3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
4RB3C 1AQJA 3FPFA 2DW4A 4FZVA 2KKOA 1YS6A 2W24A 3DR5A 2CO5A 2AXLA 4P55A 2HYGD 3HSFA 1QO0D 3IYLW 5DLYA 4I01A 2QUFA 4RTQA 3SFZA 2V74B 3JSOA 2FYTA 4PONA 3SSNA 4PYJA 4IHSA 4NHJA 3V8LA 5HS9A 1YFHA 3I0TA 3TLJA 10MHA 1YQAA 3EDPA 2AN3A 4YUWA 2GAUA 4HRAA 1RZ4A 4QQKA 4RTKA 3THSA 2DULA 4RVFA 4O6JA 1JQDA 2YR2A 5CYVA 3O2PE 4RGUA 4U88A 1NE2A 1XD7A 3HCDA 2IDKA 4IRGA 1WG8A 3C6KA 2MD5A 4EJWA 4LFUA 5ILSA 4EVIA 4AX8A 4KVZA 2PFBA 1VLMA 2OYRA 4BLUA 2JHPA 1XCBA 4EQZA 1U5TA 1JHFA 2MC3A 1D8KA 2BGCA 4GC9A 5GIOE 1Y0UA 3FX3A 1RUNA 2AOVA 4Y2HA 3K6RA 3BDDA 2YX4A 3DMFA 3EVGA 4E2WA 1LQ1A 3LECA 5HIMA 2GH1A 1FBQA 5EIFA 4MEYF 5FADA 1F1ZA 2IFTA 1T6SA 4GEKA 1GXQA 1IUYA 3KETA 2PEXA 2VODA 3LKDA 4PIMA 4CKBA 3ABTA 3KHKA 3MCZA 3NRVA 1AQIA 2PJPA 3T7TA 3BKWA 2HOEA 3H2BA 5T6BA 1NW3A 3GO5A 2GS9A 3HRTA 3ZMDA 4QDJA 4UVCA 1RI1A 2VDWA 1F4KA 3CTAA 1FYKA 1KPGA 3TDUC 3TM4A 2H09A 1KQ0A 1IRFA 5K0CA 1KR5A 2H11A 4C03A 1ZARA 2EA2A 3WGHA 3MQ2A 1AV6A 5IT3A 4S05A 3PFGA 3QV2A 1SKMA 4EM0B 3NW9A 5CLSA 3DXXA 3FUXA 3Q9VA 4KN7X 4LWPA 4MTDA 1BC8C 5DTRA 4CTJA 2OA4A 3R24A 2W84A 4LG0A 2DO7A 3CDHA 4B09A 3EEYA 2H6CA 4OIOF 3JWJA 1ZLKA 2Z6UA 4TV7A 3VB2A 5DTQA 4FP9A 1YW9A 1ZKDA 5K1YA 4EJVA 4UXNA 1DPRA 3GW2A 3VODA 2GZWA 5E17F 1FP2A 5DRTA 3HOTA 4M7RA 3ORHA 1TW3A 1Q0SA 4XSZF 1IXSB 5EMJA 1JHHA 3OU2A 5LHIA 5E1XA 3SR4A 5CVUA 3H92A 4Z2YA 3HVJA 4R05A 3WTUC 1ZAOA 3FHZA 4RV9A 1WI9A 4HDVA 3V8KA 2X4HA 2EFPA 4WXDA 4LD5A 1IXRC 1XGMA 2HTEA 3EEOA 1K79A 1D5VA 2P40A 2RKHA 2HDCA 3SZTA 3TO7A 2VONA 2P5LC 1VQ1A 4AZVA 3C18A 2V7EA 5DRYA 3HHHA 2HEOA 3KP6A 4OA5A 2AOUB 4HZFA 3NEUA 3COAC 2ZFWA 2FK7A 2A5YB 5HLGA 2DLLA 3GUDA 5FHRA 2XAGA 1JG4A 4HQEA 2BV6A 2JHCA 3CO6C 4HX7A 2ZXJA 4LMYA 4P58A 3KQSA 5FFZA 3D2LA 2PX8A 3AAFA 2OAZA 2FEZA 2P3QA 1R1VA 4AIHA 2K27A 2R6ZA 3KZZA 4M6YA 2ESHA 4P9UA 5C1IA 4YV2A 3LCUA 1S3JA 4I98B 5KYGA 1TNSA 2IVMA 4PCQA 1SQGA 2QQAA 3DFGA 2OQRA 2HZTA 3I5UA 1V39A 3TO6A 1XTPA 2E1CA 3WTYC 3JAMZ 2ZW9A 2IA2A 2PX2A 5BQTA 3FPEA 2YXEA 4QLCU 4L0YB 5HIKA 4F86A 3BWCA 2FCAA 5LRSA 4I09A 5DCMB 2BEOA 3UA4A 4A6DA 3CUQA 3CJTA 3N4MA 2WK1A 4EJTA 2ISZA 1QQIA 2JRTA 2W25A 1KU7A 1PUEE 1X3UA 3B3FA 2KW5A 1CF7B 2EFJA 2DQLA 2GPYA 2EV5A 2NXEA 3MHTA 2OQGA 4DF3A 1S7OA 3KP4A 3DXJF 2VDUE 2O0LA 2PN6A 3WTSC 2FHPA 3TPZA 2ADUA 2Q2EA 4RGRA 3RKYA 3ML6A 2EV0A 5F6FA 2ZKZA 1OMIA 4A5MA 4L18B 1HXDA 5JR3A 3IRRA 5ICGA 1FBSA 1QNTA 4MTEA 2P41A 5AONA 4JQFA 3EGEA 5HS7A 2AOTB 2YTZA 4RB0A 1YB2A 2L54A 3NVMB 4YUXA 1YS7A 4PYNA 2OZUA 3TMAA 2P3OA 2A6EF 4KIBA 1BIAA 1KGSA 2HQRA 5K0LA 3IL2A 3DLIA 1ZG5A 1USTA 3B02A 2RV8A 2OZVA 2PG4A 4R8HA 5K5OA 2VN2A 2WWYA 4P7FA 3FTEA 1QZYA 1XSVA 2H1RA 2E7XA 5H6QA 1L0OC 1RJEA 5D5XB 5DUIA 4K6MA 3GNLA 5P8WA 2YSRA 2PI0A 2RQPA 3O7WA 3OFJA 1PP7U 2KJCA 3T0YA 4LECA 3WTTC 4OINF 5MHTA 2IRFG 5ILUA 2FNPA 3KPUA 4LJZF 5H02A 2XBMA 2UWMA 3P71T 1R8XA 3V7RA 4PYIA 1WQ2A 2L4MA 5KS2A 5EMLA 3ZN1A 2K86A 5D8KB 4B8XA 3GX4X 1IW7F 4LLLA 5JI6A 2R7DA 3RKWA 3ULQB 5JHUA 3VFZA 2Q41A 3LAJA 2FPOA 2I62A 2GA1A 4YIFA 5EMKA 1VPTA 1OYIA 2AR0A 4UUVA 3M9AA 2GIVA 3I64A 3KEQA 2EFQA 1H1DA 2EG5A 2CGPA 1FNNA 3C3PA 2XAFA 1G6Q1 5HOQA 5FB2A 5EHIA 2C6YA 2OY0A 2ESNA 3REOA 1ZLJA 2IH4A 3HTUA 3ZMZA 2ELHA 2VBYA 3B3GA 1MJFA 2KRFA 1KQ8A 3WG9A 4BAYA 5E1WA 5E9QA 3L9FA 2M45A 4KRGA 2PV0A 1RJFA 5L3CA 1YW8A 2EK5A 5E18F 4OIPF 1O7LA 1IY9A 2P1DA 4WWCA 3LA3A 2G72A 2VDVE 5DSXA 5B1SA 3PS9A 1FJXA 2HTSA 1J9IA 3AXSA 1HBXG 1I9GA 5T64A 1UIRA 2XASA 2QY6A 5D4RA 5F1RA 2G1PA 2AVNA 3ZMVA 4BY9E 2YVLA 4RVGA 3O4FA 3U1DA 2XKPA 1NW8A 3M8FA 1VP9A 2P7IA 1G6NA 3DTNA 3FMRA 4X60A 1JG1A 1LEBA 1NKVA 4HX4A 2XRNA 3E6CC 1DUXC 1FLIA 1DL5A 3PT9A 1RIOH 5C9ZA 1MZBA 2VZ9A 2RNJA 5ICFA 1R1UA 2F5DA 3K1PA 3EVBA 3KQVA 4Y15A 2NNYA 1RI4A 5K5QA 4KIGA 2O57A 2ZBPA 1R58A 1X1AA 3ERED 1WXWA 1GXPA 4L5IA 4H0EA 2VC0A 4ISCA 1M6YA 3ELWA 1PDNC 4RAZA 1AOYA 3LQRA 4E2XA 5CUQA 5ERGB 4FT4A 1RI3A 4GOMD 4EMSA 2C7QA 4RAYA 4C07A 4M71A 5AIPA 3P9IA 4YFNF 3SXJA 3HSRA 3NTVA 2DK5A 1KPIA 4MHTA 3DLCA 4R79A 1P2FA 4KN4X 3NMUF 3WODF 4HC4A 3KP3A 3G89A 3DF8A 4M72A 1P39A 1O3RA 1W7PA 5K01A 4PNEA 1J59A 3CBGA 2PX4A 4HTFB 2V1UA 3EYYA 1OYYA 5EHGA 4FX4A 2ZTHA 4ATNA 1XDSA 3A7DA 2JH9A 2HFHA 1M6EX 2PGXA 3T8TA 2B9EA 4CXMA 5BW4A 1SFEA 5FD6A 2XVAA 5FA8A 1QBJA 2EA4A 1ZQ9A 3F8BA 3G3ZA 1NV8A 5GM2A 1BI1A 5EZSA 1R5HA 2M8EA 1J5YA 4NECA 4ZTBA 2UZKA 4PZJA 4EGYA 3PX3A 4YUZA 1RI7A 2P6SA 3ECHA 4U7TB 3EUHA 3MTIA 4AVPA 3JWGA 3TFWA 5L3BA 3FYDA 2KJBA 1YFJA 3GFJA 4HH4A 4CKEA 4KFCA 5TRDA 1Z6TA 1WZNA 1BBYA 3UA3A 4KIFA 4Q48A 5KQRA 3LA2A 4IXAA 2D1VA 2G7HA 3ID6C 4KDRA 4YUVA 4HW0A 3B89A 1Z1DA 2DFIA 4HSGA 4AZWA 1FBNA 5E20A 4I0AA 3AJDA 5T67A 4ZYGA 4X41A 1X19A 2FA5A 1WKMA 3TDZC 5EKXA 2AN4A 5EPEA 2V9VA 3DUWA 3C3YA 3G8BA 2TDXA 1G38A 4UHTA 5HEKA 3LCVB 2P35A 1UFMA 5HIJA 3P2EA 2DTRA 4DNCA 2YXDA 2IIPA 3WU1B 5LQAA 1B9MA 2N47A 3SSOA 1ZRDA 2IA0A 3L8DA 4GF5A 1FT9A 4HV6A 4JK1X 4OA8A 3SZPA 3H3ZA 5L3GA 1S6LA 3LX6A 2P5KA 3JTHA 5GM1A 4RTNA 1BOOA 4LG1A 3HSEA 5EZQA 1T38A 1DUSA 5CM2Z 4MGRA 1O9GA 3I59B 3RJPA 1WXXA 