2CO5A

F93 from stiv, a winged-helix dna-binding protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
KYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVLFLTEKGMKEFEELHEFFKKIVCHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Winged-Helix Protein from Sulfolobus Turreted Icosahedral Virus Points Toward Stabilizing Disulfide Bonds in the Intracellular Proteins of a Hyperthermophilic Virus.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus
molecule tags Viral protein/winged helix
molecule keywords VIRAL PROTEIN F93
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2co5A00
2IW5A 3NEUA 2DT5A 3HSFA 4LG0A 2IA2A 5CVJA 3WU0A 3GFIA 2Z33A 3JSOA 3WE3A 4A5NA 4M72A 1J59A 4LD5A 5H20A 1K79A 1BI2A 4YIIA 1BOAA 4I0AA 4ENMA 1L0OC 4LK1F 3GYHX 3FMSA 3CDHA 3ZMZA 2P8TA 4KA4A 1QGPA 2UXNA 3QP5A 4BHBA 4I02A 1KU2A 2HQRA 3RIRA 3C1DA 1SFXA 2IVMA 4MNUA 2PG4A 2PI0A 4HZFA 5JR3A 1VTNC 3V7RA 5D4SA 1I6XA 2NYXA 1ZG3A 3F8MA 3DKWA 3OOPA 1IN8A 5ERIA 3PQKA 4B09A 2A5YB 4BNCA 1U5TA 5BPDA 1BIAA 2WWYA 3LQRA 1R36A 4BYYA 1Z6TA 4AWXB 3HRMA 4L18B 2Z3YA 2XAFA 4R8HA 4N0BA 2DW4A 2QWWA 5L3DA 5FLXZ 1TLHB 4FHTA 1AOYA 4L9TA 4UVBA 4WXDA 3E6DA 5HDGA 3Q5FA 2K4JA 3ECOA 3DFGA 1J9IA 4I2OA 2NNNA 1MD0A 2XHKA 2M5WA 3KP6A 2K27A 3CUQC 3G3ZA 4D0PA 1F9NA 1WRJA 1Q1HA 3J81Z 3WTZA 2LSOA 3ZMTA 1YW8A 1QZYA 1YQAA 2W84A 2VONA 2OQRA 2MLKA 1HBXG 4M73A 2EK5A 3QU6A 4Q4ZF 2FBKA 1I5ZA 3QPHA 4KMUX 4ZH4F 1GVJA 1YG2A 1T98A 4CICA 5E20A 1UHMA 3LFKA 2A69F 4K2EA 4F7ZA 2LF8A 1FSEA 4P96A 1KYZA 1PP8F 4HBLA 4BHCA 3HTSB 4IXAA 4P9UA 4KYWA 1J75A 4WWCA 4RB3C 3O2PE 3GUDA 2KJBA 2JPCA 4RS8A 2P5LC 3R0JA 1Z05A 3F21A 2DQRA 1RIOH 4LB6B 3TO9A 3ELKA 1LNWA 4R1HA 3U9GA 1K78A 5DCMA 3RPUA 4ZZDA 1YS6A 1E17A 4A6EA 1K6OA 1O7FA 1ZH5A 1LDJA 3GLXA 1HW1A 2ESHA 2G9WA 4HQMA 3P7NA 1R58A 4GYIA 1U3EM 3IC7A 3K2ZA 5DUIA 3FF5A 2GXBA 1KA8A 2K02A 2IRFG 3TDUC 4L0ZB 1DPRA 3CO6C 2CYYA 3KP4A 2EFQA 3ERED 3K1NA 3KFWX 3EYYA 4HAMA 4KUMA 1NHAA 1GXQA 1ON2A 1Z91A 4HOBA 2FBIA 1RUNA 3GX4X 3BOQA 2MLGA 4XSXF 1SD4A 1EH6A 2PMHA 4IPAA 1P2FA 5HLHA 1KU9A 2XIGA 5KK1A 3VFZA 3VOEA 3IRRA 2YU3A 5LEJA 4Y13A 2DO7A 4JBAA 1BC7C 3S2WA 1P4AA 3BY6A 3V4GA 2JRTA 3R6SA 1SD7A 1YS7A 3GZ6A 4L0YB 1XD7A 2ZJ2A 1S29A 2DI3A 2K86A 2UZKA 2BBYA 5AIQA 4CYDA 2VT2A 4HF0A 3R61A 2F5CA 5ICGA 2O6GE 4PDKA 2MC3A 1YW9A 5FD5A 3I71A 3K0LA 3BPVA 5LRRA 4MTDA 4RAYA 3NRVA 1U78A 4M6XA 3DQVC 1HKQA 4Q5SF 3F22A 1YLFA 2A07F 2CWEA 4EMSA 3JSPA 1LVAA 1FBQA 4HF2A 3BJOA 4WXHA 3TKYA 1GXPA 3L09A 1MJAA 5CVIA 4UVAA 4XSZF 4ETSA 4YFNF 1I27A 2L01A 2XASA 5ILVA 3KE2A 4IRHA 1T0FA 3REOA 2QLZA 5J8FA 2HOEA 3HOTA 4WK8F 4HX8A 1QPMA 4EJWA 2STTA 2UWMA 5IT9Z 4KIGA 3E6MA 1ULYA 3HIFA 2FRHA 2L4AA 3KP2A 2M8EA 3JAMK 2W85A 1OYWA 2VN2A 2RKHA 5BMZA 2ZCWA 4RB1A 1Z7UA 4N9HA 4ENNA 1FBSA 1GHCA 2Q0OA 3QU3A 2DLLA 3NQOA 3RYPA 1R22A 2XROA 1OYIA 3RKXA 4AD9A 1XGMA 5D8LB 4ZZLA 1OKRA 2QQBA 2QYOA 1IXCA 1KYWA 3RKWA 1ZAOA 3AAFA 2IPQX 3N4MA 1G3SA 5FB2A 3JTGA 4BH9A 3F3XA 3LQQA 1OPCA 2D1VA 2L54A 2W25A 4MEYF 4HX4A 4IHTA 3M8FA 3J81K 1MDMA 3GXOA 1MKMA 5E17F 1BM9A 4YG2F 3D0SA 5HDKA 1LEAA 2E1NA 1KGSA 4HYEA 1IXSB 2Z99A 5FD6A 3KP5A 1HKTA 4EJUA 3DXJF 1RNLA 4WXCA 3CLOA 5D6EA 4HQEA 1I1GA 2QM3A 1SAXA 1S8NA 4OIPF 1ZLJA 4UUVA 2ZNZA 3T8TA 2YR2A 2Z5UA 4N9IA 1J5YA 3WU1B 1U8RA 4RB0A 4ZYHA 1TW2A 4ENKA 3RYRA 1UFMA 4S04A 3DV8A 1PDNC 2QENA 4CGZA 2FBHA 3BJAA 1IAWA 1MJBA 1FSHA 3ECHA 4OIRF 1EV7A 4ON0A 3OV8A 3WTSC 2OA4A 3DPTA 2NAZA 4L5JA 2WC2A 2BYVE 1LB2A 2ZKZA 3BROA 1I1SA 1YYVA 1KU3A 2M1BA 1XSDA 1S6LA 2EV0A 4P9FA 3IL2A 1TNSA 1ZRFA 1W7PB 2P7VB 1R23A 4EM1A 1U5TC 2DPUA 4OIOF 2BE5F 2P6SA 3CO7C 3EYIA 1QNTA 5LGUA 1IF1A 2V6CA 3F8FA 1BBYA 1QZZA 3HSRA 1LJ9A 2COMA 1FPQA 2A6EF 4HLYA 4CDGA 3KZZA 2PLYA 4LMYA 1HQCA 3K1MA 2E7WA 2VT3A 5LHIA 1BI0A 3I59B 3FMRA 2KJCA 4GCVA 2RC4A 4U88A 4U0YA 1XSXA 3KP3A 4EM2A 3JAMZ 3EETA 5LHGA 1ZREA 4JK1X 4XBFA 3TGNA 3COAC 1B9NA 5A2QK 2O0YA 4S05A 3E5QA 3FM3A 4Q48A 1H9GA 1P4WA 1EH7A 5ILSA 1SD6A 1ZGJA 5E18F 3MZHA 1XMKA 2FA5A 2XAHA 2EFOA 1G3YA 1KQ0A 1FYLA 2DQLA 4LLLA 1JHFA 4RGSA 3H3UA 4R79A 2BGCA 1HW2A 2EWNA 1CGPA 4U7BA 5AIPA 2FU4A 3CTAA 1FP2A 3R4KA 5H6QA 4LLNA 4EM0B 5F6FA 3LA3A 5DEQA 3O3KA 2ZXJA 3E6CC 5J8CA 2IA1A 4CZZA 5F1RA 2P5KA 1TBXA 4A5MA 2MH2A 1USTA 2MA3A 3BZ6A 2HTSA 1SFUA 3K9TA 1IZ1A 1LDDA 5DUKA 5FGMA 1R1TA 3C18A 2Z9OA 2GIVA 1ZARA 4HW0A 1YW7A 5TJJA 5LGTA 4XLNF 2L3DA 6PAXA 2IA0A 5CLSA 4PGHA 4G8XA 2P7CB 1FLIA 1L3LA 3EQLF 5ICCA 5DD8A 3DPLC 2IT0A 3IKVA 1TTYA 4MHGA 2Y0MA 5LGNA 2G7UA 5HS9A 4MQVA 1FY7A 3ROUA 2P5VA 2GA2A 2YPRA 2LNBA 2OAZA 2HKXA 3KP7A 4HDUA 5HLGA 1MJ9A 3ZMDA 4I98B 4EQQA 3TOBA 2KIFA 3MEXA 1KQ8A 5ICEA 3F72A 5HVQC 4GO1A 3CUQA 3SHFA 3DF8A 2CW0F 1BI1A 3ABTA 4RGRA 4AIHA 4NB5A 5D5UB 2IJLA 2NRAC 4XRFA 2Y75A 1P92A 5D4RA 1AWCA 2GXGA 4EV0A 5CVRA 3SZPA 1Z6RA 1RZ4A 1TW3A 2XUBA 2CG4A 2C6YA 2DBBA 2MBFA 2HWVA 3WTYC 2ISYA 3F8CA 1XCVA 1K78B 4FT8A 1O57A 2H6BA 1XCBA 3ZMUA 5A2QZ 4GGGA 5ED4A 4PCQA 3LA2A 4AIJA 1HSTA 2FE3A 5LRSA 2R7FA 2D1HA 1CF7B 1JGSA 2VBWA 2L4MA 3V7SA 3WTXC 1BIBA 2XAJA 3B02A 3TDZC 2EB7A 2HR3A 4KIBA 4HDVA 5DCFA 1MZBA 1JE8A 4EJVA 4M9XA 4QLCU 2XGXA 2CO5A 4G7ZF 4M71A 3E5UA 5K1YA 4LK0F 5AONA 5CJ9A 3O6BB 4UVCA 4YFXF 1XGSA 1WI9A 1IRGA 4PZJA 3MQ0A 2YX7A 2OZ6A 2O8XA 5EEGA 4M6YA 2HFHA 3BWGA 3F8NA 1FP1D 2JTVA 3I4PA 2E7XA 2HZTA 4OMZA 5D5WB 1Y0UA 2DAOA 3WE2A 2EA2A 4BAYA 3JTHA 2XKOA 2HGCA 2QQ9A 1ZHFA 3R0AA 1B59A 4GXOA 2A6HF 2FNAA 3U1DA 2W57A 2VXZA 3ZN1A 4A0XA 2V1UA 1MGTA 5CYVA 3CUOA 2FF4A 2PN6A 4HLXA 4I0BA 4ENJA 3PFIA 4EVIA 2R3SA 4M74A 3L9FA 2GAUA 1TQMA 2V9VA 1KU7A 4EGYA 1LQ1A 1ZLKA 1B9MA 4Y17A 3GWZA 4JQFA 1XDSA 2XAQA 4A12A 1XN7A 4AIKA 1Z1DA 2PMUA 5D5XB 2QZ8A 4A2UA 3T8RA 3GO5A 2ZBKA 1SMTA 2VOOA 3VEPA 1FT9A 1BN5A 2R7DA 4XLPF 1WSUA 1ZRDA 2PQ8A 3C7JA 4I09A 4LB5A 1PUEE 4U7DA 2K4BA 4IVNA 3I54A 1FBUA 2H94A 4G94A 4B8XA 5L3CA 3D5LA 1RUOA 4P5OA 3E5XA 1R1UA 1FOKA 3P9CA 2A61A 2OZUA 3GF2A 3HUGA 3JW4A 4Q47A 3F23A 3CJNA 3DEUA 3K69A 4KT5C 2RDPA 2K7LA 1YO5C 2LF7A 4CO8A 5E1WA 3I64A 3BP8A 2OU2A 3GFJA 1T6SA 5FO5A 3WTWC 5D5VB 1UHWA 2V1DA 1FZPB 1BI3A 2OD5A 4BQAA 4MTEA 4A0ZA 3FM5A 2DU9A 5DCMB 3T1BA 4OU0A 3J80Z 5BS6A 1E2XA 5CVVA 1S3JA 1OYYA 2ADUA 1K7AA 3GW2A 2JT1A 4RAZA 1W7PD 1DPUA 5IT9K 5IT3A 3ABUA 2TDXA 1MDMB 5DYMA 1O3SA 4CHUA 2PEXA 1G4DA 1V4RA 2B0LA 3ZN0A 3SXYA 2RVCA 2W24A 3EDPA 3FXRA 1SFEA 2BV6A 2E1CA 5L3EA 4HX7A 2ZMEA 2QQAA 3MFKA 1R7JA 1FYKA 4OMYA 4RB2C 5D6FA 2CFXA 2X4HA 1HXDA 5KVRA 1ON1A 3HRSA 1J0RA 3HSEA 2QVOA 4LGWA 1O3QA 3KLOA 4KN7X 3HYIA 4RGXA 2V79A 1XGNA 1YIOA 1UCRA 1C0WA 4UXNA 2CGPA 4GYGA 1B4AA 3ZQ7A 1TNTA 3KEOA 2HEOA 2XAGA 2HQNA 3MZYA 3C3WA 2VBYA 4LG0B 3W6JB 2VC0A 1S7OA 2VODA 3MCZA 1OMIA 2YX4A 2KKOA 3CUQB 4NHJA 1LDKB 2F5DA 3B73A 4KDPA 2KIMA 3I0TA 5E8GA 5LLQA 2AS5F 2LDUA 3FMQA 1O7LA 4L9VA 2ZO4A 1H0MA 3KCCA 3WGIA 3V8JA 1WQ2A 2D2WA 2VBZA 4IRIA 1T2KA 2FMYA 5EEHA 1WWXA 1QO0D 2ZFWA 3QPTA 4ZYGA 2VOPA 1W5TA 2XVCA 2MH9A 3KLNA 2ELHA 3LWFA 4E70A 2XV4S 2ACJA 3QP6A 1TQIA 1JXSA 3ML6A 1F5TA 1O3TA 3LA7A 1W7PA 2PFBA 2JPBA 4ESBA 3FHZA 2JSCA 4NQWA 2RNJA 4HV6A 3M7GA 3M9AA 4LFUA 2EFPA 1V3FA 2O3FA 1R1VA 3BJ6A 1SD5A 3PQJA 4LJZF 2F5FA 4OOIA 1ZRCA 4EJOA 3M8EA 1D3YA 4LLGF 4ESJA 2KRFA 2J5PA 4YFKF 1STZA 1W5SA 1XSVA 3RKYA 2HDCA 4BHPA 5K5QA 3F6OA 1ODDA 2DTRA 3HHHA 2VC1A 4Y15A 2VE9A 1WKMA 3HOSA 1G3TA 4MQ9F 1TQPA 1XGOA 1R5HA 2UXXA 1U2WA 3G73A 3SQNA 1R00A 2RGVA 2ZNYA 4FX0A 1D5VA 3MAJA 2MD5A 3T5XA 2HYGD 1IN7A 4A6DA 2HTJA 1DP7P 2O03A 2Q2EA 4EGZA 2HS5A 3IHUA 1H9TA 1HSJA 3WTVC 4ZYDA 2DPDA 4G6QA 1YTYA 3DP7A 3E97A 3M1EA 3RDIA 3WGHA 4O5VA 3FZVA 3U2RA 4L9JA 3VODA 2O61A 2RQPA 2KIUA 1F1ZA 4CXFA 4KMFA 3V8KA 3QRFF 2P4WA 3WTTC 2XRNA 1XDUA 1ZN2A 4H0EA 4Z2YA 2YSRA 1F4KA 3ZMSA 1U6GA 2LKPA 1B6AA 3WG9A 4O6JA 3P9KA 2Q8KA 5DV5A 4ESFA 5D8KB 1RI7A 4BXUA 3F6VA 4KIFA 3J7AO 1DUXC 4UV8A 1IRFA 4KICA 3EUHA 3L00A 5E8IA 3BDDA 2GZWA 2FQ3A 4UNOA 4WF2A 2IP2A 2HKOA 2ZMEB 2A68F 2EV5A 3T0YA 3VB2A 1UB9A 1FC3A 1BC8C 1ZGAA 1OR7A 1J2XA 4UHTA 3MWMA 3GFLA 4RGUA 2XKPA 3HTUA 1IN6A 3BPXA 2FMLA 3Q9VA 2QBYB 1FNNA 1ONVA 3E3VA 2P6TA 2F2EA 4I7HA 2RN7A 2VBXA 3HHGA 3Q9SA 2EV6A 1QQIA 4WX9A 5LEKA 1QBJA 2BEOA 4L9NA 5LHHA 2V1XA 3LAJA 2FOKA 5L3BA 2OBPA 3TQNA 2STWA 5BOXA 3GEZA 5FLXK 2EFNA 3SFZA 3RPQA 4WCGA 2VE8A 5JFRA 4MGRA 1ZG5A 5ILUA 2WTEA 2F5EA 3RTRA 3IRQA 1REPC 4G7HF 1USSA 2CSOA 1A04A 1IUYA 3V7CA 4O3MA 3H3ZA 2ETHA 3W6KB 1P6RA 1HKSA 1G3WA 1S7AA 2CQKA 3ZP5A 3R60A 3I5UA 3F8BA 2JZYA 3QOPA 4A0YA 2DK5A 2QUFA 2L02A 2RV8A 2EFWA 2GA1A 5J6XA 3WGGA 1FX7A 4P55A 1U5TB 3IWZA 1B1BA 3H92A 3L7WA 5FFZA 1D8KA 4DNCA 5L3GA 3IKTA 1CF7A 3E6BA 1D8JA 5HLIA 3LSTA 4U0VA 1PP7U 5CVUA 5F64A 1ZYRF 2J5OA 5L3FA 1IN4A 4MEXF 1YFHA 2FEZA 2FXAA 3GZ5A 3N97A 3K1PA 3RJPA 5JVTA 2M30A 1T38A 4G7OF 2PBIA 1KQ9A 2OQGA 4HF1A 3WTUC 1X3UA 1R5GA 4OINF 4G6DA 4ZYEA 2NNYA 4IRGA 5TRDA 4KFCA 4UV9A 1LEBA 1XB4A 2M45A 3ULQB 3P9IA 5HS8A 1W4MA 4U0WA 4M9ZA 3RI4A 5JI6A 4KN4X 4ASNA 1T39A 5DD4A 4AVPA 1EH8A 4OIQF 2D45A 5H6RA 3I58A 4KNYA 4L5IA 2DFIA 4QWQA 2A3SA 3I53A 5DDGA 4FX4A 3KZYA 3TO7A 3ZPLA 1DDNA 1G6NA 5E1XA 2PJPA 3GFMA 1JHHA 5ICFA 3GVAA 1FYMA 1ZG1A 1IXRC 4G9YA 3L2CA 3KEQA 1FWZA 3TO6A 4M9SA 5K5OA 3IWFA 5K5RA 1J7KA 5BQTA 3TOAA 2X0LA 4DQ2A 2G7HA 4YIFA 2GWRA 1HW5A 1XMAA 5FFXA 4IF4A 3FWEA 2H6CA 3HRUA 5LBQA 1IW7F 1IN5A 4TV7A 2DK8A 4EJTA 2H09A 3FXQA 3V8LA 1Z9CA 2ESNA 4PGGA 5JHUA 3QAHA 3KETA 3I59A 5HDNA 4IHSA 3HRTA 2FSWA 1P4XA 4HA8A 3FX3A 5HOOA 3J80K 2GQQA 3ISPA 1SMYF 1BJAA 4IJAA 2AXLA 3ZMVA 1O3RA 2EJRA 5E1ZB 3SZTA 3LAPA 2QBYA 5BPIA 5HS7A 2M87A 4HV5A 3WODF 2H27A 2Y48A 3FXUA 2WV0A 2HYFA 2EA4A 2ISZA 2NS0A 2FNPA 4I01A
chains in the Genus database with same CATH superfamily
4FQGA 2IW5A 3NEUA 2DT5A 1TL8A 4A3DJ 3HSFA 4LG0A 4XK4A 2IA2A 2X48A 5CVJA 3WU0A 1X2MA 3GFIA 1TZLA 2Z33A 4BUPA 3JSOA 2HQ5A 2WBMA 3WE3A 3DCFA 4A5NA 3CCLI 3WHBA 4Y52J 4M72A 1J59A 2R0QC 3KEYA 4LD5A 5H20A 1K79A 5C3EJ 3RSNA 1BI2A 4YIIA 1BOAA 2CH0A 4I0AA 2BY2A 4ENMA 2XF5A 1ZR4A 1L0OC 3SDBA 4LK1F 3GYHX 4MFEA 3FMSA 3CDHA 3ZMZA 3G2BA 3S16J 2O5RA 2PJRA 2P8TA 3S3MA 4KA4A 1QGPA 2UXNA 3QP5A 4BHBA 4I02A 2HDWA 1KU2A 2HQRA 3RIRA 3C1DA 1SFXA 1TT5B 2IVMA 4MNUA 2PG4A 2MSYA 2PI0A 3TP3A 4HZFA 3S17J 5GTIC 1AHDP 1WGXA 4B1RA 5JR3A 3ERMA 1VTNC 3BTIA 1X3ZB 3V7RA 1ITYA 5D4SA 1I6XA 1U9OA 2NYXA 1ZG3A 3BR5A 5LFAA 3F8MA 2DOEA 2DA3A 3ZGKA 3DKWA 2NXNB 4QTRA 3OOPA 1IN8A 1W0UA 5ERIA 4XIDA 4EEFG 3PQKA 4XRSA 4E7ZA 4B09A 3LL7A 4YEJA 4D5FA 4OWRB 2A5YB 4BNCA 2XPUA 1U5TA 4IO9F 5BPDA 1WZ2A 2X1DA 1BIAA 1AA7A 3EUKL 2WWYA 3LQRA 1R36A 1SVLA 3HOUJ 4BYYA 1Z6TA 4AWXB 3HRMA 4RBOA 1RKTA 4L18B 3IAM2 3QQAA 2Z3YA 2BY3A 2XAFA 1WCMJ 4R8HA 4N0BA 3CCEI 4XKCA 2DW4A 5JVGF 2QWWA 5L3DA 1GDTA 5FLXZ 2ZXIA 2ZJPF 3IH3A 4I6ZA 1TLHB 2KQRA 4FETA 4XRSG 4FHTA 1AOYA 5IP7J 4L9TA 4V2FA 2OF7A 1NK2P 4UVBA 4WXDA 2OUMA 3G4SI 2RQQA 3E6DA 5HDGA 3Q5FA 2K4JA 1OJLA 3ECOA 1RR8C 2DMUA 3ZQCA 3DFGA 3HKZA 4I2OA 1J9IA 1PJRA 2NNNA 1UG0A 3P5JA 1MD0A 2XHKA 2M5WA 3V42A 1A35A 3KP6A 1OCZH 2P81A 4CCMA 2K27A 3CUQC 3G3ZA 4D0PA 1F9NA 3OWTA 4CCLA 1WRJA 4B47A 1Q1HA 3J81Z 4F91B 1FIPA 3WTZA 2LSOA 4A69C 3CCJI 1N77A 3ZMTA 1YW8A 1QZYA 1YQAA 1GVDA 2W84A 2XDVA 2VONA 2OQRA 2COBA 3CCVI 2MLKA 1H8AC 1HBXG 3JCUC 3L2UA 2HVRA 4M73A 2EK5A 3HG9A 3QU6A 2K5CA 2QGUA 4Q4ZF 2FBKA 4KITB 1I5ZA 3QPHA 4KMUX 4ZH4F 3BR3A 1GVJA 3CCRI 1YG2A 1T98A 4CICA 3O8HA 1Y1WJ 5E20A 1UHMA 2UV1A 3LFKA 4BE0A 2A69F 4K2EA 1VQ4I 4F7ZA 3OS1A 4X6AJ 2LF8A 3BG3A 1FSEA 1JUPA 5J4VA 2R5ZA 1W5CC 4P96A 3RKQA 1KYZA 2W1OA 1PP8F 4HBLA 4BHCA 3HTSB 4IXAA 4P9UA 4KYWA 2M0CA 1J75A 1UZCA 4WWCA 1OCOH 4RB3C 3O2PE 2RNGA 2HU9A 3I55I 1Y39A 3CC4I 5GADJ 5K7FA 3VDXA 1LKXA 2KRCA 3GUDA 2KJBA 2JPCA 2VKHA 3AG2H 2MABA 3A0BC 3R0JA 1Z05A 4RS8A 5C44J 3F21A 2DQRA 1A36A 1RIOH 4LB6B 4E4HA 2JVGA 3CMMA 3ELKA 