3BZ6A

Crystal structure of a conserved protein of unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
NAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVMNLTQGQVGQSLRALEGRGLTRLVMGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRMHDFEDSEQVVHQLERLIARGLATLVPRQSGQREDRYMHLIGDPEDLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0502 protein PSPTO_2686
publication title The crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000.
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 52
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04337 DUF480 Protein of unknown function, DUF480
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bz6A01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bz6A02
3G3ZA 3CUOA 4MHGA 2P6SA 2HQNA 4G6QA 5LHIA 1D8JA 4R79A 3BZ6A 3WTUC 2GA2A 2YX7A 1KYZA 1Y0UA 1HKQA 1U78A 1TQMA 4HA8A 3K1MA 5DCMA 2VE8A 1J7KA 3MCZA 2QM3A 1LEBA 3ZN1A 2XAJA 1ZLKA 4IRIA 3COAC 3L2CA 3F22A 1F4KA 1RIOH 5KK1A 3H92A 1LNWA 1DUXC 2A5YB 1FP1D 4GCVA 2STWA 3E6BA 4A6EA 1R22A 2W85A 2OU2A 3V8KA 5L3GA 5J8FA 4IHTA 4A5MA 2H6CA 2CSOA 2EB7A 4M74A 1GXQA 2VT3A 4NB5A 1REPC 1ZREA 3KZZA 5K5OA 3M8FA 3JSOA 4I0BA 2K4JA 2HTSA 3MWMA 1JXSA 3M7GA 4I2OA 3BROA 1EH6A 3F6VA 1GVJA 1H9TA 2KJBA 2PMUA 1R5GA 1O3TA 1XSDA 4ETSA 2CGPA 2WWYA 5HVQC 3L00A 1STZA 2BGCA 5LGNA 3TQNA 5BQTA 3LSTA 2YR2A 2DPUA 2GAUA 2OQRA 2W25A 1HW1A 1UHWA 1Z7UA 5E1WA 4KFCA 3HRUA 2YX4A 4WK8F 2XRNA 1RUNA 1R36A 1G6NA 2O0YA 2CFXA 1QBJA 1TLHB 2LSOA 3OOPA 4OU0A 4HF1A 3G73A 1XN7A 2BE5F 1FX7A 3WTYC 3QRFF 1G3TA 2BV6A 4Q4ZF 3WTZA 1FWZA 4ZYEA 3KP7A 3KFWX 2GA1A 4YFNF 1YS7A 2P8TA 4GXOA 3EYYA 1XSXA 3C3WA 3DPLC 1XD7A 3RTRA 1IRGA 1FBUA 3VB2A 3IKTA 1R00A 4CZZA 2VONA 4CICA 4IJAA 2FBIA 5BMZA 1G3YA 3DEUA 3V7SA 1ONVA 1UCRA 4BHCA 4NHJA 1TTYA 3SFZA 3I71A 2VE9A 5E1ZB 3ZMDA 2H27A 2DTRA 2UXNA 4HDVA 5BPDA 2PFBA 5F6FA 3U2RA 3IC7A 2KIUA 3QU3A 1IAWA 2M87A 1FSEA 5LRRA 2VODA 1FYLA 4OMYA 1IW7F 3FWEA 3J7AO 3BPXA 1SAXA 2HKOA 4ESFA 3FMSA 2NS0A 3O2PE 3BJ6A 3GFIA 2DAOA 4EJVA 4M73A 4NQWA 2Z99A 3EYIA 3F8MA 4K2EA 4WXHA 1W5TA 1L0OC 2FEZA 1EH8A 3MAJA 3P7NA 4I98B 5LGUA 3RPUA 2COMA 2IPQX 5H6QA 2DFIA 4BXUA 3U1DA 1P4XA 2P5VA 1WRJA 1SD5A 4KNYA 2M45A 4G94A 2VC0A 3Q9SA 2FF4A 3VODA 2CG4A 3SQNA 1B4AA 4RAYA 5D4SA 5D5UB 3FXUA 3NEUA 1TW3A 1ZG1A 1B1BA 4PZJA 3WODF 2VN2A 1S7OA 2HDCA 2UXXA 4CDGA 1IRFA 3RKYA 1K78A 4LFUA 4KIFA 1OPCA 3IRRA 5HS7A 4I09A 4BYYA 2WTEA 3T5XA 1ZARA 4B09A 5J8CA 5CVVA 2GIVA 1XGMA 5K5QA 2P4WA 2J5PA 2YU3A 4ZYDA 1WKMA 1R7JA 1O3QA 5DD8A 2XV4S 4XLPF 2EV6A 5D6EA 5FLXZ 1LDDA 4IVNA 4JBAA 1T39A 2IRFG 3TOAA 1SFXA 4D0PA 3B73A 5E8GA 2CW0F 2MLKA 2CWEA 4MEYF 1A04A 4HZFA 1IN4A 2H09A 1SFUA 1BC8C 4PGGA 3T8RA 1I1GA 1O3SA 5L3BA 2LNBA 2PLYA 4LLGF 3SHFA 5CVIA 2A3SA 2YSRA 2DT5A 3HHGA 2GZWA 1J75A 4HW0A 2V1XA 1XB4A 4KIBA 2MLGA 3WE2A 1J9IA 3GEZA 3ELKA 1F5TA 1E17A 2RC4A 3L9FA 4HQMA 4HX4A 1W7PD 4EJWA 4O5VA 2P7CB 4MEXF 4CHUA 4E70A 3HSFA 5ILUA 5DCMB 4LB5A 4HYEA 2RV8A 3RKXA 3DQVC 2WV0A 2RKHA 1C0WA 2BYVE 1HW2A 2XKPA 2DQRA 4AIJA 2EK5A 1P6RA 4LLNA 2Z5UA 5LEKA 2OQGA 3ZPLA 3RI4A 3C1DA 2XUBA 2IA1A 4OIQF 1HW5A 1LJ9A 2B0LA 4L0YB 3I4PA 3TKYA 3L7WA 5LEJA 3PQKA 1XGSA 3LQRA 2FNAA 3JTHA 2O6GE 3PQJA 4EM1A 3GZ6A 3F6OA 3KP2A 4CXFA 4CGZA 4L9JA 5IT3A 3HRSA 2WC2A 1T0FA 2EJRA 5EEHA 3F8BA 3JTGA 3IRQA 2MH2A 4HF0A 2HKXA 3N97A 4KA4A 2F5CA 1XGOA 5DYMA 2ELHA 4KIGA 3LAJA 1KQ9A 2QUFA 1OYWA 1O57A 3ZMUA 1IZ1A 2IT0A 1U8RA 1Z6TA 1BN5A 4P96A 3RYPA 1AWCA 1ON1A 2K27A 1X3UA 4OOIA 4LK1F 4MNUA 3E5UA 4RB1A 3ECOA 4Q47A 3TO7A 1TQPA 3V4GA 4G9YA 4RS8A 2EV0A 1MJ9A 4N9HA 2XIGA 5IT9Z 5D5XB 4M6XA 3NQOA 3TO6A 2R7FA 4DNCA 4I7HA 2V1DA 3HOTA 1QNTA 1O7FA 1JHHA 4HAMA 2W84A 2JPCA 2V1UA 2VBZA 4JK1X 1BI3A 5CVJA 1UB9A 4KDPA 3ULQB 3DF8A 1DP7P 2X0LA 2KIMA 4HLYA 3NRVA 3SXYA 3DV8A 3I5UA 4HLXA 1LEAA 2C6YA 4P9FA 4BHBA 4MQVA 4QWQA 2D45A 5D5VB 2A61A 3P9IA 3OV8A 1ON2A 2OZ6A 3L09A 5LHGA 2DPDA 4KUMA 1CF7A 3B02A 2LF8A 1DPUA 1K7AA 1G4DA 3M9AA 4AIHA 1XGNA 4Q48A 1R1UA 4A0XA 1S7AA 2O8XA 2HQRA 2L02A 4KN7X 4WXDA 3FXRA 3BPVA 5JFRA 5TJJA 4A5NA 3MZYA 4P55A 4U7DA 3LQQA 5FLXK 2Y48A 3ZMTA 4MTEA 2R7DA 2NAZA 2HYFA 3KLOA 1LB2A 4XSZF 1HSJA 3DP7A 2STTA 2CO5A 3T1BA 4IRHA 4WF2A 1G3SA 1T38A 3AAFA 2E1CA 3E3VA 4LJZF 3DXJF 4HQEA 2EFPA 2XAGA 3IHUA 1K78B 3GO5A 4L18B 5F1RA 3FHZA 4DQ2A 3BJOA 1MDMA 4JQFA 3F72A 1XDUA 3K1PA 5E20A 5FFXA 1WWXA 2OA4A 1YQAA 4GYIA 2K86A 4LMYA 3FMRA 3H3ZA 4KICA 3I0TA 2OBPA 1U2WA 5CVUA 4ASNA 5DEQA 1B9NA 4KYWA 3FF5A 3J80Z 1FY7A 1HXDA 1U5TA 1FZPB 2X4HA 4CO8A 1SD4A 1VTNC 3H3UA 3GXOA 5DUIA 4WWCA 2JRTA 1W7PA 2LDUA 4PCQA 3GFMA 3CTAA 2ESNA 2GXBA 1D5VA 1SFEA 4HOBA 4UUVA 3I58A 1MGTA 2V79A 2XKOA 4ENNA 2O3FA 4IRGA 2A6HF 1KQ0A 2V9VA 1R1VA 3F21A 4L5IA 2A6EF 3GW2A 5ICFA 1AOYA 3DFGA 3WU1B 5HOOA 3QP5A 2HYGD 4U88A 3HIFA 3CO7C 1ZAOA 2FXAA 3QPHA 4FT8A 3ML6A 3Q9VA 4OIOF 2DK8A 1MZBA 4A0YA 2W57A 3CUQA 4ENJA 4KMUX 4M72A 2DI3A 1IXSB 4LG0B 3RKWA 4BHPA 1LDKB 5BS6A 2QENA 2IJLA 3M1EA 5FO5A 2MH9A 4EJUA 3LAPA 3K2ZA 5EEGA 4ESJA 1WI9A 3I53A 1R5HA 2EFOA 4EMSA 4R8HA 5FD5A 1J59A 1Z05A 4S05A 1FOKA 4BH9A 4EV0A 4YFXF 1H9GA 2QYOA 1HSTA 4O3MA 3ROUA 1F1ZA 5A2QZ 2BBYA 2NNNA 2P5LC 2HGCA 1Z91A 1IXRC 3LA3A 1BI1A 2L01A 5IT9K 4Y13A 2O03A 4AD9A 3ZMSA 4A12A 4EJTA 2A68F 3QAHA 3KP3A 3K1NA 1I6XA 5FFZA 1ZGJA 1YLFA 1SD7A 3WG9A 1QZZA 2FA5A 2KJCA 2IVMA 1P92A 2P7VB 5K1YA 4LD5A 4AVPA 4L0ZB 2G9WA 1BM9A 4EM2A 3DKWA 1YW9A 5D8LB 1FYKA 3RJPA 3MFKA 4ZYHA 1TBXA 3GUDA 2HEOA 3EUHA 1QZYA 1XSVA 3EETA 1BBYA 5ICCA 2JZYA 2RNJA 1WQ2A 2W24A 4ZZDA 3C7JA 2YPRA 1J2XA 5E1XA 5DDGA 3LA7A 2BEOA 3R61A 3I59B 3K0LA 2NYXA 5FB2A 4TV7A 5DV5A 4U0VA 3QOPA 3BP8A 5HLGA 3TO9A 1DDNA 2Y0MA 1S29A 1W4MA 3GLXA 3SZTA 3WTWC 2AXLA 3K69A 1PP7U 3P9CA 3DPTA 4EVIA 1ZHFA 1YW7A 5E8IA 4G7ZF 1J5YA 4PDKA 1R1TA 1OYYA 2PQ8A 3RYRA 1IUYA 3KEOA 4M9ZA 5HS8A 2XAFA 4UV8A 1CF7B 2HFHA 3IWFA 5JVTA 5L3DA 1XCVA 5D8KB 2D1HA 4UHTA 3V8LA 1Z6RA 1LVAA 4YFKF 3HRTA 3WGGA 2DW4A 1OKRA 2NRAC 4M6YA 3QP6A 3ZMZA 1YG2A 2EFNA 2E1NA 3V7CA 1U5TC 1FBQA 4OIPF 3ISPA 2LF7A 5CLSA 4H0EA 4ZYGA 5CJ9A 2NNYA 4XRFA 1P4AA 3VOEA 4CYDA 1T6SA 3HSEA 1JGSA 2M1BA 1I1SA 2KRFA 2JT1A 5LBQA 1EH7A 1QGPA 1TNTA 4O6JA 4MTDA 4GYGA 5D5WB 4HX8A 3T0YA 1O3RA 4YG2F 2QQAA 3RIRA 2ZFWA 2MC3A 2ETHA 3ZP5A 2EA2A 4BNCA 2UWMA 1MKMA 2VBWA 1U5TB 1YW8A 3BJAA 3KP4A 3CUQC 4UVBA 1ZH5A 5D4RA 4GO1A 3KEQA 4HV6A 4FX0A 4LB6B 2Z3YA 3V7RA 2ISZA 4N0BA 4RB3C 5BPIA 4L9TA 2ZXJA 5JR3A 2P6TA 1DPRA 2HS5A 1FBSA 4HDUA 1B9MA 5FGMA 2EV5A 3CJNA 2KIFA 2RDPA 1LQ1A 3KZYA 2XASA 3HTSB 3LWFA 1YTYA 4I02A 2MBFA 3TGNA 3WU0A 5H6RA 4IPAA 1LDJA 1F9NA 4PGHA 5JI6A 5A2QK 1ZG3A 1OYIA 1R23A 3ABUA 3FM3A 1H0MA 4Z2YA 5HDKA 3KP5A 2QBYA 3TDZC 5F64A 4WXCA 2EWNA 4OMZA 2ISYA 2ZMEA 3QPTA 1RNLA 1KU2A 3JSPA 1KU3A 1QO0D 1P4WA 2GXGA 4M9SA 1D8KA 2LKPA 3K9TA 3R0JA 3HSRA 1NHAA 3LA2A 3ABTA 1BIAA 6PAXA 4KT5C 3GWZA 1EV7A 2FBHA 2HOEA 1B59A 3REOA 5HLHA 3HTUA 4L9NA 1SMTA 5D6FA 2H6BA 2IW5A 4LK0F 1YO5C 5LHHA 2FQ3A 3E5XA 2IP2A 1E2XA 4RB0A 2PEXA 2Q2EA 2OAZA 3D0SA 1FC3A 2A69F 1ZG5A 3ZN0A 4GGGA 4ENMA 3IKVA 3PFIA 1FSHA 3WGIA 3WTVC 2F5FA 2R3SA 1YS6A 4RB2C 2K02A 4UVAA 5AIPA 2RN7A 4ON0A 5LLQA 2Q0OA 3I54A 2L3DA 3JAMZ 1JE8A 1BI0A 3E6MA 2XGXA 5J6XA 2PG4A 3BY6A 2V6CA 4EM0B 2Y75A 1O7LA 1FNNA 2FRHA 3QU6A 3RDIA 4Y15A 2Q8KA 2PBIA 4RAZA 3F23A 3TDUC 3W6JB 2ZKZA 2ZJ2A 3ECHA 3GFJA 4M71A 1HKSA 3WTXC 5LRSA 1I27A 1YIOA 3CLOA 1V3FA 4G7OF 3GFLA 3KLNA 1YFHA 1ZN2A 5ERIA 4KN4X 4XLNF 1MJAA 3FZVA 2Z33A 5E17F 4XSXF 5CYVA 3TOBA 2QVOA 2GQQA 3MZHA 3RPQA 3VEPA 1T98A 1IN8A 4G6DA 1K79A 5L3CA 4F7ZA 2VBXA 3J81Z 1IF1A 1BOAA 4FHTA 2TDXA 2J5OA 4HBLA 3P9KA 4HV5A 4OINF 4AIKA 2XAHA 2DBBA 4RGRA 3W6KB 1S6LA 2ACJA 5ED4A 3KE2A 1ZRFA 2M30A 2PMHA 1P2FA 4Y17A 4OIRF 4EJOA 5LGTA 1OR7A 4A6DA 5HDNA 5AIQA 3HYIA 1TQIA 3V8JA 4XBFA 1IN5A 2L54A 2ESHA 2G7UA 4KMFA 2O61A 5DD4A 2G7HA 3FMQA 4QLCU 1U3EM 1PP8F 1Q1HA 4ESBA 3CO6C 2RGVA 4BQAA 2QQ9A 2VXZA 2EFQA 4G7HF 2UZKA 1KU7A 5CVRA 2QLZA 1UHMA 3ZMVA 3F8FA 1D3YA 1BJAA 3ZQ7A 5HS9A 3I64A 1BC7C 2ZNZA 5HDGA 2MD5A 3HUGA 2KKOA 3GX4X 1ZRCA 2F5DA 4M9XA 1QQIA 2HTJA 1TNSA 1HQCA 3U9GA 4HF2A 5H20A 3FX3A 5BOXA 3ERED 4G8XA 3CDHA 3FM5A 4RGXA 1HBXG 1MD0A 1SMYF 1FPQA 2JPBA 3R0AA 5ILSA 4EQQA 5JHUA 2EFWA 5ILVA 1QPMA 3BOQA 2JTVA 3M8EA 4A0ZA 1USSA 2VOOA 4B8XA 4MQ9F 2DQLA 1U6GA 2DK5A 1ULYA 1TW2A 2L4AA 2K4BA 2ADUA 5E18F 3R4KA 1MJBA 2VT2A 4IXAA 3O3KA 3KCCA 2K7LA 5HLIA 1SD6A 2E7WA 1PDNC 1S8NA 4UXNA 2XAQA 4YIFA 1FT9A 2E7XA 3R60A 1RUOA 3C18A 4WCGA 1FYMA 3MEXA 5FD6A 1ODDA 2HR3A 4P9UA 2Z9OA 3WGHA 3E6DA 2OD5A 2FBKA 3R6SA 2FU4A 1BIBA 2CQKA 3BWGA 1KGSA 2QZ8A 2DU9A 2ZNYA 2QBYB 1PUEE 3JW4A 3HRMA 4HX7A 2QQBA 1W5SA 2VBYA 4R1HA 2EA4A 1G3WA 1CGPA 2JSCA 1YYVA 4S04A 2ZMEB 3SZPA 4U0YA 3Q5FA 3S2WA 1UFMA 1XCBA 2M5WA 2H94A 3D5LA 4UNOA 1JHFA 2FMYA 4P5OA 5ICEA 1ZRDA 1ZLJA 5DCFA 5KVRA 1L3LA 3MQ0A 1GHCA 1B6AA 3JAMK 3EDPA 4U0WA 2PJPA 2D2WA 3GF2A 1XMAA 1R58A 4ZH4F 4UVCA 4IF4A 4EGZA 3F3XA 1KU9A 2IA2A 3WTTC 2L4MA 5ICGA 3GZ5A 3J80K 2A07F 4LG0A 4LLLA 1RZ4A 2AS5F 1KA8A 4MGRA 2FMLA 1ZYRF 1I5ZA 3WE3A 2F2EA 2CYYA 1V4RA 4I01A 4U7BA 4Q5SF 4IHSA 2FOKA 3VFZA 1GXPA 3F8NA 4L9VA 1MDMB 3IL2A 2XROA 3LFKA 3EQLF 5TRDA 4ENKA 2QWWA 1FLIA 2M8EA 1OMIA 4ZZLA 3E6CC 1Z9CA 3J81K 3KP6A 2ZBKA 1T2KA 4RGUA 2HWVA 4BAYA 1S3JA 4L5JA 3GVAA 2FNPA 3KETA 4FX4A 3T8TA 2PI0A 3FXQA 4LGWA 1IN7A 2D1VA 2XVCA 3WTSC 1WSUA 3O6BB 1W7PB 1RI7A 4EGYA 5K5RA 1ZGAA 1KQ8A 2FSWA 1HKTA 2ZCWA 1BI2A 3E97A 2HZTA 1J0RA 1KYWA 4YIIA 4AWXB 1XMKA 2DO7A 2PN6A 4WX9A 2GWRA 3GYHX 1XDSA 1K6OA 5DUKA 4A2UA 1USTA 2ZO4A 1FP2A 5L3FA 3N4MA 1IXCA 5AONA 4I0AA 3HHHA 2OZUA 4UV9A 3I59A 2XHKA 2MA3A 2F5EA 3CUQB 4RGSA 2VC1A 5L3EA 3HOSA 2RVCA 2FE3A 2IA0A 2DLLA 2VOPA 1IN6A 4N9IA 2P5KA 3BDDA 3IWZA 1Z1DA 3E5QA 2RQPA 3F8CA
chains in the Genus database with same CATH superfamily
5M5WJ 3G3ZA 3BG7A 3CUOA 4MHGA 3CQZJ 3S3MA 2DOAA 4BY7J 2P6SA 2HQNA 4G6QA 5LHIA 1D8JA 3CESA 4R79A 3BZ6A 3WTUC 1PUFA 2DOFA 2BY3A 2GA2A 3QWLA 1WH5A 5IOYA 4C9YA 2EIJH 2DOEA 2YX7A 1KYZA 2LLKA 2OJED 1Y0UA 5JLWA 5J4YA 1HKQA 3DTEA 1TQMA 1U78A 3O8GA 4HA8A 3K1MA 5DCMA 1TP4A 2VE8A 3QQAA 1J7KA 3MCZA 2QM3A 1LEBA 3ZN1A 2FQ4A 2XAJA 1ZLKA 4IRIA 3COAC 4BJ6C 3L2CA 5EYRA 3F22A 1VQNI 3SDBA 1F4KA 1SFKA 5BNGA 1RIOH 3HUGB 3BCAA 5C44J 5KK1A 3H92A 1VQ9I 3DPUA 1LNWA 2VQGA 1DUXC 2A5YB 1IG7A 1FP1D 4GCVA 5KAIC 2STWA 3E6BA 4A6EA 1R22A 2L9VA 2NVTJ 2LYCA 2W85A 2OU2A 3V8KA 5L3GA 5J8FA 3B6AA 4D7NA 2GM4A 2L7KA 4IHTA 4A5MA 3PM1A 3H9QA 2H6CA 2CSOA 2CJJA 2EB7A 4M74A 3CCLI 1GXQA 2VT3A 4NB5A 4IX7A 1S72I 1REPC 3K70C 3KZZA 1JKOC 4S0HB 1ZREA 5K5OA 1ACIA 3A01A 4RAGA 4IOAF 1WFXA 3ZRGA 1TWFJ 2NS7A 2CUEA 3M8FA 3LSIA 3JSOA 4I0BA 2K4JA 2COBA 4RM2A 4M3BA 2HTSA 1WJBA 3OYNA 3MWMA 3HGGA 1JXSA 3M7GA 1QVUA 4I2OA 3BROA 1MSFC 4RBOA 1EH6A 1RC9A 5EGOB 3F6VA 1GVJA 1Z21A 1OJLA 1LFPA 2HZDA 1H9TA 2KJBA 2PMUA 1R5GA 1O3TA 1XSDA 4ETSA 2CGPA 2ZXIA 2WWYA 3BZKA 3HGYA 5HVQC 4E7KA 3L00A 1STZA 4MO7A 1TWAJ 2BGCA 3RKQA 3TMOA 2KDOA 5LGNA 3TQNA 5BQTA 4D9JA 3OWTA 2CQNA 3LSTA 2HDWA 2YR2A 2DPUA 2GAUA 2OQRA 3OR2C 2HPIA 2W25A 5GAHJ 1HW1A 4XR6A 1UHWA 1Z7UA 2VPLA 2CQ7A 5E1WA 3CMYA 3HB9A 4KFCA 3HRUA 2YX4A 4WK8F 2XRNA 1RUNA 1OLTA 1R36A 1G6NA 2LFBA 2O0YA 3ZQGA 4DIQA 4DYQA 1Y39A 1FOXA 2CFXA 4DYCA 1QBJA 4UUSA 1TLHB 2LSOA 3W2VA 3OOPA 4OU0A 3QPSA 4HF1A 3G73A 1T08B 1XN7A 4Z6YA 1BW5A 2BE5F 2WAFA 2DCEA 4XKVA 1FX7A 1FJLA 3CCEI 5GAGJ 3WTYC 3QRFF 2M4GA 3V42A 1G3TA 2BV6A 4Q4ZF 4U87A 2QF7A 2EZIA 3WTZA 1FWZA 2ELKA 4ZYEA 3KP7A 3KFWX 3J7ZI 2GA1A 3A4CA 4YFNF 1YS7A 2CW7A 3LSGA 2OV7A 3H5AA 2P8TA 2ME0A 4GXOA 3EYYA 1XSXA 3C3WA 3DPLC 1XD7A 2ZB9A 4PSXA 3RTRA 1IRGA 1FBUA 1AKHB 1RR7A 3VB2A 3KYLA 3IKTA 1R00A 4CZZA 2VONA 4CICA 2K9MA 2FBIA 4IJAA 5BMZA 1VQ5I 4HRIA 1G3YA 1PYVA 3DEUA 3CC4I 3V7SA 1ONVA 2I10A 2VKDA 2WAEA 3S32A 