3W6KB 2XHKA 2IP2A 1YF3A 4L9JA 2EFWA 4U0YA 3HRSA 1YIOA 2FSWA 2BR5A 3R0AA 5GOZA 4PCLA 2VOPA 1JG2A 3UJAA 1XB4A 3PTAA 3LHDA 4DQ2A 5BMZA 2P5VA 4WXCA 3BWGA 3OZRA 4IRHA 2P7HA 3MTEA 3WTZA 3GU3A 1KYZA 4ENMA 4A0YA 4F7ZA 1BC5A 3FUTA 3F8FA 3JWIA 1QANA 5EVJA 3ECOA 4R6XA 4LGWA 3L2CA 1U6GA 4KA4A 2PY6A 4XUDA 5E1ZB 5HDNA 3KLNA 2DI3A 3V97A 2HWVA 3Q87B 2NXCA 4E31A 2CL5A 2QQ9A 3HVHA 3V8VA 4RTMA 1Q1HA 2VBXA 4PYOA 4QVGA 3A26A 5BPIA 2IBSA 3BWYA 3WU0A 2IH2A 4YV0A 5EGSA 3GO4A 5DM0A 2PBFA 3TKYA 1G3SA 2EV6A 1GHCA 2STTA 1HW2A 1XGOA 3M7GA 1RI5A 2K4JA 3T7RA 2ONYA 1EH7A 5GP1A 1FSEA 4L5JA 3LCCA 4GOOD 4QVKA 3GFIA 4JXJA 3PLAE 3CJRA 3FTDA 3HCBA 3O31A 3KP5A 1YG2A 3NVKI 4Q47A 2L4AA 2ZZNA 4FGZA 5GIPE 3E05A 3HCEA 3PB3A 1HSTA 4NQWA 1MDMB 2FRXA 5IH3A 3UJ7A 1J75A 5DX0A 2J5OA 1FSHA 1UWVA 2NYXA 1RI2A 5JUWA 3G7UA 2JJQA 3VYWA 3ISPA 3GRVA 1WS6A 1YZ3A 2GB4A 2PVCA 2HV9A 3FRIA 4AIJA 4RVHA 5CD1A 1TW2A 1G8AA 2QRVA 3KLOA 5HILA 2VC1A 4L7VA 3DXZA 2PMHA 4ASNA 4XCXA 1KA8A 1Z91A 3K69A 1K78B 2FBIA 3ANXA 4RYLA 5LGNA 2P6TA 5HDGA 3UBTA 4B17A 2E1NA 4Q4ZF 2HWKA 3R9XB 2CMGA 2RC4A 2EJUA 1AF7A 3E6BA 3THRA 3IHTA 4V0RA 4KUMA 3R0JA 2PSSA 2STWA 3E23A 3C0KA 2MBFA 1B9NA 3BPXA 5F2OA 3G2PA 1HKSA 1ZYRF 4IKPA 3S2WA 3QU3A 3P2KA 1EH6A 3IWZA 3GZ5A 2ZIGA 1BIBA 3KQMA 4WXHA 3KQPA 4A12A 2YQZA 4YMHA 2XVMA 5DPMA 3LL7A 4BNCA 3EGIA 2ZJ2A 2ACJA 1HQCA 1ZG1A 3MZYA 4DM3A 2DK8A 2RDPA 2E5WA 3AWIA 2ESRA 1EG2A 5HLIA 1XGSA 4O3MA 5FWAA 2PXCA 1O3TA 5C0OE 2VS1A 3KCCA 2I7CA 1FZPB 2P8TA 2FMLA 4CHUA 1R22A 1HNNA 4OQDA 4AZSA 4FSDA 4GO1A 2PT6A 5H6RA 3ZQ7A 2V6CA 2IH5A 2YR0A 5LEJA 3N97A 3OU6A 1JSZA 1KYWA 2O8XA 5CVRA 5EKUA 3BJ6A 2EFOA 4DZRA 3MWMA 3HUGA 2OB2A 2G9WA 3FXUA 4RGSA 2IPXA 1FYLA 1L3IA 2M5WA 3ROUA 4ZYDA 3R6SA 4IWNA 2EJRA 3E8SA 4BP1A 4HLXA 5DM1A 1IN5A 3TQNA 3CGGA 4BP3A 2Q8KA 3BWBA 3F8NA 2NRAC 3FUWA 5DXAA 5E1DA 3F21A 2OO3A 2NNWB 3F8MA 4IRIA 4I2OA 5L3EA 4POOA 2IW5A 4OQEA 2RVCA 1BI2A 8MHTA 2JPCA 1XSDA 2LDUA 3U9GA 2COMA 2CYYA 2LNBA 2F8LA 3B7PA 2QQBA 4QPPA 2AVDA 5BS6A 3M4XA 1R00A 2K4MA 1IXKA 3QOXA 3M6XA 3UJBA 1YZHA 4IV8A 3UJCA 4E2ZA 3KPVA 2VT2A 2EB7A 3NQOA 1JSXA 2P8JA 3KPWA 2ZO4A 3HRMA 5LHGA 2QBYA 4ZYHA 1K6OA 3HNRA 1B1BA 2FRHA 4U0VA 4RB2C 1U5TB 2ZCWA 2JG3A 3DMHA 2D2WA 3F23A 1HKQA 2DBBA 2O06A 3FTFA 3IHUA 3F72A 1KPHA 3BOQA 3JSPA 5J8CA 2PXXA 1FY7A 1WWXA 4WF2A 4QQNA 1HW5A 2ZWAA 3LA7A 3G73A 1X1DA 4HG2A 1OR8A 5LHHA 3IC7A 3E5QA 4G6QA 3RIEA 4EGZA 5FO5A 3JAMK 2YPRA 1W4MA 2ZSUA 2LKPA 1RJGA 1T98A 3HHGA 4RVDA 4A2UA 3I4PA 5LQJA 1U5TC 1ONVA 4X61A 1MJAA 3FZGA 3DV8A 4GCVA 2V79A 5EOVA 1VTNC 4QTUB 4O29A 1BM9A 5U4XA 2XUBA 3KZYA 2OBPA 2L3DA 3OFKA 3P8ZA 4HGZA 3R6TA 2F5CA 1S7AA 2H00A 1AWCA 5EIWA 1SAXA 3BJOA 2ZWVA 2IDJA 5FLXZ 1LB2A 2Y1WA 3E6DA 3K0LA 2GA2A 2DAOA 1NT2A 3HRUA 2NS0A 2OD5A 4A0ZA 4ER6A 2ZULA 4ER0A 4RTRA 2A69F 2ZIFA 5HVQC 3RPUA 4LB5A 2IT0A 1IZ1A 3OZTA 4LG0B 4GYIA 5K03A 5E1MA 1VL5A 4RS8A 1KQ9A 4Y17A 2FNAA 4LLNA 1IRGA 2IPQX 2HTJA 3U2RA 3LBYA 1IN8A 3SQNA 5E2BA 2ZBKA 1VE3A 2OXTA 1B4AA 1BOAA 4C08A 4HX8A 5FQNA 5LQKA 3GFMA 5FLXK 2NXNA 3MERA 2OZ6A 5E1OA 2NNNA 3FF5A 2NXJA 4XBFA 1IN7A 3I54A 2DU9A 5K5RA 3TKAA 4KWCA 1BHJA 1KP9A 2AN5A 3CKKA 1E17A 2VBWA 3DPLC 1LVAA 3EETA 1L3CA 5BPDA 4OU0A 2UYCA 4PWYA 1O9HA 4CTKA 3ELUA 2YX1A 2C7OA 3GEZA 2B25A 1I1GA 4GQBA 4EKGA 3S68A 5DCFA 3DP7A 2FF4A 3DH0A 3GVAA 3BGVA 1DDNA 2GWRA 1P91A 1UFKA 4GGGA 2BR3A 2VE9A 2VP3A 3A25A 5E8GA 3L09A 4LK0F 3P9NA 3AY0A 2IGTA 2ZCJA 5G02A 3FPGA 2Z5UA 3UWPA 3HIFA 3I71A 1IN4A 1XCLA 4WVLA 4WCGA 3QOWA 2X0LA 2BH2A 3I58A 4I0BA 4HQMA 3OZSA 4N9HA 4A0XA 3GYHX 4ER7A 5DD4A 4LLGF 2B3TA 2UYHA 3P9CA 2HR1A 1O3SA 2KIMA 1JG3A 2L01A 2CKDA 1W5TA 1T2KA 3EVDA 1I5ZA 3G88A 2OB1A 5EEGA 3LQQA 5CIYA 2M1BA 3GFLA 3T8RA 4ZZDA 3KR1A 5BOXA 5HOOA 3PQKA 4AZTA 3J7AO 2RN7A 3J80Z 3KP7A 1TLHB 2OKCA 1EAMA 4FS8A 3BWMA 2PWYA 4WK8F 4GYGA 4E32A 5GINE 4Q5SF 2FXAA 1HW1A 5FWDA 4GC5A 3OE5A 5E1BA 5BW5A 4KMUX 2QZ8A 3FPHA 1I1NA 2BBYA 2O6GE 2PXAA 4HYEA 1ZRFA 1MJBA 2WV0A 1JTEA 3CUQB 3TO9A 1L3LA 5D6EA 5EMMA 1BN5A 5HIIA 3J80K 3LWFA 2EJTA 1M0EA 2AZTA 1JE8A 1QAMA 4C05A 4RTLA 1J0RA 3BZ6A 3KPJA 3R61A 4G7HF 3RKXA 5K0JA 5D8LB 1G3WA 4IHTA 4RTJA 3ZMTA 4OX9Y 5CVIA 1G4DA 3O6BB 1FC3A 2PBIA 3WTWC 2HMYB 5CJ9A 2CWEA 3FZVA 1P4AA 3LBFA 4EQQA 2NYUA 3CUQC 4PDKA 1R7JA 2CMHA 4ETSA 3PVCA 2D45A 4UOEA 4ZYEA 3LDUA 1OR7A 1R36A 4ESBA 5HZMA 4MQ4A 3KPYA 1F5TA 1F3LA 4G56A 3B5IA 4C4AA 4AIKA 2YUIA 1O54A 5LQCA 4GOND 3CJNA 3FUUA 3HTSB 3DEUA 5DT2A 2XGXA 5LRRA 2WTEA 5ERIA 1SG9A 2A6HF 1ZRCA 4BHBA 3BUSA 5K09A 5TJJA 4RGXA 1B6AA 4G9YA 4X1OA 2JPBA 3GZ6A 3VOEA 1FOKA 1QYRA 2XKOA 2UXNA 3X0DA 4A5NA 4DKJA 5LSAA 3QPTA 1P1CA 3ER8A 2WA1A 1PJZA 4RTPA 1R5GA 2M30A 4M38A 1P4XA 3FPJA 1MD0A 1ULYA 4M9XA 2NP6A 1V3FA 4YUYA 4EV0A 1XCVA 4P96A 1QAQA 3M1EA 3KU1A 4PGHA 3GCZA 3KKZA 3RIRA 3V7SA 4M36A 3DKWA 5DX8A 3JWHA 2XYRA 2ZNYA 3RW9A 1ZGJA 2UYOA 4BLVA 5L3DA 2PQ8A 2BM9A 2EX4A 3ELKA 3GRYA 2PX5A 4PCAA 1MHTA 1UHWA 4HF1A 3GWZA 3L7WA 4C04A 3F6VA 1HSJA 1KIAA 2HGCA 3R0QA 3LPMA 4YIIA 3EVEA 1BI0A 4EKIA 1FPQA 2K02A 3F4KA 3FTCA 4I7HA 2F2EA 1JQ3A 2JH8A 4E33A 