3BZ6A

Crystal structure of a conserved protein of unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
NAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVMNLTQGQVGQSLRALEGRGLTRLVMGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRMHDFEDSEQVVHQLERLIARGLATLVPRQSGQREDRYMHLIGDPEDLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000.
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
molecule keywords UPF0502 protein PSPTO_2686
total genus 52
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04337 DUF480 Protein of unknown function, DUF480
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bz6A01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bz6A02
2D45A 2FF4A 3J81K 3JAMZ 1I5ZA 3M9AA 1ZAOA 5HLIA 3BWGA 4XLPF 2E1NA 2XV4S 3U9GA 2RDPA 4B09A 1WRJA 5HLGA 4O3MA 2VT2A 3BY6A 3ZN1A 3KZZA 3B73A 3P9KA 1XGOA 2VBWA 3LA7A 1KU2A 1OYWA 2IA1A 4HV5A 4LB5A 3ECHA 4MGRA 1ZARA 3DKWA 4R1HA 4HOBA 1SD4A 2Q2EA 1Z91A 3ZP5A 2A6EF 4NQWA 3ZMZA 4EGZA 3T8RA 2UXNA 2HFHA 1JE8A 1MDMB 2XAFA 3M1EA 3FMSA 3H92A 2FRHA 1HKSA 1Z1DA 3CO6C 3WODF 2EJRA 3PFIA 3TOAA 4E70A 4RGRA 5D5XB 1E2XA 2XKPA 3CO7C 5FD5A 3RI4A 3ZMVA 3K9TA 1KQ8A 4WXHA 2CWEA 2IA0A 2EV5A 5HS9A 1J0RA 5LHHA 3FMQA 2PEXA 4UVCA 4G7OF 2K27A 3I58A 4RAYA 2W24A 1O3QA 2O8XA 5DUIA 4BHCA 1L3LA 1DP7P 2CGPA 4M6YA 4L9VA 2LNBA 4ESFA 1G4DA 4GYIA 3W6JB 2PG4A 1UCRA 4HX7A 4CYDA 2WC2A 1EV7A 2P7CB 5E8GA 3U2RA 1DPUA 3MFKA 2MD5A 1ODDA 2FMLA 4GGGA 4BXUA 3GFIA 5HS7A 3EETA 1TBXA 4IXAA 4QWQA 2ISZA 3J80Z 2MLGA 1AOYA 5AONA 1DDNA 5DCFA 4JBAA 1FSEA 4KN4X 2VN2A 3I59A 1ULYA 3ROUA 1P4AA 3KEOA 1D5VA 5L3GA 2M87A 2EK5A 3NQOA 3SZTA 4KNYA 2XUBA 4I01A 2EWNA 5E20A 3LQQA 3WTXC 4HW0A 1XMKA 5LGTA 1HSJA 1FX7A 4FX0A 1SAXA 1G3SA 5K1YA 4A2UA 2DPDA 1R58A 1ZH5A 3RYPA 3HOTA 5DDGA 4KMFA 4R79A 1TQMA 2DLLA 4K2EA 4WCGA 2EV6A 1BN5A 2V1XA 3VOEA 4CXFA 3OOPA 5D8KB 1LDDA 4Z2YA 3FM5A 3R6SA 1XCBA 1ZRDA 1AWCA 2XVCA 3MWMA 3D0SA 3C18A 1KQ9A 3KLNA 2DT5A 2NNYA 1KQ0A 1BI1A 4OMYA 5FFXA 2JSCA 1MGTA 5F6FA 4LG0B 3FHZA 1GVJA 3FF5A 4U0WA 1SD7A 1SFUA 2DO7A 3QP5A 1U6GA 1UHWA 5LLQA 3J81Z 3KLOA 1S7AA 2QENA 1OYYA 2XAHA 1IN7A 3KZYA 4Y17A 3WGHA 2ZNYA 3MZHA 3KP3A 1XGSA 4A5MA 2A5YB 5ILSA 4JQFA 1U5TA 3CUQC 1FZPB 1ZREA 3E6BA 4RB0A 3M7GA 1OR7A 4A6EA 2GIVA 2QWWA 3FXQA 1W7PB 5H6RA 3H3ZA 1RNLA 1SFXA 1OYIA 3L09A 2VC0A 1HW2A 4KYWA 4A0XA 3IKTA 4XBFA 3K1PA 4HDUA 1O57A 1TTYA 2GAUA 2YR2A 1BM9A 3E5UA 4LK0F 2IRFG 1KGSA 4FX4A 1UHMA 4UV9A 3TOBA 4I2OA 3ZMUA 2HDCA 4EJOA 4P5OA 1YFHA 4EQQA 3BJOA 5FO5A 4G6DA 1J2XA 1LNWA 5ICEA 4WF2A 3BJ6A 2GXBA 3GZ6A 1IRFA 2EFPA 2DPUA 1Z6TA 2J5OA 2HOEA 4OIPF 2BE5F 4MQVA 2NNNA 3RKXA 1J7KA 3KP4A 2PI0A 2XROA 2FU4A 3KEQA 4RGUA 2KIFA 3QRFF 2FQ3A 3QPTA 2P8TA 3ZMTA 2Y48A 3SZPA 3F6OA 4BHBA 4UNOA 3BDDA 1TW2A 2PJPA 1IXSB 3IC7A 1ONVA 1HKQA 3ZN0A 4EM2A 2RKHA 1XDSA 5D8LB 5LEKA 4Q4ZF 4U7BA 4S05A 1FBQA 4NHJA 1EH6A 5LRRA 4AIHA 1T98A 3KCCA 4CGZA 2F5CA 4KDPA 3TDZC 4G9YA 3V7SA 3VEPA 3WTWC 3K0LA 1T2KA 4OMZA 1J5YA 4IHSA 4XSZF 4L9NA 3GUDA 4A12A 1ZG5A 2VT3A 2XAGA 2P7VB 2VE8A 2C6YA 1PUEE 3KP5A 3E6DA 2ZCWA 1R7JA 1V3FA 3FXUA 3IKVA 1I27A 5E18F 4OIQF 1BJAA 1MKMA 1HSTA 2KRFA 1OKRA 1RUOA 1HKTA 4MTEA 2HKOA 4U0YA 3GF2A 1U3EM 2XGXA 2K02A 2IW5A 3C7JA 2CSOA 1JHFA 2IVMA 3TO7A 4P9UA 2Q0OA 5H20A 5J8FA 3QU3A 1XMAA 3V8JA 3K2ZA 3JTHA 3VODA 3HRUA 3W6KB 3ML6A 5HDNA 1FC3A 2FNPA 2QQAA 2VBYA 3DEUA 1YW8A 4ZH4F 1RUNA 1O7LA 2V1UA 4IF4A 2XIGA 5FGMA 1TW3A 5FLXZ 4G7ZF 2JTVA 4LB6B 3M8FA 3F8FA 4N9IA 2O61A 5CVVA 2H09A 5HDKA 3KE2A 4IRIA 2Z99A 4DQ2A 5HS8A 1LVAA 5ED4A 5BOXA 1JGSA 4Y15A 3V8LA 1GXPA 3TGNA 1K79A 2QQBA 2M30A 1P2FA 4G7HF 3C3WA 1F9NA 3KP2A 2CO5A 4BQAA 4M6XA 1U2WA 5L3EA 3ISPA 5DCMA 4Q47A 2R7FA 4OOIA 2BBYA 1XSXA 4WX9A 4U88A 1YW9A 5IT9K 5CVJA 4FT8A 1F4KA 2K7LA 3F21A 2NRAC 3EQLF 4PCQA 4ENMA 5CVUA 5H6QA 3BPVA 3M8EA 2HQNA 1FWZA 4YFNF 1LEAA 3D5LA 3F6VA 4ENNA 2EFNA 4HZFA 3WGGA 5CVIA 3IWZA 1FYLA 2F5DA 2GXGA 3F8MA 3ULQB 3R61A 1BC7C 1B4AA 1ZRFA 1FY7A 1Z9CA 3GFLA 1O3RA 3E5XA 3O2PE 2EA2A 4ZYDA 3J7AO 1QNTA 4CHUA 4Q5SF 5D6EA 2NYXA 1K7AA 5FLXK 1ZLKA 1I6XA 4GCVA 1IW7F 3EUHA 4IRGA 1G6NA 3T8TA 1ON2A 2JPBA 4RGSA 5D5UB 2W84A 2A61A 2F2EA 3E5QA 2D1VA 3TO9A 2QBYA 1TLHB 2COMA 4MQ9F 2A68F 2HTSA 3RPQA 4P96A 3WU0A 5J8CA 3ABTA 1XD7A 1QZZA 1SMYF 5K5RA 3E6MA 1PP7U 3WE3A 3RKYA 3F23A 2M1BA 4YIIA 5TRDA 1YO5C 3MEXA 3I4PA 1YLFA 3QU6A 2LDUA 1QO0D 2HR3A 2X0LA 3ZQ7A 3HIFA 3WTYC 3L7WA 4GYGA 5BPIA 3T5XA 3TO6A 2HKXA 4HX4A 2E7XA 1PDNC 2B0LA 4HQEA 2HWVA 4EJUA 3CTAA 1IUYA 3GX4X 1B9NA 5E1XA 1LDKB 2QYOA 2YPRA 4KIGA 2YU3A 1MJBA 3FX3A 2FMYA 4N0BA 2HYFA 4G94A 1T38A 4H0EA 3COAC 3E3VA 1IAWA 1RIOH 1QQIA 4BAYA 4LG0A 2A07F 1R1UA 1D8JA 4CZZA 2YSRA 1U8RA 3V8KA 3V4GA 5LBQA 3J80K 4YIFA 3NEUA 2M5WA 2KJCA 4RAZA 1HBXG 2CG4A 2OA4A 2PN6A 2DQLA 4EVIA 2F5EA 3U1DA 5DD8A 2LF7A 2G9WA 1FLIA 2MC3A 3Q9SA 1J59A 2FA5A 2HS5A 3G3ZA 4WWCA 2Y75A 4ZYGA 3V7CA 3LA2A 4BHPA 1P4XA 1KU7A 1REPC 2JPCA 4HLXA 3V7RA 1K6OA 4KT5C 2JRTA 3WE2A 4ZZDA 1R5HA 3BZ6A 4KIFA 3IRQA 2RN7A 3HUGA 5AIQA 4L18B 1TQIA 5ILVA 4S04A 4IPAA 1CF7A 3K1NA 3R0JA 1UB9A 1I1SA 1XCVA 1FSHA 1K78A 4LLLA 4I09A 2ZXJA 1L0OC 1KYWA 4U0VA 4KIBA 2ZKZA 4A5NA 3KP7A 1XGMA 2H94A 1J75A 5KK1A 3GXOA 3TDUC 2AS5F 3I53A 4XSXF 1WSUA 1R1VA 1EH8A 1P6RA 1FYKA 2XASA 3K1MA 1LEBA 4I02A 4HF2A 1BIAA 3SFZA 2H27A 2FNAA 6PAXA 1F1ZA 1B9MA 3LQRA 3LWFA 5LHIA 2UWMA 4FHTA 3HSRA 1K78B 2KIMA 3WU1B 4L9TA 5HLHA 2DI3A 5JI6A 2H6BA 3GLXA 5E1ZB 2EFOA 5D5WB 2QLZA 1OPCA 3DFGA 2BYVE 5CYVA 4MNUA 4YG2F 2TDXA 5EEGA 4YFKF 2P5KA 2Z33A 2DK8A 2M8EA 3L2CA 2IPQX 4HBLA 4KFCA 4G8XA 1O7FA 4R8HA 3TQNA 4U7DA 2QBYB 3REOA 3SQNA 4RGXA 1IN8A 2V9VA 1U5TB 2L01A 4EJTA 2WV0A 1SMTA 1A04A 2P5LC 3P9IA 3NRVA 2ZBKA 1S3JA 3L9FA 4ENJA 4P55A 2WTEA 1HW1A 2K4BA 3RIRA 4UV8A 1W5SA 1YS7A 4RB2C 3IRRA 2DAOA 2ETHA 3N97A 1USSA 2O0YA 5DUKA 5LGNA 4L5IA 5ERIA 5D6FA 3MCZA 2DU9A 2ZO4A 2BEOA 1RI7A 3PQJA 1FPQA 4OIRF 3LAPA 2DFIA 3DV8A 2AXLA 2MBFA 2V1DA 4GO1A 5JR3A 3LFKA 3I59B 4LD5A 2QVOA 4HF0A 1P92A 2VONA 1D3YA 4CICA 5K5OA 1SD5A 2Q8KA 4MHGA 5CVRA 2VC1A 1BOAA 2E7WA 2VBZA 3L00A 2A69F 2R7DA 1YW7A 4KICA 3DP7A 3WG9A 3T0YA 2V79A 2OZUA 4PGGA 3E6CC 1NHAA 3HTSB 2XKOA 5D5VB 2GWRA 1C0WA 2EV0A 2J5PA 2PQ8A 2LSOA 2ZFWA 3I71A 2FOKA 2DW4A 3HRSA 5E8IA 4DNCA 1QZYA 1GHCA 2O3FA 2ADUA 5A2QZ 1Y0UA 3ELKA 2EB7A 1WQ2A 3F3XA 3HRTA 1XSVA 1R00A 1IN4A 3FWEA 4KMUX 1F5TA 1SFEA 4IRHA 2RQPA 1QGPA 1ZG1A 1W7PD 2CW0F 5BPDA 1FOKA 1QBJA 2MH9A 1KU9A 1ZLJA 1ZYRF 1W4MA 2VXZA 1LDJA 1IZ1A 3JSOA 4UVBA 2PMUA 2O03A 2V6CA 1X3UA 3N4MA 3RPUA 1SD6A 1R5GA 1MJ9A 4L5JA 1D8KA 1Z6RA 3GFMA 3WTVC 1ZGAA 2OZ6A 1R22A 3JW4A 3I5UA 2DTRA 5L3DA 2UZKA 2L3DA 4PDKA 3RKWA 2QZ8A 4LMYA 3S2WA 2OQGA 1G3YA 3GFJA 3GYHX 5ICCA 4LGWA 5LHGA 1HXDA 3GWZA 1ZHFA 3RYRA 3MZYA 1U78A 1KU3A 4BYYA 1T0FA 2L02A 3DF8A 5E17F 1YS6A 4EM0B 1Q1HA 3WTZA 2VBXA 3KP6A 1B1BA 1H9GA 4N9HA 1EH7A 1T39A 1FP2A 3QOPA 2DBBA 2FE3A 2FBIA 4IHTA 4MTDA 3R0AA 4HQMA 1MD0A 4BH9A 1FP1D 3MAJA 3JAMK 4AIKA 4JK1X 2F5FA 1R23A 1ZN2A 5F1RA 4I0BA 2W85A 2Z9OA 1CGPA 4RS8A 3GO5A 4Y13A 1H0MA 1DUXC 1XGNA 3OV8A 1MZBA 3JSPA 2MH2A 3DPTA 1BI3A 3I54A 1H9TA 5DD4A 2P4WA 3ZMSA 3R60A 3I64A 5HDGA 3K69A 4ETSA 4WXDA 4OINF 1JXSA 5BS6A 1J9IA 4WXCA 2WWYA 2OD5A 5L3CA 1MJAA 3MQ0A 4AIJA 4XLNF 5LRSA 1YTYA 2KJBA 2YX7A 4EM1A 1BC8C 1S7OA 3HSEA 2DQRA 1BBYA 1LB2A 1LQ1A 5BMZA 2EA4A 1KA8A 3FM3A 5CLSA 1FYMA 4HF1A 1HW5A 2IP2A 3TKYA 1WI9A 4TV7A 4ENKA 3IWFA 4M71A 1XN7A 4NB5A 4OU0A 2OQRA 4ASNA 2IT0A 1DPRA 3WGIA 4A6DA 1TNTA 5D4RA 4LLNA 2PBIA 2HZTA 1FT9A 1S29A 2ZMEA 3HHHA 3LA3A 4HDVA 1KYZA 1I1GA 4GXOA 2FXAA 3GEZA 1B59A 3QPHA 2BV6A 3KFWX 2CQKA 4EV0A 4D0PA 3Q5FA 1PP8F 5DYMA 2EFWA 5JVTA 1IXRC 3PQKA 2PMHA 3ERED 2PFBA 1BI0A 3CJNA 5LEJA 4ESJA 4CDGA 2K86A 4PZJA 2QUFA 4KN7X 5IT3A 3F72A 3BOQA 2GA1A 5F64A 3Q9VA 2X4HA 3C1DA 4A0ZA 4PGHA 5AIPA 3BROA 5J6XA 4L0YB 3WTSC 2Z3YA 2ZNZA 2RC4A 4HLYA 2ISYA 2HYGD 2QQ9A 2D2WA 4EGYA 1STZA 3LAJA 5CJ9A 5L3BA 3WTTC 3P9CA 3RTRA 1FBSA 2YX4A 5DEQA 1VTNC 3EYYA 3ZMDA 2G7HA 2IJLA 4M74A 2Z5UA 3ECOA 4UXNA 4AWXB 4UHTA 3T1BA 1YYVA 1IF1A 2NAZA 5K5QA 5TJJA 4ZYHA 1IRGA 3FMRA 3B02A 2OU2A 1USTA 5A2QK 2ACJA 1RZ4A 1P4WA 2R3SA 4LK1F 3SHFA 4IJAA 5EEHA 5KVRA 4P9FA 1ZRCA 5FD6A 4M72A 4IVNA 1YQAA 3F22A 2VE9A 2MA3A 4RB3C 1BI2A 3GZ5A 2STTA 4QLCU 2E1CA 2EFQA 3P7NA 1U5TC 4OIOF 3CUQA 4HA8A 2P5VA 3O3KA 1WKMA 1TNSA 5ICGA 5ILUA 2XRNA 2OAZA 2LKPA 2RV8A 2QM3A 3EDPA 4BNCA 1YIOA 3CDHA 1R36A 2CFXA 4I7HA 3F8BA 2ZJ2A 1R1TA 5JHUA 1ZG3A 4LLGF 2JZYA 4AD9A 4ON0A 3QAHA 1B6AA 3BPXA 4I0AA 4HYEA 4EMSA 3BJAA 1W7PA 5LGUA 4WK8F 2VOPA 4MEXF 3GVAA 5DV5A 3R4KA 5FFZA 2L4AA 4L9JA 1BIBA 2A6HF 2BGCA 4AVPA 2L4MA 3ABUA 4A0YA 2L54A 1ZGJA 2KIUA 2ZMEB 2K4JA 1E17A 2Y0MA 1XB4A 1JHHA 2FBKA 3VFZA 3FZVA 2PLYA 4RB1A 4EJWA 3DQVC 4ZZLA 3F8CA 1FBUA 2HQRA 1IN6A 2VODA 3I0TA 2O6GE 3AAFA 1GXQA 3KETA 3E97A 1MDMA 1YG2A 5IT9Z 1XSDA 2FBHA 2KKOA 4F7ZA 2GQQA 2A3SA 3O6BB 4MEYF 1S6LA 3HHGA 1V4RA 2IA2A 2HEOA 2RGVA 1ON1A 2RVCA 4HAMA 3LSTA 3BP8A 1S8NA 4L0ZB 3FXRA 5FB2A 3CUQB 4UVAA 3QP6A 1CF7B 2W25A 4XRFA 2H6CA 2FEZA 3DXJF 2OBPA 1G3TA 3G73A 1TQPA 2ESHA 3VB2A 2CYYA 1Z05A 2VOOA 1WWXA 1O3SA 4KUMA 2STWA 4YFXF 5JFRA 3IL2A 1QPMA 1IN5A 4HV6A 3HTUA 1FNNA 3SXYA 2JT1A 3HSFA 4HX8A 2GZWA 1T6SA 2MLKA 4ESBA 1W5TA 4Q48A 3IHUA 3GW2A 4KA4A 2D1HA 1Z7UA 1OMIA 4O6JA 2XAJA 3CUOA 2HGCA 2M45A 1G3WA 3WTUC 3ZPLA 2ELHA 4LJZF 3RJPA 1HQCA 2HTJA 5D4SA 4M9SA 2RNJA 2ESNA 2NS0A 5HVQC 2GA2A 4G6QA 1XDUA 2XAQA 4M9ZA 3RDIA 4EJVA 5HOOA 3EYIA 5L3FA 3H3UA 3CLOA 3DPLC 4I98B 2XHKA 4M9XA 5E1WA 2P6SA 3HOSA 2G7UA 4UUVA 2UXXA 3JTGA 2W57A 4ZYEA 4LFUA 4M73A 1O3TA 2LF8A 3F8NA 4B8XA 3HYIA 2FSWA 2DK5A 2P6TA 1UFMA 5BQTA 3HRMA 5DCMB 4CO8A 1LJ9A 4O5VA 5ICFA 1IXCA
chains in the Genus database with same CATH superfamily
5FKNA 2OV7A 2D45A 1YJWI 2FF4A 3J81K 3M07A 4NQWB 3JAMZ 2L0KA 5HNFA 4FISA 1I5ZA 3M9AA 2Y9ZA 1H89C 1ZAOA 3OY9A 5EZGA 5HLIA 4XICA 3BWGA 4HSTA 3KPHA 4XLPF 2V1NA 1Z0XA 2E1NA 2XV4S 3PM1A 3U9GA 1T8IA 4RAFA 3F9KA 4PSWA 1D5YA 2RDPA 2XGDA 1WRJA 4B09A 2NVQJ 2X51A 5HLGA 4O3MA 1LVKA 2LVSA 2VT2A 5B1BH 3BY6A 3ZN1A 3KZZA 3BR2A 3B73A 3P9KA 1XGOA 1AU7A 1I50J 2WA0A 2VBWA 3LA7A 1KU2A 2VJIA 1OYWA 2IA1A 2HDWA 4HV5A 4PFOA 5TISC 1FMVA 1AA7A 4F3QA 4LB5A 1EF4A 4YRVA 2JMWA 1LPQA 3ECHA 4MGRA 2CS3A 4A3LJ 1ZARA 3DKWA 4HOBA 4R1HA 2Y30A 1SD4A 2Q2EA 3FXKA 1Y1WJ 1Z91A 2HZDA 2LBFB 3ZP5A 2DJIA 3DWLE 1ZTRA 2ECBA 2A05A 5GADJ 2A6EF 3CJQB 4NQWA 4XLHA 1S72I 3ZMZA 4EGZA 3T8RA 2LFBA 2UXNA 1N77A 4A3GJ 2FQ4A 1B8IA 2HFHA 1JE8A 1S5LC 1XTAA 1MDMB 5EF6A 2CQ7A 2XAFA 2V6EA 3M1EA 3FMSA 4UUTA 3H92A 2KMUA 5HLTA 2FRHA 3JRFA 3ZGKA 1HKSA 3RQIA 3QODA 1WJBA 1Z1DA 3CO6C 3WODF 2EJRA 2PJRB 3PFIA 3TOAA 4E70A 3PFYA 4RGRA 5H2FC 2XF7A 5D5XB 1E2XA 2XKPA 3CO7C 2KDOA 5FD5A 3RI4A 2HPMA 3ZMVA 3JREA 3K9TA 5EG0B 1KQ8A 1R4MB 4WXHA 2ID3A 3BZKA 2CWEA 1JT0A 3K70D 1JKOC 4HRIA 1XG1A 4I76A 2IA0A 2EV5A 4A3EJ 5HS9A 2X1DA 1WFXA 1J0RA 2DOFA 5LHHA 3BR0A 2PEXA 2RNGA 3FMQA 2YS9A 3HKZA 4UVCA 5GP9A 4G7OF 2K27A 3I58A 1BL0A 3B6AA 3RQ4A 4DBRA 4RAYA 3WU2C 1PJRA 2W24A 1O3QA 3NWSA 1KZHA 2O8XA 5DUIA 4BHCA 1L3LA 1JJ8C 4B43A 1DP7P 1WJ5A 3O8GA 2CGPA 4M6YA 4L9VA 2LNBA 3EPZA 4ESFA 3PIPF 1G4DA 1N75A 4BGDA 4GYIA 3W6JB 2ICWG 2PG4A 3BG3A 1EKEA 1UCRA 2VQGA 2E36A 4HX7A 1MNEA 3K70C 1PUFA 4CYDA 2V9KA 2WC2A 1EV7A 2P7CB 3L2WA 5E8GA 2D5VA 3U2RA 1DPUA 3MFKA 2MD5A 5GAEJ 2KHMA 1ODDA 2FMLA 2WB1A 2LY1A 5M5XJ 3TEDA 5LD2C 4GGGA 2UV1A 1JKRC 4BXUA 3JRGA 3GFIA 1A6QA 2F48A 3EETA 1TBXA 5HS7A 2XF6A 4IXAA 4CUGA 4BE2A 4QWQA 2ISZA 3J80Z 3I3LA 2MLGA 1AOYA 5AONA 1R6RA 1DDNA 3H5NA 1SC7A 5DCFA 3SFIA 4JBAA 1FSEA 4KN4X 3DLLF 3QYBA 2VN2A 2BHZA 3I59A 2GOMA 3K4BA 2ZMEC 1ULYA 3ROUA 1YHQI 4B3XA 1RESA 1P4AA 3H9JA 3KEOA 1E3PA 1D5VA 5L3GA 1QPIA 2NVXJ 3Q0VA 2M87A 3ONQA 3L2QA 5EYRA 3S2DJ 