1H88C

Crystal structure of ternary protein-dna complex1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C03
2COBA 1GV2A 4XK4A 3I4MJ 4C3IJ 2EZHA 2LVSA 3LSPA 1ZR2A 1AKHB 2ME0A 3JRIA 2NOGA 1I50J 1JT0A 4BY1J 3CQZJ 1RPWA 2QF7A 1TWAJ 3K7AJ 2DMNA 1O4XA 4MO7A 3BR2A 1E3OC 4V2FA 5E3NA 1FJLA 2GM4A 3HDDA 3M4OJ 4AC0A 1JTYA 2JN6A 2XGCA 3HGGA 1X2MA 4M3EA 2K40A 3CDLA 2EZLA 3FK7A 2R0QC 1Z0XA 2M9HA 3DCFA 2TRTA 2NS8A 5EZHA 2L7FP 1I6HJ 1LE8B 2JK3A 1HDDC 4W1UA 1B72B 1WPKA 2R7ZJ 1IGNA 4B4CA 2JA8J 4D7NA 3RZOJ 1JKOC 5FLMJ 5F0FA 5IP6A 3PO3J 2K9QA 3S16J 4UUSA 2HQ5A 2X6OA 3IV5A 2CRGA 5BNGA 2M34A 3OOUA 1HDPA 3ZQCA 1U9NA 1JT6A 2LR8A 3TP0A 4IHWA 3LSJA 3FKIJ 2DA7A 5IOYA 2B63J 1H8AC 2AO9A 1T33A 4CYCB 1XS9A 3GTKJ 1MSEC 1X58A 2OPTA 3HBLA 3A02A 1ETKA 2JMWA 5EG0B 2L9RA 5M5WJ 4DYRA 5EYRA 5M3MJ 1NK3P 3I4NJ 3SJMA 1QVTA 1Q1VA 1HLVA 2XPVA 3IH3A 1UMQA 3NARA 1MNMC 3VPRA 2O9LA 3QPSA 2K9NA 2MW8A 2E2IJ 5J1RA 1EF4A 5EDNA 1X2NA 1YRNB 4S0HB 3K2AA 5IYBJ 1XG1A 5IYCJ 4B1RA 3HOWJ 3C2BA 1D5YA 1MH3A 1BJZA 4IHXA 1IRZA 1ZQ3P 3PO2J 1AKHA 2E1OA 3GTJJ 2Y9ZA 2DA5A 3F0CA 2R93J 4DZJA 4I76A 2CU7A 2JWTA 1IUFA 2IEKA 5FKOA 1IV6A 4M3GA 1XC5A 4A3CJ 1TWHJ 3O8GA 1RESA 2LK2A 2ME6A 1ETWA 2FD5A 1DU0A 1TWCJ 3BTLA 2FJ1A 4M3DA 1BW5A 1U78A 1A6IA 3GTGJ 2IBDA 3JRDA 4ABZA 2JJ7A 2R5YA 1TWFJ 3FIWA 3A03A 4NDLA 1TWGJ 4M3BA 1B72A 1ZGWA 5F27A 4JX4A 2EQRA 3Q0VA 5J1UA 4HNVA 1SANA 4X6AJ 1JUSA 2ECBA 3A01A 4FISA 2HXOA 1WH5A 4DYCA 2H8RA 3BR1A 4D5CA 5E3MA 3Q0UA 3O8HA 4EEFG 3JRAA 2L7MP 3ZQLA 4QTRA 1HOMA 3B6AA 9ANTA 2LKXA 4XRSG 1OJLA 1OCPA 3H0GJ 3WHCA 5EG0A 3OSFA 3BQYA 3HKZN 3S14J 3BTJA 1WCMJ 5DTDA 5K7ZA 3HGYA 5EGOA 3CMYA 2Y30A 4BBSJ 3M3YJ 1T56A 1FTTA 3G1MA 3PM1A 1P7IA 4DW6A 2IAIA 3BT9A 2ECCA 2QCOA 5C44J 4MLOA 4B3AA 1JKQC 4BBRJ 2LD5A 2NS7A 2ZB9A 3S17J 2XB0X 4FE4A 2X9DA 3TW6A 3BR5A 2ID6A 2FX0A 1W0TA 1MBHA 2DTZA 2R92J 2XSDC 1Z77A 4A3LJ 5IYDJ 1BA5A 4XIDA 4QIWN 4D7MA 1PUFB 2NVXJ 4C2MJ 1GVDA 2GBYA 2DMQA 1RKWA 3G1LA 5K7HA 4L5EA 1LFBA 2G0EA 2YS9A 1VNDA 2HOTA 3ZQFA 4JYKA 1QPIA 1RETA 4JP0A 3B6CA 4C3JJ 1JGGA 3JRGA 1A5JA 2M2EA 3Q3SA 5FKMA 1PUFA 3GBGA 1SFOJ 2XPUA 3ZQIA 3LOCA 4A69C 3MVPA 3H3VK 4DYQA 4A93J 5M5YJ 3JRBA 5M3FJ 2DA3A 2CUFA 3IH2A 2N8GA 2OF7A 1MBFA 1ITYA 2AHQA 2HDDA 1CQTA 3BR0A 1BL0A 2CJJA 2GLOA 1ZK8A 2PMZN 1WH7A 2DA6A 2P81A 2XPWA 1DU6A 5C3EJ 3DEWA 4BKXA 3A01B 1ZR4A 3S1QJ 1WI3A 1LFUP 2VKVA 1QVUA 2X48A 1GUUA 3QPLA 4FE7A 5F0CA 4C3HJ 2ELKA 4RDUA 1IDYA 5F0HA 1GT0C 2I10A 2JA7J 2HOSA 2XGEA 1W0UA 1H89C 1FTZA 1UHSA 4V2GA 3TW7A 4XRMA 2EH3A 2VUMJ 1MSFC 4MFEA 3BR6A 3Q0WA 2R5ZB 2Y0SN 4JX5A 3JRHA 1BW6A 4RBOA 1ENHA 3LSGA 3E7LA 5EEAA 3HB9A 5K7FA 5GPAA 2WV1A 3QQAA 5F08A 5FKKA 4A3JJ 1ETYA 1TC3C 5JLXA 2CUEA 3SFIA 3NAUA 1MBKA 2DN0A 4DZPA 1ETQA 5IP7J 3D1NI 1JKPC 2YU9J 5FJ8J 1F36A 2XB5A 2TCTA 1OCTC 3S1RJ 2ID3A 3BTCA 3LSRA 1IG7A 2JA5J 3GTPJ 2KT0A 3RZDJ 3W6VA 1OFCX 4IEJA 4W97A 1R9TJ 1NTCA 1JUMA 5IP9J 3HOVJ 5HODA 3FK6A 1ORKA 5EZGA 4A3DJ 4A3KJ 2LY9A 5M5XJ 4A3IJ 4A3BJ 5FKNA 3TEDA 5DS9A 2CQXA 1ETVA 3JRCA 1JJ6C 3BG5A 1HF0A 2DMUA 4M6VA 3HEFA 2K9SA 3ZQGA 3GTMJ 3MKLA 3RQIA 1HCRA 5E3OA 3TP3A 4FCYA 3BG9A 4AUXA 1JKRC 2H1KA 3BTIA 1GDTA 2WAQN 2NVYJ 3BR3A 1APLC 1ZTRA 4BXXJ 3WHBA 2M8GX 2XRLA 1AHDP 1JUPA 4X1EA 1ETOA 1K83J 2DA1A 5E3LA 2HOAA 2XGDA 2DA2A 5JLWA 1POGA 2LTPA 3S2HJ 1G2HA 4FTHA 1ETXA 1MBJA 1ZKGA 2CQQA 2NVTJ 4A3GJ 1YRNA 2Y9YA 1IC8A 1P7JA 4BY7J 2YUSA 4JX6A 1JJ8C 4Y52J 5GP9A 3ZOBA 3OIOA 1K61A 2E19A 3GTQJ 1U9OA 1Y1VJ 4LOCA 2VI6A 3JREA 4J19A 2WB1N 3OSGA 3BQZA 1LE8A 3ZQHA 2R5ZA 2MG4A 2DA4A 2HI3A 2LP0A 3HM5A 2Y2ZA 1F43A 2L7ZA 1B8IB 4IHYA 2JA6J 5J1YA 2FQ4A 3UKGA 4MFDA 4IHVA 1VI0A 3S2DJ 1QRYA 5GPCA 4UUSB 3JRFA 2NVQJ 3S15J 2R5YB 3HOYJ 5EF6A 1GV5A 2KDZA 2EBIA 2Y31A 2O7OA 3FISA 2O8KA 3S1MJ 5IOZA 1B8IA 1VFCA 2RAEA 4AYBN 1IJWC 3IH4A 2DMTA 2LLKA 1H88C 2MSYA 4CYCA 5FLVA 2MGQA 3BG3A 3S1NJ 4A3FJ 3G1OA 1NK2P 2L0KA 4A3MJ 4UUTA 4M3FA 1VF9A 3HOXJ 3CCYA 3JR9A 2DMPA 4QSHA 5EGOB 3HOUJ 3LNQA 2W48A 2DJNA 2EZKA 5IPAA 3RKQA 1UG2A 2HYJA 4I6ZA 3SDGA 2D5VA 2VPRA 1WGXA 4D5FA 2VKEA 1FEXA 1IDZA 1RR7A 3L1PA 3GTLJ 5F04A 4GFBA 4Y7NJ 1MBEA 1FIAA 2E2JJ 4XICA 2HXIA 4MIMA 1AU7A 4A3EJ 1U8BA 3HOZJ 1RKTA 2LFBA 1Y1WJ 2M0CA 5C4XJ 5FKLA 1JTXA 1MH4A 2EZIA 1S7EA 5J3LA 4XRSA 3GTOJ 5F1JA 2E2HJ 1MBGA 4G12A 3MN2A 1FIPA 1I3QJ 5C4JJ
chains in the Genus database with same CATH superfamily
2COBA 3I4MJ 5ICCA 4PGGA 3SEQA 1EH8A 4Q5SF 4JOMA 2LVSA 3P9IA 2IA1A 3A2KA 5HDNA 5TISC 1I50J 2DT7B 1K6OA 2MD0A 1KU2A 1JT0A 1Y8RB 1SFUA 1MKMA 1RPWA 2QF7A 1TWAJ 1A31A 3O3KA 3HHGA 3KP4A 3RQ4A 4Y4RA 2XAHA 4V2FA 5EEGA 5E3NA 4BE2A 3HDDA 2X51A 4G8XA 4AC0A 5HLTA 3FMSA 1ODDA 3HGGA 1IXRC 1KA8A 1FZPB 1BR2A 2L54A 4CICA 4G7OF 2EZLA 5CVRA 4A6DA 4CCJA 1N25A 3WTTC 2M9HA 5CKTA 4A5NA 2W25A 1FBQA 1LE8B 3MD2A 3EUHC 5D6EA 2V9VA 2BV6A 3IHUA 1B72B 1AA7A 1WSUA 2ZFUA 3OOPA 3C1DA 2E7XA 2IW5A 2G7HA 4XLEA 1UELB 3S16J 3BZKA 4UUSA 5BNGA 1XSXA 3AL0C 1HDPA 2DFIA 3HIFA 1I27A 2OV7A 3D5RC 4ZYEA 3TP0A 2ETHA 3H3ZA 1IXSB 4NC6A 1H8AC 4F52A 1T33A 1XS9A 3HBLA 1G3TA 3VYRB 4O5VA 1Q1HA 1XB4A 1T08B 4WX9A 5CVJA 1L3LA 3CCJI 1YHQI 4F92B 1LB2A 4G6QA 1NK3P 3FXLA 1F4KA 2JRTA 3I4NJ 2OA4A 1Y39A 1Q1VA 5FD5A 1B9MA 1MNEA 1BOAA 2W4SA 2PBIA 3TO6A 3OWTA 1K78B 1HBXG 2E5ZA 2O9LA 1LJ9A 1XTAA 2Z2SB 4CDGA 2LYCA 3K1MA 1KU7A 2ADUA 4BXUA 1EF4A 5EDNA 3WTSC 2LH9A 2Z1DA 3C2BA 1IRZA 2O5RA 3ISPA 3KX2A 2Y9ZA 2XF7A 2HVQA 3MWMA 2CU7A 3DTEA 3E3VA 5FKOA 1XCVA 1ZARA 2XV4S 2MA3A 3ZXSA 2F4OB 1USSA 1TWHJ 2DK8A 3HJEA 5CPRB 3O8GA 1RESA 4ENNA 4ENJA 1B1BA 4YG2F 2Z5UA 3WU0A 1TWCJ 3K0LA 4BJTA 1U78A 5FROA 4A5MA 1BR1A 1SFXA 4LK1F 4ON0A 4IXAA 4PFOA 1OISA 3PSFA 5L3GA 1YI2I 3VDXA 1YS6A 2E5NA 4L9VA 4M3BA 3S2WA 1YW8A 3QAHA 2EQRA 4JX4A 2ECBA 3D5LA 2HPIA 3E1SA 3ZMSA 1OYIA 1B4AA 5F6FA 3LAJA 2H8RA 1LVKA 1HXDA 3WTWC 2ISYA 3O8HA 3P9KA 2ZXHA 1R00A 3BROA 1Z3XA 3ZQLA 3B6AA 1R5GA 2F5EA 4HZFA 4JQFA 4L9TA 4XORA 1OJLA 1OCPA 2QSFX 2ZMEA 4XRSG 3WHCA 4DJAA 3OIQA 2L5QA 1LPQA 4RM3A 3BTJA 4P9UA 2JVHA 2I5UA 5L3CA 5DTDA 3I9V2 3HGYA 5EGOA 1VQMI 4RAZA 2GWRA 3V7RA 2GZWA 4BU2A 1FPQA 3I59B 2HTJA 2YPRA 3V7CA 1T56A 2LY1A 1E17A 4DW6A 4HNTA 4PK4A 1VQ6I 2R7UA 2ECCA 4ZDPA 4ZH4F 4ZZLA 2M45A 3CO7C 4MLOA 4B3AA 4BBRJ 2LD5A 3GFMA 3CCQI 2DAOA 1DP7P 2LC2A 4E7KA 1JGSA 3CDIA 4KIFA 1R36A 2FE3A 1Z77A 5GTIC 4A3LJ 3K10A 5LGTA 3IAS2 5IYDJ 1J09A 3SZTA 2LKSA 4O3MA 3AG4H 2V79A 4C2MJ 1E3HA 5HS9A 1RKWA 3KEQA 4XOTA 3IWFA 1R1VA 1VQLI 1ZRCA 4GCVA 3HXLA 1YQAA 4FQGA 1W7PA 3JRGA 5FKMA 2VXDA 3K4KA 5FFZA 3KCCA 1IW7F 3TOAA 3ZQIA 2DODA 3ZQ7A 5CJ9A 4DYQA 3FMQA 4XOPA 4HV5A 3JRBA 2PMHA 2W84A 1R71A 1N78A 5HLGA 1I3AA 4WXCA 3O6BB 3GVAA 1CQTA 2CJJA 1FOXA 5HNHA 1U3EM 2GLOA 1W7PD 3DU5A 1ZK8A 2P6SA 3FZVA 3ZMVA 2CGPA 2L9VA 1WH7A 2FF4A 5C3EJ 3JSOA 5D8LB 4BDYA 1ZYRF 4N4NB 3HUGB 3A01B 3VODA 3S1QJ 1QO0D 5FRNA 4NC7A 2O6GE 4C3HJ 2ELKA 4WCGA 1R6RA 2ZMEC 2FBKA 4RDUA 2Q2EB 5F0HA 3QU6A 2A69F 2K86A 1V55H 1V54H 1V5EA 3KFWX 4LFUA 5KAIC 1HA8A 2I10A 3DBRB 4RB1A 3JTGA 4M72A 1H89C 3OYHA 2H1LA 1FTZA 3TGNA 4XRMA 3TOBA 4LK0F 2Y75A 1ZREA 1MSFC 4BEHA 1Z7LA 1A35A 2A07F 3FX3A 4Q48A 2Y0SN 3HC7A 5GADJ 1XDSA 1BW6A 2VB6A 4XM3A 3LL7A 4UHTA 3HB9A 5GPAA 2WV1A 4K2EA 3TO7A 2MLGA 5FKKA 1TC3C 2IGNA 3SFIA 2XAJA 3AAFA 5CVIA 3ZCOA 1G59A 2VIXA 2DN0A 1YO5C 3WGHA 3GFJA 5DDGA 3CCRI 3OS2A 5LHIA 2FQ3A 4IJAA 4A2UA 1IRXA 1U2WA 2XB5A 3E0JB 3GF2A 2E35A 2ID3A 5D4SA 3LSRA 2OTJI 2MH2A 2XGXA 3S32A 3W3CA 2JA5J 3DTKA 2KT0A 3W6VA 4F93B 3CCLI 2ZC2A 1MJ9A 4IEJA 3KYDB 1R9TJ 1NTCA 5IP9J 1R49A 3L09A 5A2QZ 3EUHA 4A3KJ 4BHPA 3HOTA 4CYDA 1TW2A 4PJNA 4B09A 3HL2A 2V9KA 1F5TA 5DS9A 2CQXA 1F9NA 4PJLA 4Y15A 3WU1B 3JRCA 3A1YA 3GZ6A 1JJ6C 1FMWA 2GA2A 3L00A 3HEFA 4FASD 2EIMH 3GLXA 2H8WA 4HBLA 4RB3C 2VKHA 3PUBA 2K3FA 4II3A 2A68F 4DIQA 1RRJA 2VL8A 4AUXA 4I0AA 5E8IA 4M71A 2WAQN 3OL3A 4BXXJ 3R60A 4OINF 4PUSA 1V3FA 3WHBA 1PDNC 1HQCA 1AHDP 2W00A 4DQ2A 2WAEA 2KJBA 2Z16A 1K83J 2XGDA 2DA2A 3I64A 1POGA 2FEZA 2KP6A 4NHJA 1YTYA 1G2HA 1S8NA 3OMYA 3RKXA 2ZO4A 1FY7A 4BJ6C 4KIBA 5JHFA 4FHTA 2HQRA 1DPUA 2VBZA 3ASOH 1FSEA 3N97A 3SFZA 5GP9A 1NG6A 3OIOA 2VE8A 1K61A 2E19A 4E7SA 3G2BA 1Y1VJ 2VOOA 3CF2A 2VI6A 5L3FA 5J6XA 5FB2A 2R5ZA 5BPIA 4U0VA 4GDFA 3LQRA 1YITI 1J75A 4S04A 1TL8A 2JA6J 4I0BA 4OAYA 2FQ4A 3CF5F 1VI0A 4B44A 4U7DA 2NNYA 3DBLB 1ZGAA 2R5YB 3H5NA 4IVNA 4J01A 1E0EA 5EF6A 1VQPI 1DQUA 5J47A 5BOXA 3FHNA 5IOZA 2RAEA 1BC8C 4BUPA 3F9KA 4WF2A 3CCVI 2IT0A 3FDYA 2EIJH 5FO5A 2F6CA 4RM2A 3LWFA 2EV5A 4XN3A 3RYPA 4EJVA 2L0KA 1KYWA 3RI4A 4LITA 4LIUA 2LBFB 2X4HA 4GYIA 3I56I 2V6CA 4D0PA 1OCZH 2M30A 3BJOA 4NQWA 2VE9A 3TBIA 1KZHA 4HF1A 2DJNA 2K9MA 1Z21A 1T6SA 3G4SI 2GIVA 4BS9A 3L1PA 2CWEA 3A4CA 3MCZA 1P9QC 3BCBA 3F6OA 2H6BA 2XHKA 4MIMA 2ZFWA 4DBQA 