3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
5E1DA 5E2AA 5D4SA 3FXRA 4LG0B 1WRJA 3HOTA 2WTEA 4XBFA 3FX3A 5HZMA 2MD5A 5DD8A 4NB5A 5JR3A 3CGGA 3BJOA 3EVFA 3EQLF 4FP9A 4RVDA 1FP2A 1BI0A 1AOYA 4DQ2A 1KQ9A 1NW3A 5EMKA 4JXJA 4IRIA 1B1BA 1DPUA 1G3TA 3JSPA 1O9HA 2LDUA 5E18F 2EG5A 3V8KA 2Q0OA 1KA8A 2B9EA 3L00A 4IF4A 3WE3A 3EETA 2HYGD 3P9NA 1HKSA 2FPOA 3PB3A 3VODA 2OY0A 1LQ1A 4Q4ZF 3R3HA 2UZKA 1IN8A 3T8TA 4LGWA 5C0OE 1YS7A 3IEIA 1G8AA 4Y15A 1LNWA 3PQKA 2AN4A 2PX2A 3P71T 3HTXA 2VT2A 2DU9A 3L09A 4GF5A 2CGPA 1XSDA 5EEGA 1I6XA 2EV0A 4EJVA 3GNLA 5EMJA 3FPJA 3HYIA 3KR2A 2MC3A 3DLIA 2P8TA 3KQSA 2PSSA 2R7FA 3UJ6A 1O7LA 3SXYA 3IRQA 1SAXA 1TLHB 4MGRA 1IUYA 1PJZA 2P4WA 3TLJA 3KPVA 2FBHA 3GDHA 4E31A 2HQNA 2GPYA 1G60A 2PXAA 3ER9A 3AXSA 1XMKA 1F5TA 4YIIA 1P6RA 2VODA 3HA3A 4WK8F 3EPPA 1L0OC 3L2CA 1MD0A 5ICFA 3C6KA 1IAWA 4HRAA 1EIZA 4F7ZA 3CBGA 2EFQA 3GRVA 3IKVA 2XASA 5EIWA 1N2XA 5TJJA 3IWFA 2O06A 4MHGA 1KQ0A 5K5OA 2VS1A 4M72A 5DSTA 3X0DA 2JG3A 4KN4X 5H6QA 4PCAA 2ZKZA 2ZCWA 5FTWA 3RYPA 4L9JA 5FFZA 2Z6AA 1IM8A 4HBLA 3WU0A 3P2EA 2LNBA 2DI3A 3K1PA 2PJDA 2JPBA 5FFXA 2HTSA 1PP7U 1U5TB 5K0NA 3ID6C 2BZGA 3UJDA 1KU2A 2PX8A 2CWWA 1ZRFA 1DL5A 4A2UA 2W84A 3KPUA 4S04A 2WA2A 3KQMA 5FLXZ 4P58A 2G71A 5E1ZB 2P6SA 2NXCA 3U9GA 4YUVA 4PGHA 1FPQA 4HLXA 2AS0A 1KGSA 2NXNA 5D5XB 3E3VA 1XD7A 2IPQX 2K4MA 1R6AA 2I7CA 2YXLA 3D5LA 5FULA 2GAUA 5MHTA 1DDNA 4N0BA 3E6BA 5FD5A 1I1NA 5GM1A 5IKMA 4OIPF 2FF4A 1L1EA 5D5VB 2P1DA 2XYQA 4DCGA 3M6UA 1R1TA 3V7CA 2G8NA 3UJBA 3TGNA 1WZNA 3LCVB 2OBFA 3ROUA 5D1HA 2Z99A 5FADA 5HDGA 4R6XA 2IW5A 3ZMTA 3PT9A 4NECA 3LL7A 2CQKA 2JJQA 1SUSA 3OFKA 1L3BA 2RNJA 1W5SA 3IV6A 1YZ3A 5BPIA 3WG9A 3O2PE 3GZ6A 3K6RA 2L3DA 2YX7A 2MBFA 5L3GA 4QQNA 2DO7A 4AZWA 1CF7B 3EVAA 1AWCA 3GFJA 5F2KA 1R7JA 3ERED 4HH4A 2CYYA 1AV6A 4JK1X 3MGGA 4RGRA 1T2KA 3HRTA 1N7IA 4QWQA 4HQEA 2FK7A 1R18A 3V8LA 1MKMA 3Q9SA 4B8XA 2VC0A 4WWCA 2H6CA 2NAZA 1HW5A 4MNUA 4MTEA 4U7PB 1JG3A 2Q41A 4I98B 2DPDA 3TDZC 2PMHA 4LB5A 1O57A 3IRRA 3ISPA 4BH9A 5DT2A 3M9AA 1SD5A 4B17A 4G7ZF 1H9TA 4HQMA 3LFKA 3Q87B 5LQCA 1M0EA 4QLCU 3HCFA 3LBFA 5LQAA 4HDUA 5HIKA 1FZPB 2J5OA 2JH9A 3UJAA 2WV0A 3MERA 3SSNA 3F22A 3K9TA 1YUBA 1PDNC 3FXUA 3FWEA 1VE3A 3KCCA 5EMLA 3F21A 5EOVA 3IC7A 2L02A 3MEXA 2YTZA 3REOA 3BP8A 1G3SA 5EZQA 4BHCA 1YW7A 4LMYA 1RJGA 4YV1A 2Z3YA 3OU7A 4L18B 1O7FA 5EZSA 5EGSA 2OXTA 4U88A 5LQKA 2O3FA 3P9CA 2N47A 3Q5FA 2BH2A 4C05A 1USTA 5EIFA 2H27A 5K05A 2ERCA 4LK0F 2DAOA 1KU3A 1Q0TA 5DM4A 3HRUA 4UOEA 4POOA 3HUGA 5HS8A 2HR3A 2ZBRA 1U5TA 5HLIA 5HIIA 5F64A 4NHJA 1R22A 3GLXA 3FTFA 4OINF 3E7PA 3JWJA 5CIYA 2QY6A 2NNNA 1B4AA 2JPCA 2B0LA 5LGUA 4E32A 4ENMA 2E5WA 3VC1A 2Y1XA 3DULA 3CO6C 5FA8A 1PRYA 2CFXA 2DLLA 1SMYF 3BGVA 3BXOA 4PYOA 4KA4A 3DLCA 2PGXA 3HVHA 4G94A 2V7EA 2GLUA 2FMLA 1XDSA 2ZMEA 2AR0A 3BWMA 1XCJA 2M30A 5K01A 5D1NA 2OB1A 5BPDA 2OZUA 5HDKA 4CWAA 5GIOE 2I62A 1YFLA 1XJ5A 3BWBA 3FUUA 2HFHA 1SQGA 4WF2A 4AZSA 3O3KA 1YW9A 2PV0A 4BHBA 2K7LA 3Q7EA 5DYMA 5E8JA 1BI3A 3MAJA 4P7GA 1LDKB 1D5VA 2ZBPA 4G7HF 1UFMA 3DXXA 2QYOA 1YB2A 3G88A 1MJFA 1ZH5A 1R00A 3LQQA 3R24A 1YF3A 4U0WA 1HMYA 1S29A 3CUQC 2HNKA 4H0NA 3TKAA 3JTHA 2FCAA 4EMSA 3E05A 4F86A 1J59A 3KKZA 2Z6QA 3OE5A 3HSFA 3G5TA 8MHTA 5E1WA 3WGGA 5E17F 3CUQB 4LG0A 3W6KB 4BHPA 3D0SA 4DA4A 5JHUA 1IXSB 3ZMVA 1XGMA 2PEXA 3OZSA 1OR8A 3PFHA 4RS8A 3SZTA 1B6AA 3KP3A 4YUZA 3LBYA 4YMHA 3V8JA 2ZWAA 4M9ZA 1NKVA 1TNSA 3T0IA 3N97A 4IRGA 3R61A 3K0LA 3SFZA 1P4XA 4GOLD 1TPYA 2HZTA 1TW2A 3A4TA 2HR1A 2KJBA 2MLGA 1OPCA 1RUOA 3EVZA 4A5MA 1NW6A 2RGVA 5FHQA 4U7DA 2V74B 3HA7A 3B7PA 1HSTA 1ZLKA 2I6GA 1R8YA 3J81Z 4PINA 4EK9A 3KE2A 5EQJB 1UCRA 4IRHA 2EJRA 5LGNA 2B78A 1RI7A 3KHKA 4X61A 4IHSA 1WG8A 1YS6A 2EFWA 3FRHA 1KYZA 2O03A 3C3PA 3EYYA 2OYRA 3F8BA 3QRFF 4X60A 3ZMSA 5KYGA 2P3LA 2AOUA 2ESHA 2G7UA 1EV7A 4QTUB 2C6YA 4HX4A 1U5TC 4RV9A 1ULYA 1PUEE 3KPJA 5E1MA 4E2ZA 2FQ3A 5DTRA 2BR3A 4DZRA 4YV0A 5LQNA 3E6CC 1REPC 4WCGA 1VQ1A 1BBYA 1LEAA 2A3SA 1FYMA 2ZZMA 5KQSA 3SHFA 5K5QA 2CMGA 3HCBA 3ABTA 3IWZA 4ESBA 3GRYA 1K79A 3OZTA 2KJCA 2F5EA 5KS2A 2XHKA 2P7VB 4IPAA 4LWOA 5J8FA 1FSHA 2EK5A 2M1BA 2V6CA 3DF8A 5K0FA 4IV8A 3MQ0A 1IW7F 1JHFA 4KIFA 4RSRA 1FYKA 3F6VA 4A0YA 5EVJA 1ZREA 4EGZA 2XVAA 4MWZA 2M87A 2ESRA 4L0ZB 2YVLA 1UB9A 1EH6A 2HMYB 3FUVA 3HTSB 2XUBA 5D8KB 2IBTA 3P8ZA 4EQZA 2QM3A 1TNTA 3S2WA 5LRSA 5HLHA 4PYLA 1Q1HA 5FLXK 2UYHA 1OKRA 1TW3A 4PZJA 5T64A 3LQRA 4RVFA 3ELUA 1YW8A 4BLUA 5E1BA 5E20A 3DXJF 2F8LA 2ZIGA 3SXJA 5DD4A 5FGMA 3KQVA 1X1DA 5A2QK 1BIBA 1W7PD 5LRRA 2FYTA 4GOOD 1NBIA 4ZTBA 3TR6A 4M74A 1E17A 1KPIA 5F2NA 4Q47A 3SSMA 2EWNA 3DQVC 3MQ2A 3T7RA 4YFKF 2VONA 5FB2A 3TO6A 4P9FA 2X0LA 5F1RA 2P5VA 4PYIA 2VOPA 1XGOA 4KYWA 3NTVA 4UHTA 5EKXA 3P9KA 2E7XA 2P5KA 1FP1D 1Q0SA 4HSGA 3SVZA 3ERCA 3F8MA 3EEYA 2XBMA 1G4DA 2IA0A 3IKTA 3TQSA 3KEOA 3GW2A 4L0YB 5CVRA 4IWNA 1I1SA 1JG4A 5HVQC 4LLGF 2G70A 4XUCA 