5C44J

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c44J00
1CQTA 1X2NA 5BNGA 2LR8A 4C3IJ 3S1MJ 1Z77A 2R7ZJ 4DZPA 2LD5A 2HXOA 1BW5A 1MNMC 1YRNA 3PM1A 5IOYA 3HOUJ 3LOCA 3PO2J 2OPTA 2WB1N 3B6AA 5IP6A 3TW7A 1XS9A 1O4XA 4JYKA 1GVDA 2JWTA 5EZHA 3JRBA 4BY1J 4Y7NJ 4BBRJ 2N8GA 4DYQA 1HCRA 1HDPA 4BBSJ 2GBYA 2H1KA 4V2GA 1OFCX 5F0CA 4MO7A 1P7JA 5EG0A 3JR9A 2ME0A 4Y52J 3W6VA 4RBOA 2IAIA 2WAQN 4I76A 2E1OA 2HDDA 4C3JJ 1GT0C 4EEFG 2ME6A 3HOZJ 3M3YJ 3HDDA 3CDLA 5EF6A 3B6CA 3BTLA 1FEXA 3ZQHA 4I6ZA 4XRSG 2RAEA 2KT0A 3NARA 2MW8A 1ZR2A 2Y30A 5M5WJ 2JA6J 2OF7A 3K7AJ 4MIMA 4FCYA 3QPSA 1IRZA 2ELKA 1IGNA 2DA5A 4DZJA 1Z0XA 1OJLA 2CJJA 1NK2P 2K9SA 4XICA 3S1NJ 1F43A 3DCFA 3IH2A 3ZQFA 1TWFJ 1MH3A 3BR2A 5F08A 5FKNA 2O8KA 3GTJJ 3O8HA 9ANTA 2XB0X 4V2FA 5IYCJ 5IOZA 2CUFA 2DJNA 1XG1A 2LKXA 2XPUA 1MH4A 1NTCA 1MBHA 2R92J 1D5YA 2XGCA 2TCTA 4M3BA 4C2MJ 2ZB9A 5F1JA 5FLMJ 4HNVA 5DS9A 1APLC 1K61A 4JX4A 3JRCA 4RDUA 4A3FJ 5M5XJ 4LOCA 1JKPC 1UHSA 5IYDJ 1JUPA 1G2HA 2VUMJ 1I3QJ 3HOVJ 2JN6A 3L1PA 3HM5A 2DA2A 1BA5A 3BG3A 2HOAA 5GPAA 2GM4A 3S1RJ 2R0QC 1MBEA 1FIAA 2E2JJ 2D5VA 4B3AA 1HOMA 2M0CA 1JUSA 1JT0A 4A69C 3ZQLA 3RZDJ 1JT6A 3IH4A 1JKQC 3S17J 1TWAJ 2CU7A 3IH3A 3GTPJ 3NAUA 1IV6A 2EZKA 3K2AA 4X1EA 5M5YJ 3PO3J 1SFOJ 1AKHB 2Y9YA 3FISA 1VF9A 4A3KJ 3WHBA 3JRGA 2YUSA 5FKKA 3G1LA 3GBGA 2R5ZA 3D1NI 2NVTJ 4D7MA 4C3HJ 1TWCJ 3G1MA 2X6OA 3UKGA 3LNQA 1QVTA 1XC5A 1GDTA 3JREA 3F0CA 3HOXJ 3HGGA 3H3VK 4IHXA 2DA7A 5C3EJ 1GV5A 1UG2A 3LSPA 1ZQ3P 4M3FA 4CYCB 5E3OA 1AU7A 1TWGJ 5IP9J 3Q0VA 2M2EA 1W0UA 1RETA 1QPIA 1T33A 2QF7A 1Y1WJ 1VFCA 2JMWA 4XK4A 4FE7A 3ZOBA 1WPKA 1HF0A 2WV1A 1Q1VA 3JRFA 2DA6A 4B4CA 3S2HJ 1JKRC 2YS9A 4XRSA 3BTCA 5EEAA 1H8AC 2FX0A 2XGEA 3DEWA 4UUSB 1TC3C 4XRMA 4S0HB 4G12A 4FTHA 3FIWA 3BT9A 2NS8A 2H8RA 3GTGJ 1ETWA 5F27A 3JRIA 1JJ6C 3GTMJ 1IDZA 1MBJA 2NVXJ 2EZHA 2FJ1A 2E2IJ 2LLKA 2M34A 1QVUA 4IHYA 1I50J 3SJMA 2JJ7A 4BXXJ 3A02A 1OCTC 2KDZA 5C4XJ 2CQQA 3S2DJ 3HGYA 2LTPA 3HKZN 3WHCA 4M3DA 4DW6A 1RKWA 5K7HA 2HOSA 2HQ5A 2XB5A 3A01B 4A3LJ 1MBGA 1U8BA 3H0GJ 5IYBJ 1B72B 1HLVA 2I10A 4J19A 3S16J 2G0EA 2VPRA 2R5YB 1JJ8C 2EBIA 2ID3A 5EGOB 2MGQA 3BQZA 2IEKA 3BR5A 3C2BA 2DTZA 2K9NA 3QQAA 1NK3P 1ITYA 1MBKA 1OCPA 4M3EA 5K7FA 4BY7J 3LSGA 2ID6A 2P81A 1JGGA 2LK2A 3GTKJ 4GFBA 4A3CJ 3S15J 2MG4A 3GTQJ 2AO9A 3OSFA 1AKHA 2X48A 2XPVA 2CUEA 5C44J 5F04A 5F0HA 2EQRA 3BG9A 1VNDA 2VKVA 3CMYA 1LE8B 2HYJA 1X58A 4ABZA 3RZOJ 3IV5A 3TEDA 3G1OA 2E2HJ 1H88C 1DU6A 1A6IA 1W0TA 2ECBA 5J1RA 4M6VA 1BL0A 4D5FA 1PUFB 1ZKGA 5K7ZA 3HBLA 4A3IJ 4CYCA 3BTJA 2COBA 5DTDA 2JA8J 4AYBN 1B8IB 1U9OA 4QSHA 4D7NA 1IC8A 1MSEC 3BG5A 1IJWC 1U9NA 2FQ4A 1MSFC 2QCOA 2XSDC 5M3MJ 4A3BJ 2CRGA 4A93J 2W48A 1RESA 2LP0A 5HODA 2VKEA 2O9LA 1ZGWA 2Y31A 1WH5A 5GP9A 2DA4A 2LFBA 1IUFA 3RQIA 1ETYA 3OSGA 2HOTA 3Q0WA 5JLXA 3OIOA 4UUSA 4A3MJ 4A3DJ 2EH3A 2IBDA 3MKLA 3OOUA 1IDYA 3A03A 4M3GA 3HEFA 3M4OJ 4UUTA 4NDLA 4X6AJ 2L7FP 2XGDA 3SDGA 2DMPA 2DMQA 2DN0A 3TP0A 2VI6A 1JUMA 1MBFA 3MVPA 4A3JJ 5FKLA 4IEJA 4QTRA 2JA7J 1F36A 2LVSA 1ETVA 2EZLA 1GUUA 4BKXA 5JLWA 2L7ZA 1WI3A 2L7MP 5E3NA 1JTXA 4A3EJ 1ENHA 2NVQJ 3A01A 1ETXA 2TRTA 4DYCA 1LFBA 1B72A 1FTTA 3GTOJ 2Y9ZA 1ETQA 2R5ZB 3BTIA 4IHVA 3RKQA 1UMQA 4D5CA 2X9DA 5GPCA 5F0FA 2R5YA 1RPWA 5EGOA 2XRLA 5J1UA 2ECCA 2GLOA 1YRNB 1TWHJ 3BR0A 2K9QA 2M9HA 3I4MJ 3BR6A 4MFEA 2Y2ZA 3HOWJ 1RKTA 3CCYA 1WGXA 2DMTA 4W97A 1A5JA 1DU0A 4A3GJ 1SANA 1X2MA 3LSJA 1JTYA 5J1YA 2MSYA 3QPLA 1RR7A 4XIDA 1ETKA 2DA3A 2M8GX 3TW6A 1EF4A 4MFDA 3FK7A 5E3LA 5EG0B 1VI0A 2JK3A 1BW6A 3ZQIA 1LE8A 4AC0A 5C4JJ 1ETOA 4W1UA 2L0KA 2NVYJ 3FKIJ 5IP7J 1QRYA 2JA5J 4AUXA 2NOGA 3FK6A 3I4NJ 2DMUA 1S7EA 1PUFA 5E3MA 2PMZN 3GTLJ 3S14J 1GV2A 5J3LA 1Y1VJ 3BQYA 1WCMJ 4JX6A 1JKOC 1POGA 5EZGA 4B1RA 1IG7A 2EZIA 1HDDC 1FJLA 2Y0SN 3Q3SA 3ZQCA 2AHQA 2CQXA 4QIWN 1LFUP 1B8IA 1BJZA 4JX5A 3SFIA 5M3FJ 2XPWA 1U78A 2YU9J 1E3OC 5FKMA 3TP3A 2HI3A 2DA1A 3BR3A 4MLOA 3Q0UA 2FD5A 4FE4A 2DMNA 5FLVA 2K40A 1FIPA 3VPRA 3JRDA 1T56A 1ORKA 3MN2A 4DYRA 2B63J 1FTZA 3HOYJ 2E19A 2L9RA 3O8GA 5FJ8J 3JRAA 4IHWA 1I6HJ 1ZK8A 1H89C 2R93J 3HB9A 4JP0A 1WH7A 1R9TJ 4L5EA 3JRHA 1ZR4A 1P7IA 5EDNA 3CQZJ 3LSRA 1ZTRA 5FKOA 3ZQGA 3BR1A 2HXIA 1K83J 1AHDP 4FISA 5IPAA 2LY9A 3E7LA 2NS7A 2O7OA 5EYRA 3S1QJ
chains in the Genus database with same CATH superfamily
2L01A 3W3CA 1V5GA 3FKJA 4I01A 2DJIA 2MD0A 3I4PA 1SVLA 2LD5A 1V4RA 4IKFA 2OJED 1BW5A 2WTEA 4KMUX 3BDDA 2OPTA 3C1DA 2PLYA 4U87A 4E70A 3B6AA 2R7FA 4XLAA 4BU2A 1Z3XA 1O4XA 4JYKA 1GVDA 4LD5A 2VQHA 5EEGA 2JWTA 2GQQA 1IRGA 3JRBA 3M8JA 4IRHA 2V4JC 4V2GA 3L09A 3VOEA 1DP7P 4I2OA 5EG0A 4DGWB 4IL6C 1MNEA 2IAIA 4RAYA 3IAM2 2KLOA 1UELB 1BM9A 3C2GA 3DP7A 4C3JJ 3QYFA 4N4NB 1YJ9I 4EEFG 3N97A 2DDAA 5LHHA 1PP8F 2IS2A 3HDDA 4ZYHA 3CDLA 5EF6A 2F4IA 1IRFA 1J2XA 4RAFA 1MNDA 2JPBA 2XAUA 3ZQHA 2R7XA 3NARA 5B5EC 1TLHB 2H6CA 2MLGA 1Y56A 2OF7A 1K6OA 3OYNA 4FCYA 1K78A 5HVQC 3S2WA 1FT9A 2DA5A 3CF2A 3ZMVA 3KE2A 3G6EI 2KQRA 4F52A 3M9AA 3TO7A 3FF5A 3S1NJ 3KP7A 1F43A 3ZMZA 2XC7A 1ZN2A 1XCVA 2L4AA 2ZJ2A 1KGSA 1OCCH 1DP3A 3BR2A 1TZLA 2J5PA 1ON1A 3HRTA 9ANTA 4V2FA 5IOZA 1VQ9I 2VJJA 4HLXA 2LKXA 3WTXC 1MH4A 5CKTA 1MBHA 2F5CA 3EUHC 1W1WE 1Z05A 2KMUA 4M3BA 3RJPA 5GTIC 5FLMJ 1TTYA 1D1CA 3IRRA 1ON2A 4B47A 2EILH 4LOCA 2L3DA 1RR8C 1UHSA 2YSRA 2O03A 1H9GA 4XORA 4EM1A 3L1PA 1EJ9A 1BA5A 2STWA 4L9VA 1F4KA 1MBEA 2F5DA 3H36A 4LGWA 2F6CA 2E2JJ 2ZMEC 1HOMA 4KUMA 2C6YA 1TT0A 4A69C 3HRMA 4BHBA 1YS7A 4O5VA 4WXDA 1JKQC 2ZJPF 2KPMA 4KA4A 1G59A 4ITVA 2CV0A 2CH0A 2PJPA 3ZQQA 1TT5B 2KIMA 2VJIA 2E34A 2G7UA 2CQ7A 5M5YJ 3H3UA 5J8CA 1QU3A 1SFOJ 2IGOA 2Y9YA 4UVAA 3FISA 3HPGA 4I02A 3SDBA 3HUGB 1VF9A 4B8XA 4MEYF 3WGIA 3WHBA 4II3A 5FKKA 3G1LA 2HZTA 3BOQA 2R5ZA 1M1EB 4E7LA 2NVTJ 2MFZA 2X6OA 1XC5A 3EUAA 3TQNA 4IXAA 3OIPA 4PCQA 4ESBA 2DODA 4IO9F 3W2WA 2DW4A 3KP3A 3HGGA 4LB6B 3K1PA 2R7SA 2DA7A 5D5WB 1I3AA 1GV5A 3MZYA 4IRIA 5CLSA 4KITB 3SEQA 4GRIA 1IF1A 2P5KA 4LIVA 2BHZA 1GXQA 3CJNA 3K4JA 3CO7C 4G7HF 1A35A 4HG2A 2M2EA 3AKZA 5CVIA 3CF5F 1SMTA 1VFCA 2JMWA 5L3GA 4FE7A 3CP2A 3EDPA 3LL7A 1WPKA 5A2QK 4B43A 3CCMI 1GXPA 1MW7A 3S2HJ 1BI3A 1MMNA 1S3JA 2VBWA 1WFXA 2YS9A 4J00A 1G4DA 2EPFA 2FX0A 2X6WA 4HEA2 4M6XA 2JUCA 1YW8A 4M72A 5JR3A 2M7BA 3DKXA 2OU2A 4FTHA 3FIWA 2R7RA 4RGUA 2H8RA 1RUOA 1D5VA 1L3LA 1W7PA 2MA3A 5B1BH 1JJ6C 1R4MB 2FRHA 5CVVA 2ZJQF 4RB2C 2EK5A 2HDCA 3BPVA 2HVQA 2DCEA 2LDUA 2ZMEB 1QVUA 4IHYA 1I50J 2JJ7A 1X4PA 1P2FA 5FRMA 1V5FA 3MMYB 3V4GA 3VSLA 5JHUA 4BXXJ 3RKXA 2OTLI 2CQQA 3H3ZA 3HGYA 3HKZN 4PJNA 2KP6A 3OR2C 4OAZA 1W36C 4N0BA 3H0GJ 2A5YB 4HAMA 2I10A 5BQTA 4J19A 2G0EA 3S16J 3CMEI 3S1QJ 3BJAA 3H5AA 3I9V2 5DEQA 3GX4X 5EGOB 3BQZA 4U0WA 1UHMA 1P4XA 1QZEA 2XSJC 4WF2A 3K69A 1LUJB 1G8XA 4IQ4A 3G71I 1ZELA 4YG2F 5J47A 1HW1A 1WRJA 4GYIA 3DV8A 3OYFA 4KICA 1G3WA 1VQ7I 4RGXA 3BZKA 1OCOH 3NEUA 3D5LA 3GTQJ 2AO9A 2CS3A 3ASNH 5HDKA 1O3QA 4HPQA 2VQGA 1R5GA 3ABUA 2LRDA 2BBYA 2H09A 5F0HA 2FNAA 4J01A 1Y39A 2VKVA 2Z3YA 4ABZA 1X58A 3RZOJ 3IV5A 1KU2A 1FP2A 4QPQA 4Q4ZF 3W2AA 1A6IA 5IT9Z 1TP4A 1J09A 5J1RA 2V1XA 1RIOH 1BL0A 4D5FA 3KLNA 4BEHA 5HNFA 1ZG5A 4ESJA 3PL8A 4YIIA 4NC6A 3HG9A 2IVMA 1DGWY 4A0XA 4P9UA 1X4OA 4A3IJ 2ZNYA 2O3FA 1NG7A 1W5SA 2KHMA 3P9IA 1X1BA 2COBA 1GLNA 2A5WA 3RKYA 4GDFA 2OBPA 5F6FA 1VQMI 4HF1A 4XLEA 4QSHA 1BBYA 1WJBA 1UHWA 2IA2A 2I8DA 4A3BJ 1BJAA 1L0OC 1RESA 2LP0A 3I5UA 4UV9A 3SEZA 3MKYB 5HODA 4XSXF 2ZKZA 2VKEA 3HSRA 1Y0UA 3O6BB 4M9SA 4A0ZA 3E1SA 2QVOA 1IUFA 2XVCA 2V9PA 3PUBA 5D4SA 4XKVA 5D6EA 4CZZA 3Q0WA 2RVCA 4UUSA 3LA7A 1Y6IA 1RI7A 1J59A 3AG3H 4A3DJ 2K3PA 2W25A 3KYLA 2R7WA 3T5XA 2IGMA 2HGCA 2BY0A 3E3VA 4M3GA 3V8JA 5L3BA 3HEFA 3HRSA 4NDLA 4HYEA 3SDGA 3HZJA 4CYDA 2DMQA 1JUMA 3ZMDA 1MBFA 3M1CA 4P1WA 1I5ZA 5FKLA 3NQOA 4QTRA 3DWLE 2ZFUA 2HTJA 3KP2A 2EZLA 1JGSA 3V7RA 2RQPA 1P4AA 4CCNA 4PJJA 3FBIB 3H5RA 3RTRA 1LB2A 3MKWB 3ZRGA 1FTTA 1O3TA 3G73A 3GTOJ 2B7EA 1YG2A 2QQ8A 4D5CA 2VONA 3LSMA 4YIFA 2XRLA 1EH6A 2GLOA 2HPIA 2Y48A 3RPUA 3BR0A 4G6TB 1JE8A 3D5RC 1I27A 1TW3A 2IRFG 3BR6A 3M7GA 1HA8A 1FP1D 4L9JA 1RKTA 1SAXA 5DYMA 2A07F 3I0TA 3ULQB 1N77A 1X2MA 2FOKA 4H0EA 4Q5SF 2XDVA 2LKPA 4B09A 2DA3A 2QSHX 4JBAA 2ADUA 3ESWB 2PMHA 2WA0A 3ZMUA 3FK7A 3L2UA 5EG0B 2JK3A 3VYUB 5TRDA 3ZQIA 5HLTA 2B9SA 1LE8A 5C4JJ 1ETOA 2V79A 3DTKA 3S3MA 5HDNA 3FKIJ 4KIBA 2JA5J 2CSOA 4AUXA 3I4NJ 5F1RA 3IAS2 1S7EA 4WCGA 4HW0A 5CQGA 1BC8C 3BQYA 2UZKA 2O5RA 1VQ6I 3IL2A 1AOYA 1WJAA 4F7ZA 2FSWA 2FMLA 5CQEA 3V42A 3ZQCA 1R00A 2PEXA 1LFUP 1KA8A 1FMWA 1V5EA 4CCMA 1LQ1A 3ZXSA 1K78B 4NUBA 3K4CA 3HJEA 4HX7A 2RV8A 3ROUA 3FMSA 1HKSA 3PFYA 3PNYA 4KDPA 2AQFA 3PFIA 2UUZA 1WSUA 3DU5A 3DBLB 4Y15A 3CCUI 1CF7A 2KRFA 3O2PE 3AG2H 2EIMH 1T56A 3CDHA 2DFHA 3MZHA 2OCCH 