1H88C

Crystal structure of ternary protein-dna complex1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
b'GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C03
3RQIA 2EZKA 2R5ZB 1H88C 5IYCJ 1NK2P 1A6IA 3HGYA 1MBJA 1IDZA 1VFCA 5IPAA 1ZTRA 5E3MA 2XPWA 3S2DJ 3HB9A 1HDDC 3SFIA 1AU7A 1BW5A 1Z0XA 3SDGA 1BW6A 3GTJJ 1ETKA 2VPRA 1W0UA 2CQQA 4DYQA 4A3MJ 1LE8B 1EF4A 1JT6A 2K9QA 5IOYA 4XRSG 5K7HA 2IEKA 4A3GJ 2HOSA 5C4JJ 1JTXA 1IJWC 1UHSA 4M3GA 5C44J 4C3JJ 4I76A 2LP0A 2LTPA 3HBLA 1AKHB 1I6HJ 4FE7A 4IHWA 5JLWA 1JKPC 5GPCA 1QVUA 4M3FA 2R5YB 4UUSB 2WAQN 4C3IJ 3TP3A 2JA7J 4JX5A 2L0KA 1VNDA 3G1OA 5EG0A 2RAEA 4Y7NJ 5F1JA 2L7ZA 4HNVA 3SJMA 2XB0X 5K7ZA 4RDUA 3BG5A 5EZGA 3GTLJ 5M3FJ 3CQZJ 1MBGA 5IP9J 2VI6A 3BR6A 1JJ8C 2E2IJ 2XB5A 1JUMA 2XPUA 3IH4A 2XPVA 2DA7A 1D5YA 3BR2A 3TP0A 3NAUA 2DA1A 2D5VA 3H0GJ 1OFCX 1WH7A 2CJJA 1FIAA 1ETWA 3E7LA 4X1EA 2R93J 1BJZA 1JTYA 3DEWA 3S14J 1JT0A 2O8KA 3BQYA 5F08A 2K9NA 2NS7A 1ZR4A 3QPSA 1ETQA 1IV6A 4V2FA 5M5XJ 2GLOA 4BY1J 3MN2A 2O9LA 1GUUA 2G0EA 1B8IA 5DS9A 3WHBA 2LLKA 4M6VA 4AC0A 4CYCA 1HLVA 1HOMA 1MSFC 5DTDA 1WGXA 1SFOJ 4D5CA 5FKKA 2TCTA 5IOZA 1MBFA 5HODA 5J1UA 2TRTA 1LFUP 1RKTA 2IAIA 5FKOA 2W48A 3MVPA 2AO9A 4XRMA 1U9NA 2L7FP 2NOGA 4DYCA 2ELKA 1HF0A 4A69C 2DMTA 4QIWN 2JA5J 5M5WJ 3CMYA 2M9HA 2ID6A 1ETYA 1LFBA 3HM5A 3BG3A 1FJLA 1IRZA 4FISA 5EEAA 4IEJA 1MH4A 2N8GA 2COBA 2EZLA 3RKQA 1FTZA 1ENHA 1U78A 1MBKA 1XG1A 1OCPA 3C2BA 2GM4A 4B4CA 4A3FJ 3W6VA 4W1UA 3GTGJ 3WHCA 4V2GA 1ZKGA 5GP9A 3O8GA 3CDLA 3FIWA 4A3BJ 2LR8A 1TC3C 2EH3A 2MG4A 5IYBJ 1NK3P 3JRCA 4QTRA 1XS9A 2Y30A 5EGOB 2R5ZA 3JRGA 3K2AA 1IUFA 3OIOA 2DMNA 5EYRA 1GV2A 1ETOA 3ZQHA 2JA6J 3LSJA 3ZQFA 2Y2ZA 5F0CA 1U9OA 2E1OA 3O8HA 4A3CJ 2HXIA 3Q0WA 9ANTA 3BR0A 3QQAA 4XIDA 2HOAA 4FCYA 2EQRA 1GVDA 2FD5A 2HI3A 3NARA 2CRGA 4M3DA 3JRHA 1DU0A 2HOTA 1LE8A 3D1NI 3BTJA 1T56A 2LKXA 2X48A 3IH2A 1XC5A 1UMQA 3S1MJ 1CQTA 4AYBN 1TWAJ 4DZPA 1AKHA 2I10A 2YU9J 4I6ZA 3H3VK 2JN6A 5EF6A 2H8RA 4GFBA 1TWGJ 2R0QC 2E2HJ 2R5YA 4UUSA 4XK4A 2DTZA 3BR5A 3PM1A 4M3BA 4S0HB 3TW7A 2NVXJ 3S1NJ 1RETA 2M0CA 2R92J 4A3IJ 1VF9A 3HOZJ 5C4XJ 3MKLA 3B6AA 1RESA 4D7MA 4B3AA 2CQXA 1E3OC 3UKGA 1QPIA 3HOWJ 1OJLA 5J1YA 4FE4A 3HOVJ 2QCOA 1Z77A 3ZQGA 3JRBA 4X6AJ 5F0FA 1H89C 5J3LA 3I4MJ 2LK2A 3LSGA 1WPKA 3HOUJ 2EZHA 4A3EJ 5FKMA 1B72A 4JP0A 1B72B 1VI0A 4XRSA 2JMWA 1X58A 2K9SA 3HGGA 2HQ5A 2R7ZJ 1P7IA 5FKLA 1Y1WJ 3HDDA 4MIMA 1APLC 2AHQA 1IG7A 4JX6A 1YRNB 2HYJA 2ZB9A 2Y0SN 5EZHA 4MFEA 4A3DJ 1MNMC 2MSYA 3OSFA 1X2MA 4BXXJ 1JGGA 5E3NA 4IHVA 4UUTA 2CUFA 2K40A 3B6CA 3S17J 1ORKA 4B1RA 2LFBA 1RR7A 2ECCA 3S16J 2VKEA 1UG2A 2ID3A 5FJ8J 1R9TJ 2M8GX 1FEXA 1X2NA 1H8AC 2WV1A 3S1QJ 2DMQA 2DA5A 5E3OA 2MW8A 3HKZN 3G1MA 1K83J 3M4OJ 2DA3A 3Q0VA 1TWHJ 1U8BA 2ECBA 2KT0A 3OOUA 2IBDA 1MBEA 2Y9ZA 2CUEA 1Y1VJ 4D5FA 1ETXA 2FJ1A 2LVSA 3S1RJ 1IDYA 3JRDA 4L5EA 1G2HA 3LOCA 1MBHA 4IHYA 2HDDA 3ZQLA 2E19A 5J1RA 5C3EJ 4A3KJ 4FTHA 4MLOA 1JUPA 2E2JJ 1PUFB 3PO3J 1DU6A 2O7OA 2PMZN 3A01B 3PO2J 2XRLA 5EGOA 2NVQJ 3LSPA 1MH3A 2XGEA 4BBRJ 1TWFJ 2ME0A 2NS8A 2M34A 4DZJA 3Q0UA 1JKOC 3A02A 5FLVA 2Y9YA 1W0TA 1JJ6C 5IP7J 3JRIA 1A5JA 3IH3A 1GT0C 1RKWA 1K61A 3GTKJ 2QF7A 3ZQIA 2H1KA 1I50J 1JUSA 4G12A 2L9RA 4NDLA 2P81A 3ZOBA 1QRYA 4DYRA 1HDPA 3BTLA 1WH5A 2M2EA 2XGDA 2HXOA 1WCMJ 4D7NA 4C3HJ 4QSHA 2DA2A 5FKNA 2LD5A 1HCRA 3I4NJ 1AHDP 3A03A 3JR9A 2DN0A 4C2MJ 1I3QJ 3JREA 1BA5A 2FX0A 1ZR2A 2DA6A 2L7MP 4ABZA 1S7EA 3GBGA 2YS9A 5EDNA 1T33A 1TWCJ 1WI3A 4Y52J 3CCYA 1F36A 2XSDC 3DCFA 5EG0B 3TEDA 3M3YJ 2X9DA 2JJ7A 4RBOA 2VUMJ 4BKXA 3L1PA 3JRFA 2EBIA 3GTOJ 3FK7A 5JLXA 2B63J 3GTQJ 1YRNA 1FIPA 1QVTA 3VPRA 2DJNA 1P7JA 1BL0A 1POGA 3GTMJ 1JKRC 3GTPJ 2JK3A 3OSGA 2OPTA 3G1LA 4A3JJ 2GBYA 1GV5A 1JKQC 4A3LJ 1IGNA 1IC8A 3S2HJ 1OCTC 1ZGWA 1ITYA 2DMUA 2X6OA 3ZQCA 5IYDJ 3RZOJ 2NVYJ 2OF7A 1NTCA 3BG9A 4XICA 4BBSJ 2MGQA 1B8IB 1GDTA 3BR3A 5F27A 3FISA 4CYCB 3LNQA 3BTCA 2JA8J 3FKIJ 5BNGA 3K7AJ 4MFDA 1Q1VA 2EZIA 4LOCA 5M3MJ 3LSRA 3F0CA 5IP6A 4MO7A 4W97A 3RZDJ 3BTIA 2KDZA 1F43A 3IV5A 3BQZA 1ZK8A 5FLMJ 1ETVA 2ME6A 1ZQ3P 2CU7A 1FTTA 5F0HA 5K7FA 2WB1N 2DA4A 2Y31A 3BT9A 4AUXA 2DMPA 3Q3SA 4JYKA 1PUFA 3A01A 4M3EA 3S15J 1MSEC 3HOXJ 5E3LA 3HOYJ 4DW6A 1RPWA 3JRAA 4EEFG 4J19A 3FK6A 2XGCA 5M5YJ 3BR1A 2NVTJ 1SANA 4BY7J 5GPAA 2YUSA 2JWTA 4JX4A 3QPLA 2FQ4A 1O4XA 2VKVA 3TW6A 4IHXA 3HEFA 2LY9A 4A93J 5F04A
chains in the Genus database with same CATH superfamily
4PUSA 5TJJA 2EZKA 2K4BA 3IAS2 3E6BA 1IDZA 3C18A 1WQ2A 1A31A 3SFIA 1AU7A 3RPUA 4WF2A 1Z0XA 3HTUA 1RNLA 2K86A 3SDGA 2D1HA 2VPRA 4E6KG 2AXTC 1D0ZA 2CQQA 1JT6A 5KAIC 2KL4A 3K4MA 2IEKA 4L18B 2JPCA 3LA2A 2EK5A 5C4JJ 2EJRA 2L01A 4M3GA 3RIRA 3SFZA 2LP0A 3KZZA 1YX3A 4IHWA 1J9IA 4ESJA 2HDWA 5ILVA 2XDVA 4Q4ZF 1YW8A 1IUYA 1WFXA 1ZN2A 2WAQN 4C3IJ 3TP3A 1YLFA 2NS0A 3H92A 2JUGA 2E36A 1VNDA 3ABMH 3KEYA 2X1CA 4Q47A 4KITB 1G3WA 4RDUA 2QA4I 4NUBA 5ERIA 3F8MA 5EZGA 3WTVC 2HYGD 4A0XA 5HOOA 1PYVA 3P9KA 4ON0A 3HPHA 2F5EA 4ZYAA 3V7SA 1Z6RA 1JJ8C 2E2IJ 1JUMA 3I64A 2VODA 3VYRB 3K70D 2XPVA 2DA7A 4PJNA 2HU9A 2KZVA 2B0LA 2QGUA 3H0GJ 2FNAA 1OFCX 1WH7A 3GVAA 1ETWA 1BJZA 4G7OF 5F08A 2IS6A 2K9NA 2NS7A 3UNGC 4DBRA 5LRRA 1IV6A 2Z9OA 4V2FA 1IF1A 2GLOA 3WTZA 2ZXWH 4AVPA 1VQ7I 2O9LA 2QQBA 3CJTB 1GUUA 1GHCA 3BZKA 1B8IA 3WHBA 1ZARA 2YR2A 2Y69H 3H5AA 4PJLA 4AC0A 1HOMA 1MSFC 1E17A 1TTYA 2OBPA 4BL0B 1WGXA 2LMDA 4ENKA 2B7EA 3I5UA 2TCTA 1OMIA 2JRMA 1LFUP 1RKTA 2IAIA 4B3XA 2DU9A 3MVPA 1XGMA 4XRMA 4KIGA 1TT0A 1YITI 3DV8A 4DYCA 1BR2A 2ELKA 3GLLA 2QSHX 1HF0A 3K4LA 4G94A 2KLOA 2M9HA 1T2KA 3VFZA 3GXOA 1K78B 4A5MA 1XCBA 2N8GA 3QPTA 4D9JA 2K3FA 1WJFA 3WODF 3HOTA 5GAHJ 3IWFA 1MNDA 3C2BA 2JVGA 4D0PA 1PUEE 4BGDA 3EUHC 2XVCA 5GP9A 4YIIA 2K5CA 5F6FA 3CJNA 2GOXB 3JSOA 4ZJZA 3I4PA 4EATA 2Z33A 1BOBA 5IYBJ 4AIKA 2D1VA 2UXNA 4BDYA 3Q5FA 4U0VA 2FBHA 1P4WA 5BPDA 2OQGA 1RR8C 5CQEA 2BW3A 4M6XA 2P0WA 5EYRA 3D5LA 3WU2C 2BY1A 2EFNA 4MQ9F 3WGGA 3ZQHA 2CS3A 3C3WA 3U9GA 1I39A 3ZQFA 3DTKA 1VTNC 1F5TA 2E1OA 1SAUA 3Q0WA 1X4PA 3BR0A 4FCYA 1GVDA 2A05A 1MMAA 4M3DA 1BI2A 3C1DA 4HX7A 2J5PA 3GEZA 5H6RA 2DYSH 3TO7A 2ZJQF 2LKXA 3LMMA 1D8JA 4C2TA 1UMQA 4LJZF 4AYBN 4DZPA 1B9MA 4EM2A 4BQNA 5LFAA 1KQ0A 2M4GA 2JN6A 2UUZA 3DLAA 1SD5A 1P6RA 2V9KA 1D1AA 2KRHA 4EGZA 2DFHA 4BEHA 1FOYA 5TGTA 4XLPF 2QWWA 1V3FA 3N4MA 2NVXJ 5FRNA 3PIOF 2KKOA 1VF9A 1J59A 4HV5A 4N4OB 3HOZJ 3NQOA 1EH6A 3RKXA 5C4XJ 3B6AA 3D5SC 3M8EA 4RAGA 5TRDA 2CQXA 3C2HA 2HDCA 4C30A 1IRFA 2X6XA 5E1ZB 2EIJH 3ULQB 3PNVA 3GZ6A 5JHFA 5J1YA 4KUMA 4OMYA 1LEAA 2DLLA 3WE2A 2LK2A 5FKMA 2LY2A 5BS6A 2GOMA 1X58A 4RGSA 1KQ9A 2K9SA 4IRHA 3BLYA 5FKLA 3HDDA 3FBIB 4XNFA 3ROUA 2H09A 4JX6A 4Q5SF 3ERMA 2Y0SN 2BYVE 2FNPA 1YHQI 3TL4X 4U0YA 3DEEA 2VQHA 2WAQA 3T5XA 5E3NA 4CA0A 4WK8F 5L3CA 4B1RA 1IW7F 4KT6A 1RR7A 2ECCA 4AIDA 3WTSC 2FBKA 1R1TA 2M8GX 1ON1A 2WV1A 2RNGA 1TQPA 5L3BA 3HKZN 1O7LA 3TO9A 3M4OJ 1ZGAA 1D0YA 2DA3A 3LAJA 3K4NA 2ZXJA 2OD5A 3DBHB 5CVUA 1X1CA 3FBNB 4XONA 1YQAA 3CUQC 5J4VA 2ZMEC 1ETXA 4HX8A 5ICCA 3FMQA 4G7ZF 1UAAA 3S1RJ 1IDYA 3DEUA 3AKZA 2MA3A 1BC7C 2DDAA 1G2HA 5B1AH 2VIXA 3L9FA 1JE8A 4A5NA 4L9NA 4DNCA 2E19A 2RQQA 3C7JA 3DU6A 1DU6A 1R58A 2XRLA 5EGOA 2NVQJ 1I6XA 4BE0A 1QPMA 2A6TA 3VWBA 4Y17A 2NS8A 4II3A 4FASD 5E8IA 4M9XA 2E60A 3HXLA 4NC8A 3KP3A 2P6TA 3FHZA 1R6RA 4LG0A 4XQFA 2DOEA 2LREA 1VQMI 2A07F 5FLVA 2Y9YA 1X3WB 2DPDA 1EJ9A 1H9GA 1JJ6C 5IP7J 4O5VA 1QHHD 1D1CA 1RC9A 1FBUA 3VYTB 3ZGKA 3G71I 1RKWA 2OQRA 2VKHA 4CH7A 2R7RA 2PMUA 4UB8C 4HF0A 2QF7A 3GTKJ 2ZFUA 1I50J 3PUBA 4G12A 4NDLA 3ZQ7A 2ZXIA 3RSNA 1EA3A 3ZOBA 4BU2A 3ZQQA 5HLTA 1LDKB 4NC7A 1X1PA 5D5UB 4C3HJ 4QSHA 4UVBA 2XIGA 3E0JB 1CGPA 2CV2A 3CJRB 3I4NJ 5J8FA 1YS6A 4PGHA 3OYNA 1BA5A 2FX0A 2L9VA 3WTYC 2MH2A 2PMZA 4LMYA 1ZR2A 2WY7Q 2DA6A 4HOBA 1YX5A 4PSWA 1QA6A 3GBGA 2YS9A 5JVGF 1VQ4I 3CO6C 4H4KC 1TWCJ 1MJ9A 2Z3YA 4LIUA 3RCOA 3K1NA 3CCYA 3DXJF 1GLNA 3DCFA 3TEDA 1WJCA 2I8DA 2XGXA 2JJ7A 4I99C 2EINH 3A1YA 2Q2EA 5IY5H 1ZLJA 3KEOA 1IN5A 4YFKF 2V6EA 1XDSA 2NNYA 2TDXA 4Y3OA 5JLXA 1VQNI 1QVTA 3F6VA 4AYBA 1P7JA 4KIBA 1POGA 3ZP5A 2CO5A 2VN2A 1OR7C 1S7OA 2W84A 2K4JA 3PSFA 4PJJA 1BR4A 1IGNA 2MLKA 5LGNA 4L5JA 2DDBA 4PJMA 2DXIA 2X6OA 1MW7A 3ZQCA 1X3UA 4CCLA 1XMXA 4JOMA 5J6XA 1V4RA 1NTCA 2EFPA 2VJJA 3RI4A 1VQ9I 3K1PA 2XAGA 3E6CC 4IQ4A 1IXCA 3EETA 2JA8J 3DKYA 3JAMK 2FMLA 3FKIJ 1R4NB 1JXSA 1SEUA 2M5WA 3S93A 2RGVA 2X4HA 3BCAA 4BS9A 3F0CA 2ETHA 5JI6A 2P5VA 5CVJA 2DODA 4BE1A 3EYYA 3MZHA 4HYEA 4BH9A 5GTHC 5ED4A 3BTIA 3RZDJ 3IV5A 3CDHA 3N97A 1K4TA 5FLMJ 1ZQ3P 5K7FA 1QZEA 3BT9A 2XUBA 1WJAA 5FFXA 3Q3SA 4JYKA 1PUFA 2VQGA 3A01A 4M3EA 4RB0A 3S15J 1T98A 2Y0SA 5TISC 4CXFA 4IHTA 1HKSA 3NWSA 2P7CB 5DV5A 4IZZA 2CH0A 1L3LA 4PJ0C 3LSHA 3RPQA 4EEFG 3DP7A 2KJBA 