1FOWA

Nmr structure of l11-c76, the c-terminal domain of 50s ribosomal protein l11, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution solution structure of ribosomal protein L11-C76, a helical protein with a flexible loop that becomes structured upon binding to RNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
molecule keywords L11-C76
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1996-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1fowA00
1YJWI 1VQMI 3CD6I 3CCJI 2E36A 3G4SI 2OTLI 2E34A 1FOYA 4V19K 3CCRI 1VQ9I 1VQ6I 1YJNI 1YITI 3J7YJ 1VQ7I 5GAEJ 1VQKI 1Y39A 1VQ5I 1FOWA 2QEXI 3CCUI 1S72I 2H8WA 2K3FA 2JQ7A 2NXNB 3CC2I 3I56I 3CMEI 1VQOI 2QA4I 2E35A 1ACIA 1FOXA 5DM7F 4IOCF 1YJ9I 1VQLI 2FOWA 3CCSI 3PIOF 4IO9F 2ZJPF 1MMSA 3DLLF 1HC8A 2ZJQF 2ZJRF 3CCVI 4UY8I 5GADJ 3CCLI 3CC4I 3PIPF 3CCEI 3CCMI 3CCQI 1YIJI 1VQPI 1VQ8I 1YI2I 3G71I 3I55I 5GAHJ 3CC7I 3G6EI 5GAGJ 1QA6A 1VQ4I 1YHQI 3CMAI 3CF5F 2OTJI 3J7ZI 5JVGF 5DM6F 1VQNI 3CJTB 4IOAF
chains in the Genus database with same CATH superfamily
4S0HB 4P96A 3JCUC 3HTUA 3BG9A 3E1SA 3Q9SA 3CCYA 3SZPA 2E7WA 5DUIA 5DCMA 5FKLA 4E7KA 3C18A 3CMEI 4BHCA 2M4GA 4LLGF 5ICGA 2B9SA 2VUMJ 2K3PA 2P4WA 2XF6A 3WTSC 4HQMA 2DFHA 2KL4A 4G9YA 2ZC2A 5GPCA 1JJ8C 2CUFA 3MEXA 1R1TA 4ZYHA 1E0EA 2IAIA 2E5NA 1B8IA 3G73A 4XKCA 4BAYA 1S3JA 4ETSA 5TRDA 3H36A 2DMTA 1IUYA 1BR4A 1Y1VJ 1YTYA 1E2XA 2ZFUA 1YW9A 1K79A 2YR2A 3KEOA 4LK0F 1P6RA 3OL3A 2PX9A 1STZA 2HU9A 5H2FC 3HKZN 3CCVI 2ZJ2A 3N4MA 3RSNA 3PNTA 3OYKA 1IXRC 1QZZA 5HLGA 2J5PA 3BLYA 4KT6A 2W57A 4IHTA 2RKHA 4RBOA 1ZN2A 1YIOA 1ETKA 1TWCJ 4HNVA 1UAAA 4Y3OA 1BN5A 3LSRA 2I5UA 1QVTA 2VOPA 1R1VA 3DPLC 1D3YA 1L0OC 2Z9OA 3I59A 5IP7J 1IN6A 2XRNA 1EH7A 4TV7A 3EPZA 1ZRFA 2A05A 1V4RA 3MMYB 1TZLA 4G7HF 1Z91A 4RAZA 1BBYA 2W82A 3WTVC 2M7AA 3F8CA 3V8KA 2Z99A 3AKZA 3BG5A 1FTZA 3T8RA 2KIFA 1XTAA 4P9FA 4WK8F 3M9AA 1WVRA 1T6SA 3ULQB 3O6BB 4YIIA 4HLYA 3C7JA 2V6EA 4XKWA 1B72A 3NWSA 3VODA 1XSDA 2NS7A 4PDKA 4Z6YA 1GLNA 5ICCA 1QU3A 2D45A 5ED4A 3BG3A 4ZTJA 2JA5J 2G0EA 2FXAA 4HPQA 1Q1HA 2VT3A 3DU5A 1X1PA 3GBGA 1T98A 3RCOA 3MFKA 2VOOA 2FEZA 3Q0UA 2IRFG 3ABLH 3KETA 3U9GA 2IT0A 1YLFA 2KP6A 1NG7A 4HV5A 3GTMJ 4IHSA 3G4SI 1KU7A 4AIKA 4HF1A 4EJTA 2Y9YA 2RV8A 3ZMUA 1I5ZA 2TRTA 1Z67A 1TT5B 2M5WA 4XIDA 3Q0VA 1WJEA 3KFWX 3TO6A 1DP7P 4PJLA 1RKWA 4B3XA 4A12A 4D1QA 3F8NA 4OMZA 4RAFA 2R7WA 2VXZA 5LRRA 2DJNA 1T0FC 3KEYA 2ELKA 2DW4A 2EQRA 3HGYA 1VQ4I 3GZ5A 2OJED 2Z3YA 3ERMA 4WF2A 3VYUB 1JGSA 3RKWA 3BT9A 3QPSA 2MGQA 5FLVA 2KRFA 1BL0A 3OYFA 1UCRA 2N8GA 3BTIA 3MKZA 3S2HJ 3JAMK 4WWCA 4UXNA 2FOWA 2KQRA 2KRCA 3HIFA 4FETA 4V2FA 1TQMA 3GTJJ 3TOAA 1MKMA 1B72B 3H5NA 4A3LJ 1N78A 1QHGA 3WTUC 1ZQ3P 4UNOA 1P4AA 2F5FA 2RNJA 3DBHB 1J09A 2VJIA 2HVSA 4O5VA 2VASA 4RM2A 4GYGA 2EFPA 3EUHA 2KZVA 3PSFA 2H27A 4J19A 1ZK8A 3VOEA 1KU9A 4LG0A 3IRQA 1S72I 3VSLA 4M3EA 4C2UA 3I4NJ 1X1DA 5DCMB 3L2VA 3HJEA 4L5EA 3KP3A 4ENNA 3O8HA 2XKPA 1Z3YA 1Y6IA 1MJ9A 4L9TA 2DMNA 2QENA 4L9JA 2XGEA 4ZYDA 2XIGA 4J00A 3BG7A 3CTAA 4NC6A 5KK1A 5HOOA 4C3HJ 1RIOH 1JJ6C 4RMNA 1R5ID 2A6HF 2QLZA 2VT2A 1XPXA 1RESA 5K7FA 2L4MA 2V9KA 5DM6F 4EJWA 4IOAF 1HSTA 2NVUB 3CCJI 1VQ6I 3BJOA 3DTEA 3K10A 1G2HA 4FTHA 1B6AA 2WV1A 4PJ0C 2Y0SN 4XK4A 2JK3A 2M4KA 1TQIA 3WGHA 4PJMA 1YJ9I 2F5DA 2R7OA 3HOZJ 2A6TA 4A3CJ 2E7XA 4B44A 3JRBA 5FROA 2HVQA 4N9HA 3BC8A 3EDPA 4JOMA 2LREA 2DCEA 3IL2A 4NC7A 4A5NA 2IGNA 1BC8C 2NS0A 2M8EA 3C2BA 3R60A 4ITVA 1DPRA 5BPIA 3OSFA 1SMYF 5J4VA 4UB6C 1T33A 1ACIA 1J7KA 1FC3A 2V9VA 3HRUA 3SZTA 1U5TB 3K4CA 2CUJA 1HW2A 3SQNA 1IF1A 1MMSA 4M73A 3DLLF 1LKXA 1SFOJ 3QPTA 1IW7F 2W85A 3E97A 1W36D 3DEUA 4EEFG 2NAZA 5J1YA 4FT8A 1USSA 3IAS2 2EIKH 2HQ5A 4IPAA 5JVGF 1HW1A 4Q47A 1H89C 4E7SA 3CQZJ 1Z6RA 2CO5A 5TJJA 4F92B 3RKQA 2F5CA 2R7RA 4RGXA 5DS9A 3DPTA 5A2QZ 2XRLA 3ROUA 2L5QA 3OYCA 3OIQA 1VQOI 4IHYA 3H9JA 4CO8A 2XAGA 4B47A 2HXIA 5ILSA 3M1EA 3V42A 4ASNA 5HLHA 2F6CA 2WWYA 4BQNA 1ONVA 4RLFA 1PJRA 3U2RA 2R0QC 4RB0A 3CJTB 1TP4A 5CVJA 3ABKH 2PQ8A 3TKYA 1TNSA 3T1BA 1WJFA 2HR3A 3OV8A 1SD6A 2F5EA 4RGSA 2YX4A 2E35A 2EK5A 3TW6A 3PQJA 3FM3A 1VQLI 2P8TA 1FBUA 1ZAOA 3VDXA 5E18F 1FT9A 1QRYA 2EFWA 3HPGA 5BPDA 2LFBA 4M3BA 4UY8I 2PG4A 3LQRA 2Z2SB 1YIJI 2ZNYA 1D1CA 3UR3C 5ILUA 1IRGA 1WH7A 4HX7A 2DO7A 2FX0A 1WWXA 2L2OA 3ELKA 2ZSHB 1VFCA 2STTA 1HW5A 4G12A 3IRRA 1IJWC 4Q4ZF 2EILH 2WY7Q 1JUMA 2COMA 2M3AA 2ZSIB 2VLAA 3SJMA 2L0KA 4FX4A 4LG3A 2V1UA 5J47A 4Y7NJ 2XAUA 4UVAA 3S3OA 5AIQA 4OMYA 1I27A 2MH2A 1ETWA 4EM1A 1HCRA 3U1KA 3GTGJ 1HKTA 2AQEA 3BZCA 1W5TA 4C2MJ 1REPC 4G94A 3TDUC 2LNBA 3U21A 4WCGA 2CUEA 3QOEA 1LPQA 1A6IA 3OS2A 4FE7A 3FMQA 3BR2A 1IV8A 4HLXA 2E34A 5EJCA 2IGKA 3OYLA 2XVCA 5FKMA 3WTXC 4Q48A 5J6XA 2DFFA 2STWA 5IYBJ 4BBSJ 3LSPA 1J59A 5J1UA 2PJRA 4IL6C 4UB8C 4DGWB 4QPOA 1R22A 4ZH4F 3K9TA 2R92J 4B09A 3E0JB 2MLGA 4Y17A 4HDUA 3GUDA 2FUG2 4EGYA 1OYWA 2LOOA 4XSZF 4NDLA 5ICEA 1KA8A 5B5EC 2HYFA 1HDDC 4CICA 3MZHA 2GIVA 3LSGA 4KT5C 5DM7F 4LLLA 4OINF 3EYYA 3PJRA 4AWXB 3GVAA 4M9ZA 1DGWY 1XC5A 1PUEE 4HF2A 2CQQA 2FU4A 3OYDA 1ERDA 3GTOJ 3EUAA 3DXJF 2CGPA 1D0ZA 1B8IB 2A69F 1W7PB 2DQRA 1JXSA 2KLOA 4KIBA 3C2GA 1E3OC 2VONA 2IA0A 3WU2C 4BJTA 4OIPF 1G59A 2XDVA 3ZN0A 1BI3A 5M5XJ 3WE2A 1WPKA 4KA4A 3OWTA 1ZRCA 3GFLA 1K4TA 2F4OB 5J1RA 2LY1A 3QOPA 2K4BA 1B1BA 1QHHD 2KIMA 4JK1X 4F55A 1PYVA 3CLOA 3ZGKA 2WAFA 1XB4A 2OCCH 1OMIA 4A6EA 3DKYA 3R0JA 5JFRA 5BQTA 3HB9A 2HPIA 2ACJA 3D5RC 1DU6A 2LKPA 1MW7A 3JW4A 5E3MA 2IGMA 3BWGA 4EQQA 1U8RA 2V7FA 2DDAA 2FNPA 4LB5A 2QEXI 1M1EB 1LB2A 2JA8J 2IEKA 3G3ZA 1IG7A 1FOKA 3BTLA 4DNCA 2OUMA 2K02A 3CP2A 2E2IJ 2W25A 2H6BA 3FXKA 1SAXA 4MO7A 3CDHA 2LG4A 3J7ZI 3A0BC 1VQNI 2EZIA 1HKQA 2JWTA 3PUFA 2Y75A 3GYHX 2JVGA 4OIOF 2PJPA 3QYEA 3J81K 4IRHA 4MEXF 3JR9A 4C3JJ 3GFIA 5IT9Z 3R4KA 3CUQB 4IHWA 3KP5A 1V5FA 5FLMJ 1A6QA 3W6JB 1TTYA 2VB6A 2E1MB 1FP2A 2F5VA 3TEDA 2ZJRF 3OYBA 1V55H 4E7HA 1QPIA 3SXYA 4KFCA 3RZDJ 3F9KA 2UWMA 3F8FA 2X6WA 4II3A 1VQPI 4MFDA 1IN5A 5B3SH 3M8FA 4ZYAA 3SDBA 3WU1B 1KGSA 3BQZA 1R1UA 2BE5F 1Y1WJ 3I58A 1ULYA 5IP9J 2JA6J 4BH9A 2Y30A 3PO2J 3SHFA 1HQCA 4HDVA 1UG2A 3QP6A 5IPAA 3JSOA 2D1VA 2BOLA 3S15J 4G6DA 4XRMA 3OYMA 3PIPF 1EH6A 2EBIA 2GZWA 2ADUA 5LBQA 4II2A 3J7AY 3GWZA 4RS8A 4QPQA 1QBJA 2TDXA 2V1XA 2W00A 3RYPA 2ETHA 2KMUA 1UJ8A 3GLXA 3AG2H 1G3SA 3KPHA 4A3MJ 3C1DA 1VQKI 3K4BA 2LBFB 2ZXIA 3A02A 2GXBA 3RQ4A 2BXZA 4NQWB 3MWMA 2ECBA 3PO3J 1SFXA 4R1HA 1W4MA 4ZTFA 1ETXA 1JUSA 2FJ1A 