1P2FA 2FNAA 4HV5A 2VBXA 4LECA 2Z33A 2L4AA 4RAZA 3KP4A 1RI3A 1RJDA 5E1OA 4RTJA 3I58A 4G7OF 3DMGA 3GFLA 2R6ZA 1MDMB 2IGTA 4GXOA 2ESNA 2XV4S 2ISYA 4AVPA 1NBHA 2P3OA 3EYIA 4C08A 3OPNA 4U7TB 2NXJA 3RI4A 2V1DA 2H6BA 1XCBA 5U4XA 2NP6A 2VP3A 1I5ZA 3R6TA 1ZRCA 2L01A 4KN7X 4MTDA 4P7JA 3WTZA 4RWZA 5BXYA 3R60A 4ENKA 2G72A 5K0CA 1O54A 3QU3A 3R9XB 2FNPA 1Y0UA 3GYHX 3MHTA 2XAQA 1H0MA 4BYYA 4P5OA 3KP5A 5HOOA 3JW4A 1CF7A 4EJTA 3GRUA 4PYJA 1P1CA 2P35A 1PP8F 2ZIFA 4X63A 2CKDA 5FWAA 3E6MA 2ZXJA 2PX5A 3BWYA 1R23A 2E1CA 3B3JA 2EJTA 3NEUA 3OU6A 4C07A 3BJ6A 2DQLA 2ISZA 1FJXA 2QVOA 4P55A 1KR5A 1K78B 2FU4A 4EKIA 3WU1B 3CJRA 2K27A 2PLYA 1KYWA 4HAMA 2PWPA 3QOXA 3HRMA 3ELWA 5T67A 3M7GA 2PMUA 2XRNA 1WQ2A 5LHHA 4Q48A 5HS7A 2ELHA 4R8SA 2PJPA 5LR6A 2BE5F 1QZYA 1DUSA 4RTSA 4PIMA 1Z9CA 3BOQA 4O3MA 1IN5A 2RN7A 2AXLA 2RQPA 1ON1A 3PS9A 4PWYA 4ON0A 2M45A 2XGXA 4RTOA 2P7IA 5DLYA 2O8XA 4P96A 3ZN0A 5D5UB 4HF1A 5DV5A 3G5LA 1OYIA 3KQQA 4EM1A 5E8GA 1YIOA 4P7FA 1HXDA 2P5LC 3F3XA 3KQWA 4MEYF 4FX0A 1XSXA 4EQQA 1SD6A 2GA2A 2YR2A 4I7HA 4UXNA 4V0QA 4RTMA 1UIRA 1QZZA 2K4JA 1NW5A 1UWVA 1EH8A 2DULA 2IRFG 3UJ9A 1BJAA 1Z3CA 4FHTA 3E8SA 2DFIA 3M33A 4HA8A 2VXZA 4O29A 2IH2A 3PLAE 3GX4X 3TMAA 5D6FA 4XLNF 1F4KA 3BKXA 2C7OA 2MH9A 1ZG5A 3HA5A 3O4FA 4LWPA 3HVJA 3K0BA 2OD5A 5G02A 5K0JA 3F8NA 3F6OA 2F5DA 4KDCA 4FX4A 1B9MA 3G2PA 3JSOA 3LDUA 2YR0A 5GP1A 5AIQA 4Y2HA 1M6EX 3OCJA 3U81A 2CW0F 4KIGA 4BY9E 3HSRA 5DUIA 2OBPA 2VZ9A 1FNNA 1W7PA 1XSVA 1VBFA 2LSOA 1FX7A 1Z05A 3EVCA 3MZHA 1RI2A 4DM3A 1G3YA 4I09A 5H6RA 1VLMA 4RGXA 2CSOA 4M73A 5EPEA 1D8JA 1KXZA 3JWHA 4RTRA 1YFJA 1R1UA 3ZMDA 1T6SA 3EVGA 4EJUA 1AQIA 3RKYA 5DCFA 2VE8A 1U3EM 2IP2A 1R8XA 4CTKA 4EM0B 2FRHA 1XCVA 3HEMA 4PYMA 3PVCA 4YUXA 1UHWA 4CXMA 4GOND 2BGCA 4UVCA 5KVRA 2FA5A 4L5JA 1G55A 2ZMEB 2DPMA 1IZ1A 4QPNA 2NNYA 1ZAOA 2EA4A 2EA2A 4XRFA 2PT6A 3GXOA 4U0YA 1FWZA 1DUXC 3HCDA 3PQJA 3SGLA 4C04A 5E8RA 3U1DA 3GO4A 3LECA 4RTQA 10MHA 3I64A 3P7NA 1ODDA 2P41A 1XN7A 3L9FA 2K4BA 5T6BA 5AONA 4EKGA 4A12A 1FC3A 4GGGA 3RYRA 2PXCA 2ONYA 2VDWA 4HGZA 2VBZA 4DF3A 4A0XA 5HLGA 4RB3C 5P8WA 3BT7A 1SFEA 2A6EF 4QDKA 2GQQA 3C3WA 1XGNA 3T8RA 4KICA 4K6MA 3HNRA 1S3JA 2L54A 2H1RA 1YTYA 3LA7A 1BM9A 2FOKA 1JQ3A 3WSTA 2ZBQA 3GRRA 3ME5A 4BLVA 2VC1A 4KUMA 2XKPA 2A07F 1NT2A 1A04A 5EHGA 1RJEA 1M6YA 4YUYA 2X4HA 3LGAA 1IRFA 3FMRA 5FWDA 4C4AA 5LQUA 3HOSA 3V8VA 2EB7A 5F6FA 3W6JB 1GXQA 4E2WA 2XVMA 3HCAA 2Y0MA 2A69F 3MWMA 3PFGA 4RB0A 4Y17A 2WWYA 3RTRA 1NV9A 5CLSA 2A6HF 5EMMA 3KP2A 4M9XA 5ILVA 4OQDA 3E5UA 5ICCA 3S68A 1SUIA 4FSDA 4C06A 2GA1A 5CVUA 2DK8A 2GAFA 4CZZA 1D3YA 4ER7A 1IN4A 4YFNF 1EG2A 1T43A 2GIVA 2OQRA 1L3CA 5D4RA 1QGPA 2IFTA 3TO9A 4MEXF 2AOUB 2C7PA 1KP9A 2HDCA 1USSA 3GZ5A 1VIDA 1U2ZA 1W5TA 1S7AA 3K1NA 2Y48A 5E8IA 4FS8A 2ORED 1J9IA 5IT9Z 2FBIA 5ILSA 3P2IA 5ICEA 2QQ9A 3GFIA 1BKYA 3QPHA 2P7HA 4UVBA 3KPWA 2Q8KA 4M9SA 4LLLA 3GUDA 1JHHA 3FPGA 1TQPA 2JTVA 1IXRC 4ENNA 3LDGA 3EVDA 2F2EA 3K69A 4ESFA 3THRA 3BWGA 3FM3A 5HDNA 2H09A 4A6EA 1MJBA 1Z6TA 5M5BA 2VBYA 2O05A 3CDHA 4RX1A 3TPZA 3I53A 1NV8A 1MJ9A 3LHDA 3CO7C 4IVNA 5TRDA 2MLKA 5EG5A 1G38A 3LDFA 5DXJA 2C7RA 3F8CA 3A7EA 3U2RA 4PONA 1SG9A 2O61A 4LK1F 2UYQA 5IT3A 3KETA 3G2OA 3LKZA 2BBYA 1IN7A 2QQAA 3TKYA 2W25A 2AOWA 1KU7A 2F5CA 1L9KA 2STTA 2VOOA 3SR4A 4CICA 5HEKA 5H20A 3HRSA 4IKPA 5FO5A 3F8FA 2KIFA 1SQFA 1I9GA 3RKXA 3FUXA 2RVCA 1QNTA 2OZVA 1K7AA 1L3IA 2HQRA 4CKCA 1R58A 1U2WA 5D5WB 3FUWA 4FT2A 1ZHFA 3GO5A 4DCMA 3AJDA 2E7WA 2FXAA 3MAGA 5LBQA 3MCZA 2D1HA 5GINE 4HTFB 3DOUA 2RC4A 2ZZKA 4MHTA 4KT5C 2IH4A 4ER3A 3ELYA 5L3DA 1NW7A 3UJ8A 3GGDA 3EDPA 5A2QZ 1ZG1A 4FGZA 5BQTA 4R05A 3UFBA 3B3FA 2EFOA 2LF7A 2XKOA 4OIOF 2UZ4A 2HWKA 1IN6A 3AAFA 2ACJA 1HQCA 4AX8A 4MIKA 1TTYA 2ZVJA 3B73A 4ZYHA 1IXKA 1FBQA 4H0EA 2GZWA 2PQ8A 3RPUA 5LSAA 2ZSUA 5HILA 2CO5A 7MHTA 3KLOA 4KDPA 4AIHA 1JQEA 2TDXA 2JHAA 4ESJA 4TV7A 1CGPA 3HTUA 3KR1A 1LJ9A 3OU2A 4HYEA 5D8LB 2DPUA 4E70A 5CD1A 4KDRA 1I1GA 3H2BA 2C7QA 2WA1A 4F85A 4JBAA 3QOPA 1INLA 4R8RA 4KWCA 1ONVA 3UWPA 3THSA 2FSWA 3DP7A 2QRVA 1SD7A 2HGCA 5LHGA 3LX6A 4QVKA 3M8EA 2A61A 3DKWA 4BP1A 4IHTA 4PIPA 4P9UA 3LCUA 4HV6A 4BAYA 2JHPA 3F72A 2STWA 3VSEA 5K5RA 1MZBA 1YZHA 5CVDA 3UJCA 1S8NA 2RDPA 3HP7A 3TFWA 2A14A 1RI1A 5JUWA 1ZARA 3ZPLA 2P40A 3WE2A 4U7BA 4I2OA 5FUBA 1RZ4A 3EVBA 2YQZA 3ANXA 2AVNA 5LEJA 5DRTA 4LLNA 3ELKA 3QU6A 3P97A 3GRZA 1O3RA 1B42A 3KEQA 4I0BA 4FSXA 5FCDA 2XYRA 1R5HA 2AOXA 5E9JA 4PCLA 3ER8A 4WX9A 1V4RA 2MH2A 3KLNA 3JWIA 1Y8CA 4YMGA 1R1VA 2IA2A 4NQWA 1IF1A 4GOMD 5DX1A 3DMFA 2GH1A 3CJTA 4BLWA 1NHAA 2OPBA 2ZIEA 1JSZA 3ZMUA 1VTNC 2ZLBA 1BI1A 3HVKA 5FQNA 1HSJA 2ZFWA 1I4WA 3BZ6A 3O7WA 5E9QA 2ZWVA 2H94A 1BC5A 4XLPF 5HS9A 3NDJA 4OA5A 3M8FA 3GF2A 2VT3A 1BOAA 1RI4A 4MQ4A 1BHJA 4HX8A 3HCEA 3BDDA 2Y75A 4XCXA 3L8DA 2R3SA 2ZTHA 4R8HA 2JT1A 1BC8C 1L3LA 4RVHA 1OYWA 2EJUA 1KPHA 1BI2A 5L3CA 1P1BA 2B2CA 2GB4A 4IXAA 5IT9K 