1FOWA

Nmr structure of l11-c76, the c-terminal domain of 50s ribosomal protein l11, minimized average structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L11-C76
publication title High resolution solution structure of ribosomal protein L11-C76, a helical protein with a flexible loop that becomes structured upon binding to RNA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ribosomal protein
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1996-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1fowA00
2QEXI 1VQKI 4IOAF 1YITI 1VQNI 3CC7I 2K3FA 2ZJPF 3I56I 3CCQI 2H8WA 1YI2I 5GAGJ 3G6EI 1VQ4I 3PIOF 5GADJ 3G4SI 3PIPF 1VQPI 1VQOI 4V19K 2QA4I 3CCLI 3G71I 1YJNI 3CCEI 2JQ7A 2ZJRF 5JVGF 3DLLF 1VQ5I 3CMAI 1YJWI 3CCMI 3CCJI 2OTLI 1VQ6I 4UY8I 4IO9F 1YHQI 3CC2I 3CCVI 5GAEJ 3CD6I 1S72I 1ACIA 1VQ7I 1FOXA 3CJTB 3CCUI 1MMSA 1YJ9I 2E35A 1QA6A 3CC4I 1FOYA 1VQMI 3J7YJ 3CF5F 5DM7F 5GAHJ 1Y39A 3CMEI 2E36A 2OTJI 2NXNB 1HC8A 1FOWA 5DM6F 1VQ8I 2ZJQF 1YIJI 4IOCF 2E34A 1VQLI 3I55I 2FOWA 1VQ9I 3CCRI 3J7ZI 3CCSI
chains in the Genus database with same CATH superfamily
2R7SA 1JUMA 2F5FA 1OCRH 4FT8A 3T0YA 3S1MJ 1K78B 4C2MJ 3V4GA 2JTVA 2VBXA 3PL8A 3QRFF 2Z16A 1ZH5A 5FKNA 1P92A 1S9HA 3ZCOA 4HF1A 1J2XA 1O7FA 3TL4X 2PMZA 3WU2C 2GIZA 3HBLA 4S0HB 3H3ZA 4RMNA 5F1RA 3OIOA 3KP5A 4BHPA 3HTSB 2XSJC 3DBHB 1OCCH 5IYBJ 3GZ6A 1W7PA 4KICA 1IRFA 2LKXA 3ELKA 3CMYA 1LVAA 1D5YA 2X48A 3PNYA 3RDIA 3S1RJ 1WH5A 1OCPA 2CUEA 3IRRA 1OMIA 2V1UA 1V3FA 1ZQ3P 2YX4A 1MNMC 3HYIA 2L3DA 1R5GA 2VOOA 4D7NA 4DBRA 3GZ5A 3CP8A 3OMYA 2HS5A 2CWEA 4ESFA 2JA2A 1YLFA 4R1HA 4A6DA 1WCMJ 2XC7A 2TCTA 3BWGA 3R0JA 2KDOA 4CYCA 1MBHA 5C44J 2HOSA 3CMAI 4GYGA 3GTOJ 2KJBA 4IEJA 1DPUA 3W6VA 3CCJI 1FBSA 3E6MA 1ZTRA 3WTZA 5D8LB 2W84A 3NQOA 3M1CA 3K6GA 2HGCA 5CYVA 3ZR8X 4MQVA 2G7UA 1P7JA 3M8EA 2F2EA 3I4MJ 5LGNA 5CVVA 2X1CA 3AG2H 3F8FA 3KLNA 2X6YA 5ILVA 1XDUA 1J5YA 2CW8A 5HNFA 1RRJA 1LDKB 5DD4A 3QYFA 4AIKA 4DYQA 3MD2A 5DCMA 4YFXF 2FD5A 5ILUA 2VQGA 3PSFA 2E7WA 1WJEA 2LRDA 3L9FA 4BDYA 1Z0XA 1P2FA 1XSDA 1PDNC 1PYVA 3BC8A 1VQMI 1H0MA 5E79C 2RC4A 1MNEA 1R5HA 4LFUA 1LE8A 2LBFA 2N8GA 1U78A 1ZR4A 1Y0UA 5LHGA 5DM7F 2L2OA 2V1XA 4IPAA 4MTDA 3FHNA 4CH7A 3VYRB 1QHGA 3JRIA 2BY1A 2LNBA 3MN2A 2X85A 3HKZN 5F0FA 1JKRC 1I5ZA 1DP3A 2XDVA 1WJ5A 1YIJI 1KU7A 4RAGA 2X1EA 4G9YA 1I6HJ 1SMTA 2CG4A 4DZPA 1B4AA 4ZTJA 3ZQCA 3FM5A 1ZGJA 5FLXZ 2GM4A 5K5OA 5KVRA 3WG9A 2DYRH 2XPVA 4AIHA 2D1VA 3H0GJ 4AIDA 4ZYAA 3L2QA 1JUSA 3J7AY 1S7EA 1VQKI 1WKMA 2A5YB 1BJZA 4DOZA 3NWSA 4RB0A 4BE1A 2HR3A 1WHUA 2RV8A 3DKYA 3HZJA 2F4OB 2FA5A 3D5SC 4XRFA 3CCQI 1ETYA 2XB5A 4L9JA 3PNTA 1Z1DA 3VB2A 2KJCA 3K1PA 4B3AA 3P5JA 3G4SI 2F4IA 5EJCA 3SDGA 3IWFA 3TP3A 2D45A 1G3YA 5JHUA 3PUFA 5F6FA 4OIOF 4RGRA 2AO9A 1HW5A 5BPIA 2W82A 1X19A 1Z21A 4FISA 4MEXF 2KZGA 3IKVA 4M3DA 3W2WA 2ACJA 3FKIJ 2ELKA 4CZCA 5D8KB 4OIRF 4AD9A 4BXUA 3F23A 2OAZA 3MQ0A 1K6OA 2JQ7A 1IXSB 3KEOA 4FE4A 4NC6A 4CO8A 3J81Z 3HUGA 2E2JJ 1FSHA 4JYKA 1XGSA 4AYBA 3EDPA 1R1TA 1Z7LA 2ZXWH 2XPUA 4PUSA 2R3SA 1I6XA 1K7AA 1FIAA 1JKPC 3MKYB 2H1KA 3S3OA 1TNTA 1YX3A 4HDVA 2P6TA 1CGPA 2GXGA 2QGUA 1AU7A 2DODA 3OYHA 2M8GX 3HOXJ 2JJ7A 5M3FJ 1JE8A 2HTJA 2HTSA 5KAFC 1R7JA 2EFOA 2V9PA 3OYKA 3HDDA 4RB2C 3CTAA 3DKWA 3FISA 2IPQX 4LD5A 2HPMA 1YTYA 4PJ0C 1XGNA 4EJVA 3S93A 2R7DA 4A3BJ 1F43A 3DV8A 4XQFA 1HA8A 2A3SA 2L9RA 2ID3A 4XM3A 2M8EA 3SFZA 5E18F 4A3LJ 2HPIA 3IH4A 2OV7A 4M3BA 1NTCA 2WWYA 1WPKA 5E8GA 4IKFA 2HQNA 1SVMA 1KYZA 5AIPA 1OFCX 4ETSA 5FD6A 3MAJA 1W7PD 2CV1A 3OS1A 3WHCA 4OIQF 4LG0B 2EIJH 3EYIA 2R7UA 1P9QC 5FO5A 3OSGA 3LSTA 3I54A 4N9IA 4A0YA 1SFEA 2YS9A 4HEA2 2ZFWA 4LB6B 2KL4A 1D1CA 4BGDA 3RPQA 3GWZA 1CQTA 3V8KA 2MW8A 3HSEA 1DUXC 1QVTA 3T5XA 4BQNA 5HVQC 5HS8A 2F4MB 2HXOA 4IOAF 1SANA 2K9SA 2OC6A 3DEUA 2OBPA 2LKPA 2QQ9A 3I56I 1TWHJ 4KMFA 4EJWA 2EV0A 4FQGA 3GLXA 3JW4A 4JBAA 1GXQA 3BTLA 4YFNF 5ICCA 2LP0A 2XRLA 1EV7A 3RPUA 1R9TJ 1MDMA 4G94A 2L5QA 2PFBA 3SYTA 1F5TA 5IT9K 1O3RA 1LDJA 1V5EA 3KE2A 1MBGA 3Q0VA 3QU6A 4HSTA 4P1WA 2QA4I 3HB9A 1J0RA 3IV5A 3MMYB 2KRCA 1S8NA 3E0JB 4I09A 4I01A 1KGSA 3BTJA 3QQAA 1FLIA 4A2UA 2X51A 4PK4A 2R7OA 4GXOA 1ZKGA 2DFFA 2ESNA 3K2ZA 5J3LA 5J4VA 1J75A 4KA4A 3MVPA 2WB1N 1TT0A 1XGOA 2MGQA 4UXNA 1R49A 2JRTA 4A93J 2M5WA 4FETA 2ZNYA 2X0LA 2EFWA 2VKEA 1Z9CA 3TW7A 3CJTB 4Y7NJ 5DD8A 1UG2A 4WCGA 2C6YA 5L3EA 2OUMA 3ECOA 4TV7A 4Q4ZF 3HXLA 4B48A 4O3MA 1GUUA 3RI4A 2K40A 3I71A 4QPOA 2HOAA 4YIFA 2GIVA 1JI8A 5GPCA 4DW6A 4HNVA 4I0BA 2O03A 2FQ3A 1LEBA 4XOTA 1HSTA 2ADUA 4O5VA 3HRMA 3RZOJ 5IOZA 2NXNB 3BZCA 3KEQA 2VONA 5D5VB 2VPRA 3PSIA 2XAFA 1GHCA 3BPXA 2P7CB 2KHMA 4BQQA 1HF0A 2OCCH 5L3GA 1H89C 2R5YB 3DEWA 1XG1A 5F0HA 4II3A 2WAFA 2HQAA 4IQJA 2LDUA 2A68F 1BR4A 1VQ9I 2FMYA 3SZGA 2CV0A 1J7KA 2M7AA 3FXUA 4IZZA 4GRIA 3ZP5A 1ETQA 4B43A 4I6ZA 2X1DA 1O3TA 2VI6A 1O7LA 2WAEA 4BBRJ 1TWGJ 2JWTA 1MH3A 1K61A 2LTPA 1XMKA 2WTEA 5EEHA 1OPCA 5E3OA 2E60A 3E3VA 2E2IJ 2ZB9A 2EINH 4I0AA 4L5JA 2DFHA 1PP7U 5E8IA 4EGZA 1H88C 5E1XA 3SEZA 3CDLA 1U5TA 3ML6A 1HKSA 2HI3A 3DQVC 2DW4A 3O6BB 3CJRB 4Q48A 2JA7J 3HOYJ 1LUJB 2EV6A 3A0HC 3E97A 1R5ID 2O6GE 3GF2A 4BQOA 1NH3A 4ZYGA 1RPWA 3HSFA 1SFUA 1LFUP 1GV2A 1TWFJ 4RB3C 3W6KB 3AFHA 3LSJA 3BR0A 3IH3A 3PQJA 1K4TA 1Z3XA 3RQ4A 3GTLJ 2VUMJ 4LMYA 3PO2J 3CCEI 5FRNA 4AUXA 1T08B 1R36A 2BHZA 2KRHA 5DEQA 4NNJA 1SD7A 3E6CC 2E5NA 2NNYA 1X3UA 3FXJA 2XVCA 4A3DJ 3RKYA 2KRFA 1R22A 3OV8A 3S2HJ 4XN0A 3L1PA 1BL0A 2IVMA 2E2HJ 4D5FA 3MEXA 3V8LA 2M1BA 2B9SA 2EFNA 4DQ2A 4DYCA 1BI1A 4A5NA 3W6JB 3HRSA 3OWTA 5BMZA 2OU2A 5IYDJ 1JHFA 2E35A 2VIXA 1D0XA 3F8BA 1T6SA 1Z05A 2E7XA 1HW1A 2L54A 3C7JA 1FTTA 3H5NA 4ENNA 4O6JA 2XGDA 1MJ9A 1RUOA 2R93J 1T98A 2DO7A 4UV9A 1A6QA 1WZ2A 4LB5A 4BEHA 1YOVB 3WTXC 3BDDA 1R4MB 4ZDOA 4AM3A 1ONVA 4WXDA 1TC3C 1Y8QB 3FK7A 1KA8A 3RPUD 2R92J 3Q9VA 2BW3A 5D5UB 1BIBA 2OD5A 3J81K 3LOCA 3S14J 4U87A 3HM5A 2QF7A 2VLAA 1ZR2A 2E1OA 4A6EA 4WX9A 2K4BA 3OR1C 4K2EA 5K7FA 1HBXG 4NHJA 1BA5A 4IHYA 1U9OA 1MSFC 2QBYB 5EG0B 5K5QA 2H27A 3ABLH 2G7HA 3WGHA 1Q1VA 2NAZA 4BJ5C 4EVIA 4HLXA 1AWCA 2Z5UA 3E5QA 4E7IA 1K78A 4HX8A 1LPQA 2BHYA 3ABTA 4ZYEA 4G6QA 3SFIA 3BJAA 4AVZA 5KK1A 2UV1A 2DOFA 2QWWA 3R0AA 5L3DA 4D5CA 4UV8A 5DUKA 3OY9A 3EUHA 3DLAA 1K4SA 1Z67A 4MO7A 2ESHA 3CCYA 2LY1A 2MFZA 3BCBA 2LF7A 2WBMA 4E7ZA 1TBXA 1IZ1A 5LFAA 2E1MC 1X1DA 5K5RA 2M7BA 3W2AA 1MKMA 2K3PA 1D1AA 2PN6A 3BTCA 4Z2YA 5LEJA 2NVUB 4IHVA 3BG7A 3BTIA 4G6TB 5ERIA 5BNGA 3OYAA 3DLLF 