4BDZA 2P81A 2EK5A 3NQOA 4XRMA 1TWFJ 3H9QA 2OJED 3SZTA 4KNYA 2ID6A 5E3NA 2XUBA 4PJLA 4I01A 1MNMC 1I3QJ 3HOVJ 4C30A 3PSFA 2EWNA 3M3YJ 5E20A 3KEYA 3LQQA 3WTXC 4HW0A 3ZCOA 1XMKA 5LGTA 3I56I 2H8RA 1HSJA 2Y9YA 2DA5A 1FX7A 1TWHJ 4FX0A 1SAXA 1G3SA 5K1YA 2CRGA 1YIJI 4A2UA 1AKHA 2DPDA 1R58A 1ZH5A 2NVTJ 3RYPA 3HOTA 4ZC3A 4IHYA 5DDGA 4KMFA 4BJ6C 2AO9A 4R79A 1A31A 4UB8C 5F0FA 1TQMA 4XKBA 4AIDA 1R49A 1DU6A 5FRMA 2DLLA 4BKXA 3JRIA 1UMQA 4K2EA 4DZJA 3BR5A 3AG2H 4WCGA 3QQAA 4DW6A 1MW7A 2EV6A 1BN5A 2FX0A 2V1XA 4W97A 2E1MC 2W82A 5J40A 1ZGWA 3VOEA 4CXFA 1DU0A 3Q3SA 3DEEA 3OOPA 5D8KB 3ZQLA 1HDPA 3LSGA 5IOYA 3OYEA 5JVGF 1LDDA 4CSWA 1RC9A 4Z2YA 1IC8A 2JA8J 3FM5A 2QGUA 3R6SA 4E7IA 1XCBA 3CDIA 4RLFA 4ITVA 4BQNA 4N4NB 1VFCA 1JKQC 4FQGA 1ZRDA 2V26A 4BUPA 1AWCA 1YJ9I 4H4KC 3S3OA 2XVCA 3MWMA 3D0SA 2MGQA 3PL8A 3C18A 2NS8A 2DA6A 1V55H 1W0TA 3K7AJ 1KQ9A 3ZQGA 3KLNA 2DT5A 2NNYA 2HPIA 1KQ0A 1BI1A 1B8IB 4OMYA 5FFXA 2JSCA 2Q1ZB 3ZOBA 1MGTA 1T56A 2WBMA 5F6FA 4LG0B 3FHZA 2DFHA 3OYDA 2DTZA 1GVJA 2ELJA 2KRHA 3ASOH 3FF5A 3QPLA 5GTIC 4U0WA 1SD7A 1SFUA 2DO7A 3QP5A 3S16J 1X19A 3U21A 1X3ZB 3PUFA 1U6GA 3AG4H 1UHWA 2LYCA 5LLQA 3J81Z 2QA4I 3KLOA 3LL7A 2CV2A 1S7AA 2QENA 1MIJA 1OYYA 1OFCX 2XAHA 1IN7A 3KZYA 3GTOJ 4B3AA 4C3HJ 4C2TA 2K5CA 4Y17A 2DA4A 3WGHA 5HNHA 4A3CJ 2ZNYA 3MZHA 3KP3A 1GV2A 1XGSA 4A5MA 5EDNA 2A5YB 5ILSA 3OR2C 4JQFA 1JTXA 1U5TA 2Y0SA 3WHCA 1O4XA 3CUQC 4E7HA 1W0UA 2E5NA 1FZPB 1ZREA 3E6BA 3V42A 4RB0A 4C2MJ 1MMDA 2DYSH 2LK2A 4V2FA 4AM3A 3M7GA 1OR7A 4A6EA 2GIVA 2QWWA 4XMYA 3FXQA 4BY7J 1HC8A 3HPHA 1DQUA 2ZJQF 1W7PB 5H6RA 3H3ZA 1RNLA 2BXZA 4DOZA 1KONA 1SFXA 1OYIA 2IEKA 1BOBA 2L5QA 3L09A 2VC0A 1HW2A 4KYWA 2KZVA 3FXMA 4PFPA 3OYJA 4A0XA 1ETQA 4I99C 4XBFA 3K1PA 3IKTA 4YEJA 3S1QJ 4HDUA 4PUSA 1O57A 1TTYA 1XPXA 1FOWA 1YRNB 2GAUA 2YR2A 1BM9A 2DT6A 3E5UA 3GTPJ 4LK0F 2IRFG 4DZPA 3AG1H 1DGWY 1KGSA 1P9QC 3VYRB 4FX4A 1UHMA 4UV9A 3QPSA 3TOBA 2W48A 4I2OA 3ZMUA 2HDDA 2HDCA 4EJOA 2ELKA 4OWRB 4P5OA 1YFHA 4EQQA 3BTCA 3BJOA 5FO5A 4G6DA 1A35A 1J2XA 1LNWA 5ICEA 3BTLA 4WF2A 1Z67A 3BJ6A 2GXBA 3G1OA 3GZ6A 4CZCA 1IRFA 3PO2J 2EFPA 2W7NA 1IRZA 1S7EA 2DPUA 1Z6TA 2J5OA 4W1UA 2HOEA 2F4IA 4OIPF 1T08B 1RRJA 2BE5F 4MQVA 2NNNA 3GMEA 5CQEA 3RKXA 1OCOH 2IBDA 2HYJA 5KHDA 3CCSI 1J7KA 3KP4A 2PI0A 4RM3A 5M5WJ 1DP3A 1ENHA 2JJ7A 1V5FA 2XROA 2FU4A 3KEQA 4RGUA 2KIFA 2I10A 2KLOA 3QRFF 2XDVA 2FQ3A 3QPTA 2VQCA 4Y52J 3PO3J 2P8TA 3ZMTA 2Y48A 4B47A 2DA2A 3SZPA 3F6OA 4BHBA 4UNOA 3SEZA 3AL0B 3E1SA 2QSHX 3BDDA 4PJNA 2QQ8A 1TW2A 2PJPA 2LLKA 1IXSB 2NOJB 3IC7A 1LFPA 1ONVA 1LKXA 1HKQA 3ZN0A 1A5JA 4EM2A 2RKHA 1XDSA 3HL2A 1VQNI 4MFDA 1X4OA 5D8LB 5LEKA 2NVYJ 3NWTA 2MABA 4Q4ZF 3CC4I 3X2QH 4U7BA 4S05A 4FTHA 1FBQA 1UAAA 3OYKA 4NHJA 1WH7A 1EH6A 3QWLA 5KAIC 2DMUA 3MVPA 4M3GA 4XL9A 2HOSA 5LRRA 4AIHA 3W3CA 3DLAA 1T98A 3ZQIA 1OR7C 3KCCA 4CGZA 1SEUA 2F5CA 4KDPA 3OIOA 3TDZC 3H5RA 4G9YA 1GT0C 3V7SA 3VEPA 3WTWC 2E5ZA 3K0LA 1T2KA 3PUBA 4OMZA 1RR8C 1J5YA 2R92J 1G8XA 4IHSA 2VKDA 4XSZF 3C2BA 4L9NA 3GUDA 5J4VA 4A12A 3OS0A 1ZG5A 2VT3A 2XAGA 1JUMA 2CUZA 3A02A 5JLXA 2P7VB 2VE8A 5KNLA 3J7AY 3LNQA 3BTJA 2LP0A 4JX5A 2C6YA 1UHSA 3KP5A 3E6DA 2ZCWA 1PUEE 1VI0A 4A3FJ 2AHQA 3P5JA 1R7JA 1V3FA 3FXUA 3IKVA 5LFAA 2HU9A 1QHGA 2ECCA 3WHBA 3DKXA 1I27A 5E18F 4OIQF 1BJAA 4D7NA 1MKMA 1HSTA 2E1MB 3FKJA 2KRFA 1OKRA 1RUOA 9ANTA 2CUEA 1HKTA 3VPRA 4MTEA 1SFOJ 4BXXJ 2HKOA 4U0YA 3GF2A 1U3EM 2XGXA 2CQNA 2K02A 2ZSIB 2IW5A 4XNFA 5DM6F 3C7JA 2CSOA 1JHFA 2DODA 1JUPA 1D0YA 1VNDA 2IVMA 2RREA 3TO7A 4D1QA 4P9UA 2GM4A 2Q0OA 3H36A 5H20A 5GPAA 5J8FA 3QU3A 3ZQFA 4XKCA 1BA5A 1XMAA 3V8JA 4I6ZA 3K2ZA 4E7JA 3JTHA 1VQLI 3VODA 3HOUJ 1LFBA 3HRUA 4OAYA 3W6KB 3ML6A 5HDNA 4BY1J 1FC3A 2JUCA 4HG2A 4XM3A 2FNPA 3GTQJ 2QQAA 2K85A 2VBYA 3DEUA 1YW8A 4ZH4F 1VZ0A 2M7BA 3BR1A 2LMDA 4ABZA 2X6OA 1RUNA 1O7LA 4HNTA 3MD2A 2XF5A 3FXLA 4IF4A 2V1UA 2XIGA 3Q0WA 5FGMA 1TW3A 4AUXA 5FLXZ 4G7ZF 2JTVA 2RAEA 4LB6B 1MSEC 3M8FA 2VJJA 3F8FA 4N9IA 1F36A 5K7FA 2O61A 5CVVA 3LOCA 4XLCA 2H09A 3HM5A 5HDKA 3KE2A 4IRIA 1IGNA 2Z99A 4DQ2A 1ERDA 5HS8A 1LVAA 3S1MJ 1TT5B 3F0CA 4Z6YA 5ED4A 5BOXA 1JGSA 3LSJA 4Y15A 1V54H 3V8LA 1GXPA 2KQRA 1A36A 1IDZA 2OUMA 2NXNB 2VXDA 1EJ9A 2KZGA 2BY2A 3TGNA 3SJMA 2GBYA 3BCBA 1K79A 2QQBA 2DA7A 2M30A 4XN3A 1P2FA 2DA1A 4G7HF 3C3WA 2P0WA 1F9NA 3KP2A 2CO5A 2O5RA 4Y33A 2WAQN 4BQAA 2HI3A 3FK6A 3S2HJ 4M6XA 1U2WA 1AHDP 5L3EA 3ISPA 5DCMA 1HDDC 4Q47A 1FTZA 1Y8QB 2R7FA 4OOIA 1EA3A 1X58A 2BBYA 3CLQA 2R7TA 4BACA 5FLMJ 1XSXA 2MG4A 4WX9A 2DOAA 2VUMJ 2JVHA 3ABKH 4NC8A 1YW9A 4U88A 5CVJA 3CMAI 4FT8A 5IT9K 1F4KA 1IUFA 2K7LA 3F21A 5J3LA 3HOWJ 3LSRA 2NRAC 2ME6A 5IP9J 2R7VA 4YELA 2QSFX 3EQLF 1Y56A 4PCQA 1PYVA 2YUSA 5CVUA 4ENMA 2X85A 3OYAA 1VQKI 2Y0SN 5H6QA 2Z2SB 3BPVA 2PJRA 3M8EA 2HQNA 3OOUA 5BNGA 2R7RA 1FWZA 1OCPA 5EJCA 1LEAA 4YFNF 1OCCH 4F92B 3D5LA 3GLLA 3F6VA 4ENNA 2EFNA 3FHNA 2L9RA 2E60A 4HZFA 3A1YA 3QYFA 2F4MB 3WGGA 1MH3A 5CVIA 1GUUA 3A4CA 3IWZA 5K7HA 4B48A 1OQYA 1FYLA 2F5DA 2GXGA 3F8MA 3ULQB 1JJ6C 3R61A 1E3HA 5IYCJ 1BC7C 3O8HA 1B4AA 1ZRFA 2KT0A 1ETKA 2QEXI 2R7QA 1FY7A 1Z9CA 3GFLA 3K4KA 2LBFA 3E5XA 3O2PE 5M3FJ 1O3RA 1VQ8I 1M1EB 2EA2A 4ZYDA 3J7AO 4DYQA 2XPUA 2OC6A 1WGXA 1QNTA 3BT9A 2HVRA 4LIVA 1VF9A 5D6EA 4CHUA 3CD6I 4LITA 2NYXA 2ZFUA 4Q5SF 1WJDA 1K7AA 4JX4A 5FLXK 1ZLKA 1I6XA 4GCVA 1K4SA 1MBJA 1IW7F 2DN0A 3OIQA 3EUHA 4DIQA 2WY8Q 3SYTA 2FJ1A 1X1BA 4IRGA 1G6NA 3T8TA 1ON2A 1K61A 2JPBA 3RKQA 5C4JJ 2G0EA 3L1PA 4RGSA 3GBGA 2W84A 5D5UB 4OAZA 1Q1VA 3FXJA 3ZXSA 2A61A 2QKLB 1QRYA 2F2EA 3E5QA 1OJLA 3N05A 3CJRB 2D1VA 3TO9A 5M3MJ 1D1CA 4PJJA 4FCYA 2VLAA 1R4NB 4N4OB 3JRAA 1TLHB 2QBYA 2COMA 4MQ9F 1UJ8A 2A68F 3ZQCA 2HTSA 4A3DJ 3RPQA 3H9GA 3BG7A 4P96A 3WU0A 3DBRB 3G71I 3DCFA 4E7ZA 3RCOA 3TBIA 5J8CA 3H0DA 3ABTA 1XD7A 2CV1A 1QZZA 1D1BA 4JYKA 5FJ8J 1SMYF 1ZELA 5K5RA 3E6MA 1PP7U 4BQOA 2H1KA 3PNTA 3WE3A 3RKYA 3F23A 1X2MA 3MZ8A 2M1BA 4YIIA 5TRDA 3MKLA 1YO5C 3MEXA 3I4PA 4BQQA 3I4MJ 3VDXA 1YLFA 4IL6C 3QU6A 1SFKA 2WB1N 2BW3B 1WJEA 2LDUA 1QO0D 2HR3A 2JA7J 2X0LA 3CMMA 3ZQ7A 3HIFA 4BS9A 3WTYC 2Y31A 3L7WA 4GYGA 5BPIA 4RMNA 3T5XA 3TO6A 1QHHD 2HKXA 1UELB 4HX4A 1Z77A 2E7XA 1PDNC 1R5ID 2B0LA 2BHYA 1BR4A 4HQEA 2HWVA 3UNGC 4EJUA 2X1CA 3CTAA 1IUYA 3ZRGA 1G59A 3GX4X 3S15J 1B9NA 3DBHB 3BG9A 5E1XA 1LDKB 2QYOA 3W6VA 2M0MA 2YPRA 4CCOA 3IH2A 4KIGA 3CCUI 2YU3A 5B1AH 2VQLA 4XONA 1MJBA 3FX3A 2QKMB 2FMYA 4N0BA 2HYFA 1A6IA 4G94A 2NVUB 1T38A 4CYCB 1Z3XA 2VIXA 4IX7A 5GAGJ 2LH9A 2K3FA 4H0EA 3COAC 3E3VA 1X1PA 1IAWA 1RIOH 1J09A 1QQIA 4BAYA 4LG0A 1IJWC 2A07F 1R1UA 2HQAA 4XLFA 3OYNA 1QA6A 1D8JA 4CZZA 5FRNA 2W1OA 2YSRA 3CDLA 1U8RA 1PUFB 3FBNB 3V8KA 2E2HJ 3V4GA 1Y0NA 5JHFA 3L2RA 4BDYA 5LBQA 2KRCA 3J80K 2DA3A 3S93A 4NDLA 4UUSA 4YIFA 2JA6J 2CUFA 3NEUA 1T0FC 3CMEI 2M5WA 2KJCA 4RAZA 1RKTA 1HBXG 2CG4A 2OA4A 2PN6A 4FETA 2DQLA 2M4KA 4HEA2 4EVIA 2F5EA 2QF7A 3U1DA 3CMYA 5DD8A 3JCUC 2LF7A 5EGOA 2V4JC 3K6GA 4D5CA 5DTDA 1W1WE 2G9WA 1FLIA 4AU7A 4PJ0C 2MC3A 3A01B 3Q9SA 1U0JA 1J59A 2DXIA 2FA5A 2HS5A 3C2GA 3G3ZA 4WWCA 1Z21A 1B72A 2Y75A 3ESWB 2CQXA 1FIPA 4ZJZA 4ZYGA 4BEHB 3V7CA 3LA2A 4BHPA 3KIOA 1P4XA 3ASNH 4QSHA 5GPCA 1KU7A 1REPC 1MMSA 2JPCA 1MBKA 4HLXA 3V7RA 3OS2A 1K6OA 2BW3A 4KT5C 2JRTA 1NG6A 3WE2A 5IYDJ 2VJ4A 4XLEA 1BJZA 5F0CA 3BCAA 1X2NA 4ZZDA 2E1OA 4NBQA 1R5HA 4RAGA 3OS1A 3BZ6A 4KIFA 1JKPC 3IRQA 1VQ4I 2RN7A 5FLVA 3HUGA 5AIQA 4L18B 2KPMA 1VQOI 4RBOA 2ME0A 1TQIA 5ILVA 2MFZA 3FDYA 2K9LA 2M4GA 2JK3A 4S04A 1ETXA 4XOTA 4IPAA 2K9SA 1IV8A 3K1NA 3R0JA 1CF7A 1D1AA 1UB9A 3LFUA 3C2HA 1I1SA 2X9DA 1XCVA 3JRCA 1FSHA 3OYMA 1K78A 4LLLA 4I09A 5J47A 3CCQI 2ZXJA 1L0OC 1KYWA 1W5CC 4U0VA 2XSJC 4KIBA 2ZKZA 3OYHA 4A5NA 3KP7A 2R5ZB 4DBQA 1B72B 1XGMA 4F91B 2BVMA 2H94A 3CCLI 1J75A 5KK1A 3GXOA 3TDUC 2AS5F 3DEWA 4FE4A 2ZSHB 4ZTJA 1TT0A 3I53A 1WJAA 4XSXF 1WSUA 1Y39A 3KX2A 1R1VA 2M8GX 1EH8A 1P6RA 1X1AA 1FYKA 2XASA 3K1MA 3FIWA 1LEBA 3M1CA 2R5YB 3LSPA 4XRSA 4I02A 4UUSB 4PSXA 1TWGJ 4S0HB 4HF2A 4NUBA 3OL4A 4X6AJ 1BIAA 2X6XA 3SFZA 3LSKA 2H27A 2FNAA 4X0GA 2O8KA 6PAXA 1F1ZA 2DMQA 1B9MA 3LQRA 2B7EA 3LWFA 2LKSA 5LHIA 1YJNI 2DFFA 3IAM2 1ZR2A 2UWMA 2K40A 4FHTA 3HSRA 2H8WA 1ORKA 1K78B 2WV1A 3G2BA 1P7IA 2DCEA 4PK4A 2KIMA 4A93J 3WU1B 4L9TA 5HLHA 2XPVA 3JRHA 3E7LA 2DI3A 2W4SA 3HXLA 5JI6A 2H6BA 3GLXA 5E1ZB 4ZDOA 2EFOA 2FD5A 5D5WB 2QLZA 1OPCA 3DFGA 2BYVE 3ZQQA 5CYVA 5CKTA 4MNUA 1FEXA 4YG2F 2TDXA 5EEGA 4YFKF 2P5KA 2Z33A 1TC3C 5B3SH 2DK8A 2M8EA 3L2CA 3HUGB 1WHUA 2WAQA 4AYBA 5IPAA 2IPQX 3Q0UA 4HBLA 4KFCA 4D7MA 4G8XA 1O7FA 3A03A 5E3LA 3K4MA 3DU5A 3D1NI 4R8HA 3TQNA 2F4OB 3HJEA 2OF7A 4U7DA 2QBYB 2LTPA 3HOXJ 1LE8A 3TP0A 2O7OA 3G4SI 3REOA 2XGEA 4CCKA 4ZTFA 3SQNA 4RGXA 3CCEI 1IN8A 2V9VA 1U5TB 1E0EA 5HODA 2L01A 4EJTA 2WV0A 1SMTA 1A04A 2P5LC 3HC7A 1FTTA 3P9IA 3NRVA 2ZBKA 4IEJA 4HSRA 3TL4X 1S3JA 3DKYA 1ACIA 3L9FA 4ENJA 4P55A 2WTEA 3LSMA 1HW1A 1YX5A 2K4BA 4M6VA 3RIRA 4UV8A 3JR9A 2WY7Q 1W5SA 2VKVA 5M5YJ 2GIZA 3QOEA 3IV5A 2K9MA 3H5AA 1YS7A 1MBHA 2IGKA 2ZXHA 1E3OC 1RKWA 3BZCA 4ANJA 4RB2C 4PJMA 3HKZN 3IRRA 3HPGA 2DAOA 2ETHA 1USSA 2O0YA 5DUKA 3N97A 4F52A 2JA5J 5LGNA 1XMXA 4L5IA 5ERIA 5D6FA 2R0QC 1HLVA 3MCZA 1SANA 1WI3A 2DU9A 1RETA 2ZO4A 2BEOA 1RI7A 3PQJA 1FPQA 5IOZA 2QSGX 4OIRF 3LAPA 2DFIA 1Y1VJ 3DV8A 4CCMA 1MMGA 2E71A 2KISA 5GAHJ 2AXLA 2MBFA 2V1DA 3PNVA 2MC4A 2AQFA 4GO1A 4RDUA 4A3KJ 4M3DA 5JR3A 4CCLA 3HOZJ 1IRXA 3A0BC 3LFKA 3OIPA 3I59B 2M34A 4LD5A 2QVOA 2EIKH 1X3WB 1F43A 1SVOA 2A5WA 2OPTA 4HF0A 4NC7A 4BXFA 1P92A 4XK4A 2VONA 1D3YA 3HGGA 4CICA 2M9HA 5K5OA 1SD5A 2Q8KA 4MHGA 4DJAA 3TMOA 2HOTA 2LKXA 3CF5F 5CVRA 1SAUA 2VC1A 1YE9A 2DDBA 1BOAA 1JGGA 1RR7A 2E7WA 2GLOA 1JUSA 2MD0A 3GTLJ 2Y2ZA 2VBZA 3MN2A 2LRDA 3L00A 2A69F 2R7DA 1YW7A 4KICA 3DP7A 3WG9A 1MMNA 3T0YA 2V79A 2OZUA 2B9SA 3CP2A 2CQQA 2KP6A 4PGGA 3E6CC 1G2HA 2DMNA 1NHAA 2K9NA 2ZC2A 2R7UA 3HTSB 3HG9A 3DTKA 2XKOA 5D5VB 2GWRA 2JRMA 1C0WA 2EV0A 1H8AC 3S14J 3KYLA 2J5PA 2PQ8A 2LSOA 2ZFWA 3I71A 5FKKA 2FOKA 4V19K 2DW4A 3HRSA 3WG7H 5E8IA 4DNCA 1QZYA 3GTKJ 1GHCA 2O3FA 2ADUA 2CU7A 5A2QZ 1Y0UA 3ELKA 1U8BA 2LOOA 2V7FA 2EB7A 1U9OA 1LFUP 1WQ2A 2NOGA 1X4PA 3F3XA 3GCMA 3H0GJ 3HRTA 1XSVA 1R00A 2Z1DA 4RLQA 1IN4A 1VQ9I 3FWEA 2VPRA 4KMUX 3KYDB 4XOPA 1F5TA 1SFEA 4IRHA 2RQPA 5F0HA 1QGPA 1UZCA 2JVGA 1VQ7I 4C2UA 1ZG1A 1W7PD 4BE1A 3FK7A 4GRIA 4IOAF 4BJTA 2PMZN 4BU2A 4A69C 1ETYA 2CW0F 3KYCB 2E2JJ 5BPDA 2IS1A 1FOKA 1QBJA 2MH9A 1KU9A 1ZLJA 3MKWB 1ZYRF 2VJ5A 1W4MA 2OTJI 1TL8A 1XC5A 4UB6C 1U9NA 4B4CA 1BW6A 2VXZA 1IZ1A 1LDJA 3JSOA 2ZXWH 3HBLA 2PMUA 2O03A 2V6CA 2AQEA 4UVBA 4ZDPA 3SZGA 1X3UA 1NTCA 4F93B 3N4MA 3RPUA 4IO9F 3K4JA 4XRSG 1VQ5I 2MW8A 2V9PA 3J7YJ 1SD6A 1R5GA 1MJ9A 4L5JA 1D8KA 1Z6RA 2E19A 4B44A 4BEHA 3GFMA 3WTVC 2VKEA 1ZGAA 4DYCA 2QCOA 2OZ6A 1R22A 3JW4A 3I5UA 2DTRA 3VSLA 1H88C 5L3DA 2PX9A 2UZKA 4YIRX 2L3DA 4PDKA 3RKWA 2M7AA 2QZ8A 2CFOA 4LMYA 3S2WA 1VQPI 2OCEA 3MKZA 2OQGA 1G3YA 3TP3A 4Y3OA 3GFJA 3GYHX 4AC0A 5ICCA 4LGWA 5LHGA 1HXDA 3GWZA 1ZHFA 3M4OJ 3RYRA 1ETWA 2COBA 3MZYA 4QPOA 4RA2A 2DMTA 4DGWB 1U78A 2Q2EB 1KU3A 1WZ2A 4BYYA 2HVSA 5CQGA 1T0FA 2L02A 1N78A 4XN0A 1SVLA 3DF8A 4KISA 3CCRI 3NAUA 1NK3P 5E17F 4BL0B 4FE7A 2ZXIA 5F04A 1WJCA 1HF0A 1YS6A 2R5ZA 4KT6A 4EM0B 3K4LA 1Q1HA 5TGTA 1HCRA 3WTZA 1QVTA 2IGMA 4KITB 4II3A 2R7XA 3D5SC 2VBXA 3CCJI 3VWBA 2CJJA 1GDTA 5E79C 1N25A 3KP6A 3DU6A 1B1BA 2EH3A 1H9GA 1LUJB 4N9HA 5EEAA 1EH7A 1T39A 1FP2A 3MKYB 3BC8A 3QOPA 2DBBA 2L9VA 2FE3A 2FBIA 2K3PA 5GTHC 1OCRH 4IHTA 3NARA 3EUHC 4J00A 2OTLI 1YRNA 4MTDA 3R0AA 4HQMA 1MD0A 4XKVA 1YI2I 2I8DA 2N8GA 3BTIA 1FP1D 3MAJA 4BH9A 3JAMK 4AIKA 3UKGA 4JK1X 1TP4A 2F5FA 1R23A 1ZN2A 4IOCF 5F1RA 4I0BA 3PJRA 4NC6A 2W85A 4E7SA 1MBFA 4J01A 5F27A 2BY1A 2HVQA 1CGPA 2Z9OA 4C9YA 3GZNB 4RS8A 3TW7A 3KZIC 3OSGA 2GXAA 5K7ZA 3K10A 3CCVI 3GO5A 3EUAA 4BJ5C 4Y13A 