1H88C

Crystal structure of ternary protein-dna complex1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C03
4DYRA 4XRMA 3OSGA 3HGYA 4A3FJ 1F36A 2NOGA 1MSFC 1FJLA 2XGDA 1ETWA 2IBDA 1YRNA 3S1RJ 4AYBN 2LLKA 1MBFA 1JTXA 4D5CA 1A5JA 2XPUA 2XSDC 2HI3A 2R5ZB 2RAEA 5M5XJ 2EQRA 2NVXJ 4JYKA 1IDZA 3BTIA 1JJ6C 4QTRA 2LD5A 1OCTC 4I76A 4XRSA 1BW6A 3JRHA 2M9HA 5F27A 1XS9A 2JK3A 3ZQLA 1GV2A 1WCMJ 5GP9A 4V2GA 5IYBJ 2R5YA 4MO7A 4RBOA 5F0HA 2VI6A 5FJ8J 3Q3SA 1GDTA 2NVYJ 2H8RA 9ANTA 4A3BJ 2NVTJ 2DMQA 3WHBA 2CU7A 5IP6A 4L5EA 3TP3A 3HOXJ 5K7HA 4FE4A 3BTJA 2JA7J 2O9LA 4D7MA 3B6AA 1U8BA 2DN0A 3BR3A 1B8IB 3S1NJ 2LVSA 4J19A 3CQZJ 2XPWA 1PUFA 1EF4A 4IHWA 1UG2A 1WGXA 1TWCJ 3JRIA 2DMPA 3HKZN 1UHSA 1GT0C 1JUSA 1LFUP 5M3FJ 1B72B 4DW6A 4M3FA 1JKRC 3SJMA 1MBEA 3IH2A 1CQTA 2R5ZA 4ABZA 2TCTA 1FEXA 1HLVA 2D5VA 5E3OA 3H3VK 2HOTA 2QF7A 1E3OC 3BTCA 1U78A 1MH4A 2KDZA 3OIOA 2G0EA 2GM4A 4W1UA 2CUFA 2TRTA 3BG5A 2L7MP 3IH4A 5JLXA 3RKQA 3S16J 1F43A 2FQ4A 1TWFJ 2CJJA 5M3MJ 1Y1VJ 3ZQHA 3A01B 4A3LJ 3Q0WA 4BBRJ 2EZLA 2HOSA 3FK7A 2M2EA 1IDYA 1SANA 1HCRA 1UMQA 3QQAA 4BXXJ 2OF7A 1OFCX 5FKNA 3RZDJ 2DA5A 2DJNA 1B8IA 5J3LA 1H88C 2L7FP 3JRBA 3PM1A 5BNGA 3S15J 2ECCA 1DU6A 3LNQA 1B72A 2IAIA 4JX5A 1VNDA 2COBA 2LKXA 2DA2A 3HOYJ 3BG3A 2L9RA 4C3JJ 3B6CA 4MIMA 1W0UA 2JJ7A 3LSJA 2XPVA 3HM5A 5J1UA 1MH3A 1IUFA 1AU7A 2X6OA 1IGNA 2E19A 1ETQA 3I4MJ 3C2BA 1GV5A 2DMUA 1H8AC 3HGGA 2MG4A 2E2IJ 4DZPA 2ID3A 1NTCA 2MGQA 1QVUA 1BW5A 2E2HJ 5FKMA 3TEDA 2YS9A 2B63J 3A01A 4IEJA 2DMTA 2EZIA 2VKEA 1XC5A 2Y31A 3S17J 3JRDA 1MBJA 1ZK8A 3CCYA 1Z77A 3BT9A 2HXIA 3MKLA 4Y7NJ 3HOWJ 5JLWA 5C4XJ 4M3EA 4IHXA 4JX4A 5FKKA 1S7EA 5E3NA 2XB0X 4C3IJ 3S2DJ 1X58A 1MBHA 1QVTA 1GVDA 2N8GA 3LSPA 5DS9A 2HYJA 1ETKA 3ZQGA 3QPSA 3FK6A 1RR7A 3IH3A 2X9DA 3JRCA 1VFCA 2Y9ZA 4QIWN 1ZTRA 4M3GA 1JT0A 2ELKA 3LOCA 4UUSB 4HNVA 5K7ZA 2R0QC 1TWGJ 3ZOBA 3HB9A 2O8KA 3GTJJ 5F0CA 3JREA 3OOUA 2IEKA 2AHQA 4XICA 5F1JA 1AKHB 4CYCB 4A3IJ 4I6ZA 4D5FA 4GFBA 1JTYA 2ECBA 2DTZA 5FLMJ 2Y0SN 2OPTA 3LSGA 3PO2J 1R9TJ 2NVQJ 4B3AA 1ORKA 4FCYA 3MVPA 2LFBA 2YU9J 2Y30A 1K83J 1Y1WJ 1FTZA 3BG9A 4A93J 1IRZA 2GLOA 3JRAA 2DA6A 2VUMJ 1WPKA 3Q0VA 1LFBA 3JRFA 1FTTA 2EZKA 2WV1A 1O4XA 4FE7A 1G2HA 1XG1A 4M3BA 5EGOB 3MN2A 3GTLJ 3GTQJ 3SDGA 5EZHA 4IHYA 1IV6A 2JWTA 4W97A 3VPRA 1NK3P 3HOZJ 3K2AA 1DU0A 3G1OA 1FIAA 4JX6A 3ZQFA 4XRSG 4A3MJ 4AUXA 1I3QJ 1TWHJ 4UUSA 2AO9A 3O8GA 4UUTA 5F0FA 3IV5A 1ZQ3P 2LK2A 2MSYA 5EDNA 2EH3A 4BKXA 5E3LA 1ETYA 1ETVA 4CYCA 5J1RA 2XB5A 5EYRA 5DTDA 1I50J 3BR1A 4A3CJ 2WB1N 4MFDA 1Z0XA 1W0TA 3GTOJ 2DA7A 4M6VA 5EF6A 3M4OJ 2K9SA 1QRYA 4DYCA 4B4CA 4RDUA 4C3HJ 2JA8J 4A3DJ 5GPAA 3HBLA 1RESA 3FISA 3G1MA 1HOMA 3HEFA 2ME0A 5FKOA 1IG7A 5F04A 2CQXA 3SFIA 2Y2ZA 3S1MJ 5M5WJ 5EGOA 2K9NA 5IYCJ 1HDDC 2LP0A 3CDLA 2JMWA 1U9OA 2ZB9A 3M3YJ 1JT6A 2K40A 1IJWC 4LOCA 4BY1J 3GTMJ 1A6IA 3GTGJ 1OJLA 2LR8A 2CQQA 1LE8B 4FISA 1PUFB 2R93J 5EEAA 1RKWA 3PO3J 4A3JJ 1T56A 2XRLA 1TC3C 3S14J 3E7LA 4A69C 3BR6A 5GPCA 1ZR4A 2XGEA 5E3MA 2ID6A 4FTHA 5IP7J 1D5YA 2FD5A 1QPIA 1HDPA 2HQ5A 3QPLA 2L0KA 4A3KJ 5C44J 4QSHA 2CUEA 3BQYA 2VKVA 4X6AJ 4DZJA 2K9QA 2JN6A 3A02A 1SFOJ 3S2HJ 2R92J 3CMYA 3H0GJ 1P7IA 1VF9A 3DEWA 2VPRA 5K7FA 2QCOA 1T33A 2R7ZJ 1BA5A 1ITYA 3K7AJ 2LTPA 3RZOJ 1H89C 3BR0A 2HDDA 1ETXA 2I10A 2MW8A 2JA5J 3F0CA 2GBYA 5IOZA 4X1EA 3RQIA 3D1NI 2FJ1A 5EG0B 1NK2P 1OCPA 1FIPA 3FKIJ 3BTLA 1RETA 2PMZN 5F08A 3HOUJ 3NAUA 3GTKJ 2DA1A 5C4JJ 3UKGA 1MBKA 3O8HA 4JP0A 4V2FA 1JJ8C 1LE8A 1ETOA 5IP9J 2EBIA 2FX0A 2M34A 1ZR2A 3GTPJ 1WH7A 1I6HJ 2HOAA 3G1LA 1AHDP 2WAQN 1WI3A 3BQZA 2DA4A 3NARA 1Q1VA 3HDDA 1ZKGA 5IYDJ 1X2MA 3Q0UA 2Y9YA 2JA6J 1MSEC 2DMNA 3A03A 1TWAJ 3I4NJ 2XGCA 3BR5A 1JKOC 1JUMA 1RKTA 2HXOA 1JKPC 4XIDA 2M0CA 2LY9A 2YUSA 1BJZA 5IPAA 2W48A 3S1QJ 1P7JA 2X48A 5IOYA 4AC0A 1IC8A 3DCFA 1K61A 1BL0A 4XK4A 5HODA 3BR2A 3W6VA 1MBGA 2EZHA 3ZQIA 5EZGA 3TP0A 2E2JJ 5C3EJ 4BY7J 4DYQA 3JR9A 1X2NA 2E1OA 3ZQCA 4A3EJ 1AKHA 4BBSJ 3WHCA 4G12A 4EEFG 5EG0A 2H1KA 1MNMC 1YRNB 2M8GX 4NDLA 2P81A 4B1RA 4Y52J 3GBGA 4A3GJ 1ZGWA 2CRGA 4D7NA 4M3DA 4C2MJ 1RPWA 5J1YA 2KT0A 2ME6A 3JRGA 2NS8A 2O7OA 4MFEA 2R5YB 1JGGA 2DA3A 3HOVJ 4MLOA 1VI0A 4IHVA 1WH5A 1JUPA 5FLVA 3TW6A 2NS7A 3L1PA 2L7ZA 4S0HB 3OSFA 3LSRA 1HF0A 1POGA 1JKQC 1GUUA 1ENHA 1U9NA 3FIWA 3TW7A 5FKLA 1APLC 5M5YJ
chains in the Genus database with same CATH superfamily
4DYRA 1RC9A 2VOOA 2FE3A 4JQFA 2P6SA 3KYDB 1EV7A 1KYWA 4HW0A 1SAUA 4P9UA 4KT5C 2Z1DA 1FJLA 1R4MB 4M9ZA 2RNJA 4BDZA 2IBDA 5JVTA 1QNTA 2LLKA 2VT2A 4BJ6C 3CUQA 2Y69H 3PNTA 4L5JA 5TISC 3WTZA 5LFAA 2Z9OA 3OL3A 4HX4A 3K69A 4JYKA 3K70D 4ESBA 5ILVA 3BTIA 1JJ6C 1OCTC 2E1NA 3KETA 2X0LA 2PI0A 1BW6A 2W24A 1GV2A 1MJBA 1EA3A 1Z3YA 2XHKA 5E8IA 4MO7A 1W1WE 5J47A 2ZSIB 5F0HA 5FJ8J 3R60A 3CJRB 2NVYJ 3VYRB 9ANTA 3R61A 2NVTJ 4WXDA 3WHBA 5IP6A 2FXAA 4FE4A 2O9LA 2FA5A 1K4TA 1S9HA 3I54A 4KDPA 3HXLA 1OISA 2QENA 4WCGA 5J40A 1D1BA 1SMTA 1BR2A 3J81K 1PUFA 5DYMA 1GHCA 4PFOA 4IHWA 4B48A 1WGXA 3HKZN 2CSOA 1YQAA 4MEXF 1JUSA 4P1WA 1ON2A 2KIUA 3V42A 4AYBA 4EV0A 1TZLA 2NRAC 2QA4I 4AVPA 1MBEA 2VBZA 3DV8A 1U5TA 1FEXA 2B7EA 3H3VK 2GA2A 3WTYC 4HBLA 1SD6A 3WU2C 1CF7A 1IXRC 4BUPA 2NYXA 2QGUA 1HXDA 4BGDA 4OOIA 3BG5A 3VFZA 1TTYA 5JLXA 1HW1A 5CPRB 5HNHA 2JVHA 3S16J 2VC1A 1ZRFA 1RR8C 1OLTA 3A01B 2KL4A 2CV2A 3Q0WA 2EILH 1K6YA 2V9PA 4BBRJ 2EZLA 1MNDA 4IQ4A 5D4RA 4E7HA 3V7CA 2HOSA 1Z6TA 2XC7A 2WY8Q 3AKZA 1YLFA 2D45A 2CUZA 2FBIA 3TO7A 1HCRA 1UMQA 4I0AA 1BI1A 2DK5A 2X6YA 1B8IA 5J3LA 5DV5A 3CMAI 1H88C 2A5YB 3T8RA 2FU4A 3JRBA 2ZNZA 5TGTA 2K86A 2LC2A 4LB5A 1JE8A 4KISA 3QOPA 1ZN2A 3S8PA 2RGVA 2R7WA 2MFZA 3DKYA 2B9SA 3NEUA 1T6SA 1P6RA 2X6XA 3P9CA 2M7AA 3L2QA 1MJ9A 2EPFA 4LG3A 3K6GA 4ENKA 2JJ7A 5FRNA 3LSJA 1YOVB 2XPVA 1EJ9A 3CCEI 3H92A 4XN0A 5BOXA 3E6DA 3TL4X 3L7WA 4A0ZA 3J7AY 3H9GA 1KU3A 2WV0A 4FHTA 4BNCA 2ID3A 1NTCA 2XF5A 3DBRB 4M74A 1YG2A 5FKMA 5JI6A 4U0YA 3QPHA 4UUVA 3J7ZI 2HKXA 3DP7A 2EZIA 2V9KA 3JRDA 5HDKA 1XB4A 4NQWB 5FLXZ 2E60A 2E5NA 1WSUA 4II2A 3LSIA 2ZJQF 3HOWJ 2VL8A 2MD5A 4Y33A 5LRSA 5JLWA 2P0WA 4IHXA 5FKKA 5FFZA 3H36A 3I4PA 4C3IJ 5ILSA 1G3YA 2DT7B 3SEZA 2IRFG 1MBHA 3CUOA 2M4GA 2FMLA 3G6EI 2FNAA 5DS9A 4L0ZB 5HS9A 2ZJRF 1H0MA 5AONA 1A35A 3ABUA 3QPSA 2KJCA 2H1LA 4E70A 1VQ5I 1UB9A 4XKWA 2X9DA 3KYCB 1XGOA 1ZTRA 1Y8QB 2KDOA 1XDUA 1OR7A 1K4SA 1R1UA 3QYFA 1HA8A 4NHJA 2E1MB 3LOCA 1U6GA 2CO5A 5HLTA 5K7ZA 1TWGJ 2QYOA 5ICGA 3OYKA 4P5OA 3NWSA 4YIRX 1FC3A 2STWA 3F72A 2GIZA 3JREA 2R4GA 4I99C 1Y0UA 2HDWA 2IEKA 2MH9A 5F1JA 2FOWA 4CYCB 3AFHA 1JTYA 3F8MA 4NB5A 2BGCA 2ECBA 5ERIA 3SZTA 1S29A 1R9TJ 1B9MA 1N75A 4B3AA 4UHTA 1ORKA 4GGGA 2UV1A 2W1OA 4FCYA 1BR4A 1FYMA 2NS0A 4L9VA 4IJAA 5D5VB 1BN5A 1FTZA 3BG9A 1V5FA 3KP7A 1WPKA 1FT9A 3Q0VA 1PVEA 4A6EA 2WV1A 2TDXA 1G2HA 3TOAA 4V19K 2H8WA 2OU2A 2X6WA 3SZGA 2KKOA 2G7HA 1KQ9A 3KP2A 1IV6A 2JWTA 4PGGA 1ZRDA 3HOZJ 3LQRA 4JX6A 3WTVC 1W5TA 2NNYA 3FHZA 1V5GA 1LDDA 4M73A 4UUSA 1ZQ3P 3LAJA 2LK2A 1EH8A 2MSYA 5EDNA 3GUDA 1M1EB 4BKXA 2ZO4A 5E3LA 1ETYA 4P55A 3AG4H 1ETVA 2HVQA 2XSJC 3HZJA 2DAOA 4HG2A 5EYRA 3HSEA 2COMA 1G4DA 2IS1A 4MFDA 1SVLA 2XAJA 2ZC2A 2XAFA 4XLEA 3M4OJ 3D5RC 4QWQA 4C3HJ 4OAYA 2M45A 2JA8J 3ZGKA 5GPAA 3R0AA 2BHYA 2XAHA 3G1MA 3HEFA 4KICA 4Y3OA 2H6BA 3RI4A 5GADJ 3E6CC 5AIPA 4I7HA 3F3XA 4CO8A 1HDDC 1PJRA 1IF1A 3R4KA 4II3A 5J4VA 5H6QA 3TO6A 2D1VA 3LFUA 1KGSA 3CESA 5D5XB 1IJWC 3I71A 4M72A 1O7LA 1JGSA 3GFIA 2VKHA 3CP8A 4KT6A 2VBWA 4LLGF 1MDMB 2F6CA 1T0FA 2F4IA 2LH9A 2XRLA 4IPAA 2JTVA 5HDGA 3CC2I 2ID6A 3OS0A 1D5YA 2XKPA 3CCJI 3J80K 4L5IA 1I6XA 1HDPA 1YX3A 4U88A 1FOWA 5DCMB 3MKYB 2L0KA 4H0EA 4Q5SF 4QSHA 1YITI 2CUEA 3A0HC 3I64A 3BQYA 4N9IA 1TL8A 5B5EC 2JN6A 3OMYA 3C3WA 1Z7LA 3S2HJ 3H1CA 4AD9A 2NNNA 4L9NA 4OIQF 5K7FA 3ZRGA 2XUBA 3K7AJ 1DGRM 3CTAA 2EINH 2Y0MA 3I53A 2MW8A 3F0CA 1I1GA 2GBYA 4U7DA 1E17A 3RQIA 1VQMI 3AL0C 1HSTA 2KRCA 3TMOA 4CZZA 3BTLA 5GAHJ 1RETA 2PMZN 3OR1C 4GXOA 2R7XA 2FUG2 1MMSA 3BLYA 2KIFA 4DGWB 4NQWA 4RB1A 2DXIA 5C4JJ 1MBKA 1D8JA 3O8HA 4BU2A 1DQUA 3HSRA 2BY3A 3RDIA 1JJ8C 3H35A 2GOMA 1LE8A 2EWNA 3GVAA 3EPZA 5HLHA 3BZCA 3FMSA 1C0WA 1B59A 1KQ0A 2HOAA 3FMQA 1LNWA 2HQNA 1XGNA 3FXJA 3DPUA 3EYYA 1WI3A 4C2UA 2O3FA 4EQQA 2LDUA 5KVRA 4MEYF 2XRNA 2VONA 1X2MA 1R71A 1HKQA 3K4BA 3NRVA 3BR5A 3TGNA 1JI8A 4ZDPA 2V1UA 1BIBA 5D6EA 4FETA 2H09A 3S32A 1P92A 2W48A 1USTA 3KE2A 1P7JA 3JAMK 3E5UA 2HQRA 1WJCA 1HW2A 1BL0A 3WE3A 4OMYA 3W6VA 2EK5A 3ZQIA 2QQ8A 5HS8A 3LSKA 2KPMA 4XLPF 3MWMA 1W4MA 4HF1A 3ZXSA 3ZMDA 3JR9A 2LG4A 1E3PA 1D0ZA 3DBLB 4A3EJ 1LVKA 2H1KA 1RRJA 4KYWA 2EIKH 3RQ4A 2BBYA 4HSRA 2M8GX 4NDLA 2OBPA 4A5MA 4B44A 2R7SA 4O5VA 1ZARA 1TNTA 2EFOA 4KMUX 1Z6RA 2ISYA 3CUQB 3D5LA 3WG7H 2AXLA 2L02A 2Q1ZB 4YIIA 2BYVE 2DT5A 