2XC7A 1UCRA 4BHCA 4NHJA 2R5YB 1TTYA 4PUSA 3SFZA 3I71A 2VE9A 5E1ZB 3ZMDA 3PFYA 4A3DJ 1X3WB 3FXJA 2EQRA 4M6VA 3SEQA 3I55I 2H27A 2DTRA 2A05A 2UXNA 3FBNB 4HDVA 2LC2A 2DJNA 3IAM2 1RESA 3ONQA 5BPDA 2PFBA 2DFHA 2KIQA 4D7MA 5F6FA 4C2TA 4IOCF 2JVGA 3U2RA 3IC7A 2KIUA 3QU3A 2E2JJ 1IAWA 2LY9A 3CCJI 2M87A 4HG2A 1FSEA 1WVRA 2MG4A 5LRRA 2VODA 1FYLA 1T0FC 1BL0A 2V1NA 2QSHX 4OMYA 1IW7F 2X6XA 3LNQA 1IUFA 3FWEA 3J7AO 1ERDA 3BPXA 2K85A 1SAXA 1P7IA 2A6TA 2HKOA 4ESFA 3FMSA 2NS0A 1MBHA 3O2PE 3BJ6A 3GFIA 2DAOA 2F5VA 4EJVA 3HOYJ 4M73A 4NQWA 2Z99A 3EYIA 3F8MA 4K2EA 2DODA 2NVQJ 4BE0A 4WXHA 1W5TA 1SVLA 2CU7A 2YUSA 4QSHA 1L0OC 2FEZA 3PUFA 1EH8A 3K2AA 3MAJA 3P7NA 4I98B 2KT0A 5LGUA 3RPUA 5J3LA 4IQJA 2COMA 1T8IA 1G2HA 2IPQX 5H6QA 2DFIA 4F93B 3OYGA 1N25A 1S5LC 4BXUA 3U1DA 1P4XA 2P5VA 1WRJA 1H89C 3ZR8X 1SD5A 2X48A 4F92B 4KNYA 2M45A 4G94A 2VC0A 2AO9A 3Q9SA 2FF4A 3VODA 2CG4A 3CCMI 1YHQI 3SQNA 1B4AA 1BR1A 4RAYA 2VKHA 5D4SA 4A3MJ 3HJEA 5D5UB 2DDBA 3FXUA 3NEUA 3ABMH 1TW3A 4C2UA 3JRGA 1ZG1A 1B1BA 2AXTC 2CV2A 4PZJA 2GLOA 1DQUA 3WODF 2LY2A 4J01A 2VN2A 4YIRX 1QA6A 1S7OA 2HDCA 3OYCA 1FEXA 2ZC2A 1WPKA 1X4OA 2UXXA 4A3CJ 1Y1WJ 1IRXA 4XLFA 4CDGA 3HOWJ 1IRFA 4LG3A 3RKYA 1ZGWA 1K78A 4LFUA 1OCPA 2EPFA 4UY8I 4A69C 4KIFA 1OPCA 4UB6C 3HDDA 1UJ8A 2HOAA 4BUPA 4XIDA 5HS7A 4QIWN 4D1QA 3IRRA 4I09A 3I3LA 4BYYA 2OTJI 4C30A 1TZLA 2M0MA 2WTEA 3T5XA 3DBRB 3PIPF 1ZARA 2VI6A 4B09A 5J8CA 5CVVA 1ORKA 2GIVA 1XGMA 2R93J 2BY0A 5K5QA 2P4WA 2WY7Q 2J5PA 3WHBA 2YU3A 4ZYDA 1WKMA 1R7JA 1O3QA 5DD8A 4QTRA 2VASA 2XV4S 2EV6A 5D6EA 5FLXZ 4XLPF 4M3EA 3VPRA 1LDDA 4IVNA 2F4MB 4JBAA 1T39A 2DT7B 2IRFG 3VDXA 3E0JB 3P5JA 3TOAA 3CCRI 1SFXA 2IS6A 1ETXA 4D0PA 1OFCX 2KFDA 3B73A 5E8GA 2CW0F 3M8JA 2MLKA 2CWEA 4MEYF 4A3IJ 1A04A 3A02A 4HZFA 4KT6A 1IN4A 2V26A 3AFHA 2H09A 1VQMI 1SFUA 1BC8C 2KZGA 3LFUA 3IP4B 4PGGA 3T8RA 3S2DJ 1I1GA 1O3SA 5L3BA 4BDZA 2LNBA 2ZSHB 4PSWA 2PLYA 2IGMA 3GCMA 3HOUJ 4LLGF 1R4MB 1MH3A 3SHFA 3AG3H 3LL7A 2DMQA 5CVIA 2A3SA 2Y0SN 4DOZA 2YSRA 2DT5A 3HHGA 5FRMA 3SDGA 2GZWA 1J75A 4A93J 1K61A 2JWTA 3HKZA 4HW0A 4I6ZA 2V1XA 1XB4A 2DA2A 3IH4A 4KIBA 4NC7A 2MLGA 3WE2A 1J9IA 3GEZA 2VQLA 3ELKA 3TP0A 4JOMA 1F5TA 1E17A 2RC4A 2R7UA 3L9FA 5M5XJ 4HQMA 3MKYB 4HX4A 1W7PD 2EIMH 3OYKA 3B6CA 3ESWB 5EJCA 1P7JA 1H88C 4EJWA 4GDFA 4O5VA 2P7CB 3DLLF 4MEXF 4CHUA 4E70A 3L2WA 3HSFA 5E3MA 5ILUA 5DCMB 4LB5A 2CH0A 5FKKA 2W00A 1VQ7I 4HYEA 1E3HA 3BG9A 2JA7J 2RV8A 3RKXA 2ZFUA 3K7AJ 1IO2A 3DQVC 2H8WA 2L9SA 5J47A 2Q2EB 3UKGA 2WV0A 2RKHA 4XQFA 1C0WA 2K3PA 2BYVE 1HW2A 1YRNA 2XKPA 2HVRA 2DQRA 3OL3A 1VQ8I 4AIJA 1CQTA 1TWGJ 2BY1A 4B43A 3ASOH 2EK5A 3Q3SA 1RKTA 1FIAA 3K4LA 2IAIA 2FUG2 1P6RA 5TGTA 1R4NB 4D5FA 1YIJI 4LLNA 2UV1A 2X9DA 1HF0A 1YJNI 2Z5UA 4HNTA 3VWBA 3OOUA 5LEKA 2QGUA 2IXSA 2OQGA 3ZPLA 1I3QJ 3A01B 1IV8A 1M1EB 3RI4A 3C1DA 3PNTA 2BHZA 2ID3A 2XUBA 5J1YA 2JRMA 4EATA 1HC8A 2IA1A 2DDAA 3SYTA 4OIQF 4I99C 3M1CA 2MC4A 3ZQHA 1HW5A 1LJ9A 2B0LA 3BTIA 2KRCA 3KPHA 3I4PA 5IY5H 4L0YB 3TKYA 5M3MJ 3L7WA 3S3OA 5LEJA 3PQKA 1XGSA 3LQRA 2FNAA 2K9NA 2ECCA 3JTHA 2O6GE 3PO3J 3PQJA 3OSFA 4EM1A 5FKMA 3GZ6A 1K83J 3F6OA 3KP2A 5B5EC 4CXFA 4CGZA 1LKXA 1MNDA 4L9JA 5IT3A 3BG5A 3N05A 3CJTB 5DM7F 2VIXA 3HRSA 2MYSA 2WC2A 1T0FA 2NOGA 4H4KC 2ZJQF 2EJRA 2BOLA 5EEHA 3F8BA 3JTGA 3IRQA 4XK4A 2MH2A 1WJEA 3K4JA 4HF0A 2HKXA 3JCUC 2YS9A 5FLVA 2NXNB 3MVPA 3N97A 3ZQFA 1S9HA 2DA4A 4KA4A 1FTZA 2F5CA 4CUGA 1XGOA 5DYMA 2ELHA 4KIGA 3MN2A 3LAJA 1KQ9A 2QUFA 2K40A 2VJ5A 3M4OJ 1OYWA 1O57A 3ZMUA 4UUSB 4IZZA 1IZ1A 2IT0A 1U8RA 4IQ4A 2EZKA 4QPQA 1Z6TA 1BN5A 3LSMA 2WA0A 4P96A 3RYPA 1ZR2A 1AWCA 2M7BA 1ON1A 1JUSA 2K27A 1X3UA 4OOIA 2LKSA 4LK1F 5J40A 2A5WA 4MNUA 3E5UA 4RB1A 2L0KA 3ECOA 2HQ5A 3OYLA 4Q47A 1JT0A 1UAAA 4AUXA 1B72A 3TO7A 3FBIB 1TQPA 3PSIA 3V4GA 2H1LA 4G9YA 5B1BH 4RS8A 2P81A 2N8GA 2EV0A 1MJ9A 1EJ9A 4N9HA 2XIGA 4D5CA 1MNEA 5IT9Z 5D5XB 3S14J 4M6XA 1Y1VJ 3GBGA 1W5CC 2R7FA 3NQOA 5F27A 3TO6A 4DNCA 3BG6A 2ID6A 4I7HA 2V1DA 3HOTA 1QNTA 1O7FA 3W6VA 1JHHA 4HAMA 3OS1A 2W84A 4IHYA 2JPCA 4FETA 2V4JC 3K4CA 2V1UA 2VBZA 4JK1X 1DGWY 1NG7A 4A3JJ 1BI3A 3ZQCA 2DA7A 1FOYA 3G1LA 1XX5A 5CVJA 4FASD 1UB9A 2L5QA 1I3AA 1HOMA 1TT5B 4ANJA 1K4SA 4KDPA 1OCRH 4B3XA 1G8XA 3ULQB 4BXFA 3DF8A 2X85A 2DTZA 1DP7P 4ABZA 1W36C 4B1RA 4BQNA 5HNHA 2X0LA 4IL6C 2KHMA 2IGOA 2KIMA 4HLYA 3CCYA 3NRVA 2K3FA 3SXYA 3DV8A 3I5UA 3GTMJ 4BBSJ 5B66C 3S15J 2QA4I 3OS0A 5GTIC 2JSPA 3AG4H 2ME6A 3JRAA 3PNVA 4HLXA 1LEAA 3GLLA 2ZSIB 4E7HA 3TEDA 1X1PA 3D5RC 2C6YA 4P9FA 1D0YA 4BHBA 5FJ8J 4MQVA 1QVTA 4QWQA 4CA0A 2D45A 5D5VB 2A61A 3P9IA 5F04A 3OV8A 1JUMA 4Y33A 2WV1A 1ON2A 2OZ6A 3L09A 5LHGA 2DPDA 4KUMA 1CF7A 3B02A 2LF8A 3ZCOA 4OAYA 1DPUA 1K7AA 1G4DA 1ENHA 1OCCH 3CJRB 4NQWB 1MMNA 2NOJB 2KMUA 3M9AA 4AIHA 1XGNA 4RLFA 2PMZN 4Q48A 1R1UA 3CP8A 3OYEA 1K6YA 1PVEA 1VF9A 4A0XA 3JR9A 1S7AA 2O8XA 1QPIA 2HQRA 3LOCA 4ZTJA 2L02A 3ZOBA 4KN7X 4BEHA 4WXDA 3FXRA 3BPVA 3OYMA 3G4SI 3C2BA 5JFRA 5TJJA 4A5NA 3MZYA 4NDLA 4P55A 2E1OA 4U7DA 1LE8B 3AL0C 3LQQA 2F4IA 5FLXK 2Y48A 3ZMTA 3MKWB 4GRIA 4MTEA 3CJQB 2R7DA 2NAZA 1WJFA 4LIUA 5TISC 4ZJZA 2HYFA 4M3DA 1G59A 3KLOA 1LB2A 4XSZF 3QPLA 4W1UA 1HSJA 3GTPJ 3DP7A 4N4OB 1IGNA 3L1PA 2CO5A 2Y31A 2STTA 2NVYJ 4PJLA 3T1BA 4IRHA 4WF2A 1G3SA 1VQPI 1HA8A 1UG0A 1T38A 3AAFA 4BBRJ 2E1CA 4A3EJ 3E3VA 4LJZF 3DXJF 3ZQIA 4HQEA 2EFPA 1YX3A 4BE2A 2XAGA 4RM3A 3IHUA 2CV1A 1K78B 3GO5A 2WY8Q 2X1CA 4L18B 1QZEA 4XLCA 5F1RA 1POGA 2X6WA 3FHZA 4DQ2A 4IHWA 3BJOA 1A35A 1MDMA 4JQFA 3F72A 1XDUA 1OCOH 3K1PA 5E20A 2Z16A 5FFXA 2IBDA 4YELA 1WWXA 1MMSA 2OA4A 1YQAA 2XPUA 2K86A 2K9QA 4GYIA 4LMYA 1ZQ3P 2Y69H 3FMRA 1MH4A 5F08A 1SANA 2CUFA 3H3ZA 2QCOA 4KICA 3I0TA 4ZC3A 1YJ9I 1Z7LA 3L2QA 1BW6A 2RAEA 3HEFA 2E71A 2HYJA 3KX2A 5GPCA 1VNDA 2OBPA 4CYCB 2VJJA 1U2WA 5CVUA 3HL2A 4IO9F 1D1BA 4ASNA 5DEQA 2HOTA 1B9NA 4KYWA 3PIOF 3FF5A 3QYBA 3J80Z 1DGRM 1FY7A 1HXDA 1WZ2A 1U5TA 3BR6A 1MW7A 1ETVA 2VQCA 5JVGF 4MFDA 1FZPB 2X4HA 4CO8A 3BR1A 2L9NA 1SD4A 1VTNC 3H3UA 3GXOA 5DUIA 2G0EA 2K5CA 4WWCA 2OF7A 2JRTA 5FROA 1HDPA 4MLOA 1W7PA 2LDUA 4PCQA 3GFMA 4AVZA 3CTAA 2BW3B 4E4HA 1XS9A 2ESNA 1JTYA 1SVOA 3E1SA 2GXBA 4LOCA 3WHCA 1D5VA 1SFEA 1X1BA 4HOBA 4HEA2 4UUVA 3I58A 1MGTA 5E3OA 4ZDPA 2V79A 2XKOA 3BZCA 4ENNA 2O3FA 2M9HA 4IRGA 2A6HF 1KQ0A 2V9VA 1R1VA 3F21A 4L5IA 2LREA 3PJRA 3S1NJ 3VYRB 4BS9A 2A6EF 5CQGA 3GW2A 5ICFA 2E1MC 3H36A 1AOYA 2EZLA 1V5EA 3DFGA 3WU1B 1GV2A 5HOOA 2BVLA 1U8BA 2XDVA 3CD6I 3QP5A 2HYGD 4U88A 3HIFA 4XRMA 3CO7C 1ZAOA 5IPAA 2FXAA 3QPHA 4FT8A 2CV0A 3ML6A 1ETQA 5EF6A 3Q9VA 3PNYA 2GXAA 2HVSA 4OIOF 1UHSA 2DK8A 5FKOA 4CCNA 4X6AJ 1MZBA 3A0BC 4A0YA 3CP2A 2W57A 3U21A 3CUQA 3UNGC 2L2OA 3BR0A 1GLNA 1ZR4A 1NK2P 4LITA 4ENJA 2CUZA 4KMUX 4UUTA 1ETKA 4M72A 4Y3OA 2BXYA 1XG1A 3IV5A 2DI3A 1IXSB 2HDDA 4LG0B 3RKWA 5LD2C 4BHPA 1LDKB 3KIOA 5IYBJ 1I6HJ 4N4NB 4KITB 5BS6A 3QOEA 2QENA 2PJRB 2IJLA 1D0XA 1T33A 3M1EA 2Y2ZA 1YRNB 5FO5A 2MH9A 3LSJA 4B44A 4EJUA 2JN6A 2M7AA 3LAPA 3K2ZA 5EEGA 4ESJA 2R7VA 2W4SA 1RR8C 3OMYA 1WI9A 3I53A 1R5HA 2EFOA 1U9NA 4XL9A 1LFUP 4EMSA 4R8HA 5FD5A 1W0TA 3CDLA 4JX6A 3GTQJ 1J59A 1Z05A 3MZ8A 5DTDA 1T95A 4S05A 1FOKA 4BH9A 2LMDA 4EV0A 3ZQQA 1MBEA 4KJZA 4YFXF 5C3EJ 1D1AA 2QKLB 1H9GA 3ZGKA 2QYOA 1HSTA 1OCTC 3ROUA 4O3MA 1F1ZA 5A2QZ 2JUGA 4F91B 2LY1A 5J1RA 2PX9A 2BBYA 2NNNA 2EH3A 2P5LC 2HGCA 1Z91A 4DJAA 2DJIA 4BDYA 4PJ0C 1MSEC 1IXRC 2F4OB 1S7EA 4FQGA 2HXIA 4PFOA 3LA3A 1BI1A 2L01A 5IT9K 2JK3A 2IS4A 2WB1N 4Y13A 2O03A 3H5NA 4AD9A 1FOWA 3S8PA 3ZMSA 4A12A 4EJTA 2R7ZJ 3QODA 2A68F 3H0GJ 3QAHA 1P9QC 3KP3A 4QPOA 1XPXA 3BQYA 2GBYA 3K1NA 1I6XA 2WBMA 5FFZA 1VFCA 1ZGJA 1YLFA 2JA6J 4M3GA 4Y4RA 1SD7A 4ZDOA 3CCSI 1XMXA 1YX5A 4C3HJ 3WG9A 4YRVA 1QZZA 2FA5A 2KJCA 1WCMJ 2IVMA 4C2MJ 1P92A 2P7VB 2LP0A 3ABKH 5K1YA 3HOZJ 3OIOA 4LD5A 1T56A 3F0CA 3I4MJ 4BACA 3G2BA 3JRBA 4ZYAA 4AVPA 4L0ZB 2G9WA 4RLQA 5KAFC 1BM9A 2XAUA 2OTLI 2DFFA 2HXOA 3LSHA 4EM2A 2KL4A 3GTOJ 3DKWA 1ZELA 1SEUA 1B72B 4JX4A 1YW9A 2ZMEC 2LKXA 1D1CA 5D8LB 1FYKA 1SC7A 3RJPA 3MFKA 3KYDB 4ZYHA 1TBXA 3DU5A 1AHDP 3GUDA 2HEOA 3EUHA 1QZYA 2GIZA 1QU3A 3PL8A 2TCTA 1XSVA 3EETA 1BBYA 5ICCA 5JLXA 2JZYA 1VQ4I 2RNJA 5M5YJ 2RNGA 1WQ2A 2W24A 2E34A 3VSLA 1X4PA 3HPGA 4ZZDA 3C7JA 2X1EA 3U1KA 2KQRA 2EILH 2YPRA 1J2XA 3FXKA 4HSRA 3EUKL 4BXXJ 2W82A 3TP3A 1K4TA 5E1XA 5DDGA 1MMAA 2DYSH 3LA7A 1R49A 2BEOA 3EUAA 3I59B 3K0LA 3R61A 2NYXA 2D5VA 2E5NA 5FB2A 2HU9A 2RREA 1Y0NA 4TV7A 4U0VA 5DV5A 5CQEA 3QOPA 3BP8A 5HLGA 4PJNA 1UG2A 3TO9A 1R5ID 2I5UA 2Y0MA 1DDNA 1S29A 1VI0A 1W4MA 3GLXA 2GOXB 4V2GA 3SZTA 3WTWC 3OYDA 1DP3A 1KONA 2AXLA 3K69A 2XB0X 1PP7U 3P9CA 3DPTA 3S16J 4EVIA 3ZXSA 2KP6A 5M3FJ 5DS9A 1ZHFA 2K9LA 1Q1VA 1E3PA 1YW7A 3PO2J 5E8IA 4G7ZF 2IGNA 1J5YA 3OYHA 4PDKA 1R1TA 1OYYA 2PQ8A 3RYRA 1IUYA 3HC7A 3KEOA 4M9ZA 3RCOA 1A6IA 1TWCJ 1PUFB 4XKWA 2XAFA 5HS8A 4UV8A 1CF7B 1YI2I 1FTTA 2HFHA 3IWFA 5JVTA 5L3DA 1XCVA 5D8KB 1ETOA 2W1OA 2YU9J 3JREA 3S93A 2D1HA 4UHTA 3V8LA 1Z6RA 1LVAA 4YFKF 3HRTA 3WGGA 1X1CA 1VQKI 3FK6A 4HSTA 2DW4A 1OKRA 2M0CA 3WG7H 4XLAA 2V6EA 3CMEI 2NRAC 4M6YA 3QP6A 3VYTB 1XC5A 2JVHA 2WAQN 3ASNH 1MIJA 3CZ6A 3ZMZA 2B9SA 1VQ6I 3BC8A 4BQOA 2MABA 1YG2A 4AYBN 2EFNA 4F55A 5EG0A 2IS2A 1VQLI 2E1NA 3V7CA 1U5TC 1MBFA 3OIQA 1FBQA 4OIPF 2X1DA 3ISPA 1QRYA 2FD5A 2EZHA 5FLMJ 2NVXJ 4P1WA 4FTHA 3DBHB 2LF7A 2VXDA 4A3KJ 5IP6A 1NK3P 3JRFA 5CLSA 4H0EA 3CCVI 5F1JA 4ZYGA 5CJ9A 3JRCA 2H8RA 1A31A 2NS8A 4B48A 2NNYA 1JJ6C 4XRFA 3NWSA 2E2HJ 1P4AA 3TW7A 3VOEA 4CYDA 2DN0A 3OR1C 5F0HA 5K7FA 5K7HA 1T6SA 4AC0A 3HSEA 4DBRA 2M4KA 2LK2A 1UZCA 1JGSA 2M1BA 4XMYA 1I1SA 2KRFA 1FMVA 2W7NA 2JT1A 2LOOA 5LBQA 1EH7A 3BT9A 3DTKA 3H3VK 1QGPA 1TNTA 2OCEA 4O6JA 4MTDA 4BY1J 4GYGA 5D5WB 3SEZA 2QSFX 4HX8A 3C2HA 2VQHA 3T0YA 5B1AH 3CC7I 2VUMJ 4MIMA 1MNMC 1I50J 2XF7A 1O3RA 3BLYA 4YG2F 2L7FP 5E3NA 3S17J 2QQAA 3RIRA 2ZFWA 5C4XJ 1GUUA 2MC3A 2ETHA 3ZP5A 1X2MA 2EA2A 4BNCA 2UWMA 4PFPA 4RAFA 3K4BA 3FXLA 1MKMA 2VBWA 3ABLH 1RKWA 3CMAI 2JA8J 2VB6A 3RPUD 1R6RA 1U5TB 1YW8A 2CMPA 1BOBA 3BJAA 3KP4A 5DM6F 3CUQC 5HNFA 1MBGA 4UVBA 2OCCH 2TRTA 1ZH5A 4BQQA 3Q0WA 4F52A 5D4RA 4GO1A 2R5ZA 3KEQA 3MMYB 4FX0A 4HV6A 4LB6B 2Z3YA 3V7RA 2ISZA 2Z1DA 4N0BA 4RB3C 5BPIA 2X51A 3CDIA 1OR7C 4L9TA 1O4XA 4G12A 3L2VA 2ZXJA 5JR3A 3SZGA 2P6TA 2R7WA 4XLEA 1DPRA 5LFAA 2HS5A 1FBSA 4XLHA 4HDUA 2DYRH 3A2KA 1B9MA 5FGMA 2EV5A 3CJNA 2Z2SB 2KIFA 2RDPA 1JUPA 1XTAA 4XOTA 1LQ1A 4KISA 3KZYA 2XASA 3HTSB 3LWFA 1Y8RB 1ITYA 1YTYA 4I02A 5C4JJ 3OL4A 2MBFA 4E7JA 2DXIA 4NUBA 3GMEA 3TGNA 2DA1A 2VJIA 3WU0A 5H6RA 2R7OA 4IPAA 9ANTA 1LDJA 2O9LA 1F9NA 2E2IJ 1Z77A 1I39A 4PGHA 2OPTA 5JI6A 1IJWC 3FKIJ 5A2QK 1IDYA 1ZG3A 1OYIA 1ZKGA 3FHNA 1R23A 3ABUA 3FM3A 5IP9J 3KZIC 2CUJA 1H0MA 2W48A 4Z2YA 5HDKA 2ICWG 2XF6A 2ELJA 3KP5A 2QBYA 3A0HC 4V2FA 2JA5J 3TDZC 5F64A 3NWTA 4WXCA 3TW6A 4HNUA 2M34A 5EZGA 3QYFA 2CRGA 2O7OA 2EWNA 4E6KG 4HPQA 5KNLA 3GTLJ 4OMZA 2ISYA 4E7ZA 4DZJA 4V19K 2ZMEA 3QPTA 1RNLA 1KU2A 3JSPA 1KU3A 1QO0D 1P4WA 3BCBA 4BJTA 1F36A 1X2NA 2GXGA 4M9SA 3S1MJ 1D8KA 2LKPA 2R7SA 1OQYA 3TBIA 3DBLB 3K9TA 3R0JA 3HSRA 3K70D 1NHAA 3LA2A 3ABTA 1BIAA 2OC6A 6PAXA 4KT5C 2KLOA 4XICA 1WJCA 3GWZA 1EV7A 2FBHA 2R92J 3EUHC 2HOEA 1B59A 2KZVA 1YOVB 3REOA 5HLHA 3A1YA 3HTUA 4L9NA 1SMTA 4X0GA 5D6FA 2H6BA 2IW5A 4LK0F 3LSRA 1YO5C 5LHHA 3DLAA 2FQ3A 3E5XA 2IP2A 1E2XA 4W97A 4RB0A 2PEXA 3G71I 2Q2EA 2OAZA 3D0SA 1FC3A 2A69F 2X6YA 1ZG5A 2DMTA 3FIWA 3ZN0A 1JGGA 4GGGA 4ENMA 4XNFA 4Y7NJ 1UELB 3IKVA 4PJMA 3PFIA 3HBLA 2Y0SA 1FSHA 3WGIA 1YJWI 3WTVC 2F5FA 2R3SA 2E5ZA 5IOZA 1WJ5A 3S3NA 1YS6A 1X19A 4RB2C 2K02A 3HKZN 4UVAA 2XPVA 5AIPA 2RN7A 4ON0A 3VYSB 5LLQA 2Q0OA 1N78A 3VYUB 3E7LA 1IC8A 3I54A 2XB5A 1GVDA 2L3DA 3FDYA 3JAMZ 5J4VA 2LBFA 1YE9A 4NNJA 1FIPA 4FISA 1JE8A 1BI0A 3E6MA 2XGXA 5J6XA 2F6CA 2JA2A 2PG4A 3BY6A 1GV5A 1LVKA 2OUMA 2FX0A 1V55H 1H8AC 