1H88C

Crystal structure of ternary protein-dna complex1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C03
4A3CJ 2Y31A 2OF7A 2LTPA 4IEJA 2FX0A 5IYDJ 4FCYA 1K61A 1JKRC 1TWFJ 2ZB9A 5FJ8J 1POGA 3LSPA 4B3AA 3OSGA 2N8GA 3BT9A 1BA5A 3BTLA 2M0CA 1ZK8A 1S7EA 1Z77A 2ME6A 2R7ZJ 3M3YJ 5JLWA 3QPSA 2R92J 5FKOA 3BR3A 2JA6J 2JA5J 2YU9J 2DA4A 2XPUA 3S14J 3BTJA 3S2HJ 1JUMA 4MO7A 3ZQHA 4A3GJ 2E1OA 2O7OA 2K9NA 3LSRA 1QPIA 3IH2A 5C44J 3IV5A 1FTZA 1I3QJ 1UHSA 3GTGJ 3RZOJ 1AHDP 5C4XJ 4C2MJ 4AYBN 5C3EJ 2CJJA 2DMQA 5FKNA 1MH4A 3RKQA 2XB5A 2R5YB 2WV1A 4UUTA 2YUSA 2LR8A 2W48A 1NK3P 4IHVA 3BR0A 3JRGA 4BKXA 4XRMA 4A3LJ 5F0HA 5FKKA 3DCFA 4IHXA 1OCTC 2IBDA 4HNVA 4C3HJ 1P7JA 3LSJA 4IHWA 1QVUA 1AU7A 3A02A 1JKOC 5EF6A 1IUFA 4DW6A 4J19A 4FTHA 3Q3SA 3BQYA 4DZPA 1IG7A 2DMPA 1A5JA 1ZKGA 2CUFA 4QSHA 4FE4A 1XS9A 3MN2A 1SANA 2R0QC 1RETA 3M4OJ 1IDYA 2HDDA 3JRHA 1JT0A 1TWHJ 3SDGA 3ZQGA 5EG0A 5IP7J 2VPRA 2DA6A 3DEWA 2K9QA 4C3JJ 4X1EA 3O8GA 5E3MA 3S1RJ 3PM1A 5EZGA 1G2HA 5DS9A 4CYCB 5GP9A 2JMWA 5HODA 4MLOA 3BR1A 1EF4A 3S1NJ 1HDDC 1K83J 3GTMJ 3Q0UA 1IGNA 2DJNA 2MG4A 2LK2A 3BR5A 4FE7A 3TW6A 4D5FA 5F27A 2QF7A 3D1NI 1PUFA 2XGEA 4RDUA 1IRZA 5FLVA 3BQZA 2L9RA 3BG9A 1ETXA 5F0FA 4A3DJ 2JK3A 3BTIA 1GDTA 3UKGA 5C4JJ 3K2AA 3HOUJ 4A3FJ 1JT6A 2DMUA 1WH5A 4AUXA 1JKPC 5EG0B 4MIMA 3HOYJ 3TW7A 4EEFG 3ZQFA 1W0TA 1AKHB 2ELKA 1JUPA 2M34A 1LE8B 3GTLJ 1U9NA 1FIAA 4A3EJ 1HCRA 2DMTA 4M3DA 3JR9A 1MSEC 2VKEA 1RR7A 2NVYJ 1XG1A 3H3VK 4QTRA 3HOXJ 2LKXA 3G1OA 2E2HJ 5FKMA 3CQZJ 2CU7A 1X2MA 1IV6A 1OJLA 3OSFA 5E3LA 1IC8A 4BBRJ 4BY1J 1VF9A 2EZIA 3PO3J 4JYKA 4MFEA 5J1RA 1U9OA 4D7MA 2DMNA 5GPCA 2LY9A 3I4NJ 3HOZJ 5IYBJ 2KDZA 5M3MJ 3FKIJ 5M5WJ 3SJMA 2DA2A 2Y30A 1RPWA 4I6ZA 4Y52J 4M3BA 4M3GA 2WB1N 1HOMA 2AHQA 5EYRA 4XK4A 3WHCA 2VI6A 4D5CA 1MSFC 1XC5A 1MNMC 2VUMJ 3HBLA 1FEXA 3LNQA 1HF0A 5IP6A 1ETYA 4L5EA 3K7AJ 5F1JA 1R9TJ 1ZR4A 5J3LA 1H89C 1LE8A 4W97A 4UUSA 5BNGA 4DYRA 4FISA 4I76A 5M5XJ 1RKWA 2M2EA 2VKVA 4XRSG 3TP3A 2CUEA 4A3JJ 2IAIA 1I50J 3L1PA 5K7ZA 4XICA 4A69C 1F43A 2Y9YA 3C2BA 4C3IJ 1PUFB 1CQTA 1TWAJ 3ZQLA 4XRSA 1RESA 1FIPA 3PO2J 2HQ5A 1TWCJ 3GTOJ 1Q1VA 3B6AA 3TP0A 2ME0A 3A03A 1Z0XA 2DTZA 2KT0A 5IP9J 3BR2A 5FLMJ 2MGQA 4IHYA 2HYJA 4NDLA 2GLOA 4QIWN 3NARA 3HEFA 2HI3A 3CDLA 1H8AC 3ZQIA 1TWGJ 4JX6A 2LVSA 5EDNA 5F08A 3GBGA 3LOCA 3GTPJ 2L7ZA 1GUUA 3HOWJ 1DU6A 5K7HA 4UUSB 2D5VA 1ORKA 5EGOB 5J1UA 1P7IA 3B6CA 2JWTA 3QPLA 1JGGA 2YS9A 5IOZA 3CMYA 1ETWA 2E19A 5IYCJ 3QQAA 3Q0WA 4A3KJ 1QRYA 1W0UA 5F04A 2ECBA 1WH7A 1BJZA 1HDPA 1MBHA 2MSYA 2Y2ZA 1U78A 1LFBA 1WPKA 1LFUP 5F0CA 1GV5A 2HOTA 2L7FP 1MBGA 1IJWC 3S1MJ 1ETVA 2X6OA 3BR6A 1TC3C 2XPVA 1AKHA 3WHBA 2H8RA 2GM4A 3FK6A 2QCOA 1A6IA 4W1UA 1WI3A 1T56A 2FJ1A 3OOUA 9ANTA 2R93J 5M3FJ 4GFBA 2NS8A 3GTJJ 4V2GA 3RZDJ 1BL0A 3JRDA 1APLC 1UG2A 2LLKA 2XB0X 4S0HB 2M8GX 3JREA 3FIWA 4A93J 3IH3A 5EEAA 2HOAA 2JJ7A 2P81A 1E3OC 5DTDA 3SFIA 3FISA 1FTTA 1JJ8C 4B1RA 2FQ4A 1GVDA 2E2JJ 2ID6A 2E2IJ 2H1KA 1X58A 2EZLA 3A01B 3GTQJ 1MBFA 1YRNA 2NVQJ 2DN0A 1ZGWA 2NVXJ 2O9LA 1GT0C 5E3OA 1B72B 3CCYA 1RKTA 2NVTJ 3W6VA 2LFBA 2HOSA 3MKLA 2Y9ZA 2OPTA 1H88C 1MBJA 2JA7J 2AO9A 3HOVJ 1VI0A 3A01A 3S16J 1WGXA 4JX5A 1B8IA 1D5YA 1GV2A 2MW8A 3BG3A 3ZQCA 2CRGA 3VPRA 4CYCA 4A3MJ 3BTCA 1F36A 2ECCA 5E3NA 5M5YJ 1ZTRA 1QVTA 4ABZA 3JRFA 2X48A 3LSGA 2B63J 1ENHA 5J1YA 3H0GJ 3O8HA 1YRNB 3S15J 4V2FA 4RBOA 5IPAA 4X6AJ 3OIOA 3IH4A 1I6HJ 1X2NA 2DA3A 2TCTA 2CQXA 4MFDA 1ETOA 5FKLA 1BW5A 2R5YA 3HKZN 2LD5A 2JN6A 3G1MA 1JTYA 1FJLA 5GPAA 4M6VA 4DYCA 3JRAA 3HGGA 2EZKA 2HXIA 3HM5A 3FK7A 5K7FA 4BBSJ 3I4MJ 2NS7A 2ID3A 1OFCX 1OCPA 2M9HA 2PMZN 2HXOA 3E7LA 2IEKA 3ZOBA 4Y7NJ 2R5ZB 2XSDC 1Y1VJ 2DA7A 1JKQC 1ETQA 1WCMJ 1IDZA 5EZHA 3G1LA 1U8BA 3BG5A 2EH3A 4D7NA 1BW6A 1ITYA 2DA5A 2DA1A 2R5ZA 1NTCA 3HB9A 1JJ6C 3S2DJ 4BXXJ 2GBYA 3RQIA 3JRIA 2XPWA 3MVPA 4XIDA 2COBA 2XRLA 4BY7J 3Q0VA 2G0EA 2LP0A 1VNDA 2Y0SN 2L0KA 5EGOA 4A3BJ 2L7MP 3TEDA 1B8IB 2K40A 1ZR2A 4M3FA 3HDDA 2K9SA 4DYQA 4DZJA 1O4XA 4JP0A 3NAUA 5JLXA 1T33A 2EBIA 2FD5A 1VFCA 1DU0A 3S17J 2XGCA 1B72A 2RAEA 1ZQ3P 4AC0A 1SFOJ 2EQRA 2I10A 3JRCA 1ETKA 1MBEA 3GTKJ 5IOYA 2TRTA 4JX4A 2NOGA 1JUSA 1NK2P 2JA8J 3F0CA 2X9DA 4M3EA 1JTXA 2XGDA 1HLVA 2WAQN 2CQQA 1UMQA 4G12A 2O8KA 3S1QJ 1MBKA 3HGYA 4A3IJ 4B4CA 1Y1WJ 3JRBA 2EZHA 1MH3A 4LOCA
chains in the Genus database with same CATH superfamily
2B9SA 2OD5A 2X1CA 1JGSA 3C18A 3LSIA 4L5JA 4RMNA 2GXBA 4A3CJ 4KN4X 5IYDJ 1VQOI 1QZEA 1YE9A 3PUBA 2OZ6A 5L3DA 4GYIA 5JLWA 2L9SA 1LPQA 4LITA 1FOKA 5FB2A 1MNEA 3PIOF 1YOVB 1WJEA 2R92J 2VXZA 2VOOA 2YU9J 2UZKA 4KITB 3QOPA 3WU1B 4BDZA 2PMHA 3K4JA 4EJTA 3E6BA 3KLOA 3GVAA 2E1OA 2ZXIA 2JVGA 2VJJA 4AVPA 1FTZA 1I3QJ 5IT9Z 2W7NA 1Z6TA 4Z2YA 4AYBN 3AG1H 2CJJA 2DMQA 4AIKA 1MH4A 5HOOA 2M87A 3KLNA 3REOA 4XOTA 3RKQA 4CO8A 2WV1A 4XSXF 2YUSA 2LR8A 2IGMA 4IQJA 2LF8A 3GWZA 3BR0A 2XHKA 5KVRA 3SQNA 4AIJA 4D9JA 4L9NA 2KMUA 2L54A 2M45A 3DCFA 1OCTC 3F8FA 5CVRA 1P7JA 3LSJA 4IHWA 2FQ3A 1U2WA 3FHZA 4HDVA 2WBMA 4MQ9F 1AU7A 2W24A 4FTHA 4ZDOA 2Q1ZB 1FC3A 3BQYA 3I54A 3I53A 4ENMA 2DMPA 3X2QH 1O7FA 4PSWA 4ZC3A 1ZKGA 4I0AA 4QSHA 3CP8A 2QA4I 1SANA 1RETA 3KP5A 1J75A 1HW1A 4MEXF 3JRHA 5DD4A 3ZQGA 2ZJPF 1Z7LA 3FXQA 3ERED 5E1ZB 1B9NA 2VBYA 2MD5A 1Y39A 3BROA 3F8CA 3PM1A 1X4PA 5EZGA 3WTVC 5DUKA 5DCMA 4PK4A 5GP9A 2MH9A 4ANJA 1USSA 1EF4A 3R0AA 2PMZA 5BPIA 1ZYRF 3VYSB 2ZJRF 1KQ9A 4U7DA 1IAWA 5J8FA 2X51A 1IGNA 2FXAA 3BR5A 4FE7A 1J7KA 1TW3A 2FMYA 2PJRA 3PQKA 4XBFA 1PUFA 2HPIA 4OIRF 4RDUA 2XAJA 3BQZA 1R49A 1OCZH 2XKOA 3DQVC 2BHYA 4E7KA 3HC7A 4OOIA 3UKGA 3HOUJ 1Y56A 4IRHA 1V55H 1JT6A 4A3FJ 1ZG1A 1IN8A 2R7UA 2P8TA 3LL7A 3J7YJ 2BY3A 1WH5A 1KQ8A 5L3EA 5EG0B 2UWMA 4MIMA 5BMZA 3LQQA 3OYJA 3ZN1A 2H09A 5JFRA 2OQGA 4IZZA 2LDUA 1JXSA 5LHGA 4O3MA 4M3DA 2VKEA 2CQ7A 2MABA 2V1NA 4L0ZB 1I39A 3N05A 1OR7A 4WK8F 3RDIA 2WV0A 3G1OA 2LREA 2CU7A 1YI2I 1XSDA 1OJLA 1P4XA 3M7GA 4ZJZA 3H9QA 3FXUA 2KJCA 2EZIA 4M73A 4MFEA 4KICA 3KFWX 2KIQA 3MWMA 5IYBJ 2KDZA 2MA3A 1J9IA 2L01A 1I1SA 4ZZLA 1YW9A 3WTYC 3ROUA 4A5NA 2Q0OA 2VIXA 1EA3A 2X1EA 3PFIA 3GCMA 1YHQI 5A2QK 4FX0A 4XK4A 3TBIA 1R5GA 1VQ6I 4P96A 4BNCA 2X4HA 2VI6A 1XC5A 2VUMJ 2QQ8A 1R7JA 2HVRA 2ZBKA 4L5EA 1U8RA 4LIUA 1WWXA 3OYAA 3K69A 1LE8A 3KIOA 2K4BA 4HW0A 3PSFA 5EEGA 4I76A 5F64A 4BHBA 5TRDA 2K9LA 4N4NB 2Z16A 2IXSA 2JTVA 4LK1F 5K7ZA 1DPRA 3P9IA 3TO7A 2WTEA 3OYCA 5FD6A 1WZ2A 1FSEA 3QWLA 1EH6A 4XLAA 1SFEA 5ICEA 3KP2A 4DNCA 4LG3A 4XONA 1RESA 3H5AA 5L3BA 4RAZA 4G8XA 3PO2J 2FBIA 2E1NA 4ZYEA 3B6AA 3A03A 1AA7A 1BI0A 2VJIA 2XSJC 2DFFA 1MJ9A 1BIAA 1XSXA 3FMRA 5KCMA 3JTHA 4H4KC 3GYHX 1K4TA 3ESWB 2HYJA 3OWTA 1U0JA 3NRVA 4IF4A 3LAPA 1LKXA 4I99C 4KFCA 4C2UA 3HEFA 3HRTA 4IQ4A 4L9TA 2CV0A 4Y4RA 2O6GE 4XR6A 3HHHA 2W25A 1TL8A 1VQ4I 3CC4I 1PJRA 4A6DA 1IV8A 2L7ZA 3GTPJ 2E34A 1IXCA 2X1DA 3HG9A 4U0YA 2HQRA 2HQAA 1OCOH 5AONA 5EGOB 2E1MC 1P7IA 2DCEA 2JWTA 1XMXA 3QPLA 5LGNA 1BI1A 5FRMA 3CMEI 5IOZA 2VBZA 4G9YA 4PUSA 2XASA 5IYCJ 4G6TB 3QQAA 4A3KJ 5JI6A 1QRYA 3RKYA 1VTNC 4WXHA 3ZQ7A 3V8JA 1D0ZA 2NOJB 3DKYA 4E70A 2L4AA 3L2QA 1HDPA 2MSYA 2Y75A 4M9ZA 1X3UA 2P7CB 2WY8Q 4GXOA 2E35A 1W36C 3V7SA 1GV5A 3L9FA 1MBGA 3TO6A 1LVKA 1KA8A 1X3WB 4W1UA 3W3CA 1WI3A 5HVQC 4KA4A 2KPMA 3OOUA 2Z9OA 2R7XA 3ZPLA 4NC7A 2VE8A 5M3FJ 4GFBA 2NS8A 3NEUA 1G3SA 4EJOA 1BL0A 3JRDA 3BCAA 4MTDA 2ZJ2A 4S0HB 5HDGA 4XLEA 3E6DA 1X1DA 4M6XA 1WJAA 1ZRDA 1FBQA 2JJ7A 3W2VA 4RB0A 5DTDA 3FISA 3CCVI 3HHGA 2AXTC 1HKTA 2ZSHB 2NAZA 2NYXA 2ID6A 2P0WA 2MC4A 3RPQA 1MDMA 1EH7A 3K70C 3GTQJ 5E79C 4J00A 3CF2A 1YRNA 2XAUA 2BW3A 1ODDA 3IL2A 2UUZA 4XKWA 2DN0A 2HYFA 2HPMA 2VQGA 3MFKA 1R1UA 3I56I 1REPC 2WAFA 1LQ1A 1R4NB 4OAYA 2DJIA 5H20A 1E3HA 2QSFX 5K5RA 2FOWA 2Z3YA 2QGUA 2Y9ZA 1IF1A 1D8KA 2NRAC 4AVZA 1H88C 3K70D 1MBJA 2BBYA 2CW0F 4F52A 3HOVJ 4IJAA 3TL4X 2DT6A 3RJPA 4U7BA 1LDKB 5LEKA 5K1YA 4A12A 2G7HA 1T95A 2CW7A 2MW8A 3I5UA 3N97A 3LA3A 1HW2A 2R4GA 2CYYA 4BS9A 1UZCA 3PSIA 2W1OA 2JUCA 4G7ZF 4WWCA 2P7VB 2P5LC 4HF1A 4ABZA 2ELHA 2WB1A 2X48A 3JRFA 3LSGA 1ENHA 3K4BA 3CD6I 4HNTA 3O8HA 1FOYA 2EA4A 3S15J 2E36A 4L9JA 4V2FA 5IPAA 1SD6A 2XV4S 4X6AJ 3DKXA 3DPLC 3C1DA 2J5OA 5LHIA 1X2NA 2DA3A 1EV7A 4EQQA 3F8MA 1ZARA 4WCGA 2JN6A 3IKTA 3QPHA 2E1MB 3K6GA 5GPAA 2WADA 4HG2A 1WSUA 4NC8A 3ASNH 4E7SA 2STTA 1X1AA 1FLIA 3HM5A 5E1WA 4RB3C 3K10A 3CJRB 2HU9A 1YTYA 2LOOA 3MKWB 2ID3A 3M9AA 2M9HA 3E3VA 2LYCA 3E7LA 3O2PE 4BJ5C 4BAYA 2PX9A 3KZYA 3T0YA 2R5ZB 1Y1VJ 2DA7A 1YX3A 1JKQC 1ETQA 3CMAI 1IDZA 2L4MA 5B1BH 2EH3A 1MZBA 1FBSA 3HRMA 2R7DA 1ITYA 2DA5A 4XN0A 1JJ6C 2HZTA 2KHMA 3OIPA 2GBYA 3EDPA 3I3LA 2EV5A 2DOAA 2F4OB 2DT7B 3L2CA 2JPCA 5JHFA 4J01A 3FHNA 4UHTA 1BI2A 2COBA 2XRLA 4D1QA 2UV1A 2DW4A 4CCJA 1VNDA 2Y0SN 2L0KA 3DTKA 2CWEA 