2CO5A

F93 from stiv, a winged-helix dna-binding protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
KYMRINYYIILKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVLFLTEKGMKEFEELHEFFKKIVCHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRAL PROTEIN F93
publication title A Winged-Helix Protein from Sulfolobus Turreted Icosahedral Virus Points Toward Stabilizing Disulfide Bonds in the Intracellular Proteins of a Hyperthermophilic Virus.
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus
molecule tags Viral protein/winged helix
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2co5A00
4YG2F 2V6CA 4EJOA 4O6JA 5F1RA 3HYIA 3KP2A 4OIOF 4KIBA 3HOSA 2HQRA 5DCMB 2DQRA 4OMZA 3FXUA 3BROA 2LF8A 1E17A 3VEPA 4L9JA 3ELKA 1MZBA 3CUOA 3E6BA 5HOOA 3QRFF 3TOAA 2VXZA 2KJCA 1SFUA 2OZ6A 3QAHA 4GXOA 4N9HA 2OAZA 4LLGF 1G3SA 1GXPA 3KE2A 5H6QA 1TW2A 1O57A 5LEKA 1P6RA 5L3BA 4Q5SF 2FF4A 3RDIA 1ON1A 5AIPA 1MJ9A 2L4AA 4HW0A 2HTSA 3KLNA 3FWEA 3GUDA 3FMQA 2ESHA 4WCGA 1ZGJA 5F6FA 5DD8A 3I71A 3ZMSA 3H3ZA 3QP6A 1XSDA 5LRSA 3H3UA 3BJOA 4N9IA 4HF0A 2CWEA 3LA7A 3F8FA 2FQ3A 3RYRA 1LEAA 2QYOA 1Z6TA 4QLCU 3R0JA 2MLGA 4A0YA 1XGOA 3WTXC 3ZN0A 5DUKA 3DXJF 1XB4A 3WGGA 5CVRA 4HQMA 4LG0A 3RTRA 3EDPA 2PFBA 1P2FA 3QP5A 5BQTA 2PBIA 1YW8A 5J8CA 1U6GA 3F6VA 1B1BA 2HQNA 1SD4A 4YFXF 4WX9A 3R0AA 4JQFA 5ILUA 4M73A 2B0LA 4ESFA 5K5OA 3F72A 3T0YA 3P9IA 4I01A 1WI9A 2EFNA 2EV0A 3F6OA 4A0ZA 2MLKA 4M72A 4P5OA 3LAPA 1BIAA 4N0BA 1SD6A 3IC7A 5CVVA 2P5LC 2GIVA 1KU2A 1HW2A 3WE2A 1J5YA 4LK1F 3FMRA 5L3CA 1HXDA 3J80Z 2FU4A 3RPQA 3IRQA 3E97A 2DFIA 5HLIA 2DK8A 5H6RA 5JI6A 1TQIA 1FT9A 2DTRA 3C3WA 3KEOA 1ZH5A 6PAXA 2FMLA 1XGSA 3F21A 1PDNC 2EFOA 1P4XA 2HR3A 1I5ZA 4RS8A 5LEJA 1YS6A 2K02A 3MEXA 3R6SA 3RKYA 3T1BA 2DO7A 4PGGA 2XAJA 2IPQX 4G94A 3VOEA 1U2WA 5AIQA 1R1UA 3ZMZA 1IN4A 1DDNA 3ZP5A 5DUIA 2K4JA 4Q47A 2PMUA 4M74A 3W6JB 3J7AO 3PQKA 2Q8KA 1D3YA 1O7FA 2IA1A 2VT2A 3P9CA 2FXAA 2YR2A 1OR7A 3DFGA 4ESJA 3EUHA 4I09A 3WG9A 2XGXA 2D1VA 4R8HA 1F9NA 1W4MA 2RVCA 3HSFA 2QWWA 2NS0A 1H0MA 4M9ZA 3I59A 1FYMA 5D8LB 3NEUA 4KIFA 5E1WA 5TJJA 2A07F 3LQRA 4MGRA 2V1DA 5E20A 1IN5A 2MC3A 3N97A 3EYIA 5HDGA 3WTWC 3M1EA 1Z6RA 3DV8A 2CQKA 3VB2A 5JHUA 3V8LA 4DNCA 4O5VA 3HRTA 4FX4A 1J59A 1P4WA 3IWFA 2WTEA 3E5UA 1IXCA 1UFMA 4ENKA 1RUOA 3Q9VA 1FP2A 5JR3A 2C6YA 3ECHA 3TDZC 1R5GA 1EV7A 1YW9A 3IHUA 1IRGA 2EFPA 3ZMVA 1K79A 2Y0MA 1FYKA 5HDKA 1B6AA 4EV0A 2FBKA 1W5TA 4L5IA 3V7SA 5HS8A 4GYIA 2GA2A 1FP1D 1W5SA 2XUBA 4RAZA 1IUYA 2L4MA 5HDNA 1NHAA 5D5WB 4FHTA 1SFXA 4BNCA 5BS6A 2GXGA 4ENMA 1CF7A 3OOPA 3RI4A 4L5JA 2Q0OA 2XAFA 4I98B 3GYHX 1S7OA 4LLLA 2IA0A 3KCCA 3M7GA 3TQNA 1F5TA 3QU3A 1HW1A 1XN7A 4A6DA 1JGSA 1KA8A 1L0OC 3HSRA 3L7WA 2KIFA 1ZARA 1C0WA 2H6BA 1LQ1A 1RIOH 2ZNZA 1O7LA 1F1ZA 4MEXF 4ZZDA 2DLLA 3J81Z 3FMSA 4P55A 4CICA 4I0BA 3JSPA 1Z91A 2V79A 3K1NA 2A6HF 4HA8A 1R1VA 1OPCA 3JSOA 1QZYA 4B09A 5LBQA 3HOTA 5DYMA 5LLQA 4MEYF 4M9SA 2M8EA 5FLXK 3JW4A 1G3YA 3BZ6A 1J0RA 1TTYA 2BV6A 5IT9K 5DCMA 3O2PE 1QZZA 3RIRA 3GWZA 4OIPF 1BI2A 4P9UA 3ULQB 5IT3A 2GZWA 2OA4A 1HBXG 1Z7UA 3HTSB 4DQ2A 1ZRDA 4ZZLA 4LGWA 1FBQA 3I54A 3MCZA 3KEQA 4P9FA 1U3EM 1SMTA 1Y0UA 2ZBKA 2VC0A 2GWRA 2A3SA 1DUXC 1BOAA 3T8TA 1TW3A 3L00A 3S2WA 2HEOA 3DQVC 1T0FA 5HLHA 1QBJA 3ZPLA 2G9WA 1ZRFA 1MDMB 3Q5FA 2VOPA 2DT5A 1PP7U 2M1BA 4GYGA 5FD6A 3V8JA 4RGRA 2LSOA 5KVRA 4LMYA 3IWZA 2QBYB 2XKPA 4ENJA 2FRHA 2L02A 5ICFA 2Z99A 2EA2A 3WGIA 3CDHA 2O6GE 1B4AA 1FX7A 1IN6A 2FOKA 1USTA 2O61A 1ON2A 2DW4A 1YIOA 1FYLA 3E3VA 3FHZA 1QGPA 4NQWA 3GFIA 4GCVA 4L18B 4WXDA 1O3QA 4XSXF 3GO5A 4PGHA 3GX4X 4U0YA 3O3KA 2XVCA 1SMYF 1WRJA 2LF7A 3BJAA 2QLZA 2WC2A 5DDGA 4RAYA 1BBYA 2K27A 1FZPB 2OU2A 3ZMUA 1S3JA 3BPVA 3LWFA 3ABUA 3SZPA 3FF5A 1O3SA 2XASA 2QENA 2CG4A 4WF2A 1LVAA 2VC1A 1YLFA 1IN8A 2OQRA 1KYWA 1BN5A 3LAJA 2FNPA 3U1DA 2RC4A 5E8IA 2EV6A 3ABTA 4P96A 3F3XA 1R1TA 1OYIA 4XLNF 1IRFA 2D1HA 3E5XA 2IA2A 1KU3A 1OYWA 4A2UA 4G6QA 1L3LA 4EVIA 2X0LA 2L01A 3U9GA 3F23A 2W85A 2KIMA 2MH2A 3HTUA 4AWXB 4Q48A 2RV8A 4ETSA 3GLXA 4LK0F 1K6OA 1REPC 2NNNA 2ELHA 4ZYDA 2VBWA 5BMZA 5E18F 3C1DA 2BEOA 3TO6A 4RB3C 3GFMA 1YYVA 3FM3A 3KP5A 3HSEA 1FSEA 5FB2A 1ZLKA 5E1ZB 2EV5A 4MNUA 1SFEA 3GF2A 4KNYA 3LFKA 3WE3A 2HFHA 1P4AA 1HSTA 1KU9A 3ERED 2MBFA 3TOBA 2R3SA 3E6DA 3FXQA 1B9MA 4EJUA 1PP8F 3RYPA 1SAXA 5D4RA 3KLOA 1E2XA 3K9TA 4U0WA 3M8EA 2DK5A 1MD0A 2W24A 2O8XA 5D5VB 2E1CA 1KQ9A 2ZXJA 3GEZA 1RNLA 2HZTA 4QWQA 4JBAA 4LFUA 4ZYHA 3ECOA 2YX7A 3LSTA 2XIGA 2G7UA 2CW0F 2FSWA 5K1YA 4HV6A 4IHSA 2KJBA 2BE5F 1IF1A 1U5TB 4HX7A 1KQ8A 3LQQA 1XCVA 2P6TA 4CHUA 3SZTA 4I02A 1QO0D 5FGMA 1I27A 1W7PD 2CO5A 4M6YA 4LB6B 2WWYA 2L54A 4OIQF 2W57A 3F8BA 1T2KA 1O3RA 5DCFA 4HX4A 3ZN1A 1FWZA 3RJPA 1RI7A 1V4RA 2DPUA 2EA4A 2RKHA 3CUQB 2F5DA 3BWGA 5DEQA 3IL2A 5F64A 5LHHA 1XMKA 2MA3A 5BOXA 4Y13A 1GHCA 2GQQA 4FT8A 4WK8F 1SD7A 4CYDA 3SHFA 5EEGA 3I58A 4BXUA 2ISYA 3ZQ7A 2O0YA 4R1HA 1BI1A 2RQPA 3M8FA 2VBXA 2YU3A 1I1SA 5D5UB 1TQPA 4MQVA 3KP4A 4XBFA 3GZ5A 3ROUA 2XAHA 2TDXA 2P8TA 5CJ9A 2A6EF 4BQAA 2RN7A 1BM9A 3KP7A 3WU1B 3REOA 3BOQA 4ON0A 1XMAA 2IW5A 3WU0A 2NYXA 5L3EA 2X4HA 2FE3A 4UVBA 1LEBA 4NB5A 2GXBA 4F7ZA 2VODA 3V7RA 2PLYA 3DKWA 2OD5A 4U7DA 2YX4A 5KK1A 1DPUA 3TDUC 4HDUA 3EYYA 4HYEA 2HKOA 1BC7C 1ZN2A 3MFKA 1IAWA 5LGUA 2CYYA 3BJ6A 3RPUA 5ICCA 4BHCA 4WXHA 3CO7C 5E8GA 4A5MA 1HKTA 2V9VA 4KN7X 2JSCA 1JE8A 4GGGA 4UVCA 4Y17A 2JZYA 4I2OA 1YQAA 2HYGD 4YFKF 1HW5A 4AD9A 2ESNA 3J80K 3KETA 1T38A 1MDMA 2AS5F 3IKVA 1XDUA 3BDDA 3L9FA 1R23A 1JXSA 1H9GA 2KIUA 4UVAA 2PI0A 2QUFA 2DBBA 2QBYA 1U5TC 2PEXA 1YG2A 1DPRA 2UXNA 2E1NA 1UB9A 1S29A 2VONA 4UV8A 1YO5C 4M9XA 1F4KA 1TQMA 4KIGA 2FBIA 1D8JA 1J7KA 4HF1A 1T98A 2HDCA 1CGPA 2J5OA 5K5QA 1IXRC 4EM0B 3HUGA 4AIJA 3TGNA 3QPHA 2QZ8A 4PCQA 1PUEE 1G3TA 2QQBA 5JFRA 3FM5A 3TKYA 4AVPA 1TNTA 5DV5A 1ZRCA 1XGNA 2H27A 1K78B 2IT0A 1QQIA 2UWMA 4Z2YA 4RGSA 1J9IA 3IKTA 4BAYA 3ZMDA 2VE9A 3K1PA 1UCRA 4HF2A 4EM2A 1S7AA 5CVIA 1TBXA 4O3MA 2A69F 1BC8C 4OOIA 1YS7A 1WQ2A 4PDKA 4YIFA 4A12A 3F8CA 1I1GA 2OQGA 3N4MA 1VTNC 1XD7A 1ODDA 2YSRA 4EGYA 2XROA 4EM1A 1JHFA 1U8RA 1KU7A 4H0EA 5BPIA 1AWCA 2A61A 4KDPA 4CDGA 2HOEA 1ZG3A 5LGNA 4A0XA 2PJPA 2UXXA 2P7CB 2CGPA 3EETA 1T39A 5FFXA 3F8NA 5ILSA 4G8XA 1Z9CA 1TLHB 4KICA 2F5FA 2P5VA 2VBYA 4KA4A 1YTYA 1KYZA 3R4KA 2QVOA 3SQNA 3FX3A 3GFJA 1EH6A 4JK1X 5CVUA 2HWVA 3DPTA 4UHTA 1IN7A 1BIBA 3D5LA 2QM3A 3TO7A 1AOYA 2ISZA 5D6FA 4M6XA 3V4GA 4HX8A 5E1XA 2ACJA 2K4BA 4MTEA 2F5EA 1YFHA 5D5XB 1LDDA 2Z9OA 1FPQA 2V1XA 3IRRA 3J81K 4HLYA 2O03A 4KT5C 2MD5A 3I64A 4S04A 4RB1A 4OMYA 3HIFA 3AAFA 4IPAA 2P7VB 3WTUC 3SXYA 5ICGA 1YW7A 3P7NA 4I0AA 2F5CA 4A6EA 2EFWA 3JTGA 4MQ9F 1Q1HA 2K86A 2JPBA 4ASNA 4KUMA 4ESBA 5CYVA 1U5TA 2IP2A 4K2EA 5LHGA 2P6SA 5HS7A 1MJBA 1V3FA 1JHHA 1TNSA 3PQJA 2FMYA 1G3WA 2ZCWA 3T8RA 2QQ9A 2E7WA 3KZYA 2HGCA 3HRUA 3EQLF 2VE8A 4RB0A 1IZ1A 1H9TA 2VBZA 4E70A 3W6KB 4CXFA 4UUVA 2DAOA 3CUQA 3I53A 4HQEA 2JT1A 5DD4A 3C18A 1FLIA 2UZKA 1LNWA 2MH9A 3WGHA 3CTAA 2K7LA 2XV4S 4OU0A 3LA2A 4TV7A 2ZMEB 2JRTA 3V7CA 1W7PB 2GA1A 1WWXA 2JTVA 2ZFWA 4IF4A 4AIKA 1R58A 1FSHA 2WV0A 3VFZA 1QNTA 3H92A 1D5VA 2HTJA 3COAC 2P5KA 2R7FA 4BHBA 4Q4ZF 3C7JA 1ZREA 1HQCA 3OV8A 2RNJA 3Q9SA 4MTDA 4PZJA 3LA3A 2KRFA 2STTA 3NQOA 5TRDA 2ETHA 4IRGA 3VODA 3G73A 3I5UA 1HKQA 1ZG1A 5HLGA 4ENNA 1HSJA 5J8FA 3K0LA 1WKMA 1LDKB 2ZO4A 1SD5A 1ZYRF 1BI0A 3MWMA 2Z33A 1FNNA 4HBLA 4HLXA 3L2CA 1EH8A 3GZ6A 1K7AA 3JAMZ 3U2RA 3HRSA 2OBPA 3KP3A 3ISPA 3GVAA 1GXQA 3WTSC 2RDPA 3QPTA 1ULYA 2M30A 1R00A 1XSVA 2EWNA 1MKMA 2ZNYA 4XSZF 4LJZF 4G6DA 2H6CA 1WSUA 3O6BB 2BGCA 2PMHA 5ILVA 4L0YB 4CGZA 2EFQA 2NRAC 5EEHA 2EK5A 5ERIA 2CFXA 2E7XA 3F22A 2XKOA 1MGTA 5L3FA 4Y15A 3GXOA 5D6EA 1ZHFA 5LHIA 4IRHA 4U0VA 3P9KA 2EB7A 1Z05A 1ZAOA 1A04A 4HZFA 2CSOA 4HOBA 4LB5A 2Z5UA 2RGVA 1P92A 5D4SA 5L3GA 3G3ZA 3WTVC 1BJAA 2QQAA 1R7JA 1BI3A 1U78A 4G7ZF 4UXNA 3WTYC 2H09A 5E17F 1K78A 3KZZA 1GVJA 4HDVA 4L9VA 1J2XA 2KKOA 4OIRF 2GAUA 1D8KA 3F8MA 4ZH4F 4I7HA 1ZGAA 2Q2EA 4L9TA 1G6NA 4LG0B 2COMA 4RGXA 3B02A 5A2QZ 3HHGA 3DF8A 3T5XA 3E5QA 1EH7A 2A5YB 3DEUA 4OINF 5FLXZ 4LLNA 4YIIA 1T6SA 5IT9Z 3L09A 2ADUA 2PG4A 2XRNA 4KMFA 4A5NA 2W25A 1HKSA 2VT3A 2FNAA 4CZZA 2XAQA 5BPDA 4U88A 2P4WA 1XSXA 4NHJA 3I4PA 3BY6A 4BHPA 4G7OF 4D0PA 3JAMK 4IVNA 3V8KA 2IRFG 2XHKA 3M9AA 2XAGA 5FO5A 2DU9A 1R22A 3I0TA 1B9NA 5ED4A 2VOOA 2NAZA 4L0ZB 3DP7A 1OMIA 2HKXA 5L3DA 1ZG5A 2BYVE 1OYYA 3K69A 2M5WA 2A68F 1B59A 2YPRA 2FBHA 2FA5A 1ZLJA 1LDJA 1MJAA 1R36A 4CO8A 5CLSA 1STZA 3WTTC 3SFZA 2L3DA 4IHTA 4B8XA 2V1UA 3PFIA 1I6XA 2PN6A 3K2ZA 2STWA 5K5RA 5FD5A 3WTZA 3CUQC 4ZYGA 3ML6A 4BH9A 3MZYA 4YFNF 4FX0A 2LNBA 2G7HA 5LRRA 1FOKA 1IXSB 3CLOA 2PQ8A 1Z1DA 1FBSA 3B73A 4EJTA 4HAMA 3GW2A 4KYWA 5J6XA 2Y48A 2HYFA 3D0SA 3RKWA 2NNYA 2JPCA 3I59B 4EQQA 4S05A 4WWCA 3RKXA 2DPDA 5A2QK 3CO6C 5HS9A 1IW7F 4L9NA 5JVTA 1LB2A 5LGTA 2J5PA 3KFWX 1FC3A 1LJ9A 3R61A 2VN2A 4IXAA 2ZKZA 4XRFA 4EJVA 3GFLA 4UV9A 3TO9A 3KP6A 4ZYEA 1XGMA 3ZMTA 5CVJA 3MAJA 1ONVA 2FEZA 4KFCA 1X3UA 1XDSA 3BP8A 3WODF 2R7DA 2ZJ2A 4KN4X 2BBYA 2HS5A 3BPXA 4LD5A 4MHGA 1J75A 4IRIA 4XLPF 3DPLC 1UHWA 3QU6A 1R5HA 1UHMA 2D45A 4U7BA 5H20A 2DI3A 1S6LA 4HV5A 3R60A 4R79A 1RUNA 4BYYA 1DP7P 3NRVA 5HVQC 2LDUA 2W84A 5D8KB 2D2WA 4AIHA 3K1MA 1O3TA 1G4DA 2O3FA 4KMUX 2M45A 1FY7A 3MZHA 4UNOA 2ZMEA 3HHHA 2OZUA 1OKRA 4G7HF 2LKPA 1W7PA 1CF7B 1KQ0A 3QOPA 1FBUA 1RZ4A 5AONA 3E6CC 4G9YA 3JTHA 1XCBA 4WXCA 4EGZA 2Y75A 2F2EA 3MQ0A 2Z3YA 3FXRA 3CJNA 5ICEA 4EMSA 4EJWA 4GO1A 2M87A 2AXLA 2IJLA 4RGUA 4RB2C 4IJAA 1S8NA 3FZVA 2DQLA 2H94A 1QPMA 2EJRA 1KGSA 4M71A 5FFZA 3HRMA 3E6MA 1USSA 2IVMA
chains in the Genus database with same CATH superfamily
2OV7A 5B3SH 4A3CJ 1VQNI 3M07A 4YG2F 4A3KJ 2IS1A 4EEFG 2V6CA 4EJOA 4O6JA 5F1RA 5DTDA 2MG4A 1G2HA 1FOYA 5DS9A 3QYEA 3HYIA 4F93B 3KP2A 3ERMA 1HCRA 5LFAA 4KIBA 4OIOF 3HOSA 2VJIA 2HQRA 4FETA 5IP9J 4BUPA 3S3MA 5DCMB 5GADJ 2DQRA 2R93J 4F91B 4OMZA 3CQZJ 1DGRM 3G1MA 3FXUA 1JI8A 2XF5A 2OCEA 3BROA 2Z16A 3S2DJ 4A3FJ 5B66C 2IBDA 2LF8A 3RZDJ 1E17A 2QKMB 3VEPA 4GDFA 3GCMA 2E60A 3HL2A 1OR7C 4L9JA 2DFHA 3EUHC 3ELKA 1MZBA 2CQ7A 2VKEA 3CUOA 2DTZA 3E6BA 5HOOA 3QRFF 3TOAA 2VXZA 3CDLA 4GFBA 2KJCA 1SFUA 1V5EA 4IX7A 5JLXA 3PJRA 2OZ6A 3QAHA 1JKPC 1RKTA 3DU5A 3LSGA 4GXOA 4A93J 4N9HA 2LG4A 2OAZA 1A6IA 4LLGF 1VQ8I 1G3SA 2LOOA 2MABA 2DJNA 4W97A 4NNJA 1GXPA 3KE2A 3FXKA 5B1BH 1TW2A 5H6QA 1O57A 2P0WA 5EF6A 5LEKA 1P6RA 3ASOH 1Z7LA 5L3BA 4Q5SF 5F08A 2FF4A 1S9HA 3U1KA 3RDIA 1ON1A 2KRHA 3ZQGA 4BBSJ 2VQHA 4BY1J 2KHMA 5AIPA 1MJ9A 2L4AA 1JUPA 2HTSA 3KLNA 3A02A 4HW0A 3J7YJ 3FWEA 3GUDA 4XKWA 3FMQA 2DOFA 2R5ZB 3HGGA 2ZJQF 2ESHA 4WCGA 1ZGJA 5F6FA 5DD8A 1JUSA 3I71A 4ANJA 1T56A 2EIMH 3ZMSA 3H3ZA 3QP6A 2X6WA 1XSDA 1Z3XA 1B72B 5LRSA 3H3UA 3BJOA 3DWLE 3IUOA 4NC8A 3JR9A 1MMSA 4N9IA 4HF0A 2CWEA 3LA7A 2Y2ZA 4NQWB 3F8FA 2FQ3A 2NS7A 3RYRA 4BGDA 5IYCJ 4IO9F 1LEAA 2QYOA 2BHZA 1Z6TA 1W1WE 4QLCU 2DXIA 4HPQA 3R0JA 2MLGA 4A0YA 1XGOA 2VUMJ 3CJQB 3WTXC 3ZN0A 4C3IJ 1MMAA 5DUKA 3DXJF 4M3EA 1XB4A 4BDYA 2WAEA 3WGGA 4B44A 5CVRA 4HQMA 2VB6A 2E36A 1TT0A 2DA4A 5HNFA 4IHYA 4LG0A 3RTRA 3EDPA 2PFBA 1RPWA 1P2FA 3QP5A 5BQTA 2PBIA 1YW8A 5J8CA 1U6GA 3F6VA 1B1BA 3I4MJ 1GDTA 2E1OA 2HQNA 2L7FP 5FJ8J 1SD4A 4YFXF 4FASD 4WX9A 4DOZA 3R0AA 4JQFA 5ILUA 2WB1N 4M73A 3LNQA 2B0LA 4ESFA 5K5OA 3HKZN 3F72A 3LSPA 3T0YA 3U21A 2OTJI 1SVMA 1UZCA 3P9IA 3JRGA 2VPLA 4BQQA 4I01A 1WI9A 2EFNA 2EV0A 3F6OA 4A0ZA 1YJ9I 2MLKA 3K4LA 4M72A 4P5OA 4QIWN 1VQ5I 4IHWA 4E7ZA 3LAPA 1D1CA 1BIAA 4N0BA 3S15J 1SD6A 1U0JA 3BR3A 2ZFUA 1N77A 3IC7A 4NDLA 3VDXA 5CVVA 5GTIC 1Z67A 1PYVA 2GIVA 1KU2A 2P5LC 1HW2A 3VSLA 5IY5H 3WE2A 1J5YA 4LK1F 3C2GA 1MBFA 3FMRA 3K4CA 5L3CA 2IGKA 3JRCA 4BY7J 3S1QJ 1HXDA 2HOSA 3QQAA 3J80Z 2FU4A 3AG2H 3QPLA 