5C44J

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c44J00
1ZQ3P 3CMYA 2TRTA 4A93J 1WH5A 4A3MJ 3RZOJ 2NS8A 1GT0C 2HOAA 4I76A 1OJLA 4IHWA 3ZQCA 2DA6A 3A01B 3LNQA 1VI0A 2XPUA 5IP9J 4BXXJ 1JKQC 9ANTA 4HNVA 2LY9A 2O8KA 1TWGJ 1GDTA 1HOMA 2HOSA 3QPLA 2R0QC 4DYQA 4S0HB 4L5EA 3BQZA 3BG5A 3Q3SA 3JRHA 3LSRA 3IH3A 4QIWN 1IRZA 1MBEA 4DYCA 3JR9A 2IEKA 2Y2ZA 4QSHA 4FISA 1H8AC 1MH4A 1VNDA 3I4NJ 3HOXJ 3TP0A 1NK3P 4A3IJ 3OSFA 1XG1A 2R5ZB 1ZK8A 2K9NA 2R93J 1I6HJ 4NDLA 2W48A 1JT0A 2YU9J 1ITYA 4MLOA 1GVDA 2ELKA 2Y30A 1K61A 2DTZA 1I50J 2JN6A 4DZJA 3MVPA 1RKWA 1BW6A 1I3QJ 4LOCA 1ETQA 2H1KA 3BR5A 3LSJA 2R7ZJ 1A5JA 4Y52J 3S16J 4V2FA 1UG2A 4M3EA 3JRBA 5IYCJ 1IC8A 4B3AA 1ZTRA 3GBGA 3S15J 1ZKGA 3PO2J 3BR3A 3S1QJ 1SANA 2JWTA 2YS9A 2KDZA 1JKRC 1D5YA 1F43A 2L7ZA 4A3JJ 4W97A 2Y9ZA 3RKQA 1UMQA 5BNGA 3GTPJ 3A02A 3PM1A 1POGA 2XPVA 2VI6A 1WGXA 1T56A 4A3FJ 1JGGA 2L7FP 2NVQJ 3IV5A 1H88C 5FLVA 1ETOA 2DA7A 1WI3A 3CQZJ 3ZQLA 2R5ZA 4XRMA 2D5VA 4RBOA 3S2DJ 2EH3A 5K7HA 2Y31A 3BR0A 4A69C 4UUSB 2HI3A 3Q0WA 1LE8A 2FQ4A 2O7OA 4BBSJ 5EGOA 5IOYA 1EF4A 1MBJA 4A3GJ 1JTYA 2CQQA 2L0KA 2JK3A 1YRNB 1JJ6C 2M9HA 3GTMJ 2QF7A 3B6CA 1Y1WJ 5EG0B 3HOVJ 4JP0A 2K40A 5JLXA 3UKGA 2E1OA 4DZPA 3HM5A 3TW6A 1JTXA 5FKOA 1JJ8C 1RKTA 2LFBA 2LTPA 2EZLA 4V2GA 5C44J 1IUFA 5C4XJ 1HDPA 3M3YJ 4XRSG 1O4XA 5EYRA 3OOUA 1K83J 3L1PA 3WHBA 1FIPA 2DA1A 2EZHA 2YUSA 3HOUJ 3ZOBA 5F0FA 3S1RJ 2EZIA 1WPKA 2XB0X 2WAQN 2M0CA 2R5YB 2FX0A 1NK2P 1MSFC 4FCYA 4AYBN 2ID3A 3OIOA 2EBIA 3FKIJ 1B72B 5E3LA 5HODA 3PO3J 5JLWA 1ZGWA 5J3LA 1X58A 3H3VK 4XIDA 4DW6A 4CYCB 5E3NA 1BJZA 2XB5A 3VPRA 1LFBA 3LSPA 3ZQGA 4B4CA 3LSGA 2E2HJ 4DYRA 2B63J 1JUMA 2VKVA 2LLKA 1GV5A 5FJ8J 2GLOA 4C2MJ 2NVXJ 2ME6A 1WH7A 2AO9A 1P7IA 3CDLA 3B6AA 1TWAJ 4A3CJ 1HF0A 5GPAA 5K7ZA 3BTIA 3DCFA 4M3GA 3IH4A 4FTHA 5IYDJ 3HGGA 3TP3A 4MFEA 1AKHB 2N8GA 5F04A 2CUEA 5IP6A 1HCRA 3A01A 4W1UA 1NTCA 2JA6J 3RQIA 1FIAA 2DMTA 3S14J 1Y1VJ 1DU6A 3BG9A 1RETA 1X2MA 5EZGA 4BBRJ 2Y9YA 2IBDA 3HOZJ 1QRYA 4G12A 4XRSA 4MO7A 3FIWA 2G0EA 4AUXA 4BY1J 3GTLJ 4FE4A 5M5WJ 1VF9A 1IDYA 4RDUA 3H0GJ 1ZR2A 4IHXA 3HGYA 3HOWJ 2CJJA 5C3EJ 2MW8A 4IHVA 3Q0UA 1T33A 4C3IJ 3C2BA 5M5XJ 3G1LA 2WV1A 4XK4A 2OPTA 1AHDP 2CQXA 2ME0A 1JKOC 4GFBA 2JA7J 2DMPA 2E2JJ 1P7JA 5F0HA 1OFCX 2NS7A 2NVYJ 3BT9A 3M4OJ 1DU0A 5EGOB 1HDDC 3W6VA 5EG0A 2NOGA 3QPSA 3GTJJ 5EF6A 3JRGA 3BR1A 3JREA 2MGQA 1BA5A 2DA3A 1U9NA 5M5YJ 3O8GA 3NAUA 1MH3A 3Q0VA 3FK7A 3K2AA 3WHCA 1IJWC 3O8HA 4AC0A 2HXOA 1MBHA 4C3HJ 1TWHJ 2P81A 4FE7A 1GV2A 3DEWA 2HYJA 5F08A 1GUUA 1JT6A 4A3DJ 4QTRA 3SFIA 4C3JJ 2LVSA 2AHQA 1JUPA 2K9SA 4BY7J 2X9DA 3BTLA 1WCMJ 1ORKA 1ETYA 5E3MA 1G2HA 5FKMA 2XRLA 2VUMJ 5EZHA 5IYBJ 1BW5A 4IHYA 4D5FA 2EZKA 5FKNA 1U9OA 2M2EA 3ZQIA 2RAEA 2VPRA 4Y7NJ 5DS9A 1SFOJ 2FJ1A 2JJ7A 2TCTA 3G1OA 4A3KJ 1PUFB 2R5YA 1MBKA 3BQYA 2DJNA 2CUFA 1JKPC 1ETWA 2MSYA 2DA4A 1XC5A 2R92J 3BR2A 1TWCJ 5DTDA 1OCTC 5FKKA 4JYKA 3JRIA 3HKZN 1LFUP 1PUFA 2LKXA 1AKHA 1MBFA 2M8GX 2H8RA 4CYCA 2O9LA 5IPAA 5IOZA 3S1NJ 1FTZA 1E3OC 3BR6A 1AU7A 2E19A 3GTQJ 1IV6A 1QPIA 2XGEA 3A03A 3E7LA 2LK2A 1FTTA 1R9TJ 2EQRA 2LD5A 5F1JA 3SDGA 1ETKA 2XGDA 3NARA 3ZQFA 1ETVA 3S2HJ 2COBA 3TEDA 2XPWA 4MFDA 2ID6A 2L9RA 4X6AJ 1OCPA 1RR7A 3JRAA 2K9QA 1APLC 3S1MJ 3GTKJ 5FKLA 1MNMC 1F36A 3FISA 2XGCA 1ENHA 1B72A 2CRGA 5M3FJ 2DA5A 1RPWA 1FEXA 5J1YA 3G1MA 1XS9A 2LR8A 3BG3A 3SJMA 1W0UA 4JX4A 5EDNA 2JMWA 1TC3C 3GTGJ 2X48A 4I6ZA 1Z77A 3HB9A 1BL0A 3JRFA 1QVTA 2GBYA 4M3DA 5F27A 5GP9A 4XICA 2DMQA 1H89C 3LOCA 5E3OA 1QVUA 5GPCA 1B8IA 1MSEC 4BKXA 1Z0XA 2I10A 5F0CA 2DMNA 2IAIA 4A3LJ 2HOTA 3QQAA 3HBLA 3RZDJ 4M3BA 1IG7A 1S7EA 2LP0A 3S17J 2M34A 2QCOA 4A3BJ 1B8IB 3GTOJ 2CU7A 2X6OA 1X2NA 3K7AJ 3D1NI 2HDDA 3ZQHA 1IGNA 5EEAA 3BTJA 1JUSA 3MKLA 4D5CA 2FD5A 2ECCA 2HXIA 5M3MJ 3OSGA 3IH2A 2XSDC 1RESA 5C4JJ 2L7MP 2WB1N 5IP7J 4JX6A 1W0TA 4MIMA 4M6VA 2VKEA 5K7FA 1ZR4A 4IEJA 3FK6A 2ECBA 1FJLA 2Y0SN 2KT0A 2DA2A 2MG4A 3HEFA 2JA5J 4X1EA 2E2IJ 2GM4A 3BTCA 4EEFG 3HDDA 2JA8J 4UUSA 1UHSA 5J1RA 1Q1VA 2ZB9A 1CQTA 4D7MA 4UUTA 4A3EJ 1VFCA 1U78A 2PMZN 1A6IA 1LE8B 3JRDA 2OF7A 3JRCA 4JX5A 5J1UA 1MBGA 2HQ5A 1YRNA 4B1RA 3I4MJ 3TW7A 3MN2A 1HLVA 2DN0A 1ETXA 2DMUA 1U8BA 1TWFJ 5FLMJ 3CCYA 1IDZA 3F0CA 4D7NA 3HOYJ 4J19A 2NVTJ 4M3FA 4ABZA
chains in the Genus database with same CATH superfamily
3I59A 5FFZA 2O03A 2TRTA 1WH5A 4P55A 4PJJA 3C3WA 1Q1HA 2NS8A 2VBXA 2DYRH 2BYVE 2DDBA 4IHWA 4ZZLA 3ASOH 1IN6A 2XPUA 5IP9J 3H9QA 4BXXJ 1W7PA 3LA3A 4U87A 2R7VA 2Z3YA 4HNVA 3WTXC 1D0XA 2CQKA 3ASNH 4HA8A 1YW7A 4L9JA 1Y6IA 1DGWY 4BS9A 1GDTA 1IRGA 2HNHA 3MKWB 2XDVA 4KUMA 5GTHC 4BE0A 1YYVA 3JRHA 3IH3A 3HOSA 1SVMA 2ZMEC 3LSIA 3TOAA 3HC7A 2IRFG 1UAAA 3K9TA 3LQRA 1E0EA 2LY2A 1SAUA 1TT0A 1GXQA 2HYGD 2DOFA 2VJ5A 3TP0A 3L2CA 2QZ8A 1NK3P 5FD6A 3R6SA 4HX7A 4ZYGA 4M9SA 4ESFA 1K7AA 1BN5A 4LITA 3CUQC 4U7BA 4NDLA 2W48A 2YU9J 2KHMA 1XPXA 2V9PA 2ZSHB 1XCVA 1GVDA 2ELKA 3ZGKA 1DPUA 2PBIA 3FXRA 5KAIC 3OYEA 5LGTA 3F3XA 3OR2C 1K61A 4AIDA 1K4TA 2GA2A 3CO7C 2DPDA 3MEXA 4KJZA 3TOBA 3HOTA 1ETQA 3M9AA 1SFXA 2DK5A 3QODA 1A5JA 4M72A 4AIJA 1XD7A 3BLYA 4R1HA 4RGUA 2PN6A 1YJWI 2OC6A 3GFIA 5IYCJ 1IC8A 5CVIA 1XSDA 1ZTRA 4ON0A 5E1WA 4C2TA 3PO2J 1BR1A 3BR3A 5ED4A 1MDMB 1SANA 2JWTA 3U21A 1R6RA 2BXYA 2IGOA 1YLFA 3L2RA 3LAJA 4IOAF 3U1KA 2R3SA 4HRIA 3H5AA 4CCNA 1QHGA 3CJNA 3PM1A 3I54A 2XPVA 4XLHA 2VI6A 3K1PA 5FROA 3AG3H 4WK8F 3VYTB 3AKZA 2L2OA 2L7FP 2VOPA 1D1AA 4HV6A 1H88C 3OY9A 3ZQLA 3G3ZA 1ZH5A 3HJEA 3RPUA 1CGPA 2P6SA 3TL4X 3ZMZA 2I5UA 3P5JA 1YIOA 2X1EA 1LEAA 3BR0A 1SMYF 2HI3A 5D5WB 3ZPLA 2ZJ2A 3H36A 1EF4A 4CSWA 3EUKL 4A3GJ 2CQQA 2M0MA 1YRNB 2GWRA 5D4SA 3H35A 1Y1WJ 4EM2A 2M45A 4BXUA 5EG0B 2R7TA 2A68F 3FMSA 1QQIA 1SFUA 3W2WA 3OYBA 1SFEA 3F8BA 1FYLA 3WU0A 1FOYA 3TW6A 1JTXA 5FKOA 1R49A 3CJRB 3SEQA 2WTEA 5IT9Z 4KIGA 2CG4A 2KRFA 2EZLA 4V2GA 3FXOA 4GCVA 5C44J 3M3YJ 1CF7A 2E7XA 3CDIA 2DT5A 5J8FA 1O4XA 4XOPA 3H5NA 2E60A 1FIPA 4UB8C 5KK1A 2YUSA 4PSXA 1WPKA 3ESWB 2BVMA 2ADUA 2WAQN 2M0CA 3NWTA 4FCYA 3OYAA 4PGGA 1BI2A 2BE5F 5HS9A 2KRCA 4M73A 4GYGA 2BZTA 1REPC 2HQRA 2ZMEB 3HRSA 3DXJF 2R7RA 1X4OA 5E3LA 5HODA 3PO3J 3AG2H 3M8FA 3K4LA 3H3VK 2KZVA 1BR4A 4ENNA 3L2WA 1BM9A 4DYRA 5FB2A 2VKVA 2FXAA 1IN5A 1Z7LA 4C2MJ 2NVXJ 3QWLA 1TL8A 2F6CA 3IP4B 4BXFA 4CXFA 2JVGA 1FC3A 3CDLA 3F9KA 4CCLA 5B3SH 2GAUA 3B6AA 4A3CJ 3J7AY 2X6WA 5TISC 1VQKI 3BTIA 1G3TA 1X1PA 3GZNB 4L5JA 3ULQB 5IYDJ 2J5PA 4GXOA 1B9MA 1OR7A 1YX3A 2BOLA 4PFPA 5F04A 4HSRA 1QBJA 3SQNA 4W1UA 1XGMA 2QKMB 2JA6J 3GF2A 4UVAA 3RQIA 2RNGA 2KQRA 3R0JA 4DOZA 2DMTA 2DW4A 3F8MA 3M07A 3BCAA 2V6EA 3KP3A 1N25A 4CICA 1KYZA 3L2QA 5HDKA 3S2WA 6PAXA 4RAGA 4G12A 2A05A 2WADA 4U7DA 2P0WA 4FE4A 1W1WE 2CV2A 3H0GJ 1IN7A 1G8XA 1ZR2A 2ZBKA 3HGYA 2HTJA 2Q2EB 5C3EJ 4IHVA 3DP7A 2EIJH 3QRFF 3D5LA 1S7AA 1BI0A 2JUCA 2BVLA 2W4SA 3HRUA 3RSNA 1U3EM 1I6XA 4E7SA 3GTLJ 4UVBA 2JA7J 2ZFWA 2E34A 1U5TB 3KEQA 1IXCA 3WE2A 2MLGA 1MDMA 1ON2A 2DFHA 2PEXA 4RLFA 2JPBA 2HQAA 3BT9A 3EQLF 2CUZA 3H9GA 4KITB 2C6YA 4CCOA 2HVRA 4OIQF 1KU9A 3CP8A 1TLHB 4BDZA 1FBUA 2VBZA 4PSWA 4DNCA 4EV0A 1MH3A 3H3UA 4ZDPA 5LLQA 3OYHA 2WY8Q 4NBQA 3BCBA 2EV5A 2KIMA 3CD6I 1TWHJ 1LVKA 2XF6A 1GUUA 4G7HF 4L0YB 5FLXZ 1OYIA 3SFIA 2FNAA 4OIRF 3LQQA 1JUPA 1OCOH 4BY7J 3V7SA 4ZJZA 5ICEA 3LAPA 1W7PB 1G2HA 2VUMJ 5IYBJ 4IHYA 4UHTA 1XMAA 1KQ9A 2MC3A 2OV7A 4Y7NJ 5HOOA 2JA8J 5DS9A 2IPQX 4BJTA 3G1OA 5HLTA 1A36A 2OD5A 2CUFA 4E7ZA 5HVQC 1N78A 2ZXJA 3K4NA 3AL0B 3FDYA 5CVVA 2HPIA 2DA4A 4G7ZF 2CWEA 2CO5A 3PNVA 1Z3YA 3H9JA 2X0LA 4ZC3A 2O0YA 4HAMA 1LKXA 5D6FA 5DTDA 4JYKA 4QWQA 2DK8A 2QBYB 1S72I 4A0ZA 4MTEA 1XGSA 2GA1A 1JE8A 3RIRA 1WJ5A 3ZQQA 3HTUA 5L3GA 4CZCA 2ISYA 2VQCA 5IOZA 3S1NJ 1XMXA 5KVRA 2XV4S 4NB5A 1WWXA 4ESBA 3J7AO 3I64A 2R7WA 1FYKA 2L02A 2DLLA 3PUBA 1N75A 2LD5A 3SDGA 1ETKA 3NARA 3ZQFA 4ZH4F 3H0DA 4C2UA 3QPHA 3RTRA 3S3OA 1K4SA 2ID6A 2YX4A 4IXAA 2X51A 3KX2A 2NYXA 4L0ZB 1RR7A 3KP4A 3LA2A 4IQJA 2IGNA 1MW7A 5FKLA 3KP5A 2BY3A 4NC6A 3J80K 2H1LA 3FISA 2X6XA 4CCKA 5KHDA 1B72A 2CRGA 2QM3A 2DA5A 2L4AA 3AFHA 1FEXA 2OZUA 4JK1X 5J1YA 5DUIA 2CW8A 3SJMA 3ERED 3PIPF 4NQWA 1Z6TA 2V6CA 2M3AA 4B47A 1RUOA 1ZRFA 1P4WA 1Z77A 4NUBA 1TQIA 5A2QK 1OCRH 2GXGA 3C2GA 3SYTA 2WBMA 2NAZA 2OUMA 1YJ9I 4KFCA 5ILSA 5F27A 1QPMA 2JTVA 2XF7A 2F5VA 2DMQA 5ICGA 2MYSA 4NNJA 2ZJPF 1O3RA 1B8IA 1MSEC 5ERIA 1ULYA 3GLXA 3KPHA 5DCMA 1FP1D 1R1VA 3N97A 1TP4A 2DMNA 2IAIA 2ZC2A 3BZKA 1F4KA 3MWMA 2HOTA 3HBLA 1FPQA 1QZZA 2ELHA 1IV8A 3RZDJ 1BOAA 3S17J 1WHUA 2DPUA 3CUQA 4CH7A 2ZFUA 2EA2A 3I58A 4ZYEA 2DDAA 2DBBA 4A3BJ 3GTOJ 5LD2C 1T0FA 3GXOA 1X2NA 2HDDA 3C7JA 1IGNA 2O61A 2PQ8A 1Z1DA 1E2XA 1JUSA 1E3HA 1LPQA 4R8HA 5DD8A 3WGIA 2O6GE 4O6JA 4HG2A 5LGNA 2IGMA 4YIFA 2LF8A 3IRRA 3IH2A 