3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
1RJEA 4KYWA 1FWZA 1EJ0A 4E32A 1T43A 5DSXA 2QQ9A 3LBFA 4M72A 2C6YA 1V39A 1ZQ9A 1IN6A 4EGZA 3MZHA 3KP6A 1SAXA 3Q7EA 1XSVA 1VQ1A 2M87A 1NV8A 5K0FA 2A07F 3GFMA 3HTSB 1HNNA 3V8JA 4U7PB 3SR4A 5DLYA 3ZN1A 5L3CA 4V0RA 5DTQA 3E23A 1L0OC 3REOA 1F1ZA 3A7EA 5HIMA 4IV0A 1U6GA 3LDGA 3GIWA 3GYHX 1P1BA 2NXCA 3MFKA 2YX7A 1M0EA 2UXNA 5HS9A 1QANA 2AOWA 2LKPA 1IXRC 3KPWA 4QPNA 4HGYA 3ZP5A 2P7CB 2BBYA 4KUMA 3BROA 1BM9A 3DP7A 4ETSA 4MWZA 5KS2A 3VFZA 3I58A 4RGRA 1OYWA 3T7TA 3SXYA 1ZLKA 4QQKA 2BYVE 3OZSA 4IRIA 4L0YB 4CTJA 3ROUA 3HVIA 4WCGA 2AOVA 3TMAA 3DMGA 5GWXA 4BLUA 3JTHA 3WTUC 1NT2A 4U7DA 3I54A 3E05A 5F2NA 5JHUA 2E1CA 4KNYA 3EMBA 3NVKI 1R5GA 1K6OA 3F8BA 1I1NA 1Q0SA 4PGHA 2FBKA 4K2EA 3PX2A 1IN7A 2Q8KA 4HC4A 2PMHA 4E2ZA 2HZTA 3FUUA 2K4BA 2MBFA 3GZ5A 4OA8A 4A0ZA 1BKYA 3K9TA 3HA5A 4EKIA 4Q47A 1XTPA 1YW9A 4I01A 4FP9A 5FLXZ 3M6WA 2HEOA 3A4TA 3R6TA 3HP7A 1HQCA 2COMA 3F72A 4EVIA 2STWA 1RJGA 2G9WA 2XHKA 3ORHA 4UVCA 2XAGA 2ZIEA 3L9FA 4O6JA 4AIKA 5H6QA 2MA3A 2D1VA 3KQYA 2MH2A 3IRQA 2Z6UA 3LCVB 3WSTA 2D45A 3NWEA 3R9XB 2W84A 2O0LA 4PYMA 1N2XA 3DTNA 3PVCA 2WA2A 3GZ6A 1NW3A 2AN5A 1S8NA 1E2XA 1YS7A 4BY9E 3DOUA 1XB4A 3TQNA 4EV0A 4IPAA 2EWNA 3GF2A 5FGMA 2YUIA 1KHHA 2YU3A 1VP3A 4M71A 5FWDA 4BP3A 4R8HA 1HW1A 2M30A 1R8XA 4GYGA 2Q2EA 3J81K 4AZTA 2ZBQA 5T6BA 2EFPA 3HHHA 1U2ZA 5DPMA 2EFWA 3FPFA 3LCUA 3LBYA 4BP1A 3GNLA 5FFXA 3QPTA 2DQLA 4GF5A 1ON2A 3SSOA 4L7VA 3D2LA 4M37A 1OYIA 1O7FA 2P3QA 1XGSA 3FF5A 3TR6A 4RTJA 3O6BB 5CYVA 3IRRA 3COAC 2L01A 4HF0A 5CVUA 5K1YA 1P4WA 1SVUA 4UV9A 2QRVB 1SMYF 4FSXA 2NYXA 3NRVA 1B1BA 4GYIA 4ON0A 4ENKA 1JTEA 3BWMA 4OQEA 4ESFA 1ORIA 1Z6TA 4OINF 2PI0A 2VOOA 2QVOA 4MEXF 3HYIA 1G3WA 4YUWA 3G2QA 2YXEA 2FMYA 3RKYA 3LL7A 3TDUC 1LDDA 1O3RA 2AN3A 2QRVA 2A68F 1OKRA 3KQTA 4RWZA 3FTFA 1A04A 4ESJA 2NXNA 5D1NA 3W6KB 4M6XA 4FT2A 1N7IA 3HTXA 3DPTA 3LA7A 2EJRA 2JZYA 1ZG1A 5DM4A 2IRFG 3LQQA 1VBFA 5ICEA 2QWWA 2OO3A 3CDHA 1T2KA 4EQZA 4R1HA 3KP3A 5J6XA 4OMZA 2HNKA 5DX0A 4ER3A 4EK9A 4L5IA 1IXSB 4LLGF 2NXJA 3JWIA 1I27A 4V0QA 1JQDA 5ILVA 1Z91A 4HQEA 2JJQA 1FNNA 2BEOA 4JXJA 5LEKA 3N4MA 2ZTHA 4E70A 3IV6A 1V3FA 1S3JA 2HOEA 1P39A 2VS1A 3C18A 4M6YA 4BXUA 5DUKA 2PFBA 1DPUA 1ZLJA 1KU2A 5FO5A 4FSDA 3RW9A 4OOIA 3GFLA 2EFJA 3EUHA 3HCEA 4MEYF 2L4MA 4FX0A 1XCVA 2XYQA 3TO6A 4Q4ZF 2IA0A 3R6SA 3VC1A 2HTSA 5CJ9A 2ETHA 2B0LA 2UYHA 3OOPA 1J0RA 1Y8CA 5F6FA 2GA1A 1IN4A 4IVNA 4FT4A 2IBSA 5EMLA 5HEKA 2CYYA 3PQJA 2IW5A 2IA1A 1XVAA 3R60A 2GAFA 4I7HA 3T8RA 1AWCA 3KLNA 2P3LA 4KWCA 2ZBRA 3EEYA 4I09A 5A2QZ 5EZSA 1QQIA 5D6EA 4A5MA 3NEUA 4YUXA 2IH2A 1USTA 3EDPA 5E2AA 1G3SA 1HMYA 3BWGA 3M9AA 4P58A 3ZMSA 1Z3CA 1J5YA 2B78A 3KPVA 1TBXA 1KPIA 1REPC 3CJQA 5CIYA 4GO1A 1NV9A 3VSEA 4NB5A 3VYWA 5LR6A 5JFRA 2X4HA 3UJ9A 4KIBA 3JWHA 2KIFA 1KQ0A 2FEZA 3X0DA 4RAZA 1T38A 4KMUX 2P7VB 3TOBA 1EG2A 2YQZA 3LPMA 1XGNA 4NQWA 2BM8A 4Y17A 1SFUA 3KPYA 3D0SA 5K0LA 1FYKA 5EHGA 2GAUA 4AZSA 5E9WA 1DCTA 3GRVA 4RVHA 3CUQA 1D8JA 3KR9A 1KPGA 3KE2A 3KZYA 3R0AA 2VN2A 1Q0TA 4RTNA 5L3EA 2L4AA 4O3MA 1YO5C 3GO4A 1YFHA 2DU9A 4MHGA 2AOTB 1ZGJA 1LEBA 5FA8A 2ZFWA 4XBFA 1ZH5A 1FOKA 3BZ6A 5ERIA 3TO9A 4U0WA 2HS5A 3HCDA 2BZGA 2I6GA 4YMGA 4LG0A 4KVZA 4KT5C 1DUXC 4IHTA 3EVFA 4MTEA 3O7WA 5BS6A 3Q5FA 3LFKA 4UVAA 1UIRA 2EV6A 2M1BA 3SX0A 1IAWA 2OA4A 1G3TA 4CGZA 4MIKA 4KDPA 2OY0A 4R6XA 1FX7A 5TRDA 4HW0A 3SZTA 3RIRA 2H27A 3KLOA 2ZNZA 5JUWA 3P97A 2L02A 4RSRA 3IC7A 3KZZA 3G2OA 2XVMA 2Z99A 2EX4A 5HDGA 5BXYA 2OBPA 2R7FA 3EVAA 3HRUA 2VBWA 1PUEE 4I98B 5GM1A 3SGLA 1MHTA 1STZA 2VDWA 2IT0A 3G8BA 3K0BA 2DLLA 4UNOA 1F3LA 3G8AA 3A26A 4R79A 3NMUF 3KHKA 4M9SA 1ZRDA 1SMTA 3ZMVA 2W25A 3F23A 2GXBA 5DTMA 5CLSA 2NNWB 3CO6C 5CD1A 3CKKA 5IT9Z 1TQIA 2QLZA 1RJFA 2ZW9A 1G4DA 1RIOH 4B09A 1BC7C 2IJLA 5LBQA 2Y1WA 1BI0A 1D3YA 1QZYA 3ZMZA 4LGWA 3V8VA 1EV7A 4RTPA 1VLMA 3PFIA 3WU0A 5E9QA 1AQJA 2KIUA 3QAHA 4BHBA 2OAZA 1LQ1A 3RPUA 3Q9SA 2P8TA 4OMYA 4ZTBA 4PIPA 1XGOA 5HOOA 1ODDA 4I02A 5LRSA 1YYVA 2ZCWA 3M7GA 2H11A 2EJTA 1KP9A 3ECHA 4EJOA 4YV2A 2VBYA 4UOEA 3MQ0A 5HVQC 5DCFA 2JH8A 4IF4A 5JR3A 2FYTA 1B6AA 4P96A 2HKXA 3P2KA 2EB7A 4ENMA 3ME5A 3RI4A 2FXAA 1R1TA 4ZZDA 3M8FA 5ERGB 2P1DA 5LQJA 2KKOA 2DULA 3KP4A 3UFBA 4HH4A 5CVVA 5DD8A 5IT9K 2OBFA 3F21A 2HKOA 4XCXA 3HOSA 4OIOF 1UB9A 1O54A 1JGSA 2B9EA 3TOAA 3DEUA 3IWZA 1I1SA 3E5QA 4L9JA 5D6FA 5E8RA 2PVCA 3K2ZA 1XGMA 5GP1A 1JQEA 2HQNA 1INLA 3C7JA 3SM3A 3UJDA 4CICA 1MJAA 5LHIA 3BP8A 3NJRA 4A5NA 4X63A 4DA4A 1LJ9A 4ER0A 1I5ZA 4DQ2A 3V8LA 3ANXA 3BOQA 1FT9A 3DQVC 4OIQF 3U2RA 3MAJA 3NWBA 1MJ9A 2F5CA 1R58A 3F8FA 2OQGA 5EKUA 5K8VA 1JXSA 5C9ZA 1YZ3A 3RKXA 2GH1A 4PNEA 2VE8A 5CVEA 5D5XB 3FUTA 1TNSA 1IRGA 5FB2A 2QM3A 5DX1A 2XKPA 5DYMA 5HOQA 2KW5A 1ZREA 3M6VA 1BC8C 3DR5A 3GRYA 3K1PA 1KXZA 1U5TC 5D8LB 3ER9A 2I62A 1FBQA 2VP3A 2PG4A 4OU0A 2LD4A 2EJUA 4OQDA 4HF1A 4M9ZA 3SZPA 1R36A 2QBYB 3P8ZA 3R24A 3UJ6A 1IF1A 2CFXA 1Y0UA 2M5WA 1L3IA 4AIJA 3P9NA 3KFWX 4CWAA 4X61A 4MNUA 5P8WA 1NKVA 5FLXK 4QTTB 3T7RA 4UVBA 1BOOA 5L3BA 4AX8A 3TQSA 4PIMA 3KQOA 3HM2A 