1AU7A 2VONA 4XBFA 2STWA 4OOIA 1X1CA 1RKTA 2PFBA 3LSHA 1P4AA 3FXQA 5HLHA 1D0XA 3VSKA 1Y1WJ 2E1NA 3BZ6A 3CJQB 1ZGJA 2VC0A 2IS1A 4KMUX 5FKLA 1JTXA 2EZIA 2R7SA 2W85A 1WZ2A 4MEXF 1Z91A 5J3LA 4XRSA 2V7FA 5HDGA 2XAGA 3GFIA 1R5HA 2LNBA 4CHUA 1I3QJ 2VASA 1W7PB 3I0TA 4HLYA 4J00A 4WXDA 3BC8A 2M5WA 2VBXA 5D5UB 4C3IJ 2EZHA 1AKHB 1ZR2A 3JRIA 2HDCA 2G9WA 2FOWA 4AWXB 1TW3A 1SEUA 1ON1A 3RKYA 2DPDA 3CQZJ 1O4XA 1IN6A 4HX8A 3OS0A 2GA1A 3MFKA 4HRIA 2BHZA 1S72I 1E3OC 4AVZA 3QYEA 3KIOA 1YX5A 4EV0A 2VBWA 1WKMA 2CV1A 1C0WA 4IOCF 3GZ5A 3CDLA 3FK7A 2PEXA 2EIKH 1Z0XA 1D8JA 5LEJA 1K4SA 1I6HJ 4N4OB 4QPOA 1XMAA 1HDDC 2R7VA 3ELKA 5JI6A 3L2RA 2FSWA 4XQFA 3DLLF 2UXXA 3EETA 4B4CA 3OYKA 2JA8J 5FRMA 3E5QA 2GOXB 3VEPA 3RZOJ 1JKOC 5FLMJ 1LEBA 3DXJF 2HS5A 1BIBA 4BE1A 3PO3J 2K9QA 2IVMA 4PCQA 4ESJA 2CYYA 3KZYA 4PZJA 4CXFA 2KFDA 5GAHJ 1JT6A 5L3BA 4IRHA 4UY8I 3IAM2 3TKYA 1KQ0A 3D0SA 3ECHA 1XGNA 2B63J 3A0BC 2AO9A 5LLQA 3A0HC 4HAMA 1MSEC 5KNLA 2EA4A 1VQ9I 4HG2A 1HC8A 1ETKA 2JMWA 2L9RA 1U5TA 5KHDA 5BQTA 5M5WJ 1XPXA 2DYSH 2V1UA 3B02A 1QVTA 4NBQA 1YLFA 1KU3A 2NYXA 3IH3A 3P5JA 1UMQA 2QSHX 2ELHA 1FBSA 2IGKA 2RNGA 2Q1ZB 2F5DA 4XONA 4YRVA 2ESNA 2QKLB 5J1RA 4D1QA 1X2NA 4S0HB 3K2AA 1USTA 3M1CA 1HW5A 5ICEA 3ZN0A 4ZYAA 3HOWJ 1MH3A 1U5TB 1BJZA 2QSGX 4IHXA 4G9YA 1ZQ3P 1AKHA 4BQNA 2BVLA 1MW7A 5ERIA 2QEXI 3J7YJ 3JTHA 1X1PA 4CO8A 5HLIA 2D1VA 1XSVA 1XC5A 3FXUA 2XIGA 3L2QA 3PNYA 4EJTA 2ME6A 4R79A 1OYYA 1E2XA 4PSXA 5DCMA 2CW7A 4F3QA 2Y0SA 4GYGA 2KRCA 2IBDA 4CCMA 5HS8A 4G7HF 3FF5A 1PJRA 2PQ8A 2L9NA 2E36A 3RDIA 2YX4A 2JT1A 2QKMB 2XC7A 3K4MA 1Z9CA 2RKHA 1K6YA 1B72A 1REPC 3ZMUA 4HNUA 5F27A 1ZGWA 4HNVA 4NNJA 2R7QA 1JUSA 3CD6I 3H5AA 4BXFA 1ERDA 2JPBA 2KPMA 3OYIA 1VQ7I 4II2A 2HXOA 1WH5A 3BR1A 4CGZA 1TP4A 2IJLA 1SD4A 3I54A 4D5CA 2ZJ2A 3Q0UA 3JRAA 2B0LA 9ANTA 1PVEA 3I5UA 3KLOA 2LKXA 1D0ZA 3W6KB 3REOA 2CFOA 4OIQF 4RGUA 1TT5B 1WCMJ 2QGUA 1SAXA 4CSWA 4ZDLA 1TQPA 2DQLA 3CP8A 1F1ZA 2L01A 1G8XA 1FTTA 3G1MA 1P7IA 3N05A 2HVRA 1FOYA 1OKRA 1YW7A 2UUZA 3LQQA 4HLXA 4ANJA 1B9NA 4FX4A 1D1BA 4KICA 1FT9A 2KLOA 2NS7A 2ZB9A 4XSZF 3EPZA 4E7HA 4UNOA 3BR5A 1W0TA 1FOKA 3M9AA 2R92J 2F4MB 2H6CA 2W24A 1YW9A 3M8FA 2VT2A 2JZYA 3LA3A 4I09A 3ZMDA 4CCNA 3ZP5A 1Y56A 1WJBA 3GLLA 3H9QA 2AS5F 4D7MA 1PUFB 2AQEA 4E4HA 3RPUD 1T39A 4XSXF 5JHUA 4Y17A 3LSKA 4L5EA 2G0EA 1EJ9A 2DLLA 1SD7A 3G3ZA 3BG6A 2ZKZA 1XD7A 3W6JB 4OU0A 1RETA 1JGGA 3B6CA 3GBGA 4IPAA 1O3QA 4CUGA 2HQAA 3MVPA 4KJZA 3H3VK 4A93J 2XKPA 4KFCA 5M3FJ 3F8BA 2CUFA 3LSMA 2X6XA 2N8GA 3AG3H 3IH2A 5DCMB 2OF7A 1MBFA 4Y13A 5E20A 1HSTA 2RDPA 3ULQB 2P7CB 3U1KA 2HKOA 2VKDA 3CESA 3FXMA 3IRQA 3BR0A 1BL0A 2CFXA 4BNCA 2Q0OA 2BHYA 2JTVA 2P81A 1S9HA 3ABUA 2PJRA 1XSDA 2Y48A 3GW2A 3DEWA 3HSEA 4AU7A 1OCCH 1ZR4A 1ZHFA 3KP6A 2X48A 3F8NA 1GUUA 2QBYB 3WTVC 5LHHA 3ABTA 3FWEA 2H27A 4OWRB 3J81Z 2VC1A 3J80K 1OYWA 2EFWA 2EINH 2O0YA 3NRVA 2HOSA 2STTA 1BC7C 4YFKF 1W0UA 3ZPLA 4G7ZF 2DOEA 2LBFA 2QZ8A 3TW7A 3MZYA 2VUMJ 4L18B 3CMAI 2K5CA 2MFZA 2HU9A 3I59A 4P1WA 3WGIA 1J59A 3JRHA 4RBOA 2BYVE 1ENHA 3LSGA 5F1RA 1D1AA 2Y0MA 5K7FA 3BZCA 4BH9A 4M74A 1O3SA 5JVTA 1RR8C 4BE0A 2CUEA 5AIPA 1DDNA 2BY0A 3JAMK 1MBKA 1Z1DA 2BXZA 2CQNA 5BPDA 4DZPA 5CLSA 3IL2A 1S5LC 3D1NI 1JKPC 3M7GA 2WAQA 4BEHB 3V4GA 1WVRA 2V9PA 2L7KA 3S1RJ 5CVUA 1BBYA 1M1EB 4KN7X 1IG7A 3GTPJ 2KQRA 2YX7A 2XUBA 1JUMA 2A3SA 3HOVJ 1EV7A 2KDOA 3J7AY 4ZYDA 1IF1A 4BHCA 4P55A 2HVSA 2PLYA 1PP8F 5LHGA 5E17F 2X1CA 2Z99A 1K79A 2L2OA 2L3DA 1GXQA 2OCCH 3R0AA 1HF0A 2B7EA 2HPMA 2JVGA 3WTXC 2F5FA 3K1PA 4IKFA 4M6VA 2FU4A 3ZQGA 3GTMJ 2MLKA 2LG4A 2WV0A 2P5KA 3MKLA 4HA8A 4AYBA 5E79C 4FCYA 1B59A 4RA2A 5B5EC 3H9GA 2H1KA 5EJCA 3BR3A 1X1DA 1MMNA 1ZH5A 3DLAA 3ZRGA 2BVMA 1ETOA 2L4AA 4HX7A 2R7DA 1K78A 4EJUA 3MZHA 1Z05A 3S2HJ 1O7LA 1PYVA 2K85A 3V8LA 4U0WA 1TQIA 1ZKGA 4FTHA 1WJ5A 4XNFA 3MEXA 4CZZA 1YRNA 2VODA 1IC8A 4BY7J 2DFFA 3FM5A 3I3LA 1JJ8C 5IT9K 1VZ0A 4RGRA 4BQAA 1VQ5I 1BI0A 1U9OA 2BEOA 4J19A 3BQZA 4KN4X 3T0YA 2LOOA 4ZJZA 2DA4A 2MC4A 2YU3A 4UB6C 2L7ZA 1F43A 3PQKA 2LREA 3L2WA 1GLNA 2JQ7A 2OTLI 5GPCA 4UUSB 3OYGA 2NVQJ 3S15J 1WWXA 4EGYA 2ZXWH 1GHCA 2FUG2 1TLHB 4XKBA 2Q2EA 1ULYA 2R3SA 2O7OA 4BL0B 2RV8A 3V7SA 3S1MJ 1B8IA 2O8XA 2GAUA 1Z7UA 3BG7A 1SVMA 3I58A 4O6JA 4AYBN 2LLKA 2LDUA 5BS6A 2IS4A 3G1OA 1NK2P 2KIUA 4FT8A 1VF9A 2KHMA 5L3EA 2VOPA 2E7WA 3CCYA 2WY8Q 2UV1A 1SMYF 3JR9A 3LSIA 5CYVA 5H6QA 4B47A 2EFPA 4UV8A 1XN7A 5DD8A 2ZCWA 2DXIA 2K3PA 5EGOB 1ACIA 4QPQA 2W48A 1QBJA 2DQRA 3OYJA 2HNHA 2Y69H 2IPQX 4I6ZA 1O3TA 1L0OC 3GXOA 4D5FA 2VKEA 3HRSA 4IOAF 5F04A 5DV5A 1XX5A 4Y7NJ 1CGPA 4LLLA 3PFIA 3VYUB 2HXIA 3H92A 4JBAA 5EEHA 2QQAA 3O2PE 4BQQA 1H0MA 4DBRA 3GX4X 4XKVA 5L3DA 2E1MB 2CMPA 1Y0NA 5TJJA 4I01A 2LFBA 3E97A 3CMMA 3C3WA 2I8DA 4BAYA 4YFXF 4XKWA 1W5TA 2M0CA 5DYMA 4XLNF 5C4XJ 2F5VA 3GFLA 4I2OA 4YIIA 1MH4A 2XF6A 3PJRA 2PJPA 1ZELA 3ABMH 1S7EA 1Y6IA 2EK5A 2FMYA 4M6XA 5F1JA 2DCEA 4UV9A 4NUBA 5FD6A 1MBGA 3WG7H 3GYHX 1KU9A 1ZAOA 4G94A 3T5XA 3WTYC 1KONA 1SFEA 4XK4A 4RGSA 4L0ZB 1LEAA 2X85A 3KPHA 2CW0F 5ICFA 2NOGA 2PI0A 1KQ8A 2HQNA 4Q4ZF 1BJAA 1R1TA 3C2GA 1SD5A 4IZZA 2VPLA 3H5RA 3K7AJ 1S7AA 2DMNA 3HPGA 3S93A 1FYLA 2K7LA 3SDBA 3BR2A 1FJLA 3LAPA 2GM4A 2QYOA 3Q5FA 2XROA 1JTYA 2JN6A 2WADA 1YJNI 2XGCA 3EYYA 5ILVA 2ESHA 1D1CA 3RIRA 4M3EA 4KYWA 1FNNA 4KT6A 3IUOA 2R0QC 1RC9A 1RNLA 5FGMA 1AWCA 2TRTA 3DF8A 2QLZA 2HKXA 2NS8A 2DOAA 1ZG3A 5EZHA 2L7FP 1BI3A 5DUIA 3MMYB 1G3WA 1UB9A 2XVCA 1IGNA 3BJ6A 5FFXA 3WU2C 1LNWA 1RZ4A 4RAYA 4L5IA 3RPQA 3BPVA 5F0FA 4HX4A 2FOKA 4CH7A 4PDKA 3FXRA 4B48A 2HQ5A 3IV5A 1NHAA 2K02A 2D2WA 1MNDA 2M34A 3OR1C 5LGNA 3KLNA 4KIGA 4EM1A 1QNTA 1G4DA 3ZQCA 2V4JC 4CCLA 2RQPA 1U9NA 3P9CA 1Y8QB 4RS8A 2BW3A 3KP5A 3FKIJ 3HKZA 2DA7A 4GRIA 1FX7A 4CYCB 1S6LA 4C2TA 3GTKJ 3KYCB 2XAUA 1I1SA 3RCOA 1X58A 1IAWA 2OPTA 3A02A 3H36A 1D5VA 2LSOA 1X19A 1FSHA 4AIHA 2ZJPF 2R7OA 3DWLE 2M3AA 3BLYA 5EYRA 2OQRA 1J2XA 2CUZA 1HLVA 2EV0A 3OYBA 3OYNA 2XPVA 3HTUA 4HDVA 1MMSA 4YELA 3RSNA 3VPRA 3CJTB 2KRFA 3CZ6A 3ZMZA 2MW8A 3ZN1A 1JI8A 1T8IA 1D0YA 1EH6A 1XG1A 4XRFA 4ESBA 4LB5A 1Z3YA 1D5YA 4KDPA 4LG0A 4M6YA 3FXJA 5ICGA 2NOJB 2W82A 3OS1A 2E1OA 1BI1A 2QBYA 4I98B 3FKJA 5TGTA 2R93J 3PNVA 3BY6A 1WJEA 2QUFA 1BN5A 1MZBA 1IUFA 2IEKA 1IV6A 3QPHA 1A6QA 1I39A 1ZRFA 1SAUA 3F22A 2LK2A 2BY1A 5K1YA 4U0YA 3T8RA 3BP8A 4A0XA 2BBYA 5FLXZ 3M8EA 2CW8A 4M73A 1ETWA 4GXOA 1TTYA 2FD5A 3JW4A 1OPCA 3H9JA 1DU0A 2BOLA 2FJ1A 3K69A 4M3DA 4M9XA 1A6IA 3GTGJ 3OYEA 4MTDA 3DKXA 6PAXA 5J4VA 4ABZA 4ZDOA 1TWFJ 3FXOA 3SEZA 3FIWA 4TV7A 4A0ZA 2HR3A 2KJCA 1TWGJ 1HW2A 2OCEA 2LF8A 3Q0VA 4BACA 1SANA 4X6AJ 3AKZA 4HW0A 3B73A 4RMNA 3S3NA 2OD5A 5JFRA 2CQKA 4FX0A 4XKCA 1MDMB 4PSWA 4IRIA 1R22A 5E3MA 4E7LA 2OZUA 3DPLC 2L7MP 4QTRA 4EGZA 1GVJA 1KGSA 1W36C 3H0GJ 5EG0A 2FRHA 5KAFC 2DDBA 3BQYA 1JE8A 3S14J 3H3UA 4OIRF 2FBIA 1QPMA 1RUOA 4UB8C 4RAGA 1J9IA 4G6TB 4BGDA 4KMFA 4BBSJ 3OV8A 3PM1A 3V8JA 1H9TA 3BT9A 2F4IA 5IT3A 5C44J 3K6GA 1MMDA 3QPTA 2HOEA 2UWMA 2ZJRF 2EPFA 2XB0X 2H94A 3QU3A 3QWLA 2PMUA 2X9DA 1HW1A 3OYCA 3H1CA 1DPRA 2ID6A 3X2QH 4LMYA 1MBHA 3K9TA 2V1NA 4ESFA 2K27A 1W5SA 3SHFA 5E1XA 1BA5A 2FNPA 1SFKA 1YYVA 2IGMA 2VJJA 1DP3A 3GWZA 1GVDA 1WHUA 2GBYA 2RVCA 3G1LA 3GEZA 3EYIA 1LFBA 1VNDA 2GQQA 3S3MA 1IN4A 1ONVA 2HOTA 3ZQFA 2ISZA 1LVAA 2IA2A 1QPIA 4JP0A 4C3JJ 1A5JA 2M2EA 1YE9A 2P5VA 1STZA 3J7AO 2XPUA 2V26A 3CUOA 5D5VB 5DM6F 3WTUC 2R7FA 1V5FA 1S3JA 1IN5A 4EM0B 2XASA 4N9IA 2DA3A 2VQLA 4DNCA 1FP2A 2FMLA 2FNAA 3CUQC 5KVRA 3ML6A 1ITYA 2AHQA 2O3FA 1MMGA 2NAZA 4RGXA 3AFHA 3JAMZ 4YIRX 2PMZN 5J40A 2QQ8A 4L0YB 2XPWA 3QODA 1YIOA 4KNYA 3D5SC 5LBQA 2E1CA 1WJFA 4IO9F 2VKVA 3OY9A 1QVUA 3CLQA 4Y33A 1YIJI 3QPLA 4FE7A 5F0CA 3SXYA 4OIPF 3TQNA 3BDDA 2LF7A 4GO1A 1CF7A 2DFHA 2A6EF 2PN6A 3ZR8X 4P96A 4U87A 4IHSA 2K9LA 3CC2I 2LMDA 2XGEA 2E71A 3CJRB 2DOFA 2EH3A 2W7NA 3F8MA 3E6MA 1UHMA 2M4KA 1SMTA 3BR6A 3Q0WA 4LD5A 2IS2A 1R1UA 4JX5A 1X3UA 5H2FC 2HYGD 2HYFA 2CSOA 1UJ8A 4UVCA 2IRFG 3E7LA 2CV0A 2A61A 3WE2A 1WRJA 2X6WA 2KKOA 4E7ZA 5F08A 5J4YA 5FLXK 2DPUA 2VQGA 5D6FA 1A04A 2G7UA 4ETSA 3G73A 2JRMA 2J5OA 2TDXA 1O57A 3K70C 1ETQA 2M0MA 2WBMA 4MQ9F 5IP7J 1JXSA 2A5YB 2ZXIA 3RJPA 4GGGA 2P6TA 2YU9J 1MDMA 1J5YA 3HRTA 4Z2YA 3HOSA 3FHZA 1FMVA 1TNTA 3EDPA 1FP1D 5H6RA 5HVQC 1OCTC 1IRGA 3BTCA 2OJED 2KIQA 2EJRA 2P7VB 3QP6A 4EM2A 3MKYB 3RZDJ 3C18A 3NWTA 5IT9Z 3MZ8A 4W97A 1R4NB 4FETA 2DT5A 3DTIA 5GAGJ 5B66C 2ICWG 5HODA 2ZSIB 4A3DJ 1U6GA 4LG3A 4F55A 5FKNA 1GXPA 2JSCA 1UCRA 3Q9VA 3TDZC 3F8FA 3BG5A 4YFNF 4UVAA 2DMUA 2WAFA 3CC4I 4AIKA 1S7OA 2WY7Q 2C6YA 2YSRA 3BG9A 4ZTJA 4PJMA 3E6CC 3NQOA 1JKRC 1GDTA 2EV6A 5DD4A 4IHTA 4XLFA 2XRLA 4HYEA 2R7TA 1ON2A 3U9GA 5E3LA 2FBHA 2HOAA 5JLWA 1OLTA 4HV6A 1XMXA 1LDDA 3MAJA 2ZSHB 