2DOEA

Solution structure of the third ff domain of human transcription factor ca150
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
GSSGSSGEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation regulator 1
publication title Solution structure of the third FF domain of human transcription factor CA150
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 17
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2doeA00
2DOFA 2L9VA 2KIQA 2JUCA 2KZGA 2K85A 2B7EA 4FQGA 2DOEA 2E71A 2KFDA 1UZCA 2DODA 2LKSA 2KISA 2CQNA
chains in the Genus database with same CATH superfamily
1F4KA 4HYEA 1ZN2A 1JUMA 3CDIA 2YR2A 1FEXA 4UHTA 1OFCX 4Y7NJ 2L0KA 5FLMJ 1V4RA 3GTJJ 3LSHA 3K10A 5E1WA 2QKLB 2IVMA 5J1YA 4J19A 3RZDJ 4CCNA 4NC7A 1Q1VA 3KLNA 3O2PE 4R1HA 3JREA 5LHIA 1REPC 1L0OC 2HKXA 3DTEA 3HTSB 2VBXA 2RQPA 4CYDA 4LB6B 3CMAI 2Y2ZA 4XR6A 2JZYA 2HZDA 4IHWA 2X1EA 5FKLA 2B63J 2L54A 3LA2A 1H0MA 2PI0A 2L01A 3G73A 2K4BA 4ZTJA 5DDGA 3MKWB 2JPBA 3HOTA 3HXLA 3V7CA 3S1RJ 2BBYA 3HBLA 4NUBA 5DYMA 1GDTA 5LFAA 1BOBA 4U87A 1TQPA 2CUFA 2OA4A 3C2GA 3T5XA 2F6CA 1RC9A 2ICWG 2LH9A 3J80K 2VUMJ 3DPTA 1FOWA 2LNBA 2KT0A 1YE9A 3GWZA 4JP0A 4R8HA 3TOBA 5LBQA 4KIFA 2HXIA 2XDVA 5HDKA 3JR9A 2E60A 1AKHB 4B1RA 4ZYAA 1MDMA 2E1MC 1HA8A 2DMNA 1Y1WJ 3HUGA 1ZRFA 4XOTA 5EJCA 1D0XA 1YFHA 2GZWA 2MGQA 2GIVA 4L9VA 2A5YB 3D5SC 3QYFA 4A69C 3CC2I 3FZVA 3K1MA 5M5XJ 3IUOA 3IWFA 4RGUA 1W0UA 4RGXA 1WHUA 2Z1DA 1GUUA 1D3YA 1SFKA 1JUSA 1D1BA 1OKRA 2A07F 3W6VA 2DA5A 2I8DA 4BKXA 2M7BA 4IOAF 5IT9Z 1WWXA 2VT2A 1BA5A 3B6CA 2E5ZA 3DEEA 3OYCA 2R7WA 4PK4A 1MGTA 3IL2A 4WXCA 5FKOA 5JFRA 2ELHA 2UXXA 2R7QA 3ESWB 2ZJRF 3F22A 3F8CA 4BDYA 3A01A 2DXIA 3GZ6A 1SC7A 3P9KA 4EV0A 4WK8F 1PVEA 2BY1A 4IRGA 2M8GX 1G4DA 3KYDB 5GTIC 1A6IA 2VKHA 5FFZA 2CO5A 4RAZA 2VL8A 2WTEA 4LJZF 4XORA 4WXDA 4ZC3A 3BCAA 2NVQJ 5FKNA 1OCTC 3M7GA 1ON2A 3BROA 1G59A 1SAUA 3DCFA 3H3UA 4HA8A 5HLHA 2R7FA 2X1CA 2ZNZA 1VTNC 3CC4I 3I4PA 3OL3A 3IWZA 1NG7A 2B9SA 1W5TA 5KAFC 4F93B 3PSFA 1E3HA 5KNLA 2MH2A 1LUJB 2HYFA 4C3JJ 4EJUA 3RJPA 1A35A 4YFXF 3BG6A 3S17J 1LFUP 1S72I 2COBA 1FMWA 3RCOA 3UKGA 3EUHA 2V9PA 2HVQA 2YSRA 3DP7A 1FP1D 5D6EA 2VONA 2JN6A 3DPLC 2UUZA 5M5YJ 2DDAA 3WTTC 2LOOA 4GYIA 1A5JA 1VI0A 2WADA 2ZB9A 1UELB 2CG4A 1Y56A 1ITYA 1WJEA 4UXNA 2D45A 3CF5F 5J1UA 2E36A 4CDGA 4M71A 2ZXHA 3J7AO 2IS2A 4C2MJ 3G2BA 1ZRCA 3RSNA 1I1GA 5H20A 3S32A 3OMYA 4HSTA 3I4MJ 4P55A 1K6YA 4Q48A 4BHBA 1E0EA 4RAYA 4BH9A 1W4MA 3DTKA 4RM3A 2GAUA 4LLGF 1P2FA 1HW1A 4UB6C 2W24A 3K0LA 3F6VA 1GLNA 3ZQFA 4C2TA 2IGKA 2F5FA 1PP8F 3C2HA 1S7OA 3FMQA 2F48A 5HS7A 2AHQA 4L0YB 1QZZA 4BQAA 3WGHA 3H0DA 4CZCA 1XC5A 1N75A 2JSPA 4B44A 3BJ6A 3I5UA 3HGGA 2KRFA 1XSXA 4XLHA 2V6EA 1OLTA 2ZFUA 3HSFA 2RVCA 4AUXA 1TLHB 1P4WA 3EUAA 4UVCA 4HNUA 3PUFA 2Y0MA 3CCVI 3CO6C 4WWCA 3DLLF 4E7KA 4E4HA 3K6GA 1NH3A 5E8GA 5LGNA 3NWSA 3S14J 1Z6RA 4FE4A 3LSJA 3IRQA 2QBYB 3CCSI 1LDDA 4LG0B 4Q47A 4EM1A 5D5UB 1SANA 3GMEA 2ZCWA 2ZMEB 2YU9J 5J40A 2LY1A 5EGOB 3E5XA 3FMSA 3K70D 1Z9CA 2JQ7A 2VPLA 4HNTA 4Y52J 2A5WA 3R60A 5DD8A 1IV8A 4HOBA 2X4HA 4UUSB 4L0ZB 3BJOA 4PJLA 3ZCOA 2Y48A 1XTAA 4UVBA 5HS9A 4M3FA 4XLEA 3ZMTA 1MBEA 4A3FJ 1O7LA 1S7AA 3M07A 3Q3SA 2DU9A 3LSTA 5GAGJ 3F3XA 4M6VA 2CYYA 2V26A 2OTJI 3MKLA 4ZDOA 2HPMA 2V79A 1MBHA 2GXAA 2Z5UA 1R4NB 3LA7A 2RV8A 3W2VA 2TDXA 4RA2A 5EEGA 4OMZA 3GTMJ 1W7PD 2QZ8A 4IJAA 3D5LA 3H5RA 5JHFA 4WCGA 2EILH 3GLXA 1XGOA 4L9TA 3IHUA 4NB5A 5L3BA 1G6NA 3JW4A 1Z05A 4KT6A 3OS1A 3NAUA 3Q9VA 2CUZA 1MW7A 1R49A 1OMIA 1YLFA 2K9MA 3F72A 2R4GA 2X6WA 1TBXA 3ZN1A 2GA2A 3SEQA 1MNMC 1ETOA 3ABTA 3ECOA 3FX3A 4I0AA 4A3DJ 1K4SA 2PMZN 3EDPA 2KJCA 2Y9ZA 3PSIA 3LL7A 2STWA 1IDZA 2M9HA 3K4CA 4IHYA 1R6RA 4LLLA 3U1KA 4DZPA 2RNJA 2H8RA 2F4MB 5J8FA 2NXNB 4M3BA 3U2RA 1ZTRA 4AIDA 3ASNH 4ANJA 4CCLA 4XRSA 5GAHJ 4IHTA 3KP6A 1LDJA 3BZ6A 1W5CC 2VQCA 2QBYA 3ABUA 4LG0A 1JHHA 4KJZA 2ZMEA 5EGOA 2D5VA 4ZYHA 2WWYA 3M8FA 2LKSA 2KRHA 2DMTA 2KIUA 3VWBA 4UUSA 5F0CA 2FMLA 1IG7A 4G12A 3OOUA 5IPAA 3HRUA 3MKYB 3B73A 2LKPA 2B0LA 2FXAA 1IXRC 1YW8A 3CESA 1U0JA 1X1AA 2WY8Q 2DOAA 3BG5A 5E1XA 5F08A 2DYSH 2CW7A 2K9LA 2K9SA 5F04A 3HOXJ 2TRTA 2Y30A 2R7TA 1EJ9A 3CDLA 1F5TA 2YX7A 1X1PA 3PQKA 2OAZA 3MN2A 4HV5A 2CRGA 2WB1A 4U88A 3BPVA 1EH8A 4L5JA 4H4KC 2X48A 3WTZA 1JKRC 5CLSA 2DA2A 4I2OA 3SQNA 5JR3A 1J09A 1R22A 2M4GA 3KIOA 1LVAA 2OF7A 5BMZA 2M34A 1ZREA 5ICEA 5KVRA 5LEJA 3I55I 2MFZA 4FX0A 4HX8A 1MSFC 2J5OA 3NRVA 4HDVA 2H6BA 2ME6A 1KU7A 4BBRJ 4ABZA 3ZN0A 1S7EA 3EYYA 3ISPA 3H0GJ 1D8KA 2JTVA 4BJTA 3OS2A 1USSA 2X9DA 4GDFA 3TO7A 1ZGWA 4E7ZA 3EUHC 5D4RA 3MZ8A 2M45A 1FOYA 2PBIA 3CLQA 2AXTC 1I1SA 1G3WA 3PNYA 3QYEA 3E7LA 4GO1A 1T33A 3R0JA 1YRNB 4DBQA 3JTGA 4BY7J 5ICFA 5BS6A 1YJNI 5L3EA 2EPFA 1DQUA 1V54H 4NC6A 4CSWA 5LHGA 3IKTA 4KYWA 2DAOA 4IVNA 1FZPB 2NVTJ 2DFEA 1K78A 4P5OA 1OJLA 3BDDA 4FT8A 2KIFA 3OYGA 3F8NA 4DZJA 2HOEA 2IW5A 4ESJA 2IS6A 3WU2C 3K4NA 5L3GA 4BHPA 3B6AA 3N05A 2L7FP 2DLLA 2JMWA 5DUKA 1PUEE 3BZCA 1HSJA 3I64A 4Y33A 2VBWA 1XDUA 1T95A 2CH0A 4II3A 5GP9A 3WE3A 5IYDJ 2XASA 1SMYF 3OOPA 1Z21A 1N25A 2F5EA 3ZGKA 5DM7F 2VLAA 1MMSA 1BI3A 4HX7A 2M1BA 3G71I 5HNHA 3I56I 1SFOJ 2Q2EB 2O6GE 3HKZA 2LD5A 1R36A 2M8EA 5J3LA 3RPUA 5HS8A 5A2QZ 5H2FC 1NTCA 1C0WA 1ULYA 5EZHA 5E18F 3FWEA 3HPGA 2E5NA 2YX4A 2KJBA 4NBQA 3Q0WA 2L9SA 3RYPA 4FASD 2F5DA 4YEJA 2ECBA 3OS0A 2NS7A 3KZIC 4J01A 2JA6J 2VPRA 4EJVA 3RDIA 2BW3A 2M0MA 2IA2A 2OJED 1F36A 2KPMA 2K7LA 1D0ZA 2MSYA 2G7UA 4EEFG 5LGUA 2QSHX 5DS9A 2IBDA 4Y3OA 3WTVC 1I50J 1TWFJ 3S2DJ 4IHXA 1OISA 2MH9A 1LFBA 3RPQA 4EGYA 1YRNA 2D1VA 1VQ7I 3BG7A 4L9JA 2KZVA 4IHVA 1ZARA 1ZELA 2BY2A 4EJWA 1IF1A 4AVPA 3H5NA 3ONQA 3AG2H 4YFNF 2HOSA 2KISA 2FUG2 3G1MA 2MG4A 3BP8A 3SZGA 1IUYA 3TOAA 5HODA 4IZZA 1A04A 1DPRA 1I3AA 2RQQA 3U1DA 2HTSA 1DP7P 4BNCA 4EM2A 5GPCA 3TO9A 3BPXA 4I76A 2R7DA 4HSRA 2FX0A 3MWMA 1BC8C 3MZHA 3AL0C 1OPCA 1Z6TA 2M30A 1ZG3A 1QO0D 2CWEA 2CGPA 4A3IJ 4XKWA 3V8KA 3GXOA 2XRLA 5EYRA 2JRTA 2O0YA 2XHKA 1J7KA 2Q2EA 1K7AA 2K85A 4NHJA 5HVQC 1X1BA 3P9CA 1TL8A 5ILUA 5FO5A 4MTEA 5FKKA 3TO6A 2CMPA 5DCMB 1ZG5A 1XMXA 2XIGA 1CGPA 2E2HJ 1WI3A 4U0WA 4AWXB 2VBYA 2ACJA 5HDNA 3COAC 1NG6A 1AA7A 2LREA 4F52A 4IPAA 1LFPA 2ESNA 