1FOWA

Nmr structure of l11-c76, the c-terminal domain of 50s ribosomal protein l11, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords L11-C76
publication title High resolution solution structure of ribosomal protein L11-C76, a helical protein with a flexible loop that becomes structured upon binding to RNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1996-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1fowA00
2E34A 5GAHJ 1QA6A 3CC7I 1VQ8I 5GADJ 1VQ4I 3CF5F 1YJWI 1FOYA 1VQKI 3CCJI 3CJTB 3CC2I 2E35A 2H8WA 2QEXI 2JQ7A 3CCUI 1YI2I 1YJ9I 3CCEI 1YIJI 4V19K 2OTLI 1HC8A 2FOWA 5GAEJ 1FOWA 3CCSI 4IOAF 1VQPI 5DM6F 3G4SI 3J7ZI 1YJNI 2OTJI 1FOXA 3CCRI 4IOCF 3CCMI 3G71I 1YHQI 5GAGJ 1VQ9I 3CMEI 3G6EI 2K3FA 1S72I 1VQ5I 2QA4I 3CCVI 1MMSA 3I55I 2ZJQF 3I56I 4IO9F 3J7YJ 3CCQI 2NXNB 3PIPF 3CMAI 3PIOF 2ZJRF 1VQMI 5DM7F 3CCLI 1VQ6I 2ZJPF 1ACIA 1VQOI 3DLLF 1VQ7I 1VQLI 1VQNI 1YITI 3CD6I 3CC4I 4UY8I 1Y39A 5JVGF 2E36A
chains in the Genus database with same CATH superfamily
1J5YA 4L5IA 3GEZA 3OY9A 2V1NA 4G6TB 1S3JA 2NS0A 3MVPA 3HOXJ 4KMFA 1B72B 2M8EA 4XLEA 1X4PA 3JRBA 1FMVA 3F8MA 4IKFA 1QVUA 3IH2A 4Y33A 2XIGA 1R4NB 4I6ZA 3WHBA 1LDKB 4RS8A 3TEDA 2RC4A 2E1NA 1R22A 4BJ6C 4NBQA 1UELB 2VI6A 4UV9A 4AIHA 2LKSA 2Y48A 2X6OA 2JZYA 4RGSA 3B6CA 3S16J 2QF7A 3AL0B 3TP0A 3QPHA 4HNUA 2HNHA 3WHCA 3H5RA 1LEAA 2QEXI 1BI2A 2ACJA 4X1EA 3SFIA 5HODA 1B59A 3FXMA 1YI2I 1X1DA 4HSTA 1YJ9I 3H9GA 3MZYA 4KJZA 5FB2A 1S6LA 4UB8C 3QPTA 1ZG1A 4P9UA 1WJ5A 3SJMA 2NRAC 1KYZA 4CGZA 3ABMH 1ZN2A 4WF2A 2V6CA 2XHKA 1H9GA 4IZZA 3J7AY 1PP7U 1QRYA 3QOPA 3H0DA 4O6JA 2XASA 5F6FA 2VONA 3D5LA 1AOYA 4V2GA 2M2EA 1Z1DA 3GX4X 1ZG3A 4XN0A 5IOZA 4IOCF 3G71I 2BEOA 2DPDA 5ICEA 3OYJA 5IOYA 3K9TA 3TOAA 1DU6A 5J47A 1Z3XA 4YIRX 2STWA 3TDZC 2XC7A 3COAC 3KLNA 1NTCA 4ENJA 4CYCB 2W82A 3I0TA 3OYNA 4NUBA 2L3DA 1BOBA 1IV8A 2F5VA 1IUFA 3BPXA 3GO5A 1HSTA 2HOSA 1BR1A 3GFLA 1PP8F 2F5EA 3PL8A 3WG7H 1ZREA 3ZXSA 5D6EA 3SEZA 2JWTA 3PUBA 1EH6A 2O61A 4UUTA 2DA5A 2XKPA 3HYIA 5B1BH 2HOAA 1KU2A 3HOWJ 2X6WA 3MKZA 1SANA 2YSRA 3ZMUA 2AQEA 2IPQX 5KK1A 1TNSA 3VEPA 3BCAA 4EMSA 3ESWB 1W5CC 3O6BB 2MLKA 2OQGA 1Y8RB 3IUOA 4D5FA 1U5TC 2IA1A 3JRCA 4S04A 3W6KB 2CWEA 1MDMB 1IXCA 2EFNA 5DCMA 5B5EC 3B73A 2XGEA 3FWEA 4BXXJ 3QP5A 2HZDA 5HLTA 2KISA 2P0WA 4OOIA 3ZMSA 4DJAA 2XRNA 3ZMTA 4I76A 4BQOA 3RYRA 5GADJ 3KPHA 2IJLA 3PFYA 5E8GA 4CCOA 3CF5F 2EFPA 5EJCA 2GA1A 2HQ5A 3BLYA 4QPQA 4BGDA 3DKXA 2EWNA 3E3VA 2XB5A 3IH3A 3LSKA 2CQQA 1R36A 4EGZA 2W85A 2DA6A 4BJ5C 1UHMA 2I8DA 1STZA 4CSWA 2R4GA 3D5RC 3FBNB 1GHCA 4MEYF 1OCPA 1OYIA 1OLTA 2L4MA 3DBHB 5IT9K 4MLOA 3S3MA 4E6KG 2R7XA 1JKOC 1Z05A 2VXZA 2XGCA 3HGGA 4LLNA 5L3BA 4Q5SF 1HC8A 3GFMA 1AWCA 5JLWA 4PCQA 1FBUA 2GBYA 4DYRA 4EATA 1LQ1A 3FHNA 4C3IJ 3N97A 1SFOJ 2VE9A 2KDZA 4ENKA 2A05A 2FBHA 3CDLA 4OWRB 4C30A 2FE3A 5TISC 2RKHA 4JX6A 3ZQCA 3LFUA 2BGCA 4AIJA 1YJNI 3MD2A 5HS9A 3C18A 4BQQA 3HDDA 1AKHB 3MN2A 3QOEA 5DUIA 1U78A 3BG7A 5HDGA 3FIWA 1VQ9I 2BBYA 1ZLJA 5GPAA 3JRHA 1G2HA 1P4XA 4B8XA 4BUPA 1BOAA 3CCVI 1L0OC 1A6QA 3OL3A 1MMSA 2P5KA 3CLOA 2KRCA 2NXNB 3ML6A 4UVAA 1F5TA 3MKWB 1HOMA 1BJAA 1S29A 2ZJPF 2E2JJ 1B8IA 2G7UA 1F9NA 3BDDA 3DLLF 4OIQF 3NWSA 4IHYA 4BHBA 1KU7A 3I71A 3D5SC 2ESNA 3J80Z 3MFKA 1BR2A 5DDGA 1WVRA 4BXFA 2PBIA 4AD9A 3WTTC 1U8BA 2DAOA 5J3LA 2GOXB 1W7PB 3GFJA 1R00A 1KU9A 2QVOA 4A0YA 1BL0A 3EETA 2GXAA 1WQ2A 3FKJA 4I98B 3WTUC 2ID3A 9ANTA 4Y3OA 2EK5A 4LG0A 4DQ2A 5F1RA 5L3DA 4HQMA 1ORKA 1N78A 2B0LA 3Q9SA 3ZQIA 1O3QA 2A69F 4A3KJ 1W36C 4NHJA 3FXUA 3BJ6A 4RAFA 2VXDA 5EEGA 1KYWA 2XB0X 1E3PA 1KONA 4M72A 4X0GA 2JA2A 4KICA 4Z2YA 2DYRH 1I5ZA 3GWZA 4Y4RA 5EG0B 1A36A 3MKYB 4WX9A 1FYMA 4PGHA 1U2WA 5IPAA 3MQ0A 3CMYA 3E6MA 1BW5A 5M5YJ 1VZ0A 4KIGA 4OAYA 3CCEI 4PGGA 1Z7UA 1KZHA 3L2QA 3JW4A 5A2QZ 1D8JA 2NAZA 4R8HA 3S1NJ 3DWLE 3RSNA 1FJLA 4RGRA 1TWCJ 2JMWA 1UJ8A 4GYGA 2PFBA 3BPVA 4LIUA 4DBRA 1R5ID 2WC2A 3T5XA 1FSHA 4BBSJ 2IW5A 1WH7A 1XG1A 1CF7A 3K70D 3KP5A 1I3AA 4XNFA 3JRGA 2VBXA 4I09A 2K9QA 1B6AA 5FROA 5D6FA 5JFRA 1OR7C 5TGTA 2DLLA 1JKPC 2WAFA 4EJVA 2PX9A 2AXTC 2K9MA 2EQRA 2Y0SN 1YLFA 1JKRC 3Q0VA 3OSGA 2ZNYA 2M87A 1GDTA 1OFCX 2Z33A 4BNCA 3OS0A 4NC7A 2A07F 2L5QA 1YE9A 1FOKA 3ABKH 2L9VA 4KITB 3P9KA 2XDVA 4XLAA 3I5UA 2L7ZA 4N4OB 1JTXA 4XSZF 3FM3A 4RM2A 1JUMA 2ZB9A 5F0FA 4A5MA 1HW2A 3M9AA 3SDBA 1PUEE 3CP8A 4AYBN 3GLLA 2DFEA 3WGHA 1VQ7I 4C2MJ 2GXBA 1VQNI 1QZEA 3LQRA 2UXNA 4B4CA 2RNGA 4D0PA 3GVAA 2W1OA 4E70A 1RETA 3PUFA 1YRNA 2DW4A 2PMHA 5JVGF 2XPVA 2IXSA 2Z9OA 4A3JJ 3K4CA 1E0EA 3IWZA 4HDVA 3JCUC 1QVTA 2IGMA 4M9ZA 1IG7A 2HOTA 2HFHA 3JRDA 2HGCA 2QQ8A 3ABTA 4O5VA 2V1UA 2ZCWA 3EQLF 3CMMA 1X2MA 4FHTA 4FE4A 4GCVA 4IVNA 1LEBA 3JR9A 1GT0C 3LSJA 3WTWC 1VTNC 4ZYEA 1Y0UA 1SMYF 4GO1A 3GUDA 4YELA 5IP9J 4M6XA 1P2FA 3IC7A 3UNGC 4XONA 1X3UA 3H5NA 3W2WA 4NQWB 3F23A 3HOVJ 3WU2C 5IT3A 2RQPA 4IPAA 3BJOA 4RB3C 3L7WA 3CO6C 4OIOF 2FOWA 1W5TA 1WCMJ 3HPGA 3QP6A 5BPDA 2O7OA 5FFXA 2MW8A 1R1TA 2R93J 2QQBA 3NARA 3R4KA 4CUGA 3LSIA 3FK6A 1FTZA 1V54H 4B3AA 4BE0A 2OAZA 3F22A 5CVRA 3K4BA 1OPCA 3NEUA 2H6CA 2D2WA 4RMNA 2EV5A 2IA0A 3C3WA 2BW3A 3MKLA 4HLYA 1O4XA 3LWFA 4EM0B 4ESJA 2K3FA 5M5XJ 3LFKA 1HW5A 2LK2A 2GXGA 3RPUA 4MNUA 1JJ6C 2H6BA 2R7TA 3CJRB 2FEZA 3C2GA 3HIFA 3I55I 4KA4A 1FWZA 2EZLA 4IO9F 3CESA 3F3XA 3QQAA 2M0MA 2IEKA 3CCQI 2HQRA 4F91B 3PO2J 3GYHX 2GOMA 2E1MC 1Z3YA 1ZG5A 2CUJA 2ISYA 4DYQA 3BROA 2HDDA 5DM7F 2MGQA 2R7OA 1BN5A 3I59B 4OINF 2M30A 4LK0F 4CXFA 3OYEA 3BG3A 1EH8A 3O8GA 3P7NA 1G4DA 2DT5A 1OR7A 2IVMA 2Y0MA 2DDBA 5LHHA 2VT2A 1GXQA 3N05A 2Q1ZB 4LOCA 2W4SA 5H6QA 2D5VA 2KLOA 1I50J 1W4MA 1SFKA 5K5QA 2QQ9A 4CH7A 1YG2A 4A93J 4XSXF 1F1ZA 1HXDA 2BV6A 2F5FA 3GW2A 1ZRFA 2VPRA 4EJWA 3OOPA 1R5HA 5EGOA 3I54A 5AONA 4UVBA 5K5RA 4H0EA 2STTA 3RYPA 3BT9A 1H89C 2L9RA 4B3XA 2VOOA 1I27A 1B9NA 3HSEA 4BQAA 4BH9A 1DGWY 2HKOA 1WFXA 4WWCA 3S14J 1ZYRF 1NK2P 4OAZA 1HQCA 1OKRA 4UV8A 3FXRA 1WWXA 3E6BA 2ZMEA 3SQNA 3ZRGA 2BY0A 4WCGA 1SD5A 4DOZA 4F93B 3J81K 5EZHA 2M45A 2F4OB 3HOYJ 2JQ7A 1T8IA 4JQFA 1ENHA 2FQ3A 2EFWA 6PAXA 3WU0A 2ME0A 4ZYHA 1SAXA 2BVLA 2JSPA 2L7KA 2OCCH 1O3TA 1IF1A 1MH4A 1DP3A 2VB6A 1XMXA 1QHHD 4A3IJ 3AG4H 1ULYA 2UUZA 1Y1VJ 3Q0UA 2EIMH 1KQ8A 3HKZN 1DP7P 2H09A 4II2A 1HA8A 1EF4A 4M6YA 1MNDA 4E7KA 4IHSA 4IHVA 2CJJA 1R49A 2QSGX 5KHDA 3Q9VA 2WAQN 4O3MA 4YIFA 4CYDA 3RQ4A 4UNOA 4FETA 2CO5A 3E5XA 4PFOA 2OTJI 4L9JA 4RAGA 3BG5A 3H36A 5F04A 5CJ9A 3CCRI 1HBXG 2P7CB 2ZNZA 