3FK6A 4LGWA 5M5YJ 3BR1A 2VT3A 2QVOA 1YI2I 4EJWA 4NBQA 4E7JA 3CCJI 5GPAA 2ZCWA 4JX4A 4A6EA 1V5GA 1QHGA 2FQ4A 3FXLA 3HKZA 1X1DA 2QBYB 4A93J 5F04A 1XTAA 1QO0D 3B02A 2K7LA 3RQIA 2FRHA 4ENNA 1T08B 2VJ5A 1H88C 2R5ZB 2Z16A 3BG7A 3LL7A 5CVRA 3VODA 1VQLI 2ZSHB 3F3XA 2PI0A 5DCMB 1VFCA 5IPAA 1ZTRA 4RGRA 3LSKA 2OZUA 2NAZA 3DPTA 1HDDC 5FLXK 1DP7P 1TW3A 2JSPA 1DQUA 3DFGA 1BW6A 2G9WA 3IAM2 3IHUA 3BZCA 2EIMH 1ZRCA 1T0FC 2CG4A 1S7AA 4A3MJ 2KRCA 5IOYA 1KGSA 1R71A 5K7HA 4HBLA 1ODDA 2HQNA 4RGXA 1JTXA 4IF4A 3ASNH 5C44J 1LJ9A 3LSTA 2IGOA 3KX2A 4FE7A 4CO8A 4OIOF 5JLWA 2NXNB 3LA7A 3M9AA 4M3FA 3H3UA 5CYVA 2HFHA 5HLHA 3OYMA 1JKPC 4CCKA 4UUSB 4ENJA 1ZRFA 3OS0A 4JX5A 4OIPF 4I0BA 3G1OA 3VSLA 3GWZA 2YU3A 1NG7A 2RAEA 2XF7A 5F1JA 2L7ZA 3E3VA 2XB0X 1UG0A 5K7ZA 3ML6A 2E5ZA 3TGNA 2NNNA 3CQZJ 4BACA 1MBGA 4AIJA 3FDYA 2G7UA 3IWZA 3ZRGA 5L3GA 4F7ZA 3KYDB 1QBJA 3BR6A 2NRAC 1EV7A 3IP4B 3OYKA 2YX4A 1XGSA 2PFBA 1Z7UA 2VONA 3DLLF 1OYIA 2DT6A 1VZ0A 1Z9CA 1FSEA 2CJJA 2DFFA 3E7LA 3MD2A 2EFOA 1JTYA 2QSGX 4LD5A 1ZHFA 1ZG1A 1JT0A 5LHGA 3HJEA 3QPSA 5D4RA 2RDPA 3MEXA 3R61A 1PP8F 4BY1J 4RAFA 4EJOA 3OIPA 4YFXF 3REOA 2XRNA 3IUOA 2EWNA 1ULYA 4G6QA 1MDMB 2M4KA 4CCNA 4L9JA 4CYCA 1HLVA 3HUGB 4UXNA 1W1WE 5JFRA 1RZ4A 1SFOJ 1WJ5A 1I27A 5IOZA 1MBFA 1YYVA 3VSKA 3OYDA 3CCSI 1DGRM 1FT9A 2IW5A 3I55I 2KISA 1R7JA 4PFPA 2KIFA 2E7XA 3KYCB 2AO9A 3LFKA 5FB2A 2W4SA 2NOGA 2CUZA 2KFDA 5F64A 4ZYDA 2DTRA 2JA5J 5M5WJ 2P5LC 4MHGA 3F21A 1FJLA 1XX5A 1IRZA 2CW7A 4IEJA 3RKQA 1FTZA 1U5TA 1ENHA 1CF7A 1B1BA 3ECOA 3H5NA 2XF6A 3P7NA 5H20A 2QENA 1KYZA 1XB4A 4B4CA 3J7AY 4P9UA 3I59B 2HWVA 2P7VB 3B73A 4LLGF 1W5TA 2CFOA 3GZ5A 2F4MB 2BHZA 3CDLA 4IQJA 4A3BJ 3H5RA 4PZJA 3IRRA 1U3EM 1N78A 2EH3A 4RAZA 5FRMA 4XN3A 1MZBA 3JRCA 4KN7X 2K9MA 3RTRA 4N4NB 3MWMA 2Y30A 2IT0A 2VBWA 2DCEA 3K2AA 2PQ8A 3OIOA 3OYCA 4HQEA 1GV2A 3DQVC 3LSJA 2ELHA 5B66C 1IO2A 2ZO4A 1U9OA 2MABA 3O8HA 2HXIA 9ANTA 3LWFA 5L3DA 5FGMA 3H9GA 2EQRA 2NVUB 3NARA 2STTA 3DPUA 2H6CA 5CKTA 3BTJA 1T56A 1BBYA 3HL2A 3OYIA 3D1NI 1LE8A 2X48A 1XC5A 2FU4A 2RV8A 2I10A 1AKHA 3TOAA 2VOPA 2HPMA 5CVIA 3RYPA 4GFBA 1L0OC 2DYRH 2H8RA 2R0QC 2E2HJ 3D5RC 3CC2I 2YSRA 2R5YA 1OCCH 1USSA 2Y0MA 3BR5A 2DTZA 1UJ8A 1R00A 3BJAA 3PM1A 5KHDA 4IRIA 4ZDOA 5HNHA 3TW7A 3S1NJ 4LITA 3JAMZ 3QU6A 1WZ2A 3IRQA 4A3IJ 2H94A 1PJRA 1J2XA 1MJBA 2PEXA 4WXCA 3KETA 2XROA 4BQAA 4ZYGA 3OYJA 1BI1A 4IRGA 4HDVA 3HPGA 3LSIA 2Z5UA 1ZRDA 1QPIA 1DUXC 3HOWJ 4G6TB 5E1WA 2HS5A 1OJLA 1XMAA 3ABTA 4RM3A 1E0EA 4X6AJ 3JRBA 3OV8A 2ZBKA 1H89C 5J3LA 3U1KA 3LSGA 3ZR8X 2EZHA 4UV9A 2VBXA 2JQ7A 2DJIA 1WSUA 1B72B 2R7SA 1VI0A 3FX3A 4E4HA 2HQ5A 2IGNA 3L00A 2FF4A 5H2FC 4HF1A 2ZKZA 1P7IA 2RREA 1APLC 4EV0A 1IG7A 2HYJA 3OL4A 1QNTA 3FF5A 4J01A 2VB6A 4G6DA 1FPQA 3F8CA 5A2QK 3CTAA 5FD5A 5HNFA 1G8XA 3HC7A 1MNMC 5EEHA 1JGGA 2OJED 1DPUA 3OYBA 1B4AA 2GXGA 4UUTA 3V7RA 3X2QH 4ZYEA 3B6CA 2CGPA 1HA8A 1ORKA 1AA7A 4J00A 4II2A 3L2RA 1FP2A 2E1CA 1JHFA 1QZYA 1R5GA 1SD6A 5FJ8J 1FEXA 2KQRA 5FLXZ 2FOKA 2QKLB 3COAC 1FOKA 3S1QJ 2DMQA 2DA5A 1OCRH 2DI3A 2DQLA 2MW8A 4WXDA 4DBQA 5GAGJ 2HZTA 1K83J 2KHMA 3OYGA 2GA1A 1Y0UA 2L2OA 2ECBA 2KT0A 4I98B 2CFXA 4AIHA 2IBDA 1F1ZA 3PUFA 1F9NA 4BAYA 1TLHB 1YOVB 1Z3XA 4L9VA 3FXKA 3A2KA 4UUVA 2E5NA 2HR3A 2VE9A 1X4OA 2X51A 2WWYA 1MMSA 3I58A 4ZC3A 1MBHA 2UXXA 3GO5A 3Q9SA 4IHYA 4C2UA 3FM5A 5HLIA 3VEPA 1XN7A 3RYRA 2R3SA 2XC7A 4FTHA 4MLOA 3F9KA 3MZYA 3EQLF 1T95A 3F22A 3PO3J 3KLOA 2O7OA 2PMZN 3QP6A 3CMEI 3PO2J 3DKXA 3SEQA 3LSPA 2UZKA 1MH3A 4LG3A 4B44A 2JZYA 3BPVA 4DZJA 3CD6I 4UV8A 1FC3A 1KU7A 3Q0UA 1JKOC 2R7QA 5D8LB 4L0ZB 4HA8A 1UFMA 2EILH 4HV6A 1U2WA 2DT5A 4GCVA 3AG3H 5GAEJ 4X0GA 3ISPA 1EH7A 1R22A 4WWCA 5AIPA 4YFNF 2QZ8A 1VQKI 2OTJI 4OIQF 4HSTA 1G3SA 4XORA 4IPAA 4EJTA 1TP4A 2H1KA 1B9NA 4YIRX 4L5IA 1JUSA 2DFEA 3S32A 4KFCA 1IN7A 2MBFA 3M1CA 3BY6A 1FZPB 1T6SA 1HDPA 1OYWA 3S8PA 1SMYF 3KEQA 1WCMJ 4D7NA 3W3CA 2DA2A 5FKNA 2L54A 4QPQA 3UR3C 4RB2C 1HCRA 1AHDP 3K0LA 3A03A 2QLZA 4RGUA 4NHJA 4ZDPA 4MEYF 2L7MP 2LBFA 2W25A 1XPXA 2IA1A 1B6AA 4G9YA 1A6QA 3ZMTA 2L4AA 1E2XA 1Y8QB 3H35A 1WI3A 2CV1A 3TOBA 3ELKA 1FBSA 1F36A 4XSXF 2F5FA 2YPRA 4AM3A 1S5LC 2R7UA 2GQQA 3HG9A 1O3SA 1J0RA 4HX4A 4UVAA 3SZGA 4IHSA 4N0BA 3FK7A 4GYIA 2B63J 1YRNA 3R6SA 4G8XA 4CCOA 3TQNA 1GVJA 1UB9A 3GTMJ 3WTXC 1KU3A 1JKRC 3GTPJ 2OPTA 1UZCA 1ZH5A 3CUOA 3G1LA 3BDDA 1GV5A 4XLFA 4A3LJ 1XSDA 3CUQB 2ZMEB 2BY0A 4ANJA 1BJAA 4QLCU 1RI7A 5KK1A 1ZGWA 1R1VA 1GXQA 2RNJA 4UVCA 3RZOJ 1BN5A 4B43A 1OCZH 2GIZA 2ESHA 4BBSJ 2ZXHA 1B8IB 3BOQA 1O3TA 2LRDA 3A0BC 1OLTA 1VQ6I 2W1OA 2W57A 5F27A 4NQWA 4EMSA 4HLYA 3A0HC 2HKXA 4F52A 3I56I 4DIQA 3CJQB 5ILUA 3DTEA 3D0SA 3LSRA 1HW2A 3F6OA 1LB2A 5CPRB 3HRSA 3PL8A 4MO7A 1LKXA 1M1EB 2PG4A 4W97A 3A4CA 1W7PA 2M8EA 2WADA 1YE9A 2QQ8A 3KZYA 1ZK8A 1YFHA 2WV0A 2CU7A 1FTTA 1R5HA 2Y31A 2DA4A 2RC4A 2HNHA 2WB1N 4AUXA 4E7HA 2F5DA 5CLSA 4G7HF 1MSEC 5LHHA 5E3LA 2DOFA 4DW6A 3BROA 3AAFA 5E8GA 2CV0A 3PNTA 2XGCA 3I53A 4XN0A 1A35A 1WJEA 2GXBA 3JTHA 4BY7J 2MD5A 1USTA 3QYFA 2F5VA 3V4GA 2YUSA 5DD4A 2CYYA 2JWTA 2A6EF 3QPLA 3BG6A 1Y39A 1STZA 1J7KA 2GA2A 3M8JA 2XASA 1Z1DA 3HEFA 3QYEA 1X3ZB 3J81K 4I09A 1YJNI 1MIJA 1TBXA 4ETSA 2JSCA 2BW3B 5IYCJ 1IV8A 1A6IA 3SHFA 4O3MA 4DQ2A 2IXSA 4RAYA 5HDNA 3IL2A 3ERED 2VLAA 2OA4A 3JSPA 1ZREA 2RVCA 3ASOH 4BXFA 5E3MA 5A2QZ 1WJDA 3HB9A 1X1BA 3FM3A 3G6EI 3LQQA 3HHHA 3GTJJ 4XKVA 5E1XA 1W0UA 1I5ZA 4FX0A 2V1DA 4DYQA 5K1YA 3FXJA 1Z3YA 2K9QA 4U87A 1EF4A 4IX7A 4A3GJ 1R49A 1LUJB 2EIKH 3OR1C 3QU3A 4I76A 3HBLA 1I6HJ 4E7IA 2DPUA 3E1SA 2XAHA 3HSFA 3MZ8A 1QVUA 4XKBA 1SVLA 4S05A 2ZNZA 3DPLC 2UV1A 3S3OA 2JA7J 3K4KA 4P55A 2VOOA 2F4OB 5EG0A 3H3ZA 5FO5A 3V8KA 1S9HA 1X19A 2WTEA 4AVZA 4Y7NJ 3S3MA 1FYLA 1S8NA 3IKVA 4HNVA 3HYIA 3L2VA 2HVQA 2MD0A 2ISZA 2OV7A 3BG5A 4K2EA 3WTTC 3TO6A 2VASA 2I5UA 3MCZA 3CCRI 2VI6A 4NC6A 1V54H 5FFZA 1FY7A 2OCEA 3IKTA 3IH4A 1ON2A 1J75A 2HGCA 1K79A 3T1BA 1D5YA 3BR2A 3TP0A 5AIQA 3NAUA 2DA1A 3K9TA 2D5VA 2ELJA 3F8NA 2IGMA 5E17F 4X1EA 2X1DA 2H1LA 2R93J 2CUJA 1FBQA 2VT2A 2O8KA 3BQYA 1J09A 5LRSA 5LLQA 5H6QA 1IN8A 2PX9A 2KJCA 3RKYA 5M5XJ 1HXDA 3FXQA 4RM2A 5IT9K 4FHTA 2COMA 4XM3A 5GADJ 2VPLA 2KMUA 5DS9A 3J80K 2ZJPF 2OCCH 1Z21A 2DW4A 4M6VA 4GGGA 4UY8I 4NNJA 2HTJA 5FKKA 3MKWB 4IOAF 5LEJA 5HODA 2IS2A 2XF5A 4HG2A 1NG6A 2TRTA 5J1UA 2HEOA 1KA8A 5FKOA 2W24A 1AOYA 2W48A 2PMHA 2VJIA 3L2CA 1U9NA 2LF7A 1Y6IA 3K2ZA 3J7ZI 2DMTA 1N75A 4QIWN 4BUPA 4A0YA 3SYTA 2MFZA 1TQMA 2ID6A 2MH9A 2XAJA 3BG3A 3K1MA 2CW8A 5J40A 2CQKA 1S3JA 2EV5A 2LKSA 4FISA 4RLQA 1MH4A 4U7DA 2EZLA 2RQPA 2STWA 1IN4A 5HS9A 3GW2A 1XG1A 2GM4A 3EPZA 3GUDA 3CCMI 3I59A 2X1EA 4A3FJ 3GF2A 3QRFF 4LLNA 1J5YA 3E5QA 3KE2A 4IL6C 4HF2A 2LSOA 1ZKGA 2GZWA 5K5RA 2L9NA 3FIWA 2EFQA 2LR8A 1TC3C 2M3AA 5EJCA 1BIBA 2QUFA 2PBIA 3MQ0A 1UCRA 2VC0A 1R4MB 4XLHA 5EGOB 3OYEA 4Q48A 4M74A 4Y15A 2LH9A 3JRGA 2CW0F 1IUFA 1KONA 4O6JA 4OMZA 2K02A 2A3SA 2Y2ZA 2XSJC 4LG0B 3OMYA 1ZELA 4CCJA 3H36A 4CZCA 2L5QA 3QQAA 2RKHA 2HOAA 3GFJA 4XIDA 2HI3A 2HQRA 1DU0A 2KP6A 2BHYA 4XRFA 4BQQA 3C2GA 3K6GA 5B1BH 3OYHA 4U0WA 3CCVI 1O3QA 2R7XA 4XL9A 2WB1A 1IAWA 4LK0F 4RMNA 3WE3A 3S1MJ 4QPOA 2XKOA 1TWAJ 4L9TA 2O61A 2YU9J 5HLGA 1SFEA 4I6ZA 4XK4A 1W5CC 2WA0A 1HW5A 2NYXA 3E6MA 4S0HB 1VQ8I 3R0JA 3QOPA 1RETA 3KIOA 5LGUA 1MD0A 3CO7C 1QGPA 1OISA 2O03A 3WU1B 3MKLA 1HW1A 4E7LA 1RESA 1Z6TA 3W2VA 3Q9VA 4D7MA 4MTDA 4DGWB 4B3AA 2QSFX 2R7VA 3CMAI 3BP8A 4HPQA 2VBZA 3OL3A 3UKGA 5JR3A 1IRGA 2KIUA 3BZ6A 1WI9A 2L4MA 4JBAA 2X6YA 3CP8A 5CJ9A 4FE4A 2X6WA 3RPUD 2QCOA 3ZQGA 2PJRB 1XGOA 3I4MJ 3GFLA 3HOUJ 3I3LA 3ABKH 3G3ZA 1B72A 2L02A 2ZSIB 2F6CA 3O3KA 2Q2EB 4Z6YA 1YJ9I 1LPQA 2FQ3A 3QP5A 2FXAA 3HGGA 2GAUA 1P92A 4DJAA 4PK4A 5D5XB 2R7ZJ 4F91B 2AS5F 1HQCA 5FROA 1JGSA 4MIMA 2O8XA 2AHQA 2KDOA 5J8CA 1FYMA 2FA5A 2VC1A 4M72A 3WG7H 1R1UA 1U8RA 2WAEA 5EZHA 4KICA 1XCVA 1ZGJA 3J81Z 3OSFA 3RQ4A 3CDIA 2V6CA 4HLXA 4YG2F 5DDGA 4H0EA 5DD8A 3F8BA 3K10A 4Y13A 4FQGA 3S16J 3LAPA 1YW9A 3R60A 2DQRA 2ID3A 1X2NA 2V7FA 3CF2A 3EUHA 3M07A 3O2PE 1H8AC 2R7WA 2A6HF 5E3OA 4I01A 4HEA2 1YG2A 3OY9A 1SC7A 1OKRA 1KYWA 2ZJ2A 4CZZA 1TNSA 1IRXA 2LDUA 1K78A 3Q0VA 4XSZF 5ICEA 1U8BA 3CF5F 4CGZA 1YO5C 3V8LA 3OOUA 4IJAA 2CMPA 1T39A 1MBEA 1LVKA 3H9JA 3I71A 1MMNA 2ZNYA 4LK1F 4UNOA 3M8FA 2LVSA 2BZTA 3JRDA 2ISYA 2V1XA 2HZDA 5LD2C 2WC2A 4BE2A 5HVQC 3KLNA 2FOWA 2HDDA 4I7HA 1HSJA 4RA2A 4WXHA 1KU2A 3QODA 4BQOA 4BYYA 5J1RA 4R8HA 1FX7A 3I0TA 5HDGA 5C3EJ 5HS8A 3SZTA 3DU5A 2KRFA 1PUFB 3J7YJ 1KQ8A 3A01B 2OUMA 4KT5C 4CUGA 5DCFA 1H0MA 3DBRB 4BBRJ 2ME0A 4ITVA 3LA3A 4QWQA 2M34A 2W00A 3GZNB 5LHIA 2IPQX 4C9YA 3A02A 4BJTA 4ASNA 1T8IA 1W0TA 2DAOA 2IJLA 4HQMA 2E7WA 3BJ6A 1D1BA 3JRIA 1GT0C 4CSWA 2OC6A 3WGHA 1K61A 3H9QA 1Z67A 3CLQA 3SQNA 5IT9Z 