2CO5A

F93 from stiv, a winged-helix dna-binding protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
KYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVLFLTEKGMKEFEELHEFFKKIVCHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/winged helix
molecule keywords VIRAL PROTEIN F93
publication title A Winged-Helix Protein from Sulfolobus Turreted Icosahedral Virus Points Toward Stabilizing Disulfide Bonds in the Intracellular Proteins of a Hyperthermophilic Virus.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2co5A00
3WE3A 4EMSA 2E7XA 3V7CA 4JQFA 3ABTA 1RZ4A 4E70A 1B9NA 4EV0A 1JXSA 1MJ9A 2L3DA 1V3FA 1R36A 2O3FA 4MQVA 2PN6A 1KYZA 4MHGA 1IAWA 1O3SA 4WXHA 4I7HA 5DD4A 2BE5F 3C18A 4QLCU 5DCMB 1ZARA 2K4JA 2EFQA 4IVNA 4OOIA 5DCMA 2EB7A 2EV5A 5F1RA 4O3MA 5L3EA 2FNAA 1G6NA 3E5QA 3SHFA 4OU0A 3HRTA 2ZNYA 2Q2EA 1YS6A 2ACJA 3R4KA 1MGTA 1I27A 4UNOA 5DD8A 2PG4A 1I6XA 5H20A 5L3FA 1XD7A 2R3SA 1QGPA 2XAQA 5FFXA 3HUGA 2XAFA 2FMLA 4G6QA 3M8EA 4HX8A 3ZMDA 1XGNA 1QNTA 2LF8A 4M74A 4AIKA 5E1ZB 4BQAA 2OA4A 3ZMTA 2MBFA 2JSCA 4G8XA 1ZGJA 4B8XA 3LQQA 4RB2C 1XDUA 2P5KA 1YTYA 3ROUA 3CDHA 1STZA 4EJTA 5JFRA 2HDCA 3HSFA 4GYIA 1B4AA 1O3TA 5ILUA 1L3LA 3HHGA 2HTJA 2XKOA 3VB2A 2B0LA 1J75A 3ZN1A 5CJ9A 3EUHA 3RKYA 2PI0A 3F6OA 1PDNC 2GA2A 5LBQA 4UHTA 3QRFF 4Z2YA 5LRSA 2W25A 4R8HA 5DDGA 1W5SA 4KA4A 2X0LA 2MLGA 1ZAOA 2M30A 3KP7A 2DFIA 3QOPA 2VBXA 2EK5A 3MEXA 2KKOA 2ESHA 5KK1A 2EJRA 3R0JA 4LLNA 3ML6A 3I54A 3BPXA 2QQAA 1RI7A 2PEXA 4UV9A 2LSOA 1YIOA 2X4HA 3C3WA 5LLQA 2DTRA 2ESNA 2L4AA 3GFIA 4KMUX 2ELHA 3ISPA 2XRNA 4I02A 1DP7P 1FYMA 5L3DA 4N9HA 1CF7B 1WRJA 3H3UA 1CF7A 4PGHA 3K0LA 5HDGA 4GGGA 1WQ2A 2DW4A 3E6MA 2BGCA 3HRMA 4A0YA 1PUEE 5F64A 2OU2A 2XVCA 3VODA 4LK1F 3HRUA 4EJVA 2ZXJA 2MD5A 3CUOA 2CYYA 4KFCA 1TQPA 5HLIA 5TJJA 4RAZA 4LG0A 1IRGA 3LAPA 2BEOA 3BJOA 4IF4A 4KYWA 4S04A 4LLGF 1RUNA 2Z3YA 1EH6A 3QP6A 3ECHA 1BI2A 5DUIA 1I1SA 1BI1A 3M7GA 1J9IA 3F3XA 4HDVA 2VC1A 3BJAA 5FLXZ 2FBKA 2OZUA 1KU3A 3ZMZA 3CO7C 1YW7A 1S6LA 3REOA 1W7PB 2A5YB 4HV6A 1W7PA 2FE3A 5D8KB 2GXGA 1ODDA 4WXDA 1SFEA 1FYKA 2JT1A 1S7AA 4ENNA 1U8RA 2FF4A 3ZQ7A 5IT9Z 3EYYA 4XLNF 1UHMA 4P96A 2J5OA 5FD5A 1HW1A 1R7JA 3FM3A 4KN7X 3CUQC 1K79A 5L3GA 3IHUA 2L4MA 1F9NA 5F6FA 4I09A 1LEAA 1R58A 3OOPA 3HSEA 3C1DA 4WF2A 1SFUA 1P92A 5CVJA 4BAYA 2FA5A 2A07F 4JBAA 3NQOA 3SZTA 3Q5FA 2W24A 1P4WA 3U2RA 3IRQA 4CHUA 4MNUA 1MKMA 2G7UA 1O3QA 2EFNA 3TOAA 3GF2A 1FT9A 3LA2A 1FBUA 1SD4A 1JHFA 2FRHA 1ULYA 4H0EA 5LHGA 2VE9A 3HTUA 5AIQA 2HTSA 3CTAA 1ON1A 4A2UA 1Y0UA 5LEKA 3F6VA 4YIIA 1EV7A 4XBFA 2D2WA 4ASNA 3ZN0A 3KP3A 4CDGA 1W5TA 3MCZA 2EA4A 4MQ9F 4KUMA 4LB5A 2IJLA 3FMQA 2VE8A 1R23A 2A68F 1F5TA 2YSRA 3DV8A 1ZYRF 1ZLKA 3GFMA 3KEOA 4Q48A 1EH7A 2DQLA 4M9ZA 4PGGA 2A61A 1SD6A 1WWXA 3WGIA 4G9YA 3O3KA 1B59A 2K7LA 3JSPA 1LVAA 2K27A 1TW3A 2XAGA 2ZKZA 3HIFA 3E6DA 3U9GA 2FEZA 2DPDA 3AAFA 3F23A 3KZZA 3I71A 2V1UA 3BZ6A 3KZYA 2HWVA 4EGZA 2P8TA 2XGXA 2QENA 4L18B 1LDDA 3QAHA 4ENKA 1XDSA 2NYXA 1FBSA 3L09A 3CLOA 4HLYA 4RB1A 1HQCA 3FF5A 4M73A 1AWCA 2GWRA 1YQAA 2K02A 2F5CA 2D45A 3DPTA 1YO5C 1FYLA 4KIBA 3TDZC 4L9TA 3IC7A 2EFWA 4KN4X 1OPCA 1KQ9A 3MQ0A 2CO5A 2EV0A 2G7HA 5HS9A 2NAZA 1OYIA 1G3YA 1U5TB 3KEQA 1KU9A 3DQVC 2OQRA 1U5TA 5HS8A 3P9CA 2DO7A 3CO6C 4DQ2A 3IL2A 4XSZF 1IRFA 1DDNA 3WG9A 3V8KA 4Y17A 5HDKA 2RKHA 3GEZA 3TO7A 3JTGA 3B73A 5BPDA 1G3TA 3F8CA 2WV0A 3WTWC 1KU2A 2DAOA 1XSXA 2HGCA 2Q8KA 3I59B 3BWGA 2DPUA 3KCCA 3I59A 3L00A 4F7ZA 3T8TA 1IXSB 5BPIA 4UUVA 4N9IA 2VONA 3WU1B 2QWWA 3VEPA 4B09A 3WTYC 4A0XA 5ED4A 5FGMA 2HYFA 3J80Z 5K5OA 3N97A 2MA3A 3SZPA 3M8FA 1PP7U 3GZ5A 1B1BA 5ILVA 1R00A 2HOEA 3ZPLA 2L01A 2PMHA 4OMZA 1BOAA 5E1WA 2J5PA 4CZZA 2XV4S 2RNJA 3LA3A 3SFZA 4IPAA 1TNTA 1QQIA 2P4WA 5IT3A 4KDPA 3I64A 1TQMA 4GCVA 4BH9A 4IHSA 5L3BA 5FLXK 4FT8A 2CG4A 4MTDA 3D0SA 1HXDA 1KU7A 2VODA 2JRTA 2HR3A 3RTRA 4G94A 3K1PA 2XROA 2DU9A 4ZYHA 5J6XA 2OAZA 1UFMA 1ONVA 3IKTA 1IUYA 4WXCA 3KLNA 3T1BA 4L9JA 3FXQA 4WWCA 3P7NA 4PCQA 2QLZA 5BQTA 1IN8A 1BIAA 4IRIA 4M6YA 3S2WA 3KP2A 3GO5A 1LB2A 1PP8F 5E17F 1MD0A 4LGWA 5IT9K 4P9FA 3G73A 3F72A 1EH8A 4OMYA 2PQ8A 3F8BA 2HKXA 5LGNA 1XGMA 1Z9CA 5FO5A 1TBXA 2QZ8A 2A6EF 1XCVA 5ICCA 2OD5A 4KIFA 2NNYA 2Z5UA 5LRRA 1T6SA 2NRAC 2HYGD 1HSTA 3DF8A 1QZZA 3E3VA 3WE2A 1T39A 2VBYA 1DPRA 1U78A 2DBBA 5D4SA 1P6RA 4OINF 3E5UA 3PQKA 4LMYA 1W7PD 5E20A 3WGGA 3B02A 5D5VB 3M9AA 1TLHB 1TNSA 1BC8C 4HX4A 1D8KA 4L9NA 1Q1HA 1IZ1A 3JTHA 1YS7A 1Z1DA 2GIVA 2H6BA 2JPCA 1FNNA 4IJAA 5HVQC 2Y0MA 2XHKA 5JHUA 1K7AA 3KP5A 2ZNZA 3GW2A 1XGSA 1WKMA 2ISYA 1IW7F 2Z9OA 2HS5A 3EDPA 4U88A 3O2PE 3RJPA 3F8MA 3SQNA 5ILSA 4G7OF 2F2EA 3WGHA 1XCBA 3V8LA 4RAYA 3ULQB 4A5MA 5J8CA 3C7JA 3E97A 3LFKA 4U7BA 3GFJA 3HOTA 2XKPA 2E7WA 2P6TA 4I98B 3VOEA 2ZO4A 4LG0B 1LQ1A 1OYWA 3HHHA 2W84A 4HF0A 3TO9A 1J5YA 2UZKA 4HAMA 3FXRA 3GFLA 2LF7A 3P9IA 1R5GA 3F8NA 1P4XA 4R1HA 5E18F 5J8FA 2M87A 4IRHA 3I0TA 4EM0B 2VC0A 3GLXA 2IA0A 1REPC 3F21A 3KETA 4UVBA 4Q5SF 5E8GA 4L0ZB 2Y75A 5HDNA 5D5UB 4O6JA 4U7DA 1GHCA 2GZWA 1ZRFA 4A12A 3TO6A 3VFZA 4KT5C 4OIQF 2AS5F 5H6QA 2CQKA 2MH2A 3RYPA 1HW2A 5BOXA 3K2ZA 3BDDA 2KIFA 5K5QA 2KRFA 5CLSA 2A6HF 1H9TA 2V1XA 3LAJA 1KQ8A 1NHAA 1RNLA 3E5XA 4BHCA 1Z05A 4I0BA 3W6JB 2O03A 3SXYA 1R1TA 3RIRA 1R1VA 2RC4A 2ZFWA 4EJUA 4M72A 4MEXF 2K4BA 3ZP5A 1XSVA 4A6EA 2Z99A 2FOKA 4AIHA 1XMAA 1O7FA 3BROA 4RB3C 4GXOA 1HSJA 2IA2A 2JTVA 4HX7A 2VBZA 1O3RA 1S3JA 2DK5A 2KJCA 1BI3A 1R5HA 3GVAA 1S7OA 4GO1A 3LSTA 5DCFA 3F22A 3FWEA 2PBIA 4P9UA 2XIGA 1O57A 1U6GA 4S05A 1IN5A 1B9MA 3HRSA 1YYVA 2EFOA 1LJ9A 1ZH5A 3L7WA 2RGVA 2COMA 5FD6A 1YLFA 3Q9SA 2XASA 1FSEA 1TQIA 1S29A 4HOBA 2VN2A 3K1NA 3T0YA 3OV8A 3QPTA 1R1UA 1ZG3A 4KNYA 5LGUA 4YFKF 1F4KA 3J80K 2CFXA 2RV8A 4EQQA 1JE8A 4XSXF 3FMSA 4O5VA 4EM2A 3JSOA 1SD7A 3MWMA 1FSHA 1HW5A 3R0AA 2IVMA 3CUQA 4Q47A 2KIUA 4EJOA 4KIGA 1BI0A 4U0WA 1U5TC 1E17A 2AXLA 1HKTA 4K2EA 4DNCA 4AD9A 4HYEA 2FSWA 3QPHA 1G4DA 3N4MA 5K1YA 4U0VA 1P4AA 4HLXA 5D4RA 4UVAA 3WU0A 4P5OA 1J7KA 2GA1A 3HTSB 1YW8A 2H09A 4ENMA 5ERIA 2EWNA 1IXCA 5ICFA 5CVUA 4LD5A 1J59A 3ZMSA 3ELKA 1Z91A 4HBLA 3WODF 3J81Z 1X3UA 5DV5A 1U2WA 3EYIA 4OIPF 1BC7C 2IW5A 4ZZLA 1KA8A 5LGTA 1SFXA 3JAMK 1LNWA 4HQMA 3R6SA 4BXUA 4L0YB 1G3WA 3WTSC 2FQ3A 4RGRA 2DLLA 2BV6A 5D8LB 2O0YA 2HZTA 3GWZA 3BJ6A 1IN7A 2VOPA 2ZJ2A 2HKOA 1J0RA 2H94A 1ZLJA 3W6KB 3ZMUA 1ZRCA 3KLOA 2UWMA 1GVJA 2HEOA 2TDXA 4L9VA 1ZHFA 3E6BA 4OIOF 2IRFG 3GXOA 3BY6A 2L02A 4LLLA 4ZYEA 4A6DA 3LA7A 1ON2A 1KQ0A 1LEBA 4MTEA 4Q4ZF 2FNPA 2RVCA 3KE2A 1HKQA 2V1DA 5LHIA 1WSUA 4N0BA 1ZREA 1JHHA 3K9TA 1T98A 2VT2A 4QWQA 2H27A 2F5FA 1XB4A 2F5DA 5HLHA 3IRRA 5BS6A 2M1BA 1GXQA 1YW9A 2H6CA 1QPMA 4PZJA 3DKWA 1O7LA 2VT3A 4UVCA 5L3CA 4A5NA 1B6AA 4FX4A 1QBJA 2HQNA 3K69A 1SAXA 4CXFA 3FZVA 1HKSA 3Q9VA 1XMKA 3ZMVA 4TV7A 4AVPA 4HF2A 4KICA 4I2OA 1ZG1A 1FC3A 6PAXA 2EA2A 1FZPB 3RDIA 5HLGA 2K86A 4CO8A 1RUOA 5FB2A 3RKWA 1I1GA 4LJZF 1IXRC 2STWA 4MEYF 3BP8A 2FBIA 3COAC 2EV6A 2F5EA 4YFNF 1ZRDA 3KP4A 2Q0OA 1ZG5A 1FLIA 1H9GA 1Z7UA 5JI6A 3MZYA 2MLKA 2XAHA 2FXAA 3H92A 2V79A 3WTVC 2QVOA 1VTNC 2PLYA 1D5VA 2RQPA 4ZH4F 1FBQA 2IA1A 1FP1D 2YR2A 2VXZA 1K78B 2QM3A 3FX3A 2UXNA 1JGSA 4L5JA 1K78A 4HDUA 3L9FA 4I0AA 4HV5A 3O6BB 3H3ZA 3QP5A 2NNNA 3WTUC 1V4RA 2FMYA 3JAMZ 5DEQA 3TGNA 1CGPA 3PFIA 1MDMB 2YU3A 1MDMA 4BHPA 3DEUA 1OKRA 4AIJA 3GX4X 4P55A 5FFZA 1D3YA 3I53A 4LB6B 4FHTA 2QYOA 4I01A 2LNBA 2RDPA 3EETA 3L2CA 4OIRF 1XSDA 1FOKA 2LKPA 3RYRA 2ZMEB 4A0ZA 2FBHA 3DPLC 4D0PA 2ZMEA 4JK1X 4G7HF 2GXBA 1ZGAA 4RGSA 2PFBA 2XUBA 2DK8A 1A04A 1FP2A 3GUDA 4UV8A 4GYGA 2E1NA 5CVRA 3PQJA 4FX0A 1U3EM 3NRVA 3IWZA 1DPUA 1FWZA 2Y48A 3MFKA 2QQBA 4XRFA 3CJNA 2JZYA 1XGOA 2O8XA 4KMFA 3E6CC 4ZYGA 1BM9A 1KGSA 2ISZA 2DQRA 4U0YA 2M5WA 1E2XA 5CVVA 1HBXG 2CWEA 2XAJA 5HOOA 2P7VB 3K1MA 2IT0A 2QBYB 3BOQA 2QBYA 5H6RA 3DP7A 3WTZA 3D5LA 2WC2A 3F8FA 2YPRA 4PDKA 4ESJA 5D6FA 1MJAA 3FMRA 2ZBKA 1WI9A 2CW0F 2GAUA 4G7ZF 2MH9A 4Y15A 2G9WA 2BYVE 2CSOA 1MJBA 2A3SA 1R22A 2IPQX 4IXAA 3TOBA 3GYHX 4AWXB 1UHWA 3M1EA 3QU3A 2JPBA 1D8JA 1LDKB 4Y13A 1T38A 3DXJF 3T8RA 3R61A 2HQRA 1BBYA 5ICGA 4NB5A 1RIOH 4CICA 4ON0A 3J81K 1S8NA 2STTA 3IKVA 1T2KA 5KVRA 2VBWA 5A2QK 4HW0A 3TQNA 3HYIA 1IN6A 1IN4A 4YG2F 1P2FA 4CYDA 2RN7A 5TRDA 3WTXC 2O6GE 4MGRA 2DI3A 2R7DA 2ZCWA 4IHTA 3LQRA 2M8EA 4HQEA 5HS7A 4L5IA 2MC3A 5K5RA 4LK0F 4BNCA 2D1VA 3HOSA 3G3ZA 3V4GA 3NEUA 2UXXA 2WTEA 1MZBA 1BIBA 4XLPF 4RB0A 4YFXF 4HZFA 4G6DA 5DUKA 1BJAA 1W4MA 3TKYA 1TTYA 3U1DA 4ETSA 4ESFA 4IRGA 1L0OC 3I4PA 1I5ZA 4ESBA 4M9XA 1FY7A 1LDJA 1AOYA 3V7SA 4BYYA 5CVIA 2Z33A 4HF1A 1K6OA 3MZHA 3RPUA 1XN7A 3RPQA 2P5VA 3P9KA 1C0WA 5AONA 2W85A 4EM1A 1SD5A 1GXPA 2P5LC 5EEGA 2OBPA 5AIPA 2KIMA 1SMTA 2WWYA 4ENJA 4CGZA 4ZYDA 1QO0D 3HSRA 3RKXA 2QQ9A 3I58A 4RS8A 2YX7A 1USTA 3FM5A 4M6XA 1Z6RA 2C6YA 4UXNA 3V7RA 1IF1A 4ZZDA 3CUQB 5D5WB 1H0MA 5ICEA 2M45A 2GQQA 5D5XB 5DYMA 1F1ZA 1OMIA 2LDUA 3R60A 1OYYA 4RGXA 3FXUA 1T0FA 3DFGA 5LEJA 3KP6A 2PMUA 3GZ6A 1KYWA 2KJBA 3I5UA 1Z6TA 4R79A 4M71A 2BBYA 4WX9A 5JR3A 5LHHA 2E1CA 3J7AO 1FX7A 2FU4A 4EJWA 5JVTA 2V6CA 4LFUA 3V8JA 1G3SA 2CGPA 1UCRA 5E8IA 2YX4A 2ETHA 3RI4A 3MAJA 4YIFA 2L54A 3FHZA 1YFHA 3T5XA 2HFHA 4EVIA 1FPQA 2DT5A 5A2QZ 1USSA 2EFPA 2D1HA 2P6SA 4RGUA 5BMZA 3LWFA 1DUXC 2IP2A 4M9SA 5CYVA 1UB9A 3QU6A 3IWFA 3EQLF 2W57A 2QUFA 3WTTC 2P7CB 1QZYA 4NQWA 4WK8F 3BPVA 4WCGA 2ADUA 4BHBA 2R7FA 1TW2A 2PJPA 2A69F 3ECOA 4NHJA 2VOOA 3JW4A 1J2XA 2NS0A 1OR7A 2OZ6A 3TDUC 1ZN2A 3KFWX 1SMYF 4EGYA 3ABUA 2OQGA 1YG2A 2O61A 1BN5A 5D6EA 5E1XA 3ERED 2V9VA 4HA8A 5EEHA
chains in the Genus database with same CATH superfamily
2WBMA 3WE3A 2JN6A 2E7XA 4EMSA 3CF2A 2BW3A 5GTHC 3V7CA 1ORKA 5CQGA 4JQFA 4CCLA 3ABTA 1WJEA 2L9NA 1RZ4A 2VKVA 1B9NA 3BZKA 4E70A 3FHNA 4EV0A 3QYFA 3SDGA 1GVDA 3HGGA 1JXSA 1MJ9A 2L3DA 4JX6A 2IS6A 1V3FA 2KFDA 1R36A 4RA2A 2O3FA 3W2AA 2WA0A 4MQVA 3CJRB 2PN6A 1KYZA 3HEFA 4MHGA 1IAWA 1O3SA 4BU2A 1MMGA 2WAEA 4E6KG 2WV1A 4WXHA 2RNGA 4I7HA 4ITVA 4IQ4A 4PFPA 2LK2A 5DD4A 2BE5F 2M0CA 4IL6C 3C18A 2XSDC 4QLCU 2GOXB 5DCMB 1ZARA 2K4JA 2EFQA 2DMQA 4IVNA 3G1LA 4OOIA 4XKVA 3OYJA 5DCMA 2EB7A 2OV7A 2EV5A 5IP7J 5F1RA 5E3OA 1QVUA 1I50J 5F04A 3Q0WA 2ZXWH 4O3MA 4RAGA 1PJRA 5L3EA 2FNAA 1G6NA 3E5QA 1Y39A 2EZHA 3SHFA 1S9HA 2Q2EB 4OU0A 2X1CA 3HRTA 2ZNYA 2Q2EA 1YS6A 3QWLA 2ACJA 3ERMA 2M9HA 3K4LA 5CQEA 4E7IA 2QSHX 3R4KA 2CV2A 2JA7J 2EINH 4XOPA 1MGTA 2JQ7A 3S3OA 3HOZJ 1I27A 4UNOA 5DD8A 2PG4A 1I6XA 1OCZH 3NWSA 1ERDA 5H20A 3FXLA 5L3FA 4BKXA 1XD7A 2R3SA 3OYHA 3GTGJ 2F48A 3ZQGA 1QGPA 2QSGX 2XAQA 2W4SA 5FFXA 1Z3YA 1QRYA 2FMLA 2XAFA 3HUGA 4G6QA 4HG2A 5FRNA 2ZMEC 3M8EA 2ZC2A 1Z77A 4H4KC 2VB6A 3JCUC 3O8GA 4HX8A 3ZMDA 2BVMA 4BQNA 1XGNA 1QNTA 2LF8A 4M74A 2ME6A 2LRDA 4AIKA 5E1ZB 4BQAA 2OA4A 3MKWB 3ZMTA 2MBFA 4A69C 1FMVA 2JSCA 3M07A 4E7LA 1V5GA 3BR6A 1ZGJA 4G8XA 3LQQA 2CUEA 4B8XA 4RDUA 4RB2C 1LFBA 2JK3A 5F27A 1XDUA 2P5KA 5J47A 2GLOA 2HXOA 4IOAF 3OWTA 1YTYA 3ROUA 4A3LJ 3CDHA 3BZCA 2JRMA 2KZGA 1STZA 4EJTA 4BQQA 1VQMI 2BVLA 5JFRA 2PJRB 2DFFA 2HDCA 2VQGA 3HSFA 1E0EA 1OJLA 2PJRA 4GYIA 1B4AA 2LLKA 3LSMA 1O3TA 5K7HA 2OF7A 5ILUA 1QA6A 2L9VA 4XRSG 2LOOA 5B66C 5KAFC 2MFZA 1L3LA 3HHGA 2HTJA 2XKOA 3VB2A 2B0LA 2IEKA 3OYKA 2MABA 1J75A 1YRNB 3PO3J 1P7JA 2K85A 3CLQA 4L5EA 3ZN1A 4XL9A 5CJ9A 3I55I 1YRNA 3EUHA 3WHCA 1OCOH 1D1BA 2W48A 3KYDB 2CS3A 3RKYA 2Y0SN 5GAGJ 1IGNA 2FD5A 2PI0A 3S15J 3F6OA 1PDNC 4M3BA 2GA2A 5TISC 5LBQA 2E1MC 4I6ZA 4UHTA 1JTXA 1HOMA 3HOUJ 1XS9A 5FRMA 1POGA 3QRFF 4IQJA 3HB9A 4Z2YA 3PNVA 5LRSA 2BXZA 2W25A 4R8HA 2V1NA 4IO9F 5DDGA 1NG6A 1W5SA 2LREA 4KA4A 2X0LA 4JOMA 2MLGA 4IHYA 3HGYA 1ZAOA 2M30A 3KP7A 2DFIA 3QOPA 4F52A 1ZGWA 1ETYA 3QOEA 2VBXA 3K70C 2EK5A 3MEXA 4PFOA 3ASOH 4P1WA 5J1YA 2KKOA 2ESHA 3H0GJ 5KK1A 2EJRA 5FKNA 2UV1A 