1DGRM 1UAAA 3H36A 2WBMA 2ME0A 1BOAA 3ABKH 2ELKA 3G3ZA 2LFBA 3OSGA 1BM9A 2VQLA 1GXPA 1EKEA 1Z7LA 5FJ8J 2M5WA 4AU7A 1MH3A 4LG3A 5DCFA 2OPTA 5E17F 1WJ5A 5L3CA 2R5ZB 3CCYA 3TBIA 5CVIA 3ZMUA 3OWTA 2FD5A 3SYTA 5LD2C 4NQWB 4GGGA 3HOVJ 3P7NA 2DODA 3GEZA 2DO7A 1IN6A 2EV0A 2QENA 1X3ZB 2Q1ZB 4ZDLA 2H1KA 1X19A 1IXCA 3TP0A 2TCTA 1Y8QB 3KCCA 3Q0VA 3QQAA 1KZHA 4DIQA 1VQMI 3WU1B 1Y6IA 1CF7B 3ERMA 1VQ6I 5TISC 3CCQI 2H6CA 1WI9A 3T8RA 3PO3J 5IT9K 1RESA 2JA5J 5ILSA 2ZKZA 3BLYA 3BOQA 4LGWA 1SMTA 4HZFA 4W97A 5IY5H 1O3QA 4PJJA 4P1WA 1OCPA 3M8JA 4RDUA 2W00A 3L2UA 2KL4A 4FQGA 4IRHA 5D5XB 1LJ9A 1XN7A 4XLAA 5F6FA 3RKQA 1AHDP 3E3VA 1FIPA 4A3KJ 1YW7A 4LFUA 4D9JA 5B1AH 2XV4S 2G7HA 2LY2A 2KZGA 3BR6A 3K4MA 4F55A 1Z3XA 1PDNC 2A69F 1JT0A 4E7SA 3PNVA 5GTHC 4ETSA 4OAZA 4BAYA 2MW8A 1G3TA 1T08B 2VQGA 3S3NA 4DOZA 2BHYA 1EF4A 3IKVA 4P9UA 2ID3A 2ZSHB 5K5QA 3AKZA 3H9QA 2GLOA 4KNYA 3JRCA 1V3FA 1OR7A 2EV5A 4HBLA 2X1DA 3E0JB 4BE1A 3GW2A 4BE0A 1S5LC 3FBIB 3RYRA 3LSIA 4WX9A 2IGOA 2OCCH 4GXOA 5DM6F 1U78A 4O3MA 2EZIA 1HW5A 3K69A 3NWTA 3DU5A 4Y17A 3C7JA 4C3IJ 2NYXA 1T0FC 3A03A 3QPLA 2VBZA 2B7EA 2WV0A 3L09A 4MEXF 4M3EA 4I98B 2C6YA 5D6FA 4NQWA 3V42A 1QQIA 3CP8A 3PIPF 2DA7A 1BI0A 3C1DA 1YQAA 4A6DA 5EG0B 1CF7A 2DT5A 2CQ7A 2G0EA 3CJNA 3KFWX 3F8FA 3OYAA 3NQOA 4C9YA 2F5CA 3IAS2 2EWNA 4HV6A 5F27A 1VQ4I 2G9WA 3QPHA 2X6YA 2P6TA 2VJIA 2HFHA 2L7MP 4GCVA 3QP6A 4QIWN 1UJ8A 3L2VA 2EV6A 1H89C 1R00A 4LB5A 2XROA 2A6HF 2W25A 1PUFB 4YG2F 3OYBA 1VQKI 1R5ID 2P7VB 2LYCA 1LEBA 2YU3A 3OIQA 5J4YA 2JA8J 2WV1A 3HZJA 1KU2A 2UV1A 3MCZA 1R58A 4BYYA 4LMYA 2GOXB 2LF7A 4CCOA 3WTXC 3WTUC 1NK2P 4N9IA 1JXSA 4UVAA 4KDPA 4YRVA 5IYBJ 4KICA 3DV8A 4FTHA 3DF8A 2BHZA 1UMQA 1P9QC 3HM5A 3LMMA 2DFFA 3MEXA 2MBFA 2DW4A 1QNTA 1ETYA 3I58A 3TP3A 3K4KA 4ENMA 2Y75A 3IAM2 5CVJA 3G1OA 2E7XA 2M4KA 3VODA 1ZR4A 3E5QA 3KP5A 3H1CA 2NNYA 3ASOH 3HYIA 3I3LA 4M9ZA 3I9V2 5KCMA 3FXOA 1DU0A 3G1LA 3HDDA 1LDKB 2OU2A 2DA4A 3UR3C 4NC8A 1FY7A 1IN5A 4QPQA 3P5JA 5FFXA 4B3XA 3GFIA 3G4SI 2OQRA 2XGDA 1J59A 1ETXA 2XPVA 4B4CA 3ABLH 5BPIA 2XAQA 1QHHD 3ERED 2PLYA 3LSGA 1VQPI 1LKXA 2N8GA 4B43A 4OIOF 4M3GA 5EG0A 5FRMA 1U2WA 2MD5A 2V7FA 2R5YB 5GPAA 4OWRB 4BBSJ 3J7AY 1RZ4A 3H3ZA 2ISYA 3VYSB 1OCRH 1UCRA 1U3EM 4UB8C 5F1JA 4CCMA 3TEDA 2OV7A 4Z6YA 2DQLA 1I27A 1AKHA 3BR5A 1JKQC 2M2EA 1XMAA 3PQJA 2O03A 1TQMA 4CYCB 5L3FA 2HVSA 4B48A 5C4JJ 3K1NA 2ETHA 1IRGA 4EGZA 3HGYA 4G8XA 3BTIA 2XKOA 3O6BB 1MKMA 2DQRA 4FISA 4KUMA 1Y39A 4F7ZA 1Z3YA 4UUTA 4FX4A 2QUFA 3LSMA 1LE8B 1APLC 4IRIA 2EQRA 1IC8A 2UXNA 3IH4A 3FISA 3WHBA 1UG2A 3RKXA 3ZQGA 3HHHA 1JJ8C 3LFUA 2DJNA 2FOKA 2STTA 2RKHA 4E7JA 2DK5A 4XLCA 5ICGA 5BPDA 2HDDA 2VE8A 2DOFA 4V19K 5DV5A 3I53A 4CHUA 1BJZA 4BQOA 2VJ4A 3LSKA 1IUFA 4DJAA 3LQQA 2Z9OA 1HKSA 5LRRA 1FMVA 3CZ6A 1KU9A 3W2AA 3DBRB 4MQ9F 3BR3A 4G9YA 1R1TA 2PMZA 2K40A 1V55H 4M73A 2VN2A 4A3LJ 2ELJA 2R5YA 3GTOJ 2FSWA 1Q1HA 4IEJA 2L4AA 4V2FA 1ZG1A 4BXFA 2HQNA 2LTPA 4KITB 2L9RA 1TC3C 1BIBA 2DA1A 2ZC2A 2VIXA 4GFBA 3I54A 3VEPA 3VYTB 2DPDA 1T2KA 1OCZH 4A93J 4W1UA 2YS9A 3HOSA 2O3FA 1U5TB 3S3MA 1B4AA 2JPCA 3BCBA 3F8BA 3IRRA 1J2XA 4BY1J 1KYZA 1OCCH 5D4SA 3EUKL 3T1BA 1LE8A 3UNGC 1T98A 2HYGD 2YPRA 3PJRA 2JA2A 1RKWA 2M7AA 4N0BA 3ELKA 1QZEA 4MFDA 3A4CA 3ZOBA 4CCKA 3L2QA 1B6AA 1QHGA 4MLOA 3BT9A 2JVGA 2F2EA 2R92J 1J0RA 4EMSA 2RGVA 4MNUA 1X4OA 2FU4A 5GADJ 2X0LA 1YIOA 1S3JA 4PSWA 4HNVA 3ZP5A 3BR1A 1W0TA 4XONA 1FBQA 1B59A 4AYBN 4CO8A 4S0HB 2VJJA 2XGXA 1GVDA 2NNNA 4K2EA 3A2KA 1BI1A 3G6EI 1XCBA 4JX6A 4HF0A 3SZTA 4A0YA 2UWMA 5CPRB 4R79A 4BDZA 3HOZJ 1ZRDA 1MBJA 3VDXA 3X2QH 3JRGA 3HIFA 1YITI 2FBHA 2R7OA 3OYFA 2VOOA 2QCOA 3DKYA 3E6MA 4S05A 2Z16A 2GM4A 1FWZA 1FC3A 1DP3A 5EEAA 1KQ9A 3KEOA 4Q5SF 5FB2A 4L18B 1WJCA 4RGRA 1TZLA 3ZPLA 3QPSA 2GA1A 3I4NJ 1ZLJA 3EPZA 2XPWA 2V6CA 1ETQA 1EH7A 5A2QK 3S2WA 4I7HA 1KU3A 2JWTA 3TW6A 4EJOA 2ECCA 4RBOA 3QOEA 5ILVA 1LB2A 1YS7A 3MMYB 1X2NA 2XSDC 2OZ6A 1I39A 1U5TA 5CVRA 1D5VA 1XDSA 3F8MA 2PJPA 2VE9A 2ZXJA 4D7NA 1U8RA 3VB2A 2O5RA 3CC7I 3VFZA 3LFKA 5D8LB 2LSOA 2VI6A 1BJAA 3ZR8X 2CQNA 3FXKA 4ZYEA 1TWAJ 3GFLA 3BWGA 4Z2YA 4HF1A 4A2UA 3OYMA 3MFKA 4P9FA 4PJNA 1PJRA 3GCMA 1B8IB 4UNOA 2QYOA 1QVUA 3HB9A 3LNQA 2L02A 4OOIA 1RR8C 3GTLJ 3JSOA 4HEA2 1BIAA 2JT1A 3BJAA 3GO5A 1UG0A 4AC0A 5EDNA 1J9IA 3GTGJ 4X1EA 5E8IA 1MBGA 3FHZA 4KT5C 1JTXA 3KYLA 3PUBA 5K7HA 1WKMA 2X6XA 1F1ZA 2EA2A 4MFEA 1EA3A 1MMDA 1HLVA 1YS6A 2K02A 2H8WA 1GVJA 1ZR2A 1VQ9I 1ETKA 3EETA 3L2WA 2JJ7A 3CD6I 2BZTA 3TKYA 3KEQA 4N4NB 3QOPA 5IP9J 4LOCA 1MMAA 2HKOA 3H35A 3WODF 4IO9F 1BW5A 1G3YA 3JAMZ 1A31A 1XPXA 5HOOA 3SJMA 1VQOI 3BQZA 1P7IA 1Z1DA 2P81A 5EF6A 3QWLA 4CZZA 3Q5FA 3VSLA 5KAIC 1JI8A 3U9GA 4IOCF 4IF4A 2CV0A 5F0HA 4ENJA 1HQCA 1E2XA 2XRNA 4XSXF 1QVTA 3IH2A 4HDUA 1XGNA 2CQQA 3E97A 4KIBA 4IX7A 3S3OA 1IAWA 2L7ZA 1ENHA 3JRIA 1SD7A 3W2WA 3B02A 3PFYA 1WJAA 3V8JA 1FSEA 1FSHA 1FYKA 2WC2A 2W4SA 1YIJI 4C30A 2R7VA 1RNLA 1ZQ3P 1TTYA 5J6XA 4G7ZF 3L1PA 2ZNYA 2MD0A 3QAHA 5H6QA 4BEHB 2EFWA 3OSFA 2FBIA 5B5EC 3IP4B 3AAFA 4L9NA 1FNNA 5BNGA 1S9HA 2Y0SN 1ZAOA 1MZBA 5HDGA 2VC1A 1VQLI 4ZTFA 1R4MB 4HW0A 1I5ZA 5IOYA 1FOKA 3M1EA 2QQAA 2V1XA 1S29A 1IJWC 4BQQA 3RI4A 3GTPJ 3FM5A 2A6TA 4U0VA 3DFGA 3PIOF 2HI3A 4PDKA 1RUNA 2YUSA 2H09A 4N9HA 2WB1N 1LQ1A 3EYIA 4DYCA 1OYIA 2WA0A 3BC8A 2GQQA 1OYWA 4PJMA 1K83J 1XSVA 2Z99A 3FXLA 3GZNB 3Q0UA 5B3SH 4AM3A 5IYCJ 2FBKA 2UZKA 2QEXI 3FDYA 1IV6A 2F4IA 3BTCA 2BVMA 1JGGA 1MSEC 2AXLA 1U8BA 4XKBA 2AS5F 3OR1C 2OQGA 5HLIA 2D2WA 5M5WJ 1XCVA 1QPMA 3FK6A 2V9KA 1MJBA 5B1BH 3U21A 3WGIA 1D1CA 4E6KG 3OYIA 3SFZA 4OIRF 4I6ZA 5K7ZA 2NAZA 1LPQA 1MJAA 2KIQA 4HPQA 1Z91A 1TQIA 3CO7C 1AWCA 1RI7A 2FA5A 2F5VA 4B09A 3FBNB 4QLCU 1Z67A 3E1SA 9ANTA 4RLFA 4IQJA 3K1PA 1KGSA 2DOEA 3WU0A 1PP7U 4B3AA 2KIMA 1FBSA 2W48A 3W3CA 1WZ2A 2A68F 3BG3A 4LLNA 1WVRA 4O6JA 1JT6A 2VQHA 3C3WA 4FETA 1D5YA 1RPWA 1K79A 5LGTA 2XB0X 4II2A 4BS9A 2R7XA 2K3PA 1V5FA 4PGHA 1T38A 4HG2A 1IDYA 1E17A 3ZQQA 3CDHA 3H92A 3TQNA 1BI2A 2CJJA 2BY0A 2BY3A 2R7ZJ 3RQ4A 1VZ0A 1X1DA 2R7RA 2CW8A 3K2ZA 2VXZA 1O3SA 3BG9A 1FTZA 3TMOA 2L7KA 2M3AA 1Z77A 1SD4A 1P4XA 3NARA 1JKPC 4BACA 3DEWA 4DBRA 1YOVB 2LKXA 2O8KA 5CYVA 4DYQA 3TL4X 1I6HJ 3L00A 4LITA 