3RPQA 3MKZA 3IRQA 3E97A 2DFIA 1Y0NA 5GP9A 5HLIA 2DK8A 2JWTA 2N8GA 3GLLA 4V2FA 1LUJB 1V54H 3L2QA 5M5XJ 1Z0XA 2JK3A 5H6RA 1VNDA 3BTJA 5JI6A 1TQIA 1FT9A 3HOZJ 2DTRA 2GBYA 3C3WA 3KEOA 1ZH5A 6PAXA 3RSNA 2FMLA 3GTMJ 2RQQA 1XGSA 1VQPI 4XOTA 4D9JA 3SJMA 3F21A 3K70C 1PDNC 2K9LA 2XB0X 2CUZA 2EFOA 4YIRX 1P4XA 2HR3A 1A5JA 1ENHA 1I5ZA 4RS8A 1V5FA 2EZHA 1W36D 4E4HA 3BC8A 2OCCH 5LEJA 3OIOA 3I55I 4IHVA 2EPFA 3OYAA 1YS6A 2K02A 5FKLA 3CC2I 3MEXA 2V1NA 3R6SA 3RKYA 3T1BA 1UELB 2KIQA 2DO7A 4IOCF 4PGGA 3ESWB 2XAJA 2IPQX 3VSKA 3SEZA 2E5NA 1D1AA 4G94A 3VOEA 1WZ2A 1U2WA 5AIQA 1R1UA 3ZCOA 4CCOA 3ZMZA 1T0FC 3PIPF 1IN4A 2Z1DA 1DDNA 2DFEA 3ZP5A 2GM4A 5DUIA 2M0CA 1I50J 2K4JA 3A03A 4Q47A 4HRIA 2PMUA 4M74A 3W6JB 2MFZA 3J7AO 3PQKA 2VJJA 3PSIA 1PVEA 2Q8KA 4XKBA 2XC7A 3A01A 2HXIA 1D3YA 1ZELA 1O7FA 2XPUA 2ZMEC 2IA1A 3EPZA 3TMOA 4RLFA 2VT2A 3FXMA 3PO2J 3P9CA 2FXAA 4A3IJ 2FQ4A 2YR2A 1OR7A 3DFGA 4OAZA 4ESJA 3EUHA 4I09A 3WG9A 3HOXJ 2RNGA 2XGXA 2HDWA 2D1VA 4R8HA 1F9NA 3ZGKA 1W4MA 2RVCA 1R49A 3M1CA 3L2VA 1MMGA 3HSFA 2JN6A 1IUFA 3SDGA 2QWWA 2NS0A 3H35A 1H0MA 2JA6J 4M9ZA 3I59A 3G71I 1FYMA 1TWFJ 5D8LB 1D0ZA 2I8DA 3NEUA 2YUSA 4KIFA 3S14J 1FOXA 5E1WA 5TJJA 1AHDP 2A07F 1P7JA 2QCOA 4JP0A 3LQRA 4MGRA 2V1DA 5E20A 1IN5A 1X1BA 2MC3A 2FUG2 3BG9A 4PUSA 5HDGA 3N97A 3WTWC 2CV1A 3DBRB 3M1EA 4XRMA 1Z6RA 3DV8A 2JA7J 4CH7A 2CQKA 4KJZA 3VB2A 3CMAI 5JHUA 1E3HA 3V8LA 1K4TA 3HDDA 4DNCA 2XAUA 4O5VA 3FBIB 3HRTA 2DODA 5FRMA 3GTPJ 4N4NB 4FX4A 1J59A 4CCNA 5FLMJ 1HF0A 2BVMA 1P4WA 3PUBA 3QYBA 3IWFA 1XMXA 4XR6A 2DMQA 2WTEA 3E5UA 1WJFA 1IXCA 1UFMA 4ENKA 1RUOA 3OL4A 4HNTA 3Q9VA 4BJ6C 3GTKJ 2HOTA 1FP2A 5JR3A 2C6YA 3ECHA 3DTEA 5M3FJ 1T95A 3TDZC 3MZ8A 1EKEA 1R5GA 1EV7A 1YW9A 3IHUA 4LIVA 3S32A 4M3DA 1IRGA 2EFPA 3ZMVA 4CCMA 1K79A 1TP4A 2IEKA 3DTIA 2BY1A 2Y0MA 3HC7A 5GTHC 1FYKA 2XSJC 4QPOA 5HDKA 4XNFA 1B6AA 4EV0A 3HOWJ 2FBKA 1W5TA 2KZGA 4L5IA 3V7SA 5HS8A 1JTYA 4GYIA 2GA2A 1FP1D 4BE1A 1W5SA 4C30A 3IAM2 2XUBA 4RAZA 3JRFA 3AG1H 1IUYA 2L4MA 5HDNA 5FKOA 2DMUA 1NHAA 5D5WB 4FHTA 1I3QJ 1SFXA 4BNCA 4D7NA 2R7TA 5BS6A 1IV8A 2GXGA 1K83J 4ENMA 2VKVA 3PL8A 1CF7A 3OOPA 2X9DA 3RI4A 1DU6A 1YRNB 3HBLA 4L5JA 3OS2A 2Q0OA 2XAFA 4ZYAA 1G8XA 3OIQA 4B47A 3CMYA 4I98B 3GYHX 1S7OA 4LLLA 1MBKA 2IA0A 3KCCA 2ELKA 3M7GA 3TQNA 1F5TA 4NBQA 3QU3A 2BW3A 1HW1A 1XN7A 3HZJA 4A6DA 4DYCA 1JGSA 2WAQA 1KA8A 2XSDC 1RKWA 1X1DA 4PSXA 1L0OC 4XKCA 3HSRA 1BR2A 3L7WA 2CQXA 2KIFA 4Z6YA 1F36A 1UAAA 2DYSH 1ZARA 4X0GA 4IOAF 1XPXA 3H5NA 1C0WA 1N25A 1RC9A 1A35A 4BXXJ 2H6BA 5CPRB 2K3PA 1LQ1A 1RIOH 2ZNZA 2CUJA 1O7LA 2PX9A 5F1JA 1F1ZA 2M4KA 2VL8A 4MEXF 4ZZDA 3H36A 2DLLA 2F48A 3J81Z 4Y3OA 3I56I 3FMSA 4RDUA 4P55A 1Y6IA 4CICA 4I0BA 3JSPA 1Z91A 4G6TB 2PJRA 1JUMA 2V79A 3K1NA 3CCVI 5E3NA 2A6HF 3JRDA 4HA8A 1PUFA 1W0TA 1R1VA 2QSFX 2BZTA 1OPCA 3JSOA 2NVQJ 2Q2EB 3CP2A 1QZYA 3P5JA 4B09A 5LBQA 4IQJA 3HOTA 5DYMA 5LLQA 4MEYF 5JVGF 4M9SA 3VYTB 1SVOA 2M8EA 5FLXK 3JW4A 1G3YA 2M7BA 3BZ6A 4XMYA 1J0RA 1TTYA 2BV6A 5IT9K 3MKLA 5DCMA 4ZC3A 1HC8A 3O2PE 1QZZA 3CP8A 3RIRA 3BG7A 3PM1A 3GWZA 5KNLA 4OIPF 4IEJA 1BI2A 4P9UA 2DCEA 2HZDA 3ULQB 5IT3A 2GZWA 4KITB 1Y39A 2OA4A 4PJMA 1HBXG 1Z7UA 3HTSB 4DQ2A 1ZRDA 1A6QA 1FBQA 3I54A 4LGWA 4E6KG 4ZZLA 3MCZA 3KEQA 4P9FA 1U3EM 2JJ7A 1SMTA 2Y30A 2O5RA 5EZGA 1Y0UA 3OYEA 4XKVA 2ZBKA 4CYCB 2VC0A 2VPRA 2GWRA 2A3SA 4BACA 1DUXC 3DKXA 1BOAA 3T8TA 1TW3A 3L00A 3S2WA 2HEOA 3BQZA 3DQVC 1OCZH 3CF5F 2DN0A 1T0FA 5HLHA 1R71A 1QBJA 3ZPLA 1LPQA 2XF7A 2G9WA 1ZRFA 4XLCA 3S8PA 1MDMB 3Q5FA 2VOPA 2DT5A 1WH5A 1PP7U 2M1BA 4GYGA 4CUGA 2AHQA 5FD6A 1NK3P 1LFPA 2RREA 1LFUP 3H0DA 3V8JA 5IP7J 5J3LA 4RGRA 4DGWB 2LSOA 3M8JA 5KVRA 2K40A 1TZLA 4LMYA 3IWZA 1JT0A 1ZR4A 1BA5A 3DCFA 3MMYB 2QBYB 4Y7NJ 2XKPA 4ENJA 3O8HA 3IP4B 2W4SA 5JLWA 3OR2C 2AXTC 2FRHA 5CKTA 2R5ZA 4NUBA 2L02A 4XL9A 5ICFA 3PO3J 3CLQA 4Y4RA 2YU9J 2Z99A 3HPHA 3CCEI 2EA2A 2M7AA 3WGIA 4I76A 3CDHA 2O6GE 3GTLJ 1MMDA 1NH3A 3LFUA 1B4AA 3HKZA 2OTLI 1FX7A 1IN6A 1J09A 2FOKA 1B72A 1USTA 2O61A 1ETYA 1ON2A 2DDAA 2DW4A 1YIOA 1FYLA 3LL7A 3CCUI 1NK2P 3E3VA 3FHZA 1QGPA 2XGCA 4NQWA 3GFIA 3HUGB 4DZJA 3W2VA 1X58A 1YX3A 4GCVA 4L18B 3AFHA 1N78A 2EIJH 4WXDA 1O3QA 4XSXF 3GTGJ 3LMMA 3GO5A 3ONQA 4PGHA 4KT6A 3GX4X 4U0YA 3O3KA 2XVCA 2GOXB 2PMZN 2QSGX 1SMYF 4U87A 2KL4A 1WRJA 3D1NI 2LF7A 1ETVA 2R4GA 3BJAA 2QLZA 2WC2A 5DDGA 4RAYA 1BBYA 2L5QA 2K27A 2W00A 1FZPB 1DU0A 3ZQCA 1Y1WJ 3J7ZI 2OU2A 2NVYJ 3ZMUA 1Y8QB 1TL8A 1S3JA 2LR8A 4NC7A 3BPVA 5FKMA 3LWFA 2CW8A 3ABUA 3SZPA 3FF5A 1O3SA 3G4SI 3HM5A 2LVSA 2X1CA 2EZLA 1UHSA 2G0EA 3WHCA 2XASA 2QENA 1I3AA 2CG4A 4V19K 4WF2A 1LVAA 4HEA2 2VC1A 3EUAA 4B48A 1YLFA 1IN8A 3H9JA 1B8IB 1DP3A 2OQRA 1KYWA 3Q0VA 4MLOA 1BN5A 3HB9A 4XLHA 4IKFA 1BJZA 1QA6A 3LAJA 1MIJA 2DA6A 2Y0SN 2FNPA 3U1DA 2RC4A 5E8IA 2EV6A 2VKHA 3F0CA 3ABTA 4P96A 3F3XA 1R1TA 4J01A 3TL4X 3Q0WA 1OYIA 4XLNF 1IRFA 2D1HA 3E5XA 4FE7A 1QVUA 2IA2A 5C4XJ 1TT5B 4AYBN 1KU3A 1OYWA 4A2UA 3DLLF 3CD6I 2FJ1A 4I6ZA 2M34A 4G6QA 4E7HA 1L3LA 2ZJPF 5GAHJ 2ICWG 4EVIA 2X0LA 3HPGA 2L01A 3U9GA 1MNEA 4YELA 3F23A 4B3XA 2W85A 1GV5A 4F92B 2KIMA 3K10A 4DIQA 2L9NA 2MH2A 4HNVA 3HTUA 4AWXB 4Q48A 1W5CC 2DDBA 4BKXA 4C3HJ 2LBFB 2RV8A 2V26A 1K61A 4ETSA 2CW7A 3GLXA 3JREA 2DMPA 3KIOA 4LK0F 1K6OA 3AL0B 1REPC 4JYKA 2X1EA 3DTKA 2NNNA 2ELHA 4XRSG 2DMNA 3RKQA 4RLQA 4ZYDA 5F27A 3M4OJ 1SEUA 2COBA 2VBWA 5BMZA 3A1YA 5E18F 4X1EA 1U9NA 4A3DJ 4XLEA 1DQUA 3C1DA 3BG6A 3OYKA 2ZSIB 2L0KA 4M3GA 2BEOA 3TO6A 4P1WA 4RB3C 3GFMA 2JMWA 1LVKA 2HI3A 1FTTA 1YYVA 3WG7H 3FM3A 3HJEA 3KP5A 3HSEA 4PJJA 3OS1A 1FSEA 4XRSA 5H2FC 5FB2A 3GZNB 1YIJI 1ZLKA 5F0FA 4PK4A 2X51A 2A5WA 5E1ZB 2EV5A 2M2EA 4MNUA 1SFEA 1JKQC 3GF2A 4BU2A 4KNYA 3KPHA 3LFKA 1WJBA 2I5UA 3WE3A 4B43A 2HFHA 1P4AA 1HSTA 1ORKA 1KU9A 3ERED 2MBFA 1GUUA 3TOBA 2AO9A 2R3SA 3E6DA 3FXQA 1B9MA 4EJUA 1PP8F 1H88C 3B6AA 3RYPA 1SAXA 5D4RA 2JQ7A 1XTAA 2K9MA 2R7OA 3IAS2 2LY1A 2LD5A 4FQGA 3KLOA 2IS6A 1E2XA 5IYBJ 3K4MA 1SC7A 3MD2A 4YEJA 5M5YJ 3OYHA 3K9TA 3PNTA 4DBRA 4XLAA 2FX0A 3OY9A 4U0WA 4QPQA 3M8EA 2W82A 2DK5A 1MD0A 2W24A 1VQOI 1IV6A 1P9QC 2O8XA 5D5VB 3VWBA 2E1CA 1KQ9A 3A4CA 3BLYA 4CCKA 2R7SA 2ZXJA 1YJWI 4GRIA 3GEZA 3NARA 1TWCJ 1EA3A 2Y9YA 1RNLA 2HZTA 2KDZA 3A0BC 4QWQA 4JBAA 2NVTJ 1HDPA 2XPVA 4LFUA 4ZYHA 4BE0A 3BZCA 3KX2A 3ECOA 1ZTRA 1YE9A 2YX7A 1S7EA 3LSTA 2V9KA 2G7UA 2CW0F 2XIGA 3TW6A 2FSWA 3VYSB 5K1YA 4HV6A 4IHSA 2KJBA 4BQNA 5GPCA 1ZK8A 2F5VA 1E3PA 2BE5F 1IF1A 1U5TB 4UUSB 1ITYA 1RRJA 1WJEA 4HX7A 1KQ8A 4A3MJ 3OYIA 3LQQA 1XCVA 2P6TA 4CHUA 3SZTA 3AKZA 2F4IA 4I02A 1QO0D 5FGMA 1I27A 1W7PD 2CO5A 4M6YA 1U9OA 4B4CA 4LB6B 2WWYA 3FK6A 1HOMA 2L54A 2DFFA 2XGDA 1FEXA 4OIQF 2WADA 2BY2A 3ZOBA 2W57A 3F8BA 5TISC 2M9HA 1T2KA 1O3RA 5DCFA 4HX4A 3CCYA 2AQFA 3ZN1A 1FWZA 3RJPA 3ZRGA 1RI7A 1V4RA 4ZDOA 2OPTA 2DPUA 2EA4A 4RMNA 2RKHA 3CUQB 2F5DA 3BWGA 5DEQA 3OIPA 3IL2A 5F64A 5LHHA 4A3LJ 1SFKA 1XMKA 2MA3A 5BOXA 4Y13A 1GHCA 2GQQA 1PJRA 2KLOA 4FT8A 4WK8F 1QU3A 3B6CA 3LSHA 1SD7A 2CH0A 4CYDA 5J4YA 3SHFA 5EEGA 2HQ5A 1OLTA 1P7IA 3I58A 1X3ZB 4BXUA 1T33A 2ISYA 3ZQ7A 4HNUA 1YRNA 1KZHA 2O0YA 4R1HA 1R9TJ 1UG0A 1FOWA 5FKKA 4L5EA 4Y52J 1BI1A 2RQPA 3M8FA 3BG3A 2VBXA 2ID3A 2YU3A 1I1SA 5D5UB 1TQPA 3ZQQA 2EILH 4MQVA 1QRYA 2L9RA 1WVRA 3KP4A 4XBFA 1MBGA 3A0HC 3GZ5A 3LSKA 2R7ZJ 3ROUA 2XAHA 2TDXA 2P8TA 5HNHA 1RR8C 2QQ8A 3PUFA 2E2IJ 3AL0C 5CJ9A 4E7JA 2A6EF 1VQLI 2QSHX 4BQAA 1U8BA 5M3MJ 2RN7A 1BM9A 4XICA 2Y9ZA 3KP7A 3WU1B 3REOA 3BOQA 1MBEA 4ON0A 1XMAA 1ERDA 2XF6A 1MBHA 2IW5A 3WU0A 2NYXA 2MGQA 3WU2C 5L3EA 1Q1VA 3OYJA 2X4HA 4FTHA 3JRHA 3FXOA 2FE3A 2L9SA 4HG2A 4UVBA 1I39A 2TRTA 1OISA 4LG3A 2LKSA 1LEBA 1GLNA 4NB5A 2GXBA 4F7ZA 3ZXSA 2VODA 3V7RA 2PLYA 2DJIA 3DKWA 4XM3A 2OD5A 4M3BA 4CCJA 4U7DA 2OC6A 2YX4A 2Q1ZB 5KK1A 4JOMA 1DPUA 3TDUC 4HDUA 3EYYA 4HYEA 4PJLA 2HKOA 3ZQLA 2K5CA 1BC7C 4BE2A 3IH2A 1IJWC 1YI2I 1ZN2A 3KYDB 3MFKA 3C2HA 3K2AA 2CV2A 1IAWA 5LGUA 5FROA 2CYYA 5HLTA 5C4JJ 3BJ6A 3RPUA 5ICCA 1K4SA 4XLFA 4BHCA 2L7ZA 4WXHA 3L2RA 3CO7C 5E8GA 4LITA 4A5MA 1HKTA 2V9VA 4KN7X 3H1CA 4RM3A 2JSCA 1JE8A 4UB6C 4CYCA 4GGGA 1K6YA 4UVCA 3H9GA 4Y17A 2JZYA 2M0MA 4YRVA 4I2OA 2KDOA 3TP0A 1SANA 1YQAA 2HYGD 2LP0A 4YFKF 1H8AC 5J1RA 1HW5A 1MW7A 4AD9A 2ESNA 3J80K 4E7SA 2K3FA 1BW6A 2DA7A 3KETA 1T38A 1MDMA 2NOJB 2AS5F 4RA2A 3IKVA 5B1AH 2DA5A 1XDUA 3UNGC 1ZKGA 3BDDA 1ETXA 3S2HJ 3L9FA 1R23A 3CF2A 3F9KA 1JXSA 1H9GA 3VYRB 3NWSA 1R4NB 5EG0B 1TWHJ 1GVDA 2KIUA 3BCAA 4UVAA 3OYBA 3IH4A 4C2MJ 2PI0A 3S17J 2NXNB 2QUFA 1YITI 1VZ0A 3K4BA 2DBBA 1ZQ3P 1ZR2A 2QBYA 3HOYJ 1U5TC 2PEXA 1AU7A 1YG2A 5JHFA 1DPRA 2UXNA 2E1NA 2CUFA 1UB9A 3H0GJ 1MNMC 4V2GA 2GXAA 1S29A 2VONA 1I6HJ 4UV8A 4IHXA 2V4JC 3OSGA 1YO5C 1WJDA 2JA8J 3BT9A 2M8GX 2KMUA 4M9XA 1MSEC 3LSMA 5GPAA 3OYMA 1F4KA 4CSWA 1TQMA 2VQGA 4KIGA 2FBIA 1D8JA 2EZKA 1J7KA 4HF1A 1T98A 2XDVA 2HDCA 1CGPA 4ZDLA 4ZTFA 3DU6A 2E1MB 2J5OA 1FMVA 4FCYA 1MBJA 3FBNB 5K5QA 1GT0C 1IXRC 4EM0B 3HUGA 4C3JJ 3H9QA 4AIJA 3TGNA 3QPHA 2QZ8A 4PCQA 4KISA 4DZPA 1PUEE 1G3TA 4PJNA 2QQBA 1Y1VJ 5JFRA 2F6CA 3FM5A 3TKYA 2CQQA 2X6OA 3PNVA 1MMNA 1TNTA 4A69C 4AVPA 5DV5A 1ZRCA 1XGNA 2H27A 1K78B 2IT0A 1QQIA 2UWMA 2R7QA 4Z2YA 3S3NA 3A2KA 4RGSA 1J9IA 3IKTA 4BAYA 2IAIA 3ZMDA 3O8GA 2VE9A 3S16J 3CESA 5DM6F 1QVTA 3K1PA 2NVXJ 1VQ9I 3RQ4A 1UCRA 3G6EI 1ETQA 2ZB9A 4J00A 1LKXA 2DT7B 2O8KA 3MVPA 4HF2A 3OYLA 4EM2A 1S7AA 2W48A 1IDZA 5CVIA 2OJED 2I10A 2IS4A 1TBXA 2VIXA 2X6XA 3OMYA 2EBIA 2VI6A 1B8IA 3S1MJ 4O3MA 2D5VA 2IGMA 4HSRA 3CCSI 2A69F 1E3OC 1BC8C 2NS8A 3OYFA 3SYTA 4OOIA 2E71A 2V7FA 1YS7A 1WQ2A 2VKDA 1JTXA 4PDKA 4YIFA 4A12A 2KRCA 3F8CA 1VQ4I 1I1GA 1VQKI 3QOEA 2OQGA 3N4MA 1VTNC 1XD7A 1ODDA 3QODA 2YSRA 4EGYA 1A36A 2R5YB 2L9VA 2XROA 4EM1A 1JHFA 3H3VK 3K4NA 1U8RA 1KU7A 4H0EA 2VQCA 3D5RC 2HPMA 5BPIA 3AG4H 1AWCA 2A61A 3L1PA 4KDPA 4CDGA 2HOEA 1H89C 2Y69H 2HVRA 1ZG3A 5LGNA 3FISA 2R7UA 4JX6A 2H1LA 4A0XA 2MSYA 1YX5A 3RCOA 1VFCA 4MFEA 2PJPA 1BR4A 4XN0A 2LBFA 3DLAA 3FKIJ 2UXXA 2Y31A 2P7CB 2KT0A 2VLAA 4H4KC 2JA5J 2CGPA 3OYGA 4CCLA 4AVZA 2JRMA 1V5GA 3EETA 2CMPA 4RBOA 4XORA 5HODA 1T39A 5FFXA 4D5CA 3F8NA 2E5ZA 1OCTC 3CCMI 5ILSA 1M1EB 4BJTA 4G8XA 1Z9CA 1TLHB 2CUEA 3ABMH 4KICA 4DW6A 2F5FA 2P5VA 3EUKL 2VBYA 4KA4A 5CQEA 1YTYA 1WI3A 1KYZA 3R4KA 2QVOA 4BJ5C 3OOUA 2WY7Q 3SQNA 2YS9A 3FX3A 3GFJA 4BL0B 3L2WA 2WB1A 4B1RA 1EH6A 4JK1X 5CVUA 2O7OA 2TCTA 2HWVA 3DPTA 2DOEA 4UHTA 2ELJA 5IYDJ 1IN7A 1IC8A 5EZHA 1BIBA 3D5LA 2QM3A 3DKYA 3TO7A 2L7MP 1AOYA 3X2QH 2ISZA 5IP6A 5D6FA 4M6XA 5IOZA 3MKYB 3V4GA 3BTIA 4HX8A 5E1XA 2LH9A 2ACJA 2E35A 2EINH 5EGOB 2K4BA 2IGOA 4MTEA 2F5EA 1S5LC 2IGNA 3UKGA 1MSFC 2XB5A 1YFHA 4E7LA 5D5XB 4NC6A 1S72I 1XG1A 3CMMA 4II2A 4G12A 1LDDA 2Z9OA 1FPQA 4J19A 2WAFA 2V1XA 3IRRA 3J81K 4HLYA 3CMEI 5J1YA 3BR2A 3HG9A 3BR0A 2V6EA 1BL0A 2O03A 4KT5C 4XK4A 3CDIA 3KYLA 2QGUA 2MD5A 3I64A 1WHUA 3I4NJ 2DA3A 3LSJA 4C2UA 4S04A 4RB1A 3M3YJ 4OMYA 3HIFA 3AAFA 4UB8C 4IPAA 1PUFB 3CCQI 2P7VB 3WTUC 3SXYA 5ICGA 3FK7A 1YW7A 3P7NA 1X3WB 4I0AA 1JKOC 2E1MC 2F5CA 2MC4A 4A6EA 1X4PA 2EFWA 2LTPA 3JTGA 4FE4A 2JVGA 1HA8A 4MQ9F 1Q1HA 2K86A 2JPBA 1T8IA 3CC7I 5J47A 2EZIA 4ASNA 3MKWB 1RETA 2WAQN 2ZXHA 4KUMA 3HGYA 1UMQA 2FD5A 4ESBA 5CYVA 1U5TA 2IP2A 3G1LA 4UUSA 1LE8B 4K2EA 2E2HJ 4B3AA 2CU7A 5LHGA 2P6SA 5HS7A 1IGNA 1RR7A 1MJBA 3OYCA 1V3FA 1JHHA 3SEQA 1TNSA 2CS3A 3PQJA 2FMYA 4I99C 1G3WA 2ZCWA 3T8RA 2QQ9A 3TW7A 3G1OA 2E7WA 3ZR8X 3DEWA 3KZYA 4RAFA 1YJNI 2MW8A 2ZSHB 2HGCA 4PSWA 5FRNA 5EEAA 3HRUA 1JJ6C 3EQLF 2XGEA 2VE8A 4RB0A 3BZKA 3RZOJ 1IZ1A 3DEEA 3I9V2 4BS9A 1H9TA 2VBZA 4E70A 2R7XA 3WHBA 3BR5A 1ETOA 3W6KB 2KISA 4CXFA 1NTCA 4XN3A 4UUVA 2DAOA 3CUQA 3I53A 4HQEA 2JT1A 2F4MB 4MFDA 5DD4A 3C18A 1FLIA 2UZKA 1LNWA 2MH9A 1NG7A 3WGHA 4FISA 1FIAA 3CTAA 2K7LA 3OS0A 2XV4S 1TC3C 4OU0A 5EDNA 2WV1A 3LA2A 3FDYA 4TV7A 3CC4I 2ZMEB 2JRTA 