3W3CA 3GZ6A 3QP5A 3KP7A 1YRNA 4I98B 2BY1A 4I7HA 1LFBA 1TNTA 5EGOB 2XF5A 1WQ2A 3IUOA 5LFAA 2JRMA 2GXAA 4GRIA 4QSHA 3N05A 4XLCA 4U88A 3HRTA 5E1WA 4G7ZF 1R9TJ 4CCMA 4XL9A 2BXYA 4AYBN 3CCUI 2MH9A 2LSOA 1SVMA 1BJZA 2GA1A 3B6CA 1D1BA 4P1WA 3Q0WA 2KIUA 5F04A 2DT7B 2V6CA 3RYRA 1ZYRF 1MJBA 1A31A 1BIAA 3MN2A 5D6EA 4FX0A 2EINH 2EA4A 5K5QA 1MBHA 5F64A 2O8XA 2CW8A 1GV2A 3IWFA 5HNHA 2E1CA 1ON1A 3DQVC 2DPDA 2DFIA 1H8AC 4CGZA 1R4MB 2ECCA 2ZKZA 4IXAA 1Y39A 3IKVA 3FMRA 1DGRM 1U5TC 3OS1A 3PL8A 1V3FA 1NK3P 1FIAA 4PZJA 3CJRB 3QQAA 4HX8A 1YS6A 3DFGA 3LFKA 4JP0A 1LJ9A 4E4HA 3E3VA 3DEEA 3FXMA 4E6KG 2K9LA 3UKGA 1Z1DA 3A0HC 2QF7A 1MZBA 3ZQFA 4A0YA 2L7ZA 4MTEA 5HS9A 3ZN1A 4RM3A 4AU7A 1KONA 2QSGX 1Y8QB 5EG0A 2BY2A 4HOBA 1YJNI 2MC3A 3HOTA 2E1OA 1BJAA 4FCYA 2R93J 1FMWA 2O61A 2OZ6A 2XAFA 2JPBA 3OOPA 3X2QH 1I50J 2XGXA 4DW6A 3VSKA 1WI3A 2P6TA 1NG6A 1B9NA 2OZUA 4P5OA 1KQ8A 1CF7B 3M7GA 1LDKB 2M30A 5ICFA 3CC4I 5KNLA 3L09A 5B66C 3CLQA 2JUCA 6PAXA 2Y31A 3GZNB 3H0GJ 2Z33A 4Y15A 1BOBA 4IZZA 2BY3A 4CZCA 4XRSA 4L5IA 5LLQA 2X6XA 1P4XA 5IYDJ 2CW7A 3SFIA 2NVTJ 2KJBA 1RC9A 3I4PA 3GCMA 3JRIA 1R23A 4PUSA 2FQ4A 2AO9A 4BHBA 3QYBA 1S5LC 4LIVA 2JN6A 2A6EF 5D4SA 4KMFA 3VB2A 1S7OA 2M9HA 1XS9A 4GO1A 2X6YA 1G6NA 3RKXA 2BW3B 5FB2A 2VBYA 1MDMB 4GGGA 3PNYA 5CVVA 3WU0A 4DOZA 3BZ6A 3QRFF 5J40A 2BW3A 2RQQA 2XSDC 2CG4A 4PCQA 3NARA 1VQ5I 1FEXA 3QAHA 2LC2A 2ISZA 5GTHC 1D0XA 2X1CA 3HSEA 2CFXA 3FZVA 2V79A 2IW5A 3R0AA 4HZFA 1DP3A 3GMEA 4WXDA 3ZQGA 5FRMA 4HQEA 1LDJA 3OSGA 1SANA 1SD4A 4MEYF 2XKOA 5E1XA 4E7JA 3DPUA 2MLKA 2NOJB 2HQNA 1LVAA 2FD5A 3P7NA 4CCOA 2ZMEA 4D0PA 1DDNA 1OCCH 1DU0A 4WXHA 4XOPA 5K7HA 4KN7X 3KE2A 3SYTA 2FMLA 3BR1A 5CVIA 5FKKA 1EF4A 2O6GE 3GTPJ 4R79A 1V5EA 2QQAA 2M1BA 1FYKA 2CQNA 3TO7A 4PJNA 3VYRB 1ZG1A 1RR8C 2GBYA 3LSMA 2DA7A 4NC8A 3HOUJ 2E60A 2JJ7A 4NHJA 3GEZA 5CLSA 2EJRA 5D5UB 2R7FA 4XRSG 1GXPA 2MA3A 2R7DA 3LA2A 3ONQA 4L9NA 4I6ZA 1IC8A 3TBIA 4HNTA 4LFUA 4HG2A 1YS7A 2VKHA 4ZC3A 1AU7A 2DLLA 3RPUD 2KIQA 2ELJA 5EZHA 4DYQA 2ZBKA 2V26A 1X3UA 2EFNA 4ANJA 3BTCA 3F0CA 4I0BA 5IOYA 4HAMA 4OIRF 3W2AA 2XAQA 3P5JA 3QODA 1Y0NA 4F52A 1MD0A 5E79C 3IKTA 4RA2A 4CUGA 3TOBA 4A3EJ 4Z2YA 1ETVA 3SEZA 3JRCA 1SEUA 4FE4A 4C2TA 3K4MA 5FO5A 3HBLA 1HBXG 4KISA 5DD4A 2B7EA 3FHNA 2DFEA 1XDSA 2MABA 3EUKL 3D5SC 1SFKA 1OLTA 1IRZA 4B43A 2Y0SA 4AUXA 2HQRA 2R7XA 1OR7C 1E3PA 4QTRA 3HOSA 4BS9A 1OKRA 1HDPA 2AXTC 3REOA 4AD9A 4PSXA 2K40A 3FK7A 4ZDPA 4Y33A 1S6LA 5EEHA 5J8FA 5E1ZB 4KUMA 4BNCA 3S1QJ 1JHHA 1G8XA 2KKOA 3KIOA 4UVBA 4XORA 5JVTA 5K5OA 3F21A 3K1MA 1PVEA 1QQIA 3CO7C 1FSEA 1WHUA 3H3UA 1IZ1A 4CCJA 2LH9A 3FM5A 2QUFA 3PIOF 4GXOA 3MAJA 2DT5A 2LBFA 2IP2A 2IS6A 5LHHA 2COBA 2BGCA 1K78A 2MFZA 1MSFC 2QWWA 3ZQIA 1VQ8I 2CV1A 3BTJA 2DXIA 2XPUA 2L3DA 1BC7C 1LNWA 2VL8A 3L7WA 2L4AA 2X1DA 4CH7A 4JX5A 1FYMA 2OTLI 3H5RA 4S04A 3QPLA 1ZGWA 3F8BA 4KYWA 4HW0A 1R71A 4XICA 2EH3A 1IV6A 2ME0A 4XOTA 2KZGA 4M6YA 1U6GA 1I3AA 4BJ5C 1YFHA 2X1EA 2L7MP 5M3FJ 1D5YA 2HI3A 1S7AA 5CPRB 5L3FA 1B4AA 2MBFA 3E6DA 4G7OF 3RPQA 1ETYA 4X1EA 1TWGJ 4XLHA 4AVPA 5E3OA 1MIJA 5FRNA 4L5JA 2NRAC 3CF2A 3V4GA 1WRJA 3F22A 3GF2A 2GM4A 2VIXA 2E1NA 4BQQA 3IC7A 1FOXA 3WGGA 5BNGA 4M72A 2F4MB 3GFMA 2DTRA 3KP4A 1BR1A 2CWEA 1IXCA 1XX5A 2O7OA 5IY5H 2DK8A 4UUTA 2VQLA 1WKMA 2M45A 5FKOA 4EM2A 4I76A 4XN3A 1D1AA 1VF9A 1JUPA 2D1HA 3I54A 4PJJA 2MYSA 3T0YA 4KICA 5CQGA 4NB5A 2X51A 1SMTA 1WJBA 3IH3A 5GPAA 1NHAA 1NH3A 3QU6A 2VQGA 2L54A 4EV0A 5L3GA 1Z0XA 1ON2A 5DV5A 5JLXA 1D8JA 4ESJA 1WCMJ 4KJZA 2DOAA 3ABUA 4ZJZA 4OOIA 2RGVA 3T5XA 2FSWA 1U3EM 4BJ6C 2QM3A 2HZTA 4WXCA 1TWFJ 1RUNA 2A07F 4GFBA 4BGDA 3C3WA 3CCEI 3PSIA 2ZCWA 1KU3A 1ZLKA 2K85A 2HNHA 4YEJA 1ZR4A 2VPLA 2YU3A 4I02A 1TL8A 4M71A 1U5TA 1JTYA 1GDTA 3OIOA 2JA2A 4YFXF 1R58A 4IVNA 3E5QA 3ZQHA 2MSYA 3ASOH 3JRHA 3AL0C 3A1YA 4O6JA 3VPRA 1X3WB 5HODA 2RQPA 2VI6A 2CQXA 4P9UA 1RETA 2ZXJA 4LOCA 1P9QC 3MKWB 2BZTA 3EETA 5CJ9A 2CJJA 3GTKJ 2ZO4A 4CCLA 3P9CA 1Z7LA 3A2KA 4YIFA 4HNUA 5DD8A 5KAFC 1H88C 1A5JA 4IKFA 5D4RA 3RI4A 4CHUA 2AHQA 4H0EA 4DBRA 1VQ7I 3IHUA 4X0GA 2DA3A 4BL0B 3S17J 1WJDA 3GTLJ 4YFNF 4B4CA 1WJ5A 2Y9ZA 3OYIA 1X2MA 1SFUA 2JSCA 2OV7A 1K83J 4D5FA 4WX9A 2P0WA 4A93J 2F2EA 2LLKA 1WJCA 1Z05A 2WAEA 2M87A 5IP6A 2NOGA 3FBNB 5GAHJ 2JMWA 3LSIA 1F5TA 4XMYA 2XGDA 4U7DA 3M4OJ 1JKOC 2PMHA 2DYSH 2R5YB 1TWHJ 5AIPA 5FGMA 2PBIA 3TP3A 2K4JA 1W1WE 1HSJA 1UHSA 5D8KB 4DQ2A 4F7ZA 4ZYGA 2PJRB 3WE3A 4MIMA 1JKPC 2WTEA 1P92A 1HOMA 4I2OA 1IRXA 4JYKA 1MBFA 2HWVA 3LSHA 1R49A 4XKVA 4BXFA 1ETQA 2R7VA 1JT0A 5H6QA 2O9LA 2DA4A 5LHGA 4BACA 4J01A 2WADA 1R4NB 2JTVA 3VYTB 4H4KC 2WA0A 3S32A 4AM3A 3HOYJ 3FHZA 1FSHA 3D0SA 2UUZA 2PMUA 2K9NA 3KYCB 4XLEA 5JR3A 3D1NI 4DZJA 1ETOA 4PSWA 2DDBA 2M8GX 1YO5C 4ENJA 4YELA 3G2BA 3S1RJ 1R6RA 3OL4A 5KHDA 2GAUA 1LFUP 4A0ZA 4UVCA 5FFXA 3JRDA 2PI0A 5CQEA 5GAEJ 2DA6A 1IGNA 3PM1A 4A3GJ 1OISA 2IBDA 3ASNH 1J2XA 5KVRA 5F1RA 2R3SA 1WSUA 3MD2A 3OYHA 4PGGA 3IAM2 4FISA 2C6YA 5IT9K 4OIQF 3J81Z 5F0FA 2OA4A 1MBEA 4YFKF 1JT6A 3G71I 1XCVA 1VTNC 2CQ7A 2G7UA 1NTCA 5HNFA 3RTRA 1YJWI 3H9GA 2HEOA 1BA5A 4AIJA 1G3TA 2HTSA 3AL0B 2DAOA 3DV8A 5CVRA 2NXNB 3K2ZA 1UB9A 1B59A 4IOCF 3ZP5A 3CMMA 2DOFA 1P7JA 3ESWB 1J9IA 2QCOA 2K7LA 2LKXA 3JRGA 4LK1F 3DBRB 5H20A 2Q2EA 3OMYA 4KIGA 4CCKA 3LAJA 1X4PA 2XUBA 2FRHA 1CGPA 1FTTA 1XGMA 3F8MA 3H3ZA 2RDPA 5FJ8J 1E3HA 1R5GA 3E6BA 4CYDA 4ENKA 5JHFA 3EQLF 3BQYA 1Z7UA 2BEOA 2LD5A 4XKBA 1GXQA 1QZYA 1MGTA 4CXFA 3GXOA 2KDOA 4UHTA 5E8GA 3DKWA 2HTJA 3HXLA 2UZKA 5BS6A 4I01A 1N75A 4BU2A 2VJ5A 1I39A 5CYVA 3FKJA 4BHPA 1LEAA 5LGNA 4XONA 3HSFA 3PQKA 1KQ9A 4A3IJ 4AC0A 2GWRA 4XQFA 2M0CA 3CDLA 1FLIA 1Y8RB 3V8JA 2LP0A 4ESFA 1KU2A 5C4JJ 2OAZA 3SFZA 3G1MA 1F4KA 3VWBA 2IS2A 4XR6A 1S9HA 2KRHA 2XB0X 4LJZF 4ESBA 3I59B 1LEBA 2LVSA 3ABMH 3FXLA 5J8CA 2DA1A 4BDYA 2DBBA 2EV5A 2WAQA 3H9QA 2HQAA 2BVLA 2R5YA 1OCZH 3OYNA 2KT0A 1W36C 4KIFA 5HDGA 2Q0OA 1EV7A 3IP4B 3OIPA 5GADJ 4L0YB 1WZ2A 4KN4X 3FBIB 4HX4A 2WY8Q 3I71A 4OAZA 5LHIA 4FQGA 3I0TA 3L2UA 4DZPA 2ZMEC 3B73A 2H8RA 2JA7J 2ESHA 2VBZA 4IQJA 3BCBA 4NBQA 3NRVA 3H92A 4L9VA 1XMXA 3F23A 5TGTA 4A0XA 1LDDA 4XLPF 2AXLA 2V9PA 1DPUA 3WTTC 3K7AJ 2KISA 3ZQCA 4BE1A 5HS8A 1RRJA 3CESA 1ITYA 2X9DA 4XLAA 3K1NA 5F27A 1FY7A 3CCQI 2D5VA 1YYVA 5J4YA 4RGRA 4HV6A 1TT0A 2WB1N 3PFYA 1CQTA 2DN0A 5F6FA 5EEAA 4Q5SF 2EFOA 2ID6A 3FF5A 1S8NA 3HC7A 1J75A 3M8EA 5F0CA 1HA8A 2L7FP 1Z9CA 1FOWA 2K3FA 4LITA 4M3FA 4ZZDA 1R7JA 3TQNA 1Y0UA 5DTDA 1JKRC 1XN7A 1ZRDA 4D7NA 