1H0MA 2LG4A 3I4NJ 1DUXC 3SDGA 2VASA 1XGNA 3OV8A 5FROA 1MZBA 3OR1C 2MH2A 3JSPA 3BLYA 3DPTA 4IHVA 1PVEA 1BI3A 4J19A 1K6YA 3I54A 3MMYB 3GTMJ 2BY0A 5C3EJ 1T33A 4A3IJ 1H9TA 2JN6A 3W2VA 5DD4A 2P4WA 3ZMSA 3R60A 3I64A 2RQQA 1I39A 3G1MA 2TCTA 3DPUA 5HDGA 3K69A 4QPQA 4ETSA 4WXDA 2AXTC 2VL8A 4OINF 1JXSA 5EG0A 5BS6A 1J9IA 4XLAA 1V5EA 1D0ZA 4WXCA 3OYBA 2XC7A 2ZJPF 2IGNA 2WWYA 1RPWA 2OD5A 2YU9J 1ETOA 4X1EA 5E3OA 5L3CA 1MJAA 3MQ0A 4AIJA 4JOMA 1OISA 1QU3A 4XLNF 1POGA 2E35A 2L2OA 5LRSA 1YTYA 1YITI 1MBEA 2KJBA 2R7WA 2YX7A 4EM1A 1WVRA 1S7OA 1BC8C 3HSEA 2DQRA 3ZQHA 1BBYA 2I5UA 1T95A 1LB2A 1LQ1A 5BMZA 2EA4A 1DGRM 1KA8A 5E3MA 3ZR8X 3FM3A 2X6WA 2IS4A 2IGOA 3U1KA 5CLSA 2H1LA 5B66C 1FYMA 4HF1A 1HA8A 3G6EI 1CQTA 2DDAA 1HW5A 2IP2A 3TKYA 1WI9A 2L7FP 3PIOF 4TV7A 4ENKA 3IWFA 2EBIA 4M71A 4BE0A 1XN7A 4NB5A 4OU0A 4HNUA 2OQRA 4ASNA 2FOWA 2IT0A 1DPRA 3SDBA 3WGIA 2IS2A 4A6DA 1TNTA 5D4RA 4LLNA 2PBIA 2HZTA 1FT9A 1XS9A 1S29A 2ZMEA 2R7OA 3HHHA 3LA3A 4HDVA 1KYZA 1I1GA 4GXOA 2FXAA 1ZK8A 2OCCH 3GEZA 1NG7A 4LOCA 3BG5A 1UG2A 2CUJA 1B59A 1WJFA 2BV6A 3KFWX 3QPHA 2CQKA 1FOXA 4EV0A 5B5EC 2L9SA 2VI6A 4D0PA 3H35A 3Q5FA 2VQHA 2UUZA 5IP7J 3AG3H 1NH3A 2X48A 3CC7I 1PP8F 5DYMA 2EFWA 3G1LA 5FKLA 4JP0A 1IXRC 5JVTA 3PQKA 3DTEA 2PMHA 3M8JA 3ERED 4UY8I 3FXOA 5C44J 2PFBA 1BI0A 2LC2A 1OLTA 3CJNA 5LEJA 4ESJA 2NS7A 3E0JB 4E7KA 4CDGA 2K86A 3DBLB 4PZJA 3OYCA 3CZ6A 2QUFA 4ZYAA 4KN7X 5IT3A 3F72A 3BOQA 3I55I 2GA1A 5F64A 3Q9VA 5EZHA 1YX3A 2X4HA 3C1DA 2R5YA 3K2AA 3IH3A 4GFBA 2KIQA 4A0ZA 4PGHA 5AIPA 3UR3C 2E34A 3BROA 2LY9A 1P7JA 4HNVA 5J6XA 4L0YB 2Z3YA 3WTSC 4E7LA 2EPFA 2ZNZA 1NK2P 1AKHB 2RC4A 4HLYA 2CMPA 4BBRJ 3K4NA 5CPRB 2ISYA 2HYGD 2QQ9A 2D2WA 4XIDA 5KAFC 4EGYA 2IXSA 1STZA 3LAJA 5CJ9A 2DFEA 3VYUB 5L3BA 3WTTC 3S8PA 4FASD 3P9CA 3RTRA 2KDZA 2XRLA 1FBSA 5J4YA 3A0HC 1ETVA 3AFHA 2DT7B 2YX4A 5DEQA 1TWCJ 1VTNC 3EYYA 3RSNA 2G7HA 3ZMDA 2IJLA 2EQRA 4M74A 2B63J 2Z5UA 1VQMI 3BQZA 3ECOA 3IP4B 2Y69H 4UXNA 4AWXB 4UHTA 3T1BA 1YYVA 1XX5A 3B6CA 3CC2I 1IF1A 2WAFA 2NAZA 5K5QA 2F6CA 4AVZA 1WCMJ 5TJJA 4ZYHA 1IRGA 3FMRA 3B02A 2OU2A 3CCYA 1USTA 5A2QK 1FMWA 1MBGA 2ACJA 1RZ4A 1R71A 4Y4RA 1P4WA 2EIJH 4Y7NJ 3IH4A 2JUGA 4MFEA 2TRTA 2R3SA 4LK1F 3JRBA 3CF2A 3SEQA 3SHFA 3S3MA 1IG7A 2L7MP 4IJAA 5EEHA 2L9NA 5KVRA 1BR2A 2L7ZA 4P9FA 1ZRCA 1SVMA 4MO7A 5FD6A 3A01A 4M72A 4IVNA 1YQAA 4EATA 2JWTA 2F5VA 3F22A 3GTJJ 2VE9A 2MA3A 5F1JA 4RB3C 1BI2A 4GDFA 3GZ5A 4NNJA 2HXIA 2STTA 4QLCU 4A3MJ 1VQ6I 4A3BJ 2E1CA 2EFQA 1ZQ3P 1BW5A 3BG6A 1APLC 4D9JA 4HPQA 2LR8A 3L2VA 3P7NA 2LD5A 1IV6A 3W2AA 5JLWA 4E4HA 1U5TC 1Z3YA 4OIOF 2BY3A 3CUQA 4HA8A 4E6KG 2WAEA 2P5VA 3O3KA 2MSYA 3BQYA 1UG0A 1WKMA 1TNSA 3OYIA 5ICGA 4ZDLA 5ILUA 2XPWA 2CH0A 2XRNA 2OAZA 2LKPA 2RV8A 4CA0A 2QM3A 3EDPA 4BNCA 2IS6A 2M2EA 1YIOA 3CDHA 1R36A 3CP8A 3CJTB 5KCMA 3AL0C 1MMAA 2CFXA 4I7HA 3F8BA 4XQFA 2ZJ2A 2R93J 3LSIA 1R1TA 2FUG2 4XR6A 1Y8RB 5JHUA 1OCZH 1ZG3A 4LLGF 4CH7A 3K4CA 3AKZA 3I9V2 1S9HA 1MSFC 2JZYA 4AD9A 4ON0A 3QAHA 1I6HJ 1B6AA 4CYCA 3BPXA 4I0AA 2R4GA 4HYEA 4EMSA 5FKOA 3BJAA 2XAUA 1W7PA 3L2UA 3JRDA 5LGUA 4WK8F 3LSHA 2Z16A 5DM7F 2VOPA 4C3JJ 3D5RC 4MEXF 3GVAA 4MIMA 5DV5A 4CCJA 2ZJRF 4JX6A 3CCMI 5J1RA 3R4KA 5FFZA 2L4AA 4L9JA 1BIBA 2A6HF 2BGCA 4AVPA 2HNHA 2L4MA 4P1WA 3ABUA 4A0YA 5J1YA 1BR1A 2L54A 1FOYA 1ZGJA 2XGCA 2KIUA 2ZMEB 2K4JA 3BR3A 1E17A 2PMZA 1XB4A 2Y0MA 3S1NJ 3FISA 1JHHA 3H3VK 1ITYA 1K83J 1IDYA 4G6TB 2BXYA 2FBKA 2EZIA 3OSFA 3VFZA 3FZVA 2PLYA 4RB1A 4F55A 3S1RJ 2JA2A 4EJWA 5IYBJ 3DQVC 3OMYA 2EINH 3HB9A 4ZZLA 3F8CA 1FBUA 4XKWA 4B1RA 3H1CA 1W36D 2HXOA 2HQRA 1IN6A 2VODA 3I0TA 2XB0X 4CCNA 2O6GE 3AAFA 4IHWA 1MNDA 3RPUD 1GXQA 1WH5A 3KETA 4XORA 3OYGA 3E97A 1MDMA 2EZLA 1YG2A 5IT9Z 1XSDA 2FBHA 3LMMA 3EUKL 2KKOA 4F7ZA 2GQQA 2EIMH 3OWTA 3OYFA 1WPKA 2A3SA 2BVLA 1JTYA 2DMPA 3O6BB 4II2A 4MEYF 2HOAA 2EZHA 4RM2A 1S6LA 3HHGA 4M3FA 1K4TA 1V4RA 1TWAJ 4C3IJ 2IA2A 2HEOA 2RGVA 1ON1A 2RVCA 1TZLA 4HAMA 3LSTA 3PNYA 3OL3A 2XB5A 3BP8A 1S8NA 1QZEA 5IY5H 2KL4A 2ZB9A 4L0ZB 1GLNA 3FXRA 5FB2A 2KFDA 3VSKA 3CUQB 4UVAA 3QP6A 3HEFA 2XSDC 2HQ5A 4G12A 1CF7B 2W25A 4XRFA 2H6CA 2FEZA 3DXJF 4LIUA 2OBPA 1G3TA 3G73A 2MYSA 1TQPA 2CW8A 1GVDA 1QVUA 2ESHA 3VB2A 1Z05A 1YOVB 2CYYA 2JSPA 3ABLH 2EZKA 4A3JJ 2L7KA 2VOOA 5C4XJ 1WWXA 1O3SA 4KUMA 4IHXA 3CQZJ 2STWA 3DTIA 1ZKGA 4YFXF 5JFRA 4LG3A 4QIWN 5FKMA 1JI8A 2X6YA 3IL2A 4QTRA 1QPMA 1IN5A 4D5FA 3HOYJ 4HV6A 2A6TA 3HTUA 1HOMA 1FNNA 3HZJA 3SXYA 2JT1A 3HSFA 4HX8A 2GZWA 3S3NA 1T6SA 2MLKA 4IKFA 2CV0A 4ESBA 1W5TA 4Q48A 3FBIB 4L5EA 3IHUA 3GW2A 2BOLA 3FKIJ 4V2GA 2VB6A 3ERMA 3ABMH 2M3AA 1JT6A 4KA4A 3QYEA 2D1HA 1Z7UA 1OMIA 2X1EA 4O6JA 2O9LA 3VYSB 5F08A 3CUOA 2XAJA 2CW7A 2HGCA 2M45A 3CESA 1FIAA 1G3WA 3BR6A 3WTUC 3ZPLA 5J1UA 4DYRA 2ELHA 4LJZF 2E2IJ 1Z7LA 1FJLA 3RJPA 4EEFG 1HQCA 2DOEA 2HTJA 5D4SA 2M0CA 4M9SA 4U87A 2RNJA 2ESNA 3IAS2 5EGOB 1X1CA 2DJNA 2NS0A 2VKHA 5HVQC 2GOXB 2GA2A 4KJZA 4G6QA 1XDUA 2XAQA 3RZOJ 4M9ZA 1W36C 3HGYA 3RDIA 4IQJA 4EJVA 4IQ4A 5HOOA 4M3BA 3EYIA 3A2KA 3IUOA 2VPLA 2JQ7A 5L3FA 1OCTC 3W2WA 1V5GA 3H3UA 1X1DA 3CLOA 3DPLC 1R9TJ 4I98B 2XHKA 4M9XA 5E1WA 2P6SA 5DS9A 3HDDA 3HOSA 2G7UA 3RZDJ 4UUVA 2IAIA 2UXXA 2BZTA 3JTGA 2W57A 1GV5A 3S32A 4ZYEA 4LFUA 4M73A 1O3TA 2LF8A 4BBSJ 3F8NA 3VYTB 2K9QA 4B8XA 3J7ZI 1ZR4A 3TW6A 2DYRH 3HYIA 2FSWA 1MH4A 2DK5A 2EILH 5IP6A 4MLOA 1LE8B 4AYBN 2P6TA 3S17J 1IO2A 1UFMA 5BQTA 3HRMA 3OYLA 4M3EA 3PSIA 5DCMB 4CO8A 1I3AA 1LJ9A 3GTGJ 2LY2A 1Y6IA 4O5VA 2R7SA 5ICFA 2WADA 4IZZA 2R7ZJ 2W00A 1D0XA 1IXCA 2LREA
chains in the Genus database with same CATH topology
2D45A 2FF4A 3J81K 3JAMZ 1I5ZA 3M9AA 1ZAOA 5HLIA 3BWGA 4XLPF 2E1NA 2XV4S 3U9GA 2RDPA 4B09A 1WRJA 5HLGA 4O3MA 2VT2A 3BY6A 3ZN1A 3KZZA 3B73A 3P9KA 1XGOA 2VBWA 3LA7A 1KU2A 1OYWA 2IA1A 4HV5A 4LB5A 3ECHA 4MGRA 1ZARA 3DKWA 4R1HA 4HOBA 1SD4A 2Q2EA 1Z91A 3ZP5A 2A6EF 4NQWA 3ZMZA 4EGZA 3T8RA 2UXNA 2HFHA 1JE8A 1MDMB 2XAFA 3M1EA 3FMSA 3H92A 2FRHA 1HKSA 1Z1DA 3CO6C 3WODF 2EJRA 3PFIA 3TOAA 4E70A 4RGRA 5D5XB 1E2XA 2XKPA 3CO7C 5FD5A 3RI4A 3ZMVA 3K9TA 1KQ8A 4WXHA 2CWEA 2IA0A 2EV5A 5HS9A 1J0RA 5LHHA 3FMQA 2PEXA 4UVCA 4G7OF 2K27A 3I58A 4RAYA 2W24A 1O3QA 2O8XA 5DUIA 4BHCA 1L3LA 1DP7P 2CGPA 4M6YA 4L9VA 2LNBA 4ESFA 1G4DA 4GYIA 3W6JB 2PG4A 1UCRA 4HX7A 4CYDA 2WC2A 1EV7A 2P7CB 5E8GA 3U2RA 1DPUA 3MFKA 2MD5A 1ODDA 2FMLA 4GGGA 4BXUA 3GFIA 5HS7A 3EETA 1TBXA 4IXAA 4QWQA 2ISZA 3J80Z 2MLGA 1AOYA 5AONA 1DDNA 5DCFA 4JBAA 1FSEA 4KN4X 2VN2A 3I59A 1ULYA 3ROUA 1P4AA 3KEOA 1D5VA 5L3GA 2M87A 2EK5A 3NQOA 3SZTA 4KNYA 2XUBA 4I01A 2EWNA 5E20A 3LQQA 3WTXC 4HW0A 1XMKA 5LGTA 1HSJA 1FX7A 4FX0A 1SAXA 1G3SA 5K1YA 4A2UA 2DPDA 1R58A 1ZH5A 3RYPA 3HOTA 5DDGA 4KMFA 4R79A 1TQMA 2DLLA 4K2EA 4WCGA 2EV6A 1BN5A 2V1XA 3VOEA 4CXFA 3OOPA 5D8KB 1LDDA 4Z2YA 3FM5A 3R6SA 1XCBA 1ZRDA 1AWCA 2XVCA 3MWMA 3D0SA 3C18A 1KQ9A 3KLNA 2DT5A 2NNYA 1KQ0A 1BI1A 4OMYA 5FFXA 2JSCA 1MGTA 5F6FA 4LG0B 3FHZA 1GVJA 3FF5A 4U0WA 1SD7A 1SFUA 2DO7A 3QP5A 1U6GA 1UHWA 5LLQA 3J81Z 3KLOA 1S7AA 2QENA 1OYYA 2XAHA 1IN7A 3KZYA 4Y17A 3WGHA 2ZNYA 3MZHA 3KP3A 1XGSA 4A5MA 2A5YB 5ILSA 4JQFA 1U5TA 3CUQC 1FZPB 1ZREA 3E6BA 4RB0A 3M7GA 1OR7A 4A6EA 2GIVA 2QWWA 3FXQA 1W7PB 5H6RA 3H3ZA 1RNLA 1SFXA 1OYIA 3L09A 2VC0A 1HW2A 4KYWA 4A0XA 3IKTA 4XBFA 3K1PA 4HDUA 1O57A 1TTYA 2GAUA 2YR2A 1BM9A 3E5UA 4LK0F 2IRFG 1KGSA 4FX4A 1UHMA 4UV9A 3TOBA 4I2OA 3ZMUA 2HDCA 4EJOA 4P5OA 1YFHA 4EQQA 3BJOA 5FO5A 4G6DA 1J2XA 1LNWA 5ICEA 4WF2A 3BJ6A 2GXBA 3GZ6A 1IRFA 2EFPA 2DPUA 1Z6TA 2J5OA 2HOEA 4OIPF 2BE5F 4MQVA 2NNNA 3RKXA 1J7KA 3KP4A 2PI0A 2XROA 2FU4A 3KEQA 4RGUA 2KIFA 3QRFF 2FQ3A 3QPTA 2P8TA 3ZMTA 2Y48A 3SZPA 3F6OA 4BHBA 4UNOA 3BDDA 1TW2A 2PJPA 1IXSB 3IC7A 1ONVA 1HKQA 3ZN0A 4EM2A 2RKHA 1XDSA 5D8LB 5LEKA 4Q4ZF 4U7BA 4S05A 1FBQA 4NHJA 1EH6A 5LRRA 4AIHA 1T98A 3KCCA 4CGZA 2F5CA 4KDPA 3TDZC 4G9YA 3V7SA 3VEPA 3WTWC 3K0LA 1T2KA 4OMZA 1J5YA 4IHSA 4XSZF 4L9NA 3GUDA 4A12A 1ZG5A 2VT3A 2XAGA 2P7VB 2VE8A 2C6YA 1PUEE 3KP5A 3E6DA 2ZCWA 1R7JA 1V3FA 3FXUA 3IKVA 1I27A 5E18F 4OIQF 1BJAA 1MKMA 1HSTA 2KRFA 1OKRA 1RUOA 1HKTA 4MTEA 2HKOA 4U0YA 3GF2A 1U3EM 2XGXA 2K02A 2IW5A 3C7JA 2CSOA 1JHFA 2IVMA 3TO7A 4P9UA 2Q0OA 5H20A 5J8FA 3QU3A 1XMAA 3V8JA 3K2ZA 3JTHA 3VODA 3HRUA 3W6KB 3ML6A 5HDNA 1FC3A 2FNPA 2QQAA 2VBYA 3DEUA 1YW8A 4ZH4F 1RUNA 1O7LA 2V1UA 4IF4A 2XIGA 5FGMA 1TW3A 5FLXZ 4G7ZF 2JTVA 4LB6B 3M8FA 3F8FA 4N9IA 2O61A 5CVVA 2H09A 5HDKA 3KE2A 4IRIA 2Z99A 4DQ2A 5HS8A 1LVAA 5ED4A 5BOXA 1JGSA 4Y15A 3V8LA 1GXPA 3TGNA 1K79A 2QQBA 2M30A 1P2FA 4G7HF 3C3WA 1F9NA 3KP2A 2CO5A 4BQAA 4M6XA 1U2WA 5L3EA 3ISPA 5DCMA 4Q47A 2R7FA 4OOIA 2BBYA 1XSXA 4WX9A 4U88A 1YW9A 5IT9K 5CVJA 4FT8A 1F4KA 2K7LA 3F21A 2NRAC 3EQLF 4PCQA 4ENMA 5CVUA 5H6QA 3BPVA 3M8EA 2HQNA 1FWZA 4YFNF 1LEAA 3D5LA 3F6VA 4ENNA 2EFNA 4HZFA 3WGGA 5CVIA 3IWZA 1FYLA 2F5DA 2GXGA 3F8MA 3ULQB 3R61A 1BC7C 1B4AA 1ZRFA 1FY7A 1Z9CA 3GFLA 1O3RA 3E5XA 3O2PE 2EA2A 4ZYDA 3J7AO 1QNTA 4CHUA 4Q5SF 5D6EA 2NYXA 1K7AA 5FLXK 1ZLKA 1I6XA 4GCVA 1IW7F 3EUHA 4IRGA 1G6NA 3T8TA 1ON2A 2JPBA 4RGSA 5D5UB 2W84A 2A61A 2F2EA 3E5QA 2D1VA 3TO9A 2QBYA 1TLHB 2COMA 4MQ9F 2A68F 2HTSA 3RPQA 4P96A 3WU0A 5J8CA 3ABTA 1XD7A 1QZZA 1SMYF 5K5RA 3E6MA 1PP7U 3WE3A 3RKYA 3F23A 2M1BA 4YIIA 5TRDA 1YO5C 3MEXA 3I4PA 1YLFA 3QU6A 2LDUA 1QO0D 2HR3A 2X0LA 3ZQ7A 3HIFA 3WTYC 3L7WA 4GYGA 5BPIA 3T5XA 3TO6A 2HKXA 4HX4A 2E7XA 1PDNC 2B0LA 4HQEA 2HWVA 4EJUA 3CTAA 1IUYA 3GX4X 1B9NA 5E1XA 1LDKB 2QYOA 2YPRA 4KIGA 2YU3A 1MJBA 3FX3A 2FMYA 4N0BA 2HYFA 4G94A 1T38A 4H0EA 3COAC 3E3VA 1IAWA 1RIOH 1QQIA 4BAYA 4LG0A 2A07F 1R1UA 1D8JA 4CZZA 2YSRA 1U8RA 3V8KA 3V4GA 5LBQA 3J80K 4YIFA 3NEUA 2M5WA 2KJCA 4RAZA 1HBXG 2CG4A 2OA4A 2PN6A 2DQLA 4EVIA 2F5EA 3U1DA 5DD8A 2LF7A 2G9WA 1FLIA 2MC3A 3Q9SA 1J59A 2FA5A 2HS5A 3G3ZA 4WWCA 2Y75A 4ZYGA 3V7CA 3LA2A 4BHPA 1P4XA 1KU7A 1REPC 2JPCA 4HLXA 3V7RA 1K6OA 4KT5C 2JRTA 3WE2A 4ZZDA 1R5HA 3BZ6A 4KIFA 3IRQA 2RN7A 3HUGA 5AIQA 4L18B 1TQIA 5ILVA 4S04A 4IPAA 1CF7A 3K1NA 3R0JA 1UB9A 1I1SA 1XCVA 1FSHA 1K78A 4LLLA 4I09A 2ZXJA 1L0OC 1KYWA 4U0VA 4KIBA 2ZKZA 4A5NA 3KP7A 1XGMA 2H94A 1J75A 5KK1A 3GXOA 3TDUC 2AS5F 3I53A 4XSXF 1WSUA 1R1VA 1EH8A 1P6RA 1FYKA 2XASA 3K1MA 1LEBA 4I02A 4HF2A 1BIAA 3SFZA 2H27A 2FNAA 6PAXA 1F1ZA 1B9MA 3LQRA 3LWFA 5LHIA 2UWMA 4FHTA 3HSRA 1K78B 2KIMA 3WU1B 4L9TA 5HLHA 2DI3A 5JI6A 2H6BA 3GLXA 5E1ZB 2EFOA 5D5WB 2QLZA 1OPCA 3DFGA 2BYVE 5CYVA 4MNUA 4YG2F 2TDXA 5EEGA 4YFKF 2P5KA 2Z33A 2DK8A 2M8EA 3L2CA 2IPQX 4HBLA 4KFCA 4G8XA 1O7FA 4R8HA 3TQNA 4U7DA 2QBYB 3REOA 3SQNA 4RGXA 1IN8A 2V9VA 1U5TB 2L01A 4EJTA 2WV0A 1SMTA 1A04A 2P5LC 3P9IA 3NRVA 2ZBKA 1S3JA 3L9FA 4ENJA 4P55A 2WTEA 1HW1A 2K4BA 3RIRA 4UV8A 1W5SA 1YS7A 4RB2C 3IRRA 2DAOA 2ETHA 3N97A 1USSA 2O0YA 5DUKA 5LGNA 4L5IA 5ERIA 5D6FA 3MCZA 2DU9A 2ZO4A 2BEOA 1RI7A 3PQJA 1FPQA 4OIRF 3LAPA 2DFIA 3DV8A 2AXLA 2MBFA 2V1DA 4GO1A 5JR3A 3LFKA 3I59B 4LD5A 2QVOA 4HF0A 1P92A 2VONA 1D3YA 4CICA 5K5OA 1SD5A 2Q8KA 4MHGA 5CVRA 2VC1A 1BOAA 2E7WA 2VBZA 3L00A 2A69F 2R7DA 1YW7A 4KICA 3DP7A 3WG9A 3T0YA 2V79A 2OZUA 4PGGA 3E6CC 1NHAA 3HTSB 2XKOA 5D5VB 2GWRA 1C0WA 2EV0A 2J5PA 2PQ8A 2LSOA 2ZFWA 3I71A 2FOKA 2DW4A 3HRSA 5E8IA 4DNCA 1QZYA 1GHCA 2O3FA 2ADUA 5A2QZ 1Y0UA 3ELKA 2EB7A 1WQ2A 3F3XA 3HRTA 1XSVA 1R00A 1IN4A 3FWEA 4KMUX 1F5TA 1SFEA 4IRHA 2RQPA 1QGPA 1ZG1A 1W7PD 2CW0F 5BPDA 1FOKA 1QBJA 2MH9A 1KU9A 1ZLJA 1ZYRF 1W4MA 2VXZA 1LDJA 1IZ1A 3JSOA 4UVBA 2PMUA 2O03A 2V6CA 1X3UA 3N4MA 3RPUA 1SD6A 1R5GA 1MJ9A 4L5JA 1D8KA 1Z6RA 3GFMA 3WTVC 1ZGAA 2OZ6A 1R22A 3JW4A 3I5UA 2DTRA 5L3DA 2UZKA 2L3DA 4PDKA 3RKWA 2QZ8A 4LMYA 3S2WA 2OQGA 1G3YA 3GFJA 3GYHX 5ICCA 4LGWA 5LHGA 1HXDA 3GWZA 1ZHFA 3RYRA 3MZYA 1U78A 1KU3A 4BYYA 1T0FA 2L02A 3DF8A 5E17F 1YS6A 4EM0B 1Q1HA 3WTZA 2VBXA 3KP6A 1B1BA 1H9GA 4N9HA 1EH7A 1T39A 1FP2A 3QOPA 2DBBA 2FE3A 2FBIA 4IHTA 4MTDA 3R0AA 