1H88C

Crystal structure of ternary protein-dna complex1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C03
3SFIA 2COBA 3ZQFA 4IHXA 1JJ6C 2ID3A 1TWFJ 2L7ZA 2FQ4A 2R5ZB 3CCYA 4MLOA 2ECBA 4A3BJ 2LTPA 4A3GJ 2L7FP 3A02A 3W6VA 5F04A 1BA5A 2LD5A 3GTLJ 2NS8A 3NARA 1IDYA 2DA6A 3O8GA 4B1RA 3G1LA 3SJMA 4EEFG 2CQQA 5J1UA 2DMQA 1W0UA 1OJLA 5E3OA 2I10A 3BTJA 3RZDJ 4XIDA 4HNVA 2MG4A 3HOUJ 3S17J 1JUMA 3JRFA 2NS7A 3FK6A 1RR7A 1JUPA 2Y31A 3GTGJ 2VPRA 3JRCA 4IHWA 5E3MA 1JT6A 4W97A 2K40A 3WHBA 1WPKA 1XS9A 2DA7A 5F0FA 3HKZN 1B72B 3S2DJ 3F0CA 5C4JJ 1I50J 3BG5A 2WV1A 3JREA 3OIOA 4A3EJ 1PUFB 1MSEC 1F43A 3OSFA 3K7AJ 3HDDA 2NVTJ 4A3JJ 2X48A 3JRIA 2B63J 2IEKA 5F1JA 1BW6A 3B6CA 1Z0XA 2RAEA 1H8AC 4FCYA 2VKVA 4XK4A 3RQIA 4BBRJ 3LSJA 2R0QC 4FTHA 1P7JA 4B4CA 1F36A 5K7FA 4A3MJ 2R5YB 4I76A 3BG3A 2GBYA 2DJNA 1APLC 4CYCB 4JX5A 2HI3A 4ABZA 5M5YJ 2XPWA 5IPAA 1RESA 3A01A 1VFCA 1HLVA 3BTCA 2LFBA 2DMNA 3S16J 2DMUA 3ZOBA 2LKXA 1CQTA 2YUSA 9ANTA 2D5VA 3TW6A 5M5XJ 2HXIA 1JGGA 5FKLA 1XG1A 2R92J 1OFCX 4D5CA 2R93J 5GP9A 3TP0A 3JRAA 1ETQA 4MIMA 1ITYA 2EZIA 1HOMA 3HGYA 3LSGA 2DTZA 1AHDP 1DU6A 5FKNA 1ETOA 4A3DJ 4X1EA 2HDDA 2HOTA 3HEFA 2LVSA 3O8HA 2CUEA 4FISA 5J1RA 3WHCA 1IDZA 1A6IA 3G1OA 1WCMJ 4Y52J 2DMTA 2JN6A 4QTRA 4AUXA 3I4NJ 5IP6A 1ORKA 2DA1A 1ETKA 1RKTA 2CRGA 1HDDC 5F0CA 2EBIA 2JA6J 4AYBN 4JYKA 4QIWN 2EZLA 3RZOJ 1MNMC 4W1UA 3Q0UA 1JTYA 3HOWJ 3ZQHA 1ETXA 2FD5A 3BG9A 3CDLA 1Q1VA 2M8GX 5FKOA 4DYQA 5M3FJ 2K9QA 1JKRC 1FTZA 2R5YA 4C3IJ 5F08A 4A3IJ 2Y9ZA 3JR9A 3UKGA 4IEJA 1H89C 1GT0C 2HXOA 2XRLA 1K83J 2L9RA 5EZHA 2O9LA 4JX6A 2CU7A 5F27A 1ZR4A 1G2HA 1QVUA 5EG0A 1T56A 2PMZN 1VF9A 2WAQN 3LOCA 4C2MJ 3S1NJ 2Y9YA 3BR2A 4XRSG 4DYCA 5M3MJ 3GTQJ 2YU9J 1IGNA 3BR0A 2EQRA 3S1RJ 1UMQA 1WH7A 2L0KA 2VKEA 3FISA 2LR8A 4M3EA 2X9DA 1QPIA 1U9OA 1ZK8A 1LE8A 2EZKA 4M3DA 5FKMA 4IHYA 3S15J 1LFUP 1QVTA 2XGDA 5FKKA 1W0TA 3S14J 4DZJA 2IBDA 1JKPC 1WGXA 3ZQGA 1OCTC 1PUFA 4BY7J 4C3HJ 1WI3A 5C3EJ 1H88C 1Y1WJ 2MGQA 2CQXA 2KT0A 3CQZJ 2NVYJ 3B6AA 4A3LJ 2XPVA 4MFDA 4I6ZA 4M3BA 5FJ8J 3IH4A 2TCTA 3ZQCA 1JKQC 1GVDA 2HOSA 5E3NA 4A3FJ 2ELKA 1FEXA 4B3AA 3HBLA 3TEDA 2ZB9A 3FK7A 2M0CA 1YRNA 2JK3A 2XGEA 2M34A 2R5ZA 4V2GA 2FX0A 5GPAA 3GTJJ 5IYBJ 3S1MJ 5EGOB 1ETYA 2O7OA 3QPLA 2R7ZJ 1ENHA 1MBKA 1E3OC 4DZPA 1VI0A 5IYDJ 1POGA 1X2MA 3LNQA 5JLXA 3JRGA 2N8GA 1T33A 2HYJA 5K7HA 1LFBA 2FJ1A 4LOCA 2DA5A 3VPRA 5IP7J 1IC8A 2ECCA 5GPCA 2Y2ZA 4Y7NJ 3BR1A 1IV6A 1AU7A 1I3QJ 1MSFC 3MVPA 3FKIJ 1NTCA 1VNDA 5FLMJ 3GBGA 1JT0A 3HGGA 1P7IA 5K7ZA 3BTLA 3BQYA 3BTIA 5F0HA 1ZTRA 3LSRA 4DW6A 1JUSA 1NK3P 4NDLA 2DMPA 4XRSA 2EZHA 4QSHA 4C3JJ 1SFOJ 1BJZA 3BR6A 1MBHA 4A3KJ 1LE8B 1TC3C 4D5FA 2O8KA 2NVQJ 4S0HB 3OOUA 1IJWC 2GLOA 1ZR2A 2G0EA 5E3LA 1JJ8C 4M3GA 4J19A 3HB9A 3Q0WA 2P81A 1Z77A 2LK2A 4UUTA 1JTXA 4D7NA 2CUFA 3LSPA 1GDTA 3M4OJ 1YRNB 1ETWA 4MFEA 3I4MJ 1I6HJ 2XB0X 1HCRA 1AKHB 5EZGA 1BL0A 3A01B 1Y1VJ 1IG7A 1SANA 1D5YA 3ZQIA 2X6OA 1TWGJ 2CJJA 1S7EA 2NVXJ 5EGOA 1O4XA 2JA8J 1BW5A 4MO7A 4A69C 3BT9A 2DA2A 4UUSA 3GTPJ 2XB5A 3K2AA 1FJLA 3IH2A 4RBOA 2XGCA 1AKHA 5M5WJ 3HOXJ 3BQZA 5C44J 2H1KA 2OF7A 2XPUA 2LY9A 3HOYJ 2E2JJ 1RKWA 5J3LA 5IYCJ 1ETVA 3MKLA 1XC5A 2JMWA 3PO2J 3GTOJ 2E19A 1MBFA 4X6AJ 2HQ5A 2JJ7A 3TW7A 1R9TJ 3S1QJ 2M9HA 4XRMA 4FE4A 1A5JA 4UUSB 1FTTA 2KDZA 3PM1A 4A3CJ 1DU0A 2LP0A 3S2HJ 2VI6A 1RETA 4DYRA 3D1NI 3BR3A 4IHVA 1FIPA 2HOAA 3A03A 3HOZJ 3DEWA 5J1YA 1ZKGA 3JRBA 2L7MP 4BKXA 2IAIA 1TWHJ 1GV2A 3M3YJ 4BXXJ 2M2EA 4M3FA 4M6VA 2JA7J 2E2IJ 5IP9J 3RKQA 3E7LA 1ZGWA 1MBGA 5IOZA 2DA4A 3H0GJ 5EYRA 1QRYA 3HOVJ 2K9SA 1U9NA 3QQAA 5EG0B 1IUFA 2JA5J 3GTKJ 4V2FA 3DCFA 3PO3J 1GV5A 2K9NA 4FE7A 2XSDC 5EF6A 3HM5A 2OPTA 2E1OA 5DS9A 3IV5A 5JLWA 4G12A 1B8IA 3CMYA 5HODA 2DN0A 2VUMJ 2ME0A 1MBEA 2NOGA 1X58A 1K61A 5C4XJ 2ME6A 3MN2A 1U78A 3L1PA 1X2NA 2Y0SN 4D7MA 4XICA 2AO9A 4JP0A 1ZQ3P 5FLVA 1HDPA 2Y30A 3Q3SA 5DTDA 4JX4A 1U8BA 2GM4A 2E2HJ 2JWTA 4AC0A 2LLKA 1UHSA 4BY1J 1B8IB 1OCPA 3JRDA 1FIAA 4RDUA 1MH3A 2YS9A 1TWCJ 3H3VK 3Q0VA 1NK2P 2QCOA 3G1MA 4A93J 3GTMJ 4BBSJ 1JKOC 5BNGA 1B72A 2TRTA 3NAUA 3OSGA 2ID6A 2QF7A 2WB1N 5IOYA 1EF4A 3BR5A 3TP3A 5EDNA 1WH5A 2MW8A 4CYCA 1GUUA 2MSYA 3SDGA 1UG2A 2EH3A 1MH4A 1IRZA 3QPSA 3JRHA 2AHQA 1MBJA 2DA3A 2H8RA 1HF0A 3ZQLA 5EEAA 1TWAJ 2W48A 1RPWA 4GFBA 3IH3A 4L5EA 3FIWA 3C2BA
chains in the Genus database with same CATH superfamily
2Z99A 5BMZA 1P4AA 2R7QA 3SFIA 2F5VA 2WY8Q 4YELA 3LWFA 2COBA 3CF5F 4C2TA 1JJ6C 3CP8A 2ID3A 5LEJA 4IHXA 4KICA 5ICGA 3MCZA 5LRRA 4AU7A 3H35A 3KP5A 2A69F 3A02A 3OMYA 3PL8A 1YW8A 4OIQF 2LD5A 3E5UA 3M8FA 2NS8A 1SEUA 4I0BA 4A0XA 1HW5A 2CYYA 1ZN2A 3CD6I 3V8LA 2HR3A 1R1TA 2XF6A 1GXQA 3BTJA 2R3SA 3CCJI 2RC4A 4HNVA 2MG4A 2K4JA 3JSOA 2BVMA 3HOUJ 3ONQA 3CMAI 3JRFA 3FK6A 1HC8A 2VPRA 2ZKZA 2W57A 1JT6A 1QZYA 1TW2A 3CJTB 1FNNA 3N4MA 3RTRA 2WC2A 1XCBA 2QSHX 2IP2A 1XS9A 1Z05A 1B72B 3S2DJ 4DBQA 1HA8A 5CJ9A 4EATA 2W85A 3HTUA 5C4JJ 5FFZA 3JREA 4XSXF 4O6JA 1MDMA 1MJAA 3I53A 5KCMA 1F43A 3HDDA 3K7AJ 4RB2C 1Q1HA 3DP7A 2B63J 4LG3A 4IPAA 3PUBA 2D1HA 2CO5A 4BJ5C 3CUOA 3ASNH 1H8AC 3GLXA 4DJAA 3E6BA 3LSJA 2R0QC 2IA0A 1SVOA 2MLKA 1XB4A 1KYWA 3WODF 1F36A 2WAQA 2JRMA 3H9JA 5K7FA 4L9JA 3SZGA 4A3MJ 4Y13A 3OYMA 2K7LA 1R00A 4HEA2 5CVVA 2GBYA 2KRFA 4K2EA 1U5TC 4JX5A 4U88A 3ECHA 1KU2A 2PN6A 3D5SC 5FFXA 2XPWA 4IOCF 1OLTA 1RESA 4BHBA 3CCRI 1HLVA 3BDDA 1O57A 2V6EA 2VBWA 2DMUA 3IKVA 4NB5A 4OAYA 3I5UA 3T5XA 5M5XJ 2HXIA 2HVSA 5FKLA 2R92J 3LMMA 3J7AO 3GXOA 2W7NA 5CQGA 4LLLA 4MEXF 2BW3A 3WU0A 3KETA 1ITYA 2BVLA 1HOMA 3OYFA 1B59A 2KKOA 3DEUA 2YPRA 3IKTA 1S7AA 1FBUA 1Z67A 2H6BA 3LA7A 4BEHB 4HLYA 4I7HA 2KISA 2GZWA 5HDKA 3O8HA 1PDNC 4RGXA 1IDZA 4G9YA 3L2VA 4Y52J 2DMTA 2JN6A 2QBYA 3FZVA 2L54A 2DA1A 4BXFA 2L4AA 1DP3A 2LY2A 2JUGA 4HYEA 4ZZLA 1MIJA 2KMUA 3BPVA 1ZHFA 3J7AY 4UHTA 1TW3A 1QHGA 1IN7A 5HLIA 1X1AA 1ZG1A 2UXNA 4UB8C 3BG9A 3CDLA 1Q1VA 2PMUA 5LFAA 2M8GX 5FKOA 2IT0A 1O3QA 1OISA 2K9QA 3IP4B 3BG6A 5M3FJ 1W1WE 2K27A 4DIQA 3V42A 4XSZF 2R5YA 4C3IJ 3K1NA 3GO5A 2FA5A 1H89C 2Q2EA 3MKWB 2NRAC 4OIRF 2DOAA 3KCCA 2L9RA 5CVJA 3GFJA 4JX6A 2CU7A 3HJEA 5GAEJ 2P6TA 5F27A 3GFMA 1ZR4A 2E1CA 1G3WA 2JQ7A 2HTSA 5EG0A 3V8JA 2LF7A 1T56A 2WAQN 1T8IA 2GIVA 5LRSA 3BR2A 3FX3A 4XORA 2YU9J 1KU9A 5FLXK 3CC7I 2CS3A 2L0KA 2XRNA 3F72A 3I56I 3DWLE 3FISA 4XOTA 3L2WA 4M3EA 4KUMA 5DD8A 1I27A 1GHCA 1PP8F 5JHUA 1SFUA 1V54H 4CGZA 4UVAA 4ZH4F 2PI0A 2MH2A 2L01A 3S14J 2KDOA 4YG2F 3G3ZA 5HVQC 5ILUA 5IY5H 3U9GA 3H9GA 1CGPA 4FETA 3HIFA 2F4IA 5BQTA 2EV0A 1J75A 2QQ8A 1KGSA 3B6AA 1D1CA 4A3LJ 2XPVA 1EH8A 1KQ9A 2TCTA 1U6GA 2PQ8A 1BIAA 1M1EB 4BDZA 1IN8A 2HOSA 5E3NA 1U2WA 2KZGA 1FEXA 1QQIA 1U3EM 3AG2H 1T38A 3ZP5A 2GA2A 2CFXA 2JK3A 2R5ZA 4V2GA 4RGRA 2HQNA 2FX0A 5GPAA 5JHFA 4CCMA 3S1MJ 5EJCA 4KT5C 1MBKA 3MEXA 2FBHA 2MD5A 2ZXJA 3JRGA 2CSOA 4EGYA 2ACJA 2BHZA 3QU3A 1BI3A 1G3SA 4MTEA 5K7HA 5A2QZ 4C2UA 1P4WA 4LOCA 3GF2A 1K6YA 4UB6C 4J01A 1MNEA 1YE9A 1DDNA 2VB6A 1TZLA 3OIQA 1D0XA 3MVPA 4A0YA 4F93B 1UJ8A 1XGSA 2JA2A 4M9SA 4IO9F 4E7LA 1SD5A 1NTCA 2E60A 5FLMJ 3HGGA 1P7IA 5L3CA 3BTLA 3E1SA 4GXOA 2L02A 1YIOA 3LSRA 2DU9A 4XN3A 1X1PA 3OYGA 5H6QA 3L7WA 4FX4A 4XRSA 1R7JA 1Z6TA 2EZHA 4NUBA 5LHIA 3BR6A 5LHHA 3GMEA 2DO7A 4A3KJ 1LE8B 1TC3C 4S0HB 4B8XA 2VLAA 1YOVB 4L5IA 3CLOA 5LD2C 1JJ8C 4HDUA 2DDAA 1SFKA 3FF5A 2ZXWH 2Q1ZB 1NH3A 2FXAA 5H6RA 3HRSA 3QYFA 3DF8A 3IAS2 3Q0WA 4ZDLA 1Z77A 2LK2A 2K3PA 1JTXA 1K78B 2HVQA 1RIOH 3VYRB 3PQKA 4CCOA 4XLHA 1PYVA 3M1EA 5D6EA 1MMSA 3J80Z 1XGMA 5DM6F 4KISA 1XMAA 1BL0A 1Y1VJ 4HOBA 1D5YA 1ZG3A 2AXTC 3ZQIA 4QPQA 3H5RA 4F91B 3WGIA 2QQ9A 2IW5A 1O4XA 3BY6A 2NVUB 2KIFA 5CLSA 4DQ2A 1LDKB 2CW8A 4HX4A 1IRGA 2GXBA 2CG4A 2F4MB 4A69C 2ZJRF 1D0ZA 2VONA 3C2HA 4R8HA 3GTPJ 4L9VA 2XB5A 3K2AA 1FJLA 4I99C 1OKRA 3ERMA 3IH2A 1ZG5A 1FBSA 2HQRA 5TRDA 3DFGA 2VQGA 1TQIA 1ZRDA 1S8NA 2VQHA 3BQZA 5C44J 2P7CB 2LY9A 2M0MA 3HOYJ 1VQ6I 4H0EA 3M7GA 4BJ6C 3CO7C 1XC5A 4XKWA 5ILSA 4GGGA 2KLOA 3ZN1A 2IA1A 4XLFA 3GTOJ 4MGRA 3N05A 2A6TA 2DPDA 2P5VA 2CW7A 2JJ7A 1VQLI 4XRMA 3SEQA 4UUSB 4XLCA 2PEXA 3RYRA 2R4GA 4KA4A 2KDZA 4A3CJ 2DFEA 2LP0A 4DGWB 2Y48A 4HZFA 1WJAA 2MD0A 4BNCA 4HX8A 4ENNA 1E2XA 4IHVA 1BIBA 2HOAA 1WJDA 4G6QA 1T39A 3PSIA 2HVRA 2OU2A 1ZKGA 4PJ0C 2DW4A 4U0WA 2L7MP 3GZ5A 1TWHJ 2CGPA 1DGRM 3OYLA 4BXXJ 1XDSA 4M6VA 4M3FA 1TLHB 4ENJA 1J5YA 2Q2EB 2BHYA 1BI1A 1BR4A 1SMTA 1F4KA 1OQYA 5IOZA 2DA4A 3OY9A 1QRYA 2M1BA 2K9SA 3GX4X 1Z3XA 1W7PB 5HS7A 4RB1A 4V2FA 4L0YB 1Y8QB 2RVCA 3KLOA 5CVUA 1T6SA 3B02A 4LK0F 1MGTA 4PCQA 2HEOA 5JLWA 2JZYA 2V9PA 1BC8C 3CMYA 2G7HA 3K10A 1SVLA 1MBEA 2NOGA 1K61A 2JVGA 3T8TA 4X0GA 2DTRA 1IF1A 1A31A 3K4KA 3OS0A 1T08B 2HOEA 2HQAA 3BZKA 4WF2A 2HPMA 1IN5A 1UHSA 1WRJA 3HUGB 1Z21A 3CJRB 4IF4A 4XKCA 