC3A 3WU1B 1R58A 2M7AA 1Z1DA 4CSWA 3PIPF 2NS8A 1J75A 3LSPA 3GYHX 4FE7A 2IGNA 2M4GA 1FNNA 3QU3A 1ITYA 5DYMA 1IUFA 2K02A 3KP7A 2E71A 5LBQA 5L3CA 2HDWA 2ZJPF 4HNUA 3ONQA 1HA8A 5EGOB 1HC8A 2GXGA 1Z6TA 1MJAA 3M4OJ 1POGA 4D1QA 1TP4A 2XC7A 4LG0A 1BBYA 2EILH 2EA2A 3HOSA 1OPCA 2CSOA 3BCAA 2H09A 2KIUA 2VJ5A 4HF1A 1Z3XA 1DGRM 4HSRA 3G3ZA 5FROA 4YEJA 1JKOC 4UUTA 5DCMB 3ZGKA 4GO1A 4XLAA 1WCMJ 4MGRA 4PZJA 2K4BA 2HKOA 4RGSA 3BY6A 1RESA 2VLAA 3AL0B 4BNCA 1JJ6C 1ULYA 1IG7A 3TP0A 1WI3A 2EB7A 1VF9A 2D1VA 3V8LA 2EBIA 3RYPA 3K4JA 3FXMA 3GVAA 1EV7A 4OMZA 3BT9A 2NS0A 2EZLA 3PO2J 2DI3A 5J1UA 3FMSA 1YTYA 5D5UB 3BDDA 2LMDA 2XPWA 2ZFWA 3TKYA 3J81Z 1WJAA 3CDLA 4U88A 3CDIA 4M72A 1FOKA 1G3YA 3GTGJ 1A6QA 1RR8C 1IC8A 1DDNA 1HOMA 3F8BA 3WTVC 4CCKA 1MNEA 1GUUA 3KLOA 4YIRX 2ME0A 5E17F 2XGEA 3OYLA 4XRMA 2FOKA 4XKWA 4HDVA 1D1AA 3VOEA 1LNWA 2KJCA 4I2OA 1E17A 3OYEA 4ON0A 4EJTA 3DLLF 3SJMA 1S9HA 5FGMA 2F4MB 4A0XA 3COAC 3RIRA 2ESNA 2K9NA 3GFLA 1MGTA 1BA5A 1G4DA 3OR2C 1I39A 2PMZA 4BY1J 4ZDPA 2VJIA 1SAXA 5DM7F 2A69F 3FXLA 4HQMA 2O5RA 2JRMA 3K4NA 1YYVA 1AOYA 3F6VA 2CUZA 2XSDC 5M5YJ 3M7GA 3HRUA 4RAZA 1EH8A 2G7UA 3OSFA 1LFUP 4EVIA 3TW6A 2NVTJ 1RETA 3VEPA 1XN7A 4F3QA 3W2WA 5F0CA 2LYCA 4L5IA 1XCBA 5B5EC 3K70C 1Y39A 4BJ6C 1PUFA 4DZJA 3CCUI 5FLXK 1FTZA 2ZJQF 1FBSA 5E1ZB 2KKOA 2EA4A 2W57A 5E20A 3W6VA 1T33A 4ZDOA 2BW3B 4HZFA 2J5OA 2QBYB 1OYWA 1WWXA 2KZGA 3KEYA 4Y33A 4HEA2 1FP2A 1B8IB 4QPQA 5L3EA 1JKRC 2HVSA 3A03A 3SDBA 2HU9A 4A93J 3QPTA 1M1EB 1OCOH 4C30A 5FRMA 4RB1A 5GPCA 4ZJZA 4YG2F 5L3BA 1R36A 5IY5H 5K5OA 2CS3A 1XPXA 2KHMA 4RAGA 3MZHA 2VXZA 1UJ8A 4JBAA 4IL6C 1ONVA 4M9XA 5ERIA 5EF6A 4U7BA 1I6HJ 1LJ9A 4CO8A 3WTTC 2JTVA 5IP7J 1MBGA 3VODA 2W82A 2JSPA 3BC8A 3F9KA 2CQNA 4NC8A 4Y4RA 2O03A 1KQ9A 4KYWA 1RR7A 1NK2P 2V7FA 3OYNA 4CYCB 5LD2C 2VIXA 4C3JJ 1ZRCA 3F8MA 1ZYRF 2R3SA 2DMNA 3K9TA 1TT5B 1V5GA 2L7KA 3CCQI 2AQFA 4DYQA 1XDSA 2CV2A 1VQOI 1LB2A 4MNUA 2CQ7A 2VPRA 2OA4A 3E97A 3HEFA 4KN7X 2ZBKA 4M74A 4ZH4F 2IGOA 2IPQX 1RIOH 1W36C 1OCCH 5JI6A 2W00A 4M3GA 1KU7A 1LKXA 5EGOA 1OJLA 2FBHA 2CWEA 3PQKA 4WF2A 4G7OF 1R00A 2JMWA 3JAMK 1A6IA 2EWNA 3KFWX 2MSYA 4LG3A 2Z16A 1Z67A 2P6TA 3O2PE 5ICEA 4EGYA 2R93J 3FXRA 2E1OA 1ZR4A 5DCMA 1EA3A 3MVPA 3D5RC 3PFYA 1XMXA 1OISA 3CUOA 2ZSIB 3H0GJ 3GX4X 1R23A 1SC7A 1VQMI 3QP6A 2V1UA 4F92B 1G8XA 5K5QA 3J7AY 2BY2A 2FA5A 3IKVA 3NWTA 3ZQIA 4MQVA 3L2CA 2LG4A 3OYDA 1CQTA 4I99C 2QGUA 4BHBA 1HXDA 2HPIA 1Y0NA 3IAM2 3OIPA 3S15J 3I71A 3BP8A 2PG4A 1P6RA 2R7XA 3HUGB 3DV8A 3W3CA 5IOYA 2ZCWA 3LL7A 3TOBA 5BQTA 4IRGA 3DFGA 4ZYEA 3CC2I 3GTQJ 4AD9A 3O8HA 4XLNF 1GT0C 1WSUA 4B8XA 1RZ4A 2L4MA 1WJFA 4G7HF 1YJWI 2HQRA 5GPAA 2EZIA 2HEOA 1O3QA 3CCYA 2DAOA 4L5JA 3MN2A 4XNFA 4L0ZB 2M8EA 1P4WA 3HZJA 3G6EI 3O6BB 4B3XA 1VTNC 3PSFA 2NNYA 3DPUA 1ZG5A 3GTKJ 2IEKA 2NAZA 4R79A 5HOOA 4IF4A 3AKZA 1U2WA 1S3JA 2FJ1A 1L3LA 1EH7A 3CO7C 1IN8A 3PSIA 2D2WA 2WB1N 5IYBJ 3IKTA 1OR7A 3HSRA 2LVSA 4I98B 3E0JB 2V4JC 3MKZA 3CCLI 2FXAA 3QU6A 3IC7A 2VI6A 3F21A 2IXSA 4F52A 1S5LC 1G3TA 4MFEA 3GUDA 1QBJA 1QVTA 1LDJA 3KP2A 2I5UA 3VYTB 1ZN2A 5J4VA 2WBMA 1DP7P 2BHYA 1B1BA 2BW3A 2Z3YA 4EJOA 2L9VA 5JR3A 2R7FA 3BR5A 2PMHA 4RB3C 1BJAA 4FTHA 2GXAA 5LHIA 2BEOA 3RSNA 2L54A 2ZNYA 5HLIA 1ZH5A 3FXKA 2DT5A 3GFMA 1E3HA 1B8IA 2O61A 2R7WA 3S32A 2EIMH 1BM9A 1YJ9I 2M9HA 4CZZA 1VQLI 2L9RA 4I6ZA 3QYBA 3SXYA 3OOPA 1K83J 3PQJA 2LD5A 1FSEA 2QEXI 3S1MJ 4U7DA 4LGWA 2Y9YA 4E7HA 2X6WA 3OMYA 3F23A 4WWCA 1BR1A 1W1WE 1WJEA 3PFIA 3WTUC 1ENHA 4ENNA 1QZZA 3NARA 2W85A 2LP0A 2XV4S 2HNHA 4N9HA 1GHCA 2DDAA 3PUBA 4CYCA 3EUHC 1HW2A 1GXQA 4JX6A 2W4SA 3Q0VA 2HQNA 4B48A 1K6OA 2YU3A 5FKMA 3DTEA 1ZTRA 4B09A 3GWZA 2H8WA 4LK0F 2HFHA 4BU2A 5E8GA 4M73A 2KQRA 2HTSA 2EV6A 3DEWA 4XLPF 2QSGX 2QQBA 4Y52J 3D5SC 4PGGA 3ZQFA 4BKXA 1KONA 2VBZA 2Z1DA 5ILUA 1LDKB 1SMYF 5F0HA 3FF5A 1IF1A 4C3HJ 3C1DA 3DQVC 2MC4A 4K2EA 5K7FA 1VQ9I 2EJRA 4EM2A 1X19A 1TZLA 2QQ8A 2YR2A 3ESWB 2CW8A 5TRDA 3E1SA 5D6FA 4G6DA 5FRNA 3ZCOA 3PNTA 1FX7A 1Z6RA 3Q5FA 2JRTA 4PJLA 4YIIA 3S16J 3F22A 4RM2A 4OWRB 2GQQA 2NOGA 1HKTA 3M8FA 3T5XA 1V5FA 1R22A 3I53A 3SEZA 1A35A 2L7ZA 3ABUA 1OCRH 3LA2A 4HF0A 1QU3A 4BQAA 1R5GA 5IOZA 3L09A 1SMTA 1CF7B 4EGZA 3KYLA 3C2GA 3FMQA 2H1KA 1BW6A 4I02A 4XLCA 4CCLA 4QLCU 3DTIA 3F3XA 3IUOA 4UV9A 2G0EA 4BEHB 3CMAI 3AAFA 1ZG1A 2K86A 3G4SI 1EKEA 1XD7A 2XIGA 2ISZA 4RLFA 2HOAA 3JRDA 2VOOA 3HUGA 1O3TA 3G2BA 3TDUC 4ITVA 2BE5F 3MD2A 1HSJA 2HYGD 3CUQB 3RJPA 3ECHA 4YRVA 2LY1A 3PO3J 3O3KA 3VB2A 1YO5C 2P5KA 5E3OA 5BMZA 2JVGA 3QP5A 2IRFG 4HSTA 1RKTA 4XSZF 2MA3A 1DQUA 4M3FA 2L9NA 1JE8A 1FY7A 5GP9A 2MH2A 3ELKA 4ESFA 1TTYA 4U87A 3ZRGA 2NVUB 2YPRA 2O0YA 3BZKA 2HTJA 3EUAA 2NVQJ 4A5NA 3ZQCA 3BTLA 3GF2A 4RBOA 2BZTA 1U78A 4FX0A 1B9NA 3H9QA 2DW4A 1R4MB 1AHDP 2V9VA 1P7IA 1USSA 4NNJA 3OIOA 1XB4A 1SFKA 2DPDA 2O9LA 4HPQA 3CC7I 2A61A 1YOVB 1FZPB 2ZJRF 5FLXZ 3DPLC 2HXIA 2P8TA 3K10A 2NYXA 1DP3A 1QNTA 4RMNA 2EV5A 1I50J 3CMYA 2DA5A 2UV1A 4N4OB 1ZRDA 3SHFA 3GZ6A 2QYOA 2L4AA 1YHQI 3ISPA 4UXNA 3GTOJ 2IP2A 4KMFA 3LSIA 3CC4I 4PFOA 1XGSA 2HZTA 4B1RA 4IQ4A 3LOCA 5CQGA 2R5ZB 3TDZC 1XMAA 4Z6YA 3J7ZI 2A3SA 1R1UA 4PGHA 1W5SA 2CMPA 4XBFA 5L3DA 3SDGA 3V7SA 4HOBA 4UVCA 2ZB9A 2OJED 1RPWA 2HS5A 4EATA 3ULQB 1YX3A 3K1NA 1JHFA 1OFCX 4I0BA 2DO7A 3ERED 3LSRA 1BN5A 4A3MJ 4BBRJ 3A4CA 2PQ8A 2HQ5A 2V26A 5AIQA 3ZMDA 2XB0X 2VASA 1V54H 5ILVA 3ABLH 4GGGA 4NC6A 2K27A 4L0YB 3JREA 4A3EJ 2P5VA 1GVDA 3S2WA 3BZCA 1XC5A 3QODA 5HDKA 1JUSA 3I9V2 3L00A 3P9CA 1MBFA 2VODA 3SZTA 2XKPA 4OINF 3JCUC 2P5LC 2LSOA 3CESA 3K2AA 1Y8RB 3UR3C 4ZDLA 2CUJA 1ETOA 4OIPF 5J40A 4F91B 4Q5SF 5GAGJ 4BQQA 1MZBA 4CCJA 2WAEA 4X0GA 3VSKA 5CVVA 2NOJB 4IKFA 1KYWA 3FDYA 3JAMZ 2H6BA 2FNAA 3S8PA 3I0TA 4CGZA 1QHGA 1APLC 2H1LA 4TV7A 3BR3A 2HR3A 3EYYA 1JT6A 1SVMA 3M8EA 5IYDJ 3HG9A 5FO5A 2ZFUA 4IOAF 1HW1A 2ZKZA 2LBFB 2KDOA 1TT0A 1D0ZA 3EUKL 1ZRFA 3MEXA 4PSWA 1ZLJA 3T8RA 5EZGA 2HXOA 2VKDA 4U0YA 3CJQB 2FD5A 3A1YA 3U2RA 2H94A 1J9IA 4RAYA 3K7AJ 3TBIA 4ETSA 2JQ7A 4M6YA 2CYYA 2OTLI 2QSFX 3Q3SA 2QSHX 6PAXA 2F5VA 4RDUA 3S3NA 2JA5J 3BROA 1ZREA 5C4XJ 3FXOA 5E3MA 4EEFG 4YFNF 2A6EF 2F4IA 4QTRA 2FUG2 2VE8A 1TWCJ 2K5CA 5KVRA 3CUQA 2QENA 4NHJA 1Z3YA 1R9TJ 5FD5A 3JSOA 1TWGJ 4PUSA 4CHUA 2EV0A 2MH9A 3S2DJ 4D9JA 3OOUA 3CP2A 2PJRB 1I1GA 2M30A 4E7KA 2XPUA 1A31A 9ANTA 1Z05A 3KP5A 4XRSA 4NQWA 2Y69H 3DPTA 2GLOA 3HSFA 2ECCA 3EPZA 4XN0A 2R7RA 3BR6A 3KEOA 4I7HA 2OCEA 4D5CA 1FEXA 1D8KA 1I3AA 1HSTA 1QHHD 2GAUA 4L5EA 4U0WA 4Y13A 1ZG3A 3R0JA 4HDUA 3SQNA 3H1CA 2TDXA 1NK3P 3PM1A 4RB0A 3C2BA 2PX9A 2QKMB 3L2UA 4A0ZA 4PJ0C 4NBQA 4MQ9F 2GOXB 4A6DA 5B1AH 1MH4A 3PJRA 2DA2A 1OCPA 1WJDA 3BPVA 2QCOA 3E5UA 3J7YJ 2C6YA 4BY7J 1R7JA 3E6BA 1P7JA 4G6QA 4IOCF 3HOUJ 4ZZLA 4YFXF 2HZDA 3I3LA 2IA1A 2IS1A 2FBKA 1Y1WJ 1XX5A 2X1CA 3KEQA 4LOCA 5D5WB 3RQIA 3FMRA 2E1MC 4IHSA 1WKMA 2E2JJ 2K9QA 1G3SA 1X1CA 3RKQA 1N75A 5LEJA 3J80Z 2DMQA 1HW5A 3HTSB 4RA2A 1O3RA 2PMUA 3NEUA 1FMWA 1F43A 3ZMSA 4OAZA 5CVRA 5KCMA 2R5ZA 5J8CA 4A3CJ 4FT8A 2CV1A 3FK6A 4E7SA 5JVGF 3H5NA 1Q1HA 5HNFA 3I56I 4RB2C 3OYGA 1KQ0A 4AYBA 3RKYA 