3V4GA 1YW8A 2YSRA 3TO7A 2ZSUA 4PCLA 2AOTA 3I0TA 2IPXA 3H3ZA 3GRRA 3SHFA 1ZG3A 5CVRA 3HA3A 5GIOE 2RGVA 5HS7A 1DDNA 2GLUA 4HTFA 3ML6A 1PP8F 4BAYA 3FM5A 1XDUA 2E7XA 2PEXA 3F6VA 2P6SA 5EMMA 4FHTA 1EH8A 2V1XA 1ZG5A 1VTNC 2MLKA 5CVJA 3B89A 2XGXA 2IPQX 3MQ2A 3LKZA 1J59A 3UBTA 2NAZA 3D5LA 2RV8A 4G6QA 1RI4A 3WG9A 4C04A 5T64A 2HMYB 1NE2A 3MTIA 4MQ4A 2YX4A 4ISCA 3KR0A 5BP7A 3T0YA 4B17A 1USSA 2GPYA 3TM4A 2HGCA 2MLGA 3M70A 5LGNA 1B9MA 3HRSA 3FWEA 4D0PA 5HIKA 3BT7A 10MHA 1W7PA 5LGUA 1D2GA 2GB4A 3RDIA 3BDDA 2P7HA 5E1XA 3BUSA 1D2HA 3E6BA 1HKSA 1MD0A 4G9YA 3EVGA 4HX7A 4PYKA 3CUQC 4QVKA 5LEJA 2PSSA 5E2BA 2PGXA 3KCCA 1CF7A 3JAMZ 3EVBA 3FYDA 4IXAA 3I71A 1GXQA 3EETA 5H02A 1SFXA 2XV4S 1KYZA 2VONA 3EVZA 5DEQA 4RTOA 3FZVA 2AXLA 3BGIA 2YXDA 3QOWA 5EHIA 3HOTA 1RJDA 4BLVA 2FQ3A 1EJ6A 2RQPA 5KQSA 2DPUA 3EGIA 2EA4A 2ORED 3B02A 1T39A 2W85A 1UFKA 4EJUA 1RZ4A 2VBZA 1O3SA 2ONZA 5FUBA 1UCRA 2BR4A 3E5XA 2FHPA 4YFNF 2ACJA 2JPCA 3CJTA 1ZGAA 1FJXA 2BGCA 2O8XA 1J9IA 2IA2A 1AOYA 4DF3A 1TW3A 3FXUA 2PX8A 2V6CA 1JR4A 4LMYA 2DI3A 1O9GA 4R8SA 3O2PE 4LK1F 3RKWA 2WA1A 2QENA 5CVIA 1D2CA 1IRFA 4UUVA 4P7KA 3G3ZA 5DM0A 5HDKA 4QPPA 1K7AA 4NECA 3FXRA 4PYIA 5U4XA 4LFUA 4BHCA 3KQWA 5IKMA 2IH4A 4WX9A 4XRFA 2QY6A 2L3DA 4E30A 3V8KA 3SXJA 2ZKZA 4RTKA 5E18F 1FBUA 2XYRA 4KW7A 4UV8A 1IXKA 1XJ5A 2D1HA 4M74A 2JSCA 3G5TA 1SKMA 5K5OA 3WU1B 4KA4A 3H92A 4YFKF 3TRKA 3AXTA 1I6XA 4FGZA 2AS0A 4RYLA 2BV6A 5FHQA 1SD6A 4C4AA 2ZBKA 1PP7U 2XAQA 2EK5A 3E97A 1NW5A 2OYRA 1YTYA 3CLOA 1OR8A 3V7SA 4MHTA 5E20A 4CKBA 2A6HF 4GXOA 1HKQA 2I9KA 2IH5A 2HTJA 1O3TA 2F8LA 3B3GA 2HFHA 1D5VA 2CG4A 4GOOD 1BOAA 5LLQA 1LDJA 2NP7A 3GU3A 3IHUA 2Y1XA 2LSOA 3CJNA 1T6SA 4QDJA 4E33A 2JG3A 2G1PA 3GXOA 2XRNA 3G5LA 2P35A 1LDKB 3GWZA 3I9FA 4L0ZB 2STTA 5HLHA 1X3UA 4EJTA 4RTSA 3IWFA 3FPHA 2V1DA 3NW9A 1YIOA 4IKPA 3IHTA 4P9UA 3V7CA 4DNCA 3FTDA 3I5UA 4AZWA 2Q0OA 2R6ZA 3N97A 1QZZA 2W57A 5ICFA 1NW7A 2O57A 5F1RA 3UJ7A 5K5RA 2CKDA 1CGPA 5HILA 3GW2A 2ZJ2A 2XAJA 2N47A 2PWPA 2XVCA 5HIJA 5D5UB 2VC1A 2E1NA 2L54A 1JG4A 3ERCA 3FPEA 3M6XA 4KN7X 4YFXF 4RV9A 1R8YA 2O06A 4HQMA 5E8IA 4FS8A 3MERA 3ER8A 1KIAA 1KU7A 5G02A 2RC4A 1IZ1A 4O29A 1X19A 2XASA 3JWJA 5EPEA 2YX1A 2DAOA 5K0CA 4JBAA 1P4AA 1EQAA 1R22A 5BPDA 3IEIA 5AIQA 5LQRA 4KICA 1J75A 4F84A 3MWMA 3BWYA 5E1BA 1G6NA 4HX8A 1WQ2A 3EGEA 3ABUA 1PRYA 2FF4A 3CGGA 3ID6C 4MTLA 3HRTA 5ICGA 3LWFA 1QAQA 2V79A 5BMZA 1P1CA 3ZQ7A 4KFCA 4L9TA 1FC3A 2I7CA 2OPBA 3LQRA 1YQAA 1BHJA 5E1MA 1W7PB 4YMHA 1HXDA 3HCCA 4EJVA 3UWPA 4YV0A 4YIFA 3ELDA 1T98A 4A12A 2J5OA 1QPMA 5HLIA 1R6AA 2G7UA 2YR2A 3HNRA 1IXCA 3JTGA 4U88A 3K1NA 3E7PA 3BJAA 3KP5A 2UXXA 2P41A 3C0KA 1DUSA 5CUQA 3QP5A 4WF2A 3VOEA 3F8MA 2PLWA 5EZQA 3GFJA 2ESRA 2RKHA 1ONVA 3R0JA 3B73A 4L9NA 2H1RA 2Z3YA 2GQQA 2J5PA 4KDRA 3FTEA 2YVLA 4KIGA 5E1WA 3DXYA 1RNLA 4LB6B 3FM3A 4UHTA 5LGTA 5ILUA 5DXAA 2UYQA 4C07A 5DDGA 2HR1A 5BPIA 4YUZA 4ZZLA 3I4PA 2VOPA 4FZVA 2HYFA 2OB2A 3FRIA 1TLHB 4L5JA 1D8KA 3DV8A 3PX3A 6PAXA 2H00A 2WWYA 3BKWA 5HIIA 2F2EA 1NW6A 1R00A 2EFNA 3B7PA 2JPBA 4ESBA 2PXCA 5C0OE 1EH7A 4UXNA 2AS5F 4PYLA 2F5DA 1KR5A 3FMQA 5K05A 3T0IA 3KP2A 1ULYA 2NNYA 1BJAA 2ZO4A 1WZNA 5CM2Z 3FUWA 1W4MA 2MD5A 4DM3A 2PQ8A 3GUDA 1TPYA 4CO8A 1O9HA 4P7FA 1VE3A 1H1DA 3CVOA 1Z9CA 2RVCA 3HCFA 5J8CA 4HBLA 2JHAA 4EM0B 2PX4A 1TQMA 2O61A 3HVKA 4AZVA 2RDPA 1S29A 1DPRA 2WC2A 3LA3A 3GDHA 2WV0A 1WI9A 4RGUA 2FBIA 3T8TA 1KGSA 3O4FA 3AY0A 2VT2A 5DSTA 4MTDA 1HBXG 3UJAA 2FK8A 2O0YA 3L8DA 1NHAA 1W7PD 2VC0A 2BR5A 4WXCA 2PWYA 2O05A 1B59A 1F4KA 3WTVC 1IUYA 1BIBA 1RI7A 1AQIA 5K0JA 2UWMA 1S6LA 3RPQA 1FLIA 2FPOA 3BGVA 3BKXA 1UFMA 3NTVA 1M6EX 1S7OA 5FWAA 2FNAA 3K69A 5H20A 2P8JA 1R23A 1YS6A 2V9VA 1QBJA 3EEOA 3FMSA 2UYOA 4FT8A 1JG2A 4PONA 4RTRA 4XLNF 2V1UA 5D5VB 1G60A 3DMHA 3I53A 8MHTA 2TDXA 3MCZA 3QOXA 4YUVA 2FE3A 1U2WA 4AUKA 1G3YA 3LX6A 5DX8A 4HA8A 5DTRA 2Z33A 5IH3A 2Z9OA 5DM1A 2PJPA 1R1UA 4U0VA 2CSOA 2AN4A 3SQNA 1BI3A 3F8CA 1YUBA 4Q48A 4U7TB 2ZCJA 4N9HA 3AAFA 4PYQA 2XKOA 3PT9A 1XSXA 2ZVJA 3CC8A 3ZMTA 4ENJA 2NS0A 2Z5UA 4CHUA 2P40A 5BOXA 3I64A 3VB2A 5K0GA 2VODA 3WE2A 4IHSA 3WE3A 1N7JA 3B3JA 5EIFA 2A5YB 3FPJA 2LNBA 2CMHA 2GA9A 4A2UA 4LLLA 1BI1A 4CTKA 3HVJA 4BNCA 3G89A 4CXMA 2GIVA 4G7ZF 2AVDA 3LHDA 4R6WA 2OB1A 2ISZA 1XMAA 1H0MA 4DQ0A 3M1EA 5BW5A 1YF3A 9MHTA 5J8FA 4HLYA 1K78A 3ZPLA 1KQ9A 4BHPA 3OU7A 4HG2A 3IL2A 1G8AA 2V74B 4RVDA 4KRGA 3KU1A 1F5TA 1JTFA 3K0LA 2GA2A 2DO7A 3ELKA 5LQUA 3E6CC 1R1VA 2C7QA 2PT9A 3FX3A 4M36A 2K86A 3FXQA 4ATNA 4L9VA 4PWYA 2B2CA 3J80Z 4LG1A 3EYYA 2ZWVA 2E5WA 2OZUA 2Y0MA 1XCLA 1XN7A 3KR2A 2C7OA 3ELUA 3ELYA 4P9FA 1F38A 5TJJA 3L09A 3WTYC 1W5SA 2FRHA 3KEOA 1NBHA 4AWXB 3WTZA 2EG5A 5DT2A 5JI6A 3NVMB 4POOA 3BPVA 3KPJA 3MHTA 2LDUA 5EEHA 4X1OA 3HA7A 3TM5A 4C06A 5F64A 3VEPA 4OBWA 2IVMA 2G72A 2XUBA 5DCMB 3KQSA 3NDIA 2DFIA 3F6OA 4RB3C 3MCTA 2ERCA 4P7GA 4O5VA 4IWNA 3LGAA 3A25A 4ASNA 3VC2A 1SQFA 4C08A 3CUQB 1JQ3A 4X60A 2OKCA 3GRUA 4CZZA 4HTFB 4BYYA 1FPQA 1KA8A 4Z2YA 5B1SA 2GZWA 2FCAA 3IKTA 1Z6RA 5KYGA 3K1MA 1GXPA 3F4KA 3C6KA 3HSRA 3JSPA 2PV0A 4HLXA 