4EJVA 4Z2YA 5C4JJ 1MJBA 3HL2A 2EJRA 3CLQA 5H2FC 4MIMA 1K78A 5TRDA 5D4RA 2EILH 2ECBA 1FJLA 4Y4RA 3F23A 1Z9CA 2RVCA 4KDPA 2OZ6A 2L9NA 3CUQB 2M5WA 1YE9A 3K4CA 3HEFA 2JA5J 1ZLJA 2V1NA 2LY1A 5L3EA 5LHHA 2ZNZA 3OYNA 3PSIA 1F1ZA 4G6QA 1MIJA 4LIVA 3VDXA 2A69F 1MGTA 1ON1A 1XN7A 4UUTA 4AU7A 2DODA 1RUNA 3WE3A 2CW7A 2DU9A 3BG7A 2OF7A 1LQ1A 2DYSH 3G6EI 4BQNA 1MBGA 5HS7A 3F21A 4IRHA 2GQQA 4II2A 3BWGA 2DAOA 3DBRB 1ZN2A 5FFXA 4I02A 1QGPA 5FLMJ 2PMHA 1EH7A 4J19A 1XX5A 4M3FA 4PDKA 5K5RA 4HF0A 1FLIA 1S8NA 3JTGA 4A93J 1IN4A 2MH2A 4A3MJ 1STZA 2E1MB 4PUSA 3LSMA 3MMYB 4XSZF 3MKZA 1GVJA 2BW3A 2EFOA 3DKWA 3A1YA 3LNQA 9ANTA 4LB5A 3ZRGA 2LY9A 2H6CA 4BEHB 3KYLA 1TWGJ 2F2EA 1WI9A 5CYVA 1RC9A 3I0TA 1G6NA 1RR8C 4GDFA 3BJAA 2HOSA 3QPLA 4H4KC 1SAXA 1R4NB 1TNSA 4DYQA 3PSFA 4S0HB 2CFOA 2HGCA 3K6GA 4YFKF 5DCMB 4L5EA 2R7FA 3BQZA 4ZYHA 3Q3SA 3OS2A 3HXLA 2MC4A 2OU2A 1MBEA 1A31A 2QVOA 2IEKA 2G7UA 2H6BA 2ZNYA 1MMSA 2XKOA 4QSHA 3T8RA 1R4MB 4FISA 2QWWA 5CPRB 3GYHX 2QSGX 2H27A 1Z05A 2F48A 4EJOA 3IKTA 2AQFA 4MQ9F 4A3IJ 1J7KA 1D8JA 4A2UA 2K9NA 2VIXA 2X85A 4XLPF 1V5GA 1UB9A 5H20A 1OLTA 5J40A 1MMAA 1WJBA 3J80Z 2Y30A 3KP7A 1OYWA 4CDGA 3Q9VA 4FETA 4DZJA 1D1CA 3MVPA 1RKWA 4BHCA 4Y52J 3AG4H 4HQEA 1UG2A 3QOEA 4M3EA 3V8JA 3JRBA 4O5VA 4B3AA 4LG0A 2Z9OA 3CMAI 1DUXC 3U9GA 3CC2I 4MQVA 3RDIA 3FBNB 1ZLKA 4LFUA 2L7ZA 4A3JJ 2Y9ZA 1G3WA 1LFPA 3RKQA 4PK4A 5BNGA 3L7WA 4BEHA 3GTPJ 4OAZA 1HSJA 1U0JA 2ZJRF 5JR3A 1JGGA 3ABKH 1DP7P 1BI1A 3H92A 3G4SI 1DPRA 1MJAA 1ETOA 1OISA 2DA7A 2K4BA 1USSA 3CQZJ 3DBLB 4XLAA 3K4KA 1X3ZB 5D5XB 1FYMA 4QPOA 1WVRA 2D5VA 3PFYA 1B6AA 1EH6A 2EH3A 5K7HA 2F4IA 3P7NA 1RI7A 4UUSB 3Q0WA 2KPMA 1RRJA 2FQ4A 3ZMDA 4O3MA 4BBSJ 2M8EA 3LWFA 5IOYA 3DLAA 4ZTFA 2DOAA 4UV8A 4XQFA 3A4CA 3ZN0A 3GFJA 4F3QA 2M9HA 3GTMJ 2WC2A 2QF7A 1V55H 5B1BH 1F5TA 4JP0A 2OCCH 3P9KA 2E1OA 4DJAA 2EA4A 4G6DA 3HM5A 3DF8A 4YEJA 4CO8A 4I0BA 1Y8QB 1RKTA 1UELB 4X0GA 4UVCA 2DXIA 1ACIA 1YW8A 5DEQA 4XRSG 3ELKA 3PNTA 3W3CA 3L1PA 1S5LC 3WHBA 2DA1A 2ZCWA 4HBLA 2EZIA 3OIPA 2XVCA 2ZXIA 3ZMVA 2VL8A 4XKWA 2R5YB 1O3QA 1PDNC 1MSFC 3LMMA 4AYBN 4QLCU 2ID3A 3H3ZA 3OIOA 3OOPA 3FM3A 2CQNA 3RYPA 3I55I 1B9NA 5JVGF 1BI3A 1QNTA 2FF4A 4DQ2A 2RREA 3X2QH 2M87A 3U1DA 1KYWA 3VYSB 2WB1A 4M6XA 4CYCB 1ZG5A 3ZQGA 4B4CA 1ZRDA 3HSFA 2E2HJ 4RA2A 1JUMA 2P7VB 5FJ8J 2OQRA 3EETA 4RM2A 4WCGA 3VOEA 2OBPA 3S32A 1XGOA 3GUDA 2F4OB 4HZFA 3DKXA 2KJBA 1TWAJ 3RQ4A 3BY6A 3WG7H 3GO5A 3E6CC 3N4MA 4KMFA 1P9QC 2HYFA 3DCFA 2GZWA 1T8IA 1QA6A 1WKMA 3HPGA 3HGGA 4KN4X 3TP3A 4ZZDA 4AVPA 3OYKA 1AKHB 2DCEA 5IP6A 3JTHA 1R5HA 3M8EA 4N4NB 2LDUA 2E71A 1SVOA 5GADJ 1HKTA 5FRNA 1DU6A 3BG9A 1UG0A 2ZO4A 1X2MA 3CJQB 4HOBA 3HUGB 4BBRJ 2Z99A 2P7CB 2JT1A 3RKWA 4BE1A 3EUHC 4MO7A 2G0EA 3FIWA 4AUXA 4XM3A 4BY1J 4UY8I 5M5WJ 1G4DA 1VF9A 3ZMUA 1IDYA 2VQHA 2L01A 3E0JB 4F7ZA 2HDWA 1GHCA 2L3DA 1R5GA 2P4WA 3HOWJ 2CJJA 2MLKA 3V7CA 4KN7X 2QA4I 3DQVC 1T33A 5L3FA 5M5XJ 2AXTC 2VT2A 3E3VA 1R7JA 2JRMA 2XAQA 4XK4A 3R4KA 2OPTA 4CYDA 2GXBA 2VOOA 1AHDP 3T1BA 5IT3A 2UV1A 4BE2A 1OCCH 4RAYA 1S3JA 4I0AA 4GFBA 2QEXI 4HDUA 4CGZA 5LGUA 4ZDOA 4HQMA 3E6MA 2ZXWH 1DU0A 2JPCA 1HDDC 3W6VA 2NOGA 4M74A 4IL6C 2LRDA 3CP2A 3M8JA 4HV5A 2QSHX 2GIVA 4E4HA 3JREA 4RB1A 3TKYA 1BA5A 4XMYA 2IS2A 2DA3A 1DP3A 5D8LB 4CZZA 3A0HC 3QU6A 3PL8A 2ZSIB 5M5YJ 1O3TA 3NAUA 3WHCA 3K2AA 2VONA 1VQLI 2BW3B 2ESHA 3O8HA 4F55A 1W5SA 1VZ0A 4Y17A 3K70C 4RB2C 2IT0A 1MBHA 1A35A 2CFXA 1J9IA 4MGRA 2HFHA 1JT6A 3KLOA 3VSKA 2OCEA 2HTSA 4A0YA 2JVHA 1CF7B 1I5ZA 2FOWA 2X9DA 2XAHA 1FP2A 2V9VA 2F5FA 3ECHA 1WCMJ 4BUPA 1ETYA 3SFZA 1E3PA 2A6HF 3ZXSA 5FKMA 1X1BA 3OIQA 3TO6A 5E18F 4IHSA 1W5TA 3FX3A 4D5FA 1U6GA 5FKNA 1U9OA 3ZQIA 2RAEA 2VPRA 2DQLA 3CO6C 2QBYA 2FJ1A 2TCTA 2PMZA 1KU7A 2YR2A 3R60A 4I01A 3K70D 3OYGA 5E8GA 4ZTJA 1HW2A 1UFMA 2KKOA 2VBWA 4XKCA 2M30A 5GTIC 3LFKA 3CCUI 1T08B 2EFPA 1PVEA 2A6TA 4K2EA 1IN8A 2NVUB 4G7OF 3GFLA 1YOVB 3B73A 2M8GX 2VJ4A 3CUOA 1R1TA 2MABA 2IP2A 1E3OC 2L9SA 4R79A 1PUEE 2NS0A 2A3SA 1BR2A 1IV6A 4BJ5C 1QPIA 2MFZA 2XGEA 3PFIA 1SD6A 4FT8A 4N4OB 1FTTA 3HRMA 2O3FA 2I8DA 4OIPF 2VASA 5F1JA 5HLHA 1DGRM 2V79A 2XGDA 3I5UA 3M1CA 5DV5A 1R23A 1ETVA 2JA2A 2Z33A 2XPWA 4GYIA 3DBHB 3I59B 4MFDA 3GX4X 2JQ7A 2M7BA 2NXNB 1OCPA 1FX7A 3A0BC 5E1ZB 4LK0F 3S1MJ 1HQCA 4LG3A 4HSTA 1YHQI 3KZYA 1VQMI 2XGCA 3BP8A 1HKQA 3JCUC 3IUOA 3G1MA 4EJTA 4GRIA 1R22A 2RQPA 1P92A 3E5XA 2JMWA 3GTGJ 2ISZA 2X48A 3KETA 4HLXA 1H9GA 4FX0A 2WAFA 3DEEA 2VE9A 3L00A 4BAYA 1YS7A 4MEXF 3ZQ7A 1WRJA 4XICA 4E6KG 4EQQA 4KICA 5E3OA 5GPCA 1XDSA 4ENKA 4BKXA 2CV0A 2I10A 1KA8A 1PJRA 5F0CA 3DTIA 1J59A 1W7PD 3OL4A 3QQAA 2H94A 3ECOA 2OJED 1S7OA 1S6LA 3WTSC 2KLOA 5KAFC 3SXYA 1U5TC 4WX9A 2VC1A 4IVNA 1S9HA 3MKYB 1O3SA 3OL3A 3HSEA 3O6BB 2WY7Q 2W7NA 1SVLA 3D1NI 2Y69H 3ZQHA 5B1AH 1TTYA 3BZCA 1T98A 4D5CA 2V1UA 2HXIA 2MD0A 3OSGA 2L7MP 1OR7C 2IA1A 4HX8A 3RKYA 5K5QA 5BPDA 2HOEA 5E17F 4M6VA 2VKEA 5K7FA 4XLFA 4N9IA 3FXLA 2LC2A 4PJLA 3IL2A 3D5RC 2Y0SN 1V54H 2MG4A 1JHHA 1BOBA 2HPMA 2K9MA 2IVMA 2DFIA 2IXSA 4OMZA 2VC0A 3HDDA 3HHHA 4UUSA 2IS1A 4N9HA 5HDNA 3EYIA 5JHUA 2ZB9A 3GFMA 1CQTA 1G3SA 1HW1A 2L9VA 4PFOA 5DUKA 3W2VA 3OYMA 2CGPA 4BU2A 3PQKA 2E1NA 1LDKB 4J01A 1OKRA 3HRTA 1J0RA 3E6BA 2RDPA 3BJ6A 1YRNA 1VQ6I 2DT7B 4ASNA 2VQGA 3O2PE 1HLVA 3OYCA 2V1DA 5KNLA 1TWFJ 1WSUA 2W82A 1MMGA 3F8FA 4MHGA 4D7NA 3HOYJ 3T0YA 4I7HA 2Z16A 1PYVA 2MH9A 3W6JB 4L9TA 4I2OA 3QAHA 1HOMA 1FOWA 4D9JA 4HLYA 4AIHA 3NRVA 1ZQ3P 4RGXA 4ZYAA 2RNJA 4V19K 3RZOJ 1HXDA 1EKEA 5EJCA 3K4MA 5K1YA 1VI0A 4IOCF 3OR1C 1VQOI 2O8KA 1TQMA 1I1GA 2TDXA 1D0ZA 2XROA 4DGWB 2X1CA 1R5ID 5AIQA 3GVAA 4LK1F 3W6KB 1IZ1A 3WU2C 5B5EC 4RLQA 4QIWN 1KQ0A 4DYCA 1UHWA 5L3DA 5LEKA 1IO2A 2HU9A 2Y2ZA 3IKVA 4XORA 1RZ4A 2EPFA 4XLNF 2GIZA 2F5CA 2O5RA 2WA0A 4IF4A 4AD9A 1O57A 1VNDA 4HPQA 4XNFA 2RV8A 3QPTA 3OSFA 1AA7A 2YX7A 2R5ZB 2OAZA 4E70A 4G6TB 2EIKH 1JXSA 3RI4A 4MLOA 1EH8A 4GO1A 1XDUA 4BDYA 3CLOA 1YG2A 3CCRI 3BDDA 4M71A 4LOCA 4RGSA 3BR5A 3LSJA 2HKXA 3J81K 1WJFA 4AVZA 4PJNA 3S16J 1OMIA 3DTKA 4JOMA 2V4JC 4V2FA 4NHJA 2IS4A 2ACJA 4BYYA 5D5UB 4II3A 1LDDA 4LLLA 5D6EA 2HVQA 3SHFA 2KL4A 4OAYA 2K86A 4BHBA 3S15J 1J75A 3FXUA 3PNYA 1ZKGA 3CCSI 5HS8A 1SD7A 2LNBA 1K6OA 2NNNA 1F43A 3EPZA 1KQ8A 2FEZA 1IF1A 4YELA 3KEOA 2XASA 1PP7U 4Z6YA 4FX4A 2E5NA 3KEYA 5HNHA 1POGA 1VQ9I 3FWEA 2VBYA 1FT9A 1IAWA 1T56A 4YG2F 2XGXA 4RM3A 2VODA 1MJ9A 1SD5A 2DI3A 3IV5A 2COMA 4J00A 3DEUA 5E8IA 2MD5A 5D5VB 3R0AA 4D0PA 3CCLI 3IRQA 3DPLC 2R5ZA 4XRMA 4AWXB 4RBOA 2IA2A 1W4MA 3S2DJ 1J2XA 1Y0NA 5LEJA 2CSOA 1ERDA 1LE8A 4U88A 3ZN1A 5BS6A 4ZDLA 3LSHA 5BPIA 2W25A 1JTYA 3WGGA 4UXNA 2JRTA 2L0KA 3RCOA 3CCQI 1HA8A 1ZELA 2M1BA 1JJ6C 3NEUA 2UWMA 4JQFA 5JLXA 3UKGA 3GLLA 1ZRCA 4DZPA 3KFWX 5KCMA 3TBIA 2BY1A 2BV6A 4BQOA 1W36C 1ZGAA 2UUZA 3FKJA 3T8TA 1JJ8C 4G9YA 4FASD 3VYRB 2Z1DA 2STWA 3CC7I 2HWVA 1I39A 2EK5A 3DKYA 2Y48A 3WTTC 1X3UA 2VJJA 5EYRA 2PLYA 3OOUA 1K83J 5DD4A 3F72A 3DV8A 2EZHA 3ZOBA 5F0FA 3S1RJ 1VQ5I 1MMNA 5L3CA 2XB0X 4TV7A 1YFHA 1NK2P 3W2AA 1YW9A 2R4GA 1VQNI 2BY0A 1U5TA 2XF5A 3SDBA 4HNTA 1T38A 4BGDA 5ILVA 4B8XA 3CF2A 3I9V2 2KDOA 4XIDA 2DFFA 4DW6A 3HKZA 5E3NA 1FSEA 3WTZA 4NQWB 1LFBA 3LSPA 5BQTA 1ZGJA 3BROA 1I27A 3K4BA 4F92B 1Y8RB 3JW4A 2AS5F 4HF2A 2B63J 5CVUA 1GV5A 2OA4A 3L09A 2GLOA 2V9KA 3ZCOA 4Y33A 2J5OA 1WH7A 2ME6A 3EDPA 4IPAA 1NG7A 3G2BA 4RS8A 3V4GA 2G9WA 1VQPI 1USTA 5DM6F 3C18A 5GPAA 3F8NA 4L5IA 5K7ZA 2E1CA 2LYCA 3IH4A 3ZP5A 2XAFA 5JHFA 3VEPA 4XN0A 2CUEA 3HUGA 1J09A 1WJCA 1X1CA 3QOPA 1HCRA 3A01A 4CUGA 3MQ0A 3REOA 1FIAA 3S14J 2A61A 1O7FA 1Z21A 3CMMA 1RETA 4I98B 3M7GA 4YFXF 1J5YA 3QYFA 2Y9YA 4F93B 2IBDA 3K2ZA 4YRVA 1YQAA 2D1HA 3Q9SA 1O7LA 4XRSA 1S29A 2WAEA 5AIPA 4RDUA 3QU3A 1ZHFA 2D2WA 4IHXA 4Q47A 5JVTA 3HG9A 1ONVA 3HSRA 4QPQA 4C3IJ 5HDGA 5F64A 2QLZA 3G1LA 1OQYA 1Z67A 2L4MA 1U8RA 1SMTA 1BBYA 1JKOC 1UJ8A 4N0BA 2KP6A 1WFXA 1T2KA 3CJTB 1MKMA 1OFCX 3ZMTA 2QGUA 4FQGA 2EINH 2NS7A 4XR6A 3DU6A 3COAC 3M4OJ 5EGOB 4IZZA 3C1DA 3IWFA 2STTA 1FBSA 3JRGA 4HEA2 3HPHA 4F91B 2XAUA 3TDUC 2NOJB 2P5VA 3MAJA 2QQBA 2EB7A 1U9NA 4LGWA 5HLIA 2K9LA 4CA0A 3VYUB 4HDVA 2R7SA 1ZG1A 3LSTA 1RIOH 3IC7A 5LRRA 4LJZF 3LSKA 2HXOA 2W57A 1FZPB 4C3HJ 2P81A 1X1DA 2KIQA 1GV2A 4FE7A 1G3YA 2HYJA 4PJMA 4QTRA 1WJEA 4PZJA 4C3JJ 3BG6A 2AHQA 2K9SA 3CESA 4EM1A 3DLLF 1PP8F 3BTLA 2RQQA 5GAGJ 3I56I 2XRLA 4E7KA 3LFUA 2YPRA 1YITI 3AAFA 2M2EA 4A0XA 1YJNI 5CLSA 3JAMZ 3HTSB 4A3KJ 2JJ7A 1SEUA 5TGTA 4AIKA 3BQYA 4ENJA 2JUGA 2EV6A 1ETWA 1JKPC 2MSYA 1T6SA 1XC5A 3C2HA 2CV1A 2DOEA 3HHGA 4H0EA 1MMDA 1JI8A 3EYYA 1T95A 1AKHA 1PUFA 2LKXA 4PCQA 2BHZA 3O3KA 5J47A 2HEOA 4KYWA 2XIGA 4KT6A 1ODDA 5IPAA 4UNOA 3KZIC 3LL7A 1FMVA 2VKDA 3BR6A 3J7ZI 1IRXA 1AU7A 5FGMA 2YSRA 3I53A 