3GLXA 2F5FA 2QM3A 3EVAA 2QWWA 4D0PA 2H27A 3G8AA 5BXYA 1FX7A 2LD4A 3VC2A 6PAXA 1JQEA 5JFRA 2GXBA 4HAMA 1SFUA 2CG4A 2CW0F 4GUAA 4HDUA 3C1DA 3B73A 1U78A 4MTLA 4P7GA 1EJ6A 2ZZMA 3KEOA 4FHTA 3BJAA 2JZYA 3UJDA 1FP1D 2HR3A 3WE2A 2HS5A 1X1BA 3JW4A 3RYPA 1Y8CA 3F3XA 3ABUA 3CO7C 2UZ4A 4MIKA 2YX7A 2B78A 2BE5F 1S8NA 3FM3A 5ICEA 2W85A 1SVUA 1HKTA 1EQAA 4EJOA 3G2MA 5LQRA 1IAWA 2A07F 4ENNA 1I4WA 1YUBA 1U2ZA 4U7DA 4JBAA 2CQKA 3BT7A 1W5SA 3RDIA 1H0MA 3UJ6A 4L9TA 3D5LA 3NDJA 1XMAA 3KR9A 4XUEA 3KR2A 3IEIA 1INLA 4ENJA 4OIQF 2GQQA 4HF2A 4DCMA 3LGAA 1SMTA 4E70A 3Q9SA 3OV8A 5LQUA 3PQJA 2IA1A 1NW6A 3LFKA 1Z05A 2FBHA 3MAGA 2EFNA 2FBKA 4CICA 4UNOA 3SSMA 2K7LA 4L0ZB 3PFHA 4A6EA 4OMYA 2Z6QA 1IN6A 3GIWA 4HV5A 2O3FA 3GRZA 4GBED 2AOUA 1T39A 3A4TA 2Z6AA 3QP5A 5ILVA 4H0NA 3KR0A 3NJRA 3EGVA 3QU6A 4BHCA 3HEMA 3MQ0A 1W7PB 1XDZA 3SXYA 5FFXA 5KK1A 4HF0A 1R23A 1PP8F 4F84A 1SQFA 2ERCA 2MLGA 4IPAA 2HYFA 1KXZA 3SX0A 4HOBA 3OPNA 3BKXA 1I1SA 2Y75A 3DMGA 3NDIA 1WSUA 5H20A 5LR6A 3M8EA 3JTGA 1SUIA 3BZBA 3G5TA 2WC2A 3I53A 1BC7C 2GAFA 1IM8A 1DCTA 4OBXA 3FM5A 1RUOA 5HS8A 1ZHFA 4CXFA 1XDUA 2CWWA 4YMGA 3RPQA 3NWEA 3V4GA 1CGPA 2XROA 3SMQA 4XLPF 5FGMA 5D1NA 5DCMA 3KQTA 2CSOA 1P1BA 4M9ZA 4BYYA 4ESJA 4L9VA 2VOOA 2ZLBA 3NWBA 4DMGA 1D8JA 1R8YA 5HFJA 3J81Z 1F9NA 5EG5A 1XXLA 5DEQA 3T1BA 4CKCA 1R18A 1SD5A 4P5OA 2KIFA 1F38A 5EC8A 1CF7A 4RWZA 5IKMA 5DDGA 1ZREA 1P6RA 5K0NA 4ENKA 2W57A 2NP7A 4HLYA 4RTOA 4BLWA 2DQRA 1E2XA 4QTTB 3GRUA 1G60A 4PGGA 3T0IA 3P9KA 4IVNA 3GRRA 3KE2A 2P7CB 2XYQA 3B3JA 1LNWA 2ETHA 2DPUA 2ADMA 5K0GA 5KQSA 4P7KA 3BXOA 3J81K 2MH9A 4PIPA 2IBTA 1NHAA 2VXZA 4G6DA 4GXOA 5KVAA 2PLYA 5LLQA 3R3HA 1H9GA 2AOTA 3PX2A 3L00A 1U8RA 1LEAA 1G3TA 4M9SA 5FQOA 4E30A 4KNYA 4ZH4F 2A68F 3MCTA 5LQNA 2ISYA 4PYKA 4X63A 4CO8A 2AOWA 1MGTA 3MZHA 3DULA 2ZVJA 2LF8A 1JGSA 3LDFA 1TBXA 2KIUA 3OU7A 3A27A 1Z3CA 4QDKA 1JR4A 1PRYA 3FXRA 4PYQA 2K4BA 1XGNA 2FK8A 4IJAA 3OCJA 2O61A 3QOPA 5LGUA 2O07A 2R3SA 2E7WA 3LDGA 4PYMA 2H94A 4QWQA 3BROA 3IKTA 3EYIA 3HA7A 3HOSA 4MWZA 5F64A 1JXSA 3HVIA 2QLZA 5DSTA 1G8SA 4UV8A 2JTVA 1STZA 1TPYA 3E3VA 3ELDA 3ZP5A 1D2CA 1T43A 1X1CA 3QAHA 4YV1A 2VE8A 1ZN2A 2XAQA 1P4WA 2GLUA 3R4KA 2O0YA 4EM2A 5K0EA 2M87A 2HKXA 4OBWA 1VP3A 2GXGA 3DPTA 2PLWA 3ME5A 3FMSA 3KFWX 3QRFF 3OOPA 1BKYA 2BM8A 3P7NA 3WE3A 1J7KA 5KVRA 1QPMA 1TQMA 2OPBA 2NAZA 3FYCA 4FR0A 3RODA 2YXLA 4KICA 1NW7A 4U7PB 1A04A 4DA4A 2MLKA 3WGGA 3EMBA 5K0FA 4QPNA 4BXUA 5E8JA 1FBUA 4LK1F 4ZZLA 1W7PD 2HKOA 2A3SA 3VSEA 2AOXA 3M6VA 2QYOA 1BI3A 2Q0OA 2P4WA 5LBQA 1KU2A 5A2QZ 3DOUA 1J2XA 3SVZA 2BR4A 2G71A 3D0SA 4ER5A 4KYWA 1BJAA 4LWOA 3P2IA 4Y30A 3CLOA 2QRVB 4IV0A 5D5UB 5DV5A 4CGZA 1L1EA 3C7JA 3HM2A 3ZMUA 3ZPLA 2FOKA 2MH2A 3F22A 2P7VB 4BH9A 2ZNZA 1YTYA 3EVZA 1Z9CA 1D2HA 1LDJA 3TRKA 3U81A 3HA3A 5EQJB 4AWXB 5A2QK 5FHQA 1GVJA 2OBFA 5CVDA 2AS0A 3LKZA 3WTXC 3MEXA 4I02A 5CCXA 4MQVA 1NV9A 5AIQA 3TM5A 1YFLA 3E97A 3MAJA 3W6JB 4XRFA 5GWXA 3M33A 1R6AA 3P97A 3EVFA 4FSXA 5DD8A 3LSTA 1HMYA 4UV9A 4OIRF 3EMDA 5D1HA 2O03A 3HYIA 5FTWA 3O3KA 1YYVA 3GDHA 1ON1A 2VT3A 1U2WA 2RGVA 1D3YA 3KQWA 5DXJA 2BYVE 4HBLA 4R8SA 4MEXF 4WX9A 3HVKA 2FQ3A 2LSOA 2Z9OA 3FXQA 2MA3A 5FUBA 3K0BA 2ZBRA 4FT2A 2B2CA 2JT1A 1O57A 1TNTA 4MHGA 4HA8A 3UJ8A 3CJQA 1YW7A 4HTFA 5K8VA 4Y13A 3E5UA 4XLNF 3HTXA 2GA9A 3FMQA 4AD9A 4E2YA 4L9NA 2XYVA 3ELYA 3IV6A 3WSTA 2PMUA 2BZGA 1L9KA 3HCCA 1SD7A 4O5VA 3T7SA 1I6XA 3EQLF 5L3FA 1XCJA 2PKWA 4G8XA 5HDKA 3KP2A 1JTFA 2XAJA 1UHMA 1D2GA 2UXXA 3HCFA 4AUKA 5DM2A 4M74A 3FRHA 4RX1A 3GXOA 2XV4S 4M37A 1SMYF 3TOSA 3ERCA 3ZN0A 1WY7A 3HP7A 2V1XA 1FWZA 3VC1A 2Z33A 3PFIA 4HGYA 1IXCA 2OU2A 2L02A 3OE4A 5M5BA 3UJ9A 1Z7UA 3QPHA 4F85A 4V0QA 5D6FA 4YG2F 5F2KA 1USSA 2UYQA 1OPCA 3FWEA 3SM3A 1UB9A 4UVAA 1R74A 1DPUA 2F5EA 3TR6A 2QBYB 1L3BA 1P92A 4FX0A 4NB5A 1KU9A 3CUOA 5DYMA 3TOAA 1VBFA 2J5PA 2XIGA 2V1DA 5J6XA 1ZG3A 5CVVA 3M6UA 2IJLA 2I9KA 5ED4A 2ZMEA 5CVEA 5E9JA 2FU4A 2P3LA 3KQQA 4U0WA 1FYMA 1QZZA 4BQAA 3BGIA 2JSCA 1WRJA 3Q7EA 3A7EA 1REPC 1ON2A 2B0LA 2DT5A 2H6BA 1XN7A 2QVOA 1XVAA 2ZIEA 3SHFA 1TQPA 1ODDA 4KW7A 2PWPA 5CVJA 1LDDA 1EH8A 2XVCA 4G94A 3MFKA 2ZZKA 2Y48A 3I59A 4M6XA 3M6WA 5K0BA 1XSXA 1NBHA 1TQIA 3MB5A 4EM1A 3K1NA 5FD5A 4C06A 5K05A 5FULA 4MNUA 1N2XA 2YU3A 5DUKA 4KDPA 4PINA 4P9FA 1OKRA 2LF7A 3G2OA 1MJ9A 1KHHA 3ZMSA 3G2QA 1UCRA 4GOLD 1V4RA 1RNLA 1T0FA 4OMZA 2G8NA 1I27A 1YLFA 2FE3A 5FCDA 2XAHA 2FMYA 5LEKA 5BP7A 3LAPA 3CC8A 3VEPA 3V7CA 5ICCA 1VIDA 2WA2A 5E9WA 5E8IA 4OOIA 3UZUA 3IKVA 4ER3A 5LGTA 1ZH5A 2HQNA 1S29A 5E8RA 4IF4A 2A61A 2G70A 4YFKF 4YFXF 2Z99A 3EVCA 5HLHA 1O7FA 1SD6A 4LB6B 3TOBA 3GF2A 3M70A 2ZFUA 3WTVC 5DM4A 5DX1A 3TGNA 5FA5A 2R7FA 3C6MA 3BY6A 4CWAA 3HA5A 2I6GA 1SFXA 4R1HA 2EWNA 1IF1A 1MKMA 5F2NA 3EPPA 4DCGA 5E2AA 1OYWA 1SD4A 1G55A 2O05A 3CVOA 7MHTA 1LJ9A 2Y1XA 9MHTA 4CDGA 1G3YA 1YO5C 4XUCA 5EEHA 2CFXA 2PT9A 3QP6A 1B59A 3UFBA 3RTRA 1R1TA 3RI4A 3MGGA 1MDMA 3GGDA 4S04A 3DQVC 4DQ0A 2ZBQA 3GJYA 1NBIA 3G5LA 3K9TA 4KT5C 3E5XA 2QENA 3V8JA 4RSRA 1LDKB 3SGLA 3F8CA 3FUVA 5DTMA 4EK9A 1RJDA 2A14A 1DP7P 3KQYA 4KMFA 3E6MA 2Y0MA 1O3QA 2JHAA 4ESFA 1EV7A 5JVTA 2HNKA 2QE6A 4CZZA 1NW5A 4RTSA 5D5WB 3Q5FA 2PJDA 1ZGAA 4R6WA 1K78A 3BP8A 3E7PA 4N0BA 5IT9Z 2DPDA 4UVBA 3HCAA 4FT8A 2C7PA 4N9IA 4R8RA 2VBZA 2DPMA 4M73A 4KDCA 3R60A 4P7JA 1B42A 4CYDA 1XJ5A 2Z3YA 1QGPA 5D5VB 3I9FA 2AS5F 3CCFA 1ORIA 2ZMEB 3DXYA 3IRQA 1Q0TA 4G7OF 4U7BA 3K1MA 3AXTA 4G7ZF 2D1HA 5CCBA 3F6OA 1KU3A 5DWQA 3TQSA 3C3WA 1C0WA 1Z6RA 5IT9K 4K2EA 1ORHA 3KQOA 4MQ9F 3IWFA 2ONZA 1N7IA 3ER9A 2C7RA 2G7UA 3T5XA 3WGIA 3RYRA 1K7AA 1EJ0A 3K2ZA 4ON0A 4EJUA 4BHPA 4PYLA 1XMKA 1EIZA 1QAOA 5J8FA 5D4SA 3BGDA 1U3EM 1TTYA 1SUSA 4XSXF 3BPVA 2ORED 4RB1A 1H9TA 1N7JA 3H3UA
