3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
b'AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
4BHCA 5DRYA 3KR1A 2M45A 2VP3A 2P1DA 3DPLC 4RGSA 2EV6A 2ISYA 1R74A 5DX8A 4OMZA 2V7EA 3JWIA 2YVLA 1RIOH 3LWFA 2FHPA 3UJCA 1FC3A 2ETHA 2ZFWA 1HQCA 1IAWA 3GF2A 5ICFA 1HSJA 3CLOA 3DMFA 4JXJA 4PYMA 2ORED 1YF3A 2WWYA 3BKWA 3WE2A 1OYWA 1P6RA 3X0DA 4E2XA 2PGXA 2YU3A 4U0VA 2ZIGA 4UVBA 2LF7A 3BROA 3SSOA 1EV7A 4G7HF 1DDNA 5HS9A 4I0BA 4CHUA 1LJ9A 3M7GA 5D1NA 2QRVA 1L0OC 3OPNA 2EJUA 1NV8A 3R0QA 2Y48A 3CTAA 4G7ZF 3H2BA 2ZZKA 4L9VA 1X1DA 4UHTA 3CBGA 1SFEA 2YXEA 4I7HA 3KLNA 2AS5F 4BY9E 4DA4A 1XDZA 3J80K 2R7FA 3GWZA 1D8KA 4G94A 3O2PE 1R8YA 5E9JA 5EZSA 5K0JA 2WV0A 1NHAA 3DH0A 3N4MA 5K01A 2GAFA 1K79A 1R18A 3WU0A 3V8JA 1I1SA 5DD8A 3GFLA 2Y1XA 2WA2A 3EUHA 1BJAA 4EJWA 5J8CA 5CYVA 1BI0A 3UJ7A 4RGUA 1WXWA 4V0QA 2D1HA 3A4TA 2DAOA 5EMJA 3PB3A 4GC9A 4BYYA 2IFTA 2QENA 4UV9A 2HEOA 1TQIA 3GFMA 4HRAA 5KQRA 2FBIA 5D8KB 4WK8F 1O3TA 3EVDA 5FQNA 3KP7A 1ZARA 2QBYA 1AQJA 3B3JA 3ECOA 1RI4A 1U5TC 1XJ5A 3FPEA 2QQBA 4HAMA 5FO5A 1TW3A 4E31A 1MJAA 5HDKA 3IHTA 5K0CA 5K1YA 4BLVA 2PMHA 3T0YA 2NXNA 3SQNA 3BWMA 4F7ZA 3NWBA 1IRGA 2ELHA 2P3OA 3R6SA 2PLWA 4M6XA 2VS1A 1VP3A 1W7PA 2JH8A 1IM8A 2UYQA 2QE6A 1UFKA 4LLGF 3TO6A 4G6QA 5F64A 2ZIEA 4IF4A 5F6FA 5DM1A 4EM0B 2DI3A 1QAQA 3L2CA 2Z6QA 2FNAA 4RTQA 2B9EA 5FQOA 5HVQC 3BWYA 3EQLF 4ZYDA 2L02A 4N0BA 3EMBA 5LQAA 3FWEA 4Y2HA 1QAOA 1QBJA 5L3DA 3KQWA 3T0IA 3F8FA 3LCCA 3KPWA 2YUIA 5E20A 3JAMK 1Z7UA 1D3YA 5DCMB 2PX2A 3PVCA 3TFWA 2PT9A 1G60A 2CW0F 4BH9A 3COAC 1SQFA 2ZNZA 4L0YB 1FZPB 3A26A 5EHIA 5LGUA 3KETA 2FPOA 2CYYA 3VODA 3UJBA 1BOOA 2ZBPA 4P96A 4ISCA 2B2CA 2CGPA 3OFJA 3CUOA 2L01A 1NKVA 4PYKA 2EFWA 3R9XB 1PUEE 1ZGAA 5JI6A 2AOWA 2E5WA 3OE4A 3IWFA 2STWA 6PAXA 1LEBA 5EPEA 3R3HA 1S29A 2EFPA 3U2RA 2P4WA 3W6JB 1Z91A 2MLGA 3I53A 3C7JA 3ZMUA 1BIBA 1YYVA 1ZRDA 5E1MA 4ER0A 2PX5A 4KA4A 4M72A 3HTSB 2PJPA 1VIDA 1YZHA 3EGIA 3GCZA 3OV8A 5BMZA 3C6MA 5HDGA 2XAJA 4M9SA 2VN2A 3SX0A 1D2CA 3G8AA 1IN7A 2KJCA 1T43A 3KZYA 2J5PA 2IW5A 2O03A 4RAYA 4EVIA 2JRTA 4GCVA 4G9YA 3PS9A 2FEZA 1USSA 2V9VA 3MWMA 5DSXA 2IBSA 4LMYA 4YIIA 3TM5A 3KCCA 3FTEA 1KU7A 2HWVA 3HYIA 4FSXA 3BPVA 2N47A 2IDJA 1VQ1A 2BM8A 3LECA 4S05A 5EOVA 1T38A 3HVJA 2LSOA 2ZFUA 5ICEA 2Q2EA 5DTMA 4LK0F 3EETA 5D1HA 4YFKF 4ER3A 2FYTA 1H0MA 1IXCA 2DW4A 1YFLA 5HEKA 5E8GA 3IYLW 4IRIA 4RGXA 4P9UA 4U7PB 2XIGA 4ATNA 2Q41A 4RTPA 2P6TA 1IRFA 3BGDA 5D5VB 1H9GA 1Q0SA 4YUZA 4A0XA 4EJTA 4PYOA 4FR0A 4F85A 4LB5A 2AOXA 1XGOA 3WTWC 3HUGA 5LEJA 4PIPA 2HOEA 5DM0A 4EM1A 3A27A 1BIAA 4KFCA 4LFUA 1WG8A 4CICA 1DL5A 2XHKA 5LEKA 4WVLA 3UA3A 3HHGA 3ZPLA 2UYHA 2JPBA 2LKPA 3LQQA 5C1IA 4LG1A 2EV5A 3I9FA 4O5VA 1XXLA 4IXAA 4PYNA 3M1EA 3E3VA 2ZBQA 2BH2A 3ZN1A 3H3UA 3I71A 4EMSA 3I0TA 4OU0A 2VC0A 2IIPA 1YG2A 2CQKA 1O54A 4C03A 2DQLA 1N7JA 4YFXF 3KQMA 5EEGA 4QDKA 3K1PA 4IPAA 5T67A 3FPGA 3MHTA 1J2XA 4LD5A 2Z5UA 1YLFA 1W5TA 1PJZA 1VL5A 5E1XA 2YR2A 5DTQA 4ZZLA 5LHGA 4E2YA 2K4JA 2P7IA 2RN7A 4ZYGA 4EQZA 2UXNA 3HNRA 3ZMTA 1VBFA 2DT5A 2BR4A 4CZZA 4M73A 5H6QA 1RUOA 4IV8A 1HKTA 3A7DA 4Q47A 2M87A 3GRRA 3I59A 4HTFA 3V8LA 1ZRFA 5JUWA 4BXUA 2Z3YA 1IUYA 4MQ4A 3W6KB 2YR0A 5FCDA 1F3LA 3GZ5A 4BLWA 4EKGA 3R4KA 3A25A 3F23A 4LWOA 5LHIA 1NW6A 2FA5A 1R5HA 5DPMA 4L7VA 1L3IA 2P6SA 2JHCA 1QQIA 4RSRA 5D6EA 2FRXA 3VYWA 4R05A 3EGVA 5ILSA 2NS0A 3PTAA 2NP7A 1ZRCA 3V7SA 2EX4A 1SD6A 4G56A 4ER7A 5EVJA 1D2HA 1U3EM 1ODDA 2K86A 4E30A 2ZCJA 2BR3A 1RNLA 3BJOA 5C9ZA 5FWAA 3WTTC 1UHMA 3I58A 2NNNA 2NNWB 3IWZA 3AY0A 3BPXA 3DV8A 3NDJA 1S3JA 2GZWA 4DCMA 5ICGA 2V6CA 2O0YA 5HZMA 1KR5A 4LGWA 1XCJA 3PFIA 2JG3A 4GQBA 1LDDA 3EVCA 1B1BA 3QOXA 3WTUC 1CF7A 1O3RA 4OA5A 5LGNA 1ORHA 3THRA 1DCTA 3GYHX 1Z3CA 2NYXA 3B5IA 2P5LC 1XCLA 3DQVC 2K4MA 2QVOA 5CVEA 2EFQA 4IRHA 4HV6A 3BGIA 2GWRA 4MGRA 1FOKA 2XVMA 5BPDA 2ESRA 4OIRF 3ERED 3V7CA 4KMUX 4G8XA 4R8RA 3ER9A 4QPNA 4P9FA 3LBFA 4GXOA 4IHTA 4QWQA 4EM2A 1MDMB 3RIEA 1FPQA 3E8SA 4OIOF 2FBKA 2K4BA 2PXXA 3P9KA 4E2WA 1IXSB 1EH8A 1NW7A 2A6HF 1WY7A 5EHGA 4HG2A 3TKAA 2NAZA 3LPMA 2BGCA 1M6EX 1ON1A 1ZAOA 2V1UA 2GXGA 5K0NA 4RVGA 1P39A 1D2GA 4QQKA 3PFGA 4DQ0A 5H20A 3P9IA 4R8HA 3AAFA 3QAHA 4HX8A 4X60A 2EFNA 2O07A 4PCAA 3DF8A 1DPRA 4IHSA 4KIFA 3QP5A 4RTNA 2NP6A 4HF0A 2ESHA 2H09A 2VDWA 1ULYA 4RTLA 4ON0A 1MGTA 4LG0A 4XRFA 3HTUA 2ZULA 4DMGA 4LB6B 4B8XA 5E18F 3VC1A 3BJAA 2EV0A 3OZTA 5TJJA 2E7WA 3FMQA 4I2OA 4OIPF 2P3QA 3ISPA 4ETSA 3THSA 3V8KA 1E2XA 1O3QA 5E8IA 3SZTA 4HX7A 3BUSA 1NW8A 4GOOD 2OBFA 2GA2A 5L3FA 2GAUA 4CDGA 1L3LA 1K78B 3EYYA 2HTSA 1I1GA 3MAJA 1BI2A 3G8BA 2I7CA 3ID6C 4RTKA 1Q0TA 3LA3A 4GYGA 5EC8A 3RKXA 1U78A 5DX1A 1SMTA 1G8SA 3FRIA 2HMYB 2IT0A 1LVAA 1HMYA 2FXAA 1B4AA 5BS6A 3G2PA 3TQSA 3WE3A 4E70A 5EEHA 3WGGA 2WA1A 1Z6TA 2JJQA 4U0WA 1SKMA 3BWGA 1YS7A 4A5NA 3CJRA 3R61A 3TOSA 1V3FA 4KN4X 3E97A 1ZG3A 3HCCA 1G38A 2FSWA 5KK1A 4V0RA 5LHHA 2B0LA 3MFKA 3TLJA 2Z33A 4KNYA 2ZNYA 3ELYA 3EVGA 1IN6A 3HSFA 1EH6A 1RI3A 5FUBA 1YFHA 3HVIA 5K0FA 4XCXA 5CJ9A 2M5WA 4KDPA 4MHTA 3C3WA 4Q4ZF 1JG4A 2IH4A 2E1NA 2WTEA 3HRTA 1BM9A 