3C6MA 3DXXA 3QP6A 2JHPA 1JHFA 5K09A 5L3GA 1ZYRF 2O07A 2PMUA 3QV2A 5HFJA 5K01A 5FHRA 2K7LA 2OD5A 3P9CA 5GINE 3DUWA 3KR1A 4Y2HA 4PYOA 5GM2A 2QQBA 3L2CA 4AVPA 3KEQA 4PINA 2FBHA 3IKVA 5DCMA 3RTRA 3MZYA 1QGPA 1ZHFA 4LK0F 5ED4A 1YB2A 4PCAA 2ZMEA 3QU3A 2YTZA 2MC3A 3OE5A 2M8EA 1U78A 4G6DA 5GIPE 5T67A 3GCZA 2H09A 4ZH4F 5M5BA 4GOND 3C3YA 2HDCA 3TFWA 4AD9A 4GEKA 3A27A 1X1AA 4Q5SF 1BC5A 5FCDA 2EFOA 3OZTA 1TNTA 1FY7A 4FR0A 7MHTA 4Y30A 5JVTA 1WRJA 5A2QK 3JWGA 4DCGA 2MH9A 2H94A 2QBYA 3RYPA 1U3EM 2DW4A 1EAMA 2IBTA 2K4MA 4RB1A 4JQFA 2GXGA 3MAGA 2NYUA 4CKCA 2DQRA 2DK5A 1U8RA 3LKDA 4A0XA 4ER5A 2F5FA 3PFGA 3MEXA 2AOUB 3ZN0A 2HWKA 1V4RA 3WTTC 1XCBA 3OCJA 1KU3A 2ISYA 3CUOA 4PCQA 2ZIFA 1W5TA 1IM8A 4RS8A 2VDUE 4RTQA 3ISPA 2Y75A 3PTAA 1VPTA 2BM9A 2H6CA 2QE6A 4CDGA 3ECOA 4XLPF 5L3DA 2PXXA 1ORHA 3IYLW 3M33A 5F2OA 1P92A 1SD7A 1DL5A 5E1OA 5K5QA 3LAPA 3P2IA 3ZMDA 3EVEA 1SD5A 5KVAA 1Z05A 4PZJA 1T0FA 4CXFA 2ADUA 3WTWC 3VODA 3QU6A 5LQAA 4XSXF 4XUDA 1IN5A 1JSZA 1GVJA 2HQRA 2XROA 3P9KA 4Y15A 3GO5A 3AXSA 1R74A 4GOMD 2OU2A 4RVFA 2P4WA 4A6DA 3HHGA 3M4XA 1Z1DA 2PX2A 1KU9A 2JH9A 1SD4A 3PFHA 2FU4A 2ZNYA 4E2WA 2QQAA 2ZXJA 2Z6AA 3LSTA 2BR3A 5DV5A 3KPUA 1R7JA 2PX5A 3QPHA 4PYNA 3U81A 1K79A 4GCVA 2H6BA 2A6EF 3UZUA 4ZYDA 1RI5A 4R05A 4CYDA 4WK8F 1H9TA 4YUYA 2FSWA 2NXEA 2A3SA 1GHCA 2LF7A 5DXJA 2ZZNA 1P4XA 1SQGA 3T7SA 1QYRA 4C03A 2P5KA 1K78B 4QQNA 4EM1A 4QDKA 4AIHA 3P7NA 2Q41A 1VP9A 3Q9VA 5D8KB 4G7OF 4HYEA 2D2WA 3SMQA 1I1GA 1MJBA 4RB2C 2ONYA 4ZYGA 2XYVA 3TKAA 2HYGD 1F9NA 2VE9A 4RB0A 1R18A 3JAMK 1FZPB 2NNNA 2WK1A 3EMDA 4KN4X 5EVJA 1UHMA 4G94A 1X1BA 4HF2A 2A69F 3OZRA 1HW2A 1YZHA 4HV5A 1EH6A 3PQKA 2ZLBA 5EC8A 2UZ4A 1WKMA 5EMJA 5LHHA 5E17F 2AR0A 4MQVA 2UZKA 2C7PA 3O31A 2EV5A 5FQOA 1O57A 2CGPA 2ELHA 1DP7P 4HZFA 3CO7C 2G8NA 1WY7A 4GC5A 5F2KA 2XAFA 3K6RA 4FX4A 4RTLA 3O3KA 4EKGA 5FA5A 5HZMA 3PS9A 1L3LA 4TV7A 1P91A 1RI2A 2VT3A 3R4KA 3DLCA 2WTEA 3KKZA 2X0LA 3LCCA 4P5OA 5LHGA 2VXZA 1NW8A 3GEZA 3TKYA 5E8GA 1G6Q1 5EMKA 2IGTA 1JE8A 4I0AA 1LB2A 3ERED 3THRA 2XAHA 1HSJA 5DRYA 4KDCA 3LA2A 1PDNC 5FQNA 1HW5A 5AONA 4DKJA 5BW4A 3V97A 1FBNA 1IW7F 5GOZA 4RGSA 4JK1X 3DLIA 1BN5A 1XSDA 2EV0A 2FA5A 5D4RA 3AJDA 3M6UA 2RNJA 1JHHA 2K27A 4QLCU 4M7RA 3ULQB 1FYMA 4IV8A 1QO0D 4ZYEA 2PLYA 2FMLA 3U1DA 2VBXA 2O03A 3T1BA 3KP7A 2VZ9A 4KMFA 3FZGA 4DZRA 1VL5A 2YXLA 5K0NA 3DULA 3BXOA 5AIPA 4M38A 2ESNA 3M8EA 1UWVA 5EGSA 3SSNA 5CCBA 5BQTA 1X1DA 2P7IA 4G56A 4B8XA 2A14A 5FULA 3F8NA 1RUOA 2AVNA 3CTAA 4YV1A 2DPDA 1IN8A 3WODF 3G2MA 2AOUA 4U0YA 3EPPA 1L1EA 3E8SA 2P5VA 2P5LC 1XDZA 4OBXA 5EIWA 3LECA 5CCXA 5EQJB 1MDMA 4ENNA 3UA4A 3JW4A 1HSTA 1OPCA 1HKTA 1SG9A 4EQQA 5K0BA 2ESHA 3OV8A 4WVLA 1B4AA 3B5IA 2XBMA 3WTXC 1YG2A 4R8RA 1QAMA 5E1DA 1FBSA 1CF7B 2K02A 3SFZA 2JT1A 2FK7A 3DMFA 1YW7A 3EGVA 2IFTA 2HR3A 1LEAA 5K03A 4F7ZA 1ZRFA 3QOPA 1P2FA 5IT3A 2V7EA 4OA5A 3EQLF 3R3HA 2P3OA 3E6DA 3RJPA 3TOSA 1YFLA 5KK1A 5LRRA 5LQCA 2Z6QA 1TW2A 3BY6A 1FP1D 3W6JB 1XXLA 2HV9A 2PY6A 3TDZC 5HS8A 4OIPF 3MB5A 5D1HA 4LLNA 1NBIA 1MDMB 3U9GA 3MTEA 3DXZA 3J81Z 4XUEA 1OR7A 3BPXA 2ZBPA 2A61A 3ZMUA 1FP2A 3OU2A 3UJBA 3PLAE 3OFKA 2KJBA 2CL5A 3SVZA 2G7HA 1L9KA 3UJCA 4N9IA 4LG0B 4IRGA 3NDJA 5L3FA 1L3CA 3FUVA 2PJDA 1AV6A 4E2XA 4ER6A 3GRZA 3E5UA 2YPRA 2OQRA 4YG2F 3BGDA 4NHJA 5E8JA 3DH0A 2AZTA 5KQRA 1IY9A 1XD7A 5EKXA 3WGHA 5KVRA 1YFJA 2BH2A 2QZ8A 1G38A 3G73A 1O7LA 3DXJF 5FD5A 2M45A 2ADMA 2CO5A 2FRXA 3I59A 3H3UA 2PXAA 4M73A 3DKWA 1LNWA 2OZ6A 2CW0F 4CKEA 1XDSA 4QVGA 4E31A 1BIAA 3F22A 4EMSA 1KYWA 1UHWA 1ON1A 3BJOA 2O6GE 1ZKDA 4BLWA 4K6MA 4A6EA 3P2EA 2GWRA 4I2OA 5EEGA 5LQKA 3P9IA 3EVCA 2DT5A 3HIFA 3Q87B 4DMGA 1FSHA 3SSMA 2G71A 2PKWA 3L00A 2ZMEB 5HDNA 3FRHA 3ABTA 3P71T 4GOLD 3S68A 3HUGA 3S2WA 4HX4A 2HWVA 4RX1A 2KIMA 3E3VA 3WTSC 2K4JA 4LJZF 2OZVA 4S05A 1PJZA 3GJYA 3E6MA 3I59B 3HCAA 3GGDA 4N0BA 4HV6A 3QRFF 1WG8A 1U5TA 5LSAA 3FMRA 2UYCA 1L3BA 5K0EA 2CMGA 2O3FA 4M9XA 4I0BA 3HEMA 5CVDA 2FNPA 2ZWAA 5FD6A 4GQBA 3ELWA 2KRFA 5H6RA 4EM2A 4PGGA 1B42A 2YR0A 4P7JA 4E2YA 2CQKA 4HSGA 4XSZF 2Y48A 1QAOA 2OXTA 2FOKA 2CWWA 5DD4A 4S04A 2HTEA 5C1IA 4LB5A 3UJ8A 3LDUA 3AWIA 4HRAA 2R7DA 3CCFA 5EOVA 3EVDA 4G8XA 4RAYA 3GVAA 4H0EA 2AOXA 3BZBA 4GUAA 1RI3A 1S7AA 1YLFA 2PBIA 3NQOA 4OX9Y 3R61A 3C3WA 2JTVA 2DBBA 4RGXA 1KPHA 5MHTA 4YIIA 4XUCA 3RODA 3HSEA 3G88A 3THSA 4ZYHA 2IDJA 2W24A 3BWBA 4MQ9F 4H0NA 4IJAA 3RYRA 4X41A 4KIFA 4BQAA 3HCBA 3OE4A 3TPZA 5FADA 2EA2A 3GX4X 3LAJA 2GS9A 4C05A 2PBFA 1M6YA 4BH9A 1AF7A 3FPGA 3R0QA 4HOBA 2B3TA 3OU6A 2IIPA 1Q1HA 3F3XA 4IRHA 5DM2A 5DRTA 1BBYA 3RIEA 4HGZA 1MZBA 2P6TA 1EIZA 5FFZA 2ZULA 3KQQA 1LVAA 2PN6A 3TLJA 3HRMA 2PT6A 3G7UA 2KJCA 3C1DA 4U7BA 4WWCA 4P55A 3G2PA 1TQPA 4F85A 5EG5A 3WGGA 2IDKA 3L7WA 2ZFUA 1SUIA 2E7WA 1JG3A 1O3QA 3HVHA 1JSXA 1QNTA 3DFGA 4LWPA 4F86A 1MJFA 1SFEA 3C3PA 2ZZMA 4A0YA 5D4SA 4EJWA 2ZIGA 1WXXA 1J2XA 4L18B 1MGTA 3J80K 3OPNA 4PYJA 1FSEA 4HAMA 2C7RA 1ZAOA 1XCJA 3FUXA 5HLGA 1ZN2A 2R3SA 1OMIA 3HSFA 3DPLC 4GBED 1WXWA 2G70A 4QTUB 3B3FA 1I4WA 4Y13A 2QUFA 1B9NA 1G8SA 1RUNA 3DF8A 5ICCA 3OFJA 4DCMA 3H2BA 1VIDA 3GLXA 1C0WA 2JRTA 3WGIA 1X1CA 1TTYA 1E17A 3GFIA 1MKMA 3CJRA 2JHCA 2VDVE 3TGNA 1OYYA 2XIGA 5DUIA 3V7RA 1ZRCA 4MGRA 1BI2A 5ILSA 1WSUA 3KQVA 3MGGA 4LD5A 1Z7UA 4G7HF 2ZZKA 4GGGA 4PDKA 3BWCA 4LECA 3EYIA 1FYLA 1JG1A 1SUSA 4WXHA 1G55A 5LQNA 1ZARA 3UA3A 4ER7A 4LWOA 2BE5F 2LF8A 1R5HA 2DK8A 4GC9A 5E1ZB 2XVAA 1XMKA 3BJ6A 3KETA 4HDUA 5DWQA 5FTWA 3FHZA 1J7KA 4OIRF 2IP2A 1P6RA 3J7AO 3LDFA 2B25A 5E9JA 3KQPA 4EGYA 3PB3A 4HDVA 2NP6A 1RI1A 3T5XA 4RTMA 3HTUA 3CBGA 4RVGA 2NRAC 3FTCA 1U5TB 5D5WB 4WXDA 1WS6A 2QYOA 2DTRA 3A7DA 2DPMA 2RN7A 4QWQA 1KQ8A 1H9GA 1I9GA 3JSOA 3KQMA 3FYCA 2F5EA 2EFQA 2CWEA 1WWXA