4HG2A 3ZMSA 3RSNA 3ZN0A 1EKEA 3K69A 2CH0A 2VC0A 5IT3A 4RDUA 1MH3A 3V4GA 3PFYA 3H3VK 2LSOA 2LYCA 3WTUC 1HBXG 1D8KA 3WTWC 4WXHA 4L5JA 5DCMB 3BZ6A 5BNGA 2A07F 2LKPA 3OL3A 3SZPA 3M07A 1TTYA 4ZJZA 6PAXA 2ID6A 1P4XA 2IPQX 2WB1N 2OC6A 3VDXA 3TP3A 1WH5A 3KP2A 2F48A 1B9MA 2GOXB 1UCRA 5AIQA 3H3ZA 1R5ID 4HF2A 1N25A 4RB0A 2GAUA 2PMZA 3E5QA 5H20A 1LB2A 1MZBA 4EMSA 2XF7A 1WFXA 2H8RA 2E1NA 2R7DA 5EEAA 2DAOA 3BC8A 2HDCA 3FIWA 2HKXA 2DFIA 5FROA 3ZQFA 3X2QH 5H2FC 2L7ZA 3EYYA 2QSGX 1N77A 2FQ4A 2HS5A 4XR6A 2P8TA 3G4SI 1AOYA 4YIIA 1D1AA 3VFZA 4LB5A 4A3GJ 2X1CA 4ASNA 1Z3YA 3EUAA 3HHHA 1YG2A 4BEHA 3GTLJ 3K70C 1PVEA 5ED4A 2DA6A 3HPHA 2MH9A 4EEFG 3SQNA 5J1UA 2A5YB 2RREA 1W0UA 2DPUA 1OJLA 2BYVE 3AFHA 4PSWA 5D5UB 2VOOA 4XIDA 2XKPA 5BPDA 1D5VA 2E35A 3ERED 1UFMA 4EVIA 2QKMB 3GTGJ 3JRCA 1VQ9I 5D8LB 1SVMA 3S93A 4KIBA 4E7KA 2HKOA 3E0JB 4HAMA 2O3FA 2V6CA 2PLYA 4F52A 4EJVA 2OV7A 3FBNB 3UNGC 2RKHA 2BE5F 4UVCA 3HKZN 5F0FA 3G6EI 4OINF 5IT9K 4IQ4A 1PUFB 2O5RA 3BG5A 3PNVA 1MSEC 3TOBA 3OSFA 3OIPA 1BR1A 1GXPA 2X48A 2A6HF 1BW6A 2KRHA 3B6CA 2D2WA 2VT3A 3K4LA 2X1DA 2RAEA 2BY2A 3K1PA 3K6GA 4M9XA 3WU2C 4E6KG 4YRVA 1LVAA 4MTDA 5LGNA 2KPMA 4BBRJ 3MFKA 4B4CA 3A0HC 1AA7A 1B6AA 2IA2A 2EFWA 2DFHA 2XROA 4M74A 2C6YA 1IN4A 2BW3B 3BG3A 1VZ0A 2M30A 2DJIA 5LHGA 3Q5FA 4II3A 1C0WA 4XRFA 2HI3A 1LEBA 5M5YJ 2QZ8A 4DOZA 1OR7A 1VQKI 4CYDA 5IPAA 1VFCA 4BQAA 4Y4RA 2LFBA 3HZJA 3ZOBA 1CQTA 4EM0B 1USSA 4IHTA 3ECOA 3KZZA 4ETSA 4HNTA 3V7RA 4D1QA 2HZDA 2QGUA 3ZMTA 2QQBA 2R93J 3TP0A 4MIMA 3EUHA 2M5WA 2EWNA 2EZIA 2OD5A 2NNYA 2VODA 3HYIA 3K1MA 3HGYA 1WJEA 3VYSB 1Z7LA 2JUCA 4XKVA 5FKNA 3P5JA 4Z2YA 4X1EA 3H9QA 2UWMA 2L9VA 3GZ6A 2HDDA 4KIFA 3HEFA 2LVSA 4AIKA 3C2GA 1A6IA 3G1OA 3OS1A 1KU7A 4BACA 2ELJA 2L7KA 4XM3A 3K2ZA 3JAMZ 3CCVI 1ORKA 3OYDA 4A6EA 1RKTA 5JVGF 4ZYHA 2EIJH 3MQ0A 2WBMA 3L2UA 5F0CA 2EBIA 3K4CA 4HV6A 4JYKA 4AYBN 1YI2I 4O5VA 3KZIC 3RZOJ 1ZRFA 1MMGA 2DT7B 4W1UA 3Q0UA 2MABA 3OR2C 1FBQA 4Y17A 4S05A 2HYFA 1YS7A 3ELKA 5E20A 4BE1A 1JKRC 4G6DA 1XGOA 2XV4S 3RIRA 3DPLC 4GCVA 5KNLA 3LSHA 4A3IJ 3PFIA 3OR1C 1D8JA 2VT2A 1GLNA 2HXOA 3FMQA 3I0TA 4ZTJA 2RV8A 5LGTA 5J47A 1K83J 1L0OC 2O9LA 3DU6A 2ZSHB 2HDWA 5HDNA 1G2HA 4C9YA 1QVUA 1YS6A 2A68F 3TKYA 1MKMA 4PJNA 3S2WA 4HV5A 2X85A 4IXAA 3EDPA 3G73A 3S1RJ 3F6VA 1IN6A 3M9AA 5E18F 1ZAOA 2VIXA 4RM3A 2X9DA 1QPIA 1ERDA 4ZYEA 4LLNA 2L9NA 5K5OA 1U9OA 1ZK8A 4RGUA 2K9LA 2JRTA 1FT9A 4XBFA 2V26A 4XKBA 1EV7A 4M3DA 5FLXZ 4DNCA 1LFUP 3EPZA 2XGDA 1QVTA 2IRFG 2HPIA 1BJAA 4XNFA 2IBDA 2R7OA 2ZNYA 4P55A 1PUFA 4BY7J 1WI3A 3DV8A 4U0VA 3OYEA 2BGCA 4M6XA 1H88C 1NHAA 4F55A 2GXGA 2DBBA 2CQXA 4ZTFA 1OCCH 4MFDA 4HDVA 3IH4A 4PFPA 1VQ5I 2Z33A 2RDPA 1KQ8A 1GVDA 2JSCA 3BJAA 4U87A 4A3FJ 1ON1A 1IRXA 5L3BA 3HBLA 3TEDA 3HKZA 4PJJA 3FK7A 1YRNA 1BOBA 2A05A 4HF0A 3GTJJ 3G2BA 3IAM2 5IYBJ 2EILH 5DV5A 3OYKA 2R7ZJ 1BC7C 2H1LA 4EGZA 3O6BB 4DZPA 1VI0A 2F5EA 5IYDJ 2V79A 3WTXC 1POGA 1X2MA 2DOFA 4OAZA 4PK4A 1P92A 3OS2A 1KONA 2HYJA 2I5UA 2XGXA 1F9NA 1BR2A 3QRFF 2Y2ZA 1MSFC 3S3MA 1AU7A 1G6NA 1KA8A 3KP6A 2ZMEB 3FKIJ 1FPQA 1Y56A 3QPHA 1FP2A 4OOIA 1X1BA 3GBGA 3K70D 2ELHA 5GTIC 4NBQA 1X3ZB 3BTIA 2V1NA 3C1DA 4LIVA 1ZTRA 4BL0B 3RKXA 3HC7A 2FMYA 5DUKA 1FY7A 3HOSA 2QENA 4C3JJ 4CH7A 2O03A 2NVQJ 2E36A 2K4BA 2O8KA 3F9KA 3OOUA 4XN0A 5FB2A 3I71A 2FE3A 3QU6A 3JTHA 1SFEA 1ZR2A 2XAUA 5E3LA 5DYMA 3ZMDA 3H92A 2STTA 1IXSB 4B44A 4AIJA 3ZR8X 2IS1A 5EEGA 3HB9A 2R7XA 3L9FA 4LITA 2IGMA 2L4MA 3ABLH 4UUTA 3F6OA 4D7NA 3GFLA 2PJRB 4F92B 1U8RA 1R22A 1S6LA 2EINH 3I64A 1GDTA 5KAFC 4E7JA 4P9UA 1YRNB 1ETWA 2E5NA 1FOYA 4BGDA 4P1WA 1YW9A 2FEZA 2YSRA 1AKHB 4B48A 3MD2A 4FQGA 1SANA 2LBFB 2V1XA 2JVHA 4CCKA 3IWFA 5EGOA 3DKXA 3KEYA 2BY0A 3TO7A 2FBKA 4GYIA 3CDIA 3CJQB 1RRJA 3CF2A 3BROA 3GUDA 4XONA 1B4AA 3WTSC 3BT9A 3K9TA 2STWA 4F3QA 4IRIA 4GRIA 4UUSA 2W84A 2IGOA 4L9TA 4RGSA 2F5DA 1E0EA 3IUOA 5M5WJ 4IX7A 2BEOA 4UXNA 2E2JJ 2YX4A 5J3LA 3MAJA 4L9NA 2W1OA 3ABUA 5ILVA 5IYCJ 1FC3A 1I5ZA 2XAQA 2R7WA 2JSPA 1Y8RB 1W36C 3CMEI 1BBYA 4HX7A 4D9JA 5JFRA 1EH6A 3P7NA 1IAWA 1HW2A 1CF7A 1MBFA 4X6AJ 2OBPA 1UAAA 4KJZA 3TW7A 4HBLA 3S1QJ 2DODA 3J7YJ 3FWEA 3PM1A 3S2HJ 4I02A 3HSRA 2X6YA 2L3DA 3D1NI 4PJLA 2R7VA 1VTNC 1ZLJA 1ZREA 2V4JC 3OYNA 3A03A 3HOZJ 3ZMZA 2PJRA 4BKXA 2M4GA 2W4SA 1GV2A 2GIZA 1VQOI 3M3YJ 3DTKA 2V7FA 3RPUA 2VXZA 4G94A 2HNHA 2H94A 4ZYAA 3WTTC 3I3LA 4RAZA 3DLLF 3K4NA 5GTHC 3AL0C 4OIPF 1YJWI 1SD4A 1U9NA 3GTKJ 2E1MC 2JA5J 5J8CA 1YITI 1XD7A 3L2QA 4N0BA 1XSDA 3CUQC 3PO3J 3LSMA 3F8CA 4FE7A 2K3FA 5DS9A 4ENKA 4R79A 3KP7A 1YJNI 2ESNA 4KDPA 4G12A 1FYLA 2OQRA 4XLNF 5HODA 1OCZH 2DN0A 4RAYA 3T8RA 5JI6A 2Z5UA 2ME0A 3R0JA 2Y0SA 3M1CA 2ME6A 3KP4A 2COMA 4I01A 3C7JA 2Z1DA 3L1PA 3LAJA 1X2NA 2Y0SN 5J8FA 1FMWA 2ZXIA 4A2UA 1H0MA 2W25A 2AO9A 2OTLI 3LQRA 1ZQ3P 2GOMA 2EIMH 4NHJA 2PG4A 2VJ4A 2ZCWA 4DBRA 4OMYA 2Y30A 3COAC 2LNBA 2QKLB 2QSFX 5L3FA 1U8BA 4MQ9F 4NQWA 2LLKA 1IUYA 3W6JB 1LDJA 3PIOF 2K86A 3KFWX 2WADA 2LC2A 2CV1A 4IQJA 2VKDA 3QODA 4BY1J 2LREA 3SFZA 1B8IB 2M87A 1UHWA 3QYBA 1QGPA 2P4WA 4HSRA 3R0AA 3ABTA 4M73A 2R7RA 1K4TA 4Q4ZF 1PJRA 3PQJA 2OA4A 3BCBA 2ZJ2A 3WGGA 4AD9A 1LDDA 2BZTA 1NK2P 1QA6A 2F6CA 4A93J 2RQPA 3WGHA 3U2RA 4BBSJ 1B9NA 2OCCH 3CCQI 4LG0B 4BYYA 1TNSA 3FXRA 3NAUA 5TISC 2TDXA 3S3OA 2QF7A 1EF4A 5JVTA 4KT6A 2H27A 4Q48A 5EDNA 1QHHD 3MZ8A 2VE8A 5D5XB 2MW8A 2QBYB 4G7OF 1GUUA 3GWZA 1ON2A 3SDGA 4G6TB 2FQ3A 2EH3A 4BS9A 1MH4A 4A5NA 1IRZA 4I98B 4AIHA 1R23A 4YIRX 3JRHA 1V5GA 2DA3A 3MMYB 2LF8A 3IC7A 3VSKA 2NXNB 1HF0A 3SHFA 1OYWA 2XAJA 1RPWA 2O61A 1RNLA 3I4PA 4YFXF 2KJBA 3DTEA 1RUNA 3B73A 2ZJQF 3KX2A 4MLOA 1IXRC 2ECBA 1ZGAA 2L7FP 4HPQA 2EIKH 2AS5F 1WZ2A 2H6CA 5F04A 3BLYA 2BBYA 1IDYA 2NNNA 3O8GA 3SJMA 3GEZA 3G1LA 3HPGA 4NQWB 1NG7A 2DMQA 2Y75A 4GO1A 3HL2A 3CESA 2EFPA 3S8PA 3IRQA 2I10A 4HW0A 3TOAA 2UXXA 2E7XA 2VBYA 4QLCU 2QA4I 4ENMA 1XDUA 2E71A 3W2WA 1SMYF 2NS7A 1RR7A 1K78A 1JUPA 5E3MA 5HS8A 3PSFA 4W97A 2OAZA 3ZQQA 5LBQA 2EA4A 2KIMA 2L5QA 2PX9A 5FO5A 3VOEA 1G3TA 2IGNA 3GVAA 3CC4I 1S7OA 4ITVA 1I50J 2WV1A 1IZ1A 2XSJC 3A1YA 3OIOA 4A3EJ 3OL4A 5E1WA 2NVTJ 2GXAA 3V8KA 4GYGA 1V5EA 1TL8A 5F1JA 1YX5A 4FT8A 3H36A 3FXMA 4FCYA 2VKVA 1IRFA 1X3UA 2DXIA 3KYLA 3OV8A 3RQIA 4ESJA 1S72I 3KEQA 3CCLI 1QPMA 5E79C 3U21A 4B3XA 2RQQA 4CSWA 3PJRA 1P7JA 2EPFA 4NC6A 4IOAF 3M8EA 5A2QK 2DFFA 1OCRH 2QEXI 2R5YB 3TDZC 1WHUA 3OYHA 3D5LA 1X1CA 3AL0B 2DJNA 1APLC 4CYCB 4WK8F 3MKYB 4RAGA 3FXJA 1FYMA 3TQNA 2DCEA 3S32A 3WG9A 3BTCA 3HRUA 5FRMA 2DMNA 3DPUA 3S16J 3FMSA 4NC7A 5LLQA 4G8XA 2YUSA 9ANTA 3A0BC 2D5VA 4AYBA 5KHDA 1ZH5A 1XG1A 5E8GA 5D4SA 4D5CA 1WVRA 3RKWA 1YJ9I 1J09A 3JRAA 2WTEA 5B1AH 1ETQA 2BY1A 1X19A 4HSTA 3LSGA 3CP2A 1AHDP 2XIGA 1DU6A 3V7SA 5B66C 3C18A 1ETOA 3RKYA 3AG1H 2MFZA 1WJFA 3FXOA 3OYBA 5FRNA 2HOTA 2VQCA 2A61A 2FMLA 5HNHA 1E3PA 3QP5A 4QTRA 4AUXA 4WXDA 3I4NJ 4BHPA 3RPUD 4U7DA 1ETKA 2CRGA 1HDDC 3J80K 1JGSA 3JTGA 3K4BA 1J2XA 1V4RA 2X0LA 5HS9A 4QIWN 2EZLA 4II2A 2NOJB 2JPCA 3R4KA 1QZZA 2E5ZA 1MNMC 1I3AA 3HOWJ 4KIGA 3ZQHA 4MQVA 1ETXA 2VPLA 2GA1A 3CUQA 3DTIA 5AONA 2A3SA 1R36A 2G9WA 5EEHA 4LIUA 1FTZA 1EJ9A 4HQEA 3CDHA 4N9IA 3MZYA 4LGWA 4LLGF 4KITB 3UKGA 2DOEA 1IO2A 4IEJA 5ICEA 1GT0C 4TV7A 2XRLA 2KJCA 5BS6A 3GZNB 3ZMVA 3BZCA 3ASOH 1OMIA 2QM3A 3EETA 1A36A 1R4MB 4BQOA 1W5SA 5BPIA 2PMZN 1VF9A 1Z7UA 4PGHA 1W7PA 3DLAA 4AWXB 1G4DA 3S1NJ 2B7EA 4DYCA 3GTQJ 3VEPA 4UUVA 4N4OB 1IGNA 3BR0A 4UVBA 2EQRA 1UMQA 1EH7A 1WH7A 1BI2A 3I58A 4LG0A 3EQLF 3FXKA 2Y69H 4PUSA 4ZC3A 3TO6A 2UZKA 2R7UA 2J5OA 1SFXA 3W3CA 2BV6A 4XMYA 5FKMA 5CQEA 4IHYA 4UV8A 2QYOA 4CXFA 2IS4A 2VASA 1OYIA 4DZJA 4YEJA 3ZQGA 1PP7U 3PIPF 4AVZA 4C3HJ 5LGUA 1O3SA 5C3EJ 3E97A 4KMUX 5CPRB 3GCMA 3H5NA 4ZYGA 1E17A 5DUIA 2KT0A 3CQZJ 3ZRGA 1R1UA 3AG4H 3ZQCA 2XKOA 3PUFA 1JKQC 2WAFA 5L3DA 2ELKA 5KVRA 2ZB9A 3FDYA 2MBFA 2M0CA 1G59A 5BOXA 2XDVA 4PZJA 3W2VA 2EFOA 4LD5A 3QAHA 2ESHA 3WG7H 4BUPA 1ETYA 2O7OA 3SEZA 3CO6C 1ENHA 3S3NA 1E3OC 3KPHA 2P0WA 3LFUA 4M6YA 1R5HA 2A6EF 5JLXA 5B1BH 1YW7A 1T33A 2EB7A 2N8GA 3QYEA 4I09A 1LFBA 1SAUA 4XOPA 2M7BA 3BJOA 4AIDA 2FJ1A 1YTYA 3VPRA 5IP7J 3LSTA 2ECCA 1DPUA 5GPCA 3RQ4A 4Y7NJ 1HKTA 2V1DA 3BR1A 1IV6A 1VQ4I 1I3QJ 2JT1A 3EUHC 3WTZA 1JHHA 3QWLA 2KQRA 1DPRA 3I59B 2F2EA 2H8WA 1KZHA 5HNFA 3W2AA 1QNTA 3ZMUA 3FMRA 3BQYA 5F0HA 3FKJA 3I55I 2HTJA 4DW6A 2DMPA 4O3MA 1LJ9A 3JCUC 4BQNA 4QSHA 4WX9A 3WE3A 1W36D 4D5FA 1RR8C 2GLOA 2HU9A 2G0EA 5F6FA 3TGNA 1N75A 2VBZA 3NWSA 2DK8A 4Y3OA 1WWXA 1XCVA 4M3GA 5J4VA 4J19A 1JE8A 2IS6A 2LKSA 1MMDA 5K5QA 2P81A 1RUOA 5HOOA 2MC4A 1FOKA 3F3XA 1TNTA 3LSPA 3GFIA 3M4OJ 3JAMK 1ZRCA 3DXJF 2P5LC 4MFEA 3ULQB 3I4MJ 3CMMA 2XB0X 2Z9OA 1U5TA 4BAYA 3AG3H 3E6CC 1IG7A 2X6OA 3TDUC 5DD4A 2FBIA 2CJJA 1R4NB 4BHCA 2ISZA 2X6XA 