3ERMA 1KONA 3QRFF 1O57A 3AG2H 3KP6A 5FFXA 4EM0B 2K4JA 3LA7A 1B8IB 2K40A 1M1EB 2RQQA 2OCEA 2IW5A 2HVSA 1KZHA 2KLOA 4XLNF 3M07A 2A3SA 2V7FA 3OR2C 1RNLA 4MTEA 3NWSA 5D5UB 4EJUA 3CCRI 4M6YA 4LD5A 3FXLA 4F55A 3WE2A 4DBRA 3S17J 1VFCA 2RV8A 3FWEA 4KDPA 1B72A 4PJMA 1ZQ3P 4AC0A 2RVCA 3M8JA 4RM3A 3JRCA 1ETKA 1MBEA 4ESFA 2EFPA 4JX4A 3IC7A 1JUSA 1MMNA 3F0CA 2X9DA 4M3EA 3JSPA 3I0TA 1N78A 4E6KG 3OYEA 2ZXHA 2Z99A 1E2XA 4G12A 2IVMA 1VQ9I 1MBKA 2JSCA 1U5TC 2VODA 4A3IJ 3OYGA 2MYSA 2ZCWA 3U2RA 2KFDA 2ZMEA 4DGWB 4FASD 4LLNA 3MD2A 1IRXA 3ECOA 2OF7A 3TGNA 4IEJA 3VSLA 5F6FA 1SD5A 1JKRC 4BUPA 5FJ8J 1P92A 1POGA 3EETA 3BT9A 3G2BA 2H6CA 1ZK8A 2LY1A 2LBFB 1Z77A 2R7ZJ 3M3YJ 1O7LA 2RC4A 2AXLA 2A5WA 2XUBA 3LFKA 5H2FC 2JA6J 2JA5J 4D0PA 1UHMA 2EA2A 2W84A 3BG6A 2OCCH 4UNOA 2K9NA 3IH2A 3EPZA 4OMYA 2P5VA 4CCMA 2VLAA 4AWXB 1S6LA 3RZOJ 4N0BA 2BHZA 4C2MJ 3RYRA 3HYIA 4Q4ZF 1HSTA 1QGPA 3AG3H 2A69F 3DBHB 1JE8A 4EMSA 1OYYA 4JK1X 2CSOA 3VB2A 4IRGA 3GFJA 1NK3P 2OA4A 2YU3A 3V42A 5F0HA 5FKKA 2HQNA 3GFIA 2LC2A 4EVIA 4AIHA 2IBDA 3CJTB 3E5XA 1QVUA 3CJNA 3LMMA 2HS5A 2NS0A 4CCNA 4CICA 5L3CA 1WJDA 1S7OA 4P5OA 5ILSA 2EFWA 4QLCU 2H27A 2DQLA 3ABLH 1R4MB 4N9IA 1A5JA 1FNNA 3D0SA 3F72A 3S3OA 4Y3OA 5ICCA 3CO7C 4KISA 3M4OJ 1IDYA 1YW8A 2HDDA 2E71A 2QSGX 1TWHJ 5H6RA 1JI8A 2BE5F 1KU2A 5IP7J 2W85A 3FZVA 4HZFA 4X1EA 3O8GA 3S32A 2V79A 5KAIC 3DLLF 3UNGC 4NHJA 5F1RA 4B09A 3F6OA 3IAM2 5HNFA 1A6QA 1MMSA 4MLOA 1ZLKA 1ZREA 1K78A 2GA2A 3OL3A 4LG0A 5FLXK 5HS7A 2A07F 4UVAA 4HDUA 1OCRH 4I09A 2DJNA 3TW6A 2LK2A 4A0XA 4D5FA 2DTRA 3DTEA 4LFUA 1IRZA 2HTJA 5FLVA 2L9RA 2L9NA 3RSNA 2VBWA 3CMMA 3HSEA 4A3DJ 4B3XA 5HLGA 1GDTA 5FGMA 1FZPB 3K2AA 1Z1DA 5JR3A 3WODF 2DMUA 4BEHB 2M30A 1D1CA 4G6DA 4HSTA 4M72A 5E18F 2LKSA 3HOYJ 2VE9A 1ZG3A 1FP1D 1B9MA 1W0TA 2RNJA 4N9HA 3E6MA 3CUQC 2ZFWA 5JHUA 3GTLJ 2L2OA 4UUVA 1FIAA 3ZP5A 2FF4A 1KGSA 2QENA 2DMTA 4YFXF 2DOEA 1GLNA 2ELJA 4A2UA 1ERDA 3JR9A 2EFNA 2NVYJ 2VC1A 3JW4A 1TQMA 1WJFA 3WE3A 4PJJA 2P4WA 3FX3A 4QTRA 4UB8C 2JPBA 1XN7A 4M74A 1IC8A 4IHTA 4F7ZA 5B5EC 3EUHA 3E5QA 3KZIC 5J1RA 1BC8C 1K7AA 2IGOA 4IKFA 2LY9A 3I4NJ 3HOZJ 3GEZA 3JAMK 3FKIJ 3SJMA 2LH9A 3J80Z 4KNYA 2DA2A 2K9MA 1RPWA 2H94A 2Y30A 4ASNA 5ILUA 3DBRB 4I6ZA 2K5CA 3FBNB 4Y52J 4M3GA 2WB1N 1HOMA 2HGCA 3G71I 2Y69H 1N77A 1IO2A 2UXNA 1QA6A 1RI7A 2DT5A 1FEXA 1F5TA 1LUJB 4N4OB 3CUOA 1IRFA 2QWWA 3HRUA 4F3QA 2VONA 3CCQI 2W4SA 1H89C 3LSHA 5BNGA 1X4OA 4LIVA 1IXSB 2VKDA 1ZELA 3ZMSA 4AM3A 4XKCA 1MJAA 2VKVA 4RAFA 3GZ6A 3TP3A 2NXNB 3OS0A 2OTLI 2CUEA 4JOMA 1I50J 5L3FA 1YG2A 2DDBA 2HWVA 4R8HA 1VZ0A 3IRRA 3C2HA 3FKJA 4XICA 3RPUD 4BDYA 1F43A 2Y9YA 4E4HA 3RKWA 2QKLB 5HLHA 4YEJA 1TWAJ 2QLZA 4XRSA 3WTSC 1Z21A 3OYKA 1XB4A 2QKMB 1KU3A 4YIIA 1TW2A 3QPTA 1XTAA 2VT2A 1XDUA 3H36A 1P4AA 3TP0A 5D4RA 3L2RA 2KT0A 3CO6C 1ZGAA 3BR2A 3OMYA 5FLMJ 4JQFA 4HF2A 2A68F 4O6JA 4IHYA 5D5VB 4MHGA 1T2KA 1H9GA 2PEXA 1GXPA 3VEPA 4I7HA 5IT9K 1Y0UA 1H8AC 4BQNA 1C0WA 2K85A 4JX6A 5EDNA 3A4CA 1MMAA 3KCCA 3LOCA 3HOWJ 4M9XA 1DU6A 2BXZA 1R5HA 3MKZA 1Z3YA 1ORKA 5FROA 5J1UA 3B6CA 3GUDA 1AOYA 4CDGA 2GXAA 2D45A 3GFLA 3KYCB 4U0WA 1JGGA 3I59A 3IWFA 3LFUA 4BE1A 4LLLA 3CMYA 3OYIA 2QEXI 2V1XA 2VXDA 3Q0WA 1W0UA 3GW2A 1LJ9A 2BY0A 5F04A 3BC8A 3LSTA 3HJEA 3CJQB 2EINH 1MBHA 4YELA 2Q2EB 5F0CA 2HOTA 1EJ9A 1ETVA 5H6QA 1SAUA 3CF5F 5DCFA 1TC3C 2LBFA 3WHBA 2QCOA 2FJ1A 1DP7P 9ANTA 3SXYA 3GLXA 2VASA 3GTJJ 3RZDJ 3J7AY 1UG2A 2V6CA 3DFGA 1I1GA 5LFAA 2DU9A 2M8GX 4RB1A 2MH2A 3AKZA 3IKVA 2QYOA 3F9KA 3AL0B 3M8EA 2VOPA 5IY5H 2MD0A 4FT8A 2I8DA 4A93J 2HTSA 2DYRH 1U5TA 2R7TA 2P81A 1E3OC 3SFIA 1FT9A 4CH7A 1YITI 4Y15A 3AL0C 1XMKA 5K5QA 1BJAA 3A01B 2OC6A 1YX5A 2ZKZA 3RKXA 5J47A 1E3PA 5BQTA 2E1CA 3MAJA 4HA8A 2B0LA 2XAQA 3KE2A 5DCMB 3J81K 4XKBA 5E3OA 3F6VA 1B72B 3CCYA 1RKTA 2V1UA 1W4MA 2HOSA 4KT5C 1T39A 3OYDA 1YIJI 4P1WA 2LG4A 2P6SA 2M1BA 2AO9A 2XF5A 2JA7J 1N75A 4WX9A 2P6TA 1VI0A 2IA1A 5DM7F 4KMFA 2JT1A 2JRTA 1B8IA 5FFZA 4E7ZA 3BG3A 2V1DA 2PBIA 2A61A 2GIZA 2DK8A 3VPRA 4CYCA 1MIJA 2HDCA 1E0EA 1EH8A 2RNGA 1T6SA 2VN2A 4BGDA 2MFZA 2VJ5A 5M5YJ 1ZTRA 5E17F 3LSMA 3P7NA 4P55A 1FMVA 4B48A 2DI3A 2XF6A 3JCUC 2ESHA 2QBYA 4GGGA 4HYEA 4ZYHA 2O5RA 3WU2C 1I6HJ 4U87A 1W7PB 4BH9A 1QZYA 3K0LA 4XNFA 4MFDA 3DWLE 3H3ZA 3DP7A 5FKLA 3HKZN 4PZJA 3G1MA 1BI3A 2F5VA 4ZZDA 4M6VA 4Q5SF 1P2FA 3JRAA 3HGGA 1BC7C 2EZKA 3FK7A 4BBSJ 1Z67A 3I4MJ 1S29A 3OYNA 2XRNA 4KIGA 1ON1A 3OV8A 4M9SA 3V4GA 1OFCX 2PMZN 5CVVA 2EIKH 3ZOBA 2IEKA 2XF7A 3EUHC 2CGPA 1QO0D 2GA1A 2FRHA 3R0JA 5EZHA 1IN6A 2KL4A 2CUJA 1MKMA 1D3YA 1BIBA 2K86A 3H1CA 3HOSA 1S7AA 3FXOA 2R5ZA 3S2DJ 3BWGA 1FOWA 1ACIA 1WJBA 3JRIA 3KX2A 4G94A 1FMWA 1MMGA 3K1NA 2D1HA 4B44A 3OYBA 1MGTA 4Z6YA 1V5FA 2CQNA 1SC7A 1UCRA 4BXFA 3AFHA 3RPUA 5ERIA 1Y8RB 2V26A 2L7MP 5CQGA 1ZR2A 3CCMI 4HQEA 3MMYB 4RAYA 5AIQA 1HKQA 1D0XA 2ZXWH 2LY2A 1QHHD 2OAZA 4BHPA 4BE0A 4DZJA 1P4WA 1SFXA 4JP0A 3G6EI 3TOBA 3IHUA 3NAUA 1ZH5A 1TP4A 1RIOH 2CV2A 4HF0A 1DU0A 2XGCA 5CVUA 2RAEA 2XKPA 1I27A 4RLFA 2KIUA 1SFOJ 2EQRA 3QOEA 2KZGA 2Z5UA 2BXYA 2EIJH 5IOYA 2E5NA 2Y0MA 1PUEE 2JA8J 2JSPA 4DOZA 5IT3A 1JTXA 2WAQN 3V8LA 3BG7A 3MQ0A 2WWYA 1FP2A 1MH3A 1RZ4A 3ZN0A 2O0YA 2Y0SA 3SEZA 2Y31A 4MNUA 2LTPA 1DQUA 1ZRCA 2FX0A 3FMQA 4FCYA 1K61A 1XCVA 1TWFJ 2LRDA 2DPUA 1TLHB 3DPTA 3LSPA 3OSGA 3FF5A 1BA5A 4YIRX 1S7EA 3CTAA 2ME6A 2A5YB 4QWQA 2DLLA 3QPSA 3U1DA 3RYPA 1NH3A 2BY1A 3COAC 2K3PA 2R7OA 4ENNA 4II2A 3S14J 3BTJA 4AU7A 2CMPA 3DF8A 2DYSH 4DQ2A 3WTUC 1J0RA 1XCBA 3ZQHA 1W5SA 4PCQA 2KP6A 2HFHA 5C44J 2ICWG 3SZPA 1PDNC 1J2XA 1UHSA 3GTGJ 1AHDP 5C4XJ 5FKNA 2IGNA 3GF2A 1T08B 3G4SI 5LHHA 3I58A 2XB5A 5HS9A 2R5YB 1JHHA 2ZNZA 2CFOA 3DEEA 4UUTA 3MEXA 2DXIA 2W48A 3CCLI 4IHVA 5HNHA 4BKXA 5DD8A 2F2EA 3T5XA 5TGTA 3BDDA 1WFXA 5J4VA 1N25A 3VFZA 4HNVA 2F6CA 3OOPA 1KYWA 2BEOA 3A02A 1JKOC 1IUFA 3ASOH 4DW6A 3PQJA 3Q3SA 4BJ6C 2OBPA 2PLYA 5BOXA 2YX7A 4BACA 4DZPA 4KIFA 2LNBA 1ZG5A 3TMOA 3OYMA 2CUFA 2K27A 3DV8A 4BQAA 4FE4A 3FM3A 1XS9A 2R0QC 3LAJA 5D6EA 3BP8A 4CXFA 1PP8F 1FYLA 3T8TA 2IS1A 4MGRA 1XDSA 2DA6A 3HRSA 4RGSA 2K9QA 4XQFA 4C3JJ 2ZFUA 5ICGA 2P5KA 5E3MA 3S1RJ 3ZMDA 3WGIA 3PNVA 2H6BA 3HPGA 3W6KB 3FXJA 5E8IA 3KZZA 3KEOA 1G2HA 3ZGKA 2DFHA 4NNJA 2JMWA 5HODA 3HIFA 3EYIA 3HZJA 3BZKA 3R4KA 4HPQA 1HDDC 1K83J 3I64A 4BXUA 3GTMJ 3H5RA 1LEBA 2OJED 5GAEJ 3P9KA 3JAMZ 1K78B 1DGWY 2KRFA 1DGRM 2MG4A 3DU6A 5F27A 2QF7A 3W2AA 2XGEA 1J59A 2F5FA 2EJRA 3BG9A 4DIQA 5F0FA 1WJ5A 3RIRA 4UVCA 5KNLA 1MJBA 2JK3A 3BTIA 2XVCA 2KIMA 2RDPA 2ZNYA 3BJ6A 3IAS2 1BR1A 3HSFA 3T8RA 3WU0A 1JKPC 4ENJA 4ESJA 3TW7A 1I3AA 2VT3A 4U88A 4AYBA 4UB6C 3ZQFA 4CGZA 1AKHB 3M8FA 4NC6A 1SVLA 1LFPA 1QPMA 3QYBA 4U0VA 1DDNA 1LE8B 3W6JB 1TQPA 3DLAA 4A3EJ 5EJCA 4WXCA 5LLQA 1SD7A 1FBUA 5E1XA 1BR4A 4XLHA 3MKYB 1MSEC 4CZZA 2O61A 3KP7A 1G3WA 4OAZA 2XGXA 4E7LA 5D4SA 3MCZA 2J5PA 3L00A 1LB2A 2LKXA 1R36A 2DAOA 5FKMA 3J81Z 2KQRA 3QU6A 4QPOA 4RB2C 5E3LA 4BBRJ 5J8CA 4BY1J 2XAGA 2YR2A 1VF9A 2F5CA 2Z1DA 3PO3J 4JYKA 2F4MB 5ICFA 3JTGA 4CCOA 2FMLA 3E6CC 3V8KA 1TNSA 5GPCA 4FX4A 2AS5F 5M3MJ 3K1MA 5M5WJ 3K1PA 4B43A 2NVUB 3AAFA 2E7WA 1R71A 3MZHA 4ZDPA 4EGYA 2HZDA 2AQEA 3WGGA 5EYRA 3S3NA 3WHCA 2OQRA 2KKOA 2VQCA 2L9VA 2VB6A 1Y8QB 5IP6A 2ZJQF 1WRJA 4AD9A 3K7AJ 1XPXA 1R9TJ 4HX4A 1ON2A 2HVQA 4W97A 2HOEA 1QHGA 1TNTA 1Z91A 2E7XA 4BQQA 4UUSA 2L7KA 4DYRA 2CH0A 3E97A 2R7FA 3HTUA 1FOXA 5JVTA 2M2EA 4A3JJ 2K02A 2KRHA 3L1PA 2R7VA 4ZYGA 4A69C 2V9VA 1NHAA 3SZGA 2ZMEB 1HBXG 1PUFB 5CKTA 3A2KA 4TV7A 1LVAA 3ISPA 5HLTA 3FXRA 3J80K 4V19K 4G6QA 1T0FC 1TZLA 1OISA 3A0HC 2ME0A 4XL9A 1GXQA 5IP9J 3ML6A 2X85A 5ILVA 3OIQA 1HC8A 1UJ8A 5ED4A 4NDLA 1ZN2A 2GLOA 3CDIA 4ITVA 3NARA 4QIWN 5HDKA 4EJWA 4I98B 5DM6F 3CDLA 1B6AA 1B59A 1YIOA 3FXMA 3K4NA 4KMUX 3SZTA 3WTWC 5CYVA 3EUAA 4I2OA 3OY9A 3V7RA 1UB9A 4C2TA 4G7OF 1O3SA 5F08A 4BU2A 2DQRA 1GUUA 1A36A 5K7HA 4UUSB 1HKSA 3BZCA 3SYTA 2Z33A 4EATA 2W82A 1U5TB 2A6EF 4CCKA 3UR3C 2K3FA 3L7WA 2JVHA 4RA2A 1IZ1A 3PFYA 3ZQQA 5HDNA 2IS2A 2EPFA 5TISC 2DFIA 2GZWA 2ECBA 3ABMH 4BYYA 2PJPA 1R58A 2JQ7A 3SFZA 1OLTA 2XAFA 2ZXJA 5D8KB 4HV6A 1LFBA 2STWA 4AIDA 2PN6A 1P9QC 2L7FP 1DUXC 1IJWC 3S1MJ 3CESA 1B4AA 2I5UA 4NBQA 3WTZA 2JRMA 3FK6A 2H8RA 3CP2A 5L3GA 2HR3A 2R3SA 5LD2C 1ZHFA 5LEJA 1BM9A 3CCUI 1QBJA 3H35A 1USTA 4UV8A 3BZ6A 1OCCH 1APLC 2LLKA 4LB6B 3VYUB 3OS1A 2ISZA 2BYVE 4Q47A 5B3SH 2O03A 1Z9CA 1VQLI 4IX7A 5E20A 1FYMA 2VPLA 1Z3XA 1BBYA 4ZTFA 2HOAA 4ON0A 1R00A 1HA8A 1TQIA 1JJ8C 4B1RA 2FQ4A 4C30A 2M3AA 2E2IJ 4ZDLA 1X58A 4HEA2 3PJRA 2VL8A 2XROA 4RGRA 4XLCA 5DV5A 3T1BA 2GIVA 2M4KA 2HYGD 3FDYA 1VQ8I 3I9V2 3DEUA 2O9LA 1ZGWA 3VYTB 1GT0C 4IL6C 2JUGA 2FNPA 5KK1A 5FD5A 4LLGF 2IGKA 3CCJI 4GRIA 3E5UA 2DK5A 3MKLA 4RAGA 2OTJI 1D8JA 1W5TA 2QVOA 2QM3A 