chains in the Genus database with same CATH superfamily
5KSZA 4ZHQB 1MC8A 3SJZA 3V00A 3OTGA 5A1JA 3UYKA 2VASA 3DAPA 1B6RA 2G63A 3LG2A 5FNVA 1YE5A 1YIDA 5EL0A 5FUMA 2FMXA 4UDYX 1JQJC 1EK6A 3CPSA 4Q4DA 2XZDA 3MZ0A 4RD2A 2QQ9A 4CN9A 2OBYA 3LBFA 4E7OA 3L40A 3N2EA 1OBOA 2DBVO 2BIFA 3FDJA 5EZYB 5BWBA 4PQFA 4XTCS 2C6YA 1QHIA 5JD3A 3PNOA 3UPUA 4UTRA 3N2LA 4ZK6A 2PANA 3CCMI 1Z3XA 3BSSA 1ZUNA 3FETA 4HEA2 3MZHA 3KP6A 1QBGA 3ROQA 2ACWA 1VCNA 4HRVA 4I66A 4L6CA 1VQ1A 4MR7A 2XYGA 3I6BA 3T7IA 4EOGA 1SANA 3GFMA 4Y9TA 4ECEA 3V8JA 3O90A 4B33A 4UUMA 4UCWA 4KXUA 3MJEA 2CC2A 2HOTA 4RKEA 3BAZA 3TI9A 2CHUA 5EF6A 3LSYA 3L7CA 4R2JA 2DOEA 5DTQA 5L40A 3U09A 5DISB 3NBZC 3REOA 1BJTA 2QD3A 1AO0A 4P0PB 1FRNA 4DEYA 3IH4A 1Z2OX 2QXYA 1LGYA 1VI2A 3D9QX 3LDGA 3M82A 3W5IA 1F8UA 3MFKA 1IY8A 3NEAA 5DP1A 4ALLA 1TUEA 4MYTA 3AERA 2YX7A 1P2VA 1QVWA 3WFZA 4XSVA 4RFVA 5HS9A 1TQ8A 1L4EA 4CCLA 2CMDA 2ZAOA 1DP4A 2H4JA 5L6MB 1U3VA 5FX2A 4KAFA 3VR6D 3EC2A 1A31A 1DWUA 1KRWA 3FM9A 1NUPA 1ZD1A 5AI9A 2P7CB 3HG7A 3VFZA 1U8AA 3I58A 2PJRA 1YRYE 1U4OA 2WADA 2D5CA 3HDVA 4PLPA 4Q3OA 3OZXA 1OYWA 3JRGA 4G2NA 1UQRA 4LC0A 3QX7A 4GP9A 4PLFA 1DG3A 4F5ZA 3PIIA 1CZOA 1J9EA 3QLJA 2ZJ3A 1C30A 4LY6A 4IMRA 4KZPA 1QBKC 2C2WA 3T5BA 3FI9A 4DSZA 2AOVA 2Q0SA 3KSUA 4CTNA 2M6LA 4Y0NA 3OQBA 1F9AA 1LBHA 5I4KA 3AWDA 5HPYB 1NT2A 1OAOA 1VFPA 3BR1A 1WJFA 2I1QA 5JVDB 1P5JA 2XWBF 2ZK7A 1Z37A 4KNYA 1WL8A 2H9IA 4G9EA 3SP1A 4AX4A 3NVKI 3T94A 5F0CA 1XRNA 1WGXA 3B9BA 3C3EA 3LA6A 4LYEA 1MNEA 5K3BA 2SHKA 1I1NA 2RBEA 1IJFA 2WF8A 5AQEA 3FXOA 3LUFA 3QVMA 2FBKA 3T3MB 2MR6A 5KCMA 1IDOA 1RHRA 3K70B 1SVKA 4BV2A 5DU2A 3JQAD 3JCZA 4BO6A 1I3OA 1SK9A 2VQEB 2GD6A 3P45A 1ZXXA 3GZ5A 4LS3A 4P9NA 3ZYCA 4OA8A 4A0ZA 1HDYA 4MV1A 5FOXA 4YUAA 1Z7BA 3K9TA 3U44A 2EZHA 4QUGA 4ZAVA 4AD8A 1O0BA 1Y1RA 3FFAA 2QTGA 3GGPA 4JKOA 1PKEA 2C8LA 4IOCF 1ADYA 4R98A 1HOTA 4PRLA 4BEJA 4EVIA 3F72A 4YMUA 2STWA 3DOJA 3LNCA 5CG2A 2G9WA 2XHKA 3ORHA 2O7VA 1L5KA 4BKRA 3ZS8A 3B12A 4EUHA 1GVDA 3L9FA 4FB4A 4D0GA 5GPBA 3IEKA 1IY2A 4RA9A 5EZGA 1H4TA 2OM6A 4G4SO 2MH2A 3IRQA 2KMLA 3OBBA 3LCVB 2Q7DA 5D7BA 3WSTA 3GVHA 4DV2B 4X1IB 2V58A 3OL4A 1P33A 2ZJ5A 3HM9A 3LI2A 1V5WA 3GCDA 4NYIQ 1KZ7B 4QYIB 1PFWA 1M2JA 2QA5A 3QTTA 2LY1A 1CJCA 1GGHA 1KO1A 4KLCA 1SPXA 3FNRA 1QSGA 3ZDXB 4UU1A 5LZ2A 3EWIA 1FFCA 4JI6B 2ZRMA 1O9BA 2O0HA 2BP7B 3KT0A 4HDKA 1YR7A 3OFNA 3DPUA 1JMYA 2AN5A 2I7XA 1IJEA 1YS7A 1WCYA 1ZO8A 3JYNA 3DOUA 4YACA 2DEUA 3SZRA 3MINB 1T4BA 1JMVA 2OBMA 4PINA 3AEZA 2A94A 3IOBA 3AR8A 5JY6A 1VFCA 4IQGA 3NYWA 4C5CA 4R8HA 1O87A 3PR3A 3WGKA 3H2KA 4DVJA 2ZIXA 3PTZA 5K6RA 2HXOA 2M30A 4GYGA 1PI3A 2AG5A 4J0DA 1RVV1 4UEJA 4AZTA 2O52A 2ZBQA 3I9V1 4XEHA 3GDWA 5ANRB 2JMWA 3UKGA 5KSOA 3NDBB 1WU8A 3HHHA 1U2ZA 2H2GA 2NZ8A 4BLVA 2WMNB 1Y3DE 5G1PA 2EFWA 1SXGA 3LTNC 3I62A 3LCUA 1XZPA 2X51A 5FFXA 3QPTA 2PL3A 2DQLA 3OMLA 1ESNA 3RVJA 1YB4A 2FOWA 3QU5A 2DCEA 4YXWA 3D2LA 3I6IA 4M37A 3UW1A 5IS2A 2ZRFA 4JOSA 1O7JA 2V97A 3OUZA 1N4DA 2Y3IA 3SR0A 1UAGA 4DV3B 2VSOA 2EL9A 5FPSA 3RUFA 1CY1A 2X0JA 5AKIA 3TNYA 4A3KJ 3QVWA 4MRMB 2UAGA 4OUDA 5CVUA 4HF0A 4H27A 4M8LA 2YRXA 3KAKA 4INJA 1DBQA 2Q2EB 4KKVA 4I1YA 3W2FA 1V3UA 4L0CA 1P72A 3EQ8A 4PHTA 3HJTA 4C4XA 2W6QA 4BXOA 3QUCA 3DL0A 1Q3TA 3ETJA 2NYXA 4GYIA 1F8XA 4YAOA 2QF7A 4IHQA 1YA8A 2B6HA 1JTEA 1M2HA 4HX9A 2HZBA 4DANA 4EI7A 1U02A 4G5SA 2NV2B 1YT5A 3QBDA 4MH0R 4ESFA 5AK3A 1MEOA 4EGAA 2PI0A 1MABB 2QROA 5COAA 7ABPA 1BU8A 2QVOA 4N40A 2EQBA 2CJPA 2O5EA 4K6HA 3HYIA 4YP6A 1RHUA 3W78A 2YWJA 3FRJA 4C4TA 3EQ9A 3HYSA 1UM9A 1FJ2A 3CSUA 3SC4A 3RKYA 3MFYA 3CF4G 4MUAA 4RH3A 1JH9A 1UPUA 3ZQUA 3KOYA 1H6CA 1LC0A 1O8CA 2OAP1 2WSSD 3C8MA 1SIBE 5JCJD 1I6KA 3GLTA 3LP8A 1U5BA 3H3JA 4FEAA 5FFFA 4E4RA 3CZ4A 1E61A 3FTFA 3SZGA 1OLXA 2PD4A 3HKEA 1Y8ZA 4BP9A 1NA5A 3EH1A 4QLBA 4ITVA 3CIFA 1I24A 1SCNE 4GW3A 4R7ZA 4ESJA 4JKIA 3NDRA 2W98A 1II8A 2XF2A 2XKJE 1FRFS 4NZ9A 621PA 3PQ8A 3GLIB 4BGDA 1FXSA 1N7IA 4Y2UA 2EJRA 1TM1E 1ZG1A 5DHRA 5KZMB 2IRFG 4ARBA 4BMVA 1FTZA 2XE8A 1OCCH 2BW3B 3EUHC 1GLNA 1E32A 1OJ7A 2QWWA 2COUA 3EXG2 3PKJA 5HF5A 4F04A 4L8GA 3ETNA 3JASA 4NYMR 2OO3A 5KYXA 1F3OA 2H63A 4KLAA 2HK7A 3RQSA 3RT1A 1DTSA 1Y7IA 1T2KA 3RYIA 2R5ZA 4R1HA 2JUCA 4N18A 1YS4A 4TTQA 3VPDA 2TECE 3TTSA 5LDDC 3WRXC 5I4BA 4R9UC 2D0OB 1J23A 2R7NA 1T5HX 4LFCB 3CJTB 4LLGF 4KMSA 4C0QC 1NQAO 2QN8A 4EZEA 4KMMA 5A3QA 1I27A 2EDCA 2E1RA 4V0QA 3F7OA 3TDNA 4KXFB 1ODJA 4B3AA 4HQEA 