1H88C

Crystal structure of ternary protein-dna complex1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h88C03
4AC0A 2PMZN 2HI3A 1Y1WJ 1CQTA 5K7HA 2TCTA 3H0GJ 2DA4A 1NTCA 4JYKA 5FJ8J 2LP0A 1WPKA 1ETOA 2CRGA 3JRFA 4I6ZA 3GTLJ 5FKKA 4A3JJ 3ZQHA 1BW6A 4DYCA 3S1QJ 5BNGA 3BTLA 4FTHA 2K9SA 1ETYA 3M4OJ 2Y0SN 1LFUP 3BTIA 4Y7NJ 3DCFA 3OSGA 2ID6A 3PO3J 3JRIA 4Y52J 4BBRJ 4CYCB 2RAEA 2M2EA 3BR5A 4B1RA 4C2MJ 1SANA 2M8GX 3HBLA 3O8HA 1U8BA 3G1LA 1MSFC 1PUFB 1XS9A 1NK2P 1U9OA 3NAUA 3BG3A 5E3OA 3CDLA 2DA1A 1EF4A 2DA6A 2LK2A 5IP9J 2NVYJ 5IOZA 2XB5A 2EBIA 4X6AJ 2DJNA 1U78A 4B4CA 1G2HA 2EZKA 1DU0A 2ZB9A 3GTPJ 1X2NA 3IV5A 1HDPA 1IGNA 4V2FA 3JR9A 1AKHA 1O4XA 3CQZJ 3HGYA 2X48A 3BR1A 4UUSB 1JKQC 2MSYA 1JTYA 2IAIA 2Y9ZA 2HXOA 2R5ZB 1IDYA 4S0HB 1IV6A 2D5VA 5FLMJ 1ETKA 3S1RJ 4A3FJ 5J1UA 2JJ7A 4M3DA 1R9TJ 1GUUA 2Y30A 3WHCA 2YU9J 3BG5A 1IC8A 1X58A 2H8RA 3K2AA 2O9LA 4MIMA 1W0UA 5HODA 5JLWA 5M3MJ 4A3LJ 3G1MA 3K7AJ 2Y31A 1HF0A 3JRCA 4QIWN 1JUMA 4MO7A 1HLVA 1MBFA 2HXIA 3MVPA 1AHDP 2EQRA 1B72A 3UKGA 2R92J 3H3VK 1MBKA 3BTCA 1JUPA 4JX4A 3B6AA 5E3NA 3JRGA 1JGGA 1QPIA 3BTJA 3HEFA 1I6HJ 1I3QJ 5FKLA 1LE8B 1NK3P 2CUEA 5FKMA 3LSGA 1FJLA 1OCPA 3PM1A 2EZHA 2MGQA 1ETXA 3BR2A 5DTDA 4GFBA 2O8KA 4IHYA 2ME0A 2LVSA 3A01A 2WV1A 5J1YA 3BT9A 3S14J 1JUSA 2VKEA 4V2GA 1X2MA 1ENHA 2VKVA 3A02A 4A69C 4IHXA 3JRBA 2KDZA 1FIAA 3S2DJ 2O7OA 4DW6A 2GM4A 1GV5A 1TC3C 4BBSJ 2HDDA 5IOYA 4W1UA 3SDGA 1JJ8C 5EYRA 5F0CA 1B8IA 2JK3A 4QTRA 5C4JJ 5FLVA 3W6VA 3LNQA 4A3IJ 3GTMJ 4LOCA 3IH4A 5EEAA 2QCOA 3HOZJ 1U9NA 3B6CA 5IP7J 2HOTA 3HOVJ 4IHWA 2XPVA 3FK7A 2YUSA 4B3AA 3Q3SA 3RZOJ 4BXXJ 2M0CA 3TW6A 1ETVA 1APLC 2GBYA 3ZOBA 1MSEC 1JKPC 3GTOJ 1P7IA 4FE4A 2R7ZJ 3MKLA 1A5JA 4DYRA 3GTJJ 2ID3A 1QRYA 4AUXA 4W97A 3ZQGA 2L7FP 4I76A 4UUTA 1POGA 3Q0WA 3VPRA 2VPRA 2LKXA 2K9QA 3ZQIA 4MFDA 5EF6A 3BR3A 3SJMA 3S1MJ 3GTKJ 1GVDA 5M5YJ 3PO2J 1MBGA 2CU7A 3JRAA 5EZGA 1AKHB 2XRLA 1RKTA 3QQAA 1Z0XA 1MNMC 4HNVA 1JKRC 1IG7A 2FX0A 1BA5A 1FIPA 3D1NI 3TP3A 5IP6A 2L7MP 1PUFA 1RESA 2MG4A 2JA7J 5C44J 2OPTA 2WB1N 4M3EA 5F0HA 2ECBA 1GV2A 2WAQN 3IH3A 4FCYA 2QF7A 3HM5A 2X9DA 4FISA 2EZLA 5F0FA 3JREA 2EH3A 5IYCJ 2R93J 5EDNA 3ZQCA 5EZHA 1RR7A 1I50J 2VI6A 1QVTA 3MN2A 2VUMJ 2LY9A 5EGOB 1ZKGA 4M6VA 5FKOA 3HOYJ 4MFEA 5F27A 2AO9A 2DMUA 2R5YB 5EG0A 1WCMJ 3OIOA 1JTXA 3HGGA 1YRNB 4M3GA 1TWCJ 3HB9A 4C3IJ 1RETA 2XPWA 4D5CA 1UMQA 2R5ZA 1BW5A 1ZR4A 1DU6A 1RPWA 3HOUJ 5IYBJ 1LFBA 2NS8A 1TWAJ 1JT6A 4EEFG 2LLKA 3RQIA 2ECCA 4G12A 1IRZA 2NS7A 3OSFA 1FEXA 2IBDA 1IDZA 5J1RA 1VFCA 4D7MA 3GTGJ 4A3CJ 4BKXA 2FD5A 1JJ6C 1XG1A 4JX6A 2NVTJ 2XGCA 3GTQJ 2JA6J 1BJZA 1VI0A 2W48A 4M3FA 3A01B 2HOSA 4D7NA 1E3OC 1RKWA 2CQQA 4JP0A 3I4MJ 3S15J 5DS9A 3DEWA 3S2HJ 2L7ZA 2XGEA 3BQZA 3S16J 2IEKA 3M3YJ 4XK4A 5JLXA 2B63J 2OF7A 4A3GJ 1MBEA 2FJ1A 4RDUA 3S17J 2DMNA 1T56A 3FKIJ 1B8IB 1VNDA 3F0CA 3JRHA 3TP0A 3ZQFA 2FQ4A 2YS9A 5E3LA 2DTZA 1ETWA 3G1OA 5F1JA 1ZR2A 4C3HJ 2COBA 1HOMA 2DMQA 1F36A 1WH5A 1QVUA 3BQYA 2L9RA 2E2IJ 1OJLA 4C3JJ 1AU7A 2DA7A 5C4XJ 1UHSA 5IPAA 1MH4A 2ELKA 5IYDJ 3LSJA 4AYBN 4XICA 1MBJA 2DMPA 3HDDA 1Y1VJ 5C3EJ 2LFBA 2XSDC 4XRSG 3HKZN 4IHVA 3JRDA 3LSPA 2LTPA 2MW8A 4QSHA 3HOWJ 2Y2ZA 2E2HJ 1GT0C 3QPSA 4ABZA 1Q1VA 2LD5A 9ANTA 2X6OA 4XRMA 2DA2A 4XRSA 2JMWA 4IEJA 2KT0A 1Z77A 4A3DJ 2DN0A 1OCTC 2CUFA 4CYCA 1H89C 2DMTA 2ME6A 4DZJA 2JA5J 5FKNA 3L1PA 1MBHA 2E1OA 2G0EA 1WI3A 1S7EA 3FIWA 3HOXJ 1SFOJ 3SFIA 1WH7A 2XB0X 4BY1J 2XPUA 1TWGJ 5K7ZA 3ZQLA 2NVXJ 2TRTA 5M3FJ 4M3BA 2JN6A 4A3BJ 4MLOA 2EZIA 2HOAA 1D5YA 2L0KA 1UG2A 1A6IA 3RZDJ 3OOUA 3NARA 2DA3A 2Y9YA 1F43A 3CCYA 2N8GA 5M5XJ 4D5FA 1K61A 5F08A 1ORKA 2XGDA 1TWFJ 1ETQA 5EG0B 1OFCX 3BR0A 4X1EA 3FISA 2E2JJ 4A3MJ 3C2BA 4UUSA 1FTTA 1TWHJ 2P81A 3BR6A 1GDTA 1P7JA 1HDDC 3S1NJ 2I10A 1B72B 3WHBA 3LSRA 4L5EA 5M5WJ 4FE7A 5J3LA 2JA8J 1ZK8A 3BG9A 3A03A 1ZGWA 1W0TA 5EGOA 2K9NA 3QPLA 1MH3A 2M34A 2NOGA 4DZPA 2R5YA 1HCRA 4A3EJ 1YRNA 4J19A 3TEDA 1WGXA 3IH2A 2LR8A 1IUFA 2CQXA 3CMYA 1T33A 1ZQ3P 2JWTA 4JX5A 4RBOA 1JT0A 4BY7J 4A3KJ 3I4NJ 2H1KA 1JKOC 5E3MA 1K83J 3O8GA 4A93J 5GP9A 3TW7A 5GPAA 4XIDA 5K7FA 1IJWC 2NVQJ 2E19A 4DYQA 2GLOA 3Q0VA 1VF9A 1ZTRA 1LE8A 1ITYA 2DA5A 3FK6A 3E7LA 5GPCA 2AHQA 2HQ5A 2K40A 2HYJA 3RKQA 2R0QC 5F04A 1H8AC 1XC5A 1H88C 2CJJA 1BL0A 2M9HA 3GBGA 3Q0UA 3LOCA 4NDLA 1FTZA
chains in the Genus database with same CATH superfamily
3DLAA 3DU5A 4LG3A 2TCTA 3H0GJ 1YG2A 3V7RA 4JYKA 2ZSIB 1PVEA 3P9KA 4I6ZA 4F91B 2FBKA 2MBFA 2WV0A 2KHMA 2R7SA 3S1QJ 2RKHA 1Z6RA 3KE2A 4P1WA 2V9PA 3ZP5A 2Q0OA 5LBQA 1O3RA 3BROA 1B59A 4CCJA 3KP3A 2OQGA 4XNFA 4CCKA 2MH2A 4XKVA 3BTIA 3BCAA 1EKEA 2BXYA 2WWYA 3LA2A 5AIQA 5HLTA 2ID6A 3PO3J 3JRIA 3QP6A 4Y52J 4GYGA 4CYCB 2RAEA 2M2EA 4RM3A 4G6QA 4U0YA 3C1DA 2VJJA 3AL0B 3CMEI 2M8GX 3CMAI 2HKOA 2EV0A 3BJAA 2XHKA 4LB6B 3L00A 3OYGA 2HOEA 2DCEA 1KQ9A 3OL4A 2LRDA 3LA7A 1E2XA 5BQTA 2VN2A 2DA1A 1EF4A 2LK2A 5IP9J 1Z7LA 5DD8A 1G2HA 3G2BA 2QSFX 2R4GA 2WY8Q 5FD5A 2PJRB 5ICFA 5L3BA 1EH7A 4KMUX 3IV5A 4GGGA 1IGNA 3WU1B 4UY8I 2E1CA 1VQNI 1O4XA 1T98A 1MMSA 3CQZJ 1ZGJA 3M8EA 1R00A 4CHUA 1YW7A 3EDPA 4JQFA 4KIGA 1FOWA 1IUYA 1X1BA 2V79A 2IAIA 2DDAA 3DPLC 4L0YB 1IDYA 4S0HB 1ZG3A 3CCLI 3K4LA 2BY1A 5FLMJ 2NVUB 2H6BA 3S1RJ 1L0OC 2AQFA 1GUUA 2X85A 2IGNA 5FFXA 3ECOA 3KLOA 1YYVA 2DAOA 4HDVA 4HRIA 5GAGJ 4G8XA 1O7FA 5LLQA 2YU3A 4U7BA 1XSDA 3WE2A 2JSCA 3LSMA 4BXFA 4II3A 1X19A 3AKZA 1W0UA 5K5OA 4E7KA 5D8LB 3SZTA 2ZCWA 3LAPA 2Q2EA 3K1NA 4IJAA 3RQ4A 1QGPA 2VL8A 3BP8A 3OWTA 1QA6A 4Y13A 5IT9Z 3P9IA 2BBYA 3KPHA 2Y31A 4L9JA 3FXLA 4QIWN 1IXCA 2R3SA 2KIUA 5JVGF 2YPRA 4P9UA 5LRRA 2HXIA 3CLQA 3MD2A 1AHDP 3G71I 1R4NB 2Z33A 2K7LA 5HLGA 2PMZA 2P7CB 1P2FA 2CW0F 1HW2A 3CESA 3ZCOA 5E20A 1ULYA 1QPIA 1Z91A 3BTJA 1A36A 1K4SA 1I6HJ 1I3QJ 1T0FA 1LE8B 3VYTB 2KJCA 3LSGA 1R58A 4E7IA 1X4PA 1K6OA 2HNHA 2L9SA 3BR2A 1Y8RB 3M7GA 2E71A 3UR3C 4CCLA 1S3JA 3A01A 2Y0SA 4Z2YA 1BOAA 2EB7A 4ANJA 4A69C 1N25A 2W85A 1FIAA 4XMYA 4G7HF 2CW7A 1GV5A 3RYPA 1TC3C 2VBXA 2HDDA 3ZMZA 5TJJA 4D1QA 4G7ZF 2X6XA 3GX4X 1TLHB 5F0CA 1B8IA 2JK3A 4D9JA 2X6YA 3CZ6A 2HVSA 4EJOA 2PQ8A 3LNQA 2DK5A 4QLCU 1XMAA 4A3IJ 1I1SA 1OPCA 2P4WA 4LOCA 3KEYA 1K6YA 2Z2SB 1BR4A 4XQFA 4MTEA 5IP7J 1ERDA 2EIMH 2ZXHA 4IHWA 2XPVA 1VQOI 3RTRA 2M87A 4XKCA 5ILSA 3TW6A 2GBYA 1W5SA 2DO7A 5JVTA 1QHHD 3OY9A 2F4MB 3GTJJ 2FMYA 1I5ZA 2W84A 2WBMA 3K1MA 1QPMA 4U0WA 2HEOA 3GF2A 3ABLH 4W97A 3ZQGA 4BHBA 1STZA 3ZN0A 4I76A 4UUTA 2QKMB 4XN3A 1JGSA 3Q0WA 3VPRA 3K4JA 3WG9A 1OCZH 2EILH 3ZQIA 1D5VA 1T08B 1XCBA 5EF6A 2BV6A 1O3SA 3AL0C 4BDZA 3S1MJ 4GDFA 1GVDA 1YW8A 2XRNA 3I54A 1YE9A 2EIJH 3PO2J 4CICA 1MBGA 1V5FA 1YS6A 2XRLA 4L18B 5AIPA 2FOWA 5CKTA 1VQ4I 1IG7A 3ZN1A 5ILUA 2EFOA 3QPTA 4V19K 4ZYGA 3TP3A 3WG7H 1FLIA 2MA3A 4BEHA 2MG4A 3IKTA 2JA7J 5F0HA 1Z3XA 2KL4A 2WAQN 3EUHC 3IH3A 2GIZA 4BE1A 3I5UA 4N9HA 3KEQA 1FX7A 3QP5A 1VQPI 3D0SA 4LFUA 4BYYA 2XIGA 3E6MA 1T39A 3JTGA 4KISA 1DGRM 3OYCA 1X1AA 1D3YA 1KA8A 1QVTA 2VC1A 2DODA 4BQNA 5DUKA 1BJAA 4M6VA 5FKOA 4BE0A 5CVVA 2GXBA 3H1CA 3N4MA 1WCMJ 4M9ZA 4EATA 3OYAA 3KEOA 4BGDA 4HBLA 3N97A 3D5SC 1BW5A 5DDGA 3HRSA 1R23A 3R0AA 2DPDA 2LY1A 2EINH 2NS8A 1SMTA 1JT6A 2CS3A 2ZBKA 2ZXWH 3ROUA 3NWTA 4EGZA 3OSFA 1LEAA 1FEXA 1HW5A 1G4DA 2RN7A 4D7MA 1Y6IA 1H0MA 1W5CC 2OTLI 2FD5A 2YX7A 4XN0A 5KCMA 1H9GA 1OISA 3JTHA 5EJCA 2GA1A 2VT2A 4HW0A 1MJAA 3H0DA 4GYIA 3TL4X 3CCQI 3DU6A 4IKFA 2A61A 2IA1A 4M3FA 1VQ6I 2BVLA 1E3OC 4N0BA 2W82A 3RDIA 2L7ZA 3BQZA 3H5RA 4PZJA 1W7PD 2OF7A 4A3GJ 4ZYAA 5LGTA 1I1GA 1MBEA 2ELHA 4EM1A 2VKHA 1VNDA 2L54A 2E35A 2MYSA 1SFUA 2PJPA 3BPVA 3FF5A 2DTZA 1ETWA 1R71A 1HOMA 1BOBA 1WH5A 2H6CA 1FSEA 5FROA 4BJTA 2R7RA 3P9CA 4C3JJ 5TGTA 4WWCA 5C4XJ 1UHSA 2JT1A 5IPAA 2QGUA 3GO5A 5K5QA 2K27A 3FMRA 4HPQA 3REOA 3VSKA 3V7CA 4HDUA 3HDDA 4IL6C 3CJQB 1FMVA 2XSDC 2XVCA 2O5RA 1X1CA 1WJAA 2F48A 3KCCA 2EWNA 3VEPA 1R7JA 2DPUA 3LSPA 1UB9A 1WJBA 2CSOA 4XLAA 2ESHA 1WJCA 4II2A 5ED4A 3QYBA 4QSHA 2Y2ZA 2DFIA 3K4KA 4Z6YA 4E4HA 2DDBA 1ZGAA 2A5WA 2QYOA 4I0BA 3U21A 2VONA 3WTYC 3PQKA 4XRMA 2K3PA 2Q1ZB 3ZXSA 2F4OB 4B09A 3FX3A 2DN0A 4JBAA 3H3ZA 2L4MA 3C2HA 3DWLE 1N77A 4H4KC 4DZJA 2WA0A 4HEA2 1WJEA 1ONVA 3OS1A 3DLLF 1C0WA 2IS6A 1A04A 1WH7A 3F8FA 3V8JA 1HC8A 4OWRB 3ELKA 1TWGJ 2NNNA 3CF2A 5KVRA 3WTZA 4N4OB 4AVPA 2FNPA 2TRTA 5M3FJ 3TBIA 1J75A 4RB1A 4BDYA 2JN6A 4KIBA 2P5KA 4PUSA 4KIFA 2GXGA 4EVIA 2WAEA 1A6IA 3RZDJ 3NARA 1MNEA 1UJ8A 3OR1C 5LEKA 2Y9YA 3RPUA 2A6EF 3U1DA 1OR7A 2G7UA 2GZWA 4D5FA 5F08A 4IOCF 1ORKA 2LMDA 3SZPA 3B02A 2CWEA 4M72A 1E0EA 3BR0A 2CFXA 4UUSA 4A3MJ 1Y8QB 2MLKA 3PSFA 4O3MA 3V7SA 4LK1F 3WTTC 4X0GA 1YJNI 2HKXA 1EA3A 1E3HA 5E8GA 1XGNA 2VE8A 2Z5UA 2I10A 5H20A 1YI2I 1SAUA 1TNSA 1B72B 4UXNA 3ZMSA 3KIOA 4ZJZA 2QQBA 1G3YA 