3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
2ESHA 2MLGA 4WX9A 3PQJA 3G5TA 1FWZA 2QBYA 4RTSA 1SG9A 4ER5A 5F1RA 5EZSA 4QTUB 3EEOA 5CVDA 5TRDA 4ATNA 2EFPA 3B3JA 1IXCA 3DXYA 3I64A 4ENMA 3LCUA 1VPTA 3UA4A 1KQ8A 2OXTA 3DR5A 2JZYA 4PINA 2HMYB 4H0EA 2EV0A 4YUVA 2EWNA 1ZRCA 1UHMA 3WSTA 1JQ3A 3LPMA 2BE5F 4M9XA 1L3IA 2COMA 7MHTA 2QLZA 4ENNA 1VTNC 5LGTA 2HDCA 1OYYA 3THSA 1U6GA 4I09A 5LQCA 1G3TA 1Z6TA 3ER9A 2EB7A 3BP8A 5LQAA 2DT5A 1EG2A 1BN5A 4G9YA 2GAFA 4EK9A 1XSVA 2LDUA 5IT9Z 2A6EF 4P96A 1U2WA 4DMGA 1OYWA 1HSTA 2M8EA 3SM3A 1ZKDA 1R23A 2DO7A 5EKUA 5K03A 2VS1A 2VBZA 2ZNZA 3C3PA 5DSTA 1ONVA 3BY6A 1L0OC 3BZBA 1Y8CA 1SAXA 5EOVA 3KP2A 4LJZF 3OU7A 5E8JA 4MHTA 2JJQA 2HWVA 3LAJA 2KRFA 2DK5A 3I59A 3VODA 2IBSA 3U1DA 2FF4A 5FADA 2AN3A 2P7VB 3TDUC 1DUXC 3C7JA 3AXSA 3JAMK 3LDUA 3WTVC 1XCJA 2FBHA 3G8AA 1HQCA 5DXAA 2PJPA 1SMYF 3KQQA 2GA1A 1O3RA 1FBSA 2NAZA 3HVJA 4FHTA 5E1MA 2IH4A 3G88A 2AOUA 3VC2A 2O03A 2ZMEA 2ONYA 1YUBA 3GNLA 4PYQA 2YXEA 4X63A 3OU6A 3E6CC 8MHTA 3F72A 3K1MA 4HX7A 1VBFA 4L5IA 3RI4A 5CVRA 4ZZLA 5DPMA 3U81A 4AIKA 1XCLA 5HIJA 1DUSA 2DQLA 2E1NA 1SVUA 2OZUA 1KIAA 2FNAA 3FMSA 5FB2A 4YFNF 2PXAA 3SR4A 1G55A 4HOBA 4X1OA 4M9SA 3QOWA 4A2UA 2CSOA 2Q2EA 3HCEA 2K7LA 2AOWA 3ZMZA 1U78A 3NVMB 2IBTA 5K05A 3FXRA 4GBED 3GIWA 2X4HA 2PVCA 1EH6A 3JSPA 3DULA 1I1NA 3VEPA 3EDPA 3DP7A 3GFJA 3KZYA 1YW8A 3E3VA 4G6DA 3R4KA 5HDKA 3ABTA 3E23A 3ECOA 1UHWA 1D2HA 3LBFA 3X0DA 3H2BA 5HVQC 1G38A 1QGPA 1SMTA 2B9EA 1EH8A 2N47A 3ECHA 1I1GA 5EIFA 4DQ0A 2A5YB 3TLJA 3KPWA 1KU2A 3OCJA 4RV9A 3TM5A 4BAYA 3EGEA 1U5TC 5DXJA 1BI1A 3BJOA 4XSZF 2A6HF 1DCTA 2PGXA 4IRIA 1R18A 2RKHA 2CL5A 5CYVA 4OBWA 1JQEA 2P3LA 2OB2A 3A7EA 4HTFB 2ZBPA 3HIFA 2WK1A 2UWMA 2F8LA 2PY6A 4A0ZA 5DM2A 1LDDA 5HLGA 3WGGA 5CCBA 1V4RA 2G7UA 4IF4A 3DUWA 3FPEA 4RB1A 2E1CA 4HLXA 2KIFA 5E1WA 3DPLC 3G89A 2PN6A 3EYYA 4MEYF 4QVKA 2EFNA 2QQAA 4RX1A 3JTGA 2YSRA 1ON1A 3TFWA 1QYRA 3KCCA 5K0CA 5D4SA 4GXOA 4KYWA 2DULA 2BV6A 3L09A 3B5IA 2MBFA 1LEAA 2O06A 4A0XA 2OAZA 2JTVA 1O9HA 3RDIA 5GM1A 1ZLJA 4U88A 2MC3A 4ISCA 1XSXA 4AIHA 1BOOA 2HV9A 3BJ6A 3K9TA 1HBXG 2EK5A 2KJCA 3TPZA 5K0JA 2FK7A 4I0AA 2P7CB 1AQIA 3G2QA 1RI3A 2VBYA 4WCGA 4HSGA 2DW4A 5JI6A 1P91A 4DF3A 1XCVA 2EFWA 4PIMA 4R6WA 4G56A 1G8AA 2RVCA 5K0LA 1OKRA 3CJRA 3HCBA 3ML6A 4JXJA 4U0VA 3T0YA 2RDPA 4MTEA 4DNCA 3MGGA 3C6MA 2PXCA 1XDSA 2Y0MA 2P3QA 3TMAA 1BC7C 4M72A 1WRJA 3UBTA 2CG4A 1W7PA 6PAXA 4WK8F 5DD4A 1W7PB 4WVLA 4R8SA 2EX4A 1PUEE 4N0BA 2J5PA 2OA4A 2HZTA 2OZ6A 3L00A 4QPNA 5DDGA 4RVGA 4QWQA 4NHJA 5EEHA 1JG4A 2AR0A 4KVZA 3GRUA 1XN7A 3CUQB 5HILA 1ZG1A 5EMMA 1IXKA 2EA4A 2K4BA 5E9JA 2DK8A 5FTWA 3ZMSA 2GAUA 2P7IA 1OMIA 3P71T 3NDIA 3CTAA 1PP7U 1BBYA 4HGYA 5JHUA 1ODDA 1XDUA 5JUWA 4S04A 1TPYA 4ENKA 1ZQ9A 2NNWB 5P8WA 3FPFA 3M6XA 4XCXA 2FMYA 5E20A 4EJTA 3LDFA 5KYGA 1W5TA 4RTOA 2BYVE 1BIAA 3C18A 2F2EA 2EA2A 2M5WA 4BQAA 2FBIA 4Y2HA 4WF2A 1EQAA 3VC1A 4M71A 2W57A 3T1BA 4GC9A 3KLOA 2GPYA 3KETA 1YFHA 1VLMA 1XGSA 4I98B 4XSXF 3C6KA 3LAPA 2A68F 4YUWA 1HXDA 1H9TA 3HTSB 2ISYA 2QUFA 4XRFA 3HYIA 4M73A 3DEUA 4RGSA 3CUQC 4IRHA 4EM2A 3I58A 2H11A 4Q47A 3LQRA 2JRTA 1ORIA 4Y15A 2KIUA 4YV2A 5E1BA 4DCGA 1WSUA 5G02A 4M37A 3FTFA 3KP3A 4E30A 2FA5A 2YPRA 3BROA 4LLNA 3E97A 2ZZNA 3CDHA 3R6TA 4BNCA 3V7RA 5FULA 3PFIA 2E7WA 3GFMA 2V1XA 2ZSUA 1X1BA 2UXNA 1MJBA 1JG2A 2IFTA 3CUOA 1YIOA 3R0AA 3EUHA 4OU0A 1J75A 3B3FA 3EVBA 5FWAA 3F8BA 3KQWA 5DRYA 1P4AA 1SD5A 5DD8A 3G2MA 1HW1A 3SXYA 5F2NA 4EQQA 5HLHA 1D2GA 2VBXA 2P5LC 4AUKA 5B1SA 4I7HA 2ACJA 2VT3A 3HRUA 2ZO4A 3MTIA 2VDUE 2A61A 4YFKF 2H1RA 4ZTBA 3QAHA 2Y1WA 1MZBA 3EMDA 5DCFA 3SVZA 4KDPA 1P4WA 2BR4A 3UFBA 1Y0UA 4ZYDA 2FHPA 5DX8A 5HOQA 3ERED 5ILVA 1DP7P 1JHFA 1NW8A 2QVOA 3CVOA 3KR0A 4DA4A 1BC8C 1R6AA 1FBQA 2W84A 3P2EA 3RPUA 4KWCA 1NV8A 4ON0A 2VXZA 1N2XA 4HC4A 2P8TA 3WE3A 1B59A 4MIKA 3Q9VA 4M7RA 3CGGA 2CWWA 5CVJA 4KFCA 1XXLA 1G3SA 4M74A 2PV0A 3K1PA 5GIOE 4BHBA 5HFJA 4EV0A 4FT8A 5K5QA 4FX4A 2I62A 2GA2A 5FFZA 3WTTC 4ER3A 3KQMA 4C05A 4QQNA 3KQYA 4P9FA 3C1DA 3ELKA 4PZJA 4YIFA 1H1DA 3LHDA 3ZMVA 4PCQA 5L3CA 3SQNA 3KQVA 3KU1A 2ZWVA 1B9NA 1IY9A 5HIKA 3C3YA 1J0RA 1IRGA 5LRSA 5T64A 1S29A 1BHJA 3HSFA 3D2LA 3LFKA 2ZTHA 1SQGA 3ER8A 2IIPA 2IDJA 2EG5A 1NBIA 4KN7X 1QQIA 3BOQA 3ANXA 3CBGA 2IRFG 2NNYA 1DDNA 2ZNYA 4RVFA 4C08A 3TQNA 1D8JA 1K7AA 3TQSA 1HW2A 3RIRA 1IRFA 5EHGA 4CZZA 2Y75A 1STZA 2Q41A 3LCCA 2G7HA 2F5EA 1BI2A 1R00A 4MQVA 4QPPA 3EEYA 5L3EA 3P9NA 4C07A 5E18F 2DPMA 3MB5A 1D5VA 2EJRA 4LG1A 2AOTA 4UVCA 2OBPA 5DYMA 1MJFA 2I6GA 1J9IA 4IXAA 4KDCA 2FEZA 2JHAA 2P7HA 5E8IA 2VODA 2BH2A 1IAWA 2WV0A 2LSOA 5FO5A 2Z33A 4RWZA 3U9GA 3PX3A 4ZYGA 3GFLA 1WS6A 5LLQA 3GJYA 4B17A 2OB1A 2OO3A 1T39A 4P5OA 5LHGA 1AWCA 1XB4A 1IXRC 2JHPA 3LBYA 5HDGA 4BHPA 5LEJA 3IRQA 1G60A 4RTQA 2AOVA 2ESNA 1YQAA 1M6EX 1UFKA 1BI0A 5D8KB 3GRZA 4IKPA 9MHTA 4BP1A 4P9UA 2D1HA 1FT9A 1OYIA 4G8XA 4BYYA 1O7LA 3HTUA 1OR8A 5FQNA 3PVCA 2ZZMA 4FT4A 1FLIA 5DTMA 4K6MA 3EGVA 2VBWA 3KP6A 2CMHA 3HHGA 3PTAA 3SX0A 3DMHA 5JR3A 3EVEA 3KEOA 5L3BA 3A25A 2STWA 3UJBA 4LK0F 1FP2A 3FM3A 