4PGGA 2IJLA 4AWXB 5K0BA 3KPYA 5EC8A 5DSXA 3J7AO 4KIBA 2QBYA 4A5NA 3OOPA 4ZH4F 4OIQF 5ICGA 1FBUA 1J2XA 4IJAA 1G8SA 5CM2Z 3VOEA 2ZNZA 5FD6A 3DXYA 5HOQA 2QQBA 2IH5A 4E2XA 4GCVA 2OQGA 4WXHA 2GWRA 1Z91A 4UVAA 4PDKA 3NVMB 5B1SA 2W57A 3OZRA 4CO8A 3WTXC 4X41A 1ZGAA 3JAMK 1E2XA 3I9FA 4R6WA 1YLFA 3VB2A 1FYLA 1HKTA 3NW9A 4EJOA 2IPXA 2ZJ2A 1T38A 4HLYA 4HGYA 1YQAA 2PBIA 2NYXA 4ZYDA 3BROA 2NNWB 4OQEA 5GM2A 3G2QA 3SZPA 1ON2A 5DX8A 1J75A 1TQMA 2OKCA 3Q9VA 2YXDA 5H02A 4Y13A 3RPQA 3I4PA 3TOBA 2W85A 4Q5SF 3G89A 5K1YA 2V79A 4UUVA 3LA2A 5C9ZA 2ZO4A 2FBKA 1JTFA 3DMHA 2QLZA 1GHCA 1K6OA 3BZBA 1JG2A 3CUOA 3HCCA 4DQ0A 3DFGA 3J80K 2ETHA 3BY6A 2PXXA 2CWEA 2G1PA 4KW7A 1BC7C 2EV6A 5BS6A 4ER0A 2PY6A 5IH3A 3C0KA 1IXCA 4WXDA 2ONZA 2HKXA 1DPRA 1H9GA 2OO3A 1H1DA 2VBWA 1TQIA 4OMYA 3OFJA 3FTDA 1LEBA 5J8CA 1O3SA 1KPGA 3J81K 4CTJA 5DWQA 3FMQA 3TRKA 4RGSA 2O0LA 5GWXA 2Z9OA 4S05A 6PAXA 4HZFA 2YXEA 3KZYA 3MTEA 9MHTA 1BN5A 3ZQ7A 3GEZA 4YIFA 2XAGA 1F9NA 2UYOA 2V1XA 2OU2A 3MTIA 5GIPE 4AIKA 5ERGB 3ZP5A 1LDDA 1X1BA 1T0FA 1X3UA 2GXGA 2KKOA 4U0VA 1FOKA 3RKWA 4YV2A 3V97A 2JZYA 2P8JA 2KIMA 1G6NA 1BOOA 3A26A 5L3BA 1WWXA 2QE6A 1J5YA 3QP6A 3PTAA 2OB2A 3LA3A 3WTTC 3H3ZA 4MQVA 4CGZA 1AF7A 2O07A 2ZNYA 3DV8A 2M8EA 1SMTA 1N7JA 3FTCA 2P3QA 3F4KA 4ER5A 5JFRA 1WXWA 4KMFA 1ZQ9A 2QRVB 4GEKA 3A27A 1SFUA 4X1OA 3V7SA 5C1IA 4OMZA 4YG2F 2XVCA 4LB6B 2BM8A 2QBYB 2YX1A 3AY0A 4FT8A 4GBED 1R36A 5K0GA 3HIFA 1C0WA 3C6MA 2BR5A 2W24A 3H92A 1STZA 3FYDA 1G3WA 3C18A 5BW5A 1JE8A 1J0RA 3F23A 1XTPA 2DT5A 3VYWA 1WKMA 3T7TA 3CCFA 3G8AA 2EFPA 3NWEA 3UA3A 3QPTA 3SMQA 3M4XA 4OX9Y 4E30A 3SX0A 3GVAA 3KP6A 1WXXA 4ISCA 4M71A 1P91A 5K8VA 5DTQA 3WGHA 1QO0D 1W4MA 1XMAA 5JVTA 3BPXA 1FLIA 4QQKA 2HV9A 3MFKA 2IDKA 3I59B 2O57A 5DM2A 5E9WA 3GU3A 4L5IA 3FPEA 2FMYA 2PLWA 2JH8A 3FZVA 3T0YA 1KU9A 3MZYA 5D6EA 1QYRA 1GVJA 2UXNA 4AIJA 3ULQB 1RJFA 2OZ6A 1X1AA 2AN3A 3N4MA 2PI0A 4M7RA 4AD9A 1R5GA 1F3LA 3SQNA 3PFIA 1U8RA 5AIPA 1V39A 5DXAA 5ILUA 2PVCA 1OYYA 4OOIA 2PWYA 3P2KA 3QOWA 4V0RA 1VP3A 5EHIA 3WTVC 2VN2A 1P4WA 2IT0A 3GIWA 1FT9A 1WS6A 3RW9A 1F38A 4WXCA 5FQOA 1RUNA 3HSEA 3BGIA 2UWMA 3QV2A 3DPLC 1P4AA 3FPHA 2D2WA 1Z6RA 2YUIA 4GYIA 4CKEA 3E5XA 3EGIA 5CVIA 3RIRA 3TM5A 1JXSA 3FMSA 2AOVA 5DCMB 4PNEA 4UNOA 1D2GA 5DPMA 3UJ7A 3EMDA 4HDVA 1ORHA 3R0JA 4I0AA 5EKUA 2PBFA 5E1XA 5CCBA 2PT9A 2R7DA 1ZGJA 3DR5A 4OU0A 4RB1A 1F1ZA 1P39A 1XDUA 3TOAA 5J6XA 3UZUA 2XAFA 1YG2A 3R0AA 2HEOA 5DTMA 3HM2A 1WI9A 5DM1A 3V7RA 4JQFA 3KQOA 1FSEA 2EV5A 4I01A 4I02A 2PKWA 1QAOA 4G8XA 2JHCA 1EJ0A 4O5VA 1XB4A 2DK5A 4N9IA 3TM4A 1KIAA 2QZ8A 4RTNA 2VDVE 4AZVA 4G6QA 4KVZA 4GUAA 1G6Q1 3LAPA 1R74A 4MTLA 4RVGA 3NJRA 2YU3A 1J7KA 4KMUX 1DP7P 2F5FA 3UBTA 4N9HA 4ZZLA 1EJ6A 4KFCA 4GC5A 3M1EA 5LEKA 5ED4A 3E6DA 3AWIA 1V3FA 4DMGA 3TOSA 1B9NA 3L7WA 3GCZA 4G56A 1HW2A 5CJ9A 1JG1A 2AOTB 4EV0A 3ZMZA 3OV8A 4ASNA 1UFKA 1XXLA 4PYQA 2K02A 3T5XA 3HHGA 3NWBA 1X19A 1XCLA 4IV0A 2GXBA 1VP9A 1WY7A 2ZW9A 5K09A 1YYVA 1EQAA 1DCTA 5KVAA 4K2EA 4BQAA 3BWCA 2PG4A 4CYDA 5BP7A 1JSXA 2H00A 4LD5A 2BR4A 5BW4A 3M70A 5HIJA 3RIEA 4HX7A 3G2MA 3FM5A 1VPTA 2Z6UA 2DQRA 2AS5F 1JGSA 1YO5C 4RGUA 3V4GA 3EGEA 2H11A 1SVUA 2D45A 4XUDA 3PX2A 4ZYEA 4O6JA 2HWVA 5K0EA 4YFXF 4ZZDA 1T39A 4AUKA 3KQPA 4E33A 2DTRA 2QUFA 4XSZF 2FRXA 2IDJA 1FBSA 4MQ9F 3E23A 1I27A 3VEPA 3D2LA 4FT4A 3COAC 3CLOA 1K78A 2XAHA 5BOXA 1HBXG 2O0YA 1QAQA 3WTSC 1NE2A 4EGYA 4BXUA 5DRYA 2RV8A 5ERIA 3H3UA 2ADUA 4HC4A 3B3GA 3KFWX 4XSXF 3TO7A 3KQYA 3FPFA 3ZN1A 3FXQA 4QTTB 4BP3A 2OA4A 4R1HA 2WK1A 2RKHA 4FZVA 2YSRA 4ENJA 3HVIA 4L9VA 4QVGA 1ZKDA 3K2ZA 3EVEA 3DH0A 1OMIA 3PX3A 3CJNA 4RTKA 3K1MA 2BM9A 4HW0A 3R6SA 4GYGA 4DKJA 5DCMA 3VC2A 4GO1A 1JQDA 3T7SA 4YUWA 2FK8A 1U6GA 5LHIA 3EEOA 3BKWA 3O31A 2AN5A 4RAYA 1O9GA 1HKQA 1MDMA 4M36A 2FEZA 1HW1A 1AQJA 1FBNA 2NRAC 2UYCA 3JAMZ 5L3EA 5KK1A 4PYNA 3FRIA 4RTPA 3CKKA 5HIMA 4ETSA 3R4KA 3UA4A 2ZBKA 4HG2A 3G73A 3WTUC 3DUWA 1S6LA 2K86A 1QQIA 3I5UA 2VDUE 2V9VA 3FYCA 3ELDA 3M6WA 2PFBA 3ECHA 1X1CA 3IHUA 2EFJA 2UXXA 5K03A 2B25A 1HNNA 3BUSA 2ZCJA 1D8KA 1XGSA 2HOEA 5LQRA 4G6DA 2V1UA 4C03A 3LAJA 1D2CA 1O3QA 2BYVE 4RB2C 1O3TA 4QDJA 4GC9A 4LG1A 3G7UA 3DTNA 3T1BA 2IVMA 3I54A 3QAHA 4A0ZA 3M6XA 2XROA 5CCXA 3TQNA 3C3YA 3LSTA 3OE4A 5CVEA 4B09A 3B89A 5CUQA 3EMBA 4L9NA 4PYKA 4LJZF 3LKDA 2OAZA 2BV6A 2J5PA 2GS9A 4ATNA 3I59A 2DBBA 3ORHA 3LPMA 2GA9A 4LFUA 4OIRF 4CXFA 1Z7UA 1YFHA 5CVJA 3KU1A 2NP7A 4UV9A 3P9IA 4L9TA 2O6GE 1KHHA 2IA1A 2A5YB 3KR0A 2XAJA 1EH7A 2LF8A 3GFMA 3AXTA 2CMHA 4FR0A 2ZULA 5DEQA 4XUEA 2LD4A 2NXEA 3A25A 4RYLA 3KQTA 2P6TA 3EUHA 3KZZA 1S7OA 5DM0A 1MGTA 3GJYA 1ZRDA 1KQ8A 2AVDA 4OBWA 5DDGA 1QANA 1QBJA 1LB2A 1IRGA 4ER6A 2CL5A 1MHTA 1XDZA 4HF2A 3O6BB 1ZN2A 3CTAA 2HTEA 4RTLA 3FZGA 1LVAA 2LKPA 3VFZA 1RNLA 1XVAA 3IYLW 3DEUA 2PN6A 4HTFA 2JRTA 1B59A 3WGIA 3R0QA 3FTEA 4UV8A 4CHUA 5KQRA 3B02A 2CG4A 1W7PB 1MJAA 4QPPA 4DNCA 5EEHA 3WTYC 3JTGA 