2VHZA 5E7QA 4ZZ0A 4FMCF 1W8IA 1XF9A 3PDIA 2ZOSA 4JXJA 3ZX5A 4BB0A 4X1EA 5LEKA 3FOBA 3F46A 3VU3A 2VOJA 1ESZA 4XUGB 4W1QA 1KXJA 2RI0A 3Q5EA 4L8YA 2G17A 2Q2OA 3HSSA 3L7IA 3CT4A 4R9SA 5CNKA 2HOEA 5JE8A 4D42A 1E1NA 2CVQA 3ZWMA 2FKNA 4M6YA 5DUKA 3HDQA 3N53A 4DA6A 4FWIB 1K4MA 3V1UA 4K26A 3O73A 3Q7RA 3DQZA 1PD1A 2WKPA 3PRJA 4OJKA 1PK9A 1VHJA 3BYZA 5TVKA 3EUHA 1NMQA 1I3AA 2NU7B 5B5EC 1Y6GA 4OL0A 1XCVA 7REQB 4CR7A 3PM1A 3G1MA 3CY6A 2JVKA 1POGA 3MUOA 1N1MA 4WQMA 2J6BA 2PS9A 4ZVVA 3VC1A 3VOTA 3OOPA 3B9QA 1Y8CA 1MX9A 5F6FA 4F0JA 5B36A 1XMQB 3COWA 2J33A 1ZY2A 4LTDA 5A7HA 1CW2B 1LDGA 1UKEA 3PXXA 4LV6A 5D00A 3NIGB 2N1BA 5BSFA 5HEKA 4M0MA 2QDXA 2CYYA 1AQ6A 3JY6A 5BT9A 1XVAA 5PGMA 5CAEA 3R60A 3L18A 4RKRA 1SEUA 4IWYA 1F2TB 2EIXA 4K87A 2L7MP 1ZSNA 4I5GA 4ME6A 1Y3HA 1GAJA 2F3UA 4I7HA 3AESB 3CURA 1SGWA 3JAKB 1AWCA 2P3LA 3N28A 1V48A 3OQ6A 2R7XA 1B0PA 2OV7A 3I42A 3L5KA 4LHEA 3QLVC 4YRQA 1WXQA 3EEYA 3IMFA 2NMVA 1QQIA 1AKUA 2QJFA 1E2LA 4ND6A 4B6SA 4DV4B 3PWSA 1S9DA 4QWMA 1U7HA 1XCPA 1GGNA 5JD5A 2ECQA 2VWQA 4Y6SA 1ORVA 1Z8HA 1ND6A 3ZNQA 3DAFA 3F5FA 1N0IA 4R2WA 4S1NA 3U56A 3CP8A 2J08A 4YUXA 5PNTA 1N5DA 2VZ0A 3NKLA 1Q92A 3HL2A 2COEA 3KKOA 1PJ4A 2FP4A 3PHHA 3FHNA 3E03A 3FR7A 4RAFA 4D1YA 1JIKA 3RROA 5HP4A 1E77A 2L7ZA 1GRNA 3WIEA 1TT0A 1EMDA 3ABQB 4M60A 2P2DA 4KSYA 1Z3CA 3JX9A 1UFVA 4OVKA 2B78A 1JB9A 1U2QA 4IUCS 5F9FA 1BWRA 4IOKA 5FPYA 4BVKA 4F1JA 1EK2A 1DKUA 1NIJA 1SXHA 2FGKA 4LXIA 3JD4A 4Q9HA 4Y2TA 5ECWA 2CY0A 1QYVA 1WJDA 2B7BA 2JIBA 3HBAA 5DBOA 4N5NA 4PNZA 1DO8A 3MMYB 4GO1A 1KO4A 2F1IA 3QA9A 1VQ4I 1ZITA 2VRWA 3JQ6A 3OWOA 1PSZA 2VYFA 1ZBQA 4ON9A 5EWMB 4KIJA 2Z8YM 5I7VA 4Z99A 1E4EA 3DBOB 4R9NA 1O3YA 3UT5B 4NRDA 3UJ9A 4AIIA 1TC1A 4A92A 4B5LA 3JWHA 2FLKA 4B2IA 2QSYA 1A3CA 5REQA 3FCOA 3IOEA 1T38A 3ZKWB 3X0DA 2P7VB 1UANA 1EG2A 3LPMA 2IIQA 1JPJA 1Y81A 5EY5B 3IODA 3G7NA 4MWSA 3MW8A 4Y17A 5K0TA 1SC1A 2A7XA 3L8YA 4FGJA 4H3SA 1RWPA 4C7BA 1FYKA 4MJ3A 3SIRA 3SZMA 2COKA 2ZEJA 1IZ7A 3QOFA 5EHGA 5NULA 4AZSA 5JQGA 4EYKA 4BFVA 3GRVA 3MWJA 3UUWA 2C07A 1P1JA 1H6DA 4RVHA 3TBHA 1BFUA 2JA1A 4AG3A 5JS8A 2XVZA 3AY3A 3KE2A 3R0AA 1VPLA 4LOHA 2VP2A 1Q0TA 1YS9A 1R9MA 2MTBA 2XKBA 3RBXA 2BF4A 3GEMA 4B6QA 1ATIA 2V6IA 5BY2A 3GO4A 3OTWA 1YFHA 3UOGA 3EXIB 1YDFA 2F3TA 3W5JA 5DASA 1FDVA 1REQB 2W2PA 1GU1A 1XD2A 3L7MA 3Q0TA 5FA8A 1WD5A 3TZ6A 4D45A 5ITZB 4KPEC 4QM7A 1K5HA 3B9PA 3NM6B 2FE1A 2E4WA 3SHOA 1NJ2A 1B8UA 1ICEA 2G4LA 4IUDS 4U0WA 2PKQP 4JOBA 4MW2A 1H22A 2BZGA 2I6GA 2IYLD 3KOWA 4MK4A 4AJLA 4O4JB 3EBPA 1ZAYA 4PHHA 4IHTA 3EVFA 4MTEA 4XFKA 4D0NA 3EGDB 5BS6A 3HE3A 5EQTA 3KDSE 3LFKA 4ENSA 5CFNA 2K7FA 3JQEA 1EUYA 1C1DB 3GB9A 1SA0A 3GGCA 2WM9B 3SX0A 2Y9PB 1GPAA 4QICA 1IZ0A 4ZYLA 1N9ZA 4CGZA 4J1NA 4KN8A 2EF0A 4N5IX 4M76B 4HVCA 2HJWA 2QLBA 3LF2A 4DAOA 4IZHA 2ZYHA 2X86A 3U9LA 2J87A 2DJ5A 4TTTS 5TRDA 2DSTA 3SZTA 1NVVQ 2Y05A 5HE8A 2H27A 2FUEA 4QYMA 2CS3A 3KLOA 1GPJA 4J2TA 1ZUNB 5EUBA 2ZNZA 4B48A 4I4LA 1P9LA 2QD4A 1MRZA 1SVIA 2JRMA 1DAFA 1ZL2A 1CUJA 2C3YA 4HLUA 1PVDA 3QKUA 5C4MA 3ROKA 1ZGBA 4W9NC 3Q5DA 2Z99A 3QA3E 1QZXA 3OPMA 1OISA 1SU6A 4RMJA 4KO2S 5IM4A 3VO8A 1WUIS 1ESCA 2OZKA 3F3SA 2VBWA 1CUAA 3Q0VA 4P86A 4I0WB 1STZA 5JFGA 2DLLA 4UNOA 1X1PA 2A0KA 2ZJ1A 4RFSA 4NBRA 3G8AA 3FCUB 4R8KA 3KHKA 1YQTA 5CX1A 3DTVD 5FOVA 3IP7A 3BA6A 3LIPA 1AN9A 1CRLA 1PJTA 4BFUA 2GXBA 4MNTA 3K4KA 5DTMA 4FB5A 1ISMA 5FLXA 4W5RA 1THGA 2R1TB 1SWVA 2HMWA 4QIWN 5CD1A 3U60B 5IT9Z 4BXOB 1TQIA 1W76A 5TPWA 1PJQA 3RVSA 1G291 2D5BA 1G4DA 1RIOH 1RQXA 1S8FA 2C9YA 1ZW6A 2XUPA 2Z2YA 4D8XA 2IJLA 1DC5A 4ZPJA 3QXGA 1EB8A 5T4FA 4LGWA 3R6LA 1AHPA 2ZANA 3HXTA 1NE7A 3NWPA 4QG3A 1B23P 1VLMA 3OJWA 3TTUA 2AMVA 1S02A 1O08A 3RYHB 3LXUX 3PFIA 1T2FA 1XTVA 2VDWB 3DL7A 3KB1A 4X3CA 2PGIA 3DBLA 5K4HA 1AQJA 4QM6A 3VZSA 2ZI9A 3C7KA 2OAZA 1VKRA 3NBXX 1NVGA 3RPUA 3OIDA 4KAAA 1PFKA 2GN0A 2O6LA 2UVDA 3PF9A 4JU9A 4RVSA 4ZOAA 2Y4NA 4D6XA 4BATA 3D0OA 3GPIA 2OXIA 2JZNA 4URXR 1NI4B 4KR9A 1O5TA 2JQ7A 1SURA 1VDZA 1XGOA 5C1PA 5IHXA 3U7GA 2LKDA 1ODDA 4I02A 1G4HA 4FASD 1IG3A 1WP4A 5LRSA 3K0AA 2ZCWA 1W48A 3F6CA 1ZJ6A 4OK6A 4TMVA 1DIBA 3M7GA 1X39A 4WZBE 2XA1A 4EARA 5MFZA 4JYAB 4OU4A 4EJOA 4JBNA 4YV2A 2VBYA 2JKZA 4DADA 1UG2A 4UOEA 4H0CA 1IQ0A 3EZXA 2GYVA 5A5DA 2YV3A 3M6IA 1JR3D 3O74A 4PSUA 5HQ3B 5DI3B 2HJVA 3M9WA 5C8YF 4IF4A 5JR3A 2GEJA 3NHMA 4PAWA 2FYTA 3PJEA 4ZI7B 2LP4Y 2JLCA 5J2UA 1WV0A 2JAWA 1H0HA 4ENMA 3P2KA 1WXFA 1NLYA 1P3DA 1PR5A 1AUOA 3ZDDA 3I12A 3KVRA 2FXAA 2VLBA 2BXZA 1BA3A 1FLAA 2PQMA 1Z6AA 2VTEA 4PC3A 5D6OA 2DDAA 1JDPA 2C77A 2KSQA 3HKDA 5ERGB 1DAGA 2M2IA 4JX9A 4UM8B 2DULA 5G0TA 3HWSA 1T9AA 3TTVA 7GPBA 2P27A 3HZRA 1U8ZA 3VHXA 1U4NA 1O2DA 3IPXA 4NOJA 4C2AA 1AA6A 1NWCA 3AR6A 5ALKA 5BNWA 3HOSA 1YC2A 1UB9A 1P0CA 3WGZA 4N3BA 5EHNA 3ROPA 1QZTA 2ZIWB 2CDAA 2WU0A 3DP9A 3NHRA 4L9JA 3EBOA 4D56A 2C9CA 1M2GA 4DWWA 5L3SA 3DBRA 3IO5A 3S81A 3DE2X 2DKNA 4Z4GA 3F9IA 4LE0A 4BLOA 4Z9AA 3CX8A 3I1IA 1XGMA 1JQAA 2GKOA 1KSFX 1KONA 5CR9A 2IXGA 1QC5A 1WXHA 3EOAI 5CFQA 3AIKA 1FSPA 2BV3A 3GK3A 3WLJA 4CW7A 2AEJA 4CG2A 1WO8A 3UJDA 