4FE7A 5J3LA 4YELA 1ZK8A 5GAEJ 1Z7UA 2RNGA 3S3MA 4F93B 4F55A 3J7ZI 1HKTA 3QPLA 5L3CA 1K78A 3R60A 1SD5A 5CYVA 4AVZA 1VQKI 3TQNA 4HX7A 4KT5C 1T33A 4XR6A 4JX5A 1J59A 5E79C 3LFUA 3WTVC 2K02A 5E3MA 3S2WA 2MC3A 4BL0B 5GP9A 4R79A 2XSJC 1S72I 4JOMA 3OYHA 2E19A 2K85A 2BW3A 3H9GA 1X1DA 2J5OA 3AFHA 3VODA 1ITYA 5FB2A 5GPCA 3UNGC 5F04A 3KLNA 1H8AC 4G94A 1XC5A 3TOBA 2CJJA 3ERMA 1E3PA 4A0ZA 1BL0A 3LL7A 3GBGA 5BMZA 1UG0A 2Y75A 2ETHA 5IY5H 1DPUA 5CVJA 4AC0A 2PMZN 5K7HA 1D0ZA 2R7QA 3S32A 2OJED 4EM0B 5IT3A 3MKZA 4KT6A 5HLHA 2VE9A 1VTNC 5J4VA 1ETOA 2CRGA 1Z67A 2IRFG 3GTLJ 1R4MB 2VJ4A 2KRFA 3KP7A 5LHIA 4HLYA 3ZQHA 1MKMA 1S5LC 4NC6A 5ICCA 2KIMA 1D8JA 4ZTJA 1TQIA 1WVRA 1W5TA 3ZMDA 2ISYA 2Y0SN 3JCUC 2H8WA 2DOAA 4RAGA 4Y7NJ 3EYIA 3H35A 1SFEA 3TO6A 1Z05A 4NQWB 1QBJA 1FC3A 4MNUA 4BBRJ 2LOOA 1OCOH 1LFPA 4BE2A 4KN4X 3F9KA 4O5VA 1SVOA 2DQLA 4P96A 1YO5C 1X3WB 2EA2A 3CCSI 3AG4H 4HLXA 2W4SA 1MSFC 2LBFB 2RVCA 1GHCA 4FASD 4FETA 4YIIA 1U9OA 1BN5A 3BG3A 4RB2C 2QWWA 3MZHA 3DEEA 1KU2A 3QU6A 2DFFA 2XB5A 2X51A 4IQJA 2OAZA 3FZVA 2EZKA 1KZHA 1DU0A 4Q4ZF 1D1AA 3SFZA 4Q48A 2KIQA 2XROA 2IA2A 1ON2A 3AG3H 1YLFA 4AIHA 4BS9A 3HGYA 4IOAF 3NQOA 1R5GA 4CA0A 5H6QA 1SD6A 4Y4RA 3HUGB 1JKQC 4XORA 1JTYA 3HG9A 3MWMA 4M71A 4NUBA 2HQNA 2ZKZA 3GFJA 1A31A 1IV6A 2D5VA 2VQGA 4LG0B 1ETKA 4L9TA 4A3FJ 2JJ7A 4M3DA 3DKWA 1K79A 4L5IA 3SQNA 2Y30A 3LSIA 3WHCA 4B48A 2ZJRF 1X58A 2M3AA 2MH9A 3V4GA 4EV0A 1BI1A 3WGHA 3I59B 2JQ7A 2A69F 5HODA 1G59A 1YIJI 4CXFA 4PFPA 4U7DA 4UNOA 2KPMA 4UV8A 4A2UA 3DF8A 2JVHA 2OA4A 4MQVA 4XSXF 5ICGA 2IP2A 1ZRCA 3JRCA 1MMNA 1GXPA 1JUMA 4MO7A 1HLVA 3C7JA 1MBFA 4WK8F 4DJAA 2FSWA 1ON1A 2EQRA 4YEJA 3OYNA 3UKGA 1B72A 3KP5A 2F5VA 3BTCA 1JUPA 1JHHA 2L9VA 1KONA 2F5CA 1QHGA 2B7EA 5FLXZ 2JA2A 3T8RA 2DU9A 3U1KA 2UZKA 2W57A 3FBIB 4CZCA 2HR3A 1HKSA 1BC7C 3BG6A 1XGSA 1ETXA 2KZVA 2CUZA 3F72A 3TKYA 3LAJA 1XTAA 4UHTA 3CJRB 2DTRA 4FT8A 2VKEA 2Z99A 1ENHA 2QQAA 4FX0A 2V6CA 2VOOA 5DCMA 4EMSA 2K9LA 3S2DJ 2O7OA 4ETSA 4DW6A 2IVMA 2QA4I 3WE3A 2LY2A 3E6CC 3GFIA 1M1EB 2P6SA 2ZNYA 2DYSH 1R1TA 3SDGA 3SEQA 3CC4I 5JHUA 2EIKH 1R36A 5C4JJ 1B6AA 4I09A 3W6VA 4RAFA 2GQQA 1A35A 1WWXA 3GTMJ 2ZSHB 3ONQA 5DD4A 2QCOA 2A5YB 2QQ9A 4GXOA 4R8HA 2BY2A 1S29A 2ZXIA 2K5CA 1TW3A 3CCVI 3FK7A 4B3AA 2DFEA 2VKDA 3Q3SA 2M0CA 1AWCA 1ETVA 3AAFA 4CGZA 2OC6A 2R7ZJ 2AS5F 3HOTA 1A5JA 4DYRA 3A2KA 5LD2C 4P5OA 4OMZA 3AG2H 1WKMA 2ID3A 1VQ8I 2HTJA 4HSRA 3FM5A 4AUXA 4RA2A 4XLEA 4OIPF 2L7FP 3V8LA 3TDZC 2K9QA 2LKXA 3SEZA 4MFDA 3SHFA 3BWGA 2OQRA 5D6FA 5J8FA 2VJIA 3F6VA 3CDIA 4NQWA 1B9MA 3CMMA 4M9SA 3K6GA 1O3TA 2NRAC 1NG6A 1DGWY 2H1LA 3HPHA 5B66C 2BZTA 5EZGA 3BZCA 1FOXA 1AKHB 1G6NA 2DQRA 1RKTA 2L2OA 2ZC2A 3GWZA 1JKRC 2JPCA 3JW4A 2FX0A 1BA5A 3GLXA 1FYLA 3D1NI 3EYYA 5IP6A 2CYYA 1RESA 1FSHA 1FYKA 2CUJA 5JFRA 2IT0A 5C44J 4M3EA 2ECBA 5L3FA 4Y15A 3U2RA 3CO6C 1TT0A 2HDWA 2QF7A 2X9DA 4IPAA 3CC2I 1IRGA 4FISA 5E1ZB 1P92A 3C2GA 3JREA 4MHGA 2VIXA 4BH9A 1FBQA 5EDNA 5EZHA 4PJ0C 3I56I 1I50J 2VI6A 3E5QA 4PSWA 3ISPA 2VUMJ 2LY9A 1XGMA 1U0JA 2BGCA 3F8CA 1OCRH 2M5WA 4XBFA 3F21A 3MEXA 5F27A 1K4TA 2DMUA 1IZ1A 3HUGA 2HQAA 3OIOA 5EG0A 3HGGA 4Y17A 1J9IA 1KYZA 4C3IJ 4PFOA 4Y3OA 3VB2A 1ZR4A 3Q9SA 4ZH4F 1RPWA 3GXOA 3PQJA 2IGKA 3BJ6A 3A0HC 1IF1A 1R5ID 3GMEA 1B1BA 5GADJ 1ZRFA 2X1DA 4G12A 1IRZA 4E7LA 1VQ5I 2YSRA 2IBDA 3ASOH 2QVOA 2RQQA 3FM3A 5HDGA 3I59A 2HYGD 3V42A 3RYRA 3GTGJ 4A3CJ 1JJ6C 4LB5A 3L2WA 3SDBA 4NBQA 3G3ZA 3DP7A 4ENJA 2LH9A 4RMNA 3WTWC 1BJZA 3W6JB 1VI0A 2HOSA 1B4AA 2HZTA 2LKSA 5B1BH 3MAJA 2FBHA 1RKWA 2RGVA 3PNVA 2BOLA 1MJ9A 3G4SI 4KICA 2D1VA 5DS9A 3DEWA 5GAHJ 3QYEA 2CH0A 2JUCA 2NAZA 5JLXA 2B63J 2QBYB 1RC9A 3HHHA 5J8CA 2VASA 2FJ1A 4RDUA 3S17J 2DMNA 1XPXA 3IRQA 1SD7A 1LDKB 3M9AA 2ISZA 2O03A 2L3DA 3I58A 3O2PE 3TP0A 4E6KG 2FQ4A 2YS9A 5J40A 5E3LA 2F6CA 3G1OA 4ZC3A 2COBA 1HA8A 2FQ3A 4IO9F 4Q47A 1QVUA 5D5UB 5DUIA 5BPIA 1L3LA 2L9RA 2Y69H 1VQMI 1F5TA 2ELKA 2XAUA 3CCJI 3ABKH 1RZ4A 2XAQA 1MBJA 3E5UA 2IPQX 2LFBA 4BHPA 1FNNA 4XRSG 1ACIA 1B9NA 3DTKA 1ZLKA 3DV8A 2PLYA 3E97A 4NC8A 1WFXA 3OS2A 1DUXC 1MW7A 1R22A 3K9TA 4EJVA 1D1CA 2F4IA 4WF2A 3L2VA 2WB1A 1GT0C 1W4MA 3QPSA 4ABZA 1Q1VA 2QENA 3HXLA 4HV5A 9ANTA 2X6OA 5D5XB 4XRSA 3DPUA 1VQLI 2D45A 4CYCA 1TTYA 2DMTA 2KJBA 4ZYDA 4CYDA 3R6SA 1MBHA 5E1WA 1W7PB 1FOKA 4LLNA 2G0EA 1S7EA 1SFOJ 3WU2C 2XGXA 4L9NA 2E5ZA 1HBXG 2XPUA 1V4RA 3ZQQA 1IXRC 2RNJA 2DOFA 2L7KA 3OIQA 4ENKA 1F4KA 5KHDA 1VZ0A 4M3BA 4B8XA 2AXTC 2EZIA 2I8DA 2M4KA 3K70D 1UG2A 4RGXA 3GVAA 1PUEE 1QO0D 3GZNB 5B3SH 4KITB 3EUHA 2LC2A 3CCYA 2PJRA 2N8GA 4BAYA 1K61A 2ZMEB 2ZNZA 1PYVA 3PFIA 1OFCX 2D1HA 3MCZA 3SYTA 4I7HA 2E2JJ 1WJFA 1R1UA 1Z21A 1FTTA 3DPTA 2AQEA 2MD5A 1KQ8A 3IKVA 2P81A 4CO8A 2KIFA 2QQ8A 1GDTA 1QQIA 1FOYA 2DLLA 4I98B 5F6FA 4YIRX 3QOEA 4AWXB 4DIQA 5LFAA 4F52A 1IN8A 3GZ5A 1U5TB 2KRHA 4BHCA 4PK4A 1T6SA 3BC8A 2KZGA 1SD4A 1O7LA 2V26A 4RGUA 1IN7A 2DBBA 3J7AY 3EQLF 2KISA 2KP6A 3COAC 1OYYA 3IHUA 3M8FA 1W0TA 4IVNA 4HNUA 2IS2A 1SFKA 2NOGA 5J6XA 1HCRA 2VC0A 1PJRA 4A3EJ 2XF6A 4ESFA 1RRJA 3IUOA 1FP2A 4HX4A 2EV6A 4IF4A 1RUNA 2XAFA 4PGHA 4RBOA 1JT0A 2VPLA 4BY7J 3I4NJ 4HAMA 2H1KA 3KZIC 1KYWA 3EETA 1WSUA 4J01A 4HG2A 4A93J 4AYBA 1ZG1A 1D8KA 3LSTA 4KNYA 3H5AA 2JVGA 3LMMA 5GPAA 2NVQJ 5D5WB 5CVIA 4DYQA 2M0MA 2ZJ2A 2FU4A 3HKZA 4AD9A 2KDOA 1LE8A 2DA5A 3WGIA 1T8IA 3P5JA 2AHQA 5BS6A 5HDKA 2K40A 4KDPA 2R0QC 2BY0A 3RPUD 4XRFA 3CLOA 2GOMA 3A1YA 4HQMA 3L9FA 1S7OA 1ODDA 1MDMB 2HTSA 2K86A 2HI3A 1CQTA 3L2CA 1SVLA 4L5JA 3H9JA 1NTCA 3KP2A 3LQRA 5DEQA 3BDDA 3HTUA 3KETA 1VQ7I 1JI8A 1Z6TA 2GXAA 4G6TB 3ZGKA 1BW6A 3RJPA 3BTLA 5BNGA 4FTHA 3RCOA 1SAXA 1I3AA 4ON0A 1S9HA 3O3KA 3K4CA 2E7WA 1LFUP 1QZEA 4CCNA 2BYVE 2XAJA 5J4YA 1N78A 2IGMA 3W2AA 1S6LA 2EJRA 2VBYA 4B1RA 1BR1A 4A5MA 1SANA 4WXCA 3OR2C 2M45A 3O8HA 2EFQA 4AU7A 1W1WE 2R7VA 3QPHA 3G1LA 2CQKA 2LREA 2VXZA 3J81K 1NK2P 2CMPA 5E3OA 3K4NA 4E7ZA 2DA6A 3HSRA 1XGOA 4IXAA 2EBIA 4X6AJ 1S8NA 5LRSA 1U78A 1R49A 2XF5A 1IRFA 2DOEA 4B4CA 1FYMA 1DDNA 2KKOA 1IN4A 2L5QA 1XSVA 3OYMA 3VWBA 3GTPJ 3OIPA 3SXYA 1HDPA 3JSPA 4XL9A 2STTA 4V2FA 3JR9A 5TRDA 3IAM2 2EA4A 3BR1A 2WADA 4FQGA 4MEYF 2H94A 3QOPA 1UFMA 4C2UA 2E60A 2Y9ZA 2HXOA 4XOPA 2R5ZB 2UWMA 2X0LA 5H2FC 1G8XA 3T0YA 2EFWA 5J1UA 2F5EA 1R9TJ 3R61A 4U0VA 4N9IA 1MZBA 2NYXA 3CP8A 2ZMEC 2QEXI 2M1BA 2O9LA 4BNCA 4BU2A 5E1XA 5HOOA 2F2EA 2FXAA 2PMUA 1XB4A 3KP6A 4MIMA 3T5XA 1UHMA 4E7JA 2DJIA 4M9XA 4EM2A 1VQ9I 2ZMEA 4L0ZB 1R6RA 2HZDA 2COMA 2X6WA 4UB8C 5JLWA 1MNDA 1XDUA 2HPMA 3O6BB 2R7WA 3K7AJ 2MD0A 1U5TC 4EJWA 5F64A 1BI0A 1XSXA 1H9TA 3R4KA 4NHJA 2JPBA 3MVPA 3J80K 3H3VK 2R92J 3TO9A 1MBKA 1HKQA 2X1CA 2W25A 3K0LA 3CD6I 3B6AA 2CO5A 5LHHA 4ZTFA 2OU2A 5E3NA 1YFHA 1BI2A 2FUG2 4HF0A 2FOKA 3F8MA 3FXKA 2K9MA 1NK3P 2CUEA 1NHAA 3GYHX 3RKYA 4F92B 2HVRA 1P4WA 1SVMA 4LIVA 3PM1A 2EZHA 2MGQA 4GRIA 5DTDA 2W24A 3VYSB 2O8KA 3ZMUA 4IHYA 2ME0A 4CUGA 3OYEA 4K2EA 2WV1A 3S14J 4IQ4A 1ZG5A 1D0YA 1OQYA 1X2MA 2VKVA 3A02A 3F8NA 4MGRA 2JZYA 2WTEA 4RGRA 4IHXA 1XCVA 2KDZA 4DOZA 4BQAA 2GM4A 1YIOA 3A0BC 4M6XA 1DP7P 1MMAA 4E7HA 4HNTA 5IOYA 1I27A 2E36A 5J47A 4W1UA 4CZZA 1J2XA 4BQOA 1A6QA 3T1BA 2M30A 2IGOA 4QTRA 2A68F 5FLVA 1J09A 2UXXA 4RLFA 2P7VB 1O57A 4HA8A 1LVKA 4HF1A 3HOZJ 1U9NA 4D0PA 3ZR8X 2QSGX 2YUSA 3RZOJ 4LLGF 4G7OF 3J81Z 5L3EA 1T2KA 1APLC 4YFXF 1MSEC 1JKPC 1UZCA 4FE4A 4XKBA 3GEZA 3VOEA 1R5HA 2QM3A 4RAZA 5CLSA 3I64A 2W1OA 1RR8C 3CJNA 1RNLA 5DCFA 2R7OA 3SZGA 2OTJI 4GO1A 5A2QK 3FMSA 1POGA 3OYDA 1XD7A 3CJTB 3GUDA 3L7WA 3HIFA 5H6RA 3BR3A 3SJMA 5B5EC 5L3DA 1LEBA 2CU7A 2UXNA 3OYIA 2V1DA 2EV5A 1HXDA 4HNVA 1MNMC 2LKPA 5FO5A 3VYUB 3L2UA 4UVCA 3DEUA 3R0JA 1ZH5A 3IAS2 2O0YA 2OZUA 4DGWB 1KQ0A 2BVMA 2L7MP 1TL8A 2WB1N 4J00A 1GV2A 6PAXA 4GCVA 3FXRA 3MZYA 1TQPA 4Q5SF 3S8PA 1I6XA 5CQEA 5F0FA 1BR2A 5GTIC 2ADUA 4PCQA 3W6KB 5IYCJ 2R93J 1RR7A 4QWQA 4OU0A 1BBYA 2H09A 2HDCA 4C2TA 5EGOB 5EEHA 2PG4A 4XLCA 5CVUA 1SMYF 2LG4A 4MFEA 3FBNB 2AO9A 1OYWA 2R5YB 1YRNB 4M3GA 1TWCJ 2M7BA 5KAIC 4F7ZA 2XPWA 4D5CA 1UMQA 2R5ZA 1DU6A 2VQCA 3HRMA 3MKWB 5K5RA 5IYBJ 4BQQA 2KLOA 2FEZA 1LPQA 2CFOA 1TWAJ 3KYLA 3RQIA 5D4SA 2ECCA 1P9QC 5E18F 3GZ6A 2OV7A 3GFMA 3C18A 1IDZA 5J1RA 1DPRA 2LF8A 4QPOA 4RS8A 3F8BA 3CCUI 3IRRA 1YJWI 1ZRDA 4E7SA 3FXQA 1YX5A 2XGCA 2L4AA 1YW9A 2V1NA 1E17A 3VFZA 3GTQJ 4KMFA 3PNTA 1BI3A 4RAYA 2JA6J 3HPGA 4DBRA 4OIOF 1S7AA 2W48A 2OBPA 3A01B 3W2VA 2RC4A 1QU3A 5IT9K 3I4MJ 1BIAA 3S15J 3FXOA 2VBWA 2X1EA 3S2HJ 1LUJB 3S16J 2IEKA 3LFKA 3ML6A 3M3YJ 4BJ6C 5ICEA 1PP7U 3F22A 1RI7A 3E6DA 2FMLA 3RI4A 2LNBA 2A3SA 1T56A 3U9GA 3FKIJ 4LIUA 1B8IB 3F0CA 4CCMA 2HU9A 5HDNA 2E7XA 3W2WA 1LNWA 2M8EA 3KX2A 3BY6A 1IN6A 5D6EA 1ZR2A 3OV8A 4C3HJ 2BXZA 4ZDOA 2GWRA 3BQYA 2KRCA 3MFKA 2E2IJ 2DA7A 