3W3CA 2V6CA 4EM0B 4DW6A 1IV6A 2Y75A 1O7LA 1FNNA 2FRHA 2XGEA 4RDUA 3QU6A 1HLVA 5GADJ 3RDIA 4Y15A 3H9JA 2Q8KA 5H2FC 2I8DA 2PBIA 4RAZA 4BU2A 3F23A 3TDUC 3W6JB 1BA5A 1X3ZB 2ZKZA 4DZPA 4X1EA 3CCQI 1VQOI 3TL4X 3BTCA 2ZJ2A 2VJ4A 2R7RA 2XRLA 3OYIA 3HZJA 3AL0B 3ECHA 3GFJA 1MBJA 4M71A 1HKSA 2JUCA 4PK4A 2P0WA 5LRSA 5HLTA 3WTXC 1NH3A 1I27A 1YIOA 5EEAA 3CLOA 1V3FA 4G7OF 3GFLA 3KLNA 2WAQA 4CSWA 3CCUI 1YFHA 1ZN2A 2L9RA 5ERIA 3AKZA 3RZOJ 3H35A 4KN4X 4XLNF 1MJAA 4AYBA 3FZVA 1GT0C 2Z33A 2E36A 5E17F 3S2HJ 2AHQA 4XSXF 5CYVA 3TOBA 2QVOA 2LH9A 3HOVJ 1YITI 1BR2A 2DT6A 3CMMA 1BR4A 3KYCB 3BQZA 3CF5F 4F3QA 4Y52J 2EBIA 2GQQA 4ITVA 4JX5A 3MZHA 3BR2A 4XRSG 3BR3A 2E35A 3RPQA 3VEPA 1JKPC 2QEXI 1T98A 4BKXA 1IN8A 3FK7A 1Y8QB 4G6DA 3BR5A 2HOSA 2R7TA 1LUJB 3J7YJ 5L3CA 4F7ZA 3HG9A 1K79A 2BVMA 2VBXA 3J81Z 5E3LA 4M3FA 1IF1A 1BOAA 4FHTA 2TDXA 1TWHJ 3CLQA 4CZCA 3ZQLA 1WJAA 2J5OA 1MMGA 2UUZA 5GTHC 1B8IA 3M3YJ 2R7XA 2VL8A 4HBLA 1JKQC 2CS3A 3P9KA 3RQIA 3QYEA 3NAUA 4HV5A 4OINF 3DKYA 4AIKA 2R7QA 3HM5A 2K9SA 3UR3C 2XAHA 2EINH 3HOXJ 1BJZA 2DBBA 3DEEA 4RGRA 3W6KB 4FE7A 1S6LA 1JI8A 4RMNA 2ACJA 3OYJA 5ED4A 3KE2A 1D5YA 1ZRFA 1QHGA 2M30A 3FKJA 2PMHA 4CCKA 1IRZA 2QQ8A 1A36A 1P2FA 4Y17A 4OIRF 4EJOA 5LGTA 1OR7A 3OYFA 2CFOA 4A6DA 3HXLA 4E7LA 5HDNA 5AIQA 4XOPA 2DFEA 3Q0UA 3HYIA 1TQIA 3V8JA 2O8KA 4XBFA 1IN5A 1UMQA 3ERMA 5EG0B 2L54A 4NC6A 2ESHA 4NC8A 2G7UA 4CCJA 2MW8A 4KMFA 2O61A 4GFBA 1JTXA 2HVQA 5DD4A 2G7HA 2LTPA 4ZDLA 3FMQA 3RQ4A 2AQFA 4IKFA 4E7SA 4QLCU 1U3EM 1PP8F 3I9V2 1Q1HA 4ESBA 3CO6C 4II3A 2QSGX 2RGVA 1JJ8C 4BQAA 2QQ9A 4AU7A 2VXZA 1R9TJ 3S1RJ 2EFQA 4G7HF 2UZKA 3WU2C 1Y6IA 1LPQA 2E1MB 1KU7A 1J09A 5CVRA 2DA6A 3F9KA 3K10A 3AG2H 2BHYA 1NG6A 1QHHD 2QLZA 5FKNA 1UHMA 3ZMVA 5JHFA 2V9PA 2B63J 2NVUB 1Y56A 3F8FA 3GZNB 1D3YA 2CQXA 3OIPA 3K4NA 1BJAA 4C3JJ 3ZQ7A 5B3SH 2Y30A 5HS9A 3I64A 4MFEA 1BC7C 4HNVA 3JRIA 4A3BJ 2ZNZA 3DKXA 5HDGA 3BG3A 3AG1H 2IEKA 3GTKJ 2MD5A 3HUGA 2KKOA 2IGKA 3GX4X 1ZRCA 2F5DA 4M9XA 1QQIA 2HTJA 1TNSA 1HQCA 2MFZA 1KZHA 3U9GA 4HF2A 3MKZA 5J1UA 5CKTA 5H20A 1LE8A 4A3LJ 5GPAA 3FX3A 4IEJA 5BOXA 3ERED 4G8XA 3CDHA 3FM5A 4RGXA 5F0FA 4J00A 3OSGA 1HBXG 1MD0A 2XPWA 2X6OA 3W2AA 1SMYF 1FPQA 2JPBA 1AU7A 3R0AA 1HDDC 5ILSA 4B47A 2DMUA 1X1AA 4EQQA 5JHUA 4CCOA 1RPWA 2B7EA 2AQEA 2EFWA 2MD0A 5ILVA 1QPMA 1HCRA 2E19A 1RRJA 2R5ZB 3BOQA 2JTVA 3M8EA 4A0ZA 1USSA 4XKCA 3GTGJ 4AM3A 2MSYA 3M07A 2VOOA 5GP9A 2O5RA 3NARA 2HI3A 4B8XA 5FRNA 3OYAA 4MQ9F 5EGOA 2DQLA 1N75A 3HPHA 1EKEA 1U6GA 2XGCA 3BTJA 3G1MA 3LSKA 4FE4A 4IHVA 2DK5A 1ULYA 1TW2A 4CCMA 1OISA 2L4AA 4JYKA 2K4BA 3FISA 2ADUA 5E18F 3R4KA 4DYRA 1MJBA 2DMPA 2CW8A 5K7ZA 2VT2A 1WI3A 4IXAA 2PMZA 3O3KA 1W0UA 4IHXA 3KCCA 2K7LA 3K6GA 3A03A 2RQQA 5HLIA 3D1NI 3IUOA 3IH2A 1SD6A 2QKMB 3IH3A 4CYCA 3I56I 2E7WA 1PDNC 1WJDA 4B3AA 1S8NA 4UXNA 2XAQA 3EPZA 2BZTA 5IYCJ 1EA3A 2L7MP 1FT9A 4YIFA 2CQQA 3PSFA 2E7XA 4CCLA 4BE1A 3R60A 1EF4A 1RUOA 2M8GX 4BJ5C 3C18A 4DBQA 4WCGA 2XSDC 1SVMA 1VZ0A 4EEFG 1A5JA 2F48A 3JRDA 1FYMA 4XN0A 1U9OA 3MEXA 5GAEJ 4FCYA 5FD6A 1X1DA 2VPRA 3H5RA 1ODDA 1JT6A 2HR3A 3FXOA 1APLC 2DA3A 4P9UA 2Z9OA 3WGHA 4G6TB 3SJMA 3E6DA 2OD5A 2FBKA 2LRDA 3R6SA 2FU4A 1BIBA 2CQKA 3BWGA 1KGSA 2QZ8A 2DU9A 2ZNYA 2BW3A 2QBYB 1MMDA 1ZTRA 1PUEE 3JW4A 4XN3A 3HRMA 4HX7A 1D0ZA 2QQBA 4I76A 1W5SA 2VBYA 4R1HA 2EA4A 2ZXWH 4L5EA 1AKHA 2VLAA 1G3WA 2LVSA 5KHDA 2JSCA 1YYVA 2VKVA 1CGPA 2IS1A 4S04A 2ZMEB 4OAZA 3SZPA 4U0YA 3Q5FA 2HNHA 2R0QC 2WADA 3PUBA 1Z0XA 3S2WA 1UFMA 5IYDJ 2R5YA 1XCBA 2M5WA 2H94A 3D5LA 3OYBA 4II2A 2KISA 4UNOA 2V7FA 3LSPA 1JHFA 3IAS2 2FMYA 4P5OA 1U0JA 2FJ1A 1ETYA 5ICEA 1ZRDA 1ZLJA 1OCZH 3DTIA 3J7AY 3X2QH 5DCFA 5KVRA 3RZDJ 1SAUA 1ZK8A 2M2EA 1L3LA 1LFBA 3MQ0A 3Q0VA 1GHCA 1B6AA 3JAMK 4C3IJ 3G6EI 3EDPA 4U0WA 3S1QJ 3K4MA 2PJPA 5KCMA 3VSKA 2D2WA 2VKEA 3GF2A 3OS2A 4BEHB 3SFIA 1XMAA 3C2GA 1R58A 4ZH4F 2GOMA 4UVCA 1PJRA 3H9GA 4IF4A 1TL8A 2BY2A 4EGZA 3F3XA 1E0EA 1KU9A 2IA2A 3WTTC 2L4MA 5ICGA 3GZ5A 3J80K 2A07F 3OY9A 2JMWA 2DMNA 4LG0A 2JQ7A 2XSJC 4DGWB 2H1KA 3W2WA 4XONA 4LLLA 1RZ4A 1NTCA 2AS5F 1KA8A 4MGRA 1Z3XA 2PJRA 2FMLA 1ZYRF 1MBKA 1I5ZA 3WE3A 2F2EA 2CYYA 1V4RA 4BL0B 2ECBA 4I01A 4U7BA 1WHUA 4Q5SF 2Y9YA 2FOKA 4IHSA 3VFZA 1GXPA 3L2RA 3F8NA 3H1CA 3MD2A 1DU0A 4L9VA 4AIDA 1GDTA 1MDMB 3G1OA 3IL2A 2XROA 3KEYA 4BGDA 3LFKA 3EQLF 2LBFB 5TRDA 4XRSA 1N77A 2LG4A 4YEJA 5EDNA 2BXZA 4ENKA 2QWWA 1FLIA 2M8EA 1FMWA 1V5FA 2HPMA 1OMIA 2KPMA 4ZZLA 3E6CC 1Z9CA 3J81K 2Y9ZA 3KP6A 2XGDA 1F43A 2ZBKA 1T2KA 4RGUA 2KDZA 1IDZA 4XM3A 2M3AA 4RA2A 2HWVA 1W1WE 1E3OC 1WH7A 1DU6A 4BAYA 4CH7A 4E7IA 1S3JA 4L5JA 3GVAA 2MGQA 2FNPA 3KETA 4FX4A 3T8TA 2PI0A 1WGXA 2XF5A 3DWLE 4UB8C 3DU6A 3FXQA 1R71A 4LGWA 1IN7A 3DEWA 2E60A 2D1VA 2FOWA 2XVCA 1TC3C 1Z67A 3DCFA 4PJJA 3WTSC 1WSUA 3O6BB 1W7PB 3JRHA 1RI7A 2LR8A 3CC2I 4EGYA 2ZJRF 3MKLA 1W36D 5K5RA 1Z3YA 1ZGAA 3RSNA 1KQ8A 2FSWA 1ETWA 2ZXHA 4OWRB 4LIVA 3FXMA 1HKTA 3O8HA 3CF2A 2ZCWA 2HQAA 1BI2A 3E97A 2HZTA 1J0RA 1KYWA 4YIIA 4AWXB 1XMKA 2DO7A 2KRHA 2PN6A 1SFOJ 2R4GA 5FKLA 4WX9A 2GWRA 3GYHX 1XDSA 1K6OA 5DUKA 4A2UA 5CPRB 5HODA 1USTA 4ZTFA 1JKRC 1B8IB 1X58A 4NBQA 5EZHA 2ZJPF 2ZO4A 1FP2A 4B4CA 4JP0A 5L3FA 3N4MA 3D5SC 1V54H 2L7ZA 1IXCA 2WB1A 5AONA 4I0AA 5E79C 3I4NJ 3HHHA 3L2UA 2OZUA 4UV9A 3I59A 2XHKA 2MA3A 4XKBA 2F5EA 3CUQB 1RETA 3H0DA 1A6QA 4A3GJ 5F0CA 2EIKH 4RGSA 2VC1A 5L3EA 3HOSA 2RVCA 3K4KA 2FE3A 2IA0A 2DLLA 2Q1ZB 2JJ7A 4J19A 1V5GA 2VOPA 1IN6A 2DA5A 4N9IA 2P5KA 3BTLA 2LD5A 4XORA 3BDDA 3IWZA 3GTJJ 1TT0A 1Z1DA 1AA7A 3E5QA 2RQPA 3LMMA 5IP7J 4A3FJ 2V9KA 3F8CA
chains in the Genus database with same CATH topology
3G3ZA 3CUOA 4MHGA 2P6SA 2HQNA 4G6QA 5LHIA 1D8JA 4R79A 3BZ6A 3WTUC 2GA2A 2YX7A 1KYZA 1Y0UA 1HKQA 1U78A 1TQMA 4HA8A 3K1MA 5DCMA 2VE8A 1J7KA 3MCZA 2QM3A 1LEBA 3ZN1A 2XAJA 1ZLKA 4IRIA 3COAC 3L2CA 3F22A 1F4KA 1RIOH 5KK1A 3H92A 1LNWA 1DUXC 2A5YB 1FP1D 4GCVA 2STWA 3E6BA 4A6EA 1R22A 2W85A 2OU2A 3V8KA 5L3GA 5J8FA 4IHTA 4A5MA 2H6CA 2CSOA 2EB7A 4M74A 1GXQA 2VT3A 4NB5A 1REPC 1ZREA 3KZZA 5K5OA 3M8FA 3JSOA 4I0BA 2K4JA 2HTSA 3MWMA 1JXSA 3M7GA 4I2OA 3BROA 1EH6A 3F6VA 1GVJA 1H9TA 2KJBA 2PMUA 1R5GA 1O3TA 1XSDA 4ETSA 2CGPA 2WWYA 5HVQC 3L00A 1STZA 2BGCA 5LGNA 3TQNA 5BQTA 3LSTA 2YR2A 2DPUA 2GAUA 2OQRA 2W25A 1HW1A 1UHWA 1Z7UA 5E1WA 4KFCA 3HRUA 2YX4A 4WK8F 2XRNA 1RUNA 1R36A 1G6NA 2O0YA 2CFXA 1QBJA 1TLHB 2LSOA 3OOPA 4OU0A 4HF1A 3G73A 1XN7A 2BE5F 1FX7A 3WTYC 3QRFF 1G3TA 2BV6A 4Q4ZF 3WTZA 1FWZA 4ZYEA 3KP7A 3KFWX 2GA1A 4YFNF 1YS7A 2P8TA 4GXOA 3EYYA 1XSXA 3C3WA 3DPLC 1XD7A 3RTRA 1IRGA 1FBUA 3VB2A 3IKTA 1R00A 4CZZA 2VONA 4CICA 4IJAA 2FBIA 5BMZA 1G3YA 3DEUA 3V7SA 1ONVA 1UCRA 4BHCA 4NHJA 1TTYA 3SFZA 3I71A 2VE9A 5E1ZB 3ZMDA 2H27A 2DTRA 2UXNA 4HDVA 5BPDA 2PFBA 5F6FA 3U2RA 3IC7A 2KIUA 3QU3A 1IAWA 2M87A 1FSEA 5LRRA 2VODA 1FYLA 4OMYA 1IW7F 3FWEA 3J7AO 3BPXA 1SAXA 2HKOA 4ESFA 3FMSA 2NS0A 3O2PE 3BJ6A 3GFIA 2DAOA 4EJVA 4M73A 4NQWA 2Z99A 3EYIA 3F8MA 4K2EA 4WXHA 1W5TA 1L0OC 2FEZA 1EH8A 3MAJA 3P7NA 4I98B 5LGUA 3RPUA 2COMA 2IPQX 5H6QA 2DFIA 4BXUA 3U1DA 1P4XA 2P5VA 1WRJA 1SD5A 4KNYA 2M45A 4G94A 2VC0A 3Q9SA 2FF4A 3VODA 2CG4A 3SQNA 1B4AA 4RAYA 5D4SA 5D5UB 3FXUA 3NEUA 1TW3A 1ZG1A 1B1BA 4PZJA 3WODF 2VN2A 1S7OA 2HDCA 2UXXA 4CDGA 1IRFA 3RKYA 1K78A 4LFUA 4KIFA 1OPCA 3IRRA 5HS7A 4I09A 4BYYA 2WTEA 3T5XA 1ZARA 4B09A 5J8CA 5CVVA 2GIVA 1XGMA 5K5QA 2P4WA 2J5PA 2YU3A 4ZYDA 1WKMA 1R7JA 1O3QA 5DD8A 2XV4S 4XLPF 2EV6A 5D6EA 5FLXZ 1LDDA 4IVNA 4JBAA 1T39A 2IRFG 3TOAA 1SFXA 4D0PA 3B73A 5E8GA 2CW0F 2MLKA 2CWEA 4MEYF 1A04A 4HZFA 1IN4A 2H09A 1SFUA 1BC8C 4PGGA 3T8RA 1I1GA 1O3SA 5L3BA 2LNBA 2PLYA 4LLGF 3SHFA 5CVIA 2A3SA 2YSRA 2DT5A 3HHGA 2GZWA 1J75A 4HW0A 2V1XA 1XB4A 4KIBA 2MLGA 3WE2A 1J9IA 3GEZA 3ELKA 1F5TA 1E17A 2RC4A 3L9FA 4HQMA 4HX4A 1W7PD 4EJWA 4O5VA 2P7CB 4MEXF 4CHUA 4E70A 3HSFA 5ILUA 5DCMB 4LB5A 4HYEA 2RV8A 3RKXA 3DQVC 2WV0A 2RKHA 1C0WA 2BYVE 1HW2A 2XKPA 2DQRA 4AIJA 2EK5A 1P6RA 4LLNA 2Z5UA 5LEKA 2OQGA 3ZPLA 3RI4A 3C1DA 2XUBA 2IA1A 4OIQF 1HW5A 1LJ9A 2B0LA 4L0YB 3I4PA 3TKYA 3L7WA 5LEJA 3PQKA 1XGSA 3LQRA 2FNAA 3JTHA 2O6GE 3PQJA 4EM1A 3GZ6A 3F6OA 3KP2A 4CXFA 4CGZA 4L9JA 5IT3A 3HRSA 2WC2A 1T0FA 2EJRA 5EEHA 3F8BA 3JTGA 3IRQA 2MH2A 4HF0A 2HKXA 3N97A 4KA4A 2F5CA 1XGOA 5DYMA 2ELHA 4KIGA 3LAJA 1KQ9A 2QUFA 1OYWA 1O57A 3ZMUA 1IZ1A 2IT0A 1U8RA 1Z6TA 1BN5A 4P96A 3RYPA 1AWCA 1ON1A 2K27A 1X3UA 4OOIA 4LK1F 4MNUA 3E5UA 4RB1A 3ECOA 4Q47A 3TO7A 1TQPA 3V4GA 4G9YA 4RS8A 2EV0A 1MJ9A 4N9HA 2XIGA 5IT9Z 5D5XB 4M6XA 3NQOA 3TO6A 2R7FA 4DNCA 4I7HA 2V1DA 3HOTA 1QNTA 1O7FA 1JHHA 4HAMA 2W84A 2JPCA 2V1UA 2VBZA 4JK1X 1BI3A 5CVJA 1UB9A 4KDPA 3ULQB 3DF8A 1DP7P 2X0LA 2KIMA 4HLYA 3NRVA 3SXYA 3DV8A 3I5UA 4HLXA 1LEAA 2C6YA 4P9FA 4BHBA 4MQVA 4QWQA 2D45A 5D5VB 2A61A 3P9IA 3OV8A 1ON2A 2OZ6A 3L09A 5LHGA 2DPDA 4KUMA 1CF7A 3B02A 2LF8A 1DPUA 1K7AA 1G4DA 3M9AA 4AIHA 1XGNA 4Q48A 1R1UA 4A0XA 1S7AA 2O8XA 2HQRA 2L02A 4KN7X 4WXDA 3FXRA 3BPVA 5JFRA 5TJJA 4A5NA 3MZYA 4P55A 4U7DA 3LQQA 5FLXK 2Y48A 3ZMTA 4MTEA 2R7DA 2NAZA 2HYFA 3KLOA 1LB2A 4XSZF 1HSJA 3DP7A 2STTA 2CO5A 3T1BA 4IRHA 4WF2A 1G3SA 1T38A 3AAFA 2E1CA 3E3VA 4LJZF 3DXJF 4HQEA 2EFPA 2XAGA 3IHUA 1K78B 3GO5A 4L18B 5F1RA 3FHZA 4DQ2A 3BJOA 1MDMA 4JQFA 3F72A 1XDUA 3K1PA 5E20A 5FFXA 1WWXA 2OA4A 1YQAA 4GYIA 2K86A 4LMYA 3FMRA 3H3ZA 4KICA 3I0TA 2OBPA 1U2WA 5CVUA 4ASNA 5DEQA 1B9NA 4KYWA 3FF5A 3J80Z 1FY7A 1HXDA 1U5TA 1FZPB 2X4HA 4CO8A 1SD4A 1VTNC 3H3UA 3GXOA 5DUIA 4WWCA 2JRTA 1W7PA 2LDUA 4PCQA 3GFMA 3CTAA 2ESNA 2GXBA 1D5VA 1SFEA 4HOBA 4UUVA 3I58A 1MGTA 2V79A 2XKOA 4ENNA 2O3FA 4IRGA 2A6HF 1KQ0A 2V9VA 1R1VA 3F21A 4L5IA 2A6EF 3GW2A 5ICFA 1AOYA 3DFGA 3WU1B 5HOOA 3QP5A 2HYGD 4U88A 3HIFA 3CO7C 1ZAOA 2FXAA 3QPHA 4FT8A 3ML6A 3Q9VA 4OIOF 2DK8A 1MZBA 4A0YA 2W57A 3CUQA 4ENJA 4KMUX 4M72A 2DI3A 1IXSB 4LG0B 3RKWA 4BHPA 1LDKB 5BS6A 2QENA 2IJLA 3M1EA 5FO5A 2MH9A 4EJUA 3LAPA 3K2ZA 5EEGA 4ESJA 1WI9A 3I53A 1R5HA 2EFOA 4EMSA 4R8HA 5FD5A 1J59A 1Z05A 4S05A 1FOKA 4BH9A 4EV0A 4YFXF 1H9GA 2QYOA 1HSTA 4O3MA 3ROUA 1F1ZA 5A2QZ 2BBYA 2NNNA 2P5LC 2HGCA 1Z91A 1IXRC 3LA3A 1BI1A 2L01A 5IT9K 4Y13A 2O03A 4AD9A 3ZMSA 4A12A 4EJTA 2A68F 3QAHA 3KP3A 3K1NA 1I6XA 5FFZA 1ZGJA 1YLFA 1SD7A 3WG9A 1QZZA 2FA5A 2KJCA 2IVMA 1P92A 2P7VB 5K1YA 4LD5A 4AVPA 4L0ZB 2G9WA 1BM9A 4EM2A 3DKWA 1YW9A 5D8LB 1FYKA 3RJPA 3MFKA 4ZYHA 1TBXA 3GUDA 2HEOA 3EUHA 1QZYA 1XSVA 3EETA 1BBYA 5ICCA 2JZYA 2RNJA 1WQ2A 2W24A 4ZZDA 3C7JA 2YPRA 1J2XA 5E1XA 5DDGA 3LA7A 2BEOA 3R61A 3I59B 3K0LA 2NYXA 5FB2A 4TV7A 5DV5A 4U0VA 3QOPA 3BP8A 5HLGA 3TO9A 1DDNA 2Y0MA 1S29A 1W4MA 3GLXA 3SZTA 3WTWC 2AXLA 3K69A 1PP7U 3P9CA 3DPTA 4EVIA 1ZHFA 1YW7A 5E8IA 4G7ZF 1J5YA 4PDKA 1R1TA 1OYYA 2PQ8A 3RYRA 1IUYA 3KEOA 4M9ZA 5HS8A 2XAFA 4UV8A 1CF7B 2HFHA 3IWFA 5JVTA 5L3DA 1XCVA 5D8KB 2D1HA 4UHTA 3V8LA 1Z6RA 1LVAA 4YFKF 3HRTA 3WGGA 2DW4A 1OKRA 2NRAC 4M6YA 3QP6A 3ZMZA 1YG2A 2EFNA 2E1NA 3V7CA 1U5TC 1FBQA 4OIPF 3ISPA 2LF7A 5CLSA 4H0EA 4ZYGA 5CJ9A 2NNYA 4XRFA 1P4AA 3VOEA 4CYDA 1T6SA 3HSEA 1JGSA 2M1BA 1I1SA 2KRFA 2JT1A 5LBQA 1EH7A 1QGPA 1TNTA 4O6JA 4MTDA 4GYGA 5D5WB 4HX8A 3T0YA 1O3RA 4YG2F 2QQAA 3RIRA 2ZFWA 2MC3A 2ETHA 3ZP5A 2EA2A 4BNCA 2UWMA 1MKMA 2VBWA 1U5TB 1YW8A 3BJAA 3KP4A 3CUQC 4UVBA 1ZH5A 5D4RA 4GO1A 3KEQA 4HV6A 4FX0A 4LB6B 2Z3YA 3V7RA 2ISZA 4N0BA 4RB3C 5BPIA 4L9TA 2ZXJA 5JR3A 2P6TA 1DPRA 2HS5A 1FBSA 4HDUA 1B9MA 5FGMA 2EV5A 3CJNA 2KIFA 2RDPA 1LQ1A 3KZYA 2XASA 3HTSB 3LWFA 1YTYA 4I02A 2MBFA 3TGNA 3WU0A 5H6RA 4IPAA 1LDJA 1F9NA 4PGHA 5JI6A 5A2QK 1ZG3A 1OYIA 1R23A 3ABUA 3FM3A 1H0MA 4Z2YA 5HDKA 3KP5A 2QBYA 3TDZC 5F64A 4WXCA 2EWNA 4OMZA 2ISYA 2ZMEA 3QPTA 1RNLA 1KU2A 3JSPA 1KU3A 1QO0D 1P4WA 2GXGA 4M9SA 1D8KA 2LKPA 3K9TA 3R0JA 3HSRA 1NHAA 3LA2A 3ABTA 1BIAA 6PAXA 4KT5C 3GWZA 1EV7A 2FBHA 2HOEA 1B59A 3REOA 5HLHA 3HTUA 4L9NA 1SMTA 5D6FA 2H6BA 2IW5A 4LK0F 