1FYKA 4GEKA 1IN5A 1VL5A 3HCDA 4R05A 1Z3CA 5KVAA 5D6FA 2O0LA 3P97A 5D6EA 3TOBA 4UV8A 3GXOA 1L1EA 5EMJA 4E2XA 1MKMA 4Y13A 1REPC 2M87A 1IN6A 3G7UA 3GGDA 2DTRA 4IPAA 4DZRA 4Z2YA 5FUBA 1T98A 1S3JA 1TTYA 3F6VA 3TKAA 2H6BA 4ETSA 4YUYA 2HKXA 1RUNA 4U7DA 2H6CA 1RJDA 1TW3A 2YU3A 2OKCA 4HLYA 5JVTA 3M6VA 2X0LA 3DPTA 1R1VA 1XTPA 4V0RA 1K78A 2E7XA 1MGTA 2Q8KA 5CIYA 3O2PE 4MTLA 1P6RA 3FTCA 1FZPB 1P39A 5BMZA 1EIZA 4X61A 3AJDA 5KQRA 3QOPA 5BS6A 3IHTA 1H9GA 2UZKA 5A2QZ 4KA4A 4R8RA 1XMKA 5ICEA 4YMHA 3KLNA 2AS0A 3HEMA 4EJUA 3JAMZ 2NYUA 2A07F 3FRIA 3QOXA 3PS9A 3VB2A 3E5XA 5GM2A 1PRYA 2VONA 5FLXK 1MDMA 1U5TB 2KJBA 1CF7A 3BKXA 3NJRA 3N97A 4QQKA 1B6AA 3GX4X 2JG3A 2XKOA 3UWPA 4LG0A 2NYXA 1NT2A 1FNNA 1FSEA 4OIQF 4PYKA 2G71A 1BM9A 1G4DA 5CVEA 2XV4S 2ZMEB 2A14A 2ZJ2A 2AOUB 3VFZA 2XYVA 3MHTA 3DXZA 4HV6A 1DL5A 3CCFA 5IKMA 3CC8A 3V7CA 4RTMA 2CW0F 5CVIA 2L4AA 2D2WA 5HIMA 3BDDA 1FX7A 2D1VA 5FLXZ 1HNNA 4F84A 1VQ1A 2GS9A 1SD4A 2HQNA 3DXXA 4YIIA 5E1OA 1ZGJA 2IA0A 3PX2A 5DCMB 3TGNA 3O31A 3P7NA 5HEKA 5DCMA 4EGZA 5CM2Z 4JBAA 2L01A 2BGCA 5D1NA 3S68A 2FRXA 4UV9A 1KPGA 5IT9K 3JWIA 2R7FA 3OU2A 5DV5A 3M8EA 3NRVA 2AN4A 4ENJA 2ZFWA 3V4GA 2BR3A 4CICA 4GC5A 3SFZA 1Z05A 5ERGB 3RPQA 4AZVA 3ZMUA 3NTVA 4D0PA 2NP7A 2VE8A 1KR5A 2NXJA 3MTEA 4HZFA 1TW2A 2CWEA 4ASNA 5A2QK 4KT5C 5EHIA 3GLXA 2OY0A 2JT1A 4RS8A 5H6QA 4PYJA 2XRNA 5FGMA 3BWMA 3IHUA 1NBHA 3FTEA 2HEOA 3VSEA 1AV6A 3E6BA 1YF3A 3WTYC 4XLPF 4Q4ZF 2EFJA 2VOPA 3A4TA 4RSRA 1VE3A 3Q5FA 3GF2A 4O3MA 4N9HA 1FBUA 4G6QA 3VOEA 5D4RA 4HQMA 4BLVA 3SSNA 3C3WA 1HKQA 4UUVA 2QZ8A 1FBNA 2FPOA 1DPUA 1LDKB 1X1CA 2QQ9A 3MEXA 3D5LA 4RTLA 3FXQA 2V7EA 4C4AA 3QU3A 3ERCA 4RVHA 5FA5A 3SSOA 4P7GA 5H20A 4GYIA 4E70A 1NW6A 4HRAA 1VP9A 2C7RA 3IWFA 4GO1A 3IRRA 3M4XA 3GU3A 4HX8A 1R5GA 2ELHA 3HOSA 3DV8A 2MLKA 4DQ2A 3REOA 1QANA 1R8YA 2VP3A 3LCVB 3HRTA 1HKSA 2MA3A 2VDVE 3IWZA 3F4KA 1RZ4A 4HF2A 2V74B 2NNNA 4M38A 2IP2A 1AQJA 4GGGA 4O6JA 3RKWA 3QP5A 1OR7A 3MCTA 4MTDA 1LEBA 3K6RA 3FM5A 4KIFA 3GZ5A 3A26A 2ESRA 1R36A 4NECA 4BP3A 2V1DA 4FP9A 2IH2A 4YMGA 2DFIA 2A69F 2L3DA 2HS5A 2ERCA 4TV7A 3B7PA 4LWPA 1ON2A 2DU9A 3BXOA 2H00A 2GB4A 3NDJA 2B25A 1P1BA 3GEZA 4HAMA 4LB5A 2K4MA 3M6WA 5C1IA 4B09A 1JTFA 2OU2A 3I0TA 1D2CA 2Y48A 4AVPA 5GIPE 5LSAA 5JFRA 5DSXA 2K4JA 2Z5UA 3AY0A 4ER0A 2PXXA 4UHTA 4ESBA 2PX2A 4YV1A 3JSOA 3BWYA 2EV5A 1Z9CA 1XCBA 1X1DA 2IPXA 2XGXA 4LWOA 5BXYA 3WG9A 4AZTA 4MEXF 2H94A 3P8ZA 1GXQA 3HHHA 2HTSA 2QYOA 1ZG3A 2AN5A 4KDRA 1EJ6A 1USSA 3F8FA 5BPDA 4L18B 2STTA 3JTHA 1I4WA 2PX8A 2HYFA 4L0ZB 2P5VA 4OIRF 4EM1A 4EVIA 1IN7A 3KE2A 4LLGF 4RGXA 3KR1A 3B02A 1HKTA 2YR2A 2D45A 3KP7A 1V39A 2AOTB 2NXNA 3BWGA 2CQKA 5D5WB 4DM3A 1HMYA 1IZ1A 1WI9A 4S05A 1T43A 3PLAE 1UFMA 4F85A 1D8KA 3PFGA 4QDKA 4A12A 1L3BA 1FSHA 3C0KA 1IF1A 1UIRA 4LK1F 1Q0SA 1UWVA 3HA5A 4GQBA 5LHIA 2JH9A 4FGZA 2NS0A 4YFXF 4GOMD 3OZTA 5K01A 1E2XA 4FT2A 3M9AA 4A6DA 1SKMA 2BZGA 2UYCA 4EJOA 3K2ZA 1WG8A 2R6ZA 4GUAA 2PT9A 3BUSA 1LNWA 1LQ1A 3RIEA 5ED4A 4HYEA 2KW5A 1B42A 3ISPA 3P9IA 3MAJA 1TQPA 3ZN1A 5FD6A 2Z6AA 2NXCA 3P2IA 1TBXA 3JWGA 1LJ9A 1WXWA 1XDZA 2RC4A 4OA8A 3ELYA 3O6BB 2H27A 3NWBA 2GZWA 3BPXA 5KK1A 5E9QA 4HW0A 5C0OE 5D8LB 1JXSA 4MGRA 2I7CA 3IEIA 2O57A 4RGRA 3IKVA 3LQQA 4M6YA 5LHHA 4AZSA 3FPHA 4XUCA 1BOAA 3I71A 3F8NA 4BLUA 3R60A 5HZMA 1USTA 4RYLA 1SD7A 2VC1A 3DOUA 2CGPA 2IA2A 2ONZA 4P55A 5LQRA 3G2OA 5FA8A 3CJQA 4NB5A 4RB3C 3ROUA 4CWAA 2QENA 3CJTA 5ICGA 4CXMA 3WU0A 2UYQA 2LNBA 2G9WA 3A27A 4PCAA 3FZGA 2HR3A 2PMUA 1M0EA 2QRVB 1RI5A 4CKBA 1ZH5A 3OZRA 3COAC 5H02A 2VN2A 1JSXA 3LA2A 3E6MA 2AOXA 2ZBKA 1ZLKA 3PB3A 4OBXA 4ZZDA 4KW7A 5EIWA 1YZ3A 1S7AA 3ABUA 3HRMA 3R9XB 4KIGA 3UJDA 4BLWA 5T6BA 3KR9A 5GP1A 3E8SA 4WXHA 3LKZA 3MWMA 4M36A 5BOXA 2XKPA 1RJEA 1J59A 3EVAA 2GA9A 1X19A 3J80K 2IGTA 2CYYA 5HS7A 5EGSA 4ZYHA 5GOZA 4RB0A 1B9MA 2PT6A 3NWEA 3HOTA 2HWKA 1RI4A 2O07A 3GDHA 1IXSB 2H09A 5E1DA 3V8VA 2IW5A 3H3UA 2JPCA 3QU6A 4LG0B 4MWZA 3BZ6A 4IJAA 2Y1XA 1Z1DA 1Z6RA 1U5TA 1NE2A 1QAOA 4KRGA 2AS5F 1SD6A 2M30A 5K5OA 5K0FA 3HVKA 2PX5A 3KP5A 1YTYA 10MHA 1R1UA 3H92A 3GZ6A 4PYOA 4P7JA 5DLYA 2EV6A 1MDMB 1G6Q1 3ZPLA 2OZVA 1N7IA 2O8XA 2NRAC 3HA3A 2XVAA 1HSJA 3ULQB 3R6SA 2YXLA 3LL7A 5K8VA 5E1XA 1JTEA 5FQOA 1JSZA 5ICFA 1WZNA 2A3SA 3DFGA 4L9NA 4OIOF 1KXZA 1F3LA 3SMQA 2HR1A 3FUTA 1RI1A 2J5OA 3OZSA 2ZW9A 1WWXA 4CDGA 3OOPA 1S8NA 2WA2A 2MH2A 1KHHA 5J8FA 1KQ0A 2PMHA 3MCZA 1K78B 3I5UA 3DLCA 3LDGA 3HM2A 1BJAA 3SGLA 3I54A 4HDUA 4LFUA 4CXFA 1RNLA 1FC3A 3THRA 5DT2A 3MQ2A 2JPBA 2ZULA 1O54A 3IYLW 4WXCA 1KPIA 5IH3A 4RVDA 1XVAA 4V0QA 2HTEA 5DEQA 2FSWA 4POOA 2FRHA 1PJZA 2K02A 1RJFA 2IH5A 4I0BA 1U3EM 1RI2A 1RI7A 2ZVJA 2DAOA 4UXNA 5LQUA 3R61A 3T0IA 2VDWA 3SZTA 5CD1A 5K09A 3WU1B 1R8XA 4LLLA 4P7FA 2PSSA 3MERA 3SZPA 4ZH4F 4HG2A 3F8MA 4PGHA 4CYDA 3OE5A 4U7BA 2DPDA 5DM4A 1QO0D 5FWDA 3J81K 3KEQA 3FMRA 2Z6UA 5KVRA 3KQTA 3TDZC 5E1ZB 3WGHA 5J6XA 2JH8A 4OX9Y 1TLHB 1NV9A 4KICA 3PFHA 1MD0A 2FBKA 3HUGA 4HQEA 3CJNA 4R1HA 1Z7UA 2GIVA 2OPBA 1V3FA 4DKJA 2G8NA 2L4MA 1NKVA 4EJVA 2P3OA 3F8CA 4E31A 5ILSA 3KPUA 2QE6A 3LKDA 