4HQMA 1MD0A 4BH9A 1FP1D 3MAJA 3JAMK 4AIKA 4JK1X 2F5FA 1R23A 1ZN2A 5F1RA 4I0BA 2W85A 2Z9OA 1CGPA 4RS8A 3GO5A 4Y13A 1H0MA 1DUXC 1XGNA 3OV8A 1MZBA 3JSPA 2MH2A 3DPTA 1BI3A 3I54A 1H9TA 5DD4A 2P4WA 3ZMSA 3R60A 3I64A 5HDGA 3K69A 4ETSA 4WXDA 4OINF 1JXSA 5BS6A 1J9IA 4WXCA 2WWYA 2OD5A 5L3CA 1MJAA 3MQ0A 4AIJA 4XLNF 5LRSA 1YTYA 2KJBA 2YX7A 4EM1A 1BC8C 1S7OA 3HSEA 2DQRA 1BBYA 1LB2A 1LQ1A 5BMZA 2EA4A 1KA8A 3FM3A 5CLSA 1FYMA 4HF1A 1HW5A 2IP2A 3TKYA 1WI9A 4TV7A 4ENKA 3IWFA 4M71A 1XN7A 4NB5A 4OU0A 2OQRA 4ASNA 2IT0A 1DPRA 3WGIA 4A6DA 1TNTA 5D4RA 4LLNA 2PBIA 2HZTA 1FT9A 1S29A 2ZMEA 3HHHA 3LA3A 4HDVA 1KYZA 1I1GA 4GXOA 2FXAA 3GEZA 1B59A 3QPHA 2BV6A 3KFWX 2CQKA 4EV0A 4D0PA 3Q5FA 1PP8F 5DYMA 2EFWA 5JVTA 1IXRC 3PQKA 2PMHA 3ERED 2PFBA 1BI0A 3CJNA 5LEJA 4ESJA 4CDGA 2K86A 4PZJA 2QUFA 4KN7X 5IT3A 3F72A 3BOQA 2GA1A 5F64A 3Q9VA 2X4HA 3C1DA 4A0ZA 4PGHA 5AIPA 3BROA 5J6XA 4L0YB 3WTSC 2Z3YA 2ZNZA 2RC4A 4HLYA 2ISYA 2HYGD 2QQ9A 2D2WA 4EGYA 1STZA 3LAJA 5CJ9A 5L3BA 3WTTC 3P9CA 3RTRA 1FBSA 2YX4A 5DEQA 1VTNC 3EYYA 3ZMDA 2G7HA 2IJLA 4M74A 2Z5UA 3ECOA 4UXNA 4AWXB 4UHTA 3T1BA 1YYVA 1IF1A 2NAZA 5K5QA 5TJJA 4ZYHA 1IRGA 3FMRA 3B02A 2OU2A 1USTA 5A2QK 2ACJA 1RZ4A 1P4WA 2R3SA 4LK1F 3SHFA 4IJAA 5EEHA 5KVRA 4P9FA 1ZRCA 5FD6A 4M72A 4IVNA 1YQAA 3F22A 2VE9A 2MA3A 4RB3C 1BI2A 3GZ5A 2STTA 4QLCU 2E1CA 2EFQA 3P7NA 1U5TC 4OIOF 3CUQA 4HA8A 2P5VA 3O3KA 1WKMA 1TNSA 5ICGA 5ILUA 2XRNA 2OAZA 2LKPA 2RV8A 2QM3A 3EDPA 4BNCA 1YIOA 3CDHA 1R36A 2CFXA 4I7HA 3F8BA 2ZJ2A 1R1TA 5JHUA 1ZG3A 4LLGF 2JZYA 4AD9A 4ON0A 3QAHA 1B6AA 3BPXA 4I0AA 4HYEA 4EMSA 3BJAA 1W7PA 5LGUA 4WK8F 2VOPA 4MEXF 3GVAA 5DV5A 3R4KA 5FFZA 2L4AA 4L9JA 1BIBA 2A6HF 2BGCA 4AVPA 2L4MA 3ABUA 4A0YA 2L54A 1ZGJA 2KIUA 2ZMEB 2K4JA 1E17A 2Y0MA 1XB4A 1JHHA 2FBKA 3VFZA 3FZVA 2PLYA 4RB1A 4EJWA 3DQVC 4ZZLA 3F8CA 1FBUA 2HQRA 1IN6A 2VODA 3I0TA 2O6GE 3AAFA 1GXQA 3KETA 3E97A 1MDMA 1YG2A 5IT9Z 1XSDA 2FBHA 2KKOA 4F7ZA 2GQQA 2A3SA 3O6BB 4MEYF 1S6LA 3HHGA 1V4RA 2IA2A 2HEOA 2RGVA 1ON1A 2RVCA 4HAMA 3LSTA 3BP8A 1S8NA 4L0ZB 3FXRA 5FB2A 3CUQB 4UVAA 3QP6A 1CF7B 2W25A 4XRFA 2H6CA 2FEZA 3DXJF 2OBPA 1G3TA 3G73A 1TQPA 2ESHA 3VB2A 2CYYA 1Z05A 2VOOA 1WWXA 1O3SA 4KUMA 2STWA 4YFXF 5JFRA 3IL2A 1QPMA 1IN5A 4HV6A 3HTUA 1FNNA 3SXYA 2JT1A 3HSFA 4HX8A 2GZWA 1T6SA 2MLKA 4ESBA 1W5TA 4Q48A 3IHUA 3GW2A 4KA4A 2D1HA 1Z7UA 1OMIA 4O6JA 2XAJA 3CUOA 2HGCA 2M45A 1G3WA 3WTUC 3ZPLA 2ELHA 4LJZF 3RJPA 1HQCA 2HTJA 5D4SA 4M9SA 2RNJA 2ESNA 2NS0A 5HVQC 2GA2A 4G6QA 1XDUA 2XAQA 4M9ZA 3RDIA 4EJVA 5HOOA 3EYIA 5L3FA 3H3UA 3CLOA 3DPLC 4I98B 2XHKA 4M9XA 5E1WA 2P6SA 3HOSA 2G7UA 4UUVA 2UXXA 3JTGA 2W57A 4ZYEA 4LFUA 4M73A 1O3TA 2LF8A 3F8NA 4B8XA 3HYIA 2FSWA 2DK5A 2P6TA 1UFMA 5BQTA 3HRMA 5DCMB 4CO8A 1LJ9A 4O5VA 5ICFA 1IXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D45 A;  2FF4 A;  3J81 K;  3JAM Z;  1I5Z A;  3M9A A;  1ZAO A;  5HLI A;  3BWG A;  4XLP F;  2E1N A;  2XV4 S;  3U9G A;  2RDP A;  4B09 A;  1WRJ A;  5HLG A;  4O3M A;  2VT2 A;  3BY6 A;  3ZN1 A;  3KZZ A;  3B73 A;  3P9K A;  1XGO A;  2VBW A;  3LA7 A;  1KU2 A;  1OYW A;  2IA1 A;  4HV5 A;  4LB5 A;  3ECH A;  4MGR A;  1ZAR A;  3DKW A;  4R1H A;  4HOB A;  1SD4 A;  2Q2E A;  1Z91 A;  3ZP5 A;  2A6E F;  4NQW A;  3ZMZ A;  4EGZ A;  3T8R A;  2UXN A;  2HFH A;  1JE8 A;  1MDM B;  2XAF A;  3M1E A;  3FMS A;  3H92 A;  2FRH A;  1HKS A;  1Z1D A;  3CO6 C;  3WOD F;  2EJR A;  3PFI A;  3TOA A;  4E70 A;  4RGR A;  5D5X B;  1E2X A;  2XKP A;  3CO7 C;  5FD5 A;  3RI4 A;  3ZMV A;  3K9T A;  1KQ8 A;  4WXH A;  2CWE A;  2IA0 A;  2EV5 A;  5HS9 A;  1J0R A;  5LHH A;  3FMQ A;  2PEX A;  4UVC A;  4G7O F;  2K27 A;  3I58 A;  4RAY A;  2W24 A;  1O3Q A;  2O8X A;  5DUI A;  4BHC A;  1L3L A;  1DP7 P;  2CGP A;  4M6Y A;  4L9V A;  2LNB A;  4ESF A;  1G4D A;  4GYI A;  3W6J B;  2PG4 A;  1UCR A;  4HX7 A;  4CYD A;  2WC2 A;  1EV7 A;  2P7C B;  5E8G A;  3U2R A;  1DPU A;  3MFK A;  2MD5 A;  1ODD A;  2FML A;  4GGG A;  4BXU A;  3GFI A;  5HS7 A;  3EET A;  1TBX A;  4IXA A;  4QWQ A;  2ISZ A;  3J80 Z;  2MLG A;  1AOY A;  5AON A;  1DDN A;  5DCF A;  4JBA A;  1FSE A;  4KN4 X;  2VN2 A;  3I59 A;  1ULY A;  3ROU A;  1P4A A;  3KEO A;  1D5V A;  5L3G A;  2M87 A;  2EK5 A;  3NQO A;  3SZT A;  4KNY A;  2XUB A;  4I01 A;  2EWN A;  5E20 A;  3LQQ A;  3WTX C;  4HW0 A;  1XMK A;  5LGT A;  1HSJ A;  1FX7 A;  4FX0 A;  1SAX A;  1G3S A;  5K1Y A;  4A2U A;  2DPD A;  1R58 A;  1ZH5 A;  3RYP A;  3HOT A;  5DDG A;  4KMF A;  4R79 A;  1TQM A;  2DLL A;  4K2E A;  4WCG A;  2EV6 A;  1BN5 A;  2V1X A;  3VOE A;  4CXF A;  3OOP A;  5D8K B;  1LDD A;  4Z2Y A;  3FM5 A;  3R6S A;  1XCB A;  1ZRD A;  1AWC A;  2XVC A;  3MWM A;  3D0S A;  3C18 A;  1KQ9 A;  3KLN A;  2DT5 A;  2NNY A;  1KQ0 A;  1BI1 A;  4OMY A;  5FFX A;  2JSC A;  1MGT A;  5F6F A;  4LG0 B;  3FHZ A;  1GVJ A;  3FF5 A;  4U0W A;  1SD7 A;  1SFU A;  2DO7 A;  3QP5 A;  1U6G A;  1UHW A;  5LLQ A;  3J81 Z;  3KLO A;  1S7A A;  2QEN A;  1OYY A;  2XAH A;  1IN7 A;  3KZY A;  4Y17 A;  3WGH A;  2ZNY A;  3MZH A;  3KP3 A;  1XGS A;  4A5M A;  2A5Y B;  5ILS A;  4JQF A;  1U5T A;  3CUQ C;  1FZP B;  1ZRE A;  3E6B A;  4RB0 A;  3M7G A;  1OR7 A;  4A6E A;  2GIV A;  2QWW A;  3FXQ A;  1W7P B;  5H6R A;  3H3Z A;  1RNL A;  1SFX A;  1OYI A;  3L09 A;  2VC0 A;  1HW2 A;  4KYW A;  4A0X A;  3IKT A;  4XBF A;  3K1P A;  4HDU A;  1O57 A;  1TTY A;  2GAU A;  2YR2 A;  1BM9 A;  3E5U A;  4LK0 F;  2IRF G;  1KGS A;  4FX4 A;  1UHM A;  4UV9 A;  3TOB A;  4I2O A;  3ZMU A;  2HDC A;  4EJO A;  4P5O A;  1YFH A;  4EQQ A;  3BJO A;  5FO5 A;  4G6D A;  1J2X A;  1LNW A;  5ICE A;  4WF2 A;  3BJ6 A;  2GXB A;  3GZ6 A;  1IRF A;  2EFP A;  2DPU A;  1Z6T A;  2J5O A;  2HOE A;  4OIP F;  2BE5 F;  4MQV A;  2NNN A;  3RKX A;  1J7K A;  3KP4 A;  2PI0 A;  2XRO A;  2FU4 A;  3KEQ A;  4RGU A;  2KIF A;  3QRF F;  2FQ3 A;  3QPT A;  2P8T A;  3ZMT A;  2Y48 A;  3SZP A;  3F6O A;  4BHB A;  4UNO A;  3BDD A;  1TW2 A;  2PJP A;  1IXS B;  3IC7 A;  1ONV A;  1HKQ A;  3ZN0 A;  4EM2 A;  2RKH A;  1XDS A;  5D8L B;  5LEK A;  4Q4Z F;  4U7B A;  4S05 A;  1FBQ A;  4NHJ A;  1EH6 A;  5LRR A;  4AIH A;  1T98 A;  3KCC A;  4CGZ A;  2F5C A;  4KDP A;  3TDZ C;  4G9Y A;  3V7S A;  3VEP A;  3WTW C;  3K0L A;  1T2K A;  4OMZ A;  1J5Y A;  4IHS A;  4XSZ F;  4L9N A;  3GUD A;  4A12 A;  1ZG5 A;  2VT3 A;  2XAG A;  2P7V B;  2VE8 A;  2C6Y A;  1PUE E;  3KP5 A;  3E6D A;  2ZCW A;  1R7J A;  1V3F A;  3FXU A;  3IKV A;  1I27 A;  5E18 F;  4OIQ F;  1BJA A;  1MKM A;  1HST A;  2KRF A;  1OKR A;  1RUO A;  1HKT A;  4MTE A;  2HKO A;  4U0Y A;  3GF2 A;  1U3E M;  2XGX A;  2K02 A;  2IW5 A;  3C7J A;  2CSO A;  1JHF A;  2IVM A;  3TO7 A;  4P9U A;  2Q0O A;  5H20 A;  5J8F A;  3QU3 A;  1XMA A;  3V8J A;  3K2Z A;  3JTH A;  3VOD A;  3HRU A;  3W6K B;  3ML6 A;  5HDN A;  1FC3 A;  2FNP A;  2QQA A;  2VBY A;  3DEU A;  1YW8 A;  4ZH4 F;  1RUN A;  1O7L A;  2V1U A;  4IF4 A;  2XIG A;  5FGM A;  1TW3 A;  5FLX Z;  4G7Z F;  2JTV A;  4LB6 B;  3M8F A;  3F8F A;  4N9I A;  2O61 A;  5CVV A;  2H09 A;  5HDK A;  3KE2 A;  4IRI A;  2Z99 A;  4DQ2 A;  5HS8 A;  1LVA A;  5ED4 A;  5BOX A;  1JGS A;  4Y15 A;  3V8L A;  1GXP A;  3TGN A;  1K79 A;  2QQB A;  2M30 A;  1P2F A;  4G7H F;  3C3W A;  1F9N A;  3KP2 A;  2CO5 A;  4BQA A;  4M6X A;  1U2W A;  5L3E A;  3ISP A;  5DCM A;  4Q47 A;  2R7F A;  4OOI A;  2BBY A;  1XSX A;  4WX9 A;  4U88 A;  1YW9 A;  5IT9 K;  5CVJ A;  4FT8 A;  1F4K A;  2K7L A;  3F21 A;  2NRA C;  3EQL F;  4PCQ A;  4ENM A;  5CVU A;  5H6Q A;  3BPV A;  3M8E A;  2HQN A;  1FWZ A;  4YFN F;  1LEA A;  3D5L A;  3F6V A;  4ENN A;  2EFN A;  4HZF A;  3WGG A;  5CVI A;  3IWZ A;  1FYL A;  2F5D A;  2GXG A;  3F8M A;  3ULQ B;  3R61 A;  1BC7 C;  1B4A A;  1ZRF A;  1FY7 A;  1Z9C A;  3GFL A;  1O3R A;  3E5X A;  3O2P E;  2EA2 A;  4ZYD A;  3J7A O;  1QNT A;  4CHU A;  4Q5S F;  5D6E A;  2NYX A;  1K7A A;  5FLX K;  1ZLK A;  1I6X A;  4GCV A;  1IW7 F;  3EUH A;  4IRG A;  1G6N A;  3T8T A;  1ON2 A;  2JPB A;  4RGS A;  5D5U B;  2W84 A;  2A61 A;  2F2E A;  3E5Q A;  2D1V A;  3TO9 A;  2QBY A;  1TLH B;  2COM A;  4MQ9 F;  2A68 F;  2HTS A;  3RPQ A;  4P96 A;  3WU0 A;  5J8C A;  3ABT A;  1XD7 A;  1QZZ A;  1SMY F;  5K5R A;  3E6M A;  1PP7 U;  3WE3 A;  3RKY A;  3F23 A;  2M1B A;  4YII A;  5TRD A;  1YO5 C;  3MEX A;  3I4P A;  1YLF A;  3QU6 A;  2LDU A;  1QO0 D;  2HR3 A;  2X0L A;  3ZQ7 A;  3HIF A;  3WTY C;  3L7W A;  4GYG A;  5BPI A;  3T5X A;  3TO6 A;  2HKX A;  4HX4 A;  2E7X A;  1PDN C;  2B0L A;  4HQE A;  2HWV A;  4EJU A;  3CTA A;  1IUY A;  3GX4 X;  1B9N A;  5E1X A;  1LDK B;  2QYO A;  2YPR A;  4KIG A;  2YU3 A;  1MJB A;  3FX3 A;  2FMY A;  4N0B A;  2HYF A;  4G94 A;  1T38 A;  4H0E A;  3COA C;  3E3V A;  1IAW A;  1RIO H;  1QQI A;  4BAY A;  4LG0 A;  2A07 F;  1R1U A;  1D8J A;  4CZZ A;  2YSR A;  1U8R A;  3V8K A;  3V4G A;  5LBQ A;  3J80 K;  4YIF A;  3NEU A;  2M5W A;  2KJC A;  4RAZ A;  1HBX G;  2CG4 A;  2OA4 A;  2PN6 A;  2DQL A;  4EVI A;  2F5E A;  3U1D A;  5DD8 A;  2LF7 A;  2G9W A;  1FLI A;  2MC3 A;  3Q9S A;  1J59 A;  2FA5 A;  2HS5 A;  3G3Z A;  4WWC A;  2Y75 A;  4ZYG A;  3V7C A;  3LA2 A;  4BHP A;  1P4X A;  1KU7 A;  1REP C;  2JPC A;  4HLX A;  3V7R A;  1K6O A;  4KT5 C;  2JRT A;  3WE2 A;  4ZZD A;  1R5H A;  3BZ6 A;  4KIF A;  3IRQ A;  2RN7 A;  3HUG A;  5AIQ A;  4L18 B;  1TQI A;  5ILV A;  4S04 A;  4IPA A;  1CF7 A;  3K1N A;  3R0J A;  1UB9 A;  1I1S A;  1XCV A;  1FSH A;  1K78 A;  4LLL A;  4I09 A;  2ZXJ A;  1L0O C;  1KYW A;  4U0V A;  4KIB A;  2ZKZ A;  4A5N A;  3KP7 A;  1XGM A;  2H94 A;  1J75 A;  5KK1 A;  3GXO A;  3TDU C;  2AS5 F;  3I53 A;  4XSX F;  1WSU A;  1R1V A;  1EH8 A;  1P6R A;  1FYK A;  2XAS A;  3K1M A;  1LEB A;  4I02 A;  4HF2 A;  1BIA A;  3SFZ A;  2H27 A;  2FNA A;  6PAX A;  1F1Z A;  1B9M A;  3LQR A;  3LWF A;  5LHI A;  2UWM A;  4FHT A;  3HSR A;  1K78 B;  2KIM A;  3WU1 B;  4L9T A;  5HLH A;  2DI3 A;  5JI6 A;  2H6B A;  3GLX A;  5E1Z B;  2EFO A;  5D5W B;  2QLZ A;  1OPC A;  3DFG A;  2BYV E;  5CYV A;  4MNU A;  4YG2 F;  2TDX A;  5EEG A;  4YFK F;  2P5K A;  2Z33 A;  2DK8 A;  2M8E A;  3L2C A;  2IPQ X;  4HBL A;  4KFC A;  4G8X A;  1O7F A;  4R8H A;  3TQN A;  4U7D A;  2QBY B;  3REO A;  3SQN A;  4RGX A;  1IN8 A;  2V9V A;  1U5T B;  2L01 A;  4EJT A;  2WV0 A;  1SMT A;  1A04 A;  2P5L C;  3P9I A;  3NRV A;  2ZBK A;  1S3J A;  3L9F A;  4ENJ A;  4P55 A;  2WTE A;  1HW1 A;  2K4B A;  3RIR A;  4UV8 A;  1W5S A;  1YS7 A;  4RB2 C;  3IRR A;  2DAO A;  2ETH A;  3N97 A;  1USS A;  2O0Y A;  5DUK A;  5LGN A;  4L5I A;  5ERI A;  5D6F A;  3MCZ A;  2DU9 A;  2ZO4 A;  2BEO A;  1RI7 A;  3PQJ A;  1FPQ A;  4OIR F;  3LAP A;  2DFI A;  3DV8 A;  2AXL A;  2MBF A;  2V1D A;  4GO1 A;  5JR3 A;  3LFK A;  3I59 B;  4LD5 A;  2QVO A;  4HF0 A;  1P92 A;  2VON A;  1D3Y A;  4CIC A;  5K5O A;  1SD5 A;  2Q8K A;  4MHG A;  5CVR A;  2VC1 A;  1BOA A;  2E7W A;  2VBZ A;  3L00 A;  2A69 F;  2R7D A;  1YW7 A;  4KIC A;  3DP7 A;  3WG9 A;  3T0Y A;  2V79 A;  2OZU A;  4PGG A;  3E6C C;  1NHA A;  3HTS B;  2XKO A;  5D5V B;  2GWR A;  1C0W A;  2EV0 A;  2J5P A;  2PQ8 A;  2LSO A;  2ZFW A;  3I71 A;  2FOK A;  2DW4 A;  3HRS A;  5E8I A;  4DNC A;  1QZY A;  1GHC A;  2O3F A;  2ADU A;  5A2Q Z;  1Y0U A;  3ELK A;  2EB7 A;  1WQ2 A;  3F3X A;  3HRT A;  1XSV A;  1R00 A;  1IN4 A;  3FWE A;  4KMU X;  1F5T A;  1SFE A;  4IRH A;  2RQP A;  1QGP A;  1ZG1 A;  1W7P D;  2CW0 F;  5BPD A;  1FOK A;  1QBJ A;  2MH9 A;  1KU9 A;  1ZLJ A;  1ZYR F;  1W4M A;  2VXZ A;  1LDJ A;  1IZ1 A;  3JSO A;  4UVB A;  2PMU A;  2O03 A;  2V6C A;  1X3U A;  3N4M A;  3RPU A;  1SD6 A;  1R5G A;  1MJ9 A;  4L5J A;  1D8K A;  1Z6R A;  3GFM A;  3WTV C;  1ZGA A;  2OZ6 A;  1R22 A;  3JW4 A;  3I5U A;  2DTR A;  5L3D A;  2UZK A;  2L3D A;  4PDK A;  3RKW A;  2QZ8 A;  4LMY A;  3S2W A;  2OQG A;  