2K5CA 1WSUA 3VYTB 2JA8J 2EFQA 3BPXA 2Q8KA 3A2KA 2MLGA 4MO7A 1G8XA 2AQEA 2DT5A 3DQVC 3HUGA 4HQMA 4V19K 3LFKA 1HW1A 4RLQA 4S04A 2LY1A 2IJLA 1HXDA 1YIJI 1VQNI 1TQMA 2XGCA 1AKHA 3FXQA 1BM9A 1ULYA 2OF7A 3HXLA 4ANJA 1SD6A 1ZYRF 2YX7A 4XLEA 2VJJA 1OPCA 3T0YA 1WJBA 1ETVA 2P6SA 4BH9A 1UELB 1MD0A 1X4OA 2E19A 1FWZA 1Z91A 1Z9CA 4BE0A 3SDBA 4FE4A 5K5RA 1FTTA 3ABMH 3KEOA 1VQMI 2VI6A 1RETA 4E7HA 1YYVA 4JK1X 3VWBA 3BR3A 5CKTA 4CZZA 4XQFA 5LEKA 2Q0OA 3DEWA 2R7FA 3R60A 1YQAA 3CUQB 4E4HA 4L18B 4IRGA 3BWGA 4RLFA 2PBIA 3P9KA 3VSLA 1FMVA 2M2EA 5D5VB 1R5GA 3RI4A 1REPC 3RKQA 3TMOA 1ZGWA 1GVJA 2VC1A 3H0GJ 5EYRA 3J81K 2J5PA 3HOVJ 1R71A 4WCGA 2X4HA 3ABKH 4XL9A 2XF5A 3DPTA 3DBLB 5EG0B 3WTVC 4J00A 3DCFA 3DU5A 1BN5A 3ML6A 2K9NA 3RYPA 3WTYC 2XSDC 5EF6A 3HM5A 2OPTA 3CCSI 1ZGJA 1VQPI 4P5OA 1E3HA 2EV6A 3IV5A 4QWQA 2X51A 3EYIA 2RN7A 3J81Z 3R61A 2XHKA 4I0AA 1XSVA 2GWRA 2VUMJ 1ACIA 1R49A 3LL7A 5C4XJ 1X58A 3MN2A 1T98A 3GLLA 3HSEA 4BU2A 2VE9A 2V9VA 3K0LA 1YO5C 2CV0A 1LEAA 5D8KB 2OJED 3F22A 2ZO4A 4XICA 1X1DA 1FP1D 4JP0A 1W5CC 4L0ZB 2ICWG 3Q3SA 5J6XA 4WWCA 2M7AA 2E2HJ 2JWTA 3J7ZI 1STZA 1LKXA 4M72A 3KYCB 4JOMA 3UR3C 4KYWA 2WY7Q 1FIAA 2IVMA 2RNGA 3VYUB 3DEEA 2PMHA 3LAPA 2YS9A 3C3WA 3Q0VA 2KHMA 1FSHA 2QCOA 3DBHB 3G1MA 3JW4A 4EV0A 1IW7F 1UHMA 1JKOC 2XAGA 3I9V2 4BDYA 2TRTA 5ICFA 4MHGA 5D6FA 5KK1A 5IOYA 4UY8I 4RM2A 3TL4X 2ADUA 2E34A 1V3FA 5E8IA 2MSYA 3GW2A 1I39A 1A04A 4IJAA 2KFDA 4HA8A 2FRHA 3ROUA 3QPSA 5DCFA 3F8NA 1FOWA 5ERIA 2NAZA 1BOAA 1JXSA 2DYSH 1Y0NA 1TWAJ 4GFBA 1DGWY 4L5EA 3C2BA 3BOQA 1WJ5A 3PNTA 4R1HA 3CCMI 2VOPA 1OR7C 1FOXA 1A35A 2A5WA 2KP6A 1P2FA 1TWFJ 4KN7X 4QPOA 3L09A 2RGVA 2CW0F 2R5ZB 1TT0A 4CICA 3CCYA 4A3BJ 5D4RA 2LTPA 2DDBA 4LFUA 3O2PE 3W6VA 1N78A 5E1ZB 5FD5A 1P9QC 1VQ7I 1BA5A 3NARA 2KIQA 1XSXA 4B1RA 2CQQA 3OWTA 3KLNA 3CZ6A 1D3YA 1R6RA 3L2CA 2VJIA 5E3OA 2HGCA 3RZDJ 2FOKA 2NYXA 3H0DA 2B0LA 3LSKA 1R58A 2ZMEC 1MJ9A 2ZBKA 3RDIA 3S17J 1JUMA 3ESWB 3FM5A 4EM2A 2OZ6A 1TP4A 2Y31A 1V5FA 5K1YA 4IHWA 2VKHA 4LK1F 3OOPA 4EJOA 4CUGA 2W82A 3KZYA 3I59A 2DT6A 2K40A 3TBIA 3WHBA 3HG9A 5DDGA 1WPKA 2DA7A 1QU3A 2Z3YA 3F21A 4IVNA 3F0CA 2VN2A 2IS2A 4ON0A 1W4MA 1NG6A 2E7WA 2WWYA 2HZTA 1LFPA 4A3JJ 2K02A 2XUBA 3JRIA 2IEKA 4EJWA 4E7ZA 2VL8A 2ZC2A 1Z0XA 3GYHX 4KMFA 2Z16A 3D5RC 2LOOA 2X1EA 3R6SA 1LPQA 1K6OA 2BXYA 2CQKA 4XK4A 3WE2A 1PUEE 1S29A 1DP7P 2H09A 3DKWA 5CYVA 2VQLA 2QQAA 4FTHA 4BE2A 2UV1A 2JPBA 1ZARA 4I76A 3VODA 4E7SA 2ZJPF 1XN7A 1WJCA 2M45A 4YFNF 4IL6C 4RB3C 3BJ6A 4N4NB 2YR2A 4ABZA 1O7FA 2CUJA 5E1XA 1A6QA 3A01A 3F8FA 4Z6YA 1HSJA 2LKXA 2LMDA 3TW6A 4U0YA 1T0FC 3A4CA 4JQFA 4PFOA 5TJJA 1JGGA 1OFCX 2DK5A 2XASA 1AWCA 5GP9A 2IXSA 1USTA 2OTJI 2L9SA 3DBRB 1QO0D 3CCEI 3LSIA 1YFHA 5FD6A 2DYRH 5JR3A 3P9IA 4EM1A 2DTZA 4OWRB 4BXUA 4A3DJ 4KFCA 1Z6RA 2ZFWA 1UG0A 4NNJA 3QOPA 5B3SH 2CUEA 3DKYA 4FISA 3WHCA 5J1RA 1WCMJ 1W7PD 3OYJA 1CF7B 2ISYA 3F23A 4P96A 4RAFA 1K79A 1H9TA 1XGNA 5IP6A 2QUFA 5KAIC 5J40A 3REOA 3RJPA 4AM3A 2JA6J 4M9ZA 4XLAA 2I8DA 2NS0A 4PSXA 1JTYA 1S5LC 3MZHA 2R7TA 3T1BA 4A0ZA 2QVOA 2FD5A 4H4KC 3LA3A 2W00A 3IHUA 1IV8A 1X3WB 4DYQA 2OQGA 2FNAA 3WU1B 2EV5A 2OCEA 2P7VB 2O0YA 1S3JA 3KP3A 3OYCA 5F08A 4ZYDA 2Y9ZA 3JR9A 2FF4A 1U0JA 4N9HA 1YX3A 3E3VA 1F5TA 3IWZA 4CZCA 3D0SA 2M4KA 5EZHA 1K4SA 1H9GA 4ZDOA 2KZVA 3PNYA 4Y33A 3LOCA 1YLFA 4C2MJ 2Y9YA 4XRSG 5TGTA 2AXLA 5M3MJ 2KIUA 1RZ4A 2EFNA 3ZPLA 5ICCA 1TQPA 2M3AA 5CVIA 2VKEA 2JTVA 2LR8A 5DEQA 2MC3A 2LRDA 4A6DA 3KIOA 2GQQA 4ESBA 2XAFA 4B09A 2XC7A 4HLXA 1LE8A 2EZKA 2W24A 2MA3A 3LQQA 2V9KA 1UZCA 4AVPA 1HKSA 2KRCA 4E70A 1XTAA 1K7AA 4B43A 3S15J 1W0TA 5FKKA 1Y0UA 3RPQA 5F64A 1JKPC 2D45A 1WGXA 1RI7A 1OCTC 2ZXHA 2X6WA 3ZQ7A 1Y1WJ 2MGQA 3V7CA 3TO9A 2NVYJ 4FHTA 1ODDA 4I6ZA 3HRTA 4M3BA 2ZFUA 4CO8A 5FJ8J 2HFHA 4FX0A 3CTAA 5IT9Z 1RC9A 2WB1A 4B3AA 3Q9VA 1ONVA 2F5CA 3FBIB 1UB9A 2XGEA 4F7ZA 2M34A 3FHNA 3EUKL 4BQQA 2LH9A 2D1VA 3LA2A 1JHFA 5EGOB 3QPLA 3H1CA 4GDFA 2RNJA 5HLGA 1T2KA 2DQLA 1FSEA 1LUJB 4IHSA 1XMXA 1ZELA 3LNQA 4RA2A 4ESFA 3QPTA 1F1ZA 1D0YA 3VB2A 2Z2SB 1J0RA 2DA5A 4YIFA 3M8JA 3CLQA 1IC8A 2DQRA 3FM3A 4M71A 3E6DA 2BOLA 5DM7F 3N97A 2E1MB 5J4YA 3H3UA 4HF1A 3BCAA 2Y0MA 3RCOA 4FASD 1VNDA 4Y15A 1O3TA 1I1GA 1JT0A 5K7ZA 2CWEA 4EQQA 1OCOH 2ZNZA 4MNUA 1SC7A 3QOEA 3FXLA 3HHGA 4C30A 4XLPF 1JUSA 1NK3P 4NDLA 3Q9SA 4A12A 1LVKA 2FOWA 1VQ8I 5GAGJ 1SFOJ 4CCLA 1BJZA 2ZSIB 1MBHA 1FLIA 3KE2A 2EJRA 3JSPA 3F8BA 1IJWC 5GADJ 1MDMB 3CJNA 2M8EA 5B5EC 3IRRA 4OMZA 1IXCA 4P9FA 2DLLA 1B1BA 1BI0A 2ZMEA 1T0FA 1I1SA 2VJ5A 2CUFA 1JI8A 1MW7A 3U1DA 4HNUA 5D5WB 4KN4X 2EA2A 4I2OA 3OYIA 3HSFA 4IZZA 1I6HJ 1HCRA 5EZGA 4CCNA 3A01B 3ZGKA 2QWWA 4Q5SF 2LDUA 4G7ZF 2PFBA 1TWGJ 2NVXJ 1S7EA 5L3EA 3BG7A 1Y39A 4YFKF 1QZEA 2V1UA 4UV9A 4E7IA 4UNOA 1HKQA 2BXZA 2G7UA 1D1BA 3L00A 4RMNA 4KNYA 1BW5A 1R1VA 1T95A 4LB6B 2F4OB 2DA2A 4B47A 3MKZA 2CQ7A 4RBOA 1I6XA 1MMNA 2L2OA 3HOXJ 2H1KA 2CMPA 2XPUA 2LBFA 3CCUI 1RKWA 2LG4A 2AQFA 2YU3A 5DCMA 3L2RA 1W5TA 4IRHA 4D0PA 1KU3A 3MKLA 3ZCOA 1L3LA 3NQOA 1O3RA 2JMWA 3PO2J 4PGGA 1HSTA 1KYZA 4Q47A 2IGKA 4CHUA 3KYDB 2P5KA 3I54A 2VXDA 2HQ5A 1R9TJ 4OIOF 2FUG2 3K4MA 2M9HA 2HYGD 3SXYA 1A5JA 3E6MA 5HLTA 1O7LA 2XVCA 2PJPA 1DU0A 2F5FA 4MEYF 4PJMA 3U1KA 4DYRA 1TT5B 1FIPA 2WAEA 5E17F 2KL4A 1FYKA 1J7KA 5J1YA 4OU0A 3JRBA 2O8XA 3K4JA 1XPXA 2HWVA 2IAIA 2K9MA 2DI3A 4CA0A 1J59A 1QBJA 1WI9A 1TBXA 2E2IJ 2JA7J 5IP9J 1YHQI 2FNPA 3SZTA 3E7LA 4U7BA 2B9SA 1MBGA 2FU4A 5F1RA 1U5TB 2QLZA 1HQCA 3H5AA 2O6GE 1WQ2A 2CFOA 3QQAA 1IUFA 4BJTA 2CQNA 4IKFA 4CCJA 1GV5A 1XX5A 5HLHA 3MWMA 2ETHA 4WXCA 1KQ0A 1MJBA 2E1OA 3P9CA 3G71I 1B8IA 1SD7A 1MMAA 3IL2A 1G3YA 4EJUA 3HTSB 1LNWA 2BY3A 2R7SA 1U78A 1S9HA 5AIPA 1LQ1A 3AAFA 1ZLKA 2K85A 3E5XA 1V55H 1XMKA 4D7MA 1Z1DA 3ZXSA 1FZPB 5FLVA 1SAXA 4A5MA 1HDPA 3W6KB 5DTDA 4JX4A 2GM4A 3OYAA 4AC0A 4JBAA 1DUXC 3QP6A 2FSWA 2WV0A 3NEUA 3ISPA 4NC8A 3HOTA 4LJZF 1OCPA 1Y6IA 2CV2A 1WKMA 3JRDA 2WA0A 4EJTA 2UUZA 4LMYA 1TWCJ 5GAHJ 3NRVA 3AKZA 3FHZA 2MYSA 3GTMJ 4CDGA 4PDKA 1OYYA 1J9IA 4ZZDA 1FX7A 5CVRA 1B72A 4G7HF 1MNDA 2OZUA 4ZDPA 1DQUA 3SYTA 2VBXA 3OSGA 2CUZA 3F8MA 3FXUA 3BR5A 5L3GA 3BP8A 2OUMA 4CYCA 3HRMA 5HDGA 4HRIA 1EA3A 1UG2A 1P6RA 2EK5A 5FGMA 1X4PA 3NWTA 2AHQA 1MBJA 3O3KA 2XAHA 3CC2I 3ZQLA 2W48A 4RS8A 3IH3A
chains in the Genus database with same CATH topology
3SFIA 2COBA 3ZQFA 4IHXA 1JJ6C 2ID3A 1TWFJ 2L7ZA 2FQ4A 2R5ZB 3CCYA 4MLOA 2ECBA 4A3BJ 2LTPA 4A3GJ 2L7FP 3A02A 3W6VA 5F04A 1BA5A 2LD5A 3GTLJ 2NS8A 3NARA 1IDYA 2DA6A 3O8GA 4B1RA 3G1LA 3SJMA 4EEFG 2CQQA 5J1UA 2DMQA 1W0UA 1OJLA 5E3OA 2I10A 3BTJA 3RZDJ 4XIDA 4HNVA 2MG4A 3HOUJ 3S17J 1JUMA 3JRFA 2NS7A 3FK6A 1RR7A 1JUPA 2Y31A 3GTGJ 2VPRA 3JRCA 4IHWA 5E3MA 1JT6A 4W97A 2K40A 3WHBA 1WPKA 1XS9A 2DA7A 5F0FA 3HKZN 1B72B 3S2DJ 3F0CA 5C4JJ 1I50J 3BG5A 2WV1A 3JREA 3OIOA 4A3EJ 1PUFB 1MSEC 1F43A 3OSFA 3K7AJ 3HDDA 2NVTJ 4A3JJ 2X48A 3JRIA 2B63J 2IEKA 5F1JA 1BW6A 3B6CA 1Z0XA 2RAEA 1H8AC 4FCYA 2VKVA 4XK4A 3RQIA 4BBRJ 3LSJA 2R0QC 4FTHA 1P7JA 4B4CA 1F36A 5K7FA 4A3MJ 2R5YB 4I76A 3BG3A 2GBYA 2DJNA 1APLC 4CYCB 4JX5A 2HI3A 4ABZA 5M5YJ 2XPWA 5IPAA 1RESA 3A01A 1VFCA 1HLVA 3BTCA 2LFBA 2DMNA 3S16J 2DMUA 3ZOBA 2LKXA 1CQTA 2YUSA 9ANTA 2D5VA 3TW6A 5M5XJ 2HXIA 1JGGA 5FKLA 1XG1A 2R92J 1OFCX 4D5CA 2R93J 5GP9A 3TP0A 3JRAA 1ETQA 4MIMA 1ITYA 2EZIA 1HOMA 3HGYA 3LSGA 2DTZA 1AHDP 1DU6A 5FKNA 1ETOA 4A3DJ 4X1EA 2HDDA 2HOTA 3HEFA 2LVSA 3O8HA 2CUEA 4FISA 5J1RA 3WHCA 1IDZA 1A6IA 3G1OA 1WCMJ 4Y52J 2DMTA 2JN6A 4QTRA 4AUXA 3I4NJ 5IP6A 1ORKA 2DA1A 1ETKA 1RKTA 2CRGA 1HDDC 5F0CA 2EBIA 2JA6J 4AYBN 4JYKA 4QIWN 2EZLA 3RZOJ 1MNMC 4W1UA 3Q0UA 1JTYA 3HOWJ 3ZQHA 1ETXA 2FD5A 3BG9A 3CDLA 1Q1VA 2M8GX 5FKOA 4DYQA 5M3FJ 2K9QA 1JKRC 1FTZA 2R5YA 4C3IJ 5F08A 4A3IJ 2Y9ZA 3JR9A 3UKGA 4IEJA 1H89C 1GT0C 2HXOA 2XRLA 1K83J 2L9RA 5EZHA 2O9LA 4JX6A 2CU7A 5F27A 1ZR4A 1G2HA 1QVUA 5EG0A 1T56A 2PMZN 1VF9A 2WAQN 3LOCA 4C2MJ 3S1NJ 2Y9YA 3BR2A 4XRSG 4DYCA 5M3MJ 3GTQJ 2YU9J 1IGNA 3BR0A 2EQRA 3S1RJ 1UMQA 1WH7A 2L0KA 2VKEA 3FISA 2LR8A 4M3EA 2X9DA 1QPIA 1U9OA 1ZK8A 1LE8A 2EZKA 4M3DA 5FKMA 4IHYA 3S15J 1LFUP 1QVTA 2XGDA 5FKKA 1W0TA 3S14J 4DZJA 2IBDA 1JKPC 1WGXA 3ZQGA 1OCTC 1PUFA 4BY7J 4C3HJ 1WI3A 5C3EJ 1H88C 1Y1WJ 2MGQA 2CQXA 2KT0A 3CQZJ 2NVYJ 3B6AA 4A3LJ 2XPVA 4MFDA 4I6ZA 4M3BA 5FJ8J 3IH4A 2TCTA 3ZQCA 1JKQC 1GVDA 2HOSA 5E3NA 4A3FJ 2ELKA 1FEXA 4B3AA 3HBLA 3TEDA 2ZB9A 3FK7A 2M0CA 1YRNA 2JK3A 2XGEA 2M34A 2R5ZA 4V2GA 2FX0A 5GPAA 3GTJJ 5IYBJ 3S1MJ 5EGOB 1ETYA 2O7OA 3QPLA 2R7ZJ 1ENHA 1MBKA 1E3OC 4DZPA 1VI0A 5IYDJ 1POGA 1X2MA 3LNQA 5JLXA 3JRGA 2N8GA 1T33A 2HYJA 5K7HA 1LFBA 2FJ1A 4LOCA 2DA5A 3VPRA 5IP7J 1IC8A 2ECCA 5GPCA 2Y2ZA 4Y7NJ 3BR1A 1IV6A 1AU7A 1I3QJ 1MSFC 3MVPA 3FKIJ 1NTCA 1VNDA 5FLMJ 3GBGA 