1FOWA

Nmr structure of l11-c76, the c-terminal domain of 50s ribosomal protein l11, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L11-C76
publication title High resolution solution structure of ribosomal protein L11-C76, a helical protein with a flexible loop that becomes structured upon binding to RNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1996-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1fowA00
1S72I 2K3FA 3CCSI 3CF5F 3CMAI 5GAGJ 1VQ5I 2H8WA 5DM6F 2OTLI 3PIPF 3DLLF 1VQKI 5GAEJ 3CCJI 1YHQI 2FOWA 5GADJ 3CCRI 1FOYA 3CCMI 3G4SI 1Y39A 1QA6A 3CCQI 4IO9F 2E36A 3CCUI 3PIOF 1VQNI 2E34A 2QA4I 3J7ZI 1VQ7I 1YITI 1YJ9I 4V19K 1VQOI 3I56I 1YIJI 3CJTB 1FOXA 2ZJRF 5GAHJ 1HC8A 5JVGF 2NXNB 3CMEI 1FOWA 2ZJPF 3I55I 2QEXI 3G71I 1YJNI 3CCEI 2ZJQF 3CC2I 3CCLI 5DM7F 1VQLI 1VQPI 1VQ4I 4UY8I 2OTJI 2E35A 2JQ7A 1ACIA 3J7YJ 1VQ6I 1YI2I 1VQ8I 3CC4I 3CCVI 1YJWI 3CD6I 3G6EI 4IOCF 3CC7I 1VQ9I 1VQMI 1MMSA 4IOAF
chains in the Genus database with same CATH superfamily
1MBJA 2BHYA 1PP7U 1WJEA 4K2EA 2VXDA 4B3XA 2PJRA 2KPMA 4NHJA 2VE8A 2PX9A 1Z1DA 2DJNA 2R4GA 3DTEA 1FTZA 4NQWB 1HSTA 4XR6A 4LG0A 5JLXA 1QU3A 3S15J 3ZMVA 1ETVA 3MVPA 1ON2A 4A3KJ 3OYCA 4I02A 5BMZA 4HW0A 4HLXA 3FM3A 5GPAA 2EZKA 3ULQB 1V3FA 3C2BA 1QPMA 4NB5A 1K61A 2PQ8A 3E97A 4ZYEA 1FBSA 4AWXB 3G3ZA 1ZTRA 4OAZA 4L5IA 1A31A 3PNTA 3WTYC 4FE4A 3CCUI 2V79A 3MEXA 4ETSA 2R7VA 2QSGX 2W4SA 1USSA 4CHUA 1ZAOA 5K5RA 4V19K 2WADA 1ZRCA 2BOLA 2DQRA 3R0JA 3S2HJ 3IKVA 2DTZA 3CCYA 3KETA 5LHGA 4HX4A 4M9SA 1X1CA 2P4WA 1WJCA 3WGHA 1IXCA 3RZDJ 4GXOA 3D0SA 2ZFWA 2CH0A 2BV6A 5LRSA 1YTYA 3ZMDA 4KDPA 1XMAA 4FETA 2R7TA 3B02A 1MW7A 1I1GA 2XHKA 2QEXI 2ZJ2A 3CCEI 4BYYA 3JREA 1XPXA 3S3MA 1MBEA 2K85A 4XKWA 1B6AA 4Y4RA 2Z5UA 1GVJA 1UG2A 4RAYA 3CJNA 2IS4A 2M7AA 2EV5A 4ABZA 2Y0SN 1WGXA 3L2RA 4WX9A 1GXPA 4OMZA 4QIWN 1N78A 1VQ4I 5HS7A 4F55A 2KZVA 5FLVA 4B4CA 3M8FA 3SDGA 1UHSA 4AC0A 1ACIA 1CQTA 3CDLA 5JLWA 1FY7A 3WHBA 2KQRA 2VJ4A 1VF9A 1I39A 3FK7A 4YRVA 1R1TA 4HDUA 2F5FA 1IZ1A 1ETOA 3TW6A 3ELKA 1XN7A 1FYMA 3CTAA 4JX5A 2HGCA 3QRFF 1HLVA 1MIJA 1HKSA 2HU9A 3CUQA 5HLIA 2XROA 5BPDA 3PUBA 4NC8A 2AO9A 3GZNB 3OYBA 2I8DA 4LGWA 4CCNA 3FIWA 4IL6C 4KIGA 4EGZA 5LGUA 2KIMA 2IAIA 4F7ZA 4R8HA 1LFPA 1PVEA 1S72I 1F5TA 4Q47A 1HOMA 1U8BA 2HVQA 1PP8F 1HQCA 2AS5F 3PJRA 4I09A 4UHTA 5GAGJ 3GMEA 3Q5FA 2ME6A 1UB9A 2Y48A 5DM6F 1KQ9A 2DT5A 5D4SA 4Z6YA 2HYJA 1KU7A 2CWEA 3EYYA 3HSFA 1K79A 2X6XA 5LEJA 3DEWA 3ONQA 5IOZA 1R4MB 1W5TA 1XDSA 1XGOA 2B63J 2OAZA 1R6RA 2JA6J 1W7PA 1R4NB 1P7JA 5EEHA 2CV2A 1MJ9A 5FD5A 3JRBA 3SEQA 1FEXA 1RETA 2BYVE 3M7GA 2YS9A 3MZHA 1DDNA 3M3YJ 1FBUA 5D4RA 4BHPA 1MGTA 2JUGA 1U9OA 2LY1A 4CXFA 2E1MB 3E6BA 3WG9A 4XORA 4WWCA 4HBLA 3H1CA 3CJRB 1P92A 2E7WA 2MSYA 3JRFA 1ZN2A 2QCOA 5IP7J 3BR0A 1WJFA 2VQGA 4XOPA 2L7ZA 5FFXA 2KDOA 4WXHA 3I0TA 3TP3A 2NAZA 5JVGF 2VBXA 2GWRA 5IYBJ 5DTDA 5A2QZ 4G6TB 1ETQA 3G2BA 3GO5A 1R9TJ 4FT8A 3VFZA 3S93A 3V8LA 3OV8A 1DPUA 3KEQA 3DPUA 3U2RA 4G7OF 1EF4A 4M73A 3LA7A 2O8KA 2GA2A 3H9GA 3HIFA 4GO1A 3ZN0A 1LVKA 1B59A 4IXAA 4ZYGA 5IP6A 2FSWA 4RGUA 1A35A 4C2UA 2Z9OA 4HPQA 1J75A 2LFBA 2BE5F 4RS8A 4D0PA 5BOXA 1BW5A 2LY9A 2Z2SB 2M34A 2GBYA 2ZSHB 3CMMA 2ZXJA 4IRIA 1B9MA 2CMPA 4XRFA 3I3LA 3K4KA 3IWFA 2XVCA 3D5RC 2Q8KA 2QLZA 1FJLA 4M3GA 2VL8A 2P6TA 5H6QA 5LLQA 3J81Z 1A6QA 1EH6A 3KFWX 3CCVI 4MEXF 4HF2A 1ONVA 3DLAA 1TBXA 2CYYA 5F0CA 4XK4A 4BBSJ 2IT0A 2L9SA 3DTKA 2L7FP 1FX7A 4ZYDA 1YW8A 1SD6A 2ZB9A 2FX0A 2L02A 1JT6A 3K1NA 4M3FA 2J5OA 3BG7A 2KRFA 1K78A 5ERIA 4RLFA 1XD7A 4X0GA 2E71A 3CMAI 2NOGA 5KCMA 5J4VA 1YS7A 2DMNA 2VQLA 3VYSB 4D7MA 2V6CA 2HPIA 3LSGA 4O3MA 4BY1J 2OUMA 3X2QH 4UV9A 3Q9SA 1JT0A 1Z21A 3BY6A 3OYIA 1GVDA 3H9QA 5EZGA 4BEHB 3QODA 2FNAA 2XKPA 1J09A 3SYTA 4B09A 2R93J 4Q5SF 4E7IA 2AXTC 1IN7A 3JSOA 3PFYA 4PJNA 4KYWA 1PUFB 2QVOA 3GUDA 2CFOA 1MSFC 1OCTC 5HLGA 2CSOA 2VE9A 5D5VB 2ZNYA 3GFJA 2A05A 2CRGA 2OBPA 5EF6A 4I0BA 3FDYA 2L9NA 1K4SA 2V26A 1BC8C 4LLGF 3H3VK 4ESFA 2F4OB 2VQCA 1AHDP 4WCGA 4KT6A 4BGDA 3ZMSA 1IXSB 2CQ7A 3JTGA 1XGSA 4WF2A 1FOXA 2PEXA 3HOXJ 2D5VA 3SXYA 3FM5A 2CG4A 5DCMB 1E3OC 4F3QA 1N25A 3WTZA 4AYBN 2ZFUA 4XONA 1LJ9A 4U7DA 2DA6A 2QQBA 2YU9J 4P5OA 5B1AH 5M5YJ 1V55H 1IW7F 2EFWA 2VIXA 2XV4S 4LK1F 2L2OA 4LOCA 4BE2A 3GTOJ 3PO3J 4IHWA 3EDPA 2IA0A 1UG0A 3CCLI 4LITA 1BL0A 2HEOA 4X1EA 1RIOH 3DBHB 2IGMA 5IT9Z 1V4RA 2IP2A 1MBFA 3ASOH 3F8FA 4LIUA 1U78A 3BG5A 5BNGA 2KIUA 1R71A 2UV1A 1QZZA 3C3WA 1XSDA 2OPTA 1B4AA 3JW4A 3P9CA 4IRHA 2EIJH 1LE8B 2Z99A 5J8FA 1S7EA 2OQGA 3A01B 1P4AA 1U9NA 4D9JA 3V8KA 2Y75A 4BQNA 9ANTA 3LAPA 3BR6A 4A3JJ 2FBHA 4HSTA 5EG0B 4L9JA 2JN6A 5KNLA 3DXJF 3S17J 2V6EA 3L2WA 5FRMA 2HTSA 3CC7I 1VQ9I 2Q2EA 2R7OA 5L3BA 3HBLA 4I99C 5FO5A 1SFXA 2MLKA 1U5TB 2JVHA 2KJBA 2YUSA 2HXOA 4HV6A 2LMDA 4ZDOA 1NG6A 1OYIA 2FXAA 2Y2ZA 3MAJA 2DPDA 1HF0A 2XPVA 3QU6A 1XX5A 2K3FA 4HA8A 4E4HA 4E7HA 2M9HA 2P5LC 4MQ9F 1A36A 2E2IJ 3KYLA 5FROA 3F0CA 4UVAA 2O0YA 3PUFA 3OOPA 2GXBA 5DCFA 3V7CA 2VONA 1T08B 1IG7A 4Y13A 3H0GJ 1BJZA 1IRGA 1V54H 1E17A 1WFXA 2ZSIB 4L5EA 4BS9A 1J0RA 1K6YA 2KKOA 4DYRA 3I59A 4UUSA 1D1BA 1MJAA 2XAUA 1OQYA 2EA2A 3OSGA 1JJ6C 1BOAA 4E7SA 2V1UA 1JHHA 1U0JA 2XGEA 1ZREA 5FKKA 3CCQI 3QP6A 2GIVA 2KISA 4A2UA 1L0OC 3QPTA 1Y8QB 1X1PA 2MABA 2VJ5A 5FD6A 3JRHA 2CW7A 4W1UA 1VQ7I 1IO2A 2IS2A 5AIPA 1YJ9I 1OR7A 2HYGD 4XKBA 3OIPA 1W36C 3CDHA 1JKPC 1T38A 2DT7B 4A3LJ 3IHUA 4LB6B 3V7SA 1UMQA 1PUEE 2XASA 2HXIA 1UCRA 1F36A 3TL4X 2FBKA 1YW7A 4XRSA 2RGVA 2VI6A 4FHTA 2O9LA 3U9GA 3OYHA 4OIRF 5J1RA 3P5JA 2DFEA 3L2VA 1GT0C 1UELB 1XGMA 3I9V2 3HRMA 2EZIA 3LFUA 4EM0B 5DUKA 2QBYB 1YOVB 2IS6A 3D5LA 1BR1A 2OD5A 3ZOBA 4A69C 2QQAA 1OLTA 3U1KA 3JAMK 2CGPA 3I54A 2E1CA 1WRJA 3JR9A 2JSCA 2E35A 2IGKA 2H09A 5H6RA 2R7UA 3RSNA 3DU6A 3O6BB 3UNGC 1STZA 2PJRB 3HOVJ 2Q1ZB 1FIAA 3GFMA 2JVGA 2VN2A 4LG0B 1EA3A 2DTRA 4PCQA 2STTA 2MD5A 1G6NA 1T2KA 3N97A 2JSPA 4DJAA 3RKQA 1WKMA 2DDAA 2YX7A 1WZ2A 1UJ8A 1T95A 1DGRM 2V9KA 1ZR4A 3ABKH 3FISA 3WHCA 4CZCA 2MA3A 3VDXA 4BACA 1RESA 2K27A 4HEA2 4GRIA 3UR3C 2X6OA 3ERMA 3BWGA 1X1BA 2H1LA 1TL8A 3E7LA 5D8LB 3OYEA 2RREA 1RNLA 4CO8A 5B5EC 3S1MJ 4Y17A 2CQNA 1FYLA 1AWCA 5IYCJ 1YO5C 1DP3A 1WCMJ 1GDTA 2WWYA 5GADJ 1QRYA 2PMZA 5CPRB 5F0HA 1G3SA 1F1ZA 1Y39A 5L3EA 3P9IA 3R60A 1LPQA 1S6LA 1JTYA 4L9VA 4ZC3A 3W3CA 1K83J 2F4IA 1JKOC 2ZXHA 4YELA 5D5UB 2EBIA 4YIFA 1KU2A 1SFOJ 3KEOA 1U3EM 2VASA 2E34A 3CP8A 5IYDJ 2H8RA 1UAAA 4I6ZA 1LVAA 2FBIA 