3DFGA 2O03A 3LFKA 3PL8A 2NVTJ 4MNUA 4A3GJ 4N9HA 2Y9YA 3AL0B 3LSTA 3QYFA 1CF7B 3K4BA 1P7JA 2O61A 3U21A 1TNSA 2YUSA 4JX6A 5E1WA 2R7WA 3ZOBA 4C30A 4LOCA 3IP4B 4EJWA 3V42A 2DFEA 3JREA 1YJ9I 1LE8A 3ZQHA 3ABLH 2L9SA 3F21A 2Y2ZA 3U2RA 3RYRA 1B8IB 3COAC 3PUFA 5J1YA 2RREA 2Z33A 4IHVA 2UXNA 2DW4A 1AOYA 1MIJA 4I99C 3HOYJ 4OMYA 2M1BA 2KDZA 4V19K 4H4KC 1O7FA 2KISA 3FISA 1EH7A 3SQNA 1VFCA 2D1HA 4LJZF 4KISA 2R4GA 1IJWC 3IH4A 3DPUA 4NQWB 3NWSA 3RPUA 4M9ZA 2CH0A 4XMYA 2HEOA 5FLVA 1NG7A 4HPQA 3BG3A 4A3FJ 3P7NA 3DQVC 4MTEA 2OZ6A 2M4GA 3BOQA 1J0RA 3CLOA 4A3MJ 3SZGA 2MABA 3VFZA 4M3FA 4RLQA 1LDKB 3E6DA 3OYFA 3HOXJ 1QZZA 3LA7A 3E5UA 5LRRA 2OAZA 5CQEA 2DMPA 4QSHA 1MMAA 1WQ2A 3R0JA 2JPCA 3RKWA 3HOUJ 3LNQA 3CUQA 1SD6A 2EZKA 3L2VA 2CUJA 3OYMA 4ENMA 5IPAA 1UG2A 2HYJA 2LRDA 3SDGA 1R23A 2D5VA 1WGXA 3KP3A 3DKYA 4XLCA 3K70D 3QRFF 1FEXA 1IDZA 2OBPA 1RR7A 3CCEI 3ZGKA 4GFBA 1IN7A 2WA0A 1MBEA 4MHGA 4XLAA 4XICA 3IKVA 2F5CA 3FBIB 2PG4A 1OCRH 2J5PA 2X1EA 2YR2A 4A3EJ 3WG9A 2JUGA 4NB5A 1U8BA 2KZVA 1X3WB 5ED4A 1ZG5A 3ASNH 3FBNB 3HRUA 1SVOA 2GXAA 5J8CA 2GXBA 2JUCA 5D8KB 2E2HJ 5E8GA 2NNNA 1HKSA 1ZG1A 4G12A 1BR4A 1FIPA 1OR7A 2BY2A 4XN0A 1R7JA 1GV2A 2A6TA 3CCSI 1WI9A 1BIAA 3LSPA 3LA2A 2ME0A 4MEYF 2IP2A 5B1BH 2KMUA 5KK1A 1W1WE 1LQ1A 5K5RA 4BY1J 1OMIA 3JSPA 1YFHA 1ZN2A 4MO7A 1G3YA 1VTNC 2MC3A 2PMZA 1RUNA 3M4OJ 1R5ID 3KE2A 4E7IA 1ZRDA 3H35A 1U5TC 1X2MA 3KZIC 3F72A 3F3XA 3HTSB 4LLNA 2K40A 3K2ZA 1YOVB 4WK8F 4ZC3A 5LD2C 3ESWB 3DCFA 3F8CA 2ZBKA 2IGOA 2JK3A 2DTRA 4W1UA 3GUDA 1WPKA 2R7ZJ 5ILUA 3W2AA 2VJ4A 3LFUA 4D7NA 4M9SA 2Q8KA 5HDKA 4QWQA 2HWVA 2RN7A 1QQIA 2A6HF 5IP6A 2P4WA 2X6OA 3G71I 3VSLA 2CRGA 1UHWA 4DOZA 1VQOI 3OOUA 5K5OA 3K4NA 1UZCA 2DDAA 4IQJA 4PJJA 3KYLA 3ONQA 2LR8A 1IXCA 2B9SA 1VQNI 4IHWA 1HKTA 3LSJA 4F91B 2KL4A 4ZYHA 3OYLA 1PUEE 5IOYA 2QA4I 4BQOA 2K4JA 4BYYA 1QHHD 3HG9A 5EG0B 4DYRA 2E1MC 3PQJA 5M3MJ 3MKWB 4HDUA 4LLGF 3DPTA 1XDUA 3QP5A 3SJMA 4ZTFA 2XF5A 1K4TA 1OCOH 2FXAA 4WXHA 3PFYA 5LGUA 1I5ZA 2XDVA 2W57A 1XGOA 3EUKL 2VQHA 2X0LA 3NARA 3Q9SA 3J7ZI 1MNMC 3QPSA 1FBUA 2K9NA 3BJAA 3HHHA 2UZKA 1OR7C 2E2IJ 2ZJQF 2HZDA 3M1EA 4HEA2 2DO7A 2KIMA 4OMZA 4E6KG 1YRNB 1R58A 5E1ZB 5IYBJ 5IYCJ 2NRAC 1WJAA 2DU9A 2IS6A 4B1RA 4L9JA 5AIQA 2EWNA 2K4BA 1HSJA 5JVGF 3HSRA 1N77A 3PO2J 1W36D 4N0BA 4KA4A 3K4LA 3GTJJ 2DA5A 3R6SA 3F0CA 4IL6C 1X1AA 3OIPA 3L2CA 4DZJA 2ACJA 4I7HA 4I76A 2JWTA 2ZXJA 3HUGA 4PFPA 3T1BA 2CQ7A 4M3GA 1W4MA 1IV8A 2DK5A 1VQ4I 3VOEA 4A3CJ 1RIOH 4CZCA 3GCMA 4XR6A 5H20A 4U7BA 1HKQA 3E6BA 3BTLA 3VYTB 2CG4A 2WC2A 4RLFA 4OIOF 1BW5A 1TZLA 1RI7A 3JRDA 4ASNA 3I4PA 3BCAA 2R5YA 2JJ7A 2EFQA 3A03A 4NDLA 1KYZA 4ITVA 4F7ZA 1T0FA 1BM9A 1OQYA 2OUMA 1P2FA 2KIFA 1P92A 5J1UA 1WJDA 3A01A 3TO9A 1P6RA 3CO6C 1X4PA 4FISA 4DYCA 2PJRB 4HSRA 4EEFG 2MH9A 2QQBA 3CCUI 1HOMA 4CCOA 2Z9OA 2EFOA 5LFAA 2HTSA 3K4JA 1TBXA 2A5WA 3KEOA 2DI3A 3HKZN 2F2EA 3ROUA 5D5WB 3OSFA 5AONA 4LGWA 5DEQA 5K7ZA 3GMEA 5IY5H 4PJ0C 3CMYA 2Y30A 1TQMA 2XSJC 1YJWI 3M3YJ 4E7JA 2KZGA 3R61A 4EMSA 2IAIA 2VLAA 2QCOA 1BOBA 4B43A 4E70A 3DEEA 2VBYA 5LRSA 1JKQC 3S17J 2NVUB 2LKPA 4FE4A 3DP7A 1QA6A 1LUJB 1LKXA 3TW6A 3LMMA 2FX0A 2CO5A 2FA5A 3L7WA 3IC7A 3HZJA 2DTZA 2XSDC 1MD0A 3DU6A 4XIDA 4QIWN 4RB0A 3T8TA 3DKWA 2WWYA 3S3OA 2NVXJ 3F23A 1IUYA 1SVLA 2DMQA 4H0EA 5K7HA 2YS9A 5D4RA 3L2UA 2MD5A 2X6YA 5K5QA 1K7AA 3CTAA 1VQ8I 2OQGA 4HOBA 2GXGA 4JYKA 3FM3A 5CVVA 4C2UA 2XRNA 3Q3SA 1PUFA 4HF0A 1SFOJ 2JA2A 4YIFA 2BE5F 3CP2A 2AQFA 3LOCA 3SZPA 4A69C 4HQEA 1QGPA 2XAQA 5DUKA 5M5YJ 1UG0A 2GOMA 3I71A 3CMEI 5HOOA 3OL4A 3IRRA 3F6VA 2OC6A 4AVPA 2HDDA 3BPXA 1LDJA 4BJ5C 4L9NA 2HZTA 4IQ4A 1DUXC 4HF2A 4LG0B 1IO2A 2M8EA 1MGTA 3L9FA 2F48A 2DA6A 1DU6A 4P9FA 3J81K 5CQGA 4YEJA 2JSPA 3V8KA 2M7BA 1QU3A 2IXSA 3MQ0A 4BKXA 4MGRA 3VB2A 1BI2A 1WI3A 2Z3YA 1LFUP 2EILH 4C9YA 2L02A 2CV2A 3ERMA 3KZZA 3WTZA 1D8KA 2X1DA 1IN8A 1IDYA 3UNGC 4CA0A 3I53A 2VJ5A 1GT0C 2QENA 2W1OA 4S05A 2JA7J 1YX3A 5BMZA 1UHSA 4V2GA 1MJAA 4Y3OA 3IKTA 2QWWA 4IF4A 3M07A 2EFNA 1QHGA 4RB2C 1ZLKA 3HRMA 4KITB 4MFEA 2M7AA 4IX7A 2R5ZB 1O3RA 4UVBA 1D3YA 4UXNA 1XGMA 2RGVA 5EEAA 4Z6YA 3J80Z 3M8JA 3QQAA 3TDUC 2DBBA 3GO5A 3HSFA 4A3JJ 1ETYA 4RAFA 1UFMA 1YG2A 5JLXA 4L5JA 3NAUA 2MBFA 1E3PA 3PSIA 1U8RA 1T2KA 3NEUA 3ERED 4ZZDA 2HDWA 4ZYGA 2BXYA 4Q47A 3EUAA 5FJ8J 3OYDA 4D9JA 1F36A 5DM7F 3AG2H 3PIPF 2AXLA 2TCTA 1FC3A 1T95A 1MJBA 2P0WA 2R7RA 2ZMEB 1JHFA 4AM3A 2DJIA 1XGSA 1Z6TA 1OFCX 2D45A 2E60A 4PGHA 4JK1X 2QM3A 1TT0A 3FK6A 1ORKA 5EZGA 2LY9A 3ECOA 4G6DA 5M5XJ 4HQMA 4A3IJ 1VQKI 4AD9A 4A3BJ 2IA0A 3TEDA 2V6EA 3EQLF 1EA3A 1T98A 1IRFA 1ETVA 1KQ9A 4A6EA 2BGCA 4CCKA 4EJOA 3FXKA 2K9SA 3JCUC 3RQIA 1XCBA 5E3OA 3TP3A 1HCRA 1JHHA 1V5GA 1W5CC 3BWGA 3CUQB 3KP2A 3K1NA 4KT5C 1T0FC 5HS7A 3SYTA 2VQCA 5B1AH 4A0YA 3KETA 4QLCU 3BTIA 2NVYJ 1APLC 1ZTRA 3S8PA 2VXZA 3PNTA 4LIVA 2M8GX 3C2HA 2VT3A 1LFPA 1J7KA 2LY2A 1UAAA 1N75A 3U1DA 1EKEA 1JUPA 4X1EA 2KRHA 5ILSA 3MKZA 2DA1A 4IRGA 3TL4X 4X0GA 3OR2C 2RNJA 3VWBA 1G6NA 2LTPA 4MQVA 4BHBA 2WTEA 2EA2A 5J8FA 1ETXA 1MBJA 3DBHB 2CQQA 3QOPA 1FLIA 4P5OA 1P4XA 1FWZA 4HSTA 1X1BA 4Y52J 2V1XA 2ZNZA 1U0JA 4R1HA 5LEKA 1R4MB 2DYRH 2PX9A 3K4CA 3GTQJ 4R8HA 5A2QK 4AIJA 3N4MA 3I55I 5TRDA 3HYIA 3IWZA 3QOEA 3OSGA 2WB1N 3KP7A 2MG4A 2HI3A 3VYSB 3W2VA 2EB7A 2LP0A 2E34A 2NXNB 2P8TA 3HM5A 4XLPF 2NS0A 2H09A 2ELJA 3C7JA 3G6EI 3CC7I 3UR3C 4IHYA 2HGCA 3R4KA 4ENKA 3UKGA 1Z6RA 4MFDA 3S2DJ 1QRYA 2OU2A 2VJIA 3JRFA 4EVIA 2ZNYA 4XL9A 1T38A 2M87A 1GV5A 2EBIA 2Y31A 4I02A 5D5XB 3CCMI 4B8XA 5HNFA 3QYBA 1FYMA 1QZEA 3ZQQA 2O8KA 4WWCA 3TMOA 4XLHA 4U88A 2DMTA 2XAFA 3WGGA 1H88C 2MSYA 4CYCA 5GTHC 5F64A 2BY3A 2MGQA 1FYKA 1S29A 2GIZA 2A05A 3S1NJ 1I6XA 5GAEJ 4UUTA 1QZYA 4DGWB 2VN2A 2WB1A 1P4WA 1WFXA 3HPHA 1X3ZB 2AXTC 2V1DA 3PIOF 1PP7U 2RQQA 3H0DA 4EQQA 3GZNB 1DGWY 1H9GA 3RKQA 2P5LC 3ABKH 1YS7A 5B3SH 2COMA 4B3XA 1DGRM 1Z67A 2HFHA 2VPRA 3KEYA 4UUVA 3GTLJ 4KUMA 2DT6A 4AIDA 2E2JJ 1FIAA 2RC4A 1X4OA 5DCFA 5JR3A 1ZLJA 2L4MA 3ZMTA 4BDZA 3FMRA 2BW3B 4OAZA 5E18F 3HOZJ 1XMKA 1WJCA 3CDHA 2BZTA 2QVOA 1SC7A 4LB6B 2MYSA 3DV8A 1V4RA 3W2WA 1I1GA 2QQ9A 2CS3A 3WODF 4NC8A 3RTRA 3GTOJ 1B6AA 3DEUA 3CJNA 2XKOA 2R7XA 4A12A 1A36A 1Y0UA 1G3SA 4EATA 1FOWA 3AG1H 3MN2A 1NH3A 3OYAA 5KCMA 3WE3A 1IZ1A 3E5XA 5C4JJ
chains in the Genus database with same CATH topology
2COBA 1GV2A 4XK4A 3I4MJ 4C3IJ 2EZHA 2LVSA 3LSPA 1ZR2A 1AKHB 2ME0A 3JRIA 2NOGA 1I50J 1JT0A 4BY1J 3CQZJ 1RPWA 2QF7A 1TWAJ 3K7AJ 2DMNA 1O4XA 4MO7A 3BR2A 1E3OC 4V2FA 5E3NA 1FJLA 2GM4A 3HDDA 3M4OJ 4AC0A 1JTYA 2JN6A 2XGCA 3HGGA 1X2MA 4M3EA 2K40A 3CDLA 2EZLA 3FK7A 2R0QC 1Z0XA 2M9HA 3DCFA 2TRTA 2NS8A 5EZHA 2L7FP 1I6HJ 1LE8B 2JK3A 1HDDC 4W1UA 1B72B 1WPKA 2R7ZJ 1IGNA 4B4CA 2JA8J 4D7NA 3RZOJ 1JKOC 5FLMJ 5F0FA 5IP6A 3PO3J 2K9QA 3S16J 4UUSA 2HQ5A 2X6OA 3IV5A 2CRGA 5BNGA 2M34A 3OOUA 1HDPA 3ZQCA 1U9NA 1JT6A 2LR8A 3TP0A 4IHWA 3LSJA 3FKIJ 2DA7A 5IOYA 2B63J 1H8AC 2AO9A 1T33A 4CYCB 1XS9A 3GTKJ 1MSEC 1X58A 2OPTA 3HBLA 3A02A 1ETKA 2JMWA 5EG0B 2L9RA 5M5WJ 4DYRA 5EYRA 5M3MJ 1NK3P 3I4NJ 3SJMA 1QVTA 1Q1VA 1HLVA 2XPVA 3IH3A 1UMQA 3NARA 1MNMC 3VPRA 2O9LA 3QPSA 2K9NA 2MW8A 2E2IJ 5J1RA 1EF4A 5EDNA 1X2NA 1YRNB 4S0HB 3K2AA 5IYBJ 1XG1A 5IYCJ 4B1RA 3HOWJ 3C2BA 1D5YA 1MH3A 1BJZA 4IHXA 1IRZA 1ZQ3P 3PO2J 1AKHA 2E1OA 3GTJJ 2Y9ZA 2DA5A 3F0CA 2R93J 4DZJA 4I76A 2CU7A 2JWTA 1IUFA 2IEKA 5FKOA 1IV6A 4M3GA 1XC5A 4A3CJ 1TWHJ 3O8GA 1RESA 2LK2A 2ME6A 1ETWA 2FD5A 1DU0A 1TWCJ 3BTLA 2FJ1A 4M3DA 1BW5A 1U78A 1A6IA 3GTGJ 2IBDA 3JRDA 4ABZA 2JJ7A 2R5YA 1TWFJ 3FIWA 3A03A 4NDLA 1TWGJ 4M3BA 1B72A 1ZGWA 5F27A 4JX4A 2EQRA 3Q0VA 5J1UA 4HNVA 1SANA 4X6AJ 1JUSA 2ECBA 3A01A 4FISA 2HXOA 1WH5A 4DYCA 2H8RA 3BR1A 4D5CA 5E3MA 3Q0UA 3O8HA 4EEFG 3JRAA 2L7MP 3ZQLA 4QTRA 1HOMA 3B6AA 9ANTA 2LKXA 4XRSG 1OJLA 1OCPA 3H0GJ 3WHCA 5EG0A 3OSFA 3BQYA 3HKZN 3S14J 3BTJA 1WCMJ 5DTDA 5K7ZA 3HGYA 5EGOA 3CMYA 2Y30A 4BBSJ 3M3YJ 1T56A 1FTTA 3G1MA 3PM1A 1P7IA 4DW6A 2IAIA 3BT9A 2ECCA 2QCOA 5C44J 4MLOA 4B3AA 1JKQC 4BBRJ 2LD5A 2NS7A 2ZB9A 3S17J 2XB0X 4FE4A 2X9DA 3TW6A 3BR5A 2ID6A 2FX0A 1W0TA 1MBHA 2DTZA 2R92J 2XSDC 1Z77A 4A3LJ 5IYDJ 1BA5A 4XIDA 4QIWN 4D7MA 1PUFB 2NVXJ 4C2MJ 1GVDA 2GBYA 2DMQA 1RKWA 3G1LA 5K7HA 4L5EA 1LFBA 2G0EA 2YS9A 1VNDA 2HOTA 3ZQFA 4JYKA 1QPIA 1RETA 4JP0A 3B6CA 4C3JJ 1JGGA 3JRGA 1A5JA 2M2EA 3Q3SA 5FKMA 1PUFA 3GBGA 1SFOJ 2XPUA 3ZQIA 3LOCA 4A69C 3MVPA 3H3VK 4DYQA 4A93J 5M5YJ 3JRBA 5M3FJ 2DA3A 2CUFA 3IH2A 2N8GA 2OF7A 1MBFA 1ITYA 2AHQA 2HDDA 1CQTA 3BR0A 1BL0A 2CJJA 2GLOA 1ZK8A 2PMZN 1WH7A 2DA6A 2P81A 2XPWA 1DU6A 5C3EJ 3DEWA 4BKXA 3A01B 1ZR4A 3S1QJ 1WI3A 1LFUP 2VKVA 1QVUA 2X48A 1GUUA 3QPLA 4FE7A 5F0CA 4C3HJ 2ELKA 4RDUA 1IDYA 5F0HA 1GT0C 2I10A 2JA7J 2HOSA 2XGEA 1W0UA 1H89C 1FTZA 