3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
2FNAA 4PCLA 3BWGA 1TQIA 3PFGA 1H0MA 2PFBA 1VE3A 2PX4A 3QRFF 1INLA 1SFEA 4HV5A 2F5CA 2ZWAA 4R79A 3V97A 2ZKZA 2LKPA 1V3FA 1ZG3A 5L3GA 2CGPA 1XXLA 1ODDA 1EJ6A 1LVAA 1BI1A 2ZSUA 3SVZA 5K09A 2HTSA 3KQQA 3VFZA 3UBTA 2ZFWA 4GYIA 4D0PA 3CDHA 3P9NA 5DD8A 1OMIA 2VODA 2RKHA 4RVDA 2V79A 3GWZA 3QAHA 5GWXA 1EG2A 1I6XA 1IXRC 3NEUA 5FWAA 2H6CA 1IRFA 2DO7A 2PQ8A 1U2WA 1MJBA 1IXSB 2EFNA 3BJ6A 5BPIA 4YFKF 1M6YA 4RB3C 4FT4A 5T67A 1H9GA 4P9UA 1GHCA 3B5IA 5EEGA 4DQ2A 5D8LB 5BPDA 3KQPA 3SM3A 4U7DA 2IVMA 3ANXA 2M30A 2ZMEA 1YLFA 4GYGA 4EV0A 3RIEA 2ZBPA 2MH9A 2WK1A 2HTJA 4DA4A 1R1TA 4M38A 2QM3A 3P9CA 3UA3A 1XGMA 2P5VA 5AONA 2HGCA 1T6SA 3CO6C 3BOQA 3WGHA 3HRUA 3ORHA 5E8RA 3GZ5A 2EFJA 4XUDA 2QY6A 3CVOA 3BUSA 2EG5A 2K27A 2P6SA 2VZ9A 4PWYA 2A3SA 4YV1A 3FZVA 1DCTA 4BYYA 2ZNYA 5EVJA 1VBFA 5BP7A 4EM2A 1DPRA 1XDSA 2HYGD 2IH4A 5E1XA 3W6JB 5HDNA 5K5RA 4PGHA 5FHQA 4LLNA 3B02A 4OQDA 5E9QA 1YW7A 1JQEA 2PKWA 4FZVA 5EPEA 2NXCA 1KQ9A 1YIOA 5DM4A 1XN7A 4EKGA 1FSEA 2KIFA 4WX9A 4XUCA 3TR6A 4KA4A 3LFKA 4KNYA 3ELYA 3U9GA 3GVAA 4LGWA 3ML6A 3O6BB 2BR4A 3HSRA 3OE4A 1MDMB 3LAPA 3UJ7A 2BEOA 5LHIA 3COAC 5EEHA 4PYMA 3R61A 2PGXA 3T7RA 2ETHA 4RGUA 3KQYA 3UJAA 3KP6A 1ONVA 2HR1A 1U5TB 3OU6A 2ACJA 4P55A 1KR5A 2GA1A 1BI0A 2ZIEA 2OA4A 4XUEA 1JTFA 4HSGA 3UJ6A 2PXCA 3IWFA 4YIIA 5EKUA 2G7HA 2VBWA 4M71A 2EWNA 3ZN1A 3RDIA 1S7AA 5CVIA 3L09A 2GLUA 5CCBA 5EHIA 5HIKA 4LK0F 5CJ9A 2MC3A 4ZYEA 4P9FA 3DXXA 5EZSA 4ENMA 5HS9A 3I54A 4DMGA 1Z1DA 1YQAA 3EEYA 1F3LA 1HW1A 2VBYA 3D5LA 1BM9A 1YW9A 5EZQA 3KR0A 2ZXJA 1KQ0A 2ADUA 3LHDA 5E2AA 2Q8KA 2LDUA 3KP7A 4KIFA 4IHSA 1JGSA 4XRFA 1WSUA 3L8DA 1RUNA 4LK1F 2KW5A 1HQCA 4HV6A 1KPGA 3BGVA 3ISPA 4GOMD 4RTQA 4F86A 1UFMA 5CD1A 1NW5A 5K0EA 3IYLW 1J0RA 3G3ZA 5HS7A 4PONA 1F5TA 4Y2HA 5HIMA 2OD5A 3WGIA 1N2XA 1AQJA 1R1UA 3F23A 3GRRA 5DTMA 5F64A 2JG3A 1Y0UA 4MEXF 5DD4A 1I27A 2F5FA 4ENKA 2Y1WA 3PLAE 3K1MA 4KUMA 5E8GA 2QE6A 4A6DA 4G8XA 5LEJA 1U8RA 3F72A 2QYOA 2PBFA 1QANA 1I9GA 3E3VA 5EC8A 4FR0A 4I0BA 4EJTA 2PJPA 2BYVE 5M5BA 2KIUA 3VEPA 3OZTA 3GXOA 3A25A 2Z9OA 3S2WA 2B25A 3TQSA 1O3RA 2JT1A 2H94A 2XGXA 2ZBRA 1BIBA 2GAFA 6PAXA 3LCVB 5CM2Z 1LDKB 3E5XA 4PIMA 4YG2F 3BGDA 2XV4S 1RI2A 5MHTA 2YR0A 3PFIA 2PVCA 3EQLF 4PYLA 5HDKA 4U7BA 5D4SA 4LG0B 2M1BA 1K79A 1KU2A 5EMLA 3TRKA 3LAJA 3FRHA 2NNYA 4GOND 2K7LA 4EJVA 4OIOF 2PSSA 4RX1A 1ON2A 3R60A 5GOZA 1V39A 1UB9A 1KYZA 4LMYA 3FTEA 2IA1A 4GC5A 4ESFA 4E2YA 2CSOA 4HTFB 4LJZF 4RVGA 3B73A 3UJ8A 3ECOA 1Z3CA 3GF2A 1LDJA 1XMKA 4QTUB 1SUSA 4RTOA 2G1PA 1QYRA 3T1BA 1ON1A 3KZYA 4BHPA 3UFBA 2QRVA 1MZBA 1AOYA 3L00A 2DK8A 1LDDA 2ZNZA 4GXOA 4L9NA 4KN7X 4P5OA 1FOKA 2VT3A 1USSA 5EIWA 1M6EX 1CF7A 3TKYA 3DEUA 2FSWA 2IW5A 5EMJA 1RI4A 2GPYA 7MHTA 2ISZA 1K7AA 1QNTA 2OY0A 5DUIA 4ON0A 1J75A 4WXHA 5D8KB 3FTDA 3ZN0A 2STTA 4G9YA 5EG5A 5HIIA 2EK5A 2GA2A 1WXXA 4PGGA 1P4AA 5E20A 4OA5A 5T6BA 3LA2A 1R23A 4X41A 4Q48A 2A5YB 4LG1A 4L9VA 4HBLA 3I59B 2J5OA 2M45A 4BLUA 2P8TA 2AS5F 1W5SA 5DTQA 3I5UA 5DYMA 3A7EA 2EV5A 4I09A 3SX0A 5DX0A 2OXTA 2AOWA 4LB6B 2I9KA 1TQMA 3WU1B 3M6UA 2L01A 1YTYA 1S6LA 1ZKDA 3HM2A 4LECA 1K78A 1ZG5A 2FBIA 2Q0OA 4M6YA 4ENJA 2PBIA 1ZARA 4U7TB 2L02A 4C4AA 5LQAA 1TPYA 3BY6A 4IXAA 3SMQA 3EGIA 1BBYA 2Y75A 3FYDA 4F84A 2CMHA 3P97A 3RYRA 3ECHA 3G73A 1UCRA 3WU0A 4OX9Y 4B8XA 1BC7C 2QWWA 2X0LA 5DM1A 2ADMA 4N9HA 5LQKA 5FB2A 1JQDA 5FFZA 5IKMA 1OKRA 2FU4A 5DPMA 2AOUB 4RTSA 3J80K 1ULYA 4LWPA 4E33A 5E1MA 3QU6A 1AQIA 1YZHA 3DTNA 1YO5C 4R6WA 3DMGA 5K0CA 4IV0A 1ZREA 3T0IA 1NT2A 2FBHA 2UYQA 2HS5A 5LQUA 3E6MA 2UYCA 1BOOA 3ELDA 5JUWA 4IWNA 5D6EA 3C0KA 2RVCA 1R1VA 1R7JA 4A5NA 4Y15A 2Z3YA 5LGUA 3HCCA 2HKOA 2C7RA 2FMYA 4KIGA 2F5EA 1SQFA 2YX4A 4UV9A 4OQEA 2R7DA 3NW9A 5FGMA 3E23A 2C7OA 3PQKA 4QPPA 1U6GA 1W5TA 1NKVA 4PIPA 4PDKA 3G2QA 3CUQC 2O0YA 3HSFA 1RI7A 1AF7A 4HC4A 4YUWA 3FPHA 4CKBA 2GH1A 2BE5F 2CYYA 3KQVA 3MZHA 3THSA 3GRVA 1DP7P 3FMSA 3I64A 3W6KB 4UOEA 2K4BA 4CXMA 1F1ZA 1G8SA 2FCAA 5LRSA 5J8FA 2VXZA 2IPXA 1OR7A 3IKTA 1LJ9A 3E7PA 1I1GA 3BZ6A 3CKKA 1L3CA 1S29A 3HRMA 4JQFA 3FPEA 5DEQA 2A6HF 2IJLA 3FXRA 2AZTA 2M5WA 1Z91A 3MGGA 4YMGA 4IKPA 5E9WA 3TO6A 2UYOA 4BHCA 4KYWA 5DRYA 2IH5A 3HOSA 4YUYA 4I2OA 4OMYA 1VQ1A 4PYQA 3TPZA 3HTXA 1VTNC 2IDKA 3LDFA 4A0ZA 3EVEA 2EFPA 2H00A 4RTMA 1R18A 4ZYGA 3JW4A 3F22A 2IBTA 4A0YA 3K0BA 3THRA 1YG2A 3WTVC 2ZW9A 4HQEA 5FD5A 1R36A 3DUWA 4DQ0A 2HV9A 5FLXZ 3ZMTA 4K6MA 4EGZA 3DMFA 4KT5C 1B59A 4CHUA 5LHGA 2HYFA 3TM4A 4HLXA 1R8XA 1T43A 1FT9A 1HKTA 5LQJA 3P2EA 4AWXB 4WWCA 2NXEA 3GX4X 5KQRA 3LGAA 5KVAA 2IPQX 2UXNA 3FUUA 1R5HA 4FT2A 3BDDA 3U81A 4MTEA 1MGTA 4NQWA 3LX6A 4PYIA 2MBFA 2XKPA 2NYUA 2BR3A 3LCUA 5D5XB 2AOTA 4KDPA 5B1SA 3J7AO 1REPC 4P7FA 4M72A 2M87A 1WI9A 3JWHA 2P35A 3NTVA 3B3FA 3TDZC 3FYCA 1D2HA 2P3LA 4BP3A 4E2ZA 2DI3A 1DPUA 3HA5A 4UVAA 3T7TA 2IT0A 3HRSA 2MA3A 5G02A 1NW3A 3ERCA 1TLHB 4CTKA 2LF8A 3I9FA 3N97A 4GQBA 3P9KA 2ZFUA 5K01A 3K1PA 4M74A 3C7JA 4M9ZA 4FP9A 1KGSA 1XJ5A 4E30A 1WRJA 1XSDA 4L5IA 5FD6A 2Z5UA 4LB5A 1ZGJA 4L9TA 9MHTA 4RWZA 2B3TA 