3TP0A 2Y0MA 3UNGC 1LE8A 1PDNC 2RNGA 4M3DA 3V7RA 2ICWG 4U7BA 5E17F 2UV1A 1ORKA 1PP7U 1HLVA 2BY0A 2K86A 2P6SA 2ZNZA 3U1DA 5CKTA 1MMAA 2CSOA 5LGUA 4YG2F 3CCRI 1OYYA 1ZH5A 2OBPA 1PUFB 2UXNA 2KHMA 3O3KA 2HOEA 2EPFA 3AG4H 4M6VA 2QGUA 3CUQC 4G6TB 3E5XA 3CZ6A 5JHUA 2ZJPF 3S2DJ 4EVIA 2NVQJ 1RPWA 5EZGA 4IHVA 2RAEA 3S14J 5DEQA 2XC7A 2F4IA 2ZXHA 4W97A 4IEJA 1R00A 4CYCA 1TQPA 1SVOA 3DP7A 4D7MA 4EGZA 1YHQI 3GO5A 3HRSA 3S93A 4JX4A 2P5VA 4Y52J 3HL2A 5J3LA 1ZLJA 4RB1A 2HKXA 2CS3A 2R5ZB 1N77A 5EYRA 3W6VA 5M3MJ 2B0LA 4UUVA 3I4MJ 1POGA 3L2CA 2OC6A 4PGHA 5HLIA 1OCRH 1K7AA 2H1LA 3JRAA 3NAUA 5HLTA 3JTHA 4A6DA 3EYIA 3VEPA 3ZMSA 2E2HJ 4B3AA 2EZLA 3A01B 3KZIC 5D8LB 4BXUA 1G3WA 1K4SA 2GA2A 2XPWA 3SEQA 1PP8F 4RLQA 4Y13A 2CFOA 4RB2C 5KAIC 1LQ1A 2MD5A 1OFCX 4BQAA 2Y2ZA 3CJQB 1JI8A 4V2GA 2LTPA 4ZYEA 2H8WA 4RAGA 4E7ZA 5D5XB 5D5VB 2DOEA 4HYEA 4QLCU 5AONA 5H6RA 1BIBA 3NEUA 4N0BA 2YUSA 5D5WB 3IH2A 2EV0A 4E7IA 2EIMH 1TC3C 2OQGA 3ZXSA 3LL7A 3ZMTA 2H09A 2X0LA 2JPCA 3NWTA 4LD5A 4BYYA 1RR7A 3FIWA 2IXSA 3I64A 1SFEA 1O3SA 1ZG3A 3PFIA 3LWFA 4MGRA 3KX2A 1TW2A 4FHTA 4QWQA 2A3SA 4XN0A 3DTKA 1OCOH 3KP6A 2A68F 3FXUA 3HHHA 1YE9A 3SZGA 2NVYJ 3MKLA 2Z1DA 1SD7A 4EJVA 3BCAA 5E3NA 2OCEA 4XLFA 5L3EA 2BHYA 3M1CA 4A3BJ 1VZ0A 2BYVE 3LFUA 2FOKA 3K6GA 1UMQA 2XV4S 1K61A 1X4OA 3ZCOA 2IA1A 2H1KA 1ZTRA 2BHZA 1RNLA 1IXSB 2VQHA 2CV0A 2RVCA 4C3IJ 2O5RA 3HHGA 3OYEA 2X6OA 3L2RA 1XSXA 2WC2A 2EWNA 2F48A 4XM3A 1IDZA 2Q1ZB 3TO9A 2DQLA 3HUGA 4EATA 4XBFA 1KYZA 2DJIA 3ZR8X 2HGCA 3H0DA 2H94A 3WTWC 3LOCA 5LD2C 1F1ZA 3I55I 2O0YA 3CC7I 2AQFA 4NNJA 4PFOA 4BBRJ 1ZGAA 1DQUA 4LLNA 3S1MJ 3LA3A 3CD6I 3Q9VA 2DMUA 1F36A 4E7LA 3TL4X 2IS4A 1YQAA 1ZREA 3TGNA 1OCPA 4PK4A 1K78B 1L3LA 1IN4A 2L9VA 1MH3A 2VBWA 1K6OA 1UHMA 2JVHA 4F3QA 2DU9A 2R7SA 9ANTA 1AOYA 4N4NB 3F3XA 1T56A 3BROA 3ZRGA 4LG0B 1AWCA 1UFMA 1SD5A 2QQBA 4Y4RA 1U9NA 2FBHA 2ZB9A 3TMOA 1FBQA 1MBJA 2LY2A 3GX4X 5F0HA 3MCZA 2M0MA 5DDGA 1YW8A 4LMYA 2PMZN 3S1NJ 4U0VA 1BI0A 3OR2C 1T95A 1AHDP 3J80Z 1WH5A 2IVMA 3BR5A 1KYWA 5IOZA 2ZXWH 4HEA2 3GTQJ 3KLOA 4K2EA 5HDNA 5JLWA 3FXOA 1O7LA 5ILVA 3AAFA 1KZHA 3FMSA 1OQYA 2VJJA 3GFJA 4AVZA 2QSFX 1FYLA 2HZDA 1H9GA 3FK6A 1GT0C 2V1DA 4JBAA 2LYCA 1R36A 4DJAA 2WB1A 1MMDA 2LK2A 2BVMA 2LF7A 3AFHA 1ZGJA 1JKQC 1H0MA 3J7YJ 2DTZA 2DA5A 2HDCA 3HG9A 4BY1J 3BG6A 3HEFA 3IWZA 1XCBA 3HOXJ 1F43A 2VE8A 4I0AA 1FNNA 1LFPA 2PFBA 1U0JA 2QBYB 4YRVA 1JGGA 3F72A 5FKNA 3KZZA 1BOAA 2OTJI 4DIQA 4M3GA 3ZMZA 5LGTA 1XDUA 1YITI 1BR2A 4ABZA 1TBXA 4G8XA 3H35A 3S16J 3BP8A 3IV5A 2UXXA 2DMPA 2K27A 4RDUA 3LAPA 2KDZA 1R5HA 1TWAJ 4NUBA 3MQ0A 2KJCA 3RKYA 1LVKA 1WGXA 3K69A 5FD5A 4BE2A 3TDZC 3RPUA 5EEGA 3DTIA 4IF4A 4IO9F 5B1BH 1O4XA 2K9MA 2ID3A 4D9JA 2M34A 4D5CA 1W7PD 3KYDB 4L18B 2CMPA 4HF0A 3BR6A 5FLXZ 4A3KJ 5BMZA 1QNTA 1Z3XA 3HYIA 2FA5A 2VC0A 1VI0A 1Z77A 4UV8A 1HF0A 1Q1VA 3HOWJ 1X19A 1J5YA 1MNDA 1C0WA 2DT6A 1O57A 1UHWA 4V19K 4BE0A 4GDFA 1GV5A 2HXOA 2K9QA 2PN6A 3HM5A 1V5GA 2M2EA 2A5WA 2I8DA 3F6OA 4BUPA 2FE3A 1QVUA 4PFPA 5C44J 1I1SA 3LMMA 5F1JA 1W5CC 3ZMDA 3S3MA 5IYCJ 4UV9A 3HZJA 2AS5F 2DODA 2MG4A 3CJNA 3WODF 1A04A 2R7TA 3L00A 2OPTA 3FX3A 3ZQQA 1OCTC 1T38A 2YS9A 2NNYA 1K6YA 1UELB 2QBYA 2IGOA 4CSWA 2PLYA 4IJAA 3BPVA 3H3VK 2EFQA 1P2FA 3BY6A 3K70D 1B9MA 1I3QJ 2QSHX 2W7NA 4BY7J 5GTIC 3I53A 2E5ZA 1LUJB 4DYRA 1I1GA 1VNDA 3GLLA 2CU7A 3DKXA 2ESNA 3O8GA 4LB6B 1IDYA 1W0UA 4IX7A 5BOXA 4KNYA 3BR0A 1YI2I 1FP1D 3BPXA 2GOXB 5FFZA 2K5CA 1QA6A 1WI9A 5K5RA 2IA2A 4HA8A 1U78A 1SVLA 2J5OA 1BW5A 1P4WA 2HOAA 2HPMA 1MH4A 4MNUA 3V8LA 1FJLA 1XD7A 3K4JA 3FWEA 4DYCA 2YX7A 2TCTA 3K0LA 2ISYA 3BR3A 5D6FA 2Z5UA 2M7BA 2XROA 1AKHB 2VC1A 3RJPA 2JRTA 4L0ZB 4X6AJ 1F9NA 3I5UA 3FXJA 1XGSA 3A4CA 3E7LA 5IT3A 3ZPLA 2YPRA 1EH8A 3P9IA 1S7EA 1EA3A 2IPQX 2RC4A 3FDYA 5F08A 1YW7A 1XGOA 5EG0B 1FMVA 1ZARA 2E1MC 4M9SA 1T2KA 1GHCA 4BQOA 5C4XJ 5M5WJ 3FXQA 1BI2A 5M5YJ 1A35A 3JRFA 1O3QA 1TW3A 1XGNA 3DU6A 1W0TA 1U2WA 2P81A 2HS5A 3KLNA 3HOVJ 3RZOJ 2GQQA 3K1PA 4RGUA 1AKHA 3BDDA 1ZR2A 2XHKA 1USTA 3P9KA 4W1UA 2EIJH 1YG2A 2WBMA 3CUOA 3S2WA 5FD6A 4LIUA 1FX7A 2ZMEB 1BI1A 3ECOA 2XPVA 3WG9A 4HBLA 3HGGA 2W24A 1G4DA 2L9RA 3WHBA 1V54H 2JSPA 3DF8A 3K4NA 3KYLA 3G6EI 2G9WA 3ECHA 5K1YA 3CDIA 1GVJA 4CCNA 1IRFA 1A36A 3KCCA 1HKSA 2CUZA 2ELHA 3N97A 1KQ0A 1FPQA 3HUGB 4XRFA 3OYAA 1VQ9I 1JTXA 2KFDA 2VODA 1FIPA 3QWLA 4OU0A 3K2AA 2XGCA 4AIDA 3KZYA 2LKSA 2QA4I 2RREA 3S3NA 4I99C 1EJ9A 2VBXA 2Y48A 3VFZA 2DI3A 3VYSB 1IN8A 5HDKA 4ZDOA 1OR7A 4DBQA 2P7VB 1FBSA 4A3FJ 2CV2A 2LY9A 3DWLE 1NK2P 1OPCA 3CO6C 4HSTA 4GYIA 4M6XA 3R6SA 1RKTA 2DPUA 2HVRA 2E36A 1WJAA 2VN2A 4HRIA 1JHFA 3PNVA 1XG1A 1IN7A 2HDWA 4BKXA 3O2PE 1AA7A 4M74A 1YRNB 3K4KA 2PEXA 5ERIA 4C9YA 2EZKA 3GW2A 2VQCA 2MD0A 3W2VA 2Y69H 2P5LC 4NQWA 4S05A 3HTSB 1WFXA 3I3LA 3BZKA 3OYGA 1ODDA 2HDDA 3OY9A 3CMYA 1DUXC 2GIZA 2X85A 3OYJA 2EZHA 1RI7A 2QYOA 4R8HA 3TW7A 4BEHB 4EJUA 5GAGJ 1CF7A 3JSPA 4C30A 4B8XA 3LQQA 3SDGA 1Z21A 3ABTA 3D5LA 3ZMVA 3FISA 4U87A 4A5MA 2OF7A 3ISPA 1UG0A 5B1AH 2EB7A 3NQOA 1TLHB 4LGWA 3LSKA 4KDPA 3W6KB 3BJAA 4MQVA 1E17A 1HXDA 1S29A 3ZQ7A 1MMNA 2FMYA 2MC4A 3L2QA 3ZOBA 1ZG5A 1I6HJ 2NS8A 3LA7A 4N9IA 2R7ZJ 1T08B 5TISC 3H1CA 4GCVA 3HKZA 2GOMA 1X1AA 2L9SA 2LMDA 4HSRA 5DUKA 1X3ZB 4U0WA 3V7SA 1MDMA 4AIHA 4KMUX 4RAYA 3ZQLA 5EDNA 5E3LA 2R7UA 1ZHFA 4A2UA 1UZCA 4N4OB 3LSJA 2JQ7A 2JUGA 1IAWA 3BOQA 1J0RA 3J80K 4YIRX 4UUSB 3CUQA 2MW8A 5CVUA 2NYXA 1GUUA 2XAJA 1P7IA 4U0YA 3B02A 4A3DJ 3M07A 2LRDA 2W4SA 4CYCB 5E8IA 3AG1H 5HS7A 3C2HA 1D5VA 4ZZLA 3HPHA 3ML6A 1ZKGA 5KCMA 1JE8A 1T0FA 1BM9A 1Z6TA 1MBKA 2CYYA 2VKVA 1ZELA 4A69C 2CW0F 1SC7A 2O8KA 2K9SA 1PUFA 4F91B 2L9NA 2QZ8A 2ZFWA 3A03A 4CZZA 1I6XA 3JREA 2XSJC 2W84A 2E2JJ 1G3YA 4B1RA 1QGPA 5EGOA 4EJOA 2R4GA 3Q5FA 2W48A 3S8PA 1IO2A 1OYIA 3F6VA 4ENMA 1LE8B 3J7AO 1QO0D 3K4LA 4OAYA 3HRMA 3WHCA 4EM0B 4JX6A 1YX3A 1O7FA 3M8JA 1MBGA 2HOTA 2LR8A 5L3BA 2HYJA 2E19A 3AG3H 2XASA 2ME6A 3E6MA 2QVOA 1YOVB 3G1LA 3B6AA 1XSVA 2VE9A 4IRGA 1D8KA 3G1OA 2CQKA 2DK5A 2W1OA 1APLC 2JT1A 3WTYC 3T8TA 3IH4A 1RUOA 2NVXJ 4E70A 3W2WA 3E6CC 1MNMC 4ZDLA 2FBIA 2VXDA 2YU9J 2WV0A 2B63J 1X1CA 4FASD 4IQ4A 4UUSA 4OWRB 3KP2A 3OS0A 1Y56A 3R61A 4BXXJ 2EV6A 3QPHA 2VKDA 2YSRA 5L3DA 2ZJQF 1X2NA 2QKLB 5A2QK 2DA2A 4XLNF 3RDIA 4CA0A 2XF7A 1O3RA 3BJ6A 3Q3SA 2L01A 4QIWN 3FXRA 1YX5A 4P55A 1BW6A 4MHGA 4BDZA 3KEQA 3V7CA 1EKEA 3DCFA 2QQ9A 1VQMI 3LSTA 1FOYA 1SAUA 2HFHA 2XB5A 4G6QA 2NNNA 3K70C 4IHXA 2V1NA 3MKYB 1QZEA 3HSRA 1MSEC 3CC2I 