1UHSA 4V2GA 3TW7A 4XRMA 2EH3A 2VUMJ 1MSFC 4MFEA 3BR6A 3Q0WA 2R5ZB 2Y0SN 4JX5A 3JRHA 1BW6A 4RBOA 1ENHA 3LSGA 3E7LA 5EEAA 3HB9A 5K7FA 5GPAA 2WV1A 3QQAA 5F08A 5FKKA 4A3JJ 1ETYA 1TC3C 5JLXA 2CUEA 3SFIA 3NAUA 1MBKA 2DN0A 4DZPA 1ETQA 5IP7J 3D1NI 1JKPC 2YU9J 5FJ8J 1F36A 2XB5A 2TCTA 1OCTC 3S1RJ 2ID3A 3BTCA 3LSRA 1IG7A 2JA5J 3GTPJ 2KT0A 3RZDJ 3W6VA 1OFCX 4IEJA 4W97A 1R9TJ 1NTCA 1JUMA 5IP9J 3HOVJ 5HODA 3FK6A 1ORKA 5EZGA 4A3DJ 4A3KJ 2LY9A 5M5XJ 4A3IJ 4A3BJ 5FKNA 3TEDA 5DS9A 2CQXA 1ETVA 3JRCA 1JJ6C 3BG5A 1HF0A 2DMUA 4M6VA 3HEFA 2K9SA 3ZQGA 3GTMJ 3MKLA 3RQIA 1HCRA 5E3OA 3TP3A 4FCYA 3BG9A 4AUXA 1JKRC 2H1KA 3BTIA 1GDTA 2WAQN 2NVYJ 3BR3A 1APLC 1ZTRA 4BXXJ 3WHBA 2M8GX 2XRLA 1AHDP 1JUPA 4X1EA 1ETOA 1K83J 2DA1A 5E3LA 2HOAA 2XGDA 2DA2A 5JLWA 1POGA 2LTPA 3S2HJ 1G2HA 4FTHA 1ETXA 1MBJA 1ZKGA 2CQQA 2NVTJ 4A3GJ 1YRNA 2Y9YA 1IC8A 1P7JA 4BY7J 2YUSA 4JX6A 1JJ8C 4Y52J 5GP9A 3ZOBA 3OIOA 1K61A 2E19A 3GTQJ 1U9OA 1Y1VJ 4LOCA 2VI6A 3JREA 4J19A 2WB1N 3OSGA 3BQZA 1LE8A 3ZQHA 2R5ZA 2MG4A 2DA4A 2HI3A 2LP0A 3HM5A 2Y2ZA 1F43A 2L7ZA 1B8IB 4IHYA 2JA6J 5J1YA 2FQ4A 3UKGA 4MFDA 4IHVA 1VI0A 3S2DJ 1QRYA 5GPCA 4UUSB 3JRFA 2NVQJ 3S15J 2R5YB 3HOYJ 5EF6A 1GV5A 2KDZA 2EBIA 2Y31A 2O7OA 3FISA 2O8KA 3S1MJ 5IOZA 1B8IA 1VFCA 2RAEA 4AYBN 1IJWC 3IH4A 2DMTA 2LLKA 1H88C 2MSYA 4CYCA 5FLVA 2MGQA 3BG3A 3S1NJ 4A3FJ 3G1OA 1NK2P 2L0KA 4A3MJ 4UUTA 4M3FA 1VF9A 3HOXJ 3CCYA 3JR9A 2DMPA 4QSHA 5EGOB 3HOUJ 3LNQA 2W48A 2DJNA 2EZKA 5IPAA 3RKQA 1UG2A 2HYJA 4I6ZA 3SDGA 2D5VA 2VPRA 1WGXA 4D5FA 2VKEA 1FEXA 1IDZA 1RR7A 3L1PA 3GTLJ 5F04A 4GFBA 4Y7NJ 1MBEA 1FIAA 2E2JJ 4XICA 2HXIA 4MIMA 1AU7A 4A3EJ 1U8BA 3HOZJ 1RKTA 2LFBA 1Y1WJ 2M0CA 5C4XJ 5FKLA 1JTXA 1MH4A 2EZIA 1S7EA 5J3LA 4XRSA 3GTOJ 5F1JA 2E2HJ 1MBGA 4G12A 3MN2A 1FIPA 1I3QJ 5C4JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COB A;  1GV2 A;  4XK4 A;  3I4M J;  4C3I J;  2EZH A;  2LVS A;  3LSP A;  1ZR2 A;  1AKH B;  2ME0 A;  3JRI A;  2NOG A;  1I50 J;  1JT0 A;  4BY1 J;  3CQZ J;  1RPW A;  2QF7 A;  1TWA J;  3K7A J;  2DMN A;  1O4X A;  4MO7 A;  3BR2 A;  1E3O C;  4V2F A;  5E3N A;  1FJL A;  2GM4 A;  3HDD A;  3M4O J;  4AC0 A;  1JTY A;  2JN6 A;  2XGC A;  3HGG A;  1X2M A;  4M3E A;  2K40 A;  3CDL A;  2EZL A;  3FK7 A;  2R0Q C;  1Z0X A;  2M9H A;  3DCF A;  2TRT A;  2NS8 A;  5EZH A;  2L7F P;  1I6H J;  1LE8 B;  2JK3 A;  1HDD C;  4W1U A;  1B72 B;  1WPK A;  2R7Z J;  1IGN A;  4B4C A;  2JA8 J;  4D7N A;  3RZO J;  1JKO C;  5FLM J;  5F0F A;  5IP6 A;  3PO3 J;  2K9Q A;  3S16 J;  4UUS A;  2HQ5 A;  2X6O A;  3IV5 A;  2CRG A;  5BNG A;  2M34 A;  3OOU A;  1HDP A;  3ZQC A;  1U9N A;  1JT6 A;  2LR8 A;  3TP0 A;  4IHW A;  3LSJ A;  3FKI J;  2DA7 A;  5IOY A;  2B63 J;  1H8A C;  2AO9 A;  1T33 A;  4CYC B;  1XS9 A;  3GTK J;  1MSE C;  1X58 A;  2OPT A;  3HBL A;  3A02 A;  1ETK A;  2JMW A;  5EG0 B;  2L9R A;  5M5W J;  4DYR A;  5EYR A;  5M3M J;  1NK3 P;  3I4N J;  3SJM A;  1QVT A;  1Q1V A;  1HLV A;  2XPV A;  3IH3 A;  1UMQ A;  3NAR A;  1MNM C;  3VPR A;  2O9L A;  3QPS A;  2K9N A;  2MW8 A;  2E2I J;  5J1R A;  1EF4 A;  5EDN A;  1X2N A;  1YRN B;  4S0H B;  3K2A A;  5IYB J;  1XG1 A;  5IYC J;  4B1R A;  3HOW J;  3C2B A;  1D5Y A;  1MH3 A;  1BJZ A;  4IHX A;  1IRZ A;  1ZQ3 P;  3PO2 J;  1AKH A;  2E1O A;  3GTJ J;  2Y9Z A;  2DA5 A;  3F0C A;  2R93 J;  4DZJ A;  4I76 A;  2CU7 A;  2JWT A;  1IUF A;  2IEK A;  5FKO A;  1IV6 A;  4M3G A;  1XC5 A;  4A3C J;  1TWH J;  3O8G A;  1RES A;  2LK2 A;  2ME6 A;  1ETW A;  2FD5 A;  1DU0 A;  1TWC J;  3BTL A;  2FJ1 A;  4M3D A;  1BW5 A;  1U78 A;  1A6I A;  3GTG J;  2IBD A;  3JRD A;  4ABZ A;  2JJ7 A;  2R5Y A;  1TWF J;  3FIW A;  3A03 A;  4NDL A;  1TWG J;  4M3B A;  1B72 A;  1ZGW A;  5F27 A;  4JX4 A;  2EQR A;  3Q0V A;  5J1U A;  4HNV A;  1SAN A;  4X6A J;  1JUS A;  2ECB A;  3A01 A;  4FIS A;  2HXO A;  1WH5 A;  4DYC A;  2H8R A;  3BR1 A;  4D5C A;  5E3M A;  3Q0U A;  3O8H A;  4EEF G;  3JRA A;  2L7M P;  3ZQL A;  4QTR A;  1HOM A;  3B6A A;  9ANT A;  2LKX A;  4XRS G;  1OJL A;  1OCP A;  3H0G J;  3WHC A;  5EG0 A;  3OSF A;  3BQY A;  3HKZ N;  3S14 J;  3BTJ A;  1WCM J;  5DTD A;  5K7Z A;  3HGY A;  5EGO A;  3CMY A;  2Y30 A;  4BBS J;  3M3Y J;  1T56 A;  1FTT A;  3G1M A;  3PM1 A;  1P7I A;  4DW6 A;  2IAI A;  3BT9 A;  2ECC A;  2QCO A;  5C44 J;  4MLO A;  4B3A A;  1JKQ C;  4BBR J;  2LD5 A;  2NS7 A;  2ZB9 A;  3S17 J;  2XB0 X;  4FE4 A;  2X9D A;  3TW6 A;  3BR5 A;  2ID6 A;  2FX0 A;  1W0T A;  1MBH A;  2DTZ A;  2R92 J;  2XSD C;  1Z77 A;  4A3L J;  5IYD J;  1BA5 A;  4XID A;  4QIW N;  4D7M A;  1PUF B;  2NVX J;  4C2M J;  1GVD A;  2GBY A;  2DMQ A;  1RKW A;  3G1L A;  5K7H A;  4L5E A;  1LFB A;  2G0E A;  2YS9 A;  1VND A;  2HOT A;  3ZQF A;  4JYK A;  1QPI A;  1RET A;  4JP0 A;  3B6C A;  4C3J J;  1JGG A;  3JRG A;  1A5J A;  2M2E A;  3Q3S A;  5FKM A;  1PUF A;  3GBG A;  1SFO J;  2XPU A;  3ZQI A;  3LOC A;  4A69 C;  3MVP A;  3H3V K;  4DYQ A;  4A93 J;  5M5Y J;  3JRB A;  5M3F J;  2DA3 A;  2CUF A;  3IH2 A;  2N8G A;  2OF7 A;  1MBF A;  1ITY A;  2AHQ A;  2HDD A;  1CQT A;  3BR0 A;  1BL0 A;  2CJJ A;  2GLO A;  1ZK8 A;  2PMZ N;  1WH7 A;  2DA6 A;  2P81 A;  2XPW A;  1DU6 A;  5C3E J;  3DEW A;  4BKX A;  3A01 B;  1ZR4 A;  3S1Q J;  1WI3 A;  1LFU P;  2VKV A;  1QVU A;  2X48 A;  1GUU A;  3QPL A;  4FE7 A;  5F0C A;  4C3H J;  2ELK A;  4RDU A;  1IDY A;  5F0H A;  1GT0 C;  2I10 A;  2JA7 J;  2HOS A;  2XGE A;  1W0U A;  1H89 C;  1FTZ A;  1UHS A;  4V2G A;  3TW7 A;  4XRM A;  2EH3 A;  2VUM J;  1MSF C;  4MFE A;  3BR6 A;  3Q0W A;  2R5Z B;  2Y0S N;  4JX5 A;  3JRH A;  1BW6 A;  4RBO A;  1ENH A;  3LSG A;  3E7L A;  5EEA A;  3HB9 A;  5K7F A;  5GPA A;  2WV1 A;  3QQA A;  5F08 A;  5FKK A;  4A3J J;  1ETY A;  1TC3 C;  5JLX A;  2CUE A;  3SFI A;  3NAU A;  1MBK A;  2DN0 A;  4DZP A;  1ETQ A;  5IP7 J;  3D1N I;  1JKP C;  2YU9 J;  5FJ8 J;  1F36 A;  2XB5 A;  2TCT A;  1OCT C;  3S1R J;  2ID3 A;  3BTC A;  3LSR A;  1IG7 A;  2JA5 J;  3GTP J;  2KT0 A;  3RZD J;  3W6V A;  1OFC X;  4IEJ A;  4W97 A;  1R9T J;  1NTC A;  1JUM A;  5IP9 J;  3HOV J;  5HOD A;  3FK6 A;  1ORK A;  5EZG A;  4A3D J;  4A3K J;  2LY9 A;  5M5X J;  4A3I J;  4A3B J;  5FKN A;  3TED A;  5DS9 A;  2CQX A;  1ETV A;  3JRC A;  1JJ6 C;  3BG5 A;  1HF0 A;  2DMU A;  4M6V A;  3HEF A;  2K9S A;  3ZQG A;  3GTM J;  3MKL A;  3RQI A;  1HCR A;  5E3O A;  3TP3 A;  4FCY A;  3BG9 A;  4AUX A;  1JKR C;  2H1K A;  3BTI A;  1GDT A;  2WAQ N;  2NVY J;  3BR3 A;  1APL C;  1ZTR A;  4BXX J;  3WHB A;  2M8G X;  2XRL A;  1AHD P;  1JUP A;  4X1E A;  1ETO A;  1K83 J;  2DA1 A;  5E3L A;  2HOA A;  2XGD A;  2DA2 A;  5JLW A;  1POG A;  2LTP A;  3S2H J;  1G2H A;  4FTH A;  1ETX A;  1MBJ A;  1ZKG A;  2CQQ A;  2NVT J;  4A3G J;  1YRN A;  2Y9Y A;  1IC8 A;  1P7J A;  4BY7 J;  2YUS A;  4JX6 A;  1JJ8 C;  4Y52 J;  5GP9 A;  3ZOB A;  3OIO A;  1K61 A;  2E19 A;  3GTQ J;  1U9O A;  1Y1V J;  4LOC A;  2VI6 A;  3JRE A;  4J19 A;  2WB1 N;  3OSG A;  3BQZ A;  1LE8 A;  3ZQH A;  2R5Z A;  2MG4 A;  2DA4 A;  2HI3 A;  2LP0 A;  3HM5 A;  2Y2Z A;  1F43 A;  2L7Z A;  1B8I B;  4IHY A;  2JA6 J;  5J1Y A;  2FQ4 A;  3UKG A;  4MFD A;  4IHV A;  1VI0 A;  3S2D J;  1QRY A;  5GPC A;  4UUS B;  3JRF A;  2NVQ J;  3S15 J;  2R5Y B;  3HOY J;  5EF6 A;  1GV5 A;  2KDZ A;  2EBI A;  2Y31 A;  2O7O A;  3FIS A;  2O8K A;  3S1M J;  5IOZ A;  1B8I A;  1VFC A;  2RAE A;  4AYB N;  1IJW C;  3IH4 A;  2DMT A;  2LLK A;  1H88 C;  2MSY A;  4CYC A;  5FLV A;  2MGQ A;  3BG3 A;  3S1N J;  4A3F J;  3G1O A;  1NK2 P;  2L0K A;  4A3M J;  4UUT A;  4M3F A;  1VF9 A;  3HOX J;  3CCY A;  3JR9 A;  2DMP A;  4QSH A;  5EGO B;  3HOU J;  3LNQ A;  2W48 A;  2DJN A;  2EZK A;  5IPA A;  3RKQ A;  1UG2 A;  2HYJ A;  4I6Z A;  3SDG A;  2D5V A;  2VPR A;  1WGX A;  4D5F A;  2VKE A;  1FEX A;  1IDZ A;  1RR7 A;  3L1P A;  3GTL J;  5F04 A;  4GFB A;  4Y7N J;  1MBE A;  1FIA A;  2E2J J;  4XIC A;  2HXI A;  4MIM A;  1AU7 A;  4A3E J;  1U8B A;  3HOZ J;  1RKT A;  2LFB A;  1Y1W J;  2M0C A;  5C4X J;  5FKL A;  1JTX A;  1MH4 A;  2EZI A;  1S7E A;  5J3L A;  4XRS A;  3GTO J;  5F1J A;  2E2H J;  1MBG A;  4G12 A;  3MN2 A;  1FIP A;  1I3Q J;  5C4J J; 
#chains in the Genus database with same CATH topology