2RQQA 4XOTA 3UR3C 4IEJA 4Z6YA 3R0JA 2DOFA 3CJQB 4LLNA 1LPQA 3ML6A 1JUMA 3I54A 2LTPA 1APLC 1IO2A 3WU2C 3BPXA 2QQAA 3DKXA 1RI7A 3M8JA 2PEXA 4UV9A 3UKGA 1K4TA 2LSOA 1YIOA 2X4HA 3C3WA 5LLQA 2HPMA 3LSHA 4HNUA 3ZQQA 2HQ5A 2K3FA 2DTRA 2ESNA 3I4NJ 2L4AA 2X6WA 3GFIA 1WGXA 3KYCB 4BE2A 3G1MA 1N25A 4KMUX 2E34A 2ELHA 2OUMA 2ZSHB 1ETOA 4U87A 3ISPA 4RLQA 2XRNA 4F91B 4I02A 1DGWY 1DP7P 3JRIA 1DQUA 1JT6A 3G2BA 1JJ8C 1FYMA 2OTLI 5L3DA 4N9HA 1CF7B 3LSGA 2DCEA 1WRJA 2NVTJ 3H3UA 1CF7A 4PGHA 3K0LA 5HDGA 4GGGA 1WQ2A 5M5XJ 2QQ8A 1MBKA 2DW4A 3GBGA 2XC7A 3E6MA 2BGCA 2L0KA 3HRMA 4A0YA 2NS7A 3LSRA 5JVGF 1PUEE 4GRIA 5F64A 2UUZA 2QKLB 1DU0A 1SEUA 2JUCA 2OU2A 2XVCA 5EDNA 3VODA 2GXAA 2ZXIA 4LK1F 3HRUA 4EJVA 2ZXJA 2MD5A 3CUOA 2CYYA 4KFCA 1TQPA 1X2NA 1X1CA 5HLIA 3BG6A 5TJJA 3K4CA 2I10A 3M1CA 2A05A 4GDFA 3HOWJ 2VKEA 2BY0A 4RAZA 3PL8A 3LNQA 4LG0A 1IRGA 3LAPA 1WI3A 2BEOA 3BJOA 4FISA 1D0ZA 4IF4A 3CESA 4B4CA 2WB1A 5E3NA 4MLOA 3FBNB 4I76A 4KYWA 3BR3A 3HDDA 4S04A 4LLGF 4E7JA 1RUNA 2Z3YA 1EH6A 2YUSA 3ECHA 1BI2A 3QP6A 5DUIA 3GTJJ 4UUTA 1BI1A 3CF5F 1ZR4A 1I1SA 3M7GA 1JGGA 1J9IA 1U9NA 3F3XA 4HDVA 2VC1A 2CV1A 1MNDA 3SJMA 2LY9A 1A35A 4CCMA 1P9QC 3BJAA 5FLXZ 2FBKA 4PJNA 2OZUA 3K4NA 1KU3A 3ZMZA 2HXIA 4PJLA 3GLLA 4ANJA 1X1DA 3L2UA 3F0CA 4F3QA 4B47A 2XGEA 3CO7C 1Y1WJ 1YW7A 2OJED 2O5RA 1N78A 1OCTC 1S6LA 3REOA 3L2WA 4HNTA 1W7PB 2A5YB 1LKXA 3DBHB 2AQFA 4HV6A 1W7PA 2FE3A 5D8KB 2GXGA 4C2UA 1ODDA 4W1UA 1MSFC 4WXDA 2H8WA 1SFEA 1FYKA 2JT1A 1S7AA 4ENNA 3K6GA 4FTHA 1U8RA 2FF4A 3ZQ7A 4MFDA 1OCRH 3HOYJ 5M5YJ 5IT9Z 5IP9J 2DMTA 2XB0X 2Y30A 1YX3A 1VQOI 3J7ZI 3QQAA 4OWRB 2VPLA 2JWTA 3EYYA 4XLNF 2PMZN 1UHMA 4P96A 2J5OA 2CV0A 5FD5A 2X6OA 1HW1A 1R7JA 2GOMA 1K4SA 2KDOA 5C4JJ 3FM3A 4KN7X 3CUQC 2MW8A 1S72I 1K79A 5L3GA 3IHUA 2JA6J 1Q1VA 3K2AA 2L4MA 1WFXA 1F9NA 2K5CA 5F6FA 3I56I 4XNFA 1ETXA 1XX5A 2N8GA 4I09A 1LEAA 1R58A 3OOPA 3HSEA 1ETKA 3C1DA 4PUSA 4WF2A 2CW8A 1SFUA 1P92A 5CVJA 4BAYA 1HLVA 2FA5A 2A07F 1SC7A 5F08A 3BG7A 4JBAA 4XN3A 3NQOA 3SZTA 3Q5FA 2W24A 1P4WA 3U2RA 1ZQ3P 2A6TA 3OS0A 4Y33A 1PYVA 3GTKJ 3IRQA 4CHUA 3TBIA 3ZCOA 3GTOJ 5IP6A 2CUFA 3G4SI 4MNUA 2GIZA 1MKMA 2G7UA 2KLOA 1O3QA 1K6YA 3PFYA 2EFNA 1MMSA 3TOAA 3BG5A 3GF2A 2QSFX 1FT9A 1X1BA 3LA2A 1FBUA 1SD4A 1YITI 3TW6A 2HVSA 1YJNI 4RM3A 1JHFA 4KITB 4ZTJA 2FRHA 2DT7B 2O8KA 1T08B 4IHVA 1ULYA 4H0EA 5LHGA 3IV5A 2VE9A 1W5CC 3HTUA 5AIQA 2HTSA 1ACIA 1H8AC 1Y8QB 2DODA 3QPSA 1FOYA 1ETVA 2KP6A 3CTAA 1ON1A 3O8HA 4QPOA 4A2UA 1X1AA 2DT6A 1Y0UA 4BE1A 5LEKA 1X3WB 3F6VA 1ZK8A 5J4VA 3BTLA 4B48A 1D0YA 4YIIA 1EV7A 4XBFA 2D2WA 4ASNA 1W36D 3PSFA 3ZN0A 3KP3A 4CDGA 2VJJA 3D5SC 1W5TA 3MCZA 2EA4A 3MVPA 4MQ9F 4KUMA 4LB5A 2IJLA 3FMQA 5IPAA 4LIUA 2VE8A 3MMYB 5FJ8J 2KT0A 1R23A 3GCMA 2LVSA 3CP8A 5M3MJ 1VQ7I 1X58A 2VXDA 1TT5B 2A68F 3BT9A 4ZDOA 1F5TA 2YSRA 1EA3A 1ZYRF 2E5ZA 3DV8A 1ZLKA 1LFUP 3GFMA 4BDZA 1FJLA 3KEOA 4Q48A 3MD2A 1EH7A 1K83J 2K9MA 2VJIA 2DQLA 1U8BA 4FE4A 4RAFA 1RPWA 4M9ZA 1H89C 4PGGA 5HLTA 2A61A 1OCCH 1SD6A 1WWXA 3WGIA 4FCYA 4G9YA 2QKMB 3I4MJ 3O3KA 1B59A 2K7LA 1Y0NA 4XK4A 5F0HA 3JSPA 1LVAA 4DBQA 1VQPI 5GP9A 2K27A 1TW3A 3S16J 1X4OA 2XAGA 3CD6I 1FEXA 2R7XA 2ZKZA 3HIFA 3E6DA 3U9GA 2FEZA 2DPDA 3AAFA 3F23A 4DBRA 3KZZA 2LC2A 3H9JA 2WAFA 3I71A 2V1UA 3BZ6A 4ZTFA 3KZYA 4HNVA 1Z3XA 2HWVA 3B6AA 3VSLA 3L2RA 4G6TB 4EGZA 3ZR8X 4S0HB 2P8TA 5CKTA 2XGXA 1B8IB 2QENA 1S7EA 4L18B 1MBHA 2H1LA 1B8IA 1LDDA 3HKZN 3QAHA 1MSEC 4ENKA 1XDSA 2NYXA 1FBSA 3L09A 3CLOA 3BQZA 3HG9A 4HLYA 4A3CJ 3VPRA 1HQCA 3FIWA 2ID3A 1ETWA 4RB1A 3FF5A 4M73A 2W82A 2Y9YA 1AWCA 2GWRA 4NQWB 1YQAA 2K02A 2DMPA 2F5CA 3N05A 2D45A 1UELB 1XTAA 3DPTA 2DTZA 1IV8A 1YO5C 3AL0B 1FYLA 2V9PA 3FXMA 1R5ID 4HEA2 4KIBA 3EUAA 4L9TA 3TDZC 1FTTA 3IC7A 2EFWA 4IOCF 1YIJI 4KN4X 1OPCA 1KQ9A 2OC6A 3MQ0A 3CDLA 2CO5A 3ZGKA 1RRJA 2EV0A 2G7HA 5HS9A 2NAZA 1OYIA 4AIDA 4BS9A 1G3YA 1E3PA 2K3PA 1U5TB 2HVRA 2IAIA 3KEQA 1KU9A 3DQVC 3JRHA 2OQRA 1U5TA 5HS8A 3HC7A 3P9CA 4A3DJ 1HCRA 4II3A 2DO7A 2K40A 3CO6C 3MKZA 4Y52J 3OYFA 4DQ2A 3W3CA 1R4NB 3IL2A 2EQRA 4C2MJ 4XSZF 4CUGA 3JRFA 1W1WE 1IRFA 1DDNA 3WG9A 3V8KA 4PJ0C 4Y17A 5HDKA 4C30A 5FLVA 2RKHA 3GEZA 3TO7A 3JTGA 2JJ7A 3B73A 5BPDA 2W00A 4CCOA 2VLAA 1G3TA 3F8CA 2E35A 2B7EA 2NOJB 2WV0A 3WTWC 4M3EA 1KU2A 4FQGA 3OY9A 3H5RA 1TWHJ 2DAOA 4X6AJ 1XSXA 3A4CA 4IZZA 2HGCA 5C4XJ 2Q8KA 3I59B 2EIKH 1S5LC 4CSWA 3BWGA 2DPUA 3KCCA 3W6VA 3I59A 3L00A 4M3DA 4F7ZA 3T8TA 2BY2A 3CCRI 2LH9A 1IXSB 3A0HC 5BPIA 4UUVA 4N9IA 2L5QA 3S1MJ 2VONA 4B43A 3WU1B 3S3MA 1QZEA 2DN0A 4BXXJ 2QWWA 3VEPA 4B09A 2V6EA 3WTYC 4A0XA 4F55A 3PUBA 1YJWI 1MNEA 5ED4A 5FGMA 4KT6A 2HYFA 3J80Z 5K5OA 2B63J 3N97A 9ANTA 2MA3A 2CFOA 2M8GX 3EUHC 1TWCJ 2TRTA 1X1PA 2F4OB 3A1YA 4LOCA 3SZPA 3M8FA 3OR2C 1PP7U 5JLWA 2KMUA 3GZ5A 1B1BA 5ILVA 5M3FJ 1R00A 4AYBN 1BOBA 2HOEA 3ZPLA 2L01A 2PMHA 4XLEA 4OMZA 1BOAA 5E1WA 1I39A 2J5PA 4CZZA 4YIRX 2AXTC 4JYKA 2XV4S 2DXIA 1FIPA 2RNJA 3LA3A 4DZPA 3SFZA 3HUGB 4BL0B 4A3KJ 4IPAA 1TNTA 2ZSIB 1QQIA 3LSIA 2P4WA 1K61A 5IT3A 1Z0XA 4KDPA 3I64A 1MMNA 1TQMA 2HNHA 1UZCA 4GCVA 1KONA 2MG4A 4BH9A 4B3XA 3OYLA 5IYDJ 4XRMA 3DBRB 2LP0A 4UB8C 4IHSA 5L3BA 3OYCA 5FLXK 3TW7A 2F5VA 4FT8A 2CG4A 4MTDA 2DJIA 3D0SA 3C2BA 1HXDA 1KU7A 2VODA 2JRTA 3A2KA 4YELA 2HR3A 3RTRA 4G94A 2H8RA 3TL4X 2R5ZB 4XKCA 3K1PA 1MH4A 2BZTA 2VL8A 1G2HA 3OIQA 2XROA 2R5ZA 2DU9A 2BOLA 3QODA 4ZYHA 5J6XA 5F0FA 2OAZA 1UFMA 3CP2A 2TCTA 4RMNA 3OYEA 3OYAA 2I8DA 1ONVA 3OOUA 3IKTA 2CU7A 1IUYA 4NNJA 4WXCA 3KLNA 2P81A 4D9JA 4JX5A 3T1BA 4L9JA 1VQNI 3FXQA 4WWCA 3P7NA 4PCQA 2QLZA 5BQTA 1IN8A 1A5JA 1BIAA 3FBIB 5EYRA 2L9RA 2X9DA 1WJAA 1IC8A 4IRIA 4M6YA 3S2WA 3KP2A 3GO5A 4Y3OA 3V42A 1LB2A 4E7KA 2ECCA 1PP8F 4XLFA 5E17F 1MD0A 3NWTA 4LGWA 3WHBA 2DDAA 5IT9K 4CYCB 4P9FA 3G73A 3F72A 1EH8A 4OMYA 2PQ8A 3F8BA 4CYCA 2HI3A 1UJ8A 2LFBA 2HKXA 5LGNA 2CUZA 4PJMA 1XGMA 1Z9CA 1T8IA 3VYRB 5F0CA 3UNGC 5FO5A 1TBXA 2VJ5A 2QZ8A 2A6EF 4ZJZA 1XCVA 1JKRC 5EJCA 5ICCA 3BC8A 3DWLE 1WJDA 3OIPA 2OD5A 4KIFA 2NNYA 2Z5UA 5LRRA 1P7IA 1T6SA 2NRAC 2HYGD 2L9SA 3H0DA 1UMQA 1HSTA 1VI0A 3DF8A 1GT0C 2O7OA 5K7FA 1QZZA 3E3VA 3WE2A 1T39A 2VBYA 1DPRA 1U78A 2DBBA 1B72B 5D4SA 3IH3A 1P6RA 4OINF 3E5UA 3PQKA 4LMYA 1W7PD 5E20A 1SVMA 1B72A 3WGGA 1OLTA 1SVOA 3JRDA 3B02A 2HQAA 2DFEA 2E19A 2KZVA 2M2EA 2XGDA 5D5VB 3M9AA 4A3MJ 1TLHB 1TNSA 4XLHA 4DGWB 4CA0A 2DMUA 1EKEA 3G6EI 4HX4A 3G71I 1BC8C 1D8KA 4L9NA 1Q1HA 1IZ1A 3JTHA 3L2QA 1YS7A 1Z1DA 2GIVA 2H6BA 2JPCA 1FNNA 4IJAA 2JVGA 1HF0A 5HVQC 2Y0MA 2ECBA 2XHKA 2LG4A 5JHUA 4PSWA 4V2FA 5LD2C 1K7AA 3KP5A 2ZNZA 1TWFJ 3GW2A 1XGSA 2YS9A 1WKMA 2ISYA 1IDYA 1RESA 4JP0A 3RZOJ 3DTKA 1IW7F 2EPFA 2BY3A 2Z9OA 3DEEA 1AHDP 1MMAA 3ZXSA 1LFPA 1F36A 4D5CA 2X1EA 2E1OA 4DIQA 1JT0A 2HS5A 3MKYB 3EDPA 4U88A 3QPLA 5H2FC 3HBLA 3O2PE 3RJPA 3F8MA 4PK4A 3LMMA 2LY1A 3SQNA 2MC4A 5ILSA 4G7OF 2F2EA 3WGHA 4E4HA 2JA5J 3IH2A 1XCBA 5HNFA 3V8LA 4RAYA 3BTCA 3PIPF 3ULQB 3DBLB 1VNDA 4A5MA 5J8CA 2NS8A 2CJJA 1VFCA 3VYUB 3C7JA 3E97A 3LFKA 3S14J 4U7BA 1A6IA 2M3AA 1JJ6C 3K4BA 3GFJA 1I6HJ 3HOTA 2XKPA 2E7WA 2P6TA 2V4JC 3A01B 4I98B 4Y7NJ 3VOEA 2ZO4A 4LG0B 1LQ1A 1OYWA 2R7OA 3AG3H 3HHHA 3A01A 3PUFA 2W84A 4HF0A 3TO9A 1X3ZB 1J5YA 2BXYA 2UZKA 2KDZA 4HAMA 4MO7A 2QCOA 3FXRA 3GFLA 2LF7A 3P9IA 3CMEI 1R5GA 1BA5A 3F8NA 1P4XA 3BCAA 4R1HA 5E18F 4BBSJ 3AG4H 5J8FA 3D1NI 3OS1A 2VQCA 4CH7A 1XC5A 2M87A 4IRHA 1VQLI 2JA2A 3I0TA 2ELJA 4EM0B 2VC0A 2I5UA 3VWBA 3GLXA 5KAIC 1OISA 4V2GA 2IA0A 1REPC 3BCBA 2DOAA 1M1EB 3F21A 3NAUA 3KETA 3P5JA 4BUPA 4BY7J 4UVBA 4RBOA 2WB1N 3BR0A 2E2IJ 4Q5SF 5E8GA 5E79C 1SFOJ 2NVYJ 4XMYA 4L0ZB 1X4PA 4KJZA 4XRSA 3PSIA 4G12A 2L7MP 2JMWA 2Y75A 2V9KA 5HDNA 3I9V2 4O6JA 5D5UB 4U7DA 1GHCA 4BXFA 2GZWA 2R4GA 2WAQA 1ZRFA 4A12A 2G0EA 3TO6A 4DW6A 3QYBA 2Y69H 4PSXA 3VFZA 4KT5C 4BQOA 4OIQF 2AS5F 5H6QA 2DA1A 2OPTA 2CQKA 1JI8A 2O9LA 1IDZA 2MH2A 2X51A 3RYPA 1HW2A 5BOXA 3K2ZA 3BDDA 2KIFA 5K5QA 4BACA 2KRFA 5CLSA 3TP3A 1HA8A 2A6HF 2HYJA 2EILH 1H9TA 2V1XA 2V26A 1RETA 3ABLH 3LAJA 2FJ1A 1NHAA 1RNLA 3S32A 1KQ8A 3KEYA 3E5XA 4BHCA 1Z05A 4HSTA 1ZELA 4I0BA 3W6JB 2O03A 3SXYA 1HDPA 1R1TA 3RIRA 1R1VA 1MBGA 2RC4A 2ZFWA 4EJUA 1HC8A 1QVTA 1T95A 2BY1A 3TMOA 3K4KA 3DTIA 4M72A 4MEXF 1X2MA 2K4BA 3ZP5A 3K10A 1XSVA 2VKDA 4A6EA 3GTMJ 2R7QA 2Z99A 2FOKA 3OYMA 1W0UA 2OTJI 2LKSA 1T0FC 4AIHA 4QIWN 1XMAA 5M5WJ 1O7FA 3BROA 3C2GA 4RB3C 4GXOA 1HSJA 2IA2A 2JTVA 1TWGJ 2KQRA 2EBIA 4HX7A 3OSFA 3K4MA 3U1KA 2VBZA 3CCQI 1A31A 3SFIA 2QA4I 2E36A 1O3RA 1AKHB 4V19K 1S3JA 2DK5A 4DOZA 2KJCA 1BI3A 2L7FP 1AKHA 1R5HA 3GVAA 1NK2P 1S7OA 1R71A 4GO1A 2XF5A 3LSTA 2ICWG 4NC8A 4J19A 4C3JJ 3ASNH 5EEAA 1G59A 1UG0A 5DCFA 3ZOBA 3F22A 3FWEA 3FXJA 2PBIA 4D7NA 3CMMA 5KCMA 4P9UA 2XIGA 1O57A 1U6GA 4S05A 1IN5A 1B9MA 3HRSA 1YYVA 1LUJB 2XF6A 2EFOA 1LJ9A 1ZH5A 3Q0VA 3S1NJ 1R6RA 3L7WA 2RGVA 3RQIA 2COMA 3I3LA 1V54H 3PNYA 4AU7A 5FD6A 1YLFA 3Q9SA 2XASA 3CC4I 1FSEA 2RAEA 3OR1C 1FOWA 3IAS2 1TQIA 4XLAA 1S29A 2Z1DA 4HOBA 4OAZA 2VN2A 3K1NA 3RSNA 3T0YA 3OV8A 3QYEA 3OL4A 3QPTA 4AVZA 3PIOF 1R1UA 2XPUA 3Q0UA 2E2JJ 1ZG3A 2CQ7A 4KNYA 1FTZA 5LGUA 4YFKF 4ZDPA 3RQ4A 1F4KA 4PJJA 4E7ZA 3J80K 2CFXA 2RV8A 4AM3A 4EQQA 4XONA 2EIMH 5FLMJ 3CC2I 4B3AA 1JE8A 4XSXF 3FMSA 1W0TA 4O5VA 2M4GA 2MD0A 4DZJA 4HRIA 2QF7A 4EM2A 1MW7A 2R7ZJ 4XM3A 3JSOA 4XLCA 3AL0C 1SD7A 3MWMA 2M4KA 1HW5A 1FSHA 3R0AA 1JKPC 1D0XA 3CCMI 2WY8Q 5IYCJ 2DYSH 4A3BJ 3U21A 2IVMA 3CUQA 4Q47A 3VYSB 4CCJA 1D1AA 2EH3A 2KIUA 1VQ5I 3HPGA 1OR7C 4LIVA 4EJOA 4KIGA 4ZYAA 4BY1J 1WJ5A 1BI0A 4U0WA 1U5TC 1E17A 2AXLA 1WCMJ 3BG3A 1NTCA 4K2EA 4ZC3A 4AD9A 4HYEA 4DNCA 1HKTA 2FSWA 3QPHA 2CH0A 1O4XA 1G4DA 3N4MA 2DOEA 5K1YA 4U0VA 1P4AA 1QHHD 4HLXA 5D4RA 3JR9A 4UVAA 1IUFA 2ELKA 3WU0A 2R7UA 4ZDLA 4P5OA 1E3OC 1J7KA 2GA1A 1AU7A 3DKYA 4NBQA 1W36C 3HTSB 2BHYA 1YW8A 2H09A 3BTJA 4ENMA 2DA7A 3RCOA 3FKJA 3AFHA 3W2VA 5ERIA 1BW6A 3OL3A 4D5FA 2FOWA 1E3HA 3SYTA 1RKTA 2EWNA 1VQ9I 1IXCA 2B9SA 3HKZA 4XKBA 5ICFA 4XIDA 5CVUA 4LD5A 1J59A 3ZMSA 4DJAA 3ELKA 1Z91A 4IX7A 4HBLA 5DS9A 4BE0A 2KISA 2AHQA 1BR1A 3WODF 3J81Z 3JRGA 1X3UA 1IG7A 3AG1H 5DV5A 1U2WA 3EYIA 3BQYA 4EEFG 2ZB9A 4OIPF 1FOXA 1BC7C 2VQLA 2IW5A 1IRZA 4ZZLA 1KA8A 5LGTA 3OIOA 1SFXA 3JAMK 1LNWA 2R7TA 5CPRB 3CMAI 3CCVI 2GM4A 4HQMA 3R6SA 1SVLA 4BXUA 2DFHA 4L0YB 1G3WA 2AQEA 2FQ3A 2KPMA 2VJ4A 4NC6A 3WTSC 2FQ4A 3HZJA 4RGRA 2DLLA 2BV6A 4J00A 5D8LB 2O0YA 2DA5A 2HZTA 3H1CA 1R49A 3GWZA 3BJ6A 4DYCA 4CZCA 3K4JA 1IN7A 3DU5A 3PNTA 4UB6C 2ZJ2A 2VOPA 2HKOA 3BTIA 1J0RA 4LG3A 2H94A 1UAAA 3OSGA 2XDVA 2K9LA 4BJ6C 2M7AA 2IGOA 5FKMA 1ZLJA 3W6KB 3ZMUA 1ZRCA 3FKIJ 3OYDA 3IAM2 3KLOA 2UWMA 1GVJA 2HEOA 1FIAA 2TDXA 4L9VA 1ZHFA 3E6BA 4CCNA 4OIOF 1WPKA 3DCFA 2IRFG 3GXOA 3BY6A 1SANA 2L02A 4LLLA 2R7RA 4ZYEA 4M6VA 4A6DA 3L1PA 3LA7A 4BJTA 3H9QA 1ON2A 1KQ0A 4YEJA 4UY8I 2R5YB 3EPZA 1LEBA 4MTEA 2Z2SB 4Q4ZF 2BHZA 1YJ9I 2FNPA 2RVCA 3KE2A 2R5YA 3E7LA 3E0JB 3H36A 1VQKI 1GUUA 1HKQA 5DM6F 2V1DA 1EJ9A 5LHIA 1WJBA 1H88C 1WSUA 4N0BA 1ZREA 4C9YA 1JHHA 4DYQA 3K9TA 1MNMC 5EF6A 1RC9A 3PO2J 3TEDA 1T98A 2VT2A 4QWQA 2H27A 1ENHA 1XB4A 2F5FA 2F5DA 3CCYA 2P0WA 3GMEA 5HLHA 3IRRA 3X2QH 2CQQA 3CQZJ 2LMDA 2Z16A 2NOGA 1MBEA 5BS6A 2M1BA 2AO9A 1GXQA 1YW9A 4BBRJ 2H6CA 2KHMA 1QPMA 2V7FA 2X85A 2YU9J 3JREA 3HOVJ 3BR1A 4PZJA 3DKWA 1O7LA 1MMDA 1RKWA 2VT3A 3A02A 4UVCA 4A3GJ 3DEWA 5L3CA 3FK7A 2M34A 1J09A 1PVEA 4A5NA 1B6AA 4FX4A 2F6CA 1WHUA 2HQNA 3K69A 4M3FA 1SAXA 1QBJA 4CXFA 3FZVA 1HKSA 4MFEA 3Q9VA 3AKZA 1VF9A 1XMKA 3ZMVA 4AYBA 3LFUA 2LR8A 4TV7A 1Y56A 1YI2I 4AVPA 2JUGA 3H5AA 4DYRA 2K9SA 2M7BA 5JLXA 4HF2A 4KICA 4I2OA 1ZG1A 3E1SA 1FC3A 3NARA 2R7SA 6PAXA 2EA2A 1FZPB 3RDIA 4BGDA 5HLGA 2K86A 4CO8A 1XPXA 1RUOA 4AUXA 3ABMH 5FB2A 4XN0A 3RKWA 2DYRH 1I1GA 4LJZF 1IXRC 2STWA 2XRLA 2R7VA 4MEYF 3BP8A 1ETQA 2FBIA 4A3JJ 2MSYA 3COAC 2EV6A 2COBA 2F5EA 