1LDJA 2ZFUA 3GRVA 3IC7A 4GOND 3EVZA 3JWJA 1EH7A 1IN4A 3W6JB 1SUIA 4KMUX 3KPJA 2OBFA 1LVAA 4OOIA 3MFKA 4IHSA 4PCLA 3TO6A 3V7SA 3HSEA 5FHQA 3EVCA 3UZUA 4Q5SF 5DM1A 5F64A 5K0GA 1P2FA 2PI0A 5HIIA 4PONA 3T8TA 3SSMA 2C7PA 2G72A 2ORED 3GUDA 3DLIA 4KMFA 4YV0A 2PX4A 1HW5A 2IA1A 1SQFA 5HS8A 1WY7A 2QY6A 2V1UA 1R22A 2OQRA 3FUXA 3T7SA 3CO7C 5CUQA 1LB2A 1K6OA 5E8GA 3GFIA 1G6NA 2O61A 1JGSA 5LBQA 1G3WA 3P9CA 5CLSA 5D5VB 1F9NA 1VIDA 4EQZA 3FXUA 1FP1D 3P2KA 2XYQA 3E5UA 1XGNA 5LQNA 3CKKA 4RAZA 1IM8A 5DTQA 4XUDA 2FMLA 2ZCJA 4HBLA 1H0MA 2FYTA 3KQOA 3F22A 3M1EA 2IPQX 1FY7A 2VE9A 1XSDA 1ZHFA 3QPHA 5LQJA 1KP9A 1U8RA 2ADMA 5ILUA 4EMSA 3FPJA 3MQ0A 2MD5A 1C0WA 2ZZKA 3DMGA 3GWZA 3NQOA 4FZVA 5EKXA 3NVKI 1O3SA 4R8HA 2WWYA 5CJ9A 5FHRA 2O0YA 3S2WA 1ZREA 3FPGA 5E8RA 1UB9A 5DTRA 5DUKA 5FCDA 3TOSA 2XVMA 3PT9A 5BPIA 3EVDA 3DKWA 3WTZA 2YR0A 1YFLA 1RIOH 1PP8F 1CGPA 2XYRA 2ZIGA 3FX3A 1ZGAA 5E2BA 3HNRA 4LB6B 1R5HA 2L54A 3FYCA 1T0FA 3RW9A 4EKGA 1Q1HA 2EJTA 4U7PB 2DQRA 4OIPF 3UJ7A 4YG2F 1A04A 1I6XA 2XAGA 2HTJA 2AXLA 3TRKA 2V9VA 4GCVA 1BI3A 3EYIA 3Q7EA 4Y17A 1I1SA 2GWRA 3E5QA 4AIJA 2YUIA 4AD9A 2YXDA 3FTDA 5EEGA 4EGYA 3T7RA 1QZZA 1AOYA 4A5NA 2GH1A 4G94A 4Y30A 5L3GA 1F1ZA 5EC8A 5IT3A 4MNUA 1DPRA 1R74A 3OFKA 3ELWA 2K86A 4OQEA 4UVAA 3GO4A 1ZN2A 1GXPA 2FXAA 1IN8A 5ERIA 2OQGA 1PDNC 3J7AO 3TR6A 2W24A 2LF8A 3OV8A 3TM4A 4EJWA 1NW5A 1QPMA 3FWEA 3GYHX 4KNYA 4C04A 4K2EA 2LF7A 2ZBQA 4O29A 4A6EA 1KU7A 2ZCWA 3BWCA 2Z3YA 1JE8A 3EQLF 4FX0A 1T2KA 3U2RA 1JHHA 1O9GA 2BM9A 3WODF 3M6UA 4GYGA 1O7FA 3GCZA 4BHCA 5K0BA 5FFXA 1YLFA 1I5ZA 3F3XA 1P92A 1KU3A 2VOOA 1T38A 2YX4A 1D3YA 5EMKA 3WE2A 3RYPA 1KA8A 4E2YA 4ER7A 1E17A 4WXDA 3T8RA 1WQ2A 1XGOA 2PQ8A 3FYDA 3GO5A 5DRTA 3HTXA 4CO8A 1WKMA 4H0NA 5M5BA 2P5KA 3OE4A 4BXUA 4YUZA 3KP4A 3JWHA 1ZRFA 2XAQA 4RGUA 2WC2A 3NMUF 3K1NA 2V6CA 3MZYA 1ZRDA 3J80Z 2CO5A 1YS6A 1UCRA 5BW4A 2XVCA 4R6XA 2ZIFA 4RTPA 4M9ZA 2XROA 2P6SA 2PJDA 5AIQA 2PWYA 4RTRA 4L9TA 3ZMTA 3RJPA 3CUQA 1YG2A 4B8XA 4JQFA 2B2CA 3WTUC 2FQ3A 4QDJA 1KQ9A 1YZHA 5CVUA 3EMBA 4P58A 4G7ZF 3K0LA 2QQBA 1OPCA 5LEKA 3HSRA 5LGUA 3M70A 4P7KA 2VC0A 3O3KA 5BQTA 3B3GA 2RGVA 2PBIA 2YTZA 5D5XB 1ZG5A 3PQKA 5K0EA 2OD5A 3KR2A 1NHAA 3AXTA 3L2CA 2P1DA 2AVNA 1XJ5A 3ZN0A 3LWFA 2PLYA 5GWXA 2YVLA 3LECA 1X1AA 5K0NA 2XHKA 3LX6A 4L9VA 1W5SA 2EFOA 3Q9SA 1R7JA 3HCCA 2PEXA 2GQQA 1L3CA 4F86A 5EG5A 4OA5A 2M45A 4RTNA 3DF8A 2HNKA 4R79A 3HP7A 3D0SA 3K69A 5EQJB 3WTSC 2GLUA 2FOKA 3HRSA 3JW4A 3EGIA 3ZMDA 2GXGA 1S7OA 1QBJA 3I9FA 4FSXA 1XGMA 5HS9A 3I4PA 4PGGA 5DX1A 4PNEA 4LGWA 4AWXB 2XAHA 2ZXJA 1FOKA 2YX1A 4PYMA 1QZYA 3T5XA 3G2PA 1ULYA 2B0LA 2HOEA 4HGZA 2XASA 2EJUA 3BT7A 2CMGA 2NXEA 4WWCA 4L0YB 1EV7A 4U0YA 4PDKA 3LA3A 1YFJA 4HDVA 2Z99A 3OFJA 4OMYA 4I2OA 4F7ZA 3UJAA 3KFWX 1ORHA 3IKTA 2W85A 1VP3A 4FS8A 2TDXA 4LECA 4EKIA 1ZARA 4E2WA 3E6DA 2FK8A 5DUIA 2Z9OA 1KYWA 5HDNA 3DMFA 4G7OF 4QLCU 4XLNF 3IV6A 5K1YA 3HCAA 4FR0A 1Q0TA 3ZQ7A 2EFQA 3HVHA 2DI3A 4IRGA 2RV8A 3EPPA 1KPHA 3UJ8A 1W7PD 1JR4A 4I01A 1I9GA 3FZVA 4RTJA 2BEOA 4PIPA 2HQRA 5D5UB 2PWPA 3T7TA 4MQ4A 2CKDA 3K0BA 3G8BA 3KQSA 1ZAOA 3QPTA 3LSTA 2BR5A 1O57A 4HF0A 4N9IA 2P40A 2VT2A 4IHTA 1BKYA 4OMZA 4M6XA 3UA3A 2FCAA 2IT0A 4HH4A 3OPNA 2ISZA 3GW2A 2P8JA 3RODA 2PG4A 4ESJA 5LQKA 1AF7A 2FU4A 2YX7A 3F21A 3RYRA 3TOAA 1EAMA 2C7OA 4I02A 4PYLA 3TO9A 4BH9A 4LD5A 3FHZA 1YYVA 3GRYA 4CTJA 2L02A 2Q0OA 4MQ9F 1RJGA 2ZWAA 1SFXA 4KUMA 1BIBA 1GVJA 5E2AA 3FUWA 5EVJA 1TNSA 1WXXA 4HF1A 1J7KA 2O05A 1L9KA 4FSDA 1YW9A 5KS2A 2LD4A 2ZIEA 3M33A 1R58A 2UYOA 3RKYA 3W6KB 4U0WA 3ID6C 2XBMA 3KZZA 2Z6QA 3LGAA 3G5LA 1X3UA 1RUOA 4CKCA 1XD7A 5HOOA 1F4KA 3FUUA 2RN7A 3ELUA 2UYHA 1SUSA 1NW3A 4OQDA 5KQSA 3TKYA 4QTTB 3CLOA 3BJAA 2V79A 4ER6A 5AONA 4L5JA 3V8JA 1F5TA 3R3HA 5D1HA 4HX4A 1G3YA 4RB2C 5LRRA 3BKWA 1M6YA 3LA7A 4PWYA 4G7HF 1T6SA 2QM3A 2QRVA 3FUVA 1YB2A 4ZYEA 5FD5A 3L9FA 1N7JA 3KKZA 5T67A 5DX0A 4IV8A 1G8SA 2IVMA 1INLA 4EM0B 1I27A 1MJAA 3DQVC 3L8DA 2C6YA 3M8FA 1ZYRF 1JG1A 1SFUA 4OINF 2XUBA 1O3TA 2KIMA 3UJ6A 4E33A 3TO7A 5F2OA 3WTWC 5LR6A 1TQMA 3F6OA 3B89A 4E32A 1B4AA 3DXJF 2DPUA 4KIBA 2ZKZA 5EMLA 3WGIA 3HVIA 4AZWA 4E2ZA 3I53A 2JSCA 2R3SA 2UZ4A 2PBFA 2BM8A 4QVGA 3SHFA 5L3FA 1QNTA 1YO5C 1FYLA 5DM0A 2HYGD 2RQPA 5K5RA 2B78A 5EZQA 5E9WA 3BGDA 3KHKA 2W25A 4RTKA 1FJXA 4IVNA 1YW7A 3MZHA 5EPEA 4HV5A 3L7WA 2HGCA 3N4MA 4IV0A 3B73A 1EJ0A 2IJLA 3V8LA 2XIGA 1KGSA 3IL2A 3FMQA 5H6RA 4AX8A 3QRFF 4UOEA 1TNTA 2AZTA 1XMAA 2P35A 2K27A 5TJJA 1S6LA 3R0JA 4A0YA 1W4MA 5DWQA 1GHCA 4KN4X 1MJ9A 4UVBA 3RKXA 3CO6C 4PYNA 5F2KA 4MHGA 3BGVA 4HTFA 3V97A 2C7QA 2DBBA 3NEUA 2XAFA 5GINE 4X60A 2ZBRA 3GRRA 3DTNA 3E7PA 2KKOA 5ICCA 4C03A 2VZ9A 1R1TA 4CTKA 2I9KA 2ETHA 4U7TB 4Q48A 1NW7A 2PKWA 2P6TA 3FF5A 1J2XA 2FE3A 3WTXC 5LGNA 4CHUA 3SXJA 4A5MA 5MHTA 2IDKA 4GOLD 2P4WA 2HFHA 3UJCA 2RNJA 5F6FA 3ORHA 2JHCA 3J81Z 4GF5A 2AVDA 1IUYA 3BGIA 1SFEA 5J8CA 3NW9A 3ELDA 3AWIA 1U2ZA 2UXXA 3E05A 1P1CA 1FPQA 3DH0A 3KPYA 2FNPA 1K79A 2WTEA 2XAJA 1BC5A 5BW5A 3HCFA 1KYZA 1QAMA 1L3LA 3P9KA 3KPVA 3O4FA 1CF7B 3VYWA 3MAGA 1P4XA 2R7DA 4X41A 3EVGA 2O3FA 3V8KA 2PLWA 4UNOA 3GVAA 1JQDA 2QBYB 1TQIA 2F5DA 4HA8A 4NQWA 3A7DA 4XBFA 2B3TA 3R24A 2NP6A 3BPVA 1O3QA 5CCXA 3G3ZA 3QV2A 3O7WA 3UJ9A 4GOOD 2HKOA 3KQPA 2WA1A 5L3DA 2OYRA 1FYMA 3QP6A 3AAFA 4L9JA 2M1BA 3R0QA 5AIPA 2PFBA 2P41A 2F5CA 2DLLA 2ZLBA 1QAQA 2GXBA 1KU9A 5BP7A 5CVVA 2ADUA 1IW7F 5C9ZA 3RTRA 3HA7A 2LKPA 4CKEA 3EVFA 3BWBA 4C06A 4RAYA 1J5YA 1B1BA 3M7GA 3FRHA 4ESFA 2MH9A 4LMYA 3I59B 2E5WA 1YS7A 2O6GE 2F5FA 5E17F 5HLIA 4PYIA 2G70A 2CFXA 1JG3A 2QWWA 1MHTA 3ME5A 4O5VA 3F23A 1F38A 4YUXA 2BBYA 4JK1X 3EETA 5U4XA 3G73A 4IWNA 4L7VA 3H3ZA 4XUEA 2YQZA 4BY9E 2G1PA 3Q87B 3ZP5A 1Z91A 4DCMA 4CGZA