 2COB A;  3I4M J;  5ICC A;  4PGG A;  3SEQ A;  1EH8 A;  4Q5S F;  4JOM A;  2LVS A;  3P9I A;  2IA1 A;  3A2K A;  5HDN A;  5TIS C;  1I50 J;  2DT7 B;  1K6O A;  2MD0 A;  1KU2 A;  1JT0 A;  1Y8R B;  1SFU A;  1MKM A;  1RPW A;  2QF7 A;  1TWA J;  1A31 A;  3O3K A;  3HHG A;  3KP4 A;  3RQ4 A;  4Y4R A;  2XAH A;  4V2F A;  5EEG A;  5E3N A;  4BE2 A;  3HDD A;  2X51 A;  4G8X A;  4AC0 A;  5HLT A;  3FMS A;  1ODD A;  3HGG A;  1IXR C;  1KA8 A;  1FZP B;  1BR2 A;  2L54 A;  4CIC A;  4G7O F;  2EZL A;  5CVR A;  4A6D A;  4CCJ A;  1N25 A;  3WTT C;  2M9H A;  5CKT A;  4A5N A;  2W25 A;  1FBQ A;  1LE8 B;  3MD2 A;  3EUH C;  5D6E A;  2V9V A;  2BV6 A;  3IHU A;  1B72 B;  1AA7 A;  1WSU A;  2ZFU A;  3OOP A;  3C1D A;  2E7X A;  2IW5 A;  2G7H A;  4XLE A;  1UEL B;  3S16 J;  3BZK A;  4UUS A;  5BNG A;  1XSX A;  3AL0 C;  1HDP A;  2DFI A;  3HIF A;  1I27 A;  2OV7 A;  3D5R C;  4ZYE A;  3TP0 A;  2ETH A;  3H3Z A;  1IXS B;  4NC6 A;  1H8A C;  4F52 A;  1T33 A;  1XS9 A;  3HBL A;  1G3T A;  3VYR B;  4O5V A;  1Q1H A;  1XB4 A;  1T08 B;  4WX9 A;  5CVJ A;  1L3L A;  3CCJ I;  1YHQ I;  4F92 B;  1LB2 A;  4G6Q A;  1NK3 P;  3FXL A;  1F4K A;  2JRT A;  3I4N J;  2OA4 A;  1Y39 A;  1Q1V A;  5FD5 A;  1B9M A;  1MNE A;  1BOA A;  2W4S A;  2PBI A;  3TO6 A;  3OWT A;  1K78 B;  1HBX G;  2E5Z A;  2O9L A;  1LJ9 A;  1XTA A;  2Z2S B;  4CDG A;  2LYC A;  3K1M A;  1KU7 A;  2ADU A;  4BXU A;  1EF4 A;  5EDN A;  3WTS C;  2LH9 A;  2Z1D A;  3C2B A;  1IRZ A;  2O5R A;  3ISP A;  3KX2 A;  2Y9Z A;  2XF7 A;  2HVQ A;  3MWM A;  2CU7 A;  3DTE A;  3E3V A;  5FKO A;  1XCV A;  1ZAR A;  2XV4 S;  2MA3 A;  3ZXS A;  2F4O B;  1USS A;  1TWH J;  2DK8 A;  3HJE A;  5CPR B;  3O8G A;  1RES A;  4ENN A;  4ENJ A;  1B1B A;  4YG2 F;  2Z5U A;  3WU0 A;  1TWC J;  3K0L A;  4BJT A;  1U78 A;  5FRO A;  4A5M A;  1BR1 A;  1SFX A;  4LK1 F;  4ON0 A;  4IXA A;  4PFO A;  1OIS A;  3PSF A;  5L3G A;  1YI2 I;  3VDX A;  1YS6 A;  2E5N A;  4L9V A;  4M3B A;  3S2W A;  1YW8 A;  3QAH A;  2EQR A;  4JX4 A;  2ECB A;  3D5L A;  2HPI A;  3E1S A;  3ZMS A;  1OYI A;  1B4A A;  5F6F A;  3LAJ A;  2H8R A;  1LVK A;  1HXD A;  3WTW C;  2ISY A;  3O8H A;  3P9K A;  2ZXH A;  1R00 A;  3BRO A;  1Z3X A;  3ZQL A;  3B6A A;  1R5G A;  2F5E A;  4HZF A;  4JQF A;  4L9T A;  4XOR A;  1OJL A;  1OCP A;  2QSF X;  2ZME A;  4XRS G;  3WHC A;  4DJA A;  3OIQ A;  2L5Q A;  1LPQ A;  4RM3 A;  3BTJ A;  4P9U A;  2JVH A;  2I5U A;  5L3C A;  5DTD A;  3I9V 2;  3HGY A;  5EGO A;  1VQM I;  4RAZ A;  2GWR A;  3V7R A;  2GZW A;  4BU2 A;  1FPQ A;  3I59 B;  2HTJ A;  2YPR A;  3V7C A;  1T56 A;  2LY1 A;  1E17 A;  4DW6 A;  4HNT A;  4PK4 A;  1VQ6 I;  2R7U A;  2ECC A;  4ZDP A;  4ZH4 F;  4ZZL A;  2M45 A;  3CO7 C;  4MLO A;  4B3A A;  4BBR J;  2LD5 A;  3GFM A;  3CCQ I;  2DAO A;  1DP7 P;  2LC2 A;  4E7K A;  1JGS A;  3CDI A;  4KIF A;  1R36 A;  2FE3 A;  1Z77 A;  5GTI C;  4A3L J;  3K10 A;  5LGT A;  3IAS 2;  5IYD J;  1J09 A;  3SZT A;  2LKS A;  4O3M A;  3AG4 H;  2V79 A;  4C2M J;  1E3H A;  5HS9 A;  1RKW A;  3KEQ A;  4XOT A;  3IWF A;  1R1V A;  1VQL I;  1ZRC A;  4GCV A;  3HXL A;  1YQA A;  4FQG A;  1W7P A;  3JRG A;  5FKM A;  2VXD A;  3K4K A;  5FFZ A;  3KCC A;  1IW7 F;  3TOA A;  3ZQI A;  2DOD A;  3ZQ7 A;  5CJ9 A;  4DYQ A;  3FMQ A;  4XOP A;  4HV5 A;  3JRB A;  2PMH A;  2W84 A;  1R71 A;  1N78 A;  5HLG A;  1I3A A;  4WXC A;  3O6B B;  3GVA A;  1CQT A;  2CJJ A;  1FOX A;  5HNH A;  1U3E M;  2GLO A;  1W7P D;  3DU5 A;  1ZK8 A;  2P6S A;  3FZV A;  3ZMV A;  2CGP A;  2L9V A;  1WH7 A;  2FF4 A;  5C3E J;  3JSO A;  5D8L B;  4BDY A;  1ZYR F;  4N4N B;  3HUG B;  3A01 B;  3VOD A;  3S1Q J;  1QO0 D;  5FRN A;  4NC7 A;  2O6G E;  4C3H J;  2ELK A;  4WCG A;  1R6R A;  2ZME C;  2FBK A;  4RDU A;  2Q2E B;  5F0H A;  3QU6 A;  2A69 F;  2K86 A;  1V55 H;  1V54 H;  1V5E A;  3KFW X;  4LFU A;  5KAI C;  1HA8 A;  2I10 A;  3DBR B;  4RB1 A;  3JTG A;  4M72 A;  1H89 C;  3OYH A;  2H1L A;  1FTZ A;  3TGN A;  4XRM A;  3TOB A;  4LK0 F;  2Y75 A;  1ZRE A;  1MSF C;  4BEH A;  1Z7L A;  1A35 A;  2A07 F;  3FX3 A;  4Q48 A;  2Y0S N;  3HC7 A;  5GAD J;  1XDS A;  1BW6 A;  2VB6 A;  4XM3 A;  3LL7 A;  4UHT A;  3HB9 A;  5GPA A;  2WV1 A;  4K2E A;  3TO7 A;  2MLG A;  5FKK A;  1TC3 C;  2IGN A;  3SFI A;  2XAJ A;  3AAF A;  5CVI A;  3ZCO A;  1G59 A;  2VIX A;  2DN0 A;  1YO5 C;  3WGH A;  3GFJ A;  5DDG A;  3CCR I;  3OS2 A;  5LHI A;  2FQ3 A;  4IJA A;  4A2U A;  1IRX A;  1U2W A;  2XB5 A;  3E0J B;  3GF2 A;  2E35 A;  2ID3 A;  5D4S A;  3LSR A;  2OTJ I;  2MH2 A;  2XGX A;  3S32 A;  3W3C A;  2JA5 J;  3DTK A;  2KT0 A;  3W6V A;  4F93 B;  3CCL I;  2ZC2 A;  1MJ9 A;  4IEJ A;  3KYD B;  1R9T J;  1NTC A;  5IP9 J;  1R49 A;  3L09 A;  5A2Q Z;  3EUH A;  4A3K J;  4BHP A;  3HOT A;  4CYD A;  1TW2 A;  4PJN A;  4B09 A;  3HL2 A;  2V9K A;  1F5T A;  5DS9 A;  2CQX A;  1F9N A;  4PJL A;  4Y15 A;  3WU1 B;  3JRC A;  3A1Y A;  3GZ6 A;  1JJ6 C;  1FMW A;  2GA2 A;  3L00 A;  3HEF A;  4FAS D;  2EIM H;  3GLX A;  2H8W A;  4HBL A;  4RB3 C;  2VKH A;  3PUB A;  2K3F A;  4II3 A;  2A68 F;  4DIQ A;  1RRJ A;  2VL8 A;  4AUX A;  4I0A A;  5E8I A;  4M71 A;  2WAQ N;  3OL3 A;  4BXX J;  3R60 A;  4OIN F;  4PUS A;  1V3F A;  3WHB A;  1PDN C;  1HQC A;  1AHD P;  2W00 A;  4DQ2 A;  2WAE A;  2KJB A;  2Z16 A;  1K83 J;  2XGD A;  2DA2 A;  3I64 A;  1POG A;  2FEZ A;  2KP6 A;  4NHJ A;  1YTY A;  1G2H A;  1S8N A;  3OMY A;  3RKX A;  2ZO4 A;  1FY7 A;  4BJ6 C;  4KIB A;  5JHF A;  4FHT A;  2HQR A;  1DPU A;  2VBZ A;  3ASO H;  1FSE A;  3N97 A;  3SFZ A;  5GP9 A;  1NG6 A;  3OIO A;  2VE8 A;  1K61 A;  2E19 A;  4E7S A;  3G2B A;  1Y1V J;  2VOO A;  3CF2 A;  2VI6 A;  5L3F A;  5J6X A;  5FB2 A;  2R5Z A;  5BPI A;  4U0V A;  4GDF A;  3LQR A;  1YIT I;  1J75 A;  4S04 A;  1TL8 A;  2JA6 J;  4I0B A;  4OAY A;  2FQ4 A;  3CF5 F;  1VI0 A;  4B44 A;  4U7D A;  2NNY A;  3DBL B;  1ZGA A;  2R5Y B;  3H5N A;  4IVN A;  4J01 A;  1E0E A;  5EF6 A;  1VQP I;  1DQU A;  5J47 A;  5BOX A;  3FHN A;  5IOZ A;  2RAE A;  1BC8 C;  4BUP A;  3F9K A;  4WF2 A;  3CCV I;  2IT0 A;  3FDY A;  2EIJ H;  5FO5 A;  2F6C A;  4RM2 A;  3LWF A;  2EV5 A;  4XN3 A;  3RYP A;  4EJV A;  2L0K A;  1KYW A;  3RI4 A;  4LIT A;  4LIU A;  2LBF B;  2X4H A;  4GYI A;  3I56 I;  2V6C A;  4D0P A;  1OCZ H;  2M30 A;  3BJO A;  4NQW A;  2VE9 A;  3TBI A;  1KZH A;  4HF1 A;  2DJN A;  2K9M A;  1Z21 A;  1T6S A;  3G4S I;  2GIV A;  4BS9 A;  3L1P A;  2CWE A;  3A4C A;  3MCZ A;  1P9Q C;  3BCB A;  3F6O A;  2H6B A;  2XHK A;  4MIM A;  2ZFW A;  4DBQ A;  1AU7 A;  2VON A;  4XBF A;  2STW A;  4OOI A;  1X1C A;  1RKT A;  2PFB A;  3LSH A;  1P4A A;  3FXQ A;  5HLH A;  1D0X A;  3VSK A;  1Y1W J;  2E1N A;  3BZ6 A;  3CJQ B;  1ZGJ A;  2VC0 A;  2IS1 A;  4KMU X;  5FKL A;  1JTX A;  2EZI A;  2R7S A;  2W85 A;  1WZ2 A;  4MEX F;  1Z91 A;  5J3L A;  4XRS A;  2V7F A;  5HDG A;  2XAG A;  3GFI A;  1R5H A;  2LNB A;  4CHU A;  1I3Q J;  2VAS A;  1W7P B;  3I0T A;  4HLY A;  4J00 A;  4WXD A;  3BC8 A;  2M5W A;  2VBX A;  5D5U B;  4C3I J;  2EZH A;  1AKH B;  1ZR2 A;  3JRI A;  2HDC A;  2G9W A;  2FOW A;  4AWX B;  1TW3 A;  1SEU A;  1ON1 A;  3RKY A;  2DPD A;  3CQZ J;  1O4X A;  1IN6 A;  4HX8 A;  3OS0 A;  2GA1 A;  3MFK A;  4HRI A;  2BHZ A;  1S72 I;  1E3O C;  4AVZ A;  3QYE A;  3KIO A;  1YX5 A;  4EV0 A;  2VBW A;  1WKM A;  2CV1 A;  1C0W A;  4IOC F;  3GZ5 A;  3CDL A;  3FK7 A;  2PEX A;  2EIK H;  1Z0X A;  1D8J A;  5LEJ A;  1K4S A;  1I6H J;  4N4O B;  4QPO A;  1XMA A;  1HDD C;  2R7V A;  3ELK A;  5JI6 A;  3L2R A;  2FSW A;  4XQF A;  3DLL F;  2UXX A;  3EET A;  4B4C A;  3OYK A;  2JA8 J;  5FRM A;  3E5Q A;  2GOX B;  3VEP A;  3RZO J;  1JKO C;  5FLM J;  1LEB A;  3DXJ F;  2HS5 A;  1BIB A;  4BE1 A;  3PO3 J;  2K9Q A;  2IVM A;  4PCQ A;  4ESJ A;  2CYY A;  3KZY A;  4PZJ A;  4CXF A;  2KFD A;  5GAH J;  1JT6 A;  5L3B A;  4IRH A;  4UY8 I;  3IAM 2;  3TKY A;  1KQ0 A;  3D0S A;  3ECH A;  1XGN A;  2B63 J;  3A0B C;  2AO9 A;  5LLQ A;  3A0H C;  4HAM A;  1MSE C;  5KNL A;  2EA4 A;  1VQ9 I;  4HG2 A;  1HC8 A;  1ETK A;  2JMW A;  2L9R A;  1U5T A;  5KHD A;  5BQT A;  5M5W J;  1XPX A;  2DYS H;  2V1U A;  3B02 A;  1QVT A;  4NBQ A;  1YLF A;  1KU3 A;  2NYX A;  3IH3 A;  3P5J A;  1UMQ A;  2QSH X;  2ELH A;  1FBS A;  2IGK A;  2RNG A;  2Q1Z B;  2F5D A;  4XON A;  4YRV A;  2ESN A;  2QKL B;  5J1R A;  4D1Q A;  1X2N A;  4S0H B;  3K2A A;  1UST A;  3M1C A;  1HW5 A;  5ICE A;  3ZN0 A;  4ZYA A;  3HOW J;  1MH3 A;  1U5T B;  1BJZ A;  2QSG X;  4IHX A;  4G9Y A;  1ZQ3 P;  1AKH A;  4BQN A;  2BVL A;  1MW7 A;  5ERI A;  2QEX I;  3J7Y J;  3JTH A;  1X1P A;  4CO8 A;  5HLI A;  2D1V A;  1XSV A;  1XC5 A;  3FXU A;  2XIG A;  3L2Q A;  3PNY A;  4EJT A;  2ME6 A;  4R79 A;  1OYY A;  1E2X A;  4PSX A;  5DCM A;  2CW7 A;  4F3Q A;  2Y0S A;  4GYG A;  2KRC A;  2IBD A;  4CCM A;  5HS8 A;  4G7H F;  3FF5 A;  1PJR A;  2PQ8 A;  2L9N A;  2E36 A;  3RDI A;  2YX4 A;  2JT1 A;  2QKM B;  2XC7 A;  3K4M A;  1Z9C A;  2RKH A;  1K6Y A;  1B72 A;  1REP C;  3ZMU A;  4HNU A;  5F27 A;  1ZGW A;  4HNV A;  4NNJ A;  2R7Q A;  1JUS A;  3CD6 I;  3H5A A;  4BXF A;  1ERD A;  2JPB A;  2KPM A;  3OYI A;  1VQ7 I;  4II2 A;  2HXO A;  1WH5 A;  3BR1 A;  4CGZ A;  1TP4 A;  2IJL A;  1SD4 A;  3I54 A;  4D5C A;  2ZJ2 A;  3Q0U A;  