5DDGA 1UFMA 2DDAA 2DO7A 4OU0A 4BJTA 1G4DA 3SHFA 2IPQX 4NB5A 5DEQA 2Q8KA 2PG4A 5E8GA 3A01A 3S16J 1IN7A 1D5YA 1GV2A 5LRSA 1B1BA 3VDXA 3ZQCA 2CRGA 4HX7A 3K4CA 5D8LB 1BR2A 4CHUA 4HX8A 4XOPA 4DBQA 2NNNA 3F23A 2RN7A 3NQOA 2E60A 1QQIA 2ECCA 2FBHA 1G8XA 3GXOA 3CC7I 2RREA 4JBAA 2B63J 2RGVA 3H9JA 1HW5A 1I6XA 5J1YA 2CV1A 3H0GJ 1YRNB 4LGWA 2R7WA 1HXDA 4RBOA 5FRNA 1S72I 3OIOA 3IH4A 1RUOA 2LF7A 3A1YA 3KEYA 3GZNB 4OMZA 1ETOA 2A05A 1BOBA 2M0MA 3U1KA 4HRIA 3QODA 2LD5A 1WKMA 1JTYA 3I71A 1FJLA 5HLIA 3VYRB 4F92B 3CLQA 4UXNA 4BQOA 4XSZF 2NS7A 1FYKA 3BJAA 1OCPA 1YLFA 2HXOA 4F91B 2A6HF 4LJZF 5CPRB 2KRCA 3E1SA 2R7RA 2XSDC 1W7PD 2H1LA 1WCMJ 2LMDA 1U8BA 3BG5A 4D7NA 1BW6A 1PP7U 4R1HA 1TTYA 1XGOA 3DXJF 4ENKA 1DPUA 4BXXJ 3KPHA 4PDKA 2IA0A 1QNTA 4ZYDA 4HQMA 3KP3A 4NUBA 2XPWA 3S3MA 1ZAOA 3MVPA 3WGHA 5CLSA 2HEOA 4R79A 4BY7J 3Q0VA 2QQBA 4A5MA 3QP5A 4BE2A 1UAAA 4O5VA 2F4IA 5EGOA 1ZRFA 3F8BA 4A3BJ 3NWTA 3TDUC 4E7HA 3ZR8X 4ZTJA 3DBLB 3VWBA 3O3KA 2ZSIB 1LEAA 1VQ5I 3VODA 2E5ZA 4DYQA 1J5YA 4S05A 1J09A 4A0ZA 5TJJA 1S3JA 2F5DA 2DODA 4BHCA 2ZMEC 4ZYAA 2XAHA 3S2WA 4Y33A 3D5SC 3K2ZA 1T33A 2EBIA 2B7EA 1U6GA 3PL8A 2X6YA 4X0GA 1RC9A 4QPQA 2I10A 3CC2I 3R6SA 6PAXA 5KAFC 4FETA 2FSWA 3GTKJ 3DKWA 2TRTA 1H0MA 2NOGA 1MW7A 3IWZA 3E0JB 3ZMUA 1HLVA 4KYWA 4OIOF 1X1BA 4A0YA 1UMQA 2O8KA 3S1QJ 4GCVA 2L3DA 3WG9A 4B4CA 1Y1WJ 4RLQA 3JRBA 2EZHA 3ABUA 1F4KA 2CS3A 4OIQF 3CUQB 3OSFA 3D5LA 3BCBA 2ZO4A 2YX4A 2M5WA 3EYYA 2IP2A 2VKHA 3I4PA 1UHWA 3ZCOA 3CCSI 4PSXA 2ZB9A 4L0YB 4B3AA 4B8XA 3TQNA 4UVBA 2N8GA 2W57A 2CUZA 2M8EA 3BTLA 2ETHA 2M0CA 1W1WE 4LK0F 1XSVA 1XGNA 1K6YA 2HNHA 3BLYA 2FE3A 5FKOA 1V3FA 3BR3A 2DFEA 3QU3A 2DA4A 2XPUA 3EQLF 4KIBA 4K2EA 3S2HJ 1JUMA 1WVRA 2CQKA 4MO7A 1A31A 1OR7C 5GTIC 4A3GJ 1P6RA 2TDXA 2BV6A 2O7OA 3F3XA 4HSRA 3LSRA 1QPIA 1F9NA 3IV5A 4Y13A 5C3EJ 2GAUA 4IOCF 2WAQA 2W00A 3QAHA 4PGGA 3BOQA 3QP6A 3DU5A 4YIFA 3HKZA 1SVMA 2VBXA 5BPDA 2R7SA 3TOAA 1DP3A 1K4SA 5LBQA 2D1VA 5LGTA 2O8XA 3JRGA 1IRGA 4XRMA 4A3LJ 2XDVA 2CW8A 4IPAA 1BOAA 3VSKA 4IHXA 1SFUA 2AQFA 3S8PA 4UV9A 4C3HJ 1YQAA 3BPVA 2PQ8A 3GFMA 2L02A 3W2WA 1O3QA 3H3UA 1A35A 5EF6A 4J19A 4P9FA 2V4JC 3OYLA 5GAHJ 1GHCA 4OIPF 3B73A 4M71A 3ONQA 2BY2A 3MZYA 3TDZC 1IG7A 2QUFA 4IOAF 2QZ8A 4G7HF 4EGZA 2M4GA 1YYVA 2EFQA 1GVJA 1L0OC 1W7PA 3MN2A 2CO5A 3FXKA 3TKYA 1OYWA 3GX4X 1JT0A 1TT0A 2YSRA 3P5JA 3SDGA 1IW7F 1V54H 1Y6IA 2XIGA 4HNUA 5EG0A 2VPRA 4E7IA 3DEWA 1G3YA 1RUNA 4CCLA 2DPDA 3GLLA 5GAGJ 3HUGA 4DJAA 2EILH 5JVGF 3G73A 3CDHA 3PNYA 2V9KA 3JSOA 5DS9A 2PI0A 4CYCB 4L9VA 3FMSA 4ETSA 5FO5A 3GMEA 2PJRB 3BR1A 3S1NJ 4I01A 3MZ8A 3H92A 4PFOA 5CVIA 1K6OA 4L18B 2O3FA 1FSHA 3PUFA 4B47A 3Q0UA 5CJ9A 3LWFA 3C3WA 1V5GA 3U21A 1Z7UA 4F93B 2GWRA 3D1NI 2LSOA 2G9WA 1QU3A 3BJOA 1ETXA 2D2WA 4KJZA 2XC7A 1OMIA 4HLYA 5GADJ 5C4JJ 5BS6A 5DYMA 2V9PA 1T8IA 4HAMA 4XLFA 3IP4B 3RTRA 4AUXA 3K9TA 3BY6A 3H5NA 1XD7A 1HSJA 4EEFG 4PJ0C 4MQVA 2ELKA 1JUPA 2M34A 4PGHA 3R60A 1U9NA 1HCRA 1YS7A 1AWCA 1UELB 3ZRGA 3L2WA 3RI4A 1X1PA 1RR7A 1MD0A 3OYHA 3PNTA 1XG1A 3H3VK 2IRFG 2M7AA 2MBFA 1O3RA 3KYLA 2MC3A 2HKOA 1VQMI 3HOXJ 2E2HJ 3CQZJ 1X2MA 2X0LA 3O6BB 1X3ZB 4HOBA 3CZ6A 1IV6A 2EB7A 2ESNA 2KISA 1G59A 2EK5A 1KU7A 1EKEA 3QYEA 1OKRA 1U9OA 1Z6RA 2FUG2 2DMNA 4D7MA 1VQ7I 2ADUA 3HTSB 2KIFA 4RGXA 2KZVA 2Q2EA 3ECHA 2BZTA 2EWNA 2FNAA 5J4YA 2QBYB 2EV0A 2R7QA 4II3A 2OV7A 3ULQB 2UXXA 4M3BA 3A0BC 2AHQA 4XLPF 5D6FA 1F1ZA 2G7UA 5CVJA 4D5CA 1MSFC 1MNMC 4HLXA 1JHFA 3HBLA 2KDOA 4CZCA 3LNQA 3I59B 1HF0A 3L2UA 1ETYA 1WQ2A 4E7JA 2RQPA 1LDDA 4EM1A 5F1JA 2WY7Q 5J3LA 1ZR4A 3J7AO 3B02A 3FBIB 1KYZA 2H8WA 3HOTA 4FISA 1FX7A 4KUMA 5M5XJ 1RKWA 1ZLJA 1R22A 2HKXA 4CA0A 4XRSG 1D0YA 1U3EM 4LMYA 1TBXA 2IAIA 3IUOA 1R5ID 3I55I 2IS4A 3F8NA 3C2BA 5LGUA 3K4LA 4C3IJ 3HUGB 3RQ4A 1H9TA 1NG6A 1CQTA 3ZQLA 1ZGJA 2LKPA 1R1TA 1FIPA 2BVMA 2HQ5A 1TWCJ 1VQKI 3GTOJ 5D5WB 1Q1VA 3QYFA 3ZMZA 1D1BA 1Z0XA 2DTZA 1A04A 4HBLA 1UG0A 2Z2SB 4P9UA 2V6EA 1SFKA 2EFOA 2MGQA 1FY7A 3S93A 3OL4A 1NG7A 5LRRA 1YJWI 5A2QZ 2HI3A 3ZQIA 1TWGJ 1V5EA 2ISYA 2LVSA 3GBGA 3CCEI 1RR8C 1YFHA 3DTIA 1VQPI 1MDMB 3LA2A 2D5VA 2F48A 2A6TA 1FWZA 4XN3A 5AIPA 2OU2A 5J40A 2JZYA 4FHTA 1R23A 2YS9A 1IUYA 3HXLA 5B66C 4XM3A 3GO5A 1ETWA 2E19A 4H0EA 1XX5A 1X19A 2VQHA 5DUIA 1SVOA 1CGPA 1IN4A 4KN7X 4WXDA 3KYDB 4GYGA 1WH7A 4KT6A 2EIMH 1BJZA 2HDWA 2VJ4A 2Y2ZA 4GO1A 2QSHX 1U78A 3D5RC 1SMYF 1WPKA 2EV6A 1LFUP 3F22A 2IS6A 2JA2A 4ZH4F 1I5ZA 4YFKF 2PFBA 2YPRA 1YJ9I 3OR1C 2X6OA 3BR6A 3WG7H 2XPVA 1AKHA 2GM4A 4OWRB 2QQAA 1XMAA 3H9GA 1A6IA 3TO9A 1T56A 4OINF 2BVLA 1CF7B 2R93J 3IRQA 4YRVA 2CFXA 3CLOA 4IO9F 4LB5A 4V2GA 2RKHA 2CG4A 2XB0X 1D1AA 3JREA 2COMA 3FIWA 4S04A 1D5VA 3CUQA 3IH3A 5EEAA 3Q5FA 4XRFA 1SD4A 4BL0B 2WC2A 1FTTA 3HL2A 1HQCA 1MNDA 1WJCA 4IHSA 4RM2A 2IJLA 1GVDA 4RS8A 2E2JJ 3U9GA 2H1KA 2EZLA 1BN5A 4NQWB 3M1CA 4EJVA 1MBFA 1LNWA 3LSKA 1K79A 4HV5A 2NVQJ 4A6EA 2FA5A 4BEHA 2NVXJ 2BGCA 4XKVA 3PIPF 5GTHC 3LQRA 2GXGA 3Q9SA 3KP4A 1O3TA 2NVTJ 3W6VA 2LFBA 5CQEA 2OUMA 1TT5B 4FQGA 5D5XB 2C6YA 2OPTA 4EM2A 4WF2A 1XGSA 1YW7A 2BW3B 2GOXB 1V4RA 3OYFA 4XMYA 2MLKA 1WGXA 3F21A 2FEZA 4PJLA 4JX5A 4IVNA 1WI9A 1S5LC 1PYVA 3BPXA 4XORA 3EUKL 1YJNI 1XGMA 3H0DA 4A3MJ 3N4MA 3BTCA 1F36A 1OQYA 5E3NA 3L09A 1QVTA 4IRIA 1RRJA 4YG2F 1MMDA 2MLGA 2FBKA 4NQWA 2IT0A 3C2GA 3RCOA 3SEQA 2ACJA 3ABKH 2TCTA 1L3LA 2CQXA 4I0BA 1IXRC 2BOLA 4CSWA 1BW5A 2R5YA 3V7CA 1LDJA 2X6WA 2M7BA 4DYCA 1S8NA 4I02A 1Z05A 3FM5A 2VC0A 2HXIA 3HSRA 3ZXSA 5K7FA 2WA0A 4YFNF 1X1CA 1IN5A 2GQQA 3VOEA 2FU4A 3M1EA 3WTXC 1SAXA 1CF7A 2ZC2A 2OZUA 1YO5C 4GDFA 1S9HA 3G3ZA 4Y7NJ 5HS8A 2VQLA 2X6XA 3G1LA 3J7ZI 4MEYF 4Y17A 3C7JA 1G3TA 2WAEA 3AG4H 2KJBA 4EV0A 2DA1A 1NTCA 3HB9A 3ABTA 2GOMA 2QQ9A 5B1AH 1R6RA 3RQIA 1SMTA 5K5OA 1VQNI 3ZMVA 3ELKA 3WTTC 3DPUA 4Q48A 4XIDA 1Q1HA 1FPQA 5FLXZ 1KQ0A 1YS6A 5EEHA 1T98A 1QZZA 1KU9A 2G0EA 2LP0A 3KETA 1G6NA 4IXAA 1W36D 4L5IA 1R1VA 1SEUA 3L2VA 1WHUA 3TEDA 1OPCA 1PVEA 3HDDA 4M3FA 1T0FA 5KHDA 3R61A 2K9SA 2NNYA 4LG0B 4RGUA 1OYIA 2DBBA 1O4XA 1ONVA 3P9CA 1T38A 2FOKA 2K7LA 5JLXA 3OS2A 5J6XA 2FD5A 1W5CC 3Q9VA 3ZMTA 1E17A 2F5EA 3HPHA 4CYDA 1STZA 4ESBA 1ULYA 4PFPA 3KEQA 1NK2P 1Y0NA 4CUGA 2XGDA 2CQQA 2PMUA 3GZ5A 4C9YA 4UY8I 2DOFA 2IA2A 2Y48A 3HGYA 2L5QA 4PJNA 3SDBA 3K4KA 3K4MA 4LOCA
chains in the Genus database with same CATH topology
4A3CJ 2Y31A 2OF7A 2LTPA 4IEJA 2FX0A 5IYDJ 4FCYA 1K61A 1JKRC 1TWFJ 2ZB9A 5FJ8J 1POGA 3LSPA 4B3AA 3OSGA 2N8GA 3BT9A 1BA5A 3BTLA 2M0CA 1ZK8A 1S7EA 1Z77A 2ME6A 2R7ZJ 3M3YJ 5JLWA 3QPSA 2R92J 5FKOA 3BR3A 2JA6J 2JA5J 2YU9J 2DA4A 2XPUA 3S14J 3BTJA 3S2HJ 1JUMA 4MO7A 3ZQHA 4A3GJ 2E1OA 2O7OA 2K9NA 3LSRA 1QPIA 3IH2A 5C44J 3IV5A 1FTZA 1I3QJ 1UHSA 3GTGJ 3RZOJ 1AHDP 5C4XJ 4C2MJ 4AYBN 5C3EJ 2CJJA 2DMQA 5FKNA 1MH4A 3RKQA 2XB5A 2R5YB 2WV1A 4UUTA 2YUSA 2LR8A 2W48A 1NK3P 4IHVA 3BR0A 3JRGA 4BKXA 4XRMA 4A3LJ 5F0HA 5FKKA 3DCFA 4IHXA 1OCTC 2IBDA 4HNVA 4C3HJ 1P7JA 3LSJA 4IHWA 1QVUA 1AU7A 3A02A 1JKOC 5EF6A 1IUFA 4DW6A 4J19A 4FTHA 3Q3SA 3BQYA 4DZPA 1IG7A 2DMPA 1A5JA 1ZKGA 2CUFA 4QSHA 4FE4A 1XS9A 3MN2A 1SANA 2R0QC 1RETA 3M4OJ 1IDYA 2HDDA 3JRHA 1JT0A 1TWHJ 3SDGA 3ZQGA 5EG0A 5IP7J 2VPRA 2DA6A 3DEWA 2K9QA 4C3JJ 4X1EA 3O8GA 5E3MA 3S1RJ 3PM1A 5EZGA 1G2HA 5DS9A 4CYCB 5GP9A 2JMWA 5HODA 4MLOA 3BR1A 1EF4A 3S1NJ 1HDDC 1K83J 3GTMJ 3Q0UA 1IGNA 2DJNA 2MG4A 2LK2A 3BR5A 4FE7A 3TW6A 4D5FA 5F27A 2QF7A 3D1NI 1PUFA 2XGEA 4RDUA 1IRZA 5FLVA 3BQZA 2L9RA 3BG9A 1ETXA 5F0FA 4A3DJ 2JK3A 3BTIA 1GDTA 3UKGA 5C4JJ 3K2AA 3HOUJ 4A3FJ 1JT6A 2DMUA 1WH5A 4AUXA 1JKPC 5EG0B 4MIMA 3HOYJ 3TW7A 4EEFG 3ZQFA 1W0TA 1AKHB 2ELKA 1JUPA 2M34A 1LE8B 3GTLJ 1U9NA 1FIAA 4A3EJ 1HCRA 2DMTA 4M3DA 3JR9A 1MSEC 2VKEA 1RR7A 2NVYJ 1XG1A 3H3VK 4QTRA 3HOXJ 2LKXA 3G1OA 2E2HJ 5FKMA 3CQZJ 2CU7A 1X2MA 1IV6A 1OJLA 3OSFA 5E3LA 1IC8A 4BBRJ 4BY1J 1VF9A 2EZIA 3PO3J 4JYKA 4MFEA 5J1RA 1U9OA 4D7MA 2DMNA 5GPCA 2LY9A 3I4NJ 3HOZJ 5IYBJ 2KDZA 5M3MJ 3FKIJ 5M5WJ 3SJMA 2DA2A 2Y30A 1RPWA 4I6ZA 4Y52J 4M3BA 4M3GA 2WB1N 1HOMA 2AHQA 5EYRA 4XK4A 3WHCA 2VI6A 4D5CA 1MSFC 1XC5A 1MNMC 2VUMJ 3HBLA 1FEXA 3LNQA 1HF0A 5IP6A 1ETYA 4L5EA 3K7AJ 5F1JA 1R9TJ 1ZR4A 5J3LA 1H89C 1LE8A 4W97A 4UUSA 5BNGA 4DYRA 4FISA 4I76A 5M5XJ 1RKWA 2M2EA 2VKVA 4XRSG 3TP3A 2CUEA 4A3JJ 2IAIA 1I50J 3L1PA 5K7ZA 4XICA 4A69C 1F43A 2Y9YA 3C2BA 4C3IJ 1PUFB 1CQTA 1TWAJ 3ZQLA 4XRSA 1RESA 1FIPA 3PO2J 2HQ5A 1TWCJ 3GTOJ 1Q1VA 3B6AA 3TP0A 2ME0A 3A03A 1Z0XA 2DTZA 2KT0A 5IP9J 3BR2A 5FLMJ 2MGQA 4IHYA 2HYJA 4NDLA 2GLOA 4QIWN 3NARA 3HEFA 2HI3A 3CDLA 1H8AC 3ZQIA 1TWGJ 4JX6A 2LVSA 5EDNA 5F08A 3GBGA 3LOCA 3GTPJ 2L7ZA 1GUUA 3HOWJ 1DU6A 5K7HA 4UUSB 2D5VA 1ORKA 5EGOB 5J1UA 1P7IA 3B6CA 2JWTA 3QPLA 1JGGA 2YS9A 5IOZA 3CMYA 1ETWA 2E19A 5IYCJ 3QQAA 3Q0WA 4A3KJ 1QRYA 1W0UA 