1YLFA 1UG0A 2L9RA 2PI0A 3GZNB 3JRAA 2VODA 1I1SA 2KZVA 1D0YA 3JTHA 5CVUA 1ZK8A 1I6HJ 1LVKA 2CV1A 4OAYA 1WH7A 1UZCA 1YYVA 2IS4A 4L5EA 2D2WA 4RAGA 2HQAA 1YJWI 1MJAA 4PDKA 4EJUA 1LVAA 2A3SA 3BR1A 4CH7A 2EB7A 5B3SH 1AHDP 1USTA 1H9TA 3FDYA 2DOAA 2WADA 3E7LA 3DFGA 3M8FA 5LRRA 1R5HA 2JSCA 5EYRA 3IKTA 1CQTA 5BNGA 2KJCA 4C3IJ 2V6CA 1DPUA 3ZR8X 2R7ZJ 4BQAA 2X1EA 2HXOA 3J7YJ 3JSPA 3CCJI 3ZN0A 1YRNA 3ML6A 3CCEI 3REOA 3HOUJ 3LOCA 3J81K 3PO2J 1EH7A 5L3EA 2ZO4A 4P96A 2RNJA 3SZPA 2P5VA 5IP6A 2DXIA 3J7AY 4EM2A 3WTWC 3KEOA 3RYPA 1YHQI 4DYQA 1FMVA 2E1MC 5HLGA 2IGKA 3RYRA 4MO7A 1FBUA 1XGNA 5BS6A 3FZVA 4Y52J 3W6VA 2WAQN 1YX3A 3CTAA 2CG4A 5KCMA 4EM0B 1XGSA 4IF4A 2MC4A 4IHSA 2ME6A 2ZXJA 4Q47A 4EJWA 1XSVA 2IPQX 1D0XA 1ZAOA 3F23A 5IY5H 4O6JA 2IXSA 3OS1A 2AXTC 3GFJA 2XUBA 4I6ZA 4XRSG 2RAEA 2JT1A 4EVIA 3OL4A 5CVRA 1DUXC 3KFWX 4ASNA 4RM3A 1ZR2A 2F5FA 2JA6J 3VODA 3BP8A 2PQ8A 3QPSA 2A6HF 3FMRA 4HSRA 1FYLA 2Q2EA 5D5XB 3HYIA 3OYKA 2VT3A 4GCVA 4PGGA 3DCFA 4IPAA 4XOPA 2GOMA 1TWFJ 2BY3A 4HNUA 1MH3A 2Y69H 2FUG2 2FBHA 5L3FA 4BH9A 1Z7UA 4EJOA 1W7PB 2XPUA 1FLIA 1IN6A 2V26A 2ZB9A 1APLC 4HNVA 5DDGA 5DS9A 5DUIA 2LYCA 2JUGA 4RDUA 1W5CC 5M5XJ 4LJZF 5LGNA 3E5UA 1JKPC 4XLHA 1XMAA 2ZCWA 5LLQA 2LREA 4FETA 4GO1A 3HM5A 3BJ6A 1SC7A 4IOAF 3A1YA 2WWYA 4L5IA 4TV7A 2GM4A 1I1GA 3I3LA 2R0QC 3I54A 2QUFA 3LMMA 4GXOA 4RAZA 2DLLA 1NH3A 1D8JA 3IP4B 4XLCA 1ZREA 1HQCA 2Z2SB 3CCVI 3WTSC 4E7HA 1JT0A 4LLNA 1J5YA 2HEOA 3ZQLA 1JT6A 2CW8A 3GLLA 3QOPA 1R6RA 2E1MB 3F8BA 3LSHA 1UJ8A 2JTVA 1OLTA 3C7JA 2ACJA 3NAUA 1IV6A 2JVGA 3K2AA 4E7ZA 2Q0OA 2HQNA 4AWXB 1FOWA 5EEHA 4PSXA 3ZCOA 4DBRA 1KONA 4NC7A 2PBIA 1R22A 3WTYC 3JRGA 2GA1A 3OYAA 2W24A 5DCFA 4D7MA 5HOOA 4C3HJ 2K3FA 3LNQA 1QVTA 2VLAA 3OL3A 4XQFA 1RNLA 5L3CA 4BEHB 4E7KA 3WTUC 3K4MA 2XROA 1R1TA 4M3FA 5E3OA 4E7JA 5FLXK 5IP9J 2QEXI 3QRFF 1RETA 2QF7A 4HV5A 3SHFA 2LF8A 2A61A 3OS2A 4KFCA 3HL2A 3ZOBA 4ETSA 2VN2A 4OWRB 4MQVA 3L2QA 3EYIA 1QPMA 2QWWA 4B4CA 2K02A 2GXBA 2V9VA 2LH9A 1JHHA 2XKPA 5EEAA 1XGMA 2JPCA 4UUSB 4G7ZF 5D6FA 4XRMA 3GWZA 4F91B 1WJ5A 3HSFA 2HQRA 3BT9A 5DCMA 2ICWG 3AG4H 4ZZLA 2NS8A 2UXXA 3GTGJ 4OMYA 1R58A 3PIPF 1KU3A 4DNCA 1SVMA 3MQ0A 1IDZA 3SYTA 2RKHA 2FXAA 5GTHC 3R61A 1MMSA 2E2IJ 3SJMA 2Y0SA 2L9NA 3DXJF 4NBQA 5C4XJ 3S2DJ 1TBXA 4ZDOA 2M87A 4A12A 3F8NA 3I59A 4DW6A 1RKWA 2ELHA 4RMNA 2M4KA 1ZRDA 1U8BA 2BXZA 1KZHA 2QBYA 2ZSHB 2EJRA 3QYBA 3VYTB 2LMDA 1V54H 1JJ8C 2ID3A 1FC3A 4Y3OA 3ABMH 2IEKA 1TQMA 1B1BA 2JRMA 2K9NA 3QQAA 3IRQA 4ENKA 1ITYA 1R49A 1ZG1A 4ENJA 3HTUA 1OCPA 1P4WA 3OYLA 2M45A 3ISPA 2ID6A 3LSGA 4KT6A 4I09A 1V3FA 2P81A 4BXUA 1JGGA 2BZTA 3PSIA 1T8IA 4GFBA 1SD6A 2DDBA 2MG4A 3WU1B 5H6QA 3BG6A 4BXFA 2GXAA 1WJEA 3JCUC 1S9HA 2KIUA 2X48A 3HSEA 5C44J 3CC7I 4A5NA 2IA1A 5LHGA 1B4AA 3BG9A 3MEXA 1VNDA 1ZLKA 2V6EA 4UXNA 4L9NA 3CMYA 1LE8B 3SXYA 1G3SA 2E2HJ 1DU6A 3DBHB 2ECBA 4OIPF 3DKWA 2J5OA 2OQGA 1T0FA 3MZ8A 2DFIA 1HBXG 3I58A 1QZYA 1V55H 2YR2A 4AD9A 3CCRI 3CUOA 3BTJA 4AU7A 3RSNA 4CXFA 4CSWA 4AYBN 1P92A 3H9JA 1Z9CA 5AIQA 2M8EA 5TJJA 3T0YA 4D7NA 4ESFA 1IJWC 4ZDPA 2QCOA 4M73A 2CRGA 2W48A 1PVEA 3JAMK 3FHZA 2L7KA 1KYWA 1YI2I 4AIHA 2LFBA 4ZC3A 3OSGA 5E18F 1D3YA 3GF2A 1CF7B 1BI2A 2IBDA 4M71A 3MKLA 1F5TA 5LGTA 1SFUA 1MJ9A 2ZC2A 1K4TA 2BE5F 3A03A 2FU4A 4U0VA 3PSFA 3GLXA 3NRVA 3KEYA 3W2VA 2XGDA 2FQ3A 2EFQA 2DMPA 3TP0A 5D8KB 4JOMA 3KZZA 1A31A 3UNGC 2HZDA 4I0BA 1N25A 2JA7J 2ZXHA 3K70C 1ETVA 1TQIA 4RS8A 2DT7B 3X2QH 1R1VA 2O0YA 1ENHA 2CQKA 1EKEA 2EV0A 1FSHA 1TNSA 2O61A 3K1NA 2FOWA 1ETQA 3I55I 3TO9A 3F9KA 5GPCA 2X9DA 3DU6A 2R5YA 4CCLA 2UV1A 2QKMB 3TMOA 2G7HA 1NHAA 5DM6F 1YRNB 1TWHJ 1Z67A 2CGPA 2H27A 2M9HA 4NQWA 5GAGJ 2O6GE 3I4MJ 2EA2A 3CLOA 4I98B 1YJNI 2BY2A 3ERMA 4A5MA 3LSIA 2CFOA 1FOXA 3ONQA 3HOWJ 2ESNA 1OQYA 4MGRA 3DEUA 2X1CA 1F9NA 3GFIA 4R8HA 3MKZA 2M8GX 1EF4A 1VZ0A 2CUZA 2MYSA 3E6DA 4RGRA 5E3LA 1VI0A 4A6EA 1MGTA 3J80Z 1ZRCA 1LDDA 5FO5A 1ZYRF 1QRYA 2FE3A 3CZ6A 2OTJI 2NOGA 3FK6A 4XLNF 1F1ZA 1LFPA 4BDYA 1PUFA 2PMZN 3S14J 2Y75A 1DGRM 1YX5A 5J3LA 1IV8A 2H94A 4ZTJA 5LRSA 1HKQA 2L9VA 1YE9A 3WE3A 2EZIA 3S3NA 1HDDC 3OYEA 1YFHA 1OCRH 2CQXA 2NNNA 3LA2A 4JX5A 3SFIA 4HX8A 3ZN1A 4KIGA 3DPUA 1YIJI 1U78A 2K86A 1SAUA 2Q2EB 3BZCA 4XKWA 1E3OC 2EIJH 4L0YB 1MKMA 1KQ0A 2PG4A 2DA1A 2P8TA 3CCLI 2NVUB 4YFXF 1WJDA 3HPHA 4EJTA 4FE4A 3SQNA 3V7SA 3ZGKA 3SFZA 1JXSA 3E6BA 3I56I 3KPHA 4Z2YA 1Z3YA 1IAWA 4U7DA 4DYRA 5D4RA 2B63J 3HOYJ 4BGDA 2VT2A 2E19A 4BJTA 3ERED 3QODA 5ICEA 2L4MA 4MNUA 3OYHA 2R93J 4JP0A 4BHPA 2M0MA 5E17F 5JI6A 2GIZA 1T6SA 4AIJA 2OQRA 2CUJA 1P7IA 3DF8A 1QBJA 2E60A 1R71A 3VWBA 2AXLA 4L18B 3C18A 1Z6RA 2IW5A 4P55A 1ZGAA 1PJRA 3DPTA 2PX9A 2XGXA 3G2BA 4PZJA 4CCJA 2DT6A 3ECOA 3U1KA 4A2UA 2O7OA 2ZFWA 2PJRA 2LR8A 2R7QA 3S1MJ 1MMAA 1Z77A 1O57A 1XCBA 3ASOH 2FMYA 5K5QA 2G9WA 3QWLA 5E8GA 2HVRA 4FX4A 3OYIA 1MNMC 2DOFA 2X51A 1XX5A 3KETA 2WB1N 1X1PA 1WHUA 3NWTA 5AIPA 5LHIA 4F93B 3ZP5A 3TW7A 2YX4A 4LLLA 1E17A 4CHUA 3FXJA 1ULYA 2R3SA 5EZHA 2GZWA 2QQ9A 1OKRA 1O3SA 1SMYF 4BY1J 2GIVA 2K4JA 1HCRA 1Z1DA 1HDPA 4BBSJ 4BL0B 3PIOF 2VC0A 3ABKH 3GZ5A 4AIKA 1OCZH 5LD2C 2DQRA 2ME0A 4RBOA 3DBRB 4KN4X 2V7FA 2WAFA 2HDDA 3L2VA 4IZZA 2DBBA 4ZYGA 2QM3A 2EV6A 1ZARA 3HOZJ 3ZQ7A 4UNOA 1SFKA 1X3WB 1XTAA 3F6VA 1ERDA 2W84A 4PJMA 2A05A 3S32A 4BQQA 1IW7F 2P7CB 1EH8A 2QZ8A 1R23A 2CV2A 1GVJA 2HOEA 2MW8A 4S05A 2Y30A 3HOSA 1W5TA 1YTYA 3K7AJ 4BAYA 1T0FC 2ELJA 1AA7A 2COMA 1D0ZA 2ELKA 4G9YA 1IRZA 1E0EA 1XPXA 1Z0XA 3A0HC 4HNTA 4M9XA 3BPXA 1NK2P 2VOPA 3CO6C 2K9SA 4XICA 4R1HA 3IH2A 4XSZF 1MDMA 1QGPA 3ZQFA 2M1BA 4KT5C 4E6KG 4Y33A 1WZ2A 1J75A 2XRNA 3A2KA 2XB0X 2EA4A 3RQ4A 5DCMB 5IYCJ 1VQLI 2CUFA 5EJCA 3D5SC 5HDGA 3PUFA 4Y17A 4U0YA 3HHHA 1NTCA 1C0WA 2IGNA 1QNTA 1D5YA 1S29A 2TCTA 5KVRA 3LSTA 5F1JA 5IT3A 3L2RA 1K61A 2QGUA 4JX4A 3JRCA 4GGGA 5KAIC 2BOLA 2JQ7A 3K6GA 5FLXZ 2ZBKA 1BR1A 2VUMJ 3HOVJ 5F64A 2VKHA 2VB6A 3I59B 2ZSIB 2DA2A 3WTVC 1X1DA 4A0YA 1VQ5I 1G6NA 3F6OA 3HXLA 3CCQI 1UFMA 4IX7A 2QBYB 4BJ5C 4UVBA 1FNNA 2NAZA 4PUSA 1SFEA 2DO7A 4B3AA 1XMKA 2M0CA 3U9GA 4OIRF 2Z1DA 3TKYA 3RZDJ 3IH4A 2XV4S 1YO5C 5JFRA 2CU7A 3IH3A 4PJLA 1KU7A 1YIOA 3BC8A 4JQFA 1BC7C 3GTPJ 4OOIA 1KU9A 4LFUA 2EZKA 4X1EA 5BOXA 1FOKA 3BWGA 3RCOA 2OUMA 4WX9A 3SZGA 2RNGA 2X6YA 4RM2A 2E35A 4L0ZB 3LQRA 4A3KJ 5FB2A 2KL4A 2YUSA 2VBYA 2WY7Q 3GBGA 5LGUA 4RA2A 2BW3A 2K9LA 1TWCJ 5E8IA 4LITA 3UKGA 3IUOA 1LPQA 1KQ9A 2X4HA 3JREA 3F0CA 3DQVC 3EUHA 3KZYA 4M9ZA 4Y13A 5D5VB 4O3MA 1T98A 2K4BA 4IHXA 1LJ9A 2F4MB 5C3EJ 2RQQA 4MEXF 1UG2A 5ICCA 2YPRA 4YIRX 5JVGF 2E5ZA 2KKOA 3LSPA 4B3XA 1ZQ3P 1LNWA 4UHTA 1EA3A 2LNBA 2QQBA 4CUGA 1TWGJ 2WAQA 3Q0VA 4ZYDA 2DOEA 1T33A 3AFHA 5E79C 1Y1WJ 1HW5A 1IZ1A 4HX4A 3I71A 2V1UA 1BR2A 3ABTA 4ZTFA 1IXRC 1HF0A 3LAJA 3GFMA 1Q1VA 3RIRA 3MWMA 3QYEA 3R4KA 4UB8C 5FROA 3JRFA 4N4OB 2A68F 3H1CA 1K4SA 2OZ6A 1JKRC 1OISA 2XAQA 3BTCA 1GHCA 2Q8KA 1Y0NA 1S7AA 3DEWA 5IT9K 4RLQA 2XAJA 4HBLA 5JHFA 2QQAA 1U5TA 5HS9A 3ELKA 2BY1A 3GW2A 4BQNA 1SD7A 1TNTA 2XIGA 3FBNB 5F27A 3JRIA 5BPIA 2V1NA 3GTMJ 2LY1A 3QAHA 1QQIA 2NVXJ 2EZHA 2KRCA 1HSTA 3P9KA 2A6EF 2LLKA 1BI1A 3A02A 4NC8A 2KJBA 2TDXA 2KDZA 2HYFA 4II2A 3IKVA 1REPC 2OD5A 4XN0A 3WHCA 3CUQA 4LK1F 1SD4A 4M3DA 5K7HA 2HQ5A 3F3XA 3MAJA 2BV6A 1ODDA 2HTSA 4A3LJ 5IYBJ 2EIKH 3CMMA 1T08B 2QSFX 4I7HA 3JAMZ 1FX7A 1XSXA 2R5YB 5HNHA 1STZA 1YW9A 2MGQA 3JSOA 3BR5A 1Y8QB 1X1CA 3T1BA 1XSDA 2GXGA 3Q5FA 1MBKA 1B9NA 1S7OA 4NQWB 4XM3A 3K4NA 2MH9A 3LQQA 1WI9A 3EQLF 5DUKA 1R36A 3VSKA 3HOTA 3TO6A 1VQPI 5DD4A 4A3CJ 4AVPA 3S15J 4R79A 2HDWA 3OSFA 4L5JA 2W00A 5A2QZ 1AKHA 2A6TA 2PFBA 2QYOA 2CUEA 1I39A 1YITI 5F04A 4CCKA 2VBXA 2EQRA 3CJTB 4EATA 4HLYA 3IC7A 2O8XA 4BNCA 3L2CA 1UCRA 4IHTA 3TEDA 2BVMA 1H88C 2JVHA 4G7OF 4D9JA 3W6KB 2E71A 4M6VA 1WWXA 2Y0MA 2XF5A 3PQKA 1PUFB 1S72I 4YRVA 3HBLA 4KISA 4D0PA 5AONA 3L7WA 2CFXA 4UVCA 4CYCA 3GZ6A 5DTDA 4JK1X 4ZYAA 4B44A 3UR3C 1UB9A 1U9OA 1A04A 2LC2A 3KEQA 3M1EA 3OYGA 4PSWA 1IC8A 3BY6A 1MSFC 2FQ4A 1W36D 4XLFA 4EJVA 1O7FA 3BLYA 4A93J 3EYYA 2VQCA 4XNFA 4HQMA 3QPHA 4LIUA 1IXSB 2Y31A 1ZGWA 2IS6A 2DA4A 5TGTA 1R5ID 2K85A 2JSPA 1R7JA 1J9IA 1ETYA 1N78A 3H92A 3LAPA 3R0AA 4RLFA 4EV0A 3OIOA 5ILSA 4A3MJ 2EH3A 3OOUA 5FFZA 4BE0A 3HIFA 4DJAA 4EGZA 1DDNA 2LOOA 3IWFA 4XONA 4UV8A 1SD5A 2UXNA 2Z5UA 4B48A 4X6AJ 2FNPA 2DN0A 2OC6A 4XLPF 2OAZA 1J7KA 3MVPA 1EV7A 4A3JJ 2W57A 5D5UB 2E7XA 4HDVA 2X0LA 3BCAA 3BZ6A 2LG4A 3M8EA 1F36A 1IN7A 2L5QA 2LVSA 3CP8A 4BKXA 1GUUA 1IN8A 4HV6A 1B59A 2HNHA 3N05A 3OY9A 3OYCA 2L7ZA 1WI3A 5E3NA 1JTXA 3OYJA 4N9HA 4FT8A 5KNLA 1YQAA 2FBIA 3LFKA 3LSKA 1XB4A 3A01A 1ETXA 4NB5A 2TRTA 1B72A 1LFBA 2PJRB 2Y9ZA 2K27A 2VC1A 2V9KA 2W1OA 3BTIA 4IHVA 2F2EA 4U88A 5K1YA 2KIFA 1RPWA 2WAEA 3LWFA 1U2WA 4BYYA 2ECCA 