3ZQIA 2BVLA 2R7TA 3FHNA 2H27A 3U21A 2Y48A 1RIOH 5J4YA 1SAXA 3J80Z 2WAFA 2P81A 3RJPA 1PP7U 1QRYA 1U6GA 5CVVA 4DYRA 3FXRA 3VB2A 2ACJA 2K9LA 3M7GA 3BTLA 1EKEA 2M2EA 3O6BB 3OS2A 4KIFA 3DBLB 2LD5A 4A6DA 1BI0A 4I02A 4GO1A 4KJZA 5E20A 5DUKA 3JR9A 2BY2A 2JT1A 4C2MJ 4ZZDA 1I3QJ 5HS7A 1FP1D 3FXOA 4B48A 4ABZA 4RB3C 5EDNA 2ZFWA 1SFXA 2H6BA 2AXLA 3KP7A 4M6YA 1YIJI 1T33A 1LFPA 5D4SA 2IGKA 5J47A 3FMRA 1SVMA 4OAZA 2WBMA 3AG2H 3TMOA 3M3YJ 3WU0A 4PGGA 2LF8A 3N05A 4GYGA 4E70A 4RBOA 4HW0A 2VUMJ 3DF8A 3CCUI 3FMSA 2OAZA 4BKXA 3JRFA 3H0DA 2EBIA 2XV4S 5K5QA 4BXUA 2V1NA 2P8TA 4HRIA 3ECHA 1HBXG 4BNCA 3GTOJ 4UB6C 2BGCA 2M30A 1FIPA 3VPRA 1OYYA 2BEOA 2KZGA 1I3AA 1BL0A 5DUIA 1E3HA 5DYMA 2CWEA 5IT3A 2G7HA 4UHTA 1RUNA 1FOWA 3OSGA 1GXPA 3K4JA 2IRFG 4B8XA 1JKQC 1SVOA 3CUQA 2ZMEA 1FWZA 2V79A 2V9PA 3QAHA 1OCTC 4YEJA 1ITYA 4KYWA 5DEQA 1ZG3A 4BJ5C 2OF7A 3BG9A 3L2QA 4LIVA 4XICA 4B09A 3CP2A 1B59A 1GDTA 3BR3A 2ICWG 2C6YA 5D8KB 3FXUA 4CYCB 3FISA 1RRJA 1AWCA 3BTCA 1D0XA 5E79C 4HZFA 1A36A 2A61A 1VQPI 2BXYA 2M7AA 3V7CA 4A12A 2O6GE 5BNGA 3HIFA 2J5OA 5DM7F 4LOCA 3BJOA 5M3MJ 3BC8A 3SZPA 4ZDLA 1W36D 3WTWC 3VOEA 3QWLA 1MMDA 4KA4A 4AWXB 3PFIA 1G59A 1W5SA 4EM0B 3F23A 1UHWA 2LC2A 4IOCF 1ETVA 1ZAOA 4OU0A 5F0HA 2ZJRF 4M71A 4CDGA 1XSVA 4RS8A 3JRAA 1U5TB 3ABLH 2EA2A 1CF7B 3W2AA 3GX4X 4J19A 3OOPA 3K4CA 5L3EA 3DWLE 4F3QA 5D5VB 4D1QA 2NVTJ 1G6NA 1DGWY 1SANA 4HNTA 1XD7A 5AONA 4N9IA 3VYUB 1O4XA 2VKVA 4FETA 3MKYB 3L2UA 4XLEA 4IHXA 2LY9A 5L3FA 3MAJA 1Q1HA 2VJ4A 4MTEA 1U5TC 3SDBA 1NK2P 2EV0A 3HGYA 3S2WA 1MBJA 1LVAA 2XPWA 3S2DJ 2LG4A 5LGTA 4N9HA 1W7PD 1FLIA 1BW5A 3PQJA 3MMYB 3KP6A 4GXOA 2BBYA 1ETKA 3E5UA 3EUAA 2IA0A 4CYDA 2R7OA 1LE8B 4XLAA 3EYIA 2E34A 2R7FA 4HDUA 1BM9A 4XRSG 5KAFC 4ESBA 3E97A 2HOSA 3JW4A 1IXSB 1IJWC 2NOJB 1UHSA 3BPXA 4OOIA 1BOAA 3VYSB 4C3JJ 1AKHB 2LTPA 4YELA 4M9SA 1D5VA 3HRTA 5GPCA 1OR7A 1LDDA 3T0YA 2R5YB 1W4MA 3KP4A 4HSRA 5LEKA 3PFYA 2M45A 2BXZA 2AQEA 2XKPA 4OIRF 2L0KA 2MLGA 2VBYA 2A5WA 2JRTA 5JHUA 2Y75A 2VXDA 3SJMA 2CQ7A 3ZCOA 3GTLJ 2DK8A 2K3PA 5M3FJ 3SXYA 4RB1A 3J7AO 2A69F 2FBIA 4P1WA 3WG9A 4U7BA 1TL8A 2VQLA 3W6KB 5IP9J 4BHPA 2F4IA 4GRIA 2XB5A 2XPUA 4V19K 3HRUA 4KNYA 2V26A 4ZYHA 3R4KA 3M1EA 1K7AA 2XAFA 4PCQA 2DT7B 2LY1A 3V42A 1I1GA 1FIAA 3DTIA 1HC8A 3RDIA 3S14J 3DEWA 3ZXSA 3G4SI 1LQ1A 2HKOA 1ZR4A 1ETQA 2JUCA 5ICGA 3LFUA 1BC8C 3MN2A 1REPC 1KU9A 2KPMA 3GFMA 4CCMA 1P9QC 5BOXA 2BOLA 2G0EA 4YRVA 1ONVA 1TNTA 2LLKA 4XKWA 4S04A 2VQCA 1NH3A 3E6DA 3DKWA 4EM1A 5DTDA 5KCMA 2DK5A 4D5CA 1TQIA 5K5OA 2M1BA 2Q1ZB 1WRJA 2CSOA 1R5ID 1ZLKA 1N25A 1IZ1A 1FOXA 5B3SH 5FD6A 1BR1A 2EB7A 3JCUC 1R36A 2L7FP 1MGTA 2F48A 1Z7LA 1BI3A 5DM6F 1O7FA 1N77A 4U88A 3OYLA 4A69C 3QYBA 1OPCA 3CMYA 2H8WA 1ETYA 1LFBA 3HM5A 1FSHA 3IC7A 5CQGA 1MMGA 3QOEA 5EEAA 2COBA 3KP5A 1U78A 2UWMA 2EV6A 1YJWI 1MBKA 2FMYA 1OCPA 2F2EA 3W6VA 1HSTA 4W1UA 1HKQA 2BY3A 4Z2YA 3GTGJ 3WHCA 3BWGA 4KN4X 5KNLA 4V2GA 2A5YB 4P9FA 3P9CA 4A0ZA 2B9SA 3PIPF 3O8GA 3GYHX 1Y8RB 2L9SA 3E5XA 1T0FA 1FMWA 2MG4A 2QBYA 2QQAA 1NK3P 1Y56A 4B47A 4QTRA 4XKCA 3PQKA 4BDZA 2QEXI 1XS9A 1XDUA 2E71A 1SMTA 2R5ZA 2O5RA 3EUKL 4ENMA 2DMNA 3OS1A 1K4SA 1P4AA 1ETOA 5DCMA 4Y33A 3U1DA 2JA6J 2IS1A 1SFUA 5F0CA 2KIMA 1NHAA 3ZMUA 2D2WA 2HYFA 4A3CJ 1I1SA 3ABUA 2W85A 4BHCA 3OR2C 2FD5A 3JRHA 1TW2A 1QZZA 2CRGA 2HOTA 3TKYA 2MC4A 2PLYA 1DP3A 3IH2A 1S29A 3AL0B 2V9VA 3L09A 3PNYA 1CQTA 2YX7A 4EJUA 1MKMA 4DOZA 3H3VK 5EF6A 1VQ5I 3F72A 1S6LA 2PJPA 1TWGJ 3HZJA 3OYAA 2EPFA 2RN7A 4UUSA 3HSRA 4M3BA 2P4WA 4XBFA 4BEHB 4XMYA 3CCLI 1H9TA 5KVRA 3PJRA 3ONQA 2R7DA 1FNNA 2M0CA 2VE8A 2R92J 2BV6A 3I54A 2CQNA 2Q8KA 4EGYA 2VL8A 3CMMA 2AQFA 5BPIA 1C0WA 2HVSA 1K6OA 4LFUA 4PFOA 3AL0C 2LOOA 3GCMA 3GFIA 2IA2A 4LB5A 1V5EA 1E3OC 2DOAA 2E1NA 4TV7A 2LBFB 1X1AA 1YIOA 2XAUA 2LNBA 4IVNA 3K70C 3HOVJ 3AFHA 1Z77A 2FEZA 2O0YA 1O3RA 3L7WA 2PJRA 5F0FA 2E1MB 1WPKA 4A3EJ 3BCBA 3VDXA 4F92B 4JP0A 4YIFA 1Y0NA 4XRSA 2JMWA 6PAXA 2M0MA 2IP2A 3HHGA 3KFWX 3L2WA 1WVRA 2K85A 3HSEA 1K6YA 1Y1WJ 1MDMA 1YRNB 1KZHA 1WKMA 2WY8Q 2ZB9A 4R1HA 1PVEA 2FUG2 1YW7A 1HKTA 3ZN0A 3P9IA 4NB5A 1UHMA 3HUGA 2ESNA 3HTSB 2HTSA 1OQYA 4MFEA 3FWEA 4MEXF 2MSYA 4A3DJ 1X2MA 3K4BA 4BXXJ 4F93B 3SEZA 1PDNC 2E1MC 4IHVA 2CUFA 2K40A 3S17J 2LFBA 2X0LA 1UELB 3CCQI 2VKEA 4XLCA 4LB6B 2K27A 1UG2A 2HPIA 3TBIA 1R9TJ 3TDZC 2E35A 5E18F 1W36C 4PSXA 3KYLA 5ILSA 3K69A 2QM3A 3G1MA 2R4GA 3CC7I 1JI8A 3PSIA 3T8TA 3JTGA 1TWHJ 5BQTA 3WTUC 4NQWB 4WCGA 4XR6A 2Y9ZA 2CUEA 2OU2A 1IXRC 1Y1VJ 4HAMA 4D5FA 2Q0OA 2FJ1A 2V4JC 3ZMVA 4L5EA 2ADUA 2QYOA 3LOCA 4Y4RA 3KZIC 3WGIA 3ZPLA 4JQFA 1W7PB 3V8JA 3GLXA 3ZQLA 2VKDA 3ZMZA 5F1RA 3S3NA 2VXZA 1O57A 4A3KJ 2X85A 1JUPA 1WHUA 4HNUA 1V5FA 1WJBA 5D6FA 2ZC2A 4CICA 1YTYA 2E2JJ 2P6SA 3AG1H 5ICFA 3CC4I 2XGEA 3G73A 2W82A 1TWFJ 4OAYA 4ESFA 5HDKA 3ZMSA 4XOTA 2JVHA 4MNUA 2D45A 4OINF 3H1CA 4A2UA 1ERDA 2LYCA 1JHHA 1WWXA 3FKJA 1XSXA 1A5JA 1ZYRF 2EA4A 1ZG5A 1FYKA 3IH3A 4XLNF 3KP2A 3NEUA 2EFWA 2M7BA 2O3FA 5BMZA 4GDFA 1D3YA 2Z2SB 2MC3A 5D6EA 1Z91A 3TDUC 1XMKA 2L9RA 2OZ6A 5GTIC 4ZH4F 1VQOI 4IKFA 2L7KA 4M9ZA 2IVMA 3CCEI 3MFKA 2BE5F 4I2OA 1WH5A 3KPHA 2XGDA 4ZTFA 2HXOA 2V1UA 3OYFA 2F5CA 2P5KA 4CHUA 4AU7A 1R23A 1XGNA 4IXAA 5B5EC 5JVTA 4KMUX 3W6JB 2JA2A 4KMFA 1TT5B 2DN0A 3JREA 1LNWA 2JTVA 2HOEA 3CLOA 2L3DA 1S7EA 1D8KA 3NRVA 4Y52J 3F8FA 3KCCA 2XSDC 2DBBA 5EG0B 3P5JA 3U2RA 2X9DA 4ZZLA 1OCOH 1LDJA 1DDNA 4RLFA 3L1PA 2OTLI 2GXAA 3HOSA 4FT8A 1MJAA 3GTQJ 2DJNA 3ESWB 4OWRB 2W7NA 4BJ6C 1G4DA 1DPRA 1BIAA 4IO9F 2JK3A 1E3PA 1TZLA 1G3YA 4MGRA 1YS7A 1SFKA 4A3JJ 2GBYA 2HVRA 3EDPA 1A04A 1IC8A 2FSWA 4I0AA 2PN6A 3S2HJ 2BVMA 2XAQA 4KDPA 2XHKA 2DMUA 3RKWA 5IYDJ 1SD4A 1MNEA 3CESA 2NVYJ 3OWTA 4EQQA 3NWTA 5EEGA 2Z99A 2MGQA 2QQ9A 1ACIA 1F4KA 4LLLA 3LNQA 4ZTJA 1P4XA 3CZ6A 3ZMDA 3ZN1A 3I9V2 1V55H 3K7AJ 4MFDA 1Q1VA 1S72I 2FE3A 2EZIA 3FXMA 3QPHA 1FMVA 2QKMB 5IP6A 4BHBA 4WX9A 2DO7A 2DFIA 1LEBA 1T38A 3AG4H 4EJVA 2KDZA 2IS4A 1QU3A 1F43A 3FZVA 4P5OA 1Z05A 3BQZA 1P2FA 4M73A 1RUOA 2ME6A 4P96A 2M87A 2JPBA 2KIQA 4R79A 3MKZA 1IN6A 1EH8A 1QQIA 2DMPA 4E7SA 2GWRA 4E7ZA 4MQVA 2GIVA 3LSMA 4KISA 4XOPA 3G2BA 3HOXJ 3HOYJ 1RPWA 4L0YB 4PDKA 1U0JA 5D5WB 2Z1DA 4AD9A 2LKPA 2A68F 4EVIA 2HQAA 1SD7A 2MYSA 4F55A 4JK1X 4E7KA 3OIQA 3R0AA 1G3TA 3W2WA 3GMEA 3T8RA 3TW6A 5LBQA 3HRMA 4FX4A 3LQRA
chains in the Genus database with same CATH topology
3RQIA 2EZKA 2R5ZB 1H88C 5IYCJ 1NK2P 1A6IA 3HGYA 1MBJA 1IDZA 1VFCA 5IPAA 1ZTRA 5E3MA 2XPWA 3S2DJ 3HB9A 1HDDC 3SFIA 1AU7A 1BW5A 1Z0XA 3SDGA 1BW6A 3GTJJ 1ETKA 2VPRA 1W0UA 2CQQA 4DYQA 4A3MJ 1LE8B 1EF4A 1JT6A 2K9QA 5IOYA 4XRSG 5K7HA 2IEKA 4A3GJ 2HOSA 5C4JJ 1JTXA 1IJWC 1UHSA 4M3GA 5C44J 4C3JJ 4I76A 2LP0A 2LTPA 3HBLA 1AKHB 1I6HJ 4FE7A 4IHWA 5JLWA 1JKPC 5GPCA 1QVUA 4M3FA 2R5YB 4UUSB 2WAQN 4C3IJ 3TP3A 2JA7J 4JX5A 2L0KA 1VNDA 3G1OA 5EG0A 2RAEA 4Y7NJ 5F1JA 2L7ZA 4HNVA 3SJMA 2XB0X 5K7ZA 4RDUA 3BG5A 5EZGA 3GTLJ 5M3FJ 3CQZJ 1MBGA 5IP9J 2VI6A 3BR6A 1JJ8C 2E2IJ 2XB5A 1JUMA 2XPUA 3IH4A 2XPVA 2DA7A 1D5YA 3BR2A 3TP0A 3NAUA 2DA1A 2D5VA 3H0GJ 1OFCX 1WH7A 2CJJA 1FIAA 1ETWA 3E7LA 4X1EA 2R93J 1BJZA 1JTYA 3DEWA 3S14J 1JT0A 2O8KA 3BQYA 5F08A 2K9NA 2NS7A 1ZR4A 3QPSA 1ETQA 1IV6A 4V2FA 5M5XJ 2GLOA 4BY1J 3MN2A 2O9LA 1GUUA 2G0EA 1B8IA 5DS9A 3WHBA 2LLKA 4M6VA 4AC0A 4CYCA 1HLVA 1HOMA 1MSFC 5DTDA 1WGXA 1SFOJ 4D5CA 5FKKA 2TCTA 5IOZA 1MBFA 5HODA 5J1UA 2TRTA 1LFUP 1RKTA 2IAIA 5FKOA 2W48A 3MVPA 2AO9A 4XRMA 1U9NA 2L7FP 2NOGA 4DYCA 2ELKA 1HF0A 4A69C 2DMTA 4QIWN 2JA5J 5M5WJ 3CMYA 2M9HA 2ID6A 1ETYA 1LFBA 3HM5A 3BG3A 1FJLA 1IRZA 4FISA 5EEAA 4IEJA 1MH4A 2N8GA 2COBA 2EZLA 3RKQA 1FTZA 1ENHA 1U78A 1MBKA 1XG1A 1OCPA 3C2BA 2GM4A 4B4CA 4A3FJ 3W6VA 4W1UA 3GTGJ 3WHCA 4V2GA 1ZKGA 5GP9A 3O8GA 3CDLA 3FIWA 4A3BJ 2LR8A 1TC3C 2EH3A 2MG4A 5IYBJ 1NK3P 3JRCA 4QTRA 1XS9A 2Y30A 5EGOB 2R5ZA 3JRGA 3K2AA 1IUFA 3OIOA 2DMNA 5EYRA 1GV2A 1ETOA 3ZQHA 2JA6J 3LSJA 3ZQFA 2Y2ZA 5F0CA 1U9OA 2E1OA 3O8HA 4A3CJ 2HXIA 3Q0WA 9ANTA 3BR0A 3QQAA 4XIDA 2HOAA 4FCYA 2EQRA 1GVDA 2FD5A 2HI3A 3NARA 2CRGA 4M3DA 3JRHA 1DU0A 2HOTA 1LE8A 3D1NI 3BTJA 1T56A 2LKXA 2X48A 3IH2A 1XC5A 1UMQA 3S1MJ 1CQTA 4AYBN 1TWAJ 4DZPA 1AKHA 2I10A 2YU9J 4I6ZA 3H3VK 2JN6A 5EF6A 2H8RA 4GFBA 1TWGJ 2R0QC 2E2HJ 2R5YA 4UUSA 4XK4A 2DTZA 3BR5A 3PM1A 4M3BA 4S0HB 3TW7A 2NVXJ 3S1NJ 1RETA 2M0CA 2R92J 4A3IJ 1VF9A 3HOZJ 5C4XJ 3MKLA 3B6AA 1RESA 4D7MA 4B3AA 2CQXA 1E3OC 3UKGA 1QPIA 3HOWJ 1OJLA 5J1YA 4FE4A 3HOVJ 2QCOA 1Z77A 3ZQGA 3JRBA 4X6AJ 5F0FA 1H89C 5J3LA 3I4MJ 2LK2A 3LSGA 1WPKA 3HOUJ 2EZHA 4A3EJ 5FKMA 1B72A 4JP0A 1B72B 1VI0A 4XRSA 2JMWA 1X58A 2K9SA 3HGGA 2HQ5A 2R7ZJ 1P7IA 5FKLA 1Y1WJ 3HDDA 4MIMA 1APLC 2AHQA 1IG7A 4JX6A 1YRNB 2HYJA 2ZB9A 2Y0SN 5EZHA 4MFEA 4A3DJ 1MNMC 2MSYA 3OSFA 1X2MA 4BXXJ 