3BZ6A

Crystal structure of a conserved protein of unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
NAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVMNLTQGQVGQSLRALEGRGLTRLVMGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRMHDFEDSEQVVHQLERLIARGLATLVPRQSGQREDRYMHLIGDPEDLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0502 protein PSPTO_2686
publication title The crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000.
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 52
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04337 DUF480 Protein of unknown function, DUF480
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bz6A01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bz6A02
1ULYA 4CGZA 2ZNYA 3GVAA 2H6BA 1MJAA 3E6BA 3WGGA 2DFIA 4H0EA 5D6EA 1L3LA 4EGZA 3IL2A 4HX7A 5ILVA 4IF4A 2XASA 2FBIA 3FMRA 1T39A 3BY6A 5H6QA 2PN6A 2MA3A 4LB6B 3JSOA 3RKYA 1FT9A 4HYEA 4CHUA 4N9IA 2OQGA 2VE8A 3GYHX 1I6XA 2F5EA 3CO6C 4B8XA 3HUGA 4IHTA 1XMAA 5ICEA 1XGSA 1IRGA 1ZRCA 2O0YA 2RGVA 1FBSA 2Y75A 1EH7A 2LKPA 4K2EA 1R23A 2K4JA 1E2XA 2CWEA 2VXZA 3RTRA 2QVOA 1V4RA 1Z7UA 3RI4A 1SFEA 3F23A 1T6SA 5D5VB 4M9ZA 1JGSA 1RI7A 2HZTA 1TQIA 2FA5A 1LJ9A 4A5MA 2FNAA 3MFKA 1CF7A 5DUKA 1SAXA 5LRSA 3LQRA 5D5WB 1YTYA 1D8KA 1FZPB 1XD7A 3GLXA 5HLGA 2ISYA 4YFKF 1K78B 5ICFA 5CVJA 4L5JA 4EMSA 1YG2A 1ZARA 1OYWA 1KU9A 2XVCA 2DO7A 4UVCA 4ESFA 4IHSA 1ZG1A 1REPC 3L7WA 3KP6A 1IW7F 1FP1D 3QPHA 2HDCA 1KQ0A 1O7FA 3IHUA 3F3XA 2M45A 5TRDA 4LK0F 1YW7A 5E1XA 2WWYA 2PMUA 2GXGA 1FP2A 3G73A 3T1BA 3VFZA 2VT2A 2HTJA 2PFBA 2JZYA 2O8XA 2ZBKA 2LNBA 3C3WA 5HLIA 4A0XA 2W57A 5F64A 4M74A 3R4KA 3MAJA 1F9NA 1P4AA 3U9GA 2M87A 4NHJA 1OYIA 4IVNA 2WTEA 2PLYA 1O57A 2E7XA 1J5YA 4M6XA 1JHHA 4GO1A 1HQCA 1E17A 4OU0A 2FBHA 2F5CA 4KIFA 3TDZC 1XGMA 3FM5A 3O2PE 3EYYA 2Y0MA 5LGTA 1I5ZA 3P7NA 1YW8A 3I53A 3CUOA 5ILSA 5JR3A 3TOBA 2V1XA 3GFIA 3V8LA 1J2XA 1KU7A 4P9UA 1IN4A 5DEQA 3GWZA 1G6NA 1TQPA 1S6LA 2QQAA 3V7RA 3VEPA 5E8GA 1W7PD 3V8JA 4RB2C 3QPTA 3MZHA 3BROA 4HLXA 4CZZA 3LFKA 2A3SA 3L9FA 3F22A 1X3UA 4B09A 1G3TA 4ENJA 1LB2A 1O3TA 3C7JA 4L0ZB 1IUYA 1Z91A 3GW2A 4RAYA 1WWXA 4IRGA 4LJZF 4A12A 5LGUA 3GUDA 4I02A 2NS0A 3ZMSA 2VBWA 2J5OA 4AIJA 3I5UA 3HRUA 3HHHA 3BP8A 4AVPA 4ZYDA 3DFGA 4NB5A 2VOPA 4G7HF 1FLIA 4IRIA 3E3VA 1B9MA 2LF7A 5TJJA 4OIQF 1U3EM 4I0AA 2H09A 5DD8A 5FD6A 2ESHA 3L2CA 4KMUX 2Y48A 1F4KA 5FFZA 3ULQB 2W85A 3RPUA 5JHUA 3C1DA 3J80Z 2P6TA 2ELHA 4E70A 1ZREA 3T0YA 3WGHA 2H94A 1LDKB 3CLOA 2G7HA 4A6DA 3DV8A 2HGCA 4I09A 3BJAA 1Z6TA 1DUXC 2FF4A 1XGNA 4HA8A 3KEQA 4O6JA 1XDSA 2PMHA 1WKMA 3JSPA 2V79A 4ZZLA 1ZN2A 2L3DA 5K5QA 4L9NA 1J75A 4U88A 3K1PA 4KICA 1BC7C 2P5LC 1BBYA 1BI2A 3K2ZA 2YX7A 1R7JA 2O03A 3FXQA 3I0TA 3LA3A 2IP2A 4AIKA 3GZ6A 2E1NA 3IC7A 1BJAA 4PGGA 3EYIA 5BS6A 3F8MA 1R1TA 1TQMA 1SD5A 1JHFA 3EDPA 2GA1A 1BN5A 2ZXJA 1RZ4A 3CDHA 1MZBA 4EJOA 4BHBA 2ESNA 3VB2A 1JE8A 1Z6RA 4HDUA 2OQRA 3M1EA 2VBYA 4L18B 2PEXA 4RB1A 2A6HF 1FSEA 4CDGA 3R0AA 5JFRA 2OAZA 2VOOA 3QP6A 5HDNA 3K1MA 3K9TA 4RGRA 2VODA 1FOKA 4QWQA 3IWZA 3KP7A 3VOEA 1RIOH 2GQQA 1P6RA 1FYMA 1EH6A 1G3YA 2YX4A 5D5UB 3SZPA 3ABUA 5ICCA 1KGSA 1ZLJA 4BYYA 1ZRFA 1RNLA 3SZTA 3F8BA 3FMSA 2RDPA 5DCMA 2DK8A 4XSXF 3R6SA 1UB9A 5KVRA 2VT3A 4RGSA 2W24A 2HTSA 2ZMEA 4ESBA 4KA4A 2CQKA 1MGTA 4MGRA 2HEOA 4IJAA 4A2UA 3EETA 1KQ8A 1UHWA 1OR7A 2XAGA 4HX8A 5E18F 1S7AA 3L00A 1F1ZA 4CICA 3F72A 3DPLC 2BE5F 2EB7A 1S7OA 4Q47A 1QO0D 4OIOF 1SMTA 4L9TA 2DQLA 3FF5A 4MTEA 1D8JA 5LRRA 4IPAA 5DDGA 4AD9A 2RVCA 1FBUA 4U0WA 1H9GA 2YU3A 3V4GA 2VN2A 1STZA 4EJWA 5DCFA 2OZUA 2X0LA 1BC8C 3R60A 2FRHA 4LG0B 4GXOA 3KEOA 3GX4X 4ENKA 1GXPA 3KZZA 3GFJA 1ZLKA 2TDXA 2EV0A 1MDMA 5HDKA 1U5TB 5IT3A 4RGUA 4ZYEA 4LD5A 2VE9A 1G3WA 1XSVA 3TOAA 4EM2A 1NHAA 2EFPA 1BOAA 3WTUC 4PDKA 1IXSB 3BDDA 5K1YA 1D3YA 4HF0A 3WGIA 2XKOA 4NQWA 5DD4A 2P7VB 5LHHA 4O5VA 3J81K 3H3ZA 1K6OA 1Y0UA 3WTZA 1ON1A 4KNYA 2LSOA 5CVRA 3DPTA 2MLGA 3HSFA 4BH9A 4F7ZA 3O6BB 3M9AA 3WTWC 2Q8KA 4M72A 1DDNA 5J8CA 5FLXK 4BNCA 2O3FA 5FLXZ 2C6YA 1KU2A 4MQ9F 2BGCA 3TGNA 5CVUA 4I7HA 3GZ5A 2DU9A 2QENA 3ZQ7A 1LEAA 3ZMVA 3WTXC 4R8HA 1YQAA 1XN7A 4M71A 5AONA 3CTAA 2XHKA 3KLNA 3P9IA 1MJBA 2H6CA 2GAUA 2HWVA 4HLYA 1G4DA 5ILUA 1GXQA 1U5TA 1R00A 2J5PA 3P9CA 1Q1HA 3KP2A 4EJTA 3WG9A 4M6YA 5LLQA 3EQLF 3ZN1A 4EJVA 1ZG5A 3MZYA 1XCVA 5LHGA 4TV7A 3B02A 1W7PB 1FX7A 3WU1B 2XAQA 2OZ6A 3KETA 3WE2A 2VC0A 3ZN0A 2M1BA 2FXAA 4KDPA 4PGHA 1YIOA 2EJRA 1UHMA 3WTYC 1YLFA 3NQOA 2STWA 2Q0OA 2G9WA 5BMZA 2EK5A 1U5TC 3WE3A 2CO5A 5LEJA 2XAFA 2HR3A 4P96A 3RKXA 1H9TA 4HV6A 1ON2A 2DTRA 4Y15A 1WRJA 5DV5A 3QP5A 4MEXF 2ZCWA 5E8IA 3N4MA 5FD5A 4KMFA 2AS5F 3C18A 4EJUA 2ZO4A 2P4WA 3I59B 3BWGA 1ZAOA 3V7CA 4S04A 2QQBA 1D5VA 1B59A 4YFNF 4LLLA 3TO7A 2A6EF 4G94A 1SFUA 2KJCA 4IRHA 3K1NA 1L0OC 1SD7A 3E6CC 2AXLA 4RS8A 2DLLA 5JI6A 2KRFA 4XSZF 1R36A 2KIUA 4WK8F 2ACJA 1HBXG 1HXDA 2UXNA 1FY7A 3ERED 3FM3A 4RGXA 1K78A 4DQ2A 1QZZA 2MLKA 1LVAA 4XRFA 3SFZA 1C0WA 1HKQA 1VTNC 2DT5A 1YW9A 2IPQX 5L3DA 5DYMA 2GWRA 5LEKA 4QLCU 3Q9SA 3PQJA 2HQNA 1IN5A 3S2WA 4A5NA 3I71A 2R3SA 2D1HA 5D5XB 2WV0A 3BJ6A 2V1UA 5A2QZ 3L09A 2FE3A 2Z3YA 2Z5UA 1QZYA 2CYYA 4I01A 1W5TA 3RYPA 2L54A 4BAYA 1FWZA 3QU6A 1IN6A 1BI3A 3H92A 3E6MA 2P5KA 3I59A 3RYRA 2HYGD 1B4AA 3HIFA 4ESJA 4M9SA 3E5UA 3M7GA 4OIPF 2UZKA 2HFHA 4XLPF 3WTVC 2K02A 3E5XA 3HRTA 3J80K 1MKMA 1T0FA 3RJPA 5L3FA 5IT9K 5IT9Z 5LGNA 3ZMDA 5D6FA 4KIBA 3CO7C 3ELKA 2MH2A 2P6SA 4G6QA 3JAMZ 2YR2A 3IKTA 3W6KB 1KA8A 2D2WA 2M8EA 3E6DA 4BQAA 3DF8A 4MHGA 2L4MA 1Z9CA 4MTDA 3F21A 4YFXF 2W25A 2XRNA 1CGPA 1QGPA 5EEGA 1TNSA 3ABTA 2RNJA 1XSDA 4WXHA 2DBBA 3HHGA 3AAFA 1O3SA 3REOA 4ZZDA 3CJNA 5D4SA 5HLHA 2X4HA 1IXCA 1FYKA 2Z99A 4U7DA 2A5YB 3TDUC 2NAZA 2EWNA 3I64A 4I2OA 4BXUA 4S05A 1QNTA 3FXRA 1TNTA 2F5DA 2A07F 3LWFA 1PUEE 4HF1A 2ZKZA 3OOPA 3ZMZA 3CUQB 4YG2F 1J9IA 1BIBA 1WQ2A 1IN8A 4WCGA 3WTSC 4KT5C 2EFNA 2JT1A 2VBZA 5LBQA 4GYGA 3F6VA 4Q48A 4U0YA 4L9VA 3TQNA 3IRRA 4HQEA 2R7DA 5EEHA 4AIHA 4RAZA 1I27A 3WTTC 4LB5A 3V8KA 2BYVE 4G6DA 4HBLA 1J59A 3TO6A 4HW0A 1SD6A 3Q5FA 1ONVA 3SQNA 4HF2A 2BV6A 1USSA 3GEZA 2IVMA 1TTYA 3R61A 3P9KA 3HSEA 1IZ1A 3EUHA 5J8FA 3ROUA 3HTSB 1J0RA 1ZRDA 4XBFA 2H27A 2IA0A 1LEBA 2XAHA 3DXJF 3GF2A 1DPUA 2HKOA 1V3FA 2XGXA 2IA1A 2CGPA 1P4WA 5AIPA 1FC3A 1I1SA 5KK1A 3MWMA 1WSUA 3GFLA 2W84A 3RDIA 4I98B 2FSWA 4CO8A 1TLHB 2GA2A 5L3GA 3T5XA 3CUQA 2QWWA 2MD5A 5FB2A 1JXSA 3COAC 2V6CA 5HS7A 3KZYA 3KFWX 4Q4ZF 2DAOA 4ZYGA 1I1GA 2CSOA 5FGMA 2PI0A 2B0LA 1PDNC 2HYFA 1OPCA 3FXUA 4RB3C 1WI9A 2COMA 2BBYA 1UCRA 3ZMUA 2K86A 4G8XA 1K79A 2ADUA 1S29A 2EV6A 3T8RA 4YIIA 4RB0A 3QRFF 2OU2A 2D1VA 1YO5C 1QPMA 2XV4S 2XUBA 2QYOA 3HTUA 4WF2A 5BOXA 3CUQC 3F8NA 3MQ0A 1U6GA 1R5HA 1F5TA 2XAJA 1U8RA 3U2RA 1ZG3A 3D0SA 4N0BA 5CLSA 1FBQA 3F8CA 2QUFA 4EM1A 2DK5A 3G3ZA 5D4RA 5K5OA 3ISPA 1BI1A 1YS7A 2RV8A 1MD0A 3W6JB 1IAWA 4UV9A 1XCBA 2QLZA 2DPUA 1ZYRF 3U1DA 1SFXA 1KYWA 3FZVA 3RIRA 2L4AA 1S8NA 3HYIA 2EFQA 4LG0A 1R22A 4GGGA 5LHIA 2ZNZA 3JTGA 2FBKA 1LNWA 2P8TA 4UXNA 4LFUA 1P4XA 2WC2A 2KIMA 3MCZA 1HW1A 4Y17A 1W5SA 1R1UA 5JVTA 1OKRA 5BPIA 3KCCA 1ZGJA 4UNOA 2E1CA 2R7FA 3FX3A 4FX4A 3FWEA 1TW2A 1K7AA 2Z33A 4DNCA 2F2EA 4R1HA 5HS9A 4LLNA 2O6GE 1ZH5A 1Z05A 4ON0A 2CW0F 5F6FA 1SMYF 3IRQA 4ENMA 4LMYA 2Q2EA 5BPDA 2NNNA 1RUNA 3LA7A 3WODF 4ZH4F 4L5IA 4A0YA 4OINF 1YFHA 2M5WA 4KN4X 2IJLA 2JPBA 2RQPA 1ODDA 4BHCA 4UUVA 4N9HA 3BJOA 3WU0A 5ICGA 2GIVA 1GHCA 2KIFA 4HDVA 3BZ6A 1U78A 1ZGAA 4HX4A 2KKOA 3V7SA 4Q5SF 2FNPA 5AIQA 1G3SA 3N97A 5BQTA 1PP7U 2L01A 4ENNA 4JK1X 4LLGF 3H3UA 5CVIA 1IRFA 4KIGA 1BM9A 1HW2A 3E97A 3Q9VA 2LDUA 3M8EA 2GZWA 3KLOA 2HKXA 3FMQA 3IKVA 3TKYA 1T38A 4OMYA 2PBIA 3IWFA 4UV8A 1W4MA 1W7PA 1SD4A 2DQRA 1AWCA 4EV0A 4U0VA 1O3RA 2HOEA 1FYLA 5E1WA 4ASNA 2YSRA 2GXBA 5D8LB 1QQIA 2DW4A 4KUMA 1XMKA 1YYVA 2ETHA 1BIAA 1H0MA 4IXAA 4UVBA 4LGWA 3I58A 3QAHA 1YS6A 2IW5A 1A04A 3DKWA 3RPQA 5CVVA 2IA2A 4P55A 3KE2A 4Y13A 3D5LA 2IRFG 5A2QK 1T98A 2UWMA 3ZP5A 1R58A 1XGOA 2OA4A 2FEZA 5D8KB 3HOTA 4WXDA 3ML6A 3SHFA 2XIGA 4KN7X 2RC4A 2E7WA 4UHTA 4ZYHA 3DEUA 4HZFA 3ECHA 2O61A 2A61A 1XDUA 2FMYA 3R0JA 4YIFA 2QBYB 2JRTA 3BPXA 3LAJA 4OMZA 2M30A 2UXXA 3HRMA 3OV8A 5HDGA 2Z9OA 4A6EA 3KP4A 1LQ1A 2QM3A 3FHZA 2JPCA 1TBXA 1XB4A 2V9VA 2PQ8A 4CXFA 4L9JA 3QOPA 4WXCA 4G9YA 2NRAC 2XKPA 1J7KA 1P2FA 1IN7A 4O3MA 5J6XA 1RUOA 2ISZA 3PFIA 4PZJA 3JAMK 4CYDA 2JTVA 4L0YB 1KYZA 1EV7A 2FMLA 2RN7A 3J7AO 2DI3A 1KU3A 1UFMA 3LSTA 2P5VA 1B1BA 4EQQA 5HVQC 2K7LA 2QZ8A 1LDDA 1FSHA 2BEOA 4I0BA 1DP7P 4KYWA 1U2WA 1B9NA 4G7ZF 5FO5A 2EA2A 2LF8A 3LA2A 1O7LA 3ZMTA 5DCMB 5L3EA 5E20A 3QU3A 2HQRA 1IF1A 1AOYA 3JTHA 3RKWA 3SXYA 2ZMEB 2HS5A 2RKHA 1LDJA 4UVAA 2FOKA 5F1RA 1FPQA 4KFCA 2QBYA 2EA4A 4EGYA 3GXOA 5K5RA 2A69F 1XSXA 1ZHFA 2MH9A 4GCVA 4P9FA 2F5FA 2D45A 4GYIA 5E17F 4XLNF 1MJ9A 2FU4A 1PP8F 1HSJA 4FX0A 4HAMA 1DPRA 2STTA 2KJBA 4WX9A 3I54A 4P5OA 2VBXA 2YPRA 4MEYF 2XROA 1R1VA 4PCQA 5CYVA 5ERIA 2OD5A 4D0PA 2EFWA 4WWCA 3F8FA 4JBAA 1MDMB 3VODA 3JW4A 5FFXA 3BOQA 3KP3A 2DPDA 4EVIA 2FQ3A 3DQVC 1HSTA 2A68F 2EFOA 4M9XA 2CG4A 2K4BA 1B6AA 3ECOA 5DUIA 4HV5A 3HRSA 3KP5A 2P7CB 3HOSA 2PG4A 1O3QA 2ZFWA 2L02A 3NEUA 1GVJA 5HOOA 4FHTA 2NYXA 5L3CA 1R5GA 3ZPLA 4G7OF 6PAXA 1BI0A 1T2KA 2VC1A 1OYYA 4LK1F 1HKSA 4R79A 3TO9A 2NNYA 1IXRC 4ETSA 3MEXA 1OMIA 5H20A 1QBJA 1Z1DA 2G7UA 1KQ9A 4M73A 2OBPA 2EV5A 5CJ9A 2QQ9A 4HOBA 3DP7A 3E5QA 4FT8A 4HQMA 2IT0A 1TW3A 4Z2YA 3F6OA 2ZJ2A 5E1ZB 2MBFA 4AWXB 5ED4A 3B73A 1EH8A 2VONA 4U7BA 5H6RA 5L3BA 1FNNA 4OIRF 3K0LA 3GO5A 3K69A 4MNUA 4A0ZA 1HW5A 1S3JA 2MC3A 3M8FA 4BHPA 3GFMA 3I4PA 3PQKA 3T8TA 2JSCA 3HSRA 3BPVA 3O3KA 1CF7B 1USTA 2CFXA 3NRVA 4EM0B 1HKTA 2V1DA 3LQQA 2PJPA 1P92A 5HS8A 4OOIA 3J81Z 3LAPA 2K27A 4JQFA 4MQVA
chains in the Genus database with same CATH superfamily
1ULYA 4CGZA 2ZNYA 3GVAA 5DTDA 1W36C 3L2QA 3QPSA 1B8IA 2H6BA 1ETWA 4I6ZA 1MJAA 3CCQI 1WJDA 2LG4A 3E6BA 1Y56A 2JJ7A 3WGGA 2L2OA 2DFIA 3HXLA 4H0EA 5D6EA 1L3LA 1XS9A 3HEFA 4EGZA 2DA1A 4BQNA 3IL2A 4HX7A 5ILVA 4M3BA 2EPFA 4IF4A 4IO9F 4KISA 2XASA 4C9YA 3FDYA 2FBIA 3FMRA 1T39A 1OCPA 1X1AA 3QYEA 3BY6A 1YIJI 2R7XA 1IDZA 5H6QA 1XPXA 2PN6A 2MA3A 3EUAA 4LB6B 3JSOA 3RKYA 1JKOC 1FT9A 4HYEA 4B44A 4CHUA 4N9IA 1ZR4A 2OQGA 2DOAA 2VE8A 2L7FP 3GYHX 1I6XA 2F5EA 1TP4A 4B8XA 3JRHA 3HUGA 3CO6C 4IHTA 1XMAA 4DZJA 1XGSA 3OIOA 4XM3A 5ICEA 1IRGA 1NG6A 1ZRCA 2LKSA 2O0YA 1MNDA 2RGVA 1FBSA 3N05A 3VSLA 4F92B 1R6RA 2Y75A 2EILH 1EH7A 2LKPA 3P5JA 2ZJQF 4K2EA 1R23A 2ECCA 1GV5A 3ESWB 3QYFA 2K4JA 1ORKA 1E2XA 1BR1A 3ZCOA 2CWEA 1X1DA 5KCMA 2CUJA 2VXZA 3OYDA 3RTRA 2QVOA 2E2HJ 1V4RA 1Z7UA 3RI4A 4GFBA 1SFEA 3LSJA 5IP9J 2LBFB 3F23A 4A3IJ 1T6SA 5D5VB 4M9ZA 1JGSA 1RI7A 3A01A 3L1PA 2HZTA 1Z77A 1TQIA 2FA5A 1LJ9A 4A5MA 2FNAA 3MFKA 2DDBA 2BOLA 3ZQGA 2I10A 4LIVA 1CF7A 4XICA 5DUKA 3IAS2 1VQNI 1NTCA 1VQOI 1SAXA 1E0EA 1JT6A 1E3PA 5LRSA 3CDIA 3LQRA 5D5WB 1YTYA 1DP3A 3FXKA 1D8KA 1FZPB 1XD7A 3GTGJ 2IGNA 3GLXA 4IX7A 3S1NJ 3ZOBA 5HLGA 1JJ8C 2O8KA 2K9QA 4IKFA 1X1BA 1WZ2A 2ISYA 4YFKF 1BA5A 2CUZA 1K78B 4F91B 5ICFA 5CVJA 4L5JA 4EMSA 1YG2A 1ZARA 2JUGA 2IS1A 4OAYA 1OYWA 1KU9A 3CCUI 2XVCA 3ZQLA 5E3LA 3IV5A 1I6HJ 2R7RA 2DO7A 5GAEJ 4UVCA 4ESFA 4IHSA 1ZG1A 5EZHA 2RNGA 1REPC 2CV1A 3K2AA 3L7WA 3KP6A 5GAGJ 3DTEA 1FOWA 1IW7F 5J4YA 1FP1D 4NC8A 3QPHA 5TGTA 1G59A 2HDCA 1KQ0A 1O7FA 1GDTA 3FK6A 3IHUA 3F3XA 3OYLA 2M45A 5TRDA 2DA2A 2QCOA 4LK0F 1YW7A 5E1XA 2WWYA 4DW6A 2PMUA 2GXGA 1FP2A 3G73A 4HSRA 5EYRA 3T1BA 1ETQA 3VFZA 2HOSA 3BZKA 1UAAA 2KISA 2VT2A 2HTJA 2PFBA 2CJJA 4C2MJ 1AKHA 3OYJA 2JZYA 2O8XA 2ZBKA 1OCOH 3CMEI 1GUUA 2LNBA 2NVYJ 3C3WA 2XF5A 5HLIA 1MW7A 2FQ4A 4A0XA 1JT0A 2W57A 5F64A 4M74A 3R4KA 1I3QJ 1QVTA 2XB5A 5IYDJ 3MAJA 1F9NA 1P4AA 3U9GA 2M87A 4NHJA 3H9GA 2UUZA 1OYIA 4IVNA 3JRDA 4A3FJ 