3CUQC 1MSFC 1MJBA 1Z91A 5HNHA 2WV1A 3BTIA 4EV0A 2KZVA 2XF6A 2ZJ2A 2KMUA 2IBDA 1ZKGA 3IH3A 3O8GA 2XGCA 3ECOA 2X4HA 5EEAA 2KLOA 3NQOA 2VN2A 5DM6F 3W6KB 3CZ6A 1X58A 3QAHA 1UFMA 3B6AA 4MTEA 4ABZA 5DS9A 1JTXA 3E5QA 1B72B 2NXNB 1SD7A 2HYJA 2ZO4A 5FJ8J 5FFXA 5K1YA 1TW2A 3GMEA 2KRCA 4P5OA 2V6CA 2E60A 1LDDA 5C3EJ 4GDFA 4UVBA 1T6SA 1KGSA 3KZIC 3OYBA 2UXNA 3RDIA 3CTAA 2K9SA 1U0JA 3R4KA 1OYIA 2VXDA 1P92A 2D5VA 3DTKA 3HXLA 4C2UA 3F8FA 1X2NA 3P5JA 4LK1F 5HVQC 1YQAA 1K7AA 1PYVA 3MKLA 3P9IA 3DF8A 4BYYA 2R7SA 2DA1A 3V42A 1PDNC 1HQCA 2WV0A 3X2QH 1SFUA 2XAFA 2ELJA 2DA4A 4EJVA 3F6OA 1I27A 3V8JA 4IRHA 3M07A 1GV2A 5HS8A 3MKWB 1T95A 5IYCJ 2V1XA 2EH3A 1YW9A 3HHHA 2LBFA 5M3MJ 1YITI 5DUIA 2F5DA 2V6EA 1AWCA 4A3GJ 1MNMC 2IVMA 3MQ0A 3CF5F 1J5YA 2XAJA 5LHGA 3CCSI 4JQFA 5IPAA 1GV5A 2CW0F 3EQLF 3BG9A 3FBNB 5FLVA 1SD6A 2RQQA 3HOXJ 3CJRB 2BV6A 5GTHC 5LGNA 1J0RA 2R7ZJ 5E1XA 1QVUA 4UVAA 2P6SA 2DA7A 2LR8A 4NC7A 2OAZA 5FB2A 3RPUA 1P9QC 3HKZN 4UHTA 1T8IA 5ED4A 3FXQA 3JRHA 5BPDA 4A3LJ 1IN7A 3KP4A 4XOTA 1W5CC 5TJJA 3HM5A 4OAYA 3F72A 1XSXA 2P4WA 1LFBA 2JA7J 4R8HA 3WGGA 1U3EM 4UUSB 2MYSA 5DD4A 4II2A 3OYHA 3S3MA 2XKOA 2NVXJ 3QQAA 2NS7A 2VKEA 1ZGWA 2PJRA 2XPVA 4E7LA 3QYFA 1YE9A 4MHGA 4P9FA 4M3BA 5BOXA 1X2MA 3A01B 3H35A 3OWTA 3CQZJ 1IXSB 5FLMJ 2M4KA 3D1NI 4V19K 4PJNA 4HW0A 1Z7UA 2XGDA 1JHHA 2KRFA 4S0HB 4HYEA 2L7MP 3GLXA 1Y8QB 2JA6J 3HDDA 3PIOF 2R7VA 4XK4A 3IH2A 5EG0B 1Y0UA 1UZCA 2CUFA 2G9WA 1DU6A 2OU2A 3BTCA 3K2ZA 2F5FA 1VQKI 4HF2A 2HI3A 5E1WA 4MO7A 5A2QZ 2LF8A 5F1RA 2OQGA 2K3PA 1X4PA 2KPMA 3IH4A 2BY0A 3GZ5A 4E7ZA 4ESJA 4A3DJ 3HC7A 3BWGA 2OZUA 3HIFA 3FBIB 4L9JA 4KIBA 4HA8A 4Z2YA 1J2XA 4Y17A 1BW5A 4A5MA 2MD5A 4MLOA 4MFDA 1MW7A 1VFCA 3KETA 1Z7LA 2X51A 3OYIA 3U1KA 2R7OA 2OUMA 2LLKA 2A6TA 4BS9A 3A2KA 2CGPA 2JUGA 2RC4A 3T8TA 5IP6A 4XKCA 1R1VA 3U9GA 4RGUA 3K70D 4J01A 3BQZA 2DT7B 1ZGAA 2Q0OA 4FX4A 1P4AA 5D5VB 5F0FA 2VPLA 1FBQA 5FKLA 3LQRA 4HX4A 3WU0A 2D45A 2HGCA 2JZYA 1R5HA 2PLYA 2VL8A 5LEKA 1W7PA 2GZWA 1J09A 3S93A 2QLZA 1TNTA 1X3WB 1UG0A 5EJCA 3BG7A 5J3LA 3A02A 3H5AA 2KISA 3JRAA 2XAHA 3ZMZA 3EUHA 2QWWA 2RN7A 4GYGA 3FHNA 3NRVA 4XL9A 2LY9A 3I5UA 1B72A 1ORKA 2JPCA 3KE2A 3H9JA 3H3UA 3LSKA 3WTYC 4RAFA 3TP3A 1RNLA 1YJNI 5IT3A 1SEUA 3I4NJ 4B43A 4GCVA 4RGXA 4HV6A 2VJ4A 2Q1ZB 4KT5C 4DIQA 1MSEC 1YS7A 3BG5A 1Z21A 1WFXA 2VONA 4V2GA 2O7OA 4BL0B 1UHWA 3LSGA 3L9FA 2E35A 5JLWA 1HDPA 4OU0A 2K9LA 3ASNH 3WE3A 1KA8A 1D0XA 5F64A 3VYSB 3FK7A 4U0VA 5LRSA 5M5XJ 1YI2I 2GA2A 4G8XA 2HYFA 3ZMUA 2XF7A 4BDYA 4V2FA 4BE2A 2L01A 4O3MA 3W2AA 1LUJB 3I59B 1VI0A 2GM4A 5H6RA 1SD5A 1E3PA 2K3FA 1T0FC 2Q2EB 3H3ZA 1NG7A 4PJJA 3JRFA 1D5YA 3K4BA 1BOAA 3R61A 3IAS2 3KP3A 5CJ9A 2EFNA 1W36D 1D1CA 1JTYA 2XGXA 4I0AA 5H6QA 4M3EA 3GCMA 4O5VA 1FIAA 1TQIA 5L3FA 2P7VB 3QOPA 4XLFA 4FCYA 2VUMJ 2UWMA 1WQ2A 1RC9A 2JT1A 3HRSA 3KIOA 3J81K 2WAQN 2V9KA 5CKTA 4G6TB 3W6JB 2R92J 1UMQA 2AS5F 2VOPA 2R4GA 1R5ID 1X4OA 3G1OA 4E7IA 1N77A 4ENJA 1Y1VJ 3N97A 2E5ZA 1H0MA 1UG2A 5CVUA 1IUYA 5DCFA 2ICWG 3HOWJ 1V4RA 5M3FJ 4PDKA 2N8GA 4P55A 2WY8Q 3LQQA 4BQOA 5GADJ 2IJLA 4UUSA 2KDZA 2ETHA 3G73A 4HQEA 1IJWC 4A69C 3WG7H 4UUVA 4Y7NJ 5H20A 3HJEA 2YX4A 2RNGA 3WTZA 5LLQA 1R6RA 2JWTA 1S72I 3WTWC 4ESBA 1QPMA 3GTPJ 3H3VK 2XHKA 3S17J 4PK4A 3BOQA 2OD5A 3A01A 1EF4A 2OV7A 1XG1A 2DTRA 4O6JA 2KIMA 4WXCA 4XLHA 4M6VA 3RPUD 4WX9A 1IRFA 5E79C 3UNGC 5GAHJ 3GTJJ 2QQ9A 3TL4X 2IS2A 1GDTA
chains in the Genus database with same CATH topology
1JUSA 1GUUA 2EZKA 1MBFA 2ME0A 2XGEA 5EG0A 4XRMA 4JX4A 1ETQA 1U9OA 5FKOA 2ID6A 5JLXA 2O8KA 3SJMA 3K2AA 2DJNA 1ETOA 2LKXA 2EQRA 3ZOBA 2K9NA 3BR0A 3JRIA 1BA5A 3B6CA 4BY1J 4XICA 3RZOJ 4X1EA 2XSDC 1JJ8C 1APLC 3BR3A 3RZDJ 1O4XA 5M5YJ 1JT6A 3OSFA 1LFUP 2NVTJ 2YS9A 3TW6A 1Z77A 5IYDJ 1RETA 1QPIA 2X48A 2COBA 1AU7A 5F0CA 5F08A 2L0KA 5EYRA 2ECBA 1PUFA 4DZJA 1FTZA 5EZGA 4DZPA 2HXOA 4FISA 2MG4A 4QIWN 2FD5A 5C4JJ 1FJLA 3W6VA 1T33A 3K7AJ 5F04A 3LSJA 4DYCA 3Q3SA 3Q0UA 3QPSA 4RDUA 2PMZN 1B8IB 2M8GX 2CJJA 1JKRC 2JA5J 3A03A 5C4XJ 1LE8B 5E3MA 4EEFG 4A93J 4QTRA 1WH5A 4NDLA 1TWCJ 5GPCA 1R9TJ 2RAEA 1W0UA 4BXXJ 1TWGJ 4A3KJ 5C44J 1I6HJ 5EF6A 3S2DJ 3HBLA 3OOUA 1YRNB 4DW6A 4IEJA 2XPUA 2YU9J 9ANTA 2JJ7A 5IP7J 1MBGA 4XRSA 1TWAJ 3UKGA 2GLOA 2ECCA 3BR6A 1TC3C 1RR7A 5FKNA 1NK2P 1S7EA 4D5CA 4D7MA 3QPLA 1ZK8A 4CYCB 1FEXA 4DYRA 4L5EA 4C3JJ 3ZQHA 1NK3P 2DMNA 3PM1A 3GTMJ 3C2BA 1AKHB 3FKIJ 4DYQA 4A3FJ 3S14J 1FTTA 2JK3A 1MH4A 2VPRA 3HEFA 1ETWA 2M34A 2DA2A 4B3AA 1OCPA 2QCOA 3IV5A 4BY7J 1P7JA 1VNDA 3HOUJ 4M3GA 1Y1WJ 2ME6A 2Y30A 5EGOA 4LOCA 1OJLA 2Y0SN 3RQIA 1JKPC 3JRBA 1H88C 5K7ZA 3JR9A 1JGGA 2E2JJ 2K9QA 3RKQA 5J1YA 2DMQA 2JMWA 1A6IA 2CRGA 3HGGA 2MSYA 1F43A 1DU0A 2AHQA 2R5ZA 1AKHA 2R93J 4A3CJ 2E1OA 4FE4A 1ZR4A 3FK6A 2CQXA 3MVPA 2ELKA 1MSFC 1WGXA 2WV1A 2JA8J 4A3BJ 3BTIA 3H0GJ 3SFIA 3ZQGA 1F36A 2QF7A 3LNQA 2H8RA 3BQYA 2E2IJ 1WH7A 1ZKGA 2IBDA 2IAIA 3IH3A 3O8GA 3OSGA 1ZQ3P 3ZQIA 2XGCA 1W0TA 1JUMA 1CQTA 3F0CA 5EEAA 4C2MJ 1X58A 2P81A 2M0CA 3B6AA 1SANA 2HOSA 4ABZA 3S15J 5DS9A 1IDZA 1JTXA 4J19A 2R5YB 1B72B 4IHXA 5IOYA 2HYJA 5FJ8J 5BNGA 2B63J 1I3QJ 2E2HJ 4IHVA 1UHSA 1ETXA 5C3EJ 1E3OC 1TWHJ 3GTQJ 3O8HA 1GT0C 2NVYJ 4AYBN 5GPAA 2EZIA 2K9SA 2DMPA 4XIDA 3CCYA 5E3LA 4AC0A 1K61A 3MN2A 2D5VA 1X2NA 3M3YJ 5IP9J 3MKLA 3HOZJ 3FISA 2Y9ZA 2IEKA 3GTKJ 2DA1A 1IV6A 2FJ1A 2DA4A 2WB1N 3GBGA 5IYBJ 3JRGA 1GV2A 2LVSA 2LK2A 5IYCJ 4IHWA 1FIPA 2EH3A 5EZHA 5DTDA 2FQ4A 2VI6A 5M3MJ 4A3GJ 1MNMC 2R0QC 4XRSG 1G2HA 4MFEA 5IPAA 1QVTA 1BJZA 1GV5A 3BG9A 1T56A 3NAUA 5FLVA 3HOXJ 3BR5A 2R7ZJ 4FTHA 1QVUA 2DA7A 2LR8A 1JKQC 2OPTA 3HKZN 4BBSJ 1B8IA 3G1MA 2LFBA 3JRHA 1LE8A 2M9HA 2KT0A 4AUXA 1JT0A 4A3LJ 1HLVA 2L9RA 4I6ZA 3HM5A 1K83J 2DTZA 3BR2A 2LD5A 5F27A 1LFBA 2JA7J 2XRLA 3S1MJ 4UUSB 2TRTA 2Y9YA 1ETKA 2NVXJ 1U9NA 1Z0XA 3QQAA 2NS7A 2VKEA 4B4CA 1ZGWA 2DMTA 3JRCA 1YRNA 2XPVA 3HGYA 1ENHA 3NARA 4M3BA 1X2MA 2LP0A 2I10A 3A01B 2MW8A 3CQZJ 5J1RA 1HCRA 5E3NA 5FLMJ 3BG3A 3D1NI 3HOYJ 2LTPA 4M3DA 4CYCA 4JX6A 3Q0VA 2XGDA 3L1PA 5FKMA 3FIWA 1ZTRA 4S0HB 2L7MP 2JA6J 3HDDA 3S1NJ 4XK4A 3IH2A 5EG0B 2CUFA 1IDYA 1DU6A 3BTCA 3DEWA 2HI3A 2YUSA 4MO7A 2OF7A 1ETVA 1H89C 4Y52J 4IHYA 1MH3A 3ZQFA 4BKXA 1WPKA 4W97A 1A5JA 5F0HA 2HOTA 2ID3A 3IH4A 3VPRA 4A3DJ 4C3HJ 3GTLJ 5K7FA 2M2EA 1BW5A 3HOVJ 1IRZA 4MFDA 4MLOA 1Q1VA 4I76A 1VFCA 4A3JJ 3S16J 3S1QJ 2LLKA 1JUPA 2NOGA 3TEDA 1RKWA 1HDDC 2XB5A 5IP6A 3G1LA 2L7ZA 3HB9A 1MBJA 3S1RJ 1OCTC 5HODA 2CU7A 4QSHA 1PUFB 2Y31A 3BQZA 5IOZA 5F0FA 3BTJA 1ETYA 5FKLA 2DN0A 4HNVA 1IGNA 2VKVA 2H1KA 1BW6A 3S2HJ 1XS9A 1QRYA 2G0EA 1U8BA 1MBHA 3Q0WA 2L7FP 1SFOJ 1BL0A 4W1UA 4D7NA 2AO9A 5J3LA 3A02A 3WHCA 2CUEA 3JRAA 5M5WJ 2HOAA 4MIMA 3I4MJ 3JRDA 2LY9A 2R5YA 1B72A 1ORKA 5EDNA 3PO3J 5E3OA 3TP3A 2DA6A 2DA3A 3I4NJ 5FKKA 1RKTA 1MBKA 2TCTA 4M3FA 2DMUA 2Y2ZA 1MSEC 3BG5A 2MGQA 4X6AJ 3WHBA 5GP9A 4V2GA 2O7OA 1MBEA 3LSGA 5JLWA 1HDPA 3TW7A 4GFBA 3E7LA 5K7HA 1TWFJ 3FK7A 1ZR2A 2JN6A 5M5XJ 2GBYA 2NS8A 3LSPA 2EZHA 4FE7A 4V2FA 4JYKA 2NVQJ 3ZQCA 3BTLA 1ITYA 1VI0A 4RBOA 2GM4A 2HDDA 1U78A 1IUFA 2W48A 1AHDP 1P7IA 3OIOA 