3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
4XSZF 3SFZA 5F2OA 1JTFA 5E2AA 1OR7A 2ZBKA 3SSNA 4MQ4A 1BOAA 1BOOA 3KFWX 2ZFUA 5J8FA 4RTQA 4MEXF 4ETSA 3J81K 1UFKA 1JHHA 5LQJA 1JQ3A 2FXAA 4JBAA 3ORHA 3V7RA 5DD8A 3EEYA 3ZMTA 2H94A 2W57A 5TJJA 2ZSUA 5BW4A 1FBUA 5CLSA 2STTA 2GAFA 3LDUA 4G94A 3A27A 3HTSB 4PYLA 3BUSA 4E2WA 4XLPF 1ZARA 4M9ZA 1R1VA 5D5VB 1XCLA 1ZQ9A 4N9HA 4GOLD 3P97A 3FXQA 3NQOA 4I09A 4F86A 2P40A 5U4XA 4Y30A 1S8NA 2XKPA 3SM3A 2G1PA 4FHTA 4LK0F 3PX3A 3RJPA 5EVJA 1S6LA 4GO1A 1RUOA 4FZVA 2ISZA 1ZGAA 3UA3A 3CBGA 3AWIA 1QAQA 2IPQX 4ISCA 4UVAA 4U7BA 4RYLA 2AVNA 4F85A 3AXSA 4QPNA 3JAMZ 3VC1A 2JSCA 3M8FA 2ZFWA 1SFEA 2PXAA 3P2IA 2Q8KA 2V1DA 2DFIA 1OYWA 2Y0MA 5KVAA 3MTIA 2PWYA 4CHUA 1O3QA 3ER9A 2IT0A 3VSEA 1WI9A 5HIIA 4HG2A 1I4WA 1KPHA 2RN7A 2LNBA 2AOUB 3PFIA 5ICEA 5DPMA 1U3EM 4HDVA 2FEZA 1ODDA 2ZZKA 4B09A 2A68F 2ZWAA 3AJDA 3CUQC 3W6KB 1SQFA 5K03A 3LAJA 2B9EA 3E7PA 4MGRA 1RJEA 2WTEA 3EQLF 3I59A 4LLNA 3TQNA 5HIMA 5E9JA 1LJ9A 3W6JB 3GVAA 2XAQA 2MLKA 1WKMA 3H2BA 4ER0A 5JFRA 5LEKA 2GXBA 3GIWA 4BAYA 1X1CA 2P8JA 1K79A 1B42A 1LEAA 3BWCA 3FHZA 4L9VA 2N47A 4PYMA 3KP4A 3B89A 5E8RA 5KYGA 5LQRA 3UWPA 2XGXA 1LNWA 5DV5A 4RTSA 5J6XA 4NB5A 2MC3A 3TKYA 3B73A 2GH1A 2COMA 2GLUA 3K6RA 4ENJA 4UHTA 1LDJA 4WX9A 4I2OA 2IGTA 2NXNA 5L3BA 1FBQA 3UBTA 4IPAA 3G73A 5K5RA 1ZRCA 3KPYA 2ZJ2A 4RVHA 1NV9A 1X1BA 3G7UA 3R0QA 3GEZA 3TDUC 3ABUA 4PDKA 2NS0A 2IDJA 1I1GA 2UXXA 3K9TA 1IZ1A 4M6YA 5P8WA 5ILSA 3FRIA 2UZ4A 2YUIA 3QOPA 5KQSA 3O2PE 2O03A 3FPHA 3I5UA 4LMYA 4AIHA 5K5QA 5FADA 1TNTA 1IN4A 4HV6A 1G8AA 3R6TA 3O7WA 4FT8A 3EYIA 3WTYC 3JTGA 1TW3A 3MAGA 3ID6C 5A2QZ 3IKVA 2WA2A 3VEPA 3FM3A 2ZNYA 2B3TA 4WWCA 2AOUA 4U7TB 1MZBA 3E5QA 4LLGF 2H00A 4LGWA 1O3RA 2LF8A 3F8BA 2K27A 2EV6A 3ZN1A 4P58A 2JPBA 2IBSA 3QU3A 3V7CA 3AAFA 3QOWA 2J5PA 2A07F 1O3SA 4LFUA 3MB5A 2CYYA 3TO6A 3CJTA 4KA4A 1ZG1A 3BJOA 4IXAA 3HHGA 3K1NA 4RV9A 3K1PA 4QVKA 3GDHA 3SSOA 1KXZA 1F3LA 3ELUA 1DPUA 2MBFA 3ZMUA 3C3YA 5EMMA 3M6WA 1YTYA 3KQQA 4HQEA 2XVAA 5LQAA 4E2YA 1U2WA 2RKHA 4L9JA 4HTFA 4ER7A 3SXJA 5E1BA 3REOA 4WK8F 3RIRA 2AN5A 2M8EA 1MHTA 3ECOA 2HS5A 2K4MA 3OZTA 1REPC 5ERGB 4LD5A 2GAUA 4KW7A 2ESRA 4MEYF 4P96A 4C08A 2ZLBA 4V0RA 1R58A 5A2QK 2ZCJA 2M45A 2IBTA 4EK9A 4YMHA 4HBLA 1IY9A 1BKYA 3GO5A 2E7WA 2XIGA 4FX4A 2GQQA 4YV0A 2NRAC 4H0EA 2GA1A 3F23A 4UNOA 4P55A 1PRYA 2P6SA 3H3UA 2PBFA 4YUYA 1ZYRF 5L3DA 3I0TA 1E17A 2YX1A 3CGGA 3DUWA 3WE2A 4KICA 2VS1A 1KQ0A 3V8VA 3GRUA 3TFWA 3EVDA 1YS7A 3UJAA 5JI6A 4CKBA 5BW5A 4CGZA 4RGSA 4EJVA 5HS8A 1GXQA 3VB2A 4E30A 1PP7U 3PX2A 1IRGA 2VZ9A 5DCFA 1BC5A 4PCAA 2XVMA 1WS6A 3LWFA 1YUBA 2A14A 3HCEA 3TM5A 4UV9A 1QAOA 5HVQC 4G8XA 4EKGA 2V7EA 1FNNA 3GWZA 3MTEA 3P9CA 1FBNA 4PCLA 4QVGA 2O0LA 4JQFA 4YIIA 1XGSA 5E9QA 2DAOA 1DDNA 1D3YA 4EM0B 4R8HA 4XBFA 1I6XA 3LBYA 3G8BA 1R00A 3IHUA 3KQVA 4WXDA 5GP1A 3KR0A 1XSVA 2BYVE 2F8LA 3LBFA 5HIJA 2P7IA 1IXRC 1YYVA 3IEIA 3LL7A 4E33A 1KR5A 1O9HA 2IPXA 3JWIA 3QP5A 1IM8A 3HNRA 1HSJA 4EJWA 4Q47A 5C9ZA 1GHCA 1TQMA 2PEXA 3B5IA 2ESNA 5D6EA 3DTNA 4XUDA 3ANXA 4AZSA 3QRFF 1JXSA 4DM3A 4YV2A 2PX4A 3LAPA 3GGDA 3GYHX 4HYEA 3ZMZA 1GXPA 4QTTB 4DMGA 4AZWA 4N0BA 2CGPA 3LQRA 2GWRA 3KQOA 5D1HA 4L0YB 3CJQA 1KQ9A 4LWOA 2RNJA 4RB3C 3DMGA 2CWEA 5K8VA 1PDNC 2XUBA 1IW7F 5CJ9A 4Q48A 2O8XA 3V97A 3T0YA 2EFWA 2P3OA 5T67A 3FWEA 3CDHA 3SHFA 4EVIA 4OBWA 5K0GA 3HTUA 3SZTA 3T8TA 5LGUA 5HILA 2OZUA 3LKDA 3VYWA 3D0SA 1MDMA 2YVLA 1JQEA 2H1RA 3KPJA 4YUVA 3VFZA 3LECA 3A7DA 5HDKA 3E5XA 1B1BA 3BKWA 2V74B 2BM9A 2JZYA 3M6UA 2A61A 4OQDA 2V1UA 4GOMD 5H02A 5BXYA 5DTMA 4PCQA 4ON0A 1OPCA 2OD5A 3MQ2A 5E1XA 1ZLKA 3P9IA 2HTJA 1YZ3A 3MHTA 3UZUA 3GLXA 5K0NA 1AF7A 3WTXC 3T1BA 3DKWA 1M6EX 4BY9E 4E32A 2OY0A 3FUXA 2F5CA 2I62A 5CVJA 1I1NA 3KR1A 5H20A 3EVEA 5DM2A 1OR8A 5E18F 2KIMA 4E70A 2FCAA 2CMGA 1NT2A 3OV8A 3GXOA 3MGGA 2FOKA 2AS0A 3ML6A 1EIZA 3C3PA 3GFJA 5CIYA 5G02A 9MHTA 5DD4A 2FRXA 3DXYA 2XKOA 2RDPA 3ABTA 5E8JA 1D5VA 2QRVB 3E6DA 3P7NA 3LHDA 2DO7A 5DRTA 1HW2A 4R6XA 2WV0A 4POOA 2XVCA 2QM3A 3SVZA 2B0LA 2DPMA 1IXKA 2PXXA 4UOEA 2FMLA 1FYKA 4E31A 2IW5A 2H27A 1G4DA 3BDDA 3M6XA 4LECA 5EZQA 2DQLA 2XAGA 2O6GE 2HNKA 5E20A 5FB2A 1MJ9A 2E7XA 3P2EA 1V3FA 2EJRA 3L09A 1UIRA 2QBYB 2JHCA 4ESJA 1FLIA 5HZMA 2P5LC 5KS2A 2O0YA 3MERA 1TLHB 4GYIA 3N97A 1EH7A 3IWFA 3K69A 4KUMA 4OIQF 3M4XA 1N7JA 2FMYA 2G71A 2B2CA 1S7AA 3KQMA 3E6CC 1W7PA 2EFQA 4DF3A 5DX1A 2GZWA 3IHTA 2EX4A 1Z7UA 3KEOA 2VT2A 5K0CA 3WU0A 4UVCA 4OINF 3RYPA 2O57A 3WGHA 4KWCA 4MTEA 3S68A 4L18B 2QZ8A 5EHIA 3IYLW 3B02A 4CWAA 4EQQA 2AOWA 3KQWA 4RX1A 1YZHA 3FTEA 3TO9A 3P71T 2BZGA 3T7TA 3DMFA 1XJ5A 4JK1X 1ZG3A 4O6JA 5HOQA 3ZQ7A 2ZBRA 1YW9A 1VL5A 3FPGA 5K09A 1IXSB 1XGNA 3M70A 4RB2C 4X63A 1OYIA 3VODA 5CVRA 4RS8A 2G9WA 2XRNA 4F84A 2ZULA 1CF7A 3HVJA 1P2FA 4QWQA 2AS5F 2DI3A 2QRVA 1KGSA 2FE3A 4UVBA 3WG9A 3KZYA 1XDZA 3MQ0A 5EHGA 1TQIA 4O3MA 2PJDA 1H0MA 2I9KA 4HAMA 5JUWA 3KR2A 3HVIA 3C18A 2XBMA 3DF8A 4Z2YA 3DXZA 2R7DA 2ZMEA 3A25A 3OZSA 4HGZA 2I6GA 3HA3A 4HZFA 3HEMA 3L2CA 3DOUA 4PIMA 2ZZNA 5D5WB 2P35A 2ETHA 2GA9A 1I27A 