2WTEA 2PLYA 1O57A 2E7XA 4RLQA 4CH7A 1J5YA 4M6XA 1MBEA 1JHHA 1RR7A 4GO1A 4I99C 1HQCA 1E17A 4OU0A 2FBHA 2F5CA 2X6WA 4KIFA 3TDZC 1F36A 1XGMA 2Y30A 3FM5A 3MMYB 3J7AY 3O2PE 3EYYA 2Y0MA 5LGTA 1I5ZA 3P7NA 4D7NA 2KIQA 1YW8A 3OYEA 3I53A 3CUOA 5ILSA 5JR3A 1YJ9I 2NVQJ 4XR6A 3TOBA 2X48A 5C44J 2R7QA 3D5SC 2V1XA 3GFIA 4BQOA 5K7FA 3V8LA 2R5YA 1J2XA 3BR1A 2EQRA 1KU7A 4P9UA 1IN4A 5DEQA 3GWZA 1G6NA 2N8GA 1TQPA 3SDGA 1S6LA 2QQAA 3A0HC 3V7RA 3VEPA 5E8GA 1W7PD 3V8JA 4RB2C 3QPTA 1ZR2A 3MZHA 2OTLI 2W4SA 3KPHA 3BROA 4HLXA 2R5ZB 2NS8A 4CZZA 3LFKA 2DMPA 2A3SA 3L9FA 1WCMJ 3MKYB 2CQNA 1X1PA 2L0KA 3F22A 1X3UA 4BE2A 4B09A 1ZELA 1WJAA 2OUMA 1WJEA 2ID3A 3M8JA 1G3TA 1WPKA 4ENJA 1LB2A 3OYMA 1Z3XA 1O3TA 3C7JA 4HNUA 4L0ZB 1IUYA 4M3EA 1G8XA 1Q1VA 1Z91A 1TC3C 3GW2A 3EPZA 1FIPA 2CH0A 4RAYA 1WWXA 4IRGA 4LJZF 4U87A 4A12A 5LGUA 3GUDA 4I02A 2NS0A 2W00A 3DBLB 3ZMSA 2VBWA 2J5OA 4B48A 3QPLA 4AIJA 3I5UA 3HRUA 3HHHA 2X1EA 3BP8A 4AVPA 4XKCA 4ZYDA 2CS3A 3DFGA 4NB5A 2JQ7A 2VLAA 2VOPA 4G7HF 3S16J 1FTZA 1A6QA 4JX6A 4E7LA 4IRIA 3E3VA 1FLIA 1B9MA 2LF7A 3CCJI 5TJJA 2YUSA 4OIQF 1U3EM 4I0AA 2WAEA 2H09A 5DD8A 1H88C 5FD6A 2R7ZJ 2ESHA 4FASD 4NNJA 3L2CA 4JX5A 2Y48A 4KMUX 2GLOA 1F4KA 4E4HA 5FFZA 3ULQB 2W85A 3RPUA 9ANTA 5JHUA 3C1DA 1YRNB 2P6TA 4E70A 2ELHA 3J80Z 1ZREA 3T0YA 1SVLA 3WGHA 1XTAA 2H94A 3CP2A 1LDKB 3CLOA 3MN2A 2NVTJ 2Y9ZA 2G7HA 4A6DA 3DV8A 3CLQA 4BJ6C 2HGCA 4I09A 3BJAA 1Z6TA 3CCEI 1DUXC 2FF4A 3ABKH 2DYRH 4BY7J 1XGNA 3LSGA 4HA8A 3KEQA 4O6JA 1XDSA 4JYKA 2WY8Q 5GPAA 3OS1A 2PMHA 2HNHA 1WKMA 2K9NA 1TZLA 3JSPA 2V79A 2CUFA 3CCMI 4ZZLA 5GAHJ 1ZN2A 2L3DA 2LRDA 3S32A 1SC7A 1OISA 5K5QA 3H5NA 1D5YA 2XPWA 2DTZA 4L9NA 2Q1ZB 3GLLA 1J75A 2E1MB 3CC7I 4IHVA 4U88A 2IEKA 3K1PA 4KICA 2R5ZA 1BC7C 2GM4A 2P5LC 1BBYA 1BI2A 3HG9A 3K2ZA 2HU9A 2YX7A 1R7JA 2O03A 5F04A 1Y6IA 1MBGA 3FXQA 3I0TA 3LA3A 5JHFA 2CQQA 2IGOA 2IP2A 4OWRB 4AIKA 2ME0A 2E1NA 3GZ6A 1MBFA 3IC7A 4LITA 3K70C 4UUTA 1BJAA 3PSFA 4PGGA 1MBKA 3EYIA 2BXZA 1UHSA 1T0FC 1VFCA 2BY0A 5BS6A 1Z21A 3JRAA 3F8MA 3RZOJ 1JUMA 1R1TA 2M0MA 1KZHA 3O8GA 1TQMA 1SD5A 1JHFA 2BY1A 2Y2ZA 3EDPA 4GRIA 2GA1A 1BN5A 2ZXJA 5J40A 1RZ4A 1PUFB 2LY2A 1WH5A 4E7HA 3CDHA 2RQQA 1MZBA 4F3QA 1MMNA 5KAIC 4BHBA 4EJOA 3JRFA 2ESNA 3VB2A 1JE8A 3GZNB 1Z6RA 3LSMA 3JRBA 4HDUA 5GPCA 2OQRA 3S3OA 3CMMA 3M1EA 2VBYA 4L18B 1U9OA 1TT5B 1POGA 2DJIA 1VQ9I 1BR2A 1S7EA 2PEXA 4RB1A 3CJRB 1Y8QB 2A6HF 1FSEA 4A3EJ 2TCTA 4CDGA 1N25A 1S9HA 2BVMA 3R0AA 2MSYA 1LE8A 5JFRA 2OAZA 2VOOA 2JA8J 2GIZA 1X4OA 3QP6A 1YRNA 4BE0A 5HDNA 1PVEA 3K1MA 3K9TA 1MNMC 2JN6A 4RGRA 3OS0A 2VODA 3CMYA 1FOKA 4QWQA 4DYQA 3IWZA 2VJJA 3KP7A 3PJRA 3VOEA 2IS4A 1RIOH 2GQQA 1P6RA 1FYMA 1EH6A 1G3YA 1Y1VJ 2DA4A 2Z2SB 4A3JJ 2YX4A 3GBGA 3SZPA 1Z0XA 5D5UB 1TT0A 3ABUA 5ICCA 1KGSA 4GDFA 1ZLJA 3S8PA 4BYYA 1ZRFA 1RNLA 4CCLA 2X1DA 3SZTA 4X1EA 1GLNA 1HDDC 3F8BA 3FMSA 1IRZA 1FMVA 2RDPA 1RPWA 3VPRA 1D0YA 3GTLJ 1TWAJ 5DCMA 2V9KA 4NQWB 2H1KA 2DK8A 4XSXF 1SFKA 3R6SA 1SFOJ 1JKQC 1NH3A 1UB9A 2BW3A 5KVRA 2VT3A 1HCRA 4DGWB 5CPRB 4RGSA 2W24A 1TWGJ 2HTSA 4RBOA 2ZMEA 4ESBA 4KA4A 4A3MJ 2CQKA 1MGTA 3H1CA 3G1MA 4MGRA 2VJ4A 1XC5A 2ECBA 3OIQA 2HEOA 4IJAA 4A2UA 1U8BA 3EETA 1KQ8A 1UHWA 1OR7A 2XAGA 1N75A 2EZHA 4HX8A 4XLAA 5E18F 3LL7A 2B9SA 1S7AA 2MYSA 3L00A 2WA0A 4UB6C 4XLCA 1SVOA 1F1ZA 5IOYA 4CICA 3F72A 5IYBJ 3DPLC 2G0EA 2LC2A 2BE5F 1VQ4I 2EB7A 1S7OA 4Q47A 1QO0D 1QVUA 4OIOF 4ITVA 1SMTA 3BZCA 4L9TA 4XOPA 2E35A 5FKOA 2DQLA 3FF5A 4MTEA 1WFXA 1UZCA 5LRRA 3RQ4A 4E7ZA 4YELA 2H8RA 4IPAA 5DDGA 1D8JA 1FIAA 1OCZH 3CJTB 3B6AA 4OAZA 2O5RA 4AD9A 2RVCA 2D5VA 1FBUA 4U0WA 1RKWA 4A69C 1E3HA 1H9GA 2YU3A 3V4GA 2VN2A 1STZA 2BY3A 4EJWA 1XG1A 5DCFA 2I8DA 2OZUA 3DEEA 1FMWA 2X0LA 1BC8C 3R60A 2FRHA 4A93J 1OCTC 1TL8A 2E71A 2ZMEC 3CCRI 4LG0B 4W1UA 1F43A 2K9LA 4GXOA 4HG2A 3KEOA 3ZQQA 4DBQA 1R4MB 3FK7A 3GX4X 4ENKA 5FKMA 4D7MA 2DOFA 2DA3A 5LD2C 1GXPA 3KZZA 1OR7C 1MBHA 2CW7A 3FBIB 3GFJA 1D0XA 1ZLKA 2TDXA 2EV0A 4NUBA 1MDMA 3UKGA 5HDKA 3HDDA 2CQ7A 1ETOA 1OLTA 1U5TB 5IT3A 4RGUA 4ZYEA 3H0GJ 4LD5A 3TBIA 2VE9A 1G3WA 2ZJPF 1XSVA 3TOAA 4EM2A 5M3MJ 3HGYA 1NHAA 2EFPA 1BOAA 3WTUC 4PDKA 1IXSB 3BDDA 5K1YA 4FQGA 2HXOA 1WH7A 1D3YA 2KT0A 4HF0A 2LP0A 3BT9A 3WGIA 2XKOA 2ZJRF 4FISA 4NQWA 2DYSH 5DD4A 2O9LA 2X6YA 2P7VB 5LHHA 5B3SH 4O5VA 1APLC 3J81K 2ZSHB 3H3ZA 4AIDA 5FKKA 1K6OA 1Y0UA 4BJ5C 1W36D 3WTZA 1D1BA 1ON1A 3ZGKA 3NAUA 4KNYA 1X58A 2LSOA 3PSIA 4C3HJ 2PX9A 5CVRA 4IZZA 3I56I 1T56A 5DS9A 2IBDA 3DPTA 2MLGA 3JR9A 3HSFA 4RA2A 3LFUA 4IHWA 4BH9A 3QODA 5CQEA 1S5LC 3U1KA 1T08B 3ZQCA 2R7UA 2DFHA 1T95A 3M9AA 3O6BB 2Q2EB 4F7ZA 1D1AA 1JUSA 4XQFA 2HQAA 2Y31A 3WTWC 2Q8KA 3DEWA 2DT6A 3S93A 2A6TA 4M72A 1DDNA 5J8CA 3DTIA 2DMQA 2LY1A 1J09A 5FLXK 4BNCA 2O3FA 3IAM2 5E3MA 3FXMA 5FLXZ 2C6YA 1KU2A 4MQ9F 2BGCA 3TGNA 5CVUA 1GT0C 2KMUA 4I7HA 5B66C 3GZ5A 3L2UA 4FCYA 2QEXI 2DU9A 2JUCA 2QENA 3ZQ7A 3PM1A 1LEAA 4CZCA 3ZMVA 3WTXC 4R8HA 1A35A 2ELKA 1YQAA 2VXDA 1XN7A 2EIKH 4QPQA 1DGWY 4M71A 3EUKL 3CTAA 1X2MA 2XHKA 5AONA 2V4JC 3LSHA 1LUJB 2BXYA 1EA3A 3KLNA 3BR2A 3P9IA 1MJBA 2H6CA 3PUFA 1Z3YA 4IQJA 4A3BJ 4XIDA 2GAUA 2HWVA 4HLYA 4Y33A 1G4DA 5ILUA 1GXQA 1U5TA 1R00A 3A0BC 2J5PA 3P9CA 3RSNA 1Q1HA 3KP2A 2I5UA 4EJTA 2CUEA 3WG9A 4M6YA 4B47A 5GADJ 5LLQA 1IJWC 3VSKA 2LOOA 4D5CA 3SYTA 2GXAA 4KITB 3EQLF 1YOVB 2VIXA 2BVLA 3ZN1A 4EJVA 1ZG5A 3MZYA 4KT6A 1XCVA 3DU5A 5LHGA 4TV7A 3OYKA 3B02A 2PMZA 1W7PB 3HOUJ 1FX7A 3PNVA 3WU1B 1R49A 2EZLA 2XAQA 2OZ6A 2TRTA 3KETA 4XLFA 3WE2A 2VC0A 3KEYA 3BR5A 3ZN0A 1I39A 1WJCA 2XF7A 3OMYA 2M1BA 2FXAA 2YU9J 2MC4A 3S17J 2DJNA 2LY9A 4PGHA 3L2RA 4KDPA 2FOWA 1YIOA 2EJRA 1UHMA 3WTYC 3GTKJ 1YLFA 3CDLA 3NQOA 4C30A 2STWA 2EBIA 2V7FA 5CKTA 2Q0OA 2G9WA 3W2AA 1ZKGA 1K4TA 5BMZA 2EK5A 1U5TC 3WE3A 2CO5A 3Q0UA 5LEJA 3BQYA 2XAFA 2L7KA 2HR3A 4P96A 1ERDA 3RKXA 1DU0A 1H9TA 4HV6A 3S1QJ 1ON2A 1V5EA 2E19A 2DTRA 3AFHA 1W1WE 4ABZA 3DU6A 2ZFUA 1YX5A 4Y15A 2QKMB 1XMXA 1WRJA 1R4NB 5DV5A 4CCKA 1DQUA 3MZ8A 2LREA 3QP5A 2V1NA 4MEXF 2ZCWA 5E8IA 3N4MA 4IOAF 1JKRC 5FD5A 4KMFA 1WGXA 1BW5A 2O7OA 1VQLI 5EDNA 2AS5F 1X2NA 3C18A 2MW8A 4EJUA 5IYCJ 2OF7A 1JJ6C 2AHQA 3M3YJ 2ZO4A 2P4WA 3I59B 4RM3A 2E34A 3BWGA 3S1RJ 1ZAOA 3TMOA 1EF4A 3V7CA 4S04A 3OSFA 2QQBA 2K3PA 1OCCH 1D5VA 1B59A 2HYJA 2DODA 3CQZJ 4KJZA 5B1AH 4YFNF 4B4CA 4LLLA 3TO7A 2A6EF 2LBFA 2XGEA 4G94A 1SFUA 1BL0A 2KJCA 4PJNA 2R7TA 4A3CJ 2PMZN 3K7AJ 3DLAA 4XOTA 4IRHA 3K1NA 5K7HA 3FISA 1L0OC 4PSXA 3ZQIA 1SD7A 3E6CC 1RKTA 2DA7A 2BY2A 2AXLA 4RS8A 2DLLA 4S0HB 5JI6A 1LFUP 2KRFA 4XSZF 1R36A 3UNGC 2KIUA 2PJRB 4WK8F 3DTKA 2ACJA 3KYDB 1HBXG 1HXDA 2HQ5A 2RAEA 3PNTA 3TEDA 2UXNA 1FY7A 3ERED 3BG5A 4UUSB 1ETVA 1I50J 2A05A 3FM3A 4RGXA 4D5FA 1K78A 4DQ2A 4ZDOA 2WAQA 1QZZA 2MLKA 3BLYA 1LVAA 4XRFA 3SFZA 3OR1C 2L9SA 1C0WA 1HKQA 1VTNC 2DT5A 1YW9A 2ICWG 2IPQX 2OV7A 2VKHA 5L3DA 5DYMA 2GWRA 3M07A 4PJJA 4QLCU 5LEKA 2DXIA 1QPIA 4UY8I 2XRLA 3A1YA 1FOYA 3Q9SA 3PQJA 2HQNA 3IP4B 1IN5A 3S2WA 2DFFA 4V2GA 3ABMH 4A5NA 1YX3A 3HOXJ 3I71A 3U21A 4BQQA 4G12A 2R3SA 2D1HA 4MO7A 5D5XB 3BJ6A 2WV0A 2V1UA 2VJ5A 5A2QZ 3QWLA 2V6EA 2KPMA 2F6CA 2EZKA 3L09A 2FE3A 2AQEA 3LMMA 4AM3A 2Z3YA 1K61A 2Z5UA 1QZYA 2CYYA 4I01A 2VQHA 3QOEA 5J47A 1W5TA 2CV0A 1LFPA 3RYPA 2H8WA 2KL4A 2CFOA 1X19A 2L54A 4BAYA 2GOMA 2M2EA 3CZ6A 1FWZA 5F08A 3QU6A 3ABLH 2R7SA 1IN6A 1BI3A 3H92A 2NS7A 3E6MA 5IY5H 3G6EI 3CESA 2P5KA 2ZXIA 3I59A 3RYRA 4PJ0C 5K7ZA 2HYGD 2DT7B 3HOVJ 2OPTA 2M4GA 2XDVA 1B4AA 2KZGA 5JLXA 4XRSA 3HIFA 4ESJA 4M9SA 3E5UA 3M7GA 3G1LA 4OIPF 3GMEA 2UZKA 2HFHA 2KDZA 1R9TJ 4XLPF 1MIJA 4MFDA 3WTVC 1YI2I 2K02A 1ZQ3P 3PFYA 4BJTA 3E5XA 2WAQN 1PYVA 1RESA 3C2BA 3HRTA 3J80K 4Y3OA 1MKMA 2A5WA 2HVSA 1T0FA 4UB8C 3RJPA 3W2VA 1JUPA 1LVKA 5L3FA 3JRCA 5IT9K 2EINH 5IT9Z 5LGNA 2EH3A 2QGUA 2HI3A 1OJLA 3PO2J 2F4OB 3S2HJ 3ZMDA 5D6FA 5HNHA 3BTIA 4KIBA 3TW6A 3CO7C 3WHCA 4EATA 3OS2A 1LKXA 3ELKA 4IHYA 2MH2A 2P6SA 4G6QA 2VJIA 3MKLA 1ETKA 5DM6F 3JAMZ 2YR2A 3IKTA 3W6KB 3K4BA 1WVRA 1KA8A 2D2WA 3SJMA 3RQIA 2M8EA 2X1CA 2X6XA 3E6DA 3SDBA 3L2WA 4IHXA 4BQAA 3DF8A 4DYRA 5KAFC 2CMPA 1EKEA 4CYCB 1ITYA 4MHGA 2L4MA 3GTJJ 4HNTA 3SZGA 1Z9CA 4MTDA 3RPUD 3CP8A 1K6YA 2L7MP 5E3NA 3F21A 4BACA 4YFXF 3BTCA 3CCYA 2W25A 2M9HA 2LMDA 2XRNA 1BOBA 1CGPA 1QGPA 5J1YA 5EEGA 4HRIA 1MH4A 3ASNH 4M6VA 1IRXA 1TNSA 3CF2A 3ABTA 3SEQA 3H5AA 4ZDPA 2HOAA 2RNJA 2NOJB 2E1OA 1XSDA 4MIMA 4WXHA 3JCUC 2DBBA 3HHGA 3AAFA 1O3SA 3E0JB 3REOA 4ZZDA 3CJNA 2VQGA 5EGOB 5D4SA 5HLHA 3IH3A 1YITI 2B7EA 4W97A 5JVGF 2X4HA 2CV2A 3C2GA 1IXCA 1FYKA 2Z99A 2M0CA 3J7YJ 1DU6A 4U7DA 2A5YB 3TDUC 3GTPJ 2NAZA 2EWNA 3I64A 4BDYA 3CF5F 1ZGWA 4I2OA 2X85A 4BXUA 1ETXA 2RREA 4S05A 4FE4A 1QNTA 3FXRA 1TNTA 4AC0A 2F4MB 2XF6A 2F5DA 2A07F 3D5RC 3LWFA 1PUEE 3FBNB 4F52A 4HF1A 2ZKZA 4C2TA 3OOPA 3Q3SA 3ZMZA 3C2HA 4XLHA 3CUQB 2JA2A 2LH9A 4YG2F 4E6KG 1J9IA 1IUFA 1X3ZB 1BIBA 1WQ2A 5M5XJ 4L5EA 2BZTA 1IN8A 4WCGA 5FKNA 3WTSC 2JRMA 4KT5C 2ZSIB 3VYSB 2EFNA 3S2DJ 2JT1A 2E5ZA 1DGRM 4YIRX 2VBZA 3UR3C 5LBQA 4CA0A 5F0FA 1A31A 4GYGA 4XRMA 2QSFX 3K4LA 3F6VA 2VI6A 3M1CA 1IV6A 1NK3P 4J01A 4Q48A 3FHNA 4U0YA 2DMNA 4L9VA 3TQNA 3IRRA 4HQEA 5C4JJ 2R7DA 2JVGA 5EEHA 4AIHA 2R0QC 4RAZA 4FETA 1I27A 3WTTC 1H89C 5CQGA 4BXFA 4LB5A 3V8KA 4BEHB 2BYVE 1HF0A 4G6DA 4HBLA 1J59A 3TO6A 4HW0A 1SD6A 3CCSI 3OYBA 3Q5FA 3BR3A 1OCRH 1ONVA 2UV1A 4ZYAA 2BV6A 1USSA 3SQNA 4FTHA 4HF2A 3HOYJ 3GEZA 2IVMA 1X3WB 1TTYA 2NXNB 3R61A 3P9KA 2JA5J 2ID6A 3HSEA 1IZ1A 3EUHA 5J8FA 4QIWN 3ROUA 3HTSB 4XNFA 1J0RA 1XX5A 1ZRDA 4XBFA 2VUMJ 3OYIA 2L5QA 3AG4H 2R93J 2H27A 3A02A 2IA0A 4IOCF 1LEBA 2XAHA 3DXJF 1UG0A 1D0ZA 1T8IA 3GF2A 1IG7A 1EJ9A 1GV2A 4QTRA 1DPUA 5HLTA 1PUFA 2HKOA 2KP6A 3RKQA 3HPHA 2F5VA 1VF9A 1B8IB 1V3FA 1V5GA 3JRGA 2XGXA 2IA1A 2CGPA 1B72B 1P4WA 1Y1WJ 2LR8A 1HA8A 3K6GA 1H8AC 3BC8A 5AIPA 3S14J 1FC3A 1I1SA 5IP7J 5KK1A 1WJ5A 1MBJA 1Y39A 3SEZA 3MWMA 1WSUA 2E1MC 3H36A 2W7NA 3CC4I 4CSWA 3H9JA 3GFLA 2KRHA 2VKVA 3HJEA 4HEA2 2W84A 3RDIA 4ANJA 4I98B 2FSWA 4CO8A 4C2UA 4NC6A 1TLHB 2GA2A 1M1EB 1UG2A 3FKIJ 5L3GA 4RM2A 2K85A 3T5XA 3EUHC 3ZXSA 5EEAA 3CUQA 2QWWA 3CCLI 1ENHA 2MD5A 5FB2A 3OOUA 1JXSA 3COAC 4A3DJ 2V6CA 3KIOA 2XGCA 5HS7A 3KZYA 5B1BH 3KFWX 2OCCH 4Q4ZF 4M3GA 2LK2A 5DM7F 2DAOA 3G71I 1WI3A 4ZYGA 3GTOJ 1I1GA 4CCOA 2CSOA 5FGMA 4B43A 2NVXJ 2PI0A 2KFDA 2B0LA 1PDNC 4CCJA 4B1RA 2HYFA 1OPCA 3FXUA 4LG3A 5KHDA 3K4NA 1WI9A 3OWTA 4RB3C 2EIMH 3DPUA 2HOTA 2COMA 2BBYA 3AL0B 1UCRA 4G6TB 3ZMUA 1VQMI 2K86A 4PUSA 1P9QC 4G8XA 3E7LA 1K79A 3HBLA 2ADUA 1S29A 2EV6A 3T8RA 1HC8A 2P81A 3HOWJ 4YIIA 3ZR8X 2Z1DA 4RB0A 3V42A 4AU7A 3QRFF 2OU2A 2D1VA 5GTIC 1YO5C 1QPMA 2XV4S 2GBYA 5F0HA 2XUBA 3BR6A 2QYOA 3OIPA 3HTUA 4WF2A 5BOXA 2X51A 3HC7A 2JVHA 1W5CC 3CUQC 5E3OA 3BTJA 3F8NA 3DKYA 1N78A 1U0JA 3MQ0A 1P7JA 2WAFA 1U6GA 1R5HA 1F5TA 2M7BA 2XPVA 2CW8A 3K4CA 1P7IA 2L9NA 2XAJA 1W0TA 1U8RA 4DZPA 4E7JA 2HDDA 5EJCA 3RCOA 3SFIA 3U2RA 1ZG3A 3D0SA 4N0BA 4BU2A 5CLSA 3WG7H 1FBQA 3F8CA 2QUFA 4I76A 4C3IJ 4EM1A 2DA6A 2DK5A 4PFOA 3G3ZA 1B72A 5D4RA 1HDPA 5K5OA 3ISPA 1YHQI 3BQZA 1BI1A 3X2QH 1YS7A 4B3AA 3MKZA 1MNEA 2RV8A 1MD0A 3W6JB 1IAWA 4UV9A 3G1OA 2HVQA 1XCBA 2X6OA 2QLZA 2DPUA 1ZYRF 3VDXA 2DFEA 3U1DA 1SFXA 3ZQFA 3S15J 1KYWA 3FZVA 4XORA 1VZ0A 5M5WJ 3RIRA 2L4AA 1S8NA 3HYIA 2EFQA 4LG0A 1N77A 1R22A 4GGGA 5LHIA 2ZNZA 3JTGA 2FBKA 3HZJA 1LNWA 2P8TA 4UXNA 4LFUA 4BS9A 1YJWI 1P4XA 4N4OB 2WC2A 2KIMA 3MCZA 4IQ4A 2E2IJ 1HW1A 2JK3A 4Y17A 4E7SA 3I4NJ 1W5SA 1RETA 2QA4I 3F9KA 2XC7A 1R1UA 5JVTA 1KONA 1ZK8A 1AKHB 2XSJC 1OKRA 4BBRJ 5BPIA 4RAFA 3H35A 1X4PA 3KCCA 2W82A 1ZGJA 4UNOA 2E1CA 1V54H 2R7FA 3WU2C 3FX3A 4QSHA 3HL2A 3TL4X 4FX4A 3KX2A 2L9VA 5KNLA 3G2BA 3FWEA 1TW2A 1K7AA 3DBRB 2Z33A 2WADA 4DNCA 2MABA 4ZC3A 4RLFA 2F2EA 2LTPA 3Q0WA 4R1HA 5HS9A 1OFCX 2JMWA 4LLNA 2O6GE 1ZH5A 4AYBA 1IO2A 1Z05A 3DBHB 1U9NA 2CW0F 4ON0A 5HODA 2DDAA 