2DODA 2E5ZA 2XB5A 3K7AJ 3T1BA 3VOEA 1OYYA 2E60A 1FBQA 1R36A 1SVLA 1LEAA 4MFEA 2CUJA 3GTMJ 3F22A 1OPCA 1D5VA 1NTCA 3ZQFA 2CW0F 2W48A 5ICEA 4JYKA 2LDUA 1RKWA 4P96A 2FOKA 4G6QA 3BOQA 4JOMA 3TGNA 4CDGA 3KZIC 2RN7A 3CUQB 3QOEA 1XGNA 1BC7C 4XBFA 4UXNA 5EZHA 5HDNA 2F5CA 1VQPI 2KRHA 1QZYA 2F5VA 3TO9A 4B48A 2WTEA 4MEYF 1HSJA 5ICFA 2EB7A 5B3SH 4EJVA 5EEAA 3LSTA 4UB6C 5LD2C 4Y7NJ 4L18B 1ZR2A 1O3SA 1VI0A 1KQ0A 3GWZA 3FBNB 1XCVA 4EM1A 1W5SA 1OCZH 3JSPA 2HYFA 2G7UA 2A69F 2K9MA 2ZBKA 2M4KA 3M1EA 1YJWI 3CD6I 4HQEA 4EV0A 5BS6A 1UHMA 4IOCF 1FOKA 2JRTA 2VBZA 4U88A 3KP2A 3HPHA 2JA8J 3ZQIA 4L0YB 3KCCA 2TRTA 1RR7A 4CCMA 1I50J 1W7PB 4Y33A 1Y6IA 4PUSA 3RPUD 3DEEA 2D45A 4DIQA 3CESA 1HW2A 4XKCA 4LD5A 1U8RA 2MG4A 1K6OA 1ZLJA 2CS3A 2F6CA 4BKXA 1Z0XA 1SFEA 4ENKA 3PNVA 4IHXA 1FMVA 2OTLI 3PIPF 1TT0A 3F8MA 3BR3A 5K5OA 2QKMB 1SEUA 1WHUA 2X0LA 2PBIA 3E6MA 4B44A 4XLFA 1TWCJ 4M3EA 3BR5A 2BEOA 4EEFG 1JKQC 1FP2A 5FKOA 3VYUB 1MNEA 2FOWA 3T8TA 4RBOA 4KN4X 2OCCH 3JRCA 3DPTA 3G4SI 2XRNA 2HDWA 3WTSC 2KHMA 3E6CC 2R7QA 2E36A 1HDPA 3WTWC 3WU1B 3L2QA 1G4DA 2HZDA 2QA4I 2UWMA 2LSOA 5C3EJ 1H89C 3SEZA 3OYJA 2DK5A 3NARA 3R61A 4Q48A 2FQ3A 3K69A 4DYQA 5LFAA 1E3HA 4DYCA 4AVPA 4MTEA 2WV1A 1HC8A 4G9YA 3SZTA 3CMEI 3U21A 4ENMA 1SD4A 1XMXA 3VB2A 3BR2A 5E3MA 4PGGA 5E20A 4U87A 1IGNA 1U2WA 2GM4A 3OS0A 2M45A 4E7KA 1LNWA 2HOEA 1TWFJ 3CC2I 1S7AA 3AKZA 4BE0A 2QGUA 3K9TA 5BQTA 2X9DA 1VQLI 4NDLA 3Q0WA 3OY9A 1YYVA 3GTLJ 3OWTA 2FA5A 3F3XA 4EATA 2Y0MA 4U0WA 2BVMA 2X1CA 1K78B 2O7OA 2QUFA 4A93J 2JQ7A 4B3AA 2OZ6A 1I3QJ 3OR1C 3CUOA 3OSFA 4A5MA 5M3MJ 2FU4A 5L3GA 1IV8A 3CZ6A 2XAQA 5CVVA 3JRAA 2MW8A 3S2DJ 2HVSA 1TTYA 5DDGA 4RGXA 4IEJA 4HSRA 3G6EI 3BROA 2DLLA 3ZR8X 4HX8A 4CZZA 2E5NA 3GTQJ 3PFIA 5F04A 1D1CA 4HZFA 4FX4A 1ENHA 3L9FA 3OS2A 1IF1A 2E2HJ 2Y69H 2COMA 1EJ9A 4BHCA 5KAIC 4F93B 1TNSA 4A3MJ 2ID3A 2XSJC 3E5QA 2ZKZA 1SAXA 3VWBA 4EVIA 2K9QA 5C44J 2K40A 4U7BA 5LGNA 3IRQA 1LDDA 2LKPA 2BZTA 2KJCA 4GYGA 4ITVA 4GYIA 5J6XA 4RDUA 5E8GA 2OV7A 3R6SA 3WU2C 4I7HA 2CV0A 1KONA 4MQVA 4F92B 2DYSH 4XLNF 2A6EF 3LQQA 1MDMA 2DXIA 3HYIA 1BR4A 3QPSA 3ABMH 3EQLF 3M8EA 4YG2F 5ED4A 1ZRDA 1A04A 4LLNA 2BXYA 3RYRA 3K6GA 2JUCA 5C4JJ 2X1EA 3CCRI 1R49A 3S1NJ 2RV8A 3D5SC 1SAUA 3Q0UA 3MKWB 4GGGA 4BXUA 1RPWA 4AD9A 2O61A 2IA1A 3RIRA 5FGMA 1KYWA 2L5QA 4HAMA 4IO9F 4BNCA 2WBMA 2ZXWH 3I71A 4L9NA 4XRMA 1NG7A 2DMPA 3CLOA 3KIOA 3IRRA 1VQOI 5D5XB 1ZELA 4KIBA 2X6YA 2ZO4A 3EUAA 4YIRX 3D1NI 2F5DA 2K86A 1DUXC 1ITYA 1OYWA 2CQXA 3SZGA 3REOA 2R7ZJ 3T8RA 1CGPA 4BU2A 4A6DA 1ZG3A 3DP7A 1FC3A 4NNJA 4ZJZA 4PJJA 3S1QJ 1FOWA 3IP4B 3TOBA 4L9TA 1J9IA 3HL2A 3KP3A 3I55I 2VKDA 3HOWJ 2XUBA 4XKVA 2W7NA 2ZXIA 3PSFA 2HWVA 4DOZA 4M6XA 4IJAA 1TC3C 4S05A 2Q2EB 4KFCA 4MGRA 2LLKA 1HA8A 2Y9YA 2XGDA 1OR7C 2L3DA 1L3LA 2NVTJ 2RDPA 3I53A 1YX5A 5IPAA 4I01A 4BBRJ 4G6DA 1SVMA 3AG4H 1VQ6I 2MD0A 3W6JB 2DQLA 2F48A 1QVUA 1R5ID 3CC4I 4Z2YA 2P8TA 3L2UA 3ZP5A 2K9SA 3GLLA 5H2FC 3TP0A 3A0BC 2Y9ZA 2E2JJ 4Y3OA 4UUSB 3I59B 2BY3A 4I76A 1T0FC 1ZARA 3GFIA 2DI3A 2A61A 1X1DA 4ZDPA 3DFGA 5J3LA 2NRAC 4MFDA 3VSKA 5AONA 3NRVA 3GTGJ 1U6GA 3MKZA 1R58A 4CA0A 2GOMA 2JPCA 2MH9A 4II3A 1KZHA 2VOPA 3LOCA 5A2QK 4J01A 3PSIA 2R7WA 5F08A 2DMUA 1D8JA 3P9KA 3W2VA 5HNFA 2MYSA 1B1BA 3DTIA 2HPMA 3N4MA 4ANJA 2BBYA 2LF7A 2VT2A 3RPUA 2IGOA 1P9QC 3ECHA 3H35A 4M6YA 4M74A 4O5VA 2B7EA 2LG4A 5J40A 5EYRA 2AQFA 1UZCA 4IHTA 4E6KG 5E79C 3MZ8A 1JXSA 3ZQLA 4UB8C 5FLXK 2TDXA 5FKMA 5K7HA 4HYEA 1TNTA 3BQYA 1XS9A 1YQAA 2JJ7A 4M6VA 1R22A 3PIOF 2WAFA 1SD7A 3QQAA 4BUPA 1PDNC 2HZTA 3JTHA 1IDZA 1WPKA 3DKXA 1PYVA 4LJZF 4KT5C 1YW9A 2DA2A 1OJLA 4GCVA 1WJBA 2L9RA 2M0MA 3BT9A 3BTJA 3VPRA 4EJOA 2ZJRF 2ISYA 5KVRA 5KK1A 1LUJB 2DA3A 1FSEA 3ZQCA 4LLLA 5F27A 1XB4A 1SVOA 3DF8A 3H5AA 4D1QA 3QP5A 2A6TA 3KE2A 1BA5A 3BPXA 4B47A 2JTVA 2PG4A 4F91B 2FD5A 3HZJA 3HOYJ 3FMSA 3WE3A 4L0ZB 2XAHA 2IXSA 3BJAA 5C4XJ 1X3WB 3OYNA 1J2XA 3OYAA 3H36A 3FF5A 4WXCA 3C2HA 2HVRA 1O3TA 1IN5A 1R23A 2BHZA 2QWWA 5M3FJ 3HGYA 3MZYA 2PLYA 2KIFA 2I10A 3JCUC 1Z9CA 2W00A 2DDBA 2GXAA 2OTJI 3KP7A 4G8XA 4HF1A 2LF8A 3H3UA 4M71A 4PFOA 3GTJJ 4J19A 3BR1A 1BI2A 2V9PA 3IH4A 1HW1A 2VQHA 3K4MA 2KDZA 1AU7A 1R1UA 6PAXA 3W6VA 1PJRA 5CYVA 2ETHA 1YI2I 1I3AA 4OU0A 2LC2A 2VBWA 3L2CA 2VXZA 2C6YA 2IEKA 4WXDA 5GTIC 3LFKA 2JWTA 4KUMA 3OYGA 1BI0A 4U0VA 1MBGA 3QPHA 1HBXG 3BLYA 3OL4A 4YFXF 5HODA 1OCCH 2JT1A 3K4CA 1Y0NA 5EDNA 3A2KA 1LDJA 1WI3A 5DS9A 3S2WA 1NHAA 4PJMA 1RKTA 2DN0A 1RC9A 2IGNA 4RLQA 3IH3A 3HJEA 2E1NA 4CH7A 5TISC 1X3ZB 4JX4A 4G7HF 5E17F 1FTTA 2WY8Q 5F0FA 1Z77A 3FHNA 4A12A 4IX7A 1DPRA 2WB1A 1SFUA 1G8XA 5E3OA 1MMGA 4Y52J 2MLGA 4GDFA 4PJLA 4UV8A 5DD8A 2MFZA 4G7ZF 1MBHA 1JE8A 5J1UA 4HNTA 2JZYA 3IC7A 2XGCA 3L1PA 1ZYRF 4QWQA 3HGGA 2Z1DA 1TWHJ 3K1PA 5AIQA 3HKZN 4BJ6C 4AIHA 1MH4A 2HR3A 5CVJA 3WTTC 1QA6A 4PJ0C 5FFZA 1W0UA 4CGZA 1ZH5A 3BTIA 2HDCA 4P9UA 5EEGA 2R7RA 5JI6A 2VUMJ 2X4HA 3HPGA 2VJIA 2ESHA 2EH3A 3K4JA 5K7ZA 2BY1A 3BG9A 2GXGA 4L5JA 1IN8A 3HUGA 4WK8F 3PL8A 4E7LA 5H20A 5TJJA 4UUTA 5HLHA 4B43A 2H27A 2R5YA 1T33A 1JKRC 2EV0A 4YIIA 2KRCA 4ON0A 3HKZA 1HXDA 3F23A 2PMUA 4ZYAA 3J80K 1TWGJ 2VKEA 5GP9A 4FX0A 4C9YA 5GPCA 4RGSA 2P5VA 2KIQA 1ORKA 2JRMA 4M72A 4A3IJ 2W1OA 2JA5J 3A02A 1SMYF 5IOYA 3DKYA 4C3HJ 2OF7A 3H0DA 2DA7A 1MD0A 1QVTA 2NYXA 5ILSA 3IWZA 3KYDB 4MHGA 1C0WA 4IKFA 3V4GA 1OCOH 3E1SA 4HLYA 4EQQA 2LTPA 4XOTA 3PM1A 3GW2A 4A3EJ 2WAQA 3SQNA 5F1RA 3EYIA 5E8IA 5B1BH 4XLEA 4Y15A 2DFHA 4XLHA 4NC6A 3HSEA 5ICGA 4LMYA 1IV6A 2VKVA 1W5CC 4AUXA 2K02A 3ABUA 3LA3A 2A07F 4BJTA 1Y1VJ 5JVTA 4MO7A 3ZGKA 1H9GA 3COAC 3BC8A 4FASD 2RKHA 3LA2A 1IRZA 1S29A 1HDDC 5CKTA 5DUIA 4KMFA 5KAFC 1T0FA 1R1VA 2DU9A 1Y56A 2K7LA 4KIFA 1A6IA 1G2HA 3OYDA 1ON1A 1Y1WJ 5JFRA 1G3TA 4ASNA 3KYCB 1F43A 4HV5A 1GXQA 1HCRA 4JX6A 2X51A 1JTXA 1XTAA 2Y31A 5L3DA 5CJ9A 3SFZA 1H88C 1X4PA 1G3WA 2QM3A 4CCOA 1YRNA 3AAFA 2FQ4A 4Q4ZF 1Y8RB 2DO7A 5HLTA 2HOAA 2RQPA 3ABTA 4DZJA 2DFFA 1F4KA 3M4OJ 5DEQA 3GVAA 3RQIA 1VQKI 1YHQI 1MMNA 3QAHA 3KEYA 2PMZN 3H3ZA 3G1MA 4A3DJ 4LK0F 3OYKA 2M5WA 2KT0A 4EMSA 3W2AA 2FUG2 2V9VA 3EETA 3J7AO 2L4AA 1JHFA 4F52A 2DBBA 3LSJA 2ELKA 3OS1A 4QPQA 4QTRA 4BHBA 1O7FA 1EH7A 2G0EA 3GCMA 1JGSA 2K4JA 1YIJI 2GQQA 3HRUA 3GFLA 4OWRB 1WQ2A 4NBQA 4P9FA 1TT5B 2MC3A 1MJBA 3EUHA 2M7BA 5E3LA 2P0WA 1T6SA 1W4MA 2N8GA 2L7MP 4EGYA 1O3QA 1NK2P 4MTDA 4BXXJ 4KNYA 2VBYA 4NC7A 5TGTA 2GAUA 1NH3A 4CYCA 4RB1A 1D1AA 2LKXA 3RTRA 4YFKF 3AG2H 2J5PA 1Q1HA 2DOEA 4HDVA 4KISA 1SFKA 