2HR3A 5FO5A 3T7SA 2P6TA 2OYRA 4BHBA 3KQSA 1WQ2A 2COMA 2IIPA 2CW0F 4F7ZA 2O6GE 5BQTA 1KXZA 4BQAA 5ICGA 4M9XA 4QTTB 3LKZA 2HFHA 3IEIA 4AD9A 3GU3A 1BIAA 3E6CC 3FPGA 3L2CA 2P7HA 5LBQA 3HVIA 1LB2A 2DULA 4GC9A 3F8NA 3EGVA 3HCEA 1A04A 3AWIA 1G6NA 5K0FA 5IT3A 5E1WA 1L9KA 4F85A 1MJAA 2CKDA 1QO0D 2P5KA 2JHAA 3H2BA 1HBXG 4IRGA 2P41A 1QAOA 1IF1A 3M33A 2CWWA 4RTRA 1FBNA 2AOXA 4A0XA 3OFKA 5K8VA 3QPTA 2MLKA 3FRIA 3PX3A 4KMUX 1QAMA 2A14A 1WKMA 5A2QK 3FUWA 3P9IA 3MZYA 4MTDA 2JRTA 3Q87B 2ZVJA 3O31A 3OU7A 4KDCA 1F38A 2EX4A 2TDXA 4UXNA 2I7CA 3DOUA 4CWAA 3R24A 5C9ZA 2V1UA 2G70A 3FMQA 1JHHA 1SFXA 1W7PD 4AZTA 5C1IA 4PZJA 2DPMA 1G3WA 4Z2YA 3ZQ7A 3ELUA 4RS8A 3HA7A 3LWFA 3DF8A 2GA9A 5LEKA 3O4FA 5K0JA 5ILUA 2YX1A 4YFNF 4XLPF 2W57A 3WTUC 1EAMA 3L7WA 1OYWA 5DCMA 1WG8A 1ZQ9A 4ER0A 2XKOA 2AN5A 1O57A 4Y17A 2IA2A 1EV7A 2KJCA 3BPXA 3QP6A 4RB1A 2Y1XA 1FYKA 3H92A 2ONZA 4C08A 2KKOA 2PXAA 2G71A 2YTZA 4CKEA 4TV7A 1QZZA 2VP3A 2ZCJA 3QU3A 1V4RA 3EVGA 4ER3A 2Y48A 1WWXA 4HX7A 3R0AA 1QBJA 2PY6A 2VDUE 2XAFA 3A7DA 1S3JA 2ESRA 1QZYA 5D4RA 2OAZA 3KLOA 2ZLBA 3C3YA 1FZPB 3EGEA 3KPYA 4GF5A 2OPBA 2CL5A 4DKJA 2PX2A 1AV6A 1ZRCA 1FYLA 1W7PB 2R3SA 1HKQA 4IPAA 1ZAOA 2MD5A 3LBYA 3KEQA 2VE9A 4DCGA 2VS1A 5GP1A 1TQPA 2DAOA 1PP8F 3G7UA 3E8SA 5L3FA 5EQJB 3ELWA 3KPUA 2ZCWA 2Z33A 3G88A 2WV0A 4QWQA 1IN7A 1JQ3A 1NV9A 4U88A 8MHTA 1EH6A 2EJRA 2QBYA 2DPDA 3FTCA 1O9GA 4GUAA 3ME5A 4HAMA 1ZRDA 4DM3A 3UZUA 4PCAA 4I02A 4FGZA 2B78A 2XVCA 4ZZDA 3UA4A 1P92A 4I7HA 2GS9A 2UZKA 1RJEA 2XBMA 1HMYA 2O06A 2HWVA 3EDPA 4BNCA 3C6MA 2A6EF 3V8JA 3R9XB 4UNOA 2H1RA 4OMZA 3T0YA 3WTXC 4M37A 4HZFA 3EVCA 3CUQA 2IP2A 2CG4A 3D0SA 5LQNA 4AIJA 2DQRA 3K0LA 1UIRA 4ER6A 1KU7A 5K0BA 2FK8A 2NXJA 3OZRA 5DTRA 5EKXA 2XHKA 1MD0A 4HF2A 3CBGA 2EFOA 5CIYA 4X63A 1M0EA 2XYQA 4U0VA 3D2LA 3HOTA 3JWIA 1L3LA 5DCFA 2YPRA 4FT8A 2ERCA 1YS6A 3UJBA 3HSEA 1TNTA 1T38A 2BM9A 2W25A 2LF7A 2ESNA 5FWDA 4WCGA 2PI0A 1XCJA 5H6QA 1IRGA 3TOSA 1BI3A 2RDPA 1FC3A 1R74A 1Q0SA 3I53A 2G7UA 3DXZA 1EH8A 1P6RA 4RTKA 3MTIA 2NP6A 1Z7UA 3SQNA 1ZG1A 3DULA 4PYOA 5HDGA 3CJTA 5ED4A 1LQ1A 2WWYA 1JHFA 2DBBA 2GAUA 4L5JA 2C6YA 1FYMA 2N47A 5D5WB 2GZWA 5CUQA 2XASA 4AIKA 2L4MA 5D1NA 3WGGA 2D1VA 2JHPA 1STZA 1LNWA 1JR4A 2ZULA 2HZTA 2EJUA 2P7CB 3BXOA 4Q47A 1T0FA 3CC8A 1Q0TA 5FCDA 4BXUA 3FTFA 3N4MA 5DT2A 4B17A 4HG2A 3LQRA 4Q5SF 2EV6A 2RNJA 4ZZLA 5DWQA 3KR2A 4P96A 4CGZA 2LNBA 1KU3A 1SMYF 2H11A 1S8NA 3FMRA 5E8IA 3F8MA 4ZTBA 3GFIA 3WTSC 2PT9A 3BROA 3ZP5A 2GB4A 3HP7A 2HNKA 5GINE 5KYGA 3RYPA 5F6FA 3QOXA 3ERED 3GIWA 4IRHA 3MAJA 5DXAA 5HLGA 2IGTA 3CJQA 3TQNA 2QUFA 3VODA 5JHUA 4BH9A 5HIJA 3VSEA 2QVOA 3Q5FA 3M9AA 3KU1A 3UJCA 5HFJA 4RTPA 2VONA 1OYIA 3TLJA 1XD7A 4G56A 4U7PB 4YUZA 3IKVA 2QZ8A 4HOBA 1L3IA 3MWMA 3GFMA 2PX5A 1P39A 1MJFA 3CJNA 3JWGA 2H6BA 3U1DA 2DU9A 3RPUA 3LKDA 5T64A 1YB2A 2FMLA 1FBQA 4PYKA 2FOKA 2FXAA 2V9VA 1BI2A 5LR6A 4GEKA 5FHRA 1MJ9A 5K0NA 2PN6A 3F8CA 1IZ1A 4UVCA 2CWEA 3JAMK 2AOVA 4ER7A 5ICCA 3DMHA 2QQBA 5ERGB 3BT7A 3CUOA 3O3KA 3BGIA 2R6ZA 10MHA 2J5PA 4L0ZB 2ZIFA 3G5LA 5HS8A 1RIOH 2E1NA 4X60A 5DX1A 3EPPA 3BJAA 3HYIA 4LLGF 3CO7C 2BBYA 2ONYA 3R6SA 2YU3A 2YXLA 1Q1HA 1SD6A 3DPTA 3DV8A 2WA1A 3DQVC 2Z6AA 3FUVA 2Q41A 3KP4A 3P2IA 3NDIA 3C3WA 2UXXA 5D5UB 1LEAA 1O3QA 3KETA 5D1HA 2JZYA 1DL5A 2EB7A 2DFIA 1SD5A 3OPNA 5JI6A 2PLYA 4KIBA 5ILVA 5LQRA 3IHTA 4QQKA 1MDMA 4X61A 3E6DA 2PV0A 5LGNA 1WY7A 3KZZA 1U5TA 3KPVA 2Z99A 5EMMA 2VOOA 1S7OA 5LRRA 5U4XA 3KCCA 1HW2A 2OQRA 1YYVA 3M6VA 1TTYA 4ETSA 2HQRA 1JG3A 4GOLD 5CYVA 1QQIA 1I1NA 3O2PE 3SR4A 3K1NA 3OCJA 3ER9A 3T5XA 3V7RA 3DLIA 4EGYA 4AUKA 1BOAA 2PG4A 4KW7A 2JH8A 2IA0A 3K6RA 1SKMA 2V7EA 4CDGA 5EHGA 3SXJA 3HHGA 3FPFA 4R8SA 3NDJA 1YFJA 2P3QA 3EVZA 5EOVA 4HW0A 1O3SA 4P7JA 3J80Z 3EUHA 2D45A 3G89A 1R58A 3M7GA 5BS6A 2VT2A 3PFHA 3KKZA 1EJ0A 5CVEA 2F2EA 4MHGA 2L4AA 3M70A 4S04A 5FA5A 1KU9A 3K2ZA 5ILSA 2RGVA 3GFJA 4L0YB 4ISCA 4E31A 2F8LA 4UHTA 1G4DA 3E6BA 2ZMEB 1DUXC 3HVHA 5C0OE 4RTLA 3BWBA 3I0TA 3BWMA 1G6Q1 3RTRA 3EYIA 3EVBA 3P2KA 3DKWA 1I5ZA 1FNNA 4CICA 3JSOA 1ZH5A 2E5WA 1IXKA 1LEBA 1FX7A 2L3DA 5GIOE 4KDRA 3GRUA 1D2GA 3OZSA 1E2XA 3PS9A 1RI5A 5TJJA 3HVKA 1YFHA 1ZLJA 3J81K 2FF4A 3FM5A 4FSXA 3EVFA 2A61A 4RAYA 1XSVA 2AN4A 3X0DA 3BJOA 1O7LA 4MQ4A 1IUYA 4FS8A 5DM0A 1QPMA 1B4AA 2OZVA 5H6RA 2EV0A 2BM8A 2XROA 2PJDA 1B1BA 2GQQA 3I71A 1R00A 1NV8A 3HCFA 3Q9VA 2EFWA 5JFRA 4G6DA 2ORED 2K4MA 4HRAA 2ESHA 3KEOA 3V8KA 2NNNA 1SAXA 3EMBA 4RVFA 4EJWA 4LG0A 2OZ6A 5IT9K 5ERIA 3LCCA 4EQZA 2QQAA 3DPLC 5DRTA 3B3JA 3QOWA 3FXQA 5ICFA 3M8FA 3MTEA 1T2KA 3BKWA 1B42A 4OA8A 2BV6A 2BGCA 4WXDA 2UWMA 1KPHA 5H02A 4HDVA 3R3HA 5E17F 2ZWVA 4CXFA 3M6WA 4HTFA 2UZ4A 3ROUA 3G5TA 2Z6QA 5E9JA 2RV8A 3EVAA 1HXDA 1GXPA 2OZUA 2PXXA 2XVMA 3GUDA 2WTEA 4MQ9F 1FLIA 3GNLA 2V6CA 1JG4A 3A26A 4JXJA 1O7FA 1IXCA 1G3YA 1Z05A 2W85A 3R4KA 1O3TA 5CVUA 5J6XA 4O29A 2E1CA 1HW5A 3HTUA 3FPJA 4HF1A 1XMAA 2GXBA 1JSXA 3LBFA 5AIQA 4I01A 1IM8A 4FSDA 3HA3A 2ZBQA 4WXCA 3V4GA 1UFKA 2IDJA 1R6AA 1N7IA 2KIMA 4CYDA 3F4KA 2DW4A 4PYJA 3RPQA 1MKMA 3BPVA 3FWEA 4AZWA 2ZZMA 3QV2A 