1DPRA 3TDUC 5GAGJ 2D1VA 1YHQI 4HF2A 4XQFA 2VASA 4EGYA 1J0RA 1SD4A 1XD7A 4RA2A 1LUJB 2F4IA 5CVVA 4ZZLA 3S15J 3DXJF 2VN2A 3TP3A 1B9MA 5J4YA 2LOOA 5EYRA 4DYCA 1OMIA 5CKTA 4P55A 2R7DA 2Z5UA 4XRFA 5E1XA 4CA0A 4CO8A 1YS6A 2YU9J 1QPIA 4F55A 3HM5A 2O9LA 1Y0NA 2KRHA 2F5DA 2K9LA 3VDXA 1R4MB 1IJWC 2EH3A 1MSEC 2FXAA 2JVHA 2UWMA 4ZDPA 1VQ6I 2QKMB 5LD2C 4WXCA 5K7FA 4XKWA 5DUKA 1X4OA 3S2WA 2DT6A 3BR6A 1U0JA 1LDDA 2DMNA 2DFIA 3G1LA 2A6HF 3DEEA 1E3OC 4OIRF 2KP6A 3F8NA 4MEXF 4C9YA 4HOBA 4P5OA 3Q5FA 2DU9A 4QSHA 2Z99A 5M3FJ 5TRDA 3RIRA 4Y17A 2HVQA 1U8RA 3T8RA 1T39A 1QBJA 4GFBA 3QWLA 5CVIA 4QLCU 5DD4A 3KLOA 5C3EJ 1G3TA 3KETA 1BA5A 4XOPA 3CO7C 1IAWA 3JRFA 4KYWA 1IZ1A 4LMYA 1TP4A 3N4MA 4XMYA 3F9KA 1PDNC 3AL0C 1K79A 4YFXF 2FMLA 3NQOA 4ZJZA 5EF6A 2XGDA 1OCOH 3OYHA 4BE2A 2XKOA 3ISPA 1IN5A 1QGPA 1Z21A 2A3SA 4XK4A 4E7HA 1PVEA 3KEYA 5LHIA 3S2HJ 1YIOA 4PSWA 4Y13A 2CW7A 4RM3A 1Y8QB 4G7OF 3EUHC 4RB2C 4M74A 4PJJA 1V5FA 4I02A 3GTMJ 3CUOA 2JPCA 2DO7A 1BI1A 2MYSA 5BQTA 3F6VA 1TBXA 4A0XA 5FJ8J 1O7FA 2Z1DA 2WAEA 1XGOA 3HGYA 2XAQA 2MLGA 2M3AA 2PEXA 2F5CA 1TZLA 3K4MA 1SD7A 2R3SA 2P5VA 1FMWA 1ZGJA 4KT6A 1LE8A 2OQRA 5EZGA 5J8FA 3ULQB 2MSYA 2TRTA 1HKSA 1IC8A 3CJNA 2QA4I 3ZMZA 4FX4A 2EA2A 1Q1VA 2L0KA 5D8KB 4BHPA 4IJAA 1ZK8A 3CUQA 3L1PA 1FSEA 3ZGKA 3MMYB 3G73A 3BTIA 5IYBJ 4U0WA 3IL2A 2QKLB 1XGNA 4YIIA 4BACA 2ZC2A 2LFBA 2IBDA 1VQMI 1QNTA 1YO5C 1Y56A 3B02A 4KIFA 2BZTA 2JUCA 2X1EA 3HSRA 4M3EA 5FGMA 3OYKA 2XAUA 3WTSC 3KE2A 2K9SA 3SZTA 1RUOA 2E2IJ 3CDHA 2CUZA 5H2FC 1ZTRA 5K5OA 1I1SA 5BS6A 1P4WA 3QYEA 2LC2A 3WGIA 5BPIA 2O5RA 2W57A 3H0GJ 3ERED 2AS5F 1V3FA 4M3DA 4E7LA 5FKNA 2OBPA 4XM3A 2E19A 1ZQ3P 2KIUA 2X85A 3A0HC 2IT0A 2GIZA 1MBFA 4CCKA 2QYOA 2PQ8A 3PNYA 3PJRA 2LVSA 3F6OA 4HF0A 5BOXA 3RI4A 4A6DA 1WJFA 3D0SA 2KIQA 3FKIJ 4HSRA 4XKCA 4ESBA 1OYYA 1VI0A 4MGRA 2W7NA 4IHWA 1PYVA 1QPMA 2WB1A 5LEJA 2KJBA 2XGXA 1BI0A 2FUG2 3FM5A 3LSRA 1UZCA 2LY9A 3C7JA 3IRRA 4G7ZF 3GTLJ 3GTOJ 5L3GA 3GTKJ 2YR2A 2LBFB 1YW9A 2EINH 3E6CC 1IN6A 4KFCA 3HL2A 1G6NA 2FJ1A 1P92A 2Y75A 2OPTA 2VKEA 2DODA 4V19K 5JLXA 4FISA 2IAIA 2EPFA 3S17J 3HRMA 5GAEJ 1PUFB 1ZR2A 2HQAA 4KIBA 3PO3J 2NVQJ 1EJ9A 1VQPI 1Z6TA 1W0UA 1DDNA 1NHAA 2JRMA 2IS6A 4JYKA 2TDXA 3JSOA 1HKQA 2JA5J 3I4MJ 2VC1A 3HUGA 2JA6J 3J80K 3DLAA 4I99C 5EEHA 1TWFJ 1AHDP 2DK8A 4LG0B 1UB9A 2X9DA 5LGTA 4N0BA 4DNCA 2OF7A 2MH9A 4IF4A 5L3CA 1DUXC 2IS1A 3DPUA 1JT6A 2L54A 1ON2A 1MZBA 1MMNA 2IGNA 3LSTA 3AKZA 1AU7A 1POGA 4L18B 1G3YA 2RN7A 3CLQA 2WY8Q 5ILSA 3HOZJ 5GPCA 3LSPA 3D1NI 1KGSA 5ICGA 2DYSH 1ETVA 3I64A 3TL4X 4GDFA 4L0YB 3QAHA 4J00A 1LNWA 4KN4X 2V6EA 1SEUA 4U88A 1ETOA 1D5YA 3HHGA 3F8CA 3C1DA 2ID6A 2Y2ZA 2A6EF 2ETHA 4CYCA 4FTHA 1JKQC 3PSFA 1HCRA 2UXXA 2MC4A 2HEOA 3FXJA 4UY8I 3HRTA 4DZPA 2L9SA 2K3PA 4HW0A 3PNVA 1J2XA 3I53A 4PJNA 5F64A 3ZCOA 3QRFF 3EPZA 2RDPA 3FBIB 2PJPA 1ZAOA 2P4WA 2MG4A 1FZPB 4XICA 5KCMA 2QWWA 1MJ9A 5DTDA 4ZDLA 5A2QK 5CQGA 3ZQ7A 2JA7J 4A3CJ 4ON0A 2JK3A 4DIQA 1CF7B 1QA6A 4KT5C 1LVKA 2O8XA 2KDOA 4CHUA 2DMUA 1W5SA 4E7SA 1EA3A 2NVUB 2ZXIA 1UAAA 3Q3SA 4KMUX 1T6SA 1VQ4I 2AHQA 3BTJA 3TW7A 1XPXA 4A3BJ 5E1ZB 1ZKGA 2GA2A 1IN7A 1MDMA 2VC0A 4HDUA 1FOYA 4BJTA 4A3MJ 3DP7A 2WTEA 2BOLA 2X51A 3SEQA 1TQIA 1QO0D 1SMTA 1MNMC 1T56A 2MA3A 3CC2I 1RZ4A 2ZFWA 4ZTJA 3GCMA 5GP9A 2CUEA 4ENNA 2QGUA 3FX3A 3MCZA 3C2BA 2ICWG 2DXIA 3BQYA 3AG3H 2CV1A 4ZYGA 2PJRA 1IXSB 5CLSA 3U1KA 2VUMJ 3OV8A 2IP2A 2KT0A 3S3OA 1WZ2A 2CFXA 4G6DA 3RPQA 2KL4A 3FMSA 2V4JC 4UVCA 2VLAA 4E7IA 2HPMA 2ECCA 2ELKA 2DJIA 5FKKA 5E20A 2Y30A 3KYDB 5JI6A 3GBGA 2HQNA 3G2BA 4FASD 1WJAA 4MIMA 3ZN0A 4U0YA 2PMZA 5FKLA 3DBLB 4LB5A 1U5TA 1SVLA 1G59A 3CCMI 1YX3A 5HS7A 4EJTA 1GV2A 1Y6IA 3QYFA 2YPRA 1XMKA 4U7DA 3HBLA 1SFEA 3KX2A 3KEOA 3PQKA 1H0MA 3DEWA 2CUFA 3BTCA 4L9VA 2OCEA 1BJZA 1E2XA 3CZ6A 3LA2A 5HS8A 5HNFA 2H1LA 4N9IA 1AKHA 5EEAA 1BIAA 1RKWA 3CMAI 1TLHB 4XLCA 4A3LJ 1B72A 2EFQA 1H8AC 1BR4A 3FXKA 2I10A 4AWXB 2Q2EA 1SAUA 1GV5A 2DMQA 2Z2SB 1KQ0A 1VQLI 3BJAA 1BBYA 3CC4I 4XIDA 3K1NA 2Z3YA 3FXQA 4JP0A 2D45A 4I01A 1T33A 4IL6C 2EZIA 3ASOH 2VKDA 1TQPA 1IN8A 3RZDJ 4IRGA 5IYDJ 5FFZA 1O7LA 5C44J 5CVJA 1D1BA 2VJIA 2KMUA 2VKVA 4ETSA 1FP2A 3V7CA 5J4VA 4CCNA 2D1HA 1XDSA 4LK1F 1OYWA 4E7JA 3OYDA 2X0LA 3M07A 4M3FA 1FBSA 1JI8A 1NG7A 1USTA 1W36D 1U6GA 2F48A 1FYKA 2HPIA 2CW8A 2QSFX 3L2CA 4I7HA 2VE8A 1YJWI 1MIJA 2XROA 1HDDC 2EV0A 2FSWA 4OMYA 3DU6A 3MEXA 3GFIA 2FMYA 4BEHB 3CP2A 1TW2A 1T2KA 1MW7A 4BQNA 1S7EA 1F36A 4BL0B 1FX7A 1YIJI 3TO6A 2E5ZA 5EG0A 4LGWA 1RUNA 3RPUD 2FU4A 2RQQA 1U9NA 4KUMA 2RAEA 1RNLA 3WE2A 2NS7A 2DQRA 2HYGD 5HOOA 1I6HJ 2O03A 3OR1C 1IV6A 3CCSI 2FNPA 2XF7A 1EKEA 5DM6F 1V4RA 3ZP5A 2LNBA 4E7ZA 2O6GE 1SFXA 1MBGA 3PM1A 3WU1B 3J7AO 1FT9A 4XRMA 4S0HB 4L9NA 3ZN1A 3OYCA 2R7ZJ 4F92B 3F8FA 1I39A 2VQHA 1C0WA 3OSFA 2ZKZA 2HR3A 5M3MJ 1S72I 4AU7A 3X2QH 1K78B 4LITA 4HF1A 1LFBA 4M73A 1ODDA 1V55H 4LB6B 3KEQA 2ZJQF 5HNHA 1WH5A 3J7YJ 2L7FP 2EA4A 4HX4A 3BR3A 4BDYA 1HKTA 1MBKA 3G3ZA 1Z9CA 4DW6A 4BE1A 2ELJA 1S7OA 3MWMA 2CW0F 2H1KA 4HX8A 4PFPA 2NVXJ 3T8TA 1O3SA 2ZMEB 1T98A 1U9OA 2JA8J 1E17A 1FP1D 1S8NA 1XX5A 1I1GA 3R0JA 2LR8A 1Z67A 2BXZA 1A31A 4G94A 3LSHA 3OYMA 4I2OA 1WJEA 3LQQA 3OIPA 4HYEA 2KRFA 3L2UA 5HLIA 3BOQA 3LA3A 2KIFA 1CGPA 1JHHA 3IP4B 4IXAA 5E3MA 3LOCA 1ONVA 2Z16A 3H3UA 3U9GA 1FTTA 3RZOJ 1XB4A 3PQJA 1IDZA 4I0BA 2OUMA 4W97A 2M7BA 1SVOA 3WG9A 2JTVA 3EUAA 3V8LA 3GTGJ 3BR2A 5GTIC 2M8GX 4LFUA 2V1XA 3K1MA 1RIOH 3L2VA 3RCOA 3F21A 2CV2A 3IKTA 3V7RA 2VKHA 4NB5A 4YEJA 1IO2A 2ZXJA 2HZTA 5J1RA 3TGNA 3CJTB 1IN4A 1FPQA 3L00A 2H8WA 3ZMDA 3F8BA 2K9NA 2M9HA 2R7UA 2WV1A 3I4PA 1X3WB 2ZBKA 2Q8KA 3VOEA 4EQQA 3QU3A 4A6EA 5HLHA 2UZKA 5L3EA 1Q1HA 1T08B 1X1BA 4N9HA 2CV0A 3JREA 2NVYJ 1N75A 1UG0A 2HVRA 1EH7A 1TT5B 1ETQA 2GLOA 1MMAA 4XKBA 1WJCA 3BZCA 2WA0A 3DCFA 1TW3A 1HDPA 2RGVA 1JHFA 3BQZA 3PSIA 3HSFA 3GZ5A 2XPWA 3S93A 3S1QJ 5LEKA 5IYCJ 2DBBA 3W6JB 3ZQLA 3DTEA 4N4NB 1R9TJ 4KNYA 5ICFA 4OMZA 1R7JA 4G12A 4A2UA 2DOAA 3CTAA 3TO9A 5E3NA 2HOEA 1WGXA 4G8XA 1RKTA 2IS4A 1IUYA 1WI9A 2XAFA 4HNTA 3BR1A 3ZPLA 1W1WE 3DV8A 3DKYA 5HDNA 1YW7A 4D7MA 3GTJJ 5F0HA 2QBYA 1VFCA 2HYFA 4HAMA 3ELKA 2XAGA 4IQJA 1K61A 4G6QA 4YFNF 2XAHA 1F43A 1Z0XA 1KQ9A 2L7MP 3EUKL 4D1QA 2DA4A 2CYYA 2ECBA 4EJUA 1IXRC 4BS9A 1TTYA 1UMQA 4BDZA 1GXPA 3A2KA 1T95A 3OYBA 1S5LC 2FQ4A 4R1HA 3VYTB 4RGUA 1SFUA 4PSXA 4NC6A 4AVZA 2J5OA 3W3CA 2R7VA 1APLC 2IS2A 2FD5A 3K7AJ 4GGGA 4GYIA 4UUVA 1XTAA 2NNNA 3H9JA 2DTZA 5FLXZ 3C2HA 3K4KA 