3NQOA 2IRFG 2EFPA 2EJRA 1TW2A 3I4NJ 4C3IJ 3OYLA 3HTSB 4A3GJ 2HKOA 2D1VA 3I5UA 3DV8A 1X2NA 2VPRA 3F72A 1S3JA 4BXFA 3OYFA 3TEDA 2Z16A 5JHFA 4HRIA 1WJDA 5EGOA 2CQQA 1MMDA 3BCBA 4FTHA 2EK5A 3RPQA 1IN6A 1BI3A 1WSUA 1VQ8I 1TLHB 1SMTA 4IHVA 2M3AA 3BP8A 3B73A 2W82A 1MDMB 2DPUA 2STWA 4A3FJ 2R7XA 1IXRC 4AIKA 1WH5A 2O5RA 3FMRA 3OIQA 3OMYA 4UVBA 2VC1A 2LR8A 3MKLA 4XN0A 4U0YA 2B9SA 2NVXJ 2D2WA 4X6AJ 2IVMA 4PSWA 5D6EA 3ZQQA 1B72A 2GZWA 4PGHA 5ICCA 3B6CA 1D0ZA 4E70A 1MNMC 2O6GE 3QPLA 4A3BJ 3K2AA 3NWSA 4IVNA 1ZGAA 1I6XA 4HQMA 3ZRGA 4DZPA 2IS1A 3L09A 1I5ZA 3ROUA 3F9KA 2RNGA 1BI1A 1QQIA 2FF4A 4G94A 4ZYHA 4EJTA 3O8GA 2ECBA 3ERED 3V7RA 3CLQA 3TO7A 4XRSG 2OCEA 4HF0A 3SJMA 2KP6A 2ACJA 3EUKL 1YFHA 1ZKGA 1XSVA 1TQIA 1USTA 2WV0A 2RC4A 2NVQJ 4R79A 1IAWA 2KLOA 4A0YA 3HSRA 1J7KA 2IPQX 5HS8A 5LEKA 3LSKA 3HOUJ 2X48A 4BH9A 1ZG1A 4DQ2A 3E5UA 5GTHC 3HOSA 1Z67A 3CJTB 1XG1A 2P5KA 2WY7Q 4CYDA 3AL0C 2IA2A 2F4MB 2UXNA 2UZKA 3S8PA 3L00A 5GAHJ 1F9NA 2LKSA 3KX2A 1GV5A 5K5QA 3C7JA 3HRTA 3TDUC 4R1HA 1JUPA 3F21A 4M9XA 3ZN1A 4HNUA 1FNNA 2GIZA 1MH3A 3QYBA 1D5YA 1R5GA 1B8IA 2BXZA 1M1EB 3W6KB 4RB2C 2OU2A 4RMNA 2EILH 4LIVA 1GLNA 1CF7A 3ZCOA 4BE1A 5M5XJ 3WTVC 5K7FA 1N75A 5HDGA 5HVQC 3HM5A 3KP4A 4YFNF 1O3RA 3F8CA 1J5YA 5KHDA 3L7WA 3DEUA 1OMIA 2D1HA 2KL4A 3A4CA 4DGWB 1FT9A 2KMUA 2LBFA 5DYMA 4B8XA 3PO2J 1DU6A 3AL0B 2OC6A 4C3JJ 2LD5A 4XQFA 2A3SA 4JBAA 2QQ9A 2O3FA 5LBQA 5E1ZB 4AIJA 3TQNA 5F64A 4OMYA 4AM3A 1WJ5A 2EFNA 3MWMA 2ELJA 3MD2A 3TO6A 2LVSA 2OJED 3KPHA 2WAEA 3B6AA 3CF5F 5LGTA 4TV7A 5J47A 1AKHA 2HQAA 2W25A 1XMKA 4XLAA 2M0CA 4B1RA 5IP9J 1FLIA 4CCKA 3BJOA 3ASNH 3MFKA 2R7FA 5CQGA 2H8WA 1S7OA 1Z91A 3NEUA 1XDUA 1NK3P 3E3VA 4EM2A 3C18A 3K70D 1ZGWA 2HQ5A 2FMLA 3WG7H 2M4GA 1TQPA 3MN2A 1H9TA 3JRIA 2ZNZA 3FXQA 2XGXA 4CICA 4A5NA 1Z7UA 4E7JA 2DA4A 2FJ1A 3FXLA 3GZ5A 3A0HC 4PFPA 3LQRA 5FRNA 1FMWA 4PSXA 4CCLA 1W0TA 1VTNC 3HOZJ 2ELHA 3LL7A 4ENNA 4HG2A 3HDDA 1BBYA 5LRRA 1VFCA 1O57A 3MQ0A 2A5YB 3BPVA 4DNCA 1D0XA 3K70C 2QQ8A 4FQGA 4IHSA 2LRDA 5DV5A 3LNQA 3Q0VA 1LFBA 1IRFA 1ETKA 2O8XA 2H1KA 4HX7A 1HKTA 2NXNB 4KA4A 4BDYA 2HOTA 1S9HA 3GLXA 2GOXB 3ZQHA 2W84A 2V7FA 2H94A 1Z3XA 1ZHFA 1VZ0A 3C2GA 1X4OA 3BTLA 3CMYA 4ZH4F 1TWAJ 4LB5A 2QKLB 2COBA 4BJ5C 3VYRB 5DM7F 3NWTA 2VJJA 1DU0A 2BW3A 1QNTA 2E1MC 2Y0SA 3TKYA 2HKXA 1YS6A 2CUFA 2QSHX 3QOPA 1B9NA 4I98B 2XAJA 4S04A 5F6FA 3RKWA 3C1DA 2MC4A 3J7YJ 3GYHX 2R5ZA 2A5WA 3ECOA 1KYZA 4XL9A 3S3OA 1YLFA 2PI0A 2M87A 5E1XA 3LAJA 2VT3A 1MBKA 3ABLH 3IUOA 4BQAA 5CVIA 2CUEA 1FP1D 1HKQA 2IBDA 2K9LA 2HOSA 1IUYA 2ZMEA 4AU7A 3KZZA 4OOIA 3H5NA 2L7KA 4FE7A 3F8NA 3BJ6A 4II2A 3FHZA 2XF7A 2LOOA 3CF2A 4N0BA 3CCSI 2MH2A 4ESBA 3GTKJ 4XNFA 4LG3A 1BJAA 4XMYA 3BG3A 4MNUA 1I6HJ 4KICA 1VQ5I 3U1DA 3DU5A 3P7NA 3FXKA 1ZLKA 1IJWC 1ETXA 4CUGA 3K10A 3HUGB 1KGSA 5D6FA 4A0XA 2RAEA 1T98A 1TP4A 3DLLF 1MZBA 3HXLA 2R5YB 2R0QC 5J4YA 3WTXC 1R7JA 3K4LA 4DBQA 4A6EA 2HI3A 3S1RJ 2E1OA 3RQ4A 2AXLA 3TOAA 3Q3SA 4N9IA 4IQJA 1RZ4A 4M3BA 2DCEA 1VNDA 3OR2C 3VSLA 3RDIA 4AVZA 4IZZA 3O2PE 2ME0A 4EJUA 4V2FA 1FPQA 3HB9A 2G7HA 1ULYA 4NQWA 3GF2A 1YX3A 4ENJA 4QLCU 2MGQA 3A1YA 5E18F 2EIMH 3GBGA 3DCFA 1MNDA 2RVCA 3HHGA 1BM9A 1E2XA 2XAGA 2NVUB 2YX4A 2NS8A 3FXUA 4RAZA 2CO5A 3O3KA 2EA4A 4PZJA 2EFOA 1Z6TA 5FLXZ 3SFIA 2DT6A 1OKRA 4BY7J 1TW3A 2BY0A 2VB6A 2XF6A 4IQ4A 1LQ1A 2DMTA 2ZJPF 3FMQA 2M2EA 2K3PA 4MIMA 4XLCA 2FRHA 4P55A 4OIPF 1KQ8A 1X58A 4RAFA 4LFUA 3J81K 2IJLA 5FKNA 4D5FA 2R92J 1LDKB 1OISA 1GHCA 2XPWA 3QYFA 2UXXA 3ZQ7A 2HQNA 4H0EA 4UY8I 1FWZA 2XB0X 2L54A 1ZG5A 1XC5A 3DKWA 4IHYA 4M3DA 1UFMA 3K4NA 4UVCA 2HFHA 1RUOA 1HW5A 3EUHC 5HS9A 5LHHA 1LFUP 3PQJA 2F2EA 2HTJA 2VKHA 3F8BA 3R0AA 4KMUX 3CO7C 4EJWA 1K7AA 3HG9A 1W1WE 4A0ZA 1YRNB 2XC7A 1XSXA 3AFHA 1V5GA 2V4JC 2DK8A 1POGA 2DMQA 2KFDA 4ESJA 4S0HB 1V5EA 2EWNA 2NNYA 2OQRA 2A68F 3RCOA 5JR3A 2VODA 1ETYA 3E0JB 4ZTFA 3FXRA 2DFIA 1T39A 2EPFA 3F6OA 2ESNA 2EFQA 1ERDA 1EV7A 2WB1N 3RKYA 4DBRA 3AG1H 4W97A 2XPUA 3LSIA 3LSPA 2X1DA 1BOBA 2EINH 1JI8A 2VOOA 1KU9A 2E19A 3KLOA 1G59A 5L3CA 2Q0OA 1ZRFA 5FB2A 1GV2A 4C30A 1APLC 3SZPA 2QF7A 1R5HA 2L4MA 1QHHD 4HOBA 4RB3C 1I1SA 5ILVA 1Z6RA 4BQQA 1X2MA 3GTPJ 1AOYA 3CCMI 3N05A 4XM3A 2VC0A 2I5UA 1Z7LA 2PN6A 2HS5A 3S32A 3TDZC 4CYCB 1U5TC 4H4KC 5E3NA 3MCZA 2M8EA 1VQNI 3IAS2 3DBLB 4QPOA 1IRXA 2NS0A 3ESWB 2K9NA 3FXJA 2X6WA 3GZ6A 4J00A 2HQRA 2QSFX 3VYTB 2DYRH 3V42A 2JPBA 3J7AY 2DAOA 4BQOA 3M1CA 3S16J 2LP0A 3LWFA 2W57A 2WA0A 5IT9K 2V1NA 4UUVA 2X85A 1IDYA 3K0LA 5K1YA 3G1LA 3TMOA 3MMYB 2LK2A 5EGOB 1D3YA 3I58A 3WGGA 1REPC 2LNBA 4XSXF 3ZPLA 4AYBA 2OZUA 4N9HA 4OINF 1XCBA 3G71I 1WH7A 2ZJQF 4JP0A 2ICWG 4ZDLA 1P4WA 5IT3A 3IAM2 1OCPA 3QWLA 3G73A 4O6JA 1YE9A 2EZLA 4C2MJ 2G9WA 2ID6A 1Y0UA 2K4BA 4RM3A 1P2FA 2MBFA 5CVRA 2BGCA 4GFBA 1MKMA 2WAQN 3KZYA 3BDDA 2R7SA 3J80Z 1H8AC 3ZQGA 5TRDA 3PQKA 2JMWA 1B72B 3BZCA 3DBRB 5M5WJ 2QENA 1E3PA 4BL0B 3IKTA 4PK4A 1OCRH 3FZVA 5DD4A 3RI4A 3CO6C 4BAYA 2NOJB 1O7LA 4KJZA 2O03A 3V8JA 2R7DA 1W36D 1S8NA 1N77A 1BIBA 4ZZLA 2FMYA 2M30A 5LHIA 3HOTA 3FWEA 4V2GA 2DW4A 4PDKA 2HNHA 1WJAA 2ZCWA 4IRGA 1Q1VA 2M8GX 4ZZDA 3VEPA 1S5LC 4IOAF 5FKLA 2B0LA 4UNOA 1YG2A 2OA4A 4ZTJA 2RNJA 3I4PA 5HNHA 4OIOF 3ZMTA 2HDDA 3FKIJ 2P7VB 1MMAA 5JHUA 3T0YA 1WVRA 1ZGJA 4XSZF 1BR2A 3LSHA 1BIAA 1X1AA 2L01A 3JAMZ 3NAUA 3CJQB 1JUMA 4P1WA 4BDZA 1FOYA 3GEZA 2K5CA 4N4OB 4G12A 2BY2A 2E7XA 3G1OA 4IPAA 3T5XA 4DW6A 3CDIA 1D8KA 4FCYA 1B8IB 4AIDA 1UHWA 3S3NA 4NUBA 2A6HF 3E5XA 1P4XA 3DWLE 4OAYA 3JRDA 4N4NB 2NVYJ 1X3UA 1CF7B 1TZLA 4M9ZA 4RGRA 1YITI 2CW8A 1Z3YA 2XRLA 3ZMZA 1RRJA 4C2TA 3BG6A 3IL2A 4XN3A 1X19A 3K1MA 3TW7A 2PJPA 3LSMA 3JRGA 3UKGA 2YU3A 3I64A 3VODA 5D8KB 1QZEA 3M07A 2CFXA 3HHHA 4BEHA 3BTCA 2LYCA 2JA2A 3CP2A 1BW6A 3HEFA 2P7CB 2VPLA 4RA2A 1LB2A 1PUFA 4I0AA 4D5CA 3SDBA 3AG3H 2H6BA 2ZC2A 3H5RA 2LBFB 1FYKA 3WODF 1JGGA 1IC8A 2ISZA 3RZOJ 2XSDC 4QSHA 1IUFA 1FIPA 1QHGA 1WWXA 3E6DA 5EJCA 5F1JA 2YPRA 4JQFA 3FXMA 2XKOA 2Z3YA 2DA1A 2PMHA 2Y30A 1LKXA 3FX3A 4IF4A 3K4BA 2DOAA 5IY5H 3RYPA 4I2OA 2AHQA 1WI9A 5DCMA 1H0MA 2F5EA 4MLOA 1OFCX 3A03A 2EZHA 2GA1A 1IN4A 2TCTA 3CQZJ 5FLMJ 1AKHB 1RI7A 2WC2A 1TQMA 1SC7A 2ADUA 4E7ZA 3OOUA 1AA7A 3OYMA 2LY2A 3TBIA 2P81A 2XIGA 2EV6A 3FK6A 5CQEA 2DOFA 2QYOA 3LMMA 1E0EA 3HTUA 1ZQ3P 2DJIA 5HOOA 3F6VA 3QYEA 1DP7P 3EPZA 3H92A 2W85A 3CUQC 1T56A 2NNNA 2NS7A 1QO0D 3FXOA 1MMSA 3S14J 3O8HA 1LE8A 5CVUA 5J1YA 2JA7J 1SD5A 1T8IA 1SANA 3KP6A 1DQUA 5ILUA 1W7PD 3A01A 2CQKA 5B66C 1V5FA 2CU7A 1RR8C 4CSWA 4XICA 3KLNA 2L0KA 2YR2A 5EG0A 2H6CA 3MKYB 3IV5A 1QPIA 4CCJA 1O4XA 1G3YA 1ODDA 1J59A 2L9VA 3M9AA 5GAEJ 2V1XA 3SHFA 3CCJI 5D5WB 2KZGA 4XLPF 3BZ6A 3HRSA 3WE2A 3OIOA 1U5TA 2ZMEC 3H9JA 4KITB 3ZMUA 2EIKH 3FKJA 1QGPA 5FJ8J 4RM2A 3J7ZI 2LREA 5CLSA 3RKXA 1FZPB 2BW3B 3I56I 4OIQF 3DQVC 1I27A 2V1DA 1D0YA 2XAFA 4FISA 2VLAA 5E1WA 5HDKA 5BPIA 3GXOA 1A5JA 2YSRA 2CV1A 2ECCA 1RUNA 2LH9A 2P6SA 2R5ZB 2XDVA 2EQRA 3PNYA 3ISPA 1Z05A 3WGIA 1EH8A 1FSHA 1JUSA 1K4TA 1YJNI 2FE3A 3W2WA 2M1BA 2FEZA 3KP5A 2GLOA 3RJPA 1KU3A 3HC7A 4YEJA 3Q9VA 2IW5A 2ZMEB 4RAGA 3WU0A 1QBJA 4RB0A 1LEBA 2UUZA 3ZXSA 3LSRA 4HNVA 2RQQA 3M8JA 1ZK8A 3R4KA 4XIDA 3BZKA 3FBIB 1EKEA 5L3FA 2XF5A 1MSEC 2R3SA 2BVLA 3GX4X 4KN7X 3K2ZA 2AQEA 3BQZA 5J8CA 4D7NA 2Z33A 2W24A 2CJJA 3ML6A 2FNPA 1R00A 2CUZA 1P7IA 2PFBA 1KA8A 3WTUC 2QBYA 4A3CJ 1GUUA 1JJ8C 1P6RA 3BCAA 3QU3A 2DA5A 1BN5A 1ETWA 3OL3A 1DGWY 1YIOA 1VQMI 2QZ8A 3I4MJ 4JK1X 3DPLC 3IH2A 2JK3A