3OOPA 4N0BA 5HOOA 3LDUA 1P1CA 2I62A 5EIFA 4OINF 5FULA 3SXYA 1HSTA 1SUIA 3SSMA 3VC1A 3I59A 2JJQA 3HVJA 1XGSA 2HKXA 4Q4ZF 3SZTA 3R0QA 1CGPA 3MFKA 2P3OA 1XDUA 3AXTA 2OO3A 4MTLA 3SGLA 1BHJA 1J7KA 4N9IA 3M4XA 2F5DA 4OOIA 4QPNA 3MCZA 3FHZA 1ZLKA 3KP3A 2GWRA 1JXSA 3R6TA 3L9FA 3IRQA 3T8TA 1K6OA 1YS7A 4QLCU 2V74B 3KQWA 4KRGA 3GEZA 4M36A 3CTAA 4ESBA 1DDNA 5E8JA 1U3EM 5E2BA 4L9JA 2HQNA 1XTPA 2K86A 1KP9A 3REOA 3H3UA 4BY9E 1B9MA 4MQVA 4AIHA 4EM0B 4YV2A 3JTGA 3DP7A 4UUVA 3FX3A 5GIPE 5KVRA 2ZBKA 1NE2A 2YUIA 5BW5A 3TKAA 2VDWA 5BMZA 1PRYA 5E1ZB 1VLMA 1VIDA 4HYEA 1J59A 2CO5A 2BH2A 3KP2A 4IVNA 3A4TA 4HX4A 1L3BA 2GIVA 4GGGA 3TMAA 2EJTA 3VB2A 4OBWA 2AOUA 5CCXA 2UYHA 3SFZA 3E05A 4IJAA 5L3DA 2STWA 2JPCA 4L7VA 2A68F 1U5TC 5DUKA 2YVLA 3MAGA 2VOPA 3VC2A 4C05A 1P1BA 2MH2A 4OIRF 4PCQA 1T39A 4EJUA 5K05A 4GO1A 3CLOA 4ZYDA 2IRFG 2QENA 1IW7F 3FUXA 3EETA 1L1EA 2NAZA 5P8WA 4ZYHA 5DLYA 4PINA 2QRVB 3NWEA 2VBXA 2ELHA 2IBSA 4KFCA 1VP3A 1J5YA 3C3PA 5A2QZ 2HOEA 1BC5A 3ZMDA 4RYLA 4R6XA 1CF7B 1HNNA 1XCVA 4M73A 3V7CA 1D3YA 5CVJA 5HLHA 4I98B 5DXJA 3UWPA 3ELKA 4S05A 1QAQA 2V1XA 3HUGA 2P7IA 3UJ9A 2XAGA 1SD7A 5FQOA 2D1HA 4OIQF 4DCMA 4XSZF 1ZHFA 3GYHX 2XVAA 4H0NA 5DM2A 3ZPLA 1G3SA 3TO7A 2FRHA 3KFWX 2XRNA 3G2OA 4G7ZF 1XDZA 3TFWA 4G6QA 3IL2A 5BOXA 2AVNA 2OBFA 1IN5A 2O57A 2C7PA 4EK9A 1P4WA 4ATNA 2PT6A 3MCTA 2P5LC 2BR5A 1YFLA 2JPBA 2H27A 1PUEE 3WODF 2G9WA 4MEYF 4M9SA 4E70A 1K78B 3NMUF 3HIFA 4QDKA 1RI1A 2PLWA 5HZMA 3WTTC 2M8EA 3QOPA 2ZJ2A 2FPOA 1X1AA 1RJGA 3GO5A 5LLQA 3Q7EA 3P8ZA 5HOQA 1X19A 4XSXF 5DV5A 1PP7U 2JH9A 3TOBA 1ORIA 1JTEA 5FA8A 4CKCA 3SSNA 3K69A 2AXLA 5LQCA 3OFJA 2DT5A 3GCZA 1XCBA 1J9IA 3G2PA 1C0WA 3KLNA 4UVBA 2DQLA 2VBZA 4RAZA 1PDNC 2QLZA 4GBED 4R05A 2E7WA 3BKXA 2HTEA 1NHAA 1T98A 1ORHA 4NECA 1B9NA 4MGRA 3WE3A 4Y13A 5L3CA 1KIAA 1PJZA 3FF5A 4IF4A 1JE8A 4H0EA 3SZPA 2OU2A 4KMFA 3RJPA 5F2OA 1VP9A 3HCAA 2KRFA 3MQ0A 2PMUA 2PWYA 4KVZA 3M8EA 3HTSB 3MEXA 1ZYRF 2FYTA 2P40A 4A5MA 2DLLA 4GOOD 1BJAA 2XUBA 3E5UA 5HLIA 4QVKA 2OB1A 2WA2A 2FK7A 4R1HA 1KYWA 1KPIA 5DX8A 1Z9CA 3RKYA 1D8JA 4XLNF 3GRZA 2X4HA 3TO9A 2FA5A 2YXEA 3QPHA 4G94A 4RGXA 1BC8C 2FRXA 4IV8A 3NVKI 4RV9A 5HVQC 2H09A 5KK1A 1P4XA 1DUSA 5IH3A 1G8AA 1F4KA 3V7SA 1R5GA 1OYYA 4HX8A 3S68A 4KN4X 1XGNA 5LHHA 2O07A 2VDVE 1U78A 1G55A 4CZZA 3MQ2A 1R22A 2AS0A 2A07F 4YMHA 3KP5A 4BLVA 3HHHA 3V8LA 2VE8A 4B09A 4WVLA 1BN5A 5HEKA 3DR5A 5FFXA 1Y8CA 4OBXA 1RJDA 3GGDA 3C18A 3IRRA 3ZMSA 3RW9A 5LSAA 3GZ6A 4XBFA 3EMDA 1RZ4A 3MHTA 1G60A 1IN4A 4HH4A 4PYNA 1ZRFA 1XVAA 2PX8A 3GFLA 5L3BA 2CMGA 4ESJA 1FPQA 5KS2A 2W24A 5BXYA 1G3TA 2IFTA 4AVPA 2AN3A 1WZNA 4C04A 3I58A 1JG1A 4MIKA 3ABTA 2CQKA 4P7KA 2XAHA 2EA4A 1Z6TA 5JR3A 2LD4A 2P7VB 3OV8A 2OKCA 3RIRA 3NWBA 3C1DA 2YSRA 1E17A 2C7QA 3ABUA 4WK8F 3B3GA 2JSCA 2W84A 3KR9A 4EVIA 1IY9A 1SVUA 3IV6A 4HGZA 2XIGA 5DSTA 4ASNA 2MLGA 3CGGA 3E5QA 4CO8A 1TBXA 4WF2A 2YQZA 4CTJA 2WC2A 1I4WA 3O7WA 3DH0A 2HDCA 1D2CA 4C07A 2FQ3A 5K0LA 3OU2A 4P58A 1FY7A 1USTA 3HNRA 3IWZA 3EYYA 5J8CA 4JK1X 4A6EA 2O0LA 3BZBA 4O6JA 4YV0A 2FEZA 4RTJA 2ZZNA 2XAJA 3G8AA 4HA8A 4AX8A 2PEXA 5TRDA 4R8HA 2AOTB 1X1BA 3DLCA 4K2EA 4HDUA 2RN7A 5LGTA 1Z6RA 2XYVA 2AVDA 3HEMA 4GCVA 2ISYA 4OIPF 4JBAA 3Q9SA 2G72A 1ZGAA 3WSTA 2QQ9A 4BAYA 2FNPA 1OR8A 1RNLA 2A69F 4O5VA 2RC4A 4P7GA 1O9HA 4LWOA 5K0GA 3CCFA 4A12A 1ZN2A 1I1SA 1KA8A 2Q2EA 5CVDA 5F2KA 1KHHA 3FXUA 3GDHA 2B0LA 4RB2C 3LPMA 3NVMB 1FJXA 4DZRA 3JAMZ 2Y0MA 3M1EA 3RI4A 5E1BA 1TNSA 4L18B 4NB5A 1NW7A 2O03A 1X1DA 2NNWB 2L54A 1NW8A 1EIZA 3B7PA 2GXGA 4ZH4F 2NXNA 4KICA 4RGSA 5EMKA 4YUVA 5FQNA 1B6AA 4DNCA 4BP1A 1SD4A 3G2MA 3PT9A 4YUXA 4IRIA 3GRYA 2FHPA 1W7PA 1RJFA 3NRVA 3ZMZA 3AAFA 3KQTA 3DXJF 2ZO4A 5JVTA 1GXQA 1IN8A 3VOEA 1SMTA 5DDGA 5E1DA 1NBIA 1FWZA 3F8BA 3IC7A 2OBPA 4FX0A 4QVGA 2O3FA 2V1DA 3JTHA 2NP7A 4HLYA 4Y30A 1FP1D 1HSJA 2O8XA 2CFXA 4A2UA 3WTWC 5CVRA 3LDGA 2ZTHA 5L3EA 5DSXA 5K5OA 1JSZA 3K9TA 2R7FA 3HRTA 3LSTA 3GLXA 1N7JA 3EVDA 3T8RA 3KE2A 2FE3A 2VC1A 1XGOA 2HEOA 4C03A 4E2WA 3F8FA 5FADA 3WE2A 2LSOA 4YFXF 1JG2A 5D6FA 3SHFA 2NRAC 5CVVA 3RKWA 2G8NA 3FM3A 1YF3A 3BWYA 2DTRA 3TGNA 5F1RA 1H1DA 4MNUA 4BLWA 1UHMA 4M6XA 3R0JA 4XCXA 2O61A 2FBKA 3IHUA 3RKXA 1SG9A 4RGRA 2ZIGA 3WG9A 1NBHA 3PX2A 2Z6UA 2YR2A 1FBUA 4HF0A 4EM1A 3HCBA 3LECA 4E32A 4UV8A 5K03A 3M6XA 3LA7A 4FX4A 1VL5A 3LA3A 5HILA 3CJRA 1W4MA 1H9TA 1D5VA 2ZZKA 2HWKA 3V8VA 2EA2A 5DCMB 2XYRA 5BW4A 1WS6A 4C06A 3PTAA 2OQGA 1SFUA 4FHTA 3TM5A 3AXSA 1X3UA 3SSOA 4R8RA 1XCLA 3KPWA 2OB2A 2IH2A 4IHTA 1FP2A 3U2RA 2I6GA 2RQPA 3TOAA 1YUBA 2K02A 3F21A 2JHCA 5AIPA 4M7RA 3AY0A 1XB4A 3UJDA 1MHTA 3ER8A 2D2WA 3RODA 3I4PA 1UWVA 1O54A 5H20A 4RVHA 1NW6A 5E18F 2BZGA 3FUTA 1J2XA 5FTWA 3AJDA 3WTYC 1UHWA 2DK5A 3J81Z 3QP5A 5ICEA 2VN2A 1QGPA 1AWCA 3EEOA 5FLXK 3GO4A 3KR1A 1EH7A 5F2NA 4MHTA 4LFUA 4EQQA 4NHJA 1WXWA 3KHKA 4V0RA 3GW2A 4QDJA 2B2CA 3MB5A 3ZMVA 1FSHA 4LD5A 2YX7A 3PQJA 3PVCA 1U2ZA 4EKIA 2DPUA 2QBYB 3B89A 5IT9Z 2P1DA 5K5QA 3HCDA 3BP8A 5EGSA 3NQOA 3ZMUA 3OE5A 1L0OC 4PNEA 2E7XA 1GVJA 2K4JA 5D5VB 1FBSA 4EMSA 3JSPA 4ENNA 2YXDA 3GJYA 1IAWA 3FZGA 4RSRA 3VYWA 1G38A 3TDUC 3F6VA 4EJOA 1F9NA 4KWCA 2EFQA 3P7NA 4DF3A 3LQQA 5CLSA 1P2FA 1SQGA 3LL7A 4ER5A 3A27A 3KQMA 4LLLA 1IN6A 1RI3A 3F6OA 2NYXA 3MERA 3CUQB 3PB3A 1D8KA 4G7HF 1EQAA 5E1OA 5GM1A 3BWCA 2O05A 5K1YA 4G7OF 3H3ZA 2PMHA 4E2XA 4POOA 2P4WA 3ID6C 4MWZA 1RUOA 3KPJA 1TW2A 4U0YA 5FUBA 2XAQA 3KQOA 3ULQB 4U0WA 4V0QA 4RTNA 2AR0A 3E97A 3G8BA 4HGYA 3C6KA 3DFGA 4AZSA 3F3XA 5KQSA 1R8YA 5GM2A 1XSXA 3WTZA 2PWPA 4RB0A 2P8JA 1VPTA 1X1CA 1TW3A 4I0AA 3P71T 2VC0A 2NS0A 1KQ8A 4QQNA 1BKYA 2JTVA 4YIFA 1P91A 1YZ3A 4X1OA 3NJRA 2KJBA 4AZVA 4OU0A 2B9EA 4O3MA 1YW8A 2HMYB 1HKSA 4HQMA 3DXYA 1OPCA 3JWJA