3BQYA 3PO3J 3CDIA 1Z3YA 1XDSA 1W36D 2QSHX 3GVAA 3A03A 2EZIA 4YEJA 2Q8KA 3CCMI 3I9V2 1EA3A 3CUOA 2KLOA 2VC0A 1TP4A 4PJLA 5F27A 2CQNA 5EDNA 4YFKF 3BQZA 4LIUA 2V9VA 1T56A 3GUDA 1OKRA 2WA0A 5IYCJ 1EH6A 5EZHA 5HDGA 4LLLA 2E1CA 2R0QC 4BU2A 5LHHA 3VPRA 3GTGJ 1QZZA 3E5UA 4ON0A 2VASA 3FXOA 3H3UA 4P9FA 2NNNA 3REOA 1OISA 1R1UA 2P6SA 2PQ8A 3HRUA 3L2CA 4PGHA 4J01A 4RLFA 4LK0F 3OYJA 3ROUA 4BJ6C 2L02A 3NARA 5J8CA 2Z1DA 1OYIA 3F0CA 3MZYA 3WU1B 4S04A 1Z7UA 1IF1A 1L3LA 1ZG5A 5FGMA 3HIFA 3TDUC 3N4MA 1NK2P 3TW6A 1R23A 4I2OA 3ERED 2VJIA 4KIFA 5CQGA 2LD5A 4MGRA 3TQNA 4YRVA 2XKOA 1EJ9A 2FRHA 3KFWX 5F04A 4IVNA 4C2UA 5H2FC 1OR7A 1LVKA 3BR5A 1IG7A 2EV5A 4A3MJ 5LD2C 2K3FA 3LSIA 1R6RA 2ISZA 1ON2A 2DOAA 5J4YA 3FXLA 1W5SA 1D0YA 3ZQFA 2ZKZA 3KZYA 4L0YB 3A4CA 3JSPA 2PG4A 1FT9A 1HKQA 2JZYA 1Y8RB 2QQ8A 1JJ8C 4KN4X 5ED4A 1BBYA 1UELB 2NS7A 3KX2A 5KCMA 3HL2A 3P9CA 4AWXB 4UHTA 4ESJA 2Y0MA 1YFHA 1OJLA 1BC7C 2JA8J 1HOMA 2FBKA 5B5EC 2OQGA 3PIPF 4XOPA 1JT6A 3M07A 3KPHA 1VQOI 1G3SA 1TZLA 2VN2A 3JSOA 3BOQA 3LSMA 1WFXA 3BPVA 1SVLA 1JUPA 2PMUA 1QNTA 3CCLI 2CRGA 4LOCA 1FYKA 4MEYF 3K70D 4EJTA 1I3QJ 5LGUA 3QYEA 5CJ9A 4FE7A 5D4SA 2P0WA 2B7EA 5KNLA 4OU0A 3IAS2 4HNUA 3E5XA 1MJBA 1VTNC 2DMQA 4FTHA 1BIAA 3HEFA 2TDXA 3I53A 1X4PA 4P96A 2XAJA 3MCZA 1SD4A 2DA5A 2PMHA 4CUGA 3CUQB 4KMUX 3D0SA 1IO2A 1YX5A 1ZREA 3SZTA 1YS7A 2DT7B 2Y2ZA 3IL2A 3DTEA 3HPGA 4HV5A 3S32A 3WU0A 4RGUA 2HVQA 3M9AA 1F36A 2IBDA 3DPUA 2LY9A 2AXLA 4H4KC 1W36C 2FOKA 1MBEA 2XB0X 3KP2A 2RNJA 2XAHA 3DU5A 1FSEA 2AS5F 4XN3A 4CGZA 2IS4A 2OA4A 2FMLA 3ZMUA 2VQHA 3JR9A 2M2EA 3GTJJ 1FNNA 3K10A 1WH7A 1HW2A 2LC2A 4IRHA 5D5XB 1SC7A 4NBQA 5F1JA 1GDTA 3JRAA 1SFKA 2XKPA 2OTJI 4M3FA 3ISPA 2HDWA 3SJMA 2R7ZJ 1D5VA 1ULYA 3BR3A 1B1BA 3IUOA 3RKWA 2KFDA 1OCTC 3ZXSA 3GYHX 2R4GA 3H9QA 4LG0A 3F8CA 1Y0NA 3D5RC 2E34A 2OF7A 3OS0A 1ETWA 3P9IA 2ZC2A 4DZJA 2ELHA 4M74A 3FXQA 4M9XA 3ZOBA 2HFHA 4IJAA 3RJPA 1U5TC 1UB9A 1XD7A 3BZ6A 5CKTA 2DU9A 5JFRA 4EEFG 1DGWY 2VT3A 3L7WA 5ICEA 4R8HA 3U9GA 2K4JA 4D0PA 5J6XA 1TQMA 3KZIC 1WJAA 1V5FA 2DOEA 3KYCB 5LHIA 4PJJA 3LAJA 5E1WA 3GTPJ 4MQ9F 3PIOF 4Y15A 3WTTC 4NC7A 2ME6A 5B66C 1MJAA 2QCOA 4B3XA 4B4CA 2LVSA 2DFEA 5E3NA 1VQPI 1X1PA 1TNSA 2DMPA 4BDZA 5LBQA 4E7SA 4EM0B 4OOIA 3H36A 1N77A 4GYIA 2BY2A 2Y0SN 2F5DA 3L00A 4BUPA 2RQQA 2TRTA 2MLGA 2VBYA 1GLNA 3SHFA 3TOAA 3HG9A 4H0EA 1WJCA 4WWCA 3FXMA 4L9TA 3HTUA 3JRDA 1MSEC 3HOSA 2DBBA 1ZRCA 1VQ5I 2OPTA 2E5ZA 1VZ0A 2EFPA 2ZXJA 1YQAA 1YHQI 5JI6A 1OYWA 2F5EA 3HC7A 5KAIC 1V5GA 2HKXA 2DQLA 2HVRA 4X6AJ 4BY7J 4UNOA 4I98B 3SQNA 1Z6RA 4M3GA 4A3KJ 1ACIA 3K70C 1G4DA 2R7XA 5LGTA 1OLTA 2O8XA 3HGYA 4FHTA 3TGNA 1HDDC 4CCMA 3CJNA 1ZG1A 3TOBA 3S16J 1WVRA 2LREA 2PJPA 3VWBA 2L0KA 2V1NA 1IRXA 2ZMEC 3I4PA 1GT0C 4AC0A 1IN5A 1FP1D 1MNDA 2O5RA 1REPC 2LLKA 2CUFA 3BR6A 3SEQA 3ZQHA 2FUG2 4HQEA 1Y1WJ 3SZPA 4NUBA 1SEUA 1RR8C 3MZ8A 1POGA 5IP9J 3OL4A 4B44A 1RUNA 4A12A 1ITYA 1RC9A 2L01A 2XV4S 1HC8A 2BOLA 3K4NA 2KMUA 4HQMA 5TJJA 1P4AA 3TMOA 4ABZA 1HLVA 2LSOA 1ODDA 2VPLA 2CS3A 2CQKA 4HW0A 2Q0OA 3KETA 3OYNA 2R5YA 3FF5A 3IWZA 5TRDA 2FJ1A 1QU3A 2HEOA 3ZGKA 1YYVA 4XR6A 4BH9A 2DCEA 1G8XA 4DBQA 3S3MA 1Z77A 2KKOA 3QPTA 4ZTFA 2RQPA 2M45A 3S3NA 2KQRA 2ZXIA 3LAPA 1S7OA 2XGEA 2CGPA 4F52A 5EEGA 4HAMA 5HLIA 2CUZA 3WE2A 1MZBA 3CC7I 2Z3YA 2XAUA 3Q0WA 5CVJA 3LQRA 4CXFA 1U3EM 2IS6A 3WODF 3G6EI 2M3AA 5EEAA 1T38A 1ETOA 2P7VB 3BY6A 2PJRB 3C2BA 2VBWA 2VE9A 2K9NA 2WADA 3N97A 3QAHA 1UG0A 3CESA 1J09A 2ECBA 1RZ4A 3LL7A 3EQLF 4EM2A 2W1OA 3A0BC 1FMVA 5HDNA 2H8RA 4XKCA 4XK4A 4V19K 1BW6A 4OAYA 3R60A 2W85A 1QZYA 1O57A 1I27A 1QO0D 1W0TA 2EWNA 3HGGA 2FSWA 2VQLA 3S8PA 1MBFA 4DGWB 3PFYA 2LBFB 4JX5A 2R5ZB 4IO9F 3RIRA 3LSKA 2VT2A 3M8JA 2R7WA 4MTEA 1QBJA 9ANTA 2IW5A 1B72B 4RAYA 3ASNH 3GXOA 4KDPA 3SXYA 2J5OA 1MBKA 1NG7A 4D7MA 4LK1F 4II2A 5J40A 1MD0A 4BKXA 3HOWJ 5D5WB 1VQ7I 1ZELA 4LG3A 5ICGA 4XIDA 5M3MJ 4DNCA 2HZTA 3AAFA 1IXCA 2BZTA 5LEKA 2EPFA 3ZMZA 4C30A 5M5YJ 2H09A 2IEKA 4C9YA 1AKHB 1QZEA 2Y30A 1IRZA 2EH3A 1D1BA 1WGXA 4HX7A 4PJMA 4A0XA 2W24A 2STWA 3FXRA 2DLLA 4UVAA 5FFZA 1E3HA 5JLXA 3WTUC 3GFLA 3H92A 1X2NA 5GAHJ 1OR7C 3VSLA 2XUBA 4BHCA 1ORKA 5IP6A 2KDZA 2JSPA 2A05A 4E4HA 5BPDA 5C4XJ 1FTZA 2Z99A 2DDAA 1FOWA 2BY0A 2XASA 2LK2A 4I99C 4IX7A 5B1BH 4HRIA 3HOVJ 4IOCF 1T8IA 2WY8Q 1BC8C 3LNQA 1PUFB 2FEZA 1TLHB 5FKLA 1TWCJ 3QOPA 1ZGWA 1IN7A 3CCSI 2IJLA 4IHSA 2QBYA 3K4CA 5K1YA 5EG0A 3HPHA 4RBOA 2NVXJ 1X4OA 3GCMA 4JOMA 4MNUA 2R7FA 2CO5A 3T8TA 3JCUC 5C4JJ 3C3WA 3A1YA 3ZQLA 4BS9A 1ETXA 3QPHA 4PGGA 2PEXA 2V1DA 1EH8A 1E2XA 1JKQC 3FXKA 2MC3A 3G3ZA 2WAQN 5BS6A 1I1SA 2CJJA 2B63J 2YU9J 4BXXJ 2FE3A 2F5VA 2DQRA 4BL0B 4A3FJ 2RREA 4LJZF 3JAMZ 1TL8A 2HVSA 2E1MB 4U7DA 2V26A 4YIRX 2JK3A 1NHAA 3VYSB 3G2BA 1ZN2A 2L4MA 4IL6C 3J7AO 3VFZA 5GPAA 4ASNA 4UUSA 3O2PE 2VQCA 2L7KA 2ETHA 2D2WA 4M9ZA 2DA3A 4WXHA 4U0VA 5TGTA 5LLQA 1YJNI 3LSPA 3RYPA 2GAUA 3FBNB 3OYMA 3EYYA 1A04A 4N4OB 2PLYA 3LSRA 4ENJA 2MBFA 2QENA 4LIVA 3MFKA 2IT0A 4Y3OA 1LJ9A 2WC2A 3CC2I 1F1ZA 4UB8C 4EQQA 2VODA 1MGTA 1XB4A 2DI3A 2H1LA 3CDHA 2IA0A 2EZHA 1U2WA 3UKGA 2NS8A 1K83J 3E7LA 4KT5C 2VKDA 3E6DA 3HHHA 2M9HA 5F08A 3NEUA 3CZ6A 4I7HA 1YJ9I 4NDLA 1ZAOA 3HOUJ 1U9NA 2LG4A 1X1BA 1ZYRF 3AG3H 2BY3A 2Z2SB 2ICWG 3BR1A 1D8JA 3CJQB 4IHWA 1J9IA 1P4WA 4NQWA 3W3CA 3IRQA 1FYLA 3S2WA 3BLYA 4HNTA 3S2DJ 2HWVA 3TBIA 1B8IB 3O8HA 1S7AA 4BXFA 2EILH 3TKYA 2ME0A 2EZKA 3HRTA 1DU6A 3R4KA 3OYFA 3DP7A 3FDYA 1WJBA 4CCLA 1XX5A 2P4WA 3DFGA 3DWLE 2FQ4A 3OL3A 1MIJA 3DBRB 4KN7X 3ZPLA 3COAC 3HKZA 4IRIA 1FEXA 5J1YA 4M6VA 4PJNA 1DGRM 3CLQA 1LNWA 4BBSJ 3HSRA 4QTRA 5FROA 5F64A 1IN8A 3KP3A 4RGXA 2L7FP 5IPAA 3D5LA 3W2VA 4B1RA 5F0CA 3A01B 2FBHA 2L4AA 3OYDA 1Y56A 3KP6A 3QWLA 3WTSC 3S17J 3L2UA 5FRMA 2F6CA 1USSA 3IAM2 2QZ8A 2DMNA 2ZJPF 4A5MA 2XHKA 3QU3A 2GOXB 2IGKA 5GAGJ 2KIQA 2L7ZA 2DT5A 3LSGA 4HDUA 3BJOA 3RYRA 4BJTA 1O3QA 4G8XA 1I3AA 3CMMA 4KIGA 3I64A 1SAUA 4A69C 2B0LA 3M8FA 4GFBA 5JLWA 3V7RA 1ENHA 2EA4A 1GVDA 3KIOA 5JR3A 4XRMA 3B02A 1L0OC 2LF8A 3ABMH 4Y17A 1X3WB 4PSXA 3X2QH 4J00A 2WV0A 1A36A 4F93B 2P8TA 1WI9A 2QUFA 3OS2A 2MG4A 2KPMA 3IKTA 1PVEA 1FOKA 2K9LA 1R1VA 4GCVA 3B73A 1RESA 4GO1A 5TISC 4XBFA 3AL0C 2VKVA 4XLAA 4HYEA 3CUQA 1R58A 3JTHA 1U6GA 2COMA 2W00A 4HA8A 4G7HF 2FU4A 3F8NA 3QYBA 4Y4RA 1YS6A 3WTYC 4M72A 4E7KA 1P4XA 3V7SA 5EGOB 4DJAA 2DMTA 3CC4I 2MSYA 2M87A 2W7NA 2JA6J 2EK5A 2JVHA 3J7YJ 2DFIA 4G7ZF 4I02A 1IGNA 2AHQA 4KYWA 2K02A 2Y48A 4V2GA 2CYYA 4ENKA 2XRNA 1HXDA 1BJAA 