3A03A 3CCEI 4OU0A 1R9TJ 2EQRA 3FM5A 2BXZA 3HZJA 1QHHD 4XONA 3IHUA 3S2HJ 2ESNA 2COBA 2FMLA 5ICCA 3OYJA 4FHTA 4KISA 1GLNA 3IAM2 2LMDA 3JRAA 1SC7A 3GTKJ 2JSPA 1OCZH 1QZYA 1MNMC 1LJ9A 1F36A 5JFRA 5J8CA 2LKSA 3AG1H 4BHPA 2KRHA 5A2QZ 2D45A 3CDHA 1XS9A 2P8TA 2Q8KA 2LR8A 3BG3A 5DM7F 4JX4A 4ETSA 1B4AA 4WF2A 4I6ZA 3WODF 3CTAA 4M9ZA 4NC8A 3HB9A 1HC8A 1BL0A 2XHKA 3TGNA 1LEBA 2X6YA 4UUVA 3JRFA 5LBQA 4E7LA 5FLXK 2KIUA 3KCCA 2W85A 3LOCA 1H89C 1QVUA 3FMRA 2G7HA 2LH9A 5ICFA 2R7DA 2FBKA 2LF7A 4WXCA 2E36A 2HZDA 2VPLA 2NNYA 4M3BA 1IG7A 1S7EA 2LP0A 3L9FA 4S04A 1D3YA 2BGCA 4KT5C 1BC8C 2KISA 3OYLA 1ZREA 2V26A 2XRNA 2GOMA 4U0YA 4WXDA 1TZLA 2CU7A 4G94A 2AXLA 3MFKA 3K7AJ 1NG6A 2F5EA 3FXKA 4LMYA 5EEAA 2PI0A 2E35A 1T39A 2ECCA 3FXQA 5M3MJ 1KGSA 4PGHA 2CH0A 1ZARA 2XSDC 3FHZA 1RESA 2IS6A 2FNPA 4JX6A 5D8KB 1IW7F 3ZMSA 4EJWA 2K3PA 1ZR4A 3FK6A 2ZXHA 2W1OA 5E79C 2PX9A 2QQAA 2B7EA 4LLNA 2DA2A 2MBFA 4L9VA 1MNDA 2MA3A 3HIFA 1T0FC 2E7WA 4Y13A 2E2IJ 2KJCA 2OTJI 2Q0OA 4MNUA 3RPUD 1XTAA 2R7OA 5J1RA 2FA5A 2W00A 2Q2EA 2JSCA 1JGSA 4D7MA 3NWSA 3VODA 4ESJA 4HF1A 4A3EJ 1X3WB 1VFCA 4CHUA 5FRMA 2PMZN 3RYRA 1A6IA 4LIUA 4IQ4A 1LE8B 3PJRA 2DTRA 4EJUA 1QO0D 4JX5A 5J1UA 1YS6A 3GW2A 3GMEA 2FUG2 3MN2A 3DPUA 3WGHA 1K79A 2DN0A 2Q1ZB 2DMUA 3FF5A 3IWZA 4LD5A 1EV7A 1U8BA 3QYEA 3UR3C 1LVAA 2DT6A 1IDZA 1ZYRF 1YX5A 2QUFA 2FRHA 2NVTJ 4ABZA 1E17A 1LDJA 5DCFA 1FY7A 3WG9A 4G8XA 3CMYA 4KA4A 3Q5FA 5CKTA 2K5CA 3NQOA 1GT0C 2HOAA 4I76A 4Y15A 3SEZA 2HS5A 4XBFA 1OJLA 1QU3A 3ZQCA 1R1UA 2DA6A 4OOIA 1X1AA 2EWNA 3KYDB 2XAGA 3A01B 3BC8A 3QYBA 4EVIA 1JKQC 2X1DA 2B9SA 2EFNA 1BIAA 2P6TA 4C30A 3K1NA 1WQ2A 2EV0A 4EATA 2R0QC 4DBQA 1F9NA 1FSHA 2AQEA 4A12A 3BG5A 1I3AA 4S05A 3LSRA 1WZ2A 5CQGA 1MZBA 2M4KA 1IRZA 1KU2A 3V7RA 2OTLI 3ABMH 3JR9A 3ABTA 1FWZA 3TMOA 2WAQA 2Y0MA 3DTEA 3P9CA 1HW5A 2QYOA 1H8AC 1MH4A 3I3LA 2K7LA 3I4NJ 3HOXJ 1ZAOA 4LG0B 1XG1A 1ZK8A 2A6EF 1I6HJ 3I71A 3OS1A 4B09A 2R93J 3CZ6A 2LSOA 1BC7C 1JT0A 1ITYA 3H1CA 1JHFA 4XSXF 2LKPA 2ZJQF 2DTZA 1I50J 4E7JA 2JN6A 3V8LA 2M7AA 2K3FA 3K10A 4KMUX 1BW6A 4OMYA 1I3QJ 2A07F 2H1KA 3GZ5A 2IW5A 2R7ZJ 1DDNA 4WXHA 1R71A 1HSTA 5H6QA 3SZTA 1XSXA 4M9XA 3DWLE 3U2RA 2HKOA 4XKBA 3GBGA 1TNTA 5DDGA 5IY5H 2Y0SA 3ABUA 4XRFA 5E20A 3S1QJ 5BMZA 3TQNA 3DFGA 2YS9A 2KDZA 1JKRC 1D5YA 2KZGA 4W97A 2EIMH 1UMQA 3OYFA 3RJPA 3VWBA 4IRIA 2BBYA 1KONA 2OQGA 2CUJA 3A02A 1WGXA 4A3FJ 4EGZA 5BOXA 2NVQJ 5FLVA 1WI3A 4P1WA 2B0LA 3EUAA 4BJ6C 3ROUA 4LLGF 5TJJA 4L18B 1C0WA 1Z7UA 3OWTA 3JAMK 1EA3A 3FBIB 1FOXA 2QENA 2GOXB 2Y31A 1LUJB 4E7IA 4A69C 2ETHA 2LREA 2FU4A 3K1MA 4U0WA 2O7OA 1W5CC 5EGOA 3T5XA 1MBJA 1XB4A 5AONA 2FSWA 3E5QA 2JK3A 3LA7A 2CMPA 3FXJA 3DU5A 2EFQA 3B6CA 3B02A 3HOVJ 2K40A 2ZKZA 4P96A 3JSOA 5IT9K 4BL0B 3KLNA 2LOOA 4IKFA 2A5WA 4PJ0C 4A5NA 2LFBA 4A6EA 1L3LA 4Y3OA 2LTPA 1WJDA 4EMSA 4F52A 3CMEI 5FD5A 2E1MC 2L54A 1IUFA 5C4XJ 1HDPA 2PG4A 4LB6B 3ONQA 3F6VA 2ICWG 3V42A 1B59A 4JBAA 2L7KA 3HOUJ 4BQQA 1Y0UA 2H8WA 2FOKA 2PMUA 1AOYA 2FX0A 2PJRB 2BEOA 2UXNA 1X19A 2EBIA 3FKIJ 4RAZA 2YU3A 1B72B 2R7QA 1SD4A 1GXPA 1BIBA 5JLWA 1FBQA 1ZGWA 5J3LA 2NRAC 1X58A 3WU1B 2Z2SB 2PJPA 4E7HA 3KYCB 3TO9A 1BJZA 3FMQA 3ISPA 2XB5A 3D0SA 3VPRA 3E1SA 3LSGA 1IXSB 2KFDA 4XN3A 1L0OC 5E1XA 1HBXG 2LLKA 2BY2A 5F6FA 3CCVI 1D5VA 4OINF 2DFEA 5J4YA 1AWCA 3D5SC 2EFWA 1B1BA 3K0LA 2AO9A 4RGRA 3FXMA 1P7IA 3PIOF 1P2FA 4RB0A 2VN2A 1A04A 4NC7A 4IO9F 1HF0A 1YI2I 4OWRB 5CQEA 1Z6RA 1R36A 1TQPA 4M3GA 5HNFA 4FTHA 2WWYA 4B43A 4MFEA 4Q4ZF 2N8GA 2HR3A 1NTCA 5J6XA 2GXAA 1EJ9A 3KE2A 1UZCA 1Y1VJ 2DQRA 3ZR8X 2VKHA 2VB6A 4A5MA 1M1EB 4XL9A 3S93A 2V7FA 5EZGA 2P5LC 3BPXA 1V5EA 4GGGA 1VQ4I 3OYIA 4DIQA 4ITVA 2QSFX 5B66C 2DO7A 1TT5B 3HOZJ 4RB3C 1QRYA 2D1VA 2UXXA 4P9UA 2XKPA 3FZVA 3K69A 1V5FA 2RKHA 2FBHA 4HW0A 1I1SA 2MW8A 5JI6A 3Q0UA 3K4JA 3DPTA 3C2BA 5EEHA 2CQ7A 2LBFB 5K5OA 4MTDA 4I09A 3ABLH 5H6RA 1V4RA 2RN7A 2W24A 2WV1A 2VE8A 3SZPA 1YO5C 2K27A 5ILUA 4B44A 3QP5A 3KP2A 2CQXA 2ME0A 4IX7A 2DMPA 2E2JJ 1P7JA 5F0HA 4OIOF 2WV0A 3G73A 2PJRA 2ZMEA 2VT3A 2ELJA 2NVYJ 4YIRX 2Y75A 5EG0A 3M1EA 3MZYA 1ZG3A 3QPSA 3WTVC 3GTJJ 5EF6A 1NHAA 4HX4A 3BR1A 2MGQA 3WTUC 1FMWA 5CVRA 3G71I 1OYYA 1KU3A 1IXRC 4XOTA 4DBRA 3MCZA 3L2UA 4Q5SF 4XLEA 3O8GA 3CC4I 1YIJI 3Q0VA 1H9TA 1SFKA 3FK7A 1IJWC 2CS3A 4AC0A 2BHYA 4YIIA 1VQ8I 2HDCA 3I4PA 2E5ZA 1DQUA 1WJAA 1X4PA 3GZ6A 3DEWA 2O8XA 1YTYA 5F08A 4A3DJ 2M4GA 2A5YB 3OMYA 1UHMA 2LG4A 2LVSA 1XSVA 3GCMA 4Q48A 1HKSA 2KMUA 3HYIA 4UB6C 4CCMA 1LB2A 1FNNA 2W84A 1ORKA 4RAFA 5LFAA 5E3MA 4ANJA 5EZHA 1BW5A 2EZKA 4CCJA 1SFOJ 1PUFB 2L5QA 2QKLB 1TW2A 3A2KA 2R5YA 1MBKA 1TBXA 3E6DA 2DJNA 1VTNC 3ML6A 2FMYA 2R92J 4HNUA 4WWCA 3BR2A 1TWCJ 4HYEA 1OCTC 5FKKA 3EUHA 2VXZA 3F8CA 3JRIA 3HKZN 3RKXA 1LFUP 3BOQA 1P6RA 1MBFA 3PUFA 5CJ9A 1H0MA 3KP6A 2H8RA 4U0VA 1N77A 3H5RA 4CYCA 2XUBA 2O9LA 2FBIA 3F22A 1FTZA 3N05A 2K85A 4A6DA 1R58A 4B48A 2E19A 1NH3A 3GTQJ 2XC7A 5LHIA 4UV9A 3E7LA 4KIFA 2H09A 5EEGA 2CW0F 2DJIA 2LK2A 1Z91A 2IGKA 2VJIA 3MD2A 2V1XA 2UZKA 3QP6A 2R7UA 3J81Z 3TEDA 2KIFA 4I99C 2L9RA 4X6AJ 1IUYA 4IJAA 4AM3A 4KIBA 1U2WA 3KIOA 2K9QA 1APLC 4XLCA 1VQ7I 1OPCA 4KNYA 5GAHJ 3TO7A 3ERMA 1ENHA 3PQJA 4BH9A 2K4JA 5M3FJ 1RNLA 1RPWA 3GEZA 3L2VA 1K6YA 4IRGA 4M6YA 4XKVA 1MNEA 4D1QA 1W0UA 5EDNA 1TC3C 2IA0A 1Z3XA 2VQLA 2PFBA 2JZYA 3BPVA 5HLGA 3S3MA 3BJOA 3BZ6A 1QVTA 1QZEA 5L3BA 2GBYA 4M3DA 5GP9A 2Z5UA 3CF5F 2QQ8A 5LHGA 4AYBA 4B3XA 3OV8A 1Z0XA 4RMNA 4BNCA 3CCMI 5CVJA 4YFNF 3WTYC 4A3LJ 1K78B 3OS0A 3VSLA 2VXDA 3MZHA 3MZ8A 4IHTA 4EM0B 1Y56A 2M34A 2QCOA 3R61A 1BJAA 1MD0A 5DYMA 1UCRA 1B8IB 2LBFA 2CYYA 3KZZA 1P4XA 1R00A 2X6OA 3S3NA 2QQ9A 3BTJA 3MKLA 2FD5A 4P5OA 3OYDA 3VB2A 5F1RA 1G59A 1D8KA 5GAEJ 3E5UA 2RGVA 2WB1N 1KZHA 2F4MB 5IP7J 3RPQA 1W0TA 3P9IA 4MEYF 1P4AA 2FE3A 1IRFA 4IEJA 2P5KA 3UNGC 2KT0A 4ENMA 3E97A 3GWZA 2FQ3A 1LNWA 1V3FA 1W36D 4X1EA 3F6OA 4ZYDA 4BACA 1Y39A 2XSJC 2IJLA 5LRSA 3BTCA 4EEFG 3S8PA 2GM4A 4L9NA 3CCJI 2F5DA 1UHSA 1XCBA 3WTWC 1A6QA 1Q1VA 3VFZA 4P9FA 2VLAA 2HQNA 1U78A 5FO5A 1XGNA 2HVSA 3JRDA 3FHNA 3TDZC 1D0YA 3JRCA 2XAJA 2X4HA 2K02A 2HQ5A 4BQAA 2R7XA 3AL0C 1XMKA 3IAS2 4C9YA 1FOKA 4B1RA 3I4MJ 3TW7A 4EGYA 2RC4A 1ETXA 1D1BA 5J4VA 3SZGA 3JSPA 3CCYA 2HZTA 3F0CA 1TW3A 3V8KA 3J7YJ
chains in the Genus database with same CATH topology
1ZQ3P 3CMYA 2TRTA 4A93J 1WH5A 4A3MJ 3RZOJ 2NS8A 1GT0C 2HOAA 4I76A 1OJLA 4IHWA 3ZQCA 2DA6A 3A01B 3LNQA 1VI0A 2XPUA 5IP9J 4BXXJ 1JKQC 9ANTA 4HNVA 2LY9A 2O8KA 1TWGJ 1GDTA 1HOMA 2HOSA 3QPLA 2R0QC 4DYQA 4S0HB 4L5EA 3BQZA 3BG5A 3Q3SA 3JRHA 3LSRA 3IH3A 4QIWN 1IRZA 1MBEA 4DYCA 3JR9A 2IEKA 2Y2ZA 4QSHA 4FISA 1H8AC 1MH4A 1VNDA 3I4NJ 3HOXJ 3TP0A 1NK3P 4A3IJ 3OSFA 1XG1A 2R5ZB 1ZK8A 2K9NA 2R93J 1I6HJ 4NDLA 2W48A 1JT0A 2YU9J 1ITYA 4MLOA 1GVDA 2ELKA 2Y30A 1K61A 2DTZA 1I50J 2JN6A 4DZJA 3MVPA 1RKWA 1BW6A 1I3QJ 4LOCA 1ETQA 2H1KA 3BR5A 3LSJA 2R7ZJ 1A5JA 4Y52J 3S16J 4V2FA 1UG2A 4M3EA 3JRBA 5IYCJ 1IC8A 4B3AA 1ZTRA 3GBGA 3S15J 1ZKGA 3PO2J 3BR3A 3S1QJ 1SANA 2JWTA 2YS9A 2KDZA 1JKRC 1D5YA 1F43A 2L7ZA 4A3JJ 4W97A 2Y9ZA 3RKQA 1UMQA 5BNGA 3GTPJ 3A02A 3PM1A 1POGA 2XPVA 2VI6A 1WGXA 1T56A 4A3FJ 1JGGA 2L7FP 2NVQJ 3IV5A 1H88C 5FLVA 1ETOA 2DA7A 1WI3A 3CQZJ 3ZQLA 2R5ZA 4XRMA 2D5VA 4RBOA 3S2DJ 2EH3A 5K7HA 2Y31A 3BR0A 4A69C 4UUSB 2HI3A 3Q0WA 1LE8A 2FQ4A 2O7OA 4BBSJ 5EGOA 5IOYA 1EF4A 1MBJA 4A3GJ 1JTYA 2CQQA 2L0KA 2JK3A 1YRNB 1JJ6C 2M9HA 3GTMJ 2QF7A 3B6CA 1Y1WJ 5EG0B 3HOVJ 4JP0A 2K40A 5JLXA 3UKGA 2E1OA 4DZPA 3HM5A 3TW6A 1JTXA 5FKOA 1JJ8C 1RKTA 2LFBA 2LTPA 2EZLA 4V2GA 5C44J 1IUFA 5C4XJ 1HDPA 3M3YJ 4XRSG 1O4XA 5EYRA 3OOUA 1K83J 3L1PA 3WHBA 1FIPA 2DA1A 2EZHA 2YUSA 3HOUJ 3ZOBA 5F0FA 3S1RJ 2EZIA 1WPKA 2XB0X 2WAQN 2M0CA 2R5YB 2FX0A 1NK2P 1MSFC 4FCYA 4AYBN 2ID3A 3OIOA 2EBIA 3FKIJ 1B72B 5E3LA 5HODA 3PO3J 5JLWA 1ZGWA 5J3LA 1X58A 3H3VK 4XIDA 4DW6A 4CYCB 5E3NA 1BJZA 2XB5A 3VPRA 1LFBA 3LSPA 3ZQGA 4B4CA 3LSGA 2E2HJ 4DYRA 2B63J 1JUMA 2VKVA 2LLKA 1GV5A 5FJ8J 2GLOA 4C2MJ 2NVXJ 2ME6A 1WH7A 2AO9A 1P7IA 3CDLA 3B6AA 1TWAJ 4A3CJ 1HF0A 5GPAA 5K7ZA 3BTIA 3DCFA 4M3GA 3IH4A 4FTHA 5IYDJ 3HGGA 3TP3A 4MFEA 1AKHB 2N8GA 5F04A 2CUEA 5IP6A 1HCRA 3A01A 4W1UA 1NTCA 2JA6J 3RQIA 1FIAA 2DMTA 3S14J 1Y1VJ 1DU6A 3BG9A 1RETA 1X2MA 5EZGA 4BBRJ 2Y9YA 2IBDA 3HOZJ 1QRYA 4G12A 4XRSA 4MO7A 3FIWA 2G0EA 4AUXA 4BY1J 3GTLJ 4FE4A 5M5WJ 1VF9A 1IDYA 4RDUA 3H0GJ 1ZR2A 4IHXA 3HGYA 3HOWJ 2CJJA 5C3EJ 2MW8A 4IHVA 3Q0UA 1T33A 4C3IJ 3C2BA 5M5XJ 3G1LA 2WV1A 4XK4A 2OPTA 1AHDP 2CQXA 2ME0A 1JKOC 4GFBA 2JA7J 2DMPA 2E2JJ 1P7JA 5F0HA 1OFCX 2NS7A 2NVYJ 3BT9A 3M4OJ 1DU0A 5EGOB 1HDDC 3W6VA 5EG0A 2NOGA 3QPSA 3GTJJ 5EF6A 3JRGA 3BR1A 3JREA 2MGQA 1BA5A 2DA3A 1U9NA 5M5YJ 3O8GA 3NAUA 1MH3A 3Q0VA 3FK7A 3K2AA 3WHCA 1IJWC 3O8HA 4AC0A 2HXOA 1MBHA 4C3HJ 1TWHJ 2P81A 4FE7A 1GV2A 3DEWA 2HYJA 5F08A 1GUUA 1JT6A 4A3DJ 4QTRA 3SFIA 4C3JJ 2LVSA 2AHQA 1JUPA 2K9SA 4BY7J 2X9DA 3BTLA 1WCMJ 1ORKA 1ETYA 5E3MA 1G2HA 5FKMA 2XRLA 2VUMJ 5EZHA 5IYBJ 1BW5A 4IHYA 4D5FA 2EZKA 5FKNA 1U9OA 2M2EA 3ZQIA 2RAEA 2VPRA 4Y7NJ 5DS9A 1SFOJ 2FJ1A 2JJ7A 2TCTA 3G1OA 4A3KJ 1PUFB 2R5YA 1MBKA 3BQYA 2DJNA 2CUFA 1JKPC 1ETWA 2MSYA 2DA4A 1XC5A 2R92J 3BR2A 1TWCJ 5DTDA 1OCTC 5FKKA 4JYKA 3JRIA 3HKZN 1LFUP 1PUFA 2LKXA 1AKHA 1MBFA 2M8GX 2H8RA 4CYCA 2O9LA 5IPAA 5IOZA 3S1NJ 1FTZA 1E3OC 3BR6A 1AU7A 2E19A 3GTQJ 1IV6A 1QPIA 2XGEA 3A03A 3E7LA 2LK2A 1FTTA 1R9TJ 2EQRA 2LD5A 5F1JA 3SDGA 1ETKA 2XGDA 3NARA 3ZQFA 1ETVA 3S2HJ 2COBA 3TEDA 2XPWA 4MFDA 2ID6A 2L9RA 4X6AJ 1OCPA 1RR7A 3JRAA 2K9QA 1APLC 3S1MJ 3GTKJ 5FKLA 1MNMC 1F36A 3FISA 2XGCA 1ENHA 1B72A 2CRGA 5M3FJ 2DA5A 1RPWA 1FEXA 5J1YA 3G1MA 1XS9A 2LR8A 3BG3A 3SJMA 1W0UA 4JX4A 5EDNA 2JMWA 1TC3C 3GTGJ 2X48A 4I6ZA 1Z77A 3HB9A 1BL0A 3JRFA 1QVTA 2GBYA 4M3DA 5F27A 5GP9A 4XICA 2DMQA 1H89C 3LOCA 5E3OA 1QVUA 5GPCA 1B8IA 1MSEC 4BKXA 1Z0XA 2I10A 5F0CA 2DMNA 2IAIA 4A3LJ 2HOTA 3QQAA 3HBLA 3RZDJ 4M3BA 1IG7A 1S7EA 2LP0A 3S17J 2M34A 2QCOA 4A3BJ 1B8IB 3GTOJ 2CU7A 2X6OA 1X2NA 3K7AJ 3D1NI 2HDDA 3ZQHA 1IGNA 5EEAA 3BTJA 1JUSA 3MKLA 4D5CA 2FD5A 2ECCA 2HXIA 5M3MJ 3OSGA 3IH2A 2XSDC 1RESA 5C4JJ 2L7MP 2WB1N 5IP7J 4JX6A 1W0TA 4MIMA 4M6VA 2VKEA 5K7FA 1ZR4A 4IEJA 3FK6A 2ECBA 1FJLA 2Y0SN 2KT0A 2DA2A 2MG4A 3HEFA 2JA5J 4X1EA 2E2IJ 2GM4A 3BTCA 4EEFG 3HDDA 2JA8J 4UUSA 1UHSA 5J1RA 1Q1VA 2ZB9A 1CQTA 4D7MA 4UUTA 4A3EJ 1VFCA 1U78A 2PMZN 1A6IA 1LE8B 3JRDA 2OF7A 3JRCA 4JX5A 5J1UA 1MBGA 2HQ5A 1YRNA 4B1RA 3I4MJ 3TW7A 3MN2A 1HLVA 2DN0A 1ETXA 2DMUA 1U8BA 1TWFJ 5FLMJ 3CCYA 1IDZA 3F0CA 4D7NA 3HOYJ 4J19A 2NVTJ 4M3FA 4ABZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ3 P;  3CMY A;  2TRT A;  4A93 J;  1WH5 A;  4A3M J;  3RZO J;  2NS8 A;  1GT0 C;  2HOA A;  4I76 A;  1OJL A;  4IHW A;  3ZQC A;  2DA6 A;  3A01 B;  3LNQ A;  1VI0 A;  2XPU A;  5IP9 J;  4BXX J;  1JKQ C;  9ANT A;  4HNV A;  2LY9 A;  2O8K A;  1TWG J;  1GDT A;  1HOM A;  2HOS A;  3QPL A;  2R0Q C;  4DYQ A;  4S0H B;  4L5E A;  3BQZ A;  3BG5 A;  3Q3S A;  3JRH A;  3LSR A;  3IH3 A;  4QIW N;  1IRZ A;  1MBE A;  4DYC A;  3JR9 A;  2IEK A;  2Y2Z A;  4QSH A;  4FIS A;  1H8A C;  1MH4 A;  1VND A;  3I4N J;  3HOX J;  3TP0 A;  1NK3 P;  4A3I J;  3OSF A;  1XG1 A;  2R5Z B;  1ZK8 A;  2K9N A;  2R93 J;  1I6H J;  4NDL A;  2W48 A;  1JT0 A;  2YU9 J;  1ITY A;  4MLO A;  1GVD A;  2ELK A;  2Y30 A;  1K61 A;  2DTZ A;  1I50 J;  2JN6 A;  4DZJ A;  3MVP A;  1RKW A;  1BW6 A;  1I3Q J;  4LOC A;  1ETQ A;  2H1K A;  3BR5 A;  3LSJ A;  2R7Z J;  1A5J A;  4Y52 J;  3S16 J;  4V2F A;  1UG2 A;  4M3E A;  3JRB A;  5IYC J;  1IC8 A;  4B3A A;  1ZTR A;  3GBG A;  3S15 J;  1ZKG A;  3PO2 J;  3BR3 A;  3S1Q J;  1SAN A;  2JWT A;  2YS9 A;  2KDZ A;  1JKR C;  1D5Y A;  1F43 A;  2L7Z A;  4A3J J;  4W97 A;  2Y9Z A;  3RKQ A;  1UMQ A;  5BNG A;  3GTP J;  3A02 A;  3PM1 A;  1POG A;  2XPV A;  2VI6 A;  1WGX A;  1T56 A;  4A3F J;  1JGG A;  2L7F P;  2NVQ J;  3IV5 A;  1H88 C;  5FLV A;  1ETO A;  2DA7 A;  1WI3 A;  3CQZ J;  3ZQL A;  2R5Z A;  4XRM A;  2D5V A;  4RBO A;  3S2D J;  2EH3 A;  5K7H A;  2Y31 A;  3BR0 A;  4A69 C;  4UUS B;  2HI3 A;  3Q0W A;  1LE8 A;  2FQ4 A;  2O7O A;  4BBS J;  5EGO A;  5IOY A;  1EF4 A;  1MBJ A;  4A3G J;  1JTY A;  2CQQ A;  2L0K A;  2JK3 A;  1YRN B;  1JJ6 C;  2M9H A;  3GTM J;  2QF7 A;  3B6C A;  1Y1W J;  5EG0 B;  3HOV J;  4JP0 A;  2K40 A;  5JLX A;  3UKG A;  2E1O A;  4DZP A;  3HM5 A;  3TW6 A;  1JTX A;  5FKO A;  1JJ8 C;  1RKT A;  2LFB A;  2LTP A;  2EZL A;  4V2G A;  5C44 J;  1IUF A;  5C4X J;  1HDP A;  3M3Y J;  4XRS G;  1O4X A;  5EYR A;  3OOU A;  1K83 J;  3L1P A;  3WHB A;  1FIP A;  2DA1 A;  2EZH A;  2YUS A;  3HOU J;  3ZOB A;  5F0F A;  3S1R J;  2EZI A;  1WPK A;  2XB0 X;  2WAQ N;  2M0C A;  2R5Y B;  2FX0 A;  1NK2 P;  1MSF C;  4FCY A;  4AYB N;  2ID3 A;  3OIO A;  2EBI A;  3FKI J;  1B72 B;  5E3L A;  5HOD A;  3PO3 J;  5JLW A;  1ZGW A;  5J3L A;  1X58 A;  3H3V K;  4XID A;  4DW6 A;  4CYC B;  5E3N A;  1BJZ A;  2XB5 A;  3VPR A;  1LFB A;  3LSP A;  3ZQG A;  4B4C A;  3LSG A;  2E2H J;  4DYR A;  2B63 J;  1JUM A;  2VKV A;  2LLK A;  1GV5 A;  5FJ8 J;  2GLO A;  4C2M J;  2NVX J;  2ME6 A;  1WH7 A;  2AO9 A;  1P7I A;  3CDL A;  3B6A A;  1TWA J;  4A3C J;  1HF0 A;  5GPA A;  5K7Z A;  3BTI A;  3DCF A;  4M3G A;  3IH4 A;  4FTH A;  5IYD J;  3HGG A;  3TP3 A;  4MFE A;  1AKH B;  2N8G A;  5F04 A;  2CUE A;  5IP6 A;  1HCR A;  3A01 A;  4W1U A;  1NTC A;  2JA6 J;  3RQI A;  1FIA A;  2DMT A;  3S14 J;  1Y1V J;  1DU6 A;  3BG9 A;  1RET A;  1X2M A;  5EZG A;  4BBR J;  2Y9Y A;  2IBD A;  3HOZ J;  1QRY A;  4G12 A;  4XRS A;  4MO7 A;  3FIW A;  2G0E A;  4AUX A;  4BY1 J;  3GTL J;  4FE4 A;  5M5W J;  1VF9 A;  1IDY A;  4RDU A;  3H0G J;  1ZR2 A;  4IHX A;  3HGY A;  3HOW J;  2CJJ A;  5C3E J;  2MW8 A;  4IHV A;  3Q0U A;  1T33 A;  4C3I J;  3C2B A;  5M5X J;  3G1L A;  2WV1 A;  4XK4 A;  2OPT A;  1AHD P;  2CQX A;  2ME0 A;  1JKO C;  4GFB A;  2JA7 J;  2DMP A;  2E2J J;  1P7J A;  5F0H A;  1OFC X;  2NS7 A;  2NVY J;  3BT9 A;  3M4O J;  1DU0 A;  5EGO B;  1HDD C;  3W6V A;  5EG0 A;  2NOG A;  3QPS A;  3GTJ J;  5EF6 A;  3JRG A;  3BR1 A;  3JRE A;  2MGQ A;  1BA5 A;  2DA3 A;  1U9N A;  5M5Y J;  3O8G A;  3NAU A;  1MH3 A;  3Q0V A;  3FK7 A;  3K2A A;  3WHC A;  1IJW C;  3O8H A;  4AC0 A;  2HXO A;  1MBH A;  4C3H J;  1TWH J;  2P81 A;  4FE7 A;  1GV2 A;  3DEW A;  2HYJ A;  5F08 A;  1GUU A;  1JT6 A;  4A3D J;  4QTR A;  3SFI A;  4C3J J;  2LVS A;  2AHQ A;  1JUP A;  2K9S A;  4BY7 J;  2X9D A;  3BTL A;  1WCM J;  1ORK A;  1ETY A;  5E3M A;  1G2H A;  5FKM A;  2XRL A;  2VUM J;  5EZH A;  5IYB J;  1BW5 A;  4IHY A;  4D5F A;  2EZK A;  5FKN A;  1U9O A;  2M2E A;  3ZQI A;  2RAE A;  2VPR A;  4Y7N J;  5DS9 A;  1SFO J;  2FJ1 A;  2JJ7 A;  2TCT A;  3G1O A;  4A3K J;  1PUF B;  2R5Y A;  1MBK A;  3BQY A;  2DJN A;  2CUF A;  1JKP C;  1ETW A;  2MSY A;  2DA4 A;  1XC5 A;  2R92 J;  3BR2 A;  1TWC J;  5DTD A;  1OCT C;  5FKK A;  4JYK A;  3JRI A;  3HKZ N;  1LFU P;  1PUF A;  2LKX A;  1AKH A;  1MBF A;  2M8G X;  2H8R A;  4CYC A;  2O9L A;  5IPA A;  5IOZ A;  3S1N J;  1FTZ A;  1E3O C;  3BR6 A;  1AU7 A;  2E19 A;  3GTQ J;  1IV6 A;  1QPI A;  2XGE A;  3A03 A;  3E7L A;  2LK2 A;  1FTT A;  1R9T J;  2EQR A;  2LD5 A;  5F1J A;  3SDG A;  1ETK A;  2XGD A;  3NAR A;  3ZQF A;  1ETV A;  3S2H J;  2COB A;  3TED A;  2XPW A;  4MFD A;  2ID6 A;  2L9R A;  4X6A J;  1OCP A;  1RR7 A;  3JRA A;  2K9Q A;  1APL C;  3S1M J;  3GTK J;  5FKL A;  1MNM C;  1F36 A;  3FIS A;  2XGC A;  1ENH A;  1B72 A;  2CRG A;  5M3F J;  2DA5 A;  1RPW A;  1FEX A;  5J1Y A;  3G1M A;  1XS9 A;  2LR8 A;  3BG3 A;  3SJM A;  1W0U A;  4JX4 A;  5EDN A;  2JMW A;  1TC3 C;  3GTG J;  2X48 A;  4I6Z A;  1Z77 A;  3HB9 A;  1BL0 A;  3JRF A;  1QVT A;  2GBY A;  4M3D A;  5F27 A;  5GP9 A;  4XIC A;  2DMQ A;  1H89 C;  3LOC A;  5E3O A;  1QVU A;  5GPC A;  1B8I A;  1MSE C;  4BKX A;  1Z0X A;  2I10 A;  5F0C A;  2DMN A;  2IAI A;  4A3L J;  2HOT A;  3QQA A;  3HBL A;  3RZD J;  4M3B A;  1IG7 A;  1S7E A;  2LP0 A;  3S17 J;  2M34 A;  2QCO A;  4A3B J;  1B8I B;  3GTO J;  2CU7 A;  2X6O A;  1X2N A;  3K7A J;  3D1N I;  2HDD A;  3ZQH A;  1IGN A;  5EEA A;  3BTJ A;  1JUS A;  3MKL A;  4D5C A;  2FD5 A;  2ECC A;  2HXI A;  5M3M J;  3OSG A;  3IH2 A;  2XSD C;  1RES A;  5C4J J;  2L7M P;  2WB1 N;  5IP7 J;  4JX6 A;  1W0T A;  4MIM A;  4M6V A;  2VKE A;  5K7F A;  1ZR4 A;  4IEJ A;  3FK6 A;  2ECB A;  1FJL A;  2Y0S N;  2KT0 A;  2DA2 A;  2MG4 A;  3HEF A;  2JA5 J;  4X1E A;  2E2I J;  2GM4 A;  3BTC A;  4EEF G;  3HDD A;  2JA8 J;  4UUS A;  1UHS A;  5J1R A;  1Q1V A;  2ZB9 A;  1CQT A;  4D7M A;  4UUT A;  4A3E J;  1VFC A;  1U78 A;  2PMZ N;  1A6I A;  1LE8 B;  3JRD A;  2OF7 A;  3JRC A;  4JX5 A;  5J1U A;  1MBG A;  2HQ5 A;  1YRN A;  4B1R A;  3I4M J;  3TW7 A;  3MN2 A;  1HLV A;  2DN0 A;  1ETX A;  2DMU A;  1U8B A;  1TWF J;  5FLM J;  3CCY A;  1IDZ A;  3F0C A;  4D7N A;  3HOY J;  4J19 A;  2NVT J;  4M3F A;  4ABZ A; 
#chains in the Genus database with same CATH topology