2BHZA 1XS9A 1LE8B 1MBEA 4GRIA 1ETYA 2LDUA 3K4LA 1ZRDA 3Q0WA 3M1CA 2P5LC 4ASNA 1A5JA 3DF8A 2MH2A 1I3QJ 1H9TA 2O3FA 2M7AA 2V7FA 3TMOA 3CUQB 4UUSA 5DD8A 3LNQA 2EJRA 5JHFA 2R5YA 2HTSA 5ICCA 2HS5A 2EBIA 3ABLH 3VYRB 2K02A 4H4KC 3T0YA 4ZYDA 4MTDA 1Y1WJ 4X6AJ 4MFEA 4XORA 2ZJ2A 4Y7NJ 3S32A 4MQ9F 2F6CA 2CGPA 3MAJA 2QZ8A 4BY7J 3HOSA 1XSXA 3IH4A 3OWTA 4HBLA 2E71A 1UCRA 2COBA 4L5EA 1JUSA 3FZVA 1NK3P 3GF2A 4XRSA 3GTQJ 2VOPA 1FOWA 2Y69H 4M3GA 3K4NA 2IGOA 1I6XA 1HF0A 3EDPA 1JTYA 2DN0A 2E5NA 4HNVA 4V2FA 5B1AH 2X1DA 1X19A 5LBQA 3CMEI 3M1EA 1VQ5I 4D9JA 2P6SA 5F1JA 3FXLA 4ZH4F 2WADA 5B66C 3A01A 3K4JA 1XMAA 3LA7A 3SYTA 2FF4A 2CMPA 5CYVA 3H3ZA 4HV5A 3K69A 1OCRH 1LVAA 4BYYA 5DCFA 3DEUA 3QPLA 3JAMZ 2EZKA 2A68F 2DA7A 3RKQA 3V8JA 2NVTJ 2GIVA 3QU6A 5E17F 4MTEA 5L3FA 5DCMB 1YQAA 2ZXHA 5FKOA 5C4JJ 5FD6A 1SVMA 2CRGA 2K5CA 5IP6A 1R5GA 1EV7A 1MMDA 2VJ5A 3R6SA 4BXUA 2LKXA 2F4MB 2QQAA 2NNYA 4WK8F 4UXNA 1Z7LA 5D4RA 4MO7A 2XSJC 1GUUA 2A6TA 4M3BA 4U0VA 2E34A 5M5WJ 2V9VA 1P7IA 4AM3A 1ZR4A 3HUGB 2X4HA 4HX7A 4E4HA 3DPLC 1QZZA 4B09A 1VQ8I 1DU0A 1FEXA 3ZQQA 1XN7A 2WB1N 1V5GA 4IX7A 3F72A 4WXHA 2KPMA 5F08A 4ZTFA 3KP6A 4MFDA 1WRJA 4Q4ZF 1P6RA 3A02A 3DQVC 2R5ZA 4FT8A 1P9QC 2HWVA 3KZYA 2A61A 1FY7A 4M71A 3S3NA 3M8EA 3A1YA 2HDWA 1TWHJ 3I9V2 3TO7A 3W2VA 3WE3A 3E1SA 3ECHA 3RJPA 4RB1A 2GWRA 3KCCA 3HG9A 4HEA2 4A3FJ 4BU2A 1FIAA 5FRMA 1TC3C 1QQIA 1J7KA 4HA8A 1ZLKA 4HQEA 2DMTA 3KFWX 2AQFA 2CU7A 3M8FA 1JE8A 3I4NJ 4OU0A 3V8KA 2PMUA 2M0CA 1MJBA 2RV8A 3ASNH 1D0XA 3I3LA 3HRSA 4JOMA 3LL7A 4ENMA 1N77A 2VODA 1O57A 1X2NA 2JJ7A 3MZHA 2KZVA 2DOFA 3WGGA 3TW6A 3WTZA 1IGNA 1FOXA 2MD0A 3H92A 2B63J 2XV4S 1LKXA 2BE5F 3NAUA 3BR0A 2ELHA 3L9FA 3JTGA 3VYUB 1MKMA 1LFUP 1B8IB 2R7QA 1J59A 3OMYA 4U87A 1LJ9A 5D5WB 1JXSA 2VBYA 3GTPJ 1X1PA 2XF5A 2CS3A 2W48A 4BAYA 2PI0A 1X1CA 4A12A 1ZHFA 2YUSA 1RR7A 5CVUA 3PIOF 4A0ZA 2HU9A 2ZJRF 3DU5A 3L2RA 2A5WA 5HVQC 1T0FC 2DA3A 3H9QA 3HXLA 3FK7A 2YU3A 1YS7A 3RKXA 1J09A 5E1WA 1ACIA 3BCBA 1VQOI 4CDGA 3EUHA 2L01A 4Q48A 2DQLA 3VFZA 3S1MJ 3RTRA 2KFDA 2LY2A 5FKMA 3IRQA 1P4AA 3CCYA 3ROUA 3JSPA 2PJRB 2EZHA 4CCMA 4XLNF 2P8TA 1PJRA 3CDIA 1XSDA 2E36A 2NOGA 3KZZA 1FNNA 1GVDA 2LRDA 1ZRCA 1UHWA 4IRHA 3K6GA 2NOJB 2HDCA 2G7HA 2V79A 4DGWB 2GQQA 1TQMA 1E3HA 2X48A 3E97A 3QYBA 4MQVA 4XOTA 2K40A 1U5TB 3CF2A 1FBQA 4UHTA 2L4AA 2DA1A 2LYCA 2E1CA 1ITYA 2RREA 1ETXA 3E0JB 5J40A 3FMRA 4L9TA 1B1BA 2DA2A 3K2ZA 4ZDOA 1ZGAA 3M8JA 1VNDA 4PUSA 1JT0A 2QSHX 3CCJI 4II3A 5E3LA 2VIXA 4D5CA 3WTXC 2OC6A 2W84A 3OYIA 1R58A 4A69C 4IEJA 3CCUI 2K4JA 1ZGWA 3BP8A 1G8XA 3HC7A 2Q2EB 3HHHA 3SZGA 4AIDA 4ABZA 1R1UA 2XRLA 2EIJH 5JVTA 2OU2A 1D5VA 2PMZN 3K1PA 4HV6A 4XR6A 1ETWA 4HLXA 3K70C 4ANJA 4ESFA 2VBWA 4Y52J 2LBFA 2DCEA 1FIPA 2VBZA 3TKYA 2WV0A 2FA5A 3VPRA 3DTIA 2LF8A 4G9YA 2WBMA 4EJOA 3CQZJ 2VPLA 3JRIA 4FQGA 5F0CA 1Z77A 1PUFA 3G6EI 4XLFA 3PFIA 3R60A 2OZUA 5K7HA 3DTKA 3K2AA 3ERMA 2BHYA 2L02A 5J1YA 2R92J 2JRTA 3OS2A 4W1UA 2CSOA 1D3YA 3FDYA 5IT9Z 1YX5A 2GZWA 2V9PA 5ILVA 2LD5A 2W24A 1D1AA 1NG6A 3U21A 1AA7A 2COMA 2DI3A 3P9IA 1YRNB 3M7GA 2JSCA 3BG6A 3IAS2 4PJMA 2Y9YA 4B47A 1OCZH 2JN6A 4L0ZB 3K10A 2HXOA 1K6YA 1TT0A 1Z6RA 5DEQA 3H1CA 4LLGF 2PLYA 1IRFA 3NWTA 3JTHA 2MBFA 1W7PD 2E7XA 4Z6YA 5F27A 2M4GA 3OIOA 3VODA 2XSDC 2LG4A 3VB2A 4WXDA 1YOVB 2E7WA 3FISA 2R7WA 1R71A 1UHSA 1MJAA 3ZQHA 4OIPF 2LH9A 3BTLA 1SC7A 1JGSA 1RRJA 2F2EA 1RESA 2Y9ZA 3E5QA 3A0BC 1D0YA 1T0FA 3KP4A 3CC7I 5K7ZA 3HB9A 4Q47A 4LLLA 5E8IA 1VF9A 3FF5A 1BI3A 4B1RA 2MFZA 1RC9A 2FX0A 3DFGA 1R6RA 4B43A 1K4TA 3KIOA 3A4CA 3CJQB 4ZC3A 2DFHA 1FLIA 5H6RA 3BC8A 3KP3A 1VQKI 2OD5A 3BZKA 4NC8A 1WKMA 2R7SA 1OCCH 4UB6C 3F0CA 3JRAA 2LY1A 1ZARA 3W6VA 2H94A 1QZYA 2L2OA 2MD5A 5KVRA 4LD5A 4J19A 4C3JJ 1FYLA 3EYYA 1J9IA 4QIWN 2DFFA 4P9FA 4JBAA 5AIQA 1KA8A 2BW3B 5ILUA 4RDUA 1W7PA 1K7AA 4A3GJ 5DYMA 1U3EM 2P81A 2AO9A 4HZFA 4RLQA 1WI3A 2R7FA 5DS9A 4EV0A 4MHGA 3ZOBA 2ZSIB 4IOAF 4QWQA 3TQNA 1MGTA 1TNTA 2HXIA 2YS9A 2WWYA 4U7BA 3KYCB 1W0TA 5BMZA 2DDAA 2IA2A 5J1UA 3IWFA 3A03A 1JGGA 3U1DA 2M1BA 4HPQA 5AIPA 3HOUJ 1GVJA 1IRXA 3FXOA 2LSOA 3BR5A 5LGNA 4LJZF 2O0YA 2TCTA 2W25A 5JHUA 3WODF 2PN6A 4F3QA 2B9SA 4KISA 1ETKA 4JX5A 4FX0A 3AAFA 1X3ZB 1IRGA 1RPWA 2ZMEC 2EFOA 2VQGA 4BKXA 2KKOA 2XVCA 2LF7A 4PJ0C 3KYLA 2Y0SA 2R7RA 2VQLA 1K83J 2B7EA 1HLVA 2DTRA 1GLNA 1MNEA 5FD5A 5D4SA 1KU3A 1OJLA 3E6DA 3MZ8A 2EILH 2M4KA 1MH3A 2ESHA 3HZJA 3GZNB 3ZMVA 2YX4A 3V7SA 4QPOA 1V5EA 1XC5A 5EGOB 3G1MA 5J6XA 3RDIA 5LLQA 4AUXA 4NDLA 2LREA 3HTSB 2HVSA 1MBJA 1BW6A 4RB0A 5D5UB 1O3RA 4AYBA 4P96A 2Y31A 2V26A 1YTYA 1MBHA 3SDGA 1HSJA 2CQNA 4PDKA 1YYVA 2HKXA 2DOEA 3E7LA 1K6OA 3P5JA 1NH3A 5HLGA 2YX7A 2ZSHB 2XAJA 3OYFA 4LG3A 2VQCA 5GAHJ 2QUFA 3S1RJ 2E60A 3L09A 4CCLA 3AG2H 4L5JA 3H5AA 1YW8A 4PJLA 1DPUA 4CICA 5LHGA 3ONQA 2LLKA 4M9XA 4RGXA 3SFZA 2KZGA 3K0LA 1WHUA 2LMDA 1USSA 2FBKA 3NRVA 5E3OA 3LAJA 2VJJA 1ZH5A 1RI7A 1IDYA 5TJJA 2K27A 4GXOA 1QU3A 3DPTA 4EEFG 5ERIA 2V1DA 2MABA 2CFOA 2VT3A 4CZCA 4C2TA 4ITVA 4XN3A 1L3LA 2UV1A 4JK1X 2QM3A 1BIBA 1T38A 1LFPA 2K85A 4HG2A 2K86A 2P6TA 2QBYB 4BHCA 3OYAA 4EVIA 4XKVA 1R23A 2FNAA 1OCTC 3IV5A 1XGMA 5LRRA 2K4BA 1X58A 2QLZA 1MSFC 3IAM2 2HI3A 1MMGA 5LFAA 4FCYA 2H8RA 2EB7A 2N8GA 3RKYA 5IY5H 3UKGA 1TWGJ 3AFHA 1K4SA 2AXLA 4XRSG 2EIKH 2ZFUA 3U2RA 5JR3A 1TWAJ 5D5VB 5EDNA 3GZ6A 1S9HA 4C2UA 4BEHA 3G4SI 1G3SA 4S05A 2QENA 4A3DJ 3VWBA 4DZJA 5LGUA 2E1OA 3M3YJ 1XSVA 3S2DJ 3BZ6A 5B3SH 4IRIA 5J8CA 2RVCA 3HEFA 1D8KA 4XL9A 2FBIA 1G3WA 2NYXA 1BC7C 2W00A 2ISZA 2QCOA 4AVPA 1DGRM 2J5PA 2BVMA 4B48A 2XF6A 3RKWA 1ON1A 4M9SA 2DJNA 2C6YA 2X1CA 3ABUA 2V9KA 3BWGA 5KAIC 4KN7X 3IKVA 4PZJA 3LMMA 3OYGA 1WPKA 3O2PE 3M4OJ 5FLXK 3IHUA 2I5UA 1LDJA 4IHXA 1JJ8C 1ERDA 2Q0OA 4FE7A 1UFMA 3O8HA 3REOA 3ZQGA 4NQWA 4B44A 1R1VA 4AC0A 2NS8A 1K78A 4UUSB 2DK5A 3FHZA 4J01A 3SHFA 3HPHA 5IP7J 3O3KA 3LSMA 2R5YB 3SXYA 5C4XJ 2GAUA 3ZR8X 3VSLA 1XDUA 1BM9A 1IW7F 2E1MB 3HRUA 3HTUA 4XLHA 1LB2A 2JVGA 1OISA 4BBRJ 1YITI 1D1CA 4G7HF 4CCJA 3UR3C 3WTYC 4CZZA 1LPQA 1REPC 2RNJA 1WJBA 2X6XA 4JX4A 1J75A 2JT1A 5BNGA 2EV6A 1A6IA 5D5XB 1IRZA 1Y39A 1F4KA 2CQ7A 2XUBA 5D8LB 3W2AA 3S8PA 3BY6A 2K7LA 1UG2A 2CQXA 4YG2F 3KP2A 2BY2A 2CG4A 1B4AA 2CQKA 3G1OA 2OJED 4M6VA 5FO5A 3KP7A 3R61A 3CUQC 4D7NA 2PG4A 2A5YB 3H35A 4RLFA 4YRVA 4I0AA 4XLPF 2H27A 5E79C 3GLXA 2JPBA 2G9WA 3LAPA 2DT7B 3TBIA 1RR8C 2WY7Q 3RQIA 1SD6A 2OV7A 4HRIA 5KAFC 1MD0A 4Y15A 3DKWA 3A01B 3OIQA 4DBQA 3I59A 3OL4A 4RAZA 1M1EB 2G0EA 5CQEA 2KJCA 2E35A 3PNTA 2BXYA 3AG1H 4TV7A 3VYSB 2OZ6A 2VJ4A 4A5NA 4YFKF 3HOTA 3LSGA 3GMEA 1X1AA 2L9NA 1TL8A 5DV5A 3VSKA 3ZQFA 3I58A 1YFHA 1WSUA 2E2HJ 3BG9A 3HJEA 4QTRA 2BY3A 4AIKA 4PK4A 2IRFG 1FC3A 2OTLI 3JAMK 3SZPA 5FRNA 4F52A 2BYVE 2GM4A 2LKPA 2P7VB 3B6AA 2OA4A 4P1WA 1OQYA 2M34A 4BY1J 2X6YA 5CPRB 1D0ZA 4LIVA 3J7ZI 2LTPA 2HYJA 3V4GA 2ADUA 3HKZA 2HTJA 1HW1A 4ZYAA 3OR2C 3R0AA 2DPUA 1ZELA 3V42A 4KDPA 2XPUA 2WAQA 3DBRB 2JUGA 3QODA 1QHGA 4RAYA 2O8KA 1WJDA 5E18F 3T1BA 2ZXWH 3J81Z 4EM1A 5FLVA 3EYIA 1JUPA 4EM2A 2FOKA 5KNLA 5K1YA 3I56I 3KZIC 3H3VK 3OS1A 4C3HJ 2KHMA 5HDKA 2VL8A 3PIPF 3L2WA 1A04A 2IGKA 3WTVC 1XCVA 2R0QC 2R5ZB 5LRSA 5GTHC 3CCLI 4R79A 4RBOA 3GXOA 3OOUA 1S7AA 3E5UA 1A35A 2BY1A 1XGSA 2KIMA 2MC3A 2ZO4A 4XBFA 1CQTA 3FMQA 4IQ4A 4IHTA 1XCBA 2M5WA 3P9CA 1H88C 2CH0A 4NNJA 3CD6I 1P7JA 3TOBA 2DMPA 4K2EA 3OYLA 3ECOA 5ED4A 1BC8C 5FLMJ 4ZZDA 1N25A 1Z91A 2ME6A 1DQUA 4A3EJ 2KQRA 2LP0A 3QPSA 4F7ZA 5H20A 2FRHA