1D5YA 3JRFA 2O9LA 5F1JA 1JTYA 5EGOB 2HXIA 4M3EA 3M4OJ 1FIAA 1I50J 3CMYA 1POGA 2DA5A 4FCYA 2VUMJ 4D5FA 3BR1A 2WAQN 4JX5A 2R92J 3GTOJ 1UMQA 4A3IJ 4B1RA 2CQQA 3LOCA 3G1OA 2R5ZB 1H8AC 1Y1VJ 1JKOC 4UUTA 1HF0A 3SDGA 3DCFA 1WCMJ 1UG2A 2ZB9A 1RPWA 3HOWJ 5M3FJ 1RESA 2N8GA 1JJ6C 4UUSA 2X6OA 2KDZA 1IG7A 3TP0A 1WI3A 1IJWC 2E19A 1VF9A 1NTCA 1OFCX 2EBIA 4A69C 4Y7NJ 3LSRA 3BT9A 2X9DA 4A3MJ 4BBRJ 2EZLA 4C3IJ 5J1UA 3PO2J 2JWTA 2HQ5A 2K40A 3H3VK 3GTPJ 2XB0X 4G12A 3S17J 3A01A 2XPWA 1EF4A 1XG1A 4JP0A 3JREA 3CDLA 4M6VA 2FX0A 4A3EJ 3GTGJ 3ZQLA 1GVDA 3GTJJ 1IC8A 1HOMA 1XC5A 1GDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUS A;  1GUU A;  2EZK A;  1MBF A;  2ME0 A;  2XGE A;  5EG0 A;  4XRM A;  4JX4 A;  1ETQ A;  1U9O A;  5FKO A;  2ID6 A;  5JLX A;  2O8K A;  3SJM A;  3K2A A;  2DJN A;  1ETO A;  2LKX A;  2EQR A;  3ZOB A;  2K9N A;  3BR0 A;  3JRI A;  1BA5 A;  3B6C A;  4BY1 J;  4XIC A;  3RZO J;  4X1E A;  2XSD C;  1JJ8 C;  1APL C;  3BR3 A;  3RZD J;  1O4X A;  5M5Y J;  1JT6 A;  3OSF A;  1LFU P;  2NVT J;  2YS9 A;  3TW6 A;  1Z77 A;  5IYD J;  1RET A;  1QPI A;  2X48 A;  2COB A;  1AU7 A;  5F0C A;  5F08 A;  2L0K A;  5EYR A;  2ECB A;  1PUF A;  4DZJ A;  1FTZ A;  5EZG A;  4DZP A;  2HXO A;  4FIS A;  2MG4 A;  4QIW N;  2FD5 A;  5C4J J;  1FJL A;  3W6V A;  1T33 A;  3K7A J;  5F04 A;  3LSJ A;  4DYC A;  3Q3S A;  3Q0U A;  3QPS A;  4RDU A;  2PMZ N;  1B8I B;  2M8G X;  2CJJ A;  1JKR C;  2JA5 J;  3A03 A;  5C4X J;  1LE8 B;  5E3M A;  4EEF G;  4A93 J;  4QTR A;  1WH5 A;  4NDL A;  1TWC J;  5GPC A;  1R9T J;  2RAE A;  1W0U A;  4BXX J;  1TWG J;  4A3K J;  5C44 J;  1I6H J;  5EF6 A;  3S2D J;  3HBL A;  3OOU A;  1YRN B;  4DW6 A;  4IEJ A;  2XPU A;  2YU9 J;  9ANT A;  2JJ7 A;  5IP7 J;  1MBG A;  4XRS A;  1TWA J;  3UKG A;  2GLO A;  2ECC A;  3BR6 A;  1TC3 C;  1RR7 A;  5FKN A;  1NK2 P;  1S7E A;  4D5C A;  4D7M A;  3QPL A;  1ZK8 A;  4CYC B;  1FEX A;  4DYR A;  4L5E A;  4C3J J;  3ZQH A;  1NK3 P;  2DMN A;  3PM1 A;  3GTM J;  3C2B A;  1AKH B;  3FKI J;  4DYQ A;  4A3F J;  3S14 J;  1FTT A;  2JK3 A;  1MH4 A;  2VPR A;  3HEF A;  1ETW A;  2M34 A;  2DA2 A;  4B3A A;  1OCP A;  2QCO A;  3IV5 A;  4BY7 J;  1P7J A;  1VND A;  3HOU J;  4M3G A;  1Y1W J;  2ME6 A;  2Y30 A;  5EGO A;  4LOC A;  1OJL A;  2Y0S N;  3RQI A;  1JKP C;  3JRB A;  1H88 C;  5K7Z A;  3JR9 A;  1JGG A;  2E2J J;  2K9Q A;  3RKQ A;  5J1Y A;  2DMQ A;  2JMW A;  1A6I A;  2CRG A;  3HGG A;  2MSY A;  1F43 A;  1DU0 A;  2AHQ A;  2R5Z A;  1AKH A;  2R93 J;  4A3C J;  2E1O A;  4FE4 A;  1ZR4 A;  3FK6 A;  2CQX A;  3MVP A;  2ELK A;  1MSF C;  1WGX A;  2WV1 A;  2JA8 J;  4A3B J;  3BTI A;  3H0G J;  3SFI A;  3ZQG A;  1F36 A;  2QF7 A;  3LNQ A;  2H8R A;  3BQY A;  2E2I J;  1WH7 A;  1ZKG A;  2IBD A;  2IAI A;  3IH3 A;  3O8G A;  3OSG A;  1ZQ3 P;  3ZQI A;  2XGC A;  1W0T A;  1JUM A;  1CQT A;  3F0C A;  5EEA A;  4C2M J;  1X58 A;  2P81 A;  2M0C A;  3B6A A;  1SAN A;  2HOS A;  4ABZ A;  3S15 J;  5DS9 A;  1IDZ A;  1JTX A;  4J19 A;  2R5Y B;  1B72 B;  4IHX A;  5IOY A;  2HYJ A;  5FJ8 J;  5BNG A;  2B63 J;  1I3Q J;  2E2H J;  4IHV A;  1UHS A;  1ETX A;  5C3E J;  1E3O C;  1TWH J;  3GTQ J;  3O8H A;  1GT0 C;  2NVY J;  4AYB N;  5GPA A;  2EZI A;  2K9S A;  2DMP A;  4XID A;  3CCY A;  5E3L A;  4AC0 A;  1K61 A;  3MN2 A;  2D5V A;  1X2N A;  3M3Y J;  5IP9 J;  3MKL A;  3HOZ J;  3FIS A;  2Y9Z A;  2IEK A;  3GTK J;  2DA1 A;  1IV6 A;  2FJ1 A;  2DA4 A;  2WB1 N;  3GBG A;  5IYB J;  3JRG A;  1GV2 A;  2LVS A;  2LK2 A;  5IYC J;  4IHW A;  1FIP A;  2EH3 A;  5EZH A;  5DTD A;  2FQ4 A;  2VI6 A;  5M3M J;  4A3G J;  1MNM C;  2R0Q C;  4XRS G;  1G2H A;  4MFE A;  5IPA A;  1QVT A;  1BJZ A;  1GV5 A;  3BG9 A;  1T56 A;  3NAU A;  5FLV A;  3HOX J;  3BR5 A;  2R7Z J;  4FTH A;  1QVU A;  2DA7 A;  2LR8 A;  1JKQ C;  2OPT A;  3HKZ N;  4BBS J;  1B8I A;  3G1M A;  2LFB A;  3JRH A;  1LE8 A;  2M9H A;  2KT0 A;  4AUX A;  1JT0 A;  4A3L J;  1HLV A;  2L9R A;  4I6Z A;  3HM5 A;  1K83 J;  2DTZ A;  3BR2 A;  2LD5 A;  5F27 A;  1LFB A;  2JA7 J;  2XRL A;  3S1M J;  4UUS B;  2TRT A;  2Y9Y A;  1ETK A;  2NVX J;  1U9N A;  1Z0X A;  3QQA A;  2NS7 A;  2VKE A;  4B4C A;  1ZGW A;  2DMT A;  3JRC A;  1YRN A;  2XPV A;  3HGY A;  1ENH A;  3NAR A;  4M3B A;  1X2M A;  2LP0 A;  2I10 A;  3A01 B;  2MW8 A;  3CQZ J;  5J1R A;  1HCR A;  5E3N A;  5FLM J;  3BG3 A;  3D1N I;  3HOY J;  2LTP A;  4M3D A;  4CYC A;  4JX6 A;  3Q0V A;  2XGD A;  3L1P A;  5FKM A;  3FIW A;  1ZTR A;  4S0H B;  2L7M P;  2JA6 J;  3HDD A;  3S1N J;  4XK4 A;  3IH2 A;  5EG0 B;  2CUF A;  1IDY A;  1DU6 A;  3BTC A;  3DEW A;  2HI3 A;  2YUS A;  4MO7 A;  2OF7 A;  1ETV A;  1H89 C;  4Y52 J;  4IHY A;  1MH3 A;  3ZQF A;  4BKX A;  1WPK A;  4W97 A;  1A5J A;  5F0H A;  2HOT A;  2ID3 A;  3IH4 A;  3VPR A;  4A3D J;  4C3H J;  3GTL J;  5K7F A;  2M2E A;  1BW5 A;  3HOV J;  1IRZ A;  4MFD A;  4MLO A;  1Q1V A;  4I76 A;  1VFC A;  4A3J J;  3S16 J;  3S1Q J;  2LLK A;  1JUP A;  2NOG A;  3TED A;  1RKW A;  1HDD C;  2XB5 A;  5IP6 A;  3G1L A;  2L7Z A;  3HB9 A;  1MBJ A;  3S1R J;  1OCT C;  5HOD A;  2CU7 A;  4QSH A;  1PUF B;  2Y31 A;  3BQZ A;  5IOZ A;  5F0F A;  3BTJ A;  1ETY A;  5FKL A;  2DN0 A;  4HNV A;  1IGN A;  2VKV A;  2H1K A;  1BW6 A;  3S2H J;  1XS9 A;  1QRY A;  2G0E A;  1U8B A;  1MBH A;  3Q0W A;  2L7F P;  1SFO J;  1BL0 A;  4W1U A;  4D7N A;  2AO9 A;  5J3L A;  3A02 A;  3WHC A;  2CUE A;  3JRA A;  5M5W J;  2HOA A;  4MIM A;  3I4M J;  3JRD A;  2LY9 A;  2R5Y A;  1B72 A;  1ORK A;  5EDN A;  3PO3 J;  5E3O A;  3TP3 A;  2DA6 A;  2DA3 A;  3I4N J;  5FKK A;  1RKT A;  1MBK A;  2TCT A;  4M3F A;  2DMU A;  2Y2Z A;  1MSE C;  3BG5 A;  2MGQ A;  4X6A J;  3WHB A;  5GP9 A;  4V2G A;  2O7O A;  1MBE A;  3LSG A;  5JLW A;  1HDP A;  3TW7 A;  4GFB A;  3E7L A;  5K7H A;  1TWF J;  3FK7 A;  1ZR2 A;  2JN6 A;  5M5X J;  2GBY A;  2NS8 A;  3LSP A;  2EZH A;  4FE7 A;  4V2F A;  4JYK A;  2NVQ J;  3ZQC A;  3BTL A;  1ITY A;  1VI0 A;  4RBO A;  2GM4 A;  2HDD A;  1U78 A;  1IUF A;  2W48 A;  1AHD P;  1P7I A;  3OIO A;  1D5Y A;  3JRF A;  2O9L A;  5F1J A;  1JTY A;  5EGO B;  2HXI A;  4M3E A;  3M4O J;  1FIA A;  1I50 J;  3CMY A;  1POG A;  2DA5 A;  4FCY A;  2VUM J;  4D5F A;  3BR1 A;  2WAQ N;  4JX5 A;  2R92 J;  3GTO J;  1UMQ A;  4A3I J;  4B1R A;  2CQQ A;  3LOC A;  3G1O A;  2R5Z B;  1H8A C;  1Y1V J;  1JKO C;  4UUT A;  1HF0 A;  3SDG A;  3DCF A;  1WCM J;  1UG2 A;  2ZB9 A;  1RPW A;  3HOW J;  5M3F J;  1RES A;  2N8G A;  1JJ6 C;  4UUS A;  2X6O A;  2KDZ A;  1IG7 A;  3TP0 A;  1WI3 A;  1IJW C;  2E19 A;  1VF9 A;  1NTC A;  1OFC X;  2EBI A;  4A69 C;  4Y7N J;  3LSR A;  3BT9 A;  2X9D A;  4A3M J;  4BBR J;  2EZL A;  4C3I J;  5J1U A;  3PO2 J;  2JWT A;  2HQ5 A;  2K40 A;  3H3V K;  3GTP J;  2XB0 X;  4G12 A;  3S17 J;  3A01 A;  2XPW A;  1EF4 A;  1XG1 A;  4JP0 A;  3JRE A;  3CDL A;  4M6V A;  2FX0 A;  4A3E J;  3GTG J;  3ZQL A;  1GVD A;  3GTJ J;  1IC8 A;  1HOM A;  1XC5 A;  1GDT A; 
#chains in the Genus database with same CATH topology