chains in the Genus database with same CATH topology
1S72I 2K3FA 3CCSI 3CF5F 3CMAI 5GAGJ 1VQ5I 2H8WA 5DM6F 2OTLI 3PIPF 3DLLF 1VQKI 5GAEJ 3CCJI 1YHQI 2FOWA 5GADJ 3CCRI 1FOYA 3CCMI 3G4SI 1Y39A 1QA6A 3CCQI 4IO9F 2E36A 3CCUI 3PIOF 1VQNI 2E34A 2QA4I 3J7ZI 1VQ7I 1YITI 1YJ9I 4V19K 1VQOI 3I56I 1YIJI 3CJTB 1FOXA 2ZJRF 5GAHJ 1HC8A 5JVGF 2NXNB 3CMEI 1FOWA 2ZJPF 3I55I 2QEXI 3G71I 1YJNI 3CCEI 2ZJQF 3CC2I 3CCLI 5DM7F 1VQLI 1VQPI 1VQ4I 4UY8I 2OTJI 2E35A 2JQ7A 1ACIA 3J7YJ 1VQ6I 1YI2I 1VQ8I 3CC4I 3CCVI 1YJWI 3CD6I 3G6EI 4IOCF 3CC7I 1VQ9I 1VQMI 1MMSA 4IOAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 I;  2K3F A;  3CCS I;  3CF5 F;  3CMA I;  5GAG J;  1VQ5 I;  2H8W A;  5DM6 F;  2OTL I;  3PIP F;  3DLL F;  1VQK I;  5GAE J;  3CCJ I;  1YHQ I;  2FOW A;  5GAD J;  3CCR I;  1FOY A;  3CCM I;  3G4S I;  1Y39 A;  1QA6 A;  3CCQ I;  4IO9 F;  2E36 A;  3CCU I;  3PIO F;  1VQN I;  2E34 A;  2QA4 I;  3J7Z I;  1VQ7 I;  1YIT I;  1YJ9 I;  4V19 K;  1VQO I;  3I56 I;  1YIJ I;  3CJT B;  1FOX A;  2ZJR F;  5GAH J;  1HC8 A;  5JVG F;  2NXN B;  3CME I;  1FOW A;  2ZJP F;  3I55 I;  2QEX I;  3G71 I;  1YJN I;  3CCE I;  2ZJQ F;  3CC2 I;  3CCL I;  5DM7 F;  1VQL I;  1VQP I;  1VQ4 I;  4UY8 I;  2OTJ I;  2E35 A;  2JQ7 A;  1ACI A;  3J7Y J;  1VQ6 I;  1YI2 I;  1VQ8 I;  3CC4 I;  3CCV I;  1YJW I;  3CD6 I;  3G6E I;  4IOC F;  3CC7 I;  1VQ9 I;  1VQM I;  1MMS A;  4IOA F; 
#chains in the Genus database with same CATH topology
 1MBJ A;  2BHY A;  1PP7 U;  1WJE A;  4K2E A;  2VXD A;  4B3X A;  2PJR A;  2KPM A;  4NHJ A;  2VE8 A;  2PX9 A;  1Z1D A;  2DJN A;  2R4G A;  3DTE A;  1FTZ A;  4NQW B;  1HST A;  4XR6 A;  4LG0 A;  5JLX A;  1QU3 A;  3S15 J;  3ZMV A;  1ETV A;  3MVP A;  1ON2 A;  4A3K J;  3OYC A;  4I02 A;  5BMZ A;  4HW0 A;  4HLX A;  3FM3 A;  5GPA A;  2EZK A;  3ULQ B;  1V3F A;  3C2B A;  1QPM A;  4NB5 A;  1K61 A;  2PQ8 A;  3E97 A;  4ZYE A;  1FBS A;  4AWX B;  3G3Z A;  1ZTR A;  4OAZ A;  4L5I A;  1A31 A;  3PNT A;  3WTY C;  4FE4 A;  3CCU I;  2V79 A;  3MEX A;  4ETS A;  2R7V A;  2QSG X;  2W4S A;  1USS A;  4CHU A;  1ZAO A;  5K5R A;  4V19 K;  2WAD A;  1ZRC A;  2BOL A;  2DQR A;  3R0J A;  3S2H J;  3IKV A;  2DTZ A;  3CCY A;  3KET A;  5LHG A;  4HX4 A;  4M9S A;  1X1C A;  2P4W A;  1WJC A;  3WGH A;  1IXC A;  3RZD J;  4GXO A;  3D0S A;  2ZFW A;  2CH0 A;  2BV6 A;  5LRS A;  1YTY A;  3ZMD A;  4KDP A;  1XMA A;  4FET A;  2R7T A;  3B02 A;  1MW7 A;  1I1G A;  2XHK A;  2QEX I;  2ZJ2 A;  3CCE I;  4BYY A;  3JRE A;  1XPX A;  3S3M A;  1MBE A;  2K85 A;  4XKW A;  1B6A A;  4Y4R A;  2Z5U A;  1GVJ A;  1UG2 A;  4RAY A;  3CJN A;  2IS4 A;  2M7A A;  2EV5 A;  4ABZ A;  2Y0S N;  1WGX A;  3L2R A;  4WX9 A;  1GXP A;  4OMZ A;  4QIW N;  1N78 A;  1VQ4 I;  5HS7 A;  4F55 A;  2KZV A;  5FLV A;  4B4C A;  3M8F A;  3SDG A;  1UHS A;  4AC0 A;  1ACI A;  1CQT A;  3CDL A;  5JLW A;  1FY7 A;  3WHB A;  2KQR A;  2VJ4 A;  1VF9 A;  1I39 A;  3FK7 A;  4YRV A;  1R1T A;  4HDU A;  2F5F A;  1IZ1 A;  1ETO A;  3TW6 A;  3ELK A;  1XN7 A;  1FYM A;  3CTA A;  4JX5 A;  2HGC A;  3QRF F;  1HLV A;  1MIJ A;  1HKS A;  2HU9 A;  3CUQ A;  5HLI A;  2XRO A;  5BPD A;  3PUB A;  4NC8 A;  2AO9 A;  3GZN B;  3OYB A;  2I8D A;  4LGW A;  4CCN A;  3FIW A;  4IL6 C;  4KIG A;  4EGZ A;  5LGU A;  2KIM A;  2IAI A;  4F7Z A;  4R8H A;  1LFP A;  1PVE A;  1S72 I;  1F5T A;  4Q47 A;  1HOM A;  1U8B A;  2HVQ A;  1PP8 F;  1HQC A;  2AS5 F;  3PJR A;  4I09 A;  4UHT A;  5GAG J;  3GME A;  3Q5F A;  2ME6 A;  1UB9 A;  2Y48 A;  5DM6 F;  1KQ9 A;  2DT5 A;  5D4S A;  4Z6Y A;  2HYJ A;  1KU7 A;  2CWE A;  3EYY A;  3HSF A;  1K79 A;  2X6X A;  5LEJ A;  3DEW A;  3ONQ A;  5IOZ A;  1R4M B;  1W5T A;  1XDS A;  1XGO A;  2B63 J;  2OAZ A;  1R6R A;  2JA6 J;  1W7P A;  1R4N B;  1P7J A;  5EEH A;  2CV2 A;  1MJ9 A;  5FD5 A;  3JRB A;  3SEQ A;  1FEX A;  1RET A;  2BYV E;  3M7G A;  2YS9 A;  3MZH A;  1DDN A;  3M3Y J;  1FBU A;  5D4R A;  4BHP A;  1MGT A;  2JUG A;  1U9O A;  2LY1 A;  4CXF A;  2E1M B;  3E6B A;  3WG9 A;  4XOR A;  4WWC A;  4HBL A;  3H1C A;  3CJR B;  1P92 A;  2E7W A;  2MSY A;  3JRF A;  1ZN2 A;  2QCO A;  5IP7 J;  3BR0 A;  1WJF A;  2VQG A;  4XOP A;  2L7Z A;  5FFX A;  2KDO A;  4WXH A;  3I0T A;  3TP3 A;  2NAZ A;  5JVG F;  2VBX A;  2GWR A;  5IYB J;  5DTD A;  5A2Q Z;  4G6T B;  1ETQ A;  3G2B A;  3GO5 A;  1R9T J;  4FT8 A;  3VFZ A;  3S93 A;  3V8L A;  3OV8 A;  1DPU A;  3KEQ A;  3DPU A;  3U2R A;  4G7O F;  1EF4 A;  4M73 A;  3LA7 A;  2O8K A;  2GA2 A;  3H9G A;  3HIF A;  4GO1 A;  3ZN0 A;  1LVK A;  1B59 A;  4IXA A;  4ZYG A;  5IP6 A;  2FSW A;  4RGU A;  1A35 A;  4C2U A;  2Z9O A;  4HPQ A;  1J75 A;  2LFB A;  2BE5 F;  4RS8 A;  4D0P A;  5BOX A;  1BW5 A;  2LY9 A;  2Z2S B;  2M34 A;  2GBY A;  2ZSH B;  3CMM A;  2ZXJ A;  4IRI A;  1B9M A;  2CMP A;  4XRF A;  3I3L A;  3K4K A;  3IWF A;  2XVC A;  3D5R C;  2Q8K A;  2QLZ A;  1FJL A;  4M3G A;  2VL8 A;  2P6T A;  5H6Q A;  5LLQ A;  3J81 Z;  1A6Q A;  1EH6 A;  3KFW X;  3CCV I;  4MEX F;  4HF2 A;  1ONV A;  3DLA A;  1TBX A;  2CYY A;  5F0C A;  4XK4 A;  4BBS J;  2IT0 A;  2L9S A;  3DTK A;  2L7F P;  1FX7 A;  4ZYD A;  1YW8 A;  1SD6 A;  2ZB9 A;  2FX0 A;  2L02 A;  1JT6 A;  3K1N A;  4M3F A;  2J5O A;  3BG7 A;  2KRF A;  1K78 A;  5ERI A;  4RLF A;  1XD7 A;  4X0G A;  2E71 A;  3CMA I;  2NOG A;  5KCM A;  5J4V A;  1YS7 A;  2DMN A;  2VQL A;  3VYS B;  4D7M A;  2V6C A;  2HPI A;  3LSG A;  4O3M A;  4BY1 J;  2OUM A;  3X2Q H;  4UV9 A;  3Q9S A;  1JT0 A;  1Z21 A;  3BY6 A;  