5F04A 2ECBA 1WH7A 1BJZA 1HDPA 1MBHA 2MSYA 2Y2ZA 1U78A 1LFBA 1WPKA 1LFUP 5F0CA 1GV5A 2HOTA 2L7FP 1MBGA 1IJWC 3S1MJ 1ETVA 2X6OA 3BR6A 1TC3C 2XPVA 1AKHA 3WHBA 2H8RA 2GM4A 3FK6A 2QCOA 1A6IA 4W1UA 1WI3A 1T56A 2FJ1A 3OOUA 9ANTA 2R93J 5M3FJ 4GFBA 2NS8A 3GTJJ 4V2GA 3RZDJ 1BL0A 3JRDA 1APLC 1UG2A 2LLKA 2XB0X 4S0HB 2M8GX 3JREA 3FIWA 4A93J 3IH3A 5EEAA 2HOAA 2JJ7A 2P81A 1E3OC 5DTDA 3SFIA 3FISA 1FTTA 1JJ8C 4B1RA 2FQ4A 1GVDA 2E2JJ 2ID6A 2E2IJ 2H1KA 1X58A 2EZLA 3A01B 3GTQJ 1MBFA 1YRNA 2NVQJ 2DN0A 1ZGWA 2NVXJ 2O9LA 1GT0C 5E3OA 1B72B 3CCYA 1RKTA 2NVTJ 3W6VA 2LFBA 2HOSA 3MKLA 2Y9ZA 2OPTA 1H88C 1MBJA 2JA7J 2AO9A 3HOVJ 1VI0A 3A01A 3S16J 1WGXA 4JX5A 1B8IA 1D5YA 1GV2A 2MW8A 3BG3A 3ZQCA 2CRGA 3VPRA 4CYCA 4A3MJ 3BTCA 1F36A 2ECCA 5E3NA 5M5YJ 1ZTRA 1QVTA 4ABZA 3JRFA 2X48A 3LSGA 2B63J 1ENHA 5J1YA 3H0GJ 3O8HA 1YRNB 3S15J 4V2FA 4RBOA 5IPAA 4X6AJ 3OIOA 3IH4A 1I6HJ 1X2NA 2DA3A 2TCTA 2CQXA 4MFDA 1ETOA 5FKLA 1BW5A 2R5YA 3HKZN 2LD5A 2JN6A 3G1MA 1JTYA 1FJLA 5GPAA 4M6VA 4DYCA 3JRAA 3HGGA 2EZKA 2HXIA 3HM5A 3FK7A 5K7FA 4BBSJ 3I4MJ 2NS7A 2ID3A 1OFCX 1OCPA 2M9HA 2PMZN 2HXOA 3E7LA 2IEKA 3ZOBA 4Y7NJ 2R5ZB 2XSDC 1Y1VJ 2DA7A 1JKQC 1ETQA 1WCMJ 1IDZA 5EZHA 3G1LA 1U8BA 3BG5A 2EH3A 4D7NA 1BW6A 1ITYA 2DA5A 2DA1A 2R5ZA 1NTCA 3HB9A 1JJ6C 3S2DJ 4BXXJ 2GBYA 3RQIA 3JRIA 2XPWA 3MVPA 4XIDA 2COBA 2XRLA 4BY7J 3Q0VA 2G0EA 2LP0A 1VNDA 2Y0SN 2L0KA 5EGOA 4A3BJ 2L7MP 3TEDA 1B8IB 2K40A 1ZR2A 4M3FA 3HDDA 2K9SA 4DYQA 4DZJA 1O4XA 4JP0A 3NAUA 5JLXA 1T33A 2EBIA 2FD5A 1VFCA 1DU0A 3S17J 2XGCA 1B72A 2RAEA 1ZQ3P 4AC0A 1SFOJ 2EQRA 2I10A 3JRCA 1ETKA 1MBEA 3GTKJ 5IOYA 2TRTA 4JX4A 2NOGA 1JUSA 1NK2P 2JA8J 3F0CA 2X9DA 4M3EA 1JTXA 2XGDA 1HLVA 2WAQN 2CQQA 1UMQA 4G12A 2O8KA 3S1QJ 1MBKA 3HGYA 4A3IJ 4B4CA 1Y1WJ 3JRBA 2EZHA 1MH3A 4LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C J;  2Y31 A;  2OF7 A;  2LTP A;  4IEJ A;  2FX0 A;  5IYD J;  4FCY A;  1K61 A;  1JKR C;  1TWF J;  2ZB9 A;  5FJ8 J;  1POG A;  3LSP A;  4B3A A;  3OSG A;  2N8G A;  3BT9 A;  1BA5 A;  3BTL A;  2M0C A;  1ZK8 A;  1S7E A;  1Z77 A;  2ME6 A;  2R7Z J;  3M3Y J;  5JLW A;  3QPS A;  2R92 J;  5FKO A;  3BR3 A;  2JA6 J;  2JA5 J;  2YU9 J;  2DA4 A;  2XPU A;  3S14 J;  3BTJ A;  3S2H J;  1JUM A;  4MO7 A;  3ZQH A;  4A3G J;  2E1O A;  2O7O A;  2K9N A;  3LSR A;  1QPI A;  3IH2 A;  5C44 J;  3IV5 A;  1FTZ A;  1I3Q J;  1UHS A;  3GTG J;  3RZO J;  1AHD P;  5C4X J;  4C2M J;  4AYB N;  5C3E J;  2CJJ A;  2DMQ A;  5FKN A;  1MH4 A;  3RKQ A;  2XB5 A;  2R5Y B;  2WV1 A;  4UUT A;  2YUS A;  2LR8 A;  2W48 A;  1NK3 P;  4IHV A;  3BR0 A;  3JRG A;  4BKX A;  4XRM A;  4A3L J;  5F0H A;  5FKK A;  3DCF A;  4IHX A;  1OCT C;  2IBD A;  4HNV A;  4C3H J;  1P7J A;  3LSJ A;  4IHW A;  1QVU A;  1AU7 A;  3A02 A;  1JKO C;  5EF6 A;  1IUF A;  4DW6 A;  4J19 A;  4FTH A;  3Q3S A;  3BQY A;  4DZP A;  1IG7 A;  2DMP A;  1A5J A;  1ZKG A;  2CUF A;  4QSH A;  4FE4 A;  1XS9 A;  3MN2 A;  1SAN A;  2R0Q C;  1RET A;  3M4O J;  1IDY A;  2HDD A;  3JRH A;  1JT0 A;  1TWH J;  3SDG A;  3ZQG A;  5EG0 A;  5IP7 J;  2VPR A;  2DA6 A;  3DEW A;  2K9Q A;  4C3J J;  4X1E A;  3O8G A;  5E3M A;  3S1R J;  3PM1 A;  5EZG A;  1G2H A;  5DS9 A;  4CYC B;  5GP9 A;  2JMW A;  5HOD A;  4MLO A;  3BR1 A;  1EF4 A;  3S1N J;  1HDD C;  1K83 J;  3GTM J;  3Q0U A;  1IGN A;  2DJN A;  2MG4 A;  2LK2 A;  3BR5 A;  4FE7 A;  3TW6 A;  4D5F A;  5F27 A;  2QF7 A;  3D1N I;  1PUF A;  2XGE A;  4RDU A;  1IRZ A;  5FLV A;  3BQZ A;  2L9R A;  3BG9 A;  1ETX A;  5F0F A;  4A3D J;  2JK3 A;  3BTI A;  1GDT A;  3UKG A;  5C4J J;  3K2A A;  3HOU J;  4A3F J;  1JT6 A;  2DMU A;  1WH5 A;  4AUX A;  1JKP C;  5EG0 B;  4MIM A;  3HOY J;  3TW7 A;  4EEF G;  3ZQF A;  1W0T A;  1AKH B;  2ELK A;  1JUP A;  2M34 A;  1LE8 B;  3GTL J;  1U9N A;  1FIA A;  4A3E J;  1HCR A;  2DMT A;  4M3D A;  3JR9 A;  1MSE C;  2VKE A;  1RR7 A;  2NVY J;  1XG1 A;  3H3V K;  4QTR A;  3HOX J;  2LKX A;  3G1O A;  2E2H J;  5FKM A;  3CQZ J;  2CU7 A;  1X2M A;  1IV6 A;  1OJL A;  3OSF A;  5E3L A;  1IC8 A;  4BBR J;  4BY1 J;  1VF9 A;  2EZI A;  3PO3 J;  4JYK A;  4MFE A;  5J1R A;  1U9O A;  4D7M A;  2DMN A;  5GPC A;  2LY9 A;  3I4N J;  3HOZ J;  5IYB J;  2KDZ A;  5M3M J;  3FKI J;  5M5W J;  3SJM A;  2DA2 A;  2Y30 A;  1RPW A;  4I6Z A;  4Y52 J;  4M3B A;  4M3G A;  2WB1 N;  1HOM A;  2AHQ A;  5EYR A;  4XK4 A;  3WHC A;  2VI6 A;  4D5C A;  1MSF C;  1XC5 A;  1MNM C;  2VUM J;  3HBL A;  1FEX A;  3LNQ A;  1HF0 A;  5IP6 A;  1ETY A;  4L5E A;  3K7A J;  5F1J A;  1R9T J;  1ZR4 A;  5J3L A;  1H89 C;  1LE8 A;  4W97 A;  4UUS A;  5BNG A;  4DYR A;  4FIS A;  4I76 A;  5M5X J;  1RKW A;  2M2E A;  2VKV A;  4XRS G;  3TP3 A;  2CUE A;  4A3J J;  2IAI A;  1I50 J;  3L1P A;  5K7Z A;  4XIC A;  4A69 C;  1F43 A;  2Y9Y A;  3C2B A;  4C3I J;  1PUF B;  1CQT A;  1TWA J;  3ZQL A;  4XRS A;  1RES A;  1FIP A;  3PO2 J;  2HQ5 A;  1TWC J;  3GTO J;  1Q1V A;  3B6A A;  3TP0 A;  2ME0 A;  3A03 A;  1Z0X A;  2DTZ A;  2KT0 A;  5IP9 J;  3BR2 A;  5FLM J;  2MGQ A;  4IHY A;  2HYJ A;  4NDL A;  2GLO A;  4QIW N;  3NAR A;  3HEF A;  2HI3 A;  3CDL A;  1H8A C;  3ZQI A;  1TWG J;  4JX6 A;  2LVS A;  5EDN A;  5F08 A;  3GBG A;  3LOC A;  3GTP J;  2L7Z A;  1GUU A;  3HOW J;  1DU6 A;  5K7H A;  4UUS B;  2D5V A;  1ORK A;  5EGO B;  5J1U A;  1P7I A;  3B6C A;  2JWT A;  3QPL A;  1JGG A;  2YS9 A;  5IOZ A;  3CMY A;  1ETW A;  2E19 A;  5IYC J;  3QQA A;  3Q0W A;  4A3K J;  1QRY A;  1W0U A;  5F04 A;  2ECB A;  1WH7 A;  1BJZ A;  1HDP A;  1MBH A;  2MSY A;  2Y2Z A;  1U78 A;  1LFB A;  1WPK A;  1LFU P;  5F0C A;  1GV5 A;  2HOT A;  2L7F P;  1MBG A;  1IJW C;  3S1M J;  1ETV A;  2X6O A;  3BR6 A;  1TC3 C;  2XPV A;  1AKH A;  3WHB A;  2H8R A;  2GM4 A;  3FK6 A;  2QCO A;  1A6I A;  4W1U A;  1WI3 A;  1T56 A;  2FJ1 A;  3OOU A;  9ANT A;  2R93 J;  5M3F J;  4GFB A;  2NS8 A;  3GTJ J;  4V2G A;  3RZD J;  1BL0 A;  3JRD A;  1APL C;  1UG2 A;  2LLK A;  2XB0 X;  4S0H B;  2M8G X;  3JRE A;  3FIW A;  4A93 J;  3IH3 A;  5EEA A;  2HOA A;  2JJ7 A;  2P81 A;  1E3O C;  5DTD A;  3SFI A;  3FIS A;  1FTT A;  1JJ8 C;  4B1R A;  2FQ4 A;  1GVD A;  2E2J J;  2ID6 A;  2E2I J;  2H1K A;  1X58 A;  2EZL A;  3A01 B;  3GTQ J;  1MBF A;  1YRN A;  2NVQ J;  2DN0 A;  1ZGW A;  2NVX J;  2O9L A;  1GT0 C;  5E3O A;  1B72 B;  3CCY A;  1RKT A;  2NVT J;  3W6V A;  2LFB A;  2HOS A;  3MKL A;  2Y9Z A;  2OPT A;  1H88 C;  1MBJ A;  2JA7 J;  2AO9 A;  3HOV J;  1VI0 A;  3A01 A;  3S16 J;  1WGX A;  4JX5 A;  1B8I A;  1D5Y A;  1GV2 A;  2MW8 A;  3BG3 A;  3ZQC A;  2CRG A;  3VPR A;  4CYC A;  4A3M J;  3BTC A;  1F36 A;  2ECC A;  5E3N A;  5M5Y J;  1ZTR A;  1QVT A;  4ABZ A;  3JRF A;  2X48 A;  3LSG A;  2B63 J;  1ENH A;  5J1Y A;  3H0G J;  3O8H A;  1YRN B;  3S15 J;  4V2F A;  4RBO A;  5IPA A;  4X6A J;  3OIO A;  3IH4 A;  1I6H J;  1X2N A;  2DA3 A;  2TCT A;  2CQX A;  4MFD A;  1ETO A;  5FKL A;  1BW5 A;  2R5Y A;  3HKZ N;  2LD5 A;  2JN6 A;  3G1M A;  1JTY A;  1FJL A;  5GPA A;  4M6V A;  4DYC A;  3JRA A;  3HGG A;  2EZK A;  2HXI A;  3HM5 A;  3FK7 A;  5K7F A;  4BBS J;  3I4M J;  2NS7 A;  2ID3 A;  1OFC X;  1OCP A;  2M9H A;  2PMZ N;  2HXO A;  3E7L A;  2IEK A;  3ZOB A;  4Y7N J;  2R5Z B;  2XSD C;  1Y1V J;  2DA7 A;  1JKQ C;  1ETQ A;  1WCM J;  1IDZ A;  5EZH A;  3G1L A;  1U8B A;  3BG5 A;  2EH3 A;  4D7N A;  1BW6 A;  1ITY A;  2DA5 A;  2DA1 A;  2R5Z A;  1NTC A;  3HB9 A;  1JJ6 C;  3S2D J;  4BXX J;  2GBY A;  3RQI A;  3JRI A;  2XPW A;  3MVP A;  4XID A;  2COB A;  2XRL A;  4BY7 J;  3Q0V A;  2G0E A;  2LP0 A;  1VND A;  2Y0S N;  2L0K A;  5EGO A;  4A3B J;  2L7M P;  3TED A;  1B8I B;  2K40 A;  1ZR2 A;  4M3F A;  3HDD A;  2K9S A;  4DYQ A;  4DZJ A;  1O4X A;  4JP0 A;  3NAU A;  5JLX A;  1T33 A;  2EBI A;  2FD5 A;  1VFC A;  1DU0 A;  3S17 J;  2XGC A;  1B72 A;  2RAE A;  1ZQ3 P;  4AC0 A;  1SFO J;  2EQR A;  2I10 A;  3JRC A;  1ETK A;  1MBE A;  3GTK J;  5IOY A;  2TRT A;  4JX4 A;  2NOG A;  1JUS A;  1NK2 P;  2JA8 J;  3F0C A;  2X9D A;  4M3E A;  1JTX A;  2XGD A;  1HLV A;  2WAQ N;  2CQQ A;  1UMQ A;  4G12 A;  2O8K A;  3S1Q J;  1MBK A;  3HGY A;  4A3I J;  4B4C A;  1Y1W J;  3JRB A;  2EZH A;  1MH3 A;  4LOC A; 
#chains in the Genus database with same CATH topology