1JGGA 5E3NA 4IHVA 4UUTA 2CUFA 2K40A 3B6CA 3S17J 1ORKA 4B1RA 2LFBA 1RR7A 2ECCA 3S16J 2VKEA 1UG2A 2ID3A 5FJ8J 1R9TJ 2M8GX 1FEXA 1X2NA 1H8AC 2WV1A 3S1QJ 2DMQA 2DA5A 5E3OA 2MW8A 3HKZN 3G1MA 1K83J 3M4OJ 2DA3A 3Q0VA 1TWHJ 1U8BA 2ECBA 2KT0A 3OOUA 2IBDA 1MBEA 2Y9ZA 2CUEA 1Y1VJ 4D5FA 1ETXA 2FJ1A 2LVSA 3S1RJ 1IDYA 3JRDA 4L5EA 1G2HA 3LOCA 1MBHA 4IHYA 2HDDA 3ZQLA 2E19A 5J1RA 5C3EJ 4A3KJ 4FTHA 4MLOA 1JUPA 2E2JJ 1PUFB 3PO3J 1DU6A 2O7OA 2PMZN 3A01B 3PO2J 2XRLA 5EGOA 2NVQJ 3LSPA 1MH3A 2XGEA 4BBRJ 1TWFJ 2ME0A 2NS8A 2M34A 4DZJA 3Q0UA 1JKOC 3A02A 5FLVA 2Y9YA 1W0TA 1JJ6C 5IP7J 3JRIA 1A5JA 3IH3A 1GT0C 1RKWA 1K61A 3GTKJ 2QF7A 3ZQIA 2H1KA 1I50J 1JUSA 4G12A 2L9RA 4NDLA 2P81A 3ZOBA 1QRYA 4DYRA 1HDPA 3BTLA 1WH5A 2M2EA 2XGDA 2HXOA 1WCMJ 4D7NA 4C3HJ 4QSHA 2DA2A 5FKNA 2LD5A 1HCRA 3I4NJ 1AHDP 3A03A 3JR9A 2DN0A 4C2MJ 1I3QJ 3JREA 1BA5A 2FX0A 1ZR2A 2DA6A 2L7MP 4ABZA 1S7EA 3GBGA 2YS9A 5EDNA 1T33A 1TWCJ 1WI3A 4Y52J 3CCYA 1F36A 2XSDC 3DCFA 5EG0B 3TEDA 3M3YJ 2X9DA 2JJ7A 4RBOA 2VUMJ 4BKXA 3L1PA 3JRFA 2EBIA 3GTOJ 3FK7A 5JLXA 2B63J 3GTQJ 1YRNA 1FIPA 1QVTA 3VPRA 2DJNA 1P7JA 1BL0A 1POGA 3GTMJ 1JKRC 3GTPJ 2JK3A 3OSGA 2OPTA 3G1LA 4A3JJ 2GBYA 1GV5A 1JKQC 4A3LJ 1IGNA 1IC8A 3S2HJ 1OCTC 1ZGWA 1ITYA 2DMUA 2X6OA 3ZQCA 5IYDJ 3RZOJ 2NVYJ 2OF7A 1NTCA 3BG9A 4XICA 4BBSJ 2MGQA 1B8IB 1GDTA 3BR3A 5F27A 3FISA 4CYCB 3LNQA 3BTCA 2JA8J 3FKIJ 5BNGA 3K7AJ 4MFDA 1Q1VA 2EZIA 4LOCA 5M3MJ 3LSRA 3F0CA 5IP6A 4MO7A 4W97A 3RZDJ 3BTIA 2KDZA 1F43A 3IV5A 3BQZA 1ZK8A 5FLMJ 1ETVA 2ME6A 1ZQ3P 2CU7A 1FTTA 5F0HA 5K7FA 2WB1N 2DA4A 2Y31A 3BT9A 4AUXA 2DMPA 3Q3SA 4JYKA 1PUFA 3A01A 4M3EA 3S15J 1MSEC 3HOXJ 5E3LA 3HOYJ 4DW6A 1RPWA 3JRAA 4EEFG 4J19A 3FK6A 2XGCA 5M5YJ 3BR1A 2NVTJ 1SANA 4BY7J 5GPAA 2YUSA 2JWTA 4JX4A 3QPLA 2FQ4A 1O4XA 2VKVA 3TW6A 4IHXA 3HEFA 2LY9A 4A93J 5F04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQI A;  2EZK A;  2R5Z B;  1H88 C;  5IYC J;  1NK2 P;  1A6I A;  3HGY A;  1MBJ A;  1IDZ A;  1VFC A;  5IPA A;  1ZTR A;  5E3M A;  2XPW A;  3S2D J;  3HB9 A;  1HDD C;  3SFI A;  1AU7 A;  1BW5 A;  1Z0X A;  3SDG A;  1BW6 A;  3GTJ J;  1ETK A;  2VPR A;  1W0U A;  2CQQ A;  4DYQ A;  4A3M J;  1LE8 B;  1EF4 A;  1JT6 A;  2K9Q A;  5IOY A;  4XRS G;  5K7H A;  2IEK A;  4A3G J;  2HOS A;  5C4J J;  1JTX A;  1IJW C;  1UHS A;  4M3G A;  5C44 J;  4C3J J;  4I76 A;  2LP0 A;  2LTP A;  3HBL A;  1AKH B;  1I6H J;  4FE7 A;  4IHW A;  5JLW A;  1JKP C;  5GPC A;  1QVU A;  4M3F A;  2R5Y B;  4UUS B;  2WAQ N;  4C3I J;  3TP3 A;  2JA7 J;  4JX5 A;  2L0K A;  1VND A;  3G1O A;  5EG0 A;  2RAE A;  4Y7N J;  5F1J A;  2L7Z A;  4HNV A;  3SJM A;  2XB0 X;  5K7Z A;  4RDU A;  3BG5 A;  5EZG A;  3GTL J;  5M3F J;  3CQZ J;  1MBG A;  5IP9 J;  2VI6 A;  3BR6 A;  1JJ8 C;  2E2I J;  2XB5 A;  1JUM A;  2XPU A;  3IH4 A;  2XPV A;  2DA7 A;  1D5Y A;  3BR2 A;  3TP0 A;  3NAU A;  2DA1 A;  2D5V A;  3H0G J;  1OFC X;  1WH7 A;  2CJJ A;  1FIA A;  1ETW A;  3E7L A;  4X1E A;  2R93 J;  1BJZ A;  1JTY A;  3DEW A;  3S14 J;  1JT0 A;  2O8K A;  3BQY A;  5F08 A;  2K9N A;  2NS7 A;  1ZR4 A;  3QPS A;  1ETQ A;  1IV6 A;  4V2F A;  5M5X J;  2GLO A;  4BY1 J;  3MN2 A;  2O9L A;  1GUU A;  2G0E A;  1B8I A;  5DS9 A;  3WHB A;  2LLK A;  4M6V A;  4AC0 A;  4CYC A;  1HLV A;  1HOM A;  1MSF C;  5DTD A;  1WGX A;  1SFO J;  4D5C A;  5FKK A;  2TCT A;  5IOZ A;  1MBF A;  5HOD A;  5J1U A;  2TRT A;  1LFU P;  1RKT A;  2IAI A;  5FKO A;  2W48 A;  3MVP A;  2AO9 A;  4XRM A;  1U9N A;  2L7F P;  2NOG A;  4DYC A;  2ELK A;  1HF0 A;  4A69 C;  2DMT A;  4QIW N;  2JA5 J;  5M5W J;  3CMY A;  2M9H A;  2ID6 A;  1ETY A;  1LFB A;  3HM5 A;  3BG3 A;  1FJL A;  1IRZ A;  4FIS A;  5EEA A;  4IEJ A;  1MH4 A;  2N8G A;  2COB A;  2EZL A;  3RKQ A;  1FTZ A;  1ENH A;  1U78 A;  1MBK A;  1XG1 A;  1OCP A;  3C2B A;  2GM4 A;  4B4C A;  4A3F J;  3W6V A;  4W1U A;  3GTG J;  3WHC A;  4V2G A;  1ZKG A;  5GP9 A;  3O8G A;  3CDL A;  3FIW A;  4A3B J;  2LR8 A;  1TC3 C;  2EH3 A;  2MG4 A;  5IYB J;  1NK3 P;  3JRC A;  4QTR A;  1XS9 A;  2Y30 A;  5EGO B;  2R5Z A;  3JRG A;  3K2A A;  1IUF A;  3OIO A;  2DMN A;  5EYR A;  1GV2 A;  1ETO A;  3ZQH A;  2JA6 J;  3LSJ A;  3ZQF A;  2Y2Z A;  5F0C A;  1U9O A;  2E1O A;  3O8H A;  4A3C J;  2HXI A;  3Q0W A;  9ANT A;  3BR0 A;  3QQA A;  4XID A;  2HOA A;  4FCY A;  2EQR A;  1GVD A;  2FD5 A;  2HI3 A;  3NAR A;  2CRG A;  4M3D A;  3JRH A;  1DU0 A;  2HOT A;  1LE8 A;  3D1N I;  3BTJ A;  1T56 A;  2LKX A;  2X48 A;  3IH2 A;  1XC5 A;  1UMQ A;  3S1M J;  1CQT A;  4AYB N;  1TWA J;  4DZP A;  1AKH A;  2I10 A;  2YU9 J;  4I6Z A;  3H3V K;  2JN6 A;  5EF6 A;  2H8R A;  4GFB A;  1TWG J;  2R0Q C;  2E2H J;  2R5Y A;  4UUS A;  4XK4 A;  2DTZ A;  3BR5 A;  3PM1 A;  4M3B A;  4S0H B;  3TW7 A;  2NVX J;  3S1N J;  1RET A;  2M0C A;  2R92 J;  4A3I J;  1VF9 A;  3HOZ J;  5C4X J;  3MKL A;  3B6A A;  1RES A;  4D7M A;  4B3A A;  2CQX A;  1E3O C;  3UKG A;  1QPI A;  3HOW J;  1OJL A;  5J1Y A;  4FE4 A;  3HOV J;  2QCO A;  1Z77 A;  3ZQG A;  3JRB A;  4X6A J;  5F0F A;  1H89 C;  5J3L A;  3I4M J;  2LK2 A;  3LSG A;  1WPK A;  3HOU J;  2EZH A;  4A3E J;  5FKM A;  1B72 A;  4JP0 A;  1B72 B;  1VI0 A;  4XRS A;  2JMW A;  1X58 A;  2K9S A;  3HGG A;  2HQ5 A;  2R7Z J;  1P7I A;  5FKL A;  1Y1W J;  3HDD A;  4MIM A;  1APL C;  2AHQ A;  1IG7 A;  4JX6 A;  1YRN B;  2HYJ A;  2ZB9 A;  2Y0S N;  5EZH A;  4MFE A;  4A3D J;  1MNM C;  2MSY A;  3OSF A;  1X2M A;  4BXX J;  1JGG A;  5E3N A;  4IHV A;  4UUT A;  2CUF A;  2K40 A;  3B6C A;  3S17 J;  1ORK A;  4B1R A;  2LFB A;  1RR7 A;  2ECC A;  3S16 J;  2VKE A;  1UG2 A;  2ID3 A;  5FJ8 J;  1R9T J;  2M8G X;  1FEX A;  1X2N A;  1H8A C;  2WV1 A;  3S1Q J;  2DMQ A;  2DA5 A;  5E3O A;  2MW8 A;  3HKZ N;  3G1M A;  1K83 J;  3M4O J;  2DA3 A;  3Q0V A;  1TWH J;  1U8B A;  2ECB A;  2KT0 A;  3OOU A;  2IBD A;  1MBE A;  2Y9Z A;  2CUE A;  1Y1V J;  4D5F A;  1ETX A;  2FJ1 A;  2LVS A;  3S1R J;  1IDY A;  3JRD A;  4L5E A;  1G2H A;  3LOC A;  1MBH A;  4IHY A;  2HDD A;  3ZQL A;  2E19 A;  5J1R A;  5C3E J;  4A3K J;  4FTH A;  4MLO A;  1JUP A;  2E2J J;  1PUF B;  3PO3 J;  1DU6 A;  2O7O A;  2PMZ N;  3A01 B;  3PO2 J;  2XRL A;  5EGO A;  2NVQ J;  3LSP A;  1MH3 A;  2XGE A;  4BBR J;  1TWF J;  2ME0 A;  2NS8 A;  2M34 A;  4DZJ A;  3Q0U A;  1JKO C;  3A02 A;  5FLV A;  2Y9Y A;  1W0T A;  1JJ6 C;  5IP7 J;  3JRI A;  1A5J A;  3IH3 A;  1GT0 C;  1RKW A;  1K61 A;  3GTK J;  2QF7 A;  3ZQI A;  2H1K A;  1I50 J;  1JUS A;  4G12 A;  2L9R A;  4NDL A;  2P81 A;  3ZOB A;  1QRY A;  4DYR A;  1HDP A;  3BTL A;  1WH5 A;  2M2E A;  2XGD A;  2HXO A;  1WCM J;  4D7N A;  4C3H J;  4QSH A;  2DA2 A;  5FKN A;  2LD5 A;  1HCR A;  3I4N J;  1AHD P;  3A03 A;  3JR9 A;  2DN0 A;  4C2M J;  1I3Q J;  3JRE A;  1BA5 A;  2FX0 A;  1ZR2 A;  2DA6 A;  2L7M P;  4ABZ A;  1S7E A;  3GBG A;  2YS9 A;  5EDN A;  1T33 A;  1TWC J;  1WI3 A;  4Y52 J;  3CCY A;  1F36 A;  2XSD C;  3DCF A;  5EG0 B;  3TED A;  3M3Y J;  2X9D A;  2JJ7 A;  4RBO A;  2VUM J;  4BKX A;  3L1P A;  3JRF A;  2EBI A;  3GTO J;  3FK7 A;  5JLX A;  2B63 J;  3GTQ J;  1YRN A;  1FIP A;  1QVT A;  3VPR A;  2DJN A;  1P7J A;  1BL0 A;  1POG A;  3GTM J;  1JKR C;  3GTP J;  2JK3 A;  3OSG A;  2OPT A;  3G1L A;  4A3J J;  2GBY A;  1GV5 A;  1JKQ C;  4A3L J;  1IGN A;  1IC8 A;  3S2H J;  1OCT C;  1ZGW A;  1ITY A;  2DMU A;  2X6O A;  3ZQC A;  5IYD J;  3RZO J;  2NVY J;  2OF7 A;  1NTC A;  3BG9 A;  4XIC A;  4BBS J;  2MGQ A;  1B8I B;  1GDT A;  3BR3 A;  5F27 A;  3FIS A;  4CYC B;  3LNQ A;  3BTC A;  2JA8 J;  3FKI J;  5BNG A;  3K7A J;  4MFD A;  1Q1V A;  2EZI A;  4LOC A;  5M3M J;  3LSR A;  3F0C A;  5IP6 A;  4MO7 A;  4W97 A;  3RZD J;  3BTI A;  2KDZ A;  1F43 A;  3IV5 A;  3BQZ A;  1ZK8 A;  5FLM J;  1ETV A;  2ME6 A;  1ZQ3 P;  2CU7 A;  1FTT A;  5F0H A;  5K7F A;  2WB1 N;  2DA4 A;  2Y31 A;  3BT9 A;  4AUX A;  2DMP A;  3Q3S A;  4JYK A;  1PUF A;  3A01 A;  4M3E A;  3S15 J;  1MSE C;  3HOX J;  5E3L A;  3HOY J;  4DW6 A;  1RPW A;  3JRA A;  4EEF G;  4J19 A;  3FK6 A;  2XGC A;  5M5Y J;  3BR1 A;  2NVT J;  1SAN A;  4BY7 J;  5GPA A;  2YUS A;  2JWT A;  4JX4 A;  3QPL A;  2FQ4 A;  1O4X A;  2VKV A;  3TW6 A;  4IHX A;  3HEF A;  2LY9 A;  4A93 J;  5F04 A; 
#chains in the Genus database with same CATH topology