1JT0A 3HGGA 1P7IA 5K7ZA 3BTLA 3BQYA 3BTIA 5F0HA 1ZTRA 3LSRA 4DW6A 1JUSA 1NK3P 4NDLA 2DMPA 4XRSA 2EZHA 4QSHA 4C3JJ 1SFOJ 1BJZA 3BR6A 1MBHA 4A3KJ 1LE8B 1TC3C 4D5FA 2O8KA 2NVQJ 4S0HB 3OOUA 1IJWC 2GLOA 1ZR2A 2G0EA 5E3LA 1JJ8C 4M3GA 4J19A 3HB9A 3Q0WA 2P81A 1Z77A 2LK2A 4UUTA 1JTXA 4D7NA 2CUFA 3LSPA 1GDTA 3M4OJ 1YRNB 1ETWA 4MFEA 3I4MJ 1I6HJ 2XB0X 1HCRA 1AKHB 5EZGA 1BL0A 3A01B 1Y1VJ 1IG7A 1SANA 1D5YA 3ZQIA 2X6OA 1TWGJ 2CJJA 1S7EA 2NVXJ 5EGOA 1O4XA 2JA8J 1BW5A 4MO7A 4A69C 3BT9A 2DA2A 4UUSA 3GTPJ 2XB5A 3K2AA 1FJLA 3IH2A 4RBOA 2XGCA 1AKHA 5M5WJ 3HOXJ 3BQZA 5C44J 2H1KA 2OF7A 2XPUA 2LY9A 3HOYJ 2E2JJ 1RKWA 5J3LA 5IYCJ 1ETVA 3MKLA 1XC5A 2JMWA 3PO2J 3GTOJ 2E19A 1MBFA 4X6AJ 2HQ5A 2JJ7A 3TW7A 1R9TJ 3S1QJ 2M9HA 4XRMA 4FE4A 1A5JA 4UUSB 1FTTA 2KDZA 3PM1A 4A3CJ 1DU0A 2LP0A 3S2HJ 2VI6A 1RETA 4DYRA 3D1NI 3BR3A 4IHVA 1FIPA 2HOAA 3A03A 3HOZJ 3DEWA 5J1YA 1ZKGA 3JRBA 2L7MP 4BKXA 2IAIA 1TWHJ 1GV2A 3M3YJ 4BXXJ 2M2EA 4M3FA 4M6VA 2JA7J 2E2IJ 5IP9J 3RKQA 3E7LA 1ZGWA 1MBGA 5IOZA 2DA4A 3H0GJ 5EYRA 1QRYA 3HOVJ 2K9SA 1U9NA 3QQAA 5EG0B 1IUFA 2JA5J 3GTKJ 4V2FA 3DCFA 3PO3J 1GV5A 2K9NA 4FE7A 2XSDC 5EF6A 3HM5A 2OPTA 2E1OA 5DS9A 3IV5A 5JLWA 4G12A 1B8IA 3CMYA 5HODA 2DN0A 2VUMJ 2ME0A 1MBEA 2NOGA 1X58A 1K61A 5C4XJ 2ME6A 3MN2A 1U78A 3L1PA 1X2NA 2Y0SN 4D7MA 4XICA 2AO9A 4JP0A 1ZQ3P 5FLVA 1HDPA 2Y30A 3Q3SA 5DTDA 4JX4A 1U8BA 2GM4A 2E2HJ 2JWTA 4AC0A 2LLKA 1UHSA 4BY1J 1B8IB 1OCPA 3JRDA 1FIAA 4RDUA 1MH3A 2YS9A 1TWCJ 3H3VK 3Q0VA 1NK2P 2QCOA 3G1MA 4A93J 3GTMJ 4BBSJ 1JKOC 5BNGA 1B72A 2TRTA 3NAUA 3OSGA 2ID6A 2QF7A 2WB1N 5IOYA 1EF4A 3BR5A 3TP3A 5EDNA 1WH5A 2MW8A 4CYCA 1GUUA 2MSYA 3SDGA 1UG2A 2EH3A 1MH4A 1IRZA 3QPSA 3JRHA 2AHQA 1MBJA 2DA3A 2H8RA 1HF0A 3ZQLA 5EEAA 1TWAJ 2W48A 1RPWA 4GFBA 3IH3A 4L5EA 3FIWA 3C2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFI A;  2COB A;  3ZQF A;  4IHX A;  1JJ6 C;  2ID3 A;  1TWF J;  2L7Z A;  2FQ4 A;  2R5Z B;  3CCY A;  4MLO A;  2ECB A;  4A3B J;  2LTP A;  4A3G J;  2L7F P;  3A02 A;  3W6V A;  5F04 A;  1BA5 A;  2LD5 A;  3GTL J;  2NS8 A;  3NAR A;  1IDY A;  2DA6 A;  3O8G A;  4B1R A;  3G1L A;  3SJM A;  4EEF G;  2CQQ A;  5J1U A;  2DMQ A;  1W0U A;  1OJL A;  5E3O A;  2I10 A;  3BTJ A;  3RZD J;  4XID A;  4HNV A;  2MG4 A;  3HOU J;  3S17 J;  1JUM A;  3JRF A;  2NS7 A;  3FK6 A;  1RR7 A;  1JUP A;  2Y31 A;  3GTG J;  2VPR A;  3JRC A;  4IHW A;  5E3M A;  1JT6 A;  4W97 A;  2K40 A;  3WHB A;  1WPK A;  1XS9 A;  2DA7 A;  5F0F A;  3HKZ N;  1B72 B;  3S2D J;  3F0C A;  5C4J J;  1I50 J;  3BG5 A;  2WV1 A;  3JRE A;  3OIO A;  4A3E J;  1PUF B;  1MSE C;  1F43 A;  3OSF A;  3K7A J;  3HDD A;  2NVT J;  4A3J J;  2X48 A;  3JRI A;  2B63 J;  2IEK A;  5F1J A;  1BW6 A;  3B6C A;  1Z0X A;  2RAE A;  1H8A C;  4FCY A;  2VKV A;  4XK4 A;  3RQI A;  4BBR J;  3LSJ A;  2R0Q C;  4FTH A;  1P7J A;  4B4C A;  1F36 A;  5K7F A;  4A3M J;  2R5Y B;  4I76 A;  3BG3 A;  2GBY A;  2DJN A;  1APL C;  4CYC B;  4JX5 A;  2HI3 A;  4ABZ A;  5M5Y J;  2XPW A;  5IPA A;  1RES A;  3A01 A;  1VFC A;  1HLV A;  3BTC A;  2LFB A;  2DMN A;  3S16 J;  2DMU A;  3ZOB A;  2LKX A;  1CQT A;  2YUS A;  9ANT A;  2D5V A;  3TW6 A;  5M5X J;  2HXI A;  1JGG A;  5FKL A;  1XG1 A;  2R92 J;  1OFC X;  4D5C A;  2R93 J;  5GP9 A;  3TP0 A;  3JRA A;  1ETQ A;  4MIM A;  1ITY A;  2EZI A;  1HOM A;  3HGY A;  3LSG A;  2DTZ A;  1AHD P;  1DU6 A;  5FKN A;  1ETO A;  4A3D J;  4X1E A;  2HDD A;  2HOT A;  3HEF A;  2LVS A;  3O8H A;  2CUE A;  4FIS A;  5J1R A;  3WHC A;  1IDZ A;  1A6I A;  3G1O A;  1WCM J;  4Y52 J;  2DMT A;  2JN6 A;  4QTR A;  4AUX A;  3I4N J;  5IP6 A;  1ORK A;  2DA1 A;  1ETK A;  1RKT A;  2CRG A;  1HDD C;  5F0C A;  2EBI A;  2JA6 J;  4AYB N;  4JYK A;  4QIW N;  2EZL A;  3RZO J;  1MNM C;  4W1U A;  3Q0U A;  1JTY A;  3HOW J;  3ZQH A;  1ETX A;  2FD5 A;  3BG9 A;  3CDL A;  1Q1V A;  2M8G X;  5FKO A;  4DYQ A;  5M3F J;  2K9Q A;  1JKR C;  1FTZ A;  2R5Y A;  4C3I J;  5F08 A;  4A3I J;  2Y9Z A;  3JR9 A;  3UKG A;  4IEJ A;  1H89 C;  1GT0 C;  2HXO A;  2XRL A;  1K83 J;  2L9R A;  5EZH A;  2O9L A;  4JX6 A;  2CU7 A;  5F27 A;  1ZR4 A;  1G2H A;  1QVU A;  5EG0 A;  1T56 A;  2PMZ N;  1VF9 A;  2WAQ N;  3LOC A;  4C2M J;  3S1N J;  2Y9Y A;  3BR2 A;  4XRS G;  4DYC A;  5M3M J;  3GTQ J;  2YU9 J;  1IGN A;  3BR0 A;  2EQR A;  3S1R J;  1UMQ A;  1WH7 A;  2L0K A;  2VKE A;  3FIS A;  2LR8 A;  4M3E A;  2X9D A;  1QPI A;  1U9O A;  1ZK8 A;  1LE8 A;  2EZK A;  4M3D A;  5FKM A;  4IHY A;  3S15 J;  1LFU P;  1QVT A;  2XGD A;  5FKK A;  1W0T A;  3S14 J;  4DZJ A;  2IBD A;  1JKP C;  1WGX A;  3ZQG A;  1OCT C;  1PUF A;  4BY7 J;  4C3H J;  1WI3 A;  5C3E J;  1H88 C;  1Y1W J;  2MGQ A;  2CQX A;  2KT0 A;  3CQZ J;  2NVY J;  3B6A A;  4A3L J;  2XPV A;  4MFD A;  4I6Z A;  4M3B A;  5FJ8 J;  3IH4 A;  2TCT A;  3ZQC A;  1JKQ C;  1GVD A;  2HOS A;  5E3N A;  4A3F J;  2ELK A;  1FEX A;  4B3A A;  3HBL A;  3TED A;  2ZB9 A;  3FK7 A;  2M0C A;  1YRN A;  2JK3 A;  2XGE A;  2M34 A;  2R5Z A;  4V2G A;  2FX0 A;  5GPA A;  3GTJ J;  5IYB J;  3S1M J;  5EGO B;  1ETY A;  2O7O A;  3QPL A;  2R7Z J;  1ENH A;  1MBK A;  1E3O C;  4DZP A;  1VI0 A;  5IYD J;  1POG A;  1X2M A;  3LNQ A;  5JLX A;  3JRG A;  2N8G A;  1T33 A;  2HYJ A;  5K7H A;  1LFB A;  2FJ1 A;  4LOC A;  2DA5 A;  3VPR A;  5IP7 J;  1IC8 A;  2ECC A;  5GPC A;  2Y2Z A;  4Y7N J;  3BR1 A;  1IV6 A;  1AU7 A;  1I3Q J;  1MSF C;  3MVP A;  3FKI J;  1NTC A;  1VND A;  5FLM J;  3GBG A;  1JT0 A;  3HGG A;  1P7I A;  5K7Z A;  3BTL A;  3BQY A;  3BTI A;  5F0H A;  1ZTR A;  3LSR A;  4DW6 A;  1JUS A;  1NK3 P;  4NDL A;  2DMP A;  4XRS A;  2EZH A;  4QSH A;  4C3J J;  1SFO J;  1BJZ A;  3BR6 A;  1MBH A;  4A3K J;  1LE8 B;  1TC3 C;  4D5F A;  2O8K A;  2NVQ J;  4S0H B;  3OOU A;  1IJW C;  2GLO A;  1ZR2 A;  2G0E A;  5E3L A;  1JJ8 C;  4M3G A;  4J19 A;  3HB9 A;  3Q0W A;  2P81 A;  1Z77 A;  2LK2 A;  4UUT A;  1JTX A;  4D7N A;  2CUF A;  3LSP A;  1GDT A;  3M4O J;  1YRN B;  1ETW A;  4MFE A;  3I4M J;  1I6H J;  2XB0 X;  1HCR A;  1AKH B;  5EZG A;  1BL0 A;  3A01 B;  1Y1V J;  1IG7 A;  1SAN A;  1D5Y A;  3ZQI A;  2X6O A;  1TWG J;  2CJJ A;  1S7E A;  2NVX J;  5EGO A;  1O4X A;  2JA8 J;  1BW5 A;  4MO7 A;  4A69 C;  3BT9 A;  2DA2 A;  4UUS A;  3GTP J;  2XB5 A;  3K2A A;  1FJL A;  3IH2 A;  4RBO A;  2XGC A;  1AKH A;  5M5W J;  3HOX J;  3BQZ A;  5C44 J;  2H1K A;  2OF7 A;  2XPU A;  2LY9 A;  3HOY J;  2E2J J;  1RKW A;  5J3L A;  5IYC J;  1ETV A;  3MKL A;  1XC5 A;  2JMW A;  3PO2 J;  3GTO J;  2E19 A;  1MBF A;  4X6A J;  2HQ5 A;  2JJ7 A;  3TW7 A;  1R9T J;  3S1Q J;  2M9H A;  4XRM A;  4FE4 A;  1A5J A;  4UUS B;  1FTT A;  2KDZ A;  3PM1 A;  4A3C J;  1DU0 A;  2LP0 A;  3S2H J;  2VI6 A;  1RET A;  4DYR A;  3D1N I;  3BR3 A;  4IHV A;  1FIP A;  2HOA A;  3A03 A;  3HOZ J;  3DEW A;  5J1Y A;  1ZKG A;  3JRB A;  2L7M P;  4BKX A;  2IAI A;  1TWH J;  1GV2 A;  3M3Y J;  4BXX J;  2M2E A;  4M3F A;  4M6V A;  2JA7 J;  2E2I J;  5IP9 J;  3RKQ A;  3E7L A;  1ZGW A;  1MBG A;  5IOZ A;  2DA4 A;  3H0G J;  5EYR A;  1QRY A;  3HOV J;  2K9S A;  1U9N A;  3QQA A;  5EG0 B;  1IUF A;  2JA5 J;  3GTK J;  4V2F A;  3DCF A;  3PO3 J;  1GV5 A;  2K9N A;  4FE7 A;  2XSD C;  5EF6 A;  3HM5 A;  2OPT A;  2E1O A;  5DS9 A;  3IV5 A;  5JLW A;  4G12 A;  1B8I A;  3CMY A;  5HOD A;  2DN0 A;  2VUM J;  2ME0 A;  1MBE A;  2NOG A;  1X58 A;  1K61 A;  5C4X J;  2ME6 A;  3MN2 A;  1U78 A;  3L1P A;  1X2N A;  2Y0S N;  4D7M A;  4XIC A;  2AO9 A;  4JP0 A;  1ZQ3 P;  5FLV A;  1HDP A;  2Y30 A;  3Q3S A;  5DTD A;  4JX4 A;  1U8B A;  2GM4 A;  2E2H J;  2JWT A;  4AC0 A;  2LLK A;  1UHS A;  4BY1 J;  1B8I B;  1OCP A;  3JRD A;  1FIA A;  4RDU A;  1MH3 A;  2YS9 A;  1TWC J;  3H3V K;  3Q0V A;  1NK2 P;  2QCO A;  3G1M A;  4A93 J;  3GTM J;  4BBS J;  1JKO C;  5BNG A;  1B72 A;  2TRT A;  3NAU A;  3OSG A;  2ID6 A;  2QF7 A;  2WB1 N;  5IOY A;  1EF4 A;  3BR5 A;  3TP3 A;  5EDN A;  1WH5 A;  2MW8 A;  4CYC A;  1GUU A;  2MSY A;  3SDG A;  1UG2 A;  2EH3 A;  1MH4 A;  1IRZ A;  3QPS A;  3JRH A;  2AHQ A;  1MBJ A;  2DA3 A;  2H8R A;  1HF0 A;  3ZQL A;  5EEA A;  1TWA J;  2W48 A;  1RPW A;  4GFB A;  3IH3 A;  4L5E A;  3FIW A;  3C2B A; 
#chains in the Genus database with same CATH topology