 2B9S A;  2OD5 A;  2X1C A;  1JGS A;  3C18 A;  3LSI A;  4L5J A;  4RMN A;  2GXB A;  4A3C J;  4KN4 X;  5IYD J;  1VQO I;  1QZE A;  1YE9 A;  3PUB A;  2OZ6 A;  5L3D A;  4GYI A;  5JLW A;  2L9S A;  1LPQ A;  4LIT A;  1FOK A;  5FB2 A;  1MNE A;  3PIO F;  1YOV B;  1WJE A;  2R92 J;  2VXZ A;  2VOO A;  2YU9 J;  2UZK A;  4KIT B;  3QOP A;  3WU1 B;  4BDZ A;  2PMH A;  3K4J A;  4EJT A;  3E6B A;  3KLO A;  3GVA A;  2E1O A;  2ZXI A;  2JVG A;  2VJJ A;  4AVP A;  1FTZ A;  1I3Q J;  5IT9 Z;  2W7N A;  1Z6T A;  4Z2Y A;  4AYB N;  3AG1 H;  2CJJ A;  2DMQ A;  4AIK A;  1MH4 A;  5HOO A;  2M87 A;  3KLN A;  3REO A;  4XOT A;  3RKQ A;  4CO8 A;  2WV1 A;  4XSX F;  2YUS A;  2LR8 A;  2IGM A;  4IQJ A;  2LF8 A;  3GWZ A;  3BR0 A;  2XHK A;  5KVR A;  3SQN A;  4AIJ A;  4D9J A;  4L9N A;  2KMU A;  2L54 A;  2M45 A;  3DCF A;  1OCT C;  3F8F A;  5CVR A;  1P7J A;  3LSJ A;  4IHW A;  2FQ3 A;  1U2W A;  3FHZ A;  4HDV A;  2WBM A;  4MQ9 F;  1AU7 A;  2W24 A;  4FTH A;  4ZDO A;  2Q1Z B;  1FC3 A;  3BQY A;  3I54 A;  3I53 A;  4ENM A;  2DMP A;  3X2Q H;  1O7F A;  4PSW A;  4ZC3 A;  1ZKG A;  4I0A A;  4QSH A;  3CP8 A;  2QA4 I;  1SAN A;  1RET A;  3KP5 A;  1J75 A;  1HW1 A;  4MEX F;  3JRH A;  5DD4 A;  3ZQG A;  2ZJP F;  1Z7L A;  3FXQ A;  3ERE D;  5E1Z B;  1B9N A;  2VBY A;  2MD5 A;  1Y39 A;  3BRO A;  3F8C A;  3PM1 A;  1X4P A;  5EZG A;  3WTV C;  5DUK A;  5DCM A;  4PK4 A;  5GP9 A;  2MH9 A;  4ANJ A;  1USS A;  1EF4 A;  3R0A A;  2PMZ A;  5BPI A;  1ZYR F;  3VYS B;  2ZJR F;  1KQ9 A;  4U7D A;  1IAW A;  5J8F A;  2X51 A;  1IGN A;  2FXA A;  3BR5 A;  4FE7 A;  1J7K A;  1TW3 A;  2FMY A;  2PJR A;  3PQK A;  4XBF A;  1PUF A;  2HPI A;  4OIR F;  4RDU A;  2XAJ A;  3BQZ A;  1R49 A;  1OCZ H;  2XKO A;  3DQV C;  2BHY A;  4E7K A;  3HC7 A;  4OOI A;  3UKG A;  3HOU J;  1Y56 A;  4IRH A;  1V55 H;  1JT6 A;  4A3F J;  1ZG1 A;  1IN8 A;  2R7U A;  2P8T A;  3LL7 A;  3J7Y J;  2BY3 A;  1WH5 A;  1KQ8 A;  5L3E A;  5EG0 B;  2UWM A;  4MIM A;  5BMZ A;  3LQQ A;  3OYJ A;  3ZN1 A;  2H09 A;  5JFR A;  2OQG A;  4IZZ A;  2LDU A;  1JXS A;  5LHG A;  4O3M A;  4M3D A;  2VKE A;  2CQ7 A;  2MAB A;  2V1N A;  4L0Z B;  1I39 A;  3N05 A;  1OR7 A;  4WK8 F;  3RDI A;  2WV0 A;  3G1O A;  2LRE A;  2CU7 A;  1YI2 I;  1XSD A;  1OJL A;  1P4X A;  3M7G A;  4ZJZ A;  3H9Q A;  3FXU A;  2KJC A;  2EZI A;  4M73 A;  4MFE A;  4KIC A;  3KFW X;  2KIQ A;  3MWM A;  5IYB J;  2KDZ A;  2MA3 A;  1J9I A;  2L01 A;  1I1S A;  4ZZL A;  1YW9 A;  3WTY C;  3ROU A;  4A5N A;  2Q0O A;  2VIX A;  1EA3 A;  2X1E A;  3PFI A;  3GCM A;  1YHQ I;  5A2Q K;  4FX0 A;  4XK4 A;  3TBI A;  1R5G A;  1VQ6 I;  4P96 A;  4BNC A;  2X4H A;  2VI6 A;  1XC5 A;  2VUM J;  2QQ8 A;  1R7J A;  2HVR A;  2ZBK A;  4L5E A;  1U8R A;  4LIU A;  1WWX A;  3OYA A;  3K69 A;  1LE8 A;  3KIO A;  2K4B A;  4HW0 A;  3PSF A;  5EEG A;  4I76 A;  5F64 A;  4BHB A;  5TRD A;  2K9L A;  4N4N B;  2Z16 A;  2IXS A;  2JTV A;  4LK1 F;  5K7Z A;  1DPR A;  3P9I A;  3TO7 A;  2WTE A;  3OYC A;  5FD6 A;  1WZ2 A;  1FSE A;  3QWL A;  1EH6 A;  4XLA A;  1SFE A;  5ICE A;  3KP2 A;  4DNC A;  4LG3 A;  4XON A;  1RES A;  3H5A A;  5L3B A;  4RAZ A;  4G8X A;  3PO2 J;  2FBI A;  2E1N A;  4ZYE A;  3B6A A;  3A03 A;  1AA7 A;  1BI0 A;  2VJI A;  2XSJ C;  2DFF A;  1MJ9 A;  1BIA A;  1XSX A;  3FMR A;  5KCM A;  3JTH A;  4H4K C;  3GYH X;  1K4T A;  3ESW B;  2HYJ A;  3OWT A;  1U0J A;  3NRV A;  4IF4 A;  3LAP A;  1LKX A;  4I99 C;  4KFC A;  4C2U A;  3HEF A;  3HRT A;  4IQ4 A;  4L9T A;  2CV0 A;  4Y4R A;  2O6G E;  4XR6 A;  3HHH A;  2W25 A;  1TL8 A;  1VQ4 I;  3CC4 I;  1PJR A;  4A6D A;  1IV8 A;  2L7Z A;  3GTP J;  2E34 A;  1IXC A;  2X1D A;  3HG9 A;  4U0Y A;  2HQR A;  2HQA A;  1OCO H;  5AON A;  5EGO B;  2E1M C;  1P7I A;  2DCE A;  2JWT A;  1XMX A;  3QPL A;  5LGN A;  1BI1 A;  5FRM A;  3CME I;  5IOZ A;  2VBZ A;  4G9Y A;  4PUS A;  2XAS A;  5IYC J;  4G6T B;  3QQA A;  4A3K J;  5JI6 A;  1QRY A;  3RKY A;  1VTN C;  4WXH A;  3ZQ7 A;  3V8J A;  1D0Z A;  2NOJ B;  3DKY A;  4E70 A;  2L4A A;  3L2Q A;  1HDP A;  2MSY A;  2Y75 A;  4M9Z A;  1X3U A;  2P7C B;  2WY8 Q;  4GXO A;  2E35 A;  1W36 C;  3V7S A;  1GV5 A;  3L9F A;  1MBG A;  3TO6 A;  1LVK A;  1KA8 A;  1X3W B;  4W1U A;  3W3C A;  1WI3 A;  5HVQ C;  4KA4 A;  2KPM A;  3OOU A;  2Z9O A;  2R7X A;  3ZPL A;  4NC7 A;  2VE8 A;  5M3F J;  4GFB A;  2NS8 A;  3NEU A;  1G3S A;  4EJO A;  1BL0 A;  3JRD A;  3BCA A;  4MTD A;  2ZJ2 A;  4S0H B;  5HDG A;  4XLE A;  3E6D A;  1X1D A;  4M6X A;  1WJA A;  1ZRD A;  1FBQ A;  2JJ7 A;  3W2V A;  4RB0 A;  5DTD A;  3FIS A;  3CCV I;  3HHG A;  2AXT C;  1HKT A;  2ZSH B;  2NAZ A;  2NYX A;  2ID6 A;  2P0W A;  2MC4 A;  3RPQ A;  1MDM A;  1EH7 A;  3K70 C;  3GTQ J;  5E79 C;  4J00 A;  3CF2 A;  1YRN A;  2XAU A;  2BW3 A;  1ODD A;  3IL2 A;  2UUZ A;  4XKW A;  2DN0 A;  2HYF A;  2HPM A;  2VQG A;  3MFK A;  1R1U A;  3I56 I;  1REP C;  2WAF A;  1LQ1 A;  1R4N B;  4OAY A;  2DJI A;  5H20 A;  1E3H A;  2QSF X;  5K5R A;  2FOW A;  2Z3Y A;  2QGU A;  2Y9Z A;  1IF1 A;  1D8K A;  2NRA C;  4AVZ A;  1H88 C;  3K70 D;  1MBJ A;  2BBY A;  2CW0 F;  4F52 A;  3HOV J;  4IJA A;  3TL4 X;  2DT6 A;  3RJP A;  4U7B A;  1LDK B;  5LEK A;  5K1Y A;  4A12 A;  2G7H A;  1T95 A;  2CW7 A;  2MW8 A;  3I5U A;  3N97 A;  3LA3 A;  1HW2 A;  2R4G A;  2CYY A;  4BS9 A;  1UZC A;  3PSI A;  2W1O A;  2JUC A;  4G7Z F;  4WWC A;  2P7V B;  2P5L C;  4HF1 A;  4ABZ A;  2ELH A;  2WB1 A;  2X48 A;  3JRF A;  3LSG A;  1ENH A;  3K4B A;  3CD6 I;  4HNT A;  3O8H A;  1FOY A;  2EA4 A;  3S15 J;  2E36 A;  4L9J A;  4V2F A;  5IPA A;  1SD6 A;  2XV4 S;  4X6A J;  3DKX A;  3DPL C;  3C1D A;  2J5O A;  5LHI A;  1X2N A;  2DA3 A;  1EV7 A;  4EQQ A;  3F8M A;  1ZAR A;  4WCG A;  2JN6 A;  3IKT A;  3QPH A;  2E1M B;  3K6G A;  5GPA A;  2WAD A;  4HG2 A;  1WSU A;  4NC8 A;  3ASN H;  4E7S A;  2STT A;  1X1A A;  1FLI A;  3HM5 A;  5E1W A;  4RB3 C;  3K10 A;  3CJR B;  2HU9 A;  1YTY A;  2LOO A;  3MKW B;  2ID3 A;  3M9A A;  2M9H A;  3E3V A;  2LYC A;  3E7L A;  3O2P E;  4BJ5 C;  4BAY A;  2PX9 A;  3KZY A;  3T0Y A;  2R5Z B;  1Y1V J;  2DA7 A;  1YX3 A;  1JKQ C;  1ETQ A;  3CMA I;  1IDZ A;  2L4M A;  5B1B H;  2EH3 A;  1MZB A;  1FBS A;  3HRM A;  2R7D A;  1ITY A;  2DA5 A;  4XN0 A;  1JJ6 C;  2HZT A;  2KHM A;  3OIP A;  2GBY A;  3EDP A;  3I3L A;  2EV5 A;  2DOA A;  2F4O B;  2DT7 B;  3L2C A;  2JPC A;  5JHF A;  4J01 A;  3FHN A;  4UHT A;  1BI2 A;  2COB A;  2XRL A;  4D1Q A;  2UV1 A;  2DW4 A;  4CCJ A;  1VND A;  2Y0S N;  2L0K A;  3DTK A;  2CWE A;  3ERM A;  1KON A;  3QRF F;  1O57 A;  3AG2 H;  3KP6 A;  5FFX A;  4EM0 B;  2K4J A;  3LA7 A;  1B8I B;  2K40 A;  1M1E B;  2RQQ A;  2OCE A;  2IW5 A;  2HVS A;  1KZH A;  2KLO A;  4XLN F;  3M07 A;  2A3S A;  2V7F A;  3OR2 C;  1RNL A;  4MTE A;  3NWS A;  5D5U B;  4EJU A;  3CCR I;  4M6Y A;  4LD5 A;  3FXL A;  4F55 A;  3WE2 A;  4DBR A;  3S17 J;  1VFC A;  2RV8 A;  3FWE A;  4KDP A;  1B72 A;  4PJM A;  1ZQ3 P;  4AC0 A;  2RVC A;  3M8J A;  4RM3 A;  3JRC A;  1ETK A;  1MBE A;  4ESF A;  2EFP A;  4JX4 A;  3IC7 A;  1JUS A;  1MMN A;  3F0C A;  2X9D A;  4M3E A;  3JSP A;  3I0T A;  1N78 A;  4E6K G;  3OYE A;  2ZXH A;  2Z99 A;  1E2X A;  4G12 A;  2IVM A;  1VQ9 I;  1MBK A;  2JSC A;  1U5T C;  2VOD A;  4A3I J;  3OYG A;  2MYS A;  2ZCW A;  3U2R A;  2KFD A;  2ZME A;  4DGW B;  4FAS D;  4LLN A;  3MD2 A;  1IRX A;  3ECO A;  2OF7 A;  3TGN A;  4IEJ A;  3VSL A;  5F6F A;  1SD5 A;  1JKR C;  4BUP A;  5FJ8 J;  1P92 A;  1POG A;  3EET A;  3BT9 A;  3G2B A;  2H6C A;  1ZK8 A;  2LY1 A;  2LBF B;  1Z77 A;  2R7Z J;  3M3Y J;  1O7L A;  2RC4 A;  2AXL A;  2A5W A;  2XUB A;  3LFK A;  5H2F C;  2JA6 J;  2JA5 J;  4D0P A;  1UHM A;  2EA2 A;  2W84 A;  3BG6 A;  2OCC H;  4UNO A;  2K9N A;  3IH2 A;  3EPZ A;  4OMY A;  2P5V A;  4CCM A;  2VLA A;  4AWX B;  1S6L A;  3RZO J;  4N0B A;  2BHZ A;  4C2M J;  3RYR A;  3HYI A;  4Q4Z F;  1HST A;  1QGP A;  3AG3 H;  2A69 F;  3DBH B;  1JE8 A;  4EMS A;  1OYY A;  4JK1 X;  2CSO A;  3VB2 A;  4IRG A;  3GFJ A;  1NK3 P;  2OA4 A;  2YU3 A;  3V42 A;  5F0H A;  5FKK A;  2HQN A;  3GFI A;  2LC2 A;  4EVI A;  4AIH A;  2IBD A;  3CJT B;  3E5X A;  1QVU A;  3CJN A;  3LMM A;  2HS5 A;  2NS0 A;  4CCN A;  4CIC A;  5L3C A;  1WJD A;  1S7O A;  4P5O A;  5ILS A;  2EFW A;  4QLC U;  2H27 A;  2DQL A;  3ABL H;  1R4M B;  4N9I A;  1A5J A;  1FNN A;  3D0S A;  3F72 A;  3S3O A;  4Y3O A;  5ICC A;  3CO7 C;  4KIS A;  3M4O J;  1IDY A;  1YW8 A;  2HDD A;  2E71 A;  2QSG X;  1TWH J;  5H6R A;  1JI8 A;  2BE5 F;  1KU2 A;  5IP7 J;  2W85 A;  3FZV A;  4HZF A;  4X1E A;  3O8G A;  3S32 A;  2V79 A;  5KAI C;  3DLL F;  3UNG C;  4NHJ A;  5F1R A;  4B09 A;  3F6O A;  3IAM 2;  5HNF A;  1A6Q A;  1MMS A;  4MLO A;  1ZLK A;  1ZRE A;  1K78 A;  2GA2 A;  3OL3 A;  4LG0 A;  5FLX K;  5HS7 A;  2A07 F;  4UVA A;  4HDU A;  1OCR H;  4I09 A;  2DJN A;  3TW6 A;  2LK2 A;  4A0X A;  4D5F A;  2DTR A;  3DTE A;  4LFU A;  1IRZ A;  2HTJ A;  5FLV A;  2L9R A;  2L9N A;  3RSN A;  2VBW A;  3CMM A;  3HSE A;  4A3D J;  4B3X A;  5HLG A;  1GDT A;  5FGM A;  1FZP B;  3K2A A;  1Z1D A;  5JR3 A;  3WOD F;  2DMU A;  4BEH B;  2M30 A;  1D1C A;  4G6D A;  4HST A;  4M72 A;  5E18 F;  2LKS A;  3HOY J;  2VE9 A;  1ZG3 A;  1FP1 D;  1B9M A;  1W0T A;  2RNJ A;  