3TO9A 1LNWA 4R1HA 2E5NA 3U9GA 1K78A 5DCMA 5FLVA 4IKFA 3RPUA 2CW8A 2FOWA 3BCAA 2K9QA 2KZGA 3BT9A 4ZZDA 1YS6A 2VJ5A 2X6OA 1E17A 2L0KA 3MN2A 4A6EA 1K6OA 1O7FA 3OYAA 1ZH5A 1LDJA 2F48A 3GLXA 1HW1A 2ESHA 1V5FA 2R93J 2G9WA 2CJJA 2JN6A 1A31A 2V4JC 4HQMA 2V1NA 3U1KA 2B63J 3P7NA 1R58A 1ETYA 4HSTA 2VJJA 4GYIA 1FIAA 1U3EM 2BVMA 3IC7A 3K2ZA 5DUIA 3LOCA 3FF5A 3VYTB 2GXBA 2LOOA 3BTLA 1KA8A 2K02A 2IRFG 1D0YA 4D7NA 2KDZA 3TDUC 4L0ZB 3HPGA 3N05A 2DT7B 3CDLA 1DPRA 1GV5A 3DU6A 4C2MJ 3FBNB 4BGDA 4PFOA 2VIXA 4LITA 2EIKH 3CO6C 2CYYA 3KP4A 2EFQA 1LVKA 2DYRH 3ERED 3K1NA 3Q0UA 3TP0A 3CESA 2DDAA 1DGWY 3QOEA 3KFWX 5IYCJ 2VL8A 2ECBA 1R9TJ 3JRAA 2L9RA 4CCNA 3EYYA 4BE1A 4HAMA 4KUMA 1TC3C 1NHAA 1T33A 5E79C 1GXQA 4AUXA 1ON2A 1Z91A 2DFHA 4HOBA 2FBIA 5EF6A 1RUNA 3GX4X 2KISA 1FEXA 1D1CA 3BOQA 2HPMA 1QPIA 2MLGA 4XSXF 2HXIA 1G2HA 1SD4A 1DU0A 1QZEA 1EH6A 2PMHA 4IPAA 1P2FA 4Y33A 5HLTA 4F3QA 3FXJA 1GT0C 1XC5A 5HLHA 1KU9A 2XIGA 5KK1A 3VFZA 3VOEA 3IRRA 2YU3A 5LEJA 3S14J 1WI3A 3GTJJ 3SYTA 4Y13A 2DDBA 2DO7A 4JBAA 5GPAA 3CMYA 3NARA 5IP6A 4BEHB 1BC7C 1XS9A 3CMAI 1B8IB 2R7QA 1QA6A 4YIRX 3PO2J 3S2WA 1P4AA 3BY6A 3D5RC 1GLNA 3V4GA 2JRTA 3R6SA 4AM3A 1SD7A 3WHCA 1JKOC 1YS7A 3GZ6A 4L0YB 3HJEA 1XD7A 2ZJ2A 1S29A 2DI3A 2K86A 2QSHX 2UZKA 2BBYA 3DEEA 3CC2I 5AIQA 2BHYA 3NWSA 4CYDA 3DU5A 4XKVA 2DT6A 3J7AY 2VT2A 4QPQA 1HDDC 4UB6C 4HF0A 4PK4A 3R61A 2F5CA 5ICGA 2O6GE 1VQLI 1SEUA 4A3BJ 1KZHA 4PDKA 3L2WA 2MC3A 1YW9A 5FD5A 3I71A 3K0LA 3BPVA 5LRRA 3DTKA 4J19A 2E36A 3RPUD 4MTDA 2MD0A 3ASOH 3RQ4A 4RAYA 1MIJA 3NRVA 2XGEA 1U78A 4M6XA 5B3SH 3DQVC 1HKQA 4Q5SF 5LD2C 2NS8A 3H36A 2CQ7A 2HI3A 4AYBN 3L2QA 2CQQA 2ELJA 4IHXA 1W1WE 3F22A 4XRMA 1YLFA 2A07F 4HNTA 4V19K 4EATA 2CWEA 3CJQB 4EMSA 2EZKA 3JSPA 1LVAA 2LP0A 1FBQA 4HF2A 5FJ8J 3PO3J 3BJOA 2ME0A 5EZHA 2OV7A 4WXHA 3TKYA 1GXPA 3L09A 1MJAA 3HZJA 4XONA 4BQOA 5CVIA 3S1QJ 1Y0NA 1BW6A 4UVAA 2LC2A 4XSZF 2CMPA 4ETSA 4YFNF 4KISA 1RKWA 4W97A 2W00A 1I27A 2L7MP 5FKKA 2L01A 3CLQA 2XASA 4DBRA 1Y56A 3ONQA 2NVUB 3BG7A 5ILVA 1MH4A 1OCRH 2R7XA 3KE2A 3PIOF 4IRHA 3S2HJ 1T0FA 3REOA 2QLZA 4C2UA 4F92B 5J8FA 1LPQA 1HLVA 2HOEA 1I3QJ 3ZOBA 2YUSA 2GIZA 3HOTA 2F4OB 1EA3A 4WK8F 4HX8A 4BQQA 1QPMA 4EJWA 3ZQGA 2STTA 2UWMA 5IT9Z 1X2NA 4KIGA 4BJTA 3CCMI 3E6MA 3KZIC 3EPZA 4IOAF 2LH9A 1ULYA 3HIFA 2FRHA 2L4AA 3KP2A 3ZCOA 2M8EA 3FHNA 3JAMK 5IOYA 3S3NA 1NTCA 2EIMH 2IGKA 2W85A 1P7JA 1VI0A 1OYWA 1X3WB 2VN2A 4N4OB 1Q1VA 3BR1A 2RKHA 2NOGA 1OQYA 5BMZA 2ZCWA 1F36A 5J1UA 2M0MA 4A3MJ 1HC8A 4RB1A 2LKXA 3MZ8A 2IS6A 1YITI 2DMQA 4DIQA 3S32A 1Z7UA 4N9HA 4ENNA 3E1SA 3ZQHA 4XOPA 1FBSA 4IHVA 1GHCA 4C3IJ 4BY7J 2Q0OA 4PJJA 2DODA 1APLC 2XGDA 3VYSB 2L7FP 4XL9A 3QU3A 4ZYAA 2DLLA 3NQOA 3RYPA 1GV2A 1R22A 2Y9ZA 1VF9A 2FQ4A 2XROA 1OYIA 2EZIA 4C3HJ 3RKXA 4AD9A 1W36C 2M7BA 1D1AA 1XGMA 5D8LB 5B5EC 1TT0A 4ZZLA 4A3KJ 1OR7C 1OKRA 3J7YJ 1T56A 2QQBA 2QYOA 4MO7A 3KPHA 1IXCA 1KYWA 3RKWA 1ZAOA 3AAFA 1PUFA 2QA4I 4XM3A 2IPQX 3N4MA 2OTLI 3VWBA 2V7FA 1G3SA 5FB2A 3JTGA 4BH9A 3F3XA 2MYSA 3LQQA 1OPCA 1X1PA 2D1VA 5J3LA 4FISA 2L54A 2W25A 4MEYF 4HX4A 2ZJRF 1A5JA 4IHTA 3M8FA 3J81K 2LY1A 1MDMA 3GXOA 1MKMA 5E17F 3PNYA 1BM9A 4YG2F 3D0SA 5HDKA 1LEAA 2E1NA 1KGSA 3OYDA 4HYEA 1D0ZA 1A6IA 1IXSB 2QEXI 2Z99A 4A3IJ 1E3HA 4CCJA 1PUFB 5FD6A 3DLAA 4HRIA 3KP5A 1HKTA 3MKLA 4EJUA 3DXJF 3LMMA 5IPAA 4OAZA 1RNLA 3ASNH 5DS9A 4NC7A 1Z7LA 4L5EA 5M5YJ 2NVQJ 4WXCA 3CLOA 3LSHA 4CCOA 5D6EA 4HNUA 4HQEA 1I1GA 2X51A 2ZC2A 1VFCA 2QM3A 2RAEA 1SAXA 1S8NA 4LOCA 4OIPF 2M2EA 1ZLJA 1TWHJ 2Y69H 2OC6A 4UUVA 2ZNZA 3T8TA 2YR2A 1RRJA 2Z5UA 5IYDJ 4N9IA 1J5YA 3WU1B 1UJ8A 3OYLA 1U8RA 2Z1DA 4RB0A 4ZYHA 3QWLA 1TW2A 4ENKA 3RZOJ 2ICWG 1ETQA 3RYRA 2Q2EB 1UFMA 4S04A 2HOTA 3BZCA 3DV8A 1PDNC 1MBKA 2JA6J 1IDYA 2QENA 4CGZA 2EILH 2FBHA 4DGWB 9ANTA 2QKMB 2CUZA 4QSHA 1O4XA 2VKVA 3BJAA 4M3FA 1IAWA 2CFOA 1MJBA 3GBGA 5DM6F 1FSHA 2CRGA 4IL6C 3ECHA 5DTDA 4OIRF 4BDYA 1EV7A 4ON0A 3OV8A 3FK6A 3WTSC 2OTJI 2OA4A 2FD5A 1YE9A 3GCMA 2M3AA 5B1BH 5TGTA 3DTIA 3DPTA 2NAZA 1ETKA 4ZTFA 3K6GA 4L5JA 1SC7A 3UR3C 2WC2A 2R7SA 2BYVE 3DTEA 1LB2A 2ZKZA 3H35A 1ZQ3P 3ESWB 3BROA 1I1SA 1VQPI 2NVTJ 3VYRB 1KU3A 1YYVA 1YX5A 3KYDB 4RMNA 4Y3OA 2M1BA 4X0GA 2HXOA 3FBIB 1S6LA 2EV0A 4P9FA 3TMOA 5E3MA 1XSDA 1TNSA 3IL2A 4XICA 1W7PB 2P7VB 1R23A 2WAQN 4D5CA 4EM1A 2R5ZB 1U5TC 5CQGA 2DPUA 3A03A 3A01B 1Z0XA 4OIOF 1UMQA 4ITVA 2BE5F 1K6YA 2P6SA 4F55A 3CO7C 3EYIA 2XGCA 1QNTA 2K9SA 4XMYA 5LGUA 1IF1A 1IGNA 2VLAA 2V6CA 3FXLA 2O8KA 4JX6A 1PVEA 3F8FA 4M3EA 1YX3A 1BBYA 1QZZA 3HSRA 3K4LA 3JRBA 1LJ9A 2IAIA 3VYUB 4D1QA 2COMA 1FPQA 2A6EF 2TCTA 4HLYA 2X6YA 4DZJA 3MKYB 1AKHB 4C2TA 3G6EI 2EZLA 4CDGA 3KZZA 2PLYA 4LMYA 1HQCA 3K1MA 2JA8J 2E7WA 3HDDA 1V54H 2VT3A 3OYFA 5LHIA 3I4NJ 3BZKA 3HKZN 3SZGA 2DN0A 1BI0A 3I59B 1QVTA 4DYRA 3FMRA 2LRDA 5H2FC 2KJCA 3TW6A 4GCVA 3CQZJ 2BVLA 1MNEA 3F0CA 3UKGA 2RC4A 4U88A 4U0YA 2R7RA 4DBQA 1XSXA 3A2KA 3KP3A 2JJ7A 4EM2A 3JAMZ 1ZR2A 2VQGA 2CV1A 3EETA 5LHGA 4LIVA 1ZREA 2BW3A 4JK1X 1WJ5A 4XBFA 2R7ZJ 3BLYA 5CKTA 1BJZA 5FKNA 3TGNA 3COAC 3S1RJ 4D7MA 1B9NA 5A2QK 2O0YA 4S05A 4F52A 5EGOB 3E5QA 3MD2A 2Q1ZB 2ZXHA 3FM3A 4Q48A 1H9GA 5KNLA 1P4WA 1EH7A 3IAS2 1VQ6I 4LG3A 5ILSA 1SD6A 1ZGJA 5E18F 4BS9A 3MZHA 1XMKA 3GTMJ 2FA5A 2ID6A 2XAHA 1D5YA 2EFOA 2XF6A 1G3YA 1KQ0A 4PJMA 2DQLA 4LLLA 1FYLA 1JHFA 4RGSA 3H3UA 4R79A 2BGCA 1HW2A 2EWNA 4RAFA 2ECCA 4U7BA 1CGPA 5AIPA 2FU4A 4BY1J 3CTAA 2A05A 1FP2A 2JA5J 3R4KA 1BW5A 5H6QA 1MMDA 4LLNA 2M7AA 2XAUA 4EM0B 2D5VA 1N25A 5F6FA 3H5RA 1RR7A 3LA3A 5DEQA 1S72I 3O3KA 4M6VA 1V5EA 2ZXJA 1Z21A 3E6CC 5J8CA 2IA1A 3W2VA 4CZZA 4BEHA 5F1RA 1LFPA 2P5KA 2CUFA 1TBXA 3E7LA 2E2IJ 1BR1A 3HXLA 4DYCA 4A5MA 3K4JA 2MH2A 1USTA 3DEWA 1WH5A 2L9SA 2MA3A 4BQNA 3BZ6A 2HTSA 3OIOA 4IX7A 1SFUA 3K9TA 1IZ1A 2PMZA 1LDDA 5DUKA 3BR6A 5FGMA 4U87A 3HOVJ 3LFUA 1R1TA 3C18A 4M3BA 2Z9OA 2GIVA 4FE7A 1ZARA 4HW0A 2EINH 4RM2A 2L9VA 4FE4A 1T8IA 4BJ5C 4A3CJ 1YW7A 4I76A 1D1BA 4FASD 2I10A 5TJJA 3TL4X 5LGTA 4XLNF 1RESA 4A3GJ 5GAGJ 4QIWN 2GBYA 1ACIA 2L3DA 4ZDLA 3CCYA 3JRHA 2KZVA 4M3DA 4CZCA 6PAXA 2IA0A 5F0CA 4CA0A 3K4MA 3K4BA 3D1NI 5CLSA 1R4MB 1MNMC 4PGHA 2KLOA 1MMSA 4G8XA 2OJED 2P7CB 1WFXA 2HYJA 2WV1A 1FLIA 1L3LA 2W48A 4V2GA 2OPTA 3EQLF 5ICCA 3M1CA 1IV8A 3I3LA 5DD8A 1YOVB 3DPLC 1JUMA 2B7EA 2IT0A 3CCSI 3IKVA 1JTXA 2KMUA 1TTYA 1POGA 2KRHA 3PNTA 3H1CA 4MHGA 2AXTC 1Y1VJ 2KDOA 2Y0MA 5LGNA 1IRZA 4HSRA 2E19A 2G7UA 5HS9A 1EF4A 4MQVA 3OYIA 1FY7A 3ROUA 2P5VA 2GA2A 2YPRA 3BG5A 2LNBA 2OAZA 3DLLF 2HKXA 3KP7A 4HDUA 5HLGA 1MJ9A 3ZQQA 4BE2A 3ZMDA 4HG2A 4GRIA 4I98B 4EQQA 3OMYA 3TOBA 2KIFA 3MEXA 1KQ8A 3LSMA 3F72A 5ICEA 1JJ8C 1F43A 5HVQC 2KFDA 2LYCA 4GO1A 3OYKA 1NK3P 3CUQA 2W4SA 1MMNA 2OCEA 3SHFA 4GDFA 3ABKH 4IQ4A 4PFPA 3DF8A 2CW0F 1BI1A 5K7ZA 2Y31A 3ABTA 1FMWA 4RGRA 3HOZJ 1N78A 4AIHA 1QVUA 4NB5A 5D5UB 3G1LA 3PSFA 2JUCA 2IJLA 5JHFA 2NRAC 1E0EA 5F08A 3WU2C 4XRFA 3SEQA 2P0WA 2Y75A 2L9NA 3MKWB 1P92A 5D4RA 1AWCA 2GXGA 4XQFA 1VQ8I 4EV0A 2LVSA 5CVRA 3SZPA 1Z6RA 3W2WA 1FTZA 1RZ4A 1TW3A 2BHZA 4B3XA 2XUBA 2CG4A 3LSIA 2P5LC 2C6YA 2DBBA 2MBFA 2HWVA 3WTYC 2ISYA 2K9LA 3F8CA 1XCVA 1XG1A 3NAUA 1FJLA 1K78B 4FT8A 1YIJI 1O57A 1JTYA 2H6BA 1XCBA 3ZMUA 3OS0A 5A2QZ 3L2VA 1H88C 1R4NB 4GGGA 2VQLA 4D9JA 5ED4A 1GUUA 4PCQA 3LA2A 3BQYA 2VKEA 2HVSA 4AIJA 1ERDA 1HSTA 2FE3A 5LRSA 2R7FA 2D1HA 4E7LA 1B72A 2M9HA 4W1UA 1JGSA 1CF7B 1DP3A 2VBWA 4E7IA 2L4MA 3V7SA 3WTXC 3PSIA 1BIBA 1BR2A 2DFFA 2XAJA 3B02A 3TDZC 2EB7A 2HR3A 4KIBA 4HDVA 4PJLA 5DCFA 1MZBA 1JE8A 4EJVA 1CQTA 3I56I 4JYKA 3OIPA 4BKXA 4ZDOA 4M9XA 4QLCU 2XGXA 2CO5A 4G7ZF 4M71A 2QSFX 3E5UA 5IYBJ 1XX5A 5K1YA 1SVOA 4LK0F 4IHYA 4ZDPA 5AONA 4MLOA 4BDZA 5CJ9A 1Z67A 5DM7F 2AQEA 2DA7A 3O6BB 4UVCA 3LSJA 4YFXF 1BOBA 1XGSA 2F4IA 5M3FJ 4II3A 3CF5F 1WI9A 4RA2A 1UHSA 1IRGA 1X1CA 4PZJA 2VJIA 3S1MJ 2UUZA 4N4NB 3MQ0A 1LFBA 2JUGA 2WY7Q 2YX7A 5FKMA 2OZ6A 2O8XA 1WHUA 5EEGA 1IC8A 1OLTA 2RREA 4M6YA 2HFHA 3BWGA 4CSWA 5EJCA 4M3GA 2IS4A 3F8NA 5FRNA 1FP1D 1A6QA 2JTVA 3I4PA 1OCTC 2E7XA 3DBLB 1V55H 2HZTA 4OMZA 3X2QH 3QODA 2KHMA 2Y0SN 5D5WB 1Y0UA 2DAOA 3WE2A 2DFEA 2EA2A 4BAYA 2IS2A 4UY8I 1LFUP 3JTHA 2XKOA 2W7NA 4KJZA 2HGCA 2QQ9A 1ZHFA 2XPWA 3C2BA 2X6WA 3R0AA 1B59A 1JJ6C 4GXOA 1WPKA 2PJRB 2A6HF 2FNAA 3U1DA 2ZFUA 4UUSA 2W57A 2MG4A 2VXZA 3ZN1A 2IEKA 4A0XA 2V1UA 1MGTA 1ETVA 3CUOA 3DPUA 5CYVA 5E3OA 2FF4A 2PN6A 1YHQI 4HLXA 4E7SA 5EG0B 4I0BA 3GTPJ 2K85A 1B8IA 2VASA 3H9QA 4ENJA 3PFIA 4EVIA 1ZK8A 2R3SA 1WJBA 4M74A 3L9FA 2F5VA 2GAUA 1TQMA 2R5YB 2V9VA 1VQOI 1KU7A 2M8GX 4EGYA 1LQ1A 1ZLKA 1JKRC 1B9MA 4Y17A 3GWZA 1IO2A 4JQFA 1VZ0A 4AC0A 1TWAJ 3OYMA 1JT6A 1X4OA 1XDSA 1MH3A 4J01A 2XAQA 4A12A 3AG1H 3GTKJ 1RETA 1XN7A 4AIKA 1H89C 3M07A 1Z1DA 2PMUA 5D5XB 2QZ8A 5HNFA 3W3CA 4A2UA 3T8RA 1FMVA 3GO5A 2ZBKA 1S9HA 3BTCA 2LY9A 1SMTA 3OR1C 2VOOA 3VEPA 2NVXJ 1FT9A 5GAEJ 1BN5A 2R7DA 4XLPF 1WSUA 2N8GA 4ZJZA 2R5YA 1ZRDA 3HGGA 2PQ8A 2R4GA 3PM1A 3C7JA 4CH7A 4I09A 3RCOA 1PUEE 4LB5A 5F1JA 1K83J 4U7DA 2K4BA 2A6TA 1ETOA 3H3VK 4IVNA 3H5NA 3I54A 5EDNA 1FBUA 1YRNA 2H94A 2V6EA 4NUBA 1MNDA 1Z3YA 4G94A 2L7ZA 4B8XA 2LBFB 5L3CA 3Q0VA 5TISC 3S3OA 3E0JB 3D5LA 1RUOA 2E1MB 4F93B 4P5OA 2CS3A 3E5XA 1R1UA 4B44A 1FOKA 2VKDA 2MC4A 3P9CA 2ZJQF 2A61A 3HM5A 1TWFJ 1ZTRA 2EPFA 2OZUA 3GF2A 3HUGA 3L1PA 2WY8Q 3JW4A 2EBIA 4RAGA 2F4MB 1SANA 1Z3XA 4Q47A 2CW7A 3F23A 1QRYA 3Q0WA 3PUFA 3CJNA 2XPVA 5J4YA 4B48A 3DEUA 3K69A 2XC7A 4KT5C 1VQ7I 5JLWA 2RDPA 2K7LA 1YO5C 3JRFA 2LF7A 4AIDA 4CO8A 2TRTA 5E1WA 3I64A 3BP8A 1NH3A 2VPRA 3CP8A 2OU2A 2EQRA 2LD5A 1OFCX 2IGMA 4XN0A 1FOYA 3GFJA 1T6SA 5FO5A 3WTWC 3QPSA 5D5VB 3I9V2 1M1EB 1UHWA 1MBFA 2XB5A 2HDDA 2V1DA 1FZPB 4IHWA 1JKQC 2K3PA 1BI3A 2OD5A 3DWLE 4BQAA 2R7OA 4MTEA 4A0ZA 3FM5A 2IBDA 3HL2A 2DU9A 1U9NA 4AU7A 5DCMB 3T1BA 4KT6A 1QU3A 1P9QC 5FRMA 1MBHA 5B1AH 4OU0A 1FTTA 3J80Z 5BS6A 1E2XA 3CF2A 3OIQA 2JMWA 1BR4A 2K3FA 2DA2A 3CCQI 5B66C 2FX0A 2V26A 4FCYA 3OL4A 1X1BA 3GTGJ 5CVVA 2BXZA 2YS9A 5KAFC 4RLFA 1S3JA 1OYYA 2ADUA 2M34A 4G12A 1K7AA 2E34A 3GW2A 3JRCA 2JT1A 1WVRA 4RAZA 3ZXSA 1W7PD 3A1YA 1DPUA 2JRMA 1ETWA 5IT9K 5IT3A 2X9DA 3ABUA 2V9KA 2TDXA 5DYMA 1O3SA 1MDMB 2ELKA 5F27A 4CHUA 2PEXA 5C4XJ 1G4DA 4DYQA 1V4RA 3K7AJ 5GPCA 1IG7A 1SVMA 2B0LA 3ZN0A 3FK7A 3UNGC 5IY5H 3LSPA 3SXYA 4E7JA 2RVCA 2IXSA 2W24A 3EDPA 2XRLA 3FXRA 4PJNA 5CPRB 3AKZA 1SFEA 3DKXA 3G71I 1SFKA 2I5UA 4XLCA 2BV6A 3BR2A 3J7ZI 3K70C 2K40A 2E1CA 1MMGA 3OY9A 3G1OA 4CCKA 5M5XJ 5L3EA 3DBHB 4HX7A 2ZMEA 3JRDA 1I6HJ 3HOYJ 2LTPA 3FIWA 2QQAA 3MFKA 3S15J 5BNGA 4ABZA 1R7JA 1FYKA 1OCPA 2QF7A 3PNVA 4OMYA 4RB2C 4I99C 5D6FA 2CFXA 1UG2A 2O7OA 2X4HA 3HPHA 3IUOA 4DW6A 2DOFA 3W2AA 1HXDA 2E2JJ 5KVRA 3M4OJ 1ON1A 3HRSA 1J0RA 3PFYA 3HSEA 3GTLJ 1DU6A 4ANJA 2QVOA 4LGWA 1O3QA 3KLOA 4KN7X 4B4CA 1KONA 2FUG2 3FKJA 4PJ0C 3HYIA 3AG4H 3CCUI 1U0JA 4RGXA 3CDIA 2V79A 2EH3A 5GTHC 2JA7J 1XGNA 1YIOA 1G8XA 3JR9A 1UCRA 2B9SA 1C0WA 2E5ZA 4JX4A 4DZPA 4UXNA 2CGPA 4GYGA 3GTQJ 1B4AA 4XKBA 3JRGA 3HEFA 3ZQ7A 1TNTA 2VQCA 3KEOA 2HEOA 2XAGA 2HQNA 3MZYA 3TBIA 3C3WA 2VBYA 2DA6A 3W6JB 5KHDA 3OYBA 1U8BA 3H0DA 1VQKI 4LG0B 3PIPF 2VC0A 1S7OA 2HQAA 4J00A 3K4KA 1XPXA 2VODA 2L7KA 3MCZA 2DA5A 1OMIA 1SAUA 2YX4A 4HEA2 2KKOA 3CUQB 4NHJA 1LDKB 2F5DA 3B73A 4KDPA 2KIMA 3I0TA 5E8GA 5LLQA 2VXDA 5IOZA 3FDYA 1Y8QB 2HVQA 2AS5F 2LDUA 3FMQA 1O7LA 4L9VA 1SFOJ 2ZO4A 1H0MA 3KCCA 3WGIA 3KIOA 3K10A 3GMEA 3NWTA 3V8JA 1WQ2A 1HA8A 2D2WA 1ETXA 2VBZA 3OSFA 4IRIA 1T2KA 2KP6A 2FMYA 5EEHA 1WWXA 3LNQA 1QO0D 2ZFWA 2F6CA 3QPTA 4ZYGA 5M3MJ 3L2RA 2VOPA 1MW7A 5JLXA 1W5TA 2XVCA 2XF7A 4PUSA 2LKSA 1IUFA 2MH9A 3H5AA 3KLNA 2ELHA 3LWFA 4E70A 2IS1A 4YELA 2XV4S 2R7UA 1P7IA 2ACJA 1EJ9A 3QP6A 1TQIA 2ZSHB 3CC7I 1JXSA 2IGOA 2JSPA 3ML6A 3BR0A 2JK3A 3LA7A 5K7HA 2JWTA 1W7PA 1O3TA 1F5TA 5KCMA 2PFBA 1VQMI 1MSEC 4A3LJ 2JPBA 4ESBA 3FHZA 1ZRFA 