3SR4A 2FK7A 3T7SA 2HR3A 3G5TA 4R6WA 1QGPA 4OX9Y 1JE8A 2EWNA 5BQTA 4YV1A 5IT9K 5DM4A 4KIGA 5HDNA 2B25A 3BWBA 3HVKA 2ZIGA 2VONA 8MHTA 3TRKA 1H9GA 3KU1A 2HKXA 1RIOH 4V0QA 3WU1B 2HWVA 4ENKA 3I71A 4LWPA 3TMAA 2AVDA 4I01A 4HQMA 1ZREA 3DEUA 1JTEA 1RJFA 3FPJA 2W84A 2KIUA 3GU3A 2ZTHA 3R24A 4HRAA 1FSHA 1J0RA 2HDCA 4RB0A 1UHMA 3TOBA 4YFKF 2G7HA 2PWPA 2AN3A 1EAMA 2EFNA 2UYCA 5E9WA 3FMSA 5JR3A 1TBXA 3O3KA 5LQUA 3CKKA 2XAHA 5K0FA 4EM2A 1SVUA 4L9TA 5K01A 5GIPE 4ENNA 2M1BA 1G60A 5LHIA 3HCCA 3D2LA 4C06A 2P41A 1X1AA 1R5GA 4KVZA 2W24A 1ZH5A 1SG9A 3F6VA 3SQNA 4LG0B 2QUFA 3NVMB 3EYYA 3FXRA 4QDKA 1TNSA 3TGNA 1BI0A 3FXUA 1FYLA 3FM5A 2L3DA 2G7UA 3UJ8A 5TRDA 2EFJA 4XUCA 4AIJA 3UA4A 2ZXJA 3UJBA 4A5NA 1BJAA 3LA7A 1W7PD 1J2XA 4HV5A 2QQAA 4K6MA 3NW9A 1W7PB 3M33A 3EMBA 4E2ZA 1B59A 3SGLA 1D8JA 5EEGA 2PV0A 1A04A 5D5UB 1R23A 4OMYA 4CTKA 5H6QA 2QENA 2EA4A 2ZVJA 1KQ8A 3BWGA 4JXJA 5BMZA 1KPIA 4KDRA 1EH6A 3F4KA 2Q41A 4EJTA 2O3FA 3MFKA 3PLAE 2KW5A 1OMIA 3ECHA 2Z33A 5HIKA 3HRUA 1AV6A 5F6FA 2FNAA 2FBIA 1NE2A 3K0BA 5DXAA 4U0VA 1R1UA 4IJAA 5DYMA 1BN5A 3RODA 3WGIA 3V8KA 3GRZA 3KCCA 2OBFA 3SX0A 3J81Z 3E8SA 3NWEA 4PYOA 3K1MA 1UFMA 1FT9A 1JHFA 4GBED 2F5FA 2OKCA 3DPLC 3E5UA 4EJUA 4ESFA 5GOZA 2ADMA 3J80Z 3G2QA 2BM8A 3EVBA 1J59A 2NXCA 2P7HA 1P4WA 1ON2A 3F8MA 1SD5A 2QLZA 1V4RA 3G2PA 2UZKA 1M0EA 2YU3A 5DUKA 2AZTA 2HV9A 5EOVA 2DQRA 5FTWA 5LQCA 1NW7A 2BGCA 5E1DA 5FA5A 5EKXA 3Q5FA 2CMHA 4TV7A 4RTKA 1SKMA 2IFTA 3R4KA 4EJOA 5GWXA 1NV8A 1YLFA 3EVZA 1XSXA 2HYGD 1XDSA 2FPOA 3HA7A 3NVKI 5HEKA 5CVDA 3Q87B 3PFGA 3EDPA 1YFLA 4WVLA 3WTSC 5FD6A 3SXYA 5B1SA 2DPUA 5FHQA 2JH9A 4AX8A 3QAHA 3GRRA 1LEBA 3L7WA 3FX3A 5LQNA 4L7VA 1SMYF 3OPNA 1VIDA 3UFBA 2LD4A 3TOAA 4AIKA 1KU2A 3DLIA 5HLHA 2Y1WA 1SUSA 4A6EA 1K78A 2JHAA 3BOQA 2Z6QA 3LCVB 2ERCA 5EMKA 4O29A 4KNYA 1IN5A 3LSTA 1XXLA 1ON1A 4YG2F 5LSAA 1DP7P 5GIOE 2ZKZA 2OQRA 3P9NA 5BP7A 3DQVC 1T98A 2VT3A 4IVNA 3DV8A 2L02A 1SD4A 5KK1A 3IV6A 3LX6A 2IJLA 5EQJB 1FJXA 1HKQA 4N9IA 3G5LA 4DQ2A 4WF2A 4M9XA 2VN2A 3FMRA 3NDJA 4RTLA 3TQSA 1NHAA 3BGDA 2YPRA 4NQWA 4RAZA 3BZBA 2DLLA 1L3BA 3TKAA 2RQPA 1FY7A 3KQYA 4XUEA 3L9FA 1XCVA 3WSTA 3MWMA 5EPEA 3MEXA 1ULYA 4RTMA 1XGMA 1D2GA 4HOBA 1QBJA 2VXZA 1NBHA 5DUIA 2J5OA 2C7OA 4OIOF 4NECA 4DCMA 1KIAA 2YR0A 1L0OC 2XROA 5FWAA 4F7ZA 1HW5A 5BPDA 3H92A 2K7LA 2NP7A 3PQKA 4EGZA 1KYZA 1XTPA 5FGMA 3PFHA 3LCCA 3ZPLA 4IHTA 1R22A 1YW7A 1KU3A 4GC9A 2RGVA 1CF7B 4IF4A 1XSDA 1SUIA 2XV4S 3B3JA 1PP8F 2UYQA 2AOTB 1ZG5A 2VBZA 3ISPA 3I58A 2P3LA 3I59B 3F21A 4QQKA 3IL2A 4G6QA 4PNEA 4Y17A 4RB1A 2G8NA 2P5VA 2QQ9A 1IAWA 3GZ5A 2BR4A 2PMHA 2PGXA 5IKMA 3LQQA 4ZH4F 5E1ZB 3T0IA 5E2BA 2A5YB 5D5XB 2CKDA 1H1DA 2AR0A 3LGAA 1AQJA 2P3QA 2PG4A 3G89A 5E1OA 5GM2A 1T38A 5FFXA 1P6RA 4AWXB 4S04A 3KHKA 5T6BA 3K2ZA 5FLXK 1MDMB 4GEKA 4QLCU 4RAYA 2GPYA 3WTUC 1EG2A 5HLGA 3NMUF 2V1XA 1UB9A 4GXOA 3R60A 1VP3A 2QE6A 3V8JA 4HTFB 4L5JA 4ASNA 4IWNA 1G38A 2K4JA 3RPUA 5LQKA 3HSEA 4KRGA 4HF2A 3MAJA 4LG0A 3FUTA 3A4TA 2XAFA 3JWJA 3UJ9A 4M6XA 4UXNA 1L3LA 3R6SA 2DU9A 3B3FA 2BH2A 1IN8A 1QNTA 10MHA 2L01A 4BHPA 4L0ZB 4Y15A 4I0BA 4FSDA 3CO7C 5LLQA 1RI1A 4O5VA 3P9KA 3RW9A 1IXCA 1LDDA 3QPHA 1XGOA 3LA3A 5D4RA 1L1EA 4G7ZF 1NBIA 4EQZA 2OB2A 1DPRA 1Z91A 2OAZA 3T8RA 5LHHA 2VODA 3JWGA 3G2OA 3ERCA 3THSA 4MIKA 2OB1A 5GM1A 4BH9A 3NTVA 4OQEA 4PINA 6PAXA 2OXTA 3GF2A 2C7RA 3PTAA 1S3JA 1JG3A 5D8KB 3KR9A 4MWZA 1WZNA 3FYCA 3F22A 4P9FA 3HOTA 4C05A 3C6KA 4BNCA 3MZYA 2NNYA 2OA4A 5L3FA 5D1NA 5DX0A 5J8CA 4PYJA 1T43A 4P7JA 5FUBA 2FQ3A 5JHUA 2BR5A 3HRSA 3E6MA 4E2XA 2BV6A 2V79A 1P1BA 1YO5C 4LB5A 3FZGA 5EIWA 1UCRA 2DK8A 4G56A 4GCVA 1E2XA 3B7PA 4RVGA 1BI1A 3P8ZA 4MTLA 2NYUA 3OU6A 3J7AO 4XCXA 4YFXF 4IRGA 4R05A 1P4AA 2EJUA 1T6SA 3I54A 3I64A 4G7HF 3CO6C 3DXJF 1BM9A 5CCXA 1S29A 1RI5A 2CG4A 3GCZA 3DMHA 3THRA 5HFJA 1G3WA 1Z1DA 2EK5A 3E05A 2P1DA 4B8XA 3EVCA 5EKUA 2R7FA 3KPWA 5M5BA 4M74A 1L9KA 2TDXA 2LKPA 4U0WA 2H11A 2YXDA 2FNPA 4BP1A 3M9AA 3EGIA 3LA2A 4PYKA 2HQRA 3WE3A 5LR6A 3F72A 3TR6A 2ZWVA 5LGTA 1M6YA 3I9FA 3EUHA 2HWKA 4I98B 3OOPA 3LPMA 4AZTA 1EJ6A 5DWQA 2IRFG 2JG3A 3IRRA 4FT4A 3N4MA 4S05A 4X41A 1R5HA 1G6NA 3HCFA 5FO5A 5K0EA 1JR4A 2MH2A 3OU2A 2ACJA 2NP6A 3M7GA 5F64A 1QZYA 2AN4A 3G3ZA 2HGCA 4K2EA 2IH5A 2BE5F 2R6ZA 2O05A 2PX2A 2DTRA 1F1ZA 2CSOA 3GX4X 4M73A 1DUSA 1WRJA 1L3IA 4AZVA 2OBPA 1RI2A 2ZO4A 1ZAOA 4CXFA 4DQ0A 1D2HA 3BJ6A 5C0OE 3BZ6A 3U81A 2OYRA 4RVFA 4DNCA 2W85A 5AONA 3F8NA 4A2UA 1JSXA 3ME5A 5FLXZ 1RJDA 3CJRA 2BEOA 1MJBA 5LRSA 5L3EA 1W4MA 3CJNA 4KDCA 4KMFA 3BGIA 4GOOD 4C03A 4DKJA 1O9GA 3FTCA 4HSGA 2LSOA 3DLCA 4A5MA 5ERIA 1N7IA 1J7KA 3M8EA 5K0JA 2QYOA 1F9NA 2NYXA 3KLNA 1T39A 3FUUA 4B17A 1K7AA 3QV2A 3EVGA 3SZPA 4UUVA 3CVOA 1IN7A 4A12A 2HTSA 5DT2A 2OQGA 1FP2A 1AOYA 4GUAA 4Y2HA 1NW6A 5K5OA 1TQPA 3CTAA 5BOXA 2VBXA 3KP5A 1YIOA 4HX7A 2F2EA 3FMQA 2I7CA 4GOND 3RPQA 3V4GA 3BWYA 3GUDA 1HQCA 3ELDA 1RI4A 3RKXA 3HOSA 3NEUA 3CC8A 1T2KA 3GFMA 1P92A 3S2WA 1Y8CA 2O06A 5ILUA 2FSWA 5FWDA 3EEOA 3HVHA 3ZMSA 1NW8A 3ELWA 3DXXA 2HYFA 4Q5SF 2CWWA 2A6HF 2MD5A 1QYRA 2KKOA 1DL5A 1ORHA 