1XC5A 5K7FA 1EF4A 2ECCA 3V7CA 1G59A 1W7PB 2GA1A 3FXLA 2ID6A 1WWXA 2JTVA 4BQOA 2VJ4A 2ZFWA 4IF4A 4AIKA 1JT6A 4HSTA 2LY9A 1YOVB 3W3CA 2W1OA 1R58A 1FSHA 2WV0A 1AKHB 2QF7A 3VFZA 2X48A 3JRBA 2B63J 3AG3H 1QNTA 3CJTB 3H92A 9ANTA 1D5VA 2HTJA 2B9SA 1TWGJ 3COAC 5K7HA 2P5KA 2R7FA 3OSFA 1X2NA 2JUCA 4BHBA 3E7LA 4Q4ZF 4BEHB 3C7JA 4JX5A 1ZREA 2HNHA 1X1CA 1HQCA 3OV8A 2RNJA 3Q9SA 4MTDA 2BVLA 4PZJA 3HEFA 3W6VA 2E34A 5GAEJ 3LA3A 2DT6A 1WJ5A 2KRFA 4II3A 3K70D 2STTA 3HOUJ 1F43A 3NQOA 1EJ9A 5TRDA 2ETHA 4MO7A 4IRGA 3BTCA 3VODA 3G73A 3I5UA 1HKQA 5M5WJ 2BOLA 1WPKA 2JUGA 2GOMA 1ZG1A 4QSHA 3TBIA 4XQFA 5HLGA 4ENNA 5C3EJ 1W0UA 1HSJA 1IDYA 5GAGJ 5B5EC 5J8FA 3K0LA 1WKMA 1VQMI 1LDKB 1VQ7I 2KFDA 5E3OA 3IV5A 1XS9A 2LREA 2ZO4A 3ZQFA 3HXLA 4XOPA 1SD5A 1XX5A 1ZYRF 4DYQA 4F55A 1BI0A 3MWMA 3H5RA 1A31A 2VASA 2Z33A 3CCRI 3TEDA 1OCOH 1FNNA 2ZXIA 2K9SA 4W1UA 4HBLA 1GV2A 4HLXA 3L2CA 1EH8A 4D1QA 3GZ6A 5J40A 1K7AA 3JAMZ 5E3MA 1OFCX 1X2MA 3U2RA 2H8RA 3HRSA 4JX4A 2OBPA 3KP3A 3ISPA 3GVAA 2P81A 4RM2A 1FTZA 2A6TA 1JGGA 1GXQA 4XONA 2VQLA 3WTSC 3BR1A 2RDPA 3Q3SA 3QPTA 1ULYA 2M30A 2DOAA 2L2OA 3ZQHA 2BXZA 1O4XA 1R00A 4E7IA 1XSVA 2EWNA 4ZDPA 1R6RA 1MKMA 4IL6C 2VXDA 2ZNYA 4XSZF 5F0CA 3VYUB 1SAUA 3VPRA 2DA2A 4C2TA 4LJZF 1X1AA 4G6DA 2H6CA 1D5YA 1WSUA 1X4OA 4AIDA 4A3GJ 3O6BB 2BGCA 2PMHA 5ILVA 5EG0A 4A3BJ 4L0YB 4IZZA 4CGZA 2EFQA 2NRAC 2BY3A 5EEHA 5KCMA 2EK5A 4BXFA 3JCUC 3PFYA 5ERIA 2CFXA 2E7XA 3BR6A 1ACIA 3F22A 2XKOA 3ABKH 3D5SC 1MGTA 5L3FA 1ETKA 4Y15A 1VI0A 3GXOA 5D6EA 1YHQI 1ZHFA 4EATA 5LHIA 4IRHA 4U0VA 1KONA 3P9KA 2VJ5A 2EB7A 1Z05A 1ZAOA 5DM7F 1A04A 4ZTJA 3ZQIA 3S3OA 2IXSA 3C2BA 4HZFA 2CSOA 4HOBA 2NOGA 3QPSA 2LLKA 2Z5UA 4LB5A 1D0XA 2NVUB 4S0HB 2RGVA 1LFBA 1P92A 4OWRB 5D4SA 5L3GA 3G3ZA 2HU9A 2H8WA 1OCPA 1Y8RB 5KAFC 3WTVC 1BJAA 1Y56A 2QQAA 1R7JA 1WJAA 1BI3A 2LC2A 1U78A 3GBGA 4G7ZF 4UXNA 3BTLA 3QYFA 2LK2A 3WTYC 1IG7A 4QTRA 3FIWA 2H09A 5E17F 1K78A 1ZGWA 3KZZA 1GVJA 2X85A 5EYRA 4HDVA 4L9VA 1TWAJ 1J2XA 1IRXA 2KKOA 4OIRF 2GAUA 1QHHD 3OYDA 1D8KA 3F8MA 4ZH4F 4I7HA 2WY8Q 2DYRH 2O9LA 1ZGAA 2Q2EA 5J1UA 4L9TA 1G6NA 3BQYA 4LG0B 4AU7A 2COMA 2E19A 2HXOA 3JRIA 4BDZA 4RGXA 2HYJA 3B02A 5A2QZ 3HHGA 3DF8A 1BR1A 4OAYA 2BY0A 3T5XA 2R7VA 3E5QA 1EH7A 2A5YB 2ECBA 3SZGA 3DEUA 4OINF 3DPUA 5FLXZ 3KZIC 1BW5A 2H1KA 2CRGA 2EIKH 4YIIA 4LLNA 4AUXA 1T6SA 2HVSA 5IPAA 5IT9Z 3L09A 2HDDA 2ADUA 3NAUA 1VQ6I 2HOAA 2PG4A 2XRNA 4UUTA 4KMFA 4A5NA 3I3LA 4RAGA 3CZ6A 2W25A 1HKSA 2VT3A 5FKNA 1W36C 2R5YA 2FNAA 2K9NA 4CZZA 2XAQA 3K6GA 5BPDA 3GTOJ 1WH7A 4U88A 2JA2A 1FMWA 2P4WA 1XSXA 3SFIA 4NHJA 3I4PA 3BY6A 4BHPA 4G7OF 2KPMA 5IOYA 4D0PA 1QHGA 5F04A 3JAMK 4IVNA 3V8KA 2E2JJ 1WJCA 2IRFG 2WBMA 2XHKA 3M9AA 2XAGA 2LY2A 2EH3A 4PFPA 1X19A 3FHNA 5FO5A 2DU9A 2LFBA 1MH3A 1JJ8C 1R22A 3I0TA 3DBLB 1B9NA 5ED4A 4M3FA 3GTJJ 2ZXWH 2VOOA 3ABLH 5LD2C 2NAZA 2XRLA 4L0ZB 2QA4I 4LIUA 2PMZA 3PSFA 4PJ0C 3DP7A 1QPIA 1OMIA 1FIPA 1OCRH 2HKXA 4Y33A 3CJRB 1VF9A 5L3DA 4M6VA 1ZG5A 4F52A 4E7KA 3LOCA 2A05A 2BYVE 1OYYA 5K7ZA 1IRZA 2KP6A 3K69A 4BBRJ 5KAIC 1FJLA 1Z77A 2M5WA 3IH3A 2CFOA 2QKLB 2A68F 3OYNA 1B59A 1WFXA 2YPRA 2FBHA 1RESA 2FA5A 1ZLJA 1LDJA 1MJAA 1R36A 4CO8A 1HLVA 3BCBA 5CLSA 1STZA 3WTTC 3SFZA 2L3DA 4IHTA 4B8XA 2JSPA 3PFIA 2V1UA 2JVHA 2Y0SA 3W2AA 1I6XA 2PN6A 3K2ZA 2LRDA 2V9PA 2STWA 2R7WA 2HVQA 2F4OB 5CQGA 3G2BA 2CJJA 4A3EJ 5K5RA 4UY8I 5FD5A 3WTZA 1Z3YA 3BG5A 3CUQC 3EYIA 4ZYGA 4AYBA 4A3JJ 5EGOA 4CZCA 2FOWA 3ML6A 2BXYA 3OL3A 3OWTA 3S93A 4BH9A 3MZYA 2ME6A 4YFNF 3Q0UA 4FX0A 2CQNA 3PIOF 2XPWA 2LNBA 2G7HA 5LRRA 3A01B 1FOKA 1AA7A 1IXSB 3GMEA 2K9QA 3CLOA 2GIZA 4F3QA 3GTQJ 1UJ8A 2PQ8A 4ITVA 1Z1DA 1FBSA 3H5AA 3B73A 5EJCA 4EJTA 4HAMA 2IS2A 2ME0A 3GW2A 4D7MA 4MIMA 4KYWA 5J6XA 1V55H 4ZJZA 2Y48A 2HYFA 3SDBA 3D0SA 4XIDA 3CCLI 3RKWA 3S1RJ 2NNYA 2JPCA 3I59B 3KEYA 1CQTA 2GLOA 4EQQA 2AQEA 1UG2A 4S05A 4WWCA 3RKXA 2DPDA 5A2QK 2DMTA 3CO6C 2L7KA 5HS9A 1IW7F 4L9NA 5JVTA 1LB2A 1POGA 3RQIA 3E0JB 5LGTA 1R5ID 2J5PA 3KFWX 1FC3A 3ASNH 2LYCA 1WCMJ 1LJ9A 3R61A 2VN2A 2WA0A 5F0HA 5J4VA 2ZJRF 3LSIA 4IXAA 4AC0A 2ZKZA 2ZC2A 4XRFA 4EJVA 1NG6A 3GFLA 4UV9A 2HQAA 3TO9A 3KP6A 1LE8A 4ZYEA 2R92J 2RAEA 1XGMA 3ZMTA 5CVJA 1WGXA 2R7RA 3MAJA 2R0QC 1ONVA 1MNDA 2FEZA 2UV1A 2W7NA 4KFCA 1SVLA 1X3UA 1XDSA 3BP8A 3N05A 3WODF 2R7DA 2ZJ2A 2X6YA 2Z2SB 3W2WA 4KN4X 2BBYA 5BNGA 3JRAA 2HS5A 2KQRA 2KZVA 3BPXA 4LD5A 4MHGA 1J75A 2LKXA 4DJAA 4IRIA 3S1NJ 4XLPF 2OF7A 3DPLC 2BHYA 3FKJA 1UHWA 4AM3A 3QU6A 1R5HA 2M4GA 2HPIA 1APLC 1UHMA 4CA0A 3QWLA 2D45A 4U7BA 5H20A 2DI3A 2EQRA 1D1BA 1S6LA 3DBHB 1Z21A 3UR3C 1E0EA 4HV5A 3R60A 1BOBA 4R79A 1IO2A 1RUNA 4BYYA 1DP7P 3NRVA 3KYCB 5HVQC 2LDUA 2W84A 4ABZA 5D8KB 2D2WA 1OCCH 4X6AJ 4AIHA 3K1MA 1OJLA 1O3TA 1G4DA 2O3FA 4KMUX 3FXJA 2M45A 1N75A 1FY7A 3K4KA 1SFOJ 3MZHA 4UNOA 4IQ4A 2ZMEA 3HHHA 2OZUA 1OKRA 4G7HF 1MH4A 3K4JA 4DYRA 2LKPA 1JKRC 1W7PA 5E3LA 1CF7B 2OUMA 1KQ0A 3QOPA 1FBUA 1RZ4A 3NWTA 5AONA 3E6CC 2QEXI 4G9YA 1HDDC 3CCJI 3JTHA 1XCBA 4WXCA 1AKHA 4EGZA 2Y75A 3L2UA 3K7AJ 2BW3B 2UUZA 5KHDA 3LSRA 2M3AA 2F2EA 2MD0A 3MQ0A 2CV0A 2Z3YA 3OR1C 3J7AY 3FXRA 2K85A 2B7EA 3CJNA 4C9YA 4BEHA 5ICEA 1OQYA 2X1DA 4LOCA 1R4MB 3PNYA 4EMSA 4EJWA 5E79C 4GO1A 2M87A 3TP3A 1D0YA 2DA1A 2AXLA 5C44J 5FLVA 2IJLA 4RGUA 4RB2C 3V42A 1T08B 4IJAA 3RPUD 1S8NA 3FZVA 2DQLA 4DBQA 2H94A 1ETWA 1QPMA 2EJRA 1X1PA 5TGTA 3HOVJ 1QZEA 1KGSA 4N4OB 4M71A 2PJRB 5FFZA 2LMDA 3HRMA 3E6MA 4D5FA 1DGWY 4PFOA 3E1SA 3MN2A 1USSA 2MYSA 2IVMA
chains in the Genus database with same CATH topology
4YG2F 2V6CA 4EJOA 4O6JA 5F1RA 3HYIA 3KP2A 4OIOF 4KIBA 3HOSA 2HQRA 5DCMB 2DQRA 4OMZA 3FXUA 3BROA 2LF8A 1E17A 3VEPA 4L9JA 3ELKA 1MZBA 3CUOA 3E6BA 5HOOA 3QRFF 3TOAA 2VXZA 2KJCA 1SFUA 2OZ6A 3QAHA 4GXOA 4N9HA 2OAZA 4LLGF 1G3SA 1GXPA 3KE2A 5H6QA 1TW2A 1O57A 5LEKA 1P6RA 5L3BA 4Q5SF 2FF4A 3RDIA 1ON1A 5AIPA 1MJ9A 2L4AA 4HW0A 2HTSA 3KLNA 3FWEA 3GUDA 3FMQA 2ESHA 4WCGA 1ZGJA 5F6FA 5DD8A 3I71A 3ZMSA 3H3ZA 3QP6A 1XSDA 5LRSA 3H3UA 3BJOA 4N9IA 4HF0A 2CWEA 3LA7A 3F8FA 2FQ3A 3RYRA 1LEAA 2QYOA 1Z6TA 4QLCU 3R0JA 2MLGA 4A0YA 1XGOA 3WTXC 3ZN0A 5DUKA 3DXJF 1XB4A 3WGGA 5CVRA 4HQMA 4LG0A 3RTRA 3EDPA 2PFBA 1P2FA 3QP5A 5BQTA 2PBIA 1YW8A 5J8CA 1U6GA 3F6VA 1B1BA 2HQNA 1SD4A 4YFXF 4WX9A 3R0AA 4JQFA 5ILUA 4M73A 2B0LA 4ESFA 5K5OA 3F72A 3T0YA 3P9IA 4I01A 1WI9A 2EFNA 2EV0A 3F6OA 4A0ZA 2MLKA 4M72A 4P5OA 3LAPA 1BIAA 4N0BA 1SD6A 3IC7A 5CVVA 2P5LC 2GIVA 1KU2A 1HW2A 3WE2A 1J5YA 4LK1F 3FMRA 5L3CA 1HXDA 3J80Z 2FU4A 3RPQA 3IRQA 3E97A 2DFIA 5HLIA 2DK8A 5H6RA 5JI6A 1TQIA 1FT9A 2DTRA 3C3WA 3KEOA 1ZH5A 6PAXA 2FMLA 1XGSA 3F21A 1PDNC 2EFOA 1P4XA 2HR3A 1I5ZA 4RS8A 5LEJA 1YS6A 2K02A 3MEXA 3R6SA 3RKYA 3T1BA 2DO7A 4PGGA 2XAJA 2IPQX 4G94A 3VOEA 1U2WA 5AIQA 1R1UA 3ZMZA 1IN4A 1DDNA 3ZP5A 5DUIA 2K4JA 4Q47A 2PMUA 4M74A 3W6JB 3J7AO 3PQKA 2Q8KA 1D3YA 1O7FA 2IA1A 2VT2A 3P9CA 2FXAA 2YR2A 1OR7A 3DFGA 4ESJA 3EUHA 4I09A 3WG9A 2XGXA 2D1VA 4R8HA 1F9NA 1W4MA 2RVCA 3HSFA 2QWWA 2NS0A 1H0MA 4M9ZA 3I59A 1FYMA 5D8LB 3NEUA 4KIFA 5E1WA 5TJJA 2A07F 3LQRA 4MGRA 2V1DA 5E20A 1IN5A 2MC3A 3N97A 3EYIA 5HDGA 3WTWC 3M1EA 1Z6RA 3DV8A 2CQKA 3VB2A 5JHUA 3V8LA 4DNCA 4O5VA 3HRTA 4FX4A 1J59A 1P4WA 3IWFA 2WTEA 3E5UA 1IXCA 1UFMA 4ENKA 1RUOA 3Q9VA 1FP2A 5JR3A 2C6YA 3ECHA 3TDZC 1R5GA 1EV7A 1YW9A 3IHUA 1IRGA 2EFPA 3ZMVA 1K79A 2Y0MA 1FYKA 5HDKA 1B6AA 4EV0A 2FBKA 1W5TA 4L5IA 3V7SA 5HS8A 4GYIA 2GA2A 1FP1D 1W5SA 2XUBA 4RAZA 1IUYA 2L4MA 5HDNA 1NHAA 5D5WB 4FHTA 1SFXA 4BNCA 5BS6A 2GXGA 4ENMA 1CF7A 3OOPA 3RI4A 4L5JA 2Q0OA 2XAFA 4I98B 3GYHX 1S7OA 4LLLA 2IA0A 3KCCA 3M7GA 3TQNA 1F5TA 3QU3A 1HW1A 1XN7A 4A6DA 1JGSA 1KA8A 1L0OC 3HSRA 3L7WA 2KIFA 1ZARA 1C0WA 2H6BA 1LQ1A 1RIOH 2ZNZA 1O7LA 1F1ZA 4MEXF 4ZZDA 2DLLA 3J81Z 3FMSA 4P55A 4CICA 4I0BA 3JSPA 1Z91A 2V79A 3K1NA 2A6HF 4HA8A 1R1VA 1OPCA 3JSOA 1QZYA 4B09A 5LBQA 3HOTA 5DYMA 5LLQA 4MEYF 4M9SA 2M8EA 5FLXK 3JW4A 1G3YA 3BZ6A 1J0RA 1TTYA 2BV6A 5IT9K 5DCMA 3O2PE 1QZZA 3RIRA 3GWZA 4OIPF 1BI2A 4P9UA 3ULQB 5IT3A 2GZWA 2OA4A 1HBXG 1Z7UA 3HTSB 4DQ2A 1ZRDA 4ZZLA 4LGWA 1FBQA 3I54A 3MCZA 3KEQA 4P9FA 1U3EM 1SMTA 1Y0UA 2ZBKA 2VC0A 2GWRA 2A3SA 1DUXC 1BOAA 3T8TA 1TW3A 3L00A 3S2WA 2HEOA 3DQVC 1T0FA 5HLHA 1QBJA 3ZPLA 2G9WA 1ZRFA 1MDMB 3Q5FA 2VOPA 2DT5A 1PP7U 2M1BA 4GYGA 5FD6A 3V8JA 4RGRA 2LSOA 5KVRA 4LMYA 3IWZA 2QBYB 2XKPA 4ENJA 2FRHA 2L02A 5ICFA 2Z99A 2EA2A 3WGIA 3CDHA 2O6GE 1B4AA 1FX7A 1IN6A 2FOKA 1USTA 2O61A 1ON2A 2DW4A 1YIOA 1FYLA 3E3VA 3FHZA 1QGPA 4NQWA 3GFIA 4GCVA 4L18B 4WXDA 1O3QA 4XSXF 3GO5A 4PGHA 3GX4X 4U0YA 3O3KA 2XVCA 1SMYF 1WRJA 2LF7A 3BJAA 2QLZA 2WC2A 5DDGA 4RAYA 1BBYA 2K27A 1FZPB 2OU2A 3ZMUA 1S3JA 3BPVA 3LWFA 3ABUA 3SZPA 3FF5A 1O3SA 2XASA 2QENA 2CG4A 4WF2A 1LVAA 2VC1A 1YLFA 1IN8A 2OQRA 1KYWA 1BN5A 3LAJA 2FNPA 3U1DA 2RC4A 5E8IA 2EV6A 3ABTA 4P96A 3F3XA 1R1TA 1OYIA 4XLNF 1IRFA 2D1HA 3E5XA 2IA2A 1KU3A 1OYWA 4A2UA 4G6QA 1L3LA 4EVIA 2X0LA 2L01A 3U9GA 3F23A 2W85A 2KIMA 2MH2A 3HTUA 4AWXB 4Q48A 2RV8A 4ETSA 3GLXA 4LK0F 1K6OA 1REPC 2NNNA 2ELHA 4ZYDA 2VBWA 5BMZA 5E18F 3C1DA 2BEOA 3TO6A 4RB3C 3GFMA 1YYVA 3FM3A 3KP5A 3HSEA 1FSEA 5FB2A 1ZLKA 5E1ZB 2EV5A 4MNUA 1SFEA 3GF2A 4KNYA 3LFKA 3WE3A 2HFHA 1P4AA 1HSTA 1KU9A 3ERED 2MBFA 3TOBA 2R3SA 3E6DA 3FXQA 1B9MA 4EJUA 1PP8F 3RYPA 1SAXA 5D4RA 3KLOA 1E2XA 3K9TA 4U0WA 3M8EA 2DK5A 1MD0A 2W24A 2O8XA 5D5VB 2E1CA 1KQ9A 2ZXJA 3GEZA 1RNLA 2HZTA 4QWQA 4JBAA 4LFUA 4ZYHA 3ECOA 2YX7A 3LSTA 2XIGA 2G7UA 2CW0F 2FSWA 5K1YA 4HV6A 4IHSA 2KJBA 2BE5F 1IF1A 1U5TB 4HX7A 1KQ8A 3LQQA 1XCVA 2P6TA 4CHUA 3SZTA 4I02A 1QO0D 5FGMA 1I27A 1W7PD 2CO5A 4M6YA 4LB6B 2WWYA 2L54A 4OIQF 2W57A 3F8BA 1T2KA 1O3RA 5DCFA 4HX4A 3ZN1A 1FWZA 3RJPA 1RI7A 1V4RA 2DPUA 2EA4A 2RKHA 3CUQB 2F5DA 3BWGA 5DEQA 3IL2A 5F64A 5LHHA 1XMKA 2MA3A 5BOXA 4Y13A 1GHCA 2GQQA 4FT8A 4WK8F 1SD7A 4CYDA 3SHFA 5EEGA 3I58A 4BXUA 2ISYA 3ZQ7A 2O0YA 4R1HA 1BI1A 2RQPA 3M8FA 2VBXA 2YU3A 1I1SA 5D5UB 1TQPA 4MQVA 3KP4A 4XBFA 3GZ5A 3ROUA 2XAHA 2TDXA 2P8TA 5CJ9A 2A6EF 4BQAA 2RN7A 1BM9A 3KP7A 3WU1B 3REOA 3BOQA 4ON0A 1XMAA 2IW5A 3WU0A 2NYXA 5L3EA 2X4HA 2FE3A 4UVBA 1LEBA 4NB5A 2GXBA 4F7ZA 2VODA 3V7RA 2PLYA 3DKWA 2OD5A 4U7DA 2YX4A 5KK1A 1DPUA 3TDUC 4HDUA 3EYYA 4HYEA 2HKOA 1BC7C 1ZN2A 3MFKA 1IAWA 5LGUA 2CYYA 3BJ6A 3RPUA 5ICCA 4BHCA 4WXHA 3CO7C 5E8GA 4A5MA 1HKTA 2V9VA 4KN7X 2JSCA 1JE8A 4GGGA 4UVCA 4Y17A 2JZYA 4I2OA 1YQAA 2HYGD 4YFKF 1HW5A 4AD9A 2ESNA 3J80K 3KETA 1T38A 1MDMA 2AS5F 3IKVA 1XDUA 3BDDA 3L9FA 1R23A 1JXSA 1H9GA 2KIUA 4UVAA 2PI0A 2QUFA 2DBBA 2QBYA 1U5TC 2PEXA 1YG2A 1DPRA 2UXNA 2E1NA 1UB9A 1S29A 2VONA 4UV8A 1YO5C 4M9XA 1F4KA 1TQMA 4KIGA 2FBIA 1D8JA 1J7KA 4HF1A 1T98A 2HDCA 1CGPA 2J5OA 5K5QA 1IXRC 4EM0B 3HUGA 4AIJA 3TGNA 3QPHA 2QZ8A 4PCQA 1PUEE 1G3TA 2QQBA 5JFRA 3FM5A 3TKYA 4AVPA 1TNTA 5DV5A 1ZRCA 1XGNA 2H27A 1K78B 2IT0A 1QQIA 2UWMA 4Z2YA 4RGSA 1J9IA 3IKTA 4BAYA 3ZMDA 2VE9A 3K1PA 1UCRA 4HF2A 4EM2A 1S7AA 5CVIA 1TBXA 4O3MA 2A69F 1BC8C 4OOIA 1YS7A 1WQ2A 4PDKA 4YIFA 4A12A 3F8CA 1I1GA 2OQGA 3N4MA 1VTNC 1XD7A 1ODDA 2YSRA 4EGYA 2XROA 4EM1A 1JHFA 1U8RA 1KU7A 4H0EA 5BPIA 1AWCA 2A61A 4KDPA 4CDGA 2HOEA 1ZG3A 5LGNA 4A0XA 2PJPA 2UXXA 2P7CB 2CGPA 3EETA 1T39A 5FFXA 3F8NA 5ILSA 4G8XA 1Z9CA 1TLHB 4KICA 2F5FA 2P5VA 2VBYA 4KA4A 1YTYA 1KYZA 3R4KA 2QVOA 3SQNA 3FX3A 3GFJA 1EH6A 4JK1X 5CVUA 2HWVA 3DPTA 4UHTA 1IN7A 1BIBA 3D5LA 2QM3A 3TO7A 1AOYA 2ISZA 5D6FA 4M6XA 3V4GA 4HX8A 5E1XA 2ACJA 2K4BA 4MTEA 2F5EA 1YFHA 5D5XB 1LDDA 2Z9OA 1FPQA 2V1XA 3IRRA 3J81K 4HLYA 2O03A 4KT5C 2MD5A 3I64A 4S04A 4RB1A 4OMYA 3HIFA 3AAFA 4IPAA 2P7VB 3WTUC 3SXYA 5ICGA 1YW7A 3P7NA 4I0AA 2F5CA 4A6EA 2EFWA 3JTGA 4MQ9F 1Q1HA 2K86A 2JPBA 4ASNA 4KUMA 4ESBA 5CYVA 1U5TA 2IP2A 4K2EA 5LHGA 2P6SA 5HS7A 1MJBA 1V3FA 1JHHA 1TNSA 3PQJA 2FMYA 1G3WA 2ZCWA 3T8RA 2QQ9A 2E7WA 3KZYA 2HGCA 3HRUA 3EQLF 2VE8A 4RB0A 1IZ1A 1H9TA 2VBZA 