1JI8A 2NS0A 5LEKA 1XN7A 1E3PA 2XF6A 2Y2ZA 3F8FA 2DMTA 1JHFA 2OV7A 4G94A 4DBQA 4LG0A 4A3GJ 3TDUC 1SANA 4U7BA 4P5OA 3M07A 5J1YA 2MSYA 3ZPLA 1RR7A 1MZBA 1Z6TA 4XIDA 1HKTA 1ETKA 3QU3A 2R7OA 3TW6A 3PJRA 4MHGA 4RB3C 3TOAA 4MFDA 3TGNA 2VXDA 3OS0A 4HOBA 5CPRB 4AC0A 4AM3A 2RGVA 4W1UA 2L0KA 2FF4A 3CDIA 2HVSA 3FXQA 1BOAA 1OYIA 1SVOA 2MABA 2DQLA 2CYYA 1YOVB 2KFDA 2M5WA 4JX6A 2LSOA 1LKXA 2EV5A 4A6DA 4B1RA 4OINF 4FHTA 4MQ9F 1OYWA 4Y4RA 2Y0SN 3OIQA 4EQQA 1FJLA 2EFOA 3QOEA 2AHQA 3GMEA 4QIWN 1B8IA 3V7CA 2HS5A 3E5QA 2IS1A 2XPWA 1MMGA 1IXCA 1S8NA 3PNTA 1HSJA 4HF0A 2EFPA 5FFXA 2YU9J 1FOYA 1Y8RB 3E97A 4AYBA 2HI3A 1XD7A 1MDMB 1X1AA 3Q0UA 1ZH5A 1MJBA 2XAFA 3DPLC 2FD5A 1LEBA 2B0LA 2DMNA 3SZTA 5D8LB 3CCSI 2K40A 2KZGA 1FIPA 2Z9OA 5CVJA 1ZLJA 1IRXA 2VQLA 4HRIA 2X6XA 3MN2A 2P4WA 1E3HA 2FEZA 3KIOA 2R4GA 3EETA 3OR1C 3VDXA 1VQ8I 2IP2A 4HDUA 1PUEE 1PP7U 2DU9A 2P6TA 1H89C 3K4KA 2ZXIA 2QA4I 3B73A 4HQEA 3P7NA 3FXMA 4KN7X 1U5TC 1ZR4A 3CQZJ 3DTIA 2HYGD 3LSRA 1ZTRA 3A0BC 5FKOA 3RKWA 3ZQGA 1QA6A 3WU2C 3F22A 4DQ2A 2VIXA 2Z16A 2BEOA 3IWZA 2GWRA 1LDKB 1WKMA 1K83J 2LBFA 3U2RA 3BCBA 2UWMA 1W4MA 2WBMA 2X1DA 2NS7A 4PFOA 3J7ZI 5GAHJ 1X2NA 2STTA 3FM3A 2W7NA 2MH2A 4DZPA 1RRJA 1FPQA 1RUNA 2CQNA 3CUQC 4YFKF 4L9TA 1Z91A 3I64A 2VKDA 4LK0F 3WG7H 3PM1A 5IOYA 2VBZA 5HS7A 5J8FA 2HFHA 2EFNA 2H1LA 3H9QA 3KYDB 2W85A 3CLQA 1XS9A 3EPZA 3KP5A 4BUPA 4Y7NJ 2ZXWH 4KJZA 4BBRJ 2N8GA 1BIBA 3Q9SA 2BW3B 3E0JB 3FXLA 4HF2A 3HKZA 2GBYA 2H1KA 3JW4A 1OFCX 5F0CA 4NNJA 1P7JA 4F92B 3P9CA 3JR9A 1E2XA 2V1DA 3T8RA 2L9SA 3QP5A 3WODF 2XKOA 3F8CA 5E1ZB 4I76A 3V8LA 4LB5A 4UUVA 2CO5A 2E1OA 5LEJA 2RREA 3R60A 1GT0C 2DFEA 4KIFA 5ICGA 1UAAA 4H4KC 3M3YJ 3S3OA 2QENA 4XOTA 2VPLA 1QZZA 1USSA 1FBQA 1XMXA 3COAC 3FM5A 4DOZA 3B6CA 3BTLA 3K1MA 3FXRA 3FXOA 5K5RA 1FEXA 2A69F 2KT0A 3OMYA 3VB2A 2PMZA 2K7LA 3KYCB 3MD2A 4FQGA 5M5WJ 2VASA 3RPQA 1SEUA 1W7PD 2ISYA 4G6DA 4MIMA 4CZCA 3F8MA 1K79A 1IGNA 1R4NB 3QP6A 3DEEA 4DZJA 5J4YA 1OJLA 2DAOA 2Z33A 5HLHA 2WC2A 4P9FA 2CJJA 1T2KA 4C2TA 2HU9A 2HKXA 2MC3A 2D45A 1K6YA 4HZFA 1U5TB 5E1XA 5F08A 5FKNA 2O8KA 3GTJJ 4C9YA 3O8HA 3ABLH 2DJNA 4XMYA 1XG1A 4CDGA 3G4SI 2JRTA 2M30A 2R92J 2M7AA 2IA0A 2XGCA 2BYVE 4CICA 4C2MJ 4IRGA 4BACA 4ENNA 2I5UA 3J81Z 4A3FJ 3OV8A 2NXNB 5IYDJ 1JUPA 1XDUA 4LG3A 1G2HA 1I3QJ 3WU0A 4D1QA 2JN6A 1I6XA 3TOBA 3CUQB 4ZH4F 2E5NA 3BG3A 1MIJA 2HOAA 5E1WA 5GPAA 4BHCA 1HC8A 2RDPA 3S1RJ 5KK1A 5J6XA 4PGHA 1FIAA 4IVNA 3BG7A 3ECHA 1G3YA 4HA8A 5BPDA 2OZUA 2D5VA 6PAXA 2OCEA 1WQ2A 4V19K 1JUSA 4XBFA 4UY8I 2R7UA 1AWCA 4GYGA 1YS6A 1VQOI 3DLAA 3S17J 1ACIA 1TWAJ 4KYWA 1MMDA 4OIQF 3DKYA 1OMIA 3BROA 1Z21A 2ZJRF 3GVAA 4E7SA 4YFNF 3OYBA 5E20A 1XGOA 2JZYA 1NG6A 4X0GA 3PO3J 1KYZA 3TL4X 3GUDA 3KCCA 1SFXA 1AKHB 2W4SA 1D1AA 3TBIA 3WE2A 4Z6YA 2WB1A 5FD6A 2HPMA 2NRAC 2BGCA 2E36A 3BJOA 3D1NI 2DI3A 3G1MA 2QLZA 3TDZC 2CW7A 1GDTA 3E6MA 3H0DA 3L9FA 4CA0A 2EWNA 1OPCA 4YELA 3HOXJ 3WG9A 3H3VK 5J40A 2BXYA 4G8XA 3RDIA 1CGPA 3P5JA 1MD0A 4CYCB 1AU7A 1W0UA 1RZ4A 4WXHA 1QPIA 3C3WA 2E1CA 4XK4A 2PN6A 4C2UA 2K9MA 2WV1A 4AVZA 4ON0A 1K7AA 1Z7LA 2DA6A 4EMSA 2VJ4A 4XRSA 1D1BA 3DTEA 4LMYA 4DIQA 1S6LA 2L54A 4IJAA 1H8AC 2E1NA 2XGEA 5LFAA 3OOPA 4WXCA 1TC3C 1IN5A 4S0HB 3D0SA 1IUYA 3NWSA 2D1VA 1OR7A 4G12A 1VQ4I 5L3DA 1ETWA 2ZNZA 3T8TA 3HC7A 3B02A 5B1AH 4FASD 1MBJA 1D8KA 2FJ1A 3CJRB 3LFUA 4FX0A 4ZZDA 2M34A 1OYYA 1U0JA 1T95A 1ONVA 3MCZA 1OCTC 4MTEA 3RPUD 2LTPA 2F5VA 4I0AA 4HSTA 3L00A 4MTDA 3RI4A 2HOSA 2XB5A 3VFZA 2YX7A 3A01B 1MBGA 3AL0C 2P6SA 1B72B 1HLVA 2M3AA 4C30A 3OYDA 1T38A 1FBSA 2VPRA 3EUKL 3OYMA 3C2HA 3GFLA 5ILVA 2EBIA 2PMUA 1ZG3A 1H0MA 1U6GA 3C2BA 3I53A 3ZMSA 2DTZA 1NK3P 3W6JB 4EGYA 3L2WA 2F4OB 3K2ZA 4M3EA 3V8KA 2H8WA 5K7FA 2BHYA 4BY7J 1ZRFA 3HTSB 4NHJA 4M74A 3K4LA 1R1UA 1LEAA 3H9GA 1B6AA 2KIQA 2LK2A 3GTKJ 5H6RA 2LF7A 4LG0B 1KQ8A 2FA5A 5K5OA 4BQOA 5TISC 4E4HA 5J4VA 3MFKA 2XPVA 3G3ZA 3HUGA 2DYSH 2YU3A 2L02A 2RC4A 3KLOA 5HS8A 3O3KA 5ERIA 3WTZA 2MBFA 2WY8Q 1WJCA 4RB0A 1P9QC 2HYJA 5KHDA 3Q9VA 1O3RA 4CCOA 1FY7A 2NYXA 3G1OA 5GAEJ 2MLKA 1W0TA 4CO8A 2W82A 3KZIC 3VYRB 3DLLF 1ZKGA 3E5XA 4BJ6C 5K7ZA 2EFWA 4QWQA 4AIDA 2DK8A 4XL9A 3HHGA 2E7WA 1O7LA 1XDSA 3VYSB 1FYKA 1X3ZB 2Q1ZB 2VL8A 2VXZA 4XRFA 4KNYA 2JA8J 1B8IB 1WVRA 3ZMTA 3R6SA 1MSEC 1YW7A 3BG5A 1U9NA 1VQNI 2XSDC 1B9MA 5M3MJ 5FD5A 3QU6A 1FWZA 1S5LC 4RGSA 4KMFA 3K0LA 4F55A 3CC4I 2XHKA 5DD8A 2R7TA 1X3UA 4WK8F 2O9LA 1WH5A 3LA3A 5GP9A 2P7VB 1ZHFA 3RQIA 1IN4A 1QO0D 2KDOA 3J80K 5HLIA 2HOTA 3GEZA 2P5LC 5JLXA 4OMZA 2IT0A 4BE1A 2P0WA 4XKBA 1IDYA 1VQKI 2DFFA 4XN3A 1BR4A 3GXOA 3K9TA 1N75A 2BVLA 4OIOF 2AQEA 3A4CA 3S8PA 1TL8A 3M4OJ 1TW2A 4UUTA 2L7FP 3AL0B 4XKCA 2XASA 2VI6A 3CC2I 3PNVA 4WWCA 2CMPA 5H20A 1TQPA 1FYMA 2ZMEA 4IEJA 3FWEA 4G6QA 3WGHA 1Q1HA 2QKLB 3E6CC 2RN7A 5FRNA 3CD6I 3WTTC 3CMAI 3H5NA 5B66C 4Q48A 1P6RA 3K4BA 5JLWA 4S04A 2L7MP 4A3EJ 2LBFB 3U1DA 4I99C 5ICFA 2NNYA 2MD5A 1DQUA 2GA2A 3KP6A 2DPUA 3JTGA 2OA4A 1J0RA 2M4GA 4F3QA 2NVQJ 1QHGA 3CJQB 2DPDA 1RC9A 4DYCA 3GO5A 4E7IA 2R5ZB 4ZJZA 2WV0A 3RKQA 5KAFC 4UB6C 2QSGX 1UMQA 5F0FA 4QLCU 2IJLA 2R7DA 3KP4A 3OWTA 5EGOA 5J1UA 2L2OA 3GCMA 4BE2A 1BN5A 2K9QA 3S93A 4M6YA 2DYRH 4IQJA 2VE8A 3FX3A 4MFEA 4ZDLA 1HXDA 3CCYA 1WGXA 1HW2A 4W97A 1A5JA 2DT5A 1DU0A 3K10A 3LSJA 4BDZA 1JTYA 3J7AO 3QPLA 5LBQA 2VOOA 3GYHX 5ED4A 2CWEA 4IOCF 3U21A 2LKSA 2F48A 2VE9A 1BW6A 2ETHA 4ANJA 2ISZA 5JVTA 2HWVA 2NVYJ 5IP7J 2XAGA 2CW0F 2HR3A 3HRUA 4N9IA 2GOXB 2DMUA 5DV5A 2NOJB 5E3MA 1U8RA 2VJ5A 3GTLJ 3F21A 1GV2A 1Y1VJ 1WCMJ 3VEPA 4QPOA 3F72A 1POGA 1JKOC 1A36A 5EZGA 1IG7A 3AAFA 3FXUA 3Q3SA 3K70D 2HKOA 1BI0A 1PYVA 1BJZA 5FGMA 3WGGA 2DTRA 5M3FJ 1FZPB 2K5CA 3QPTA 4ENMA 1QHHD 4K2EA 5FKMA 3TP3A 1WJFA 1T39A 2JA2A 1BOBA 4MLOA 3BR3A 2D1HA 4YEJA 1PDNC 5GADJ 4RB1A 2AS5F 5FLVA 4BS9A 2ESHA 2F5EA 4OU0A 4PJ0C 5H2FC 1VTNC 1U3EM 3VPRA 3JRDA 3KX2A 2GAUA 1ORKA 1FTZA 2LY2A 4ZYEA 4PFPA 3R0JA 3O8GA 5FJ8J 4IHWA 2XAHA 2XF7A 3PQJA 4PK4A 5BMZA 1LDJA 3N4MA 3HB9A 5CYVA 1A6QA 3H35A 1R9TJ 4CGZA 1BIAA 2EINH 4XR6A 1FSEA 2DK5A 2X85A 5ILUA 5EDNA 3JRHA 3FHNA 2Z99A 3CESA 3FMQA 1OR7C 3FXKA 1G3TA 2R7VA 2KISA 1DPRA 4LLGF 5CJ9A 1X19A 2H6BA 5DM7F 2HXIA 3AG1H 1IO2A 4FISA 1ZGJA 5IPAA 2FBKA 2LY9A 3IHUA 2KRHA
chains in the Genus database with same CATH topology
1CQTA 1X2NA 5BNGA 2LR8A 4C3IJ 3S1MJ 1Z77A 2R7ZJ 4DZPA 2LD5A 2HXOA 1BW5A 1MNMC 1YRNA 3PM1A 5IOYA 3HOUJ 3LOCA 3PO2J 2OPTA 2WB1N 3B6AA 5IP6A 3TW7A 1XS9A 1O4XA 4JYKA 1GVDA 2JWTA 5EZHA 3JRBA 4BY1J 4Y7NJ 4BBRJ 2N8GA 4DYQA 1HCRA 1HDPA 4BBSJ 2GBYA 2H1KA 4V2GA 1OFCX 5F0CA 4MO7A 1P7JA 5EG0A 3JR9A 2ME0A 4Y52J 3W6VA 4RBOA 2IAIA 2WAQN 4I76A 2E1OA 2HDDA 4C3JJ 1GT0C 4EEFG 2ME6A 3HOZJ 3M3YJ 3HDDA 3CDLA 5EF6A 3B6CA 3BTLA 1FEXA 3ZQHA 4I6ZA 4XRSG 2RAEA 2KT0A 3NARA 2MW8A 1ZR2A 2Y30A 5M5WJ 2JA6J 2OF7A 3K7AJ 4MIMA 4FCYA 3QPSA 1IRZA 2ELKA 1IGNA 2DA5A 4DZJA 1Z0XA 1OJLA 2CJJA 1NK2P 2K9SA 4XICA 3S1NJ 1F43A 3DCFA 3IH2A 3ZQFA 1TWFJ 1MH3A 3BR2A 5F08A 5FKNA 2O8KA 3GTJJ 3O8HA 9ANTA 2XB0X 4V2FA 5IYCJ 5IOZA 2CUFA 2DJNA 1XG1A 2LKXA 2XPUA 1MH4A 1NTCA 1MBHA 2R92J 1D5YA 2XGCA 2TCTA 4M3BA 4C2MJ 2ZB9A 5F1JA 5FLMJ 4HNVA 5DS9A 1APLC 1K61A 4JX4A 3JRCA 4RDUA 4A3FJ 5M5XJ 4LOCA 1JKPC 1UHSA 5IYDJ 1JUPA 1G2HA 2VUMJ 1I3QJ 3HOVJ 2JN6A 3L1PA 3HM5A 2DA2A 1BA5A 3BG3A 2HOAA 5GPAA 2GM4A 3S1RJ 2R0QC 1MBEA 1FIAA 2E2JJ 2D5VA 4B3AA 1HOMA 2M0CA 1JUSA 1JT0A 4A69C 3ZQLA 3RZDJ 1JT6A 3IH4A 1JKQC 3S17J 1TWAJ 2CU7A 3IH3A 3GTPJ 3NAUA 1IV6A 2EZKA 3K2AA 4X1EA 5M5YJ 3PO3J 1SFOJ 1AKHB 2Y9YA 3FISA 1VF9A 4A3KJ 3WHBA 3JRGA 2YUSA 5FKKA 3G1LA 3GBGA 2R5ZA 3D1NI 2NVTJ 4D7MA 4C3HJ 1TWCJ 3G1MA 2X6OA 3UKGA 3LNQA 1QVTA 1XC5A 1GDTA 3JREA 3F0CA 3HOXJ 3HGGA 3H3VK 4IHXA 2DA7A 5C3EJ 1GV5A 1UG2A 3LSPA 1ZQ3P 4M3FA 4CYCB 5E3OA 1AU7A 1TWGJ 5IP9J 3Q0VA 2M2EA 1W0UA 1RETA 1QPIA 1T33A 2QF7A 1Y1WJ 1VFCA 2JMWA 4XK4A 4FE7A 3ZOBA 1WPKA 1HF0A 2WV1A 1Q1VA 3JRFA 2DA6A 4B4CA 3S2HJ 1JKRC 2YS9A 4XRSA 3BTCA 5EEAA 1H8AC 2FX0A 2XGEA 3DEWA 4UUSB 1TC3C 4XRMA 4S0HB 4G12A 4FTHA 3FIWA 3BT9A 2NS8A 2H8RA 3GTGJ 1ETWA 5F27A 3JRIA 1JJ6C 3GTMJ 1IDZA 1MBJA 2NVXJ 2EZHA 2FJ1A 2E2IJ 2LLKA 2M34A 1QVUA 4IHYA 1I50J 3SJMA 2JJ7A 4BXXJ 3A02A 1OCTC 2KDZA 5C4XJ 2CQQA 3S2DJ 3HGYA 2LTPA 3HKZN 3WHCA 4M3DA 4DW6A 1RKWA 5K7HA 2HOSA 2HQ5A 2XB5A 3A01B 4A3LJ 1MBGA 1U8BA 3H0GJ 5IYBJ 1B72B 1HLVA 2I10A 4J19A 3S16J 2G0EA 2VPRA 2R5YB 1JJ8C 2EBIA 2ID3A 5EGOB 2MGQA 3BQZA 2IEKA 3BR5A 3C2BA 2DTZA 2K9NA 3QQAA 1NK3P 1ITYA 1MBKA 1OCPA 4M3EA 5K7FA 4BY7J 3LSGA 2ID6A 2P81A 1JGGA 2LK2A 3GTKJ 4GFBA 4A3CJ 3S15J 2MG4A 3GTQJ 2AO9A 3OSFA 1AKHA 2X48A 2XPVA 2CUEA 5C44J 5F04A 5F0HA 2EQRA 3BG9A 1VNDA 2VKVA 3CMYA 1LE8B 2HYJA 1X58A 4ABZA 3RZOJ 3IV5A 3TEDA 3G1OA 2E2HJ 1H88C 1DU6A 1A6IA 1W0TA 