5F6FA 1QA6A 1SMYF 4PK4A 4ZDLA 3IRQA 4MLOA 3AG2H 1S72I 4ENMA 2NVUB 1Z67A 3IUOA 3ASOH 4LMYA 4BXXJ 4PSWA 5F27A 2HPIA 2WBMA 2Q2EA 2MD0A 3BCBA 3S3NA 2LFBA 4PJMA 2JA6J 4NC7A 1BW6A 3K10A 1QHHD 2NNNA 5BPDA 2KQRA 2LD5A 1RUNA 3LA7A 3WODF 3HGGA 5FROA 4ZH4F 4L5IA 2V9PA 4A0YA 4OINF 4M3FA 2R5YB 4DOZA 1YFHA 2M5WA 4KN4X 2IJLA 2JSPA 4II2A 2JPBA 2KRCA 3AL0C 1QU3A 2RQPA 1ODDA 4BHCA 2FD5A 3BG3A 4D9JA 4UUVA 4N9HA 5E79C 3BJOA 2R7WA 3WU0A 1D1CA 4BE1A 5ICGA 4RAGA 3OSGA 3PO3J 2GIVA 3KYCB 1VQ7I 1GHCA 2KIFA 4C3JJ 4HDVA 1A36A 4ZJZA 2B63J 3BZ6A 1U78A 2V26A 1E3OC 2LLKA 5IOZA 3DKXA 1ZGAA 4PFPA 4HX4A 1SAUA 2DN0A 2KKOA 1VQKI 3V7SA 4N4NB 4Q5SF 2DMTA 2FNPA 1G3SA 5AIQA 3OYHA 3N97A 2QQ8A 5BQTA 2KHMA 1PP7U 2L01A 4ENNA 1RC9A 2ME6A 4JK1X 4LLGF 1VQ8I 3ONQA 3H3UA 4HSTA 5CVIA 1IRFA 1MMDA 4XMYA 4NBQA 2YS9A 4ZTJA 4KIGA 5J1UA 4X6AJ 4AYBN 1BM9A 2QF7A 5M3FJ 1HW2A 3E97A 1O4XA 3Q9VA 2IS2A 2LDUA 4HNVA 3M8EA 1K4SA 2GZWA 5GP9A 4DBRA 3LNQA 3O8HA 3KYLA 3W6VA 1FOXA 1MMGA 2JA7J 3KLOA 2HKXA 3FMQA 3IKVA 3TKYA 3S3MA 1R71A 4J19A 1T38A 4OMYA 2PBIA 3IWFA 4UV8A 1IDYA 5M5YJ 1W4MA 1W7PA 1SD4A 4D1QA 1TWCJ 2DQRA 1LPQA 1AWCA 3I55I 4EV0A 4U0VA 2M4KA 1O3RA 2NOGA 2ZC2A 2HOEA 1FYLA 4XRSG 5E1WA 4ASNA 4ZTFA 2K9MA 2XSDC 2CU7A 2YSRA 3G4SI 2LKXA 1IGNA 2GXBA 5D8LB 1QQIA 2DW4A 3I9V2 4KUMA 1Y0NA 1XMKA 1YYVA 2W48A 2HVRA 3ZRGA 2ETHA 2XPUA 1BIAA 1H0MA 3H3VK 2L7ZA 4IXAA 4XL9A 5BNGA 2ELJA 4UVBA 4CCMA 2R4GA 2JWTA 4LGWA 1VI0A 3I58A 1PJRA 3QAHA 4Y52J 1YS6A 2IW5A 5FRNA 1A04A 3DKWA 2Y69H 2KLOA 2IA2A 3PL8A 4XKVA 5CVVA 4P55A 3RPQA 4X0GA 3KE2A 2E36A 4BY1J 4Y13A 3D5LA 2IRFG 5A2QK 1T98A 4LIUA 3FXOA 2UWMA 3ZP5A 1R58A 2HXIA 2VL8A 1A6IA 3F0CA 1XGOA 2OA4A 2FEZA 5D8KB 2MG4A 3RZDJ 3HOTA 2OTJI 4WXDA 3TP3A 3Q0VA 3ML6A 5C4XJ 3SHFA 2QKLB 2VQLA 4II3A 5FRMA 2XIGA 4KN7X 2RC4A 3A03A 3W3CA 2E7WA 3A4CA 4UHTA 4ZYHA 3DEUA 3CC2I 4HZFA 4DJAA 5FJ8J 1UELB 2DOEA 3TP0A 3ECHA 2O61A 2A61A 1XDUA 2FMYA 3R0JA 4YIFA 2QBYB 1OQYA 2JRTA 4EEFG 3BPXA 3LAJA 1WHUA 4OMZA 1HOMA 3ERMA 3JREA 1JTXA 2M30A 3OL4A 2OCEA 2UXXA 3HRMA 3K4KA 3OV8A 2LYCA 2M8GX 5HDGA 4YRVA 4IL6C 2F4IA 3PUBA 4A6EA 4F55A 2Z9OA 3PIOF 3LSPA 3KP4A 3BCAA 4JP0A 1LQ1A 3I3LA 4IEJA 2QM3A 3A2KA 3FHZA 2FJ1A 2BHYA 2JPCA 1TBXA 2QSHX 1XB4A 4Y4RA 3OYGA 2V9VA 2PQ8A 3HPGA 2PJRA 4CXFA 4YEJA 1UMQA 1VNDA 1RR8C 2OC6A 1QHGA 5C3EJ 4L9JA 3HM5A 3QOPA 4G9YA 4WXCA 4UUSA 2XKPA 2NRAC 3HOZJ 1J7KA 1P2FA 1MMSA 2R7OA 4FE7A 1K83J 1IN7A 4O3MA 5J6XA 1AHDP 1LE8B 2K40A 1RUOA 2ISZA 5GTHC 3PFIA 4PZJA 3JAMK 4CYDA 3LSRA 3AG3H 3AKZA 2JTVA 4L0YB 1KYZA 1EV7A 1R5ID 3VYRB 2FMLA 2RN7A 3MKWB 2DI3A 3J7AO 1KU3A 3S1MJ 1UFMA 3I4MJ 3LSTA 4MFEA 4RMNA 2P5VA 1B1BA 4EQQA 4NDLA 3WHBA 5HVQC 2K7LA 1RRJA 4AVZA 2QZ8A 3H9QA 3HKZA 1LDDA 1Z7LA 2BEOA 2ZB9A 4BUPA 1FSHA 3GTQJ 4I0BA 1DP7P 2IS6A 4KYWA 1U2WA 3K70D 4BL0B 1W0UA 1B9NA 3BG9A 4QPOA 2M34A 4G7ZF 5FO5A 2VKEA 3ZQHA 2EA2A 2LF8A 3DCFA 3LA2A 4V2FA 3OYNA 1O7LA 2HDWA 3ZMTA 1FJLA 2P0WA 5DCMB 3KZIC 2H1LA 4B3XA 5L3EA 2WV1A 5E20A 2W1OA 3QU3A 1MSEC 4V19K 2HQRA 3OYAA 2BW3B 1IF1A 3JTHA 1AOYA 1SEUA 3RKWA 3LSIA 3PNYA 3MVPA 3SXYA 5H2FC 3J7ZI 2ZMEB 4BGDA 1CQTA 2HS5A 1ZTRA 4J00A 2RKHA 1LDJA 4UVAA 2FOKA 1FEXA 3AG1H 1G2HA 5F1RA 3B6CA 1FPQA 2E2JJ 1JGGA 4KFCA 2QBYA 2EA4A 5IP6A 1T33A 4EGYA 2QSGX 3GXOA 5K5RA 1VQ5I 3VYTB 2A69F 3BG7A 4A3KJ 4XN3A 1XSXA 1ZHFA 1LFBA 2MH9A 4Z6YA 1JKPC 2DA5A 4CUGA 1WJBA 4GCVA 4P9FA 2F5FA 4JOMA 2D45A 4GYIA 1TWHJ 4P1WA 1A5JA 5E17F 4XLNF 1MJ9A 2FU4A 1SVMA 1PP8F 5HNFA 1BJZA 5TISC 5JLWA 2HZDA 1HSJA 1V5FA 2VKDA 2LVSA 4FX0A 4HAMA 1IC8A 1DPRA 2STTA 3LOCA 2KJBA 4WX9A 3I54A 4P5OA 2VBXA 2YPRA 2AO9A 3IH2A 4MEYF 3BR0A 1BR4A 2XROA 1WJFA 2ZXHA 4PJLA 2EZIA 1R1VA 3HKZN 2AXTC 4PCQA 4XONA 2E60A 4DIQA 5CYVA 1X1CA 5ERIA 2OD5A 5J3LA 4D0PA 2EFWA 3PIPF 4WWCA 3OYFA 5EZGA 3F8FA 2HPMA 4BDZA 4JBAA 3FXJA 1MDMB 1VQPI 3VODA 3JW4A 5FFXA 3BOQA 4JX4A 3DWLE 1I3AA 2VPRA 4CYCA 3KP3A 2DPDA 4EVIA 1FTTA 2FQ3A 3BTLA 2FX0A 3DQVC 1HSTA 2A68F 4BBSJ 3OL3A 1GVDA 2AQFA 2EFOA 4M9XA 2CG4A 3TW7A 3H0DA 2K4BA 1B6AA 2WB1A 1MMAA 3ECOA 5EG0B 4BKXA 2M3AA 5J1RA 5LFAA 2R7VA 2K9SA 5DUIA 1QZEA 1UJ8A 4HV5A 3CJQB 3HRSA 3KP5A 5F1JA 1HLVA 2VASA 2DCEA 1Y8RB 2P7CB 3HOSA 4RDUA 4F93B 2PG4A 1O3QA 2ZFWA 2CQXA 2L02A 3NEUA 4XLEA 5IPAA 4H4KC 1GVJA 4XN0A 1YE9A 5HOOA 4FHTA 4AUXA 3NWTA 2NYXA 2COBA 4XKBA 1ETYA 4M3DA 5L3CA 5EGOA 1ACIA 2K5CA 1R5GA 3K4MA 3ZPLA 4G7OF 6PAXA 2DMUA 2M7AA 5FKLA 3D1NI 1BI0A 2VQCA 3L2VA 1T2KA 2XGDA 2VC1A 5B5EC 1OYYA 2KZVA 2L9RA 4LK1F 1HKSA 4CCNA 2Y0SA 5J4VA 1YJNI 3QQAA 4R79A 3OR2C 3TO9A 5FLMJ 2NNYA 4E7IA 2OJED 1IXRC 2E5NA 4ETSA 3MEXA 4E7KA 1OMIA 2XAUA 3FIWA 2VPLA 5EF6A 5H20A 1QBJA 3IH4A 3QYBA 1Z1DA 2G7UA 1KQ9A 4M73A 5F0CA 2EIJH 3VYUB 2OBPA 2EV5A 5CJ9A 3JRIA 2QQ9A 4HOBA 3DLLF 2IAIA 3DP7A 3CD6I 3E5QA 1SANA 3BG6A 4FT8A 3VWBA 3GTMJ 4HQMA 2IT0A 2GOXB 1TW3A 5FLVA 4Z2YA 3F6OA 2ZJ2A 5E1ZB 2MBFA 4AWXB 3HUGB 2F48A 5ED4A 1NK2P 2MFZA 2XB0X 3B73A 1EH8A 3NARA 2R92J 3FKJA 3CMAI 2VONA 4U7BA 2Y9YA 3FXLA 3H5RA 3NWSA 5H6RA 3M4OJ 2WY7Q 5L3BA 1NG7A 4HPQA 1IV8A 1FNNA 1MH3A 2WB1N 2IXSA 4Y7NJ 4OIRF 3K0LA 3GO5A 3K69A 4MNUA 4A0ZA 1JTYA 1V55H 1HW5A 1S3JA 2MC3A 3M8FA 2IGKA 4BHPA 1MSFC 3GFMA 2FUG2 3I4PA 3PQKA 4A3GJ 4BEHA 2ZXWH 3T8TA 3A01B 2X9DA 2JSCA 2VB6A 1QRYA 2MGQA 3HSRA 3GCMA 3BPVA 2BHZA 5EG0A 3O3KA 1CF7B 1USTA 2CRGA 4DYCA 3OY9A 3MD2A 4A3LJ 2CFXA 3NRVA 4EM0B 3OYCA 3LSKA 3E1SA 1AU7A 2Z16A 4XK4A 1HKTA 2IGMA 2V1DA 3LQQA 2K3FA 2PJPA 1VQ6I 1P92A 4XKWA 2Y0SN 5HS8A 1TWFJ 3K4JA 4OOIA 3J81Z 3LAPA 2K27A 1AA7A 3HB9A 4LOCA 3W2WA 3CCVI 1JI8A 2KDOA 4JQFA 4MQVA
chains in the Genus database with same CATH topology
1ULYA 4CGZA 2ZNYA 3GVAA 2H6BA 1MJAA 3E6BA 3WGGA 2DFIA 4H0EA 5D6EA 1L3LA 4EGZA 3IL2A 4HX7A 5ILVA 4IF4A 2XASA 2FBIA 3FMRA 1T39A 3BY6A 5H6QA 2PN6A 2MA3A 4LB6B 3JSOA 3RKYA 1FT9A 4HYEA 4CHUA 4N9IA 2OQGA 2VE8A 3GYHX 1I6XA 2F5EA 3CO6C 4B8XA 3HUGA 4IHTA 1XMAA 5ICEA 1XGSA 1IRGA 1ZRCA 2O0YA 2RGVA 1FBSA 2Y75A 1EH7A 2LKPA 4K2EA 1R23A 2K4JA 1E2XA 2CWEA 2VXZA 3RTRA 2QVOA 1V4RA 1Z7UA 3RI4A 1SFEA 3F23A 1T6SA 5D5VB 4M9ZA 1JGSA 1RI7A 2HZTA 1TQIA 2FA5A 1LJ9A 4A5MA 2FNAA 3MFKA 1CF7A 5DUKA 1SAXA 5LRSA 3LQRA 5D5WB 1YTYA 1D8KA 1FZPB 1XD7A 3GLXA 5HLGA 2ISYA 4YFKF 1K78B 5ICFA 5CVJA 4L5JA 4EMSA 1YG2A 1ZARA 1OYWA 1KU9A 2XVCA 2DO7A 4UVCA 4ESFA 4IHSA 1ZG1A 1REPC 3L7WA 3KP6A 1IW7F 1FP1D 3QPHA 2HDCA 1KQ0A 1O7FA 3IHUA 3F3XA 2M45A 5TRDA 4LK0F 1YW7A 5E1XA 2WWYA 2PMUA 2GXGA 1FP2A 3G73A 3T1BA 3VFZA 2VT2A 2HTJA 2PFBA 2JZYA 2O8XA 2ZBKA 2LNBA 3C3WA 5HLIA 4A0XA 2W57A 5F64A 4M74A 3R4KA 3MAJA 1F9NA 1P4AA 3U9GA 2M87A 4NHJA 1OYIA 4IVNA 2WTEA 2PLYA 1O57A 2E7XA 1J5YA 4M6XA 1JHHA 4GO1A 1HQCA 1E17A 4OU0A 2FBHA 2F5CA 4KIFA 3TDZC 1XGMA 3FM5A 3O2PE 3EYYA 2Y0MA 5LGTA 1I5ZA 3P7NA 1YW8A 3I53A 3CUOA 5ILSA 5JR3A 3TOBA 2V1XA 3GFIA 3V8LA 1J2XA 1KU7A 4P9UA 1IN4A 5DEQA 3GWZA 1G6NA 1TQPA 1S6LA 2QQAA 3V7RA 3VEPA 5E8GA 1W7PD 3V8JA 4RB2C 3QPTA 3MZHA 3BROA 4HLXA 4CZZA 3LFKA 2A3SA 3L9FA 3F22A 1X3UA 4B09A 1G3TA 4ENJA 1LB2A 1O3TA 3C7JA 4L0ZB 1IUYA 1Z91A 3GW2A 4RAYA 1WWXA 4IRGA 4LJZF 4A12A 5LGUA 3GUDA 4I02A 2NS0A 3ZMSA 2VBWA 2J5OA 4AIJA 3I5UA 3HRUA 3HHHA 3BP8A 4AVPA 4ZYDA 3DFGA 4NB5A 2VOPA 4G7HF 1FLIA 4IRIA 3E3VA 1B9MA 2LF7A 5TJJA 4OIQF 1U3EM 4I0AA 2H09A 5DD8A 5FD6A 2ESHA 3L2CA 4KMUX 2Y48A 1F4KA 5FFZA 3ULQB 2W85A 3RPUA 5JHUA 3C1DA 3J80Z 2P6TA 2ELHA 4E70A 1ZREA 3T0YA 3WGHA 2H94A 1LDKB 3CLOA 2G7HA 4A6DA 3DV8A 2HGCA 4I09A 3BJAA 1Z6TA 1DUXC 2FF4A 1XGNA 4HA8A 3KEQA 4O6JA 1XDSA 2PMHA 1WKMA 3JSPA 2V79A 4ZZLA 1ZN2A 2L3DA 5K5QA 4L9NA 1J75A 4U88A 3K1PA 4KICA 1BC7C 2P5LC 1BBYA 1BI2A 3K2ZA 2YX7A 1R7JA 2O03A 3FXQA 3I0TA 3LA3A 2IP2A 4AIKA 3GZ6A 2E1NA 3IC7A 1BJAA 4PGGA 3EYIA 5BS6A 3F8MA 1R1TA 1TQMA 1SD5A 1JHFA 3EDPA 2GA1A 1BN5A 2ZXJA 1RZ4A 3CDHA 1MZBA 4EJOA 4BHBA 2ESNA 3VB2A 1JE8A 1Z6RA 4HDUA 2OQRA 3M1EA 2VBYA 4L18B 2PEXA 4RB1A 2A6HF 1FSEA 4CDGA 3R0AA 5JFRA 2OAZA 2VOOA 3QP6A 5HDNA 3K1MA 3K9TA 4RGRA 2VODA 1FOKA 4QWQA 3IWZA 3KP7A 3VOEA 1RIOH 2GQQA 1P6RA 1FYMA 1EH6A 1G3YA 2YX4A 5D5UB 3SZPA 3ABUA 5ICCA 1KGSA 1ZLJA 4BYYA 1ZRFA 1RNLA 3SZTA 3F8BA 3FMSA 2RDPA 5DCMA 2DK8A 4XSXF 3R6SA 1UB9A 5KVRA 2VT3A 4RGSA 2W24A 2HTSA 2ZMEA 4ESBA 4KA4A 2CQKA 1MGTA 4MGRA 2HEOA 4IJAA 4A2UA 3EETA 1KQ8A 1UHWA 1OR7A 2XAGA 4HX8A 5E18F 1S7AA 3L00A 1F1ZA 4CICA 3F72A 3DPLC 2BE5F 2EB7A 1S7OA 4Q47A 1QO0D 4OIOF 1SMTA 4L9TA 2DQLA 3FF5A 4MTEA 1D8JA 5LRRA 4IPAA 5DDGA 4AD9A 2RVCA 1FBUA 4U0WA 1H9GA 2YU3A 3V4GA 2VN2A 1STZA 4EJWA 5DCFA 2OZUA 2X0LA 1BC8C 3R60A 2FRHA 4LG0B 4GXOA 3KEOA 3GX4X 4ENKA 1GXPA 3KZZA 3GFJA 1ZLKA 2TDXA 2EV0A 1MDMA 5HDKA 1U5TB 5IT3A 4RGUA 4ZYEA 4LD5A 2VE9A 1G3WA 1XSVA 3TOAA 4EM2A 1NHAA 2EFPA 1BOAA 3WTUC 4PDKA 1IXSB 3BDDA 5K1YA 1D3YA 4HF0A 3WGIA 2XKOA 4NQWA 5DD4A 2P7VB 5LHHA 4O5VA 3J81K 3H3ZA 1K6OA 1Y0UA 3WTZA 1ON1A 4KNYA 2LSOA 5CVRA 3DPTA 2MLGA 3HSFA 4BH9A 4F7ZA 3O6BB 3M9AA 3WTWC 2Q8KA 4M72A 1DDNA 5J8CA 5FLXK 4BNCA 2O3FA 5FLXZ 2C6YA 1KU2A 4MQ9F 2BGCA 3TGNA 5CVUA 4I7HA 3GZ5A 2DU9A 2QENA 3ZQ7A 1LEAA 3ZMVA 3WTXC 4R8HA 1YQAA 1XN7A 4M71A 5AONA 3CTAA 2XHKA 3KLNA 3P9IA 1MJBA 2H6CA 2GAUA 2HWVA 4HLYA 1G4DA 5ILUA 1GXQA 1U5TA 1R00A 2J5PA 3P9CA 1Q1HA 3KP2A 4EJTA 3WG9A 4M6YA 5LLQA 3EQLF 3ZN1A 4EJVA 1ZG5A 3MZYA 1XCVA 5LHGA 4TV7A 3B02A 1W7PB 1FX7A 3WU1B 2XAQA 2OZ6A 3KETA 3WE2A 2VC0A 3ZN0A 2M1BA 2FXAA 4KDPA 4PGHA 1YIOA 2EJRA 1UHMA 3WTYC 1YLFA 3NQOA 2STWA 2Q0OA 2G9WA 5BMZA 2EK5A 1U5TC 3WE3A 2CO5A 5LEJA 2XAFA 2HR3A 4P96A 3RKXA 1H9TA 4HV6A 1ON2A 2DTRA 4Y15A 1WRJA 5DV5A 3QP5A 4MEXF 2ZCWA 5E8IA 3N4MA 5FD5A 4KMFA 2AS5F 3C18A 4EJUA 2ZO4A 2P4WA 3I59B 3BWGA 1ZAOA 3V7CA 4S04A 2QQBA 1D5VA 1B59A 4YFNF 4LLLA 3TO7A 2A6EF 4G94A 1SFUA 2KJCA 4IRHA 3K1NA 1L0OC 1SD7A 3E6CC 2AXLA 4RS8A 2DLLA 5JI6A 2KRFA 4XSZF 1R36A 2KIUA 4WK8F 2ACJA 1HBXG 1HXDA 2UXNA 1FY7A 3ERED 3FM3A 4RGXA 1K78A 4DQ2A 1QZZA 2MLKA 1LVAA 4XRFA 3SFZA 1C0WA 1HKQA 1VTNC 2DT5A 1YW9A 2IPQX 5L3DA 5DYMA 2GWRA 5LEKA 4QLCU 3Q9SA 3PQJA 2HQNA 1IN5A 3S2WA 4A5NA 3I71A 2R3SA 2D1HA 5D5XB 2WV0A 3BJ6A 2V1UA 5A2QZ 3L09A 2FE3A 2Z3YA 2Z5UA 1QZYA 2CYYA 4I01A 1W5TA 3RYPA 2L54A 4BAYA 1FWZA 3QU6A 1IN6A 1BI3A 3H92A 3E6MA 2P5KA 3I59A 3RYRA 2HYGD 1B4AA 3HIFA 4ESJA 4M9SA 3E5UA 3M7GA 4OIPF 2UZKA 2HFHA 4XLPF 3WTVC 2K02A 3E5XA 3HRTA 3J80K 1MKMA 1T0FA 3RJPA 5L3FA 5IT9K 5IT9Z 5LGNA 3ZMDA 5D6FA 4KIBA 3CO7C 3ELKA 2MH2A 2P6SA 4G6QA 3JAMZ 2YR2A 3IKTA 3W6KB 1KA8A 2D2WA 2M8EA 3E6DA 4BQAA 3DF8A 4MHGA 2L4MA 1Z9CA 4MTDA 3F21A 4YFXF 2W25A 2XRNA 1CGPA 1QGPA 5EEGA 1TNSA 3ABTA 2RNJA 1XSDA 4WXHA 2DBBA 3HHGA 3AAFA 1O3SA 3REOA 4ZZDA 3CJNA 5D4SA 5HLHA 2X4HA 1IXCA 1FYKA 2Z99A 4U7DA 2A5YB 3TDUC 2NAZA 2EWNA 3I64A 4I2OA 4BXUA 4S05A 1QNTA 3FXRA 1TNTA 2F5DA 2A07F 3LWFA 1PUEE 4HF1A 2ZKZA 3OOPA 3ZMZA 3CUQB 4YG2F 1J9IA 1BIBA 1WQ2A 1IN8A 4WCGA 3WTSC 4KT5C 2EFNA 2JT1A 2VBZA 5LBQA 4GYGA 3F6VA 4Q48A 4U0YA 4L9VA 3TQNA 3IRRA 4HQEA 2R7DA 5EEHA 4AIHA 4RAZA 1I27A 3WTTC 4LB5A 3V8KA 2BYVE 4G6DA 4HBLA 1J59A 3TO6A 4HW0A 1SD6A 3Q5FA 1ONVA 3SQNA 4HF2A 2BV6A 1USSA 3GEZA 2IVMA 1TTYA 3R61A 3P9KA 3HSEA 1IZ1A 3EUHA 5J8FA 3ROUA 3HTSB 1J0RA 1ZRDA 4XBFA 2H27A 2IA0A 1LEBA 2XAHA 3DXJF 3GF2A 1DPUA 2HKOA 1V3FA 2XGXA 2IA1A 2CGPA 1P4WA 5AIPA 1FC3A 1I1SA 5KK1A 3MWMA 1WSUA 3GFLA 2W84A 3RDIA 4I98B 2FSWA 4CO8A 1TLHB 2GA2A 5L3GA 3T5XA 3CUQA 2QWWA 2MD5A 5FB2A 1JXSA 3COAC 2V6CA 5HS7A 3KZYA 3KFWX 4Q4ZF 2DAOA 4ZYGA 1I1GA 2CSOA 5FGMA 2PI0A 2B0LA 1PDNC 2HYFA 1OPCA 3FXUA 4RB3C 1WI9A 2COMA 2BBYA 1UCRA 3ZMUA 2K86A 4G8XA 1K79A 2ADUA 1S29A 2EV6A 3T8RA 4YIIA 4RB0A 3QRFF 2OU2A 2D1VA 1YO5C 1QPMA 2XV4S 2XUBA 2QYOA 3HTUA 4WF2A 5BOXA 3CUQC 3F8NA 3MQ0A 1U6GA 1R5HA 1F5TA 2XAJA 1U8RA 3U2RA 1ZG3A 3D0SA 4N0BA 5CLSA 1FBQA 3F8CA 2QUFA 4EM1A 2DK5A 3G3ZA 5D4RA 5K5OA 3ISPA 1BI1A 1YS7A 2RV8A 1MD0A 3W6JB 1IAWA 4UV9A 1XCBA 2QLZA 2DPUA 1ZYRF 3U1DA 1SFXA 1KYWA 