chains in the Genus database with same CATH superfamily
4BQNA 5MN6A 1PVDA 5DSZA 4IEEA 1ECPA 1INLA 4YRDA 1A71A 1Y8QA 5AK3A 4OLJA 3GMIA 1LD3A 4FW8A 2PGDA 5EL0A 3KYDB 5U4QA 4Y9SA 2ZIXA 3L92A 5MFZA 4PRLA 3NV7A 1Z37A 4ZARA 5GPBA 5KIAA 2YWBA 5GWXA 2GZHA 2IU6A 3WYFA 2HXGA 4F5ZA 1QKJA 3PNSA 1OKKD 4WFIA 3CEJA 2HRBA 1MMFB 2K9MA 5T67A 1RLJA 1S3FA 5JQGB 3LWZA 1QC5B 1VRWA 3SM3A 4ZHSA 1SU4A 2GYVA 1Z47A 1TLFA 2ZYAA 5BYKA 5I4IA 5J59A 3HR4A 1TF2A 2A0XA 4EJSA 4G8DA 5DTEA 4TL7A 5JNLA 3C3BA 2FUKA 4D25A 3M3HA 1HRKA 1OH5A 1VBFA 4E7OA 1WB4A 1G0OA 3RKSA 3QOYA 2VHJA 4RDCA 1CDDA 3DE1X 1U2DA 3OQPA 1D2RA 2PKEA 4AUMA 2ZBUA 2PAAA 2XCUA 3E48A 1PG0A 3UJ7A 2P68A 2GF0A 1NMSA 3EXG1 4Z0PA 1M1NA 1ONVA 2R7VA 1IAQA 3RVJA 1DZIA 2EJVA 4O0MA 4A93J 2GA1A 2VP0A 3A6ZA 3M81A 2IGOA 2WM8A 4AK9A 4Z7JA 2VBWA 3ZX5A 4TQGA 3L09A 2E9SA 5HIKA 1QIKA 3WHIA 1IQUA 1RPNA 4PX3A 5HS9A 4GBGA 5K6TA 5FUVA 3COSA 1WRBA 1P9LA 4C01A 3U7EB 1H2ZA 5K3FA 2LDUA 1DXHA 4W6ZA 4NG5A 1RHKA 4JX8A 2X3UA 3BGVA 1T0HB 4V1CA 3HR7A 3IYLW 4TWJA 4BRWA 2E48A 5B2ZA 2LWIA 4UU1A 1N2XA 4CODB 3EZXA 1L5MA 1Y0UA 3G82C 2G88A 2V4MA 2XH8A 5AKXA 1HETA 2G5GX 4AXXA 2XKJE 1QANA 3Q8WA 4AVYA 1JRLA 3OUZA 3ZI4A 1KWGA 1PEKE 3A25A 3LOPA 3DMRA 5AH0A 4EW3A 3SWWA 2IHUA 4Z4CA 2OC6A 1QFMA 4ECEA 2PVCA 1BN7A 1HG0A 4U7BA 3TW8B 4RDXA 3TRKA 3GJ8A 5AM1A 2K7LA 2BFCB 1GVHA 2B4QA 5KEIA 4EJVA 2EV9A 3TRFA 2IYWA 4LRXA 3GNSA 1ONPA 5CLQA 1QB8A 3MNFA 4AG5A 4LNUB 2JIMA 4M1KA 4OREX 5M34A 4QBTA 1SHTX 3DV9A 1ON1A 3AY7A 1GLVA 3Q11A 3L77A 3C6XA 4GXQA 4HYYA 1MZBA 3V4PB 4TN1A 4DWVA 4P5OA 2VT3A 1B7GO 1USSA 4IIJF 3RVPA 2JCBA 3MJFA 1M34A 2VZ0A 3DUFB 3MEQA 1GM5A 3NIDB 3KSRA 2AXPA 2YZGA 1V8OA 2GPAA 5JSKA 4JHXA 5B55A 3I59B 1U7WA 4H3KB 4N39A 4YCBA 3DOCA 5JVGF 2PFKA 1FMTA 3P5BA 1KAGA 3ANYB 4Q1VA 3O8QA 4DW6A 1SQ0A 1AVTA 2QUAA 5H2FC 5HZKA 2GILA 3K9CA 3ZLJA 1KYTA 3AL2A 4RJLA 3PFCA 4HAYA 5B5EC 1XNQB 3TDNA 4NC7A 3GTJJ 4QPOA 2HQOA 3NBFA 2GPBA 3ZLTA 3M1AA 3KDAA 5K9ZA 2Q0HA 4LZJA 2LREA 1AQIA 1MH1A 1L5LA 3WLPA 4OAYA 3RAGA 5JZVA 3EHEA 2X77A 4IXTA 5LQUA 3VR5A 2LV8A 5I9NA 2JFNA 4JKIA 2Q5JA 3ST7A 1BOOA 5JUWA 2Y0SN 2YFKA 3HL4A 4RXUA 5EWJB 3WLAA 3INRA 1MB4A 3ADBA 4ZU1X 4UY8I 3FWZA 3F7NA 2QD5A 2O7VA 3PLRA 4ZEWA 3HSFA 3C3XA 1TYCA 2LY1A 1ILEA 3ONFA 1V4BA 4P38A 4KVFA 1V1MB 2BF4A 1MIJA 3PYMA 1BQ3A 5K45A 1SK9A 4O08A 2X8JA 3TX6A 1Z8FA 4NDLA 3AESB 3Q2OA 1FFXB 1ZJYA 2GI4A 4N4NB 1E3PA 2QUZA 3BZ6A 3CMYA 4FYYA 1K63A 3E9ZA 4IHXA 3EWSA 3F5DA 1P1RA 3CF5F 2VJOA 5LZ9A 1VQ1A 1OXMA 1EVJA 3UT5A 1GFIA 1GGFA 3K0BA 4CKCB 4ZAYA 2JIPA 3UV6A 1R36A 1BXRB 3VKHA 2HQ1A 4B4DA 2Z3ZA 4D46A 1G5QA 3LT2A 1CYDA 3URKA 2PKCA 4U9IS 4XW2A 3MQFA 1DJPA 3U4HA 2M1ZA 3L7NA 1YBVA 3W6ZA 3LCUA 3QLUA 4TLEA 2GXUA 1DAIA 4WFQA 1YRBA 1NYLA 1PG5A 4LJ9A 5GZ3A 3B9QA 4DCTA 2ATIA 4HLNA 4QRHA 2DE0X 3C6YA 2YFYA 3I9FA 5JYBA 3ZGZA 2ON6A 2GHQA 1KIMA 1AQUA 4L0QA 2B3TA 4TT8A 2QNIA 3PF8A 3FNGA 2WUGA 5A4DA 3UUFA 2YWHA 4M9XA 5J2TA 5I7OA 2XNCA 2PMZN 1NW4A 4PJ0C 2CSUA 2DHEA 4GQIA 2NOJB 1DDGA 3EGVA 3MOSA 3HWSA 5GJCA 3F0CA 2X0NA 2J08A 2FJ0A 4MWSA 3L2RA 1G8JA 1FYWA 3TVDA 3NWOA 1RC9A 4TM8A 4JEUA 4RTRA 3QPVA 4A0XA 3EZNA 3DBLA 3FUWA 4P92A 1JEYB 3P9IA 4QHYA 2I7CA 5HJ5A 1VRCA 4GNKA 1X8JA 5AW6A 1JHHA 1OAOA 3PPIA 1UDCA 3WRYC 4Z2YA 4ACAA 2QMZA 5K7SA 4ZOEA 3HA7A 1VIMA 3LWFA 4N18A 2HU7A 3WIDA 4IJ5A 2KT0A 1WG8A 1W9MA 3RSSA 1SU7A 3QH4A 1KONA 1DZ3A 3BMXA 1VJ0A 2QSHX 3TK1A 4PBSA 5FPHA 3IOCA 2G71A 2YTZA 5DM70 4ZDLA 1S7GA 3F6PA 5JD3A 2OAZA 4H27A 2FQ1A 3NXKA 1Z35A 2CL5A 4JT8A 3TMOA 1ZXXA 2B1QA 4QEZA 4P93A 2HZBA 4CEJA 3RYFA 2HU2A 1PP8F 5JNSA 4GI7A 2ZUCA 1R8QA 3ICEA 3O0TA 4EEFG 1GG5A 1K7SN 3A6JA 4M2LA 4C0SA 1O6ZA 2C96A 1SXPA 4K7JA 4ZZDA 1R5OA 3FOAA 2R48A 3FYSA 4OB7A 4AWXA 3DE0X 3HU5A 3FE2A 4UPVA 1WSWA 4OFBA 3IJRA 1N75A 3D3WA 1VKZA 3ETLA 3SIRA 1G8XA 1PBTA 3K4MA 1C3EA 1VSUA 3TJZA 5B7PA 4XGQA 1MD0A 3H8JA 1K5PA 4X63A 2W4QA 2LPMA 2F3RA 2XLCA 3QXSA 4H1TA 5D6NA 4FT8A 3K2BA 5CDFA 3CW9A 2LKCA 2NU6A 3RYIB 4ZANA 1G19A 2V3CC 2R7SA 3TOSA 3BD8A 1E2NA 4Q24A 5ESWA 2C42A 4RTKA 4XGKA 1X8XA 3SQNA 1UKYA 4XQEA 5BN1A 1OWPA 2DBYA 2GAUA 1XWIA 5KHOC 5CUQA 3QE0A 4RNCA 2JCGA 1LNWA 1X3LA 1GYPA 2XDYA 2G9ZA 1Y6QA 3A01A 3SEFA 3N8DA 3N4MA 2EQAA 1KU3A 1SMYF 3KAJA 2RDMA 4GSLA 3DU6A 2HNKA 1PR0A 4X94A 4O2BA 2MYPA 1VQ4I 4EUEA 3UH1A 1FLNA 5LZ5A 2JZCA 4MR7A 3UXMA 3DCJA 1XNGA 4HXEB 3GLHB 1UFOA 3KSAC 2HDWA 1U04A 3GFMA 2QTAA 4Z9BA 2CJFA 4ML3A 4UTPA 2YUSA 5T7BA 5DVZA 