2ECBA 5J1RA 4M6VA 1BL0A 4D5FA 1PUFB 1ZKGA 5K7ZA 3HBLA 4A3IJ 4CYCA 3BTJA 2COBA 5DTDA 2JA8J 4AYBN 1B8IB 1U9OA 4QSHA 4D7NA 1IC8A 1MSEC 3BG5A 1IJWC 1U9NA 2FQ4A 1MSFC 2QCOA 2XSDC 5M3MJ 4A3BJ 2CRGA 4A93J 2W48A 1RESA 2LP0A 5HODA 2VKEA 2O9LA 1ZGWA 2Y31A 1WH5A 5GP9A 2DA4A 2LFBA 1IUFA 3RQIA 1ETYA 3OSGA 2HOTA 3Q0WA 5JLXA 3OIOA 4UUSA 4A3MJ 4A3DJ 2EH3A 2IBDA 3MKLA 3OOUA 1IDYA 3A03A 4M3GA 3HEFA 3M4OJ 4UUTA 4NDLA 4X6AJ 2L7FP 2XGDA 3SDGA 2DMPA 2DMQA 2DN0A 3TP0A 2VI6A 1JUMA 1MBFA 3MVPA 4A3JJ 5FKLA 4IEJA 4QTRA 2JA7J 1F36A 2LVSA 1ETVA 2EZLA 1GUUA 4BKXA 5JLWA 2L7ZA 1WI3A 2L7MP 5E3NA 1JTXA 4A3EJ 1ENHA 2NVQJ 3A01A 1ETXA 2TRTA 4DYCA 1LFBA 1B72A 1FTTA 3GTOJ 2Y9ZA 1ETQA 2R5ZB 3BTIA 4IHVA 3RKQA 1UMQA 4D5CA 2X9DA 5GPCA 5F0FA 2R5YA 1RPWA 5EGOA 2XRLA 5J1UA 2ECCA 2GLOA 1YRNB 1TWHJ 3BR0A 2K9QA 2M9HA 3I4MJ 3BR6A 4MFEA 2Y2ZA 3HOWJ 1RKTA 3CCYA 1WGXA 2DMTA 4W97A 1A5JA 1DU0A 4A3GJ 1SANA 1X2MA 3LSJA 1JTYA 5J1YA 2MSYA 3QPLA 1RR7A 4XIDA 1ETKA 2DA3A 2M8GX 3TW6A 1EF4A 4MFDA 3FK7A 5E3LA 5EG0B 1VI0A 2JK3A 1BW6A 3ZQIA 1LE8A 4AC0A 5C4JJ 1ETOA 4W1UA 2L0KA 2NVYJ 3FKIJ 5IP7J 1QRYA 2JA5J 4AUXA 2NOGA 3FK6A 3I4NJ 2DMUA 1S7EA 1PUFA 5E3MA 2PMZN 3GTLJ 3S14J 1GV2A 5J3LA 1Y1VJ 3BQYA 1WCMJ 4JX6A 1JKOC 1POGA 5EZGA 4B1RA 1IG7A 2EZIA 1HDDC 1FJLA 2Y0SN 3Q3SA 3ZQCA 2AHQA 2CQXA 4QIWN 1LFUP 1B8IA 1BJZA 4JX5A 3SFIA 5M3FJ 2XPWA 1U78A 2YU9J 1E3OC 5FKMA 3TP3A 2HI3A 2DA1A 3BR3A 4MLOA 3Q0UA 2FD5A 4FE4A 2DMNA 5FLVA 2K40A 1FIPA 3VPRA 3JRDA 1T56A 1ORKA 3MN2A 4DYRA 2B63J 1FTZA 3HOYJ 2E19A 2L9RA 3O8GA 5FJ8J 3JRAA 4IHWA 1I6HJ 1ZK8A 1H89C 2R93J 3HB9A 4JP0A 1WH7A 1R9TJ 4L5EA 3JRHA 1ZR4A 1P7IA 5EDNA 3CQZJ 3LSRA 1ZTRA 5FKOA 3ZQGA 3BR1A 2HXIA 1K83J 1AHDP 4FISA 5IPAA 2LY9A 3E7LA 2NS7A 2O7OA 5EYRA 3S1QJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQT A;  1X2N A;  5BNG A;  2LR8 A;  4C3I J;  3S1M J;  1Z77 A;  2R7Z J;  4DZP A;  2LD5 A;  2HXO A;  1BW5 A;  1MNM C;  1YRN A;  3PM1 A;  5IOY A;  3HOU J;  3LOC A;  3PO2 J;  2OPT A;  2WB1 N;  3B6A A;  5IP6 A;  3TW7 A;  1XS9 A;  1O4X A;  4JYK A;  1GVD A;  2JWT A;  5EZH A;  3JRB A;  4BY1 J;  4Y7N J;  4BBR J;  2N8G A;  4DYQ A;  1HCR A;  1HDP A;  4BBS J;  2GBY A;  2H1K A;  4V2G A;  1OFC X;  5F0C A;  4MO7 A;  1P7J A;  5EG0 A;  3JR9 A;  2ME0 A;  4Y52 J;  3W6V A;  4RBO A;  2IAI A;  2WAQ N;  4I76 A;  2E1O A;  2HDD A;  4C3J J;  1GT0 C;  4EEF G;  2ME6 A;  3HOZ J;  3M3Y J;  3HDD A;  3CDL A;  5EF6 A;  3B6C A;  3BTL A;  1FEX A;  3ZQH A;  4I6Z A;  4XRS G;  2RAE A;  2KT0 A;  3NAR A;  2MW8 A;  1ZR2 A;  2Y30 A;  5M5W J;  2JA6 J;  2OF7 A;  3K7A J;  4MIM A;  4FCY A;  3QPS A;  1IRZ A;  2ELK A;  1IGN A;  2DA5 A;  4DZJ A;  1Z0X A;  1OJL A;  2CJJ A;  1NK2 P;  2K9S A;  4XIC A;  3S1N J;  1F43 A;  3DCF A;  3IH2 A;  3ZQF A;  1TWF J;  1MH3 A;  3BR2 A;  5F08 A;  5FKN A;  2O8K A;  3GTJ J;  3O8H A;  9ANT A;  2XB0 X;  4V2F A;  5IYC J;  5IOZ A;  2CUF A;  2DJN A;  1XG1 A;  2LKX A;  2XPU A;  1MH4 A;  1NTC A;  1MBH A;  2R92 J;  1D5Y A;  2XGC A;  2TCT A;  4M3B A;  4C2M J;  2ZB9 A;  5F1J A;  5FLM J;  4HNV A;  5DS9 A;  1APL C;  1K61 A;  4JX4 A;  3JRC A;  4RDU A;  4A3F J;  5M5X J;  4LOC A;  1JKP C;  1UHS A;  5IYD J;  1JUP A;  1G2H A;  2VUM J;  1I3Q J;  3HOV J;  2JN6 A;  3L1P A;  3HM5 A;  2DA2 A;  1BA5 A;  3BG3 A;  2HOA A;  5GPA A;  2GM4 A;  3S1R J;  2R0Q C;  1MBE A;  1FIA A;  2E2J J;  2D5V A;  4B3A A;  1HOM A;  2M0C A;  1JUS A;  1JT0 A;  4A69 C;  3ZQL A;  3RZD J;  1JT6 A;  3IH4 A;  1JKQ C;  3S17 J;  1TWA J;  2CU7 A;  3IH3 A;  3GTP J;  3NAU A;  1IV6 A;  2EZK A;  3K2A A;  4X1E A;  5M5Y J;  3PO3 J;  1SFO J;  1AKH B;  2Y9Y A;  3FIS A;  1VF9 A;  4A3K J;  3WHB A;  3JRG A;  2YUS A;  5FKK A;  3G1L A;  3GBG A;  2R5Z A;  3D1N I;  2NVT J;  4D7M A;  4C3H J;  1TWC J;  3G1M A;  2X6O A;  3UKG A;  3LNQ A;  1QVT A;  1XC5 A;  1GDT A;  3JRE A;  3F0C A;  3HOX J;  3HGG A;  3H3V K;  4IHX A;  2DA7 A;  5C3E J;  1GV5 A;  1UG2 A;  3LSP A;  1ZQ3 P;  4M3F A;  4CYC B;  5E3O A;  1AU7 A;  1TWG J;  5IP9 J;  3Q0V A;  2M2E A;  1W0U A;  1RET A;  1QPI A;  1T33 A;  2QF7 A;  1Y1W J;  1VFC A;  2JMW A;  4XK4 A;  4FE7 A;  3ZOB A;  1WPK A;  1HF0 A;  2WV1 A;  1Q1V A;  3JRF A;  2DA6 A;  4B4C A;  3S2H J;  1JKR C;  2YS9 A;  4XRS A;  3BTC A;  5EEA A;  1H8A C;  2FX0 A;  2XGE A;  3DEW A;  4UUS B;  1TC3 C;  4XRM A;  4S0H B;  4G12 A;  4FTH A;  3FIW A;  3BT9 A;  2NS8 A;  2H8R A;  3GTG J;  1ETW A;  5F27 A;  3JRI A;  1JJ6 C;  3GTM J;  1IDZ A;  1MBJ A;  2NVX J;  2EZH A;  2FJ1 A;  2E2I J;  2LLK A;  2M34 A;  1QVU A;  4IHY A;  1I50 J;  3SJM A;  2JJ7 A;  4BXX J;  3A02 A;  1OCT C;  2KDZ A;  5C4X J;  2CQQ A;  3S2D J;  3HGY A;  2LTP A;  3HKZ N;  3WHC A;  4M3D A;  4DW6 A;  1RKW A;  5K7H A;  2HOS A;  2HQ5 A;  2XB5 A;  3A01 B;  4A3L J;  1MBG A;  1U8B A;  3H0G J;  5IYB J;  1B72 B;  1HLV A;  2I10 A;  4J19 A;  3S16 J;  2G0E A;  2VPR A;  2R5Y B;  1JJ8 C;  2EBI A;  2ID3 A;  5EGO B;  2MGQ A;  3BQZ A;  2IEK A;  3BR5 A;  3C2B A;  2DTZ A;  2K9N A;  3QQA A;  1NK3 P;  1ITY A;  1MBK A;  1OCP A;  4M3E A;  5K7F A;  4BY7 J;  3LSG A;  2ID6 A;  2P81 A;  1JGG A;  2LK2 A;  3GTK J;  4GFB A;  4A3C J;  3S15 J;  2MG4 A;  3GTQ J;  2AO9 A;  3OSF A;  1AKH A;  2X48 A;  2XPV A;  2CUE A;  5C44 J;  5F04 A;  5F0H A;  2EQR A;  3BG9 A;  1VND A;  2VKV A;  3CMY A;  1LE8 B;  2HYJ A;  1X58 A;  4ABZ A;  3RZO J;  3IV5 A;  3TED A;  3G1O A;  2E2H J;  1H88 C;  1DU6 A;  1A6I A;  1W0T A;  2ECB A;  5J1R A;  4M6V A;  1BL0 A;  4D5F A;  1PUF B;  1ZKG A;  5K7Z A;  3HBL A;  4A3I J;  4CYC A;  3BTJ A;  2COB A;  5DTD A;  2JA8 J;  4AYB N;  1B8I B;  1U9O A;  4QSH A;  4D7N A;  1IC8 A;  1MSE C;  3BG5 A;  1IJW C;  1U9N A;  2FQ4 A;  1MSF C;  2QCO A;  2XSD C;  5M3M J;  4A3B J;  2CRG A;  4A93 J;  2W48 A;  1RES A;  2LP0 A;  5HOD A;  2VKE A;  2O9L A;  1ZGW A;  2Y31 A;  1WH5 A;  5GP9 A;  2DA4 A;  2LFB A;  1IUF A;  3RQI A;  1ETY A;  3OSG A;  2HOT A;  3Q0W A;  5JLX A;  3OIO A;  4UUS A;  4A3M J;  4A3D J;  2EH3 A;  2IBD A;  3MKL A;  3OOU A;  1IDY A;  3A03 A;  4M3G A;  3HEF A;  3M4O J;  4UUT A;  4NDL A;  4X6A J;  2L7F P;  2XGD A;  3SDG A;  2DMP A;  2DMQ A;  2DN0 A;  3TP0 A;  2VI6 A;  1JUM A;  1MBF A;  3MVP A;  4A3J J;  5FKL A;  4IEJ A;  4QTR A;  2JA7 J;  1F36 A;  2LVS A;  1ETV A;  2EZL A;  1GUU A;  4BKX A;  5JLW A;  2L7Z A;  1WI3 A;  2L7M P;  5E3N A;  1JTX A;  4A3E J;  1ENH A;  2NVQ J;  3A01 A;  1ETX A;  2TRT A;  4DYC A;  1LFB A;  1B72 A;  1FTT A;  3GTO J;  2Y9Z A;  1ETQ A;  2R5Z B;  3BTI A;  4IHV A;  3RKQ A;  1UMQ A;  4D5C A;  2X9D A;  5GPC A;  5F0F A;  2R5Y A;  1RPW A;  5EGO A;  2XRL A;  5J1U A;  2ECC A;  2GLO A;  1YRN B;  1TWH J;  3BR0 A;  2K9Q A;  2M9H A;  3I4M J;  3BR6 A;  4MFE A;  2Y2Z A;  3HOW J;  1RKT A;  3CCY A;  1WGX A;  2DMT A;  4W97 A;  1A5J A;  1DU0 A;  4A3G J;  1SAN A;  1X2M A;  3LSJ A;  1JTY A;  5J1Y A;  2MSY A;  3QPL A;  1RR7 A;  4XID A;  1ETK A;  2DA3 A;  2M8G X;  3TW6 A;  1EF4 A;  4MFD A;  3FK7 A;  5E3L A;  5EG0 B;  1VI0 A;  2JK3 A;  1BW6 A;  3ZQI A;  1LE8 A;  4AC0 A;  5C4J J;  1ETO A;  4W1U A;  2L0K A;  2NVY J;  3FKI J;  5IP7 J;  1QRY A;  2JA5 J;  4AUX A;  2NOG A;  3FK6 A;  3I4N J;  2DMU A;  1S7E A;  1PUF A;  5E3M A;  2PMZ N;  3GTL J;  3S14 J;  1GV2 A;  5J3L A;  1Y1V J;  3BQY A;  1WCM J;  4JX6 A;  1JKO C;  1POG A;  5EZG A;  4B1R A;  1IG7 A;  2EZI A;  1HDD C;  1FJL A;  2Y0S N;  3Q3S A;  3ZQC A;  2AHQ A;  2CQX A;  4QIW N;  1LFU P;  1B8I A;  1BJZ A;  4JX5 A;  3SFI A;  5M3F J;  2XPW A;  1U78 A;  2YU9 J;  1E3O C;  5FKM A;  3TP3 A;  2HI3 A;  2DA1 A;  3BR3 A;  4MLO A;  3Q0U A;  2FD5 A;  4FE4 A;  2DMN A;  5FLV A;  2K40 A;  1FIP A;  3VPR A;  3JRD A;  1T56 A;  1ORK A;  3MN2 A;  4DYR A;  2B63 J;  1FTZ A;  3HOY J;  2E19 A;  2L9R A;  3O8G A;  5FJ8 J;  3JRA A;  4IHW A;  1I6H J;  1ZK8 A;  1H89 C;  2R93 J;  3HB9 A;  4JP0 A;  1WH7 A;  1R9T J;  4L5E A;  3JRH A;  1ZR4 A;  1P7I A;  5EDN A;  3CQZ J;  3LSR A;  1ZTR A;  5FKO A;  3ZQG A;  3BR1 A;  2HXI A;  1K83 J;  1AHD P;  4FIS A;  5IPA A;  2LY9 A;  3E7L A;  2NS7 A;  2O7O A;  5EYR A;  3S1Q J; 
#chains in the Genus database with same CATH topology