chains in the Genus database with same CATH superfamily
1Y1KE 1FUIA 3PJRA 2KKOA 3VSAA 2CB0A 4OGFA 2HYGD 4UE3S 1CFJA 2D5VA 5FOXA 3CTPA 3TNJA 2VWQA 4IHSA 2Q3DA 5GPAA 1SQSA 1Z5PA 1N8TA 1V3TA 2X8JA 1F4VA 2GO1A 5AW3A 3KSAC 4RTKA 1XI2A 1LJUA 3FCEA 4GZMA 1W87A 5IYZA 3C8DA 1QHIA 3C6KA 2MD5A 2DQZA 1HZZC 4LFUA 1FEZA 4L6IA 1MEJA 3VKGA 5TGTA 4IQGA 2AFIE 2W6PA 1BGWA 2QN7A 4G5YA 2PUBA 4Y2HA 2GQ0A 4Z9YA 4PN7A 1ZH2A 4Q7QA 2QX9A 2IJGX 4NABA 1I2CA 3KXKA 2XWSA 1IBRA 2XCUA 2XNHA 3LKDA 4MIEA 3CWQA 4P5DA 4YX9A 2WICA 2C9CA 4M1KA 1NW3A 1JTVA 3V8NA 4Q05A 5LA6B 4PLFA 1ZNYA 3IUSA 3TDUC 2PUCA 3OLQA 4YJGA 3EYWA 4GLBA 4KMRA 2H09A 3WMXA 2EIHA 1KQ0A 3C3XA 3B48A 3GF4A 2EA2A 3WGHA 4BB5A 4UHKA 1B0PA 1T25A 4XLAA 3U4GA 4XKJA 4EPXA 1PT7A 2DO7A 4FSHA 1ABFA 3GFFA 3K6JA 5EWLA 1ZKDA 2C2OA 2FSVA 5ILOA 2DN0A 4BDZA 4TKVA 5E17F 1E3TA 2XC7A 1WDWB 1WZEA 1GGHA 4ZVMA 4J75A 2AFHB 1DKRA 5I4KA 3HRKA 1R4AA 4TKLA 4RBNA 1YR3A 3SZTA 1EFRD 3U21A 1NQOA 4CDMA 4XQCA 3RS5A 3VVCA 5I7RA 4EJSB 1SOAA 2P68A 3S1AA 3WLQA 2W8ZA 1RWVA 1UT8A 5IZCC 1FMJA 5EMNA 1R1VA 1GFSA 2VN8A 3AETA 3AONB 4P9UA 2C2BA 2B4YA 3B36A 4LNUB 5G2OA 1SCJA 1XPXA 3VU9B 7REQB 3TGLA 2GPSA 2PX2A 2WUGA 1GTRA 3B9BA 1OFUX 3DBVO 2AJDA 4KR3A 2GBIA 3IVGA 3NPMA 4C0HA 3LYAA 2AF3C 5CNJA 2NUAB 2GPYA 2NXEA 3TLGA 1Q1GA 4Y7CA 5DGCA 4CCSA 4D97A 2A0YA 4A5MA 3IIEA 1XZMA 4OHZA 4JQFA 5HS7A 4DLSA 3H4TA 1WEKA 5KNBD 5KOHB 1PG0A 2XMBA 5CVCA 3PFYA 1KEKA 1PN3A 3H36A 1I50J 3IL2A 2WUEA 1LK5A 2OZVA 3V46A 1A9QA 3IGFA 3NM4A 4R8HA 4JY7A 1XUOA 3DMTA 4Q93A 1QZYA 2Q1ZB 2OHFA 2P77A 1GN8A 1LPPA 3FWKA 1PP7U 1ZOOA 1KEEB 4G0QA 1XTUA 1GGEA 5TJHA 3NH6A 1GPLA 3BIJA 1N1MA 1ZCBA 1JNYA 2FSVC 1FY2A 4RANA 1CZLA 3CV3A 4CM6A 4IEEA 1RZ3A 3QPLA 2Q41A 4R0VA 2PKYX 3DFMA 2DRIA 1NG1A 3V33A 2ORWA 3PR2B 3KEQA 2R8YA 1WJEA 4UBJA 1REQA 2QTMA 3FBIB 3D1NI 3DEZA 2ZE5A 4MV5A 2L7FP 2RGCA 2VBYA 1KAMA 3K2BA 3KT6A 3JCZA 2DPGA 3LQKA 1T2NA 4YQYA 4DB2A 2VPZA 3KVVA 4YAFA 2LIVA 1YW8A 5EJ6A 1J0XO 1NVBA 1CT9A 5EKSA 2KRHA 3NBQA 3UIEA 3FB1A 1V11A 3MC1A 5JJBA 2HPIA 1Z68A 2FRVA 1HBXG 1DOZA 5D4RA 4P80A 8OHMA 5KSOA 3RFUA 2W6NA 1FOEB 4L27A 6CHYA 4MPPA 4C76A 3LT0A 2QLTA 1ZFNA 2X42A 1DUXC 1IHYA 3BQNB 1ISIA 5ITSA 3MMYB 1IZ7A 3TI7A 3TRDA 1Y6GA 2QTLA 1RI4A 2IEKA 5M5XJ 1H9AA 1GXPA 4HR7A 3CZ4A 2ATIA 4ISCA 5AJVB 3UPUA 1GGMA 2PD3A 3F96A 3PUKA 4PR0A 1KA9H 5LKRA 1NLFA 2A9PA 2A92A 4E2XA 2LTAA 1OFGA 3RQ4A 4RPGA 1LPAB 5LU9A 1CVIA 2LWIA 4DLPA 4EENA 2DK5A 5HZHA 4K6OA 4MHTA 2VF8A 3NMUF 2FZGA 5B1BH 4ZIRA 1N2ZA 3L0SA 3NM5A 1OKKA 1OYYA 3BIXA 3NHPA 4LXQA 4CXMA 1UELB 5BQPA 2ZE7A 4HATA 1XMPA 4MXDA 1H3EA 5FV4A 4I9FA 1SHLA 2QU8A 3QLVA 3JQAB 5HQ3A 3DMTC 1B26A 3MTIA 4WZBA 4IXNA 1E2IA 4FFOA 1WZNA 4YRAA 2RBKA 2B83A 3B89A 3Q3SA 3PF9A 4I0AA 2KI5A 2QX8A 4MV1A 3MQ4A 3NV9A 3SI7A 2CYCA 1TMYA 5CURA 4RHCA 5HIJA 1KL7A 4DNCA 1YZFA 3WU1B 1RR8C 1IEQA 4QD3A 4CHGA 5DTIA 4JK1X 4U0KA 3WNZA 4Y2QA 5CM8B 1RJ9A 3VPAA 1GY8A 3OEYA 2QLLA 4WCDA 1BFKA 3QXXA 4ZCQA 1V47A 4AG6A 3DKKA 3KYDA 4NU6A 3BXXA 3L7DA 5T3YA 4N4OB 5G4LA 1DOAA 2VOPA 3P26A 1JDVA 1JAZA 4GGMX 4OOEA 4FMPA 3E5NA 5JC8A 4G5XA 1PFYA 1FDWA 1Z73A 3MMZA 4E5NA 1OD6A 1ZJZA 2IYAA 1MC1A 3ASZA 3D3WB 2JCYA 3EPKA 2NXCA 2CL5A 3JPYA 3LFTA 3JZFA 3BWYA 1L5ZA 1TQHA 5DM0A 1KRWA 4RLHA 4BWYA 1F6WA 1RI5A 3FNRA 3VZSA 1UBOS 2H48A 4HAUA 1YJ5A 5AW0A 2JFFA 3DT6A 4H15A 4RIGA 2XNDD 3FTDA 1YT5A 4E3WA 5A7HA 5LZ4A 1R7RA 4N82A 4LIUA 4M3GA 2B5VA 2XF6A 3GT7A 1OLSA 2WTXA 4IDDA 4UMDA 2ZCVA 2HZ7A 4G0OA 2C3UA 4IIJB 2ZTLA 2XF5A 3VKHA 1MV5A 4CODB 3ITDA 4ZT5A 3PKJA 2QD3A 5IU6A 3C4JA 3WISA 1GGVA 3QLVC 3MJDA 5PGMA 1O03A 2ZXHA 2WWGA 4RFSB 2I4IA 4WN9B 1XMOB 3JYHA 4S24A 4IKPA 2HI0A 3KQMA 4DLVA 2W83A 1UZAA 1W25A 3BMOB 2IGBA 2O5VA 1JR3A 4R1TA 1M2JA 3AOGA 4QQRA 3RVOA 3PYXA 5A2GA 1WJGA 1ZD9A 3A03A 3L8HA 3AWIA 2IPOA 2PXCA 4A15A 2I7CA 3UXYA 1HNNA 5HOEA 1RKXA 2Z2SB 1DJLA 2C7VA 4OATA 5EQDA 3NO4A 5IF3A 2WWFA 5CVRA 3RYTC 3BJ6A 2EFOA 3DKRA 3LU1A 4DY4A 4PZZA 2G9WA 4CM8A 2OGUA 4BMNA 4IWNA 1S5PA 4RJTA 2XKBA 3TW8A 2GN6A 1GU0A 4HUTA 4B3DA 2NNWB 5DU2A 2BHRA 4TN5A 3VBCA 1ZONA 4LOHA 1SUCA 4RHFA 2CYYA 2R8RA 3GGSA 2RHGB 5HM6A 2HXIA 2WSYB 2GCNA 2V4ZA 1TZMA 2DFPA 1U0FA 4EOGA 1K6OA 3UW3A 1FL9A 5ALQA 2EGGA 1P4HA 3RS3A 2DBBA 2V7TA 2HCFA 2A9KA 4WF2A 4R1OA 2YJNA 2DA4A 3O2JA 2FAXA 1WUKS 5CNKA 3CA8A 1KFEB 1M7BA 2ZQYA 3GJTA 1TO6A 4K9PA 2XUBA 3TEMA 2QPAA 1NAHA 5IFKA 3DCFA 2I8CA 2OUIA 5FLXZ 1LB2A 2UUOA 3A4VA 1U8BA 1QPBA 5DEIA 