1O7FA 2KZVA 4LK1F 5J1YA 3F8FA 3BPXA 4ANJA 2HZTA 4XLNF 2XROA 3ZP5A 1TP4A 3LL7A 2KISA 1IO2A 4EGYA 3FX3A 3P7NA 5CLSA 4C9YA 1X1CA 1P4XA 2K9LA 5FLVA 2OD5A 3O2PE 3OWTA 3F6VA 1ZGJA 2M87A 4XOTA 4JBAA 3RKXA 3L1PA 3K4KA 3FHNA 1POGA 1X3UA 1JKQC 1U9NA 3ZR8X 5FKLA 4XRMA 4YEJA 3PFIA 5CQEA 2V26A 4G7HF 4YELA 1F36A 2HQAA 2XIGA 4IRHA 4BHCA 1MSFC 4XLFA 3ELKA 2L4MA 2XGDA 1FPQA 3KZYA 2XV4S 3DKXA 1A5JA 2EA2A 1IN6A 2HI3A 1U5TB 3EUHC 1OYYA 1R36A 3F23A 2RAEA 5M5XJ 5CJ9A 2EQRA 1S6LA 1I5ZA 2IVMA 1IDZA 2BOLA 1Y56A 3BJ6A 4GDFA 2NAZA 2FOKA 3AAFA 4E6KG 1XS9A 2A3SA 5IYBJ 4RBOA 4X0GA 3WTTC 3VSKA 1XGSA 5ILUA 4RLQA 2UXNA 1ACIA 1OCZH 5H2FC 2CU7A 3H3ZA 4CCOA 1YIJI 4IHTA 2I5UA 3HG9A 5K7HA 1G3WA 3ERMA 3MZHA 2HR3A 2JA7J 4D7MA 3H9JA 2RQPA 3GMEA 4AIJA 2XF6A 1B8IB 1GVJA 1S3JA 3CQZJ 2XPWA 1VTNC 3PNYA 4ENJA 1UG2A 1VQLI 4RGSA 1UHSA 3P9KA 1QHHD 4CCKA 2QM3A 2B0LA 4DW6A 4M3FA 4BXFA 4YFKF 4E4HA 2VOPA 4S04A 3IRQA 2RDPA 4E7ZA 5KAFC 3T8TA 2L9VA 3IH2A 3ZMVA 2DO7A 2M5WA 4CICA 4OU0A 4ZDLA 1HLVA 1XX5A 2Z99A 1IRFA 2G0EA 1IAWA 3ESWB 1SEUA 5IT9K 2JRTA 3IC7A 4A0XA 2CUFA 2Q0OA 3FDYA 2TRTA 2L7MP 3IH4A 3BOQA 4A6DA 1FSHA 3RKQA 4G7ZF 1SFEA 1YJWI 2FQ4A 1PP8F 5ICEA 5M3MJ 3V8KA 3E6MA 4EJTA 3TKYA 3KLNA 3ZQHA 2XAQA 2WAFA 2XKOA 1R5GA 3U1KA 4DNCA 2IS6A 3S3MA 2PJRA 2ZMEA 4AIHA 4F55A 4XR6A 1IDYA 2ZXHA 1REPC 5L3EA 3QQAA 4BXXJ 2R7DA 2QQAA 3I58A 2OF7A 3I5UA 2DA5A 3CD6I 2A5WA 1OPCA 1ZHFA 4EM2A 1B1BA 2KP6A 1STZA 5BNGA 3K0LA 3K1MA 3IKTA 2Z3YA 1DU6A 3LNQA 2DLLA 1LUJB 1XMKA 2IAIA 4JX5A 2OTLI 2DK8A 2COBA 2LKXA 2L7KA 3J7YJ 3K4LA 4ENMA 2OV7A 4GO1A 1W0UA 1KU7A 5D8LB 3ASNH 2IGOA 2L01A 3MCZA 5K5QA 1AU7A 1FP1D 1IGNA 3W2VA 3C2BA 1GV5A 4RLFA 5LGTA 2DMUA 2ZXWH 4RS8A 3HGGA 3HJEA 2E2IJ 3K4JA 2JSCA 4L0YB 5B3SH 1T08B 1QVUA 1BW5A 3BP8A 3RYPA 2HTJA 1RZ4A 2KFDA 4QLCU 4IEJA 1KU2A 1XC5A 3S17J 2F4OB 4CCJA 2LOOA 1YIOA 3CCYA 1O3TA 1VQOI 2BXYA 2E5ZA 2RQQA 3MKLA 3MKZA 4R1HA 4NC7A 2EV5A 4KFCA 2IGKA 4XMYA 3OYLA 2IJLA 2WY7Q 4ON0A 3S2DJ 3C18A 4XSXF 1X58A 2VB6A 1UAAA 3BJAA 1UJ8A 4O3MA 2PFBA 3LSPA 4GRIA 1FSEA 4HNUA 1WJBA 2HYJA 1ETKA 2IP2A 3ZQGA 4HQMA 4YIFA 3OYDA 5E8GA 2K5CA 1WZ2A 2EV0A 2R7FA 3FXOA 1UFMA 3FK6A 5B1AH 3H5NA 4QIWN 2BXZA 2WADA 5HS7A 4YFXF 2HPMA 2L9SA 2UXXA 5J8CA 4M3GA 4BE0A 1JT0A 1AA7A 2LMDA 4G9YA 4UUSB 2E71A 5DCFA 2YX4A 3H0DA 1LDJA 4HNVA 2R0QC 4G6QA 5E79C 3HHGA 4M6YA 1QBJA 4CDGA 1YS6A 3FBNB 1WKMA 4WXCA 1MKMA 2BHZA 3DKWA 2AHQA 4XICA 3REOA 3ASOH 3PL8A 2IA2A 4I6ZA 4PUSA 4D5FA 2P4WA 1SC7A 4J01A 2VQLA 1UHMA 3OS1A 1SD7A 2DTZA 1YI2I 2GQQA 2PQ8A 2OPTA 2DOEA 2Y0SN 3LSGA 4XNFA 5LHGA 2JQ7A 2ETHA 2JPCA 3U1DA 4DIQA 2NVQJ 3PO2J 2W25A 4BJTA 1E0EA 3KLOA 2XDVA 4ZYHA 2YU9J 4HF0A 2IS4A 1NG7A 2V6CA 3VWBA 2DA6A 4KNYA 2VUMJ 1LFBA 3FM3A 3JRFA 1FTTA 2EZKA 3LSTA 2HDCA 1FOXA 3KFWX 3QPTA 3MN2A 4RGRA 3HL2A 5EZHA 1RI7A 2PMHA 4W97A 3GZ6A 1NK3P 4CCLA 2XAUA 3G1OA 1DU0A 4A3MJ 1XCVA 2R7UA 2W82A 1VQ9I 1X1PA 4AUXA 1TWHJ 4MTEA 3MD2A 3O8GA 2CG4A 1D8KA 2KRFA 2O5RA 1X1AA 1X4PA 2WBMA 3MAJA 2W00A 1YO5C 3F9KA 1HQCA 1SVMA 1S5LC 3GEZA 4A3CJ 5JR3A 2M30A 2WB1N 3NQOA 3ABKH 1Z0XA 2DA7A 1XTAA 2QQ9A 1VQNI 3ABMH 4ASNA 4HEA2 2QBYA 2J5OA 4XM3A 1SMYF 2K9SA 1E2XA 1WI9A 4LK0F 3KYLA 3CF2A 4DYCA 3GYHX 1IV8A 2K7LA 5KNLA 3CCMI 4A3DJ 1R22A 4EJWA 3HBLA 3DPLC 5L3FA 3FISA 1HOMA 2L3DA 3FXUA 1NG6A 3ZMSA 3GO5A 3SFIA 3WODF 3WTSC 4RM2A 1FYKA 2RNGA 3A2KA 5EGOA 1FOYA 5KHDA 2K9NA 2Z2SB 1I39A 1YJNI 1IRGA 5IYCJ 5BPIA 4ZZLA 4XLCA 4XLHA 2Z5UA 1IN7A 2CWEA 1U9OA 2ZB9A 1T98A 5FD6A 2YU3A 3BDDA 4YRVA 2LYCA 4OMZA 2FBHA 2K40A 4BY1J 2JA2A 3V8JA 5ED4A 2DBBA 1OJLA 4R8HA 5EEHA 3ZQQA 2CQQA 1X19A 2HYFA 1LE8B 2RVCA 4EM0B 1LEBA 2R93J 3PO3J 1J0RA 3M07A 1TC3C 2XVCA 2PJPA 3DF8A 3E7LA 4A69C 3BR6A 2AQFA 2VJJA 4PSWA 5GPCA 5IP7J 3AL0B 5TRDA 1W5SA 4KN7X 5K5OA 1U8RA 5HLGA 2CQKA 2HQ5A 5IY5H 1N77A 4A3KJ 4LG0A 1R7JA 3OYAA 1IN5A 3QODA 2E34A 4IX7A 4N4NB 1N78A 2EIMH 4DZJA 1W36C 2E1CA 3A02A 4E7KA 3K2ZA 2FNPA 1P7IA 3H0GJ 5H20A 3UNGC 3OYJA 3DEWA 3P5JA 2PLYA 1O57A 1XGMA 1T33A 3HYIA 2R7ZJ 3J81Z 3DEEA 3CMMA 1BA5A 1ITYA 3PJRA 4F52A 2O6GE 4HAMA 3RZOJ 3BR0A 3OY9A 1XMXA 1ONVA 2LRDA 3BZ6A 3D0SA 4ZC3A 2JA5J 4PK4A 1K7AA 4X1EA 2OZ6A 1OCPA 4D0PA 4C30A 2RKHA 4MNUA 3HOUJ 4ZDOA 2W85A 3QP5A 1XSDA 4HZFA 3UKGA 2STTA 2JSPA 4V2FA 1Z1DA 2EBIA 5DEQA 3SEQA 4UB8C 1S7OA 1AHDP 3BQZA 3NARA 4OINF 3CCQI 4KA4A 5IYDJ 4RB3C 1X4OA 1MZBA 3F21A 2JA6J 2BV6A 2DMNA 3A03A 2EV6A 4WX9A 2XGCA 2DT6A 3KP3A 3OOPA 3KCCA 3MZ8A 2VQGA 3EETA 1ZLJA 3QOEA 3DXJF 3DCFA 3BCAA 3K4NA 2BY2A 4BHPA 5HODA 4MQ9F 5D5WB 2DDBA 2L4AA 1P4WA 2VQCA 2ZJPF 4Y4RA 3OIQA 2CV0A 2E2JJ 2QLZA 5C3EJ 2CW0F 2VBYA 4IXAA 4DBRA 2CGPA 4L18B 1SVOA 1X2NA 2E1OA 4DQ2A 4J00A 4BBSJ 4EEFG 5EG0A 1MNMC 1LPQA 5EEGA 4UNOA 1NH3A 3FM5A 2O61A 4MQVA 2Y48A 1LDKB 3RPUD 3S2WA 3HRTA 3GBGA 4M9XA 5CVRA 1T95A 3HUGB 5FO5A 2VC0A 2Q8KA 2ESHA 3DBHB 1DDNA 1J75A 1BC8C 2OC6A 3PSIA 1D1AA 2KT0A 1J59A 2WAQA 4HSTA 3H9QA 2IPQX 3RPUA 1T39A 2HPIA 2O7OA 1ULYA 4MFEA 3NWTA 5LBQA 5K5RA 2VBXA 2M8EA 2R7VA 4PDKA 2BEOA 1VI0A 2DDAA 1JUPA 3TW6A 1EH6A 2HKOA 4EATA 4A0YA 2NS7A 3CDIA 3CCLI 4S0HB 1ZREA 2HVSA 3ULQB 1I1SA 2WC2A 3FIWA 4NNJA 3SHFA 4ESFA 5M5YJ 1FNNA 1IN4A 4F3QA 3OSGA 4XRFA 2E7WA 4A3FJ 2JUGA 4R79A 2L54A 1BI2A 2CYYA 5KK1A 3KPHA 1OCCH 1V5EA 3GCMA 3C7JA 3S1RJ 4AYBN 2VN2A 2EIJH 1R1TA 4IO9F 1BIAA 1JTXA 2XSDC 2GOXB 2W7NA 2X85A 3SYTA 2H6CA 2NVXJ 2FF4A 4BEHB 1DP7P 2LD5A 3PQJA 1X3WB 3LSMA 3G2BA 3OYIA 2IA0A 3JRHA 1OMIA 2M9HA 1FWZA 3ZQLA 3KP4A 3V7RA 3CCRI 1WCMJ 1Y39A 2HYGD 2Q2EA 4I0BA 3AG1H 4UVCA 1MJAA 3BC8A 2VI6A 1GDTA 1U0JA 1LKXA 2CFOA 5LD2C 2ISZA 2ZNYA 4MHGA 4A3BJ 4KIBA 2VJ5A 4CH7A 2A6EF 2PJRB 2F5CA 3HOXJ 2ZMEB 1VQPI 3B6AA 1U8BA 4EM1A 4UB6C 1RNLA 3W2WA 3F8NA 1LJ9A 5LGUA 3F6OA 5F6FA 3S1NJ 2FSWA 2LVSA 3VYSB 1T8IA 5GTIC 3QAHA 4Y15A 3GWZA 1WQ2A 5B66C 1VQ7I 1EF4A 3CLQA 1TWCJ 2V6EA 1OQYA 1MD0A 2DMPA 2V7FA 2X4HA 5DD8A 5BQTA 1LFUP 3IWFA 3KX2A 3L9FA 2R7TA 4AU7A 4Y17A 3OR2C 4GYIA 1QZYA 2PG4A 2R5ZA 4ABZA 2FMYA 2OCEA 2TCTA 2VE8A 1IXSB 3JTHA 2LBFB 4WK8F 2D5VA 2HOTA 1V55H 2QF7A 3QWLA 3BTCA 1MH4A 3I55I 2E1MC 3R6SA 4W1UA 3JSPA 4M71A 4U7BA 4HPQA 4EMSA 2OZUA 2M1BA 3TQNA 5CKTA 3VSLA 1F43A 3V8LA 2NOJB 2OJED 3RTRA 4E7JA 1ZGAA 3ZMUA 3U9GA 5HNFA 2QZ8A 1BC7C 4A3LJ 4FASD 3SQNA 3F22A 3FK7A 5F64A 3R0JA 5IT3A 3BPVA 5JHFA 2ESNA 3TOBA 4LLLA 2K4JA 3RKYA 2P8TA 1ON1A 4XKBA 4LGWA 2FEZA 4BDYA 4Q47A 2E7XA 4B8XA 1MMGA 2YPRA 3HKZA 3PM1A 3CO6C 4BS9A 3N4MA 2KJBA 2ECCA 3QYEA 1B72A 4BE2A 1VNDA 2JVGA 4BQOA 4LIUA 1TQPA 4KIFA 3W6KB 3BG3A 2Y0SA 4C3JJ 3S3OA 2DU9A 2IW5A 1VQ8I 1IUYA 1FX7A 3M1CA 3HM5A 1MH3A 3M9AA 3L2UA 5LRRA 4WWCA 3T0YA 3TO9A 2X6OA 4GYGA 2R3SA 4TV7A 1HC8A 1TNSA 5F1RA 2LKSA 3PNVA 4M6XA 3ECHA 4DZPA 3ZMTA 2W84A 2X1DA 5D4SA 5LHIA 2LY1A 4Z2YA 3TEDA 2E2HJ 2YS9A 2B63J 2LREA 2LSOA 2OQGA 4FT8A 3J80Z 1AOYA 2DMTA 2VKEA 3HRUA 1MMDA 2Y31A 2XF7A 3KZIC 1WJFA 1ZK8A 1YW7A 4CZCA 2A61A 1DP3A 5FROA 2I8DA 2HXIA 3BT9A 3HUGA 1FMWA 2EFNA 4EJVA 4Y7NJ 3GXOA 1DPRA 3HC7A 1NHAA 4F91B 3U21A 2XB0X 5E3NA 1MGTA 1Y0NA 2Y75A 5JHUA 3GF2A 4LLNA 4XBFA 4PJ0C 4BQQA 1GVDA 4IKFA 4ZYGA 1O3SA 2BVMA 2ZKZA 4IHSA 4HV5A 2CUJA 1YFHA 1BBYA 4BE1A 4ZH4F 2EFQA 3IH3A 1VFCA 5FRMA 2Y9ZA 3EUHA 1VQKI 4NC6A 1X3ZB 2XGXA 3IUOA 3LA3A 5E1ZB 1XPXA 4ESJA 3OYMA 1Z21A 2VXDA 1YTYA 3ZOBA 1V54H 2O8KA 2A6TA 3FMRA 1FZPB 5F0CA 3M8FA 2MC4A 3OOUA 2VT3A 3VDXA 5J8FA 4G7OF 1YS7A 1EKEA 4YFNF 4A3IJ 3BY6A 2GXGA 4E7SA 2M3AA 1W7PB 3M8JA 5GAEJ 3BZKA 1R49A 4BYYA 2KHMA 3E3VA 4CGZA 4LIVA 2QBYB 5JVGF 5E17F 3CCUI 3E5QA 4UVAA 4BEHA 4RGUA 3JAMZ 1HW5A 1K83J 2F5DA 4I02A 1Y1WJ 1F4KA 4A93J 1IRZA 2GLOA 1QZEA 3BWGA 3ABLH 1IRXA 5LEJA 4LD5A 2X51A 5CYVA 4Q4ZF 1TQIA 1QGPA 4OAZA 4PSXA 1ZAOA 2CW7A 2VPLA 1XG1A 5EGOB 3GTLJ 2E36A 3DLLF 3OV8A 2CMPA 1D0XA 2QKMB 1KA8A 3K2AA 1FIAA 2GIVA 4U87A 1MMNA 3GLLA 4B3XA 1GXPA 4RAZA 3C2GA 5CVIA 2A68F 1G8XA 2AO9A 2MC3A 3E5XA 3WG9A 4UUTA 4PGHA 3IV5A 1WJAA 2DQRA 2P7VB 3IL2A 1XSVA 3K9TA 1OKRA 1T38A 1E3HA 2EH3A 4LMYA 1TT5B 3FXRA 2IS2A 2F2EA 3Q9SA 3TDUC 1FOKA 2O0YA 2VXZA 1B4AA 2XB5A 5DTDA 1I50J 2MABA 3BR1A 4DBQA 5LHHA 4S05A 1W0TA 4LG0B 2GWRA 3V4GA 3CP2A 4M6VA 2K4BA 2LBFA 1R58A 4HV6A 2RREA 3BCBA 4B4CA 3IWZA 4BAYA 3LQQA 2CQ7A 5E1WA 4XQFA 5DDGA 5HVQC 3GFLA 3HTSB 2QSGX 2CQXA 4PFPA 2GXAA 2Y2ZA 3L2RA 4EGZA 2DFEA 3VYTB 1ZYRF 2HWVA 2O03A 3EQLF 2ZXJA 2V1NA 3CF5F 3CDLA 1QU3A 5E20A 4CCNA 2WWYA 3KEOA 3ZN0A 4OIRF 4U0VA 3ECOA 2LY2A 1JT6A 3CUQC 4XLAA 3W3CA 5AIQA 3TBIA 4D1QA 2EFWA 4BXUA 3CDHA 4HLXA 4L9JA 3VEPA 5DUIA 1I3AA 3WU0A 1K79A 4FISA 1G59A 3G71I 4XORA 2ZBKA 1RKWA 3JW4A 4CSWA 4A3JJ 1BR1A 1FP2A 1LFPA 5KCMA 4G94A 1PP7U 3EUKL 2MYSA 4FTHA 1SFXA 3QU6A 3K70C 1QPIA 2F48A 3WGIA 4A5NA 2GA1A 2IGMA 3QPLA 4BQNA 2FRHA 5D6FA 4PJMA 5FLXK 1ZRCA 2DFHA 2K9QA 4KIGA 