3VODA 1VQ8I 2A5WA 1IJWC 3WTWC 2IRFG 2O9LA 1UMQA 3GTMJ 1FPQA 1G3TA 1IDYA 1SFXA 3PM1A 3HJEA 3DKXA 3E1SA 1X3ZB 5GP9A 1DQUA 1X58A 2BYVE 4HG2A 3FM3A 3KP4A 2DA7A 3BG5A 2H6BA 3A2KA 3ZQGA 4P9UA 3P9KA 2ELJA 2JVGA 3OIQA 3M7GA 2DDBA 4OIPF 1FYMA 1Q1HA 2GZWA 3GEZA 4L0ZB 1B59A 4F92B 2V9KA 1ZLKA 1VQNI 4KFCA 4OWRB 2Z33A 1FBUA 4XRSG 5B3SH 1CF7B 2JPCA 4BY1J 3DTIA 2IA1A 1FJLA 3K7AJ 4HBLA 4RAFA 2QSFX 3L2RA 2NVQJ 3I4NJ 1ZG3A 1LDDA 2DA6A 4QIWN 3WTVC 1OCZH 3OSFA 2H94A 2STTA 3AG4H 3K4BA 1IDZA 2X6WA 5FLMJ 2COBA 1SFOJ 3LMMA 2D1HA 1OYYA 1UCRA 4KIBA 1G3WA 2Q2EB 3G71I 2Y9ZA 1PJRA 4QSHA 2FNAA 3LA2A 1YE9A 3RZDJ 6PAXA 1MMDA 1T39A 2P5LC 4A3GJ 1WJFA 2DPDA 3K4KA 5LRSA 2K5CA 2WB1A 1JGGA 3MKWB 1LKXA 3K69A 1D8KA 4G12A 1Y6IA 2ZMEB 1OCOH 4RAZA 4XORA 1FP2A 3J80Z 3MKLA 2DT6A 1YW9A 4MLOA 4G7OF 4PFPA 1EF4A 3VYTB 2M4KA 1JGSA 2V6CA 4HPQA 4CCOA 3U1KA 1HKTA 2VXDA 2K9QA 3G1LA 3JAMK 2LKSA 2CV2A 1ZRFA 3EETA 1JJ6C 2L7MP 2DMUA 2R7QA 4R79A 2K27A 2VC1A 2UXNA 2K9MA 3CF5F 1MMAA 3QP5A 5AONA 2GXAA 1RNLA 4KITB 1UAAA 5HOOA 3ABUA 4XLNF 3CQZJ 3CMEI 2E36A 2O3FA 1KU9A 3ULQB 2LOOA 1R00A 1XSVA 3DPLC 4M73A 2IGMA 5JVTA 1VFCA 2KIUA 4X1EA 1U8BA 1MH4A 2LY2A 3KZZA 3RTRA 1FY7A 3JTGA 1ZRDA 1MMGA 3OOUA 2WAQA 4S05A 2FOWA 3S15J 1JXSA 2JSCA 1S29A 4WF2A 2HZDA 5HLHA 1BM9A 4PDKA 1X1CA 1OQYA 2MA3A 1JTYA 5EYRA 1XTAA 4HF2A 5DCFA 3RSNA 2Q1ZB 3ZN0A 5BQTA 2DA1A 4XSZF 1T0FA 1UHMA 4HX4A 5HLTA 5DTDA 4XONA 4EMSA 3B6CA 2ISYA 5CVIA 2UZKA 3ZQIA 4YIIA 3ZRGA 4XLHA 1YITI 3GFIA 3H35A 2DTZA 2BGCA 2CU7A 2HOTA 1ZARA 4AIJA 1IRGA 4QWQA 2A61A 2M4GA 1STZA 2DXIA 1DP7P 2P5VA 1YI2I 2HDCA 1UFMA 2JPBA 1WSUA 1V4RA 1LQ1A 5L3CA 5ICFA 2VOPA 4EJUA 3F22A 4A3JJ 5IOYA 2PJRA 3FMQA 4Y33A 2XF6A 4CICA 2GOMA 1BR2A 2LFBA 2CQ7A 2A69F 3EPZA 2DAOA 4M3EA 3T1BA 3WE3A 5FJ8J 1YIOA 2FNPA 2WV1A 4C3IJ 4LLNA 2XGCA 2MLKA 1E3PA 2WY7Q 3M4OJ 3KEYA 5FKOA 4YELA 4Q47A 4QPQA 1M1EB 2ZJRF 5JVGF 2YX7A 2JN6A 3OYLA 3OYCA 5H6QA 4KNYA 1JHHA 3ZN1A 2V7FA 3CF2A 3H9GA 2R7RA 1B9NA 4M6XA 3BG3A 1W0UA 5BOXA 1H9TA 2R5ZA 1BOBA 1TT5B 4U88A 5E17F 4V2FA 1R71A 1I1GA 3C18A 4LITA 4WK8F 1B72A 2EA2A 3LWFA 1S72I 3FBIB 3BJ6A 1A5JA 1KU2A 5HDKA 1YRNB 3ABKH 3Q5FA 2IGNA 2MD5A 1E0EA 3OYBA 4MHGA 1AKHA 1GVJA 2YUSA 3S1NJ 1KQ0A 1TTYA 3GZNB 1W4MA 3G1OA 3O8GA 3DCFA 2BV6A 1YW7A 3F3XA 3K1NA 4BACA 1KQ8A 4PCQA 5HNHA 2XROA 3U1DA 2MYSA 3ONQA 1Y39A 2NOJB 3ZMVA 4JX6A 4M6YA 1ZK8A 2VJ5A 4N9HA 3K9TA 4KUMA 1IAWA 4U0WA 2VBZA 1IV6A 4UB6C 3H1CA 3FX3A 3I59B 3FHZA 3TEDA 4RDUA 1W5CC 2CW7A 2ZO4A 5CQEA 5GTIC 1MBJA 3ESWB 3I58A 4NC8A 3NRVA 1PUFA 1XCBA 3BG9A 3P7NA 3HOZJ 2PI0A 3FWEA 2EIKH 1FZPB 1BI0A 1RI7A 4E7HA 5L3BA 2PX9A 4EV0A 3LQQA 4HZFA 3ZMSA 1XGMA 2VE8A 2EIMH 1B6AA 1ETKA 1GV5A 3I5UA 1XCVA 2MD0A 3GO5A 2H8WA 4EM1A 1RKTA 1VQ4I 4IF4A 2K85A 1LFPA 2M0CA 2RN7A 4L5IA 5E20A 1QHHD 1A6IA 1W7PB 3WHBA 1BR1A 1JKOC 3JRFA 4L18B 3R6SA 2YU3A 3ZMTA 1BI2A 2UXXA 2FBIA 3EUHC 4OMYA 3MZHA 4ZDLA 4FCYA 4F3QA 4ZYHA 1HDPA 2OJED 4OMZA 2ZNZA 1X1AA 2XF5A 2IGOA 3IHUA 3WG7H 2LR8A 3CUQC 4I76A 2EJRA 3HHGA 1HQCA 4W97A 4EJOA 2O7OA 3V42A 4CYCB 3BR2A 2HYJA 1SVOA 2HYFA 4RLQA 2DN0A 3R61A 3OIPA 2YR2A 2ZCWA 3I0TA 2OTLI 1V55H 3NAUA 1VQ6I 2CFOA 1RETA 1TWAJ 5D6EA 3F6VA 4A3CJ 2HDDA 1P6RA 3DEEA 4XKWA 4UUSB 2VKHA 3CD6I 3CO7C 3PNVA 3BZKA 1QQIA 2JUCA 2FF4A 4F55A 4PSWA 4BHBA 5DCMB 1FOXA 4B09A 1IN6A 1SD5A 2QSGX 1X2MA 1IW7F 1T33A 3OR2C 2PBIA 4M71A 4L9VA 3IH2A 4KISA 1U0JA 1IUFA 2ZFUA 2A07F 1LE8B 2VB6A 4N4NB 1KQ9A 4RS8A 4ZYDA 1APLC 2JT1A 3BG6A 1RR7A 2P5KA 4EATA 3HOTA 2L9SA 3JRCA 3GBGA 2W48A 4ZJZA 4JQFA 5LRRA 4HV6A 2AQFA 1B8IA 1S3JA 3L09A 3F21A 2GWRA 3ASOH 4CDGA 2ZJ2A 5HS9A 3BROA 5FFXA 5E3MA 2IS1A 2OZUA 3OYGA 5EF6A 2DTRA 1HCRA 2MC4A 4RM2A 5FB2A 2KT0A 4IQ4A 1S6LA 5A2QK 2XPWA 1UHSA 3AG1H 1LB2A 2YPRA 1FC3A 4P5OA 4ESBA 2E71A 3K4JA 3TO7A 3CCRI 3H0DA 2O8KA 1T95A 2MABA 2D5VA 2VJJA 2A6HF 2IP2A 3DBLB 3GFMA 3ZQ7A 4BE2A 1R4NB 4QLCU 3OOPA 1WWXA 4CA0A 5JHFA 3A01A 1FX7A 2Y9YA 2Y75A 2NOGA 1O4XA 3LA3A 2CQQA 4U0YA 1AOYA 3J80K 4HSRA 2KZVA 4RB1A 4A3EJ 1VNDA 4DYRA 4UUVA 4OAZA 3O3KA 2L9NA 4LGWA 5ILSA 1XN7A 2HXIA 4ENMA 2HQ5A 3PQKA 2Y31A 2JA5J 1U8RA 1I50J 3BT9A 4JP0A 2AXTC 1ON1A 1HSJA 1DU0A 3B6AA 2OCEA 1IXRC 2M34A 3Q0UA 2X4HA 2G9WA 1V54H 5H6RA 4A3IJ 3VSKA 1QPMA 5DS9A 1H9GA 2HOEA 4NB5A 2DA2A 2KP6A 1W1WE 2PMZN 3TO6A 3K2AA 3D1NI 3U2RA 4D1QA 3JREA 5J47A 4KT6A 3U21A 1IUYA 4XL9A 3PFIA 3VOEA 4B8XA 3HUGB 4XLPF 4EGYA 2Y69H 3QPSA 2ECCA 4BQAA 3C2HA 4CCNA 3AL0B 4Q5SF 3K0LA 1YJWI 2W57A 5E3LA 1FIPA 2IS2A 4ITVA 3LFKA 1KZHA 4CHUA 5GAEJ 2V6EA 1USTA 1T2KA 5FKKA 1KU3A 3OYIA 5HS7A 1DDNA 3QOEA 1MMSA 4GGGA 2BVMA 4WXCA 1QGPA 3GW2A 3G73A 2HKOA 2QKLB 5D6FA 2E1NA 5FD5A 5L3FA 1YG2A 4UVCA 1K6YA 1QA6A 1FOYA 5EGOA 2IAIA 3F72A 5J1UA 3TO9A 1BN5A 1WRJA 1BOAA 2M0MA 4XMYA 1ZHFA 3CLOA 3V8JA 4XICA 3L2VA 5IY5H 5K7ZA 4ZDPA 4D9JA 1T0FC 2XGXA 3IP4B 3ZQQA 5DM6F 4BE0A 2LH9A 1AA7A 1PUEE 1EH7A 5K7HA 3VDXA 2BXZA 3MWMA 3I55I 2EZLA 5J8FA 2IXSA 5KHDA 3F8MA 3E6BA 1LEAA 1PP8F 2NRAC 2QKMB 2YSRA 3RQIA 3TDZC 2G0EA 3DPTA 4FASD 5HLGA 4JX4A 2NYXA 1TW3A 3H3VK 3BP8A 2QEXI 1Z91A 2ZSHB 2QVOA 1I39A 2H6CA 3JRGA 2EB7A 3FZVA 3DU6A 1FBQA 5AIQA 3GFJA 2NS0A 1N25A 4ANJA 3DF8A 2VL8A 1CF7A 5FLXK 2GBYA 2BXYA 1IC8A 2KIFA 3M1EA 4ZH4F 2ZXHA 2RAEA 2DK8A 3BCAA 1VF9A 4E7JA 2A6TA 4PFOA 3KYDB 1WJDA 1G2HA 4LLGF 3V7CA 1QRYA 1MDMB 1UZCA 1BW5A 3FMSA 3CO6C 4XSXF 4XLCA 4PZJA 4BNCA 3UNGC 3G1MA 4UUTA 4XKVA 3RCOA 1DPRA 2Y0SA 2NVTJ 2Q2EA 4G6DA 2HU9A 3JRHA 3EUKL 5IP7J 3DTKA 1UHWA 4X0GA 1VI0A 2CW0F 2DA4A 3GMEA 3Q9SA 1J59A 1A35A 2I10A 3H5RA 2DJNA 2CH0A 3KP7A 1TQPA 2KIMA 4A0ZA 5CVUA 2GQQA 4L5EA 4Z6YA 2A6EF 1N78A 2R7TA 2E19A 3EUAA 2RNGA 2QLZA 3M3YJ 2UWMA 1YW8A 4XLFA 2QM3A 1Y1VJ 2XSDC 3L2WA 3AKZA 1G6NA 2ZMEA 5FLVA 1EKEA 3JRBA 5DUIA 3UR3C 1RKWA 2BVLA 2X6OA 3H9JA 4ZC3A 5GTHC 4AYBN 4AU7A 2O0YA 3DXJF 2XF7A 4AVPA 4E7LA 2BBYA 3LA7A 1W5TA 4CYDA 2NVYJ 4CZZA 1SAXA 2DPUA 4IHTA 5FKMA 1XMAA 4N0BA 4CSWA 3TP0A 3PJRA 2RVCA 4C3HJ 1UJ8A 3RKQA 2FX0A 1JT0A 2CUJA 1LFBA 1WI3A 1Z6TA 4F91B 1ZGAA 2UUZA 2CFXA 2OQRA 1QVUA 2RGVA 4J19A 4FX4A 2AQEA 3F9KA 2R7VA 3FKJA 3LSHA 3KYLA 4XNFA 5C3EJ 1VQLI 2F5CA 2XIGA 2EBIA 3F6OA 4BYYA 3N05A 2V79A 3S1QJ 4L9NA 1KYWA 1NK3P 1TW2A 1S5LC 1SMYF 3C2GA 1XPXA 2FXAA 1C0WA 3MKZA 4IRGA 3WGIA 5CVRA 2K86A 2RDPA 5CLSA 1AHDP 2QQAA 4P55A 4E70A 1GXPA 2QQBA 4W1UA 4GDFA 4MFEA 3RKXA 2OZ6A 1U5TB 2BEOA 1XC5A 2CQXA 1RIOH 2LYCA 2QYOA 3FK6A 1XSXA 3QPLA 1YO5C 2I5UA 3LFUA 3QP6A 1A31A 3GX4X 5GADJ 2I8DA 2XAGA 1KONA 2MH9A 3FMRA 4RGSA 