2JSCA 3GTOJ 4NQWA 2RNJA 4HV6A 3M7GA 2IGNA 3ABMH 2YU9J 3M9AA 4LFUA 2EFPA 1V3FA 2O9LA 2O3FA 1R1VA 3K70D 3BC8A 1EKEA 1OISA 4A3EJ 3BJ6A 1SD5A 3PQJA 4LJZF 3KYLA 1JUSA 1AU7A 1E3PA 1ZELA 2F5FA 2A5WA 4OOIA 3TW7A 2XSDC 1ZRCA 4EJOA 2VPLA 3M8EA 3EUHC 1D3YA 4LLGF 4ESJA 2KRFA 2J5PA 5F0FA 4YFKF 1STZA 3VSLA 3OYGA 1W5SA 2DCEA 2G0EA 3OOUA 1XSVA 1R5ID 1K4TA 3RKYA 2HDCA 2M4KA 5GP9A 4FTHA 4BHPA 5K5QA 2QKLB 3F6OA 1ODDA 3S93A 4IZZA 2DTRA 3SFIA 4OAYA 3HHHA 2VC1A 4Y15A 2VE9A 1WJDA 3QYFA 1QHGA 2LFBA 2GLOA 3DKYA 4XORA 3S1NJ 2HZDA 1WKMA 4ZC3A 3HOSA 1G3TA 4MQ9F 1TQPA 2WADA 1XGOA 1R5HA 2Y9YA 2UXXA 1U2WA 4CYCB 3G73A 1TWGJ 3SQNA 1R00A 2RGVA 2ZNYA 4FX0A 1D5VA 3M3YJ 2GXAA 3MAJA 3MMYB 3U21A 2PX9A 2MD5A 3T5XA 2Y0SA 3AFHA 2HYGD 2KT0A 2AO9A 1IN7A 3AG3H 3ZQIA 1IJWC 4A6DA 2OCCH 2HTJA 1DP7P 2E1OA 4II2A 2ZXWH 1T0FC 4RLQA 5C4JJ 3SEZA 2O03A 2Q2EA 4EGZA 2HS5A 3IHUA 4QPOA 2ME6A 1IDZA 1H9TA 1JGGA 1DQUA 1HSJA 3WTVC 1R71A 1FOXA 4BJ6C 1IV6A 4ZYDA 4CYCA 2DPDA 1S5LC 3GLLA 4G6QA 1YTYA 3OL3A 3DP7A 3E97A 4IEJA 2FJ1A 3M1EA 3RDIA 2KPMA 2NOJB 2BOLA 1ORKA 3BQZA 2BY1A 2X1EA 3WGHA 1OCCH 4O5VA 3FZVA 4XNFA 3U2RA 4L9JA 2GOXB 3HC7A 3VODA 2O61A 2I8DA 2RQPA 2X6XA 2VUMJ 4BL0B 1X58A 2KIUA 4PSWA 4XLFA 1F1ZA 2Y30A 4CXFA 4KMFA 1TWCJ 2QSGX 3V8KA 4BU2A 1QHHD 3QRFF 2P4WA 3WTTC 1B72B 4GFBA 2XRNA 1XDUA 1ZN2A 2PMZN 4H0EA 4Z2YA 2YSRA 5J47A 1F4KA 5EG0A 2XSJC 3ZMSA 3IP4B 2CUEA 3LSKA 1U6GA 3OYJA 3K4NA 3OSGA 2LKPA 3H9JA 3CJRB 4E7KA 1B6AA 2XB0X 1W0TA 3WG9A 4CUGA 4O6JA 3P9KA 2Q8KA 3BCBA 5DV5A 4ESFA 3W6VA 5D8KB 3EUAA 1RI7A 4BXUA 4A3FJ 3F6VA 4XLAA 2ZB9A 4KIFA 3J7AO 3ZQFA 1DUXC 4UV8A 1IRFA 4KICA 1LE8A 2WB1A 3IH2A 3EUHA 3MVPA 3L00A 5E8IA 4C30A 4ZTJA 5FLMJ 2VI6A 1UELB 3BDDA 5EEAA 2GZWA 2FQ3A 4UNOA 2LLKA 4WF2A 2IP2A 2HKOA 1W36D 2DMTA 2LR8A 2ZMEB 2Y2ZA 2A68F 2EV5A 3T0YA 2CV2A 2M4GA 3VB2A 1MSFC 3CD6I 1UB9A 1FC3A 1BC8C 1ZGAA 3SJMA 3CJTB 1OR7A 1UAAA 1J2XA 4G6TB 4UHTA 2GOMA 2EZHA 2X1CA 3MWMA 3GFLA 2X85A 4RGUA 2LK2A 2DJIA 2XKPA 1IRXA 1IN6A 3BPXA 2FMLA 3HTUA 3Q9VA 4XOTA 2QBYB 1FNNA 2DA1A 1ONVA 3E3VA 2P6TA 1VQ9I 2JQ7A 2F2EA 4I7HA 2R92J 2RN7A 2VB6A 2VBXA 3O8GA 3HHGA 1WJAA 2H8WA 3Q9SA 2EV6A 1QQIA 3ABLH 3BTJA 4WX9A 3TEDA 5LEKA 1K61A 2LREA 3RZDJ 1QBJA 2BEOA 4L9NA 5LHHA 2HPIA 1FOWA 2E2HJ 2BZTA 2V1XA 5E3LA 2FOKA 2AQFA 3ZR8X 3LAJA 1T08B 3IV5A 4PSXA 2BW3B 5L3BA 2OBPA 3TQNA 1X4PA 4E6KG 5BOXA 3BG6A 1YI2I 3GEZA 2STWA 3VSKA 5FLXK 2EFNA 3SFZA 3WG7H 3RPQA 3IH4A 4WCGA 5EGOA 2AHQA 2VE8A 5JFRA 4RM3A 2DMPA 3I4MJ 4MIMA 3FXOA 4MGRA 3C2HA 1K4SA 1ZG5A 3PJRA 1NG6A 1HCRA 5ILUA 2WTEA 2F5EA 3M8JA 2H1LA 1MBEA 5F0HA 3RTRA 3IRQA 1REPC 4G7HF 1USSA 1JI8A 2R7TA 2CSOA 1A04A 1WH7A 1IUYA 2CQNA 4JX5A 2EIJH 3V7CA 4O3MA 3HOWJ 3OYNA 3FXKA 3H3ZA 1X1AA 2ETHA 3W6KB 1BL0A 1P6RA 1HKSA 5GAHJ 3AL0C 1G3WA 2VJ4A 4UUTA 2LG4A 1S7AA 3OS2A 2CQKA 3ZP5A 3R60A 3I5UA 3F8BA 3S2DJ 2K9NA 4Y4RA 2JZYA 3QOPA 3DBRB 4A0YA 2DK5A 1WJEA 2JA2A 2QUFA 3SDGA 5KAIC 2L02A 2RV8A 2EFWA 2K9MA 4A3JJ 2GA1A 2WAQA 5J6XA 3WGGA 2DOAA 1LUJB 3F9KA 2HOAA 3BG9A 3LSGA 1YJNI 1VQNI 1FX7A 3FKIJ 1BA5A 5FROA 2W82A 4NQWB 3VPRA 4P55A 1U5TB 3IWZA 1B1BA 2WB1N 1LE8B 3H92A 5EZGA 3L7WA 5FFZA 4C3JJ 1D8KA 1I50J 1WJCA 4DNCA 4DJAA 5L3GA 2KIQA 5CQEA 3IKTA 3E6BA 1CF7A 2DXIA 1D8JA 5HLIA 1HF0A 3B6CA 3LSTA 4BBRJ 1MBJA 2LBFA 3HGYA 4U0VA 5EYRA 1PP7U 5F04A 5CVUA 5F64A 1PYVA 1NG7A 1I39A 1ZYRF 2J5OA 2MFZA 4AYBA 5L3FA 2R7VA 1IN4A 4MEXF 1YFHA 2FEZA 4BBSJ 2FXAA 3GZ5A 3N97A 3Q3SA 3CMEI 3K1PA 3K4CA 3RJPA 2DTZA 3GZNB 2CUJA 5JVTA 2M30A 3A0HC 3HUGB 4JOMA 4XN3A 1T38A 4G7OF 2PBIA 1KQ9A 3JREA 1E3OC 2OQGA 4XLEA 4HF1A 3WTUC 1DGRM 1X3UA 3QYBA 2H1KA 1R5GA 3KX2A 3CP2A 3QPLA 4OINF 3OYHA 5HNHA 4G6DA 1HOMA 1R6RA 2VQHA 4ZYEA 4YRVA 1RPWA 4AVZA 2NVYJ 1JT0A 2L5QA 2E71A 5HODA 4BXFA 1J09A 2NNYA 4IRGA 2KL4A 5TRDA 1JKPC 4UV9A 4KFCA 1LEBA 2GM4A 4IOCF 4RDUA 2DA4A 3OYEA 2CQXA 4XKWA 1XB4A 1T95A 2M45A 2Z2SB 3FISA 1G59A 4C9YA 3ULQB 3P9IA 4B3AA 5HS8A 1W4MA 1MMAA 3OYCA 4U0WA 4M9ZA 4E7HA 3RI4A 2DMNA 5JI6A 4UUSB 3JRIA 3A4CA 4KN4X 2CU7A 4ASNA 1T39A 2Z16A 4HNVA 3HOXJ 1Y8RB 5DD4A 5M5WJ 3K2AA 4AVPA 1EH8A 4OIQF 2D45A 5H6RA 1TP4A 3D5SC 3I58A 5J40A 2ZSIB 4Z6YA 1Z77A 4KNYA 4L5IA 1MBGA 2DFIA 4Y7NJ 4QWQA 2A3SA 2BY0A 2V9PA 2BXYA 3HBLA 3I53A 5DDGA 3FXMA 2MGQA 3QYEA 4FX4A 1S7EA 3KZYA 3TO7A 3ZPLA 5J1YA 1DDNA 5FKOA 4NDLA 1VQ5I 4HPQA 1G6NA 5E1XA 2QQ8A 5IP9J 2PJPA 3GFMA 3A01A 1Y6IA 1D0XA 2LMDA 4UB8C 1JHHA 1VNDA 5ICFA 2DYSH 3GVAA 2E60A 1FYMA 4IQJA 1ZG1A 4LIUA 1IXRC 4G9YA 3L2CA 2WA0A 2MW8A 3ZQLA 3KEQA 1FWZA 3TO6A 4M9SA 3A02A 1XMXA 2ZMEC 4B43A 5K5OA 4MFDA 1V5GA 2E1MC 3G1MA 2QCOA 3IWFA 2JVHA 5K5RA 1J7KA 5J1RA 5BQTA 3LSRA 3TOAA 2X0LA 4DQ2A 2DJNA 3ZRGA 2G7HA 2HOSA 3H9GA 1X19A 3CZ6A 4YIFA 2ID3A 2WAEA 2GWRA 1HW5A 2NS7A 1XMAA 4X1EA 5FFXA 1AKHA 3PUBA 2WAFA 4IF4A 1YJWI 3FWEA 2H6CA 3HRUA 4JP0A 3S8PA 5LBQA 1IW7F 1IN5A 4TV7A 2DK8A 4BXXJ 2H8RA 4EJTA 4NBQA 2H09A 3FXQA 3V8LA 1Z9CA 2ESNA 4PGGA 5JHUA 3QAHA 4NNJA 2LY2A 4XLHA 3KETA 3OR2C 3I59A 5HDNA 4IHSA 3HRTA 2FSWA 1YRNB 1P4XA 2HNHA 4HA8A 4NC8A 4XR6A 3AL0B 4NC6A 3FX3A 5HOOA 3J80K 2GQQA 1ZGWA 1X1DA 3ISPA 2L2OA 3C2GA 4BACA 1R49A 1SMYF 1BJAA 1HDPA 2AXLA 3KYCB 4IJAA 1I3AA 1N75A 3ZMVA 3B6AA 3H0GJ 2EJRA 1O3RA 1RC9A 5E1ZB 3SZTA 2E35A 3LAPA 1ENHA 2QBYA 5BPIA 2CV0A 1YJ9I 3PL8A 5HS7A 5E3NA 2M87A 4HV5A 3MKZA 3WODF 2R7WA 2H27A 3RQIA 2Y48A 3FXUA 5FKLA 4P1WA 4DOZA 1ZKGA 2WV0A 2HYFA 4A93J 1XTAA 2EA4A 3HB9A 1WJFA 2ISZA 2NS0A 2FNPA 4H4KC 4S0HB 4I01A
chains in the Genus database with same CATH topology
2IW5A 3NEUA 2DT5A 3HSFA 4LG0A 2IA2A 5CVJA 3WU0A 3GFIA 2Z33A 3JSOA 3WE3A 4A5NA 4M72A 1J59A 4LD5A 5H20A 1K79A 1BI2A 4YIIA 1BOAA 4I0AA 4ENMA 1L0OC 4LK1F 3GYHX 3FMSA 3CDHA 3ZMZA 2P8TA 4KA4A 1QGPA 2UXNA 3QP5A 4BHBA 4I02A 1KU2A 2HQRA 3RIRA 3C1DA 1SFXA 2IVMA 4MNUA 2PG4A 2PI0A 4HZFA 5JR3A 1VTNC 3V7RA 5D4SA 1I6XA 2NYXA 1ZG3A 3F8MA 3DKWA 3OOPA 1IN8A 5ERIA 3PQKA 4B09A 2A5YB 4BNCA 1U5TA 5BPDA 1BIAA 2WWYA 3LQRA 1R36A 4BYYA 1Z6TA 4AWXB 3HRMA 4L18B 2Z3YA 2XAFA 4R8HA 4N0BA 2DW4A 2QWWA 5L3DA 5FLXZ 1TLHB 4FHTA 1AOYA 4L9TA 4UVBA 4WXDA 3E6DA 5HDGA 3Q5FA 2K4JA 3ECOA 3DFGA 1J9IA 4I2OA 2NNNA 1MD0A 2XHKA 2M5WA 3KP6A 2K27A 3CUQC 3G3ZA 4D0PA 1F9NA 1WRJA 1Q1HA 3J81Z 3WTZA 2LSOA 3ZMTA 1YW8A 1QZYA 1YQAA 2W84A 2VONA 2OQRA 2MLKA 1HBXG 4M73A 2EK5A 3QU6A 4Q4ZF 2FBKA 1I5ZA 3QPHA 4KMUX 4ZH4F 1GVJA 1YG2A 1T98A 4CICA 5E20A 1UHMA 3LFKA 2A69F 4K2EA 4F7ZA 2LF8A 1FSEA 4P96A 1KYZA 1PP8F 4HBLA 4BHCA 3HTSB 4IXAA 4P9UA 4KYWA 1J75A 4WWCA 4RB3C 3O2PE 3GUDA 2KJBA 2JPCA 4RS8A 2P5LC 3R0JA 1Z05A 3F21A 2DQRA 1RIOH 4LB6B 3TO9A 3ELKA 1LNWA 4R1HA 3U9GA 1K78A 5DCMA 3RPUA 4ZZDA 1YS6A 1E17A 4A6EA 1K6OA 1O7FA 1ZH5A 1LDJA 3GLXA 1HW1A 2ESHA 2G9WA 4HQMA 3P7NA 1R58A 4GYIA 1U3EM 3IC7A 3K2ZA 5DUIA 3FF5A 2GXBA 1KA8A 2K02A 2IRFG 3TDUC 4L0ZB 1DPRA 3CO6C 2CYYA 3KP4A 2EFQA 3ERED 3K1NA 3KFWX 3EYYA 4HAMA 4KUMA 1NHAA 1GXQA 1ON2A 1Z91A 4HOBA 2FBIA 1RUNA 3GX4X 3BOQA 2MLGA 4XSXF 1SD4A 1EH6A 2PMHA 4IPAA 1P2FA 5HLHA 1KU9A 2XIGA 5KK1A 3VFZA 3VOEA 3IRRA 2YU3A 5LEJA 4Y13A 2DO7A 4JBAA 1BC7C 3S2WA 1P4AA 3BY6A 3V4GA 2JRTA 3R6SA 1SD7A 1YS7A 3GZ6A 4L0YB 1XD7A 2ZJ2A 1S29A 2DI3A 2K86A 2UZKA 2BBYA 5AIQA 4CYDA 2VT2A 4HF0A 3R61A 2F5CA 5ICGA 2O6GE 4PDKA 2MC3A 1YW9A 5FD5A 3I71A 3K0LA 3BPVA 5LRRA 4MTDA 4RAYA 3NRVA 1U78A 4M6XA 3DQVC 1HKQA 4Q5SF 3F22A 1YLFA 2A07F 2CWEA 4EMSA 3JSPA 1LVAA 1FBQA 4HF2A 3BJOA 4WXHA 3TKYA 1GXPA 3L09A 1MJAA 5CVIA 4UVAA 4XSZF 4ETSA 4YFNF 1I27A 2L01A 2XASA 5ILVA 3KE2A 4IRHA 1T0FA 3REOA 2QLZA 5J8FA 2HOEA 3HOTA 4WK8F 4HX8A 1QPMA 4EJWA 2STTA 2UWMA 5IT9Z 4KIGA 3E6MA 1ULYA 3HIFA 2FRHA 2L4AA 3KP2A 2M8EA 3JAMK 2W85A 1OYWA 2VN2A 2RKHA 5BMZA 2ZCWA 4RB1A 1Z7UA 4N9HA 4ENNA 1FBSA 1GHCA 2Q0OA 3QU3A 2DLLA 3NQOA 3RYPA 1R22A 2XROA 1OYIA 3RKXA 4AD9A 1XGMA 5D8LB 4ZZLA 1OKRA 2QQBA 2QYOA 1IXCA 1KYWA 3RKWA 1ZAOA 3AAFA 2IPQX 3N4MA 1G3SA 5FB2A 3JTGA 4BH9A 3F3XA 3LQQA 1OPCA 2D1VA 2L54A 2W25A 4MEYF 4HX4A 4IHTA 3M8FA 3J81K 1MDMA 3GXOA 1MKMA 5E17F 1BM9A 4YG2F 3D0SA 5HDKA 1LEAA 2E1NA 1KGSA 4HYEA 1IXSB 2Z99A 5FD6A 3KP5A 1HKTA 4EJUA 3DXJF 1RNLA 4WXCA 3CLOA 5D6EA 4HQEA 1I1GA 2QM3A 1SAXA 1S8NA 4OIPF 1ZLJA 4UUVA 2ZNZA 3T8TA 2YR2A 2Z5UA 4N9IA 1J5YA 3WU1B 1U8RA 4RB0A 4ZYHA 1TW2A 4ENKA 3RYRA 1UFMA 4S04A 3DV8A 1PDNC 2QENA 4CGZA 2FBHA 3BJAA 1IAWA 1MJBA 1FSHA 3ECHA 4OIRF 1EV7A 4ON0A 3OV8A 3WTSC 2OA4A 3DPTA 2NAZA 4L5JA 2WC2A 2BYVE 1LB2A 2ZKZA 3BROA 1I1SA 1YYVA 1KU3A 2M1BA 1XSDA 1S6LA 2EV0A 4P9FA 3IL2A 1TNSA 1ZRFA 1W7PB 2P7VB 1R23A 4EM1A 1U5TC 2DPUA 4OIOF 2BE5F 2P6SA 3CO7C 3EYIA 1QNTA 5LGUA 1IF1A 2V6CA 3F8FA 1BBYA 1QZZA 3HSRA 1LJ9A 2COMA 1FPQA 2A6EF 4HLYA 4CDGA 3KZZA 2PLYA 4LMYA 1HQCA 3K1MA 2E7WA 2VT3A 5LHIA 1BI0A 3I59B 3FMRA 2KJCA 4GCVA 2RC4A 4U88A 4U0YA 1XSXA 3KP3A 4EM2A 3JAMZ 3EETA 5LHGA 1ZREA 4JK1X 4XBFA 3TGNA 3COAC 1B9NA 5A2QK 2O0YA 4S05A 3E5QA 3FM3A 4Q48A 1H9GA 1P4WA 1EH7A 5ILSA 1SD6A 1ZGJA 5E18F 3MZHA 1XMKA 2FA5A 2XAHA 2EFOA 1G3YA 1KQ0A 1FYLA 2DQLA 4LLLA 1JHFA 4RGSA 3H3UA 4R79A 2BGCA 1HW2A 2EWNA 1CGPA 4U7BA 5AIPA 2FU4A 3CTAA 1FP2A 3R4KA 5H6QA 4LLNA 4EM0B 5F6FA 3LA3A 5DEQA 3O3KA 2ZXJA 3E6CC 5J8CA 2IA1A 4CZZA 5F1RA 2P5KA 1TBXA 4A5MA 2MH2A 1USTA 2MA3A 3BZ6A 2HTSA 1SFUA 3K9TA 1IZ1A 1LDDA 5DUKA 5FGMA 1R1TA 3C18A 2Z9OA 2GIVA 1ZARA 4HW0A 1YW7A 5TJJA 5LGTA 4XLNF 2L3DA 6PAXA 2IA0A 5CLSA 4PGHA 4G8XA 2P7CB 1FLIA 1L3LA 3EQLF 5ICCA 5DD8A 3DPLC 2IT0A 3IKVA 1TTYA 4MHGA 2Y0MA 5LGNA 2G7UA 5HS9A 4MQVA 1FY7A 3ROUA 2P5VA 2GA2A 2YPRA 2LNBA 2OAZA 2HKXA 3KP7A 4HDUA 5HLGA 1MJ9A 3ZMDA 4I98B 4EQQA 3TOBA 2KIFA 3MEXA 1KQ8A 5ICEA 3F72A 5HVQC 4GO1A 3CUQA 3SHFA 3DF8A 2CW0F 1BI1A 3ABTA 4RGRA 4AIHA 4NB5A 5D5UB 2IJLA 2NRAC 4XRFA 2Y75A 1P92A 5D4RA 1AWCA 2GXGA 4EV0A 5CVRA 3SZPA 1Z6RA 1RZ4A 1TW3A 2XUBA 2CG4A 2C6YA 2DBBA 2MBFA 2HWVA 3WTYC 2ISYA 3F8CA 1XCVA 1K78B 4FT8A 1O57A 2H6BA 1XCBA 3ZMUA 5A2QZ 4GGGA 5ED4A 4PCQA 3LA2A 4AIJA 1HSTA 2FE3A 5LRSA 2R7FA 2D1HA 1CF7B 1JGSA 2VBWA 2L4MA 3V7SA 3WTXC 1BIBA 2XAJA 3B02A 3TDZC 2EB7A 2HR3A 4KIBA 4HDVA 5DCFA 1MZBA 1JE8A 4EJVA 4M9XA 4QLCU 2XGXA 2CO5A 4G7ZF 4M71A 3E5UA 5K1YA 4LK0F 5AONA 5CJ9A 3O6BB 4UVCA 4YFXF 1XGSA 1WI9A 1IRGA 4PZJA 3MQ0A 2YX7A 2OZ6A 2O8XA 5EEGA 4M6YA 2HFHA 3BWGA 3F8NA 1FP1D 2JTVA 3I4PA 2E7XA 2HZTA 4OMZA 5D5WB 1Y0UA 2DAOA 3WE2A 2EA2A 4BAYA 3JTHA 2XKOA 2HGCA 2QQ9A 1ZHFA 3R0AA 1B59A 4GXOA 2A6HF 2FNAA 3U1DA 2W57A 2VXZA 3ZN1A 4A0XA 2V1UA 1MGTA 5CYVA 3CUOA 2FF4A 2PN6A 4HLXA 4I0BA 4ENJA 3PFIA 4EVIA 2R3SA 4M74A 3L9FA 2GAUA 1TQMA 2V9VA 1KU7A 4EGYA 1LQ1A 1ZLKA 1B9MA 4Y17A 3GWZA 4JQFA 1XDSA 2XAQA 4A12A 1XN7A 4AIKA 1Z1DA 2PMUA 5D5XB 2QZ8A 4A2UA 3T8RA 3GO5A 2ZBKA 1SMTA 2VOOA 3VEPA 1FT9A 1BN5A 2R7DA 4XLPF 1WSUA 1ZRDA 2PQ8A 3C7JA 4I09A 4LB5A 1PUEE 4U7DA 2K4BA 4IVNA 3I54A 1FBUA 2H94A 4G94A 4B8XA 5L3CA 3D5LA 1RUOA 4P5OA 3E5XA 1R1UA 1FOKA 3P9CA 2A61A 2OZUA 3GF2A 3HUGA 3JW4A 4Q47A 3F23A 3CJNA 3DEUA 3K69A 4KT5C 2RDPA 2K7LA 1YO5C 2LF7A 4CO8A 5E1WA 3I64A 3BP8A 2OU2A 3GFJA 1T6SA 5FO5A 3WTWC 5D5VB 1UHWA 2V1DA 1FZPB 1BI3A 2OD5A 4BQAA 4MTEA 4A0ZA 3FM5A 2DU9A 5DCMB 3T1BA 4OU0A 3J80Z 5BS6A 1E2XA 5CVVA 1S3JA 1OYYA 2ADUA 1K7AA 3GW2A 2JT1A 4RAZA 1W7PD 1DPUA 5IT9K 5IT3A 3ABUA 2TDXA 1MDMB 5DYMA 1O3SA 4CHUA 2PEXA 1G4DA 1V4RA 2B0LA 3ZN0A 3SXYA 2RVCA 2W24A 3EDPA 3FXRA 1SFEA 2BV6A 2E1CA 5L3EA 4HX7A 2ZMEA 2QQAA 3MFKA 1R7JA 1FYKA 4OMYA 4RB2C 5D6FA 2CFXA 2X4HA 1HXDA 5KVRA 1ON1A 3HRSA 1J0RA 3HSEA 2QVOA 4LGWA 1O3QA 3KLOA 4KN7X 3HYIA 4RGXA 2V79A 1XGNA 1YIOA 1UCRA 1C0WA 4UXNA 2CGPA 4GYGA 1B4AA 3ZQ7A 1TNTA 3KEOA 2HEOA 2XAGA 2HQNA 3MZYA 3C3WA 2VBYA 4LG0B 3W6JB 2VC0A 1S7OA 2VODA 3MCZA 1OMIA 2YX4A 2KKOA 3CUQB 4NHJA 1LDKB 2F5DA 3B73A 4KDPA 2KIMA 3I0TA 5E8GA 5LLQA 2AS5F 2LDUA 3FMQA 1O7LA 4L9VA 2ZO4A 1H0MA 3KCCA 3WGIA 3V8JA 1WQ2A 2D2WA 2VBZA 4IRIA 1T2KA 2FMYA 5EEHA 1WWXA 1QO0D 