1TW2A 2PFBA 2DPDA 3NDIA 1D2CA 1VP9A 2AOXA 4PWYA 2K86A 3OZRA 3Q7EA 2HQNA 3MCTA 3KZZA 4P7GA 2KRFA 3IC7A 3R0JA 3BWMA 2YSRA 3L00A 3GFLA 4PGHA 1HBXG 3HA5A 4DCGA 1XCBA 4OIPF 4ZTBA 2EJTA 1SQGA 2IH2A 3P2KA 3NJRA 4A0XA 3KP6A 1ZKDA 4RTPA 4FT2A 1SAXA 3V7SA 3KQSA 5MHTA 5DEQA 3M6VA 2ELHA 2M87A 3G2MA 4QDJA 1XMKA 3RYRA 3M1EA 3HCAA 1FOKA 1EQAA 3FTDA 1HKSA 4ZYGA 3DR5A 3F6OA 2NNNA 4HH4A 1XDUA 1BI3A 5FULA 1WXXA 2IP2A 4XLNF 4G7OF 2YXLA 3HSFA 3KP7A 4WCGA 4WXCA 5FD5A 4KYWA 3BY6A 4I02A 3MCZA 4M9SA 1WWXA 2UYHA 2Z5UA 4R8RA 4PYIA 1RI7A 3JWHA 2VOPA 1AQIA 1Q0SA 1FZPB 1B9NA 3F8FA 4KN7X 2R3SA 2ORED 1U6GA 1B4AA 2XASA 5EMJA 4HX4A 2CO5A 4BQAA 3ROUA 4GC5A 1QQIA 5CVIA 4OIRF 2JTVA 1P1CA 5DCMA 1ZN2A 3I4PA 4MHGA 5E8IA 1R8YA 1F5TA 2L54A 3C6MA 2IIPA 4YUWA 4ZZDA 2DULA 1MJAA 2M30A 2NNWB 3IKTA 3HTXA 4PIPA 3GNLA 4GF5A 1HW1A 4MNUA 1I1SA 2NXJA 2P6TA 3QPTA 1MD0A 4KIFA 2FF4A 3UJCA 2HR1A 3I53A 3FYDA 2C6YA 5DDGA 3OE5A 1R7JA 1Y0UA 5CYVA 3IWZA 4HX8A 7MHTA 1BI2A 1YG2A 4ENMA 1I5ZA 2Z99A 2D45A 4RWZA 2PN6A 3ULQB 2AOTA 4IRHA 3GJYA 5C1IA 2ZW9A 1FPQA 2NXEA 5K05A 3GO4A 1VTNC 4IRIA 4HC4A 1QO0D 3BROA 5HS7A 4BHCA 5F2KA 1J5YA 3EPPA 3BJAA 4AUKA 3EVAA 4YIFA 3C0KA 3EMDA 3PVCA 5FA8A 2D2WA 2MA3A 1P4XA 1R74A 4LB6B 1LQ1A 1YB2A 3KKZA 3COAC 2O61A 1NW5A 4IV0A 3KETA 2HKOA 4XRFA 3WTVC 5DM0A 1XCJA 4OOIA 2DW4A 1JG2A 1ONVA 1X1DA 5EZSA 1WG8A 4P7KA 1T0FA 4ZZLA 4GQBA 3GRVA 1U5TA 5KQRA 1K78B 4X60A 4X1OA 1UWVA 5CCBA 2VC1A 5DRYA 3C1DA 5KVRA 3DPTA 2ZBQA 3UJ7A 1FC3A 5EG5A 1KU9A 3EGVA 2GB4A 3SSMA 2EV5A 3L8DA 1V39A 3HUGA 3A7EA 3QP6A 4YMGA 4IKPA 1P91A 4LG1A 3FTFA 2L4AA 1JG1A 4CTJA 2PY6A 2CW0F 3HIFA 3OFKA 4PYQA 1X19A 1D8KA 3T5XA 1HKTA 2O07A 3NRVA 1YQAA 5EEHA 1HXDA 4HLYA 4CO8A 3RI4A 1Q0TA 1ORIA 5E17F 3U9GA 4ER3A 1O3TA 4LLLA 2Y1XA 3WTTC 4LK1F 4FR0A 1USSA 2RV8A 5EC8A 5CM2Z 3KLOA 4RGUA 4Y13A 1QZZA 4ESBA 5ILVA 1BC8C 2FK8A 1R6AA 1S7OA 1XVAA 1BC7C 5DSTA 4BLUA 1U5TB 1BHJA 3OCJA 4U7DA 1Z9CA 3HRMA 3Q9VA 2ISYA 5EGSA 2PQ8A 1STZA 4YUXA 5EMLA 5FQOA 2OPBA 2V6CA 1XN7A 1U2ZA 1WY7A 3EGEA 5FFZA 2H6CA 3O4FA 1LVAA 1Z3CA 5T64A 3HCBA 2IA1A 1I9GA 2D1VA 4AVPA 4QPPA 5LEJA 3RTRA 3H3ZA 1ZLJA 1Z6RA 2LF7A 4KDPA 1FWZA 2PMUA 4BP3A 2GXGA 2HZTA 3LKZA 4CKCA 2EA2A 4IHSA 3Q9SA 4RTOA 2PXCA 3HP7A 4CICA 3U1DA 3HCDA 3OFJA 5E8GA 4RGRA 3PB3A 3UJ6A 3VOEA 1MKMA 1OKRA 1BIBA 4A6DA 4RTRA 3WTZA 2FA5A 1TTYA 3QU6A 3FPFA 3TOSA 4BLVA 2IH4A 2JT1A 4HLXA 1B6AA 1G3TA 3JTHA 4MQ9F 5HS9A 3SMQA 2WK1A 1YFHA 5CUQA 5DXJA 2P7CB 1YFJA 4PZJA 3BT7A 2KJCA 2EB7A 4LJZF 2JRTA 2B78A 5AIPA 2LDUA 4M72A 2X0LA 1JSZA 1ZGJA 2JH8A 1DUXC 4MHTA 1IRFA 2ZIFA 5ICFA 3GFIA 1R18A 5FQNA 5IT3A 3NWBA 2GA2A 2PJPA 2AXLA 1LB2A 4FS8A 4EGYA 4HF1A 2ZCWA 1SFXA 2E1NA 3X0DA 1Q1HA 1KA8A 4M7RA 2L4MA 5L3GA 3KP3A 2FYTA 3VC2A 3C7JA 4RVDA 4KMUX 1C0WA 5D4SA 3KEQA 2VDVE 1RUNA 2HFHA 2PLWA 3FUVA 2PLYA 3WGGA 2AOVA 1QAMA 5DLYA 2IA2A 2JPCA 2YX7A 2WA1A 5K0BA 1EV7A 1JG4A 2KJBA 4A0ZA 2EFPA 2XYVA 3BXOA 3K0LA 5DTQA 2HOEA 4YFNF 3IRQA 1K6OA 4HF0A 5DSXA 2EV0A 4EV0A 1EH8A 4RSRA 1USTA 1G3YA 2P8TA 1DCTA 1J9IA 3G88A 1XB4A 2M5WA 4I0AA 3PS9A 1U8RA 4IV8A 3U2RA 2VE8A 2F5DA 2IVMA 2ZNZA 3RKYA 3EETA 1YW8A 3JSPA 1G6Q1 1J75A 3FF5A 4HW0A 1HMYA 4CDGA 1SD7A 1KU7A 2PT6A 3BGVA 5DM1A 3CLOA 3CUQA 2FBHA 1BBYA 3ZN0A 1H9TA 2ZMEB 2YXEA 3F3XA 3JW4A 5E1WA 2OU2A 1KHHA 5CVUA 4FSXA 1G8SA 3J80K 3TO7A 5IH3A 2RVCA 4BLWA 3TPZA 1VQ1A 1GVJA 2OO3A 1YS6A 5BS6A 4OA5A 1KPGA 2YX4A 4R8SA 5DCMB 3TM4A 2XHKA 2VBYA 5CVVA 3R0AA 3TDZC 2OZVA 2C7QA 2BR3A 3DP7A 5DX8A 3FZVA 1JGSA 5ED4A 1O7FA 4KFCA 3ZP5A 1UHWA 1Z05A 3V8LA 4A0YA 2FRHA 2WC2A 5L3CA 1SD6A 1SMTA 4XSXF 1INLA 2GS9A 4C4AA 2X4HA 2PSSA 3QOXA 3D5LA 1WXWA 1QPMA 2HEOA 5EIFA 2Y75A 3KQPA 4P5OA 1XMAA 3R9XB 1RI3A 2JHPA 2P4WA 1F4KA 1R36A 3BPXA 5H6RA 5FHRA 3ERED 3WTWC 2PKWA 4G9YA 4H0NA 4L5IA 5FCDA 3MZHA 3DULA 4P7FA 1ZRDA 1U5TC 2NAZA 2UWMA 4C07A 5LGNA 3DH0A 2K02A 4D0PA 1MJFA 5AIQA 3OU7A 3GW2A 4FGZA 4NHJA 5K0LA 2QBYA 3WODF 4M37A 1MGTA 4OU0A 2K4BA 3ZMDA 3BP8A 1TPYA 3ZMVA 1YF3A 4M38A 1FP1D 2H09A 2YTZA 2Y48A 3JAMK 1O57A 4RTJA 3F8CA 4GGGA 3BKXA 2QQBA 3PQJA 4WXHA 5DTRA 3HSRA 2A6EF 4HGYA 5F1RA 4U7PB 4EMSA 4PYNA 2VOOA 3LCUA 3FRHA 1NKVA 1HSTA 4U88A 2Q0OA 2WWYA 2DT5A 2G72A 2OZ6A 5D8LB 2XYRA 4RGXA 3KQTA 1IN6A 3BPVA 4DZRA 1W5TA 4KT5C 2F5EA 5D6FA 2PI0A 2ZBPA 3CUOA 3KE2A 4MQVA 2VDWA 2PBIA 2EFOA 3KP2A 3CUQB 3GRYA 2PX8A 4ZYDA 1SFUA 2VDUE 2JJQA 2VBWA 3TLJA 2H6BA 5HOOA 2VC0A 2KIFA 1RNLA 3CCFA 4CZZA 2RC4A 1G3SA 3DFGA 2ZZMA 2EG5A 2C7PA 2D1HA 4FP9A 4ZYEA 2DBBA 2VE9A 5IT9Z 3KPVA 3FPEA 3R61A 4AD9A 4L9NA 2E1CA 1FSEA 3O31A 1Z6TA 2FHPA 2Z6AA 4HA8A 3B3GA 2MH9A 2Z3YA 3HM2A 4R1HA 4UV8A 2ADUA 2P5KA 2IA0A 3E97A 2MLGA 2V9VA 2Z6UA 4P9UA 5GINE 1B9MA 3PT9A 5ICCA 1VBFA 2ONZA 2P7VB 1F38A 1KP9A 3AY0A 2Q2EA 1AWCA 1QANA 2IDKA 2PT9A 3RKWA 3E23A 2DK5A 2HTEA 1PUEE 1VLMA 3UJDA 4ER5A 2VP3A 4OBXA 3JSOA 2ONYA 1O7LA 4OA8A 5HDGA 4CKEA 2FU4A 2CL5A 3ELKA 3HYIA 3OE4A 3HRTA 4M71A 3FUWA 5F2NA 2W25A 1NW3A 1RJGA 1R1TA 3G8AA 4X61A 3R3HA 1WQ2A 3RDIA 1R8XA 2UXNA 2PVCA 1RZ4A 1IF1A 4BXUA 2A3SA 5ICGA 3C3WA 1JQDA 1LDKB 3RIEA 1O54A 2Z9OA 1L3CA 2PX5A 2STWA 1G55A 4Q4ZF 5JVTA 5LBQA 4RTNA 5K1YA 1X3UA 2QWWA 1BIAA 3E3VA 1EJ0A 3LDFA 4CXMA 5BPIA 1KYWA 4BHBA 4PONA 4PGGA 4OMZA 1ZHFA 5HLIA 2A69F 1VE3A 4ATNA 3KPUA 4M36A 2ESHA 2UYOA 2ZIEA 3HHHA 3T7RA 4EKIA 1CGPA 4QTUB 2XAJA 4BYYA 2E5WA 3A26A 2CFXA 3ELYA 3E6BA 1HNNA 4MTDA 1W5SA 2FBKA 3ER8A 4KIBA 4EM1A 4QQNA 2CQKA 4KN4X 4YUZA 4ZYHA 4FX0A 1ZRFA 4CYDA 2G70A 5LHGA 1P39A 3GZ6A 2BBYA 1FBSA 5CVEA 2QY6A 5CD1A 3LDGA 1FX7A 5E1MA 2GIVA 3LFKA 4R79A 1WSUA 4DA4A 4GYGA 2QVOA 3O6BB 4I7HA 2YQZA 1U78A 5LRRA 1N2XA 2XYQA 4C04A 3AXTA 3EVFA 1OYYA 1XD7A 2YR2A 4G6DA 1PJZA 1FYMA 2HMYB 1VPTA 4HDUA 4ER6A 1IUYA 4U0YA