4E70A 3W6KB 4CXFA 4UUVA 2DAOA 3CUQA 3I53A 4HQEA 2JT1A 5DD4A 3C18A 1FLIA 2UZKA 1LNWA 2MH9A 3WGHA 3CTAA 2K7LA 2XV4S 4OU0A 3LA2A 4TV7A 2ZMEB 2JRTA 3V7CA 1W7PB 2GA1A 1WWXA 2JTVA 2ZFWA 4IF4A 4AIKA 1R58A 1FSHA 2WV0A 3VFZA 1QNTA 3H92A 1D5VA 2HTJA 3COAC 2P5KA 2R7FA 4BHBA 4Q4ZF 3C7JA 1ZREA 1HQCA 3OV8A 2RNJA 3Q9SA 4MTDA 4PZJA 3LA3A 2KRFA 2STTA 3NQOA 5TRDA 2ETHA 4IRGA 3VODA 3G73A 3I5UA 1HKQA 1ZG1A 5HLGA 4ENNA 1HSJA 5J8FA 3K0LA 1WKMA 1LDKB 2ZO4A 1SD5A 1ZYRF 1BI0A 3MWMA 2Z33A 1FNNA 4HBLA 4HLXA 3L2CA 1EH8A 3GZ6A 1K7AA 3JAMZ 3U2RA 3HRSA 2OBPA 3KP3A 3ISPA 3GVAA 1GXQA 3WTSC 2RDPA 3QPTA 1ULYA 2M30A 1R00A 1XSVA 2EWNA 1MKMA 2ZNYA 4XSZF 4LJZF 4G6DA 2H6CA 1WSUA 3O6BB 2BGCA 2PMHA 5ILVA 4L0YB 4CGZA 2EFQA 2NRAC 5EEHA 2EK5A 5ERIA 2CFXA 2E7XA 3F22A 2XKOA 1MGTA 5L3FA 4Y15A 3GXOA 5D6EA 1ZHFA 5LHIA 4IRHA 4U0VA 3P9KA 2EB7A 1Z05A 1ZAOA 1A04A 4HZFA 2CSOA 4HOBA 4LB5A 2Z5UA 2RGVA 1P92A 5D4SA 5L3GA 3G3ZA 3WTVC 1BJAA 2QQAA 1R7JA 1BI3A 1U78A 4G7ZF 4UXNA 3WTYC 2H09A 5E17F 1K78A 3KZZA 1GVJA 4HDVA 4L9VA 1J2XA 2KKOA 4OIRF 2GAUA 1D8KA 3F8MA 4ZH4F 4I7HA 1ZGAA 2Q2EA 4L9TA 1G6NA 4LG0B 2COMA 4RGXA 3B02A 5A2QZ 3HHGA 3DF8A 3T5XA 3E5QA 1EH7A 2A5YB 3DEUA 4OINF 5FLXZ 4LLNA 4YIIA 1T6SA 5IT9Z 3L09A 2ADUA 2PG4A 2XRNA 4KMFA 4A5NA 2W25A 1HKSA 2VT3A 2FNAA 4CZZA 2XAQA 5BPDA 4U88A 2P4WA 1XSXA 4NHJA 3I4PA 3BY6A 4BHPA 4G7OF 4D0PA 3JAMK 4IVNA 3V8KA 2IRFG 2XHKA 3M9AA 2XAGA 5FO5A 2DU9A 1R22A 3I0TA 1B9NA 5ED4A 2VOOA 2NAZA 4L0ZB 3DP7A 1OMIA 2HKXA 5L3DA 1ZG5A 2BYVE 1OYYA 3K69A 2M5WA 2A68F 1B59A 2YPRA 2FBHA 2FA5A 1ZLJA 1LDJA 1MJAA 1R36A 4CO8A 5CLSA 1STZA 3WTTC 3SFZA 2L3DA 4IHTA 4B8XA 2V1UA 3PFIA 1I6XA 2PN6A 3K2ZA 2STWA 5K5RA 5FD5A 3WTZA 3CUQC 4ZYGA 3ML6A 4BH9A 3MZYA 4YFNF 4FX0A 2LNBA 2G7HA 5LRRA 1FOKA 1IXSB 3CLOA 2PQ8A 1Z1DA 1FBSA 3B73A 4EJTA 4HAMA 3GW2A 4KYWA 5J6XA 2Y48A 2HYFA 3D0SA 3RKWA 2NNYA 2JPCA 3I59B 4EQQA 4S05A 4WWCA 3RKXA 2DPDA 5A2QK 3CO6C 5HS9A 1IW7F 4L9NA 5JVTA 1LB2A 5LGTA 2J5PA 3KFWX 1FC3A 1LJ9A 3R61A 2VN2A 4IXAA 2ZKZA 4XRFA 4EJVA 3GFLA 4UV9A 3TO9A 3KP6A 4ZYEA 1XGMA 3ZMTA 5CVJA 3MAJA 1ONVA 2FEZA 4KFCA 1X3UA 1XDSA 3BP8A 3WODF 2R7DA 2ZJ2A 4KN4X 2BBYA 2HS5A 3BPXA 4LD5A 4MHGA 1J75A 4IRIA 4XLPF 3DPLC 1UHWA 3QU6A 1R5HA 1UHMA 2D45A 4U7BA 5H20A 2DI3A 1S6LA 4HV5A 3R60A 4R79A 1RUNA 4BYYA 1DP7P 3NRVA 5HVQC 2LDUA 2W84A 5D8KB 2D2WA 4AIHA 3K1MA 1O3TA 1G4DA 2O3FA 4KMUX 2M45A 1FY7A 3MZHA 4UNOA 2ZMEA 3HHHA 2OZUA 1OKRA 4G7HF 2LKPA 1W7PA 1CF7B 1KQ0A 3QOPA 1FBUA 1RZ4A 5AONA 3E6CC 4G9YA 3JTHA 1XCBA 4WXCA 4EGZA 2Y75A 2F2EA 3MQ0A 2Z3YA 3FXRA 3CJNA 5ICEA 4EMSA 4EJWA 4GO1A 2M87A 2AXLA 2IJLA 4RGUA 4RB2C 4IJAA 1S8NA 3FZVA 2DQLA 2H94A 1QPMA 2EJRA 1KGSA 4M71A 5FFZA 3HRMA 3E6MA 1USSA 2IVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YG2 F;  2V6C A;  4EJO A;  4O6J A;  5F1R A;  3HYI A;  3KP2 A;  4OIO F;  4KIB A;  3HOS A;  2HQR A;  5DCM B;  2DQR A;  4OMZ A;  3FXU A;  3BRO A;  2LF8 A;  1E17 A;  3VEP A;  4L9J A;  3ELK A;  1MZB A;  3CUO A;  3E6B A;  5HOO A;  3QRF F;  3TOA A;  2VXZ A;  2KJC A;  1SFU A;  2OZ6 A;  3QAH A;  4GXO A;  4N9H A;  2OAZ A;  4LLG F;  1G3S A;  1GXP A;  3KE2 A;  5H6Q A;  1TW2 A;  1O57 A;  5LEK A;  1P6R A;  5L3B A;  4Q5S F;  2FF4 A;  3RDI A;  1ON1 A;  5AIP A;  1MJ9 A;  2L4A A;  4HW0 A;  2HTS A;  3KLN A;  3FWE A;  3GUD A;  3FMQ A;  2ESH A;  4WCG A;  1ZGJ A;  5F6F A;  5DD8 A;  3I71 A;  3ZMS A;  3H3Z A;  3QP6 A;  1XSD A;  5LRS A;  3H3U A;  3BJO A;  4N9I A;  4HF0 A;  2CWE A;  3LA7 A;  3F8F A;  2FQ3 A;  3RYR A;  1LEA A;  2QYO A;  1Z6T A;  4QLC U;  3R0J A;  2MLG A;  4A0Y A;  1XGO A;  3WTX C;  3ZN0 A;  5DUK A;  3DXJ F;  1XB4 A;  3WGG A;  5CVR A;  4HQM A;  4LG0 A;  3RTR A;  3EDP A;  2PFB A;  1P2F A;  3QP5 A;  5BQT A;  2PBI A;  1YW8 A;  5J8C A;  1U6G A;  3F6V A;  1B1B A;  2HQN A;  1SD4 A;  4YFX F;  4WX9 A;  3R0A A;  4JQF A;  5ILU A;  4M73 A;  2B0L A;  4ESF A;  5K5O A;  3F72 A;  3T0Y A;  3P9I A;  4I01 A;  1WI9 A;  2EFN A;  2EV0 A;  3F6O A;  4A0Z A;  2MLK A;  4M72 A;  4P5O A;  3LAP A;  1BIA A;  4N0B A;  1SD6 A;  3IC7 A;  5CVV A;  2P5L C;  2GIV A;  1KU2 A;  1HW2 A;  3WE2 A;  1J5Y A;  4LK1 F;  3FMR A;  5L3C A;  1HXD A;  3J80 Z;  2FU4 A;  3RPQ A;  3IRQ A;  3E97 A;  2DFI A;  5HLI A;  2DK8 A;  5H6R A;  5JI6 A;  1TQI A;  1FT9 A;  2DTR A;  3C3W A;  3KEO A;  1ZH5 A;  6PAX A;  2FML A;  1XGS A;  3F21 A;  1PDN C;  2EFO A;  1P4X A;  2HR3 A;  1I5Z A;  4RS8 A;  5LEJ A;  1YS6 A;  2K02 A;  3MEX A;  3R6S A;  3RKY A;  3T1B A;  2DO7 A;  4PGG A;  2XAJ A;  2IPQ X;  4G94 A;  3VOE A;  1U2W A;  5AIQ A;  1R1U A;  3ZMZ A;  1IN4 A;  1DDN A;  3ZP5 A;  5DUI A;  2K4J A;  4Q47 A;  2PMU A;  4M74 A;  3W6J B;  3J7A O;  3PQK A;  2Q8K A;  1D3Y A;  1O7F A;  2IA1 A;  2VT2 A;  3P9C A;  2FXA A;  2YR2 A;  1OR7 A;  3DFG A;  4ESJ A;  3EUH A;  4I09 A;  3WG9 A;  2XGX A;  2D1V A;  4R8H A;  1F9N A;  1W4M A;  2RVC A;  3HSF A;  2QWW A;  2NS0 A;  1H0M A;  4M9Z A;  3I59 A;  1FYM A;  5D8L B;  3NEU A;  4KIF A;  5E1W A;  5TJJ A;  2A07 F;  3LQR A;  4MGR A;  2V1D A;  5E20 A;  1IN5 A;  2MC3 A;  3N97 A;  3EYI A;  5HDG A;  3WTW C;  3M1E A;  1Z6R A;  3DV8 A;  2CQK A;  3VB2 A;  5JHU A;  3V8L A;  4DNC A;  4O5V A;  3HRT A;  4FX4 A;  1J59 A;  1P4W A;  3IWF A;  2WTE A;  3E5U A;  1IXC A;  1UFM A;  4ENK A;  1RUO A;  3Q9V A;  1FP2 A;  5JR3 A;  2C6Y A;  3ECH A;  3TDZ C;  1R5G A;  1EV7 A;  1YW9 A;  3IHU A;  1IRG A;  2EFP A;  3ZMV A;  1K79 A;  2Y0M A;  1FYK A;  5HDK A;  1B6A A;  4EV0 A;  2FBK A;  1W5T A;  4L5I A;  3V7S A;  5HS8 A;  4GYI A;  2GA2 A;  1FP1 D;  1W5S A;  2XUB A;  4RAZ A;  1IUY A;  2L4M A;  5HDN A;  1NHA A;  5D5W B;  4FHT A;  1SFX A;  4BNC A;  5BS6 A;  2GXG A;  4ENM A;  1CF7 A;  3OOP A;  3RI4 A;  4L5J A;  2Q0O A;  2XAF A;  4I98 B;  3GYH X;  1S7O A;  4LLL A;  2IA0 A;  3KCC A;  3M7G A;  3TQN A;  1F5T A;  3QU3 A;  1HW1 A;  1XN7 A;  4A6D A;  1JGS A;  1KA8 A;  1L0O C;  3HSR A;  3L7W A;  2KIF A;  1ZAR A;  1C0W A;  2H6B A;  1LQ1 A;  1RIO H;  2ZNZ A;  1O7L A;  1F1Z A;  4MEX F;  4ZZD A;  2DLL A;  3J81 Z;  3FMS A;  4P55 A;  4CIC A;  4I0B A;  3JSP A;  1Z91 A;  2V79 A;  3K1N A;  2A6H F;  4HA8 A;  1R1V A;  1OPC A;  3JSO A;  1QZY A;  4B09 A;  5LBQ A;  3HOT A;  5DYM A;  5LLQ A;  4MEY F;  4M9S A;  2M8E A;  5FLX K;  3JW4 A;  1G3Y A;  3BZ6 A;  1J0R A;  1TTY A;  2BV6 A;  5IT9 K;  5DCM A;  3O2P E;  1QZZ A;  3RIR A;  3GWZ A;  4OIP F;  1BI2 A;  4P9U A;  3ULQ B;  5IT3 A;  2GZW A;  2OA4 A;  1HBX G;  1Z7U A;  3HTS B;  4DQ2 A;  1ZRD A;  4ZZL A;  4LGW A;  1FBQ A;  3I54 A;  3MCZ A;  3KEQ A;  4P9F A;  1U3E M;  1SMT A;  1Y0U A;  2ZBK A;  2VC0 A;  2GWR A;  2A3S A;  1DUX C;  1BOA A;  3T8T A;  1TW3 A;  3L00 A;  3S2W A;  2HEO A;  3DQV C;  1T0F A;  5HLH A;  1QBJ A;  3ZPL A;  2G9W A;  1ZRF A;  1MDM B;  3Q5F A;  2VOP A;  2DT5 A;  1PP7 U;  2M1B A;  4GYG A;  5FD6 A;  3V8J A;  4RGR A;  2LSO A;  5KVR A;  4LMY A;  3IWZ A;  2QBY B;  2XKP A;  4ENJ A;  2FRH A;  2L02 A;  5ICF A;  2Z99 A;  2EA2 A;  3WGI A;  3CDH A;  2O6G E;  1B4A A;  1FX7 A;  1IN6 A;  2FOK A;  1UST A;  2O61 A;  1ON2 A;  2DW4 A;  1YIO A;  1FYL A;  3E3V A;  3FHZ A;  1QGP A;  4NQW A;  3GFI A;  4GCV A;  4L18 B;  4WXD A;  1O3Q A;  4XSX F;  3GO5 A;  4PGH A;  3GX4 X;  4U0Y A;  3O3K A;  2XVC A;  1SMY F;  1WRJ A;  2LF7 A;  3BJA A;  2QLZ A;  2WC2 A;  5DDG A;  4RAY A;  1BBY A;  2K27 A;  1FZP B;  2OU2 A;  3ZMU A;  1S3J A;  3BPV A;  3LWF A;  3ABU A;  3SZP A;  3FF5 A;  1O3S A;  2XAS A;  2QEN A;  2CG4 A;  4WF2 A;  1LVA A;  2VC1 A;  1YLF A;  1IN8 A;  2OQR A;  1KYW A;  1BN5 A;  3LAJ A;  2FNP A;  3U1D A;  2RC4 A;  5E8I A;  2EV6 A;  3ABT A;  4P96 A;  3F3X A;  1R1T A;  1OYI A;  4XLN F;  1IRF A;  2D1H A;  3E5X A;  2IA2 A;  1KU3 A;  1OYW A;  4A2U A;  4G6Q A;  1L3L A;  4EVI A;  2X0L A;  2L01 A;  3U9G A;  3F23 A;  2W85 A;  2KIM A;  2MH2 A;  3HTU A;  4AWX B;  4Q48 A;  2RV8 A;  4ETS A;  3GLX A;  4LK0 F;  1K6O A;  1REP C;  2NNN A;  2ELH A;  4ZYD A;  2VBW A;  5BMZ A;  5E18 F;  3C1D A;  2BEO A;  3TO6 A;  4RB3 C;  3GFM A;  1YYV A;  3FM3 A;  3KP5 A;  3HSE A;  1FSE A;  5FB2 A;  1ZLK A;  5E1Z B;  2EV5 A;  4MNU A;  1SFE A;  3GF2 A;  4KNY A;  3LFK A;  3WE3 A;  2HFH A;  1P4A A;  1HST A;  1KU9 A;  3ERE D;  2MBF A;  3TOB A;  2R3S A;  3E6D A;  3FXQ A;  1B9M A;  4EJU A;  1PP8 F;  3RYP A;  1SAX A;  5D4R A;  3KLO A;  1E2X A;  3K9T A;  4U0W A;  3M8E A;  2DK5 A;  1MD0 A;  2W24 A;  2O8X A;  5D5V B;  2E1C A;  1KQ9 A;  2ZXJ A;  3GEZ A;  1RNL A;  2HZT A;  4QWQ A;  4JBA A;  4LFU A;  4ZYH A;  3ECO A;  2YX7 A;  3LST A;  2XIG A;  2G7U A;  2CW0 F;  2FSW A;  5K1Y A;  4HV6 A;  4IHS A;  2KJB A;  2BE5 F;  1IF1 A;  1U5T B;  4HX7 A;  1KQ8 A;  3LQQ A;  1XCV A;  2P6T A;  4CHU A;  3SZT A;  4I02 A;  1QO0 D;  5FGM A;  1I27 A;  1W7P D;  2CO5 A;  4M6Y A;  4LB6 B;  2WWY A;  2L54 A;  4OIQ F;  2W57 A;  3F8B A;  1T2K A;  1O3R A;  5DCF A;  4HX4 A;  3ZN1 A;  1FWZ A;  3RJP A;  1RI7 A;  1V4R A;  2DPU A;  2EA4 A;  2RKH A;  3CUQ B;  2F5D A;  3BWG A;  5DEQ A;  3IL2 A;  5F64 A;  5LHH A;  1XMK A;  2MA3 A;  5BOX A;  4Y13 A;  1GHC A;  2GQQ A;  4FT8 A;  4WK8 F;  1SD7 A;  4CYD A;  3SHF A;  5EEG A;  3I58 A;  4BXU A;  2ISY A;  3ZQ7 A;  2O0Y A;  4R1H A;  1BI1 A;  2RQP A;  3M8F A;  2VBX A;  2YU3 A;  1I1S A;  5D5U B;  1TQP A;  4MQV A;  3KP4 A;  4XBF A;  3GZ5 A;  3ROU A;  2XAH A;  2TDX A;  2P8T A;  5CJ9 A;  2A6E F;  4BQA A;  2RN7 A;  1BM9 A;  3KP7 A;  3WU1 B;  3REO A;  3BOQ A;  4ON0 A;  1XMA A;  2IW5 A;  3WU0 A;  2NYX A;  5L3E A;  2X4H A;  2FE3 A;  4UVB A;  1LEB A;  4NB5 A;  2GXB A;  4F7Z A;  2VOD A;  3V7R A;  2PLY A;  3DKW A;  2OD5 A;  4U7D A;  2YX4 A;  5KK1 A;  1DPU A;  3TDU C;  4HDU A;  3EYY A;  4HYE A;  2HKO A;  1BC7 C;  1ZN2 A;  3MFK A;  1IAW A;  5LGU A;  2CYY A;  3BJ6 A;  3RPU A;  5ICC A;  4BHC A;  4WXH A;  3CO7 C;  5E8G A;  4A5M A;  1HKT A;  2V9V A;  4KN7 X;  2JSC A;  1JE8 A;  4GGG A;  4UVC A;  4Y17 A;  2JZY A;  4I2O A;  1YQA A;  2HYG D;  4YFK F;  1HW5 A;  4AD9 A;  2ESN A;  3J80 K;  3KET A;  1T38 A;  1MDM A;  2AS5 F;  3IKV A;  1XDU A;  3BDD A;  3L9F A;  1R23 A;  1JXS A;  1H9G A;  2KIU A;  4UVA A;  2PI0 A;  2QUF A;  2DBB A;  2QBY A;  1U5T C;  2PEX A;  1YG2 A;  1DPR A;  2UXN A;  2E1N A;  1UB9 A;  1S29 A;  2VON A;  4UV8 A;  1YO5 C;  4M9X A;  1F4K A;  1TQM A;  4KIG A;  2FBI A;  1D8J A;  1J7K A;  4HF1 A;  1T98 A;  2HDC A;  1CGP A;  2J5O A;  5K5Q A;  1IXR C;  4EM0 B;  3HUG A;  4AIJ A;  3TGN A;  3QPH A;  2QZ8 A;  4PCQ A;  1PUE E;  1G3T A;  2QQB A;  5JFR A;  3FM5 A;  3TKY A;  4AVP A;  1TNT A;  5DV5 A;  1ZRC A;  1XGN A;  2H27 A;  1K78 B;  2IT0 A;  1QQI A;  2UWM A;  4Z2Y A;  4RGS A;  1J9I A;  3IKT A;  4BAY A;  3ZMD A;  2VE9 A;  3K1P A;  1UCR A;  4HF2 A;  4EM2 A;  1S7A A;  5CVI A;  1TBX A;  4O3M A;  2A69 F;  1BC8 C;  4OOI A;  1YS7 A;  1WQ2 A;  4PDK A;  4YIF A;  4A12 A;  3F8C A;  1I1G A;  2OQG A;  3N4M A;  1VTN C;  1XD7 A;  1ODD A;  2YSR A;  4EGY A;  2XRO A;  4EM1 A;  1JHF A;  1U8R A;  1KU7 A;  4H0E A;  5BPI A;  1AWC A;  2A61 A;  4KDP A;  4CDG A;  2HOE A;  1ZG3 A;  5LGN A;  4A0X A;  2PJP A;  2UXX A;  2P7C B;  2CGP A;  3EET A;  1T39 A;  5FFX A;  3F8N A;  5ILS A;  4G8X A;  1Z9C A;  1TLH B;  4KIC A;  2F5F A;  2P5V A;  2VBY A;  4KA4 A;  1YTY A;  1KYZ A;  3R4K A;  2QVO A;  3SQN A;  3FX3 A;  3GFJ A;  1EH6 A;  4JK1 X;  5CVU A;  2HWV A;  3DPT A;  4UHT A;  1IN7 A;  1BIB A;  3D5L A;  2QM3 A;  3TO7 A;  1AOY A;  2ISZ A;  5D6F A;  4M6X A;  3V4G A;  4HX8 A;  5E1X A;  2ACJ A;  2K4B A;  4MTE A;  2F5E A;  1YFH A;  5D5X B;  1LDD A;  2Z9O A;  1FPQ A;  2V1X A;  3IRR A;  3J81 K;  4HLY A;  2O03 A;  4KT5 C;  2MD5 A;  3I64 A;  4S04 A;  4RB1 A;  4OMY A;  3HIF A;  3AAF A;  4IPA A;  2P7V B;  3WTU C;  3SXY A;  5ICG A;  1YW7 A;  