1OLUA 1U63A 1HE4A 5BR1A 3X2QH 4MVJE 1ZS9A 2BBOA 2IOYA 2Q1UA 3EE6A 4YRMA 2UUCB 1H65A 5IT9A 3BP8A 2H59A 3R8CA 3DQQA 2Z2IA 1BCRB 1L0BA 1QHHA 4GGPA 2XBUA 1H2WA 3B6IA 3DMYA 3ONDA 4KCGA 1I5ZA 4Q37A 3JRHA 4F6RB 4RF4A 5TPZD 9ATCA 1Q0ZA 2FW7A 4B6RA 1X14A 3MAJA 3NWBA 2BFEA 3C4JA 2YRWA 4CCYA 1ZNZA 2ZJYA 4YA6A 4BDSA 1D2EA 1NN3A 1T29A 4JZYA 4XQGA 4X84A 3GPLA 4FBMA 2XAUA 3U7QB 2VKTA 5AVSA 4FWBA 1JXSA 2DQ4A 4R2IA 5BQ3A 1JVNA 1U8UA 3HB0A 2IS4A 4DTCA 2GH1A 1HFEL 4PNEA 3FSGA 3DDNA 3MXTA 5CVEA 5D5XB 3SKYA 1XDDA 4DJ5X 1A9TA 1TNSA 1NMSA 1F60A 1Q0UA 2FP3A 2Y1CA 1MDBA 1R0WA 1J99A 1XG5A 2QP4A 4E7JA 4EAQA 4N4OB 2OFPA 2W2KA 4CCJA 2R6HA 2MMGA 4PVDA 4R5MA 4ZREA 3WRWA 2SBTA 3DD1A 5AIAA 4EEKA 5KINB 3K1PA 4GYJA 2B1GA 1U5TC 1NIPA 2QOEA 1ETXA 5K3AA 4ZAWA 1RABA 4MI6A 1SKQA 2PG4A 2VP3A 1ZRNA 1O97C 4OU0A 2Q29A 2XR1A 1JEOA 2YZ7A 3AHEA 4OQDA 2X22A 1C8LA 5C3EJ 4HF1A 1P5HA 2EGGA 3T5DA 4C4OA 5CGZA 1VB5A 4X44A 4M9ZA 2PGDA 1WB9A 1RXCA 4GM0A 1A8PA 5JECA 2NV6A 1L7MA 3K10A 2PU5A 3GFGA 3P8ZA 1GITA 3PSAA 5JHFA 1IF1A 2HDDA 4HPQA 3V8RA 2XCOA 3ZWPA 4URVR 1Y0UA 1G20A 2OHXA 1L3IA 1YMQA 5BPHA 2LOOA 2FW8A 3VTFA 4N48A 1ETYA 1NFRA 5FLXK 1SNYA 1WXDA 4QTTB 5TMEA 4CLEA 1XPOA 1BOOA 3QXSA 4XQCA 1ULZA 2M98A 4GR4A 5AJHA 5DYGA 3KQUA 1G17A 3YASA 4WN9A 3OZUA 1OA0A 1CNEA 1GRCA 2IYFA 2WJ4A 3HM2A 2AQHA 4NDZA 5G0WA 3RSZA 1K6XA 3IRVA 4CKWA 3F8WA 3NUQA 4IGKA 3WMEA 3TO7A 1BXGA 2ZSUA 3SBXA 5I7SA 3F7MA 3QE3A 2AJ8A 3DL2A 3QELB 3R5FA 3A6GA 4HR7A 1YCHA 4G1EB 2VWHA 5DGHA 1CR2A 1RLUA 4DMFA 2OKGA 4E6EA 3H3ZA 4IX9A 1Z8DA 1NN1A 3SX2A 3VU9B 2EFDB 3KXIA 2WHPB 3L9WA 5DB4A 4DCTA 1BVRA 1VB3A 5HS7A 3O8RA 4IV5A 4WJKB 2C84A 5ERXA 4R1LA 3WKBA 4GZ5A 2VUTA 4HTFA 4ZARA 5A06A 2BOLA 4H7EA 2GWHA 2A0XA 4MFDA 3K7EA 4D57A 2CVZA 3ISJA 2EINH 4BAYA 2ZTLA 3AEQB 4JD5A 4XI9A 1TTTA 4I6GA 1KI1A 1CUZA 1Y9JA 1I1OA 2IY9A 3KZXA 4I99A 5F9MA 2P6SA 2X5XA 4RPGA 4W5HA 2GHIA 4LJ8A 4TVSA 4RF2A 2JCGA 4FHTA 2CMFA 2Q62A 4RQAA 4S1TA 4XPZA 4XSGA 4B5KA 4BZWA 3BF7A 2B20A 2PR2A 4MUBA 1WXEA 3KYLA 2B6NA 4MGZR 2GBGA 3W4KA 3L6UA 1ZD4A 4A93J 2WHPA 4N49A 5D3KA 2ZSFA 3UBTA 1XPRA 2RV8A 5FBLB 2OUMA 2HPMA 1B4DA 3SFIA 2PV7A 4HQOA 4AS2A 4NDNE 4ENUA 3B3QA 4BC0A 1D7OA 4FQ5A 3KOUA 2HMYB 2XMZA 4U9IS 3RTDA 1SXJE 4O4IB 5KNCD 3RS4A 1W1WA 3KR0A 3QW4B 5JIBA 3T0YA 4B17A 1USSA 2P30A 4DTIA 1FU7A 2L42A 2AWNA 3OKPA 2JZCA 1LPOA 2HF7A 2W4MA 1KO5A 1J0EA 3GJZA 4YCMA 4PHGA 5FH9A 3PFCA 2XRLA 5LMZA 2VF5X 5C5CA 3HDGA 1HKUA 2QRKA 2JJMA 1WR8A 3DFMA 2JCXA 3AF4A 4BRSA 3PCXA 5HIKA 5KHLB 4FJ2A 10MHA 4GICA 5JEDA 4IYJA 2HF9A 4CCYB 4Y0VA 2X85A 3QIVA 1DBRA 5E1XA 3OQ1A 3BUSA 1SU7A 1X3LA 4PO9A 2V7QD 1PFUA 3RRZA 4LVCA 2QLTA 1MD0A 2DA2A 3WZMA 1XYYA 3ZWOA 2DFTA 4PYKA 3O0TA 1EVJA 1C3EA 1KEWA 3EHEA 4QVKA 1ZHHA 4NICA 2X42A 5KYYA 2WG0A 1ULHA 1FU4A 3RAPR 4OXNA 3WAJA 5H4GA 2FW6A 4YYEA 1DRWA 1JB1A 1G9XA 1TEHA 3GJRA 4FGKA 1MBGA 5HQ3A 1XEAA 4I55B 4WKBA 2BY0A 4WHMA 4UDNA 1N5OX 4KMRA 1KEEB 3CB4A 3HWRA 4X00A 1M1NA 3IIMA 3FF1A 4MQLA 1QOPB 1KYZA 4LQCA 4LW8A 4P93A 2GZRA 1Y9EA 3EIXA 3JSAA 4TMTA 3GRAA 3EVZA 2WIBA 3QNMA 4EG0A 1M0WA 1Q50A 1Q6ZA 4G09A 1BA5A 2WJIA 1MBHA 2AXLA 1Q7EA 1SM4A 2FZGA 3OY2A 5JZSA 1A88A 3TBKA 3GJ8A 1LDBA 4EY3A 1XR3A 2HI3A 3WO0A 4BB5A 1OZAA 1XFDA 3G13A 4HT3B 2J7KA 1T39A 1UFKA 2Y69H 1VLHA 1RZ4A 1VI6A 1UAYA 2UZ0A 3SDSA 3N0TA 1X6VA 2F6CA 2FHPA 5EIBC 2BFOA 1JWBB 2ONKA 4E4HA 3OZ7A 1ZOOA 2Q4BA 1E5QA 4R2HA 1QKKA 1K75A 2DFFA 1UBGA 2ZRIA 2VF2A 2WY2D 4A23A 5M04A 1B6GA 4JIMA 5L3ZA 2F2TA 2Q6OA 3ZHUA 1KMHB 2O8XA 1J9IA 1P2SA 2O8DA 2J9ZB 2IA2A 1FMVA 1CUBA 1B7GO 2AGVA 3KYCA 5JU6A 1HV8A 4DF3A 1BE6A 1TW3A 1I32A 3V4RA 3ZHRA 1ES9A 1RCFA 1ZJJA 1WOYA 4UHJA 1JR4A 1XX6A 5LL6P 1A9PA 2DI3A 2EJWA 1DDOA 2JZOA 5DI3A 5JAHA 5AJVB 1QPBA 2VTDA 3HU1A 3LNQA 3RBVA 4CMCA 4CODB 5JO0A 4R8SA 1BR1A 3QWIA 3QKSA 3RKWA 1YASA 2WA1A 4O2BF 4Z6KA 5KOJB 4RM3A 2RHHA 4FOOA 5A1TA 5KKCA 2QENA 4OQZA 1V5GA 1GQOA 2CB0A 2EZ8A 4K5QA 3K09A 2C42A 4I4TF 4OHVA 7ADHA 3P0EA 3G3ZA 4BFSA 5G0UA 1K7AA 4NECA 5KYXB 1WJCA 1TZKA 2NSLA 5TS2A 4NI5A 1XAJA 2ZJBA 2QTZA 4NDAA 1W5CC 1GARA 4WSOA 1GTZA 1HLFA 2A9KA 3O9VA 1LSSA 5ULLA 3EN0A 3RVOA 1SQ0A 1DTWA 2QY6A 4DMKA 3CF5F 2DPGA 4E30A 1C8KA 1PNRA 1E6WA 2ZKZA 5E18F 4N0EA 1VMKA 1BDIA 2XQJA 1GPYA 2V7XA 3FPAA 4KW7A 2DMUA 3CRZA 1X94A 2H8GA 5EZ5A 3V48A 3WLFA 5JD4A 4M74A 1C4XA 1KJZA 2QD2A 3WU1B 3EFEA 3G5TA 3HJBA 4KI7A 4QPJC 4BXFA 2I76A 4KA4A 2W8BA 3DV0A 4YFKF 2IYRA 2R7WA 2XT6A 3GUCA 2QG9A 4UNQA 4Q0MA 3CH7A 4FGZA 2QTMA 1NZJA 1UP7A 4JX6A 4RYLA 4PRYA 1P0FA 5FHQA 4JIGA 4GOXA 1LTHR 3ZZTA 4I1OA 1YKGA 1PP7U 2OFXA 2IYVA 1JAXA 1JI3A 2V6FA 2D5AA 2ZVQX 3NRJA 4NH4A 1FQWA 1MFPA 1X1RA 3HCNA 1RZRA 4UATA 1NW5A 2FUG6 4HGNA 4QOJA 2YU9J 4Y6LA 3P26A 2ZAGA 2IXSA 4LZWA 3GLRA 1PW7A 3V7FA 2NZJA 1I51A 1U28C 3CLOA 4EKDA 5AM4A 4F92B 3FOWA 2DHEA 5E20A 4CKBA 2VPXA 2VPLA 5F23A 1HDCA 4L8FA 3T7KA 2I9KA 5KQLA 6AT1A 4XOUA 2FEOA 2IH5A 1O3TA 1XI2A 4FZRA 1KORA 2FQXA 1UOPA 3AHDA 1YHNA 4GOOD 1PNVA 1ZA2A 4OQXA 2BGLA 1EUQA 3WL4A 4XOPA 3D8RA 4LMPA 2QZ4A 3SS9X 3SX4A 5LYJF 1A2OA 2H4WA 1RQPA 2V4ZA 2VIIA 4TV8B 3RK0A 