3OYI A;  1GVD A;  3H9Q A;  5EZG A;  4BEH B;  3QOD A;  2FNA A;  2XKP A;  1J09 A;  3SYT A;  4B09 A;  2R93 J;  4Q5S F;  4E7I A;  2AXT C;  1IN7 A;  3JSO A;  3PFY A;  4PJN A;  4KYW A;  1PUF B;  2QVO A;  3GUD A;  2CFO A;  1MSF C;  1OCT C;  5HLG A;  2CSO A;  2VE9 A;  5D5V B;  2ZNY A;  3GFJ A;  2A05 A;  2CRG A;  2OBP A;  5EF6 A;  4I0B A;  3FDY A;  2L9N A;  1K4S A;  2V26 A;  1BC8 C;  4LLG F;  3H3V K;  4ESF A;  2F4O B;  2VQC A;  1AHD P;  4WCG A;  4KT6 A;  4BGD A;  3ZMS A;  1IXS B;  2CQ7 A;  3JTG A;  1XGS A;  4WF2 A;  1FOX A;  2PEX A;  3HOX J;  2D5V A;  3SXY A;  3FM5 A;  2CG4 A;  5DCM B;  1E3O C;  4F3Q A;  1N25 A;  3WTZ A;  4AYB N;  2ZFU A;  4XON A;  1LJ9 A;  4U7D A;  2DA6 A;  2QQB A;  2YU9 J;  4P5O A;  5B1A H;  5M5Y J;  1V55 H;  1IW7 F;  2EFW A;  2VIX A;  2XV4 S;  4LK1 F;  2L2O A;  4LOC A;  4BE2 A;  3GTO J;  3PO3 J;  4IHW A;  3EDP A;  2IA0 A;  1UG0 A;  3CCL I;  4LIT A;  1BL0 A;  2HEO A;  4X1E A;  1RIO H;  3DBH B;  2IGM A;  5IT9 Z;  1V4R A;  2IP2 A;  1MBF A;  3ASO H;  3F8F A;  4LIU A;  1U78 A;  3BG5 A;  5BNG A;  2KIU A;  1R71 A;  2UV1 A;  1QZZ A;  3C3W A;  1XSD A;  2OPT A;  1B4A A;  3JW4 A;  3P9C A;  4IRH A;  2EIJ H;  1LE8 B;  2Z99 A;  5J8F A;  1S7E A;  2OQG A;  3A01 B;  1P4A A;  1U9N A;  4D9J A;  3V8K A;  2Y75 A;  4BQN A;  9ANT A;  3LAP A;  3BR6 A;  4A3J J;  2FBH A;  4HST A;  5EG0 B;  4L9J A;  2JN6 A;  5KNL A;  3DXJ F;  3S17 J;  2V6E A;  3L2W A;  5FRM A;  2HTS A;  3CC7 I;  1VQ9 I;  2Q2E A;  2R7O A;  5L3B A;  3HBL A;  4I99 C;  5FO5 A;  1SFX A;  2MLK A;  1U5T B;  2JVH A;  2KJB A;  2YUS A;  2HXO A;  4HV6 A;  2LMD A;  4ZDO A;  1NG6 A;  1OYI A;  2FXA A;  2Y2Z A;  3MAJ A;  2DPD A;  1HF0 A;  2XPV A;  3QU6 A;  1XX5 A;  2K3F A;  4HA8 A;  4E4H A;  4E7H A;  2M9H A;  2P5L C;  4MQ9 F;  1A36 A;  2E2I J;  3KYL A;  5FRO A;  3F0C A;  4UVA A;  2O0Y A;  3PUF A;  3OOP A;  2GXB A;  5DCF A;  3V7C A;  2VON A;  1T08 B;  1IG7 A;  4Y13 A;  3H0G J;  1BJZ A;  1IRG A;  1V54 H;  1E17 A;  1WFX A;  2ZSI B;  4L5E A;  4BS9 A;  1J0R A;  1K6Y A;  2KKO A;  4DYR A;  3I59 A;  4UUS A;  1D1B A;  1MJA A;  2XAU A;  1OQY A;  2EA2 A;  3OSG A;  1JJ6 C;  1BOA A;  4E7S A;  2V1U A;  1JHH A;  1U0J A;  2XGE A;  1ZRE A;  5FKK A;  3CCQ I;  3QP6 A;  2GIV A;  2KIS A;  4A2U A;  1L0O C;  3QPT A;  1Y8Q B;  1X1P A;  2MAB A;  2VJ5 A;  5FD6 A;  3JRH A;  2CW7 A;  4W1U A;  1VQ7 I;  1IO2 A;  2IS2 A;  5AIP A;  1YJ9 I;  1OR7 A;  2HYG D;  4XKB A;  3OIP A;  1W36 C;  3CDH A;  1JKP C;  1T38 A;  2DT7 B;  4A3L J;  3IHU A;  4LB6 B;  3V7S A;  1UMQ A;  1PUE E;  2XAS A;  2HXI A;  1UCR A;  1F36 A;  3TL4 X;  2FBK A;  1YW7 A;  4XRS A;  2RGV A;  2VI6 A;  4FHT A;  2O9L A;  3U9G A;  3OYH A;  4OIR F;  5J1R A;  3P5J A;  2DFE A;  3L2V A;  1GT0 C;  1UEL B;  1XGM A;  3I9V 2;  3HRM A;  2EZI A;  3LFU A;  4EM0 B;  5DUK A;  2QBY B;  1YOV B;  2IS6 A;  3D5L A;  1BR1 A;  2OD5 A;  3ZOB A;  4A69 C;  2QQA A;  1OLT A;  3U1K A;  3JAM K;  2CGP A;  3I54 A;  2E1C A;  1WRJ A;  3JR9 A;  2JSC A;  2E35 A;  2IGK A;  2H09 A;  5H6R A;  2R7U A;  3RSN A;  3DU6 A;  3O6B B;  3UNG C;  1STZ A;  2PJR B;  3HOV J;  2Q1Z B;  1FIA A;  3GFM A;  2JVG A;  2VN2 A;  4LG0 B;  1EA3 A;  2DTR A;  4PCQ A;  2STT A;  2MD5 A;  1G6N A;  1T2K A;  3N97 A;  2JSP A;  4DJA A;  3RKQ A;  1WKM A;  2DDA A;  2YX7 A;  1WZ2 A;  1UJ8 A;  1T95 A;  1DGR M;  2V9K A;  1ZR4 A;  3ABK H;  3FIS A;  3WHC A;  4CZC A;  2MA3 A;  3VDX A;  4BAC A;  1RES A;  2K27 A;  4HEA 2;  4GRI A;  3UR3 C;  2X6O A;  3ERM A;  3BWG A;  1X1B A;  2H1L A;  1TL8 A;  3E7L A;  5D8L B;  3OYE A;  2RRE A;  1RNL A;  4CO8 A;  5B5E C;  3S1M J;  4Y17 A;  2CQN A;  1FYL A;  1AWC A;  5IYC J;  1YO5 C;  1DP3 A;  1WCM J;  1GDT A;  2WWY A;  5GAD J;  1QRY A;  2PMZ A;  5CPR B;  5F0H A;  1G3S A;  1F1Z A;  1Y39 A;  5L3E A;  3P9I A;  3R60 A;  1LPQ A;  1S6L A;  1JTY A;  4L9V A;  4ZC3 A;  3W3C A;  1K83 J;  2F4I A;  1JKO C;  2ZXH A;  4YEL A;  5D5U B;  2EBI A;  4YIF A;  1KU2 A;  1SFO J;  3KEO A;  1U3E M;  2VAS A;  2E34 A;  3CP8 A;  5IYD J;  2H8R A;  1UAA A;  4I6Z A;  1LVA A;  2FBI A;  2DOD A;  2E5Z A;  2XB5 A;  3K7A J;  3T1B A;  3VOE A;  1OYY A;  2E60 A;  1FBQ A;  1R36 A;  1SVL A;  1LEA A;  4MFE A;  2CUJ A;  3GTM J;  3F22 A;  1OPC A;  1D5V A;  1NTC A;  3ZQF A;  2CW0 F;  2W48 A;  5ICE A;  4JYK A;  2LDU A;  1RKW A;  4P96 A;  2FOK A;  4G6Q A;  3BOQ A;  4JOM A;  3TGN A;  4CDG A;  3KZI C;  2RN7 A;  3CUQ B;  3QOE A;  1XGN A;  1BC7 C;  4XBF A;  4UXN A;  5EZH A;  5HDN A;  2F5C A;  1VQP I;  2KRH A;  1QZY A;  2F5V A;  3TO9 A;  4B48 A;  2WTE A;  4MEY F;  1HSJ A;  5ICF A;  2EB7 A;  5B3S H;  4EJV A;  5EEA A;  3LST A;  4UB6 C;  5LD2 C;  4Y7N J;  4L18 B;  1ZR2 A;  1O3S A;  1VI0 A;  1KQ0 A;  3GWZ A;  3FBN B;  1XCV A;  4EM1 A;  1W5S A;  1OCZ H;  3JSP A;  2HYF A;  2G7U A;  2A69 F;  2K9M A;  2ZBK A;  2M4K A;  3M1E A;  1YJW I;  3CD6 I;  4HQE A;  4EV0 A;  5BS6 A;  1UHM A;  4IOC F;  1FOK A;  2JRT A;  2VBZ A;  4U88 A;  3KP2 A;  3HPH A;  2JA8 J;  3ZQI A;  4L0Y B;  3KCC A;  2TRT A;  1RR7 A;  4CCM A;  1I50 J;  1W7P B;  4Y33 A;  1Y6I A;  4PUS A;  3RPU D;  3DEE A;  2D45 A;  4DIQ A;  3CES A;  1HW2 A;  4XKC A;  4LD5 A;  1U8R A;  2MG4 A;  1K6O A;  1ZLJ A;  2CS3 A;  2F6C A;  4BKX A;  1Z0X A;  1SFE A;  4ENK A;  3PNV A;  4IHX A;  1FMV A;  2OTL I;  3PIP F;  1TT0 A;  3F8M A;  3BR3 A;  5K5O A;  2QKM B;  1SEU A;  1WHU A;  2X0L A;  2PBI A;  3E6M A;  4B44 A;  4XLF A;  1TWC J;  4M3E A;  3BR5 A;  2BEO A;  4EEF G;  1JKQ C;  1FP2 A;  5FKO A;  3VYU B;  1MNE A;  2FOW A;  3T8T A;  4RBO A;  4KN4 X;  2OCC H;  3JRC A;  3DPT A;  3G4S I;  2XRN A;  2HDW A;  3WTS C;  2KHM A;  3E6C C;  2R7Q A;  2E36 A;  1HDP A;  3WTW C;  3WU1 B;  3L2Q A;  1G4D A;  2HZD A;  2QA4 I;  2UWM A;  2LSO A;  5C3E J;  1H89 C;  3SEZ A;  3OYJ A;  2DK5 A;  3NAR A;  3R61 A;  4Q48 A;  2FQ3 A;  3K69 A;  4DYQ A;  5LFA A;  1E3H A;  4DYC A;  4AVP A;  4MTE A;  2WV1 A;  1HC8 A;  4G9Y A;  3SZT A;  3CME I;  3U21 A;  4ENM A;  1SD4 A;  1XMX A;  3VB2 A;  3BR2 A;  5E3M A;  4PGG A;  5E20 A;  4U87 A;  1IGN A;  1U2W A;  2GM4 A;  3OS0 A;  2M45 A;  4E7K A;  1LNW A;  2HOE A;  1TWF J;  3CC2 I;  1S7A A;  3AKZ A;  4BE0 A;  2QGU A;  3K9T A;  5BQT A;  2X9D A;  1VQL I;  4NDL A;  3Q0W A;  3OY9 A;  1YYV A;  3GTL J;  3OWT A;  2FA5 A;  3F3X A;  4EAT A;  2Y0M A;  4U0W A;  2BVM A;  2X1C A;  1K78 B;  2O7O A;  2QUF A;  4A93 J;  2JQ7 A;  4B3A A;  2OZ6 A;  1I3Q