chains in the Genus database with same CATH topology
2E34A 5GAHJ 1QA6A 3CC7I 1VQ8I 5GADJ 1VQ4I 3CF5F 1YJWI 1FOYA 1VQKI 3CCJI 3CJTB 3CC2I 2E35A 2H8WA 2QEXI 2JQ7A 3CCUI 1YI2I 1YJ9I 3CCEI 1YIJI 4V19K 2OTLI 1HC8A 2FOWA 5GAEJ 1FOWA 3CCSI 4IOAF 1VQPI 5DM6F 3G4SI 3J7ZI 1YJNI 2OTJI 1FOXA 3CCRI 4IOCF 3CCMI 3G71I 1YHQI 5GAGJ 1VQ9I 3CMEI 3G6EI 2K3FA 1S72I 1VQ5I 2QA4I 3CCVI 1MMSA 3I55I 2ZJQF 3I56I 4IO9F 3J7YJ 3CCQI 2NXNB 3PIPF 3CMAI 3PIOF 2ZJRF 1VQMI 5DM7F 3CCLI 1VQ6I 2ZJPF 1ACIA 1VQOI 3DLLF 1VQ7I 1VQLI 1VQNI 1YITI 3CD6I 3CC4I 4UY8I 1Y39A 5JVGF 2E36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E34 A;  5GAH J;  1QA6 A;  3CC7 I;  1VQ8 I;  5GAD J;  1VQ4 I;  3CF5 F;  1YJW I;  1FOY A;  1VQK I;  3CCJ I;  3CJT B;  3CC2 I;  2E35 A;  2H8W A;  2QEX I;  2JQ7 A;  3CCU I;  1YI2 I;  1YJ9 I;  3CCE I;  1YIJ I;  4V19 K;  2OTL I;  1HC8 A;  2FOW A;  5GAE J;  1FOW A;  3CCS I;  4IOA F;  1VQP I;  5DM6 F;  3G4S I;  3J7Z I;  1YJN I;  2OTJ I;  1FOX A;  3CCR I;  4IOC F;  3CCM I;  3G71 I;  1YHQ I;  5GAG J;  1VQ9 I;  3CME I;  3G6E I;  2K3F A;  1S72 I;  1VQ5 I;  2QA4 I;  3CCV I;  1MMS A;  3I55 I;  2ZJQ F;  3I56 I;  4IO9 F;  3J7Y J;  3CCQ I;  2NXN B;  3PIP F;  3CMA I;  3PIO F;  2ZJR F;  1VQM I;  5DM7 F;  3CCL I;  1VQ6 I;  2ZJP F;  1ACI A;  1VQO I;  3DLL F;  1VQ7 I;  1VQL I;  1VQN I;  1YIT I;  3CD6 I;  3CC4 I;  4UY8 I;  1Y39 A;  5JVG F;  2E36 A; 
#chains in the Genus database with same CATH topology
 1J5Y A;  4L5I A;  3GEZ A;  3OY9 A;  2V1N A;  4G6T B;  1S3J A;  2NS0 A;  3MVP A;  3HOX J;  4KMF A;  1B72 B;  2M8E A;  4XLE A;  1X4P A;  3JRB A;  1FMV A;  3F8M A;  4IKF A;  1QVU A;  3IH2 A;  4Y33 A;  2XIG A;  1R4N B;  4I6Z A;  3WHB A;  1LDK B;  4RS8 A;  3TED A;  2RC4 A;  2E1N A;  1R22 A;  4BJ6 C;  4NBQ A;  1UEL B;  2VI6 A;  4UV9 A;  4AIH A;  2LKS A;  2Y48 A;  2X6O A;  2JZY A;  4RGS A;  3B6C A;  3S16 J;  2QF7 A;  3AL0 B;  3TP0 A;  3QPH A;  4HNU A;  2HNH A;  3WHC A;  3H5R A;  1LEA A;  2QEX I;  1BI2 A;  2ACJ A;  4X1E A;  3SFI A;  5HOD A;  1B59 A;  3FXM A;  1YI2 I;  1X1D A;  4HST A;  1YJ9 I;  3H9G A;  3MZY A;  4KJZ A;  5FB2 A;  1S6L A;  4UB8 C;  3QPT A;  1ZG1 A;  4P9U A;  1WJ5 A;  3SJM A;  2NRA C;  1KYZ A;  4CGZ A;  3ABM H;  1ZN2 A;  4WF2 A;  2V6C A;  2XHK A;  1H9G A;  4IZZ A;  3J7A Y;  1PP7 U;  1QRY A;  3QOP A;  3H0D A;  4O6J A;  2XAS A;  5F6F A;  2VON A;  3D5L A;  1AOY A;  4V2G A;  2M2E A;  1Z1D A;  3GX4 X;  1ZG3 A;  4XN0 A;  5IOZ A;  4IOC F;  3G71 I;  2BEO A;  2DPD A;  5ICE A;  3OYJ A;  5IOY A;  3K9T A;  3TOA A;  1DU6 A;  5J47 A;  1Z3X A;  4YIR X;  2STW A;  3TDZ C;  2XC7 A;  3COA C;  3KLN A;  1NTC A;  4ENJ A;  4CYC B;  2W82 A;  3I0T A;  3OYN A;  4NUB A;  2L3D A;  1BOB A;  1IV8 A;  2F5V A;  1IUF A;  3BPX A;  3GO5 A;  1HST A;  2HOS A;  1BR1 A;  3GFL A;  1PP8 F;  2F5E A;  3PL8 A;  3WG7 H;  1ZRE A;  3ZXS A;  5D6E A;  3SEZ A;  2JWT A;  3PUB A;  1EH6 A;  2O61 A;  4UUT A;  2DA5 A;  2XKP A;  3HYI A;  5B1B H;  2HOA A;  1KU2 A;  3HOW J;  2X6W A;  3MKZ A;  1SAN A;  2YSR A;  3ZMU A;  2AQE A;  2IPQ X;  5KK1 A;  1TNS A;  3VEP A;  3BCA A;  4EMS A;  3ESW B;  1W5C C;  3O6B B;  2MLK A;  2OQG A;  1Y8R B;  3IUO A;  4D5F A;  1U5T C;  2IA1 A;  3JRC A;  4S04 A;  3W6K B;  2CWE A;  1MDM B;  1IXC A;  2EFN A;  5DCM A;  5B5E C;  3B73 A;  2XGE A;  3FWE A;  4BXX J;  3QP5 A;  2HZD A;  5HLT A;  2KIS A;  2P0W A;  4OOI A;  3ZMS A;  4DJA A;  2XRN A;  3ZMT A;  4I76 A;  4BQO A;  3RYR A;  5GAD J;  3KPH A;  2IJL A;  3PFY A;  5E8G A;  4CCO A;  3CF5 F;  2EFP A;  5EJC A;  2GA1 A;  2HQ5 A;  3BLY A;  4QPQ A;  4BGD A;  3DKX A;  2EWN A;  3E3V A;  2XB5 A;  3IH3 A;  3LSK A;  2CQQ A;  1R36 A;  4EGZ A;  2W85 A;  2DA6 A;  4BJ5 C;  1UHM A;  2I8D A;  1STZ A;  4CSW A;  2R4G A;  3D5R C;  3FBN B;  1GHC A;  4MEY F;  1OCP A;  1OYI A;  1OLT A;  2L4M A;  3DBH B;  5IT9 K;  4MLO A;  3S3M A;  4E6K G;  2R7X A;  1JKO C;  1Z05 A;  2VXZ A;  2XGC A;  3HGG A;  4LLN A;  5L3B A;  4Q5S F;  1HC8 A;  3GFM A;  1AWC A;  5JLW A;  4PCQ A;  1FBU A;  2GBY A;  4DYR A;  4EAT A;  1LQ1 A;  3FHN A;  4C3I J;  3N97 A;  1SFO J;  2VE9 A;  2KDZ A;  4ENK A;  2A05 A;  2FBH A;  3CDL A;  4OWR B;  4C30 A;  2FE3 A;  5TIS C;  2RKH A;  4JX6 A;  3ZQC A;  3LFU A;  2BGC A;  4AIJ A;  1YJN I;  3MD2 A;  5HS9 A;  3C18 A;  4BQQ A;  3HDD A;  1AKH B;  3MN2 A;  3QOE A;  5DUI A;  1U78 A;  3BG7 A;  5HDG A;  3FIW A;  1VQ9 I;  2BBY A;  1ZLJ A;  5GPA A;  3JRH A;  1G2H A;  1P4X A;  4B8X A;  4BUP A;  1BOA A;  3CCV I;  1L0O C;  1A6Q A;  3OL3 A;  1MMS A;  2P5K A;  3CLO A;  2KRC A;  2NXN B;  3ML6 A;  4UVA A;  1F5T A;  3MKW B;  1HOM A;  1BJA A;  1S29 A;  2ZJP F;  2E2J J;  1B8I A;  2G7U A;  1F9N A;  3BDD A;  3DLL F;  4OIQ F;  3NWS A;  4IHY A;  4BHB A;  1KU7 A;  3I71 A;  3D5S C;  2ESN A;  3J80 Z;  3MFK A;  1BR2 A;  5DDG A;  1WVR A;  4BXF A;  2PBI A;  4AD9 A;  3WTT C;  1U8B A;  2DAO A;  5J3L A;  2GOX B;  1W7P B;  3GFJ A;  1R00 A;  1KU9 A;  2QVO A;  4A0Y A;  1BL0 A;  3EET A;  2GXA A;  1WQ2 A;  3FKJ A;  4I98 B;  3WTU C;  2ID3 A;  9ANT A;  4Y3O A;  2EK5 A;  4LG0 A;  4DQ2 A;  5F1R A;  5L3D A;  4HQM A;  1ORK A;  1N78 A;  2B0L A;  3Q9S A;  3ZQI A;  1O3Q A;  2A69 F;  4A3K J;  1W36 C;  4NHJ A;  3FXU A;  3BJ6 A;  4RAF A;  2VXD A;  5EEG A;  1KYW A;  2XB0 X;  1E3P A;  1KON A;  4M72 A;  4X0G A;  2JA2 A;  4KIC A;  4Z2Y A;  2DYR H;  1I5Z A;  3GWZ A;  4Y4R A;  5EG0 B;  1A36 A;  3MKY B;  4WX9 A;  1FYM A;  4PGH A;  1U2W