4N9H A;  3E6M A;  3CUQ C;  2ZFW A;  5JHU A;  3GTL J;  2L2O A;  4UUV A;  1FIA A;  3ZP5 A;  2FF4 A;  1KGS A;  2QEN A;  2DMT A;  4YFX F;  2DOE A;  1GLN A;  2ELJ A;  4A2U A;  1ERD A;  3JR9 A;  2EFN A;  2NVY J;  2VC1 A;  3JW4 A;  1TQM A;  1WJF A;  3WE3 A;  4PJJ A;  2P4W A;  3FX3 A;  4QTR A;  4UB8 C;  2JPB A;  1XN7 A;  4M74 A;  1IC8 A;  4IHT A;  4F7Z A;  5B5E C;  3EUH A;  3E5Q A;  3KZI C;  5J1R A;  1BC8 C;  1K7A A;  2IGO A;  4IKF A;  2LY9 A;  3I4N J;  3HOZ J;  3GEZ A;  3JAM K;  3FKI J;  3SJM A;  2LH9 A;  3J80 Z;  4KNY A;  2DA2 A;  2K9M A;  1RPW A;  2H94 A;  2Y30 A;  4ASN A;  5ILU A;  3DBR B;  4I6Z A;  2K5C A;  3FBN B;  4Y52 J;  4M3G A;  2WB1 N;  1HOM A;  2HGC A;  3G71 I;  2Y69 H;  1N77 A;  1IO2 A;  2UXN A;  1QA6 A;  1RI7 A;  2DT5 A;  1FEX A;  1F5T A;  1LUJ B;  4N4O B;  3CUO A;  1IRF A;  2QWW A;  3HRU A;  4F3Q A;  2VON A;  3CCQ I;  2W4S A;  1H89 C;  3LSH A;  5BNG A;  1X4O A;  4LIV A;  1IXS B;  2VKD A;  1ZEL A;  3ZMS A;  4AM3 A;  4XKC A;  1MJA A;  2VKV A;  4RAF A;  3GZ6 A;  3TP3 A;  2NXN B;  3OS0 A;  2OTL I;  2CUE A;  4JOM A;  1I50 J;  5L3F A;  1YG2 A;  2DDB A;  2HWV A;  4R8H A;  1VZ0 A;  3IRR A;  3C2H A;  3FKJ A;  4XIC A;  3RPU D;  4BDY A;  1F43 A;  2Y9Y A;  4E4H A;  3RKW A;  2QKL B;  5HLH A;  4YEJ A;  1TWA J;  2QLZ A;  4XRS A;  3WTS C;  1Z21 A;  3OYK A;  1XB4 A;  2QKM B;  1KU3 A;  4YII A;  1TW2 A;  3QPT A;  1XTA A;  2VT2 A;  1XDU A;  3H36 A;  1P4A A;  3TP0 A;  5D4R A;  3L2R A;  2KT0 A;  3CO6 C;  1ZGA A;  3BR2 A;  3OMY A;  5FLM J;  4JQF A;  4HF2 A;  2A68 F;  4O6J A;  4IHY A;  5D5V B;  4MHG A;  1T2K A;  1H9G A;  2PEX A;  1GXP A;  3VEP A;  4I7H A;  5IT9 K;  1Y0U A;  1H8A C;  4BQN A;  1C0W A;  2K85 A;  4JX6 A;  5EDN A;  3A4C A;  1MMA A;  3KCC A;  3LOC A;  3HOW J;  4M9X A;  1DU6 A;  2BXZ A;  1R5H A;  3MKZ A;  1Z3Y A;  1ORK A;  5FRO A;  5J1U A;  3B6C A;  3GUD A;  1AOY A;  4CDG A;  2GXA A;  2D45 A;  3GFL A;  3KYC B;  4U0W A;  1JGG A;  3I59 A;  3IWF A;  3LFU A;  4BE1 A;  4LLL A;  3CMY A;  3OYI A;  2QEX I;  2V1X A;  2VXD A;  3Q0W A;  1W0U A;  3GW2 A;  1LJ9 A;  2BY0 A;  5F04 A;  3BC8 A;  3LST A;  3HJE A;  3CJQ B;  2EIN H;  1MBH A;  4YEL A;  2Q2E B;  5F0C A;  2HOT A;  1EJ9 A;  1ETV A;  5H6Q A;  1SAU A;  3CF5 F;  5DCF A;  1TC3 C;  2LBF A;  3WHB A;  2QCO A;  2FJ1 A;  1DP7 P;  9ANT A;  3SXY A;  3GLX A;  2VAS A;  3GTJ J;  3RZD J;  3J7A Y;  1UG2 A;  2V6C A;  3DFG A;  1I1G A;  5LFA A;  2DU9 A;  2M8G X;  4RB1 A;  2MH2 A;  3AKZ A;  3IKV A;  2QYO A;  3F9K A;  3AL0 B;  3M8E A;  2VOP A;  5IY5 H;  2MD0 A;  4FT8 A;  2I8D A;  4A93 J;  2HTS A;  2DYR H;  1U5T A;  2R7T A;  2P81 A;  1E3O C;  3SFI A;  1FT9 A;  4CH7 A;  1YIT I;  4Y15 A;  3AL0 C;  1XMK A;  5K5Q A;  1BJA A;  3A01 B;  2OC6 A;  1YX5 A;  2ZKZ A;  3RKX A;  5J47 A;  1E3P A;  5BQT A;  2E1C A;  3MAJ A;  4HA8 A;  2B0L A;  2XAQ A;  3KE2 A;  5DCM B;  3J81 K;  4XKB A;  5E3O A;  3F6V A;  1B72 B;  3CCY A;  1RKT A;  2V1U A;  1W4M A;  2HOS A;  4KT5 C;  1T39 A;  3OYD A;  1YIJ I;  4P1W A;  2LG4 A;  2P6S A;  2M1B A;  2AO9 A;  2XF5 A;  2JA7 J;  1N75 A;  4WX9 A;  2P6T A;  1VI0 A;  2IA1 A;  5DM7 F;  4KMF A;  2JT1 A;  2JRT A;  1B8I A;  5FFZ A;  4E7Z A;  3BG3 A;  2V1D A;  2PBI A;  2A61 A;  2GIZ A;  2DK8 A;  3VPR A;  4CYC A;  1MIJ A;  2HDC A;  1E0E A;  1EH8 A;  2RNG A;  1T6S A;  2VN2 A;  4BGD A;  2MFZ A;  2VJ5 A;  5M5Y J;  1ZTR A;  5E17 F;  3LSM A;  3P7N A;  4P55 A;  1FMV A;  4B48 A;  2DI3 A;  2XF6 A;  3JCU C;  2ESH A;  2QBY A;  4GGG A;  4HYE A;  4ZYH A;  2O5R A;  3WU2 C;  1I6H J;  4U87 A;  1W7P B;  4BH9 A;  1QZY A;  3K0L A;  4XNF A;  4MFD A;  3DWL E;  3H3Z A;  3DP7 A;  5FKL A;  3HKZ N;  4PZJ A;  3G1M A;  1BI3 A;  2F5V A;  4ZZD A;  4M6V A;  4Q5S F;  1P2F A;  3JRA A;  3HGG A;  1BC7 C;  2EZK A;  3FK7 A;  4BBS J;  1Z67 A;  3I4M J;  1S29 A;  3OYN A;  2XRN A;  4KIG A;  1ON1 A;  3OV8 A;  4M9S A;  3V4G A;  1OFC X;  2PMZ N;  5CVV A;  2EIK H;  3ZOB A;  2IEK A;  2XF7 A;  3EUH C;  2CGP A;  1QO0 D;  2GA1 A;  2FRH A;  3R0J A;  5EZH A;  1IN6 A;  2KL4 A;  2CUJ A;  1MKM A;  1D3Y A;  1BIB A;  2K86 A;  3H1C A;  3HOS A;  1S7A A;  3FXO A;  2R5Z A;  3S2D J;  3BWG A;  1FOW A;  1ACI A;  1WJB A;  3JRI A;  3KX2 A;  4G94 A;  1FMW A;  1MMG A;  3K1N A;  2D1H A;  4B44 A;  3OYB A;  1MGT A;  4Z6Y A;  1V5F A;  2CQN A;  1SC7 A;  1UCR A;  4BXF A;  3AFH A;  3RPU A;  5ERI A;  1Y8R B;  2V26 A;  2L7M P;  5CQG A;  1ZR2 A;  3CCM I;  4HQE A;  3MMY B;  4RAY A;  5AIQ A;  1HKQ A;  1D0X A;  2ZXW H;  2LY2 A;  1QHH D;  2OAZ A;  4BHP A;  4BE0 A;  4DZJ A;  1P4W A;  1SFX A;  4JP0 A;  3G6E I;  3TOB A;  3IHU A;  3NAU A;  1ZH5 A;  1TP4 A;  1RIO H;  2CV2 A;  4HF0 A;  1DU0 A;  2XGC A;  5CVU A;  2RAE A;  2XKP A;  1I27 A;  4RLF A;  2KIU A;  1SFO J;  2EQR A;  3QOE A;  2KZG A;  2Z5U A;  2BXY A;  2EIJ H;  5IOY A;  2E5N A;  2Y0M A;  1PUE E;  2JA8 J;  2JSP A;  4DOZ A;  5IT3 A;  1JTX A;  2WAQ N;  3V8L A;  3BG7 A;  3MQ0 A;  2WWY A;  1FP2 A;  1MH3 A;  1RZ4 A;  3ZN0 A;  2O0Y A;  2Y0S A;  3SEZ A;  2Y31 A;  4MNU A;  2LTP A;  1DQU A;  1ZRC A;  2FX0 A;  3FMQ A;  4FCY A;  1K61 A;  1XCV A;  1TWF J;  2LRD A;  2DPU A;  1TLH B;  3DPT A;  3LSP A;  3OSG A;  3FF5 A;  1BA5 A;  4YIR X;  1S7E A;  3CTA A;  2ME6 A;  2A5Y B;  4QWQ A;  2DLL A;  3QPS A;  3U1D A;  3RYP A;  1NH3 A;  2BY1 A;  3COA C;  2K3P A;  2R7O A;  4ENN A;  4II2 A;  3S14 J;  3BTJ A;  4AU7 A;  2CMP A;  3DF8 A;  2DYS H;  4DQ2 A;  3WTU C;  1J0R A;  1XCB A;  3ZQH A;  1W5S A;  4PCQ A;  2KP6 A;  2HFH A;  5C44 J;  2ICW G;  3SZP A;  1PDN C;  1J2X A;  1UHS A;  3GTG J;  1AHD P;  5C4X J;  5FKN A;  2IGN A;  3GF2 A;  1T08 B;  3G4S I;  5LHH A;  3I58 A;  2XB5 A;  5HS9 A;  2R5Y B;  1JHH A;  2ZNZ A;  2CFO A;  3DEE A;  4UUT A;  3MEX A;  2DXI A;  2W48 A;  3CCL I;  4IHV A;  5HNH A;  4BKX A;  5DD8 A;  2F2E A;  3T5X A;  5TGT A;  3BDD A;  1WFX A;  5J4V A;  1N25 A;  3VFZ A;  4HNV A;  2F6C A;  3OOP A;  1KYW A;  2BEO A;  3A02 A;  1JKO C;  1IUF A;  3ASO H;  4DW6 A;  3PQJ A;  3Q3S A;  4BJ6 C;  2OBP A;  2PLY A;  5BOX A;  2YX7 A;  4BAC A;  4DZP A;  4KIF A;  2LNB A;  1ZG5 A;  3TMO A;  3OYM A;  2CUF A;  2K27 A;  3DV8 A;  4BQA A;  4FE4 A;  3FM3 A;  1XS9 A;  2R0Q C;  3LAJ A;  5D6E A;  3BP8 A;  4CXF A;  1PP8 F;  1FYL A;  3T8T A;  2IS1 A;  4MGR A;  1XDS A;  2DA6 A;  3HRS A;  4RGS A;  2K9Q A;  4XQF A;  4C3J J;  2ZFU A;  5ICG A;  2P5K A;  5E3M A;  3S1R J;  3ZMD A;  3WGI A;  3PNV A;  2H6B A;  3HPG A;  3W6K B;  3FXJ A;  5E8I A;  3KZZ A;  3KEO A;  1G2H A;  3ZGK A;  2DFH A;  4NNJ A;  2JMW A;  5HOD A;  3HIF A;  3EYI A;  3HZJ A;  3BZK A;  3R4K A;  4HPQ A;  1HDD C;  1K83 J;  3I64 A;  4BXU A;  3GTM J;  3H5R A;  1LEB A;  2OJE D;  5GAE J;  3P9K A;  3JAM Z;  1K78 B;  1DGW Y;  2KRF A;  1DGR M;  2MG4 A;  3DU6 A;  5F27 A;  2QF7 A;  3W2A A;  2XGE A;  1J59 A;  2F5F A;  2EJR A;  3BG9 A;  4DIQ A;  5F0F A;  1WJ5 A;  3RIR A;  4UVC A;  5KNL A;  1MJB A;  2JK3 A;  3BTI A;  2XVC A;  2KIM A;  2RDP A;  2ZNY A;  3BJ6 A;  3IAS 2;  1BR1 A;  3HSF A;  3T8R A;  3WU0 A;  1JKP C;  4ENJ A;  4ESJ A;  3TW7 A;  1I3A A;  2VT3 A;  4U88 A;  4AYB A;  4UB6 C;  3ZQF A;  4CGZ A;  1AKH B;  3M8F A;  4NC6 A;  1SVL A;  1LFP A;  1QPM A;  3QYB A;  4U0V A;  1DDN A;  1LE8 B;  3W6J B;  1TQP A;  3DLA A;  4A3E J;  5EJC A;  4WXC A;  5LLQ A;  1SD7 A;  1FBU A;  5E1X A;  1BR4 A;  4XLH A;  3MKY B;  1MSE C;  4CZZ A;  2O61 A;  3KP7 A;  1G3W A;  4OAZ A;  2XGX A;  4E7L A;  5D4S A;  3MCZ A;  2J5P A;  3L00 A;  1LB2 A;  2LKX A;  1R36 A;  2DAO A;  5FKM A;  3J81 Z;  2KQR A;  3QU6 A;  4QPO A;  4RB2 C;  5E3L A;  4BBR J;  5J8C A;  4BY1 J;  2XAG A;  2YR2 A;  1VF9 A;  2F5C A;  2Z1D A;  3PO3 J;  4JYK A;  2F4M B;  5ICF A;  3JTG A;  4CCO A;  2FML A;  3E6C C;  3V8K A;  1TNS A;  5GPC A;  4FX4 A;  2AS5 F;  5M3M J;  3K1M A;  5M5W J;  3K1P A;  4B43 A;  2NVU B;  3AAF A;  2E7W A;  1R71 A;  3MZH A;  4ZDP A;  4EGY A;  2HZD A;  2AQE A;  3WGG A;  5EYR A;  3S3N A;  3WHC A;  2OQR A;  2KKO A;  2VQC A;  2L9V A;  2VB6 A;  1Y8Q B;  5IP6 A;  2ZJQ F;  1WRJ A;  4AD9 A;  3K7A J;  1XPX A;  1R9T J;  4HX4 A;  1ON2 A;  2HVQ A;  4W97 A;  2HOE A;  1QHG A;  1TNT A;  1Z91 A;  2E7X A;  4BQQ A;  4UUS A;  2L7K A;  4DYR A;  2CH0 A;  3E97 A;  2R7F A;  3HTU A;  1FOX A;  5JVT A;  2M2E A;  4A3J J;  2K02 A;  2KRH A;  3L1P A;  2R7V A;  4ZYG A;  4A69 C;  2V9V A;  1NHA A;  3SZG A;  2ZME B;  1HBX G;  1PUF B;  5CKT A;  3A2K A;  4TV7 A;  1LVA A;  3ISP A;  5HLT A;  3FXR A;  3J80 K;  4V19 K;  4G6Q A;  1T0F C;  1TZL A;  1OIS A;  3A0H C;  2ME0 A;  4XL9 A;  1GXQ A;  5IP9 J;  3ML6 A;  2X85 A;  5ILV A;  3OIQ A;  1HC8 A;  1UJ8 A;  5ED4 A;  4NDL A;  1ZN2 A;  2GLO