4FP9A 4YV2A 2F2EA 2F5FA 3IL2A 2QM3A 1IN8A 1KIAA 3AXSA 4S04A 4FHTA 2EG5A 3NEUA 5FD5A 4Q48A 2IRFG 2MLKA 3FZVA 3LFKA 5E2BA 1EH7A 3HCFA 4ER5A 2XV4S 3MTEA 2P3LA 5DM4A 1P91A 2IVMA 3P97A 3GRYA 2XVAA 3DXZA 4C07A 3CKKA 3IRRA 2E1CA 1O9GA 1OR8A 3MCTA 3ZMDA 1PP8F 3UJ8A 1JG2A 2AVNA 3CO6C 5GIOE 1IN4A 3P2IA 4ENMA 1TPYA 2OO3A 5U4XA 3E6MA 3MB5A 3G5TA 4EK9A 3DPTA 2ZZMA 2OXTA 1HNNA 3TDUC 4HH4A 5F2KA 1R5GA 3HA7A 2DBBA 1JQEA 3GFIA 4U88A 2ZKZA 1X19A 3F8MA 1R7JA 2IPQX 1X1BA 3CJNA 4X63A 3FXRA 1GXPA 1P4WA 3T7RA 5E1OA 2Z9OA 3L8DA 1HXDA 2PX4A 3UJAA 2G7HA 2L54A 5BXYA 1MZBA 3KQVA 5DD4A 4ZYHA 3L9FA 3KR0A 4CKBA 2O8XA 1SD5A 4YG2F 3G2MA 3OFKA 4O29A 3MEXA 3SSMA 1L3CA 3PT9A 4U7BA 3F4KA 4I09A 4MHGA 3MCZA 5ILVA 3CDHA 2GA9A 4AZVA 5DWQA 4KDCA 2JT1A 3FTDA 3ABUA 1MJ9A 3HM2A 1MKMA 3LA2A 5HLGA 2C7PA 1XGMA 3TO7A 1R00A 1VP9A 2CG4A 2EFOA 4PCLA 1XSXA 5HOOA 4NECA 3RYPA 4DKJA 1Q1HA 2IJLA 1KYZA 3KQQA 2NXJA 3BZBA 4M6YA 3KKZA 5HLIA 4GF5A 2OYRA 1KQ8A 4K6MA 4XUEA 4R79A 1S8NA 3HCBA 5ERIA 4RTOA 1GVJA 3ZMSA 2VXZA 3WTSC 2G71A 3LKDA 2PI0A 4CGZA 1I4WA 3K6RA 4XLPF 5A2QZ 3B73A 2PX8A 5EZQA 3GUDA 1XD7A 2QLZA 3MGGA 4KIBA 4KDRA 1JTEA 5CUQA 2XAHA 4IKPA 1HW2A 4P7JA 3P2EA 1UB9A 4POOA 1U5TA 5EIFA 3FM3A 4QVGA 4YV1A 4P55A 4PDKA 2P7CB 4XSZF 3GFJA 1UCRA 3PQKA 2F8LA 5DCFA 3I64A 4L18B 2OQGA 2AXLA 4DM3A 3A7EA 2CSOA 3I4PA 3K2ZA 2ZIFA 3RW9A 3VC2A 2A07F 4OQDA 1HW5A 3GGDA 5LGTA 2A68F 3OZSA 3ABTA 3UA4A 5ICCA 3DOUA 4NHJA 1R1UA 2G70A 4BHBA 2JZYA 1NE2A 2ZWAA 1MDMA 1ZLJA 5A2QK 2BE5F 3F8BA 4RB1A 1IXKA 3M9AA 3OOPA 1OMIA 1YS6A 4U7TB 4X41A 3SMQA 3JWHA 3JWJA 2M1BA 4M9ZA 2HKOA 1NT2A 1SFUA 4HSGA 2HR3A 4PNEA 1TTYA 3JTGA 5E17F 3E6BA 2G7UA 3K0BA 3RTRA 4YIFA 5EMKA 3HSRA 4MEXF 3HCDA 3R24A 1EJ0A 3FXUA 1TQMA 3P9CA 2PJDA 3ORHA 1D5VA 3SGLA 3FX3A 4B17A 5FGMA 3ZP5A 2FK8A 3E5XA 4WCGA 3WTYC 3FPFA 5FHRA 2O3FA 3SZPA 1LDKB 2C6YA 1VLMA 3Q7EA 1JTFA 2FE3A 5CIYA 5IT3A 1MHTA 4A12A 5DLYA 3TOAA 3LDFA 1I1NA 4RWZA 2BR5A 3G5LA 1R6AA 4HF1A 2BZGA 1QZYA 2GA1A 3CUQB 2PY6A 4XLNF 5FFZA 1XTPA 3LDUA 4GEKA 3B7PA 2K02A 4LECA 3R6TA 5FFXA 2D1VA 3OU2A 3WGHA 5K5RA 3HTXA 2CO5A 1I5ZA 1ZHFA 3GEZA 2H00A 3T7SA 2EFJA 1KU3A 3EVEA 4I02A 1OR7A 3IRQA 1F5TA 4CKEA 3HIFA 1P4XA 4CTKA 4DQ2A 3NVKI 4OBWA 3EVBA 2QY6A 4RTMA 2VOPA 4OQEA 1PP7U 3LX6A 4OINF 1W4MA 1P1CA 3KPUA 1I9GA 2G8NA 3E6DA 3ZN0A 1U2WA 4KYWA 4HW0A 3T8RA 4FSDA 1FBSA 3HOTA 2OKCA 2HR1A 4Y15A 1AF7A 2DO7A 3IKTA 1U8RA 4QLCU 2CFXA 4F84A 1A04A 2JPCA 2DPUA 3EEOA 2ZW9A 3KU1A 5EG5A 2IA0A 4WXCA 3BOQA 4DCGA 4HGYA 2FQ3A 3U81A 3GNLA 2ZBKA 5DT2A 2BV6A 3RI4A 2A3SA 2DLLA 3E23A 5J6XA 4HDVA 4G6DA 3EVAA 5HFJA 5HS7A 4RVFA 3DR5A 5BQTA 1TQPA 1JSZA 4HX4A 3E05A 3FM5A 3RYRA 4X61A 3FUXA 1FBQA 1VTNC 4I0AA 3TO9A 1QNTA 3KP3A 1HBXG 4E33A 4RGRA 1IY9A 3Q5FA 4UUVA 1QZZA 1NV9A 5JR3A 3B89A 2MD5A 2YSRA 3FYDA 1MD0A 3TQNA 2BBYA 3DLIA 1Y8CA 3BWBA 5IH3A 3E6CC 2KW5A 3LBYA 2L3DA 1NBIA 2H94A 3FUVA 2C7RA 1FT9A 1F1ZA 4XSXF 3G2OA 2F5DA 5GWXA 2HDCA 1LDJA 4PGHA 2R6ZA 2YTZA 1AV6A 3VB2A 3D0SA 1VPTA 1KPGA 2JSCA 3EEYA 5DUIA 2V1XA 2VC1A 7MHTA 2ZZNA 2ZBRA 9MHTA 1JHHA 5EMLA 2ONZA 3CJQA 5K0LA 4P7KA 1XSDA 4M74A 3DMHA 5K03A 1DPUA 2XYRA 2TDXA 5EKUA 3FPJA 3LGAA 2GQQA 3KP2A 3E7PA 1L1EA 1FJXA 4IJAA 3G2QA 2XGXA 4QVKA 1JR4A 2OB1A 4WWCA 4P7FA 4R6XA 5P8WA 2EK5A 5FA8A 1YUBA 4LK1F 2HWKA 5DX0A 1G3WA 1XMAA 2OBPA 3QOWA 4GO1A 3HA5A 5LLQA 1ZG5A 2IGTA 1SMYF 2IBTA 3PLAE 5ED4A 1FBNA 3M6XA 4ASNA 3T8TA 2LNBA 2FOKA 1GHCA 3NVMB 1T98A 5LRSA 3DTNA 1KA8A 1WXXA 1KQ0A 1N2XA 1QANA 3DXJF 2NYUA 3H92A 1ON2A 2QZ8A 3ROUA 3C3PA 2DU9A 2CWWA 2YX4A 2QBYB 2I9KA 1W7PD 3JTHA 5K5QA 10MHA 2E7XA 3K0LA 2GS9A 2O06A 4MIKA 2KIUA 3TRKA 1FSHA 2QQAA 3HVKA 1S7AA 3HSEA 1FSEA 2AOTB 5AIQA 1FYKA 5FULA 4ZZDA 2PBIA 5GOZA 2RVCA 4ESFA 2IDKA 4RV9A 1QGPA 5JVTA 1ZYRF 3FUWA 4PWYA 5E9QA 3G88A 2OAZA 4KWCA 2OA4A 3M8EA 3RKWA 2I6GA 1FP2A 3T7TA 2JHAA 5FADA 2PN6A 2PBFA 1B6AA 3ER8A 3WODF 1YTYA 5CVUA 1USTA 4TV7A 5F2OA 1T39A 1HSTA 2FF4A 3PX3A 1KU9A 4GC5A 5E9WA 3DKWA 4RYLA 4ZTBA 5B1SA 4AZTA 1XB4A 4DZRA 5MHTA 4I01A 3KZZA 3FF5A 4U7DA 5K05A 1R36A 2P5VA 3J7AO 4GOND 1XN7A 4RS8A 4X1OA 3HOSA 1KPIA 5DEQA 1BC7C 3B3GA 4IWNA 4RB2C 5DCMA 4BP3A 4OA8A 1O3SA 1JQDA 2BEOA 1TNSA 4RB0A 2P7HA 1REPC 4MNUA 3LAJA 2PT6A 3BGVA 1KGSA 2UZKA 5BP7A 2YXLA 3CCFA 4C05A 3DMGA 3DEUA 1J75A 1O7FA 2ISZA 5HIMA 3ME5A 1B42A 2FNPA 2QUFA 1UFMA 1QYRA 2O05A 2XROA 1XCVA 4CWAA 2NXCA 4EJUA 4KVZA 5GINE 3BJ6A 2HS5A 1YIOA 3LL7A 5L3GA 2ZTHA 3REOA 3CUQC 5GM1A 4C06A 5T6BA 3FYCA 4UVCA 2ACJA 2XAGA 1CGPA 3PX2A 4NB5A 1J5YA 4WXHA 4BQAA 2CKDA 2G72A 3NWEA 4E32A 2PG4A 3LQRA 4M71A 3MZHA 3RKYA 1PDNC 4GUAA 1ZGJA 2RC4A 3O4FA 2HQRA 4YUWA 2GB4A 1JG3A 1AQIA 2EA4A 2VBXA 2IP2A 2UXXA 2Q8KA 1OKRA 2STTA 5EKXA 3NJRA 2RNJA 2DK5A 4MTEA 3JSOA 2QQ9A 2H6BA 3CUQA 5D5WB 1P2FA 2FMYA 1JGSA 2HYFA 5AONA 4L5JA 3R0AA 2HFHA 2KKOA 3QOPA 3G3ZA 5HIIA 3UWPA 4HOBA 2ZMEB 5LQNA 1J9IA 3EMDA 5FD6A 4K2EA 3EVFA 2AS0A 1TLHB 2MA3A 5DUKA 2R7DA 2P8JA 5FHQA 1B9MA 2VDVE 5H02A 2D2WA 1RJDA 2IH2A 4O6JA 2ZXJA 2W24A 4PGGA 3GRVA 5FB2A 2XYQA 1JQ3A 4PIMA 3KQSA 1X3UA 5K0BA 2IH5A 4M38A 4BAYA 4MWZA 