A;  5IPA A;  3MQ0 A;  3CMY A;  3E6M A;  1BW5 A;  5M5Y J;  1VZ0 A;  4KIG A;  4OAY A;  3CCE I;  4PGG A;  1Z7U A;  1KZH A;  3L2Q A;  3JW4 A;  5A2Q Z;  1D8J A;  2NAZ A;  4R8H A;  3S1N J;  3DWL E;  3RSN A;  1FJL A;  4RGR A;  1TWC J;  2JMW A;  1UJ8 A;  4GYG A;  2PFB A;  3BPV A;  4LIU A;  4DBR A;  1R5I D;  2WC2 A;  3T5X A;  1FSH A;  4BBS J;  2IW5 A;  1WH7 A;  1XG1 A;  1CF7 A;  3K70 D;  3KP5 A;  1I3A A;  4XNF A;  3JRG A;  2VBX A;  4I09 A;  2K9Q A;  1B6A A;  5FRO A;  5D6F A;  5JFR A;  1OR7 C;  5TGT A;  2DLL A;  1JKP C;  2WAF A;  4EJV A;  2PX9 A;  2AXT C;  2K9M A;  2EQR A;  2Y0S N;  1YLF A;  1JKR C;  3Q0V A;  3OSG A;  2ZNY A;  2M87 A;  1GDT A;  1OFC X;  2Z33 A;  4BNC A;  3OS0 A;  4NC7 A;  2A07 F;  2L5Q A;  1YE9 A;  1FOK A;  3ABK H;  2L9V A;  4KIT B;  3P9K A;  2XDV A;  4XLA A;  3I5U A;  2L7Z A;  4N4O B;  1JTX A;  4XSZ F;  3FM3 A;  4RM2 A;  1JUM A;  2ZB9 A;  5F0F A;  4A5M A;  1HW2 A;  3M9A A;  3SDB A;  1PUE E;  3CP8 A;  4AYB N;  3GLL A;  2DFE A;  3WGH A;  1VQ7 I;  4C2M J;  2GXB A;  1VQN I;  1QZE A;  3LQR A;  2UXN A;  4B4C A;  2RNG A;  4D0P A;  3GVA A;  2W1O A;  4E70 A;  1RET A;  3PUF A;  1YRN A;  2DW4 A;  2PMH A;  5JVG F;  2XPV A;  2IXS A;  2Z9O A;  4A3J J;  3K4C A;  1E0E A;  3IWZ A;  4HDV A;  3JCU C;  1QVT A;  2IGM A;  4M9Z A;  1IG7 A;  2HOT A;  2HFH A;  3JRD A;  2HGC A;  2QQ8 A;  3ABT A;  4O5V A;  2V1U A;  2ZCW A;  3EQL F;  3CMM A;  1X2M A;  4FHT A;  4FE4 A;  4GCV A;  4IVN A;  1LEB A;  3JR9 A;  1GT0 C;  3LSJ A;  3WTW C;  1VTN C;  4ZYE A;  1Y0U A;  1SMY F;  4GO1 A;  3GUD A;  4YEL A;  5IP9 J;  4M6X A;  1P2F A;  3IC7 A;  3UNG C;  4XON A;  1X3U A;  3H5N A;  3W2W A;  4NQW B;  3F23 A;  3HOV J;  3WU2 C;  5IT3 A;  2RQP A;  4IPA A;  3BJO A;  4RB3 C;  3L7W A;  3CO6 C;  4OIO F;  2FOW A;  1W5T A;  1WCM J;  3HPG A;  3QP6 A;  5BPD A;  2O7O A;  5FFX A;  2MW8 A;  1R1T A;  2R93 J;  2QQB A;  3NAR A;  3R4K A;  4CUG A;  3LSI A;  3FK6 A;  1FTZ A;  1V54 H;  4B3A A;  4BE0 A;  2OAZ A;  3F22 A;  5CVR A;  3K4B A;  1OPC A;  3NEU A;  2H6C A;  2D2W A;  4RMN A;  2EV5 A;  2IA0 A;  3C3W A;  2BW3 A;  3MKL A;  4HLY A;  1O4X A;  3LWF A;  4EM0 B;  4ESJ A;  2K3F A;  5M5X J;  3LFK A;  1HW5 A;  2LK2 A;  2GXG A;  3RPU A;  4MNU A;  1JJ6 C;  2H6B A;  2R7T A;  3CJR B;  2FEZ A;  3C2G A;  3HIF A;  3I55 I;  4KA4 A;  1FWZ A;  2EZL A;  4IO9 F;  3CES A;  3F3X A;  3QQA A;  2M0M A;  2IEK A;  3CCQ I;  2HQR A;  4F91 B;  3PO2 J;  3GYH X;  2GOM A;  2E1M C;  1Z3Y A;  1ZG5 A;  2CUJ A;  2ISY A;  4DYQ A;  3BRO A;  2HDD A;  5DM7 F;  2MGQ A;  2R7O A;  1BN5 A;  3I59 B;  4OIN F;  2M30 A;  4LK0 F;  4CXF A;  3OYE A;  3BG3 A;  1EH8 A;  3O8G A;  3P7N A;  1G4D A;  2DT5 A;  1OR7 A;  2IVM A;  2Y0M A;  2DDB A;  5LHH A;  2VT2 A;  1GXQ A;  3N05 A;  2Q1Z B;  4LOC A;  2W4S A;  5H6Q A;  2D5V A;  2KLO A;  1I50 J;  1W4M A;  1SFK A;  5K5Q A;  2QQ9 A;  4CH7 A;  1YG2 A;  4A93 J;  4XSX F;  1F1Z A;  1HXD A;  2BV6 A;  2F5F A;  3GW2 A;  1ZRF A;  2VPR A;  4EJW A;  3OOP A;  1R5H A;  5EGO A;  3I54 A;  5AON A;  4UVB A;  5K5R A;  4H0E A;  2STT A;  3RYP A;  3BT9 A;  1H89 C;  2L9R A;  4B3X A;  2VOO A;  1I27 A;  1B9N A;  3HSE A;  4BQA A;  4BH9 A;  1DGW Y;  2HKO A;  1WFX A;  4WWC A;  3S14 J;  1ZYR F;  1NK2 P;  4OAZ A;  1HQC A;  1OKR A;  4UV8 A;  3FXR A;  1WWX A;  3E6B A;  2ZME A;  3SQN A;  3ZRG A;  2BY0 A;  4WCG A;  1SD5 A;  4DOZ A;  4F93 B;  3J81 K;  5EZH A;  2M45 A;  2F4O B;  3HOY J;  2JQ7 A;  1T8I A;  4JQF A;  1ENH A;  2FQ3 A;  2EFW A;  6PAX A;  3WU0 A;  2ME0 A;  4ZYH A;  1SAX A;  2BVL A;  2JSP A;  2L7K A;  2OCC H;  1O3T A;  1IF1 A;  1MH4 A;  1DP3 A;  2VB6 A;  1XMX A;  1QHH D;  4A3I J;  3AG4 H;  1ULY A;  2UUZ A;  1Y1V J;  3Q0U A;  2EIM H;  1KQ8 A;  3HKZ N;  1DP7 P;  2H09 A;  4II2 A;  1HA8 A;  1EF4 A;  4M6Y A;  1MND A;  4E7K A;  4IHS A;  4IHV A;  2CJJ A;  1R49 A;  2QSG X;  5KHD A;  3Q9V A;  2WAQ N;  4O3M A;  4YIF A;  4CYD A;  3RQ4 A;  4UNO A;  4FET A;  2CO5 A;  3E5X A;  4PFO A;  2OTJ I;  4L9J A;  4RAG A;  3BG5 A;  3H36 A;  5F04 A;  5CJ9 A;  3CCR I;  1HBX G;  2P7C B;  2ZNZ A;  1DPR A;  3TDU C;  5GAG J;  2D1V A;  1YHQ I;  4HF2 A;  4XQF A;  2VAS A;  4EGY A;  1J0R A;  1SD4 A;  1XD7 A;  4RA2 A;  1LUJ B;  2F4I A;  5CVV A;  4ZZL A;  3S15 J;  3DXJ F;  2VN2 A;  3TP3 A;  1B9M A;  5J4Y A;  2LOO A;  5EYR A;  4DYC A;  1OMI A;  5CKT A;  4P55 A;  2R7D A;  2Z5U A;  4XRF A;  5E1X A;  4CA0 A;  4CO8 A;  1YS6 A;  2YU9 J;  1QPI A;  4F55 A;  3HM5 A;  2O9L A;  1Y0N A;  2KRH A;  2F5D A;  2K9L A;  3VDX A;  1R4M B;  1IJW C;  2EH3 A;  1MSE C;  2FXA A;  2JVH A;  2UWM A;  4ZDP A;  1VQ6 I;  2QKM B;  5LD2 C;  4WXC A;  5K7F A;  4XKW A;  5DUK A;  1X4O A;  3S2W A;  2DT6 A;  3BR6 A;  1U0J A;  1LDD A;  2DMN A;  2DFI A;  3G1L A;  2A6H F;  3DEE A;  1E3O C;  4OIR F;  2KP6 A;  3F8N A;  4MEX F;  4C9Y A;  4HOB A;  4P5O A;  3Q5F A;  2DU9 A;  4QSH A;  2Z99 A;  5M3F J;  5TRD A;  3RIR A;  4Y17 A;  2HVQ A;  1U8R A;  3T8R A;  1T39 A;  1QBJ A;  4GFB A;  3QWL A;  5CVI A;  4QLC U;  5DD4 A;  3KLO A;  5C3E J;  1G3T A;  3KET A;  1BA5 A;  4XOP A;  3CO7 C;  1IAW A;  3JRF A;  4KYW A;  1IZ1 A;  4LMY A;  1TP4 A;  3N4M A;  4XMY A;  3F9K A;  1PDN C;  3AL0 C;  1K79 A;  4YFX F;  2FML A;  3NQO A;  4ZJZ A;  5EF6 A;  2XGD A;  1OCO H;  3OYH A;  4BE2 A;  2XKO A;  3ISP A;  1IN5 A;  1QGP A;  1Z21 A;  2A3S A;  4XK4 A;  4E7H A;  1PVE A;  3KEY A;  5LHI A;  3S2H J;  1YIO A;  4PSW A;  4Y13 A;  2CW7 A;  4RM3 A;  1Y8Q B;  4G7O F;  3EUH C;  4RB2 C;  4M74 A;  4PJJ A;  1V5F A;  4I02 A;  3GTM J;  3CUO A;  2JPC A;  2DO7 A;  1BI1 A;  2MYS A;  5BQT A;  3F6V A;  1TBX A;  4A0X A;  5FJ8 J;  1O7F A;  2Z1D A;  2WAE A;  1XGO A;  3HGY A;  2XAQ A;  2MLG A;  2M3A A;  2PEX A;  2F5C A;  1TZL A;  3K4M A;  1SD7 A;  2R3S A;  2P5V A;  1FMW A;  1ZGJ A;  4KT6 A;  1LE8 A;  2OQR A;  5EZG A;  5J8F A;  3ULQ B;  2MSY A;  2TRT A;  1HKS A;  1IC8 A;  3CJN A;  2QA4 I;  3ZMZ A;  4FX4 A;  2EA2 A;  1Q1V A;  2L0K A;  5D8K B;  4BHP A;  4IJA A;  1ZK8 A;  3CUQ A;  3L1P A;  1FSE A;  3ZGK A;  3MMY B;  3G73 A;  3BTI A;  5IYB J;  4U0W A;  3IL2 A;  2QKL B;  1XGN A;  4YII A;  4BAC A;  2ZC2 A;  2LFB A;  2IBD A;  1VQM I;  1QNT A;  1YO5 C;  1Y56 A;  3B02 A;  4KIF A;  2BZT A;  2JUC A;  2X1E A;  3HSR A;  4M3E A;  5FGM A;  3OYK A;  2XAU A;  3WTS C;  3KE2 A;  2K9S A;  3SZT A;  1RUO A;  2E2I J;  3CDH A;  2CUZ A;  5H2F C;  1ZTR A;  5K5O A;  1I1S A;  5BS6 A;  