 4PUS A;  5TJJ A;  2EZK A;  2K4B A;  3IAS 2;  3E6B A;  1IDZ A;  3C18 A;  1WQ2 A;  1A31 A;  3SFI A;  1AU7 A;  3RPU A;  4WF2 A;  1Z0X A;  3HTU A;  1RNL A;  2K86 A;  3SDG A;  2D1H A;  2VPR A;  4E6K G;  2AXT C;  1D0Z A;  2CQQ A;  1JT6 A;  5KAI C;  2KL4 A;  3K4M A;  2IEK A;  4L18 B;  2JPC A;  3LA2 A;  2EK5 A;  5C4J J;  2EJR A;  2L01 A;  4M3G A;  3RIR A;  3SFZ A;  2LP0 A;  3KZZ A;  1YX3 A;  4IHW A;  1J9I A;  4ESJ A;  2HDW A;  5ILV A;  2XDV A;  4Q4Z F;  1YW8 A;  1IUY A;  1WFX A;  1ZN2 A;  2WAQ N;  4C3I J;  3TP3 A;  1YLF A;  2NS0 A;  3H92 A;  2JUG A;  2E36 A;  1VND A;  3ABM H;  3KEY A;  2X1C A;  4Q47 A;  4KIT B;  1G3W A;  4RDU A;  2QA4 I;  4NUB A;  5ERI A;  3F8M A;  5EZG A;  3WTV C;  2HYG D;  4A0X A;  5HOO A;  1PYV A;  3P9K A;  4ON0 A;  3HPH A;  2F5E A;  4ZYA A;  3V7S A;  1Z6R A;  1JJ8 C;  2E2I J;  1JUM A;  3I64 A;  2VOD A;  3VYR B;  3K70 D;  2XPV A;  2DA7 A;  4PJN A;  2HU9 A;  2KZV A;  2B0L A;  2QGU A;  3H0G J;  2FNA A;  1OFC X;  1WH7 A;  3GVA A;  1ETW A;  1BJZ A;  4G7O F;  5F08 A;  2IS6 A;  2K9N A;  2NS7 A;  3UNG C;  4DBR A;  5LRR A;  1IV6 A;  2Z9O A;  4V2F A;  1IF1 A;  2GLO A;  3WTZ A;  2ZXW H;  4AVP A;  1VQ7 I;  2O9L A;  2QQB A;  3CJT B;  1GUU A;  1GHC A;  3BZK A;  1B8I A;  3WHB A;  1ZAR A;  2YR2 A;  2Y69 H;  3H5A A;  4PJL A;  4AC0 A;  1HOM A;  1MSF C;  1E17 A;  1TTY A;  2OBP A;  4BL0 B;  1WGX A;  2LMD A;  4ENK A;  2B7E A;  3I5U A;  2TCT A;  1OMI A;  2JRM A;  1LFU P;  1RKT A;  2IAI A;  4B3X A;  2DU9 A;  3MVP A;  1XGM A;  4XRM A;  4KIG A;  1TT0 A;  1YIT I;  3DV8 A;  4DYC A;  1BR2 A;  2ELK A;  3GLL A;  2QSH X;  1HF0 A;  3K4L A;  4G94 A;  2KLO A;  2M9H A;  1T2K A;  3VFZ A;  3GXO A;  1K78 B;  4A5M A;  1XCB A;  2N8G A;  3QPT A;  4D9J A;  2K3F A;  1WJF A;  3WOD F;  3HOT A;  5GAH J;  3IWF A;  1MND A;  3C2B A;  2JVG A;  4D0P A;  1PUE E;  4BGD A;  3EUH C;  2XVC A;  5GP9 A;  4YII A;  2K5C A;  5F6F A;  3CJN A;  2GOX B;  3JSO A;  4ZJZ A;  3I4P A;  4EAT A;  2Z33 A;  1BOB A;  5IYB J;  4AIK A;  2D1V A;  2UXN A;  4BDY A;  3Q5F A;  4U0V A;  2FBH A;  1P4W A;  5BPD A;  2OQG A;  1RR8 C;  5CQE A;  2BW3 A;  4M6X A;  2P0W A;  5EYR A;  3D5L A;  3WU2 C;  2BY1 A;  2EFN A;  4MQ9 F;  3WGG A;  3ZQH A;  2CS3 A;  3C3W A;  3U9G A;  1I39 A;  3ZQF A;  3DTK A;  1VTN C;  1F5T A;  2E1O A;  1SAU A;  3Q0W A;  1X4P A;  3BR0 A;  4FCY A;  1GVD A;  2A05 A;  1MMA A;  4M3D A;  1BI2 A;  3C1D A;  4HX7 A;  2J5P A;  3GEZ A;  5H6R A;  2DYS H;  3TO7 A;  2ZJQ F;  2LKX A;  3LMM A;  1D8J A;  4C2T A;  1UMQ A;  4LJZ F;  4AYB N;  4DZP A;  1B9M A;  4EM2 A;  4BQN A;  5LFA A;  1KQ0 A;  2M4G A;  2JN6 A;  2UUZ A;  3DLA A;  1SD5 A;  1P6R A;  2V9K A;  1D1A A;  2KRH A;  4EGZ A;  2DFH A;  4BEH A;  1FOY A;  5TGT A;  4XLP F;  2QWW A;  1V3F A;  3N4M A;  2NVX J;  5FRN A;  3PIO F;  2KKO A;  1VF9 A;  1J59 A;  4HV5 A;  4N4O B;  3HOZ J;  3NQO A;  1EH6 A;  3RKX A;  5C4X J;  3B6A A;  3D5S C;  3M8E A;  4RAG A;  5TRD A;  2CQX A;  3C2H A;  2HDC A;  4C30 A;  1IRF A;  2X6X A;  5E1Z B;  2EIJ H;  3ULQ B;  3PNV A;  3GZ6 A;  5JHF A;  5J1Y A;  4KUM A;  4OMY A;  1LEA A;  2DLL A;  3WE2 A;  2LK2 A;  5FKM A;  2LY2 A;  5BS6 A;  2GOM A;  1X58 A;  4RGS A;  1KQ9 A;  2K9S A;  4IRH A;  3BLY A;  5FKL A;  3HDD A;  3FBI B;  4XNF A;  3ROU A;  2H09 A;  4JX6 A;  4Q5S F;  3ERM A;  2Y0S N;  2BYV E;  2FNP A;  1YHQ I;  3TL4 X;  4U0Y A;  3DEE A;  2VQH A;  2WAQ A;  3T5X A;  5E3N A;  4CA0 A;  4WK8 F;  5L3C A;  4B1R A;  1IW7 F;  4KT6 A;  1RR7 A;  2ECC A;  4AID A;  3WTS C;  2FBK A;  1R1T A;  2M8G X;  1ON1 A;  2WV1 A;  2RNG A;  1TQP A;  5L3B A;  3HKZ N;  1O7L A;  3TO9 A;  3M4O J;  1ZGA A;  1D0Y A;  2DA3 A;  3LAJ A;  3K4N A;  2ZXJ A;  2OD5 A;  3DBH B;  5CVU A;  1X1C A;  3FBN B;  4XON A;  1YQA A;  3CUQ C;  5J4V A;  2ZME C;  1ETX A;  4HX8 A;  5ICC A;  3FMQ A;  4G7Z F;  1UAA A;  3S1R J;  1IDY A;  3DEU A;  3AKZ A;  2MA3 A;  1BC7 C;  2DDA A;  1G2H A;  5B1A H;  2VIX A;  3L9F A;  1JE8 A;  4A5N A;  4L9N A;  4DNC A;  2E19 A;  2RQQ A;  3C7J A;  3DU6 A;  1DU6 A;  1R58 A;  2XRL A;  5EGO A;  2NVQ J;  1I6X A;  4BE0 A;  1QPM A;  2A6T A;  3VWB A;  4Y17 A;  2NS8 A;  4II3 A;  4FAS D;  5E8I A;  4M9X A;  2E60 A;  3HXL A;  4NC8 A;  3KP3 A;  2P6T A;  3FHZ A;  1R6R A;  4LG0 A;  4XQF A;  2DOE A;  2LRE A;  1VQM I;  2A07 F;  5FLV A;  2Y9Y A;  1X3W B;  2DPD A;  1EJ9 A;  1H9G A;  1JJ6 C;  5IP7 J;  4O5V A;  1QHH D;  1D1C A;  1RC9 A;  1FBU A;  3VYT B;  3ZGK A;  3G71 I;  1RKW A;  2OQR A;  2VKH A;  4CH7 A;  2R7R A;  2PMU A;  4UB8 C;  4HF0 A;  2QF7 A;  3GTK J;  2ZFU A;  1I50 J;  3PUB A;  4G12 A;  4NDL A;  3ZQ7 A;  2ZXI A;  3RSN A;  1EA3 A;  3ZOB A;  4BU2 A;  3ZQQ A;  5HLT A;  1LDK B;  4NC7 A;  1X1P A;  5D5U B;  4C3H J;  4QSH A;  4UVB A;  2XIG A;  3E0J B;  1CGP A;  2CV2 A;  3CJR B;  3I4N J;  5J8F A;  1YS6 A;  4PGH A;  3OYN A;  1BA5 A;  2FX0 A;  2L9V A;  3WTY C;  2MH2 A;  2PMZ A;  4LMY A;  1ZR2 A;  2WY7 Q;  2DA6 A;  4HOB A;  1YX5 A;  4PSW A;  1QA6 A;  3GBG A;  2YS9 A;  5JVG F;  1VQ4 I;  3CO6 C;  4H4K C;  1TWC J;  1MJ9 A;  2Z3Y A;  4LIU A;  3RCO A;  3K1N A;  3CCY A;  3DXJ F;  1GLN A;  3DCF A;  3TED A;  1WJC A;  2I8D A;  2XGX A;  2JJ7 A;  4I99 C;  2EIN H;  3A1Y A;  2Q2E A;  5IY5 H;  1ZLJ A;  3KEO A;  1IN5 A;  4YFK F;  2V6E A;  1XDS A;  2NNY A;  2TDX A;  4Y3O A;  5JLX A;  1VQN I;  1QVT A;  3F6V A;  4AYB A;  1P7J A;  4KIB A;  1POG A;  3ZP5 A;  2CO5 A;  2VN2 A;  1OR7 C;  1S7O A;  2W84 A;  2K4J A;  3PSF A;  4PJJ A;  1BR4 A;  1IGN A;  2MLK A;  5LGN A;  4L5J A;  2DDB A;  4PJM A;  2DXI A;  2X6O A;  1MW7 A;  3ZQC A;  1X3U A;  4CCL A;  1XMX A;  4JOM A;  5J6X A;  1V4R A;  1NTC A;  2EFP A;  2VJJ A;  3RI4 A;  1VQ9 I;  3K1P A;  2XAG A;  3E6C C;  4IQ4 A;  1IXC A;  3EET A;  2JA8 J;  3DKY A;  3JAM K;  2FML A;  3FKI J;  1R4N B;  1JXS A;  1SEU A;  2M5W A;  3S93 A;  2RGV A;  2X4H A;  3BCA A;  4BS9 A;  3F0C A;  2ETH A;  5JI6 A;  2P5V A;  5CVJ A;  2DOD A;  4BE1 A;  3EYY A;  3MZH A;  4HYE A;  4BH9 A;  5GTH C;  5ED4 A;  3BTI A;  3RZD J;  3IV5 A;  3CDH A;  3N97 A;  1K4T A;  5FLM J;  1ZQ3 P;  5K7F A;  1QZE A;  3BT9 A;  2XUB A;  1WJA A;  5FFX A;  3Q3S A;  4JYK A;  1PUF A;  2VQG A;  3A01 A;  4M3E A;  4RB0 A;  3S15 J;  1T98 A;  2Y0S A;  5TIS C;  4CXF A;  4IHT A;  1HKS A;  3NWS A;  2P7C B;  5DV5 A;  4IZZ A;  2CH0 A;  1L3L A;  4PJ0 C;  3LSH A;  3RPQ A;  4EEF G;  3DP7 A;  2KJB A;  3FK6 A;  4LGW A;  5M5Y J;  3BR1 A;  2VT3 A;  2QVO A;  1YI2 I;  4EJW A;  4NBQ A;  4E7J A;  3CCJ I;  5GPA A;  2ZCW A;  4JX4 A;  4A6E A;  1V5G A;  1QHG A;  2FQ4 A;  3FXL A;  3HKZ A;  1X1D A;  2QBY B;  4A93 J;  5F04 A;  1XTA A;  1QO0 D;  3B02 A;  2K7L A;  3RQI A;  2FRH A;  4ENN A;  1T08 B;  2VJ5 A;  1H88 C;  2R5Z B;  2Z16 A;  3BG7 A;  3LL7 A;  5CVR A;  3VOD A;  1VQL I;  2ZSH B;  3F3X A;  2PI0 A;  5DCM B;  1VFC A;  5IPA A;  1ZTR A;  4RGR A;  3LSK A;  2OZU A;  2NAZ A;  3DPT A;  1HDD C;  5FLX K;  1DP7 P;  1TW3 A;  2JSP A;  1DQU A;  3DFG A;  1BW6 A;  2G9W A;  3IAM 2;  3IHU A;  3BZC A;  2EIM H;  1ZRC A;  1T0F C;  2CG4 A;  1S7A A;  4A3M J;  2KRC A;  5IOY A;  1KGS A;  1R71 A;  5K7H A;  4HBL A;  1ODD A;  2HQN A;  4RGX A;  1JTX A;  4IF4 A;  3ASN H;  5C44 J;  1LJ9 A;  3LST A;  2IGO A;  3KX2 A;  4FE7 A;  4CO8 A;  4OIO F;  5JLW A;  2NXN B;  3LA7 A;  3M9A A;  4M3F A;  3H3U A;  5CYV A;  2HFH A;  5HLH A;  3OYM A;  1JKP C;  4CCK A;  4UUS B;  4ENJ A;  1ZRF A;  3OS0 A;  4JX5 A;  4OIP F;  4I0B A;  3G1O A;  3VSL A;  3GWZ A;  2YU3 A;  1NG7 A;  2RAE A;  2XF7 A;  5F1J A;  2L7Z A;  3E3V A;  2XB0 X;  1UG0 A;  5K7Z A;  3ML6 A;  2E5Z A;  3TGN A;  2NNN A;  3CQZ J;  4BAC A;  1MBG A;  4AIJ A;  3FDY A;  2G7U A;  3IWZ A;  3ZRG A;  5L3G A;  4F7Z A;  3KYD B;  1QBJ A;  3BR6 A;  2NRA C;  1EV7 A;  3IP4 B;  3OYK A;  2YX4 A;  1XGS A;  2PFB A;  1Z7U A;  2VON A;  3DLL F;  1OYI A;  2DT6 A;  1VZ0 A;  1Z9C A;  1FSE A;  2CJJ A;  2DFF A;  3E7L A;  3MD2 A;  2EFO A;  1JTY A;  2QSG X;  4LD5 A;  1ZHF A;  1ZG1 A;  1JT0 A;  5LHG A;  3HJE A;  3QPS A;  5D4R A;  2RDP A;  3MEX A;  3R61 A;  1PP8 F;  4BY1 J;  4RAF A;  4EJO A;  3OIP A;  4YFX F;  3REO A;  2XRN A;  3IUO A;  2EWN A;  1ULY A;  4G6Q A;  1MDM B;  2M4K A;  4CCN A;  4L9J A;  4CYC A;  1HLV A;  3HUG B;  4UXN A;  1W1W E;  5JFR A;  1RZ4 A;  1SFO J;  1WJ5 A;  1I27 A;  5IOZ A;  1MBF A;  1YYV A;  3VSK A;  3OYD A;  3CCS I;  1DGR M;  1FT9 A;  2IW5 A;  3I55 I;  2KIS A;  1R7J A;  4PFP A;  2KIF A;  2E7X A;  3KYC B;  2AO9 A;  3LFK A;  5FB2 A;  2W4S A;  2NOG A;  2CUZ A;  2KFD A;  5F64 A;  4ZYD A;  2DTR A;  2JA5 J;  5M5W J;  2P5L C;  4MHG A;  3F21 A;  1FJL A;  1XX5 A;  1IRZ A;  2CW7 A;  4IEJ A;  3RKQ A;  1FTZ A;  1U5T A;  1ENH A;  1CF7 A;  1B1B A;  3ECO A;  3H5N A;  2XF6 A;  3P7N A;  5H20 A;  2QEN A;  1KYZ A;  1XB4 A;  4B4C A;  3J7A Y;  4P9U A;  3I59 B;  2HWV A;  2P7V B;  3B73 A;  4LLG F;  1W5T A;  2CFO A;  3GZ5 A;  2F4M B;  2BHZ A;  3CDL A;  4IQJ A;  4A3B J;  3H5R A;  4PZJ A;  3IRR A;  1U3E M;  1N78 A;  2EH3 A;  4RAZ A;  5FRM A;  4XN3 A;  1MZB A;  3JRC A;  4KN7 X;  2K9M A;  3RTR A;  4N4N B;  3MWM A;  2Y30 A;  2IT0 A;  2VBW A;  2DCE A;  3K2A A;  2PQ8 A;  3OIO A;  3OYC