1SURA 4F72A 3BZWA 4CMKA 5TGTA 2GBLA 3JAMK 1ZOIA 2HXIA 3W6VA 2GM5A 5A71A 3C2HA 1RZ3A 4BO1A 1ULTA 4RK1A 2LR0A 4DGSA 5L40A 3KL4A 1I0LA 2XUDA 1ZMTA 5T4HA 1JKOC 2YXLA 1F7VA 3D3EA 3FHLA 1ZH6A 2L9VA 5IYCJ 5D1HA 3KYIB 2Z9CA 4GI1A 3OPNA 5JI6A 2GPNA 2IXSA 3EG9B 1L7DA 1P33A 4EZIA 4NENB 5K7ZA 4OK6A 1XZPA 4MGHA 5CYVA 3FTPA 1PLKA 1PDWA 3GTQJ 1YDFA 5BQ5A 4R3UC 2JIQA 4L5YA 3AR4A 3VNRA 5GVRA 2DEUA 4V24A 4O4LB 2DA5A 3TLCA 4A2WA 1DU4A 4MAMA 2X8WA 3DVAA 4DAOA 1A8QA 1PVOA 3HPRA 1Q84A 2ACEA 3PFHA 4D4GA 2GBYA 1H94A 3QPAA 4A8JB 3T1TA 4MHGA 2R4TA 4BUZA 3CH4B 1VYTA 3GB9A 2FZCA 3I0NA 2B1RA 2FB9A 1VGVA 2ZMEB 3ENKA 2BY1A 1UZCA 3UYLA 1JQKA 1G6Q1 2FPGA 4X1KB 3G79A 1VG8A 1OVMA 2E5WA 2BHYA 1B72A 3BDAA 3VXKA 4NU0A 3J81K 2GFIA 2ZXUA 4DPKA 4K40A 2A3RA 3SEQA 3S28A 4OHPA 3ROKA 5BWCA 5EYPB 1B1BA 3P32A 3V8KA 2NNNA 2A9RA 4O1MA 2QQAA 2RGWA 3H5LA 3B3JA 3OF2A 1ZCAA 2VUHB 2ZYWX 3GZ4A 5HQJA 3CVUA 3AILA 1VZ3A 4WDQA 3ICOA 3WGLA 2Z6QA 3HKZA 1PTJA 4Q5IA 3LUFA 4MQ9F 8ABPA 1NA5A 2V8BA 3FPJA 2H2AA 3IS3A 2YV2A 3B5EA 1B0PA 3LLSA 4WXCA 1RMTA 3KZIC 3H7AA 4U2EA 1Q7TA 4M3FA 2VKTA 2DJIA 1GSHA 4LDNA 1ZA2A 4HNSA 2ZREA 5IYBJ 5EIFA 3PEWA 4CUJA 2J0SA 3BR2A 1QF9A 5F5NA 1QVTA 2JJQA 3GJXC 1E9AA 3KPHA 3HR8A 2LE0A 5KTRA 2IS6A 4Q3BA 3B6AA 1QS0B 2QU8A 2ZJFA 5JI2E 2C2ZA 2DQYA 1TJ3A 4BU2A 4V0OA 3HY6A 3H2JA 4MYRA 1ND5A 5C4IA 1B9MA 4JOCA 2JI8A 3IB3A 4UUVA 1BAPA 1FOEB 1GT6A 2RC6A 3ZIDA 2C2WA 3F5MA 1Z7GA 1KORA 3B9PA 4KBGA 3F5QA 3IUNA 2AHQA 3HLYA 3K09C 4CCNA 3TDKA 1RWOA 3E61A 2VOPA 4J0FA 1T39A 1FJLA 4RA9A 4AX4A 2WKSA 5FPQA 3IRUA 2QRVB 3DEHA 4BAZA 4I8XA 3V7CA 3HJAA 1I7NA 3R0VA 1V1JA 2PDAA 3OYKA 2L7FP 1CQPA 2B36A 1VHDA 1W36D 5IULC 1Q0RA 5AICA 4G4GA 4XSZF 4U0JA 1XD2A 2FGKA 4FCVA 3E2PA 4PG6A 3N2KB 4GW3A 3CMAI 1QVRA 3FETA 3ANTA 4ATNA 2UVPB 2HB6A 4TYPA 5DCUA 2IC5A 1OXTA 1W4AA 2F1JA 1MCZA 2X9GA 4G0WA 3W6OA 2R47A 3BPSA 2P2ZA 2DPHA 5CFPA 1AMOA 2BRUA 3CPSA 4M8IA 1NZJA 4YI5A 1RP7A 4XB1A 3L4BC 2FZ5A 1L4YA 2CYCA 5CT6A 1U80A 4UTXA 4MYTA 1RM5A 3KQLA 2DT5A 1XCBA 3KOXA 1DIOB 4AY3A 3NWSA 3FHJA 5KC8A 1ZA1A 3HBAA 1XQYA 5TF4A 6YASA 4AUEA 1EP9A 2Z95A 1WO8A 3VR1A 4QXMA 5KU7A 2BKAA 2IX3A 1ZK3A 2VT7A 3HCAA 3WZ2A 4IJUA 1RM3A 2VJLA 5TS3A 2FYTA 1AD2A 1LBSA 2JFVA 2DLLA 4RLHA 4GOOD 3GPLA 1YD7A 4D3DA 5KVVA 2W6ZA 4WCFB 1XA0A 1KYWA 4ENQA 1JTVA 1Z9CA 4PK4A 1ZBQA 3TG8A 4C3VA 2I91A 3KUKA 2HXSA 3OOWA 5JCXA 3ZCTA 5FOQA 1W46A 3DE6X 2ZXWH 4RLQA 4D5GA 5KK1A 3IAXA 2O8BB 4F2PA 3MKWB 1V5EA 3GLGB 1FFWA 2X15A 3MTGA 4DG5A 1J8VA 4KQHA 1KK2A 3IA2A 4JLAA 1VZ2A 3QXCA 3DLTA 4R5HA 3CVJA 4BLVA 7REQA 4XKCA 4US1R 1KVQA 2ZK7A 4ZOLA 1J9GA 5IY5H 2AR9A 3M3DA 2WU8A 1TM2A 3QLJA 4TYYA 4H3VA 3QTLA 4UASA 3DEZA 5H9WA 2NVOA 1Z0SA 1WV0A 3RU7A 4EY3A 2N9UA 1A9XA 1HDXA 4QM7A 3GF4A 2W71A 2BFFB 4ESJA 1FPQA 3FVRA 3CYFA 3DB2A 2ZRGA 4P7KA 1Z6TA 3AVOA 4A3IJ 4PQEA 3H86A 1N1MA 2P7VB 4EO9A 3DM5A 1VKRA 3GYBA 5HUJA 1QRUA 4FGSA 3ZU4A 3B3GA 3S3OA 3IV6A 2VBIA 2QQ8A 4CKWA 4EI7A 5K8CA 2D00A 3K8OE 2EG9A 5HVNA 2ZG6A 4AY5A 2I1WA 1Z3IX 1OH6A 3C4VA 2WFMA 3NZEA 3B8EA 3GN1A 1VJRA 1UKZA 3HEMA 2ZQYA 2DT7B 3NHAA 3WSTA 2RC4A 4P86A 3NT4A 4RB2C 1BQ4A 4L8VA 3RI4A 2I8DA 4DTCA 3QVXA 2NXNA 4LJYA 5BMVA 5LMNB 3WGVA 4W6QA 5AIBA 1XZKA 3D3QA 2WD8A 2FUNB 2BKLA 3AJ8A 3ZMZA 3FIJA 3SJCA 4XRSG 3VOEA 3WR5A 1J56A 2V1DA 3JTHA 3LSPA 4BNUA 4A92A 4H60A 4JX5A 4U2KA 2Q46A 3FNEA 1RVV1 3A1EA 4XA8A 1QPGA 3PDHA 3QV1A 4LY3A 4PC6A 3CBQA 4PR0A 4XR4A 1G20A 2QGFA 3KUXA 1GGHA 5D6FA 2RAEA 5CVVA 3S1RJ 1P5JA 3MGCA 4Z6YA 4I3GA 3STVA 4ZTFA 4BLWA 4Z4FA 2XRFA 2Z09A 4AMYA 2NSHA 2ZIGA 3QLTA 3RARA 2D6FA 2VHZA 2JA7J 4TV9F 5J63A 5ALWA 1UJMA 4UB6C 4KSCA 4N9QA 5AVXA 3V8VA 1E0JA 5AVQA 1NVGA 1SFUA 4E15A 1DS6A 1OLSA 4IHTA 3BK2A 3X1JA 3SI7A 2QIOA 4KLRA 2RQPA 4FXPA 3BMQA 1C41A 4M9UA 3TWOA 1BXGA 2X8AA 3Q9LA 3KYJB 1J2XA 2QDXA 1X6VA 3WTYC 5L6MB 1CRLA 3EEOA 5FLXK 1WI3A 4A03A 3ZUPA 3N2EA 1R3DA 2J9GA 5GTIC 3MB5A 2EYUA 3AI7A 2YY7A 4GRIA 4XKBA 1KDRA 2OLKA 3VBEA 3R1IA 4KFTA 3K9BA 2G4LA 4ENNA 5J2TF 4ZREA 4TS4A 2Z4RA 3TDUC 4KQIA 3P7NA 1QHGA 1DKUA 3RRYA 4XIFA 1WPRA 1TVEA 2P4UA 4MZDA 3AHCA 2ZYTX 4PRYA 2B6NA 2NYXA 3NOQA 3CNBA 1AMNA 1IN1A 4BY1J 2Q07A 5K6RA 4BFXA 4WNYA 3I2KA 1P5RA 4IUCS 1N0IA 2QRJA 3A6HA 1CF2O 4NU6A 4JA0A 1H88C 4DR7B 1OXUA 3CSSA 3JWPA 5DNAA 4X1OA 3KYBA 2H3EA 3O4JA 1E5LA 5JRJA 1YW8A 4AVZA 1AB6A 4ERXA 5F77A 1OPCA 4PCLA 2QU7A 2PUDA 1ZEMA 4EF5A 2F5CA 4R79A 2WSSA 1SBQA 1JHVA 5KOJB 1RC1A 5EF6A 5EQFA 2XQIA 4PVDA 3H36A 3E3LA 2B1JA 1Y33E 3HLTA 1BH2A 3FKSA 2C84A 3R9IA 3WIEA 1WXEA 2VAMA 5CNKA 2VODA 5HKKD 3EPJA 1UPBA 1E79A 1RT9A 4H18A 4I6JA 2X8LA 1EH5A 1T9KA 3CUEF 1QFZA 2MINA 2DQKA 3PNTA 3B5IA 1NC1A 2WJAA 1XEWY 2AFHE 2RAVA 2ZSIA 1YB4A 1Q0HA 3RIEA 3HFGA 2ZBPA 2DOKA 4I1SA 5AONA 1L7NA 5C53B 4A2QA 2JATA 2NU7A 2EFJA 2I8CA 2HJHA 4BJ6A 2VQDA 4DIEA 3OPQA 4XN3A 3BMNB 3DOOA 3UGJA 1USIA 1PZXA 4O25A 4C20A 2HQBA 3UUEA 2AG5A 1KMHB 4L5AA 5DM4A 3NEPX 2I2XB 4WOCA 1MOZA 2BR4A 1ETVA 2R6GA 5AR1A 2WYOA 2WSIA 2R8PA 1W19A 1KVSA 2NTNA 4BNIA 5HMLA 1VJ5A 3NTUA 2W90A 1Y1SA 4XGRA 2DFHA 2JZNA 4LK0F 4Q66C 4P9FA 2OAP1 4KQWA 3C4JA 