5EGOB 4YFNF 3LSJA 1ZRDA 4KISA 3KP4A 2VIXA 1ZTRA 5EGOA 2Q0OA 5IY5H 1VQ4I 3ZQHA 4FETA 2KRHA 1ZG5A 5FKLA 3SEZA 1FLIA 1H9GA 1Z7UA 5JI6A 3MZYA 2MLKA 2XAHA 2FXAA 3H92A 4FE7A 1QHGA 3CCJI 2V79A 3WTVC 5GPCA 2QVOA 2PX9A 4QPQA 4XQFA 1VTNC 2PLYA 1D5VA 3Q3SA 2RQPA 4W97A 2K9NA 1FBQA 4ZH4F 2IA1A 1FP1D 2JSPA 2Q1ZB 4RM2A 2YR2A 2ZXHA 2VXZA 1XG1A 3H5NA 3ZQIA 1K78B 2QM3A 3FX3A 2UXNA 3ZQCA 1JGSA 1TC3C 1G8XA 4L5JA 1K78A 3CCSI 5KHDA 4HDUA 1IV6A 5J4YA 2VASA 1Z67A 3L9FA 4I0AA 2Y0SA 4HV5A 5GTIC 3O6BB 3H3ZA 5GAEJ 5B3SH 1R4MB 2KL4A 3QP5A 2NNNA 3WTUC 1V4RA 2FMYA 3JRAA 3LSKA 5DEQA 3JAMZ 3K70D 3TGNA 1CGPA 4F93B 1I3AA 1YX5A 3PFIA 1MDMB 2YU3A 3OMYA 4XR6A 2LKXA 1NG7A 2IBDA 3S17J 5TGTA 2R92J 4C3HJ 1MDMA 4BHPA 1Y6IA 2GBYA 3KX2A 2OCCH 3S2HJ 3KZIC 1ZR2A 3DEUA 1OKRA 2VUMJ 4AIJA 3ZQLA 1BJZA 2DA2A 2JVHA 3GX4X 4P55A 3IH4A 5FFZA 1D3YA 3I53A 4LB6B 1LE8B 2XF7A 4FHTA 2EZLA 2QYOA 1LE8A 4I01A 5HNHA 1JKQC 2CUJA 2HDWA 2LNBA 2RDPA 3EETA 3L2CA 4OIRF 1DGRM 1TP4A 1XSDA 1FOKA 4NUBA 4C2TA 1I3QJ 2LKPA 2HOSA 3B6CA 1AA7A 3RYRA 2QGUA 2ZMEB 4A0ZA 2FBHA 3DPLC 3FXKA 4D0PA 2NVUB 1YOVB 2ZMEA 4JK1X 3OYNA 4G7HF 2GXBA 1U9OA 3OYIA 1ZGAA 4RGSA 2PFBA 2XUBA 2DK8A 1X19A 3A0BC 2Y9ZA 3HM5A 1A04A 2LY2A 1FP2A 4XKWA 5KNLA 3GUDA 1QU3A 2E2HJ 4UV8A 2EIJH 2RREA 4GYGA 3LOCA 2E1NA 1MIJA 5CVRA 3PQJA 4QTRA 2K9QA 2X6YA 4FX0A 1U3EM 3NRVA 1D1CA 3IWZA 4D1QA 1DPUA 1FWZA 3CCLI 4IHWA 2MGQA 2Y48A 2DA6A 3MFKA 3H9GA 3ONQA 3ESWB 1XMXA 2QQBA 2CQXA 1MBJA 1SAUA 5EZHA 3CMYA 4XRFA 3CJNA 2JZYA 1XGOA 2O8XA 1WJCA 2HOTA 4KMFA 4CCKA 5B1BH 3E6CC 4ZYGA 1BM9A 1KGSA 2VPRA 2ISZA 2DQRA 3A03A 5F1JA 2M5WA 4U0YA 1JUPA 1E2XA 2X6XA 3GZNB 5CVVA 1HBXG 2CWEA 2XAJA 4NC7A 4Y4RA 5HOOA 2P7VB 1A36A 1T56A 3K1MA 2E1MB 1FMWA 2IT0A 4E7HA 2QBYB 3BOQA 2CMPA 2QBYA 2IXSA 5H6RA 3DP7A 3WTZA 3KIOA 3D5LA 1N75A 1Z21A 2E71A 2WC2A 1TWAJ 3F8FA 2YPRA 4PDKA 4ESJA 4BJ5C 4N4NB 3D5RC 3CZ6A 1R9TJ 2E5NA 2XGCA 4X0GA 5D6FA 2ZJQF 3RPUD 4J01A 1MJAA 3FMRA 2ZBKA 1WI9A 2CW0F 1BR2A 2GAUA 3HJEA 4G7ZF 3S3NA 2MH9A 2Y31A 3BR5A 4Y15A 1F43A 2ZJPF 5J1RA 1YE9A 2G9WA 2BYVE 1OFCX 2CSOA 2ME0A 3DLLF 3CCUI 1MJBA 2XAUA 5IOYA 3FDYA 4B44A 2OCEA 5GADJ 2A3SA 1R22A 2IPQX 4IXAA 3TOBA 1TT0A 3GYHX 4AWXB 1JUSA 1UHWA 3M1EA 3QU3A 2JPBA 1D8JA 3HPHA 1RR8C 1LDKB 3MN2A 4Y13A 1N77A 3J7AY 1T38A 3DXJF 2H1KA 2F4IA 3T8RA 1JKOC 3R61A 4XORA 2HQRA 1IRXA 1BBYA 5ICGA 4NB5A 1RIOH 4NDLA 4CICA 4ON0A 4FASD 2DA4A 4I99C 4EATA 2E60A 3J81K 1S8NA 2STTA 3C2HA 3IKVA 1T2KA 3MZ8A 5KVRA 1YHQI 2VBWA 5A2QK 2PMZA 4HW0A 3JRBA 2W7NA 2X1DA 2WAQN 1V5EA 1GDTA 3TQNA 3HYIA 1GLNA 1IN6A 1IN4A 4YG2F 3M4OJ 1P2FA 2F4MB 2XPVA 4CYDA 2RN7A 5TRDA 3WTXC 2A5WA 1V55H 2O6GE 4MGRA 2DI3A 2R7DA 2ZCWA 5K7ZA 3OS2A 2VQHA 1IJWC 4IHTA 3LQRA 2R93J 2M8EA 3ZQFA 3DPUA 4HQEA 1DU6A 2DMNA 5HS7A 4L5IA 2MC3A 5K5RA 2LD5A 4LK0F 3M3YJ 3BLYA 4BNCA 3F9KA 2D1VA 2KRCA 4A3FJ 3HOSA 3G3ZA 5B1AH 2L2OA 3MKLA 1MH3A 1Y8RB 3V4GA 3NEUA 1DP3A 2UXXA 2WTEA 1MZBA 2EZIA 3IP4B 2XPWA 1BIBA 4XLPF 4RB0A 2QEXI 4YFXF 4HZFA 3HOXJ 4G6DA 3DU6A 3S1QJ 1QPIA 1ZKGA 2HU9A 4A3EJ 5JHFA 5DTDA 5DUKA 3CJTB 1UG2A 2VI6A 2KIQA 1BJAA 1W4MA 2XSJC 3TKYA 5IOZA 3CCEI 1V5FA 1TTYA 3U1DA 4ETSA 2EZKA 4IRGA 5J1UA 4ESFA 3FXOA 1VQ8I 5EG0B 2VKHA 1L0OC 2LBFB 3S1RJ 3I4PA 3SDBA 5EG0A 1I5ZA 1BW5A 4ESBA 2LBFA 4M9XA 1FY7A 1LDJA 1AOYA 3V7SA 4BYYA 5CVIA 3AG2H 2Z33A 2MYSA 1K6OA 3MZHA 4HF1A 3RPUA 2D5VA 1XN7A 3RPQA 1WVRA 3FK6A 2P5VA 3P9KA 1C0WA 5AONA 2W85A 3SEQA 4EM1A 3HL2A 1SD5A 1GXPA 2CRGA 4LITA 2P5LC 5EEGA 2OBPA 5AIPA 2NXNB 2KIMA 1SMTA 5FKOA 5E3LA 4XICA 5DM7F 2WWYA 4ENJA 5C44J 4CGZA 3K7AJ 4ZYDA 1QO0D 1SFKA 3PM1A 3HSRA 3S8PA 3RKXA 3DTEA 2CQNA 2QQ9A 3I58A 4RS8A 4HSRA 2YX7A 4HPQA 3PJRA 2L7KA 4N4OB 1GV2A 3G1OA 3H35A 3DLAA 4F92B 4A93J 1ITYA 3RZDJ 1PUFB 1USTA 3FM5A 4M6XA 1OCPA 1PUFA 3H3VK 1Z6RA 3LSPA 2C6YA 1TZLA 4UXNA 3V7RA 5BNGA 1IF1A 4ZZDA 4QSHA 2IS2A 3CUQB 5FKKA 5D5WB 1H0MA 2IS1A 5ICEA 3TP0A 1OQYA 2GQQA 2M45A 1Y1VJ 3FISA 5D5XB 1LVKA 2W1OA 3ABKH 1VQ6I 3RKQA 3IUOA 5DYMA 1F1ZA 5GAHJ 1OMIA 2LDUA 3R60A 4X1EA 3CC7I 2FX0A 2IGNA 1OYYA 4RGXA 3FXUA 1KZHA 1T0FA 3DFGA 4YRVA 5LEJA 3KP6A 2PMUA 1RR7A 1GV5A 4ABZA 2IS4A 1T33A 3GZ6A 1BR4A 1KYWA 2KJBA 3I5UA 1Z6TA 1Z7LA 3KYLA 4R79A 4M71A 4AC0A 2BBYA 2HDDA 1U0JA 4WX9A 3S2DJ 1CQTA 2XB5A 2LYCA 4UUSB 5JR3A 3OYGA 5LHHA 2DA3A 2DJNA 1VZ0A 2E1CA 2ID6A 3J7AO 4UUSA 1UHSA 1TL8A 1NH3A 4BDYA 5LFAA 1FX7A 2HOAA 4GFBA 2FU4A 4EJWA 2NVQJ 5JVTA 2CW7A 3J7YJ 2ZFUA 2V6CA 4LFUA 3VYTB 4MIMA 3V8JA 3W2WA 1G3SA 2CGPA 1UCRA 5IYBJ 5E8IA 2YX4A 2ETHA 4JX4A 3RI4A 1WH5A 4C3IJ 2HPIA 3MAJA 3EUKL 2HVQA 4YIFA 4A3IJ 2L54A 3FHZA 1YFHA 3T5XA 2HFHA 4B1RA 4EVIA 3GTPJ 1FPQA 2WADA 1WJFA 2R7WA 2DT5A 5A2QZ 1USSA 2EFPA 2D1HA 2P6SA 3LL7A 4RGUA 5BMZA 2HZDA 3LWFA 1DUXC 3VDXA 2IP2A 3JRCA 4M9SA 1EF4A 5CYVA 5HODA 5EZGA 1UB9A 3QU6A 1D5YA 5J3LA 3WG7H 3ZRGA 3IWFA 3EQLF 2W57A 2QUFA 3L2VA 4IHXA 3WTTC 5J40A 2P7CB 2JA8J 3VSKA 3BG9A 3GTLJ 1QZYA 3OYBA 2IGKA 2NVXJ 4NQWA 2WY7Q 3BPVA 3HXLA 2L7ZA 4WK8F 2DDBA 4WCGA 2ADUA 5GPAA 4IKFA 4BHBA 2R0QC 2R7FA 1NK3P 2M0MA 1MBFA 1TW2A 4II2A 2ZJRF 5B5EC 1HDDC 1JTYA 4M3GA 2PJPA 4BEHB 3SZGA 1A6QA 4E7SA 2A69F 3ECOA 4BEHA 3CDIA 4NHJA 5E3MA 2VOOA 3JW4A 1J2XA 2NS0A 1OR7A 2OZ6A 2IGMA 2FUG2 1WH7A 3TDUC 3KPHA 1ZN2A 3KFWX 1SMYF 4EGYA 3ABUA 2X48A 1WZ2A 2OQGA 3S93A 3GTQJ 1YG2A 2O61A 1BL0A 5C3EJ 1BN5A 4HA8A 5D6EA 4RLFA 3BR2A 5E1XA 2Y2ZA 4OAYA 3ERED 2V9VA 2BW3B 5FROA 4D7MA 5EEHA
chains in the Genus database with same CATH topology
3WE3A 4EMSA 2E7XA 3V7CA 4JQFA 3ABTA 1RZ4A 4E70A 1B9NA 4EV0A 1JXSA 1MJ9A 2L3DA 1V3FA 1R36A 2O3FA 4MQVA 2PN6A 1KYZA 4MHGA 1IAWA 1O3SA 4WXHA 4I7HA 5DD4A 2BE5F 3C18A 4QLCU 5DCMB 1ZARA 2K4JA 2EFQA 4IVNA 4OOIA 5DCMA 2EB7A 2EV5A 5F1RA 4O3MA 5L3EA 2FNAA 1G6NA 3E5QA 3SHFA 4OU0A 3HRTA 2ZNYA 2Q2EA 1YS6A 2ACJA 3R4KA 1MGTA 1I27A 4UNOA 5DD8A 2PG4A 1I6XA 5H20A 5L3FA 1XD7A 2R3SA 1QGPA 2XAQA 5FFXA 3HUGA 2XAFA 2FMLA 4G6QA 3M8EA 4HX8A 3ZMDA 1XGNA 1QNTA 2LF8A 4M74A 4AIKA 5E1ZB 4BQAA 2OA4A 3ZMTA 2MBFA 2JSCA 4G8XA 1ZGJA 4B8XA 3LQQA 4RB2C 1XDUA 2P5KA 1YTYA 3ROUA 3CDHA 1STZA 4EJTA 5JFRA 2HDCA 3HSFA 4GYIA 1B4AA 1O3TA 5ILUA 1L3LA 3HHGA 2HTJA 2XKOA 3VB2A 2B0LA 1J75A 3ZN1A 5CJ9A 3EUHA 3RKYA 2PI0A 3F6OA 1PDNC 2GA2A 5LBQA 4UHTA 3QRFF 4Z2YA 5LRSA 2W25A 4R8HA 5DDGA 1W5SA 4KA4A 2X0LA 2MLGA 1ZAOA 2M30A 3KP7A 2DFIA 3QOPA 2VBXA 2EK5A 3MEXA 2KKOA 2ESHA 5KK1A 2EJRA 3R0JA 4LLNA 3ML6A 3I54A 3BPXA 2QQAA 1RI7A 2PEXA 4UV9A 2LSOA 1YIOA 2X4HA 3C3WA 5LLQA 2DTRA 2ESNA 2L4AA 3GFIA 4KMUX 2ELHA 3ISPA 2XRNA 4I02A 1DP7P 1FYMA 5L3DA 4N9HA 1CF7B 1WRJA 3H3UA 1CF7A 4PGHA 3K0LA 5HDGA 4GGGA 1WQ2A 2DW4A 3E6MA 2BGCA 3HRMA 4A0YA 1PUEE 5F64A 2OU2A 2XVCA 3VODA 4LK1F 3HRUA 4EJVA 2ZXJA 2MD5A 3CUOA 2CYYA 4KFCA 1TQPA 5HLIA 5TJJA 4RAZA 4LG0A 1IRGA 3LAPA 2BEOA 3BJOA 4IF4A 4KYWA 4S04A 4LLGF 1RUNA 2Z3YA 1EH6A 3QP6A 3ECHA 1BI2A 5DUIA 1I1SA 1BI1A 3M7GA 1J9IA 3F3XA 4HDVA 2VC1A 3BJAA 5FLXZ 2FBKA 2OZUA 1KU3A 3ZMZA 3CO7C 1YW7A 1S6LA 3REOA 1W7PB 2A5YB 4HV6A 1W7PA 2FE3A 5D8KB 2GXGA 1ODDA 4WXDA 1SFEA 1FYKA 2JT1A 1S7AA 4ENNA 1U8RA 2FF4A 3ZQ7A 5IT9Z 3EYYA 4XLNF 1UHMA 4P96A 2J5OA 5FD5A 1HW1A 1R7JA 3FM3A 4KN7X 3CUQC 1K79A 5L3GA 3IHUA 2L4MA 1F9NA 5F6FA 4I09A 1LEAA 1R58A 3OOPA 3HSEA 3C1DA 4WF2A 1SFUA 1P92A 5CVJA 4BAYA 2FA5A 2A07F 4JBAA 3NQOA 3SZTA 3Q5FA 2W24A 1P4WA 3U2RA 3IRQA 4CHUA 4MNUA 1MKMA 2G7UA 1O3QA 2EFNA 3TOAA 3GF2A 1FT9A 3LA2A 1FBUA 1SD4A 1JHFA 2FRHA 1ULYA 4H0EA 5LHGA 2VE9A 3HTUA 5AIQA 2HTSA 3CTAA 1ON1A 4A2UA 1Y0UA 5LEKA 3F6VA 4YIIA 1EV7A 4XBFA 2D2WA 4ASNA 3ZN0A 3KP3A 4CDGA 1W5TA 3MCZA 2EA4A 4MQ9F 4KUMA 4LB5A 2IJLA 3FMQA 2VE8A 1R23A 2A68F 1F5TA 2YSRA 3DV8A 1ZYRF 1ZLKA 3GFMA 3KEOA 4Q48A 1EH7A 2DQLA 4M9ZA 4PGGA 2A61A 1SD6A 1WWXA 3WGIA 4G9YA 3O3KA 1B59A 2K7LA 3JSPA 1LVAA 2K27A 1TW3A 2XAGA 2ZKZA 3HIFA 3E6DA 3U9GA 2FEZA 2DPDA 3AAFA 3F23A 3KZZA 3I71A 2V1UA 3BZ6A 3KZYA 2HWVA 4EGZA 2P8TA 2XGXA 2QENA 4L18B 1LDDA 3QAHA 4ENKA 1XDSA 2NYXA 1FBSA 3L09A 3CLOA 4HLYA 4RB1A 1HQCA 3FF5A 4M73A 1AWCA 2GWRA 1YQAA 2K02A 2F5CA 2D45A 3DPTA 1YO5C 1FYLA 4KIBA 3TDZC 4L9TA 3IC7A 2EFWA 4KN4X 1OPCA 1KQ9A 3MQ0A 2CO5A 2EV0A 2G7HA 5HS9A 2NAZA 1OYIA 1G3YA 1U5TB 3KEQA 1KU9A 3DQVC 2OQRA 1U5TA 5HS8A 3P9CA 2DO7A 3CO6C 4DQ2A 3IL2A 4XSZF 1IRFA 1DDNA 3WG9A 3V8KA 4Y17A 5HDKA 2RKHA 3GEZA 3TO7A 3JTGA 3B73A 5BPDA 1G3TA 3F8CA 2WV0A 3WTWC 1KU2A 2DAOA 1XSXA 2HGCA 2Q8KA 3I59B 3BWGA 2DPUA 3KCCA 3I59A 3L00A 4F7ZA 3T8TA 1IXSB 5BPIA 4UUVA 4N9IA 2VONA 3WU1B 2QWWA 3VEPA 4B09A 3WTYC 4A0XA 5ED4A 5FGMA 2HYFA 3J80Z 5K5OA 3N97A 2MA3A 3SZPA 3M8FA 1PP7U 3GZ5A 1B1BA 5ILVA 1R00A 2HOEA 3ZPLA 2L01A 2PMHA 4OMZA 1BOAA 5E1WA 2J5PA 4CZZA 2XV4S 2RNJA 3LA3A 3SFZA 4IPAA 1TNTA 1QQIA 2P4WA 5IT3A 4KDPA 3I64A 1TQMA 4GCVA 4BH9A 4IHSA 5L3BA 5FLXK 4FT8A 2CG4A 4MTDA 3D0SA 1HXDA 1KU7A 2VODA 2JRTA 2HR3A 3RTRA 4G94A 3K1PA 2XROA 2DU9A 4ZYHA 5J6XA 2OAZA 1UFMA 1ONVA 3IKTA 1IUYA 4WXCA 3KLNA 3T1BA 4L9JA 3FXQA 4WWCA 3P7NA 4PCQA 2QLZA 5BQTA 1IN8A 1BIAA 4IRIA 4M6YA 3S2WA 3KP2A 3GO5A 1LB2A 1PP8F 5E17F 1MD0A 4LGWA 5IT9K 4P9FA 3G73A 3F72A 1EH8A 4OMYA 2PQ8A 3F8BA 2HKXA 5LGNA 1XGMA 1Z9CA 5FO5A 1TBXA 2QZ8A 2A6EF 1XCVA 5ICCA 2OD5A 4KIFA 2NNYA 2Z5UA 5LRRA 1T6SA 2NRAC 2HYGD 1HSTA 3DF8A 1QZZA 3E3VA 3WE2A 1T39A 2VBYA 1DPRA 1U78A 2DBBA 5D4SA 1P6RA 4OINF 3E5UA 3PQKA 4LMYA 1W7PD 5E20A 3WGGA 3B02A 5D5VB 3M9AA 1TLHB 1TNSA 1BC8C 4HX4A 1D8KA 4L9NA 1Q1HA 1IZ1A 3JTHA 1YS7A 1Z1DA 2GIVA 2H6BA 2JPCA 1FNNA 4IJAA 5HVQC 2Y0MA 2XHKA 5JHUA 1K7AA 3KP5A 2ZNZA 3GW2A 1XGSA 1WKMA 2ISYA 1IW7F 2Z9OA 2HS5A 3EDPA 4U88A 3O2PE 3RJPA 3F8MA 3SQNA 5ILSA 4G7OF 2F2EA 3WGHA 1XCBA 3V8LA 4RAYA 3ULQB 4A5MA 5J8CA 3C7JA 3E97A 3LFKA 4U7BA 3GFJA 3HOTA 2XKPA 2E7WA 2P6TA 4I98B 3VOEA 2ZO4A 4LG0B 1LQ1A 1OYWA 3HHHA 2W84A 4HF0A 3TO9A 1J5YA 2UZKA 4HAMA 3FXRA 3GFLA 2LF7A 3P9IA 1R5GA 3F8NA 1P4XA 4R1HA 5E18F 5J8FA 2M87A 4IRHA 3I0TA 4EM0B 2VC0A 3GLXA 2IA0A 1REPC 3F21A 3KETA 4UVBA 4Q5SF 5E8GA 4L0ZB 2Y75A 5HDNA 5D5UB 4O6JA 4U7DA 1GHCA 2GZWA 1ZRFA 4A12A 3TO6A 3VFZA 4KT5C 4OIQF 2AS5F 5H6QA 2CQKA 2MH2A 3RYPA 1HW2A 5BOXA 3K2ZA 3BDDA 2KIFA 5K5QA 2KRFA 5CLSA 2A6HF 1H9TA 2V1XA 3LAJA 1KQ8A 1NHAA 1RNLA 3E5XA 4BHCA 1Z05A 4I0BA 3W6JB 2O03A 3SXYA 1R1TA 3RIRA 1R1VA 2RC4A 2ZFWA 4EJUA 4M72A 4MEXF 2K4BA 3ZP5A 1XSVA 4A6EA 2Z99A 2FOKA 4AIHA 1XMAA 1O7FA 3BROA 4RB3C 4GXOA 1HSJA 2IA2A 2JTVA 4HX7A 2VBZA 1O3RA 1S3JA 2DK5A 2KJCA 1BI3A 1R5HA 3GVAA 1S7OA 4GO1A 3LSTA 5DCFA 3F22A 3FWEA 2PBIA 4P9UA 2XIGA 1O57A 1U6GA 4S05A 1IN5A 1B9MA 3HRSA 1YYVA 2EFOA 1LJ9A 1ZH5A 3L7WA 2RGVA 2COMA 5FD6A 1YLFA 3Q9SA 2XASA 1FSEA 1TQIA 1S29A 4HOBA 2VN2A 3K1NA 3T0YA 3OV8A 3QPTA 1R1UA 1ZG3A 4KNYA 5LGUA 4YFKF 1F4KA 3J80K 2CFXA 2RV8A 4EQQA 1JE8A 4XSXF 3FMSA 4O5VA 4EM2A 3JSOA 1SD7A 3MWMA 1FSHA 1HW5A 3R0AA 2IVMA 3CUQA 4Q47A 2KIUA 4EJOA 4KIGA 1BI0A 4U0WA 1U5TC 1E17A 2AXLA 1HKTA 4K2EA 4DNCA 4AD9A 4HYEA 2FSWA 3QPHA 1G4DA 3N4MA 5K1YA 4U0VA 1P4AA 4HLXA 5D4RA 4UVAA 3WU0A 4P5OA 1J7KA 2GA1A 3HTSB 1YW8A 2H09A 4ENMA 5ERIA 2EWNA 1IXCA 5ICFA 5CVUA 4LD5A 1J59A 3ZMSA 3ELKA 1Z91A 4HBLA 3WODF 3J81Z 1X3UA 5DV5A 1U2WA 3EYIA 4OIPF 1BC7C 2IW5A 4ZZLA 1KA8A 5LGTA 1SFXA 3JAMK 1LNWA 4HQMA 3R6SA 4BXUA 4L0YB 1G3WA 3WTSC 2FQ3A 4RGRA 2DLLA 2BV6A 5D8LB 2O0YA 2HZTA 3GWZA 3BJ6A 1IN7A 2VOPA 2ZJ2A 2HKOA 1J0RA 2H94A 1ZLJA 3W6KB 3ZMUA 1ZRCA 3KLOA 2UWMA 1GVJA 2HEOA 2TDXA 4L9VA 1ZHFA 3E6BA 4OIOF 2IRFG 3GXOA 3BY6A 2L02A 4LLLA 4ZYEA 4A6DA 3LA7A 1ON2A 1KQ0A 1LEBA 4MTEA 4Q4ZF 2FNPA 2RVCA 3KE2A 1HKQA 2V1DA 5LHIA 1WSUA 4N0BA 1ZREA 1JHHA 3K9TA 1T98A 2VT2A 4QWQA 2H27A 2F5FA 1XB4A 2F5DA 5HLHA 3IRRA 5BS6A 2M1BA 1GXQA 1YW9A 2H6CA 1QPMA 4PZJA 3DKWA 1O7LA 2VT3A 4UVCA 5L3CA 4A5NA 1B6AA 4FX4A 1QBJA 2HQNA 3K69A 1SAXA 4CXFA 3FZVA 1HKSA 3Q9VA 1XMKA 3ZMVA 4TV7A 4AVPA 4HF2A 4KICA 4I2OA 1ZG1A 1FC3A 6PAXA 2EA2A 1FZPB 3RDIA 