1MBKA 3RKYA 3HKZN 2ZMEC 4KN7X 4GYGA 4P96A 1YW9A 2HNHA 4PCQA 3CUQB 1IXSB 3SEZA 5TJJA 2DN0A 5D5WB 3GFJA 2LG4A 4ITVA 3OIOA 5KK1A 2EZLA 1ORKA 2CFOA 6PAXA 4IXAA 5J47A 1JUPA 2M0CA 3DU6A 3KZYA 3ZQLA 2NRAC 5CVVA 4F92B 1U5TC 2WAFA 1BR2A 3CUOA 2DTZA 2H1LA 2DYRH 3VYUB 4ZZLA 4MGRA 3D0SA 1HKQA 2EH3A 4MTDA 2L2OA 4ENKA 2DMPA 2A6EF 2L5QA 1F9NA 1X58A 2CUEA 2I10A 3A0HC 1B1BA 5CJ9A 3ZRGA 3LSRA 1BC7C 3MQ0A 4A3MJ 4V2GA 1BL0A 2HQRA 4YIFA 2KFDA 3OYJA 1SD5A 2IT0A 1R5HA 3CJQB 1XMKA 2W7NA 3HSRA 5E3OA 1D8JA 5DTDA 2JA7J 2BXYA 1E3OC 2MYSA 4U7DA 3DEUA 1ON1A 1W7PB 1W1WE 1YG2A 2DCEA 5KHDA 1QZYA 4RAGA 5F1RA 2PJRB 1SVLA 4XKCA 1HSTA 1LEAA 3ZMVA 4DW6A 2EINH 2P7CB 3DPUA 3I71A 1GXQA 2P0WA 4UV9A 2W82A 1B72B 4RS8A 2MC3A 1RKTA 2R7SA 2R3SA 3TDZC 4UV8A 3RIRA 4Y13A 2P6SA 4M9XA 2VJ5A 3E6BA 1Y0NA 2LC2A 4MO7A 1YTYA 1R5GA 3JTHA 3L2RA 3FHNA 2A05A 3SDBA 3H3VK 2I5UA 2D1HA 4CUGA 1YJ9I 3P9IA 1XSDA 5K7FA 1P92A 2QGUA 3J81Z 2MA3A 5DCMA 1OCOH 3FF5A 2KKOA 2EB7A 1UZCA 4ENNA 2XUBA 2VKDA 3ZMZA 1FOXA 1ZHFA 5E3LA 3GLLA 3LOCA 3VYRB 2KDOA 4XRMA 1WH7A 1R1VA 3HTUA 3OYLA 1G2HA 3CUQA 1GT0C 2MLKA 1WJFA 2XAFA 5C44J 1FYMA 3DXJF 4E7LA 2GOMA 3WTYC 2LR8A 1R23A 2IGMA 4XBFA 3V7SA 1G3SA 1JTYA 3AG4H 3CJRB 5FD5A 2P5KA 4XM3A 1R9TJ 4B8XA 2LDUA 2R5ZA 3K9TA 1N77A 3KP4A 1NK3P 4EATA 2O61A 2FJ1A 2BOLA 1A36A 2JVHA 4LD5A 4JYKA 3A01B 4HLXA 1I6XA 1LVKA 2E1OA 5IP7J 3CCMI 4A3GJ 1KA8A 3GVAA 3SFIA 1W7PA 3KLOA 5M3FJ 1XD7A 2HQAA 2K3FA 4RM2A 5LHHA 2NOGA 3L7WA 2PJRA 1U6GA 1P6RA 2DI3A 3KYCB 3OL4A 1O3RA 2GWRA 2HU9A 4A0XA 3DBLB 3DKWA 5GAEJ 2WAQN 2XB5A 3RPUD 2VC0A 2ZO4A 1B72A 1TW2A 3M4OJ 4CXFA 4KISA 4XQFA 2QVOA 3DKXA 2PG4A 2W1OA 2HQ5A 4O5VA 3MZYA 2P5LC 2DDBA 1SEUA 3KX2A 2EFNA 1T39A 4RB0A 2AQFA 2DA6A 1IRZA 3SZPA 1G8XA 1SD6A 4OAYA 1L3LA 1RRJA 1X3WB 4XRSG 3GX4X 1FP2A 3BR0A 3FXUA 5L3DA 1ONVA 4A5NA 1ZGAA 1UHMA 2IXSA 2XF5A 1OQYA 2CQKA 4PUSA 3JCUC 1A6QA 4S04A 3KE2A 2IS4A 1V5GA 3WGGA 1WPKA 1ETWA 2OBPA 1ZLKA 3AG1H 4IQ4A 2OCEA 2V1DA 3OYKA 1ACIA 1K6OA 3BZKA 3HSEA 3AG3H 3VSKA 1IZ1A 1GHCA 4M3DA 2M87A 1O3TA 3ABMH 3R6SA 2HWVA 4A0ZA 3ZMDA 1O4XA 1RR7A 2IAIA 3ZQ7A 1FT9A 4YFKF 4FCYA 3FKIJ 1FLIA 3CLOA 1Y0UA 2XGCA 3PL8A 2LK2A 4BJ6C 4HX4A 2OUMA 2MLGA 1VF9A 2LVSA 1EV7A 4KMUX 3HRSA 2PFBA 4IHSA 3PM1A 4JBAA 5K5RA 3ZXSA 4FHTA 5AIPA 2LRDA 1T6SA 1B9MA 5FLXZ 2IA0A 4HF2A 3CP2A 2L3DA 4A3JJ 2NVYJ 2RDPA 1NHAA 2QLZA 3HOWJ 3M1CA 4A3BJ 4OIPF 1YX3A 3BY6A 3BQYA 3CMEI 4XMYA 2Y31A 4E70A 4U0YA 2DJIA 2Z33A 5IOZA 2X85A 1VFCA 2XAJA 1IW7F 4LIVA 3HHGA 3KP2A 2K9QA 1IN7A 2EFPA 5H6RA 1WSUA 3A02A 2E71A 3OYEA 1HDDC 2VASA 1SFEA 2XF7A 5F0FA 2KMUA 2K4JA 3EQLF 5FKMA 3WTSC 1PUFA 2QF7A 1LNWA 1BR4A 2NVUB 3TW7A 2ZJQF 1YJWI 4E7IA 2E2IJ 4A3CJ 4CICA 3OY9A 1MIJA 2FRHA 2EK5A 4GRIA 4OU0A 4XOPA 3A1YA 3ZQHA 2COMA 4ESFA 4KMFA 4EVIA 4JK1X 1YX5A 3W6JB 3LQRA 1ZKGA 3F9KA 3IH3A 2O7OA 1ERDA 1FTTA 2QM3A 4BL0B 3RTRA 2EIMH 4A3EJ 4J00A 2XKPA 2K27A 4LIUA 4A12A 3FXRA 4BJ5C 2HEOA 2A61A 4MEYF 5ED4A 3J80Z 2XVCA 2ZXWH 3I59B 2PN6A 4RMNA 1X4PA 2WAEA 4XN0A 1S8NA 2FNAA 5DEQA 4ASNA 3HJEA 4RB1A 4AYBA 2JSCA 3S93A 4G94A 5ICCA 4E7HA 4ZYGA 3C18A 4ESBA 3CCUI 2XAGA 5AIQA 1D0YA 4A5MA 2GXGA 5B66C 3MKZA 1JKOC 1TW3A 4CH7A 1HCRA 1USTA 3S1MJ 3ML6A 3OR2C 3AL0B 3FKJA 4AD9A 3JSPA 1HXDA 1WRJA 4RGSA 4YELA 3LAJA 3K4BA 5DUIA 2JK3A 2BV6A 2MABA 1OR7C 2EJRA 2QQ8A 5HLTA 4QTRA 3W6KB 4YIRX 2ADUA 5JHUA 2LF8A 4CYCA 4C2UA 3CUQC 4OINF 1ZH5A 2BGCA 4XK4A 4X0GA 3K70C 1WQ2A 1QBJA 1TWCJ 2BE5F 2CQXA 3GBGA 4EM0B 1I3QJ 2R93J 1IN8A 4BE2A 2KLOA 2IS1A 2PEXA 3CMMA 2W84A 1IO2A 5IT3A 2Y69H 3J7ZI 3PFIA 4G6DA 3FM3A 4WF2A 5HNFA 3FK7A 3WG9A 3D1NI 2HGCA 2HTJA 5K1YA 4HQEA 4XLNF 5D8KB 3O8GA 1VQNI 3QYBA 2R7UA 2HOAA 1SFXA 4PFOA 3JAMK 3QPTA 1U9OA 3CF2A 4ZYDA 1H9TA 2IRFG 2V9VA 4JX5A 1MNEA 3LAPA 4I0BA 2EZKA 4QWQA 2PQ8A 3DTIA 5CQGA 3TGNA 3SDGA 4N4OB 5E79C 1MMGA 1FJLA 5ERIA 3I59A 4XL9A 3I0TA 1X3UA 1RUOA 1JE8A 1VNDA 1VQ5I 4F91B 2FMYA 2RC4A 3R0AA 3ROUA 5IP6A 2ZFWA 3RZOJ 4XRFA 2AO9A 3L9FA 2OZUA 2E1CA 2HZTA 4EQQA 3MD2A 4BGDA 3JRAA 2ID6A 2HS5A 4NDLA 2ISZA 1XGMA 4BXXJ 1MJ9A 1CQTA 2GBYA 2Q0OA 2KQRA 5EEHA 1SVMA 3FXMA 3HRMA 1STZA 3K4JA 2IPQX 1ETVA 4BQNA 4BU2A 3KP7A 5E20A 4PJ0C 1IRFA 1HW2A 3REOA 5JI6A 2AQEA 1DPUA 5M3MJ 2EBIA 1HC8A 2MC4A 1FYLA 4D5CA 1ZK8A 3ULQB 3L2CA 3M3YJ 1WJBA 1QPIA 1TP4A 4M74A 1QU3A 2OC6A 3M9AA 3WE2A 2E2JJ 3H9JA 5CQEA 2EFOA 2P4WA 4I09A 4CCJA 1BBYA 1K78B 4ON0A 4EJTA 1K61A 2DMUA 2E35A 1QRYA 2JUGA 3A0BC 2E34A 1YI2I 1XX5A 2QKMB 3Q9SA 3S15J 4ZH4F 1HOMA 1R1UA 4XN3A 2PMUA 1MD0A 3HEFA 5EZGA 2Y0SA 2ESHA 2DA3A 4H0EA 3S16J 3M8EA 3ZMSA 1J5YA 1WCMJ 1TT5B 2BYVE 3WG7H 4U7BA 2F4OB 3GFMA 3KPHA 4L5IA 2VKVA 3CMYA 2HPIA 4ZDPA 1BW6A 2CUJA 4KN4X 4D5FA 2R0QC 1ZGJA 4MHGA 1YHQI 3HOUJ 1EH6A 2OD5A 2IJLA 2NS0A 1Y8RB 4I99C 2CFXA 2CW0F 4HAMA 2E1NA 1N78A 3OYNA 1UB9A 3LSPA 5FD6A 1FX7A 3GUDA 3AFHA 3DWLE 2NVXJ 2Z2SB 2FQ3A 4G6QA 3QU6A 3DBHB 3CCRI 3KETA 3F6OA 3NEUA 2FQ4A 4X6AJ 2DT7B 2E7WA 5TGTA 3TDUC 4PGGA 5E3MA 3H5AA 2VXDA 3OV8A 4MIMA 1TNTA 2E1MB 3O3KA 2HXOA 2BW3B 3RKWA 1MMNA 4XLFA 4M6XA 1T8IA 2ZXIA 2JRMA 2RREA 2V4JC 4PSXA 2EFQA 4RAFA 1P7JA 2FE3A 1QGPA 4M6YA 3WHCA 2XSJC 1S6LA 3R4KA 2BEOA 1UHWA 2X6OA 3CCJI 1HF0A 1M1EB 4DNCA 1JHFA 1SAXA 2Y9YA 3N4MA 1B9NA 2CS3A 2NS8A 4XLPF 3JRDA 2RAEA 2XPUA 2W85A 2WY7Q 4I02A 4A6EA 1TWHJ 2W57A 1RETA 2IEKA 2RN7A 1TNSA 5CVUA 5CKTA 1SVOA 3FIWA 5J1RA 1TWGJ 1FBUA 2V1NA 2P5VA 5LRSA 1X1CA 4BUPA 1SFUA 1B8IA 3BR2A 2EIKH 3MVPA 3HOYJ 4KIGA 3ECHA 1JJ6C 1T0FA 1MNDA 5FROA 2KHMA 3E5UA 1IRXA 3F21A 3IV5A 1AU7A 3R61A 2XAUA 4XICA 2QA4I 2X51A 2XGEA 4AIJA 3RQIA 4ZJZA 5J4VA 4D0PA 1T56A 3K7AJ 3FXJA 2GXBA 3N97A 3V8LA 2DT6A 4AIHA 3O8HA 3F23A 1HBXG 2KP6A 2DBBA 5JLXA 1KQ8A 3E6CC 1W5SA 2QWWA 1J75A 1WGXA 3GYHX 3T0YA 2E19A 3DLAA 2O8XA 2LBFB 2Q8KA 4KA4A 2A3SA 3BTJA 2ZJ2A 3CTAA 3CQZJ 5E3NA 2L9NA 4ZZDA 4XIDA 1JGSA 1WJDA 4XKVA 5DD4A 2ZBKA 1YO5C 5FGMA 5LEKA 1FIAA 2CSOA 1W36C 2IA1A 2IGNA 3J81K 4G6TB 1R71A 2QSGX 1PYVA 3FMRA 2LLKA 1HDPA 1P4AA 2K9NA 4HRIA 1DGWY 3MAJA 1TT0A 3D5RC 4I01A 1H8AC 1K4TA 4C3HJ 4D7MA 1OYYA 1ZYRF 4LK1F 3J7YJ 4BEHA 5F64A 1KYWA 4F3QA 2VODA 1KQ0A 1W36D 2NOJB 4YIIA 3C2BA 3CCLI 4OIQF 2GIZA 3CJTB 4PZJA 3K4LA 1Y1VJ 3GZ5A 5K5OA 4XNFA 5BOXA 4WXHA 3QODA 