 2Z99 A;  5BMZ A;  1P4A A;  2R7Q A;  3SFI A;  2F5V A;  2WY8 Q;  4YEL A;  3LWF A;  2COB A;  3CF5 F;  4C2T A;  1JJ6 C;  3CP8 A;  2ID3 A;  5LEJ A;  4IHX A;  4KIC A;  5ICG A;  3MCZ A;  5LRR A;  4AU7 A;  3H35 A;  3KP5 A;  2A69 F;  3A02 A;  3OMY A;  3PL8 A;  1YW8 A;  4OIQ F;  2LD5 A;  3E5U A;  3M8F A;  2NS8 A;  1SEU A;  4I0B A;  4A0X A;  1HW5 A;  2CYY A;  1ZN2 A;  3CD6 I;  3V8L A;  2HR3 A;  1R1T A;  2XF6 A;  1GXQ A;  3BTJ A;  2R3S A;  3CCJ I;  2RC4 A;  4HNV A;  2MG4 A;  2K4J A;  3JSO A;  2BVM A;  3HOU J;  3ONQ A;  3CMA I;  3JRF A;  3FK6 A;  1HC8 A;  2VPR A;  2ZKZ A;  2W57 A;  1JT6 A;  1QZY A;  1TW2 A;  3CJT B;  1FNN A;  3N4M A;  3RTR A;  2WC2 A;  1XCB A;  2QSH X;  2IP2 A;  1XS9 A;  1Z05 A;  1B72 B;  3S2D J;  4DBQ A;  1HA8 A;  5CJ9 A;  4EAT A;  2W85 A;  3HTU A;  5C4J J;  5FFZ A;  3JRE A;  4XSX F;  4O6J A;  1MDM A;  1MJA A;  3I53 A;  5KCM A;  1F43 A;  3HDD A;  3K7A J;  4RB2 C;  1Q1H A;  3DP7 A;  2B63 J;  4LG3 A;  4IPA A;  3PUB A;  2D1H A;  2CO5 A;  4BJ5 C;  3CUO A;  3ASN H;  1H8A C;  3GLX A;  4DJA A;  3E6B A;  3LSJ A;  2R0Q C;  2IA0 A;  1SVO A;  2MLK A;  1XB4 A;  1KYW A;  3WOD F;  1F36 A;  2WAQ A;  2JRM A;  3H9J A;  5K7F A;  4L9J A;  3SZG A;  4A3M J;  4Y13 A;  3OYM A;  2K7L A;  1R00 A;  4HEA 2;  5CVV A;  2GBY A;  2KRF A;  4K2E A;  1U5T C;  4JX5 A;  4U88 A;  3ECH A;  1KU2 A;  2PN6 A;  3D5S C;  5FFX A;  2XPW A;  4IOC F;  1OLT A;  1RES A;  4BHB A;  3CCR I;  1HLV A;  3BDD A;  1O57 A;  2V6E A;  2VBW A;  2DMU A;  3IKV A;  4NB5 A;  4OAY A;  3I5U A;  3T5X A;  5M5X J;  2HXI A;  2HVS A;  5FKL A;  2R92 J;  3LMM A;  3J7A O;  3GXO A;  2W7N A;  5CQG A;  4LLL A;  4MEX F;  2BW3 A;  3WU0 A;  3KET A;  1ITY A;  2BVL A;  1HOM A;  3OYF A;  1B59 A;  2KKO A;  3DEU A;  2YPR A;  3IKT A;  1S7A A;  1FBU A;  1Z67 A;  2H6B A;  3LA7 A;  4BEH B;  4HLY A;  4I7H A;  2KIS A;  2GZW A;  5HDK A;  3O8H A;  1PDN C;  4RGX A;  1IDZ A;  4G9Y A;  3L2V A;  4Y52 J;  2DMT A;  2JN6 A;  2QBY A;  3FZV A;  2L54 A;  2DA1 A;  4BXF A;  2L4A A;  1DP3 A;  2LY2 A;  2JUG A;  4HYE A;  4ZZL A;  1MIJ A;  2KMU A;  3BPV A;  1ZHF A;  3J7A Y;  4UHT A;  1TW3 A;  1QHG A;  1IN7 A;  5HLI A;  1X1A A;  1ZG1 A;  2UXN A;  4UB8 C;  3BG9 A;  3CDL A;  1Q1V A;  2PMU A;  5LFA A;  2M8G X;  5FKO A;  2IT0 A;  1O3Q A;  1OIS A;  2K9Q A;  3IP4 B;  3BG6 A;  5M3F J;  1W1W E;  2K27 A;  4DIQ A;  3V42 A;  4XSZ F;  2R5Y A;  4C3I J;  3K1N A;  3GO5 A;  2FA5 A;  1H89 C;  2Q2E A;  3MKW B;  2NRA C;  4OIR F;  2DOA A;  3KCC A;  2L9R A;  5CVJ A;  3GFJ A;  4JX6 A;  2CU7 A;  3HJE A;  5GAE J;  2P6T A;  5F27 A;  3GFM A;  1ZR4 A;  2E1C A;  1G3W A;  2JQ7 A;  2HTS A;  5EG0 A;  3V8J A;  2LF7 A;  1T56 A;  2WAQ N;  1T8I A;  2GIV A;  5LRS A;  3BR2 A;  3FX3 A;  4XOR A;  2YU9 J;  1KU9 A;  5FLX K;  3CC7 I;  2CS3 A;  2L0K A;  2XRN A;  3F72 A;  3I56 I;  3DWL E;  3FIS A;  4XOT A;  3L2W A;  4M3E A;  4KUM A;  5DD8 A;  1I27 A;  1GHC A;  1PP8 F;  5JHU A;  1SFU A;  1V54 H;  4CGZ A;  4UVA A;  4ZH4 F;  2PI0 A;  2MH2 A;  2L01 A;  3S14 J;  2KDO A;  4YG2 F;  3G3Z A;  5HVQ C;  5ILU A;  5IY5 H;  3U9G A;  3H9G A;  1CGP A;  4FET A;  3HIF A;  2F4I A;  5BQT A;  2EV0 A;  1J75 A;  2QQ8 A;  1KGS A;  3B6A A;  1D1C A;  4A3L J;  2XPV A;  1EH8 A;  1KQ9 A;  2TCT A;  1U6G A;  2PQ8 A;  1BIA A;  1M1E B;  4BDZ A;  1IN8 A;  2HOS A;  5E3N A;  1U2W A;  2KZG A;  1FEX A;  1QQI A;  1U3E M;  3AG2 H;  1T38 A;  3ZP5 A;  2GA2 A;  2CFX A;  2JK3 A;  2R5Z A;  4V2G A;  4RGR A;  2HQN A;  2FX0 A;  5GPA A;  5JHF A;  4CCM A;  3S1M J;  5EJC A;  4KT5 C;  1MBK A;  3MEX A;  2FBH A;  2MD5 A;  2ZXJ A;  3JRG A;  2CSO A;  4EGY A;  2ACJ A;  2BHZ A;  3QU3 A;  1BI3 A;  1G3S A;  4MTE A;  5K7H A;  5A2Q Z;  4C2U A;  1P4W A;  4LOC A;  3GF2 A;  1K6Y A;  4UB6 C;  4J01 A;  1MNE A;  1YE9 A;  1DDN A;  2VB6 A;  1TZL A;  3OIQ A;  1D0X A;  3MVP A;  4A0Y A;  4F93 B;  1UJ8 A;  1XGS A;  2JA2 A;  4M9S A;  4IO9 F;  4E7L A;  1SD5 A;  1NTC A;  2E60 A;  5FLM J;  3HGG A;  1P7I A;  5L3C A;  3BTL A;  3E1S A;  4GXO A;  2L02 A;  1YIO A;  3LSR A;  2DU9 A;  4XN3 A;  1X1P A;  3OYG A;  5H6Q A;  3L7W A;  4FX4 A;  4XRS A;  1R7J A;  1Z6T A;  2EZH A;  4NUB A;  5LHI A;  3BR6 A;  5LHH A;  3GME A;  2DO7 A;  4A3K J;  1LE8 B;  1TC3 C;  4S0H B;  4B8X A;  2VLA A;  1YOV B;  4L5I A;  3CLO A;  5LD2 C;  1JJ8 C;  4HDU A;  2DDA A;  1SFK A;  3FF5 A;  2ZXW H;  2Q1Z B;  1NH3 A;  2FXA A;  5H6R A;  3HRS A;  3QYF A;  3DF8 A;  3IAS 2;  3Q0W A;  4ZDL A;  1Z77 A;  2LK2 A;  2K3P A;  1JTX A;  1K78 B;  2HVQ A;  1RIO H;  3VYR B;  3PQK A;  4CCO A;  4XLH A;  1PYV A;  3M1E A;  5D6E A;  1MMS A;  3J80 Z;  1XGM A;  5DM6 F;  4KIS A;  1XMA A;  1BL0 A;  1Y1V J;  4HOB A;  1D5Y A;  1ZG3 A;  2AXT C;  3ZQI A;  4QPQ A;  3H5R A;  4F91 B;  3WGI A;  2QQ9 A;  2IW5 A;  1O4X A;  3BY6 A;  2NVU B;  2KIF A;  5CLS A;  4DQ2 A;  1LDK B;  2CW8 A;  4HX4 A;  1IRG A;  2GXB A;  2CG4 A;  2F4M B;  4A69 C;  2ZJR F;  1D0Z A;  2VON A;  3C2H A;  4R8H A;  3GTP J;  4L9V A;  2XB5 A;  3K2A A;  1FJL A;  4I99 C;  1OKR A;  3ERM A;  3IH2 A;  1ZG5 A;  1FBS A;  2HQR A;  5TRD A;  3DFG A;  2VQG A;  1TQI A;  1ZRD A;  1S8N A;  2VQH A;  3BQZ A;  5C44 J;  2P7C B;  2LY9 A;  2M0M A;  3HOY J;  1VQ6 I;  4H0E A;  3M7G A;  4BJ6 C;  3CO7 C;  1XC5 A;  4XKW A;  5ILS A;  4GGG A;  2KLO A;  3ZN1 A;  2IA1 A;  4XLF A;  3GTO J;  4MGR A;  3N05 A;  2A6T A;  2DPD A;  2P5V A;  2CW7 A;  2JJ7 A;  1VQL I;  4XRM A;  3SEQ A;  4UUS B;  4XLC A;  2PEX A;  3RYR A;  2R4G A;  4KA4 A;  2KDZ A;  4A3C J;  2DFE A;  2LP0 A;  4DGW B;  2Y48 A;  4HZF A;  1WJA A;  2MD0 A;  4BNC A;  4HX8 A;  4ENN A;  1E2X A;  4IHV A;  1BIB A;  2HOA A;  1WJD A;  4G6Q A;  1T39 A;  3PSI A;  2HVR A;  2OU2 A;  1ZKG A;  4PJ0 C;  2DW4 A;  4U0W A;  2L7M P;  3GZ5 A;  1TWH J;  2CGP A;  1DGR M;  3OYL A;  4BXX J;  1XDS A;  4M6V A;  4M3F A;  1TLH B;  4ENJ A;  1J5Y A;  2Q2E B;  2BHY A;  1BI1 A;  1BR4 A;  1SMT A;  1F4K A;  1OQY A;  5IOZ A;  2DA4 A;  3OY9 A;  1QRY A;  2M1B A;  2K9S A;  3GX4 X;  1Z3X A;  1W7P B;  5HS7 A;  4RB1 A;  4V2F A;  4L0Y B;  1Y8Q B;  2RVC A;  3KLO A;  5CVU A;  1T6S A;  3B02 A;  4LK0 F;  1MGT A;  4PCQ A;  2HEO A;  5JLW A;  2JZY A;  2V9P A;  1BC8 C;  3CMY A;  2G7H A;  3K10 A;  1SVL A;  1MBE A;  2NOG A;  1K61 A;  2JVG A;  3T8T A;  4X0G A;  2DTR A;  1IF1 A;  1A31 A;  3K4K A;  3OS0 A;  1T08 B;  2HOE A;  2HQA A;  3BZK A;  4WF2 A;  2HPM A;  1IN5 A;  1UHS A;  1WRJ A;  3HUG B;  1Z21 A;  3CJR B;  4IF4 A;  4XKC A;  4HG2 A;  3ZMS A;  3RSN A;  3ZN0 A;  1EKE A;  3K69 A;  2CH0 A;  2VC0 A;  5IT3 A;  4RDU A;  1MH3 A;  3V4G A;  3PFY A;  3H3V K;  2LSO A;  2LYC A;  3WTU C;  1HBX G;  1D8K A;  3WTW C;  4WXH A;  4L5J A;  5DCM B;  3BZ6 A;  5BNG A;  2A07 F;  2LKP A;  3OL3 A;  3SZP A;  3M07 A;  1TTY A;  4ZJZ A;  6PAX A;  2ID6 A;  1P4X A;  2IPQ X;  2WB1 N;  2OC6 A;  3VDX A;  3TP3 A;  1WH5 A;  3KP2 A;  2F48 A;  1B9M A;  2GOX B;  1UCR A;  5AIQ A;  3H3Z A;  1R5I D;  4HF2 A;  1N25 A;  4RB0 A;  2GAU A;  2PMZ A;  3E5Q A;  5H20 A;  1LB2 A;  1MZB A;  4EMS A;  2XF7 A;  1WFX A;  2H8R A;  2E1N A;  2R7D A;  5EEA A;  2DAO A;  3BC8 A;  2HDC A;  3FIW A;  2HKX A;  2DFI A;  5FRO A;  3ZQF A;  3X2Q H;  5H2F C;  2L7Z A;  3EYY A;  2QSG X;  1N77 A;  2FQ4 A;  2HS5 A;  4XR6 A;  2P8T A;  3G4S I;  1AOY A;  4YII A;  1D1A A;  3VFZ A;  4LB5 A;  4A3G J;  2X1C A;  4ASN A;  1Z3Y A;  3EUA A;  3HHH A;  1YG2 A;  4BEH A;  3GTL J;  3K70 C;  1PVE A;  5ED4 A;  2DA6 A;  3HPH A;  2MH9 A;  4EEF G;  3SQN A;  5J1U A;  2A5Y B;  2RRE A;  1W0U A;  2DPU A;  1OJL A;  2BYV E;  3AFH A;  4PSW A;  5D5U B;  2VOO A;  4XID A;  2XKP A;  5BPD A;  1D5V A;  2E35 A;  3ERE D;  1UFM A;  4EVI A;  2QKM B;  3GTG J;  3JRC A;  1VQ9 I;  5D8L B;  1SVM A;  3S93 A;  4KIB A;  4E7K A;  2HKO A;  3E0J B;  4HAM A;  2O3F A;  2V6C A;  2PLY A;  4F52 A;  4EJV A;  2OV7 A;  3FBN B;  3UNG C;  2RKH A;  2BE5 F;  4UVC A;  3HKZ N;  5F0F A;  3G6E I;  4OIN F;  5IT9 K;  4IQ4 A;  1PUF B;  2O5R A;  3BG5 A;  3PNV A;  1MSE C;  3TOB A;  3OSF A;  3OIP A;  1BR1 A;  1GXP A;  2X48 A;  2A6H F;  1BW6 A;  2KRH A;  3B6C A;  2D2W A;  2VT3 A;  3K4L A;  2X1D A;  2RAE A;  2BY2 A;  3K1P A;  3K6G A;  4M9X A;  3WU2 C;  4E6K G;  4YRV A;  1LVA A;  4MTD A;  5LGN A;  2KPM A;  4BBR J;  3MFK A;  4B4C A;  3A0H C;  1AA7 A;  1B6A A;  2IA2 A;  2EFW A;  2DFH A;  2XRO A;  4M74 A;  2C6Y A;  1IN4 A;  2BW3 B;  3BG3 A;  1VZ0 A;  2M30 A;  2DJI A;  5LHG A;  3Q5F A;  4II3 A;  1C0W A;  4XRF A;  2HI3 A;  1LEB A;  5M5Y J;  2QZ8 A;  4DOZ A;  1OR7 A;  1VQK I;  4CYD A;  5IPA A;  1VFC A;  4BQA A;  4Y4R A;  2LFB A;  3HZJ A;  3ZOB A;  1CQT A;  4EM0 B;  1USS A;  4IHT A;  3ECO A;  3KZZ A;  4ETS A;  4HNT A;  3V7R A;  4D1Q A;  2HZD A;  2QGU A;  3ZMT A;  2QQB A;  2R93 J;  3TP0 A;  4MIM A;  3EUH A;  2M5W A;  2EWN A;  2EZI A;  2OD5 A;  2NNY A;  2VOD A;  3HYI A;  3K1M A;  3HGY A;  1WJE A;  3VYS B;  1Z7L A;  2JUC A;  4XKV A;  5FKN A;  3P5J A;  4Z2Y A;  4X1E A;  3H9Q A;  2UWM A;  2L9V A;  3GZ6 A;  2HDD A;  4KIF A;  3HEF A;  2LVS A;  4AIK A;  3C2G A;  1A6I A;  3G1O A;  3OS1 A;  1KU7 A;  4BAC A;  2ELJ A;  2L7K A;  4XM3 A;  3K2Z A;  3JAM Z;  3CCV I;  1ORK A;  3OYD A;  4A6E A;  