A;  3CDI A;  4ITV A;  3NAR A;  4QIW N;  5HDK A;  4EJW A;  4I98 B;  5DM6 F;  3CDL A;  1B6A A;  1B59 A;  1YIO A;  3FXM A;  3K4N A;  4KMU X;  3SZT A;  3WTW C;  5CYV A;  3EUA A;  4I2O A;  3OY9 A;  3V7R A;  1UB9 A;  4C2T A;  4G7O F;  1O3S A;  5F08 A;  4BU2 A;  2DQR A;  1GUU A;  1A36 A;  5K7H A;  4UUS B;  1HKS A;  3BZC A;  3SYT A;  2Z33 A;  4EAT A;  2W82 A;  1U5T B;  2A6E F;  4CCK A;  3UR3 C;  2K3F A;  3L7W A;  2JVH A;  4RA2 A;  1IZ1 A;  3PFY A;  3ZQQ A;  5HDN A;  2IS2 A;  2EPF A;  5TIS C;  2DFI A;  2GZW A;  2ECB A;  3ABM H;  4BYY A;  2PJP A;  1R58 A;  2JQ7 A;  3SFZ A;  1OLT A;  2XAF A;  2ZXJ A;  5D8K B;  4HV6 A;  1LFB A;  2STW A;  4AID A;  2PN6 A;  1P9Q C;  2L7F P;  1DUX C;  1IJW C;  3S1M J;  3CES A;  1B4A A;  2I5U A;  4NBQ A;  3WTZ A;  2JRM A;  3FK6 A;  2H8R A;  3CP2 A;  5L3G A;  2HR3 A;  2R3S A;  5LD2 C;  1ZHF A;  5LEJ A;  1BM9 A;  3CCU I;  1QBJ A;  3H35 A;  1UST A;  4UV8 A;  3BZ6 A;  1OCC H;  1APL C;  2LLK A;  4LB6 B;  3VYU B;  3OS1 A;  2ISZ A;  2BYV E;  4Q47 A;  5B3S H;  2O03 A;  1Z9C A;  1VQL I;  4IX7 A;  5E20 A;  1FYM A;  2VPL A;  1Z3X A;  1BBY A;  4ZTF A;  2HOA A;  4ON0 A;  1R00 A;  1HA8 A;  1TQI A;  1JJ8 C;  4B1R A;  2FQ4 A;  4C30 A;  2M3A A;  2E2I J;  4ZDL A;  1X58 A;  4HEA 2;  3PJR A;  2VL8 A;  2XRO A;  4RGR A;  4XLC A;  5DV5 A;  3T1B A;  2GIV A;  2M4K A;  2HYG D;  3FDY A;  1VQ8 I;  3I9V 2;  3DEU A;  2O9L A;  1ZGW A;  3VYT B;  1GT0 C;  4IL6 C;  2JUG A;  2FNP A;  5KK1 A;  5FD5 A;  4LLG F;  2IGK A;  3CCJ I;  4GRI A;  3E5U A;  2DK5 A;  3MKL A;  4RAG A;  2OTJ I;  1D8J A;  1W5T A;  2QVO A;  2QM3 A;  5DDG A;  1UFM A;  2DDA A;  2DO7 A;  4OU0 A;  4BJT A;  1G4D A;  3SHF A;  2IPQ X;  4NB5 A;  5DEQ A;  2Q8K A;  2PG4 A;  5E8G A;  3A01 A;  3S16 J;  1IN7 A;  1D5Y A;  1GV2 A;  5LRS A;  1B1B A;  3VDX A;  3ZQC A;  2CRG A;  4HX7 A;  3K4C A;  5D8L B;  1BR2 A;  4CHU A;  4HX8 A;  4XOP A;  4DBQ A;  2NNN A;  3F23 A;  2RN7 A;  3NQO A;  2E60 A;  1QQI A;  2ECC A;  2FBH A;  1G8X A;  3GXO A;  3CC7 I;  2RRE A;  4JBA A;  2B63 J;  2RGV A;  3H9J A;  1HW5 A;  1I6X A;  5J1Y A;  2CV1 A;  3H0G J;  1YRN B;  4LGW A;  2R7W A;  1HXD A;  4RBO A;  5FRN A;  1S72 I;  3OIO A;  3IH4 A;  1RUO A;  2LF7 A;  3A1Y A;  3KEY A;  3GZN B;  4OMZ A;  1ETO A;  2A05 A;  1BOB A;  2M0M A;  3U1K A;  4HRI A;  3QOD A;  2LD5 A;  1WKM A;  1JTY A;  3I71 A;  1FJL A;  5HLI A;  3VYR B;  4F92 B;  3CLQ A;  4UXN A;  4BQO A;  4XSZ F;  2NS7 A;  1FYK A;  3BJA A;  1OCP A;  1YLF A;  2HXO A;  4F91 B;  2A6H F;  4LJZ F;  5CPR B;  2KRC A;  3E1S A;  2R7R A;  2XSD C;  1W7P D;  2H1L A;  1WCM J;  2LMD A;  1U8B A;  3BG5 A;  4D7N A;  1BW6 A;  1PP7 U;  4R1H A;  1TTY A;  1XGO A;  3DXJ F;  4ENK A;  1DPU A;  4BXX J;  3KPH A;  4PDK A;  2IA0 A;  1QNT A;  4ZYD A;  4HQM A;  3KP3 A;  4NUB A;  2XPW A;  3S3M A;  1ZAO A;  3MVP A;  3WGH A;  5CLS A;  2HEO A;  4R79 A;  4BY7 J;  3Q0V A;  2QQB A;  4A5M A;  3QP5 A;  4BE2 A;  1UAA A;  4O5V A;  2F4I A;  5EGO A;  1ZRF A;  3F8B A;  4A3B J;  3NWT A;  3TDU C;  4E7H A;  3ZR8 X;  4ZTJ A;  3DBL B;  3VWB A;  3O3K A;  2ZSI B;  1LEA A;  1VQ5 I;  3VOD A;  2E5Z A;  4DYQ A;  1J5Y A;  4S05 A;  1J09 A;  4A0Z A;  5TJJ A;  1S3J A;  2F5D A;  2DOD A;  4BHC A;  2ZME C;  4ZYA A;  2XAH A;  3S2W A;  4Y33 A;  3D5S C;  3K2Z A;  1T33 A;  2EBI A;  2B7E A;  1U6G A;  3PL8 A;  2X6Y A;  4X0G A;  1RC9 A;  4QPQ A;  2I10 A;  3CC2 I;  3R6S A;  6PAX A;  5KAF C;  4FET A;  2FSW A;  3GTK J;  3DKW A;  2TRT A;  1H0M A;  2NOG A;  1MW7 A;  3IWZ A;  3E0J B;  3ZMU A;  1HLV A;  4KYW A;  4OIO F;  1X1B A;  4A0Y A;  1UMQ A;  2O8K A;  3S1Q J;  4GCV A;  2L3D A;  3WG9 A;  4B4C A;  1Y1W J;  4RLQ A;  3JRB A;  2EZH A;  3ABU A;  1F4K A;  2CS3 A;  4OIQ F;  3CUQ B;  3OSF A;  3D5L A;  3BCB A;  2ZO4 A;  2YX4 A;  2M5W A;  3EYY A;  2IP2 A;  2VKH A;  3I4P A;  1UHW A;  3ZCO A;  3CCS I;  4PSX A;  2ZB9 A;  4L0Y B;  4B3A A;  4B8X A;  3TQN A;  4UVB A;  2N8G A;  2W57 A;  2CUZ A;  2M8E A;  3BTL A;  2ETH A;  2M0C A;  1W1W E;  4LK0 F;  1XSV A;  1XGN A;  1K6Y A;  2HNH A;  3BLY A;  2FE3 A;  5FKO A;  1V3F A;  3BR3 A;  2DFE A;  3QU3 A;  2DA4 A;  2XPU A;  3EQL F;  4KIB A;  4K2E A;  3S2H J;  1JUM A;  1WVR A;  2CQK A;  4MO7 A;  1A31 A;  1OR7 C;  5GTI C;  4A3G J;  1P6R A;  2TDX A;  2BV6 A;  2O7O A;  3F3X A;  4HSR A;  3LSR A;  1QPI A;  1F9N A;  3IV5 A;  4Y13 A;  5C3E J;  2GAU A;  4IOC F;  2WAQ A;  2W00 A;  3QAH A;  4PGG A;  3BOQ A;  3QP6 A;  3DU5 A;  4YIF A;  3HKZ A;  1SVM A;  2VBX A;  5BPD A;  2R7S A;  3TOA A;  1DP3 A;  1K4S A;  5LBQ A;  2D1V A;  5LGT A;  2O8X A;  3JRG A;  1IRG A;  4XRM A;  4A3L J;  2XDV A;  2CW8 A;  4IPA A;  1BOA A;  3VSK A;  4IHX A;  1SFU A;  2AQF A;  3S8P A;  4UV9 A;  4C3H J;  1YQA A;  3BPV A;  2PQ8 A;  3GFM A;  2L02 A;  3W2W A;  1O3Q A;  3H3U A;  1A35 A;  5EF6 A;  4J19 A;  4P9F A;  2V4J C;  3OYL A;  5GAH J;  1GHC A;  4OIP F;  3B73 A;  4M71 A;  3ONQ A;  2BY2 A;  3MZY A;  3TDZ C;  1IG7 A;  2QUF A;  4IOA F;  2QZ8 A;  4G7H F;  4EGZ A;  2M4G A;  1YYV A;  2EFQ A;  1GVJ A;  1L0O C;  1W7P A;  3MN2 A;  2CO5 A;  3FXK A;  3TKY A;  1OYW A;  3GX4 X;  1JT0 A;  1TT0 A;  2YSR A;  3P5J A;  3SDG A;  1IW7 F;  1V54 H;  1Y6I A;  2XIG A;  4HNU A;  5EG0 A;  2VPR A;  4E7I A;  3DEW A;  1G3Y A;  1RUN A;  4CCL A;  2DPD A;  3GLL A;  5GAG J;  3HUG A;  4DJA A;  2EIL H;  5JVG F;  3G73 A;  3CDH A;  3PNY A;  2V9K A;  3JSO A;  5DS9 A;  2PI0 A;  4CYC B;  4L9V A;  3FMS A;  4ETS A;  5FO5 A;  3GME A;  2PJR B;  3BR1 A;  3S1N J;  4I01 A;  3MZ8 A;  3H92 A;  4PFO A;  5CVI A;  1K6O A;  4L18 B;  2O3F A;  1FSH A;  3PUF A;  4B47 A;  3Q0U A;  5CJ9 A;  3LWF A;  3C3W A;  1V5G A;  3U21 A;  1Z7U A;  4F93 B;  2GWR A;  3D1N I;  2LSO A;  2G9W A;  1QU3 A;  3BJO A;  1ETX A;  2D2W A;  4KJZ A;  2XC7 A;  1OMI A;  4HLY A;  5GAD J;  5C4J J;  5BS6 A;  5DYM A;  2V9P A;  1T8I A;  4HAM A;  4XLF A;  3IP4 B;  3RTR A;  4AUX A;  3K9T A;  3BY6 A;  3H5N A;  1XD7 A;  1HSJ A;  4EEF G;  4PJ0 C;  4MQV A;  2ELK A;  1JUP A;  2M34 A;  4PGH A;  3R60 A;  1U9N A;  1HCR A;  1YS7 A;  1AWC A;  1UEL B;  3ZRG A;  3L2W A;  3RI4 A;  1X1P A;  1RR7 A;  1MD0 A;  3OYH A;  3PNT A;  1XG1 A;  3H3V K;  2IRF G;  2M7A A;  2MBF A;  1O3R A;  3KYL A;  2MC3 A;  2HKO A;  1VQM I;  3HOX J;  2E2H J;  3CQZ J;  1X2M A;  2X0L A;  3O6B B;  1X3Z B;  4HOB A;  3CZ6 A;  1IV6 A;  2EB7 A;  2ESN A;  2KIS A;  1G59 A;  2EK5 A;  1KU7 A;  1EKE A;  3QYE A;  1OKR A;  1U9O A;  1Z6R A;  2FUG 2;  2DMN A;  4D7M A;  1VQ7 I;  2ADU A;  3HTS B;  2KIF A;  4RGX A;  2KZV A;  2Q2E A;  3ECH A;  2BZT A;  2EWN A;  2FNA A;  5J4Y A;  2QBY B;  2EV0 A;  2R7Q A;  4II3 A;  2OV7 A;  3ULQ B;  2UXX A;  4M3B A;  3A0B C;  2AHQ A;  4XLP F;  5D6F A;  1F1Z A;  2G7U A;  5CVJ A;  4D5C A;  1MSF C;  1MNM C;  4HLX A;  1JHF A;  3HBL A;  2KDO A;  4CZC A;  3LNQ A;  3I59 B;  1HF0 A;  3L2U A;  1ETY A;  1WQ2 A;  4E7J A;  2RQP A;  1LDD A;  4EM1 A;  5F1J A;  2WY7 Q;  5J3L A;  1ZR4 A;  3J7A O;  3B02 A;  3FBI B;  1KYZ A;  2H8W A;  3HOT A;  4FIS A;  1FX7 A;  4KUM A;  5M5X J;  1RKW A;  1ZLJ A;  1R22 A;  2HKX A;  4CA0 A;  4XRS G;  1D0Y A;  1U3E M;  4LMY A;  1TBX A;  2IAI A;  3IUO A;  1R5I D;  3I55 I;  2IS4 A;  3F8N A;  3C2B A;  5LGU A;  3K4L A;  4C3I J;  3HUG B;  3RQ4 A;  1H9T A;  1NG6 A;  1CQT A;  3ZQL A;  1ZGJ A;  2LKP A;  1R1T A;  1FIP A;  2BVM A;  2HQ5 A;  1TWC J;  1VQK I;  3GTO J;  5D5W B;  1Q1V A;  3QYF A;  3ZMZ A;  1D1B A;  1Z0X A;  2DTZ A;  1A04 A;  4HBL A;  1UG0 A;  2Z2S B;  4P9U A;  2V6E A;  1SFK A;  2EFO A;  2MGQ A;  1FY7 A;  3S93 A;  3OL4 A;  1NG7 A;  5LRR A;  1YJW I;  5A2Q Z;  2HI3 A;  3ZQI A;  1TWG J;  1V5E A;  2ISY A;  2LVS A;  3GBG A;  3CCE I;  1RR8 C;  1YFH A;  3DTI A;  1VQP I;  1MDM B;  3LA2 A;  2D5V A;  2F48 A;  2A6T A;  1FWZ A;  4XN3 A;  5AIP A;  2OU2 A;  5J40 A;  2JZY A;  4FHT A;  1R23 A;  2YS9 A;  1IUY A;  3HXL A;  5B66 C;  4XM3 A;  3GO5 A;  1ETW A;  2E19 A;  4H0E A;  1XX5 A;  1X19 A;  2VQH A;  5DUI A;  1SVO A;  1CGP A;  1IN4 A;  4KN7 X;  4WXD A;  3KYD B;  4GYG A;  1WH7 A;  4KT6 A;  2EIM H;  1BJZ A;  2HDW A;  2VJ4 A;  2Y2Z A;  4GO1 A;  2QSH X;  1U78 A;  3D5R C;  1SMY F;  1WPK A;  2EV6 A;  1LFU P;  3F22 A;  2IS6 A;  2JA2 A;  4ZH4 F;  1I5Z A;  4YFK F;  2PFB A;  2YPR A;  1YJ9 I;  3OR1 C;  2X6O A;  3BR6 A;  3WG7 H;  2XPV A;  1AKH A;  2GM4 A;  4OWR B;  2QQA A;  1XMA A;  3H9G A;  1A6I A;  3TO9 A;  1T56 A;  4OIN F;  2BVL A;  1CF7 B;  2R93 J;  3IRQ A;  4YRV A;  2CFX A;  3CLO A;  4IO9 F;  4LB5 A;  4V2G A;  2RKH A;  2CG4 A;  2XB0 X;  1D1A A;  3JRE A;  2COM A;  3FIW A;  4S04 A;  1D5V A;  3CUQ A;  3IH3 A;  5EEA A;  3Q5F A;  4XRF A;  1SD4 A;  4BL0 B;  2WC2 