3FZVA 3RIRA 2L4AA 1S8NA 3HYIA 2EFQA 4LG0A 1R22A 4GGGA 5LHIA 2ZNZA 3JTGA 2FBKA 1LNWA 2P8TA 4UXNA 4LFUA 1P4XA 2WC2A 2KIMA 3MCZA 1HW1A 4Y17A 1W5SA 1R1UA 5JVTA 1OKRA 5BPIA 3KCCA 1ZGJA 4UNOA 2E1CA 2R7FA 3FX3A 4FX4A 3FWEA 1TW2A 1K7AA 2Z33A 4DNCA 2F2EA 4R1HA 5HS9A 4LLNA 2O6GE 1ZH5A 1Z05A 4ON0A 2CW0F 5F6FA 1SMYF 3IRQA 4ENMA 4LMYA 2Q2EA 5BPDA 2NNNA 1RUNA 3LA7A 3WODF 4ZH4F 4L5IA 4A0YA 4OINF 1YFHA 2M5WA 4KN4X 2IJLA 2JPBA 2RQPA 1ODDA 4BHCA 4UUVA 4N9HA 3BJOA 3WU0A 5ICGA 2GIVA 1GHCA 2KIFA 4HDVA 3BZ6A 1U78A 1ZGAA 4HX4A 2KKOA 3V7SA 4Q5SF 2FNPA 5AIQA 1G3SA 3N97A 5BQTA 1PP7U 2L01A 4ENNA 4JK1X 4LLGF 3H3UA 5CVIA 1IRFA 4KIGA 1BM9A 1HW2A 3E97A 3Q9VA 2LDUA 3M8EA 2GZWA 3KLOA 2HKXA 3FMQA 3IKVA 3TKYA 1T38A 4OMYA 2PBIA 3IWFA 4UV8A 1W4MA 1W7PA 1SD4A 2DQRA 1AWCA 4EV0A 4U0VA 1O3RA 2HOEA 1FYLA 5E1WA 4ASNA 2YSRA 2GXBA 5D8LB 1QQIA 2DW4A 4KUMA 1XMKA 1YYVA 2ETHA 1BIAA 1H0MA 4IXAA 4UVBA 4LGWA 3I58A 3QAHA 1YS6A 2IW5A 1A04A 3DKWA 3RPQA 5CVVA 2IA2A 4P55A 3KE2A 4Y13A 3D5LA 2IRFG 5A2QK 1T98A 2UWMA 3ZP5A 1R58A 1XGOA 2OA4A 2FEZA 5D8KB 3HOTA 4WXDA 3ML6A 3SHFA 2XIGA 4KN7X 2RC4A 2E7WA 4UHTA 4ZYHA 3DEUA 4HZFA 3ECHA 2O61A 2A61A 1XDUA 2FMYA 3R0JA 4YIFA 2QBYB 2JRTA 3BPXA 3LAJA 4OMZA 2M30A 2UXXA 3HRMA 3OV8A 5HDGA 2Z9OA 4A6EA 3KP4A 1LQ1A 2QM3A 3FHZA 2JPCA 1TBXA 1XB4A 2V9VA 2PQ8A 4CXFA 4L9JA 3QOPA 4WXCA 4G9YA 2NRAC 2XKPA 1J7KA 1P2FA 1IN7A 4O3MA 5J6XA 1RUOA 2ISZA 3PFIA 4PZJA 3JAMK 4CYDA 2JTVA 4L0YB 1KYZA 1EV7A 2FMLA 2RN7A 3J7AO 2DI3A 1KU3A 1UFMA 3LSTA 2P5VA 1B1BA 4EQQA 5HVQC 2K7LA 2QZ8A 1LDDA 1FSHA 2BEOA 4I0BA 1DP7P 4KYWA 1U2WA 1B9NA 4G7ZF 5FO5A 2EA2A 2LF8A 3LA2A 1O7LA 3ZMTA 5DCMB 5L3EA 5E20A 3QU3A 2HQRA 1IF1A 1AOYA 3JTHA 3RKWA 3SXYA 2ZMEB 2HS5A 2RKHA 1LDJA 4UVAA 2FOKA 5F1RA 1FPQA 4KFCA 2QBYA 2EA4A 4EGYA 3GXOA 5K5RA 2A69F 1XSXA 1ZHFA 2MH9A 4GCVA 4P9FA 2F5FA 2D45A 4GYIA 5E17F 4XLNF 1MJ9A 2FU4A 1PP8F 1HSJA 4FX0A 4HAMA 1DPRA 2STTA 2KJBA 4WX9A 3I54A 4P5OA 2VBXA 2YPRA 4MEYF 2XROA 1R1VA 4PCQA 5CYVA 5ERIA 2OD5A 4D0PA 2EFWA 4WWCA 3F8FA 4JBAA 1MDMB 3VODA 3JW4A 5FFXA 3BOQA 3KP3A 2DPDA 4EVIA 2FQ3A 3DQVC 1HSTA 2A68F 2EFOA 4M9XA 2CG4A 2K4BA 1B6AA 3ECOA 5DUIA 4HV5A 3HRSA 3KP5A 2P7CB 3HOSA 2PG4A 1O3QA 2ZFWA 2L02A 3NEUA 1GVJA 5HOOA 4FHTA 2NYXA 5L3CA 1R5GA 3ZPLA 4G7OF 6PAXA 1BI0A 1T2KA 2VC1A 1OYYA 4LK1F 1HKSA 4R79A 3TO9A 2NNYA 1IXRC 4ETSA 3MEXA 1OMIA 5H20A 1QBJA 1Z1DA 2G7UA 1KQ9A 4M73A 2OBPA 2EV5A 5CJ9A 2QQ9A 4HOBA 3DP7A 3E5QA 4FT8A 4HQMA 2IT0A 1TW3A 4Z2YA 3F6OA 2ZJ2A 5E1ZB 2MBFA 4AWXB 5ED4A 3B73A 1EH8A 2VONA 4U7BA 5H6RA 5L3BA 1FNNA 4OIRF 3K0LA 3GO5A 3K69A 4MNUA 4A0ZA 1HW5A 1S3JA 2MC3A 3M8FA 4BHPA 3GFMA 3I4PA 3PQKA 3T8TA 2JSCA 3HSRA 3BPVA 3O3KA 1CF7B 1USTA 2CFXA 3NRVA 4EM0B 1HKTA 2V1DA 3LQQA 2PJPA 1P92A 5HS8A 4OOIA 3J81Z 3LAPA 2K27A 4JQFA 4MQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  4CGZ A;  2ZNY A;  3GVA A;  2H6B A;  1MJA A;  3E6B A;  3WGG A;  2DFI A;  4H0E A;  5D6E A;  1L3L A;  4EGZ A;  3IL2 A;  4HX7 A;  5ILV A;  4IF4 A;  2XAS A;  2FBI A;  3FMR A;  1T39 A;  3BY6 A;  5H6Q A;  2PN6 A;  2MA3 A;  4LB6 B;  3JSO A;  3RKY A;  1FT9 A;  4HYE A;  4CHU A;  4N9I A;  2OQG A;  2VE8 A;  3GYH X;  1I6X A;  2F5E A;  3CO6 C;  4B8X A;  3HUG A;  4IHT A;  1XMA A;  5ICE A;  1XGS A;  1IRG A;  1ZRC A;  2O0Y A;  2RGV A;  1FBS A;  2Y75 A;  1EH7 A;  2LKP A;  4K2E A;  1R23 A;  2K4J A;  1E2X A;  2CWE A;  2VXZ A;  3RTR A;  2QVO A;  1V4R A;  1Z7U A;  3RI4 A;  1SFE A;  3F23 A;  1T6S A;  5D5V B;  4M9Z A;  1JGS A;  1RI7 A;  2HZT A;  1TQI A;  2FA5 A;  1LJ9 A;  4A5M A;  2FNA A;  3MFK A;  1CF7 A;  5DUK A;  1SAX A;  5LRS A;  3LQR A;  5D5W B;  1YTY A;  1D8K A;  1FZP B;  1XD7 A;  3GLX A;  5HLG A;  2ISY A;  4YFK F;  1K78 B;  5ICF A;  5CVJ A;  4L5J A;  4EMS A;  1YG2 A;  1ZAR A;  1OYW A;  1KU9 A;  2XVC A;  2DO7 A;  4UVC A;  4ESF A;  4IHS A;  1ZG1 A;  1REP C;  3L7W A;  3KP6 A;  1IW7 F;  1FP1 D;  3QPH A;  2HDC A;  1KQ0 A;  1O7F A;  3IHU A;  3F3X A;  2M45 A;  5TRD A;  4LK0 F;  1YW7 A;  5E1X A;  2WWY A;  2PMU A;  2GXG A;  1FP2 A;  3G73 A;  3T1B A;  3VFZ A;  2VT2 A;  2HTJ A;  2PFB A;  2JZY A;  2O8X A;  2ZBK A;  2LNB A;  3C3W A;  5HLI A;  4A0X A;  2W57 A;  5F64 A;  4M74 A;  3R4K A;  3MAJ A;  1F9N A;  1P4A A;  3U9G A;  2M87 A;  4NHJ A;  1OYI A;  4IVN A;  2WTE A;  2PLY A;  1O57 A;  2E7X A;  1J5Y A;  4M6X A;  1JHH A;  4GO1 A;  1HQC A;  1E17 A;  4OU0 A;  2FBH A;  2F5C A;  4KIF A;  3TDZ C;  1XGM A;  3FM5 A;  3O2P E;  3EYY A;  2Y0M A;  5LGT A;  1I5Z A;  3P7N A;  1YW8 A;  3I53 A;  3CUO A;  5ILS A;  5JR3 A;  3TOB A;  2V1X A;  3GFI A;  3V8L A;  1J2X A;  1KU7 A;  4P9U A;  1IN4 A;  5DEQ A;  3GWZ A;  1G6N A;  1TQP A;  1S6L A;  2QQA A;  3V7R A;  3VEP A;  5E8G A;  1W7P D;  3V8J A;  4RB2 C;  3QPT A;  3MZH A;  3BRO A;  4HLX A;  4CZZ A;  3LFK A;  2A3S A;  3L9F A;  3F22 A;  1X3U A;  4B09 A;  1G3T A;  4ENJ A;  1LB2 A;  1O3T A;  3C7J A;  4L0Z B;  1IUY A;  1Z91 A;  3GW2 A;  4RAY A;  1WWX A;  4IRG A;  4LJZ F;  4A12 A;  5LGU A;  3GUD A;  4I02 A;  2NS0 A;  3ZMS A;  2VBW A;  2J5O A;  4AIJ A;  3I5U A;  3HRU A;  3HHH A;  3BP8 A;  4AVP A;  4ZYD A;  3DFG A;  4NB5 A;  2VOP A;  4G7H F;  1FLI A;  4IRI A;  3E3V A;  1B9M A;  2LF7 A;  5TJJ A;  4OIQ F;  1U3E M;  4I0A A;  2H09 A;  5DD8 A;  5FD6 A;  2ESH A;  3L2C A;  4KMU X;  2Y48 A;  1F4K A;  5FFZ A;  3ULQ B;  2W85 A;  3RPU A;  5JHU A;  3C1D A;  3J80 Z;  2P6T A;  2ELH A;  4E70 A;  1ZRE A;  3T0Y A;  3WGH A;  2H94 A;  1LDK B;  3CLO A;  2G7H A;  4A6D A;  3DV8 A;  2HGC A;  4I09 A;  3BJA A;  1Z6T A;  1DUX C;  2FF4 A;  1XGN A;  4HA8 A;  3KEQ A;  4O6J A;  1XDS A;  2PMH A;  1WKM A;  3JSP A;  2V79 A;  4ZZL A;  1ZN2 A;  2L3D A;  5K5Q A;  4L9N A;  1J75 A;  4U88 A;  3K1P A;  4KIC A;  1BC7 C;  2P5L C;  1BBY A;  1BI2 A;  3K2Z A;  2YX7 A;  1R7J A;  2O03 A;  3FXQ A;  3I0T A;  3LA3 A;  2IP2 A;  4AIK A;  3GZ6 A;  2E1N A;  3IC7 A;  1BJA A;  4PGG A;  3EYI A;  5BS6 A;  3F8M A;  1R1T A;  1TQM A;  1SD5 A;  1JHF A;  3EDP A;  2GA1 A;  1BN5 A;  2ZXJ A;  1RZ4 A;  3CDH A;  1MZB A;  4EJO A;  4BHB A;  2ESN A;  3VB2 A;  1JE8 A;  1Z6R A;  4HDU A;  2OQR A;  3M1E A;  2VBY A;  4L18 B;  2PEX A;  4RB1 A;  2A6H F;  1FSE A;  4CDG A;  3R0A A;  5JFR A;  2OAZ A;  2VOO A;  3QP6 A;  5HDN A;  3K1M A;  3K9T A;  4RGR A;  2VOD A;  1FOK A;  4QWQ A;  3IWZ A;  3KP7 A;  3VOE A;  1RIO H;  2GQQ A;  1P6R A;  1FYM A;  1EH6 A;  1G3Y A;  2YX4 A;  5D5U B;  3SZP A;  3ABU A;  5ICC A;  1KGS A;  1ZLJ A;  4BYY A;  1ZRF A;  1RNL A;  3SZT A;  3F8B A;  3FMS A;  2RDP A;  5DCM A;  2DK8 A;  4XSX F;  3R6S A;  1UB9 A;  5KVR A;  2VT3 A;  4RGS A;  2W24 A;  2HTS A;  2ZME A;  4ESB A;  4KA4 A;  2CQK A;  1MGT A;  4MGR A;  2HEO A;  4IJA A;  4A2U A;  3EET A;  1KQ8 A;  1UHW A;  1OR7 A;  2XAG A;  4HX8 A;  5E18 F;  1S7A A;  3L00 A;  1F1Z A;  4CIC A;  3F72 A;  3DPL C;  2BE5 F;  2EB7 A;  1S7O A;  4Q47 A;  1QO0 D;  4OIO F;  1SMT A;  4L9T A;  2DQL A;  3FF5 A;  4MTE A;  1D8J A;  5LRR A;  4IPA A;  5DDG A;  4AD9 A;  2RVC A;  1FBU A;  4U0W A;  1H9G A;  2YU3 A;  3V4G A;  2VN2 A;  1STZ A;  4EJW A;  5DCF A;  2OZU A;  2X0L A;  1BC8 C;  3R60 A;  2FRH A;  4LG0 B;  4GXO A;  3KEO A;  3GX4 X;  4ENK A;  1GXP A;  3KZZ A;  3GFJ A;  1ZLK A;  2TDX A;  2EV0 A;  1MDM A;  5HDK A;  1U5T B;  5IT3 A;  4RGU A;  4ZYE A;  4LD5 A;  2VE9 A;  1G3W A;  1XSV A;  3TOA A;  4EM2 A;  1NHA A;  2EFP A;  1BOA A;  3WTU C;  4PDK A;  1IXS B;  3BDD A;  5K1Y A;  1D3Y A;  4HF0 A;  3WGI A;  2XKO A;  4NQW A;  5DD4 A;  2P7V B;  5LHH A;  4O5V A;  3J81 K;  3H3Z A;  1K6O A;  1Y0U A;  3WTZ A;  1ON1 A;  4KNY A;  2LSO A;  5CVR A;  3DPT A;  2MLG A;  3HSF A;  4BH9 A;  4F7Z A;  3O6B B;  3M9A A;  3WTW C;  2Q8K A;  4M72 A;  1DDN A;  5J8C A;  5FLX K;  4BNC A;  2O3F A;  5FLX Z;  2C6Y A;  1KU2 A;  4MQ9 F;  2BGC A;  3TGN A;  5CVU A;  4I7H A;  3GZ5 A;  2DU9 A;  2QEN A;  3ZQ7 A;  1LEA A;  3ZMV A;  3WTX C;  4R8H A;  1YQA A;  1XN7 A;  4M71 A;  5AON A;  3CTA A;  2XHK A;  3KLN A;  3P9I A;  1MJB A;  2H6C A;  2GAU A;  2HWV A;  4HLY A;  1G4D A;  5ILU A;  1GXQ A;  1U5T A;  1R00 A;  2J5P A;  3P9C A;  1Q1H A;  3KP2 A;  4EJT A;  3WG9 A;  4M6Y A;  5LLQ A;  3EQL F;  3ZN1 A;  4EJV A;  1ZG5 A;  3MZY A;  1XCV A;  5LHG A;  4TV7 A;  3B02 A;  1W7P B;  1FX7 A;  3WU1 B;  2XAQ A;  2OZ6 A;  3KET A;  3WE2 A;  2VC0 A;  3ZN0 A;  2M1B A;  2FXA A;  4KDP A;  4PGH A;  1YIO A;  2EJR A;  1UHM A;  3WTY C;  1YLF A;  3NQO A;  2STW A;  2Q0O A;  2G9W A;  5BMZ A;  2EK5 A;  1U5T C;  3WE3 A;  2CO5 A;  5LEJ A;  2XAF A;  2HR3 A;  4P96 A;  3RKX A;  1H9T A;  4HV6 A;  1ON2 A;  2DTR A;  4Y15 A;  1WRJ A;  5DV5 A;  3QP5 A;  4MEX F;  2ZCW A;  5E8I A;  3N4M A;  5FD5 A;  4KMF A;  2AS5 F;  3C18 A;  4EJU A;  2ZO4 A;  2P4W A;  3I59 B;  3BWG A;  1ZAO A;  3V7C A;  4S04 A;  2QQB A;  1D5V A;  1B59 A;  4YFN F;  4LLL A;  3TO7 A;  2A6E F;  4G94 A;  1SFU A;  2KJC A;  4IRH A;  3K1N A;  1L0O C;  1SD7 A;  3E6C C;  2AXL A;  4RS8 A;  2DLL A;  5JI6 A;  2KRF A;  4XSZ F;  1R36 A;  2KIU A;  4WK8 F;  2ACJ A;  1HBX G;  1HXD A;  2UXN A;  1FY7 A;  3ERE D;  3FM3 A;  4RGX A;  1K78 A;  4DQ2 A;  1QZZ A;  2MLK A;  1LVA A;  4XRF A;  3SFZ A;  1C0W A;  1HKQ A;  1VTN C;  2DT5 A;  1YW9 A;  2IPQ X;  5L3D A;  5DYM A;  2GWR A;  5LEK A;  4QLC U;  3Q9S A;  3PQJ A;  2HQN A;  1IN5 A;  3S2W A;  4A5N A;  3I71 A;  2R3S A;  2D1H A;  5D5X B;  2WV0 A;  3BJ6 A;  2V1U A;  5A2Q Z;  3L09 A;  2FE3 A;  2Z3Y A;  2Z5U A;  1QZY A;  2CYY A;  4I01 A;  1W5T A;  3RYP A;  2L54 A;  4BAY A;  1FWZ A;  3QU6 A;  1IN6 A;  1BI3 A;  3H92 A;  3E6M A;  2P5K A;  3I59 A;  3RYR A;  2HYG D;  1B4A A;  3HIF A;  4ESJ A;  4M9S A;  3E5U A;  3M7G A;  4OIP F;  2UZK A;  2HFH A;  4XLP F;  3WTV C;  2K02 A;  3E5X A;  3HRT A;  3J80 K;  1MKM A;  1T0F A;  3RJP A;  5L3F A;  5IT9 K;  5IT9 Z;  5LGN A;  3ZMD A;  5D6F A;  4KIB A;  3CO7 C;  3ELK A;  2MH2 A;  2P6S A;  4G6Q A;  3JAM Z;  2YR2 A;  3IKT A;  3W6K B;  1KA8 A;  2D2W A;  2M8E A;  3E6D A;  4BQA A;  3DF8 A;  4MHG A;  2L4M A;  1Z9C A;  4MTD A;  3F21 A;  4YFX F;  2W25 A;  2XRN A;  1CGP A;  1QGP A;  5EEG A;  1TNS A;  3ABT A;  2RNJ A;  1XSD A;  4WXH A;  2DBB A;  3HHG A;  3AAF A;  1O3S A;  3REO A;  4ZZD A;  3CJN A;  5D4S A;  5HLH A;  2X4H A;  1IXC A;  1FYK A;  2Z99 A;  4U7D A;  2A5Y B;  3TDU C;  2NAZ A;  2EWN A;  3I64 A;  4I2O A;  4BXU A;  4S05 A;  1QNT A;  3FXR A;  1TNT A;  2F5D A;  2A07 F;  3LWF A;  1PUE E;  4HF1 A;  2ZKZ A;  3OOP A;  3ZMZ A;  3CUQ B;  4YG2 F;  1J9I A;  1BIB A;  1WQ2 A;  1IN8 A;  4WCG A;  3WTS C;  4KT5 C;  2EFN A;  2JT1 A;  2VBZ A;  5LBQ A;  4GYG A;  3F6V A;  4Q48 A;  4U0Y A;  4L9V A;  3TQN A;  3IRR A;  4HQE A;  2R7D A;  5EEH A;  4AIH A;  4RAZ A;  1I27 A;  3WTT C;  4LB5 A;  3V8K A;  2BYV E;  4G6D A;  4HBL A;  1J59 A;  3TO6 A;  4HW0 A;  1SD6 A;  3Q5F A;  1ONV A;  3SQN A;  4HF2 A;  2BV6 A;  1USS A;  3GEZ A;  2IVM A;  1TTY A;  3R61 A;  3P9K A;  3HSE A;  1IZ1 A;  3EUH A;  5J8F A;  3ROU A;  3HTS B;  1J0R A;  1ZRD A;  4XBF A;  2H27 A;  2IA0 A;  1LEB A;  2XAH A;  3DXJ F;  3GF2 A;  1DPU A;  2HKO A;  1V3F A;  2XGX A;  2IA1 A;  2CGP A;  1P4W A;  5AIP A;  1FC3 A;  1I1S A;  5KK1 A;  3MWM A;  1WSU A;  3GFL A;  2W84 A;  3RDI A;  4I98 B;  2FSW A;  4CO8 A;  1TLH B;  2GA2 A;  5L3G A;  3T5X A;  3CUQ A;  2QWW A;  2MD5 A;  5FB2 A;  1JXS A;  3COA C;  2V6C A;  5HS7 A;  3KZY A;  3KFW X;  4Q4Z F;  2DAO A;  4ZYG A;  1I1G A;  2CSO A;  5FGM A;  2PI0 A;  2B0L A;  1PDN C;  2HYF A;  1OPC A;  3FXU A;  4RB3 C;  1WI9 A;  2COM A;  2BBY A;  1UCR A;  3ZMU A;  2K86 A;  4G8X A;  1K79 A;  2ADU A;  1S29 A;  2EV6 A;  3T8R A;  4YII A;  4RB0 A;  3QRF F;  2OU2 A;  2D1V A;  1YO5 C;  1QPM A;  2XV4 S;  2XUB A;  2QYO A;  3HTU A;  4WF2 A;  5BOX A;  3CUQ C;  3F8N A;  