3JRA A;  2B0L A;  9ANT A;  1PVE A;  3I5U A;  3KLO A;  2LKX A;  1D0Z A;  3W6K B;  3REO A;  2CFO A;  4OIQ F;  4RGU A;  1TT5 B;  1WCM J;  2QGU A;  1SAX A;  4CSW A;  4ZDL A;  1TQP A;  2DQL A;  3CP8 A;  1F1Z A;  2L01 A;  1G8X A;  1FTT A;  3G1M A;  1P7I A;  3N05 A;  2HVR A;  1FOY A;  1OKR A;  1YW7 A;  2UUZ A;  3LQQ A;  4HLX A;  4ANJ A;  1B9N A;  4FX4 A;  1D1B A;  4KIC A;  1FT9 A;  2KLO A;  2NS7 A;  2ZB9 A;  4XSZ F;  3EPZ A;  4E7H A;  4UNO A;  3BR5 A;  1W0T A;  1FOK A;  3M9A A;  2R92 J;  2F4M B;  2H6C A;  2W24 A;  1YW9 A;  3M8F A;  2VT2 A;  2JZY A;  3LA3 A;  4I09 A;  3ZMD A;  4CCN A;  3ZP5 A;  1Y56 A;  1WJB A;  3GLL A;  3H9Q A;  2AS5 F;  4D7M A;  1PUF B;  2AQE A;  4E4H A;  3RPU D;  1T39 A;  4XSX F;  5JHU A;  4Y17 A;  3LSK A;  4L5E A;  2G0E A;  1EJ9 A;  2DLL A;  1SD7 A;  3G3Z A;  3BG6 A;  2ZKZ A;  1XD7 A;  3W6J B;  4OU0 A;  1RET A;  1JGG A;  3B6C A;  3GBG A;  4IPA A;  1O3Q A;  4CUG A;  2HQA A;  3MVP A;  4KJZ A;  3H3V K;  4A93 J;  2XKP A;  4KFC A;  5M3F J;  3F8B A;  2CUF A;  3LSM A;  2X6X A;  2N8G A;  3AG3 H;  3IH2 A;  5DCM B;  2OF7 A;  1MBF A;  4Y13 A;  5E20 A;  1HST A;  2RDP A;  3ULQ B;  2P7C B;  3U1K A;  2HKO A;  2VKD A;  3CES A;  3FXM A;  3IRQ A;  3BR0 A;  1BL0 A;  2CFX A;  4BNC A;  2Q0O A;  2BHY A;  2JTV A;  2P81 A;  1S9H A;  3ABU A;  2PJR A;  1XSD A;  2Y48 A;  3GW2 A;  3DEW A;  3HSE A;  4AU7 A;  1OCC H;  1ZR4 A;  1ZHF A;  3KP6 A;  2X48 A;  3F8N A;  1GUU A;  2QBY B;  3WTV C;  5LHH A;  3ABT A;  3FWE A;  2H27 A;  4OWR B;  3J81 Z;  2VC1 A;  3J80 K;  1OYW A;  2EFW A;  2EIN H;  2O0Y A;  3NRV A;  2HOS A;  2STT A;  1BC7 C;  4YFK F;  1W0U A;  3ZPL A;  4G7Z F;  2DOE A;  2LBF A;  2QZ8 A;  3TW7 A;  3MZY A;  2VUM J;  4L18 B;  3CMA I;  2K5C A;  2MFZ A;  2HU9 A;  3I59 A;  4P1W A;  3WGI A;  1J59 A;  3JRH A;  4RBO A;  2BYV E;  1ENH A;  3LSG A;  5F1R A;  1D1A A;  2Y0M A;  5K7F A;  3BZC A;  4BH9 A;  4M74 A;  1O3S A;  5JVT A;  1RR8 C;  4BE0 A;  2CUE A;  5AIP A;  1DDN A;  2BY0 A;  3JAM K;  1MBK A;  1Z1D A;  2BXZ A;  2CQN A;  5BPD A;  4DZP A;  5CLS A;  3IL2 A;  1S5L C;  3D1N I;  1JKP C;  3M7G A;  2WAQ A;  4BEH B;  3V4G A;  1WVR A;  2V9P A;  2L7K A;  3S1R J;  5CVU A;  1BBY A;  1M1E B;  4KN7 X;  1IG7 A;  3GTP J;  2KQR A;  2YX7 A;  2XUB A;  1JUM A;  2A3S A;  3HOV J;  1EV7 A;  2KDO A;  3J7A Y;  4ZYD A;  1IF1 A;  4BHC A;  4P55 A;  2HVS A;  2PLY A;  1PP8 F;  5LHG A;  5E17 F;  2X1C A;  2Z99 A;  1K79 A;  2L2O A;  2L3D A;  1GXQ A;  2OCC H;  3R0A A;  1HF0 A;  2B7E A;  2HPM A;  2JVG A;  3WTX C;  2F5F A;  3K1P A;  4IKF A;  4M6V A;  2FU4 A;  3ZQG A;  3GTM J;  2MLK A;  2LG4 A;  2WV0 A;  2P5K A;  3MKL A;  4HA8 A;  4AYB A;  5E79 C;  4FCY A;  1B59 A;  4RA2 A;  5B5E C;  3H9G A;  2H1K A;  5EJC A;  3BR3 A;  1X1D A;  1MMN A;  1ZH5 A;  3DLA A;  3ZRG A;  2BVM A;  1ETO A;  2L4A A;  4HX7 A;  2R7D A;  1K78 A;  4EJU A;  3MZH A;  1Z05 A;  3S2H J;  1O7L A;  1PYV A;  2K85 A;  3V8L A;  4U0W A;  1TQI A;  1ZKG A;  4FTH A;  1WJ5 A;  4XNF A;  3MEX A;  4CZZ A;  1YRN A;  2VOD A;  1IC8 A;  4BY7 J;  2DFF A;  3FM5 A;  3I3L A;  1JJ8 C;  5IT9 K;  1VZ0 A;  4RGR A;  4BQA A;  1VQ5 I;  1BI0 A;  1U9O A;  2BEO A;  4J19 A;  3BQZ A;  4KN4 X;  3T0Y A;  2LOO A;  4ZJZ A;  2DA4 A;  2MC4 A;  2YU3 A;  4UB6 C;  2L7Z A;  1F43 A;  3PQK A;  2LRE A;  3L2W A;  1GLN A;  2JQ7 A;  2OTL I;  5GPC A;  4UUS B;  3OYG A;  2NVQ J;  3S15 J;  1WWX A;  4EGY A;  2ZXW H;  1GHC A;  2FUG 2;  1TLH B;  4XKB A;  2Q2E A;  1ULY A;  2R3S A;  2O7O A;  4BL0 B;  2RV8 A;  3V7S A;  3S1M J;  1B8I A;  2O8X A;  2GAU A;  1Z7U A;  3BG7 A;  1SVM A;  3I58 A;  4O6J A;  4AYB N;  2LLK A;  2LDU A;  5BS6 A;  2IS4 A;  3G1O A;  1NK2 P;  2KIU A;  4FT8 A;  1VF9 A;  2KHM A;  5L3E A;  2VOP A;  2E7W A;  3CCY A;  2WY8 Q;  2UV1 A;  1SMY F;  3JR9 A;  3LSI A;  5CYV A;  5H6Q A;  4B47 A;  2EFP A;  4UV8 A;  1XN7 A;  5DD8 A;  2ZCW A;  2DXI A;  2K3P A;  5EGO B;  1ACI A;  4QPQ A;  2W48 A;  1QBJ A;  2DQR A;  3OYJ A;  2HNH A;  2Y69 H;  2IPQ X;  4I6Z A;  1O3T A;  1L0O C;  3GXO A;  4D5F A;  2VKE A;  3HRS A;  4IOA F;  5F04 A;  5DV5 A;  1XX5 A;  4Y7N J;  1CGP A;  4LLL A;  3PFI A;  3VYU B;  2HXI A;  3H92 A;  4JBA A;  5EEH A;  2QQA A;  3O2P E;  4BQQ A;  1H0M A;  4DBR A;  3GX4 X;  4XKV A;  5L3D A;  2E1M B;  2CMP A;  1Y0N A;  5TJJ A;  4I01 A;  2LFB A;  3E97 A;  3CMM A;  3C3W A;  2I8D A;  4BAY A;  4YFX F;  4XKW A;  1W5T A;  2M0C A;  5DYM A;  4XLN F;  5C4X J;  2F5V A;  3GFL A;  4I2O A;  4YII A;  1MH4 A;  2XF6 A;  3PJR A;  2PJP A;  1ZEL A;  3ABM H;  1S7E A;  1Y6I A;  2EK5 A;  2FMY A;  4M6X A;  5F1J A;  2DCE A;  4UV9 A;  4NUB A;  5FD6 A;  1MBG A;  3WG7 H;  3GYH X;  1KU9 A;  1ZAO A;  4G94 A;  3T5X A;  3WTY C;  1KON A;  1SFE A;  4XK4 A;  4RGS A;  4L0Z B;  1LEA A;  2X85 A;  3KPH A;  2CW0 F;  5ICF A;  2NOG A;  2PI0 A;  1KQ8 A;  2HQN A;  4Q4Z F;  1BJA A;  1R1T A;  3C2G A;  1SD5 A;  4IZZ A;  2VPL A;  3H5R A;  3K7A J;  1S7A A;  2DMN A;  3HPG A;  3S93 A;  1FYL A;  2K7L A;  3SDB A;  3BR2 A;  1FJL A;  3LAP A;  2GM4 A;  2QYO A;  3Q5F A;  2XRO A;  1JTY A;  2JN6 A;  2WAD A;  1YJN I;  2XGC A;  3EYY A;  5ILV A;  2ESH A;  1D1C A;  3RIR A;  4M3E A;  4KYW A;  1FNN A;  4KT6 A;  3IUO A;  2R0Q C;  1RC9 A;  1RNL A;  5FGM A;  1AWC A;  2TRT A;  3DF8 A;  2QLZ A;  2HKX A;  2NS8 A;  2DOA A;  1ZG3 A;  5EZH A;  2L7F P;  1BI3 A;  5DUI A;  3MMY B;  1G3W A;  1UB9 A;  2XVC A;  1IGN A;  3BJ6 A;  5FFX A;  3WU2 C;  1LNW A;  1RZ4 A;  4RAY A;  4L5I A;  3RPQ A;  3BPV A;  5F0F A;  4HX4 A;  2FOK A;  4CH7 A;  4PDK A;  3FXR A;  4B48 A;  2HQ5 A;  3IV5 A;  1NHA A;  2K02 A;  2D2W A;  1MND A;  2M34 A;  3OR1 C;  5LGN A;  3KLN A;  4KIG A;  4EM1 A;  1QNT A;  1G4D A;  3ZQC A;  2V4J C;  4CCL A;  2RQP A;  1U9N A;  3P9C A;  1Y8Q B;  4RS8 A;  2BW3 A;  3KP5 A;  3FKI J;  3HKZ A;  2DA7 A;  4GRI A;  1FX7 A;  4CYC B;  1S6L A;  4C2T A;  3GTK J;  3KYC B;  2XAU A;  1I1S A;  3RCO A;  1X58 A;  1IAW A;  2OPT A;  3A02 A;  3H36 A;  1D5V A;  2LSO A;  1X19 A;  1FSH A;  4AIH A;  2ZJP F;  2R7O A;  3DWL E;  2M3A A;  3BLY A;  5EYR A;  2OQR A;  1J2X A;  2CUZ A;  1HLV A;  2EV0 A;  3OYB A;  3OYN A;  2XPV A;  3HTU A;  4HDV A;  1MMS A;  4YEL A;  3RSN A;  3VPR A;  3CJT B;  2KRF A;  3CZ6 A;  3ZMZ A;  2MW8 A;  3ZN1 A;  1JI8 A;  1T8I A;  1D0Y A;  1EH6 A;  1XG1 A;  4XRF A;  4ESB A;  4LB5 A;  1Z3Y A;  1D5Y A;  4KDP A;  4LG0 A;  4M6Y A;  3FXJ A;  5ICG A;  2NOJ B;  2W82 A;  3OS1 A;  2E1O A;  1BI1 A;  2QBY A;  4I98 B;  3FKJ A;  5TGT A;  2R93 J;  3PNV A;  3BY6 A;  1WJE A;  2QUF A;  1BN5 A;  1MZB A;  1IUF A;  2IEK A;  1IV6 A;  3QPH A;  1A6Q A;  1I39 A;  1ZRF A;  1SAU A;  3F22 A;  2LK2 A;  2BY1 A;  5K1Y A;  4U0Y A;  3T8R A;  3BP8 A;  4A0X A;  2BBY A;  5FLX Z;  3M8E A;  2CW8 A;  4M73 A;  1ETW A;  4GXO A;  1TTY A;  2FD5 A;  3JW4 A;  1OPC A;  3H9J A;  1DU0 A;  2BOL A;  2FJ1 A;  3K69 A;  4M3D A;  4M9X A;  1A6I A;  3GTG J;  3OYE A;  4MTD A;  3DKX A;  6PAX A;  5J4V A;  4ABZ A;  4ZDO A;  1TWF J;  3FXO A;  3SEZ A;  3FIW A;  4TV7 A;  4A0Z A;  2HR3 A;  2KJC A;  1TWG J;  1HW2 A;  2OCE A;  2LF8 A;  3Q0V A;  4BAC A;  1SAN A;  4X6A J;  3AKZ A;  4HW0 A;  3B73 A;  4RMN A;  3S3N A;  2OD5 A;  5JFR A;  2CQK A;  4FX0 A;  4XKC A;  1MDM B;  4PSW A;  4IRI A;  1R22 A;  5E3M A;  4E7L A;  2OZU A;  3DPL C;  2L7M P;  4QTR A;  4EGZ A;  1GVJ A;  1KGS A;  1W36 C;  3H0G J;  5EG0 A;  2FRH A;  5KAF C;  2DDB A;  3BQY A;  1JE8 A;  3S14 J;  3H3U A;  4OIR F;  2FBI A;  1QPM A;  1RUO A;  4UB8 C;  4RAG A;  1J9I A;  4G6T B;  4BGD A;  4KMF A;  4BBS J;  3OV8 A;  3PM1 A;  3V8J A;  1H9T A;  3BT9 A;  2F4I A;  5IT3 A;  5C44 J;  3K6G A;  1MMD A;  3QPT A;  2HOE A;  2UWM A;  2ZJR F;  2EPF A;  2XB0 X;  2H94 A;  3QU3 A;  3QWL A;  2PMU A;  2X9D A;  1HW1 A;  3OYC A;  3H1C A;  1DPR A;  2ID6 A;  3X2Q H;  4LMY A;  1MBH A;  3K9T A;  2V1N A;  4ESF A;  2K27 A;  1W5S A;  3SHF A;  5E1X A;  1BA5 A;  2FNP A;  1SFK A;  1YYV A;  2IGM A;  2VJJ A;  1DP3 A;  3GWZ A;  1GVD A;  1WHU A;  2GBY A;  2RVC A;  3G1L A;  3GEZ A;  3EYI A;  1LFB A;  1VND A;  2GQQ A;  3S3M A;  1IN4 A;  1ONV A;  2HOT A;  3ZQF A;  2ISZ A;  1LVA A;  2IA2 A;  1QPI A;  4JP0 A;  4C3J J;  1A5J A;  2M2E A;  1YE9 A;  2P5V A;  1STZ A;  3J7A O;  2XPU A;  2V26 A;  3CUO A;  5D5V B;  5DM6 F;  3WTU C;  2R7F A;  1V5F A;  1S3J A;  1IN5 A;  4EM0 B;  2XAS A;  4N9I A;  2DA3 A;  2VQL A;  4DNC A;  1FP2 A;  2FML A;  2FNA A;  3CUQ C;  5KVR A;  3ML6 A;  1ITY A;  2AHQ A;  2O3F A;  1MMG A;  2NAZ A;  4RGX A;  3AFH A;  3JAM Z;  4YIR X;  2PMZ N;  5J40 A;  2QQ8 A;  4L0Y B;  2XPW A;  3QOD A;  1YIO A;  4KNY A;  3D5S C;  5LBQ A;  2E1C A;  1WJF A;  4IO9 F;  2VKV A;  