5HLGA 2K86A 4CO8A 1RUOA 5FB2A 3RKWA 1I1GA 4LJZF 1IXRC 2STWA 4MEYF 3BP8A 2FBIA 3COAC 2EV6A 2F5EA 4YFNF 1ZRDA 3KP4A 2Q0OA 1ZG5A 1FLIA 1H9GA 1Z7UA 5JI6A 3MZYA 2MLKA 2XAHA 2FXAA 3H92A 2V79A 3WTVC 2QVOA 1VTNC 2PLYA 1D5VA 2RQPA 4ZH4F 1FBQA 2IA1A 1FP1D 2YR2A 2VXZA 1K78B 2QM3A 3FX3A 2UXNA 1JGSA 4L5JA 1K78A 4HDUA 3L9FA 4I0AA 4HV5A 3O6BB 3H3ZA 3QP5A 2NNNA 3WTUC 1V4RA 2FMYA 3JAMZ 5DEQA 3TGNA 1CGPA 3PFIA 1MDMB 2YU3A 1MDMA 4BHPA 3DEUA 1OKRA 4AIJA 3GX4X 4P55A 5FFZA 1D3YA 3I53A 4LB6B 4FHTA 2QYOA 4I01A 2LNBA 2RDPA 3EETA 3L2CA 4OIRF 1XSDA 1FOKA 2LKPA 3RYRA 2ZMEB 4A0ZA 2FBHA 3DPLC 4D0PA 2ZMEA 4JK1X 4G7HF 2GXBA 1ZGAA 4RGSA 2PFBA 2XUBA 2DK8A 1A04A 1FP2A 3GUDA 4UV8A 4GYGA 2E1NA 5CVRA 3PQJA 4FX0A 1U3EM 3NRVA 3IWZA 1DPUA 1FWZA 2Y48A 3MFKA 2QQBA 4XRFA 3CJNA 2JZYA 1XGOA 2O8XA 4KMFA 3E6CC 4ZYGA 1BM9A 1KGSA 2ISZA 2DQRA 4U0YA 2M5WA 1E2XA 5CVVA 1HBXG 2CWEA 2XAJA 5HOOA 2P7VB 3K1MA 2IT0A 2QBYB 3BOQA 2QBYA 5H6RA 3DP7A 3WTZA 3D5LA 2WC2A 3F8FA 2YPRA 4PDKA 4ESJA 5D6FA 1MJAA 3FMRA 2ZBKA 1WI9A 2CW0F 2GAUA 4G7ZF 2MH9A 4Y15A 2G9WA 2BYVE 2CSOA 1MJBA 2A3SA 1R22A 2IPQX 4IXAA 3TOBA 3GYHX 4AWXB 1UHWA 3M1EA 3QU3A 2JPBA 1D8JA 1LDKB 4Y13A 1T38A 3DXJF 3T8RA 3R61A 2HQRA 1BBYA 5ICGA 4NB5A 1RIOH 4CICA 4ON0A 3J81K 1S8NA 2STTA 3IKVA 1T2KA 5KVRA 2VBWA 5A2QK 4HW0A 3TQNA 3HYIA 1IN6A 1IN4A 4YG2F 1P2FA 4CYDA 2RN7A 5TRDA 3WTXC 2O6GE 4MGRA 2DI3A 2R7DA 2ZCWA 4IHTA 3LQRA 2M8EA 4HQEA 5HS7A 4L5IA 2MC3A 5K5RA 4LK0F 4BNCA 2D1VA 3HOSA 3G3ZA 3V4GA 3NEUA 2UXXA 2WTEA 1MZBA 1BIBA 4XLPF 4RB0A 4YFXF 4HZFA 4G6DA 5DUKA 1BJAA 1W4MA 3TKYA 1TTYA 3U1DA 4ETSA 4ESFA 4IRGA 1L0OC 3I4PA 1I5ZA 4ESBA 4M9XA 1FY7A 1LDJA 1AOYA 3V7SA 4BYYA 5CVIA 2Z33A 4HF1A 1K6OA 3MZHA 3RPUA 1XN7A 3RPQA 2P5VA 3P9KA 1C0WA 5AONA 2W85A 4EM1A 1SD5A 1GXPA 2P5LC 5EEGA 2OBPA 5AIPA 2KIMA 1SMTA 2WWYA 4ENJA 4CGZA 4ZYDA 1QO0D 3HSRA 3RKXA 2QQ9A 3I58A 4RS8A 2YX7A 1USTA 3FM5A 4M6XA 1Z6RA 2C6YA 4UXNA 3V7RA 1IF1A 4ZZDA 3CUQB 5D5WB 1H0MA 5ICEA 2M45A 2GQQA 5D5XB 5DYMA 1F1ZA 1OMIA 2LDUA 3R60A 1OYYA 4RGXA 3FXUA 1T0FA 3DFGA 5LEJA 3KP6A 2PMUA 3GZ6A 1KYWA 2KJBA 3I5UA 1Z6TA 4R79A 4M71A 2BBYA 4WX9A 5JR3A 5LHHA 2E1CA 3J7AO 1FX7A 2FU4A 4EJWA 5JVTA 2V6CA 4LFUA 3V8JA 1G3SA 2CGPA 1UCRA 5E8IA 2YX4A 2ETHA 3RI4A 3MAJA 4YIFA 2L54A 3FHZA 1YFHA 3T5XA 2HFHA 4EVIA 1FPQA 2DT5A 5A2QZ 1USSA 2EFPA 2D1HA 2P6SA 4RGUA 5BMZA 3LWFA 1DUXC 2IP2A 4M9SA 5CYVA 1UB9A 3QU6A 3IWFA 3EQLF 2W57A 2QUFA 3WTTC 2P7CB 1QZYA 4NQWA 4WK8F 3BPVA 4WCGA 2ADUA 4BHBA 2R7FA 1TW2A 2PJPA 2A69F 3ECOA 4NHJA 2VOOA 3JW4A 1J2XA 2NS0A 1OR7A 2OZ6A 3TDUC 1ZN2A 3KFWX 1SMYF 4EGYA 3ABUA 2OQGA 1YG2A 2O61A 1BN5A 5D6EA 5E1XA 3ERED 2V9VA 4HA8A 5EEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WE3 A;  4EMS A;  2E7X A;  3V7C A;  4JQF A;  3ABT A;  1RZ4 A;  4E70 A;  1B9N A;  4EV0 A;  1JXS A;  1MJ9 A;  2L3D A;  1V3F A;  1R36 A;  2O3F A;  4MQV A;  2PN6 A;  1KYZ A;  4MHG A;  1IAW A;  1O3S A;  4WXH A;  4I7H A;  5DD4 A;  2BE5 F;  3C18 A;  4QLC U;  5DCM B;  1ZAR A;  2K4J A;  2EFQ A;  4IVN A;  4OOI A;  5DCM A;  2EB7 A;  2EV5 A;  5F1R A;  4O3M A;  5L3E A;  2FNA A;  1G6N A;  3E5Q A;  3SHF A;  4OU0 A;  3HRT A;  2ZNY A;  2Q2E A;  1YS6 A;  2ACJ A;  3R4K A;  1MGT A;  1I27 A;  4UNO A;  5DD8 A;  2PG4 A;  1I6X A;  5H20 A;  5L3F A;  1XD7 A;  2R3S A;  1QGP A;  2XAQ A;  5FFX A;  3HUG A;  2XAF A;  2FML A;  4G6Q A;  3M8E A;  4HX8 A;  3ZMD A;  1XGN A;  1QNT A;  2LF8 A;  4M74 A;  4AIK A;  5E1Z B;  4BQA A;  2OA4 A;  3ZMT A;  2MBF A;  2JSC A;  4G8X A;  1ZGJ A;  4B8X A;  3LQQ A;  4RB2 C;  1XDU A;  2P5K A;  1YTY A;  3ROU A;  3CDH A;  1STZ A;  4EJT A;  5JFR A;  2HDC A;  3HSF A;  4GYI A;  1B4A A;  1O3T A;  5ILU A;  1L3L A;  3HHG A;  2HTJ A;  2XKO A;  3VB2 A;  2B0L A;  1J75 A;  3ZN1 A;  5CJ9 A;  3EUH A;  3RKY A;  2PI0 A;  3F6O A;  1PDN C;  2GA2 A;  5LBQ A;  4UHT A;  3QRF F;  4Z2Y A;  5LRS A;  2W25 A;  4R8H A;  5DDG A;  1W5S A;  4KA4 A;  2X0L A;  2MLG A;  1ZAO A;  2M30 A;  3KP7 A;  2DFI A;  3QOP A;  2VBX A;  2EK5 A;  3MEX A;  2KKO A;  2ESH A;  5KK1 A;  2EJR A;  3R0J A;  4LLN A;  3ML6 A;  3I54 A;  3BPX A;  2QQA A;  1RI7 A;  2PEX A;  4UV9 A;  2LSO A;  1YIO A;  2X4H A;  3C3W A;  5LLQ A;  2DTR A;  2ESN A;  2L4A A;  3GFI A;  4KMU X;  2ELH A;  3ISP A;  2XRN A;  4I02 A;  1DP7 P;  1FYM A;  5L3D A;  4N9H A;  1CF7 B;  1WRJ A;  3H3U A;  1CF7 A;  4PGH A;  3K0L A;  5HDG A;  4GGG A;  1WQ2 A;  2DW4 A;  3E6M A;  2BGC A;  3HRM A;  4A0Y A;  1PUE E;  5F64 A;  2OU2 A;  2XVC A;  3VOD A;  4LK1 F;  3HRU A;  4EJV A;  2ZXJ A;  2MD5 A;  3CUO A;  2CYY A;  4KFC A;  1TQP A;  5HLI A;  5TJJ A;  4RAZ A;  4LG0 A;  1IRG A;  3LAP A;  2BEO A;  3BJO A;  4IF4 A;  4KYW A;  4S04 A;  4LLG F;  1RUN A;  2Z3Y A;  1EH6 A;  3QP6 A;  3ECH A;  1BI2 A;  5DUI A;  1I1S A;  1BI1 A;  3M7G A;  1J9I A;  3F3X A;  4HDV A;  2VC1 A;  3BJA A;  5FLX Z;  2FBK A;  2OZU A;  1KU3 A;  3ZMZ A;  3CO7 C;  1YW7 A;  1S6L A;  3REO A;  1W7P B;  2A5Y B;  4HV6 A;  1W7P A;  2FE3 A;  5D8K B;  2GXG A;  1ODD A;  4WXD A;  1SFE A;  1FYK A;  2JT1 A;  1S7A A;  4ENN A;  1U8R A;  2FF4 A;  3ZQ7 A;  5IT9 Z;  3EYY A;  4XLN F;  1UHM A;  4P96 A;  2J5O A;  5FD5 A;  1HW1 A;  1R7J A;  3FM3 A;  4KN7 X;  3CUQ C;  1K79 A;  5L3G A;  3IHU A;  2L4M A;  1F9N A;  5F6F A;  4I09 A;  1LEA A;  1R58 A;  3OOP A;  3HSE A;  3C1D A;  4WF2 A;  1SFU A;  1P92 A;  5CVJ A;  4BAY A;  2FA5 A;  2A07 F;  4JBA A;  3NQO A;  3SZT A;  3Q5F A;  2W24 A;  1P4W A;  3U2R A;  3IRQ A;  4CHU A;  4MNU A;  1MKM A;  2G7U A;  1O3Q A;  2EFN A;  3TOA A;  3GF2 A;  1FT9 A;  3LA2 A;  1FBU A;  1SD4 A;  1JHF A;  2FRH A;  1ULY A;  4H0E A;  5LHG A;  2VE9 A;  3HTU A;  5AIQ A;  2HTS A;  3CTA A;  1ON1 A;  4A2U A;  1Y0U A;  5LEK A;  3F6V A;  4YII A;  1EV7 A;  4XBF A;  2D2W A;  4ASN A;  3ZN0 A;  3KP3 A;  4CDG A;  1W5T A;  3MCZ A;  2EA4 A;  4MQ9 F;  4KUM A;  4LB5 A;  2IJL A;  3FMQ A;  2VE8 A;  1R23 A;  2A68 F;  1F5T A;  2YSR A;  3DV8 A;  1ZYR F;  1ZLK A;  3GFM A;  3KEO A;  4Q48 A;  1EH7 A;  2DQL A;  4M9Z A;  4PGG A;  2A61 A;  1SD6 A;  1WWX A;  3WGI A;  4G9Y A;  3O3K A;  1B59 A;  2K7L A;  3JSP A;  1LVA A;  2K27 A;  1TW3 A;  2XAG A;  2ZKZ A;  3HIF A;  3E6D A;  3U9G A;  2FEZ A;  2DPD A;  3AAF A;  3F23 A;  3KZZ A;  3I71 A;  2V1U A;  3BZ6 A;  3KZY A;  2HWV A;  4EGZ A;  2P8T A;  2XGX A;  2QEN A;  4L18 B;  1LDD A;  3QAH A;  4ENK A;  1XDS A;  2NYX A;  1FBS A;  3L09 A;  3CLO A;  4HLY A;  4RB1 A;  1HQC A;  3FF5 A;  4M73 A;  1AWC A;  2GWR A;  1YQA A;  2K02 A;  2F5C A;  2D45 A;  3DPT A;  1YO5 C;  1FYL A;  4KIB A;  3TDZ C;  4L9T A;  3IC7 A;  2EFW A;  4KN4 X;  1OPC A;  1KQ9 A;  3MQ0 A;  2CO5 A;  2EV0 A;  2G7H A;  5HS9 A;  2NAZ A;  1OYI A;  1G3Y A;  1U5T B;  3KEQ A;  1KU9 A;  3DQV C;  2OQR A;  1U5T A;  5HS8 A;  3P9C A;  2DO7 A;  3CO6 C;  4DQ2 A;  3IL2 A;  4XSZ F;  1IRF A;  1DDN A;  3WG9 A;  3V8K A;  4Y17 A;  5HDK A;  2RKH A;  3GEZ A;  3TO7 A;  3JTG A;  3B73 A;  5BPD A;  1G3T A;  3F8C A;  2WV0 A;  3WTW C;  1KU2 A;  2DAO A;  1XSX A;  2HGC A;  2Q8K A;  3I59 B;  3BWG A;  2DPU A;  3KCC A;  3I59 A;  3L00 A;  4F7Z A;  3T8T A;  1IXS B;  5BPI A;  4UUV A;  4N9I A;  2VON A;  3WU1 B;  2QWW A;  3VEP A;  4B09 A;  3WTY C;  4A0X A;  5ED4 A;  5FGM A;  2HYF A;  3J80 Z;  5K5O A;  3N97 A;  2MA3 A;  3SZP A;  3M8F A;  1PP7 U;  3GZ5 A;  1B1B A;  5ILV A;  1R00 A;  2HOE A;  3ZPL A;  2L01 A;  2PMH A;  4OMZ A;  1BOA A;  5E1W A;  2J5P A;  4CZZ A;  2XV4 S;  2RNJ A;  3LA3 A;  3SFZ A;  4IPA A;  1TNT A;  1QQI A;  2P4W A;  5IT3 A;  4KDP A;  3I64 A;  1TQM A;  4GCV A;  4BH9 A;  4IHS A;  5L3B A;  5FLX K;  4FT8 A;  2CG4 A;  4MTD A;  3D0S A;  1HXD A;  1KU7 A;  2VOD A;  2JRT A;  2HR3 A;  3RTR A;  4G94 A;  3K1P A;  2XRO A;  2DU9 A;  4ZYH A;  5J6X A;  2OAZ A;  1UFM A;  1ONV A;  3IKT A;  1IUY A;  4WXC A;  3KLN A;  3T1B A;  4L9J A;  3FXQ A;  4WWC A;  3P7N A;  4PCQ A;  2QLZ A;  5BQT A;  1IN8 A;  1BIA A;  4IRI A;  4M6Y A;  3S2W A;  3KP2 A;  3GO5 A;  1LB2 A;  1PP8 F;  5E17 F;  1MD0 A;  4LGW A;  5IT9 K;  4P9F A;  3G73 A;  3F72 A;  1EH8 A;  4OMY A;  2PQ8 A;  3F8B A;  2HKX A;  5LGN A;  1XGM A;  1Z9C A;  5FO5 A;  1TBX A;  2QZ8 A;  2A6E F;  1XCV A;  5ICC A;  2OD5 A;  4KIF A;  2NNY A;  2Z5U A;  5LRR A;  1T6S A;  2NRA C;  2HYG D;  1HST A;  3DF8 A;  1QZZ A;  3E3V A;  3WE2 A;  1T39 A;  2VBY A;  1DPR A;  1U78 A;  2DBB A;  5D4S A;  1P6R A;  4OIN F;  3E5U A;  3PQK A;  4LMY A;  1W7P D;  5E20 A;  3WGG A;  3B02 A;  5D5V B;  3M9A A;  1TLH B;  1TNS A;  1BC8 C;  4HX4 A;  1D8K A;  4L9N A;  1Q1H A;  1IZ1 A;  3JTH A;  1YS7 A;  1Z1D A;  2GIV A;  2H6B A;  2JPC A;  1FNN A;  4IJA A;  5HVQ C;  2Y0M A;  2XHK A;  5JHU A;  1K7A A;  3KP5 A;  2ZNZ A;  3GW2 A;  1XGS A;  1WKM A;  2ISY A;  1IW7 F;  2Z9O A;  2HS5 A;  3EDP A;  4U88 A;  3O2P E;  3RJP A;  3F8M A;  3SQN A;  5ILS A;  4G7O F;  2F2E A;  3WGH A;  1XCB A;  3V8L A;  4RAY A;  3ULQ B;  4A5M A;  5J8C A;  3C7J A;  3E97 A;  3LFK A;  4U7B A;  3GFJ A;  3HOT A;  2XKP A;  2E7W A;  2P6T A;  4I98 B;  3VOE A;  2ZO4 A;  4LG0 B;  1LQ1 A;  1OYW A;  3HHH A;  2W84 A;  4HF0 A;  3TO9 A;  1J5Y A;  2UZK A;  4HAM A;  3FXR A;  3GFL A;  2LF7 A;  3P9I A;  1R5G A;  3F8N A;  1P4X A;  4R1H A;  5E18 F;  5J8F A;  2M87 A;  4IRH A;  3I0T A;  4EM0 B;  2VC0 A;  3GLX A;  2IA0 A;  1REP C;  3F21 A;  3KET A;  4UVB A;  4Q5S F;  5E8G A;  4L0Z B;  2Y75 A;  5HDN A;  5D5U B;  4O6J A;  4U7D A;  1GHC A;  2GZW A;  1ZRF A;  4A12 A;  3TO6 A;  3VFZ A;  4KT5 C;  4OIQ F;  2AS5 F;  5H6Q A;  2CQK A;  2MH2 A;  3RYP A;  1HW2 A;  5BOX A;  3K2Z A;  3BDD A;  2KIF A;  5K5Q A;  2KRF A;  5CLS A;  2A6H F;  1H9T A;  2V1X A;  3LAJ A;  1KQ8 A;  1NHA A;  1RNL A;  3E5X A;  4BHC A;  1Z05 A;  4I0B A;  3W6J B;  2O03 A;  3SXY A;  1R1T A;  3RIR A;  1R1V A;  2RC4 A;  2ZFW A;  4EJU A;  4M72 A;  4MEX F;  2K4B A;  3ZP5 A;  1XSV A;  4A6E A;  2Z99 A;  2FOK A;  4AIH A;  1XMA A;  1O7F A;  3BRO A;  4RB3 C;  4GXO A;  1HSJ A;  2IA2 A;  2JTV A;  4HX7 A;  2VBZ A;  1O3R A;  1S3J A;  2DK5 A;  2KJC A;  1BI3 A;  1R5H A;  3GVA A;  1S7O A;  4GO1 A;  3LST A;  5DCF A;  3F22 A;  3FWE A;  2PBI A;  4P9U A;  2XIG A;  1O57 A;  1U6G A;  4S05 A;  1IN5 A;  1B9M A;  3HRS A;  1YYV A;  2EFO A;  1LJ9 A;  1ZH5 A;  3L7W A;  2RGV A;  2COM A;  5FD6 A;  1YLF A;  3Q9S A;  2XAS A;  1FSE A;  1TQI A;  1S29 A;  4HOB A;  2VN2 A;  3K1N A;  3T0Y A;  3OV8 A;  3QPT A;  1R1U A;  1ZG3 A;  4KNY A;  5LGU A;  4YFK F;  1F4K A;  3J80 K;  2CFX A;  2RV8 A;  4EQQ A;  1JE8 A;  4XSX F;  3FMS A;  4O5V A;  4EM2 A;  3JSO A;  1SD7 A;  3MWM A;  1FSH A;  1HW5 A;  3R0A A;  2IVM A;  3CUQ A;  4Q47 A;  2KIU A;  4EJO A;  4KIG A;  1BI0 A;  4U0W A;  1U5T C;  1E17 A;  2AXL A;  1HKT A;  4K2E A;  4DNC A;  4AD9 A;  4HYE A;  2FSW A;  3QPH A;  1G4D A;  3N4M A;  5K1Y A;  4U0V A;  1P4A A;  4HLX A;  5D4R A;  4UVA A;  3WU0 A;  4P5O A;  1J7K A;  2GA1 A;  3HTS B;  1YW8 A;  2H09 A;  4ENM A;  5ERI A;  2EWN A;  1IXC A;  5ICF A;  5CVU A;  4LD5 A;  1J59 A;  3ZMS A;  3ELK A;  1Z91 A;  4HBL A;  3WOD F;  3J81 Z;  1X3U A;  5DV5 A;  1U2W A;  3EYI A;  4OIP F;  1BC7 C;  2IW5 A;  4ZZL A;  1KA8 A;  5LGT A;  1SFX A;  3JAM K;  1LNW A;  4HQM A;  3R6S A;  4BXU A;  4L0Y B;  1G3W A;  3WTS C;  2FQ3 A;  4RGR A;  2DLL A;  2BV6 A;  5D8L B;  2O0Y A;  2HZT A;  3GWZ A;  3BJ6 A;  1IN7 A;  2VOP A;  2ZJ2 A;  2HKO A;  1J0R A;  2H94 A;  1ZLJ A;  3W6K B;  3ZMU A;  1ZRC A;  3KLO A;  2UWM A;  1GVJ A;  2HEO A;  2TDX A;  4L9V A;  1ZHF A;  3E6B A;  4OIO F;  2IRF G;  3GXO A;  3BY6 A;  2L02 A;  4LLL A;  4ZYE A;  4A6D A;  3LA7 A;  1ON2 A;  1KQ0 A;  1LEB A;  4MTE A;  4Q4Z F;  2FNP A;  2RVC A;  3KE2 A;  1HKQ A;  2V1D A;  5LHI A;  1WSU A;  4N0B A;  1ZRE A;  1JHH A;  3K9T A;  1T98 A;  