3I4PA 4MQ9F 5BPDA 1MH4A 1ZREA 1LB2A 2DK8A 2DT5A 4ENMA 4AYBN 2BE5F 2CQ7A 3DBRB 4XICA 5A2QZ 4L9VA 1Y1VJ 2BEOA 3OMYA 2NNYA 2HQRA 2RV8A 1EJ9A 4BJ5C 3HKZN 4IHVA 2ZO4A 3M07A 3JSOA 3H5NA 4OAZA 3JRDA 2FBIA 1U2WA 5HNHA 1TT5B 1RUOA 1ZAOA 1BIBA 3F6OA 2E2HJ 3I71A 5BOXA 2E5NA 3QAHA 1W36C 3FWEA 4IEJA 3Q5FA 2CV1A 5FD6A 4IZZA 2Q8KA 1WQ2A 1QZZA 2CUFA 2B0LA 2GOXB 1USSA 1H89C 2ME6A 3MMYB 1QNTA 3EUAA 2JA5J 3ABUA 3I3LA 2OCCH 5FKNA 2CV0A 2E1OA 2HS5A 1WI3A 3E6BA 2V9KA 2D2WA 4BEHB 1LQ1A 2VB6A 1USTA 4LLLA 3D5RC 4BY1J 3OS0A 3ERED 2LBFA 1WZ2A 2O8XA 3PIPF 1AOYA 5CJ9A 5K7ZA 2NVXJ 4KYWA 1J5YA 2FNAA 3GLLA 1J0RA 4MLOA 2BY3A 4A12A 2L0KA 1D5YA 4DBQA 4BUPA 1FT9A 3OOUA 2IA0A 3HZJA 3KZYA 4B47A 3I9V2 3FHZA 2LF7A 1NG7A 2VOPA 2DT6A 1F43A 2P5LC 1IAWA 2P8TA 3KFWX 5FRNA 1FWZA 2XUBA 1R1VA 1TW2A 3HSEA 3PIOF 3G73A 2XAHA 1Y39A 4X1EA 4LITA 4I99C 4Y33A 4S05A 3CCEI 1TP4A 1DQUA 3C2BA 3IWFA 1D0XA 1TWHJ 4I0AA 3E3VA 4AIDA 2ZJPF 1ZHFA 2EFPA 1GLNA 3CDHA 4LG0A 1BM9A 1P7JA 2P5VA 3W3CA 4CSWA 3QODA 1FBUA 5HS9A 3WHBA 3HHGA 3LSRA 4L5EA 4ZZLA 3KZZA 3H92A 4YFKF 5M5WJ 4I2OA 2JA8J 3CUQB 3S3OA 2IJLA 1WHUA 2LSOA 3BG9A 4DNCA 2XV4S 1ZGWA 2PBIA 5EGOA 4EJTA 3TGNA 1WRJA 1MH3A 4DZPA 4CH7A 2B9SA 2BHZA 2R5YA 3DXJF 1YRNA 3CCMI 4KUMA 1WGXA 2TDXA 2XKPA 3IH2A 4HSTA 2LR8A 3M1CA 1CF7B 1IUFA 4OIQF 2LYCA 3CMYA 1ZQ3P 2V1XA 3HTSB 2PMHA 4UUVA 1EH8A 2OD5A 4LMYA 3NEUA 1T0FC 2MLGA 4A3KJ 2ELJA 4PSXA 4LD5A 4G9YA 4XLHA 1K83J 4HX8A 4XSZF 1OLTA 1IRXA 4M73A 3RPQA 1OMIA 2Z16A 3TW7A 2XASA 5K7FA 4IHSA 2M7AA 2GLOA 3Q0VA 1Z9CA 2OZ6A 3ULQB 2VQLA 3ZRGA 5LGUA 2HQ5A 4HYEA 2R7TA 3RKQA 2UV1A 1X3ZB 2IS4A 3KP4A 3ZMVA 4KA4A 2M9HA 3Q0UA 4NDLA 2PFBA 1FTZA 5JHFA 1EH6A 4WXDA 4WCGA 1Y1WJ 2Z3YA 4ASNA 1V5GA 5B1AH 1T38A 2DA4A 5FJ8J 3RIRA 1X4OA 1GVJA 2CQNA 1WPKA 2LP0A 3VYRB 3JRFA 1ZN2A 3PUFA 2NXNB 2YR2A 3FHNA 2XC7A 4PJMA 5FKKA 2E1MB 2RDPA 4A3JJ 4PJJA 4DYCA 1IW7F 4YG2F 1ZYRF 4IRHA 2K9SA 1ETYA 1QZYA 4ZYHA 4FX4A 4U87A 4N4NB 3RSNA 3M4OJ 2MFZA 3A4CA 3DCFA 3OSGA 3M8JA 1MD0A 2H27A 5AONA 3L2RA 1N75A 3BR5A 4C2MJ 2O61A 4HF2A 5EEGA 2DFHA 2ESNA 1YITI 3B73A 3HBLA 1MMGA 1U8BA 3G6EI 1PUFB 1XS9A 3IL2A 1GXQA 2QSHX 2VT3A 3C3WA 3NAUA 1RIOH 4CCOA 3CDLA 2V4JC 2F5DA 2NVYJ 5IOZA 4UVAA 2KMUA 2DJNA 3L2QA 4XKWA 3BOQA 2RQPA 4XM3A 3VDXA 1KGSA 2ZB9A 1X2NA 1KU9A 2W7NA 5CPRB 2K4JA 4B3XA 4OMYA 1AKHA 1G3SA 3OYLA 2VODA 2DW4A 2X48A 2V1UA 1TBXA 4UUSB 2MSYA 4WX9A 2LDUA 1MGTA 1P4XA 4OIRF 2V7FA 3CP2A 4M6YA 2VLAA 3K4BA 3PFYA 4BACA 3F23A 4FHTA 4XOTA 3TDUC 4XLNF 3LA3A 2VQHA 3LWFA 1U6GA 2YU9J 3BG5A 4A6DA 3VSLA 1IC8A 2JSPA 3K2AA 2H8RA 3QRFF 1XDSA 2IS1A 4KFCA 1Z3YA 2EFNA 3IC7A 2I5UA 2JRMA 4QPQA 4P55A 4C9YA 2FE3A 2OCEA 4I02A 3FMQA 5D4RA 1K78B 4C30A 5JI6A 2CG4A 2K3FA 3K2ZA 3KYCB 4IRGA 5LHGA 2AXLA 5M3MJ 5ILVA 4A3LJ 3DTEA 3GFLA 2HGCA 4RM2A 2L9NA 2BHYA 3FKJA 2QKLB 3G1MA 1FP1D 1OKRA 3DTIA 4KJZA 1TNTA 2HWVA 1HF0A 1Y56A 1DP3A 2DT7B 4ESBA 4NB5A 3E1SA 5KK1A 1V5EA 3CTAA 2FA5A 3OYFA 3TO7A 3I55I 3CUQC 3IP4B 1MJBA 3GCMA 4ITVA 1G3WA 4JX4A 3H9QA 3WTSC 2HFHA 3MQ0A 2QUFA 3JRGA 1JGGA 3DQVC 5HLIA 3CUQA 3DKYA 4WXHA 3HSFA 2BW3B 3HEFA 5KAFC 5DM6F 5E17F 5D5VB 2Y48A 5FKLA 1YQAA 5FKMA 5F1RA 1FJLA 4R1HA 4LGWA 2Y0MA 1OCPA 2CV2A 1LDDA 2XKOA 4GFBA 3RKWA 1U3EM 2LVSA 3ESWB 2PN6A 1JE8A 4ENNA 1CF7A 3JAMK 3K70C 5J1YA 3BT9A 2A05A 1JUSA 2O3FA 3ABMH 4V2GA 3JRBA 2V9VA 3T8TA 3WTXC 1FMWA 4UV9A 3BPXA 4BBSJ 2QBYA 1YJ9I 1X1PA 2IXSA 1JJ8C 1REPC 5EYRA 3HL2A 2FF4A 2VBZA 1P4AA 3S93A 4YFNF 4JK1X 1HW1A 2ZXJA 3GW2A 5K1YA 3ZPLA 3ASNH 2YX4A 1UHWA 2R7FA 3I53A 3K69A 3IH4A 5EEAA 1F9NA 4O6JA 3CCRI 2IW5A 3B6CA 2HOTA 4TV7A 3HOVJ 4XLPF 2XF7A 2KFDA 1AA7A 4BXXJ 2E1MC 2V6EA 1NH3A 3ZOBA 4ZZDA 1ZELA 3PJRA 3GTOJ 1P7IA 5DYMA 1JXSA 3MKLA 4I01A 4ESJA 1MIJA 2KQRA 4UVBA 4MEXF 2L02A 2Z1DA 1XX5A 4BXUA 3Q9VA 1QRYA 2WAFA 3FXMA 1K7AA 1XMKA 3IWZA 1SC7A 1WI9A 1JHFA 2VPRA 3L09A 1CGPA 1HSJA 2P0WA 3PL8A 1FPQA 3X2QH 4YIFA 1KU3A 3ECHA 4A5NA 3DBLB 3RKXA 3HRTA 3MKYB 2HVQA 5ERIA 4EGYA 3GTKJ 3K1PA 5M5YJ 2GA2A 4S04A 3BZKA 1U8RA 3JRAA 3EUKL 4ZDLA 2XAGA 2ZFWA 3K4MA 4UB6C 3OYJA 3I0TA 3QQAA 1Z0XA 2Z9OA 4OOIA 1J7KA 2ACJA 4CDGA 1OYIA 2ZJQF 2MC4A 1FIPA 4RB0A 4LK0F 1W7PA 3HRUA 4IX7A 1PUFA 2R7XA 3LSKA 5LGNA 2OPTA 5HS7A 2CW8A 2W00A 3KYDB 4FCYA 3HM5A 1OR7C 2EZLA 1F1ZA 2EH3A 3MZ8A 3ZQCA 4U88A 1FZPB 1YS7A 1FBSA 4ZDPA 2DXIA 3MN2A 1ZKGA 3ZQ7A 3HOYJ 3QYFA 1HQCA 2G7HA 1YHQI 1JTXA 3HB9A 1RETA 3CC7I 1FY7A 1OCCH 3EPZA 3OYBA 2GIVA 4IRIA 1ZLJA 4KN7X 3HOUJ 3LSHA 1LFBA 4A0XA 4EEFG 2LLKA 2EK5A 1U5TA 2NS7A 3N05A 5FFZA 1EV7A 1IXSB 3HJEA 1VFCA 1WJ5A 4BKXA 4M74A 1XG1A 3JAMZ 4OAYA 4JX6A 5KNLA 2NVTJ 1IO2A 1YTYA 3HYIA 4A6EA 2PX9A 2G9WA 4OINF 3OYKA 4RB3C 2E1NA 5CQGA 2DYRH 3M1EA 1HSTA 4D7NA 2CQQA 4JP0A 3HOSA 5DCMB 3J7AO 2XGEA 4H0EA 1KU7A 2PEXA 4EQQA 4XK4A 2QZ8A 1SFXA 3FXJA 2RREA 3E5XA 4MTDA 2DI3A 3OL3A 4PGGA 2HYFA 2QLZA 2K4BA 3JRHA 3FXUA 2FRHA 4A0YA 5DM7F 3ZQFA 5JR3A 4RLQA 3H3UA 5F1JA 5FLXK 2J5PA 2DMQA 2JRTA 1F36A 1G3TA 1Y0UA 3F3XA 1P6RA 1OJLA 1AU7A 4B43A 3TMOA 5L3GA 1LVAA 1XN7A 4E70A 1MDMA 3BG7A 3K10A 5IYDJ 3LSJA 4HOBA 2DMPA 2GAUA 4XONA 5CVRA 5TISC 5C3EJ 3BLYA 1PDNC 3CF5F 2VJ5A 1O3QA 1TZLA 3ZMTA 3DKXA 2R7UA 5FRMA 5GTHC 3NRVA 2LTPA 2STWA 2MABA 1YOVB 2MW8A 3CO7C 3HOWJ 4HV6A 5HVQC 3PUBA 3QU3A 2LD5A 2WAQA 1V3FA 2P6TA 3ABTA 2WC2A 3LQQA 1PP8F 2A07F 2F5FA 2R7DA 4EJUA 2DA2A 2JMWA 2KT0A 3AG1H 1WJDA 1Z77A 4A3DJ 2VXDA 5FGMA 1OCTC 4PDKA 1Z1DA 1UAAA 5D8KB 3L1PA 5LEJA 3PNYA 1T95A 3BCBA 4ZYEA 3J7YJ 3HOXJ 3FIWA 1XMXA 4NNJA 3PSIA 3SFIA 2XB0X 2ICWG 2O6GE 4PJLA 4F3QA 4AM3A 3ZQLA 1LKXA 2WY7Q 4A3BJ 2XDVA 2HOAA 1IV8A 1V55H 2NOJB 4NC7A 1BC8C 1Q1HA 2DA3A 2JUGA 1UCRA 3FDYA 5M5XJ 4LJZF 1MMDA 2XGDA 1TWFJ 1LDJA 1ETQA 4PJNA 5EG0B 2Q2EB 3FISA 3TOAA 1YX3A 3J80Z 3DBHB 3OOPA 1LJ9A 3BZ6A 3WU0A 3BR6A 4XLFA 3HC7A 3QWLA 1HDDC 1TQMA 3S1NJ 2PI0A 4HQEA 2E34A 2ZFUA 2A6HF 1D1BA 5E8IA 4IHTA 3WTUC 4AIJA 1UELB 2X4HA 3A03A 3D5LA 2K9NA 4RGSA 4HZFA 3NWSA 2M34A 5HS8A 4AIKA 1X3UA 5DV5A 4J19A 3TEDA 2JTVA 2HPIA 2OUMA 2CQXA 3WGGA 1I39A 4P9FA 2JWTA 3S3NA 1W36D 1SEUA 3H36A 1JKOC 3O8GA 4G6DA 3P7NA 4XIDA 1IJWC 4B44A 2NS0A 3BJOA 2M4GA 1VF9A 1ZARA 1ZTRA 2UUZA 3WODF 3DFGA 2C6YA 3FK6A 5HNFA 3E7LA 4DQ2A 3E0JB 2A6TA 2HYJA 1Y0NA 2EPFA 2CGPA 1IN5A 1V54H 1H88C 2L01A 4YRVA 3CUOA 3LOCA 3V8KA
chains in the Genus database with same CATH topology
4AC0A 2PMZN 2HI3A 1Y1WJ 1CQTA 5K7HA 2TCTA 3H0GJ 2DA4A 1NTCA 4JYKA 5FJ8J 2LP0A 1WPKA 1ETOA 2CRGA 3JRFA 4I6ZA 3GTLJ 5FKKA 4A3JJ 3ZQHA 1BW6A 4DYCA 3S1QJ 5BNGA 3BTLA 4FTHA 2K9SA 1ETYA 3M4OJ 2Y0SN 1LFUP 3BTIA 4Y7NJ 3DCFA 3OSGA 2ID6A 3PO3J 3JRIA 4Y52J 4BBRJ 4CYCB 2RAEA 2M2EA 3BR5A 4B1RA 4C2MJ 1SANA 2M8GX 3HBLA 3O8HA 1U8BA 3G1LA 1MSFC 1PUFB 1XS9A 1NK2P 1U9OA 3NAUA 3BG3A 5E3OA 3CDLA 2DA1A 1EF4A 2DA6A 2LK2A 5IP9J 2NVYJ 5IOZA 2XB5A 2EBIA 4X6AJ 2DJNA 1U78A 4B4CA 1G2HA 2EZKA 1DU0A 2ZB9A 3GTPJ 1X2NA 3IV5A 1HDPA 1IGNA 4V2FA 3JR9A 1AKHA 1O4XA 3CQZJ 3HGYA 2X48A 3BR1A 4UUSB 1JKQC 2MSYA 1JTYA 2IAIA 2Y9ZA 2HXOA 2R5ZB 1IDYA 4S0HB 1IV6A 2D5VA 5FLMJ 1ETKA 3S1RJ 4A3FJ 5J1UA 2JJ7A 4M3DA 1R9TJ 1GUUA 2Y30A 3WHCA 2YU9J 3BG5A 1IC8A 1X58A 2H8RA 3K2AA 2O9LA 4MIMA 1W0UA 5HODA 5JLWA 5M3MJ 4A3LJ 3G1MA 3K7AJ 2Y31A 1HF0A 3JRCA 4QIWN 1JUMA 4MO7A 1HLVA 1MBFA 2HXIA 3MVPA 1AHDP 2EQRA 1B72A 3UKGA 2R92J 3H3VK 1MBKA 3BTCA 1JUPA 4JX4A 3B6AA 5E3NA 3JRGA 1JGGA 1QPIA 3BTJA 3HEFA 1I6HJ 1I3QJ 5FKLA 1LE8B 1NK3P 2CUEA 5FKMA 3LSGA 1FJLA 1OCPA 3PM1A 2EZHA 2MGQA 1ETXA 3BR2A 5DTDA 4GFBA 2O8KA 4IHYA 2ME0A 2LVSA 3A01A 2WV1A 5J1YA 3BT9A 3S14J 1JUSA 2VKEA 4V2GA 1X2MA 1ENHA 2VKVA 3A02A 4A69C 4IHXA 3JRBA 2KDZA 1FIAA 3S2DJ 2O7OA 4DW6A 2GM4A 1GV5A 1TC3C 4BBSJ 2HDDA 5IOYA 4W1UA 3SDGA 1JJ8C 5EYRA 5F0CA 1B8IA 2JK3A 4QTRA 5C4JJ 5FLVA 3W6VA 3LNQA 4A3IJ 3GTMJ 4LOCA 3IH4A 5EEAA 2QCOA 3HOZJ 1U9NA 3B6CA 5IP7J 2HOTA 3HOVJ 4IHWA 2XPVA 3FK7A 2YUSA 4B3AA 3Q3SA 3RZOJ 4BXXJ 2M0CA 3TW6A 1ETVA 1APLC 2GBYA 3ZOBA 1MSEC 1JKPC 3GTOJ 1P7IA 4FE4A 2R7ZJ 3MKLA 1A5JA 4DYRA 3GTJJ 2ID3A 1QRYA 4AUXA 4W97A 3ZQGA 2L7FP 4I76A 4UUTA 1POGA 3Q0WA 3VPRA 2VPRA 2LKXA 2K9QA 3ZQIA 4MFDA 5EF6A 3BR3A 3SJMA 3S1MJ 3GTKJ 1GVDA 5M5YJ 3PO2J 1MBGA 2CU7A 3JRAA 5EZGA 1AKHB 2XRLA 1RKTA 3QQAA 1Z0XA 1MNMC 4HNVA 1JKRC 1IG7A 2FX0A 1BA5A 1FIPA 3D1NI 3TP3A 5IP6A 2L7MP 1PUFA 1RESA 2MG4A 2JA7J 5C44J 2OPTA 2WB1N 4M3EA 5F0HA 2ECBA 1GV2A 2WAQN 3IH3A 4FCYA 2QF7A 3HM5A 2X9DA 4FISA 2EZLA 5F0FA 3JREA 2EH3A 5IYCJ 2R93J 5EDNA 3ZQCA 5EZHA 1RR7A 1I50J 2VI6A 1QVTA 3MN2A 2VUMJ 2LY9A 5EGOB 1ZKGA 4M6VA 5FKOA 3HOYJ 4MFEA 5F27A 2AO9A 2DMUA 2R5YB 5EG0A 1WCMJ 3OIOA 1JTXA 3HGGA 1YRNB 4M3GA 1TWCJ 3HB9A 4C3IJ 1RETA 2XPWA 4D5CA 1UMQA 2R5ZA 1BW5A 1ZR4A 1DU6A 1RPWA 3HOUJ 5IYBJ 1LFBA 2NS8A 1TWAJ 1JT6A 4EEFG 2LLKA 3RQIA 2ECCA 4G12A 1IRZA 2NS7A 