1YO5C 5LHHA 2FQ3A 3E5XA 2IP2A 1E2XA 4RB0A 2PEXA 2Q2EA 2OAZA 3D0SA 1FC3A 2A69F 1ZG5A 3ZN0A 4GGGA 4ENMA 3IKVA 3PFIA 1FSHA 3WGIA 3WTVC 2F5FA 2R3SA 1YS6A 4RB2C 2K02A 4UVAA 5AIPA 2RN7A 4ON0A 5LLQA 2Q0OA 3I54A 2L3DA 3JAMZ 1JE8A 1BI0A 3E6MA 2XGXA 5J6XA 2PG4A 3BY6A 2V6CA 4EM0B 2Y75A 1O7LA 1FNNA 2FRHA 3QU6A 3RDIA 4Y15A 2Q8KA 2PBIA 4RAZA 3F23A 3TDUC 3W6JB 2ZKZA 2ZJ2A 3ECHA 3GFJA 4M71A 1HKSA 3WTXC 5LRSA 1I27A 1YIOA 3CLOA 1V3FA 4G7OF 3GFLA 3KLNA 1YFHA 1ZN2A 5ERIA 4KN4X 4XLNF 1MJAA 3FZVA 2Z33A 5E17F 4XSXF 5CYVA 3TOBA 2QVOA 2GQQA 3MZHA 3RPQA 3VEPA 1T98A 1IN8A 4G6DA 1K79A 5L3CA 4F7ZA 2VBXA 3J81Z 1IF1A 1BOAA 4FHTA 2TDXA 2J5OA 4HBLA 3P9KA 4HV5A 4OINF 4AIKA 2XAHA 2DBBA 4RGRA 3W6KB 1S6LA 2ACJA 5ED4A 3KE2A 1ZRFA 2M30A 2PMHA 1P2FA 4Y17A 4OIRF 4EJOA 5LGTA 1OR7A 4A6DA 5HDNA 5AIQA 3HYIA 1TQIA 3V8JA 4XBFA 1IN5A 2L54A 2ESHA 2G7UA 4KMFA 2O61A 5DD4A 2G7HA 3FMQA 4QLCU 1U3EM 1PP8F 1Q1HA 4ESBA 3CO6C 2RGVA 4BQAA 2QQ9A 2VXZA 2EFQA 4G7HF 2UZKA 1KU7A 5CVRA 2QLZA 1UHMA 3ZMVA 3F8FA 1D3YA 1BJAA 3ZQ7A 5HS9A 3I64A 1BC7C 2ZNZA 5HDGA 2MD5A 3HUGA 2KKOA 3GX4X 1ZRCA 2F5DA 4M9XA 1QQIA 2HTJA 1TNSA 1HQCA 3U9GA 4HF2A 5H20A 3FX3A 5BOXA 3ERED 4G8XA 3CDHA 3FM5A 4RGXA 1HBXG 1MD0A 1SMYF 1FPQA 2JPBA 3R0AA 5ILSA 4EQQA 5JHUA 2EFWA 5ILVA 1QPMA 3BOQA 2JTVA 3M8EA 4A0ZA 1USSA 2VOOA 4B8XA 4MQ9F 2DQLA 1U6GA 2DK5A 1ULYA 1TW2A 2L4AA 2K4BA 2ADUA 5E18F 3R4KA 1MJBA 2VT2A 4IXAA 3O3KA 3KCCA 2K7LA 5HLIA 1SD6A 2E7WA 1PDNC 1S8NA 4UXNA 2XAQA 4YIFA 1FT9A 2E7XA 3R60A 1RUOA 3C18A 4WCGA 1FYMA 3MEXA 5FD6A 1ODDA 2HR3A 4P9UA 2Z9OA 3WGHA 3E6DA 2OD5A 2FBKA 3R6SA 2FU4A 1BIBA 2CQKA 3BWGA 1KGSA 2QZ8A 2DU9A 2ZNYA 2QBYB 1PUEE 3JW4A 3HRMA 4HX7A 2QQBA 1W5SA 2VBYA 4R1HA 2EA4A 1G3WA 1CGPA 2JSCA 1YYVA 4S04A 2ZMEB 3SZPA 4U0YA 3Q5FA 3S2WA 1UFMA 1XCBA 2M5WA 2H94A 3D5LA 4UNOA 1JHFA 2FMYA 4P5OA 5ICEA 1ZRDA 1ZLJA 5DCFA 5KVRA 1L3LA 3MQ0A 1GHCA 1B6AA 3JAMK 3EDPA 4U0WA 2PJPA 2D2WA 3GF2A 1XMAA 1R58A 4ZH4F 4UVCA 4IF4A 4EGZA 3F3XA 1KU9A 2IA2A 3WTTC 2L4MA 5ICGA 3GZ5A 3J80K 2A07F 4LG0A 4LLLA 1RZ4A 2AS5F 1KA8A 4MGRA 2FMLA 1ZYRF 1I5ZA 3WE3A 2F2EA 2CYYA 1V4RA 4I01A 4U7BA 4Q5SF 4IHSA 2FOKA 3VFZA 1GXPA 3F8NA 4L9VA 1MDMB 3IL2A 2XROA 3LFKA 3EQLF 5TRDA 4ENKA 2QWWA 1FLIA 2M8EA 1OMIA 4ZZLA 3E6CC 1Z9CA 3J81K 3KP6A 2ZBKA 1T2KA 4RGUA 2HWVA 4BAYA 1S3JA 4L5JA 3GVAA 2FNPA 3KETA 4FX4A 3T8TA 2PI0A 3FXQA 4LGWA 1IN7A 2D1VA 2XVCA 3WTSC 1WSUA 3O6BB 1W7PB 1RI7A 4EGYA 5K5RA 1ZGAA 1KQ8A 2FSWA 1HKTA 2ZCWA 1BI2A 3E97A 2HZTA 1J0RA 1KYWA 4YIIA 4AWXB 1XMKA 2DO7A 2PN6A 4WX9A 2GWRA 3GYHX 1XDSA 1K6OA 5DUKA 4A2UA 1USTA 2ZO4A 1FP2A 5L3FA 3N4MA 1IXCA 5AONA 4I0AA 3HHHA 2OZUA 4UV9A 3I59A 2XHKA 2MA3A 2F5EA 3CUQB 4RGSA 2VC1A 5L3EA 3HOSA 2RVCA 2FE3A 2IA0A 2DLLA 2VOPA 1IN6A 4N9IA 2P5KA 3BDDA 3IWZA 1Z1DA 3E5QA 2RQPA 3F8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3Z A;  3CUO A;  4MHG A;  2P6S A;  2HQN A;  4G6Q A;  5LHI A;  1D8J A;  4R79 A;  3BZ6 A;  3WTU C;  2GA2 A;  2YX7 A;  1KYZ A;  1Y0U A;  1HKQ A;  1U78 A;  1TQM A;  4HA8 A;  3K1M A;  5DCM A;  2VE8 A;  1J7K A;  3MCZ A;  2QM3 A;  1LEB A;  3ZN1 A;  2XAJ A;  1ZLK A;  4IRI A;  3COA C;  3L2C A;  3F22 A;  1F4K A;  1RIO H;  5KK1 A;  3H92 A;  1LNW A;  1DUX C;  2A5Y B;  1FP1 D;  4GCV A;  2STW A;  3E6B A;  4A6E A;  1R22 A;  2W85 A;  2OU2 A;  3V8K A;  5L3G A;  5J8F A;  4IHT A;  4A5M A;  2H6C A;  2CSO A;  2EB7 A;  4M74 A;  1GXQ A;  2VT3 A;  4NB5 A;  1REP C;  1ZRE A;  3KZZ A;  5K5O A;  3M8F A;  3JSO A;  4I0B A;  2K4J A;  2HTS A;  3MWM A;  1JXS A;  3M7G A;  4I2O A;  3BRO A;  1EH6 A;  3F6V A;  1GVJ A;  1H9T A;  2KJB A;  2PMU A;  1R5G A;  1O3T A;  1XSD A;  4ETS A;  2CGP A;  2WWY A;  5HVQ C;  3L00 A;  1STZ A;  2BGC A;  5LGN A;  3TQN A;  5BQT A;  3LST A;  2YR2 A;  2DPU A;  2GAU A;  2OQR A;  2W25 A;  1HW1 A;  1UHW A;  1Z7U A;  5E1W A;  4KFC A;  3HRU A;  2YX4 A;  4WK8 F;  2XRN A;  1RUN A;  1R36 A;  1G6N A;  2O0Y A;  2CFX A;  1QBJ A;  1TLH B;  2LSO A;  3OOP A;  4OU0 A;  4HF1 A;  3G73 A;  1XN7 A;  2BE5 F;  1FX7 A;  3WTY C;  3QRF F;  1G3T A;  2BV6 A;  4Q4Z F;  3WTZ A;  1FWZ A;  4ZYE A;  3KP7 A;  3KFW X;  2GA1 A;  4YFN F;  1YS7 A;  2P8T A;  4GXO A;  3EYY A;  1XSX A;  3C3W A;  3DPL C;  1XD7 A;  3RTR A;  1IRG A;  1FBU A;  3VB2 A;  3IKT A;  1R00 A;  4CZZ A;  2VON A;  4CIC A;  4IJA A;  2FBI A;  5BMZ A;  1G3Y A;  3DEU A;  3V7S A;  1ONV A;  1UCR A;  4BHC A;  4NHJ A;  1TTY A;  3SFZ A;  3I71 A;  2VE9 A;  5E1Z B;  3ZMD A;  2H27 A;  2DTR A;  2UXN A;  4HDV A;  5BPD A;  2PFB A;  5F6F A;  3U2R A;  3IC7 A;  2KIU A;  3QU3 A;  1IAW A;  2M87 A;  1FSE A;  5LRR A;  2VOD A;  1FYL A;  4OMY A;  1IW7 F;  3FWE A;  3J7A O;  3BPX A;  1SAX A;  2HKO A;  4ESF A;  3FMS A;  2NS0 A;  3O2P E;  3BJ6 A;  3GFI A;  2DAO A;  4EJV A;  4M73 A;  4NQW A;  2Z99 A;  3EYI A;  3F8M A;  4K2E A;  4WXH A;  1W5T A;  1L0O C;  2FEZ A;  1EH8 A;  3MAJ A;  3P7N A;  4I98 B;  5LGU A;  3RPU A;  2COM A;  2IPQ X;  5H6Q A;  2DFI A;  4BXU A;  3U1D A;  1P4X A;  2P5V A;  1WRJ A;  1SD5 A;  4KNY A;  2M45 A;  4G94 A;  2VC0 A;  3Q9S A;  2FF4 A;  3VOD A;  2CG4 A;  3SQN A;  1B4A A;  4RAY A;  5D4S A;  5D5U B;  3FXU A;  3NEU A;  1TW3 A;  1ZG1 A;  1B1B A;  4PZJ A;  3WOD F;  2VN2 A;  1S7O A;  2HDC A;  2UXX A;  4CDG A;  1IRF A;  3RKY A;  1K78 A;  4LFU A;  4KIF A;  1OPC A;  3IRR A;  5HS7 A;  4I09 A;  4BYY A;  2WTE A;  3T5X A;  1ZAR A;  4B09 A;  5J8C A;  5CVV A;  2GIV A;  1XGM A;  5K5Q A;  2P4W A;  2J5P A;  2YU3 A;  4ZYD A;  1WKM A;  1R7J A;  1O3Q A;  5DD8 A;  2XV4 S;  4XLP F;  2EV6 A;  5D6E A;  5FLX Z;  1LDD A;  4IVN A;  4JBA A;  1T39 A;  2IRF G;  3TOA A;  1SFX A;  4D0P A;  3B73 A;  5E8G A;  2CW0 F;  2MLK A;  2CWE A;  4MEY F;  1A04 A;  4HZF A;  1IN4 A;  2H09 A;  1SFU A;  1BC8 C;  4PGG A;  3T8R A;  1I1G A;  1O3S A;  5L3B A;  2LNB A;  2PLY A;  4LLG F;  3SHF A;  5CVI A;  2A3S A;  2YSR A;  2DT5 A;  3HHG A;  2GZW A;  1J75 A;  4HW0 A;  2V1X A;  1XB4 A;  4KIB A;  2MLG A;  3WE2 A;  1J9I A;  3GEZ A;  3ELK A;  1F5T A;  1E17 A;  2RC4 A;  3L9F A;  4HQM A;  4HX4 A;  1W7P D;  4EJW A;  4O5V A;  2P7C B;  4MEX F;  4CHU A;  4E70 A;  3HSF A;  5ILU A;  5DCM B;  4LB5 A;  4HYE A;  2RV8 A;  3RKX A;  3DQV C;  2WV0 A;  2RKH A;  1C0W A;  2BYV E;  1HW2 A;  2XKP A;  2DQR A;  4AIJ A;  2EK5 A;  1P6R A;  4LLN A;  2Z5U A;  5LEK A;  2OQG A;  3ZPL A;  3RI4 A;  3C1D A;  2XUB A;  2IA1 A;  4OIQ F;  1HW5 A;  1LJ9 A;  2B0L A;  4L0Y B;  3I4P A;  3TKY A;  3L7W A;  5LEJ A;  3PQK A;  1XGS A;  3LQR A;  2FNA A;  3JTH A;  2O6G E;  3PQJ A;  4EM1 A;  3GZ6 A;  3F6O A;  3KP2 A;  4CXF A;  4CGZ A;  4L9J A;  5IT3 A;  3HRS A;  2WC2 A;  1T0F A;  2EJR A;  5EEH A;  3F8B A;  3JTG A;  3IRQ A;  2MH2 A;  4HF0 A;  2HKX A;  3N97 A;  4KA4 A;  2F5C A;  1XGO A;  5DYM A;  2ELH A;  4KIG A;  3LAJ A;  1KQ9 A;  2QUF A;  1OYW A;  1O57 A;  3ZMU A;  1IZ1 A;  2IT0 A;  1U8R A;  1Z6T A;  1BN5 A;  4P96 A;  3RYP A;  1AWC A;  1ON1 A;  2K27 A;  1X3U A;  4OOI A;  4LK1 F;  4MNU A;  3E5U A;  4RB1 A;  3ECO A;  4Q47 A;  3TO7 A;  1TQP A;  3V4G A;  4G9Y A;  4RS8 A;  2EV0 A;  1MJ9 A;  4N9H A;  2XIG A;  5IT9 Z;  5D5X B;  4M6X A;  3NQO A;  3TO6 A;  2R7F A;  4DNC A;  4I7H A;  2V1D A;  3HOT A;  1QNT A;  1O7F A;  1JHH A;  4HAM A;  2W84 A;  2JPC A;  2V1U A;  2VBZ A;  4JK1 X;  1BI3 A;  5CVJ A;  1UB9 A;  4KDP A;  3ULQ B;  3DF8 A;  1DP7 P;  2X0L A;  2KIM A;  4HLY A;  3NRV A;  3SXY A;  3DV8 A;  3I5U A;  4HLX A;  1LEA A;  2C6Y A;  4P9F A;  4BHB A;  4MQV A;  4QWQ A;  2D45 A;  5D5V B;  2A61 A;  3P9I A;  3OV8 A;  1ON2 A;  2OZ6 A;  3L09 A;  5LHG A;  2DPD A;  4KUM A;  1CF7 A;  3B02 A;  2LF8 A;  1DPU A;  1K7A A;  1G4D A;  3M9A A;  4AIH A;  1XGN A;  4Q48 A;  1R1U A;  4A0X A;  1S7A A;  2O8X A;  2HQR A;  2L02 A;  4KN7 X;  4WXD A;  3FXR A;  3BPV A;  5JFR A;  5TJJ A;  4A5N A;  3MZY A;  4P55 A;  4U7D A;  3LQQ A;  5FLX K;  2Y48 A;  3ZMT A;  4MTE A;  2R7D A;  2NAZ A;  2HYF A;  3KLO A;  1LB2 A;  4XSZ F;  1HSJ A;  3DP7 A;  2STT A;  2CO5 A;  3T1B A;  4IRH A;  4WF2 A;  1G3S A;  1T38 A;  3AAF A;  2E1C A;  3E3V A;  4LJZ F;  3DXJ F;  4HQE A;  2EFP A;  2XAG A;  3IHU A;  1K78 B;  3GO5 A;  4L18 B;  5F1R A;  3FHZ A;  4DQ2 A;  3BJO A;  1MDM A;  4JQF A;  3F72 A;  1XDU A;  3K1P A;  5E20 A;  5FFX A;  1WWX A;  2OA4 A;  1YQA A;  4GYI A;  2K86 A;  4LMY A;  3FMR A;  3H3Z A;  4KIC A;  3I0T A;  2OBP A;  1U2W A;  5CVU A;  4ASN A;  5DEQ A;  1B9N A;  4KYW A;  3FF5 A;  3J80 Z;  1FY7 A;  1HXD A;  1U5T A;  1FZP B;  2X4H A;  4CO8 A;  1SD4 A;  1VTN C;  3H3U A;  3GXO A;  5DUI A;  4WWC A;  2JRT A;  1W7P A;  2LDU A;  4PCQ A;  3GFM A;  3CTA A;  2ESN A;  2GXB A;  1D5V A;  1SFE A;  4HOB A;  4UUV A;  3I58 A;  1MGT A;  2V79 A;  2XKO A;  4ENN A;  2O3F A;  4IRG A;  2A6H F;  1KQ0 A;  2V9V A;  1R1V A;  3F21 A;  4L5I A;  2A6E F;  3GW2 A;  5ICF A;  1AOY A;  3DFG A;  3WU1 B;  5HOO A;  3QP5 A;  2HYG D;  4U88 A;  3HIF A;  3CO7 C;  1ZAO A;  2FXA A;  3QPH A;  4FT8 A;  3ML6 A;  3Q9V A;  4OIO F;  2DK8 A;  1MZB A;  4A0Y A;  2W57 A;  3CUQ A;  4ENJ A;  4KMU X;  4M72 A;  2DI3 A;  1IXS B;  4LG0 B;  3RKW A;  4BHP A;  1LDK B;  5BS6 A;  2QEN A;  2IJL A;  3M1E A;  5FO5 A;  2MH9 A;  4EJU A;  3LAP A;  3K2Z A;  5EEG A;  4ESJ A;  1WI9 A;  3I53 A;  1R5H A;  2EFO A;  4EMS A;  4R8H A;  5FD5 A;  1J59 A;  1Z05 A;  4S05 A;  1FOK A;  4BH9 A;  4EV0 A;  4YFX F;  1H9G A;  2QYO A;  1HST A;  4O3M A;  3ROU A;  1F1Z A;  5A2Q Z;  2BBY A;  2NNN A;  2P5L C;  2HGC A;  1Z91 A;  1IXR C;  3LA3 A;  1BI1 A;  2L01 A;  5IT9 K;  4Y13 A;  2O03 A;  4AD9 A;  3ZMS A;  4A12 A;  4EJT A;  2A68 F;  3QAH A;  3KP3 A;  3K1N A;  1I6X A;  5FFZ A;  1ZGJ A;  1YLF A;  1SD7 A;  3WG9 A;  1QZZ A;  2FA5 A;  2KJC A;  2IVM A;  1P92 A;  2P7V B;  5K1Y A;  4LD5 A;  4AVP A;  4L0Z B;  2G9W A;  1BM9 A;  4EM2 A;  3DKW A;  1YW9 A;  5D8L B;  1FYK A;  3RJP A;  3MFK A;  4ZYH A;  1TBX A;  3GUD A;  2HEO A;  3EUH A;  1QZY A;  1XSV A;  3EET A;  1BBY A;  5ICC A;  2JZY A;  2RNJ A;  1WQ2 A;  2W24 A;  4ZZD A;  3C7J A;  2YPR A;  1J2X A;  5E1X A;  5DDG A;  3LA7 A;  2BEO A;  3R61 A;  3I59 B;  3K0L A;  2NYX A;  5FB2 A;  4TV7 A;  5DV5 A;  4U0V A;  3QOP A;  3BP8 A;  5HLG A;  3TO9 A;  1DDN A;  2Y0M A;  1S29 A;  1W4M A;  3GLX A;  3SZT A;  3WTW C;  2AXL A;  3K69 A;  1PP7 U;  3P9C A;  3DPT A;  4EVI A;  1ZHF A;  1YW7 A;  5E8I A;  4G7Z F;  1J5Y A;  4PDK A;  1R1T A;  1OYY A;  2PQ8 A;  3RYR A;  1IUY A;  3KEO A;  4M9Z A;  5HS8 A;  2XAF A;  4UV8 A;  1CF7 B;  2HFH A;  3IWF A;  5JVT A;  5L3D A;  1XCV A;  5D8K B;  2D1H A;  4UHT A;  3V8L A;  1Z6R A;  1LVA A;  4YFK F;  3HRT A;  3WGG A;  2DW4 A;  1OKR A;  2NRA C;  4M6Y A;  3QP6 A;  3ZMZ A;  1YG2 A;  2EFN A;  2E1N A;  3V7C A;  1U5T C;  1FBQ A;  4OIP F;  3ISP A;  2LF7 A;  5CLS A;  4H0E A;  4ZYG A;  5CJ9 A;  2NNY A;  4XRF A;  1P4A A;  3VOE A;  4CYD A;  1T6S A;  3HSE A;  1JGS A;  2M1B A;  1I1S A;  2KRF A;  2JT1 A;  5LBQ A;  1EH7 A;  1QGP A;  1TNT A;  4O6J A;  4MTD A;  4GYG A;  5D5W B;  4HX8 A;  3T0Y A;  1O3R A;  4YG2 F;  2QQA A;  3RIR A;  2ZFW A;  2MC3 A;  2ETH A;  3ZP5 A;  2EA2 A;  4BNC A;  2UWM A;  1MKM A;  2VBW A;  1U5T B;  1YW8 A;  3BJA A;  3KP4 A;  3CUQ C;  4UVB A;  1ZH5 A;  5D4R A;  4GO1 A;  3KEQ A;  4HV6 A;  4FX0 A;  4LB6 B;  2Z3Y A;  3V7R A;  2ISZ A;  4N0B A;  4RB3 C;  5BPI A;  4L9T A;  2ZXJ A;  5JR3 A;  2P6T A;  1DPR A;  2HS5 A;  1FBS A;  4HDU A;  1B9M A;  5FGM A;  2EV5 A;  3CJN A;  2KIF A;  2RDP A;  1LQ1 A;  3KZY A;  2XAS A;  3HTS B;  3LWF A;  1YTY A;  4I02 A;  2MBF A;  3TGN A;  3WU0 A;  5H6R A;  4IPA A;  1LDJ A;  1F9N A;  4PGH A;  5JI6 A;  5A2Q K;  1ZG3 A;  1OYI A;  1R23 A;  3ABU A;  3FM3 A;  1H0M A;  4Z2Y A;  5HDK A;  3KP5 A;  2QBY A;  3TDZ C;  5F64 A;  4WXC A;  2EWN A;  4OMZ A;  2ISY A;  2ZME