2VT2 A;  4QWQ A;  2H27 A;  2F5F A;  1XB4 A;  2F5D A;  5HLH A;  3IRR A;  5BS6 A;  2M1B A;  1GXQ A;  1YW9 A;  2H6C A;  1QPM A;  4PZJ A;  3DKW A;  1O7L A;  2VT3 A;  4UVC A;  5L3C A;  4A5N A;  1B6A A;  4FX4 A;  1QBJ A;  2HQN A;  3K69 A;  1SAX A;  4CXF A;  3FZV A;  1HKS A;  3Q9V A;  1XMK A;  3ZMV A;  4TV7 A;  4AVP A;  4HF2 A;  4KIC A;  4I2O A;  1ZG1 A;  1FC3 A;  6PAX A;  2EA2 A;  1FZP B;  3RDI A;  5HLG A;  2K86 A;  4CO8 A;  1RUO A;  5FB2 A;  3RKW A;  1I1G A;  4LJZ F;  1IXR C;  2STW A;  4MEY F;  3BP8 A;  2FBI A;  3COA C;  2EV6 A;  2F5E A;  4YFN F;  1ZRD A;  3KP4 A;  2Q0O A;  1ZG5 A;  1FLI A;  1H9G A;  1Z7U A;  5JI6 A;  3MZY A;  2MLK A;  2XAH A;  2FXA A;  3H92 A;  2V79 A;  3WTV C;  2QVO A;  1VTN C;  2PLY A;  1D5V A;  2RQP A;  4ZH4 F;  1FBQ A;  2IA1 A;  1FP1 D;  2YR2 A;  2VXZ A;  1K78 B;  2QM3 A;  3FX3 A;  2UXN A;  1JGS A;  4L5J A;  1K78 A;  4HDU A;  3L9F A;  4I0A A;  4HV5 A;  3O6B B;  3H3Z A;  3QP5 A;  2NNN A;  3WTU C;  1V4R A;  2FMY A;  3JAM Z;  5DEQ A;  3TGN A;  1CGP A;  3PFI A;  1MDM B;  2YU3 A;  1MDM A;  4BHP A;  3DEU A;  1OKR A;  4AIJ A;  3GX4 X;  4P55 A;  5FFZ A;  1D3Y A;  3I53 A;  4LB6 B;  4FHT A;  2QYO A;  4I01 A;  2LNB A;  2RDP A;  3EET A;  3L2C A;  4OIR F;  1XSD A;  1FOK A;  2LKP A;  3RYR A;  2ZME B;  4A0Z A;  2FBH A;  3DPL C;  4D0P A;  2ZME A;  4JK1 X;  4G7H F;  2GXB A;  1ZGA A;  4RGS A;  2PFB A;  2XUB A;  2DK8 A;  1A04 A;  1FP2 A;  3GUD A;  4UV8 A;  4GYG A;  2E1N A;  5CVR A;  3PQJ A;  4FX0 A;  1U3E M;  3NRV A;  3IWZ A;  1DPU A;  1FWZ A;  2Y48 A;  3MFK A;  2QQB A;  4XRF A;  3CJN A;  2JZY A;  1XGO A;  2O8X A;  4KMF A;  3E6C C;  4ZYG A;  1BM9 A;  1KGS A;  2ISZ A;  2DQR A;  4U0Y A;  2M5W A;  1E2X A;  5CVV A;  1HBX G;  2CWE A;  2XAJ A;  5HOO A;  2P7V B;  3K1M A;  2IT0 A;  2QBY B;  3BOQ A;  2QBY A;  5H6R A;  3DP7 A;  3WTZ A;  3D5L A;  2WC2 A;  3F8F A;  2YPR A;  4PDK A;  4ESJ A;  5D6F A;  1MJA A;  3FMR A;  2ZBK A;  1WI9 A;  2CW0 F;  2GAU A;  4G7Z F;  2MH9 A;  4Y15 A;  2G9W A;  2BYV E;  2CSO A;  1MJB A;  2A3S A;  1R22 A;  2IPQ X;  4IXA A;  3TOB A;  3GYH X;  4AWX B;  1UHW A;  3M1E A;  3QU3 A;  2JPB A;  1D8J A;  1LDK B;  4Y13 A;  1T38 A;  3DXJ F;  3T8R A;  3R61 A;  2HQR A;  1BBY A;  5ICG A;  4NB5 A;  1RIO H;  4CIC A;  4ON0 A;  3J81 K;  1S8N A;  2STT A;  3IKV A;  1T2K A;  5KVR A;  2VBW A;  5A2Q K;  4HW0 A;  3TQN A;  3HYI A;  1IN6 A;  1IN4 A;  4YG2 F;  1P2F A;  4CYD A;  2RN7 A;  5TRD A;  3WTX C;  2O6G E;  4MGR A;  2DI3 A;  2R7D A;  2ZCW A;  4IHT A;  3LQR A;  2M8E A;  4HQE A;  5HS7 A;  4L5I A;  2MC3 A;  5K5R A;  4LK0 F;  4BNC A;  2D1V A;  3HOS A;  3G3Z A;  3V4G A;  3NEU A;  2UXX A;  2WTE A;  1MZB A;  1BIB A;  4XLP F;  4RB0 A;  4YFX F;  4HZF A;  4G6D A;  5DUK A;  1BJA A;  1W4M A;  3TKY A;  1TTY A;  3U1D A;  4ETS A;  4ESF A;  4IRG A;  1L0O C;  3I4P A;  1I5Z A;  4ESB A;  4M9X A;  1FY7 A;  1LDJ A;  1AOY A;  3V7S A;  4BYY A;  5CVI A;  2Z33 A;  4HF1 A;  1K6O A;  3MZH A;  3RPU A;  1XN7 A;  3RPQ A;  2P5V A;  3P9K A;  1C0W A;  5AON A;  2W85 A;  4EM1 A;  1SD5 A;  1GXP A;  2P5L C;  5EEG A;  2OBP A;  5AIP A;  2KIM A;  1SMT A;  2WWY A;  4ENJ A;  4CGZ A;  4ZYD A;  1QO0 D;  3HSR A;  3RKX A;  2QQ9 A;  3I58 A;  4RS8 A;  2YX7 A;  1UST A;  3FM5 A;  4M6X A;  1Z6R A;  2C6Y A;  4UXN A;  3V7R A;  1IF1 A;  4ZZD A;  3CUQ B;  5D5W B;  1H0M A;  5ICE A;  2M45 A;  2GQQ A;  5D5X B;  5DYM A;  1F1Z A;  1OMI A;  2LDU A;  3R60 A;  1OYY A;  4RGX A;  3FXU A;  1T0F A;  3DFG A;  5LEJ A;  3KP6 A;  2PMU A;  3GZ6 A;  1KYW A;  2KJB A;  3I5U A;  1Z6T A;  4R79 A;  4M71 A;  2BBY A;  4WX9 A;  5JR3 A;  5LHH A;  2E1C A;  3J7A O;  1FX7 A;  2FU4 A;  4EJW A;  5JVT A;  2V6C A;  4LFU A;  3V8J A;  1G3S A;  2CGP A;  1UCR A;  5E8I A;  2YX4 A;  2ETH A;  3RI4 A;  3MAJ A;  4YIF A;  2L54 A;  3FHZ A;  1YFH A;  3T5X A;  2HFH A;  4EVI A;  1FPQ A;  2DT5 A;  5A2Q Z;  1USS A;  2EFP A;  2D1H A;  2P6S A;  4RGU A;  5BMZ A;  3LWF A;  1DUX C;  2IP2 A;  4M9S A;  5CYV A;  1UB9 A;  3QU6 A;  3IWF A;  3EQL F;  2W57 A;  2QUF A;  3WTT C;  2P7C B;  1QZY A;  4NQW A;  4WK8 F;  3BPV A;  4WCG A;  2ADU A;  4BHB A;  2R7F A;  1TW2 A;  2PJP A;  2A69 F;  3ECO A;  4NHJ A;  2VOO A;  3JW4 A;  1J2X A;  2NS0 A;  1OR7 A;  2OZ6 A;  3TDU C;  1ZN2 A;  3KFW X;  1SMY F;  4EGY A;  3ABU A;  2OQG A;  1YG2 A;  2O61 A;  1BN5 A;  5D6E A;  5E1X A;  3ERE D;  2V9V A;  4HA8 A;  5EEH A; 
#chains in the Genus database with same CATH topology
 2WBM A;  3WE3 A;  2JN6 A;  2E7X A;  4EMS A;  3CF2 A;  2BW3 A;  5GTH C;  3V7C A;  1ORK A;  5CQG A;  4JQF A;  4CCL A;  3ABT A;  1WJE A;  2L9N A;  1RZ4 A;  2VKV A;  1B9N A;  3BZK A;  4E70 A;  3FHN A;  4EV0 A;  3QYF A;  3SDG A;  1GVD A;  3HGG A;  1JXS A;  1MJ9 A;  2L3D A;  4JX6 A;  2IS6 A;  1V3F A;  2KFD A;  1R36 A;  4RA2 A;  2O3F A;  3W2A A;  2WA0 A;  4MQV A;  3CJR B;  2PN6 A;  1KYZ A;  3HEF A;  4MHG A;  1IAW A;  1O3S A;  4BU2 A;  1MMG A;  2WAE A;  4E6K G;  2WV1 A;  4WXH A;  2RNG A;  4I7H A;  4ITV A;  4IQ4 A;  4PFP A;  2LK2 A;  5DD4 A;  2BE5 F;  2M0C A;  4IL6 C;  3C18 A;  2XSD C;  4QLC U;  2GOX B;  5DCM B;  1ZAR A;  2K4J A;  2EFQ A;  2DMQ A;  4IVN A;  3G1L A;  4OOI A;  4XKV A;  3OYJ A;  5DCM A;  2EB7 A;  2OV7 A;  2EV5 A;  5IP7 J;  5F1R A;  5E3O A;  1QVU A;  1I50 J;  5F04 A;  3Q0W A;  2ZXW H;  4O3M A;  4RAG A;  1PJR A;  5L3E A;  2FNA A;  1G6N A;  3E5Q A;  1Y39 A;  2EZH A;  3SHF A;  1S9H A;  2Q2E B;  4OU0 A;  2X1C A;  3HRT A;  2ZNY A;  2Q2E A;  1YS6 A;  3QWL A;  2ACJ A;  3ERM A;  2M9H A;  3K4L A;  5CQE A;  4E7I A;  2QSH X;  3R4K A;  2CV2 A;  2JA7 J;  2EIN H;  4XOP A;  1MGT A;  2JQ7 A;  3S3O A;  3HOZ J;  1I27 A;  4UNO A;  5DD8 A;  2PG4 A;  1I6X A;  1OCZ H;  3NWS A;  1ERD A;  5H20 A;  3FXL A;  5L3F A;  4BKX A;  1XD7 A;  2R3S A;  3OYH A;  3GTG J;  2F48 A;  3ZQG A;  1QGP A;  2QSG X;  2XAQ A;  2W4S A;  5FFX A;  1Z3Y A;  1QRY A;  2FML A;  2XAF A;  3HUG A;  4G6Q A;  4HG2 A;  5FRN A;  2ZME C;  3M8E A;  2ZC2 A;  1Z77 A;  4H4K C;  2VB6 A;  3JCU C;  3O8G A;  4HX8 A;  3ZMD A;  2BVM A;  4BQN A;  1XGN A;  1QNT A;  2LF8 A;  4M74 A;  2ME6 A;  2LRD A;  4AIK A;  5E1Z B;  4BQA A;  2OA4 A;  3MKW B;  3ZMT A;  2MBF A;  4A69 C;  1FMV A;  2JSC A;  3M07 A;  4E7L A;  1V5G A;  3BR6 A;  1ZGJ A;  4G8X A;  3LQQ A;  2CUE A;  4B8X A;  4RDU A;  4RB2 C;  1LFB A;  2JK3 A;  5F27 A;  1XDU A;  2P5K A;  5J47 A;  2GLO A;  2HXO A;  4IOA F;  3OWT A;  1YTY A;  3ROU A;  4A3L J;  3CDH A;  3BZC A;  2JRM A;  2KZG A;  1STZ A;  4EJT A;  4BQQ A;  1VQM I;  2BVL A;  5JFR A;  2PJR B;  2DFF A;  2HDC A;  2VQG A;  3HSF A;  1E0E A;  1OJL A;  2PJR A;  4GYI A;  1B4A A;  2LLK A;  3LSM A;  1O3T A;  5K7H A;  2OF7 A;  5ILU A;  1QA6 A;  2L9V A;  4XRS G;  2LOO A;  5B66 C;  5KAF C;  2MFZ A;  1L3L A;  3HHG A;  2HTJ A;  2XKO A;  3VB2 A;  2B0L A;  2IEK A;  3OYK A;  2MAB A;  1J75 A;  1YRN B;  3PO3 J;  1P7J A;  2K85 A;  3CLQ A;  4L5E A;  3ZN1 A;  4XL9 A;  5CJ9 A;  3I55 I;  1YRN A;  3EUH A;  3WHC A;  1OCO H;  1D1B A;  2W48 A;  3KYD B;  2CS3 A;  3RKY A;  2Y0S N;  5GAG J;  1IGN A;  2FD5 A;  2PI0 A;  3S15 J;  3F6O A;  1PDN C;  4M3B A;  2GA2 A;  5TIS C;  5LBQ A;  2E1M C;  4I6Z A;  4UHT A;  1JTX A;  1HOM A;  3HOU J;  1XS9 A;  5FRM A;  1POG A;  3QRF F;  4IQJ A;  3HB9 A;  4Z2Y A;  3PNV A;  5LRS A;  2BXZ A;  2W25 A;  4R8H A;  2V1N A;  4IO9 F;  5DDG A;  1NG6 A;  1W5S A;  2LRE A;  4KA4 A;  2X0L A;  4JOM A;  2MLG A;  4IHY A;  3HGY A;  1ZAO A;  2M30 A;  3KP7 A;  2DFI A;  3QOP A;  4F52 A;  1ZGW A;  1ETY A;  3QOE A;  2VBX A;  3K70 C;  2EK5 A;  3MEX A;  4PFO A;  3ASO H;  4P1W A;  5J1Y A;  2KKO A;  2ESH A;  3H0G J;  5KK1 A;  2EJR A;  5FKN A;  2UV1 A;  2RQQ A;  4XOT A;  3UR3 C;  4IEJ A;  4Z6Y A;  3R0J A;  2DOF A;  3CJQ B;  4LLN A;  1LPQ A;  3ML6 A;  1JUM A;  3I54 A;  2LTP A;  1APL C;  1IO2 A;  3WU2 C;  3BPX A;  2QQA A;  3DKX A;  1RI7 A;  3M8J A;  2PEX A;  4UV9 A;  3UKG A;  1K4T A;  2LSO A;  1YIO A;  2X4H A;  3C3W A;  5LLQ A;  2HPM A;  3LSH A;  4HNU A;  3ZQQ A;  2HQ5 A;  2K3F A;  2DTR A;  2ESN A;  3I4N J;  2L4A A;  2X6W A;  3GFI A;  1WGX A;  3KYC B;  4BE2 A;  3G1M A;  1N25 A;  4KMU X;  2E34 A;  2ELH A;  2OUM A;  2ZSH B;  1ETO A;  4U87 A;  3ISP A;  4RLQ A;  2XRN A;  4F91 B;  4I02 A;  1DGW Y;  1DP7 P;  3JRI A;  1DQU A;  1JT6 A;  3G2B A;  1JJ8 C;  1FYM A;  2OTL I;  5L3D A;  4N9H A;  1CF7 B;  3LSG A;  2DCE A;  1WRJ A;  2NVT J;  3H3U A;  1CF7 A;  4PGH A;  3K0L A;  5HDG A;  4GGG A;  1WQ2 A;  5M5X J;  2QQ8 A;  1MBK A;  2DW4 A;  3GBG A;  2XC7 A;  3E6M A;  2BGC A;  2L0K A;  3HRM A;  4A0Y A;  2NS7 A;  3LSR A;  5JVG F;  1PUE E;  4GRI A;  5F64 A;  2UUZ A;  2QKL B;  1DU0 A;  1SEU A;  2JUC A;  2OU2 A;  2XVC A;  5EDN A;  3VOD A;  2GXA A;  2ZXI A;  4LK1 F;  3HRU A;  4EJV A;  2ZXJ A;  2MD5 A;  3CUO A;  2CYY A;  4KFC A;  1TQP A;  1X2N A;  1X1C A;  5HLI A;  3BG6 A;  5TJJ A;  3K4C A;  2I10 A;  3M1C A;  2A05 A;  4GDF A;  3HOW J;  2VKE A;  2BY0 A;  4RAZ A;  3PL8 A;  3LNQ A;  4LG0 A;  1IRG A;  3LAP A;  1WI3 A;  2BEO A;  3BJO A;  4FIS A;  1D0Z A;  4IF4 A;  3CES A;  4B4C A;  2WB1 A;  5E3N A;  4MLO A;  3FBN B;  4I76 A;  4KYW A;  3BR3 A;  3HDD A;  4S04 A;  4LLG F;  4E7J A;  1RUN A;  2Z3Y A;  1EH6 A;  2YUS A;  3ECH A;  1BI2 A;  3QP6 A;  5DUI A;  3GTJ J;  4UUT A;  1BI1 A;  3CF5 F;  1ZR4 A;  1I1S A;  3M7G A;  1JGG A;  1J9I A;  1U9N A;  3F3X A;  4HDV A;  2VC1 A;  2CV1 A;  1MND A;  3SJM A;  2LY9 A;  1A35 A;  4CCM A;  1P9Q C;  3BJA A;  5FLX Z;  2FBK A;  4PJN A;  2OZU A;  3K4N A;  1KU3 A;  3ZMZ A;  2HXI A;  4PJL A;  3GLL A;  4ANJ A;  1X1D A;  3L2U A;  3F0C A;  4F3Q A;  4B47 A;  2XGE A;  3CO7 C;  1Y1W J;  1YW7 A;  2OJE D;  2O5R A;  1N78 A;  1OCT C;  1S6L A;  3REO A;  3L2W A;  4HNT A;  1W7P B;  2A5Y B;  1LKX A;  3DBH B;  2AQF A;  4HV6 A;  1W7P A;  2FE3 A;  5D8K B;  2GXG A;  4C2U A;  1ODD A;  4W1U A;  1MSF C;  4WXD A;  2H8W A;  1SFE A;  1FYK A;  2JT1 A;  1S7A A;  4ENN A;  3K6G A;  4FTH A;  1U8R A;  2FF4 A;  3ZQ7 A;  4MFD A;  1OCR H;  3HOY J;  5M5Y J;  5IT9 Z;  5IP9 J;  2DMT A;  2XB0 X;  2Y30 A;  1YX3 A;  1VQO I;  3J7Z I;  3QQA A;  4OWR B;  2VPL A;  2JWT A;  3EYY A;  4XLN F;  2PMZ N;  1UHM A;  4P96 A;  2J5O A;  2CV0 A;  5FD5 A;  2X6O A;  1HW1 A;  1R7J A;  2GOM A;  1K4S A;  2KDO A;  5C4J J;  3FM3 A;  4KN7 X;  3CUQ C;  2MW8 A;  1S72 I;  1K79 A;  5L3G A;  3IHU A;  2JA6 J;  1Q1V A;  3K2A A;  2L4M A;  1WFX A;  1F9N A;  2K5C A;  5F6F A;  3I56 I;  4XNF A;  1ETX A;  1XX5 A;  2N8G A;  4I09 A;  1LEA A;  1R58 A;  3OOP A;  3HSE A;  1ETK A;  3C1D A;  4PUS A;  4WF2 A;  2CW8 A;  1SFU A;  1P92 A;  5CVJ A;  4BAY A;  1HLV A;  2FA5 A;  2A07 F;  1SC7 A;  5F08 A;  3BG7 A;  4JBA A;  4XN3 A;  3NQO A;  3SZT A;  3Q5F A;  2W24 A;  1P4W A;  3U2R A;  1ZQ3 P;  2A6T A;  3OS0 A;  4Y33 A;  1PYV A;  3GTK J;  3IRQ A;  4CHU A;  3TBI A;  3ZCO A;  3GTO J;  5IP6 A;  2CUF A;  3G4S I;  4MNU A;  2GIZ A;  1MKM A;  2G7U A;  2KLO A;  1O3Q A;  1K6Y A;  3PFY A;  2EFN A;  1MMS A;  3TOA A;  3BG5 A;  3GF2 A;  2QSF X;  1FT9 A;  1X1B A;  3LA2 A;  1FBU A;  1SD4 A;  1YIT I;  3TW6 A;  2HVS A;  1YJN I;  4RM3 A;  1JHF A;  4KIT B;  4ZTJ A;  2FRH A;  2DT7 B;  2O8K A;  1T08 B;  4IHV A;  1ULY A;  4H0E A;  5LHG A;  3IV5 A;  2VE9 A;  1W5C C;  3HTU A;  5AIQ A;  2HTS A;  1ACI A;  1H8A C;  1Y8Q B;  2DOD A;  3QPS A;  1FOY A;  1ETV A;  2KP6 A;  3CTA A;  1ON1 A;  3O8H A;  4QPO A;  4A2U A;  1X1A A;  2DT6 A;  1Y0U A;  4BE1 A;  5LEK A;  1X3W B;  3F6V A;  1ZK8 A;  5J4V A;  3BTL A;  4B48 A;  1D0Y A;  4YII A;  1EV7 A;  4XBF A;  2D2W A;  4ASN A;  1W36 D;  3PSF A;  3ZN0 A;  3KP3 A;  4CDG A;  2VJJ A;  3D5S C;  1W5T A;  3MCZ A;  2EA4 A;  3MVP A;  4MQ9 F;  4KUM A;  4LB5 