J;  3OR1 C;  3CUO A;  3OSF A;  4A5M A;  5M3M J;  2FU4 A;  5L3G A;  1IV8 A;  3CZ6 A;  2XAQ A;  5CVV A;  3JRA A;  2MW8 A;  3S2D J;  2HVS A;  1TTY A;  5DDG A;  4RGX A;  4IEJ A;  4HSR A;  3G6E I;  3BRO A;  2DLL A;  3ZR8 X;  4HX8 A;  4CZZ A;  2E5N A;  3GTQ J;  3PFI A;  5F04 A;  1D1C A;  4HZF A;  4FX4 A;  1ENH A;  3L9F A;  3OS2 A;  1IF1 A;  2E2H J;  2Y69 H;  2COM A;  1EJ9 A;  4BHC A;  5KAI C;  4F93 B;  1TNS A;  4A3M J;  2ID3 A;  2XSJ C;  3E5Q A;  2ZKZ A;  1SAX A;  3VWB A;  4EVI A;  2K9Q A;  5C44 J;  2K40 A;  4U7B A;  5LGN A;  3IRQ A;  1LDD A;  2LKP A;  2BZT A;  2KJC A;  4GYG A;  4ITV A;  4GYI A;  5J6X A;  4RDU A;  5E8G A;  2OV7 A;  3R6S A;  3WU2 C;  4I7H A;  2CV0 A;  1KON A;  4MQV A;  4F92 B;  2DYS H;  4XLN F;  2A6E F;  3LQQ A;  1MDM A;  2DXI A;  3HYI A;  1BR4 A;  3QPS A;  3ABM H;  3EQL F;  3M8E A;  4YG2 F;  5ED4 A;  1ZRD A;  1A04 A;  4LLN A;  2BXY A;  3RYR A;  3K6G A;  2JUC A;  5C4J J;  2X1E A;  3CCR I;  1R49 A;  3S1N J;  2RV8 A;  3D5S C;  1SAU A;  3Q0U A;  3MKW B;  4GGG A;  4BXU A;  1RPW A;  4AD9 A;  2O61 A;  2IA1 A;  3RIR A;  5FGM A;  1KYW A;  2L5Q A;  4HAM A;  4IO9 F;  4BNC A;  2WBM A;  2ZXW H;  3I71 A;  4L9N A;  4XRM A;  1NG7 A;  2DMP A;  3CLO A;  3KIO A;  3IRR A;  1VQO I;  5D5X B;  1ZEL A;  4KIB A;  2X6Y A;  2ZO4 A;  3EUA A;  4YIR X;  3D1N I;  2F5D A;  2K86 A;  1DUX C;  1ITY A;  1OYW A;  2CQX A;  3SZG A;  3REO A;  2R7Z J;  3T8R A;  1CGP A;  4BU2 A;  4A6D A;  1ZG3 A;  3DP7 A;  1FC3 A;  4NNJ A;  4ZJZ A;  4PJJ A;  3S1Q J;  1FOW A;  3IP4 B;  3TOB A;  4L9T A;  1J9I A;  3HL2 A;  3KP3 A;  3I55 I;  2VKD A;  3HOW J;  2XUB A;  4XKV A;  2W7N A;  2ZXI A;  3PSF A;  2HWV A;  4DOZ A;  4M6X A;  4IJA A;  1TC3 C;  4S05 A;  2Q2E B;  4KFC A;  4MGR A;  2LLK A;  1HA8 A;  2Y9Y A;  2XGD A;  1OR7 C;  2L3D A;  1L3L A;  2NVT J;  2RDP A;  3I53 A;  1YX5 A;  5IPA A;  4I01 A;  4BBR J;  4G6D A;  1SVM A;  3AG4 H;  1VQ6 I;  2MD0 A;  3W6J B;  2DQL A;  2F48 A;  1QVU A;  1R5I D;  3CC4 I;  4Z2Y A;  2P8T A;  3L2U A;  3ZP5 A;  2K9S A;  3GLL A;  5H2F C;  3TP0 A;  3A0B C;  2Y9Z A;  2E2J J;  4Y3O A;  4UUS B;  3I59 B;  2BY3 A;  4I76 A;  1T0F C;  1ZAR A;  3GFI A;  2DI3 A;  2A61 A;  1X1D A;  4ZDP A;  3DFG A;  5J3L A;  2NRA C;  4MFD A;  3VSK A;  5AON A;  3NRV A;  3GTG J;  1U6G A;  3MKZ A;  1R58 A;  4CA0 A;  2GOM A;  2JPC A;  2MH9 A;  4II3 A;  1KZH A;  2VOP A;  3LOC A;  5A2Q K;  4J01 A;  3PSI A;  2R7W A;  5F08 A;  2DMU A;  1D8J A;  3P9K A;  3W2V A;  5HNF A;  2MYS A;  1B1B A;  3DTI A;  2HPM A;  3N4M A;  4ANJ A;  2BBY A;  2LF7 A;  2VT2 A;  3RPU A;  2IGO A;  1P9Q C;  3ECH A;  3H35 A;  4M6Y A;  4M74 A;  4O5V A;  2B7E A;  2LG4 A;  5J40 A;  5EYR A;  2AQF A;  1UZC A;  4IHT A;  4E6K G;  5E79 C;  3MZ8 A;  1JXS A;  3ZQL A;  4UB8 C;  5FLX K;  2TDX A;  5FKM A;  5K7H A;  4HYE A;  1TNT A;  3BQY A;  1XS9 A;  1YQA A;  2JJ7 A;  4M6V A;  1R22 A;  3PIO F;  2WAF A;  1SD7 A;  3QQA A;  4BUP A;  1PDN C;  2HZT A;  3JTH A;  1IDZ A;  1WPK A;  3DKX A;  1PYV A;  4LJZ F;  4KT5 C;  1YW9 A;  2DA2 A;  1OJL A;  4GCV A;  1WJB A;  2L9R A;  2M0M A;  3BT9 A;  3BTJ A;  3VPR A;  4EJO A;  2ZJR F;  2ISY A;  5KVR A;  5KK1 A;  1LUJ B;  2DA3 A;  1FSE A;  3ZQC A;  4LLL A;  5F27 A;  1XB4 A;  1SVO A;  3DF8 A;  3H5A A;  4D1Q A;  3QP5 A;  2A6T A;  3KE2 A;  1BA5 A;  3BPX A;  4B47 A;  2JTV A;  2PG4 A;  4F91 B;  2FD5 A;  3HZJ A;  3HOY J;  3FMS A;  3WE3 A;  4L0Z B;  2XAH A;  2IXS A;  3BJA A;  5C4X J;  1X3W B;  3OYN A;  1J2X A;  3OYA A;  3H36 A;  3FF5 A;  4WXC A;  3C2H A;  2HVR A;  1O3T A;  1IN5 A;  1R23 A;  2BHZ A;  2QWW A;  5M3F J;  3HGY A;  3MZY A;  2PLY A;  2KIF A;  2I10 A;  3JCU C;  1Z9C A;  2W00 A;  2DDB A;  2GXA A;  2OTJ I;  3KP7 A;  4G8X A;  4HF1 A;  2LF8 A;  3H3U A;  4M71 A;  4PFO A;  3GTJ J;  4J19 A;  3BR1 A;  1BI2 A;  2V9P A;  3IH4 A;  1HW1 A;  2VQH A;  3K4M A;  2KDZ A;  1AU7 A;  1R1U A;  6PAX A;  3W6V A;  1PJR A;  5CYV A;  2ETH A;  1YI2 I;  1I3A A;  4OU0 A;  2LC2 A;  2VBW A;  3L2C A;  2VXZ A;  2C6Y A;  2IEK A;  4WXD A;  5GTI C;  3LFK A;  2JWT A;  4KUM A;  3OYG A;  1BI0 A;  4U0V A;  1MBG A;  3QPH A;  1HBX G;  3BLY A;  3OL4 A;  4YFX F;  5HOD A;  1OCC H;  2JT1 A;  3K4C A;  1Y0N A;  5EDN A;  3A2K A;  1LDJ A;  1WI3 A;  5DS9 A;  3S2W A;  1NHA A;  4PJM A;  1RKT A;  2DN0 A;  1RC9 A;  2IGN A;  4RLQ A;  3IH3 A;  3HJE A;  2E1N A;  4CH7 A;  5TIS C;  1X3Z B;  4JX4 A;  4G7H F;  5E17 F;  1FTT A;  2WY8 Q;  5F0F A;  1Z77 A;  3FHN A;  4A12 A;  4IX7 A;  1DPR A;  2WB1 A;  1SFU A;  1G8X A;  5E3O A;  1MMG A;  4Y52 J;  2MLG A;  4GDF A;  4PJL A;  4UV8 A;  5DD8 A;  2MFZ A;  4G7Z F;  1MBH A;  1JE8 A;  5J1U A;  4HNT A;  2JZY A;  3IC7 A;  2XGC A;  3L1P A;  1ZYR F;  4QWQ A;  3HGG A;  2Z1D A;  1TWH J;  3K1P A;  5AIQ A;  3HKZ N;  4BJ6 C;  4AIH A;  1MH4 A;  2HR3 A;  5CVJ A;  3WTT C;  1QA6 A;  4PJ0 C;  5FFZ A;  1W0U A;  4CGZ A;  1ZH5 A;  3BTI A;  2HDC A;  4P9U A;  5EEG A;  2R7R A;  5JI6 A;  2VUM J;  2X4H A;  3HPG A;  2VJI A;  2ESH A;  2EH3 A;  3K4J A;  5K7Z A;  2BY1 A;  3BG9 A;  2GXG A;  4L5J A;  1IN8 A;  3HUG A;  4WK8 F;  3PL8 A;  4E7L A;  5H20 A;  5TJJ A;  4UUT A;  5HLH A;  4B43 A;  2H27 A;  2R5Y A;  1T33 A;  1JKR C;  2EV0 A;  4YII A;  2KRC A;  4ON0 A;  3HKZ A;  1HXD A;  3F23 A;  2PMU A;  4ZYA A;  3J80 K;  1TWG J;  2VKE A;  5GP9 A;  4FX0 A;  4C9Y A;  5GPC A;  4RGS A;  2P5V A;  2KIQ A;  1ORK A;  2JRM A;  4M72 A;  4A3I J;  2W1O A;  2JA5 J;  3A02 A;  1SMY F;  5IOY A;  3DKY A;  4C3H J;  2OF7 A;  3H0D A;  2DA7 A;  1MD0 A;  1QVT A;  2NYX A;  5ILS A;  3IWZ A;  3KYD B;  4MHG A;  1C0W A;  4IKF A;  3V4G A;  1OCO H;  3E1S A;  4HLY A;  4EQQ A;  2LTP A;  4XOT A;  3PM1 A;  3GW2 A;  4A3E J;  2WAQ A;  3SQN A;  5F1R A;  3EYI A;  5E8I A;  5B1B H;  4XLE A;  4Y15 A;  2DFH A;  4XLH A;  4NC6 A;  3HSE A;  5ICG A;  4LMY A;  1IV6 A;  2VKV A;  1W5C C;  4AUX A;  2K02 A;  3ABU A;  3LA3 A;  2A07 F;  4BJT A;  1Y1V J;  5JVT A;  4MO7 A;  3ZGK A;  1H9G A;  3COA C;  3BC8 A;  4FAS D;  2RKH A;  3LA2 A;  1IRZ A;  1S29 A;  1HDD C;  5CKT A;  5DUI A;  4KMF A;  5KAF C;  1T0F A;  1R1V A;  2DU9 A;  1Y56 A;  2K7L A;  4KIF A;  1A6I A;  1G2H A;  3OYD A;  1ON1 A;  1Y1W J;  5JFR A;  1G3T A;  4ASN A;  3KYC B;  1F43 A;  4HV5 A;  1GXQ A;  1HCR A;  4JX6 A;  2X51 A;  1JTX A;  1XTA A;  2Y31 A;  5L3D A;  5CJ9 A;  3SFZ A;  1H88 C;  1X4P A;  1G3W A;  2QM3 A;  4CCO A;  1YRN A;  3AAF A;  2FQ4 A;  4Q4Z F;  