2ZFWA 3QPTA 4ZYGA 2VOPA 1W5TA 2XVCA 2MH9A 3KLNA 2ELHA 3LWFA 4E70A 2XV4S 2ACJA 3QP6A 1TQIA 1JXSA 3ML6A 1F5TA 1O3TA 3LA7A 1W7PA 2PFBA 2JPBA 4ESBA 3FHZA 2JSCA 4NQWA 2RNJA 4HV6A 3M7GA 3M9AA 4LFUA 2EFPA 1V3FA 2O3FA 1R1VA 3BJ6A 1SD5A 3PQJA 4LJZF 2F5FA 4OOIA 1ZRCA 4EJOA 3M8EA 1D3YA 4LLGF 4ESJA 2KRFA 2J5PA 4YFKF 1STZA 1W5SA 1XSVA 3RKYA 2HDCA 4BHPA 5K5QA 3F6OA 1ODDA 2DTRA 3HHHA 2VC1A 4Y15A 2VE9A 1WKMA 3HOSA 1G3TA 4MQ9F 1TQPA 1XGOA 1R5HA 2UXXA 1U2WA 3G73A 3SQNA 1R00A 2RGVA 2ZNYA 4FX0A 1D5VA 3MAJA 2MD5A 3T5XA 2HYGD 1IN7A 4A6DA 2HTJA 1DP7P 2O03A 2Q2EA 4EGZA 2HS5A 3IHUA 1H9TA 1HSJA 3WTVC 4ZYDA 2DPDA 4G6QA 1YTYA 3DP7A 3E97A 3M1EA 3RDIA 3WGHA 4O5VA 3FZVA 3U2RA 4L9JA 3VODA 2O61A 2RQPA 2KIUA 1F1ZA 4CXFA 4KMFA 3V8KA 3QRFF 2P4WA 3WTTC 2XRNA 1XDUA 1ZN2A 4H0EA 4Z2YA 2YSRA 1F4KA 3ZMSA 1U6GA 2LKPA 1B6AA 3WG9A 4O6JA 3P9KA 2Q8KA 5DV5A 4ESFA 5D8KB 1RI7A 4BXUA 3F6VA 4KIFA 3J7AO 1DUXC 4UV8A 1IRFA 4KICA 3EUHA 3L00A 5E8IA 3BDDA 2GZWA 2FQ3A 4UNOA 4WF2A 2IP2A 2HKOA 2ZMEB 2A68F 2EV5A 3T0YA 3VB2A 1UB9A 1FC3A 1BC8C 1ZGAA 1OR7A 1J2XA 4UHTA 3MWMA 3GFLA 4RGUA 2XKPA 3HTUA 1IN6A 3BPXA 2FMLA 3Q9VA 2QBYB 1FNNA 1ONVA 3E3VA 2P6TA 2F2EA 4I7HA 2RN7A 2VBXA 3HHGA 3Q9SA 2EV6A 1QQIA 4WX9A 5LEKA 1QBJA 2BEOA 4L9NA 5LHHA 2V1XA 3LAJA 2FOKA 5L3BA 2OBPA 3TQNA 2STWA 5BOXA 3GEZA 5FLXK 2EFNA 3SFZA 3RPQA 4WCGA 2VE8A 5JFRA 4MGRA 1ZG5A 5ILUA 2WTEA 2F5EA 3RTRA 3IRQA 1REPC 4G7HF 1USSA 2CSOA 1A04A 1IUYA 3V7CA 4O3MA 3H3ZA 2ETHA 3W6KB 1P6RA 1HKSA 1G3WA 1S7AA 2CQKA 3ZP5A 3R60A 3I5UA 3F8BA 2JZYA 3QOPA 4A0YA 2DK5A 2QUFA 2L02A 2RV8A 2EFWA 2GA1A 5J6XA 3WGGA 1FX7A 4P55A 1U5TB 3IWZA 1B1BA 3H92A 3L7WA 5FFZA 1D8KA 4DNCA 5L3GA 3IKTA 1CF7A 3E6BA 1D8JA 5HLIA 3LSTA 4U0VA 1PP7U 5CVUA 5F64A 1ZYRF 2J5OA 5L3FA 1IN4A 4MEXF 1YFHA 2FEZA 2FXAA 3GZ5A 3N97A 3K1PA 3RJPA 5JVTA 2M30A 1T38A 4G7OF 2PBIA 1KQ9A 2OQGA 4HF1A 3WTUC 1X3UA 1R5GA 4OINF 4G6DA 4ZYEA 2NNYA 4IRGA 5TRDA 4KFCA 4UV9A 1LEBA 1XB4A 2M45A 3ULQB 3P9IA 5HS8A 1W4MA 4U0WA 4M9ZA 3RI4A 5JI6A 4KN4X 4ASNA 1T39A 5DD4A 4AVPA 1EH8A 4OIQF 2D45A 5H6RA 3I58A 4KNYA 4L5IA 2DFIA 4QWQA 2A3SA 3I53A 5DDGA 4FX4A 3KZYA 3TO7A 3ZPLA 1DDNA 1G6NA 5E1XA 2PJPA 3GFMA 1JHHA 5ICFA 3GVAA 1FYMA 1ZG1A 1IXRC 4G9YA 3L2CA 3KEQA 1FWZA 3TO6A 4M9SA 5K5OA 3IWFA 5K5RA 1J7KA 5BQTA 3TOAA 2X0LA 4DQ2A 2G7HA 4YIFA 2GWRA 1HW5A 1XMAA 5FFXA 4IF4A 3FWEA 2H6CA 3HRUA 5LBQA 1IW7F 1IN5A 4TV7A 2DK8A 4EJTA 2H09A 3FXQA 3V8LA 1Z9CA 2ESNA 4PGGA 5JHUA 3QAHA 3KETA 3I59A 5HDNA 4IHSA 3HRTA 2FSWA 1P4XA 4HA8A 3FX3A 5HOOA 3J80K 2GQQA 3ISPA 1SMYF 1BJAA 4IJAA 2AXLA 3ZMVA 1O3RA 2EJRA 5E1ZB 3SZTA 3LAPA 2QBYA 5BPIA 5HS7A 2M87A 4HV5A 3WODF 2H27A 2Y48A 3FXUA 2WV0A 2HYFA 2EA4A 2ISZA 2NS0A 2FNPA 4I01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW5 A;  3NEU A;  2DT5 A;  3HSF A;  4LG0 A;  2IA2 A;  5CVJ A;  3WU0 A;  3GFI A;  2Z33 A;  3JSO A;  3WE3 A;  4A5N A;  4M72 A;  1J59 A;  4LD5 A;  5H20 A;  1K79 A;  1BI2 A;  4YII A;  1BOA A;  4I0A A;  4ENM A;  1L0O C;  4LK1 F;  3GYH X;  3FMS A;  3CDH A;  3ZMZ A;  2P8T A;  4KA4 A;  1QGP A;  2UXN A;  3QP5 A;  4BHB A;  4I02 A;  1KU2 A;  2HQR A;  3RIR A;  3C1D A;  1SFX A;  2IVM A;  4MNU A;  2PG4 A;  2PI0 A;  4HZF A;  5JR3 A;  1VTN C;  3V7R A;  5D4S A;  1I6X A;  2NYX A;  1ZG3 A;  3F8M A;  3DKW A;  3OOP A;  1IN8 A;  5ERI A;  3PQK A;  4B09 A;  2A5Y B;  4BNC A;  1U5T A;  5BPD A;  1BIA A;  2WWY A;  3LQR A;  1R36 A;  4BYY A;  1Z6T A;  4AWX B;  3HRM A;  4L18 B;  2Z3Y A;  2XAF A;  4R8H A;  4N0B A;  2DW4 A;  2QWW A;  5L3D A;  5FLX Z;  1TLH B;  4FHT A;  1AOY A;  4L9T A;  4UVB A;  4WXD A;  3E6D A;  5HDG A;  3Q5F A;  2K4J A;  3ECO A;  3DFG A;  1J9I A;  4I2O A;  2NNN A;  1MD0 A;  2XHK A;  2M5W A;  3KP6 A;  2K27 A;  3CUQ C;  3G3Z A;  4D0P A;  1F9N A;  1WRJ A;  1Q1H A;  3J81 Z;  3WTZ A;  2LSO A;  3ZMT A;  1YW8 A;  1QZY A;  1YQA A;  2W84 A;  2VON A;  2OQR A;  2MLK A;  1HBX G;  4M73 A;  2EK5 A;  3QU6 A;  4Q4Z F;  2FBK A;  1I5Z A;  3QPH A;  4KMU X;  4ZH4 F;  1GVJ A;  1YG2 A;  1T98 A;  4CIC A;  5E20 A;  1UHM A;  3LFK A;  2A69 F;  4K2E A;  4F7Z A;  2LF8 A;  1FSE A;  4P96 A;  1KYZ A;  1PP8 F;  4HBL A;  4BHC A;  3HTS B;  4IXA A;  4P9U A;  4KYW A;  1J75 A;  4WWC A;  4RB3 C;  3O2P E;  3GUD A;  2KJB A;  2JPC A;  4RS8 A;  2P5L C;  3R0J A;  1Z05 A;  3F21 A;  2DQR A;  1RIO H;  4LB6 B;  3TO9 A;  3ELK A;  1LNW A;  4R1H A;  3U9G A;  1K78 A;  5DCM A;  3RPU A;  4ZZD A;  1YS6 A;  1E17 A;  4A6E A;  1K6O A;  1O7F A;  1ZH5 A;  1LDJ A;  3GLX A;  1HW1 A;  2ESH A;  2G9W A;  4HQM A;  3P7N A;  1R58 A;  4GYI A;  1U3E M;  3IC7 A;  3K2Z A;  5DUI A;  3FF5 A;  2GXB A;  1KA8 A;  2K02 A;  2IRF G;  3TDU C;  4L0Z B;  1DPR A;  3CO6 C;  2CYY A;  3KP4 A;  2EFQ A;  3ERE D;  3K1N A;  3KFW X;  3EYY A;  4HAM A;  4KUM A;  1NHA A;  1GXQ A;  1ON2 A;  1Z91 A;  4HOB A;  2FBI A;  1RUN A;  3GX4 X;  3BOQ A;  2MLG A;  4XSX F;  1SD4 A;  1EH6 A;  2PMH A;  4IPA A;  1P2F A;  5HLH A;  1KU9 A;  2XIG A;  5KK1 A;  3VFZ A;  3VOE A;  3IRR A;  2YU3 A;  5LEJ A;  4Y13 A;  2DO7 A;  4JBA A;  1BC7 C;  3S2W A;  1P4A A;  3BY6 A;  3V4G A;  2JRT A;  3R6S A;  1SD7 A;  1YS7 A;  3GZ6 A;  4L0Y B;  1XD7 A;  2ZJ2 A;  1S29 A;  2DI3 A;  2K86 A;  2UZK A;  2BBY A;  5AIQ A;  4CYD A;  2VT2 A;  4HF0 A;  3R61 A;  2F5C A;  5ICG A;  2O6G E;  4PDK A;  2MC3 A;  1YW9 A;  5FD5 A;  3I71 A;  3K0L A;  3BPV A;  5LRR A;  4MTD A;  4RAY A;  3NRV A;  1U78 A;  4M6X A;  3DQV C;  1HKQ A;  4Q5S F;  3F22 A;  1YLF A;  2A07 F;  2CWE A;  4EMS A;  3JSP A;  1LVA A;  1FBQ A;  4HF2 A;  3BJO A;  4WXH A;  3TKY A;  1GXP A;  3L09 A;  1MJA A;  5CVI A;  4UVA A;  4XSZ F;  4ETS A;  4YFN F;  1I27 A;  2L01 A;  2XAS A;  5ILV A;  3KE2 A;  4IRH A;  1T0F A;  3REO A;  2QLZ A;  5J8F A;  2HOE A;  3HOT A;  4WK8 F;  4HX8 A;  1QPM A;  4EJW A;  2STT A;  2UWM A;  5IT9 Z;  4KIG A;  3E6M A;  1ULY A;  3HIF A;  2FRH A;  2L4A A;  3KP2 A;  2M8E A;  3JAM K;  2W85 A;  1OYW A;  2VN2 A;  2RKH A;  5BMZ A;  2ZCW A;  4RB1 A;  1Z7U A;  4N9H A;  4ENN A;  1FBS A;  1GHC A;  2Q0O A;  3QU3 A;  2DLL A;  3NQO A;  3RYP A;  1R22 A;  2XRO A;  1OYI A;  3RKX A;  4AD9 A;  1XGM A;  5D8L B;  4ZZL A;  1OKR A;  2QQB A;  2QYO A;  1IXC A;  1KYW A;  3RKW A;  1ZAO A;  3AAF A;  2IPQ X;  3N4M A;  1G3S A;  5FB2 A;  3JTG A;  4BH9 A;  3F3X A;  3LQQ A;  1OPC A;  2D1V A;  2L54 A;  2W25 A;  4MEY F;  4HX4 A;  4IHT A;  3M8F A;  3J81 K;  1MDM A;  3GXO A;  1MKM A;  5E17 F;  1BM9 A;  4YG2 F;  3D0S A;  5HDK A;  1LEA A;  2E1N A;  1KGS A;  4HYE A;  1IXS B;  2Z99 A;  5FD6 A;  3KP5 A;  1HKT A;  4EJU A;  3DXJ F;  1RNL A;  4WXC A;  3CLO A;  5D6E A;  4HQE A;  1I1G A;  2QM3 A;  1SAX A;  1S8N A;  4OIP F;  1ZLJ A;  4UUV A;  2ZNZ A;  3T8T A;  2YR2 A;  2Z5U A;  4N9I A;  1J5Y A;  3WU1 B;  1U8R A;  4RB0 A;  4ZYH A;  1TW2 A;  4ENK A;  3RYR A;  1UFM A;  4S04 A;  3DV8 A;  1PDN C;  2QEN A;  4CGZ A;  2FBH A;  3BJA A;  1IAW A;  1MJB A;  1FSH A;  3ECH A;  4OIR F;  1EV7 A;  4ON0 A;  3OV8 A;  3WTS C;  2OA4 A;  3DPT A;  2NAZ A;  4L5J A;  2WC2 A;  2BYV E;  1LB2 A;  2ZKZ A;  3BRO A;  1I1S A;  1YYV A;  1KU3 A;  2M1B A;  1XSD A;  1S6L A;  2EV0 A;  4P9F A;  3IL2 A;  1TNS A;  1ZRF A;  1W7P B;  2P7V B;  1R23 A;  4EM1 A;  1U5T C;  2DPU A;  4OIO F;  2BE5 F;  2P6S A;  3CO7 C;  3EYI A;  1QNT A;  5LGU A;  1IF1 A;  2V6C A;  3F8F A;  1BBY A;  1QZZ A;  3HSR A;  1LJ9 A;  2COM A;  1FPQ A;  2A6E F;  4HLY A;  4CDG A;  3KZZ A;  2PLY A;  4LMY A;  1HQC A;  3K1M A;  2E7W A;  2VT3 A;  5LHI A;  1BI0 A;  3I59 B;  3FMR A;  2KJC A;  4GCV A;  2RC4 A;  4U88 A;  4U0Y A;  1XSX A;  3KP3 A;  4EM2 A;  3JAM Z;  3EET A;  5LHG A;  1ZRE A;  4JK1 X;  4XBF A;  3TGN A;  3COA C;  1B9N A;  5A2Q K;  2O0Y A;  4S05 A;  3E5Q A;  3FM3 A;  4Q48 A;  1H9G A;  1P4W A;  1EH7 A;  5ILS A;  1SD6 A;  1ZGJ A;  5E18 F;  3MZH A;  1XMK A;  2FA5 A;  2XAH A;  2EFO A;  1G3Y A;  1KQ0 A;  1FYL A;  2DQL A;  4LLL A;  1JHF A;  4RGS A;  3H3U A;  4R79 A;  2BGC A;  1HW2 A;  2EWN A;  1CGP A;  4U7B A;  5AIP A;  2FU4 A;  3CTA A;  1FP2 A;  3R4K A;  5H6Q A;  4LLN A;  4EM0 B;  5F6F A;  3LA3 A;  5DEQ A;  3O3K A;  2ZXJ A;  3E6C C;  5J8C A;  2IA1 A;  4CZZ A;  5F1R A;  2P5K A;  1TBX A;  4A5M A;  2MH2 A;  1UST A;  2MA3 A;  3BZ6 A;  2HTS A;  1SFU A;  3K9T A;  1IZ1 A;  1LDD A;  5DUK A;  5FGM A;  1R1T A;  3C18 A;  2Z9O A;  2GIV A;  1ZAR A;  4HW0 A;  1YW7 A;  5TJJ A;  5LGT A;  4XLN F;  2L3D A;  6PAX A;  2IA0 A;  5CLS A;  4PGH A;  4G8X A;  2P7C B;  1FLI A;  1L3L A;  3EQL F;  5ICC A;  5DD8 A;  3DPL C;  2IT0 A;  3IKV A;  1TTY A;  4MHG A;  2Y0M A;  5LGN A;  2G7U A;  5HS9 A;  4MQV A;  1FY7 A;  3ROU A;  2P5V A;  2GA2 A;  2YPR A;  2LNB A;  2OAZ A;  2HKX A;  3KP7 A;  4HDU A;  5HLG A;  1MJ9 A;  3ZMD A;  4I98 B;  4EQQ A;  3TOB A;  2KIF A;  3MEX A;  1KQ8 A;  5ICE A;  3F72 A;  5HVQ C;  4GO1 A;  3CUQ A;  3SHF A;  3DF8 A;  2CW0 F;  1BI1 A;  3ABT A;  4RGR A;  4AIH A;  4NB5 A;  5D5U B;  2IJL A;  2NRA C;  4XRF A;  2Y75 A;  1P92 A;  5D4R A;  1AWC A;  2GXG A;  4EV0 A;  5CVR A;  3SZP A;  1Z6R A;  1RZ4 A;  1TW3 A;  2XUB A;  2CG4 A;  2C6Y A;  2DBB A;  2MBF A;  2HWV A;  3WTY C;  2ISY A;  3F8C A;  1XCV A;  1K78 B;  4FT8 A;  1O57 A;  2H6B A;  1XCB A;  3ZMU A;  5A2Q Z;  4GGG A;  5ED4 A;  4PCQ A;  3LA2 A;  4AIJ A;  1HST A;  2FE3 A;  5LRS A;  2R7F A;  2D1H A;  1CF7 B;  1JGS A;  2VBW A;  2L4M A;  3V7S A;  3WTX C;  1BIB A;  2XAJ A;  3B02 A;  3TDZ C;  2EB7 A;  2HR3 A;  4KIB A;  4HDV A;  5DCF A;  1MZB A;  1JE8 A;  4EJV A;  4M9X A;  4QLC U;  2XGX A;  2CO5 A;  4G7Z F;  4M71 A;  3E5U A;  5K1Y A;  4LK0 F;  5AON A;  5CJ9 A;  3O6B B;  4UVC A;  4YFX F;  1XGS A;  1WI9 A;  1IRG A;  4PZJ A;  3MQ0 A;  2YX7 A;  2OZ6 A;  2O8X A;  5EEG A;  4M6Y A;  2HFH A;  3BWG A;  3F8N A;  1FP1 D;  2JTV A;  3I4P A;  2E7X A;  2HZT A;  4OMZ A;  5D5W B;  1Y0U A;  2DAO A;  3WE2 A;  2EA2 A;  4BAY A;  3JTH A;  2XKO A;  2HGC A;  2QQ9 A;  1ZHF A;  3R0A A;  1B59 A;  4GXO A;  2A6H F;  2FNA A;  3U1D A;  2W57 A;  2VXZ A;  3ZN1 A;  4A0X A;  2V1U A;  1MGT A;  5CYV A;  3CUO A;  2FF4 A;  2PN6 A;  4HLX A;  4I0B A;  4ENJ A;  3PFI A;  4EVI A;  2R3S A;  4M74 A;  3L9F A;  2GAU A;  1TQM A;  2V9V A;  1KU7 A;  4EGY A;  1LQ1 A;  1ZLK A;  1B9M A;  4Y17 A;  3GWZ A;  4JQF A;  1XDS A;  2XAQ A;  4A12 A;  1XN7 A;  4AIK A;  1Z1D A;  2PMU A;  5D5X B;  2QZ8 A;  4A2U A;  3T8R A;  3GO5 A;  2ZBK A;  1SMT A;  2VOO A;  3VEP A;  1FT9 A;  1BN5 A;  2R7D A;  4XLP F;  1WSU A;  1ZRD A;  2PQ8 A;  3C7J A;  4I09 A;  4LB5 A;  1PUE E;  4U7D A;  2K4B A;  4IVN A;  3I54 A;  1FBU A;  2H94 A;  4G94 A;  4B8X A;  5L3C A;  3D5L A;  1RUO A;  4P5O A;  3E5X A;  1R1U A;  1FOK A;  3P9C A;  2A61 A;  2OZU A;  3GF2 A;  3HUG A;  3JW4 A;  4Q47 A;  3F23 A;  3CJN A;  3DEU A;  3K69 A;  4KT5 C;  2RDP A;  2K7L A;  1YO5 C;  2LF7 A;  4CO8 A;  5E1W A;  3I64 A;  3BP8 A;  2OU2 A;  3GFJ A;  1T6S A;  5FO5 A;  3WTW C;  5D5V B;  1UHW A;  2V1D A;  1FZP B;  1BI3 A;  2OD5 A;  4BQA A;  4MTE A;  4A0Z A;  3FM5 A;  2DU9 A;  5DCM B;  3T1B A;  4OU0 A;  3J80 Z;  5BS6 A;  1E2X A;  5CVV A;  1S3J A;  1OYY A;  2ADU A;  1K7A A;  3GW2 A;  2JT1 A;  4RAZ A;  1W7P D;  1DPU A;  5IT9 K;  5IT3 A;  3ABU A;  2TDX A;  1MDM B;  5DYM A;  1O3S A;  4CHU A;  2PEX A;  1G4D A;  1V4R A;  2B0L A;  3ZN0 A;  3SXY A;  2RVC A;  2W24 A;  3EDP A;  3FXR A;  1SFE A;  2BV6 A;  2E1C A;  5L3E A;  4HX7 A;  2ZME A;  2QQA A;  3MFK A;  1R7J A;  1FYK A;  4OMY A;  4RB2 C;  5D6F A;  2CFX A;  2X4H A;  1HXD A;  5KVR A;  1ON1 A;  3HRS A;  1J0R A;  3HSE A;  2QVO A;  4LGW A;  1O3Q A;  3KLO A;  4KN7 X;  3HYI A;  4RGX A;  2V79 A;  1XGN A;  1YIO A;  1UCR A;  1C0W A;  4UXN A;  2CGP A;  4GYG A;  1B4A A;  3ZQ7 A;  1TNT A;  3KEO A;  2HEO A;  2XAG A;  2HQN A;  3MZY