1MMNA 2EQRA 2DYSH 2GXBA 3KLOA 4M9SA 2ZBKA 3CP2A 3Q3SA 4RM3A 5D4RA 1FMWA 1MW7A 1F9NA 1IV8A 2K7LA 1IN4A 5DDGA 4HOBA 4XKBA 2IA2A 1D3YA 2P81A 4OINF 1H8AC 3NWTA 4IHXA 3K1MA 2ID6A 2F48A 1ETVA 2GA1A 2VJ4A 5IT3A 4XRSA 5B1AH 1WQ2A 3C1DA 5CPRB 2HYGD 3WGGA 3ZMDA 5DYMA 2MH2A 1G59A 4NQWB 4UY8I 2KISA 1BI3A 3K4LA 3CCVI 2CMPA 1E3OC 1P7IA 4HF0A 3GTKJ 4IXAA 2W4SA 3VYUB 4U7BA 1O3SA 2V4JC 2Z9OA 4MFDA 3SDBA 4DIQA 2DJIA 3GTQJ 1N75A 4CCKA 2GLOA 4C2TA 3CCUI 1ZLJA 3K4MA 1D0ZA 2W25A 4B47A 4RA2A 1YRNA 5M5XJ 2XAQA 4UVBA 4CCJA 2CSOA 4ZZLA 5HODA 5A2QZ 1FWZA 3GLLA 2EFQA 3H5AA 3FIWA 3OYEA 4E6KG 2HNHA 1JTXA 2LMDA 3ERMA 3VEPA 2X6XA 1TQIA 5H20A 1F4KA 2O61A 2JMWA 5J1RA 1ERDA 4BEHB 4HLYA 2RKHA 4KJZA 3QODA 5M5WJ 3PUBA 3KCCA 1SD6A 5IT9Z 4XLEA 2BE5F 4FX0A 1K79A 2L9VA 2GA2A 3IC7A 2X9DA 4BAYA 2BW3B 1QPIA 2ZJQF 4JK1X 3A02A 5E1ZB 3I59A 4Y13A 2DK5A 1XS9A 2ZSIB 5DV5A 1B9MA 3I3LA 1XMXA 2JRMA 3ECHA 4YG2F 4Y52J 1NG6A 2M30A 4C3JJ 4ZZDA 3T8RA 2HQRA 3J7ZI 2JUGA 5EZGA 1E17A 2J5PA 2VXZA 4MIMA 4F7ZA
chains in the Genus database with same CATH topology
2QEXI 1VQKI 4IOAF 1YITI 1VQNI 3CC7I 2K3FA 2ZJPF 3I56I 3CCQI 2H8WA 1YI2I 5GAGJ 3G6EI 1VQ4I 3PIOF 5GADJ 3G4SI 3PIPF 1VQPI 1VQOI 4V19K 2QA4I 3CCLI 3G71I 1YJNI 3CCEI 2JQ7A 2ZJRF 5JVGF 3DLLF 1VQ5I 3CMAI 1YJWI 3CCMI 3CCJI 2OTLI 1VQ6I 4UY8I 4IO9F 1YHQI 3CC2I 3CCVI 5GAEJ 3CD6I 1S72I 1ACIA 1VQ7I 1FOXA 3CJTB 3CCUI 1MMSA 1YJ9I 2E35A 1QA6A 3CC4I 1FOYA 1VQMI 3J7YJ 3CF5F 5DM7F 5GAHJ 1Y39A 3CMEI 2E36A 2OTJI 2NXNB 1HC8A 1FOWA 5DM6F 1VQ8I 2ZJQF 1YIJI 4IOCF 2E34A 1VQLI 3I55I 2FOWA 1VQ9I 3CCRI 3J7ZI 3CCSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX I;  1VQK I;  4IOA F;  1YIT I;  1VQN I;  3CC7 I;  2K3F A;  2ZJP F;  3I56 I;  3CCQ I;  2H8W A;  1YI2 I;  5GAG J;  3G6E I;  1VQ4 I;  3PIO F;  5GAD J;  3G4S I;  3PIP F;  1VQP I;  1VQO I;  4V19 K;  2QA4 I;  3CCL I;  3G71 I;  1YJN I;  3CCE I;  2JQ7 A;  2ZJR F;  5JVG F;  3DLL F;  1VQ5 I;  3CMA I;  1YJW I;  3CCM I;  3CCJ I;  2OTL I;  1VQ6 I;  4UY8 I;  4IO9 F;  1YHQ I;  3CC2 I;  3CCV I;  5GAE J;  3CD6 I;  1S72 I;  1ACI A;  1VQ7 I;  1FOX A;  3CJT B;  3CCU I;  1MMS A;  1YJ9 I;  2E35 A;  1QA6 A;  3CC4 I;  1FOY A;  1VQM I;  3J7Y J;  3CF5 F;  5DM7 F;  5GAH J;  1Y39 A;  3CME I;  2E36 A;  2OTJ I;  2NXN B;  1HC8 A;  1FOW A;  5DM6 F;  1VQ8 I;  2ZJQ F;  1YIJ I;  4IOC F;  2E34 A;  1VQL I;  3I55 I;  2FOW A;  1VQ9 I;  3CCR I;  3J7Z I;  3CCS I; 
#chains in the Genus database with same CATH topology
 2R7S A;  1JUM A;  2F5F A;  1OCR H;  4FT8 A;  3T0Y A;  3S1M J;  1K78 B;  4C2M J;  3V4G A;  2JTV A;  2VBX A;  3PL8 A;  3QRF F;  2Z16 A;  1ZH5 A;  5FKN A;  1P92 A;  1S9H A;  3ZCO A;  4HF1 A;  1J2X A;  1O7F A;  3TL4 X;  2PMZ A;  3WU2 C;  2GIZ A;  3HBL A;  4S0H B;  3H3Z A;  4RMN A;  5F1R A;  3OIO A;  3KP5 A;  4BHP A;  3HTS B;  2XSJ C;  3DBH B;  1OCC H;  5IYB J;  3GZ6 A;  1W7P A;  4KIC A;  1IRF A;  2LKX A;  3ELK A;  3CMY A;  1LVA A;  1D5Y A;  2X48 A;  3PNY A;  3RDI A;  3S1R J;  1WH5 A;  1OCP A;  2CUE A;  3IRR A;  1OMI A;  2V1U A;  1V3F A;  1ZQ3 P;  2YX4 A;  1MNM C;  3HYI A;  2L3D A;  1R5G A;  2VOO A;  4D7N A;  4DBR A;  3GZ5 A;  3CP8 A;  3OMY A;  2HS5 A;  2CWE A;  4ESF A;  2JA2 A;  1YLF A;  4R1H A;  4A6D A;  1WCM J;  2XC7 A;  2TCT A;  3BWG A;  3R0J A;  2KDO A;  4CYC A;  1MBH A;  5C44 J;  2HOS A;  3CMA I;  4GYG A;  3GTO J;  2KJB A;  4IEJ A;  1DPU A;  3W6V A;  3CCJ I;  1FBS A;  3E6M A;  1ZTR A;  3WTZ A;  5D8L B;  2W84 A;  3NQO A;  3M1C A;  3K6G A;  2HGC A;  5CYV A;  3ZR8 X;  4MQV A;  2G7U A;  1P7J A;  3M8E A;  2F2E A;  3I4M J;  5LGN A;  5CVV A;  2X1C A;  3AG2 H;  3F8F A;  3KLN A;  2X6Y A;  5ILV A;  1XDU A;  1J5Y A;  2CW8 A;  5HNF A;  1RRJ A;  1LDK B;  5DD4 A;  3QYF A;  4AIK A;  4DYQ A;  3MD2 A;  5DCM A;  4YFX F;  2FD5 A;  5ILU A;  2VQG A;  3PSF A;  2E7W A;  1WJE A;  2LRD A;  3L9F A;  4BDY A;  1Z0X A;  1P2F A;  1XSD A;  1PDN C;  1PYV A;  3BC8 A;  1VQM I;  1H0M A;  5E79 C;  2RC4 A;  1MNE A;  1R5H A;  4LFU A;  1LE8 A;  2LBF A;  2N8G A;  1U78 A;  1ZR4 A;  1Y0U A;  5LHG A;  5DM7 F;  2L2O A;  2V1X A;  4IPA A;  4MTD A;  3FHN A;  4CH7 A;  3VYR B;  1QHG A;  3JRI A;  2BY1 A;  2LNB A;  3MN2 A;  2X85 A;  3HKZ N;  5F0F A;  1JKR C;  1I5Z A;  1DP3 A;  2XDV A;  1WJ5 A;  1YIJ I;  1KU7 A;  4RAG A;  2X1E A;  4G9Y A;  1I6H J;  1SMT A;  2CG4 A;  4DZP A;  1B4A A;  4ZTJ A;  3ZQC A;  3FM5 A;  1ZGJ A;  5FLX Z;  2GM4 A;  5K5O A;  5KVR A;  3WG9 A;  2DYR H;  2XPV A;  4AIH A;  2D1V A;  3H0G J;  4AID A;  4ZYA A;  3L2Q A;  1JUS A;  3J7A Y;  1S7E A;  1VQK I;  1WKM A;  2A5Y B;  1BJZ A;  4DOZ A;  3NWS A;  4RB0 A;  4BE1 A;  2HR3 A;  1WHU A;  2RV8 A;  3DKY A;  3HZJ A;  2F4O B;  2FA5 A;  3D5S C;  4XRF A;  3CCQ I;  1ETY A;  2XB5 A;  4L9J A;  3PNT A;  1Z1D A;  3VB2 A;  2KJC A;  3K1P A;  4B3A A;  3P5J A;  3G4S I;  2F4I A;  5EJC A;  3SDG A;  3IWF A;  3TP3 A;  2D45 A;  1G3Y A;  5JHU A;  3PUF A;  5F6F A;  4OIO F;  4RGR A;  2AO9 A;  1HW5 A;  5BPI A;  2W82 A;  1X19 A;  1Z21 A;  4FIS A;  4MEX F;  2KZG A;  3IKV A;  4M3D A;  3W2W A;  2ACJ A;  3FKI J;  2ELK A;  4CZC A;  5D8K B;  4OIR F;  4AD9 A;  4BXU A;  3F23 A;  2OAZ A;  3MQ0 A;  1K6O A;  2JQ7 A;  1IXS B;  3KEO A;  4FE4 A;  4NC6 A;  4CO8 A;  3J81 Z;  3HUG A;  2E2J J;  1FSH A;  4JYK A;  1XGS A;  4AYB A;  3EDP A;  1R1T A;  1Z7L A;  2ZXW H;  2XPU A;  4PUS A;  2R3S A;  1I6X A;  1K7A A;  1FIA A;  1JKP C;  3MKY B;  2H1K A;  3S3O A;  1TNT A;  1YX3 A;  4HDV A;  2P6T A;  1CGP A;  2GXG A;  2QGU A;  1AU7 A;  2DOD A;  3OYH A;  2M8G X;  3HOX J;  2JJ7 A;  5M3F J;  1JE8 A;  2HTJ A;  2HTS A;  5KAF C;  1R7J A;  2EFO A;  2V9P A;  3OYK A;  3HDD A;  4RB2 C;  3CTA A;  3DKW A;  3FIS A;  2IPQ X;  4LD5 A;  2HPM A;  1YTY A;  4PJ0 C;  1XGN A;  4EJV A;  3S93 A;  2R7D A;  4A3B J;  1F43 A;  3DV8 A;  4XQF A;  1HA8 A;  2A3S A;  2L9R A;  2ID3 A;  4XM3 A;  2M8E A;  3SFZ A;  5E18 F;  4A3L J;  2HPI A;  3IH4 A;  2OV7 A;  4M3B A;  1NTC A;  2WWY A;  1WPK A;  5E8G A;  4IKF A;  2HQN A;  1SVM A;  1KYZ A;  5AIP A;  1OFC X;  4ETS A;  5FD6 A;  3MAJ A;  1W7P D;  2CV1 A;  3OS1 A;  3WHC A;  4OIQ F;  4LG0 B;  2EIJ H;  3EYI A;  2R7U A;  1P9Q C;  5FO5 A;  3OSG A;  3LST A;  3I54 A;  4N9I A;  4A0Y A;  1SFE A;  2YS9 A;  4HEA 2;  2ZFW A;  4LB6 B;  2KL4 A;  1D1C A;  4BGD A;  3RPQ A;  3GWZ A;  1CQT A;  3V8K A;  2MW8 A;  3HSE A;  1DUX C;  1QVT A;  3T5X A;  4BQN A;  5HVQ C;  5HS8 A;  2F4M B;  2HXO