chains in the Genus database with same CATH superfamily
2MLGA 4BJ5C 4WX9A 2HMUA 2R7XA 3EAQA 5E3OA 1C80A 2PGJA 2QDXA 3HWWA 1ZIPA 2WY7Q 4BNWA 1SG9A 3VI4B 4ER5A 2V55B 5EHXA 5EZSA 3ER9A 3K96A 1U7OA 1I2AA 1TVCA 1V7PC 5EESA 4GI7A 3E3LA 5CVDA 3SEZA 1PVDA 2DWUA 2A3NA 3VNRA 2FPXA 4AJEA 3B3JA 1T0FC 1OWMA 3PUKA 5EXEA 5EWLB 4EAAA 2QU7A 4QWWA 5FWYB 2GLTA 1KQ8A 1DDIA 2WKQA 4A91A 4CQLB 1SZCA 3IOEA 1A8SA 4ZAVA 3U26A 1E5VA 3JAKA 1XZDA 4H35A 2HMYB 4KAFA 2DFDA 4PLZA 1DEOA 2CHQA 3DO5A 2EWNA 3KT6A 3RRYA 2VP6A 1JQAA 2W2TA 3HKCA 4UQOA 3VYVA 1ZRCA 1E3OC 3MJDA 1VPVA 2FR1A 3JAKB 3WSTA 2HBRA 2Y9YA 1NXXA 1Y1SA 3DLPX 1GLVA 3H1GA 4AZ0B 3K6SA 4DUZB 1L3IA 2COMA 2NTYC 3FMVA 1JKPC 1RPWA 3N53A 1VTNC 4HQLA 1AA7A 1GZ4A 4N6OA 3VNQA 4OVKA 4BIMA 4YUAA 1TUEA 3V7WA 4W7IA 4A10A 2ZE7A 1U6GA 3OURA 3RSGA 1EGHA 3VPBA 4BFUA 4NV3A 4R1PA 4NP6A 3WGQA 3DR3A 4H3SA 4ZODA 4CEJB 1UC5B 4A8JA 5K0ZA 1G3TA 2ZRQA 1XQXA 4TN5A 2P27A 2PRZA 1W0KA 1H4TA 3PHHA 3K0AA 2EB7A 2L7KA 3HB1A 4JJEA 3MTAA 4Q03A 5JS2A 1DKRA 2R751 2WKSA 5E3NA 2CD9A 3TTWA 3OYCA 2HIHA 3AY6A 3RUDA 1EXVA 4O4JA 1AHDP 1GTG1 4D2IA 4ND5A 3NASA 1BN5A 1QTNA 2QX4A 3OKFA 3L7NA 4RCYA 2XUFA 5EPUA 5F1PA 1JFFB 5JALA 2P6NA 2Q9UA 2A6EF 4FYIA 5IXSA 3WWZA 2FUEA 4ALIA 1IH8A 1E2UA 4CMEC 4DMGA 5MN6A 4MVCA 3A9RA 4LXIA 4PRKA 1T0UA 3L0DA 3TOCA 4JBYA 4JUFA 3CVVA 2M6LA 1Y7PA 1KC3A 1QJ4A 2DO7A 1T2DA 2GF9A 2IF0A 4ZVKA 4KXQA 4MV3A 4CF3A 5DO9A 2ECKA 4CKBB 5H83A 3I9KA 3AEQA 2NG1A 4D56A 4JLMA 3ABRB 3AF0A 3CUVA 3S2ZA 4CFYA 2R8EA 1Y8CA 4QFDA 7MDHA 3GW8A 1Y98A 4NRDA 4QU8A 2AJDA 5EOVA 5D01A 1N1GA 1ZP6A 1WB9A 4MHTA 2H92A 6ADHA 1KEWA 2PX0A 4X0GA 4KL8S 3FXJA 2B5VA 4OKSA 1LJUA 1Y82A 3LWNA 4CLXA 2FF4A 2VUHB 5FADA 3LYUA 2AN3A 3BXHA 1JHAA 5CK5A 3MMPA 5K0TA 3AUSA 3TDUC 1UC9A 1DUXC 3C7JA 2WWHA 2GFIA 2BKEA 2C9YA 1RPZA 3HL4A 3AXSA 4UVGA 1XEFA 1XF9A 2Z9CA 3FPLA 3I2GA 3PR3A 3WTVC 4RF2A 2YHSA 2ZJOA 2XT0A 4EHFA 3JARA 4G1UC 1HQCA 3RHZA 4DBRA 1E60A 1JMVA 1ORDA 2VF7A 4JYBA 3ZQ6A 3R3WA 1X7YA 5TQVA 4GG1A 1HETA 2WY8Q 2BN4A 2ZSHA 3FPCA 5CYGA 2ONYA 4NQZA 4QUGA 3LGXA 1LY1A 2C2ZA 1VJ0A 5C4GB 1N78A 5LC1A 4F7WA 1DARA 2QIOA 8MHTA 4U8GA 1CZLA 3F72A 1I1HA 4JLPA 1O0SA 3JQ8A 1VBFA 3AHIA 5KHAA 4RH0A 1YZKA 3RI4A 4HWTA 4MDFA 4AM8A 5CVRA 4ZZLA 1N3BA 2P5YA 4F4HA 3W5JA 1GZHB 4TL7A 3A1VA 5AJYA 5ITSA 5IKOA 4MUIA 3U81A 2QTRA 2EIMH 4AIKA 3UXHA 5KO2A 3LBIA 5HIJA 4R2HA 4DOZA 4D02A 1X0XA 1WVRA 5ADUS 2UXBB 2OZUA 5UKDA 5JAPA 1SXQA 2B30A 5M34A 3MJVA 1U3CA 2HXGA 1G4HA 1NKSA 1G7CA 1ESCA 2GN8A 2GMWA 3QBDA 1NJFA 2PXAA 1NUQA 1DAPA 2XZPA 1PSWA 4INPA 4JVNA 5AXCA 3WP0A 4HOBA 1CZKA 3ZY2A 1F3OA 4BNDB 2I29A 3TNFA 2O6LA 2Q7OE 4YR9A 4F92B 1UP4A 5IW8A 5LYJA 2QN1A 4JHXA 4C3ZA 3HCEA 3S44A 2K7LA 5BWCA 1BQEA 2WIJA 4GM1A 4MICA 3MN1A 3NUQA 3ZHYA 3O75A 2HOSA 1RACA 2C31A 4FGLA 1VQ4I 3A2KA 3OCXA 1Y9DA 3VR0A 3FDJA 4KDFA 4NDLA 1MKYA 2X2EA 3B9PA 2FFAA 2DA5A 2VJMA 2H1OA 4QVIA 2YS6A 3EWNA 1PQUA 4EYOA 1M75A 3VEPA 1CDDA 2D5IA 4JT8A 1ZK2A 4EFNA 3PSIA 5KNCH 3O4RA 4UUQA 4J1NA 4Q66C 3SNHA 4FE3A 3T34A 3E3VA 4RJKA 2QX9A 4JXXA 3S1AB 4HGRA 4OHCA 4OHXA 1OWLA 3WK7A 1UADA 3S68A 4EGAA 2EKDA 3PUJA 3FYUA 4X94A 1ESEA 1H4VB 4BMSA 5CFOA 1AVTA 4J0CA 4NPHA 3H5OA 2I6SA 3Q72A 3QYEA 1P19A 3K73O 2B9EA 4YLGA 1EH8A 4O4JF 4ZEMA 3R3JA 2A5YB 2EQ5A 2X1LA 3CA8A 4TTRA 4D5GA 1OHHA 1SHZA 3KPWA 3SC3A 1KU2A 1A4IA 1IEXA 3B1XA 1ZD4A 3N7AA 3GDOA 1YXMA 3EGEA 1J56A 4FLFA 3V4VB 2M0CA 5A02A 1U9IA 3IKLA 3PEFA 5GJBA 1O89A 4LKRA 1XUOA 4NCXA 2PGXA 2AJTA 4V0LA 3MMXA 4UBOA 2XA9A 3O38A 2XA2A 1S72I 1T56A 2YNMA 5JDIC 5JFGA 3BEDA 3TUZC 2C0QA 3AUJB 2QLTA 2OR3A 2V7PA 2JGDA 2QZPA 3FHCB 5CYVA 3FWKA 1X1QA 1ZPDA 2CHEA 3HZRA 4GXQA 2FQ4A 3E9MA 1AHPA 2V9PA 1Z5VA 2OB2A 1DDOA 3L7OA 3OYJA 1E9VA 2EKBA 2PVPA 3E0XA 4FONA 4HTFB 4WHMA 4YMIA 1VHWA 3JZMA 3OOWA 4DSAA 2J3IA 1M73E 3W5IA 4II3A 2PY6A 2BY3A 3ZJ5A 2QM7A 3C5CA 5CK4A 1U0RA 5DM2A 3R6GA 4JKOA 2Q45A 3WJ7A 2VKEA 3WGGA 1Y0NA 1KR2A 1SA0B 3OSFA 1TJYA 4HKTA 4WERA 3DUWA 3NV9A 4UE3S 5BNWA 4MOWA 3W6OA 4R2MA 2VYVD 1NULA 4GPTA 2E1CA 4OLBA 3EHEA 2KIFA 1XXHE 4TN1A 2B3DA 2QRJA 3DKKA 2OL4A 1P61B 3KKPA 3EYYA 2BEVA 1PZFA 2FP4A 3BAFA 4P83A 1MIOB 1LS6A 4QVKA 4D3FA 3U16A 1DJOA 2VXDA 4XW2A 4RX1A 3VPXA 4F3CA 4MR7A 1G2HA 5KTTA 3OX1A 1GRNA 2YSRA 2GYYA 4Y7CA 4G9GA 3QWFA 3KCCA 2MSEB 4UU7A 5D4SA 1WF3A 2FMUA 2OEPA 4GXOA 4K8OA 4MNTA 1UBLS 2BV6A 3L4BA 221PA 2HBYA 4RADA 3H3XA 3B5IA 3ZWBA 2Z04A 4D43A 1GPWB 1YQ9A 1TADA 2X9QA 3ZK9A 