3OSFA 1FEXA 2IBDA 1IDZA 5J1RA 1VFCA 4D7MA 3GTGJ 4A3CJ 4BKXA 2FD5A 1JJ6C 1XG1A 4JX6A 2NVTJ 2XGCA 3GTQJ 2JA6J 1BJZA 1VI0A 2W48A 4M3FA 3A01B 2HOSA 4D7NA 1E3OC 1RKWA 2CQQA 4JP0A 3I4MJ 3S15J 5DS9A 3DEWA 3S2HJ 2L7ZA 2XGEA 3BQZA 3S16J 2IEKA 3M3YJ 4XK4A 5JLXA 2B63J 2OF7A 4A3GJ 1MBEA 2FJ1A 4RDUA 3S17J 2DMNA 1T56A 3FKIJ 1B8IB 1VNDA 3F0CA 3JRHA 3TP0A 3ZQFA 2FQ4A 2YS9A 5E3LA 2DTZA 1ETWA 3G1OA 5F1JA 1ZR2A 4C3HJ 2COBA 1HOMA 2DMQA 1F36A 1WH5A 1QVUA 3BQYA 2L9RA 2E2IJ 1OJLA 4C3JJ 1AU7A 2DA7A 5C4XJ 1UHSA 5IPAA 1MH4A 2ELKA 5IYDJ 3LSJA 4AYBN 4XICA 1MBJA 2DMPA 3HDDA 1Y1VJ 5C3EJ 2LFBA 2XSDC 4XRSG 3HKZN 4IHVA 3JRDA 3LSPA 2LTPA 2MW8A 4QSHA 3HOWJ 2Y2ZA 2E2HJ 1GT0C 3QPSA 4ABZA 1Q1VA 2LD5A 9ANTA 2X6OA 4XRMA 2DA2A 4XRSA 2JMWA 4IEJA 2KT0A 1Z77A 4A3DJ 2DN0A 1OCTC 2CUFA 4CYCA 1H89C 2DMTA 2ME6A 4DZJA 2JA5J 5FKNA 3L1PA 1MBHA 2E1OA 2G0EA 1WI3A 1S7EA 3FIWA 3HOXJ 1SFOJ 3SFIA 1WH7A 2XB0X 4BY1J 2XPUA 1TWGJ 5K7ZA 3ZQLA 2NVXJ 2TRTA 5M3FJ 4M3BA 2JN6A 4A3BJ 4MLOA 2EZIA 2HOAA 1D5YA 2L0KA 1UG2A 1A6IA 3RZDJ 3OOUA 3NARA 2DA3A 2Y9YA 1F43A 3CCYA 2N8GA 5M5XJ 4D5FA 1K61A 5F08A 1ORKA 2XGDA 1TWFJ 1ETQA 5EG0B 1OFCX 3BR0A 4X1EA 3FISA 2E2JJ 4A3MJ 3C2BA 4UUSA 1FTTA 1TWHJ 2P81A 3BR6A 1GDTA 1P7JA 1HDDC 3S1NJ 2I10A 1B72B 3WHBA 3LSRA 4L5EA 5M5WJ 4FE7A 5J3LA 2JA8J 1ZK8A 3BG9A 3A03A 1ZGWA 1W0TA 5EGOA 2K9NA 3QPLA 1MH3A 2M34A 2NOGA 4DZPA 2R5YA 1HCRA 4A3EJ 1YRNA 4J19A 3TEDA 1WGXA 3IH2A 2LR8A 1IUFA 2CQXA 3CMYA 1T33A 1ZQ3P 2JWTA 4JX5A 4RBOA 1JT0A 4BY7J 4A3KJ 3I4NJ 2H1KA 1JKOC 5E3MA 1K83J 3O8GA 4A93J 5GP9A 3TW7A 5GPAA 4XIDA 5K7FA 1IJWC 2NVQJ 2E19A 4DYQA 2GLOA 3Q0VA 1VF9A 1ZTRA 1LE8A 1ITYA 2DA5A 3FK6A 3E7LA 5GPCA 2AHQA 2HQ5A 2K40A 2HYJA 3RKQA 2R0QC 5F04A 1H8AC 1XC5A 1H88C 2CJJA 1BL0A 2M9HA 3GBGA 3Q0UA 3LOCA 4NDLA 1FTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC0 A;  2PMZ N;  2HI3 A;  1Y1W J;  1CQT A;  5K7H A;  2TCT A;  3H0G J;  2DA4 A;  1NTC A;  4JYK A;  5FJ8 J;  2LP0 A;  1WPK A;  1ETO A;  2CRG A;  3JRF A;  4I6Z A;  3GTL J;  5FKK A;  4A3J J;  3ZQH A;  1BW6 A;  4DYC A;  3S1Q J;  5BNG A;  3BTL A;  4FTH A;  2K9S A;  1ETY A;  3M4O J;  2Y0S N;  1LFU P;  3BTI A;  4Y7N J;  3DCF A;  3OSG A;  2ID6 A;  3PO3 J;  3JRI A;  4Y52 J;  4BBR J;  4CYC B;  2RAE A;  2M2E A;  3BR5 A;  4B1R A;  4C2M J;  1SAN A;  2M8G X;  3HBL A;  3O8H A;  1U8B A;  3G1L A;  1MSF C;  1PUF B;  1XS9 A;  1NK2 P;  1U9O A;  3NAU A;  3BG3 A;  5E3O A;  3CDL A;  2DA1 A;  1EF4 A;  2DA6 A;  2LK2 A;  5IP9 J;  2NVY J;  5IOZ A;  2XB5 A;  2EBI A;  4X6A J;  2DJN A;  1U78 A;  4B4C A;  1G2H A;  2EZK A;  1DU0 A;  2ZB9 A;  3GTP J;  1X2N A;  3IV5 A;  1HDP A;  1IGN A;  4V2F A;  3JR9 A;  1AKH A;  1O4X A;  3CQZ J;  3HGY A;  2X48 A;  3BR1 A;  4UUS B;  1JKQ C;  2MSY A;  1JTY A;  2IAI A;  2Y9Z A;  2HXO A;  2R5Z B;  1IDY A;  4S0H B;  1IV6 A;  2D5V A;  5FLM J;  1ETK A;  3S1R J;  4A3F J;  5J1U A;  2JJ7 A;  4M3D A;  1R9T J;  1GUU A;  2Y30 A;  3WHC A;  2YU9 J;  3BG5 A;  1IC8 A;  1X58 A;  2H8R A;  3K2A A;  2O9L A;  4MIM A;  1W0U A;  5HOD A;  5JLW A;  5M3M J;  4A3L J;  3G1M A;  3K7A J;  2Y31 A;  1HF0 A;  3JRC A;  4QIW N;  1JUM A;  4MO7 A;  1HLV A;  1MBF A;  2HXI A;  3MVP A;  1AHD P;  2EQR A;  1B72 A;  3UKG A;  2R92 J;  3H3V K;  1MBK A;  3BTC A;  1JUP A;  4JX4 A;  3B6A A;  5E3N A;  3JRG A;  1JGG A;  1QPI A;  3BTJ A;  3HEF A;  1I6H J;  1I3Q J;  5FKL A;  1LE8 B;  1NK3 P;  2CUE A;  5FKM A;  3LSG A;  1FJL A;  1OCP A;  3PM1 A;  2EZH A;  2MGQ A;  1ETX A;  3BR2 A;  5DTD A;  4GFB A;  2O8K A;  4IHY A;  2ME0 A;  2LVS A;  3A01 A;  2WV1 A;  5J1Y A;  3BT9 A;  3S14 J;  1JUS A;  2VKE A;  4V2G A;  1X2M A;  1ENH A;  2VKV A;  3A02 A;  4A69 C;  4IHX A;  3JRB A;  2KDZ A;  1FIA A;  3S2D J;  2O7O A;  4DW6 A;  2GM4 A;  1GV5 A;  1TC3 C;  4BBS J;  2HDD A;  5IOY A;  4W1U A;  3SDG A;  1JJ8 C;  5EYR A;  5F0C A;  1B8I A;  2JK3 A;  4QTR A;  5C4J J;  5FLV A;  3W6V A;  3LNQ A;  4A3I J;  3GTM J;  4LOC A;  3IH4 A;  5EEA A;  2QCO A;  3HOZ J;  1U9N A;  3B6C A;  5IP7 J;  2HOT A;  3HOV J;  4IHW A;  2XPV A;  3FK7 A;  2YUS A;  4B3A A;  3Q3S A;  3RZO J;  4BXX J;  2M0C A;  3TW6 A;  1ETV A;  1APL C;  2GBY A;  3ZOB A;  1MSE C;  1JKP C;  3GTO J;  1P7I A;  4FE4 A;  2R7Z J;  3MKL A;  1A5J A;  4DYR A;  3GTJ J;  2ID3 A;  1QRY A;  4AUX A;  4W97 A;  3ZQG A;  2L7F P;  4I76 A;  4UUT A;  1POG A;  3Q0W A;  3VPR A;  2VPR A;  2LKX A;  2K9Q A;  3ZQI A;  4MFD A;  5EF6 A;  3BR3 A;  3SJM A;  3S1M J;  3GTK J;  1GVD A;  5M5Y J;  3PO2 J;  1MBG A;  2CU7 A;  3JRA A;  5EZG A;  1AKH B;  2XRL A;  1RKT A;  3QQA A;  1Z0X A;  1MNM C;  4HNV A;  1JKR C;  1IG7 A;  2FX0 A;  1BA5 A;  1FIP A;  3D1N I;  3TP3 A;  5IP6 A;  2L7M P;  1PUF A;  1RES A;  2MG4 A;  2JA7 J;  5C44 J;  2OPT A;  2WB1 N;  4M3E A;  5F0H A;  2ECB A;  1GV2 A;  2WAQ N;  3IH3 A;  4FCY A;  2QF7 A;  3HM5 A;  2X9D A;  4FIS A;  2EZL A;  5F0F A;  3JRE A;  2EH3 A;  5IYC J;  2R93 J;  5EDN A;  3ZQC A;  5EZH A;  1RR7 A;  1I50 J;  2VI6 A;  1QVT A;  3MN2 A;  2VUM J;  2LY9 A;  5EGO B;  1ZKG A;  4M6V A;  5FKO A;  3HOY J;  4MFE A;  5F27 A;  2AO9 A;  2DMU A;  2R5Y B;  5EG0 A;  1WCM J;  3OIO A;  1JTX A;  3HGG A;  1YRN B;  4M3G A;  1TWC J;  3HB9 A;  4C3I J;  1RET A;  2XPW A;  4D5C A;  1UMQ A;  2R5Z A;  1BW5 A;  1ZR4 A;  1DU6 A;  1RPW A;  3HOU J;  5IYB J;  1LFB A;  2NS8 A;  1TWA J;  1JT6 A;  4EEF G;  2LLK A;  3RQI A;  2ECC A;  4G12 A;  1IRZ A;  2NS7 A;  3OSF A;  1FEX A;  2IBD A;  1IDZ A;  5J1R A;  1VFC A;  4D7M A;  3GTG J;  4A3C J;  4BKX A;  2FD5 A;  1JJ6 C;  1XG1 A;  4JX6 A;  2NVT J;  2XGC A;  3GTQ J;  2JA6 J;  1BJZ A;  1VI0 A;  2W48 A;  4M3F A;  3A01 B;  2HOS A;  4D7N A;  1E3O C;  1RKW A;  2CQQ A;  4JP0 A;  3I4M J;  3S15 J;  5DS9 A;  3DEW A;  3S2H J;  2L7Z A;  2XGE A;  3BQZ A;  3S16 J;  2IEK A;  3M3Y J;  4XK4 A;  5JLX A;  2B63 J;  2OF7 A;  4A3G J;  1MBE A;  2FJ1 A;  4RDU A;  3S17 J;  2DMN A;  1T56 A;  3FKI J;  1B8I B;  1VND A;  3F0C A;  3JRH A;  3TP0 A;  3ZQF A;  2FQ4 A;  2YS9 A;  5E3L A;  2DTZ A;  1ETW A;  3G1O A;  5F1J A;  1ZR2 A;  4C3H J;  2COB A;  1HOM A;  2DMQ A;  1F36 A;  1WH5 A;  1QVU A;  3BQY A;  2L9R A;  2E2I J;  1OJL A;  4C3J J;  1AU7 A;  2DA7 A;  5C4X J;  1UHS A;  5IPA A;  1MH4 A;  2ELK A;  5IYD J;  3LSJ A;  4AYB N;  4XIC A;  1MBJ A;  2DMP A;  3HDD A;  1Y1V J;  5C3E J;  2LFB A;  2XSD C;  4XRS G;  3HKZ N;  4IHV A;  3JRD A;  3LSP A;  2LTP A;  2MW8 A;  4QSH A;  3HOW J;  2Y2Z A;  2E2H J;  1GT0 C;  3QPS A;  4ABZ A;  1Q1V A;  2LD5 A;  9ANT A;  2X6O A;  4XRM A;  2DA2 A;  4XRS A;  2JMW A;  4IEJ A;  2KT0 A;  1Z77 A;  4A3D J;  2DN0 A;  1OCT C;  2CUF A;  4CYC A;  1H89 C;  2DMT A;  2ME6 A;  4DZJ A;  2JA5 J;  5FKN A;  3L1P A;  1MBH A;  2E1O A;  2G0E A;  1WI3 A;  1S7E A;  3FIW A;  3HOX J;  1SFO J;  3SFI A;  1WH7 A;  2XB0 X;  4BY1 J;  2XPU A;  1TWG J;  5K7Z A;  3ZQL A;  2NVX J;  2TRT A;  5M3F J;  4M3B A;  2JN6 A;  4A3B J;  4MLO A;  2EZI A;  2HOA A;  1D5Y A;  2L0K A;  1UG2 A;  1A6I A;  3RZD J;  3OOU A;  3NAR A;  2DA3 A;  2Y9Y A;  1F43 A;  3CCY A;  2N8G A;  5M5X J;  4D5F A;  1K61 A;  5F08 A;  1ORK A;  2XGD A;  1TWF J;  1ETQ A;  5EG0 B;  1OFC X;  3BR0 A;  4X1E A;  3FIS A;  2E2J J;  4A3M J;  3C2B A;  4UUS A;  1FTT A;  1TWH J;  2P81 A;  3BR6 A;  1GDT A;  1P7J A;  1HDD C;  3S1N J;  2I10 A;  1B72 B;  3WHB A;  3LSR A;  4L5E A;  5M5W J;  4FE7 A;  5J3L A;  2JA8 J;  1ZK8 A;  3BG9 A;  3A03 A;  1ZGW A;  1W0T A;  5EGO A;  2K9N A;  3QPL A;  1MH3 A;  2M34 A;  2NOG A;  4DZP A;  2R5Y A;  1HCR A;  4A3E J;  1YRN A;  4J19 A;  3TED A;  1WGX A;  3IH2 A;  2LR8 A;  1IUF A;  2CQX A;  3CMY A;  1T33 A;  1ZQ3 P;  2JWT A;  4JX5 A;  4RBO A;  1JT0 A;  4BY7 J;  4A3K J;  3I4N J;  2H1K A;  1JKO C;  5E3M A;  1K83 J;  3O8G A;  4A93 J;  5GP9 A;  3TW7 A;  5GPA A;  4XID A;  5K7F A;  1IJW C;  2NVQ J;  2E19 A;  4DYQ A;  2GLO A;  3Q0V A;  1VF9 A;  1ZTR A;  1LE8 A;  1ITY A;  2DA5 A;  3FK6 A;  3E7L A;  5GPC A;  2AHQ A;  2HQ5 A;  2K40 A;  2HYJ A;  3RKQ A;  2R0Q C;  5F04 A;  1H8A C;  1XC5 A;  1H88 C;  2CJJ A;  1BL0 A;  2M9H A;  3GBG A;  3Q0U A;  3LOC A;  4NDL A;  1FTZ A; 
#chains in the Genus database with same CATH topology