3P7N A;  4I0A A;  2F5C A;  4A6E A;  2EFW A;  3JTG A;  4MQ9 F;  1Q1H A;  2K86 A;  2JPB A;  4ASN A;  4KUM A;  4ESB A;  5CYV A;  1U5T A;  2IP2 A;  4K2E A;  5LHG A;  2P6S A;  5HS7 A;  1MJB A;  1V3F A;  1JHH A;  1TNS A;  3PQJ A;  2FMY A;  1G3W A;  2ZCW A;  3T8R A;  2QQ9 A;  2E7W A;  3KZY A;  2HGC A;  3HRU A;  3EQL F;  2VE8 A;  4RB0 A;  1IZ1 A;  1H9T A;  2VBZ A;  4E70 A;  3W6K B;  4CXF A;  4UUV A;  2DAO A;  3CUQ A;  3I53 A;  4HQE A;  2JT1 A;  5DD4 A;  3C18 A;  1FLI A;  2UZK A;  1LNW A;  2MH9 A;  3WGH A;  3CTA A;  2K7L A;  2XV4 S;  4OU0 A;  3LA2 A;  4TV7 A;  2ZME B;  2JRT A;  3V7C A;  1W7P B;  2GA1 A;  1WWX A;  2JTV A;  2ZFW A;  4IF4 A;  4AIK A;  1R58 A;  1FSH A;  2WV0 A;  3VFZ A;  1QNT A;  3H92 A;  1D5V A;  2HTJ A;  3COA C;  2P5K A;  2R7F A;  4BHB A;  4Q4Z F;  3C7J A;  1ZRE A;  1HQC A;  3OV8 A;  2RNJ A;  3Q9S A;  4MTD A;  4PZJ A;  3LA3 A;  2KRF A;  2STT A;  3NQO A;  5TRD A;  2ETH A;  4IRG A;  3VOD A;  3G73 A;  3I5U A;  1HKQ A;  1ZG1 A;  5HLG A;  4ENN A;  1HSJ A;  5J8F A;  3K0L A;  1WKM A;  1LDK B;  2ZO4 A;  1SD5 A;  1ZYR F;  1BI0 A;  3MWM A;  2Z33 A;  1FNN A;  4HBL A;  4HLX A;  3L2C A;  1EH8 A;  3GZ6 A;  1K7A A;  3JAM Z;  3U2R A;  3HRS A;  2OBP A;  3KP3 A;  3ISP A;  3GVA A;  1GXQ A;  3WTS C;  2RDP A;  3QPT A;  1ULY A;  2M30 A;  1R00 A;  1XSV A;  2EWN A;  1MKM A;  2ZNY A;  4XSZ F;  4LJZ F;  4G6D A;  2H6C A;  1WSU A;  3O6B B;  2BGC A;  2PMH A;  5ILV A;  4L0Y B;  4CGZ A;  2EFQ A;  2NRA C;  5EEH A;  2EK5 A;  5ERI A;  2CFX A;  2E7X A;  3F22 A;  2XKO A;  1MGT A;  5L3F A;  4Y15 A;  3GXO A;  5D6E A;  1ZHF A;  5LHI A;  4IRH A;  4U0V A;  3P9K A;  2EB7 A;  1Z05 A;  1ZAO A;  1A04 A;  4HZF A;  2CSO A;  4HOB A;  4LB5 A;  2Z5U A;  2RGV A;  1P92 A;  5D4S A;  5L3G A;  3G3Z A;  3WTV C;  1BJA A;  2QQA A;  1R7J A;  1BI3 A;  1U78 A;  4G7Z F;  4UXN A;  3WTY C;  2H09 A;  5E17 F;  1K78 A;  3KZZ A;  1GVJ A;  4HDV A;  4L9V A;  1J2X A;  2KKO A;  4OIR F;  2GAU A;  1D8K A;  3F8M A;  4ZH4 F;  4I7H A;  1ZGA A;  2Q2E A;  4L9T A;  1G6N A;  4LG0 B;  2COM A;  4RGX A;  3B02 A;  5A2Q Z;  3HHG A;  3DF8 A;  3T5X A;  3E5Q A;  1EH7 A;  2A5Y B;  3DEU A;  4OIN F;  5FLX Z;  4LLN A;  4YII A;  1T6S A;  5IT9 Z;  3L09 A;  2ADU A;  2PG4 A;  2XRN A;  4KMF A;  4A5N A;  2W25 A;  1HKS A;  2VT3 A;  2FNA A;  4CZZ A;  2XAQ A;  5BPD A;  4U88 A;  2P4W A;  1XSX A;  4NHJ A;  3I4P A;  3BY6 A;  4BHP A;  4G7O F;  4D0P A;  3JAM K;  4IVN A;  3V8K A;  2IRF G;  2XHK A;  3M9A A;  2XAG A;  5FO5 A;  2DU9 A;  1R22 A;  3I0T A;  1B9N A;  5ED4 A;  2VOO A;  2NAZ A;  4L0Z B;  3DP7 A;  1OMI A;  2HKX A;  5L3D A;  1ZG5 A;  2BYV E;  1OYY A;  3K69 A;  2M5W A;  2A68 F;  1B59 A;  2YPR A;  2FBH A;  2FA5 A;  1ZLJ A;  1LDJ A;  1MJA A;  1R36 A;  4CO8 A;  5CLS A;  1STZ A;  3WTT C;  3SFZ A;  2L3D A;  4IHT A;  4B8X A;  2V1U A;  3PFI A;  1I6X A;  2PN6 A;  3K2Z A;  2STW A;  5K5R A;  5FD5 A;  3WTZ A;  3CUQ C;  4ZYG A;  3ML6 A;  4BH9 A;  3MZY A;  4YFN F;  4FX0 A;  2LNB A;  2G7H A;  5LRR A;  1FOK A;  1IXS B;  3CLO A;  2PQ8 A;  1Z1D A;  1FBS A;  3B73 A;  4EJT A;  4HAM A;  3GW2 A;  4KYW A;  5J6X A;  2Y48 A;  2HYF A;  3D0S A;  3RKW A;  2NNY A;  2JPC A;  3I59 B;  4EQQ A;  4S05 A;  4WWC A;  3RKX A;  2DPD A;  5A2Q K;  3CO6 C;  5HS9 A;  1IW7 F;  4L9N A;  5JVT A;  1LB2 A;  5LGT A;  2J5P A;  3KFW X;  1FC3 A;  1LJ9 A;  3R61 A;  2VN2 A;  4IXA A;  2ZKZ A;  4XRF A;  4EJV A;  3GFL A;  4UV9 A;  3TO9 A;  3KP6 A;  4ZYE A;  1XGM A;  3ZMT A;  5CVJ A;  3MAJ A;  1ONV A;  2FEZ A;  4KFC A;  1X3U A;  1XDS A;  3BP8 A;  3WOD F;  2R7D A;  2ZJ2 A;  4KN4 X;  2BBY A;  2HS5 A;  3BPX A;  4LD5 A;  4MHG A;  1J75 A;  4IRI A;  4XLP F;  3DPL C;  1UHW A;  3QU6 A;  1R5H A;  1UHM A;  2D45 A;  4U7B A;  5H20 A;  2DI3 A;  1S6L A;  4HV5 A;  3R60 A;  4R79 A;  1RUN A;  4BYY A;  1DP7 P;  3NRV A;  5HVQ C;  2LDU A;  2W84 A;  5D8K B;  2D2W A;  4AIH A;  3K1M A;  1O3T A;  1G4D A;  2O3F A;  4KMU X;  2M45 A;  1FY7 A;  3MZH A;  4UNO A;  2ZME A;  3HHH A;  2OZU A;  1OKR A;  4G7H F;  2LKP A;  1W7P A;  1CF7 B;  1KQ0 A;  3QOP A;  1FBU A;  1RZ4 A;  5AON A;  3E6C C;  4G9Y A;  3JTH A;  1XCB A;  4WXC A;  4EGZ A;  2Y75 A;  2F2E A;  3MQ0 A;  2Z3Y A;  3FXR A;  3CJN A;  5ICE A;  4EMS A;  4EJW A;  4GO1 A;  2M87 A;  2AXL A;  2IJL A;  4RGU A;  4RB2 C;  4IJA A;  1S8N A;  3FZV A;  2DQL A;  2H94 A;  1QPM A;  2EJR A;  1KGS A;  4M71 A;  5FFZ A;  3HRM A;  3E6M A;  1USS A;  2IVM A; 
#chains in the Genus database with same CATH topology
 2OV7 A;  5B3S H;  4A3C J;  1VQN I;  3M07 A;  4YG2 F;  4A3K J;  2IS1 A;  4EEF G;  2V6C A;  4EJO A;  4O6J A;  5F1R A;  5DTD A;  2MG4 A;  1G2H A;  1FOY A;  5DS9 A;  3QYE A;  3HYI A;  4F93 B;  3KP2 A;  3ERM A;  1HCR A;  5LFA A;  4KIB A;  4OIO F;  3HOS A;  2VJI A;  2HQR A;  4FET A;  5IP9 J;  4BUP A;  3S3M A;  5DCM B;  5GAD J;  2DQR A;  2R93 J;  4F91 B;  4OMZ A;  3CQZ J;  1DGR M;  3G1M A;  3FXU A;  1JI8 A;  2XF5 A;  2OCE A;  3BRO A;  2Z16 A;  3S2D J;  4A3F J;  5B66 C;  2IBD A;  2LF8 A;  3RZD J;  1E17 A;  2QKM B;  3VEP A;  4GDF A;  3GCM A;  2E60 A;  3HL2 A;  1OR7 C;  4L9J A;  2DFH A;  3EUH C;  3ELK A;  1MZB A;  2CQ7 A;  2VKE A;  3CUO A;  2DTZ A;  3E6B A;  5HOO A;  3QRF F;  3TOA A;  2VXZ A;  3CDL A;  4GFB A;  2KJC A;  1SFU A;  1V5E A;  4IX7 A;  5JLX A;  3PJR A;  2OZ6 A;  3QAH A;  1JKP C;  1RKT A;  3DU5 A;  3LSG A;  4GXO A;  4A93 J;  4N9H A;  2LG4 A;  2OAZ A;  1A6I A;  4LLG F;  1VQ8 I;  1G3S A;  2LOO A;  2MAB A;  2DJN A;  4W97 A;  4NNJ A;  1GXP A;  3KE2 A;  3FXK A;  5B1B H;  1TW2 A;  5H6Q A;  1O57 A;  2P0W A;  5EF6 A;  5LEK A;  1P6R A;  3ASO H;  1Z7L A;  5L3B A;  4Q5S F;  5F08 A;  2FF4 A;  1S9H A;  3U1K A;  3RDI A;  1ON1 A;  2KRH A;  3ZQG A;  4BBS J;  2VQH A;  4BY1 J;  2KHM A;  5AIP A;  1MJ9 A;  2L4A A;  1JUP A;  2HTS A;  3KLN A;  3A02 A;  4HW0 A;  3J7Y J;  3FWE A;  3GUD A;  4XKW A;  3FMQ A;  2DOF A;  2R5Z B;  3HGG A;  2ZJQ F;  2ESH A;  4WCG A;  1ZGJ A;  5F6F A;  5DD8 A;  1JUS A;  3I71 A;  4ANJ A;  1T56 A;  2EIM H;  3ZMS A;  3H3Z A;  3QP6 A;  2X6W A;  1XSD A;  1Z3X A;  1B72 B;  5LRS A;  3H3U A;  3BJO A;  3DWL E;  3IUO A;  4NC8 A;  3JR9 A;  1MMS A;  4N9I A;  4HF0 A;  2CWE A;  3LA7 A;  2Y2Z A;  4NQW B;  3F8F A;  2FQ3 A;  2NS7 A;  3RYR A;  4BGD A;  5IYC J;  4IO9 F;  1LEA A;  2QYO A;  2BHZ A;  1Z6T A;  1W1W E;  4QLC U;  2DXI A;  4HPQ A;  3R0J A;  2MLG A;  4A0Y A;  1XGO A;  2VUM J;  3CJQ B;  3WTX C;  3ZN0 A;  4C3I J;  1MMA A;  5DUK A;  3DXJ F;  4M3E A;  1XB4 A;  4BDY A;  2WAE A;  3WGG A;  4B44 A;  5CVR A;  4HQM A;  2VB6 A;  2E36 A;  1TT0 A;  2DA4 A;  5HNF A;  4IHY A;  4LG0 A;  3RTR A;  3EDP A;  2PFB A;  1RPW A;  1P2F A;  3QP5 A;  5BQT A;  2PBI A;  1YW8 A;  5J8C A;  1U6G A;  3F6V A;  1B1B A;  3I4M J;  1GDT A;  2E1O A;  2HQN A;  2L7F P;  5FJ8 J;  1SD4 A;  4YFX F;  4FAS D;  4WX9 A;  4DOZ A;  3R0A A;  4JQF A;  5ILU A;  2WB1 N;  4M73 A;  3LNQ A;  2B0L A;  4ESF A;  5K5O A;  3HKZ N;  3F72 A;  3LSP A;  3T0Y A;  3U21 A;  2OTJ I;  1SVM A;  1UZC A;  3P9I A;  3JRG A;  2VPL A;  4BQQ A;  4I01 A;  1WI9 A;  2EFN A;  2EV0 A;  3F6O A;  4A0Z A;  1YJ9 I;  2MLK A;  3K4L A;  4M72 A;  4P5O A;  4QIW N;  1VQ5 I;  4IHW A;  4E7Z A;  3LAP A;  1D1C A;  1BIA A;  4N0B A;  3S15 J;  1SD6 A;  1U0J A;  3BR3 A;  2ZFU A;  1N77 A;  3IC7 A;  4NDL A;  3VDX A;  5CVV A;  5GTI C;  1Z67 A;  1PYV A;  2GIV A;  1KU2 A;  2P5L C;  1HW2 A;  3VSL A;  5IY5 H;  3WE2 A;  1J5Y A;  4LK1 F;  3C2G A;  1MBF A;  3FMR A;  3K4C A;  5L3C A;  2IGK A;  3JRC A;  4BY7 J;  3S1Q J;  1HXD A;  2HOS A;  3QQA A;  3J80 Z;  2FU4 A;  3AG2 H;  3QPL A;  3RPQ A;  3MKZ A;  3IRQ A;  3E97 A;  2DFI A;  1Y0N A;  5GP9 A;  5HLI A;  2DK8 A;  2JWT A;  2N8G A;  3GLL A;  4V2F A;  1LUJ B;  1V54 H;  3L2Q A;  5M5X J;  1Z0X A;  2JK3 A;  5H6R A;  1VND A;  3BTJ A;  5JI6 A;  1TQI A;  1FT9 A;  3HOZ J;  2DTR A;  2GBY A;  3C3W A;  3KEO A;  1ZH5 A;  6PAX A;  3RSN A;  2FML A;  3GTM J;  2RQQ A;  1XGS A;  1VQP I;  4XOT A;  4D9J A;  3SJM A;  3F21 A;  3K70 C;  1PDN C;  2K9L A;  2XB0 X;  2CUZ A;  2EFO A;  4YIR X;  1P4X A;  2HR3 A;  1A5J A;  1ENH A;  1I5Z A;  4RS8 A;  1V5F A;  2EZH A;  1W36 D;  4E4H A;  3BC8 A;  2OCC H;  5LEJ A;  3OIO A;  3I55 I;  4IHV A;  2EPF A;  3OYA A;  1YS6 A;  2K02 A;  5FKL A;  3CC2 I;  3MEX A;  2V1N A;  3R6S A;  3RKY A;  3T1B A;  1UEL B;  2KIQ A;  2DO7 A;  4IOC F;  4PGG A;  3ESW B;  2XAJ A;  2IPQ X;  3VSK A;  3SEZ A;  2E5N A;  1D1A A;  4G94 A;  3VOE A;  1WZ2 A;  1U2W A;  5AIQ A;  1R1U A;  3ZCO A;  4CCO A;  3ZMZ A;  1T0F C;  3PIP F;  1IN4 A;  2Z1D A;  1DDN A;  2DFE A;  3ZP5 A;  2GM4 A;  5DUI A;  2M0C A;  1I50 J;  2K4J A;  3A03 A;  4Q47 A;  4HRI A;  2PMU A;  4M74 A;  3W6J B;  2MFZ A;  3J7A O;  3PQK A;  2VJJ A;  3PSI A;  1PVE A;  2Q8K A;  4XKB A;  2XC7 A;  3A01 A;  2HXI A;  1D3Y A;  1ZEL A;  1O7F A;  2XPU A;  2ZME C;  2IA1 A;  3EPZ A;  3TMO A;  4RLF A;  2VT2 A;  3FXM A;  3PO2 J;  3P9C A;  2FXA A;  4A3I J;  2FQ4 A;  2YR2 A;  1OR7 A;  3DFG A;  4OAZ A;  4ESJ A;  3EUH A;  4I09 A;  3WG9 A;  3HOX J;  2RNG A;  2XGX A;  2HDW A;  2D1V A;  4R8H A;  1F9N A;  3ZGK A;  1W4M A;  2RVC A;  1R49 A;  3M1C A;  3L2V A;  1MMG A;  3HSF A;  2JN6 A;  1IUF A;  3SDG A;  2QWW A;  2NS0 A;  3H35 A;  1H0M A;  2JA6 J;  4M9Z A;  3I59 A;  3G71 I;  1FYM A;  1TWF J;  5D8L B;  1D0Z A;  2I8D A;  3NEU A;  2YUS A;  4KIF A;  3S14 J;  1FOX A;  5E1W A;  5TJJ A;  1AHD P;  2A07 F;  1P7J A;  2QCO A;  4JP0 A;  3LQR A;  4MGR A;  2V1D A;  5E20 A;  1IN5 A;  1X1B A;  2MC3 A;  2FUG 2;  3BG9 A;  4PUS A;  5HDG A;  3N97 A;  3WTW C;  2CV1 A;  3DBR B;  3M1E A;  4XRM A;  1Z6R A;  3DV8 A;  2JA7 J;  4CH7 A;  2CQK A;  4KJZ A;  3VB2 A;  3CMA I;  5JHU A;  1E3H A;  3V8L A;  1K4T A;  3HDD A;  4DNC A;  2XAU A;  4O5V A;  3FBI B;  3HRT A;  2DOD A;  5FRM A;  3GTP J;  4N4N B;  4FX4 A;  1J59 A;  4CCN A;  5FLM J;  1HF0 A;  2BVM A;  1P4W A;  3PUB A;  3QYB A;  3IWF A;  1XMX A;  4XR6 A;  2DMQ A;  2WTE A;  3E5U A;  1WJF A;  1IXC A;  1UFM A;  4ENK A;  1RUO A;  3OL4 A;  4HNT A;  3Q9V A;  4BJ6 C;  3GTK J;  2HOT A;  1FP2 A;  5JR3 A;  2C6Y A;  3ECH A;  3DTE A;  5M3F J;  1T95 A;  3TDZ C;  3MZ8 A;  1EKE A;  1R5G A;  1EV7 A;  1YW9 A;  3IHU A;  4LIV A;  3S32 A;  4M3D A;  1IRG A;  2EFP A;  3ZMV A;  4CCM A;  1K79 A;  1TP4 A;  2IEK A;  3DTI A;  2BY1 A;  2Y0M A;  3HC7 A;  5GTH C;  1FYK A;  2XSJ C;  4QPO A;  5HDK A;  4XNF A;  1B6A A;  4EV0 A;  3HOW J;  2FBK A;  1W5T A;  2KZG A;  4L5I A;  3V7S A;  5HS8 A;  1JTY A;  4GYI A;  2GA2 A;  1FP1 D;  4BE1 A;  1W5S A;  4C30 A;  3IAM 2;  2XUB A;  4RAZ A;  3JRF A;  3AG1 H;  1IUY A;  2L4M A;  5HDN A;  5FKO A;  2DMU A;  1NHA A;  5D5W B;  4FHT A;  1I3Q J;  1SFX A;  4BNC A;  4D7N A;  2R7T A;  5BS6 A;  1IV8 A;  2GXG A;  1K83 J;  4ENM A;  2VKV A;  3PL8 A;  1CF7 A;  3OOP A;  2X9D A;  3RI4 A;  1DU6 A;  1YRN B;  3HBL A;  4L5J A;  3OS2 A;  2Q0O A;  2XAF A;  4ZYA A;  1G8X A;  3OIQ A;  4B47 A;  3CMY A;  4I98 B;  3GYH X;  1S7O A;  4LLL A;  1MBK A;  2IA0 A;  3KCC A;  2ELK A;  3M7G A;  3TQN A;  1F5T A;  4NBQ A;  3QU3 A;  2BW3 A;  1HW1 A;  1XN7 A;  3HZJ A;  4A6D A;  4DYC A;  1JGS A;  2WAQ A;  1KA8 A;  2XSD C;  1RKW A;  1X1D A;  4PSX A;  1L0O C;  4XKC A;  3HSR A;  1BR2 A;  3L7W A;  2CQX A;  2KIF A;  4Z6Y A;  1F36 A;  1UAA A;  2DYS H;  1ZAR A;  4X0G A;  4IOA F;  1XPX A;  3H5N A;  1C0W A;  1N25 A;  1RC9 A;  1A35 A;  4BXX J;  2H6B A;  5CPR B;  2K3P A;  1LQ1 A;  1RIO H;  2ZNZ A;  2CUJ A;  1O7L A;  2PX9 A;  5F1J A;  1F1Z A;  2M4K A;  2VL8 A;  4MEX F;  4ZZD A;  3H36 A;  2DLL A;  2F48 A;  3J81 Z;  4Y3O A;  3I56 I;  3FMS A;  4RDU A;  4P55 A;  1Y6I A;  4CIC A;  4I0B A;  3JSP A;  1Z91 A;  4G6T B;  2PJR A;  1JUM