1ENHA 4MLOA 1U9OA 3CP8A 4EMSA 3CCSI 2WAQN 2O03A 3QU3A 5HVQC 2I10A 2QQ8A 3L9FA 3FKIJ 3I9V2 3CCLI 4AYBA 2OU2A 1XMAA 2QKMB 2VKEA 1MNEA 1N25A 2LF8A 4BEHA 1X58A 2CH0A 2H6CA 2HKOA 2A61A 2OQRA 2OD5A 1D0YA 2HOSA 2VJ4A 5C3EJ 1QPMA 2FNAA 2X4HA 3M3YJ 5LEJA 3WG7H 2XAHA 2HYGD 3I56I 2GLOA 3LNQA 5E20A 3COAC 4IRIA 3L1PA 2P7CB 4A3JJ 3OOUA 1FWZA 2GXGA 1MMGA 1HC8A 2EA2A 2BBYA 2VPRA 1MJAA 4MQ9F 5LRSA 3CCMI 3A01A 1T8IA 3L2WA 3CMAI 3CF5F 5K7ZA 1GVDA 2FF4A 4M9XA 2PMZA 5LEKA 1XMKA 3WGIA 2Q2EB 3OR1C 3DLAA 5FLXK 3PUBA 5L3CA 2KPMA 4CDGA 2R7QA 4MFEA 3EUHC 2R5ZA 2P5KA 5DCFA 5EF6A 5JI6A 2D2WA 1IUFA 2Q8KA 2CRGA 4XSXF 1W7PA 2Z16A 2IS1A 1O3TA 2IJLA 2BV6A 2G7HA 2FQ3A 2O3FA 4MTDA 4O3MA 3HDDA 1FZPB 1OJLA 1U8BA 1H9TA 1X1BA 2JZYA 3RQIA 4I09A 4KITB 3MVPA 5DYMA 3H5AA 2FBKA 3QYFA 3E5UA 3DBLB 3ERED 3DEWA 1T39A 2X48A 4F93B 2DYRH 3RIRA 2LDUA 2V4JC 3MZYA 4B48A 2DMQA 1W5SA 3JAMZ 2A5YB 2RN7A 4XNFA 5GP9A 4RB3C 1RZ4A 3JTGA 2E71A 4JQFA 4ON0A 2L02A 2L7KA 3WTZA 3MZ8A
chains in the Genus database with same CATH topology
1YJWI 1VQMI 3CD6I 3CCJI 2E36A 3G4SI 2OTLI 2E34A 1FOYA 4V19K 3CCRI 1VQ9I 1VQ6I 1YJNI 1YITI 3J7YJ 1VQ7I 5GAEJ 1VQKI 1Y39A 1VQ5I 1FOWA 2QEXI 3CCUI 1S72I 2H8WA 2K3FA 2JQ7A 2NXNB 3CC2I 3I56I 3CMEI 1VQOI 2QA4I 2E35A 1ACIA 1FOXA 5DM7F 4IOCF 1YJ9I 1VQLI 2FOWA 3CCSI 3PIOF 4IO9F 2ZJPF 1MMSA 3DLLF 1HC8A 2ZJQF 2ZJRF 3CCVI 4UY8I 5GADJ 3CCLI 3CC4I 3PIPF 3CCEI 3CCMI 3CCQI 1YIJI 1VQPI 1VQ8I 1YI2I 3G71I 3I55I 5GAHJ 3CC7I 3G6EI 5GAGJ 1QA6A 1VQ4I 1YHQI 3CMAI 3CF5F 2OTJI 3J7ZI 5JVGF 5DM6F 1VQNI 3CJTB 4IOAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW I;  1VQM I;  3CD6 I;  3CCJ I;  2E36 A;  3G4S I;  2OTL I;  2E34 A;  1FOY A;  4V19 K;  3CCR I;  1VQ9 I;  1VQ6 I;  1YJN I;  1YIT I;  3J7Y J;  1VQ7 I;  5GAE J;  1VQK I;  1Y39 A;  1VQ5 I;  1FOW A;  2QEX I;  3CCU I;  1S72 I;  2H8W A;  2K3F A;  2JQ7 A;  2NXN B;  3CC2 I;  3I56 I;  3CME I;  1VQO I;  2QA4 I;  2E35 A;  1ACI A;  1FOX A;  5DM7 F;  4IOC F;  1YJ9 I;  1VQL I;  2FOW A;  3CCS I;  3PIO F;  4IO9 F;  2ZJP F;  1MMS A;  3DLL F;  1HC8 A;  2ZJQ F;  2ZJR F;  3CCV I;  4UY8 I;  5GAD J;  3CCL I;  3CC4 I;  3PIP F;  3CCE I;  3CCM I;  3CCQ I;  1YIJ I;  1VQP I;  1VQ8 I;  1YI2 I;  3G71 I;  3I55 I;  5GAH J;  3CC7 I;  3G6E I;  5GAG J;  1QA6 A;  1VQ4 I;  1YHQ I;  3CMA I;  3CF5 F;  2OTJ I;  3J7Z I;  5JVG F;  5DM6 F;  1VQN I;  3CJT B;  4IOA F; 
#chains in the Genus database with same CATH topology
 4S0H B;  4P96 A;  3JCU C;  3HTU A;  3BG9 A;  3E1S A;  3Q9S A;  3CCY A;  3SZP A;  2E7W A;  5DUI A;  5DCM A;  5FKL A;  4E7K A;  3C18 A;  3CME I;  4BHC A;  2M4G A;  4LLG F;  5ICG A;  2B9S A;  2VUM J;  2K3P A;  2P4W A;  2XF6 A;  3WTS C;  4HQM A;  2DFH A;  2KL4 A;  4G9Y A;  2ZC2 A;  5GPC A;  1JJ8 C;  2CUF A;  3MEX A;  1R1T A;  4ZYH A;  1E0E A;  2IAI A;  2E5N A;  1B8I A;  3G73 A;  4XKC A;  4BAY A;  1S3J A;  4ETS A;  5TRD A;  3H36 A;  2DMT A;  1IUY A;  1BR4 A;  1Y1V J;  1YTY A;  1E2X A;  2ZFU A;  1YW9 A;  1K79 A;  2YR2 A;  3KEO A;  4LK0 F;  1P6R A;  3OL3 A;  2PX9 A;  1STZ A;  2HU9 A;  5H2F C;  3HKZ N;  3CCV I;  2ZJ2 A;  3N4M A;  3RSN A;  3PNT A;  3OYK A;  1IXR C;  1QZZ A;  5HLG A;  2J5P A;  3BLY A;  4KT6 A;  2W57 A;  4IHT A;  2RKH A;  4RBO A;  1ZN2 A;  1YIO A;  1ETK A;  1TWC J;  4HNV A;  1UAA A;  4Y3O A;  1BN5 A;  3LSR A;  2I5U A;  1QVT A;  2VOP A;  1R1V A;  3DPL C;  1D3Y A;  1L0O C;  2Z9O A;  3I59 A;  5IP7 J;  1IN6 A;  2XRN A;  1EH7 A;  4TV7 A;  3EPZ A;  1ZRF A;  2A05 A;  1V4R A;  3MMY B;  1TZL A;  4G7H F;  1Z91 A;  4RAZ A;  1BBY A;  2W82 A;  3WTV C;  2M7A A;  3F8C A;  3V8K A;  2Z99 A;  3AKZ A;  3BG5 A;  1FTZ A;  3T8R A;  2KIF A;  1XTA A;  4P9F A;  4WK8 F;  3M9A A;  1WVR A;  1T6S A;  3ULQ B;  3O6B B;  4YII A;  4HLY A;  3C7J A;  2V6E A;  4XKW A;  1B72 A;  3NWS A;  3VOD A;  1XSD A;  2NS7 A;  4PDK A;  4Z6Y A;  1GLN A;  5ICC A;  1QU3 A;  2D45 A;  5ED4 A;  3BG3 A;  4ZTJ A;  2JA5 J;  2G0E A;  2FXA A;  4HPQ A;  1Q1H A;  2VT3 A;  3DU5 A;  1X1P A;  3GBG A;  1T98 A;  3RCO A;  3MFK A;  2VOO A;  2FEZ A;  3Q0U A;  2IRF G;  3ABL H;  3KET A;  3U9G A;  2IT0 A;  1YLF A;  2KP6 A;  1NG7 A;  4HV5 A;  3GTM J;  4IHS A;  3G4S I;  1KU7 A;  4AIK A;  4HF1 A;  4EJT A;  2Y9Y A;  2RV8 A;  3ZMU A;  1I5Z A;  2TRT A;  1Z67 A;  1TT5 B;  2M5W A;  4XID A;  3Q0V A;  1WJE A;  3KFW X;  3TO6 A;  1DP7 P;  4PJL A;  1RKW A;  4B3X A;  4A12 A;  4D1Q A;  3F8N A;  4OMZ A;  4RAF A;  2R7W A;  2VXZ A;  5LRR A;  2DJN A;  1T0F C;  3KEY A;  2ELK A;  2DW4 A;  2EQR A;  3HGY A;  1VQ4 I;  3GZ5 A;  2OJE D;  2Z3Y A;  3ERM A;  4WF2 A;  3VYU B;  1JGS A;  3RKW A;  3BT9 A;  3QPS A;  2MGQ A;  5FLV A;  2KRF A;  1BL0 A;  3OYF A;  1UCR A;  2N8G A;  3BTI A;  3MKZ A;  3S2H J;  3JAM K;  4WWC A;  4UXN A;  2FOW A;  2KQR A;  2KRC A;  3HIF A;  4FET A;  4V2F A;  1TQM A;  3GTJ J;  3TOA A;  1MKM A;  1B72 B;  3H5N A;  4A3L J;  1N78 A;  1QHG A;  3WTU C;  1ZQ3 P;  4UNO A;  1P4A A;  2F5F A;  2RNJ A;  3DBH B;  1J09 A;  2VJI A;  2HVS A;  4O5V A;  2VAS A;  4RM2 A;  4GYG A;  2EFP A;  3EUH A;  2KZV A;  3PSF A;  2H27 A;  4J19 A;  1ZK8 A;  3VOE A;  1KU9 A;  4LG0 A;  3IRQ A;  1S72 I;  3VSL A;  4M3E A;  4C2U A;  3I4N J;  1X1D A;  5DCM B;  3L2V A;  3HJE A;  4L5E A;  3KP3 A;  4ENN A;  3O8H A;  2XKP A;  1Z3Y A;  1Y6I A;  1MJ9 A;  4L9T A;  2DMN A;  2QEN A;  4L9J A;  2XGE A;  4ZYD A;  2XIG A;  4J00 A;  3BG7 A;  3CTA A;  4NC6 A;  5KK1 A;  5HOO A;  4C3H J;  1RIO H;  1JJ6 C;  4RMN A;  1R5I D;  2A6H F;  2QLZ A;  2VT2 A;  1XPX A;  1RES A;  5K7F A;  2L4M A;  2V9K A;  5DM6 F;  4EJW A;  4IOA F;  1HST A;  2NVU B;  3CCJ I;  1VQ6 I;  3BJO A;  3DTE A;  3K10 A;  1G2H A;  4FTH A;  1B6A A;  2WV1 A;  4PJ0 C;  2Y0S N;  4XK4 A;  2JK3 A;  2M4K A;  1TQI A;  3WGH A;  4PJM A;  1YJ9 I;  2F5D A;  2R7O A;  3HOZ J;  2A6T A;  4A3C J;  2E7X A;  4B44 A;  3JRB A;  5FRO A;  2HVQ A;  4N9H A;  3BC8 A;  3EDP A;  4JOM A;  2LRE A;  2DCE A;  3IL2 A;  4NC7 A;  4A5N A;  2IGN A;  1BC8 C;  2NS0 A;  2M8E A;  3C2B A;  3R60 A;  4ITV A;  1DPR A;  5BPI A;  3OSF A;  1SMY F;  5J4V A;  4UB6 C;  1T33 A;  1ACI A;  1J7K A;  1FC3 A;  2V9V A;  3HRU A;  3SZT A;  1U5T B;  3K4C A;  2CUJ A;  1HW2 A;  3SQN A;  1IF1 A;  1MMS A;  4M73 A;  3DLL F;  1LKX A;  1SFO J;  3QPT A;  1IW7 F;  2W85 A;  3E97 A;  1W36 D;  3DEU A;  4EEF G;  2NAZ A;  5J1Y A;  4FT8 A;  1USS A;  3IAS 2;  2EIK H;  2HQ5 A;  4IPA A;  5JVG F;  1HW1 A;  4Q47 