1RKT A;  5JVG F;  4ZYH A;  2EIJ H;  3MQ0 A;  2WBM A;  3L2U A;  5F0C A;  2EBI A;  3K4C A;  4HV6 A;  4JYK A;  4AYB N;  1YI2 I;  4O5V A;  3KZI C;  3RZO J;  1ZRF A;  1MMG A;  2DT7 B;  4W1U A;  3Q0U A;  2MAB A;  3OR2 C;  1FBQ A;  4Y17 A;  4S05 A;  2HYF A;  1YS7 A;  3ELK A;  5E20 A;  4BE1 A;  1JKR C;  4G6D A;  1XGO A;  2XV4 S;  3RIR A;  3DPL C;  4GCV A;  5KNL A;  3LSH A;  4A3I J;  3PFI A;  3OR1 C;  1D8J A;  2VT2 A;  1GLN A;  2HXO A;  3FMQ A;  3I0T A;  4ZTJ A;  2RV8 A;  5LGT A;  5J47 A;  1K83 J;  1L0O C;  2O9L A;  3DU6 A;  2ZSH B;  2HDW A;  5HDN A;  1G2H A;  4C9Y A;  1QVU A;  1YS6 A;  2A68 F;  3TKY A;  1MKM A;  4PJN A;  3S2W A;  4HV5 A;  2X85 A;  4IXA A;  3EDP A;  3G73 A;  3S1R J;  3F6V A;  1IN6 A;  3M9A A;  5E18 F;  1ZAO A;  2VIX A;  4RM3 A;  2X9D A;  1QPI A;  1ERD A;  4ZYE A;  4LLN A;  2L9N A;  5K5O A;  1U9O A;  1ZK8 A;  4RGU A;  2K9L A;  2JRT A;  1FT9 A;  4XBF A;  2V26 A;  4XKB A;  1EV7 A;  4M3D A;  5FLX Z;  4DNC A;  1LFU P;  3EPZ A;  2XGD A;  1QVT A;  2IRF G;  2HPI A;  1BJA A;  4XNF A;  2IBD A;  2R7O A;  2ZNY A;  4P55 A;  1PUF A;  4BY7 J;  1WI3 A;  3DV8 A;  4U0V A;  3OYE A;  2BGC A;  4M6X A;  1H88 C;  1NHA A;  4F55 A;  2GXG A;  2DBB A;  2CQX A;  4ZTF A;  1OCC H;  4MFD A;  4HDV A;  3IH4 A;  4PFP A;  1VQ5 I;  2Z33 A;  2RDP A;  1KQ8 A;  1GVD A;  2JSC A;  3BJA A;  4U87 A;  4A3F J;  1ON1 A;  1IRX A;  5L3B A;  3HBL A;  3TED A;  3HKZ A;  4PJJ A;  3FK7 A;  1YRN A;  1BOB A;  2A05 A;  4HF0 A;  3GTJ J;  3G2B A;  3IAM 2;  5IYB J;  2EIL H;  5DV5 A;  3OYK A;  2R7Z J;  1BC7 C;  2H1L A;  4EGZ A;  3O6B B;  4DZP A;  1VI0 A;  2F5E A;  5IYD J;  2V79 A;  3WTX C;  1POG A;  1X2M A;  2DOF A;  4OAZ A;  4PK4 A;  1P92 A;  3OS2 A;  1KON A;  2HYJ A;  2I5U A;  2XGX A;  1F9N A;  1BR2 A;  3QRF F;  2Y2Z A;  1MSF C;  3S3M A;  1AU7 A;  1G6N A;  1KA8 A;  3KP6 A;  2ZME B;  3FKI J;  1FPQ A;  1Y56 A;  3QPH A;  1FP2 A;  4OOI A;  1X1B A;  3GBG A;  3K70 D;  2ELH A;  5GTI C;  4NBQ A;  1X3Z B;  3BTI A;  2V1N A;  3C1D A;  4LIV A;  1ZTR A;  4BL0 B;  3RKX A;  3HC7 A;  2FMY A;  5DUK A;  1FY7 A;  3HOS A;  2QEN A;  4C3J J;  4CH7 A;  2O03 A;  2NVQ J;  2E36 A;  2K4B A;  2O8K A;  3F9K A;  3OOU A;  4XN0 A;  5FB2 A;  3I71 A;  2FE3 A;  3QU6 A;  3JTH A;  1SFE A;  1ZR2 A;  2XAU A;  5E3L A;  5DYM A;  3ZMD A;  3H92 A;  2STT A;  1IXS B;  4B44 A;  4AIJ A;  3ZR8 X;  2IS1 A;  5EEG A;  3HB9 A;  2R7X A;  3L9F A;  4LIT A;  2IGM A;  2L4M A;  3ABL H;  4UUT A;  3F6O A;  4D7N A;  3GFL A;  2PJR B;  4F92 B;  1U8R A;  1R22 A;  1S6L A;  2EIN H;  3I64 A;  1GDT A;  5KAF C;  4E7J A;  4P9U A;  1YRN B;  1ETW A;  2E5N A;  1FOY A;  4BGD A;  4P1W A;  1YW9 A;  2FEZ A;  2YSR A;  1AKH B;  4B48 A;  3MD2 A;  4FQG A;  1SAN A;  2LBF B;  2V1X A;  2JVH A;  4CCK A;  3IWF A;  5EGO A;  3DKX A;  3KEY A;  2BY0 A;  3TO7 A;  2FBK A;  4GYI A;  3CDI A;  3CJQ B;  1RRJ A;  3CF2 A;  3BRO A;  3GUD A;  4XON A;  1B4A A;  3WTS C;  3BT9 A;  3K9T A;  2STW A;  4F3Q A;  4IRI A;  4GRI A;  4UUS A;  2W84 A;  2IGO A;  4L9T A;  4RGS A;  2F5D A;  1E0E A;  3IUO A;  5M5W J;  4IX7 A;  2BEO A;  4UXN A;  2E2J J;  2YX4 A;  5J3L A;  3MAJ A;  4L9N A;  2W1O A;  3ABU A;  5ILV A;  5IYC J;  1FC3 A;  1I5Z A;  2XAQ A;  2R7W A;  2JSP A;  1Y8R B;  1W36 C;  3CME I;  1BBY A;  4HX7 A;  4D9J A;  5JFR A;  1EH6 A;  3P7N A;  1IAW A;  1HW2 A;  1CF7 A;  1MBF A;  4X6A J;  2OBP A;  1UAA A;  4KJZ A;  3TW7 A;  4HBL A;  3S1Q J;  2DOD A;  3J7Y J;  3FWE A;  3PM1 A;  3S2H J;  4I02 A;  3HSR A;  2X6Y A;  2L3D A;  3D1N I;  4PJL A;  2R7V A;  1VTN C;  1ZLJ A;  1ZRE A;  2V4J C;  3OYN A;  3A03 A;  3HOZ J;  3ZMZ A;  2PJR A;  4BKX A;  2M4G A;  2W4S A;  1GV2 A;  2GIZ A;  1VQO I;  3M3Y J;  3DTK A;  2V7F A;  3RPU A;  2VXZ A;  4G94 A;  2HNH A;  2H94 A;  4ZYA A;  3WTT C;  3I3L A;  4RAZ A;  3DLL F;  3K4N A;  5GTH C;  3AL0 C;  4OIP F;  1YJW I;  1SD4 A;  1U9N A;  3GTK J;  2E1M C;  2JA5 J;  5J8C A;  1YIT I;  1XD7 A;  3L2Q A;  4N0B A;  1XSD A;  3CUQ C;  3PO3 J;  3LSM A;  3F8C A;  4FE7 A;  2K3F A;  5DS9 A;  4ENK A;  4R79 A;  3KP7 A;  1YJN I;  2ESN A;  4KDP A;  4G12 A;  1FYL A;  2OQR A;  4XLN F;  5HOD A;  1OCZ H;  2DN0 A;  4RAY A;  3T8R A;  5JI6 A;  2Z5U A;  2ME0 A;  3R0J A;  2Y0S A;  3M1C A;  2ME6 A;  3KP4 A;  2COM A;  4I01 A;  3C7J A;  2Z1D A;  3L1P A;  3LAJ A;  1X2N A;  2Y0S N;  5J8F A;  1FMW A;  2ZXI A;  4A2U A;  1H0M A;  2W25 A;  2AO9 A;  2OTL I;  3LQR A;  1ZQ3 P;  2GOM A;  2EIM H;  4NHJ A;  2PG4 A;  2VJ4 A;  2ZCW A;  4DBR A;  4OMY A;  2Y30 A;  3COA C;  2LNB A;  2QKL B;  2QSF X;  5L3F A;  1U8B A;  4MQ9 F;  4NQW A;  2LLK A;  1IUY A;  3W6J B;  1LDJ A;  3PIO F;  2K86 A;  3KFW X;  2WAD A;  2LC2 A;  2CV1 A;  4IQJ A;  2VKD A;  3QOD A;  4BY1 J;  2LRE A;  3SFZ A;  1B8I B;  2M87 A;  1UHW A;  3QYB A;  1QGP A;  2P4W A;  4HSR A;  3R0A A;  3ABT A;  4M73 A;  2R7R A;  1K4T A;  4Q4Z F;  1PJR A;  3PQJ A;  2OA4 A;  3BCB A;  2ZJ2 A;  3WGG A;  4AD9 A;  1LDD A;  2BZT A;  1NK2 P;  1QA6 A;  2F6C A;  4A93 J;  2RQP A;  3WGH A;  3U2R A;  4BBS J;  1B9N A;  2OCC H;  3CCQ I;  4LG0 B;  4BYY A;  1TNS A;  3FXR A;  3NAU A;  5TIS C;  2TDX A;  3S3O A;  2QF7 A;  1EF4 A;  5JVT A;  4KT6 A;  2H27 A;  4Q48 A;  5EDN A;  1QHH D;  3MZ8 A;  2VE8 A;  5D5X B;  2MW8 A;  2QBY B;  4G7O F;  1GUU A;  3GWZ A;  1ON2 A;  3SDG A;  4G6T B;  2FQ3 A;  2EH3 A;  4BS9 A;  1MH4 A;  4A5N A;  1IRZ A;  4I98 B;  4AIH A;  1R23 A;  4YIR X;  3JRH A;  1V5G A;  2DA3 A;  3MMY B;  2LF8 A;  3IC7 A;  3VSK A;  2NXN B;  1HF0 A;  3SHF A;  1OYW A;  2XAJ A;  1RPW A;  2O61 A;  1RNL A;  3I4P A;  4YFX F;  2KJB A;  3DTE A;  1RUN A;  3B73 A;  2ZJQ F;  3KX2 A;  4MLO A;  1IXR C;  2ECB A;  1ZGA A;  2L7F P;  4HPQ A;  2EIK H;  2AS5 F;  1WZ2 A;  2H6C A;  5F04 A;  3BLY A;  2BBY A;  1IDY A;  2NNN A;  3O8G A;  3SJM A;  3GEZ A;  3G1L A;  3HPG A;  4NQW B;  1NG7 A;  2DMQ A;  2Y75 A;  4GO1 A;  3HL2 A;  3CES A;  2EFP A;  3S8P A;  3IRQ A;  2I10 A;  4HW0 A;  3TOA A;  2UXX A;  2E7X A;  2VBY A;  4QLC U;  2QA4 I;  4ENM A;  1XDU A;  2E71 A;  3W2W A;  1SMY F;  2NS7 A;  1RR7 A;  1K78 A;  1JUP A;  5E3M A;  5HS8 A;  3PSF A;  4W97 A;  2OAZ A;  3ZQQ A;  5LBQ A;  2EA4 A;  2KIM A;  2L5Q A;  2PX9 A;  5FO5 A;  3VOE A;  1G3T A;  2IGN A;  3GVA A;  3CC4 I;  1S7O A;  4ITV A;  1I50 J;  2WV1 A;  1IZ1 A;  2XSJ C;  3A1Y A;  3OIO A;  4A3E J;  3OL4 A;  5E1W A;  2NVT J;  2GXA A;  3V8K A;  4GYG A;  1V5E A;  1TL8 A;  5F1J A;  1YX5 A;  4FT8 A;  3H36 A;  3FXM A;  4FCY A;  2VKV A;  1IRF A;  1X3U A;  2DXI A;  3KYL A;  3OV8 A;  3RQI A;  4ESJ A;  1S72 I;  3KEQ A;  3CCL I;  1QPM A;  5E79 C;  3U21 A;  4B3X A;  2RQQ A;  4CSW A;  3PJR A;  1P7J A;  2EPF A;  4NC6 A;  4IOA F;  3M8E A;  5A2Q K;  2DFF A;  1OCR H;  2QEX I;  2R5Y B;  3TDZ C;  1WHU A;  3OYH A;  3D5L A;  1X1C A;  3AL0 B;  2DJN A;  1APL C;  4CYC B;  4WK8 F;  3MKY B;  4RAG A;  3FXJ A;  1FYM A;  3TQN A;  2DCE A;  3S32 A;  3WG9 A;  3BTC A;  3HRU A;  5FRM A;  2DMN A;  3DPU A;  3S16 J;  3FMS A;  4NC7 A;  5LLQ A;  4G8X A;  2YUS A;  9ANT A;  3A0B C;  2D5V A;  4AYB A;  5KHD A;  1ZH5 A;  1XG1 A;  5E8G A;  5D4S A;  4D5C A;  1WVR A;  3RKW A;  1YJ9 I;  1J09 A;  3JRA A;  2WTE A;  5B1A H;  1ETQ A;  2BY1 A;  1X19 A;  4HST A;  3LSG A;  3CP2 A;  1AHD P;  2XIG A;  1DU6 A;  3V7S A;  5B66 C;  3C18 A;  1ETO A;  3RKY A;  3AG1 H;  2MFZ A;  1WJF A;  3FXO A;  3OYB A;  5FRN A;  2HOT A;  2VQC A;  2A61 A;  2FML A;  5HNH A;  1E3P A;  3QP5 A;  4QTR A;  4AUX A;  4WXD A;  3I4N J;  4BHP A;  3RPU D;  4U7D A;  1ETK A;  2CRG A;  1HDD C;  3J80 K;  1JGS A;  3JTG A;  3K4B A;  1J2X A;  1V4R A;  2X0L A;  5HS9 A;  4QIW N;  2EZL A;  4II2 A;  2NOJ B;  2JPC A;  3R4K A;  1QZZ A;  2E5Z A;  1MNM C;  1I3A A;  3HOW J;  4KIG A;  3ZQH A;  4MQV A;  1ETX A;  2VPL A;  2GA1 A;  3CUQ A;  3DTI A;  5AON A;  2A3S A;  1R36 A;  2G9W A;  5EEH A;  4LIU A;  1FTZ A;  1EJ9 A;  4HQE A;  3CDH A;  4N9I A;  3MZY A;  4LGW A;  4LLG F;  4KIT B;  3UKG A;  2DOE A;  1IO2 A;  4IEJ A;  5ICE A;  1GT0 C;  4TV7 A;  2XRL A;  2KJC A;  5BS6 A;  3GZN B;  3ZMV A;  3BZC A;  3ASO H;  1OMI A;  2QM3 A;  3EET A;  1A36 A;  1R4M B;  4BQO A;  1W5S A;  5BPI A;  2PMZ N;  1VF9 A;  1Z7U A;  4PGH A;  1W7P A;  3DLA A;  4AWX B;  1G4D A;  3S1N J;  2B7E A;  4DYC A;  3GTQ J;  3VEP A;  4UUV A;  4N4O B;  1IGN A;  3BR0 A;  4UVB A;  2EQR A;  1UMQ A;  1EH7 A;  1WH7 A;  1BI2 A;  3I58 A;  4LG0 A;  3EQL F;  3FXK A;  2Y69 H;  4PUS A;  4ZC3 A;  3TO6 A;  2UZK A;  2R7U A;  2J5O A;  1SFX A;  3W3C A;  2BV6 A;  4XMY A;  5FKM A;  5CQE A;  4IHY A;  4UV8 A;  2QYO A;  4CXF A;  2IS4 A;  2VAS A;  1OYI A;  4DZJ A;  4YEJ A;  3ZQG A;  1PP7 U;  3PIP F;  4AVZ A;  