1Y8R B;  2DO7 A;  5HLT A;  2HOA A;  2RQP A;  3ABT A;  4DZJ A;  2DFF A;  1F4K A;  3M4O J;  5DEQ A;  3GVA A;  3RQI A;  1VQK I;  1YHQ I;  1MMN A;  3QAH A;  3KEY A;  2PMZ N;  3H3Z A;  3G1M A;  4A3D J;  4LK0 F;  3OYK A;  2M5W A;  2KT0 A;  4EMS A;  3W2A A;  2FUG 2;  2V9V A;  3EET A;  3J7A O;  2L4A A;  1JHF A;  4F52 A;  2DBB A;  3LSJ A;  2ELK A;  3OS1 A;  4QPQ A;  4QTR A;  4BHB A;  1O7F A;  1EH7 A;  2G0E A;  3GCM A;  1JGS A;  2K4J A;  1YIJ I;  2GQQ A;  3HRU A;  3GFL A;  4OWR B;  1WQ2 A;  4NBQ A;  4P9F A;  1TT5 B;  2MC3 A;  1MJB A;  3EUH A;  2M7B A;  5E3L A;  2P0W A;  1T6S A;  1W4M A;  2N8G A;  2L7M P;  4EGY A;  1O3Q A;  1NK2 P;  4MTD A;  4BXX J;  4KNY A;  2VBY A;  4NC7 A;  5TGT A;  2GAU A;  1NH3 A;  4CYC A;  4RB1 A;  1D1A A;  2LKX A;  3RTR A;  4YFK F;  3AG2 H;  2J5P A;  1Q1H A;  2DOE A;  4HDV A;  4KIS A;  1SFK A;  3NQO A;  2IRF G;  2EFP A;  2EJR A;  1TW2 A;  3I4N J;  4C3I J;  3OYL A;  3HTS B;  4A3G J;  2HKO A;  2D1V A;  3I5U A;  3DV8 A;  1X2N A;  2VPR A;  3F72 A;  1S3J A;  4BXF A;  3OYF A;  3TED A;  2Z16 A;  5JHF A;  4HRI A;  1WJD A;  5EGO A;  2CQQ A;  1MMD A;  3BCB A;  4FTH A;  2EK5 A;  3RPQ A;  1IN6 A;  1BI3 A;  1WSU A;  1VQ8 I;  1TLH B;  1SMT A;  4IHV A;  2M3A A;  3BP8 A;  3B73 A;  2W82 A;  1MDM B;  2DPU A;  2STW A;  4A3F J;  2R7X A;  1IXR C;  4AIK A;  1WH5 A;  2O5R A;  3FMR A;  3OIQ A;  3OMY A;  4UVB A;  2VC1 A;  2LR8 A;  3MKL A;  4XN0 A;  4U0Y A;  2B9S A;  2NVX J;  2D2W A;  4X6A J;  2IVM A;  4PSW A;  5D6E A;  3ZQQ A;  1B72 A;  2GZW A;  4PGH A;  5ICC A;  3B6C A;  1D0Z A;  4E70 A;  1MNM C;  2O6G E;  3QPL A;  4A3B J;  3K2A A;  3NWS A;  4IVN A;  1ZGA A;  1I6X A;  4HQM A;  3ZRG A;  4DZP A;  2IS1 A;  3L09 A;  1I5Z A;  3ROU A;  3F9K A;  2RNG A;  1BI1 A;  1QQI A;  2FF4 A;  4G94 A;  4ZYH A;  4EJT A;  3O8G A;  2ECB A;  3ERE D;  3V7R A;  3CLQ A;  3TO7 A;  4XRS G;  2OCE A;  4HF0 A;  3SJM A;  2KP6 A;  2ACJ A;  3EUK L;  1YFH A;  1ZKG A;  1XSV A;  1TQI A;  1UST A;  2WV0 A;  2RC4 A;  2NVQ J;  4R79 A;  1IAW A;  2KLO A;  4A0Y A;  3HSR A;  1J7K A;  2IPQ X;  5HS8 A;  5LEK A;  3LSK A;  3HOU J;  2X48 A;  4BH9 A;  1ZG1 A;  4DQ2 A;  3E5U A;  5GTH C;  3HOS A;  1Z67 A;  3CJT B;  1XG1 A;  2P5K A;  2WY7 Q;  4CYD A;  3AL0 C;  2IA2 A;  2F4M B;  2UXN A;  2UZK A;  3S8P A;  3L00 A;  5GAH J;  1F9N A;  2LKS A;  3KX2 A;  1GV5 A;  5K5Q A;  3C7J A;  3HRT A;  3TDU C;  4R1H A;  1JUP A;  3F21 A;  4M9X A;  3ZN1 A;  4HNU A;  1FNN A;  2GIZ A;  1MH3 A;  3QYB A;  1D5Y A;  1R5G A;  1B8I A;  2BXZ A;  1M1E B;  3W6K B;  4RB2 C;  2OU2 A;  4RMN A;  2EIL H;  4LIV A;  1GLN A;  1CF7 A;  3ZCO A;  4BE1 A;  5M5X J;  3WTV C;  5K7F A;  1N75 A;  5HDG A;  5HVQ C;  3HM5 A;  3KP4 A;  4YFN F;  1O3R A;  3F8C A;  1J5Y A;  5KHD A;  3L7W A;  3DEU A;  1OMI A;  2D1H A;  2KL4 A;  3A4C A;  4DGW B;  1FT9 A;  2KMU A;  2LBF A;  5DYM A;  4B8X A;  3PO2 J;  1DU6 A;  3AL0 B;  2OC6 A;  4C3J J;  2LD5 A;  4XQF A;  2A3S A;  4JBA A;  2QQ9 A;  2O3F A;  5LBQ A;  5E1Z B;  4AIJ A;  3TQN A;  5F64 A;  4OMY A;  4AM3 A;  1WJ5 A;  2EFN A;  3MWM A;  2ELJ A;  3MD2 A;  3TO6 A;  2LVS A;  2OJE D;  3KPH A;  2WAE A;  3B6A A;  3CF5 F;  5LGT A;  4TV7 A;  5J47 A;  1AKH A;  2HQA A;  2W25 A;  1XMK A;  4XLA A;  2M0C A;  4B1R A;  5IP9 J;  1FLI A;  4CCK A;  3BJO A;  3ASN H;  3MFK A;  2R7F A;  5CQG A;  2H8W A;  1S7O A;  1Z91 A;  3NEU A;  1XDU A;  1NK3 P;  3E3V A;  4EM2 A;  3C18 A;  3K70 D;  1ZGW A;  2HQ5 A;  2FML A;  3WG7 H;  2M4G A;  1TQP A;  3MN2 A;  1H9T A;  3JRI A;  2ZNZ A;  3FXQ A;  2XGX A;  4CIC A;  4A5N A;  1Z7U A;  4E7J A;  2DA4 A;  2FJ1 A;  3FXL A;  3GZ5 A;  3A0H C;  4PFP A;  3LQR A;  5FRN A;  1FMW A;  4PSX A;  4CCL A;  1W0T A;  1VTN C;  3HOZ J;  2ELH A;  3LL7 A;  4ENN A;  4HG2 A;  3HDD A;  1BBY A;  5LRR A;  1VFC A;  1O57 A;  3MQ0 A;  2A5Y B;  3BPV A;  4DNC A;  1D0X A;  3K70 C;  2QQ8 A;  4FQG A;  4IHS A;  2LRD A;  5DV5 A;  3LNQ A;  3Q0V A;  1LFB A;  1IRF A;  1ETK A;  2O8X A;  2H1K A;  4HX7 A;  1HKT A;  2NXN B;  4KA4 A;  4BDY A;  2HOT A;  1S9H A;  3GLX A;  2GOX B;  3ZQH A;  2W84 A;  2V7F A;  2H94 A;  1Z3X A;  1ZHF A;  1VZ0 A;  3C2G A;  1X4O A;  3BTL A;  3CMY A;  4ZH4 F;  1TWA J;  4LB5 A;  2QKL B;  2COB A;  4BJ5 C;  3VYR B;  5DM7 F;  3NWT A;  2VJJ A;  1DU0 A;  2BW3 A;  1QNT A;  2E1M C;  2Y0S A;  3TKY A;  2HKX A;  1YS6 A;  2CUF A;  2QSH X;  3QOP A;  1B9N A;  4I98 B;  2XAJ A;  4S04 A;  5F6F A;  3RKW A;  3C1D A;  2MC4 A;  3J7Y J;  3GYH X;  2R5Z A;  2A5W A;  3ECO A;  1KYZ A;  4XL9 A;  3S3O A;  1YLF A;  2PI0 A;  2M87 A;  5E1X A;  3LAJ A;  2VT3 A;  1MBK A;  3ABL H;  3IUO A;  4BQA A;  5CVI A;  2CUE A;  1FP1 D;  1HKQ A;  2IBD A;  2K9L A;  2HOS A;  1IUY A;  2ZME A;  4AU7 A;  3KZZ A;  4OOI A;  3H5N A;  2L7K A;  4FE7 A;  3F8N A;  3BJ6 A;  4II2 A;  3FHZ A;  2XF7 A;  2LOO A;  3CF2 A;  4N0B A;  3CCS I;  2MH2 A;  4ESB A;  3GTK J;  4XNF A;  4LG3 A;  1BJA A;  4XMY A;  3BG3 A;  4MNU A;  1I6H J;  4KIC A;  1VQ5 I;  3U1D A;  3DU5 A;  3P7N A;  3FXK A;  1ZLK A;  1IJW C;  1ETX A;  4CUG A;  3K10 A;  3HUG B;  1KGS A;  5D6F A;  4A0X A;  2RAE A;  1T98 A;  1TP4 A;  3DLL F;  1MZB A;  3HXL A;  2R5Y B;  2R0Q C;  5J4Y A;  3WTX C;  1R7J A;  3K4L A;  4DBQ A;  4A6E A;  2HI3 A;  3S1R J;  2E1O A;  3RQ4 A;  2AXL A;  3TOA A;  3Q3S A;  4N9I A;  4IQJ A;  1RZ4 A;  4M3B A;  2DCE A;  1VND A;  3OR2 C;  3VSL A;  3RDI A;  4AVZ A;  4IZZ A;  3O2P E;  2ME0 A;  4EJU A;  4V2F A;  1FPQ A;  3HB9 A;  2G7H A;  1ULY A;  4NQW A;  3GF2 A;  1YX3 A;  4ENJ A;  4QLC U;  2MGQ A;  3A1Y A;  5E18 F;  2EIM H;  3GBG A;  3DCF A;  1MND A;  2RVC A;  3HHG A;  1BM9 A;  1E2X A;  2XAG A;  2NVU B;  2YX4 A;  2NS8 A;  3FXU A;  4RAZ A;  2CO5 A;  3O3K A;  2EA4 A;  4PZJ A;  2EFO A;  1Z6T A;  5FLX Z;  3SFI A;  2DT6 A;  1OKR A;  4BY7 J;  1TW3 A;  2BY0 A;  2VB6 A;  2XF6 A;  4IQ4 A;  1LQ1 A;  2DMT A;  2ZJP F;  3FMQ A;  2M2E A;  2K3P A;  4MIM A;  4XLC A;  2FRH A;  4P55 A;  4OIP F;  1KQ8 A;  1X58 A;  4RAF A;  4LFU A;  3J81 K;  2IJL A;  5FKN A;  4D5F A;  2R92 J;  1LDK B;  1OIS A;  1GHC A;  2XPW A;  3QYF A;  2UXX A;  3ZQ7 A;  2HQN A;  4H0E A;  4UY8 I;  1FWZ A;  2XB0 X;  2L54 A;  1ZG5 A;  1XC5 A;  3DKW A;  4IHY A;  4M3D A;  1UFM A;  3K4N A;  4UVC A;  2HFH A;  1RUO A;  1HW5 A;  3EUH C;  5HS9 A;  5LHH A;  1LFU P;  3PQJ A;  2F2E A;  2HTJ A;  2VKH A;  3F8B A;  3R0A A;  4KMU X;  3CO7 C;  4EJW A;  1K7A A;  3HG9 A;  1W1W E;  4A0Z