A;  1H89 C;  4E7S A;  3CQZ J;  1Z6R A;  2CO5 A;  5TJJ A;  4F92 B;  3RKQ A;  2F5C A;  2R7R A;  4RGX A;  5DS9 A;  3DPT A;  5A2Q Z;  2XRL A;  3ROU A;  2L5Q A;  3OYC A;  3OIQ A;  1VQO I;  4IHY A;  3H9J A;  4CO8 A;  2XAG A;  4B47 A;  2HXI A;  5ILS A;  3M1E A;  3V42 A;  4ASN A;  5HLH A;  2F6C A;  2WWY A;  4BQN A;  1ONV A;  4RLF A;  1PJR A;  3U2R A;  2R0Q C;  4RB0 A;  3CJT B;  1TP4 A;  5CVJ A;  3ABK H;  2PQ8 A;  3TKY A;  1TNS A;  3T1B A;  1WJF A;  2HR3 A;  3OV8 A;  1SD6 A;  2F5E A;  4RGS A;  2YX4 A;  2E35 A;  2EK5 A;  3TW6 A;  3PQJ A;  3FM3 A;  1VQL I;  2P8T A;  1FBU A;  1ZAO A;  3VDX A;  5E18 F;  1FT9 A;  1QRY A;  2EFW A;  3HPG A;  5BPD A;  2LFB A;  4M3B A;  4UY8 I;  2PG4 A;  3LQR A;  2Z2S B;  1YIJ I;  2ZNY A;  1D1C A;  3UR3 C;  5ILU A;  1IRG A;  1WH7 A;  4HX7 A;  2DO7 A;  2FX0 A;  1WWX A;  2L2O A;  3ELK A;  2ZSH B;  1VFC A;  2STT A;  1HW5 A;  4G12 A;  3IRR A;  1IJW C;  4Q4Z F;  2EIL H;  2WY7 Q;  1JUM A;  2COM A;  2M3A A;  2ZSI B;  2VLA A;  3SJM A;  2L0K A;  4FX4 A;  4LG3 A;  2V1U A;  5J47 A;  4Y7N J;  2XAU A;  4UVA A;  3S3O A;  5AIQ A;  4OMY A;  1I27 A;  2MH2 A;  1ETW A;  4EM1 A;  1HCR A;  3U1K A;  3GTG J;  1HKT A;  2AQE A;  3BZC A;  1W5T A;  4C2M J;  1REP C;  4G94 A;  3TDU C;  2LNB A;  3U21 A;  4WCG A;  2CUE A;  3QOE A;  1LPQ A;  1A6I A;  3OS2 A;  4FE7 A;  3FMQ A;  3BR2 A;  1IV8 A;  4HLX A;  2E34 A;  5EJC A;  2IGK A;  3OYL A;  2XVC A;  5FKM A;  3WTX C;  4Q48 A;  5J6X A;  2DFF A;  2STW A;  5IYB J;  4BBS J;  3LSP A;  1J59 A;  5J1U A;  2PJR A;  4IL6 C;  4UB8 C;  4DGW B;  4QPO A;  1R22 A;  4ZH4 F;  3K9T A;  2R92 J;  4B09 A;  3E0J B;  2MLG A;  4Y17 A;  4HDU A;  3GUD A;  2FUG 2;  4EGY A;  1OYW A;  2LOO A;  4XSZ F;  4NDL A;  5ICE A;  1KA8 A;  5B5E C;  2HYF A;  1HDD C;  4CIC A;  3MZH A;  2GIV A;  3LSG A;  4KT5 C;  5DM7 F;  4LLL A;  4OIN F;  3EYY A;  3PJR A;  4AWX B;  3GVA A;  4M9Z A;  1DGW Y;  1XC5 A;  1PUE E;  4HF2 A;  2CQQ A;  2FU4 A;  3OYD A;  1ERD A;  3GTO J;  3EUA A;  3DXJ F;  2CGP A;  1D0Z A;  1B8I B;  2A69 F;  1W7P B;  2DQR A;  1JXS A;  2KLO A;  4KIB A;  3C2G A;  1E3O C;  2VON A;  2IA0 A;  3WU2 C;  4BJT A;  4OIP F;  1G59 A;  2XDV A;  3ZN0 A;  1BI3 A;  5M5X J;  3WE2 A;  1WPK A;  4KA4 A;  3OWT A;  1ZRC A;  3GFL A;  1K4T A;  2F4O B;  5J1R A;  2LY1 A;  3QOP A;  2K4B A;  1B1B A;  1QHH D;  2KIM A;  4JK1 X;  4F55 A;  1PYV A;  3CLO A;  3ZGK A;  2WAF A;  1XB4 A;  2OCC H;  1OMI A;  4A6E A;  3DKY A;  3R0J A;  5JFR A;  5BQT A;  3HB9 A;  2HPI A;  2ACJ A;  3D5R C;  1DU6 A;  2LKP A;  1MW7 A;  3JW4 A;  5E3M A;  2IGM A;  3BWG A;  4EQQ A;  1U8R A;  2V7F A;  2DDA A;  2FNP A;  4LB5 A;  2QEX I;  1M1E B;  1LB2 A;  2JA8 J;  2IEK A;  3G3Z A;  1IG7 A;  1FOK A;  3BTL A;  4DNC A;  2OUM A;  2K02 A;  3CP2 A;  2E2I J;  2W25 A;  2H6B A;  3FXK A;  1SAX A;  4MO7 A;  3CDH A;  2LG4 A;  3J7Z I;  3A0B C;  1VQN I;  2EZI A;  1HKQ A;  2JWT A;  3PUF A;  2Y75 A;  3GYH X;  2JVG A;  4OIO F;  2PJP A;  3QYE A;  3J81 K;  4IRH A;  4MEX F;  3JR9 A;  4C3J J;  3GFI A;  5IT9 Z;  3R4K A;  3CUQ B;  4IHW A;  3KP5 A;  1V5F A;  5FLM J;  1A6Q A;  3W6J B;  1TTY A;  2VB6 A;  2E1M B;  1FP2 A;  2F5V A;  3TED A;  2ZJR F;  3OYB A;  1V55 H;  4E7H A;  1QPI A;  3SXY A;  4KFC A;  3RZD J;  3F9K A;  2UWM A;  3F8F A;  2X6W A;  4II3 A;  1VQP I;  4MFD A;  1IN5 A;  5B3S H;  3M8F A;  4ZYA A;  3SDB A;  3WU1 B;  1KGS A;  3BQZ A;  1R1U A;  2BE5 F;  1Y1W J;  3I58 A;  1ULY A;  5IP9 J;  2JA6 J;  4BH9 A;  2Y30 A;  3PO2 J;  3SHF A;  1HQC A;  4HDV A;  1UG2 A;  3QP6 A;  5IPA A;  3JSO A;  2D1V A;  2BOL A;  3S15 J;  4G6D A;  4XRM A;  3OYM A;  3PIP F;  1EH6 A;  2EBI A;  2GZW A;  2ADU A;  5LBQ A;  4II2 A;  3J7A Y;  3GWZ A;  4RS8 A;  4QPQ A;  1QBJ A;  2TDX A;  2V1X A;  2W00 A;  3RYP A;  2ETH A;  2KMU A;  1UJ8 A;  3GLX A;  3AG2 H;  1G3S A;  3KPH A;  4A3M J;  3C1D A;  1VQK I;  3K4B A;  2LBF B;  2ZXI A;  3A02 A;  2GXB A;  3RQ4 A;  2BXZ A;  4NQW B;  3MWM A;  2ECB A;  3PO3 J;  1SFX A;  4R1H A;  1W4M A;  4ZTF A;  1ETX A;  1JUS A;  2FJ1 A;  3W3C A;  3GZ6 A;  3QP5 A;  3KP7 A;  1YRN A;  4I98 B;  2BY1 A;  4I7H A;  1LFB A;  1TNT A;  5EGO B;  2XF5 A;  1WQ2 A;  3IUO A;  5LFA A;  2JRM A;  2GXA A;  4GRI A;  4QSH A;  3N05 A;  4XLC A;  4U88 A;  3HRT A;  5E1W A;  4G7Z F;  1R9T J;  4CCM A;  4XL9 A;  2BXY A;  4AYB N;  3CCU I;  2MH9 A;  2LSO A;  1SVM A;  1BJZ A;  2GA1 A;  3B6C A;  1D1B A;  4P1W A;  3Q0W A;  2KIU A;  5F04 A;  2DT7 B;  2V6C A;  3RYR A;  1ZYR F;  1MJB A;  1A31 A;  1BIA A;  3MN2 A;  5D6E A;  4FX0 A;  2EIN H;  2EA4 A;  5K5Q A;  1MBH A;  5F64 A;  2O8X A;  2CW8 A;  1GV2 A;  3IWF A;  5HNH A;  2E1C A;  1ON1 A;  3DQV C;  2DPD A;  2DFI A;  1H8A C;  4CGZ A;  1R4M B;  2ECC A;  2ZKZ A;  4IXA A;  1Y39 A;  3IKV A;  3FMR A;  1DGR M;  1U5T C;  3OS1 A;  3PL8 A;  1V3F A;  1NK3 P;  1FIA A;  4PZJ A;  3CJR B;  3QQA A;  4HX8 A;  1YS6 A;  3DFG A;  3LFK A;  4JP0 A;  1LJ9 A;  4E4H A;  3E3V A;  3DEE A;  3FXM A;  4E6K G;  2K9L A;  3UKG A;  1Z1D A;  3A0H C;  2QF7 A;  1MZB A;  3ZQF A;  4A0Y A;  2L7Z A;  4MTE A;  5HS9 A;  3ZN1 A;  4RM3 A;  4AU7 A;  1KON A;  2QSG X;  1Y8Q B;  5EG0 A;  2BY2 A;  4HOB A;  1YJN I;  2MC3 A;  3HOT A;  2E1O A;  1BJA A;  4FCY A;  2R93 J;  1FMW A;  2O61 A;  2OZ6 A;  2XAF A;  2JPB A;  3OOP A;  3X2Q H;  1I50 J;  2XGX A;  4DW6 A;  3VSK A;  1WI3 A;  2P6T A;  1NG6 A;  1B9N A;  2OZU A;  4P5O A;  1KQ8 A;  1CF7 B;  3M7G A;  1LDK B;  2M30 A;  5ICF A;  3CC4 I;  5KNL A;  3L09 A;  5B66 C;  3CLQ A;  2JUC A;  6PAX A;  2Y31 A;  3GZN B;  3H0G J;  2Z33 A;  4Y15 A;  1BOB A;  4IZZ A;  2BY3 A;  4CZC A;  4XRS A;  4L5I A;  5LLQ A;  2X6X A;  1P4X A;  5IYD J;  2CW7 A;  3SFI A;  2NVT J;  2KJB A;  1RC9 A;  3I4P A;  3GCM A;  3JRI A;  1R23 A;  4PUS A;  2FQ4 A;  2AO9 A;  4BHB A;  3QYB A;  1S5L C;  4LIV A;  2JN6 A;  2A6E F;  5D4S A;  4KMF A;  3VB2 A;  1S7O A;  2M9H A;  1XS9 A;  4GO1 A;  2X6Y A;  1G6N A;  3RKX A;  2BW3 B;  5FB2 A;  2VBY A;  1MDM B;  4GGG A;  3PNY A;  5CVV A;  3WU0 A;  4DOZ A;  3BZ6 A;  3QRF F;  5J40 A;  2BW3 A;  2RQQ A;  2XSD C;  2CG4 A;  4PCQ A;  3NAR A;  1VQ5 I;  1FEX A;  3QAH A;  2LC2 A;  2ISZ A;  5GTH C;  1D0X A;  2X1C A;  3HSE A;  2CFX A;  3FZV A;  2V79 A;  2IW5 A;  3R0A A;  4HZF A;  1DP3 A;  3GME A;  4WXD A;  3ZQG A;  5FRM A;  4HQE A;  1LDJ A;  3OSG A;  1SAN A;  1SD4 A;  4MEY F;  2XKO A;  5E1X A;  4E7J A;  3DPU A;  2MLK A;  2NOJ B;  2HQN A;  1LVA