chains in the Genus database with same CATH superfamily
3ANTA 1DXYA 4XSZF 2CZQA 5FWNA 4DC1A 2ORYA 4A0QA 2DR3A 2QPOA 3EGDA 4Q00A 1ZH4A 2CCJA 5F2OA 4BMVA 3HPQA 2W2MA 1QDLB 3MUNA 3SZRA 3WRYC 2JAXA 1ZK2A 5E2AA 1OR7A 1OWLA 3ZLTA 4F12A 5JY6A 1NBEA 4MQ4A 3HUEA 1XDGA 4J2TA 1V3UA 3ED1A 3UXEA 5L3ZA 3L79A 2CY0A 2FFJA 1A7AA 1PJQA 4H3SA 4BVKA 5JCJD 2JA2A 5F0CA 1Y3BE 3EX7C 3LQ2A 3DLTA 1JJIA 5J8FA 3FYUB 3V2GA 2WP0A 3IVMA 4PV7A 2QL9A 4BJTA 3AB8A 1B16A 1XK6A 3D7MA 4K9PA 4MPJA 4IFBA 4UUOA 1R4NA 3HUDA 5DYTA 1FFBA 4NBQA 2UUZA 1E7QA 2KZVA 2DRIA 1DBSA 4JBAA 2YMQA 3QIVA 5HKBA 5ENVA 1KSFX 2R9VA 2ZTVA 5DD8A 3DF9A 1ACIA 3HVUA 2Y76A 1I4OA 2ZIWB 3D6VA 3KL4A 1Y9JA 4I1UA 3F6BX 4N7BA 5FTMA 5AVXA 5TJJA 3CLTD 3OJWA 4IIHA 3WXBA 1OH6A 2HA4A 4NJEA 2R93J 4G94A 4QUIA 1X3WB 1XELA 3A27A 4BTVA 2LR8A 1C7ZA 2RHGB 3ZCSA 3T95A 3BUSA 4KE9A 1FUUA 1BZYA 2BAGA 4M9ZA 1O6CA 2ZJ3A 1QHNA 2WPDA 3FCUB 1XAGA 2XF5A 3LNQA 1F0KA 1Q6ZA 3Q11A 4GOLD 4QUJA 3SHTA 4B0OA 1MB0A 4YJGA 4I09A 4AKIA 2IXSA 3F6SA 4F86A 1TJ4A 5AOVA 3GHHA 1M1NA 1XCOA 1S8NA 2IZ6A 5JYCA 4NZNA 2OHHA 5C4XJ 1F2UB 2WF5A 1E3WA 5B55A 3RSQA 4FNAA 5B6JA 5JZSA 5JFTA 4LK0F 3PX3A 3UJHA 5HZHA 1SOWA 5EVJA 1M7HA 3QI2A 3IUSA 2HF8A 2QVCA 3O3CA 2XGJA 1LFAA 4DBLC 4EJSB 2PYDA 1C81A 1NI5A 5I01A 3AWIA 5HFNA 4G6ZA 4WOPA 3GP8A 1QAQA 1ZM9A 2HJGA 4ISCA 1DARA 3D4LA 2DFHA 3N6XA 2CLDX 4JQZA 4RYLA 3H18A 1DZ3A 2ZANA 2DPYA 1JAZA 2QVGA 5L45A 3JAMZ 1E7RA 3OA2A 3RRMA 1W7AA 3UXMA 2PFKA 4WDQA 1V7PC 4IZ6A 2QU7A 2ZFWA 4PJ0C 2P9EA 4D4JA 4FWTA 4DC0A 3CC2I 1SUEA 2IXGA 1XX6A 2ILVA 3KV3O 4OK5A 5K51A 1OYWA 3E8MA 3EEQA 4RACA 1T2VA 3MVEA 1TWAJ 5KJ1A 3WFJA 4IIXA 3PIIA 3D3KA 4PS1A 4EI8A 4XR4A 3FSGA 3QPBA 1YL7A 1UBFA 2VZLA 2J3KA 4O4LF 2ZSDA 1JSRA 3PXBA 4MK4A 5DPMA 3ZZTA 2E2JJ 4N5LA 4RVUA 3MT8A 3EFEA 3QVKA 5H7XA 2BVLA 3NAMA 1SKAA 4Q1AA 1KMQA 2GQ0A 2QTFA 1ZW1A 1VG1A 5E7JA 4TKUB 1PWZA 2XMQA 4B09A 2A68F 1S9HA 8AT1A 1MG0A 2ZWAA 3RF6A 3CUQC 3W6KB 1SQFA 3PQCA 5K03A 1J8MF 3LAJA 3E7PA 2XQVA 4FHCA 4JNCA 1MKYA 5I9TA 4DREA 3FG9A 1WDTA 2WTEA 4LITA 3WNBA 4UM9B 1YJ5A 3R5FA 3OCUA 1V1RA 2HPAA 4N0MA 4B74A 1B3BA 2MYPA 2REOA 5JASA 3OI7A 2DR0A 2PFGA 3ZEAA 2KT0A 1WMSA 3IPXA 3K5PA 1WETA 4CKYA 3EOAI 2XAQA 2MLKA 2OAEA 4MYSA 3WSWA 2EQRA 1BDHA 3DL2A 1KS9A 1E2UA 1T95A 2OCAA 3T4PA 3RSSA 2JGMA 3ZZUA 2EJCA 3ZGOA 2GXBA 2TRTA 2D3WA 4H16A 4BAYA 1DIBA 4YAUA 1HV8A 3DZFA 3OZUA 1ENOA 4ARZB 3PX7A 1IM2A 3VR4D 1U9OA 1K79A 3RKRA 3W2TA 2ORWA 1IU9A 1MAHA 3LMMA 5FWYA 2HRCA 3PPXA 4TUYB 3PVZA 3LPDA 5IPFA 3JRFA 2W6QA 4PYMA 4MKRA 3O4GA 2Z6VA 1I3CA 2H5JA 3OYCA 3PQFA 4WW0A 3LXRA 5LQRA 4GKAA 5KNDD 3BS4A 2XGXA 4QDTA 4DCVA 2QUBA 1Z0KA 2B1RA 2L7FP 1LNWA 2I76A 3L46A 4OO3A 4RANA 3LC0A 2AG0A 4AZ0B 4CDNA 3RR2A 2BKUA 4YMLA 1RVV1 5FOTA 1FOXA 1ZJWA 3DFKA 2GH1A 4ERNA 4TYNA 3OFNA 4MVJG 4UUNA 4XTCS 3SWWA 5CBKA 2EU8A 3K6RA 3W06A 1SHKA 4FS3A 2C42A 4AJPA 1PUXA 3COWA 3BR0A 1JW9B 1M6HA 1YE9A 4I2OA 2V7QD 3CNEA 2ZRCA 3D8RA 2BHTA 3S2YA 4BGIA 5L3BA 1OFCX 2O5RA 1XTUA 1FBQA 3CEJA 5BVHA 4UZEA 3G73A 1NSTA 2NU9B 3T9BA 4O8CA 3TBFA 4FVTA 1AXGA 4C4TA 2I2DA 5KWJA 4JLAA 5JD6A 2JGKA 1EXMA 1QBGA 2XMSA 1EBUA 3OLZA 2CLMB 2A9JA 3D3WA 4IAOA 2NS0A 1E18A 3K9TA 1QF6A 5U1PA 1KYIA 4LS3A 3D8SA 1DAIA 4HBGA 3TAUA 5BSMA 1VJ1A 5A5FA 5I6DA 1SU8A 2GF0A 1TMKA 3AR9A 5G2OA 4KQXA 2Q4BA 3IDQA 1I2ZA 4RORA 4RWEA 3QOPA 3UMSA 3SS8A 3E0JB 1CJVC 4NFLA 4DIKA 3D43A 5DE3A 2WHPA 3KEYA 3IH4A 4H7FA 4AIHA 4FX2A 4DMRA 2SCUB 5FADA 3ONFA 4HQFA 4JASB 1GRCA 1Q0LA 2R4GA 4MI3A 4DMUB 1NPDA 4E1VA 3R6TA 2QRGA 1RYBA 3O7WA 1R5NA 4QEDA 4TTPA 3JYQA 1RXWA 4AUXA 1IWPB 1JIJA 2JKVA 2FN7A 3L1HA 4LQ4A 4O6VA 1Z3YA 1DG3A 3IKVA 1I7SB 2WA2A 3ZOZA 1TNDA 4OLJA 3FM3A 2JLCA 2ZNYA 2GRJA 3GH1A 1U9ZA 5BUZA 5ITWA 4DABA 2WG2A 1LDYA 3E5QA 3GLGA 2G9RA 2GJ8A 3UB2A 2L9RA 3TW6A 4YDHB 2DBYA 2WAYA 2XQIA 2ECOA 2JAWA 5BO5A 1T29A 3GF4A 4C2BA 2LF8A 4YMUA 1IXYA 2ECPA 2K27A 2M34A 5LB2A 3FB4A 3EBLA 2EV6A 4LRQA 5ALQA 4KO2S 4ZZIA 3T1TA 2XITA 5C8DA 2JPBA 1QTQA 3JAMA 2IBSA 1J0XO 3U61B 3WWOA 5M34A 3E4DA 3V7CA 2DBRA 2ZI5A 3RS8A 2RC6A 4J43A 1ZC3A 2A07F 2A1UA 3OQ6A 3PNKA 4EPRA 1W4ZA 3OO0A 4LFUA 3JCUC 1OUMA 3MB5A 4Q05A 2CYYA 3OS2A 1OGIA 3TZBA 3EUWA 1EIWA 4KA4A 3IBYA 1AMOA 1OQYA 3BJOA 1FJ2A 3MWLA 4IXAA 4Q03A 4YJDA 2F6RA 3OIDA 3RS5A 4Q37A 4WLNA 1CUYA 4AF8A 1ZUNB 4CKWB 2CLOB 1KETA 1K7SN 1Z28A 3WJ7A 1PSDA 4H7IA 4KU4A 4RV9A 4BQPA 5LL6P 2OTLI 2HXSA 2K5CA 2J5RA 3COPA 2WUVA 4QVKA 1P9NA 4X3CA 5KAPA 