A;  3C3W A;  2VBY A;  4LG0 B;  3W6J B;  2VC0 A;  1S7O A;  2VOD A;  3MCZ A;  1OMI A;  2YX4 A;  2KKO A;  3CUQ B;  4NHJ A;  1LDK B;  2F5D A;  3B73 A;  4KDP A;  2KIM A;  3I0T A;  5E8G A;  5LLQ A;  2AS5 F;  2LDU A;  3FMQ A;  1O7L A;  4L9V A;  2ZO4 A;  1H0M A;  3KCC A;  3WGI A;  3V8J A;  1WQ2 A;  2D2W A;  2VBZ A;  4IRI A;  1T2K A;  2FMY A;  5EEH A;  1WWX A;  1QO0 D;  2ZFW A;  3QPT A;  4ZYG A;  2VOP A;  1W5T A;  2XVC A;  2MH9 A;  3KLN A;  2ELH A;  3LWF A;  4E70 A;  2XV4 S;  2ACJ A;  3QP6 A;  1TQI A;  1JXS A;  3ML6 A;  1F5T A;  1O3T A;  3LA7 A;  1W7P A;  2PFB A;  2JPB A;  4ESB A;  3FHZ A;  2JSC A;  4NQW A;  2RNJ A;  4HV6 A;  3M7G A;  3M9A A;  4LFU A;  2EFP A;  1V3F A;  2O3F A;  1R1V A;  3BJ6 A;  1SD5 A;  3PQJ A;  4LJZ F;  2F5F A;  4OOI A;  1ZRC A;  4EJO A;  3M8E A;  1D3Y A;  4LLG F;  4ESJ A;  2KRF A;  2J5P A;  4YFK F;  1STZ A;  1W5S A;  1XSV A;  3RKY A;  2HDC A;  4BHP A;  5K5Q A;  3F6O A;  1ODD A;  2DTR A;  3HHH A;  2VC1 A;  4Y15 A;  2VE9 A;  1WKM A;  3HOS A;  1G3T A;  4MQ9 F;  1TQP A;  1XGO A;  1R5H A;  2UXX A;  1U2W A;  3G73 A;  3SQN A;  1R00 A;  2RGV A;  2ZNY A;  4FX0 A;  1D5V A;  3MAJ A;  2MD5 A;  3T5X A;  2HYG D;  1IN7 A;  4A6D A;  2HTJ A;  1DP7 P;  2O03 A;  2Q2E A;  4EGZ A;  2HS5 A;  3IHU A;  1H9T A;  1HSJ A;  3WTV C;  4ZYD A;  2DPD A;  4G6Q A;  1YTY A;  3DP7 A;  3E97 A;  3M1E A;  3RDI A;  3WGH A;  4O5V A;  3FZV A;  3U2R A;  4L9J A;  3VOD A;  2O61 A;  2RQP A;  2KIU A;  1F1Z A;  4CXF A;  4KMF A;  3V8K A;  3QRF F;  2P4W A;  3WTT C;  2XRN A;  1XDU A;  1ZN2 A;  4H0E A;  4Z2Y A;  2YSR A;  1F4K A;  3ZMS A;  1U6G A;  2LKP A;  1B6A A;  3WG9 A;  4O6J A;  3P9K A;  2Q8K A;  5DV5 A;  4ESF A;  5D8K B;  1RI7 A;  4BXU A;  3F6V A;  4KIF A;  3J7A O;  1DUX C;  4UV8 A;  1IRF A;  4KIC A;  3EUH A;  3L00 A;  5E8I A;  3BDD A;  2GZW A;  2FQ3 A;  4UNO A;  4WF2 A;  2IP2 A;  2HKO A;  2ZME B;  2A68 F;  2EV5 A;  3T0Y A;  3VB2 A;  1UB9 A;  1FC3 A;  1BC8 C;  1ZGA A;  1OR7 A;  1J2X A;  4UHT A;  3MWM A;  3GFL A;  4RGU A;  2XKP A;  3HTU A;  1IN6 A;  3BPX A;  2FML A;  3Q9V A;  2QBY B;  1FNN A;  1ONV A;  3E3V A;  2P6T A;  2F2E A;  4I7H A;  2RN7 A;  2VBX A;  3HHG A;  3Q9S A;  2EV6 A;  1QQI A;  4WX9 A;  5LEK A;  1QBJ A;  2BEO A;  4L9N A;  5LHH A;  2V1X A;  3LAJ A;  2FOK A;  5L3B A;  2OBP A;  3TQN A;  2STW A;  5BOX A;  3GEZ A;  5FLX K;  2EFN A;  3SFZ A;  3RPQ A;  4WCG A;  2VE8 A;  5JFR A;  4MGR A;  1ZG5 A;  5ILU A;  2WTE A;  2F5E A;  3RTR A;  3IRQ A;  1REP C;  4G7H F;  1USS A;  2CSO A;  1A04 A;  1IUY A;  3V7C A;  4O3M A;  3H3Z A;  2ETH A;  3W6K B;  1P6R A;  1HKS A;  1G3W A;  1S7A A;  2CQK A;  3ZP5 A;  3R60 A;  3I5U A;  3F8B A;  2JZY A;  3QOP A;  4A0Y A;  2DK5 A;  2QUF A;  2L02 A;  2RV8 A;  2EFW A;  2GA1 A;  5J6X A;  3WGG A;  1FX7 A;  4P55 A;  1U5T B;  3IWZ A;  1B1B A;  3H92 A;  3L7W A;  5FFZ A;  1D8K A;  4DNC A;  5L3G A;  3IKT A;  1CF7 A;  3E6B A;  1D8J A;  5HLI A;  3LST A;  4U0V A;  1PP7 U;  5CVU A;  5F64 A;  1ZYR F;  2J5O A;  5L3F A;  1IN4 A;  4MEX F;  1YFH A;  2FEZ A;  2FXA A;  3GZ5 A;  3N97 A;  3K1P A;  3RJP A;  5JVT A;  2M30 A;  1T38 A;  4G7O F;  2PBI A;  1KQ9 A;  2OQG A;  4HF1 A;  3WTU C;  1X3U A;  1R5G A;  4OIN F;  4G6D A;  4ZYE A;  2NNY A;  4IRG A;  5TRD A;  4KFC A;  4UV9 A;  1LEB A;  1XB4 A;  2M45 A;  3ULQ B;  3P9I A;  5HS8 A;  1W4M A;  4U0W A;  4M9Z A;  3RI4 A;  5JI6 A;  4KN4 X;  4ASN A;  1T39 A;  5DD4 A;  4AVP A;  1EH8 A;  4OIQ F;  2D45 A;  5H6R A;  3I58 A;  4KNY A;  4L5I A;  2DFI A;  4QWQ A;  2A3S A;  3I53 A;  5DDG A;  4FX4 A;  3KZY A;  3TO7 A;  3ZPL A;  1DDN A;  1G6N A;  5E1X A;  2PJP A;  3GFM A;  1JHH A;  5ICF A;  3GVA A;  1FYM A;  1ZG1 A;  1IXR C;  4G9Y A;  3L2C A;  3KEQ A;  1FWZ A;  3TO6 A;  4M9S A;  5K5O A;  3IWF A;  5K5R A;  1J7K A;  5BQT A;  3TOA A;  2X0L A;  4DQ2 A;  2G7H A;  4YIF A;  2GWR A;  1HW5 A;  1XMA A;  5FFX A;  4IF4 A;  3FWE A;  2H6C A;  3HRU A;  5LBQ A;  1IW7 F;  1IN5 A;  4TV7 A;  2DK8 A;  4EJT A;  2H09 A;  3FXQ A;  3V8L A;  1Z9C A;  2ESN A;  4PGG A;  5JHU A;  3QAH A;  3KET A;  3I59 A;  5HDN A;  4IHS A;  3HRT A;  2FSW A;  1P4X A;  4HA8 A;  3FX3 A;  5HOO A;  3J80 K;  2GQQ A;  3ISP A;  1SMY F;  1BJA A;  4IJA A;  2AXL A;  3ZMV A;  1O3R A;  2EJR A;  5E1Z B;  3SZT A;  3LAP A;  2QBY A;  5BPI A;  5HS7 A;  2M87 A;  4HV5 A;  3WOD F;  2H27 A;  2Y48 A;  3FXU A;  2WV0 A;  2HYF A;  2EA4 A;  2ISZ A;  2NS0 A;  2FNP A;  4I01 A; 
#chains in the Genus database with same CATH topology
 4FQG A;  2IW5 A;  3NEU A;  2DT5 A;  1TL8 A;  4A3D J;  3HSF A;  4LG0 A;  4XK4 A;  2IA2 A;  2X48 A;  5CVJ A;  3WU0 A;  1X2M A;  3GFI A;  1TZL A;  2Z33 A;  4BUP A;  3JSO A;  2HQ5 A;  2WBM A;  3WE3 A;  3DCF A;  4A5N A;  3CCL I;  3WHB A;  4Y52 J;  4M72 A;  1J59 A;  2R0Q C;  3KEY A;  4LD5 A;  5H20 A;  1K79 A;  5C3E J;  3RSN A;  1BI2 A;  4YII A;  1BOA A;  2CH0 A;  4I0A A;  2BY2 A;  4ENM A;  2XF5 A;  1ZR4 A;  1L0O C;  3SDB A;  4LK1 F;  3GYH X;  4MFE A;  3FMS A;  3CDH A;  3ZMZ A;  3G2B A;  3S16 J;  2O5R A;  2PJR A;  2P8T A;  3S3M A;  4KA4 A;  1QGP A;  2UXN A;  3QP5 A;  4BHB A;  4I02 A;  2HDW A;  1KU2 A;  2HQR A;  3RIR A;  3C1D A;  1SFX A;  1TT5 B;  2IVM A;  4MNU A;  2PG4 A;  2MSY A;  2PI0 A;  3TP3 A;  4HZF A;  3S17 J;  5GTI C;  1AHD P;  1WGX A;  4B1R A;  5JR3 A;  3ERM A;  1VTN C;  3BTI A;  1X3Z B;  3V7R A;  1ITY A;  5D4S A;  1I6X A;  1U9O A;  2NYX A;  1ZG3 A;  3BR5 A;  5LFA A;  3F8M A;  2DOE A;  2DA3 A;  3ZGK A;  3DKW A;  2NXN B;  4QTR A;  3OOP A;  1IN8 A;  1W0U A;  5ERI A;  4XID A;  4EEF G;  3PQK A;  4XRS A;  4E7Z A;  4B09 A;  3LL7 A;  4YEJ A;  4D5F A;  4OWR B;  2A5Y B;  4BNC A;  2XPU A;  1U5T A;  4IO9 F;  5BPD A;  1WZ2 A;  2X1D A;  1BIA A;  1AA7 A;  3EUK L;  2WWY A;  3LQR A;  1R36 A;  1SVL A;  3HOU J;  4BYY A;  1Z6T A;  4AWX B;  3HRM A;  4RBO A;  1RKT A;  4L18 B;  3IAM 2;  3QQA A;  2Z3Y A;  2BY3 A;  2XAF A;  1WCM J;  4R8H A;  4N0B A;  3CCE I;  4XKC A;  2DW4 A;  5JVG F;  2QWW A;  5L3D A;  1GDT A;  5FLX Z;  2ZXI A;  2ZJP F;  3IH3 A;  4I6Z A;  1TLH B;  2KQR A;  4FET A;  4XRS G;  4FHT A;  1AOY A;  5IP7 J;  4L9T A;  4V2F A;  2OF7 A;  1NK2 P;  4UVB A;  4WXD A;  2OUM A;  3G4S I;  2RQQ A;  3E6D A;  5HDG A;  3Q5F A;  2K4J A;  1OJL A;  3ECO A;  1RR8 C;  2DMU A;  3ZQC A;  3DFG A;  3HKZ A;  4I2O A;  1J9I A;  1PJR A;  2NNN A;  1UG0 A;  3P5J A;  1MD0 A;  2XHK A;  2M5W A;  3V42 A;  1A35 A;  3KP6 A;  1OCZ H;  2P81 A;  4CCM A;  2K27 A;  3CUQ C;  3G3Z A;  4D0P A;  1F9N A;  3OWT A;  4CCL A;  1WRJ A;  4B47 A;  1Q1H A;  3J81 Z;  4F91 B;  1FIP A;  3WTZ A;  2LSO A;  4A69 C;  3CCJ I;  1N77 A;  3ZMT A;  1YW8 A;  1QZY A;  1YQA A;  1GVD A;  2W84 A;  2XDV A;  2VON A;  2OQR A;  2COB A;  3CCV I;  2MLK A;  1H8A C;  1HBX G;  3JCU C;  3L2U A;  2HVR A;  4M73 A;  2EK5 A;  3HG9 A;  3QU6 A;  2K5C A;  2QGU A;  4Q4Z F;  2FBK A;  4KIT B;  1I5Z A;  3QPH A;  4KMU X;  4ZH4 F;  3BR3 A;  1GVJ A;  3CCR I;  1YG2 A;  1T98 A;  4CIC A;  3O8H A;  1Y1W J;  5E20 A;  1UHM A;  2UV1 A;  3LFK A;  4BE0 A;  2A69 F;  4K2E A;  1VQ4 I;  4F7Z A;  3OS1 A;  4X6A J;  2LF8 A;  3BG3 A;  1FSE A;  1JUP A;  5J4V A;  2R5Z A;  1W5C C;  4P96 A;  3RKQ A;  1KYZ A;  2W1O A;  1PP8 F;  4HBL A;  4BHC A;  3HTS B;  4IXA A;  4P9U A;  4KYW A;  2M0C A;  1J75 A;  1UZC A;  4WWC A;  1OCO H;  4RB3 C;  3O2P E;  2RNG A;  2HU9 A;  3I55 I;  1Y39 A;  3CC4 I;  5GAD J;  5K7F A;  3VDX A;  1LKX A;  2KRC A;  3GUD A;  2KJB A;  2JPC A;  2VKH A;  3AG2 H;  2MAB A;  3A0B C;  3R0J A;  1Z05 A;  4RS8 A;  5C44 J;  3F21 A;  2DQR A;  1A36 A;  1RIO H;  4LB6 B;  4E4H A;  2JVG A;  3CMM A;  3ELK A;  3TO9 A;  1LNW A;  4R1H A;  2E5N A;  3U9G A;  1K78 A;  5DCM A;  5FLV A;  4IKF A;  3RPU A;  2CW8 A;  2FOW A;  3BCA A;  2K9Q A;  2KZG A;  3BT9 A;  4ZZD A;  1YS6 A;  2VJ5 A;  2X6O A;  1E17 A;  2L0K A;  3MN2 A;  4A6E A;  1K6O A;  1O7F A;  3OYA A;  1ZH5 A;  1LDJ A;  2F48 A;  3GLX A;  1HW1 A;  2ESH A;  1V5F A;  2R93 J;  2G9W A;  2CJJ A;  2JN6 A;  1A31 A;  2V4J C;  4HQM A;  2V1N A;  3U1K A;  2B63 J;  3P7N A;  1R58 A;  1ETY A;  4HST A;  2VJJ A;  4GYI A;  1FIA A;  1U3E M;  2BVM A;  3IC7 A;  3K2Z A;  5DUI A;  3LOC A;  3FF5 A;  3VYT B;  2GXB A;  2LOO A;  3BTL A;  1KA8 A;  2K02 A;  2IRF G;  1D0Y A;  4D7N A;  2KDZ A;  3TDU C;  4L0Z B;  3HPG A;  3N05 A;  2DT7 B;  3CDL A;  1DPR A;  1GV5 A;  3DU6 A;  4C2M J;  3FBN B;  4BGD A;  4PFO A;  2VIX A;  4LIT A;  2EIK H;  3CO6 C;  2CYY A;  3KP4 A;  2EFQ A;  1LVK A;  2DYR H;  3ERE D;  3K1N A;  3Q0U A;  3TP0 A;  3CES A;  2DDA A;  1DGW Y;  3QOE A;  3KFW X;  5IYC J;  2VL8 A;  2ECB A;  1R9T J;  3JRA A;  2L9R A;  4CCN A;  3EYY A;  4BE1 A;  4HAM A;  4KUM A;  1TC3 C;  1NHA A;  1T33 A;  5E79 C;  1GXQ A;  4AUX A;  1ON2 A;  1Z91 A;  2DFH A;  4HOB A;  2FBI A;  5EF6 A;  1RUN A;  3GX4 X;  2KIS A;  1FEX A;  1D1C A;  3BOQ A;  2HPM A;  1QPI A;  2MLG A;  4XSX F;  2HXI A;  1G2H A;  1SD4 A;  1DU0 A;  1QZE A;  1EH6 A;  2PMH A;  4IPA A;  1P2F A;  4Y33 A;  5HLT A;  4F3Q A;  3FXJ A;  1GT0 C;  1XC5 A;  5HLH A;  1KU9 A;  2XIG A;  5KK1 A;  3VFZ A;  3VOE A;  3IRR A;  2YU3 A;  5LEJ A;  3S14 J;  1WI3 A;  3GTJ J;  3SYT A;  4Y13 A;  2DDB A;  2DO7 A;  4JBA A;  5GPA A;  3CMY A;  3NAR A;  5IP6 A;  4BEH B;  1BC7 C;  1XS9 A;  3CMA I;  1B8I B;  2R7Q A;  1QA6 A;  4YIR X;  3PO2 J;  3S2W A;  1P4A A;  3BY6 A;  3D5R C;  1GLN A;  3V4G A;  2JRT A;  3R6S A;  4AM3 A;  1SD7 A;  3WHC A;  1JKO C;  1YS7 A;  3GZ6 A;  4L0Y B;  3HJE A;  1XD7 A;  2ZJ2 A;  1S29 A;  2DI3 A;  2K86 A;  2QSH X;  2UZK A;  2BBY A;  3DEE A;  3CC2 I;  5AIQ A;  2BHY A;  3NWS A;  4CYD A;  3DU5 A;  4XKV A;  2DT6 A;  3J7A Y;  2VT2 A;  4QPQ A;  1HDD C;  4UB6 C;  4HF0 A;  4PK4 A;  3R61 A;  2F5C A;  5ICG A;  2O6G E;  1VQL I;  1SEU A;  4A3B J;  1KZH A;  4PDK A;  3L2W A;  2MC3 A;  1YW9 A;  5FD5 A;  3I71 A;  3K0L A;  3BPV A;  5LRR A;  3DTK A;  4J19 A;  2E36 A;  3RPU D;  4MTD A;  2MD0 A;  3ASO H;  3RQ4 A;  4RAY A;  1MIJ A;  3NRV A;  2XGE A;  1U78 A;  4M6X A;  5B3S H;  3DQV C;  1HKQ A;  4Q5S F;  5LD2 C;  2NS8 A;  3H36 A;  2CQ7 A;  2HI3 A;  4AYB N;  3L2Q A;  2CQQ A;  2ELJ A;  4IHX A;  1W1W E;  3F22 A;  4XRM A;  1YLF A;  2A07 F;  4HNT A;  4V19 K;  4EAT A;  2CWE A;  3CJQ B;  4EMS A;  2EZK A;  3JSP A;  1LVA A;  2LP0 A;  1FBQ A;  4HF2 A;  5FJ8 J;  3PO3 J;  3BJO A;  2ME0 A;  5EZH A;  2OV7 A;  4WXH A;  3TKY A;  1GXP A;  3L09 A;  1MJA A;  3HZJ A;  4XON A;  4BQO A;  5CVI A;  3S1Q J;  1Y0N A;  1BW6 A;  4UVA A;  2LC2 A;  4XSZ F;  2CMP A;  4ETS A;  4YFN F;  4KIS A;  1RKW A;  4W97 A;  2W00 A;  1I27 A;  2L7M P;  5FKK A;  2L01 A;  3CLQ A;  2XAS A;  4DBR A;  1Y56 A;  3ONQ A;  2NVU B;  3BG7 A;  5ILV A;  1MH4 A;  1OCR H;  2R7X A;  3KE2 A;  3PIO F;  4IRH A;  3S2H J;  1T0F A;  3REO A;  2QLZ A;  4C2U A;  4F92 B;  5J8F A;  1LPQ A;  1HLV A;  2HOE A;  1I3Q J;  3ZOB A;  2YUS A;  2GIZ A;  3HOT A;  2F4O B;  1EA3 A;  4WK8 F;  4HX8 A;  4BQQ A;  1QPM A;  4EJW A;  3ZQG A;  2STT A;  2UWM A;  5IT9 Z;  1X2N A;  4KIG A;  4BJT A;  3CCM I;  3E6M A;  3KZI C;  3EPZ A;  4IOA F;  2LH9 A;  1ULY A;  3HIF A;  2FRH A;  2L4A A;  3KP2 A;  3ZCO A;  2M8E A;  3FHN A;  3JAM K;  5IOY A;  3S3N A;  1NTC A;  2EIM H;  2IGK A;  2W85 A;  1P7J A;  1VI0 A;  1OYW A;  1X3W B;  2VN2 A;  4N4O B;  1Q1V A;  3BR1 A;  2RKH A;  2NOG A;  1OQY A;  5BMZ A;  2ZCW A;  1F36 A;  5J1U A;  2M0M A;  4A3M J;  1HC8 A;  4RB1 A;  2LKX A;  3MZ8 A;  2IS6 A;  1YIT I;  2DMQ A;  4DIQ A;  3S32 A;  1Z7U A;  4N9H A;  4ENN A;  3E1S A;  3ZQH A;  4XOP A;  1FBS A;  4IHV A;  1GHC A;  4C3I J;  4BY7 J;  2Q0O A;  4PJJ A;  2DOD A;  1APL C;  2XGD A;  3VYS B;  2L7F P;  4XL9 A;  3QU3 A;  4ZYA A;  2DLL A;  3NQO A;  3RYP A;  1GV2 A;  