4F84A 3G3ZA 1D2HA 2FHPA 5FA5A 5FHRA 3EGVA 5LQJA 3E97A 3ECOA 1ZYRF 2IIPA 3FHZA 2B3TA 5LLQA 3NRVA 2Y1WA 4P7KA 1IY9A 4OBXA 5GOZA 3SSOA 1QPMA 4D0PA 3CC8A 3WODF 3TDUC 3FF5A 4R79A 2HS5A 3C1DA 5JI6A 2KW5A 4HF0A 2Z5UA 4Z2YA 4L7VA 2G7HA 2KRFA 2Q2EA 3BJAA 1EAMA 4WVLA 2PX4A 3LWFA 4HOBA 2HYFA 1U78A 2IBSA 2AOTA 3M6VA 3J80Z 4M6XA 3I71A 1T98A 5BMZA 5HFJA 2D1VA 3NQOA 1ZLJA 4G9YA 2YPRA 1VL5A 4EVIA 3HHHA 5DUKA 2QENA 2MA3A 5F2OA 5E2BA 1P92A 3KP7A 3RDIA 4A6DA 4PCQA 3A7DA 3JWGA 2HTJA 4ZYGA 1WSUA 1RI5A 2EFNA 3G8BA 4CDGA 4KRGA 2ZFUA 3ML6A 1JR4A 1UHMA 2DW4A 2YX4A 2E1NA 3MB5A 2P7CB 1GXPA 4M38A 1Z1DA 5CVVA 3I0TA 2A68F 2JSCA 1NW8A 1JTEA 1SD4A 2L4MA 3ABUA 5CYVA 3IHTA 3DPTA 5K0LA 2VE9A 2XIGA 3NVKI 2AZTA 3KR9A 4AZTA 2WC2A 1QAMA 3FUTA 5LGTA 4E2YA 4CKBA 4EM2A 2M5WA 3RJPA 1ORIA 2QWWA 3MCTA 3QP5A 1FY7A 4GQBA 5DX0A 2ADMA 3WTWC 4M6YA 2NS0A 3GWZA 3SM3A 2I9KA 1TBXA 1ZG3A 2ZZNA 2EX4A 1SFXA 1LDJA 3NMUF 2NYUA 3DXZA 3CUQA 2G9WA 3NDIA 3BPVA 2XYVA 2FE3A 3C7JA 4EJWA 4BNCA 3B5IA 4M37A 2BEOA 4Y30A 1SKMA 5L3FA 4OA8A 3IL2A 2KIUA 1OR7A 3E5QA 3BGDA 3CJQA 3RODA 3LCCA 2COMA 3CVOA 1RIOH 2HKOA 1BIAA 4KNYA
chains in the Genus database with same CATH superfamily
1OC4A 1JH8A 1XLTC 1I3MA 2FEKA 2NTYC 2V7UA 2WV9A 2XCQA 1T5SA 1HC8A 3F6EX 5E1DA 5JSFA 1X0VA 1ISSA 4GX5A 2DJNA 4QYSA 1HH4A 4LZPA 5JCJD 4O1HA 4UU8A 2WTEA 4EHFA 1HG1A 1W5EA 3JAMA 4OWRB 2Q1XA 2BBOA 1NF2A 2VVTA 1GZ7A 2QSYA 3JD3A 5HZMA 1IZ9A 1U65A 2QORA 4MWOA 4UCFA 5DD8A 3IPCA 1HZZC 1BX3A 2F3SA 2HO5A 3CGGA 4NTZA 3BTUA 4YJHB 1C8VB 2VEDA 1YBMA 2BN4A 1TYBE 3ASOH 2JGFA 4TTVA 2NYVA 2VHQA 3ONWA 3COJA 2VXOA 5EJCA 2CQNA 2DU8A 4G2NA 3CX3A 4KKVA 4RJLA 3DL7A 3S70A 1H6BA 3TNYA 4HDKA 1J2RA 3LQ2A 2DWUA 3RTDA 5K2OA 5AXAA 2GARA 2HBZA 1DPUA 3MUNA 3B7GA 3H0EA 1R10A 4L15A 1OLXB 1XCOA 2B2XA 1JNYA 3QG1A 4E2FA 2ICAA 3QVLA 4QIHA 3L00A 3GPDG 4MSUA 1PYGA 3PC6A 3SPXA 3CDLA 5CJPA 5BN5A 2GOXB 3VODA 2ZSIB 3WFIA 4A92A 4YRJA 2JJ1A 1XMVA 3Q88A 3P5SA 3KKKA 4PIVA 4JLMA 3T8TA 4LGWA 4MO9A 5T4FA 2G6BA 1GG9A 5C0OE 4KYIB 1UKYA 2BY4A 5CK4A 2WWFA 3IOEA 3IEIA 3K30A 4XGKA 5K6RA 3AT1A 3L4BC 3I42A 3MUEA 3ZZMA 2F4IA 3AEXA 5JIBA 3QQPA 3VR5D 3DLAA 3P71T 4TT3A 4BWVA 3OT5A 4KH0A 1H85A 1H1LA 1WZCA 4KU4A 3L09A 1BA5A 2HYJA 5TX7A 3OM0A 2Q5LA 4NC9A 2RI0A 4XKJA 5EJ4A 2L7MP 5JYEA 5IKOA 1UM9A 3IBYA 1HEYA 2YCBA 1ZA2A 5EEGA 2I3AA 1I6XA 4J49A 1RXEA 3HR4A 3N86A 2W2KB 1JKJA 1SOVA 5NULA 4F45A 2BELA 4GVPA 4QL3A 4DQLA 2WHPA 4GZ3A 4OQXA 1I5RA 5CYGA 3KQSA 2RIPA 2R7FA 1CK4A 3IXLA 1Q20A 1DHRA 1JAIA 3EIWA 2R1TA 2R00A 1AO3A 3M9LA 4D4MA 1SAXA 1WNTA 4XLZA 1DIHA 4MRAA 3L2UA 1IHOA 2HBQA 2C8JA 4H3KB 3HDVA 3KPVA 5ALOA 1CJBA 1Y3DE 4XOPA 2C99A 2CHFA 3OJXA 2QD5A 2Q21A 2DLNA 2FBHA 5KAFC 3E7XA 4H35A 4ROSA 5TIIA 1TM1E 1Z15A 1D03A 1GHTA 3LLSA 3PZRA 4HRIA 1YL5A 1FRZA 2IQ5A 3P2JA 1FYFA 1Z75A 5GGYA 1Y4ZA 4NOKA 2JLYA 1P8JA 1K6IA 2HUNA 5A4KA 2AG1A 4ARSA 1F5TA 1X80A 4CCNA 1BCSA 4YALA 2LE0A 4KUHA 2CVOA 3LXMA 2FUNB 3U09A 2VJKA 5B36A 1G3IA 5EDNA 3B48A 2EQ5A 1Z4MA 4R0MA 5FR2A 3L2CA 3GG9A 4Y9DA 3JRIA 5DW3A 5AOBA 2K85A 1IAWA 2AHQA 5KUTA 1ARZA 3GUUA 2H4XA 4REOA 2FU5C 1Z7BA 2BKXA 2CHUA 2XASA 4X1IA 3S3MA 1D6NA 2M6RA 1RRGA 1E3QA 4LXIA 3P0HA 2V97A 4HDRA 4OV6B 3IWFA 2AUNA 4A23A 2CUJA 2GERA 1C9JA 4CLRA 4NE2A 2DLDA 1F0KA 1OCEA 3ADKA 5KDOA 3RHTA 1X1TA 3GGSA 3PJEA 5L3RA 1N2IA 3FTPA 2DA6A 4HBLA 4ALLA 1QMPA 3RKUA 2DI3A 1BVHA 2PJDA 2A67A 3D6VA 1I7PA 3VR6D 1U5TB 2MHCA 5B3LA 4DBQA 1N3BA 1Q11A 2G8LA 2BZGA 2WJ6A 3AUTA 3EMVA 3NM4A 3OT1A 4CM4B 3UJDA 4EPRA 1GG5A 2PX8A 4V38A 4NYIR 2HYIC 1XZDA 4JVNA 4ZU3A 2IGMA 1GVHA 4R69A 4U6SA 4YRNA 4JOQA 1ANKA 3ZRGA 1C4WA 4J16A 5L3SA 2Y0PA 1GD1O 3KQMA 2PZEA 3QKTA 2ZUVA 3DHYA 4ESOA 3WK7A 2OT3B 2Q50A 4CG2A 1QPZA 3X1JA 1CQWA 4GBGA 3WYDA 1A2BA 3HFJA 4HK4A 5K3FB 5EZ5A 5IN4A 1E6WA 3G0CA 3IHWA 1F5SA 1UBJS 5AKLA 4HLXA 1W9HA 1FDTA 1JRLA 1DADA 2FP3A 2C8KA 4IEFB 1Y8ZA 4V0NA 2IITA 4CGYA 3E3VA 1XD7A 2K4MA 4KWHA 4ZOLA 4Q15A 3RSQA 4IX7A 1ESNA 1CRLA 2GBFA 2QJRA 3GCWA 1HL7A 3HPRA 1HO3A 4ZGWA 4BEWA 3DWEX 1DDNA 1NPYA 3FH0A 4Q9AA 1U0FA 5FD5A 1EBFA 1FFWA 2EQAA 3U1KA 3ZQHA 1I1NA 1IBRA 1VRVA 2DQYA 4JD5A 1YZYA 4Q9IA 5E3IA 4QXPA 4ZIRA 5ITWA 1XZAA 1ECGA 4U4AA 5JS6A 1SC9A 2CL0X 4B4CA 2QTCA 3M4ZA 4H6WA 4BPBA 3SFIA 3A6PC 2FPSA 4C2UA 2B1JA 2CXQA 2FCRA 3E9NA 1J8QA 4FE3A 1GCGA 4W5JA 5FOUA 3OQOA 1II8A 1KK0A 5JJCA 4OMDA 2M1ZA 3ZJUA 1B7GO 1TLTA 5CLIA 5KHLB 4GIBA 3RU7A 3ZW9A 4C0BA 2CLCX 1U11A 2GBGA 2M6KA 5JCXA 5D1HA 2Z99A 5FADA 4D99A 2R44A 2CV2A 2X9NA 5K3AA 1ZD5A 4R6XA 4XD7A 4OGGA 1SVWA 2B94A 3LL7A 2FV8A 3R1IA 4M86A 3SC3A 2Q1TA 4PJLA 1SUSA 3OD5A 1Y0BA 2POCA 4HWTA 2COEA 4TXJA 5LYJA 4QT0A 1K89A 2QRJA 4DQDA 2CCKA 3H42B 3IV6A 3FWNA 4IVPA 1JDZA 2ODBA 1Q1GA 3MTAA 1D1TA 1QS0B 2VKQA 4R9VA 3O9ZA 4L4YA 5SZIA 5HXAA 2ON6A 3PK0A 1OX4B 4IGKA 3NHFA 4V0MA 5BRAA 2VL7A 3NWSA 1FNBA 1X7WA 1U8FO 4FXOA 1JFTA 2JLBA 2X6QA 3PGKA 1L4BA 4F4JA 1ITYA 4NJMA 4MRSA 