4HQMA 2FEZA 3HPHA 2LMDA 5J8CA 2HR3A 3S1QJ 3E6DA 1O57A 4UUVA 1Z0XA 4HLYA 3JRHA 3PNTA 3BTLA 5TRDA 2EZHA 1H9GA 1IN4A 1KONA 4G7HF 2DK8A 5FLVA 4B47A 1F43A 1DU6A 2VB6A 4OMYA 4L5EA 1POGA 1XGSA 5C3EJ 2CV1A 2FNPA 2XAHA 3HC7A 1RIOH 2PMHA 3V4GA 3GF2A 5JVTA 2HVRA 1QA6A 1R7JA 3LWFA 2VT3A 1GV2A 2DTRA 4JQFA 1HKTA 1XG1A 3PO2J 3HG9A 3V7RA 2DFHA 4M72A 2ZJPF 3LA3A 3QP5A 3S1NJ 3JRBA 5JVGF 2LBFA 3VOEA 3ZQCA 5AONA 1ODDA 1UHSA 4Y4RA 1E3PA 3IC7A 4Q4ZF 5C4XJ 1UFMA 4QSHA 4DQ2A 2JUCA 3S2HJ 1MH4A 3FXQA 1H88C 2OTLI 1V5EA 4AVZA 2LP0A 2O9LA 3SHFA 4BXUA 5D5VB 3OYDA 1IGNA 2DFIA 2L9VA 2HDWA 2XF6A 1VQ8I 4JX4A 3VPRA 1Z7UA 1DDNA 3QRFF 4BHCA 2FOWA 2HYJA 3F0CA 3T8TA 1YYVA 2QQBA 4M9SA 2P8TA 2FF4A 3OIPA 1U9NA 2CU7A 5JLWA 2XC7A 4FE7A 3ZQIA 3HL2A 2CV2A 2KRCA 2BXZA 4IKFA 4MQVA 2Z3YA 2HDCA 3DQVC 5E1ZB 1WFXA 4D1QA 2V1UA 2DPUA 3S8PA 3OYHA 4DGWB 2K5CA 2EA4A 2VOPA 1BR1A 2K86A 5FRNA 2WAQA 1D1AA 1BN5A 1MBFA 4TV7A 2KDZA 3CCEI 2BVLA 2QSFX 4DYRA 2ZSIB 3H9GA 4LK0F 3WTWC 2EIJH 4PFPA 4XSZF 1XB4A 3HRTA 4CGZA 2PX9A 3GTKJ 4JOMA 1GV5A 4KFCA 4UY8I 2IP2A 4QPOA 1MDMB 3KP3A 3JRFA 4RLQA 2QQ9A 1WH5A 2VKEA 4G7OF 2LY9A 3KZZA 5LLQA 3HUGB 1XS9A 2J5PA 4AIKA 2DMQA 3KEYA 2HOTA 1AOYA 2H94A 2L4MA 4NNJA 5FLXK 2H27A 4Y15A 3GTQJ 5HLGA 5BQTA 2RNGA 1FPQA 1DUXC 3QU3A 4CA0A 4IL6C 1O7FA 4RB2C 3SXYA 1X2MA 3K2AA 4RB3C
chains in the Genus database with same CATH topology
2DOFA 2L9VA 2KIQA 2JUCA 2KZGA 2K85A 2B7EA 4FQGA 2DOEA 2E71A 2KFDA 1UZCA 2DODA 2LKSA 2KISA 2CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOF A;  2L9V A;  2KIQ A;  2JUC A;  2KZG A;  2K85 A;  2B7E A;  4FQG A;  2DOE A;  2E71 A;  2KFD A;  1UZC A;  2DOD A;  2LKS A;  2KIS A;  2CQN A; 
#chains in the Genus database with same CATH topology
 1F4K A;  4HYE A;  1ZN2 A;  1JUM A;  3CDI A;  2YR2 A;  1FEX A;  4UHT A;  1OFC X;  4Y7N J;  2L0K A;  5FLM J;  1V4R A;  3GTJ J;  3LSH A;  3K10 A;  5E1W A;  2QKL B;  2IVM A;  5J1Y A;  4J19 A;  3RZD J;  4CCN A;  4NC7 A;  1Q1V A;  3KLN A;  3O2P E;  4R1H A;  3JRE A;  5LHI A;  1REP C;  1L0O C;  2HKX A;  3DTE A;  3HTS B;  2VBX A;  2RQP A;  4CYD A;  4LB6 B;  3CMA I;  2Y2Z A;  4XR6 A;  2JZY A;  2HZD A;  4IHW A;  2X1E A;  5FKL A;  2B63 J;  2L54 A;  3LA2 A;  1H0M A;  2PI0 A;  2L01 A;  3G73 A;  2K4B A;  4ZTJ A;  5DDG A;  3MKW B;  2JPB A;  3HOT A;  3HXL A;  3V7C A;  3S1R J;  2BBY A;  3HBL A;  4NUB A;  5DYM A;  1GDT A;  5LFA A;  1BOB A;  4U87 A;  1TQP A;  2CUF A;  2OA4 A;  3C2G A;  3T5X A;  2F6C A;  1RC9 A;  2ICW G;  2LH9 A;  3J80 K;  2VUM J;  3DPT A;  1FOW A;  2LNB A;  2KT0 A;  1YE9 A;  3GWZ A;  4JP0 A;  4R8H A;  3TOB A;  5LBQ A;  4KIF A;  2HXI A;  2XDV A;  5HDK A;  3JR9 A;  2E60 A;  1AKH B;  4B1R A;  4ZYA A;  1MDM A;  2E1M C;  1HA8 A;  2DMN A;  1Y1W J;  3HUG A;  1ZRF A;  4XOT A;  5EJC A;  1D0X A;  1YFH A;  2GZW A;  2MGQ A;  2GIV A;  4L9V A;  2A5Y B;  3D5S C;  3QYF A;  4A69 C;  3CC2 I;  3FZV A;  3K1M A;  5M5X J;  3IUO A;  3IWF A;  4RGU A;  1W0U A;  4RGX A;  1WHU A;  2Z1D A;  1GUU A;  1D3Y A;  1SFK A;  1JUS A;  1D1B A;  1OKR A;  2A07 F;  3W6V A;  2DA5 A;  2I8D A;  4BKX A;  2M7B A;  4IOA F;  5IT9 Z;  1WWX A;  2VT2 A;  1BA5 A;  3B6C A;  2E5Z A;  3DEE A;  3OYC A;  2R7W A;  4PK4 A;  1MGT A;  3IL2 A;  4WXC A;  5FKO A;  5JFR A;  2ELH A;  2UXX A;  2R7Q A;  3ESW B;  2ZJR F;  3F22 A;  3F8C A;  4BDY A;  3A01 A;  2DXI A;  3GZ6 A;  1SC7 A;  3P9K A;  4EV0 A;  4WK8 F;  1PVE A;  2BY1 A;  4IRG A;  2M8G X;  1G4D A;  3KYD B;  5GTI C;  1A6I A;  2VKH A;  5FFZ A;  2CO5 A;  4RAZ A;  2VL8 A;  2WTE A;  4LJZ F;  4XOR A;  4WXD A;  4ZC3 A;  3BCA A;  2NVQ J;  5FKN A;  1OCT C;  3M7G A;  1ON2 A;  3BRO A;  1G59 A;  1SAU A;  3DCF A;  3H3U A;  4HA8 A;  5HLH A;  2R7F A;  2X1C A;  2ZNZ A;  1VTN C;  3CC4 I;  3I4P A;  3OL3 A;  3IWZ A;  1NG7 A;  2B9S A;  1W5T A;  5KAF C;  4F93 B;  3PSF A;  1E3H A;  5KNL A;  2MH2 A;  1LUJ B;  2HYF A;  4C3J J;  4EJU A;  3RJP A;  1A35 A;  4YFX F;  3BG6 A;  3S17 J;  1LFU P;  1S72 I;  2COB A;  1FMW A;  3RCO A;  3UKG A;  3EUH A;  2V9P A;  2HVQ A;  2YSR A;  3DP7 A;  1FP1 D;  5D6E A;  2VON A;  2JN6 A;  3DPL C;  2UUZ A;  5M5Y J;  2DDA A;  3WTT C;  2LOO A;  4GYI A;  1A5J A;  1VI0 A;  2WAD A;  2ZB9 A;  1UEL B;  2CG4 A;  1Y56 A;  1ITY A;  1WJE A;  4UXN A;  2D45 A;  3CF5 F;  5J1U A;  2E36 A;  4CDG A;  4M71 A;  2ZXH A;  3J7A O;  2IS2 A;  4C2M J;  3G2B A;  1ZRC A;  3RSN A;  1I1G A;  5H20 A;  3S32 A;  3OMY A;  4HST A;  3I4M J;  4P55 A;  1K6Y A;  4Q48 A;  4BHB A;  1E0E A;  4RAY A;  4BH9 A;  1W4M A;  3DTK A;  4RM3 A;  2GAU A;  4LLG F;  1P2F A;  1HW1 A;  4UB6 C;  2W24 A;  3K0L A;  3F6V A;  1GLN A;  3ZQF A;  4C2T A;  2IGK A;  2F5F A;  1PP8 F;  3C2H A;  1S7O A;  3FMQ A;  2F48 A;  5HS7 A;  2AHQ A;  4L0Y B;  1QZZ A;  4BQA A;  3WGH A;  3H0D A;  4CZC A;  1XC5 A;  1N75 A;  2JSP A;  4B44 A;  3BJ6 A;  3I5U A;  3HGG A;  2KRF A;  1XSX A;  4XLH A;  2V6E A;  1OLT A;  2ZFU A;  3HSF A;  2RVC A;  4AUX A;  1TLH B;  1P4W A;  3EUA A;  4UVC A;  4HNU A;  3PUF A;  2Y0M A;  3CCV I;  3CO6 C;  4WWC A;  3DLL F;  4E7K A;  4E4H A;  3K6G A;  1NH3 A;  5E8G A;  5LGN A;  3NWS A;  3S14 J;  1Z6R A;  4FE4 A;  3LSJ A;  3IRQ A;  2QBY B;  3CCS I;  1LDD A;  4LG0 B;  4Q47 A;  4EM1 A;  5D5U B;  1SAN A;  3GME A;  2ZCW A;  2ZME B;  2YU9 J;  5J40 A;  2LY1 A;  5EGO B;  3E5X A;  3FMS A;  3K70 D;  1Z9C A;  2JQ7 A;  2VPL A;  4HNT A;  4Y52 J;  2A5W A;  3R60 A;  5DD8 A;  1IV8 A;  4HOB A;  2X4H A;  4UUS B;  4L0Z B;  3BJO A;  4PJL A;  3ZCO A;  2Y48 A;  1XTA A;  4UVB A;  5HS9 A;  4M3F A;  4XLE A;  3ZMT A;  1MBE A;  4A3F J;  1O7L A;  1S7A A;  3M07 A;  3Q3S A;  2DU9 A;  3LST A;  5GAG J;  3F3X A;  4M6V A;  2CYY A;  2V26 A;  2OTJ I;  3MKL A;  4ZDO A;  2HPM A;  2V79 A;  1MBH A;  2GXA A;  2Z5U A;  1R4N B;  3LA7 A;  2RV8 A;  3W2V A;  2TDX A;  4RA2 A;  5EEG A;  4OMZ A;  3GTM J;  1W7P D;  2QZ8 A;  4IJA A;  3D5L A;  3H5R A;  5JHF A;  4WCG A;  2EIL H;  3GLX A;  1XGO A;  4L9T A;  3IHU A;  4NB5 A;  5L3B A;  1G6N A;  3JW4 A;  1Z05 A;  4KT6 A;  3OS1 A;  3NAU A;  3Q9V A;  2CUZ A;  1MW7 A;  1R49 A;  1OMI A;  1YLF A;  2K9M A;  3F72 A;  2R4G A;  2X6W A;  1TBX A;  3ZN1 A;  2GA2 A;  