1P4W A;  3QYE A;  2LC2 A;  3WGI A;  5BPI A;  2O5R A;  2W57 A;  3H0G J;  3ERE D;  2AS5 F;  1V3F A;  4M3D A;  4E7L A;  5FKN A;  2OBP A;  4XM3 A;  2E19 A;  1ZQ3 P;  2KIU A;  2X85 A;  3A0H C;  2IT0 A;  2GIZ A;  1MBF A;  4CCK A;  2QYO A;  2PQ8 A;  3PNY A;  3PJR A;  2LVS A;  3F6O A;  4HF0 A;  5BOX A;  3RI4 A;  4A6D A;  1WJF A;  3D0S A;  2KIQ A;  3FKI J;  4HSR A;  4XKC A;  4ESB A;  1OYY A;  1VI0 A;  4MGR A;  2W7N A;  4IHW A;  1PYV A;  1QPM A;  2WB1 A;  5LEJ A;  2KJB A;  2XGX A;  1BI0 A;  2FUG 2;  3FM5 A;  3LSR A;  1UZC A;  2LY9 A;  3C7J A;  3IRR A;  4G7Z F;  3GTL J;  3GTO J;  5L3G A;  3GTK J;  2YR2 A;  2LBF B;  1YW9 A;  2EIN H;  3E6C C;  1IN6 A;  4KFC A;  3HL2 A;  1G6N A;  2FJ1 A;  1P92 A;  2Y75 A;  2OPT A;  2VKE A;  2DOD A;  4V19 K;  5JLX A;  4FIS A;  2IAI A;  2EPF A;  3S17 J;  3HRM A;  5GAE J;  1PUF B;  1ZR2 A;  2HQA A;  4KIB A;  3PO3 J;  2NVQ J;  1EJ9 A;  1VQP I;  1Z6T A;  1W0U A;  1DDN A;  1NHA A;  2JRM A;  2IS6 A;  4JYK A;  2TDX A;  3JSO A;  1HKQ A;  2JA5 J;  3I4M J;  2VC1 A;  3HUG A;  2JA6 J;  3J80 K;  3DLA A;  4I99 C;  5EEH A;  1TWF J;  1AHD P;  2DK8 A;  4LG0 B;  1UB9 A;  2X9D A;  5LGT A;  4N0B A;  4DNC A;  2OF7 A;  2MH9 A;  4IF4 A;  5L3C A;  1DUX C;  2IS1 A;  3DPU A;  1JT6 A;  2L54 A;  1ON2 A;  1MZB A;  1MMN A;  2IGN A;  3LST A;  3AKZ A;  1AU7 A;  1POG A;  4L18 B;  1G3Y A;  2RN7 A;  3CLQ A;  2WY8 Q;  5ILS A;  3HOZ J;  5GPC A;  3LSP A;  3D1N I;  1KGS A;  5ICG A;  2DYS H;  1ETV A;  3I64 A;  3TL4 X;  4GDF A;  4L0Y B;  3QAH A;  4J00 A;  1LNW A;  4KN4 X;  2V6E A;  1SEU A;  4U88 A;  1ETO A;  1D5Y A;  3HHG A;  3F8C A;  3C1D A;  2ID6 A;  2Y2Z A;  2A6E F;  2ETH A;  4CYC A;  4FTH A;  1JKQ C;  3PSF A;  1HCR A;  2UXX A;  2MC4 A;  2HEO A;  3FXJ A;  4UY8 I;  3HRT A;  4DZP A;  2L9S A;  2K3P A;  4HW0 A;  3PNV A;  1J2X A;  3I53 A;  4PJN A;  5F64 A;  3ZCO A;  3QRF F;  3EPZ A;  2RDP A;  3FBI B;  2PJP A;  1ZAO A;  2P4W A;  2MG4 A;  1FZP B;  4XIC A;  5KCM A;  2QWW A;  1MJ9 A;  5DTD A;  4ZDL A;  5A2Q K;  5CQG A;  3ZQ7 A;  2JA7 J;  4A3C J;  4ON0 A;  2JK3 A;  4DIQ A;  1CF7 B;  1QA6 A;  4KT5 C;  1LVK A;  2O8X A;  2KDO A;  4CHU A;  2DMU A;  1W5S A;  4E7S A;  1EA3 A;  2NVU B;  2ZXI A;  1UAA A;  3Q3S A;  4KMU X;  1T6S A;  1VQ4 I;  2AHQ A;  3BTJ A;  3TW7 A;  1XPX A;  4A3B J;  5E1Z B;  1ZKG A;  2GA2 A;  1IN7 A;  1MDM A;  2VC0 A;  4HDU A;  1FOY A;  4BJT A;  4A3M J;  3DP7 A;  2WTE A;  2BOL A;  2X51 A;  3SEQ A;  1TQI A;  1QO0 D;  1SMT A;  1MNM C;  1T56 A;  2MA3 A;  3CC2 I;  1RZ4 A;  2ZFW A;  4ZTJ A;  3GCM A;  5GP9 A;  2CUE A;  4ENN A;  2QGU A;  3FX3 A;  3MCZ A;  3C2B A;  2ICW G;  2DXI A;  3BQY A;  3AG3 H;  2CV1 A;  4ZYG A;  2PJR A;  1IXS B;  5CLS A;  3U1K A;  2VUM J;  3OV8 A;  2IP2 A;  2KT0 A;  3S3O A;  1WZ2 A;  2CFX A;  4G6D A;  3RPQ A;  2KL4 A;  3FMS A;  2V4J C;  4UVC A;  2VLA A;  4E7I A;  2HPM A;  2ECC A;  2ELK A;  2DJI A;  5FKK A;  5E20 A;  2Y30 A;  3KYD B;  5JI6 A;  3GBG A;  2HQN A;  3G2B A;  4FAS D;  1WJA A;  4MIM A;  3ZN0 A;  4U0Y A;  2PMZ A;  5FKL A;  3DBL B;  4LB5 A;  1U5T A;  1SVL A;  1G59 A;  3CCM I;  1YX3 A;  5HS7 A;  4EJT A;  1GV2 A;  1Y6I A;  3QYF A;  2YPR A;  1XMK A;  4U7D A;  3HBL A;  1SFE A;  3KX2 A;  3KEO A;  3PQK A;  1H0M A;  3DEW A;  2CUF A;  3BTC A;  4L9V A;  2OCE A;  1BJZ A;  1E2X A;  3CZ6 A;  3LA2 A;  5HS8 A;  5HNF A;  2H1L A;  4N9I A;  1AKH A;  5EEA A;  1BIA A;  1RKW A;  3CMA I;  1TLH B;  4XLC A;  4A3L J;  1B72 A;  2EFQ A;  1H8A C;  1BR4 A;  3FXK A;  2I10 A;  4AWX B;  2Q2E A;  1SAU A;  1GV5 A;  2DMQ A;  2Z2S B;  1KQ0 A;  1VQL I;  3BJA A;  1BBY A;  3CC4 I;  4XID A;  3K1N A;  2Z3Y A;  3FXQ A;  4JP0 A;  2D45 A;  4I01 A;  1T33 A;  4IL6 C;  2EZI A;  3ASO H;  2VKD A;  1TQP A;  1IN8 A;  3RZD J;  4IRG A;  5IYD J;  5FFZ A;  1O7L A;  5C44 J;  5CVJ A;  1D1B A;  2VJI A;  2KMU A;  2VKV A;  4ETS A;  1FP2 A;  3V7C A;  5J4V A;  4CCN A;  2D1H A;  1XDS A;  4LK1 F;  1OYW A;  4E7J A;  3OYD A;  2X0L A;  3M07 A;  4M3F A;  1FBS A;  1JI8 A;  1NG7 A;  1UST A;  1W36 D;  1U6G A;  2F48 A;  1FYK A;  2HPI A;  2CW8 A;  2QSF X;  3L2C A;  4I7H A;  2VE8 A;  1YJW I;  1MIJ A;  2XRO A;  1HDD C;  2EV0 A;  2FSW A;  4OMY A;  3DU6 A;  3MEX A;  3GFI A;  2FMY A;  4BEH B;  3CP2 A;  1TW2 A;  1T2K A;  1MW7 A;  4BQN A;  1S7E A;  1F36 A;  4BL0 B;  1FX7 A;  1YIJ I;  3TO6 A;  2E5Z A;  5EG0 A;  4LGW A;  1RUN A;  3RPU D;  2FU4 A;  2RQQ A;  1U9N A;  4KUM A;  2RAE A;  1RNL A;  3WE2 A;  2NS7 A;  2DQR A;  2HYG D;  5HOO A;  1I6H J;  2O03 A;  3OR1 C;  1IV6 A;  3CCS I;  2FNP A;  2XF7 A;  1EKE A;  5DM6 F;  1V4R A;  3ZP5 A;  2LNB A;  4E7Z A;  2O6G E;  1SFX A;  1MBG A;  3PM1 A;  3WU1 B;  3J7A O;  1FT9 A;  4XRM A;  4S0H B;  4L9N A;  3ZN1 A;  3OYC A;  2R7Z J;  4F92 B;  3F8F A;  1I39 A;  2VQH A;  1C0W A;  3OSF A;  2ZKZ A;  2HR3 A;  5M3M J;  1S72 I;  4AU7 A;  3X2Q H;  1K78 B;  4LIT A;  4HF1 A;  1LFB A;  4M73 A;  1ODD A;  1V55 H;  4LB6 B;  3KEQ A;  2ZJQ F;  5HNH A;  1WH5 A;  3J7Y J;  2L7F P;  2EA4 A;  4HX4 A;  3BR3 A;  4BDY A;  1HKT A;  1MBK A;  3G3Z A;  1Z9C A;  4DW6 A;  4BE1 A;  2ELJ A;  1S7O A;  3MWM A;  2CW0 F;  2H1K A;  4HX8 A;  4PFP A;  2NVX J;  3T8T A;  1O3S A;  2ZME B;  1T98 A;  1U9O A;  2JA8 J;  1E17 A;  1FP1 D;  1S8N A;  1XX5 A;  1I1G A;  3R0J A;  2LR8 A;  1Z67 A;  2BXZ A;  1A31 A;  4G94 A;  3LSH A;  3OYM A;  4I2O A;  1WJE A;  3LQQ A;  3OIP A;  4HYE A;  2KRF A;  3L2U A;  5HLI A;  3BOQ A;  3LA3 A;  2KIF A;  1CGP A;  1JHH A;  3IP4 B;  4IXA A;  5E3M A;  3LOC A;  1ONV A;  2Z16 A;  3H3U A;  3U9G A;  1FTT A;  3RZO J;  1XB4 A;  3PQJ A;  1IDZ A;  4I0B A;  2OUM A;  4W97 A;  2M7B A;  1SVO A;  3WG9 A;  2JTV A;  3EUA A;  3V8L A;  3GTG J;  3BR2 A;  5GTI C;  2M8G X;  4LFU A;  2V1X A;  3K1M A;  1RIO H;  3L2V A;  3RCO A;  3F21 A;  2CV2 A;  3IKT A;  3V7R A;  2VKH A;  4NB5 A;  4YEJ A;  1IO2 A;  2ZXJ A;  2HZT A;  5J1R A;  3TGN A;  3CJT B;  1IN4 A;  1FPQ A;  3L00 A;  2H8W A;  3ZMD A;  3F8B A;  2K9N A;  2M9H A;  2R7U A;  2WV1 A;  3I4P A;  1X3W B;  2ZBK A;  2Q8K A;  3VOE A;  4EQQ A;  3QU3 A;  4A6E A;  5HLH A;  2UZK A;  5L3E A;  1Q1H A;  1T08 B;  1X1B A;  4N9H A;  2CV0 A;  3JRE A;  2NVY J;  1N75 A;  1UG0 A;  2HVR A;  1EH7 A;  1TT5 B;  1ETQ A;  2GLO A;  1MMA A;  4XKB A;  1WJC A;  3BZC A;  2WA0 A;  3DCF A;  1TW3 A;  1HDP A;  2RGV A;  1JHF A;  3BQZ A;  3PSI A;  3HSF A;  3GZ5 A;  2XPW A;  3S93 A;  3S1Q J;  5LEK A;  5IYC