4YV0A 4FS8A 3KEQA 1TW2A 4A5MA 4KMFA 3O6BB 2Y0MA 3FUTA 1V39A 1SD4A 4PONA 5DXJA 4IRGA 3N97A 5CVRA 4OOIA 3KP5A 1Z1DA 3F6OA 5KVAA 1OYYA 3ULQB 2VBYA 1JHFA 5BW4A 3TR6A 3CVOA 3FMSA 3HCAA 1M0EA 4AIJA 5L3BA 3U1DA 1BHJA 3L09A 2VBWA 3JSPA 2VE8A 3BY6A 1ZG1A 4A0ZA 4HDUA 1NW5A 8MHTA 4GGGA 3NW9A 1R1VA 3LKZA 1LEAA 1AOYA 2FU4A 5CVDA 3MAGA 2Y1WA 4M7RA 5CCBA 1KU2A 3C6KA 2A61A 3BKXA 3V97A 5DSTA 2PWPA 2IA1A 4N9IA 3TPZA 2X4HA 2XUBA 3ZMZA 1T2KA 3E5QA 3K9TA 2GIVA 3FXQA 3NTVA 4Y30A 2X0LA 4RAZA 3FTFA 2RV8A 3LHDA 1KP9A 1FWZA 4ZH4F 4GBED 2BM9A 2NXEA 3DULA 1HKQA 2ZO4A 1XVAA 3UJDA 4H0NA 1ZREA 3CO7C 5DTRA 5GIPE 3F22A 2LDUA 3QU6A 5EQJB 2P5KA 4H0EA 2H6CA 5LQUA 4UV8A 4GYIA 2IA2A 4UOEA 3K69A 2HV9A 1WKMA 2DQRA 3FTCA 3ELKA 1EQAA 3B3FA 5G02A 2XASA 5L3EA 3U9GA 4D0PA 3M70A 1IXRC 4PZJA 1N7IA 2FMLA 3GIWA 5CLSA 3BXOA 1JG1A 3I59B 3SM3A 4AD9A 3GLXA 4HTFB 4YUXA 2VT2A 2ZSUA 3MZYA 3KQYA 3T1BA 2H1RA 5CVVA 1JXSA 2O0LA 3HA3A 5CVJA 1KYWA 5CM2Z 4A0YA 5IT9Z 4HQEA 1G3YA 3F8NA 5CVIA 5E2AA 1HW1A 1R58A 3M6WA 4AZSA 2HYGD 2B78A 3M6UA 2LD4A 3C0KA 1U6GA 3VFZA 2UWMA 1Y0UA 1B9NA 5E8RA 3IKVA 5KS2A 3SR4A 2PMUA 1SUSA 2VDUE 4MEYF 4E2ZA 3D5LA 2OZ6A 4B09A 4OBXA 3UJ6A 2O6GE 3CC8A 1EJ6A 1KPHA 3HRSA 1VE3A 5LR6A 3O31A 4L9NA 4L9TA 1T0FA 5IKMA 3JAMZ 2ONYA 5CCXA 4EJVA 4KUMA 4IV0A 1S7OA 2AOTA 4YMGA 3PFHA 4L9JA 4WXDA 2VZ9A 1FYMA 3HVHA 3DFGA 2G9WA 1J59A 2GH1A 2OZVA 2ZCWA 4YUVA 4HZFA 2IPXA 3GO4A 1EAMA 1WI9A 4Z2YA 4EQQA 4CYDA 2MBFA 2K7LA 1LQ1A 2AOUB 5IT9K 5E1ZB 4LLNA 5LBQA 2VODA 4Y17A 3ZMVA 2ZLBA 3QPHA 1CF7B 4QDJA 4AUKA 1BN5A 5HLHA 4BNCA 1D8JA 5D5XB 2XBMA 1FP1D 2XAFA 4C08A 2V74B 1SFXA 1H1DA 2EA2A 2GLUA 3BZ6A 2PV0A 4RTSA 1RJEA 1QPMA 2Y75A 5DDGA 3MQ2A 4PYQA 2ADUA 2F5CA 1ZH5A 4ESBA 2XKOA 2DK8A 2AOVA 1XDUA 1T6SA 2BYVE 1TNTA 2RKHA 3VEPA 2LF8A 2A69F 3I54A 2XYVA 1TBXA 3HRMA 1SD7A 2NNYA 2Z99A 2AN3A 3WSTA 1IZ1A 2DULA 1BC5A 2CL5A 1BI3A 2W85A 2PXAA 3K1MA 2OQRA 5F1RA 4YUYA 2RGVA 3M8FA 4HV5A 1F9NA 3FRHA 4RVDA 1RI2A 1ZQ9A 2YQZA 3HHHA 3GX4X 3MQ0A 1BKYA 1ZN2A 5D5UB 2PLYA 1W5SA 1H9TA 2KRFA 5LRRA 2ZWVA 3LCUA 4EGZA 2OD5A 2OB2A 4LG0B 4U0YA 1R8XA 2CMHA 5FA5A 3EVZA 2W84A 3QU3A 3GDHA 3QRFF 3TM4A 2L4MA 2XVCA 3GW2A 2M8EA 1XMKA 3B02A 2J5OA 3K1NA 1RJGA 2PQ8A 3QPTA 5D8LB 1EIZA 1G4DA 4PCQA 5KQSA 2NRAC 1O57A 3C18A 5KVRA 1RUNA 5M5BA 2FRHA 1Z9CA 3HCEA 3G73A 3G89A 5GM2A 4AZWA 1MJBA 2R3SA 4QTUB 2DFIA 5HS8A 1FNNA 5BOXA 2AVDA 3P7NA 3KLOA 2KIFA 1K78A 1C0WA 1SQGA 4UVAA 1G55A 1R22A 2C7OA 3TOBA 5FWDA 2DTRA 2RDPA 1Z05A 1YFJA 2ZMEA 5TRDA 3GVAA 3UBTA 3S68A 1P92A 2PVCA 3P2KA 3OZRA 1V4RA 3BT7A 4XUCA 1OPCA 3ML6A 5EIWA 3TDZC 2ERCA 5DXAA 5ERGB 1BC8C 2D45A 1BBYA 5E1WA 4I98B 3KPVA 1BI1A 1WZNA 3KP6A 1DUXC 1G6NA 3V8VA 1LNWA 3GZ6A 2MC3A 2DPDA 4QTTB 1YZ3A 1YQAA 4FGZA 5F2NA 3KPJA 4XUDA 1I6XA 1JSXA 5HOQA 3C3YA 4NQWA 2MH9A 4ENJA 1FY7A 3JWGA 4OMYA 3ECHA 5FTWA 5BW5A 1QO0D 2P41A 2COMA 2M30A 3O3KA 3G7UA 4HQMA 2PKWA 3KPYA 3GRUA 4BHPA 3KR2A 2FBHA 1X1CA 1INLA 4HLXA 3ERCA 1U2ZA 2HTEA 3QV2A 3WG9A 1F4KA 1DUSA 2JH9A 2MH2A 3FPHA 3ZQ7A 4UXNA 1SUIA 1P4AA 3GU3A 2Q0OA 4R1HA 3WGIA 3P71T 3UJ9A 1ZLKA 4PYIA 3QP6A 1ONVA 4WF2A 5E8JA 3TMAA 3KQTA 2AN5A 2DPMA 3P8ZA 1K6OA 2PSSA 2GPYA 4HYEA 5JHUA 1BOAA 5K09A 4P58A 3RJPA 2OZUA 2WC2A 4YMHA 2EJRA 2OU2A 5HIKA 3HRUA 3NRVA 1G6Q1 2EJTA 3ELWA 2Z6AA 2PWYA 2YX7A 1ZKDA 2HZTA 3T5XA 2PEXA 3SFZA 5D4RA 3EYIA 3KQOA 1O7LA 3VSEA 5L3CA 2H27A 1XGNA 2QRVB 3GXOA 5J8FA 2I62A 4FZVA 4GOMD 2ESNA 3Q87B 4A6DA 4BP1A 4KIGA 3WTVC 1RJFA 1MJFA 2VE9A 2P7VB 4KICA 4XBFA 4DNCA 2ZVJA 3EDPA 4MQVA 3HEMA 4FT4A 2AN4A 2VONA 4CTJA 2G1PA 3NQOA 2OY0A 4L0ZB 3TKYA 2PXCA 2HQNA 1WS6A 5KYGA 3DXXA 5DRTA 2V1DA 4OX9Y 1FX7A 1FLIA 3RDIA 2AR0A 3HP7A 3J81Z 4AX8A 3I5UA 3DP7A 3BP8A 4FX0A 4AWXB 2P8TA 4P5OA 2GXBA 3ELUA 4KW7A 5LSAA 4JBAA 3OCJA 3KFWX 2KJBA 1YB2A 1UWVA 2JHPA 3SSNA 3KHKA 3Q9SA 3EGEA 1RZ4A 1PRYA 5HDNA 4L5IA 3M33A 1WRJA 4RB3C 1E17A 3IV6A 1YW8A 3ANXA 2HNKA 3SXJA 2XRNA 3SHFA 1XDSA 3BWCA 1G8AA 1YO5C 3L00A 1I27A 1F38A 3KQPA 4P7GA 3O7WA 2Z6UA 2CMGA 3RODA 4R8SA 2PFBA 2QWWA 3V4GA 4FT8A 4A2UA 5DM2A 3IC7A 3VOEA 3AWIA 4PYLA 4EJOA 5EGSA 5LQKA 2EWNA 1UIRA 2H11A 4MTLA 2HTJA 4RX1A 1NW3A 3AJDA 1XCBA 5JFRA 3LA7A 1STZA 3FUUA 3MERA 3NDIA 1IF1A 3UZUA 1EG2A 1W7PB 5BPIA 3J81K 1WSUA 2O61A 3M6VA 1Z6RA 5HILA 4CXMA 4MTDA 2B3TA 2XAQA 3RPUA 1YW9A 3KR9A 5LQJA 3KP4A 4YFNF 1U5TB 3GJYA 4Q5SF 1UHWA 2RQPA 5E1DA 1B59A 2ZJ2A 2AZTA 4QQNA 3D2LA 5ILUA 3DLCA 3RPQA 2AOUA 2P40A 2YX1A 3LDGA 4HF2A 3R60A 5HIJA 3KE2A 1FYLA 5K0EA 4JQFA 3NMUF 3Q9VA 4A6EA 3OU6A 1R23A 3IHUA 2HKXA 3OU7A 2C7QA 1ORIA 3DXYA 4C04A 4N9HA 3KEOA 4FT2A 1K7AA 5K8VA 3F72A 1SVUA 5H6RA 5GP1A 4RVHA 2ADMA 1J7KA 2UYOA 2W57A 3WTXC 2YPRA 2F5EA 3PQJA 3SVZA 3H3ZA 2CWEA 1RI5A 3ELDA 3RIRA 2HGCA 2EB7A 4R6WA 5AIPA 4CO8A 3EPPA 4EV0A 1G3SA 1X1AA 1M6YA 4KRGA 3UFBA 3P9NA 1WQ2A 2A14A 5C0OE 3FZGA 2P35A 1FBUA 4ESJA 4ER6A 5DV5A 1IN5A 4HLYA 5FLXZ 4KN7X 4UNOA 4HC4A 4O3MA 1SG9A 3R0JA 4M9XA 2YXDA 2WK1A 1AWCA 1JE8A 2OPBA 4Y13A 1RI1A 4IVNA 4LLLA 2UYCA 3CGGA 3IEIA 1DP7P 3OE5A 4KT5C 4HGZA 1P1BA 4HBLA 1YW7A 4M36A 2KIMA 2O57A 4F86A 2FCAA 3F3XA 2A5YB 5DYMA 1QAMA 4G7OF 1J0RA 3DUWA 4ENNA 2FK7A 2K27A 4M37A 4EKIA 2XKPA 2L4AA 5D6FA 3LCVB 4LWPA 4C4AA 4PINA 3FMRA 1GXQA 4ZYEA 3F6VA 5K0GA 2A6EF 4WX9A 5E1BA 1G3TA 3MTIA 1SAXA 3M4XA 4OIQF 3JW4A 4AIKA 5LQCA 4GOLD 4RTRA 3F21A 1IW7F 5FLXK 2JTVA 1KXZA 4JK1X 1L3BA 4RTJA 2B25A 1KQ9A 4PYJA 3TGNA 1O9HA 4CXFA 5EMMA 4AIHA 2VOOA 2V79A 3GRZA 1WWXA 1XGSA 3GO5A 3AXTA 4LJZF 3E5UA 4EGYA 1XSVA 4QPPA 1HKSA 3LAPA 3FHZA 3LSTA 4ENKA 1S6LA 4MQ9F 2W25A 5K5OA 1L9KA 4FX4A 5T64A 2VT3A 3SXYA 5LQRA 4HA8A 4AVPA 5D4SA 3S2WA 3L7WA 1KHHA 3F8CA 3WTZA 3WU1B 1R1TA 5CD1A 1LB2A 2VBZA 4CKCA 3C1DA 2QYOA 3BDDA 1RI7A 3CJTA 1OYIA 1NBHA 4DF3A 3J80Z 3V7RA 2UZ4A 4BLUA