4C3H J;  5LGU A;  1O3S A;  5C3E J;  3E97 A;  4KMU X;  5CPR B;  3GCM A;  3H5N A;  4ZYG A;  1E17 A;  5DUI A;  2KT0 A;  3CQZ J;  3ZRG A;  1R1U A;  3AG4 H;  3ZQC A;  2XKO A;  3PUF A;  1JKQ C;  2WAF A;  5L3D A;  2ELK A;  5KVR A;  2ZB9 A;  3FDY A;  2MBF A;  2M0C A;  1G59 A;  5BOX A;  2XDV A;  4PZJ A;  3W2V A;  2EFO A;  4LD5 A;  3QAH A;  2ESH A;  3WG7 H;  4BUP A;  1ETY A;  2O7O A;  3SEZ A;  3CO6 C;  1ENH A;  3S3N A;  1E3O C;  3KPH A;  2P0W A;  3LFU A;  4M6Y A;  1R5H A;  2A6E F;  5JLX A;  5B1B H;  1YW7 A;  1T33 A;  2EB7 A;  2N8G A;  3QYE A;  4I09 A;  1LFB A;  1SAU A;  4XOP A;  2M7B A;  3BJO A;  4AID A;  2FJ1 A;  1YTY A;  3VPR A;  5IP7 J;  3LST A;  2ECC A;  1DPU A;  5GPC A;  3RQ4 A;  4Y7N J;  1HKT A;  2V1D A;  3BR1 A;  1IV6 A;  1VQ4 I;  1I3Q J;  2JT1 A;  3EUH C;  3WTZ A;  1JHH A;  3QWL A;  2KQR A;  1DPR A;  3I59 B;  2F2E A;  2H8W A;  1KZH A;  5HNF A;  3W2A A;  1QNT A;  3ZMU A;  3FMR A;  3BQY A;  5F0H A;  3FKJ A;  3I55 I;  2HTJ A;  4DW6 A;  2DMP A;  4O3M A;  1LJ9 A;  3JCU C;  4BQN A;  4QSH A;  4WX9 A;  3WE3 A;  1W36 D;  4D5F A;  1RR8 C;  2GLO A;  2HU9 A;  2G0E A;  5F6F A;  3TGN A;  1N75 A;  2VBZ A;  3NWS A;  2DK8 A;  4Y3O A;  1WWX A;  1XCV A;  4M3G A;  5J4V A;  4J19 A;  1JE8 A;  2IS6 A;  2LKS A;  1MMD A;  5K5Q A;  2P81 A;  1RUO A;  5HOO A;  2MC4 A;  1FOK A;  3F3X A;  1TNT A;  3LSP A;  3GFI A;  3M4O J;  3JAM K;  1ZRC A;  3DXJ F;  2P5L C;  4MFE A;  3ULQ B;  3I4M J;  3CMM A;  2XB0 X;  2Z9O A;  1U5T A;  4BAY A;  3AG3 H;  3E6C C;  1IG7 A;  2X6O A;  3TDU C;  5DD4 A;  2FBI A;  2CJJ A;  1R4N B;  4BHC A;  2ISZ A;  2X6X A;  2K5C A;  1WSU A;  3VYT B;  2JA8 J;  2EFQ A;  3BPX A;  2Q8K A;  3A2K A;  2MLG A;  4MO7 A;  1G8X A;  2AQE A;  2DT5 A;  3DQV C;  3HUG A;  4HQM A;  4V19 K;  3LFK A;  1HW1 A;  4RLQ A;  4S04 A;  2LY1 A;  2IJL A;  1HXD A;  1YIJ I;  1VQN I;  1TQM A;  2XGC A;  1AKH A;  3FXQ A;  1BM9 A;  1ULY A;  2OF7 A;  3HXL A;  4ANJ A;  1SD6 A;  1ZYR F;  2YX7 A;  4XLE A;  2VJJ A;  1OPC A;  3T0Y A;  1WJB A;  1ETV A;  2P6S A;  4BH9 A;  1UEL B;  1MD0 A;  1X4O A;  2E19 A;  1FWZ A;  1Z91 A;  1Z9C A;  4BE0 A;  3SDB A;  4FE4 A;  5K5R A;  1FTT A;  3ABM H;  3KEO A;  1VQM I;  2VI6 A;  1RET A;  4E7H A;  1YYV A;  4JK1 X;  3VWB A;  3BR3 A;  5CKT A;  4CZZ A;  4XQF A;  5LEK A;  2Q0O A;  3DEW A;  2R7F A;  3R60 A;  1YQA A;  3CUQ B;  4E4H A;  4L18 B;  4IRG A;  3BWG A;  4RLF A;  2PBI A;  3P9K A;  3VSL A;  1FMV A;  2M2E A;  5D5V B;  1R5G A;  3RI4 A;  1REP C;  3RKQ A;  3TMO A;  1ZGW A;  1GVJ A;  2VC1 A;  3H0G J;  5EYR A;  3J81 K;  2J5P A;  3HOV J;  1R71 A;  4WCG A;  2X4H A;  3ABK H;  4XL9 A;  2XF5 A;  3DPT A;  3DBL B;  5EG0 B;  3WTV C;  4J00 A;  3DCF A;  3DU5 A;  1BN5 A;  3ML6 A;  2K9N A;  3RYP A;  3WTY C;  2XSD C;  5EF6 A;  3HM5 A;  2OPT A;  3CCS I;  1ZGJ A;  1VQP I;  4P5O A;  1E3H A;  2EV6 A;  3IV5 A;  4QWQ A;  2X51 A;  3EYI A;  2RN7 A;  3J81 Z;  3R61 A;  2XHK A;  4I0A A;  1XSV A;  2GWR A;  2VUM J;  1ACI A;  1R49 A;  3LL7 A;  5C4X J;  1X58 A;  3MN2 A;  1T98 A;  3GLL A;  3HSE A;  4BU2 A;  2VE9 A;  2V9V A;  3K0L A;  1YO5 C;  2CV0 A;  1LEA A;  5D8K B;  2OJE D;  3F22 A;  2ZO4 A;  4XIC A;  1X1D A;  1FP1 D;  4JP0 A;  1W5C C;  4L0Z B;  2ICW G;  3Q3S A;  5J6X A;  4WWC A;  2M7A A;  2E2H J;  2JWT A;  3J7Z I;  1STZ A;  1LKX A;  4M72 A;  3KYC B;  4JOM A;  3UR3 C;  4KYW A;  2WY7 Q;  1FIA A;  2IVM A;  2RNG A;  3VYU B;  3DEE A;  2PMH A;  3LAP A;  2YS9 A;  3C3W A;  3Q0V A;  2KHM A;  1FSH A;  2QCO A;  3DBH B;  3G1M A;  3JW4 A;  4EV0 A;  1IW7 F;  1UHM A;  1JKO C;  2XAG A;  3I9V 2;  4BDY A;  2TRT A;  5ICF A;  4MHG A;  5D6F A;  5KK1 A;  5IOY A;  4UY8 I;  4RM2 A;  3TL4 X;  2ADU A;  2E34 A;  1V3F A;  5E8I A;  2MSY A;  3GW2 A;  1I39 A;  1A04 A;  4IJA A;  2KFD A;  4HA8 A;  2FRH A;  3ROU A;  3QPS A;  5DCF A;  3F8N A;  1FOW A;  5ERI A;  2NAZ A;  1BOA A;  1JXS A;  2DYS H;  1Y0N A;  1TWA J;  4GFB A;  1DGW Y;  4L5E A;  3C2B A;  3BOQ A;  1WJ5 A;  3PNT A;  4R1H A;  3CCM I;  2VOP A;  1OR7 C;  1FOX A;  1A35 A;  2A5W A;  2KP6 A;  1P2F A;  1TWF J;  4KN7 X;  4QPO A;  3L09 A;  2RGV A;  2CW0 F;  2R5Z B;  1TT0 A;  4CIC A;  3CCY A;  4A3B J;  5D4R A;  2LTP A;  2DDB A;  4LFU A;  3O2P E;  3W6V A;  1N78 A;  5E1Z B;  5FD5 A;  1P9Q C;  1VQ7 I;  1BA5 A;  3NAR A;  2KIQ A;  1XSX A;  4B1R A;  2CQQ A;  3OWT A;  3KLN A;  3CZ6 A;  1D3Y A;  1R6R A;  3L2C A;  2VJI A;  5E3O A;  2HGC A;  3RZD J;  2FOK A;  2NYX A;  3H0D A;  2B0L A;  3LSK A;  1R58 A;  2ZME C;  1MJ9 A;  2ZBK A;  3RDI A;  3S17 J;  1JUM A;  3ESW B;  3FM5 A;  4EM2 A;  2OZ6 A;  1TP4 A;  2Y31 A;  1V5F A;  5K1Y A;  4IHW A;  2VKH A;  4LK1 F;  3OOP A;  4EJO A;  4CUG A;  2W82 A;  3KZY A;  3I59 A;  2DT6 A;  2K40 A;  3TBI A;  3WHB A;  3HG9 A;  5DDG A;  1WPK A;  2DA7 A;  1QU3 A;  2Z3Y A;  3F21 A;  4IVN A;  3F0C A;  2VN2 A;  2IS2 A;  4ON0 A;  1W4M A;  1NG6 A;  2E7W A;  2WWY A;  2HZT A;  1LFP A;  4A3J J;  2K02 A;  2XUB A;  3JRI A;  2IEK A;  4EJW A;  4E7Z A;  2VL8 A;  2ZC2 A;  1Z0X A;  3GYH X;  4KMF A;  2Z16 A;  3D5R C;  2LOO A;  2X1E A;  3R6S A;  1LPQ A;  1K6O A;  2BXY A;  2CQK A;  4XK4 A;  3WE2 A;  1PUE E;  1S29 A;  1DP7 P;  2H09 A;  3DKW A;  5CYV A;  2VQL A;  2QQA A;  4FTH A;  4BE2 A;  2UV1 A;  2JPB A;  1ZAR A;  4I76 A;  3VOD A;  4E7S A;  2ZJP F;  1XN7 A;  1WJC A;  2M45 A;  4YFN F;  4IL6 C;  4RB3 C;  3BJ6 A;  4N4N B;  2YR2 A;  4ABZ A;  1O7F A;  2CUJ A;  5E1X A;  1A6Q A;  3A01 A;  3F8F A;  4Z6Y A;  1HSJ A;  2LKX A;  2LMD A;  3TW6 A;  4U0Y A;  1T0F C;  3A4C A;  4JQF A;  4PFO A;  5TJJ A;  1JGG A;  1OFC X;  2DK5 A;  2XAS A;  1AWC A;  5GP9 A;  2IXS A;  1UST A;  2OTJ I;  2L9S A;  3DBR B;  1QO0 D;  3CCE I;  3LSI A;  1YFH A;  5FD6 A;  2DYR H;  5JR3 A;  3P9I A;  4EM1 A;  2DTZ A;  4OWR B;  4BXU A;  4A3D J;  4KFC A;  1Z6R A;  2ZFW A;  1UG0 A;  4NNJ A;  3QOP A;  5B3S H;  2CUE A;  3DKY A;  4FIS A;  3WHC A;  5J1R A;  1WCM J;  1W7P D;  3OYJ A;  1CF7 B;  2ISY A;  3F23 A;  4P96 A;  4RAF A;  1K79 A;  1H9T A;  1XGN A;  5IP6 A;  2QUF A;  5KAI C;  5J40 A;  3REO A;  3RJP A;  4AM3 A;  2JA6 J;  4M9Z A;  4XLA A;  2I8D A;  2NS0 A;  4PSX A;  1JTY A;  1S5L C;  3MZH A;  2R7T A;  3T1B A;  4A0Z A;  2QVO A;  2FD5 A;  4H4K C;  3LA3 A;  2W00 A;  3IHU A;  1IV8 A;  1X3W B;  4DYQ A;  2OQG A;  2FNA A;  3WU1 B;  2EV5 A;  2OCE A;  2P7V B;  2O0Y A;  1S3J A;  3KP3 A;  3OYC A;  5F08 A;  4ZYD A;  2Y9Z A;  3JR9 A;  2FF4 A;  1U0J A;  4N9H A;  1YX3 A;  3E3V A;  1F5T A;  3IWZ A;  4CZC A;  3D0S A;  2M4K A;  5EZH A;  1K4S A;  1H9G A;  4ZDO A;  2KZV A;  3PNY A;  4Y33 A;  3LOC A;  1YLF A;  4C2M J;  2Y9Y A;  4XRS G;  5TGT A;  2AXL A;  5M3M J;  2KIU A;  1RZ4 A;  2EFN A;  3ZPL A;  5ICC A;  1TQP A;  2M3A A;  5CVI A;  2VKE A;  2JTV A;  2LR8 A;  5DEQ A;  2MC3 A;  2LRD A;  4A6D A;  3KIO A;  2GQQ A;  4ESB A;  2XAF A;  4B09 A;  2XC7 A;  4HLX A;  1LE8 A;  2EZK A;  2W24 A;  2MA3 A;  3LQQ A;  2V9K A;  1UZC A;  4AVP A;  1HKS A;  2KRC A;  4E70 A;  1XTA A;  1K7A A;  4B43 A;  3S15 J;  1W0T A;  5FKK A;  1Y0U A;  3RPQ A;  5F64 A;  1JKP C;  2D45 A;  1WGX A;  1RI7 A;  1OCT C;  2ZXH A;  2X6W A;  3ZQ7 A;  1Y1W J;  2MGQ A;  3V7C A;  3TO9 A;  2NVY J;  4FHT A;  1ODD A;  4I6Z A;  3HRT A;  4M3B A;  2ZFU A;  4CO8 A;  5FJ8 J;  2HFH A;  4FX0 A;  3CTA A;  5IT9 Z;  1RC9 A;  2WB1 A;  4B3A A;  3Q9V A;  1ONV A;  2F5C A;  3FBI B;  1UB9 A;  2XGE A;  4F7Z A;  2M34 A;  3FHN A;  3EUK L;  4BQQ A;  2LH9 A;  2D1V A;  3LA2 A;  1JHF A;  5EGO B;  3QPL A;  3H1C A;  4GDF A;  2RNJ A;  5HLG A;  1T2K A;  2DQL A;  1FSE A;  1LUJ B;  4IHS A;  1XMX A;  1ZEL A;  3LNQ A;  4RA2 A;  4ESF A;  3QPT A;  1F1Z A;  1D0Y A;  3VB2 A;  2Z2S B;  1J0R A;  2DA5 A;  4YIF A;  3M8J A;  3CLQ A;  1IC8 A;  2DQR A;  3FM3 A;  4M71 A;  3E6D A;  2BOL A;  5DM7 F;  3N97 A;  2E1M B;  5J4Y A;  3H3U A;  4HF1 A;  3BCA A;  2Y0M A;  3RCO A;  4FAS D;  1VND A;  4Y15 A;  1O3T A;  1I1G A;  1JT0 A;  5K7Z A;  2CWE A;  4EQQ A;  1OCO H;  2ZNZ A;  4MNU A;  1SC7 A;  3QOE A;  3FXL A;  3HHG A;  4C30 A;  4XLP F;  1JUS A;  1NK3 P;  4NDL A;  3Q9S A;  4A12 A;  1LVK A;  2FOW A;  1VQ8 I;  5GAG J;  1SFO J;  4CCL A;  1BJZ A;  2ZSI B;  1MBH A;  1FLI A;  3KE2 A;  2EJR A;  3JSP A;  3F8B A;  1IJW C;  5GAD J;  1MDM B;  3CJN A;  2M8E A;  5B5E C;  3IRR A;  4OMZ A;  1IXC A;  4P9F A;  2DLL A;  1B1B A;  1BI0 A;  2ZME A;  1T0F A;  1I1S A;  2VJ5 A;  2CUF A;  1JI8 A;  1MW7 A;  3U1D A;  4HNU A;  5D5W B;  4KN4 X;  2EA2 A;  4I2O A;  3OYI A;  3HSF A;  4IZZ A;  1I6H J;  1HCR A;  5EZG A;  4CCN A;  3A01 B;  3ZGK A;  2QWW A;  4Q5S F;  2LDU A;  4G7Z F;  2PFB A;  1TWG J;  2NVX J;  1S7E A;  5L3E A;  3BG7 A;  1Y39 