A;  4IOA F;  1SAN A;  2K9S A;  2OC6 A;  3DEU A;  2OBP A;  2LKP A;  2QQ9 A;  3I56 I;  1TWH J;  4KMF A;  4EJW A;  2EV0 A;  4FQG A;  3GLX A;  3JW4 A;  4JBA A;  1GXQ A;  3BTL A;  4YFN F;  5ICC A;  2LP0 A;  2XRL A;  1EV7 A;  3RPU A;  1R9T J;  1MDM A;  4G94 A;  2L5Q A;  2PFB A;  3SYT A;  1F5T A;  5IT9 K;  1O3R A;  1LDJ A;  1V5E A;  3KE2 A;  1MBG A;  3Q0V A;  3QU6 A;  4HST A;  4P1W A;  2QA4 I;  3HB9 A;  1J0R A;  3IV5 A;  3MMY B;  2KRC A;  1S8N A;  3E0J B;  4I09 A;  4I01 A;  1KGS A;  3BTJ A;  3QQA A;  1FLI A;  4A2U A;  2X51 A;  4PK4 A;  2R7O A;  4GXO A;  1ZKG A;  2DFF A;  2ESN A;  3K2Z A;  5J3L A;  5J4V A;  1J75 A;  4KA4 A;  3MVP A;  2WB1 N;  1TT0 A;  1XGO A;  2MGQ A;  4UXN A;  1R49 A;  2JRT A;  4A93 J;  2M5W A;  4FET A;  2ZNY A;  2X0L A;  2EFW A;  2VKE A;  1Z9C A;  3TW7 A;  3CJT B;  4Y7N J;  5DD8 A;  1UG2 A;  4WCG A;  2C6Y A;  5L3E A;  2OUM A;  3ECO A;  4TV7 A;  4Q4Z F;  3HXL A;  4B48 A;  4O3M A;  1GUU A;  3RI4 A;  2K40 A;  3I71 A;  4QPO A;  2HOA A;  4YIF A;  2GIV A;  1JI8 A;  5GPC A;  4DW6 A;  4HNV A;  4I0B A;  2O03 A;  2FQ3 A;  1LEB A;  4XOT A;  1HST A;  2ADU A;  4O5V A;  3HRM A;  3RZO J;  5IOZ A;  2NXN B;  3BZC A;  3KEQ A;  2VON A;  5D5V B;  2VPR A;  3PSI A;  2XAF A;  1GHC A;  3BPX A;  2P7C B;  2KHM A;  4BQQ A;  1HF0 A;  2OCC H;  5L3G A;  1H89 C;  2R5Y B;  3DEW A;  1XG1 A;  5F0H A;  4II3 A;  2WAF A;  2HQA A;  4IQJ A;  2LDU A;  2A68 F;  1BR4 A;  1VQ9 I;  2FMY A;  3SZG A;  2CV0 A;  1J7K A;  2M7A A;  3FXU A;  4IZZ A;  4GRI A;  3ZP5 A;  1ETQ A;  4B43 A;  4I6Z A;  2X1D A;  1O3T A;  2VI6 A;  1O7L A;  2WAE A;  4BBR J;  1TWG J;  2JWT A;  1MH3 A;  1K61 A;  2LTP A;  1XMK A;  2WTE A;  5EEH A;  1OPC A;  5E3O A;  2E60 A;  3E3V A;  2E2I J;  2ZB9 A;  2EIN H;  4I0A A;  4L5J A;  2DFH A;  1PP7 U;  5E8I A;  4EGZ A;  1H88 C;  5E1X A;  3SEZ A;  3CDL A;  1U5T A;  3ML6 A;  1HKS A;  2HI3 A;  3DQV C;  2DW4 A;  3O6B B;  3CJR B;  4Q48 A;  2JA7 J;  3HOY J;  1LUJ B;  2EV6 A;  3A0H C;  3E97 A;  1R5I D;  2O6G E;  3GF2 A;  4BQO A;  1NH3 A;  4ZYG A;  1RPW A;  3HSF A;  1SFU A;  1LFU P;  1GV2 A;  1TWF J;  4RB3 C;  3W6K B;  3AFH A;  3LSJ A;  3BR0 A;  3IH3 A;  3PQJ A;  1K4T A;  1Z3X A;  3RQ4 A;  3GTL J;  2VUM J;  4LMY A;  3PO2 J;  3CCE I;  5FRN A;  4AUX A;  1T08 B;  1R36 A;  2BHZ A;  2KRH A;  5DEQ A;  4NNJ A;  1SD7 A;  3E6C C;  2E5N A;  2NNY A;  1X3U A;  3FXJ A;  2XVC A;  4A3D J;  3RKY A;  2KRF A;  1R22 A;  3OV8 A;  3S2H J;  4XN0 A;  3L1P A;  1BL0 A;  2IVM A;  2E2H J;  4D5F A;  3MEX A;  3V8L A;  2M1B A;  2B9S A;  2EFN A;  4DQ2 A;  4DYC A;  1BI1 A;  4A5N A;  3W6J B;  3HRS A;  3OWT A;  5BMZ A;  2OU2 A;  5IYD J;  1JHF A;  2E35 A;  2VIX A;  1D0X A;  3F8B A;  1T6S A;  1Z05 A;  2E7X A;  1HW1 A;  2L54 A;  3C7J A;  1FTT A;  3H5N A;  4ENN A;  4O6J A;  2XGD A;  1MJ9 A;  1RUO A;  2R93 J;  1T98 A;  2DO7 A;  4UV9 A;  1A6Q A;  1WZ2 A;  4LB5 A;  4BEH A;  1YOV B;  3WTX C;  3BDD A;  1R4M B;  4ZDO A;  4AM3 A;  1ONV A;  4WXD A;  1TC3 C;  1Y8Q B;  3FK7 A;  1KA8 A;  3RPU D;  2R92 J;  3Q9V A;  2BW3 A;  5D5U B;  1BIB A;  2OD5 A;  3J81 K;  3LOC A;  3S14 J;  4U87 A;  3HM5 A;  2QF7 A;  2VLA A;  1ZR2 A;  2E1O A;  4A6E A;  4WX9 A;  2K4B A;  3OR1 C;  4K2E A;  5K7F A;  1HBX G;  4NHJ A;  1BA5 A;  4IHY A;  1U9O A;  1MSF C;  2QBY B;  5EG0 B;  5K5Q A;  2H27 A;  3ABL H;  2G7H A;  3WGH A;  1Q1V A;  2NAZ A;  4BJ5 C;  4EVI A;  4HLX A;  1AWC A;  2Z5U A;  3E5Q A;  4E7I A;  1K78 A;  4HX8 A;  1LPQ A;  2BHY A;  3ABT A;  4ZYE A;  4G6Q A;  3SFI A;  3BJA A;  4AVZ A;  5KK1 A;  2UV1 A;  2DOF A;  2QWW A;  3R0A A;  5L3D A;  4D5C A;  4UV8 A;  5DUK A;  3OY9 A;  3EUH A;  3DLA A;  1K4S A;  1Z67 A;  4MO7 A;  2ESH A;  3CCY A;  2LY1 A;  2MFZ A;  3BCB A;  2LF7 A;  2WBM A;  4E7Z A;  1TBX A;  1IZ1 A;  5LFA A;  2E1M C;  1X1D A;  5K5R A;  2M7B A;  3W2A A;  1MKM A;  2K3P A;  1D1A A;  2PN6 A;  3BTC A;  4Z2Y A;  5LEJ A;  2NVU B;  4IHV A;  3BG7 A;  3BTI A;  4G6T B;  5ERI A;  5BNG A;  3OYA A;  3DLL F;  3BQY A;  3PO3 J;  3CDI A;  1Z3Y A;  1XDS A;  1W36 D;  2QSH X;  3GVA A;  3A03 A;  2EZI A;  4YEJ A;  2Q8K A;  3CCM I;  3I9V 2;  1EA3 A;  3CUO A;  2KLO A;  2VC0 A;  1TP4 A;  4PJL A;  5F27 A;  2CQN A;  5EDN A;  4YFK F;  3BQZ A;  4LIU A;  2V9V A;  1T56 A;  3GUD A;  1OKR A;  2WA0 A;  5IYC J;  1EH6 A;  5EZH A;  5HDG A;  4LLL A;  2E1C A;  2R0Q C;  4BU2 A;  5LHH A;  3VPR A;  3GTG J;  1QZZ A;  3E5U A;  4ON0 A;  2VAS A;  3FXO A;  3H3U A;  4P9F A;  2NNN A;  3REO A;  1OIS A;  1R1U A;  2P6S A;  2PQ8 A;  3HRU A;  3L2C A;  4PGH A;  4J01 A;  4RLF A;  4LK0 F;  3OYJ A;  3ROU A;  4BJ6 C;  2L02 A;  3NAR A;  5J8C A;  2Z1D A;  1OYI A;  3F0C A;  3MZY A;  3WU1 B;  4S04 A;  1Z7U A;  1IF1 A;  1L3L A;  1ZG5 A;  5FGM A;  3HIF A;  3TDU C;  3N4M A;  1NK2 P;  3TW6 A;  1R23 A;  4I2O A;  3ERE D;  2VJI A;  4KIF A;  5CQG A;  2LD5 A;  4MGR A;  3TQN A;  4YRV A;  2XKO A;  1EJ9 A;  2FRH A;  3KFW X;  5F04 A;  4IVN A;  4C2U A;  5H2F C;  1OR7 A;  1LVK A;  3BR5 A;  1IG7 A;  2EV5 A;  4A3M J;  5LD2 C;  2K3F A;  3LSI A;  1R6R A;  2ISZ A;  1ON2 A;  2DOA A;  5J4Y A;  3FXL A;  1W5S A;  1D0Y A;  3ZQF A;  2ZKZ A;  3KZY A;  4L0Y B;  3A4C A;  3JSP A;  2PG4 A;  1FT9 A;  1HKQ A;  2JZY A;  1Y8R B;  2QQ8 A;  1JJ8 C;  4KN4 X;  5ED4 A;  1BBY A;  1UEL B;  2NS7 A;  3KX2 A;  5KCM A;  3HL2 A;  3P9C A;  4AWX B;  4UHT A;  4ESJ A;  2Y0M A;  1YFH A;  1OJL A;  1BC7 C;  2JA8 J;  1HOM A;  2FBK A;  5B5E C;  2OQG A;  3PIP F;  4XOP A;  1JT6 A;  3M07 A;  3KPH A;  1VQO I;  1G3S A;  1TZL A;  2VN2 A;  3JSO A;  3BOQ A;  3LSM A;  1WFX A;  3BPV A;  1SVL A;  1JUP A;  2PMU A;  1QNT A;  3CCL I;  2CRG A;  4LOC A;  1FYK A;  4MEY F;  3K70 D;  4EJT A;  1I3Q J;  5LGU A;  3QYE A;  5CJ9 A;  4FE7 A;  5D4S A;  2P0W A;  2B7E A;  5KNL A;  4OU0 A;  3IAS 2;  4HNU A;  3E5X A;  1MJB A;  1VTN C;  2DMQ A;  4FTH A;  1BIA A;  3HEF A;  2TDX A;  3I53 A;  1X4P A;  4P96 A;  2XAJ A;  3MCZ A;  1SD4 A;  2DA5 A;  2PMH A;  4CUG A;  3CUQ B;  4KMU X;  3D0S A;  1IO2 A;  1YX5 A;  1ZRE A;  3SZT A;  1YS7 A;  2DT7 B;  2Y2Z A;  3IL2 A;  3DTE A;  3HPG A;  4HV5 A;  3S32 A;  3WU0 A;  4RGU A;  2HVQ A;  3M9A A;  1F36 A;  2IBD A;  3DPU A;  2LY9 A;  2AXL A;  4H4K C;  1W36 C;  2FOK A;  1MBE A;  2XB0 X;  3KP2 A;  2RNJ A;  2XAH A;  3DU5 A;  1FSE A;  2AS5 F;  4XN3 A;  4CGZ A;  2IS4 A;  2OA4 A;  2FML A;  3ZMU A;  2VQH A;  3JR9 A;  2M2E A;  3GTJ J;  1FNN A;  3K10 A;  1WH7 A;  1HW2 