A;  2FD5 A;  3P7N A;  4CCO A;  2ZME A;  4D0P A;  1DDN A;  1OCC H;  1DU0 A;  4WXH A;  4XOP A;  5K7H A;  4KN7 X;  3KE2 A;  3SYT A;  2FML A;  3BR1 A;  5CVI A;  5FKK A;  1EF4 A;  2O6G E;  3GTP J;  4R79 A;  1V5E A;  2QQA A;  2M1B A;  1FYK A;  2CQN A;  3TO7 A;  4PJN A;  3VYR B;  1ZG1 A;  1RR8 C;  2GBY A;  3LSM A;  2DA7 A;  4NC8 A;  3HOU J;  2E60 A;  2JJ7 A;  4NHJ A;  3GEZ A;  5CLS A;  2EJR A;  5D5U B;  2R7F A;  4XRS G;  1GXP A;  2MA3 A;  2R7D A;  3LA2 A;  3ONQ A;  4L9N A;  4I6Z A;  1IC8 A;  3TBI A;  4HNT A;  4LFU A;  4HG2 A;  1YS7 A;  2VKH A;  4ZC3 A;  1AU7 A;  2DLL A;  3RPU D;  2KIQ A;  2ELJ A;  5EZH A;  4DYQ A;  2ZBK A;  2V26 A;  1X3U A;  2EFN A;  4ANJ A;  3BTC A;  3F0C A;  4I0B A;  5IOY A;  4HAM A;  4OIR F;  3W2A A;  2XAQ A;  3P5J A;  3QOD A;  1Y0N A;  4F52 A;  1MD0 A;  5E79 C;  3IKT A;  4RA2 A;  4CUG A;  3TOB A;  4A3E J;  4Z2Y A;  1ETV A;  3SEZ A;  3JRC A;  1SEU A;  4FE4 A;  4C2T A;  3K4M A;  5FO5 A;  3HBL A;  1HBX G;  4KIS A;  5DD4 A;  2B7E A;  3FHN A;  2DFE A;  1XDS A;  2MAB A;  3EUK L;  3D5S C;  1SFK A;  1OLT A;  1IRZ A;  4B43 A;  2Y0S A;  4AUX A;  2HQR A;  2R7X A;  1OR7 C;  1E3P A;  4QTR A;  3HOS A;  4BS9 A;  1OKR A;  1HDP A;  2AXT C;  3REO A;  4AD9 A;  4PSX A;  2K40 A;  3FK7 A;  4ZDP A;  4Y33 A;  1S6L A;  5EEH A;  5J8F A;  5E1Z B;  4KUM A;  4BNC A;  3S1Q J;  1JHH A;  1G8X A;  2KKO A;  3KIO A;  4UVB A;  4XOR A;  5JVT A;  5K5O A;  3F21 A;  3K1M A;  1PVE A;  1QQI A;  3CO7 C;  1FSE A;  1WHU A;  3H3U A;  1IZ1 A;  4CCJ A;  2LH9 A;  3FM5 A;  2QUF A;  3PIO F;  4GXO A;  3MAJ A;  2DT5 A;  2LBF A;  2IP2 A;  2IS6 A;  5LHH A;  2COB A;  2BGC A;  1K78 A;  2MFZ A;  1MSF C;  2QWW A;  3ZQI A;  1VQ8 I;  2CV1 A;  3BTJ A;  2DXI A;  2XPU A;  2L3D A;  1BC7 C;  1LNW A;  2VL8 A;  3L7W A;  2L4A A;  2X1D A;  4CH7 A;  4JX5 A;  1FYM A;  2OTL I;  3H5R A;  4S04 A;  3QPL A;  1ZGW A;  3F8B A;  4KYW A;  4HW0 A;  1R71 A;  4XIC A;  2EH3 A;  1IV6 A;  2ME0 A;  4XOT A;  2KZG A;  4M6Y A;  1U6G A;  1I3A A;  4BJ5 C;  1YFH A;  2X1E A;  2L7M P;  5M3F J;  1D5Y A;  2HI3 A;  1S7A A;  5CPR B;  5L3F A;  1B4A A;  2MBF A;  3E6D A;  4G7O F;  3RPQ A;  1ETY A;  4X1E A;  1TWG J;  4XLH A;  4AVP A;  5E3O A;  1MIJ A;  5FRN A;  4L5J A;  2NRA C;  3CF2 A;  3V4G A;  1WRJ A;  3F22 A;  3GF2 A;  2GM4 A;  2VIX A;  2E1N A;  4BQQ A;  3IC7 A;  1FOX A;  3WGG A;  5BNG A;  4M72 A;  2F4M B;  3GFM A;  2DTR A;  3KP4 A;  1BR1 A;  2CWE A;  1IXC A;  1XX5 A;  2O7O A;  5IY5 H;  2DK8 A;  4UUT A;  2VQL A;  1WKM A;  2M45 A;  5FKO A;  4EM2 A;  4I76 A;  4XN3 A;  1D1A A;  1VF9 A;  1JUP A;  2D1H A;  3I54 A;  4PJJ A;  2MYS A;  3T0Y A;  4KIC A;  5CQG A;  4NB5 A;  2X51 A;  1SMT A;  1WJB A;  3IH3 A;  5GPA A;  1NHA A;  1NH3 A;  3QU6 A;  2VQG A;  2L54 A;  4EV0 A;  5L3G A;  1Z0X A;  1ON2 A;  5DV5 A;  5JLX A;  1D8J A;  4ESJ A;  1WCM J;  4KJZ A;  2DOA A;  3ABU A;  4ZJZ A;  4OOI A;  2RGV A;  3T5X A;  2FSW A;  1U3E M;  4BJ6 C;  2QM3 A;  2HZT A;  4WXC A;  1TWF J;  1RUN A;  2A07 F;  4GFB A;  4BGD A;  3C3W A;  3CCE I;  3PSI A;  2ZCW A;  1KU3 A;  1ZLK A;  2K85 A;  2HNH A;  4YEJ A;  1ZR4 A;  2VPL A;  2YU3 A;  4I02 A;  1TL8 A;  4M71 A;  1U5T A;  1JTY A;  1GDT A;  3OIO A;  2JA2 A;  4YFX F;  1R58 A;  4IVN A;  3E5Q A;  3ZQH A;  2MSY A;  3ASO H;  3JRH A;  3AL0 C;  3A1Y A;  4O6J A;  3VPR A;  1X3W B;  5HOD A;  2RQP A;  2VI6 A;  2CQX A;  4P9U A;  1RET A;  2ZXJ A;  4LOC A;  1P9Q C;  3MKW B;  2BZT A;  3EET A;  5CJ9 A;  2CJJ A;  3GTK J;  2ZO4 A;  4CCL A;  3P9C A;  1Z7L A;  3A2K A;  4YIF A;  4HNU A;  5DD8 A;  5KAF C;  1H88 C;  1A5J A;  4IKF A;  5D4R A;  3RI4 A;  4CHU A;  2AHQ A;  4H0E A;  4DBR A;  1VQ7 I;  3IHU A;  4X0G A;  2DA3 A;  4BL0 B;  3S17 J;  1WJD A;  3GTL J;  4YFN F;  4B4C A;  1WJ5 A;  2Y9Z A;  3OYI A;  1X2M A;  1SFU A;  2JSC A;  2OV7 A;  1K83 J;  4D5F A;  4WX9 A;  2P0W A;  4A93 J;  2F2E A;  2LLK A;  1WJC A;  1Z05 A;  2WAE A;  2M87 A;  5IP6 A;  2NOG A;  3FBN B;  5GAH J;  2JMW A;  3LSI A;  1F5T A;  4XMY A;  2XGD A;  4U7D A;  3M4O J;  1JKO C;  2PMH A;  2DYS H;  2R5Y B;  1TWH J;  5AIP A;  5FGM A;  2PBI A;  3TP3 A;  2K4J A;  1W1W E;  1HSJ A;  1UHS A;  5D8K B;  4DQ2 A;  4F7Z A;  4ZYG A;  2PJR B;  3WE3 A;  4MIM A;  1JKP C;  2WTE A;  1P92 A;  1HOM A;  4I2O A;  1IRX A;  4JYK A;  1MBF A;  2HWV A;  3LSH A;  1R49 A;  4XKV A;  4BXF A;  1ETQ A;  2R7V A;  1JT0 A;  5H6Q A;  2O9L A;  2DA4 A;  5LHG A;  4BAC A;  4J01 A;  2WAD A;  1R4N B;  2JTV A;  3VYT B;  4H4K C;  2WA0 A;  3S32 A;  4AM3 A;  3HOY J;  3FHZ A;  1FSH A;  3D0S A;  2UUZ A;  2PMU A;  2K9N A;  3KYC B;  4XLE A;  5JR3 A;  3D1N I;  4DZJ A;  1ETO A;  4PSW A;  2DDB A;  2M8G X;  1YO5 C;  4ENJ A;  4YEL A;  3G2B A;  3S1R J;  1R6R A;  3OL4 A;  5KHD A;  2GAU A;  1LFU P;  4A0Z A;  4UVC A;  5FFX A;  3JRD A;  2PI0 A;  5CQE A;  5GAE J;  2DA6 A;  1IGN A;  3PM1 A;  4A3G J;  1OIS A;  2IBD A;  3ASN H;  1J2X A;  5KVR A;  5F1R A;  2R3S A;  1WSU A;  3MD2 A;  3OYH A;  4PGG A;  3IAM 2;  4FIS A;  2C6Y A;  5IT9 K;  4OIQ F;  3J81 Z;  5F0F A;  2OA4 A;  1MBE A;  4YFK F;  1JT6 A;  3G71 I;  1XCV A;  1VTN C;  2CQ7 A;  2G7U A;  1NTC A;  5HNF A;  3RTR A;  1YJW I;  3H9G A;  2HEO A;  1BA5 A;  4AIJ A;  1G3T A;  2HTS A;  3AL0 B;  2DAO A;  3DV8 A;  5CVR A;  2NXN B;  3K2Z A;  1UB9 A;  1B59 A;  4IOC F;  3ZP5 A;  3CMM A;  2DOF A;  1P7J A;  3ESW B;  1J9I A;  2QCO A;  2K7L A;  2LKX A;  3JRG A;  4LK1 F;  3DBR B;  5H20 A;  2Q2E A;  3OMY A;  4KIG A;  4CCK A;  3LAJ A;  1X4P A;  2XUB A;  2FRH A;  1CGP A;  1FTT A;  1XGM A;  3F8M A;  3H3Z A;  2RDP A;  5FJ8 J;  1E3H A;  1R5G A;  3E6B A;  4CYD A;  4ENK A;  5JHF A;  3EQL F;  3BQY A;  1Z7U A;  2BEO A;  2LD5 A;  4XKB A;  1GXQ A;  1QZY A;  1MGT A;  4CXF A;  3GXO A;  2KDO A;  4UHT A;  5E8G A;  3DKW A;  2HTJ A;  3HXL A;  2UZK A;  5BS6 A;  4I01 A;  1N75 A;  4BU2 A;  2VJ5 A;  1I39 A;  5CYV A;  3FKJ A;  4BHP A;  1LEA A;  5LGN A;  4XON A;  3HSF A;  3PQK A;  1KQ9 A;  4A3I J;  4AC0 A;  2GWR A;  4XQF A;  2M0C A;  3CDL A;  1FLI A;  1Y8R B;  3V8J A;  2LP0 A;  4ESF A;  1KU2 A;  5C4J J;  2OAZ A;  3SFZ A;  3G1M A;  1F4K A;  3VWB A;  2IS2 A;  4XR6 A;  1S9H A;  2KRH A;  2XB0 X;  4LJZ F;  4ESB A;  3I59 B;  1LEB A;  2LVS A;  3ABM H;  3FXL A;  5J8C A;  2DA1 A;  4BDY A;  2DBB A;  2EV5 A;  2WAQ A;  3H9Q A;  2HQA A;  2BVL A;  2R5Y A;  1OCZ H;  3OYN A;  2KT0 A;  1W36 C;  4KIF A;  5HDG A;  2Q0O A;  1EV7 A;  3IP4 B;  3OIP