4UNRA 4BNVA 3DBHB 4QDJA 4UHFA 4WV3A 2CBZA 4E03A 2G1PA 3GXOA 1CP2A 3G4SI 4LTMA 4S12A 1Z7EA 5TX7A 3VJLA 2LGJA 5E6RB 4BX3A 4I8XA 3VJRA 2JFGA 3KELA 3GWZA 4IDBA 2C3UA 5ADUS 3IEVA 4FFDA 1HORA 3DEWA 2Y4OA 2STTA 5HLHA 1Q22A 4RTSA 3WHPA 1VHQA 2HOQA 3KZNA 2WJ3A 2G1JA 3PRKE 1ZGWA 1LH0A 4TSRA 3L07A 5TEVA 4TKVA 2PUGA 2I4TA 3V7CA 3IAEA 5DHSA 4DNCA 1WDMA 3H5LA 1K4SA 4AZWA 5JYDA 3DKIA 4G25A 3D1NI 1E2DA 4JJIA 3N97A 1TJ3A 4UMVA 4DM4A 4QSMA 2REOA 4Y1FA 1QZZA 5ICFA 3JQ9A 5B3JA 4Y7NJ 2ZSKA 3II6X 2H1LA 4ITUA 1NW7A 4JLMA 3NONA 3UJ7A 1WQ1R 3TD2A 1U8FO 2D59A 1CYDA 2D54A 4R1TA 3GW2A 4DWOA 2ZUWA 2ZJ2A 2QM0A 1XCGB 2ZE8A 1IWOA 1P1HA 2XVCA 3ICCA 4PF1A 3V7NA 2C7GA 3MB8A 1BMTA 2W83A 3VR3A 2P78A 3U7IA 2AO9A 3WLTA 3ERCA 1KJIA 1BQ3A 1TGVA 1IEVA 3ICOA 4RV9A 4YFXF 1W87A 3UHOA 3U7EB 5E3OA 4RS4A 3VR3D 4D9MA 4FS8A 4LRQA 3RFTA 4DFDA 1KIAA 1FVXA 3RVNA 4Q9JA 2RC4A 2AQEA 2ME0A 1BO6A 2QW0X 4NPHA 1MBEA 4KLRA 4TL7A 2XASA 3C1UA 1Z28A 4YJGB 3FPBA 2Q1TA 4H3HB 4JBAA 1FL9A 5BPDA 1Y1KE 2XRFA 2Z1DA 1UC9A 1X0XA 1F2TA 3Q5GA 2MFZA 4FLFA 4TV9F 3VFDA 1PEDA 3VSCA 1IBKB 1A95A 3FWPA 3LQKA 4D96A 1ONSA 3L8MA 5B6IA 1XAIA 4F3RA 5I9LA 2QSHX 5IFLA 3NEYA 2G07A 5E3MA 3W5UA 2Q3DA 1XTUA 3ON5A 5BURA 3TGPA 1WQ2A 1E1YA 2FEXA 3OOSA 4RZ2A 4JT9A 1Z2DA 3IKLA 1J1IA 1K63A 2HLDA 3DBIA 1K98A 2GILA 3LWFA 4MTLA 3W7BA 5HJEA 2L9VA 1TL8A 1HEYA 1ZUHA 3PQFA 5HS4A 5JWOA 3MMXA 1UPAA 4M1WA 2J0QA 4PFPA 2JEZA 2RHRA 3QLUA 4L8VA 2PYDA 4EO7A 2M2EA 2GCEA 2OPBA 4FHFA 1VFNA 3A6ZA 2UXDB 4Q3NA 2O8CB 2IYOA 1RC9A 1W7PB 1HXDA 3DMNA 3BDVA 3GBPA 2WHQA 2QVCA 3EUWA 2VUHB 1PLJA 3ELDA 3WRXA 1T98A 2I2DA 2VBIA 5IT5A 4WH0A 2JAPA 5JARA 3JRDA 5HLIA 4WUVA 1P4HA 1GPDG 5IAEA 4E21A 5BVGB 3FHTA 2P5SA 2A67A 3GC6A 3WL6A 3E7PA 5F1OA 2BUAA 3F74A 3ODGA 2PZ8A 3KP5A 3PYXA 1LB1B 1YKSA 1QXSA 1G98A 1Y7LA 5FKNA 4PSWA 4ALKA 4YAJA 4QT0A 2PLRA 4Z9YA 2AQIA 5JRZA 1UOOA 4P4GA 3IPAA 1GOTA 5JUWA 1FY2A 4WASA 2JGRA 4QJIA 3AF2A 1R6RA 1CUFA 1SUEA 5E3HA 2PLWA 1KK3A 3BL6A 3OAAD 1PZGA 3QELA 3GFJA 2X0KA 3JR9A 3ZWQA 1OHHA 5SYAA 2VYCA 2RKHA 1H66A 3LC2O 1EAYA 2I3BA 4EITA 3CCYA 2JA6J 2NLOA 5EJ6A 1WJAA 4L9NA 4ACBA 3O8GA 3I0MA 1XP5A 2AUNA 2VVTA 1K27A 5B4TA 4TVKA 2GQQA 1Z6QA 1LPQA 2J5PA 5I5EA 1L7QA 2DPHA 3R3UA 3LRTA 3Q8KA 4BMOB 1GJRA 5E1WA 5I8ZA 4E4TA 2F1RA 5CNIA 2ZUEA 3RBAA 1SXJC 3TTYA 2VL7A 3MOGA 2Z08A 2I80A 2HHJA 2HH9A 2IY8A 3JQ7B 5SZJA 3UAVA 5J1RA 2XLCA 2FPIA 4J8PA 3SEAA 2XDYA 3N6VA 4L75A 4LHVA 5DXAA 4DV7B 2I6TA 3V1KA 3PXGA 3B1FA 1JSRA 1P61B 1XJ0A 2J1LA 3HP1A 3IBCA 1C29B 4I4IA 4JELA 4LRXA 3T3DA 3JQAB 1U7UA 1PD0A 2QYTA 5B1EA 4ZZLA 1M7HA 4HTAA 3I4PA 2NU8B 1ZMOA 3WGUA 4P3OA 3KQHA 2VOPA 1RWOA 1TM5E 1S2NA 3H86A 5BSGA 4EB6B 2PBZA 5FPPA 3ZE1B 4R69A 4BMSA 2WUGA 1A5JA 1C3OB 3H84A 2CW5A 3H4IA 1TD1A 2F2EA 1SWWA 3LJKA 1NW6A 4GX0A 5F21A 4DXHA 3S2SA 4C6RA 4DMMA 4Y6OA 2DR0A 5KTRA 2E3JA 4QNNA 3A8TA 3A4IA 1H6BA 2JPBA 1VZ0A 3P4XA 2AS5F 1CZRA 4GL4A 4RY9A 3W5AA 3CGWA 4PYLA 3DZBA 1I2ZA 3KSRA 3FVQA 4ETMA 4Y8VA 2AFIE 4ESOA 1T6YA 1DADA 2HL6A 1XC7A 3IELA 3JASB 1E4YA 3KP2A 1ULYA 1AGPA 2A6PA 1BJAA 1E3JA 4WKCA 1IZ8A 1IYZA 3FNGA 1DBWA 1E4VA 1G8MA 4KPUB 2BSAA 3ZBQA 1W4MA 1M6NA 1RRFA 3F9CA 3LW7A 1F06A 2OUIA 2YWBA 3BD6A 2A3NA 4Y6RA 2M1ZA 1Q0HA 4DM3A 4YRGA 2BY1A 3GUDA 3NWSA 1P4RA 1QLWA 3I32A 2C29D 4P7FA 1PVVA 1KS9A 3MJCA 2GXAA 1FUIA 3PP8A 3ZIUA 3NALA 1TM3E 2FETA 3DTIA 4EW1A 1Z9CA 2DFLA 2OOKA 3JRBA 3HCFA 3F3MA 3IQGX 3A2NA 4EJSC 3KDPA 4QUHA 5JASA 1KDZA 3MTBA 2PT5A 4G37A 1JHDA 1PEYA 4W6ZA 4LJLA 5KDDA 3CLQA 1AHNA 4C6TB 3QU4A 2HJGA 2F8TA 4MRMA 3L0SA 5C44J 3ZDYB 1UBEA 3ENWA 2DUNA 1XZBA 3H5OA 2BY4A 1HZZC 4HNVA 5AHWA 3ZWDA 3WGNA 1FFWA 1TIBA 2FBIA 4I5IA 1KGSA 3O4FA 4UCXA 1VQ8I 3RV3A 2X1EA 3CLVA 3L4EA 5EJIA 5ADWA 5DSTA 5KOJA 4MLDA 1KETA 6REQB 4KQCA 2CLIB 3G8CA 1ADCA 2FK8A 1UK8A 4RZXA 2O0YA 4ZGBA 2DE0X 2EHJA 4QXMA 3RFXA 2MIIA 2PMZN 1EXMA 4F7WA 3IX7A 2VC0A 4HFNA 1NG6A 2PWYA 4IDGA 3ZHOA 4OP1A 2O05A 2WAAA 4ENWA 1L1QA 4JI0B 2BFDB 3CVXA 3LIIA 1KEKA 3RYCB 3IP3A 2R5YB 4M49A 3GV0A 1IPFA 3OZEA 2HMVA 4UNSA 2SCUB 3K6GA 3NJ4A 4XWGA 4V0MA 5SYMA 3PRHA 1AQIA 2Q6TA 1NUAA 5I51A 1KQFA 5K0JA 1VG0B 2DFNA 2UWMA 3GW8A 5HUHA 1ETKA 1KZ1A 3D8NA 1NG9A 3BKXA 2QCOA 1V96A 1VA4A 1UFMA 1DV2A 2Z83A 5E6RA 3QY0A 3A6JA 1R9JA 1W46A 2XQKA 5EE5B 5KYYB 2ZJZA 1N0WA 3BQNB 3NTVA 1W581 1PR9A 2NZXA 3S1SA 3TVYA 1ZIXA 5T4EA 2MINA 2X1DA 5JDCA 5H20A 3RIHA 2P8JA 5JJCA 4K9KA 5IVKA 1YS6A 2IS1A 1GUDA 1MJNA 2WSLA 3L6RA 3F90A 5J4LA 1OWNA 2R00A 1EFUA 1U2DC 4DL9A 3GN2A 3N87A 5KYWB 5K8UA 4F3TA 1R6UA 3HEBA 3STWA 3IHLA 2HVRA 1QGUB 2QE7D 3RBZA 4EL0A 2V1UA 4OHBA 1E9VA 3AKZA 2HQSA 2W2OA 4HAWA 5CXXA 3CU5A 5T6MA 2TDXA 3MCZA 1C80A 2QQEA 3F4LA 3G2BA 1PYGA 2MT9A 2PBLA 2Q50A 2XOEA 2ZUBA 1X7XB 4YUVA 4CM6A 1EX7A 3UB4A 3V46A 1SBYA 1RKQA 3ESZA 4BVAA 1G3YA 4HA8A 3D4LA 1DZIA 4RA6A 2Z33A 5IH3A 1YR3A 5DM1A 1TJYA 3I4FA 3FKJA 1K92A 4XWWA 5FRMA 4FW8A 5HTKA 3SQNA 5HKBA 3FOZA 1BI3A 3F8CA 2XSJC 1IOZA 1M72A 4Q48A 1TEVA 1YUBA 1C50A 4I50F 4YP0A 3BTVA 3DAGA 4XB6B 1F4VA 3AAFA 4E2FA 5BYKA 2XKOA 3QYJA 1CQXA 3IQFA 3CC8A 5C4XJ 4PG5A 1OILA 4ENJA 