4AWXB 1DUXC 3RKWA 4ZYDA 1ZELA 3JCUC 4CXFA 4PJLA 3MQ0A 4I09A 3DQVC 4XN3A 4NUBA 3A0BC 2LTPA 4BACA 4NBQA 1H89C 3PFYA 1IW7F 2HDDA 3W2AA 1ETXA 2I10A 4XL9A 1HKTA 5IOZA 3P9IA 4N0BA 3GFJA 3D1NI 2FJ1A 3A4CA 5EG0B 1NK2P 5GTHC 5F08A 1U5TC 2DA1A 3BG7A 2DTRA 2JZYA 1U2WA 2ELJA 3AG3H 1KZHA 2V1DA 1BJAA 5IT9Z 4BHBA 4ENNA 1ETOA 2BVLA 4RMNA 3ERED 1ZR2A 1WH7A 1RUNA 3SXYA 1I6HJ 2CH0A 1SFKA 4XKVA 3I9V2 3LAPA 1BM9A 1PYVA 1Q1HA 2DA4A 2F4MB 4ZTFA 3H3UA 1S72I 2FBKA 5ICFA 3RIRA 2IGNA 5KAIC 1MSEC 4JOMA 3WTXC 3WTWC 3CC7I 1JKOC 3E1SA 3FF5A 3WE2A 5ICCA 1JKPC 2M0CA 4GCVA 2QSFX 2YUSA 5IPAA 3S1QJ 2X48A 1FBUA 4AC0A 1IC8A 1XD7A 2L2OA 4XK4A 3B02A 3CJTB 1ZLKA 1W7PD 3ISPA 4RB0A 3HIFA 2D2WA 2DPUA 2EZHA 3CLOA 3OYGA 3TP0A 2KRHA 4Z6YA 2RV8A 3ZQ7A 2DI3A 4LJZF 1MW7A 1S8NA 4KUMA 3ZQCA 4G12A 1KQ8A 3IP4B 2KIMA 3B73A 2PMZA 5BPDA 1J09A 2F5VA 2K9MA 4LITA 3HPHA 4UV9A 1W7PA 5L3BA 3EUAA 3O6BB 4B1RA 1FBQA 1P9QC 1Y6IA 4A3GJ 3LSHA 2CRGA 4HOBA 2P7CB 4Y13A 4D7NA 2R7RA 4XOPA 4RAGA 4M3DA 1XCBA 4C2MJ 1T2KA 2F5EA 1V4RA 2KIQA 3CZ6A 2HS5A 2HVRA 2ME6A 2AQEA 1ZG5A 1USSA 1IZ1A 2Q2EB 1CGPA 3JSOA 3ZCOA 3KEYA 3HOSA 2V1XA 1SFUA 3SDBA 2KMUA 4IHVA 4ETSA 1H9GA 3KP5A 4Q48A 3OSFA 2UZKA 3LSRA 3DFGA 4A2UA 3CO7C 1GUUA 3TW7A 1APLC 3DEUA 1U3EM 3DTIA 3IKVA 2FQ3A 4YG2F 3LMMA 3MZYA 3HGYA 2K3PA 2NOGA 2EFPA 1LVAA 1WFXA 5LGNA 4PJJA 4XKCA 4IQJA 5L3CA 1ETWA 2ZSHB 1YRNA 3OS2A 3Q9VA 2ZXIA 3VYUB 5FGMA 1MBFA 2DJIA 4D5CA 2XASA 2G7UA 2XPUA 2R5ZB 3ONQA 4HDUA 3OYBA 5D5UB 4HF2A 2KLOA 1OR7C 2K85A 4WF2A 3WGGA 1A31A 4JK1X 5FFXA 4AVZA 2JUCA 4QTRA 3OYHA 2IA1A 4I76A 2RN7A 3E0JB 4XRSA 5F27A 1DPUA 2UWMA 2JK3A 4OWRB 5GP9A 4V2GA 1W36D 2R5YA 3ZN1A 2MH2A 5E1XA 2BY0A 3Q3SA 3FXLA 1P4AA 4L9TA 3Q5FA 2H8RA 2C6YA 1YJ9I 2DMQA 3RYRA 4L5EA 2LKPA 4K2EA 3TP3A 4CYDA 2P6TA 3BTJA 2AS5F 1YYVA 3HSFA 3KZZA 2ELHA 2DN0A 1MMAA 4DOZA 2QEXI 3DU6A 1N25A 3BR3A 3T5XA 2H27A 3MFKA 2NXNB 4J19A 1BOBA 4H4KC 1IN8A 2ZJ2A 3OYCA 3MMYB 3JRIA 1Z91A 3I3LA 4EJOA 1GT0C 3FXKA 1B6AA 4UV8A 5M3FJ 2BW3B 1B72B 1R6RA 4XONA 4D9JA 3W6JB 2CW8A 1O3RA 1JKRC 2HOEA 3SJMA 4NC8A 1OYIA 1CQTA 2X1EA 2XAGA 4MTDA 3KEQA 1Y8RB 1TQMA 5E3OA 5TJJA 2M7BA 1E3OC 1U78A 2KDZA 1FY7A 3OIOA 4KJZA 3RCOA 2VIXA 3S93A 2GM4A 2DCEA 3N05A 3QU3A 1R23A 1OYWA 1TW2A 2PBIA 5BS6A 1FBSA 3PSFA 5DD4A 1SD5A 2QQBA 1HSJA 1TWFJ 1WHUA 2EB7A 2CJJA 3CCSI 1ZH5A 1Y1VJ 5HLIA 3T1BA 1JHHA 1JHFA 2P5VA 1PUEE 1MNEA 4G6TB 2MA3A 2M2EA 3SZPA 3DTKA 2GXBA 4BL0B 3RPQA 4HLYA 5L3GA 1SANA 2DW4A 1OFCX 5FKNA 3RZDJ 2DJNA 1L3LA 1P2FA 5CVUA 4HRIA 2Z16A 3KIOA 3DTEA 5CVVA 2L7FP 5CQGA 1R5HA 1LQ1A 4ZJZA 4PCQA 3WU1B 4AM3A 4DJAA 3S15J 3PUBA 1B9NA 3KP6A 3L2WA 4LFUA 1HBXG 3CCVI 1FLIA 1Z7UA 2VASA 3DWLE 2DA2A 3HOYJ 2L9RA 3B6CA 3QRFF 2VJ4A 2IT0A 4KMFA 5DM6F 2CV1A 4MIMA 2HU9A 2MLKA 1KONA 4F7ZA 5BMZA 1A36A 5J1UA 3IRRA 3IHUA 1IUFA 1KYZA 2E19A 1ETQA 3D5SC 2NVUB 4LB6B 3I4MJ 1T0FC 3A1YA 1BI3A 1H8AC 2MG4A 4G6DA 1XMAA 1K78B 2MGQA 3DPTA 2UUZA 3I56I 3FKJA 2PN6A 5D8KB 3K1PA 1UCRA 3A01A 4O6JA 3GX4X 2HGCA 1MBJA 4AIDA 4ZYEA 2K02A 1UZCA 1Z77A 3K4CA 2A69F 1D1CA 2GZWA 1PDNC 5C4XJ 4M3EA 1G3SA 3GFMA 2G9WA 2KZGA 4JX4A 4B43A 2V79A 1S7EA 1LEAA 4HX7A 5HOOA 2QWWA 1FYLA 3C1DA 5FB2A 2BY1A 1QVTA 5FD5A 3S3NA 3G73A 2N8GA 2GAUA 3I59B 4OIPF 2IXSA 2EA4A 2JT1A 1MIJA 2P5KA 5H6RA 2CFXA 4FQGA 4HYEA 1D3YA 1YHQI 3DU5A 1RR7A 4QPOA 1Z9CA 1RIOH 3JRCA 4CUGA 4I01A 4BH9A 4P9FA 1X1DA 2HEOA 2ELKA 3AG2H 2DFFA 1WRJA 2VKDA 5GAGJ 1UG0A 3BROA 3HB9A 2BE5F 4I98B 4MGRA 4KITB 2YX7A 1G6NA 3GTJJ 2DYRH 2ACJA 4WXHA 1XDSA 1AKHB 4CHUA 2OA4A 2ZCWA 4GFBA 1YW9A 2JPBA 2L5QA 2DFIA 3X2QH 1WWXA 1WJEA 2MD0A 2PX9A 5FLMJ 2QSHX 1QHGA 2MLGA 4P96A 2DPDA 4IRIA 3PUFA 2DOFA 1Z3XA 1ZG3A 2K27A 3MVPA 3O3KA 4ITVA 2LFBA 2Y30A 1L0OC 3JRAA 4CA0A 3L2VA 5HDNA 1O3QA 2YSRA 1O4XA 4FE7A 3F8CA 4M3BA 4UY8I 3CJQB 3GTQJ 2LF8A 3HTUA 3RSNA 3SDGA 3OYNA 4IHYA 3VPRA 5B1BH 3PQKA 3ZQFA 5L3DA 4XRSG 3VOEA 2PMUA 1I3QJ 4KN4X 1GXQA 1UELB 2A6HF 5F0FA 1BI0A 2OCCH 1H9TA 2CS3A 1RUOA 3BJOA 4IL6C 4I2OA 5EJCA 2ZFWA 1Z05A 4FX0A 3K1NA 3OYFA 3K10A 4CYCA 2BW3A 2RC4A 5J1RA 2AXTC 1V3FA 3FXQA 1YE9A 1BOAA 3OYEA 4RA2A 3IAM2 4C2TA 1OCRH 3WTUC 4A12A 1GLNA 4N4OB 2ZFUA 3GTOJ 5JFRA 5EF6A 1J5YA 1EH7A 1FMVA 4OIOF 3M7GA 1QRYA 2HFHA 4RAYA 2F5FA 4RDUA 1F1ZA 2DYSH 2J5PA 3GZNB 1TLHB 3HOTA 3E6BA 3CMEI 1RESA 1WJDA 2ME0A 5FKOA 1IG7A 5F04A 2PEXA 2VQHA 3V7SA 1QPMA 4ZZDA 3S1MJ 5M5WJ 4HNTA 2HTSA 5A2QK 4F93B 1A04A 2LP0A 3H5RA 4EJUA 2JRMA 1WVRA 2JMWA 3FBIB 1HKSA 3M3YJ 4M9SA 5K1YA 2H94A 2W57A 3EDPA 3J7AO 2OAZA 4LOCA 2MBFA 1A6IA 3I0TA 3GTMJ 3GTGJ 3ML6A 2E35A 2LR8A 1VQ6I 3JTGA 1PUFB 3F8BA 2L9NA 2LF7A 3HPGA 1IXCA 5EEAA 4IOCF 3UR3C 1J9IA 1G3TA 1T56A 5J6XA 3ZPLA 4QPQA 3G4SI 3S14J 4IF4A 1ZR4A 2XGEA 5E3MA 4N9HA 4ZYAA 1D5VA 1YX5A 3IAS2 2LNBA 2WB1A 2FD5A 4RM3A 3M1EA 1I27A 3FZVA 4HX8A 3FXMA 5C44J 2QVOA 1SD4A 4U0WA 4E7LA 2VKVA 4X6AJ 2QKLB 2M4KA 1SFOJ 3PIOF 3CMYA 3C2HA 2R92J 3G3ZA 1CF7B 2OUMA 1VF9A 3L00A 3LA7A 2VPRA 3L09A 2QCOA 1VZ0A 4ZTJA 2R7OA 3GZ5A 5DM7F 2QUFA 2VLAA 2OTJI 1R1VA 5LLQA 1K78A 3HRSA 3RJPA 4CCMA 2VODA 1UHWA 2O8XA 2ICWG 3CC4I 3ABTA 1QZZA 1KU9A 2WAEA 3OL4A 4IVNA 1FIPA 3FKIJ 3U2RA 3MEXA 2VJIA 2HNHA 1J7KA 3NAUA 3GTKJ 2HZDA 4B09A 4IRGA 1OCOH 1XN7A 3VODA 4HDVA 1F5TA 4JP0A 2YR2A 3LWFA 4IOAF 1R00A 3HRMA 4F92B 5IP9J 2FX0A 2M34A 1MDMA 3GTPJ 3QYBA 3LFKA 3M8EA 3G1LA 1W5CC 2WAQN 4UVBA 3WGHA 3I59A 1F9NA 1QO0D 1Q1VA 2WA0A 4PJNA 3HDDA 1ZKGA 4HQEA 1ZG1A 3DLAA 4RAFA 5DCMA 2DQLA 3Q0UA 2Y9YA 6PAXA 4B47A 1TWAJ 3I4NJ 5J4YA 1A6QA 3H5AA 2EJRA 2DOAA 1R4NB 4G8XA 2ZMEC 1JUMA 4PZJA 3ROUA 3N97A 1RKTA 2HXOA 4E7IA 4XIDA 1R5ID 1S7AA 2LY9A 3FWEA 4EVIA 1BJZA 2KQRA 3GLXA 4RGXA 4AIKA 5IOYA 3CJNA 1K61A 3K4MA 2P5LC 3ZMZA 4FX4A 1JXSA 3BR2A 1AWCA 4RB2C 1MBGA 1TT0A 5EZGA 4BQAA 3BG6A 4BY7J 4DYQA 3COAC 1AKHA 3WHCA 1TBXA 3OIPA 2D1HA 5DUKA 1YRNB 2P81A 2A07F 1ERDA 1DGWY 3TDZC 3EYIA 2CQNA 2M0MA 2V9VA 4Y52J 3VB2A 3GW2A 1X1BA 2W4SA 1ZGWA 2WTEA 1WJ5A 2VE9A 1RPWA 2K3FA 2BZTA 2A05A 1XSXA 4XSZF 3QP6A 1LB2A 3L2CA 1TW3A 1QQIA 1J2XA 3JRGA 2NS8A 2R5YB 4IZZA 5A2QZ 2R7QA 3SFZA 2V4JC 1JGGA 2ADUA 1SAXA 2DA3A 3MKWB 3HOVJ 1ODDA 4MLOA 3E97A 5E18F 1WH5A 3LA2A 3PIPF 5LEKA 1YW8A 1K6OA 1D0YA 2Z33A 1QA6A 2DODA 2L7ZA 1VQ4I 4BJ5C 1HF0A 4HA8A 2X1CA 4UXNA 2OQRA 5CVJA 1ENHA 3HHHA 1Z67A
chains in the Genus database with same CATH topology
4DYRA 4XRMA 3OSGA 3HGYA 4A3FJ 1F36A 2NOGA 1MSFC 1FJLA 2XGDA 1ETWA 2IBDA 1YRNA 3S1RJ 4AYBN 2LLKA 1MBFA 1JTXA 4D5CA 1A5JA 2XPUA 2XSDC 2HI3A 2R5ZB 2RAEA 5M5XJ 2EQRA 2NVXJ 4JYKA 1IDZA 3BTIA 1JJ6C 4QTRA 2LD5A 1OCTC 4I76A 4XRSA 1BW6A 3JRHA 2M9HA 5F27A 1XS9A 2JK3A 3ZQLA 1GV2A 1WCMJ 5GP9A 4V2GA 5IYBJ 2R5YA 4MO7A 4RBOA 5F0HA 2VI6A 5FJ8J 3Q3SA 1GDTA 2NVYJ 2H8RA 9ANTA 4A3BJ 2NVTJ 2DMQA 3WHBA 2CU7A 5IP6A 4L5EA 3TP3A 3HOXJ 5K7HA 4FE4A 3BTJA 2JA7J 2O9LA 4D7MA 3B6AA 1U8BA 2DN0A 3BR3A 1B8IB 3S1NJ 2LVSA 4J19A 3CQZJ 2XPWA 1PUFA 1EF4A 4IHWA 1UG2A 1WGXA 1TWCJ 3JRIA 2DMPA 3HKZN 1UHSA 1GT0C 1JUSA 1LFUP 5M3FJ 1B72B 4DW6A 4M3FA 1JKRC 3SJMA 1MBEA 3IH2A 1CQTA 2R5ZA 4ABZA 2TCTA 1FEXA 1HLVA 2D5VA 5E3OA 3H3VK 2HOTA 2QF7A 1E3OC 3BTCA 1U78A 1MH4A 2KDZA 3OIOA 2G0EA 2GM4A 4W1UA 2CUFA 2TRTA 3BG5A 2L7MP 3IH4A 5JLXA 3RKQA 3S16J 1F43A 2FQ4A 1TWFJ 2CJJA 5M3MJ 1Y1VJ 3ZQHA 3A01B 4A3LJ 3Q0WA 4BBRJ 2EZLA 2HOSA 3FK7A 2M2EA 1IDYA 1SANA 1HCRA 1UMQA 3QQAA 4BXXJ 2OF7A 1OFCX 5FKNA 3RZDJ 2DA5A 2DJNA 1B8IA 5J3LA 1H88C 2L7FP 3JRBA 3PM1A 5BNGA 3S15J 2ECCA 1DU6A 3LNQA 1B72A 2IAIA 4JX5A 1VNDA 2COBA 2LKXA 2DA2A 3HOYJ 3BG3A 2L9RA 4C3JJ 3B6CA 4MIMA 1W0UA 2JJ7A 3LSJA 2XPVA 3HM5A 5J1UA 1MH3A 1IUFA 1AU7A 2X6OA 1IGNA 2E19A 1ETQA 3I4MJ 3C2BA 1GV5A 2DMUA 1H8AC 3HGGA 2MG4A 2E2IJ 4DZPA 2ID3A 1NTCA 2MGQA 1QVUA 1BW5A 2E2HJ 5FKMA 3TEDA 2YS9A 2B63J 3A01A 4IEJA 2DMTA 2EZIA 2VKEA 1XC5A 2Y31A 3S17J 3JRDA 1MBJA 1ZK8A 3CCYA 1Z77A 3BT9A 2HXIA 3MKLA 4Y7NJ 3HOWJ 5JLWA 5C4XJ 4M3EA 4IHXA 4JX4A 5FKKA 1S7EA 5E3NA 2XB0X 4C3IJ 3S2DJ 1X58A 1MBHA 1QVTA 1GVDA 2N8GA 3LSPA 5DS9A 2HYJA 1ETKA 3ZQGA 3QPSA 3FK6A 1RR7A 3IH3A 2X9DA 3JRCA 1VFCA 2Y9ZA 4QIWN 1ZTRA 4M3GA 1JT0A 2ELKA 3LOCA 4UUSB 4HNVA 5K7ZA 2R0QC 1TWGJ 3ZOBA 3HB9A 2O8KA 3GTJJ 5F0CA 3JREA 3OOUA 2IEKA 2AHQA 4XICA 5F1JA 1AKHB 4CYCB 4A3IJ 4I6ZA 4D5FA 4GFBA 1JTYA 2ECBA 2DTZA 5FLMJ 2Y0SN 2OPTA 3LSGA 3PO2J 1R9TJ 2NVQJ 4B3AA 1ORKA 4FCYA 3MVPA 2LFBA 2YU9J 2Y30A 1K83J 1Y1WJ 1FTZA 3BG9A 4A93J 1IRZA 2GLOA 3JRAA 2DA6A 2VUMJ 1WPKA 3Q0VA 1LFBA 3JRFA 1FTTA 2EZKA 2WV1A 1O4XA 4FE7A 1G2HA 1XG1A 4M3BA 5EGOB 3MN2A 3GTLJ 3GTQJ 3SDGA 5EZHA 4IHYA 1IV6A 2JWTA 4W97A 3VPRA 1NK3P 3HOZJ 3K2AA 1DU0A 3G1OA 1FIAA 4JX6A 3ZQFA 4XRSG 4A3MJ 4AUXA 1I3QJ 1TWHJ 4UUSA 2AO9A 3O8GA 4UUTA 5F0FA 3IV5A 1ZQ3P 2LK2A 2MSYA 5EDNA 2EH3A 4BKXA 5E3LA 1ETYA 1ETVA 4CYCA 5J1RA 2XB5A 