A;  5GAD J;  4L0Y B;  1WZ2 A;  4KN4 X;  3FBI B;  4HX4 A;  2WY8 Q;  3I71 A;  4OAZ A;  5LHI A;  4FQG A;  3I0T A;  3L2U A;  4DZP A;  2ZME C;  3B73 A;  2H8R A;  2JA7 J;  2ESH A;  2VBZ A;  4IQJ A;  3BCB A;  4NBQ A;  3NRV A;  3H92 A;  4L9V A;  1XMX A;  3F23 A;  5TGT A;  4A0X A;  1LDD A;  4XLP F;  2AXL A;  2V9P A;  1DPU A;  3WTT C;  3K7A J;  2KIS A;  3ZQC A;  4BE1 A;  5HS8 A;  1RRJ A;  3CES A;  1ITY A;  2X9D A;  4XLA A;  3K1N A;  5F27 A;  1FY7 A;  3CCQ I;  2D5V A;  1YYV A;  5J4Y A;  4RGR A;  4HV6 A;  1TT0 A;  2WB1 N;  3PFY A;  1CQT A;  2DN0 A;  5F6F A;  5EEA A;  4Q5S F;  2EFO A;  2ID6 A;  3FF5 A;  1S8N A;  3HC7 A;  1J75 A;  3M8E A;  5F0C A;  1HA8 A;  2L7F P;  1Z9C A;  1FOW A;  2K3F A;  4LIT A;  4M3F A;  4ZZD A;  1R7J A;  3TQN A;  1Y0U A;  5DTD A;  1JKR C;  1XN7 A;  1ZRD A;  4D7N A;  3TP0 A;  2Y0M A;  3UNG C;  1LE8 A;  1PDN C;  2RNG A;  4M3D A;  3V7R A;  2ICW G;  4U7B A;  5E17 F;  2UV1 A;  1ORK A;  1PP7 U;  1HLV A;  2BY0 A;  2K86 A;  2P6S A;  2ZNZ A;  3U1D A;  5CKT A;  1MMA A;  2CSO A;  5LGU A;  4YG2 F;  3CCR I;  1OYY A;  1ZH5 A;  2OBP A;  1PUF B;  2UXN A;  2KHM A;  3O3K A;  2HOE A;  2EPF A;  3AG4 H;  4M6V A;  2QGU A;  3CUQ C;  4G6T B;  3E5X A;  3CZ6 A;  5JHU A;  2ZJP F;  3S2D J;  4EVI A;  2NVQ J;  1RPW A;  5EZG A;  4IHV A;  2RAE A;  3S14 J;  5DEQ A;  2XC7 A;  2F4I A;  2ZXH A;  4W97 A;  4IEJ A;  1R00 A;  4CYC A;  1TQP A;  1SVO A;  3DP7 A;  4D7M A;  4EGZ A;  1YHQ I;  3GO5 A;  3HRS A;  3S93 A;  4JX4 A;  2P5V A;  4Y52 J;  3HL2 A;  5J3L A;  1ZLJ A;  4RB1 A;  2HKX A;  2CS3 A;  2R5Z B;  1N77 A;  5EYR A;  3W6V A;  5M3M J;  2B0L A;  4UUV A;  3I4M J;  1POG A;  3L2C A;  2OC6 A;  4PGH A;  5HLI A;  1OCR H;  1K7A A;  2H1L A;  3JRA A;  3NAU A;  5HLT A;  3JTH A;  4A6D A;  3EYI A;  3VEP A;  3ZMS A;  2E2H J;  4B3A A;  2EZL A;  3A01 B;  3KZI C;  5D8L B;  4BXU A;  1G3W A;  1K4S A;  2GA2 A;  2XPW A;  3SEQ A;  1PP8 F;  4RLQ A;  4Y13 A;  2CFO A;  4RB2 C;  5KAI C;  1LQ1 A;  2MD5 A;  1OFC X;  4BQA A;  2Y2Z A;  3CJQ B;  1JI8 A;  4V2G A;  2LTP A;  4ZYE A;  2H8W A;  4RAG A;  4E7Z A;  5D5X B;  5D5V B;  2DOE A;  4HYE A;  4QLC U;  5AON A;  5H6R A;  1BIB A;  3NEU A;  4N0B A;  2YUS A;  5D5W B;  3IH2 A;  2EV0 A;  4E7I A;  2EIM H;  1TC3 C;  2OQG A;  3ZXS A;  3LL7 A;  3ZMT A;  2H09 A;  2X0L A;  2JPC A;  3NWT A;  4LD5 A;  4BYY A;  1RR7 A;  3FIW A;  2IXS A;  3I64 A;  1SFE A;  1O3S A;  1ZG3 A;  3PFI A;  3LWF A;  4MGR A;  3KX2 A;  1TW2 A;  4FHT A;  4QWQ A;  2A3S A;  4XN0 A;  3DTK A;  1OCO H;  3KP6 A;  2A68 F;  3FXU A;  3HHH A;  1YE9 A;  3SZG A;  2NVY J;  3MKL A;  2Z1D A;  1SD7 A;  4EJV A;  3BCA A;  5E3N A;  2OCE A;  4XLF A;  5L3E A;  2BHY A;  3M1C A;  4A3B J;  1VZ0 A;  2BYV E;  3LFU A;  2FOK A;  3K6G A;  1UMQ A;  2XV4 S;  1K61 A;  1X4O A;  3ZCO A;  2IA1 A;  2H1K A;  1ZTR A;  2BHZ A;  1RNL A;  1IXS B;  2VQH A;  2CV0 A;  2RVC A;  4C3I J;  2O5R A;  3HHG A;  3OYE A;  2X6O A;  3L2R A;  1XSX A;  2WC2 A;  2EWN A;  2F48 A;  4XM3 A;  1IDZ A;  2Q1Z B;  3TO9 A;  2DQL A;  3HUG A;  4EAT A;  4XBF A;  1KYZ A;  2DJI A;  3ZR8 X;  2HGC A;  3H0D A;  2H94 A;  3WTW C;  3LOC A;  5LD2 C;  1F1Z A;  3I55 I;  2O0Y A;  3CC7 I;  2AQF A;  4NNJ A;  4PFO A;  4BBR J;  1ZGA A;  1DQU A;  4LLN A;  3S1M J;  3LA3 A;  3CD6 I;  3Q9V A;  2DMU A;  1F36 A;  4E7L A;  3TL4 X;  2IS4 A;  1YQA A;  1ZRE A;  3TGN A;  1OCP A;  4PK4 A;  1K78 B;  1L3L A;  1IN4 A;  2L9V A;  1MH3 A;  2VBW A;  1K6O A;  1UHM A;  2JVH A;  4F3Q A;  2DU9 A;  2R7S A;  9ANT A;  1AOY A;  4N4N B;  3F3X A;  1T56 A;  3BRO A;  3ZRG A;  4LG0 B;  1AWC A;  1UFM A;  1SD5 A;  2QQB A;  4Y4R A;  1U9N A;  2FBH A;  2ZB9 A;  3TMO A;  1FBQ A;  1MBJ A;  2LY2 A;  3GX4 X;  5F0H A;  3MCZ A;  2M0M A;  5DDG A;  1YW8 A;  4LMY A;  2PMZ N;  3S1N J;  4U0V A;  1BI0 A;  3OR2 C;  1T95 A;  1AHD P;  3J80 Z;  1WH5 A;  2IVM A;  3BR5 A;  1KYW A;  5IOZ A;  2ZXW H;  4HEA 2;  3GTQ J;  3KLO A;  4K2E A;  5HDN A;  5JLW A;  3FXO A;  1O7L A;  5ILV A;  3AAF A;  1KZH A;  3FMS A;  1OQY A;  2VJJ A;  3GFJ A;  4AVZ A;  2QSF X;  1FYL A;  2HZD A;  1H9G A;  3FK6 A;  1GT0 C;  2V1D A;  4JBA A;  2LYC A;  1R36 A;  4DJA A;  2WB1 A;  1MMD A;  2LK2 A;  2BVM A;  2LF7 A;  3AFH A;  1ZGJ A;  1JKQ C;  1H0M A;  3J7Y J;  2DTZ A;  2DA5 A;  2HDC A;  3HG9 A;  4BY1 J;  3BG6 A;  3HEF A;  3IWZ A;  1XCB A;  3HOX J;  1F43 A;  2VE8 A;  4I0A A;  1FNN A;  1LFP A;  2PFB A;  1U0J A;  2QBY B;  4YRV A;  1JGG A;  3F72 A;  5FKN A;  3KZZ A;  1BOA A;  2OTJ I;  4DIQ A;  4M3G A;  3ZMZ A;  5LGT A;  1XDU A;  1YIT I;  1BR2 A;  4ABZ A;  1TBX A;  4G8X A;  3H35 A;  3S16 J;  3BP8 A;  3IV5 A;  2UXX A;  2DMP A;  2K27 A;  4RDU A;  3LAP A;  2KDZ A;  1R5H A;  1TWA J;  4NUB A;  3MQ0 A;  2KJC A;  3RKY A;  1LVK A;  1WGX A;  3K69 A;  5FD5 A;  4BE2 A;  3TDZ C;  3RPU A;  5EEG A;  3DTI A;  4IF4 A;  4IO9 F;  5B1B H;  1O4X A;  2K9M A;  2ID3 A;  4D9J A;  2M34 A;  4D5C A;  1W7P D;  3KYD B;  4L18 B;  2CMP A;  4HF0 A;  3BR6 A;  5FLX Z;  4A3K J;  5BMZ A;  1QNT A;  1Z3X A;  3HYI A;  2FA5 A;  2VC0 A;  1VI0 A;  1Z77 A;  4UV8 A;  1HF0 A;  1Q1V A;  3HOW J;  1X19 A;  1J5Y A;  1MND A;  1C0W A;  2DT6 A;  1O57 A;  1UHW A;  4V19 K;  4BE0 A;  4GDF A;  1GV5 A;  2HXO A;  2K9Q A;  2PN6 A;  3HM5 A;  1V5G A;  2M2E A;  2A5W A;  2I8D A;  3F6O A;  4BUP A;  2FE3 A;  1QVU A;  4PFP A;  5C44 J;  1I1S A;  3LMM A;  5F1J A;  1W5C C;  3ZMD A;  3S3M A;  5IYC J;  4UV9 A;  3HZJ A;  2AS5 F;  2DOD A;  2MG4 A;  3CJN A;  3WOD F;  1A04 A;  2R7T A;  3L00 A;  2OPT A;  3FX3 A;  3ZQQ A;  1OCT C;  1T38 A;  2YS9 A;  2NNY A;  1K6Y A;  1UEL B;  2QBY A;  2IGO A;  4CSW A;  2PLY A;  4IJA A;  3BPV A;  3H3V K;  2EFQ A;  1P2F A;  3BY6 A;  3K70 D;  1B9M A;  1I3Q J;  2QSH X;  2W7N A;  4BY7 J;  5GTI C;  3I53 A;  2E5Z A;  1LUJ B;  4DYR A;  1I1G A;  1VND A;  3GLL A;  2CU7 A;  3DKX A;  2ESN A;  3O8G A;  4LB6 B;  1IDY A;  1W0U A;  4IX7 A;  5BOX A;  4KNY A;  3BR0 A;  1YI2 I;  1FP1 D;  3BPX A;  2GOX B;  5FFZ A;  2K5C A;  1QA6 A;  1WI9 A;  5K5R A;  2IA2 A;  4HA8 A;  1U78 A;  1SVL A;  2J5O A;  1BW5 A;  1P4W A;  2HOA A;  2HPM A;  1MH4 A;  4MNU A;  3V8L A;  1FJL A;  1XD7 A;  3K4J A;  3FWE A;  4DYC A;  2YX7 A;  2TCT A;  3K0L A;  2ISY A;  3BR3 A;  5D6F A;  2Z5U A;  2M7B A;  2XRO A;  1AKH B;  2VC1 A;  3RJP A;  2JRT A;  4L0Z B;  4X6A J;  1F9N A;  3I5U A;  3FXJ A;  1XGS A;  3A4C A;  3E7L A;  5IT3 A;  3ZPL A;  2YPR A;  1EH8 A;  3P9I