chains in the Genus database with same CATH superfamily
2QI9C 5CEEA 3CCUI 3WAGA 4QJBA 3VPXA 2GBLC 1K6IA 5ARBA 1VE7A 3ZCPA 5F76A 1FC3A 3LUPA 5EVCA 4Q7JB 3MKLA 4C0KA 5GONB 3HBLA 2CV2A 3FWKA 2ZIGA 2IKQA 4L9WA 1LS6A 3Q7IA 1PKXA 5JNVA 1DDNA 2INGX 2WBLC 1JR2A 1TECE 3OPNA 4CG3A 2Y0PA 1GVNB 4OLFA 4WY2A 2ZZKA 2CXUA 1X1DA 1HT3A 3A28A 3PQFA 1B26A 2Q4BA 3OEWA 4MYUA 2DBQA 1BGXT 2XUZA 3E1GA 3VUFA 5K0JA 1PJTA 3SN6A 2VPLA 1ZA2A 2QKLB 2PM8A 3OPXA 1CY2A 5EWJB 5KU7A 2EFGA 2HHHB 1I1SA 2WHYA 1JLKA 3AF0A 4G5QA 1E63A 5BR7A 3UV7A 1FLDA 1JHVA 1ZJJA 1ECLA 2XOKA 1P4SA 4EMUA 2WSBA 4EB6A 4BHTA 1FY2A 3AO0B 1PNOA 3R7WA 1L4KA 5DWDA 5EJ7A 1U0NA 1E18A 1S2GA 3OIGA 1IZ7A 2IWRA 2JH8A 3WRWA 3BXXA 4IF4A 1RIIA 2HQAA 3OIOA 1YNOA 2GTIA 2QG4A 3UHPA 3B12A 4GG1A 4L5CA 2XITA 3RASA 4QT4A 1T8PA 2XNCA 4HWOA 1GQQA 3VODA 3TECE 4Q00A 1BOOA 2DLCX 8ATCA 3CUOA 4CCMA 3GPIA 1SBYA 1LRKA 2MT9A 4I1PA 3IWFA 4ROTA 3CCJI 4OSPA 3L4EA 4R31A 1JWAB 3TD2A 3ZGZA 4B3DA 5JOQA 1A1SA 3TTUA 5C4JJ 2VN2A 4ND6A 3ORFA 1SQ5A 3TJRA 4YAJA 2M1XA 3PNQA 1NW4A 3ET5A 4GCVA 2V9VA 5DSXA 3CINA 1VL2A 1QJ4A 5CBPA 3EVTA 4YIIA 1YUMA 2ST1A 3HYIA 3PXAA 4Z8XA 2VQSA 2ZFUA 4UPVA 1YHQI 2UVQA 2PUGA 2EGGA 3I0MA 3ZWBA 1YFLA 1YRYE 3VHXA 4A6XA 1XYYA 3E4CA 2NU9A 4LRUA 1NUPA 1GPDG 4EI8A 4LGMA 1H9GA 3J7YJ 3IPCA 3K0FA 3QWIA 5GJBA 5HQTA 1B6RA 2VVTA 4N5IX 1WG8A 1ETYA 2R7WA 3NFRA 3QX8A 5JS7A 1NU8A 3AW8A 1QH8A 1R0BA 3NT4A 3I4NJ 2ALJA 2G7MC 1OWNA 3I71A 3DPIA 3PV0A 2CQKA 1JKJA 3C4VA 2PKYX 3N5CA 4NLLA 2X1LA 3MWKA 1XO1A 3JYNA 1Z0ZA 1Y6FA 5IF9A 4J75A 1O6CA 1YI1A 3T8YA 3H0DA 3Q8LA 2Z2SB 3KS9A 2FB9A 1AQ6A 4D99A 2MC4A 2BMEA 4CZZA 1B7GO 5EF6A 1WU8A 1V5EA 3W2GA 3NBFA 4OB7A 1UJ8A 1TCVA 4G0UA 1M5TA 3TMOA 3D7MA 2HMWA 1JJIA 2OOSA 4C7JA 3SEQA 2HO4A 2WKPA 5B53A 1J0CA 1GXSB 2P6SA 2F4NA 4TTTS 2QUKA 5CA0B 3Q3GE 4LX0A 1NVEA 4MUGA 2BSQA 1QHGA 2V7GA 3M4NA 2VL8A 4U9HS 3ROPA 5EPOA 1ODFA 3PSAA 2GZWA 2FSUA 2WJ3A 2P78A 3BSSA 2I6FA 2WJHA 4FYJA 3W06A 1FLAA 3S29A 1T0HB 1GV0A 5SZJA 2Q6LA 1M74A 3N2ZB 1I8TA 4G1CA 3KLPX 5JQWA 5FEUA 4OIRF 4KMUX 2AJBA 1GUZA 4R8RA 1N9KA 2CQQA 3U6BA 1DAMA 3IVAA 5KSYA 3IMCA 1T2CA 2FFJA 3WGOA 2EW1A 5DIZA 4CSWA 1JIVA 2SHKA 2NSLA 2YHIB 3ZR8X 5JWHA 4DQ0A 3P2MA 1KJZA 1UBRS 3P9IA 2YICA 3NP9A 4IHSA 4YCDA 1TZMA 4FEGA 1R16A 4L4YA 1M2EA 3RJTA 1SXJA 4ZOLA 5JSQA 4BEBA 5J1SB 3VVLA 1U9IA 3KQHA 1ZHOA 3ZW8A 1QLHA 2REBA 1F4VA 4F1KA 3OOEA 3MB8A 2CH0A 3S1AA 2ID7A 1ULHA 2QUHA 3FYUC 4KISA 3C8UA 2GA2A 5L3FA 2KDOA 3FKQA 4XA8A 2GAUA 2I2FA 4HO1X 1BJRE 4GZMA 5AI5A 3GLIB 3JQAA 4GYGA 3BXHA 3RKXA 1L5HB 2V54A 3R9IA 1T5TA 2R5YA 2CUNA 4LDQA 1HMYA 5BS6A 2G9RA 5BVHB 2FLWA 2JJQA 1SKMA 1XDWA 1E1RA 1OMOA 3E97A 3VKVA 5F9MA 5CIQA 1XKXA 2OCBA 3CNHA 4DYCA 3TZQA 4JUAA 1KI3A 4R7GA 2FRDC 3VOTA 4XCXA 1ML4A 3CTMA 4KDPA 2VFAA 4YRQA 4C0BA 2RC6A 4C0LA 2DVMA 4LYYA 2F5FA 2K7FA 1P31A 3ROQA 1G5TA 2MLKA 1PFKA 3T4UA 2H29A 3AHFA 3PL5A 1WBDA 3DFFA 4QAQA 5DISB 3GLFE 5C8XA 3NGMA 1JHRA 3VR6D 1WETA 2PSJA 2BC9A 3NJ8A 5F12A 4X1KA 4KYUA 2E36A 4KFRA 4CDMA 1JEDA 4GKJB 1FX1A 3IUMA 2IGMA 1CY1A 2RARA 5ALSA 4HNUA 4O02B 2QI9F 2WWGA 2D5LA 3PT9A 1W1WA 4TV8F 1RJ9A 2OCEA 5I4KA 3WDMA 2CJYA 5FPHA 2YOFA 1WXDA 3HM2A 5C46F 2QMZA 4MB2A 4GLOA 4Z1MA 3VPSA 4IJKA 2AXNA 1PFYA 3AGPA 3TLAA 2SBTA 4M6YA 2J32A 4U7JA 1TVKB 4DZZA 4WBSA 2B1GA 5JCXA 4RTOA 1N6NA 2ACVA 2G71A 5T3UA 3FRJA 2PRZA 4XLPF 2Q9AA 4IILA 1UJBA 1AHDP 3GUDA 3A1DA 1QP4A 4PR0A 4POOA 5I7OA 1EJ2A 2BHTA 5CB8A 4YV1A 4I99C 4UMEA 1QTIA 2CMDA 4YBRA 2JIRA 3L7BA 2IXBA 2XPWA 4GBMA 2BSAA 3A7EA 3CIOA 5J2TF 1NMSA 1RESA 3K05A 5HGJA 1E2UA 4CW7A 2YV4A 2VYCA 4NBRA 1R1UA 2G70A 1K98A 3CKLA 3LNCA 4UNQA 4LCEA 2F43B 4OJNA 2M1BA 2CNDA 1NT2A 1ZIXA 4INOA 1WDTA 2PVPA 2F4VB 1XRRA 3HFSA 4E5DA 1RWKA 2O3FA 1XMJA 4LCBA 4CRWB 2Y92A 4BJTA 5DP1A 2YWRA 2CXHA 4K6KA 1WMDA 4UBOA 2DYRH 2O8BA 2H65A 4RO0A 4I6EA 4MK4A 3VV2A 3D6UA 1K4KA 4RBNA 4QYXA 1GFSA 4EYSA 5CPFA 1R0YA 2H00A 1JH9A 3IIKA 4I02A 1E3PA 3OC0A 4DQ2A 4BVBA 3BA1A 4IX9A 1MV5A 5DHFA 2CYCA 4XFKA 5BSUA 4BLSA 4KYWA 4P83A 3L93A 4UHDA 5HM8A 4GMGA 2OHOA 1TDJA 1Y4ZA 1Y8RB 4C3ZA 3NLLA 4XLHA 3KU1A 3LF2A 3ZWMA 2ZBVA 5CDFE 1ZXBA 2YOHA 2YZ7A 1W34A 3EULA 1PUJA 3E23A 4HDVA 1KWGA 3O2SB 1JSZA 3FUXA 3R0VA 1C1DA 3QVWA 1EFPA 3AWDA 4I0AA 1HE1C 4IFEA 4QECA 4LJ8A 3W8FA 1IY9A 2H4XA 4J6FA 3B89A 4HRIA 5EP3A 1V55H 1YDMA 1ODCA 2AJCA 4A3MJ 3E6CC 2KW5A 5ALFA 3ZCUA 1CY7A 1ZUD1 3FZEA 3E8XA 4XSXF 4BACA 