5EYRA 5DTDA 1I50J 3BR1A 4A3CJ 2WB1N 4MFDA 1Z0XA 1W0TA 3GTOJ 2DA7A 4M6VA 5EF6A 3M4OJ 2K9SA 1QRYA 4DYCA 4B4CA 4RDUA 4C3HJ 2JA8J 4A3DJ 5GPAA 3HBLA 1RESA 3FISA 3G1MA 1HOMA 3HEFA 2ME0A 5FKOA 1IG7A 5F04A 2CQXA 3SFIA 2Y2ZA 3S1MJ 5M5WJ 5EGOA 2K9NA 5IYCJ 1HDDC 2LP0A 3CDLA 2JMWA 1U9OA 2ZB9A 3M3YJ 1JT6A 2K40A 1IJWC 4LOCA 4BY1J 3GTMJ 1A6IA 3GTGJ 1OJLA 2LR8A 2CQQA 1LE8B 4FISA 1PUFB 2R93J 5EEAA 1RKWA 3PO3J 4A3JJ 1T56A 2XRLA 1TC3C 3S14J 3E7LA 4A69C 3BR6A 5GPCA 1ZR4A 2XGEA 5E3MA 2ID6A 4FTHA 5IP7J 1D5YA 2FD5A 1QPIA 1HDPA 2HQ5A 3QPLA 2L0KA 4A3KJ 5C44J 4QSHA 2CUEA 3BQYA 2VKVA 4X6AJ 4DZJA 2K9QA 2JN6A 3A02A 1SFOJ 3S2HJ 2R92J 3CMYA 3H0GJ 1P7IA 1VF9A 3DEWA 2VPRA 5K7FA 2QCOA 1T33A 2R7ZJ 1BA5A 1ITYA 3K7AJ 2LTPA 3RZOJ 1H89C 3BR0A 2HDDA 1ETXA 2I10A 2MW8A 2JA5J 3F0CA 2GBYA 5IOZA 4X1EA 3RQIA 3D1NI 2FJ1A 5EG0B 1NK2P 1OCPA 1FIPA 3FKIJ 3BTLA 1RETA 2PMZN 5F08A 3HOUJ 3NAUA 3GTKJ 2DA1A 5C4JJ 3UKGA 1MBKA 3O8HA 4JP0A 4V2FA 1JJ8C 1LE8A 1ETOA 5IP9J 2EBIA 2FX0A 2M34A 1ZR2A 3GTPJ 1WH7A 1I6HJ 2HOAA 3G1LA 1AHDP 2WAQN 1WI3A 3BQZA 2DA4A 3NARA 1Q1VA 3HDDA 1ZKGA 5IYDJ 1X2MA 3Q0UA 2Y9YA 2JA6J 1MSEC 2DMNA 3A03A 1TWAJ 3I4NJ 2XGCA 3BR5A 1JKOC 1JUMA 1RKTA 2HXOA 1JKPC 4XIDA 2M0CA 2LY9A 2YUSA 1BJZA 5IPAA 2W48A 3S1QJ 1P7JA 2X48A 5IOYA 4AC0A 1IC8A 3DCFA 1K61A 1BL0A 4XK4A 5HODA 3BR2A 3W6VA 1MBGA 2EZHA 3ZQIA 5EZGA 3TP0A 2E2JJ 5C3EJ 4BY7J 4DYQA 3JR9A 1X2NA 2E1OA 3ZQCA 4A3EJ 1AKHA 4BBSJ 3WHCA 4G12A 4EEFG 5EG0A 2H1KA 1MNMC 1YRNB 2M8GX 4NDLA 2P81A 4B1RA 4Y52J 3GBGA 4A3GJ 1ZGWA 2CRGA 4D7NA 4M3DA 4C2MJ 1RPWA 5J1YA 2KT0A 2ME6A 3JRGA 2NS8A 2O7OA 4MFEA 2R5YB 1JGGA 2DA3A 3HOVJ 4MLOA 1VI0A 4IHVA 1WH5A 1JUPA 5FLVA 3TW6A 2NS7A 3L1PA 2L7ZA 4S0HB 3OSFA 3LSRA 1HF0A 1POGA 1JKQC 1GUUA 1ENHA 1U9NA 3FIWA 3TW7A 5FKLA 1APLC 5M5YJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYR A;  4XRM A;  3OSG A;  3HGY A;  4A3F J;  1F36 A;  2NOG A;  1MSF C;  1FJL A;  2XGD A;  1ETW A;  2IBD A;  1YRN A;  3S1R J;  4AYB N;  2LLK A;  1MBF A;  1JTX A;  4D5C A;  1A5J A;  2XPU A;  2XSD C;  2HI3 A;  2R5Z B;  2RAE A;  5M5X J;  2EQR A;  2NVX J;  4JYK A;  1IDZ A;  3BTI A;  1JJ6 C;  4QTR A;  2LD5 A;  1OCT C;  4I76 A;  4XRS A;  1BW6 A;  3JRH A;  2M9H A;  5F27 A;  1XS9 A;  2JK3 A;  3ZQL A;  1GV2 A;  1WCM J;  5GP9 A;  4V2G A;  5IYB J;  2R5Y A;  4MO7 A;  4RBO A;  5F0H A;  2VI6 A;  5FJ8 J;  3Q3S A;  1GDT A;  2NVY J;  2H8R A;  9ANT A;  4A3B J;  2NVT J;  2DMQ A;  3WHB A;  2CU7 A;  5IP6 A;  4L5E A;  3TP3 A;  3HOX J;  5K7H A;  4FE4 A;  3BTJ A;  2JA7 J;  2O9L A;  4D7M A;  3B6A A;  1U8B A;  2DN0 A;  3BR3 A;  1B8I B;  3S1N J;  2LVS A;  4J19 A;  3CQZ J;  2XPW A;  1PUF A;  1EF4 A;  4IHW A;  1UG2 A;  1WGX A;  1TWC J;  3JRI A;  2DMP A;  3HKZ N;  1UHS A;  1GT0 C;  1JUS A;  1LFU P;  5M3F J;  1B72 B;  4DW6 A;  4M3F A;  1JKR C;  3SJM A;  1MBE A;  3IH2 A;  1CQT A;  2R5Z A;  4ABZ A;  2TCT A;  1FEX A;  1HLV A;  2D5V A;  5E3O A;  3H3V K;  2HOT A;  2QF7 A;  1E3O C;  3BTC A;  1U78 A;  1MH4 A;  2KDZ A;  3OIO A;  2G0E A;  2GM4 A;  4W1U A;  2CUF A;  2TRT A;  3BG5 A;  2L7M P;  3IH4 A;  5JLX A;  3RKQ A;  3S16 J;  1F43 A;  2FQ4 A;  1TWF J;  2CJJ A;  5M3M J;  1Y1V J;  3ZQH A;  3A01 B;  4A3L J;  3Q0W A;  4BBR J;  2EZL A;  2HOS A;  3FK7 A;  2M2E A;  1IDY A;  1SAN A;  1HCR A;  1UMQ A;  3QQA A;  4BXX J;  2OF7 A;  1OFC X;  5FKN A;  3RZD J;  2DA5 A;  2DJN A;  1B8I A;  5J3L A;  1H88 C;  2L7F P;  3JRB A;  3PM1 A;  5BNG A;  3S15 J;  2ECC A;  1DU6 A;  3LNQ A;  1B72 A;  2IAI A;  4JX5 A;  1VND A;  2COB A;  2LKX A;  2DA2 A;  3HOY J;  3BG3 A;  2L9R A;  4C3J J;  3B6C A;  4MIM A;  1W0U A;  2JJ7 A;  3LSJ A;  2XPV A;  3HM5 A;  5J1U A;  1MH3 A;  1IUF A;  1AU7 A;  2X6O A;  1IGN A;  2E19 A;  1ETQ A;  3I4M J;  3C2B A;  1GV5 A;  2DMU A;  1H8A C;  3HGG A;  2MG4 A;  2E2I J;  4DZP A;  2ID3 A;  1NTC A;  2MGQ A;  1QVU A;  1BW5 A;  2E2H J;  5FKM A;  3TED A;  2YS9 A;  2B63 J;  3A01 A;  4IEJ A;  2DMT A;  2EZI A;  2VKE A;  1XC5 A;  2Y31 A;  3S17 J;  3JRD A;  1MBJ A;  1ZK8 A;  3CCY A;  1Z77 A;  3BT9 A;  2HXI A;  3MKL A;  4Y7N J;  3HOW J;  5JLW A;  5C4X J;  4M3E A;  4IHX A;  4JX4 A;  5FKK A;  1S7E A;  5E3N A;  2XB0 X;  4C3I J;  3S2D J;  1X58 A;  1MBH A;  1QVT A;  1GVD A;  2N8G A;  3LSP A;  5DS9 A;  2HYJ A;  1ETK A;  3ZQG A;  3QPS A;  3FK6 A;  1RR7 A;  3IH3 A;  2X9D A;  3JRC A;  1VFC A;  2Y9Z A;  4QIW N;  1ZTR A;  4M3G A;  1JT0 A;  2ELK A;  3LOC A;  4UUS B;  4HNV A;  5K7Z A;  2R0Q C;  1TWG J;  3ZOB A;  3HB9 A;  2O8K A;  3GTJ J;  5F0C A;  3JRE A;  3OOU A;  2IEK A;  2AHQ A;  4XIC A;  5F1J A;  1AKH B;  4CYC B;  4A3I J;  4I6Z A;  4D5F A;  4GFB A;  1JTY A;  2ECB A;  2DTZ A;  5FLM J;  2Y0S N;  2OPT A;  3LSG A;  3PO2 J;  1R9T J;  2NVQ J;  4B3A A;  1ORK A;  4FCY A;  3MVP A;  2LFB A;  2YU9 J;  2Y30 A;  1K83 J;  1Y1W J;  1FTZ A;  3BG9 A;  4A93 J;  1IRZ A;  2GLO A;  3JRA A;  2DA6 A;  2VUM J;  1WPK A;  3Q0V A;  1LFB A;  3JRF A;  1FTT A;  2EZK A;  2WV1 A;  1O4X A;  4FE7 A;  1G2H A;  1XG1 A;  4M3B A;  5EGO B;  3MN2 A;  3GTL J;  3GTQ J;  3SDG A;  5EZH A;  4IHY A;  1IV6 A;  2JWT A;  4W97 A;  3VPR A;  1NK3 P;  3HOZ J;  3K2A A;  1DU0 A;  3G1O A;  1FIA A;  4JX6 A;  3ZQF A;  4XRS G;  4A3M J;  4AUX A;  1I3Q J;  1TWH J;  4UUS A;  2AO9 A;  3O8G A;  4UUT A;  5F0F A;  3IV5 A;  1ZQ3 P;  2LK2 A;  2MSY A;  5EDN A;  2EH3 A;  4BKX A;  5E3L A;  1ETY A;  1ETV A;  4CYC A;  5J1R A;  2XB5 A;  5EYR A;  5DTD A;  1I50 J;  3BR1 A;  4A3C J;  2WB1 N;  4MFD A;  1Z0X A;  1W0T A;  3GTO J;  2DA7 A;  4M6V A;  5EF6 A;  3M4O J;  2K9S A;  1QRY A;  4DYC A;  4B4C A;  4RDU A;  4C3H J;  2JA8 J;  4A3D J;  5GPA A;  3HBL A;  1RES A;  3FIS A;  3G1M A;  1HOM A;  3HEF A;  2ME0 A;  5FKO A;  1IG7 A;  5F04 A;  2CQX A;  3SFI A;  2Y2Z A;  3S1M J;  5M5W J;  5EGO A;  2K9N A;  5IYC J;  1HDD C;  2LP0 A;  3CDL A;  2JMW A;  1U9O A;  2ZB9 A;  3M3Y J;  1JT6 A;  2K40 A;  1IJW C;  4LOC A;  4BY1 J;  3GTM J;  1A6I A;  3GTG J;  1OJL A;  2LR8 A;  2CQQ A;  1LE8 B;  4FIS A;  1PUF B;  2R93 J;  5EEA A;  1RKW A;  3PO3 J;  4A3J J;  1T56 A;  2XRL A;  1TC3 C;  3S14 J;  3E7L A;  4A69 C;  3BR6 A;  5GPC A;  1ZR4 A;  2XGE A;  5E3M A;  2ID6 A;  4FTH A;  5IP7 J;  1D5Y A;  2FD5 A;  1QPI A;  1HDP A;  2HQ5 A;  3QPL A;  2L0K A;  4A3K J;  5C44 J;  4QSH A;  2CUE A;  3BQY A;  2VKV A;  4X6A J;  4DZJ A;  2K9Q A;  2JN6 A;  3A02 A;  1SFO J;  3S2H J;  2R92 J;  3CMY A;  3H0G J;  1P7I A;  1VF9 A;  3DEW A;  2VPR A;  5K7F A;  2QCO A;  1T33 A;  2R7Z J;  1BA5 A;  1ITY A;  3K7A J;  2LTP A;  3RZO J;  1H89 C;  3BR0 A;  2HDD A;  1ETX A;  2I10 A;  2MW8 A;  2JA5 J;  3F0C A;  2GBY A;  5IOZ A;  4X1E A;  3RQI A;  3D1N I;  2FJ1 A;  5EG0 B;  1NK2 P;  1OCP A;  1FIP A;  3FKI J;  3BTL A;  1RET A;  2PMZ N;  5F08 A;  3HOU J;  3NAU A;  3GTK J;  2DA1 A;  5C4J J;  3UKG A;  1MBK A;  3O8H A;  4JP0 A;  4V2F A;  1JJ8 C;  1LE8 A;  1ETO A;  5IP9 J;  2EBI A;  2FX0 A;  2M34 A;  1ZR2 A;  3GTP J;  1WH7 A;  1I6H J;  2HOA A;  3G1L A;  1AHD P;  2WAQ N;  1WI3 A;  3BQZ A;  2DA4 A;  3NAR A;  1Q1V A;  3HDD A;  1ZKG A;  5IYD J;  1X2M A;  3Q0U A;  2Y9Y A;  2JA6 J;  1MSE C;  2DMN A;  3A03 A;  1TWA J;  3I4N J;  2XGC A;  3BR5 A;  1JKO C;  1JUM A;  1RKT A;  2HXO A;  1JKP C;  4XID A;  2M0C A;  2LY9 A;  2YUS A;  1BJZ A;  5IPA A;  2W48 A;  3S1Q J;  1P7J A;  2X48 A;  5IOY A;  4AC0 A;  1IC8 A;  3DCF A;  1K61 A;  1BL0 A;  4XK4 A;  5HOD A;  3BR2 A;  3W6V A;  1MBG A;  2EZH A;  3ZQI A;  5EZG A;  3TP0 A;  2E2J J;  5C3E J;  4BY7 J;  4DYQ A;  3JR9 A;  1X2N A;  2E1O A;  3ZQC A;  4A3E J;  1AKH A;  4BBS J;  3WHC A;  4G12 A;  4EEF G;  5EG0 A;  2H1K A;  1MNM C;  1YRN B;  2M8G X;  4NDL A;  2P81 A;  4B1R A;  4Y52 J;  3GBG A;  4A3G J;  1ZGW A;  2CRG A;  4D7N A;  4M3D A;  4C2M J;  1RPW A;  5J1Y A;  2KT0 A;  2ME6 A;  3JRG A;  2NS8 A;  2O7O A;  4MFE A;  2R5Y B;  1JGG A;  2DA3 A;  3HOV J;  4MLO A;  1VI0 A;  4IHV A;  1WH5 A;  1JUP A;  5FLV A;  3TW6 A;  2NS7 A;  3L1P A;  2L7Z A;  4S0H B;  3OSF A;  3LSR A;  1HF0 A;  1POG A;  1JKQ C;  1GUU A;  1ENH A;  1U9N A;  3FIW A;  3TW7 A;  5FKL A;  1APL C;  5M5Y J; 
#chains in the Genus database with same CATH topology