1G3Y A;  3GFJ A;  3GYH X;  5ICC A;  4LGW A;  5LHG A;  1HXD A;  3GWZ A;  1ZHF A;  3RYR A;  3MZY A;  1U78 A;  1KU3 A;  4BYY A;  1T0F A;  2L02 A;  3DF8 A;  5E17 F;  1YS6 A;  4EM0 B;  1Q1H A;  3WTZ A;  2VBX A;  3KP6 A;  1B1B A;  1H9G A;  4N9H A;  1EH7 A;  1T39 A;  1FP2 A;  3QOP A;  2DBB A;  2FE3 A;  2FBI A;  4IHT A;  4MTD A;  3R0A A;  4HQM A;  1MD0 A;  4BH9 A;  1FP1 D;  3MAJ A;  3JAM K;  4AIK A;  4JK1 X;  2F5F A;  1R23 A;  1ZN2 A;  5F1R A;  4I0B A;  2W85 A;  2Z9O A;  1CGP A;  4RS8 A;  3GO5 A;  4Y13 A;  1H0M A;  1DUX C;  1XGN A;  3OV8 A;  1MZB A;  3JSP A;  2MH2 A;  3DPT A;  1BI3 A;  3I54 A;  1H9T A;  5DD4 A;  2P4W A;  3ZMS A;  3R60 A;  3I64 A;  5HDG A;  3K69 A;  4ETS A;  4WXD A;  4OIN F;  1JXS A;  5BS6 A;  1J9I A;  4WXC A;  2WWY A;  2OD5 A;  5L3C A;  1MJA A;  3MQ0 A;  4AIJ A;  4XLN F;  5LRS A;  1YTY A;  2KJB A;  2YX7 A;  4EM1 A;  1BC8 C;  1S7O A;  3HSE A;  2DQR A;  1BBY A;  1LB2 A;  1LQ1 A;  5BMZ A;  2EA4 A;  1KA8 A;  3FM3 A;  5CLS A;  1FYM A;  4HF1 A;  1HW5 A;  2IP2 A;  3TKY A;  1WI9 A;  4TV7 A;  4ENK A;  3IWF A;  4M71 A;  1XN7 A;  4NB5 A;  4OU0 A;  2OQR A;  4ASN A;  2IT0 A;  1DPR A;  3WGI A;  4A6D A;  1TNT A;  5D4R A;  4LLN A;  2PBI A;  2HZT A;  1FT9 A;  1S29 A;  2ZME A;  3HHH A;  3LA3 A;  4HDV A;  1KYZ A;  1I1G A;  4GXO A;  2FXA A;  3GEZ A;  1B59 A;  3QPH A;  2BV6 A;  3KFW X;  2CQK A;  4EV0 A;  4D0P A;  3Q5F A;  1PP8 F;  5DYM A;  2EFW A;  5JVT A;  1IXR C;  3PQK A;  2PMH A;  3ERE D;  2PFB A;  1BI0 A;  3CJN A;  5LEJ A;  4ESJ A;  4CDG A;  2K86 A;  4PZJ A;  2QUF A;  4KN7 X;  5IT3 A;  3F72 A;  3BOQ A;  2GA1 A;  5F64 A;  3Q9V A;  2X4H A;  3C1D A;  4A0Z A;  4PGH A;  5AIP A;  3BRO A;  5J6X A;  4L0Y B;  3WTS C;  2Z3Y A;  2ZNZ A;  2RC4 A;  4HLY A;  2ISY A;  2HYG D;  2QQ9 A;  2D2W A;  4EGY A;  1STZ A;  3LAJ A;  5CJ9 A;  5L3B A;  3WTT C;  3P9C A;  3RTR A;  1FBS A;  2YX4 A;  5DEQ A;  1VTN C;  3EYY A;  3ZMD A;  2G7H A;  2IJL A;  4M74 A;  2Z5U A;  3ECO A;  4UXN A;  4AWX B;  4UHT A;  3T1B A;  1YYV A;  1IF1 A;  2NAZ A;  5K5Q A;  5TJJ A;  4ZYH A;  1IRG A;  3FMR A;  3B02 A;  2OU2 A;  1UST A;  5A2Q K;  2ACJ A;  1RZ4 A;  1P4W A;  2R3S A;  4LK1 F;  3SHF A;  4IJA A;  5EEH A;  5KVR A;  4P9F A;  1ZRC A;  5FD6 A;  4M72 A;  4IVN A;  1YQA A;  3F22 A;  2VE9 A;  2MA3 A;  4RB3 C;  1BI2 A;  3GZ5 A;  2STT A;  4QLC U;  2E1C A;  2EFQ A;  3P7N A;  1U5T C;  4OIO F;  3CUQ A;  4HA8 A;  2P5V A;  3O3K A;  1WKM A;  1TNS A;  5ICG A;  5ILU A;  2XRN A;  2OAZ A;  2LKP A;  2RV8 A;  2QM3 A;  3EDP A;  4BNC A;  1YIO A;  3CDH A;  1R36 A;  2CFX A;  4I7H A;  3F8B A;  2ZJ2 A;  1R1T A;  5JHU A;  1ZG3 A;  4LLG F;  2JZY A;  4AD9 A;  4ON0 A;  3QAH A;  1B6A A;  3BPX A;  4I0A A;  4HYE A;  4EMS A;  3BJA A;  1W7P A;  5LGU A;  4WK8 F;  2VOP A;  4MEX F;  3GVA A;  5DV5 A;  3R4K A;  5FFZ A;  2L4A A;  4L9J A;  1BIB A;  2A6H F;  2BGC A;  4AVP A;  2L4M A;  3ABU A;  4A0Y A;  2L54 A;  1ZGJ A;  2KIU A;  2ZME B;  2K4J A;  1E17 A;  2Y0M A;  1XB4 A;  1JHH A;  2FBK A;  3VFZ A;  3FZV A;  2PLY A;  4RB1 A;  4EJW A;  3DQV C;  4ZZL A;  3F8C A;  1FBU A;  2HQR A;  1IN6 A;  2VOD A;  3I0T A;  2O6G E;  3AAF A;  1GXQ A;  3KET A;  3E97 A;  1MDM A;  1YG2 A;  5IT9 Z;  1XSD A;  2FBH A;  2KKO A;  4F7Z A;  2GQQ A;  2A3S A;  3O6B B;  4MEY F;  1S6L A;  3HHG A;  1V4R A;  2IA2 A;  2HEO A;  2RGV A;  1ON1 A;  2RVC A;  4HAM A;  3LST A;  3BP8 A;  1S8N A;  4L0Z B;  3FXR A;  5FB2 A;  3CUQ B;  4UVA A;  3QP6 A;  1CF7 B;  2W25 A;  4XRF A;  2H6C A;  2FEZ A;  3DXJ F;  2OBP A;  1G3T A;  3G73 A;  1TQP A;  2ESH A;  3VB2 A;  2CYY A;  1Z05 A;  2VOO A;  1WWX A;  1O3S A;  4KUM A;  2STW A;  4YFX F;  5JFR A;  3IL2 A;  1QPM A;  1IN5 A;  4HV6 A;  3HTU A;  1FNN A;  3SXY A;  2JT1 A;  3HSF A;  4HX8 A;  2GZW A;  1T6S A;  2MLK A;  4ESB A;  1W5T A;  4Q48 A;  3IHU A;  3GW2 A;  4KA4 A;  2D1H A;  1Z7U A;  1OMI A;  4O6J A;  2XAJ A;  3CUO A;  2HGC A;  2M45 A;  1G3W A;  3WTU C;  3ZPL A;  2ELH A;  4LJZ F;  3RJP A;  1HQC A;  2HTJ A;  5D4S A;  4M9S A;  2RNJ A;  2ESN A;  2NS0 A;  5HVQ C;  2GA2 A;  4G6Q A;  1XDU A;  2XAQ A;  4M9Z A;  3RDI A;  4EJV A;  5HOO A;  3EYI A;  5L3F A;  3H3U A;  3CLO A;  3DPL C;  4I98 B;  2XHK A;  4M9X A;  5E1W A;  2P6S A;  3HOS A;  2G7U A;  4UUV A;  2UXX A;  3JTG A;  2W57 A;  4ZYE A;  4LFU A;  4M73 A;  1O3T A;  2LF8 A;  3F8N A;  4B8X A;  3HYI A;  2FSW A;  2DK5 A;  2P6T A;  1UFM A;  5BQT A;  3HRM A;  5DCM B;  4CO8 A;  1LJ9 A;  4O5V A;  5ICF A;  1IXC A; 
#chains in the Genus database with same CATH topology
 5FKN A;  2OV7 A;  2D45 A;  1YJW I;  2FF4 A;  3J81 K;  3M07 A;  4NQW B;  3JAM Z;  2L0K A;  5HNF A;  4FIS A;  1I5Z A;  3M9A A;  2Y9Z A;  1H89 C;  1ZAO A;  3OY9 A;  5EZG A;  5HLI A;  4XIC A;  3BWG A;  4HST A;  3KPH A;  4XLP F;  2V1N A;  1Z0X A;  2E1N A;  2XV4 S;  3PM1 A;  3U9G A;  1T8I A;  4RAF A;  3F9K A;  4PSW A;  1D5Y A;  2RDP A;  2XGD A;  1WRJ A;  4B09 A;  2NVQ J;  2X51 A;  5HLG A;  4O3M A;  1LVK A;  2LVS A;  2VT2 A;  5B1B H;  3BY6 A;  3ZN1 A;  3KZZ A;  3BR2 A;  3B73 A;  3P9K A;  1XGO A;  1AU7 A;  1I50 J;  2WA0 A;  2VBW A;  3LA7 A;  1KU2 A;  2VJI A;  1OYW A;  2IA1 A;  2HDW A;  4HV5 A;  4PFO A;  5TIS C;  1FMV A;  1AA7 A;  4F3Q A;  4LB5 A;  1EF4 A;  4YRV A;  2JMW A;  1LPQ A;  3ECH A;  4MGR A;  2CS3 A;  4A3L J;  1ZAR A;  3DKW A;  4HOB A;  4R1H A;  2Y30 A;  1SD4 A;  2Q2E A;  3FXK A;  1Y1W J;  1Z91 A;  2HZD A;  2LBF B;  3ZP5 A;  2DJI A;  3DWL E;  1ZTR A;  2ECB A;  2A05 A;  5GAD J;  2A6E F;  3CJQ B;  4NQW A;  4XLH A;  1S72 I;  3ZMZ A;  4EGZ A;  3T8R A;  2LFB A;  2UXN A;  1N77 A;  4A3G J;  2FQ4 A;  1B8I A;  2HFH A;  1JE8 A;  1S5L C;  1XTA A;  1MDM B;  5EF6 A;  2CQ7 A;  2XAF A;  2V6E A;  3M1E A;  3FMS A;  4UUT A;  3H92 A;  2KMU A;  5HLT A;  2FRH A;  3JRF A;  3ZGK A;  1HKS A;  3RQI A;  3QOD A;  1WJB A;  1Z1D A;  3CO6 C;  3WOD F;  2EJR A;  2PJR B;  3PFI A;  3TOA A;  4E70 A;  3PFY A;  4RGR A;  5H2F C;  2XF7 A;  5D5X B;  1E2X A;  2XKP A;  3CO7 C;  2KDO A;  5FD5 A;  3RI4 A;  2HPM A;  3ZMV A;  3JRE A;  3K9T A;  5EG0 B;  1KQ8 A;  1R4M B;  4WXH A;  2ID3 A;  3BZK A;  2CWE A;  1JT0 A;  3K70 D;  1JKO C;  4HRI A;  1XG1 A;  4I76 A;  2IA0 A;  2EV5 A;  4A3E J;  5HS9 A;  2X1D A;  1WFX A;  1J0R A;  2DOF A;  5LHH A;  3BR0 A;  2PEX A;  2RNG A;  3FMQ A;  2YS9 A;  3HKZ A;  4UVC A;  5GP9 A;  4G7O F;  2K27 A;  3I58 A;  1BL0 A;  3B6A A;  3RQ4 A;  4DBR A;  4RAY A;  3WU2 C;  1PJR A;  2W24 A;  1O3Q A;  3NWS A;  1KZH A;  2O8X A;  5DUI A;  4BHC A;  1L3L A;  1JJ8 C;  4B43 A;  1DP7 P;  1WJ5 A;  3O8G A;  2CGP A;  4M6Y A;  4L9V A;  2LNB A;  3EPZ A;  4ESF A;  3PIP F;  1G4D A;  1N75 A;  4BGD A;  4GYI A;  3W6J B;  2ICW G;  2PG4 A;  3BG3 A;  1EKE A;  1UCR A;  2VQG A;  2E36 A;  4HX7 A;  1MNE A;  3K70 C;  1PUF A;  4CYD A;  2V9K A;  2WC2 A;  1EV7 A;  2P7C B;  3L2W A;  5E8G A;  2D5V A;  3U2R A;  1DPU A;  3MFK A;  2MD5 A;  5GAE J;  2KHM A;  1ODD A;  2FML A;  2WB1 A;  2LY1 A;  5M5X J;  3TED A;  5LD2 C;  4GGG A;  2UV1 A;  1JKR C;  4BXU A;  3JRG A;  3GFI A;  1A6Q A;  2F48 A;  3EET A;  1TBX A;  5HS7 A;  2XF6 A;  4IXA A;  4CUG A;  4BE2 A;  4QWQ A;  2ISZ A;  3J80 Z;  3I3L A;  2MLG A;  1AOY A;  5AON A;  1R6R A;  1DDN A;  3H5N A;  1SC7 A;  5DCF A;  3SFI A;  4JBA A;  1FSE A;  4KN4 X;  3DLL F;  3QYB A;  2VN2 A;  2BHZ A;  3I59 A;  2GOM A;  3K4B A;  2ZME C;  1ULY A;  3ROU A;  1YHQ I;  4B3X A;  1RES A;  1P4A A;  3H9J A;  3KEO A;  1E3P A;  1D5V A;  5L3G A;  1QPI A;  2NVX J;  3Q0V A;  2M87 A;  3ONQ A;  3L2Q A;  5EYR A;  3S2D J;  4BDZ A;  2P81 A;  2EK5 A;  3NQO A;  4XRM A;  1TWF J;  3H9Q A;  2OJE D;  3SZT A;  4KNY A;  2ID6 A;  5E3N A;  2XUB A;  4PJL A;  4I01 A;  1MNM C;  1I3Q J;  3HOV J;  4C30 A;  3PSF A;  2EWN A;  3M3Y J;  5E20 A;  3KEY A;  3LQQ A;  3WTX C;  4HW0 A;  3ZCO A;  1XMK A;  5LGT A;  3I56 I;  2H8R A;  1HSJ A;  2Y9Y A;  2DA5 A;  1FX7 A;  1TWH J;  4FX0 A;  1SAX A;  1G3S A;  5K1Y A;  2CRG A;  1YIJ I;  4A2U A;  1AKH A;  2DPD A;  1R58 A;  1ZH5 A;  2NVT J;  3RYP A;  3HOT A;  4ZC3 A;  4IHY A;  5DDG A;  4KMF A;  4BJ6 C;  2AO9 A;  4R79 A;  1A31 A;  4UB8 C;  5F0F A;  1TQM A;  4XKB A;  4AID A;  1R49 A;  1DU6 A;  5FRM A;  2DLL A;  4BKX A;  3JRI A;  1UMQ A;  4K2E A;  4DZJ A;  3BR5 A;  3AG2 H;  4WCG A;  3QQA A;  4DW6 A;  1MW7 A;  2EV6 A;  1BN5 A;  2FX0 A;  2V1X A;  4W97 A;  2E1M C;  2W82 A;  5J40 A;  1ZGW A;  3VOE A;  4CXF A;  1DU0 A;  3Q3S A;  3DEE A;  3OOP A;  5D8K B;  3ZQL A;  1HDP A;  3LSG A;  5IOY A;  3OYE A;  5JVG F;  1LDD A;  4CSW A;  1RC9 A;  4Z2Y A;  1IC8 A;  2JA8 J;  3FM5 A;  2QGU A;  3R6S A;  4E7I A;  1XCB A;  3CDI A;  4RLF A;  4ITV A;  4BQN A;  4N4N B;  1VFC A;  1JKQ C;  4FQG A;  1ZRD A;  2V26 A;  4BUP A;  1AWC A;  1YJ9 I;  4H4K C;  3S3O A;  2XVC A;  3MWM A;  3D0S A;  2MGQ A;  3PL8 A;  3C18 A;  2NS8 A;  2DA6 A;  1V55 H;  1W0T A;  3K7A J;  1KQ9 A;  3ZQG A;  3KLN A;  2DT5 A;  2NNY A;  2HPI A;  1KQ0 A;  1BI1 A;  1B8I B;  4OMY A;  5FFX A;  2JSC A;  2Q1Z B;  3ZOB A;  1MGT A;  1T56 A;  2WBM A;  5F6F A;  4LG0 B;  3FHZ A;  2DFH A;  3OYD A;  2DTZ A;  1GVJ A;  2ELJ A;  2KRH A;  3ASO H;  3FF5 A;  3QPL A;  5GTI C;  4U0W A;  1SD7 A;  1SFU A;  2DO7 A;  3QP5 A;  3S16 J;  1X19 A;  3U21 A;  1X3Z B;  3PUF A;  1U6G A;  3AG4 H;  1UHW A;  2LYC A;  5LLQ A;  3J81 Z;  2QA4 I;  3KLO A;  3LL7 A;  2CV2 A;  1S7A A;  2QEN A;  1MIJ A;  1OYY A;  1OFC X;  2XAH A;  1IN7 A;  3KZY A;  3GTO J;  4B3A A;  4C3H J;  4C2T A;  2K5C A;  4Y17 A;  2DA4 A;  3WGH A;  5HNH A;  4A3C J;  2ZNY A;  3MZH A;  3KP3 A;  1GV2 A;  1XGS A;  4A5M A;  5EDN A;  2A5Y B;  5ILS A;  3OR2 C;  4JQF A;  1JTX A;  1U5T A;  2Y0S A;  3WHC A;  1O4X A;  3CUQ C;  4E7H A;  1W0U A;  2E5N A;  1FZP B;  1ZRE A;  3E6B A;  3V42 A;  4RB0 A;  4C2M J;  1MMD A;  2DYS H;  2LK2 A;  4V2F A;  4AM3 A;  3M7G A;  1OR7 A;  4A6E A;  2GIV A;  2QWW A;  4XMY A;  3FXQ A;  4BY7 J;  1HC8 A;  3HPH A;  1DQU A;  2ZJQ F;  1W7P B;  5H6R A;  3H3Z A;  1RNL A;  2BXZ A;  4DOZ A;  1KON A;  1SFX A;  1OYI A;  2IEK A;  1BOB A;  2L5Q A;  3L09 A;  2VC0 A;  1HW2 A;  4KYW A;  2KZV A;  3FXM A;  4PFP A;  3OYJ A;  4A0X A;  1ETQ A;  4I99 C;  4XBF A;  3K1P A;  3IKT A;  4YEJ A;  3S1Q J;  4HDU A;  4PUS A;  1O57 A;  1TTY A;  1XPX A;  1FOW A;  1YRN B;  2GAU A;  2YR2 A;  1BM9 A;  2DT6 A;  3E5U A;  3GTP J;  4LK0 F;  2IRF G;  4DZP A;  3AG1 H;  1DGW Y;  1KGS A;  1P9Q C;  3VYR B;  4FX4 A;  1UHM A;  4UV9 A;  3QPS A;  3TOB A;  2W48 A;  4I2O A;  3ZMU A;  2HDD A;  2HDC A;  4EJO A;  2ELK A;  4OWR B;  4P5O A;  1YFH A;  4EQQ A;  3BTC A;  3BJO A;  5FO5 A;  4G6D A;  1A35 A;  1J2X A;  1LNW A;  5ICE A;  3BTL A;  4WF2 A;  1Z67 A;  3BJ6 A;  2GXB A;  3G1O A;  3GZ6 A;  4CZC A;  1IRF A;  3PO2 J;  2EFP A;  2W7N A;  1IRZ A;  1S7E A;  2DPU A;  1Z6T A;  2J5O A;  4W1U A;  2HOE A;  2F4I A;  4OIP F;  1T08 B;  1RRJ A;  2BE5 F;  4MQV A;  2NNN A;  3GME A;  5CQE A;  3RKX A;  1OCO H;  2IBD A;  2HYJ A;  5KHD A;  3CCS I;  1J7K A;  3KP4 A;  2PI0 A;  4RM3 A;  5M5W J;  1DP3 A;  1ENH A;  2JJ7 A;  1V5F A;  2XRO A;  2FU4 A;  3KEQ A;  4RGU A;  2KIF A;  2I10 A;  2KLO A;  3QRF F;  2XDV A;  2FQ3 A;  3QPT A;  2VQC A;  4Y52 J;  3PO3 J;  2P8T A;  3ZMT A;  2Y48 A;  4B47 A;  2DA2 A;  3SZP A;  3F6O A;  4BHB A;  4UNO A;  3SEZ A;  3AL0 B;  3E1S A;  2QSH X;  3BDD A;  4PJN A;  2QQ8 A;  1TW2 A;  2PJP A;  2LLK A;  1IXS B;  2NOJ B;  3IC7 A;  1LFP A;  1ONV A;  1LKX A;  1HKQ A;  3ZN0 A;  1A5J A;  4EM2 A;  2RKH A;  1XDS A;  3HL2 A;  1VQN I;  4MFD A;  1X4O A;  5D8L B;  5LEK A;  2NVY J;  3NWT A;  2MAB A;  4Q4Z F;  3CC4 I;  3X2Q H;  4U7B A;  4S05 A;  4FTH A;  1FBQ A;  1UAA A;  3OYK A;  4NHJ A;  1WH7 A;  1EH6 A;  3QWL A;  5KAI C;  2DMU A;  3MVP A;  4M3G