 3DLA A;  3DU5 A;  4LG3 A;  2TCT A;  3H0G J;  1YG2 A;  3V7R A;  4JYK A;  2ZSI B;  1PVE A;  3P9K A;  4I6Z A;  4F91 B;  2FBK A;  2MBF A;  2WV0 A;  2KHM A;  2R7S A;  3S1Q J;  2RKH A;  1Z6R A;  3KE2 A;  4P1W A;  2V9P A;  3ZP5 A;  2Q0O A;  5LBQ A;  1O3R A;  3BRO A;  1B59 A;  4CCJ A;  3KP3 A;  2OQG A;  4XNF A;  4CCK A;  2MH2 A;  4XKV A;  3BTI A;  3BCA A;  1EKE A;  2BXY A;  2WWY A;  3LA2 A;  5AIQ A;  5HLT A;  2ID6 A;  3PO3 J;  3JRI A;  3QP6 A;  4Y52 J;  4GYG A;  4CYC B;  2RAE A;  2M2E A;  4RM3 A;  4G6Q A;  4U0Y A;  3C1D A;  2VJJ A;  3AL0 B;  3CME I;  2M8G X;  3CMA I;  2HKO A;  2EV0 A;  3BJA A;  2XHK A;  4LB6 B;  3L00 A;  3OYG A;  2HOE A;  2DCE A;  1KQ9 A;  3OL4 A;  2LRD A;  3LA7 A;  1E2X A;  5BQT A;  2VN2 A;  2DA1 A;  1EF4 A;  2LK2 A;  5IP9 J;  1Z7L A;  5DD8 A;  1G2H A;  3G2B A;  2QSF X;  2R4G A;  2WY8 Q;  5FD5 A;  2PJR B;  5ICF A;  5L3B A;  1EH7 A;  4KMU X;  3IV5 A;  4GGG A;  1IGN A;  3WU1 B;  4UY8 I;  2E1C A;  1VQN I;  1O4X A;  1T98 A;  1MMS A;  3CQZ J;  1ZGJ A;  3M8E A;  1R00 A;  4CHU A;  1YW7 A;  3EDP A;  4JQF A;  4KIG A;  1FOW A;  1IUY A;  1X1B A;  2V79 A;  2IAI A;  2DDA A;  3DPL C;  4L0Y B;  1IDY A;  4S0H B;  1ZG3 A;  3CCL I;  3K4L A;  2BY1 A;  5FLM J;  2NVU B;  2H6B A;  3S1R J;  1L0O C;  2AQF A;  1GUU A;  2X85 A;  2IGN A;  5FFX A;  3ECO A;  3KLO A;  1YYV A;  2DAO A;  4HDV A;  4HRI A;  5GAG J;  4G8X A;  1O7F A;  5LLQ A;  2YU3 A;  4U7B A;  1XSD A;  3WE2 A;  2JSC A;  3LSM A;  4BXF A;  4II3 A;  1X19 A;  3AKZ A;  1W0U A;  5K5O A;  4E7K A;  5D8L B;  3SZT A;  2ZCW A;  3LAP A;  2Q2E A;  3K1N A;  4IJA A;  3RQ4 A;  1QGP A;  2VL8 A;  3BP8 A;  3OWT A;  1QA6 A;  4Y13 A;  5IT9 Z;  3P9I A;  2BBY A;  3KPH A;  2Y31 A;  4L9J A;  3FXL A;  4QIW N;  1IXC A;  2R3S A;  2KIU A;  5JVG F;  2YPR A;  4P9U A;  5LRR A;  2HXI A;  3CLQ A;  3MD2 A;  1AHD P;  3G71 I;  1R4N B;  2Z33 A;  2K7L A;  5HLG A;  2PMZ A;  2P7C B;  1P2F A;  2CW0 F;  1HW2 A;  3CES A;  3ZCO A;  5E20 A;  1ULY A;  1QPI A;  1Z91 A;  3BTJ A;  1A36 A;  1K4S A;  1I6H J;  1I3Q J;  1T0F A;  1LE8 B;  3VYT B;  2KJC A;  3LSG A;  1R58 A;  4E7I A;  1X4P A;  1K6O A;  2HNH A;  2L9S A;  3BR2 A;  1Y8R B;  3M7G A;  2E71 A;  3UR3 C;  4CCL A;  1S3J A;  3A01 A;  2Y0S A;  4Z2Y A;  1BOA A;  2EB7 A;  4ANJ A;  4A69 C;  1N25 A;  2W85 A;  1FIA A;  4XMY A;  4G7H F;  2CW7 A;  1GV5 A;  3RYP A;  1TC3 C;  2VBX A;  2HDD A;  3ZMZ A;  5TJJ A;  4D1Q A;  4G7Z F;  2X6X A;  3GX4 X;  1TLH B;  5F0C A;  1B8I A;  2JK3 A;  4D9J A;  2X6Y A;  3CZ6 A;  2HVS A;  4EJO A;  2PQ8 A;  3LNQ A;  2DK5 A;  4QLC U;  1XMA A;  4A3I J;  1I1S A;  1OPC A;  2P4W A;  4LOC A;  3KEY A;  1K6Y A;  2Z2S B;  1BR4 A;  4XQF A;  4MTE A;  5IP7 J;  1ERD A;  2EIM H;  2ZXH A;  4IHW A;  2XPV A;  1VQO I;  3RTR A;  2M87 A;  4XKC A;  5ILS A;  3TW6 A;  2GBY A;  1W5S A;  2DO7 A;  5JVT A;  1QHH D;  3OY9 A;  2F4M B;  3GTJ J;  2FMY A;  1I5Z A;  2W84 A;  2WBM A;  3K1M A;  1QPM A;  4U0W A;  2HEO A;  3GF2 A;  3ABL H;  4W97 A;  3ZQG A;  4BHB A;  1STZ A;  3ZN0 A;  4I76 A;  4UUT A;  2QKM B;  4XN3 A;  1JGS A;  3Q0W A;  3VPR A;  3K4J A;  3WG9 A;  1OCZ H;  2EIL H;  3ZQI A;  1D5V A;  1T08 B;  1XCB A;  5EF6 A;  2BV6 A;  1O3S A;  3AL0 C;  4BDZ A;  3S1M J;  4GDF A;  1GVD A;  1YW8 A;  2XRN A;  3I54 A;  1YE9 A;  2EIJ H;  3PO2 J;  4CIC A;  1MBG A;  1V5F A;  1YS6 A;  2XRL A;  4L18 B;  5AIP A;  2FOW A;  5CKT A;  1VQ4 I;  1IG7 A;  3ZN1 A;  5ILU A;  2EFO A;  3QPT A;  4V19 K;  4ZYG A;  3TP3 A;  3WG7 H;  1FLI A;  2MA3 A;  4BEH A;  2MG4 A;  3IKT A;  2JA7 J;  5F0H A;  1Z3X A;  2KL4 A;  2WAQ N;  3EUH C;  3IH3 A;  2GIZ A;  4BE1 A;  3I5U A;  4N9H A;  3KEQ A;  1FX7 A;  3QP5 A;  1VQP I;  3D0S A;  4LFU A;  4BYY A;  2XIG A;  3E6M A;  1T39 A;  3JTG A;  4KIS A;  1DGR M;  3OYC A;  1X1A A;  1D3Y A;  1KA8 A;  1QVT A;  2VC1 A;  2DOD A;  4BQN A;  5DUK A;  1BJA A;  4M6V A;  5FKO A;  4BE0 A;  5CVV A;  2GXB A;  3H1C A;  3N4M A;  1WCM J;  4M9Z A;  4EAT A;  3OYA A;  3KEO A;  4BGD A;  4HBL A;  3N97 A;  3D5S C;  1BW5 A;  5DDG A;  3HRS A;  1R23 A;  3R0A A;  2DPD A;  2LY1 A;  2EIN H;  2NS8 A;  1SMT A;  1JT6 A;  2CS3 A;  2ZBK A;  2ZXW H;  3ROU A;  3NWT A;  4EGZ A;  3OSF A;  1LEA A;  1FEX A;  1HW5 A;  1G4D A;  2RN7 A;  4D7M A;  1Y6I A;  1H0M A;  1W5C C;  2OTL I;  2FD5 A;  2YX7 A;  4XN0 A;  5KCM A;  1H9G A;  1OIS A;  3JTH A;  5EJC A;  2GA1 A;  2VT2 A;  4HW0 A;  1MJA A;  3H0D A;  4GYI A;  3TL4 X;  3CCQ I;  3DU6 A;  4IKF A;  2A61 A;  2IA1 A;  4M3F A;  1VQ6 I;  2BVL A;  1E3O C;  4N0B A;  2W82 A;  3RDI A;  2L7Z A;  3BQZ A;  3H5R A;  4PZJ A;  1W7P D;  2OF7 A;  4A3G J;  4ZYA A;  5LGT A;  1I1G A;  1MBE A;  2ELH A;  4EM1 A;  2VKH A;  1VND A;  2L54 A;  2E35 A;  2MYS A;  1SFU A;  2PJP A;  3BPV A;  3FF5 A;  2DTZ A;  1ETW A;  1R71 A;  1HOM A;  1BOB A;  1WH5 A;  2H6C A;  1FSE A;  5FRO A;  4BJT A;  2R7R A;  3P9C A;  4C3J J;  5TGT A;  4WWC A;  5C4X J;  1UHS A;  2JT1 A;  5IPA A;  2QGU A;  3GO5 A;  5K5Q A;  2K27 A;  3FMR A;  4HPQ A;  3REO A;  3VSK A;  3V7C A;  4HDU A;  3HDD A;  4IL6 C;  3CJQ B;  1FMV A;  2XSD C;  2XVC A;  2O5R A;  1X1C A;  1WJA A;  2F48 A;  3KCC A;  2EWN A;  3VEP A;  1R7J A;  2DPU A;  3LSP A;  1UB9 A;  1WJB A;  2CSO A;  4XLA A;  2ESH A;  1WJC A;  4II2 A;  5ED4 A;  3QYB A;  4QSH A;  2Y2Z A;  2DFI A;  3K4K A;  4Z6Y A;  4E4H A;  2DDB A;  1ZGA A;  2A5W A;  2QYO A;  4I0B A;  3U21 A;  2VON A;  3WTY C;  3PQK A;  4XRM A;  2K3P A;  2Q1Z B;  3ZXS A;  2F4O B;  4B09 A;  3FX3 A;  2DN0 A;  4JBA A;  3H3Z A;  2L4M A;  3C2H A;  3DWL E;  1N77 A;  4H4K C;  4DZJ A;  2WA0 A;  4HEA 2;  1WJE A;  1ONV A;  3OS1 A;  3DLL F;  1C0W A;  2IS6 A;  1A04 A;  1WH7 A;  3F8F A;  3V8J A;  1HC8 A;  4OWR B;  3ELK A;  1TWG J;  2NNN A;  3CF2 A;  5KVR A;  3WTZ A;  4N4O B;  4AVP A;  2FNP A;  2TRT A;  5M3F J;  3TBI A;  1J75 A;  4RB1 A;  4BDY A;  2JN6 A;  4KIB A;  2P5K A;  4PUS A;  4KIF A;  2GXG A;  4EVI A;  2WAE A;  1A6I A;  3RZD J;  3NAR A;  1MNE A;  1UJ8 A;  3OR1 C;  5LEK A;  2Y9Y A;  3RPU A;  2A6E F;  3U1D A;  1OR7 A;  2G7U A;  2GZW A;  4D5F A;  5F08 A;  4IOC F;  1ORK A;  2LMD A;  3SZP A;  3B02 A;  2CWE A;  4M72 A;  1E0E A;  3BR0 A;  2CFX A;  4UUS A;  4A3M J;  1Y8Q B;  2MLK A;  3PSF A;  4O3M A;  3V7S A;  4LK1 F;  3WTT C;  4X0G A;  1YJN I;  2HKX A;  1EA3 A;  1E3H A;  5E8G A;  1XGN A;  2VE8 A;  2Z5U A;  2I10 A;  5H20 A;  1YI2 I;  1SAU A;  1TNS A;  1B72 B;  4UXN A;  3ZMS A;  3KIO A;  4ZJZ A;  2QQB A;  1G3Y A;  4FE7 A;  5J3L A;  4YEL A;  1ZK8 A;  5GAE J;  1Z7U A;  2RNG A;  3S3M A;  4F93 B;  4F55 A;  3J7Z I;  1HKT A;  3QPL A;  5L3C A;  1K78 A;  3R60 A;  1SD5 A;  5CYV A;  4AVZ A;  1VQK I;  3TQN A;  4HX7 A;  4KT5 C;  1T33 A;  4XR6 A;  4JX5 A;  1J59 A;  5E79 C;  3LFU A;  3WTV C;  2K02 A;  5E3M A;  3S2W A;  2MC3 A;  4BL0 B;  5GP9 A;  4R79 A;  2XSJ C;  1S72 I;  4JOM A;  3OYH A;  2E19 A;  2K85 A;  2BW3 A;  3H9G A;  1X1D A;  2J5O A;  3AFH A;  3VOD A;  1ITY A;  5FB2 A;  5GPC A;  3UNG C;  5F04 A;  3KLN A;  1H8A C;  4G94 A;  1XC5 A;  3TOB A;  2CJJ A;  3ERM A;  1E3P A;  4A0Z A;  1BL0 A;  3LL7 A;  3GBG A;  5BMZ A;  1UG0 A;  2Y75 A;  2ETH A;  5IY5 H;  1DPU A;  5CVJ A;  4AC0 A;  2PMZ N;  5K7H A;  1D0Z A;  2R7Q A;  3S32 A;  2OJE D;  4EM0 B;  5IT3 A;  3MKZ A;  4KT6 A;  5HLH A;  2VE9 A;  1VTN C;  5J4V A;  1ETO A;  2CRG A;  1Z67 A;  2IRF G;  3GTL J;  1R4M B;  2VJ4 A;  2KRF A;  3KP7 A;  5LHI A;  4HLY A;  3ZQH A;  1MKM A;  1S5L C;  4NC6 A;  5ICC A;  2KIM A;  1D8J A;  4ZTJ A;  1TQI A;  1WVR A;  1W5T A;  3ZMD A;  2ISY A;  2Y0S N;  3JCU C;  2H8W A;  2DOA A;  4RAG A;  4Y7N J;  3EYI A;  3H35 A;  1SFE A;  3TO6 A;  1Z05 A;  4NQW B;  1QBJ A;  1FC3 A;  4MNU A;  4BBR J;  2LOO A;  1OCO H;  1LFP A;  4BE2 A;  4KN4 X;  3F9K A;  4O5V A;  1SVO A;  2DQL A;  4P96 A;  1YO5 C;  1X3W B;  2EA2 A;  3CCS I;  3AG4 H;  4HLX A;  2W4S A;  1MSF C;  2LBF B;  2RVC A;  1GHC A;  4FAS D;  4FET A;  4YII A;  1U9O A;  1BN5 A;  3BG3 A;  4RB2 C;  2QWW A;  3MZH A;  3DEE A;  1KU2 A;  3QU6 A;  2DFF A;  2XB5 A;  2X51 A;  4IQJ A;  2OAZ A;  3FZV A;  2EZK A;  1KZH A;  1DU0 A;  4Q4Z F;  1D1A A;  3SFZ A;  4Q48 A;  2KIQ A;  2XRO A;  2IA2 A;  1ON2 A;  3AG3 H;  1YLF A;  4AIH A;  4BS9 A;  3HGY A;  4IOA F;  3NQO A;  1R5G A;  4CA0 A;  5H6Q A;  1SD6 A;  4Y4R A;  3HUG B;  1JKQ C;  4XOR A;  1JTY A;  3HG9 A;  3MWM A;  4M71 A;  4NUB A;  2HQN A;  2ZKZ A;  3GFJ A;  1A31 A;  1IV6 A;  2D5V A;  2VQG A;  4LG0 B;  1ETK A;  4L9T A;  4A3F J;  2JJ7 A;  4M3D A;  3DKW A;  1K79 A;  4L5I A;  3SQN A;  2Y30 A;  3LSI A;  3WHC A;  4B48 A;  2ZJR F;  1X58 A;  2M3A A;  2MH9 A;  3V4G A;  4EV0 A;  1BI1 A;  3WGH A;  3I59 B;  2JQ7 A;  2A69 F;  5HOD A;  1G59 A;  1YIJ I;  4CXF A;  4PFP A;  4U7D A;  4UNO A;  2KPM A;  4UV8 A;  4A2U A;  3DF8 A;  2JVH A;  2OA4 A;  4MQV A;  4XSX F;  5ICG A;  2IP2 A;  1ZRC A;  3JRC A;  1MMN A;  1GXP A;  1JUM A;  4MO7 A;  1HLV A;  3C7J A;  1MBF A;  4WK8 F;  4DJA A;  2FSW A;  1ON1 A;  2EQR A;  4YEJ A;  3OYN A;  3UKG A;  1B72 A;  3KP5 A;  2F5V A;  3BTC A;  1JUP A;  1JHH A;  2L9V A;  1KON A;  2F5C A;  1QHG A;  2B7E A;  5FLX Z;  2JA2 A;  3T8R A;  2DU9 A;  3U1K A;  2UZK A;  2W57 A;  3FBI