2FN8A 1CF7B 1E2LA 3P45A 4RL6A 1L7AA 4OJYA 1A69A 4C7XA 1U9OA 3GFJA 4TKZA 3D6MA 1BQ3A 1SKAA 2CYYA 2WADA 1E2JA 2PQMA 3GMDA 4ANJA 3MGGA 3BG6A 4FVTA 4IOAF 1ECCA 1FMJA 3EUFA 1E6CA 4MQ6A 2P9BA 2XOEA 4HQEA 1IZ8A 3NEAA 2FK7A 1R18A 4B0PA 3I92A 4KPUA 1SEPA 4J43A 3LM8A 1ODLA 4NQRA 3U3KA 5CAEA 4RVNA 2V7TA 1U2EA 3G2BA 3X2FA 1P62B 3RUEA 1DQYA 1IOVA 1EFVA 1H1LB 2K6GA 1Y3BE 2NQTA 2BFEB 3D3WA 3KJQA 4U7PB 3OBBA 2ZQ5A 5D3MB 3ZZUA 1NQVA 1YVEI 3IBTA 4EFMA 2WU1A 1ABBA 1UM9B 1Z2EA 1GPMA 2EFCB 2DPDA 1NOJA 2AFIE 3QMMA 2JFQA 4NV3A 4MS3A 2PMHA 3HCOA 1O57A 4YAWA 4UE6A 4HQ0A 5KC9A 4F91B 1UK9A 3F3KA 2EX1A 2NO1A 4A5OA 2DYRH 4AP9A 4YIHA 2MSCB 5B12A 5LXTB 2DTZA 2NSLA 4BH9A 1PYDA 3FYUC 5DT2A 5C7IO 3EGXB 2XITA 3WDSA 1LTQA 1HE2A 1ORRA 4HQMA 3JR9A 2DM6A 1W85A 1C3LA 2CLIB 2EW1A 2WILA 3C6QA 3FM9A 3JQGA 1U0HC 2NWQA 3D64A 3Q7IA 4LHYA 1U2GA 2B7LA 3K20A 5A2QA 3AVXA 1OB2A 2PL9A 2G5GX 2IY9A 3GUCA 3Q87B 1PK8A 1QH8A 2Z83A 4KV9A 3IQEA 4WK2B 4DLXA 4HUTA 2JUGA 3HCFA 1V7QA 1CB7A 1TUGA 4RLHA 5HIKA 5C8ZA 1F8UA 4IHQA 2ZSKA 3GAMA 3QEJA 4DVJA 3OP4A 4Y1FA 3H2YA 2A5FA 4E5NA 1N6RA 2Q3DA 2H31A 4OM8A 5CFMA 3N8KA 4X65B 3LQ4A 2ECPA 3Q9LA 3BHNA 3OPYI 4YCJA 3FWEA 3ANYB 2FSIA 4KPFC 3KCCA 4LRTB 3ZV5A 3DHVA 1MBEA 4Y1RB 3IC7A 3QKRA 3W8FA 4Y2JA 1AQLA 1QORA 1T4BA 4UU1A 1SCDA 3UATA 2D0DA 3U9LA 1E6EA 4CYMA 1F2TB 1MQSA 1LA2A 1Q1QA 1Z0JA 2JLVA 2LKSA 5FPPA 3D6HA 5HKOA 4YV1A 2BW0A 2IA5A 3QJGA 3WYCA 5F73A 4C0LA 3TW0A 2BT4A 4E7LA 1L7PA 3WWCA 3Q98A 5CGQB 4U88A 3OIYA 4OAQA 5ICSA 5K3EA 5I3CA 1N8TA 1VJ0A 2YH2A 4ZTFA 2GJ4A 3Q5FA 5KTKA 1C0LA 5A5DA 2BH2A 3CHYA 3ABMH 1USTA 4GM0A 2DB3A 2LDBA 2ZWMA 2H27A 4PO3X 2CHQA 5EP1A 4IDNA 4UDXX 2F3QA 2RGWA 3FSGA 4WEOA 4R2HA 1Q0TA 2JIMA 1CETA 1L7DA 1N5LA 1LRLA 3R5HA 3O74A 3V1YA 4UOEA 1OQYA 4AS1A 2G04A 2X9DA 3EC7A 4M0UA 4UEWA 4QT4A 2VN8A 5AW7A 5F64A 4FJ0A 1ZOPA 1O95C 3JWJA 4ZOLF 4I4TB 4HB0A 3QUQA 4R9SA 1XP8A 2Q5FA 2X4LA 1BA3A 2GHIA 3BRSA 4GX0A 2ZB7A 3LOCA 2VSNA 3GZJA 4IZHA 4CCSA 3ZNPA 5CA1B 3IOCA 5LGUA 1CUUA 3FF1A 2JFYA 2ZCVA 4O33A 2AF3C 2JS7A 5CDYA 3OCYA 4G0OA 4JXXA 4WA7A 1KMQA 4LXYA 3KCQA 5IYBJ 2MSEB 3QXHA 1TT0A 1IBMB 4P5EA 5EE1A 3TDKA 2NNLD 3DULA 2QTNA 1V8ZA 2ZSDA 3HP1A 4AJKA 5EJ6A 1PRYA 2CNKA 4LQDA 3KZOA 4RZSA 2NSHA 3ZG6A 3F8TA 4B4OA 1VGVA 4EL5A 4PHTA 1GRCA 1N8NA 5K7ZA 1VQ9I 2QVGA 1JA0A 1XZMA 2ZYHA 3BXOA 3GB9A 2HY7A 2WIAA 3I3OA 2R5ZA 4LFBB 1E0JA 4D3SA 3KSZO 1DEKA 1RLIA 2GLUA 1Q83A 3NBKA 4B4WA 3G17A 5LLTA 1XDSA 1TFUA 3K9CA 3HKCA 1K3FA 1T33A 1IULA 1YHZA 3JRWA 2I91A 4AKHA 4WKBA 2P90A 3S8EA 3GJ3A 1LTHR 4CWAA 1HYBA 1OU4A 3U16A 3AG3H 4DJJA 4TTJA 4ZQHA 3I3SR 1J5PA 1PDOA 2CLDX 3FUUA 1WJAA 4IOLA 2HFHA 3UK2A 3OIPA 4F6LA 4P36A 3OLVA 1N5IA 4K81B 2II6A 1Z18A 2YJ5A 5A1TA 1JEAA 3ODGA 1RT9A 4WERA 4AY6A 1PL6A 3QBTA 2XUKA 1UJMA 4GU5A 1YMVA 1ZR2A 2BEWB 2EJCA 2G4CA 2NTJA 2X0JA 3CCRI 1SCUB 2MR6A 2YWBA 2Z8YA 3KD3A 1RZVA 2NLOA 4P7GA 5E8JA 2XHEA 3FCYA 3A6EA 2HSJA 2OV2A 2VXBA 1GSIA 1S7GA 4JGBA 1JSRA 2D2FA 1D5VA 1UADA 3L2RA 1Y4UA 4H7KA 4QGAA 3SC6A 4AJHA 1UFMA 3ZOKA 4JJIA 3T61A 1OIVA 2BBTA 3EXIB 5AVUA 5IZCC 1SC3A 3OCUA 1MJFA 1ZH5A 1W19A 1C9EA 2K87A 4Z54A 3AU8A 4KR3A 1BRTA 4XLHA 1N9GA 1TEZA 5ALQA 3CLQA 1K7EB 1GXSA 3IBCA 1YF3A 4X7BA 1HMYA 1S29A 3EEIA 1I4OA 2QRNA 4ML3A 5EJ9A 1ZW6A 2X0DA 4FXPA 1EFUA 1AF4A 4ECEA 1YTLA 4A3CJ 2HPHA 4EG8A 1JAXA 1AZLA 5HNHA 1NN0A 1XZHA 2NUTB 1Y9EA 2RBKA 1XL1A 1T6XA 2BFAA 3HV2A 4I5DA 5F5NA 2PKQO 4C0AC 5ITSA 3G4SI 3CG0A 3JQAB 3SVTA 4LCJA 5C5DA 2AHOA 2Z6QA 1T2FA 1B3RA 3CUEF 3EJWA 2PYIA 2BFEA 1C1DB 4MFDA 2C03A 1K8YB 5KMGA 1HDXA 3BILA 3OX4A 1DS6A 2WWTA 4MP6A 4BHPA 5C3EJ 1HDIA 2CEKA 5BT8A 5KTMA 3GEBA 1WETA 4BJ6C 1TZKA 2X0FA 1IXSB 2P4SA 4TWIA 1N36B 3HK2A 3ZMVA 4XI9A 3GOHA 3JRXA 1YTUA 3S55A 3F47A 4RS8A 1B6AA 4I4TF 1DT5A 1PV2A 1SBQA 3ZBUA 2B21A 4HZUB 3DA8A 1YQUA 5DM60 4YMHA 1E4OA 5KVCA 1S0UA 3JQGB 1B0ZA 1TNSA 1WP4A 4UAJA 4BRWA 3CF4A 1V25A 5EJ2A 2J7PD 5HCIA 3CZMA 2X5KO 2BMAA 1QXSA 3D7KA 1N2BA 2J67A 3M4NA 5CT4A 2AI3A 2NV2B 3OPQA 4ZVKA 1P4XA 5J40A 2AWOA 3FBNB 1B8IB 4GOLD 4DY6A 5GONA 1THZA 4ND1A 1TW2A 2X2FA 4XE5A 4LI0A 5TB5A 1K97A 3D0RA 4P53A 3CQZJ 1WU7A 4FQ8A 4KODA 4NMWA 1MB0A 5E9AA 3SBOA 3ICWA 2MYSA 1H6CA 1GPYA 2FG6C 4FDTA 4FNGA 1YI8A 4C6RA 4A8HA 5THQA 5U9CA 3VAZA 1FUEA 3EUAA 1IG0A 4OU5A 3WMRA 1XJ0A 3GJTA 3GRAA 5FHQA 5JALA 1YRHA 1OFHA 2P2DA 3KUCA 4E15A 4F9TA 3K9NA 2FR8C 3N76A 5KWVA 1HYEA 3KVRA 2V74B 4X6LA 1X92A 3B7PA 3V4PB 4ZT4A 4C2TA 3HXOA 1XEWY 5KINB 3LKBA 1Y1WJ 3K0FB 1XRMA 4HGOA 4PINA 2WKQA 4FBLA 4MUBA 3ANMA 2WIFA 1X9HA 3DQZA 3JAKA 3OZDA 5EQJB 4YDQA 3WTBA 5JSHA 4AIRA 3AEKA 4P0TA 1JTYA 5EUCA 5LGNA 2B78A 1EX1A 2XGOA 4G0PA 4OQMA 1RI7A 4BFZA 2ZYVX 2X3FA 3FNFA 4OD0A 3ZH2A 4XWKA 1Z5UA 4X61A 2BGJA 2QP9X 1RPAA 1WG8A 1Z73A 3FRHA 4ZXPA 1YQTA 2XB6A 4DUPA 2C2ZA 1SXPA 1W87A 2UV8A 3F8BA 5F1JA 3QRFF 2FH5B 4X60A 8LDHA 1CSEE 4L73A 1BN6A 4JR1A 1A27A 2BUCA 2DUWA 2P3LA 2Q2OA 4C0QC 3RYCA 