 2L01 A;  3W3C A;  1V5G A;  3FKJ A;  4I01 A;  2DJI A;  2MD0 A;  3I4P A;  1SVL A;  2LD5 A;  1V4R A;  4IKF A;  2OJE D;  1BW5 A;  2WTE A;  4KMU X;  3BDD A;  2OPT A;  3C1D A;  2PLY A;  4U87 A;  4E70 A;  3B6A A;  2R7F A;  4XLA A;  4BU2 A;  1Z3X A;  1O4X A;  4JYK A;  1GVD A;  4LD5 A;  2VQH A;  5EEG A;  2JWT A;  2GQQ A;  1IRG A;  3JRB A;  3M8J A;  4IRH A;  2V4J C;  4V2G A;  3L09 A;  3VOE A;  1DP7 P;  4I2O A;  5EG0 A;  4DGW B;  4IL6 C;  1MNE A;  2IAI A;  4RAY A;  3IAM 2;  2KLO A;  1UEL B;  1BM9 A;  3C2G A;  3DP7 A;  4C3J J;  3QYF A;  4N4N B;  1YJ9 I;  4EEF G;  3N97 A;  2DDA A;  5LHH A;  1PP8 F;  2IS2 A;  3HDD A;  4ZYH A;  3CDL A;  5EF6 A;  2F4I A;  1IRF A;  1J2X A;  4RAF A;  1MND A;  2JPB A;  2XAU A;  3ZQH A;  2R7X A;  3NAR A;  5B5E C;  1TLH B;  2H6C A;  2MLG A;  1Y56 A;  2OF7 A;  1K6O A;  3OYN A;  4FCY A;  1K78 A;  5HVQ C;  3S2W A;  1FT9 A;  2DA5 A;  3CF2 A;  3ZMV A;  3KE2 A;  3G6E I;  2KQR A;  4F52 A;  3M9A A;  3TO7 A;  3FF5 A;  3S1N J;  3KP7 A;  1F43 A;  3ZMZ A;  2XC7 A;  1ZN2 A;  1XCV A;  2L4A A;  2ZJ2 A;  1KGS A;  1OCC H;  1DP3 A;  3BR2 A;  1TZL A;  2J5P A;  1ON1 A;  3HRT A;  9ANT A;  4V2F A;  5IOZ A;  1VQ9 I;  2VJJ A;  4HLX A;  2LKX A;  3WTX C;  1MH4 A;  5CKT A;  1MBH A;  2F5C A;  3EUH C;  1W1W E;  1Z05 A;  2KMU A;  4M3B A;  3RJP A;  5GTI C;  5FLM J;  1TTY A;  1D1C A;  3IRR A;  1ON2 A;  4B47 A;  2EIL H;  4LOC A;  2L3D A;  1RR8 C;  1UHS A;  2YSR A;  2O03 A;  1H9G A;  4XOR A;  4EM1 A;  3L1P A;  1EJ9 A;  1BA5 A;  2STW A;  4L9V A;  1F4K A;  1MBE A;  2F5D A;  3H36 A;  4LGW A;  2F6C A;  2E2J J;  2ZME C;  1HOM A;  4KUM A;  2C6Y A;  1TT0 A;  4A69 C;  3HRM A;  4BHB A;  1YS7 A;  4O5V A;  4WXD A;  1JKQ C;  2ZJP F;  2KPM A;  4KA4 A;  1G59 A;  4ITV A;  2CV0 A;  2CH0 A;  2PJP A;  3ZQQ A;  1TT5 B;  2KIM A;  2VJI A;  2E34 A;  2G7U A;  2CQ7 A;  5M5Y J;  3H3U A;  5J8C A;  1QU3 A;  1SFO J;  2IGO A;  2Y9Y A;  4UVA A;  3FIS A;  3HPG A;  4I02 A;  3SDB A;  3HUG B;  1VF9 A;  4B8X A;  4MEY F;  3WGI A;  3WHB A;  4II3 A;  5FKK A;  3G1L A;  2HZT A;  3BOQ A;  2R5Z A;  1M1E B;  4E7L A;  2NVT J;  2MFZ A;  2X6O A;  1XC5 A;  3EUA A;  3TQN A;  4IXA A;  3OIP A;  4PCQ A;  4ESB A;  2DOD A;  4IO9 F;  3W2W A;  2DW4 A;  3KP3 A;  3HGG A;  4LB6 B;  3K1P A;  2R7S A;  2DA7 A;  5D5W B;  1I3A A;  1GV5 A;  3MZY A;  4IRI A;  5CLS A;  4KIT B;  3SEQ A;  4GRI A;  1IF1 A;  2P5K A;  4LIV A;  2BHZ A;  1GXQ A;  3CJN A;  3K4J A;  3CO7 C;  4G7H F;  1A35 A;  4HG2 A;  2M2E A;  3AKZ A;  5CVI A;  3CF5 F;  1SMT A;  1VFC A;  2JMW A;  5L3G A;  4FE7 A;  3CP2 A;  3EDP A;  3LL7 A;  1WPK A;  5A2Q K;  4B43 A;  3CCM I;  1GXP A;  1MW7 A;  3S2H J;  1BI3 A;  1MMN A;  1S3J A;  2VBW A;  1WFX A;  2YS9 A;  4J00 A;  1G4D A;  2EPF A;  2FX0 A;  2X6W A;  4HEA 2;  4M6X A;  2JUC A;  1YW8 A;  4M72 A;  5JR3 A;  2M7B A;  3DKX A;  2OU2 A;  4FTH A;  3FIW A;  2R7R A;  4RGU A;  2H8R A;  1RUO A;  1D5V A;  1L3L A;  1W7P A;  2MA3 A;  5B1B H;  1JJ6 C;  1R4M B;  2FRH A;  5CVV A;  2ZJQ F;  4RB2 C;  2EK5 A;  2HDC A;  3BPV A;  2HVQ A;  2DCE A;  2LDU A;  2ZME B;  1QVU A;  4IHY A;  1I50 J;  2JJ7 A;  1X4P A;  1P2F A;  5FRM A;  1V5F A;  3MMY B;  3V4G A;  3VSL A;  5JHU A;  4BXX J;  3RKX A;  2OTL I;  2CQQ A;  3H3Z A;  3HGY A;  3HKZ N;  4PJN A;  2KP6 A;  3OR2 C;  4OAZ A;  1W36 C;  4N0B A;  3H0G J;  2A5Y B;  4HAM A;  2I10 A;  5BQT A;  4J19 A;  2G0E A;  3S16 J;  3CME I;  3S1Q J;  3BJA A;  3H5A A;  3I9V 2;  5DEQ A;  3GX4 X;  5EGO B;  3BQZ A;  4U0W A;  1UHM A;  1P4X A;  1QZE A;  2XSJ C;  4WF2 A;  3K69 A;  1LUJ B;  1G8X A;  4IQ4 A;  3G71 I;  1ZEL A;  4YG2 F;  5J47 A;  1HW1 A;  1WRJ A;  4GYI A;  3DV8 A;  3OYF A;  4KIC A;  1G3W A;  1VQ7 I;  4RGX A;  3BZK A;  1OCO H;  3NEU A;  3D5L A;  3GTQ J;  2AO9 A;  2CS3 A;  3ASN H;  5HDK A;  1O3Q A;  4HPQ A;  2VQG A;  1R5G A;  3ABU A;  2LRD A;  2BBY A;  2H09 A;  5F0H A;  2FNA A;  4J01 A;  1Y39 A;  2VKV A;  2Z3Y A;  4ABZ A;  1X58 A;  3RZO J;  3IV5 A;  1KU2 A;  1FP2 A;  4QPQ A;  4Q4Z F;  3W2A A;  1A6I A;  5IT9 Z;  1TP4 A;  1J09 A;  5J1R A;  2V1X A;  1RIO H;  1BL0 A;  4D5F A;  3KLN A;  4BEH A;  5HNF A;  1ZG5 A;  4ESJ A;  3PL8 A;  4YII A;  4NC6 A;  3HG9 A;  2IVM A;  1DGW Y;  4A0X A;  4P9U A;  1X4O A;  4A3I J;  2ZNY A;  2O3F A;  1NG7 A;  1W5S A;  2KHM A;  3P9I A;  1X1B A;  2COB A;  1GLN A;  2A5W A;  3RKY A;  4GDF A;  2OBP A;  5F6F A;  1VQM I;  4HF1 A;  4XLE A;  4QSH A;  1BBY A;  1WJB A;  1UHW A;  2IA2 A;  2I8D A;  4A3B J;  1BJA A;  1L0O C;  1RES A;  2LP0 A;  3I5U A;  4UV9 A;  3SEZ A;  3MKY B;  5HOD A;  4XSX F;  2ZKZ A;  2VKE A;  3HSR A;  1Y0U A;  3O6B B;  4M9S A;  4A0Z A;  3E1S A;  2QVO A;  1IUF A;  2XVC A;  2V9P A;  3PUB A;  5D4S A;  4XKV A;  5D6E A;  4CZZ A;  3Q0W A;  2RVC A;  4UUS A;  3LA7 A;  1Y6I A;  1RI7 A;  1J59 A;  3AG3 H;  4A3D J;  2K3P A;  2W25 A;  3KYL A;  2R7W A;  3T5X A;  2IGM A;  2HGC A;  2BY0 A;  3E3V A;  4M3G A;  3V8J A;  5L3B A;  3HEF A;  3HRS A;  4NDL A;  4HYE A;  3SDG A;  3HZJ A;  4CYD A;  2DMQ A;  1JUM A;  3ZMD A;  1MBF A;  3M1C A;  4P1W A;  1I5Z A;  5FKL A;  3NQO A;  4QTR A;  3DWL E;  2ZFU A;  2HTJ A;  3KP2 A;  2EZL A;  1JGS A;  3V7R A;  2RQP A;  1P4A A;  4CCN A;  4PJJ A;  3FBI B;  3H5R A;  3RTR A;  1LB2 A;  3MKW B;  3ZRG A;  1FTT A;  1O3T A;  3G73 A;  3GTO J;  2B7E A;  1YG2 A;  2QQ8 A;  4D5C A;  2VON A;  3LSM A;  4YIF A;  2XRL A;  1EH6 A;  2GLO A;  2HPI A;  2Y48 A;  3RPU A;  3BR0 A;  4G6T B;  1JE8 A;  3D5R C;  1I27 A;  1TW3 A;  2IRF G;  3BR6 A;  3M7G A;  1HA8 A;  1FP1 D;  4L9J A;  1RKT A;  1SAX A;  5DYM A;  2A07 F;  3I0T A;  3ULQ B;  1N77 A;  1X2M A;  2FOK A;  4H0E A;  4Q5S F;  2XDV A;  2LKP A;  4B09 A;  2DA3 A;  2QSH X;  4JBA A;  2ADU A;  3ESW B;  2PMH A;  2WA0 A;  3ZMU A;  3FK7 A;  3L2U A;  5EG0 B;  2JK3 A;  3VYU B;  5TRD A;  3ZQI A;  5HLT A;  2B9S A;  1LE8 A;  5C4J J;  1ETO A;  2V79 A;  3DTK A;  3S3M A;  5HDN A;  3FKI J;  4KIB A;  2JA5 J;  2CSO A;  4AUX A;  3I4N J;  5F1R A;  3IAS 2;  1S7E A;  4WCG A;  4HW0 A;  5CQG A;  1BC8 C;  3BQY A;  2UZK A;  2O5R A;  1VQ6 I;  3IL2 A;  1AOY A;  1WJA A;  4F7Z A;  2FSW A;  2FML A;  5CQE A;  3V42 A;  3ZQC A;  1R00 A;  2PEX A;  1LFU P;  1KA8 A;  1FMW A;  1V5E A;  4CCM A;  1LQ1 A;  3ZXS A;  1K78 B;  4NUB A;  3K4C A;  3HJE A;  4HX7 A;  2RV8 A;  3ROU A;  3FMS A;  1HKS A;  3PFY A;  3PNY A;  4KDP A;  2AQF A;  3PFI A;  2UUZ A;  1WSU A;  3DU5 A;  3DBL B;  4Y15 A;  3CCU I;  1CF7 A;  2KRF A;  3O2P E;  3AG2 H;  2EIM H;  1T56 A;  3CDH A;  2DFH A;  3MZH A;  2OCC H;  1YLF A;  1UG0 A;  2L9R A;  2PI0 A;  3GZN B;  3JRA A;  2VOD A;  1I1S A;  2KZV A;  1D0Y A;  3JTH A;  5CVU A;  1ZK8 A;  1I6H J;  1LVK A;  2CV1 A;  4OAY A;  1WH7 A;  1UZC A;  1YYV A;  2IS4 A;  4L5E A;  2D2W A;  4RAG A;  2HQA A;  1YJW I;  1MJA A;  4PDK A;  4EJU A;  1LVA A;  2A3S A;  3BR1 A;  4CH7 A;  2EB7 A;  5B3S H;  1AHD P;  1UST A;  1H9T A;  3FDY A;  2DOA A;  2WAD A;  3E7L A;  3DFG A;  3M8F A;  5LRR A;  1R5H A;  2JSC A;  5EYR A;  3IKT A;  1CQT A;  5BNG A;  2KJC A;  4C3I J;  2V6C A;  1DPU A;  3ZR8 X;  2R7Z J;  4BQA A;  2X1E A;  2HXO A;  3J7Y J;  3JSP A;  3CCJ I;  3ZN0 A;  1YRN A;  3ML6 A;  3CCE I;  3REO A;  3HOU J;  3LOC A;  3J81 K;  3PO2 J;  1EH7 A;  5L3E A;  2ZO4 A;  4P96 A;  2RNJ A;  3SZP A;  2P5V A;  5IP6 A;  2DXI A;  3J7A Y;  4EM2 A;  3WTW C;  3KEO A;  3RYP A;  1YHQ I;  4DYQ A;  1FMV A;  2E1M C;  5HLG A;  2IGK A;  3RYR A;  4MO7 A;  1FBU A;  1XGN A;  5BS6 A;  3FZV A;  4Y52 J;  3W6V A;  2WAQ N;  1YX3 A;  3CTA A;  2CG4 A;  5KCM A;  4EM0 B;  1XGS A;  4IF4 A;  2MC4 A;  4IHS A;  2ME6 A;  2ZXJ A;  4Q47 A;  4EJW A;  1XSV A;  2IPQ X;  1D0X A;  1ZAO A;  3F23 A;  5IY5 H;  4O6J A;  2IXS A;  3OS1 A;  2AXT C;  3GFJ A;  2XUB A;  4I6Z A;  4XRS G;  2RAE A;  2JT1 A;  4EVI A;  3OL4 A;  5CVR A;  1DUX C;  3KFW X;  4ASN A;  4RM3 A;  1ZR2 A;  2F5F A;  2JA6 J;  3VOD A;  3BP8 A;  2PQ8 A;  3QPS A;  2A6H F;  3FMR A;  4HSR A;  1FYL A;  2Q2E A;  5D5X B;  3HYI A;  3OYK A;  2VT3 A;  4GCV A;  4PGG A;  3DCF A;  4IPA A;  4XOP A;  2GOM A;  1TWF J;  2BY3 A;  4HNU A;  1MH3 A;  2Y69 H;  2FUG 2;  2FBH A;  5L3F A;  4BH9 A;  1Z7U A;  4EJO A;  1W7P B;  2XPU A;  1FLI A;  1IN6 A;  2V26 A;  2ZB9 A;  1APL C;  4HNV A;  5DDG A;  5DS9 A;  5DUI A;  2LYC A;  2JUG A;  4RDU A;  1W5C C;  5M5X J;  4LJZ F;  5LGN A;  3E5U A;  1JKP C;  4XLH A;  1XMA A;  2ZCW A;  5LLQ A;  2LRE A;  4FET A;  4GO1 A;  3HM5 A;  3BJ6 A;  1SC7 A;  4IOA F;  3A1Y A;  2WWY A;  4L5I A;  4TV7 A;  2GM4 A;  1I1G A;  3I3L A;  2R0Q C;  3I54 A;  2QUF A;  3LMM A;  4GXO A;  4RAZ A;  2DLL A;  1NH3 A;  1D8J A;  3IP4 B;  4XLC A;  1ZRE A;  1HQC A;  2Z2S B;  3CCV I;  3WTS C;  4E7H A;  1JT0 A;  4LLN A;  1J5Y A;  2HEO A;  3ZQL A;  1JT6 A;  2CW8 A;  3GLL A;  3QOP A;  1R6R A;  2E1M B;  3F8B A;  3LSH A;  1UJ8 A;  2JTV A;  1OLT A;  3C7J A;  2ACJ A;  3NAU A;  1IV6 A;  2JVG A;  3K2A A;  4E7Z A;  2Q0O A;  2HQN A;  4AWX B;  1FOW A;  5EEH A;  4PSX A;  3ZCO A;  4DBR A;  1KON A;  4NC7 A;  2PBI A;  1R22 A;  3WTY C;  3JRG A;  2GA1 A;  3OYA A;  2W24 A;  5DCF A;  4D7M A;  5HOO A;  4C3H J;  2K3F A;  3LNQ A;  1QVT A;  2VLA A;  3OL3 A;  4XQF A;  1RNL A;  5L3C A;  4BEH B;  