3OY9 A;  1QVU A;  3CLQ A;  4Y33 A;  1YIJ I;  3QPL A;  4FE7 A;  5F0C A;  3SXY A;  4OIP F;  3TQN A;  3BDD A;  2LF7 A;  4GO1 A;  1CF7 A;  2DFH A;  2A6E F;  2PN6 A;  3ZR8 X;  4P96 A;  4U87 A;  4IHS A;  2K9L A;  3CC2 I;  2LMD A;  2XGE A;  2E71 A;  3CJR B;  2DOF A;  2EH3 A;  2W7N A;  3F8M A;  3E6M A;  1UHM A;  2M4K A;  1SMT A;  3BR6 A;  3Q0W A;  4LD5 A;  2IS2 A;  1R1U A;  4JX5 A;  1X3U A;  5H2F C;  2HYG D;  2HYF A;  2CSO A;  1UJ8 A;  4UVC A;  2IRF G;  3E7L A;  2CV0 A;  2A61 A;  3WE2 A;  1WRJ A;  2X6W A;  2KKO A;  4E7Z A;  5F08 A;  5J4Y A;  5FLX K;  2DPU A;  2VQG A;  5D6F A;  1A04 A;  2G7U A;  4ETS A;  3G73 A;  2JRM A;  2J5O A;  2TDX A;  1O57 A;  3K70 C;  1ETQ A;  2M0M A;  2WBM A;  4MQ9 F;  5IP7 J;  1JXS A;  2A5Y B;  2ZXI A;  3RJP A;  4GGG A;  2P6T A;  2YU9 J;  1MDM A;  1J5Y A;  3HRT A;  4Z2Y A;  3HOS A;  3FHZ A;  1FMV A;  1TNT A;  3EDP A;  1FP1 D;  5H6R A;  5HVQ C;  1OCT C;  1IRG A;  3BTC A;  2OJE D;  2KIQ A;  2EJR A;  2P7V B;  3QP6 A;  4EM2 A;  3MKY B;  3RZD J;  3C18 A;  3NWT A;  5IT9 Z;  3MZ8 A;  4W97 A;  1R4N B;  4FET A;  2DT5 A;  3DTI A;  5GAG J;  5B66 C;  2ICW G;  5HOD A;  2ZSI B;  4A3D J;  1U6G A;  4LG3 A;  4F55 A;  5FKN A;  1GXP A;  2JSC A;  1UCR A;  3Q9V A;  3TDZ C;  3F8F A;  3BG5 A;  4YFN F;  4UVA A;  2DMU A;  2WAF A;  3CC4 I;  4AIK A;  1S7O A;  2WY7 Q;  2C6Y A;  2YSR A;  3BG9 A;  4ZTJ A;  4PJM A;  3E6C C;  3NQO A;  1JKR C;  1GDT A;  2EV6 A;  5DD4 A;  4IHT A;  4XLF A;  2XRL A;  4HYE A;  2R7T A;  1ON2 A;  3U9G A;  5E3L A;  2FBH A;  2HOA A;  5JLW A;  1OLT A;  4HV6 A;  1XMX A;  1LDD A;  3MAJ A;  2ZSH B;  3DFG A;  2O03 A;  3LFK A;  3PL8 A;  2NVT J;  4MNU A;  4A3G J;  4N9H A;  2Y9Y A;  3AL0 B;  3LST A;  3QYF A;  1CF7 B;  3K4B A;  1P7J A;  2O61 A;  3U21 A;  1TNS A;  2YUS A;  4JX6 A;  5E1W A;  2R7W A;  3ZOB A;  4C30 A;  4LOC A;  3IP4 B;  4EJW A;  3V42 A;  2DFE A;  3JRE A;  1YJ9 I;  1LE8 A;  3ZQH A;  3ABL H;  2L9S A;  3F21 A;  2Y2Z A;  3U2R A;  3RYR A;  1B8I B;  3COA C;  3PUF A;  5J1Y A;  2RRE A;  2Z33 A;  4IHV A;  2UXN A;  2DW4 A;  1AOY A;  1MIJ A;  4I99 C;  3HOY J;  4OMY A;  2M1B A;  2KDZ A;  4V19 K;  4H4K C;  1O7F A;  2KIS A;  3FIS A;  1EH7 A;  3SQN A;  1VFC A;  2D1H A;  4LJZ F;  4KIS A;  2R4G A;  1IJW C;  3IH4 A;  3DPU A;  4NQW B;  3NWS A;  3RPU A;  4M9Z A;  2CH0 A;  4XMY A;  2HEO A;  5FLV A;  1NG7 A;  4HPQ A;  3BG3 A;  4A3F J;  3P7N A;  3DQV C;  4MTE A;  2OZ6 A;  2M4G A;  3BOQ A;  1J0R A;  3CLO A;  4A3M J;  3SZG A;  2MAB A;  3VFZ A;  4M3F A;  4RLQ A;  1LDK B;  3E6D A;  3OYF A;  3HOX J;  1QZZ A;  3LA7 A;  3E5U A;  5LRR A;  2OAZ A;  5CQE A;  2DMP A;  4QSH A;  1MMA A;  1WQ2 A;  3R0J A;  2JPC A;  3RKW A;  3HOU J;  3LNQ A;  3CUQ A;  1SD6 A;  2EZK A;  3L2V A;  2CUJ A;  3OYM A;  4ENM A;  5IPA A;  1UG2 A;  2HYJ A;  2LRD A;  3SDG A;  1R23 A;  2D5V A;  1WGX A;  3KP3 A;  3DKY A;  4XLC A;  3K70 D;  3QRF F;  1FEX A;  1IDZ A;  2OBP A;  1RR7 A;  3CCE I;  3ZGK A;  4GFB A;  1IN7 A;  2WA0 A;  1MBE A;  4MHG A;  4XLA A;  4XIC A;  3IKV A;  2F5C A;  3FBI B;  2PG4 A;  1OCR H;  2J5P A;  2X1E A;  2YR2 A;  4A3E J;  3WG9 A;  2JUG A;  4NB5 A;  1U8B A;  2KZV A;  1X3W B;  5ED4 A;  1ZG5 A;  3ASN H;  3FBN B;  3HRU A;  1SVO A;  2GXA A;  5J8C A;  2GXB A;  2JUC A;  5D8K B;  2E2H J;  5E8G A;  2NNN A;  1HKS A;  1ZG1 A;  4G12 A;  1BR4 A;  1FIP A;  1OR7 A;  2BY2 A;  4XN0 A;  1R7J A;  1GV2 A;  2A6T A;  3CCS I;  1WI9 A;  1BIA A;  3LSP A;  3LA2 A;  2ME0 A;  4MEY F;  2IP2 A;  5B1B H;  2KMU A;  5KK1 A;  1W1W E;  1LQ1 A;  5K5R A;  4BY1 J;  1OMI A;  3JSP A;  1YFH A;  1ZN2 A;  4MO7 A;  1G3Y A;  1VTN C;  2MC3 A;  2PMZ A;  1RUN A;  3M4O J;  1R5I D;  3KE2 A;  4E7I A;  1ZRD A;  3H35 A;  1U5T C;  1X2M A;  3KZI C;  3F72 A;  3F3X A;  3HTS B;  4LLN A;  2K40 A;  3K2Z A;  1YOV B;  4WK8 F;  4ZC3 A;  5LD2 C;  3ESW B;  3DCF A;  3F8C A;  2ZBK A;  2IGO A;  2JK3 A;  2DTR A;  4W1U A;  3GUD A;  1WPK A;  2R7Z J;  5ILU A;  3W2A A;  2VJ4 A;  3LFU A;  4D7N A;  4M9S A;  2Q8K A;  5HDK A;  4QWQ A;  2HWV A;  2RN7 A;  1QQI A;  2A6H F;  5IP6 A;  2P4W A;  2X6O A;  3G71 I;  3VSL A;  2CRG A;  1UHW A;  4DOZ A;  1VQO I;  3OOU A;  5K5O A;  3K4N A;  1UZC A;  2DDA A;  4IQJ A;  4PJJ A;  3KYL A;  3ONQ A;  2LR8 A;  1IXC A;  2B9S A;  1VQN I;  4IHW A;  1HKT A;  3LSJ A;  4F91 B;  2KL4 A;  4ZYH A;  3OYL A;  1PUE E;  5IOY A;  2QA4 I;  4BQO A;  2K4J A;  4BYY A;  1QHH D;  3HG9 A;  5EG0 B;  4DYR A;  2E1M C;  3PQJ A;  5M3M J;  3MKW B;  4HDU A;  4LLG F;  3DPT A;  1XDU A;  3QP5 A;  3SJM A;  4ZTF A;  2XF5 A;  1K4T A;  1OCO H;  2FXA A;  4WXH A;  3PFY A;  5LGU A;  1I5Z A;  2XDV A;  2W57 A;  1XGO A;  3EUK L;  2VQH A;  2X0L A;  3NAR A;  3Q9S A;  3J7Z I;  1MNM C;  3QPS A;  1FBU A;  2K9N A;  3BJA A;  3HHH A;  2UZK A;  1OR7 C;  2E2I J;  2ZJQ F;  2HZD A;  3M1E A;  4HEA 2;  2DO7 A;  2KIM A;  4OMZ A;  4E6K G;  1YRN B;  1R58 A;  5E1Z B;  5IYB J;  5IYC J;  2NRA C;  1WJA A;  2DU9 A;  2IS6 A;  4B1R A;  4L9J A;  5AIQ A;  2EWN A;  2K4B A;  1HSJ A;  5JVG F;  3HSR A;  1N77 A;  3PO2 J;  1W36 D;  4N0B A;  4KA4 A;  3K4L A;  3GTJ J;  2DA5 A;  3R6S A;  3F0C A;  4IL6 C;  1X1A A;  3OIP A;  3L2C A;  4DZJ A;  2ACJ A;  4I7H A;  4I76 A;  2JWT A;  2ZXJ A;  3HUG A;  4PFP A;  3T1B A;  2CQ7 A;  4M3G A;  1W4M A;  1IV8 A;  2DK5 A;  1VQ4 I;  3VOE A;  4A3C J;  1RIO H;  4CZC A;  3GCM A;  4XR6 A;  5H20 A;  4U7B A;  1HKQ A;  3E6B A;  3BTL A;  3VYT B;  2CG4 A;  2WC2 A;  4RLF A;  4OIO F;  1BW5 A;  1TZL A;  1RI7 A;  3JRD A;  4ASN A;  3I4P A;  3BCA A;  2R5Y A;  2JJ7 A;  2EFQ A;  3A03 A;  4NDL A;  1KYZ A;  4ITV A;  4F7Z A;  1T0F A;  1BM9 A;  1OQY A;  2OUM A;  1P2F A;  2KIF A;  1P92 A;  5J1U A;  1WJD A;  3A01 A;  3TO9 A;  1P6R A;  3CO6 C;  1X4P A;  4FIS A;  4DYC A;  2PJR B;  4HSR A;  4EEF G;  2MH9 A;  2QQB A;  3CCU I;  1HOM A;  4CCO A;  2Z9O A;  2EFO A;  5LFA A;  2HTS A;  3K4J A;  1TBX A;  2A5W A;  3KEO A;  2DI3 A;  3HKZ N;  2F2E A;  3ROU A;  5D5W B;  3OSF A;  5AON A;  4LGW A;  5DEQ A;  5K7Z A;  3GME A;  5IY5 H;  4PJ0 C;  3CMY A;  2Y30 A;  1TQM A;  2XSJ C;  1YJW I;  3M3Y J;  4E7J A;  2KZG A;  3R61 A;  4EMS A;  2IAI A;  2VLA A;  2QCO A;  1BOB A;  4B43 A;  4E70 A;  3DEE A;  2VBY A;  5LRS A;  1JKQ C;  3S17 J;  2NVU B;  2LKP A;  4FE4 A;  3DP7 A;  1QA6 A;  1LUJ B;  1LKX A;  3TW6 A;  3LMM A;  2FX0 A;  2CO5 A;  2FA5 A;  3L7W A;  3IC7 A;  3HZJ A;  2DTZ A;  2XSD C;  1MD0 A;  3DU6 A;  4XID A;  4QIW N;  4RB0 A;  3T8T A;  3DKW A;  2WWY A;  3S3O A;  2NVX J;  3F23 A;  1IUY A;  1SVL A;  2DMQ A;  4H0E A;  5K7H A;  2YS9 A;  5D4R A;  3L2U A;  2MD5 A;  2X6Y A;  5K5Q A;  1K7A A;  3CTA A;  1VQ8 I;  2OQG A;  4HOB A;  2GXG A;  4JYK A;  3FM3 A;  5CVV A;  4C2U A;  2XRN A;  3Q3S A;  1PUF A;  4HF0 A;  1SFO J;  2JA2 A;  4YIF A;  2BE5 F;  3CP2 A;  2AQF A;  3LOC A;  3SZP A;  4A69 C;  4HQE A;  1QGP A;  2XAQ A;  5DUK A;  5M5Y J;  1UG0 A;  2GOM A;  3I71 A;  3CME I;  5HOO A;  3OL4 A;  3IRR A;  3F6V A;  2OC6 A;  4AVP A;  2HDD A;  3BPX A;  1LDJ A;  4BJ5 C;  4L9N A;  2HZT A;  4IQ4 A;  1DUX C;  4HF2 A;  4LG0 B;  1IO2 A;  2M8E A;  1MGT A;  3L9F A;  2F48 A;  2DA6 A;  1DU6 A;  4P9F A;  3J81 K;  5CQG A;  4YEJ A;  2JSP A;  3V8K A;  2M7B A;  1QU3 A;  2IXS A;  3MQ0 A;  4BKX A;  4MGR A;  3VB2 A;  1BI2 A;  1WI3 A;  2Z3Y A;  1LFU P;  2EIL H;  4C9Y A;  2L02 A;  2CV2 A;  3ERM A;  3KZZ A;  3WTZ A;  1D8K A;  2X1D A;  1IN8 A;  1IDY A;  3UNG C;  4CA0 A;  3I53 A;  2VJ5 A;  1GT0 C;  2QEN A;  2W1O A;  4S05 A;  2JA7 J;  1YX3 A;  5BMZ A;  1UHS A;  4V2G A;  1MJA A;  4Y3O A;  3IKT A;  2QWW A;  4IF4 A;  3M07 A;  2EFN A;  1QHG A;  4RB2 C;  1ZLK A;  3HRM A;  4KIT B;  4MFE A;  2M7A A;  4IX7 A;  2R5Z B;  1O3R A;  4UVB A;  1D3Y A;  4UXN A;  1XGM A;  2RGV A;  5EEA A;  4Z6Y A;  3J80 Z;  3M8J A;  3QQA A;  3TDU C;  2DBB A;  3GO5 A;  3HSF A;  4A3J J;  1ETY A;  4RAF A;  1UFM A;  1YG2 A;  5JLX A;  4L5J A;  3NAU A;  2MBF A;  1E3P A;  3PSI A;  1U8R A;  1T2K A;  3NEU A;  3ERE D;  4ZZD A;  2HDW A;  4ZYG A;  2BXY A;  4Q47 A;  3EUA A;  5FJ8 J;  3OYD A;  4D9J A;  1F36 A;  5DM7 F;  3AG2 H;  3PIP F;  2AXL A;  2TCT A;  1FC3 A;  1T95 A;  1MJB A;  2P0W A;  2R7R A;  2ZME B;  1JHF A;  4AM3 A;  2DJI A;  1XGS A;  1Z6T A;  1OFC X;  2D45 A;  2E60 A;  4PGH A;  4JK1 X;  2QM3 A;  1TT0 A;  3FK6 A;  1ORK A;  5EZG A;  2LY9 A;  3ECO A;  4G6D A;  5M5X J;  4HQM A;  4A3I J;  1VQK I;  4AD9 A;  4A3B J;  2IA0 A;  3TED A;  2V6E A;  3EQL F;  1EA3 A;  1T98 A;  1IRF A;  1ETV A;  1KQ9 A;  4A6E A;  2BGC A;  4CCK A;  4EJO A;  3FXK A;  2K9S A;  3JCU C;  3RQI A;  1XCB A;  5E3O A;  3TP3 A;  1HCR A;  1JHH A;  1V5G A;  1W5C C;  3BWG A;  3CUQ B;  