B;  4CZC A;  2HR3 A;  1HKS A;  1BC7 C;  3BG6 A;  1XGS A;  1ETX A;  2KZV A;  2CUZ A;  3F72 A;  3TKY A;  3LAJ A;  1XTA A;  4UHT A;  3CJR B;  2DTR A;  4FT8 A;  2VKE A;  2Z99 A;  1ENH A;  2QQA A;  4FX0 A;  2V6C A;  2VOO A;  5DCM A;  4EMS A;  2K9L A;  3S2D J;  2O7O A;  4ETS A;  4DW6 A;  2IVM A;  2QA4 I;  3WE3 A;  2LY2 A;  3E6C C;  3GFI A;  1M1E B;  2P6S A;  2ZNY A;  2DYS H;  1R1T A;  3SDG A;  3SEQ A;  3CC4 I;  5JHU A;  2EIK H;  1R36 A;  5C4J J;  1B6A A;  4I09 A;  3W6V A;  4RAF A;  2GQQ A;  1A35 A;  1WWX A;  3GTM J;  2ZSH B;  3ONQ A;  5DD4 A;  2QCO A;  2A5Y B;  2QQ9 A;  4GXO A;  4R8H A;  2BY2 A;  1S29 A;  2ZXI A;  2K5C A;  1TW3 A;  3CCV I;  3FK7 A;  4B3A A;  2DFE A;  2VKD A;  3Q3S A;  2M0C A;  1AWC A;  1ETV A;  3AAF A;  4CGZ A;  2OC6 A;  2R7Z J;  2AS5 F;  3HOT A;  1A5J A;  4DYR A;  3A2K A;  5LD2 C;  4P5O A;  4OMZ A;  3AG2 H;  1WKM A;  2ID3 A;  1VQ8 I;  2HTJ A;  4HSR A;  3FM5 A;  4AUX A;  4RA2 A;  4XLE A;  4OIP F;  2L7F P;  3V8L A;  3TDZ C;  2K9Q A;  2LKX A;  3SEZ A;  4MFD A;  3SHF A;  3BWG A;  2OQR A;  5D6F A;  5J8F A;  2VJI A;  3F6V A;  3CDI A;  4NQW A;  1B9M A;  3CMM A;  4M9S A;  3K6G A;  1O3T A;  2NRA C;  1NG6 A;  1DGW Y;  2H1L A;  3HPH A;  5B66 C;  2BZT A;  5EZG A;  3BZC A;  1FOX A;  1AKH B;  1G6N A;  2DQR A;  1RKT A;  2L2O A;  2ZC2 A;  3GWZ A;  1JKR C;  2JPC A;  3JW4 A;  2FX0 A;  1BA5 A;  3GLX A;  1FYL A;  3D1N I;  3EYY A;  5IP6 A;  2CYY A;  1RES A;  1FSH A;  1FYK A;  2CUJ A;  5JFR A;  2IT0 A;  5C44 J;  4M3E A;  2ECB A;  5L3F A;  4Y15 A;  3U2R A;  3CO6 C;  1TT0 A;  2HDW A;  2QF7 A;  2X9D A;  4IPA A;  3CC2 I;  1IRG A;  4FIS A;  5E1Z B;  1P92 A;  3C2G A;  3JRE A;  4MHG A;  2VIX A;  4BH9 A;  1FBQ A;  5EDN A;  5EZH A;  4PJ0 C;  3I56 I;  1I50 J;  2VI6 A;  3E5Q A;  4PSW A;  3ISP A;  2VUM J;  2LY9 A;  1XGM A;  1U0J A;  2BGC A;  3F8C A;  1OCR H;  2M5W A;  4XBF A;  3F21 A;  3MEX A;  5F27 A;  1K4T A;  2DMU A;  1IZ1 A;  3HUG A;  2HQA A;  3OIO A;  5EG0 A;  3HGG A;  4Y17 A;  1J9I A;  1KYZ A;  4C3I J;  4PFO A;  4Y3O A;  3VB2 A;  1ZR4 A;  3Q9S A;  4ZH4 F;  1RPW A;  3GXO A;  3PQJ A;  2IGK A;  3BJ6 A;  3A0H C;  1IF1 A;  1R5I D;  3GME A;  1B1B A;  5GAD J;  1ZRF A;  2X1D A;  4G12 A;  1IRZ A;  4E7L A;  1VQ5 I;  2YSR A;  2IBD A;  3ASO H;  2QVO A;  2RQQ A;  3FM3 A;  5HDG A;  3I59 A;  2HYG D;  3V42 A;  3RYR A;  3GTG J;  4A3C J;  1JJ6 C;  4LB5 A;  3L2W A;  3SDB A;  4NBQ A;  3G3Z A;  3DP7 A;  4ENJ A;  2LH9 A;  4RMN A;  3WTW C;  1BJZ A;  3W6J B;  1VI0 A;  2HOS A;  1B4A A;  2HZT A;  2LKS A;  5B1B H;  3MAJ A;  2FBH A;  1RKW A;  2RGV A;  3PNV A;  2BOL A;  1MJ9 A;  3G4S I;  4KIC A;  2D1V A;  5DS9 A;  3DEW A;  5GAH J;  3QYE A;  2CH0 A;  2JUC A;  2NAZ A;  5JLX A;  2B63 J;  2QBY B;  1RC9 A;  3HHH A;  5J8C A;  2VAS A;  2FJ1 A;  4RDU A;  3S17 J;  2DMN A;  1XPX A;  3IRQ A;  1SD7 A;  1LDK B;  3M9A A;  2ISZ A;  2O03 A;  2L3D A;  3I58 A;  3O2P E;  3TP0 A;  4E6K G;  2FQ4 A;  2YS9 A;  5J40 A;  5E3L A;  2F6C A;  3G1O A;  4ZC3 A;  2COB A;  1HA8 A;  2FQ3 A;  4IO9 F;  4Q47 A;  1QVU A;  5D5U B;  5DUI A;  5BPI A;  1L3L A;  2L9R A;  2Y69 H;  1VQM I;  1F5T A;  2ELK A;  2XAU A;  3CCJ I;  3ABK H;  1RZ4 A;  2XAQ A;  1MBJ A;  3E5U A;  2IPQ X;  2LFB A;  4BHP A;  1FNN A;  4XRS G;  1ACI A;  1B9N A;  3DTK A;  1ZLK A;  3DV8 A;  2PLY A;  3E97 A;  4NC8 A;  1WFX A;  3OS2 A;  1DUX C;  1MW7 A;  1R22 A;  3K9T A;  4EJV A;  1D1C A;  2F4I A;  4WF2 A;  3L2V A;  2WB1 A;  1GT0 C;  1W4M A;  3QPS A;  4ABZ A;  1Q1V A;  2QEN A;  3HXL A;  4HV5 A;  9ANT A;  2X6O A;  5D5X B;  4XRS A;  3DPU A;  1VQL I;  2D45 A;  4CYC A;  1TTY A;  2DMT A;  2KJB A;  4ZYD A;  4CYD A;  3R6S A;  1MBH A;  5E1W A;  1W7P B;  1FOK A;  4LLN A;  2G0E A;  1S7E A;  1SFO J;  3WU2 C;  2XGX A;  4L9N A;  2E5Z A;  1HBX G;  2XPU A;  1V4R A;  3ZQQ A;  1IXR C;  2RNJ A;  2DOF A;  2L7K A;  3OIQ A;  4ENK A;  1F4K A;  5KHD A;  1VZ0 A;  4M3B A;  4B8X A;  2AXT C;  2EZI A;  2I8D A;  2M4K A;  3K70 D;  1UG2 A;  4RGX A;  3GVA A;  1PUE E;  1QO0 D;  3GZN B;  5B3S H;  4KIT B;  3EUH A;  2LC2 A;  3CCY A;  2PJR A;  2N8G A;  4BAY A;  1K61 A;  2ZME B;  2ZNZ A;  1PYV A;  3PFI A;  1OFC X;  2D1H A;  3MCZ A;  3SYT A;  4I7H A;  2E2J J;  1WJF A;  1R1U A;  1Z21 A;  1FTT A;  3DPT A;  2AQE A;  2MD5 A;  1KQ8 A;  3IKV A;  2P81 A;  4CO8 A;  2KIF A;  2QQ8 A;  1GDT A;  1QQI A;  1FOY A;  2DLL A;  4I98 B;  5F6F A;  4YIR X;  3QOE A;  4AWX B;  4DIQ A;  5LFA A;  4F52 A;  1IN8 A;  3GZ5 A;  1U5T B;  2KRH A;  4BHC A;  4PK4 A;  1T6S A;  3BC8 A;  2KZG A;  1SD4 A;  1O7L A;  2V26 A;  4RGU A;  1IN7 A;  2DBB A;  3J7A Y;  3EQL F;  2KIS A;  2KP6 A;  3COA C;  1OYY A;  3IHU A;  3M8F A;  1W0T A;  4IVN A;  4HNU A;  2IS2 A;  1SFK A;  2NOG A;  5J6X A;  1HCR A;  2VC0 A;  1PJR A;  4A3E J;  2XF6 A;  4ESF A;  1RRJ A;  3IUO A;  1FP2 A;  4HX4 A;  2EV6 A;  4IF4 A;  1RUN A;  2XAF A;  4PGH A;  4RBO A;  1JT0 A;  2VPL A;  4BY7 J;  3I4N J;  4HAM A;  2H1K A;  3KZI C;  1KYW A;  3EET A;  1WSU A;  4J01 A;  4HG2 A;  4A93 J;  4AYB A;  1ZG1 A;  1D8K A;  3LST A;  4KNY A;  3H5A A;  2JVG A;  3LMM A;  5GPA A;  2NVQ J;  5D5W B;  5CVI A;  4DYQ A;  2M0M A;  2ZJ2 A;  2FU4 A;  3HKZ A;  4AD9 A;  2KDO A;  1LE8 A;  2DA5 A;  3WGI A;  1T8I A;  3P5J A;  2AHQ A;  5BS6 A;  5HDK A;  2K40 A;  4KDP A;  2R0Q C;  2BY0 A;  3RPU D;  4XRF A;  3CLO A;  2GOM A;  3A1Y A;  4HQM A;  3L9F A;  1S7O A;  1ODD A;  1MDM B;  2HTS A;  2K86 A;  2HI3 A;  1CQT A;  3L2C A;  1SVL A;  4L5J A;  3H9J A;  1NTC A;  3KP2 A;  3LQR A;  5DEQ A;  3BDD A;  3HTU A;  3KET A;  1VQ7 I;  1JI8 A;  1Z6T A;  2GXA A;  4G6T B;  3ZGK A;  1BW6 A;  3RJP A;  3BTL A;  5BNG A;  4FTH A;  3RCO A;  1SAX A;  1I3A A;  4ON0 A;  1S9H A;  3O3K A;  3K4C A;  2E7W A;  1LFU P;  1QZE A;  4CCN A;  2BYV E;  2XAJ A;  5J4Y A;  1N78 A;  2IGM A;  3W2A A;  1S6L A;  2EJR A;  2VBY A;  4B1R A;  1BR1 A;  4A5M A;  1SAN A;  4WXC A;  3OR2 C;  2M45 A;  3O8H A;  2EFQ A;  4AU7 A;  1W1W E;  2R7V A;  3QPH A;  3G1L A;  2CQK A;  2LRE A;  2VXZ A;  3J81 K;  1NK2 P;  2CMP A;  5E3O A;  3K4N A;  4E7Z A;  2DA6 A;  3HSR A;  1XGO A;  4IXA A;  2EBI A;  4X6A J;  1S8N A;  5LRS A;  1U78 A;  1R49 A;  2XF5 A;  1IRF A;  2DOE A;  4B4C A;  1FYM A;  1DDN A;  2KKO A;  1IN4 A;  2L5Q A;  1XSV A;  3OYM A;  3VWB A;  3GTP J;  3OIP A;  3SXY A;  1HDP A;  3JSP A;  4XL9 A;  2STT A;  4V2F A;  3JR9 A;  5TRD A;  3IAM 2;  2EA4 A;  3BR1 A;  2WAD A;  4FQG A;  4MEY F;  2H94 A;  3QOP A;  1UFM A;  4C2U A;  2E60 A;  2Y9Z A;  2HXO A;  4XOP A;  2R5Z B;  2UWM A;  2X0L A;  5H2F C;  1G8X A;  3T0Y A;  2EFW A;  5J1U A;  2F5E A;  1R9T J;  3R61 A;  4U0V A;  4N9I A;  1MZB A;  2NYX A;  3CP8 A;  2ZME C;  2QEX I;  2M1B A;  2O9L A;  4BNC A;  4BU2 A;  5E1X A;  5HOO A;  2F2E A;  2FXA A;  2PMU A;  1XB4 A;  3KP6 A;  4MIM A;  3T5X A;  1UHM A;  4E7J A;  2DJI A;  4M9X A;  4EM2 A;  1VQ9 I;  2ZME A;  4L0Z B;  1R6R A;  2HZD A;  2COM A;  2X6W A;  4UB8 C;  5JLW A;  1MND A;  1XDU A;  2HPM A;  3O6B B;  2R7W A;  3K7A J;  2MD0 A;  1U5T C;  4EJW A;  5F64 A;  1BI0 A;  1XSX A;  1H9T A;  3R4K A;  4NHJ A;  2JPB A;  3MVP A;  3J80 K;  3H3V K;  2R92 J;  3TO9 A;  1MBK A;  1HKQ A;  2X1C A;  2W25 A;  3K0L A;  3CD6 I;  3B6A A;  2CO5 A;  5LHH A;  4ZTF A;  2OU2 A;  5E3N A;  1YFH A;  1BI2 A;  2FUG 2;  4HF0 A;  2FOK A;  3F8M A;  3FXK A;  2K9M A;  1NK3 P;  2CUE A;  1NHA A;  3GYH X;  3RKY A;  4F92 B;  2HVR A;  1P4W A;  1SVM A;  4LIV A;  3PM1 A;  2EZH A;  2MGQ A;  4GRI A;  5DTD A;  2W24 A;  3VYS B;  2O8K A;  3ZMU A;  4IHY A;  2ME0 A;  4CUG A;  3OYE A;  4K2E A;  2WV1 A;  3S14 J;  4IQ4 A;  1ZG5 A;  1D0Y A;  1OQY A;  1X2M A;  2VKV A;  3A02 A;  3F8N A;  4MGR A;  2JZY A;  2WTE A;  4RGR A;  4IHX A;  1XCV A;  2KDZ A;  4DOZ A;  4BQA A;  2GM4 A;  1YIO A;  3A0B C;  4M6X A;  1DP7 P;  1MMA A;  4E7H A;  4HNT A;  5IOY A;  1I27 A;  2E36 A;  5J47 A;  4W1U A;  4CZZ A;  1J2X A;  4BQO A;  1A6Q A;  3T1B A;  2M30 A;  2IGO A;  4QTR A;  2A68 F;  5FLV A;  1J09 A;  2UXX A;  4RLF A;  2P7V B;  1O57 A;  4HA8 A;  1LVK A;  4HF1 A;  3HOZ J;  1U9N A;  4D0P A;  3ZR8 X;  2QSG X;  2YUS A;  3RZO J;  4LLG F;  4G7O F;  3J81 Z;  5L3E A;  1T2K A;  1APL C;  4YFX F;  1MSE C;  1JKP C;  1UZC A;  4FE4 A;  4XKB A;  3GEZ A;  3VOE A;  1R5H A;  2QM3 A;  4RAZ A;  5CLS A;  3I64 A;  2W1O A;  1RR8 C;  3CJN A;  1RNL A;  5DCF A;  2R7O A;  3SZG A;  2OTJ I;  4GO1 A;  5A2Q K;  3FMS A;  1POG A;  3OYD A;  1XD7 A;  3CJT B;  3GUD A;  3L7W A;  3HIF A;  5H6R A;  3BR3 A;  3SJM A;  5B5E C;  5L3D A;  1LEB A;  2CU7 A;  2UXN A;  3OYI A;  2V1D A;  2EV5 A;  1HXD A;  4HNV A;  1MNM C;  2LKP A;  5FO5 A;  3VYU B;  3L2U A;  4UVC A;  3DEU