4X8LA 4F4HA 3O26A 2E18A 4HFJA 3I54A 3ZNOA 1F3LA 2R5WA 3D7NA 3HJNA 3C2GA 2KS6A 4CIXA 1FSZA 5H3LA 4RM3A 2GZ2A 1KOJA 1ZOOA 1HDIA 3KSZO 4H7PA 3H5IA 4C3OB 4CF7A 4EVRA 1AKTA 3G3ZA 4HPJB 1F5TA 2BW0A 2CVOA 4PG7A 4QJIA 5KJFA 2JLXA 5REQB 2Q27A 2GFQA 3HHPA 1V2HE 5A06A 3ZCOA 4FR0A 2JBHA 3CPEA 1TIPA 2MSNA 3TBKA 2XGXA 1QMGA 4K0KB 5B6IA 3BB1A 1DQSA 3HP1A 2P9ZA 1XZJA 5LIRA 4YELA 3CC7I 2PS0A 4UXHA 5CTAA 1R9GA 3H1BA 2QYHA 3CX6A 4E22A 1KU2A 3O1IC 1NBOA 3UT6A 3JATB 2OGUA 4DPLA 2GVDC 2P9GA 3T4XA 1X39A 1HE1C 1ON2A 4GICA 3VPGA 3ZW7A 1LV7A 4LJ7A 2AJBA 3AM1A 4J7XA 1BG6A 3VU3A 1LDJA 4H9GA 5A1JA 4TPKA 2VDOB 4BHPA 2IHBA 1WW3A 4L9NA 4WV3A 1G6HA 2IW5A 1TMKA 3B2EA 2VTBB 2HY7A 5H82A 2ATVA 3GI1A 3PNVA 1SVSA 4QNRA 2OCKA 3O8OA 2PLFA 4G89A 3ZN0A 5K3AA 4EA7A 1JEAA 3LA2A 1R23A 3AF0A 2VSQA 4AAYA 2R7OA 3OR2C 1T8IA 4HBLA 2J3JA 4EAAA 4MEAA 5FLXA 4IKEA 2R85A 1G3UA 5LLSA 5KTPA 2Q3DA 1T0IA 2QZ4A 1A9YA 4ZQFA 2R8EA 4EGAA 4MYHA 3N2IA 3WK5A 3BD7A 2Z8ZA 4HYQA 3WWDA 1YTYA 3CLUC 4PZ0A 1K78A 2I33A 4YJ3B 1QCCA 1I2CA 1JJFA 2L02A 4C4AA 2DBZA 3JV7A 4WBSA 2G5CA 2ZAIA 3O95A 3AZQA 3H9GA 3HBFA 2WVGA 1NQTA 1NIJA 3I62A 1C50A 1XEXA 2FG6C 2F3PA 2I8AA 5MDHA 3Q7TA 4TQ9A 4RZ2A 4M9QA 4UXJA 5LBUA 3W3CA 1T8SA 2AOUB 3VPRA 4MQBA 4V1CI 1R5ID 5JD6A 1ETWA 1L4HA 2ZE6A 2BTEA 5ABPA 2UYQA 4I8DA 1Z0ZA 3VOSA 1DC3A 1UPXA 2RGGA 3QELA 4PBRA 2RVCA 2WKRA 4HDNB 1MPTA 2HKOA 3ZNPA 3WLQA 1PL7A 4CQMB 2FMYA 5FJ8J 3ASNH 1W2HA 3RNOA 4IHQA 3ZIAA 5IVIA 4B73A 1JI0A 1GU7A 3ILXA 3LCRA 1FOYA 2LD5A 4YMSA 4BRUA 4PO1A 4X7RA 5M04A 1PCXA 5AM0A 3JCUC 2UAGA 3BHJA 3FGNA 4EELA 3PKZA 3JSXA 1MRSA 2D3TA 3Q88A 1Z15A 2UYOA 1UWCA 2P6OA 4YUYA 1WVRA 2KMLA 3ZH2A 2OAEA 3ABMH 4A3BJ 4H4CA 1UPCA 3AG4H 1R18A 3JW4A 5DBOA 4LK2A 1M73E 1T3GA 1XTVA 4BVHA 4DSUA 1YA6A 3B1KA 1VI6A 2L18A 1K6XA 3FD8A 1KE1A 1PJ2A 3Q1LA 5SY4A 1R8XA 1WDKA 1WKBA 4AWXB 3BFVA 4Z7NB 1D6NA 2YY5A 1EK2A 4UXIA 3CP2A 1KMQA 2RGNA 3G13A 1KR2A 5AXCA 3H0EA 3ESCA 1ZC4A 5BW8A 1HBJA 3U1TA 1BU8A 2AOTA 2F6CA 3DZ8A 3J7AO 2QVCA 1VLVA 4KL8S 1SWWA 4PPFA 1WABA 1CJCA 2A9PA 2VWGA 2ZDQA 3N97A 2JCYA 4UUQA 1VJ1A 2OHFA 1RAFA 3UMGA 2IEGA 4GQAA 4BN5A 2NUAA 2RHCA 5DNUA 3ASVA 3G0GA 2P6TA 4RHUA 1WJFA 1LI7A 2D4HA 4FXOA 5LA6F 1NAHA 3S3MA 3CMCO 2CVFA 3FPGA 2P7HA 4ENRA 2MG4A 4F5YA 1QH1A 2GCGA 4CCWA 4WZAA 4RIFA 5F23A 3OMLA 2FUEA 4F85A 5CHYA 1QO0D 2AFIB 3Q7PA 2BUBA 1Q1QA 4RSHA 1PJ3A 4HLUA 3AEKA 2EEZA 3RU9A 1BOBA 3PX3A 1QAMA 5A2QK 3JR9A 4I66A 5JS2A 3JRWA 4AW9A 4UUNA 1B1CA 2ZVJA 4WDRA 5B57C 3DXFA 1X1SA 1IDOA 3CG4A 3JX9A 3V7WA 3RH0A 1HZZC 3ELUA 2EERA 1F0YA 2GPJA 3T9FA 1IRIA 2FSVC 1QIJA 3GLIB 5DCMA 3FCCA 3UGTA 2IA2A 1BROA 1EV7A 2XSZD 4RORA 1J25A 2X76A 4R0VA 3X1ZA 3BX1A 2Q2EB 2J9FA 3QKSB 2PY6A 2ZJ8A 2WAOA 2X6YA 3UKOA 4HK4A 5HJEA 3ITNA 2BMEA 4UQPA 3ER6A 1LDNA 4AP9A 4D92A 2EW2A 2HFJA 1F2DA 1NVAA 1Q1AA 4LYJA 2XJ9A 1ZAOA 2D3WA 2IXGA 2XIJA 3G88A 3G85A 5COAA 1W85A 1KI1A 3DPUA 2ZJ0A 4GUAA 3HL0A 1GAWA 5M3FJ 2D5VA 1TL7C 4ZOLF 4PCAA 3JQRA 5AI6A 1QYDA 3VU8A 5A5DA 1HMYA 3DVAB 4J91A 3DZGA 2H1RA 1U8ZA 3U40A 4YRSA 5F7JA 3NUGA 2BLNA 4C4SA 1RZVA 4YRBA 3BOSA 1YRWA 3HUEA 2CL0X 3ONEA 3MMNA 4QXAA 4AJ9A 2RNGA 3ZDAA 3P9RA 5JDIC 4R68A 1Q3HA 3LD9A 4PY2A 5NULA 3ETDA 4DSOA 4JYBA 3CG0A 2GZSA 1G9SA 4U6SA 4JT9A 5ULLA 2KZVA 1IRGA 5AHOA 1NR1A 1FC3A 1QGUA 4JI8B 4N7RA 1KYQA 1YTLA 4KN9S 1C9DB 3ZD7A 1H66A 3CJTA 4ZIRB 2DFFA 5CPRB 3NIFB 2GEDA 3IOEA 2DVMA 2R7TA 5DTJA 3ZNNA 2VJDA 1NHWA 5BSWA 4EPRA 1LY1A 1II8B 4IDGA 3EDYA 2R7UA 2ZULA 4LDPA 3I83A 5JAUA 1GARA 4PICA 5ESXA 3JQPA 4CTNA 2HT1A 5C1BA 1SCAA 2FW1A 3LQRA 2RARA 3KR2A 4EW1A 2PEYA 5TE9A 3L8EA 5BMVF 1A8PA 1GL7A 2QUKA 4BH9A 1IY0A 5LDDC 1XVVA 5EZYF 3NEAA 1X7WB 421PA 3OO0A 4PSWA 1UODA 4YUZA 1L3IA 1OHHA 2IYTA 1P7PA 1X9IA 3ZE7A 1J7JA 3CONA 2R4UA 1QZTA 3QUTA 2VJIA 4C5AA 4FHCA 5EINA 1YT5A 4C0WA 1NTCA 4TUYB 3HEBA 2WYHA 4UHKA 2J5PA 1XZMA 5KJ1A 1SCUA 1PO7A 2VI6A 1Z16A 3K0CA 1NM5C 2WIBA 1Z6GA 5DBHX 3ZGLA 3FWNA 2O2HA 1LEAA 1O3QA 2JZYA 4AC0A 2JI9A 1ZWLA 1SD5A 1EYZA 3TR5A 4JX6A 2Z4TA 4KXFB 1UK7A 3I52A 2K85A 5JSZB 1U5TA 1SD1A 5EHXA 3H0CA 3KVYA 4WH0A 3V9AA 4RJIA 4AUKA 4G41A 4TKZA 1Y6ZA 3FPFA 4S1VA 2P3QA 2Q4OA 2E1RA 3FYUC 3A4MA 4OMUA 5KTMA 2B20A 3H4TA 5H59A 5BS6A 1TEVA 3FR8A 4FX5A 1PDOA 1EJ0A 3DTVB 2F2EA 3SLKA 4UUTA 2AC7A 5EE0A 1FNNA 1HQKA 1XN1A 2Q1TA 3FJ1A 3FVWA 4I7EA 5HODA 2G0TA 2AJ8A 2W8ZA 1XSVA 4LGCA 4YGXB 4Q3OA 4AP6A 2ZRHA 3MJTA 3NAMA 1Z83A 4E11A 5FOSA 3TD9A 3ERMA 3E5NA 2K4MA 2CB9A 4TWZA 5HF6A 1RWMA 4OGLA 3BSYA 4RVFA 3LXXA 4RD0A 4LEIA 4CL0A 2BV6A 4Q9DA 5JCZA 1KPHA 4QU9A 2OTLI 4FNGA 1GNVA 1SKYE 2CLLB 1FLIA 2F1IA 2XMBA 2PO7A 2V6CA 4DBZA 1U63A 3AM5A 3HTUA 3ANSA 1LLFA 5KOYA 3KIOA 4CQLA 2BFMA 3ZD9A 2OMKA 2D74A 2OD7A 2D7CA 1UZUA 3ZWWA 1CY6A 1S7CA 3A3YA 3IVGA 1E98A 1N5MA 4OINF 4JJAA 1N2CE 3SXYA 4XJTA 1SUIA 3R0QA 4B6RA 4XJVA 4L0MA 3UHOA 2P3OA 5IAKA 4JL8A 3VHLB 1PKEA 3JYLA 4CUGA 1ECGA 3FOFC 4BGIA 2HO4A 4KISA 3I6BA 3T8TA 4M36A 3ZE6A 1GKKA 3QVJA 4E88A 1Y6JA 1Z39A 3KLPX 3ZHCA 1OROA 4AKSA 4Y33A 3FX3A 1A69A 1KZ6A 3RC3A 4PFOA 3SYTA 3H35A 4MKRA 2BEKA 1B1AA 3A1WA 4CW7A 3A4TA 