3K0LA 3G2KA 4BO6A 1F06A 3IULA 4PW0A 1JUMA 1E2JA 4OREX 1O8CA 4PY2A 5IS2A 1HG0A 3COWA 1B1CA 2IPQX 1MB9A 3GWGA 3DCIA 5KWJA 1B15A 4LYFA 1IV8A 5EXEA 4GQAA 1IN7A 2XGDA 4UJ3A 4J43A 1PEYA 3OMWA 4Q1VA 5ARCA 4OU5A 2TMKA 5A3QA 4XGKA 4OH1A 1E1LA 4KO8A 1QYVA 5DCFA 1UOPA 3BMQB 1QYIA 5TISC 1X7HA 3S2HJ 4INJA 5FPQA 4J00A 5HRAA 1MD9A 1QB7A 2X5KO 2EEPA 4QHYA 1LQUA 4BNXA 2KIMA 4DYHA 1IVNA 4D3FA 3LQQA 2R6AA 4DR1B 3GFLA 4W1UA 4I55F 1ZOSA 4BNYA 5HOOA 2E18A 1ZA2A 3TEDA 4IR7A 1NVVR 2PWYA 5GINE 1R9TJ 2HUPA 3QBEA 3VKVA 1WJ5A 4KMUX 3FPHA 3LDAA 1SZPA 1N5DA 3RAPR 4EY4A 3K8ZA 2ZROA 1J0EA 3TZEA 3LWDA 3H5TA 4Q9AA 2BDTA 4KOAA 2FR8C 2JA1A 4FMDB 3RKRA 6ADHA 3MJFA 3U4AA 3TX2A 5BR7A 3Q0WA 3D6FA 4O2AA 3INRA 2QSGX 1R36A 1DG1G 2R7LA 3D7RA 1NKSA 2ZJOA 4MQ4A 3IAXA 4G56A 4V2FA 1K92A 3QA9A 1YDEA 4CL8A 4XCQA 3QPSA 2ZRQA 5H59A 1CHNA 1BE8A 4KNVA 4G0YA 5L8VA 4EFKA 1SG9A 1JFLA 2B1RA 4LK3A 1EDBA 2HA5A 3O8LA 2XADA 2CJWB 4CM3A 4DCJA 4DDMA 2UXNA 3X0DA 5A71A 1TADA 2YOGA 2AQFA 4NH0A 3CNNA 1D0ZA 2VKQA 4DYRA 2Z04A 2RKWA 4LWQA 4W63A 1NHWA 4Q4JA 2YICA 3L7WA 4XLLA 3SNKA 1D0VA 1Z5UA 4LJKA 4LX0A 2ONCA 2OTJI 3T3IA 3WLPA 2OJED 1J5XA 2BFBA 3ZK9A 4LRSB 4R7TA 1DQRA 4GPD1 2CFOA 1YZNA 4TM8A 1PVDA 5FPTA 2IHVA 3NOOA 2SICE 1KKLA 1LDMA 1PFGA 4K3VA 4BU1A 4FHTA 1Y4SA 3NASA 5K3EA 1P74A 3ZQLA 1LQ2A 4PU0A 2AJTA 3CZPA 4LXGA 3R8FA 4GSKA 3N2GB 1YUBA 1KI7A 4ON9A 1DBIA 2ORIA 3L8EA 1ZXXA 3FNFA 4GZ6A 3CR8A 1XRJA 4RMHA 3N39C 1UBJS 2X19A 1SHKA 2RCYA 5L6MB 3WWDA 3OV8A 1Y3CE 2NU7A 2YNMA 3U4IA 1SZCA 3LFKA 3QEAZ 1TM4E 5BT8A 2FBKA 2ZBUA 3TLXA 2ZYDA 2HF9A 4P08A 3UPTA 1MORA 3A4TA 4DIKA 4QAQA 2TMYA 2BEWA 3TB6A 1RFLA 3LKVA 5I4CA 4RM2A 3AFHA 1JA0A 1MJNA 3RHZA 4EGAA 4CLRB 2LKCA 1N0HA 2C29D 1XCMA 3S3MA 1WSUA 1Q7GA 5DBEX 2JIPA 2HPVA 3I53A 5M5YJ 4B3RB 1ZHFA 4CXFA 1U4SA 3EGXA 4FDMA 3SMQA 2ZXWH 4MB6A 2L0XA 4XDHA 5D1NA 4CMIB 2PKXA 5JNSA 2D7DA 3NWBA 1D4FA 3V7YA 5L53A 4UB8C 1L4BA 5KQGA 1YQUA 1W6UA 4ANFA 3SC2A 3E8XA 4ESEA 4HLYA 1Z7LA 4MVCA 4Z1MA 4FFSA 4PGGA 2XYQA 1K8RA 5JS7A 1FOWA 1AQYA 3MF4A 1KDVA 2G36A 3N2NA 1Q17A 1KI6A 2IBTA 2QUBA 4G6DA 1IUPA 3TCKA 5I9BA 3R3XA 1YRNB 3LNTA 4BNFA 2SKEA 3K1ZA 4X63A 1P1KA 5FRNA 1XZQA 1I6MA 3OU7A 1JR4A 3IJEB 2K4BA 1JR6A 4GMGA 3A70A 4UJ5A 4AYBN 1UPUA 3LDGA 2YN0A 2MSKA 1NVEA 1W7AA 4W1PA 3BROA 4ENVA 1JKIA 4WFKA 3LA8A 3IA2A 2VTBA 4KQMA 5GTHC 1Q7EA 4KSYA 2WJIA 1XTKA 5KOJA 1X14A 1EP9A 3RCOA 5BMVA 1SG6A 4UE2A 1OSNA 1D6JA 3UT5A 3U4QB 3SEAA 1VP3A 2HU8A 5KNCA 3D1JA 1ACMA 1QE5A 3P20A 1LUJB 4M1YA 3W9UA 4UUNA 1HNWB 1WMAA 1D09A 1T6BY 1QR6A 1ZUD1 2YOHA 2MLKA 3IPCA 3QI2A 2JAXA 2F3TA 1WXEA 3DZJA 1KVSA 2IYRA 3DTYA 4BXOB 3C3DA 4X64B 3S1MJ 2BUCA 4P9NA 1X77A 2GXQA 2UZ0A 1U7TA 3LDHA 4RKEA 4J29A 1BJAA 2SHKA 4JEIA 3AP2A 3C98A 2QRVB 1FB5A 1YJXA 3UK6A 5KAIC 4ACBA 4LQLA 3FPSA 1YTYA 1D2HA 4G0UA 1LDJA 4K9RA 4PSKA 3F7OA 4D3SA 1A4XA 1U1EA 3AK4A 1ZM9A 1JVBA 1RXSA 2YIJA 3QF7A 4KPEC 2VK2A 5D7BA 3RIGA 1A1VA 3W6JB 3OA0A 1X6VA 3T95A 4IUYA 3PRKE 4YEJA 3RR2A 5FTWA 1B6GA 4CNQA 3OIVA 5DXJA 1AHHA 5J1UA 1DRVA 3FFAA 5JEEA 2BFPA 4MHGA 2J09A 1DLJA 3M3YJ 3F9KA 2XOKD 1GA6A 3BLYA 2BZGA 4LJ6A 5JE8A 3NHRA 2F4NA 3JQ6A 3EQLF 5IJWA 2PKWA 5CKTA 2NX2A 4Y2UA 3U1KA 1PTKA 4X66B 1DO8A 4C9BA 2NVYJ 3KVNA 4HDNA 5TRTA 4YASA 1G21B 3H4VA 2WADA 1KMHA 4DLLA 2XDQA 1NN1A 2X58A 5F2KA 1USSA 2UYQA 5I8ZA 1QZEA 3EGCA 2DBRA 4X20A 3QP9A 3AF5A 1DPUA 2F2TA 3ZVKA 1L3BA 1EU1A 4DADA 3QK7A 4Z3OA 4DBLC 5CVVA 2IS6A 3RSLA 2ZRDA 3W5BA 4JS0A 2P6MA 3FYSA 4GLJA 1JDUA 1FYMA 4ONEA 2E2HJ 2R5ZB 3ZK7A 3QU5A 2E6UX 2QP9X 4Y6OA 2YVUA 2AZMA 1A9YA 5F9HA 2C1EA 1TM5E 4M6XA 3CM0A 2FN4A 1MTZA 1FX1A 4QM7A 2CBXA 4Y3UA 4ARIA 2J0VA 4BO5A 2VT7A 3DDNA 4KCGA 4EUSA 3MWYW 2WJ4A 4EHKA 1R0KA 2HKIA 3EGWA 3JQ9C 4FFBB 3QYAA 5KTPA 4HDKA 1MJHA 5B2EA 5E8IA 3HLTA 3QI7A 4JMPA 4PJJA 4Q1CA 5E8RA 2I54A 4TWIA 4TVOA 2JCGA 1L1QA 4ETNA 2BHLA 3KQKA 3T5DA 4J1NA 3IP6A 3WAGA 5HNFA 3WYAA 1MNDA 2FFRA 1Y42X 1PZNA 4DCGA 3OZBA 2O05A 2XB2A 9MHTA 5KVVA 4Y67A 2HCRA 4UHCA 4CIYA 4C89A 2XZPA 3RTRA 1QGOA 5LXTA 1YONA 2V0CA 2H1WA 4DLXA 4UHDA 3G5LA 4O8ZA 3V8JA 3ZDBA 1ZGGA 3FUVA 5LBTA 3JRIA 2PS0A 2JFZA 5CRIA 5HCNA 3U3DA 3ZHVA 2REXB 4RKFA 1YQEA 4YFYA 1NW5A 5D5WB 2PJDA 1RXUA 4XSHA 1ORDA 4P1WA 3E4DA 3G23A 3VC7A 2LPMA 1JJIA 2J67A 4GKKB 2H4ZA 2XTNA 3LNCA 1G6HA 3LUFA 3OZAA 6YASA 5CCBA 2PDAA 2NS7A 1Z6RA 1J22A 4IQ4A 4YLGA 4MQ9F 2YWBA 2F43A 1USGA 2MW8A 2R87A 2PT5A 3HEAA 5B36A 5C7OO 3CPEA 2CGEA 2ZPTX 5CYFA 2A9FA 2G0EA 2HQ1A 1TCCA 2DA7A 2QM0A 1WP9A 4WINA 4EB0A 2JKZA 4Q4AB 3D3NA 1DKLA 2VTVA 5BN3A 2X6RA 5ALHA 3KFVA 3DCYA 2AG8A 2I3DA 1NOJA 4ZDWA 5A1JA 4I08A 2IA5A 4LC1A 2H4YA 4XICA 1YWGO 3I0TA 4IYJA 3WYBA 3OTHA 3QGMA 2X2FA 1DVRA 2ZT7A 3NC4A 4J0FA 4Z8YA 4RVFA 5CYVA 1Y7PA 2SCUA 2XQJA 3LY8A 4BMXA 4OF4A 4KVZA 2OYRA 2PU7A 2QNIA 1P1RA 1KDYA 2QVZX 4RF3A 4H7JA 1IEWA 3GFBA 2WAQN 2HIGA 3M3DA 2QT9A 4TXMA 4Z4FA 3MCZA 2FPMA 4OAYA 3ZMDA 1CY1A 2PGLA 4RIEA 2HC9A 1QM5A 5AJYA 3TLCA 4FLMA 4RA9B 4R2JA 4ZMRA 5A06A 2J9GA 1JUDA 2QGFA 3EDRA 1QJ4A 3BVPA 4MS4A 4E5YA 1MH1A 3KB2A 5FBWB 4U9IS 3EH2A 4BJ5A 2YZKA 4UNIA 3CS3A 4BKRA 