A;  2IJL A;  3FMQ A;  5IPA A;  4LIU A;  2VE8 A;  3MMY B;  5FJ8 J;  2KT0 A;  1R23 A;  3GCM A;  2LVS A;  3CP8 A;  5M3M J;  1VQ7 I;  1X58 A;  2VXD A;  1TT5 B;  2A68 F;  3BT9 A;  4ZDO A;  1F5T A;  2YSR A;  1EA3 A;  1ZYR F;  2E5Z A;  3DV8 A;  1ZLK A;  1LFU P;  3GFM A;  4BDZ A;  1FJL A;  3KEO A;  4Q48 A;  3MD2 A;  1EH7 A;  1K83 J;  2K9M A;  2VJI A;  2DQL A;  1U8B A;  4FE4 A;  4RAF A;  1RPW A;  4M9Z A;  1H89 C;  4PGG A;  5HLT A;  2A61 A;  1OCC H;  1SD6 A;  1WWX A;  3WGI A;  4FCY A;  4G9Y A;  2QKM B;  3I4M J;  3O3K A;  1B59 A;  2K7L A;  1Y0N A;  4XK4 A;  5F0H A;  3JSP A;  1LVA A;  4DBQ A;  1VQP I;  5GP9 A;  2K27 A;  1TW3 A;  3S16 J;  1X4O A;  2XAG A;  3CD6 I;  1FEX A;  2R7X A;  2ZKZ A;  3HIF A;  3E6D A;  3U9G A;  2FEZ A;  2DPD A;  3AAF A;  3F23 A;  4DBR A;  3KZZ A;  2LC2 A;  3H9J A;  2WAF A;  3I71 A;  2V1U A;  3BZ6 A;  4ZTF A;  3KZY A;  4HNV A;  1Z3X A;  2HWV A;  3B6A A;  3VSL A;  3L2R A;  4G6T B;  4EGZ A;  3ZR8 X;  4S0H B;  2P8T A;  5CKT A;  2XGX A;  1B8I B;  2QEN A;  1S7E A;  4L18 B;  1MBH A;  2H1L A;  1B8I A;  1LDD A;  3HKZ N;  3QAH A;  1MSE C;  4ENK A;  1XDS A;  2NYX A;  1FBS A;  3L09 A;  3CLO A;  3BQZ A;  3HG9 A;  4HLY A;  4A3C J;  3VPR A;  1HQC A;  3FIW A;  2ID3 A;  1ETW A;  4RB1 A;  3FF5 A;  4M73 A;  2W82 A;  2Y9Y A;  1AWC A;  2GWR A;  4NQW B;  1YQA A;  2K02 A;  2DMP A;  2F5C A;  3N05 A;  2D45 A;  1UEL B;  1XTA A;  3DPT A;  2DTZ A;  1IV8 A;  1YO5 C;  3AL0 B;  1FYL A;  2V9P A;  3FXM A;  1R5I D;  4HEA 2;  4KIB A;  3EUA A;  4L9T A;  3TDZ C;  1FTT A;  3IC7 A;  2EFW A;  4IOC F;  1YIJ I;  4KN4 X;  1OPC A;  1KQ9 A;  2OC6 A;  3MQ0 A;  3CDL A;  2CO5 A;  3ZGK A;  1RRJ A;  2EV0 A;  2G7H A;  5HS9 A;  2NAZ A;  1OYI A;  4AID A;  4BS9 A;  1G3Y A;  1E3P A;  2K3P A;  1U5T B;  2HVR A;  2IAI A;  3KEQ A;  1KU9 A;  3DQV C;  3JRH A;  2OQR A;  1U5T A;  5HS8 A;  3HC7 A;  3P9C A;  4A3D J;  1HCR A;  4II3 A;  2DO7 A;  2K40 A;  3CO6 C;  3MKZ A;  4Y52 J;  3OYF A;  4DQ2 A;  3W3C A;  1R4N B;  3IL2 A;  2EQR A;  4C2M J;  4XSZ F;  4CUG A;  3JRF A;  1W1W E;  1IRF A;  1DDN A;  3WG9 A;  3V8K A;  4PJ0 C;  4Y17 A;  5HDK A;  4C30 A;  5FLV A;  2RKH A;  3GEZ A;  3TO7 A;  3JTG A;  2JJ7 A;  3B73 A;  5BPD A;  2W00 A;  4CCO A;  2VLA A;  1G3T A;  3F8C A;  2E35 A;  2B7E A;  2NOJ B;  2WV0 A;  3WTW C;  4M3E A;  1KU2 A;  4FQG A;  3OY9 A;  3H5R A;  1TWH J;  2DAO A;  4X6A J;  1XSX A;  3A4C A;  4IZZ A;  2HGC A;  5C4X J;  2Q8K A;  3I59 B;  2EIK H;  1S5L C;  4CSW A;  3BWG A;  2DPU A;  3KCC A;  3W6V A;  3I59 A;  3L00 A;  4M3D A;  4F7Z A;  3T8T A;  2BY2 A;  3CCR I;  2LH9 A;  1IXS B;  3A0H C;  5BPI A;  4UUV A;  4N9I A;  2L5Q A;  3S1M J;  2VON A;  4B43 A;  3WU1 B;  3S3M A;  1QZE A;  2DN0 A;  4BXX J;  2QWW A;  3VEP A;  4B09 A;  2V6E A;  3WTY C;  4A0X A;  4F55 A;  3PUB A;  1YJW I;  1MNE A;  5ED4 A;  5FGM A;  4KT6 A;  2HYF A;  3J80 Z;  5K5O A;  2B63 J;  3N97 A;  9ANT A;  2MA3 A;  2CFO A;  2M8G X;  3EUH C;  1TWC J;  2TRT A;  1X1P A;  2F4O B;  3A1Y A;  4LOC A;  3SZP A;  3M8F A;  3OR2 C;  1PP7 U;  5JLW A;  2KMU A;  3GZ5 A;  1B1B A;  5ILV A;  5M3F J;  1R00 A;  4AYB N;  1BOB A;  2HOE A;  3ZPL A;  2L01 A;  2PMH A;  4XLE A;  4OMZ A;  1BOA A;  5E1W A;  1I39 A;  2J5P A;  4CZZ A;  4YIR X;  2AXT C;  4JYK A;  2XV4 S;  2DXI A;  1FIP A;  2RNJ A;  3LA3 A;  4DZP A;  3SFZ A;  3HUG B;  4BL0 B;  4A3K J;  4IPA A;  1TNT A;  2ZSI B;  1QQI A;  3LSI A;  2P4W A;  1K61 A;  5IT3 A;  1Z0X A;  4KDP A;  3I64 A;  1MMN A;  1TQM A;  2HNH A;  1UZC A;  4GCV A;  1KON A;  2MG4 A;  4BH9 A;  4B3X A;  3OYL A;  5IYD J;  4XRM A;  3DBR B;  2LP0 A;  4UB8 C;  4IHS A;  5L3B A;  3OYC A;  5FLX K;  3TW7 A;  2F5V A;  4FT8 A;  2CG4 A;  4MTD A;  2DJI A;  3D0S A;  3C2B A;  1HXD A;  1KU7 A;  2VOD A;  2JRT A;  3A2K A;  4YEL A;  2HR3 A;  3RTR A;  4G94 A;  2H8R A;  3TL4 X;  2R5Z B;  4XKC A;  3K1P A;  1MH4 A;  2BZT A;  2VL8 A;  1G2H A;  3OIQ A;  2XRO A;  2R5Z A;  2DU9 A;  2BOL A;  3QOD A;  4ZYH A;  5J6X A;  5F0F A;  2OAZ A;  1UFM A;  3CP2 A;  2TCT A;  4RMN A;  3OYE A;  3OYA A;  2I8D A;  1ONV A;  3OOU A;  3IKT A;  2CU7 A;  1IUY A;  4NNJ A;  4WXC A;  3KLN A;  2P81 A;  4D9J A;  4JX5 A;  3T1B A;  4L9J A;  1VQN I;  3FXQ A;  4WWC A;  3P7N A;  4PCQ A;  2QLZ A;  5BQT A;  1IN8 A;  1A5J A;  1BIA A;  3FBI B;  5EYR A;  2L9R A;  2X9D A;  1WJA A;  1IC8 A;  4IRI A;  4M6Y A;  3S2W A;  3KP2 A;  3GO5 A;  4Y3O A;  3V42 A;  1LB2 A;  4E7K A;  2ECC A;  1PP8 F;  4XLF A;  5E17 F;  1MD0 A;  3NWT A;  4LGW A;  3WHB A;  2DDA A;  5IT9 K;  4CYC B;  4P9F A;  3G73 A;  3F72 A;  1EH8 A;  4OMY A;  2PQ8 A;  3F8B A;  4CYC A;  2HI3 A;  1UJ8 A;  2LFB A;  2HKX A;  5LGN A;  2CUZ A;  4PJM A;  1XGM A;  1Z9C A;  1T8I A;  3VYR B;  5F0C A;  3UNG C;  5FO5 A;  1TBX A;  2VJ5 A;  2QZ8 A;  2A6E F;  4ZJZ A;  1XCV A;  1JKR C;  5EJC A;  5ICC A;  3BC8 A;  3DWL E;  1WJD A;  3OIP A;  2OD5 A;  4KIF A;  2NNY A;  2Z5U A;  5LRR A;  1P7I A;  1T6S A;  2NRA C;  2HYG D;  2L9S A;  3H0D A;  1UMQ A;  1HST A;  1VI0 A;  3DF8 A;  1GT0 C;  2O7O A;  5K7F A;  1QZZ A;  3E3V A;  3WE2 A;  1T39 A;  2VBY A;  1DPR A;  1U78 A;  2DBB A;  1B72 B;  5D4S A;  3IH3 A;  1P6R A;  4OIN F;  3E5U A;  3PQK A;  4LMY A;  1W7P D;  5E20 A;  1SVM A;  1B72 A;  3WGG A;  1OLT A;  1SVO A;  3JRD A;  3B02 A;  2HQA A;  2DFE A;  2E19 A;  2KZV A;  2M2E A;  2XGD A;  5D5V B;  3M9A A;  4A3M J;  1TLH B;  1TNS A;  4XLH A;  4DGW B;  4CA0 A;  2DMU A;  1EKE A;  3G6E I;  4HX4 A;  3G71 I;  1BC8 C;  1D8K A;  4L9N A;  1Q1H A;  1IZ1 A;  3JTH A;  3L2Q A;  1YS7 A;  1Z1D A;  2GIV A;  2H6B A;  2JPC A;  1FNN A;  4IJA A;  2JVG A;  1HF0 A;  5HVQ C;  2Y0M A;  2ECB A;  2XHK A;  2LG4 A;  5JHU A;  4PSW A;  4V2F A;  5LD2 C;  1K7A A;  3KP5 A;  2ZNZ A;  1TWF J;  3GW2 A;  1XGS A;  2YS9 A;  1WKM A;  2ISY A;  1IDY A;  1RES A;  4JP0 A;  3RZO J;  3DTK A;  1IW7 F;  2EPF A;  2BY3 A;  2Z9O A;  3DEE A;  1AHD P;  1MMA A;  3ZXS A;  1LFP A;  1F36 A;  4D5C A;  2X1E A;  2E1O A;  4DIQ A;  1JT0 A;  2HS5 A;  3MKY B;  3EDP A;  4U88 A;  3QPL A;  5H2F C;  3HBL A;  3O2P E;  3RJP A;  3F8M A;  4PK4 A;  3LMM A;  2LY1 A;  3SQN A;  2MC4 A;  5ILS A;  4G7O F;  2F2E A;  3WGH A;  4E4H A;  2JA5 J;  3IH2 A;  1XCB A;  5HNF A;  3V8L A;  4RAY A;  3BTC A;  3PIP F;  3ULQ B;  3DBL B;  1VND A;  4A5M A;  5J8C A;  2NS8 A;  2CJJ A;  1VFC A;  3VYU B;  3C7J A;  3E97 A;  3LFK A;  3S14 J;  4U7B A;  1A6I A;  2M3A A;  1JJ6 C;  3K4B A;  3GFJ A;  1I6H J;  3HOT A;  2XKP A;  2E7W A;  2P6T A;  2V4J C;  3A01 B;  4I98 B;  4Y7N J;  3VOE A;  2ZO4 A;  4LG0 B;  1LQ1 A;  1OYW A;  2R7O A;  3AG3 H;  3HHH A;  3A01 A;  3PUF A;  2W84 A;  4HF0 A;  3TO9 A;  1X3Z B;  1J5Y A;  2BXY A;  2UZK A;  2KDZ A;  4HAM A;  4MO7 A;  2QCO A;  3FXR A;  3GFL A;  2LF7 A;  3P9I A;  3CME I;  1R5G A;  1BA5 A;  3F8N A;  1P4X A;  3BCA A;  4R1H A;  5E18 F;  4BBS J;  3AG4 H;  5J8F A;  3D1N I;  3OS1 A;  2VQC A;  4CH7 A;  1XC5 A;  2M87 A;  4IRH A;  1VQL I;  2JA2 A;  3I0T A;  2ELJ A;  4EM0 B;  2VC0 A;  2I5U A;  3VWB A;  3GLX A;  5KAI C;  1OIS A;  4V2G A;  2IA0 A;  1REP C;  3BCB A;  2DOA A;  1M1E B;  3F21 A;  3NAU A;  3KET A;  3P5J A;  4BUP A;  4BY7 J;  4UVB A;  4RBO A;  2WB1 N;  3BR0 A;  2E2I J;  4Q5S F;  5E8G A;  5E79 C;  1SFO J;  2NVY J;  4XMY A;  4L0Z B;  1X4P A;  4KJZ A;  4XRS A;  3PSI A;  4G12 A;  2L7M P;  2JMW A;  2Y75 A;  2V9K A;  5HDN A;  3I9V 2;  4O6J A;  5D5U B;  4U7D A;  1GHC A;  4BXF A;  2GZW A;  2R4G A;  2WAQ A;  1ZRF A;  4A12 A;  2G0E A;  3TO6 A;  4DW6 A;  3QYB A;  2Y69 H;  4PSX A;  3VFZ A;  4KT5 C;  4BQO A;  4OIQ F;  2AS5 F;  5H6Q A;  2DA1 A;  2OPT A;  2CQK A;  1JI8 A;  2O9L A;  1IDZ A;  2MH2 A;  2X51 A;  3RYP A;  1HW2 A;  5BOX A;  3K2Z A;  3BDD A;  2KIF A;  5K5Q A;  4BAC A;  2KRF A;  5CLS A;  3TP3 A;  1HA8 A;  2A6H F;  2HYJ A;  2EIL H;  1H9T A;  2V1X A;  2V26 A;  1RET A;  3ABL H;  3LAJ A;  2FJ1 A;  1NHA A;  1RNL A;  3S32 A;  1KQ8 A;  3KEY A;  3E5X A;  4BHC A;  1Z05 A;  4HST A;  1ZEL A;  4I0B A;  3W6J B;  2O03 A;  3SXY A;  1HDP A;  1R1T A;  3RIR A;  1R1V A;  1MBG A;  2RC4 A;  2ZFW A;  4EJU A;  1HC8 A;  1QVT A;  1T95 A;  2BY1 A;  3TMO A;  3K4K A;  3DTI A;  4M72 A;  4MEX F;  1X2M A;  2K4B A;  3ZP5 A;  3K10 A;  1XSV A;  2VKD A;  4A6E A;  3GTM J;  2R7Q A;  2Z99 A;  2FOK A;  3OYM A;  1W0U A;  2OTJ I;  2LKS A;  1T0F C;  4AIH A;  4QIW N;  1XMA A;  5M5W J;  1O7F A;  3BRO A;  3C2G A;  4RB3 C;  4GXO A;  1HSJ A;  2IA2 A;  2JTV A;  1TWG J;  2KQR A;  2EBI A;  4HX7 A;  3OSF A;  3K4M A;  3U1K A;  2VBZ A;  3CCQ I;  1A31 A;  3SFI A;  2QA4 I;  2E36 A;  1O3R A;  1AKH B;  4V19 K;  1S3J A;  2DK5 A;  4DOZ A;  2KJC A;  1BI3 A;  2L7F P;  1AKH A;  1R5H A;  3GVA A;  1NK2 P;  1S7O A;  1R71 A;  4GO1 A;  2XF5 A;  3LST A;  2ICW G;  4NC8 A;  4J19 A;  4C3J J;  3ASN H;  5EEA A;  1G59 A;  1UG0 A;  5DCF A;  3ZOB A;  3F22 A;  3FWE A;  3FXJ A;  2PBI A;  4D7N A;  3CMM A;  5KCM A;  4P9U A;  2XIG A;  1O57 A;  1U6G A;  4S05 A;  1IN5 A;  1B9M A;  3HRS A;  1YYV A;  1LUJ B;  2XF6 A;  2EFO A;  1LJ9 A;  1ZH5 A;  3Q0V A;  3S1N J;  1R6R A;  3L7W A;  2RGV A;  3RQI A;  2COM A;  3I3L A;  1V54 H;  3PNY A;  4AU7 A;  5FD6 A;  1YLF A;  3Q9S A;  2XAS A;  3CC4 I;  1FSE A;  2RAE A;  3OR1 C;  1FOW A;  3IAS 2;  1TQI A;  4XLA A;  1S29 A;  2Z1D A;  4HOB A;  4OAZ A;  2VN2 A;  3K1N A;  3RSN A;  3T0Y A;  3OV8 A;  3QYE A;  3OL4 A;  3QPT A;  4AVZ A;  3PIO F;  1R1U A;  2XPU A;  3Q0U A;  2E2J J;  1ZG3 A;  2CQ7 A;  4KNY A;  1FTZ A;  5LGU A;  4YFK F;  4ZDP A;  3RQ4 A;  1F4K A;  4PJJ A;  4E7Z A;  3J80 K;  2CFX A;  2RV8 A;  4AM3 A;  4EQQ A;  4XON A;  2EIM H;  5FLM J;  3CC2 I;  4B3A A;  1JE8 A;  4XSX F;  3FMS A;  1W0T A;  4O5V A;  2M4G A;  2MD0 A;  4DZJ A;  4HRI A;  2QF7 A;  4EM2 A;  1MW7 A;  2R7Z J;  4XM3 A;  3JSO A;  4XLC A;  3AL0 C;  1SD7 A;  3MWM A;  2M4K A;  1HW5 A;  1FSH A;  3R0A A;  1JKP C;  1D0X A;  3CCM I;  2WY8 Q;  5IYC J;  2DYS H;  4A3B J;  3U21 A;  2IVM A;  3CUQ A;  4Q47 A;  3VYS B;  4CCJ A;  1D1A A;  2EH3 A;  2KIU A;  1VQ5 I;  3HPG A;  1OR7 C;  4LIV A;  4EJO A;  4KIG A;  4ZYA A;  4BY1 J;  1WJ5 A;  1BI0 A;  4U0W A;  1U5T C;  1E17 A;  2AXL A;  1WCM J;  3BG3 A;  1NTC A;  4K2E A;  4ZC3 A;  4AD9 A;  4HYE A;  4DNC A;  1HKT A;  2FSW A;  3QPH A;  2CH0 A;  1O4X A;  1G4D A;  3N4M A;  2DOE A;  5K1Y A;  4U0V A;  1P4A A;  1QHH D;  4HLX A;  5D4R A;  3JR9 A;  4UVA A;  1IUF A;  2ELK A;  3WU0 A;  2R7U A;  4ZDL A;  4P5O A;  1E3O C;  1J7K A;  2GA1 A;  1AU7 A;  3DKY A;  4NBQ A;  1W36 C;  3HTS B;  2BHY A;  1YW8 A;  2H09 A;  3BTJ A;  4ENM A;  2DA7 A;  3RCO A;  3FKJ A;  3AFH A;  3W2V A;  5ERI A;  1BW6 A;  3OL3 A;  4D5F A;  2FOW A;  1E3H A;  3SYT A;  1RKT A;  2EWN A;  1VQ9 I;  1IXC A;  2B9S A;  3HKZ A;  4XKB A;  5ICF A;  4XID A;  5CVU A;  4LD5 A;  1J59 A;  3ZMS A;  4DJA A;  3ELK A;  1Z91 A;  4IX7 A;  4HBL A;  5DS9 A;  4BE0 A;  2KIS A;  2AHQ A;  1BR1 A;  3WOD F;  3J81 Z;  3JRG A;  1X3U A;  1IG7 A;  3AG1 H;  5DV5 A;  1U2W A;  3EYI A;  3BQY A;  4EEF G;  2ZB9 A;  4OIP F;  1FOX A;  1BC7 C;  2VQL A;  2IW5 A;  1IRZ A;  4ZZL A;  1KA8 A;  5LGT A;  3OIO A;  1SFX A;  3JAM K;  1LNW A;  2R7T A;  5CPR B;  3CMA I;  3CCV I;  2GM4 A;  4HQM A;  3R6S A;  1SVL A;  4BXU A;  2DFH A;  4L0Y B;  1G3W A;  2AQE A;  2FQ3 A;  2KPM A;  2VJ4 A;  4NC6 A;  3WTS C;  2FQ4 A;  3HZJ A;  4RGR A;  2DLL A;  2BV6 A;  4J00 A;  5D8L B;  2O0Y A;  2DA5 A;  2HZT A;  3H1C A;  1R49 A;  3GWZ A;  3BJ6 A;  4DYC A;  4CZC A;  3K4J A;  1IN7 A;  3DU5 A;  3PNT A;  4UB6 C;  2ZJ2 A;  2VOP A;  2HKO A;  3BTI A;  1J0R A;  4LG3 A;  2H94 A;  1UAA A;  3OSG A;  2XDV A;  2K9L A;  4BJ6 C;  2M7A A;  2IGO A;  5FKM A;  1ZLJ A;  3W6K B;  3ZMU A;  1ZRC A;  3FKI J;  3OYD