A;  4HQE A;  1GV2 A;  3DQV C;  3LSJ A;  2ELH A;  5B66 C;  1IO2 A;  2ZO4 A;  1U9O A;  2MAB A;  3O8H A;  2HXI A;  9ANT A;  3LWF A;  5L3D A;  5FGM A;  3H9G A;  2EQR A;  2NVU B;  3NAR A;  2STT A;  3DPU A;  2H6C A;  5CKT A;  3BTJ A;  1T56 A;  1BBY A;  3HL2 A;  3OYI A;  3D1N I;  1LE8 A;  2X48 A;  1XC5 A;  2FU4 A;  2RV8 A;  2I10 A;  1AKH A;  3TOA A;  2VOP A;  2HPM A;  5CVI A;  3RYP A;  4GFB A;  1L0O C;  2DYR H;  2H8R A;  2R0Q C;  2E2H J;  3D5R C;  3CC2 I;  2YSR A;  2R5Y A;  1OCC H;  1USS A;  2Y0M A;  3BR5 A;  2DTZ A;  1UJ8 A;  1R00 A;  3BJA A;  3PM1 A;  5KHD A;  4IRI A;  4ZDO A;  5HNH A;  3TW7 A;  3S1N J;  4LIT A;  3JAM Z;  3QU6 A;  1WZ2 A;  3IRQ A;  4A3I J;  2H94 A;  1PJR A;  1J2X A;  1MJB A;  2PEX A;  4WXC A;  3KET A;  2XRO A;  4BQA A;  4ZYG A;  3OYJ A;  1BI1 A;  4IRG A;  4HDV A;  3HPG A;  3LSI A;  2Z5U A;  1ZRD A;  1QPI A;  1DUX C;  3HOW J;  4G6T B;  5E1W A;  2HS5 A;  1OJL A;  1XMA A;  3ABT A;  4RM3 A;  1E0E A;  4X6A J;  3JRB A;  3OV8 A;  2ZBK A;  1H89 C;  5J3L A;  3U1K A;  3LSG A;  3ZR8 X;  2EZH A;  4UV9 A;  2VBX A;  2JQ7 A;  2DJI A;  1WSU A;  1B72 B;  2R7S A;  1VI0 A;  3FX3 A;  4E4H A;  2HQ5 A;  2IGN A;  3L00 A;  2FF4 A;  5H2F C;  4HF1 A;  2ZKZ A;  1P7I A;  2RRE A;  1APL C;  4EV0 A;  1IG7 A;  2HYJ A;  3OL4 A;  1QNT A;  3FF5 A;  4J01 A;  2VB6 A;  4G6D A;  1FPQ A;  3F8C A;  5A2Q K;  3CTA A;  5FD5 A;  5HNF A;  1G8X A;  3HC7 A;  1MNM C;  5EEH A;  1JGG A;  2OJE D;  1DPU A;  3OYB A;  1B4A A;  2GXG A;  4UUT A;  3V7R A;  3X2Q H;  4ZYE A;  3B6C A;  2CGP A;  1HA8 A;  1ORK A;  1AA7 A;  4J00 A;  4II2 A;  3L2R A;  1FP2 A;  2E1C A;  1JHF A;  1QZY A;  1R5G A;  1SD6 A;  5FJ8 J;  1FEX A;  2KQR A;  5FLX Z;  2FOK A;  2QKL B;  3COA C;  1FOK A;  3S1Q J;  2DMQ A;  2DA5 A;  1OCR H;  2DI3 A;  2DQL A;  2MW8 A;  4WXD A;  4DBQ A;  5GAG J;  2HZT A;  1K83 J;  2KHM A;  3OYG A;  2GA1 A;  1Y0U A;  2L2O A;  2ECB A;  2KT0 A;  4I98 B;  2CFX A;  4AIH A;  2IBD A;  1F1Z A;  3PUF A;  1F9N A;  4BAY A;  1TLH B;  1YOV B;  1Z3X A;  4L9V A;  3FXK A;  3A2K A;  4UUV A;  2E5N A;  2HR3 A;  2VE9 A;  1X4O A;  2X51 A;  2WWY A;  1MMS A;  3I58 A;  4ZC3 A;  1MBH A;  2UXX A;  3GO5 A;  3Q9S A;  4IHY A;  4C2U A;  3FM5 A;  5HLI A;  3VEP A;  1XN7 A;  3RYR A;  2R3S A;  2XC7 A;  4FTH A;  4MLO A;  3F9K A;  3MZY A;  3EQL F;  1T95 A;  3F22 A;  3PO3 J;  3KLO A;  2O7O A;  2PMZ N;  3QP6 A;  3CME I;  3PO2 J;  3DKX A;  3SEQ A;  3LSP A;  2UZK A;  1MH3 A;  4LG3 A;  4B44 A;  2JZY A;  3BPV A;  4DZJ A;  3CD6 I;  4UV8 A;  1FC3 A;  1KU7 A;  3Q0U A;  1JKO C;  2R7Q A;  5D8L B;  4L0Z B;  4HA8 A;  1UFM A;  2EIL H;  4HV6 A;  1U2W A;  2DT5 A;  4GCV A;  3AG3 H;  5GAE J;  4X0G A;  3ISP A;  1EH7 A;  1R22 A;  4WWC A;  5AIP A;  4YFN F;  2QZ8 A;  1VQK I;  2OTJ I;  4OIQ F;  4HST A;  1G3S A;  4XOR A;  4IPA A;  4EJT A;  1TP4 A;  2H1K A;  1B9N A;  4YIR X;  4L5I A;  1JUS A;  2DFE A;  3S32 A;  4KFC A;  1IN7 A;  2MBF A;  3M1C A;  3BY6 A;  1FZP B;  1T6S A;  1HDP A;  1OYW A;  3S8P A;  1SMY F;  3KEQ A;  1WCM J;  4D7N A;  3W3C A;  2DA2 A;  5FKN A;  2L54 A;  4QPQ A;  3UR3 C;  4RB2 C;  1HCR A;  1AHD P;  3K0L A;  3A03 A;  2QLZ A;  4RGU A;  4NHJ A;  4ZDP A;  4MEY F;  2L7M P;  2LBF A;  2W25 A;  1XPX A;  2IA1 A;  1B6A A;  4G9Y A;  1A6Q A;  3ZMT A;  2L4A A;  1E2X A;  1Y8Q B;  3H35 A;  1WI3 A;  2CV1 A;  3TOB A;  3ELK A;  1FBS A;  1F36 A;  4XSX F;  2F5F A;  2YPR A;  4AM3 A;  1S5L C;  2R7U A;  2GQQ A;  3HG9 A;  1O3S A;  1J0R A;  4HX4 A;  4UVA A;  3SZG A;  4IHS A;  4N0B A;  3FK7 A;  4GYI A;  2B63 J;  1YRN A;  3R6S A;  4G8X A;  4CCO A;  3TQN A;  1GVJ A;  1UB9 A;  3GTM J;  3WTX C;  1KU3 A;  1JKR C;  3GTP J;  2OPT A;  1UZC A;  1ZH5 A;  3CUO A;  3G1L A;  3BDD A;  1GV5 A;  4XLF A;  4A3L J;  1XSD A;  3CUQ B;  2ZME B;  2BY0 A;  4ANJ A;  1BJA A;  4QLC U;  1RI7 A;  5KK1 A;  1ZGW A;  1R1V A;  1GXQ A;  2RNJ A;  4UVC A;  3RZO J;  1BN5 A;  4B43 A;  1OCZ H;  2GIZ A;  2ESH A;  4BBS J;  2ZXH A;  1B8I B;  3BOQ A;  1O3T A;  2LRD A;  3A0B C;  1OLT A;  1VQ6 I;  2W1O A;  2W57 A;  5F27 A;  4NQW A;  4EMS A;  4HLY A;  3A0H C;  2HKX A;  4F52 A;  3I56 I;  4DIQ A;  3CJQ B;  5ILU A;  3DTE A;  3D0S A;  3LSR A;  1HW2 A;  3F6O A;  1LB2 A;  5CPR B;  3HRS A;  3PL8 A;  4MO7 A;  1LKX A;  1M1E B;  2PG4 A;  4W97 A;  3A4C A;  1W7P A;  2M8E A;  2WAD A;  1YE9 A;  2QQ8 A;  3KZY A;  1ZK8 A;  1YFH A;  2WV0 A;  2CU7 A;  1FTT A;  1R5H A;  2Y31 A;  2DA4 A;  2RC4 A;  2HNH A;  2WB1 N;  4AUX A;  4E7H A;  2F5D A;  5CLS A;  4G7H F;  1MSE C;  5LHH A;  5E3L A;  2DOF A;  4DW6 A;  3BRO A;  3AAF A;  5E8G A;  2CV0 A;  3PNT A;  2XGC A;  3I53 A;  4XN0 A;  1A35 A;  1WJE A;  2GXB A;  3JTH A;  4BY7 J;  2MD5 A;  1UST A;  3QYF A;  2F5V A;  3V4G A;  2YUS A;  5DD4 A;  2CYY A;  2JWT A;  2A6E F;  3QPL A;  3BG6 A;  1Y39 A;  1STZ A;  1J7K A;  2GA2 A;  3M8J A;  2XAS A;  1Z1D A;  3HEF A;  3QYE A;  1X3Z B;  3J81 K;  4I09 A;  1YJN I;  1MIJ A;  1TBX A;  4ETS A;  2JSC A;  2BW3 B;  5IYC J;  1IV8 A;  1A6I A;  3SHF A;  4O3M A;  4DQ2 A;  2IXS A;  4RAY A;  5HDN A;  3IL2 A;  3ERE D;  2VLA A;  2OA4 A;  3JSP A;  1ZRE A;  2RVC A;  3ASO H;  4BXF A;  5E3M A;  5A2Q Z;  1WJD A;  3HB9 A;  1X1B A;  3FM3 A;  3G6E I;  3LQQ A;  3HHH A;  3GTJ J;  4XKV A;  5E1X A;  1W0U A;  1I5Z A;  4FX0 A;  2V1D A;  4DYQ A;  5K1Y A;  3FXJ A;  1Z3Y A;  2K9Q A;  4U87 A;  1EF4 A;  4IX7 A;  4A3G J;  1R49 A;  1LUJ B;  2EIK H;  3OR1 C;  3QU3 A;  4I76 A;  3HBL A;  1I6H J;  4E7I A;  2DPU A;  3E1S A;  2XAH A;  3HSF A;  3MZ8 A;  1QVU A;  4XKB A;  1SVL A;  4S05 A;  2ZNZ A;  3DPL C;  2UV1 A;  3S3O A;  2JA7 J;  3K4K A;  4P55 A;  2VOO A;  2F4O B;  5EG0 A;  3H3Z A;  5FO5 A;  3V8K A;  1S9H A;  1X19 A;  2WTE A;  4AVZ A;  4Y7N J;  3S3M A;  1FYL A;  1S8N A;  3IKV A;  4HNV A;  3HYI A;  3L2V A;  2HVQ A;  2MD0 A;  2ISZ A;  2OV7 A;  3BG5 A;  4K2E A;  3WTT C;  3TO6 A;  2VAS A;  2I5U A;  3MCZ A;  3CCR I;  2VI6 A;  4NC6 A;  1V54 H;  5FFZ A;  1FY7 A;  2OCE A;  3IKT A;  3IH4 A;  1ON2 A;  1J75 A;  2HGC A;  1K79 A;  3T1B A;  1D5Y A;  3BR2 A;  3TP0 A;  5AIQ A;  3NAU A;  2DA1 A;  3K9T A;  2D5V A;  2ELJ A;  3F8N A;  2IGM A;  5E17 F;  4X1E A;  2X1D A;  2H1L A;  2R93 J;  2CUJ A;  1FBQ A;  2VT2 A;  2O8K A;  3BQY A;  1J09 A;  5LRS A;  5LLQ A;  5H6Q A;  1IN8 A;  2PX9 A;  2KJC A;  3RKY A;  5M5X J;  1HXD A;  3FXQ A;  4RM2 A;  5IT9 K;  4FHT A;  2COM A;  4XM3 A;  5GAD J;  2VPL A;  2KMU A;  5DS9 A;  3J80 K;  2ZJP F;  2OCC H;  1Z21 A;  2DW4 A;  4M6V A;  4GGG A;  4UY8 I;  4NNJ A;  2HTJ A;  5FKK A;  3MKW B;  4IOA F;  5LEJ A;  5HOD A;  2IS2 A;  2XF5 A;  4HG2 A;  1NG6 A;  2TRT A;  5J1U A;  2HEO A;  1KA8 A;  5FKO A;  2W24 A;  1AOY A;  2W48 A;  2PMH A;  2VJI A;  3L2C A;  1U9N A;  2LF7 A;  1Y6I A;  3K2Z A;  3J7Z I;  2DMT A;  1N75 A;  4QIW N;  4BUP A;  4A0Y A;  3SYT A;  2MFZ A;  1TQM A;  2ID6 A;  2MH9 A;  2XAJ A;  3BG3 A;  3K1M A;  2CW8 A;  5J40 A;  2CQK A;  1S3J A;  2EV5 A;  2LKS A;  4FIS A;  4RLQ A;  1MH4 A;  4U7D A;  2EZL A;  2RQP A;  2STW A;  1IN4 A;  5HS9 A;  3GW2 A;  1XG1 A;  2GM4 A;  3EPZ A;  3GUD A;  3CCM I;  3I59 A;  2X1E A;  4A3F J;  3GF2 A;  3QRF F;  4LLN A;  1J5Y A;  3E5Q A;  3KE2 A;  4IL6 C;  4HF2 A;  2LSO A;  1ZKG A;  2GZW A;  5K5R A;  2L9N A;  3FIW A;  2EFQ A;  2LR8 A;  1TC3 C;  2M3A A;  5EJC A;  1BIB A;  2QUF A;  2PBI A;  3MQ0 A;  1UCR A;  2VC0 A;  1R4M B;  4XLH A;  5EGO B;  3OYE A;  4Q48 A;  4M74 A;  4Y15 A;  2LH9 A;  3JRG A;  2CW0 F;  1IUF A;  1KON A;  4O6J A;  4OMZ A;  2K02 A;  2A3S A;  2Y2Z A;  2XSJ C;  4LG0 B;  3OMY A;  1ZEL A;  4CCJ A;  3H36 A;  4CZC A;  2L5Q A;  3QQA A;  2RKH A;  2HOA A;  3GFJ A;  4XID A;  2HI3 A;  2HQR A;  1DU0 A;  2KP6 A;  2BHY A;  4XRF A;  4BQQ A;  3C2G A;  3K6G A;  5B1B H;  3OYH A;  4U0W A;  3CCV I;  1O3Q A;  2R7X A;  4XL9 A;  2WB1 A;  1IAW A;  4LK0 F;  4RMN A;  3WE3 A;  3S1M J;  4QPO A;  2XKO A;  1TWA J;  4L9T A;  2O61 A;  2YU9 J;  5HLG A;  1SFE A;  4I6Z A;  4XK4 A;  1W5C C;  2WA0 A;  1HW5 A;  2NYX A;  3E6M A;  4S0H B;  1VQ8 I;  3R0J A;  3QOP A;  1RET A;  3KIO A;  5LGU A;  1MD0 A;  3CO7 C;  1QGP A;  1OIS A;  2O03 A;  3WU1 B;  3MKL A;  1HW1 A;  4E7L A;  1RES A;  1Z6T A;  3W2V A;  3Q9V A;  4D7M A;  4MTD A;  4DGW B;  4B3A A;  2QSF X;  2R7V A;  3CMA I;  3BP8 A;  4HPQ A;  2VBZ A;  3OL3 A;  3UKG A;  5JR3 A;  1IRG A;  2KIU A;  3BZ6 A;  1WI9 A;  2L4M A;  4JBA A;  2X6Y A;  3CP8 A;  5CJ9 A;  4FE4 A;  2X6W A;  3RPU D;  2QCO A;  3ZQG A;  2PJR B;  1XGO A;  3I4M J;  3GFL A;  3HOU J;  3I3L A;  3ABK H;  3G3Z A;  1B72 A;  2L02 A;  2ZSI B;  2F6C A;  3O3K A;  2Q2E B;  4Z6Y A;  1YJ9 I;  1LPQ A;  2FQ3 A;  3QP5 A;  2FXA A;  3HGG A;  2GAU A;  