4OSPA 1M5UA 3HACA 4QEKA 4BZXA 4BXFA 3DAGA 4JR1A 4BVAA 4XLEA 4Z53A 2XYPA 2GN1A 2YCLA 3GJ0A 5JPDA 3FOAA 4EEFG 2Z1DA 3ESZA 3PNPA 4FYVA 5D3KA 1GUYA 1NWHA 1SRQA 1DKPA 4II2A 3HY6A 2XEXA 3TP0A 2HAEA 2FOLA 2XVZA 1U04A 1NASA 5FLVA 4LY6A 4WDRA 4YCJA 3PNTA 3D6TB 3BJ6A 5IDQA 3QSYA 4BNTA 1CJMA 1HBXG 2WF9A 3PFKA 4LDQA 1G9SA 3O91A 3T7IA 1OCEA 3B1ZA 1OCRH 2O7OA 2ZJPF 4B34A 5CB4A 3IOBA 1BFKA 3VVLA 4AICA 4JYKA 1SVWA 4DCTA 4MLPA 1V3QE 4MMYB 4CDRA 2C07A 1YDMA 3C41J 4TMYA 4WZAA 4CKXA 2P7CB 5KBYA 1D0ZA 1G21B 4YLYA 3LUDA 5EXPA 4DR2B 1PW5A 1Z26A 2OV8A 2C04A 2XMPA 3NATA 3P5BA 2B82A 5JVDB 5JI6A 1O97C 5C5DA 2E55A 1W581 3RS4A 1XCVA 3KCQA 2EFWA 5LMNB 4R6WA 2M9HA 2PSJA 3DZ8A 1S96A 5TPZA 5B66C 2GN4A 2WA0A 4YRVA 1GZ6A 1KYVA 2RVCA 3GLVA 3P19A 4OH1A 1DLIA 4EHJA 3N86A 1V43A 1YACA 3DU5A 3TSAA 1TQ6A 1VSVA 2HA7A 3PE6A 4JUCA 5JAZA 1GZUA 3QU2A 4KU4A 3Q0VA 2Y77A 3HCBA 4OGKA 2I6FA 2X0RA 2AB0A 4B45A 3EMKA 1PD1A 2HZ7A 4AUMA 2FQXA 4ANJA 1NP7A 1U3FA 3MGGA 4BB6A 1GZVA 1UPCA 3W2AA 2Y76A 3M1LA 4GSLA 2O1SA 5BN3A 2FF7A 2G28A 3TMAA 4X91A 3NORA 4M4SA 3OEED 3R9IA 2AE1A 1BMTA 1C14A 3BN3A 2GPNA 1DGQA 2QEQA 2CG4A 4K9PA 2ZJ1A 2Q7DA 3ZQIA 3FCOA 4IXDA 3IUQA 4EPRA 3RSNA 5JBNA 5DVZA 5B1EA 1OFGA 3EXFB 2KPMA 3D3KA 2YL2A 4R8SA 2EX4A 4CLEA 4Q7JB 1NYTA 4MGHA 1PS9A 3M6AA 4QYIB 1WABA 4N0QA 2D7JA 1T0JB 4OHRA 2OA4A 2RJ3A 3ZGOA 1KMMA 5CDFE 4KBGA 1I14A 4M54A 4RVGA 3DM5A 1GXSA 3IIKA 1JQ5A 2CMDA 1X9IA 2W9XA 4M99A 4BO4A 3RG8A 4DARA 3PTZA 3CUQB 1DQYA 5AXAA 2X6XA 4XM2A 4F1KA 1BVYF 4ARUA 4BRSA 2BF7A 1AKYA 3WJ2A 2FSPA 1XAJA 4Z7OB 1H6AA 1UBOS 2V7QD 1H9CA 3T1OA 3EASA 3LLVA 3QU4A 4XFKA 5K8CA 4QBFA 5HDBB 4OUKX 5B64A 1QQ5A 4B5LA 2SKCA 2YJ3A 1BBYA 3UK2A 1Y1PA 2C7VA 4HGYA 4KMMA 3QITA 1ENZA 2J3DA 3NM4A 2OSBA 3TJRA 2QZ4A 3UMFA 1TPYA 2J5BA 4HDSB 3C3EA 4N49A 3R23A 2NNWB 1AUPA 2IXFA 3CZ9A 2B35A 2WMYA 4ZEVA 1UT5A 3R7SA 3KAPA 1MMGA 1I5RA 4Y2XA 2B2NA 3NFYA 3ZD9A 4QARA 5E20A 4NXNB 4DGQA 4JY7A 4NEGA 1J6UA 2FEMA 2O6HA 3TTXA 1YQWA 3JZIA 2WJ6A 1BIAA 4HQ6A 2ODAA 4DJAA 1R6UA 1EVEA 2XEDA 2EA2A 4H2DA 4KVGA 2GIZA 2FLKA 2IGBA 2VJLA 4BQAA 1FP6A 2QAJA 4Y2HA 2XDVA 5K51A 3VC1A 2BEWB 1X2BA 4Y7DA 3KUKA 3Q9NA 4C5CA 1JNYA 1WF6A 1YZNA 2ETVA 1W0JA 5JVGF 5FKKA 1QV9A 3T1BA 1VSUA 3HRKA 3FAZA 3DPIA 4GC9A 3PSHA 2GPYA 5J1TB 3R8FA 2A0FA 3P9XA 4XSXF 3B5EA 1AU7A 3EFOA 4JSRA 5CNIA 3TN7A 5BQOA 3HUGB 2CZCA 1T4MA 3NPMA 4KYTA 2ZB4A 2JA7J 3HKZA 1L5OA 1NU6A 2QR3A 3UAVA 1K8QA 3A1FA 4ASUD 4BO9A 1K5DA 2WYWA 3IR5A 3UK0A 1ISIA 3G0CA 2HJSA 3GT4A 3LBAA 2Y0EA 4MCHA 3G2JA 2WILA 4GP6A 4V0NA 3B70A 1AHIA 1DIRA 3V3KA 1VBKA 2ISYA 2QUFA 2KM1A 2Z4RA 3HYIA 4M73A 3DEUA 4RGSA 3CUQC 4WRRA 1PI3A 3AU8A 4GWKA 1BGXT 3UFXA 4PJ0C 1K0UA 4YXFA 5J23A 3FNGA 4Q47A 4J6FA 5B1AH 5HJ5A 4HFRA 5TEVA 5HWSA 4F52A 1XAIA 1Z7GA 4U4AA 1Y8AA 2OBBA 4FNGA 4Z6KA 3IAS2 1WSUA 1F14A 4TMFA 2OCIA 5CNKA 1DQPA 4ACBA 5KTRA 2YXNA 5BNTA 3FJOA 4A8JC 1N5MA 3FTFA 1SC9A 2FA5A 2YPRA 1Y1TA 5F9HA 3HP1A 4LLNA 3E97A 3BIJA 4FM9A 1GTRA 4QPCA 3OEHA 4FZ5A 2TMKA 3DDUA 3K8ZA 3FKIJ 3R6TA 4GVXA 3VKVA 3NS7A 4Z9XA 9GPBA 2WB1N 1TA0A 3CZ6A 2A57A 4AKTA 5B1YA 4RK4A 5FV7A 3PVSA 4PRYA 4G63A 4EMUA 2E7WA 5GAJA 1U02A 2HXOA 1IUOA 1YAHA 1JS1X 1S2MA 4HTAA 5JIBA 1KRXA 2ZSUA 1EX9A 1X1BA 3W8EA 1V4BA 1RLTA 4FI3C 2PG3A 4WPGA 5FFMA 4ZVTA 2P67A 3BCAA 2Q5JA 3B3FA 3CLTC 3EUHA 4BMCA 1GPDG 2P0WA 4DCOA 1FNDA 5DRYA 1V1MA 1ST3A 1ISSA 1T9CA 4JC5A 2WV1A 3AVWA 1UBUS 5F76A 2XXAB 1XMSA 4BBZA 3VYSB 1ZONA 1JJBA 5F2NA 2QTTA 1G8GA 1F12A 1G7TA 1HTWA 5AICA 3TD2A 2VUUA 1UINA 4URYR 1D2GA 2ZKLA 3QPLA 3E8XA 4DMMA 5C8YB 1HDXA 4YWHA 1HT1E 2XCTB 3KSZO 2VT3A 3HRUA 3MTIA 1T4CB 1EVJA 1HDIA 1P1HA 2VDUE 3N28A 2FZ4A 3TR5A 4BFVA 2A61A 4NG4A 4YQYA 3IQHX 3MN2A 5EERA 4ZTBA 2J5QA 4HFMA 4G5XA 1J1IA 4IJ6A 4MA5A 4MPDA 2OCEA 3SVZA 4YCCA 4G6TB 1JU9A 3O8OB 1MDBA 4RPGA 2BR4A 3KJIA 4GMHA 2QU8A 1LB1B 2FW7A 1DDGA 3IQIX 4BGDA 5IBPA 4G01B 1XHEA 4MS3B 3JR3A 2RGBA 2O0MA 3SICE 5JDIA 1UKCA 4DDHA 3WGOA 4BQQA 4M83A 5ILVA 1PFWA 5EHZA 1JHFA 1AQYA 2RD2A 2Y6VA 1PFKA 4LKOA 1MZPA 1SANA 3CVOA 3VTFA 1D0XA 1BC8C 1NVKA 2OBXA 4FFSA 4O02B 2W84A 2ZSEA 3RPUA 1M0SA 1RRVA 1YJWI 1GUZA 3CWCA 3H11B 3M6FA 4NCHA 3CZAA 4AP6A 2XNDA 1CJTC 4DLLA 5FTJA 4ON0A 1X0VA 1P9QC 4A92A 4YXWD 2VXZA 4EJ0A 1EESA 3V6LA 2HN9A 1B59A 4OIFA 4YRKA 2CWWA 1G9TA 4CKZA 3R4VA 1KL7A 1PEKE 1QFXA 4ZIRA 1G3SA 3S29A 1SC6A 1V8ZA 2EEPA 2H0RA 3SXUB 3RYTC 3WP1B 5HFJA 3QX7A 1M2FA 1QIGA 3ICWA 4J9UE 4KQWA 5JNTA 1UZLA 5GJVC 3ZBTA 1X9HA 2W2LD 1E9CA 2VHCA 3LBHA 1JKIA 1DU6A 1C50A 2IY8A 4L3OA 4R51A 4ECEA 1P2UA 4AUEA 4YX9A 4G85A 4ER3A 4KISA 2ZTSA 3C8ZA 1GU7A 1P6QA 4C05A 3NDRA 3K09C 1G59A 3RAPR 4L3WA 1HMPA 3INGA 3KQYA 2XNCA 1GV5A 1OZHA 2OCPA 1F4PA 3C1DA 3ELKA 4PZJA 4YIFA 1YQGA 2XDWA 3CLVA 2ST1A 2XVYA 4NDZA 1DELA 821PA 4PCQA 1L5GB 4DV3B 5B3KA 2QD4A 3OCUA 3EXFA 3PPYA 4Q16A 4QXQA 4D96A 4EUEA 1RC1A 1GPJA 5F7JA 1FPMA 1H8HD 3STVA 1PTJA 2WF5A 1B9NA 1Z7WA 1T95A 5HIKA 1WSBA 3K9CA 3L79A 5B6IA 1J0RA 1N0VC 5H9VA 5LRSA 2R8OA 3O3MB 4Q02A 1OXTA 4ETMA 3J81A 3O9MA 1OMOA 1WEKA 2ZTHA 3ER8A 1VRVA 4OCZA 2LE0A 4QJ3A 1XKQA 1RETA 