J;  2DBB A;  3W6J B;  3ZQL A;  3DTE A;  4N4N B;  1R9T J;  4KNY A;  5ICF A;  4OMZ A;  1R7J A;  4G12 A;  4A2U A;  2DOA A;  3CTA A;  3TO9 A;  5E3N A;  2HOE A;  1WGX A;  4G8X A;  1RKT A;  2IS4 A;  1IUY A;  1WI9 A;  2XAF A;  4HNT A;  3BR1 A;  3ZPL A;  1W1W E;  3DV8 A;  3DKY A;  5HDN A;  1YW7 A;  4D7M A;  3GTJ J;  5F0H A;  2QBY A;  1VFC A;  2HYF A;  4HAM A;  3ELK A;  2XAG A;  4IQJ A;  1K61 A;  4G6Q A;  4YFN F;  2XAH A;  1F43 A;  1Z0X A;  1KQ9 A;  2L7M P;  3EUK L;  4D1Q A;  2DA4 A;  2CYY A;  2ECB A;  4EJU A;  1IXR C;  4BS9 A;  1TTY A;  1UMQ A;  4BDZ A;  1GXP A;  3A2K A;  1T95 A;  3OYB A;  1S5L C;  2FQ4 A;  4R1H A;  3VYT B;  4RGU A;  1SFU A;  4PSX A;  4NC6 A;  4AVZ A;  2J5O A;  3W3C A;  2R7V A;  1APL C;  2IS2 A;  2FD5 A;  3K7A J;  4GGG A;  4GYI A;  4UUV A;  1XTA A;  2NNN A;  3H9J A;  2DTZ A;  5FLX Z;  3C2H A;  3K4K A;  2BHZ A;  1XS9 A;  1LE8 B;  1MBE A;  4GRI A;  1ETY A;  2LDU A;  3K4L A;  1ZRD A;  3Q0W A;  3M1C A;  2P5L C;  4ASN A;  1A5J A;  3DF8 A;  2MH2 A;  1I3Q J;  1H9T A;  2O3F A;  2M7A A;  2V7F A;  3TMO A;  3CUQ B;  4UUS A;  5DD8 A;  3LNQ A;  2EJR A;  5JHF A;  2R5Y A;  2HTS A;  5ICC A;  2HS5 A;  2EBI A;  3ABL H;  3VYR B;  2K02 A;  4H4K C;  3T0Y A;  4ZYD A;  4MTD A;  1Y1W J;  4X6A J;  4MFE A;  4XOR A;  2ZJ2 A;  4Y7N J;  3S32 A;  4MQ9 F;  2F6C A;  2CGP A;  3MAJ A;  2QZ8 A;  4BY7 J;  3HOS A;  1XSX A;  3IH4 A;  3OWT A;  4HBL A;  2E71 A;  1UCR A;  2COB A;  4L5E A;  1JUS A;  3FZV A;  1NK3 P;  3GF2 A;  4XRS A;  3GTQ J;  2VOP A;  1FOW A;  2Y69 H;  4M3G A;  3K4N A;  2IGO A;  1I6X A;  1HF0 A;  3EDP A;  1JTY A;  2DN0 A;  2E5N A;  4HNV A;  4V2F A;  5B1A H;  2X1D A;  1X19 A;  5LBQ A;  3CME I;  3M1E A;  1VQ5 I;  4D9J A;  2P6S A;  5F1J A;  3FXL A;  4ZH4 F;  2WAD A;  5B66 C;  3A01 A;  3K4J A;  1XMA A;  3LA7 A;  3SYT A;  2FF4 A;  2CMP A;  5CYV A;  3H3Z A;  4HV5 A;  3K69 A;  1OCR H;  1LVA A;  4BYY A;  5DCF A;  3DEU A;  3QPL A;  3JAM Z;  2EZK A;  2A68 F;  2DA7 A;  3RKQ A;  3V8J A;  2NVT J;  2GIV A;  3QU6 A;  5E17 F;  4MTE A;  5L3F A;  5DCM B;  1YQA A;  2ZXH A;  5FKO A;  5C4J J;  5FD6 A;  1SVM A;  2CRG A;  2K5C A;  5IP6 A;  1R5G A;  1EV7 A;  1MMD A;  2VJ5 A;  3R6S A;  4BXU A;  2LKX A;  2F4M B;  2QQA A;  2NNY A;  4WK8 F;  4UXN A;  1Z7L A;  5D4R A;  4MO7 A;  2XSJ C;  1GUU A;  2A6T A;  4M3B A;  4U0V A;  2E34 A;  5M5W J;  2V9V A;  1P7I A;  4AM3 A;  1ZR4 A;  3HUG B;  2X4H A;  4HX7 A;  4E4H A;  3DPL C;  1QZZ A;  4B09 A;  1VQ8 I;  1DU0 A;  1FEX A;  3ZQQ A;  1XN7 A;  2WB1 N;  1V5G A;  4IX7 A;  3F72 A;  4WXH A;  2KPM A;  5F08 A;  4ZTF A;  3KP6 A;  4MFD A;  1WRJ A;  4Q4Z F;  1P6R A;  3A02 A;  3DQV C;  2R5Z A;  4FT8 A;  1P9Q C;  2HWV A;  3KZY A;  2A61 A;  1FY7 A;  4M71 A;  3S3N A;  3M8E A;  3A1Y A;  2HDW A;  1TWH J;  3I9V 2;  3TO7 A;  3W2V A;  3WE3 A;  3E1S A;  3ECH A;  3RJP A;  4RB1 A;  2GWR A;  3KCC A;  3HG9 A;  4HEA 2;  4A3F J;  4BU2 A;  1FIA A;  5FRM A;  1TC3 C;  1QQI A;  1J7K A;  4HA8 A;  1ZLK A;  4HQE A;  2DMT A;  3KFW X;  2AQF A;  2CU7 A;  3M8F A;  1JE8 A;  3I4N J;  4OU0 A;  3V8K A;  2PMU A;  2M0C A;  1MJB A;  2RV8 A;  3ASN H;  1D0X A;  3I3L A;  3HRS A;  4JOM A;  3LL7 A;  4ENM A;  1N77 A;  2VOD A;  1O57 A;  1X2N A;  2JJ7 A;  3MZH A;  2KZV A;  2DOF A;  3WGG A;  3TW6 A;  3WTZ A;  1IGN A;  1FOX A;  2MD0 A;  3H92 A;  2B63 J;  2XV4 S;  1LKX A;  2BE5 F;  3NAU A;  3BR0 A;  2ELH A;  3L9F A;  3JTG A;  3VYU B;  1MKM A;  1LFU P;  1B8I B;  2R7Q A;  1J59 A;  3OMY A;  4U87 A;  1LJ9 A;  5D5W B;  1JXS A;  2VBY A;  3GTP J;  1X1P A;  2XF5 A;  2CS3 A;  2W48 A;  4BAY A;  2PI0 A;  1X1C A;  4A12 A;  1ZHF A;  2YUS A;  1RR7 A;  5CVU A;  3PIO F;  4A0Z A;  2HU9 A;  2ZJR F;  3DU5 A;  3L2R A;  2A5W A;  5HVQ C;  1T0F C;  2DA3 A;  3H9Q A;  3HXL A;  3FK7 A;  2YU3 A;  1YS7 A;  3RKX A;  1J09 A;  5E1W A;  1ACI A;  3BCB A;  1VQO I;  4CDG A;  3EUH A;  2L01 A;  4Q48 A;  2DQL A;  3VFZ A;  3S1M J;  3RTR A;  2KFD A;  2LY2 A;  5FKM A;  3IRQ A;  1P4A A;  3CCY A;  3ROU A;  3JSP A;  2PJR B;  2EZH A;  4CCM A;  4XLN F;  2P8T A;  1PJR A;  3CDI A;  1XSD A;  2E36 A;  2NOG A;  3KZZ A;  1FNN A;  1GVD A;  2LRD A;  1ZRC A;  1UHW A;  4IRH A;  3K6G A;  2NOJ B;  2HDC A;  2G7H A;  2V79 A;  4DGW B;  2GQQ A;  1TQM A;  1E3H A;  2X48 A;  3E97 A;  3QYB A;  4MQV A;  4XOT A;  2K40 A;  1U5T B;  3CF2 A;  1FBQ A;  4UHT A;  2L4A A;  2DA1 A;  2LYC A;  2E1C A;  1ITY A;  2RRE A;  1ETX A;  3E0J B;  5J40 A;  3FMR A;  4L9T A;  1B1B A;  2DA2 A;  3K2Z A;  4ZDO A;  1ZGA A;  3M8J A;  1VND A;  4PUS A;  1JT0 A;  2QSH X;  3CCJ I;  4II3 A;  5E3L A;  2VIX A;  4D5C A;  3WTX C;  2OC6 A;  2W84 A;  3OYI A;  1R58 A;  4A69 C;  4IEJ A;  3CCU I;  2K4J A;  1ZGW A;  3BP8 A;  1G8X A;  3HC7 A;  2Q2E B;  3HHH A;  3SZG A;  4AID A;  4ABZ A;  1R1U A;  2XRL A;  2EIJ H;  5JVT A;  2OU2 A;  1D5V A;  2PMZ N;  3K1P A;  4HV6 A;  4XR6 A;  1ETW A;  4HLX A;  3K70 C;  4ANJ A;  4ESF A;  2VBW A;  4Y52 J;  2LBF A;  2DCE A;  1FIP A;  2VBZ A;  3TKY A;  2WV0 A;  2FA5 A;  3VPR A;  3DTI A;  2LF8 A;  4G9Y A;  2WBM A;  4EJO A;  3CQZ J;  2VPL A;  3JRI A;  4FQG A;  5F0C A;  1Z77 A;  1PUF A;  3G6E I;  4XLF A;  3PFI A;  3R60 A;  2OZU A;  5K7H A;  3DTK A;  3K2A A;  3ERM A;  2BHY A;  2L02 A;  5J1Y A;  2R92 J;  2JRT A;  3OS2 A;  4W1U A;  2CSO A;  1D3Y A;  3FDY A;  5IT9 Z;  1YX5 A;  2GZW A;  2V9P A;  5ILV A;  2LD5 A;  2W24 A;  1D1A A;  1NG6 A;  3U21 A;  1AA7 A;  2COM A;  2DI3 A;  3P9I A;  1YRN B;  3M7G A;  2JSC A;  3BG6 A;  3IAS 2;  4PJM A;  2Y9Y A;  4B47 A;  1OCZ H;  2JN6 A;  4L0Z B;  3K10 A;  2HXO A;  1K6Y A;  1TT0 A;  1Z6R A;  5DEQ A;  3H1C A;  4LLG F;  2PLY A;  1IRF A;  3NWT A;  3JTH A;  2MBF A;  1W7P D;  2E7X A;  4Z6Y A;  5F27 A;  2M4G A;  3OIO A;  3VOD A;  2XSD C;  2LG4 A;  3VB2 A;  4WXD A;  1YOV B;  2E7W A;  3FIS A;  2R7W A;  1R71 A;  1UHS A;  1MJA A;  3ZQH A;  4OIP F;  2LH9 A;  3BTL A;  1SC7 A;  1JGS A;  1RRJ A;  2F2E A;  1RES A;  2Y9Z A;  3E5Q A;  3A0B C;  1D0Y A;  1T0F A;  3KP4 A;  3CC7 I;  5K7Z A;  3HB9 A;  4Q47 A;  4LLL A;  5E8I A;  1VF9 A;  3FF5 A;  1BI3 A;  4B1R A;  2MFZ A;  1RC9 A;  2FX0 A;  3DFG A;  1R6R A;  4B43 A;  1K4T A;  3KIO A;  3A4C A;  3CJQ B;  4ZC3 A;  2DFH A;  1FLI A;  5H6R A;  3BC8 A;  3KP3 A;  1VQK I;  2OD5 A;  3BZK A;  4NC8 A;  1WKM A;  2R7S A;  1OCC H;  4UB6 C;  3F0C A;  3JRA A;  2LY1 A;  1ZAR A;  3W6V A;  2H94 A;  1QZY A;  2L2O A;  2MD5 A;  5KVR A;  