A;  3R0J A;  1ZH5 A;  3IAS 2;  2O0Y A;  2OZU A;  4DGW B;  1KQ0 A;  2BVM A;  2L7M P;  1TL8 A;  2WB1 N;  4J00 A;  1GV2 A;  6PAX A;  4GCV A;  3FXR A;  3MZY A;  1TQP A;  4Q5S F;  3S8P A;  1I6X A;  5CQE A;  5F0F A;  1BR2 A;  5GTI C;  2ADU A;  4PCQ A;  3W6K B;  5IYC J;  2R93 J;  1RR7 A;  4QWQ A;  4OU0 A;  1BBY A;  2H09 A;  2HDC A;  4C2T A;  5EGO B;  5EEH A;  2PG4 A;  4XLC A;  5CVU A;  1SMY F;  2LG4 A;  4MFE A;  3FBN B;  2AO9 A;  1OYW A;  2R5Y B;  1YRN B;  4M3G A;  1TWC J;  2M7B A;  5KAI C;  4F7Z A;  2XPW A;  4D5C A;  1UMQ A;  2R5Z A;  1DU6 A;  2VQC A;  3HRM A;  3MKW B;  5K5R A;  5IYB J;  4BQQ A;  2KLO A;  2FEZ A;  1LPQ A;  2CFO A;  1TWA J;  3KYL A;  3RQI A;  5D4S A;  2ECC A;  1P9Q C;  5E18 F;  3GZ6 A;  2OV7 A;  3GFM A;  3C18 A;  1IDZ A;  5J1R A;  1DPR A;  2LF8 A;  4QPO A;  4RS8 A;  3F8B A;  3CCU I;  3IRR A;  1YJW I;  1ZRD A;  4E7S A;  3FXQ A;  1YX5 A;  2XGC A;  2L4A A;  1YW9 A;  2V1N A;  1E17 A;  3VFZ A;  3GTQ J;  4KMF A;  3PNT A;  1BI3 A;  4RAY A;  2JA6 J;  3HPG A;  4DBR A;  4OIO F;  1S7A A;  2W48 A;  2OBP A;  3A01 B;  3W2V A;  2RC4 A;  1QU3 A;  5IT9 K;  3I4M J;  1BIA A;  3S15 J;  3FXO A;  2VBW A;  2X1E A;  3S2H J;  1LUJ B;  3S16 J;  2IEK A;  3LFK A;  3ML6 A;  3M3Y J;  4BJ6 C;  5ICE A;  1PP7 U;  3F22 A;  1RI7 A;  3E6D A;  2FML A;  3RI4 A;  2LNB A;  2A3S A;  1T56 A;  3U9G A;  3FKI J;  4LIU A;  1B8I B;  3F0C A;  4CCM A;  2HU9 A;  5HDN A;  2E7X A;  3W2W A;  1LNW A;  2M8E A;  3KX2 A;  3BY6 A;  1IN6 A;  5D6E A;  1ZR2 A;  3OV8 A;  4C3H J;  2BXZ A;  4ZDO A;  2GWR A;  3BQY A;  2KRC A;  3MFK A;  2E2I J;  2DA7 A;  3I4P A;  4MQ9 F;  5BPD A;  1MH4 A;  1ZRE A;  1LB2 A;  2DK8 A;  2DT5 A;  4ENM A;  4AYB N;  2BE5 F;  2CQ7 A;  3DBR B;  4XIC A;  5A2Q Z;  4L9V A;  1Y1V J;  2BEO A;  3OMY A;  2NNY A;  2HQR A;  2RV8 A;  1EJ9 A;  4BJ5 C;  3HKZ N;  4IHV A;  2ZO4 A;  3M07 A;  3JSO A;  3H5N A;  4OAZ A;  3JRD A;  2FBI A;  1U2W A;  5HNH A;  1TT5 B;  1RUO A;  1ZAO A;  1BIB A;  3F6O A;  2E2H J;  3I71 A;  5BOX A;  2E5N A;  3QAH A;  1W36 C;  3FWE A;  4IEJ A;  3Q5F A;  2CV1 A;  5FD6 A;  4IZZ A;  2Q8K A;  1WQ2 A;  1QZZ A;  2CUF A;  2B0L A;  2GOX B;  1USS A;  1H89 C;  2ME6 A;  3MMY B;  1QNT A;  3EUA A;  2JA5 J;  3ABU A;  3I3L A;  2OCC H;  5FKN A;  2CV0 A;  2E1O A;  2HS5 A;  1WI3 A;  3E6B A;  2V9K A;  2D2W A;  4BEH B;  1LQ1 A;  2VB6 A;  1UST A;  4LLL A;  3D5R C;  4BY1 J;  3OS0 A;  3ERE D;  2LBF A;  1WZ2 A;  2O8X A;  3PIP F;  1AOY A;  5CJ9 A;  5K7Z A;  2NVX J;  4KYW A;  1J5Y A;  2FNA A;  3GLL A;  1J0R A;  4MLO A;  2BY3 A;  4A12 A;  2L0K A;  1D5Y A;  4DBQ A;  4BUP A;  1FT9 A;  3OOU A;  2IA0 A;  3HZJ A;  3KZY A;  4B47 A;  3I9V 2;  3FHZ A;  2LF7 A;  1NG7 A;  2VOP A;  2DT6 A;  1F43 A;  2P5L C;  1IAW A;  2P8T A;  3KFW X;  5FRN A;  1FWZ A;  2XUB A;  1R1V A;  1TW2 A;  3HSE A;  3PIO F;  3G73 A;  2XAH A;  1Y39 A;  4X1E A;  4LIT A;  4I99 C;  4Y33 A;  4S05 A;  3CCE I;  1TP4 A;  1DQU A;  3C2B A;  3IWF A;  1D0X A;  1TWH J;  4I0A A;  3E3V A;  4AID A;  2ZJP F;  1ZHF A;  2EFP A;  1GLN A;  3CDH A;  4LG0 A;  1BM9 A;  1P7J A;  2P5V A;  3W3C A;  4CSW A;  3QOD A;  1FBU A;  5HS9 A;  3WHB A;  3HHG A;  3LSR A;  4L5E A;  4ZZL A;  3KZZ A;  3H92 A;  4YFK F;  5M5W J;  4I2O A;  2JA8 J;  3CUQ B;  3S3O A;  2IJL A;  1WHU A;  2LSO A;  3BG9 A;  4DNC A;  2XV4 S;  1ZGW A;  2PBI A;  5EGO A;  4EJT A;  3TGN A;  1WRJ A;  1MH3 A;  4DZP A;  4CH7 A;  2B9S A;  2BHZ A;  2R5Y A;  3DXJ F;  1YRN A;  3CCM I;  4KUM A;  1WGX A;  2TDX A;  2XKP A;  3IH2 A;  4HST A;  2LR8 A;  3M1C A;  1CF7 B;  1IUF A;  4OIQ F;  2LYC A;  3CMY A;  1ZQ3 P;  2V1X A;  3HTS B;  2PMH A;  4UUV A;  1EH8 A;  2OD5 A;  4LMY A;  3NEU A;  1T0F C;  2MLG A;  4A3K J;  2ELJ A;  4PSX A;  4LD5 A;  4G9Y A;  4XLH A;  1K83 J;  4HX8 A;  4XSZ F;  1OLT A;  1IRX A;  4M73 A;  3RPQ A;  1OMI A;  2Z16 A;  3TW7 A;  2XAS A;  5K7F A;  4IHS A;  2M7A A;  2GLO A;  3Q0V A;  1Z9C A;  2OZ6 A;  3ULQ B;  2VQL A;  3ZRG A;  5LGU A;  2HQ5 A;  4HYE A;  2R7T A;  3RKQ A;  2UV1 A;  1X3Z B;  2IS4 A;  3KP4 A;  3ZMV A;  4KA4 A;  2M9H A;  3Q0U A;  4NDL A;  2PFB A;  1FTZ A;  5JHF A;  1EH6 A;  4WXD A;  4WCG A;  1Y1W J;  2Z3Y A;  4ASN A;  1V5G A;  5B1A H;  1T38 A;  2DA4 A;  5FJ8 J;  3RIR A;  1X4O A;  1GVJ A;  2CQN A;  1WPK A;  2LP0 A;  3VYR B;  3JRF A;  1ZN2 A;  3PUF A;  2NXN B;  2YR2 A;  3FHN A;  2XC7 A;  4PJM A;  5FKK A;  2E1M B;  2RDP A;  4A3J J;  4PJJ A;  4DYC A;  1IW7 F;  4YG2 F;  1ZYR F;  4IRH A;  2K9S A;  1ETY A;  1QZY A;  4ZYH A;  4FX4 A;  4U87 A;  4N4N B;  3RSN A;  3M4O J;  2MFZ A;  3A4C A;  3DCF A;  3OSG A;  3M8J A;  1MD0 A;  2H27 A;  5AON A;  3L2R A;  1N75 A;  3BR5 A;  4C2M J;  2O61 A;  4HF2 A;  5EEG A;  2DFH A;  2ESN A;  1YIT I;  3B73 A;  3HBL A;  1MMG A;  1U8B A;  3G6E I;  1PUF B;  1XS9 A;  3IL2 A;  1GXQ A;  2QSH X;  2VT3 A;  3C3W A;  3NAU A;  1RIO H;  4CCO A;  3CDL A;  2V4J C;  2F5D A;  2NVY J;  5IOZ A;  4UVA A;  2KMU A;  2DJN A;  3L2Q A;  4XKW A;  3BOQ A;  2RQP A;  4XM3 A;  3VDX A;  1KGS A;  2ZB9 A;  1X2N A;  1KU9 A;  2W7N A;  5CPR B;  2K4J A;  4B3X A;  4OMY A;  1AKH A;  1G3S A;  3OYL A;  2VOD A;  2DW4 A;  2X48 A;  2V1U A;  1TBX A;  4UUS B;  2MSY A;  4WX9 A;  2LDU A;  1MGT A;  1P4X A;  4OIR F;  2V7F A;  3CP2 A;  4M6Y A;  2VLA A;  3K4B A;  3PFY A;  4BAC A;  3F23 A;  4FHT A;  4XOT A;  3TDU C;  4XLN F;  3LA3 A;  2VQH A;  3LWF A;  1U6G A;  2YU9 J;  3BG5 A;  4A6D A;  3VSL A;  1IC8 A;  2JSP A;  3K2A A;  2H8R A;  3QRF F;  1XDS A;  2IS1 A;  4KFC A;  1Z3Y A;  2EFN A;  3IC7 A;  2I5U A;  2JRM A;  4QPQ A;  4P55 A;  4C9Y A;  2FE3 A;  2OCE A;  4I02 A;  3FMQ A;  5D4R A;  1K78 B;  4C30 A;  5JI6 A;  2CG4 A;  2K3F A;  3K2Z A;  3KYC B;  4IRG A;  5LHG A;  2AXL A;  5M3M J;  5ILV A;  4A3L J;  3DTE A;  3GFL A;  2HGC A;  4RM2 A;  2L9N A;  2BHY A;  3FKJ A;  2QKL B;  3G1M A;  1FP1 D;  1OKR A;  3DTI A;  4KJZ A;  1TNT A;  2HWV A;  1HF0 A;  1Y56 A;  1DP3 A;  2DT7 B;  4ESB A;  4NB5 A;  3E1S A;  5KK1 A;  1V5E A;  3CTA A;  2FA5 A;  3OYF A;  3TO7 A;  3I55 I;  3CUQ C;  3IP4 B;  1MJB A;  3GCM A;  4ITV A;  1G3W A;  4JX4 A;  3H9Q A;  3WTS C;  2HFH A;  3MQ0 A;  2QUF A;  3JRG A;  1JGG A;  3DQV C;  5HLI A;  3CUQ A;  3DKY A;  4WXH A;  3HSF A;  2BW3 B;  3HEF A;  5KAF C;  5DM6 F;  5E17 F;  5D5V B;  2Y48 A;  5FKL A;  1YQA A;  5FKM A;  5F1R A;  1FJL A;  4R1H A;  4LGW A;  2Y0M A;  1OCP A;  2CV2 A;  1LDD A;  2XKO A;  4GFB A;  3RKW A;  1U3E M;  2LVS A;  3ESW B;  2PN6 A;  1JE8 A;  4ENN A;  1CF7 A;  3JAM K;  3K70 C;  5J1Y A;  3BT9 A;  2A05 A;  1JUS A;  2O3F A;  3ABM H;  4V2G A;  3JRB A;  2V9V A;  3T8T A;  3WTX C;  1FMW A;  4UV9 A;  3BPX A;  4BBS J;  2QBY A;  1YJ9 I;  1X1P A;  2IXS A;  1JJ8 C;  1REP C;  5EYR A;  3HL2 A;  2FF4 A;  2VBZ A;  1P4A A;  3S93 A;  4YFN F;  4JK1 X;  1HW1 A;  2ZXJ A;  3GW2 A;  5K1Y A;  3ZPL A;  3ASN H;  2YX4 A;  1UHW A;  2R7F A;  3I53 A;  3K69 A;  3IH4 A;  5EEA A;  1F9N A;  4O6J A;  3CCR I;  2IW5 A;  3B6C A;  2HOT A;  4TV7 A;  3HOV J;  4XLP F;  2XF7 A;  2KFD A;  1AA7 A;  4BXX J;  2E1M C;  2V6E A;  1NH3 A;  3ZOB A;  4ZZD A;  1ZEL A;  3PJR A;  3GTO J;  1P7I A;  5DYM A;  1JXS A;  3MKL A;  4I01 A;  4ESJ A;  1MIJ A;  2KQR A;  4UVB A;  4MEX F;  2L02 A;  2Z1D A;  1XX5 A;  4BXU A;  3Q9V A;  1QRY A;  2WAF A;  3FXM A;  1K7A A;  1XMK A;  3IWZ A;  1SC7 A;  1WI9 A;  1JHF A;  2VPR A;  3L09 A;  1CGP A;  1HSJ A;  2P0W A;  3PL8 A;  1FPQ A;  3X2Q H;  4YIF A;  1KU3 A;  3ECH A;  4A5N A;  3DBL B;  3RKX A;  3HRT A;  3MKY B;  2HVQ A;  5ERI A;  4EGY A;  3GTK J;  3K1P A;  5M5Y J;  2GA2 A;  4S04 A;  3BZK A;  1U8R A;  3JRA A;  3EUK L;  4ZDL A;  2XAG A;  2ZFW A;  3K4M A;  4UB6 C;  3OYJ A;  3I0T A;  3QQA A;  1Z0X A;  2Z9O A;  4OOI A;  1J7K A;  2ACJ A;  4CDG A;  1OYI A;  2ZJQ F;  2MC4 A;  1FIP A;  4RB0 A;  4LK0 F;  1W7P A;  3HRU A;  4IX7 A;  1PUF A;  2R7X A;  3LSK A;  5LGN A;  2OPT A;  5HS7 A;  2CW8 A;  2W00 A;  3KYD B;  4FCY A;  3HM5 A;  1OR7 C;  2EZL A;  1F1Z A;  2EH3 A;  3MZ8 A;  3ZQC A;  4U88 A;  1FZP B;  1YS7 A;  1FBS A;  4ZDP A;  2DXI A;  3MN2 A;  1ZKG A;  3ZQ7 A;  3HOY J;  3QYF A;  1HQC A;  2G7H A;  1YHQ I;  1JTX A;  3HB9 A;  1RET A;  3CC7 I;  1FY7 A;  1OCC H;  3EPZ A;  3OYB A;  2GIV A;  4IRI A;  1ZLJ A;  4KN7 X;  3HOU J;  3LSH A;  1LFB A;  4A0X A;  4EEF G;  2LLK A;  2EK5 A;  1U5T A;  2NS7 A;  3N05 A;  5FFZ A;  1EV7 A;  1IXS B;  3HJE A;  1VFC A;  1WJ5 A;  4BKX A;  4M74 A;  1XG1 A;  3JAM Z;  4OAY A;  4JX6 A;  5KNL A;  2NVT J;  1IO2 A;  1YTY A;  3HYI A;  4A6E A;  2PX9 A;  2G9W A;  4OIN F;  3OYK A;  4RB3 C;  2E1N A;  5CQG A;  2DYR H;  3M1E A;  1HST A;  4D7N A;  2CQQ A;  4JP0 A;  3HOS A;  5DCM