1W2GA 3HUGB 1IVYA 1DZ3A 5I7FA 3PDUA 1S9HA 3HXLA 2OWDA 4HWSA 2PZJA 2X8WA 3DPIA 4GHWA 5TRTA 1VDZA 2PFGA 2ZSBA 5UKDA 2XMBA 2FPUA 4OO3A 3VPHA 3U5ZB 4CEJA 1E2GA 3ABKH 3AFOA 3LP5A 3IXMA 2XNJA 1M8GA 4GKAA 4OHCA 4BFXA 5BQOA 4HGQA 2E5NA 3AEZA 4L8VA 1J1IA 4PZ9A 4XPIA 5IM4A 5LQNA 2AJBA 3PQCA 4KEAA 4WUVA 1VLLA 4Y9RA 1AKHB 2ATIA 3IESA 1ZYUA 4B2PA 1QTIA 5CKTA 1VQ1A 1BBYA 1ZCBA 5ALWA 5FORA 5T4EA 3UAXA 3W4JA 5K99A 2YMLA 1L4FA 5K5QA 4A3FJ 1T13A 4XLCA 2XBLA 4S0XA 2NO9A 1IVSA 2E5ZA 5F1KA 3V34A 5EQDA 1CR1A 4MPPA 3IWZA 4ESBA 2WHXA 1COZA 2ZKIA 1DKRA 2CWDA 3EFOA 1DDOA 2HNBA 1YX5A 1LK7A 2KJCA 1PZMA 1RKXA 2ZB8A 3AHCA 3LTEA 1FTGA 3Q7QA 2GMWA 1QQTA 2P7VB 4FHGA 5DBOA 5JS2A 1KORA 3WL6A 4D9HA 5T3YA 5JLWA 3E81A 4GLJA 1AU9A 1GFSA 1FSHA 1PO7A 3S17J 4W97A 3LQKA 4IV8A 4MW9A 1HWYA 3PUYA 3K0HA 2XUHA 3F6VA 1YZVA 3HCPA 1MFPA 3UT0A 4A0YA 1SOAA 2P2CA 5HQTA 4EGZA 1ZJYA 2XVAA 3AF2A 3ASZA 2YWDA 4TMWA 3ZJYA 1IRIA 4H0FA 3QVTA 1RJ9B 1FFBA 4GI7A 2ESRA 2OCKA 4L0ZB 3DCFA 1MNMC 1EINA 1JFFB 1SPBS 1PX0A 1UB9A 3NHLA 1R12A 1EK6A 2R7OA 1QHYA 4NZYA 2HMYB 3B6KA 5D3MA 1A5AB 1ESEA 1XNJA 4BX0A 4UB6C 2QN7A 7ABPA 1Z22A 1MQAA 3ABQB 3H2JA 1L5HA 3VV2A 2L7ZA 1SH7A 5JO9A 3TOCA 4B79A 4D4LA 1UKEA 2CL7X 3AI7A 4IUCS 1VOTA 4Q19A 4EQZA 4B46A 4MGZR 5A7HA 3UB2A 3UMRA 2C5HA 2PFSA 2QQGA 1P7ZA 5JSQA 5LZ5A 1V1MB 3P0FA 4WT7A 1KEPA 3A14A 5JAIA 4MVJG 3GPBA 1E5DA 2JBAB 4B43A 3LQRA 3RCBA 3PC8C 2OCLA 1LS6A 4CLRB 2ICWG 5E20A 5FKOA 1FMTA 1GEEA 3AY3A 5DHTA 4DBLE 4QG3A 4XWGA 1R50A 1IV6A 4IIDA 2AD5A 5EJ5A 1X7GA 5AW5A 3OE7D 1KY2A 5FGMA 5K6AC 3FIUA 1O8BA 1X9GA 5LRRA 3T3GA 5GV8A 3CNQS 1JHDA 1Y0NA 2DKOA 5G53C 4ZTBA 1U2DC 1ZUNA 3PICA 2P67A 5L45A 1N6OA 2DA5A 1WDWB 2BZ0A 3GY0A 4Q02A 3J7TA 5KWSA 3PO3J 3VH2A 1WDKA 1OQAA 3T7RA 2K7FA 4RVOA 1MW8X 3U1VA 1CY8A 4BEBA 3TKAA 2DHQA 5FB2A 2OHXA 4XRRA 5ALYA 3QW4B 3TO6A 3PEUA 2PJUA 3TZKA 1JA1A 1PVVA 2H5JA 3OSGA 1W73A 4GFBA 3R5KA 2VOPA 1CQPA 1FU4A 4IO1A 4IIEA 1XGOA 4KYWA 1VZ3A 2JI9A 2JKZA 1YU9A 2NZXA 2LLKA 2Y1GA 3KSDO 1DKNA 4UMDA 4YLGA 4YQZA 4D4KA 1I3LA 2MMGA 1L7NA 3RIXA 1VXRA 1BIFA 3N2GB 1U0LA 3PC2A 2EC5A 1N2CB 3FR8A 2XBMA 2PGDA 2IA0A 5CA0F 5KTSA 1PT8A 3I3LA 3TQSA 4L4SA 1T2DA 2QK4A 3PUHA 1U4OA 2C4KA 4ICIA 1QPGA 4E13A 1V6AA 2X9GA 2ZI4A 2WBLC 4L0YB 4YP9A 3RJ9A 4K6CA 4IWNA 1I1SA 4LLGF 2M34A 1DRKA 3RVPA 1DVRA 2BHYA 2VBXA 3UXEA 5A04A 2O6HA 2R7XA 1SPXA 2VO1A 4RAZA 4PXSA 3RYHB 5DI3B 1QO7A 3I5YA 2HIGA 2VJJA 1GUYA 4OVKA 3I58A 4G7OF 2C8LA 3A70A 3DMGA 4HNUA 1Y6GA 4GGOA 1XPUA 5LBUA 3OJFA 4OK3A 1EZZA 2ESNA 3CMAI 3HRHA 4PWZA 3WAKA 4F2DA 4AM3A 2WSIA 4KG7A 2RB4A 2ZTVA 4EY3A 4C08A 3O4JA 3OTQA 4JIMA 3QNWA 1ABEA 2NXJA 3RVMA 4U9IS 3Q3JB 1M9NA 4H27A 4TUYA 2ECQA 3VAYA 1GDTA 1YE5A 1AQ6A 2ELKA 1ZH8A 3BCBA 1CFZA 2LBFB 1FL9A 1ZRCA 2RAFA 3D7SA 4RWZA 1PX2A 3WTZA 1N2OA 1U9ZA 2HJ9A 2VJBA 4WINA 4YXWA 2G72A 4DLKA 4RK5A 5K0CA 2RBGA 3R9XB 3L4KA 2V6BA 3FSEA 2FNPA 1SU6A 2YV2A 3ND9A 1U1CA 1T8TA 1SY7A 1R0RE 2A0FA 2FWBA 1C29B 2X2EA 4HS9A 3OUZA 1X7WB 3OR1C 1BFDA 1TYDE 4GMXA 4MPTA 4PNZA 4P5OA 3KE9A 4YMTA 3LVRE 5AW8A 3KP5A 5HOOA 5ECYA 3I30X 2O7NA 3GRUA 3BWEA 3PD1A 4A3SA 1PZFA 1DBVO 3D0QA 5HODA 1XEFA 5EXXA 1CW2B 1UJBA 2COUA 2EGHA 2OYSA 2X0KA 1PP8F 1PEKE 3CP8A 3AP1A 3PXUA 1KHTA 1PTKA 2CKDA 2D62A 3C5EA 1Y8QA 3HQ4O 4CIWA 3HI4A 2ZXJA 2DMRA 3SF0A 2E1CA 1E8NA 1MT0A 2EJTA 5B57C 3TGPA 3CEAA 4BEVA 5H7XA 1QFXA 4PEVA 2IUFA 4P55A 1KR5A 1BW5A 1K78B 3LPNA 3V1TC 4BP8A 1V8OA 2JKVA 4WI1A 4B6SA 5FWYA 2WHRA 5EGOB 3CJRA 3GROA 3RANA 5KYXB 1M54A 1UMCA 1XK6A 1YKSA 4ND8A 4E1VA 5JAUA 4O0LA 4HAMA 2PWPA 3F98A 5ELLA 3SEAA 1W7AA 1JHAA 3CZCA 4BC0A 1W93A 1HE4A 3KUKA 3K0EA 1NA5A 3LRTA 4V0QA 1WQ2A 3C3AA 3EOAI 3DMNA 3QEKA 4NY1A 4FINA 2DMUA 4O5OA 3LC7O 2YN0A 3ROTA 4FONA 4RKFA 1FFXB 5HFNA 4RD3A 2QQEA 3PUIA 1FX0A 5CYPA 3FK7A 3FE2A 3GAFA 2BE5F 3PHGA 2B1QA 1I4EB 1Z0SA 4YDSA 1DUSA 5D00A 4Y18A 1PEDA 1W85B 4IMJB 4WNAA 3CF4G 3ON5A 4F2WA 1RRJA 3JQQA 5H8WA 4NZOA 3MMSA 4O3MA 1G3QA 1IN5A 3RTBA 1FC0A 4O2AB 1X39A 2RN7A 4MZXA 1ON1A 2ZJYA 3IC5A 3ZWOA 3NUQA 4PZDA 2YRFA 2NYRA 4YCMA 4QQ8A 1LBSA 2C9ZA 5JWOA 2ZIZA 1QOQB 4P96A 1SIBE 1V26A 1M66A 1VE6A 3ZN0A 1WCWA 5D5UB 4HF1A 4I9NA 1ETHA 5DV5A 2L5QA 2UZIR 3LA6A 3KQQA 4Q4DA 4CQLB 5E8GA 2ZSEA 1W6RA 2OSBA 2BHRA 3A01A 5LIRA 1T91A 3F3XA 1D0ZA 3SE0A 3KQWA 4MEYF 3W2VA 3PHIA 5JH7B 4FX0A 3GK3A 4S0HB 5DYIA 4EQQA 4P2GA 5FI3A 1SD6A 2GA2A 2QMEA 2QL7A 3HV0A 1JHXA 3I9NA 4XQGA 4RTMA 4K03A 1N2SA 2X0RA 3DW1X 2NZJA 2CU7A 4I55B 2GFQA 4P5DA 4HVCA 2REBA 3G2JA 1RM4A 1NW5A 4IUBS 4I3HA 1T9HA 3QWLA 3SJZA 4QM7A 2NT4A 2VPTA 2F67A 4PHGA 3ONEA 1BE1A 4J00A 1JKRC 2JARA 2QP3A 2FPLA 2EEPA 4MKXA 2ANCA 1AKRA 4HA8A 1U2SA 3WGQA 2VXZA 2FLVA 1R0BA 2QW0X 3W5JA 3DKRA 3FKQA 3SJBA 3O9VA 4BFTA 3AX6A 2IH2A 1NLFA 1V4BA 5HSGA 5AKGA 2J3QA 3KQLA 2JVJA 4MQEB 2E4YA 4G0WA 3DZIA 4EY5A 3HA5A 1WX1A 4JUAA 1M2VA 4Y0AA 5F5LA 2O8EB 3SM9A 3N6VA 1UR5A 3C7TA 1QF9A 4ZDOA 2IZ5A 2RSLA 