 4DYR A;  1RC9 A;  2VOO A;  2FE3 A;  4JQF A;  2P6S A;  3KYD B;  1EV7 A;  1KYW A;  4HW0 A;  1SAU A;  4P9U A;  4KT5 C;  2Z1D A;  1FJL A;  1R4M B;  4M9Z A;  2RNJ A;  4BDZ A;  2IBD A;  5JVT A;  1QNT A;  2LLK A;  2VT2 A;  4BJ6 C;  3CUQ A;  2Y69 H;  3PNT A;  4L5J A;  5TIS C;  3WTZ A;  5LFA A;  2Z9O A;  3OL3 A;  4HX4 A;  3K69 A;  4JYK A;  3K70 D;  4ESB A;  5ILV A;  3BTI A;  1JJ6 C;  1OCT C;  2E1N A;  3KET A;  2X0L A;  2PI0 A;  1BW6 A;  2W24 A;  1GV2 A;  1MJB A;  1EA3 A;  1Z3Y A;  2XHK A;  5E8I A;  4MO7 A;  1W1W E;  5J47 A;  2ZSI B;  5F0H A;  5FJ8 J;  3R60 A;  3CJR B;  2NVY J;  3VYR B;  9ANT A;  3R61 A;  2NVT J;  4WXD A;  3WHB A;  5IP6 A;  2FXA A;  4FE4 A;  2O9L A;  2FA5 A;  1K4T A;  1S9H A;  3I54 A;  4KDP A;  3HXL A;  1OIS A;  2QEN A;  4WCG A;  5J40 A;  1D1B A;  1SMT A;  1BR2 A;  3J81 K;  1PUF A;  5DYM A;  1GHC A;  4PFO A;  4IHW A;  4B48 A;  1WGX A;  3HKZ N;  2CSO A;  1YQA A;  4MEX F;  1JUS A;  4P1W A;  1ON2 A;  2KIU A;  3V42 A;  4AYB A;  4EV0 A;  1TZL A;  2NRA C;  2QA4 I;  4AVP A;  1MBE A;  2VBZ A;  3DV8 A;  1U5T A;  1FEX A;  2B7E A;  3H3V K;  2GA2 A;  3WTY C;  4HBL A;  1SD6 A;  3WU2 C;  1CF7 A;  1IXR C;  4BUP A;  2NYX A;  2QGU A;  1HXD A;  4BGD A;  4OOI A;  3BG5 A;  3VFZ A;  1TTY A;  5JLX A;  1HW1 A;  5CPR B;  5HNH A;  2JVH A;  3S16 J;  2VC1 A;  1ZRF A;  1RR8 C;  1OLT A;  3A01 B;  2KL4 A;  2CV2 A;  3Q0W A;  2EIL H;  1K6Y A;  2V9P A;  4BBR J;  2EZL A;  1MND A;  4IQ4 A;  5D4R A;  4E7H A;  3V7C A;  2HOS A;  1Z6T A;  2XC7 A;  2WY8 Q;  3AKZ A;  1YLF A;  2D45 A;  2CUZ A;  2FBI A;  3TO7 A;  1HCR A;  1UMQ A;  4I0A A;  1BI1 A;  2DK5 A;  2X6Y A;  1B8I A;  5J3L A;  5DV5 A;  3CMA I;  1H88 C;  2A5Y B;  3T8R A;  2FU4 A;  3JRB A;  2ZNZ A;  5TGT A;  2K86 A;  2LC2 A;  4LB5 A;  1JE8 A;  4KIS A;  3QOP A;  1ZN2 A;  3S8P A;  2RGV A;  2R7W A;  2MFZ A;  3DKY A;  2B9S A;  3NEU A;  1T6S A;  1P6R A;  2X6X A;  3P9C A;  2M7A A;  3L2Q A;  1MJ9 A;  2EPF A;  4LG3 A;  3K6G A;  4ENK A;  2JJ7 A;  5FRN A;  3LSJ A;  1YOV B;  2XPV A;  1EJ9 A;  3CCE I;  3H92 A;  4XN0 A;  5BOX A;  3E6D A;  3TL4 X;  3L7W A;  4A0Z A;  3J7A Y;  3H9G A;  1KU3 A;  2WV0 A;  4FHT A;  4BNC A;  2ID3 A;  1NTC A;  2XF5 A;  3DBR B;  4M74 A;  1YG2 A;  5FKM A;  5JI6 A;  4U0Y A;  3QPH A;  4UUV A;  3J7Z I;  2HKX A;  3DP7 A;  2EZI A;  2V9K A;  3JRD A;  5HDK A;  1XB4 A;  4NQW B;  5FLX Z;  2E60 A;  2E5N A;  1WSU A;  4II2 A;  3LSI A;  2ZJQ F;  3HOW J;  2VL8 A;  2MD5 A;  4Y33 A;  5LRS A;  5JLW A;  2P0W A;  4IHX A;  5FKK A;  5FFZ A;  3H36 A;  3I4P A;  4C3I J;  5ILS A;  1G3Y A;  2DT7 B;  3SEZ A;  2IRF G;  1MBH A;  3CUO A;  2M4G A;  2FML A;  3G6E I;  2FNA A;  5DS9 A;  4L0Z B;  5HS9 A;  2ZJR F;  1H0M A;  5AON A;  1A35 A;  3ABU A;  3QPS A;  2KJC A;  2H1L A;  4E70 A;  1VQ5 I;  1UB9 A;  4XKW A;  2X9D A;  3KYC B;  1XGO A;  1ZTR A;  1Y8Q B;  2KDO A;  1XDU A;  1OR7 A;  1K4S A;  1R1U A;  3QYF A;  1HA8 A;  4NHJ A;  2E1M B;  3LOC A;  1U6G A;  2CO5 A;  5HLT A;  5K7Z A;  1TWG J;  2QYO A;  5ICG A;  3OYK A;  4P5O A;  3NWS A;  4YIR X;  1FC3 A;  2STW A;  3F72 A;  2GIZ A;  3JRE A;  2R4G A;  4I99 C;  1Y0U A;  2HDW A;  2IEK A;  2MH9 A;  5F1J A;  2FOW A;  4CYC B;  3AFH A;  1JTY A;  3F8M A;  4NB5 A;  2BGC A;  2ECB A;  5ERI A;  3SZT A;  1S29 A;  1R9T J;  1B9M A;  1N75 A;  4B3A A;  4UHT A;  1ORK A;  4GGG A;  2UV1 A;  2W1O A;  4FCY A;  1BR4 A;  1FYM A;  2NS0 A;  4L9V A;  4IJA A;  5D5V B;  1BN5 A;  1FTZ A;  3BG9 A;  1V5F A;  3KP7 A;  1WPK A;  1FT9 A;  3Q0V A;  1PVE A;  4A6E A;  2WV1 A;  2TDX A;  1G2H A;  3TOA A;  4V19 K;  2H8W A;  2OU2 A;  2X6W A;  3SZG A;  2KKO A;  2G7H A;  1KQ9 A;  3KP2 A;  1IV6 A;  2JWT A;  4PGG A;  1ZRD A;  3HOZ J;  3LQR A;  4JX6 A;  3WTV C;  1W5T A;  2NNY A;  3FHZ A;  1V5G A;  1LDD A;  4M73 A;  4UUS A;  1ZQ3 P;  3LAJ A;  2LK2 A;  1EH8 A;  2MSY A;  5EDN A;  3GUD A;  1M1E B;  4BKX A;  2ZO4 A;  5E3L A;  1ETY A;  4P55 A;  3AG4 H;  1ETV A;  2HVQ A;  2XSJ C;  3HZJ A;  2DAO A;  4HG2 A;  5EYR A;  3HSE A;  2COM A;  1G4D A;  2IS1 A;  4MFD A;  1SVL A;  2XAJ A;  2ZC2 A;  2XAF A;  4XLE A;  3M4O J;  3D5R C;  4QWQ A;  4C3H J;  4OAY A;  2M45 A;  2JA8 J;  3ZGK A;  5GPA A;  3R0A A;  2BHY A;  2XAH A;  3G1M A;  3HEF A;  4KIC A;  4Y3O A;  2H6B A;  3RI4 A;  5GAD J;  3E6C C;  5AIP A;  4I7H A;  3F3X A;  4CO8 A;  1HDD C;  1PJR A;  1IF1 A;  3R4K A;  4II3 A;  5J4V A;  5H6Q A;  3TO6 A;  2D1V A;  3LFU A;  1KGS A;  3CES A;  5D5X B;  1IJW C;  3I71 A;  4M72 A;  1O7L A;  1JGS A;  3GFI A;  2VKH A;  3CP8 A;  4KT6 A;  2VBW A;  4LLG F;  1MDM B;  2F6C A;  1T0F A;  2F4I A;  2LH9 A;  2XRL A;  4IPA A;  2JTV A;  5HDG A;  3CC2 I;  2ID6 A;  3OS0 A;  1D5Y A;  2XKP A;  3CCJ I;  3J80 K;  4L5I A;  1I6X A;  1HDP A;  1YX3 A;  4U88 A;  1FOW A;  5DCM B;  3MKY B;  2L0K A;  4H0E A;  4Q5S F;  4QSH A;  1YIT I;  2CUE A;  3A0H C;  3I64 A;  3BQY A;  4N9I A;  1TL8 A;  5B5E C;  2JN6 A;  3OMY A;  3C3W A;  1Z7L A;  3S2H J;  3H1C A;  4AD9 A;  2NNN A;  4L9N A;  4OIQ F;  5K7F A;  3ZRG A;  2XUB A;  3K7A J;  1DGR M;  3CTA A;  2EIN H;  2Y0M A;  3I53 A;  2MW8 A;  3F0C A;  1I1G A;  2GBY A;  4U7D A;  1E17 A;  3RQI A;  1VQM I;  3AL0 C;  1HST A;  2KRC A;  3TMO A;  4CZZ A;  3BTL A;  5GAH J;  1RET A;  2PMZ N;  3OR1 C;  4GXO A;  2R7X A;  2FUG 2;  1MMS A;  3BLY A;  2KIF A;  4DGW B;  4NQW A;  4RB1 A;  2DXI A;  5C4J J;  1MBK A;  1D8J A;  3O8H A;  4BU2 A;  1DQU A;  3HSR A;  2BY3 A;  3RDI A;  1JJ8 C;  3H35 A;  2GOM A;  1LE8 A;  2EWN A;  3GVA A;  3EPZ A;  5HLH A;  3BZC A;  3FMS A;  1C0W A;  1B59 A;  1KQ0 A;  2HOA A;  3FMQ A;  1LNW A;  2HQN A;  1XGN A;  3FXJ A;  3DPU A;  3EYY A;  1WI3 A;  4C2U A;  2O3F A;  4EQQ A;  2LDU A;  5KVR A;  4MEY F;  2XRN A;  2VON A;  1X2M A;  1R71 A;  1HKQ A;  3K4B A;  3NRV A;  3BR5 A;  3TGN A;  1JI8 A;  4ZDP A;  2V1U A;  1BIB A;  5D6E A;  4FET A;  2H09 A;  3S32 A;  1P92 A;  2W48 A;  1UST A;  3KE2 A;  1P7J A;  3JAM K;  3E5U A;  2HQR A;  1WJC A;  1HW2 A;  1BL0 A;  3WE3 A;  4OMY A;  3W6V A;  2EK5 A;  3ZQI A;  2QQ8 A;  5HS8 A;  3LSK A;  2KPM A;  4XLP F;  3MWM A;  1W4M A;  4HF1 A;  3ZXS A;  3ZMD A;  3JR9 A;  2LG4 A;  1E3P A;  1D0Z A;  3DBL B;  4A3E J;  1LVK A;  2H1K A;  1RRJ A;  4KYW A;  2EIK H;  3RQ4 A;  2BBY A;  4HSR A;  2M8G X;  4NDL A;  2OBP A;  4A5M A;  4B44 A;  2R7S A;  4O5V A;  1ZAR A;  1TNT A;  2EFO A;  4KMU X;  1Z6R A;  2ISY A;  3CUQ B;  3D5L A;  3WG7 H;  2AXL A;  2L02 A;  2Q1Z B;  4YII A;  2BYV E;  2DT5 A;  1O7F A;  2KZV A;  4LK1 F;  5J1Y A;  3F8F A;  3BPX A;  4ANJ A;  2HZT A;  4XLN F;  2XRO A;  3ZP5 A;  1TP4 A;  3LL7 A;  2KIS A;  1IO2 A;  4EGY A;  3FX3 A;  3P7N A;  5CLS A;  4C9Y A;  1X1C A;  1P4X A;  2K9L A;  5FLV A;  2OD5 A;  3O2P E;  3OWT A;  3F6V A;  1ZGJ A;  2M87 A;  4XOT A;  4JBA A;  3RKX A;  3L1P A;  3K4K A;  3FHN A;  1POG A;  1X3U A;  1JKQ C;  1U9N A;  3ZR8 X;  5FKL A;  4XRM A;  4YEJ A;  3PFI A;  5CQE A;  2V26 A;  4G7H F;  4YEL A;  1F36 A;  2HQA A;  2XIG A;  4IRH A;  4BHC A;  1MSF C;  4XLF A;  3ELK A;  2L4M A;  2XGD A;  1FPQ A;  3KZY A;  2XV4 S;  3DKX A;  1A5J A;  2EA2 A;  1IN6 A;  2HI3 A;  1U5T B;  3EUH C;  1OYY A;  1R36 A;  3F23 A;  2RAE A;  5M5X J;  5CJ9 A;  2EQR A;  1S6L A;  1I5Z A;  2IVM A;  1IDZ A;  2BOL A;  1Y56 A;  3BJ6 A;  4GDF A;  2NAZ A;  2FOK A;  3AAF A;  4E6K G;  1XS9 A;  2A3S A;  5IYB J;  4RBO A;  4X0G A;  3WTT C;  3VSK A;  1XGS A;  5ILU A;  4RLQ A;  2UXN A;  1ACI A;  1OCZ H;  5H2F C;  2CU7 A;  3H3Z A;  4CCO A;  1YIJ I;  4IHT A;  2I5U A;  3HG9 A;  5K7H A;  1G3W A;  3ERM A;  3MZH A;  2HR3 A;  2JA7 J;  4D7M A;  3H9J A;  2RQP A;  3GME A;  4AIJ A;  2XF6 A;  1B8I B;  1GVJ A;  1S3J A;  3CQZ J;  2XPW A;  1VTN C;  3PNY A;  4ENJ A;  1UG2 A;  1VQL I;  4RGS A;  1UHS A;  3P9K A;  1QHH D;  4CCK A;  2QM3 A;  2B0L A;  4DW6 A;  4M3F A;  4BXF A;  4YFK F;  4E4H A;  2VOP A;  4S04 A;  3IRQ A;  2RDP A;  4E7Z A;  5KAF C;  3T8T A;  2L9V A;  3IH2 A;  3ZMV A;  2DO7 A;  2M5W A;  4CIC A;  4OU0 A;  4ZDL A;  1HLV A;  1XX5 A;  2Z99 A;  1IRF A;  2G0E A;  1IAW A;  3ESW B;  1SEU A;  5IT9 K;  2JRT A;  3IC7 A;  4A0X A;  2CUF A;  2Q0O A;  3FDY A;  2TRT A;  2L7M P;  3IH4 A;  3BOQ A;  4A6D A;  1FSH A;  3RKQ A;  4G7Z F;  1SFE A;  1YJW I;  2FQ4 A;  1PP8 F;  5ICE A;  5M3M J;  3V8K A;  3E6M A;  4EJT A;  3TKY A;  3KLN A;  3ZQH A;  2XAQ A;  2WAF A;  2XKO A;  1R5G A;  3U1K A;  4DNC A;  2IS6 A;  3S3M A;  2PJR A;  2ZME A;  4AIH A;  4F55 A;  4XR6 A;  1IDY A;  2ZXH A;  1REP C;  5L3E A;  3QQA A;  4BXX J;  2R7D A;  2QQA A;  3I58 A;  2OF7 A;  3I5U A;  2DA5 A;  3CD6 I;  2A5W A;  1OPC A;  1ZHF A;  4EM2 A;  1B1B A;  2KP6 A;  1STZ A;  5BNG A;  3K0L A;  3K1M A;  3IKT A;  2Z3Y A;  1DU6 A;  3LNQ A;  2DLL A;  1LUJ B;  1XMK A;  2IAI A;  4JX5 A;  2OTL I;  2DK8 A;  2COB A;  2LKX A;  2L7K A;  3J7Y J;  3K4L A;  4ENM A;  2OV7 A;  4GO1 A;  1W0U A;  1KU7 A;  5D8L B;  3ASN H;  2IGO A;  2L01 A;  3MCZ A;  5K5Q A;  1AU7 A;  1FP1 D;  1IGN A;  3W2V A;  3C2B A;  1GV5 A;  4RLF A;  5LGT A;  2DMU A;  2ZXW H;  4RS8 A;  3HGG A;  3HJE A;  2E2I J;  3K4J A;  2JSC A;  4L0Y B;  5B3S H;  1T08 B;  1QVU A;  1BW5 A;  3BP8 A;  3RYP A;  2HTJ A;  1RZ4 A;  2KFD A;  4QLC U;  