3SEQ A;  1MNM C;  1ETO A;  3ABT A;  3ECO A;  3FX3 A;  4I0A A;  4A3D J;  1K4S A;  2PMZ N;  3EDP A;  2KJC A;  2Y9Z A;  3PSI A;  3LL7 A;  2STW A;  1IDZ A;  2M9H A;  3K4C A;  4IHY A;  1R6R A;  4LLL A;  3U1K A;  4DZP A;  2RNJ A;  2H8R A;  2F4M B;  5J8F A;  2NXN B;  4M3B A;  3U2R A;  1ZTR A;  4AID A;  3ASN H;  4ANJ A;  4CCL A;  4XRS A;  5GAH J;  4IHT A;  3KP6 A;  1LDJ A;  3BZ6 A;  1W5C C;  2VQC A;  2QBY A;  3ABU A;  4LG0 A;  1JHH A;  4KJZ A;  2ZME A;  5EGO A;  2D5V A;  4ZYH A;  2WWY A;  3M8F A;  2LKS A;  2KRH A;  2DMT A;  2KIU A;  3VWB A;  4UUS A;  5F0C A;  2FML A;  1IG7 A;  4G12 A;  3OOU A;  5IPA A;  3HRU A;  3MKY B;  3B73 A;  2LKP A;  2B0L A;  2FXA A;  1IXR C;  1YW8 A;  3CES A;  1U0J A;  1X1A A;  2WY8 Q;  2DOA A;  3BG5 A;  5E1X A;  5F08 A;  2DYS H;  2CW7 A;  2K9L A;  2K9S A;  5F04 A;  3HOX J;  2TRT A;  2Y30 A;  2R7T A;  1EJ9 A;  3CDL A;  1F5T A;  2YX7 A;  1X1P A;  3PQK A;  2OAZ A;  3MN2 A;  4HV5 A;  2CRG A;  2WB1 A;  4U88 A;  3BPV A;  1EH8 A;  4L5J A;  4H4K C;  2X48 A;  3WTZ A;  1JKR C;  5CLS A;  2DA2 A;  4I2O A;  3SQN A;  5JR3 A;  1J09 A;  1R22 A;  2M4G A;  3KIO A;  1LVA A;  2OF7 A;  5BMZ A;  2M34 A;  1ZRE A;  5ICE A;  5KVR A;  5LEJ A;  3I55 I;  2MFZ A;  4FX0 A;  4HX8 A;  1MSF C;  2J5O A;  3NRV A;  4HDV A;  2H6B A;  2ME6 A;  1KU7 A;  4BBR J;  4ABZ A;  3ZN0 A;  1S7E A;  3EYY A;  3ISP A;  3H0G J;  1D8K A;  2JTV A;  4BJT A;  3OS2 A;  1USS A;  2X9D A;  4GDF A;  3TO7 A;  1ZGW A;  4E7Z A;  3EUH C;  5D4R A;  3MZ8 A;  2M45 A;  1FOY A;  2PBI A;  3CLQ A;  2AXT C;  1I1S A;  1G3W A;  3PNY A;  3QYE A;  3E7L A;  4GO1 A;  1T33 A;  3R0J A;  1YRN B;  4DBQ A;  3JTG A;  4BY7 J;  5ICF A;  5BS6 A;  1YJN I;  5L3E A;  2EPF A;  1DQU A;  1V54 H;  4NC6 A;  4CSW A;  5LHG A;  3IKT A;  4KYW A;  2DAO A;  4IVN A;  1FZP B;  2NVT J;  2DFE A;  1K78 A;  4P5O A;  1OJL A;  3BDD A;  4FT8 A;  2KIF A;  3OYG A;  3F8N A;  4DZJ A;  2HOE A;  2IW5 A;  4ESJ A;  2IS6 A;  3WU2 C;  3K4N A;  5L3G A;  4BHP A;  3B6A A;  3N05 A;  2L7F P;  2DLL A;  2JMW A;  5DUK A;  1PUE E;  3BZC A;  1HSJ A;  3I64 A;  4Y33 A;  2VBW A;  1XDU A;  1T95 A;  2CH0 A;  4II3 A;  5GP9 A;  3WE3 A;  5IYD J;  2XAS A;  1SMY F;  3OOP A;  1Z21 A;  1N25 A;  2F5E A;  3ZGK A;  5DM7 F;  2VLA A;  1MMS A;  1BI3 A;  4HX7 A;  2M1B A;  3G71 I;  5HNH A;  3I56 I;  1SFO J;  2Q2E B;  2O6G E;  3HKZ A;  2LD5 A;  1R36 A;  2M8E A;  5J3L A;  3RPU A;  5HS8 A;  5A2Q Z;  5H2F C;  1NTC A;  1C0W A;  1ULY A;  5EZH A;  5E18 F;  3FWE A;  3HPG A;  2E5N A;  2YX4 A;  2KJB A;  4NBQ A;  3Q0W A;  2L9S A;  3RYP A;  4FAS D;  2F5D A;  4YEJ A;  2ECB A;  3OS0 A;  2NS7 A;  3KZI C;  4J01 A;  2JA6 J;  2VPR A;  4EJV A;  3RDI A;  2BW3 A;  2M0M A;  2IA2 A;  2OJE D;  1F36 A;  2KPM A;  2K7L A;  1D0Z A;  2MSY A;  2G7U A;  4EEF G;  5LGU A;  2QSH X;  5DS9 A;  2IBD A;  4Y3O A;  3WTV C;  1I50 J;  1TWF J;  3S2D J;  4IHX A;  1OIS A;  2MH9 A;  1LFB A;  3RPQ A;  4EGY A;  1YRN A;  2D1V A;  1VQ7 I;  3BG7 A;  4L9J A;  2KZV A;  4IHV A;  1ZAR A;  1ZEL A;  2BY2 A;  4EJW A;  1IF1 A;  4AVP A;  3H5N A;  3ONQ A;  3AG2 H;  4YFN F;  2HOS A;  2KIS A;  2FUG 2;  3G1M A;  2MG4 A;  3BP8 A;  3SZG A;  1IUY A;  3TOA A;  5HOD A;  4IZZ A;  1A04 A;  1DPR A;  1I3A A;  2RQQ A;  3U1D A;  2HTS A;  1DP7 P;  4BNC A;  4EM2 A;  5GPC A;  3TO9 A;  3BPX A;  4I76 A;  2R7D A;  4HSR A;  2FX0 A;  3MWM A;  1BC8 C;  3MZH A;  3AL0 C;  1OPC A;  1Z6T A;  2M30 A;  1ZG3 A;  1QO0 D;  2CWE A;  2CGP A;  4A3I J;  4XKW A;  3V8K A;  3GXO A;  2XRL A;  5EYR A;  2JRT A;  2O0Y A;  2XHK A;  1J7K A;  2Q2E A;  1K7A A;  2K85 A;  4NHJ A;  5HVQ C;  1X1B A;  3P9C A;  1TL8 A;  5ILU A;  5FO5 A;  4MTE A;  5FKK A;  3TO6 A;  2CMP A;  5DCM B;  1ZG5 A;  1XMX A;  2XIG A;  1CGP A;  2E2H J;  1WI3 A;  4U0W A;  4AWX B;  2VBY A;  2ACJ A;  5HDN A;  3COA C;  1NG6 A;  1AA7 A;  2LRE A;  4F52 A;  4IPA A;  1LFP A;  2ESN A;  1DGR M;  1UAA A;  3H36 A;  2WBM A;  2ME0 A;  1BOA A;  3ABK H;  2ELK A;  3G3Z A;  2LFB A;  3OSG A;  1BM9 A;  2VQL A;  1GXP A;  1EKE A;  1Z7L A;  5FJ8 J;  2M5W A;  4AU7 A;  1MH3 A;  4LG3 A;  5DCF A;  2OPT A;  5E17 F;  1WJ5 A;  5L3C A;  2R5Z B;  3CCY A;  3TBI A;  5CVI A;  3ZMU A;  3OWT A;  2FD5 A;  3SYT A;  5LD2 C;  4NQW B;  4GGG A;  3HOV J;  3P7N A;  2DOD A;  3GEZ A;  2DO7 A;  1IN6 A;  2EV0 A;  2QEN A;  1X3Z B;  2Q1Z B;  4ZDL A;  2H1K A;  1X19 A;  1IXC A;  3TP0 A;  2TCT A;  1Y8Q B;  3KCC A;  3Q0V A;  3QQA A;  1KZH A;  4DIQ A;  1VQM I;  3WU1 B;  1Y6I A;  1CF7 B;  3ERM A;  1VQ6 I;  5TIS C;  3CCQ I;  2H6C A;  1WI9 A;  3T8R A;  3PO3 J;  5IT9 K;  1RES A;  2JA5 J;  5ILS A;  2ZKZ A;  3BLY A;  3BOQ A;  4LGW A;  1SMT A;  4HZF A;  4W97 A;  5IY5 H;  1O3Q A;  4PJJ A;  4P1W A;  1OCP A;  3M8J A;  4RDU A;  2W00 A;  3L2U A;  2KL4 A;  4FQG A;  4IRH A;  5D5X B;  1LJ9 A;  1XN7 A;  4XLA A;  5F6F A;  3RKQ A;  1AHD P;  3E3V A;  1FIP A;  4A3K J;  1YW7 A;  4LFU A;  4D9J A;  5B1A H;  2XV4 S;  2G7H A;  2LY2 A;  2KZG A;  3BR6 A;  3K4M A;  4F55 A;  1Z3X A;  1PDN C;  2A69 F;  1JT0 A;  4E7S A;  3PNV A;  5GTH C;  4ETS A;  4OAZ A;  4BAY A;  2MW8 A;  1G3T A;  1T08 B;  2VQG A;  3S3N A;  4DOZ A;  2BHY A;  1EF4 A;  3IKV A;  4P9U A;  2ID3 A;  2ZSH B;  5K5Q A;  3AKZ A;  3H9Q A;  2GLO A;  4KNY A;  3JRC A;  1V3F A;  1OR7 A;  2EV5 A;  4HBL A;  2X1D A;  3E0J B;  4BE1 A;  3GW2 A;  4BE0 A;  1S5L C;  3FBI B;  3RYR A;  3LSI A;  4WX9 A;  2IGO A;  2OCC H;  4GXO A;  5DM6 F;  1U78 A;  4O3M A;  2EZI A;  1HW5 A;  3K69 A;  3NWT A;  3DU5 A;  4Y17 A;  3C7J A;  4C3I J;  2NYX A;  1T0F C;  3A03 A;  3QPL A;  2VBZ A;  2B7E A;  2WV0 A;  3L09 A;  4MEX F;  4M3E A;  4I98 B;  2C6Y A;  5D6F A;  4NQW A;  3V42 A;  1QQI A;  3CP8 A;  3PIP F;  2DA7 A;  1BI0 A;  3C1D A;  1YQA A;  4A6D A;  5EG0 B;  1CF7 A;  2DT5 A;  2CQ7 A;  2G0E A;  3CJN A;  3KFW X;  3F8F A;  3OYA A;  3NQO A;  4C9Y A;  2F5C A;  3IAS 2;  2EWN A;  4HV6 A;  5F27 A;  1VQ4 I;  2G9W A;  3QPH A;  2X6Y A;  2P6T A;  2VJI A;  2HFH A;  2L7M P;  4GCV A;  3QP6 A;  4QIW N;  1UJ8 A;  3L2V A;  2EV6 A;  1H89 C;  1R00 A;  4LB5 A;  2XRO A;  2A6H F;  2W25 A;  1PUF B;  4YG2 F;  3OYB A;  1VQK I;  1R5I D;  2P7V B;  