A;  4XL9 A;  2HOS A;  5LRR A;  4AIH A;  3W3C A;  3DLA A;  1T98 A;  3ZQI A;  1OR7 C;  3KCC A;  4CGZ A;  1SEU A;  2F5C A;  4KDP A;  3OIO A;  3TDZ C;  3H5R A;  4G9Y A;  1GT0 C;  3V7S A;  3VEP A;  3WTW C;  2E5Z A;  3K0L A;  1T2K A;  3PUB A;  4OMZ A;  1RR8 C;  1J5Y A;  2R92 J;  1G8X A;  4IHS A;  2VKD A;  4XSZ F;  3C2B A;  4L9N A;  3GUD A;  5J4V A;  4A12 A;  3OS0 A;  1ZG5 A;  2VT3 A;  2XAG A;  1JUM A;  2CUZ A;  3A02 A;  5JLX A;  2P7V B;  2VE8 A;  5KNL A;  3J7A Y;  3LNQ A;  3BTJ A;  2LP0 A;  4JX5 A;  2C6Y A;  1UHS A;  3KP5 A;  3E6D A;  2ZCW A;  1PUE E;  1VI0 A;  4A3F J;  2AHQ A;  3P5J A;  1R7J A;  1V3F A;  3FXU A;  3IKV A;  5LFA A;  2HU9 A;  1QHG A;  2ECC A;  3WHB A;  3DKX A;  1I27 A;  5E18 F;  4OIQ F;  1BJA A;  4D7N A;  1MKM A;  1HST A;  2E1M B;  3FKJ A;  2KRF A;  1OKR A;  1RUO A;  9ANT A;  2CUE A;  1HKT A;  3VPR A;  4MTE A;  1SFO J;  4BXX J;  2HKO A;  4U0Y A;  3GF2 A;  1U3E M;  2XGX A;  2CQN A;  2K02 A;  2ZSI B;  2IW5 A;  4XNF A;  5DM6 F;  3C7J A;  2CSO A;  1JHF A;  2DOD A;  1JUP A;  1D0Y A;  1VND A;  2IVM A;  2RRE A;  3TO7 A;  4D1Q A;  4P9U A;  2GM4 A;  2Q0O A;  3H36 A;  5H20 A;  5GPA A;  5J8F A;  3QU3 A;  3ZQF A;  4XKC A;  1BA5 A;  1XMA A;  3V8J A;  4I6Z A;  3K2Z A;  4E7J A;  3JTH A;  1VQL I;  3VOD A;  3HOU J;  1LFB A;  3HRU A;  4OAY A;  3W6K B;  3ML6 A;  5HDN A;  4BY1 J;  1FC3 A;  2JUC A;  4HG2 A;  4XM3 A;  2FNP A;  3GTQ J;  2QQA A;  2K85 A;  2VBY A;  3DEU A;  1YW8 A;  4ZH4 F;  1VZ0 A;  2M7B A;  3BR1 A;  2LMD A;  4ABZ A;  2X6O A;  1RUN A;  1O7L A;  4HNT A;  3MD2 A;  2XF5 A;  3FXL A;  4IF4 A;  2V1U A;  2XIG A;  3Q0W A;  5FGM A;  1TW3 A;  4AUX A;  5FLX Z;  4G7Z F;  2JTV A;  2RAE A;  4LB6 B;  1MSE C;  3M8F A;  2VJJ A;  3F8F A;  4N9I A;  1F36 A;  5K7F A;  2O61 A;  5CVV A;  3LOC A;  4XLC A;  2H09 A;  3HM5 A;  5HDK A;  3KE2 A;  4IRI A;  1IGN A;  2Z99 A;  4DQ2 A;  1ERD A;  5HS8 A;  1LVA A;  3S1M J;  1TT5 B;  3F0C A;  4Z6Y A;  5ED4 A;  5BOX A;  1JGS A;  3LSJ A;  4Y15 A;  1V54 H;  3V8L A;  1GXP A;  2KQR A;  1A36 A;  1IDZ A;  2OUM A;  2NXN B;  2VXD A;  1EJ9 A;  2KZG A;  2BY2 A;  3TGN A;  3SJM A;  2GBY A;  3BCB A;  1K79 A;  2QQB A;  2DA7 A;  2M30 A;  4XN3 A;  1P2F A;  2DA1 A;  4G7H F;  3C3W A;  2P0W A;  1F9N A;  3KP2 A;  2CO5 A;  2O5R A;  4Y33 A;  2WAQ N;  4BQA A;  2HI3 A;  3FK6 A;  3S2H J;  4M6X A;  1U2W A;  1AHD P;  5L3E A;  3ISP A;  5DCM A;  1HDD C;  4Q47 A;  1FTZ A;  1Y8Q B;  2R7F A;  4OOI A;  1EA3 A;  1X58 A;  2BBY A;  3CLQ A;  2R7T A;  4BAC A;  5FLM J;  1XSX A;  2MG4 A;  4WX9 A;  2DOA A;  2VUM J;  2JVH A;  3ABK H;  4NC8 A;  1YW9 A;  4U88 A;  5CVJ A;  3CMA I;  4FT8 A;  5IT9 K;  1F4K A;  1IUF A;  2K7L A;  3F21 A;  5J3L A;  3HOW J;  3LSR A;  2NRA C;  2ME6 A;  5IP9 J;  2R7V A;  4YEL A;  2QSF X;  3EQL F;  1Y56 A;  4PCQ A;  1PYV A;  2YUS A;  5CVU A;  4ENM A;  2X85 A;  3OYA A;  1VQK I;  2Y0S N;  5H6Q A;  2Z2S B;  3BPV A;  2PJR A;  3M8E A;  2HQN A;  3OOU A;  5BNG A;  2R7R A;  1FWZ A;  1OCP A;  5EJC A;  1LEA A;  4YFN F;  1OCC H;  4F92 B;  3D5L A;  3GLL A;  3F6V A;  4ENN A;  2EFN A;  3FHN A;  2L9R A;  2E60 A;  4HZF A;  3A1Y A;  3QYF A;  2F4M B;  3WGG A;  1MH3 A;  5CVI A;  1GUU A;  3A4C A;  3IWZ A;  5K7H A;  4B48 A;  1OQY A;  1FYL A;  2F5D A;  2GXG A;  3F8M A;  3ULQ B;  1JJ6 C;  3R61 A;  1E3H A;  5IYC J;  1BC7 C;  3O8H A;  1B4A A;  1ZRF A;  2KT0 A;  1ETK A;  2QEX I;  2R7Q A;  1FY7 A;  1Z9C A;  3GFL A;  3K4K A;  2LBF A;  3E5X A;  3O2P E;  5M3F J;  1O3R A;  1VQ8 I;  1M1E B;  2EA2 A;  4ZYD A;  3J7A O;  4DYQ A;  2XPU A;  2OC6 A;  1WGX A;  1QNT A;  3BT9 A;  2HVR A;  4LIV A;  1VF9 A;  5D6E A;  4CHU A;  3CD6 I;  4LIT A;  2NYX A;  2ZFU A;  4Q5S F;  1WJD A;  1K7A A;  4JX4 A;  5FLX K;  1ZLK A;  1I6X A;  4GCV A;  1K4S A;  1MBJ A;  1IW7 F;  2DN0 A;  3OIQ A;  3EUH A;  4DIQ A;  2WY8 Q;  3SYT A;  2FJ1 A;  1X1B A;  4IRG A;  1G6N A;  3T8T A;  1ON2 A;  1K61 A;  2JPB A;  3RKQ A;  5C4J J;  2G0E A;  3L1P A;  4RGS A;  3GBG A;  2W84 A;  5D5U B;  4OAZ A;  1Q1V A;  3FXJ A;  3ZXS A;  2A61 A;  2QKL B;  1QRY A;  2F2E A;  3E5Q A;  1OJL A;  3N05 A;  3CJR B;  2D1V A;  3TO9 A;  5M3M J;  1D1C A;  4PJJ A;  4FCY A;  2VLA A;  1R4N B;  4N4O B;  3JRA A;  1TLH B;  2QBY A;  2COM A;  4MQ9 F;  1UJ8 A;  2A68 F;  3ZQC A;  2HTS A;  4A3D J;  3RPQ A;  3H9G A;  3BG7 A;  4P96 A;  3WU0 A;  3DBR B;  3G71 I;  3DCF A;  4E7Z A;  3RCO A;  3TBI A;  5J8C A;  3H0D A;  3ABT A;  1XD7 A;  2CV1 A;  1QZZ A;  1D1B A;  4JYK A;  5FJ8 J;  1SMY F;  1ZEL A;  5K5R A;  3E6M A;  1PP7 U;  4BQO A;  2H1K A;  3PNT A;  3WE3 A;  3RKY A;  3F23 A;  1X2M A;  3MZ8 A;  2M1B A;  4YII A;  5TRD A;  3MKL A;  1YO5 C;  3MEX A;  3I4P A;  4BQQ A;  3I4M J;  3VDX A;  1YLF A;  4IL6 C;  3QU6 A;  1SFK A;  2WB1 N;  2BW3 B;  1WJE A;  2LDU A;  1QO0 D;  2HR3 A;  2JA7 J;  2X0L A;  3CMM A;  3ZQ7 A;  3HIF A;  4BS9 A;  3WTY C;  2Y31 A;  3L7W A;  4GYG A;  5BPI A;  4RMN A;  3T5X A;  3TO6 A;  1QHH D;  2HKX A;  1UEL B;  4HX4 A;  1Z77 A;  2E7X A;  1PDN C;  1R5I D;  2B0L A;  2BHY A;  1BR4 A;  4HQE A;  2HWV A;  3UNG C;  4EJU A;  2X1C A;  3CTA A;  1IUY A;  3ZRG A;  1G59 A;  3GX4 X;  3S15 J;  1B9N A;  3DBH B;  3BG9 A;  5E1X A;  1LDK B;  2QYO A;  3W6V A;  2M0M A;  2YPR A;  4CCO A;  3IH2 A;  4KIG A;  3CCU I;  2YU3 A;  5B1A H;  2VQL A;  4XON A;  1MJB A;  3FX3 A;  2QKM B;  2FMY A;  4N0B A;  2HYF A;  1A6I A;  4G94 A;  2NVU B;  1T38 A;  4CYC B;  1Z3X A;  2VIX A;  4IX7 A;  5GAG J;  2LH9 A;  2K3F A;  4H0E A;  3COA C;  3E3V A;  1X1P A;  1IAW A;  1RIO H;  1J09 A;  1QQI A;  4BAY A;  4LG0 A;  1IJW C;  2A07 F;  1R1U A;  2HQA A;  4XLF A;  3OYN A;  1QA6 A;  1D8J A;  4CZZ A;  5FRN A;  2W1O A;  2YSR A;  3CDL A;  1U8R A;  1PUF B;  3FBN B;  3V8K A;  2E2H J;  3V4G A;  1Y0N A;  5JHF A;  3L2R A;  4BDY A;  5LBQ A;  2KRC A;  3J80 K;  2DA3 A;  3S93 A;  4NDL A;  4UUS A;  4YIF A;  2JA6 J;  2CUF A;  3NEU A;  1T0F C;  3CME I;  2M5W A;  2KJC A;  4RAZ A;  1RKT A;  1HBX G;  2CG4 A;  2OA4 A;  2PN6 A;  4FET A;  2DQL A;  2M4K A;  4HEA 2;  4EVI A;  2F5E A;  2QF7 A;  3U1D A;  3CMY A;  5DD8 A;  3JCU C;  2LF7 A;  5EGO A;  2V4J C;  3K6G A;  4D5C A;  5DTD A;  1W1W E;  2G9W A;  1FLI A;  4AU7 A;  4PJ0 C;  2MC3 A;  3A01 B;  3Q9S A;  1U0J A;  1J59 A;  2DXI A;  2FA5 A;  2HS5 A;  3C2G A;  3G3Z A;  4WWC A;  1Z21 A;  1B72 A;  2Y75 A;  3ESW B;  2CQX A;  1FIP A;  4ZJZ A;  4ZYG A;  4BEH B;  3V7C A;  3LA2 A;  4BHP A;  3KIO A;  1P4X A;  3ASN H;  4QSH A;  5GPC A;  1KU7 A;  1REP C;  1MMS A;  2JPC A;  1MBK A;  4HLX A;  3V7R A;  3OS2 A;  1K6O A;  2BW3 A;  4KT5 C;  2JRT A;  1NG6 A;  3WE2 A;  5IYD J;  2VJ4 A;  4XLE A;  1BJZ A;  5F0C A;  3BCA A;  1X2N A;  4ZZD A;  2E1O A;  4NBQ A;  1R5H A;  4RAG A;  3OS1 A;  3BZ6 A;  4KIF A;  1JKP C;  3IRQ A;  1VQ4 I;  2RN7 A;  5FLV A;  3HUG A;  5AIQ A;  4L18 B;  2KPM A;  1VQO I;  4RBO A;  2ME0 A;  1TQI A;  5ILV A;  2MFZ A;  3FDY A;  2K9L A;  2M4G A;  2JK3 A;  4S04 A;  1ETX A;  4XOT A;  4IPA A;  2K9S A;  1IV8 A;  3K1N A;  3R0J A;  1CF7 A;  1D1A A;  1UB9 A;  3LFU A;  3C2H A;  1I1S A;  2X9D A;  1XCV A;  3JRC A;  1FSH A;  3OYM A;  1K78 A;  4LLL A;  4I09 A;  5J47 A;  3CCQ I;  2ZXJ A;  1L0O C;  1KYW A;  1W5C C;  4U0V A;  2XSJ C;  4KIB A;  2ZKZ A;  3OYH A;  4A5N A;  3KP7 A;  2R5Z B;  4DBQ A;  1B72 B;  1XGM A;  4F91 B;  2BVM A;  2H94 A;  3CCL I;  1J75 A;  5KK1 A;  3GXO A;  3TDU C;  2AS5 F;  3DEW A;  4FE4 A;  2ZSH B;  4ZTJ A;  1TT0 A;  3I53 A;  1WJA A;  4XSX F;  1WSU A;  1Y39 A;  3KX2 A;  1R1V A;  2M8G X;  1EH8 A;  1P6R A;  1X1A A;  1FYK A;  2XAS A;  3K1M A;  3FIW A;  1LEB A;  3M1C A;  2R5Y B;  3LSP A;  4XRS A;  4I02 A;  4UUS B;  4PSX A;  1TWG J;  4S0H B;  4HF2 A;  4NUB A;  3OL4 A;  4X6A J;  1BIA A;  2X6X A;  3SFZ A;  3LSK A;  2H27 A;  2FNA A;  4X0G A;  2O8K A;  6PAX A;  1F1Z A;  2DMQ A;  1B9M A;  3LQR A;  2B7E A;  3LWF A;  2LKS A;  5LHI A;  1YJN I;  2DFF A;  3IAM 2;  1ZR2 A;  2UWM A;  2K40 A;  4FHT A;  3HSR A;  2H8W A;  1ORK A;  1K78 B;  2WV1 A;  3G2B A;  1P7I A;  2DCE A;  4PK4 A;  2KIM A;  4A93 J;  3WU1 B;  4L9T A;  5HLH A;  2XPV A;  3JRH A;  3E7L A;  2DI3 A;  2W4S A;  3HXL A;  5JI6 A;  2H6B A;  3GLX A;  5E1Z B;  4ZDO A;  2EFO A;  2FD5 A;  5D5W B;  2QLZ A;  1OPC A;  3DFG A;  2BYV E;  3ZQQ A;  5CYV A;  5CKT A;  4MNU A;  1FEX A;  4YG2 F;  2TDX A;  5EEG A;  4YFK F;  2P5K A;  2Z33 A;  1TC3 C;  5B3S H;  2DK8 A;  2M8E A;  3L2C A;  3HUG B;  1WHU A;  2WAQ A;  4AYB A;  5IPA A;  2IPQ X;  3Q0U A;  4HBL A;  4KFC A;  4D7M A;  4G8X A;  1O7F A;  3A03 A;  5E3L A;  3K4M A;  3DU5 A;  3D1N I;  4R8H A;  3TQN A;  2F4O B;  3HJE A;  2OF7 A;  4U7D A;  2QBY B;  2LTP A;  3HOX J;  1LE8 A;  3TP0 A;  2O7O A;  3G4S I;  3REO A;  2XGE A;  4CCK A;  4ZTF A;  3SQN A;  4RGX A;  3CCE I;  1IN8 A;  2V9V A;  1U5T B;  1E0E A;  5HOD A;  2L01 A;  4EJT A;  2WV0 A;  1SMT A;  1A04 A;  2P5L C;  3HC7 A;  1FTT A;  3P9I A;  3NRV A;  2ZBK A;  4IEJ A;  4HSR A;  3TL4 X;  1S3J A;  3DKY A;  1ACI A;  3L9F A;  4ENJ A;  4P55 A;  2WTE A;  3LSM A;  1HW1 A;  1YX5 A;  2K4B A;  4M6V A;  3RIR A;  4UV8 A;  3JR9 A;  2WY7 Q;  1W5S A;  2VKV A;  5M5Y J;  2GIZ A;  3QOE A;  3IV5 A;  2K9M A;  3H5A A;  1YS7 A;  1MBH A;  2IGK A;  2ZXH A;  1E3O C;  1RKW A;  3BZC A;  4ANJ A;  4RB2 C;  4PJM A;  3HKZ N;  3IRR A;  3HPG A;  2DAO A;  2ETH A;  1USS A;  2O0Y A;  5DUK A;  3N97 A;  4F52 A;  2JA5 J;  5LGN A;  1XMX A;  4L5I A;  5ERI A;  5D6F A;  2R0Q C;  1HLV A;  3MCZ A;  1SAN A;  1WI3 A;  2DU9 A;  1RET A;  2ZO4 A;  2BEO A;  1RI7 A;  3PQJ A;  1FPQ A;  5IOZ A;  2QSG X;  4OIR F;  3LAP A;  2DFI A;  1Y1V J;  3DV8 A;  4CCM A;  1MMG A;  2E71 A;  2KIS A;  5GAH J;  2AXL A;  2MBF A;  2V1D A;  3PNV A;  2MC4 A;  2AQF A;  4GO1 A;  4RDU A;  4A3K J;  4M3D A;  5JR3 A;  4CCL A;  3HOZ J;  1IRX A;  3A0B C;  3LFK A;  3OIP A;  3I59 B;  2M34 A;  4LD5 A;  2QVO A;  2EIK H;  1X3W B;  1F43 A;  1SVO A;  2A5W A;  2OPT A;  4HF0 A;  4NC7 A;  4BXF A;  1P92 A;  4XK4 A;  2VON A;  1D3Y A;  3HGG A;  4CIC A;  2M9H A;  5K5O A;  1SD5 A;  2Q8K A;  4MHG A;  4DJA A;  3TMO A;  2HOT A;  2LKX A;  3CF5 F;  5CVR A;  1SAU A;  2VC1 A;  1YE9 A;  2DDB A;  1BOA A;  1JGG A;  1RR7 A;  2E7W A;  2GLO A;  1JUS A;  2MD0 A;  3GTL J;  2Y2Z A;  2VBZ A;  3MN2 A;  2LRD A;  3L00 A;  2A69 F;  2R7D A;  1YW7 A;  4KIC A;  3DP7 A;  3WG9 A;  1MMN A;  3T0Y A;  2V79 A;  2OZU A;  2B9S A;  3CP2 A;  2CQQ A;  2KP6 A;  4PGG A;  3E6C C;  1G2H A;  2DMN A;  1NHA A;  2K9N A;  2ZC2 A;  2R7U A;  3HTS B;  3HG9 A;  3DTK A;  2XKO A;  5D5V B;  2GWR A;  2JRM A;  1C0W A;  2EV0 A;  1H8A C;  3S14 J;  3KYL A;  2J5P A;  2PQ8 A;  2LSO A;  2ZFW A;  3I71 A;  5FKK A;  2FOK A;  4V19 K;  2DW4 A;  3HRS A;  3WG7 H;  5E8I A;  4DNC A;  1QZY A;  3GTK J;  1GHC A;  2O3F A;  2ADU A;  2CU7 A;  5A2Q Z;  1Y0U A;  3ELK A;  1U8B A;  2LOO A;  2V7F A;  2EB7 A;  1U9O A;  1LFU P;  1WQ2 A;  2NOG A;  1X4P A;  3F3X A;  3GCM A;  3H0G J;  3HRT A;  1XSV A;  1R00 A;  2Z1D A;  4RLQ A;  1IN4 A;  1VQ9 I;  3FWE A;  2VPR A;  4KMU X;  3KYD B;  4XOP A;  1F5T A;  1SFE A;  4IRH A;  2RQP A;  5F0H A;  1QGP A;  1UZC A;  2JVG A;  1VQ7 I;  4C2U A;  1ZG1 A;  1W7P D;  4BE1 A;  3FK7 A;  4GRI A;  4IOA F;  4BJT A;  2PMZ N;  4BU2 A;  4A69 C;  1ETY A;  2CW0 F;  3KYC B;  2E2J J;  5BPD A;  2IS1 A;  1FOK A;  1QBJ A;  2MH9 A;  1KU9 A;  1ZLJ A;  3MKW B;  1ZYR F;  2VJ5 A;  1W4M A;  2OTJ I;  1TL8 A;  1XC5 A;  4UB6 C;  1U9N A;  4B4C A;  1BW6 A;  2VXZ A;  1IZ1 A;  1LDJ A;  3JSO A;  2ZXW H;  3HBL A;  2PMU A;  2O03 A;  2V6C A;  2AQE A;  4UVB A;  4ZDP A;  3SZG A;  1X3U A;  1NTC A;  4F93 B;  3N4M A;  3RPU A;  4IO9 F;  3K4J A;  4XRS G;  1VQ5 I;  2MW8 A;  2V9P A;  3J7Y J;  1SD6 A;  1R5G A;  1MJ9 A;  