 4LB6 B;  1VQ6 I;  1IN5 A;  2EZK A;  2H6C A;  3DEE A;  3PNY A;  1IV8 A;  2Q8K A;  5EG0 A;  4JX4 A;  1ETQ A;  3LAP A;  3OYF A;  2ID6 A;  3DKY A;  3QWL A;  2DYR H;  5AIP A;  2RVC A;  2E1M B;  2O8K A;  5GAE J;  1UHM A;  1XGO A;  1X1A A;  1IXC A;  3HRT A;  4AIH A;  3AFH A;  1OQY A;  1UB9 A;  3BR0 A;  3B6C A;  2KFD A;  1O7F A;  1IN4 A;  2RRE A;  4X1E A;  1MDM B;  1UAA A;  5KHD A;  1ZLK A;  3BJO A;  1JJ8 C;  2F2E A;  2VBX A;  1O4X A;  2DFI A;  1QZY A;  4CCO A;  2O8X A;  5JHU A;  2UXX A;  2YS9 A;  1S7A A;  2LRD A;  2X48 A;  2COB A;  3K0L A;  1AU7 A;  2E7X A;  1BIA A;  2VC0 A;  2A07 F;  5EYR A;  2EIJ H;  3B02 A;  4Q47 A;  4L9T A;  2ISY A;  3CLO A;  3BG6 A;  2ZXI A;  4NQW B;  1QO0 D;  4GXO A;  1FJL A;  3J7A O;  2R7D A;  2FQ3 A;  3P9K A;  5DUK A;  2CFX A;  5F04 A;  2ADU A;  1WJB A;  2DCE A;  2JPB A;  2PMZ N;  3ZQQ A;  1XSD A;  2M8G X;  3RKX A;  5KK1 A;  2CJJ A;  4LIU A;  3CDH A;  1T98 A;  3F8N A;  2K7L A;  4NDL A;  2LH9 A;  1STZ A;  1IO2 A;  3KLN A;  4A12 A;  4P96 A;  3CCJ I;  2ZXJ A;  4XON A;  3JTG A;  4BXX J;  2L5Q A;  5C44 J;  1SFX A;  4PFP A;  1LPQ A;  2COM A;  2ZNZ A;  3HBL A;  3ROU A;  4IEJ A;  2JJ7 A;  3KYC B;  2F5C A;  3GFI A;  3JTH A;  2ZC2 A;  3UKG A;  1U5T C;  4UNO A;  1DGW Y;  3KX2 A;  4XR6 A;  4KIT B;  5FKN A;  5ICF A;  3HL2 A;  4D7M A;  1K79 A;  4AIJ A;  3EYI A;  4L9N A;  3QPH A;  1UST A;  2K85 A;  5J6X A;  3IHU A;  3GTM J;  3OYA A;  3GXO A;  4HNT A;  3FKI J;  2H27 A;  3L2Q A;  3I59 A;  3CCR I;  3RTR A;  4FAS D;  3LA3 A;  3GEZ A;  2JA2 A;  1TBX A;  3DEU A;  2YSR A;  1ETW A;  1P4X A;  2M34 A;  3AG4 H;  4B3A A;  1MIJ A;  2Q2E A;  2A5Y B;  4OOI A;  3IV5 A;  2O3F A;  1LVA A;  1FYK A;  3KZY A;  4XOR A;  3MFK A;  1KZH A;  5DD8 A;  3TGN A;  2MAB A;  4EMS A;  4IO9 F;  3MCZ A;  1F5T A;  1SAU A;  2Y0S N;  1JKP C;  5HLT A;  5CPR B;  1H88 C;  2FRH A;  2X6X A;  3AG1 H;  2PEX A;  5K7Z A;  1JGG A;  4AWX B;  5J1Y A;  2FEZ A;  2V79 A;  2XUB A;  1VQ7 I;  2GIV A;  3HGG A;  2WWY A;  2HDC A;  3K6G A;  2NNN A;  3ABK H;  1AA7 A;  3KZZ A;  1AKH A;  3OR1 C;  4HV5 A;  2F6C A;  3H36 A;  4FE4 A;  4XKB A;  5CVJ A;  3REO A;  3H0D A;  3EDP A;  2MFZ A;  4LIT A;  2ELK A;  3ZMT A;  1I6X A;  5KAF C;  1BI2 A;  4KDP A;  4CA0 A;  2JA8 J;  4A3B J;  1PJR A;  3OL3 A;  4HG2 A;  3HPG A;  4A0Y A;  1F36 A;  2BVM A;  2QF7 A;  3FX3 A;  3LNQ A;  3CCE I;  2KJB A;  2E2I J;  2IAI A;  4IPA A;  4LJZ F;  2LY2 A;  3V4G A;  4ZYH A;  3OSG A;  1XGM A;  1JUM A;  2B0L A;  5AON A;  3OYK A;  4YFK F;  3F0C A;  3OIQ A;  3OS1 A;  4C2M J;  5HLG A;  1WVR A;  1SAN A;  1H9G A;  2XDV A;  1KYZ A;  1R71 A;  1Z9C A;  1BC8 C;  1IDZ A;  4IHX A;  1XSV A;  3R6S A;  5BNG A;  3FXJ A;  2B63 J;  2WB1 A;  3ZP5 A;  3SFZ A;  5IT9 K;  1UHS A;  5F6F A;  2HWV A;  1E3O C;  1TWH J;  4QPO A;  2BHZ A;  1ACI A;  2NVY J;  1WJC A;  4G94 A;  2RV8 A;  4ZZD A;  4AC0 A;  2ELH A;  3E6C C;  2Z2S B;  3L7W A;  4WXH A;  3R60 A;  4ZTJ A;  2G7H A;  3LWF A;  4E70 A;  3U21 A;  3VFZ A;  3M3Y J;  2BYV E;  3RI4 A;  2IS4 A;  2X1D A;  4AVP A;  5H2F C;  2UUZ A;  4N9I A;  2Y9Z A;  2RKH A;  2IGK A;  1FMV A;  3BJ6 A;  1MDM A;  2LC2 A;  1IV6 A;  4KIF A;  4G7Z F;  2X0L A;  5J47 A;  2JVH A;  4KIC A;  3GZN B;  2XRN A;  4BJT A;  3MZY A;  3JRG A;  3TO6 A;  1W4M A;  4PCQ A;  3CO6 C;  2W24 A;  1FSH A;  4HX8 A;  2KL4 A;  5L3G A;  4ENK A;  5DTD A;  2DYS H;  1FBU A;  1F4K A;  2FQ4 A;  2WC2 A;  2UZK A;  2R0Q C;  1G2H A;  2PBI A;  3DP7 A;  5HDG A;  1MMN A;  1YW8 A;  2WAQ A;  4E4H A;  1R49 A;  2ACJ A;  4LLG F;  1WI9 A;  1BI0 A;  1JI8 A;  1D8J A;  1YS6 A;  2QM3 A;  2F48 A;  1FOX A;  2M45 A;  4WK8 F;  1JKQ C;  4CIC A;  2OPT A;  4M6X A;  4BBS J;  3Q9V A;  1B59 A;  4IZZ A;  2IA2 A;  4CYD A;  1JT0 A;  2KT0 A;  4AUX A;  3FZV A;  2J5P A;  2R7T A;  2DTZ A;  5FFZ A;  3NWS A;  5F27 A;  3LSM A;  1LQ1 A;  2XRO A;  1ETK A;  1LFP A;  3OS0 A;  5JHF A;  1U9N A;  1Z0X A;  2K9M A;  2PN6 A;  4ANJ A;  3ZMV A;  1VQ8 I;  2DMT A;  5K5R A;  3IL2 A;  2M0M A;  2LOO A;  1YLF A;  3V7C A;  4E6K G;  3LFU A;  1OLT A;  4XQF A;  2FOW A;  5HLH A;  3E5X A;  3ZXS A;  4BAC A;  5LFA A;  1N25 A;  1X1B A;  2MW8 A;  1B6A A;  5D8L B;  1OKR A;  3HTU A;  4BJ5 C;  3HOY J;  2LTP A;  4M3D A;  1FC3 A;  3DBR B;  2ZME C;  3D0S A;  2F5E A;  3L1P A;  1OMI A;  4KJZ A;  1ODD A;  1D1B A;  2FBI A;  2FF4 A;  4HRI A;  2KIQ A;  1XMK A;  1E2X A;  1IDY A;  3MMY B;  3WTS C;  3QYE A;  4M9Z A;  2HQA A;  1PVE A;  1YX5 A;  2OC6 A;  2DOF A;  2M5W A;  4IHY A;  5JFR A;  1WPK A;  4W97 A;  2HOT A;  1MMA A;  2ID3 A;  3ABM H;  3VPR A;  3C2H A;  4MEX F;  2WY7 Q;  4DQ2 A;  4BGD A;  2DU9 A;  1LEB A;  3FM3 A;  3KPH A;  1CGP A;  3HHG A;  1W7P B;  1I5Z A;  1UCR A;  4CZC A;  2E7W A;  1IRZ A;  1Q1V A;  2Z33 A;  4I76 A;  2RDP A;  3K4K A;  3M9A A;  1VZ0 A;  4M71 A;  2K4J A;  4UV8 A;  3CME I;  3L2W A;  3PL8 A;  2KRH A;  3DU6 A;  3M8J A;  3C3W A;  3TED A;  1V5E A;  5GTI C;  1HDD C;  3LSH A;  2XB5 A;  1X3Z B;  3MWM A;  4IXA A;  1OCZ H;  3C7J A;  4HLX A;  3S1R J;  4CDG A;  2CU7 A;  2CFO A;  2Y31 A;  2VQL A;  2DPU A;  3BTJ A;  1ETY A;  5D5X B;  3S3O A;  4OMY A;  2FE3 A;  4A2U A;  4EM0 B;  2CG4 A;  2VKV A;  3PNV A;  1QRY A;  2V1D A;  2OQR A;  3SZP A;  1U8B A;  2MBF A;  1KU3 A;  4W1U A;  4D7N A;  1BL0 A;  3CP8 A;  2V9P A;  4LLN A;  2DQL A;  1XGN A;  3RCO A;  4XRF A;  1RRJ A;  3I4M J;  3WG9 A;  3AG2 H;  2YX7 A;  3AG3 H;  5D6E A;  1FWZ A;  2GIZ A;  4YIF A;  2ZSH B;  1I1S A;  4FQG A;  2Y2Z A;  2VQH A;  1X3U A;  5EEG A;  4F55 A;  5LGU A;  2XVC A;  2V1N A;  3WHB A;  1H9T A;  2EPF A;  3CLQ A;  4PSX A;  1MBE A;  4PJM A;  1P2F A;  1QA6 A;  4L18 B;  1L0O C;  1A36 A;  3M1C A;  5HS9 A;  4GFB A;  4IHT A;  1G6N A;  4N0B A;  3BJA A;  5K7H A;  1MMD A;  1Y6I A;  1TWF J;  2JN6 A;  4BH9 A;  2GBY A;  5DV5 A;  2EZH A;  3U1D A;  3JSP A;  1JXS A;  3F8C A;  2DOE A;  4I01 A;  4JYK A;  1MMS A;  1K78 B;  1WRJ A;  4BHP A;  1FP1 D;  2HDD A;  4II3 A;  2EFW A;  3CMM A;  2W48 A;  3HPH A;  3C18 A;  2QZ8 A;  3QOE A;  2EFQ A;  2I8D A;  2B7E A;  2M3A A;  3CJN A;  4XN3 A;  2Y0S A;  1NHA A;  3ZN1 A;  5B3S H;  5F1J A;  4CCN A;  5D4S A;  4D0P A;  4B47 A;  2JUC A;  1ZHF A;  2FU4 A;  4AID A;  1LVK A;  2WTE A;  1RI7 A;  3DKX A;  4DOZ A;  4AM3 A;  2MD0 A;  1D3Y A;  4D5F A;  2LKP A;  3BR1 A;  4JX5 A;  2X85 A;  4EM1 A;  4A3I J;  3A0H C;  1NH3 A;  2IW5 A;  3T0Y A;  2CQQ A;  3SZG A;  5CYV A;  1H8A C;  1G3W A;  3HOT A;  4NUB A;  4DBR A;  1VQ4 I;  4LD5 A;  4RGR A;  3WOD F;  1E0E A;  2R7U A;  3RQ4 A;  1FT9 A;  3DCF A;  3GW2 A;  1HF0 A;  2LNB A;  4ENM A;  4GYI A;  4LMY A;  4XSX F;  1SD4 A;  1U8R A;  1YIO A;  2DOA A;  4RS8 A;  2X6O A;  3EET A;  2Z9O A;  2E19 A;  1MKM A;  1U5T B;  1NTC A;  1F1Z A;  4XMY A;  2JSC A;  2RNJ A;  4DNC A;  2PI0 A;  3OL4 A;  3VDX A;  2X9D A;  4C3I J;  2ZXW H;  2K40 A;  2OCC H;  2CO5 A;  2L02 A;  4G12 A;  1WZ2 A;  2L2O A;  1YG2 A;  3TOA A;  1BR4 A;  4KMU X;  1SFE A;  2VT3 A;  1XCV A;  2E1N A;  2KP6 A;  4JP0 A;  1S8N A;  2FX0 A;  2XSJ C;  4E7J A;  3ZQL A;  2X6Y A;  2QUF