2JD2A 3E3NA 4HVTA 3N7TA 2Q3LA 1IHDA 5GZ6A 2MHCA 3G8YA 3B85A 2REBA 1A72A 4V38A 3L2RA 3V8KA 5B2FA 3KT3A 5DTDA 2ILVA 3P5SA 5AW4A 3MD9A 2WWRA 1O4VA 2ZDHA 3D7SA 4K3UA 5J58A 4MQEA 5DRYA 3ZHUA 2HEOA 4G5QA 2M4GA 1USUA 5FORA 3K9LA 2RGDA 1JG4A 4HQEA 3ZV6A 4G0VA 4EELA 1ZCZA 2FEZA 2C2XA 1H05A 4TYQA 2VDOB 2PSFA 1NMYA 4X92A 4I98B 1TNSA 4JYPA 3C43A 4JLDA 4PLHA 5DW3A 3ROTA 3OOSA 1XTPA 2E1CA 4BV8A 4UD2A 4L4SA 2MINB 3L1IA 2PJZA 4BV3A 2YXEA 2YUSA 1PSZA 2H1VA 4DR6B 3UA4A 2VPIA 5BNIA 3NHMA 2KW5A 4AB1A 3G0IA 4K8RB 3QTTA 4NDZA 4XMYA 1E1CB 5JAOA 4MKHA 3VKUA 4CLOA 2GRUA 1JFRA 3MHTA 1KO5A 2BGTA 5BR8B 2W90A 4KIWA 1ECJA 1BMFA 1QLWA 4BZPA 1EDEA 1QDEA 3TUIC 2CS3A 1I8TA 5JXWA 3EFHA 2XSDC 4HRXA 5CT8A 4B4UA 5A02A 3TQRA 2P79A 1PKEA 3GLGA 2X5JO 1JTYA 1XTSA 4BFCA 3K4NA 5DCWA 1ORWA 1T8TA 3STWA 7ADHA 1U5AA 4H9GA 5IT9A 4EG0A 2E7XA 2F62A 1WKVA 2R62A 4GYWA 3DUFA 2COKA 2PSJA 4L0DA 3TIGA 2BHNA 2HBZA 1O08A 2VHYA 1NBMA 3KPUA 4BJ5C 2JSPA 2RGNA 2UWMA 2BZSA 4EMBA 1R8XA 1PTJA 2ECFA 5SICE 3OVMA 3UUGA 5JI6A 1C0EA 1KI9A 4LHEA 1ZNWA 3LA6A 1HEIA 4Q21A 2A1TS 2RI6A 3RU9A 5JALA 3PPYA 1G6Q1 2CMDA 2ETXA 2NU9B 1IMJA 4FW9A 4AD8A 3ZWDA 1GFWA 2XUDA 3GLHA 4EQ6B 4J19A 3ZHSA 1SC7A 1RJFA 2M8GX 4DG9A 3BZWA 4G1VA 4I50B 5JIBA 3P9RA 3OF5A 1RWQA 5BW8A 2QY6A 5JZMA 1Z7WA 1CCWA 2WJHA 2F3SA 4HH3C 1KJ9A 3KXLA 1L5MA 2OSVA 1NONA 1VJRA 1VHTA 1MH4A 4RKWA 5IEBA 2B8NA 4KXQA 1NZDA 1R1UA 2ECQA 3AM4A 3STYA 4B3IA 1XQVA 4FX5A 2QG6A 3L06A 3ZQ4A 4E5VA 1Z5NA 3MGKA 1G291 5KHLB 2Y69H 1X8JA 4BUPA 1KI2A 2B4KA 1RI3A 3WGVA 4EMSA 2FMUA 1JG6A 4YFNF 3CT4A 5KYXB 2Y6UA 2VLBA 5GMOA 1T5IA 3CJQB 3ACDA 2NZWA 1VKHA 4KE6A 5JD5A 1VL1A 1EP2B 4RKRA 1SPXA 2WJAA 1M73E 4F1KA 1ZQ9A 2LVBA 3RRYA 2O20A 4JI6B 2ZJ8A 1T1GA 1IOVA 5EWMB 3U3MA 3CCSI 4GU5A 2WM9B 1J5YA 2PRZA 3V2UA 1TT0A 1PV4A 4E1AA 1Z5GA 3TFWA 1FP7A 3BSYA 4CZ2A 4BDYA 3UA3A 2PMBA 2OD7A 3ID6C 1T1JA 1Y1SA 1DO2A 3ZD6A 3R4CA 5A9TA 3DVAA 1LBTA 5KO2A 1GILA 1W4ZA 2HPAA 1WKMA 2V7QA 1LU9A 3THXB 5G0VA 1TXGA 5C8YA 1F8YA 3GJQA 3GRKA 1MNEA 1PV2A 3I4FA 2HU9A 1F36A 2P5KA 3JTHA 2NO6A 1BOOA 1I3QJ 2D59A 1I0LA 3KB1A 2XHKA 1CULC 5FKJA 4L9JA 1E92A 4RENA 1X58A 2FPXA 1T26A 4WT7A 4L51A 1XB4A 2E55A 1FP4B 4ZEXA 2AFHE 1IAVA 1PW5A 3WTZA 5BPHA 1JX6A 3ECOA 2BOVA 1GNVA 5F1JA 2NVUA 2ELKA 3NWSA 5IDWA 3FDFA 4OIMA 3OM8A 4F3KA 4D5EA 3OQJA 3UJ3X 3GVPA 5CYPA 3GVIA 1OFHA 1XGOA 1IPFA 1RPTA 5GP1A 4I4TA 4CLEA 5FWNA 3LQYA 4W5NA 1P7ZA 3O31A 3QF4B 5KJFA 4NBTA 2YHBA 4MP6A 4ZDKA 2WYUA 3A2NA 1ACIA 5HIAA 1D2MA 1O0CA 1EFDN 4PE5B 4UXJA 4IILA 4HRIA 2IXBA 5JUWA 3G7UA 2FEWB 4K1LA 3L04A 4RZHA 1CJUC 4BCBA 1CB0A 1GZHB 3L7OA 3Q88A 2QVXX 5HDGA 2QTFA 4DLKA 2PYZA 2FP4B 1GUZA 2ZTUA 5E6UA 2HREA 2B9SA 1V1JA 4C2TA 3DHEA 2JVHA 4LMRA 3TE6A 1WSBA 3IWZA 1Z18A 3UWOA 3KQPA 8ABPA 3EBLA 3UF0A 3LL7A 5JW6A 1RRKA 2FV8A 5F12A 1GFIA 1V1MB 4DSOA 2AK2A 3RFXA 3G0BA 1IATA 3RUDA 1N7GA 3WS7A 2EHDA 3BAFA 1OWPA 3QLUA 3RARA 4PPFA 3KJZA 5JXJA 1T3HA 3S1SA 3U7RA 2VJOA 2ECPA 1R0ZA 4AQDA 3K9FC 1I3CA 3AYZB 3NGXA 5KTMA 3H05A 4BP1A 4BP3A 5IAJA 3OJXA 1ZUIA 2HA3A 1U2TA 5ALNA 1LV7A 3CRZA 4QOHA 2P91A 3CMEI 4V19K 4GG1A 3MG9A 4RPLA 1CBUA 4LF8B 5ENVA 3OX3A 3I4MJ 1GGNA 3HNRA 4RPKA 4U0VA 5BV8A 4XE5A 1ZICA 4TS9A 3D31A 1PZHA 1RWOA 3C15C 2QAGB 3SC6A 2AKAB 3F72A 4XVCA 1EXVA 4KQJA 1WWXA 3GLSA 2ZWAA 4RS4A 2DWOA 3OQ6A 4QECA 1UPTA 3OJEA 3E18A 2FGKA 3MKLA 3MJVA 3PE6A 4C0BA 4DJJA 4YRDA 2BHZA 5LQJA 1DB3A 3U3ZA 3DS8A 5ITZA 3K3PA 4NYMR 3V8EA 4I0WB 4NIMA 6AT1A 2VUUA 3EWNA 4EO9A 4R7ZA 1U63A 3NIBA 4JJ6A 5JS2A 3HEFA 3L0PA 4UQLA 1WHSB 1IZ1A 3WSVA 1Q0UA 4LG0B 1YE8A 1NG6A 5TQ2B 3IAAA 2RAUA 2FFAA 3GCGA 3H9CA 1DBWA 3IV7A 1IQPA 4R9RA 2O9JA 3PG5A 4B84A 2CJYA 4DS3A 2DA6A 3WK8A 1Y5RA 2B25A 1TA0A 3H0KA 3DP7A 3ZHCA 1YAHA 3BMNB 3G49A 3I1JA 3L1VA 4ESOA 1PX0A 5AM0A 2V55B 4WCGA 3I58A 3DXFA 2R6CA 1ZOPA 4LZPA 1LSSA 3QLUC 1O3SA 1JG3A 3K6KA 4NCBA 1T0JB 1M0TA 3D54D 1NRJB 1N9KA 2M1BA 3P19A 3O2QB 3CVXA 3J7AO 4QYWA 3QODA 2RN7A 2FXVA 3K31A 4AO7A 2HRRA 1E3DA 2VYQA 4YI3A 1Q22A 5JJCA 4HCJA 2X40A 4MP3A 4S1WA 3WIUA 2I6TA 4TXLA 2L9SA 2O6GE 1JTEA 3K5WA 4KDFA 1XXHA 3V6LA 3VNRA 4G0NA 3OEWA 4F9FA 5C3EJ 3OZFA 2YWDA 4RSHA 3RKXA 4NBWA 4TYYA 3LE8A 5F5LA 1E5VA 3GFPA 1A9XA 3DVRX 3OYEA 3UXEA 1RM3A 3UWSA 1SA0A 3BRSA 1P4AA 1WCV1 4NBKA 2HAEA 3THYB 1AKNA 3KPYA 1IK4A 4LY0A 4CEIA 3ASOH 1JWBB 1HE5A 3ND8A 4MW6A 4R2XA 3UMMA 4YP1A 3S1NJ 3AZPA 1KZ6A 3P9PA 2Q6TA 1NXXA 1PLJA 1S4MA 3L0IB 4HEA6 4RGXA 3U4HA 2LCQA 1RLOA 3FLMA 4OWRB 2CZQA 3VO2A 4O4IB 1MD0A 2ZIAA 2NP6A 1TU4A 2JZOA 5IULC 1LTKA 1OV4A 2QLMA 3N6XA 4XZ3A 1F8GA 4WZ6A 3FXAA 2NVOA 3N8NA 3GLUA 4DIQA 2K40A 1MOZA 1AZWA 1Q2XA 4JCOA 2BY0A 4Z53A 5LQSA 4MJ7A 4QFCA 1FPQA 2FCRA 4BNKA 1V35A 3FTCA 5BWCA 2R5WA 5K7SA 2YY6A 2R68A 1GZ6A 3EVAA 3HYTA 4ND8B 2IGKA 5HFAA 5BXYA 2AG6A 5EJMA 1FX7A 1MABB 1JQEA 4KQHA 2ZWOA 4GUAA 4HDUA 2VBIA 4I5DA 3JRNA 1QH8A 2NUTA 1ZW1A 1LV8A 2Q7OE 3QBDA 1FP1D 3KJIA 1YA6A 2HS5A 1DC8A 4RQTA 4ZVQA 2Z16A 3BRQA 5JY6A 5K6TA 4QJIA 4MDFA 5IOYA 1BDIA 4KQWA 1V16A 3MUFA 2DFKB 3IAFA 1CB7A 2DPHA 3E4CA 1Z4KA 4DTIA 4LTNA 4Z0NA 4HH1A 1MP0A 4MYTA 