A;  1YRN B;  2XC7 A;  1XSX A;  3AFH A;  1V5G A;  2V4J C;  2DK8 A;  1POG A;  2DMQ A;  2KFD A;  4ESJ A;  4S0H B;  1V5E A;  2EWN A;  2NNY A;  2OQR A;  2A68 F;  3RCO A;  5JR3 A;  2VOD A;  1ETY A;  3E0J B;  4ZTF A;  3FXR A;  2DFI A;  1T39 A;  2EPF A;  3F6O A;  2ESN A;  2EFQ A;  1ERD A;  1EV7 A;  2WB1 N;  3RKY A;  4DBR A;  3AG1 H;  4W97 A;  2XPU A;  3LSI A;  3LSP A;  2X1D A;  1BOB A;  2EIN H;  1JI8 A;  2VOO A;  1KU9 A;  2E19 A;  3KLO A;  1G59 A;  5L3C A;  2Q0O A;  1ZRF A;  5FB2 A;  1GV2 A;  4C30 A;  1APL C;  3SZP A;  2QF7 A;  1R5H A;  2L4M A;  1QHH D;  4HOB A;  4RB3 C;  1I1S A;  5ILV A;  1Z6R A;  4BQQ A;  1X2M A;  3GTP J;  1AOY A;  3CCM I;  3N05 A;  4XM3 A;  2VC0 A;  2I5U A;  1Z7L A;  2PN6 A;  2HS5 A;  3S32 A;  3TDZ C;  4CYC B;  1U5T C;  4H4K C;  5E3N A;  3MCZ A;  2M8E A;  1VQN I;  3IAS 2;  3DBL B;  4QPO A;  1IRX A;  2NS0 A;  3ESW B;  2K9N A;  3FXJ A;  2X6W A;  3GZ6 A;  4J00 A;  2HQR A;  2QSF X;  3VYT B;  2DYR H;  3V42 A;  2JPB A;  3J7A Y;  2DAO A;  4BQO A;  3M1C A;  3S16 J;  2LP0 A;  3LWF A;  2W57 A;  2WA0 A;  5IT9 K;  2V1N A;  4UUV A;  2X85 A;  1IDY A;  3K0L A;  5K1Y A;  3G1L A;  3TMO A;  3MMY B;  2LK2 A;  5EGO B;  1D3Y A;  3I58 A;  3WGG A;  1REP C;  2LNB A;  4XSX F;  3ZPL A;  4AYB A;  2OZU A;  4N9H A;  4OIN F;  1XCB A;  3G71 I;  1WH7 A;  2ZJQ F;  4JP0 A;  2ICW G;  4ZDL A;  1P4W A;  5IT3 A;  3IAM 2;  1OCP A;  3QWL A;  3G73 A;  4O6J A;  1YE9 A;  2EZL A;  4C2M J;  2G9W A;  2ID6 A;  1Y0U A;  2K4B A;  4RM3 A;  1P2F A;  2MBF A;  5CVR A;  2BGC A;  4GFB A;  1MKM A;  2WAQ N;  3KZY A;  3BDD A;  2R7S A;  3J80 Z;  1H8A C;  3ZQG A;  5TRD A;  3PQK A;  2JMW A;  1B72 B;  3BZC A;  3DBR B;  5M5W J;  2QEN A;  1E3P A;  4BL0 B;  3IKT A;  4PK4 A;  1OCR H;  3FZV A;  5DD4 A;  3RI4 A;  3CO6 C;  4BAY A;  2NOJ B;  1O7L A;  4KJZ A;  2O03 A;  3V8J A;  2R7D A;  1W36 D;  1S8N A;  1N77 A;  1BIB A;  4ZZL A;  2FMY A;  2M30 A;  5LHI A;  3HOT A;  3FWE A;  4V2G A;  2DW4 A;  4PDK A;  2HNH A;  1WJA A;  2ZCW A;  4IRG A;  1Q1V A;  2M8G X;  4ZZD A;  3VEP A;  1S5L C;  4IOA F;  5FKL A;  2B0L A;  4UNO A;  1YG2 A;  2OA4 A;  4ZTJ A;  2RNJ A;  3I4P A;  5HNH A;  4OIO F;  3ZMT A;  2HDD A;  3FKI J;  2P7V B;  1MMA A;  5JHU A;  3T0Y A;  1WVR A;  1ZGJ A;  4XSZ F;  1BR2 A;  3LSH A;  1BIA A;  1X1A A;  2L01 A;  3JAM Z;  3NAU A;  3CJQ B;  1JUM A;  4P1W A;  4BDZ A;  1FOY A;  3GEZ A;  2K5C A;  4N4O B;  4G12 A;  2BY2 A;  2E7X A;  3G1O A;  4IPA A;  3T5X A;  4DW6 A;  3CDI A;  1D8K A;  4FCY A;  1B8I B;  4AID A;  1UHW A;  3S3N A;  4NUB A;  2A6H F;  3E5X A;  1P4X A;  3DWL E;  4OAY A;  3JRD A;  4N4N B;  2NVY J;  1X3U A;  1CF7 B;  1TZL A;  4M9Z A;  4RGR A;  1YIT I;  2CW8 A;  1Z3Y A;  2XRL A;  3ZMZ A;  1RRJ A;  4C2T A;  3BG6 A;  3IL2 A;  4XN3 A;  1X19 A;  3K1M A;  3TW7 A;  2PJP A;  3LSM A;  3JRG A;  3UKG A;  2YU3 A;  3I64 A;  3VOD A;  5D8K B;  1QZE A;  3M07 A;  2CFX A;  3HHH A;  4BEH A;  3BTC A;  2LYC A;  2JA2 A;  3CP2 A;  1BW6 A;  3HEF A;  2P7C B;  2VPL A;  4RA2 A;  1LB2 A;  1PUF A;  4I0A A;  4D5C A;  3SDB A;  3AG3 H;  2H6B A;  2ZC2 A;  3H5R A;  2LBF B;  1FYK A;  3WOD F;  1JGG A;  1IC8 A;  2ISZ A;  3RZO J;  2XSD C;  4QSH A;  1IUF A;  1FIP A;  1QHG A;  1WWX A;  3E6D A;  5EJC A;  5F1J A;  2YPR A;  4JQF A;  3FXM A;  2XKO A;  2Z3Y A;  2DA1 A;  2PMH A;  2Y30 A;  1LKX A;  3FX3 A;  4IF4 A;  3K4B A;  2DOA A;  5IY5 H;  3RYP A;  4I2O A;  2AHQ A;  1WI9 A;  5DCM A;  1H0M A;  2F5E A;  4MLO A;  1OFC X;  3A03 A;  2EZH A;  2GA1 A;  1IN4 A;  2TCT A;  3CQZ J;  5FLM J;  1AKH B;  1RI7 A;  2WC2 A;  1TQM A;  1SC7 A;  2ADU A;  4E7Z A;  3OOU A;  1AA7 A;  3OYM A;  2LY2 A;  3TBI A;  2P81 A;  2XIG A;  2EV6 A;  3FK6 A;  5CQE A;  2DOF A;  2QYO A;  3LMM A;  1E0E A;  3HTU A;  1ZQ3 P;  2DJI A;  5HOO A;  3F6V A;  3QYE A;  1DP7 P;  3EPZ A;  3H92 A;  2W85 A;  3CUQ C;  1T56 A;  2NNN A;  2NS7 A;  1QO0 D;  3FXO A;  1MMS A;  3S14 J;  3O8H A;  1LE8 A;  5CVU A;  5J1Y A;  2JA7 J;  1SD5 A;  1T8I A;  1SAN A;  3KP6 A;  1DQU A;  5ILU A;  1W7P D;  3A01 A;  2CQK A;  5B66 C;  1V5F A;  2CU7 A;  1RR8 C;  4CSW A;  4XIC A;  3KLN A;  2L0K A;  2YR2 A;  5EG0 A;  2H6C A;  3MKY B;  3IV5 A;  1QPI A;  4CCJ A;  1O4X A;  1G3Y A;  1ODD A;  1J59 A;  2L9V A;  3M9A A;  5GAE J;  2V1X A;  3SHF A;  3CCJ I;  5D5W B;  2KZG A;  4XLP F;  3BZ6 A;  3HRS A;  3WE2 A;  3OIO A;  1U5T A;  2ZME C;  3H9J A;  4KIT B;  3ZMU A;  2EIK H;  3FKJ A;  1QGP A;  5FJ8 J;  4RM2 A;  3J7Z I;  2LRE A;  5CLS A;  3RKX A;  1FZP B;  2BW3 B;  3I56 I;  4OIQ F;  3DQV C;  1I27 A;  2V1D A;  1D0Y A;  2XAF A;  4FIS A;  2VLA A;  5E1W A;  5HDK A;  5BPI A;  3GXO A;  1A5J A;  2YSR A;  2CV1 A;  2ECC A;  1RUN A;  2LH9 A;  2P6S A;  2R5Z B;  2XDV A;  2EQR A;  3PNY A;  3ISP A;  1Z05 A;  3WGI A;  1EH8 A;  1FSH A;  1JUS A;  1K4T A;  1YJN I;  2FE3 A;  3W2W A;  2M1B A;  2FEZ A;  3KP5 A;  2GLO A;  3RJP A;  1KU3 A;  3HC7 A;  4YEJ A;  3Q9V A;  2IW5 A;  2ZME B;  4RAG A;  3WU0 A;  1QBJ A;  4RB0 A;  1LEB A;  2UUZ A;  3ZXS A;  3LSR A;  4HNV A;  2RQQ A;  3M8J A;  1ZK8 A;  3R4K A;  4XID A;  3BZK A;  3FBI B;  1EKE A;  5L3F A;  2XF5 A;  1MSE C;  2R3S A;  2BVL A;  3GX4 X;  4KN7 X;  3K2Z A;  2AQE A;  3BQZ A;  5J8C A;  4D7N A;  2Z33 A;  2W24 A;  2CJJ A;  3ML6 A;  2FNP A;  1R00 A;  2CUZ A;  1P7I A;  2PFB A;  1KA8 A;  3WTU C;  2QBY A;  4A3C J;  1GUU A;  1JJ8 C;  1P6R A;  3BCA A;  3QU3 A;  2DA5 A;  1BN5 A;  1ETW A;  3OL3 A;  1DGW Y;  1YIO A;  1VQM I;  2QZ8 A;  3I4M J;  4JK1 X;  3DPL C;  3IH2 A;  2JK3 A; 
#chains in the Genus database with same CATH homology
 1S72 I;  2K3F A;  3CCS I;  3CF5 F;  3CMA I;  5GAG J;  1VQ5 I;  2H8W A;  5DM6 F;  2OTL I;  3PIP F;  3DLL F;  1VQK I;  5GAE J;  3CCJ I;  1YHQ I;  2FOW A;  5GAD J;  3CCR I;  1FOY A;  3CCM I;  3G4S I;  1Y39 A;  1QA6 A;  3CCQ I;  4IO9 F;  2E36 A;  3CCU I;  3PIO F;  1VQN I;  2E34 A;  2QA4 I;  3J7Z I;  1VQ7 I;  1YIT I;  1YJ9 I;  4V19 K;  1VQO I;  3I56 I;  1YIJ I;  3CJT B;  1FOX A;  2ZJR F;  5GAH J;  1HC8 A;  5JVG F;  2NXN B;  3CME I;  1FOW A;  2ZJP F;  3I55 I;  2QEX I;  3G71 I;  1YJN I;  3CCE I;  2ZJQ F;  3CC2 I;  3CCL I;  5DM7 F;  1VQL I;  1VQP I;  1VQ4 I;  4UY8 I;  2OTJ I;  2E35 A;  2JQ7 A;  1ACI A;  3J7Y J;  1VQ6 I;  1YI2 I;  1VQ8 I;  3CC4 I;  3CCV I;  1YJW I;  3CD6 I;  3G6E I;  4IOC F;  3CC7 I;  1VQ9 I;  1VQM I;  1MMS A;  4IOA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...