A;  1S7E A;  1EA3 A;  2IPQ X;  2RC4 A;  3FDY A;  5F08 A;  1YW7 A;  1XGO A;  5EG0 B;  1FMV A;  1ZAR A;  2E1M C;  4M9S A;  1T2K A;  1GHC A;  4BQO A;  5C4X J;  5M5W J;  3FXQ A;  1BI2 A;  5M5Y J;  1A35 A;  3JRF A;  1O3Q A;  1TW3 A;  1XGN A;  3DU6 A;  1W0T A;  1U2W A;  2P81 A;  2HS5 A;  3KLN A;  3HOV J;  3RZO J;  2GQQ A;  3K1P A;  4RGU A;  1AKH A;  3BDD A;  1ZR2 A;  2XHK A;  1UST A;  3P9K A;  4W1U A;  2EIJ H;  1YG2 A;  2WBM A;  3CUO A;  3S2W A;  5FD6 A;  4LIU A;  1FX7 A;  2ZME B;  1BI1 A;  3ECO A;  2XPV A;  3WG9 A;  4HBL A;  3HGG A;  2W24 A;  1G4D A;  2L9R A;  3WHB A;  1V54 H;  2JSP A;  3DF8 A;  3K4N A;  3KYL A;  3G6E I;  2G9W A;  3ECH A;  5K1Y A;  3CDI A;  1GVJ A;  4CCN A;  1IRF A;  1A36 A;  3KCC A;  1HKS A;  2CUZ A;  2ELH A;  3N97 A;  1KQ0 A;  1FPQ A;  3HUG B;  4XRF A;  3OYA A;  1VQ9 I;  1JTX A;  2KFD A;  2VOD A;  1FIP A;  3QWL A;  4OU0 A;  3K2A A;  2XGC A;  4AID A;  3KZY A;  2LKS A;  2QA4 I;  2RRE A;  3S3N A;  4I99 C;  1EJ9 A;  2VBX A;  2Y48 A;  3VFZ A;  2DI3 A;  3VYS B;  1IN8 A;  5HDK A;  4ZDO A;  1OR7 A;  4DBQ A;  2P7V B;  1FBS A;  4A3F J;  2CV2 A;  2LY9 A;  3DWL E;  1NK2 P;  1OPC A;  3CO6 C;  4HST A;  4GYI A;  4M6X A;  3R6S A;  1RKT A;  2DPU A;  2HVR A;  2E36 A;  1WJA A;  2VN2 A;  4HRI A;  1JHF A;  3PNV A;  1XG1 A;  1IN7 A;  2HDW A;  4BKX A;  3O2P E;  1AA7 A;  4M74 A;  1YRN B;  3K4K A;  2PEX A;  5ERI A;  4C9Y A;  2EZK A;  3GW2 A;  2VQC A;  2MD0 A;  3W2V A;  2Y69 H;  2P5L C;  4NQW A;  4S05 A;  3HTS B;  1WFX A;  3I3L A;  3BZK A;  3OYG A;  1ODD A;  2HDD A;  3OY9 A;  3CMY A;  1DUX C;  2GIZ A;  2X85 A;  3OYJ A;  2EZH A;  1RI7 A;  2QYO A;  4R8H A;  3TW7 A;  4BEH B;  4EJU A;  5GAG J;  1CF7 A;  3JSP A;  4C30 A;  4B8X A;  3LQQ A;  3SDG A;  1Z21 A;  3ABT A;  3D5L A;  3ZMV A;  3FIS A;  4U87 A;  4A5M A;  2OF7 A;  3ISP A;  1UG0 A;  5B1A H;  2EB7 A;  3NQO A;  1TLH B;  4LGW A;  3LSK A;  4KDP A;  3W6K B;  3BJA A;  4MQV A;  1E17 A;  1HXD A;  1S29 A;  3ZQ7 A;  1MMN A;  2FMY A;  2MC4 A;  3L2Q A;  3ZOB A;  1ZG5 A;  1I6H J;  2NS8 A;  3LA7 A;  4N9I A;  2R7Z J;  1T08 B;  5TIS C;  3H1C A;  4GCV A;  3HKZ A;  2GOM A;  1X1A A;  2L9S A;  2LMD A;  4HSR A;  5DUK A;  1X3Z B;  4U0W A;  3V7S A;  1MDM A;  4AIH A;  4KMU X;  4RAY A;  3ZQL A;  5EDN A;  5E3L A;  2R7U A;  1ZHF A;  4A2U A;  1UZC A;  4N4O B;  3LSJ A;  2JQ7 A;  2JUG A;  1IAW A;  3BOQ A;  1J0R A;  3J80 K;  4YIR X;  4UUS B;  3CUQ A;  2MW8 A;  5CVU A;  2NYX A;  1GUU A;  2XAJ A;  1P7I A;  4U0Y A;  3B02 A;  4A3D J;  3M07 A;  2LRD A;  2W4S A;  4CYC B;  5E8I A;  3AG1 H;  5HS7 A;  3C2H A;  1D5V A;  4ZZL A;  3HPH A;  3ML6 A;  1ZKG A;  5KCM A;  1JE8 A;  1T0F A;  1BM9 A;  1Z6T A;  1MBK A;  2CYY A;  2VKV A;  1ZEL A;  4A69 C;  2CW0 F;  1SC7 A;  2O8K A;  2K9S A;  1PUF A;  4F91 B;  2L9N A;  2QZ8 A;  2ZFW A;  3A03 A;  4CZZ A;  1I6X A;  3JRE A;  2XSJ C;  2W84 A;  2E2J J;  1G3Y A;  4B1R A;  1QGP A;  5EGO A;  4EJO A;  2R4G A;  3Q5F A;  2W48 A;  3S8P A;  1IO2 A;  1OYI A;  3F6V A;  4ENM A;  1LE8 B;  3J7A O;  1QO0 D;  3K4L A;  4OAY A;  3HRM A;  3WHC A;  4EM0 B;  4JX6 A;  1YX3 A;  1O7F A;  3M8J A;  1MBG A;  2HOT A;  2LR8 A;  5L3B A;  2HYJ A;  2E19 A;  3AG3 H;  2XAS A;  2ME6 A;  3E6M A;  2QVO A;  1YOV B;  3G1L A;  3B6A A;  1XSV A;  2VE9 A;  4IRG A;  1D8K A;  3G1O A;  2CQK A;  2DK5 A;  2W1O A;  1APL C;  2JT1 A;  3WTY C;  3T8T A;  3IH4 A;  1RUO A;  2NVX J;  4E70 A;  3W2W A;  3E6C C;  1MNM C;  4ZDL A;  2FBI A;  2VXD A;  2YU9 J;  2WV0 A;  2B63 J;  1X1C A;  4FAS D;  4IQ4 A;  4UUS A;  4OWR B;  3KP2 A;  3OS0 A;  1Y56 A;  3R61 A;  4BXX J;  2EV6 A;  3QPH A;  2VKD A;  2YSR A;  5L3D A;  2ZJQ F;  1X2N A;  2QKL B;  5A2Q K;  2DA2 A;  4XLN F;  3RDI A;  4CA0 A;  2XF7 A;  1O3R A;  3BJ6 A;  3Q3S A;  2L01 A;  4QIW N;  3FXR A;  1YX5 A;  4P55 A;  1BW6 A;  4MHG A;  4BDZ A;  3KEQ A;  3V7C A;  1EKE A;  3DCF A;  2QQ9 A;  1VQM I;  3LST A;  1FOY A;  1SAU A;  2HFH A;  2XB5 A;  4G6Q A;  2NNN A;  3K70 C;  4IHX A;  2V1N A;  3MKY B;  1QZE A;  3HSR A;  1MSE C;  3CC2 I;  1ENH A;  4MLO A;  1U9O A;  3CP8 A;  4EMS A;  3CCS I;  2WAQ N;  2O03 A;  3QU3 A;  5HVQ C;  2I10 A;  2QQ8 A;  3L9F A;  3FKI J;  3I9V 2;  3CCL I;  4AYB A;  2OU2 A;  1XMA A;  2QKM B;  2VKE A;  1MNE A;  1N25 A;  2LF8 A;  4BEH A;  1X58 A;  2CH0 A;  2H6C A;  2HKO A;  2A61 A;  2OQR A;  2OD5 A;  1D0Y A;  2HOS A;  2VJ4 A;  5C3E J;  1QPM A;  2FNA A;  2X4H A;  3M3Y J;  5LEJ A;  3WG7 H;  2XAH A;  2HYG D;  3I56 I;  2GLO A;  3LNQ A;  5E20 A;  3COA C;  4IRI A;  3L1P A;  2P7C B;  4A3J J;  3OOU A;  1FWZ A;  2GXG A;  1MMG A;  1HC8 A;  2EA2 A;  2BBY A;  2VPR A;  1MJA A;  4MQ9 F;  5LRS A;  3CCM I;  3A01 A;  1T8I A;  3L2W A;  3CMA I;  3CF5 F;  5K7Z A;  1GVD A;  2FF4 A;  4M9X A;  2PMZ A;  5LEK A;  1XMK A;  3WGI A;  2Q2E B;  3OR1 C;  3DLA A;  5FLX K;  3PUB A;  5L3C A;  2KPM A;  4CDG A;  2R7Q A;  4MFE A;  3EUH C;  2R5Z A;  2P5K A;  5DCF A;  5EF6 A;  5JI6 A;  2D2W A;  1IUF A;  2Q8K A;  2CRG A;  4XSX F;  1W7P A;  2Z16 A;  2IS1 A;  1O3T A;  2IJL A;  2BV6 A;  2G7H A;  2FQ3 A;  2O3F A;  4MTD A;  4O3M A;  3HDD A;  1FZP B;  1OJL A;  1U8B A;  1H9T A;  1X1B A;  2JZY A;  3RQI A;  4I09 A;  4KIT B;  3MVP A;  5DYM A;  3H5A A;  2FBK A;  3QYF A;  3E5U A;  3DBL B;  3ERE D;  3DEW A;  1T39 A;  2X48 A;  4F93 B;  2DYR H;  3RIR A;  2LDU A;  2V4J C;  3MZY A;  4B48 A;  2DMQ A;  1W5S A;  3JAM Z;  2A5Y B;  2RN7 A;  4XNF A;  5GP9 A;  4RB3 C;  1RZ4 A;  3JTG A;  2E71 A;  4JQF A;  4ON0 A;  2L02 A;  2L7K A;  3WTZ A;  3MZ8 A; 
#chains in the Genus database with same CATH homology
 1YJW I;  1VQM I;  3CD6 I;  3CCJ I;  2E36 A;  3G4S I;  2OTL I;  2E34 A;  1FOY A;  4V19 K;  3CCR I;  1VQ9 I;  1VQ6 I;  1YJN I;  1YIT I;  3J7Y J;  1VQ7 I;  5GAE J;  1VQK I;  1Y39 A;  1VQ5 I;  1FOW A;  2QEX I;  3CCU I;  1S72 I;  2H8W A;  2K3F A;  2JQ7 A;  2NXN B;  3CC2 I;  3I56 I;  3CME I;  1VQO I;  2QA4 I;  2E35 A;  1ACI A;  1FOX A;  5DM7 F;  4IOC F;  1YJ9 I;  1VQL I;  2FOW A;  3CCS I;  3PIO F;  4IO9 F;  2ZJP F;  1MMS A;  3DLL F;  1HC8 A;  2ZJQ F;  2ZJR F;  3CCV I;  4UY8 I;  5GAD J;  3CCL I;  3CC4 I;  3PIP F;  3CCE I;  3CCM I;  3CCQ I;  1YIJ I;  1VQP I;  1VQ8 I;  1YI2 I;  3G71 I;  3I55 I;  5GAH J;  3CC7 I;  3G6E I;  5GAG J;  1QA6 A;  1VQ4 I;  1YHQ I;  3CMA I;  3CF5 F;  2OTJ I;  3J7Z I;  5JVG F;  5DM6 F;  1VQN I;  3CJT B;  4IOA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...