1P92 A;  4DJA A;  4PK4 A;  5D5X B;  2R7Z J;  4F91 B;  2AS5 F;  1HQC A;  5FRO A;  1JGS A;  4MIM A;  2O8X A;  2AHQ A;  2KDO A;  5J8C A;  1FYM A;  2FA5 A;  2VC1 A;  4M72 A;  3WG7 H;  1R1U A;  1U8R A;  2WAE A;  5EZH A;  4KIC A;  1XCV A;  1ZGJ A;  3J81 Z;  3OSF A;  3RQ4 A;  3CDI A;  2V6C A;  4HLX A;  4YG2 F;  5DDG A;  4H0E A;  5DD8 A;  3F8B A;  3K10 A;  4Y13 A;  4FQG A;  3S16 J;  3LAP A;  1YW9 A;  3R60 A;  2DQR A;  2ID3 A;  1X2N A;  2V7F A;  3CF2 A;  3EUH A;  3M07 A;  3O2P E;  1H8A C;  2R7W A;  2A6H F;  5E3O A;  4I01 A;  4HEA 2;  1YG2 A;  3OY9 A;  1SC7 A;  1OKR A;  1KYW A;  2ZJ2 A;  4CZZ A;  1TNS A;  1IRX A;  2LDU A;  1K78 A;  3Q0V A;  4XSZ F;  5ICE A;  1U8B A;  3CF5 F;  4CGZ A;  1YO5 C;  3V8L A;  3OOU A;  4IJA A;  2CMP A;  1T39 A;  1MBE A;  1LVK A;  3H9J A;  3I71 A;  1MMN A;  2ZNY A;  4LK1 F;  4UNO A;  3M8F A;  2LVS A;  2BZT A;  3JRD A;  2ISY A;  2V1X A;  2HZD A;  5LD2 C;  2WC2 A;  4BE2 A;  5HVQ C;  3KLN A;  2FOW A;  2HDD A;  4I7H A;  1HSJ A;  4RA2 A;  4WXH A;  1KU2 A;  3QOD A;  4BQO A;  4BYY A;  5J1R A;  4R8H A;  1FX7 A;  3I0T A;  5HDG A;  5C3E J;  5HS8 A;  3SZT A;  3DU5 A;  2KRF A;  1PUF B;  3J7Y J;  1KQ8 A;  3A01 B;  2OUM A;  4KT5 C;  4CUG A;  5DCF A;  1H0M A;  3DBR B;  4BBR J;  2ME0 A;  4ITV A;  3LA3 A;  4QWQ A;  2M34 A;  2W00 A;  3GZN B;  5LHI A;  2IPQ X;  4C9Y A;  3A02 A;  4BJT A;  4ASN A;  1T8I A;  1W0T A;  2DAO A;  2IJL A;  4HQM A;  2E7W A;  3BJ6 A;  1D1B A;  3JRI A;  1GT0 C;  4CSW A;  2OC6 A;  3WGH A;  1K61 A;  3H9Q A;  1Z67 A;  3CLQ A;  3SQN A;  5IT9 Z;  3ZQI A;  2BVL A;  2R7T A;  3FHN A;  2H27 A;  3U21 A;  2Y48 A;  1RIO H;  5J4Y A;  1SAX A;  3J80 Z;  2WAF A;  2P81 A;  3RJP A;  1PP7 U;  1QRY A;  1U6G A;  5CVV A;  4DYR A;  3FXR A;  3VB2 A;  2ACJ A;  2K9L A;  3M7G A;  3BTL A;  1EKE A;  2M2E A;  3O6B B;  3OS2 A;  4KIF A;  3DBL B;  2LD5 A;  4A6D A;  1BI0 A;  4I02 A;  4GO1 A;  4KJZ A;  5E20 A;  5DUK A;  3JR9 A;  2BY2 A;  2JT1 A;  4C2M J;  4ZZD A;  1I3Q J;  5HS7 A;  1FP1 D;  3FXO A;  4B48 A;  4ABZ A;  4RB3 C;  5EDN A;  2ZFW A;  1SFX A;  2H6B A;  2AXL A;  3KP7 A;  4M6Y A;  1YIJ I;  1T33 A;  1LFP A;  5D4S A;  2IGK A;  5J47 A;  3FMR A;  1SVM A;  4OAZ A;  2WBM A;  3AG2 H;  3TMO A;  3M3Y J;  3WU0 A;  4PGG A;  2LF8 A;  3N05 A;  4GYG A;  4E70 A;  4RBO A;  4HW0 A;  2VUM J;  3DF8 A;  3CCU I;  3FMS A;  2OAZ A;  4BKX A;  3JRF A;  3H0D A;  2EBI A;  2XV4 S;  5K5Q A;  4BXU A;  2V1N A;  2P8T A;  4HRI A;  3ECH A;  1HBX G;  4BNC A;  3GTO J;  4UB6 C;  2BGC A;  2M30 A;  1FIP A;  3VPR A;  1OYY A;  2BEO A;  2KZG A;  1I3A A;  1BL0 A;  5DUI A;  1E3H A;  5DYM A;  2CWE A;  5IT3 A;  2G7H A;  4UHT A;  1RUN A;  1FOW A;  3OSG A;  1GXP A;  3K4J A;  2IRF G;  4B8X A;  1JKQ C;  1SVO A;  3CUQ A;  2ZME A;  1FWZ A;  2V79 A;  2V9P A;  3QAH A;  1OCT C;  4YEJ A;  1ITY A;  4KYW A;  5DEQ A;  1ZG3 A;  4BJ5 C;  2OF7 A;  3BG9 A;  3L2Q A;  4LIV A;  4XIC A;  4B09 A;  3CP2 A;  1B59 A;  1GDT A;  3BR3 A;  2ICW G;  2C6Y A;  5D8K B;  3FXU A;  4CYC B;  3FIS A;  1RRJ A;  1AWC A;  3BTC A;  1D0X A;  5E79 C;  4HZF A;  1A36 A;  2A61 A;  1VQP I;  2BXY A;  2M7A A;  3V7C A;  4A12 A;  2O6G E;  5BNG A;  3HIF A;  2J5O A;  5DM7 F;  4LOC A;  3BJO A;  5M3M J;  3BC8 A;  3SZP A;  4ZDL A;  1W36 D;  3WTW C;  3VOE A;  3QWL A;  1MMD A;  4KA4 A;  4AWX B;  3PFI A;  1G59 A;  1W5S A;  4EM0 B;  3F23 A;  1UHW A;  2LC2 A;  4IOC F;  1ETV A;  1ZAO A;  4OU0 A;  5F0H A;  2ZJR F;  4M71 A;  4CDG A;  1XSV A;  4RS8 A;  3JRA A;  1U5T B;  3ABL H;  2EA2 A;  1CF7 B;  3W2A A;  3GX4 X;  4J19 A;  3OOP A;  3K4C A;  5L3E A;  3DWL E;  4F3Q A;  5D5V B;  4D1Q A;  2NVT J;  1G6N A;  1DGW Y;  1SAN A;  4HNT A;  1XD7 A;  5AON A;  4N9I A;  3VYU B;  1O4X A;  2VKV A;  4FET A;  3MKY B;  3L2U A;  4XLE A;  4IHX A;  2LY9 A;  5L3F A;  3MAJ A;  1Q1H A;  2VJ4 A;  4MTE A;  1U5T C;  3SDB A;  1NK2 P;  2EV0 A;  3HGY A;  3S2W A;  1MBJ A;  1LVA A;  2XPW A;  3S2D J;  2LG4 A;  5LGT A;  4N9H A;  1W7P D;  1FLI A;  1BW5 A;  3PQJ A;  3MMY B;  3KP6 A;  4GXO A;  2BBY A;  1ETK A;  3E5U A;  3EUA A;  2IA0 A;  4CYD A;  2R7O A;  1LE8 B;  4XLA A;  3EYI A;  2E34 A;  2R7F A;  4HDU A;  1BM9 A;  4XRS G;  5KAF C;  4ESB A;  3E97 A;  2HOS A;  3JW4 A;  1IXS B;  1IJW C;  2NOJ B;  1UHS A;  3BPX A;  4OOI A;  1BOA A;  3VYS B;  4C3J J;  1AKH B;  2LTP A;  4YEL A;  4M9S A;  1D5V A;  3HRT A;  5GPC A;  1OR7 A;  1LDD A;  3T0Y A;  2R5Y B;  1W4M A;  3KP4 A;  4HSR A;  5LEK A;  3PFY A;  2M45 A;  2BXZ A;  2AQE A;  2XKP A;  4OIR F;  2L0K A;  2MLG A;  2VBY A;  2A5W A;  2JRT A;  5JHU A;  2Y75 A;  2VXD A;  3SJM A;  2CQ7 A;  3ZCO A;  3GTL J;  2DK8 A;  2K3P A;  5M3F J;  3SXY A;  4RB1 A;  3J7A O;  2A69 F;  2FBI A;  4P1W A;  3WG9 A;  4U7B A;  1TL8 A;  2VQL A;  3W6K B;  5IP9 J;  4BHP A;  2F4I A;  4GRI A;  2XB5 A;  2XPU A;  4V19 K;  3HRU A;  4KNY A;  2V26 A;  4ZYH A;  3R4K A;  3M1E A;  1K7A A;  2XAF A;  4PCQ A;  2DT7 B;  2LY1 A;  3V42 A;  1I1G A;  1FIA A;  3DTI A;  1HC8 A;  3RDI A;  3S14 J;  3DEW A;  3ZXS A;  3G4S I;  1LQ1 A;  2HKO A;  1ZR4 A;  1ETQ A;  2JUC A;  5ICG A;  3LFU A;  1BC8 C;  3MN2 A;  1REP C;  1KU9 A;  2KPM A;  3GFM A;  4CCM A;  1P9Q C;  5BOX A;  2BOL A;  2G0E A;  4YRV A;  1ONV A;  1TNT A;  2LLK A;  4XKW A;  4S04 A;  2VQC A;  1NH3 A;  3E6D A;  3DKW A;  4EM1 A;  5DTD A;  5KCM A;  2DK5 A;  4D5C A;  1TQI A;  5K5O A;  2M1B A;  2Q1Z B;  1WRJ A;  2CSO A;  1R5I D;  1ZLK A;  1N25 A;  1IZ1 A;  1FOX A;  5B3S H;  5FD6 A;  1BR1 A;  2EB7 A;  3JCU C;  1R36 A;  2L7F P;  1MGT A;  2F48 A;  1Z7L A;  1BI3 A;  5DM6 F;  1O7F A;  1N77 A;  4U88 A;  3OYL A;  4A69 C;  3QYB A;  1OPC A;  3CMY A;  2H8W A;  1ETY A;  1LFB A;  3HM5 A;  1FSH A;  3IC7 A;  5CQG A;  1MMG A;  3QOE A;  5EEA A;  2COB A;  3KP5 A;  1U78 A;  2UWM A;  2EV6 A;  1YJW I;  1MBK A;  2FMY A;  1OCP A;  2F2E A;  3W6V A;  1HST A;  4W1U A;  1HKQ A;  2BY3 A;  4Z2Y A;  3GTG J;  3WHC A;  3BWG A;  4KN4 X;  5KNL A;  4V2G A;  2A5Y B;  4P9F A;  3P9C A;  4A0Z A;  2B9S A;  3PIP F;  3O8G A;  3GYH X;  1Y8R B;  2L9S A;  3E5X A;  1T0F A;  1FMW A;  2MG4 A;  2QBY A;  2QQA A;  1NK3 P;  1Y56 A;  4B47 A;  4QTR A;  4XKC A;  3PQK A;  4BDZ A;  2QEX I;  1XS9 A;  1XDU A;  2E71 A;  1SMT A;  2R5Z A;  2O5R A;  3EUK L;  4ENM A;  2DMN A;  3OS1 A;  1K4S A;  1P4A A;  1ETO A;  5DCM A;  4Y33 A;  3U1D A;  2JA6 J;  2IS1 A;  1SFU A;  5F0C A;  2KIM A;  1NHA A;  3ZMU A;  2D2W A;  2HYF A;  4A3C J;  1I1S A;  3ABU A;  2W85 A;  4BHC A;  3OR2 C;  2FD5 A;  3JRH A;  1TW2 A;  1QZZ A;  2CRG A;  2HOT A;  3TKY A;  2MC4 A;  2PLY A;  1DP3 A;  3IH2 A;  1S29 A;  3AL0 B;  2V9V A;  3L09 A;  3PNY A;  1CQT A;  2YX7 A;  4EJU A;  1MKM A;  4DOZ A;  3H3V K;  5EF6 A;  1VQ5 I;  3F72 A;  1S6L A;  2PJP A;  1TWG J;  3HZJ A;  3OYA A;  2EPF A;  2RN7 A;  4UUS A;  3HSR A;  4M3B A;  2P4W A;  4XBF A;  4BEH B;  4XMY A;  3CCL I;  1H9T A;  5KVR A;  3PJR A;  3ONQ A;  2R7D A;  1FNN A;  2M0C A;  2VE8 A;  2R92 J;  2BV6 A;  3I54 A;  2CQN A;  2Q8K A;  4EGY A;  2VL8 A;  3CMM A;  2AQF A;  5BPI A;  1C0W A;  2HVS A;  1K6O A;  4LFU A;  4PFO A;  3AL0 C;  2LOO A;  3GCM A;  3GFI A;  2IA2 A;  4LB5 A;  1V5E A;  1E3O C;  2DOA A;  2E1N A;  4TV7 A;  2LBF B;  1X1A A;  1YIO A;  2XAU A;  2LNB A;  4IVN A;  3K70 C;  3HOV J;  3AFH A;  1Z77 A;  2FEZ A;  2O0Y A;  1O3R A;  3L7W A;  2PJR A;  5F0F A;  2E1M B;  1WPK A;  4A3E J;  3BCB A;  3VDX A;  4F92 B;  4JP0 A;  4YIF A;  1Y0N A;  4XRS A;  2JMW A;  6PAX A;  2M0M A;  2IP2 A;  3HHG A;  3KFW X;  3L2W A;  1WVR A;  2K85 A;  3HSE A;  1K6Y A;  1Y1W J;  1MDM A;  1YRN B;  1KZH A;  1WKM A;  2WY8 Q;  2ZB9 A;  4R1H A;  1PVE A;  2FUG 2;  1YW7 A;  1HKT A;  3ZN0 A;  3P9I A;  4NB5 A;  1UHM A;  3HUG A;  2ESN A;  3HTS B;  2HTS A;  1OQY A;  4MFE A;  3FWE A;  4MEX F;  2MSY A;  4A3D J;  1X2M A;  3K4B A;  4BXX J;  4F93 B;  3SEZ A;  1PDN C;  2E1M C;  4IHV A;  2CUF A;  2K40 A;  3S17 J;  2LFB A;  2X0L A;  1UEL B;  3CCQ I;  2VKE A;  4XLC A;  4LB6 B;  2K27 A;  1UG2 A;  2HPI A;  3TBI A;  1R9T J;  3TDZ C;  2E35 A;  5E18 F;  1W36 C;  4PSX A;  3KYL A;  5ILS A;  3K69 A;  2QM3 A;  3G1M A;  2R4G A;  3CC7 I;  1JI8 A;  3PSI A;  3T8T A;  3JTG A;  1TWH J;  5BQT A;  3WTU C;  4NQW B;  4WCG A;  4XR6 A;  2Y9Z A;  2CUE A;  2OU2 A;  1IXR C;  1Y1V J;  4HAM A;  4D5F A;  2Q0O A;  2FJ1 A;  2V4J C;  3ZMV A;  4L5E A;  2ADU A;  2QYO A;  3LOC A;  4Y4R A;  3KZI C;  3WGI A;  3ZPL A;  4JQF A;  1W7P B;  3V8J A;  3GLX A;  3ZQL A;  2VKD A;  3ZMZ A;  5F1R A;  3S3N A;  2VXZ A;  1O57 A;  4A3K J;  2X85 A;  1JUP A;  1WHU A;  4HNU A;  1V5F A;  1WJB A;  5D6F A;  2ZC2 A;  4CIC A;  1YTY A;  2E2J J;  2P6S A;  3AG1 H;  5ICF A;  3CC4 I;  