A;  4YFK F;  1QZE A;  2V1U A;  4UV9 A;  4E7I A;  4UNO A;  1HKQ A;  2BXZ A;  2G7U A;  1D1B A;  3L00 A;  4RMN A;  4KNY A;  1BW5 A;  1R1V A;  1T95 A;  4LB6 B;  2F4O B;  2DA2 A;  4B47 A;  3MKZ A;  2CQ7 A;  4RBO A;  1I6X A;  1MMN A;  2L2O A;  3HOX J;  2H1K A;  2CMP A;  2XPU A;  2LBF A;  3CCU I;  1RKW A;  2LG4 A;  2AQF A;  2YU3 A;  5DCM A;  3L2R A;  1W5T A;  4IRH A;  4D0P A;  1KU3 A;  3MKL A;  3ZCO A;  1L3L A;  3NQO A;  1O3R A;  2JMW A;  3PO2 J;  4PGG A;  1HST A;  1KYZ A;  4Q47 A;  2IGK A;  4CHU A;  3KYD B;  2P5K A;  3I54 A;  2VXD A;  2HQ5 A;  1R9T J;  4OIO F;  2FUG 2;  3K4M A;  2M9H A;  2HYG D;  3SXY A;  1A5J A;  3E6M A;  5HLT A;  1O7L A;  2XVC A;  2PJP A;  1DU0 A;  2F5F A;  4MEY F;  4PJM A;  3U1K A;  4DYR A;  1TT5 B;  1FIP A;  2WAE A;  5E17 F;  2KL4 A;  1FYK A;  1J7K A;  5J1Y A;  4OU0 A;  3JRB A;  2O8X A;  3K4J A;  1XPX A;  2HWV A;  2IAI A;  2K9M A;  2DI3 A;  4CA0 A;  1J59 A;  1QBJ A;  1WI9 A;  1TBX A;  2E2I J;  2JA7 J;  5IP9 J;  1YHQ I;  2FNP A;  3SZT A;  3E7L A;  4U7B A;  2B9S A;  1MBG A;  2FU4 A;  5F1R A;  1U5T B;  2QLZ A;  1HQC A;  3H5A A;  2O6G E;  1WQ2 A;  2CFO A;  3QQA A;  1IUF A;  4BJT A;  2CQN A;  4IKF A;  4CCJ A;  1GV5 A;  1XX5 A;  5HLH A;  3MWM A;  2ETH A;  4WXC A;  1KQ0 A;  1MJB A;  2E1O A;  3P9C A;  3G71 I;  1B8I A;  1SD7 A;  1MMA A;  3IL2 A;  1G3Y A;  4EJU A;  3HTS B;  1LNW A;  2BY3 A;  2R7S A;  1U78 A;  1S9H A;  5AIP A;  1LQ1 A;  3AAF A;  1ZLK A;  2K85 A;  3E5X A;  1V55 H;  1XMK A;  4D7M A;  1Z1D A;  3ZXS A;  1FZP B;  5FLV A;  1SAX A;  4A5M A;  1HDP A;  3W6K B;  5DTD A;  4JX4 A;  2GM4 A;  3OYA A;  4AC0 A;  4JBA A;  1DUX C;  3QP6 A;  2FSW A;  2WV0 A;  3NEU A;  3ISP A;  4NC8 A;  3HOT A;  4LJZ F;  1OCP A;  1Y6I A;  2CV2 A;  1WKM A;  3JRD A;  2WA0 A;  4EJT A;  2UUZ A;  4LMY A;  1TWC J;  5GAH J;  3NRV A;  3AKZ A;  3FHZ A;  2MYS A;  3GTM J;  4CDG A;  4PDK A;  1OYY A;  1J9I A;  4ZZD A;  1FX7 A;  5CVR A;  1B72 A;  4G7H F;  1MND A;  2OZU A;  4ZDP A;  1DQU A;  3SYT A;  2VBX A;  3OSG A;  2CUZ A;  3F8M A;  3FXU A;  3BR5 A;  5L3G A;  3BP8 A;  2OUM A;  4CYC A;  3HRM A;  5HDG A;  4HRI A;  1EA3 A;  1UG2 A;  1P6R A;  2EK5 A;  5FGM A;  1X4P A;  3NWT A;  2AHQ A;  1MBJ A;  3O3K A;  2XAH A;  3CC2 I;  3ZQL A;  2W48 A;  4RS8 A;  3IH3 A; 
#chains in the Genus database with same CATH homology
 3SFI A;  2COB A;  3ZQF A;  4IHX A;  1JJ6 C;  2ID3 A;  1TWF J;  2L7Z A;  2FQ4 A;  2R5Z B;  3CCY A;  4MLO A;  2ECB A;  4A3B J;  2LTP A;  4A3G J;  2L7F P;  3A02 A;  3W6V A;  5F04 A;  1BA5 A;  2LD5 A;  3GTL J;  2NS8 A;  3NAR A;  1IDY A;  2DA6 A;  3O8G A;  4B1R A;  3G1L A;  3SJM A;  4EEF G;  2CQQ A;  5J1U A;  2DMQ A;  1W0U A;  1OJL A;  5E3O A;  2I10 A;  3BTJ A;  3RZD J;  4XID A;  4HNV A;  2MG4 A;  3HOU J;  3S17 J;  1JUM A;  3JRF A;  2NS7 A;  3FK6 A;  1RR7 A;  1JUP A;  2Y31 A;  3GTG J;  2VPR A;  3JRC A;  4IHW A;  5E3M A;  1JT6 A;  4W97 A;  2K40 A;  3WHB A;  1WPK A;  1XS9 A;  2DA7 A;  5F0F A;  3HKZ N;  1B72 B;  3S2D J;  3F0C A;  5C4J J;  1I50 J;  3BG5 A;  2WV1 A;  3JRE A;  3OIO A;  4A3E J;  1PUF B;  1MSE C;  1F43 A;  3OSF A;  3K7A J;  3HDD A;  2NVT J;  4A3J J;  2X48 A;  3JRI A;  2B63 J;  2IEK A;  5F1J A;  1BW6 A;  3B6C A;  1Z0X A;  2RAE A;  1H8A C;  4FCY A;  2VKV A;  4XK4 A;  3RQI A;  4BBR J;  3LSJ A;  2R0Q C;  4FTH A;  1P7J A;  4B4C A;  1F36 A;  5K7F A;  4A3M J;  2R5Y B;  4I76 A;  3BG3 A;  2GBY A;  2DJN A;  1APL C;  4CYC B;  4JX5 A;  2HI3 A;  4ABZ A;  5M5Y J;  2XPW A;  5IPA A;  1RES A;  3A01 A;  1VFC A;  1HLV A;  3BTC A;  2LFB A;  2DMN A;  3S16 J;  2DMU A;  3ZOB A;  2LKX A;  1CQT A;  2YUS A;  9ANT A;  2D5V A;  3TW6 A;  5M5X J;  2HXI A;  1JGG A;  5FKL A;  1XG1 A;  2R92 J;  1OFC X;  4D5C A;  2R93 J;  5GP9 A;  3TP0 A;  3JRA A;  1ETQ A;  4MIM A;  1ITY A;  2EZI A;  1HOM A;  3HGY A;  3LSG A;  2DTZ A;  1AHD P;  1DU6 A;  5FKN A;  1ETO A;  4A3D J;  4X1E A;  2HDD A;  2HOT A;  3HEF A;  2LVS A;  3O8H A;  2CUE A;  4FIS A;  5J1R A;  3WHC A;  1IDZ A;  1A6I A;  3G1O A;  1WCM J;  4Y52 J;  2DMT A;  2JN6 A;  4QTR A;  4AUX A;  3I4N J;  5IP6 A;  1ORK A;  2DA1 A;  1ETK A;  1RKT A;  2CRG A;  1HDD C;  5F0C A;  2EBI A;  2JA6 J;  4AYB N;  4JYK A;  4QIW N;  2EZL A;  3RZO J;  1MNM C;  4W1U A;  3Q0U A;  1JTY A;  3HOW J;  3ZQH A;  1ETX A;  2FD5 A;  3BG9 A;  3CDL A;  1Q1V A;  2M8G X;  5FKO A;  4DYQ A;  5M3F J;  2K9Q A;  1JKR C;  1FTZ A;  2R5Y A;  4C3I J;  5F08 A;  4A3I J;  2Y9Z A;  3JR9 A;  3UKG A;  4IEJ A;  1H89 C;  1GT0 C;  2HXO A;  2XRL A;  1K83 J;  2L9R A;  5EZH A;  2O9L A;  4JX6 A;  2CU7 A;  5F27 A;  1ZR4 A;  1G2H A;  1QVU A;  5EG0 A;  1T56 A;  2PMZ N;  1VF9 A;  2WAQ N;  3LOC A;  4C2M J;  3S1N J;  2Y9Y A;  3BR2 A;  4XRS G;  4DYC A;  5M3M J;  3GTQ J;  2YU9 J;  1IGN A;  3BR0 A;  2EQR A;  3S1R J;  1UMQ A;  1WH7 A;  2L0K A;  2VKE A;  3FIS A;  2LR8 A;  4M3E A;  2X9D A;  1QPI A;  1U9O A;  1ZK8 A;  1LE8 A;  2EZK A;  4M3D A;  5FKM A;  4IHY A;  3S15 J;  1LFU P;  1QVT A;  2XGD A;  5FKK A;  1W0T A;  3S14 J;  4DZJ A;  2IBD A;  1JKP C;  1WGX A;  3ZQG A;  1OCT C;  1PUF A;  4BY7 J;  4C3H J;  1WI3 A;  5C3E J;  1H88 C;  1Y1W J;  2MGQ A;  2CQX A;  2KT0 A;  3CQZ J;  2NVY J;  3B6A A;  4A3L J;  2XPV A;  4MFD A;  4I6Z A;  4M3B A;  5FJ8 J;  3IH4 A;  2TCT A;  3ZQC A;  1JKQ C;  1GVD A;  2HOS A;  5E3N A;  4A3F J;  2ELK A;  1FEX A;  4B3A A;  3HBL A;  3TED A;  2ZB9 A;  3FK7 A;  2M0C A;  1YRN A;  2JK3 A;  2XGE A;  2M34 A;  2R5Z A;  4V2G A;  2FX0 A;  5GPA A;  3GTJ J;  5IYB J;  3S1M J;  5EGO B;  1ETY A;  2O7O A;  3QPL A;  2R7Z J;  1ENH A;  1MBK A;  1E3O C;  4DZP A;  1VI0 A;  5IYD J;  1POG A;  1X2M A;  3LNQ A;  5JLX A;  3JRG A;  2N8G A;  1T33 A;  2HYJ A;  5K7H A;  1LFB A;  2FJ1 A;  4LOC A;  2DA5 A;  3VPR A;  5IP7 J;  1IC8 A;  2ECC A;  5GPC A;  2Y2Z A;  4Y7N J;  3BR1 A;  1IV6 A;  1AU7 A;  1I3Q J;  1MSF C;  3MVP A;  3FKI J;  1NTC A;  1VND A;  5FLM J;  3GBG A;  1JT0 A;  3HGG A;  1P7I A;  5K7Z A;  3BTL A;  3BQY A;  3BTI A;  5F0H A;  1ZTR A;  3LSR A;  4DW6 A;  1JUS A;  1NK3 P;  4NDL A;  2DMP A;  4XRS A;  2EZH A;  4QSH A;  4C3J J;  1SFO J;  1BJZ A;  3BR6 A;  1MBH A;  4A3K J;  1LE8 B;  1TC3 C;  4D5F A;  2O8K A;  2NVQ J;  4S0H B;  3OOU A;  1IJW C;  2GLO A;  1ZR2 A;  2G0E A;  5E3L A;  1JJ8 C;  4M3G A;  4J19 A;  3HB9 A;  3Q0W A;  2P81 A;  1Z77 A;  2LK2 A;  4UUT A;  1JTX A;  4D7N A;  2CUF A;  3LSP A;  1GDT A;  3M4O J;  1YRN B;  1ETW A;  4MFE A;  3I4M J;  1I6H J;  2XB0 X;  1HCR A;  1AKH B;  5EZG A;  1BL0 A;  3A01 B;  1Y1V J;  1IG7 A;  1SAN A;  1D5Y A;  3ZQI A;  2X6O A;  1TWG J;  2CJJ A;  1S7E A;  2NVX J;  5EGO A;  1O4X A;  2JA8 J;  1BW5 A;  4MO7 A;  4A69 C;  3BT9 A;  2DA2 A;  4UUS A;  3GTP J;  2XB5 A;  3K2A A;  1FJL A;  3IH2 A;  4RBO A;  2XGC A;  1AKH A;  5M5W J;  3HOX J;  3BQZ A;  5C44 J;  2H1K A;  2OF7 A;  2XPU A;  2LY9 A;  3HOY J;  2E2J J;  1RKW A;  5J3L A;  5IYC J;  1ETV A;  3MKL A;  1XC5 A;  2JMW A;  3PO2 J;  3GTO J;  2E19 A;  1MBF A;  4X6A J;  2HQ5 A;  2JJ7 A;  3TW7 A;  1R9T J;  3S1Q J;  2M9H A;  4XRM A;  4FE4 A;  1A5J A;  4UUS B;  1FTT A;  2KDZ A;  3PM1 A;  4A3C J;  1DU0 A;  2LP0 A;  3S2H J;  2VI6 A;  1RET A;  4DYR A;  3D1N I;  3BR3 A;  4IHV A;  1FIP A;  2HOA A;  3A03 A;  3HOZ J;  3DEW A;  5J1Y A;  1ZKG A;  3JRB A;  2L7M P;  4BKX A;  2IAI A;  1TWH J;  1GV2 A;  3M3Y J;  4BXX J;  2M2E A;  4M3F A;  4M6V A;  2JA7 J;  2E2I J;  5IP9 J;  3RKQ A;  3E7L A;  1ZGW A;  1MBG A;  5IOZ A;  2DA4 A;  3H0G J;  5EYR A;  1QRY A;  3HOV J;  2K9S A;  1U9N A;  3QQA A;  5EG0 B;  1IUF A;  2JA5 J;  3GTK J;  4V2F A;  3DCF A;  3PO3 J;  1GV5 A;  2K9N A;  4FE7 A;  2XSD C;  5EF6 A;  3HM5 A;  2OPT A;  2E1O A;  5DS9 A;  3IV5 A;  5JLW A;  4G12 A;  1B8I A;  3CMY A;  5HOD A;  2DN0 A;  2VUM J;  2ME0 A;  1MBE A;  2NOG A;  1X58 A;  1K61 A;  5C4X J;  2ME6 A;  3MN2 A;  1U78 A;  3L1P A;  1X2N A;  2Y0S N;  4D7M A;  4XIC A;  2AO9 A;  4JP0 A;  1ZQ3 P;  5FLV A;  1HDP A;  2Y30 A;  3Q3S A;  5DTD A;  4JX4 A;  1U8B A;  2GM4 A;  2E2H J;  2JWT A;  4AC0 A;  2LLK A;  1UHS A;  4BY1 J;  1B8I B;  1OCP A;  3JRD A;  1FIA A;  4RDU A;  1MH3 A;  2YS9 A;  1TWC J;  3H3V K;  3Q0V A;  1NK2 P;  2QCO A;  3G1M A;  4A93 J;  3GTM J;  4BBS J;  1JKO C;  5BNG A;  1B72 A;  2TRT A;  3NAU A;  3OSG A;  2ID6 A;  2QF7 A;  2WB1 N;  5IOY A;  1EF4 A;  3BR5 A;  3TP3 A;  5EDN A;  1WH5 A;  2MW8 A;  4CYC A;  1GUU A;  2MSY A;  3SDG A;  1UG2 A;  2EH3 A;  1MH4 A;  1IRZ A;  3QPS A;  3JRH A;  2AHQ A;  1MBJ A;  2DA3 A;  2H8R A;  1HF0 A;  3ZQL A;  5EEA A;  1TWA J;  2W48 A;  1RPW A;  4GFB A;  3IH3 A;  4L5E A;  3FIW A;  3C2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...