A;  2LC2 A;  4IRH A;  5D5X B;  1SC7 A;  4NBQ A;  5F1J A;  1GDT A;  3JRA A;  1SFK A;  2XKP A;  2OTJ I;  4M3F A;  3ISP A;  2HDW A;  3SJM A;  2R7Z J;  1D5V A;  1ULY A;  3BR3 A;  1B1B A;  3IUO A;  3RKW A;  2KFD A;  1OCT C;  3ZXS A;  3GYH X;  2R4G A;  3H9Q A;  4LG0 A;  3F8C A;  1Y0N A;  3D5R C;  2E34 A;  2OF7 A;  3OS0 A;  1ETW A;  3P9I A;  2ZC2 A;  4DZJ A;  2ELH A;  4M74 A;  3FXQ A;  4M9X A;  3ZOB A;  2HFH A;  4IJA A;  3RJP A;  1U5T C;  1UB9 A;  1XD7 A;  3BZ6 A;  5CKT A;  2DU9 A;  5JFR A;  4EEF G;  1DGW Y;  2VT3 A;  3L7W A;  5ICE A;  4R8H A;  3U9G A;  2K4J A;  4D0P A;  5J6X A;  1TQM A;  3KZI C;  1WJA A;  1V5F A;  2DOE A;  3KYC B;  5LHI A;  4PJJ A;  3LAJ A;  5E1W A;  3GTP J;  4MQ9 F;  3PIO F;  4Y15 A;  3WTT C;  4NC7 A;  2ME6 A;  5B66 C;  1MJA A;  2QCO A;  4B3X A;  4B4C A;  2LVS A;  2DFE A;  5E3N A;  1VQP I;  1X1P A;  1TNS A;  2DMP A;  4BDZ A;  5LBQ A;  4E7S A;  4EM0 B;  4OOI A;  3H36 A;  1N77 A;  4GYI A;  2BY2 A;  2Y0S N;  2F5D A;  3L00 A;  4BUP A;  2RQQ A;  2TRT A;  2MLG A;  2VBY A;  1GLN A;  3SHF A;  3TOA A;  3HG9 A;  4H0E A;  1WJC A;  4WWC A;  3FXM A;  4L9T A;  3HTU A;  3JRD A;  1MSE C;  3HOS A;  2DBB A;  1ZRC A;  1VQ5 I;  2OPT A;  2E5Z A;  1VZ0 A;  2EFP A;  2ZXJ A;  1YQA A;  1YHQ I;  5JI6 A;  1OYW A;  2F5E A;  3HC7 A;  5KAI C;  1V5G A;  2HKX A;  2DQL A;  2HVR A;  4X6A J;  4BY7 J;  4UNO A;  4I98 B;  3SQN A;  1Z6R A;  4M3G A;  4A3K J;  1ACI A;  3K70 C;  1G4D A;  2R7X A;  5LGT A;  1OLT A;  2O8X A;  3HGY A;  4FHT A;  3TGN A;  1HDD C;  4CCM A;  3CJN A;  1ZG1 A;  3TOB A;  3S16 J;  1WVR A;  2LRE A;  2PJP A;  3VWB A;  2L0K A;  2V1N A;  1IRX A;  2ZME C;  3I4P A;  1GT0 C;  4AC0 A;  1IN5 A;  1FP1 D;  1MND A;  2O5R A;  1REP C;  2LLK A;  2CUF A;  3BR6 A;  3SEQ A;  3ZQH A;  2FUG 2;  4HQE A;  1Y1W J;  3SZP A;  4NUB A;  1SEU A;  1RR8 C;  3MZ8 A;  1POG A;  5IP9 J;  3OL4 A;  4B44 A;  1RUN A;  4A12 A;  1ITY A;  1RC9 A;  2L01 A;  2XV4 S;  1HC8 A;  2BOL A;  3K4N A;  2KMU A;  4HQM A;  5TJJ A;  1P4A A;  3TMO A;  4ABZ A;  1HLV A;  2LSO A;  1ODD A;  2VPL A;  2CS3 A;  2CQK A;  4HW0 A;  2Q0O A;  3KET A;  3OYN A;  2R5Y A;  3FF5 A;  3IWZ A;  5TRD A;  2FJ1 A;  1QU3 A;  2HEO A;  3ZGK A;  1YYV A;  4XR6 A;  4BH9 A;  2DCE A;  1G8X A;  4DBQ A;  3S3M A;  1Z77 A;  2KKO A;  3QPT A;  4ZTF A;  2RQP A;  2M45 A;  3S3N A;  2KQR A;  2ZXI A;  3LAP A;  1S7O A;  2XGE A;  2CGP A;  4F52 A;  5EEG A;  4HAM A;  5HLI A;  2CUZ A;  3WE2 A;  1MZB A;  3CC7 I;  2Z3Y A;  2XAU A;  3Q0W A;  5CVJ A;  3LQR A;  4CXF A;  1U3E M;  2IS6 A;  3WOD F;  3G6E I;  2M3A A;  5EEA A;  1T38 A;  1ETO A;  2P7V B;  3BY6 A;  2PJR B;  3C2B A;  2VBW A;  2VE9 A;  2K9N A;  2WAD A;  3N97 A;  3QAH A;  1UG0 A;  3CES A;  1J09 A;  2ECB A;  1RZ4 A;  3LL7 A;  3EQL F;  4EM2 A;  2W1O A;  3A0B C;  1FMV A;  5HDN A;  2H8R A;  4XKC A;  4XK4 A;  4V19 K;  1BW6 A;  4OAY A;  3R60 A;  2W85 A;  1QZY A;  1O57 A;  1I27 A;  1QO0 D;  1W0T A;  2EWN A;  3HGG A;  2FSW A;  2VQL A;  3S8P A;  1MBF A;  4DGW B;  3PFY A;  2LBF B;  4JX5 A;  2R5Z B;  4IO9 F;  3RIR A;  3LSK A;  2VT2 A;  3M8J A;  2R7W A;  4MTE A;  1QBJ A;  9ANT A;  2IW5 A;  1B72 B;  4RAY A;  3ASN H;  3GXO A;  4KDP A;  3SXY A;  2J5O A;  1MBK A;  1NG7 A;  4D7M A;  4LK1 F;  4II2 A;  5J40 A;  1MD0 A;  4BKX A;  3HOW J;  5D5W B;  1VQ7 I;  1ZEL A;  4LG3 A;  5ICG A;  4XID A;  5M3M J;  4DNC A;  2HZT A;  3AAF A;  1IXC A;  2BZT A;  5LEK A;  2EPF A;  3ZMZ A;  4C30 A;  5M5Y J;  2H09 A;  2IEK A;  4C9Y A;  1AKH B;  1QZE A;  2Y30 A;  1IRZ A;  2EH3 A;  1D1B A;  1WGX A;  4HX7 A;  4PJM A;  4A0X A;  2W24 A;  2STW A;  3FXR A;  2DLL A;  4UVA A;  5FFZ A;  1E3H A;  5JLX A;  3WTU C;  3GFL A;  3H92 A;  1X2N A;  5GAH J;  1OR7 C;  3VSL A;  2XUB A;  4BHC A;  1ORK A;  5IP6 A;  2KDZ A;  2JSP A;  2A05 A;  4E4H A;  5BPD A;  5C4X J;  1FTZ A;  2Z99 A;  2DDA A;  1FOW A;  2BY0 A;  2XAS A;  2LK2 A;  4I99 C;  4IX7 A;  5B1B H;  4HRI A;  3HOV J;  4IOC F;  1T8I A;  2WY8 Q;  1BC8 C;  3LNQ A;  1PUF B;  2FEZ A;  1TLH B;  5FKL A;  1TWC J;  3QOP A;  1ZGW A;  1IN7 A;  3CCS I;  2IJL A;  4IHS A;  2QBY A;  3K4C A;  5K1Y A;  5EG0 A;  3HPH A;  4RBO A;  2NVX J;  1X4O A;  3GCM A;  4JOM A;  4MNU A;  2R7F A;  2CO5 A;  3T8T A;  3JCU C;  5C4J J;  3C3W A;  3A1Y A;  3ZQL A;  4BS9 A;  1ETX A;  3QPH A;  4PGG A;  2PEX A;  2V1D A;  1EH8 A;  1E2X A;  1JKQ C;  3FXK A;  2MC3 A;  3G3Z A;  2WAQ N;  5BS6 A;  1I1S A;  2CJJ A;  2B63 J;  2YU9 J;  4BXX J;  2FE3 A;  2F5V A;  2DQR A;  4BL0 B;  4A3F J;  2RRE A;  4LJZ F;  3JAM Z;  1TL8 A;  2HVS A;  2E1M B;  4U7D A;  2V26 A;  4YIR X;  2JK3 A;  1NHA A;  3VYS B;  3G2B A;  1ZN2 A;  2L4M A;  4IL6 C;  3J7A O;  3VFZ A;  5GPA A;  4ASN A;  4UUS A;  3O2P E;  2VQC A;  2L7K A;  2ETH A;  2D2W A;  4M9Z A;  2DA3 A;  4WXH A;  4U0V A;  5TGT A;  5LLQ A;  1YJN I;  3LSP A;  3RYP A;  2GAU A;  3FBN B;  3OYM A;  3EYY A;  1A04 A;  4N4O B;  2PLY A;  3LSR A;  4ENJ A;  2MBF A;  2QEN A;  4LIV A;  3MFK A;  2IT0 A;  4Y3O A;  1LJ9 A;  2WC2 A;  3CC2 I;  1F1Z A;  4UB8 C;  4EQQ A;  2VOD A;  1MGT A;  1XB4 A;  2DI3 A;  2H1L A;  3CDH A;  2IA0 A;  2EZH A;  1U2W A;  3UKG A;  2NS8 A;  1K83 J;  3E7L A;  4KT5 C;  2VKD A;  3E6D A;  3HHH A;  2M9H A;  5F08 A;  3NEU A;  3CZ6 A;  4I7H A;  1YJ9 I;  4NDL A;  1ZAO A;  3HOU J;  1U9N A;  2LG4 A;  1X1B A;  1ZYR F;  3AG3 H;  2BY3 A;  2Z2S B;  2ICW G;  3BR1 A;  1D8J A;  3CJQ B;  4IHW A;  1J9I A;  1P4W A;  4NQW A;  3W3C A;  3IRQ A;  1FYL A;  3S2W A;  3BLY A;  4HNT A;  3S2D J;  2HWV A;  3TBI A;  1B8I B;  3O8H A;  1S7A A;  4BXF A;  2EIL H;  3TKY A;  2ME0 A;  2EZK A;  3HRT A;  1DU6 A;  3R4K A;  3OYF A;  3DP7 A;  3FDY A;  1WJB A;  4CCL A;  1XX5 A;  2P4W A;  3DFG A;  3DWL E;  2FQ4 A;  3OL3 A;  1MIJ A;  3DBR B;  4KN7 X;  3ZPL A;  3COA C;  3HKZ A;  4IRI A;  1FEX A;  5J1Y A;  4M6V A;  4PJN A;  1DGR M;  3CLQ A;  1LNW A;  4BBS J;  3HSR A;  4QTR A;  5FRO A;  5F64 A;  1IN8 A;  3KP3 A;  4RGX A;  2L7F P;  5IPA A;  3D5L A;  3W2V A;  4B1R A;  5F0C A;  3A01 B;  2FBH A;  2L4A A;  3OYD A;  1Y56 A;  3KP6 A;  3QWL A;  3WTS C;  3S17 J;  3L2U A;  5FRM A;  2F6C A;  1USS A;  3IAM 2;  2QZ8 A;  2DMN A;  2ZJP F;  4A5M A;  2XHK A;  3QU3 A;  2GOX B;  2IGK A;  5GAG J;  2KIQ A;  2L7Z A;  2DT5 A;  3LSG A;  4HDU A;  3BJO A;  3RYR A;  4BJT A;  1O3Q A;  4G8X A;  1I3A A;  3CMM A;  4KIG A;  3I64 A;  1SAU A;  4A69 C;  2B0L A;  3M8F A;  4GFB A;  5JLW A;  3V7R A;  