4L5J A;  1D8K A;  1Z6R A;  2E19 A;  4B44 A;  4BEH A;  3GFM A;  3WTV C;  2VKE A;  1ZGA A;  4DYC A;  2QCO A;  2OZ6 A;  1R22 A;  3JW4 A;  3I5U A;  2DTR A;  3VSL A;  1H88 C;  5L3D A;  2PX9 A;  2UZK A;  4YIR X;  2L3D A;  4PDK A;  3RKW A;  2M7A A;  2QZ8 A;  2CFO A;  4LMY A;  3S2W A;  1VQP I;  2OCE A;  3MKZ A;  2OQG A;  1G3Y A;  3TP3 A;  4Y3O A;  3GFJ A;  3GYH X;  4AC0 A;  5ICC A;  4LGW A;  5LHG A;  1HXD A;  3GWZ A;  1ZHF A;  3M4O J;  3RYR A;  1ETW A;  2COB A;  3MZY A;  4QPO A;  4RA2 A;  2DMT A;  4DGW B;  1U78 A;  2Q2E B;  1KU3 A;  1WZ2 A;  4BYY A;  2HVS A;  5CQG A;  1T0F A;  2L02 A;  1N78 A;  4XN0 A;  1SVL A;  3DF8 A;  4KIS A;  3CCR I;  3NAU A;  1NK3 P;  5E17 F;  4BL0 B;  4FE7 A;  2ZXI A;  5F04 A;  1WJC A;  1HF0 A;  1YS6 A;  2R5Z A;  4KT6 A;  4EM0 B;  3K4L A;  1Q1H A;  5TGT A;  1HCR A;  3WTZ A;  1QVT A;  2IGM A;  4KIT B;  4II3 A;  2R7X A;  3D5S C;  2VBX A;  3CCJ I;  3VWB A;  2CJJ A;  1GDT A;  5E79 C;  1N25 A;  3KP6 A;  3DU6 A;  1B1B A;  2EH3 A;  1H9G A;  1LUJ B;  4N9H A;  5EEA A;  1EH7 A;  1T39 A;  1FP2 A;  3MKY B;  3BC8 A;  3QOP A;  2DBB A;  2L9V A;  2FE3 A;  2FBI A;  2K3P A;  5GTH C;  1OCR H;  4IHT A;  3NAR A;  3EUH C;  4J00 A;  2OTL I;  1YRN A;  4MTD A;  3R0A A;  4HQM A;  1MD0 A;  4XKV A;  1YI2 I;  2I8D A;  2N8G A;  3BTI A;  1FP1 D;  3MAJ A;  4BH9 A;  3JAM K;  4AIK A;  3UKG A;  4JK1 X;  1TP4 A;  2F5F A;  1R23 A;  1ZN2 A;  4IOC F;  5F1R A;  4I0B A;  3PJR A;  4NC6 A;  2W85 A;  4E7S A;  1MBF A;  4J01 A;  5F27 A;  2BY1 A;  2HVQ A;  1CGP A;  2Z9O A;  4C9Y A;  3GZN B;  4RS8 A;  3TW7 A;  3KZI C;  3OSG A;  2GXA A;  5K7Z A;  3K10 A;  3CCV I;  3GO5 A;  3EUA A;  4BJ5 C;  4Y13 A;  1H0M A;  2LG4 A;  3I4N J;  1DUX C;  3SDG A;  2VAS A;  1XGN A;  3OV8 A;  5FRO A;  1MZB A;  3OR1 C;  2MH2 A;  3JSP A;  3BLY A;  3DPT A;  4IHV A;  1PVE A;  1BI3 A;  4J19 A;  1K6Y A;  3I54 A;  3MMY B;  3GTM J;  2BY0 A;  5C3E J;  1T33 A;  4A3I J;  1H9T A;  2JN6 A;  3W2V A;  5DD4 A;  2P4W A;  3ZMS A;  3R60 A;  3I64 A;  2RQQ A;  1I39 A;  3G1M A;  2TCT A;  3DPU A;  5HDG A;  3K69 A;  4QPQ A;  4ETS A;  4WXD A;  2AXT C;  2VL8 A;  4OIN F;  1JXS A;  5EG0 A;  5BS6 A;  1J9I A;  4XLA A;  1V5E A;  1D0Z A;  4WXC A;  3OYB A;  2XC7 A;  2ZJP F;  2IGN A;  2WWY A;  1RPW A;  2OD5 A;  2YU9 J;  1ETO A;  4X1E A;  5E3O A;  5L3C A;  1MJA A;  3MQ0 A;  4AIJ A;  4JOM A;  1OIS A;  1QU3 A;  4XLN F;  1POG A;  2E35 A;  2L2O A;  5LRS A;  1YTY A;  1YIT I;  1MBE A;  2KJB A;  2R7W A;  2YX7 A;  4EM1 A;  1WVR A;  1S7O A;  1BC8 C;  3HSE A;  2DQR A;  3ZQH A;  1BBY A;  2I5U A;  1T95 A;  1LB2 A;  1LQ1 A;  5BMZ A;  2EA4 A;  1DGR M;  1KA8 A;  5E3M A;  3ZR8 X;  3FM3 A;  2X6W A;  2IS4 A;  2IGO A;  3U1K A;  5CLS A;  2H1L A;  5B66 C;  1FYM A;  4HF1 A;  1HA8 A;  3G6E I;  1CQT A;  2DDA A;  1HW5 A;  2IP2 A;  3TKY A;  1WI9 A;  2L7F P;  3PIO F;  4TV7 A;  4ENK A;  3IWF A;  2EBI A;  4M71 A;  4BE0 A;  1XN7 A;  4NB5 A;  4OU0 A;  4HNU A;  2OQR A;  4ASN A;  2FOW A;  2IT0 A;  1DPR A;  3SDB A;  3WGI A;  2IS2 A;  4A6D A;  1TNT A;  5D4R A;  4LLN A;  2PBI A;  2HZT A;  1FT9 A;  1XS9 A;  1S29 A;  2ZME A;  2R7O A;  3HHH A;  3LA3 A;  4HDV A;  1KYZ A;  1I1G A;  4GXO A;  2FXA A;  1ZK8 A;  2OCC H;  3GEZ A;  1NG7 A;  4LOC A;  3BG5 A;  1UG2 A;  2CUJ A;  1B59 A;  1WJF A;  2BV6 A;  3KFW X;  3QPH A;  2CQK A;  1FOX A;  4EV0 A;  5B5E C;  2L9S A;  2VI6 A;  4D0P A;  3H35 A;  3Q5F A;  2VQH A;  2UUZ A;  5IP7 J;  3AG3 H;  1NH3 A;  2X48 A;  3CC7 I;  1PP8 F;  5DYM A;  2EFW A;  3G1L A;  5FKL A;  4JP0 A;  1IXR C;  5JVT A;  3PQK A;  3DTE A;  2PMH A;  3M8J A;  3ERE D;  4UY8 I;  3FXO A;  5C44 J;  2PFB A;  1BI0 A;  2LC2 A;  1OLT A;  3CJN A;  5LEJ A;  4ESJ A;  2NS7 A;  3E0J B;  4E7K A;  4CDG A;  2K86 A;  3DBL B;  4PZJ A;  3OYC A;  3CZ6 A;  2QUF A;  4ZYA A;  4KN7 X;  5IT3 A;  3F72 A;  3BOQ A;  3I55 I;  2GA1 A;  5F64 A;  3Q9V A;  5EZH A;  1YX3 A;  2X4H A;  3C1D A;  2R5Y A;  3K2A A;  3IH3 A;  4GFB A;  2KIQ A;  4A0Z A;  4PGH A;  5AIP A;  3UR3 C;  2E34 A;  3BRO A;  2LY9 A;  1P7J A;  4HNV A;  5J6X A;  4L0Y B;  2Z3Y A;  3WTS C;  4E7L A;  2EPF A;  2ZNZ A;  1NK2 P;  1AKH B;  2RC4 A;  4HLY A;  2CMP A;  4BBR J;  3K4N A;  5CPR B;  2ISY A;  2HYG D;  2QQ9 A;  2D2W A;  4XID A;  5KAF C;  4EGY A;  2IXS A;  1STZ A;  3LAJ A;  5CJ9 A;  2DFE A;  3VYU B;  5L3B A;  3WTT C;  3S8P A;  4FAS D;  3P9C A;  3RTR A;  2KDZ A;  2XRL A;  1FBS A;  5J4Y A;  3A0H C;  1ETV A;  3AFH A;  2DT7 B;  2YX4 A;  5DEQ A;  1TWC J;  1VTN C;  3EYY A;  3RSN A;  2G7H A;  3ZMD A;  2IJL A;  2EQR A;  4M74 A;  2B63 J;  2Z5U A;  1VQM I;  3BQZ A;  3ECO A;  3IP4 B;  2Y69 H;  4UXN A;  4AWX B;  4UHT A;  3T1B A;  1YYV A;  1XX5 A;  3B6C A;  3CC2 I;  1IF1 A;  2WAF A;  2NAZ A;  5K5Q A;  2F6C A;  4AVZ A;  1WCM J;  5TJJ A;  4ZYH A;  1IRG A;  3FMR A;  3B02 A;  2OU2 A;  3CCY A;  1UST A;  5A2Q K;  1FMW A;  1MBG A;  2ACJ A;  1RZ4 A;  1R71 A;  4Y4R A;  1P4W A;  2EIJ H;  4Y7N J;  3IH4 A;  2JUG A;  4MFE A;  2TRT A;  2R3S A;  4LK1 F;  3JRB A;  3CF2 A;  3SEQ A;  3SHF A;  3S3M A;  1IG7 A;  2L7M P;  4IJA A;  5EEH A;  2L9N A;  5KVR A;  1BR2 A;  2L7Z A;  4P9F A;  1ZRC A;  1SVM A;  4MO7 A;  5FD6 A;  3A01 A;  4M72 A;  4IVN A;  1YQA A;  4EAT A;  2JWT A;  2F5V A;  3F22 A;  3GTJ J;  2VE9 A;  2MA3 A;  5F1J A;  4RB3 C;  1BI2 A;  4GDF A;  3GZ5 A;  4NNJ A;  2HXI A;  2STT A;  4QLC U;  4A3M J;  1VQ6 I;  4A3B J;  2E1C A;  2EFQ A;  1ZQ3 P;  1BW5 A;  3BG6 A;  1APL C;  4D9J A;  4HPQ A;  2LR8 A;  3L2V A;  3P7N A;  2LD5 A;  1IV6 A;  3W2A A;  5JLW A;  4E4H A;  1U5T C;  1Z3Y A;  4OIO F;  2BY3 A;  3CUQ A;  4HA8 A;  4E6K G;  2WAE A;  2P5V A;  3O3K A;  2MSY A;  3BQY A;  1UG0 A;  1WKM A;  1TNS A;  3OYI A;  5ICG A;  4ZDL A;  5ILU A;  2XPW A;  2CH0 A;  2XRN A;  2OAZ A;  2LKP A;  2RV8 A;  4CA0 A;  2QM3 A;  3EDP A;  4BNC A;  2IS6 A;  2M2E A;  1YIO A;  3CDH A;  1R36 A;  3CP8 A;  3CJT B;  5KCM A;  3AL0 C;  1MMA A;  2CFX A;  4I7H A;  3F8B A;  4XQF A;  2ZJ2 A;  2R93 J;  3LSI A;  1R1T A;  2FUG 2;  4XR6 A;  1Y8R B;  5JHU A;  1OCZ H;  1ZG3 A;  4LLG F;  4CH7 A;  3K4C A;  3AKZ A;  3I9V 2;  1S9H A;  1MSF C;  2JZY A;  4AD9 A;  4ON0 A;  3QAH A;  1I6H J;  1B6A A;  4CYC A;  3BPX A;  4I0A A;  2R4G A;  4HYE A;  4EMS A;  5FKO A;  3BJA A;  2XAU A;  1W7P A;  3L2U A;  3JRD A;  5LGU A;  4WK8 F;  3LSH A;  2Z16 A;  5DM7 F;  2VOP A;  4C3J J;  3D5R C;  4MEX F;  3GVA A;  4MIM A;  5DV5 A;  4CCJ A;  2ZJR F;  4JX6 A;  3CCM I;  5J1R A;  3R4K A;  5FFZ A;  2L4A A;  4L9J A;  1BIB A;  2A6H F;  2BGC A;  4AVP A;  2HNH A;  2L4M A;  4P1W A;  3ABU A;  4A0Y A;  5J1Y A;  1BR1 A;  2L54 A;  1FOY A;  1ZGJ A;  2XGC A;  2KIU A;  2ZME B;  2K4J A;  3BR3 A;  1E17 A;  2PMZ A;  1XB4 A;  2Y0M A;  3S1N J;  3FIS A;  1JHH A;  3H3V K;  1ITY A;  1K83 J;  1IDY A;  4G6T B;  2BXY A;  2FBK A;  2EZI A;  3OSF A;  3VFZ A;  3FZV A;  2PLY A;  4RB1 A;  4F55 A;  3S1R J;  2JA2 A;  4EJW A;  5IYB J;  3DQV C;  3OMY A;  2EIN H;  3HB9 A;  4ZZL A;  3F8C A;  1FBU A;  4XKW A;  4B1R A;  3H1C A;  1W36 D;  2HXO A;  2HQR A;  1IN6 A;  2VOD A;  3I0T A;  2XB0 X;  4CCN A;  2O6G E;  3AAF A;  4IHW A;  1MND A;  3RPU D;  1GXQ A;  1WH5 A;  3KET A;  4XOR A;  3OYG A;  3E97 A;  1MDM A;  2EZL A;  1YG2 A;  5IT9 Z;  1XSD A;  2FBH A;  3LMM A;  3EUK L;  2KKO A;  4F7Z A;  2GQQ A;  2EIM H;  3OWT A;  3OYF A;  1WPK A;  2A3S A;  2BVL A;  1JTY A;  2DMP A;  3O6B B;  4II2 A;  4MEY F;  2HOA A;  2EZH A;  4RM2 A;  1S6L A;  3HHG A;  4M3F A;  1K4T A;  1V4R A;  1TWA J;  4C3I J;  2IA2 A;  2HEO A;  2RGV A;  1ON1 A;  2RVC A;  1TZL A;  4HAM A;  3LST A;  3PNY A;  3OL3 A;  2XB5 A;  3BP8 A;  1S8N A;  1QZE A;  5IY5 H;  2KL4 A;  2ZB9 A;  4L0Z B;  1GLN A;  3FXR A;  5FB2 A;  2KFD A;  3VSK A;  3CUQ B;  4UVA A;  3QP6 A;  3HEF A;  2XSD C;  2HQ5 A;  4G12 A;  1CF7 B;  2W25 A;  4XRF A;  2H6C A;  2FEZ A;  3DXJ F;  4LIU A;  2OBP A;  1G3T A;  3G73 A;  2MYS A;  1TQP A;  2CW8 A;  1GVD A;  1QVU A;  2ESH A;  3VB2 A;  1Z05 A;  1YOV B;  2CYY A;  2JSP A;  3ABL H;  2EZK A;  4A3J J;  2L7K A;  2VOO A;  5C4X J;  1WWX A;  1O3S A;  4KUM A;  4IHX A;  3CQZ J;  2STW A;  3DTI A;  1ZKG A;  4YFX F;  5JFR A;  4LG3 A;  4QIW N;  5FKM A;  1JI8 A;  2X6Y A;  3IL2 A;  4QTR A;  1QPM A;  1IN5 A;  4D5F A;  3HOY J;  4HV6 A;  2A6T A;  3HTU A;  1HOM A;  1FNN A;  3HZJ A;  3SXY A;  2JT1 A;  3HSF A;  4HX8 A;  2GZW A;  3S3N A;  1T6S A;  2MLK A;  4IKF A;  2CV0 A;  4ESB A;  1W5T A;  4Q48 A;  3FBI B;  4L5E A;  3IHU A;  3GW2 A;  2BOL A;  3FKI J;  4V2G A;  2VB6 A;  3ERM A;  3ABM H;  2M3A A;  1JT6 A;  4KA4 A;  3QYE A;  2D1H A;  1Z7U A;  1OMI A;  2X1E A;  4O6J A;  2O9L A;  3VYS B;  5F08 A;  3CUO A;  2XAJ A;  2CW7 A;  2HGC A;  2M45 A;  3CES A;  1FIA A;  1G3W A;  3BR6 A;  3WTU C;  3ZPL A;  5J1U A;  4DYR A;  2ELH A;  4LJZ F;  2E2I J;  1Z7L A;  1FJL A;  3RJP A;  4EEF G;  1HQC A;  2DOE A;  2HTJ A;  5D4S A;  2M0C A;  4M9S A;  4U87 A;  2RNJ A;  2ESN A;  3IAS 2;  5EGO B;  1X1C A;  2DJN A;  2NS0 A;  2VKH A;  5HVQ C;  2GOX B;  2GA2 A;  4KJZ A;  4G6Q A;  1XDU A;  2XAQ A;  3RZO J;  4M9Z A;  1W36 C;  3HGY A;  3RDI A;  4IQJ A;  4EJV A;  4IQ4 A;  5HOO A;  4M3B A;  3EYI A;  3A2K A;  3IUO A;  2VPL A;  2JQ7 A;  5L3F A;  1OCT C;  3W2W A;  1V5G A;  3H3U A;  1X1D A;  3CLO A;  3DPL C;  1R9T J;  4I98 B;  2XHK A;  4M9X A;  5E1W A;  2P6S A;  5DS9 A;  3HDD A;  3HOS A;  2G7U A;  3RZD J;  4UUV A;  2IAI A;  2UXX A;  2BZT A;  3JTG A;  2W57 A;  1GV5 A;  3S32 A;  4ZYE A;  4LFU A;  4M73 A;  1O3T A;  2LF8 A;  4BBS J;  3F8N A;  3VYT B;  2K9Q A;  4B8X A;  3J7Z I;  1ZR4 A;  3TW6 A;  2DYR H;  3HYI A;  2FSW A;  1MH4 A;  2DK5 A;  2EIL H;  5IP6 A;  4MLO A;  1LE8 B;  4AYB N;  2P6T A;  3S17 J;  1IO2 A;  1UFM A;  5BQT A;  3HRM A;  3OYL A;  4M3E A;  3PSI A;  5DCM B;  4CO8 A;  1I3A A;  1LJ9 A;  3GTG J;  2LY2 A;  1Y6I A;  4O5V A;  2R7S A;  5ICF A;  2WAD A;  4IZZ A;  2R7Z J;  2W00 A;  1D0X A;  1IXC A;  2LRE A; 
#chains in the Genus database with same CATH homology