5IZCA 4B2YA 4PSVA 1QRUA 2WBMA 2VP2A 5BSWA 1JMYA 2D0IA 4C4YA 1QU3A 2K7LA 3OX2A 4D1QA 2E4AA 4NYIQ 4OMYA 2WDPA 4EPVA 3HOYJ 1MH9A 2B30A 1TF2A 2Q28A 2QLNA 1EVKA 2OQVA 3U4CA 3QU6A 5IVHA 2P2DA 5FLKA 3ESDA 1A96A 2ENUA 2OHGA 3JRXA 2WNSA 1GZ4A 4G36A 4IPAA 3JALB 5EP1A 5HDBB 4OKSA 3O2SB 4GRDA 2Q3EA 1IM8A 4YACA 2B8WA 3WP0A 1C3EA 1UJ6A 1QFZA 2LRDA 3KL2A 4X6UA 2WUVA 1XD9A 1YXMA 3UK1A 1ZIDA 3ZVRA 3FPCA 1XXLA 1KJYA 2MYSA 4ND6A 1F38A 4C30A 1LE8A 2P5SA 2FJUA 3I2YX 4RTOA 4D02A 4BLWA 5HDQA 1T9BA 3PSAA 5GP9A 3DZKA 1E96A 1C3LA 1BFDA 2J0UA 5AYVA 1IZ0A 4YCCA 2IITA 3U0VA 2UZ3A 4RV5A 1H1LB 3L00A 2CXTA 4QKQA 1XG1A 2PSEA 5J9FA 4DPMA 4M9SA 4H3HB 3GMTA 4HUJA 2EFHB 4AYWA 3W6VA 1H93A 4YQFA 4WK2B 3ZYZA 1AA9A 3JQPA 1T2UA 1OJLA 2EWWA 3P2MA 4IJKA 3RRJA 2O61A 4U8HA 3IP9A 1WB4A 3GJ5A 3DV2A 3W3ZB 1PUFB 3PDIB 3IKTA 3EYIA 4ZCIA 1C9KA 3EFOB 3OE1A 1G8SA 3HDYA 2JTVA 3I28A 1TF5A 1D2CA 3CCQI 4G0WA 2VE8A 3ZW9A 1JHDA 3TBFA 4HFNA 4UEWA 2Q8QA 2D3WA 1KS2A 4XX1A 2XA9A 3T4UA 3A1FA 3PUWA 3ZDFA 4ZYUA 2FEAA 2G4LA 1TJ3A 5FA6A 1MU0A 5KNLA 5IKOA 3QWFA 5JYEA 2J0SA 1MNMC 3DE3X 1QHNA 3WB2A 5G4KA 2OPBA 1XYGA 1YQXA 5IUJC 3IPYA 2V03A 3WGGA 3QBVA 4QPNA 4YHBA 4TLEA 4U8GA 3SMVA 3OFSA 4CM9D 4U6QA 3M6VA 2QYOA 5EPOA 5A1TA 1BYIA 1TEVA 3HGGA 5B5EC 1J2XA 5FNVF 4MLZA 1UDBA 1N2CB 4Y30A 2YV2A 1GG2A 2HOQA 4BX3A 4RM3A 4MW2A 1L1EA 3C7JA 2A84A 3F22A 1S1MA 3WY9A 1JKJB 1UBGA 3T7EA 3KOUA 1TWAJ 3BILA 4DIBA 5BT9A 5AESA 3SYRA 3SQDA 4B3SB 5AIQA 4HBGA 4AT1A 1P7WA 2VEOA 1MO2A 1A88A 1GGKA 4XTRA 4JGIA 1VL8A 3LSTA 3EMDA 3IBSA 1ZXLA 1AKEA 4Y2TA 2ZU6A 4Q19A 2C7BA 2ZJ3A 4LRXA 2CK3D 4C0XA 3AFOA 1CEEA 1U2WA 3FZYA 1R6BX 3P9XA 2F6RA 1WLSA 3CP2A 5EFZA 4R8SA 4MEXF 5AXAA 3Q0VA 5EJGA 3I5XA 4RL4A 2CV2A 1N4DA 2P6NA 2E87A 4R4JA 3ELYA 4A8JC 3KBBA 3BJIC 3PR3A 1NI4B 2LKXA 5CTJA 1E58A 1CD5A 1E1QD 4WJKB 3EUAA 4PTZA 4CCYB 3PRHA 1T36A 4ZRMA 3NU1A 1YRWA 3DU6A 1RC8A 3GXOA 2ZAMA 4AAYA 2XV4S 4WCVA 2QR2A 1VQ5I 2VCHA 2PZAA 4HUQB 2R7QA 2QX4A 4HGYA 1C8VB 3N3AC 5M5BA 3ADPA 3N6RA 4W6QA 4L5YA 3KDAA 4UVAA 1BGXT 3GLQA 1WU7A 2O0KA 1LFUP 2WUDA 2X6XA 1Z3IX 4NXMB 4RDXA 2FZWA 3ZCPA 1JE1A 2IJLA 5MGBA 3I12A 1I6KA 1Y4ZA 4YHHB 5KTSA 1Q0PA 1RETA 3AL0B 1J0AA 1RW4A 3SHFA 1IN1A 1T4DA 4PSAA 1SVMA 1EH8A 4G94A 3DBLB 4F5EA 1QR2A 4TLCA 1GDHA 4YEDA 4EM1A 2AG0A 4I5EA 1Q5PA 1ADFA 3PQ5A 2ZSBA 1FDRA 4R41A 5ARDA 2I4MA 3V7CA 4OOIA 4AJPA 4AMVA 4RKYA 4C3ZA 2HQNA 4DV4B 1M10A 4ZVLA 1AUQA 4MP8A 3Q1KA 2WD7B 1SVWA 3IR5A 1COZA 1QV7A 4ZO8A 3VNBA 5BQFA 1I3KA 2BISA 2VH5R 4MIOA 4J4TA 3WE7A 5IVIA 2Y1XA 5JC1A 5EJ2A 3VR5D 1D4OA 1SQ5A 2OECA 2Z83A 4K6FA 1L4MA 2PGNA 5KYUB 4W5TA 4J0EA 1Q44A 4YDQA 2G9UA 4LY3A 1MPTA 4J3FA 1EX9A 2ARKA 3TGPA 3K4CA 2PLNA 2JHAA 3R23A 5THKA 1LPQA 1NUHA 4FCWA 5EERA 1P1FA 3OKAA 4EY8A 3F2IA 3HCAA 3R5HA 3T35A 3EFBA 4TUYB 2QVCA 4IPTA 5AVTA 2HWYA 3UGJA 1XZPA 1YI1A 3HHEA 1OCOH 4WIAA 4AWBA 1PJ3A 3R7WB 1UQTA 4BECA 1C8LA 4MQMA 4NJEB 1K7AA 5A7FA 2EFGA 1J8VA 2QL5A 3SS7X 1JSCA 4MITA 3TIFA 3PD7A 1E3MA 5DMHA 3FXKA 4Z9BA 1PNRA 1J25A 3MJRA 5KKNB 4TS4A 3CB4A 4P84A 2AXLA 5DNVA 5DLYA 5F23A 1WCIA 3JSOA 2HLNA 2I80A 1DQPA 5SZHB 2GXUA 5HS9A 5D3QA 3E9QA 4R31A 2IVZA 1NMXA 2AN3A 2PQ6A 2QSYA 1WUYA 4DLUA 3WLSA 1JQDA 4U88A 1HDIA 3EBOA 3C1UA 1CR2A 1KMIY 3G2LA 4X1EA 3M6LA 3DNMA 2PFBA 3WTCA 1RYNA 3DO6A 2X0EA 1VC2A 4OAOA 1ZD4A 3QNWA 1YU9A 3K6RA 2FEOA 3QYBA 4MWGA 3QWHA 1LQ1A 2YS6A 2GH1A 1NVMB 3HJRA 1E69A 3AMVA 1CUUA 1CJMA 4PK4A 1JJBA 1SBHA 1S2LA 1O4XA 1VKOA 4DIMA 4KLCA 1IZ8A 2F00A 1Z0FA 4PFKA 4G86A 1XTAA 2HGZA 3D4LA 1IHPA 1P4SA 4C2UA 3HCPA 1NXSA 2D5IA 1L5GB 5CFNA 4JXXA 3ZXUB 1Z47A 3W9YA 4BIMA 5CLSA 1QRTA 2OSBA 3HR7A 2G1JA 4QSMA 1E7WA 1WHUA 1DPRA 2GZWA 2I33A 2MABA 4MCHA 3J80A 3SDBA 1NASA 1IXSB 4YJFB 1JHHA 5AJHA 1Z38A 5LHIA 1T9GS 3SC4A 1ZJJA 4YCNA 5TNXA 1O97C 4BX0A 4IIDA 5AW7A 1EIWA 1D8AA 3CPJB 1HDXA 4HH0A 1R6DA 1UDXA 4B40A 2G88A 2P65A 1G20B 3FJYA 4C7XA 4A7PA 4YCJA 4H27A 2YQ5A 5G40A 3D64A 3QX3A 3D8HA 5JCZA 3C45A 3UBMA 4OLJA 3W8FA 1X8KA 2CH0A 1S1CA 4GWGA 4H1WA 1N2SA 2AMVA 1JXMA 3A11A 5EJ4A 2OAZA 1G21E 2B69A 2P3QA 4JI5B 2UV8A 5DHAA 3LOPA 3ABOB 1W96A 3LCUA 3W7BA 4L3OA 4R1LA 2NVXJ 1SH7A 1OQYA 3DFGA 4LKRA 2F6CA 1XDDA 4LYYA 3BCRA 3H86A 4LE0A 4MOWA 5IM4F 3CLKA 5BQTA 3H11A 2FR8A 1QVTA 1MC5A 1BVRA 1KJ8A 4UM9B 5LRSA 3CNBA 2JRTA 1ANKA 2XGSA 1N32B 4FCYA 1CF7B 2PPVA 1CETA 5JWOA 1GQSA 1GG9A 1Y3DE 3TFQA 4G26A 3T5BA 4AY6A 5FF9A 1V95A 2GPTA 3C4VA 4OYYA 2D2FA 2CL0X 2NSHA 3WLAA 1JE0A 1VTKA 5BPFA 5KAPA 3KWMA 3FMGA 2VA9A 2CWDA 2AZXA 4NX2A 2WB1A 1L8OA 1HTTA 2Z4RA 1N3BA 2QQGA 2AW5A 5JMWA 1TAQA 5DLQC 4KMSA 4UKDA 3DONA 1ZG5A 2J5KA 4BN5A 2B0JA 1R16A 3EK2A 3HB5X 4ETWA 2NAPA 3EXIA 5I8WA 3KV3O 3HJEA 1SHJA 1XEAA 5JTTA 1U3UA 2IRFG 3T1HB 3L7MA 1V48A 2L19A 2HX1A 3F4LA 5BV2P 5LDDC 3ZN1A 4RF5A 1DRWA 4OI4A 2OQ2A 3ULQB 3IBTA 1M5UA 4F4FA 1HSOA 4RHXA 5E4TA 1E7RA 3ZBTA 2G5GX 3KKOA 1AGPA 2O23A 3CNEA 1ZLJA 1DMSA 1IBSA 1P7YA 1SURA 3NEYA 1GARA 3ZWYA 1YR7A 3I56I 5TMPA 1Y4UA 2PLAA 5JS1A 1QA6A 3JQ7B 4NF2A 3ZLUA 4LJSA 4BCCA 4LZZA 4OTZA 3FXMA 4HNAB 4UEJA 1JEAA 4RXUA 3U0BA 3MYRA 3G9XA 2X8BA 