A;  4L9V A;  2RQP A;  2VC1 A;  4IX7 A;  1T0F A;  5D8K B;  1FLI A;  3Q9S A;  4MTD A;  1U9O A;  5FKO A;  1RUN A;  5JLX A;  2CQK A;  1HKQ A;  1C0W A;  2BOL A;  2MLK A;  2DJN A;  2LKX A;  5E8I A;  2EQR A;  3ZOB A;  3ABT A;  3E3V A;  3GO5 A;  4NB5 A;  3JRI A;  2W25 A;  4G9Y A;  1WJ5 A;  4YEL A;  2W7N A;  1TL8 A;  3DBL B;  4KIG A;  5EEH A;  4XIC A;  4IJA A;  3RZO J;  3GLL A;  2GXB A;  1O3S A;  1ZAR A;  1PP7 U;  4JK1 X;  3WGI A;  3BLY A;  2GWR A;  2VB6 A;  1K4S A;  4DGW B;  3RZD J;  2D1H A;  1MD0 A;  3I55 I;  2IS6 A;  2DFF A;  1Z77 A;  1XDU A;  1QPI A;  2A5W A;  4LLL A;  1W5T A;  3E6D A;  2XAQ A;  3BCB A;  5F08 A;  4BDZ A;  2L0K A;  2IA0 A;  2L3D A;  3IP4 B;  1ON1 A;  2ECB A;  4OIR F;  4EQQ A;  3ZPL A;  1R4N B;  2W84 A;  3FXU A;  3HYI A;  4EJW A;  2DXI A;  4DZP A;  2CW7 A;  3K1M A;  4FIS A;  2DOD A;  2MG4 A;  2VE9 A;  4J00 A;  2VJJ A;  4QIW N;  5C4J J;  1O7L A;  3TO7 A;  4H4K C;  2E34 A;  3LSJ A;  1R1T A;  2PJP A;  2QKL B;  4HX7 A;  4DYC A;  4F93 B;  3Q0U A;  3QPS A;  2DLL A;  4BE0 A;  1FPQ A;  3WU2 C;  1LE8 B;  5J8F A;  3OV8 A;  1WH5 A;  4OIQ F;  1DPR A;  2XAS A;  1GLN A;  5IT9 Z;  2DJI A;  1BI1 A;  4B44 A;  2HOE A;  1Y56 A;  2BY3 A;  1IW7 F;  4RM3 A;  1IN6 A;  4BXF A;  4LIV A;  1B4A A;  1T08 B;  1D0Y A;  2BVL A;  2RAE A;  1KU2 A;  3OYM A;  1W0U A;  4A3K J;  1DPU A;  4UB6 C;  2HVQ A;  1YRN B;  2ESH A;  4DW6 A;  2Z99 A;  3VYR B;  2YU9 J;  2HPM A;  1YIJ I;  2EK5 A;  4C9Y A;  3AL0 C;  1TWA J;  1YW7 A;  1MJ9 A;  3KP6 A;  3J80 K;  1TC3 C;  1S7E A;  2QBY A;  3DLA A;  3LAJ A;  3QPL A;  1ZK8 A;  3N4M A;  1V55 H;  2WAF A;  4DYR A;  3ZQH A;  4HAM A;  2A68 F;  4BAY A;  1BR2 A;  5FD6 A;  1GXP A;  3P7N A;  3PUF A;  1AKH B;  1X1P A;  3ERM A;  1K78 A;  3E6M A;  4A3F J;  2MLG A;  1K6Y A;  4KUM A;  3S14 J;  2R7Q A;  3TQN A;  2DK8 A;  3FWE A;  2OBP A;  3MKY B;  1FTT A;  2JK3 A;  2Z5U A;  2Y0M A;  1DUX C;  4F7Z A;  2WA0 A;  4N4N B;  5J4Y A;  1TNS A;  1X1D A;  1VND A;  5E18 F;  3V7R A;  2ME6 A;  2Y30 A;  1GVJ A;  1IAW A;  2PFB A;  4R1H A;  5ILS A;  3JRB A;  3V8K A;  3JR9 A;  3K1P A;  3OS2 A;  4DJA A;  1T39 A;  4DBQ A;  4ZYD A;  1TQP A;  1QQI A;  1ZEL A;  4HLY A;  2Y48 A;  2CRG A;  1S7O A;  3CCM I;  5BS6 A;  1FYL A;  3SYT A;  5ICG A;  1DU0 A;  2AHQ A;  2AXT C;  2XF5 A;  3BZ6 A;  1SVL A;  1OR7 C;  1WHU A;  2HVR A;  2QQA A;  2CQX A;  4CXF A;  2VKH A;  1BIB A;  3HRM A;  4FHT A;  3ASO H;  4FET A;  4P9U A;  1WGX A;  3VSL A;  2FNP A;  4KIS A;  2BGC A;  1ZAO A;  3SFI A;  3ZQG A;  2VQC A;  2H8R A;  3BQY A;  3L2R A;  4H0E A;  1YFH A;  1WH7 A;  1IRG A;  4UY8 I;  1ZQ3 P;  1U5T A;  2QVO A;  3WE2 A;  2QA4 I;  1W0T A;  4BXU A;  3L2V A;  3MAJ A;  3LMM A;  1VQP I;  2P81 A;  3DWL E;  2M0C A;  3T1B A;  2HOS A;  3FM5 A;  1SVO A;  1VQN I;  2ZME B;  4KT6 A;  4J19 A;  2R5Y B;  4KA4 A;  3WTX C;  5LRR A;  3DXJ F;  1ON2 A;  3B73 A;  3W2V A;  2DBB A;  3FKJ A;  1I3Q J;  5ICC A;  2E2H J;  4IHV A;  2A05 A;  5BPI A;  1MND A;  1ETX A;  3H9G A;  1HBX G;  2XAG A;  4XLE A;  4BE1 A;  1MMG A;  4XOP A;  2FSW A;  3LA7 A;  4RLQ A;  4AYB N;  2P7C B;  4XID A;  2DMP A;  3IWZ A;  5E3L A;  1N78 A;  1K61 A;  1A04 A;  3TMO A;  3RKW A;  1VQ5 I;  4CUG A;  1O57 A;  5IP9 J;  4BHC A;  2EIK H;  3HOZ J;  3K69 A;  4P1W A;  5KAI C;  4IQJ A;  1V3F A;  3FIS A;  3HKZ A;  2LRE A;  1FOW A;  5CVI A;  3H92 A;  4S04 A;  4CH7 A;  5TGT A;  2STW A;  2VBW A;  1D5V A;  3GBG A;  3OYC A;  2AXL A;  4CCM A;  4KFC A;  2LK2 A;  3CD6 I;  4IHW A;  5B1B H;  3CCV I;  2E36 A;  1FIP A;  4Y3O A;  4AIK A;  5EZH A;  4IVN A;  1U6G A;  2CV0 A;  1TQM A;  5CLS A;  4WCG A;  1J59 A;  1HKS A;  4OIO F;  2RGV A;  2DT6 A;  3G71 I;  4XRS G;  2AQE A;  1BJZ A;  2XAU A;  3LST A;  4Y15 A;  1T56 A;  3NAU A;  4LG0 B;  1S6L A;  5JVT A;  4Q4Z F;  1W7P D;  2IGM A;  3KYD B;  1EJ9 A;  2M87 A;  2O6G E;  2P0W A;  4ZYG A;  1REP C;  3G1M A;  2LFB A;  3TO9 A;  4UB8 C;  5DDG A;  1LE8 A;  1UEL B;  4M9S A;  1XTA A;  2CH0 A;  4LFU A;  1HLV A;  2WAD A;  1G59 A;  5DEQ A;  3BR2 A;  1J7K A;  5A2Q K;  2HKX A;  3K4M A;  2XRL A;  4S05 A;  5KNL A;  3JW4 A;  2TRT A;  3D5L A;  4WXD A;  4IRI A;  2M1B A;  2LDU A;  3ZQ7 A;  4B4C A;  3JRC A;  1YRN A;  1NG6 A;  2E1C A;  1KU9 A;  2FML A;  3HGY A;  3DU5 A;  1EH6 A;  1IZ1 A;  1LEA A;  1BOB A;  2DQR A;  4JOM A;  1PUE E;  2I10 A;  3I64 A;  2IT0 A;  5J1R A;  1HCR A;  5E3N A;  3BG3 A;  4EJU A;  4ZYA A;  4AVZ A;  3I54 A;  2EIN H;  3A0B C;  3WGH A;  1FOY A;  5CQE A;  3VWB A;  1ERD A;  3LFK A;  3FIW A;  2KIF A;  3S1N J;  3SEQ A;  5LGT A;  1K4T A;  3I4P A;  4C2T A;  2STT A;  2DFE A;  3FHZ A;  2YUS A;  4XM3 A;  2OF7 A;  1ETV A;  4ZC3 A;  1H89 C;  2DK5 A;  2NRA C;  2BBY A;  1MH3 A;  2W1O A;  1A5J A;  4QWQ A;  5HS7 A;  2L9S A;  5TIS C;  4HBL A;  5HDN A;  3GTL J;  2M7B A;  5D4R A;  2M2E A;  4KNY A;  4Q48 A;  1JGS A;  3HOV J;  2EFP A;  1T2K A;  3K4C A;  3BPX A;  4A3J J;  3ZN0 A;  3GFJ A;  1B9M A;  1QGP A;  1T38 A;  3CJT B;  2FMY A;  2ZXH A;  3S1Q J;  1BC7 C;  1JUP A;  4I09 A;  2VQG A;  2BY1 A;  1RKW A;  1KQ8 A;  3RYR A;  1S29 A;  1OYY A;  4XKV A;  2F4O B;  3G1L A;  4BUP A;  1ZGJ A;  3HB9 A;  3ML6 A;  1MBJ A;  1OCT C;  3KCC A;  5HOD A;  4QSH A;  1PUF B;  2DDB A;  3VYU B;  1F9N A;  2A6H F;  3H5R A;  1FYM A;  4AU7 A;  1IXR C;  3ZR8 X;  2DN0 A;  4HNV A;  2DFH A;  5LHH A;  1IGN A;  2Y75 A;  3I58 A;  3S2H J;  1XS9 A;  4ZTF A;  2VBY A;  3K4L A;  2LF7 A;  1MBH A;  3Q0W A;  2L7F P;  2LKS A;  3IRR A;  1SFO J;  4MEY F;  2AO9 A;  3WHC A;  3M1E A;  2CUE A;  3CF2 A;  3DKW A;  1QZE A;  5M5W J;  2E5N A;  4MIM A;  2GOM A;  2ZME A;  3OY9 A;  4GRI A;  1IRX A;  5B66 C;  2R5Y A;  5EDN A;  3IRQ A;  3OYJ A;  3MZ8 A;  3R0A A;  4BQN A;  2DA6 A;  2DA3 A;  3QRF F;  2OZ6 A;  2EFO A;  5FKK A;  1MBK A;  2TCT A;  4LB5 A;  1RUO A;  4KN4 X;  2DMU A;  1PP8 F;  1CF7 A;  2OTJ I;  2MGQ A;  1TW3 A;  4X6A J;  2X1E A;  2VT2 A;  3RPQ A;  3TW7 A;  2GA1 A;  1TLH B;  3IWF A;  2BXZ A;  2B9S A;  3N05 A;  3HSE A;  3E7L A;  4ASN A;  4BEH A;  1BI3 A;  3DBH B;  2BXY A;  4A6E A;  1ZR2 A;  2MC3 A;  3WU1 B;  1R58 A;  2M7A A;  1Z1D A;  4CSW A;  3PIP F;  2NS8 A;  1J75 A;  3LSP A;  3GYH X;  4FE7 A;  2IGN A;  2M4G A;  1FNN A;  3QU3 A;  1ITY A;  5DYM A;  1IUF A;  2K02 A;  3KP7 A;  2E71 A;  5LBQ A;  5L3C A;  2HDW A;  2ZJP F;  4HNU A;  3ONQ A;  1HA8 A;  5EGO B;  1HC8 A;  2GXG A;  1Z6T A;  1MJA A;  3M4O J;  1POG A;  4D1Q A;  1TP4 A;  2XC7 A;  4LG0 A;  1BBY A;  2EIL H;  2EA2 A;  3HOS A;  1OPC A;  2CSO A;  3BCA A;  2H09 A;  2KIU A;  2VJ5 A;  4HF1 A;  1Z3X A;  1DGR M;  4HSR A;  3G3Z A;  5FRO A;  4YEJ A;  1JKO C;  4UUT A;  5DCM B;  3ZGK A;  4GO1 A;  4XLA A;  1WCM J;  4MGR A;  4PZJ A;  2K4B A;  2HKO A;  4RGS A;  3BY6 A;  1RES A;  2VLA A;  3AL0 B;  4BNC A;  1JJ6 C;  1ULY A;  1IG7 A;  3TP0 A;  1WI3 A;  2EB7 A;  1VF9 A;  2D1V A;  3V8L A;  2EBI A;  3RYP A;  3K4J A;  3FXM A;  3GVA A;  1EV7 A;  4OMZ A;  3BT9 A;  2NS0 A;  2EZL A;  3PO2 J;  2DI3 A;  5J1U A;  3FMS A;  