 3I59 A;  5FFZ A;  2O03 A;  2TRT A;  1WH5 A;  4P55 A;  4PJJ A;  3C3W A;  1Q1H A;  2NS8 A;  2VBX A;  2DYR H;  2BYV E;  2DDB A;  4IHW A;  4ZZL A;  3ASO H;  1IN6 A;  2XPU A;  5IP9 J;  3H9Q A;  4BXX J;  1W7P A;  3LA3 A;  4U87 A;  2R7V A;  2Z3Y A;  4HNV A;  3WTX C;  1D0X A;  2CQK A;  3ASN H;  4HA8 A;  1YW7 A;  4L9J A;  1Y6I A;  1DGW Y;  4BS9 A;  1GDT A;  1IRG A;  2HNH A;  3MKW B;  2XDV A;  4KUM A;  5GTH C;  4BE0 A;  1YYV A;  3JRH A;  3IH3 A;  3HOS A;  1SVM A;  2ZME C;  3LSI A;  3TOA A;  3HC7 A;  2IRF G;  1UAA A;  3K9T A;  3LQR A;  1E0E A;  2LY2 A;  1SAU A;  1TT0 A;  1GXQ A;  2HYG D;  2DOF A;  2VJ5 A;  3TP0 A;  3L2C A;  2QZ8 A;  1NK3 P;  5FD6 A;  3R6S A;  4HX7 A;  4ZYG A;  4M9S A;  4ESF A;  1K7A A;  1BN5 A;  4LIT A;  3CUQ C;  4U7B A;  4NDL A;  2W48 A;  2YU9 J;  2KHM A;  1XPX A;  2V9P A;  2ZSH B;  1XCV A;  1GVD A;  2ELK A;  3ZGK A;  1DPU A;  2PBI A;  3FXR A;  5KAI C;  3OYE A;  5LGT A;  3F3X A;  3OR2 C;  1K61 A;  4AID A;  1K4T A;  2GA2 A;  3CO7 C;  2DPD A;  3MEX A;  4KJZ A;  3TOB A;  3HOT A;  1ETQ A;  3M9A A;  1SFX A;  2DK5 A;  3QOD A;  1A5J A;  4M72 A;  4AIJ A;  1XD7 A;  3BLY A;  4R1H A;  4RGU A;  2PN6 A;  1YJW I;  2OC6 A;  3GFI A;  5IYC J;  1IC8 A;  5CVI A;  1XSD A;  1ZTR A;  4ON0 A;  5E1W A;  4C2T A;  3PO2 J;  1BR1 A;  3BR3 A;  5ED4 A;  1MDM B;  1SAN A;  2JWT A;  3U21 A;  1R6R A;  2BXY A;  2IGO A;  1YLF A;  3L2R A;  3LAJ A;  4IOA F;  3U1K A;  2R3S A;  4HRI A;  3H5A A;  4CCN A;  1QHG A;  3CJN A;  3PM1 A;  3I54 A;  2XPV A;  4XLH A;  2VI6 A;  3K1P A;  5FRO A;  3AG3 H;  4WK8 F;  3VYT B;  3AKZ A;  2L2O A;  2L7F P;  2VOP A;  1D1A A;  4HV6 A;  1H88 C;  3OY9 A;  3ZQL A;  3G3Z A;  1ZH5 A;  3HJE A;  3RPU A;  1CGP A;  2P6S A;  3TL4 X;  3ZMZ A;  2I5U A;  3P5J A;  1YIO A;  2X1E A;  1LEA A;  3BR0 A;  1SMY F;  2HI3 A;  5D5W B;  3ZPL A;  2ZJ2 A;  3H36 A;  1EF4 A;  4CSW A;  3EUK L;  4A3G J;  2CQQ A;  2M0M A;  1YRN B;  2GWR A;  5D4S A;  3H35 A;  1Y1W J;  4EM2 A;  2M45 A;  4BXU A;  5EG0 B;  2R7T A;  2A68 F;  3FMS A;  1QQI A;  1SFU A;  3W2W A;  3OYB A;  1SFE A;  3F8B A;  1FYL A;  3WU0 A;  1FOY A;  3TW6 A;  1JTX A;  5FKO A;  1R49 A;  3CJR B;  3SEQ A;  2WTE A;  5IT9 Z;  4KIG A;  2CG4 A;  2KRF A;  2EZL A;  4V2G A;  3FXO A;  4GCV A;  5C44 J;  3M3Y J;  1CF7 A;  2E7X A;  3CDI A;  2DT5 A;  5J8F A;  1O4X A;  4XOP A;  3H5N A;  2E60 A;  1FIP A;  4UB8 C;  5KK1 A;  2YUS A;  4PSX A;  1WPK A;  3ESW B;  2BVM A;  2ADU A;  2WAQ N;  2M0C A;  3NWT A;  4FCY A;  3OYA A;  4PGG A;  1BI2 A;  2BE5 F;  5HS9 A;  2KRC A;  4M73 A;  4GYG A;  2BZT A;  1REP C;  2HQR A;  2ZME B;  3HRS A;  3DXJ F;  2R7R A;  1X4O A;  5E3L A;  5HOD A;  3PO3 J;  3AG2 H;  3M8F A;  3K4L A;  3H3V K;  2KZV A;  1BR4 A;  4ENN A;  3L2W A;  1BM9 A;  4DYR A;  5FB2 A;  2VKV A;  2FXA A;  1IN5 A;  1Z7L A;  4C2M J;  2NVX J;  3QWL A;  1TL8 A;  2F6C A;  3IP4 B;  4BXF A;  4CXF A;  2JVG A;  1FC3 A;  3CDL A;  3F9K A;  4CCL A;  5B3S H;  2GAU A;  3B6A A;  4A3C J;  3J7A Y;  2X6W A;  5TIS C;  1VQK I;  3BTI A;  1G3T A;  1X1P A;  3GZN B;  4L5J A;  3ULQ B;  5IYD J;  2J5P A;  4GXO A;  1B9M A;  1OR7 A;  1YX3 A;  2BOL A;  4PFP A;  5F04 A;  4HSR A;  1QBJ A;  3SQN A;  4W1U A;  1XGM A;  2QKM B;  2JA6 J;  3GF2 A;  4UVA A;  3RQI A;  2RNG A;  2KQR A;  3R0J A;  4DOZ A;  2DMT A;  2DW4 A;  3F8M A;  3M07 A;  3BCA A;  2V6E A;  3KP3 A;  1N25 A;  4CIC A;  1KYZ A;  3L2Q A;  5HDK A;  3S2W A;  6PAX A;  4RAG A;  4G12 A;  2A05 A;  2WAD A;  4U7D A;  2P0W A;  4FE4 A;  1W1W E;  2CV2 A;  3H0G J;  1IN7 A;  1G8X A;  1ZR2 A;  2ZBK A;  3HGY A;  2HTJ A;  2Q2E B;  5C3E J;  4IHV A;  3DP7 A;  2EIJ H;  3QRF F;  3D5L A;  1S7A A;  1BI0 A;  2JUC A;  2BVL A;  2W4S A;  3HRU A;  3RSN A;  1U3E M;  1I6X A;  4E7S A;  3GTL J;  4UVB A;  2JA7 J;  2ZFW A;  2E34 A;  1U5T B;  3KEQ A;  1IXC A;  3WE2 A;  2MLG A;  1MDM A;  1ON2 A;  2DFH A;  2PEX A;  4RLF A;  2JPB A;  2HQA A;  3BT9 A;  3EQL F;  2CUZ A;  3H9G A;  4KIT B;  2C6Y A;  4CCO A;  2HVR A;  4OIQ F;  1KU9 A;  3CP8 A;  1TLH B;  4BDZ A;  1FBU A;  2VBZ A;  4PSW A;  4DNC A;  4EV0 A;  1MH3 A;  3H3U A;  4ZDP A;  5LLQ A;  3OYH A;  2WY8 Q;  4NBQ A;  3BCB A;  2EV5 A;  2KIM A;  3CD6 I;  1TWH J;  1LVK A;  2XF6 A;  1GUU A;  4G7H F;  4L0Y B;  5FLX Z;  1OYI A;  3SFI A;  2FNA A;  4OIR F;  3LQQ A;  1JUP A;  1OCO H;  4BY7 J;  3V7S A;  4ZJZ A;  5ICE A;  3LAP A;  1W7P B;  1G2H A;  2VUM J;  5IYB J;  4IHY A;  4UHT A;  1XMA A;  1KQ9 A;  2MC3 A;  2OV7 A;  4Y7N J;  5HOO A;  2JA8 J;  5DS9 A;  2IPQ X;  4BJT A;  3G1O A;  5HLT A;  1A36 A;  2OD5 A;  2CUF A;  4E7Z A;  5HVQ C;  1N78 A;  2ZXJ A;  3K4N A;  3AL0 B;  3FDY A;  5CVV A;  2HPI A;  2DA4 A;  4G7Z F;  2CWE A;  2CO5 A;  3PNV A;  1Z3Y A;  3H9J A;  2X0L A;  4ZC3 A;  2O0Y A;  4HAM A;  1LKX A;  5D6F A;  5DTD A;  4JYK A;  4QWQ A;  2DK8 A;  2QBY B;  1S72 I;  4A0Z A;  4MTE A;  1XGS A;  2GA1 A;  1JE8 A;  3RIR A;  1WJ5 A;  3ZQQ A;  3HTU A;  5L3G A;  4CZC A;  2ISY A;  2VQC A;  5IOZ A;  3S1N J;  1XMX A;  5KVR A;  2XV4 S;  4NB5 A;  1WWX A;  4ESB A;  3J7A O;  3I64 A;  2R7W A;  1FYK A;  2L02 A;  2DLL A;  3PUB A;  1N75 A;  2LD5 A;  3SDG A;  1ETK A;  3NAR A;  3ZQF A;  4ZH4 F;  3H0D A;  4C2U A;  3QPH A;  3RTR A;  3S3O A;  1K4S A;  2ID6 A;  2YX4 A;  4IXA A;  2X51 A;  3KX2 A;  2NYX A;  4L0Z B;  1RR7 A;  3KP4 A;  3LA2 A;  4IQJ A;  2IGN A;  1MW7 A;  5FKL A;  3KP5 A;  2BY3 A;  4NC6 A;  3J80 K;  2H1L A;  3FIS A;  2X6X A;  4CCK A;  5KHD A;  1B72 A;  2CRG A;  2QM3 A;  2DA5 A;  2L4A A;  3AFH A;  1FEX A;  2OZU A;  4JK1 X;  5J1Y A;  5DUI A;  2CW8 A;  3SJM A;  3ERE D;  3PIP F;  4NQW A;  1Z6T A;  2V6C A;  2M3A A;  4B47 A;  1RUO A;  1ZRF A;  1P4W A;  1Z77 A;  4NUB A;  1TQI A;  5A2Q K;  1OCR H;  2GXG A;  3C2G A;  3SYT A;  2WBM A;  2NAZ A;  2OUM A;  1YJ9 I;  4KFC A;  5ILS A;  5F27 A;  1QPM A;  2JTV A;  2XF7 A;  2F5V A;  2DMQ A;  5ICG A;  2MYS A;  4NNJ A;  2ZJP F;  1O3R A;  1B8I A;  1MSE C;  5ERI A;  1ULY A;  3GLX A;  3KPH A;  5DCM A;  1FP1 D;  1R1V A;  3N97 A;  1TP4 A;  2DMN A;  2IAI A;  2ZC2 A;  3BZK A;  1F4K A;  3MWM A;  2HOT A;  3HBL A;  1FPQ A;  1QZZ A;  2ELH A;  1IV8 A;  3RZD J;  1BOA A;  3S17 J;  1WHU A;  2DPU A;  3CUQ A;  4CH7 A;  2ZFU A;  2EA2 A;  3I58 A;  4ZYE A;  2DDA A;  2DBB A;  4A3B J;  3GTO J;  5LD2 C;  1T0F A;  3GXO A;  1X2N A;  2HDD A;  3C7J A;  1IGN A;  2O61 A;  2PQ8 A;  1Z1D A;  1E2X A;  1JUS A;  1E3H A;  1LPQ A;  4R8H A;  5DD8 A;  3WGI A;  2O6G E;  4O6J A;  4HG2 A;  5LGN A;  2IGM A;  4YIF A;  2LF8 A;  3IRR A;  3IH2 A;  4EJV A;  4Z2Y A;  5C4J J;  1MJB A;  3HL2 A;  2EJR A;  3CLQ A;  5H2F C;  4MIM A;  1K78 A;  5TRD A;  5D4R A;  2EIL H;  2ECB A;  1FJL A;  4Y4R A;  3F23 A;  1Z9C A;  2RVC A;  4KDP A;  2OZ6 A;  2L9N A;  3CUQ B;  2M5W A;  1YE9 A;  3K4C A;  3HEF A;  2JA5 J;  1ZLJ A;  2V1N A;  2LY1 A;  5L3E A;  5LHH A;  2ZNZ A;  3OYN A;  3PSI A;  1F1Z A;  4G6Q A;  1MIJ A;  4LIV A;  3VDX A;  2A69 F;  1MGT A;  1ON1 A;  1XN7 A;  4UUT A;  4AU7 A;  2DOD A;  1RUN A;  3WE3 A;  2CW7 A;  2DU9 A;  3BG7 A;  2OF7 A;  1LQ1 A;  2DYS H;  3G6E I;  4BQN A;  1MBG A;  5HS7 A;  3F21 A;  4IRH A;  2GQQ A;  4II2 A;  3BWG A;  2DAO A;  3DBR B;  1ZN2 A;  5FFX A;  4I02 A;  1QGP A;  5FLM J;  2PMH A;  1EH7 A;  4J19 A;  1XX5 A;  4M3F A;  4PDK A;  5K5R A;  4HF0 A;  1FLI A;  1S8N A;  3JTG A;  4A93 J;  1IN4 A;  2MH2 A;  4A3M J;  1STZ A;  2E1M B;  4PUS A;  3LSM A;  3MMY B;  4XSZ F;  3MKZ A;  1GVJ A;  2BW3 A;  2EFO A;  3DKW A;  3A1Y A;  3LNQ A;  9ANT A;  4LB5 A;  3ZRG A;  2LY9 A;  2H6C A;  4BEH B;  3KYL A;  1TWG J;  2F2E A;  1WI9 A;  5CYV A;  1RC9 A;  3I0T A;  1G6N A;  1RR8 C;  4GDF A;  3BJA A;  2HOS A;  3QPL A;  4H4K C;  1SAX A;  1R4N B;  1TNS A;  4DYQ A;  3PSF A;  4S0H B;  2CFO A;  2HGC A;  3K6G A;  4YFK F;  5DCM B;  4L5E A;  2R7F A;  3BQZ A;  4ZYH A;  3Q3S A;  3OS2 A;  3HXL A;  2MC4 A;  2OU2 A;  1MBE A;  1A31 A;  2QVO A;  2IEK A;  2G7U A;  2H6B A;  2ZNY A;  1MMS A;  2XKO A;  4QSH A;  3T8R A;  1R4M B;  4FIS A;  2QWW A;  5CPR B;  3GYH X;  2QSG X;  2H27 A;  1Z05 A;  2F48 A;  4EJO A;  3IKT A;  2AQF A;  4MQ9 F;  4A3I J;  1J7K A;  1D8J A;  4A2U A;  2K9N A;  2VIX A;  2X85 A;  4XLP F;  1V5G A;  1UB9 A;  5H20 A;  1OLT A;  5J40 A;  1MMA A;  1WJB A;  3J80 Z;  2Y30 A;  3KP7 A;  1OYW A;  4CDG A;  3Q9V A;  4FET A;  4DZJ A;  1D1C A;  3MVP A;  1RKW A;  4BHC A;  4Y52 J;  3AG4 H;  4HQE A;  1UG2 A;  3QOE A;  4M3E A;  3V8J A;  3JRB A;  4O5V A;  4B3A A;  4LG0 A;  2Z9O A;  3CMA I;  1DUX C;  3U9G A;  3CC2 I;  4MQV A;  3RDI A;  3FBN B;  1ZLK A;  4LFU A;  2L7Z A;  4A3J J;  2Y9Z A;  1G3W A;  1LFP A;  3RKQ A;  4PK4 A;  5BNG A;  3L7W A;  4BEH A;  3GTP J;  4OAZ A;  1HSJ A;  1U0J A;  2ZJR F;  5JR3 A;  1JGG A;  3ABK H;  1DP7 P;  1BI1 A;  3H92 A;  3G4S I;  1DPR A;  1MJA A;  1ETO A;  1OIS A;  2DA7 A;  2K4B A;  1USS A;  3CQZ J;  3DBL B;  4XLA A;  3K4K A;  1X3Z B;  5D5X B;  1FYM A;  4QPO A;  1WVR A;  2D5V A;  3PFY A;  1B6A A;  1EH6 A;  2EH3 A;  5K7H A;  2F4I A;  3P7N A;  1RI7 A;  4UUS B;  3Q0W A;  2KPM A;  1RRJ A;  2FQ4 A;  3ZMD A;  4O3M A;  4BBS J;  2M8E A;  3LWF A;  5IOY A;  3DLA A;  4ZTF A;  2DOA A;  4UV8 A;  4XQF A;  3A4C A;  3ZN0 A;  3GFJ A;  