2AK2A 3QVMA 2UUPA 4HVAA 4BEHA 3PRHA 1NRIA 2P9FA 1S96A 1XPOA 3EQ7A 5KNDD 2WAAA 5DUKA 3LV8A 2R1UA 3PITA 3L01A 4DEYA 2X7XA 2QTVA 2HU8A 1YL7A 1NBME 1B8IB 5D84A 3KQHA 4CKWB 5I9SA 4RYLA 3FKQA 1TQHA 3AM4A 3V8BA 4TZ6A 2A4MA 5IK2A 3HRHA 2QN8A 2TMYA 2FV8A 4BXOB 1KJNA 2PU7A 1JQAA 1AU9A 4L5EA 4ZO4A 1NMEA 4HDRA 2B92A 5FTKA 3IQZA 4D0LB 2XUJA 1U3TA 1EVQA 2UVQA 2UUCB 3H5RA 1YRQA 3NDPA 4HVLA 3DCFA 3O47A 4GXNA 2XJ4A 2X0JA 2ZUUA 4QZVA 4PNHA 1PUEE 3LKVA 1NC3A 2GRJA 3ZU6A 3W6UA 5IMBA 3SIXA 1ILWA 4E70A 1EM6A 2CSXA 1RI1A 4RKWA 5HZMA 3VWBA 2B8JA 1DAHA 1TC1A 3QPSA 5FR2A 2L0KA 1O95D 3GMSA 5SZJA 3PF9A 1ZZGA 4UNNA 2FGJA 3IUEA 1CY1A 1D1BA 1U31A 4EGFA 2R1VA 1RWKA 3N2GB 3CX3A 4IF4A 1JE8A 4H0EA 4QSMA 2E4AA 5KJCA 1XD8A 1ZH0A 4LOHA 1UDBA 4A6PA 2IYPA 5ILGA 1UOPA 1C3JA 4W5JA 4ZV7A 1QPIA 3ZC3A 1S02A 1SCKA 2WA2A 1M67A 4WADA 3AHJA 4G1EB 3GRZA 3DWFA 5K8TA 2PGJA 1LBHA 3G5UA 3U1BA 3ROQA 2FRXA 1PSDA 3VZSA 3GLQA 1LE8A 4IV8A 1UP7A 3H1PA 3LX5A 2I65A 3WA6A 4PZEA 5KTOA 1XRQA 3V7SA 1JDZA 2ELKA 1JBEA 1DKRA 2JI4A 3H3JA 2MSKA 3EGDB 5HEKA 3BMOA 2GWHA 2PZMA 2VWHA 4BQPA 3C18A 2CJPA 2CFIA 3TO5A 1GRCA 3WL6A 3QKIA 1RZ4A 3U3DA 1F0PA 1TM5E 2P4HX 3OYEA 4YREA 2R7RA 3T5CA 4HNAA 4BP9A 5FXMA 1IH8A 3DO5A 3OLCX 5EWMB 3FX2A 3SQWA 3AC0A 1CPYA 2ORYA 1MVOA 3DL4A 1MNAA 3ESRA 1V3QE 5AYVA 5AI9A 1U0NA 2FPXA 4DADA 3NWBA 1M8PA 3ABUA 2BFNA 2DFEA 4ZCPA 3Q5GA 1MQSA 2XIGA 2Y30A 3CGGA 3QMPA 4CO8A 1U5BB 4BO0A 1JTYA 3AVQA 3MWLA 2HDCA 4P22A 1FY7A 2HMTA 3QFSA 5TPZD 2EAUA 3E1GA 2JVIA 1K2VN 3JQAA 4XQ0A 2AF3C 4PAQA 4OIPF 2NV6A 4MMZB 3N2ZB 1I7QB 2C07A 4LWOA 1ZN2A 5I7EA 1I1SA 4XYLA 4V19K 4D0SA 4N82A 5ALOA 2YV3A 2Y0MA 1C0EA 1Z7LA 2GN4A 3I5YA 5A4AA 3S2HJ 5EMKA 4DNCA 3PHBE 1J00A 3E1KA 1NBIA 1L0BA 3TOXA 1Z67A 4FX0A 2AJCA 4JSYA 2O8XA 3OLXA 3ASUA 4RBOA 4EECA 1KI6A 4XLEA 1MZVA 2JGIA 3DJFA 1TL8A 4GWKA 3UPUA 4UEWA 1N7JA 4V0ME 3T8RA 3OQMA 3C6ZA 4DLRA 1DLIA 4Q37A 3IT3A 1NURA 3ZS9A 3OY2A 1FSSA 4YRCA 1CUWA 2OCLA 4HQOA 1N6RA 3DR3A 1RQGA 2AGVA 3H2YA 1CB0A 4YPFA 2RG1A 3LHKA 3R9KA 1ZD8A 1RYDA 3RTBA 3ZQIA 1X0XA 2WTAA 2XT6A 3GJSA 5JO0A 1G5HA 2OBMA 4RZIA 3FRJA 1YBMA 1MB9A 1D2MA 1A4XA 5AIPA 3UJDA 3E5RA 2CQ7A 5KSZA 3N2YA 5CYFA 3RTEA 5FKNA 1MKYA 5FNVF 4UUPA 3T41A 3I4PA 3IJPA 2BFDA 1KJ9A 3JQFC 4ZAXA 1USWA 3ENQA 1T0UA 3QU9A 4OUDA 3ABLH 4FOSA 1IXZA 1JMVA 3HCWA 5KNLA 3C48A 1VJDA 2J3MA 3LUCA 2MABA 4NBWA 2OCBA 2N0SA 4XLHA 4O2AF 3HB5X 2VF7A 5EGSA 3ZQHA 1L0OC 2WTMA 4G8JA 1BIFA 4LY9A 1IM5A 2V9CA 4TV9A 4HDKA 2P1ZA 1HA8A 1CUEA 4BNWA 1WMEA 4H1UA 1OI7A 4RVOA 4INZA 1W5BA 3CLRC 3U21A 2D13A 1EQAA 5GM1A 4JOQA 1TWFJ 4IOMA 3S29A 2C2KA 2VRBA 2LDXA 2PZBA 5LLDA 3T0FA 3RBAA 4LHVA 4BV2A 4U5XA 2OPTA 2F9FA 5TS2A 1NQOA 3KQOA 4V0QA 4ZMSA 1WXIA 2EQ5A 1W47A 4MWTA 4D6YA 5EJEA 4RB0A 2P8JA 1X1CA 1KQ8A 2R4QA 5EG0A 4DYHA 2NAPA 3HKDA 4Y7NJ 2GYUA 1ZXBA 4JFAA 4MDEA 3JQ8A 1K7CA 2HMYB 4MUNA 3F4BA 1A7UA 3K92A 4IBOA 2FR8A 5AK6A 1UBFA 3U4DA 3C14C 1U4OA 2O5CA 2EDCA 2XD9A 1VQNI 2LKPA 4XN0A 2UU9B 4CDMA 2AO9A 3VFZA 1UBMS 1ZNZA 3PD1A 5K6AC 4LS3A 4CCYB 5JNTA 1O97D 1H8EA 3L7JA 2BI8A 2V79A 4G5HA 4JGGA 2FZ4A 2H6CA 4FOPA 5BN5B 3DDNA 3EJWA 4BO8A 3VYTB 2IP4A 3LQ1A 2V65A 4E3ZA 3KJQA 3LBAA 2V5VA 1B8NA 4JN6B 1ZK2A 4AYWA 1ZELA 5DS9A 4MINA 2EP8A 4AC9A 4S0HB 3ES9A 1W5EA 2BGWA 4YV1A 2O3RA 1O95C 3EUFA 2BIFA 3IOYA 5K51A 2C8VA 4DNXA 2HMVA 3HJBA 3X2QH 4KA4A 3DHWC 3R20A 3GVAA 3F73A 5BVHB 5FLMJ 4L76A 4AYBN 1LRJA 4IIJB 1A2BA 1U0LA 3SQXA 4KPGA 4WEQA 4HSGA 1QP8A 2YJZA 4N5IX 4CJXA 3BTOA 1KFEB 4LVOA 4HT3B 3D6JA 3DM9B 2IHTA 3ZZMA 3MZ0A 4XDGA 1AA6A 4AY4A 2KL4A 3ESWB 2ORIA 5HJ7A 5E2AA 3FMVA 2W98A 4G1CA 2BI7A 1WSUA 3ZE9A 4D0RA 4LK1F 2KW5A 1M7HA 3WAGA 3F23A 3B36A 4GDFA 1DTEA 2DHQA 3PLAE 4R7TA 4UM5A 3RSGA 5EC8A 4QAJA 4AJKA 4JI5B 4IY1A 1O3RA 3V7FA 1BIBA 2WFLB 3SDZA 4ZQHA 3G4SI 1KEKA 4N9WA 1XLTA 3LVRE 5D4SA 4TLCA 4GYWA 4HEA1 1QBGA 1TVKA 1V39A 3H6HA 4BWVA 3D3KA 3LM8A 4UBNA 4LMYA 5C3UA 4ESFA 4M0DA 3IEMA 1PDVA 3W2FA 4YCCA 3NCTA 2G1PA 2WU3A 3KZYA 1XGKA 4XLAA 1HFWA 3H5TA 3OJXA 1Q3TA 5EIWA 2F1RA 2FSWA 1WF3A 5L3RA 3U3KA 4DLLA 4C5CA 5DW0A 2E7ZA 2GA2A 4PR3A 3WFIA 3W5SA 2ZITA 2A5YB 1AHNA 4EQ6A 3A1UA 3UPDA 2YCBA 3FXLA 4CCSA 4I50F 2EV5A 4XRGA 3LC0A 5I51A 4TWAA 4LB6B 2I9KA 5EGOB 1D7OA 4HO1X 2ZB4A 2W6NA 3DNPA 1W4ZA 3LJKA 3RR2A 5EHNA 3UBMA 4JYKA 2L69A 3BY6A 5I7VA 3I1JA 1MU0A 1UF9A 2XZOA 4NHEA 1JH8A 2RSLA 3T1YB 4G86A 2V0CA 2WSLA 1O0SA 1WXHA 1WBJB 3ZWPA 2UZ1A 1Z5ZA 1GKLA 4ZV9A 3FWHA 2AUTA 2E49A 1JFSA 4E33A 1ULYA 1YDGA 2V55B 3GY0A 4XPIB 4J0QA 7GPBA 1NRWA 1X3SA 4NMMA 1V4VA 1QFYA 3T0IA 1CZHA 4DIBA 5AO9A 4BQSA 3E6MA 1CUIA 3ZE0B 2LTPA 1JFFA 3SFTA 5JXIA 3BXGA 3SXUA 4CKXA 3KB1A 4JI1B 1Q6ZA 3A4LA 1DP4A 1X7YA 2WTXA 1HRDA 4AU7A 1CR6A 5BSGA 1FTNA 4FK8A 1HYEA 3QFRA 4ANFA 3NHMA 1N5RA 2QJOA 3AERA 1GDTA 3AK4A 1Q1VA 3BT9A 3RUEA 3ELBA 2O8VA 4HWSA 5MGNA 4BX3A 2Z5GA 3R8XA 4MKIA 4F6RB 5AD1A 2Y9YA 3IAS1 1JXQA 4BKOA 1JUDA 4DMCA 3E7PA 2EZTA 2E82A 4AJNA 2VJYA 5COQA 4AS2A 5E9WA 1XRLA 2ZJQF 2CBGA 2PX9A 1PUJA 4BFZA 1ZMOA 4B81A 1JDSA 1CUAA 1T6ZA 3I9NA 2Y1KA 3F67A 2FRVA 2NPFA 3PHGA 3QMMA 4HQEA 4P3YA 