4IEJ A;  1KU2 A;  1XC5 A;  3S17 J;  2F4O B;  4CCJ A;  2LOO A;  1YIO A;  3CCY A;  1O3T A;  1VQO I;  2BXY A;  2E5Z A;  2RQQ A;  3MKL A;  3MKZ A;  4R1H A;  4NC7 A;  2EV5 A;  4KFC A;  2IGK A;  4XMY A;  3OYL A;  2IJL A;  2WY7 Q;  4ON0 A;  3S2D J;  3C18 A;  4XSX F;  1X58 A;  2VB6 A;  1UAA A;  3BJA A;  1UJ8 A;  4O3M A;  2PFB A;  3LSP A;  4GRI A;  1FSE A;  4HNU A;  1WJB A;  2HYJ A;  1ETK A;  2IP2 A;  3ZQG A;  4HQM A;  4YIF A;  3OYD A;  5E8G A;  2K5C A;  1WZ2 A;  2EV0 A;  2R7F A;  3FXO A;  1UFM A;  3FK6 A;  5B1A H;  3H5N A;  4QIW N;  2BXZ A;  2WAD A;  5HS7 A;  4YFX F;  2HPM A;  2L9S A;  2UXX A;  5J8C A;  4M3G A;  4BE0 A;  1JT0 A;  1AA7 A;  2LMD A;  4G9Y A;  4UUS B;  2E71 A;  5DCF A;  2YX4 A;  3H0D A;  1LDJ A;  4HNV A;  2R0Q C;  4G6Q A;  5E79 C;  3HHG A;  4M6Y A;  1QBJ A;  4CDG A;  1YS6 A;  3FBN B;  1WKM A;  4WXC A;  1MKM A;  2BHZ A;  3DKW A;  2AHQ A;  4XIC A;  3REO A;  3ASO H;  3PL8 A;  2IA2 A;  4I6Z A;  4PUS A;  4D5F A;  2P4W A;  1SC7 A;  4J01 A;  2VQL A;  1UHM A;  3OS1 A;  1SD7 A;  2DTZ A;  1YI2 I;  2GQQ A;  2PQ8 A;  2OPT A;  2DOE A;  2Y0S N;  3LSG A;  4XNF A;  5LHG A;  2JQ7 A;  2ETH A;  2JPC A;  3U1D A;  4DIQ A;  2NVQ J;  3PO2 J;  2W25 A;  4BJT A;  1E0E A;  3KLO A;  2XDV A;  4ZYH A;  2YU9 J;  4HF0 A;  2IS4 A;  1NG7 A;  2V6C A;  3VWB A;  2DA6 A;  4KNY A;  2VUM J;  1LFB A;  3FM3 A;  3JRF A;  1FTT A;  2EZK A;  3LST A;  2HDC A;  1FOX A;  3KFW X;  3QPT A;  3MN2 A;  4RGR A;  3HL2 A;  5EZH A;  1RI7 A;  2PMH A;  4W97 A;  3GZ6 A;  1NK3 P;  4CCL A;  2XAU A;  3G1O A;  1DU0 A;  4A3M J;  1XCV A;  2R7U A;  2W82 A;  1VQ9 I;  1X1P A;  4AUX A;  1TWH J;  4MTE A;  3MD2 A;  3O8G A;  2CG4 A;  1D8K A;  2KRF A;  2O5R A;  1X1A A;  1X4P A;  2WBM A;  3MAJ A;  2W00 A;  1YO5 C;  3F9K A;  1HQC A;  1SVM A;  1S5L C;  3GEZ A;  4A3C J;  5JR3 A;  2M30 A;  2WB1 N;  3NQO A;  3ABK H;  1Z0X A;  2DA7 A;  1XTA A;  2QQ9 A;  1VQN I;  3ABM H;  4ASN A;  4HEA 2;  2QBY A;  2J5O A;  4XM3 A;  1SMY F;  2K9S A;  1E2X A;  1WI9 A;  4LK0 F;  3KYL A;  3CF2 A;  4DYC A;  3GYH X;  1IV8 A;  2K7L A;  5KNL A;  3CCM I;  4A3D J;  1R22 A;  4EJW A;  3HBL A;  3DPL C;  5L3F A;  3FIS A;  1HOM A;  2L3D A;  3FXU A;  1NG6 A;  3ZMS A;  3GO5 A;  3SFI A;  3WOD F;  3WTS C;  4RM2 A;  1FYK A;  2RNG A;  3A2K A;  5EGO A;  1FOY A;  5KHD A;  2K9N A;  2Z2S B;  1I39 A;  1YJN I;  1IRG A;  5IYC J;  5BPI A;  4ZZL A;  4XLC A;  4XLH A;  2Z5U A;  1IN7 A;  2CWE A;  1U9O A;  2ZB9 A;  1T98 A;  5FD6 A;  2YU3 A;  3BDD A;  4YRV A;  2LYC A;  4OMZ A;  2FBH A;  2K40 A;  4BY1 J;  2JA2 A;  3V8J A;  5ED4 A;  2DBB A;  1OJL A;  4R8H A;  5EEH A;  3ZQQ A;  2CQQ A;  1X19 A;  2HYF A;  1LE8 B;  2RVC A;  4EM0 B;  1LEB A;  2R93 J;  3PO3 J;  1J0R A;  3M07 A;  1TC3 C;  2XVC A;  2PJP A;  3DF8 A;  3E7L A;  4A69 C;  3BR6 A;  2AQF A;  2VJJ A;  4PSW A;  5GPC A;  5IP7 J;  3AL0 B;  5TRD A;  1W5S A;  4KN7 X;  5K5O A;  1U8R A;  5HLG A;  2CQK A;  2HQ5 A;  5IY5 H;  1N77 A;  4A3K J;  4LG0 A;  1R7J A;  3OYA A;  1IN5 A;  3QOD A;  2E34 A;  4IX7 A;  4N4N B;  1N78 A;  2EIM H;  4DZJ A;  1W36 C;  2E1C A;  3A02 A;  4E7K A;  3K2Z A;  2FNP A;  1P7I A;  3H0G J;  5H20 A;  3UNG C;  3OYJ A;  3DEW A;  3P5J A;  2PLY A;  1O57 A;  1XGM A;  1T33 A;  3HYI A;  2R7Z J;  3J81 Z;  3DEE A;  3CMM A;  1BA5 A;  1ITY A;  3PJR A;  4F52 A;  2O6G E;  4HAM A;  3RZO J;  3BR0 A;  3OY9 A;  1XMX A;  1ONV A;  2LRD A;  3BZ6 A;  3D0S A;  4ZC3 A;  2JA5 J;  4PK4 A;  1K7A A;  4X1E A;  2OZ6 A;  1OCP A;  4D0P A;  4C30 A;  2RKH A;  4MNU A;  3HOU J;  4ZDO A;  2W85 A;  3QP5 A;  1XSD A;  4HZF A;  3UKG A;  2STT A;  2JSP A;  4V2F A;  1Z1D A;  2EBI A;  5DEQ A;  3SEQ A;  4UB8 C;  1S7O A;  1AHD P;  3BQZ A;  3NAR A;  4OIN F;  3CCQ I;  4KA4 A;  5IYD J;  4RB3 C;  1X4O A;  1MZB A;  3F21 A;  2JA6 J;  2BV6 A;  2DMN A;  3A03 A;  2EV6 A;  4WX9 A;  2XGC A;  2DT6 A;  3KP3 A;  3OOP A;  3KCC A;  3MZ8 A;  2VQG A;  3EET A;  1ZLJ A;  3QOE A;  3DXJ F;  3DCF A;  3BCA A;  3K4N A;  2BY2 A;  4BHP A;  5HOD A;  4MQ9 F;  5D5W B;  2DDB A;  2L4A A;  1P4W A;  2VQC A;  2ZJP F;  4Y4R A;  3OIQ A;  2CV0 A;  2E2J J;  2QLZ A;  5C3E J;  2CW0 F;  2VBY A;  4IXA A;  4DBR A;  2CGP A;  4L18 B;  1SVO A;  1X2N A;  2E1O A;  4DQ2 A;  4J00 A;  4BBS J;  4EEF G;  5EG0 A;  1MNM C;  1LPQ A;  5EEG A;  4UNO A;  1NH3 A;  3FM5 A;  2O61 A;  4MQV A;  2Y48 A;  1LDK B;  3RPU D;  3S2W A;  3HRT A;  3GBG A;  4M9X A;  5CVR A;  1T95 A;  3HUG B;  5FO5 A;  2VC0 A;  2Q8K A;  2ESH A;  3DBH B;  1DDN A;  1J75 A;  1BC8 C;  2OC6 A;  3PSI A;  1D1A A;  2KT0 A;  1J59 A;  2WAQ A;  4HST A;  3H9Q A;  2IPQ X;  3RPU A;  1T39 A;  2HPI A;  2O7O A;  1ULY A;  4MFE A;  3NWT A;  5LBQ A;  5K5R A;  2VBX A;  2M8E A;  2R7V A;  4PDK A;  2BEO A;  1VI0 A;  2DDA A;  1JUP A;  3TW6 A;  1EH6 A;  2HKO A;  4EAT A;  4A0Y A;  2NS7 A;  3CDI A;  3CCL I;  4S0H B;  1ZRE A;  2HVS A;  3ULQ B;  1I1S A;  2WC2 A;  3FIW A;  4NNJ A;  3SHF A;  4ESF A;  5M5Y J;  1FNN A;  1IN4 A;  4F3Q A;  3OSG A;  4XRF A;  2E7W A;  4A3F J;  2JUG A;  4R79 A;  2L54 A;  1BI2 A;  2CYY A;  5KK1 A;  3KPH A;  1OCC H;  1V5E A;  3GCM A;  3C7J A;  3S1R J;  4AYB N;  2VN2 A;  2EIJ H;  1R1T A;  4IO9 F;  1BIA A;  1JTX A;  2XSD C;  2GOX B;  2W7N A;  2X85 A;  3SYT A;  2H6C A;  2NVX J;  2FF4 A;  4BEH B;  1DP7 P;  2LD5 A;  3PQJ A;  1X3W B;  3LSM A;  3G2B A;  3OYI A;  2IA0 A;  3JRH A;  1OMI A;  2M9H A;  1FWZ A;  3ZQL A;  3KP4 A;  3V7R A;  3CCR I;  1WCM J;  1Y39 A;  2HYG D;  2Q2E A;  4I0B A;  3AG1 H;  4UVC A;  1MJA A;  3BC8 A;  2VI6 A;  1GDT A;  1U0J A;  1LKX A;  2CFO A;  5LD2 C;  2ISZ A;  2ZNY A;  4MHG A;  4A3B J;  4KIB A;  2VJ5 A;  4CH7 A;  2A6E F;  2PJR B;  2F5C A;  3HOX J;  2ZME B;  1VQP I;  3B6A A;  1U8B A;  4EM1 A;  4UB6 C;  1RNL A;  3W2W A;  3F8N A;  1LJ9 A;  5LGU A;  3F6O A;  5F6F A;  3S1N J;  2FSW A;  2LVS A;  3VYS B;  1T8I A;  5GTI C;  3QAH A;  4Y15 A;  3GWZ A;  1WQ2 A;  5B66 C;  1VQ7 I;  1EF4 A;  3CLQ A;  1TWC J;  2V6E A;  1OQY A;  1MD0 A;  2DMP A;  2V7F A;  2X4H A;  5DD8 A;  5BQT A;  1LFU P;  3IWF A;  3KX2 A;  3L9F A;  2R7T A;  4AU7 A;  4Y17 A;  3OR2 C;  4GYI A;  1QZY A;  2PG4 A;  2R5Z A;  4ABZ A;  2FMY A;  2OCE A;  2TCT A;  2VE8 A;  1IXS B;  3JTH A;  2LBF B;  4WK8 F;  2D5V A;  2HOT A;  1V55 H;  2QF7 A;  3QWL A;  3BTC A;  1MH4 A;  3I55 I;  2E1M C;  3R6S A;  4W1U A;  3JSP A;  4M71 A;  4U7B A;  4HPQ A;  4EMS A;  2OZU A;  2M1B A;  3TQN A;  5CKT A;  3VSL A;  1F43 A;  3V8L A;  2NOJ B;  2OJE D;  3RTR A;  4E7J A;  1ZGA A;  3ZMU A;  3U9G A;  5HNF A;  2QZ8 A;  1BC7 C;  4A3L J;  4FAS D;  3SQN A;  3F22 A;  3FK7 A;  5F64 A;  3R0J A;  5IT3 A;  3BPV A;  5JHF A;  2ESN A;  3TOB A;  4LLL A;  2K4J A;  3RKY A;  2P8T A;  1ON1 A;  4XKB A;  4LGW A;  2FEZ A;  4BDY A;  4Q47 A;  2E7X A;  4B8X A;  1MMG A;  2YPR A;  3HKZ A;  3PM1 A;  3CO6 C;  4BS9 A;  3N4M A;  2KJB A;  2ECC A;  3QYE A;  1B72 A;  4BE2 A;  1VND A;  2JVG A;  4BQO A;  4LIU A;  1TQP A;  4KIF A;  3W6K B;  3BG3 A;  2Y0S A;  4C3J J;  3S3O A;  2DU9 A;  2IW5 A;  1VQ8 I;  1IUY A;  1FX7 A;  3M1C A;  3HM5 A;  1MH3 A;  3M9A A;  3L2U A;  5LRR A;  4WWC A;  3T0Y A;  3TO9 A;  2X6O A;  4GYG A;  2R3S A;  4TV7 A;  1HC8 A;  1TNS A;  5F1R A;  2LKS A;  3PNV A;  4M6X A;  3ECH A;  4DZP A;  3ZMT A;  2W84 A;  2X1D A;  5D4S A;  5LHI A;  2LY1 A;  4Z2Y A;  3TED A;  2E2H J;  2YS9 A;  2B63 J;  2LRE A;  2LSO A;  2OQG A;  4FT8 A;  3J80 Z;  1AOY A;  2DMT A;  2VKE A;  3HRU A;  1MMD A;  2Y31 A;  2XF7 A;  3KZI C;  1WJF A;  1ZK8 A;  1YW7 A;  4CZC A;  2A61 A;  1DP3 A;  5FRO A;  2I8D A;  2HXI A;  3BT9 A;  3HUG A;  1FMW A;  2EFN A;  4EJV A;  4Y7N J;  3GXO A;  1DPR A;  3HC7 A;  1NHA A;  4F91 B;  3U21 A;  2XB0 X;  5E3N A;  1MGT A;  1Y0N A;  2Y75 A;  5JHU A;  3GF2 A;  4LLN A;  4XBF A;  4PJ0 C;  4BQQ A;  1GVD A;  4IKF A;  4ZYG A;  1O3S A;  2BVM A;  2ZKZ A;  4IHS A;  4HV5 A;  2CUJ A;  1YFH A;  1BBY A;  4BE1 A;  4ZH4 F;  2EFQ A;  3IH3 A;  1VFC A;  5FRM A;  2Y9Z A;  3EUH A;  1VQK I;  4NC6 A;  1X3Z B;  2XGX A;  3IUO A;  3LA3 A;  5E1Z B;  1XPX A;  4ESJ A;  3OYM A;  1Z21 A;  2VXD A;  1YTY A;  3ZOB A;  1V54 H;  2O8K A;  2A6T A;  3FMR A;  1FZP B;  5F0C A;  3M8F A;  2MC4 A;  3OOU A;  2VT3 A;  3VDX A;  5J8F A;  4G7O F;  1YS7 A;  1EKE A;  4YFN F;  4A3I J;  3BY6 A;  2GXG A;  4E7S A;  2M3A A;  1W7P B;  3M8J A;  5GAE J;  3BZK A;  1R49 A;  4BYY A;  2KHM A;  3E3V A;  4CGZ A;  4LIV A;  2QBY B;  5JVG F;  5E17 F;  3CCU I;  3E5Q A;  4UVA A;  4BEH A;  4RGU A;  3JAM Z;  1HW5 A;  1K83 J;  2F5D A;  4I02 A;  1Y1W J;  1F4K A;  4A93 J;  1IRZ A;  2GLO A;  1QZE A;  3BWG A;  3ABL H;  1IRX A;  5LEJ A;  4LD5 A;  2X51 A;  5CYV A;  4Q4Z F;  