3GH3A 1IUPA 4F46A 1P7YA 2OWEA 2XUZA 2F59A 1BEEA 2F4VB 3IBSA 3OQIB 1NXPA 2YWEA 1H4TA 2ODAA 3AOEC 3WIVA 3JSOA 1APLC 6YASA 2YR0A 2I2BA 1Y3FE 1JDUA 4C2MJ 2OGTA 4RHTA 1QX3A 3IMEA 1E3JA 1T2EA 4D96A 5EJ8A 3FJ1A 4I5FA 3QXJA 2F1JA 5J9FA 3PFBA 4KIGA 5KKCA 1H4VB 5J2UF 2FMXA 4RF5A 3HZOA 5GTIC 2OBPA 1RKVA 3MS7A 4QOIA 5E3JA 4B47A 1ELOA 4JKOA 3RI3A 1U5AA 1VBFA 5C4JJ 1X7YA 9LDTA 1FX7A 3CO5A 4QKQA 1PJ8A 2I6TA 3GLFE 1YA8A 2UUPA 2KZGA 3LSJA 3AZPA 3PR1A 5JXGA 2X0IA 2ES4A 3TIVA 2DFHA 2GJAA 1D8JA 2IYFA 1IRXA 1OAKA 1M1XB 3JWHA 1RQXA 4MQFB 4Q6BA 3BS4A 3GVHA 5THKA 1PZEA 3NCHA 3EVGA 4EJUA 1AQIA 2V4UA 3AU9A 1HFEL 2WB4A 4NG4A 2TCTA 1FRQA 1R8XA 2IF0A 1YJAA 2QT9A 2ZIUB 1AX9A 3HI6A 3EUEA 1GLNA 3PVCA 1PUIA 4NCIA 4O8ZA 1WMEA 3BX1A 4OXYA 4ALMA 1QGAA 4CXMA 3ZVKA 4OQFA 1Y6RA 1DFGA 1NBOA 1QIEA 4US0R 3KQKA 4ZDIA 1JDTA 4BNTA 2FFBA 4U8GA 1WCXA 4IUDS 5FBZA 2ZUEA 4L6AA 4TLBA 8OHMA 1IZ1A 2QUJA 3UG7A 4PZ0A 1ZAOA 1SQ5A 5JO0A 4LF7B 5D84A 2EA2A 1SB8A 2PT6A 3IO5A 3LLVA 4NH0A 3GXOA 4TXNA 1FWZA 3CF2A 3GBSA 2CJXA 3M6IA 5IAGA 1ZINA 1RWKA 3SGLA 3TXXA 1U2RA 3EIOA 3PNLA 4L0CA 1GXSB 10MHA 4KXFB 4AFNA 3WS7A 1RVDA 1UBFA 1I2AA 1ZNWA 2IGBA 4FTHA 1DXYA 3H6GA 1J8YF 3ZHRA 4Z7QB 4WKNA 2BH9A 4IMIB 3GLGA 2G4LA 3L9FA 2K4BA 2GJ8A 1NG9A 1WCMJ 1GCAA 3CNHA 4AY5A 1VGQA 4QIWN 4OXIA 3R3JA 2D1TA 4Q1VA 4EO4A 3VJLA 4B34A 5LZ9A 4QSHA 4FDMA 2VBZA 4BXFA 3JARB 1K8RA 2XWSA 3LIIA 4R1TA 3RT9A 3BXFA 3O6VA 3U49A 2KIQA 3DS8A 2K2QB 3BGOS 1CUYA 2HK7A 3QELB 1NVEA 4IIFA 4QGHA 5P8WA 3WQBA 3J80A 5DHAA 3JSXA 5K7HA 4AT1A 4QDKA 2GQQA 2R7UA 3C3WA 1N2GA 1HC7A 3ZE9A 4M9QA 1AQUA 3ZWQA 1QP4A 2AQHA 3LA7A 1BM9A 1G0NA 1T8WA 1BO6A 1V1MA 5K3CA 2JEYA 3I28A 4IHJA 1RYYA 3LFUA 1VL8A 3OJLA 1UBCA 3DYIA 3EQ2A 1V45E 2P27A 3BAFA 5EHXA 2CK3A 3TLCA 1XDDA 3LJKA 2IYNA 2OXIA 3NUZA 3S8MA 2JIPA 2HNAA 4BO9A 4BLVA 4EZIA 2QRMA 4KUMA 2XKPA 1SZPA 2VWHA 2VL8A 5EHGA 3MRXA 1RJEA 1SCKA 3QTBA 4YP7A 2FQ4A 2Z2KA 3ET5A 1GUAA 4DC0A 1KDTA 3LGAA 3L7MA 5EYRA 4JHXA 3N75A 3NC0C 3T1TA 1ECFA 3D7LA 1U3CA 3FMRA 2PU7A 4IRXA 4MUAA 2WV1A 1VLZA 4WJKB 2IS2A 5FWDA 2WM3A 5FKMA 1XRSB 1N3IA 1A95A 4JEHA 4YPFA 1ZLXA 5AW2A 2E2HJ 2EB7A 1O97C 2PZMA 2QTHA 1SQSA 1CUAA 2PUCA 1AGYA 2A94A 4EQ6B 3A3KA 2XVMA 1IEQA 1M2EA 1Z3IX 3ETDA 4JUCA 4AJNA 4DV3B 1LBQA 3AZQA 2JANA 1Z06A 2FN4A 4LI3X 1DP3A 4GPEA 4PXYA 3ZDZB 3H1AA 2I29A 2HA7A 2WSSD 4NZPA 4IHVA 1GFIA 4ZYAA 1Q0PA 1UK6A 3AUSA 3F1LA 1V4NA 4LRUA 3E82A 3OM1A 1CEEA 3CX6A 3GH1A 2XOXA 4ID9A 4U02A 2Z0MA 4AF7A 4Y6LA 3GMEA 4RCVA 2BMDA 4YDRA 5ILVA 4RH1A 5JFOA 4N76A 3I9KA 3I1YA 3WWYA 2W8BB 4ZT5A 4OHFA 1BJTA 4CLDA 3MWJA 4ZTZB 4UE3S 4R7TA 4PR3A 4M4SA 2GA1A 2KQRA 1BE6A 3FMGA 4CZZA 4E7ZA 2NOGA 1D3YA 1LSUA 1EVJA 1G8GA 1P3JA 2CDCA 2F1OA 2HH9A 1TB4A 2RGNA 2WE8A 3BK1A 3IV9A 2GIVA 4N47A 4ER7A 3IAS2 2O52A 2W6OA 4E03A 5IJ9A 3D0OA 2VP2A 1YCDA 2AFRA 2SECE 4MEXF 4MW0A 5REQA 3UCFA 1WOMA 1KP9A 4ZZ0A 1WABA 2J7PA 1R16A 1YDEA 1P4SA 4Z6YA 3F9RA 3HKBB 3TLYA 1WY5A 3ISVA 3U37A 3E2PA 2W2MA 3F90A 4J4BA 4CEJB 3U21A 2E7ZA 3R09A 1LI5A 3WBKA 4QECA 1NUSA 2B3DA 4QBTA 4PZYA 2LKXA 5C4GB 3MJEA 2GCNA 4OSEA 4DR7B 5CXXA 4A3IJ 2Y69H 1ZBDA 5ILSA 4BBZA 1BKYA 2H5LA 1BCRB 1B1CA 4UVBA 4X3PA 4WCFC 4M9SA 3GUDA 1JJFA 4A2QA 1UK7A 3GVXA 1LC0A 1XR3A 4ENNA 4Y1RA 1F4PA 3O47A 4YAKA 2ZUFA 4HP8A 2NTNA 3K4NA 3S99A 2VUSA 1JKFA 5B66C 5HDNA 4A6EA 4ZJUA 4H3SA 2OK8A 1Z6TA 2L7KA 3EZXA 4W1UA 4PQEA 4D9BA 4QDZA 1CQTA 1ODSA 2HLDA 4F6CA 1K06A 3HYCA 4YCBA 3T5BA 4JENA 4NMLA 5IP9J 4MUMA 4ASUD 2REXB 4K7JA 4Q1AA 4YBZA 5J59A 4DQKA 4I81A 5BUZA 4D2IA 4BZXA 4JI4B 4XDZA 1MJ9A 1OFGA 1W30A 3EODA 2DR3A 1YI2I 4OL9A 3WZ2A 4CMEA 1Z2OX 1ODIA 5JFGA 1G38A 4NQWB 1ZA1A 4D9JA 3CPHA 1PFVA 4QJ5A 4KLAA 5IVHA 3F8CA 3A7EA 1JFFA 1K92A 3NYQA 4P6VF 4P83A 3SC4A 4PONA 3L1IA 1XNHA 4LK1F 2BEKA 3KETA 1N0WA 1RYMA 3LKZA 1FFAA 1JLSA 6CHYA 3EFBA 3Q7SA 4OFBA 3C3JA 3WADA 1C7FA 1HBJA 2PGNA 4DUGD 2W25A 1A5TA 1LRKA 4D7NA 2OZLB 5J4YA 2SCUB 1Y56A 4H31A 3ET4A 3PTZA 1OV6A 4CICA 4L76A 1OZGA 2I54A 2JFVA 3KEGA 3S2GA 2C4WA 3AESA 4U9HS 1NBMA 4QULA 4IKPA 3HHPA 1TK3A 1RJ9A 3HSSA 5E6SA 5G40A 1VHWA 4LQLA 3F8FA 3UQYS 1XU7A 3MVEA 2GBCA 3TLBA 3QYBA 1C7QA 2GQ0A 4JBYA 1ZHOA 1L5NA 1MABB 1QNTA 3MWEB 3IP5A 3TUZC 5JNSA 2OZVA 2LCQA 3GLVA 3A3OA 3PPXA 4CEHB 4IDBA 1R58A 1U2WA 2PWZA 2HX1A 1R8QA 3C16C 3NOQA 1A3CA 1VIMA 3X3HA 4MO7A 1ZONA 1JQLB 1EUYA 4L2IB 2VYQA 4B82A 1RXSA 3GO5A 2OHFA 3TINA 4KMMA 1EFTA 2E7WA 2FW7A 2PBZA 3VMMA 3VX4A 4ZYVA 5FX2A 3IMCA 4YYZA 2F4NA 3DBLB 5AM0A 2JASA 5E7QA 5BPFA 3HM9A 4IPTA 5JDIA 3R4CA 4L5YA 2XODA 2D1HA 4OPMA 4U0JA 1YU6A 1B0PA 2VXYA 2XUPA 4HKTA 1NVDA 4HTFB 1TCCA 2B82A 1JKXA 5HBRA 2EP7A 4MHTA 1DKLA 3DT9A 4E07A 4HBZA 3GCMA 4YB8A 4LJ5A 3SYMA 1QRTA 5JNTA 2RG1A 1HYQA 3UJ8A 3VV3A 3KV3O 3B1FA 3CM0A 1QO9A 1JIKA 1U6IA 1ISHA 2J6CA 5L4SA 2GFHA 2R79A 1KOFA 1TF5A 2GK6A 2X14A 4G12A 4B80A 5HYVA 3FCAA 2ZJQF 1I3KA 3S6JA 1TI7A 2XW6A 5J23A 4B1FA 4KNVA 1TGYA 2LF7A 3C1OA 