A;  3QPT A;  1RNL A;  1KU2 A;  3JSP A;  1KU3 A;  1QO0 D;  1P4W A;  2GXG A;  4M9S A;  1D8K A;  2LKP A;  3K9T A;  3R0J A;  3HSR A;  1NHA A;  3LA2 A;  3ABT A;  1BIA A;  6PAX A;  4KT5 C;  3GWZ A;  1EV7 A;  2FBH A;  2HOE A;  1B59 A;  3REO A;  5HLH A;  3HTU A;  4L9N A;  1SMT A;  5D6F A;  2H6B A;  2IW5 A;  4LK0 F;  1YO5 C;  5LHH A;  2FQ3 A;  3E5X A;  2IP2 A;  1E2X A;  4RB0 A;  2PEX A;  2Q2E A;  2OAZ A;  3D0S A;  1FC3 A;  2A69 F;  1ZG5 A;  3ZN0 A;  4GGG A;  4ENM A;  3IKV A;  3PFI A;  1FSH A;  3WGI A;  3WTV C;  2F5F A;  2R3S A;  1YS6 A;  4RB2 C;  2K02 A;  4UVA A;  5AIP A;  2RN7 A;  4ON0 A;  5LLQ A;  2Q0O A;  3I54 A;  2L3D A;  3JAM Z;  1JE8 A;  1BI0 A;  3E6M A;  2XGX A;  5J6X A;  2PG4 A;  3BY6 A;  2V6C A;  4EM0 B;  2Y75 A;  1O7L A;  1FNN A;  2FRH A;  3QU6 A;  3RDI A;  4Y15 A;  2Q8K A;  2PBI A;  4RAZ A;  3F23 A;  3TDU C;  3W6J B;  2ZKZ A;  2ZJ2 A;  3ECH A;  3GFJ A;  4M71 A;  1HKS A;  3WTX C;  5LRS A;  1I27 A;  1YIO A;  3CLO A;  1V3F A;  4G7O F;  3GFL A;  3KLN A;  1YFH A;  1ZN2 A;  5ERI A;  4KN4 X;  4XLN F;  1MJA A;  3FZV A;  2Z33 A;  5E17 F;  4XSX F;  5CYV A;  3TOB A;  2QVO A;  2GQQ A;  3MZH A;  3RPQ A;  3VEP A;  1T98 A;  1IN8 A;  4G6D A;  1K79 A;  5L3C A;  4F7Z A;  2VBX A;  3J81 Z;  1IF1 A;  1BOA A;  4FHT A;  2TDX A;  2J5O A;  4HBL A;  3P9K A;  4HV5 A;  4OIN F;  4AIK A;  2XAH A;  2DBB A;  4RGR A;  3W6K B;  1S6L A;  2ACJ A;  5ED4 A;  3KE2 A;  1ZRF A;  2M30 A;  2PMH A;  1P2F A;  4Y17 A;  4OIR F;  4EJO A;  5LGT A;  1OR7 A;  4A6D A;  5HDN A;  5AIQ A;  3HYI A;  1TQI A;  3V8J A;  4XBF A;  1IN5 A;  2L54 A;  2ESH A;  2G7U A;  4KMF A;  2O61 A;  5DD4 A;  2G7H A;  3FMQ A;  4QLC U;  1U3E M;  1PP8 F;  1Q1H A;  4ESB A;  3CO6 C;  2RGV A;  4BQA A;  2QQ9 A;  2VXZ A;  2EFQ A;  4G7H F;  2UZK A;  1KU7 A;  5CVR A;  2QLZ A;  1UHM A;  3ZMV A;  3F8F A;  1D3Y A;  1BJA A;  3ZQ7 A;  5HS9 A;  3I64 A;  1BC7 C;  2ZNZ A;  5HDG A;  2MD5 A;  3HUG A;  2KKO A;  3GX4 X;  1ZRC A;  2F5D A;  4M9X A;  1QQI A;  2HTJ A;  1TNS A;  1HQC A;  3U9G A;  4HF2 A;  5H20 A;  3FX3 A;  5BOX A;  3ERE D;  4G8X A;  3CDH A;  3FM5 A;  4RGX A;  1HBX G;  1MD0 A;  1SMY F;  1FPQ A;  2JPB A;  3R0A A;  5ILS A;  4EQQ A;  5JHU A;  2EFW A;  5ILV A;  1QPM A;  3BOQ A;  2JTV A;  3M8E A;  4A0Z A;  1USS A;  2VOO A;  4B8X A;  4MQ9 F;  2DQL A;  1U6G A;  2DK5 A;  1ULY A;  1TW2 A;  2L4A A;  2K4B A;  2ADU A;  5E18 F;  3R4K A;  1MJB A;  2VT2 A;  4IXA A;  3O3K A;  3KCC A;  2K7L A;  5HLI A;  1SD6 A;  2E7W A;  1PDN C;  1S8N A;  4UXN A;  2XAQ A;  4YIF A;  1FT9 A;  2E7X A;  3R60 A;  1RUO A;  3C18 A;  4WCG A;  1FYM A;  3MEX A;  5FD6 A;  1ODD A;  2HR3 A;  4P9U A;  2Z9O A;  3WGH A;  3E6D A;  2OD5 A;  2FBK A;  3R6S A;  2FU4 A;  1BIB A;  2CQK A;  3BWG A;  1KGS A;  2QZ8 A;  2DU9 A;  2ZNY A;  2QBY B;  1PUE E;  3JW4 A;  3HRM A;  4HX7 A;  2QQB A;  1W5S A;  2VBY A;  4R1H A;  2EA4 A;  1G3W A;  1CGP A;  2JSC A;  1YYV A;  4S04 A;  2ZME B;  3SZP A;  4U0Y A;  3Q5F A;  3S2W A;  1UFM A;  1XCB A;  2M5W A;  2H94 A;  3D5L A;  4UNO A;  1JHF A;  2FMY A;  4P5O A;  5ICE A;  1ZRD A;  1ZLJ A;  5DCF A;  5KVR A;  1L3L A;  3MQ0 A;  1GHC A;  1B6A A;  3JAM K;  3EDP A;  4U0W A;  2PJP A;  2D2W A;  3GF2 A;  1XMA A;  1R58 A;  4ZH4 F;  4UVC A;  4IF4 A;  4EGZ A;  3F3X A;  1KU9 A;  2IA2 A;  3WTT C;  2L4M A;  5ICG A;  3GZ5 A;  3J80 K;  2A07 F;  4LG0 A;  4LLL A;  1RZ4 A;  2AS5 F;  1KA8 A;  4MGR A;  2FML A;  1ZYR F;  1I5Z A;  3WE3 A;  2F2E A;  2CYY A;  1V4R A;  4I01 A;  4U7B A;  4Q5S F;  4IHS A;  2FOK A;  3VFZ A;  1GXP A;  3F8N A;  4L9V A;  1MDM B;  3IL2 A;  2XRO A;  3LFK A;  3EQL F;  5TRD A;  4ENK A;  2QWW A;  1FLI A;  2M8E A;  1OMI A;  4ZZL A;  3E6C C;  1Z9C A;  3J81 K;  3KP6 A;  2ZBK A;  1T2K A;  4RGU A;  2HWV A;  4BAY A;  1S3J A;  4L5J A;  3GVA A;  2FNP A;  3KET A;  4FX4 A;  3T8T A;  2PI0 A;  3FXQ A;  4LGW A;  1IN7 A;  2D1V A;  2XVC A;  3WTS C;  1WSU A;  3O6B B;  1W7P B;  1RI7 A;  4EGY A;  5K5R A;  1ZGA A;  1KQ8 A;  2FSW A;  1HKT A;  2ZCW A;  1BI2 A;  3E97 A;  2HZT A;  1J0R A;  1KYW A;  4YII A;  4AWX B;  1XMK A;  2DO7 A;  2PN6 A;  4WX9 A;  2GWR A;  3GYH X;  1XDS A;  1K6O A;  5DUK A;  4A2U A;  1UST A;  2ZO4 A;  1FP2 A;  5L3F A;  3N4M A;  1IXC A;  5AON A;  4I0A A;  3HHH A;  2OZU A;  4UV9 A;  3I59 A;  2XHK A;  2MA3 A;  2F5E A;  3CUQ B;  4RGS A;  2VC1 A;  5L3E A;  3HOS A;  2RVC A;  2FE3 A;  2IA0 A;  2DLL A;  2VOP A;  1IN6 A;  4N9I A;  2P5K A;  3BDD A;  3IWZ A;  1Z1D A;  3E5Q A;  2RQP A;  3F8C A; 
#chains in the Genus database with same CATH topology
 5M5W J;  3G3Z A;  3BG7 A;  3CUO A;  4MHG A;  3CQZ J;  3S3M A;  2DOA A;  4BY7 J;  2P6S A;  2HQN A;  4G6Q A;  5LHI A;  1D8J A;  3CES A;  4R79 A;  3BZ6 A;  3WTU C;  1PUF A;  2DOF A;  2BY3 A;  2GA2 A;  3QWL A;  1WH5 A;  5IOY A;  4C9Y A;  2EIJ H;  2DOE A;  2YX7 A;  1KYZ A;  2LLK A;  2OJE D;  1Y0U A;  5JLW A;  5J4Y A;  1HKQ A;  3DTE A;  1TQM A;  1U78 A;  3O8G A;  4HA8 A;  3K1M A;  5DCM A;  1TP4 A;  2VE8 A;  3QQA A;  1J7K A;  3MCZ A;  2QM3 A;  1LEB A;  3ZN1 A;  2FQ4 A;  2XAJ A;  1ZLK A;  4IRI A;  3COA C;  4BJ6 C;  3L2C A;  5EYR A;  3F22 A;  1VQN I;  3SDB A;  1F4K A;  1SFK A;  5BNG A;  1RIO H;  3HUG B;  3BCA A;  5C44 J;  5KK1 A;  3H92 A;  1VQ9 I;  3DPU A;  1LNW A;  2VQG A;  1DUX C;  2A5Y B;  1IG7 A;  1FP1 D;  4GCV A;  5KAI C;  2STW A;  3E6B A;  4A6E A;  1R22 A;  2L9V A;  2NVT J;  2LYC A;  2W85 A;  2OU2 A;  3V8K A;  5L3G A;  5J8F A;  3B6A A;  4D7N A;  2GM4 A;  2L7K A;  4IHT A;  4A5M A;  3PM1 A;  3H9Q A;  2H6C A;  2CSO A;  2CJJ A;  2EB7 A;  4M74 A;  3CCL I;  1GXQ A;  2VT3 A;  4NB5 A;  4IX7 A;  1S72 I;  1REP C;  3K70 C;  3KZZ A;  1JKO C;  4S0H B;  1ZRE A;  5K5O A;  1ACI A;  3A01 A;  4RAG A;  4IOA F;  1WFX A;  3ZRG A;  1TWF J;  2NS7 A;  2CUE A;  3M8F A;  3LSI A;  3JSO A;  4I0B A;  2K4J A;  2COB A;  4RM2 A;  4M3B A;  2HTS A;  1WJB A;  3OYN A;  3MWM A;  3HGG A;  1JXS A;  3M7G A;  1QVU A;  4I2O A;  3BRO A;  1MSF C;  4RBO A;  1EH6 A;  1RC9 A;  5EGO B;  3F6V A;  1GVJ A;  1Z21 A;  1OJL A;  1LFP A;  2HZD A;  1H9T A;  2KJB A;  2PMU A;  1R5G A;  1O3T A;  1XSD A;  4ETS A;  2CGP A;  2ZXI A;  2WWY A;  3BZK A;  3HGY A;  5HVQ C;  4E7K A;  3L00 A;  1STZ A;  4MO7 A;  1TWA J;  2BGC A;  3RKQ A;  3TMO A;  2KDO A;  5LGN A;  3TQN A;  5BQT A;  4D9J A;  3OWT A;  2CQN A;  3LST A;  2HDW A;  2YR2 A;  2DPU A;  2GAU A;  2OQR A;  3OR2 C;  2HPI A;  2W25 A;  5GAH J;  1HW1 A;  4XR6 A;  1UHW A;  1Z7U A;  2VPL A;  2CQ7 A;  5E1W A;  3CMY A;  3HB9 A;  4KFC A;  3HRU A;  2YX4 A;  4WK8 F;  2XRN A;  1RUN A;  1OLT A;  1R36 A;  1G6N A;  2LFB A;  2O0Y A;  3ZQG A;  4DIQ A;  4DYQ A;  1Y39 A;  1FOX A;  2CFX A;  4DYC A;  1QBJ A;  4UUS A;  1TLH B;  2LSO A;  3W2V A;  3OOP A;  4OU0 A;  3QPS A;  4HF1 A;  3G73 A;  1T08 B;  1XN7 A;  4Z6Y A;  1BW5 A;  2BE5 F;  2WAF A;  2DCE A;  4XKV A;  1FX7 A;  1FJL A;  3CCE I;  5GAG J;  3WTY C;  3QRF F;  2M4G A;  3V42 A;  1G3T A;  2BV6 A;  4Q4Z F;  4U87 A;  2QF7 A;  2EZI A;  3WTZ A;  1FWZ A;  2ELK A;  4ZYE A;  3KP7 A;  3KFW X;  3J7Z I;  2GA1 A;  3A4C A;  4YFN F;  1YS7 A;  2CW7 A;  3LSG A;  2OV7 A;  3H5A A;  2P8T A;  2ME0 A;  4GXO A;  3EYY A;  1XSX A;  3C3W A;  3DPL C;  1XD7 A;  2ZB9 A;  4PSX A;  3RTR A;  1IRG A;  1FBU A;  1AKH B;  1RR7 A;  3VB2 A;  3KYL A;  3IKT A;  1R00 A;  4CZZ A;  2VON A;  4CIC A;  2K9M A;  2FBI A;  4IJA A;  5BMZ A;  1VQ5 I;  4HRI A;  1G3Y A;  1PYV A;  3DEU A;  3CC4 I;  3V7S A;  1ONV A;  2I10 A;  2VKD A;  2WAE A;  3S32 A;  2XC7 A;  1UCR A;  4BHC A;  4NHJ A;  2R5Y B;  1TTY A;  4PUS A;  3SFZ A;  3I71 A;  2VE9 A;  5E1Z B;  3ZMD A;  3PFY A;  4A3D J;  1X3W B;  3FXJ A;  2EQR A;  4M6V A;  3SEQ A;  3I55 I;  2H27 A;  2DTR A;  2A05 A;  2UXN A;  3FBN B;  4HDV A;  2LC2 A;  2DJN A;  3IAM 2;  1RES A;  3ONQ A;  5BPD A;  2PFB A;  2DFH A;  2KIQ A;  4D7M A;  5F6F A;  4C2T A;  4IOC F;  2JVG A;  3U2R A;  3IC7 A;  2KIU A;  3QU3 A;  2E2J J;  1IAW A;  2LY9 A;  3CCJ I;  2M87 A;  4HG2 A;  1FSE A;  1WVR A;  2MG4 A;  5LRR A;  2VOD A;  1FYL A;  1T0F C;  1BL0 A;  2V1N A;  2QSH X;  4OMY A;  1IW7 F;  2X6X A;  3LNQ A;  1IUF A;  3FWE A;  3J7A O;  1ERD A;  3BPX A;  2K85 A;  1SAX A;  1P7I A;  2A6T A;  2HKO A;  4ESF A;  3FMS A;  2NS0 A;  1MBH A;  3O2P E;  3BJ6 A;  3GFI A;  2DAO A;  2F5V A;  4EJV A;  3HOY J;  4M73 A;  4NQW A;  2Z99 A;  3EYI A;  3F8M A;  4K2E A;  2DOD A;  2NVQ J;  4BE0 A;  4WXH A;  1W5T A;  1SVL A;  2CU7 A;  2YUS A;  4QSH A;  1L0O C;  2FEZ A;  3PUF A;  1EH8 A;  3K2A A;  3MAJ A;  3P7N A;  4I98 B;  2KT0 A;  5LGU A;  3RPU A;  5J3L A;  4IQJ A;  2COM A;  1T8I A;  1G2H A;  2IPQ X;  5H6Q A;  2DFI A;  4F93 B;  3OYG A;  1N25 A;  1S5L C;  4BXU A;  3U1D A;  1P4X A;  2P5V A;  1WRJ A;  1H89 C;  3ZR8 X;  1SD5 A;  2X48 A;  4F92 B;  4KNY A;  2M45 A;  4G94 A;  2VC0 A;  2AO9 A;  3Q9S A;  2FF4 A;  3VOD A;  2CG4 A;  3CCM I;  1YHQ I;  3SQN A;  1B4A A;  1BR1 A;  4RAY A;  2VKH A;  5D4S A;  4A3M J;  3HJE A;  5D5U B;  2DDB A;  3FXU A;  3NEU A;  3ABM H;  1TW3 A;  4C2U A;  3JRG A;  1ZG1 A;  1B1B A;  2AXT C;  2CV2 A;  4PZJ A;  2GLO A;  1DQU A;  3WOD F;  2LY2 A;  4J01 A;  2VN2 A;  4YIR X;  1QA6 A;  1S7O A;  2HDC A;  3OYC A;  1FEX A;  2ZC2 A;  1WPK A;  1X4O A;  2UXX A;  4A3C J;  1Y1W J;  1IRX A;  4XLF A;  4CDG A;  3HOW J;  1IRF A;  4LG3 A;  3RKY A;  1ZGW A;  1K78 A;  4LFU A;  1OCP A;  2EPF A;  4UY8 I;  4A69 C;  4KIF A;  1OPC A;  4UB6 C;  3HDD A;  1UJ8 A;  2HOA A;  4BUP A;  4XID A;  5HS7 A;  4QIW N;  4D1Q A;  3IRR A;  4I09 A;  3I3L A;  4BYY A;  2OTJ I;  4C30 A;  1TZL A;  2M0M A;  2WTE A;  3T5X A;  3DBR B;  3PIP F;  1ZAR A;  2VI6 A;  4B09 A;  5J8C A;  5CVV A;  1ORK A;  2GIV A;  1XGM A;  2R93 J;  2BY0 A;  5K5Q A;  2P4W A;  2WY7 Q;  2J5P A;  3WHB A;  2YU3 A;  4ZYD A;  1WKM A;  1R7J A;  1O3Q A;  5DD8 A;  4QTR A;  2VAS A;  2XV4 S;  2EV6 A;  5D6E A;  5FLX Z;  4XLP F;  4M3E A;  3VPR A;  1LDD A;  4IVN A;  2F4M B;  4JBA A;  1T39 A;  2DT7 B;  2IRF G;  3VDX A;  3E0J B;  3P5J A;  3TOA A;  3CCR I;  1SFX A;  2IS6 A;  1ETX A;  4D0P A;  1OFC X;  2KFD A;  3B73 A;  5E8G A;  2CW0 F;  3M8J A;  2MLK A;  2CWE A;  4MEY F;  4A3I J;  1A04 A;  3A02 A;  4HZF A;  4KT6 A;  1IN4 A;  2V26 A;  3AFH A;  2H09 A;  1VQM I;  1SFU A;  1BC8 C;  2KZG A;  3LFU A;  3IP4 B;  4PGG A;  3T8R A;  3S2D J;  1I1G A;  1O3S A;  5L3B A;  4BDZ A;  2LNB A;  2ZSH B;  4PSW A;  2PLY A;  2IGM A;  3GCM A;  3HOU J;  4LLG F;  1R4M B;  1MH3 A;  3SHF A;  3AG3 H;  3LL7 A;  2DMQ A;  5CVI A;  2A3S A;  2Y0S N;  4DOZ A;  2YSR A;  2DT5 A;  3HHG A;  5FRM A;  3SDG A;  2GZW A;  1J75 A;  4A93 J;  1K61 A;  2JWT A;  3HKZ A;  4HW0 A;  4I6Z A;  2V1X A;  1XB4 A;  2DA2 A;  3IH4 A;  4KIB A;  4NC7 A;  2MLG A;  3WE2 A;  1J9I A;  3GEZ A;  2VQL A;  3ELK A;  3TP0 A;  4JOM A;  1F5T A;  1E17 A;  2RC4 A;  2R7U A;  3L9F A;  5M5X J;  4HQM A;  3MKY B;  4HX4 A;  1W7P D;  2EIM H;  3OYK A;  3B6C A;  3ESW B;  5EJC A;  1P7J A;  1H88 C;  4EJW A;  4GDF A;  4O5V A;  2P7C B;  3DLL F;  4MEX F;  4CHU A;  4E70 A;  3L2W A;  3HSF A;  5E3M A;  5ILU A;  5DCM B;  4LB5 A;  2CH0 A;  5FKK A;  2W00 A;  1VQ7 I;  4HYE A;  1E3H A;  3BG9 A;  2JA7 J;  2RV8 A;  3RKX A;  2ZFU A;  3K7A J;  1IO2 A;  3DQV C;  2H8W A;  2L9S A;  5J47 A;  2Q2E B;  3UKG A;  2WV0 A;  2RKH A;  4XQF A;  1C0W A;  2K3P A;  2BYV E;  1HW2 A;  1YRN A;  2XKP A;  2HVR A;  2DQR A;  3OL3 A;  1VQ8 I;  4AIJ A;  1CQT A;  1TWG J;  2BY1 A;  4B43 A;  3ASO H;  2EK5 A;  3Q3S A;  1RKT A;  1FIA A;  3K4L A;  2IAI A;  2FUG 2;  1P6R A;  5TGT A;  1R4N B;  4D5F A;  1YIJ I;  4LLN A;  2UV1 A;  2X9D A;  1HF0 A;  1YJN I;  2Z5U A;  4HNT A;  3VWB A;  3OOU A;  5LEK A;  2QGU A;  2IXS A;  2OQG A;  3ZPL A;  1I3Q J;  3A01 B;  1IV8 A;  