 2D45 A;  2FF4 A;  3J81 K;  3JAM Z;  1I5Z A;  3M9A A;  1ZAO A;  5HLI A;  3BWG A;  4XLP F;  2E1N A;  2XV4 S;  3U9G A;  2RDP A;  4B09 A;  1WRJ A;  5HLG A;  4O3M A;  2VT2 A;  3BY6 A;  3ZN1 A;  3KZZ A;  3B73 A;  3P9K A;  1XGO A;  2VBW A;  3LA7 A;  1KU2 A;  1OYW A;  2IA1 A;  4HV5 A;  4LB5 A;  3ECH A;  4MGR A;  1ZAR A;  3DKW A;  4R1H A;  4HOB A;  1SD4 A;  2Q2E A;  1Z91 A;  3ZP5 A;  2A6E F;  4NQW A;  3ZMZ A;  4EGZ A;  3T8R A;  2UXN A;  2HFH A;  1JE8 A;  1MDM B;  2XAF A;  3M1E A;  3FMS A;  3H92 A;  2FRH A;  1HKS A;  1Z1D A;  3CO6 C;  3WOD F;  2EJR A;  3PFI A;  3TOA A;  4E70 A;  4RGR A;  5D5X B;  1E2X A;  2XKP A;  3CO7 C;  5FD5 A;  3RI4 A;  3ZMV A;  3K9T A;  1KQ8 A;  4WXH A;  2CWE A;  2IA0 A;  2EV5 A;  5HS9 A;  1J0R A;  5LHH A;  3FMQ A;  2PEX A;  4UVC A;  4G7O F;  2K27 A;  3I58 A;  4RAY A;  2W24 A;  1O3Q A;  2O8X A;  5DUI A;  4BHC A;  1L3L A;  1DP7 P;  2CGP A;  4M6Y A;  4L9V A;  2LNB A;  4ESF A;  1G4D A;  4GYI A;  3W6J B;  2PG4 A;  1UCR A;  4HX7 A;  4CYD A;  2WC2 A;  1EV7 A;  2P7C B;  5E8G A;  3U2R A;  1DPU A;  3MFK A;  2MD5 A;  1ODD A;  2FML A;  4GGG A;  4BXU A;  3GFI A;  5HS7 A;  3EET A;  1TBX A;  4IXA A;  4QWQ A;  2ISZ A;  3J80 Z;  2MLG A;  1AOY A;  5AON A;  1DDN A;  5DCF A;  4JBA A;  1FSE A;  4KN4 X;  2VN2 A;  3I59 A;  1ULY A;  3ROU A;  1P4A A;  3KEO A;  1D5V A;  5L3G A;  2M87 A;  2EK5 A;  3NQO A;  3SZT A;  4KNY A;  2XUB A;  4I01 A;  2EWN A;  5E20 A;  3LQQ A;  3WTX C;  4HW0 A;  1XMK A;  5LGT A;  1HSJ A;  1FX7 A;  4FX0 A;  1SAX A;  1G3S A;  5K1Y A;  4A2U A;  2DPD A;  1R58 A;  1ZH5 A;  3RYP A;  3HOT A;  5DDG A;  4KMF A;  4R79 A;  1TQM A;  2DLL A;  4K2E A;  4WCG A;  2EV6 A;  1BN5 A;  2V1X A;  3VOE A;  4CXF A;  3OOP A;  5D8K B;  1LDD A;  4Z2Y A;  3FM5 A;  3R6S A;  1XCB A;  1ZRD A;  1AWC A;  2XVC A;  3MWM A;  3D0S A;  3C18 A;  1KQ9 A;  3KLN A;  2DT5 A;  2NNY A;  1KQ0 A;  1BI1 A;  4OMY A;  5FFX A;  2JSC A;  1MGT A;  5F6F A;  4LG0 B;  3FHZ A;  1GVJ A;  3FF5 A;  4U0W A;  1SD7 A;  1SFU A;  2DO7 A;  3QP5 A;  1U6G A;  1UHW A;  5LLQ A;  3J81 Z;  3KLO A;  1S7A A;  2QEN A;  1OYY A;  2XAH A;  1IN7 A;  3KZY A;  4Y17 A;  3WGH A;  2ZNY A;  3MZH A;  3KP3 A;  1XGS A;  4A5M A;  2A5Y B;  5ILS A;  4JQF A;  1U5T A;  3CUQ C;  1FZP B;  1ZRE A;  3E6B A;  4RB0 A;  3M7G A;  1OR7 A;  4A6E A;  2GIV A;  2QWW A;  3FXQ A;  1W7P B;  5H6R A;  3H3Z A;  1RNL A;  1SFX A;  1OYI A;  3L09 A;  2VC0 A;  1HW2 A;  4KYW A;  4A0X A;  3IKT A;  4XBF A;  3K1P A;  4HDU A;  1O57 A;  1TTY A;  2GAU A;  2YR2 A;  1BM9 A;  3E5U A;  4LK0 F;  2IRF G;  1KGS A;  4FX4 A;  1UHM A;  4UV9 A;  3TOB A;  4I2O A;  3ZMU A;  2HDC A;  4EJO A;  4P5O A;  1YFH A;  4EQQ A;  3BJO A;  5FO5 A;  4G6D A;  1J2X A;  1LNW A;  5ICE A;  4WF2 A;  3BJ6 A;  2GXB A;  3GZ6 A;  1IRF A;  2EFP A;  2DPU A;  1Z6T A;  2J5O A;  2HOE A;  4OIP F;  2BE5 F;  4MQV A;  2NNN A;  3RKX A;  1J7K A;  3KP4 A;  2PI0 A;  2XRO A;  2FU4 A;  3KEQ A;  4RGU A;  2KIF A;  3QRF F;  2FQ3 A;  3QPT A;  2P8T A;  3ZMT A;  2Y48 A;  3SZP A;  3F6O A;  4BHB A;  4UNO A;  3BDD A;  1TW2 A;  2PJP A;  1IXS B;  3IC7 A;  1ONV A;  1HKQ A;  3ZN0 A;  4EM2 A;  2RKH A;  1XDS A;  5D8L B;  5LEK A;  4Q4Z F;  4U7B A;  4S05 A;  1FBQ A;  4NHJ A;  1EH6 A;  5LRR A;  4AIH A;  1T98 A;  3KCC A;  4CGZ A;  2F5C A;  4KDP A;  3TDZ C;  4G9Y A;  3V7S A;  3VEP A;  3WTW C;  3K0L A;  1T2K A;  4OMZ A;  1J5Y A;  4IHS A;  4XSZ F;  4L9N A;  3GUD A;  4A12 A;  1ZG5 A;  2VT3 A;  2XAG A;  2P7V B;  2VE8 A;  2C6Y A;  1PUE E;  3KP5 A;  3E6D A;  2ZCW A;  1R7J A;  1V3F A;  3FXU A;  3IKV A;  1I27 A;  5E18 F;  4OIQ F;  1BJA A;  1MKM A;  1HST A;  2KRF A;  1OKR A;  1RUO A;  1HKT A;  4MTE A;  2HKO A;  4U0Y A;  3GF2 A;  1U3E M;  2XGX A;  2K02 A;  2IW5 A;  3C7J A;  2CSO A;  1JHF A;  2IVM A;  3TO7 A;  4P9U A;  2Q0O A;  5H20 A;  5J8F A;  3QU3 A;  1XMA A;  3V8J A;  3K2Z A;  3JTH A;  3VOD A;  3HRU A;  3W6K B;  3ML6 A;  5HDN A;  1FC3 A;  2FNP A;  2QQA A;  2VBY A;  3DEU A;  1YW8 A;  4ZH4 F;  1RUN A;  1O7L A;  2V1U A;  4IF4 A;  2XIG A;  5FGM A;  1TW3 A;  5FLX Z;  4G7Z F;  2JTV A;  4LB6 B;  3M8F A;  3F8F A;  4N9I A;  2O61 A;  5CVV A;  2H09 A;  5HDK A;  3KE2 A;  4IRI A;  2Z99 A;  4DQ2 A;  5HS8 A;  1LVA A;  5ED4 A;  5BOX A;  1JGS A;  4Y15 A;  3V8L A;  1GXP A;  3TGN A;  1K79 A;  2QQB A;  2M30 A;  1P2F A;  4G7H F;  3C3W A;  1F9N A;  3KP2 A;  2CO5 A;  4BQA A;  4M6X A;  1U2W A;  5L3E A;  3ISP A;  5DCM A;  4Q47 A;  2R7F A;  4OOI A;  2BBY A;  1XSX A;  4WX9 A;  4U88 A;  1YW9 A;  5IT9 K;  5CVJ A;  4FT8 A;  1F4K A;  2K7L A;  3F21 A;  2NRA C;  3EQL F;  4PCQ A;  4ENM A;  5CVU A;  5H6Q A;  3BPV A;  3M8E A;  2HQN A;  1FWZ A;  4YFN F;  1LEA A;  3D5L A;  3F6V A;  4ENN A;  2EFN A;  4HZF A;  3WGG A;  5CVI A;  3IWZ A;  1FYL A;  2F5D A;  2GXG A;  3F8M A;  3ULQ B;  3R61 A;  1BC7 C;  1B4A A;  1ZRF A;  1FY7 A;  1Z9C A;  3GFL A;  1O3R A;  3E5X A;  3O2P E;  2EA2 A;  4ZYD A;  3J7A O;  1QNT A;  4CHU A;  4Q5S F;  5D6E A;  2NYX A;  1K7A A;  5FLX K;  1ZLK A;  1I6X A;  4GCV A;  1IW7 F;  3EUH A;  4IRG A;  1G6N A;  3T8T A;  1ON2 A;  2JPB A;  4RGS A;  5D5U B;  2W84 A;  2A61 A;  2F2E A;  3E5Q A;  2D1V A;  3TO9 A;  2QBY A;  1TLH B;  2COM A;  4MQ9 F;  2A68 F;  2HTS A;  3RPQ A;  4P96 A;  3WU0 A;  5J8C A;  3ABT A;  1XD7 A;  1QZZ A;  1SMY F;  5K5R A;  3E6M A;  1PP7 U;  3WE3 A;  3RKY A;  3F23 A;  2M1B A;  4YII A;  5TRD A;  1YO5 C;  3MEX A;  3I4P A;  1YLF A;  3QU6 A;  2LDU A;  1QO0 D;  2HR3 A;  2X0L A;  3ZQ7 A;  3HIF A;  3WTY C;  3L7W A;  4GYG A;  5BPI A;  3T5X A;  3TO6 A;  2HKX A;  4HX4 A;  2E7X A;  1PDN C;  2B0L A;  4HQE A;  2HWV A;  4EJU A;  3CTA A;  1IUY A;  3GX4 X;  1B9N A;  5E1X A;  1LDK B;  2QYO A;  2YPR A;  4KIG A;  2YU3 A;  1MJB A;  3FX3 A;  2FMY A;  4N0B A;  2HYF A;  4G94 A;  1T38 A;  4H0E A;  3COA C;  3E3V A;  1IAW A;  1RIO H;  1QQI A;  4BAY A;  4LG0 A;  2A07 F;  1R1U A;  1D8J A;  4CZZ A;  2YSR A;  1U8R A;  3V8K A;  3V4G A;  5LBQ A;  3J80 K;  4YIF A;  3NEU A;  2M5W A;  2KJC A;  4RAZ A;  1HBX G;  2CG4 A;  2OA4 A;  2PN6 A;  2DQL A;  4EVI A;  2F5E A;  3U1D A;  5DD8 A;  2LF7 A;  2G9W A;  1FLI A;  2MC3 A;  3Q9S A;  1J59 A;  2FA5 A;  2HS5 A;  3G3Z A;  4WWC A;  2Y75 A;  4ZYG A;  3V7C A;  3LA2 A;  4BHP A;  1P4X A;  1KU7 A;  1REP C;  2JPC A;  4HLX A;  3V7R A;  1K6O A;  4KT5 C;  2JRT A;  3WE2 A;  4ZZD A;  1R5H A;  3BZ6 A;  4KIF A;  3IRQ A;  2RN7 A;  3HUG A;  5AIQ A;  4L18 B;  1TQI A;  5ILV A;  4S04 A;  4IPA A;  1CF7 A;  3K1N A;  3R0J A;  1UB9 A;  1I1S A;  1XCV A;  1FSH A;  1K78 A;  4LLL A;  4I09 A;  2ZXJ A;  1L0O C;  1KYW A;  4U0V A;  4KIB A;  2ZKZ A;  4A5N A;  3KP7 A;  1XGM A;  2H94 A;  1J75 A;  5KK1 A;  3GXO A;  3TDU C;  2AS5 F;  3I53 A;  4XSX F;  1WSU A;  1R1V A;  1EH8 A;  1P6R A;  1FYK A;  2XAS A;  3K1M A;  1LEB A;  4I02 A;  4HF2 A;  1BIA A;  3SFZ A;  2H27 A;  2FNA A;  6PAX A;  1F1Z A;  1B9M A;  3LQR A;  3LWF A;  5LHI A;  2UWM A;  4FHT A;  3HSR A;  1K78 B;  2KIM A;  3WU1 B;  4L9T A;  5HLH A;  2DI3 A;  5JI6 A;  2H6B A;  3GLX A;  5E1Z B;  2EFO A;  5D5W B;  2QLZ A;  1OPC A;  3DFG A;  2BYV E;  5CYV A;  4MNU A;  4YG2 F;  2TDX A;  5EEG A;  4YFK F;  2P5K A;  2Z33 A;  2DK8 A;  2M8E A;  3L2C A;  2IPQ X;  4HBL A;  4KFC A;  4G8X A;  1O7F A;  4R8H A;  3TQN A;  4U7D A;  2QBY B;  3REO A;  3SQN A;  4RGX A;  1IN8 A;  2V9V A;  1U5T B;  2L01 A;  4EJT A;  2WV0 A;  1SMT A;  1A04 A;  2P5L C;  3P9I A;  3NRV A;  2ZBK A;  1S3J A;  3L9F A;  4ENJ A;  4P55 A;  2WTE A;  1HW1 A;  2K4B A;  3RIR A;  4UV8 A;  1W5S A;  1YS7 A;  4RB2 C;  3IRR A;  2DAO A;  2ETH A;  3N97 A;  1USS A;  2O0Y A;  5DUK A;  5LGN A;  4L5I A;  5ERI A;  5D6F A;  3MCZ A;  2DU9 A;  2ZO4 A;  2BEO A;  1RI7 A;  3PQJ A;  1FPQ A;  4OIR F;  3LAP A;  2DFI A;  3DV8 A;  2AXL A;  2MBF A;  2V1D A;  4GO1 A;  5JR3 A;  3LFK A;  3I59 B;  4LD5 A;  2QVO A;  4HF0 A;  1P92 A;  2VON A;  1D3Y A;  4CIC A;  5K5O A;  1SD5 A;  2Q8K A;  4MHG A;  5CVR A;  2VC1 A;  1BOA A;  2E7W A;  2VBZ A;  3L00 A;  2A69 F;  2R7D A;  1YW7 A;  4KIC A;  3DP7 A;  3WG9 A;  3T0Y A;  2V79 A;  2OZU A;  4PGG A;  3E6C C;  1NHA A;  3HTS B;  2XKO A;  5D5V B;  2GWR A;  1C0W A;  2EV0 A;  2J5P A;  2PQ8 A;  2LSO A;  2ZFW A;  3I71 A;  2FOK A;  2DW4 A;  3HRS A;  5E8I A;  4DNC A;  1QZY A;  1GHC A;  2O3F A;  2ADU A;  5A2Q Z;  1Y0U A;  3ELK A;  2EB7 A;  1WQ2 A;  3F3X A;  3HRT A;  1XSV A;  1R00 A;  1IN4 A;  3FWE A;  4KMU X;  1F5T A;  1SFE A;  4IRH A;  2RQP A;  1QGP A;  1ZG1 A;  1W7P D;  2CW0 F;  5BPD A;  1FOK A;  1QBJ A;  2MH9 A;  1KU9 A;  1ZLJ A;  1ZYR F;  1W4M A;  2VXZ A;  1LDJ A;  1IZ1 A;  3JSO A;  4UVB A;  2PMU A;  2O03 A;  2V6C A;  1X3U A;  3N4M A;  3RPU A;  1SD6 A;  1R5G A;  1MJ9 A;  4L5J A;  1D8K A;  1Z6R A;  3GFM A;  3WTV C;  1ZGA A;  2OZ6 A;  1R22 A;  3JW4 A;  3I5U A;  2DTR A;  5L3D A;  2UZK A;  2L3D A;  4PDK A;  3RKW A;  2QZ8 A;  4LMY A;  3S2W A;  2OQG A;  1G3Y A;  3GFJ A;  3GYH X;  5ICC A;  4LGW A;  5LHG A;  1HXD A;  3GWZ A;  1ZHF A;  3RYR A;  3MZY A;  1U78 A;  1KU3 A;  4BYY A;  1T0F A;  2L02 A;  3DF8 A;  5E17 F;  1YS6 A;  4EM0 B;  1Q1H A;  3WTZ A;  2VBX A;  3KP6 A;  1B1B A;  1H9G A;  4N9H A;  1EH7 A;  1T39 A;  1FP2 A;  3QOP A;  2DBB A;  2FE3 A;  2FBI A;  4IHT A;  4MTD A;  3R0A A;  4HQM A;  1MD0 A;  4BH9 A;  1FP1 D;  3MAJ A;  3JAM K;  4AIK A;  4JK1 X;  2F5F A;  1R23 A;  1ZN2 A;  5F1R A;  4I0B A;  2W85 A;  2Z9O A;  1CGP A;  4RS8 A;  3GO5 A;  4Y13 A;  1H0M A;  1DUX C;  1XGN A;  3OV8 A;  1MZB A;  3JSP A;  2MH2 A;  3DPT A;  1BI3 A;  3I54 A;  1H9T A;  5DD4 A;  2P4W A;  3ZMS A;  3R60 A;  3I64 A;  5HDG A;  3K69 A;  4ETS A;  4WXD A;  4OIN F;  1JXS A;  5BS6 A;  1J9I A;  4WXC A;  2WWY A;  2OD5 A;  5L3C A;  1MJA A;  3MQ0 A;  4AIJ A;  4XLN F;  5LRS A;  1YTY A;  2KJB A;  2YX7 A;  4EM1 A;  1BC8 C;  1S7O A;  3HSE A;  2DQR A;  1BBY A;  1LB2 A;  1LQ1 A;  5BMZ A;  2EA4 A;  1KA8 A;  3FM3 A;  5CLS A;  1FYM A;  4HF1 A;  1HW5 A;  2IP2 A;  3TKY A;  1WI9 A;  4TV7 A;  4ENK A;  3IWF A;  4M71 A;  1XN7 A;  4NB5 A;  4OU0 A;  2OQR A;  4ASN A;  2IT0 A;  1DPR A;  3WGI A;  4A6D A;  1TNT A;  5D4R A;  4LLN A;  2PBI A;  2HZT A;  1FT9 A;  1S29 A;  2ZME A;  3HHH A;  3LA3 A;  4HDV A;  1KYZ A;  1I1G A;  4GXO A;  2FXA A;  3GEZ A;  1B59 A;  3QPH A;  2BV6 A;  3KFW X;  2CQK A;  4EV0 A;  4D0P A;  3Q5F A;  1PP8 F;  5DYM A;  2EFW A;  5JVT A;  1IXR C;  3PQK A;  2PMH A;  3ERE D;  2PFB A;  1BI0 A;  3CJN A;  5LEJ A;  4ESJ A;  4CDG A;  2K86 A;  4PZJ A;  2QUF A;  4KN7 X;  5IT3 A;  3F72 A;  3BOQ A;  2GA1 A;  5F64 A;  3Q9V A;  2X4H A;  3C1D A;  4A0Z A;  4PGH A;  5AIP A;  3BRO A;  5J6X A;  4L0Y B;  3WTS C;  2Z3Y A;  2ZNZ A;  2RC4 A;  4HLY A;  2ISY A;  2HYG D;  2QQ9 A;  2D2W A;  4EGY A;  1STZ A;  3LAJ A;  5CJ9 A;  5L3B A;  3WTT C;  3P9C A;  3RTR A;  1FBS A;  2YX4 A;  5DEQ A;  1VTN C;  3EYY A;  3ZMD A;  2G7H A;  2IJL A;  4M74 A;  2Z5U A;  3ECO A;  4UXN A;  4AWX B;  4UHT A;  3T1B A;  1YYV A;  1IF1 A;  2NAZ A;  5K5Q A;  5TJJ A;  4ZYH A;  1IRG A;  3FMR A;  3B02 A;  2OU2 A;  1UST A;  5A2Q K;  2ACJ A;  1RZ4 A;  1P4W A;  2R3S A;  4LK1 F;  3SHF A;  4IJA A;  5EEH A;  5KVR A;  4P9F A;  1ZRC A;  5FD6 A;  4M72 A;  4IVN A;  1YQA A;  3F22 A;  2VE9 A;  2MA3 A;  4RB3 C;  1BI2 A;  3GZ5 A;  2STT A;  4QLC U;  2E1C A;  2EFQ A;  3P7N A;  1U5T C;  4OIO F;  3CUQ A;  4HA8 A;  2P5V A;  3O3K A;  1WKM A;  1TNS A;  5ICG A;  5ILU A;  2XRN A;  2OAZ A;  2LKP A;  2RV8 A;  2QM3 A;  3EDP A;  4BNC A;  1YIO A;  3CDH A;  1R36 A;  2CFX A;  4I7H A;  3F8B A;  2ZJ2 A;  1R1T A;  5JHU A;  1ZG3 A;  4LLG F;  2JZY A;  4AD9 A;  4ON0 A;  3QAH A;  1B6A A;  3BPX A;  4I0A A;  4HYE A;  4EMS A;  3BJA A;  1W7P A;  5LGU A;  4WK8 F;  2VOP A;  4MEX F;  3GVA A;  5DV5 A;  3R4K A;  5FFZ A;  2L4A A;  4L9J A;  1BIB A;  2A6H F;  2BGC A;  4AVP A;  2L4M A;  3ABU A;  4A0Y A;  2L54 A;  1ZGJ A;  2KIU A;  2ZME B;  2K4J A;  1E17 A;  2Y0M A;  1XB4 A;  1JHH A;  2FBK A;  3VFZ A;  3FZV A;  2PLY A;  4RB1 A;  4EJW A;  3DQV C;  4ZZL A;  3F8C A;  1FBU A;  2HQR A;  1IN6 A;  2VOD A;  3I0T A;  2O6G E;  3AAF A;  1GXQ A;  3KET A;  3E97 A;  1MDM A;  1YG2 A;  5IT9 Z;  1XSD A;  2FBH A;  2KKO A;  4F7Z A;  2GQQ A;  2A3S A;  3O6B B;  4MEY F;  1S6L A;  3HHG A;  1V4R A;  2IA2 A;  2HEO A;  2RGV A;  1ON1 A;  2RVC A;  4HAM A;  3LST A;  3BP8 A;  1S8N A;  4L0Z B;  3FXR A;  5FB2 A;  3CUQ B;  4UVA A;  3QP6 A;  1CF7 B;  2W25 A;  4XRF A;  2H6C A;  2FEZ A;  3DXJ F;  2OBP A;  1G3T A;  3G73 A;  1TQP A;  2ESH A;  3VB2 A;  2CYY A;  1Z05 A;  2VOO A;  1WWX A;  1O3S A;  4KUM A;  2STW A;  4YFX F;  5JFR A;  3IL2 A;  1QPM A;  1IN5 A;  4HV6 A;  3HTU A;  1FNN A;  3SXY A;  2JT1 A;  3HSF A;  4HX8 A;  2GZW A;  1T6S A;  2MLK A;  4ESB A;  1W5T A;  4Q48 A;  3IHU A;  3GW2 A;  4KA4 A;  2D1H A;  1Z7U A;  1OMI A;  4O6J A;  2XAJ A;  3CUO A;  2HGC A;  2M45 A;  1G3W A;  3WTU C;  3ZPL A;  2ELH A;  4LJZ F;  3RJP A;  1HQC A;  2HTJ A;  5D4S A;  4M9S A;  2RNJ A;  2ESN A;  2NS0 A;  5HVQ C;  2GA2 A;  4G6Q A;  1XDU A;  2XAQ A;  4M9Z A;  3RDI A;  4EJV A;  5HOO A;  3EYI A;  5L3F A;  3H3U A;  3CLO A;  3DPL C;  4I98 B;  2XHK A;  4M9X A;  5E1W A;  2P6S A;  3HOS A;  2G7U A;  4UUV A;  2UXX A;  3JTG A;  2W57 A;  4ZYE A;  4LFU A;  4M73 A;  1O3T A;  2LF8 A;  3F8N A;  4B8X A;  3HYI A;  2FSW A;  2DK5 A;  2P6T A;  1UFM A;  5BQT A;  3HRM A;  5DCM B;  4CO8 A;  1LJ9 A;  4O5V A;  5ICF A;  1IXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...