1YTY A;  5D5U B;  3BDD A;  2LMD A;  2XPW A;  2ZFW A;  3TKY A;  3J81 Z;  1WJA A;  3CDL A;  4U88 A;  3CDI A;  4M72 A;  1FOK A;  1G3Y A;  3GTG J;  1A6Q A;  1RR8 C;  1IC8 A;  1DDN A;  1HOM A;  3F8B A;  3WTV C;  4CCK A;  1MNE A;  1GUU A;  3KLO A;  4YIR X;  2ME0 A;  5E17 F;  2XGE A;  3OYL A;  4XRM A;  2FOK A;  4XKW A;  4HDV A;  1D1A A;  3VOE A;  1LNW A;  2KJC A;  4I2O A;  1E17 A;  3OYE A;  4ON0 A;  4EJT A;  3DLL F;  3SJM A;  1S9H A;  5FGM A;  2F4M B;  4A0X A;  3COA C;  3RIR A;  2ESN A;  2K9N A;  3GFL A;  1MGT A;  1BA5 A;  1G4D A;  3OR2 C;  1I39 A;  2PMZ A;  4BY1 J;  4ZDP A;  2VJI A;  1SAX A;  5DM7 F;  2A69 F;  3FXL A;  4HQM A;  2O5R A;  2JRM A;  3K4N A;  1YYV A;  1AOY A;  3F6V A;  2CUZ A;  2XSD C;  5M5Y J;  3M7G A;  3HRU A;  4RAZ A;  1EH8 A;  2G7U A;  3OSF A;  1LFU P;  4EVI A;  3TW6 A;  2NVT J;  1RET A;  3VEP A;  1XN7 A;  4F3Q A;  3W2W A;  5F0C A;  2LYC A;  4L5I A;  1XCB A;  5B5E C;  3K70 C;  1Y39 A;  4BJ6 C;  1PUF A;  4DZJ A;  3CCU I;  5FLX K;  1FTZ A;  2ZJQ F;  1FBS A;  5E1Z B;  2KKO A;  2EA4 A;  2W57 A;  5E20 A;  3W6V A;  1T33 A;  4ZDO A;  2BW3 B;  4HZF A;  2J5O A;  2QBY B;  1OYW A;  1WWX A;  2KZG A;  3KEY A;  4Y33 A;  4HEA 2;  1FP2 A;  1B8I B;  4QPQ A;  5L3E A;  1JKR C;  2HVS A;  3A03 A;  3SDB A;  2HU9 A;  4A93 J;  3QPT A;  1M1E B;  1OCO H;  4C30 A;  5FRM A;  4RB1 A;  5GPC A;  4ZJZ A;  4YG2 F;  5L3B A;  1R36 A;  5IY5 H;  5K5O A;  2CS3 A;  1XPX A;  2KHM A;  4RAG A;  3MZH A;  2VXZ A;  1UJ8 A;  4JBA A;  4IL6 C;  1ONV A;  4M9X A;  5ERI A;  5EF6 A;  4U7B A;  1I6H J;  1LJ9 A;  4CO8 A;  3WTT C;  2JTV A;  5IP7 J;  1MBG A;  3VOD A;  2W82 A;  2JSP A;  3BC8 A;  3F9K A;  2CQN A;  4NC8 A;  4Y4R A;  2O03 A;  1KQ9 A;  4KYW A;  1RR7 A;  1NK2 P;  2V7F A;  3OYN A;  4CYC B;  5LD2 C;  2VIX A;  4C3J J;  1ZRC A;  3F8M A;  1ZYR F;  2R3S A;  2DMN A;  3K9T A;  1TT5 B;  1V5G A;  2L7K A;  3CCQ I;  2AQF A;  4DYQ A;  1XDS A;  2CV2 A;  1VQO I;  1LB2 A;  4MNU A;  2CQ7 A;  2VPR A;  2OA4 A;  3E97 A;  3HEF A;  4KN7 X;  2ZBK A;  4M74 A;  4ZH4 F;  2IGO A;  2IPQ X;  1RIO H;  1W36 C;  1OCC H;  5JI6 A;  2W00 A;  4M3G A;  1KU7 A;  1LKX A;  5EGO A;  1OJL A;  2FBH A;  2CWE A;  3PQK A;  4WF2 A;  4G7O F;  1R00 A;  2JMW A;  3JAM K;  1A6I A;  2EWN A;  3KFW X;  2MSY A;  4LG3 A;  2Z16 A;  1Z67 A;  2P6T A;  3O2P E;  5ICE A;  4EGY A;  2R93 J;  3FXR A;  2E1O A;  1ZR4 A;  5DCM A;  1EA3 A;  3MVP A;  3D5R C;  3PFY A;  1XMX A;  1OIS A;  3CUO A;  2ZSI B;  3H0G J;  3GX4 X;  1R23 A;  1SC7 A;  1VQM I;  3QP6 A;  2V1U A;  4F92 B;  1G8X A;  5K5Q A;  3J7A Y;  2BY2 A;  2FA5 A;  3IKV A;  3NWT A;  3ZQI A;  4MQV A;  3L2C A;  2LG4 A;  3OYD A;  1CQT A;  4I99 C;  2QGU A;  4BHB A;  1HXD A;  2HPI A;  1Y0N A;  3IAM 2;  3OIP A;  3S15 J;  3I71 A;  3BP8 A;  2PG4 A;  1P6R A;  2R7X A;  3HUG B;  3DV8 A;  3W3C A;  5IOY A;  2ZCW A;  3LL7 A;  3TOB A;  5BQT A;  4IRG A;  3DFG A;  4ZYE A;  3CC2 I;  3GTQ J;  4AD9 A;  3O8H A;  4XLN F;  1GT0 C;  1WSU A;  4B8X A;  1RZ4 A;  2L4M A;  1WJF A;  4G7H F;  1YJW I;  2HQR A;  5GPA A;  2EZI A;  2HEO A;  1O3Q A;  3CCY A;  2DAO A;  4L5J A;  3MN2 A;  4XNF A;  4L0Z B;  2M8E A;  1P4W A;  3HZJ A;  3G6E I;  3O6B B;  4B3X A;  1VTN C;  3PSF A;  2NNY A;  3DPU A;  1ZG5 A;  3GTK J;  2IEK A;  2NAZ A;  4R79 A;  5HOO A;  4IF4 A;  3AKZ A;  1U2W A;  1S3J A;  2FJ1 A;  1L3L A;  1EH7 A;  3CO7 C;  1IN8 A;  3PSI A;  2D2W A;  2WB1 N;  5IYB J;  3IKT A;  1OR7 A;  3HSR A;  2LVS A;  4I98 B;  3E0J B;  2V4J C;  3MKZ A;  3CCL I;  2FXA A;  3QU6 A;  3IC7 A;  2VI6 A;  3F21 A;  2IXS A;  4F52 A;  1S5L C;  1G3T A;  4MFE A;  3GUD A;  1QBJ A;  1QVT A;  1LDJ A;  3KP2 A;  2I5U A;  3VYT B;  1ZN2 A;  5J4V A;  2WBM A;  1DP7 P;  2BHY A;  1B1B A;  2BW3 A;  2Z3Y A;  4EJO A;  2L9V A;  5JR3 A;  2R7F A;  3BR5 A;  2PMH A;  4RB3 C;  1BJA A;  4FTH A;  2GXA A;  5LHI A;  2BEO A;  3RSN A;  2L54 A;  2ZNY A;  5HLI A;  1ZH5 A;  3FXK A;  2DT5 A;  3GFM A;  1E3H A;  1B8I A;  2O61 A;  2R7W A;  3S32 A;  2EIM H;  1BM9 A;  1YJ9 I;  2M9H A;  4CZZ A;  1VQL I;  2L9R A;  4I6Z A;  3QYB A;  3SXY A;  3OOP A;  1K83 J;  3PQJ A;  2LD5 A;  1FSE A;  2QEX I;  3S1M J;  4U7D A;  4LGW A;  2Y9Y A;  4E7H A;  2X6W A;  3OMY A;  3F23 A;  4WWC A;  1BR1 A;  1W1W E;  1WJE A;  3PFI A;  3WTU C;  1ENH A;  4ENN A;  1QZZ A;  3NAR A;  2W85 A;  2LP0 A;  2XV4 S;  2HNH A;  4N9H A;  1GHC A;  2DDA A;  3PUB A;  4CYC A;  3EUH C;  1HW2 A;  1GXQ A;  4JX6 A;  2W4S A;  3Q0V A;  2HQN A;  4B48 A;  1K6O A;  2YU3 A;  5FKM A;  3DTE A;  1ZTR A;  4B09 A;  3GWZ A;  2H8W A;  4LK0 F;  2HFH A;  4BU2 A;  5E8G A;  4M73 A;  2KQR A;  2HTS A;  2EV6 A;  3DEW A;  4XLP F;  2QSG X;  2QQB A;  4Y52 J;  3D5S C;  4PGG A;  3ZQF A;  4BKX A;  1KON A;  2VBZ A;  2Z1D A;  5ILU A;  1LDK B;  1SMY F;  5F0H A;  3FF5 A;  1IF1 A;  4C3H J;  3C1D A;  3DQV C;  2MC4 A;  4K2E A;  5K7F A;  1VQ9 I;  2EJR A;  4EM2 A;  1X19 A;  1TZL A;  2QQ8 A;  2YR2 A;  3ESW B;  2CW8 A;  5TRD A;  3E1S A;  5D6F A;  4G6D A;  5FRN A;  3ZCO A;  3PNT A;  1FX7 A;  1Z6R A;  3Q5F A;  2JRT A;  4PJL A;  4YII A;  3S16 J;  3F22 A;  4RM2 A;  4OWR B;  2GQQ A;  2NOG A;  1HKT A;  3M8F A;  3T5X A;  1V5F A;  1R22 A;  3I53 A;  3SEZ A;  1A35 A;  2L7Z A;  3ABU A;  1OCR H;  3LA2 A;  4HF0 A;  1QU3 A;  4BQA A;  1R5G A;  5IOZ A;  3L09 A;  1SMT A;  1CF7 B;  4EGZ A;  3KYL A;  3C2G A;  3FMQ A;  2H1K A;  1BW6 A;  4I02 A;  4XLC A;  4CCL A;  4QLC U;  3DTI A;  3F3X A;  3IUO A;  4UV9 A;  2G0E A;  4BEH B;  3CMA I;  3AAF A;  1ZG1 A;  2K86 A;  3G4S I;  1EKE A;  1XD7 A;  2XIG A;  2ISZ A;  4RLF A;  2HOA A;  3JRD A;  2VOO A;  3HUG A;  1O3T A;  3G2B A;  3TDU C;  4ITV A;  2BE5 F;  3MD2 A;  1HSJ A;  2HYG D;  3CUQ B;  3RJP A;  3ECH A;  4YRV A;  2LY1 A;  3PO3 J;  3O3K A;  3VB2 A;  1YO5 C;  2P5K A;  5E3O A;  5BMZ A;  2JVG A;  3QP5 A;  2IRF G;  4HST A;  1RKT A;  4XSZ F;  2MA3 A;  1DQU A;  4M3F A;  2L9N A;  1JE8 A;  1FY7 A;  5GP9 A;  2MH2 A;  3ELK A;  4ESF A;  1TTY A;  4U87 A;  3ZRG A;  2NVU B;  2YPR A;  2O0Y A;  3BZK A;  2HTJ A;  3EUA A;  2NVQ J;  4A5N A;  3ZQC A;  3BTL A;  3GF2 A;  4RBO A;  2BZT A;  1U78 A;  4FX0 A;  1B9N A;  3H9Q A;  2DW4 A;  1R4M B;  1AHD P;  2V9V A;  1P7I A;  1USS A;  4NNJ A;  3OIO A;  1XB4 A;  1SFK A;  2DPD A;  2O9L A;  4HPQ A;  3CC7 I;  2A61 A;  1YOV B;  1FZP B;  2ZJR F;  5FLX Z;  3DPL C;  2HXI A;  2P8T A;  3K10 A;  2NYX A;  1DP3 A;  1QNT A;  4RMN A;  2EV5 A;  1I50 J;  3CMY A;  2DA5 A;  2UV1 A;  4N4O B;  1ZRD A;  3SHF A;  3GZ6 A;  2QYO A;  2L4A A;  1YHQ I;  3ISP A;  4UXN A;  3GTO J;  2IP2 A;  4KMF A;  3LSI A;  3CC4 I;  4PFO A;  1XGS A;  2HZT A;  4B1R A;  4IQ4 A;  3LOC A;  5CQG A;  2R5Z B;  3TDZ C;  1XMA A;  4Z6Y A;  3J7Z I;  2A3S A;  1R1U A;  4PGH A;  1W5S A;  2CMP A;  4XBF A;  5L3D A;  3SDG A;  3V7S A;  4HOB A;  4UVC A;  2ZB9 A;  2OJE D;  1RPW A;  2HS5 A;  4EAT A;  3ULQ B;  1YX3 A;  3K1N A;  1JHF A;  1OFC X;  4I0B A;  2DO7 A;  3ERE D;  3LSR A;  1BN5 A;  4A3M J;  4BBR J;  3A4C A;  2PQ8 A;  2HQ5 A;  2V26 A;  5AIQ A;  3ZMD A;  2XB0 X;  2VAS A;  1V54 H;  5ILV A;  3ABL H;  4GGG A;  4NC6 A;  2K27 A;  4L0Y B;  3JRE A;  4A3E J;  2P5V A;  1GVD A;  3S2W A;  3BZC A;  1XC5 A;  3QOD A;  5HDK A;  1JUS A;  3I9V 2;  3L00 A;  3P9C A;  1MBF A;  2VOD A;  3SZT A;  2XKP A;  4OIN F;  3JCU C;  2P5L C;  2LSO A;  3CES A;  3K2A A;  1Y8R B;  3UR3 C;  4ZDL A;  2CUJ A;  1ETO A;  4OIP F;  5J40 A;  4F91 B;  4Q5S F;  5GAG J;  4BQQ A;  1MZB A;  4CCJ A;  2WAE A;  4X0G A;  3VSK A;  5CVV A;  2NOJ B;  4IKF A;  1KYW A;  3FDY A;  3JAM Z;  2H6B A;  2FNA A;  3S8P A;  3I0T A;  4CGZ A;  1QHG A;  1APL C;  2H1L A;  4TV7 A;  3BR3 A;  2HR3 A;  3EYY A;  1JT6 A;  1SVM A;  3M8E A;  5IYD J;  3HG9 A;  5FO5 A;  2ZFU A;  4IOA F;  1HW1 A;  2ZKZ A;  2LBF B;  2KDO A;  1TT0 A;  1D0Z A;  3EUK L;  1ZRF A;  3MEX A;  4PSW A;  1ZLJ A;  3T8R A;  5EZG A;  2HXO A;  2VKD A;  4U0Y A;  3CJQ B;  2FD5 A;  3A1Y A;  3U2R A;  2H94 A;  1J9I A;  4RAY A;  3K7A J;  3TBI A;  4ETS A;  2JQ7 A;  4M6Y A;  2CYY A;  2OTL I;  2QSF X;  3Q3S A;  2QSH X;  6PAX A;  2F5V A;  4RDU A;  3S3N A;  2JA5 J;  3BRO A;  1ZRE A;  5C4X J;  3FXO A;  5E3M A;  4EEF G;  4YFN F;  2A6E F;  2F4I A;  4QTR A;  2FUG 2;  2VE8 A;  1TWC J;  2K5C A;  5KVR A;  3CUQ A;  2QEN A;  4NHJ A;  1Z3Y A;  1R9T J;  5FD5 A;  3JSO A;  1TWG J;  4PUS A;  4CHU A;  2EV0 A;  2MH9 A;  3S2D J;  4D9J A;  3OOU A;  3CP2 A;  2PJR B;  1I1G A;  2M30 A;  4E7K A;  2XPU A;  1A31 A;  9ANT A;  1Z05 A;  3KP5 A;  4XRS A;  4NQW A;  2Y69 H;  3DPT A;  2GLO A;  3HSF A;  2ECC A;  3EPZ A;  4XN0 A;  2R7R A;  3BR6 A;  3KEO A;  4I7H A;  2OCE A;  4D5C A;  1FEX A;  1D8K A;  1I3A A;  1HST A;  1QHH D;  2GAU A;  4L5E A;  4U0W A;  4Y13 A;  1ZG3 A;  3R0J A;  4HDU A;  3SQN A;  3H1C A;  2TDX A;  1NK3 P;  3PM1 A;  4RB0 A;  3C2B A;  2PX9 A;  2QKM B;  3L2U A;  4A0Z A;  4PJ0 C;  4NBQ A;  4MQ9 F;  2GOX B;  4A6D A;  5B1A H;  1MH4 A;  3PJR A;  2DA2 A;  1OCP A;  1WJD A;  3BPV A;  2QCO A;  3E5U A;  3J7Y J;  2C6Y A;  4BY7 J;  1R7J A;  3E6B A;  1P7J A;  4G6Q A;  4IOC F;  3HOU J;  4ZZL A;  4YFX F;  2HZD A;  3I3L A;  2IA1 A;  2IS1 A;  2FBK A;  1Y1W J;  1XX5 A;  2X1C A;  3KEQ A;  4LOC A;  5D5W B;  3RQI A;  3FMR A;  2E1M C;  4IHS A;  1WKM A;  2E2J J;  2K9Q A;  1G3S A;  1X1C A;  3RKQ A;  1N75 A;  5LEJ A;  3J80 Z;  2DMQ A;  1HW5 A;  3HTS B;  4RA2 A;  1O3R A;  2PMU A;  3NEU A;  1FMW A;  1F43 A;  3ZMS A;  4OAZ A;  5CVR A;  5KCM A;  2R5Z A;  5J8C A;  4A3C J;  4FT8 A;  2CV1 A;  3FK6 A;  4E7S A;  5JVG F;  3H5N A;  1Q1H A;  5HNF A;  3I56 I;  4RB2 C;  3OYG A;  1KQ0 A;  4AYB A;  3RKY A;  3CUQ C;  1MSF C;  1MJB A;  1Z91 A;  5HNH A;  2WV1 A;  3BTI A;  4EV0 A;  2KZV A;  2XF6 A;  2ZJ2 A;  2KMU A;  2IBD A;  1ZKG A;  3IH3 A;  3O8G A;  2XGC A;  3ECO A;  2X4H A;  5EEA A;  2KLO A;  3NQO A;  2VN2 A;  5DM6 F;  3W6K B;  3CZ6 A;  1X58 A;  3QAH A;  1UFM A;  3B6A A;  4MTE A;  4ABZ A;  5DS9 A;  1JTX A;  3E5Q A;  1B72 B;  2NXN B;  1SD7 A;  2HYJ A;  2ZO4 A;  5FJ8 J;  5FFX A;  5K1Y A;  1TW2 A;  3GME A;  2KRC A;  4P5O A;  2V6C A;  2E60 A;  1LDD A;  5C3E J;  4GDF A;  4UVB A;  1T6S A;  1KGS A;  3KZI C;  3OYB A;  2UXN A;  3RDI A;  3CTA A;  2K9S A;  1U0J A;  3R4K A;  1OYI A;  2VXD A;  1P92 A;  2D5V A;  3DTK A;  3HXL A;  4C2U A;  3F8F A;  1X2N A;  3P5J A;  4LK1 F;  5HVQ C;  1YQA A;  1K7A A;  1PYV A;  3MKL A;  3P9I A;  3DF8 A;  4BYY A;  2R7S A;  2DA1 A;  3V42 A;  1PDN C;  1HQC A;  2WV0 A;  3X2Q H;  1SFU A;  2XAF A;  2ELJ A;  2DA4 A;  4EJV A;  3F6O A;  1I27 A;  3V8J A;  4IRH A;  3M07 A;  1GV2 A;  5HS8 A;  3MKW B;  1T95 A;  5IYC J;  2V1X A;  2EH3 A;  1YW9 A;  3HHH A;  2LBF A;  5M3M J;  1YIT I;  5DUI A;  2F5D A;  2V6E A;  1AWC A;  4A3G J;  1MNM C;  2IVM A;  3MQ0 A;  3CF5 F;  1J5Y A;  2XAJ A;  5LHG A;  3CCS I;  4JQF A;  5IPA A;  1GV5 A;  2CW0 F;  3EQL F;  3BG9 A;  3FBN B;  5FLV A;  1SD6 A;  2RQQ A;  3HOX J;  3CJR B;  2BV6 A;  5GTH C;  5LGN A;  1J0R A;  2R7Z J;  5E1X A;  1QVU A;  4UVA A;  2P6S A;  2DA7 A;  2LR8 A;  4NC7 A;  2OAZ A;  5FB2 A;  3RPU A;  1P9Q C;  3HKZ N;  4UHT A;  1T8I A;  5ED4 A;  3FXQ A;  3JRH A;  5BPD A;  4A3L J;  1IN7 A;  3KP4 A;  4XOT A;  1W5C C;  5TJJ A;  3HM5 A;  4OAY A;  3F72 A;  1XSX A;  2P4W A;  1LFB A;  2JA7 J;  4R8H A;  3WGG A;  1U3E M;  4UUS B;  2MYS A;  5DD4 A;  4II2 A;  3OYH A;  3S3M A;  2XKO A;  2NVX J;  3QQA A;  2NS7 A;  2VKE A;  1ZGW A;  2PJR A;  2XPV A;  4E7L A;  3QYF A;  1YE9 A;  4MHG A;  4P9F A;  4M3B A;  5BOX A;  1X2M A;  3A01 B;  3H35 A;  3OWT A;  3CQZ J;  1IXS B;  5FLM J;  2M4K A;  3D1N I;  4V19 K;  4PJN A;  4HW0 A;  1Z7U A;  2XGD A;  1JHH A;  2KRF A;  4S0H B;  4HYE A;  2L7M P;  3GLX A;  1Y8Q B;  2JA6 J;  3HDD A;  3PIO F;  2R7V A;  4XK4 A;  3IH2 A;  5EG0 B;  1Y0U A;  1UZC A;  2CUF A;  2G9W A;  1DU6 A;  2OU2 A;  3BTC A;  3K2Z A;  2F5F A;  1VQK I;  4HF2 A;  2HI3 A;  5E1W A;  4MO7 A;  5A2Q Z;  2LF8 A;  5F1R A;  2OQG A;  2K3P A;  1X4P A;  2KPM A;  3IH4 A;  2BY0 A;  3GZ5 A;  4E7Z A;  4ESJ A;  4A3D J;  3HC7 A;  3BWG A;  2OZU A;  3HIF A;  3FBI B;  4L9J A;  4KIB A;  4HA8 A;  4Z2Y A;  1J2X A;  4Y17 A;  1BW5 A;  4A5M A;  2MD5 A;  4MLO A;  4MFD A;  1MW7 A;  1VFC A;  3KET A;  1Z7L A;  2X51 A;  3OYI A;  3U1K A;  2R7O A;  2OUM A;  2LLK A;  2A6T A;  4BS9 A;  3A2K A;  2CGP A;  2JUG A;  2RC4 A;  3T8T A;  5IP6 A;  4XKC A;  1R1V A;  3U9G A;  4RGU A;  3K70 D;  4J01 A;  3BQZ A;  2DT7 B;  1ZGA A;  2Q0O A;  4FX4 A;  1P4A A;  5D5V B;  5F0F A;  2VPL A;  1FBQ A;  5FKL A;  3LQR A;  4HX4 A;  3WU0 A;  2D45 A;  2HGC A;  2JZY A;  1R5H A;  2PLY A;  2VL8 A;  5LEK A;  1W7P A;  2GZW A;  1J09 A;  3S93 A;  2QLZ A;  1TNT A;  1X3W B;  1UG0 A;  5EJC A;  3BG7 A;  5J3L A;  3A02 A;  3H5A A;  2KIS A;  3JRA A;  2XAH A;  3ZMZ A;  3EUH A;  2QWW A;  2RN7 A;  4GYG A;  3FHN A;  3NRV A;  4XL9 A;  2LY9 A;  3I5U A;  1B72 A;  1ORK A;  2JPC A;  3KE2 A;  3H9J A;  3H3U A;  3LSK A;  3WTY C;  4RAF A;  3TP3 A;  1RNL A;  1YJN I;  5IT3 A;  1SEU A;  3I4N J;  4B43 A;  4GCV A;  4RGX A;  4HV6 A;  2VJ4 A;  2Q1Z B;  4KT5 C;  4DIQ A;  1MSE C;  1YS7 A;  3BG5 A;  1Z21 A;  1WFX A;  2VON A;  4V2G A;  2O7O A;  4BL0 B;  1UHW A;  3LSG A;  3L9F A;  2E35 A;  5JLW A;  1HDP A;  4OU0 A;  2K9L A;  3ASN H;  3WE3 A;  1KA8 A;  1D0X A;  5F64 A;  3VYS B;  3FK7 A;  4U0V A;  5LRS A;  5M5X J;  1YI2 I;  2GA2 A;  4G8X A;  2HYF A;  3ZMU A;  2XF7 A;  4BDY A;  4V2F A;  4BE2 A;  2L01 A;  4O3M A;  3W2A A;  1LUJ B;  3I59 B;  1VI0 A;  2GM4 A;  5H6R A;  1SD5 A;  1E3P A;  2K3F A;  1T0F C;  2Q2E B;  3H3Z A;  1NG7 A;  4PJJ A;  3JRF A;  1D5Y A;  3K4B A;  1BOA A;  3R61 A;  3IAS 2;  3KP3 A;  5CJ9 A;  2EFN A;  1W36 D;  1D1C A;  1JTY A;  2XGX A;  4I0A A;  5H6Q A;  4M3E A;  3GCM A;  4O5V A;  1FIA A;  1TQI A;  5L3F A;  2P7V B;  3QOP A;  4XLF A;  4FCY A;  2VUM J;  2UWM A;  1WQ2 A;  1RC9 A;  2JT1 A;  3HRS A;  3KIO A;  3J81 K;  2WAQ N;  2V9K A;  5CKT A;  4G6T B;  3W6J B;  2R92 J;  1UMQ A;  2AS5 F;  2VOP A;  2R4G A;  1R5I D;  1X4O A;  3G1O A;  4E7I A;  1N77 A;  4ENJ A;  1Y1V J;  3N97 A;  2E5Z A;  1H0M A;  1UG2 A;  5CVU A;  1IUY A;  5DCF A;  2ICW G;  3HOW J;  1V4R A;  5M3F J;  4PDK A;  2N8G A;  4P55 A;  2WY8 Q;  3LQQ A;  4BQO A;  5GAD J;  2IJL A;  4UUS A;  2KDZ A;  2ETH A;  3G73 A;  4HQE A;  1IJW C;  4A69 C;  3WG7 H;  4UUV A;  4Y7N J;  5H20 A;  3HJE A;  2YX4 A;  2RNG A;  3WTZ A;  5LLQ A;  1R6R A;  2JWT A;  1S72 I;  3WTW C;  4ESB A;  1QPM A;  3GTP J;  3H3V K;  2XHK A;  3S17 J;  4PK4 A;  3BOQ A;  2OD5 A;  3A01 A;  1EF4 A;  2OV7 A;  1XG1 A;  2DTR A;  4O6J A;  2KIM A;  4WXC A;  4XLH A;  4M6V A;  3RPU D;  4WX9 A;  1IRF A;  5E79 C;  3UNG C;  5GAH J;  3GTJ J;  2QQ9 A;  3TL4 X;  2IS2 A;  1GDT A; 