1TQI A;  1QGP A;  4OAZ A;  4PSX A;  1ZAO A;  2CW7 A;  2VPL A;  1XG1 A;  5EGO B;  3GTL J;  2E36 A;  3DLL F;  3OV8 A;  2CMP A;  1D0X A;  2QKM B;  1KA8 A;  3K2A A;  1FIA A;  2GIV A;  4U87 A;  1MMN A;  3GLL A;  4B3X A;  1GXP A;  4RAZ A;  3C2G A;  5CVI A;  2A68 F;  1G8X A;  2AO9 A;  2MC3 A;  3E5X A;  3WG9 A;  4UUT A;  4PGH A;  3IV5 A;  1WJA A;  2DQR A;  2P7V B;  3IL2 A;  1XSV A;  3K9T A;  1OKR A;  1T38 A;  1E3H A;  2EH3 A;  4LMY A;  1TT5 B;  3FXR A;  2IS2 A;  2F2E A;  3Q9S A;  3TDU C;  1FOK A;  2O0Y A;  2VXZ A;  1B4A A;  2XB5 A;  5DTD A;  1I50 J;  2MAB A;  3BR1 A;  4DBQ A;  5LHH A;  4S05 A;  1W0T A;  4LG0 B;  2GWR A;  3V4G A;  3CP2 A;  4M6V A;  2K4B A;  2LBF A;  1R58 A;  4HV6 A;  2RRE A;  3BCB A;  4B4C A;  3IWZ A;  4BAY A;  3LQQ A;  2CQ7 A;  5E1W A;  4XQF A;  5DDG A;  5HVQ C;  3GFL A;  3HTS B;  2QSG X;  2CQX A;  4PFP A;  2GXA A;  2Y2Z A;  3L2R A;  4EGZ A;  2DFE A;  3VYT B;  1ZYR F;  2HWV A;  2O03 A;  3EQL F;  2ZXJ A;  2V1N A;  3CF5 F;  3CDL A;  1QU3 A;  5E20 A;  4CCN A;  2WWY A;  3KEO A;  3ZN0 A;  4OIR F;  4U0V A;  3ECO A;  2LY2 A;  1JT6 A;  3CUQ C;  4XLA A;  3W3C A;  5AIQ A;  3TBI A;  4D1Q A;  2EFW A;  4BXU A;  3CDH A;  4HLX A;  4L9J A;  3VEP A;  5DUI A;  1I3A A;  3WU0 A;  1K79 A;  4FIS A;  1G59 A;  3G71 I;  4XOR A;  2ZBK A;  1RKW A;  3JW4 A;  4CSW A;  4A3J J;  1BR1 A;  1FP2 A;  1LFP A;  5KCM A;  4G94 A;  1PP7 U;  3EUK L;  2MYS A;  4FTH A;  1SFX A;  3QU6 A;  3K70 C;  1QPI A;  2F48 A;  3WGI A;  4A5N A;  2GA1 A;  2IGM A;  3QPL A;  4BQN A;  2FRH A;  5D6F A;  4PJM A;  5FLX K;  1ZRC A;  2DFH A;  2K9Q A;  4KIG A;  4AWX B;  1DUX C;  3RKW A;  4ZYD A;  1ZEL A;  3JCU C;  4CXF A;  4PJL A;  3MQ0 A;  4I09 A;  3DQV C;  4XN3 A;  4NUB A;  3A0B C;  2LTP A;  4BAC A;  4NBQ A;  1H89 C;  3PFY A;  1IW7 F;  2HDD A;  3W2A A;  1ETX A;  2I10 A;  4XL9 A;  1HKT A;  5IOZ A;  3P9I A;  4N0B A;  3GFJ A;  3D1N I;  2FJ1 A;  3A4C A;  5EG0 B;  1NK2 P;  5GTH C;  5F08 A;  1U5T C;  2DA1 A;  3BG7 A;  2DTR A;  2JZY A;  1U2W A;  2ELJ A;  3AG3 H;  1KZH A;  2V1D A;  1BJA A;  5IT9 Z;  4BHB A;  4ENN A;  1ETO A;  2BVL A;  4RMN A;  3ERE D;  1ZR2 A;  1WH7 A;  1RUN A;  3SXY A;  1I6H J;  2CH0 A;  1SFK A;  4XKV A;  3I9V 2;  3LAP A;  1BM9 A;  1PYV A;  1Q1H A;  2DA4 A;  2F4M B;  4ZTF A;  3H3U A;  1S72 I;  2FBK A;  5ICF A;  3RIR A;  2IGN A;  5KAI C;  1MSE C;  4JOM A;  3WTX C;  3WTW C;  3CC7 I;  1JKO C;  3E1S A;  3FF5 A;  3WE2 A;  5ICC A;  1JKP C;  2M0C A;  4GCV A;  2QSF X;  2YUS A;  5IPA A;  3S1Q J;  2X48 A;  1FBU A;  4AC0 A;  1IC8 A;  1XD7 A;  2L2O A;  4XK4 A;  3B02 A;  3CJT B;  1ZLK A;  1W7P D;  3ISP A;  4RB0 A;  3HIF A;  2D2W A;  2DPU A;  2EZH A;  3CLO A;  3OYG A;  3TP0 A;  2KRH A;  4Z6Y A;  2RV8 A;  3ZQ7 A;  2DI3 A;  4LJZ F;  1MW7 A;  1S8N A;  4KUM A;  3ZQC A;  4G12 A;  1KQ8 A;  3IP4 B;  2KIM A;  3B73 A;  2PMZ A;  5BPD A;  1J09 A;  2F5V A;  2K9M A;  4LIT A;  3HPH A;  4UV9 A;  1W7P A;  5L3B A;  3EUA A;  3O6B B;  4B1R A;  1FBQ A;  1P9Q C;  1Y6I A;  4A3G J;  3LSH A;  2CRG A;  4HOB A;  2P7C B;  4Y13 A;  4D7N A;  2R7R A;  4XOP A;  4RAG A;  4M3D A;  1XCB A;  4C2M J;  1T2K A;  2F5E A;  1V4R A;  2KIQ A;  3CZ6 A;  2HS5 A;  2HVR A;  2ME6 A;  2AQE A;  1ZG5 A;  1USS A;  1IZ1 A;  2Q2E B;  1CGP A;  3JSO A;  3ZCO A;  3KEY A;  3HOS A;  2V1X A;  1SFU A;  3SDB A;  2KMU A;  4IHV A;  4ETS A;  1H9G A;  3KP5 A;  4Q48 A;  3OSF A;  2UZK A;  3LSR A;  3DFG A;  4A2U A;  3CO7 C;  1GUU A;  3TW7 A;  1APL C;  3DEU A;  1U3E M;  3DTI A;  3IKV A;  2FQ3 A;  4YG2 F;  3LMM A;  3MZY A;  3HGY A;  2K3P A;  2NOG A;  2EFP A;  1LVA A;  1WFX A;  5LGN A;  4PJJ A;  4XKC A;  4IQJ A;  5L3C A;  1ETW A;  2ZSH B;  1YRN A;  3OS2 A;  3Q9V A;  2ZXI A;  3VYU B;  5FGM A;  1MBF A;  2DJI A;  4D5C A;  2XAS A;  2G7U A;  2XPU A;  2R5Z B;  3ONQ A;  4HDU A;  3OYB A;  5D5U B;  4HF2 A;  2KLO A;  1OR7 C;  2K85 A;  4WF2 A;  3WGG A;  1A31 A;  4JK1 X;  5FFX A;  4AVZ A;  2JUC A;  4QTR A;  3OYH A;  2IA1 A;  4I76 A;  2RN7 A;  3E0J B;  4XRS A;  5F27 A;  1DPU A;  2UWM A;  2JK3 A;  4OWR B;  5GP9 A;  4V2G A;  1W36 D;  2R5Y A;  3ZN1 A;  2MH2 A;  5E1X A;  2BY0 A;  3Q3S A;  3FXL A;  1P4A A;  4L9T A;  3Q5F A;  2H8R A;  2C6Y A;  1YJ9 I;  2DMQ A;  3RYR A;  4L5E A;  2LKP A;  4K2E A;  3TP3 A;  4CYD A;  2P6T A;  3BTJ A;  2AS5 F;  1YYV A;  3HSF A;  3KZZ A;  2ELH A;  2DN0 A;  1MMA A;  4DOZ A;  2QEX I;  3DU6 A;  1N25 A;  3BR3 A;  3T5X A;  2H27 A;  3MFK A;  2NXN B;  4J19 A;  1BOB A;  4H4K C;  1IN8 A;  2ZJ2 A;  3OYC A;  3MMY B;  3JRI A;  1Z91 A;  3I3L A;  4EJO A;  1GT0 C;  3FXK A;  1B6A A;  4UV8 A;  5M3F J;  2BW3 B;  1B72 B;  1R6R A;  4XON A;  4D9J A;  3W6J B;  2CW8 A;  1O3R A;  1JKR C;  2HOE A;  3SJM A;  4NC8 A;  1OYI A;  1CQT A;  2X1E A;  2XAG A;  4MTD A;  3KEQ A;  1Y8R B;  1TQM A;  5E3O A;  5TJJ A;  2M7B A;  1E3O C;  1U78 A;  2KDZ A;  1FY7 A;  3OIO A;  4KJZ A;  3RCO A;  2VIX A;  3S93 A;  2GM4 A;  2DCE A;  3N05 A;  3QU3 A;  1R23 A;  1OYW A;  1TW2 A;  2PBI A;  5BS6 A;  1FBS A;  3PSF A;  5DD4 A;  1SD5 A;  2QQB A;  1HSJ A;  1TWF J;  1WHU A;  2EB7 A;  2CJJ A;  3CCS I;  1ZH5 A;  1Y1V J;  5HLI A;  3T1B A;  1JHH A;  1JHF A;  2P5V A;  1PUE E;  1MNE A;  4G6T B;  2MA3 A;  2M2E A;  3SZP A;  3DTK A;  2GXB A;  4BL0 B;  3RPQ A;  4HLY A;  5L3G A;  1SAN A;  2DW4 A;  1OFC X;  5FKN A;  3RZD J;  2DJN A;  1L3L A;  1P2F A;  5CVU A;  4HRI A;  2Z16 A;  3KIO A;  3DTE A;  5CVV A;  2L7F P;  5CQG A;  1R5H A;  1LQ1 A;  4ZJZ A;  4PCQ A;  3WU1 B;  4AM3 A;  4DJA A;  3S15 J;  3PUB A;  1B9N A;  3KP6 A;  3L2W A;  4LFU A;  1HBX G;  3CCV I;  1FLI A;  1Z7U A;  2VAS A;  3DWL E;  2DA2 A;  3HOY J;  2L9R A;  3B6C A;  3QRF F;  2VJ4 A;  2IT0 A;  4KMF A;  5DM6 F;  2CV1 A;  4MIM A;  2HU9 A;  2MLK A;  1KON A;  4F7Z A;  5BMZ A;  1A36 A;  5J1U A;  3IRR A;  3IHU A;  1IUF A;  1KYZ A;  2E19 A;  1ETQ A;  3D5S C;  2NVU B;  4LB6 B;  3I4M J;  1T0F C;  3A1Y A;  1BI3 A;  1H8A C;  2MG4 A;  4G6D A;  1XMA A;  1K78 B;  2MGQ A;  3DPT A;  2UUZ A;  3I56 I;  3FKJ A;  2PN6 A;  5D8K B;  3K1P A;  1UCR A;  3A01 A;  4O6J A;  3GX4 X;  2HGC A;  1MBJ A;  4AID A;  4ZYE A;  2K02 A;  1UZC A;  1Z77 A;  3K4C A;  2A69 F;  1D1C A;  2GZW A;  1PDN C;  5C4X J;  4M3E A;  1G3S A;  3GFM A;  2G9W A;  2KZG A;  4JX4 A;  4B43 A;  2V79 A;  1S7E A;  1LEA A;  4HX7 A;  5HOO A;  2QWW A;  1FYL A;  3C1D A;  5FB2 A;  2BY1 A;  1QVT A;  5FD5 A;  3S3N A;  3G73 A;  2N8G A;  2GAU A;  3I59 B;  4OIP F;  2IXS A;  2EA4 A;  2JT1 A;  1MIJ A;  2P5K A;  5H6R A;  2CFX A;  4FQG A;  4HYE A;  1D3Y A;  1YHQ I;  3DU5 A;  1RR7 A;  4QPO A;  1Z9C A;  1RIO H;  3JRC A;  4CUG A;  4I01 A;  4BH9 A;  4P9F A;  1X1D A;  2HEO A;  2ELK A;  3AG2 H;  2DFF A;  1WRJ A;  2VKD A;  5GAG J;  1UG0 A;  3BRO A;  3HB9 A;  2BE5 F;  4I98 B;  4MGR A;  4KIT B;  2YX7 A;  1G6N A;  3GTJ J;  2DYR H;  2ACJ A;  4WXH A;  1XDS A;  1AKH B;  4CHU A;  2OA4 A;  2ZCW A;  4GFB A;  1YW9 A;  2JPB A;  2L5Q A;  2DFI A;  3X2Q H;  1WWX A;  1WJE A;  2MD0 A;  2PX9 A;  5FLM J;  2QSH X;  1QHG A;  2MLG A;  4P96 A;  2DPD A;  4IRI A;  3PUF A;  2DOF A;  1Z3X A;  1ZG3 A;  2K27 A;  3MVP A;  3O3K A;  4ITV A;  2LFB A;  2Y30 A;  1L0O C;  3JRA A;  4CA0 A;  3L2V A;  5HDN A;  1O3Q A;  2YSR A;  1O4X A;  4FE7 A;  3F8C A;  4M3B A;  4UY8 I;  3CJQ B;  3GTQ J;  2LF8 A;  3HTU A;  3RSN A;  3SDG A;  3OYN A;  4IHY A;  3VPR A;  5B1B H;  3PQK A;  3ZQF A;  5L3D A;  4XRS G;  3VOE A;  2PMU A;  1I3Q J;  4KN4 X;  1GXQ A;  1UEL B;  2A6H F;  5F0F A;  1BI0 A;  2OCC H;  1H9T A;  2CS3 A;  1RUO A;  3BJO A;  4IL6 C;  4I2O A;  5EJC A;  2ZFW A;  1Z05 A;  4FX0 A;  3K1N A;  3OYF A;  3K10 A;  4CYC A;  2BW3 A;  2RC4 A;  5J1R A;  2AXT C;  1V3F A;  3FXQ A;  1YE9 A;  1BOA A;  3OYE A;  4RA2 A;  3IAM 2;  4C2T A;  1OCR H;  3WTU C;  4A12 A;  1GLN A;  4N4O B;  2ZFU A;  3GTO J;  5JFR A;  5EF6 A;  1J5Y A;  1EH7 A;  1FMV A;  4OIO F;  3M7G A;  1QRY A;  2HFH A;  4RAY A;  2F5F A;  4RDU A;  1F1Z A;  2DYS H;  2J5P A;  3GZN B;  1TLH B;  3HOT A;  3E6B A;  3CME I;  1RES A;  1WJD A;  2ME0 A;  5FKO A;  1IG7 A;  5F04 A;  2PEX A;  2VQH A;  3V7S A;  1QPM A;  4ZZD A;  3S1M J;  5M5W J;  4HNT A;  2HTS A;  5A2Q K;  4F93 B;  1A04 A;  2LP0 A;  3H5R A;  4EJU A;  2JRM A;  1WVR A;  2JMW A;  3FBI B;  1HKS A;  3M3Y J;  4M9S A;  5K1Y A;  2H94 A;  2W57 A;  3EDP A;  3J7A O;  2OAZ A;  4LOC A;  2MBF A;  1A6I A;  3I0T A;  3GTM J;  3GTG J;  3ML6 A;  2E35 A;  2LR8 A;  1VQ6 I;  3JTG A;  1PUF B;  3F8B A;  2L9N A;  2LF7 A;  3HPG A;  1IXC A;  5EEA A;  4IOC F;  3UR3 C;  1J9I A;  1G3T A;  1T56 A;  5J6X A;  3ZPL A;  4QPQ A;  3G4S I;  3S14 J;  4IF4 A;  1ZR4 A;  2XGE A;  5E3M A;  4N9H A;  