2V9PA 1E1RD 2MCFA 1HL7A 2VA9A 3DDHA 3ILVA 1T4CA 4JUBA 1RQPA 4G0YA 3H5TA 3VR6H 2MBFA 1YQUA 4AFNA 1Y80A 2P5SA 4EF6A 5KSPA 1CJCA 3M6WA 4NLLA 4HQEA 2MHCA 5BN5A 1SCIA 1MC1A 3KZOA 4TTAA 5L7TA 5A71A 4DRXA 1GZDA 2XSJC 4GPAA 5G40A 1YS9A 4HTFA 4ZXFA 3NLLA 1PZXA 3K3PA 4ZAXA 3N87A 3FVRA 4A1OA 5IYZB 5KC9A 1EJ9A 3TZLA 3EB9A 2FWMX 2M8EA 3BB3A 4IHJF 5HIAA 2VHZA 1V5FA 2O52A 1F12A 1T91A 1REPC 4M0KA 3TQRA 3UKJA 1B7GO 1F20A 4PG8A 4KW7A 5EJEA 5EZHA 4ZOEA 1WCXA 5JQGF 1YVEI 2VTVA 3W8EA 4F2PA 1QP4A 4ER7A 1RETA 5KO2A 2K9QA 3EQZA 4PM4A 3VSAA 3VR3D 2BFDA 1H69A 4IQ0A 4V0RA 5DDIP 5EKDA 2RKWA 2QD2A 2XHZA 5EZGA 5IUNC 1I8TA 1PHPA 3H97A 1IY9A 4BVFA 4YPVA 4PU0A 4EKDA 1D2RA 2J32A 4OGWA 5D00A 2JVHA 4RGVA 3N53A 4YV0A 1W88B 4HVAA 4A23A 3U5ZB 4H0EA 1JH9A 1WB4A 4BLOA 4QREA 2GA1A 3INTA 1DEKA 1E1DA 4KTVE 1U7UA 1PRYA 2AI2A 5F7JA 4DJEC 1XMXA 3OIUA 3MJVA 4BO1A 1SIOA 2ZUUA 2C1ZA 3I3OA 3CZ4A 3L6UA 5IARA 1PS9A 4BNZA 2Y05A 1JSLA 4YUYA 3NANA 3Q6IA 1WV0A 3ITEA 3ABRB 2GNAA 5FTKA 3LGSA 4OL9A 1VQKI 1E17A 3CGGA 3DHVA 3CIOA 5EP3A 3W1EA 3UMMA 2R7TA 2J9FA 4HDRA 3WE2A 1ZIPA 4ENTA 2CE2X 2EP5A 1XVUA 2J5KA 2AKYA 5K7FA 5IFLA 3GRUA 2H1VA 2XMPA 4QYIA 1VLLA 4DR4B 1YS7A 3WIOA 4EYEA 4KACA 3UTCA 3HP4A 3ZOKA 3ETLA 5BW5A 4ITVA 3Q3SA 1UOPA 2P9QA 5IJAA 4EIWA 5HS8A 1UPBA 2GVDC 1CC1S 1WOMA 4XUGB 2WWIA 1VSTA 1ZJ4A 1GXQA 5FOUA 3C6BA 3RQSA 5CBPA 1YU6A 1U0BB 1E0AA 1X0XA 2NQ2C 2RONA 2O8CA 4L4YA 4X5OA 1IRGA 2VZ9A 2BFBB 3Q7SA 5DCFA 4OP3A 1BC5A 4PCAA 1N5IA 5L4NA 3IDFA 1WS6A 1YUBA 2A14A 2GUGA 2J09A 2V5AA 3HCEA 4HDNB 4ZU3A 4YN3A 4JI1B 2X4LA 1G291 3TP0A 4G8XA 1EH5A 4GGMX 3TLGB 2LP4Y 1FNNA 2R8ZA 3G2LA 4LRTB 4OQ4A 2H1IA 2J0UB 4C3ZA 1Z6XA 1UPUA 3FCCA 1FBNA 1KYQA 1MENA 3GJ6A 3IUPA 1XGSA 1BXKA 2QVBA 3K92A 1W48A 1DINA 2QI9F 3CKLA 4CNQA 2XJ9A 4WLFA 4ZO8A 2WR8A 2ZI4A 2JEYA 4LOHA 4V3CA 4R8HA 4BNDA 1BMQA 3BDIA 3ZVNA 1I6XA 5IWCA 1E4EB 1Z63A 1JEDA 1N5OX 1LSJA 1R8SA 3PU6A 1YR9A 3LF2A 1R00A 3IHUA 2R8YA 1CUXA 4KREA 1JAXA 1MT3A 2R8XA 3KR0A 3WGTA 2BKXA 2F8LA 4UBOA 4J91A 1F8GA 3WZ2A 2P7IA 1IXRC 4DV7B 2G83A 4AKGA 4BB6A 3EIXA 1GKUB 3T0FA 4LC1A 3U7RA 1A6IA 3OSZA 4YX9A 2PUDA 3HBLA 3OLQA 3ET5A 1E3TA 1ZWLA 4UULA 2Z2XA 4TL9A 3U3ZA 2PEXA 1AQYA 1X7HA 3B5IA 3HJTA 2ESNA 3DTNA 3LX8A 3A9TA 1TVEA 4MDYA 4RHYA 4XUDA 4HBZA 1NUHA 4UUBA 3ZE6A 4AURA 2PE5A 1KDTA 1WNTA 3LAPA 4PQYA 1QG2A 2FN3A 5DV9A 2O3QA 5KCZA 2GTIA 3KIPA 1TQ4A 3GG9A 2FMFA 3KTOA 5JSQA 4JY7A 3DMYA 4D6PA 2Q1YA 3NAGA 5JJBA 4Q82A 5D1HA 4BNGA 4C5AA 1TK9A 2XCLA 1I1OA 1M2VB 1Z8FA 1IEQA 4XSVA 1KOJA 2I55A 5H3HA 4RB3C 4F5DA 5F21A 3LT5A 2WUWE 4MLPA 1EBBA 3BL6A 1IW7F 4P54A 5CJ9A 2O8XA 2BZTA 1WW2A 4O0LA 5JS2A 1DQRA 4YXWD 1TEVA 1N2JA 3ER6A 5T67A 3PTLA 3CDHA 4PS0A 3SHFA 3SR3A 4IDOA 4EVIA 5K0GA 3SZTA 2E3JA 2TMKA 3IP8A 3LKDA 2D5IA 4G09A 3QMVA 2XF6A 2FEAA 1QG0A 3INRA 3QVGB 1MDMA 3DEWA 3OJXA 2NUAA 3H5AA 1JQEA 2WYHA 4HVTA 5L9AA 4XX0B 1SCBA 1B0ZA 2JI8A 4ZV4A 3VFZA 2NPFA 3A7DA 4MH0R 1SHZA 3F78A 5A7GA 4DMHA 1Q7CA 1IVNA 3E5MA 4IIVA 1TWCJ 4EHIA 1B8IA 1OLSB 3WTCA 5I7SA 2BRUC 3BKWA 3NNDA 4NOKA 1VPEA 4AW9A 4B85A 1XMQB 2ZOSA 4XIFA 2W6NA 1RIIA 4MAFA 4AYTA 3C2BA 4WXYB 4TTIA 1GD1O 2JZYA 2ZAGA 3L84A 4DLLA 1AGRA 2NN3C 3GUCA 1FFXA 3DMTC 3MRTA 1A71A 3CMAI 4OQDA 4E12A 2O1WA 2P27A 4GOMD 1EKXA 3N2IA 1LI7A 2HI0A 1BW6A 2AXTC 4ON0A 5DTMA 1ZISA 1S01A 2OD5A 3EXEB 2Q50A 1IVYA 2B8TA 1FIUA 2G25A 2FY8A 4RNDB 5A03A 4J19A 1P4HA 1L4FA 1OX5A 4DQKA 4Y9SA 3TECE 4OIFA 2JJ1A 2OQIA 2PS1A 4ESVA 1CEQA 3RVKA 3FK7A 1RU3A 3GAFA 1GAWA 4L5AA 1EDEA 2OECA 3E3LA 2J4CA 1IUFA 1FYVA 2DTZA 1N2ZA 2W0SA 2ZWIA 4FBMA 4URYR 4F96A 4BY9E 2Y4NA 1XVIA 3WAKA 3H9EO 1AVTA 1E2LA 3P0RA 3OZCA 1VIMA 4Q19A 3UUFA 2B8JA 3F2IA 3PSHA 4YJFA 2F5CA 1LTQA 2I3AA 1B0UA 1ISGA 2I62A 2FPMA 2I4IA 4GUDA 3F9IA 4ZT3A 5H20A 3UJ3X 3EVEA 2H0AA 5JO0A 1M5UA 4I4CA 1RT9A 2O0MA 5DM2A 2EQBA 1OR8A 4JL8A 3BHIA 3ZWYA 3PC6A 4E70A 8ATCA 2H4HA 3ESYA 2KISA 4ROTA 2BW3B 2O0KA 4GX2A 1NT2A 1Q2UA 4ED9A 3J80A 2V0GA 4NR0A 3HABA 2VYVA 4GPZA 1O6FA 2VLBA 2C99A 5IM5A 2UUOA 4ENWA 5A6VA 4E5SA 1KAEA 1X7WB 3B13B 5CIYA 4LK3A 1I6KA 2FRXA 3ABTA 3BCHA 4DE5A 2WBLC 2JEOA 3ET4A 2VJYA 2DA1A 1S7GA 2R1UA 3KLMX 4LWQA 1L5GB 4EG7A 4TZ6A 1DKLA 4AJJA 5IXSA 1HG0A 1JKJA 1YAHA 3QYFA 4FD2A 4JMLA 4N0QA 2H8GA 2P0AA 2HWWA 3UNXA 5LZ5A 3U1TA 1KGDA 1R0RE 3NHYA 5K7ZA 1YQEA 2NNLD 4QYIB 4YYEA 5FOVA 1ISJA 3A58B 2VAWA 1CEYA 3MBOA 3H8JA 4X8HA 2PXXA 3EXEA 2VF4X 3DV0B 1O94A 5K3BA 1T8PA 5LP6A 2IW5A 1MLDA 2FOWA 2YW2A 3N74A 2FWIA 4LXTA 5DK4A 1E0DA 3ZQGA 2K87A 2QP3A 1IV6A 2E5FA 3M83A 3N2YA 4U7FA 5JDCC 1KE1A 2XAGA 1NLFA 2D0IA 1O58A 2HNKA 1E2HA 1PI3A 2H8KA 1QTNA 3WGZA 4C2TA 1S1MA 3GRFA 2BSXA 5E3LA 2CFOA 2CHQA 3CZPA 3SC6A 4WV3A 3L09A 4PX9A 1UIRA 5BSRA 3S5UA 4ESJA 1SHUX 1VSBA 2P2LA 2PPVA 2II6A 2YN4A 3K2QA 5LLTA 3QSYA 1C3OA 3IX7A 1GG9A 1V1MB 3MERA 4GYIA 1SKBA 1GL7A 4YTEA 4B31A 1M2JA 4O2RA 3VKHA 4A8JB 1MJGA 4KUMA 4OIQF 3GPCA 3IUYA 3JVIA 1N7JA 2ZSFA 1YVRA 3N9IA 3NVAA 2B2CA 2BSAA 1S7AA 1M2EA 3RBZA 5B1YA 4CH7A 1YRHA 4M3EA 3OM1A 2I22A 1R0XA 3JQFC 4HAZA 2Y9YA 2EFQA 1G0OA 2Q4RA 2H08A 1SZCA 5H1YA 4RESA 