4E7K A;  3WTU C;  3K4M A;  2XRO A;  1R1T A;  4M3F A;  5E3O A;  4E7J A;  5FLX K;  5IP9 J;  2QEX I;  3QRF F;  1RET A;  2QF7 A;  4HV5 A;  3SHF A;  2LF8 A;  2A61 A;  3OS2 A;  4KFC A;  3HL2 A;  3ZOB A;  4ETS A;  2VN2 A;  4OWR B;  4MQV A;  3L2Q A;  3EYI A;  1QPM A;  2QWW A;  4B4C A;  2K02 A;  2GXB A;  2V9V A;  2LH9 A;  1JHH A;  2XKP A;  5EEA A;  1XGM A;  2JPC A;  4UUS B;  4G7Z F;  5D6F A;  4XRM A;  3GWZ A;  4F91 B;  1WJ5 A;  3HSF A;  2HQR A;  3BT9 A;  5DCM A;  2ICW G;  3AG4 H;  4ZZL A;  2NS8 A;  2UXX A;  3GTG J;  4OMY A;  1R58 A;  3PIP F;  1KU3 A;  4DNC A;  1SVM A;  3MQ0 A;  1IDZ A;  3SYT A;  2RKH A;  2FXA A;  5GTH C;  3R61 A;  1MMS A;  2E2I J;  3SJM A;  2Y0S A;  2L9N A;  3DXJ F;  4NBQ A;  5C4X J;  3S2D J;  1TBX A;  4ZDO A;  2M87 A;  4A12 A;  3F8N A;  3I59 A;  4DW6 A;  1RKW A;  2ELH A;  4RMN A;  2M4K A;  1ZRD A;  1U8B A;  2BXZ A;  1KZH A;  2QBY A;  2ZSH B;  2EJR A;  3QYB A;  3VYT B;  2LMD A;  1V54 H;  1JJ8 C;  2ID3 A;  1FC3 A;  4Y3O A;  3ABM H;  2IEK A;  1TQM A;  1B1B A;  2JRM A;  2K9N A;  3QQA A;  3IRQ A;  4ENK A;  1ITY A;  1R49 A;  1ZG1 A;  4ENJ A;  3HTU A;  1OCP A;  1P4W A;  3OYL A;  2M45 A;  3ISP A;  2ID6 A;  3LSG A;  4KT6 A;  4I09 A;  1V3F A;  2P81 A;  4BXU A;  1JGG A;  2BZT A;  3PSI A;  1T8I A;  4GFB A;  1SD6 A;  2DDB A;  2MG4 A;  3WU1 B;  5H6Q A;  3BG6 A;  4BXF A;  2GXA A;  1WJE A;  3JCU C;  1S9H A;  2KIU A;  2X48 A;  3HSE A;  5C44 J;  3CC7 I;  4A5N A;  2IA1 A;  5LHG A;  1B4A A;  3BG9 A;  3MEX A;  1VND A;  1ZLK A;  2V6E A;  4UXN A;  4L9N A;  3CMY A;  1LE8 B;  3SXY A;  1G3S A;  2E2H J;  1DU6 A;  3DBH B;  2ECB A;  4OIP F;  3DKW A;  2J5O A;  2OQG A;  1T0F A;  3MZ8 A;  2DFI A;  1HBX G;  3I58 A;  1QZY A;  1V55 H;  2YR2 A;  4AD9 A;  3CCR I;  3CUO A;  3BTJ A;  4AU7 A;  3RSN A;  4CXF A;  4CSW A;  4AYB N;  1P92 A;  3H9J A;  1Z9C A;  5AIQ A;  2M8E A;  5TJJ A;  3T0Y A;  4D7N A;  4ESF A;  1IJW C;  4ZDP A;  2QCO A;  4M73 A;  2CRG A;  2W48 A;  1PVE A;  3JAM K;  3FHZ A;  2L7K A;  1KYW A;  1YI2 I;  4AIH A;  2LFB A;  4ZC3 A;  3OSG A;  5E18 F;  1D3Y A;  3GF2 A;  1CF7 B;  1BI2 A;  2IBD A;  4M71 A;  3MKL A;  1F5T A;  5LGT A;  1SFU A;  1MJ9 A;  2ZC2 A;  1K4T A;  2BE5 F;  3A03 A;  2FU4 A;  4U0V A;  3PSF A;  3GLX A;  3NRV A;  3KEY A;  3W2V A;  2XGD A;  2FQ3 A;  2EFQ A;  2DMP A;  3TP0 A;  5D8K B;  4JOM A;  3KZZ A;  1A31 A;  3UNG C;  2HZD A;  4I0B A;  1N25 A;  2JA7 J;  2ZXH A;  3K70 C;  1ETV A;  1TQI A;  4RS8 A;  2DT7 B;  3X2Q H;  1R1V A;  2O0Y A;  1ENH A;  2CQK A;  1EKE A;  2EV0 A;  1FSH A;  1TNS A;  2O61 A;  3K1N A;  2FOW A;  1ETQ A;  3I55 I;  3TO9 A;  3F9K A;  5GPC A;  2X9D A;  3DU6 A;  2R5Y A;  4CCL A;  2UV1 A;  2QKM B;  3TMO A;  2G7H A;  1NHA A;  5DM6 F;  1YRN B;  1TWH J;  1Z67 A;  2CGP A;  2H27 A;  2M9H A;  4NQW A;  5GAG J;  2O6G E;  3I4M J;  2EA2 A;  3CLO A;  4I98 B;  1YJN I;  2BY2 A;  3ERM A;  4A5M A;  3LSI A;  2CFO A;  1FOX A;  3ONQ A;  3HOW J;  2ESN A;  1OQY A;  4MGR A;  3DEU A;  2X1C A;  1F9N A;  3GFI A;  4R8H A;  3MKZ A;  2M8G X;  1EF4 A;  1VZ0 A;  2CUZ A;  2MYS A;  3E6D A;  4RGR A;  5E3L A;  1VI0 A;  4A6E A;  1MGT A;  3J80 Z;  1ZRC A;  1LDD A;  5FO5 A;  1ZYR F;  1QRY A;  2FE3 A;  3CZ6 A;  2OTJ I;  2NOG A;  3FK6 A;  4XLN F;  1F1Z A;  1LFP A;  4BDY A;  1PUF A;  2PMZ N;  3S14 J;  2Y75 A;  1DGR M;  1YX5 A;  5J3L A;  1IV8 A;  2H94 A;  4ZTJ A;  5LRS A;  1HKQ A;  2L9V A;  1YE9 A;  3WE3 A;  2EZI A;  3S3N A;  1HDD C;  3OYE A;  1YFH A;  1OCR H;  2CQX A;  2NNN A;  3LA2 A;  4JX5 A;  3SFI A;  4HX8 A;  3ZN1 A;  4KIG A;  3DPU A;  1YIJ I;  1U78 A;  2K86 A;  1SAU A;  2Q2E B;  3BZC A;  4XKW A;  1E3O C;  2EIJ H;  4L0Y B;  1MKM A;  1KQ0 A;  2PG4 A;  2DA1 A;  2P8T A;  3CCL I;  2NVU B;  4YFX F;  1WJD A;  3HPH A;  4EJT A;  4FE4 A;  3SQN A;  3V7S A;  3ZGK A;  3SFZ A;  1JXS A;  3E6B A;  3I56 I;  3KPH A;  4Z2Y A;  1Z3Y A;  1IAW A;  4U7D A;  4DYR A;  5D4R A;  2B63 J;  3HOY J;  4BGD A;  2VT2 A;  2E19 A;  4BJT A;  3ERE D;  3QOD A;  5ICE A;  2L4M A;  4MNU A;  3OYH A;  2R93 J;  4JP0 A;  4BHP A;  2M0M A;  5E17 F;  5JI6 A;  2GIZ A;  1T6S A;  4AIJ A;  2OQR A;  2CUJ A;  1P7I A;  3DF8 A;  1QBJ A;  2E60 A;  1R71 A;  3VWB A;  2AXL A;  4L18 B;  3C18 A;  1Z6R A;  2IW5 A;  4P55 A;  1ZGA A;  1PJR A;  3DPT A;  2PX9 A;  2XGX A;  3G2B A;  4PZJ A;  4CCJ A;  2DT6 A;  3ECO A;  3U1K A;  4A2U A;  2O7O A;  2ZFW A;  2PJR A;  2LR8 A;  2R7Q A;  3S1M J;  1MMA A;  1Z77 A;  1O57 A;  1XCB A;  3ASO H;  2FMY A;  5K5Q A;  2G9W A;  3QWL A;  5E8G A;  2HVR A;  4FX4 A;  3OYI A;  1MNM C;  2DOF A;  2X51 A;  1XX5 A;  3KET A;  2WB1 N;  1X1P A;  1WHU A;  3NWT A;  5AIP A;  5LHI A;  4F93 B;  3ZP5 A;  3TW7 A;  2YX4 A;  4LLL A;  1E17 A;  4CHU A;  3FXJ A;  1ULY A;  2R3S A;  5EZH A;  2GZW A;  2QQ9 A;  1OKR A;  1O3S A;  1SMY F;  4BY1 J;  2GIV A;  2K4J A;  1HCR A;  1Z1D A;  1HDP A;  4BBS J;  4BL0 B;  3PIO F;  2VC0 A;  3ABK H;  3GZ5 A;  4AIK A;  1OCZ H;  5LD2 C;  2DQR A;  2ME0 A;  4RBO A;  3DBR B;  4KN4 X;  2V7F A;  2WAF A;  2HDD A;  3L2V A;  4IZZ A;  2DBB A;  4ZYG A;  2QM3 A;  2EV6 A;  1ZAR A;  3HOZ J;  3ZQ7 A;  4UNO A;  1SFK A;  1X3W B;  1XTA A;  3F6V A;  1ERD A;  2W84 A;  4PJM A;  2A05 A;  3S32 A;  4BQQ A;  1IW7 F;  2P7C B;  1EH8 A;  2QZ8 A;  1R23 A;  2CV2 A;  1GVJ A;  2HOE A;  2MW8 A;  4S05 A;  2Y30 A;  3HOS A;  1W5T A;  1YTY A;  3K7A J;  4BAY A;  1T0F C;  2ELJ A;  1AA7 A;  2COM A;  1D0Z A;  2ELK A;  4G9Y A;  1IRZ A;  1E0E A;  1XPX A;  1Z0X A;  3A0H C;  4HNT A;  4M9X A;  3BPX A;  1NK2 P;  2VOP A;  3CO6 C;  2K9S A;  4XIC A;  4R1H A;  3IH2 A;  4XSZ F;  1MDM A;  1QGP A;  3ZQF A;  2M1B A;  4KT5 C;  4E6K G;  4Y33 A;  1WZ2 A;  1J75 A;  2XRN A;  3A2K A;  2XB0 X;  2EA4 A;  3RQ4 A;  5DCM B;  5IYC J;  1VQL I;  2CUF A;  5EJC A;  3D5S C;  5HDG A;  3PUF A;  4Y17 A;  4U0Y A;  3HHH A;  1NTC A;  1C0W A;  2IGN A;  1QNT A;  1D5Y A;  1S29 A;  2TCT A;  5KVR A;  3LST A;  5F1J A;  5IT3 A;  3L2R A;  1K61 A;  2QGU A;  4JX4 A;  3JRC A;  4GGG A;  5KAI C;  2BOL A;  2JQ7 A;  3K6G A;  5FLX Z;  2ZBK A;  1BR1 A;  2VUM J;  3HOV J;  5F64 A;  2VKH A;  2VB6 A;  3I59 B;  2ZSI B;  2DA2 A;  3WTV C;  1X1D A;  4A0Y A;  1VQ5 I;  1G6N A;  3F6O A;  3HXL A;  3CCQ I;  1UFM A;  4IX7 A;  2QBY B;  4BJ5 C;  4UVB A;  1FNN A;  2NAZ A;  4PUS A;  1SFE A;  2DO7 A;  4B3A A;  1XMK A;  2M0C A;  3U9G A;  4OIR F;  2Z1D A;  3TKY A;  3RZD J;  3IH4 A;  2XV4 S;  1YO5 C;  5JFR A;  2CU7 A;  3IH3 A;  4PJL A;  1KU7 A;  1YIO A;  3BC8 A;  4JQF A;  1BC7 C;  3GTP J;  4OOI A;  1KU9 A;  4LFU A;  2EZK A;  4X1E A;  5BOX A;  1FOK A;  3BWG A;  3RCO A;  2OUM A;  4WX9 A;  3SZG A;  2RNG A;  2X6Y A;  4RM2 A;  2E35 A;  4L0Z B;  3LQR A;  4A3K J;  5FB2 A;  2KL4 A;  2YUS A;  2VBY A;  2WY7 Q;  3GBG A;  5LGU A;  4RA2 A;  2BW3 A;  2K9L A;  1TWC J;  5E8I A;  4LIT A;  3UKG A;  3IUO A;  1LPQ A;  1KQ9 A;  2X4H A;  3JRE A;  3F0C A;  3DQV C;  3EUH A;  3KZY A;  4M9Z A;  4Y13 A;  5D5V B;  4O3M A;  1T98 A;  2K4B A;  4IHX A;  1LJ9 A;  2F4M B;  5C3E J;  2RQQ A;  4MEX F;  1UG2 A;  5ICC A;  2YPR A;  4YIR X;  5JVG F;  2E5Z A;  2KKO A;  3LSP A;  4B3X A;  1ZQ3 P;  1LNW A;  4UHT A;  1EA3 A;  2LNB A;  2QQB A;  4CUG A;  1TWG J;  2WAQ A;  3Q0V A;  4ZYD A;  2DOE A;  1T33 A;  3AFH A;  5E79 C;  1Y1W J;  1HW5 A;  1IZ1 A;  4HX4 A;  3I71 A;  2V1U A;  1BR2 A;  3ABT A;  4ZTF A;  1IXR C;  1HF0 A;  3LAJ A;  3GFM A;  1Q1V A;  3RIR A;  3MWM A;  3QYE A;  3R4K A;  4UB8 C;  5FRO A;  3JRF A;  4N4O B;  2A68 F;  3H1C A;  1K4S A;  2OZ6 A;  1JKR C;  1OIS A;  2XAQ A;  3BTC A;  1GHC A;  2Q8K A;  1Y0N A;  1S7A A;  3DEW A;  5IT9 K;  4RLQ A;  2XAJ A;  4HBL A;  5JHF A;  2QQA A;  1U5T A;  5HS9 A;  3ELK A;  2BY1 A;  3GW2 A;  4BQN A;  1SD7 A;  1TNT A;  2XIG A;  3FBN B;  5F27 A;  3JRI A;  5BPI A;  2V1N A;  3GTM J;  2LY1 A;  3QAH A;  1QQI A;  2NVX J;  2EZH A;  2KRC A;  1HST A;  3P9K A;  2A6E F;  2LLK A;  1BI1 A;  3A02 A;  4NC8 A;  2KJB A;  2TDX A;  2KDZ A;  2HYF A;  4II2 A;  3IKV A;  1REP C;  2OD5 A;  4XN0 A;  3WHC A;  3CUQ A;  4LK1 F;  1SD4 A;  4M3D A;  5K7H A;  2HQ5 A;  3F3X A;  3MAJ A;  2BV6 A;  1ODD A;  2HTS A;  4A3L J;  5IYB J;  2EIK H;  3CMM A;  1T08 B;  2QSF X;  4I7H A;  3JAM Z;  1FX7 A;  1XSX A;  2R5Y B;  5HNH A;  1STZ A;  1YW9 A;  2MGQ A;  3JSO A;  3BR5 A;  1Y8Q B;  1X1C A;  3T1B A;  1XSD A;  2GXG A;  3Q5F A;  1MBK A;  1B9N A;  1S7O A;  4NQW B;  4XM3 A;  3K4N A;  2MH9 A;  3LQQ A;  1WI9 A;  3EQL F;  5DUK A;  1R36 A;  3VSK A;  3HOT A;  3TO6 A;  1VQP I;  5DD4 A;  4A3C J;  4AVP A;  3S15 J;  4R79 A;  2HDW A;  3OSF A;  4L5J A;  2W00 A;  5A2Q Z;  1AKH A;  2A6T A;  2PFB A;  2QYO A;  2CUE A;  1I39 A;  