A;  2V79 A;  3K1N A;  3CCV I;  5E3N A;  2A6H F;  3JRD A;  4HA8 A;  1PUF A;  1W0T A;  1R1V A;  2QSF X;  2BZT A;  1OPC A;  3JSO A;  2NVQ J;  2Q2E B;  3CP2 A;  1QZY A;  3P5J A;  4B09 A;  5LBQ A;  4IQJ A;  3HOT A;  5DYM A;  5LLQ A;  4MEY F;  5JVG F;  4M9S A;  3VYT B;  1SVO A;  2M8E A;  5FLX K;  3JW4 A;  1G3Y A;  2M7B A;  3BZ6 A;  4XMY A;  1J0R A;  1TTY A;  2BV6 A;  5IT9 K;  3MKL A;  5DCM A;  4ZC3 A;  1HC8 A;  3O2P E;  1QZZ A;  3CP8 A;  3RIR A;  3BG7 A;  3PM1 A;  3GWZ A;  5KNL A;  4OIP F;  4IEJ A;  1BI2 A;  4P9U A;  2DCE A;  2HZD A;  3ULQ B;  5IT3 A;  2GZW A;  4KIT B;  1Y39 A;  2OA4 A;  4PJM A;  1HBX G;  1Z7U A;  3HTS B;  4DQ2 A;  1ZRD A;  1A6Q A;  1FBQ A;  3I54 A;  4LGW A;  4E6K G;  4ZZL A;  3MCZ A;  3KEQ A;  4P9F A;  1U3E M;  2JJ7 A;  1SMT A;  2Y30 A;  2O5R A;  5EZG A;  1Y0U A;  3OYE A;  4XKV A;  2ZBK A;  4CYC B;  2VC0 A;  2VPR A;  2GWR A;  2A3S A;  4BAC A;  1DUX C;  3DKX A;  1BOA A;  3T8T A;  1TW3 A;  3L00 A;  3S2W A;  2HEO A;  3BQZ A;  3DQV C;  1OCZ H;  3CF5 F;  2DN0 A;  1T0F A;  5HLH A;  1R71 A;  1QBJ A;  3ZPL A;  1LPQ A;  2XF7 A;  2G9W A;  1ZRF A;  4XLC A;  3S8P A;  1MDM B;  3Q5F A;  2VOP A;  2DT5 A;  1WH5 A;  1PP7 U;  2M1B A;  4GYG A;  4CUG A;  2AHQ A;  5FD6 A;  1NK3 P;  1LFP A;  2RRE A;  1LFU P;  3H0D A;  3V8J A;  5IP7 J;  5J3L A;  4RGR A;  4DGW B;  2LSO A;  3M8J A;  5KVR A;  2K40 A;  1TZL A;  4LMY A;  3IWZ A;  1JT0 A;  1ZR4 A;  1BA5 A;  3DCF A;  3MMY B;  2QBY B;  4Y7N J;  2XKP A;  4ENJ A;  3O8H A;  3IP4 B;  2W4S A;  5JLW A;  3OR2 C;  2AXT C;  2FRH A;  5CKT A;  2R5Z A;  4NUB A;  2L02 A;  4XL9 A;  5ICF A;  3PO3 J;  3CLQ A;  4Y4R A;  2YU9 J;  2Z99 A;  3HPH A;  3CCE I;  2EA2 A;  2M7A A;  3WGI A;  4I76 A;  3CDH A;  2O6G E;  3GTL J;  1MMD A;  1NH3 A;  3LFU A;  1B4A A;  3HKZ A;  2OTL I;  1FX7 A;  1IN6 A;  1J09 A;  2FOK A;  1B72 A;  1UST A;  2O61 A;  1ETY A;  1ON2 A;  2DDA A;  2DW4 A;  1YIO A;  1FYL A;  3LL7 A;  3CCU I;  1NK2 P;  3E3V A;  3FHZ A;  1QGP A;  2XGC A;  4NQW A;  3GFI A;  3HUG B;  4DZJ A;  3W2V A;  1X58 A;  1YX3 A;  4GCV A;  4L18 B;  3AFH A;  1N78 A;  2EIJ H;  4WXD A;  1O3Q A;  4XSX F;  3GTG J;  3LMM A;  3GO5 A;  3ONQ A;  4PGH A;  4KT6 A;  3GX4 X;  4U0Y A;  3O3K A;  2XVC A;  2GOX B;  2PMZ N;  2QSG X;  1SMY F;  4U87 A;  2KL4 A;  1WRJ A;  3D1N I;  2LF7 A;  1ETV A;  2R4G A;  3BJA A;  2QLZ A;  2WC2 A;  5DDG A;  4RAY A;  1BBY A;  2L5Q A;  2K27 A;  2W00 A;  1FZP B;  1DU0 A;  3ZQC A;  1Y1W J;  3J7Z I;  2OU2 A;  2NVY J;  3ZMU A;  1Y8Q B;  1TL8 A;  1S3J A;  2LR8 A;  4NC7 A;  3BPV A;  5FKM A;  3LWF A;  2CW8 A;  3ABU A;  3SZP A;  3FF5 A;  1O3S A;  3G4S I;  3HM5 A;  2LVS A;  2X1C A;  2EZL A;  1UHS A;  2G0E A;  3WHC A;  2XAS A;  2QEN A;  1I3A A;  2CG4 A;  4V19 K;  4WF2 A;  1LVA A;  4HEA 2;  2VC1 A;  3EUA A;  4B48 A;  1YLF A;  1IN8 A;  3H9J A;  1B8I B;  1DP3 A;  2OQR A;  1KYW A;  3Q0V A;  4MLO A;  1BN5 A;  3HB9 A;  4XLH A;  4IKF A;  1BJZ A;  1QA6 A;  3LAJ A;  1MIJ A;  2DA6 A;  2Y0S N;  2FNP A;  3U1D A;  2RC4 A;  5E8I A;  2EV6 A;  2VKH A;  3F0C A;  3ABT A;  4P96 A;  3F3X A;  1R1T A;  4J01 A;  3TL4 X;  3Q0W A;  1OYI A;  4XLN F;  1IRF A;  2D1H A;  3E5X A;  4FE7 A;  1QVU A;  2IA2 A;  5C4X J;  1TT5 B;  4AYB N;  1KU3 A;  1OYW A;  4A2U A;  3DLL F;  3CD6 I;  2FJ1 A;  4I6Z A;  2M34 A;  4G6Q A;  4E7H A;  1L3L A;  2ZJP F;  5GAH J;  2ICW G;  4EVI A;  2X0L A;  3HPG A;  2L01 A;  3U9G A;  1MNE A;  4YEL A;  3F23 A;  4B3X A;  2W85 A;  1GV5 A;  4F92 B;  2KIM A;  3K10 A;  4DIQ A;  2L9N A;  2MH2 A;  4HNV A;  3HTU A;  4AWX B;  4Q48 A;  1W5C C;  2DDB A;  4BKX A;  4C3H J;  2LBF B;  2RV8 A;  2V26 A;  1K61 A;  4ETS A;  2CW7 A;  3GLX A;  3JRE A;  2DMP A;  3KIO A;  4LK0 F;  1K6O A;  3AL0 B;  1REP C;  4JYK A;  2X1E A;  3DTK A;  2NNN A;  2ELH A;  4XRS G;  2DMN A;  3RKQ A;  4RLQ A;  4ZYD A;  5F27 A;  3M4O J;  1SEU A;  2COB A;  2VBW A;  5BMZ A;  3A1Y A;  5E18 F;  4X1E A;  1U9N A;  4A3D J;  4XLE A;  1DQU A;  3C1D A;  3BG6 A;  3OYK A;  2ZSI B;  2L0K A;  4M3G A;  2BEO A;  3TO6 A;  4P1W A;  4RB3 C;  3GFM A;  2JMW A;  1LVK A;  2HI3 A;  1FTT A;  1YYV A;  3WG7 H;  3FM3 A;  3HJE A;  3KP5 A;  3HSE A;  4PJJ A;  3OS1 A;  1FSE A;  4XRS A;  5H2F C;  5FB2 A;  3GZN B;  1YIJ I;  1ZLK A;  5F0F A;  4PK4 A;  2X51 A;  2A5W A;  5E1Z B;  2EV5 A;  2M2E A;  4MNU A;  1SFE A;  1JKQ C;  3GF2 A;  4BU2 A;  4KNY A;  3KPH A;  3LFK A;  1WJB A;  2I5U A;  3WE3 A;  4B43 A;  2HFH A;  1P4A A;  1HST A;  1ORK A;  1KU9 A;  3ERE D;  2MBF A;  1GUU A;  3TOB A;  2AO9 A;  2R3S A;  3E6D A;  3FXQ A;  1B9M A;  4EJU A;  1PP8 F;  1H88 C;  3B6A A;  3RYP A;  1SAX A;  5D4R A;  2JQ7 A;  1XTA A;  2K9M A;  2R7O A;  3IAS 2;  2LY1 A;  2LD5 A;  4FQG A;  3KLO A;  2IS6 A;  1E2X A;  5IYB J;  3K4M A;  1SC7 A;  3MD2 A;  4YEJ A;  5M5Y J;  3OYH A;  3K9T A;  3PNT A;  4DBR A;  4XLA A;  2FX0 A;  3OY9 A;  4U0W A;  4QPQ A;  3M8E A;  2W82 A;  2DK5 A;  1MD0 A;  2W24 A;  1VQO I;  1IV6 A;  1P9Q C;  2O8X A;  5D5V B;  3VWB A;  2E1C A;  1KQ9 A;  3A4C A;  3BLY A;  4CCK A;  2R7S A;  2ZXJ A;  1YJW I;  4GRI A;  3GEZ A;  3NAR A;  1TWC J;  1EA3 A;  2Y9Y A;  1RNL A;  2HZT A;  2KDZ A;  3A0B C;  4QWQ A;  4JBA A;  2NVT J;  1HDP A;  2XPV A;  4LFU A;  4ZYH A;  4BE0 A;  3BZC A;  3KX2 A;  3ECO A;  1ZTR A;  1YE9 A;  2YX7 A;  1S7E A;  3LST A;  2V9K A;  2G7U A;  2CW0 F;  2XIG A;  3TW6 A;  2FSW A;  3VYS B;  5K1Y A;  4HV6 A;  4IHS A;  2KJB A;  4BQN A;  5GPC A;  1ZK8 A;  2F5V A;  1E3P A;  2BE5 F;  1IF1 A;  1U5T B;  4UUS B;  1ITY A;  1RRJ A;  1WJE A;  4HX7 A;  1KQ8 A;  4A3M J;  3OYI A;  3LQQ A;  1XCV A;  2P6T A;  4CHU A;  3SZT A;  3AKZ A;  2F4I A;  4I02 A;  1QO0 D;  5FGM A;  1I27 A;  1W7P D;  2CO5 A;  4M6Y A;  1U9O A;  4B4C A;  4LB6 B;  2WWY A;  3FK6 A;  1HOM A;  2L54 A;  2DFF A;  2XGD A;  1FEX A;  4OIQ F;  2WAD A;  2BY2 A;  3ZOB A;  2W57 A;  3F8B A;  5TIS C;  2M9H A;  1T2K A;  1O3R A;  5DCF A;  4HX4 A;  3CCY A;  2AQF A;  3ZN1 A;  1FWZ A;  3RJP A;  3ZRG A;  1RI7 A;  1V4R A;  4ZDO A;  2OPT A;  2DPU A;  2EA4 A;  4RMN A;  2RKH A;  3CUQ B;  2F5D A;  3BWG A;  5DEQ A;  3OIP A;  3IL2 A;  5F64 A;  5LHH A;  4A3L J;  1SFK A;  1XMK A;  2MA3 A;  5BOX A;  4Y13 A;  1GHC A;  2GQQ A;  1PJR A;  2KLO A;  4FT8 A;  4WK8 F;  1QU3 A;  3B6C A;  3LSH A;  1SD7 A;  2CH0 A;  4CYD A;  5J4Y A;  3SHF A;  5EEG A;  2HQ5 A;  1OLT A;  1P7I A;  3I58 A;  1X3Z B;  4BXU A;  1T33 A;  2ISY A;  3ZQ7 A;  4HNU A;  1YRN A;  1KZH A;  2O0Y A;  4R1H A;  1R9T J;  1UG0 A;  1FOW A;  5FKK A;  4L5E A;  4Y52 J;  1BI1 A;  2RQP A;  3M8F A;  3BG3 A;  2VBX A;  2ID3 A;  2YU3 A;  1I1S A;  5D5U B;  1TQP A;  3ZQQ A;  2EIL H;  4MQV A;  1QRY A;  2L9R A;  1WVR A;  3KP4 A;  4XBF A;  1MBG A;  3A0H C;  3GZ5 A;  3LSK A;  2R7Z J;  3ROU A;  2XAH A;  2TDX A;  2P8T A;  5HNH A;  1RR8 C;  2QQ8 A;  3PUF A;  2E2I J;  3AL0 C;  5CJ9 A;  4E7J A;  2A6E F;  1VQL I;  2QSH X;  4BQA A;  1U8B A;  5M3M J;  2RN7 A;  1BM9 A;  4XIC A;  2Y9Z A;  3KP7 A;  3WU1 B;  3REO A;  3BOQ A;  1MBE A;  4ON0 A;  1XMA A;  1ERD A;  2XF6 A;  1MBH A;  2IW5 A;  3WU0 A;  2NYX A;  2MGQ A;  3WU2 C;  5L3E A;  1Q1V A;  3OYJ A;  2X4H A;  4FTH A;  3JRH A;  3FXO A;  2FE3 A;  2L9S A;  4HG2 A;  4UVB A;  1I39 A;  2TRT A;  1OIS A;  4LG3 A;  2LKS A;  1LEB A;  1GLN A;  4NB5 A;  2GXB A;  4F7Z A;  3ZXS A;  2VOD A;  3V7R A;  2PLY A;  2DJI A;  3DKW A;  4XM3 A;  2OD5 A;  4M3B A;  4CCJ A;  4U7D A;  2OC6 A;  2YX4 A;  2Q1Z B;  5KK1 A;  4JOM A;  1DPU A;  3TDU C;  4HDU A;  3EYY A;  4HYE A;  4PJL A;  2HKO A;  3ZQL A;  2K5C A;  1BC7 C;  4BE2 A;  3IH2 A;  1IJW C;  1YI2 I;  1ZN2 A;  3KYD B;  3MFK A;  3C2H A;  3K2A A;  2CV2 A;  1IAW A;  5LGU A;  5FRO A;  2CYY A;  5HLT A;  5C4J J;  3BJ6 A;  3RPU A;  5ICC A;  1K4S A;  4XLF A;  4BHC A;  2L7Z A;  4WXH A;  3L2R A;  3CO7 C;  5E8G A;  4LIT A;  4A5M A;  1HKT A;  2V9V A;  4KN7 X;  3H1C A;  4RM3 A;  2JSC A;  1JE8 A;  4UB6 C;  4CYC A;  4GGG A;  1K6Y A;  4UVC A;  3H9G A;  4Y17 A;  2JZY A;  2M0M A;  4YRV A;  4I2O A;  2KDO A;  3TP0 A;  1SAN A;  1YQA A;  2HYG D;  2LP0 A;  4YFK F;  1H8A C;  5J1R A;  1HW5 A;  1MW7 A;  4AD9 A;  2ESN A;  3J80 K;  4E7S A;  2K3F A;  1BW6 A;  2DA7 A;  3KET A;  1T38 A;  1MDM A;  2NOJ B;  2AS5 F;  4RA2 A;  3IKV A;  5B1A H;  2DA5 A;  1XDU A;  3UNG C;  1ZKG A;  3BDD A;  1ETX A;  3S2H J;  3L9F A;  1R23 A;  3CF2 A;  3F9K A;  1JXS A;  1H9G A;  3VYR B;  3NWS A;  1R4N B;  5EG0 B;  1TWH J;  1GVD A;  2KIU A;  3BCA A;  4UVA A;  3OYB A;  3IH4 A;  4C2M J;  2PI0 A;  3S17 J;  2NXN B;  2QUF A;  1YIT I;  1VZ0 A;  3K4B A;  2DBB A;  1ZQ3 P;  1ZR2 A;  2QBY A;  3HOY J;  1U5T C;  2PEX A;  1AU7 A;  1YG2 A;  5JHF A;  1DPR A;  2UXN A;  2E1N A;  2CUF A;  1UB9 A;  3H0G J;  1MNM C;  4V2G A;  2GXA A;  1S29 A;  2VON A;  1I6H J;  4UV8 A;  4IHX A;  2V4J C;  3OSG A;  1YO5 C;  1WJD A;  2JA8 J;  3BT9 A;  2M8G X;  2KMU A;  4M9X A;  1MSE C;  3LSM A;  5GPA A;  3OYM A;  1F4K A;  4CSW A;  1TQM A;  2VQG A;  4KIG A;  2FBI A;  1D8J A;  2EZK A;  1J7K A;  4HF1 A;  1T98 A;  2XDV A;  2HDC A;  1CGP A;  4ZDL A;  4ZTF A;  3DU6 A;  2E1M B;  2J5O A;  1FMV A;  4FCY A;  1MBJ A;  3FBN B;  5K5Q A;  1GT0 C;  1IXR C;  4EM0 B;  3HUG A;  4C3J J;  3H9Q A;  4AIJ A;  3TGN A;  3QPH A;  2QZ8 A;  4PCQ A;  4KIS A;  4DZP A;  1PUE E;  1G3T A;  4PJN A;  2QQB A;  1Y1V J;  5JFR A;  2F6C A;  3FM5 A;  3TKY A;  2CQQ A;  2X6O A;  3PNV A;  1MMN A;  1TNT A;  4A69 C;  4AVP A;  5DV5 A;  1ZRC A;  1XGN A;  2H27 A;  1K78 B;  2IT0 A;  1QQI A;  2UWM A;  2R7Q A;  4Z2Y A;  3S3N A;  3A2K A;  4RGS A;  1J9I A;  3IKT A;  4BAY A;  2IAI A;  3ZMD A;  3O8G A;  2VE9 A;  3S16 J;  3CES A;  5DM6 F;  1QVT A;  3K1P A;  2NVX J;  1VQ9 I;  3RQ4 A;  1UCR A;  3G6E I;  1ETQ A;  2ZB9 A;  4J00 A;  1LKX A;  2DT7 B;  2O8K A;  3MVP A;  4HF2 A;  3OYL A;  4EM2 A;  1S7A A;  2W48 A;  1IDZ A;  5CVI A;  2OJE D;  2I10 A;  2IS4 A;  1TBX A;  2VIX A;  2X6X A;  3OMY A;  2EBI A;  2VI6 A;  1B8I A;  3S1M J;  4O3M A;  2D5V A;  2IGM A;  4HSR A;  3CCS I;  2A69 F;  1E3O C;  1BC8 C;  2NS8 A;  3OYF A;  3SYT A;  4OOI A;  2E71 A;  2V7F A;  1YS7 A;  1WQ2 A;  2VKD A;  1JTX A;  4PDK A;  4YIF A;  4A12 A;  2KRC A;  3F8C A;  1VQ4 I;  1I1G A;  1VQK I;  3QOE A;  2OQG A;  3N4M A;  1VTN C;  1XD7 A;  1ODD A;  3QOD A;  2YSR A;  4EGY A;  1A36 A;  2R5Y B;  2L9V A;  2XRO A;  4EM1 A;  1JHF A;  3H3V K;  3K4N A;  1U8R A;  1KU7 A;  4H0E A;  2VQC A;  3D5R C;  2HPM A;  5BPI A;  3AG4 H;  1AWC A;  2A61 A;  3L1P A;  4KDP A;  4CDG A;  2HOE A;  1H89 C;  2Y69 H;  2HVR A;  1ZG3 A;  5LGN A;  3FIS A;  2R7U A;  4JX6 A;  2H1L A;  4A0X A;  2MSY A;  1YX5 A;  3RCO A;  1VFC A;  4MFE A;  2PJP A;  1BR4 A;  4XN0 A;  2LBF A;  3DLA A;  3FKI J;  2UXX A;  2Y31 A;  2P7C B;  2KT0 A;  2VLA A;  4H4K C;  2JA5 J;  2CGP A;  3OYG A;  4CCL A;  4AVZ A;  2JRM A;  1V5G A;  3EET A;  2CMP A;  4RBO A;  4XOR A;  5HOD A;  1T39 A;  5FFX A;  4D5C A;  3F8N A;  2E5Z A;  1OCT C;  3CCM I;  5ILS A;  1M1E B;  4BJT A;  4G8X A;  1Z9C A;  1TLH B;  2CUE A;  3ABM H;  4KIC A;  4DW6 A;  2F5F A;  2P5V A;  3EUK L;  2VBY A;  4KA4 A;  5CQE A;  1YTY A;  1WI3 A;  1KYZ A;  3R4K A;  2QVO A;  4BJ5 C;  3OOU A;  2WY7 Q;  3SQN A;  2YS9 A;  3FX3 A;  3GFJ A;  4BL0 B;  3L2W A;  2WB1 A;  4B1R A;  1EH6 A;  4JK1 X;  5CVU A;  2O7O A;  2TCT A;  2HWV A;  3DPT A;  2DOE A;  4UHT A;  2ELJ A;  5IYD J;  1IN7 A;  1IC8 A;  5EZH A;  1BIB A;  3D5L A;  2QM3 A;  3DKY A;  3TO7 A;  2L7M P;  1AOY A;  3X2Q H;  2ISZ A;  5IP6 A;  5D6F A;  4M6X A;  5IOZ A;  3MKY B;  3V4G A;  3BTI A;  4HX8 A;  5E1X A;  2LH9 A;  2ACJ A;  2E35 A;  2EIN H;  5EGO B;  2K4B A;  2IGO A;  4MTE A;  2F5E A;  1S5L C;  2IGN A;  3UKG A;  1MSF C;  2XB5 A;  1YFH A;  4E7L A;  5D5X