1J99A 1Z4KA 3V80A 1SVLA 4PC6A 2BIFA 1V4VA 1NUSA 4XQGA 3JZFA 1DDNA 1ETKA 2ZNYA 4RVFA 4JA0A 5CX1B 1S4QA 5LNK1 4CF5A 4C08A 3U1KA 2EIHA 2P81A 3EG5A 5E2IA 3GRCA 3W5AA 4GOJA 1IY2A 3T1QA 3ZNOA 4P0QB 4OJKA 2CS3A 4FD2A 4OH7A 5EE1A 5C5IA 3RIRA 1K7EB 1PR1A 1SU6A 2XDQB 4CZZA 2YWFA 5EHGA 5EJMA 5BV7A 2FB9A 1UJNA 1E18A 3LCCA 3PDUA 4J29A 3DSRA 4LE2A 1BI2A 1VZ0A 3HY3A 1QR6A 4MQVA 2GCPA 4QPPA 4A3FJ 3EEYA 4C07A 2IDMA 1Y9JA 1KVTA 3M4ZA 4K88A 3LQKA 2JD2A 3JYOA 2KMLA 3QEMB 2HPHA 3UMVA 3H5AA 1NZJA 1FYFA 1RWBA 1UKAA 2IXEA 2ODTX 3KB6A 1SUFA 3STWA 3N39C 3URMA 4ZI7B 5LZ2A 4TKVA 5HF5A 3WK5A 2OBPA 4G1MB 3KIOA 2CBZA 1CR1A 2WD9A 3H9CA 1ONNA 1GIAA 1TU4A 3MIZA 3DKPA 4YR7A 1J9IA 1SR8A 3OX2A 3EEBA 5IAJA 1IPHA 4FJ2A 5ALZA 3RROA 3WTBA 5IABA 2VRBA 1G21A 4M9CA 2WJPA 5CIQA 3U19A 2P7HA 2BH2A 2H63A 4TMTA 3SZGA 2NVTJ 3W6NA 3WWEA 4A2QA 5KZMB 2WV0A 4O2BF 5ARCA 3VAAA 5FO5A 4C4YA 4Q0MA 4RWZA 1E6CA 1RR6A 2R7UA 3GFLA 3ILYA 4UCQA 4Q4AA 4LJAA 4BN0A 3E1SA 1DFGA 1AKTA 4J4BA 2D5CA 2OB1A 1LDMA 3A1DA 3WMXA 3R7AA 3LKBA 1AWCA 3H9UA 1TL8A 2CLHB 1EFUA 1CUZA 1UFQA 4LW8A 3ILHA 1FW6A 1JDUA 1IXRC 3X1ZA 5JDCA 3ZWXA 1B6SA 3FR7A 2ZJ4A 2ZE8A 4K05A 2HHAA 1JHRA 4PBRA 3PEUA 3IRQA 1IK4A 2IAIA 4FINA 3CCMI 5DN6A 5PGMA 4HB3A 2RHMA 3KC2A 1BA5A 1J2EA 2QZ9A 4FTHA 4NABA 2FI1A 2FPPA 2FETA 5D8KB 4I1UA 3M1AA 1BJRE 3OJCA 4OAOA 2Q3JA 2CGEA 4BP1A 2D1HA 4EHAA 4QGSA 1SHJA 3G85A 5IFLA 1NUUA 4QUKA 2JQ7A 2P9EA 4X7RA 1N2CE 1WPQA 3ZX4A 4CI9A 2W4QA 2PUJA 3NYRA 4ZTUB 2YMQA 1RPNA 4GPIB 2NVXJ 4P4TA 3TCKA 5KNDA 3HDQA 1KFBB 4KFTA 5FQNA 3AIMA 4F1WA 1F2VA 1KTVA 1XNRB 4FHDA 1J1UA 2FY8A 3TLZA 2DXIA 3OJOA 2L2OA 3HHGA 1CP3A 1MJNA 4NPCA 1ZI6A 4TTTS 5FBRB 5HSGA 5I3CA 5JJ5A 4IG4A 4DW6A 2L82A 4JOSA 4ZYVA 2V0CA 4B3AA 4QBHA 4LOLA 3DMHA 2DMUA 3IVXA 2AMVA 1HF3A 4XTCS 4F3TA 1YIAA 1ZM4A 1JBQA 4V24A 4DEYA 3M9WA 2EKZA 1X1RA 3WL5A 4EHBA 4XPZA 1FYKA 4UEKA 3DTVB 1EP9A 3UMCA 1K3UB 1M8FA 2XAAA 1SD2A 1P6UA 2AC2A 2Q46A 2E71A 4GD3Q 1MH3A 4OUDB 4R05A 4TROA 1F2DA 1A4UA 2D4HA 4MWBA 3P97A 2FJPA 1T9AA 4HEQA 2ROQA 5EEAA 2YZKA 3DEKA 4MIYA 4BX3A 4EF4A 1FIAA 3GXOA 5IRCD 3VR3D 1K4KA 2PO7A 3BTSA 1MKMA 1REPC 1Z33A 3K4PA 3LLMA 4FMPA 4IV5A 2DF8A 2QVYX 1RBZA 4LJLA 4C2BA 2GBYA 2JARA 4FNOA 4O4HA 4RGVA 3CURA 2DTRA 1KJJA 4IPAA 3G82C 1FVFA 3DQQA 3W1EA 1CRWG 1XTAA 1PR3A 4BY7J 1L7OA 2AEEA 1E2KA 5EUQB 1F8UA 5F1KA 4ETSA 4HH1A 5D51S 2QPTA 2LLKA 4TXLA 1RUNA 3S2DJ 3MT0A 2EKPA 1K6MA 3KD2A 4PFKA 4RA9A 1JFTA 2YU3A 3ABMH 5JFOA 5JS6A 1WY5A 4MW4A 4DNXA 1TCUA 3JD3A 3GNSA 2EBHX 3PLRA 5LKRA 1AZTA 3J7YJ 2X0LA 3S1AA 4CMHA 1XTPA 1FFXA 1H3FA 1JDTA 1MRNA 1K78A 1ZEJA 1ZRNA 2NM0A 3G3EA 3AL0C 3M9LA 2NYAA 4L5YA 4NE7A 3TLGA 4URVR 3BB1A 3N5KA 1QRTA 4FILA 5IOYA 1O58A 2PWBA 3TNJA 3EARA 4QC2A 1WMFA 2JI4A 1P39A 3HB7A 1T29A 2GHRA 2RHJA 2VT7A 2AUNA 3ABQB 4X61A 1AQUA 3V7NA 2IF2A 3RUFA 4GH5A 1SULA 4U7GA 5F2EA 4MWCA 4UFPA 1FDWA 2C1XA 4U9HS 4UBKA 3I32A 5ICEA 1OUMA 1ESNA 1DFIA 2GEBA 2NXWA 3AR5A 4IGAA 5HTKA 1Z22A 2AS0A 4BMXA 4EJUA 2A07F 3PIRA 3FRIA 3QOXA 1IB0A 5JWHA 1JRLA 4C4PA 2WF8A 3EIXA 3LVBA 5I45A 1XZMA 1SBHA 1E7YA 4GPBA 3K09A 1EPUA 3RLIA 4Q3CA 2VZEA 1E2HA 4X8LA 3JQ8B 4YREA 3W4JA 2WHEA 4MEAA 4Y2VA 1GKYA 1TKRA 4ROTA 3NJRA 2AEMA 3LPNA 1Y3BE 3UH1A 2FZEA 2JG3A 2VKHA 2XKOA 3CKYA 4MR9A 1MGPA 3ZOZA 3UATA 4G0NA 1FNNA 3KHTA 3IVAA 1HORA 1SCQA 1A9QA 3TL6A 4KRFA 1D4OA 1FLDA 2G71A 1MX1A 2Z09A 3OTHA 3CIFA 3DC2A 4CHTA 4F2DA 1GWNA 4TTIA 5CVEA 2HIAA 4YP9A 4PTYA 3S14J 3ND7A 5DTDA 3MUEA 1JWAB 1PJ4A 2FN8A 1CY2A 3MHTA 1V9CA 4LRTB 4M88A 1ZGBA 3MXOA 3OX4A 3FOWA 2DKOA 3NTLA 1QHFA 4YO7A 3JWEA 4XQ9A 6REQB 3E1KA 2RIRA 5IKMA 1S01A 4HLNA 2XUPA 2FDCA 2CW0F 5CEJA 2L4AA 1A3CA 1HG1A 2G06A 2LKCA 3AR7A 4MW1A 2H4WA 2D2WA 5TE9A 5FTNA 2GILA 1V1RB 3SAJA 5KTNA 2RGYA 1C4WA 1R3DA 1VQ1A 1SD4A 4QOIA 4FCCA 4IWXA 5AIBA 1E59A 1TM5E 3VTZA 1SFOJ 4YIIA 1LI5A 5EJ5A 5E1OA 4IDPA 2QTFA 2VB6A 4OV6B 5ESDA 2A5LA 8ADHA 1YASA 2AA3A 4RV5A 3MWEA 3WFJA 1BU8A 3QU9A 4JZKA 3P7NA 3TFQA 1PWYE 5HEKA 5DCMA 4EGZA 2Y9PB 3FLAA 2W2OA 2K5CA 3O9VA 2L01A 5HOEA 4M0KA 4NOJA 4YRBA 1FK8A 1Y63A 5D1NA 1GNVA 2GARA 3UUWA 4NCNA 3DNPA 4FLMA 1F8XA 1CY0A 2MABA 2YWXA 3A6LA 3S8MA 4AWAA 5IZCC 2HJRA 3H4VA 4RHTA 1GGMA 3GJ8A 2Y1CA 3K4LA 3M8EA 1XYGA 3K0AB 4KAJA 4M1WA 2O50A 1OX5A 4O4HF 4RFLA 4FZ3A 3TLAA 1Q5PA 2GD6A 5FPTA 1ZCAA 3P9ZA 2AN4A 2RGXA 2JAWA 1YGPA 2ZSAA 2HREA 3O93A 4DPKA 1QHEA 3D8UA 3QLVA 3WIVA 1Z05A 3NAMA 4QFBA 3NTVA 1NYRA 2ACKA 3IOMA 1JDPA 2R5FA 4WZZA 3W06A 2NO7A 2B94A 3P0IA 4GDMA 1GEGA 2DFVA 5A2QK 4ASNA 3GOHA 3ROKA 2ID9A 4KT5C 1I6HJ 3DF7A 5BV1A 3GLXA 5FROA 4E7HA 1R4NA 3PZBA 4RVUA 5IDYA 3ZU3A 1VG9B 3ND6A 4L9RA 4Y6QA 2O5EA 2JT1A 1MO3A 3VO8A 5C7OO 3B2QA 1SEVA 3B20A 3PHCA 3JAMA 3F74A 1AV7A 5H6QA 1U8XX 3E5HA 1YE8A 1UHSA 4U2EA 2FW8A 4JT2A 4HVCA 5JJCA 1UJBA 3PNQA 5L3VA 4ZOCA 2HU8A 3QKRB 4A5SA 4C0KA 4DSTA 1V25A 1AV6A 4RQBA 3E6BA 2CHGA 4UARA 4YIKA 4Q4ZF 1TMKA 4YT5A 1K75A 2VC2B 5C31A 1LFDB 3PC7A 3RJMA 3WYGA 3KQLA 3GRFA 5C3UA 3BL6A 3UV7A 3HKCB 2DHDA 3L7JA 4LC9A 3FBTA 3MWDB 5FOWA 4FX5A 2Q6OA 3GUVA 4YAEA 3DEAA 3JARB 4NENA 5AI8A 3WB1A 