3CU5A 3FBTA 2XHZA 3G6WA 1WCYA 4YDRA 5EMLA 2X6TA 4P33A 2P4HX 3HZJA 4KCGA 4FNGA 2C99A 1CUAA 4B0PA 2XKAA 2AXTC 3KK0A 1D09A 3KAKA 4P7FA 4LPKA 1A9RA 1WHTA 3T7AA 5DBFA 1QHHB 4RY9A 1XVTA 2VQGA 2W4SA 2W6CX 1DCKA 5D00A 5KCZA 1CJVC 2FOKA 1R64A 1K6EA 4AJ9A 2HRDA 2FPGA 3JTMA 4MMYB 4EKEA 2EARA 1RHRA 1IXZA 4LXHA 4L4SA 3TGWA 2KIUA 1TL7C 1FSHA 2QRLA 2QQAA 4HAXA 1X13A 1WNTA 1XFAA 4V1CI 2ABWA 3I3OA 5EQDA 4LHSA 4O1HA 3KE9A 2V0CA 4C4YA 3BFVA 1UK8A 3PNKA 4FEYA 3S2GA 1QTQA 2PBFA 4PUSA 1YTYA 1X7ZB 3TOVA 4IO9F 1IV6A 1S3GA 3H1AA 3PX3A 4OGLA 3NT2A 1C41A 3ZWPA 2O3QA 1M34B 2YDYA 5FFFA 1PT5A 4A8PA 1M2VA 2VYVD 1C7IA 4X1OA 4C7OA 4JC8A 3RS7A 4RB2C 1LEHA 3BZKA 3EZYA 1H2XA 2ZTLA 3K6JA 5L7TA 2O5CA 1NVTA 1KGSA 4HYTA 4YAKA 1Q77A 5CT6A 4JROA 2C0QA 1QRUA 1XCVA 5IOZA 1TMKA 3OPQA 3Q0EA 2WE7A 3BJ6A 2B82A 3R9XA 1H69A 2PE5A 5GM1A 5AKLA 2XVYA 2WYIA 4M1OA 4E32A 5D2CA 3WYCA 1GGNA 2E4ZA 3A9CA 5FRDA 1A35A 4MWTA 1YMQA 2QOEA 5KDLA 2VQEB 2GOYA 3D1JA 2VJMB 3CUQA 1XYGA 4MSUA 2HYFA 4IH1A 3L02A 3O8BA 4FZRA 2WU1A 3UWPA 4HOBA 4L07A 2CUFA 1V8OA 3PLNA 1Z5GA 3D6JA 2XB0X 2DBYA 5H02A 3V48A 2RG1A 2ZXJA 2GHIA 4IOAF 4A6PA 2QN3A 5TY0A 1FTNA 3HP1A 4PONA 2XSDC 3U49A 4ZYAA 5KVAA 4D9FA 4G0WA 3G23A 4EVSA 4DHWA 4GMXA 5C5CA 1ZG1A 4K9PA 4A0ZA 2PSEA 4RFVA 1KFEB 4ZICA 3H9CA 2GVZC 3IUSA 3ZY6A 1DHRA 1APBA 1JEAA 4ARCA 2X3FA 5E4TA 4A3SA 3CRW1 2H52A 1H66A 2WVAA 3NBAA 4QO8A 1FUEA 2WRZA 1OILA 3BQZA 3ZYZA 5DGIA 2GOXB 3FXQA 2RV8A 4UFPA 4K9OA 4DRXA 4ZH4F 1EXDA 4TUYA 3F6SA 4J6EA 3C4JA 3CO7C 4GYYA 1ADFA 3G02A 2YFHA 4IH4A 3GX1A 2VLAA 3FB4A 1RXSA 4IG9A 1TB4A 1Z5ZA 3MTJA 4ILKA 4D4IA 4LS3A 4EHIA 4QBHA 3I59B 3SM3A 4TYWA 5C34B 3TW0A 2AO9A 2ORYA 1EK6A 4BO0A 4FBMA 2LY2A 2VDMB 2ONJA 3GEBA 1P0PA 5G0UA 1AKVA 5C2JB 2NVUB 5E38A 2H92A 2GA8A 1ZVVA 1YS2X 2E34A 4UU8A 1R6BX 1W5AA 2VHQA 1YR9A 1MFPA 5A4AA 1QRDA 2DMUA 3U44B 2HI0A 4EJ2A 3WK5A 3FNRA 2OV2A 4HXGA 1PT6A 3V8PA 3OM1A 4X8HA 1S7OA 1JQ5A 1PV1A 3INNA 4X6LA 2PR7A 4C9YA 2CSXA 3SKYA 3GNSA 5IK2D 4UDOA 1V48A 2W2LD 2GBIA 3DVRX 3ZMVA 1UL1X 4Q01A 3C5VA 2JFFA 1THTA 1NI3A 2IEZA 4XGRA 4YP7A 2GLUA 1N4DA 1UXKA 2RHOA 1G5RA 1JHQA 3JVUA 2Y75A 2VNIA 1FIUA 1FIPA 1W0JA 4XB6B 2ZQZA 3M8JA 5ALZA 2BZSA 1J56A 3QX9A 2YZ2A 3TXXA 3ZWWA 4JZYA 1GFZA 4HEJA 1KJQA 1JXAA 1NBOA 1PE0A 4BTVA 1YBVA 1C1XA 2PUVA 2QVBA 4LZLA 3VHLB 2YN2A 3GX4X 4U2KA 5DU2A 4AYBN 1DVRA 2ORWA 3NYQA 1GNVA 1A5JA 1NJ1A 5L45A 1YX5A 5KVRA 1NF3A 2XQJA 2IY9A 4N9WA 1ZOOA 3GHHA 3I9LA 1L2TA 3II6X 3PI6A 4ZN6A 1FW6A 1SK8A 5AI6A 3DHYA 3DZBA 3GUVA 3Q2OA 3QA3E 5CDHA 1ZI9A 1ZOPA 5I7HA 1OAOC 2P0AA 5LPNA 4X44A 3QEMB 2VXDA 2H4FA 2G09A 1U3TA 3ML6A 4D74A 3K5WA 2ERCA 4JJFA 3TSWA 5E1WA 3ONQA 3GLKA 2EIHA 4C78A 4YRPA 2AD1A 1RD4A 3SEFA 3DOFA 1B2LA 5DCYA 4N54A 2HDWA 3ZDBA 4Q6BA 5F1KA 4UE3S 5BW5A 2MYPA 1VE5A 4I4TF 3I0NA 5M3FJ 4O8ZA 3ERCA 4LIUA 1GTMA 1OSNA 2BDTA 4ARBA 2AYZA 2CE7A 4L15A 4UXNA 3U6KA 1QTRA 3QP6A 2WAEA 3KJQA 3RSLA 2DPMA 5IF3A 1HR0B 2O2YA 4IIJB 1CR1A 4P58A 2WC2A 5DXFA 1GPMA 3HRUA 3ZH9B 3KE8A 1YL6A 3DU5A 4B80A 2PEXA 3J7TA 3NOOA 5L3CA 4LJ6A 4FISA 1Y3CE 3F6CA 2JGJA 4Z7JA 2HU8A 4LFCB 3IHKA 1OLXA 2JI8A 5HUJA 1O95D 2QSHX 4GXTA 2ZVJA 3ZU5A 2HT1A 1U3CA 1R88A 3VR6A 4NPAA 4G9GA 3BN3A 4KAFA 3H9EO 3NQOA 4LBZA 1BRMA 3WI7A 1DU6A 4MVCA 3SC6A 1FX7A 2CEAA 1KARA 4Q7LA 2HADA 4L4RA 3FD8A 3CF4G 1AKMA 3FTNA 3JY6A 2GXBA 4RADA 2JCVA 4NC6A 4OHCA 1W36C 2FE1A 1T24A 2P2SA 5AOVA 4D5GA 3O8LA 1SC1A 1GILA 1EFRD 5EG0A 1YO5C 2XF8A 2ZKIA 2F6CA 4Q19A 3PEYA 2HMTA 3HFJA 4FE7A 3VOEA 4PHCA 3W6VA 2PMEA 4MI9A 2W98A 4BYMA 3RAJA 4G5OA 1X0VA 3OVMA 1YVRA 5EIEA 1NXPA 3EB9A 3CLUD 1Q92A 5E1DA 5H82A 2FW8A 2JF0A 4C6HA 4ANJA 1FSFA 4D7MA 1QCYA 3DLCA 3RPQA 1TRHA 1GPJA 1E1CA 3Q9VA 1LK7A 5EGOA 3DXYA 2FG6C 3FY4A 4J43A 2CB0A 2V8BA 1JEQB 4FYWA 4AXXA 3IJPA 4BMDA 3JQBC 3EF1A 1LU9A 1JQBA 4H4DA 5ADVA 5CQGA 1OLUA 1G3SA 3W5AA 2I5UA 4E7IA 4ZEMA 4JYCA 5KDDA 3T1YB 4Z86A 4ETMA 1NTOA 5M2QA 2B6NA 3K96A 4YC7A 1JU4A 3OQIB 4EQ6B 2K6GA 4N1AA 2CLOB 2O7OA 2VKQA 3EEBA 5IC5A 3A1SA 5ILQA 2Y1OA 4TS4A 1YW7A 3QITA 4CIBA 3LC2O 3JRGA 3HDYA 1P4GA 1WKBA 3IT2A 4DMFA 1CG6A 4B73A 5AO9A 1T5HX 1E7YA 2HDDA 4DGSA 4U9IS 2D2VA 1R4MB 4C87A 2PO7A 3I8SA 2PG3A 2AFHE 3AIMA 3S2YA 2BBSA 3ZD7A 3IBTA 3ZXSA 3GZNA 4KX5A 2WF8A 4LF7B 2OM2A 4QPPA 1IWPB 3LAPA 4I5EA 4JGIA 3A6DA 4B33A 2HSJA 3QFTA 5REQA 2G0NA 3L7WA 2ZU6A 4JFRA 4H7EA 1JRLA 5ALTA 4KLCA 2SNIE 1QVTA 2IP1A 3C1DA 1PTJA 1MVLA 4PAQA 3W5CA 2YWEA 4EGQA 3Q0WA 3DPLC 3ICPA 2IL1A 3NHWA 4MJ3A 4GX0A 4I1YA 5BSTA 4NHEA 3VPBA 3QBJA 1TAUA 1YF3A 2WWYA 4URFA 3H97A 1F2VA 5KWIA 4M1MA 3Q5DA 4ES6A 3THYA 3E22A 3ESRA 2J8ZA 3NHSA 1DIGA 3GLFB 2B99A 3EUHC 3CBGA 3SZRA 4I7HA 3KLNA 2AS5F 5KNBH 4BY9E 3PWZA 3PUHA 1RPNA 1B1AA 5HDBB 1CUVA 2IUUA 3CJQB 3FI9A 5IJZA 2BEWA 4V0SA 4GPEA 1EZ4A 1W76A 1SKUA 4DLWA 3KKQA 3IUJA 1PNQA 3G4SI 2EZIA 3V8JA 2RGUA 2RHCA 2DMPA 2ID3A 4EJWA 3W8NA 1JLMA 1BWQA 1WXWA 3WJ1A 3NHUA 4W82A 4MW5A 4D4MA 4HRAA 1DX4A 4O5AA 2XSZD 1NXTA 1QBKC 3OSZA 4BOYA 2H59A 3WHCA 3QBTA 2OKGA 2QCOA 2G0EA 3COJA 3FDZB 4JC0A 1RYNA 2HA6A 4KG7A 3BWMA 2BFPA 4HQ0A 4PU0A 1IRGA 2O1SA 1VPVA 