3DMFA 5SY9A 1G9TA 4W9RA 4NZNA 1OI2A 1XL1A 1FT9A 5LQJA 5EJGA 1DUVG 2A84A 3U5ZB 1BNCA 3RRFA 5TMBA 2XYHA 3FVTA 3CCBA 3WSVA 1JXAA 2VWQA 2NYUA 5B1SA 2M87A 2ISCA 1KAOA 1DSSG 4E2ZA 3H04A 3S14J 5CNIA 4EUFA 2MA3A 1QHFA 4DOZA 3W1EA 4HPWA 4R83A 2F4NA 4YO7A 3GPBA 3PGVA 4LYFA 4E30A 3W5VA 3BR6A 3CJTB 3DJYA 5FO5A 3KU4A 2OYRA 2IIPA 1J5EB 2CW0F 4F7ZA 4S24A 1X74A 4OHWA 2X8BA 2P5SA 3D0RA 5CDUA 3AVWA 3L7BA 1O97C 1J0CA 4YRQA 4LJRA 4BQRA 4ZALA 2M9MA 2TMGA 1QQ7A 3RLIA 2JHAA 3GVPA 5B12A 1RKQA 3H5VA 1H2FA 1HX7A 2ILTA 4J75A 1IQPA 2A58A 1HE3A 4ZVNA 1F38A 2TDXA 3H1FA 1H0RA 3GDOA 3N28A 2G70A 3AEQB 3K0AA 1W7PD 1PZFA 3GP8A 1JTXA 3MM4A 2CVZA 2CMDA 1OXKB 4YRJA 3C45A 1YU9A 2BE9A 4Y1GA 2GZMA 2G9RA 2RHRA 2FR0A 1A5ZA 5LA6A 4IIDA 4J0CA 2XKOA 4HRIA 1UDAA 4ZICA 5DWDA 2G07A 4L50A 2VP3A 1I6WA 3QU3A 3LY8A 3U7GA 2WY8Q 5HBGA 3ESBA 3OLVA 5EN4A 1QZYA 4UVDA 3A31A 4BQIA 4JXXA 2O7QA 2PPVA 1AV6A 4BJ1A 3AWDA 1FYLA 5B3SH 2JBAB 3OURA 3PSIA 3RPEA 2P4SA 3OEED 3C16C 3RC2A 2Y1FA 1T9GS 1CDEA 3B9BA 1NI5A 1IN7A 3EAFA 4HGQA 1EVZA 4MB2A 5EIAA 1GVDA 3GD5A 4PLZA 8MHTA 2DPDA 3ZBTA 2POCA 1WDWB 3FTQA 3DVRX 1QQ5A 2XVCA 1Y42X 1XTIA 3FGPA 4CYCB 4CG0A 3JAMA 1TWHJ 5FPPA 4H08A 2XBUA 3EH2A 3EVCA 1F0KA 1C30B 2DQRA 3K0LA 3T3NA 4CBVA 5DTRA 3WA7A 3MJHA 2WTUA 1D9ZA 2VJMB 3LOQA 4X54A 4XGNA 3HOTA 4MCJA 3R8CA 5JXGA 5JTUA 4Q4HB 4LQDA 2ESNA 2QVYX 4J1TA 2ZIWB 4LMRA 3A02A 1R74A 2VEDA 3ZHSA 2PMKA 3DBRB 5HDGA 1SXGA 4CIVA 1HEUA 4L5JA 3Q2IA 5D5WB 3QSYA 3U13A 3VHXB 3CESA 2GLOA 1E20A 2Q6LA 5AESA 1YZLA 4HF7A 4BGDA 3UMRA 1K6MA 2W7TA 3EQ9A 1VMIA 3CRZA 4XYMA 3ZV5A 1T0FA 5A4IS 3A1SA 4R1UA 1U9OA 4QJBA 4CFYA 5BYAA 3H8WA 5E6UB 5FRNA 2CWDA 4J90A 3WTSC 1JHDA 1QYWA 1SNYA 3W5DA 5JH7F 1T2FA 2BEVB 3CINA 4CU5A 1JHPA 1O6CA 1Z5GA 4K46A 1WEKA 4FWTA 5ALRA 1NK3P 1NLFA 1Q95A 2QG4A 4CLEA 4WOJA 2I4MA 1ACIA 3TRJA 1AKHA 4KAFA 3PQ2A 3ZDCA 2OG2A 5CMLA 2HLDA 1A5TA 3I3OA 4TRNA 5E3JA 4MP3A 1HPLA 1NUHA 3J81A 1D4ZA 3D2BA 1GDHA 3R7NA 2L19A 2I4OA 1FP7A 3FPCA 3OKAA 1KHTA 3G5LA 4A3KJ 2QSJA 4FLEA 4XIIA 3CD6I 1GUDA 3PU6A 1IY1A 5DI3B 3SF0A 3QW2A 1RW4A 5CGZA 4BY7J 3MB8A 4EEXA 2NS7A 4MUAA 5ANRB 5FKOA 3H4IA 1WHTA 1MO2A 3HSKA 3T3EA 3JYPA 3E1SA 1QH0A 5EZYA 5T6MA 1UKVY 4KO1S 3DTYA 5LBTA 1XU7A 2A1TR 2MU1A 2OSBA 3DMTC 4BEHB 4BE4A 3QE4A 1MAHA 5JY1A 2GO7A 1OI3A 1Y8QB 2XCIA 3CLUD 3L79A 3DLIA 2P6UA 4PCVA 2ZIXB 2JWTA 4CDGA 3R44A 5FBRB 4H16A 2AXQA 1ZC3A 4L4UA 1O3SA 1N1GA 1OCEA 3GEHA 3DTEA 4Z8XA 621PA 2Y05A 2VLIA 3AU8A 1TM3E 1YVEI 5M3MJ 2Y0PA 4B4VA 2VDLB 5FI5A 1WKVA 4IMRA 3OQOA 3TNDA 1NNLA 2NSDA 5I7WA 4P98A 4JI6B 3U3RA 2O1SA 2IEZA 1SVKA 3A1CA 3COWA 4EJSB 5KVQA 4KO8A 2B8EA 3PS9A 4B0OA 4RK6A 2R00C 3X0DA 3OCUA 3VNUA 4Q16A 2GN1A 1B4AA 1PK8A 2IQ5A 2VPLA 3DAGA 2VBCA 1R27A 7MDHA 4I46A 5LD2C 2QVXX 3W8FA 1TUBA 3ZQQA 5DRTA 4NATA 4YCDA 1BDHA 4ENPA 1OY1A 4M60A 4XGIA 1M1NB 2ECCA 3X1DA 3K9FC 1QKIA 1WVMA 5HPYB 3WLMA 1UBNA 2R0QC 4D5FA 4NLLA 3ROUA 3G5TA 4QUIA 1Q7BA 1CQZA 1T2CA 3PR1A 2RBKA 2R8ZA 1W1WA 2WF7A 1JG4A 2BKUA 2BV3A 3FPKA 2VB6A 3V4OA 3LNCA 3R77A 4JLPA 5BSUA 4BZWA 2AI2A 4IQJA 1GYQA 2DDAA 1D2AA 3B82A 3L40A 1N5LA 1JP7A 1EBFA 1NIPA 5K3FB 2XXAA 4LOCA 1KZYC 1T2DA 2VO1A 3KUCA 2G9QA 3VHQA 1DIRA 3GVHA 3M6FA 3LY9A 5TX7A 3LE8A 4V1CB 2J5KA 3B78A 4HJXA 5H5JA 2OHOA 4OSEA 5IMSA 1RAAA 4IJVA 3PR2B 2A7XA 2XMDA 3F8WA 1BEEA 3IRQA 3BORA 1YS7A 3LRXA 1W0CA 2OYSA 1T2VA 5EHZA 1FDOA 2P2NA 3G2KA 1JI8A 2A5LA 3BGWA 5L4SA 2QRMA 4EX7A 1TTTA 2FFJA 3FZQA 2CHQA 5GTHC 4Y6PA 5GIPE 2ZBKA 3E22A 1JGTA 2VDWA 3MQ4A 4HYEA 3Q8KA 1SZJG 1JDUA 2J30A 3HS3A 4L7VA 1L4MA 4IXWA 4NBUA 3ORQA 3T4UA 3TKLA 1BEUB 4H6PA 5ADHA 4EJUA 3U7RA 4L8YA 3FUXA 3NAQA 2H9AA 4II2A 1NF8A 1XA4A 2X58A 3TRDA 1E6LA 3G49A 4G0QA 2HOEA 3O03A 3WU2C 4TKVA 1M34B 4GVPA 4D8TA 5J5AA 3EXHA 1QAQA 1BR2A 1Z6XA 3MF4A 3LBHA 4LDJA 1DQPA 1QRRA 4L8WB 4Y3OA 5L8VA 2WINI 5DP2A 3DZHA 1WBBA 3ESXA 4BQQA 1XZEA 2XB6A 4UAVA 4HAVA 3FVVA 1SUAA 2ZIVB 4TMTA 4RHYA 1Z68A 2K6GA 3O8QB 1Y4SA 4YAUA 3IE1A 2HWWA 3KAPA 4LSMA 4Y9UA 3WMWA 4C1NA 1TT0A 4D4IA 4I5IA 1A9ZA 1ISMA 4JBWA 4TOIA 2HOTA 3X1MA 3H0GJ 3LUBA 1HEYA 4G0VA 1II9A 3K69A 3NBKA 1R6TA 3ZQJA 1PT6A 4OYYA 3ZQ4A 2A9KA 4BV8A 2HZDA 2REQA 1YCGA 3C7TA 1FFGA 5FLVA 4U6QA 3O8GA 3ZQ6A 4PG8A 2J6HA 4IZ6A 2W1OA 1T2UA 2OV1A 3ENWA 3BRCA 3RWBA 5EE3A 4B6QA 2CUZA 2P0EA 3TL3A 3UAVA 2AQEA 3RFCA 4PAGA 5B37A 2KPOA 5JJ5A 3LMMA 1VKJA 4N3NA 4AQYB 3AF6A 2RHMA 3R0IA 1E3WA 1ONSA 3LPAA 4OAZA 1J8FA 1N6PA 1QTIA 1DUSA 2ZJ1A 1TM4E 1NFRA 3A06A 3CRVA 3D5TA 2BJVA 2WHRA 2X8JB 1G55A 3OWTA 1ZMXA 3V8LA 1SA0A 4BKUA 3PIDA 4MDFA 5ADVA 3VFDA 3IRRA 1QP4A 1MRNA 2IYRA 2PBZA 1OBVA 3AJAA 5HP4A 2MJLA 1Z4NA 2Q29A 4HH4A 2GEJA 4GYYA 5LJLA 4FB5A 4TTIA 2QPLA 3I6YA 1RR7A 3ZDYB 2VAPA 3UT5B 2QP4A 5LWQA 3HV0A 7AT1A 4ZN6A 1B6TA 4GL4A 3TI9A 1MC8A 1RYEA 1DBRA 2Q2OA 1EQ2A 4TV9B 3UVEA 1E3TA 3RM3A 4WK8F 4JUCA 1SVUA 3PC8A 3IILA 1W0UA 3RUPA 4Q1BA 1TBXA 1G2IA 1KO7A 2DBRA 1VKHA 1JR3A 1T8TA 3ZX4A 1KRWA 4MQMA 4KQFA 4KQ9A 5TRDA 3FG9A 5LGTA 1FEXA 4R1OA 1K97A 1K5DA 1P0QA 1PE0A 3I56I 2WPDD 1YRNA 5K0GA 1GZUA 2YFQA 5F2KA 3F1LA 1OMOA 3CPHA 1FJXA 2C3OA</