2LYC A;  1LEB A;  2YU3 A;  3OIQ A;  5J4Y A;  2JA8 J;  2WV1 A;  3HZJ A;  1KU2 A;  2UV1 A;  3MCZ A;  1R58 A;  4BYY A;  4LMY A;  2GOX B;  2LF7 A;  4CCO A;  3WTX C;  3WTU C;  1NK2 P;  4N9I A;  1JXS A;  4UVA A;  4KDP A;  4YRV A;  5IYB J;  4KIC A;  3DV8 A;  4FTH A;  3DF8 A;  2BHZ A;  1UMQ A;  1P9Q C;  3HM5 A;  3LMM A;  2DFF A;  3MEX A;  2MBF A;  2DW4 A;  1QNT A;  1ETY A;  3I58 A;  3TP3 A;  3K4K A;  4ENM A;  2Y75 A;  3IAM 2;  5CVJ A;  3G1O A;  2E7X A;  2M4K A;  3VOD A;  1ZR4 A;  3E5Q A;  3KP5 A;  3H1C A;  2NNY A;  3ASO H;  3HYI A;  3I3L A;  4M9Z A;  3I9V 2;  5KCM A;  3FXO A;  1DU0 A;  3G1L A;  3HDD A;  1LDK B;  2OU2 A;  2DA4 A;  3UR3 C;  4NC8 A;  1FY7 A;  1IN5 A;  4QPQ A;  3P5J A;  5FFX A;  4B3X A;  3GFI A;  3G4S I;  2OQR A;  2XGD A;  1J59 A;  1ETX A;  2XPV A;  4B4C A;  3ABL H;  5BPI A;  2XAQ A;  1QHH D;  3ERE D;  2PLY A;  3LSG A;  1VQP I;  1LKX A;  2N8G A;  4B43 A;  4OIO F;  4M3G A;  5EG0 A;  5FRM A;  1U2W A;  2MD5 A;  2V7F A;  2R5Y B;  5GPA A;  4OWR B;  4BBS J;  3J7A Y;  1RZ4 A;  3H3Z A;  2ISY A;  3VYS B;  1OCR H;  1UCR A;  1U3E M;  4UB8 C;  5F1J A;  4CCM A;  3TED A;  2OV7 A;  4Z6Y A;  2DQL A;  1I27 A;  1AKH A;  3BR5 A;  1JKQ C;  2M2E A;  1XMA A;  3PQJ A;  2O03 A;  1TQM A;  4CYC B;  5L3F A;  2HVS A;  4B48 A;  5C4J J;  3K1N A;  2ETH A;  1IRG A;  4EGZ A;  3HGY A;  4G8X A;  3BTI A;  2XKO A;  3O6B B;  1MKM A;  2DQR A;  4FIS A;  4KUM A;  1Y39 A;  4F7Z A;  1Z3Y A;  4UUT A;  4FX4 A;  2QUF A;  3LSM A;  1LE8 B;  1APL C;  4IRI A;  2EQR A;  1IC8 A;  2UXN A;  3IH4 A;  3FIS A;  3WHB A;  1UG2 A;  3RKX A;  3ZQG A;  3HHH A;  1JJ8 C;  3LFU A;  2DJN A;  2FOK A;  2STT A;  2RKH A;  4E7J A;  2DK5 A;  4XLC A;  5ICG A;  5BPD A;  2HDD A;  2VE8 A;  2DOF A;  4V19 K;  5DV5 A;  3I53 A;  4CHU A;  1BJZ A;  4BQO A;  2VJ4 A;  3LSK A;  1IUF A;  4DJA A;  3LQQ A;  2Z9O A;  1HKS A;  5LRR A;  1FMV A;  3CZ6 A;  1KU9 A;  3W2A A;  3DBR B;  4MQ9 F;  3BR3 A;  4G9Y A;  1R1T A;  2PMZ A;  2K40 A;  1V55 H;  4M73 A;  2VN2 A;  4A3L J;  2ELJ A;  2R5Y A;  3GTO J;  2FSW A;  1Q1H A;  4IEJ A;  2L4A A;  4V2F A;  1ZG1 A;  4BXF A;  2HQN A;  2LTP A;  4KIT B;  2L9R A;  1TC3 C;  1BIB A;  2DA1 A;  2ZC2 A;  2VIX A;  4GFB A;  3I54 A;  3VEP A;  3VYT B;  2DPD A;  1T2K A;  1OCZ H;  4A93 J;  4W1U A;  2YS9 A;  3HOS A;  2O3F A;  1U5T B;  3S3M A;  1B4A A;  2JPC A;  3BCB A;  3F8B A;  3IRR A;  1J2X A;  4BY1 J;  1KYZ A;  1OCC H;  5D4S A;  3EUK L;  3T1B A;  1LE8 A;  3UNG C;  1T98 A;  2HYG D;  2YPR A;  3PJR A;  2JA2 A;  1RKW A;  2M7A A;  4N0B A;  3ELK A;  1QZE A;  4MFD A;  3A4C A;  3ZOB A;  4CCK A;  3L2Q A;  1B6A A;  1QHG A;  4MLO A;  3BT9 A;  2JVG A;  2F2E A;  2R92 J;  1J0R A;  4EMS A;  2RGV A;  4MNU A;  1X4O A;  2FU4 A;  5GAD J;  2X0L A;  1YIO A;  1S3J A;  4PSW A;  4HNV A;  3ZP5 A;  3BR1 A;  1W0T A;  4XON A;  1FBQ A;  1B59 A;  4AYB N;  4CO8 A;  4S0H B;  2VJJ A;  2XGX A;  1GVD A;  2NNN A;  4K2E A;  3A2K A;  1BI1 A;  3G6E I;  1XCB A;  4JX6 A;  4HF0 A;  3SZT A;  4A0Y A;  2UWM A;  5CPR B;  4R79 A;  4BDZ A;  3HOZ J;  1ZRD A;  1MBJ A;  3VDX A;  3X2Q H;  3JRG A;  3HIF A;  1YIT I;  2FBH A;  2R7O A;  3OYF A;  2VOO A;  2QCO A;  3DKY A;  3E6M A;  4S05 A;  2Z16 A;  2GM4 A;  1FWZ A;  1FC3 A;  1DP3 A;  5EEA A;  1KQ9 A;  3KEO A;  4Q5S F;  5FB2 A;  4L18 B;  1WJC A;  4RGR A;  1TZL A;  3ZPL A;  3QPS A;  2GA1 A;  3I4N J;  1ZLJ A;  3EPZ A;  2XPW A;  2V6C A;  1ETQ A;  1EH7 A;  5A2Q K;  3S2W A;  4I7H A;  1KU3 A;  2JWT A;  3TW6 A;  4EJO A;  2ECC A;  4RBO A;  3QOE A;  5ILV A;  1LB2 A;  1YS7 A;  3MMY B;  1X2N A;  2XSD C;  2OZ6 A;  1I39 A;  1U5T A;  5CVR A;  1D5V A;  1XDS A;  3F8M A;  2PJP A;  2VE9 A;  2ZXJ A;  4D7N A;  1U8R A;  3VB2 A;  2O5R A;  3CC7 I;  3VFZ A;  3LFK A;  5D8L B;  2LSO A;  2VI6 A;  1BJA A;  3ZR8 X;  2CQN A;  3FXK A;  4ZYE A;  1TWA J;  3GFL A;  3BWG A;  4Z2Y A;  4HF1 A;  4A2U A;  3OYM A;  3MFK A;  4P9F A;  4PJN A;  1PJR A;  3GCM A;  1B8I B;  4UNO A;  2QYO A;  1QVU A;  3HB9 A;  3LNQ A;  2L02 A;  4OOI A;  1RR8 C;  3GTL J;  3JSO A;  4HEA 2;  1BIA A;  2JT1 A;  3BJA A;  3GO5 A;  1UG0 A;  4AC0 A;  5EDN A;  1J9I A;  3GTG J;  4X1E A;  5E8I A;  1MBG A;  3FHZ A;  4KT5 C;  1JTX A;  3KYL A;  3PUB A;  5K7H A;  1WKM A;  2X6X A;  1F1Z A;  2EA2 A;  4MFE A;  1EA3 A;  1MMD A;  1HLV A;  1YS6 A;  2K02 A;  2H8W A;  1GVJ A;  1ZR2 A;  1VQ9 I;  1ETK A;  3EET A;  3L2W A;  2JJ7 A;  3CD6 I;  2BZT A;  3TKY A;  3KEQ A;  4N4N B;  3QOP A;  5IP9 J;  4LOC A;  1MMA A;  2HKO A;  3H35 A;  3WOD F;  4IO9 F;  1BW5 A;  1G3Y A;  3JAM Z;  1A31 A;  1XPX A;  5HOO A;  3SJM A;  1VQO I;  3BQZ A;  1P7I A;  1Z1D A;  2P81 A;  5EF6 A;  3QWL A;  4CZZ A;  3Q5F A;  3VSL A;  5KAI C;  1JI8 A;  3U9G A;  4IOC F;  4IF4 A;  2CV0 A;  5F0H A;  4ENJ A;  1HQC A;  1E2X A;  2XRN A;  4XSX F;  1QVT A;  3IH2 A;  4HDU A;  1XGN A;  2CQQ A;  3E97 A;  4KIB A;  4IX7 A;  3S3O A;  1IAW A;  2L7Z A;  1ENH A;  3JRI A;  1SD7 A;  3W2W A;  3B02 A;  3PFY A;  1WJA A;  3V8J A;  1FSE A;  1FSH A;  1FYK A;  2WC2 A;  2W4S A;  1YIJ I;  4C30 A;  2R7V A;  1RNL A;  1ZQ3 P;  1TTY A;  5J6X A;  4G7Z F;  3L1P A;  2ZNY A;  2MD0 A;  3QAH A;  5H6Q A;  4BEH B;  2EFW A;  3OSF A;  2FBI A;  5B5E C;  3IP4 B;  3AAF A;  4L9N A;  1FNN A;  5BNG A;  1S9H A;  2Y0S N;  1ZAO A;  1MZB A;  5HDG A;  2VC1 A;  1VQL I;  4ZTF A;  1R4M B;  4HW0 A;  1I5Z A;  5IOY A;  1FOK A;  3M1E A;  2QQA A;  2V1X A;  1S29 A;  1IJW C;  4BQQ A;  3RI4 A;  3GTP J;  3FM5 A;  2A6T A;  4U0V A;  3DFG A;  3PIO F;  2HI3 A;  4PDK A;  1RUN A;  2YUS A;  2H09 A;  4N9H A;  2WB1 N;  1LQ1 A;  3EYI A;  4DYC A;  1OYI A;  2WA0 A;  3BC8 A;  2GQQ A;  1OYW A;  4PJM A;  1K83 J;  1XSV A;  2Z99 A;  3FXL A;  3GZN B;  3Q0U A;  5B3S H;  4AM3 A;  5IYC J;  2FBK A;  2UZK A;  2QEX I;  3FDY A;  1IV6 A;  2F4I A;  3BTC A;  2BVM A;  1JGG A;  1MSE C;  2AXL A;  1U8B A;  4XKB A;  2AS5 F;  3OR1 C;  2OQG A;  5HLI A;  2D2W A;  5M5W J;  1XCV A;  1QPM A;  3FK6 A;  2V9K A;  1MJB A;  5B1B H;  3U21 A;  3WGI A;  1D1C A;  4E6K G;  3OYI A;  3SFZ A;  4OIR F;  4I6Z A;  5K7Z A;  2NAZ A;  1LPQ A;  1MJA A;  2KIQ A;  4HPQ A;  1Z91 A;  1TQI A;  3CO7 C;  1AWC