1R22 A;  2Y9Z A;  1VF9 A;  2FQ4 A;  2XRO A;  1OYI A;  2EZI A;  4C3H J;  3RKX A;  4AD9 A;  1W36 C;  2M7B A;  1D1A A;  1XGM A;  5D8L B;  5B5E C;  1TT0 A;  4ZZL A;  4A3K J;  1OR7 C;  1OKR A;  3J7Y J;  1T56 A;  2QQB A;  2QYO A;  4MO7 A;  3KPH A;  1IXC A;  1KYW A;  3RKW A;  1ZAO A;  3AAF A;  1PUF A;  2QA4 I;  4XM3 A;  2IPQ X;  3N4M A;  2OTL I;  3VWB A;  2V7F A;  1G3S A;  5FB2 A;  3JTG A;  4BH9 A;  3F3X A;  2MYS A;  3LQQ A;  1OPC A;  1X1P A;  2D1V A;  5J3L A;  4FIS A;  2L54 A;  2W25 A;  4MEY F;  4HX4 A;  2ZJR F;  1A5J A;  4IHT A;  3M8F A;  3J81 K;  2LY1 A;  1MDM A;  3GXO A;  1MKM A;  5E17 F;  3PNY A;  1BM9 A;  4YG2 F;  3D0S A;  5HDK A;  1LEA A;  2E1N A;  1KGS A;  3OYD A;  4HYE A;  1D0Z A;  1A6I A;  1IXS B;  2QEX I;  2Z99 A;  4A3I J;  1E3H A;  4CCJ A;  1PUF B;  5FD6 A;  3DLA A;  4HRI A;  3KP5 A;  1HKT A;  3MKL A;  4EJU A;  3DXJ F;  3LMM A;  5IPA A;  4OAZ A;  1RNL A;  3ASN H;  5DS9 A;  4NC7 A;  1Z7L A;  4L5E A;  5M5Y J;  2NVQ J;  4WXC A;  3CLO A;  3LSH A;  4CCO A;  5D6E A;  4HNU A;  4HQE A;  1I1G A;  2X51 A;  2ZC2 A;  1VFC A;  2QM3 A;  2RAE A;  1SAX A;  1S8N A;  4LOC A;  4OIP F;  2M2E A;  1ZLJ A;  1TWH J;  2Y69 H;  2OC6 A;  4UUV A;  2ZNZ A;  3T8T A;  2YR2 A;  1RRJ A;  2Z5U A;  5IYD J;  4N9I A;  1J5Y A;  3WU1 B;  1UJ8 A;  3OYL A;  1U8R A;  2Z1D A;  4RB0 A;  4ZYH A;  3QWL A;  1TW2 A;  4ENK A;  3RZO J;  2ICW G;  1ETQ A;  3RYR A;  2Q2E B;  1UFM A;  4S04 A;  2HOT A;  3BZC A;  3DV8 A;  1PDN C;  1MBK A;  2JA6 J;  1IDY A;  2QEN A;  4CGZ A;  2EIL H;  2FBH A;  4DGW B;  9ANT A;  2QKM B;  2CUZ A;  4QSH A;  1O4X A;  2VKV A;  3BJA A;  4M3F A;  1IAW A;  2CFO A;  1MJB A;  3GBG A;  5DM6 F;  1FSH A;  2CRG A;  4IL6 C;  3ECH A;  5DTD A;  4OIR F;  4BDY A;  1EV7 A;  4ON0 A;  3OV8 A;  3FK6 A;  3WTS C;  2OTJ I;  2OA4 A;  2FD5 A;  1YE9 A;  3GCM A;  2M3A A;  5B1B H;  5TGT A;  3DTI A;  3DPT A;  2NAZ A;  1ETK A;  4ZTF A;  3K6G A;  4L5J A;  1SC7 A;  3UR3 C;  2WC2 A;  2R7S A;  2BYV E;  3DTE A;  1LB2 A;  2ZKZ A;  3H35 A;  1ZQ3 P;  3ESW B;  3BRO A;  1I1S A;  1VQP I;  2NVT J;  3VYR B;  1KU3 A;  1YYV A;  1YX5 A;  3KYD B;  4RMN A;  4Y3O A;  2M1B A;  4X0G A;  2HXO A;  3FBI B;  1S6L A;  2EV0 A;  4P9F A;  3TMO A;  5E3M A;  1XSD A;  1TNS A;  3IL2 A;  4XIC A;  1W7P B;  2P7V B;  1R23 A;  2WAQ N;  4D5C A;  4EM1 A;  2R5Z B;  1U5T C;  5CQG A;  2DPU A;  3A03 A;  3A01 B;  1Z0X A;  4OIO F;  1UMQ A;  4ITV A;  2BE5 F;  1K6Y A;  2P6S A;  4F55 A;  3CO7 C;  3EYI A;  2XGC A;  1QNT A;  2K9S A;  4XMY A;  5LGU A;  1IF1 A;  1IGN A;  2VLA A;  2V6C A;  3FXL A;  2O8K A;  4JX6 A;  1PVE A;  3F8F A;  4M3E A;  1YX3 A;  1BBY A;  1QZZ A;  3HSR A;  3K4L A;  3JRB A;  1LJ9 A;  2IAI A;  3VYU B;  4D1Q A;  2COM A;  1FPQ A;  2A6E F;  2TCT A;  4HLY A;  2X6Y A;  4DZJ A;  3MKY B;  1AKH B;  4C2T A;  3G6E I;  2EZL A;  4CDG A;  3KZZ A;  2PLY A;  4LMY A;  1HQC A;  3K1M A;  2JA8 J;  2E7W A;  3HDD A;  1V54 H;  2VT3 A;  3OYF A;  5LHI A;  3I4N J;  3BZK A;  3HKZ N;  3SZG A;  2DN0 A;  1BI0 A;  3I59 B;  1QVT A;  4DYR A;  3FMR A;  2LRD A;  5H2F C;  2KJC A;  3TW6 A;  4GCV A;  3CQZ J;  2BVL A;  1MNE A;  3F0C A;  3UKG A;  2RC4 A;  4U88 A;  4U0Y A;  2R7R A;  4DBQ A;  1XSX A;  3A2K A;  3KP3 A;  2JJ7 A;  4EM2 A;  3JAM Z;  1ZR2 A;  2VQG A;  2CV1 A;  3EET A;  5LHG A;  4LIV A;  1ZRE A;  2BW3 A;  4JK1 X;  1WJ5 A;  4XBF A;  2R7Z J;  3BLY A;  5CKT A;  1BJZ A;  5FKN A;  3TGN A;  3COA C;  3S1R J;  4D7M A;  1B9N A;  5A2Q K;  2O0Y A;  4S05 A;  4F52 A;  5EGO B;  3E5Q A;  3MD2 A;  2Q1Z B;  2ZXH A;  3FM3 A;  4Q48 A;  1H9G A;  5KNL A;  1P4W A;  1EH7 A;  3IAS 2;  1VQ6 I;  4LG3 A;  5ILS A;  1SD6 A;  1ZGJ A;  5E18 F;  4BS9 A;  3MZH A;  1XMK A;  3GTM J;  2FA5 A;  2ID6 A;  2XAH A;  1D5Y A;  2EFO A;  2XF6 A;  1G3Y A;  1KQ0 A;  4PJM A;  2DQL A;  4LLL A;  1FYL A;  1JHF A;  4RGS A;  3H3U A;  4R79 A;  2BGC A;  1HW2 A;  2EWN A;  4RAF A;  2ECC A;  4U7B A;  1CGP A;  5AIP A;  2FU4 A;  4BY1 J;  3CTA A;  2A05 A;  1FP2 A;  2JA5 J;  3R4K A;  1BW5 A;  5H6Q A;  1MMD A;  4LLN A;  2M7A A;  2XAU A;  4EM0 B;  2D5V A;  1N25 A;  5F6F A;  3H5R A;  1RR7 A;  3LA3 A;  5DEQ A;  1S72 I;  3O3K A;  4M6V A;  1V5E A;  2ZXJ A;  1Z21 A;  3E6C C;  5J8C A;  2IA1 A;  3W2V A;  4CZZ A;  4BEH A;  5F1R A;  1LFP A;  2P5K A;  2CUF A;  1TBX A;  3E7L A;  2E2I J;  1BR1 A;  3HXL A;  4DYC A;  4A5M A;  3K4J A;  2MH2 A;  1UST A;  3DEW A;  1WH5 A;  2L9S A;  2MA3 A;  4BQN A;  3BZ6 A;  2HTS A;  3OIO A;  4IX7 A;  1SFU A;  3K9T A;  1IZ1 A;  2PMZ A;  1LDD A;  5DUK A;  3BR6 A;  5FGM A;  4U87 A;  3HOV J;  3LFU A;  1R1T A;  3C18 A;  4M3B A;  2Z9O A;  2GIV A;  4FE7 A;  1ZAR A;  4HW0 A;  2EIN H;  4RM2 A;  2L9V A;  4FE4 A;  1T8I A;  4BJ5 C;  4A3C J;  1YW7 A;  4I76 A;  1D1B A;  4FAS D;  2I10 A;  5TJJ A;  3TL4 X;  5LGT A;  4XLN F;  1RES A;  4A3G J;  5GAG J;  4QIW N;  2GBY A;  1ACI A;  2L3D A;  4ZDL A;  3CCY A;  3JRH A;  2KZV A;  4M3D A;  4CZC A;  6PAX A;  2IA0 A;  5F0C A;  4CA0 A;  3K4M A;  3K4B A;  3D1N I;  5CLS A;  1R4M B;  1MNM C;  4PGH A;  2KLO A;  1MMS A;  4G8X A;  2OJE D;  2P7C B;  1WFX A;  2HYJ A;  2WV1 A;  1FLI A;  1L3L A;  2W48 A;  4V2G A;  2OPT A;  3EQL F;  5ICC A;  3M1C A;  1IV8 A;  3I3L A;  5DD8 A;  1YOV B;  3DPL C;  1JUM A;  2B7E A;  2IT0 A;  3CCS I;  3IKV A;  1JTX A;  2KMU A;  1TTY A;  1POG A;  2KRH A;  3PNT A;  3H1C A;  4MHG A;  2AXT C;  1Y1V J;  2KDO A;  2Y0M A;  5LGN A;  1IRZ A;  4HSR A;  2E19 A;  2G7U A;  5HS9 A;  1EF4 A;  4MQV A;  3OYI A;  1FY7 A;  3ROU A;  2P5V A;  2GA2 A;  2YPR A;  3BG5 A;  2LNB A;  2OAZ A;  3DLL F;  2HKX A;  3KP7 A;  4HDU A;  5HLG A;  1MJ9 A;  3ZQQ A;  4BE2 A;  3ZMD A;  4HG2 A;  4GRI A;  4I98 B;  4EQQ A;  3OMY A;  3TOB A;  2KIF A;  3MEX A;  1KQ8 A;  3LSM A;  3F72 A;  5ICE A;  1JJ8 C;  1F43 A;  5HVQ C;  2KFD A;  2LYC A;  4GO1 A;  3OYK A;  1NK3 P;  3CUQ A;  2W4S A;  1MMN A;  2OCE A;  3SHF A;  4GDF A;  3ABK H;  4IQ4 A;  4PFP A;  3DF8 A;  2CW0 F;  1BI1 A;  5K7Z A;  2Y31 A;  3ABT A;  1FMW A;  4RGR A;  3HOZ J;  1N78 A;  4AIH A;  1QVU A;  4NB5 A;  5D5U B;  3G1L A;  3PSF A;  2JUC A;  2IJL A;  5JHF A;  2NRA C;  1E0E A;  5F08 A;  3WU2 C;  4XRF A;  3SEQ A;  2P0W A;  2Y75 A;  2L9N A;  3MKW B;  1P92 A;  5D4R A;  1AWC A;  2GXG A;  4XQF A;  1VQ8 I;  4EV0 A;  2LVS A;  5CVR A;  3SZP A;  1Z6R A;  3W2W A;  1FTZ A;  1RZ4 A;  1TW3 A;  2BHZ A;  4B3X A;  2XUB A;  2CG4 A;  3LSI A;  2P5L C;  2C6Y A;  2DBB A;  2MBF A;  2HWV A;  3WTY C;  2ISY A;  2K9L A;  3F8C A;  1XCV A;  1XG1 A;  3NAU A;  1FJL A;  1K78 B;  4FT8 A;  1YIJ I;  1O57 A;  1JTY A;  2H6B A;  1XCB A;  3ZMU A;  3OS0 A;  5A2Q Z;  3L2V A;  1H88 C;  1R4N B;  4GGG A;  2VQL A;  4D9J A;  5ED4 A;  1GUU A;  4PCQ A;  3LA2 A;  3BQY A;  2VKE A;  2HVS A;  4AIJ A;  1ERD A;  1HST A;  2FE3 A;  5LRS A;  2R7F A;  2D1H A;  4E7L A;  1B72 A;  2M9H A;  4W1U A;  1JGS A;  1CF7 B;  1DP3 A;  2VBW A;  4E7I A;  2L4M A;  3V7S A;  3WTX C;  3PSI A;  1BIB A;  1BR2 A;  2DFF A;  2XAJ A;  3B02 A;  3TDZ C;  2EB7 A;  2HR3 A;  4KIB A;  4HDV A;  4PJL A;  5DCF A;  1MZB A;  1JE8 A;  4EJV A;  1CQT A;  3I56 I;  4JYK A;  3OIP A;  4BKX A;  4ZDO A;  4M9X A;  4QLC U;  2XGX A;  2CO5 A;  4G7Z F;  4M71 A;  2QSF X;  3E5U A;  5IYB J;  1XX5 A;  5K1Y A;  1SVO A;  4LK0 F;  4IHY A;  4ZDP A;  5AON A;  4MLO A;  4BDZ A;  5CJ9 A;  1Z67 A;  5DM7 F;  2AQE A;  2DA7 A;  3O6B B;  4UVC A;  3LSJ A;  4YFX F;  1BOB A;  1XGS A;  2F4I A;  5M3F J;  4II3 A;  3CF5 F;  1WI9 A;  4RA2 A;  1UHS A;  1IRG A;  1X1C A;  4PZJ A;  2VJI A;  3S1M J;  2UUZ A;  4N4N B;  3MQ0 A;  1LFB A;  2JUG A;  2WY7 Q;  2YX7 A;  5FKM A;  2OZ6 A;  2O8X A;  1WHU A;  5EEG A;  1IC8 A;  1OLT A;  2RRE A;  4M6Y A;  2HFH A;  3BWG A;  4CSW A;  5EJC A;  4M3G A;  2IS4 A;  3F8N A;  5FRN A;  1FP1 D;  1A6Q A;  2JTV A;  3I4P A;  1OCT C;  2E7X A;  3DBL B;  1V55 H;  2HZT A;  4OMZ A;  3X2Q H;  3QOD A;  2KHM A;  2Y0S N;  5D5W B;  1Y0U A;  2DAO A;  3WE2 A;  2DFE A;  2EA2 A;  4BAY A;  2IS2 A;  4UY8 I;  1LFU P;  3JTH A;  2XKO A;  2W7N A;  4KJZ A;  2HGC A;  2QQ9 A;  1ZHF A;  2XPW A;  3C2B A;  2X6W A;  3R0A A;  1B59 A;  1JJ6 C;  4GXO A;  1WPK A;  2PJR B;  2A6H F;  2FNA A;  3U1D A;  2ZFU A;  4UUS A;  2W57 A;  2MG4 A;  2VXZ A;  3ZN1 A;  2IEK A;  4A0X A;  2V1U A;  1MGT A;  1ETV A;  3CUO A;  3DPU A;  5CYV A;  5E3O A;  2FF4 A;  2PN6 A;  1YHQ I;  4HLX A;  4E7S A;  5EG0 B;  4I0B A;  3GTP J;  2K85 A;  1B8I A;  2VAS A;  3H9Q A;  4ENJ A;  3PFI A;  4EVI A;  1ZK8 A;  2R3S A;  1WJB A;  4M74 A;  3L9F A;  2F5V A;  2GAU A;  1TQM A;  2R5Y B;  2V9V A;  1VQO I;  1KU7 A;  2M8G X;  4EGY A;  1LQ1 A;  1ZLK A;  1JKR C;  1B9M A;  4Y17 A;  3GWZ A;  1IO2 A;  4JQF A;  1VZ0 A;  4AC0 A;  1TWA J;  3OYM A;  1JT6 A;  1X4O A;  1XDS A;  1MH3 A;  4J01 A;  2XAQ A;  4A12 A;  3AG1 H;  3GTK J;  1RET A;  1XN7 A;  4AIK A;  1H89 C;  3M07 A;  1Z1D A;  2PMU A;  5D5X B;  2QZ8 A;  5HNF A;  3W3C A;  4A2U A;  3T8R A;  1FMV A;  3GO5 A;  2ZBK A;  1S9H A;  3BTC A;  2LY9 A;  1SMT A;  3OR1 C;  2VOO A;  3VEP A;  2NVX J;  1FT9 A;  5GAE J;  1BN5 A;  2R7D A;  4XLP F;  1WSU A;  2N8G A;  4ZJZ A;  2R5Y A;  1ZRD A;  3HGG A;  2PQ8 A;  2R4G A;  3PM1 A;  3C7J A;  4CH7 A;  4I09 A;  3RCO A;  1PUE E;  4LB5 A;  5F1J A;  1K83 J;  4U7D A;  2K4B A;  2A6T A;  1ETO A;  3H3V K;  4IVN A;  3H5N A;  3I54 A;  5EDN A;  1FBU A;  1YRN A;  2H94 A;  2V6E A;  4NUB A;  1MND A;  1Z3Y A;  4G94 A;  2L7Z A;  4B8X A;  2LBF B;  5L3C A;  3Q0V A;  5TIS C;  3S3O A;  3E0J B;  3D5L A;  1RUO A;  2E1M B;  4F93 B;  4P5O A;  2CS3 A;  3E5X A;  1R1U A;  4B44 A;  1FOK A;  2VKD A;  2MC4 A;  3P9C A;  2ZJQ F;  2A61 A;  3HM5 A;  1TWF J;  1ZTR A;  2EPF A;  2OZU A;  3GF2 A;  3HUG A;  3L1P A;  2WY8 Q;  3JW4 A;  2EBI A;  4RAG A;  2F4M B;  1SAN A;  1Z3X A;  4Q47 A;  2CW7 A;  3F23 A;  1QRY A;  3Q0W A;  3PUF A;  3CJN A;  2XPV A;  5J4Y A;  4B48 A;  3DEU A;  3K69 A;  2XC7 A;  4KT5 C;  1VQ7 I;  5JLW A;  2RDP A;  2K7L A;  1YO5 C;  3JRF A;  2LF7 A;  4AID A;  4CO8 A;  2TRT A;  5E1W A;  3I64 A;  3BP8 A;  1NH3 A;  2VPR A;  3CP8 A;  2OU2 A;  2EQR A;  2LD5 A;  1OFC X;  2IGM A;  4XN0 A;  1FOY A;  3GFJ A;  1T6S A;  5FO5 A;  3WTW C;  3QPS A;  5D5V B;  3I9V 2;  1M1E B;  1UHW A;  1MBF A;  2XB5 A;  2HDD A;  2V1D A;  1FZP B;  4IHW A;  1JKQ C;  2K3P A;  1BI3 A;  2OD5 A;  3DWL E;  4BQA A;  2R7O A;  4MTE A;  4A0Z A;  3FM5 A;  2IBD A;  3HL2 A;  2DU9 A;  1U9N A;  4AU7 A;  5DCM B;  3T1B A;  4KT6 A;  1QU3 A;  1P9Q C;  5FRM A;  1MBH A;  5B1A H;  4OU0 A;  1FTT A;  3J80 Z;  5BS6 A;  1E2X A;  3CF2 A;  3OIQ A;  2JMW A;  1BR4 A;  2K3F A;  2DA2 A;  3CCQ I;  5B66 C;  2FX0 A;  2V26 A;  4FCY A;  3OL4 A;  1X1B A;  3GTG J;  5CVV A;  2BXZ A;  2YS9 A;  5KAF C;  4RLF A;  1S3J A;  1OYY A;  2ADU A;  2M34 A;  4G12 A;  1K7A A;  2E34 A;  3GW2 A;  3JRC A;  2JT1 A;  1WVR A;  4RAZ A;  3ZXS A;  1W7P D;  3A1Y A;  1DPU A;  2JRM A;  1ETW A;  5IT9 K;  5IT3 A;  2X9D A;  3ABU A;  2V9K A;  2TDX A;  5DYM A;  1O3S A;  1MDM B;  2ELK A;  5F27 A;  4CHU A;  2PEX A;  5C4X J;  1G4D A;  4DYQ A;  1V4R A;  3K7A J;  5GPC A;  1IG7 A;  1SVM A;  2B0L A;  3ZN0 A;  3FK7 A;  3UNG C;  5IY5 H;  3LSP A;  3SXY A;  4E7J A;  2RVC A;  2IXS A;  2W24 A;  3EDP A;  2XRL A;  3FXR A;  4PJN A;  5CPR B;  3AKZ A;  1SFE A;  3DKX A;  3G71 I;  1SFK A;  2I5U A;  4XLC A;  2BV6 A;  3BR2 A;  3J7Z I;  3K70 C;  2K40 A;  2E1C A;  1MMG A;  3OY9 A;  3G1O A;  4CCK A;  5M5X J;  5L3E A;  3DBH B;  4HX7 A;  2ZME A;  3JRD A;  1I6H J;  3HOY J;  2LTP A;  3FIW A;  2QQA A;  3MFK A;  3S15 J;  5BNG A;  4ABZ A;  1R7J A;  1FYK A;  1OCP A;  2QF7 A;  3PNV A;  4OMY A;  4RB2 C;  4I99 C;  5D6F A;  2CFX A;  1UG2 A;  2O7O A;  2X4H A;  3HPH A;  3IUO A;  4DW6 