1M1E B;  3RI4 A;  3C1D A;  3PNT A;  2BHZ A;  2ID3 A;  2XUB A;  5J1Y A;  2JRM A;  4EAT A;  1HC8 A;  2IA1 A;  2DDA A;  3SYT A;  4OIQ F;  4I99 C;  3M1C A;  2MC4 A;  3ZQH A;  1HW5 A;  1LJ9 A;  2B0L A;  3BTI A;  2KRC A;  3KPH A;  3I4P A;  5IY5 H;  4L0Y B;  3TKY A;  5M3M J;  3L7W A;  3S3O A;  5LEJ A;  3PQK A;  1XGS A;  3LQR A;  2FNA A;  2K9N A;  2ECC A;  3JTH A;  2O6G E;  3PO3 J;  3PQJ A;  3OSF A;  4EM1 A;  5FKM A;  3GZ6 A;  1K83 J;  3F6O A;  3KP2 A;  5B5E C;  4CXF A;  4CGZ A;  1LKX A;  1MND A;  4L9J A;  5IT3 A;  3BG5 A;  3N05 A;  3CJT B;  5DM7 F;  2VIX A;  3HRS A;  2MYS A;  2WC2 A;  1T0F A;  2NOG A;  4H4K C;  2ZJQ F;  2EJR A;  2BOL A;  5EEH A;  3F8B A;  3JTG A;  3IRQ A;  4XK4 A;  2MH2 A;  1WJE A;  3K4J A;  4HF0 A;  2HKX A;  3JCU C;  2YS9 A;  5FLV A;  2NXN B;  3MVP A;  3N97 A;  3ZQF A;  1S9H A;  2DA4 A;  4KA4 A;  1FTZ A;  2F5C A;  4CUG A;  1XGO A;  5DYM A;  2ELH A;  4KIG A;  3MN2 A;  3LAJ A;  1KQ9 A;  2QUF A;  2K40 A;  2VJ5 A;  3M4O J;  1OYW A;  1O57 A;  3ZMU A;  4UUS B;  4IZZ A;  1IZ1 A;  2IT0 A;  1U8R A;  4IQ4 A;  2EZK A;  4QPQ A;  1Z6T A;  1BN5 A;  3LSM A;  2WA0 A;  4P96 A;  3RYP A;  1ZR2 A;  1AWC A;  2M7B A;  1ON1 A;  1JUS A;  2K27 A;  1X3U A;  4OOI A;  2LKS A;  4LK1 F;  5J40 A;  2A5W A;  4MNU A;  3E5U A;  4RB1 A;  2L0K A;  3ECO A;  2HQ5 A;  3OYL A;  4Q47 A;  1JT0 A;  1UAA A;  4AUX A;  1B72 A;  3TO7 A;  3FBI B;  1TQP A;  3PSI A;  3V4G A;  2H1L A;  4G9Y A;  5B1B H;  4RS8 A;  2P81 A;  2N8G A;  2EV0 A;  1MJ9 A;  1EJ9 A;  4N9H A;  2XIG A;  4D5C A;  1MNE A;  5IT9 Z;  5D5X B;  3S14 J;  4M6X A;  1Y1V J;  3GBG A;  1W5C C;  2R7F A;  3NQO A;  5F27 A;  3TO6 A;  4DNC A;  3BG6 A;  2ID6 A;  4I7H A;  2V1D A;  3HOT A;  1QNT A;  1O7F A;  3W6V A;  1JHH A;  4HAM A;  3OS1 A;  2W84 A;  4IHY A;  2JPC A;  4FET A;  2V4J C;  3K4C A;  2V1U A;  2VBZ A;  4JK1 X;  1DGW Y;  1NG7 A;  4A3J J;  1BI3 A;  3ZQC A;  2DA7 A;  1FOY A;  3G1L A;  1XX5 A;  5CVJ A;  4FAS D;  1UB9 A;  2L5Q A;  1I3A A;  1HOM A;  1TT5 B;  4ANJ A;  1K4S A;  4KDP A;  1OCR H;  4B3X A;  1G8X A;  3ULQ B;  4BXF A;  3DF8 A;  2X85 A;  2DTZ A;  1DP7 P;  4ABZ A;  1W36 C;  4B1R A;  4BQN A;  5HNH A;  2X0L A;  4IL6 C;  2KHM A;  2IGO A;  2KIM A;  4HLY A;  3CCY A;  3NRV A;  2K3F A;  3SXY A;  3DV8 A;  3I5U A;  3GTM J;  4BBS J;  5B66 C;  3S15 J;  2QA4 I;  3OS0 A;  5GTI C;  2JSP A;  3AG4 H;  2ME6 A;  3JRA A;  3PNV A;  4HLX A;  1LEA A;  3GLL A;  2ZSI B;  4E7H A;  3TED A;  1X1P A;  3D5R C;  2C6Y A;  4P9F A;  1D0Y A;  4BHB A;  5FJ8 J;  4MQV A;  1QVT A;  4QWQ A;  4CA0 A;  2D45 A;  5D5V B;  2A61 A;  3P9I A;  5F04 A;  3OV8 A;  1JUM A;  4Y33 A;  2WV1 A;  1ON2 A;  2OZ6 A;  3L09 A;  5LHG A;  2DPD A;  4KUM A;  1CF7 A;  3B02 A;  2LF8 A;  3ZCO A;  4OAY A;  1DPU A;  1K7A A;  1G4D A;  1ENH A;  1OCC H;  3CJR B;  4NQW B;  1MMN A;  2NOJ B;  2KMU A;  3M9A A;  4AIH A;  1XGN A;  4RLF A;  2PMZ N;  4Q48 A;  1R1U A;  3CP8 A;  3OYE A;  1K6Y A;  1PVE A;  1VF9 A;  4A0X A;  3JR9 A;  1S7A A;  2O8X A;  1QPI A;  2HQR A;  3LOC A;  4ZTJ A;  2L02 A;  3ZOB A;  4KN7 X;  4BEH A;  4WXD A;  3FXR A;  3BPV A;  3OYM A;  3G4S I;  3C2B A;  5JFR A;  5TJJ A;  4A5N A;  3MZY A;  4NDL A;  4P55 A;  2E1O A;  4U7D A;  1LE8 B;  3AL0 C;  3LQQ A;  2F4I A;  5FLX K;  2Y48 A;  3ZMT A;  3MKW B;  4GRI A;  4MTE A;  3CJQ B;  2R7D A;  2NAZ A;  1WJF A;  4LIU A;  5TIS C;  4ZJZ A;  2HYF A;  4M3D A;  1G59 A;  3KLO A;  1LB2 A;  4XSZ F;  3QPL A;  4W1U A;  1HSJ A;  3GTP J;  3DP7 A;  4N4O B;  1IGN A;  3L1P A;  2CO5 A;  2Y31 A;  2STT A;  2NVY J;  4PJL A;  3T1B A;  4IRH A;  4WF2 A;  1G3S A;  1VQP I;  1HA8 A;  1UG0 A;  1T38 A;  3AAF A;  4BBR J;  2E1C A;  4A3E J;  3E3V A;  4LJZ F;  3DXJ F;  3ZQI A;  4HQE A;  2EFP A;  1YX3 A;  4BE2 A;  2XAG A;  4RM3 A;  3IHU A;  2CV1 A;  1K78 B;  3GO5 A;  2WY8 Q;  2X1C A;  4L18 B;  1QZE A;  4XLC A;  5F1R A;  1POG A;  2X6W A;  3FHZ A;  4DQ2 A;  4IHW A;  3BJO A;  1A35 A;  1MDM A;  4JQF A;  3F72 A;  1XDU A;  1OCO H;  3K1P A;  5E20 A;  2Z16 A;  5FFX A;  2IBD A;  4YEL A;  1WWX A;  1MMS A;  2OA4 A;  1YQA A;  2XPU A;  2K86 A;  2K9Q A;  4GYI A;  4LMY A;  1ZQ3 P;  2Y69 H;  3FMR A;  1MH4 A;  5F08 A;  1SAN A;  2CUF A;  3H3Z A;  2QCO A;  4KIC A;  3I0T A;  4ZC3 A;  1YJ9 I;  1Z7L A;  3L2Q A;  1BW6 A;  2RAE A;  3HEF A;  2E71 A;  2HYJ A;  3KX2 A;  5GPC A;  1VND A;  2OBP A;  4CYC B;  2VJJ A;  1U2W A;  5CVU A;  3HL2 A;  4IO9 F;  1D1B A;  4ASN A;  5DEQ A;  2HOT A;  1B9N A;  4KYW A;  3PIO F;  3FF5 A;  3QYB A;  3J80 Z;  1DGR M;  1FY7 A;  1HXD A;  1WZ2 A;  1U5T A;  3BR6 A;  1MW7 A;  1ETV A;  2VQC A;  5JVG F;  4MFD A;  1FZP B;  2X4H A;  4CO8 A;  3BR1 A;  2L9N A;  1SD4 A;  1VTN C;  3H3U A;  3GXO A;  5DUI A;  2G0E A;  2K5C A;  4WWC A;  2OF7 A;  2JRT A;  5FRO A;  1HDP A;  4MLO A;  1W7P A;  2LDU A;  4PCQ A;  3GFM A;  4AVZ A;  3CTA A;  2BW3 B;  4E4H A;  1XS9 A;  2ESN A;  1JTY A;  1SVO A;  3E1S A;  2GXB A;  4LOC A;  3WHC A;  1D5V A;  1SFE A;  1X1B A;  4HOB A;  4HEA 2;  4UUV A;  3I58 A;  1MGT A;  5E3O A;  4ZDP A;  2V79 A;  2XKO A;  3BZC A;  4ENN A;  2O3F A;  2M9H A;  4IRG A;  2A6H F;  1KQ0 A;  2V9V A;  1R1V A;  3F21 A;  4L5I A;  2LRE A;  3PJR A;  3S1N J;  3VYR B;  4BS9 A;  2A6E F;  5CQG A;  3GW2 A;  5ICF A;  2E1M C;  3H36 A;  1AOY A;  2EZL A;  1V5E A;  3DFG A;  3WU1 B;  1GV2 A;  5HOO A;  2BVL A;  1U8B A;  2XDV A;  3CD6 I;  3QP5 A;  2HYG D;  4U88 A;  3HIF A;  4XRM A;  3CO7 C;  1ZAO A;  5IPA A;  2FXA A;  3QPH A;  4FT8 A;  2CV0 A;  3ML6 A;  1ETQ A;  5EF6 A;  3Q9V A;  3PNY A;  2GXA A;  2HVS A;  4OIO F;  1UHS A;  2DK8 A;  5FKO A;  4CCN A;  4X6A J;  1MZB A;  3A0B C;  4A0Y A;  3CP2 A;  2W57 A;  3U21 A;  3CUQ A;  3UNG C;  2L2O A;  3BR0 A;  1GLN A;  1ZR4 A;  1NK2 P;  4LIT A;  4ENJ A;  2CUZ A;  4KMU X;  4UUT A;  1ETK A;  4M72 A;  4Y3O A;  2BXY A;  1XG1 A;  3IV5 A;  2DI3 A;  1IXS B;  2HDD A;  4LG0 B;  3RKW A;  5LD2 C;  4BHP A;  1LDK B;  3KIO A;  5IYB J;  1I6H J;  4N4N B;  4KIT B;  5BS6 A;  3QOE A;  2QEN A;  2PJR B;  2IJL A;  1D0X A;  1T33 A;  3M1E A;  2Y2Z A;  1YRN B;  5FO5 A;  2MH9 A;  3LSJ A;  4B44 A;  4EJU A;  2JN6 A;  2M7A A;  3LAP A;  3K2Z A;  5EEG A;  4ESJ A;  2R7V A;  2W4S A;  1RR8 C;  3OMY A;  1WI9 A;  3I53 A;  1R5H A;  2EFO A;  1U9N A;  4XL9 A;  1LFU P;  4EMS A;  4R8H A;  5FD5 A;  1W0T A;  3CDL A;  4JX6 A;  3GTQ J;  1J59 A;  1Z05 A;  3MZ8 A;  5DTD A;  1T95 A;  4S05 A;  1FOK A;  4BH9 A;  2LMD A;  4EV0 A;  3ZQQ A;  1MBE A;  4KJZ A;  4YFX F;  5C3E J;  1D1A A;  2QKL B;  1H9G A;  3ZGK A;  2QYO A;  1HST A;  1OCT C;  3ROU A;  4O3M A;  1F1Z A;  5A2Q Z;  2JUG A;  4F91 B;  2LY1 A;  5J1R A;  2PX9 A;  2BBY A;  2NNN A;  2EH3 A;  2P5L C;  2HGC A;  1Z91 A;  4DJA A;  2DJI A;  4BDY A;  4PJ0 C;  1MSE C;  1IXR C;  2F4O B;  1S7E A;  4FQG A;  2HXI A;  4PFO A;  3LA3 A;  1BI1 A;  2L01 A;  5IT9 K;  2JK3 A;  2IS4 A;  2WB1 N;  4Y13 A;  2O03 A;  3H5N A;  4AD9 A;  1FOW A;  3S8P A;  3ZMS A;  4A12 A;  4EJT A;  2R7Z J;  3QOD A;  2A68 F;  3H0G J;  3QAH A;  1P9Q C;  3KP3 A;  4QPO A;  1XPX A;  3BQY A;  2GBY A;  3K1N A;  1I6X A;  2WBM A;  5FFZ A;  1VFC A;  1ZGJ A;  1YLF A;  2JA6 J;  4M3G A;  4Y4R A;  1SD7 A;  4ZDO A;  3CCS I;  1XMX A;  1YX5 A;  4C3H J;  3WG9 A;  4YRV A;  1QZZ A;  2FA5 A;  2KJC A;  1WCM J;  2IVM A;  4C2M J;  1P92 A;  2P7V B;  2LP0 A;  3ABK H;  5K1Y A;  3HOZ J;  3OIO A;  4LD5 A;  1T56 A;  3F0C A;  3I4M J;  4BAC A;  3G2B A;  3JRB A;  4ZYA A;  4AVP A;  4L0Z B;  2G9W A;  4RLQ A;  5KAF C;  1BM9 A;  2XAU A;  2OTL I;  2DFF A;  2HXO A;  3LSH A;  4EM2 A;  2KL4 A;  3GTO J;  3DKW A;  1ZEL A;  1SEU A;  1B72 B;  4JX4 A;  1YW9 A;  2ZME C;  2LKX A;  1D1C A;  5D8L B;  1FYK A;  1SC7 A;  3RJP A;  3MFK A;  3KYD B;  4ZYH A;  1TBX A;  3DU5 A;  1AHD P;  3GUD A;  2HEO A;  3EUH A;  1QZY A;  2GIZ A;  1QU3 A;  3PL8 A;  2TCT A;  1XSV A;  3EET A;  1BBY A;  5ICC A;  5JLX A;  2JZY A;  1VQ4 I;  2RNJ A;  5M5Y J;  2RNG A;  1WQ2 A;  2W24 A;  2E34 A;  3VSL A;  1X4P A;  3HPG A;  4ZZD A;  3C7J A;  2X1E A;  3U1K A;  2KQR A;  2EIL H;  2YPR A;  1J2X A;  3FXK A;  4HSR A;  3EUK L;  4BXX J;  2W82 A;  3TP3 A;  1K4T A;  5E1X A;  5DDG A;  1MMA A;  2DYS H;  3LA7 A;  1R49 A;  2BEO A;  3EUA A;  3I59 B;  3K0L A;  3R61 A;  2NYX A;  2D5V A;  2E5N A;  5FB2 A;  2HU9 A;  2RRE A;  1Y0N A;  4TV7 A;  4U0V A;  5DV5 A;  5CQE A;  3QOP A;  3BP8 A;  5HLG A;  4PJN A;  1UG2 A;  3TO9 A;  1R5I D;  2I5U A;  2Y0M A;  1DDN A;  1S29 A;  1VI0 A;  1W4M A;  3GLX A;  2GOX B;  4V2G A;  3SZT A;  3WTW C;  3OYD A;  1DP3 A;  1KON A;  2AXL A;  3K69 A;  2XB0 X;  1PP7 U;  3P9C A;  3DPT A;  3S16 J;  4EVI A;  3ZXS A;  2KP6 A;  5M3F J;  5DS9 A;  1ZHF A;  2K9L A;  1Q1V A;  1E3P A;  1YW7 A;  3PO2 J;  5E8I A;  4G7Z F;  2IGN A;  1J5Y A;  3OYH A;  4PDK A;  1R1T A;  1OYY A;  2PQ8 A;  3RYR A;  1IUY A;  3HC7 A;  3KEO A;  4M9Z A;  3RCO A;  1A6I A;  1TWC J;  1PUF B;  4XKW A;  2XAF A;  5HS8 A;  4UV8 A;  1CF7 B;  1YI2 I;  1FTT A;  2HFH A;  3IWF A;  5JVT A;  5L3D A;  1XCV A;  5D8K B;  1ETO A;  2W1O A;  2YU9 J;  3JRE A;  3S93 A;  2D1H A;  4UHT A;  3V8L A;  1Z6R A;  1LVA A;  4YFK F;  3HRT A;  3WGG A;  1X1C A;  1VQK I;  3FK6 A;  4HST A;  2DW4 A;  1OKR A;  2M0C A;  3WG7 H;  4XLA A;  2V6E A;  3CME I;  2NRA C;  4M6Y A;  3QP6 A;  3VYT B;  1XC5 A;  2JVH A;  2WAQ N;  3ASN H;  1MIJ A;  3CZ6 A;  3ZMZ A;  2B9S A;  1VQ6 I;  3BC8 A;  4BQO A;  2MAB A;  1YG2 A;  4AYB N;  2EFN A;  4F55 A;  5EG0 A;  2IS2 A;  1VQL I;  2E1N A;  3V7C A;  1U5T C;  1MBF A;  3OIQ A;  1FBQ A;  4OIP F;  2X1D A;  3ISP A;  1QRY A;  2FD5 A;  2EZH A;  5FLM J;  2NVX J;  4P1W A;  4FTH A;  3DBH B;  2LF7 A;  2VXD A;  4A3K J;  5IP6 A;  1NK3 P;  3JRF A;  5CLS A;  4H0E A;  3CCV I;  5F1J A;  4ZYG A;  5CJ9 A;  3JRC A;  2H8R A;  1A31 A;  2NS8 A;  4B48 A;  2NNY A;  1JJ6 C;  4XRF A;  3NWS A;  2E2H J;  1P4A A;  3TW7 A;  3VOE A;  4CYD A;  2DN0 A;  3OR1 C;  5F0H A;  5K7F A;  5K7H A;  1T6S A;  4AC0 A;  3HSE A;  4DBR A;  2M4K A;  2LK2 A;  1UZC A;  1JGS A;  2M1B A;  4XMY A;  1I1S A;  2KRF A;  1FMV A;  2W7N A;  2JT1 A;  2LOO A;  5LBQ A;  1EH7 A;  3BT9 A;  3DTK A;  3H3V K;  1QGP A;  1TNT A;  2OCE A;  4O6J A;  4MTD A;  4BY1 J;  4GYG A;  5D5W B;  3SEZ A;  2QSF X;  4HX8 A;  3C2H A;  2VQH A;  3T0Y A;  5B1A H;  3CC7 I;  2VUM J;  4MIM A;  1MNM C;  1I50 J;  2XF7 A;  1O3R A;  3BLY A;  4YG2 F;  2L7F P;  5E3N A;  3S17 J;  2QQA A;  3RIR A;  2ZFW A;  5C4X J;  1GUU A;  2MC3 A;  2ETH A;  3ZP5 A;  1X2M A;  2EA2 A;  4BNC A;  2UWM A;  4PFP A;  4RAF A;  3K4B A;  3FXL A;  1MKM A;  2VBW A;  3ABL H;  1RKW A;  3CMA I;  2JA8 J;  2VB6 A;  3RPU D;  1R6R A;  1U5T B;  1YW8 A;  2CMP A;  1BOB A;  3BJA A;  3KP4 A;  5DM6 F;  3CUQ C;  5HNF A;  1MBG A;  4UVB A;  2OCC H;  2TRT A;  1ZH5 A;  4BQQ A;  3Q0W A;  4F52 A;  5D4R A;  4GO1 A;  2R5Z A;  3KEQ A;  3MMY B;  4FX0 A;  4HV6 A;  4LB6 B;  2Z3Y A;  3V7R A;  2ISZ A;  2Z1D A;  4N0B A;  4RB3 C;  5BPI A;  2X51 A;  3CDI A;  1OR7 C;  4L9T A;  1O4X A;  4G12 A;  3L2V A;  2ZXJ A;  5JR3 A;  3SZG A;  2P6T A;  2R7W A;  4XLE A;  1DPR A;  5LFA A;  2HS5 A;  1FBS A;  4XLH A;  4HDU A;  2DYR H;  3A2K A;  1B9M A;  5FGM A;  2EV5 A;  3CJN A;  2Z2S B;  2KIF A;  2RDP A;  1JUP A;  1XTA A;  4XOT A;  1LQ1 A;  4KIS A;  3KZY A;  2XAS A;  3HTS B;  3LWF A;  1Y8R B;  1ITY A;  1YTY A;  4I02 A;  5C4J J;  3OL4 A;  2MBF A;  4E7J A;  2DXI A;  4NUB A;  3GME A;  3TGN A;  2DA1 A;  2VJI A;  3WU0 A;  5H6R A;  2R7O A;  4IPA A;  9ANT A;  1LDJ A;  2O9L A;  1F9N A;  2E2I J;  1Z77 A;  1I39 A;  4PGH A;  2OPT A;  5JI6 A;  1IJW C;  3FKI J;  5A2Q K;  1IDY A;  1ZG3 A;  1OYI A;  1ZKG A;  3FHN A;  1R23 A;  3ABU A;  3FM3 A;  5IP9 J;  3KZI C;  2CUJ A;  1H0M A;  2W48 A;  4Z2Y A;  