A;  3IAM 2;  3KLO A;  2UWM A;  1GVJ A;  2HEO A;  1FIA A;  2TDX A;  4L9V A;  1ZHF A;  3E6B A;  4CCN A;  4OIO F;  1WPK A;  3DCF A;  2IRF G;  3GXO A;  3BY6 A;  1SAN A;  2L02 A;  4LLL A;  2R7R A;  4ZYE A;  4M6V A;  4A6D A;  3L1P A;  3LA7 A;  4BJT A;  3H9Q A;  1ON2 A;  1KQ0 A;  4YEJ A;  4UY8 I;  2R5Y B;  3EPZ A;  1LEB A;  4MTE A;  2Z2S B;  4Q4Z F;  2BHZ A;  1YJ9 I;  2FNP A;  2RVC A;  3KE2 A;  2R5Y A;  3E7L A;  3E0J B;  3H36 A;  1VQK I;  1GUU A;  1HKQ A;  5DM6 F;  2V1D A;  1EJ9 A;  5LHI A;  1WJB A;  1H88 C;  1WSU A;  4N0B A;  1ZRE A;  4C9Y A;  1JHH A;  4DYQ A;  3K9T A;  1MNM C;  5EF6 A;  1RC9 A;  3PO2 J;  3TED A;  1T98 A;  2VT2 A;  4QWQ A;  2H27 A;  1ENH A;  1XB4 A;  2F5F A;  2F5D A;  3CCY A;  2P0W A;  3GME A;  5HLH A;  3IRR A;  3X2Q H;  2CQQ A;  3CQZ J;  2LMD A;  2Z16 A;  2NOG A;  1MBE A;  5BS6 A;  2M1B A;  2AO9 A;  1GXQ A;  1YW9 A;  4BBR J;  2H6C A;  2KHM A;  1QPM A;  2V7F A;  2X85 A;  2YU9 J;  3JRE A;  3HOV J;  3BR1 A;  4PZJ A;  3DKW A;  1O7L A;  1MMD A;  1RKW A;  2VT3 A;  3A02 A;  4UVC A;  4A3G J;  3DEW A;  5L3C A;  3FK7 A;  2M34 A;  1J09 A;  1PVE A;  4A5N A;  1B6A A;  4FX4 A;  2F6C A;  1WHU A;  2HQN A;  3K69 A;  4M3F A;  1SAX A;  1QBJ A;  4CXF A;  3FZV A;  1HKS A;  4MFE A;  3Q9V A;  3AKZ A;  1VF9 A;  1XMK A;  3ZMV A;  4AYB A;  3LFU A;  2LR8 A;  4TV7 A;  1Y56 A;  1YI2 I;  4AVP A;  2JUG A;  3H5A A;  4DYR A;  2K9S A;  2M7B A;  5JLX A;  4HF2 A;  4KIC A;  4I2O A;  1ZG1 A;  3E1S A;  1FC3 A;  3NAR A;  2R7S A;  6PAX A;  2EA2 A;  1FZP B;  3RDI A;  4BGD A;  5HLG A;  2K86 A;  4CO8 A;  1XPX A;  1RUO A;  4AUX A;  3ABM H;  5FB2 A;  4XN0 A;  3RKW A;  2DYR H;  1I1G A;  4LJZ F;  1IXR C;  2STW A;  2XRL A;  2R7V A;  4MEY F;  3BP8 A;  1ETQ A;  2FBI A;  4A3J J;  2MSY A;  3COA C;  2EV6 A;  2COB A;  2F5E A;  5EGO B;  4YFN F;  3LSJ A;  1ZRD A;  4KIS A;  3KP4 A;  2VIX A;  1ZTR A;  5EGO A;  2Q0O A;  5IY5 H;  1VQ4 I;  3ZQH A;  4FET A;  2KRH A;  1ZG5 A;  5FKL A;  3SEZ A;  1FLI A;  1H9G A;  1Z7U A;  5JI6 A;  3MZY A;  2MLK A;  2XAH A;  2FXA A;  3H92 A;  4FE7 A;  1QHG A;  3CCJ I;  2V79 A;  3WTV C;  5GPC A;  2QVO A;  2PX9 A;  4QPQ A;  4XQF A;  1VTN C;  2PLY A;  1D5V A;  3Q3S A;  2RQP A;  4W97 A;  2K9N A;  1FBQ A;  4ZH4 F;  2IA1 A;  1FP1 D;  2JSP A;  2Q1Z B;  4RM2 A;  2YR2 A;  2ZXH A;  2VXZ A;  1XG1 A;  3H5N A;  3ZQI A;  1K78 B;  2QM3 A;  3FX3 A;  2UXN A;  3ZQC A;  1JGS A;  1TC3 C;  1G8X A;  4L5J A;  1K78 A;  3CCS I;  5KHD A;  4HDU A;  1IV6 A;  5J4Y A;  2VAS A;  1Z67 A;  3L9F A;  4I0A A;  2Y0S A;  4HV5 A;  5GTI C;  3O6B B;  3H3Z A;  5GAE J;  5B3S H;  1R4M B;  2KL4 A;  3QP5 A;  2NNN A;  3WTU C;  1V4R A;  2FMY A;  3JRA A;  3LSK A;  5DEQ A;  3JAM Z;  3K70 D;  3TGN A;  1CGP A;  4F93 B;  1I3A A;  1YX5 A;  3PFI A;  1MDM B;  2YU3 A;  3OMY A;  4XR6 A;  2LKX A;  1NG7 A;  2IBD A;  3S17 J;  5TGT A;  2R92 J;  4C3H J;  1MDM A;  4BHP A;  1Y6I A;  2GBY A;  3KX2 A;  2OCC H;  3S2H J;  3KZI C;  1ZR2 A;  3DEU A;  1OKR A;  2VUM J;  4AIJ A;  3ZQL A;  1BJZ A;  2DA2 A;  2JVH A;  3GX4 X;  4P55 A;  3IH4 A;  5FFZ A;  1D3Y A;  3I53 A;  4LB6 B;  1LE8 B;  2XF7 A;  4FHT A;  2EZL A;  2QYO A;  1LE8 A;  4I01 A;  5HNH A;  1JKQ C;  2CUJ A;  2HDW A;  2LNB A;  2RDP A;  3EET A;  3L2C A;  4OIR F;  1DGR M;  1TP4 A;  1XSD A;  1FOK A;  4NUB A;  4C2T A;  1I3Q J;  2LKP A;  2HOS A;  3B6C A;  1AA7 A;  3RYR A;  2QGU A;  2ZME B;  4A0Z A;  2FBH A;  3DPL C;  3FXK A;  4D0P A;  2NVU B;  1YOV B;  2ZME A;  4JK1 X;  3OYN A;  4G7H F;  2GXB A;  1U9O A;  3OYI A;  1ZGA A;  4RGS A;  2PFB A;  2XUB A;  2DK8 A;  1X19 A;  3A0B C;  2Y9Z A;  3HM5 A;  1A04 A;  2LY2 A;  1FP2 A;  4XKW A;  5KNL A;  3GUD A;  1QU3 A;  2E2H J;  4UV8 A;  2EIJ H;  2RRE A;  4GYG A;  3LOC A;  2E1N A;  1MIJ A;  5CVR A;  3PQJ A;  4QTR A;  2K9Q A;  2X6Y A;  4FX0 A;  1U3E M;  3NRV A;  1D1C A;  3IWZ A;  4D1Q A;  1DPU A;  1FWZ A;  3CCL I;  4IHW A;  2MGQ A;  2Y48 A;  2DA6 A;  3MFK A;  3H9G A;  3ONQ A;  3ESW B;  1XMX A;  2QQB A;  2CQX A;  1MBJ A;  1SAU A;  5EZH A;  3CMY A;  4XRF A;  3CJN A;  2JZY A;  1XGO A;  2O8X A;  1WJC A;  2HOT A;  4KMF A;  4CCK A;  5B1B H;  3E6C C;  4ZYG A;  1BM9 A;  1KGS A;  2VPR A;  2ISZ A;  2DQR A;  3A03 A;  5F1J A;  2M5W A;  4U0Y A;  1JUP A;  1E2X A;  2X6X A;  3GZN B;  5CVV A;  1HBX G;  2CWE A;  2XAJ A;  4NC7 A;  4Y4R A;  5HOO A;  2P7V B;  1A36 A;  1T56 A;  3K1M A;  2E1M B;  1FMW A;  2IT0 A;  4E7H A;  2QBY B;  3BOQ A;  2CMP A;  2QBY A;  2IXS A;  5H6R A;  3DP7 A;  3WTZ A;  3KIO A;  3D5L A;  1N75 A;  1Z21 A;  2E71 A;  2WC2 A;  1TWA J;  3F8F A;  2YPR A;  4PDK A;  4ESJ A;  4BJ5 C;  4N4N B;  3D5R C;  3CZ6 A;  1R9T J;  2E5N A;  2XGC A;  4X0G A;  5D6F A;  2ZJQ F;  3RPU D;  4J01 A;  1MJA A;  3FMR A;  2ZBK A;  1WI9 A;  2CW0 F;  1BR2 A;  2GAU A;  3HJE A;  4G7Z F;  3S3N A;  2MH9 A;  2Y31 A;  3BR5 A;  4Y15 A;  1F43 A;  2ZJP F;  5J1R A;  1YE9 A;  2G9W A;  2BYV E;  1OFC X;  2CSO A;  2ME0 A;  3DLL F;  3CCU I;  1MJB A;  2XAU A;  5IOY A;  3FDY A;  4B44 A;  2OCE A;  5GAD J;  2A3S A;  1R22 A;  2IPQ X;  4IXA A;  3TOB A;  1TT0 A;  3GYH X;  4AWX B;  1JUS A;  1UHW A;  3M1E A;  3QU3 A;  2JPB A;  1D8J A;  3HPH A;  1RR8 C;  1LDK B;  3MN2 A;  4Y13 A;  1N77 A;  3J7A Y;  1T38 A;  3DXJ F;  2H1K A;  2F4I A;  3T8R A;  1JKO C;  3R61 A;  4XOR A;  2HQR A;  1IRX A;  1BBY A;  5ICG A;  4NB5 A;  1RIO H;  4NDL A;  4CIC A;  4ON0 A;  4FAS D;  2DA4 A;  4I99 C;  4EAT A;  2E60 A;  3J81 K;  1S8N A;  2STT A;  3C2H A;  3IKV A;  1T2K A;  3MZ8 A;  5KVR A;  1YHQ I;  2VBW A;  5A2Q K;  2PMZ A;  4HW0 A;  3JRB A;  2W7N A;  2X1D A;  2WAQ N;  1V5E A;  1GDT A;  3TQN A;  3HYI A;  1GLN A;  1IN6 A;  1IN4 A;  4YG2 F;  3M4O J;  1P2F A;  2F4M B;  2XPV A;  4CYD A;  2RN7 A;  5TRD A;  3WTX C;  2A5W A;  1V55 H;  2O6G E;  4MGR A;  2DI3 A;  2R7D A;  2ZCW A;  5K7Z A;  3OS2 A;  2VQH A;  1IJW C;  4IHT A;  3LQR A;  2R93 J;  2M8E A;  3ZQF A;  3DPU A;  4HQE A;  1DU6 A;  2DMN A;  5HS7 A;  4L5I A;  2MC3 A;  5K5R A;  2LD5 A;  4LK0 F;  3M3Y J;  3BLY A;  4BNC A;  3F9K A;  2D1V A;  2KRC A;  4A3F J;  3HOS A;  3G3Z A;  5B1A H;  2L2O A;  3MKL A;  1MH3 A;  1Y8R B;  3V4G A;  3NEU A;  1DP3 A;  2UXX A;  2WTE A;  1MZB A;  2EZI A;  3IP4 B;  2XPW A;  1BIB A;  4XLP F;  4RB0 A;  2QEX I;  4YFX F;  4HZF A;  3HOX J;  4G6D A;  3DU6 A;  3S1Q J;  1QPI A;  1ZKG A;  2HU9 A;  4A3E J;  5JHF A;  5DTD A;  5DUK A;  3CJT B;  1UG2 A;  2VI6 A;  2KIQ A;  1BJA A;  1W4M A;  2XSJ C;  3TKY A;  5IOZ A;  3CCE I;  1V5F A;  1TTY A;  3U1D A;  4ETS A;  2EZK A;  4IRG A;  5J1U A;  4ESF A;  3FXO A;  1VQ8 I;  5EG0 B;  2VKH A;  1L0O C;  2LBF B;  3S1R J;  3I4P A;  3SDB A;  5EG0 A;  1I5Z A;  1BW5 A;  4ESB A;  2LBF A;  4M9X A;  1FY7 A;  1LDJ A;  1AOY A;  3V7S A;  4BYY A;  5CVI A;  3AG2 H;  2Z33 A;  2MYS A;  1K6O A;  3MZH A;  4HF1 A;  3RPU A;  2D5V A;  1XN7 A;  3RPQ A;  1WVR A;  3FK6 A;  2P5V A;  3P9K A;  1C0W A;  5AON A;  2W85 A;  3SEQ A;  4EM1 A;  3HL2 A;  1SD5 A;  1GXP A;  2CRG A;  4LIT A;  2P5L C;  5EEG A;  2OBP A;  5AIP A;  2NXN B;  2KIM A;  1SMT A;  5FKO A;  5E3L A;  4XIC A;  5DM7 F;  2WWY A;  4ENJ A;  5C44 J;  4CGZ A;  3K7A J;  4ZYD A;  1QO0 D;  1SFK A;  3PM1 A;  3HSR A;  3S8P A;  3RKX A;  3DTE A;  2CQN A;  2QQ9 A;  3I58 A;  4RS8 A;  4HSR A;  2YX7 A;  4HPQ A;  3PJR A;  2L7K A;  4N4O B;  1GV2 A;  3G1O A;  3H35 A;  3DLA A;  4F92 B;  4A93 J;  1ITY A;  3RZD J;  1PUF B;  1UST A;  3FM5 A;  4M6X A;  1OCP A;  1PUF A;  3H3V K;  1Z6R A;  3LSP A;  2C6Y A;  1TZL A;  4UXN A;  3V7R A;  5BNG A;  1IF1 A;  4ZZD A;  4QSH A;  2IS2 A;  3CUQ B;  5FKK A;  5D5W B;  1H0M A;  2IS1 A;  5ICE A;  3TP0 A;  1OQY A;  2GQQ A;  2M45 A;  1Y1V J;  3FIS A;  5D5X B;  1LVK A;  2W1O A;  3ABK H;  1VQ6 I;  3RKQ A;  3IUO A;  5DYM A;  1F1Z A;  5GAH J;  1OMI A;  2LDU A;  3R60 A;  4X1E A;  3CC7 I;  2FX0 A;  2IGN A;  1OYY A;  4RGX A;  3FXU A;  1KZH A;  1T0F A;  3DFG A;  4YRV A;  5LEJ A;  3KP6 A;  2PMU A;  1RR7 A;  1GV5 A;  4ABZ A;  2IS4 A;  1T33 A;  3GZ6 A;  1BR4 A;  1KYW A;  2KJB A;  3I5U A;  1Z6T A;  1Z7L A;  3KYL A;  4R79 A;  4M71 A;  4AC0 A;  2BBY A;  2HDD A;  1U0J A;  4WX9 A;  3S2D J;  1CQT A;  2XB5 A;  2LYC A;  4UUS B;  5JR3 A;  3OYG A;  5LHH A;  2DA3 A;  2DJN A;  1VZ0 A;  2E1C A;  2ID6 A;  3J7A O;  4UUS A;  1UHS A;  1TL8 A;  1NH3 A;  4BDY A;  5LFA A;  1FX7 A;  2HOA A;  4GFB A;  2FU4 A;  4EJW A;  2NVQ J;  5JVT A;  2CW7 A;  3J7Y J;  2ZFU A;  2V6C A;  4LFU A;  3VYT B;  4MIM A;  3V8J A;  3W2W A;  1G3S A;  2CGP A;  1UCR A;  5IYB J;  5E8I A;  2YX4 A;  2ETH A;  4JX4 A;  3RI4 A;  1WH5 A;  4C3I J;  2HPI A;  3MAJ A;  3EUK L;  2HVQ A;  4YIF A;  4A3I J;  2L54 A;  3FHZ A;  1YFH A;  3T5X A;  2HFH A;  4B1R A;  4EVI A;  3GTP J;  1FPQ A;  2WAD A;  1WJF A;  2R7W A;  2DT5 A;  5A2Q Z;  1USS A;  2EFP A;  2D1H A;  2P6S A;  3LL7 A;  4RGU A;  5BMZ A;  2HZD A;  3LWF A;  1DUX C;  3VDX A;  2IP2 A;  3JRC A;  4M9S A;  1EF4 A;  5CYV A;  5HOD A;  5EZG A;  1UB9 A;  3QU6 A;  1D5Y A;  5J3L A;  3WG7 H;  3ZRG A;  3IWF A;  3EQL F;  2W57 A;  2QUF A;  3L2V A;  4IHX A;  3WTT C;  5J40 A;  2P7C B;  2JA8 J;  3VSK A;  3BG9 A;  3GTL J;  1QZY A;  3OYB A;  2IGK A;  2NVX J;  4NQW A;  2WY7 Q;  3BPV A;  3HXL A;  2L7Z A;  4WK8 F;  2DDB A;  4WCG A;  2ADU A;  5GPA A;  4IKF A;  4BHB A;  2R0Q C;  2R7F A;  1NK3 P;  2M0M A;  1MBF A;  1TW2 A;  4II2 A;  2ZJR F;  5B5E C;  1HDD C;  1JTY A;  4M3G A;  2PJP A;  4BEH B;  3SZG A;  1A6Q A;  4E7S A;  2A69 F;  3ECO A;  4BEH A;  3CDI A;  4NHJ A;  5E3M A;  2VOO A;  3JW4 A;  1J2X A;  2NS0 A;  1OR7 A;  2OZ6 A;  2IGM A;  2FUG 2;  1WH7 A;  3TDU C;  3KPH A;  1ZN2 A;  3KFW X;  1SMY F;  4EGY A;  3ABU A;  2X48 A;  1WZ2 A;  2OQG A;  3S93 A;  3GTQ J;  1YG2 A;  2O61 A;  1BL0 A;  5C3E J;  1BN5 A;  4HA8 A;  5D6E A;  4RLF A;  3BR2 A;  5E1X A;  2Y2Z A;  4OAY A;  3ERE D;  2V9V A;  2BW3 B;  5FRO A;  4D7M A;  5EEH A; 
#chains in the Genus database with same CATH homology