4F3Q A;  2M9H A;  3GTM J;  2WC2 A;  2QF7 A;  1V55 H;  5B1B H;  1F5T A;  4JP0 A;  2OCC H;  3P9K A;  2E1O A;  4DJA A;  2EA4 A;  4G6D A;  3HM5 A;  3DF8 A;  4YEJ A;  4CO8 A;  4I0B A;  1Y8Q B;  1RKT A;  1UEL B;  4X0G A;  4UVC A;  2DXI A;  1ACI A;  1YW8 A;  5DEQ A;  4XRS G;  3ELK A;  3PNT A;  3W3C A;  3L1P A;  1S5L C;  3WHB A;  2DA1 A;  2ZCW A;  4HBL A;  2EZI A;  3OIP A;  2XVC A;  2ZXI A;  3ZMV A;  2VL8 A;  4XKW A;  2R5Y B;  1O3Q A;  1PDN C;  1MSF C;  3LMM A;  4AYB N;  4QLC U;  2ID3 A;  3H3Z A;  3OIO A;  3OOP A;  3FM3 A;  2CQN A;  3RYP A;  3I55 I;  1B9N A;  5JVG F;  1BI3 A;  1QNT A;  2FF4 A;  4DQ2 A;  2RRE A;  3X2Q H;  2M87 A;  3U1D A;  1KYW A;  3VYS B;  2WB1 A;  4M6X A;  4CYC B;  1ZG5 A;  3ZQG A;  4B4C A;  1ZRD A;  3HSF A;  2E2H J;  4RA2 A;  1JUM A;  2P7V B;  5FJ8 J;  2OQR A;  3EET A;  4RM2 A;  4WCG A;  3VOE A;  2OBP A;  3S32 A;  1XGO A;  3GUD A;  2F4O B;  4HZF A;  3DKX A;  2KJB A;  1TWA J;  3RQ4 A;  3BY6 A;  3WG7 H;  3GO5 A;  3E6C C;  3N4M A;  4KMF A;  1P9Q C;  2HYF A;  3DCF A;  2GZW A;  1T8I A;  1QA6 A;  1WKM A;  3HPG A;  3HGG A;  4KN4 X;  3TP3 A;  4ZZD A;  4AVP A;  3OYK A;  1AKH B;  2DCE A;  5IP6 A;  3JTH A;  1R5H A;  3M8E A;  4N4N B;  2LDU A;  2E71 A;  1SVO A;  5GAD J;  1HKT A;  5FRN A;  1DU6 A;  3BG9 A;  1UG0 A;  2ZO4 A;  1X2M A;  3CJQ B;  4HOB A;  3HUG B;  4BBR J;  2Z99 A;  2P7C B;  2JT1 A;  3RKW A;  4BE1 A;  3EUH C;  4MO7 A;  2G0E A;  3FIW A;  4AUX A;  4XM3 A;  4BY1 J;  4UY8 I;  5M5W J;  1G4D A;  1VF9 A;  3ZMU A;  1IDY A;  2VQH A;  2L01 A;  3E0J B;  4F7Z A;  2HDW A;  1GHC A;  2L3D A;  1R5G A;  2P4W A;  3HOW J;  2CJJ A;  2MLK A;  3V7C A;  4KN7 X;  2QA4 I;  3DQV C;  1T33 A;  5L3F A;  5M5X J;  2AXT C;  2VT2 A;  3E3V A;  1R7J A;  2JRM A;  2XAQ A;  4XK4 A;  3R4K A;  2OPT A;  4CYD A;  2GXB A;  2VOO A;  1AHD P;  3T1B A;  5IT3 A;  2UV1 A;  4BE2 A;  1OCC H;  4RAY A;  1S3J A;  4I0A A;  4GFB A;  2QEX I;  4HDU A;  4CGZ A;  5LGU A;  4ZDO A;  4HQM A;  3E6M A;  2ZXW H;  1DU0 A;  2JPC A;  1HDD C;  3W6V A;  2NOG A;  4M74 A;  4IL6 C;  2LRD A;  3CP2 A;  3M8J A;  4HV5 A;  2QSH X;  2GIV A;  4E4H A;  3JRE A;  4RB1 A;  3TKY A;  1BA5 A;  4XMY A;  2IS2 A;  2DA3 A;  1DP3 A;  5D8L B;  4CZZ A;  3A0H C;  3QU6 A;  3PL8 A;  2ZSI B;  5M5Y J;  1O3T A;  3NAU A;  3WHC A;  3K2A A;  2VON A;  1VQL I;  2BW3 B;  2ESH A;  3O8H A;  4F55 A;  1W5S A;  1VZ0 A;  4Y17 A;  3K70 C;  4RB2 C;  2IT0 A;  1MBH A;  1A35 A;  2CFX A;  1J9I A;  4MGR A;  2HFH A;  1JT6 A;  3KLO A;  3VSK A;  2OCE A;  2HTS A;  4A0Y A;  2JVH A;  1CF7 B;  1I5Z A;  2FOW A;  2X9D A;  2XAH A;  1FP2 A;  2V9V A;  2F5F A;  3ECH A;  1WCM J;  4BUP A;  1ETY A;  3SFZ A;  1E3P A;  2A6H F;  3ZXS A;  5FKM A;  1X1B A;  3OIQ A;  3TO6 A;  5E18 F;  4IHS A;  1W5T A;  3FX3 A;  4D5F A;  1U6G A;  5FKN A;  1U9O A;  3ZQI A;  2RAE A;  2VPR A;  2DQL A;  3CO6 C;  2QBY A;  2FJ1 A;  2TCT A;  2PMZ A;  1KU7 A;  2YR2 A;  3R60 A;  4I01 A;  3K70 D;  3OYG A;  5E8G A;  4ZTJ A;  1HW2 A;  1UFM A;  2KKO A;  2VBW A;  4XKC A;  2M30 A;  5GTI C;  3LFK A;  3CCU I;  1T08 B;  2EFP A;  1PVE A;  2A6T A;  4K2E A;  1IN8 A;  2NVU B;  4G7O F;  3GFL A;  1YOV B;  3B73 A;  2M8G X;  2VJ4 A;  3CUO A;  1R1T A;  2MAB A;  2IP2 A;  1E3O C;  2L9S A;  4R79 A;  1PUE E;  2NS0 A;  2A3S A;  1BR2 A;  1IV6 A;  4BJ5 C;  1QPI A;  2MFZ A;  2XGE A;  3PFI A;  1SD6 A;  4FT8 A;  4N4O B;  1FTT A;  3HRM A;  2O3F A;  2I8D A;  4OIP F;  2VAS A;  5F1J A;  5HLH A;  1DGR M;  2V79 A;  2XGD A;  3I5U A;  3M1C A;  5DV5 A;  1R23 A;  1ETV A;  2JA2 A;  2Z33 A;  2XPW A;  4GYI A;  3DBH B;  3I59 B;  4MFD A;  3GX4 X;  2JQ7 A;  2M7B A;  2NXN B;  1OCP A;  1FX7 A;  3A0B C;  5E1Z B;  4LK0 F;  3S1M J;  1HQC A;  4LG3 A;  4HST A;  1YHQ I;  3KZY A;  1VQM I;  2XGC A;  3BP8 A;  1HKQ A;  3JCU C;  3IUO A;  3G1M A;  4EJT A;  4GRI A;  1R22 A;  2RQP A;  1P92 A;  3E5X A;  2JMW A;  3GTG J;  2ISZ A;  2X48 A;  3KET A;  4HLX A;  1H9G A;  4FX0 A;  2WAF A;  3DEE A;  2VE9 A;  3L00 A;  4BAY A;  1YS7 A;  4MEX F;  3ZQ7 A;  1WRJ A;  4XIC A;  4E6K G;  4EQQ A;  4KIC A;  5E3O A;  5GPC A;  1XDS A;  4ENK A;  4BKX A;  2CV0 A;  2I10 A;  1KA8 A;  1PJR A;  5F0C A;  3DTI A;  1J59 A;  1W7P D;  3OL4 A;  3QQA A;  2H94 A;  3ECO A;  2OJE D;  1S7O A;  1S6L A;  3WTS C;  2KLO A;  5KAF C;  3SXY A;  1U5T C;  4WX9 A;  2VC1 A;  4IVN A;  1S9H A;  3MKY B;  1O3S A;  3OL3 A;  3HSE A;  3O6B B;  2WY7 Q;  2W7N A;  1SVL A;  3D1N I;  2Y69 H;  3ZQH A;  5B1A H;  1TTY A;  3BZC A;  1T98 A;  4D5C A;  2V1U A;  2HXI A;  2MD0 A;  3OSG A;  2L7M P;  1OR7 C;  2IA1 A;  4HX8 A;  3RKY A;  5K5Q A;  5BPD A;  2HOE A;  5E17 F;  4M6V A;  2VKE A;  5K7F A;  4XLF A;  4N9I A;  3FXL A;  2LC2 A;  4PJL A;  3IL2 A;  3D5R C;  2Y0S N;  1V54 H;  2MG4 A;  1JHH A;  1BOB A;  2HPM A;  2K9M A;  2IVM A;  2DFI A;  2IXS A;  4OMZ A;  2VC0 A;  3HDD A;  3HHH A;  4UUS A;  2IS1 A;  4N9H A;  5HDN A;  3EYI A;  5JHU A;  2ZB9 A;  3GFM A;  1CQT A;  1G3S A;  1HW1 A;  2L9V A;  4PFO A;  5DUK A;  3W2V A;  3OYM A;  2CGP A;  4BU2 A;  3PQK A;  2E1N A;  1LDK B;  4J01 A;  1OKR A;  3HRT A;  1J0R A;  3E6B A;  2RDP A;  3BJ6 A;  1YRN A;  1VQ6 I;  2DT7 B;  4ASN A;  2VQG A;  3O2P E;  1HLV A;  3OYC A;  2V1D A;  5KNL A;  1TWF J;  1WSU A;  2W82 A;  1MMG A;  3F8F A;  4MHG A;  4D7N A;  3HOY J;  3T0Y A;  4I7H A;  2Z16 A;  1PYV A;  2MH9 A;  3W6J B;  4L9T A;  4I2O A;  3QAH A;  1HOM A;  1FOW A;  4D9J A;  4HLY A;  4AIH A;  3NRV A;  1ZQ3 P;  4RGX A;  4ZYA A;  2RNJ A;  4V19 K;  3RZO J;  1HXD A;  1EKE A;  5EJC A;  3K4M A;  5K1Y A;  1VI0 A;  4IOC F;  3OR1 C;  1VQO I;  2O8K A;  1TQM A;  1I1G A;  2TDX A;  1D0Z A;  2XRO A;  4DGW B;  2X1C A;  1R5I D;  5AIQ A;  3GVA A;  4LK1 F;  3W6K B;  1IZ1 A;  3WU2 C;  5B5E C;  4RLQ A;  4QIW N;  1KQ0 A;  4DYC A;  1UHW A;  5L3D A;  5LEK A;  1IO2 A;  2HU9 A;  2Y2Z A;  3IKV A;  4XOR A;  1RZ4 A;  2EPF A;  4XLN F;  2GIZ A;  2F5C A;  2O5R A;  2WA0 A;  4IF4 A;  4AD9 A;  1O57 A;  1VND A;  4HPQ A;  4XNF A;  2RV8 A;  3QPT A;  3OSF A;  1AA7 A;  2YX7 A;  2R5Z B;  2OAZ A;  4E70 A;  4G6T B;  2EIK H;  1JXS A;  3RI4 A;  4MLO A;  1EH8 A;  4GO1 A;  1XDU A;  4BDY A;  3CLO A;  1YG2 A;  3CCR I;  3BDD A;  4M71 A;  4LOC A;  4RGS A;  3BR5 A;  3LSJ A;  2HKX A;  3J81 K;  1WJF A;  4AVZ A;  4PJN A;  3S16 J;  1OMI A;  3DTK A;  4JOM A;  2V4J C;  4V2F A;  4NHJ A;  2IS4 A;  2ACJ A;  4BYY A;  5D5U B;  4II3 A;  1LDD A;  4LLL A;  5D6E A;  2HVQ A;  3SHF A;  2KL4 A;  4OAY A;  2K86 A;  4BHB A;  3S15 J;  1J75 A;  3FXU A;  3PNY A;  1ZKG A;  3CCS I;  5HS8 A;  1SD7 A;  2LNB A;  1K6O A;  2NNN A;  1F43 A;  3EPZ A;  1KQ8 A;  2FEZ A;  1IF1 A;  4YEL A;  3KEO A;  2XAS A;  1PP7 U;  4Z6Y A;  4FX4 A;  2E5N A;  3KEY A;  5HNH A;  1POG A;  1VQ9 I;  3FWE A;  2VBY A;  1FT9 A;  1IAW A;  1T56 A;  4YG2 F;  2XGX A;  4RM3 A;  2VOD A;  1MJ9 A;  1SD5 A;  2DI3 A;  3IV5 A;  2COM A;  4J00 A;  3DEU A;  5E8I A;  2MD5 A;  5D5V B;  3R0A A;  4D0P A;  3CCL I;  3IRQ A;  3DPL C;  2R5Z A;  4XRM A;  4AWX B;  4RBO A;  2IA2 A;  1W4M A;  3S2D J;  1J2X A;  1Y0N A;  5LEJ A;  2CSO A;  1ERD A;  1LE8 A;  4U88 A;  3ZN1 A;  5BS6 A;  4ZDL A;  3LSH A;  5BPI A;  2W25 A;  1JTY A;  3WGG A;  4UXN A;  2JRT A;  2L0K A;  3RCO A;  3CCQ I;  1HA8 A;  1ZEL A;  2M1B A;  1JJ6 C;  3NEU A;  2UWM A;  4JQF A;  5JLX A;  3UKG A;  3GLL A;  1ZRC A;  4DZP A;  3KFW X;  5KCM A;  3TBI A;  2BY1 A;  2BV6 A;  4BQO A;  1W36 C;  1ZGA A;  2UUZ A;  3FKJ A;  3T8T A;  1JJ8 C;  4G9Y A;  4FAS D;  3VYR B;  2Z1D A;  2STW A;  3CC7 I;  2HWV A;  1I39 A;  2EK5 A;  3DKY A;  2Y48 A;  3WTT C;  1X3U A;  2VJJ A;  5EYR A;  2PLY A;  3OOU A;  1K83 J;  5DD4 A;  3F72 A;  3DV8 A;  2EZH A;  3ZOB A;  5F0F A;  3S1R J;  1VQ5 I;  1MMN A;  5L3C A;  2XB0 X;  4TV7 A;  1YFH A;  1NK2 P;  3W2A A;  1YW9 A;  2R4G A;  1VQN I;  2BY0 A;  1U5T A;  2XF5 A;  3SDB A;  4HNT A;  1T38 A;  4BGD A;  5ILV A;  4B8X A;  3CF2 A;  3I9V 2;  2KDO A;  4XID A;  2DFF A;  4DW6 A;  3HKZ A;  5E3N A;  1FSE A;  3WTZ A;  4NQW B;  1LFB A;  3LSP A;  5BQT A;  1ZGJ A;  3BRO A;  1I27 A;  3K4B A;  4F92 B;  1Y8R B;  3JW4 A;  2AS5 F;  4HF2 A;  2B63 J;  5CVU A;  1GV5 A;  2OA4 A;  3L09 A;  2GLO A;  2V9K A;  3ZCO A;  4Y33 A;  2J5O A;  1WH7 A;  2ME6 A;  3EDP A;  4IPA A;  1NG7 A;  3G2B A;  4RS8 A;  3V4G A;  2G9W A;  1VQP I;  1UST A;  5DM6 F;  3C18 A;  5GPA A;  3F8N A;  4L5I A;  5K7Z A;  2E1C A;  2LYC A;  3IH4 A;  3ZP5 A;  2XAF A;  5JHF A;  3VEP A;  4XN0 A;  2CUE A;  3HUG A;  1J09 A;  1WJC A;  1X1C A;  3QOP A;  1HCR A;  3A01 A;  4CUG A;  3MQ0 A;  3REO A;  1FIA A;  3S14 J;  2A61 A;  1O7F A;  1Z21 A;  3CMM A;  1RET A;  4I98 B;  3M7G A;  4YFX F;  