5HDK A;  2ICW G;  2XF6 A;  2ELJ A;  3KP5 A;  2QBY A;  3A0H C;  4V2F A;  2JA5 J;  3TDZ C;  5F64 A;  3NWT A;  4WXC A;  3TW6 A;  4HNU A;  2M34 A;  5EZG A;  3QYF A;  2CRG A;  2O7O A;  2EWN A;  4E6K G;  4HPQ A;  5KNL A;  3GTL J;  4OMZ A;  2ISY A;  4E7Z A;  4DZJ A;  4V19 K;  2ZME A;  3QPT A;  1RNL A;  1KU2 A;  3JSP A;  1KU3 A;  1QO0 D;  1P4W A;  3BCB A;  4BJT A;  1F36 A;  1X2N A;  2GXG A;  4M9S A;  3S1M J;  1D8K A;  2LKP A;  2R7S A;  1OQY A;  3TBI A;  3DBL B;  3K9T A;  3R0J A;  3HSR A;  3K70 D;  1NHA A;  3LA2 A;  3ABT A;  1BIA A;  2OC6 A;  6PAX A;  4KT5 C;  2KLO A;  4XIC A;  1WJC A;  3GWZ A;  1EV7 A;  2FBH A;  2R92 J;  3EUH C;  2HOE A;  1B59 A;  2KZV A;  1YOV B;  3REO A;  5HLH A;  3A1Y A;  3HTU A;  4L9N A;  1SMT A;  4X0G A;  5D6F A;  2H6B A;  2IW5 A;  4LK0 F;  3LSR A;  1YO5 C;  5LHH A;  3DLA A;  2FQ3 A;  3E5X A;  2IP2 A;  1E2X A;  4W97 A;  4RB0 A;  2PEX A;  3G71 I;  2Q2E A;  2OAZ A;  3D0S A;  1FC3 A;  2A69 F;  2X6Y A;  1ZG5 A;  2DMT A;  3FIW A;  3ZN0 A;  1JGG A;  4GGG A;  4ENM A;  4XNF A;  4Y7N J;  1UEL B;  3IKV A;  4PJM A;  3PFI A;  3HBL A;  2Y0S A;  1FSH A;  3WGI A;  1YJW I;  3WTV C;  2F5F A;  2R3S A;  2E5Z A;  5IOZ A;  1WJ5 A;  3S3N A;  1YS6 A;  1X19 A;  4RB2 C;  2K02 A;  3HKZ N;  4UVA A;  2XPV A;  5AIP A;  2RN7 A;  4ON0 A;  3VYS B;  5LLQ A;  2Q0O A;  1N78 A;  3VYU B;  3E7L A;  1IC8 A;  3I54 A;  2XB5 A;  1GVD A;  2L3D A;  3FDY A;  3JAM Z;  5J4V A;  2LBF A;  1YE9 A;  4NNJ A;  1FIP A;  4FIS A;  1JE8 A;  1BI0 A;  3E6M A;  2XGX A;  5J6X A;  2F6C A;  2JA2 A;  2PG4 A;  3BY6 A;  1GV5 A;  1LVK A;  2OUM A;  2FX0 A;  1V55 H;  1H8A C;  3W3C A;  2V6C A;  4EM0 B;  4DW6 A;  1IV6 A;  2Y75 A;  1O7L A;  1FNN A;  2FRH A;  2XGE A;  4RDU A;  3QU6 A;  1HLV A;  5GAD J;  3RDI A;  4Y15 A;  3H9J A;  2Q8K A;  5H2F C;  2I8D A;  2PBI A;  4RAZ A;  4BU2 A;  3F23 A;  3TDU C;  3W6J B;  1BA5 A;  1X3Z B;  2ZKZ A;  4DZP A;  4X1E A;  3CCQ I;  1VQO I;  3TL4 X;  3BTC A;  2ZJ2 A;  2VJ4 A;  2R7R A;  2XRL A;  3OYI A;  3HZJ A;  3AL0 B;  3ECH A;  3GFJ A;  1MBJ A;  4M71 A;  1HKS A;  2JUC A;  4PK4 A;  2P0W A;  5LRS A;  5HLT A;  3WTX C;  1NH3 A;  1I27 A;  1YIO A;  5EEA A;  3CLO A;  1V3F A;  4G7O F;  3GFL A;  3KLN A;  2WAQ A;  4CSW A;  3CCU I;  1YFH A;  1ZN2 A;  2L9R A;  5ERI A;  3AKZ A;  3RZO J;  3H35 A;  4KN4 X;  4XLN F;  1MJA A;  4AYB A;  3FZV A;  1GT0 C;  2Z33 A;  2E36 A;  5E17 F;  3S2H J;  2AHQ A;  4XSX F;  5CYV A;  3TOB A;  2QVO A;  2LH9 A;  3HOV J;  1YIT I;  1BR2 A;  2DT6 A;  3CMM A;  1BR4 A;  3KYC B;  3BQZ A;  3CF5 F;  4F3Q A;  4Y52 J;  2EBI A;  2GQQ A;  4ITV A;  4JX5 A;  3MZH A;  3BR2 A;  4XRS G;  3BR3 A;  2E35 A;  3RPQ A;  3VEP A;  1JKP C;  2QEX I;  1T98 A;  4BKX A;  1IN8 A;  3FK7 A;  1Y8Q B;  4G6D A;  3BR5 A;  2HOS A;  2R7T A;  1LUJ B;  3J7Y J;  5L3C A;  4F7Z A;  3HG9 A;  1K79 A;  2BVM A;  2VBX A;  3J81 Z;  5E3L A;  4M3F A;  1IF1 A;  1BOA A;  4FHT A;  2TDX A;  1TWH J;  3CLQ A;  4CZC A;  3ZQL A;  1WJA A;  2J5O A;  1MMG A;  2UUZ A;  5GTH C;  1B8I A;  3M3Y J;  2R7X A;  2VL8 A;  4HBL A;  1JKQ C;  2CS3 A;  3P9K A;  3RQI A;  3QYE A;  3NAU A;  4HV5 A;  4OIN F;  3DKY A;  4AIK A;  2R7Q A;  3HM5 A;  2K9S A;  3UR3 C;  2XAH A;  2EIN H;  3HOX J;  1BJZ A;  2DBB A;  3DEE A;  4RGR A;  3W6K B;  4FE7 A;  1S6L A;  1JI8 A;  4RMN A;  2ACJ A;  3OYJ A;  5ED4 A;  3KE2 A;  1D5Y A;  1ZRF A;  1QHG A;  2M30 A;  3FKJ A;  2PMH A;  4CCK A;  1IRZ A;  2QQ8 A;  1A36 A;  1P2F A;  4Y17 A;  4OIR F;  4EJO A;  5LGT A;  1OR7 A;  3OYF A;  2CFO A;  4A6D A;  3HXL A;  4E7L A;  5HDN A;  5AIQ A;  4XOP A;  2DFE A;  3Q0U A;  3HYI A;  1TQI A;  3V8J A;  2O8K A;  4XBF A;  1IN5 A;  1UMQ A;  3ERM A;  5EG0 B;  2L54 A;  4NC6 A;  2ESH A;  4NC8 A;  2G7U A;  4CCJ A;  2MW8 A;  4KMF A;  2O61 A;  4GFB A;  1JTX A;  2HVQ A;  5DD4 A;  2G7H A;  2LTP A;  4ZDL A;  3FMQ A;  3RQ4 A;  2AQF A;  4IKF A;  4E7S A;  4QLC U;  1U3E M;  1PP8 F;  3I9V 2;  1Q1H A;  4ESB A;  3CO6 C;  4II3 A;  2QSG X;  2RGV A;  1JJ8 C;  4BQA A;  2QQ9 A;  4AU7 A;  2VXZ A;  1R9T J;  3S1R J;  2EFQ A;  4G7H F;  2UZK A;  3WU2 C;  1Y6I A;  1LPQ A;  2E1M B;  1KU7 A;  1J09 A;  5CVR A;  2DA6 A;  3F9K A;  3K10 A;  3AG2 H;  2BHY A;  1NG6 A;  1QHH D;  2QLZ A;  5FKN A;  1UHM A;  3ZMV A;  5JHF A;  2V9P A;  2B63 J;  2NVU B;  1Y56 A;  3F8F A;  3GZN B;  1D3Y A;  2CQX A;  3OIP A;  3K4N A;  1BJA A;  4C3J J;  3ZQ7 A;  5B3S H;  2Y30 A;  5HS9 A;  3I64 A;  4MFE A;  1BC7 C;  4HNV A;  3JRI A;  4A3B J;  2ZNZ A;  3DKX A;  5HDG A;  3BG3 A;  3AG1 H;  2IEK A;  3GTK J;  2MD5 A;  3HUG A;  2KKO A;  2IGK A;  3GX4 X;  1ZRC A;  2F5D A;  4M9X A;  1QQI A;  2HTJ A;  1TNS A;  1HQC A;  2MFZ A;  1KZH A;  3U9G A;  4HF2 A;  3MKZ A;  5J1U A;  5CKT A;  5H20 A;  1LE8 A;  4A3L J;  5GPA A;  3FX3 A;  4IEJ A;  5BOX A;  3ERE D;  4G8X A;  3CDH A;  3FM5 A;  4RGX A;  5F0F A;  4J00 A;  3OSG A;  1HBX G;  1MD0 A;  2XPW A;  2X6O A;  3W2A A;  1SMY F;  1FPQ A;  2JPB A;  1AU7 A;  3R0A A;  1HDD C;  5ILS A;  4B47 A;  2DMU A;  1X1A A;  4EQQ A;  5JHU A;  4CCO A;  1RPW A;  2B7E A;  2AQE A;  2EFW A;  2MD0 A;  5ILV A;  1QPM A;  1HCR A;  2E19 A;  1RRJ A;  2R5Z B;  3BOQ A;  2JTV A;  3M8E A;  4A0Z A;  1USS A;  4XKC A;  3GTG J;  4AM3 A;  2MSY A;  3M07 A;  2VOO A;  5GP9 A;  2O5R A;  3NAR A;  2HI3 A;  4B8X A;  5FRN A;  3OYA A;  4MQ9 F;  5EGO A;  2DQL A;  1N75 A;  3HPH A;  1EKE A;  1U6G A;  2XGC A;  3BTJ A;  3G1M A;  3LSK A;  4FE4 A;  4IHV A;  2DK5 A;  1ULY A;  1TW2 A;  4CCM A;  1OIS A;  2L4A A;  4JYK A;  2K4B A;  3FIS A;  2ADU A;  5E18 F;  3R4K A;  4DYR A;  1MJB A;  2DMP A;  2CW8 A;  5K7Z A;  2VT2 A;  1WI3 A;  4IXA A;  2PMZ A;  3O3K A;  1W0U A;  4IHX A;  3KCC A;  2K7L A;  3K6G A;  3A03 A;  2RQQ A;  5HLI A;  3D1N I;  3IUO A;  3IH2 A;  1SD6 A;  2QKM B;  3IH3 A;  4CYC A;  3I56 I;  2E7W A;  1PDN C;  1WJD A;  4B3A A;  1S8N A;  4UXN A;  2XAQ A;  3EPZ A;  2BZT A;  5IYC J;  1EA3 A;  2L7M P;  1FT9 A;  4YIF A;  2CQQ A;  3PSF A;  2E7X A;  4CCL A;  4BE1 A;  3R60 A;  1EF4 A;  1RUO A;  2M8G X;  4BJ5 C;  3C18 A;  4DBQ A;  4WCG A;  2XSD C;  1SVM A;  1VZ0 A;  4EEF G;  1A5J A;  2F48 A;  3JRD A;  1FYM A;  4XN0 A;  1U9O A;  3MEX A;  5GAE J;  4FCY A;  5FD6 A;  1X1D A;  2VPR A;  3H5R A;  1ODD A;  1JT6 A;  2HR3 A;  3FXO A;  1APL C;  2DA3 A;  4P9U A;  2Z9O A;  3WGH A;  4G6T B;  3SJM A;  3E6D A;  2OD5 A;  2FBK A;  2LRD A;  3R6S A;  2FU4 A;  1BIB A;  2CQK A;  3BWG A;  1KGS A;  2QZ8 A;  2DU9 A;  2ZNY A;  2BW3 A;  2QBY B;  1MMD A;  1ZTR A;  1PUE E;  3JW4 A;  4XN3 A;  3HRM A;  4HX7 A;  1D0Z A;  2QQB A;  4I76 A;  1W5S A;  2VBY A;  4R1H A;  2EA4 A;  2ZXW H;  4L5E A;  1AKH A;  2VLA A;  1G3W A;  2LVS A;  5KHD A;  2JSC A;  1YYV A;  2VKV A;  1CGP A;  2IS1 A;  4S04 A;  2ZME B;  4OAZ A;  3SZP A;  4U0Y A;  3Q5F A;  2HNH A;  2R0Q C;  2WAD A;  3PUB A;  1Z0X A;  3S2W A;  1UFM A;  5IYD J;  2R5Y A;  1XCB A;  2M5W A;  2H94 A;  3D5L A;  3OYB A;  4II2 A;  2KIS A;  4UNO A;  2V7F A;  3LSP A;  1JHF A;  3IAS 2;  2FMY A;  4P5O A;  1U0J A;  2FJ1 A;  1ETY A;  5ICE A;  1ZRD A;  1ZLJ A;  1OCZ H;  3DTI A;  3J7A Y;  3X2Q H;  5DCF A;  5KVR A;  3RZD J;  1SAU A;  1ZK8 A;  2M2E A;  1L3L A;  1LFB A;  3MQ0 A;  3Q0V A;  1GHC A;  1B6A A;  3JAM K;  4C3I J;  3G6E I;  3EDP A;  4U0W A;  3S1Q J;  3K4M A;  2PJP A;  5KCM A;  3VSK A;  2D2W A;  2VKE A;  3GF2 A;  3OS2 A;  4BEH B;  3SFI A;  1XMA A;  3C2G A;  1R58 A;  4ZH4 F;  2GOM A;  4UVC A;  1PJR A;  3H9G A;  4IF4 A;  1TL8 A;  2BY2 A;  4EGZ A;  3F3X A;  1E0E A;  1KU9 A;  2IA2 A;  3WTT C;  2L4M A;  5ICG A;  3GZ5 A;  3J80 K;  2A07 F;  3OY9 A;  2JMW A;  2DMN A;  4LG0 A;  2JQ7 A;  2XSJ C;  4DGW B;  2H1K A;  3W2W A;  4XON A;  4LLL A;  1RZ4 A;  1NTC A;  2AS5 F;  1KA8 A;  4MGR A;  1Z3X A;  2PJR A;  2FML A;  1ZYR F;  1MBK A;  1I5Z A;  3WE3 A;  2F2E A;  2CYY A;  1V4R A;  4BL0 B;  2ECB A;  4I01 A;  4U7B A;  1WHU A;  4Q5S F;  2Y9Y A;  2FOK A;  4IHS A;  3VFZ A;  1GXP A;  3L2R A;  3F8N A;  3H1C A;  3MD2 A;  1DU0 A;  4L9V A;  4AID A;  1GDT A;  1MDM B;  3G1O A;  3IL2 A;  2XRO A;  3KEY A;  4BGD A;  3LFK A;  3EQL F;  2LBF B;  5TRD A;  4XRS A;  1N77 A;  2LG4 A;  4YEJ A;  5EDN A;  2BXZ A;  4ENK A;  2QWW A;  1FLI A;  2M8E A;  1FMW A;  1V5F A;  2HPM A;  1OMI A;  2KPM A;  4ZZL A;  3E6C C;  1Z9C A;  3J81 K;  2Y9Z A;  3KP6 A;  2XGD A;  1F43 A;  2ZBK A;  1T2K A;  4RGU A;  2KDZ A;  1IDZ A;  4XM3 A;  2M3A A;  4RA2 A;  2HWV A;  1W1W E;  1E3O C;  1WH7 A;  1DU6 A;  4BAY A;  4CH7 A;  4E7I A;  1S3J A;  4L5J A;  3GVA A;  2MGQ A;  2FNP A;  3KET A;  4FX4 A;  3T8T A;  2PI0 A;  1WGX A;  2XF5 A;  3DWL E;  4UB8 C;  3DU6 A;  3FXQ A;  1R71 A;  4LGW A;  1IN7 A;  3DEW A;  2E60 A;  2D1V A;  2FOW A;  2XVC A;  1TC3 C;  1Z67 A;  3DCF A;  4PJJ A;  3WTS C;  1WSU A;  3O6B B;  1W7P B;  3JRH A;  1RI7 A;  2LR8 A;  3CC2 I;  4EGY A;  2ZJR F;  3MKL A;  1W36 D;  5K5R A;  1Z3Y A;  1ZGA A;  3RSN A;  1KQ8 A;  2FSW A;  1ETW A;  2ZXH A;  4OWR B;  4LIV A;  3FXM A;  1HKT A;  3O8H A;  3CF2 A;  2ZCW A;  2HQA A;  1BI2 A;  3E97 A;  2HZT A;  1J0R A;  1KYW A;  4YII A;  4AWX B;  1XMK A;  2DO7 A;  2KRH A;  2PN6 A;  1SFO J;  2R4G A;  5FKL A;  4WX9 A;  2GWR A;  3GYH X;  1XDS A;  1K6O A;  5DUK A;  4A2U A;  5CPR B;  5HOD A;  1UST A;  4ZTF A;  1JKR C;  1B8I B;  1X58 A;  4NBQ A;  5EZH A;  2ZJP F;  2ZO4 A;  1FP2 A;  4B4C A;  4JP0 A;  5L3F A;  3N4M A;  3D5S C;  1V54 H;  2L7Z A;  1IXC A;  2WB1 A;  5AON A;  4I0A A;  5E79 C;  3I4N J;  3HHH A;  3L2U A;  2OZU A;  4UV9 A;  3I59 A;  2XHK A;  2MA3 A;  4XKB A;  2F5E A;  3CUQ B;  1RET A;  3H0D A;  1A6Q A;  4A3G J;  5F0C A;  2EIK H;  4RGS A;  2VC1 A;  5L3E A;  3HOS A;  2RVC A;  3K4K A;  2FE3 A;  2IA0 A;  2DLL A;  2Q1Z B;  2JJ7 A;  4J19 A;  1V5G A;  2VOP A;  1IN6 A;  2DA5 A;  4N9I A;  2P5K A;  3BTL A;  2LD5 A;  4XOR A;  3BDD A;  3IWZ A;  3GTJ J;  1TT0 A;  1Z1D A;  1AA7 A;  3E5Q A;  2RQP A;  3LMM A;  5IP7 J;  4A3F J;  2V9K A;  3F8C A; 
#chains in the Genus database with same CATH homology