 3WE3 A;  4EMS A;  2E7X A;  3V7C A;  4JQF A;  3ABT A;  1RZ4 A;  4E70 A;  1B9N A;  4EV0 A;  1JXS A;  1MJ9 A;  2L3D A;  1V3F A;  1R36 A;  2O3F A;  4MQV A;  2PN6 A;  1KYZ A;  4MHG A;  1IAW A;  1O3S A;  4WXH A;  4I7H A;  5DD4 A;  2BE5 F;  3C18 A;  4QLC U;  5DCM B;  1ZAR A;  2K4J A;  2EFQ A;  4IVN A;  4OOI A;  5DCM A;  2EB7 A;  2EV5 A;  5F1R A;  4O3M A;  5L3E A;  2FNA A;  1G6N A;  3E5Q A;  3SHF A;  4OU0 A;  3HRT A;  2ZNY A;  2Q2E A;  1YS6 A;  2ACJ A;  3R4K A;  1MGT A;  1I27 A;  4UNO A;  5DD8 A;  2PG4 A;  1I6X A;  5H20 A;  5L3F A;  1XD7 A;  2R3S A;  1QGP A;  2XAQ A;  5FFX A;  3HUG A;  2XAF A;  2FML A;  4G6Q A;  3M8E A;  4HX8 A;  3ZMD A;  1XGN A;  1QNT A;  2LF8 A;  4M74 A;  4AIK A;  5E1Z B;  4BQA A;  2OA4 A;  3ZMT A;  2MBF A;  2JSC A;  4G8X A;  1ZGJ A;  4B8X A;  3LQQ A;  4RB2 C;  1XDU A;  2P5K A;  1YTY A;  3ROU A;  3CDH A;  1STZ A;  4EJT A;  5JFR A;  2HDC A;  3HSF A;  4GYI A;  1B4A A;  1O3T A;  5ILU A;  1L3L A;  3HHG A;  2HTJ A;  2XKO A;  3VB2 A;  2B0L A;  1J75 A;  3ZN1 A;  5CJ9 A;  3EUH A;  3RKY A;  2PI0 A;  3F6O A;  1PDN C;  2GA2 A;  5LBQ A;  4UHT A;  3QRF F;  4Z2Y A;  5LRS A;  2W25 A;  4R8H A;  5DDG A;  1W5S A;  4KA4 A;  2X0L A;  2MLG A;  1ZAO A;  2M30 A;  3KP7 A;  2DFI A;  3QOP A;  2VBX A;  2EK5 A;  3MEX A;  2KKO A;  2ESH A;  5KK1 A;  2EJR A;  3R0J A;  4LLN A;  3ML6 A;  3I54 A;  3BPX A;  2QQA A;  1RI7 A;  2PEX A;  4UV9 A;  2LSO A;  1YIO A;  2X4H A;  3C3W A;  5LLQ A;  2DTR A;  2ESN A;  2L4A A;  3GFI A;  4KMU X;  2ELH A;  3ISP A;  2XRN A;  4I02 A;  1DP7 P;  1FYM A;  5L3D A;  4N9H A;  1CF7 B;  1WRJ A;  3H3U A;  1CF7 A;  4PGH A;  3K0L A;  5HDG A;  4GGG A;  1WQ2 A;  2DW4 A;  3E6M A;  2BGC A;  3HRM A;  4A0Y A;  1PUE E;  5F64 A;  2OU2 A;  2XVC A;  3VOD A;  4LK1 F;  3HRU A;  4EJV A;  2ZXJ A;  2MD5 A;  3CUO A;  2CYY A;  4KFC A;  1TQP A;  5HLI A;  5TJJ A;  4RAZ A;  4LG0 A;  1IRG A;  3LAP A;  2BEO A;  3BJO A;  4IF4 A;  4KYW A;  4S04 A;  4LLG F;  1RUN A;  2Z3Y A;  1EH6 A;  3QP6 A;  3ECH A;  1BI2 A;  5DUI A;  1I1S A;  1BI1 A;  3M7G A;  1J9I A;  3F3X A;  4HDV A;  2VC1 A;  3BJA A;  5FLX Z;  2FBK A;  2OZU A;  1KU3 A;  3ZMZ A;  3CO7 C;  1YW7 A;  1S6L A;  3REO A;  1W7P B;  2A5Y B;  4HV6 A;  1W7P A;  2FE3 A;  5D8K B;  2GXG A;  1ODD A;  4WXD A;  1SFE A;  1FYK A;  2JT1 A;  1S7A A;  4ENN A;  1U8R A;  2FF4 A;  3ZQ7 A;  5IT9 Z;  3EYY A;  4XLN F;  1UHM A;  4P96 A;  2J5O A;  5FD5 A;  1HW1 A;  1R7J A;  3FM3 A;  4KN7 X;  3CUQ C;  1K79 A;  5L3G A;  3IHU A;  2L4M A;  1F9N A;  5F6F A;  4I09 A;  1LEA A;  1R58 A;  3OOP A;  3HSE A;  3C1D A;  4WF2 A;  1SFU A;  1P92 A;  5CVJ A;  4BAY A;  2FA5 A;  2A07 F;  4JBA A;  3NQO A;  3SZT A;  3Q5F A;  2W24 A;  1P4W A;  3U2R A;  3IRQ A;  4CHU A;  4MNU A;  1MKM A;  2G7U A;  1O3Q A;  2EFN A;  3TOA A;  3GF2 A;  1FT9 A;  3LA2 A;  1FBU A;  1SD4 A;  1JHF A;  2FRH A;  1ULY A;  4H0E A;  5LHG A;  2VE9 A;  3HTU A;  5AIQ A;  2HTS A;  3CTA A;  1ON1 A;  4A2U A;  1Y0U A;  5LEK A;  3F6V A;  4YII A;  1EV7 A;  4XBF A;  2D2W A;  4ASN A;  3ZN0 A;  3KP3 A;  4CDG A;  1W5T A;  3MCZ A;  2EA4 A;  4MQ9 F;  4KUM A;  4LB5 A;  2IJL A;  3FMQ A;  2VE8 A;  1R23 A;  2A68 F;  1F5T A;  2YSR A;  3DV8 A;  1ZYR F;  1ZLK A;  3GFM A;  3KEO A;  4Q48 A;  1EH7 A;  2DQL A;  4M9Z A;  4PGG A;  2A61 A;  1SD6 A;  1WWX A;  3WGI A;  4G9Y A;  3O3K A;  1B59 A;  2K7L A;  3JSP A;  1LVA A;  2K27 A;  1TW3 A;  2XAG A;  2ZKZ A;  3HIF A;  3E6D A;  3U9G A;  2FEZ A;  2DPD A;  3AAF A;  3F23 A;  3KZZ A;  3I71 A;  2V1U A;  3BZ6 A;  3KZY A;  2HWV A;  4EGZ A;  2P8T A;  2XGX A;  2QEN A;  4L18 B;  1LDD A;  3QAH A;  4ENK A;  1XDS A;  2NYX A;  1FBS A;  3L09 A;  3CLO A;  4HLY A;  4RB1 A;  1HQC A;  3FF5 A;  4M73 A;  1AWC A;  2GWR A;  1YQA A;  2K02 A;  2F5C A;  2D45 A;  3DPT A;  1YO5 C;  1FYL A;  4KIB A;  3TDZ C;  4L9T A;  3IC7 A;  2EFW A;  4KN4 X;  1OPC A;  1KQ9 A;  3MQ0 A;  2CO5 A;  2EV0 A;  2G7H A;  5HS9 A;  2NAZ A;  1OYI A;  1G3Y A;  1U5T B;  3KEQ A;  1KU9 A;  3DQV C;  2OQR A;  1U5T A;  5HS8 A;  3P9C A;  2DO7 A;  3CO6 C;  4DQ2 A;  3IL2 A;  4XSZ F;  1IRF A;  1DDN A;  3WG9 A;  3V8K A;  4Y17 A;  5HDK A;  2RKH A;  3GEZ A;  3TO7 A;  3JTG A;  3B73 A;  5BPD A;  1G3T A;  3F8C A;  2WV0 A;  3WTW C;  1KU2 A;  2DAO A;  1XSX A;  2HGC A;  2Q8K A;  3I59 B;  3BWG A;  2DPU A;  3KCC A;  3I59 A;  3L00 A;  4F7Z A;  3T8T A;  1IXS B;  5BPI A;  4UUV A;  4N9I A;  2VON A;  3WU1 B;  2QWW A;  3VEP A;  4B09 A;  3WTY C;  4A0X A;  5ED4 A;  5FGM A;  2HYF A;  3J80 Z;  5K5O A;  3N97 A;  2MA3 A;  3SZP A;  3M8F A;  1PP7 U;  3GZ5 A;  1B1B A;  5ILV A;  1R00 A;  2HOE A;  3ZPL A;  2L01 A;  2PMH A;  4OMZ A;  1BOA A;  5E1W A;  2J5P A;  4CZZ A;  2XV4 S;  2RNJ A;  3LA3 A;  3SFZ A;  4IPA A;  1TNT A;  1QQI A;  2P4W A;  5IT3 A;  4KDP A;  3I64 A;  1TQM A;  4GCV A;  4BH9 A;  4IHS A;  5L3B A;  5FLX K;  4FT8 A;  2CG4 A;  4MTD A;  3D0S A;  1HXD A;  1KU7 A;  2VOD A;  2JRT A;  2HR3 A;  3RTR A;  4G94 A;  3K1P A;  2XRO A;  2DU9 A;  4ZYH A;  5J6X A;  2OAZ A;  1UFM A;  1ONV A;  3IKT A;  1IUY A;  4WXC A;  3KLN A;  3T1B A;  4L9J A;  3FXQ A;  4WWC A;  3P7N A;  4PCQ A;  2QLZ A;  5BQT A;  1IN8 A;  1BIA A;  4IRI A;  4M6Y A;  3S2W A;  3KP2 A;  3GO5 A;  1LB2 A;  1PP8 F;  5E17 F;  1MD0 A;  4LGW A;  5IT9 K;  4P9F A;  3G73 A;  3F72 A;  1EH8 A;  4OMY A;  2PQ8 A;  3F8B A;  2HKX A;  5LGN A;  1XGM A;  1Z9C A;  5FO5 A;  1TBX A;  2QZ8 A;  2A6E F;  1XCV A;  5ICC A;  2OD5 A;  4KIF A;  2NNY A;  2Z5U A;  5LRR A;  1T6S A;  2NRA C;  2HYG D;  1HST A;  3DF8 A;  1QZZ A;  3E3V A;  3WE2 A;  1T39 A;  2VBY A;  1DPR A;  1U78 A;  2DBB A;  5D4S A;  1P6R A;  4OIN F;  3E5U A;  3PQK A;  4LMY A;  1W7P D;  5E20 A;  3WGG A;  3B02 A;  5D5V B;  3M9A A;  1TLH B;  1TNS A;  1BC8 C;  4HX4 A;  1D8K A;  4L9N A;  1Q1H A;  1IZ1 A;  3JTH A;  1YS7 A;  1Z1D A;  2GIV A;  2H6B A;  2JPC A;  1FNN A;  4IJA A;  5HVQ C;  2Y0M A;  2XHK A;  5JHU A;  1K7A A;  3KP5 A;  2ZNZ A;  3GW2 A;  1XGS A;  1WKM A;  2ISY A;  1IW7 F;  2Z9O A;  2HS5 A;  3EDP A;  4U88 A;  3O2P E;  3RJP A;  3F8M A;  3SQN A;  5ILS A;  4G7O F;  2F2E A;  3WGH A;  1XCB A;  3V8L A;  4RAY A;  3ULQ B;  4A5M A;  5J8C A;  3C7J A;  3E97 A;  3LFK A;  4U7B A;  3GFJ A;  3HOT A;  2XKP A;  2E7W A;  2P6T A;  4I98 B;  3VOE A;  2ZO4 A;  4LG0 B;  1LQ1 A;  1OYW A;  3HHH A;  2W84 A;  4HF0 A;  3TO9 A;  1J5Y A;  2UZK A;  4HAM A;  3FXR A;  3GFL A;  2LF7 A;  3P9I A;  1R5G A;  3F8N A;  1P4X A;  4R1H A;  5E18 F;  5J8F A;  2M87 A;  4IRH A;  3I0T A;  4EM0 B;  2VC0 A;  3GLX A;  2IA0 A;  1REP C;  3F21 A;  3KET A;  4UVB A;  4Q5S F;  5E8G A;  4L0Z B;  2Y75 A;  5HDN A;  5D5U B;  4O6J A;  4U7D A;  1GHC A;  2GZW A;  1ZRF A;  4A12 A;  3TO6 A;  3VFZ A;  4KT5 C;  4OIQ F;  2AS5 F;  5H6Q A;  2CQK A;  2MH2 A;  3RYP A;  1HW2 A;  5BOX A;  3K2Z A;  3BDD A;  2KIF A;  5K5Q A;  2KRF A;  5CLS A;  2A6H F;  1H9T A;  2V1X A;  3LAJ A;  1KQ8 A;  1NHA A;  1RNL A;  3E5X A;  4BHC A;  1Z05 A;  4I0B A;  3W6J B;  2O03 A;  3SXY A;  1R1T A;  3RIR A;  1R1V A;  2RC4 A;  2ZFW A;  4EJU A;  4M72 A;  4MEX F;  2K4B A;  3ZP5 A;  1XSV A;  4A6E A;  2Z99 A;  2FOK A;  4AIH A;  1XMA A;  1O7F A;  3BRO A;  4RB3 C;  4GXO A;  1HSJ A;  2IA2 A;  2JTV A;  4HX7 A;  2VBZ A;  1O3R A;  1S3J A;  2DK5 A;  2KJC A;  1BI3 A;  1R5H A;  3GVA A;  1S7O A;  4GO1 A;  3LST A;  5DCF A;  3F22 A;  3FWE A;  2PBI A;  4P9U A;  2XIG A;  1O57 A;  1U6G A;  4S05 A;  1IN5 A;  1B9M A;  3HRS A;  1YYV A;  2EFO A;  1LJ9 A;  1ZH5 A;  3L7W A;  2RGV A;  2COM A;  5FD6 A;  1YLF A;  3Q9S A;  2XAS A;  1FSE A;  1TQI A;  1S29 A;  4HOB A;  2VN2 A;  3K1N A;  3T0Y A;  3OV8 A;  3QPT A;  1R1U A;  1ZG3 A;  4KNY A;  5LGU A;  4YFK F;  1F4K A;  3J80 K;  2CFX A;  2RV8 A;  4EQQ A;  1JE8 A;  4XSX F;  3FMS A;  4O5V A;  4EM2 A;  3JSO A;  1SD7 A;  3MWM A;  1FSH A;  1HW5 A;  3R0A A;  2IVM A;  3CUQ A;  4Q47 A;  2KIU A;  4EJO A;  4KIG A;  1BI0 A;  4U0W A;  1U5T C;  1E17 A;  2AXL A;  1HKT A;  4K2E A;  4DNC A;  4AD9 A;  4HYE A;  2FSW A;  3QPH A;  1G4D A;  3N4M A;  5K1Y A;  4U0V A;  1P4A A;  4HLX A;  5D4R A;  4UVA A;  3WU0 A;  4P5O A;  1J7K A;  2GA1 A;  3HTS B;  1YW8 A;  2H09 A;  4ENM A;  5ERI A;  2EWN A;  1IXC A;  5ICF A;  5CVU A;  4LD5 A;  1J59 A;  3ZMS A;  3ELK A;  1Z91 A;  4HBL A;  3WOD F;  3J81 Z;  1X3U A;  5DV5 A;  1U2W A;  3EYI A;  4OIP F;  1BC7 C;  2IW5 A;  4ZZL A;  1KA8 A;  5LGT A;  1SFX A;  3JAM K;  1LNW A;  4HQM A;  3R6S A;  4BXU A;  4L0Y B;  1G3W A;  3WTS C;  2FQ3 A;  4RGR A;  2DLL A;  2BV6 A;  5D8L B;  2O0Y A;  2HZT A;  3GWZ A;  3BJ6 A;  1IN7 A;  2VOP A;  2ZJ2 A;  2HKO A;  1J0R A;  2H94 A;  1ZLJ A;  3W6K B;  3ZMU A;  1ZRC A;  3KLO A;  2UWM A;  1GVJ A;  2HEO A;  2TDX A;  4L9V A;  1ZHF A;  3E6B A;  4OIO F;  2IRF G;  3GXO A;  3BY6 A;  2L02 A;  4LLL A;  4ZYE A;  4A6D A;  3LA7 A;  1ON2 A;  1KQ0 A;  1LEB A;  4MTE A;  4Q4Z F;  2FNP A;  2RVC A;  3KE2 A;  1HKQ A;  2V1D A;  5LHI A;  1WSU A;  4N0B A;  1ZRE A;  1JHH A;  3K9T A;  1T98 A;  2VT2 A;  4QWQ A;  2H27 A;  2F5F A;  1XB4 A;  2F5D A;  5HLH A;  3IRR A;  5BS6 A;  2M1B A;  1GXQ A;  1YW9 A;  2H6C A;  1QPM A;  4PZJ A;  3DKW A;  1O7L A;  2VT3 A;  4UVC A;  5L3C A;  4A5N A;  1B6A A;  4FX4 A;  1QBJ A;  2HQN A;  3K69 A;  1SAX A;  4CXF A;  3FZV A;  1HKS A;  3Q9V A;  1XMK A;  3ZMV A;  4TV7 A;  4AVP A;  4HF2 A;  4KIC A;  4I2O A;  1ZG1 A;  1FC3 A;  6PAX A;  2EA2 A;  1FZP B;  3RDI A;  5HLG A;  2K86 A;  4CO8 A;  1RUO A;  5FB2 A;  3RKW A;  1I1G A;  4LJZ F;  1IXR C;  2STW A;  4MEY F;  3BP8 A;  2FBI A;  3COA C;  2EV6 A;  2F5E A;  4YFN F;  1ZRD A;  3KP4 A;  2Q0O A;  1ZG5 A;  1FLI A;  1H9G A;  1Z7U A;  5JI6 A;  3MZY A;  2MLK A;  2XAH A;  2FXA A;  3H92 A;  2V79 A;  3WTV C;  2QVO A;  1VTN C;  2PLY A;  1D5V A;  2RQP A;  4ZH4 F;  1FBQ A;  2IA1 A;  1FP1 D;  2YR2 A;  2VXZ A;  1K78 B;  2QM3 A;  3FX3 A;  2UXN A;  1JGS A;  4L5J A;  1K78 A;  4HDU A;  3L9F A;  4I0A A;  4HV5 A;  3O6B B;  3H3Z A;  3QP5 A;  2NNN A;  3WTU C;  1V4R A;  2FMY A;  3JAM Z;  5DEQ A;  3TGN A;  1CGP A;  3PFI A;  1MDM B;  2YU3 A;  1MDM A;  4BHP A;  3DEU A;  1OKR A;  4AIJ A;  3GX4 X;  4P55 A;  5FFZ A;  1D3Y A;  3I53 A;  4LB6 B;  4FHT A;  2QYO A;  4I01 A;  2LNB A;  2RDP A;  3EET A;  3L2C A;  4OIR F;  1XSD A;  1FOK A;  2LKP A;  3RYR A;  2ZME B;  4A0Z A;  2FBH A;  3DPL C;  4D0P A;  2ZME A;  4JK1 X;  4G7H F;  2GXB A;  1ZGA A;  4RGS A;  2PFB A;  2XUB A;  2DK8 A;  1A04 A;  1FP2 A;  3GUD A;  4UV8 A;  4GYG A;  2E1N A;  5CVR A;  3PQJ A;  4FX0 A;  1U3E M;  3NRV A;  3IWZ A;  1DPU A;  1FWZ A;  2Y48 A;  3MFK A;  2QQB A;  4XRF A;  3CJN A;  2JZY A;  1XGO A;  2O8X A;  4KMF A;  3E6C C;  4ZYG A;  1BM9 A;  1KGS A;  2ISZ A;  2DQR A;  4U0Y A;  2M5W A;  1E2X A;  5CVV A;  1HBX G;  2CWE A;  2XAJ A;  5HOO A;  2P7V B;  3K1M A;  2IT0 A;  2QBY B;  3BOQ A;  2QBY A;  5H6R A;  3DP7 A;  3WTZ A;  3D5L A;  2WC2 A;  3F8F A;  2YPR A;  4PDK A;  4ESJ A;  5D6F A;  1MJA A;  3FMR A;  2ZBK A;  1WI9 A;  2CW0 F;  2GAU A;  4G7Z F;  2MH9 A;  4Y15 A;  2G9W A;  2BYV E;  2CSO A;  1MJB A;  2A3S A;  1R22 A;  2IPQ X;  4IXA A;  3TOB A;  3GYH X;  4AWX B;  1UHW A;  3M1E A;  3QU3 A;  2JPB A;  1D8J A;  1LDK B;  4Y13 A;  1T38 A;  3DXJ F;  3T8R A;  3R61 A;  2HQR A;  1BBY A;  5ICG A;  4NB5 A;  1RIO H;  4CIC A;  4ON0 A;  3J81 K;  1S8N A;  2STT A;  3IKV A;  1T2K A;  5KVR A;  2VBW A;  5A2Q K;  4HW0 A;  3TQN A;  3HYI A;  1IN6 A;  1IN4 A;  4YG2 F;  1P2F A;  4CYD A;  2RN7 A;  5TRD A;  3WTX C;  2O6G E;  4MGR A;  2DI3 A;  2R7D A;  2ZCW A;  4IHT A;  3LQR A;  2M8E A;  4HQE A;  5HS7 A;  4L5I A;  2MC3 A;  5K5R A;  4LK0 F;  4BNC A;  2D1V A;  3HOS A;  3G3Z A;  3V4G A;  3NEU A;  2UXX A;  2WTE A;  1MZB A;  1BIB A;  4XLP F;  4RB0 A;  4YFX F;  4HZF A;  4G6D A;  5DUK A;  1BJA A;  1W4M A;  3TKY A;  1TTY A;  3U1D A;  4ETS A;  4ESF A;  4IRG A;  1L0O C;  3I4P A;  1I5Z A;  4ESB A;  4M9X A;  1FY7 A;  1LDJ A;  1AOY A;  3V7S A;  4BYY A;  5CVI A;  2Z33 A;  4HF1 A;  1K6O A;  3MZH A;  3RPU A;  1XN7 A;  3RPQ A;  2P5V A;  3P9K A;  1C0W A;  5AON A;  2W85 A;  4EM1 A;  1SD5 A;  1GXP A;  2P5L C;  5EEG A;  2OBP A;  5AIP A;  2KIM A;  1SMT A;  2WWY A;  4ENJ A;  4CGZ A;  4ZYD A;  1QO0 D;  3HSR A;  3RKX A;  2QQ9 A;  3I58 A;  4RS8 A;  2YX7 A;  1UST A;  3FM5 A;  4M6X A;  1Z6R A;  2C6Y A;  4UXN A;  3V7R A;  1IF1 A;  4ZZD A;  3CUQ B;  5D5W B;  1H0M A;  5ICE A;  2M45 A;  2GQQ A;  5D5X B;  5DYM A;  1F1Z A;  1OMI A;  2LDU A;  3R60 A;  1OYY A;  4RGX A;  3FXU A;  1T0F A;  3DFG A;  5LEJ A;  3KP6 A;  2PMU A;  3GZ6 A;  1KYW A;  2KJB A;  3I5U A;  1Z6T A;  4R79 A;  4M71 A;  2BBY A;  4WX9 A;  5JR3 A;  5LHH A;  2E1C A;  3J7A O;  1FX7 A;  2FU4 A;  4EJW A;  5JVT A;  2V6C A;  4LFU A;  3V8J A;  1G3S A;  2CGP A;  1UCR A;  5E8I A;  2YX4 A;  2ETH A;  3RI4 A;  3MAJ A;  4YIF A;  2L54 A;  3FHZ A;  1YFH A;  3T5X A;  2HFH A;  4EVI A;  1FPQ A;  2DT5 A;  5A2Q Z;  1USS A;  2EFP A;  2D1H A;  2P6S A;  4RGU A;  5BMZ A;  3LWF A;  1DUX C;  2IP2 A;  4M9S A;  5CYV A;  1UB9 A;  3QU6 A;  3IWF A;  3EQL F;  2W57 A;  2QUF A;  3WTT C;  2P7C B;  1QZY A;  4NQW A;  4WK8 F;  3BPV A;  4WCG A;  2ADU A;  4BHB A;  2R7F A;  1TW2 A;  2PJP A;  2A69 F;  3ECO A;  4NHJ A;  2VOO A;  3JW4 A;  1J2X A;  2NS0 A;  1OR7 A;  2OZ6 A;  3TDU C;  1ZN2 A;  3KFW X;  1SMY F;  4EGY A;  3ABU A;  2OQG A;  1YG2 A;  2O61 A;  1BN5 A;  5D6E A;  5E1X A;  3ERE D;  2V9V A;  4HA8 A;  5EEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...