A;  1RI7 A;  2FA5 A;  2F5V A;  4B09 A;  3FBN B;  4QLC U;  1Z67 A;  3E1S A;  9ANT A;  4RLF A;  4IQJ A;  3K1P A;  1KGS A;  2DOE A;  3WU0 A;  1PP7 U;  4B3A A;  2KIM A;  1FBS A;  2W48 A;  3W3C A;  1WZ2 A;  2A68 F;  3BG3 A;  4LLN A;  1WVR A;  4O6J A;  1JT6 A;  2VQH A;  3C3W A;  4FET A;  1D5Y A;  1RPW A;  1K79 A;  5LGT A;  2XB0 X;  4II2 A;  4BS9 A;  2R7X A;  2K3P A;  1V5F A;  4PGH A;  1T38 A;  4HG2 A;  1IDY A;  1E17 A;  3ZQQ A;  3CDH A;  3H92 A;  3TQN A;  1BI2 A;  2CJJ A;  2BY0 A;  2BY3 A;  2R7Z J;  3RQ4 A;  1VZ0 A;  1X1D A;  2R7R A;  2CW8 A;  3K2Z A;  2VXZ A;  1O3S A;  3BG9 A;  1FTZ A;  3TMO A;  2L7K A;  2M3A A;  1Z77 A;  1SD4 A;  1P4X A;  3NAR A;  1JKP C;  4BAC A;  3DEW A;  4DBR A;  1YOV B;  2LKX A;  2O8K A;  5CYV A;  4DYQ A;  3TL4 X;  1I6H J;  3L00 A;  4LIT A;  1MBK A;  3RKY A;  3HKZ N;  2ZME C;  4KN7 X;  4GYG A;  4P96 A;  1YW9 A;  2HNH A;  4PCQ A;  3CUQ B;  1IXS B;  3SEZ A;  5TJJ A;  2DN0 A;  5D5W B;  3GFJ A;  2LG4 A;  4ITV A;  3OIO A;  5KK1 A;  2EZL A;  1ORK A;  2CFO A;  6PAX A;  4IXA A;  5J47 A;  1JUP A;  2M0C A;  3DU6 A;  3KZY A;  3ZQL A;  2NRA C;  5CVV A;  4F92 B;  1U5T C;  2WAF A;  1BR2 A;  3CUO A;  2DTZ A;  2H1L A;  2DYR H;  3VYU B;  4ZZL A;  4MGR A;  3D0S A;  1HKQ A;  2EH3 A;  4MTD A;  2L2O A;  4ENK A;  2DMP A;  2A6E F;  2L5Q A;  1F9N A;  1X58 A;  2CUE A;  2I10 A;  3A0H C;  1B1B A;  5CJ9 A;  3ZRG A;  3LSR A;  1BC7 C;  3MQ0 A;  4A3M J;  4V2G A;  1BL0 A;  2HQR A;  4YIF A;  2KFD A;  3OYJ A;  1SD5 A;  2IT0 A;  1R5H A;  3CJQ B;  1XMK A;  2W7N A;  3HSR A;  5E3O A;  1D8J A;  5DTD A;  2JA7 J;  2BXY A;  1E3O C;  2MYS A;  4U7D A;  3DEU A;  1ON1 A;  1W7P B;  1W1W E;  1YG2 A;  2DCE A;  5KHD A;  1QZY A;  4RAG A;  5F1R A;  2PJR B;  1SVL A;  4XKC A;  1HST A;  1LEA A;  3ZMV A;  4DW6 A;  2EIN H;  2P7C B;  3DPU A;  3I71 A;  1GXQ A;  2P0W A;  4UV9 A;  2W82 A;  1B72 B;  4RS8 A;  2MC3 A;  1RKT A;  2R7S A;  2R3S A;  3TDZ C;  4UV8 A;  3RIR A;  4Y13 A;  2P6S A;  4M9X A;  2VJ5 A;  3E6B A;  1Y0N A;  2LC2 A;  4MO7 A;  1YTY A;  1R5G A;  3JTH A;  3L2R A;  3FHN A;  2A05 A;  3SDB A;  3H3V K;  2I5U A;  2D1H A;  4CUG A;  1YJ9 I;  3P9I A;  1XSD A;  5K7F A;  1P92 A;  2QGU A;  3J81 Z;  2MA3 A;  5DCM A;  1OCO H;  3FF5 A;  2KKO A;  2EB7 A;  1UZC A;  4ENN A;  2XUB A;  2VKD A;  3ZMZ A;  1FOX A;  1ZHF A;  5E3L A;  3GLL A;  3LOC A;  3VYR B;  2KDO A;  4XRM A;  1WH7 A;  1R1V A;  3HTU A;  3OYL A;  1G2H A;  3CUQ A;  1GT0 C;  2MLK A;  1WJF A;  2XAF A;  5C44 J;  1FYM A;  3DXJ F;  4E7L A;  2GOM A;  3WTY C;  2LR8 A;  1R23 A;  2IGM A;  4XBF A;  3V7S A;  1G3S A;  1JTY A;  3AG4 H;  3CJR B;  5FD5 A;  2P5K A;  4XM3 A;  1R9T J;  4B8X A;  2LDU A;  2R5Z A;  3K9T A;  1N77 A;  3KP4 A;  1NK3 P;  4EAT A;  2O61 A;  2FJ1 A;  2BOL A;  1A36 A;  2JVH A;  4LD5 A;  4JYK A;  3A01 B;  4HLX A;  1I6X A;  1LVK A;  2E1O A;  5IP7 J;  3CCM I;  4A3G J;  1KA8 A;  3GVA A;  3SFI A;  1W7P A;  3KLO A;  5M3F J;  1XD7 A;  2HQA A;  2K3F A;  4RM2 A;  5LHH A;  2NOG A;  3L7W A;  2PJR A;  1U6G A;  1P6R A;  2DI3 A;  3KYC B;  3OL4 A;  1O3R A;  2GWR A;  2HU9 A;  4A0X A;  3DBL B;  3DKW A;  5GAE J;  2WAQ N;  2XB5 A;  3RPU D;  2VC0 A;  2ZO4 A;  1B72 A;  1TW2 A;  3M4O J;  4CXF A;  4KIS A;  4XQF A;  2QVO A;  3DKX A;  2PG4 A;  2W1O A;  2HQ5 A;  4O5V A;  3MZY A;  2P5L C;  2DDB A;  1SEU A;  3KX2 A;  2EFN A;  1T39 A;  4RB0 A;  2AQF A;  2DA6 A;  1IRZ A;  3SZP A;  1G8X A;  1SD6 A;  4OAY A;  1L3L A;  1RRJ A;  1X3W B;  4XRS G;  3GX4 X;  1FP2 A;  3BR0 A;  3FXU A;  5L3D A;  1ONV A;  4A5N A;  1ZGA A;  1UHM A;  2IXS A;  2XF5 A;  1OQY A;  2CQK A;  4PUS A;  3JCU C;  1A6Q A;  4S04 A;  3KE2 A;  2IS4 A;  1V5G A;  3WGG A;  1WPK A;  1ETW A;  2OBP A;  1ZLK A;  3AG1 H;  4IQ4 A;  2OCE A;  2V1D A;  3OYK A;  1ACI A;  1K6O A;  3BZK A;  3HSE A;  3AG3 H;  3VSK A;  1IZ1 A;  1GHC A;  4M3D A;  2M87 A;  1O3T A;  3ABM H;  3R6S A;  2HWV A;  4A0Z A;  3ZMD A;  1O4X A;  1RR7 A;  2IAI A;  3ZQ7 A;  1FT9 A;  4YFK F;  4FCY A;  3FKI J;  1FLI A;  3CLO A;  1Y0U A;  2XGC A;  3PL8 A;  2LK2 A;  4BJ6 C;  4HX4 A;  2OUM A;  2MLG A;  1VF9 A;  2LVS A;  1EV7 A;  4KMU X;  3HRS A;  2PFB A;  4IHS A;  3PM1 A;  4JBA A;  5K5R A;  3ZXS A;  4FHT A;  5AIP A;  2LRD A;  1T6S A;  1B9M A;  5FLX Z;  2IA0 A;  4HF2 A;  3CP2 A;  2L3D A;  4A3J J;  2NVY J;  2RDP A;  1NHA A;  2QLZ A;  3HOW J;  3M1C A;  4A3B J;  4OIP F;  1YX3 A;  3BY6 A;  3BQY A;  3CME I;  4XMY A;  2Y31 A;  4E70 A;  4U0Y A;  2DJI A;  2Z33 A;  5IOZ A;  2X85 A;  1VFC A;  2XAJ A;  1IW7 F;  4LIV A;  3HHG A;  3KP2 A;  2K9Q A;  1IN7 A;  2EFP A;  5H6R A;  1WSU A;  3A02 A;  2E71 A;  3OYE A;  1HDD C;  2VAS A;  1SFE A;  2XF7 A;  5F0F A;  2KMU A;  2K4J A;  3EQL F;  5FKM A;  3WTS C;  1PUF A;  2QF7 A;  1LNW A;  1BR4 A;  2NVU B;  3TW7 A;  2ZJQ F;  1YJW I;  4E7I A;  2E2I J;  4A3C J;  4CIC A;  3OY9 A;  1MIJ A;  2FRH A;  2EK5 A;  4GRI A;  4OU0 A;  4XOP A;  3A1Y A;  3ZQH A;  2COM A;  4ESF A;  4KMF A;  4EVI A;  4JK1 X;  1YX5 A;  3W6J B;  3LQR A;  1ZKG A;  3F9K A;  3IH3 A;  2O7O A;  1ERD A;  1FTT A;  2QM3 A;  4BL0 B;  3RTR A;  2EIM H;  4A3E J;  4J00 A;  2XKP A;  2K27 A;  4LIU A;  4A12 A;  3FXR A;  4BJ5 C;  2HEO A;  2A61 A;  4MEY F;  5ED4 A;  3J80 Z;  2XVC A;  2ZXW H;  3I59 B;  2PN6 A;  4RMN A;  1X4P A;  2WAE A;  4XN0 A;  1S8N A;  2FNA A;  5DEQ A;  4ASN A;  3HJE A;  4RB1 A;  4AYB A;  2JSC A;  3S93 A;  4G94 A;  5ICC A;  4E7H A;  4ZYG A;  3C18 A;  4ESB A;  3CCU I;  2XAG A;  5AIQ A;  1D0Y A;  4A5M A;  2GXG A;  5B66 C;  3MKZ A;  1JKO C;  1TW3 A;  4CH7 A;  1HCR A;  1UST A;  3S1M J;  3ML6 A;  3OR2 C;  3AL0 B;  3FKJ A;  4AD9 A;  3JSP A;  1HXD A;  1WRJ A;  4RGS A;  4YEL A;  3LAJ A;  3K4B A;  5DUI A;  2JK3 A;  2BV6 A;  2MAB A;  1OR7 C;  2EJR A;  2QQ8 A;  5HLT A;  4QTR A;  3W6K B;  4YIR X;  2ADU A;  5JHU A;  2LF8 A;  4CYC A;  4C2U A;  3CUQ C;  4OIN F;  1ZH5 A;  2BGC A;  4XK4 A;  4X0G A;  3K70 C;  1WQ2 A;  1QBJ A;  1TWC J;  2BE5 F;  2CQX A;  3GBG A;  4EM0 B;  1I3Q J;  2R93 J;  1IN8 A;  4BE2 A;  2KLO A;  2IS1 A;  2PEX A;  3CMM A;  2W84 A;  1IO2 A;  5IT3 A;  2Y69 H;  3J7Z I;  3PFI A;  4G6D A;  3FM3 A;  4WF2 A;  5HNF