B;  4NC6 A;  1S72 I;  1XG1 A;  3CMM A;  4II2 A;  4G12 A;  1LDD A;  2Z9O A;  1FPQ A;  4J19 A;  2WAF A;  2V1X A;  3IRR A;  3J81 K;  4HLY A;  3CME I;  5J1Y A;  3BR2 A;  3HG9 A;  3BR0 A;  2V6E A;  1BL0 A;  2O03 A;  4KT5 C;  4XK4 A;  3CDI A;  3KYL A;  2QGU A;  2MD5 A;  3I64 A;  1WHU A;  3I4N J;  2DA3 A;  3LSJ A;  4C2U A;  4S04 A;  4RB1 A;  3M3Y J;  4OMY A;  3HIF A;  3AAF A;  4UB8 C;  4IPA A;  1PUF B;  3CCQ I;  2P7V B;  3WTU C;  3SXY A;  5ICG A;  3FK7 A;  1YW7 A;  3P7N A;  1X3W B;  4I0A A;  1JKO C;  2E1M C;  2F5C A;  2MC4 A;  4A6E A;  1X4P A;  2EFW A;  2LTP A;  3JTG A;  4FE4 A;  2JVG A;  1HA8 A;  4MQ9 F;  1Q1H A;  2K86 A;  2JPB A;  1T8I A;  3CC7 I;  5J47 A;  2EZI A;  4ASN A;  3MKW B;  1RET A;  2WAQ N;  2ZXH A;  4KUM A;  3HGY A;  1UMQ A;  2FD5 A;  4ESB A;  5CYV A;  1U5T A;  2IP2 A;  3G1L A;  4UUS A;  1LE8 B;  4K2E A;  2E2H J;  4B3A A;  2CU7 A;  5LHG A;  2P6S A;  5HS7 A;  1IGN A;  1RR7 A;  1MJB A;  3OYC A;  1V3F A;  1JHH A;  3SEQ A;  1TNS A;  2CS3 A;  3PQJ A;  2FMY A;  4I99 C;  1G3W A;  2ZCW A;  3T8R A;  2QQ9 A;  3TW7 A;  3G1O A;  2E7W A;  3ZR8 X;  3DEW A;  3KZY A;  4RAF A;  1YJN I;  2MW8 A;  2ZSH B;  2HGC A;  4PSW A;  5FRN A;  5EEA A;  3HRU A;  1JJ6 C;  3EQL F;  2XGE A;  2VE8 A;  4RB0 A;  3BZK A;  3RZO J;  1IZ1 A;  3DEE A;  3I9V 2;  4BS9 A;  1H9T A;  2VBZ A;  4E70 A;  2R7X A;  3WHB A;  3BR5 A;  1ETO A;  3W6K B;  2KIS A;  4CXF A;  1NTC A;  4XN3 A;  4UUV A;  2DAO A;  3CUQ A;  3I53 A;  4HQE A;  2JT1 A;  2F4M B;  4MFD A;  5DD4 A;  3C18 A;  1FLI A;  2UZK A;  1LNW A;  2MH9 A;  1NG7 A;  3WGH A;  4FIS A;  1FIA A;  3CTA A;  2K7L A;  3OS0 A;  2XV4 S;  1TC3 C;  4OU0 A;  5EDN A;  2WV1 A;  3LA2 A;  3FDY A;  4TV7 A;  3CC4 I;  2ZME B;  2JRT A;  1XC5 A;  5K7F A;  1EF4 A;  2ECC A;  3V7C A;  1G59 A;  1W7P B;  2GA1 A;  3FXL A;  2ID6 A;  1WWX A;  2JTV A;  4BQO A;  2VJ4 A;  2ZFW A;  4IF4 A;  4AIK A;  1JT6 A;  4HST A;  2LY9 A;  1YOV B;  3W3C A;  2W1O A;  1R58 A;  1FSH A;  2WV0 A;  1AKH B;  2QF7 A;  3VFZ A;  2X48 A;  3JRB A;  2B63 J;  3AG3 H;  1QNT A;  3CJT B;  3H92 A;  9ANT A;  1D5V A;  2HTJ A;  2B9S A;  1TWG J;  3COA C;  5K7H A;  2P5K A;  2R7F A;  3OSF A;  1X2N A;  2JUC A;  4BHB A;  3E7L A;  4Q4Z F;  4BEH B;  3C7J A;  4JX5 A;  1ZRE A;  2HNH A;  1X1C A;  1HQC A;  3OV8 A;  2RNJ A;  3Q9S A;  4MTD A;  2BVL A;  4PZJ A;  3HEF A;  3W6V A;  2E34 A;  5GAE J;  3LA3 A;  2DT6 A;  1WJ5 A;  2KRF A;  4II3 A;  3K70 D;  2STT A;  3HOU J;  1F43 A;  3NQO A;  1EJ9 A;  5TRD A;  2ETH A;  4MO7 A;  4IRG A;  3BTC A;  3VOD A;  3G73 A;  3I5U A;  1HKQ A;  5M5W J;  2BOL A;  1WPK A;  2JUG A;  2GOM A;  1ZG1 A;  4QSH A;  3TBI A;  4XQF A;  5HLG A;  4ENN A;  5C3E J;  1W0U A;  1HSJ A;  1IDY A;  5GAG J;  5B5E C;  5J8F A;  3K0L A;  1WKM A;  1VQM I;  1LDK B;  1VQ7 I;  2KFD A;  5E3O A;  3IV5 A;  1XS9 A;  2LRE A;  2ZO4 A;  3ZQF A;  3HXL A;  4XOP A;  1SD5 A;  1XX5 A;  1ZYR F;  4DYQ A;  4F55 A;  1BI0 A;  3MWM A;  3H5R A;  1A31 A;  2VAS A;  2Z33 A;  3CCR I;  3TED A;  1OCO H;  1FNN A;  2ZXI A;  2K9S A;  4W1U A;  4HBL A;  1GV2 A;  4HLX A;  3L2C A;  1EH8 A;  4D1Q A;  3GZ6 A;  5J40 A;  1K7A A;  3JAM Z;  5E3M A;  1OFC X;  1X2M A;  3U2R A;  2H8R A;  3HRS A;  4JX4 A;  2OBP A;  3KP3 A;  3ISP A;  3GVA A;  2P81 A;  4RM2 A;  1FTZ A;  2A6T A;  1JGG A;  1GXQ A;  4XON A;  2VQL A;  3WTS C;  3BR1 A;  2RDP A;  3Q3S A;  3QPT A;  1ULY A;  2M30 A;  2DOA A;  2L2O A;  3ZQH A;  2BXZ A;  1O4X A;  1R00 A;  4E7I A;  1XSV A;  2EWN A;  4ZDP A;  1R6R A;  1MKM A;  4IL6 C;  2VXD A;  2ZNY A;  4XSZ F;  5F0C A;  3VYU B;  1SAU A;  3VPR A;  2DA2 A;  4C2T A;  4LJZ F;  1X1A A;  4G6D A;  2H6C A;  1D5Y A;  1WSU A;  1X4O A;  4AID A;  4A3G J;  3O6B B;  2BGC A;  2PMH A;  5ILV A;  5EG0 A;  4A3B J;  4L0Y B;  4IZZ A;  4CGZ A;  2EFQ A;  2NRA C;  2BY3 A;  5EEH A;  5KCM A;  2EK5 A;  4BXF A;  3JCU C;  3PFY A;  5ERI A;  2CFX A;  2E7X A;  3BR6 A;  1ACI A;  3F22 A;  2XKO A;  3ABK H;  3D5S C;  1MGT A;  5L3F A;  1ETK A;  4Y15 A;  1VI0 A;  3GXO A;  5D6E A;  1YHQ I;  1ZHF A;  4EAT A;  5LHI A;  4IRH A;  4U0V A;  1KON A;  3P9K A;  2VJ5 A;  2EB7 A;  1Z05 A;  1ZAO A;  5DM7 F;  1A04 A;  4ZTJ A;  3ZQI A;  3S3O A;  2IXS A;  3C2B A;  4HZF A;  2CSO A;  4HOB A;  2NOG A;  3QPS A;  2LLK A;  2Z5U A;  4LB5 A;  1D0X A;  2NVU B;  4S0H B;  2RGV A;  1LFB A;  1P92 A;  4OWR B;  5D4S A;  5L3G A;  3G3Z A;  2HU9 A;  2H8W A;  1OCP A;  1Y8R B;  5KAF C;  3WTV C;  1BJA A;  1Y56 A;  2QQA A;  1R7J A;  1WJA A;  1BI3 A;  2LC2 A;  1U78 A;  3GBG A;  4G7Z F;  4UXN A;  3BTL A;  3QYF A;  2LK2 A;  3WTY C;  1IG7 A;  4QTR A;  3FIW A;  2H09 A;  5E17 F;  1K78 A;  1ZGW A;  3KZZ A;  1GVJ A;  2X85 A;  5EYR A;  4HDV A;  4L9V A;  1TWA J;  1J2X A;  1IRX A;  2KKO A;  4OIR F;  2GAU A;  1QHH D;  3OYD A;  1D8K A;  3F8M A;  4ZH4 F;  4I7H A;  2WY8 Q;  2DYR H;  2O9L A;  1ZGA A;  2Q2E A;  5J1U A;  4L9T A;  1G6N A;  3BQY A;  4LG0 B;  4AU7 A;  2COM A;  2E19 A;  2HXO A;  3JRI A;  4BDZ A;  4RGX A;  2HYJ A;  3B02 A;  5A2Q Z;  3HHG A;  3DF8 A;  1BR1 A;  4OAY A;  2BY0 A;  3T5X A;  2R7V A;  3E5Q A;  1EH7 A;  2A5Y B;  2ECB A;  3SZG A;  3DEU A;  4OIN F;  3DPU A;  5FLX Z;  3KZI C;  1BW5 A;  2H1K A;  2CRG A;  2EIK H;  4YII A;  4LLN A;  4AUX A;  1T6S A;  2HVS A;  5IPA A;  5IT9 Z;  3L09 A;  2HDD A;  2ADU A;  3NAU A;  1VQ6 I;  2HOA A;  2PG4 A;  2XRN A;  4UUT A;  4KMF A;  4A5N A;  3I3L A;  4RAG A;  3CZ6 A;  2W25 A;  1HKS A;  2VT3 A;  5FKN A;  1W36 C;  2R5Y A;  2FNA A;  2K9N A;  4CZZ A;  2XAQ A;  3K6G A;  5BPD A;  3GTO J;  1WH7 A;  4U88 A;  2JA2 A;  1FMW A;  2P4W A;  1XSX A;  3SFI A;  4NHJ A;  3I4P A;  3BY6 A;  4BHP A;  4G7O F;  2KPM A;  5IOY A;  4D0P A;  1QHG A;  5F04 A;  3JAM K;  4IVN A;  3V8K A;  2E2J J;  1WJC A;  2IRF G;  2WBM A;  2XHK A;  3M9A A;  2XAG A;  2LY2 A;  2EH3 A;  4PFP A;  1X19 A;  3FHN A;  5FO5 A;  2DU9 A;  2LFB A;  1MH3 A;  1JJ8 C;  1R22 A;  3I0T A;  3DBL B;  1B9N A;  5ED4 A;  4M3F A;  3GTJ J;  2ZXW H;  2VOO A;  3ABL H;  5LD2 C;  2NAZ A;  2XRL A;  4L0Z B;  2QA4 I;  4LIU A;  2PMZ A;  3PSF A;  4PJ0 C;  3DP7 A;  1QPI A;  1OMI A;  1FIP A;  1OCR H;  2HKX A;  4Y33 A;  3CJR B;  1VF9 A;  5L3D A;  4M6V A;  1ZG5 A;  4F52 A;  4E7K A;  3LOC A;  2A05 A;  2BYV E;  1OYY A;  5K7Z A;  1IRZ A;  2KP6 A;  3K69 A;  4BBR J;  5KAI C;  1FJL A;  1Z77 A;  2M5W A;  3IH3 A;  2CFO A;  2QKL B;  2A68 F;  3OYN A;  1B59 A;  1WFX A;  2YPR A;  2FBH A;  1RES A;  2FA5 A;  1ZLJ A;  1LDJ A;  1MJA A;  1R36 A;  4CO8 A;  1HLV A;  3BCB A;  5CLS A;  1STZ A;  3WTT C;  3SFZ A;  2L3D A;  4IHT A;  4B8X A;  2JSP A;  3PFI A;  2V1U A;  2JVH A;  2Y0S A;  3W2A A;  1I6X A;  2PN6 A;  3K2Z A;  2LRD A;  2V9P A;  2STW A;  2R7W A;  2HVQ A;  2F4O B;  5CQG A;  3G2B A;  2CJJ A;  4A3E J;  5K5R A;  4UY8 I;  5FD5 A;  3WTZ A;  1Z3Y A;  3BG5 A;  3CUQ C;  3EYI A;  4ZYG A;  4AYB A;  4A3J J;  5EGO A;  4CZC A;  2FOW A;  3ML6 A;  2BXY A;  3OL3 A;  3OWT A;  3S93 A;  4BH9 A;  3MZY A;  2ME6 A;  4YFN F;  3Q0U A;  4FX0 A;  2CQN A;  3PIO F;  2XPW A;  2LNB A;  2G7H A;  5LRR A;  3A01 B;  1FOK A;  1AA7 A;  1IXS B;  3GME A;  2K9Q A;  3CLO A;  2GIZ A;  4F3Q A;  3GTQ J;  1UJ8 A;  2PQ8 A;  4ITV A;  1Z1D A;  1FBS A;  3H5A A;  3B73 A;  5EJC A;  4EJT A;  4HAM A;  2IS2 A;  2ME0 A;  3GW2 A;  4D7M A;  4MIM A;  4KYW A;  5J6X A;  1V55 H;  4ZJZ A;  2Y48 A;  2HYF A;  3SDB A;  3D0S A;  4XID A;  3CCL I;  3RKW A;  3S1R J;  2NNY A;  2JPC A;  3I59 B;  3KEY A;  1CQT A;  2GLO A;  4EQQ A;  2AQE A;  1UG2 A;  4S05 A;  4WWC A;  3RKX A;  2DPD A;  5A2Q K;  2DMT A;  3CO6 C;  2L7K A;  5HS9 A;  1IW7 F;  4L9N A;  5JVT A;  1LB2 A;  1POG A;  3RQI A;  3E0J B;  5LGT A;  1R5I D;  2J5P A;  3KFW X;  1FC3 A;  3ASN H;  2LYC A;  1WCM J;  1LJ9 A;  3R61 A;  2VN2 A;  2WA0 A;  5F0H A;  5J4V A;  2ZJR F;  3LSI A;  4IXA A;  4AC0 A;  2ZKZ A;  2ZC2 A;  4XRF A;  4EJV A;  1NG6 A;  3GFL A;  4UV9 A;  2HQA A;  3TO9 A;  3KP6 A;  1LE8 A;  4ZYE A;  2R92 J;  2RAE A;  1XGM A;  3ZMT A;  5CVJ A;  1WGX A;  2R7R A;  3MAJ A;  2R0Q C;  1ONV A;  1MND A;  2FEZ A;  2UV1 A;  2W7N A;  4KFC A;  1SVL A;  1X3U A;  1XDS A;  3BP8 A;  3N05 A;  3WOD F;  2R7D A;  2ZJ2 A;  2X6Y A;  2Z2S B;  3W2W A;  4KN4 X;  2BBY A;  5BNG A;  3JRA A;  2HS5 A;  2KQR A;  2KZV A;  3BPX A;  4LD5 A;  4MHG A;  1J75 A;  2LKX A;  4DJA A;  4IRI A;  3S1N J;  4XLP F;  2OF7 A;  3DPL C;  2BHY A;  3FKJ A;  1UHW A;  4AM3 A;  3QU6 A;  1R5H A;  2M4G A;  2HPI A;  1APL C;  1UHM A;  4CA0 A;  3QWL A;  2D45 A;  4U7B A;  5H20 A;  2DI3 A;  2EQR A;  1D1B A;  1S6L A;  3DBH B;  1Z21 A;  3UR3 C;  1E0E A;  4HV5 A;  3R60 A;  1BOB A;  4R79 A;  1IO2 A;  1RUN A;  4BYY A;  1DP7 P;  3NRV A;  3KYC B;  5HVQ C;  2LDU A;  2W84 A;  4ABZ A;  5D8K B;  2D2W A;  1OCC H;  4X6A J;  4AIH A;  3K1M A;  1OJL A;  1O3T A;  1G4D A;  2O3F A;  4KMU X;  3FXJ A;  2M45 A;  1N75 A;  1FY7 A;  3K4K A;  1SFO J;  3MZH A;  4UNO A;  4IQ4 A;  2ZME A;  3HHH A;  2OZU A;  1OKR A;  4G7H F;  1MH4 A;  3K4J A;  4DYR A;  2LKP A;  1JKR C;  1W7P A;  5E3L A;  1CF7 B;  2OUM A;  1KQ0 A;  3QOP A;  1FBU A;  1RZ4 A;  3NWT A;  5AON A;  3E6C C;  2QEX I;  4G9Y A;  1HDD C;  3CCJ I;  3JTH A;  1XCB A;  4WXC A;  1AKH A;  4EGZ A;  2Y75 A;  3L2U A;  3K7A J;  2BW3 B;  2UUZ A;  5KHD A;  3LSR A;  2M3A A;  2F2E A;  2MD0 A;  3MQ0 A;  2CV0 A;  2Z3Y A;  3OR1 C;  3J7A Y;  3FXR A;  2K85 A;  2B7E A;  3CJN A;  4C9Y A;  4BEH A;  5ICE A;  1OQY A;  2X1D A;  4LOC A;  1R4M B;  3PNY A;  4EMS A;  4EJW A;  5E79 C;  4GO1 A;  2M87 A;  3TP3 A;  1D0Y A;  2DA1 A;  2AXL A;  5C44 J;  5FLV A;  2IJL A;  4RGU A;  4RB2 C;  3V42 A;  1T08 B;  4IJA A;  3RPU D;  1S8N A;  3FZV A;  2DQL A;  4DBQ A;  2H94 A;  1ETW A;  1QPM A;  2EJR A;  1X1P A;  5TGT A;  3HOV J;  1QZE A;  1KGS A;  4N4O B;  4M71 A;  2PJR B;  5FFZ A;  2LMD A;  3HRM A;  3E6M A;  4D5F A;  1DGW Y;  4PFO A;  3E1S A;  3MN2 A;  1USS A;  2MYS A;  2IVM A; 
#chains in the Genus database with same CATH homology