#chains in the Genus database with same CATH homology
 1JUS A;  1GUU A;  2EZK A;  1MBF A;  2ME0 A;  2XGE A;  5EG0 A;  4XRM A;  4JX4 A;  1ETQ A;  1U9O A;  5FKO A;  2ID6 A;  5JLX A;  2O8K A;  3SJM A;  3K2A A;  2DJN A;  1ETO A;  2LKX A;  2EQR A;  3ZOB A;  2K9N A;  3BR0 A;  3JRI A;  1BA5 A;  3B6C A;  4BY1 J;  4XIC A;  3RZO J;  4X1E A;  2XSD C;  1JJ8 C;  1APL C;  3BR3 A;  3RZD J;  1O4X A;  5M5Y J;  1JT6 A;  3OSF A;  1LFU P;  2NVT J;  2YS9 A;  3TW6 A;  1Z77 A;  5IYD J;  1RET A;  1QPI A;  2X48 A;  2COB A;  1AU7 A;  5F0C A;  5F08 A;  2L0K A;  5EYR A;  2ECB A;  1PUF A;  4DZJ A;  1FTZ A;  5EZG A;  4DZP A;  2HXO A;  4FIS A;  2MG4 A;  4QIW N;  2FD5 A;  5C4J J;  1FJL A;  3W6V A;  1T33 A;  3K7A J;  5F04 A;  3LSJ A;  4DYC A;  3Q3S A;  3Q0U A;  3QPS A;  4RDU A;  2PMZ N;  1B8I B;  2M8G X;  2CJJ A;  1JKR C;  2JA5 J;  3A03 A;  5C4X J;  1LE8 B;  5E3M A;  4EEF G;  4A93 J;  4QTR A;  1WH5 A;  4NDL A;  1TWC J;  5GPC A;  1R9T J;  2RAE A;  1W0U A;  4BXX J;  1TWG J;  4A3K J;  5C44 J;  1I6H J;  5EF6 A;  3S2D J;  3HBL A;  3OOU A;  1YRN B;  4DW6 A;  4IEJ A;  2XPU A;  2YU9 J;  9ANT A;  2JJ7 A;  5IP7 J;  1MBG A;  4XRS A;  1TWA J;  3UKG A;  2GLO A;  2ECC A;  3BR6 A;  1TC3 C;  1RR7 A;  5FKN A;  1NK2 P;  1S7E A;  4D5C A;  4D7M A;  3QPL A;  1ZK8 A;  4CYC B;  1FEX A;  4DYR A;  4L5E A;  4C3J J;  3ZQH A;  1NK3 P;  2DMN A;  3PM1 A;  3GTM J;  3C2B A;  1AKH B;  3FKI J;  4DYQ A;  4A3F J;  3S14 J;  1FTT A;  2JK3 A;  1MH4 A;  2VPR A;  3HEF A;  1ETW A;  2M34 A;  2DA2 A;  4B3A A;  1OCP A;  2QCO A;  3IV5 A;  4BY7 J;  1P7J A;  1VND A;  3HOU J;  4M3G A;  1Y1W J;  2ME6 A;  2Y30 A;  5EGO A;  4LOC A;  1OJL A;  2Y0S N;  3RQI A;  1JKP C;  3JRB A;  1H88 C;  5K7Z A;  3JR9 A;  1JGG A;  2E2J J;  2K9Q A;  3RKQ A;  5J1Y A;  2DMQ A;  2JMW A;  1A6I A;  2CRG A;  3HGG A;  2MSY A;  1F43 A;  1DU0 A;  2AHQ A;  2R5Z A;  1AKH A;  2R93 J;  4A3C J;  2E1O A;  4FE4 A;  1ZR4 A;  3FK6 A;  2CQX A;  3MVP A;  2ELK A;  1MSF C;  1WGX A;  2WV1 A;  2JA8 J;  4A3B J;  3BTI A;  3H0G J;  3SFI A;  3ZQG A;  1F36 A;  2QF7 A;  3LNQ A;  2H8R A;  3BQY A;  2E2I J;  1WH7 A;  1ZKG A;  2IBD A;  2IAI A;  3IH3 A;  3O8G A;  3OSG A;  1ZQ3 P;  3ZQI A;  2XGC A;  1W0T A;  1JUM A;  1CQT A;  3F0C A;  5EEA A;  4C2M J;  1X58 A;  2P81 A;  2M0C A;  3B6A A;  1SAN A;  2HOS A;  4ABZ A;  3S15 J;  5DS9 A;  1IDZ A;  1JTX A;  4J19 A;  2R5Y B;  1B72 B;  4IHX A;  5IOY A;  2HYJ A;  5FJ8 J;  5BNG A;  2B63 J;  1I3Q J;  2E2H J;  4IHV A;  1UHS A;  1ETX A;  5C3E J;  1E3O C;  1TWH J;  3GTQ J;  3O8H A;  1GT0 C;  2NVY J;  4AYB N;  5GPA A;  2EZI A;  2K9S A;  2DMP A;  4XID A;  3CCY A;  5E3L A;  4AC0 A;  1K61 A;  3MN2 A;  2D5V A;  1X2N A;  3M3Y J;  5IP9 J;  3MKL A;  3HOZ J;  3FIS A;  2Y9Z A;  2IEK A;  3GTK J;  2DA1 A;  1IV6 A;  2FJ1 A;  2DA4 A;  2WB1 N;  3GBG A;  5IYB J;  3JRG A;  1GV2 A;  2LVS A;  2LK2 A;  5IYC J;  4IHW A;  1FIP A;  2EH3 A;  5EZH A;  5DTD A;  2FQ4 A;  2VI6 A;  5M3M J;  4A3G J;  1MNM C;  2R0Q C;  4XRS G;  1G2H A;  4MFE A;  5IPA A;  1QVT A;  1BJZ A;  1GV5 A;  3BG9 A;  1T56 A;  3NAU A;  5FLV A;  3HOX J;  3BR5 A;  2R7Z J;  4FTH A;  1QVU A;  2DA7 A;  2LR8 A;  1JKQ C;  2OPT A;  3HKZ N;  4BBS J;  1B8I A;  3G1M A;  2LFB A;  3JRH A;  1LE8 A;  2M9H A;  2KT0 A;  4AUX A;  1JT0 A;  4A3L J;  1HLV A;  2L9R A;  4I6Z A;  3HM5 A;  1K83 J;  2DTZ A;  3BR2 A;  2LD5 A;  5F27 A;  1LFB A;  2JA7 J;  2XRL A;  3S1M J;  4UUS B;  2TRT A;  2Y9Y A;  1ETK A;  2NVX J;  1U9N A;  1Z0X A;  3QQA A;  2NS7 A;  2VKE A;  4B4C A;  1ZGW A;  2DMT A;  3JRC A;  1YRN A;  2XPV A;  3HGY A;  1ENH A;  3NAR A;  4M3B A;  1X2M A;  2LP0 A;  2I10 A;  3A01 B;  2MW8 A;  3CQZ J;  5J1R A;  1HCR A;  5E3N A;  5FLM J;  3BG3 A;  3D1N I;  3HOY J;  2LTP A;  4M3D A;  4CYC A;  4JX6 A;  3Q0V A;  2XGD A;  3L1P A;  5FKM A;  3FIW A;  1ZTR A;  4S0H B;  2L7M P;  2JA6 J;  3HDD A;  3S1N J;  4XK4 A;  3IH2 A;  5EG0 B;  2CUF A;  1IDY A;  1DU6 A;  3BTC A;  3DEW A;  2HI3 A;  2YUS A;  4MO7 A;  2OF7 A;  1ETV A;  1H89 C;  4Y52 J;  4IHY A;  1MH3 A;  3ZQF A;  4BKX A;  1WPK A;  4W97 A;  1A5J A;  5F0H A;  2HOT A;  2ID3 A;  3IH4 A;  3VPR A;  4A3D J;  4C3H J;  3GTL J;  5K7F A;  2M2E A;  1BW5 A;  3HOV J;  1IRZ A;  4MFD A;  4MLO A;  1Q1V A;  4I76 A;  1VFC A;  4A3J J;  3S16 J;  3S1Q J;  2LLK A;  1JUP A;  2NOG A;  3TED A;  1RKW A;  1HDD C;  2XB5 A;  5IP6 A;  3G1L A;  2L7Z A;  3HB9 A;  1MBJ A;  3S1R J;  1OCT C;  5HOD A;  2CU7 A;  4QSH A;  1PUF B;  2Y31 A;  3BQZ A;  5IOZ A;  5F0F A;  3BTJ A;  1ETY A;  5FKL A;  2DN0 A;  4HNV A;  1IGN A;  2VKV A;  2H1K A;  1BW6 A;  3S2H J;  1XS9 A;  1QRY A;  2G0E A;  1U8B A;  1MBH A;  3Q0W A;  2L7F P;  1SFO J;  1BL0 A;  4W1U A;  4D7N A;  2AO9 A;  5J3L A;  3A02 A;  3WHC A;  2CUE A;  3JRA A;  5M5W J;  2HOA A;  4MIM A;  3I4M J;  3JRD A;  2LY9 A;  2R5Y A;  1B72 A;  1ORK A;  5EDN A;  3PO3 J;  5E3O A;  3TP3 A;  2DA6 A;  2DA3 A;  3I4N J;  5FKK A;  1RKT A;  1MBK A;  2TCT A;  4M3F A;  2DMU A;  2Y2Z A;  1MSE C;  3BG5 A;  2MGQ A;  4X6A J;  3WHB A;  5GP9 A;  4V2G A;  2O7O A;  1MBE A;  3LSG A;  5JLW A;  1HDP A;  3TW7 A;  4GFB A;  3E7L A;  5K7H A;  1TWF J;  3FK7 A;  1ZR2 A;  2JN6 A;  5M5X J;  2GBY A;  2NS8 A;  3LSP A;  2EZH A;  4FE7 A;  4V2F A;  4JYK A;  2NVQ J;  3ZQC A;  3BTL A;  1ITY A;  1VI0 A;  4RBO A;  2GM4 A;  2HDD A;  1U78 A;  1IUF A;  2W48 A;  1AHD P;  1P7I A;  3OIO A;  1D5Y A;  3JRF A;  2O9L A;  5F1J A;  1JTY A;  5EGO B;  2HXI A;  4M3E A;  3M4O J;  1FIA A;  1I50 J;  3CMY A;  1POG A;  2DA5 A;  4FCY A;  2VUM J;  4D5F A;  3BR1 A;  2WAQ N;  4JX5 A;  2R92 J;  3GTO J;  1UMQ A;  4A3I J;  4B1R A;  2CQQ A;  3LOC A;  3G1O A;  2R5Z B;  1H8A C;  1Y1V J;  1JKO C;  4UUT A;  1HF0 A;  3SDG A;  3DCF A;  1WCM J;  1UG2 A;  2ZB9 A;  1RPW A;  3HOW J;  5M3F J;  1RES A;  2N8G A;  1JJ6 C;  4UUS A;  2X6O A;  2KDZ A;  1IG7 A;  3TP0 A;  1WI3 A;  1IJW C;  2E19 A;  1VF9 A;  1NTC A;  1OFC X;  2EBI A;  4A69 C;  4Y7N J;  3LSR A;  3BT9 A;  2X9D A;  4A3M J;  4BBR J;  2EZL A;  4C3I J;  5J1U A;  3PO2 J;  2JWT A;  2HQ5 A;  2K40 A;  3H3V K;  3GTP J;  2XB0 X;  4G12 A;  3S17 J;  3A01 A;  2XPW A;  1EF4 A;  1XG1 A;  4JP0 A;  3JRE A;  3CDL A;  4M6V A;  2FX0 A;  4A3E J;  3GTG J;  3ZQL A;  1GVD A;  3GTJ J;  1IC8 A;  1HOM A;  1XC5 A;  1GDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...