A;  3FK7 A;  3WG9 A;  3D1N I;  2HGC A;  2HTJ A;  5K1Y A;  4HQE A;  4XLN F;  5D8K B;  3O8G A;  1VQN I;  3QYB A;  2R7U A;  2HOA A;  1SFX A;  4PFO A;  3JAM K;  3QPT A;  1U9O A;  3CF2 A;  4ZYD A;  1H9T A;  2IRF G;  2V9V A;  4JX5 A;  1MNE A;  3LAP A;  4I0B A;  2EZK A;  4QWQ A;  2PQ8 A;  3DTI A;  5CQG A;  3TGN A;  3SDG A;  4N4O B;  5E79 C;  1MMG A;  1FJL A;  5ERI A;  3I59 A;  4XL9 A;  3I0T A;  1X3U A;  1RUO A;  1JE8 A;  1VND A;  1VQ5 I;  4F91 B;  2FMY A;  2RC4 A;  3R0A A;  3ROU A;  5IP6 A;  2ZFW A;  3RZO J;  4XRF A;  2AO9 A;  3L9F A;  2OZU A;  2E1C A;  2HZT A;  4EQQ A;  3MD2 A;  4BGD A;  3JRA A;  2ID6 A;  2HS5 A;  4NDL A;  2ISZ A;  1XGM A;  4BXX J;  1MJ9 A;  1CQT A;  2GBY A;  2Q0O A;  2KQR A;  5EEH A;  1SVM A;  3FXM A;  3HRM A;  1STZ A;  3K4J A;  2IPQ X;  1ETV A;  4BQN A;  4BU2 A;  3KP7 A;  5E20 A;  4PJ0 C;  1IRF A;  1HW2 A;  3REO A;  5JI6 A;  2AQE A;  1DPU A;  5M3M J;  2EBI A;  1HC8 A;  2MC4 A;  1FYL A;  4D5C A;  1ZK8 A;  3ULQ B;  3L2C A;  3M3Y J;  1WJB A;  1QPI A;  1TP4 A;  4M74 A;  1QU3 A;  2OC6 A;  3M9A A;  3WE2 A;  2E2J J;  3H9J A;  5CQE A;  2EFO A;  2P4W A;  4I09 A;  4CCJ A;  1BBY A;  1K78 B;  4ON0 A;  4EJT A;  1K61 A;  2DMU A;  2E35 A;  1QRY A;  2JUG A;  3A0B C;  2E34 A;  1YI2 I;  1XX5 A;  2QKM B;  3Q9S A;  3S15 J;  4ZH4 F;  1HOM A;  1R1U A;  4XN3 A;  2PMU A;  1MD0 A;  3HEF A;  5EZG A;  2Y0S A;  2ESH A;  2DA3 A;  4H0E A;  3S16 J;  3M8E A;  3ZMS A;  1J5Y A;  1WCM J;  1TT5 B;  2BYV E;  3WG7 H;  4U7B A;  2F4O B;  3GFM A;  3KPH A;  4L5I A;  2VKV A;  3CMY A;  2HPI A;  4ZDP A;  1BW6 A;  2CUJ A;  4KN4 X;  4D5F A;  2R0Q C;  1ZGJ A;  4MHG A;  1YHQ I;  3HOU J;  1EH6 A;  2OD5 A;  2IJL A;  2NS0 A;  1Y8R B;  4I99 C;  2CFX A;  2CW0 F;  4HAM A;  2E1N A;  1N78 A;  3OYN A;  1UB9 A;  3LSP A;  5FD6 A;  1FX7 A;  3GUD A;  3AFH A;  3DWL E;  2NVX J;  2Z2S B;  2FQ3 A;  4G6Q A;  3QU6 A;  3DBH B;  3CCR I;  3KET A;  3F6O A;  3NEU A;  2FQ4 A;  4X6A J;  2DT7 B;  2E7W A;  5TGT A;  3TDU C;  4PGG A;  5E3M A;  3H5A A;  2VXD A;  3OV8 A;  4MIM A;  1TNT A;  2E1M B;  3O3K A;  2HXO A;  2BW3 B;  3RKW A;  1MMN A;  4XLF A;  4M6X A;  1T8I A;  2ZXI A;  2JRM A;  2RRE A;  2V4J C;  4PSX A;  2EFQ A;  4RAF A;  1P7J A;  2FE3 A;  1QGP A;  4M6Y A;  3WHC A;  2XSJ C;  1S6L A;  3R4K A;  2BEO A;  1UHW A;  2X6O A;  3CCJ I;  1HF0 A;  1M1E B;  4DNC A;  1JHF A;  1SAX A;  2Y9Y A;  3N4M A;  1B9N A;  2CS3 A;  2NS8 A;  4XLP F;  3JRD A;  2RAE A;  2XPU A;  2W85 A;  2WY7 Q;  4I02 A;  4A6E A;  1TWH J;  2W57 A;  1RET A;  2IEK A;  2RN7 A;  1TNS A;  5CVU A;  5CKT A;  1SVO A;  3FIW A;  5J1R A;  1TWG J;  1FBU A;  2V1N A;  2P5V A;  5LRS A;  1X1C A;  4BUP A;  1SFU A;  1B8I A;  3BR2 A;  2EIK H;  3MVP A;  3HOY J;  4KIG A;  3ECH A;  1JJ6 C;  1T0F A;  1MND A;  5FRO A;  2KHM A;  3E5U A;  1IRX A;  3F21 A;  3IV5 A;  1AU7 A;  3R61 A;  2XAU A;  4XIC A;  2QA4 I;  2X51 A;  2XGE A;  4AIJ A;  3RQI A;  4ZJZ A;  5J4V A;  4D0P A;  1T56 A;  3K7A J;  3FXJ A;  2GXB A;  3N97 A;  3V8L A;  2DT6 A;  4AIH A;  3O8H A;  3F23 A;  1HBX G;  2KP6 A;  2DBB A;  5JLX A;  1KQ8 A;  3E6C C;  1W5S A;  2QWW A;  1J75 A;  1WGX A;  3GYH X;  3T0Y A;  2E19 A;  3DLA A;  2O8X A;  2LBF B;  2Q8K A;  4KA4 A;  2A3S A;  3BTJ A;  2ZJ2 A;  3CTA A;  3CQZ J;  5E3N A;  2L9N A;  4ZZD A;  4XID A;  1JGS A;  1WJD A;  4XKV A;  5DD4 A;  2ZBK A;  1YO5 C;  5FGM A;  5LEK A;  1FIA A;  2CSO A;  1W36 C;  2IA1 A;  2IGN A;  3J81 K;  4G6T B;  1R71 A;  2QSG X;  1PYV A;  3FMR A;  2LLK A;  1HDP A;  1P4A A;  2K9N A;  4HRI A;  1DGW Y;  3MAJ A;  1TT0 A;  3D5R C;  4I01 A;  1H8A C;  1K4T A;  4C3H J;  4D7M A;  1OYY A;  1ZYR F;  4LK1 F;  3J7Y J;  4BEH A;  5F64 A;  1KYW A;  4F3Q A;  2VOD A;  1KQ0 A;  1W36 D;  2NOJ B;  4YII A;  3C2B A;  3CCL I;  4OIQ F;  2GIZ A;  3CJT B;  4PZJ A;  3K4L A;  1Y1V J;  3GZ5 A;  5K5O A;  4XNF A;  5BOX A;  4WXH A;  3QOD A;  4HQM A;  2FEZ A;  3HPH A;  2LMD A;  5J8C A;  2HR3 A;  3S1Q J;  3E6D A;  1O57 A;  4UUV A;  1Z0X A;  4HLY A;  3JRH A;  3PNT A;  3BTL A;  5TRD A;  2EZH A;  1H9G A;  1IN4 A;  1KON A;  4G7H F;  2DK8 A;  5FLV A;  4B47 A;  1F43 A;  1DU6 A;  2VB6 A;  4OMY A;  4L5E A;  1POG A;  1XGS A;  5C3E J;  2CV1 A;  2FNP A;  2XAH A;  3HC7 A;  1RIO H;  2PMH A;  3V4G A;  3GF2 A;  5JVT A;  2HVR A;  1QA6 A;  1R7J A;  3LWF A;  2VT3 A;  1GV2 A;  2DTR A;  4JQF A;  1HKT A;  1XG1 A;  3PO2 J;  3HG9 A;  3V7R A;  2DFH A;  4M72 A;  2ZJP F;  3LA3 A;  3QP5 A;  3S1N J;  3JRB A;  5JVG F;  2LBF A;  3VOE A;  3ZQC A;  5AON A;  1ODD A;  1UHS A;  4Y4R A;  1E3P A;  3IC7 A;  4Q4Z F;  5C4X J;  1UFM A;  4QSH A;  4DQ2 A;  2JUC A;  3S2H J;  1MH4 A;  3FXQ A;  1H88 C;  2OTL I;  1V5E A;  4AVZ A;  2LP0 A;  2O9L A;  3SHF A;  4BXU A;  5D5V B;  3OYD A;  1IGN A;  2DFI A;  2L9V A;  2HDW A;  2XF6 A;  1VQ8 I;  4JX4 A;  3VPR A;  1Z7U A;  1DDN A;  3QRF F;  4BHC A;  2FOW A;  2HYJ A;  3F0C A;  3T8T A;  1YYV A;  2QQB A;  4M9S A;  2P8T A;  2FF4 A;  3OIP A;  1U9N A;  2CU7 A;  5JLW A;  2XC7 A;  4FE7 A;  3ZQI A;  3HL2 A;  2CV2 A;  2KRC A;  2BXZ A;  4IKF A;  4MQV A;  2Z3Y A;  2HDC A;  3DQV C;  5E1Z B;  1WFX A;  4D1Q A;  2V1U A;  2DPU A;  3S8P A;  3OYH A;  4DGW B;  2K5C A;  2EA4 A;  2VOP A;  1BR1 A;  2K86 A;  5FRN A;  2WAQ A;  1D1A A;  1BN5 A;  1MBF A;  4TV7 A;  2KDZ A;  3CCE I;  2BVL A;  2QSF X;  4DYR A;  2ZSI B;  3H9G A;  4LK0 F;  3WTW C;  2EIJ H;  4PFP A;  4XSZ F;  1XB4 A;  3HRT A;  4CGZ A;  2PX9 A;  3GTK J;  4JOM A;  1GV5 A;  4KFC A;  4UY8 I;  2IP2 A;  4QPO A;  1MDM B;  3KP3 A;  3JRF A;  4RLQ A;  2QQ9 A;  1WH5 A;  2VKE A;  4G7O F;  2LY9 A;  3KZZ A;  5LLQ A;  3HUG B;  1XS9 A;  2J5P A;  4AIK A;  2DMQ A;  3KEY A;  2HOT A;  1AOY A;  2H94 A;  2L4M A;  4NNJ A;  5FLX K;  2H27 A;  4Y15 A;  3GTQ J;  5HLG A;  5BQT A;  2RNG A;  1FPQ A;  1DUX C;  3QU3 A;  4CA0 A;  4IL6 C;  1O7F A;  4RB2 C;  3SXY A;  1X2M A;  3K2A A;  4RB3 C; 
#chains in the Genus database with same CATH homology
 2DOF A;  2L9V A;  2KIQ A;  2JUC A;  2KZG A;  2K85 A;  2B7E A;  4FQG A;  2DOE A;  2E71 A;  2KFD A;  1UZC A;  2DOD A;  2LKS A;  2KIS A;  2CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...