3MQ0 A;  1U6G A;  1R5H A;  1F5T A;  2XAJ A;  1U8R A;  3U2R A;  1ZG3 A;  3D0S A;  4N0B A;  5CLS A;  1FBQ A;  3F8C A;  2QUF A;  4EM1 A;  2DK5 A;  3G3Z A;  5D4R A;  5K5O A;  3ISP A;  1BI1 A;  1YS7 A;  2RV8 A;  1MD0 A;  3W6J B;  1IAW A;  4UV9 A;  1XCB A;  2QLZ A;  2DPU A;  1ZYR F;  3U1D A;  1SFX A;  1KYW A;  3FZV A;  3RIR A;  2L4A A;  1S8N A;  3HYI A;  2EFQ A;  4LG0 A;  1R22 A;  4GGG A;  5LHI A;  2ZNZ A;  3JTG A;  2FBK A;  1LNW A;  2P8T A;  4UXN A;  4LFU A;  1P4X A;  2WC2 A;  2KIM A;  3MCZ A;  1HW1 A;  4Y17 A;  1W5S A;  1R1U A;  5JVT A;  1OKR A;  5BPI A;  3KCC A;  1ZGJ A;  4UNO A;  2E1C A;  2R7F A;  3FX3 A;  4FX4 A;  3FWE A;  1TW2 A;  1K7A A;  2Z33 A;  4DNC A;  2F2E A;  4R1H A;  5HS9 A;  4LLN A;  2O6G E;  1ZH5 A;  1Z05 A;  4ON0 A;  2CW0 F;  5F6F A;  1SMY F;  3IRQ A;  4ENM A;  4LMY A;  2Q2E A;  5BPD A;  2NNN A;  1RUN A;  3LA7 A;  3WOD F;  4ZH4 F;  4L5I A;  4A0Y A;  4OIN F;  1YFH A;  2M5W A;  4KN4 X;  2IJL A;  2JPB A;  2RQP A;  1ODD A;  4BHC A;  4UUV A;  4N9H A;  3BJO A;  3WU0 A;  5ICG A;  2GIV A;  1GHC A;  2KIF A;  4HDV A;  3BZ6 A;  1U78 A;  1ZGA A;  4HX4 A;  2KKO A;  3V7S A;  4Q5S F;  2FNP A;  5AIQ A;  1G3S A;  3N97 A;  5BQT A;  1PP7 U;  2L01 A;  4ENN A;  4JK1 X;  4LLG F;  3H3U A;  5CVI A;  1IRF A;  4KIG A;  1BM9 A;  1HW2 A;  3E97 A;  3Q9V A;  2LDU A;  3M8E A;  2GZW A;  3KLO A;  2HKX A;  3FMQ A;  3IKV A;  3TKY A;  1T38 A;  4OMY A;  2PBI A;  3IWF A;  4UV8 A;  1W4M A;  1W7P A;  1SD4 A;  2DQR A;  1AWC A;  4EV0 A;  4U0V A;  1O3R A;  2HOE A;  1FYL A;  5E1W A;  4ASN A;  2YSR A;  2GXB A;  5D8L B;  1QQI A;  2DW4 A;  4KUM A;  1XMK A;  1YYV A;  2ETH A;  1BIA A;  1H0M A;  4IXA A;  4UVB A;  4LGW A;  3I58 A;  3QAH A;  1YS6 A;  2IW5 A;  1A04 A;  3DKW A;  3RPQ A;  5CVV A;  2IA2 A;  4P55 A;  3KE2 A;  4Y13 A;  3D5L A;  2IRF G;  5A2Q K;  1T98 A;  2UWM A;  3ZP5 A;  1R58 A;  1XGO A;  2OA4 A;  2FEZ A;  5D8K B;  3HOT A;  4WXD A;  3ML6 A;  3SHF A;  2XIG A;  4KN7 X;  2RC4 A;  2E7W A;  4UHT A;  4ZYH A;  3DEU A;  4HZF A;  3ECH A;  2O61 A;  2A61 A;  1XDU A;  2FMY A;  3R0J A;  4YIF A;  2QBY B;  2JRT A;  3BPX A;  3LAJ A;  4OMZ A;  2M30 A;  2UXX A;  3HRM A;  3OV8 A;  5HDG A;  2Z9O A;  4A6E A;  3KP4 A;  1LQ1 A;  2QM3 A;  3FHZ A;  2JPC A;  1TBX A;  1XB4 A;  2V9V A;  2PQ8 A;  4CXF A;  4L9J A;  3QOP A;  4WXC A;  4G9Y A;  2NRA C;  2XKP A;  1J7K A;  1P2F A;  1IN7 A;  4O3M A;  5J6X A;  1RUO A;  2ISZ A;  3PFI A;  4PZJ A;  3JAM K;  4CYD A;  2JTV A;  4L0Y B;  1KYZ A;  1EV7 A;  2FML A;  2RN7 A;  3J7A O;  2DI3 A;  1KU3 A;  1UFM A;  3LST A;  2P5V A;  1B1B A;  4EQQ A;  5HVQ C;  2K7L A;  2QZ8 A;  1LDD A;  1FSH A;  2BEO A;  4I0B A;  1DP7 P;  4KYW A;  1U2W A;  1B9N A;  4G7Z F;  5FO5 A;  2EA2 A;  2LF8 A;  3LA2 A;  1O7L A;  3ZMT A;  5DCM B;  5L3E A;  5E20 A;  3QU3 A;  2HQR A;  1IF1 A;  1AOY A;  3JTH A;  3RKW A;  3SXY A;  2ZME B;  2HS5 A;  2RKH A;  1LDJ A;  4UVA A;  2FOK A;  5F1R A;  1FPQ A;  4KFC A;  2QBY A;  2EA4 A;  4EGY A;  3GXO A;  5K5R A;  2A69 F;  1XSX A;  1ZHF A;  2MH9 A;  4GCV A;  4P9F A;  2F5F A;  2D45 A;  4GYI A;  5E17 F;  4XLN F;  1MJ9 A;  2FU4 A;  1PP8 F;  1HSJ A;  4FX0 A;  4HAM A;  1DPR A;  2STT A;  2KJB A;  4WX9 A;  3I54 A;  4P5O A;  2VBX A;  2YPR A;  4MEY F;  2XRO A;  1R1V A;  4PCQ A;  5CYV A;  5ERI A;  2OD5 A;  4D0P A;  2EFW A;  4WWC A;  3F8F A;  4JBA A;  1MDM B;  3VOD A;  3JW4 A;  5FFX A;  3BOQ A;  3KP3 A;  2DPD A;  4EVI A;  2FQ3 A;  3DQV C;  1HST A;  2A68 F;  2EFO A;  4M9X A;  2CG4 A;  2K4B A;  1B6A A;  3ECO A;  5DUI A;  4HV5 A;  3HRS A;  3KP5 A;  2P7C B;  3HOS A;  2PG4 A;  1O3Q A;  2ZFW A;  2L02 A;  3NEU A;  1GVJ A;  5HOO A;  4FHT A;  2NYX A;  5L3C A;  1R5G A;  3ZPL A;  4G7O F;  6PAX A;  1BI0 A;  1T2K A;  2VC1 A;  1OYY A;  4LK1 F;  1HKS A;  4R79 A;  3TO9 A;  2NNY A;  1IXR C;  4ETS A;  3MEX A;  1OMI A;  5H20 A;  1QBJ A;  1Z1D A;  2G7U A;  1KQ9 A;  4M73 A;  2OBP A;  2EV5 A;  5CJ9 A;  2QQ9 A;  4HOB A;  3DP7 A;  3E5Q A;  4FT8 A;  4HQM A;  2IT0 A;  1TW3 A;  4Z2Y A;  3F6O A;  2ZJ2 A;  5E1Z B;  2MBF A;  4AWX B;  5ED4 A;  3B73 A;  1EH8 A;  2VON A;  4U7B A;  5H6R A;  5L3B A;  1FNN A;  4OIR F;  3K0L A;  3GO5 A;  3K69 A;  4MNU A;  4A0Z A;  1HW5 A;  1S3J A;  2MC3 A;  3M8F A;  4BHP A;  3GFM A;  3I4P A;  3PQK A;  3T8T A;  2JSC A;  3HSR A;  3BPV A;  3O3K A;  1CF7 B;  1UST A;  2CFX A;  3NRV A;  4EM0 B;  1HKT A;  2V1D A;  3LQQ A;  2PJP A;  1P92 A;  5HS8 A;  4OOI A;  3J81 Z;  3LAP A;  2K27 A;  4JQF A;  4MQV A; 
#chains in the Genus database with same CATH topology
 1ULY A;  4CGZ A;  2ZNY A;  3GVA A;  5DTD A;  1W36 C;  3L2Q A;  3QPS A;  1B8I A;  2H6B A;  1ETW A;  4I6Z A;  1MJA A;  3CCQ I;  1WJD A;  2LG4 A;  3E6B A;  1Y56 A;  2JJ7 A;  3WGG A;  2L2O A;  2DFI A;  3HXL A;  4H0E A;  5D6E A;  1L3L A;  1XS9 A;  3HEF A;  4EGZ A;  2DA1 A;  4BQN A;  3IL2 A;  4HX7 A;  5ILV A;  4M3B A;  2EPF A;  4IF4 A;  4IO9 F;  4KIS A;  2XAS A;  4C9Y A;  3FDY A;  2FBI A;  3FMR A;  1T39 A;  1OCP A;  1X1A A;  3QYE A;  3BY6 A;  1YIJ I;  2R7X A;  1IDZ A;  5H6Q A;  1XPX A;  2PN6 A;  2MA3 A;  3EUA A;  4LB6 B;  3JSO A;  3RKY A;  1JKO C;  1FT9 A;  4HYE A;  4B44 A;  4CHU A;  4N9I A;  1ZR4 A;  2OQG A;  2DOA A;  2VE8 A;  2L7F P;  3GYH X;  1I6X A;  2F5E A;  1TP4 A;  4B8X A;  3JRH A;  3HUG A;  3CO6 C;  4IHT A;  1XMA A;  4DZJ A;  1XGS A;  3OIO A;  4XM3 A;  5ICE A;  1IRG A;  1NG6 A;  1ZRC A;  2LKS A;  2O0Y A;  1MND A;  2RGV A;  1FBS A;  3N05 A;  3VSL A;  4F92 B;  1R6R A;  2Y75 A;  2EIL H;  1EH7 A;  2LKP A;  3P5J A;  2ZJQ F;  4K2E A;  1R23 A;  2ECC A;  1GV5 A;  3ESW B;  3QYF A;  2K4J A;  1ORK A;  1E2X A;  1BR1 A;  3ZCO A;  2CWE A;  1X1D A;  5KCM A;  2CUJ A;  2VXZ A;  3OYD A;  3RTR A;  2QVO A;  2E2H J;  1V4R A;  1Z7U A;  3RI4 A;  4GFB A;  1SFE A;  3LSJ A;  5IP9 J;  2LBF B;  3F23 A;  4A3I J;  1T6S A;  5D5V B;  4M9Z A;  1JGS A;  1RI7 A;  3A01 A;  3L1P A;  2HZT A;  1Z77 A;  1TQI A;  2FA5 A;  1LJ9 A;  4A5M A;  2FNA A;  3MFK A;  2DDB A;  2BOL A;  3ZQG A;  2I10 A;  4LIV A;  1CF7 A;  4XIC A;  5DUK A;  3IAS 2;  1VQN I;  1NTC A;  1VQO I;  1SAX A;  1E0E A;  1JT6 A;  1E3P A;  5LRS A;  3CDI A;  3LQR A;  5D5W B;  1YTY A;  1DP3 A;  3FXK A;  1D8K A;  1FZP B;  1XD7 A;  3GTG J;  2IGN A;  3GLX A;  4IX7 A;  3S1N J;  3ZOB A;  5HLG A;  1JJ8 C;  2O8K A;  2K9Q A;  4IKF A;  1X1B A;  1WZ2 A;  2ISY A;  4YFK F;  1BA5 A;  2CUZ A;  1K78 B;  4F91 B;  5ICF A;  5CVJ A;  4L5J A;  4EMS A;  1YG2 A;  1ZAR A;  2JUG A;  2IS1 A;  4OAY A;  1OYW A;  1KU9 A;  3CCU I;  2XVC A;  3ZQL A;  5E3L A;  3IV5 A;  1I6H J;  2R7R A;  2DO7 A;  5GAE J;  4UVC A;  4ESF A;  4IHS A;  1ZG1 A;  5EZH A;  2RNG A;  1REP C;  2CV1 A;  3K2A A;  3L7W A;  3KP6 A;  5GAG J;  3DTE A;  1FOW A;  1IW7 F;  5J4Y A;  1FP1 D;  4NC8 A;  3QPH A;  5TGT A;  1G59 A;  2HDC A;  1KQ0 A;  1O7F A;  1GDT A;  3FK6 A;  3IHU A;  3F3X A;  3OYL A;  2M45 A;  5TRD A;  2DA2 A;  2QCO A;  4LK0 F;  1YW7 A;  5E1X A;  2WWY A;  4DW6 A;  2PMU A;  2GXG A;  1FP2 A;  3G73 A;  4HSR A;  5EYR A;  3T1B A;  1ETQ A;  3VFZ A;  2HOS A;  3BZK A;  1UAA A;  2KIS A;  2VT2 A;  2HTJ A;  2PFB A;  2CJJ A;  4C2M J;  1AKH A;  3OYJ A;  2JZY A;  2O8X A;  2ZBK A;  1OCO H;  3CME I;  1GUU A;  2LNB A;  2NVY J;  3C3W A;  2XF5 A;  5HLI A;  1MW7 A;  2FQ4 A;  4A0X A;  1JT0 A;  2W57 A;  5F64 A;  4M74 A;  3R4K A;  1I3Q J;  1QVT A;  2XB5 A;  5IYD J;  3MAJ A;  1F9N A;  1P4A A;  3U9G A;  2M87 A;  4NHJ A;  3H9G A;  2UUZ A;  1OYI A;  4IVN A;  3JRD A;  4A3F J;  2WTE A;  2PLY A;  1O57 A;  2E7X A;  4RLQ A;  4CH7 A;  1J5Y A;  4M6X A;  1MBE A;  1JHH A;  1RR7 A;  4GO1 A;  4I99 C;  1HQC A;  1E17 A;  4OU0 A;  2FBH A;  2F5C A;  2X6W A;  4KIF A;  3TDZ C;  1F36 A;  1XGM A;  2Y30 A;  3FM5 A;  3MMY B;  3J7A Y;  3O2P E;  3EYY A;  2Y0M A;  5LGT A;  1I5Z A;  3P7N A;  4D7N A;  2KIQ A;  1YW8 A;  3OYE A;  3I53 A;  3CUO A;  5ILS A;  5JR3 A;  1YJ9 I;  2NVQ J;  4XR6 A;  3TOB A;  2X48 A;  5C44 J;  2R7Q A;  3D5S C;  2V1X A;  3GFI A;  4BQO A;  5K7F A;  3V8L A;  2R5Y A;  1J2X A;  3BR1 A;  2EQR A;  1KU7 A;  4P9U A;  1IN4 A;  5DEQ A;  3GWZ A;  1G6N A;  2N8G A;  1TQP A;  3SDG A;  1S6L A;  2QQA A;  3A0H C;  3V7R A;  3VEP A;  5E8G A;  1W7P D;  3V8J A;  4RB2 C;  3QPT A;  1ZR2 A;  3MZH A;  2OTL I;  2W4S A;  3KPH A;  3BRO A;  4HLX A;  2R5Z B;  2NS8 A;  4CZZ A;  3LFK A;  2DMP A;  2A3S A;  3L9F A;  1WCM J;  3MKY B;  2CQN A;  1X1P A;  2L0K A;  3F22 A;  1X3U A;  4BE2 A;  4B09 A;  1ZEL A;  1WJA A;  2OUM A;  1WJE A;  2ID3 A;  3M8J A;  1G3T A;  1WPK A;  4ENJ A;  1LB2 A;  3OYM A;  1Z3X A;  1O3T A;  3C7J A;  4HNU A;  4L0Z B;  1IUY A;  4M3E A;  1G8X A;  1Q1V A;  1Z91 A;  1TC3 C;  3GW2 A;  3EPZ A;  1FIP A;  2CH0 A;  4RAY A;  1WWX A;  4IRG A;  4LJZ F;  4U87 A;  4A12 A;  5LGU A;  3GUD A;  4I02 A;  2NS0 A;  2W00 A;  3DBL B;  3ZMS A;  2VBW A;  2J5O A;  4B48 A;  3QPL A;  4AIJ A;  3I5U A;  3HRU A;  3HHH A;  2X1E A;  3BP8 A;  4AVP A;  4XKC A;  4ZYD A;  2CS3 A;  3DFG A;  4NB5 A;  2JQ7 A;  2VLA A;  2VOP A;  4G7H F;  3S16 J;  1FTZ A;  1A6Q A;  4JX6 A;  4E7L A;  4IRI A;  3E3V A;  1FLI A;  1B9M A;  2LF7 A;  3CCJ I;  5TJJ A;  2YUS A;  4OIQ F;  1U3E M;  4I0A A;  2WAE A;  2H09 A;  5DD8 A;  1H88 C;  5FD6 A;  2R7Z J;  2ESH A;  4FAS D;  4NNJ A;  3L2C A;  4JX5 A;  2Y48 A;  4KMU X;  2GLO A;  1F4K A;  4E4H A;  5FFZ A;  3ULQ B;  2W85 A;  3RPU A;  9ANT A;  5JHU A;  3C1D A;  1YRN B;  2P6T A;  4E70 A;  2ELH A;  3J80 Z;  1ZRE A;  3T0Y A;  1SVL A;  3WGH A;  1XTA A;  2H94 A;  3CP2 A;  1LDK B;  3CLO A;  3MN2 A;  2NVT J;  2Y9Z A;  2G7H A;  4A6D A;  3DV8 A;  3CLQ A;  4BJ6 C;  2HGC A;  4I09 A;  3BJA A;  1Z6T A;  3CCE I;  1DUX C;  2FF4 A;  3ABK H;  2DYR H;  4BY7 J;  1XGN A;  3LSG A;  4HA8 A;  3KEQ A;  4O6J A;  1XDS A;  4JYK A;  2WY8 Q;  5GPA A;  3OS1 A;  2PMH A;  2HNH A;  1WKM A;  2K9N A;  1TZL A;  3JSP A;  2V79 A;  2CUF A;  3CCM I;  4ZZL A;  5GAH J;  1ZN2 A;  2L3D A;  2LRD A;  3S32 A;  1SC7 A;  1OIS A;  5K5Q A;  3H5N A;  1D5Y A;  2XPW A;  2DTZ A;  4L9N A;  2Q1Z B;  3GLL A;  1J75 A;  2E1M B;  3CC7 I;  4IHV A;  4U88 A;  2IEK A;  3K1P A;  4KIC A;  2R5Z A;  1BC7 C;  2GM4 A;  2P5L C;  1BBY A;  1BI2 A;  3HG9 A;  3K2Z A;  2HU9 A;  2YX7 A;  1R7J A;  2O03 A;  5F04 A;  1Y6I A;  1MBG A;  3FXQ A;  3I0T A;  3LA3 A;  5JHF A;  2CQQ A;  2IGO A;  2IP2 A;  4OWR B;  4AIK A;  2ME0 A;  2E1N A;  3GZ6 A;  1MBF A;  3IC7 A;  4LIT A;  3K70 C;  4UUT A;  1BJA A;  3PSF A;  4PGG A;  1MBK A;  3EYI A;  2BXZ A;  1UHS A;  1T0F C;  1VFC A;  2BY0 A;  5BS6 A;  1Z21 A;  3JRA A;  3F8M A;  3RZO J;  1JUM A;  1R1T A;  2M0M A;  1KZH A;  3O8G A;  1TQM A;  1SD5 A;  1JHF A;  2BY1 A;  2Y2Z A;  3EDP A;  4GRI A;  2GA1 A;  1BN5 A;  2ZXJ A;  5J40 A;  1RZ4 A;  1PUF B;  2LY2 A;  1WH5 A;  4E7H A;  3CDH A;  2RQQ A;  1MZB A;  4F3Q A;  1MMN A;  5KAI C;  4BHB A;  4EJO A;  3JRF A;  2ESN A;  3VB2 A;  1JE8 A;  3GZN B;  1Z6R A;  3LSM A;  3JRB A;  4HDU A;  5GPC A;  2OQR A;  3S3O A;  3CMM A;  3M1E A;  2VBY A;  4L18 B;  1U9O A;  1TT5 B;  1POG A;  2DJI A;  1VQ9 I;  1BR2 A;  1S7E A;  2PEX A;  4RB1 A;  3CJR B;  1Y8Q B;  2A6H F;  1FSE A;  4A3E J;  2TCT A;  4CDG A;  1N25 A;  1S9H A;  2BVM A;  3R0A A;  2MSY A;  1LE8 A;  5JFR A;  2OAZ A;  2VOO A;  2JA8 J;  2GIZ A;  1X4O A;  3QP6 A;  1YRN A;  4BE0 A;  5HDN A;  1PVE A;  3K1M A;  3K9T A;  1MNM C;  2JN6 A;  4RGR A;  3OS0 A;  2VOD A;  3CMY A;  1FOK A;  4QWQ A;  4DYQ A;  3IWZ A;  2VJJ A;  3KP7 A;  3PJR A;  3VOE A;  2IS4 A;  1RIO H;  2GQQ A;  1P6R A;  1FYM A;  1EH6 A;  1G3Y A;  1Y1V J;  2DA4 A;  2Z2S B;  4A3J J;  2YX4 A;  3GBG A;  3SZP A;  1Z0X A;  5D5U B;  1TT0 A;  3ABU A;  5ICC A;  1KGS A;  4GDF A;  1ZLJ A;  3S8P A;  4BYY A;  1ZRF A;  1RNL A;  