2K7FA 1K6YA 1VGRA 2H17A 3LFHA 1GTVA 5K4AA 4I5DA 2FSIA 4HQMA 4YPOA 3N7TA 4FDTA 4BB0A 3C3WA 1TGYA 3NT4A 4M55A 4J6EA 1HKQA 3O73A 3QJGA 4G81A 1OPRA 4MDEA 1FBNA 2O3JA 1DPUA 1LDKB 3C2QA 2WUDA 1T5HX 3D5LA 5AHWA 3WHBA 3ETEA 2P9QA 1Q6YA 1IGNA 1QQ6A 1HTBA 1UMCA 1W48A 1Y7IA 2FQWA 1Q0RA 4AQ7A 3ORQA 1MMSA 1GU1A 3TXAA 1XDWA 4C4AA 1ND5A 5DN9A 1SB8A 3ERCA 4GYKA 3OYBA 4HWKA 2IW1A 1PIWA 3CZMA 3RF6A 1UPFA 1HQYE 4E70A 2HLDA 2XUZA 2V59A 3EA5A 4HRVA 5A6SB 1A8UA 2FRVA 1KEEB 1M2WA 3H16A 2AO9A 1XEWX 2NU9A 4L4ZA 4MHSA 1KZ4A 4GO1A 2B4YA 2M2IA 4LZLA 3TJZA 4D45A 5ISMA 2IHBA 1E9FA 1XZFA 3ZJTA 4HX8A 3GT0A 1BDJA 5EJ2A 3DFMA 4XM0A 4IIXA 4LF9B 4DT1B 3TW6A 5M04A 2ZI4A 1A6IA 3TRHA 2JCYA 4KGXA 4DQ2A 1Q0LA 4NMXB 4M8SA 2C29D 3L2WA 2BL4A 3MJCA 2BLLA 3D6MA 3HRTA 2I2BA 3QUAA 5ALDA 1HKSA 4JSTA 4IKOA 4Y0NA 5KPDA 1TM3E 2IU4A 3IWZA 1N5RA 3F4KA 121PA 3ZDAA 3T5PA 5JCZA 2DPHA 1JLSA 4RPJA 3CINA 2IU6A 1PJRA 1UMQA 1E1DA 4ENUA 1AQJA 4FCTA 3S5UA 4MPJA 2GBLA 1GFSA 3O5AA 3I12A 4GGGA 3KYJB 4OXRA 4WN3A 3QP5A 3UR3C 1EEHA 5FBKA 5D3MB 3WWCA 3NGXA 1LEBA 3UHOA 4N82A 4QPDA 2J32A 1GLGA 2JW5A 3LW8A 4G1BA 3GZ5A 1FP4A 3LWBA 3ZXXA 4UUAA 2BDUA 5CDGA 1R36A 1OQAA 1D4FA 2VQ3A 1U3WA 4V03A 2JA1A 3L8YA 4IIJA 5F73A 4DR6B 4K2HA 3RUAA 2A69F 2QLMA 4TV7A 3WA7A 3E7DA 4MUXA 5J3JA 2XYHA 1OGYA 1LE8B 4ZQIA 2RHLA 1AKRA 1Z5GA 5H70A 3I9NA 4URUR 2GHIA 4BKMA 4IQ8A 3H9JA 1JHOA 3M07A 3MJTA 2GR9A 1IZ0A 3GEZA 1CZRA 4IDQA 3UG6A 1VCOA 1I39A 4I8XA 3ZIDA 1W36C 5B57C 1UPBA 2I1VB 4DLWA 4F2GA 1RC0A 2O7QA 4GNRA 4MPTA 3E27A 1G3MA 4KE6A 2JZOA 4C3IJ 1SXIA 3ACDA 3ETNA 3K1YA 4JWTA 3STHA 3KOOA 2KP6A 1D2CA 2C57A 3A14A 3N76A 4X93A 4YQZA 1KA9H 2B9VA 3GUCA 5ALXA 3SF8B 1PJCA 1XSEA 2GK6A 4V2UA 4G84A 2K4JA 1F60A 4M1TA 2I5UA 1MA3A 3RH0A 4ER0A 4RD0A 4RM2A 1Z29A 2IITA 2PXXA 2UZAA 3KTDA 4UHTA 3N3BC 3BWYA 1FNSA 1F2UB 1Z9CA 2PL9A 2IPXA 4XYMA 3HUEA 2O8DA 1GKUB 1FUEA 1UXGA 1X8LA 5KDLA 2Y3IA 1I2ZA 2FWPA 3KZVA 1GITA 3QQAA 1OAOA 4QXPA 3TTUA 2H94A 2PD3A 3VZPA 4TVSA 2W4MA 2OV1A 3AUKA 3CUEF 2NZ2A 3KXPA 1RHJA 3SBDA 3ZY6A 1U9JA 2CLSA 5JS7A 3LDAA 3QNUA 4CYCA 1MU0A 1HH4A 1FTQA 2G5GX 1FJHA 4FN5A 2YN0A 5CR9A 5BOSB 4YIRX 2GN9A 1PR4A 3D6UA 4WCFC 4K9DA 5JRDS 3GBGA 4BFXA 1USSA 3FMIA 1CUFA 1NQAO 1VCMA 1MXHA 4L18B 1ZGZA 2QTBA 2ZRAA 2AYXA 2QHXA 1F36A 1NBOA 3AI1A 3MW8A 3JTHA 5ALNA 5FLYA 4CCYB 2CUKA 1X7GA 1BX3A 1I4WA 1NC1A 4CM8A 1E1RD 1TCAA 1EUDB 1SIOA 4HEJA 3FDZA 4D57A 3BE5A 1UC8A 4B40A 4D7AA 4L0ZB 4P1ZA 2P5VA 4OIRF 3DKXA 4WUVA 3KR1A 5JS8A 3VPHA 3HM9A 3SS8A 1THTA 2D45A 1ZIYA 3KP7A 4FEGA 5K3EA 1MB0A 3UJNA 3Q8LA 2ZPUA 1ZK0A 1LK5A 3MXTA 1ISGA 4WIAA 2HVQA 2NXNB 1U0GA 2NQ8A 1OKKA 4C0LA 5HQTA 5EIAA 2GXUA 4DIQA 1UFMA 3ONDA 1D8KA 3PFGA 4MJ7A 2R7OA 1IRIA 3AOGA 4PX5A 3SC2A 2D62A 3ZXSA 1L3BA 3WDKA 3L7KA 3MWGA 4PZUA 5BYAA 4RKYA 1LPQA 3Q4GA 1SIUA 4LK1F 1A9XB 3RREA 1Q0SA 3LQ2A 4BHTA 3DEWA 1PJ8A 4DIOA 1XWWA 4C4XA 4GQBA 3HGGA 1DIGA 1SGWA 1UQRA 4GMXA 4ZA2A 4ML3A 5LHIA 1EM8B 2JH9A 1SOAA 3QE3A 4YFXF 1YZYA 4X24A 3R75A 3L2RA 3K10A 1O6CA 2Q50A 1HC7A 1HUQA 1TU0A 3ZVLA 3UPUA 2I78A 1LBIA 4QGHA 4EG8A 4FS3A 3UOGA 5LL6P 1TGVA 1ZVQA 1H66A 1KDTA 1ZCBA 1OGJA 2BGKA 1X3SA 2VJKA 2LCIA 2UV8A 1J22A 2CXQA 4B4CA 2YWBA 4YMUA 2W43A 3IP5A 2QAGB 2BZGA 3FMPB 3LWDA 3I6BA 5J1SB 1CBUA 2ZBDA 1MC1A 1AKQA 2SICE 1GPH1 1Z47A 4MV7A 4UNRA 2PT9A 3BUSA 2NAFA 3F2VA 1LNWA 2IPAB 3IRVA 4GT1A 4EDFA 4EPVA 4BCCA 1LQ1A 2E2IJ 4MQ6A 1WH5A 2VNJA 4EZIA 1F17A 3T7DA 2LV8A 1LDBA 2IHNA 1UBKS 3W6ZA 2YC2C 1MBKA 4HWSA 4I8IA 1JDNA 3L82B 3O4JA 4ZU3A 3ZN1A 2WP0A 4LK3A 3RTGA 1REQB 4A8TA 1J2RA 4QBIA 3IIJA 2QTWB 1E66A 3C97A 3VO1A 2NIPA 3M6MD 3Q6MA 1IOZA 1GT6A 5B58T 3V4LA 2NYRA 5C35A 1YK1A 4WXYB 1MOQA 3NG1A 4DR7B 7ADHA 4BC0A 5TMDA 2LIVA 4JYMA 4AZ3B 5G0SA 2JFPA 3DMNA 3IXMA 1AO3A 1R6XA 1S1MA 3OOHA 4W5HA 3JPWA 1WZUA 2Q6IA 1WB4A 5D8LB 4BBRJ 4A0GA 1PUFA 2IHKA 2YJNA 2HQAA 3OWHA 4FHGA 4RGRA 4QGBA 1ZUNB 3RIGA 5EMNA 2CXRA 2Q9CA 2GZ2A 4MB6A 4E4TA 2TSYB 4YT2A 2WABA 2PA3A 3B1JA 2E49A 1CUAA 3LA6A 4BLUA 4Z1MD 4UJ3A 2EJVA 5HHTA 1CDZA 2YDXA 1FDVA 5HZMA 4ZOLF 3UK6A 5C1DA 4RYLA 5JAQA 3T3GA 4IQGA 2VC1A 4OB7A 4A0FA 2IA2A 2EZHA 1BS2A 1E1CA 2JJMA 1BS9A 2NZVG 2ONZA 2QXUA 2WUVA 3CN9A 3TR0A 1RQNA 4DJTA 4BXOB 1JJFA 1CDOA 1N9GA 2FQQA 5F0FA 2R5ZB 3ADDA 3U7EB 4PAMA 3ZU5A 3M3DA 4US0R 3H5WA 1QHNA 4K7JA 4P93A 3WQHA 2QENA 3EEIA 4ZQGA 3WU0A 4KRYA 2VJYA 3G8DA 3R76A 2LNBA 1E3DA 1N4AA 2YXPX 1ZH8A 3U80A 4L8WB 4F2WA 1NVXQ 2R00C 4FUTA 2G9WA 1USKA 3FSJX 3OSZA 1Y48E 3A27A 4GP9A 3FZGA 4DT1A 2FX5A 1EP1B 3KZ1E 1H1LA 2FVXA 2BFBB 2IYYA 4ZC3A 2RONA 3SJAA 2ZQ5A 4ZDJA 4ND2A 2NYVA 2I87A 3OF2A 1LNZA 3WGVA 4J4HA 1ZGHA 3E6MA 1KEEA 3U21A 2B1JA 2XPCA 3IGFA 4MP6A 2ZBKA 4I66A 1YQTA 4E2FA 4M1YA 1DC3A 4MW6A 3KJNA 2XAUA 2Z1MA 2DMRA 4FHFA 4ZZDA 3A1UA 4K87A 4TTVA 1S7AA 4PZZA 3AB7A 2ZEJA 3EMVA 3HRMA 5FI0B 4KE9A 2QVGA 1QUEA 4NU0A 2RNGA 4D46A 1I80A 5KVSA 3K8YA 2BF4A 2JA8J 4NK5A 3KR9A 4R2LA 5GP1A 4AJPA 4EHDA 4ZCLA 4QTRA 3GA7A 1YOVB 2CBXA 1H5NA 3TLEA 4OATA 1CE8B 3LKZA 4L85A 5IUNC 1ZK8A 2EF1A 1JTYA 2P2NA 4UXHA 3T9EA 5BOXA 1QONA 3FVQA 4AXBA 4BGIA 5CXUA 