A;  1FTT A;  3HL2 A;  1HQC A;  1MND A;  1WJC A;  4IHS A;  4RM2 A;  2IJL A;  1GVD A;  4RS8 A;  2E2J J;  3U9G A;  2H1K A;  2EZL A;  1BN5 A;  4NQW B;  3M1C A;  4EJV A;  1MBF A;  1LNW A;  3LSK A;  1K79 A;  4HV5 A;  2NVQ J;  4A6E A;  2FA5 A;  4BEH A;  2NVX J;  2BGC A;  4XKV A;  3PIP F;  5GTH C;  3LQR A;  2GXG A;  3Q9S A;  3KP4 A;  1O3T A;  2NVT J;  3W6V A;  2LFB A;  5CQE A;  2OUM A;  1TT5 B;  4FQG A;  5D5X B;  2C6Y A;  2OPT A;  4EM2 A;  4WF2 A;  1XGS A;  1YW7 A;  2BW3 B;  2GOX B;  1V4R A;  3OYF A;  4XMY A;  2MLK A;  1WGX A;  3F21 A;  2FEZ A;  4PJL A;  4JX5 A;  4IVN A;  1WI9 A;  1S5L C;  1PYV A;  3BPX A;  4XOR A;  3EUK L;  1YJN I;  1XGM A;  3H0D A;  4A3M J;  3N4M A;  3BTC A;  1F36 A;  1OQY A;  5E3N A;  3L09 A;  1QVT A;  4IRI A;  1RRJ A;  4YG2 F;  1MMD A;  2MLG A;  2FBK A;  4NQW A;  2IT0 A;  3C2G A;  3RCO A;  3SEQ A;  2ACJ A;  3ABK H;  2TCT A;  1L3L A;  2CQX A;  4I0B A;  1IXR C;  2BOL A;  4CSW A;  1BW5 A;  2R5Y A;  3V7C A;  1LDJ A;  2X6W A;  2M7B A;  4DYC A;  1S8N A;  4I02 A;  1Z05 A;  3FM5 A;  2VC0 A;  2HXI A;  3HSR A;  3ZXS A;  5K7F A;  2WA0 A;  4YFN F;  1X1C A;  1IN5 A;  2GQQ A;  3VOE A;  2FU4 A;  3M1E A;  3WTX C;  1SAX A;  1CF7 A;  2ZC2 A;  2OZU A;  1YO5 C;  4GDF A;  1S9H A;  3G3Z A;  4Y7N J;  5HS8 A;  2VQL A;  2X6X A;  3G1L A;  3J7Z I;  4MEY F;  4Y17 A;  3C7J A;  1G3T A;  2WAE A;  3AG4 H;  2KJB A;  4EV0 A;  2DA1 A;  1NTC A;  3HB9 A;  3ABT A;  2GOM A;  2QQ9 A;  5B1A H;  1R6R A;  3RQI A;  1SMT A;  5K5O A;  1VQN I;  3ZMV A;  3ELK A;  3WTT C;  3DPU A;  4Q48 A;  4XID A;  1Q1H A;  1FPQ A;  5FLX Z;  1KQ0 A;  1YS6 A;  5EEH A;  1T98 A;  1QZZ A;  1KU9 A;  2G0E A;  2LP0 A;  3KET A;  1G6N A;  4IXA A;  1W36 D;  4L5I A;  1R1V A;  1SEU A;  3L2V A;  1WHU A;  3TED A;  1OPC A;  1PVE A;  3HDD A;  4M3F A;  1T0F A;  5KHD A;  3R61 A;  2K9S A;  2NNY A;  4LG0 B;  4RGU A;  1OYI A;  2DBB A;  1O4X A;  1ONV A;  3P9C A;  1T38 A;  2FOK A;  2K7L A;  5JLX A;  3OS2 A;  5J6X A;  2FD5 A;  1W5C C;  3Q9V A;  3ZMT A;  1E17 A;  2F5E A;  3HPH A;  4CYD A;  1STZ A;  4ESB A;  1ULY A;  4PFP A;  3KEQ A;  1NK2 P;  1Y0N A;  4CUG A;  2XGD A;  2CQQ A;  2PMU A;  3GZ5 A;  4C9Y A;  4UY8 I;  2DOF A;  2IA2 A;  2Y48 A;  3HGY A;  2L5Q A;  4PJN A;  3SDB A;  3K4K A;  3K4M A;  4LOC A; 
#chains in the Genus database with same CATH homology
 4A3C J;  2Y31 A;  2OF7 A;  2LTP A;  4IEJ A;  2FX0 A;  5IYD J;  4FCY A;  1K61 A;  1JKR C;  1TWF J;  2ZB9 A;  5FJ8 J;  1POG A;  3LSP A;  4B3A A;  3OSG A;  2N8G A;  3BT9 A;  1BA5 A;  3BTL A;  2M0C A;  1ZK8 A;  1S7E A;  1Z77 A;  2ME6 A;  2R7Z J;  3M3Y J;  5JLW A;  3QPS A;  2R92 J;  5FKO A;  3BR3 A;  2JA6 J;  2JA5 J;  2YU9 J;  2DA4 A;  2XPU A;  3S14 J;  3BTJ A;  3S2H J;  1JUM A;  4MO7 A;  3ZQH A;  4A3G J;  2E1O A;  2O7O A;  2K9N A;  3LSR A;  1QPI A;  3IH2 A;  5C44 J;  3IV5 A;  1FTZ A;  1I3Q J;  1UHS A;  3GTG J;  3RZO J;  1AHD P;  5C4X J;  4C2M J;  4AYB N;  5C3E J;  2CJJ A;  2DMQ A;  5FKN A;  1MH4 A;  3RKQ A;  2XB5 A;  2R5Y B;  2WV1 A;  4UUT A;  2YUS A;  2LR8 A;  2W48 A;  1NK3 P;  4IHV A;  3BR0 A;  3JRG A;  4BKX A;  4XRM A;  4A3L J;  5F0H A;  5FKK A;  3DCF A;  4IHX A;  1OCT C;  2IBD A;  4HNV A;  4C3H J;  1P7J A;  3LSJ A;  4IHW A;  1QVU A;  1AU7 A;  3A02 A;  1JKO C;  5EF6 A;  1IUF A;  4DW6 A;  4J19 A;  4FTH A;  3Q3S A;  3BQY A;  4DZP A;  1IG7 A;  2DMP A;  1A5J A;  1ZKG A;  2CUF A;  4QSH A;  4FE4 A;  1XS9 A;  3MN2 A;  1SAN A;  2R0Q C;  1RET A;  3M4O J;  1IDY A;  2HDD A;  3JRH A;  1JT0 A;  1TWH J;  3SDG A;  3ZQG A;  5EG0 A;  5IP7 J;  2VPR A;  2DA6 A;  3DEW A;  2K9Q A;  4C3J J;  4X1E A;  3O8G A;  5E3M A;  3S1R J;  3PM1 A;  5EZG A;  1G2H A;  5DS9 A;  4CYC B;  5GP9 A;  2JMW A;  5HOD A;  4MLO A;  3BR1 A;  1EF4 A;  3S1N J;  1HDD C;  1K83 J;  3GTM J;  3Q0U A;  1IGN A;  2DJN A;  2MG4 A;  2LK2 A;  3BR5 A;  4FE7 A;  3TW6 A;  4D5F A;  5F27 A;  2QF7 A;  3D1N I;  1PUF A;  2XGE A;  4RDU A;  1IRZ A;  5FLV A;  3BQZ A;  2L9R A;  3BG9 A;  1ETX A;  5F0F A;  4A3D J;  2JK3 A;  3BTI A;  1GDT A;  3UKG A;  5C4J J;  3K2A A;  3HOU J;  4A3F J;  1JT6 A;  2DMU A;  1WH5 A;  4AUX A;  1JKP C;  5EG0 B;  4MIM A;  3HOY J;  3TW7 A;  4EEF G;  3ZQF A;  1W0T A;  1AKH B;  2ELK A;  1JUP A;  2M34 A;  1LE8 B;  3GTL J;  1U9N A;  1FIA A;  4A3E J;  1HCR A;  2DMT A;  4M3D A;  3JR9 A;  1MSE C;  2VKE A;  1RR7 A;  2NVY J;  1XG1 A;  3H3V K;  4QTR A;  3HOX J;  2LKX A;  3G1O A;  2E2H J;  5FKM A;  3CQZ J;  2CU7 A;  1X2M A;  1IV6 A;  1OJL A;  3OSF A;  5E3L A;  1IC8 A;  4BBR J;  4BY1 J;  1VF9 A;  2EZI A;  3PO3 J;  4JYK A;  4MFE A;  5J1R A;  1U9O A;  4D7M A;  2DMN A;  5GPC A;  2LY9 A;  3I4N J;  3HOZ J;  5IYB J;  2KDZ A;  5M3M J;  3FKI J;  5M5W J;  3SJM A;  2DA2 A;  2Y30 A;  1RPW A;  4I6Z A;  4Y52 J;  4M3B A;  4M3G A;  2WB1 N;  1HOM A;  2AHQ A;  5EYR A;  4XK4 A;  3WHC A;  2VI6 A;  4D5C A;  1MSF C;  1XC5 A;  1MNM C;  2VUM J;  3HBL A;  1FEX A;  3LNQ A;  1HF0 A;  5IP6 A;  1ETY A;  4L5E A;  3K7A J;  5F1J A;  1R9T J;  1ZR4 A;  5J3L A;  1H89 C;  1LE8 A;  4W97 A;  4UUS A;  5BNG A;  4DYR A;  4FIS A;  4I76 A;  5M5X J;  1RKW A;  2M2E A;  2VKV A;  4XRS G;  3TP3 A;  2CUE A;  4A3J J;  2IAI A;  1I50 J;  3L1P A;  5K7Z A;  4XIC A;  4A69 C;  1F43 A;  2Y9Y A;  3C2B A;  4C3I J;  1PUF B;  1CQT A;  1TWA J;  3ZQL A;  4XRS A;  1RES A;  1FIP A;  3PO2 J;  2HQ5 A;  1TWC J;  3GTO J;  1Q1V A;  3B6A A;  3TP0 A;  2ME0 A;  3A03 A;  1Z0X A;  2DTZ A;  2KT0 A;  5IP9 J;  3BR2 A;  5FLM J;  2MGQ A;  4IHY A;  2HYJ A;  4NDL A;  2GLO A;  4QIW N;  3NAR A;  3HEF A;  2HI3 A;  3CDL A;  1H8A C;  3ZQI A;  1TWG J;  4JX6 A;  2LVS A;  5EDN A;  5F08 A;  3GBG A;  3LOC A;  3GTP J;  2L7Z A;  1GUU A;  3HOW J;  1DU6 A;  5K7H A;  4UUS B;  2D5V A;  1ORK A;  5EGO B;  5J1U A;  1P7I A;  3B6C A;  2JWT A;  3QPL A;  1JGG A;  2YS9 A;  5IOZ A;  3CMY A;  1ETW A;  2E19 A;  5IYC J;  3QQA A;  3Q0W A;  4A3K J;  1QRY A;  1W0U A;  5F04 A;  2ECB A;  1WH7 A;  1BJZ A;  1HDP A;  1MBH A;  2MSY A;  2Y2Z A;  1U78 A;  1LFB A;  1WPK A;  1LFU P;  5F0C A;  1GV5 A;  2HOT A;  2L7F P;  1MBG A;  1IJW C;  3S1M J;  1ETV A;  2X6O A;  3BR6 A;  1TC3 C;  2XPV A;  1AKH A;  3WHB A;  2H8R A;  2GM4 A;  3FK6 A;  2QCO A;  1A6I A;  4W1U A;  1WI3 A;  1T56 A;  2FJ1 A;  3OOU A;  9ANT A;  2R93 J;  5M3F J;  4GFB A;  2NS8 A;  3GTJ J;  4V2G A;  3RZD J;  1BL0 A;  3JRD A;  1APL C;  1UG2 A;  2LLK A;  2XB0 X;  4S0H B;  2M8G X;  3JRE A;  3FIW A;  4A93 J;  3IH3 A;  5EEA A;  2HOA A;  2JJ7 A;  2P81 A;  1E3O C;  5DTD A;  3SFI A;  3FIS A;  1FTT A;  1JJ8 C;  4B1R A;  2FQ4 A;  1GVD A;  2E2J J;  2ID6 A;  2E2I J;  2H1K A;  1X58 A;  2EZL A;  3A01 B;  3GTQ J;  1MBF A;  1YRN A;  2NVQ J;  2DN0 A;  1ZGW A;  2NVX J;  2O9L A;  1GT0 C;  5E3O A;  1B72 B;  3CCY A;  1RKT A;  2NVT J;  3W6V A;  2LFB A;  2HOS A;  3MKL A;  2Y9Z A;  2OPT A;  1H88 C;  1MBJ A;  2JA7 J;  2AO9 A;  3HOV J;  1VI0 A;  3A01 A;  3S16 J;  1WGX A;  4JX5 A;  1B8I A;  1D5Y A;  1GV2 A;  2MW8 A;  3BG3 A;  3ZQC A;  2CRG A;  3VPR A;  4CYC A;  4A3M J;  3BTC A;  1F36 A;  2ECC A;  5E3N A;  5M5Y J;  1ZTR A;  1QVT A;  4ABZ A;  3JRF A;  2X48 A;  3LSG A;  2B63 J;  1ENH A;  5J1Y A;  3H0G J;  3O8H A;  1YRN B;  3S15 J;  4V2F A;  4RBO A;  5IPA A;  4X6A J;  3OIO A;  3IH4 A;  1I6H J;  1X2N A;  2DA3 A;  2TCT A;  2CQX A;  4MFD A;  1ETO A;  5FKL A;  1BW5 A;  2R5Y A;  3HKZ N;  2LD5 A;  2JN6 A;  3G1M A;  1JTY A;  1FJL A;  5GPA A;  4M6V A;  4DYC A;  3JRA A;  3HGG A;  2EZK A;  2HXI A;  3HM5 A;  3FK7 A;  5K7F A;  4BBS J;  3I4M J;  2NS7 A;  2ID3 A;  1OFC X;  1OCP A;  2M9H A;  2PMZ N;  2HXO A;  3E7L A;  2IEK A;  3ZOB A;  4Y7N J;  2R5Z B;  2XSD C;  1Y1V J;  2DA7 A;  1JKQ C;  1ETQ A;  1WCM J;  1IDZ A;  5EZH A;  3G1L A;  1U8B A;  3BG5 A;  2EH3 A;  4D7N A;  1BW6 A;  1ITY A;  2DA5 A;  2DA1 A;  2R5Z A;  1NTC A;  3HB9 A;  1JJ6 C;  3S2D J;  4BXX J;  2GBY A;  3RQI A;  3JRI A;  2XPW A;  3MVP A;  4XID A;  2COB A;  2XRL A;  4BY7 J;  3Q0V A;  2G0E A;  2LP0 A;  1VND A;  2Y0S N;  2L0K A;  5EGO A;  4A3B J;  2L7M P;  3TED A;  1B8I B;  2K40 A;  1ZR2 A;  4M3F A;  3HDD A;  2K9S A;  4DYQ A;  4DZJ A;  1O4X A;  4JP0 A;  3NAU A;  5JLX A;  1T33 A;  2EBI A;  2FD5 A;  1VFC A;  1DU0 A;  3S17 J;  2XGC A;  1B72 A;  2RAE A;  1ZQ3 P;  4AC0 A;  1SFO J;  2EQR A;  2I10 A;  3JRC A;  1ETK A;  1MBE A;  3GTK J;  5IOY A;  2TRT A;  4JX4 A;  2NOG A;  1JUS A;  1NK2 P;  2JA8 J;  3F0C A;  2X9D A;  4M3E A;  1JTX A;  2XGD A;  1HLV A;  2WAQ N;  2CQQ A;  1UMQ A;  4G12 A;  2O8K A;  3S1Q J;  1MBK A;  3HGY A;  4A3I J;  4B4C A;  1Y1W J;  3JRB A;  2EZH A;  1MH3 A;  4LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...