4CCL A;  2X1D A;  3SZT A;  4X1E A;  1GLN A;  1HDD C;  3F8B A;  3FMS A;  1IRZ A;  1FMV A;  2RDP A;  1RPW A;  3VPR A;  1D0Y A;  3GTL J;  1TWA J;  5DCM A;  2V9K A;  4NQW B;  2H1K A;  2DK8 A;  4XSX F;  1SFK A;  3R6S A;  1SFO J;  1JKQ C;  1NH3 A;  1UB9 A;  2BW3 A;  5KVR A;  2VT3 A;  1HCR A;  4DGW B;  5CPR B;  4RGS A;  2W24 A;  1TWG J;  2HTS A;  4RBO A;  2ZME A;  4ESB A;  4KA4 A;  4A3M J;  2CQK A;  1MGT A;  3H1C A;  3G1M A;  4MGR A;  2VJ4 A;  1XC5 A;  2ECB A;  3OIQ A;  2HEO A;  4IJA A;  4A2U A;  1U8B A;  3EET A;  1KQ8 A;  1UHW A;  1OR7 A;  2XAG A;  1N75 A;  2EZH A;  4HX8 A;  4XLA A;  5E18 F;  3LL7 A;  2B9S A;  1S7A A;  2MYS A;  3L00 A;  2WA0 A;  4UB6 C;  4XLC A;  1SVO A;  1F1Z A;  5IOY A;  4CIC A;  3F72 A;  5IYB J;  3DPL C;  2G0E A;  2LC2 A;  2BE5 F;  1VQ4 I;  2EB7 A;  1S7O A;  4Q47 A;  1QO0 D;  1QVU A;  4OIO F;  4ITV A;  1SMT A;  3BZC A;  4L9T A;  4XOP A;  2E35 A;  5FKO A;  2DQL A;  3FF5 A;  4MTE A;  1WFX A;  1UZC A;  5LRR A;  3RQ4 A;  4E7Z A;  4YEL A;  2H8R A;  4IPA A;  5DDG A;  1D8J A;  1FIA A;  1OCZ H;  3CJT B;  3B6A A;  4OAZ A;  2O5R A;  4AD9 A;  2RVC A;  2D5V A;  1FBU A;  4U0W A;  1RKW A;  4A69 C;  1E3H A;  1H9G A;  2YU3 A;  3V4G A;  2VN2 A;  1STZ A;  2BY3 A;  4EJW A;  1XG1 A;  5DCF A;  2I8D A;  2OZU A;  3DEE A;  1FMW A;  2X0L A;  1BC8 C;  3R60 A;  2FRH A;  4A93 J;  1OCT C;  1TL8 A;  2E71 A;  2ZME C;  3CCR I;  4LG0 B;  4W1U A;  1F43 A;  2K9L A;  4GXO A;  4HG2 A;  3KEO A;  3ZQQ A;  4DBQ A;  1R4M B;  3FK7 A;  3GX4 X;  4ENK A;  5FKM A;  4D7M A;  2DOF A;  2DA3 A;  5LD2 C;  1GXP A;  3KZZ A;  1OR7 C;  1MBH A;  2CW7 A;  3FBI B;  3GFJ A;  1D0X A;  1ZLK A;  2TDX A;  2EV0 A;  4NUB A;  1MDM A;  3UKG A;  5HDK A;  3HDD A;  2CQ7 A;  1ETO A;  1OLT A;  1U5T B;  5IT3 A;  4RGU A;  4ZYE A;  3H0G J;  4LD5 A;  3TBI A;  2VE9 A;  1G3W A;  2ZJP F;  1XSV A;  3TOA A;  4EM2 A;  5M3M J;  3HGY A;  1NHA A;  2EFP A;  1BOA A;  3WTU C;  4PDK A;  1IXS B;  3BDD A;  5K1Y A;  4FQG A;  2HXO A;  1WH7 A;  1D3Y A;  2KT0 A;  4HF0 A;  2LP0 A;  3BT9 A;  3WGI A;  2XKO A;  2ZJR F;  4FIS A;  4NQW A;  2DYS H;  5DD4 A;  2O9L A;  2X6Y A;  2P7V B;  5LHH A;  5B3S H;  4O5V A;  1APL C;  3J81 K;  2ZSH B;  3H3Z A;  4AID A;  5FKK A;  1K6O A;  1Y0U A;  4BJ5 C;  1W36 D;  3WTZ A;  1D1B A;  1ON1 A;  3ZGK A;  3NAU A;  4KNY A;  1X58 A;  2LSO A;  3PSI A;  4C3H J;  2PX9 A;  5CVR A;  4IZZ A;  3I56 I;  1T56 A;  5DS9 A;  2IBD A;  3DPT A;  2MLG A;  3JR9 A;  3HSF A;  4RA2 A;  3LFU A;  4IHW A;  4BH9 A;  3QOD A;  5CQE A;  1S5L C;  3U1K A;  1T08 B;  3ZQC A;  2R7U A;  2DFH A;  1T95 A;  3M9A A;  3O6B B;  2Q2E B;  4F7Z A;  1D1A A;  1JUS A;  4XQF A;  2HQA A;  2Y31 A;  3WTW C;  2Q8K A;  3DEW A;  2DT6 A;  3S93 A;  2A6T A;  4M72 A;  1DDN A;  5J8C A;  3DTI A;  2DMQ A;  2LY1 A;  1J09 A;  5FLX K;  4BNC A;  2O3F A;  3IAM 2;  5E3M A;  3FXM A;  5FLX Z;  2C6Y A;  1KU2 A;  4MQ9 F;  2BGC A;  3TGN A;  5CVU A;  1GT0 C;  2KMU A;  4I7H A;  5B66 C;  3GZ5 A;  3L2U A;  4FCY A;  2QEX I;  2DU9 A;  2JUC A;  2QEN A;  3ZQ7 A;  3PM1 A;  1LEA A;  4CZC A;  3ZMV A;  3WTX C;  4R8H A;  1A35 A;  2ELK A;  1YQA A;  2VXD A;  1XN7 A;  2EIK H;  4QPQ A;  1DGW Y;  4M71 A;  3EUK L;  3CTA A;  1X2M A;  2XHK A;  5AON A;  2V4J C;  3LSH A;  1LUJ B;  2BXY A;  1EA3 A;  3KLN A;  3BR2 A;  3P9I A;  1MJB A;  2H6C A;  3PUF A;  1Z3Y A;  4IQJ A;  4A3B J;  4XID A;  2GAU A;  2HWV A;  4HLY A;  4Y33 A;  1G4D A;  5ILU A;  1GXQ A;  1U5T A;  1R00 A;  3A0B C;  2J5P A;  3P9C A;  3RSN A;  1Q1H A;  3KP2 A;  2I5U A;  4EJT A;  2CUE A;  3WG9 A;  4M6Y A;  4B47 A;  5GAD J;  5LLQ A;  1IJW C;  3VSK A;  2LOO A;  4D5C A;  3SYT A;  2GXA A;  4KIT B;  3EQL F;  1YOV B;  2VIX A;  2BVL A;  3ZN1 A;  4EJV A;  1ZG5 A;  3MZY A;  4KT6 A;  1XCV A;  3DU5 A;  5LHG A;  4TV7 A;  3OYK A;  3B02 A;  2PMZ A;  1W7P B;  3HOU J;  1FX7 A;  3PNV A;  3WU1 B;  1R49 A;  2EZL A;  2XAQ A;  2OZ6 A;  2TRT A;  3KET A;  4XLF A;  3WE2 A;  2VC0 A;  3KEY A;  3BR5 A;  3ZN0 A;  1I39 A;  1WJC A;  2XF7 A;  3OMY A;  2M1B A;  2FXA A;  2YU9 J;  2MC4 A;  3S17 J;  2DJN A;  2LY9 A;  4PGH A;  3L2R A;  4KDP A;  2FOW A;  1YIO A;  2EJR A;  1UHM A;  3WTY C;  3GTK J;  1YLF A;  3CDL A;  3NQO A;  4C30 A;  2STW A;  2EBI A;  2V7F A;  5CKT A;  2Q0O A;  2G9W A;  3W2A A;  1ZKG A;  1K4T A;  5BMZ A;  2EK5 A;  1U5T C;  3WE3 A;  2CO5 A;  3Q0U A;  5LEJ A;  3BQY A;  2XAF A;  2L7K A;  2HR3 A;  4P96 A;  1ERD A;  3RKX A;  1DU0 A;  1H9T A;  4HV6 A;  3S1Q J;  1ON2 A;  1V5E A;  2E19 A;  2DTR A;  3AFH A;  1W1W E;  4ABZ A;  3DU6 A;  2ZFU A;  1YX5 A;  4Y15 A;  2QKM B;  1XMX A;  1WRJ A;  1R4N B;  5DV5 A;  4CCK A;  1DQU A;  3MZ8 A;  2LRE A;  3QP5 A;  2V1N A;  4MEX F;  2ZCW A;  5E8I A;  3N4M A;  4IOA F;  1JKR C;  5FD5 A;  4KMF A;  1WGX A;  1BW5 A;  2O7O A;  1VQL I;  5EDN A;  2AS5 F;  1X2N A;  3C18 A;  2MW8 A;  4EJU A;  5IYC J;  2OF7 A;  1JJ6 C;  2AHQ A;  3M3Y J;  2ZO4 A;  2P4W A;  3I59 B;  4RM3 A;  2E34 A;  3BWG A;  3S1R J;  1ZAO A;  3TMO A;  1EF4 A;  3V7C A;  4S04 A;  3OSF A;  2QQB A;  2K3P A;  1OCC H;  1D5V A;  1B59 A;  2HYJ A;  2DOD A;  3CQZ J;  4KJZ A;  5B1A H;  4YFN F;  4B4C A;  4LLL A;  3TO7 A;  2A6E F;  2LBF A;  2XGE A;  4G94 A;  1SFU A;  1BL0 A;  2KJC A;  4PJN A;  2R7T A;  4A3C J;  2PMZ N;  3K7A J;  3DLA A;  4XOT A;  4IRH A;  3K1N A;  5K7H A;  3FIS A;  1L0O C;  4PSX A;  3ZQI A;  1SD7 A;  3E6C C;  1RKT A;  2DA7 A;  2BY2 A;  2AXL A;  4RS8 A;  2DLL A;  4S0H B;  5JI6 A;  1LFU P;  2KRF A;  4XSZ F;  1R36 A;  3UNG C;  2KIU A;  2PJR B;  4WK8 F;  3DTK A;  2ACJ A;  3KYD B;  1HBX G;  1HXD A;  2HQ5 A;  2RAE A;  3PNT A;  3TED A;  2UXN A;  1FY7 A;  3ERE D;  3BG5 A;  4UUS B;  1ETV A;  1I50 J;  2A05 A;  3FM3 A;  4RGX A;  4D5F A;  1K78 A;  4DQ2 A;  4ZDO A;  2WAQ A;  1QZZ A;  2MLK A;  3BLY A;  1LVA A;  4XRF A;  3SFZ A;  3OR1 C;  2L9S A;  1C0W A;  1HKQ A;  1VTN C;  2DT5 A;  1YW9 A;  2ICW G;  2IPQ X;  2OV7 A;  2VKH A;  5L3D A;  5DYM A;  2GWR A;  3M07 A;  4PJJ A;  4QLC U;  5LEK A;  2DXI A;  1QPI A;  4UY8 I;  2XRL A;  3A1Y A;  1FOY A;  3Q9S A;  3PQJ A;  2HQN A;  3IP4 B;  1IN5 A;  3S2W A;  2DFF A;  4V2G A;  3ABM H;  4A5N A;  1YX3 A;  3HOX J;  3I71 A;  3U21 A;  4BQQ A;  4G12 A;  2R3S A;  2D1H A;  4MO7 A;  5D5X B;  3BJ6 A;  2WV0 A;  2V1U A;  2VJ5 A;  5A2Q Z;  3QWL A;  2V6E A;  2KPM A;  2F6C A;  2EZK A;  3L09 A;  2FE3 A;  2AQE A;  3LMM A;  4AM3 A;  2Z3Y A;  1K61 A;  2Z5U A;  1QZY A;  2CYY A;  4I01 A;  2VQH A;  3QOE A;  5J47 A;  1W5T A;  2CV0 A;  1LFP A;  3RYP A;  2H8W A;  2KL4 A;  2CFO A;  1X19 A;  2L54 A;  4BAY A;  2GOM A;  2M2E A;  3CZ6 A;  1FWZ A;  5F08 A;  3QU6 A;  3ABL H;  2R7S A;  1IN6 A;  1BI3 A;  3H92 A;  2NS7 A;  3E6M A;  5IY5 H;  3G6E I;  3CES A;  2P5K A;  2ZXI A;  3I59 A;  3RYR A;  4PJ0 C;  5K7Z A;  2HYG D;  2DT7 B;  3HOV J;  2OPT A;  2M4G A;  2XDV A;  1B4A A;  2KZG A;  5JLX A;  4XRS A;  3HIF A;  4ESJ A;  4M9S A;  3E5U A;  3M7G A;  3G1L A;  4OIP F;  3GME A;  2UZK A;  2HFH A;  2KDZ A;  1R9T J;  4XLP F;  1MIJ A;  4MFD A;  3WTV C;  1YI2 I;  2K02 A;  1ZQ3 P;  3PFY A;  4BJT A;  3E5X A;  2WAQ N;  1PYV A;  1RES A;  3C2B A;  3HRT A;  3J80 K;  4Y3O A;  1MKM A;  2A5W A;  2HVS A;  1T0F A;  4UB8 C;  3RJP A;  3W2V A;  1JUP A;  1LVK A;  5L3F A;  3JRC A;  5IT9 K;  2EIN H;  5IT9 Z;  5LGN A;  2EH3 A;  2QGU A;  2HI3 A;  1OJL A;  3PO2 J;  2F4O B;  3S2H J;  3ZMD A;  5D6F A;  5HNH A;  3BTI A;  4KIB A;  3TW6 A;  3CO7 C;  3WHC A;  4EAT A;  3OS2 A;  1LKX A;  3ELK A;  4IHY A;  2MH2 A;  2P6S A;  4G6Q A;  2VJI A;  3MKL A;  1ETK A;  5DM6 F;  3JAM Z;  2YR2 A;  3IKT A;  3W6K B;  3K4B A;  1WVR A;  1KA8 A;  2D2W A;  3SJM A;  3RQI A;  2M8E A;  2X1C A;  2X6X A;  3E6D A;  3SDB A;  3L2W A;  4IHX A;  4BQA A;  3DF8 A;  4DYR A;  5KAF C;  2CMP A;  1EKE A;  4CYC B;  1ITY A;  4MHG A;  2L4M A;  3GTJ J;  4HNT A;  3SZG A;  1Z9C A;  4MTD A;  3RPU D;  3CP8 A;  1K6Y A;  2L7M P;  5E3N A;  3F21 A;  4BAC A;  4YFX F;  3BTC A;  3CCY A;  2W25 A;  2M9H A;  2LMD A;  2XRN A;  1BOB A;  1CGP A;  1QGP A;  5J1Y A;  5EEG A;  4HRI A;  1MH4 A;  3ASN H;  4M6V A;  1IRX A;  1TNS A;  3CF2 A;  3ABT A;  3SEQ A;  3H5A A;  4ZDP A;  2HOA A;  2RNJ A;  2NOJ B;  2E1O A;  1XSD A;  4MIM A;  4WXH A;  3JCU C;  2DBB A;  3HHG A;  3AAF A;  1O3S A;  3E0J B;  3REO A;  4ZZD A;  3CJN A;  2VQG A;  5EGO B;  5D4S A;  5HLH A;  3IH3 A;  1YIT I;  2B7E A;  4W97 A;  5JVG F;  2X4H A;  2CV2 A;  3C2G A;  1IXC A;  1FYK A;  2Z99 A;  2M0C A;  3J7Y J;  1DU6 A;  4U7D A;  2A5Y B;  3TDU C;  3GTP J;  2NAZ A;  2EWN A;  3I64 A;  4BDY A;  3CF5 F;  1ZGW A;  4I2O A;  2X85 A;  4BXU A;  1ETX A;  2RRE A;  4S05 A;  4FE4 A;  1QNT A;  3FXR A;  1TNT A;  4AC0 A;  2F4M B;  2XF6 A;  2F5D A;  2A07 F;  3D5R C;  3LWF A;  1PUE E;  3FBN B;  4F52 A;  4HF1 A;  2ZKZ A;  4C2T A;  3OOP A;  3Q3S A;  3ZMZ A;  3C2H A;  4XLH A;  3CUQ B;  2JA2 A;  2LH9 A;  4YG2 F;  4E6K G;  1J9I A;  1IUF A;  1X3Z B;  1BIB A;  1WQ2 A;  5M5X J;  4L5E A;  2BZT A;  1IN8 A;  4WCG A;  5FKN A;  3WTS C;  2JRM A;  4KT5 C;  2ZSI B;  3VYS B;  2EFN A;  3S2D J;  2JT1 A;  2E5Z A;  1DGR M;  4YIR X;  2VBZ A;  3UR3 C;  5LBQ A;  4CA0 A;  5F0F A;  1A31 A;  4GYG A;  4XRM A;  2QSF X;  3K4L A;  3F6V A;  2VI6 A;  3M1C A;  1IV6 A;  1NK3 P;  4J01 A;  4Q48 A;  3FHN A;  4U0Y A;  2DMN A;  4L9V A;  3TQN A;  3IRR A;  4HQE A;  5C4J J;  2R7D A;  2JVG A;  5EEH A;  4AIH A;  2R0Q C;  4RAZ A;  4FET A;  1I27 A;  3WTT C;  1H89 C;  5CQG A;  4BXF A;  4LB5 A;  3V8K A;  4BEH B;  2BYV E;  1HF0 A;  4G6D A;  4HBL A;  1J59 A;  3TO6 A;  4HW0 A;  1SD6 A;  3CCS I;  3OYB A;  3Q5F A;  3BR3 A;  1OCR H;  1ONV A;  2UV1 A;  4ZYA A;  2BV6 A;  1USS A;  3SQN A;  4FTH A;  4HF2 A;  3HOY J;  3GEZ A;  2IVM A;  1X3W B;  1TTY A;  2NXN B;  3R61 A;  3P9K A;  2JA5 J;  2ID6 A;  3HSE A;  1IZ1 A;  3EUH A;  5J8F A;  4QIW N;  3ROU A;  3HTS B;  4XNF A;  1J0R A;  1XX5 A;  1ZRD A;  4XBF A;  2VUM J;  3OYI A;  2L5Q A;  3AG4 H;  2R93 J;  2H27 A;  3A02 A;  2IA0 A;  4IOC F;  1LEB A;  2XAH A;  3DXJ F;  1UG0 A;  1D0Z A;  1T8I A;  3GF2 A;  1IG7 A;  1EJ9 A;  1GV2 A;  4QTR A;  1DPU A;  5HLT A;  1PUF A;  2HKO A;  2KP6 A;  3RKQ A;  3HPH A;  2F5V A;  1VF9 A;  1B8I B;  1V3F A;  1V5G A;  3JRG A;  2XGX A;  2IA1 A;  2CGP A;  1B72 B;  1P4W A;  1Y1W J;  2LR8 A;  1HA8 A;  3K6G A;  1H8A C;  3BC8 A;  5AIP A;  3S14 J;  1FC3 A;  1I1S A;  5IP7 J;  5KK1 A;  1WJ5 A;  1MBJ A;  1Y39 A;  3SEZ A;  3MWM A;  1WSU A;  2E1M C;  3H36 A;  2W7N A;  3CC4 I;  4CSW A;  3H9J A;  3GFL A;  2KRH A;  2VKV A;  3HJE A;  4HEA 2;  2W84 A;  3RDI A;  4ANJ A;  4I98 B;  2FSW A;  4CO8 A;  4C2U A;  4NC6 A;  1TLH B;  2GA2 A;  1M1E B;  1UG2 A;  3FKI J;  5L3G A;  4RM2 A;  2K85 A;  3T5X A;  3EUH C;  3ZXS A;  5EEA A;  3CUQ A;  2QWW A;  3CCL I;  1ENH A;  2MD5 A;  5FB2 A;  3OOU A;  1JXS A;  3COA C;  4A3D J;  2V6C A;  3KIO A;  2XGC A;  5HS7 A;  3KZY A;  5B1B H;  3KFW X;  2OCC H;  4Q4Z F;  4M3G A;  2LK2 A;  5DM7 F;  2DAO A;  3G71 I;  1WI3 A;  4ZYG A;  3GTO J;  1I1G A;  4CCO A;  2CSO A;  5FGM A;  4B43 A;  2NVX J;  2PI0 A;  2KFD A;  2B0L A;  1PDN C;  4CCJ A;  4B1R A;  2HYF A;  1OPC A;  3FXU A;  4LG3 A;  5KHD A;  3K4N A;  1WI9 A;  3OWT A;  4RB3 C;  2EIM H;  3DPU A;  2HOT A;  2COM A;  2BBY A;  3AL0 B;  1UCR A;  4G6T B;  3ZMU A;  1VQM I;  2K86 A;  4PUS A;  1P9Q C;  4G8X A;  3E7L A;  1K79 A;  3HBL A;  2ADU A;  1S29 A;  2EV6 A;  3T8R A;  1HC8 A;  2P81 A;  3HOW J;  4YII A;  3ZR8 X;  2Z1D A;  4RB0 A;  3V42 A;  4AU7 A;  3QRF F;  2OU2 A;  2D1V A;  5GTI C;  1YO5 C;  1QPM A;  2XV4 S;  2GBY A;  5F0H A;  2XUB A;  3BR6 A;  2QYO A;  3OIP A;  3HTU A;  4WF2 A;  5BOX A;  2X51 A;  3HC7 A;  2JVH A;  1W5C C;  3CUQ C;  5E3O A;  3BTJ A;  3F8N A;  