1QBGA 2WT4A 3GZ4A 4HQKA 3Q3CA 1G98A 2UYQA 1YJ5A 2O54A 4FN4A 3IOMA 4BCDA 3IP8A 4B4VA 3G9QA 2RBGA 4N0BA 2Z9BA 3RDPA 3ZGNA 2C4TA 3DKPA 2K3PA 3QUTA 3RUCA 1XRSB 3IKLA 4ENSA 2YUIA 5E20A 1E3JA 3HB9A 1J8DA 2CNBA 4HDCA 1YBHA 3PVCA 1PBTA 2CW0F 1FZPB 4WY5A 5JS8A 2Z2JA 3LQFA 1PJ4A 2CJXA 3EA4A 5JYCA 3GBPA 3WYGA 2V9KA 3H2GA 5B2FA 3BH6A 3KC2A 3ZHRA 1QHIA 3KVNA 1A9OA 4CGYA 4UUSB 2XTZA 2NTJA 4U0JA 5EPEA 3HDQA 4XJVA 3AFHA 2XNDD 2MLGA 4MW1A 3C7JA 1WE2A 4RA9B 1JYEA 1PD1A 2PJPA 1MIJA 1QIKA 4HK4A 4ENTA 4Y2JA 4TKLA 4H7KA 1J20A 3MCWA 2ZYSA 2XAJA 4MLOA 3H1FA 1E6UA 4NOKA 4A9AA 1T5OA 4J19A 5J43A 2FEPA 1E1DA 2Y67A 5IKOA 3REQB 3EPJA 4P36A 3AY7A 4RJ2A 2L42A 2QTTA 5DTMA 5EXXA 1X9HA 1JLSA 4UXJA 3FMOB 2DCMA 5AUOB 3SF0A 4QG7A 1H9BA 3EOZA 4BBSJ 1SOVA 4EG7A 1VHTA 3BREA 1NVFA 3RTBA 2YL2A 4YUZA 4KOEC 4FR0A 3EY9A 3UK0A 1SZJG 1GUFA 3CH7A 3QKSA 2DWPA 3WNZA 2QJWA 3IBGA 4Q1FA 2ZTUA 1P0FA 3OOUA 2CVQA 4AUXA 3E9NA 4OFZA 4BY1J 3IP4B 2P5SA 4N0DA 4TVSA 1WRBA 2SKDA 4DV4B 3AP3A 4EMSA 3D1NI 1O4VA 2SICE 1U2QA 3ET4A 2X0NA 3JV7A 1KTVA 1ZS9A 1YE9A 4QM7A 3OOYA 3QPDA 4CMJA 3VU8A 5ALVA 4ZZLA 2V7TA 3V9AA 2W82A 3FGPA 1KRWA 2ZJ7A 4IV8A 1LW6E 3FNQA 3MC1A 3LO5A 4GXNA 1QGUB 1N57A 2YIDA 1B2RA 5KIAA 2TS1A 3EFOA 4MB6A 3F78A 3G2LA 5JYEA 1R4NB 1TQDA 3F23A 4I3FA 4UULA 5DPMA 4MEAA 5E0OA 3E61A 2M0MA 1XNGA 4B4CA 1GR0A 4AD8A 1W4AA 4EHJA 1EFAA 1NIPA 3ZKWA 1AOXA 2ZCJA 5AXCA 2RHRA 2WYOA 1NZFA 2R60A 2IZ7A 3O74A 5IT5A 4QT0A 3DAGA 2J9FB 3NHAA 4HNHA 2O0YA 1II8B 2AT1A 4ZOEA 3TZ6A 5M5YJ 4FETA 2DE0X 4MQ5A 1P62B 3WTUC 1AO3A 3AFIA 5LGNA 1BTOA 3BR3A 5SY4A 1WCV1 1VZ0A 3FIWA 5CVEA 1J9GA 5LYYA 5BPDA 1SANA 5IK2A 3R5KA 1AGXA 3L04A 3HVUA 1RRPA 3SXUA 1UHSA 4QWQA 3GFBA 4NRDA 4US1R 2P69A 4LHXA 1GGMA 2EJWA 4N7JA 2BFNA 2NAZA 1ON1A 4FR5A 4P0PB 4GMFA 4RPKA 3PFGA 2Y76A 3ZI7A 4B7UA 3Q8WA 3CR7A 4TKUB 3ITKA 3AL3A 3U39A 1YS9A 2L82A 4XRFA 2LV8A 2BFFA 2WFZA 4N5NA 3EIXA 4N6GA 4H60A 1E9DA 3HJEA 3A3YA 3H4MA 2Y1GA 2GYWA 5B1AH 3BD9A 2DBZA 2OSBA 3U4MA 1TE2A 4XK4A 3IJ5A 3OJFA 3IVRA 5EP1A 2I2WA 4CDGA 5HM6A 4JLKA 4EMTA 3JRAA 2ZJ1A 1R0KA 3Q98A 6CHYA 2A35A 3ROEA 3M9LA 5EC8A 3TFQA 5DX1A 1VMAA 2H9IA 4Q05A 1RAEA 5KPDA 2QWXA 5D3MA 2VJQA 3ESYA 2PUBA 3VZQA 4HNRA 4A5OA 1VJTA 4IOJA 4NHOA 1HE8B 3FPLA 1FNDA 2BKLA 4CM8A 2FMKA 1SCAA 3R61A 2HPZA 3MBOA 1X94A 3ADPA 4YGYA 2WHEA 8OHMA 1H88C 4QEZA 2ZRDA 3OP1A 1BG6A 2FUKA 1EH6A 1O0BA 4XOPA 2WIKA 4DDVA 1XEFA 5E3HA 1T3SA 1FUKA 1K61A 4XLLA 2WTEA 4ID9A 1Y82A 1TLTA 4XYLA 5FR1A 3O75A 3ILSA 5FD5A 3ANMA 2B30A 3UMSA 4M0EA 5FUVA 3HCFA 2XV4S 5FUXA 2P3LA 4XWOA 1ZN9A 4RW0A 3MHPA 3HLKA 1IGNA 4MV6A 4G8BA 2E1CA 3HR8A 4IZ6A 2XXAA 3UJ8A 5BQFA 1BXRA 4E5KA 2B3DA 4TYQA 3DPTA 3T61A 4BDYA 2Q1XA 3HA7A 2DBBA 3G1UA 2IQ5A 4QATA 1Z0AA 2OFFA 4LIVA 1LF0A 2WF7A 1R10A 1P4WA 3JD2A 4XSVA 4IHJA 5C18A 3C3KA 2YJ6A 2R1TB 4ZYHA 3KR0A 4CKBA 2APJA 1SD5A 3JRFA 3PXDA 1VB5A 1O95A 3WOVA 3IR6A 2FEMA 1N2OA 1QNLA 5FNZA 2X0IA 3KLMX 1H0HA 4XL9A 1BVYF 4Y2TA 3BIFA 4OAPA 3DAOA 4XICA 3WK6A 5HOOA 1YB1A 4JX8A 2QAGB 2HXOA 2OCLA 3JXEA 3GDOA 2PEYA 3RPUD 1PFWA 1UDBA 4XIJA 1MOSA 2ID6A 1E1KA 3FCCA 3HCBA 2WY8Q 3ZMSA 1YJBA 4G2TA 2X2EA 1Y1KE 3O2QB 4OPMA 3TUZC 2O2ZA 3B6ZA 4KIBA 4KDRA 1CUSA 4P7JA 1JN0A 4UCFA 3OTOB 1C2YA 2IIBA 1QE5A 4JJZA 2HK8A 4Y8VA 4W1RA 1UM9A 2GZDA 4DUGA 3GFJA 3T0GA 2JCXA 1K6XA 3LGSA 2ZYTX 2JPDA 4M3BA 3RT9A 3BG3A 3GJ7A 1XZPA 2IU0A 5CB4F 1G3IA 4ZQHA 4MUXA 4FYXA 2DWUA 1E98A 3G5AA 3NATA 1SXJE 4AJKA 4QTRA 1MABA 2QYHA 3HV2A 3G2KA 2BY0A 5H16A 4M9ZA 3DFMA 3OYAA 3AIKA 4WLUA 5ENVA 4EY5A 2C6YA 1JTFA 4ZI7B 2AL7A 1ZITA 4MAAA 2AF4C 2D4AA 3GW8A 3OOJA 6ABPA 3IXQA 5D87A 4IZZA 1DOHA 2BZGA 2R8OA 3D5RC 2GD1O 3ZDAA 3CVJA 5EUCA 1ZZGA 1E1QD 4L95C 4EUEA 1RZ3A 1I6HJ 1I5ZA 4URZR 2EKDA 2Z04A 3WXMA 1D2NA 2J5QA 1GVDA 3FM9A 3KV3O 2OV1A 3DXFA 1Z17A 1U0LA 5FOTA 4RCVA 4JAVC 2B92A 2X1DA 3NC1C 2G8NA 3ZN0A 4FSDA 4PZCA 1COZA 2VQLA 3HBNA 2EHJA 2JPCA 1Y3BE 2GBPA 2C5GA 1NJ5A 4EM6A 2XB6A 1NQXA 3A03A 1XZ8A 4MUAA 1JAHA 4CODB 1WULS 2CHGA 1NG9A 3PUWA 3VMFA 3GJTA 3RU7A 4ZTZB 2EGUA 1N1GA 3U56A 4MQFA 1VTNC 4F60A 2VH1A 5IJXA 3THWA 1UXHA 4RGRA 3AHIA 4ZQBA 4EG1A 1CP3A 3X1YA 4BY7J 2YSRA 2QP3A 3O91A 3LK7A 3CH5A 1E1YA 2WC1A 3PHHA 4LE0A 1W1WE 4MA0A 2ZAIA 3T06B 2AUMA 4PQEA 2PUFA 2PZFA 3R5JA 3BG5A 1JEOA 4DV5B 4W7SA 2ECPA 5ALRA 3TPFA 1KSJA 1VQOI 5DCUA 3GGJA 3D54D 4RAOA 3EMKA 4ABZA 3OIVA 4G81A 1L1EA 4QVKA 5AW5A 4DDUA 1YQTA 3E9MA 1H93A 2O2JA 3LP8A 5P8WA 5F35A 4EKNB 1Y3AA 2NG1A 2OBPA 4HGOA 1A98A 2C2BA 2FPUA 2GCOB 3T8TA 5E6RA 5LZ5A 1AHPA 4WA8A 2QZ8A 4RPLA 3OWHA 5J4LA 1ULZA 3JTHA 3BBLA 3QRWA 3AYXB 3PJEA 1T8IA 1ZKGA 2LCIA 2VTVA 1LKZA 4HX2A 5FI3A 2WIGA 1CVLA 2C78A 4ESFA 1N5RA 1QGOA 1LJLA 2XSZA 1FP2A 2HRQA 1THMA 5HUQA 2ZJ6A 1GZ3A 3I9MA 3OT1A 1SG6A 2J08A 5CVUA 1CQXA 3CF5F 4MKRA 2G88A 3K2AA 1FP7A 5JJCA 4HDRA 1QZUA 2Q6IA 4KFUA 1ACIA 3BEDA 2GD0A 3D5EA 5DCMA 1VZ3A 3A02A 1O3SA 4B4WA 4EFDA 4RB0A 4RORA 2G77B 1VFPA 3FDFA 5LP6B 3CX7A 3QFFA 2WM2A 2P4SA 1L5FA 3DAYA 5L4NA 3HB4X 1R5NA 4HB3A 4Q1AA 4KMSA 1KOJA 3MINA 2H2GA 2ZXEA 1PDNC 1GSIA 2RC4A 1AJEA 2XPVA 5TPWB 5HS4A 2HQRA 3PNSA 