4DDHA 1SNYA 3A04A 3CG0A 4L74A 3FHNA 3KZIC 2X40A 3WRXC 4BZPA 4KO3S 4MQUA 3FISA 1D5CA 4DA9A 4B6EA 1QKIA 3BB1A 4DMMA 4IHYA 2R6R1 4UVCA 1XQYA 2V98A 4LZPA 1KMCA 1CUGA 5DGCA 1JHZA 2O7QA 3F90A 2V4JC 3WGHA 4KWCA 4XDHA 4MTEA 2BGMA 5FL3A 3S68A 2D5BA 5IFKA 2VTEA 4QODA 3TIFA 2FD5A 3VKVA 4L18B 5K2MA 3B9QA 2QZ8A 3AR8A 4N0DA 3B02A 3VH2A 2NZJA 3ZD9A 5LIRA 3ABZA 1FNCA 1GZSA 5SV2A 2HXIA 2OHJA 2YY6A 4JSRA 2AKEA 3A1WA 3FTEA 4D0GA 4NBSA 4KP7A 4KFSA 3VO9A 3T3DA 3UMBA 1TZ2A 1YR2A 2DWPA 1OLUB 2E6KA 2QLLA 4UUSB 5JMTA 3HKZA 1LBEA 5E0OA 1UBUS 4TS4A 1ZG3A 4H0FA 4MB0A 3DTVD 4PPQA 3ZQ7A 2GVZC 4BFWA 4JJKA 3UHJA 1YW9A 1THZA 3IDAA 4QXAA 1M1NB 1VL5A 5T4BA 4DNFA 3WA7A 2WTUA 1GR1A 1IXSB 1EFAA 4CEHA 3K1AA 2WAFA 1SCKA 3BXEA 1OYIA 3O03A 2RJ3A 2XUKA 4JB2A 1Z16A 1TC3C 4M9QA 5DT9A 1A6QA 2KPMA 4YRMA 4DS3A 1D0YA 1Z7WA 1CF7A 2AX3A 3GEDA 3HVJA 1CUJA 5MGNA 4PCUA 3UGTA 1P2FA 2W2TA 2AS5F 2D54A 2Y31A 4UVBA 2R5ZA 2JGFA 3KZYA 1N1EA 1D6NA 4GMDA 1XDZA 1FPMA 1G66A 1SUCA 3MBKA 1DBVO 4O3MA 5HHTA 3QXCA 4CF3A 1IDOA 2MJLA 4YCMA 4LF4B 7AT1A 2I9KA 3AM4A 5K2OA 2QMQA 1OBVA 3E3AA 5AJYA 3C18A 1VYHA 2PUJA 1R9GA 3GUHA 4J0JA 2KBFA 2QIPA 3PYMA 2Y71A 3DXZA 3PNMA 5FV7A 2FDXA 4Z7QB 3A25A 4FB4A 3C4QA 1ZELA 3CCMI 4PLPA 4XKWA 1UJ4A 1YB1A 1E2KA 1XRNA 2YZ7A 4HZFA 3HA3A 4GPEA 4I5IA 3TQCA 2QZJA 4JKIA 1N0WA 1PG0A 1S8FA 1AZLA 2C9OA 3M1LA 5CEEA 1VL2A 2AUTA 5KNBD 2QMZA 2X0JA 2ZT6A 1Q77A 4EVQA 1XFDA 2LREA 1P1IA 1TJNA 1ZCAA 2HDOA 4NCXA 4JQYA 1OV4A 3FPLA 4N9WA 3WO0A 2KRCA 4CUGA 2XNJA 3GD7A 1EUYA 3UEOA 4I4IA 3G5TA 5SY9A 1DJPA 4MEAA 1H05A 2VF5X 3CZQA 1CIPA 2NVQJ 1I2BA 3DGFC 4DCOA 2IY8A 5LDGA 4EENA 2DZDA 1KWKA 4LSMA 5D51S 3AL2A 2DAPA 2IXEA 3EASA 4BNYA 1CUAA 5HDNA 1W5AA 4XWOA 5HMLA 1BCSB 1FTTA 3IAXA 4ZT5A 4J0GA 2ZROA 1T9CA 3FIWA 1QHIA 4OH1A 4GI3A 2VONA 2HRDA 4TSFD 2ZUFA 4D9CA 3ZGLA 3COYA 3DDNA 3OTHA 1KMIY 3MTGA 3MJHA 4P4NA 1H9GA 4RGYA 3KU1A 3VZRA 2QJTA 1M2WA 1Q0ZA 1K5PA 2FQ1A 2NYAA 2XRMA 4BJHB 4KK4A 3I71A 1R5BA 3G9QA 3I9V6 4PFOA 1E3IA 3ICPA 2GJKA 1NQ5A 4Q4CA 1ZREA 3OWHA 4OMCA 3BK1A 3T3HA 3GAZA 1K4YA 4M0PA 5E3JA 2ZYSA 3FDZA 1MO4A 3K6KA 4N49A 4ADSG 5KSZA 3FMPB 3PQ5A 3CIFA 3S2SA 3QOFA 3TL2A 4HGOA 4JGIA 4C1NA 5I7UA 4GRDA 2ZTHA 3H99A 2QVYX 2HCJB 4XLFA 1H1LB 1J0RA 2C5GA 2HDCA 1W96A 2CLKB 2RGYA 2WLTA 1RE1A 4HOYA 4ZCPA 3ZWBA 2UUBB 2O8FB 2LP0A 2G7HA 2PWPA 2AN3A 1EAMA 4Q1VA 4NV0A 1JPNA 1QYVA 2KHZA 4WK4B 3OTQA 1YZFA 3E5RA 3UO8B 2K85A 3S44A 4LHEA 4Q9IA 3I92A 4JA0A 3EUFA 4IJ5A 5BMOA 1WDMA 3CPJB 4J00A 1Q44A 1JAHA 1WOYA 4OQLA 3O3KA 2XSZA 3BE8A 1W4RA 3SJMA 1F48A 1SCNE 3CKKA 2MT9A 5J1UA 1F14A 2NOAA 4GMHA 4XIJA 4EM2A 4L9TA 4U2BA 4D3XA 5HCNA 2A0XA 1EK6A 4AMVA 1ZMBA 2QX4A 3GTGJ 4OHYA 3VZQA 2HQAA 2WB1A 3DC2A 1ZM4A 3GLLA 1X1AA 1C9YA 1CD5A 1CY0A 1KJYA 1YBAA 2Q6TA 1WE2A 1NVGA 4WEOA 3HR8A 4KVZA 4UHDA 5JZOA 1ZH5A 3KYDB 3HBNA 2E4UA 3F6VA 3MMXA 4FYKA 4O4LA 2OFFA 2DQKA 2NTNA 4Q9NA 5JRDS 4GLJA 3EYYA 3FXRA 1CQXA 1WHTB 2QB5A 5D5PA 5JQGB 3TGNA 3TW7A 2JL1A 4FWBA 3TFWA 3CCEI 3UC9A 3O5AA 4NU6A 4I5FA 5JCJA 1A8QA 1P73A 1FJLA 2WOOA 3AQ4A 1D1TA 4MKFA 3N39C 3MWEB 2G4CA 1JR3E 1BYIA 2JFPA 4G3XA 2EFJA 4B17A 4EGAA 5FO1A 5IF9A 2ZRQA 1F5NA 5IBQA 3S1RJ 1G7SA 2ZRBA 4K88A 2QZ4A 3Q1LA 2D0DA 2P77A 4EITA 1UBNA 1YE3A 2ZR9A 3K10A 1P3DA 3BIXA 4GNKA 1J2XA 2I10A 4LA4A 1YRBA 2IYFA 3DBVO 4M55A 2AR7A 4MRSA 1M83A 1W7PB 2GZMA 3G2NA 3MM4A 2INGX 1CX9B 5JSHA 1H0HA 2VAXA 3RC2A 1SBHA 1C4OA 1B59A 5CQGA 1AA9A 3AR3A 3FE2A 3RCBA 3BCBA 3MHPA 5EHQA 4BNXA 5HS4A 1L4KA 1A04A 4Y18A 3MCWA 4OMYA 5H6QA 3FRJA 4ZAFA 3I23A 4Q4AA 2AF3C 5DNUA 1SN7A 3CPHA 1L7EA 4RCZA 1JI0A 3Q6MA 3RSHA 3OOYA 4NBLA 4CU2A 2KMLA 5FP0A 2PMBA 5EGOB 3F4KA 1I7LA 4O1HA 4OD0A 1I3NA 1K06A 2C3MA 2GUWA 4OB7A 5G1NA 4EJTA 3WRVA 2AQ8A 3PLAE 4G41A 2VNHA 2AFVA 1GZ3A 2EGUA 1CRWG 3CINA 3HH8A 1Z25A 3CRRA 1BHSA 1AN0A 1FU4A 3HXMA 1TMYA 4DA0A 1KY4A 2CRGA 4M0DA 4MWSA 5CH8A 4JI2B 3ICQB 1W2HA 1R1UA 4IJAA 2J6IA 2J5QA 4XDZA 3P9SA 3I61A 3AM1A 1BN5A 2H1CA 3RODA 3WGIA 1C1DB 3GRZA 3K9QO 3KCCA 3J81Z 3WLSA 4J1NA 1WP9A 3TCXB 4H60A 4TMZA 2UXBB 3LOUA 3PGXA 3PPWA 2YRFA 5LQSA 4P0QB 1MGOA 4EJUA 2R6GA 1XTSA 4NJEB 1WY5A 2HCFA 1GVHA 4PLVA 4HAUA 5ECGC 3G7SA 4JBLA 5IX8A 2BM8A 5I9IA 5JZBA 1PW5A 4W1UA 2B30A 2P7HA 5DN9A 5IJWA 1QPGA 4TLDA 3CLTC 3G79A 4CCKA 1U6KA 4HNUA 2XA2A 2QLZA 3KCQA 2JZOA 3G2PA 4JT2A 4LBWA 4LBVA 1NDUA 1KONA 2ODTX 1NR1A 4EUEA 1AO0A 1C50A 2OBXA 4QUDA 5MGBA 1IJWC 2FN4A 2DQRA 3L7KA 3LWZA 5CP8A 2OBYA 5EOVA 1D4FA 4H31A 1FDOA 4G8DA 2VBGA 3H1AA 5EHNA 4BKQA 1D0VA 1W85B 4H1VA 1MRZA 1G2PA 1KKLA 3L4SO 1OCOH 2B1JA 4GYJA 2ZB8A 5E1DA 4D9GA 1XU4A 4YP0A 5EKXA 3Q5FA 3DL7A 4MINA 2CMHA 2CH0A 2BM1A 1B72B 3IV9A 4FLEA 1O3YA 4LFAB 4GKJB 3T5CA 3PV0A 2JA1A 4JJ7A 4BQFA 4X1EA 2GSDA 1U9IA 3TEJA 3LQKA 5CG2A 2K9SA 3LBHA 2C4HA 3EG5A 1HX7A 2PMDA 1Z2OX 4PLCA 2W58A 4CGYA 4F2DA 3ZWNA 1MTOA 4EYQA 2VQHA 1JHRA 4Y2QA 4D44A 1YLFA 2J9FB 1XSXA 1BXRA 3V5NA 5B1BH 3CR8A 1VC2A 4NBKA 4GS5A 1AQNA 5B7GA 2GNOA 4LBZA 5JNRA 3I9OA 3L8HA 3IBCA 4PW0A 3T7IA 1VG0B 1ZXLA 3G1UA 4G9BA 2CVFA 3Q87B 3TZ6A 4G0WA 2LCQA 2ZU6A 4DWOA 2VYND 2WBMA 4KIJA 