1ENH A;  2EA4 A;  1GVD A;  3KIO A;  5JR3 A;  4XRM A;  3B02 A;  1L0O C;  2LF8 A;  3ABM H;  4Y17 A;  1X3W B;  4PSX A;  3X2Q H;  4J00 A;  2WV0 A;  1A36 A;  4F93 B;  2P8T A;  1WI9 A;  2QUF A;  3OS2 A;  2MG4 A;  2KPM A;  3IKT A;  1PVE A;  1FOK A;  2K9L A;  1R1V A;  4GCV A;  3B73 A;  1RES A;  4GO1 A;  5TIS C;  4XBF A;  3AL0 C;  2VKV A;  4XLA A;  4HYE A;  3CUQ A;  1R58 A;  3JTH A;  1U6G A;  2COM A;  2W00 A;  4HA8 A;  4G7H F;  2FU4 A;  3F8N A;  3QYB A;  4Y4R A;  1YS6 A;  3WTY C;  4M72 A;  4E7K A;  1P4X A;  3V7S A;  5EGO B;  4DJA A;  2DMT A;  3CC4 I;  2MSY A;  2M87 A;  2W7N A;  2JA6 J;  2EK5 A;  2JVH A;  3J7Y J;  2DFI A;  4G7Z F;  4I02 A;  1IGN A;  2AHQ A;  4KYW A;  2K02 A;  2Y48 A;  4V2G A;  2CYY A;  4ENK A;  2XRN A;  1HXD A;  1BJA A;  3VOD A;  1VQ8 I;  2A5W A;  1IJW C;  3WTW C;  2IRF G;  2O9L A;  1UMQ A;  3GTM J;  1FPQ A;  1G3T A;  1IDY A;  1SFX A;  3PM1 A;  3HJE A;  3DKX A;  3E1S A;  1X3Z B;  5GP9 A;  1DQU A;  1X58 A;  2BYV E;  4HG2 A;  3FM3 A;  3KP4 A;  2DA7 A;  3BG5 A;  2H6B A;  3A2K A;  3ZQG A;  4P9U A;  3P9K A;  2ELJ A;  2JVG A;  3OIQ A;  3M7G A;  2DDB A;  4OIP F;  1FYM A;  1Q1H A;  2GZW A;  3GEZ A;  4L0Z B;  1B59 A;  4F92 B;  2V9K A;  1ZLK A;  1VQN I;  4KFC A;  4OWR B;  2Z33 A;  1FBU A;  4XRS G;  5B3S H;  1CF7 B;  2JPC A;  4BY1 J;  3DTI A;  2IA1 A;  1FJL A;  3K7A J;  4HBL A;  4RAF A;  2QSF X;  3L2R A;  2NVQ J;  3I4N J;  1ZG3 A;  1LDD A;  2DA6 A;  4QIW N;  3WTV C;  1OCZ H;  3OSF A;  2H94 A;  2STT A;  3AG4 H;  3K4B A;  1IDZ A;  2X6W A;  5FLM J;  2COB A;  1SFO J;  3LMM A;  2D1H A;  1OYY A;  1UCR A;  4KIB A;  1G3W A;  2Q2E B;  3G71 I;  2Y9Z A;  1PJR A;  4QSH A;  2FNA A;  3LA2 A;  1YE9 A;  3RZD J;  6PAX A;  1MMD A;  1T39 A;  2P5L C;  4A3G J;  1WJF A;  2DPD A;  3K4K A;  5LRS A;  2K5C A;  2WB1 A;  1JGG A;  3MKW B;  1LKX A;  3K69 A;  1D8K A;  4G12 A;  1Y6I A;  2ZME B;  1OCO H;  4RAZ A;  4XOR A;  1FP2 A;  3J80 Z;  3MKL A;  2DT6 A;  1YW9 A;  4MLO A;  4G7O F;  4PFP A;  1EF4 A;  3VYT B;  2M4K A;  1JGS A;  2V6C A;  4HPQ A;  4CCO A;  3U1K A;  1HKT A;  2VXD A;  2K9Q A;  3G1L A;  3JAM K;  2LKS A;  2CV2 A;  1ZRF A;  3EET A;  1JJ6 C;  2L7M P;  2DMU A;  2R7Q A;  4R79 A;  2K27 A;  2VC1 A;  2UXN A;  2K9M A;  3CF5 F;  1MMA A;  3QP5 A;  5AON A;  2GXA A;  1RNL A;  4KIT B;  1UAA A;  5HOO A;  3ABU A;  4XLN F;  3CQZ J;  3CME I;  2E36 A;  2O3F A;  1KU9 A;  3ULQ B;  2LOO A;  1R00 A;  1XSV A;  3DPL C;  4M73 A;  2IGM A;  5JVT A;  1VFC A;  2KIU A;  4X1E A;  1U8B A;  1MH4 A;  2LY2 A;  3KZZ A;  3RTR A;  1FY7 A;  3JTG A;  1ZRD A;  1MMG A;  3OOU A;  2WAQ A;  4S05 A;  2FOW A;  3S15 J;  1JXS A;  2JSC A;  1S29 A;  4WF2 A;  2HZD A;  5HLH A;  1BM9 A;  4PDK A;  1X1C A;  1OQY A;  2MA3 A;  1JTY A;  5EYR A;  1XTA A;  4HF2 A;  5DCF A;  3RSN A;  2Q1Z B;  3ZN0 A;  5BQT A;  2DA1 A;  4XSZ F;  1T0F A;  1UHM A;  4HX4 A;  5HLT A;  5DTD A;  4XON A;  4EMS A;  3B6C A;  2ISY A;  5CVI A;  2UZK A;  3ZQI A;  4YII A;  3ZRG A;  4XLH A;  1YIT I;  3GFI A;  3H35 A;  2DTZ A;  2BGC A;  2CU7 A;  2HOT A;  1ZAR A;  4AIJ A;  1IRG A;  4QWQ A;  2A61 A;  2M4G A;  1STZ A;  2DXI A;  1DP7 P;  2P5V A;  1YI2 I;  2HDC A;  1UFM A;  2JPB A;  1WSU A;  1V4R A;  1LQ1 A;  5L3C A;  5ICF A;  2VOP A;  4EJU A;  3F22 A;  4A3J J;  5IOY A;  2PJR A;  3FMQ A;  4Y33 A;  2XF6 A;  4CIC A;  2GOM A;  1BR2 A;  2LFB A;  2CQ7 A;  2A69 F;  3EPZ A;  2DAO A;  4M3E A;  3T1B A;  3WE3 A;  5FJ8 J;  1YIO A;  2FNP A;  2WV1 A;  4C3I J;  4LLN A;  2XGC A;  2MLK A;  1E3P A;  2WY7 Q;  3M4O J;  3KEY A;  5FKO A;  4YEL A;  4Q47 A;  4QPQ A;  1M1E B;  2ZJR F;  5JVG F;  2YX7 A;  2JN6 A;  3OYL A;  3OYC A;  5H6Q A;  4KNY A;  1JHH A;  3ZN1 A;  2V7F A;  3CF2 A;  3H9G A;  2R7R A;  1B9N A;  4M6X A;  3BG3 A;  1W0U A;  5BOX A;  1H9T A;  2R5Z A;  1BOB A;  1TT5 B;  4U88 A;  5E17 F;  4V2F A;  1R71 A;  1I1G A;  3C18 A;  4LIT A;  4WK8 F;  1B72 A;  2EA2 A;  3LWF A;  1S72 I;  3FBI B;  3BJ6 A;  1A5J A;  1KU2 A;  5HDK A;  1YRN B;  3ABK H;  3Q5F A;  2IGN A;  2MD5 A;  1E0E A;  3OYB A;  4MHG A;  1AKH A;  1GVJ A;  2YUS A;  3S1N J;  1KQ0 A;  1TTY A;  3GZN B;  1W4M A;  3G1O A;  3O8G A;  3DCF A;  2BV6 A;  1YW7 A;  3F3X A;  3K1N A;  4BAC A;  1KQ8 A;  4PCQ A;  5HNH A;  2XRO A;  3U1D A;  2MYS A;  3ONQ A;  1Y39 A;  2NOJ B;  3ZMV A;  4JX6 A;  4M6Y A;  1ZK8 A;  2VJ5 A;  4N9H A;  3K9T A;  4KUM A;  1IAW A;  4U0W A;  2VBZ A;  1IV6 A;  4UB6 C;  3H1C A;  3FX3 A;  3I59 B;  3FHZ A;  3TED A;  4RDU A;  1W5C C;  2CW7 A;  2ZO4 A;  5CQE A;  5GTI C;  1MBJ A;  3ESW B;  3I58 A;  4NC8 A;  3NRV A;  1PUF A;  1XCB A;  3BG9 A;  3P7N A;  3HOZ J;  2PI0 A;  3FWE A;  2EIK H;  1FZP B;  1BI0 A;  1RI7 A;  4E7H A;  5L3B A;  2PX9 A;  4EV0 A;  3LQQ A;  4HZF A;  3ZMS A;  1XGM A;  2VE8 A;  2EIM H;  1B6A A;  1ETK A;  1GV5 A;  3I5U A;  1XCV A;  2MD0 A;  3GO5 A;  2H8W A;  4EM1 A;  1RKT A;  1VQ4 I;  4IF4 A;  2K85 A;  1LFP A;  2M0C A;  2RN7 A;  4L5I A;  5E20 A;  1QHH D;  1A6I A;  1W7P B;  3WHB A;  1BR1 A;  1JKO C;  3JRF A;  4L18 B;  3R6S A;  2YU3 A;  3ZMT A;  1BI2 A;  2UXX A;  2FBI A;  3EUH C;  4OMY A;  3MZH A;  4ZDL A;  4FCY A;  4F3Q A;  4ZYH A;  1HDP A;  2OJE D;  4OMZ A;  2ZNZ A;  1X1A A;  2XF5 A;  2IGO A;  3IHU A;  3WG7 H;  2LR8 A;  3CUQ C;  4I76 A;  2EJR A;  3HHG A;  1HQC A;  4W97 A;  4EJO A;  2O7O A;  3V42 A;  4CYC B;  3BR2 A;  2HYJ A;  1SVO A;  2HYF A;  4RLQ A;  2DN0 A;  3R61 A;  3OIP A;  2YR2 A;  2ZCW A;  3I0T A;  2OTL I;  1V55 H;  3NAU A;  1VQ6 I;  2CFO A;  1RET A;  1TWA J;  5D6E A;  3F6V A;  4A3C J;  2HDD A;  1P6R A;  3DEE A;  4XKW A;  4UUS B;  2VKH A;  3CD6 I;  3CO7 C;  3PNV A;  3BZK A;  1QQI A;  2JUC A;  2FF4 A;  4F55 A;  4PSW A;  4BHB A;  5DCM B;  1FOX A;  4B09 A;  1IN6 A;  1SD5 A;  2QSG X;  1X2M A;  1IW7 F;  1T33 A;  3OR2 C;  2PBI A;  4M71 A;  4L9V A;  3IH2 A;  4KIS A;  1U0J A;  1IUF A;  2ZFU A;  2A07 F;  1LE8 B;  2VB6 A;  4N4N B;  1KQ9 A;  4RS8 A;  4ZYD A;  1APL C;  2JT1 A;  3BG6 A;  1RR7 A;  2P5K A;  4EAT A;  3HOT A;  2L9S A;  3JRC A;  3GBG A;  2W48 A;  4ZJZ A;  4JQF A;  5LRR A;  4HV6 A;  2AQF A;  1B8I A;  1S3J A;  3L09 A;  3F21 A;  2GWR A;  3ASO H;  4CDG A;  2ZJ2 A;  5HS9 A;  3BRO A;  5FFX A;  5E3M A;  2IS1 A;  2OZU A;  3OYG A;  5EF6 A;  2DTR A;  1HCR A;  2MC4 A;  4RM2 A;  5FB2 A;  2KT0 A;  4IQ4 A;  1S6L A;  5A2Q K;  2XPW A;  1UHS A;  3AG1 H;  1LB2 A;  2YPR A;  1FC3 A;  4P5O A;  4ESB A;  2E71 A;  3K4J A;  3TO7 A;  