3O2NA 2GB4A 2RHJA 1AQIA 2KRHA 2DFPA 3DCIA 5C35A 1XSEA 4WZBE 2STTA 3JAKB 4Q9KA 5BV1A 3NJRA 2RNJA 3BMNA 1GM5A 1Z8FA 5LIRA 1GU7A 2FMYA 1QK3A 1N8KA 2XNDA 3SNHA 4AL4A 4YAIA 1J2YA 1QONA 2RJNA 5H2FC 2VDVE 2R5WA 4O2BF 5HIAA 2XYQA 3OYIA 4BAYA 4MWZA 2HJ9A 2OPTA 5IW8A 5JVDF 4FM9A 4DC9A 1S72I 4OOIA 3R6DA 4I9GA 4TZ0A 1E3WA 2AFHB 2FX3A 3V7NA 1CUZA 2P81A 3QP9A 3S5UA 1GAQA 4HPJB 3OPYI 1BHJA 2ZT5A 4Q1DA 2VE8A 1PR4A 1QG0A 1WXFA 1FSZA 4LXTA 4GGGA 1VKJA 1FFGA 1XRPA 2FMIA 4Y9UA 2OGZA 1YOBA 3RFFA 3ZV4A 1GGVA 1DAFA 3G0GA 1C7RA 2GN0A 4MO2A 1NWCA 1ENHA 4CTMA 2P2GA 2C2KA 2HA4A 3DULA 1OCZH 1PYDA 1ZREA 5E95A 5IOYA 4RPJA 1UMBB 2IA2A 1ZBQA 3JYHA 3O4HA 1VJDA 2XASA 5L3EA 1QWOA 2QW0X 2O3TA 3M70A 5DNDA 3ZZMA 1A5TA 2QQEA 2GWHA 3LSYA 5CLSA 4LAFA 4AD9A 4ZANA 5EE5B 5CVVA 5KREA 3PE6A 3GJQA 2LLKA 3N70A 4HQEA 2LD4A 3UQZA 4DG9A 1DZIA 5AJUA 2J3EA 2WAXA 2XMPA 3CC8A 3TRHA 4L9NA 4P0QB 4M83A 1UMCA 3PFHA 2HGZA 3HVHA 3GLQA 1J8VA 4Y1FA 3E1SA 1VRWA 3IIIA 4K87A 1I2BA 3D3EA 2JFUA 3PL1A 4DQKA 4MVJH 1RKUA 2IYWA 4Y2QA 5IANA 3C8MA 4XR4A 1X2NA 3T9CA 3K1ZA 4G09A 1T8SA 3R20A 2PV0A 4BU1A 1H2RS 2QRZA 3CURA 2Q8PA 1BX0A 3KWFA 4G0XA 2XUIA 3PC8A 2VWQA 5BSRA 1DBQA 2OQIA 2V5UA 4JB3A 3AG6A 2O20A 1R6XA 3ABSB 4JZKA 4TSKA 1ZJ6A 4AU1A 2DULA 5A1TA 2POQX 1KDTA 1SD2A 1YKGA 3K30A 1YJWI 4RVDA 1BWSA 1V16B 4U3JA 3Q1KA 2QR2A 1BKYA 3AERA 5D5UB 3COVA 4WA7A 3JQ9A 3CCVI 2HT6A 2HK6A 1TVEA 2VSYA 2L4MA 2Y99A 4W1UA 2JAHA 2CU7A 2D1TA 4HDMA 2W6MA 2PWBA 4G1MB 4BFCA 4LI3X 2HIMA 2BPOA 5A71A 1G5QA 2O0MA 1E3LA 1EXNA 4W1QA 4X9XA 2PR2A 2C9MA 4DCSA 5BW8A 4PANA 3AUSA 3PDIB 3H8WA 1Z05A 4UM7A 5TRDA 3S68A 1GNSA 3OZRA 1V4RA 3AETB 3K73O 1ADCA 1KS9A 1ZGBA 1LNWA 1CQWA 5F3RA 3KPJA 4EI9A 3B1YA 4PG8A 1SC7A 3EWAA 1ZBDA 4DA9A 4HQMA 3FWPA 2BAGA 1ULSA 3JZDA 5F51A 1T9DA 3I4MJ 5JAZA 3UV3A 2R65A 5EI5A 3VBCA 3VPGA 4EL5A 3GU3A 3WGIA 3C85A 2CF6A 3BIWA 5CVCA 2IOYA 3EGWA 2VNSA 4IJUA 1FTZA 3RRJA 5DBEX 1XJCA 1PWZA 4WGFA 5MN4A 3EE6A 4NKRA 2OZUA 3R3XA 2RDMA 3S15J 5HIKA 4LNHA 3AG5A 2FZWA 1S3FA 5M29A 1VSQA 3QF7A 2FY8A 4BFXA 3KSAC 1EG7A 3WE7A 4A6DA 4KIGA 3ZCOA 4WQMA 1NVMB 5DCLA 4FBLA 1PGNA 3NBYC 3HO1A 1OJ7A 1W5EA 2WBMA 3ZZNA 1TGVA 2BFEA 1Q17A 2OHGA 3QVSA 1L5RA 2CXOA 2X6QA 1Z0SA 1NR7A 4P98A 3KTAB 3RDIA 2AR0A 3KJNA 4E6PA 3DWIA 2PH1A 1AG9A 2JHPA 5LDDC 1RZ4A 4L5IA 1YCDA 4X90A 4M98A 1OBCA 1DC4A 4L4UA 3VWBA 2H0AA 1Z21A 3BWCA 2Q3HA 5JPDA 3VKWA 2O5VA 5KNCH 2G8LA 4EA6A 3GTJJ 1ZW6A 2YU9J 3QW2A 3WMXA 1M6VB 3R7WB 1GZVA 3AU9A 1RETA 3GLVA 3MERA 1TD9A 5DNYB 2ZDGA 3VOBA 2ZB2A 2WJ4A 2O8EA 3T9BA 2QEQA 2X85A 3RPUA 1WPQA 3T35A 4Q5SF 3B9BA 1QF7A 3IP7A 3OOHA 4IX7A 2P40A 3LDGA 3LYHA 3R60A 3U1BA 1I13A 1TM2A 5K0EA 4YYEA 2J6BA 3KXKA 1Y4UA 3RAEC 1MMFB 5FLVA 5FBRB 2VPRA 1H6AA 1PYVA 1AMNA 3WL7A 5K8VA 3H1CA 1TVCA 1PNRA 4BATA 4LY0A 3H3ZA 5KUTA 3RIRA 5LOVF 4CO8A 5TQ0A 2C0PA 4E7PA 3AR7A 3EQ9A 1RE1A 2C9CA 2GXUA 1VGQA 3TXYA 5L7WA 4M9XA 4J94A 3HDGA 4C7VA 3L8EA 4Y13A 1Q1QA 3AM5A 4BE2A 4X94A 1WL8A 1FYDA 1DP7P 3LT2A 5DTEA 2N8GA 3ZQIA 2Z2IA 4D0LB 2ZYDA 4G7OF 5FKJA 2B4QA 2FK7A 1EAYA 3KTOA 3A04A 1TT5A 5IJAA 4W5OA 1W73A 2HA2A 3JD0A 2BJWA 2B20A 4WDRA 4K9LA 4RTRA 2A6TA 3TGNA 1E1QA 3E9RA 4RK0A 3H16A 4M22A 2ILTA 3UT0A 3KT3A 2A3NA 5FBKA 2DN0A 1V11A 2WV9A 3VHXB 4DLAA 1NVKA 3YASA 2LOOA 2PMKA 1OT5A 2NU9B 1Z2NX 3NDRA 3DEKA 1QDEA 1UKCA 3UGTA 2WTMA 4NCAA 3I3SR 4RL4A 5KWSA 3QWFA 4TTPA 3WJ2A 2ISQA 3K0FB 4CKCA 4FONA 2FUG2 1V8FA 3BDDA 3OT5A 1P5FA 5IT0A 3KJEA 4DF3A 2UZ4A 1W87A 4C4SA 3LSKA 4BHCA 4C0SA 2QVYX 3F1LA 4DMUB 3VO9A 2ETHA 2ZFWA 3MTGA 2MD0A 3QY0A 4JXJA 4PYMA 2BFMA 5LVAA 3WKCA 4BZQA 2LF7A 5CM8B 4TLDA 3JQ8B 4PLTA 3OD5A 3H2BA 1J5PA 2ZU0C 1NWHA 3CF6R 2Y9MB 4GZ5A 1Q20A 1TXGA 4TN5A 1FBTA 2Y3IA 4CUZA 4ZO4A 7AT1A 3AUAA 3P2JA 4YS6A 3DTVD 1A8UA 1XZHA 1G2HA 4A4DA 4A36A 5A7GA 3ZH2A 2DEUA 3BWDD 3MUNA 4EA8A 2H5IA 5CR9A 1TQ8A 1OA1A 4BYYA 2WAQA 1QZXA 3C7DB 5ESWA 3BX1A 4HXFB 2CBXA 4KDEA 4LXYA 1B8OA 3ZQKA 3P9PA 2AK3A 3LLSA 3MT7A 4BRUA 5CLJA 1E5TA 1KDPA 4NONA 5K3SA 3WIVA 2KMUA 4G24A 1IM8A 1YQUA 1Z75A 5GTIC 3TO6A 4KRYA 2OTLI 3L2CA 4OLJA 5JDIA 3IAM1 5JCZA 1MGPA 2LE0A 3BCUA 1IY8A 3KALA 2GOMA 4WDQA 1U7OA 4G4SP 3N39C 1R8SA 1Z7UA 5CT5A 4OHPA 1Q5PA 3T3GA 2PX2A 2YCBA 1VQ6I 4HX9A 3GPCA 1T91A 5DOZA 1ONOA 5F78A 2ZSAA 1GKIA 2FPOA 1KI1A 3PTZA 3GLHA 2DGDA 3CT6A 4JR2A 4ISCA 4DG8A 2PZEA 5FUWA 1FTQA 1T3LA 3ZVLA 1SXJB 5T41A 3MMSA 2I2BA 1DRVA 1U2DA 2P6RA 1YYVA 1T5IA 4IVQA 4PLFA 2OBBA 3S1AB 4KA4A 2QVXX 3L7DA 3BR2A 1YDHA 2AF3C 4UNRA 3T9EA 1L4EA 4ALJA 4KJZA 4U7GA 5DNWA 4F52A 2ZR9A 1WMBA 1UM8A 2D5CA 3CQZJ 2WWIA 2D1FA 3CUWA 2J30A 1XTAA 1RPWA 4KXVA 5FBHA 2QS9A 1U28C 3HXTA 4OK3A 2H8RA 4H59A 1R0CA 2EIJH 2ZJQF 4XFJA 3H9GA 3NWJA 3HVJA 2Q2EA 1PI3A 1BDHA 2RHWA 4MGKR 3I6YA 3S3OA 3GP5A 3NC0C 3L8MA 1FFCA 1HRKA 4MDYA 2V45A 2Q5CA 3ZU3A 2Q41A 1FUUA 4LDJA 1Q0SA 4YMSA 5TV2A 3UHFA 2V7BA 1UBSB 3D3JA 4PIPA 4CQJA 5CNMA 2OENG 3TB4A 1JFTA 3BXPA 2EBUA 1DPFA 3GLTA 1G8MA 4K3VA 3W2WA 3P20A 4R83A 4RY8A 1VNDA 2R4TA 1ZAKA 3AM4A 1OIVA 2JIMA 1ZXLA 3L41A 1ADYA 2WVHA 2PH5A 3I0TA 3UQYS 3QYFA 3OF5A 1PG2A 2J0QA 4X1KB 1VLLA 3CEAA 