4ZYA A;  1D5V A;  1YX5 A;  3IAS 2;  2LNB A;  2WB1 A;  2FD5 A;  4RM3 A;  3M1E A;  1I27 A;  3FZV A;  4HX8 A;  3FXM A;  5C44 J;  2QVO A;  1SD4 A;  4U0W A;  4E7L A;  2VKV A;  4X6A J;  2QKL B;  2M4K A;  1SFO J;  3PIO F;  3CMY A;  3C2H A;  2R92 J;  3G3Z A;  1CF7 B;  2OUM A;  1VF9 A;  3L00 A;  3LA7 A;  2VPR A;  3L09 A;  2QCO A;  1VZ0 A;  4ZTJ A;  2R7O A;  3GZ5 A;  5DM7 F;  2QUF A;  2VLA A;  2OTJ I;  1R1V A;  5LLQ A;  1K78 A;  3HRS A;  3RJP A;  4CCM A;  2VOD A;  1UHW A;  2O8X A;  2ICW G;  3CC4 I;  3ABT A;  1QZZ A;  1KU9 A;  2WAE A;  3OL4 A;  4IVN A;  1FIP A;  3FKI J;  3U2R A;  3MEX A;  2VJI A;  2HNH A;  1J7K A;  3NAU A;  3GTK J;  2HZD A;  4B09 A;  4IRG A;  1OCO H;  1XN7 A;  3VOD A;  4HDV A;  1F5T A;  4JP0 A;  2YR2 A;  3LWF A;  4IOA F;  1R00 A;  3HRM A;  4F92 B;  5IP9 J;  2FX0 A;  2M34 A;  1MDM A;  3GTP J;  3QYB A;  3LFK A;  3M8E A;  3G1L A;  1W5C C;  2WAQ N;  4UVB A;  3WGH A;  3I59 A;  1F9N A;  1QO0 D;  1Q1V A;  2WA0 A;  4PJN A;  3HDD A;  1ZKG A;  4HQE A;  1ZG1 A;  3DLA A;  4RAF A;  5DCM A;  2DQL A;  3Q0U A;  2Y9Y A;  6PAX A;  4B47 A;  1TWA J;  3I4N J;  5J4Y A;  1A6Q A;  3H5A A;  2EJR A;  2DOA A;  1R4N B;  4G8X A;  2ZME C;  1JUM A;  4PZJ A;  3ROU A;  3N97 A;  1RKT A;  2HXO A;  4E7I A;  4XID A;  1R5I D;  1S7A A;  2LY9 A;  3FWE A;  4EVI A;  1BJZ A;  2KQR A;  3GLX A;  4RGX A;  4AIK A;  5IOY A;  3CJN A;  1K61 A;  3K4M A;  2P5L C;  3ZMZ A;  4FX4 A;  1JXS A;  3BR2 A;  1AWC A;  4RB2 C;  1MBG A;  1TT0 A;  5EZG A;  4BQA A;  3BG6 A;  4BY7 J;  4DYQ A;  3COA C;  1AKH A;  3WHC A;  1TBX A;  3OIP A;  2D1H A;  5DUK A;  1YRN B;  2P81 A;  2A07 F;  1ERD A;  1DGW Y;  3TDZ C;  3EYI A;  2CQN A;  2M0M A;  2V9V A;  4Y52 J;  3VB2 A;  3GW2 A;  1X1B A;  2W4S A;  1ZGW A;  2WTE A;  1WJ5 A;  2VE9 A;  1RPW A;  2K3F A;  2BZT A;  2A05 A;  1XSX A;  4XSZ F;  3QP6 A;  1LB2 A;  3L2C A;  1TW3 A;  1QQI A;  1J2X A;  3JRG A;  2NS8 A;  2R5Y B;  4IZZ A;  5A2Q Z;  2R7Q A;  3SFZ A;  2V4J C;  1JGG A;  2ADU A;  1SAX A;  2DA3 A;  3MKW B;  3HOV J;  1ODD A;  4MLO A;  3E97 A;  5E18 F;  1WH5 A;  3LA2 A;  3PIP F;  5LEK A;  1YW8 A;  1K6O A;  1D0Y A;  2Z33 A;  1QA6 A;  2DOD A;  2L7Z A;  1VQ4 I;  4BJ5 C;  1HF0 A;  4HA8 A;  2X1C A;  4UXN A;  2OQR A;  5CVJ A;  1ENH A;  3HHH A;  1Z67 A; 
#chains in the Genus database with same CATH homology
 4DYR A;  4XRM A;  3OSG A;  3HGY A;  4A3F J;  1F36 A;  2NOG A;  1MSF C;  1FJL A;  2XGD A;  1ETW A;  2IBD A;  1YRN A;  3S1R J;  4AYB N;  2LLK A;  1MBF A;  1JTX A;  4D5C A;  1A5J A;  2XPU A;  2XSD C;  2HI3 A;  2R5Z B;  2RAE A;  5M5X J;  2EQR A;  2NVX J;  4JYK A;  1IDZ A;  3BTI A;  1JJ6 C;  4QTR A;  2LD5 A;  1OCT C;  4I76 A;  4XRS A;  1BW6 A;  3JRH A;  2M9H A;  5F27 A;  1XS9 A;  2JK3 A;  3ZQL A;  1GV2 A;  1WCM J;  5GP9 A;  4V2G A;  5IYB J;  2R5Y A;  4MO7 A;  4RBO A;  5F0H A;  2VI6 A;  5FJ8 J;  3Q3S A;  1GDT A;  2NVY J;  2H8R A;  9ANT A;  4A3B J;  2NVT J;  2DMQ A;  3WHB A;  2CU7 A;  5IP6 A;  4L5E A;  3TP3 A;  3HOX J;  5K7H A;  4FE4 A;  3BTJ A;  2JA7 J;  2O9L A;  4D7M A;  3B6A A;  1U8B A;  2DN0 A;  3BR3 A;  1B8I B;  3S1N J;  2LVS A;  4J19 A;  3CQZ J;  2XPW A;  1PUF A;  1EF4 A;  4IHW A;  1UG2 A;  1WGX A;  1TWC J;  3JRI A;  2DMP A;  3HKZ N;  1UHS A;  1GT0 C;  1JUS A;  1LFU P;  5M3F J;  1B72 B;  4DW6 A;  4M3F A;  1JKR C;  3SJM A;  1MBE A;  3IH2 A;  1CQT A;  2R5Z A;  4ABZ A;  2TCT A;  1FEX A;  1HLV A;  2D5V A;  5E3O A;  3H3V K;  2HOT A;  2QF7 A;  1E3O C;  3BTC A;  1U78 A;  1MH4 A;  2KDZ A;  3OIO A;  2G0E A;  2GM4 A;  4W1U A;  2CUF A;  2TRT A;  3BG5 A;  2L7M P;  3IH4 A;  5JLX A;  3RKQ A;  3S16 J;  1F43 A;  2FQ4 A;  1TWF J;  2CJJ A;  5M3M J;  1Y1V J;  3ZQH A;  3A01 B;  4A3L J;  3Q0W A;  4BBR J;  2EZL A;  2HOS A;  3FK7 A;  2M2E A;  1IDY A;  1SAN A;  1HCR A;  1UMQ A;  3QQA A;  4BXX J;  2OF7 A;  1OFC X;  5FKN A;  3RZD J;  2DA5 A;  2DJN A;  1B8I A;  5J3L A;  1H88 C;  2L7F P;  3JRB A;  3PM1 A;  5BNG A;  3S15 J;  2ECC A;  1DU6 A;  3LNQ A;  1B72 A;  2IAI A;  4JX5 A;  1VND A;  2COB A;  2LKX A;  2DA2 A;  3HOY J;  3BG3 A;  2L9R A;  4C3J J;  3B6C A;  4MIM A;  1W0U A;  2JJ7 A;  3LSJ A;  2XPV A;  3HM5 A;  5J1U A;  1MH3 A;  1IUF A;  1AU7 A;  2X6O A;  1IGN A;  2E19 A;  1ETQ A;  3I4M J;  3C2B A;  1GV5 A;  2DMU A;  1H8A C;  3HGG A;  2MG4 A;  2E2I J;  4DZP A;  2ID3 A;  1NTC A;  2MGQ A;  1QVU A;  1BW5 A;  2E2H J;  5FKM A;  3TED A;  2YS9 A;  2B63 J;  3A01 A;  4IEJ A;  2DMT A;  2EZI A;  2VKE A;  1XC5 A;  2Y31 A;  3S17 J;  3JRD A;  1MBJ A;  1ZK8 A;  3CCY A;  1Z77 A;  3BT9 A;  2HXI A;  3MKL A;  4Y7N J;  3HOW J;  5JLW A;  5C4X J;  4M3E A;  4IHX A;  4JX4 A;  5FKK A;  1S7E A;  5E3N A;  2XB0 X;  4C3I J;  3S2D J;  1X58 A;  1MBH A;  1QVT A;  1GVD A;  2N8G A;  3LSP A;  5DS9 A;  2HYJ A;  1ETK A;  3ZQG A;  3QPS A;  3FK6 A;  1RR7 A;  3IH3 A;  2X9D A;  3JRC A;  1VFC A;  2Y9Z A;  4QIW N;  1ZTR A;  4M3G A;  1JT0 A;  2ELK A;  3LOC A;  4UUS B;  4HNV A;  5K7Z A;  2R0Q C;  1TWG J;  3ZOB A;  3HB9 A;  2O8K A;  3GTJ J;  5F0C A;  3JRE A;  3OOU A;  2IEK A;  2AHQ A;  4XIC A;  5F1J A;  1AKH B;  4CYC B;  4A3I J;  4I6Z A;  4D5F A;  4GFB A;  1JTY A;  2ECB A;  2DTZ A;  5FLM J;  2Y0S N;  2OPT A;  3LSG A;  3PO2 J;  1R9T J;  2NVQ J;  4B3A A;  1ORK A;  4FCY A;  3MVP A;  2LFB A;  2YU9 J;  2Y30 A;  1K83 J;  1Y1W J;  1FTZ A;  3BG9 A;  4A93 J;  1IRZ A;  2GLO A;  3JRA A;  2DA6 A;  2VUM J;  1WPK A;  3Q0V A;  1LFB A;  3JRF A;  1FTT A;  2EZK A;  2WV1 A;  1O4X A;  4FE7 A;  1G2H A;  1XG1 A;  4M3B A;  5EGO B;  3MN2 A;  3GTL J;  3GTQ J;  3SDG A;  5EZH A;  4IHY A;  1IV6 A;  2JWT A;  4W97 A;  3VPR A;  1NK3 P;  3HOZ J;  3K2A A;  1DU0 A;  3G1O A;  1FIA A;  4JX6 A;  3ZQF A;  4XRS G;  4A3M J;  4AUX A;  1I3Q J;  1TWH J;  4UUS A;  2AO9 A;  3O8G A;  4UUT A;  5F0F A;  3IV5 A;  1ZQ3 P;  2LK2 A;  2MSY A;  5EDN A;  2EH3 A;  4BKX A;  5E3L A;  1ETY A;  1ETV A;  4CYC A;  5J1R A;  2XB5 A;  5EYR A;  5DTD A;  1I50 J;  3BR1 A;  4A3C J;  2WB1 N;  4MFD A;  1Z0X A;  1W0T A;  3GTO J;  2DA7 A;  4M6V A;  5EF6 A;  3M4O J;  2K9S A;  1QRY A;  4DYC A;  4B4C A;  4RDU A;  4C3H J;  2JA8 J;  4A3D J;  5GPA A;  3HBL A;  1RES A;  3FIS A;  3G1M A;  1HOM A;  3HEF A;  2ME0 A;  5FKO A;  1IG7 A;  5F04 A;  2CQX A;  3SFI A;  2Y2Z A;  3S1M J;  5M5W J;  5EGO A;  2K9N A;  5IYC J;  1HDD C;  2LP0 A;  3CDL A;  2JMW A;  1U9O A;  2ZB9 A;  3M3Y J;  1JT6 A;  2K40 A;  1IJW C;  4LOC A;  4BY1 J;  3GTM J;  1A6I A;  3GTG J;  1OJL A;  2LR8 A;  2CQQ A;  1LE8 B;  4FIS A;  1PUF B;  2R93 J;  5EEA A;  1RKW A;  3PO3 J;  4A3J J;  1T56 A;  2XRL A;  1TC3 C;  3S14 J;  3E7L A;  4A69 C;  3BR6 A;  5GPC A;  1ZR4 A;  2XGE A;  5E3M A;  2ID6 A;  4FTH A;  5IP7 J;  1D5Y A;  2FD5 A;  1QPI A;  1HDP A;  2HQ5 A;  3QPL A;  2L0K A;  4A3K J;  5C44 J;  4QSH A;  2CUE A;  3BQY A;  2VKV A;  4X6A J;  4DZJ A;  2K9Q A;  2JN6 A;  3A02 A;  1SFO J;  3S2H J;  2R92 J;  3CMY A;  3H0G J;  1P7I A;  1VF9 A;  3DEW A;  2VPR A;  5K7F A;  2QCO A;  1T33 A;  2R7Z J;  1BA5 A;  1ITY A;  3K7A J;  2LTP A;  3RZO J;  1H89 C;  3BR0 A;  2HDD A;  1ETX A;  2I10 A;  2MW8 A;  2JA5 J;  3F0C A;  2GBY A;  5IOZ A;  4X1E A;  3RQI A;  3D1N I;  2FJ1 A;  5EG0 B;  1NK2 P;  1OCP A;  1FIP A;  3FKI J;  3BTL A;  1RET A;  2PMZ N;  5F08 A;  3HOU J;  3NAU A;  3GTK J;  2DA1 A;  5C4J J;  3UKG A;  1MBK A;  3O8H A;  4JP0 A;  4V2F A;  1JJ8 C;  1LE8 A;  1ETO A;  5IP9 J;  2EBI A;  2FX0 A;  2M34 A;  1ZR2 A;  3GTP J;  1WH7 A;  1I6H J;  2HOA A;  3G1L A;  1AHD P;  2WAQ N;  1WI3 A;  3BQZ A;  2DA4 A;  3NAR A;  1Q1V A;  3HDD A;  1ZKG A;  5IYD J;  1X2M A;  3Q0U A;  2Y9Y A;  2JA6 J;  1MSE C;  2DMN A;  3A03 A;  1TWA J;  3I4N J;  2XGC A;  3BR5 A;  1JKO C;  1JUM A;  1RKT A;  2HXO A;  1JKP C;  4XID A;  2M0C A;  2LY9 A;  2YUS A;  1BJZ A;  5IPA A;  2W48 A;  3S1Q J;  1P7J A;  2X48 A;  5IOY A;  4AC0 A;  1IC8 A;  3DCF A;  1K61 A;  1BL0 A;  4XK4 A;  5HOD A;  3BR2 A;  3W6V A;  1MBG A;  2EZH A;  3ZQI A;  5EZG A;  3TP0 A;  2E2J J;  5C3E J;  4BY7 J;  4DYQ A;  3JR9 A;  1X2N A;  2E1O A;  3ZQC A;  4A3E J;  1AKH A;  4BBS J;  3WHC A;  4G12 A;  4EEF G;  5EG0 A;  2H1K A;  1MNM C;  1YRN B;  2M8G X;  4NDL A;  2P81 A;  4B1R A;  4Y52 J;  3GBG A;  4A3G J;  1ZGW A;  2CRG A;  4D7N A;  4M3D A;  4C2M J;  1RPW A;  5J1Y A;  2KT0 A;  2ME6 A;  3JRG A;  2NS8 A;  2O7O A;  4MFE A;  2R5Y B;  1JGG A;  2DA3 A;  3HOV J;  4MLO A;  1VI0 A;  4IHV A;  1WH5 A;  1JUP A;  5FLV A;  3TW6 A;  2NS7 A;  3L1P A;  2L7Z A;  4S0H B;  3OSF A;  3LSR A;  1HF0 A;  1POG A;  1JKQ C;  1GUU A;  1ENH A;  1U9N A;  3FIW A;  3TW7 A;  5FKL A;  1APL C;  5M5Y J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...