3LPCA 1NVVR 3SZOA 3J80K 2Q7XA 4DKXA 2W00A 3AR9A 4UTPA 2POCA 3LPLA 4ZYHA 4JBWA 3MFYA 3M3HA 1B9MA 3H75A 3RHTA 3B3QA 3GDHA 3VZSA 1NNSA 1IXSB 4BLSA 2F43B 4HEA1 4MRVA 3RU9A 4C1NA 5MGBA 3MMSA 5C52B 3G1UA 5BV8A 2Z1NA 4JLVA 1ONPA 2PUGA 1RQPA 2OYCA 5C37A 4DILA 1CX9B 2JIOA 4RZXA 1DP3A 3C6BA 3D0RA 4EW6A 4DB2A 4O1MA 5CITA 1NE2A 3GCDA 2Z9BA 2ZE5A 1J97A 2AS5F 1SD6A 1L8OA 1ZC4A 4A8HA 4QGAA 4B75A 4AZ3A 3ROQA 2AT1A 2PX5A 3KP5A 3OO1A 3E48A 1I7QB 1T0HB 2EVWX 4K86A 1R1UA 1SPBS 2NTNA 3HL2A 2ERXA 1C30A 3OHSX 2W70A 3H3JA 2OP1A 3EXEB 1MDMB 1G5TA 1G6Q1 2P9CA 2CVHA 3PL5A 4HGQA 4NPAA 4DN6A 2O8XA 1TYDE 2ZIVB 4TWIA 3RC8A 3R6SA 3S2EA 4JP2A 3ON5A 4QIWN 1P60A 2EC5A 1R4ZA 2OZPA 2KB0A 4K9QA 4LDPA 5K8VA 5DTJA 5FA6A 3Q8XB 4F6CA 1W7AA 3F0TA 5I9MA 1DC6A 3A9VA 2GEKA 1QZXA 2C5AA 3FFXA 3F5FA 1M2VA 3PBKA 5ICFA 4L75A 5CT8A 3RFVA 4BNHA 4TZKA 2GETA 5JOQA 3O2QB 4DIKA 4DYQA 3AKCA 4B32A 1GADO 4HP8A 2Z2IA 3GJXC 4QPZA 4ZFNA 5E7JA 3STYA 1SVNA 3QOEA 2VYQA 1Q7TA 2J5OA 4IS2A 4M21A 4YGXB 5LIRA 4CDGA 3QY0A 5LZ5A 1WNTA 4XLZA 4TSRA 3DVLA 2MH2A 2A7QA 3IP1A 4Y67A 1RQRA 1U4NA 2EBUA 3TEFA 1YQUA 2CBGA 1OISA 1IC8A 1IL0A 1KVSA 1FFAA 3MCZA 3IO3A 3KM0A 3NBAA 4IIJB 5AOVA 3ZWPA 7GPBA 1UKBA 1OOEA 2VDJA 1QZ3A 4XK4A 3I2HA 3LDGA 2Y27A 3PXCX 3ETGA 1F51E 1U0OC 3LPAA 4JGGA 1YJ8A 5LUAA 3HEBA 1P62B 3EDCA 3TEJA 3MGKA 1A6QA 3FNIA 4FR5A 4LFUA 4HDUA 4HNSA 3FX2A 1XBTA 5EPOA 1U0EA 2GZ1A 2ISCA 4YONB 4NCJA 1FC3A 1T9ZA 3THRA 3LUAA 1C9YA 4D79A 3IJ5A 3MQ2A 2JPBA 2LBFA 4XARA 1VA5A 3OZEA 4WXCA 2M1ZA 1GAWA 3QVLA 521PA 2WNSA 4AN0A 3AW8A 4JENA 4GWGA 1KPIA 2WUFA 4RGYA 3PEEA 2BEUB 1SM4A 2RGNC 2Y69H 1NJ8A 1W76A 2XMDA 3GVXA 2Q3LA 3HXKA 4RYDA 5DEQA 1XVLA 2X58A 5DCLA 5BURA 4M1QA 3TBFA 3WXMA 1XRNA 4YBZA 1SXGA 4NU8X 3GFQA 1DBSA 1RI7A 1PGQA 1XTSA 4D0SA 4R1TA 3DPUA 4H31A 4RZ2A 4I76A 3FKSA 5FPSA 4RLQA 1FFEA 2EYQA 3GVIA 4UXNA 1E69A 2WPDA 3RM3A 1MD9A 4JGBA 4DV1B 1FSSA 3OPVA 3T35A 4BGVA 1GDHA 2ZYRA 4BU1A 4BQSA 1R8XA 3I04M 4CYCB 4LLLA 2QGUA 2C96A 2QG4A 5EY5B 4LEIA 1XKTA 1BN6A 1DIAA 3WLIA 3PEYA 1CP2A 1I3AA 1XX6A 3CRMA 3U7JA 1OBCA 3WGUA 3H97A 2Q0SA 3O8QB 4B2IA 2DPDA 5DM4A 2VSXA 3SYRA 3OFND 1TOAA 3RRJA 2BUBA 4ONEA 4XMYA 1Z75A 3G5UA 2NGRA 2Z2SB 1QGAA 2WB4A 1VOTA 3AH8A 3FMRA 1M8KA 2Z6UA 2QE7A 3SEQA 1QDLB 2EFCB 5TC4A 3NU1A 3S81A 1N2SA 1XWFA 3PFHA 2FBKA 1Z0IA 3U13A 1SUWA 3A2MA 1YDWA 4N8DA 2HQ1A 4BV2A 4KX5A 2A9QA 2QB5A 2PYDA 3FZQA 4IX1A 4P4UA 1XD9A 4ZO7A 5D2CA 1M1YA 1SKUA 4YAWA 5EVCA 2I8DA 2VJOA 4Q7LA 2OPBA 1OLXA 3KL4A 3O74A 4N41A 2Q1TA 2CDCA 4FU0A 1Y33E 1ADCA 2L4MA 1Y4UA 4M0FA 4MA0A 1NKVA 3T95A 2PGAA 4U3JB 2EJBA 1G2PA 2D2XA 4CVNA 3EY9A 1XZIA 1YR6A 2JIZA 1ZHOA 1DI0A 5T3UA 1TZLA 5KWJA 2HRRA 5ILSA 3DG9A 1HNWB 1OE0A 5HF6A 1E9DA 2W58A 4QPJC 2O48X 4UUOA 3EVZA 2YU9J 1E7MA 1TKBA 5CBPB 2FRDC 4D42A 4WEQA 2H2WA 3CPEA 3AG2H 1LBHA 2IUSA 2LCQA 3KPJA 1JEYB 3I6ZA 3RSHA 3MHPA 3EC2A 1LVAA 4OOIA 3MFKA 1GDTA 1P77A 3H6KA 2IYAA 3TLXA 2FOIA 1GNTA 3SQLA 1E1QA 1SG0A 1UT8A 3L5KA 4WFQA 2Y30A 1WV0A 3M83A 4MGIR 3UZUA 3O2SB 3BMCB 2DU8A 1IZ7A 3U4IA 4Q5SF 4HSTA 3GZ4A 2JK0A 1JAZA 4OOEA 5CJPA 4DGSA 3L0OA 3QYPA 1NSTA 2YYAA 4MVJH 3BMQA 3HNOA 2C7PA 3DOCA 1GQQA 4DWWA 1D2EA 3DTVA 1LC3A 4N3GA 2BLNA 2PX4A 1JA1A 1R4AA 1HW5A 4X8OA 2IA1A 4YV0A 4D82A 4KR6A 1SQFA 5HS8A 1R49A 1E3QA 2NU8A 3NAGA 1ENYA 2XUAA 1SELA 3FOBA 3NXSA 3O8DA 4GI5A 4ROSA 3PE4A 4I9NA 2P79A 3GPCA 1JQBA 2PFSA 4PUSA 1R22A 1U1GA 1TPZA 2XXBA 3T7SA 4QYIA 2KISA 2NO4A 1QIDA 4BBSJ 1OH8A 2VQHA 3WNVA 3GUYA 3FI9A 5I51A 1LB2A 5HUHA 1M67A 3TDKA 3FCSB 1JMYA 3RFTA 1T13A 2G9ZA 4PPGA 1VMIA 4MUHA 5FO1A 1ODKA 5ELLA 3Q3SA 2BSAA 2WIFA 1VIDA 1HI9A 3N8KA 4X6YA 3E5MA 4EQZA 3FXUA 3H0GJ 4FB5A 4WZBA 1OBVA 2ZS8A 4QPOA 1VCIA 4QO7A 2MOKA 2UVPA 1Z8NA 4L22A 3DBHB 2HO5A 2OYSA 4BMZA 1HRKA 2NVUA 3IC5A 2EQAA 4RJLA 1RYFA 2VJNA 1II9A 4LRUA 2YVUA 3CKKA 4G6ZA 4H27A 1Z7BA 3TQOA 4DWJA 3CVXA 4LK2A 3ROPA 3ZWWA 1H0MA 2XWPA 3MCAA 2QW1A 4GL4A 4CV0A 1C2YA 3LCRA 1OX4A 4IXMA 3O82A 3JASA 3KEYA 2IPQX 4E5UA 1M7HA 7YASA 2QSFX 5EJFA 3GA0A 4QOEA 2WYVA 1ZLYA 3QK7A 1K86A 1NVAA 2A58A 4X6XA 5FB3A 1LTHR 3QPHA 1Q1GA 3MCWA 5P21A 1DAFA 3ZXYA 3ZVMA 4IO9F 3DYBA 1T91A 1KP9A 2R7MA 3AVOA 2ADMA 4LSZA 5ILUA 3MQ0A 3EA4A 3I92A 4FZVA 4D7MA 1GG5A 2K6GA 2ZVQX 3HZZA 5E6RB 1PSZA 3IAXA 5JXIA 4NXMB 3A05A 2OCLA 2O8BB 4MZDA 1R0RE 1SG6A 5FHRA 3AHHA 3EJWA 5DN6D 2YCBA 3G9UA 3L46A 2O0YA 1B4DA 3DTKA 1J00A 1N0WA 4CCWA 5KC9A 1V9LA 1DMSA 4PAWA 5AVTA 1NQOA 4DE5A 2IL1A 2Z95A 1WCMJ 1QG4A 2C2HA 3PQ8A 3AP3A 3HA2A 3ZZMA 4BZPA 2H06A 1ZJWA 3D3JA 1QHSA 2HQSA 2Q3MA 5LCXA 6NULA 3DMRA 2J41A 1ISMA 1ISJA 1SURA 4R69A 3OCYA 1GN8A 2OC9A 3DKWA 1OCPA 2NW6A 4HQNA 5JSUA 1V3VA 2DYKA 2PKQO 3D6NB 4XYBA 2XYRA 1ZGAA 4LZAA 2BFFA 4MEBA 1U1CA 2EBIA 1ERDA 1SWVA 2NZJA 1E7RA 3HNRA 3LWZA 4MJ3A 1QDEA 5GONB 1EJ9A 3D2CA 2WPDD 3HPQA 2JI6A 3JD1A 1MOPA 3QA3E 2Q3DA 4FB4A 2O8BA 4KXFB 1ZC3A 2RG1A 5JRJA 4HUJA 4IUCS 3UJ7A 3L2QA 1W4ZA 5JJKA 3H17A 3GP3A 3LE8A 1G2OA 4FYJA 3KZNA 4XLCA 2AXLA 2IYUA 3HKDA 1MNDA 3N2KA 4ZAXA 1H22A 2NT3A 1IM5A 5IHXA 4R41A 1Y5LA 2GWRA 3E5QA 4AIJA 4AD9A 2IE0A 3M9XA