2XGE A;  3G73 A;  2W82 A;  1TWF J;  4OAY A;  4ESF A;  5HDK A;  3ZMS A;  4XOT A;  2JVH A;  4MNU A;  2D45 A;  4OIN F;  3H1C A;  4A2U A;  1ERD A;  2LYC A;  1JHH A;  1WWX A;  3FKJ A;  1XSX A;  1A5J A;  1ZYR F;  2EA4 A;  1ZG5 A;  1FYK A;  3IH3 A;  4XLN F;  3KP2 A;  3NEU A;  2EFW A;  2M7B A;  2O3F A;  5BMZ A;  4GDF A;  1D3Y A;  2Z2S B;  2MC3 A;  5D6E A;  1Z91 A;  3TDU C;  1XMK A;  2L9R A;  2OZ6 A;  5GTI C;  4ZH4 F;  1VQO I;  4IKF A;  2L7K A;  4M9Z A;  2IVM A;  3CCE I;  3MFK A;  2BE5 F;  4I2O A;  1WH5 A;  3KPH A;  2XGD A;  4ZTF A;  2HXO A;  2V1U A;  3OYF A;  2F5C A;  2P5K A;  4CHU A;  4AU7 A;  1R23 A;  1XGN A;  4IXA A;  5B5E C;  5JVT A;  4KMU X;  3W6J B;  2JA2 A;  4KMF A;  1TT5 B;  2DN0 A;  3JRE A;  1LNW A;  2JTV A;  2HOE A;  3CLO A;  2L3D A;  1S7E A;  1D8K A;  3NRV A;  4Y52 J;  3F8F A;  3KCC A;  2XSD C;  2DBB A;  5EG0 B;  3P5J A;  3U2R A;  2X9D A;  4ZZL A;  1OCO H;  1LDJ A;  1DDN A;  4RLF A;  3L1P A;  2OTL I;  2GXA A;  3HOS A;  4FT8 A;  1MJA A;  3GTQ J;  2DJN A;  3ESW B;  4OWR B;  2W7N A;  4BJ6 C;  1G4D A;  1DPR A;  1BIA A;  4IO9 F;  2JK3 A;  1E3P A;  1TZL A;  1G3Y A;  4MGR A;  1YS7 A;  1SFK A;  4A3J J;  2GBY A;  2HVR A;  3EDP A;  1A04 A;  1IC8 A;  2FSW A;  4I0A A;  2PN6 A;  3S2H J;  2BVM A;  2XAQ A;  4KDP A;  2XHK A;  2DMU A;  3RKW A;  5IYD J;  1SD4 A;  1MNE A;  3CES A;  2NVY J;  3OWT A;  4EQQ A;  3NWT A;  5EEG A;  2Z99 A;  2MGQ A;  2QQ9 A;  1ACI A;  1F4K A;  4LLL A;  3LNQ A;  4ZTJ A;  1P4X A;  3CZ6 A;  3ZMD A;  3ZN1 A;  3I9V 2;  1V55 H;  3K7A J;  4MFD A;  1Q1V A;  1S72 I;  2FE3 A;  2EZI A;  3FXM A;  3QPH A;  1FMV A;  2QKM B;  5IP6 A;  4BHB A;  4WX9 A;  2DO7 A;  2DFI A;  1LEB A;  1T38 A;  3AG4 H;  4EJV A;  2KDZ A;  2IS4 A;  1QU3 A;  1F43 A;  3FZV A;  4P5O A;  1Z05 A;  3BQZ A;  1P2F A;  4M73 A;  1RUO A;  2ME6 A;  4P96 A;  2M87 A;  2JPB A;  2KIQ A;  4R79 A;  3MKZ A;  1IN6 A;  1EH8 A;  1QQI A;  2DMP A;  4E7S A;  2GWR A;  4E7Z A;  4MQV A;  2GIV A;  3LSM A;  4KIS A;  4XOP A;  3G2B A;  3HOX J;  3HOY J;  1RPW A;  4L0Y B;  4PDK A;  1U0J A;  5D5W B;  2Z1D A;  4AD9 A;  2LKP A;  2A68 F;  4EVI A;  2HQA A;  1SD7 A;  2MYS A;  4F55 A;  4JK1 X;  4E7K A;  3OIQ A;  3R0A A;  1G3T A;  3W2W A;  3GME A;  3T8R A;  3TW6 A;  5LBQ A;  3HRM A;  4FX4 A;  3LQR A; 
#chains in the Genus database with same CATH homology
 3RQI A;  2EZK A;  2R5Z B;  1H88 C;  5IYC J;  1NK2 P;  1A6I A;  3HGY A;  1MBJ A;  1IDZ A;  1VFC A;  5IPA A;  1ZTR A;  5E3M A;  2XPW A;  3S2D J;  3HB9 A;  1HDD C;  3SFI A;  1AU7 A;  1BW5 A;  1Z0X A;  3SDG A;  1BW6 A;  3GTJ J;  1ETK A;  2VPR A;  1W0U A;  2CQQ A;  4DYQ A;  4A3M J;  1LE8 B;  1EF4 A;  1JT6 A;  2K9Q A;  5IOY A;  4XRS G;  5K7H A;  2IEK A;  4A3G J;  2HOS A;  5C4J J;  1JTX A;  1IJW C;  1UHS A;  4M3G A;  5C44 J;  4C3J J;  4I76 A;  2LP0 A;  2LTP A;  3HBL A;  1AKH B;  1I6H J;  4FE7 A;  4IHW A;  5JLW A;  1JKP C;  5GPC A;  1QVU A;  4M3F A;  2R5Y B;  4UUS B;  2WAQ N;  4C3I J;  3TP3 A;  2JA7 J;  4JX5 A;  2L0K A;  1VND A;  3G1O A;  5EG0 A;  2RAE A;  4Y7N J;  5F1J A;  2L7Z A;  4HNV A;  3SJM A;  2XB0 X;  5K7Z A;  4RDU A;  3BG5 A;  5EZG A;  3GTL J;  5M3F J;  3CQZ J;  1MBG A;  5IP9 J;  2VI6 A;  3BR6 A;  1JJ8 C;  2E2I J;  2XB5 A;  1JUM A;  2XPU A;  3IH4 A;  2XPV A;  2DA7 A;  1D5Y A;  3BR2 A;  3TP0 A;  3NAU A;  2DA1 A;  2D5V A;  3H0G J;  1OFC X;  1WH7 A;  2CJJ A;  1FIA A;  1ETW A;  3E7L A;  4X1E A;  2R93 J;  1BJZ A;  1JTY A;  3DEW A;  3S14 J;  1JT0 A;  2O8K A;  3BQY A;  5F08 A;  2K9N A;  2NS7 A;  1ZR4 A;  3QPS A;  1ETQ A;  1IV6 A;  4V2F A;  5M5X J;  2GLO A;  4BY1 J;  3MN2 A;  2O9L A;  1GUU A;  2G0E A;  1B8I A;  5DS9 A;  3WHB A;  2LLK A;  4M6V A;  4AC0 A;  4CYC A;  1HLV A;  1HOM A;  1MSF C;  5DTD A;  1WGX A;  1SFO J;  4D5C A;  5FKK A;  2TCT A;  5IOZ A;  1MBF A;  5HOD A;  5J1U A;  2TRT A;  1LFU P;  1RKT A;  2IAI A;  5FKO A;  2W48 A;  3MVP A;  2AO9 A;  4XRM A;  1U9N A;  2L7F P;  2NOG A;  4DYC A;  2ELK A;  1HF0 A;  4A69 C;  2DMT A;  4QIW N;  2JA5 J;  5M5W J;  3CMY A;  2M9H A;  2ID6 A;  1ETY A;  1LFB A;  3HM5 A;  3BG3 A;  1FJL A;  1IRZ A;  4FIS A;  5EEA A;  4IEJ A;  1MH4 A;  2N8G A;  2COB A;  2EZL A;  3RKQ A;  1FTZ A;  1ENH A;  1U78 A;  1MBK A;  1XG1 A;  1OCP A;  3C2B A;  2GM4 A;  4B4C A;  4A3F J;  3W6V A;  4W1U A;  3GTG J;  3WHC A;  4V2G A;  1ZKG A;  5GP9 A;  3O8G A;  3CDL A;  3FIW A;  4A3B J;  2LR8 A;  1TC3 C;  2EH3 A;  2MG4 A;  5IYB J;  1NK3 P;  3JRC A;  4QTR A;  1XS9 A;  2Y30 A;  5EGO B;  2R5Z A;  3JRG A;  3K2A A;  1IUF A;  3OIO A;  2DMN A;  5EYR A;  1GV2 A;  1ETO A;  3ZQH A;  2JA6 J;  3LSJ A;  3ZQF A;  2Y2Z A;  5F0C A;  1U9O A;  2E1O A;  3O8H A;  4A3C J;  2HXI A;  3Q0W A;  9ANT A;  3BR0 A;  3QQA A;  4XID A;  2HOA A;  4FCY A;  2EQR A;  1GVD A;  2FD5 A;  2HI3 A;  3NAR A;  2CRG A;  4M3D A;  3JRH A;  1DU0 A;  2HOT A;  1LE8 A;  3D1N I;  3BTJ A;  1T56 A;  2LKX A;  2X48 A;  3IH2 A;  1XC5 A;  1UMQ A;  3S1M J;  1CQT A;  4AYB N;  1TWA J;  4DZP A;  1AKH A;  2I10 A;  2YU9 J;  4I6Z A;  3H3V K;  2JN6 A;  5EF6 A;  2H8R A;  4GFB A;  1TWG J;  2R0Q C;  2E2H J;  2R5Y A;  4UUS A;  4XK4 A;  2DTZ A;  3BR5 A;  3PM1 A;  4M3B A;  4S0H B;  3TW7 A;  2NVX J;  3S1N J;  1RET A;  2M0C A;  2R92 J;  4A3I J;  1VF9 A;  3HOZ J;  5C4X J;  3MKL A;  3B6A A;  1RES A;  4D7M A;  4B3A A;  2CQX A;  1E3O C;  3UKG A;  1QPI A;  3HOW J;  1OJL A;  5J1Y A;  4FE4 A;  3HOV J;  2QCO A;  1Z77 A;  3ZQG A;  3JRB A;  4X6A J;  5F0F A;  1H89 C;  5J3L A;  3I4M J;  2LK2 A;  3LSG A;  1WPK A;  3HOU J;  2EZH A;  4A3E J;  5FKM A;  1B72 A;  4JP0 A;  1B72 B;  1VI0 A;  4XRS A;  2JMW A;  1X58 A;  2K9S A;  3HGG A;  2HQ5 A;  2R7Z J;  1P7I A;  5FKL A;  1Y1W J;  3HDD A;  4MIM A;  1APL C;  2AHQ A;  1IG7 A;  4JX6 A;  1YRN B;  2HYJ A;  2ZB9 A;  2Y0S N;  5EZH A;  4MFE A;  4A3D J;  1MNM C;  2MSY A;  3OSF A;  1X2M A;  4BXX J;  1JGG A;  5E3N A;  4IHV A;  4UUT A;  2CUF A;  2K40 A;  3B6C A;  3S17 J;  1ORK A;  4B1R A;  2LFB A;  1RR7 A;  2ECC A;  3S16 J;  2VKE A;  1UG2 A;  2ID3 A;  5FJ8 J;  1R9T J;  2M8G X;  1FEX A;  1X2N A;  1H8A C;  2WV1 A;  3S1Q J;  2DMQ A;  2DA5 A;  5E3O A;  2MW8 A;  3HKZ N;  3G1M A;  1K83 J;  3M4O J;  2DA3 A;  3Q0V A;  1TWH J;  1U8B A;  2ECB A;  2KT0 A;  3OOU A;  2IBD A;  1MBE A;  2Y9Z A;  2CUE A;  1Y1V J;  4D5F A;  1ETX A;  2FJ1 A;  2LVS A;  3S1R J;  1IDY A;  3JRD A;  4L5E A;  1G2H A;  3LOC A;  1MBH A;  4IHY A;  2HDD A;  3ZQL A;  2E19 A;  5J1R A;  5C3E J;  4A3K J;  4FTH A;  4MLO A;  1JUP A;  2E2J J;  1PUF B;  3PO3 J;  1DU6 A;  2O7O A;  2PMZ N;  3A01 B;  3PO2 J;  2XRL A;  5EGO A;  2NVQ J;  3LSP A;  1MH3 A;  2XGE A;  4BBR J;  1TWF J;  2ME0 A;  2NS8 A;  2M34 A;  4DZJ A;  3Q0U A;  1JKO C;  3A02 A;  5FLV A;  2Y9Y A;  1W0T A;  1JJ6 C;  5IP7 J;  3JRI A;  1A5J A;  3IH3 A;  1GT0 C;  1RKW A;  1K61 A;  3GTK J;  2QF7 A;  3ZQI A;  2H1K A;  1I50 J;  1JUS A;  4G12 A;  2L9R A;  4NDL A;  2P81 A;  3ZOB A;  1QRY A;  4DYR A;  1HDP A;  3BTL A;  1WH5 A;  2M2E A;  2XGD A;  2HXO A;  1WCM J;  4D7N A;  4C3H J;  4QSH A;  2DA2 A;  5FKN A;  2LD5 A;  1HCR A;  3I4N J;  1AHD P;  3A03 A;  3JR9 A;  2DN0 A;  4C2M J;  1I3Q J;  3JRE A;  1BA5 A;  2FX0 A;  1ZR2 A;  2DA6 A;  2L7M P;  4ABZ A;  1S7E A;  3GBG A;  2YS9 A;  5EDN A;  1T33 A;  1TWC J;  1WI3 A;  4Y52 J;  3CCY A;  1F36 A;  2XSD C;  3DCF A;  5EG0 B;  3TED A;  3M3Y J;  2X9D A;  2JJ7 A;  4RBO A;  2VUM J;  4BKX A;  3L1P A;  3JRF A;  2EBI A;  3GTO J;  3FK7 A;  5JLX A;  2B63 J;  3GTQ J;  1YRN A;  1FIP A;  1QVT A;  3VPR A;  2DJN A;  1P7J A;  1BL0 A;  1POG A;  3GTM J;  1JKR C;  3GTP J;  2JK3 A;  3OSG A;  2OPT A;  3G1L A;  4A3J J;  2GBY A;  1GV5 A;  1JKQ C;  4A3L J;  1IGN A;  1IC8 A;  3S2H J;  1OCT C;  1ZGW A;  1ITY A;  2DMU A;  2X6O A;  3ZQC A;  5IYD J;  3RZO J;  2NVY J;  2OF7 A;  1NTC A;  3BG9 A;  4XIC A;  4BBS J;  2MGQ A;  1B8I B;  1GDT A;  3BR3 A;  5F27 A;  3FIS A;  4CYC B;  3LNQ A;  3BTC A;  2JA8 J;  3FKI J;  5BNG A;  3K7A J;  4MFD A;  1Q1V A;  2EZI A;  4LOC A;  5M3M J;  3LSR A;  3F0C A;  5IP6 A;  4MO7 A;  4W97 A;  3RZD J;  3BTI A;  2KDZ A;  1F43 A;  3IV5 A;  3BQZ A;  1ZK8 A;  5FLM J;  1ETV A;  2ME6 A;  1ZQ3 P;  2CU7 A;  1FTT A;  5F0H A;  5K7F A;  2WB1 N;  2DA4 A;  2Y31 A;  3BT9 A;  4AUX A;  2DMP A;  3Q3S A;  4JYK A;  1PUF A;  3A01 A;  4M3E A;  3S15 J;  1MSE C;  3HOX J;  5E3L A;  3HOY J;  4DW6 A;  1RPW A;  3JRA A;  4EEF G;  4J19 A;  3FK6 A;  2XGC A;  5M5Y J;  3BR1 A;  2NVT J;  1SAN A;  4BY7 J;  5GPA A;  2YUS A;  2JWT A;  4JX4 A;  3QPL A;  2FQ4 A;  1O4X A;  2VKV A;  3TW6 A;  4IHX A;  3HEF A;  2LY9 A;  4A93 J;  5F04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...