3WTSC 5FD6A 2O2HA 3EC1A 1BW9B 4KN6A 3SXYA 5KTPA 3HRHA 4PJJA 1OPXA 2WMNB 4ILKA 4HFRA 5FHQA 4K9LA 5C4GB 5HQ3B 3QAHA 3WKEA 1DEAA 4URVR 2BGNA 3JSAA 2GYWA 5LQNA 4L7VA 1FK8A 1BWSA 3UFBA 2OD7A 3Q0VA 3WG7H 4RS3A 1RYYA 3PEVA 1KQFA 4AIKA 4KNWA 1OXUA 4GLBA 4K86A 4KXYA 4ML3A 1FRVA 1RKTA 1MN6A 1THMA 4W6ZA 2FSVA 5HLHA 2VWQA 3HB1A 5FBQB 4MW4A 3IHLA 1VMDA 5JBQA 4ZHQF 2DLDA 3OE7D 3BOQA 3CZ5A 4M0EA 4RETA 2ZXIA 2YVAA 2ERCA 5ALNA 1LV8A 1TLFA 3JQEA 4MUNA 1RYDA 4O29A 4OFZA 2CFRA 4U9IS 4ZWNA 4DNPA 3DVSX 1GFWA 2BEKA 2FEMA 2R00A 4RY2A 1U7TA 1D5WA 3LSTA 2KM1A 4GI2A 5LSAA 2QPAA 1ZPDA 1SXJD 1DFGA 3AM5A 3MS4A 4K5QA 4NQRA 2VQFB 2ZIZA 3CPEA 3P9NA 3GBPA 3HJNA 3BCAA 3Q5GA 2PMWB 3E82A 4ZOAA 4IHXA 1MX3A 1QSGA 2XW6A 4E07A 1T33A 3DV8A 5BRNA 3FNBA 2IE0A 4O4LB 4J3FA 1GYPA 3MJRA 1QFZA 3P5JA 1TQ8A 2HREA 2WJAA 5BVGA 3RYHA 5EQJB 1U0JA 4DLTA 2EZ8A 3H04A 1X14A 2WAOA 4M9XA 3NS7A 5IYZF 3FMRA 3ML1A 3OZAA 2J4FA 2XGOA 3EZ7A 3G9UA 1DXOA 4RA6A 3HJEA 4ZYVA 4RTLA 4AJOA 3H83A 4AY2A 1ITZA 4ZO9A 4ZQBA 4F4JA 1JQAA 4INZA 1U63A 2V7GA 2V3VA 3MCUA 3ZWKA 3GTKJ 1K92A 1N2GA 1E99A 2C2GA 2V7WA 3A31A 2X76A 3H2ZA 3PGKA 4HEQA 4RAZA 3MOSA 3PZRA 2W98A 1S3IA 1PJBA 4K9RA 1BJKA 1Y5MA 2MYSA 2B2XA 1V3QE 3MLBA 2FPXA 5EF6A 2RQPA 3R3UA 4D25A 1FQOA 2HHCA 4QYWA 1FY7A 3KQYA 4XUEA 3L9FA 2WJYA 4J0IA 3MEXA 1I7PA 4RTMA 1K7XB 2A1IA 2WT8A 4D81A 2VXZA 1RLUA 4R0NA 4FQGA 1NBHA 2EEZA 3GCXA 4JVMA 1YRYE 2UZ1A 4FUQA 1QH0A 3KT8A 1FXWF 5EHZA 5HOEA 2HZ7A 4JJ8A 3N07A 3MGAA 4YREA 4OIOF 2C7OA 1KIAA 4TVOA 2XROA 1PVEA 3WL3A 1RAFA 1FIPA 5BV8A 4CUJA 1ZRHA 3D3EA 4AJLA 4G1CA 4R71A 4K6HA 1CUVA 1BFKA 3ZBUA 2PA0A 3OAAA 4KI7A 4L8LA 1DKOA 3ZY6A 5FUMA 4TYWA 2NP7A 1O8BA 4HNAA 4ASUA 1QC5B 4EGZA 1W30A 4JEIA 5IAKA 4J6FA 1DBPA 3TTWA 4EJMA 4ZJUA 3U80A 4Y2JA 3BB4A 4C43A 1N2CA 3DQZA 3PFHA 3ZPLA 1R22A 1FNBA 2IUEA 5AK6A 2YKGA 1KU3A 2EH3A 1JNYA 3BK7A 4GC9A 4XZ3A 4CRWB 3AL0C 1D04A 3VPAA 5L6LB 2QN7A 2QJRA 4TS9A 1SUIA 5JWRA 2R7XA 3ZU4A 5KTYA 3W4KA 3ZU3A 3G0BA 1PP8F 2JI7A 2QGUA 2AOTB 1ZG5A 4Q9KA 2CV1A 1P2DA 2BV3A 3EZNA 2WQ7A 3F21A 1CHDA 3ESZA 2P6NA 2RH8A 3B85A 3JQGA 3P32A 4P36A 2PANA 4RA6B 1K8ZB 1I13A 4RB1A 1A1VA 2G8NA 3O2QB 1ZVKA 2QMOA 3OF5A 3VZCA 1MEEA 1NI4A 3VZDA 2WYOA 4OQYA 1T0HB 1YZTA 2BR4A 2VOJA 5E6UB 3T1YB 3F46A 2DWQA 1GV0A 4QAQA 3U4DA 5E1ZB 2O50A 3OJLA 1D6MA 4LFBB 2B7LA 4AMBA 3VNVA 1AQJA 4B7AA 1XMPA 3NB0A 2G88A 1MRSA 2F1JA 2IYZA 1OX6A 2J3MA 3IPCA 4HYQA 3OWOA 4X84A 1GAXA 4YCNA 3S6JA 3ZHCA 1CW2B 5FFXA 1DBWA 1J2UA 1Y9EA 1MVLA 1M6NA 4IHQA 3WXMA 5T6BA 5IP5A 3QKUA 3FCSB 3LSRA 1CP2A 3BRWD 2NTJA 1RWMA 4RZXA 2Y2ZA 1JIUA 1MDMB 4TSKA 4J0FA 4UPVA 4GEKA 4EATA 4LGVA 4QLCU 1JBQA 1QQTA 3D6MA 3H2GA 4RAYA 4PO3X 4XH9B 1C3VA 3RANA 2XUIA 4ZMSA 2BGLA 4JYKA 3WTUC 3OC0A 3RIMA 3VVMA 1KDOA 5JNVA 3NMUF 3K05A 4I9GA 3MIZA 3VH4A 4CV3A 2GHQA 3WK6A 3HPGA 1EQUA 2JRCA 3JYNA 4HEHA 2BI8A 3DAOA 3I1IA 4TMKA 1M0TA 1NW9B 4B6PA 1Q19A 1Q7TA 3V8JA 2ZVQX 3IC5A 4HTFB 4JYBA 5LZ8A 1RQNA 1P45A 5LQKA 2G0NA 4KRGA 1VYVA 2HXGA 1DAHA 3FKIJ 5SYMA 2DFEA 4UEJA 1U7XA 2PGDA 3FGOA 3PKJA 3FDIA 5KYYB 5MFPA 2W7TA 3KQHA 1I50J 3EMKA 2J7PA 2V03A 1FTZA 1NF8A 5EWJB 3L07A 3P2OA 3UJ9A 4QOEA 1SCQA 1QGAA 2I6QA 3EVTA 1W0KD 2FOIA 4R2KA 3FBGA 3G2JA 4BHPA 3UOAB 5DNYB 4EO4A 1FEXA 4I0BA 3UHAA 4BACA 2R86A 3GZTB 2WRZA 5LLQA 1FSFA 2IYVA 3GLRA 1RI1A 1B0PA 3P9KA 3D5QA 1IXCA 3CNQS 4HWOA 1LDDA 4ZQEA 1XGOA 3LA3A 1J6UA 1W75A 2CSUA 1NUUA 1PLKA 3AHIA 3DLBA 4G7ZF 4ZDWA 1QDEA 4N3GA 1KJQA 4CL3A 1P18A 4MMYB 3PUXA 4X85A 3AIOA 1LPNA 1RFGE 2OAZA 3GRAA 3AESB 1F8UA 4H7EA 4N5HX 4ND4A 4ECEA 4N5NA 2XC7A 2Q5JA 3IS3A 3JWGA 5EJCA 2V5UA 2OKGA 3BA6A 3HYCA 3T7DA 4UCFA 3ZTYA 5B4TA 4YRAA 3K4HA 3KBOA 5IC4A 4FIDA 1E9RA 1SBCA 4CR7A 5DO9A 1L5YA 4PINA 3ZTTA 4MS4A 1BVUA 3C8UA 1HGXA 4BE4A 4RDXA 4Y7NJ 4PICA 3E22B 2F1RA 4AWAA 3PYLA 2OO5C 4P9FA 4C05A 4E7OA 4O3FA 2WU0A 3H1TA 2W42A 5KAIC 1NOIA 5L3FA 1T9ZA 1E0JA 3LXMA 3OD1A 3CCSI 1SUAA 5DX0A 3RIHA 5CK4A 1U0GA 2CB9A 4LIPD 5GV8A 4JI3B 3B48A 4P7JA 4HMQA 2FF5A 4U5QA 5FUBA 4UATA 5JS1A 5CBPB 2FQ3A 4HGRA 4N7MA 3WL6A 3WQSB 4CQNA 1BVRA 2BR5A 3S27A 2GXAA 4CM8A 3BQNB 5EDNA 4JSYA 3LU1A 3I56I 1WPXA 2F9MA 2W2LD 3BYZA 3B7PA 3I5XA 1ZUWA 3P8ZA 1W59A 4LEIA 4PZEA 1QGOA 4LC9A 4G6TB 2UYGA 3GMEA 4LN1A 4YFXF 3HUFA 1WCIA 5L4LA 4R05A 1P4AA 3I54A 3BQ9A 3H9JA 1E1QD 4BFYA 2B92A 4IO9F 3KZVA 3K8OE 1A82A 1TM4E 2B6HA 2QLFA 3KTDA 2A94A 1E3HA 3DXJF 3KS9A 4LQDA 1Z77A 1BM9A 1IDN1 3CE9A 4HRVA 3CH5A 5FUVA 4F3RA 3JWPA 1WAMA 3A6EA 1T56A 4HNAB 3RUAA 1OVMA 1X3LA 6LDHA 2VQEB 2I4OA 3DMHA 1J06A 3LWBA 4GGOA 5HFJA 1RBZA 1Z1DA 4BVGA 2VZ0A 3PGLA 2WTBA 2CKMA 1DCMA 4C3JJ 1EFUA 1RCUA 5M5BA 1ADJA 4M74A 3BMNB 4BO2A 3A6PC 1P74A 2XWQA 1KVRA 1N57A 2FWAA 3IJPA 2LKPA 3BG9A 1MB4A 3QXJA 4PGFA 4CCYB 1YCFA 4TKLA 4D82A 4I6ZA 1H2HA 1T15A 4BP1A 2G9UA 5ER9A 2I4TA 2GEKA 1XE3A 5AKJA 1PL8A 1DC4A 3TLKA 1I0IA 3G2KA 4GXRA 2FEWB 4E32A 5JC8A 2FWNA 3V80A 3VKFA 1W36B 2OHFA 5KYTA 3Q8KA 1QB7A 1PL7A 4J7AA 4QA9A 3TR6A 5ADUS 3BTSA 2BY3A 2HVSA 4WADA 1KEVA 5E6RA 3GTQJ 3DKIA 3BFVA 1NXPA 3W7BA 2HJRA 5BT9A 2PUHA 1XD2B 5EQTA 1NVTA 4BZQA 