 3G3Z A;  3CUO A;  4MHG A;  2P6S A;  2HQN A;  4G6Q A;  5LHI A;  1D8J A;  4R79 A;  3BZ6 A;  3WTU C;  2GA2 A;  2YX7 A;  1KYZ A;  1Y0U A;  1HKQ A;  1U78 A;  1TQM A;  4HA8 A;  3K1M A;  5DCM A;  2VE8 A;  1J7K A;  3MCZ A;  2QM3 A;  1LEB A;  3ZN1 A;  2XAJ A;  1ZLK A;  4IRI A;  3COA C;  3L2C A;  3F22 A;  1F4K A;  1RIO H;  5KK1 A;  3H92 A;  1LNW A;  1DUX C;  2A5Y B;  1FP1 D;  4GCV A;  2STW A;  3E6B A;  4A6E A;  1R22 A;  2W85 A;  2OU2 A;  3V8K A;  5L3G A;  5J8F A;  4IHT A;  4A5M A;  2H6C A;  2CSO A;  2EB7 A;  4M74 A;  1GXQ A;  2VT3 A;  4NB5 A;  1REP C;  1ZRE A;  3KZZ A;  5K5O A;  3M8F A;  3JSO A;  4I0B A;  2K4J A;  2HTS A;  3MWM A;  1JXS A;  3M7G A;  4I2O A;  3BRO A;  1EH6 A;  3F6V A;  1GVJ A;  1H9T A;  2KJB A;  2PMU A;  1R5G A;  1O3T A;  1XSD A;  4ETS A;  2CGP A;  2WWY A;  5HVQ C;  3L00 A;  1STZ A;  2BGC A;  5LGN A;  3TQN A;  5BQT A;  3LST A;  2YR2 A;  2DPU A;  2GAU A;  2OQR A;  2W25 A;  1HW1 A;  1UHW A;  1Z7U A;  5E1W A;  4KFC A;  3HRU A;  2YX4 A;  4WK8 F;  2XRN A;  1RUN A;  1R36 A;  1G6N A;  2O0Y A;  2CFX A;  1QBJ A;  1TLH B;  2LSO A;  3OOP A;  4OU0 A;  4HF1 A;  3G73 A;  1XN7 A;  2BE5 F;  1FX7 A;  3WTY C;  3QRF F;  1G3T A;  2BV6 A;  4Q4Z F;  3WTZ A;  1FWZ A;  4ZYE A;  3KP7 A;  3KFW X;  2GA1 A;  4YFN F;  1YS7 A;  2P8T A;  4GXO A;  3EYY A;  1XSX A;  3C3W A;  3DPL C;  1XD7 A;  3RTR A;  1IRG A;  1FBU A;  3VB2 A;  3IKT A;  1R00 A;  4CZZ A;  2VON A;  4CIC A;  4IJA A;  2FBI A;  5BMZ A;  1G3Y A;  3DEU A;  3V7S A;  1ONV A;  1UCR A;  4BHC A;  4NHJ A;  1TTY A;  3SFZ A;  3I71 A;  2VE9 A;  5E1Z B;  3ZMD A;  2H27 A;  2DTR A;  2UXN A;  4HDV A;  5BPD A;  2PFB A;  5F6F A;  3U2R A;  3IC7 A;  2KIU A;  3QU3 A;  1IAW A;  2M87 A;  1FSE A;  5LRR A;  2VOD A;  1FYL A;  4OMY A;  1IW7 F;  3FWE A;  3J7A O;  3BPX A;  1SAX A;  2HKO A;  4ESF A;  3FMS A;  2NS0 A;  3O2P E;  3BJ6 A;  3GFI A;  2DAO A;  4EJV A;  4M73 A;  4NQW A;  2Z99 A;  3EYI A;  3F8M A;  4K2E A;  4WXH A;  1W5T A;  1L0O C;  2FEZ A;  1EH8 A;  3MAJ A;  3P7N A;  4I98 B;  5LGU A;  3RPU A;  2COM A;  2IPQ X;  5H6Q A;  2DFI A;  4BXU A;  3U1D A;  1P4X A;  2P5V A;  1WRJ A;  1SD5 A;  4KNY A;  2M45 A;  4G94 A;  2VC0 A;  3Q9S A;  2FF4 A;  3VOD A;  2CG4 A;  3SQN A;  1B4A A;  4RAY A;  5D4S A;  5D5U B;  3FXU A;  3NEU A;  1TW3 A;  1ZG1 A;  1B1B A;  4PZJ A;  3WOD F;  2VN2 A;  1S7O A;  2HDC A;  2UXX A;  4CDG A;  1IRF A;  3RKY A;  1K78 A;  4LFU A;  4KIF A;  1OPC A;  3IRR A;  5HS7 A;  4I09 A;  4BYY A;  2WTE A;  3T5X A;  1ZAR A;  4B09 A;  5J8C A;  5CVV A;  2GIV A;  1XGM A;  5K5Q A;  2P4W A;  2J5P A;  2YU3 A;  4ZYD A;  1WKM A;  1R7J A;  1O3Q A;  5DD8 A;  2XV4 S;  4XLP F;  2EV6 A;  5D6E A;  5FLX Z;  1LDD A;  4IVN A;  4JBA A;  1T39 A;  2IRF G;  3TOA A;  1SFX A;  4D0P A;  3B73 A;  5E8G A;  2CW0 F;  2MLK A;  2CWE A;  4MEY F;  1A04 A;  4HZF A;  1IN4 A;  2H09 A;  1SFU A;  1BC8 C;  4PGG A;  3T8R A;  1I1G A;  1O3S A;  5L3B A;  2LNB A;  2PLY A;  4LLG F;  3SHF A;  5CVI A;  2A3S A;  2YSR A;  2DT5 A;  3HHG A;  2GZW A;  1J75 A;  4HW0 A;  2V1X A;  1XB4 A;  4KIB A;  2MLG A;  3WE2 A;  1J9I A;  3GEZ A;  3ELK A;  1F5T A;  1E17 A;  2RC4 A;  3L9F A;  4HQM A;  4HX4 A;  1W7P D;  4EJW A;  4O5V A;  2P7C B;  4MEX F;  4CHU A;  4E70 A;  3HSF A;  5ILU A;  5DCM B;  4LB5 A;  4HYE A;  2RV8 A;  3RKX A;  3DQV C;  2WV0 A;  2RKH A;  1C0W A;  2BYV E;  1HW2 A;  2XKP A;  2DQR A;  4AIJ A;  2EK5 A;  1P6R A;  4LLN A;  2Z5U A;  5LEK A;  2OQG A;  3ZPL A;  3RI4 A;  3C1D A;  2XUB A;  2IA1 A;  4OIQ F;  1HW5 A;  1LJ9 A;  2B0L A;  4L0Y B;  3I4P A;  3TKY A;  3L7W A;  5LEJ A;  3PQK A;  1XGS A;  3LQR A;  2FNA A;  3JTH A;  2O6G E;  3PQJ A;  4EM1 A;  3GZ6 A;  3F6O A;  3KP2 A;  4CXF A;  4CGZ A;  4L9J A;  5IT3 A;  3HRS A;  2WC2 A;  1T0F A;  2EJR A;  5EEH A;  3F8B A;  3JTG A;  3IRQ A;  2MH2 A;  4HF0 A;  2HKX A;  3N97 A;  4KA4 A;  2F5C A;  1XGO A;  5DYM A;  2ELH A;  4KIG A;  3LAJ A;  1KQ9 A;  2QUF A;  1OYW A;  1O57 A;  3ZMU A;  1IZ1 A;  2IT0 A;  1U8R A;  1Z6T A;  1BN5 A;  4P96 A;  3RYP A;  1AWC A;  1ON1 A;  2K27 A;  1X3U A;  4OOI A;  4LK1 F;  4MNU A;  3E5U A;  4RB1 A;  3ECO A;  4Q47 A;  3TO7 A;  1TQP A;  3V4G A;  4G9Y A;  4RS8 A;  2EV0 A;  1MJ9 A;  4N9H A;  2XIG A;  5IT9 Z;  5D5X B;  4M6X A;  3NQO A;  3TO6 A;  2R7F A;  4DNC A;  4I7H A;  2V1D A;  3HOT A;  1QNT A;  1O7F A;  1JHH A;  4HAM A;  2W84 A;  2JPC A;  2V1U A;  2VBZ A;  4JK1 X;  1BI3 A;  5CVJ A;  1UB9 A;  4KDP A;  3ULQ B;  3DF8 A;  1DP7 P;  2X0L A;  2KIM A;  4HLY A;  3NRV A;  3SXY A;  3DV8 A;  3I5U A;  4HLX A;  1LEA A;  2C6Y A;  4P9F A;  4BHB A;  4MQV A;  4QWQ A;  2D45 A;  5D5V B;  2A61 A;  3P9I A;  3OV8 A;  1ON2 A;  2OZ6 A;  3L09 A;  5LHG A;  2DPD A;  4KUM A;  1CF7 A;  3B02 A;  2LF8 A;  1DPU A;  1K7A A;  1G4D A;  3M9A A;  4AIH A;  1XGN A;  4Q48 A;  1R1U A;  4A0X A;  1S7A A;  2O8X A;  2HQR A;  2L02 A;  4KN7 X;  4WXD A;  3FXR A;  3BPV A;  5JFR A;  5TJJ A;  4A5N A;  3MZY A;  4P55 A;  4U7D A;  3LQQ A;  5FLX K;  2Y48 A;  3ZMT A;  4MTE A;  2R7D A;  2NAZ A;  2HYF A;  3KLO A;  1LB2 A;  4XSZ F;  1HSJ A;  3DP7 A;  2STT A;  2CO5 A;  3T1B A;  4IRH A;  4WF2 A;  1G3S A;  1T38 A;  3AAF A;  2E1C A;  3E3V A;  4LJZ F;  3DXJ F;  4HQE A;  2EFP A;  2XAG A;  3IHU A;  1K78 B;  3GO5 A;  4L18 B;  5F1R A;  3FHZ A;  4DQ2 A;  3BJO A;  1MDM A;  4JQF A;  3F72 A;  1XDU A;  3K1P A;  5E20 A;  5FFX A;  1WWX A;  2OA4 A;  1YQA A;  4GYI A;  2K86 A;  4LMY A;  3FMR A;  3H3Z A;  4KIC A;  3I0T A;  2OBP A;  1U2W A;  5CVU A;  4ASN A;  5DEQ A;  1B9N A;  4KYW A;  3FF5 A;  3J80 Z;  1FY7 A;  1HXD A;  1U5T A;  1FZP B;  2X4H A;  4CO8 A;  1SD4 A;  1VTN C;  3H3U A;  3GXO A;  5DUI A;  4WWC A;  2JRT A;  1W7P A;  2LDU A;  4PCQ A;  3GFM A;  3CTA A;  2ESN A;  2GXB A;  1D5V A;  1SFE A;  4HOB A;  4UUV A;  3I58 A;  1MGT A;  2V79 A;  2XKO A;  4ENN A;  2O3F A;  4IRG A;  2A6H F;  1KQ0 A;  2V9V A;  1R1V A;  3F21 A;  4L5I A;  2A6E F;  3GW2 A;  5ICF A;  1AOY A;  3DFG A;  3WU1 B;  5HOO A;  3QP5 A;  2HYG D;  4U88 A;  3HIF A;  3CO7 C;  1ZAO A;  2FXA A;  3QPH A;  4FT8 A;  3ML6 A;  3Q9V A;  4OIO F;  2DK8 A;  1MZB A;  4A0Y A;  2W57 A;  3CUQ A;  4ENJ A;  4KMU X;  4M72 A;  2DI3 A;  1IXS B;  4LG0 B;  3RKW A;  4BHP A;  1LDK B;  5BS6 A;  2QEN A;  2IJL A;  3M1E A;  5FO5 A;  2MH9 A;  4EJU A;  3LAP A;  3K2Z A;  5EEG A;  4ESJ A;  1WI9 A;  3I53 A;  1R5H A;  2EFO A;  4EMS A;  4R8H A;  5FD5 A;  1J59 A;  1Z05 A;  4S05 A;  1FOK A;  4BH9 A;  4EV0 A;  4YFX F;  1H9G A;  2QYO A;  1HST A;  4O3M A;  3ROU A;  1F1Z A;  5A2Q Z;  2BBY A;  2NNN A;  2P5L C;  2HGC A;  1Z91 A;  1IXR C;  3LA3 A;  1BI1 A;  2L01 A;  5IT9 K;  4Y13 A;  2O03 A;  4AD9 A;  3ZMS A;  4A12 A;  4EJT A;  2A68 F;  3QAH A;  3KP3 A;  3K1N A;  1I6X A;  5FFZ A;  1ZGJ A;  1YLF A;  1SD7 A;  3WG9 A;  1QZZ A;  2FA5 A;  2KJC A;  2IVM A;  1P92 A;  2P7V B;  5K1Y A;  4LD5 A;  4AVP A;  4L0Z B;  2G9W A;  1BM9 A;  4EM2 A;  3DKW A;  1YW9 A;  5D8L B;  1FYK A;  3RJP A;  3MFK A;  4ZYH A;  1TBX A;  3GUD A;  2HEO A;  3EUH A;  1QZY A;  1XSV A;  3EET A;  1BBY A;  5ICC A;  2JZY A;  2RNJ A;  1WQ2 A;  2W24 A;  4ZZD A;  3C7J A;  2YPR A;  1J2X A;  5E1X A;  5DDG A;  3LA7 A;  2BEO A;  3R61 A;  3I59 B;  3K0L A;  2NYX A;  5FB2 A;  4TV7 A;  5DV5 A;  4U0V A;  3QOP A;  3BP8 A;  5HLG A;  3TO9 A;  1DDN A;  2Y0M A;  1S29 A;  1W4M A;  3GLX A;  3SZT A;  3WTW C;  2AXL A;  3K69 A;  1PP7 U;  3P9C A;  3DPT A;  4EVI A;  1ZHF A;  1YW7 A;  5E8I A;  4G7Z F;  1J5Y A;  4PDK A;  1R1T A;  1OYY A;  2PQ8 A;  3RYR A;  1IUY A;  3KEO A;  4M9Z A;  5HS8 A;  2XAF A;  4UV8 A;  1CF7 B;  2HFH A;  3IWF A;  5JVT A;  5L3D A;  1XCV A;  5D8K B;  2D1H A;  4UHT A;  3V8L A;  1Z6R A;  1LVA A;  4YFK F;  3HRT A;  3WGG A;  2DW4 A;  1OKR A;  2NRA C;  4M6Y A;  3QP6 A;  3ZMZ A;  1YG2 A;  2EFN A;  2E1N A;  3V7C A;  1U5T C;  1FBQ A;  4OIP F;  3ISP A;  2LF7 A;  5CLS A;  4H0E A;  4ZYG A;  5CJ9 A;  2NNY A;  4XRF A;  1P4A A;  3VOE A;  4CYD A;  1T6S A;  3HSE A;  1JGS A;  2M1B A;  1I1S A;  2KRF A;  2JT1 A;  5LBQ A;  1EH7 A;  1QGP A;  1TNT A;  4O6J A;  4MTD A;  4GYG A;  5D5W B;  4HX8 A;  3T0Y A;  1O3R A;  4YG2 F;  2QQA A;  3RIR A;  2ZFW A;  2MC3 A;  2ETH A;  3ZP5 A;  2EA2 A;  4BNC A;  2UWM A;  1MKM A;  2VBW A;  1U5T B;  1YW8 A;  3BJA A;  3KP4 A;  3CUQ C;  4UVB A;  1ZH5 A;  5D4R A;  4GO1 A;  3KEQ A;  4HV6 A;  4FX0 A;  4LB6 B;  2Z3Y A;  3V7R A;  2ISZ A;  4N0B A;  4RB3 C;  5BPI A;  4L9T A;  2ZXJ A;  5JR3 A;  2P6T A;  1DPR A;  2HS5 A;  1FBS A;  4HDU A;  1B9M A;  5FGM A;  2EV5 A;  3CJN A;  2KIF A;  2RDP A;  1LQ1 A;  3KZY A;  2XAS A;  3HTS B;  3LWF A;  1YTY A;  4I02 A;  2MBF A;  3TGN A;  3WU0 A;  5H6R A;  4IPA A;  1LDJ A;  1F9N A;  4PGH A;  5JI6 A;  5A2Q K;  1ZG3 A;  1OYI A;  1R23 A;  3ABU A;  3FM3 A;  1H0M A;  4Z2Y A;  5HDK A;  3KP5 A;  2QBY A;  3TDZ C;  5F64 A;  4WXC A;  2EWN A;  4OMZ A;  2ISY A;  2ZME A;  3QPT A;  1RNL A;  1KU2 A;  3JSP A;  1KU3 A;  1QO0 D;  1P4W A;  2GXG A;  4M9S A;  1D8K A;  2LKP A;  3K9T A;  3R0J A;  3HSR A;  1NHA A;  3LA2 A;  3ABT A;  1BIA A;  6PAX A;  4KT5 C;  3GWZ A;  1EV7 A;  2FBH A;  2HOE A;  1B59 A;  3REO A;  5HLH A;  3HTU A;  4L9N A;  1SMT A;  5D6F A;  2H6B A;  2IW5 A;  4LK0 F;  1YO5 C;  5LHH A;  2FQ3 A;  3E5X A;  2IP2 A;  1E2X A;  4RB0 A;  2PEX A;  2Q2E A;  2OAZ A;  3D0S A;  1FC3 A;  2A69 F;  1ZG5 A;  3ZN0 A;  4GGG A;  4ENM A;  3IKV A;  3PFI A;  1FSH A;  3WGI A;  3WTV C;  2F5F A;  2R3S A;  1YS6 A;  4RB2 C;  2K02 A;  4UVA A;  5AIP A;  2RN7 A;  4ON0 A;  5LLQ A;  2Q0O A;  3I54 A;  2L3D A;  3JAM Z;  1JE8 A;  1BI0 A;  3E6M A;  2XGX A;  5J6X A;  2PG4 A;  3BY6 A;  2V6C A;  4EM0 B;  2Y75 A;  1O7L A;  1FNN A;  2FRH A;  3QU6 A;  3RDI A;  4Y15 A;  2Q8K A;  2PBI A;  4RAZ A;  3F23 A;  3TDU C;  3W6J B;  2ZKZ A;  2ZJ2 A;  3ECH A;  3GFJ A;  4M71 A;  1HKS A;  3WTX C;  5LRS A;  1I27 A;  1YIO A;  3CLO A;  1V3F A;  4G7O F;  3GFL A;  3KLN A;  1YFH A;  1ZN2 A;  5ERI A;  4KN4 X;  4XLN F;  1MJA A;  3FZV A;  2Z33 A;  5E17 F;  4XSX F;  5CYV A;  3TOB A;  2QVO A;  2GQQ A;  3MZH A;  3RPQ A;  3VEP A;  1T98 A;  1IN8 A;  4G6D A;  1K79 A;  5L3C A;  4F7Z A;  2VBX A;  3J81 Z;  1IF1 A;  1BOA A;  4FHT A;  2TDX A;  2J5O A;  4HBL A;  3P9K A;  4HV5 A;  4OIN F;  4AIK A;  2XAH A;  2DBB A;  4RGR A;  3W6K B;  1S6L A;  2ACJ A;  5ED4 A;  3KE2 A;  1ZRF A;  2M30 A;  2PMH A;  1P2F A;  4Y17 A;  4OIR F;  4EJO A;  5LGT A;  1OR7 A;  4A6D A;  5HDN A;  5AIQ A;  3HYI A;  1TQI A;  3V8J A;  4XBF A;  1IN5 A;  2L54 A;  2ESH A;  2G7U A;  4KMF A;  2O61 A;  5DD4 A;  2G7H A;  3FMQ A;  4QLC U;  1U3E M;  1PP8 F;  1Q1H A;  4ESB A;  3CO6 C;  2RGV A;  4BQA A;  2QQ9 A;  2VXZ A;  2EFQ A;  4G7H F;  2UZK A;  1KU7 A;  5CVR A;  2QLZ A;  1UHM A;  3ZMV A;  3F8F A;  1D3Y A;  1BJA A;  3ZQ7 A;  5HS9 A;  3I64 A;  1BC7 C;  2ZNZ A;  5HDG A;  2MD5 A;  3HUG A;  2KKO A;  3GX4 X;  1ZRC A;  2F5D A;  4M9X A;  1QQI A;  2HTJ A;  1TNS A;  1HQC A;  3U9G A;  4HF2 A;  5H20 A;  3FX3 A;  5BOX A;  3ERE D;  4G8X A;  3CDH A;  3FM5 A;  4RGX A;  1HBX G;  1MD0 A;  1SMY F;  1FPQ A;  2JPB A;  3R0A A;  5ILS A;  4EQQ A;  5JHU A;  2EFW A;  5ILV A;  1QPM A;  3BOQ A;  2JTV A;  3M8E A;  4A0Z A;  1USS A;  2VOO A;  4B8X A;  4MQ9 F;  2DQL A;  1U6G A;  2DK5 A;  1ULY A;  1TW2 A;  2L4A A;  2K4B A;  2ADU A;  5E18 F;  3R4K A;  1MJB A;  2VT2 A;  4IXA A;  3O3K A;  3KCC A;  2K7L A;  5HLI A;  1SD6 A;  2E7W A;  1PDN C;  1S8N A;  4UXN A;  2XAQ A;  4YIF A;  1FT9 A;  2E7X A;  3R60 A;  1RUO A;  3C18 A;  4WCG A;  1FYM A;  3MEX A;  5FD6 A;  1ODD A;  2HR3 A;  4P9U A;  2Z9O A;  3WGH A;  3E6D A;  2OD5 A;  2FBK A;  3R6S A;  2FU4 A;  1BIB A;  2CQK A;  3BWG A;  1KGS A;  2QZ8 A;  2DU9 A;  2ZNY A;  2QBY B;  1PUE E;  3JW4 A;  3HRM A;  4HX7 A;  2QQB A;  1W5S A;  2VBY A;  4R1H A;  2EA4 A;  1G3W A;  1CGP A;  2JSC A;  1YYV A;  4S04 A;  2ZME B;  3SZP A;  4U0Y A;  3Q5F A;  3S2W A;  1UFM A;  1XCB A;  2M5W A;  2H94 A;  3D5L A;  4UNO A;  1JHF A;  2FMY A;  4P5O A;  5ICE A;  1ZRD A;  1ZLJ A;  5DCF A;  5KVR A;  1L3L A;  3MQ0 A;  1GHC A;  1B6A A;  3JAM K;  3EDP A;  4U0W A;  2PJP A;  2D2W A;  3GF2 A;  1XMA A;  1R58 A;  4ZH4 F;  4UVC A;  4IF4 A;  4EGZ A;  3F3X A;  1KU9 A;  2IA2 A;  3WTT C;  2L4M A;  5ICG A;  3GZ5 A;  3J80 K;  2A07 F;  4LG0 A;  4LLL A;  1RZ4 A;  2AS5 F;  1KA8 A;  4MGR A;  2FML A;  1ZYR F;  1I5Z A;  3WE3 A;  2F2E A;  2CYY A;  1V4R A;  4I01 A;  4U7B A;  4Q5S F;  4IHS A;  2FOK A;  3VFZ A;  1GXP A;  3F8N A;  4L9V A;  1MDM B;  3IL2 A;  2XRO A;  3LFK A;  3EQL F;  5TRD A;  4ENK A;  2QWW A;  1FLI A;  2M8E A;  1OMI A;  4ZZL A;  3E6C C;  1Z9C A;  3J81 K;  3KP6 A;  2ZBK A;  1T2K A;  4RGU A;  2HWV A;  4BAY A;  1S3J A;  4L5J A;  3GVA A;  2FNP A;  3KET A;  4FX4 A;  3T8T A;  2PI0 A;  3FXQ A;  4LGW A;  1IN7 A;  2D1V A;  2XVC A;  3WTS C;  1WSU A;  3O6B B;  1W7P B;  1RI7 A;  4EGY A;  5K5R A;  1ZGA A;  1KQ8 A;  2FSW A;  1HKT A;  2ZCW A;  1BI2 A;  3E97 A;  2HZT A;  1J0R A;  1KYW A;  4YII A;  4AWX B;  1XMK A;  2DO7 A;  2PN6 A;  4WX9 A;  2GWR A;  3GYH X;  1XDS A;  1K6O A;  5DUK A;  4A2U A;  1UST A;  2ZO4 A;  1FP2 A;  5L3F A;  3N4M A;  1IXC A;  5AON A;  4I0A A;  3HHH A;  2OZU A;  4UV9 A;  3I59 A;  2XHK A;  2MA3 A;  2F5E A;  3CUQ B;  4RGS A;  2VC1 A;  5L3E A;  3HOS A;  2RVC A;  2FE3 A;  2IA0 A;  2DLL A;  2VOP A;  1IN6 A;  4N9I A;  2P5K A;  3BDD A;  3IWZ A;  1Z1D A;  3E5Q A;  2RQP A;  3F8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...