4D81A 1G8GA 1UINA 2VPQA 1GILA 2M7AA 3G9XA 3PUHA 1SIWA 3D3KA 4BNKA 5ALOA 2FPWA 4DEXA 4Z5XA 5CDTA 1OKKA 3ELBA 3ZHYA 3HCPA 2VODA 2X48A 3PHJA 4RK7A 1XEXB 1M1UA 2LZ0A 4EF4A 5A4DA 4AG5A 2BGGA 3S6JA 3A1YA 5M5YJ 4A3BJ 2A5YB 2XB6A 4FI3C 4RIGA 5KIAA 1GKKA 2CMHA 4KE6A 3U7RA 2NAPA 2KMUA 2F4VB 5EJ9A 4WFQA 3V6MA 5JG7A 1QVUA 2OV6A 2QUAA 4ZA2A 4OP2A 5IHPA 2X7XA 3HVJA 4MW5A 1UBOS 2OUKA 5FRDA 4KH0A 3V1LA 3PL1A 2KE5A 3LE8A 4ZMBA 1NXPA 2IITA 3HWWA 3AHIA 2C88A 1HH4A 1MXFA 3OE1A 4ND2A 1V1JA 2PUBA 3SXPA 5AT1A 3VR6H 3M1EA 4TL9A 5FO1A 2O2EA 9MHTA 4HLYA 1IEXA 4Q1DA 1NRXA 3ZPLA 5EZYF 5FI1B 5ER6A 5F0FA 1B14A 2JFHA 1A9RA 3JD2A 1NW9B 3OU7A 4MV9A 5CM8B 5LM3A 2V74B 1PZFA 4KQMA 5K7FA 1SKAA 1CJKC 5L3VA 1G20E 3INTA 5CPBA 2XF5A 5EXSA 1F5TA 3DLPX 5TF4A 4KRYA 3K0LA 1YE8A 4DYCA 1A35A 1U2GC 1XU4A 3JRWA 4NZMA 1W30A 1CLEA 3ELKA 5LQUA 1Y3FE 3FX3A 4OB7A 4PUSA 1N77A 2O7OA 1JJVA 1ZW1A 2A7QA 2ZRNA 5EGOA 4BX0A 2A5WA 3IA2A 4JOMA 4L9VA 4JBHA 3H3FA 3QYPA 2B2CA 3J80Z 1FMJA 2V65A 1IZ9A 2XUFA 1R10A 3JYLA 1DG9A 4TV9B 2M8GX 4JVOA 2C61A 4UVGA 3RYCA 1OC2A 1XN7A 1AKQA 3IQXA 3IVGA 3BTLA 3ELUA 5DNWA 4DYHA 2JGDB 2UXCB 1JL3A 1MOPA 4AMZA 3LCRA 4Q7QA 5KDOA 1NVMB 5TJJA 3WYFA 4C7OA 2P3SA 4B4VA 2G3YA 2JVIA 3KSDO 2FRHA 3V5NA 1J0CA 1UFRA 5CLHA 5C46F 4C87A 1I39A 4EKEA 3JU3A 2O7NA 2QKMB 2DXIA 2RHMA 4JJFA 4NCKA 2JLXA 4WW0A 3BRSA 2I2XB 4BYMA 5JI6A 2WYHA 3EPHA 3E5MA 4HPJB 4CEJA 3LPDA 3BPVA 1PJBA 4YQEA 2EZ4A 1DWPA 3G6WA 2AI2A 3KPJA 4EO9A 4G07A 3LSJA 2IPNA 1HTWA 1SBTA 4YMVA 1ZZEA 4A6PA 5F64A 2MDTA 3UMYA 2QM7A 3WICA 4Z6YA 3EPRA 3NP7A 3WU2C 4D3YA 3BE8A 3MCTA 5HSGA 1GSAA 1IWBB 3P5BA 1PL7A 4L15A 2OCGA 4GEGA 2PRSA 3LVBA 4PX5A 1CNMA 1PAUA 1VE1A 3BTCA 1QYWA 4IWNA 5CK5A 4YQYA 5B3SH 4PX2A 4C4PA 2GEBA 3KKQA 1OFUA 4REOA 4QFBA 4HXGA 1Z17A 3EXHB 2C78A 1SG0A 4LDNA 4EL5A 5JC1A 2O54A 2MOKA 3MOIA 3M5CA 3GRUA 1QORA 3W79A 1PW5A 4CZZA 3DWGA 4M87A 1X7XA 3EVNA 4PG7A 4TLDA 5I7HA 4MVJP 4JL5A 1L5GB 5ITVA 5IBQA 2GYWA 1W1UA 3HDJA 4KEAA 5B1SA 2M3AA 3PJRA 1I9CA 2Q0QA 1CQIB 2FCAA 1CEXA 3HZOA 4OAPA 4WFKA 3TQHA 4FM9A 1JIUA 3FCAA 3HFGA 3QKTA 3GN1A 3UK7A 1SQ5A 1H2BA 5DLQC 5AVJA 1IPHA 3NX4A 5AM2A 1GXPA 3N2NA 3F4KA 5BSWA 3JSPA 1PGNA 1CULC 1NBMD 3M4JA 4WN3A 1IBSA 4W1PA 4KXYA 5KJ1A 1TM2A 1USWA 3CZCA 1NGSA 3AEKA 5K09A 5L3GA 1UKZA 2O07A 3IPRA 1R4NB 2WB1A 1QB8A 5HFJA 1BEZA 2JAOA 3ZU4A 4CF5A 4DT1A 2HYIC 1O4XA 3TSZA 1XYGA 1JPVA 1UQUA 4IH9A 5CQEA 5EJ8A 3QG5A 4PYOA 2QAGB 3Q88A 4C3IJ 1H8HD 5FV7A 2KISA 3TTXA 4AVPA 3P9SA 3QFRA 3IKVA 1X7WA 2HVSA 3MZYA 3DMTC 4KUHA 5ALTA 4GQAA 3QU3A 4L27A 5FTKA 4BKUA 2MC3A 1FUKA 2VNSA 3EIOA 3ONEA 3OE5A 1UXGA 5EXXA 3W1VA 4F1KA 1YB1A 2CXXA 2PGJA 3JQDA 4U7JA 1Y7PA 3AW9A 2UVQA 1U78A 4R2XA 1E2NA 4B43A 3GCZA 2IDZA 2VJMA 2H09A 3IXQA 4Y2VA 5GIPE 4MPDA 3D2CA 1OY1A 3ZYZA 4FCCA 3HOXJ 2QP9X 1KI9A 4MPPA 4UJ5A 3IP9A 2HDCA 3V1MA 4L51A 4AD9A 2WBMA 2QYSA 2IPMA 4GEKA 2Z5GA 1Y1TA 3B78A 3ZBTA 5IG2A 4DLLA 3DHNA 1VMEA 3QE9Y 2D8MA 4HLNA 3WTCA 4CM1A 5J9FA 2CYAA 3VHXB 4K1LA 2XB0X 1ZOSA 4ZN6A 4DOZA 2ACVA 1WRJA 1P5RA 5A4MS 3K6KA 4IMPA 4DCGA 2MH9A 4BQQA 2QBYA 4MCIA 1U3EM 1K8XB 3LC0A 5KNBH 1X9IA 3M1IA 4F46A 2HM7A 3RIMA 1DMSA 1XRMA 4DQUA 5DLDA 2IBTA 1Z0DA 4JQFA 1GADO 4K6OA 3GAZA 1XA4A 1KAQA 1UMCB 1IUOA 2JC3A 3JALB 4GQIA 1CB7A 2E4ZA 1M75A 3HNPA 4DY6A 5INTA 2GPTA 1RYNA 4FCYA 1MJGM 1W36C 1RJWA 2YIVX 1VL1A 2O0KA 4ZAZA 1U8RA 2GF0A 2YMPA 3PITA 3E8MA 1DEAA 4TVOA 2HXSA 1CY6A 3IAHA 3HPHA 1GPH1 3LKDA 1GDTA 2F5FA 1XP8A 3DT8A 4XCQA 4BKMA 3AEQA 3C5EA 4OH7A 3MEXA 3UMBA 3TRKA 2H51A 1LUJB 3WTTC 2VLAA 1VDMA 2HWKA 4HWPA 3T38A 1K83J 2JB9A 4LX0A 2ISYA 2BSXA 1I0IA 2ZIFA 3H97A 2QLLA 3VRHA 1YQQA 2QSFX 3ZCVA 5M5WJ 4RS8A 1T1SA 4R1SA 1I7QB 1H2YA 3PE6A 5GPAA 2Y0DA 3SYMA 3PTAA 3TTWA 2R1TA 3H1FA 4MV3A 3QMVA 5HCUA 4D7AA 4YEJA 2ZUFA 1YJ5A 1TEZA 4LF9B 4XLPF 5JATA 2PXXA 1O1YA 1R49A 2PZLA 3JREA 1YITI 1KJJA 2JAUA 5H70A 5IBPA 1CWUA 4POAA 4D3FA 1HNZB 1DL5A 1B8OA 3OTQA 5K5QA 4TS1A 4ITRC 1TZJA 1BXGB 3AUYA 4TXJA 4BE4A 1QE0A 1UMDA 1XQVA 1SD5A 2REQB 3HXPA 3OLXA 3FFBA 5K9ZA 4CPDA 3FBNB 1VQPI 1NR1A 3R0XA 4FDLA 5A05A 3F9KA 4M89A 3VPRA 2H1IA 5LPNA 2XVXA 4JBGA 5JMTA 2PUEA 4CXFA 3H6HA 2ADUA 2VL8A 2E1MC 1VG9B 2LVBA 3IULA 2XRZA 1QG4A 3BZUA 3GLHA 2KLHA 3PGXA 4AI6A 4H7DA 3MN2A 1P2TA 1R7RA 3GMSA 3IIKA 1EX1A 3I2FA 4WKNA 5CTJA 3E9CA 4GBJA 4QECA 1JSZA 1MNAA 4O4HB 3HN6A 2V0CA 4CDNA 2CV0A 2Q2VA 1ZH6A 3V6LA 2WAXA 4KYIB 3RAEC 3MTJA 1RR6A 3HRHA 4PAOA 3AXSA 4I2VA 4JXZA 1LDMA 1RM4A 2UXBB 1LW7A 2IEAA 2PEZA 2OU2A 5B6JA 3ZLUA 2QRJA 3VBCA 4KPYA 1GSOA 1YJQA 1L8QA 4XLEA 2JDID 2OGWA 1VMAA 2K3FA 3A1EA 1CDDA 1TUIA 3ANSA 4MW0A 4Q34A 2PX2A 4XDHA 2ZSBA 3KUCA 1KU9A 4WCVA 4O59O 1SD4A 2AZMA 2BMJA 3QKIA 3QYBA 4IDHA 4LXHA 3ZGLA 2PRYA 3LCMA 4FYYA 2FU4A 5A02A 6PFKA 1T2CA 3QFHA 1KIMA 1N33B 2QQAA 3GAFA 3KTDA 3WP0A 2JD2A 3AUAA 2BC9A 2DA1A 4J0JA 4IIEA 1KSGA 4YXWD 4ZOLA 3RC3A 3QW2A 3JYQA 2MINB 2O2ZA 4Z54A 4PYNA 3MUNA 2ECOA 1U0RA 3DFIA 4IKOA 1GU7A 1I0ZA 3E18A 2BZTA 4KX3A 2Q4OA 4QELA 4GCVA 3EOZA 1O96B 4QTZA 1GTG1 1QVRA 4UUOA 5FKJA 2INGX 5E6UA 4ZC8A 2JFUA 1D4OA 1V1MA 3NHJA