3KP2 A;  3K1N A;  4KT5 C;  1T0F C;  5HS7 A;  3SYT A;  2VQC A;  5B1A H;  4A0Y A;  3KET A;  4QLC U;  3BTI A;  2NVY J;  1APL C;  1ZTR A;  3S8P A;  2VXZ A;  3PNT A;  4LIV A;  2M8G X;  3C2H A;  2VT3 A;  1LFP A;  1J7K A;  2LY2 A;  1UAA A;  1N75 A;  3U1D A;  1EKE A;  1JUP A;  4X1E A;  2KRH A;  5ILS A;  3MKZ A;  2DA1 A;  4IRG A;  3TL4 X;  4X0G A;  3OR2 C;  2RNJ A;  3VWB A;  1G6N A;  2LTP A;  4MQV A;  4BHB A;  2WTE A;  2EA2 A;  5J8F A;  1ETX A;  1MBJ A;  3DBH B;  2CQQ A;  3QOP A;  1FLI A;  4P5O A;  1P4X A;  1FWZ A;  4HST A;  1X1B A;  4Y52 J;  2V1X A;  2ZNZ A;  1U0J A;  4R1H A;  5LEK A;  1R4M B;  2DYR H;  2PX9 A;  3K4C A;  3GTQ J;  4R8H A;  5A2Q K;  4AIJ A;  3N4M A;  3I55 I;  5TRD A;  3HYI A;  3IWZ A;  3QOE A;  3OSG A;  2WB1 N;  3KP7 A;  2MG4 A;  2HI3 A;  3VYS B;  3W2V A;  2EB7 A;  2LP0 A;  2E34 A;  2NXN B;  2P8T A;  3HM5 A;  4XLP F;  2NS0 A;  2H09 A;  2ELJ A;  3C7J A;  3G6E I;  3CC7 I;  3UR3 C;  4IHY A;  2HGC A;  3R4K A;  4ENK A;  3UKG A;  1Z6R A;  4MFD A;  3S2D J;  1QRY A;  2OU2 A;  2VJI A;  3JRF A;  4EVI A;  2ZNY A;  4XL9 A;  1T38 A;  2M87 A;  1GV5 A;  2EBI A;  2Y31 A;  4I02 A;  5D5X B;  3CCM I;  4B8X A;  5HNF A;  3QYB A;  1FYM A;  1QZE A;  3ZQQ A;  2O8K A;  4WWC A;  3TMO A;  4XLH A;  4U88 A;  2DMT A;  2XAF A;  3WGG A;  1H88 C;  2MSY A;  4CYC A;  5GTH C;  5F64 A;  2BY3 A;  2MGQ A;  1FYK A;  1S29 A;  2GIZ A;  2A05 A;  3S1N J;  1I6X A;  5GAE J;  4UUT A;  1QZY A;  4DGW B;  2VN2 A;  2WB1 A;  1P4W A;  1WFX A;  3HPH A;  1X3Z B;  2AXT C;  2V1D A;  3PIO F;  1PP7 U;  2RQQ A;  3H0D A;  4EQQ A;  3GZN B;  1DGW Y;  1H9G A;  3RKQ A;  2P5L C;  3ABK H;  1YS7 A;  5B3S H;  2COM A;  4B3X A;  1DGR M;  1Z67 A;  2HFH A;  2VPR A;  3KEY A;  4UUV A;  3GTL J;  4KUM A;  2DT6 A;  4AID A;  2E2J J;  1FIA A;  2RC4 A;  1X4O A;  5DCF A;  5JR3 A;  1ZLJ A;  2L4M A;  3ZMT A;  4BDZ A;  3FMR A;  2BW3 B;  4OAZ A;  5E18 F;  3HOZ J;  1XMK A;  1WJC A;  3CDH A;  2BZT A;  2QVO A;  1SC7 A;  4LB6 B;  2MYS A;  3DV8 A;  1V4R A;  3W2W A;  1I1G A;  2QQ9 A;  2CS3 A;  3WOD F;  4NC8 A;  3RTR A;  3GTO J;  1B6A A;  3DEU A;  3CJN A;  2XKO A;  2R7X A;  4A12 A;  1A36 A;  1Y0U A;  1G3S A;  4EAT A;  1FOW A;  3AG1 H;  3MN2 A;  1NH3 A;  3OYA A;  5KCM A;  3WE3 A;  1IZ1 A;  3E5X A;  5C4J J; 
#chains in the Genus database with same CATH homology
 2COB A;  1GV2 A;  4XK4 A;  3I4M J;  4C3I J;  2EZH A;  2LVS A;  3LSP A;  1ZR2 A;  1AKH B;  2ME0 A;  3JRI A;  2NOG A;  1I50 J;  1JT0 A;  4BY1 J;  3CQZ J;  1RPW A;  2QF7 A;  1TWA J;  3K7A J;  2DMN A;  1O4X A;  4MO7 A;  3BR2 A;  1E3O C;  4V2F A;  5E3N A;  1FJL A;  2GM4 A;  3HDD A;  3M4O J;  4AC0 A;  1JTY A;  2JN6 A;  2XGC A;  3HGG A;  1X2M A;  4M3E A;  2K40 A;  3CDL A;  2EZL A;  3FK7 A;  2R0Q C;  1Z0X A;  2M9H A;  3DCF A;  2TRT A;  2NS8 A;  5EZH A;  2L7F P;  1I6H J;  1LE8 B;  2JK3 A;  1HDD C;  4W1U A;  1B72 B;  1WPK A;  2R7Z J;  1IGN A;  4B4C A;  2JA8 J;  4D7N A;  3RZO J;  1JKO C;  5FLM J;  5F0F A;  5IP6 A;  3PO3 J;  2K9Q A;  3S16 J;  4UUS A;  2HQ5 A;  2X6O A;  3IV5 A;  2CRG A;  5BNG A;  2M34 A;  3OOU A;  1HDP A;  3ZQC A;  1U9N A;  1JT6 A;  2LR8 A;  3TP0 A;  4IHW A;  3LSJ A;  3FKI J;  2DA7 A;  5IOY A;  2B63 J;  1H8A C;  2AO9 A;  1T33 A;  4CYC B;  1XS9 A;  3GTK J;  1MSE C;  1X58 A;  2OPT A;  3HBL A;  3A02 A;  1ETK A;  2JMW A;  5EG0 B;  2L9R A;  5M5W J;  4DYR A;  5EYR A;  5M3M J;  1NK3 P;  3I4N J;  3SJM A;  1QVT A;  1Q1V A;  1HLV A;  2XPV A;  3IH3 A;  1UMQ A;  3NAR A;  1MNM C;  3VPR A;  2O9L A;  3QPS A;  2K9N A;  2MW8 A;  2E2I J;  5J1R A;  1EF4 A;  5EDN A;  1X2N A;  1YRN B;  4S0H B;  3K2A A;  5IYB J;  1XG1 A;  5IYC J;  4B1R A;  3HOW J;  3C2B A;  1D5Y A;  1MH3 A;  1BJZ A;  4IHX A;  1IRZ A;  1ZQ3 P;  3PO2 J;  1AKH A;  2E1O A;  3GTJ J;  2Y9Z A;  2DA5 A;  3F0C A;  2R93 J;  4DZJ A;  4I76 A;  2CU7 A;  2JWT A;  1IUF A;  2IEK A;  5FKO A;  1IV6 A;  4M3G A;  1XC5 A;  4A3C J;  1TWH J;  3O8G A;  1RES A;  2LK2 A;  2ME6 A;  1ETW A;  2FD5 A;  1DU0 A;  1TWC J;  3BTL A;  2FJ1 A;  4M3D A;  1BW5 A;  1U78 A;  1A6I A;  3GTG J;  2IBD A;  3JRD A;  4ABZ A;  2JJ7 A;  2R5Y A;  1TWF J;  3FIW A;  3A03 A;  4NDL A;  1TWG J;  4M3B A;  1B72 A;  1ZGW A;  5F27 A;  4JX4 A;  2EQR A;  3Q0V A;  5J1U A;  4HNV A;  1SAN A;  4X6A J;  1JUS A;  2ECB A;  3A01 A;  4FIS A;  2HXO A;  1WH5 A;  4DYC A;  2H8R A;  3BR1 A;  4D5C A;  5E3M A;  3Q0U A;  3O8H A;  4EEF G;  3JRA A;  2L7M P;  3ZQL A;  4QTR A;  1HOM A;  3B6A A;  9ANT A;  2LKX A;  4XRS G;  1OJL A;  1OCP A;  3H0G J;  3WHC A;  5EG0 A;  3OSF A;  3BQY A;  3HKZ N;  3S14 J;  3BTJ A;  1WCM J;  5DTD A;  5K7Z A;  3HGY A;  5EGO A;  3CMY A;  2Y30 A;  4BBS J;  3M3Y J;  1T56 A;  1FTT A;  3G1M A;  3PM1 A;  1P7I A;  4DW6 A;  2IAI A;  3BT9 A;  2ECC A;  2QCO A;  5C44 J;  4MLO A;  4B3A A;  1JKQ C;  4BBR J;  2LD5 A;  2NS7 A;  2ZB9 A;  3S17 J;  2XB0 X;  4FE4 A;  2X9D A;  3TW6 A;  3BR5 A;  2ID6 A;  2FX0 A;  1W0T A;  1MBH A;  2DTZ A;  2R92 J;  2XSD C;  1Z77 A;  4A3L J;  5IYD J;  1BA5 A;  4XID A;  4QIW N;  4D7M A;  1PUF B;  2NVX J;  4C2M J;  1GVD A;  2GBY A;  2DMQ A;  1RKW A;  3G1L A;  5K7H A;  4L5E A;  1LFB A;  2G0E A;  2YS9 A;  1VND A;  2HOT A;  3ZQF A;  4JYK A;  1QPI A;  1RET A;  4JP0 A;  3B6C A;  4C3J J;  1JGG A;  3JRG A;  1A5J A;  2M2E A;  3Q3S A;  5FKM A;  1PUF A;  3GBG A;  1SFO J;  2XPU A;  3ZQI A;  3LOC A;  4A69 C;  3MVP A;  3H3V K;  4DYQ A;  4A93 J;  5M5Y J;  3JRB A;  5M3F J;  2DA3 A;  2CUF A;  3IH2 A;  2N8G A;  2OF7 A;  1MBF A;  1ITY A;  2AHQ A;  2HDD A;  1CQT A;  3BR0 A;  1BL0 A;  2CJJ A;  2GLO A;  1ZK8 A;  2PMZ N;  1WH7 A;  2DA6 A;  2P81 A;  2XPW A;  1DU6 A;  5C3E J;  3DEW A;  4BKX A;  3A01 B;  1ZR4 A;  3S1Q J;  1WI3 A;  1LFU P;  2VKV A;  1QVU A;  2X48 A;  1GUU A;  3QPL A;  4FE7 A;  5F0C A;  4C3H J;  2ELK A;  4RDU A;  1IDY A;  5F0H A;  1GT0 C;  2I10 A;  2JA7 J;  2HOS A;  2XGE A;  1W0U A;  1H89 C;  1FTZ A;  1UHS A;  4V2G A;  3TW7 A;  4XRM A;  2EH3 A;  2VUM J;  1MSF C;  4MFE A;  3BR6 A;  3Q0W A;  2R5Z B;  2Y0S N;  4JX5 A;  3JRH A;  1BW6 A;  4RBO A;  1ENH A;  3LSG A;  3E7L A;  5EEA A;  3HB9 A;  5K7F A;  5GPA A;  2WV1 A;  3QQA A;  5F08 A;  5FKK A;  4A3J J;  1ETY A;  1TC3 C;  5JLX A;  2CUE A;  3SFI A;  3NAU A;  1MBK A;  2DN0 A;  4DZP A;  1ETQ A;  5IP7 J;  3D1N I;  1JKP C;  2YU9 J;  5FJ8 J;  1F36 A;  2XB5 A;  2TCT A;  1OCT C;  3S1R J;  2ID3 A;  3BTC A;  3LSR A;  1IG7 A;  2JA5 J;  3GTP J;  2KT0 A;  3RZD J;  3W6V A;  1OFC X;  4IEJ A;  4W97 A;  1R9T J;  1NTC A;  1JUM A;  5IP9 J;  3HOV J;  5HOD A;  3FK6 A;  1ORK A;  5EZG A;  4A3D J;  4A3K J;  2LY9 A;  5M5X J;  4A3I J;  4A3B J;  5FKN A;  3TED A;  5DS9 A;  2CQX A;  1ETV A;  3JRC A;  1JJ6 C;  3BG5 A;  1HF0 A;  2DMU A;  4M6V A;  3HEF A;  2K9S A;  3ZQG A;  3GTM J;  3MKL A;  3RQI A;  1HCR A;  5E3O A;  3TP3 A;  4FCY A;  3BG9 A;  4AUX A;  1JKR C;  2H1K A;  3BTI A;  1GDT A;  2WAQ N;  2NVY J;  3BR3 A;  1APL C;  1ZTR A;  4BXX J;  3WHB A;  2M8G X;  2XRL A;  1AHD P;  1JUP A;  4X1E A;  1ETO A;  1K83 J;  2DA1 A;  5E3L A;  2HOA A;  2XGD A;  2DA2 A;  5JLW A;  1POG A;  2LTP A;  3S2H J;  1G2H A;  4FTH A;  1ETX A;  1MBJ A;  1ZKG A;  2CQQ A;  2NVT J;  4A3G J;  1YRN A;  2Y9Y A;  1IC8 A;  1P7J A;  4BY7 J;  2YUS A;  4JX6 A;  1JJ8 C;  4Y52 J;  5GP9 A;  3ZOB A;  3OIO A;  1K61 A;  2E19 A;  3GTQ J;  1U9O A;  1Y1V J;  4LOC A;  2VI6 A;  3JRE A;  4J19 A;  2WB1 N;  3OSG A;  3BQZ A;  1LE8 A;  3ZQH A;  2R5Z A;  2MG4 A;  2DA4 A;  2HI3 A;  2LP0 A;  3HM5 A;  2Y2Z A;  1F43 A;  2L7Z A;  1B8I B;  4IHY A;  2JA6 J;  5J1Y A;  2FQ4 A;  3UKG A;  4MFD A;  4IHV A;  1VI0 A;  3S2D J;  1QRY A;  5GPC A;  4UUS B;  3JRF A;  2NVQ J;  3S15 J;  2R5Y B;  3HOY J;  5EF6 A;  1GV5 A;  2KDZ A;  2EBI A;  2Y31 A;  2O7O A;  3FIS A;  2O8K A;  3S1M J;  5IOZ A;  1B8I A;  1VFC A;  2RAE A;  4AYB N;  1IJW C;  3IH4 A;  2DMT A;  2LLK A;  1H88 C;  2MSY A;  4CYC A;  5FLV A;  2MGQ A;  3BG3 A;  3S1N J;  4A3F J;  3G1O A;  1NK2 P;  2L0K A;  4A3M J;  4UUT A;  4M3F A;  1VF9 A;  3HOX J;  3CCY A;  3JR9 A;  2DMP A;  4QSH A;  5EGO B;  3HOU J;  3LNQ A;  2W48 A;  2DJN A;  2EZK A;  5IPA A;  3RKQ A;  1UG2 A;  2HYJ A;  4I6Z A;  3SDG A;  2D5V A;  2VPR A;  1WGX A;  4D5F A;  2VKE A;  1FEX A;  1IDZ A;  1RR7 A;  3L1P A;  3GTL J;  5F04 A;  4GFB A;  4Y7N J;  1MBE A;  1FIA A;  2E2J J;  4XIC A;  2HXI A;  4MIM A;  1AU7 A;  4A3E J;  1U8B A;  3HOZ J;  1RKT A;  2LFB A;  1Y1W J;  2M0C A;  5C4X J;  5FKL A;  1JTX A;  1MH4 A;  2EZI A;  1S7E A;  5J3L A;  4XRS A;  3GTO J;  5F1J A;  2E2H J;  1MBG A;  4G12 A;  3MN2 A;  1FIP A;  1I3Q J;  5C4J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...