 4YG2 F;  2V6C A;  4EJO A;  4O6J A;  5F1R A;  3HYI A;  3KP2 A;  4OIO F;  4KIB A;  3HOS A;  2HQR A;  5DCM B;  2DQR A;  4OMZ A;  3FXU A;  3BRO A;  2LF8 A;  1E17 A;  3VEP A;  4L9J A;  3ELK A;  1MZB A;  3CUO A;  3E6B A;  5HOO A;  3QRF F;  3TOA A;  2VXZ A;  2KJC A;  1SFU A;  2OZ6 A;  3QAH A;  4GXO A;  4N9H A;  2OAZ A;  4LLG F;  1G3S A;  1GXP A;  3KE2 A;  5H6Q A;  1TW2 A;  1O57 A;  5LEK A;  1P6R A;  5L3B A;  4Q5S F;  2FF4 A;  3RDI A;  1ON1 A;  5AIP A;  1MJ9 A;  2L4A A;  4HW0 A;  2HTS A;  3KLN A;  3FWE A;  3GUD A;  3FMQ A;  2ESH A;  4WCG A;  1ZGJ A;  5F6F A;  5DD8 A;  3I71 A;  3ZMS A;  3H3Z A;  3QP6 A;  1XSD A;  5LRS A;  3H3U A;  3BJO A;  4N9I A;  4HF0 A;  2CWE A;  3LA7 A;  3F8F A;  2FQ3 A;  3RYR A;  1LEA A;  2QYO A;  1Z6T A;  4QLC U;  3R0J A;  2MLG A;  4A0Y A;  1XGO A;  3WTX C;  3ZN0 A;  5DUK A;  3DXJ F;  1XB4 A;  3WGG A;  5CVR A;  4HQM A;  4LG0 A;  3RTR A;  3EDP A;  2PFB A;  1P2F A;  3QP5 A;  5BQT A;  2PBI A;  1YW8 A;  5J8C A;  1U6G A;  3F6V A;  1B1B A;  2HQN A;  1SD4 A;  4YFX F;  4WX9 A;  3R0A A;  4JQF A;  5ILU A;  4M73 A;  2B0L A;  4ESF A;  5K5O A;  3F72 A;  3T0Y A;  3P9I A;  4I01 A;  1WI9 A;  2EFN A;  2EV0 A;  3F6O A;  4A0Z A;  2MLK A;  4M72 A;  4P5O A;  3LAP A;  1BIA A;  4N0B A;  1SD6 A;  3IC7 A;  5CVV A;  2P5L C;  2GIV A;  1KU2 A;  1HW2 A;  3WE2 A;  1J5Y A;  4LK1 F;  3FMR A;  5L3C A;  1HXD A;  3J80 Z;  2FU4 A;  3RPQ A;  3IRQ A;  3E97 A;  2DFI A;  5HLI A;  2DK8 A;  5H6R A;  5JI6 A;  1TQI A;  1FT9 A;  2DTR A;  3C3W A;  3KEO A;  1ZH5 A;  6PAX A;  2FML A;  1XGS A;  3F21 A;  1PDN C;  2EFO A;  1P4X A;  2HR3 A;  1I5Z A;  4RS8 A;  5LEJ A;  1YS6 A;  2K02 A;  3MEX A;  3R6S A;  3RKY A;  3T1B A;  2DO7 A;  4PGG A;  2XAJ A;  2IPQ X;  4G94 A;  3VOE A;  1U2W A;  5AIQ A;  1R1U A;  3ZMZ A;  1IN4 A;  1DDN A;  3ZP5 A;  5DUI A;  2K4J A;  4Q47 A;  2PMU A;  4M74 A;  3W6J B;  3J7A O;  3PQK A;  2Q8K A;  1D3Y A;  1O7F A;  2IA1 A;  2VT2 A;  3P9C A;  2FXA A;  2YR2 A;  1OR7 A;  3DFG A;  4ESJ A;  3EUH A;  4I09 A;  3WG9 A;  2XGX A;  2D1V A;  4R8H A;  1F9N A;  1W4M A;  2RVC A;  3HSF A;  2QWW A;  2NS0 A;  1H0M A;  4M9Z A;  3I59 A;  1FYM A;  5D8L B;  3NEU A;  4KIF A;  5E1W A;  5TJJ A;  2A07 F;  3LQR A;  4MGR A;  2V1D A;  5E20 A;  1IN5 A;  2MC3 A;  3N97 A;  3EYI A;  5HDG A;  3WTW C;  3M1E A;  1Z6R A;  3DV8 A;  2CQK A;  3VB2 A;  5JHU A;  3V8L A;  4DNC A;  4O5V A;  3HRT A;  4FX4 A;  1J59 A;  1P4W A;  3IWF A;  2WTE A;  3E5U A;  1IXC A;  1UFM A;  4ENK A;  1RUO A;  3Q9V A;  1FP2 A;  5JR3 A;  2C6Y A;  3ECH A;  3TDZ C;  1R5G A;  1EV7 A;  1YW9 A;  3IHU A;  1IRG A;  2EFP A;  3ZMV A;  1K79 A;  2Y0M A;  1FYK A;  5HDK A;  1B6A A;  4EV0 A;  2FBK A;  1W5T A;  4L5I A;  3V7S A;  5HS8 A;  4GYI A;  2GA2 A;  1FP1 D;  1W5S A;  2XUB A;  4RAZ A;  1IUY A;  2L4M A;  5HDN A;  1NHA A;  5D5W B;  4FHT A;  1SFX A;  4BNC A;  5BS6 A;  2GXG A;  4ENM A;  1CF7 A;  3OOP A;  3RI4 A;  4L5J A;  2Q0O A;  2XAF A;  4I98 B;  3GYH X;  1S7O A;  4LLL A;  2IA0 A;  3KCC A;  3M7G A;  3TQN A;  1F5T A;  3QU3 A;  1HW1 A;  1XN7 A;  4A6D A;  1JGS A;  1KA8 A;  1L0O C;  3HSR A;  3L7W A;  2KIF A;  1ZAR A;  1C0W A;  2H6B A;  1LQ1 A;  1RIO H;  2ZNZ A;  1O7L A;  1F1Z A;  4MEX F;  4ZZD A;  2DLL A;  3J81 Z;  3FMS A;  4P55 A;  4CIC A;  4I0B A;  3JSP A;  1Z91 A;  2V79 A;  3K1N A;  2A6H F;  4HA8 A;  1R1V A;  1OPC A;  3JSO A;  1QZY A;  4B09 A;  5LBQ A;  3HOT A;  5DYM A;  5LLQ A;  4MEY F;  4M9S A;  2M8E A;  5FLX K;  3JW4 A;  1G3Y A;  3BZ6 A;  1J0R A;  1TTY A;  2BV6 A;  5IT9 K;  5DCM A;  3O2P E;  1QZZ A;  3RIR A;  3GWZ A;  4OIP F;  1BI2 A;  4P9U A;  3ULQ B;  5IT3 A;  2GZW A;  2OA4 A;  1HBX G;  1Z7U A;  3HTS B;  4DQ2 A;  1ZRD A;  4ZZL A;  4LGW A;  1FBQ A;  3I54 A;  3MCZ A;  3KEQ A;  4P9F A;  1U3E M;  1SMT A;  1Y0U A;  2ZBK A;  2VC0 A;  2GWR A;  2A3S A;  1DUX C;  1BOA A;  3T8T A;  1TW3 A;  3L00 A;  3S2W A;  2HEO A;  3DQV C;  1T0F A;  5HLH A;  1QBJ A;  3ZPL A;  2G9W A;  1ZRF A;  1MDM B;  3Q5F A;  2VOP A;  2DT5 A;  1PP7 U;  2M1B A;  4GYG A;  5FD6 A;  3V8J A;  4RGR A;  2LSO A;  5KVR A;  4LMY A;  3IWZ A;  2QBY B;  2XKP A;  4ENJ A;  2FRH A;  2L02 A;  5ICF A;  2Z99 A;  2EA2 A;  3WGI A;  3CDH A;  2O6G E;  1B4A A;  1FX7 A;  1IN6 A;  2FOK A;  1UST A;  2O61 A;  1ON2 A;  2DW4 A;  1YIO A;  1FYL A;  3E3V A;  3FHZ A;  1QGP A;  4NQW A;  3GFI A;  4GCV A;  4L18 B;  4WXD A;  1O3Q A;  4XSX F;  3GO5 A;  4PGH A;  3GX4 X;  4U0Y A;  3O3K A;  2XVC A;  1SMY F;  1WRJ A;  2LF7 A;  3BJA A;  2QLZ A;  2WC2 A;  5DDG A;  4RAY A;  1BBY A;  2K27 A;  1FZP B;  2OU2 A;  3ZMU A;  1S3J A;  3BPV A;  3LWF A;  3ABU A;  3SZP A;  3FF5 A;  1O3S A;  2XAS A;  2QEN A;  2CG4 A;  4WF2 A;  1LVA A;  2VC1 A;  1YLF A;  1IN8 A;  2OQR A;  1KYW A;  1BN5 A;  3LAJ A;  2FNP A;  3U1D A;  2RC4 A;  5E8I A;  2EV6 A;  3ABT A;  4P96 A;  3F3X A;  1R1T A;  1OYI A;  4XLN F;  1IRF A;  2D1H A;  3E5X A;  2IA2 A;  1KU3 A;  1OYW A;  4A2U A;  4G6Q A;  1L3L A;  4EVI A;  2X0L A;  2L01 A;  3U9G A;  3F23 A;  2W85 A;  2KIM A;  2MH2 A;  3HTU A;  4AWX B;  4Q48 A;  2RV8 A;  4ETS A;  3GLX A;  4LK0 F;  1K6O A;  1REP C;  2NNN A;  2ELH A;  4ZYD A;  2VBW A;  5BMZ A;  5E18 F;  3C1D A;  2BEO A;  3TO6 A;  4RB3 C;  3GFM A;  1YYV A;  3FM3 A;  3KP5 A;  3HSE A;  1FSE A;  5FB2 A;  1ZLK A;  5E1Z B;  2EV5 A;  4MNU A;  1SFE A;  3GF2 A;  4KNY A;  3LFK A;  3WE3 A;  2HFH A;  1P4A A;  1HST A;  1KU9 A;  3ERE D;  2MBF A;  3TOB A;  2R3S A;  3E6D A;  3FXQ A;  1B9M A;  4EJU A;  1PP8 F;  3RYP A;  1SAX A;  5D4R A;  3KLO A;  1E2X A;  3K9T A;  4U0W A;  3M8E A;  2DK5 A;  1MD0 A;  2W24 A;  2O8X A;  5D5V B;  2E1C A;  1KQ9 A;  2ZXJ A;  3GEZ A;  1RNL A;  2HZT A;  4QWQ A;  4JBA A;  4LFU A;  4ZYH A;  3ECO A;  2YX7 A;  3LST A;  2XIG A;  2G7U A;  2CW0 F;  2FSW A;  5K1Y A;  4HV6 A;  4IHS A;  2KJB A;  2BE5 F;  1IF1 A;  1U5T B;  4HX7 A;  1KQ8 A;  3LQQ A;  1XCV A;  2P6T A;  4CHU A;  3SZT A;  4I02 A;  1QO0 D;  5FGM A;  1I27 A;  1W7P D;  2CO5 A;  4M6Y A;  4LB6 B;  2WWY A;  2L54 A;  4OIQ F;  2W57 A;  3F8B A;  1T2K A;  1O3R A;  5DCF A;  4HX4 A;  3ZN1 A;  1FWZ A;  3RJP A;  1RI7 A;  1V4R A;  2DPU A;  2EA4 A;  2RKH A;  3CUQ B;  2F5D A;  3BWG A;  5DEQ A;  3IL2 A;  5F64 A;  5LHH A;  1XMK A;  2MA3 A;  5BOX A;  4Y13 A;  1GHC A;  2GQQ A;  4FT8 A;  4WK8 F;  1SD7 A;  4CYD A;  3SHF A;  5EEG A;  3I58 A;  4BXU A;  2ISY A;  3ZQ7 A;  2O0Y A;  4R1H A;  1BI1 A;  2RQP A;  3M8F A;  2VBX A;  2YU3 A;  1I1S A;  5D5U B;  1TQP A;  4MQV A;  3KP4 A;  4XBF A;  3GZ5 A;  3ROU A;  2XAH A;  2TDX A;  2P8T A;  5CJ9 A;  2A6E F;  4BQA A;  2RN7 A;  1BM9 A;  3KP7 A;  3WU1 B;  3REO A;  3BOQ A;  4ON0 A;  1XMA A;  2IW5 A;  3WU0 A;  2NYX A;  5L3E A;  2X4H A;  2FE3 A;  4UVB A;  1LEB A;  4NB5 A;  2GXB A;  4F7Z A;  2VOD A;  3V7R A;  2PLY A;  3DKW A;  2OD5 A;  4U7D A;  2YX4 A;  5KK1 A;  1DPU A;  3TDU C;  4HDU A;  3EYY A;  4HYE A;  2HKO A;  1BC7 C;  1ZN2 A;  3MFK A;  1IAW A;  5LGU A;  2CYY A;  3BJ6 A;  3RPU A;  5ICC A;  4BHC A;  4WXH A;  3CO7 C;  5E8G A;  4A5M A;  1HKT A;  2V9V A;  4KN7 X;  2JSC A;  1JE8 A;  4GGG A;  4UVC A;  4Y17 A;  2JZY A;  4I2O A;  1YQA A;  2HYG D;  4YFK F;  1HW5 A;  4AD9 A;  2ESN A;  3J80 K;  3KET A;  1T38 A;  1MDM A;  2AS5 F;  3IKV A;  1XDU A;  3BDD A;  3L9F A;  1R23 A;  1JXS A;  1H9G A;  2KIU A;  4UVA A;  2PI0 A;  2QUF A;  2DBB A;  2QBY A;  1U5T C;  2PEX A;  1YG2 A;  1DPR A;  2UXN A;  2E1N A;  1UB9 A;  1S29 A;  2VON A;  4UV8 A;  1YO5 C;  4M9X A;  1F4K A;  1TQM A;  4KIG A;  2FBI A;  1D8J A;  1J7K A;  4HF1 A;  1T98 A;  2HDC A;  1CGP A;  2J5O A;  5K5Q A;  1IXR C;  4EM0 B;  3HUG A;  4AIJ A;  3TGN A;  3QPH A;  2QZ8 A;  4PCQ A;  1PUE E;  1G3T A;  2QQB A;  5JFR A;  3FM5 A;  3TKY A;  4AVP A;  1TNT A;  5DV5 A;  1ZRC A;  1XGN A;  2H27 A;  1K78 B;  2IT0 A;  1QQI A;  2UWM A;  4Z2Y A;  4RGS A;  1J9I A;  3IKT A;  4BAY A;  3ZMD A;  2VE9 A;  3K1P A;  1UCR A;  4HF2 A;  4EM2 A;  1S7A A;  5CVI A;  1TBX A;  4O3M A;  2A69 F;  1BC8 C;  4OOI A;  1YS7 A;  1WQ2 A;  4PDK A;  4YIF A;  4A12 A;  3F8C A;  1I1G A;  2OQG A;  3N4M A;  1VTN C;  1XD7 A;  1ODD A;  2YSR A;  4EGY A;  2XRO A;  4EM1 A;  1JHF A;  1U8R A;  1KU7 A;  4H0E A;  5BPI A;  1AWC A;  2A61 A;  4KDP A;  4CDG A;  2HOE A;  1ZG3 A;  5LGN A;  4A0X A;  2PJP A;  2UXX A;  2P7C B;  2CGP A;  3EET A;  1T39 A;  5FFX A;  3F8N A;  5ILS A;  4G8X A;  1Z9C A;  1TLH B;  4KIC A;  2F5F A;  2P5V A;  2VBY A;  4KA4 A;  1YTY A;  1KYZ A;  3R4K A;  2QVO A;  3SQN A;  3FX3 A;  3GFJ A;  1EH6 A;  4JK1 X;  5CVU A;  2HWV A;  3DPT A;  4UHT A;  1IN7 A;  1BIB A;  3D5L A;  2QM3 A;  3TO7 A;  1AOY A;  2ISZ A;  5D6F A;  4M6X A;  3V4G A;  4HX8 A;  5E1X A;  2ACJ A;  2K4B A;  4MTE A;  2F5E A;  1YFH A;  5D5X B;  1LDD A;  2Z9O A;  1FPQ A;  2V1X A;  3IRR A;  3J81 K;  4HLY A;  2O03 A;  4KT5 C;  2MD5 A;  3I64 A;  4S04 A;  4RB1 A;  4OMY A;  3HIF A;  3AAF A;  4IPA A;  2P7V B;  3WTU C;  3SXY A;  5ICG A;  1YW7 A;  3P7N A;  4I0A A;  2F5C A;  4A6E A;  2EFW A;  3JTG A;  4MQ9 F;  1Q1H A;  2K86 A;  2JPB A;  4ASN A;  4KUM A;  4ESB A;  5CYV A;  1U5T A;  2IP2 A;  4K2E A;  5LHG A;  2P6S A;  5HS7 A;  1MJB A;  1V3F A;  1JHH A;  1TNS A;  3PQJ A;  2FMY A;  1G3W A;  2ZCW A;  3T8R A;  2QQ9 A;  2E7W A;  3KZY A;  2HGC A;  3HRU A;  3EQL F;  2VE8 A;  4RB0 A;  1IZ1 A;  1H9T A;  2VBZ A;  4E70 A;  3W6K B;  4CXF A;  4UUV A;  2DAO A;  3CUQ A;  3I53 A;  4HQE A;  2JT1 A;  5DD4 A;  3C18 A;  1FLI A;  2UZK A;  1LNW A;  2MH9 A;  3WGH A;  3CTA A;  2K7L A;  2XV4 S;  4OU0 A;  3LA2 A;  4TV7 A;  2ZME B;  2JRT A;  3V7C A;  1W7P B;  2GA1 A;  1WWX A;  2JTV A;  2ZFW A;  4IF4 A;  4AIK A;  1R58 A;  1FSH A;  2WV0 A;  3VFZ A;  1QNT A;  3H92 A;  1D5V A;  2HTJ A;  3COA C;  2P5K A;  2R7F A;  4BHB A;  4Q4Z F;  3C7J A;  1ZRE A;  1HQC A;  3OV8 A;  2RNJ A;  3Q9S A;  4MTD A;  4PZJ A;  3LA3 A;  2KRF A;  2STT A;  3NQO A;  5TRD A;  2ETH A;  4IRG A;  3VOD A;  3G73 A;  3I5U A;  1HKQ A;  1ZG1 A;  5HLG A;  4ENN A;  1HSJ A;  5J8F A;  3K0L A;  1WKM A;  1LDK B;  2ZO4 A;  1SD5 A;  1ZYR F;  1BI0 A;  3MWM A;  2Z33 A;  1FNN A;  4HBL A;  4HLX A;  3L2C A;  1EH8 A;  3GZ6 A;  1K7A A;  3JAM Z;  3U2R A;  3HRS A;  2OBP A;  3KP3 A;  3ISP A;  3GVA A;  1GXQ A;  3WTS C;  2RDP A;  3QPT A;  1ULY A;  2M30 A;  1R00 A;  1XSV A;  2EWN A;  1MKM A;  2ZNY A;  4XSZ F;  4LJZ F;  4G6D A;  2H6C A;  1WSU A;  3O6B B;  2BGC A;  2PMH A;  5ILV A;  4L0Y B;  4CGZ A;  2EFQ A;  2NRA C;  5EEH A;  2EK5 A;  5ERI A;  2CFX A;  2E7X A;  3F22 A;  2XKO A;  1MGT A;  5L3F A;  4Y15 A;  3GXO A;  5D6E A;  1ZHF A;  5LHI A;  4IRH A;  4U0V A;  3P9K A;  2EB7 A;  1Z05 A;  1ZAO A;  1A04 A;  4HZF A;  2CSO A;  4HOB A;  4LB5 A;  2Z5U A;  2RGV A;  1P92 A;  5D4S A;  5L3G A;  3G3Z A;  3WTV C;  1BJA A;  2QQA A;  1R7J A;  1BI3 A;  1U78 A;  4G7Z F;  4UXN A;  3WTY C;  2H09 A;  5E17 F;  1K78 A;  3KZZ A;  1GVJ A;  4HDV A;  4L9V A;  1J2X A;  2KKO A;  4OIR F;  2GAU A;  1D8K A;  3F8M A;  4ZH4 F;  4I7H A;  1ZGA A;  2Q2E A;  4L9T A;  1G6N A;  4LG0 B;  2COM A;  4RGX A;  3B02 A;  5A2Q Z;  3HHG A;  3DF8 A;  3T5X A;  3E5Q A;  1EH7 A;  2A5Y B;  3DEU A;  4OIN F;  5FLX Z;  4LLN A;  4YII A;  1T6S A;  5IT9 Z;  3L09 A;  2ADU A;  2PG4 A;  2XRN A;  4KMF A;  4A5N A;  2W25 A;  1HKS A;  2VT3 A;  2FNA A;  4CZZ A;  2XAQ A;  5BPD A;  4U88 A;  2P4W A;  1XSX A;  4NHJ A;  3I4P A;  3BY6 A;  4BHP A;  4G7O F;  4D0P A;  3JAM K;  4IVN A;  3V8K A;  2IRF G;  2XHK A;  3M9A A;  2XAG A;  5FO5 A;  2DU9 A;  1R22 A;  3I0T A;  1B9N A;  5ED4 A;  2VOO A;  2NAZ A;  4L0Z B;  3DP7 A;  1OMI A;  2HKX A;  5L3D A;  1ZG5 A;  2BYV E;  1OYY A;  3K69 A;  2M5W A;  2A68 F;  1B59 A;  2YPR A;  2FBH A;  2FA5 A;  1ZLJ A;  1LDJ A;  1MJA A;  1R36 A;  4CO8 A;  5CLS A;  1STZ A;  3WTT C;  3SFZ A;  2L3D A;  4IHT A;  4B8X A;  2V1U A;  3PFI A;  1I6X A;  2PN6 A;  3K2Z A;  2STW A;  5K5R A;  5FD5 A;  3WTZ A;  3CUQ C;  4ZYG A;  3ML6 A;  4BH9 A;  3MZY A;  4YFN F;  4FX0 A;  2LNB A;  2G7H A;  5LRR A;  1FOK A;  1IXS B;  3CLO A;  2PQ8 A;  1Z1D A;  1FBS A;  3B73 A;  4EJT A;  4HAM A;  3GW2 A;  4KYW A;  5J6X A;  2Y48 A;  2HYF A;  3D0S A;  3RKW A;  2NNY A;  2JPC A;  3I59 B;  4EQQ A;  4S05 A;  4WWC A;  3RKX A;  2DPD A;  5A2Q K;  3CO6 C;  5HS9 A;  1IW7 F;  4L9N A;  5JVT A;  1LB2 A;  5LGT A;  2J5P A;  3KFW X;  1FC3 A;  1LJ9 A;  3R61 A;  2VN2 A;  4IXA A;  2ZKZ A;  4XRF A;  4EJV A;  3GFL A;  4UV9 A;  3TO9 A;  3KP6 A;  4ZYE A;  1XGM A;  3ZMT A;  5CVJ A;  3MAJ A;  1ONV A;  2FEZ A;  4KFC A;  1X3U A;  1XDS A;  3BP8 A;  3WOD F;  2R7D A;  2ZJ2 A;  4KN4 X;  2BBY A;  2HS5 A;  3BPX A;  4LD5 A;  4MHG A;  1J75 A;  4IRI A;  4XLP F;  3DPL C;  1UHW A;  3QU6 A;  1R5H A;  1UHM A;  2D45 A;  4U7B A;  5H20 A;  2DI3 A;  1S6L A;  4HV5 A;  3R60 A;  4R79 A;  1RUN A;  4BYY A;  1DP7 P;  3NRV A;  5HVQ C;  2LDU A;  2W84 A;  5D8K B;  2D2W A;  4AIH A;  3K1M A;  1O3T A;  1G4D A;  2O3F A;  4KMU X;  2M45 A;  1FY7 A;  3MZH A;  4UNO A;  2ZME A;  3HHH A;  2OZU A;  1OKR A;  4G7H F;  2LKP A;  1W7P A;  1CF7 B;  1KQ0 A;  3QOP A;  1FBU A;  1RZ4 A;  5AON A;  3E6C C;  4G9Y A;  3JTH A;  1XCB A;  4WXC A;  4EGZ A;  2Y75 A;  2F2E A;  3MQ0 A;  2Z3Y A;  3FXR A;  3CJN A;  5ICE A;  4EMS A;  4EJW A;  4GO1 A;  2M87 A;  2AXL A;  2IJL A;  4RGU A;  4RB2 C;  4IJA A;  1S8N A;  3FZV A;  2DQL A;  2H94 A;  1QPM A;  2EJR A;  1KGS A;  4M71 A;  5FFZ A;  3HRM A;  3E6M A;  1USS A;  2IVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...