1J5Y A;  3QYF A;  2Y9Y A;  4F93 B;  2IBD A;  3K2Z A;  4YRV A;  1YQA A;  2D1H A;  3Q9S A;  1O7L A;  4XRS A;  1S29 A;  2WAE A;  5AIP A;  4RDU A;  3QU3 A;  1ZHF A;  2D2W A;  4IHX A;  4Q47 A;  5JVT A;  3HG9 A;  1ONV A;  3HSR A;  4QPQ A;  4C3I J;  5HDG A;  5F64 A;  2QLZ A;  3G1L A;  1OQY A;  1Z67 A;  2L4M A;  1U8R A;  1SMT A;  1BBY A;  1JKO C;  1UJ8 A;  4N0B A;  2KP6 A;  1WFX A;  1T2K A;  3CJT B;  1MKM A;  1OFC X;  3ZMT A;  2QGU A;  4FQG A;  2EIN H;  2NS7 A;  4XR6 A;  3DU6 A;  3COA C;  3M4O J;  5EGO B;  4IZZ A;  3C1D A;  3IWF A;  2STT A;  1FBS A;  3JRG A;  4HEA 2;  3HPH A;  4F91 B;  2XAU A;  3TDU C;  2NOJ B;  2P5V A;  3MAJ A;  2QQB A;  2EB7 A;  1U9N A;  4LGW A;  5HLI A;  2K9L A;  4CA0 A;  3VYU B;  4HDV A;  2R7S A;  1ZG1 A;  3LST A;  1RIO H;  3IC7 A;  5LRR A;  4LJZ F;  3LSK A;  2HXO A;  2W57 A;  1FZP B;  4C3H J;  2P81 A;  1X1D A;  2KIQ A;  1GV2 A;  4FE7 A;  1G3Y A;  2HYJ A;  4PJM A;  4QTR A;  1WJE A;  4PZJ A;  4C3J J;  3BG6 A;  2AHQ A;  2K9S A;  3CES A;  4EM1 A;  3DLL F;  1PP8 F;  3BTL A;  2RQQ A;  5GAG J;  3I56 I;  2XRL A;  4E7K A;  3LFU A;  2YPR A;  1YIT I;  3AAF A;  2M2E A;  4A0X A;  1YJN I;  5CLS A;  3JAM Z;  3HTS B;  4A3K J;  2JJ7 A;  1SEU A;  5TGT A;  4AIK A;  3BQY A;  4ENJ A;  2JUG A;  2EV6 A;  1ETW A;  1JKP C;  2MSY A;  1T6S A;  1XC5 A;  3C2H A;  2CV1 A;  2DOE A;  3HHG A;  4H0E A;  1MMD A;  1JI8 A;  3EYY A;  1T95 A;  1AKH A;  1PUF A;  2LKX A;  4PCQ A;  2BHZ A;  3O3K A;  5J47 A;  2HEO A;  4KYW A;  2XIG A;  4KT6 A;  1ODD A;  5IPA A;  4UNO A;  3KZI C;  3LL7 A;  1FMV A;  2VKD A;  3BR6 A;  3J7Z I;  1IRX A;  1AU7 A;  5FGM A;  2YSR A;  3I53 A;  3A03 A;  3CCE I;  4OU0 A;  1R9T J;  2EQR A;  3FM5 A;  2BXZ A;  3HZJ A;  1QHH D;  4XON A;  3IHU A;  3S2H J;  2ESN A;  2COB A;  2FML A;  5ICC A;  3OYJ A;  4FHT A;  4KIS A;  1GLN A;  3IAM 2;  2LMD A;  3JRA A;  1SC7 A;  3GTK J;  2JSP A;  1OCZ H;  1QZY A;  1MNM C;  1LJ9 A;  1F36 A;  5JFR A;  5J8C A;  2LKS A;  3AG1 H;  4BHP A;  2KRH A;  5A2Q Z;  2D45 A;  3CDH A;  1XS9 A;  2P8T A;  2Q8K A;  2LR8 A;  3BG3 A;  5DM7 F;  4JX4 A;  4ETS A;  1B4A A;  4WF2 A;  4I6Z A;  3WOD F;  3CTA A;  4M9Z A;  4NC8 A;  3HB9 A;  1HC8 A;  1BL0 A;  2XHK A;  3TGN A;  1LEB A;  2X6Y A;  4UUV A;  3JRF A;  5LBQ A;  4E7L A;  5FLX K;  2KIU A;  3KCC A;  2W85 A;  3LOC A;  1H89 C;  1QVU A;  3FMR A;  2G7H A;  2LH9 A;  5ICF A;  2R7D A;  2FBK A;  2LF7 A;  4WXC A;  2E36 A;  2HZD A;  2VPL A;  2NNY A;  4M3B A;  1IG7 A;  1S7E A;  2LP0 A;  3L9F A;  4S04 A;  1D3Y A;  2BGC A;  4KT5 C;  1BC8 C;  2KIS A;  3OYL A;  1ZRE A;  2V26 A;  2XRN A;  2GOM A;  4U0Y A;  4WXD A;  1TZL A;  2CU7 A;  4G94 A;  2AXL A;  3MFK A;  3K7A J;  1NG6 A;  2F5E A;  3FXK A;  4LMY A;  5EEA A;  2PI0 A;  2E35 A;  1T39 A;  2ECC A;  3FXQ A;  5M3M J;  1KGS A;  4PGH A;  2CH0 A;  1ZAR A;  2XSD C;  3FHZ A;  1RES A;  2IS6 A;  2FNP A;  4JX6 A;  5D8K B;  1IW7 F;  3ZMS A;  4EJW A;  2K3P A;  1ZR4 A;  3FK6 A;  2ZXH A;  2W1O A;  5E79 C;  2PX9 A;  2QQA A;  2B7E A;  4LLN A;  2DA2 A;  2MBF A;  4L9V A;  1MND A;  2MA3 A;  3HIF A;  1T0F C;  2E7W A;  4Y13 A;  2E2I J;  2KJC A;  2OTJ I;  2Q0O A;  4MNU A;  3RPU D;  1XTA A;  2R7O A;  5J1R A;  2FA5 A;  2W00 A;  2Q2E A;  2JSC A;  1JGS A;  4D7M A;  3NWS A;  3VOD A;  4ESJ A;  4HF1 A;  4A3E J;  1X3W B;  1VFC A;  4CHU A;  5FRM A;  2PMZ N;  3RYR A;  1A6I A;  4LIU A;  4IQ4 A;  1LE8 B;  3PJR A;  2DTR A;  4EJU A;  1QO0 D;  4JX5 A;  5J1U A;  1YS6 A;  3GW2 A;  3GME A;  2FUG 2;  3MN2 A;  3DPU A;  3WGH A;  1K79 A;  2DN0 A;  2Q1Z B;  2DMU A;  3FF5 A;  3IWZ A;  4LD5 A;  1EV7 A;  1U8B A;  3QYE A;  3UR3 C;  1LVA A;  2DT6 A;  1IDZ A;  1ZYR F;  1YX5 A;  2QUF A;  2FRH A;  2NVT J;  4ABZ A;  1E17 A;  1LDJ A;  5DCF A;  1FY7 A;  3WG9 A;  4G8X A;  3CMY A;  4KA4 A;  3Q5F A;  5CKT A;  2K5C A;  3NQO A;  1GT0 C;  2HOA A;  4I76 A;  4Y15 A;  3SEZ A;  2HS5 A;  4XBF A;  1OJL A;  1QU3 A;  3ZQC A;  1R1U A;  2DA6 A;  4OOI A;  1X1A A;  2EWN A;  3KYD B;  2XAG A;  3A01 B;  3BC8 A;  3QYB A;  4EVI A;  1JKQ C;  2X1D A;  2B9S A;  2EFN A;  1BIA A;  2P6T A;  4C30 A;  3K1N A;  1WQ2 A;  2EV0 A;  4EAT A;  2R0Q C;  4DBQ A;  1F9N A;  1FSH A;  2AQE A;  4A12 A;  3BG5 A;  1I3A A;  4S05 A;  3LSR A;  1WZ2 A;  5CQG A;  1MZB A;  2M4K A;  1IRZ A;  1KU2 A;  3V7R A;  2OTL I;  3ABM H;  3JR9 A;  3ABT A;  1FWZ A;  3TMO A;  2WAQ A;  2Y0M A;  3DTE A;  3P9C A;  1HW5 A;  2QYO A;  1H8A C;  1MH4 A;  3I3L A;  2K7L A;  3I4N J;  3HOX J;  1ZAO A;  4LG0 B;  1XG1 A;  1ZK8 A;  2A6E F;  1I6H J;  3I71 A;  3OS1 A;  4B09 A;  2R93 J;  3CZ6 A;  2LSO A;  1BC7 C;  1JT0 A;  1ITY A;  3H1C A;  1JHF A;  4XSX F;  2LKP A;  2ZJQ F;  2DTZ A;  1I50 J;  4E7J A;  2JN6 A;  3V8L A;  2M7A A;  2K3F A;  3K10 A;  4KMU X;  1BW6 A;  4OMY A;  1I3Q J;  2A07 F;  2H1K A;  3GZ5 A;  2IW5 A;  2R7Z J;  1DDN A;  4WXH A;  1R71 A;  1HST A;  5H6Q A;  3SZT A;  1XSX A;  4M9X A;  3DWL E;  3U2R A;  2HKO A;  4XKB A;  3GBG A;  1TNT A;  5DDG A;  5IY5 H;  2Y0S A;  3ABU A;  4XRF A;  5E20 A;  3S1Q J;  5BMZ A;  3TQN A;  3DFG A;  2YS9 A;  2KDZ A;  1JKR C;  1D5Y A;  2KZG A;  4W97 A;  2EIM H;  1UMQ A;  3OYF A;  3RJP A;  3VWB A;  4IRI A;  2BBY A;  1KON A;  2OQG A;  2CUJ A;  3A02 A;  1WGX A;  4A3F J;  4EGZ A;  5BOX A;  2NVQ J;  5FLV A;  1WI3 A;  4P1W A;  2B0L A;  3EUA A;  4BJ6 C;  3ROU A;  4LLG F;  5TJJ A;  4L18 B;  1C0W A;  1Z7U A;  3OWT A;  3JAM K;  1EA3 A;  3FBI B;  1FOX A;  2QEN A;  2GOX B;  2Y31 A;  1LUJ B;  4E7I A;  4A69 C;  2ETH A;  2LRE A;  2FU4 A;  3K1M A;  4U0W A;  2O7O A;  1W5C C;  5EGO A;  3T5X A;  1MBJ A;  1XB4 A;  5AON A;  2FSW A;  3E5Q A;  2JK3 A;  3LA7 A;  2CMP A;  3FXJ A;  3DU5 A;  2EFQ A;  3B6C A;  3B02 A;  3HOV J;  2K40 A;  2ZKZ A;  4P96 A;  3JSO A;  5IT9 K;  4BL0 B;  3KLN A;  2LOO A;  4IKF A;  2A5W A;  4PJ0 C;  4A5N A;  2LFB A;  4A6E A;  1L3L A;  4Y3O A;  2LTP A;  1WJD A;  4EMS A;  4F52 A;  3CME I;  5FD5 A;  2E1M C;  2L54 A;  1IUF A;  5C4X J;  1HDP A;  2PG4 A;  4LB6 B;  3ONQ A;  3F6V A;  2ICW G;  3V42 A;  1B59 A;  4JBA A;  2L7K A;  3HOU J;  4BQQ A;  1Y0U A;  2H8W A;  2FOK A;  2PMU A;  1AOY A;  2FX0 A;  2PJR B;  2BEO A;  2UXN A;  1X19 A;  2EBI A;  3FKI J;  4RAZ A;  2YU3 A;  1B72 B;  2R7Q A;  1SD4 A;  1GXP A;  1BIB A;  5JLW A;  1FBQ A;  1ZGW A;  5J3L A;  2NRA C;  1X58 A;  3WU1 B;  2Z2S B;  2PJP A;  4E7H A;  3KYC B;  3TO9 A;  1BJZ A;  3FMQ A;  3ISP A;  2XB5 A;  3D0S A;  3VPR A;  3E1S A;  3LSG A;  1IXS B;  2KFD A;  4XN3 A;  1L0O C;  5E1X A;  1HBX G;  2LLK A;  2BY2 A;  5F6F A;  3CCV I;  1D5V A;  4OIN F;  2DFE A;  5J4Y A;  1AWC A;  3D5S C;  2EFW A;  1B1B A;  3K0L A;  2AO9 A;  4RGR A;  3FXM A;  1P7I A;  3PIO F;  1P2F A;  4RB0 A;  2VN2 A;  1A04 A;  4NC7 A;  4IO9 F;  1HF0 A;  1YI2 I;  4OWR B;  5CQE A;  1Z6R A;  1R36 A;  1TQP A;  4M3G A;  5HNF A;  4FTH A;  2WWY A;  4B43 A;  4MFE A;  4Q4Z F;  2N8G A;  2HR3 A;  1NTC A;  5J6X A;  2GXA A;  1EJ9 A;  3KE2 A;  1UZC A;  1Y1V J;  2DQR A;  3ZR8 X;  2VKH A;  2VB6 A;  4A5M A;  1M1E B;  4XL9 A;  3S93 A;  2V7F A;  5EZG A;  2P5L C;  3BPX A;  1V5E A;  4GGG A;  1VQ4 I;  3OYI A;  4DIQ A;  4ITV A;  2QSF X;  5B66 C;  2DO7 A;  1TT5 B;  3HOZ J;  4RB3 C;  1QRY A;  2D1V A;  2UXX A;  4P9U A;  2XKP A;  3FZV A;  3K69 A;  1V5F A;  2RKH A;  2FBH A;  4HW0 A;  1I1S A;  2MW8 A;  5JI6 A;  3Q0U A;  3K4J A;  3DPT A;  3C2B A;  5EEH A;  2CQ7 A;  2LBF B;  5K5O A;  4MTD A;  4I09 A;  3ABL H;  5H6R A;  1V4R A;  2RN7 A;  2W24 A;  2WV1 A;  2VE8 A;  3SZP A;  1YO5 C;  2K27 A;  5ILU A;  4B44 A;  3QP5 A;  3KP2 A;  2CQX A;  2ME0 A;  4IX7 A;  2DMP A;  2E2J J;  1P7J A;  5F0H A;  4OIO F;  2WV0 A;  3G73 A;  2PJR A;  2ZME A;  2VT3 A;  2ELJ A;  2NVY J;  4YIR X;  2Y75 A;  5EG0 A;  3M1E A;  3MZY A;  1ZG3 A;  3QPS A;  3WTV C;  3GTJ J;  5EF6 A;  1NHA A;  4HX4 A;  3BR1 A;  2MGQ A;  3WTU C;  1FMW A;  5CVR A;  3G71 I;  1OYY A;  1KU3 A;  1IXR C;  4XOT A;  4DBR A;  3MCZ A;  3L2U A;  4Q5S F;  4XLE A;  3O8G A;  3CC4 I;  1YIJ I;  3Q0V A;  1H9T A;  1SFK A;  3FK7 A;  1IJW C;  2CS3 A;  4AC0 A;  2BHY A;  4YII A;  1VQ8 I;  2HDC A;  3I4P A;  2E5Z A;  1DQU A;  1WJA A;  1X4P A;  3GZ6 A;  3DEW A;  2O8X A;  1YTY A;  5F08 A;  4A3D J;  2M4G A;  2A5Y B;  3OMY A;  1UHM A;  2LG4 A;  2LVS A;  1XSV A;  3GCM A;  4Q48 A;  1HKS A;  2KMU A;  3HYI A;  4UB6 C;  4CCM A;  1LB2 A;  1FNN A;  2W84 A;  1ORK A;  4RAF A;  5LFA A;  5E3M A;  4ANJ A;  5EZH A;  1BW5 A;  2EZK A;  4CCJ A;  1SFO J;  1PUF B;  2L5Q A;  2QKL B;  1TW2 A;  3A2K A;  2R5Y A;  1MBK A;  1TBX A;  3E6D A;  2DJN A;  1VTN C;  3ML6 A;  2FMY A;  2R92 J;  4HNU A;  4WWC A;  3BR2 A;  1TWC J;  4HYE A;  1OCT C;  5FKK