B;  3J7A O;  2XGE A;  4H0E A;  1KU7 A;  2PEX A;  4EQQ A;  4XK4 A;  2QZ8 A;  1SFX A;  3FXJ A;  2RRE A;  3E5X A;  4MTD A;  2DI3 A;  3OL3 A;  4PGG A;  2HYF A;  2QLZ A;  2K4B A;  3JRH A;  3FXU A;  2FRH A;  4A0Y A;  5DM7 F;  3ZQF A;  5JR3 A;  4RLQ A;  3H3U A;  5F1J A;  5FLX K;  2J5P A;  2DMQ A;  2JRT A;  1F36 A;  1G3T A;  1Y0U A;  3F3X A;  1P6R A;  1OJL A;  1AU7 A;  4B43 A;  3TMO A;  5L3G A;  1LVA A;  1XN7 A;  4E70 A;  1MDM A;  3BG7 A;  3K10 A;  5IYD J;  3LSJ A;  4HOB A;  2DMP A;  2GAU A;  4XON A;  5CVR A;  5TIS C;  5C3E J;  3BLY A;  1PDN C;  3CF5 F;  2VJ5 A;  1O3Q A;  1TZL A;  3ZMT A;  3DKX A;  2R7U A;  5FRM A;  5GTH C;  3NRV A;  2LTP A;  2STW A;  2MAB A;  1YOV B;  2MW8 A;  3CO7 C;  3HOW J;  4HV6 A;  5HVQ C;  3PUB A;  3QU3 A;  2LD5 A;  2WAQ A;  1V3F A;  2P6T A;  3ABT A;  2WC2 A;  3LQQ A;  1PP8 F;  2A07 F;  2F5F A;  2R7D A;  4EJU A;  2DA2 A;  2JMW A;  2KT0 A;  3AG1 H;  1WJD A;  1Z77 A;  4A3D J;  2VXD A;  5FGM A;  1OCT C;  4PDK A;  1Z1D A;  1UAA A;  5D8K B;  3L1P A;  5LEJ A;  3PNY A;  1T95 A;  3BCB A;  4ZYE A;  3J7Y J;  3HOX J;  3FIW A;  1XMX A;  4NNJ A;  3PSI A;  3SFI A;  2XB0 X;  2ICW G;  2O6G E;  4PJL A;  4F3Q A;  4AM3 A;  3ZQL A;  1LKX A;  2WY7 Q;  4A3B J;  2XDV A;  2HOA A;  1IV8 A;  1V55 H;  2NOJ B;  4NC7 A;  1BC8 C;  1Q1H A;  2DA3 A;  2JUG A;  1UCR A;  3FDY A;  5M5X J;  4LJZ F;  1MMD A;  2XGD A;  1TWF J;  1LDJ A;  1ETQ A;  4PJN A;  5EG0 B;  2Q2E B;  3FIS A;  3TOA A;  1YX3 A;  3J80 Z;  3DBH B;  3OOP A;  1LJ9 A;  3BZ6 A;  3WU0 A;  3BR6 A;  4XLF A;  3HC7 A;  3QWL A;  1HDD C;  1TQM A;  3S1N J;  2PI0 A;  4HQE A;  2E34 A;  2ZFU A;  2A6H F;  1D1B A;  5E8I A;  4IHT A;  3WTU C;  4AIJ A;  1UEL B;  2X4H A;  3A03 A;  3D5L A;  2K9N A;  4RGS A;  4HZF A;  3NWS A;  2M34 A;  5HS8 A;  4AIK A;  1X3U A;  5DV5 A;  4J19 A;  3TED A;  2JTV A;  2HPI A;  2OUM A;  2CQX A;  3WGG A;  1I39 A;  4P9F A;  2JWT A;  3S3N A;  1W36 D;  1SEU A;  3H36 A;  1JKO C;  3O8G A;  4G6D A;  3P7N A;  4XID A;  1IJW C;  4B44 A;  2NS0 A;  3BJO A;  2M4G A;  1VF9 A;  1ZAR A;  1ZTR A;  2UUZ A;  3WOD F;  3DFG A;  2C6Y A;  3FK6 A;  5HNF A;  3E7L A;  4DQ2 A;  3E0J B;  2A6T A;  2HYJ A;  1Y0N A;  2EPF A;  2CGP A;  1IN5 A;  1V54 H;  1H88 C;  2L01 A;  4YRV A;  3CUO A;  3LOC A;  3V8K A; 
#chains in the Genus database with same CATH homology
 4AC0 A;  2PMZ N;  2HI3 A;  1Y1W J;  1CQT A;  5K7H A;  2TCT A;  3H0G J;  2DA4 A;  1NTC A;  4JYK A;  5FJ8 J;  2LP0 A;  1WPK A;  1ETO A;  2CRG A;  3JRF A;  4I6Z A;  3GTL J;  5FKK A;  4A3J J;  3ZQH A;  1BW6 A;  4DYC A;  3S1Q J;  5BNG A;  3BTL A;  4FTH A;  2K9S A;  1ETY A;  3M4O J;  2Y0S N;  1LFU P;  3BTI A;  4Y7N J;  3DCF A;  3OSG A;  2ID6 A;  3PO3 J;  3JRI A;  4Y52 J;  4BBR J;  4CYC B;  2RAE A;  2M2E A;  3BR5 A;  4B1R A;  4C2M J;  1SAN A;  2M8G X;  3HBL A;  3O8H A;  1U8B A;  3G1L A;  1MSF C;  1PUF B;  1XS9 A;  1NK2 P;  1U9O A;  3NAU A;  3BG3 A;  5E3O A;  3CDL A;  2DA1 A;  1EF4 A;  2DA6 A;  2LK2 A;  5IP9 J;  2NVY J;  5IOZ A;  2XB5 A;  2EBI A;  4X6A J;  2DJN A;  1U78 A;  4B4C A;  1G2H A;  2EZK A;  1DU0 A;  2ZB9 A;  3GTP J;  1X2N A;  3IV5 A;  1HDP A;  1IGN A;  4V2F A;  3JR9 A;  1AKH A;  1O4X A;  3CQZ J;  3HGY A;  2X48 A;  3BR1 A;  4UUS B;  1JKQ C;  2MSY A;  1JTY A;  2IAI A;  2Y9Z A;  2HXO A;  2R5Z B;  1IDY A;  4S0H B;  1IV6 A;  2D5V A;  5FLM J;  1ETK A;  3S1R J;  4A3F J;  5J1U A;  2JJ7 A;  4M3D A;  1R9T J;  1GUU A;  2Y30 A;  3WHC A;  2YU9 J;  3BG5 A;  1IC8 A;  1X58 A;  2H8R A;  3K2A A;  2O9L A;  4MIM A;  1W0U A;  5HOD A;  5JLW A;  5M3M J;  4A3L J;  3G1M A;  3K7A J;  2Y31 A;  1HF0 A;  3JRC A;  4QIW N;  1JUM A;  4MO7 A;  1HLV A;  1MBF A;  2HXI A;  3MVP A;  1AHD P;  2EQR A;  1B72 A;  3UKG A;  2R92 J;  3H3V K;  1MBK A;  3BTC A;  1JUP A;  4JX4 A;  3B6A A;  5E3N A;  3JRG A;  1JGG A;  1QPI A;  3BTJ A;  3HEF A;  1I6H J;  1I3Q J;  5FKL A;  1LE8 B;  1NK3 P;  2CUE A;  5FKM A;  3LSG A;  1FJL A;  1OCP A;  3PM1 A;  2EZH A;  2MGQ A;  1ETX A;  3BR2 A;  5DTD A;  4GFB A;  2O8K A;  4IHY A;  2ME0 A;  2LVS A;  3A01 A;  2WV1 A;  5J1Y A;  3BT9 A;  3S14 J;  1JUS A;  2VKE A;  4V2G A;  1X2M A;  1ENH A;  2VKV A;  3A02 A;  4A69 C;  4IHX A;  3JRB A;  2KDZ A;  1FIA A;  3S2D J;  2O7O A;  4DW6 A;  2GM4 A;  1GV5 A;  1TC3 C;  4BBS J;  2HDD A;  5IOY A;  4W1U A;  3SDG A;  1JJ8 C;  5EYR A;  5F0C A;  1B8I A;  2JK3 A;  4QTR A;  5C4J J;  5FLV A;  3W6V A;  3LNQ A;  4A3I J;  3GTM J;  4LOC A;  3IH4 A;  5EEA A;  2QCO A;  3HOZ J;  1U9N A;  3B6C A;  5IP7 J;  2HOT A;  3HOV J;  4IHW A;  2XPV A;  3FK7 A;  2YUS A;  4B3A A;  3Q3S A;  3RZO J;  4BXX J;  2M0C A;  3TW6 A;  1ETV A;  1APL C;  2GBY A;  3ZOB A;  1MSE C;  1JKP C;  3GTO J;  1P7I A;  4FE4 A;  2R7Z J;  3MKL A;  1A5J A;  4DYR A;  3GTJ J;  2ID3 A;  1QRY A;  4AUX A;  4W97 A;  3ZQG A;  2L7F P;  4I76 A;  4UUT A;  1POG A;  3Q0W A;  3VPR A;  2VPR A;  2LKX A;  2K9Q A;  3ZQI A;  4MFD A;  5EF6 A;  3BR3 A;  3SJM A;  3S1M J;  3GTK J;  1GVD A;  5M5Y J;  3PO2 J;  1MBG A;  2CU7 A;  3JRA A;  5EZG A;  1AKH B;  2XRL A;  1RKT A;  3QQA A;  1Z0X A;  1MNM C;  4HNV A;  1JKR C;  1IG7 A;  2FX0 A;  1BA5 A;  1FIP A;  3D1N I;  3TP3 A;  5IP6 A;  2L7M P;  1PUF A;  1RES A;  2MG4 A;  2JA7 J;  5C44 J;  2OPT A;  2WB1 N;  4M3E A;  5F0H A;  2ECB A;  1GV2 A;  2WAQ N;  3IH3 A;  4FCY A;  2QF7 A;  3HM5 A;  2X9D A;  4FIS A;  2EZL A;  5F0F A;  3JRE A;  2EH3 A;  5IYC J;  2R93 J;  5EDN A;  3ZQC A;  5EZH A;  1RR7 A;  1I50 J;  2VI6 A;  1QVT A;  3MN2 A;  2VUM J;  2LY9 A;  5EGO B;  1ZKG A;  4M6V A;  5FKO A;  3HOY J;  4MFE A;  5F27 A;  2AO9 A;  2DMU A;  2R5Y B;  5EG0 A;  1WCM J;  3OIO A;  1JTX A;  3HGG A;  1YRN B;  4M3G A;  1TWC J;  3HB9 A;  4C3I J;  1RET A;  2XPW A;  4D5C A;  1UMQ A;  2R5Z A;  1BW5 A;  1ZR4 A;  1DU6 A;  1RPW A;  3HOU J;  5IYB J;  1LFB A;  2NS8 A;  1TWA J;  1JT6 A;  4EEF G;  2LLK A;  3RQI A;  2ECC A;  4G12 A;  1IRZ A;  2NS7 A;  3OSF A;  1FEX A;  2IBD A;  1IDZ A;  5J1R A;  1VFC A;  4D7M A;  3GTG J;  4A3C J;  4BKX A;  2FD5 A;  1JJ6 C;  1XG1 A;  4JX6 A;  2NVT J;  2XGC A;  3GTQ J;  2JA6 J;  1BJZ A;  1VI0 A;  2W48 A;  4M3F A;  3A01 B;  2HOS A;  4D7N A;  1E3O C;  1RKW A;  2CQQ A;  4JP0 A;  3I4M J;  3S15 J;  5DS9 A;  3DEW A;  3S2H J;  2L7Z A;  2XGE A;  3BQZ A;  3S16 J;  2IEK A;  3M3Y J;  4XK4 A;  5JLX A;  2B63 J;  2OF7 A;  4A3G J;  1MBE A;  2FJ1 A;  4RDU A;  3S17 J;  2DMN A;  1T56 A;  3FKI J;  1B8I B;  1VND A;  3F0C A;  3JRH A;  3TP0 A;  3ZQF A;  2FQ4 A;  2YS9 A;  5E3L A;  2DTZ A;  1ETW A;  3G1O A;  5F1J A;  1ZR2 A;  4C3H J;  2COB A;  1HOM A;  2DMQ A;  1F36 A;  1WH5 A;  1QVU A;  3BQY A;  2L9R A;  2E2I J;  1OJL A;  4C3J J;  1AU7 A;  2DA7 A;  5C4X J;  1UHS A;  5IPA A;  1MH4 A;  2ELK A;  5IYD J;  3LSJ A;  4AYB N;  4XIC A;  1MBJ A;  2DMP A;  3HDD A;  1Y1V J;  5C3E J;  2LFB A;  2XSD C;  4XRS G;  3HKZ N;  4IHV A;  3JRD A;  3LSP A;  2LTP A;  2MW8 A;  4QSH A;  3HOW J;  2Y2Z A;  2E2H J;  1GT0 C;  3QPS A;  4ABZ A;  1Q1V A;  2LD5 A;  9ANT A;  2X6O A;  4XRM A;  2DA2 A;  4XRS A;  2JMW A;  4IEJ A;  2KT0 A;  1Z77 A;  4A3D J;  2DN0 A;  1OCT C;  2CUF A;  4CYC A;  1H89 C;  2DMT A;  2ME6 A;  4DZJ A;  2JA5 J;  5FKN A;  3L1P A;  1MBH A;  2E1O A;  2G0E A;  1WI3 A;  1S7E A;  3FIW A;  3HOX J;  1SFO J;  3SFI A;  1WH7 A;  2XB0 X;  4BY1 J;  2XPU A;  1TWG J;  5K7Z A;  3ZQL A;  2NVX J;  2TRT A;  5M3F J;  4M3B A;  2JN6 A;  4A3B J;  4MLO A;  2EZI A;  2HOA A;  1D5Y A;  2L0K A;  1UG2 A;  1A6I A;  3RZD J;  3OOU A;  3NAR A;  2DA3 A;  2Y9Y A;  1F43 A;  3CCY A;  2N8G A;  5M5X J;  4D5F A;  1K61 A;  5F08 A;  1ORK A;  2XGD A;  1TWF J;  1ETQ A;  5EG0 B;  1OFC X;  3BR0 A;  4X1E A;  3FIS A;  2E2J J;  4A3M J;  3C2B A;  4UUS A;  1FTT A;  1TWH J;  2P81 A;  3BR6 A;  1GDT A;  1P7J A;  1HDD C;  3S1N J;  2I10 A;  1B72 B;  3WHB A;  3LSR A;  4L5E A;  5M5W J;  4FE7 A;  5J3L A;  2JA8 J;  1ZK8 A;  3BG9 A;  3A03 A;  1ZGW A;  1W0T A;  5EGO A;  2K9N A;  3QPL A;  1MH3 A;  2M34 A;  2NOG A;  4DZP A;  2R5Y A;  1HCR A;  4A3E J;  1YRN A;  4J19 A;  3TED A;  1WGX A;  3IH2 A;  2LR8 A;  1IUF A;  2CQX A;  3CMY A;  1T33 A;  1ZQ3 P;  2JWT A;  4JX5 A;  4RBO A;  1JT0 A;  4BY7 J;  4A3K J;  3I4N J;  2H1K A;  1JKO C;  5E3M A;  1K83 J;  3O8G A;  4A93 J;  5GP9 A;  3TW7 A;  5GPA A;  4XID A;  5K7F A;  1IJW C;  2NVQ J;  2E19 A;  4DYQ A;  2GLO A;  3Q0V A;  1VF9 A;  1ZTR A;  1LE8 A;  1ITY A;  2DA5 A;  3FK6 A;  3E7L A;  5GPC A;  2AHQ A;  2HQ5 A;  2K40 A;  2HYJ A;  3RKQ A;  2R0Q C;  5F04 A;  1H8A C;  1XC5 A;  1H88 C;  2CJJ A;  1BL0 A;  2M9H A;  3GBG A;  3Q0U A;  3LOC A;  4NDL A;  1FTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...