3OOPA 1QS0B 2H9AA 2CJWA 4O2BF 3HN2A 1OC2A 1VFPA 3RSCA 4AZTA 3BTLA 3HL2A 3BX1A 3V1YA 1T2CA 2JG3A 3O3NB 3FPBA 1XTJA 4FT4A 4MS3B 4MKZA 4R41A 4S05A 3BILA 4IEIA 3GP5A 4E22A 5DNVA 4KVFA 3UB4A 4RFSA 4RSGA 3GIDA 5ADWA 5JH7F 3RPUD 3S3NA 1JE0A 5L8VA 4WZZA 5H9WA 3IALA 3CVYA 4LDJA 4JLOA 2NUTA 1Y98A 2FSGA 4LQLA 3TWOA 3U5TA 1Z4QA 4BVHA 1VHTA 4FMBB 1Q1EA 3P4YA 4ZI7B 2Q9AA 3L6DA 3PG5A 5CFNA 5KNBA 2NP6A 1QGED 2XMZA 4IIGA 2W6CX 3VDRA 3M7GA 1KYTA 1H66A 3GTPJ 2I2CA 3AKYA 4MGEA 2E1MC 4LKRA 5BN4B 3R74A 3VUEA 2JFWA 4YY3B 3G3ZA 3EYAA 2GAJA 4K2EA 3H1FA 4YMWA 2IH5A 1XPUA 1ZUIA 3HSKA 2XUZA 4Y2TA 4MUJA 3QVGA 4A15A 2CSOA 1NOKA 4PVDA 2G76A 3W2WA 4M98A 4M73A 4D3ZA 1DUSA 2BM0A 3HYSA 1XJCA 3GP3A 5B2ZA 3WB9A 1WRJA 4HAVA 4Y2RA 3LUBA 5KX5F 1RTKA 2O2IA 3SK0A 1WJCA 4TT3A 5EXPA 3C2HA 2DOEA 1LA2A 3A6GA 3LUHA 3P27A 3DJYA 4TRJA 4X20B 4F4UA 4BEBA 1T1GA 2WYUA 4QSHA 3L2UA 1UKAA 5K1ZA 4J16C 3A6HA 3NPMA 2FRVA 4DNCA 1E1CB 1H3EA 2P2NA 3N59A 3U62A 5IKOA 1JSXA 4A2UA 4H77A 4YJ3B 1GCIA 1XWWA 5CDGA 3AK4A 2EZLA 3OYNA 3ACBA 3SFVA 5TS2A 3URKA 3HDDA 1W4MA 3CJNA 2YDXA 3I3SR 4IFEA 2CNNA 3BGIA 3L7OA 1IM5A 1ENZA 4GOOD 5FBHA 3GV0A 3ZRGA 5FBKA 5DM60 4YAGA 1O9GA 3FTCA 4WQMA 4OAZA 4BMXA 3PJFA 2W4IA 4U9HS 3WIBA 2J9YB 4ZPXA 3JD4A 2PGLA 4IEEA 1OCZH 3PD1A 5FI1B 1N1GA 3M8EA 4QPQA 1TT5A 2BCJQ 4LDZA 3AKZA 3CEPB 2QYOA 1STOA 5E3HA 4BMNA 1F9NA 3L0BA 2CQNA 2VKDA 3KLNA 1T39A 1ZC4A 3ORRA 3KOZA 4FFNA 4UFPA 1AB6A 1EX6A 3DE4X 1L4YA 4NYMR 2XGSA 2J3QA 4A12A 1A9QA 1LU9A 1MIOA 2JNWA 4RFVA 1FP2A 4XDGA 1Z88A 4YPFA 3E7DA 3BT9A 1RAGA 4GUAA 1IPEA 3PNYA 5K5OA 4MCAA 1ZXXA 2W00A 5JATA 4BYGA 2GBYA 4BWGA 3KZNA 1GA1A 4Y9RA 2C5AA 3DDOA 3MSCA 1WXHA 3C3KA 3OQBA 4YIHA 1YIOA 4ENSA 1WVRA 1RR8C 3LVFO 4WZ6A 4XWTA 3IQEA 3KOOA 5IVKA 3IHWA 1V96A 4W1PA 4TTVA 3RPQA 3F0CA 3BWYA 3GUDA 2X2OA 3ABOB 4GAEA 3TNDA 1U0LA 1XG5A 3HOSA 3NEUA 3BULA 2WYIA 5A9RA 2XNKA 4LJ6A 1T2KA 5CXXA 4B80A 2W7NA 1WDKA 2IIBA 3CX4A 5D3KA 4DXHA 4J76A 3SN6A 1GNTA 3ANYB 4KFTA 1JJ6C 1AZSC 2D4AA 4FKBA 5F5XA 1K0FA 3ZMSA 2HQSA 2YBEA 3HVHA 4LDQA 4D5EA 3JQFA 1WXQA 1ESEA 1YZUA 1P1HA 3KOWA 1UZAA 2HLNA 2HYFA 1R88A 3DOIA 4UASA 4Q5SF 1WWKA 1X38A 4JR0A 2D2EA 4N7RA 4WNAA 2A6HF 5TLSA 1XU9A 1FXSA 1P0MA 1XF9A 4Z9BA 3H1CA 2PH3A 4KWHA 2R68A 1WO8A 5TVKA 2X9GA 1E9SA 2PFBA 4RM2A 1TDJA 2WIDA 5HUHA 1MMNA 4CKBB 5ADVA 2HH9A 3PQ2A 4FDVA 2GNPA 1QH1A 2XB0X 4POAA 4AN4A 1MB2A 1V1RB 2NV0A 3EH2A 3GFFA 3MCTA 2QMEA 4QO7A 3WNDA 1DXQA 3HWX1 4FEYA 5IJ0B 1SXPA 3EBOA 3R0JA 2HA6A 2A0FA 1YI2I 1YZVA 3CESA 5IT9A 2YSRA 3L00A 3C14C 5CLIA 5BNZA 4PGHA 4RW0A 4JJ4A 4X24A 1XCBA 2VBFA 1WJBA 1EA7A 3JQAA 2IH2A 2IGNA 3NJRA 1OWOA 4JJIA 1MBZA 4JYMA 5ERXA 2APJA 4GXQA 1HT1E 3F6YA 4U6QA 5ARCA 3RB8A 3U3MA 3ENZA 2J7PD 4B6FA 4H9GA 4G4GA 4ZMBA 4RTPA 2A6PA 2V7BA 1E5XA 4TVBA 1TI7A 5HK8A 5BNIA 4FT2A 2IHNA 1SAXA 1FL9A 1QHXA 2V26A 1YQQA 1HYBA 1YMVA 5KWEA 2OD9A 2FRDC 4BO9A 1KC3A 3QLUA 1RC0A 3UG6A 3V7SA 5EFOA 1WVIA 4GFBA 3TW8B 4IF6A 5B2EA 1X8XA 1PFYA 2YNMA 3ORSA 2CXPA 4BXFA 4Q34A 2ZSHB 2ELHA 2HRBA 3AEUB 4RDHA 4F11A 4D9JA 5JS6A 5HRCA 2D7CA 2Z3ZA 3RYRA 2EZTA 2TCTA 2VQSA 2HF9A 1XZIA 5EP2A 5J4VA 3CUSA 2FPLA 3H36A 4ZYGA 3HKCA 3O8QB 4PSAA 4QU5A 2X7JA 3MWJA 4HH4A 4UBKA 5EE5B 1G21B 1XDUA 1BI3A 3LM8A 1WUIS 4NVRA 2BGIA 4W99A 2IP2A 1EWYA 2PT7A 3NYQA 4G7OF 2WHRA 2YXLA 3BGSA 4JUDX 3PPVA 3DW1X 3OZFA 5LPNA 4WZBE 1WI3A 3T3IA 4I0WB 3RS3A 5AW9A 3L5KA 2FSIA 1A8IA 4WZAA 4ND6A 1KSGA 4BO7A 4ZI7A 2OLEA 4Z4CA 3CNNA 4PUSA 1DIOB 1XXHB 3CMCO 3DE7X 2CUJA 1XZJA 5IRCD 3S14J 1U8ZA 2H5EA 3W5UA 2FWJA 2Z5UA 2QAIA 3V34A 1BR4A 4PYIA 5C8YB 1PTJA 3I4MJ 1DV1A 1WMEA 2VOPA 3OYFA 2BHNA 2DCMA 2Y67A 3DCJA 2A7QA 4DC9A 4F3YA 4KN7X 1JDTA 1SXJC 1U6GA 4RCVA 4IVRA 2MSLA 1RESA 4HX4A 3II6X 4QQ8A 1NVEA 1T9KA 3KFXA 3OYLA 4LNUA 3ROUA 2QKLB 2EYQA 2PU7A 3MWKA 4INPA 5CVIA 2VP5A 1GL6A 2QE7D 1J2TA 3DGEC 1P1CA 5DCMA 1ZN2A 1UOEA 1E1RA 2VH2A 1DO8A 1MO2A 2A5JA 3ZXXA 4MHGA 4D42A 1SBYA 2TS1A 1FYWA 1UR5A 1H1LA 2YINC 1U7DA 1B8OA 3GWGA 5HM8A 2IIPA 2BBTA 1LFDB 4B3CA 1DRWA 2QTCA 4GPD1 4KGDA 3S7TA 1CVLA 5AJUA 4O4IF 4WNYA 2NNWB 3BRWA 4KV9A 1JR6A 3IKTA 4OTZA 5DCUA 2FJPA 2FX0A 1TA4A 4W8HA 3C87A 4FQ5A 2GEBA 3A3PA 3QUSA 1HW1A 4N76A 2MIIA 2DPXA 2PZKA 2Q5FA 4B3MB 1Q50A 1TO1E 3P9YA 4KXWA 4L2IA 5E3IA 1CE8B 4RSMA 1R6BX 2XE6A 3B6JA 2ZVDA 3WIDA 3KSDO 1ZK3A 3JD1A 3D1NI 3UAOA 2JLRA 4GXTA 4CFYA 1DS6A 3WHPA 1LD3A 5DDGA 3K6GA 1N0HA 4LXUA 3RG2A 2I8CA 1U2SA 2DUWA 2WHPB 1TVCA 5E4YA 5CYVA 1RRJA 4NU5A 1YG2A 1DELA 1OC4A 1OFIA 1I3MA 1PK8A 4FILA 4YEDA 3LFUA 5CLHA 4ENMA 5KZMB 1PX2A 4X8OA 2PS9A 1DAMA 1JT2A 1QO9A 2NU7B 4RYDA 4IRHA 3DE5X 3M4NA 4YMIA 1RW4A 5JJCA 1BX0A 4HDRB 1V4NA 1EA5A 3G82C 3WGMA 3CG4A 4ETWA 5K05A 2E21A 3QMMA 2FUNB 2VSOA 3GO4A 3C4VA 2XTMA 3WFZA 4EA8A 3HWWA 2PYIA 4LJSA 3COSA 4C4SA 1HLDA 1B00A 1SR8A 2H3HA 2Z3VA 3EVAA 4YIFA 3PVCA 3QWHA 4U63A 2Q7DA 5JFGA 3RYCA 1G1MA 2XZTA 4B7XA 1W5CC 1P4XA 5KNCA 2OHXA 4JNKA 2IZZA 3B3AA 1L8LA 3I01M 3KKZA 4WOCA 3COAC 5DF1A 5I45A 2C95A 2O61A 2IGMA 1NW5A 3FOBA 4E6PA 5F1OA 5JI3E 3KETA 4CMKA 2WD7A 2WB2A 4QXOA 4TRNA 3UR3C 1F6DA 3WTVC