1YIT I;  5F04 A;  4CCK A;  2VBX A;  2EQR A;  3CJT B;  4EAT A;  4HLY A;  3IC7 A;  2O8X A;  4BNC A;  3L2C A;  1UCR A;  4IHT A;  3TED A;  2BVM A;  1H88 C;  2JVH A;  4G7O F;  4D9J A;  3W6K B;  2E71 A;  4M6V A;  1WWX A;  2Y0M A;  2XF5 A;  3PQK A;  1PUF B;  1S72 I;  4YRV A;  3HBL A;  4KIS A;  4D0P A;  5AON A;  3L7W A;  2CFX A;  4UVC A;  4CYC A;  3GZ6 A;  5DTD A;  4JK1 X;  4ZYA A;  4B44 A;  3UR3 C;  1UB9 A;  1U9O A;  1A04 A;  2LC2 A;  3KEQ A;  3M1E A;  3OYG A;  4PSW A;  1IC8 A;  3BY6 A;  1MSF C;  2FQ4 A;  1W36 D;  4XLF A;  4EJV A;  1O7F A;  3BLY A;  4A93 J;  3EYY A;  2VQC A;  4XNF A;  4HQM A;  3QPH A;  4LIU A;  1IXS B;  2Y31 A;  1ZGW A;  2IS6 A;  2DA4 A;  5TGT A;  1R5I D;  2K85 A;  2JSP A;  1R7J A;  1J9I A;  1ETY A;  1N78 A;  3H92 A;  3LAP A;  3R0A A;  4RLF A;  4EV0 A;  3OIO A;  5ILS A;  4A3M J;  2EH3 A;  3OOU A;  5FFZ A;  4BE0 A;  3HIF A;  4DJA A;  4EGZ A;  1DDN A;  2LOO A;  3IWF A;  4XON A;  4UV8 A;  1SD5 A;  2UXN A;  2Z5U A;  4B48 A;  4X6A J;  2FNP A;  2DN0 A;  2OC6 A;  4XLP F;  2OAZ A;  1J7K A;  3MVP A;  1EV7 A;  4A3J J;  2W57 A;  5D5U B;  2E7X A;  4HDV A;  2X0L A;  3BCA A;  3BZ6 A;  2LG4 A;  3M8E A;  1F36 A;  1IN7 A;  2L5Q A;  2LVS A;  3CP8 A;  4BKX A;  1GUU A;  1IN8 A;  4HV6 A;  1B59 A;  2HNH A;  3N05 A;  3OY9 A;  3OYC A;  2L7Z A;  1WI3 A;  5E3N A;  1JTX A;  3OYJ A;  4N9H A;  4FT8 A;  5KNL A;  1YQA A;  2FBI A;  3LFK A;  3LSK A;  1XB4 A;  3A01 A;  1ETX A;  4NB5 A;  2TRT A;  1B72 A;  1LFB A;  2PJR B;  2Y9Z A;  2K27 A;  2VC1 A;  2V9K A;  2W1O A;  3BTI A;  4IHV A;  2F2E A;  4U88 A;  5K1Y A;  2KIF A;  1RPW A;  2WAE A;  3LWF A;  1U2W A;  4BYY A;  2ECC A;  1JI8 A;  2NS0 A;  5LEK A;  1XN7 A;  1E3P A;  2XF6 A;  2Y2Z A;  3F8F A;  2DMT A;  1JHF A;  2OV7 A;  4G94 A;  4DBQ A;  4LG0 A;  4A3G J;  3TDU C;  1SAN A;  4U7B A;  4P5O A;  3M07 A;  5J1Y A;  2MSY A;  3ZPL A;  1RR7 A;  1MZB A;  1Z6T A;  4XID A;  1HKT A;  1ETK A;  3QU3 A;  2R7O A;  3TW6 A;  3PJR A;  4MHG A;  4RB3 C;  3TOA A;  4MFD A;  3TGN A;  2VXD A;  3OS0 A;  4HOB A;  5CPR B;  4AC0 A;  4AM3 A;  2RGV A;  4W1U A;  2L0K A;  2FF4 A;  3CDI A;  2HVS A;  3FXQ A;  1BOA A;  1OYI A;  1SVO A;  2MAB A;  2DQL A;  2CYY A;  1YOV B;  2KFD A;  2M5W A;  4JX6 A;  2LSO A;  1LKX A;  2EV5 A;  4A6D A;  4B1R A;  4OIN F;  4FHT A;  4MQ9 F;  1OYW A;  4Y4R A;  2Y0S N;  3OIQ A;  4EQQ A;  1FJL A;  2EFO A;  3QOE A;  2AHQ A;  3GME A;  4QIW N;  1B8I A;  3V7C A;  2HS5 A;  3E5Q A;  2IS1 A;  2XPW A;  1MMG A;  1IXC A;  1S8N A;  3PNT A;  1HSJ A;  4HF0 A;  2EFP A;  5FFX A;  2YU9 J;  1FOY A;  1Y8R B;  3E97 A;  4AYB A;  2HI3 A;  1XD7 A;  1MDM B;  1X1A A;  3Q0U A;  1ZH5 A;  1MJB A;  2XAF A;  3DPL C;  2FD5 A;  1LEB A;  2B0L A;  2DMN A;  3SZT A;  5D8L B;  3CCS I;  2K40 A;  2KZG A;  1FIP A;  2Z9O A;  5CVJ A;  1ZLJ A;  1IRX A;  2VQL A;  4HRI A;  2X6X A;  3MN2 A;  2P4W A;  1E3H A;  2FEZ A;  3KIO A;  2R4G A;  3EET A;  3OR1 C;  3VDX A;  1VQ8 I;  2IP2 A;  4HDU A;  1PUE E;  1PP7 U;  2DU9 A;  2P6T A;  1H89 C;  3K4K A;  2ZXI A;  2QA4 I;  3B73 A;  4HQE A;  3P7N A;  3FXM A;  4KN7 X;  1U5T C;  1ZR4 A;  3CQZ J;  3DTI A;  2HYG D;  3LSR A;  1ZTR A;  3A0B C;  5FKO A;  3RKW A;  3ZQG A;  1QA6 A;  3WU2 C;  3F22 A;  4DQ2 A;  2VIX A;  2Z16 A;  2BEO A;  3IWZ A;  2GWR A;  1LDK B;  1WKM A;  1K83 J;  2LBF A;  3U2R A;  3BCB A;  2UWM A;  1W4M A;  2WBM A;  2X1D A;  2NS7 A;  4PFO A;  3J7Z I;  5GAH J;  1X2N A;  2STT A;  3FM3 A;  2W7N A;  2MH2 A;  4DZP A;  1RRJ A;  1FPQ A;  1RUN A;  2CQN A;  3CUQ C;  4YFK F;  4L9T A;  1Z91 A;  3I64 A;  2VKD A;  4LK0 F;  3WG7 H;  3PM1 A;  5IOY A;  2VBZ A;  5HS7 A;  5J8F A;  2HFH A;  2EFN A;  2H1L A;  3H9Q A;  3KYD B;  2W85 A;  3CLQ A;  1XS9 A;  3EPZ A;  3KP5 A;  4BUP A;  4Y7N J;  2ZXW H;  4KJZ A;  4BBR J;  2N8G A;  1BIB A;  3Q9S A;  2BW3 B;  3E0J B;  3FXL A;  4HF2 A;  3HKZ A;  2GBY A;  2H1K A;  3JW4 A;  1OFC X;  5F0C A;  4NNJ A;  1P7J A;  4F92 B;  3P9C A;  3JR9 A;  1E2X A;  2V1D A;  3T8R A;  2L9S A;  3QP5 A;  3WOD F;  2XKO A;  3F8C A;  5E1Z B;  4I76 A;  3V8L A;  4LB5 A;  4UUV A;  2CO5 A;  2E1O A;  5LEJ A;  2RRE A;  3R60 A;  1GT0 C;  2DFE A;  4KIF A;  5ICG A;  1UAA A;  4H4K C;  3M3Y J;  3S3O A;  2QEN A;  4XOT A;  2VPL A;  1QZZ A;  1USS A;  1FBQ A;  1XMX A;  3COA C;  3FM5 A;  4DOZ A;  3B6C A;  3BTL A;  3K1M A;  3FXR A;  3FXO A;  5K5R A;  1FEX A;  2A69 F;  2KT0 A;  3OMY A;  3VB2 A;  2PMZ A;  2K7L A;  3KYC B;  3MD2 A;  4FQG A;  5M5W J;  2VAS A;  3RPQ A;  1SEU A;  1W7P D;  2ISY A;  4G6D A;  4MIM A;  4CZC A;  3F8M A;  1K79 A;  1IGN A;  1R4N B;  3QP6 A;  3DEE A;  4DZJ A;  5J4Y A;  1OJL A;  2DAO A;  2Z33 A;  5HLH A;  2WC2 A;  4P9F A;  2CJJ A;  1T2K A;  4C2T A;  2HU9 A;  2HKX A;  2MC3 A;  2D45 A;  1K6Y A;  4HZF A;  1U5T B;  5E1X A;  5F08 A;  5FKN A;  2O8K A;  3GTJ J;  4C9Y A;  3O8H A;  3ABL H;  2DJN A;  4XMY A;  1XG1 A;  4CDG A;  3G4S I;  2JRT A;  2M30 A;  2R92 J;  2M7A A;  2IA0 A;  2XGC A;  2BYV E;  4CIC A;  4C2M J;  4IRG A;  4BAC A;  4ENN A;  2I5U A;  3J81 Z;  4A3F J;  3OV8 A;  2NXN B;  5IYD J;  1JUP A;  1XDU A;  4LG3 A;  1G2H A;  1I3Q J;  3WU0 A;  4D1Q A;  2JN6 A;  1I6X A;  3TOB A;  3CUQ B;  4ZH4 F;  2E5N A;  3BG3 A;  1MIJ A;  2HOA A;  5E1W A;  5GPA A;  4BHC A;  1HC8 A;  2RDP A;  3S1R J;  5KK1 A;  5J6X A;  4PGH A;  1FIA A;  4IVN A;  3BG7 A;  3ECH A;  1G3Y A;  4HA8 A;  5BPD A;  2OZU A;  2D5V A;  6PAX A;  2OCE A;  1WQ2 A;  4V19 K;  1JUS A;  4XBF A;  4UY8 I;  2R7U A;  1AWC A;  4GYG A;  1YS6 A;  1VQO I;  3DLA A;  3S17 J;  1ACI A;  1TWA J;  4KYW A;  1MMD A;  4OIQ F;  3DKY A;  1OMI A;  3BRO A;  1Z21 A;  2ZJR F;  3GVA A;  4E7S A;  4YFN F;  3OYB A;  5E20 A;  1XGO A;  2JZY A;  1NG6 A;  4X0G A;  3PO3 J;  1KYZ A;  3TL4 X;  3GUD A;  3KCC A;  1SFX A;  1AKH B;  2W4S A;  1D1A A;  3TBI A;  3WE2 A;  4Z6Y A;  2WB1 A;  5FD6 A;  2HPM A;  2NRA C;  2BGC A;  2E36 A;  3BJO A;  3D1N I;  2DI3 A;  3G1M A;  2QLZ A;  3TDZ C;  2CW7 A;  1GDT A;  3E6M A;  3H0D A;  3L9F A;  4CA0 A;  2EWN A;  1OPC A;  4YEL A;  3HOX J;  3WG9 A;  3H3V K;  5J40 A;  2BXY A;  4G8X A;  3RDI A;  1CGP A;  3P5J A;  1MD0 A;  4CYC B;  1AU7 A;  1W0U A;  1RZ4 A;  4WXH A;  1QPI A;  3C3W A;  2E1C A;  4XK4 A;  2PN6 A;  4C2U A;  2K9M A;  2WV1 A;  4AVZ A;  4ON0 A;  1K7A A;  1Z7L A;  2DA6 A;  4EMS A;  2VJ4 A;  4XRS A;  1D1B A;  3DTE A;  4LMY A;  4DIQ A;  1S6L A;  2L54 A;  4IJA A;  1H8A C;  2E1N A;  2XGE A;  5LFA A;  3OOP A;  4WXC A;  1TC3 C;  1IN5 A;  4S0H B;  3D0S A;  1IUY A;  3NWS A;  2D1V A;  1OR7 A;  4G12 A;  1VQ4 I;  5L3D A;  1ETW A;  2ZNZ A;  3T8T A;  3HC7 A;  3B02 A;  5B1A H;  4FAS D;  1MBJ A;  1D8K A;  2FJ1 A;  3CJR B;  3LFU A;  4FX0 A;  4ZZD A;  2M34 A;  1OYY A;  1U0J A;  1T95 A;  1ONV A;  3MCZ A;  1OCT C;  4MTE A;  3RPU D;  2LTP A;  2F5V A;  4I0A A;  4HST A;  3L00 A;  4MTD A;  3RI4 A;  2HOS A;  2XB5 A;  3VFZ A;  2YX7 A;  3A01 B;  1MBG A;  3AL0 C;  2P6S A;  1B72 B;  1HLV A;  2M3A A;  4C30 A;  3OYD A;  1T38 A;  1FBS A;  2VPR A;  3EUK L;  3OYM A;  3C2H A;  3GFL A;  5ILV A;  2EBI A;  2PMU A;  1ZG3 A;  1H0M A;  1U6G A;  3C2B A;  3I53 A;  3ZMS A;  2DTZ A;  1NK3 P;  3W6J B;  4EGY A;  3L2W A;  2F4O B;  3K2Z A;  4M3E A;  3V8K A;  2H8W A;  5K7F A;  2BHY A;  4BY7 J;  1ZRF A;  3HTS B;  4NHJ A;  4M74 A;  3K4L A;  1R1U A;  1LEA A;  3H9G A;  1B6A A;  2KIQ A;  2LK2 A;  3GTK J;  5H6R A;  2LF7 A;  4LG0 B;  1KQ8 A;  2FA5 A;  5K5O A;  4BQO A;  5TIS C;  4E4H A;  5J4V A;  3MFK A;  2XPV A;  3G3Z A;  3HUG A;  2DYS H;  2YU3 A;  2L02 A;  2RC4 A;  3KLO A;  5HS8 A;  3O3K A;  5ERI A;  3WTZ A;  2MBF A;  2WY8 Q;  1WJC A;  4RB0 A;  1P9Q C;  2HYJ A;  5KHD A;  3Q9V A;  1O3R A;  4CCO A;  1FY7 A;  2NYX A;  3G1O A;  5GAE J;  2MLK A;  1W0T A;  4CO8 A;  2W82 A;  3KZI C;  3VYR B;  3DLL F;  1ZKG A;  3E5X A;  4BJ6 C;  5K7Z A;  2EFW A;  4QWQ A;  4AID A;  2DK8 A;  4XL9 A;  3HHG A;  2E7W A;  1O7L A;  1XDS A;  3VYS B;  1FYK A;  1X3Z B;  2Q1Z B;  2VL8 A;  2VXZ A;  4XRF A;  4KNY A;  2JA8 J;  1B8I B;  1WVR A;  3ZMT A;  3R6S A;  1MSE C;  1YW7 A;  3BG5 A;  1U9N A;  1VQN I;  2XSD C;  1B9M A;  5M3M J;  5FD5 A;  3QU6 A;  1FWZ A;  1S5L C;  4RGS A;  4KMF A;  3K0L A;  4F55 A;  3CC4 I;  2XHK A;  5DD8 A;  2R7T A;  1X3U A;  4WK8 F;  2O9L A;  1WH5 A;  3LA3 A;  5GP9 A;  2P7V B;  1ZHF A;  3RQI A;  1IN4 A;  1QO0 D;  2KDO A;  3J80 K;  5HLI A;  2HOT A;  3GEZ A;  2P5L C;  5JLX A;  4OMZ A;  2IT0 A;  4BE1 A;  2P0W A;  4XKB A;  1IDY A;  1VQK I;  2DFF A;  4XN3 A;  1BR4 A;  3GXO A;  3K9T A;  1N75 A;  2BVL A;  4OIO F;  2AQE A;  3A4C A;  3S8P A;  1TL8 A;  3M4O J;  1TW2 A;  4UUT A;  2L7F P;  3AL0 B;  4XKC A;  2XAS A;  2VI6 