3DKY A;  1N78 A;  1U0J A;  3MQ0 A;  1P7J A;  2WAF A;  1U6G A;  1R5H A;  1F5T A;  2M7B A;  2XPV A;  2CW8 A;  3K4C A;  1P7I A;  2L9N A;  2XAJ A;  1W0T A;  1U8R A;  4DZP A;  4E7J A;  2HDD A;  5EJC A;  3RCO A;  3SFI A;  3U2R A;  1ZG3 A;  3D0S A;  4N0B A;  4BU2 A;  5CLS A;  3WG7 H;  1FBQ A;  3F8C A;  2QUF A;  4I76 A;  4C3I J;  4EM1 A;  2DA6 A;  2DK5 A;  4PFO A;  3G3Z A;  1B72 A;  5D4R A;  1HDP A;  5K5O A;  3ISP A;  1YHQ I;  3BQZ A;  1BI1 A;  3X2Q H;  1YS7 A;  4B3A A;  3MKZ A;  1MNE A;  2RV8 A;  1MD0 A;  3W6J B;  1IAW A;  4UV9 A;  3G1O A;  2HVQ A;  1XCB A;  2X6O A;  2QLZ A;  2DPU A;  1ZYR F;  3VDX A;  2DFE A;  3U1D A;  1SFX A;  3ZQF A;  3S15 J;  1KYW A;  3FZV A;  4XOR A;  1VZ0 A;  5M5W J;  3RIR A;  2L4A A;  1S8N A;  3HYI A;  2EFQ A;  4LG0 A;  1N77 A;  1R22 A;  4GGG A;  5LHI A;  2ZNZ A;  3JTG A;  2FBK A;  3HZJ A;  1LNW A;  2P8T A;  4UXN A;  4LFU A;  4BS9 A;  1YJW I;  1P4X A;  4N4O B;  2WC2 A;  2KIM A;  3MCZ A;  4IQ4 A;  2E2I J;  1HW1 A;  2JK3 A;  4Y17 A;  4E7S A;  3I4N J;  1W5S A;  1RET A;  2QA4 I;  3F9K A;  2XC7 A;  1R1U A;  5JVT A;  1KON A;  1ZK8 A;  1AKH B;  2XSJ C;  1OKR A;  4BBR J;  5BPI A;  4RAF A;  3H35 A;  1X4P A;  3KCC A;  2W82 A;  1ZGJ A;  4UNO A;  2E1C A;  1V54 H;  2R7F A;  3WU2 C;  3FX3 A;  4QSH A;  3HL2 A;  3TL4 X;  4FX4 A;  3KX2 A;  2L9V A;  5KNL A;  3G2B A;  3FWE A;  1TW2 A;  1K7A A;  3DBR B;  2Z33 A;  2WAD A;  4DNC A;  2MAB A;  4ZC3 A;  4RLF A;  2F2E A;  2LTP A;  3Q0W A;  4R1H A;  5HS9 A;  1OFC X;  2JMW A;  4LLN A;  2O6G E;  1ZH5 A;  4AYB A;  1IO2 A;  1Z05 A;  3DBH B;  1U9N A;  2CW0 F;  4ON0 A;  5HOD A;  2DDA A;  5F6F A;  1QA6 A;  1SMY F;  4PK4 A;  4ZDL A;  3IRQ A;  4MLO A;  3AG2 H;  1S72 I;  4ENM A;  2NVU B;  1Z67 A;  3IUO A;  3ASO H;  4LMY A;  4BXX J;  4PSW A;  5F27 A;  2HPI A;  2WBM A;  2Q2E A;  2MD0 A;  3BCB A;  3S3N A;  2LFB A;  4PJM A;  2JA6 J;  4NC7 A;  1BW6 A;  3K10 A;  1QHH D;  2NNN A;  5BPD A;  2KQR A;  2LD5 A;  1RUN A;  3LA7 A;  3WOD F;  3HGG A;  5FRO A;  4ZH4 F;  4L5I A;  2V9P A;  4A0Y A;  4OIN F;  4M3F A;  2R5Y B;  4DOZ A;  1YFH A;  2M5W A;  4KN4 X;  2IJL A;  2JSP A;  4II2 A;  2JPB A;  2KRC A;  3AL0 C;  1QU3 A;  2RQP A;  1ODD A;  4BHC A;  2FD5 A;  3BG3 A;  4D9J A;  4UUV A;  4N9H A;  5E79 C;  3BJO A;  2R7W A;  3WU0 A;  1D1C A;  4BE1 A;  5ICG A;  4RAG A;  3OSG A;  3PO3 J;  2GIV A;  3KYC B;  1VQ7 I;  1GHC A;  2KIF A;  4C3J J;  4HDV A;  1A36 A;  4ZJZ A;  2B63 J;  3BZ6 A;  1U78 A;  2V26 A;  1E3O C;  2LLK A;  5IOZ A;  3DKX A;  1ZGA A;  4PFP A;  4HX4 A;  1SAU A;  2DN0 A;  2KKO A;  1VQK I;  3V7S A;  4N4N B;  4Q5S F;  2DMT A;  2FNP A;  1G3S A;  5AIQ A;  3OYH A;  3N97 A;  2QQ8 A;  5BQT A;  2KHM A;  1PP7 U;  2L01 A;  4ENN A;  1RC9 A;  2ME6 A;  4JK1 X;  4LLG F;  1VQ8 I;  3ONQ A;  3H3U A;  4HST A;  5CVI A;  1IRF A;  1MMD A;  4XMY A;  4NBQ A;  2YS9 A;  4ZTJ A;  4KIG A;  5J1U A;  4X6A J;  4AYB N;  1BM9 A;  2QF7 A;  5M3F J;  1HW2 A;  3E97 A;  1O4X A;  3Q9V A;  2IS2 A;  2LDU A;  4HNV A;  3M8E A;  1K4S A;  2GZW A;  5GP9 A;  4DBR A;  3LNQ A;  3O8H A;  3KYL A;  3W6V A;  1FOX A;  1MMG A;  2JA7 J;  3KLO A;  2HKX A;  3FMQ A;  3IKV A;  3TKY A;  3S3M A;  1R71 A;  4J19 A;  1T38 A;  4OMY A;  2PBI A;  3IWF A;  4UV8 A;  1IDY A;  5M5Y J;  1W4M A;  1W7P A;  1SD4 A;  4D1Q A;  1TWC J;  2DQR A;  1LPQ A;  1AWC A;  3I55 I;  4EV0 A;  4U0V A;  2M4K A;  1O3R A;  2NOG A;  2ZC2 A;  2HOE A;  1FYL A;  4XRS G;  5E1W A;  4ASN A;  4ZTF A;  2K9M A;  2XSD C;  2CU7 A;  2YSR A;  3G4S I;  2LKX A;  1IGN A;  2GXB A;  5D8L B;  1QQI A;  2DW4 A;  3I9V 2;  4KUM A;  1Y0N A;  1XMK A;  1YYV A;  2W48 A;  2HVR A;  3ZRG A;  2ETH A;  2XPU A;  1BIA A;  1H0M A;  3H3V K;  2L7Z A;  4IXA A;  4XL9 A;  5BNG A;  2ELJ A;  4UVB A;  4CCM A;  2R4G A;  2JWT A;  4LGW A;  1VI0 A;  3I58 A;  1PJR A;  3QAH A;  4Y52 J;  1YS6 A;  2IW5 A;  5FRN A;  1A04 A;  3DKW A;  2Y69 H;  2KLO A;  2IA2 A;  3PL8 A;  4XKV A;  5CVV A;  4P55 A;  3RPQ A;  4X0G A;  3KE2 A;  2E36 A;  4BY1 J;  4Y13 A;  3D5L A;  2IRF G;  5A2Q K;  1T98 A;  4LIU A;  3FXO A;  2UWM A;  3ZP5 A;  1R58 A;  2HXI A;  2VL8 A;  1A6I A;  3F0C A;  1XGO A;  2OA4 A;  2FEZ A;  5D8K B;  2MG4 A;  3RZD J;  3HOT A;  2OTJ I;  4WXD A;  3TP3 A;  3Q0V A;  3ML6 A;  5C4X J;  3SHF A;  2QKL B;  2VQL A;  4II3 A;  5FRM A;  2XIG A;  4KN7 X;  2RC4 A;  3A03 A;  3W3C A;  2E7W A;  3A4C A;  4UHT A;  4ZYH A;  3DEU A;  3CC2 I;  4HZF A;  4DJA A;  5FJ8 J;  1UEL B;  2DOE A;  3TP0 A;  3ECH A;  2O61 A;  2A61 A;  1XDU A;  2FMY A;  3R0J A;  4YIF A;  2QBY B;  1OQY A;  2JRT A;  4EEF G;  3BPX A;  3LAJ A;  1WHU A;  4OMZ A;  1HOM A;  3ERM A;  3JRE A;  1JTX A;  2M30 A;  3OL4 A;  2OCE A;  2UXX A;  3HRM A;  3K4K A;  3OV8 A;  2LYC A;  2M8G X;  5HDG A;  4YRV A;  4IL6 C;  2F4I A;  3PUB A;  4A6E A;  4F55 A;  2Z9O A;  3PIO F;  3LSP A;  3KP4 A;  3BCA A;  4JP0 A;  1LQ1 A;  3I3L A;  4IEJ A;  2QM3 A;  3A2K A;  3FHZ A;  2FJ1 A;  2BHY A;  2JPC A;  1TBX A;  2QSH X;  1XB4 A;  4Y4R A;  3OYG A;  2V9V A;  2PQ8 A;  3HPG A;  2PJR A;  4CXF A;  4YEJ A;  1UMQ A;  1VND A;  1RR8 C;  2OC6 A;  1QHG A;  5C3E J;  4L9J A;  3HM5 A;  3QOP A;  4G9Y A;  4WXC A;  4UUS A;  2XKP A;  2NRA C;  3HOZ J;  1J7K A;  1P2F A;  1MMS A;  2R7O A;  4FE7 A;  1K83 J;  1IN7 A;  4O3M A;  5J6X A;  1AHD P;  1LE8 B;  2K40 A;  1RUO A;  2ISZ A;  5GTH C;  3PFI A;  4PZJ A;  3JAM K;  4CYD A;  3LSR A;  3AG3 H;  3AKZ A;  2JTV A;  4L0Y B;  1KYZ A;  1EV7 A;  1R5I D;  3VYR B;  2FML A;  2RN7 A;  3MKW B;  2DI3 A;  3J7A O;  1KU3 A;  3S1M J;  1UFM A;  3I4M J;  3LST A;  4MFE A;  4RMN A;  2P5V A;  1B1B A;  4EQQ A;  4NDL A;  3WHB A;  5HVQ C;  2K7L A;  1RRJ A;  4AVZ A;  2QZ8 A;  3H9Q A;  3HKZ A;  1LDD A;  1Z7L A;  2BEO A;  2ZB9 A;  4BUP A;  1FSH A;  3GTQ J;  4I0B A;  1DP7 P;  2IS6 A;  4KYW A;  1U2W A;  3K70 D;  4BL0 B;  1W0U A;  1B9N A;  3BG9 A;  4QPO A;  2M34 A;  4G7Z F;  5FO5 A;  2VKE A;  3ZQH A;  2EA2 A;  2LF8 A;  3DCF A;  3LA2 A;  4V2F A;  3OYN A;  1O7L A;  2HDW A;  3ZMT A;  1FJL A;  2P0W A;  5DCM B;  3KZI C;  2H1L A;  4B3X A;  5L3E A;  2WV1 A;  5E20 A;  2W1O A;  3QU3 A;  1MSE C;  4V19 K;  2HQR A;  3OYA A;  2BW3 B;  1IF1 A;  3JTH A;  1AOY A;  1SEU A;  3RKW A;  3LSI A;  3PNY A;  3MVP A;  3SXY A;  5H2F C;  3J7Z I;  2ZME B;  4BGD A;  1CQT A;  2HS5 A;  1ZTR A;  4J00 A;  2RKH A;  1LDJ A;  4UVA A;  2FOK A;  1FEX A;  3AG1 H;  1G2H A;  5F1R A;  3B6C A;  1FPQ A;  2E2J J;  1JGG A;  4KFC A;  2QBY A;  2EA4 A;  5IP6 A;  1T33 A;  4EGY A;  2QSG X;  3GXO A;  5K5R A;  1VQ5 I;  3VYT B;  2A69 F;  3BG7 A;  4A3K J;  4XN3 A;  1XSX A;  1ZHF A;  1LFB A;  2MH9 A;  4Z6Y A;  1JKP C;  2DA5 A;  4CUG A;  1WJB A;  4GCV A;  4P9F A;  2F5F A;  4JOM A;  2D45 A;  4GYI A;  1TWH J;  4P1W A;  1A5J A;  5E17 F;  4XLN F;  1MJ9 A;  2FU4 A;  1SVM A;  1PP8 F;  5HNF A;  1BJZ A;  5TIS C;  5JLW A;  2HZD A;  1HSJ A;  1V5F A;  2VKD A;  2LVS A;  4FX0 A;  4HAM A;  1IC8 A;  1DPR A;  2STT A;  3LOC A;  2KJB A;  4WX9 A;  3I54 A;  4P5O A;  2VBX A;  2YPR A;  2AO9 A;  3IH2 A;  4MEY F;  3BR0 A;  1BR4 A;  2XRO A;  1WJF A;  2ZXH A;  4PJL A;  2EZI A;  1R1V A;  3HKZ N;  2AXT C;  4PCQ A;  4XON A;  2E60 A;  4DIQ A;  5CYV A;  1X1C A;  5ERI A;  2OD5 A;  5J3L A;  4D0P A;  2EFW A;  3PIP F;  4WWC A;  3OYF A;  5EZG A;  3F8F A;  2HPM A;  4BDZ A;  4JBA A;  3FXJ A;  1MDM B;  1VQP I;  3VOD A;  3JW4 A;  5FFX A;  3BOQ A;  4JX4 A;  3DWL E;  1I3A A;  2VPR A;  4CYC A;  3KP3 A;  2DPD A;  4EVI A;  1FTT A;  2FQ3 A;  3BTL A;  2FX0 A;  3DQV C;  1HST A;  2A68 F;  4BBS J;  3OL3 A;  1GVD A;  2AQF A;  2EFO A;  4M9X A;  2CG4 A;  3TW7 A;  3H0D A;  2K4B A;  1B6A A;  2WB1 A;  1MMA A;  3ECO A;  5EG0 B;  4BKX A;  2M3A A;  5J1R A;  5LFA A;  2R7V A;  2K9S A;  5DUI A;  1QZE A;  1UJ8 A;  4HV5 A;  3CJQ B;  3HRS A;  3KP5 A;  5F1J A;  1HLV A;  2VAS A;  2DCE A;  1Y8R B;  2P7C B;  3HOS A;  4RDU A;  4F93 B;  2PG4 A;  1O3Q A;  2ZFW A;  2CQX A;  2L02 A;  3NEU A;  4XLE A;  5IPA A;  4H4K C;  1GVJ A;  4XN0 A;  1YE9 A;  5HOO A;  4FHT A;  4AUX A;  3NWT A;  2NYX A;  2COB A;  4XKB A;  1ETY A;  4M3D A;  5L3C A;  5EGO A;  1ACI A;  2K5C A;  1R5G A;  3K4M A;  3ZPL A;  4G7O F;  6PAX A;  2DMU A;  2M7A A;  5FKL A;  3D1N I;  1BI0 A;  2VQC A;  3L2V A;  1T2K A;  2XGD A;  2VC1 A;  5B5E C;  1OYY A;  2KZV A;  2L9R A;  4LK1 F;  1HKS A;  4CCN A;  2Y0S A;  5J4V A;  1YJN I;  3QQA A;  4R79 A;  3OR2 C;  3TO9 A;  5FLM J;  2NNY A;  4E7I A;  2OJE D;  1IXR C;  2E5N A;  4ETS A;  3MEX A;  4E7K A;  1OMI A;  2XAU A;  3FIW A;  2VPL A;  5EF6 A;  5H20 A;  1QBJ A;  3IH4 A;  3QYB A;  1Z1D A;  2G7U A;  1KQ9 A;  4M73 A;  5F0C A;  2EIJ H;  3VYU B;  2OBP A;  2EV5 A;  5CJ9 A;  3JRI A;  2QQ9 A;  4HOB A;  3DLL F;  2IAI A;  3DP7 A;  3CD6 I;  3E5Q A;  1SAN A;  3BG6 A;  4FT8 A;  3VWB A;  3GTM J;  4HQM A;  2IT0 A;  2GOX B;  1TW3 A;  5FLV A;  4Z2Y A;  3F6O A;  2ZJ2 A;  5E1Z B;  2MBF A;  4AWX B;  3HUG B;  2F48 A;  5ED4 A;  1NK2 P;  2MFZ A;  2XB0 X;  3B73 A;  1EH8 A;  3NAR A;  2R92 J;  3FKJ A;  3CMA I;  2VON A;  4U7B A;  2Y9Y A;  3FXL A;  3H5R A;  3NWS A;  5H6R A;  3M4O J;  2WY7 Q;  5L3B A;  1NG7 A;  4HPQ A;  1IV8 A;  1FNN A;  1MH3 A;  2WB1 N;  2IXS A;  4Y7N J;  4OIR F;  3K0L A;  3GO5 A;  3K69 A;  4MNU A;  4A0Z A;  1JTY A;  1V55 H;  1HW5 A;  1S3J A;  2MC3 A;  3M8F A;  2IGK A;  4BHP A;  1MSF C;  3GFM A;  2FUG 2;  3I4P A;  3PQK A;  4A3G J;  4BEH A;  2ZXW H;  3T8T A;  3A01 B;  2X9D A;  2JSC A;  2VB6 A;  1QRY A;  2MGQ A;  3HSR A;  3GCM A;  3BPV A;  2BHZ A;  5EG0 A;  3O3K A;  1CF7 B;  1UST A;  2CRG A;  4DYC A;  3OY9 A;  3MD2 A;  4A3L J;  2CFX A;  3NRV A;  4EM0 B;  3OYC A;  3LSK A;  3E1S A;  1AU7 A;  2Z16 A;  4XK4 A;  1HKT A;  2IGM A;  2V1D A;  3LQQ A;  2K3F A;  2PJP A;  1VQ6 I;  1P92 A;  4XKW A;  2Y0S N;  5HS8 A;  1TWF J;  3K4J A;  4OOI A;  3J81 Z;  3LAP A;  2K27 A;  1AA7 A;  3HB9 A;  4LOC A;  3W2W A;  3CCV I;  1JI8 A;  2KDO A;  4JQF A;  4MQV A; 
#chains in the Genus database with same CATH homology