A;  2DOF A;  3W2A A;  1HXD A;  2E2J J;  5KVR A;  3M4O J;  1ON1 A;  3HRS A;  1J0R A;  3PFY A;  3HSE A;  3GTL J;  1DU6 A;  4ANJ A;  2QVO A;  4LGW A;  1O3Q A;  3KLO A;  4KN7 X;  4B4C A;  1KON A;  2FUG 2;  3FKJ A;  4PJ0 C;  3HYI A;  3AG4 H;  3CCU I;  1U0J A;  4RGX A;  3CDI A;  2V79 A;  2EH3 A;  5GTH C;  2JA7 J;  1XGN A;  1YIO A;  1G8X A;  3JR9 A;  1UCR A;  2B9S A;  1C0W A;  2E5Z A;  4JX4 A;  4DZP A;  4UXN A;  2CGP A;  4GYG A;  3GTQ J;  1B4A A;  4XKB A;  3JRG A;  3HEF A;  3ZQ7 A;  1TNT A;  2VQC A;  3KEO A;  2HEO A;  2XAG A;  2HQN A;  3MZY A;  3TBI A;  3C3W A;  2VBY A;  2DA6 A;  3W6J B;  5KHD A;  3OYB A;  1U8B A;  3H0D A;  1VQK I;  4LG0 B;  3PIP F;  2VC0 A;  1S7O A;  2HQA A;  4J00 A;  3K4K A;  1XPX A;  2VOD A;  2L7K A;  3MCZ A;  2DA5 A;  1OMI A;  1SAU A;  2YX4 A;  4HEA 2;  2KKO A;  3CUQ B;  4NHJ A;  1LDK B;  2F5D A;  3B73 A;  4KDP A;  2KIM A;  3I0T A;  5E8G A;  5LLQ A;  2VXD A;  5IOZ A;  3FDY A;  1Y8Q B;  2HVQ A;  2AS5 F;  2LDU A;  3FMQ A;  1O7L A;  4L9V A;  1SFO J;  2ZO4 A;  1H0M A;  3KCC A;  3WGI A;  3KIO A;  3K10 A;  3GME A;  3NWT A;  3V8J A;  1WQ2 A;  1HA8 A;  2D2W A;  1ETX A;  2VBZ A;  3OSF A;  4IRI A;  1T2K A;  2KP6 A;  2FMY A;  5EEH A;  1WWX A;  3LNQ A;  1QO0 D;  2ZFW A;  2F6C A;  3QPT A;  4ZYG A;  5M3M J;  3L2R A;  2VOP A;  1MW7 A;  5JLX A;  1W5T A;  2XVC A;  2XF7 A;  4PUS A;  2LKS A;  1IUF A;  2MH9 A;  3H5A A;  3KLN A;  2ELH A;  3LWF A;  4E70 A;  2IS1 A;  4YEL A;  2XV4 S;  2R7U A;  1P7I A;  2ACJ A;  1EJ9 A;  3QP6 A;  1TQI A;  2ZSH B;  3CC7 I;  1JXS A;  2IGO A;  2JSP A;  3ML6 A;  3BR0 A;  2JK3 A;  3LA7 A;  5K7H A;  2JWT A;  1W7P A;  1O3T A;  1F5T A;  5KCM A;  2PFB A;  1VQM I;  1MSE C;  4A3L J;  2JPB A;  4ESB A;  3FHZ A;  1ZRF A;  2JSC A;  3GTO J;  4NQW A;  2RNJ A;  4HV6 A;  3M7G A;  2IGN A;  3ABM H;  2YU9 J;  3M9A A;  4LFU A;  2EFP A;  1V3F A;  2O9L A;  2O3F A;  1R1V A;  3K70 D;  3BC8 A;  1EKE A;  1OIS A;  4A3E J;  3BJ6 A;  1SD5 A;  3PQJ A;  4LJZ F;  3KYL A;  1JUS A;  1AU7 A;  1E3P A;  1ZEL A;  2F5F A;  2A5W A;  4OOI A;  3TW7 A;  2XSD C;  1ZRC A;  4EJO A;  2VPL A;  3M8E A;  3EUH C;  1D3Y A;  4LLG F;  4ESJ A;  2KRF A;  2J5P A;  5F0F A;  4YFK F;  1STZ A;  3VSL A;  3OYG A;  1W5S A;  2DCE A;  2G0E A;  3OOU A;  1XSV A;  1R5I D;  1K4T A;  3RKY A;  2HDC A;  2M4K A;  5GP9 A;  4FTH A;  4BHP A;  5K5Q A;  2QKL B;  3F6O A;  1ODD A;  3S93 A;  4IZZ A;  2DTR A;  3SFI A;  4OAY A;  3HHH A;  2VC1 A;  4Y15 A;  2VE9 A;  1WJD A;  3QYF A;  1QHG A;  2LFB A;  2GLO A;  3DKY A;  4XOR A;  3S1N J;  2HZD A;  1WKM A;  4ZC3 A;  3HOS A;  1G3T A;  4MQ9 F;  1TQP A;  2WAD A;  1XGO A;  1R5H A;  2Y9Y A;  2UXX A;  1U2W A;  4CYC B;  3G73 A;  1TWG J;  3SQN A;  1R00 A;  2RGV A;  2ZNY A;  4FX0 A;  1D5V A;  3M3Y J;  2GXA A;  3MAJ A;  3MMY B;  3U21 A;  2PX9 A;  2MD5 A;  3T5X A;  2Y0S A;  3AFH A;  2HYG D;  2KT0 A;  2AO9 A;  1IN7 A;  3AG3 H;  3ZQI A;  1IJW C;  4A6D A;  2OCC H;  2HTJ A;  1DP7 P;  2E1O A;  4II2 A;  2ZXW H;  1T0F C;  4RLQ A;  5C4J J;  3SEZ A;  2O03 A;  2Q2E A;  4EGZ A;  2HS5 A;  3IHU A;  4QPO A;  2ME6 A;  1IDZ A;  1H9T A;  1JGG A;  1DQU A;  1HSJ A;  3WTV C;  1R71 A;  1FOX A;  4BJ6 C;  1IV6 A;  4ZYD A;  4CYC A;  2DPD A;  1S5L C;  3GLL A;  4G6Q A;  1YTY A;  3OL3 A;  3DP7 A;  3E97 A;  4IEJ A;  2FJ1 A;  3M1E A;  3RDI A;  2KPM A;  2NOJ B;  2BOL A;  1ORK A;  3BQZ A;  2BY1 A;  2X1E A;  3WGH A;  1OCC H;  4O5V A;  3FZV A;  4XNF A;  3U2R A;  4L9J A;  2GOX B;  3HC7 A;  3VOD A;  2O61 A;  2I8D A;  2RQP A;  2X6X A;  2VUM J;  4BL0 B;  1X58 A;  2KIU A;  4PSW A;  4XLF A;  1F1Z A;  2Y30 A;  4CXF A;  4KMF A;  1TWC J;  2QSG X;  3V8K A;  4BU2 A;  1QHH D;  3QRF F;  2P4W A;  3WTT C;  1B72 B;  4GFB A;  2XRN A;  1XDU A;  1ZN2 A;  2PMZ N;  4H0E A;  4Z2Y A;  2YSR A;  5J47 A;  1F4K A;  5EG0 A;  2XSJ C;  3ZMS A;  3IP4 B;  2CUE A;  3LSK A;  1U6G A;  3OYJ A;  3K4N A;  3OSG A;  2LKP A;  3H9J A;  3CJR B;  4E7K A;  1B6A A;  2XB0 X;  1W0T A;  3WG9 A;  4CUG A;  4O6J A;  3P9K A;  2Q8K A;  3BCB A;  5DV5 A;  4ESF A;  3W6V A;  5D8K B;  3EUA A;  1RI7 A;  4BXU A;  4A3F J;  3F6V A;  4XLA A;  2ZB9 A;  4KIF A;  3J7A O;  3ZQF A;  1DUX C;  4UV8 A;  1IRF A;  4KIC A;  1LE8 A;  2WB1 A;  3IH2 A;  3EUH A;  3MVP A;  3L00 A;  5E8I A;  4C30 A;  4ZTJ A;  5FLM J;  2VI6 A;  1UEL B;  3BDD A;  5EEA A;  2GZW A;  2FQ3 A;  4UNO A;  2LLK A;  4WF2 A;  2IP2 A;  2HKO A;  1W36 D;  2DMT A;  2LR8 A;  2ZME B;  2Y2Z A;  2A68 F;  2EV5 A;  3T0Y A;  2CV2 A;  2M4G A;  3VB2 A;  1MSF C;  3CD6 I;  1UB9 A;  1FC3 A;  1BC8 C;  1ZGA A;  3SJM A;  3CJT B;  1OR7 A;  1UAA A;  1J2X A;  4G6T B;  4UHT A;  2GOM A;  2EZH A;  2X1C A;  3MWM A;  3GFL A;  2X85 A;  4RGU A;  2LK2 A;  2DJI A;  2XKP A;  1IRX A;  1IN6 A;  3BPX A;  2FML A;  3HTU A;  3Q9V A;  4XOT A;  2QBY B;  1FNN A;  2DA1 A;  1ONV A;  3E3V A;  2P6T A;  1VQ9 I;  2JQ7 A;  2F2E A;  4I7H A;  2R92 J;  2RN7 A;  2VB6 A;  2VBX A;  3O8G A;  3HHG A;  1WJA A;  2H8W A;  3Q9S A;  2EV6 A;  1QQI A;  3ABL H;  3BTJ A;  4WX9 A;  3TED A;  5LEK A;  1K61 A;  2LRE A;  3RZD J;  1QBJ A;  2BEO A;  4L9N A;  5LHH A;  2HPI A;  1FOW A;  2E2H J;  2BZT A;  2V1X A;  5E3L A;  2FOK A;  2AQF A;  3ZR8 X;  3LAJ A;  1T08 B;  3IV5 A;  4PSX A;  2BW3 B;  5L3B A;  2OBP A;  3TQN A;  1X4P A;  4E6K G;  5BOX A;  3BG6 A;  1YI2 I;  3GEZ A;  2STW A;  3VSK A;  5FLX K;  2EFN A;  3SFZ A;  3WG7 H;  3RPQ A;  3IH4 A;  4WCG A;  5EGO A;  2AHQ A;  2VE8 A;  5JFR A;  4RM3 A;  2DMP A;  3I4M J;  4MIM A;  3FXO A;  4MGR A;  3C2H A;  1K4S A;  1ZG5 A;  3PJR A;  1NG6 A;  1HCR A;  5ILU A;  2WTE A;  2F5E A;  3M8J A;  2H1L A;  1MBE A;  5F0H A;  3RTR A;  3IRQ A;  1REP C;  4G7H F;  1USS A;  1JI8 A;  2R7T A;  2CSO A;  1A04 A;  1WH7 A;  1IUY A;  2CQN A;  4JX5 A;  2EIJ H;  3V7C A;  4O3M A;  3HOW J;  3OYN A;  3FXK A;  3H3Z A;  1X1A A;  2ETH A;  3W6K B;  1BL0 A;  1P6R A;  1HKS A;  5GAH J;  3AL0 C;  1G3W A;  2VJ4 A;  4UUT A;  2LG4 A;  1S7A A;  3OS2 A;  2CQK A;  3ZP5 A;  3R60 A;  3I5U A;  3F8B A;  3S2D J;  2K9N A;  4Y4R A;  2JZY A;  3QOP A;  3DBR B;  4A0Y A;  2DK5 A;  1WJE A;  2JA2 A;  2QUF A;  3SDG A;  5KAI C;  2L02 A;  2RV8 A;  2EFW A;  2K9M A;  4A3J J;  2GA1 A;  2WAQ A;  5J6X A;  3WGG A;  2DOA A;  1LUJ B;  3F9K A;  2HOA A;  3BG9 A;  3LSG A;  1YJN I;  1VQN I;  1FX7 A;  3FKI J;  1BA5 A;  5FRO A;  2W82 A;  4NQW B;  3VPR A;  4P55 A;  1U5T B;  3IWZ A;  1B1B A;  2WB1 N;  1LE8 B;  3H92 A;  5EZG A;  3L7W A;  5FFZ A;  4C3J J;  1D8K A;  1I50 J;  1WJC A;  4DNC A;  4DJA A;  5L3G A;  2KIQ A;  5CQE A;  3IKT A;  3E6B A;  1CF7 A;  2DXI A;  1D8J A;  5HLI A;  1HF0 A;  3B6C A;  3LST A;  4BBR J;  1MBJ A;  2LBF A;  3HGY A;  4U0V A;  5EYR A;  1PP7 U;  5F04 A;  5CVU A;  5F64 A;  1PYV A;  1NG7 A;  1I39 A;  1ZYR F;  2J5O A;  2MFZ A;  4AYB A;  5L3F A;  2R7V A;  1IN4 A;  4MEX F;  1YFH A;  2FEZ A;  4BBS J;  2FXA A;  3GZ5 A;  3N97 A;  3Q3S A;  3CME I;  3K1P A;  3K4C A;  3RJP A;  2DTZ A;  3GZN B;  2CUJ A;  5JVT A;  2M30 A;  3A0H C;  3HUG B;  4JOM A;  4XN3 A;  1T38 A;  4G7O F;  2PBI A;  1KQ9 A;  3JRE A;  1E3O C;  2OQG A;  4XLE A;  4HF1 A;  3WTU C;  1DGR M;  1X3U A;  3QYB A;  2H1K A;  1R5G A;  3KX2 A;  3CP2 A;  3QPL A;  4OIN F;  3OYH A;  5HNH A;  4G6D A;  1HOM A;  1R6R A;  2VQH A;  4ZYE A;  4YRV A;  1RPW A;  4AVZ A;  2NVY J;  1JT0 A;  2L5Q A;  2E71 A;  5HOD A;  4BXF A;  1J09 A;  2NNY A;  4IRG A;  2KL4 A;  5TRD A;  1JKP C;  4UV9 A;  4KFC A;  1LEB A;  2GM4 A;  4IOC F;  4RDU A;  2DA4 A;  3OYE A;  2CQX A;  4XKW A;  1XB4 A;  1T95 A;  2M45 A;  2Z2S B;  3FIS A;  1G59 A;  4C9Y A;  3ULQ B;  3P9I A;  4B3A A;  5HS8 A;  1W4M A;  1MMA A;  3OYC A;  4U0W A;  4M9Z A;  4E7H A;  3RI4 A;  2DMN A;  5JI6 A;  4UUS B;  3JRI A;  3A4C A;  4KN4 X;  2CU7 A;  4ASN A;  1T39 A;  2Z16 A;  4HNV A;  3HOX J;  1Y8R B;  5DD4 A;  5M5W J;  3K2A A;  4AVP A;  1EH8 A;  4OIQ F;  2D45 A;  5H6R A;  1TP4 A;  3D5S C;  3I58 A;  5J40 A;  2ZSI B;  4Z6Y A;  1Z77 A;  4KNY A;  4L5I A;  1MBG A;  2DFI A;  4Y7N J;  4QWQ A;  2A3S A;  2BY0 A;  2V9P A;  2BXY A;  3HBL A;  3I53 A;  5DDG A;  3FXM A;  2MGQ A;  3QYE A;  4FX4 A;  1S7E A;  3KZY A;  3TO7 A;  3ZPL A;  5J1Y A;  1DDN A;  5FKO A;  4NDL A;  1VQ5 I;  4HPQ A;  1G6N A;  5E1X A;  2QQ8 A;  5IP9 J;  2PJP A;  3GFM A;  3A01 A;  1Y6I A;  1D0X A;  2LMD A;  4UB8 C;  1JHH A;  1VND A;  5ICF A;  2DYS H;  3GVA A;  2E60 A;  1FYM A;  4IQJ A;  1ZG1 A;  4LIU A;  1IXR C;  4G9Y A;  3L2C A;  2WA0 A;  2MW8 A;  3ZQL A;  3KEQ A;  1FWZ A;  3TO6 A;  4M9S A;  3A02 A;  1XMX A;  2ZME C;  4B43 A;  5K5O A;  4MFD A;  1V5G A;  2E1M C;  3G1M A;  2QCO A;  3IWF A;  2JVH A;  5K5R A;  1J7K A;  5J1R A;  5BQT A;  3LSR A;  3TOA A;  2X0L A;  4DQ2 A;  2DJN A;  3ZRG A;  2G7H A;  2HOS A;  3H9G A;  1X19 A;  3CZ6 A;  4YIF A;  2ID3 A;  2WAE A;  2GWR A;  1HW5 A;  2NS7 A;  1XMA A;  4X1E A;  5FFX A;  1AKH A;  3PUB A;  2WAF A;  4IF4 A;  1YJW I;  3FWE A;  2H6C A;  3HRU A;  4JP0 A;  3S8P A;  5LBQ A;  1IW7 F;  1IN5 A;  4TV7 A;  2DK8 A;  4BXX J;  2H8R A;  4EJT A;  4NBQ A;  2H09 A;  3FXQ A;  3V8L A;  1Z9C A;  2ESN A;  4PGG A;  5JHU A;  3QAH A;  4NNJ A;  2LY2 A;  4XLH A;  3KET A;  3OR2 C;  3I59 A;  5HDN A;  4IHS A;  3HRT A;  2FSW A;  1YRN B;  1P4X A;  2HNH A;  4HA8 A;  4NC8 A;  4XR6 A;  3AL0 B;  4NC6 A;  3FX3 A;  5HOO A;  3J80 K;  2GQQ A;  1ZGW A;  1X1D A;  3ISP A;  2L2O A;  3C2G A;  4BAC A;  1R49 A;  1SMY F;  1BJA A;  1HDP A;  2AXL A;  3KYC B;  4IJA A;  1I3A A;  1N75 A;  3ZMV A;  3B6A A;  3H0G J;  2EJR A;  1O3R A;  1RC9 A;  5E1Z B;  3SZT A;  2E35 A;  3LAP A;  1ENH A;  2QBY A;  5BPI A;  2CV0 A;  1YJ9 I;  3PL8 A;  5HS7 A;  5E3N A;  2M87 A;  4HV5 A;  3MKZ A;  3WOD F;  2R7W A;  2H27 A;  3RQI A;  2Y48 A;  3FXU A;  5FKL A;  4P1W A;  4DOZ A;  1ZKG A;  2WV0 A;  2HYF A;  4A93 J;  1XTA A;  2EA4 A;  3HB9 A;  1WJF A;  2ISZ A;  2NS0 A;  2FNP A;  4H4K C;  4S0H B;  4I01 A; 
#chains in the Genus database with same CATH homology