3CCR I;  3H0D A;  2O8K A;  1T95 A;  2MAB A;  2D5V A;  2VJJ A;  2A6H F;  2IP2 A;  3DBL B;  3GFM A;  3ZQ7 A;  4BE2 A;  1R4N B;  4QLC U;  3OOP A;  1WWX A;  4CA0 A;  5JHF A;  3A01 A;  1FX7 A;  2Y9Y A;  2Y75 A;  2NOG A;  1O4X A;  3LA3 A;  2CQQ A;  4U0Y A;  1AOY A;  3J80 K;  4HSR A;  2KZV A;  4RB1 A;  4A3E J;  1VND A;  4DYR A;  4UUV A;  4OAZ A;  3O3K A;  2L9N A;  4LGW A;  5ILS A;  1XN7 A;  2HXI A;  4ENM A;  2HQ5 A;  3PQK A;  2Y31 A;  2JA5 J;  1U8R A;  1I50 J;  3BT9 A;  4JP0 A;  2AXT C;  1ON1 A;  1HSJ A;  1DU0 A;  3B6A A;  2OCE A;  1IXR C;  2M34 A;  3Q0U A;  2X4H A;  2G9W A;  1V54 H;  5H6R A;  4A3I J;  3VSK A;  1QPM A;  5DS9 A;  1H9G A;  2HOE A;  4NB5 A;  2DA2 A;  2KP6 A;  1W1W E;  2PMZ N;  3TO6 A;  3K2A A;  3D1N I;  3U2R A;  4D1Q A;  3JRE A;  5J47 A;  4KT6 A;  3U21 A;  1IUY A;  4XL9 A;  3PFI A;  3VOE A;  4B8X A;  3HUG B;  4XLP F;  4EGY A;  2Y69 H;  3QPS A;  2ECC A;  4BQA A;  3C2H A;  4CCN A;  3AL0 B;  4Q5S F;  3K0L A;  1YJW I;  2W57 A;  5E3L A;  1FIP A;  2IS2 A;  4ITV A;  3LFK A;  1KZH A;  4CHU A;  5GAE J;  2V6E A;  1UST A;  1T2K A;  5FKK A;  1KU3 A;  3OYI A;  5HS7 A;  1DDN A;  3QOE A;  1MMS A;  4GGG A;  2BVM A;  4WXC A;  1QGP A;  3GW2 A;  3G73 A;  2HKO A;  2QKL B;  5D6F A;  2E1N A;  5FD5 A;  5L3F A;  1YG2 A;  4UVC A;  1K6Y A;  1QA6 A;  1FOY A;  5EGO A;  2IAI A;  3F72 A;  5J1U A;  3TO9 A;  1BN5 A;  1WRJ A;  1BOA A;  2M0M A;  4XMY A;  1ZHF A;  3CLO A;  3V8J A;  4XIC A;  3L2V A;  5IY5 H;  5K7Z A;  4ZDP A;  4D9J A;  1T0F C;  2XGX A;  3IP4 B;  3ZQQ A;  5DM6 F;  4BE0 A;  2LH9 A;  1AA7 A;  1PUE E;  1EH7 A;  5K7H A;  3VDX A;  2BXZ A;  3MWM A;  3I55 I;  2EZL A;  5J8F A;  2IXS A;  5KHD A;  3F8M A;  3E6B A;  1LEA A;  1PP8 F;  2NRA C;  2QKM B;  2YSR A;  3RQI A;  3TDZ C;  2G0E A;  3DPT A;  4FAS D;  5HLG A;  4JX4 A;  2NYX A;  1TW3 A;  3H3V K;  3BP8 A;  2QEX I;  1Z91 A;  2ZSH B;  2QVO A;  1I39 A;  2H6C A;  3JRG A;  2EB7 A;  3FZV A;  3DU6 A;  1FBQ A;  5AIQ A;  3GFJ A;  2NS0 A;  1N25 A;  4ANJ A;  3DF8 A;  2VL8 A;  1CF7 A;  5FLX K;  2GBY A;  2BXY A;  1IC8 A;  2KIF A;  3M1E A;  4ZH4 F;  2ZXH A;  2RAE A;  2DK8 A;  3BCA A;  1VF9 A;  4E7J A;  2A6T A;  4PFO A;  3KYD B;  1WJD A;  1G2H A;  4LLG F;  3V7C A;  1QRY A;  1MDM B;  1UZC A;  1BW5 A;  3FMS A;  3CO6 C;  4XSX F;  4XLC A;  4PZJ A;  4BNC A;  3UNG C;  3G1M A;  4UUT A;  4XKV A;  3RCO A;  1DPR A;  2Y0S A;  2NVT J;  2Q2E A;  4G6D A;  2HU9 A;  3JRH A;  3EUK L;  5IP7 J;  3DTK A;  1UHW A;  4X0G A;  1VI0 A;  2CW0 F;  2DA4 A;  3GME A;  3Q9S A;  1J59 A;  1A35 A;  2I10 A;  3H5R A;  2DJN A;  2CH0 A;  3KP7 A;  1TQP A;  2KIM A;  4A0Z A;  5CVU A;  2GQQ A;  4L5E A;  4Z6Y A;  2A6E F;  1N78 A;  2R7T A;  2E19 A;  3EUA A;  2RNG A;  2QLZ A;  3M3Y J;  2UWM A;  1YW8 A;  4XLF A;  2QM3 A;  1Y1V J;  2XSD C;  3L2W A;  3AKZ A;  1G6N A;  2ZME A;  5FLV A;  1EKE A;  3JRB A;  5DUI A;  3UR3 C;  1RKW A;  2BVL A;  2X6O A;  3H9J A;  4ZC3 A;  5GTH C;  4AYB N;  4AU7 A;  2O0Y A;  3DXJ F;  2XF7 A;  4AVP A;  4E7L A;  2BBY A;  3LA7 A;  1W5T A;  4CYD A;  2NVY J;  4CZZ A;  1SAX A;  2DPU A;  4IHT A;  5FKM A;  1XMA A;  4N0B A;  4CSW A;  3TP0 A;  3PJR A;  2RVC A;  4C3H J;  1UJ8 A;  3RKQ A;  2FX0 A;  1JT0 A;  2CUJ A;  1LFB A;  1WI3 A;  1Z6T A;  4F91 B;  1ZGA A;  2UUZ A;  2CFX A;  2OQR A;  1QVU A;  2RGV A;  4J19 A;  4FX4 A;  2AQE A;  3F9K A;  2R7V A;  3FKJ A;  3LSH A;  3KYL A;  4XNF A;  5C3E J;  1VQL I;  2F5C A;  2XIG A;  2EBI A;  3F6O A;  4BYY A;  3N05 A;  2V79 A;  3S1Q J;  4L9N A;  1KYW A;  1NK3 P;  1TW2 A;  1S5L C;  1SMY F;  3C2G A;  1XPX A;  2FXA A;  1C0W A;  3MKZ A;  4IRG A;  3WGI A;  5CVR A;  2K86 A;  2RDP A;  5CLS A;  1AHD P;  2QQA A;  4P55 A;  4E70 A;  1GXP A;  2QQB A;  4W1U A;  4GDF A;  4MFE A;  3RKX A;  2OZ6 A;  1U5T B;  2BEO A;  1XC5 A;  2CQX A;  1RIO H;  2LYC A;  2QYO A;  3FK6 A;  1XSX A;  3QPL A;  1YO5 C;  2I5U A;  3LFU A;  3QP6 A;  1A31 A;  3GX4 X;  5GAD J;  2I8D A;  2XAG A;  1KON A;  2MH9 A;  3FMR A;  4RGS A;  1MMN A;  2EQR A;  2DYS H;  2GXB A;  3KLO A;  4M9S A;  2ZBK A;  3CP2 A;  3Q3S A;  4RM3 A;  5D4R A;  1FMW A;  1MW7 A;  1F9N A;  1IV8 A;  2K7L A;  1IN4 A;  5DDG A;  4HOB A;  4XKB A;  2IA2 A;  1D3Y A;  2P81 A;  4OIN F;  1H8A C;  3NWT A;  4IHX A;  3K1M A;  2ID6 A;  2F48 A;  1ETV A;  2GA1 A;  2VJ4 A;  5IT3 A;  4XRS A;  5B1A H;  1WQ2 A;  3C1D A;  5CPR B;  2HYG D;  3WGG A;  3ZMD A;  5DYM A;  2MH2 A;  1G59 A;  4NQW B;  4UY8 I;  2KIS A;  1BI3 A;  3K4L A;  3CCV I;  2CMP A;  1E3O C;  1P7I A;  4HF0 A;  3GTK J;  4IXA A;  2W4S A;  3VYU B;  4U7B A;  1O3S A;  2V4J C;  2Z9O A;  4MFD A;  3SDB A;  4DIQ A;  2DJI A;  3GTQ J;  1N75 A;  4CCK A;  2GLO A;  4C2T A;  3CCU I;  1ZLJ A;  3K4M A;  1D0Z A;  2W25 A;  4B47 A;  4RA2 A;  1YRN A;  5M5X J;  2XAQ A;  4UVB A;  4CCJ A;  2CSO A;  4ZZL A;  5HOD A;  5A2Q Z;  1FWZ A;  3GLL A;  2EFQ A;  3H5A A;  3FIW A;  3OYE A;  4E6K G;  2HNH A;  1JTX A;  2LMD A;  3ERM A;  3VEP A;  2X6X A;  1TQI A;  5H20 A;  1F4K A;  2O61 A;  2JMW A;  5J1R A;  1ERD A;  4BEH B;  4HLY A;  2RKH A;  4KJZ A;  3QOD A;  5M5W J;  3PUB A;  3KCC A;  1SD6 A;  5IT9 Z;  4XLE A;  2BE5 F;  4FX0 A;  1K79 A;  2L9V A;  2GA2 A;  3IC7 A;  2X9D A;  4BAY A;  2BW3 B;  1QPI A;  2ZJQ F;  4JK1 X;  3A02 A;  5E1Z B;  3I59 A;  4Y13 A;  2DK5 A;  1XS9 A;  2ZSI B;  5DV5 A;  1B9M A;  3I3L A;  1XMX A;  2JRM A;  3ECH A;  4YG2 F;  4Y52 J;  1NG6 A;  2M30 A;  4C3J J;  4ZZD A;  3T8R A;  2HQR A;  3J7Z I;  2JUG A;  5EZG A;  1E17 A;  2J5P A;  2VXZ A;  4MIM A;  4F7Z A; 
#chains in the Genus database with same CATH homology
 2QEX I;  1VQK I;  4IOA F;  1YIT I;  1VQN I;  3CC7 I;  2K3F A;  2ZJP F;  3I56 I;  3CCQ I;  2H8W A;  1YI2 I;  5GAG J;  3G6E I;  1VQ4 I;  3PIO F;  5GAD J;  3G4S I;  3PIP F;  1VQP I;  1VQO I;  4V19 K;  2QA4 I;  3CCL I;  3G71 I;  1YJN I;  3CCE I;  2JQ7 A;  2ZJR F;  5JVG F;  3DLL F;  1VQ5 I;  3CMA I;  1YJW I;  3CCM I;  3CCJ I;  2OTL I;  1VQ6 I;  4UY8 I;  4IO9 F;  1YHQ I;  3CC2 I;  3CCV I;  5GAE J;  3CD6 I;  1S72 I;  1ACI A;  1VQ7 I;  1FOX A;  3CJT B;  3CCU I;  1MMS A;  1YJ9 I;  2E35 A;  1QA6 A;  3CC4 I;  1FOY A;  1VQM I;  3J7Y J;  3CF5 F;  5DM7 F;  5GAH J;  1Y39 A;  3CME I;  2E36 A;  2OTJ I;  2NXN B;  1HC8 A;  1FOW A;  5DM6 F;  1VQ8 I;  2ZJQ F;  1YIJ I;  4IOC F;  2E34 A;  1VQL I;  3I55 I;  2FOW A;  1VQ9 I;  3CCR I;  3J7Z I;  3CCS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...