A;  3CC2 I;  3PNV A;  4WWC A;  2CMP A;  5H20 A;  1TQP A;  1FYM A;  2ZME A;  4IEJ A;  3FWE A;  4G6Q A;  3WGH A;  1Q1H A;  2QKL B;  3E6C C;  2RN7 A;  5FRN A;  3CD6 I;  3WTT C;  3CMA I;  3H5N A;  5B66 C;  4Q48 A;  1P6R A;  3K4B A;  5JLW A;  4S04 A;  2L7M P;  4A3E J;  2LBF B;  3U1D A;  4I99 C;  5ICF A;  2NNY A;  2MD5 A;  1DQU A;  2GA2 A;  3KP6 A;  2DPU A;  3JTG A;  2OA4 A;  1J0R A;  2M4G A;  4F3Q A;  2NVQ J;  1QHG A;  3CJQ B;  2DPD A;  1RC9 A;  4DYC A;  3GO5 A;  4E7I A;  2R5Z B;  4ZJZ A;  2WV0 A;  3RKQ A;  5KAF C;  4UB6 C;  2QSG X;  1UMQ A;  5F0F A;  4QLC U;  2IJL A;  2R7D A;  3KP4 A;  3OWT A;  5EGO A;  5J1U A;  2L2O A;  3GCM A;  4BE2 A;  1BN5 A;  2K9Q A;  3S93 A;  4M6Y A;  2DYR H;  4IQJ A;  2VE8 A;  3FX3 A;  4MFE A;  4ZDL A;  1HXD A;  3CCY A;  1WGX A;  1HW2 A;  4W97 A;  1A5J A;  2DT5 A;  1DU0 A;  3K10 A;  3LSJ A;  4BDZ A;  1JTY A;  3J7A O;  3QPL A;  5LBQ A;  2VOO A;  3GYH X;  5ED4 A;  2CWE A;  4IOC F;  3U21 A;  2LKS A;  2F48 A;  2VE9 A;  1BW6 A;  2ETH A;  4ANJ A;  2ISZ A;  5JVT A;  2HWV A;  2NVY J;  5IP7 J;  2XAG A;  2CW0 F;  2HR3 A;  3HRU A;  4N9I A;  2GOX B;  2DMU A;  5DV5 A;  2NOJ B;  5E3M A;  1U8R A;  2VJ5 A;  3GTL J;  3F21 A;  1GV2 A;  1Y1V J;  1WCM J;  3VEP A;  4QPO A;  3F72 A;  1POG A;  1JKO C;  1A36 A;  5EZG A;  1IG7 A;  3AAF A;  3FXU A;  3Q3S A;  3K70 D;  2HKO A;  1BI0 A;  1PYV A;  1BJZ A;  5FGM A;  3WGG A;  2DTR A;  5M3F J;  1FZP B;  2K5C A;  3QPT A;  4ENM A;  1QHH D;  4K2E A;  5FKM A;  3TP3 A;  1WJF A;  1T39 A;  2JA2 A;  1BOB A;  4MLO A;  3BR3 A;  2D1H A;  4YEJ A;  1PDN C;  5GAD J;  4RB1 A;  2AS5 F;  5FLV A;  4BS9 A;  2ESH A;  2F5E A;  4OU0 A;  4PJ0 C;  5H2F C;  1VTN C;  1U3E M;  3VPR A;  3JRD A;  3KX2 A;  2GAU A;  1ORK A;  1FTZ A;  2LY2 A;  4ZYE A;  4PFP A;  3R0J A;  3O8G A;  5FJ8 J;  4IHW A;  2XAH A;  2XF7 A;  3PQJ A;  4PK4 A;  5BMZ A;  1LDJ A;  3N4M A;  3HB9 A;  5CYV A;  1A6Q A;  3H35 A;  1R9T J;  4CGZ A;  1BIA A;  2EIN H;  4XR6 A;  1FSE A;  2DK5 A;  2X85 A;  5ILU A;  5EDN A;  3JRH A;  3FHN A;  2Z99 A;  3CES A;  3FMQ A;  1OR7 C;  3FXK A;  1G3T A;  2R7V A;  2KIS A;  1DPR A;  4LLG F;  5CJ9 A;  1X19 A;  2H6B A;  5DM7 F;  2HXI A;  3AG1 H;  1IO2 A;  4FIS A;  1ZGJ A;  5IPA A;  2FBK A;  2LY9 A;  3IHU A;  2KRH A; 
#chains in the Genus database with same CATH homology
 1CQT A;  1X2N A;  5BNG A;  2LR8 A;  4C3I J;  3S1M J;  1Z77 A;  2R7Z J;  4DZP A;  2LD5 A;  2HXO A;  1BW5 A;  1MNM C;  1YRN A;  3PM1 A;  5IOY A;  3HOU J;  3LOC A;  3PO2 J;  2OPT A;  2WB1 N;  3B6A A;  5IP6 A;  3TW7 A;  1XS9 A;  1O4X A;  4JYK A;  1GVD A;  2JWT A;  5EZH A;  3JRB A;  4BY1 J;  4Y7N J;  4BBR J;  2N8G A;  4DYQ A;  1HCR A;  1HDP A;  4BBS J;  2GBY A;  2H1K A;  4V2G A;  1OFC X;  5F0C A;  4MO7 A;  1P7J A;  5EG0 A;  3JR9 A;  2ME0 A;  4Y52 J;  3W6V A;  4RBO A;  2IAI A;  2WAQ N;  4I76 A;  2E1O A;  2HDD A;  4C3J J;  1GT0 C;  4EEF G;  2ME6 A;  3HOZ J;  3M3Y J;  3HDD A;  3CDL A;  5EF6 A;  3B6C A;  3BTL A;  1FEX A;  3ZQH A;  4I6Z A;  4XRS G;  2RAE A;  2KT0 A;  3NAR A;  2MW8 A;  1ZR2 A;  2Y30 A;  5M5W J;  2JA6 J;  2OF7 A;  3K7A J;  4MIM A;  4FCY A;  3QPS A;  1IRZ A;  2ELK A;  1IGN A;  2DA5 A;  4DZJ A;  1Z0X A;  1OJL A;  2CJJ A;  1NK2 P;  2K9S A;  4XIC A;  3S1N J;  1F43 A;  3DCF A;  3IH2 A;  3ZQF A;  1TWF J;  1MH3 A;  3BR2 A;  5F08 A;  5FKN A;  2O8K A;  3GTJ J;  3O8H A;  9ANT A;  2XB0 X;  4V2F A;  5IYC J;  5IOZ A;  2CUF A;  2DJN A;  1XG1 A;  2LKX A;  2XPU A;  1MH4 A;  1NTC A;  1MBH A;  2R92 J;  1D5Y A;  2XGC A;  2TCT A;  4M3B A;  4C2M J;  2ZB9 A;  5F1J A;  5FLM J;  4HNV A;  5DS9 A;  1APL C;  1K61 A;  4JX4 A;  3JRC A;  4RDU A;  4A3F J;  5M5X J;  4LOC A;  1JKP C;  1UHS A;  5IYD J;  1JUP A;  1G2H A;  2VUM J;  1I3Q J;  3HOV J;  2JN6 A;  3L1P A;  3HM5 A;  2DA2 A;  1BA5 A;  3BG3 A;  2HOA A;  5GPA A;  2GM4 A;  3S1R J;  2R0Q C;  1MBE A;  1FIA A;  2E2J J;  2D5V A;  4B3A A;  1HOM A;  2M0C A;  1JUS A;  1JT0 A;  4A69 C;  3ZQL A;  3RZD J;  1JT6 A;  3IH4 A;  1JKQ C;  3S17 J;  1TWA J;  2CU7 A;  3IH3 A;  3GTP J;  3NAU A;  1IV6 A;  2EZK A;  3K2A A;  4X1E A;  5M5Y J;  3PO3 J;  1SFO J;  1AKH B;  2Y9Y A;  3FIS A;  1VF9 A;  4A3K J;  3WHB A;  3JRG A;  2YUS A;  5FKK A;  3G1L A;  3GBG A;  2R5Z A;  3D1N I;  2NVT J;  4D7M A;  4C3H J;  1TWC J;  3G1M A;  2X6O A;  3UKG A;  3LNQ A;  1QVT A;  1XC5 A;  1GDT A;  3JRE A;  3F0C A;  3HOX J;  3HGG A;  3H3V K;  4IHX A;  2DA7 A;  5C3E J;  1GV5 A;  1UG2 A;  3LSP A;  1ZQ3 P;  4M3F A;  4CYC B;  5E3O A;  1AU7 A;  1TWG J;  5IP9 J;  3Q0V A;  2M2E A;  1W0U A;  1RET A;  1QPI A;  1T33 A;  2QF7 A;  1Y1W J;  1VFC A;  2JMW A;  4XK4 A;  4FE7 A;  3ZOB A;  1WPK A;  1HF0 A;  2WV1 A;  1Q1V A;  3JRF A;  2DA6 A;  4B4C A;  3S2H J;  1JKR C;  2YS9 A;  4XRS A;  3BTC A;  5EEA A;  1H8A C;  2FX0 A;  2XGE A;  3DEW A;  4UUS B;  1TC3 C;  4XRM A;  4S0H B;  4G12 A;  4FTH A;  3FIW A;  3BT9 A;  2NS8 A;  2H8R A;  3GTG J;  1ETW A;  5F27 A;  3JRI A;  1JJ6 C;  3GTM J;  1IDZ A;  1MBJ A;  2NVX J;  2EZH A;  2FJ1 A;  2E2I J;  2LLK A;  2M34 A;  1QVU A;  4IHY A;  1I50 J;  3SJM A;  2JJ7 A;  4BXX J;  3A02 A;  1OCT C;  2KDZ A;  5C4X J;  2CQQ A;  3S2D J;  3HGY A;  2LTP A;  3HKZ N;  3WHC A;  4M3D A;  4DW6 A;  1RKW A;  5K7H A;  2HOS A;  2HQ5 A;  2XB5 A;  3A01 B;  4A3L J;  1MBG A;  1U8B A;  3H0G J;  5IYB J;  1B72 B;  1HLV A;  2I10 A;  4J19 A;  3S16 J;  2G0E A;  2VPR A;  2R5Y B;  1JJ8 C;  2EBI A;  2ID3 A;  5EGO B;  2MGQ A;  3BQZ A;  2IEK A;  3BR5 A;  3C2B A;  2DTZ A;  2K9N A;  3QQA A;  1NK3 P;  1ITY A;  1MBK A;  1OCP A;  4M3E A;  5K7F A;  4BY7 J;  3LSG A;  2ID6 A;  2P81 A;  1JGG A;  2LK2 A;  3GTK J;  4GFB A;  4A3C J;  3S15 J;  2MG4 A;  3GTQ J;  2AO9 A;  3OSF A;  1AKH A;  2X48 A;  2XPV A;  2CUE A;  5C44 J;  5F04 A;  5F0H A;  2EQR A;  3BG9 A;  1VND A;  2VKV A;  3CMY A;  1LE8 B;  2HYJ A;  1X58 A;  4ABZ A;  3RZO J;  3IV5 A;  3TED A;  3G1O A;  2E2H J;  1H88 C;  1DU6 A;  1A6I A;  1W0T A;  2ECB A;  5J1R A;  4M6V A;  1BL0 A;  4D5F A;  1PUF B;  1ZKG A;  5K7Z A;  3HBL A;  4A3I J;  4CYC A;  3BTJ A;  2COB A;  5DTD A;  2JA8 J;  4AYB N;  1B8I B;  1U9O A;  4QSH A;  4D7N A;  1IC8 A;  1MSE C;  3BG5 A;  1IJW C;  1U9N A;  2FQ4 A;  1MSF C;  2QCO A;  2XSD C;  5M3M J;  4A3B J;  2CRG A;  4A93 J;  2W48 A;  1RES A;  2LP0 A;  5HOD A;  2VKE A;  2O9L A;  1ZGW A;  2Y31 A;  1WH5 A;  5GP9 A;  2DA4 A;  2LFB A;  1IUF A;  3RQI A;  1ETY A;  3OSG A;  2HOT A;  3Q0W A;  5JLX A;  3OIO A;  4UUS A;  4A3M J;  4A3D J;  2EH3 A;  2IBD A;  3MKL A;  3OOU A;  1IDY A;  3A03 A;  4M3G A;  3HEF A;  3M4O J;  4UUT A;  4NDL A;  4X6A J;  2L7F P;  2XGD A;  3SDG A;  2DMP A;  2DMQ A;  2DN0 A;  3TP0 A;  2VI6 A;  1JUM A;  1MBF A;  3MVP A;  4A3J J;  5FKL A;  4IEJ A;  4QTR A;  2JA7 J;  1F36 A;  2LVS A;  1ETV A;  2EZL A;  1GUU A;  4BKX A;  5JLW A;  2L7Z A;  1WI3 A;  2L7M P;  5E3N A;  1JTX A;  4A3E J;  1ENH A;  2NVQ J;  3A01 A;  1ETX A;  2TRT A;  4DYC A;  1LFB A;  1B72 A;  1FTT A;  3GTO J;  2Y9Z A;  1ETQ A;  2R5Z B;  3BTI A;  4IHV A;  3RKQ A;  1UMQ A;  4D5C A;  2X9D A;  5GPC A;  5F0F A;  2R5Y A;  1RPW A;  5EGO A;  2XRL A;  5J1U A;  2ECC A;  2GLO A;  1YRN B;  1TWH J;  3BR0 A;  2K9Q A;  2M9H A;  3I4M J;  3BR6 A;  4MFE A;  2Y2Z A;  3HOW J;  1RKT A;  3CCY A;  1WGX A;  2DMT A;  4W97 A;  1A5J A;  1DU0 A;  4A3G J;  1SAN A;  1X2M A;  3LSJ A;  1JTY A;  5J1Y A;  2MSY A;  3QPL A;  1RR7 A;  4XID A;  1ETK A;  2DA3 A;  2M8G X;  3TW6 A;  1EF4 A;  4MFD A;  3FK7 A;  5E3L A;  5EG0 B;  1VI0 A;  2JK3 A;  1BW6 A;  3ZQI A;  1LE8 A;  4AC0 A;  5C4J J;  1ETO A;  4W1U A;  2L0K A;  2NVY J;  3FKI J;  5IP7 J;  1QRY A;  2JA5 J;  4AUX A;  2NOG A;  3FK6 A;  3I4N J;  2DMU A;  1S7E A;  1PUF A;  5E3M A;  2PMZ N;  3GTL J;  3S14 J;  1GV2 A;  5J3L A;  1Y1V J;  3BQY A;  1WCM J;  4JX6 A;  1JKO C;  1POG A;  5EZG A;  4B1R A;  1IG7 A;  2EZI A;  1HDD C;  1FJL A;  2Y0S N;  3Q3S A;  3ZQC A;  2AHQ A;  2CQX A;  4QIW N;  1LFU P;  1B8I A;  1BJZ A;  4JX5 A;  3SFI A;  5M3F J;  2XPW A;  1U78 A;  2YU9 J;  1E3O C;  5FKM A;  3TP3 A;  2HI3 A;  2DA1 A;  3BR3 A;  4MLO A;  3Q0U A;  2FD5 A;  4FE4 A;  2DMN A;  5FLV A;  2K40 A;  1FIP A;  3VPR A;  3JRD A;  1T56 A;  1ORK A;  3MN2 A;  4DYR A;  2B63 J;  1FTZ A;  3HOY J;  2E19 A;  2L9R A;  3O8G A;  5FJ8 J;  3JRA A;  4IHW A;  1I6H J;  1ZK8 A;  1H89 C;  2R93 J;  3HB9 A;  4JP0 A;  1WH7 A;  1R9T J;  4L5E A;  3JRH A;  1ZR4 A;  1P7I A;  5EDN A;  3CQZ J;  3LSR A;  1ZTR A;  5FKO A;  3ZQG A;  3BR1 A;  2HXI A;  1K83 J;  1AHD P;  4FIS A;  5IPA A;  2LY9 A;  3E7L A;  2NS7 A;  2O7O A;  5EYR A;  3S1Q J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...