4LD5 A;  4J19 A;  4C3J J;  1FYL A;  3EYY A;  1J9I A;  4QIW N;  2DFF A;  4P9F A;  4JBA A;  5AIQ A;  1KA8 A;  2BW3 B;  5ILU A;  4RDU A;  1W7P A;  1K7A A;  4A3G J;  5DYM A;  1U3E M;  2P81 A;  2AO9 A;  4HZF A;  4RLQ A;  1WI3 A;  2R7F A;  5DS9 A;  4EV0 A;  4MHG A;  3ZOB A;  2ZSI B;  4IOA F;  4QWQ A;  3TQN A;  1MGT A;  1TNT A;  2HXI A;  2YS9 A;  2WWY A;  4U7B A;  3KYC B;  1W0T A;  5BMZ A;  2DDA A;  2IA2 A;  5J1U A;  3IWF A;  3A03 A;  1JGG A;  3U1D A;  2M1B A;  4HPQ A;  5AIP A;  3HOU J;  1GVJ A;  1IRX A;  3FXO A;  2LSO A;  3BR5 A;  5LGN A;  4LJZ F;  2O0Y A;  2TCT A;  2W25 A;  5JHU A;  3WOD F;  2PN6 A;  4F3Q A;  2B9S A;  4KIS A;  1ETK A;  4JX5 A;  4FX0 A;  3AAF A;  1X3Z B;  1IRG A;  1RPW A;  2ZME C;  2EFO A;  2VQG A;  4BKX A;  2KKO A;  2XVC A;  2LF7 A;  4PJ0 C;  3KYL A;  2Y0S A;  2R7R A;  2VQL A;  1K83 J;  2B7E A;  1HLV A;  2DTR A;  1GLN A;  1MNE A;  5FD5 A;  5D4S A;  1KU3 A;  1OJL A;  3E6D A;  3MZ8 A;  2EIL H;  2M4K A;  1MH3 A;  2ESH A;  3HZJ A;  3GZN B;  3ZMV A;  2YX4 A;  3V7S A;  4QPO A;  1V5E A;  1XC5 A;  5EGO B;  3G1M A;  5J6X A;  3RDI A;  5LLQ A;  4AUX A;  4NDL A;  2LRE A;  3HTS B;  2HVS A;  1MBJ A;  1BW6 A;  4RB0 A;  5D5U B;  1O3R A;  4AYB A;  4P96 A;  2Y31 A;  2V26 A;  1YTY A;  1MBH A;  3SDG A;  1HSJ A;  2CQN A;  4PDK A;  1YYV A;  2HKX A;  2DOE A;  3E7L A;  1K6O A;  3P5J A;  1NH3 A;  5HLG A;  2YX7 A;  2ZSH B;  2XAJ A;  3OYF A;  4LG3 A;  2VQC A;  5GAH J;  2QUF A;  3S1R J;  2E60 A;  3L09 A;  4CCL A;  3AG2 H;  4L5J A;  3H5A A;  1YW8 A;  4PJL A;  1DPU A;  4CIC A;  5LHG A;  3ONQ A;  2LLK A;  4M9X A;  4RGX A;  3SFZ A;  2KZG A;  3K0L A;  1WHU A;  2LMD A;  1USS A;  2FBK A;  3NRV A;  5E3O A;  3LAJ A;  2VJJ A;  1ZH5 A;  1RI7 A;  1IDY A;  5TJJ A;  2K27 A;  4GXO A;  1QU3 A;  3DPT A;  4EEF G;  5ERI A;  2V1D A;  2MAB A;  2CFO A;  2VT3 A;  4CZC A;  4C2T A;  4ITV A;  4XN3 A;  1L3L A;  2UV1 A;  4JK1 X;  2QM3 A;  1BIB A;  1T38 A;  1LFP A;  2K85 A;  4HG2 A;  2K86 A;  2P6T A;  2QBY B;  4BHC A;  3OYA A;  4EVI A;  4XKV A;  1R23 A;  2FNA A;  1OCT C;  3IV5 A;  1XGM A;  5LRR A;  2K4B A;  1X58 A;  2QLZ A;  1MSF C;  3IAM 2;  2HI3 A;  1MMG A;  5LFA A;  4FCY A;  2H8R A;  2EB7 A;  2N8G A;  3RKY A;  5IY5 H;  3UKG A;  1TWG J;  3AFH A;  1K4S A;  2AXL A;  4XRS G;  2EIK H;  2ZFU A;  3U2R A;  5JR3 A;  1TWA J;  5D5V B;  5EDN A;  3GZ6 A;  1S9H A;  4C2U A;  4BEH A;  3G4S I;  1G3S A;  4S05 A;  2QEN A;  4A3D J;  3VWB A;  4DZJ A;  5LGU A;  2E1O A;  3M3Y J;  1XSV A;  3S2D J;  3BZ6 A;  5B3S H;  4IRI A;  5J8C A;  2RVC A;  3HEF A;  1D8K A;  4XL9 A;  2FBI A;  1G3W A;  2NYX A;  1BC7 C;  2W00 A;  2ISZ A;  2QCO A;  4AVP A;  1DGR M;  2J5P A;  2BVM A;  4B48 A;  2XF6 A;  3RKW A;  1ON1 A;  4M9S A;  2DJN A;  2C6Y A;  2X1C A;  3ABU A;  2V9K A;  3BWG A;  5KAI C;  4KN7 X;  3IKV A;  4PZJ A;  3LMM A;  3OYG A;  1WPK A;  3O2P E;  3M4O J;  5FLX K;  3IHU A;  2I5U A;  1LDJ A;  4IHX A;  1JJ8 C;  1ERD A;  2Q0O A;  4FE7 A;  1UFM A;  3O8H A;  3REO A;  3ZQG A;  4NQW A;  4B44 A;  1R1V A;  4AC0 A;  2NS8 A;  1K78 A;  4UUS B;  2DK5 A;  3FHZ A;  4J01 A;  3SHF A;  3HPH A;  5IP7 J;  3O3K A;  3LSM A;  2R5Y B;  3SXY A;  5C4X J;  2GAU A;  3ZR8 X;  3VSL A;  1XDU A;  1BM9 A;  1IW7 F;  2E1M B;  3HRU A;  3HTU A;  4XLH A;  1LB2 A;  2JVG A;  1OIS A;  4BBR J;  1YIT I;  1D1C A;  4G7H F;  4CCJ A;  3UR3 C;  3WTY C;  4CZZ A;  1LPQ A;  1REP C;  2RNJ A;  1WJB A;  2X6X A;  4JX4 A;  1J75 A;  2JT1 A;  5BNG A;  2EV6 A;  1A6I A;  5D5X B;  1IRZ A;  1Y39 A;  1F4K A;  2CQ7 A;  2XUB A;  5D8L B;  3W2A A;  3S8P A;  3BY6 A;  2K7L A;  1UG2 A;  2CQX A;  4YG2 F;  3KP2 A;  2BY2 A;  2CG4 A;  1B4A A;  2CQK A;  3G1O A;  2OJE D;  4M6V A;  5FO5 A;  3KP7 A;  3R61 A;  3CUQ C;  4D7N A;  2PG4 A;  2A5Y B;  3H35 A;  4RLF A;  4YRV A;  4I0A A;  4XLP F;  2H27 A;  5E79 C;  3GLX A;  2JPB A;  2G9W A;  3LAP A;  2DT7 B;  3TBI A;  1RR8 C;  2WY7 Q;  3RQI A;  1SD6 A;  2OV7 A;  4HRI A;  5KAF C;  1MD0 A;  4Y15 A;  3DKW A;  3A01 B;  3OIQ A;  4DBQ A;  3I59 A;  3OL4 A;  4RAZ A;  1M1E B;  2G0E A;  5CQE A;  2KJC A;  2E35 A;  3PNT A;  2BXY A;  3AG1 H;  4TV7 A;  3VYS B;  2OZ6 A;  2VJ4 A;  4A5N A;  4YFK F;  3HOT A;  3LSG A;  3GME A;  1X1A A;  2L9N A;  1TL8 A;  5DV5 A;  3VSK A;  3ZQF A;  3I58 A;  1YFH A;  1WSU A;  2E2H J;  3BG9 A;  3HJE A;  4QTR A;  2BY3 A;  4AIK A;  4PK4 A;  2IRF G;  1FC3 A;  2OTL I;  3JAM K;  3SZP A;  5FRN A;  4F52 A;  2BYV E;  2GM4 A;  2LKP A;  2P7V B;  3B6A A;  2OA4 A;  4P1W A;  1OQY A;  2M34 A;  4BY1 J;  2X6Y A;  5CPR B;  1D0Z A;  4LIV A;  3J7Z I;  2LTP A;  2HYJ A;  3V4G A;  2ADU A;  3HKZ A;  2HTJ A;  1HW1 A;  4ZYA A;  3OR2 C;  3R0A A;  2DPU A;  1ZEL A;  3V42 A;  4KDP A;  2XPU A;  2WAQ A;  3DBR B;  2JUG A;  3QOD A;  1QHG A;  4RAY A;  2O8K A;  1WJD A;  5E18 F;  3T1B A;  2ZXW H;  3J81 Z;  4EM1 A;  5FLV A;  3EYI A;  1JUP A;  4EM2 A;  2FOK A;  5KNL A;  5K1Y A;  3I56 I;  3KZI C;  3H3V K;  3OS1 A;  4C3H J;  2KHM A;  5HDK A;  2VL8 A;  3PIP F;  3L2W A;  1A04 A;  2IGK A;  3WTV C;  1XCV A;  2R0Q C;  2R5Z B;  5LRS A;  5GTH C;  3CCL I;  4R79 A;  4RBO A;  3GXO A;  3OOU A;  1S7A A;  3E5U A;  1A35 A;  2BY1 A;  1XGS A;  2KIM A;  2MC3 A;  2ZO4 A;  4XBF A;  1CQT A;  3FMQ A;  4IQ4 A;  4IHT A;  1XCB A;  2M5W A;  3P9C A;  1H88 C;  2CH0 A;  4NNJ A;  3CD6 I;  1P7J A;  3TOB A;  2DMP A;  4K2E A;  3OYL A;  3ECO A;  5ED4 A;  1BC8 C;  5FLM J;  4ZZD A;  1N25 A;  1Z91 A;  2ME6 A;  1DQU A;  4A3E J;  2KQR A;  2LP0 A;  3QPS A;  4F7Z A;  5H20 A;  2FRH A; 
#chains in the Genus database with same CATH homology
 2E34 A;  5GAH J;  1QA6 A;  3CC7 I;  1VQ8 I;  5GAD J;  1VQ4 I;  3CF5 F;  1YJW I;  1FOY A;  1VQK I;  3CCJ I;  3CJT B;  3CC2 I;  2E35 A;  2H8W A;  2QEX I;  2JQ7 A;  3CCU I;  1YI2 I;  1YJ9 I;  3CCE I;  1YIJ I;  4V19 K;  2OTL I;  1HC8 A;  2FOW A;  5GAE J;  1FOW A;  3CCS I;  4IOA F;  1VQP I;  5DM6 F;  3G4S I;  3J7Z I;  1YJN I;  2OTJ I;  1FOX A;  3CCR I;  4IOC F;  3CCM I;  3G71 I;  1YHQ I;  5GAG J;  1VQ9 I;  3CME I;  3G6E I;  2K3F A;  1S72 I;  1VQ5 I;  2QA4 I;  3CCV I;  1MMS A;  3I55 I;  2ZJQ F;  3I56 I;  4IO9 F;  3J7Y J;  3CCQ I;  2NXN B;  3PIP F;  3CMA I;  3PIO F;  2ZJR F;  1VQM I;  5DM7 F;  3CCL I;  1VQ6 I;  2ZJP F;  1ACI A;  1VQO I;  3DLL F;  1VQ7 I;  1VQL I;  1VQN I;  1YIT I;  3CD6 I;  3CC4 I;  4UY8 I;  1Y39 A;  5JVG F;  2E36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...