 2IW5 A;  3NEU A;  2DT5 A;  3HSF A;  4LG0 A;  2IA2 A;  5CVJ A;  3WU0 A;  3GFI A;  2Z33 A;  3JSO A;  3WE3 A;  4A5N A;  4M72 A;  1J59 A;  4LD5 A;  5H20 A;  1K79 A;  1BI2 A;  4YII A;  1BOA A;  4I0A A;  4ENM A;  1L0O C;  4LK1 F;  3GYH X;  3FMS A;  3CDH A;  3ZMZ A;  2P8T A;  4KA4 A;  1QGP A;  2UXN A;  3QP5 A;  4BHB A;  4I02 A;  1KU2 A;  2HQR A;  3RIR A;  3C1D A;  1SFX A;  2IVM A;  4MNU A;  2PG4 A;  2PI0 A;  4HZF A;  5JR3 A;  1VTN C;  3V7R A;  5D4S A;  1I6X A;  2NYX A;  1ZG3 A;  3F8M A;  3DKW A;  3OOP A;  1IN8 A;  5ERI A;  3PQK A;  4B09 A;  2A5Y B;  4BNC A;  1U5T A;  5BPD A;  1BIA A;  2WWY A;  3LQR A;  1R36 A;  4BYY A;  1Z6T A;  4AWX B;  3HRM A;  4L18 B;  2Z3Y A;  2XAF A;  4R8H A;  4N0B A;  2DW4 A;  2QWW A;  5L3D A;  5FLX Z;  1TLH B;  4FHT A;  1AOY A;  4L9T A;  4UVB A;  4WXD A;  3E6D A;  5HDG A;  3Q5F A;  2K4J A;  3ECO A;  3DFG A;  1J9I A;  4I2O A;  2NNN A;  1MD0 A;  2XHK A;  2M5W A;  3KP6 A;  2K27 A;  3CUQ C;  3G3Z A;  4D0P A;  1F9N A;  1WRJ A;  1Q1H A;  3J81 Z;  3WTZ A;  2LSO A;  3ZMT A;  1YW8 A;  1QZY A;  1YQA A;  2W84 A;  2VON A;  2OQR A;  2MLK A;  1HBX G;  4M73 A;  2EK5 A;  3QU6 A;  4Q4Z F;  2FBK A;  1I5Z A;  3QPH A;  4KMU X;  4ZH4 F;  1GVJ A;  1YG2 A;  1T98 A;  4CIC A;  5E20 A;  1UHM A;  3LFK A;  2A69 F;  4K2E A;  4F7Z A;  2LF8 A;  1FSE A;  4P96 A;  1KYZ A;  1PP8 F;  4HBL A;  4BHC A;  3HTS B;  4IXA A;  4P9U A;  4KYW A;  1J75 A;  4WWC A;  4RB3 C;  3O2P E;  3GUD A;  2KJB A;  2JPC A;  4RS8 A;  2P5L C;  3R0J A;  1Z05 A;  3F21 A;  2DQR A;  1RIO H;  4LB6 B;  3TO9 A;  3ELK A;  1LNW A;  4R1H A;  3U9G A;  1K78 A;  5DCM A;  3RPU A;  4ZZD A;  1YS6 A;  1E17 A;  4A6E A;  1K6O A;  1O7F A;  1ZH5 A;  1LDJ A;  3GLX A;  1HW1 A;  2ESH A;  2G9W A;  4HQM A;  3P7N A;  1R58 A;  4GYI A;  1U3E M;  3IC7 A;  3K2Z A;  5DUI A;  3FF5 A;  2GXB A;  1KA8 A;  2K02 A;  2IRF G;  3TDU C;  4L0Z B;  1DPR A;  3CO6 C;  2CYY A;  3KP4 A;  2EFQ A;  3ERE D;  3K1N A;  3KFW X;  3EYY A;  4HAM A;  4KUM A;  1NHA A;  1GXQ A;  1ON2 A;  1Z91 A;  4HOB A;  2FBI A;  1RUN A;  3GX4 X;  3BOQ A;  2MLG A;  4XSX F;  1SD4 A;  1EH6 A;  2PMH A;  4IPA A;  1P2F A;  5HLH A;  1KU9 A;  2XIG A;  5KK1 A;  3VFZ A;  3VOE A;  3IRR A;  2YU3 A;  5LEJ A;  4Y13 A;  2DO7 A;  4JBA A;  1BC7 C;  3S2W A;  1P4A A;  3BY6 A;  3V4G A;  2JRT A;  3R6S A;  1SD7 A;  1YS7 A;  3GZ6 A;  4L0Y B;  1XD7 A;  2ZJ2 A;  1S29 A;  2DI3 A;  2K86 A;  2UZK A;  2BBY A;  5AIQ A;  4CYD A;  2VT2 A;  4HF0 A;  3R61 A;  2F5C A;  5ICG A;  2O6G E;  4PDK A;  2MC3 A;  1YW9 A;  5FD5 A;  3I71 A;  3K0L A;  3BPV A;  5LRR A;  4MTD A;  4RAY A;  3NRV A;  1U78 A;  4M6X A;  3DQV C;  1HKQ A;  4Q5S F;  3F22 A;  1YLF A;  2A07 F;  2CWE A;  4EMS A;  3JSP A;  1LVA A;  1FBQ A;  4HF2 A;  3BJO A;  4WXH A;  3TKY A;  1GXP A;  3L09 A;  1MJA A;  5CVI A;  4UVA A;  4XSZ F;  4ETS A;  4YFN F;  1I27 A;  2L01 A;  2XAS A;  5ILV A;  3KE2 A;  4IRH A;  1T0F A;  3REO A;  2QLZ A;  5J8F A;  2HOE A;  3HOT A;  4WK8 F;  4HX8 A;  1QPM A;  4EJW A;  2STT A;  2UWM A;  5IT9 Z;  4KIG A;  3E6M A;  1ULY A;  3HIF A;  2FRH A;  2L4A A;  3KP2 A;  2M8E A;  3JAM K;  2W85 A;  1OYW A;  2VN2 A;  2RKH A;  5BMZ A;  2ZCW A;  4RB1 A;  1Z7U A;  4N9H A;  4ENN A;  1FBS A;  1GHC A;  2Q0O A;  3QU3 A;  2DLL A;  3NQO A;  3RYP A;  1R22 A;  2XRO A;  1OYI A;  3RKX A;  4AD9 A;  1XGM A;  5D8L B;  4ZZL A;  1OKR A;  2QQB A;  2QYO A;  1IXC A;  1KYW A;  3RKW A;  1ZAO A;  3AAF A;  2IPQ X;  3N4M A;  1G3S A;  5FB2 A;  3JTG A;  4BH9 A;  3F3X A;  3LQQ A;  1OPC A;  2D1V A;  2L54 A;  2W25 A;  4MEY F;  4HX4 A;  4IHT A;  3M8F A;  3J81 K;  1MDM A;  3GXO A;  1MKM A;  5E17 F;  1BM9 A;  4YG2 F;  3D0S A;  5HDK A;  1LEA A;  2E1N A;  1KGS A;  4HYE A;  1IXS B;  2Z99 A;  5FD6 A;  3KP5 A;  1HKT A;  4EJU A;  3DXJ F;  1RNL A;  4WXC A;  3CLO A;  5D6E A;  4HQE A;  1I1G A;  2QM3 A;  1SAX A;  1S8N A;  4OIP F;  1ZLJ A;  4UUV A;  2ZNZ A;  3T8T A;  2YR2 A;  2Z5U A;  4N9I A;  1J5Y A;  3WU1 B;  1U8R A;  4RB0 A;  4ZYH A;  1TW2 A;  4ENK A;  3RYR A;  1UFM A;  4S04 A;  3DV8 A;  1PDN C;  2QEN A;  4CGZ A;  2FBH A;  3BJA A;  1IAW A;  1MJB A;  1FSH A;  3ECH A;  4OIR F;  1EV7 A;  4ON0 A;  3OV8 A;  3WTS C;  2OA4 A;  3DPT A;  2NAZ A;  4L5J A;  2WC2 A;  2BYV E;  1LB2 A;  2ZKZ A;  3BRO A;  1I1S A;  1YYV A;  1KU3 A;  2M1B A;  1XSD A;  1S6L A;  2EV0 A;  4P9F A;  3IL2 A;  1TNS A;  1ZRF A;  1W7P B;  2P7V B;  1R23 A;  4EM1 A;  1U5T C;  2DPU A;  4OIO F;  2BE5 F;  2P6S A;  3CO7 C;  3EYI A;  1QNT A;  5LGU A;  1IF1 A;  2V6C A;  3F8F A;  1BBY A;  1QZZ A;  3HSR A;  1LJ9 A;  2COM A;  1FPQ A;  2A6E F;  4HLY A;  4CDG A;  3KZZ A;  2PLY A;  4LMY A;  1HQC A;  3K1M A;  2E7W A;  2VT3 A;  5LHI A;  1BI0 A;  3I59 B;  3FMR A;  2KJC A;  4GCV A;  2RC4 A;  4U88 A;  4U0Y A;  1XSX A;  3KP3 A;  4EM2 A;  3JAM Z;  3EET A;  5LHG A;  1ZRE A;  4JK1 X;  4XBF A;  3TGN A;  3COA C;  1B9N A;  5A2Q K;  2O0Y A;  4S05 A;  3E5Q A;  3FM3 A;  4Q48 A;  1H9G A;  1P4W A;  1EH7 A;  5ILS A;  1SD6 A;  1ZGJ A;  5E18 F;  3MZH A;  1XMK A;  2FA5 A;  2XAH A;  2EFO A;  1G3Y A;  1KQ0 A;  1FYL A;  2DQL A;  4LLL A;  1JHF A;  4RGS A;  3H3U A;  4R79 A;  2BGC A;  1HW2 A;  2EWN A;  1CGP A;  4U7B A;  5AIP A;  2FU4 A;  3CTA A;  1FP2 A;  3R4K A;  5H6Q A;  4LLN A;  4EM0 B;  5F6F A;  3LA3 A;  5DEQ A;  3O3K A;  2ZXJ A;  3E6C C;  5J8C A;  2IA1 A;  4CZZ A;  5F1R A;  2P5K A;  1TBX A;  4A5M A;  2MH2 A;  1UST A;  2MA3 A;  3BZ6 A;  2HTS A;  1SFU A;  3K9T A;  1IZ1 A;  1LDD A;  5DUK A;  5FGM A;  1R1T A;  3C18 A;  2Z9O A;  2GIV A;  1ZAR A;  4HW0 A;  1YW7 A;  5TJJ A;  5LGT A;  4XLN F;  2L3D A;  6PAX A;  2IA0 A;  5CLS A;  4PGH A;  4G8X A;  2P7C B;  1FLI A;  1L3L A;  3EQL F;  5ICC A;  5DD8 A;  3DPL C;  2IT0 A;  3IKV A;  1TTY A;  4MHG A;  2Y0M A;  5LGN A;  2G7U A;  5HS9 A;  4MQV A;  1FY7 A;  3ROU A;  2P5V A;  2GA2 A;  2YPR A;  2LNB A;  2OAZ A;  2HKX A;  3KP7 A;  4HDU A;  5HLG A;  1MJ9 A;  3ZMD A;  4I98 B;  4EQQ A;  3TOB A;  2KIF A;  3MEX A;  1KQ8 A;  5ICE A;  3F72 A;  5HVQ C;  4GO1 A;  3CUQ A;  3SHF A;  3DF8 A;  2CW0 F;  1BI1 A;  3ABT A;  4RGR A;  4AIH A;  4NB5 A;  5D5U B;  2IJL A;  2NRA C;  4XRF A;  2Y75 A;  1P92 A;  5D4R A;  1AWC A;  2GXG A;  4EV0 A;  5CVR A;  3SZP A;  1Z6R A;  1RZ4 A;  1TW3 A;  2XUB A;  2CG4 A;  2C6Y A;  2DBB A;  2MBF A;  2HWV A;  3WTY C;  2ISY A;  3F8C A;  1XCV A;  1K78 B;  4FT8 A;  1O57 A;  2H6B A;  1XCB A;  3ZMU A;  5A2Q Z;  4GGG A;  5ED4 A;  4PCQ A;  3LA2 A;  4AIJ A;  1HST A;  2FE3 A;  5LRS A;  2R7F A;  2D1H A;  1CF7 B;  1JGS A;  2VBW A;  2L4M A;  3V7S A;  3WTX C;  1BIB A;  2XAJ A;  3B02 A;  3TDZ C;  2EB7 A;  2HR3 A;  4KIB A;  4HDV A;  5DCF A;  1MZB A;  1JE8 A;  4EJV A;  4M9X A;  4QLC U;  2XGX A;  2CO5 A;  4G7Z F;  4M71 A;  3E5U A;  5K1Y A;  4LK0 F;  5AON A;  5CJ9 A;  3O6B B;  4UVC A;  4YFX F;  1XGS A;  1WI9 A;  1IRG A;  4PZJ A;  3MQ0 A;  2YX7 A;  2OZ6 A;  2O8X A;  5EEG A;  4M6Y A;  2HFH A;  3BWG A;  3F8N A;  1FP1 D;  2JTV A;  3I4P A;  2E7X A;  2HZT A;  4OMZ A;  5D5W B;  1Y0U A;  2DAO A;  3WE2 A;  2EA2 A;  4BAY A;  3JTH A;  2XKO A;  2HGC A;  2QQ9 A;  1ZHF A;  3R0A A;  1B59 A;  4GXO A;  2A6H F;  2FNA A;  3U1D A;  2W57 A;  2VXZ A;  3ZN1 A;  4A0X A;  2V1U A;  1MGT A;  5CYV A;  3CUO A;  2FF4 A;  2PN6 A;  4HLX A;  4I0B A;  4ENJ A;  3PFI A;  4EVI A;  2R3S A;  4M74 A;  3L9F A;  2GAU A;  1TQM A;  2V9V A;  1KU7 A;  4EGY A;  1LQ1 A;  1ZLK A;  1B9M A;  4Y17 A;  3GWZ A;  4JQF A;  1XDS A;  2XAQ A;  4A12 A;  1XN7 A;  4AIK A;  1Z1D A;  2PMU A;  5D5X B;  2QZ8 A;  4A2U A;  3T8R A;  3GO5 A;  2ZBK A;  1SMT A;  2VOO A;  3VEP A;  1FT9 A;  1BN5 A;  2R7D A;  4XLP F;  1WSU A;  1ZRD A;  2PQ8 A;  3C7J A;  4I09 A;  4LB5 A;  1PUE E;  4U7D A;  2K4B A;  4IVN A;  3I54 A;  1FBU A;  2H94 A;  4G94 A;  4B8X A;  5L3C A;  3D5L A;  1RUO A;  4P5O A;  3E5X A;  1R1U A;  1FOK A;  3P9C A;  2A61 A;  2OZU A;  3GF2 A;  3HUG A;  3JW4 A;  4Q47 A;  3F23 A;  3CJN A;  3DEU A;  3K69 A;  4KT5 C;  2RDP A;  2K7L A;  1YO5 C;  2LF7 A;  4CO8 A;  5E1W A;  3I64 A;  3BP8 A;  2OU2 A;  3GFJ A;  1T6S A;  5FO5 A;  3WTW C;  5D5V B;  1UHW A;  2V1D A;  1FZP B;  1BI3 A;  2OD5 A;  4BQA A;  4MTE A;  4A0Z A;  3FM5 A;  2DU9 A;  5DCM B;  3T1B A;  4OU0 A;  3J80 Z;  5BS6 A;  1E2X A;  5CVV A;  1S3J A;  1OYY A;  2ADU A;  1K7A A;  3GW2 A;  2JT1 A;  4RAZ A;  1W7P D;  1DPU A;  5IT9 K;  5IT3 A;  3ABU A;  2TDX A;  1MDM B;  5DYM A;  1O3S A;  4CHU A;  2PEX A;  1G4D A;  1V4R A;  2B0L A;  3ZN0 A;  3SXY A;  2RVC A;  2W24 A;  3EDP A;  3FXR A;  1SFE A;  2BV6 A;  2E1C A;  5L3E A;  4HX7 A;  2ZME A;  2QQA A;  3MFK A;  1R7J A;  1FYK A;  4OMY A;  4RB2 C;  5D6F A;  2CFX A;  2X4H A;  1HXD A;  5KVR A;  1ON1 A;  3HRS A;  1J0R A;  3HSE A;  2QVO A;  4LGW A;  1O3Q A;  3KLO A;  4KN7 X;  3HYI A;  4RGX A;  2V79 A;  1XGN A;  1YIO A;  1UCR A;  1C0W A;  4UXN A;  2CGP A;  4GYG A;  1B4A A;  3ZQ7 A;  1TNT A;  3KEO A;  2HEO A;  2XAG A;  2HQN A;  3MZY A;  3C3W A;  2VBY A;  4LG0 B;  3W6J B;  2VC0 A;  1S7O A;  2VOD A;  3MCZ A;  1OMI A;  2YX4 A;  2KKO A;  3CUQ B;  4NHJ A;  1LDK B;  2F5D A;  3B73 A;  4KDP A;  2KIM A;  3I0T A;  5E8G A;  5LLQ A;  2AS5 F;  2LDU A;  3FMQ A;  1O7L A;  4L9V A;  2ZO4 A;  1H0M A;  3KCC A;  3WGI A;  3V8J A;  1WQ2 A;  2D2W A;  2VBZ A;  4IRI A;  1T2K A;  2FMY A;  5EEH A;  1WWX A;  1QO0 D;  2ZFW A;  3QPT A;  4ZYG A;  2VOP A;  1W5T A;  2XVC A;  2MH9 A;  3KLN A;  2ELH A;  3LWF A;  4E70 A;  2XV4 S;  2ACJ A;  3QP6 A;  1TQI A;  1JXS A;  3ML6 A;  1F5T A;  1O3T A;  3LA7 A;  1W7P A;  2PFB A;  2JPB A;  4ESB A;  3FHZ A;  2JSC A;  4NQW A;  2RNJ A;  4HV6 A;  3M7G A;  3M9A A;  4LFU A;  2EFP A;  1V3F A;  2O3F A;  1R1V A;  3BJ6 A;  1SD5 A;  3PQJ A;  4LJZ F;  2F5F A;  4OOI A;  1ZRC A;  4EJO A;  3M8E A;  1D3Y A;  4LLG F;  4ESJ A;  2KRF A;  2J5P A;  4YFK F;  1STZ A;  1W5S A;  1XSV A;  3RKY A;  2HDC A;  4BHP A;  5K5Q A;  3F6O A;  1ODD A;  2DTR A;  3HHH A;  2VC1 A;  4Y15 A;  2VE9 A;  1WKM A;  3HOS A;  1G3T A;  4MQ9 F;  1TQP A;  1XGO A;  1R5H A;  2UXX A;  1U2W A;  3G73 A;  3SQN A;  1R00 A;  2RGV A;  2ZNY A;  4FX0 A;  1D5V A;  3MAJ A;  2MD5 A;  3T5X A;  2HYG D;  1IN7 A;  4A6D A;  2HTJ A;  1DP7 P;  2O03 A;  2Q2E A;  4EGZ A;  2HS5 A;  3IHU A;  1H9T A;  1HSJ A;  3WTV C;  4ZYD A;  2DPD A;  4G6Q A;  1YTY A;  3DP7 A;  3E97 A;  3M1E A;  3RDI A;  3WGH A;  4O5V A;  3FZV A;  3U2R A;  4L9J A;  3VOD A;  2O61 A;  2RQP A;  2KIU A;  1F1Z A;  4CXF A;  4KMF A;  3V8K A;  3QRF F;  2P4W A;  3WTT C;  2XRN A;  1XDU A;  1ZN2 A;  4H0E A;  4Z2Y A;  2YSR A;  1F4K A;  3ZMS A;  1U6G A;  2LKP A;  1B6A A;  3WG9 A;  4O6J A;  3P9K A;  2Q8K A;  5DV5 A;  4ESF A;  5D8K B;  1RI7 A;  4BXU A;  3F6V A;  4KIF A;  3J7A O;  1DUX C;  4UV8 A;  1IRF A;  4KIC A;  3EUH A;  3L00 A;  5E8I A;  3BDD A;  2GZW A;  2FQ3 A;  4UNO A;  4WF2 A;  2IP2 A;  2HKO A;  2ZME B;  2A68 F;  2EV5 A;  3T0Y A;  3VB2 A;  1UB9 A;  1FC3 A;  1BC8 C;  1ZGA A;  1OR7 A;  1J2X A;  4UHT A;  3MWM A;  3GFL A;  4RGU A;  2XKP A;  3HTU A;  1IN6 A;  3BPX A;  2FML A;  3Q9V A;  2QBY B;  1FNN A;  1ONV A;  3E3V A;  2P6T A;  2F2E A;  4I7H A;  2RN7 A;  2VBX A;  3HHG A;  3Q9S A;  2EV6 A;  1QQI A;  4WX9 A;  5LEK A;  1QBJ A;  2BEO A;  4L9N A;  5LHH A;  2V1X A;  3LAJ A;  2FOK A;  5L3B A;  2OBP A;  3TQN A;  2STW A;  5BOX A;  3GEZ A;  5FLX K;  2EFN A;  3SFZ A;  3RPQ A;  4WCG A;  2VE8 A;  5JFR A;  4MGR A;  1ZG5 A;  5ILU A;  2WTE A;  2F5E A;  3RTR A;  3IRQ A;  1REP C;  4G7H F;  1USS A;  2CSO A;  1A04 A;  1IUY A;  3V7C A;  4O3M A;  3H3Z A;  2ETH A;  3W6K B;  1P6R A;  1HKS A;  1G3W A;  1S7A A;  2CQK A;  3ZP5 A;  3R60 A;  3I5U A;  3F8B A;  2JZY A;  3QOP A;  4A0Y A;  2DK5 A;  2QUF A;  2L02 A;  2RV8 A;  2EFW A;  2GA1 A;  5J6X A;  3WGG A;  1FX7 A;  4P55 A;  1U5T B;  3IWZ A;  1B1B A;  3H92 A;  3L7W A;  5FFZ A;  1D8K A;  4DNC A;  5L3G A;  3IKT A;  1CF7 A;  3E6B A;  1D8J A;  5HLI A;  3LST A;  4U0V A;  1PP7 U;  5CVU A;  5F64 A;  1ZYR F;  2J5O A;  5L3F A;  1IN4 A;  4MEX F;  1YFH A;  2FEZ A;  2FXA A;  3GZ5 A;  3N97 A;  3K1P A;  3RJP A;  5JVT A;  2M30 A;  1T38 A;  4G7O F;  2PBI A;  1KQ9 A;  2OQG A;  4HF1 A;  3WTU C;  1X3U A;  1R5G A;  4OIN F;  4G6D A;  4ZYE A;  2NNY A;  4IRG A;  5TRD A;  4KFC A;  4UV9 A;  1LEB A;  1XB4 A;  2M45 A;  3ULQ B;  3P9I A;  5HS8 A;  1W4M A;  4U0W A;  4M9Z A;  3RI4 A;  5JI6 A;  4KN4 X;  4ASN A;  1T39 A;  5DD4 A;  4AVP A;  1EH8 A;  4OIQ F;  2D45 A;  5H6R A;  3I58 A;  4KNY A;  4L5I A;  2DFI A;  4QWQ A;  2A3S A;  3I53 A;  5DDG A;  4FX4 A;  3KZY A;  3TO7 A;  3ZPL A;  1DDN A;  1G6N A;  5E1X A;  2PJP A;  3GFM A;  1JHH A;  5ICF A;  3GVA A;  1FYM A;  1ZG1 A;  1IXR C;  4G9Y A;  3L2C A;  3KEQ A;  1FWZ A;  3TO6 A;  4M9S A;  5K5O A;  3IWF A;  5K5R A;  1J7K A;  5BQT A;  3TOA A;  2X0L A;  4DQ2 A;  2G7H A;  4YIF A;  2GWR A;  1HW5 A;  1XMA A;  5FFX A;  4IF4 A;  3FWE A;  2H6C A;  3HRU A;  5LBQ A;  1IW7 F;  1IN5 A;  4TV7 A;  2DK8 A;  4EJT A;  2H09 A;  3FXQ A;  3V8L A;  1Z9C A;  2ESN A;  4PGG A;  5JHU A;  3QAH A;  3KET A;  3I59 A;  5HDN A;  4IHS A;  3HRT A;  2FSW A;  1P4X A;  4HA8 A;  3FX3 A;  5HOO A;  3J80 K;  2GQQ A;  3ISP A;  1SMY F;  1BJA A;  4IJA A;  2AXL A;  3ZMV A;  1O3R A;  2EJR A;  5E1Z B;  3SZT A;  3LAP A;  2QBY A;  5BPI A;  5HS7 A;  2M87 A;  4HV5 A;  3WOD F;  2H27 A;  2Y48 A;  3FXU A;  2WV0 A;  2HYF A;  2EA4 A;  2ISZ A;  2NS0 A;  2FNP A;  4I01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...