1RLTA 1G3MA 5ECDA 4X93A 4RNDB 1W5TA 1PJBA 3LM8A 1P1RA 2YMLA 2FWMX 4I55B 2YR2A 1KAOA 2E6UX 1FNCA 2G9VA 4F9EA 1QRTA 4L3WA 4GBGA 3RAFC 1TZLA 3PIRA 3KKMA 2GAOA 1RJ9B 5I8PA 1UQTA 5J3JA 2ONKA 3NYIA 5JUWA 4O4LF 3W6KB 5FCDA 4LTDA 2VQHA 1E3OC 3A25A 1LPOA 1NOJA 2XAAA 3E9ZA 4RSRA 1UODA 4H1UA 3NM5A 2XYPA 3E3AA 3CEJA 2W71A 2BR3A 1FLVA 2NNNA 2ZP1A 2NNWB 4NCIA 3AY0A 4O0MA 2HZDA 1KH2A 5A5FA 3JATB 3H5AA 2GPAA 4WNAA 5D5QA 3ASNH 2E1MC 2FW1A 4MR7A 3AVQA 3O1JC 3MWDA 1RBYA 4M76B 3QBVA 3FOAA 2ZUTA 4OA5A 4U9UA 3TRFA 1BZYA 4FWIB 1X1TA 4OH7A 4I7EA 4OUDA 1SCIA 2VJNA 2VH5R 3PEFA 5C8YB 2GCIA 1CVIA 2AMFA 4O2RA 3V7CA 3ER9A 4UEWA 3GI1A 5CB6A 4ZVQA 4H7FA 5B7GA 2D2XA 3NALA 4G1EB 1M6EX 4RVGA 4JASB 4IDQA 1EFLA 3EW9A 1KO8A 3C48A 1LH0A 3GJ4A 5IDYA 3GR6A 2CFSA 1YB7A 2REQA 1GTL1 3KWLA 2CZCA 1OKKD 4PCAA 3KIOA 2H4JA 2BCGY 3AP2A 1VRCA 2R00A 3RWBA 4DMGA 1Z25A 4PO9A 4BYGA 2O8BB 3E84A 4X7RA 2QXYA 4JBIA 4E7JA 4TWJA 5JSHA 4V0ME 3TSOA 3FCAA 5AK3A 1U9JA 3T5DA 3G7NA 2IUYA 1I1GA 4BKOA 3T6KA 2ODWA 4JVLA 1ZONA 2EATA 3E82A 1SBQA 4DGQA 3BIXA 2WD7A 5ALNA 1QFXA 4H6WA 2ODTX 4WZBB 4LF9B 1GITA 4NEGA 1E5XA 4U0WA 5KTRA 2I66A 4EJFA 2XUGA 5LB4A 1I1OA 1U6IA 5LB2A 2V4JC 1V3FA 4N9QA 1CY0A 1HF0A 3BVPA 1AS0A 1B15A 3R7AA 1U65A 1ST3A 4HGQA 1O0CA 1C9DB 3PEWA 3HVIA 3ZUGA 2VHTA 5CJ9A 4PVCA 4IZIA 3RFTA 1LVKA 2QUJA 1C1DB 2XVXA 4C3UA 4BO3A 2ODQA 5E2BA 3AEXA 1S2NA 2X7HA 1FDOA 1LV7A 1O97D 2DA1A 1TAHA 1J6UA 3GRYA 4IWYA 2IEYA 4KMRA 1E64A 1JQAA 2PA0A 3U60B 1D0SA 4DNXA 5KMGB 4ENMA 3MB5A 3KKOA 5FOUA 2OXTA 5FJJA 2LD5A 1EB9A 5DK6A 5F2KA 3N5KA 3MRVA 4EJSC 4U88A 3F8MA 2IPQX 3L6EA 5FJ8J 5FROA 5SZHB 5E1OA 5TJHA 3L2QA 1T4MA 4P4GA 3U7QB 1NF8A 2XYGA 4GECA 1FE8A 3ZZ0A 5C7IO 5LBUA 1J21A 3UWDA 4W8OA 1NKSA 4LOKA 2ZI5A 3FXJA 1MN6A 1WXQA 1ES9A 1XTQA 4JC4A 5ICMA 3RSNA 3PIIA 2PBRA 1Z0JA 4QDTA 3JARA 3TIGA 2FPPB 2DFDA 3DDHA 3MYRA 1Q50A 2YJ3A 2CG4A 1YB6A 4PCLA 1M2KA 1MC5A 2VWPA 2XODA 1EWVA 2JD0A 2NXJA 1XQVA 2HQ1A 3U7FB 2V96A 1L7RA 2BVLA 3EZ7A 4N3NA 1S8NA 1TJ4A 4LMAA 1PR9A 2CW8A 1FFAA 1SKAA 4Y1RA 3MGGA 2CMFA 2ZJ3A 4IKPA 3ZNOA 2VXOA 5M7EA 1XNHA 4ZIRA 2P7CB 4E6KG 4XSZF 3ZDRA 4D56A 4JHLA 4IP0A 2VN8A 1PKEA 4K0RA 2JGDA 5EE9A 3WA7A 1M2VB 1MZVA 3UOGA 2O0HA 2WV7A 3K2ZA 5AVVA 3CCRI 5B30A 1SUAA 2A68F 4YRDA 4MCAA 4NHJA 1P6QA 4YB8A 4BHBA 4GLJA 5H8WA 3QELB 3OLYA 3G68A 3OOPA 4JI4B 3E5NA 2OFOA 1DGQA 4DZTA 1MMDA 3SQDA 2C9YA 1RWNA 2D5BA 2AX4A 5K7HA 4HN9A 1K4SA 3R24A 3P9CA 3VZSA 5HTKA 4XRRA 4DB2A 5FGMA 2O14A 2FK8A 1VSTA 3X3HA 4XWTA 1JKPC 2FE3A 1MJNA 3U3KA 2OF7A 3KDSE 3G5MA 2JEZA 1QCDA 4TXHA 1IUNA 3BTCA 5KCMA 3ZQGA 2JL1A 3CUQB 4ITUA 1XTPA 2Y9ZA 3CUEF 3THOA 3WAKA 5HHTA 1L4LA 4OI1A 1XCOA 2R6JA 1XQ9A 1E77A 4C89A 3HTXA 3LUBA 1KIMA 1ABFA 3GEZA 1PR2A 4KWIA 1OR7A 4AMZA 1S5LC 3CKYA 4RIEA 1TP4A 2HA5A 2P9CA 3LHIA 1MH3A 1EQUA 2E19A 1Y8ZA 1Y80A 1U2WA 2AR7A 4DJAA 3I2YX 1AF7A 3KB6A 2O52A 1TPZA 421PA 1FRQA 2RE8A 4G97A 3FHCB 2XC7A 4HPWA 1SBHA 4QRDA 2ZBKA 2A3SA 4HDKA 2FMUA 2GZRA 4MXDA 4EECA 4ZDIA 3NCTA 3OWXA 3NUZA 4E33A 3IBSA 2LR8A 1GQ2A 1U2TA 2QHXA 4RSMA 3C3MA 2AZXA 3WLIA 4B5LA 5GWXA 4ZCPA 5CX4A 4ED9A 4FYPA 1RTKA 4LF6B 1QF9A 1Q21A 2ONZA 3QODA 2ZRHA 4URWR 1WUTA 1YQWA 2H0RA 2PNFA 3LGAA 4GZ3A 1OJLA 3L7IA 3K4PA 1JR4A 1WSDA 4KU4A 3IBYA 3L1PA 4RM3A 4KPUA 4LK1F 1XMAA 1B6TA 1RHUA 2MYTA 3I6MA 3PKZA 4BDTA 1XRLA 3VTAA 4XXHA 3ROTA 4YCJA 3Q72A 1QB7A 2WMNB 4CM7A 1WLSA 3DTVA 4UHFA 4F5ZA 2AFIE 4NPHA 1OWOA 3QVJA 3HSEA 2B9VA 5AIQA 3NETA 4RD1A 3EGDB 4DWWA 5JVTA 3R7NA 4ZOQI 5E9QA 3TZLA 1RYHA 2OAEA 5JFOA 3AT1A 2YNMD 3W5SA 1X3LA 4BNXA 1HSTA 3P2YA 3T7IA 4KNVA 4C7XA 3IE1A 1N1DA 4NCNA 1U11A 3ZE7A 4P32A 4GRIA 2DR0A 3E3OA 3ZRGA 3L9WA 2CE2X 4BXXJ 1L4GA 4NCXA 2AIRA 5A3VA 3ZLVA 2OFXA 1XC5A 2H1OA 3U09A 3MKYB 1A5BB 3OEHD 1TK9A 2XI4A 1RS0A 2IZOA 2ZTHA 4L3VA 4Y6QA 4UM9D 1ZSVA 5FUQA 1CRPA 3CLSD 4OYHA 3SBDA 1FOWA 5KNLA 3S14J 3LUAA 1LBTA 4C30A 4ZC3A 1NR5A 5G3ZA 2I7DA 3FKSD 4J0KA 3RNLA 1OKRA 3RLIA 3JSOA 3K1AA 2HLPA 4OTZA 3AESA 4FMCB 2QNIA 5GZ3A 2PH7A 3B9QA 2WJIA 3V00A 5G0TA 1J9EA 2VYQA 1Z4JA 3VDRA 3MXTA 4M9RA 2DJIA 4M38A 2OHJA 1TW2A 2Q1SA 1EX7A 5ARCA 3FUTA 3S1LA 4NEHB 3EUAA 4H3VA 2BMVA 3SJ7A 5EJ2A 1OYYA 1RXYA 3AYZB 2ELJA 4W5NA 5TX7A 4J3FA 3GUYA 4F4UA 1V3TA 3UATA 2GQ0A 3HMKA 1UPUA 3R5HA 1A97A 4MDHA 4JLPA 3HR7A 4JBWA 4OMFG 1W48A 4IKEA 2W2TA 2POCA 1GCGA 4I50A 5CEFA 1B43A 1OZFA 3PVZA 3RS9A 2X4HA 4MQEA 4EX6A 4DM4A 3NC4A 1YB4A 4EHLA 1OLXB 1FWZA 3KO8A 2MYNA 2BM9A 1UMDA 2ZO4A 3D31A 1AGPA 1CNEA 3IE0A 4I1SA 4IQFA 5DTRA 4CF4A 2FSFA 3VVMA 1CUUA 1TTQB 1GL3A 3DJFA 4EF4A 1XZBA 2BKAA 4EGJA 1PL6A 2N9UA 2XZPA 1Z82A 4LVOA 4K88A 1ECFA 5TGZA 3GIWA 3AUTA 2B7EA 2PQ2A 3PO2J 2K3FA 1T9AA 3F49S 4WEOA 3SKXA 3IMEA 4RV4A 4UXHA 1T6XA 1HW1A 4UAUA 4CLHA 1Y0UA 1B9NA 5EG0B 2I8DA 5JCJD 1WHSA 5M5XJ 1T1SA 4QULA 4Z4GA 2PMZN 1TWCJ 5J3LA 1Y4DE 2IX9A 1AGNA 3OZCA 3L0CA 2XTJA 2C2YA 2PV7A 1ZVKA 1CZNA 1P61B 3GO4A 4DGWB 4COOA 3WLFA 1N6IA 2RGRA 1WDLA 3TIIA 3TQOA 5I7FA 1F1BA 3RTCA 4HVTA 2RCYA 4RFSA 3L84A 2D0IA 2EKPA 3ECAA 1XDUA 4X64B 1RWBA 2A05A 1EM6A 3A32A 3NT5A 4HVAA 3V5NA 2NNYA 3PZRA 5LZ9A