 1ULY A;  4CGZ A;  2ZNY A;  3GVA A;  2H6B A;  1MJA A;  3E6B A;  3WGG A;  2DFI A;  4H0E A;  5D6E A;  1L3L A;  4EGZ A;  3IL2 A;  4HX7 A;  5ILV A;  4IF4 A;  2XAS A;  2FBI A;  3FMR A;  1T39 A;  3BY6 A;  5H6Q A;  2PN6 A;  2MA3 A;  4LB6 B;  3JSO A;  3RKY A;  1FT9 A;  4HYE A;  4CHU A;  4N9I A;  2OQG A;  2VE8 A;  3GYH X;  1I6X A;  2F5E A;  3CO6 C;  4B8X A;  3HUG A;  4IHT A;  1XMA A;  5ICE A;  1XGS A;  1IRG A;  1ZRC A;  2O0Y A;  2RGV A;  1FBS A;  2Y75 A;  1EH7 A;  2LKP A;  4K2E A;  1R23 A;  2K4J A;  1E2X A;  2CWE A;  2VXZ A;  3RTR A;  2QVO A;  1V4R A;  1Z7U A;  3RI4 A;  1SFE A;  3F23 A;  1T6S A;  5D5V B;  4M9Z A;  1JGS A;  1RI7 A;  2HZT A;  1TQI A;  2FA5 A;  1LJ9 A;  4A5M A;  2FNA A;  3MFK A;  1CF7 A;  5DUK A;  1SAX A;  5LRS A;  3LQR A;  5D5W B;  1YTY A;  1D8K A;  1FZP B;  1XD7 A;  3GLX A;  5HLG A;  2ISY A;  4YFK F;  1K78 B;  5ICF A;  5CVJ A;  4L5J A;  4EMS A;  1YG2 A;  1ZAR A;  1OYW A;  1KU9 A;  2XVC A;  2DO7 A;  4UVC A;  4ESF A;  4IHS A;  1ZG1 A;  1REP C;  3L7W A;  3KP6 A;  1IW7 F;  1FP1 D;  3QPH A;  2HDC A;  1KQ0 A;  1O7F A;  3IHU A;  3F3X A;  2M45 A;  5TRD A;  4LK0 F;  1YW7 A;  5E1X A;  2WWY A;  2PMU A;  2GXG A;  1FP2 A;  3G73 A;  3T1B A;  3VFZ A;  2VT2 A;  2HTJ A;  2PFB A;  2JZY A;  2O8X A;  2ZBK A;  2LNB A;  3C3W A;  5HLI A;  4A0X A;  2W57 A;  5F64 A;  4M74 A;  3R4K A;  3MAJ A;  1F9N A;  1P4A A;  3U9G A;  2M87 A;  4NHJ A;  1OYI A;  4IVN A;  2WTE A;  2PLY A;  1O57 A;  2E7X A;  1J5Y A;  4M6X A;  1JHH A;  4GO1 A;  1HQC A;  1E17 A;  4OU0 A;  2FBH A;  2F5C A;  4KIF A;  3TDZ C;  1XGM A;  3FM5 A;  3O2P E;  3EYY A;  2Y0M A;  5LGT A;  1I5Z A;  3P7N A;  1YW8 A;  3I53 A;  3CUO A;  5ILS A;  5JR3 A;  3TOB A;  2V1X A;  3GFI A;  3V8L A;  1J2X A;  1KU7 A;  4P9U A;  1IN4 A;  5DEQ A;  3GWZ A;  1G6N A;  1TQP A;  1S6L A;  2QQA A;  3V7R A;  3VEP A;  5E8G A;  1W7P D;  3V8J A;  4RB2 C;  3QPT A;  3MZH A;  3BRO A;  4HLX A;  4CZZ A;  3LFK A;  2A3S A;  3L9F A;  3F22 A;  1X3U A;  4B09 A;  1G3T A;  4ENJ A;  1LB2 A;  1O3T A;  3C7J A;  4L0Z B;  1IUY A;  1Z91 A;  3GW2 A;  4RAY A;  1WWX A;  4IRG A;  4LJZ F;  4A12 A;  5LGU A;  3GUD A;  4I02 A;  2NS0 A;  3ZMS A;  2VBW A;  2J5O A;  4AIJ A;  3I5U A;  3HRU A;  3HHH A;  3BP8 A;  4AVP A;  4ZYD A;  3DFG A;  4NB5 A;  2VOP A;  4G7H F;  1FLI A;  4IRI A;  3E3V A;  1B9M A;  2LF7 A;  5TJJ A;  4OIQ F;  1U3E M;  4I0A A;  2H09 A;  5DD8 A;  5FD6 A;  2ESH A;  3L2C A;  4KMU X;  2Y48 A;  1F4K A;  5FFZ A;  3ULQ B;  2W85 A;  3RPU A;  5JHU A;  3C1D A;  3J80 Z;  2P6T A;  2ELH A;  4E70 A;  1ZRE A;  3T0Y A;  3WGH A;  2H94 A;  1LDK B;  3CLO A;  2G7H A;  4A6D A;  3DV8 A;  2HGC A;  4I09 A;  3BJA A;  1Z6T A;  1DUX C;  2FF4 A;  1XGN A;  4HA8 A;  3KEQ A;  4O6J A;  1XDS A;  2PMH A;  1WKM A;  3JSP A;  2V79 A;  4ZZL A;  1ZN2 A;  2L3D A;  5K5Q A;  4L9N A;  1J75 A;  4U88 A;  3K1P A;  4KIC A;  1BC7 C;  2P5L C;  1BBY A;  1BI2 A;  3K2Z A;  2YX7 A;  1R7J A;  2O03 A;  3FXQ A;  3I0T A;  3LA3 A;  2IP2 A;  4AIK A;  3GZ6 A;  2E1N A;  3IC7 A;  1BJA A;  4PGG A;  3EYI A;  5BS6 A;  3F8M A;  1R1T A;  1TQM A;  1SD5 A;  1JHF A;  3EDP A;  2GA1 A;  1BN5 A;  2ZXJ A;  1RZ4 A;  3CDH A;  1MZB A;  4EJO A;  4BHB A;  2ESN A;  3VB2 A;  1JE8 A;  1Z6R A;  4HDU A;  2OQR A;  3M1E A;  2VBY A;  4L18 B;  2PEX A;  4RB1 A;  2A6H F;  1FSE A;  4CDG A;  3R0A A;  5JFR A;  2OAZ A;  2VOO A;  3QP6 A;  5HDN A;  3K1M A;  3K9T A;  4RGR A;  2VOD A;  1FOK A;  4QWQ A;  3IWZ A;  3KP7 A;  3VOE A;  1RIO H;  2GQQ A;  1P6R A;  1FYM A;  1EH6 A;  1G3Y A;  2YX4 A;  5D5U B;  3SZP A;  3ABU A;  5ICC A;  1KGS A;  1ZLJ A;  4BYY A;  1ZRF A;  1RNL A;  3SZT A;  3F8B A;  3FMS A;  2RDP A;  5DCM A;  2DK8 A;  4XSX F;  3R6S A;  1UB9 A;  5KVR A;  2VT3 A;  4RGS A;  2W24 A;  2HTS A;  2ZME A;  4ESB A;  4KA4 A;  2CQK A;  1MGT A;  4MGR A;  2HEO A;  4IJA A;  4A2U A;  3EET A;  1KQ8 A;  1UHW A;  1OR7 A;  2XAG A;  4HX8 A;  5E18 F;  1S7A A;  3L00 A;  1F1Z A;  4CIC A;  3F72 A;  3DPL C;  2BE5 F;  2EB7 A;  1S7O A;  4Q47 A;  1QO0 D;  4OIO F;  1SMT A;  4L9T A;  2DQL A;  3FF5 A;  4MTE A;  1D8J A;  5LRR A;  4IPA A;  5DDG A;  4AD9 A;  2RVC A;  1FBU A;  4U0W A;  1H9G A;  2YU3 A;  3V4G A;  2VN2 A;  1STZ A;  4EJW A;  5DCF A;  2OZU A;  2X0L A;  1BC8 C;  3R60 A;  2FRH A;  4LG0 B;  4GXO A;  3KEO A;  3GX4 X;  4ENK A;  1GXP A;  3KZZ A;  3GFJ A;  1ZLK A;  2TDX A;  2EV0 A;  1MDM A;  5HDK A;  1U5T B;  5IT3 A;  4RGU A;  4ZYE A;  4LD5 A;  2VE9 A;  1G3W A;  1XSV A;  3TOA A;  4EM2 A;  1NHA A;  2EFP A;  1BOA A;  3WTU C;  4PDK A;  1IXS B;  3BDD A;  5K1Y A;  1D3Y A;  4HF0 A;  3WGI A;  2XKO A;  4NQW A;  5DD4 A;  2P7V B;  5LHH A;  4O5V A;  3J81 K;  3H3Z A;  1K6O A;  1Y0U A;  3WTZ A;  1ON1 A;  4KNY A;  2LSO A;  5CVR A;  3DPT A;  2MLG A;  3HSF A;  4BH9 A;  4F7Z A;  3O6B B;  3M9A A;  3WTW C;  2Q8K A;  4M72 A;  1DDN A;  5J8C A;  5FLX K;  4BNC A;  2O3F A;  5FLX Z;  2C6Y A;  1KU2 A;  4MQ9 F;  2BGC A;  3TGN A;  5CVU A;  4I7H A;  3GZ5 A;  2DU9 A;  2QEN A;  3ZQ7 A;  1LEA A;  3ZMV A;  3WTX C;  4R8H A;  1YQA A;  1XN7 A;  4M71 A;  5AON A;  3CTA A;  2XHK A;  3KLN A;  3P9I A;  1MJB A;  2H6C A;  2GAU A;  2HWV A;  4HLY A;  1G4D A;  5ILU A;  1GXQ A;  1U5T A;  1R00 A;  2J5P A;  3P9C A;  1Q1H A;  3KP2 A;  4EJT A;  3WG9 A;  4M6Y A;  5LLQ A;  3EQL F;  3ZN1 A;  4EJV A;  1ZG5 A;  3MZY A;  1XCV A;  5LHG A;  4TV7 A;  3B02 A;  1W7P B;  1FX7 A;  3WU1 B;  2XAQ A;  2OZ6 A;  3KET A;  3WE2 A;  2VC0 A;  3ZN0 A;  2M1B A;  2FXA A;  4KDP A;  4PGH A;  1YIO A;  2EJR A;  1UHM A;  3WTY C;  1YLF A;  3NQO A;  2STW A;  2Q0O A;  2G9W A;  5BMZ A;  2EK5 A;  1U5T C;  3WE3 A;  2CO5 A;  5LEJ A;  2XAF A;  2HR3 A;  4P96 A;  3RKX A;  1H9T A;  4HV6 A;  1ON2 A;  2DTR A;  4Y15 A;  1WRJ A;  5DV5 A;  3QP5 A;  4MEX F;  2ZCW A;  5E8I A;  3N4M A;  5FD5 A;  4KMF A;  2AS5 F;  3C18 A;  4EJU A;  2ZO4 A;  2P4W A;  3I59 B;  3BWG A;  1ZAO A;  3V7C A;  4S04 A;  2QQB A;  1D5V A;  1B59 A;  4YFN F;  4LLL A;  3TO7 A;  2A6E F;  4G94 A;  1SFU A;  2KJC A;  4IRH A;  3K1N A;  1L0O C;  1SD7 A;  3E6C C;  2AXL A;  4RS8 A;  2DLL A;  5JI6 A;  2KRF A;  4XSZ F;  1R36 A;  2KIU A;  4WK8 F;  2ACJ A;  1HBX G;  1HXD A;  2UXN A;  1FY7 A;  3ERE D;  3FM3 A;  4RGX A;  1K78 A;  4DQ2 A;  1QZZ A;  2MLK A;  1LVA A;  4XRF A;  3SFZ A;  1C0W A;  1HKQ A;  1VTN C;  2DT5 A;  1YW9 A;  2IPQ X;  5L3D A;  5DYM A;  2GWR A;  5LEK A;  4QLC U;  3Q9S A;  3PQJ A;  2HQN A;  1IN5 A;  3S2W A;  4A5N A;  3I71 A;  2R3S A;  2D1H A;  5D5X B;  2WV0 A;  3BJ6 A;  2V1U A;  5A2Q Z;  3L09 A;  2FE3 A;  2Z3Y A;  2Z5U A;  1QZY A;  2CYY A;  4I01 A;  1W5T A;  3RYP A;  2L54 A;  4BAY A;  1FWZ A;  3QU6 A;  1IN6 A;  1BI3 A;  3H92 A;  3E6M A;  2P5K A;  3I59 A;  3RYR A;  2HYG D;  1B4A A;  3HIF A;  4ESJ A;  4M9S A;  3E5U A;  3M7G A;  4OIP F;  2UZK A;  2HFH A;  4XLP F;  3WTV C;  2K02 A;  3E5X A;  3HRT A;  3J80 K;  1MKM A;  1T0F A;  3RJP A;  5L3F A;  5IT9 K;  5IT9 Z;  5LGN A;  3ZMD A;  5D6F A;  4KIB A;  3CO7 C;  3ELK A;  2MH2 A;  2P6S A;  4G6Q A;  3JAM Z;  2YR2 A;  3IKT A;  3W6K B;  1KA8 A;  2D2W A;  2M8E A;  3E6D A;  4BQA A;  3DF8 A;  4MHG A;  2L4M A;  1Z9C A;  4MTD A;  3F21 A;  4YFX F;  2W25 A;  2XRN A;  1CGP A;  1QGP A;  5EEG A;  1TNS A;  3ABT A;  2RNJ A;  1XSD A;  4WXH A;  2DBB A;  3HHG A;  3AAF A;  1O3S A;  3REO A;  4ZZD A;  3CJN A;  5D4S A;  5HLH A;  2X4H A;  1IXC A;  1FYK A;  2Z99 A;  4U7D A;  2A5Y B;  3TDU C;  2NAZ A;  2EWN A;  3I64 A;  4I2O A;  4BXU A;  4S05 A;  1QNT A;  3FXR A;  1TNT A;  2F5D A;  2A07 F;  3LWF A;  1PUE E;  4HF1 A;  2ZKZ A;  3OOP A;  3ZMZ A;  3CUQ B;  4YG2 F;  1J9I A;  1BIB A;  1WQ2 A;  1IN8 A;  4WCG A;  3WTS C;  4KT5 C;  2EFN A;  2JT1 A;  2VBZ A;  5LBQ A;  4GYG A;  3F6V A;  4Q48 A;  4U0Y A;  4L9V A;  3TQN A;  3IRR A;  4HQE A;  2R7D A;  5EEH A;  4AIH A;  4RAZ A;  1I27 A;  3WTT C;  4LB5 A;  3V8K A;  2BYV E;  4G6D A;  4HBL A;  1J59 A;  3TO6 A;  4HW0 A;  1SD6 A;  3Q5F A;  1ONV A;  3SQN A;  4HF2 A;  2BV6 A;  1USS A;  3GEZ A;  2IVM A;  1TTY A;  3R61 A;  3P9K A;  3HSE A;  1IZ1 A;  3EUH A;  5J8F A;  3ROU A;  3HTS B;  1J0R A;  1ZRD A;  4XBF A;  2H27 A;  2IA0 A;  1LEB A;  2XAH A;  3DXJ F;  3GF2 A;  1DPU A;  2HKO A;  1V3F A;  2XGX A;  2IA1 A;  2CGP A;  1P4W A;  5AIP A;  1FC3 A;  1I1S A;  5KK1 A;  3MWM A;  1WSU A;  3GFL A;  2W84 A;  3RDI A;  4I98 B;  2FSW A;  4CO8 A;  1TLH B;  2GA2 A;  5L3G A;  3T5X A;  3CUQ A;  2QWW A;  2MD5 A;  5FB2 A;  1JXS A;  3COA C;  2V6C A;  5HS7 A;  3KZY A;  3KFW X;  4Q4Z F;  2DAO A;  4ZYG A;  1I1G A;  2CSO A;  5FGM A;  2PI0 A;  2B0L A;  1PDN C;  2HYF A;  1OPC A;  3FXU A;  4RB3 C;  1WI9 A;  2COM A;  2BBY A;  1UCR A;  3ZMU A;  2K86 A;  4G8X A;  1K79 A;  2ADU A;  1S29 A;  2EV6 A;  3T8R A;  4YII A;  4RB0 A;  3QRF F;  2OU2 A;  2D1V A;  1YO5 C;  1QPM A;  2XV4 S;  2XUB A;  2QYO A;  3HTU A;  4WF2 A;  5BOX A;  3CUQ C;  3F8N A;  3MQ0 A;  1U6G A;  1R5H A;  1F5T A;  2XAJ A;  1U8R A;  3U2R A;  1ZG3 A;  3D0S A;  4N0B A;  5CLS A;  1FBQ A;  3F8C A;  2QUF A;  4EM1 A;  2DK5 A;  3G3Z A;  5D4R A;  5K5O A;  3ISP A;  1BI1 A;  1YS7 A;  2RV8 A;  1MD0 A;  3W6J B;  1IAW A;  4UV9 A;  1XCB A;  2QLZ A;  2DPU A;  1ZYR F;  3U1D A;  1SFX A;  1KYW A;  3FZV A;  3RIR A;  2L4A A;  1S8N A;  3HYI A;  2EFQ A;  4LG0 A;  1R22 A;  4GGG A;  5LHI A;  2ZNZ A;  3JTG A;  2FBK A;  1LNW A;  2P8T A;  4UXN A;  4LFU A;  1P4X A;  2WC2 A;  2KIM A;  3MCZ A;  1HW1 A;  4Y17 A;  1W5S A;  1R1U A;  5JVT A;  1OKR A;  5BPI A;  3KCC A;  1ZGJ A;  4UNO A;  2E1C A;  2R7F A;  3FX3 A;  4FX4 A;  3FWE A;  1TW2 A;  1K7A A;  2Z33 A;  4DNC A;  2F2E A;  4R1H A;  5HS9 A;  4LLN A;  2O6G E;  1ZH5 A;  1Z05 A;  4ON0 A;  2CW0 F;  5F6F A;  1SMY F;  3IRQ A;  4ENM A;  4LMY A;  2Q2E A;  5BPD A;  2NNN A;  1RUN A;  3LA7 A;  3WOD F;  4ZH4 F;  4L5I A;  4A0Y A;  4OIN F;  1YFH A;  2M5W A;  4KN4 X;  2IJL A;  2JPB A;  2RQP A;  1ODD A;  4BHC A;  4UUV A;  4N9H A;  3BJO A;  3WU0 A;  5ICG A;  2GIV A;  1GHC A;  2KIF A;  4HDV A;  3BZ6 A;  1U78 A;  1ZGA A;  4HX4 A;  2KKO A;  3V7S A;  4Q5S F;  2FNP A;  5AIQ A;  1G3S A;  3N97 A;  5BQT A;  1PP7 U;  2L01 A;  4ENN A;  4JK1 X;  4LLG F;  3H3U A;  5CVI A;  1IRF A;  4KIG A;  1BM9 A;  1HW2 A;  3E97 A;  3Q9V A;  2LDU A;  3M8E A;  2GZW A;  3KLO A;  2HKX A;  3FMQ A;  3IKV A;  3TKY A;  1T38 A;  4OMY A;  2PBI A;  3IWF A;  4UV8 A;  1W4M A;  1W7P A;  1SD4 A;  2DQR A;  1AWC A;  4EV0 A;  4U0V A;  1O3R A;  2HOE A;  1FYL A;  5E1W A;  4ASN A;  2YSR A;  2GXB A;  5D8L B;  1QQI A;  2DW4 A;  4KUM A;  1XMK A;  1YYV A;  2ETH A;  1BIA A;  1H0M A;  4IXA A;  4UVB A;  4LGW A;  3I58 A;  3QAH A;  1YS6 A;  2IW5 A;  1A04 A;  3DKW A;  3RPQ A;  5CVV A;  2IA2 A;  4P55 A;  3KE2 A;  4Y13 A;  3D5L A;  2IRF G;  5A2Q K;  1T98 A;  2UWM A;  3ZP5 A;  1R58 A;  1XGO A;  2OA4 A;  2FEZ A;  5D8K B;  3HOT A;  4WXD A;  3ML6 A;  3SHF A;  2XIG A;  4KN7 X;  2RC4 A;  2E7W A;  4UHT A;  4ZYH A;  3DEU A;  4HZF A;  3ECH A;  2O61 A;  2A61 A;  1XDU A;  2FMY A;  3R0J A;  4YIF A;  2QBY B;  2JRT A;  3BPX A;  3LAJ A;  4OMZ A;  2M30 A;  2UXX A;  3HRM A;  3OV8 A;  5HDG A;  2Z9O A;  4A6E A;  3KP4 A;  1LQ1 A;  2QM3 A;  3FHZ A;  2JPC A;  1TBX A;  1XB4 A;  2V9V A;  2PQ8 A;  4CXF A;  4L9J A;  3QOP A;  4WXC A;  4G9Y A;  2NRA C;  2XKP A;  1J7K A;  1P2F A;  1IN7 A;  4O3M A;  5J6X A;  1RUO A;  2ISZ A;  3PFI A;  4PZJ A;  3JAM K;  4CYD A;  2JTV A;  4L0Y B;  1KYZ A;  1EV7 A;  2FML A;  2RN7 A;  3J7A O;  2DI3 A;  1KU3 A;  1UFM A;  3LST A;  2P5V A;  1B1B A;  4EQQ A;  5HVQ C;  2K7L A;  2QZ8 A;  1LDD A;  1FSH A;  2BEO A;  4I0B A;  1DP7 P;  4KYW A;  1U2W A;  1B9N A;  4G7Z F;  5FO5 A;  2EA2 A;  2LF8 A;  3LA2 A;  1O7L A;  3ZMT A;  5DCM B;  5L3E A;  5E20 A;  3QU3 A;  2HQR A;  1IF1 A;  1AOY A;  3JTH A;  3RKW A;  3SXY A;  2ZME B;  2HS5 A;  2RKH A;  1LDJ A;  4UVA A;  2FOK A;  5F1R A;  1FPQ A;  4KFC A;  2QBY A;  2EA4 A;  4EGY A;  3GXO A;  5K5R A;  2A69 F;  1XSX A;  1ZHF A;  2MH9 A;  4GCV A;  4P9F A;  2F5F A;  2D45 A;  4GYI A;  5E17 F;  4XLN F;  1MJ9 A;  2FU4 A;  1PP8 F;  1HSJ A;  4FX0 A;  4HAM A;  1DPR A;  2STT A;  2KJB A;  4WX9 A;  3I54 A;  4P5O A;  2VBX A;  2YPR A;  4MEY F;  2XRO A;  1R1V A;  4PCQ A;  5CYV A;  5ERI A;  2OD5 A;  4D0P A;  2EFW A;  4WWC A;  3F8F A;  4JBA A;  1MDM B;  3VOD A;  3JW4 A;  5FFX A;  3BOQ A;  3KP3 A;  2DPD A;  4EVI A;  2FQ3 A;  3DQV C;  1HST A;  2A68 F;  2EFO A;  4M9X A;  2CG4 A;  2K4B A;  1B6A A;  3ECO A;  5DUI A;  4HV5 A;  3HRS A;  3KP5 A;  2P7C B;  3HOS A;  2PG4 A;  1O3Q A;  2ZFW A;  2L02 A;  3NEU A;  1GVJ A;  5HOO A;  4FHT A;  2NYX A;  5L3C A;  1R5G A;  3ZPL A;  4G7O F;  6PAX A;  1BI0 A;  1T2K A;  2VC1 A;  1OYY A;  4LK1 F;  1HKS A;  4R79 A;  3TO9 A;  2NNY A;  1IXR C;  4ETS A;  3MEX A;  1OMI A;  5H20 A;  1QBJ A;  1Z1D A;  2G7U A;  1KQ9 A;  4M73 A;  2OBP A;  2EV5 A;  5CJ9 A;  2QQ9 A;  4HOB A;  3DP7 A;  3E5Q A;  4FT8 A;  4HQM A;  2IT0 A;  1TW3 A;  4Z2Y A;  3F6O A;  2ZJ2 A;  5E1Z B;  2MBF A;  4AWX B;  5ED4 A;  3B73 A;  1EH8 A;  2VON A;  4U7B A;  5H6R A;  5L3B A;  1FNN A;  4OIR F;  3K0L A;  3GO5 A;  3K69 A;  4MNU A;  4A0Z A;  1HW5 A;  1S3J A;  2MC3 A;  3M8F A;  4BHP A;  3GFM A;  3I4P A;  3PQK A;  3T8T A;  2JSC A;  3HSR A;  3BPV A;  3O3K A;  1CF7 B;  1UST A;  2CFX A;  3NRV A;  4EM0 B;  1HKT A;  2V1D A;  3LQQ A;  2PJP A;  1P92 A;  5HS8 A;  4OOI A;  3J81 Z;  3LAP A;  2K27 A;  4JQF A;  4MQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...