2YVLA 3VOBA 3U1DA 1YFKA 3ASVA 3MVEA 3TTVA 3EUWA 5FYDA 3EEIA 2WIDA 2C9BA 2ZAYA 3E6CC 3B6MA 1HRKA 3CX6A 2OTCA 5KNDA 4KX5A 5C1PA 3OZXA 5CLQA 4DCUA 2Y9YA 2R751 2QJWA 4K9OA 1SKBA 2VF4X 1TQ2A 3DC7A 4JOBA 1PDNC 1FDOA 1CP3A 5AFSA 3VPBA 1KFCB 3JSXA 2GD0A 4WEQA 3DF8A 4AMGA 4QGAA 3L2WA 1BMTA 3PR1A 4BQEA 1A6IA 2PNFA 5A5GA 2V1UA 2GVNA 4EW2A 2X3UA 1MBGA 1U9JA 2HFHA 1N34B 2B9EA 1QOPB 2DOKA 2VPLA 1HF0A 1RRVA 1NJ1A 2Z8ZA 3PQDA 1KE1A 1ESEA 3VZBA 1EHCA 2FPPA 1I1QB 1G4HA 1NQWA 3AHEA 4R8MA 4AVPA 4I8IA 3EJWA 4O4HB 1R6XA 4KFCA 4HD8A 3H2GA 4KIFA 3P9YA 2D0DA 1I3LA 2D54A 4P5PA 3G2NA 5EY5B 1U94A 2O2EA 4KYUA 3H13A 4M3EA 3IQZA 4YYEA 3LSGA 5FL7D 1ES9A 3NEPX 4I81A 1KOFA 1HH4A 4BKUA 4X93A 3QLTA 1KI8A 2GPJA 4OHBA 1NXWA 3IH5A 3PV0A 1LF5A 4AZ0A 2E4YA 4QL3A 3HSEA 3KTAB 3SEQA 4OV6B 1WXGA 1OXUA 1ZUHA 1J0BA 2PO5A 2AXPA 4Y2PA 3KEMA 4EEXA 2WVHA 4KXFB 4BPBA 2QQ0A 3FHCB 3O3CA 1YIOA 3VTFA 4LQ4A 1JG2A 4CM5A 5DLDA 3OIFA 3D59A 4E1VA 4GMKA 2DTZA 3FUTA 3F8FA 3PFFA 4M8IA 4DBZA 2REOA 2PRIA 4HDMB 2IXFA 1Q91A 5HFNA 2UDPA 4MA4A 2HF7A 3NYIA 3ZJYA 1JHYA 4A9AA 3GO4A 4Y9SA 3MPOA 3VZCA 1ADYA 2OO5C 1O94C 3U7QB 2VJIA 4LXXA 1U3DA 4GOOD 4J76A 3IRUA 3GFIA 1GGJA 4C88A 4YMTA 4RMIA 1V26A 2C77A 1YG2A 1GA4A 3ZV5A 2ZZNA 2VXDA 2PMKA 3IAS2 3Q9LA 1DU6A 5TF4A 1J75A 1DFHA 4JK3A 4PAMA 1Y5LA 2NYXA 4TKZA 2HJSA 1D5CA 3ISPA 2GCPA 2L69A 3T0GA 3M2PA 5AKHA 4KGZA 5TX7A 2ROQA 5DASA 4ECEA 1YOVA 4DWJA 5BQXA 4MGZR 3B51X 1PVVA 3UBTA 2E1NA 3LLMA 5CA0A 3SAJA 1SBNE 2KT0A 1NMSA 2PMZA 1SVOA 2WPNA 3OOEA 3PPVA 2R85A 4ZK2A 3CVUA 5B3KA 2MBFA 3ORRA 3MYYA 3K72B 1M8GA 2EKQA 2XE6A 3CZ9A 5TARA 4DV6B 3EWSA 4L28A 1PE0A 4KQ6A 1XRSB 3CLTD 3JR9A 1PR0A 4X1YB 2WJWA 1GL9B 3UB4A 1VF9A 4B3FX 1YCHA 3GJ0A 4HX5A 3TD9A 3DHNA 1SCQA 4IL5A 2ZAGA 4GLFA 4CHUA 3EE6A 4FSDA 3ZQ7A 2X0KA 4E12A 1GLGA 3RB8A 5EKUA 1WUTA 4FI3C 2VC2B 3ROUA 1FNMA 1U7OA 3ZJUA 1WQ3A 5CJ2A 3TVTA 3NGLA 1YIJI 4QLOA 3OURA 2BGJA 5DXAA 2OO3A 3PQCA 2XTZA 4WBSA 1X92A 2IW5A 3M1LA 1QONA 4URXR 3S28A 3U9GA 5J5CA 3M4XA 1YIDA 1CZUA 3DLTA 2EB7A 3NQOA 4YP6A 2OBBA 2WIBA 4EHAA 4PZUA 4I1PA 4N4NB 3BH6A 4PGAA 2Z8YM 1MBKA 1WPGA 2QQFA 3DWEX 2QPOA 2FN8A 1QCDA 1K75A 2WSBA 5LIPA 3BR5A 3RIEA 3JAMK 1M2VA 3FSEA 5NULA 3JQ9A 4UPVA 1PYVA 3I4PA 4RZ3A 2Q0XA 1OCCH 1MJAA 3FZGA 3CZQA 2V79A 4YAIA 3VPDA 5U4XA 4CM4A 1AK2A 3O4IA 4E5KA 3CESA 3V9PA 2VTKA 2Q8PA 1BS9A 5L4LA 5B7GA 4RBOA 3DMNA 1Z2NX 2OEPA 4IFBA 3RBXA 1O96A 5IF9A 1UC8A 4EG3A 2W2LA 2ZULA 2RK3A 3EXHB 1CS0B 1VI6A 3TQTA 1N9ZA 4V3CA 5K03A 1JLLB 1U8UA 1MXHA 5JD6A 1EXDA 2IP1A 3T6KA 3HJNA 1O95C 1E7QA 5F7ZA 2PUWA 1FFXB 2WV7A 1OZFA 5FWXB 1AT1A 5EKTA 1TIBA 2WV1A 2PZFA 2M1ZA 1KQ3A 2CF6A 3DPLC 1WL8A 3FISA 1RWMA 2W7TA 2X4LA 4C3HJ 3KL4A 1THMA 3FTNA 2P9CA 1P91A 4J4HA 4GGGA 3D6JA 1J09A 4M53A 3DDUA 2OENG 4E4YA 1OIVA 3EQ8A 1XVIA 2WT4A 2IOHA 4Q1FA 5CPBA 4Z4EA 1M2FA 4N9HA 4HF7A 5IM5A 4X7RA 2HD4A 4ROTA 5DD4A 2EGHA 1S2IA 4HXGA 5FO0A 1AS3A 3DOJA 4CVNA 2RARA 1UBUS 4AZTA 9ANTA 2XEXA 1ADGA 4IIBA 1NY6A 2QL9A 2KFDA 1RRFA 3FG9A 1RKUA 5LMCA 1GL3A 3RVJA 4HNVA 2OFPA 2OHIA 5TXGA 2NO0A 3MWDA 3PRYA 2CHEA 4EI2A 1Z21A 1JE8A 5HLTA 4F6RB 1Z2PX 1G4DA 1CYDA 1FC3A 4OGLA 3WTWC 4X8LA 4LHVA 3HOVJ 4UBNA 5CDHA 3GLFA 5FD8A 4R2HA 3A02A 4DC0A 4FYMA 2BKVA 1COWA 1WF6A 4NJMB 5FUVA 1P0CA 1B16A 4IYRA 4OHYA 5D3MA 4AIKA 1C29B 4XWYA 1AQLA 1P5RA 1XD8A 4M7WA 5LRRA 1IJKA 2WSIA 4E5UA 2UUZA 4DJEC 2QSUA 2WU1A 2WWVD 1IOLA 4NZMA 4A5NA 3O91A 1ZBDA 1DJQA 1BOFA 4M38A 1YDHA 1QVUA 3E48A 3QMVA 2C3MA 1Q0LA 2FEXA 2AGVA 5KMGA 1YBVA 4BFZA 3AF2A 3Q12A 5COAA 5T41A 2HGCA 2CJPA 2ZSDA 4LKOA 3VHXA 5HKOA 2DHEA 4L0QA 3HZRA 2HLHA 1OLXA 3S70A 2JNWA 5G1NA 4E33A 3GLXA 1NSTA 1TQ8A 3D0RA 4F1JA 4JI2B 4X1IB 2V0NA 4AC9A 3O2NA 5BMOA 4P4NA 421PA 1SFUA 3CCJI 3EIEA 1UFQA 3B73A 2V7FA 3MJ4A 3IDSA 4P81A 2W6ID 3N59A 3KG2A 2QOEA 1ZAKA 3WKEA 1NVWQ 3L3BA 4FB5A 3P2OA 1V8OA 4KU4A 5BOSA 5AXCA 5HNHA 1T9KA 2QT0A 3WZ2A 1Z9BA 3MINA 2N8GA 4PIVA 3HCOA 4C6HA 3AEUB 2HGSA 3PPXA 1V8BA 3VJKA 1H0MA 3OMXA 3BICA 2R7RA 2KYRA 2JJ2A 3P4UA 3IKJA 2LW7A 2W6QA 2VJKA 3OETA 3CTMA 1L4LA 2ZE6A 1JKFA 1RC1A 1KVTA 2YKGA 2CQ7A 2Q21A 2F3PA 2J59A 1NJ6A 3JARA 1X9IA 1JT6A 5DGXA 1KY4A 2I2XB 4IIHA 4C6TA 4W8GA 1CUXA 3G8CA 4U5XA 5I01A 3TQHA 1RLIA 3KFLA 4ALNA 4HOBA 4AKSA 3OPNA 5IPFA 1I1SA 1DAOA 2ZUDA 4RAQA 4QNRA 4XM2A 5DHUA 8ATCA 1VQLI 1XDUA 1M34A 2EBIA 1G19A 2WMDA 1XZBA 1L7AA 2W70A 3KQTA 1GSOA 2AE1A 4FQ8A 1KP3A 2CFSA 3J81Z 3PFWO 3O84A 2AKYA 3AI2A 2C5SA 1QUEA 4DJTA 4YJ3B 2XLBA 1XDWA 3B3JA 1BA3A 2ETHA 2PMEA 5H83A 2RREA 1OWLA 3ENVA 1KJQA 1BJRE 1E9VA 4AUMA 4UTOA 1E98A 2RGGA 5K8JB 3CSDA 4KNYA 2N0SA 1XAJA 2O3SA 3L79A 3HKDA 5LXTF 5JFOA 3TLMA 3T1OA 3BGOS 2OZPA 4L78A 1VSBA 1WHTB 2NT4A 1JPNA 1XEWX 3DB2A 2X1VA 3HOSA 3BTLA 1G8YA 5BSUA 4EX7A 3ZP5A 4KZKA 2CNKA 3A36A 3LRPA 4M0LA 2WG2A 3S2FA 1T8RA 1AGXA 4TT3D 3HKCA 4WNCA 1UDAA 2A58A 1IY1A 1IJBA 1IAQA 1M72A 1FFHA 1TYDE 2FSFA 2PSHA 2Y9ZA 5BURA 2VUHB 3EZFA 2HF8A 3EQ6A 4KJZA 3HXOA 2JHGA 2Y1LA 4BXUA 2B1GA 4ZQHA 3VR4D 1Z3XA 3VSEA 2AOXA 2PD6A 3K4MA 1OWMA 5A2QZ 1OHHA 4C0QC 2R93J 3HJTA 1QBKC 2B1JA 1ENHA 2FQQA