A;  3EUH A;  2VXZ A;  3F8C A;  3JRI A;  3HKZ N;  3RKX A;  1LFU P;  3BOQ A;  1P6R A;  1MBF A;  3PUF A;  5CJ9 A;  1H0M A;  3KP6 A;  2H8R A;  4U0V A;  1N77 A;  3H5R A;  4CYC A;  2XUB A;  2O9L A;  2FBI A;  3F22 A;  1FTZ A;  3N05 A;  2K85 A;  4A6D A;  1R58 A;  4B48 A;  2E19 A;  1NH3 A;  3GTQ J;  2XC7 A;  5LHI A;  4UV9 A;  3E7L A;  4KIF A;  2H09 A;  5EEG A;  2CW0 F;  2DJI A;  2LK2 A;  1Z91 A;  2IGK A;  2VJI A;  3MD2 A;  2V1X A;  2UZK A;  3QP6 A;  2R7U A;  3J81 Z;  3TED A;  2KIF A;  4I99 C;  2L9R A;  4X6A J;  1IUY A;  4IJA A;  4AM3 A;  4KIB A;  1U2W A;  3KIO A;  2K9Q A;  1APL C;  4XLC A;  1VQ7 I;  1OPC A;  4KNY A;  5GAH J;  3TO7 A;  3ERM A;  1ENH A;  3PQJ A;  4BH9 A;  2K4J A;  5M3F J;  1RNL A;  1RPW A;  3GEZ A;  3L2V A;  1K6Y A;  4IRG A;  4M6Y A;  4XKV A;  1MNE A;  4D1Q A;  1W0U A;  5EDN A;  1TC3 C;  2IA0 A;  1Z3X A;  2VQL A;  2PFB A;  2JZY A;  3BPV A;  5HLG A;  3S3M A;  3BJO A;  3BZ6 A;  1QVT A;  1QZE A;  5L3B A;  2GBY A;  4M3D A;  5GP9 A;  2Z5U A;  3CF5 F;  2QQ8 A;  5LHG A;  4AYB A;  4B3X A;  3OV8 A;  1Z0X A;  4RMN A;  4BNC A;  3CCM I;  5CVJ A;  4YFN F;  3WTY C;  4A3L J;  1K78 B;  3OS0 A;  3VSL A;  2VXD A;  3MZH A;  3MZ8 A;  4IHT A;  4EM0 B;  1Y56 A;  2M34 A;  2QCO A;  3R61 A;  1BJA A;  1MD0 A;  5DYM A;  1UCR A;  1B8I B;  2LBF A;  2CYY A;  3KZZ A;  1P4X A;  1R00 A;  2X6O A;  3S3N A;  2QQ9 A;  3BTJ A;  3MKL A;  2FD5 A;  4P5O A;  3OYD A;  3VB2 A;  5F1R A;  1G59 A;  1D8K A;  5GAE J;  3E5U A;  2RGV A;  2WB1 N;  1KZH A;  2F4M B;  5IP7 J;  3RPQ A;  1W0T A;  3P9I A;  4MEY F;  1P4A A;  2FE3 A;  1IRF A;  4IEJ A;  2P5K A;  3UNG C;  2KT0 A;  4ENM A;  3E97 A;  3GWZ A;  2FQ3 A;  1LNW A;  1V3F A;  1W36 D;  4X1E A;  3F6O A;  4ZYD A;  4BAC A;  1Y39 A;  2XSJ C;  2IJL A;  5LRS A;  3BTC A;  4EEF G;  3S8P A;  2GM4 A;  4L9N A;  3CCJ I;  2F5D A;  1UHS A;  1XCB A;  3WTW C;  1A6Q A;  1Q1V A;  3VFZ A;  4P9F A;  2VLA A;  2HQN A;  1U78 A;  5FO5 A;  1XGN A;  2HVS A;  3JRD A;  3FHN A;  3TDZ C;  1D0Y A;  3JRC A;  2XAJ A;  2X4H A;  2K02 A;  2HQ5 A;  4BQA A;  2R7X A;  3AL0 C;  1XMK A;  3IAS 2;  4C9Y A;  1FOK A;  4B1R A;  3I4M J;  3TW7 A;  4EGY A;  2RC4 A;  1ETX A;  1D1B A;  5J4V A;  3SZG A;  3JSP A;  3CCY A;  2HZT A;  3F0C A;  1TW3 A;  3V8K A;  3J7Y J; 
#chains in the Genus database with same CATH homology
 1ZQ3 P;  3CMY A;  2TRT A;  4A93 J;  1WH5 A;  4A3M J;  3RZO J;  2NS8 A;  1GT0 C;  2HOA A;  4I76 A;  1OJL A;  4IHW A;  3ZQC A;  2DA6 A;  3A01 B;  3LNQ A;  1VI0 A;  2XPU A;  5IP9 J;  4BXX J;  1JKQ C;  9ANT A;  4HNV A;  2LY9 A;  2O8K A;  1TWG J;  1GDT A;  1HOM A;  2HOS A;  3QPL A;  2R0Q C;  4DYQ A;  4S0H B;  4L5E A;  3BQZ A;  3BG5 A;  3Q3S A;  3JRH A;  3LSR A;  3IH3 A;  4QIW N;  1IRZ A;  1MBE A;  4DYC A;  3JR9 A;  2IEK A;  2Y2Z A;  4QSH A;  4FIS A;  1H8A C;  1MH4 A;  1VND A;  3I4N J;  3HOX J;  3TP0 A;  1NK3 P;  4A3I J;  3OSF A;  1XG1 A;  2R5Z B;  1ZK8 A;  2K9N A;  2R93 J;  1I6H J;  4NDL A;  2W48 A;  1JT0 A;  2YU9 J;  1ITY A;  4MLO A;  1GVD A;  2ELK A;  2Y30 A;  1K61 A;  2DTZ A;  1I50 J;  2JN6 A;  4DZJ A;  3MVP A;  1RKW A;  1BW6 A;  1I3Q J;  4LOC A;  1ETQ A;  2H1K A;  3BR5 A;  3LSJ A;  2R7Z J;  1A5J A;  4Y52 J;  3S16 J;  4V2F A;  1UG2 A;  4M3E A;  3JRB A;  5IYC J;  1IC8 A;  4B3A A;  1ZTR A;  3GBG A;  3S15 J;  1ZKG A;  3PO2 J;  3BR3 A;  3S1Q J;  1SAN A;  2JWT A;  2YS9 A;  2KDZ A;  1JKR C;  1D5Y A;  1F43 A;  2L7Z A;  4A3J J;  4W97 A;  2Y9Z A;  3RKQ A;  1UMQ A;  5BNG A;  3GTP J;  3A02 A;  3PM1 A;  1POG A;  2XPV A;  2VI6 A;  1WGX A;  1T56 A;  4A3F J;  1JGG A;  2L7F P;  2NVQ J;  3IV5 A;  1H88 C;  5FLV A;  1ETO A;  2DA7 A;  1WI3 A;  3CQZ J;  3ZQL A;  2R5Z A;  4XRM A;  2D5V A;  4RBO A;  3S2D J;  2EH3 A;  5K7H A;  2Y31 A;  3BR0 A;  4A69 C;  4UUS B;  2HI3 A;  3Q0W A;  1LE8 A;  2FQ4 A;  2O7O A;  4BBS J;  5EGO A;  5IOY A;  1EF4 A;  1MBJ A;  4A3G J;  1JTY A;  2CQQ A;  2L0K A;  2JK3 A;  1YRN B;  1JJ6 C;  2M9H A;  3GTM J;  2QF7 A;  3B6C A;  1Y1W J;  5EG0 B;  3HOV J;  4JP0 A;  2K40 A;  5JLX A;  3UKG A;  2E1O A;  4DZP A;  3HM5 A;  3TW6 A;  1JTX A;  5FKO A;  1JJ8 C;  1RKT A;  2LFB A;  2LTP A;  2EZL A;  4V2G A;  5C44 J;  1IUF A;  5C4X J;  1HDP A;  3M3Y J;  4XRS G;  1O4X A;  5EYR A;  3OOU A;  1K83 J;  3L1P A;  3WHB A;  1FIP A;  2DA1 A;  2EZH A;  2YUS A;  3HOU J;  3ZOB A;  5F0F A;  3S1R J;  2EZI A;  1WPK A;  2XB0 X;  2WAQ N;  2M0C A;  2R5Y B;  2FX0 A;  1NK2 P;  1MSF C;  4FCY A;  4AYB N;  2ID3 A;  3OIO A;  2EBI A;  3FKI J;  1B72 B;  5E3L A;  5HOD A;  3PO3 J;  5JLW A;  1ZGW A;  5J3L A;  1X58 A;  3H3V K;  4XID A;  4DW6 A;  4CYC B;  5E3N A;  1BJZ A;  2XB5 A;  3VPR A;  1LFB A;  3LSP A;  3ZQG A;  4B4C A;  3LSG A;  2E2H J;  4DYR A;  2B63 J;  1JUM A;  2VKV A;  2LLK A;  1GV5 A;  5FJ8 J;  2GLO A;  4C2M J;  2NVX J;  2ME6 A;  1WH7 A;  2AO9 A;  1P7I A;  3CDL A;  3B6A A;  1TWA J;  4A3C J;  1HF0 A;  5GPA A;  5K7Z A;  3BTI A;  3DCF A;  4M3G A;  3IH4 A;  4FTH A;  5IYD J;  3HGG A;  3TP3 A;  4MFE A;  1AKH B;  2N8G A;  5F04 A;  2CUE A;  5IP6 A;  1HCR A;  3A01 A;  4W1U A;  1NTC A;  2JA6 J;  3RQI A;  1FIA A;  2DMT A;  3S14 J;  1Y1V J;  1DU6 A;  3BG9 A;  1RET A;  1X2M A;  5EZG A;  4BBR J;  2Y9Y A;  2IBD A;  3HOZ J;  1QRY A;  4G12 A;  4XRS A;  4MO7 A;  3FIW A;  2G0E A;  4AUX A;  4BY1 J;  3GTL J;  4FE4 A;  5M5W J;  1VF9 A;  1IDY A;  4RDU A;  3H0G J;  1ZR2 A;  4IHX A;  3HGY A;  3HOW J;  2CJJ A;  5C3E J;  2MW8 A;  4IHV A;  3Q0U A;  1T33 A;  4C3I J;  3C2B A;  5M5X J;  3G1L A;  2WV1 A;  4XK4 A;  2OPT A;  1AHD P;  2CQX A;  2ME0 A;  1JKO C;  4GFB A;  2JA7 J;  2DMP A;  2E2J J;  1P7J A;  5F0H A;  1OFC X;  2NS7 A;  2NVY J;  3BT9 A;  3M4O J;  1DU0 A;  5EGO B;  1HDD C;  3W6V A;  5EG0 A;  2NOG A;  3QPS A;  3GTJ J;  5EF6 A;  3JRG A;  3BR1 A;  3JRE A;  2MGQ A;  1BA5 A;  2DA3 A;  1U9N A;  5M5Y J;  3O8G A;  3NAU A;  1MH3 A;  3Q0V A;  3FK7 A;  3K2A A;  3WHC A;  1IJW C;  3O8H A;  4AC0 A;  2HXO A;  1MBH A;  4C3H J;  1TWH J;  2P81 A;  4FE7 A;  1GV2 A;  3DEW A;  2HYJ A;  5F08 A;  1GUU A;  1JT6 A;  4A3D J;  4QTR A;  3SFI A;  4C3J J;  2LVS A;  2AHQ A;  1JUP A;  2K9S A;  4BY7 J;  2X9D A;  3BTL A;  1WCM J;  1ORK A;  1ETY A;  5E3M A;  1G2H A;  5FKM A;  2XRL A;  2VUM J;  5EZH A;  5IYB J;  1BW5 A;  4IHY A;  4D5F A;  2EZK A;  5FKN A;  1U9O A;  2M2E A;  3ZQI A;  2RAE A;  2VPR A;  4Y7N J;  5DS9 A;  1SFO J;  2FJ1 A;  2JJ7 A;  2TCT A;  3G1O A;  4A3K J;  1PUF B;  2R5Y A;  1MBK A;  3BQY A;  2DJN A;  2CUF A;  1JKP C;  1ETW A;  2MSY A;  2DA4 A;  1XC5 A;  2R92 J;  3BR2 A;  1TWC J;  5DTD A;  1OCT C;  5FKK A;  4JYK A;  3JRI A;  3HKZ N;  1LFU P;  1PUF A;  2LKX A;  1AKH A;  1MBF A;  2M8G X;  2H8R A;  4CYC A;  2O9L A;  5IPA A;  5IOZ A;  3S1N J;  1FTZ A;  1E3O C;  3BR6 A;  1AU7 A;  2E19 A;  3GTQ J;  1IV6 A;  1QPI A;  2XGE A;  3A03 A;  3E7L A;  2LK2 A;  1FTT A;  1R9T J;  2EQR A;  2LD5 A;  5F1J A;  3SDG A;  1ETK A;  2XGD A;  3NAR A;  3ZQF A;  1ETV A;  3S2H J;  2COB A;  3TED A;  2XPW A;  4MFD A;  2ID6 A;  2L9R A;  4X6A J;  1OCP A;  1RR7 A;  3JRA A;  2K9Q A;  1APL C;  3S1M J;  3GTK J;  5FKL A;  1MNM C;  1F36 A;  3FIS A;  2XGC A;  1ENH A;  1B72 A;  2CRG A;  5M3F J;  2DA5 A;  1RPW A;  1FEX A;  5J1Y A;  3G1M A;  1XS9 A;  2LR8 A;  3BG3 A;  3SJM A;  1W0U A;  4JX4 A;  5EDN A;  2JMW A;  1TC3 C;  3GTG J;  2X48 A;  4I6Z A;  1Z77 A;  3HB9 A;  1BL0 A;  3JRF A;  1QVT A;  2GBY A;  4M3D A;  5F27 A;  5GP9 A;  4XIC A;  2DMQ A;  1H89 C;  3LOC A;  5E3O A;  1QVU A;  5GPC A;  1B8I A;  1MSE C;  4BKX A;  1Z0X A;  2I10 A;  5F0C A;  2DMN A;  2IAI A;  4A3L J;  2HOT A;  3QQA A;  3HBL A;  3RZD J;  4M3B A;  1IG7 A;  1S7E A;  2LP0 A;  3S17 J;  2M34 A;  2QCO A;  4A3B J;  1B8I B;  3GTO J;  2CU7 A;  2X6O A;  1X2N A;  3K7A J;  3D1N I;  2HDD A;  3ZQH A;  1IGN A;  5EEA A;  3BTJ A;  1JUS A;  3MKL A;  4D5C A;  2FD5 A;  2ECC A;  2HXI A;  5M3M J;  3OSG A;  3IH2 A;  2XSD C;  1RES A;  5C4J J;  2L7M P;  2WB1 N;  5IP7 J;  4JX6 A;  1W0T A;  4MIM A;  4M6V A;  2VKE A;  5K7F A;  1ZR4 A;  4IEJ A;  3FK6 A;  2ECB A;  1FJL A;  2Y0S N;  2KT0 A;  2DA2 A;  2MG4 A;  3HEF A;  2JA5 J;  4X1E A;  2E2I J;  2GM4 A;  3BTC A;  4EEF G;  3HDD A;  2JA8 J;  4UUS A;  1UHS A;  5J1R A;  1Q1V A;  2ZB9 A;  1CQT A;  4D7M A;  4UUT A;  4A3E J;  1VFC A;  1U78 A;  2PMZ N;  1A6I A;  1LE8 B;  3JRD A;  2OF7 A;  3JRC A;  4JX5 A;  5J1U A;  1MBG A;  2HQ5 A;  1YRN A;  4B1R A;  3I4M J;  3TW7 A;  3MN2 A;  1HLV A;  2DN0 A;  1ETX A;  2DMU A;  1U8B A;  1TWF J;  5FLM J;  3CCY A;  1IDZ A;  3F0C A;  4D7N A;  3HOY J;  4J19 A;  2NVT J;  4M3F A;  4ABZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...