2J9YB 3NAUA 3PSFA 3L2WA 2HWKA 1PLJA 2P5YA 3A28A 4GDMA 4KMOA 2EL7A 2PR2A 4MIKA 3OJWA 4TVBA 3WOVA 4AX8A 4CV1A 4DV4B 1RQ2A 3HJBA 4LV6A 1LGYA 1JF8A 4RPLA 3LY7A 2OFOA 4H0EA 3M1AA 1EK5A 2V7GA 3QQAA 2GAOA 3JASB 4HXYA 4XVRA 2C84A 3S2ZA 2RJ3A 1WFXA 1D0SA 2VQHA 2R92J 1C0EA 2WJWA 1XWWA 1B41A 3GFTA 3K92A 3OIUA 4Q4HB 3ZXYA 1TC2A 4BMXA 5CCDA 4MR8B 4KDPA 2R1UA 4KDEA 1MV8A 1UT5A 4CKEB 3ZCQA 4YGYA 5BYJA 2CNOA 3JAWB 4IAOA 3RYIA 3GLIA 4CMIB 4ESJA 4TV7A 2QL6A 4GECA 4UEQA 3ZZ1A 4DMHA 3HTUA 3KR1A 3S29A 4D97A 3LBIA 2WHYA 4JFAA 4JP2A 4M7WA 5A0FA 2P30A 3KZKA 3O92A 3TR6A 4A8TA 5LMUB 3LZCA 5LQAA 4R8LA 2BW3B 4M7PA 2ACKA 3IIIA 5CD1A 4PX3A 3REGA 1XTQA 4PTLA 4ZC1A 2AKEA 5KOHB 3ZYZA 4F85A 4BATA 2O19A 1W5BA 1NY6A 3LW8A 1ONVA 4DT1B 5F98A 2V59A 3JD4A 3P4XA 4NHEA 4YP1A 1V3QE 1ZY2A 4UB8C 4QDOA 3RD5A 3U7RA 3V4SA 4D9FA 3PQDA 2B2NA 3AVPA 4JVLA 2KSQA 2FSWA 3LUJA 5I7RA 4HUQA 1J33A 1SD7A 3H1BA 5AHKA 5EIBC 4LHZA 1FS5A 1GP2A 2C04A 2CHGA 2Y1EA 5EFOA 1JZQA 1EWYA 3EXHA 4FKMA 1I6HJ 3DAFA 4O2BF 2PMBA 1IBLB 4DWOA 3OFND 5KU7A 3DKXA 1ZJJA 4UARA 3QBDA 1Q16A 2GYVA 4C1NA 2H8RA 1R5BA 2C2HA 3AQ4A 3ES9A 1ORDA 4PIPA 5A71A 3QFCA 4UHJA 4BP1A 3LCUA 4M1QA 1M8FA 3O1HB 3HWSA 4N6OA 4INJA 1DCKA 4A7PA 3ZBPA 3F72A 2HF8A 1P7VA 4YEJA 1QDLB 2CNBA 4M2LA 1PI3A 2R4TA 4CH7A 3TB4A 3S4YA 1JLMA 5ELXA 1YZHA 2HOSA 4D0LB 2GEUA 3CG4A 3CZPA 5ALTA 6Q21A 3TBKA 2FWMX 2RDPA 3HP7A 5JXWA 5EP2A 1N78A 4ERNA 1RI1A 2OCXA 2WC1A 1ZARA 2JD2A 4WCVA 5JUWA 3CVVA 3AO0B 1JDPA 3JR7A 3ZTTA 3WE2A 5B3KA 1L8LA 3NP9A 2DFLA 3AWDA 1H66A 3ZTWA 3SR3A 2UKDA 2FSFA 4JX9A 1VSBA 2PG3A 1T6ZA 2KISA 5FUBA 3ZE1B 1W35A 3MSXA 1YASA 4RHYA 2AQFA 1QS0A 5JMOA 2O2XA 3L93A 4Q1FA 3AUJB 3D02A 4N5NA 4L6IA 5E4YA 5KU1A 5DRTA 4B31A 5KYVA 3WQSB 5KO2A 4M1MA 3DTVD 3QU6A 1ST3A 1RWOA 2QLBA 3G9UA 3GRZA 3IEKA 3P97A 4HQ6A 3HSKA 5DV9A 1O3RA 1B42A 1HLFA 1M74A 4ZA2A 4RXUA 1E5LA 3R7LA 3E3AA 3FRJA 3EG9A 5F21A 3KJFA 1ZO8A 1PFUA 1W94A 2O7SA 2R5ZB 2XYRA 3OZFA 3PNBA 4KIJA 5KNDD 3KOMA 5IZCA 5CQGA 1ZM2A 2F1IA 3DE4X 4PCLA 1ZJWA 4Z7NB 4C0XA 4N8DA 2PZKA 1X3ZB 1V4RA 2I2DA 2AJCA 2Q1SA 3BHIA 4KE8A 1GA6A 1Y8CA 3ZDQA 3U7GA 2XXBA 3M5WA 5EJ7A 4GPAA 1E3LA 1IF1A 4O59O 2VQFB 4MVJM 3C3EA 4RETA 4EPYA 3DMFA 4NARA 4Q03A 1V6CA 2PMDA 4F3RA 1D4FA 1NLUA 1R49A 5LBTA 1FUYB 4PLWA 5ALEA 4BXXJ 2XZPA 4FC7A 3HLTA 3I04M 4WDQA 5KTYA 3ZMUA 1EHCA 3IQWA 4JXKA 5EINA 3L6BA 1HQKA 2O59A 1BI1A 4L3OA 2CLEB 3O1IC 4CUZA 3SLKA 5FKKA 1HSJA 2P9EA 1D1PA 1IWBB 1OA1A 1ZXXA 3QFSA 4WOKA 4ZVTA 3HC7A 4A91A 3MHPA 1I7QB 1T4CA 3TCKA 4QEZA 2GEDA 3O7WA 3V4OA 2WM2A 5KPDA 4WKPA 4OGFA 2H1WA 2CZQA 2ZWVA 3LWNA 4EF5A 1BC5A 1JIIA 1R6RA 2WAQN 1GQYA 1JYEA 4XQCA 3SNHA 1KEUA 5KYTA 3OYEA 2DBRA 2G7MC 4AURA 3DFUA 1UMDA 2G67A 4PRKA 1F14A 2R65A 4MS3B 3BDDA 4Q3NA 2Y75A 2FP4B 2YJ4A 4XCXA 4J2HA 1DEOA 1V2GA 2WJJA 3RTGA 3WMWA 4JI0B 3WL4A 1R71A 4R8HA 1MOPA 1PJAA 1Y6QA 2CVHA 1Z4PX 4FD2A 3KTDA 1YHYA 5H4HA 2HW8A 4H7FA 1U2TA 1Z12A 3K2BA 2R7WA 2ZJZA 1F1BA 1KPHA 1BI2A 1RWQA 2P2YA 3EQ7A 1P1BA 1W4LA 4K9QA 4IXAA 4PGGA 3MF4A 4W7IA 5K6TA 2HADA 4Z49A 1MRZA 1QH8B 1VQPI 2E1OA 3J7AO 1F1JA 3H0KA 4KQ1A 5F1OA 5T4BA 4EUFA 4A5NA 1FSFA 1R88A 2FSSA 3PNOA 1XV5A 1EMDA 5JAHA 2IEIA 3TW8A 3OZWA 2NOAA 1D6SA 3CH4B 4D1YA 1E9CA 3L7DA 3TL3A 3U39A 2J3KA 1Z07A 3L8HA 1OCCH 4R2JA 3A9CA 2FSVA 3RZDJ 3LS2A 4KQEA 1PFQA 2HXGA 2HF7A 2NUAA 4WZ6A 4CIBA 3AFHA 3VOEA 2B7CA 5FD6A 4X20B 3VNSA 2CQXA 2IH5A 4GZMA 4E2XA 1P1RA 2OQGA 8ABPA 1G5QA 1T1GA 4R31A 4R1UA 1YCGA 4PDKA 2W2PA 1U2PA 4MRVA 2VHJA 1KI4A 2QGFA 4OB6A 5B1SA 4YWJA 3L7YA 2BI8A 3Q11A 3OQNA 1NXTA 3WTXC 4EYOA 4LV5B 4IIJB 1KKMA 3D59A 5CR9A 4E94A 1C1XB 5FWXA 4R6WA 1XMJA 4HATA 7REQB 4GKBA 4JOBA 3LW7A 2W1OA 1PHRA 3NATA 3VM6A 1FYLA 4EJOA 1JVBA 1XLVA 2J5XA 1JB9A 3N58A 4ZCIA 5IDXA 1GV5A 1FMCA 2Q7DA 1M5TA 5K0ZA 5LL6P 4B6GA 2XX3A 1STOA 2PBIA 2QQ5A 2ROQA 1NVGA 2ECBA 3MUFA 5HFAA 4Y4RA 1E3EA 3RAPR 2NNWB 4OQEA 3WYBA 4N7MA 5F9HA 3VSBA 3KYJB 2NP7A 1U28A 2JFXA 4JH0A 5GM2A 3E5RA 1NJ5A 3G2QA 1ON2A 3L3BA 3VOSA 4Q21A 5HG0A 1J75A 3DGEC 3CQ9A 3DZFA 4F0JA 1J8MF 2PZLA 2VUHB 2YXDA 4YJGB 5H02A 2GCEA 4XB1A 5JAZA 5AESA 1SVLA 4B4VA 3GW8A 2A5WA 3IRUA 3OM8A 1U1DA 3R2JA 4UCXA 3T1HB 2GK4A 5JHFA 1P72A 5B6JA 4M8IA 3A6KA 1IHPA 3UOWA 3JRDA 4XWTA 2W85A 4RHXA 3G89A 4V02A 4UXJA 4B75A 4DY4A 4UUVA 1DC7A 5C5IA 1F2UA 4PLHA 4LITA 3S1QJ 3GTGJ 2YOHA 2HBRA 2YVAA 4YIRX 1SHZA 5B55A 2G9VA 2FBKA 1AKUA 3E7FA 3B36A 1S8FA 2WIJA 3CNLA 3KYLA 2H2AA 3H4MA 3PJDA 3KTAB 2H1FA 4Q9LA 4ZYZA 3AVUA 4F9FA 4FKBA 4JYMA 3P9QA 3HOUJ 3HYSA 4V24A 2B63J 2JJ2D 3CEMA 3C7CB 3TKLA 2PS9A 3M4YA 3CT4A 4KO4S 1VA5A 5IP5A 1QFZA 4EHKA 4G23A 4XFDA 5DW0A 1ZICA 2PL5A 5IJXA 4KPEC 3OZAA 4KO2S 4KW7A 4EHAA 1U8ZA 1MEOA 3DU6A 2C31A 3ZHBA 4BFLA 2X2PA 2R87A 5JSZA 3QWFA 1D6JA 2QM7A 2WVHA 2EBWA 3TTWA 5HVNA 1HEIA 3C2QA 3QWBA 1W9MA 4M89A 4IY1A 3WNZA 2OZPA 4MWSA 4PTYA 3TMYA 4MK4A 2BZ1A 3GLTA 2O8NA 1XC5A 3DLTA 2HKXA 2P0WA 1NE7A 1ZTRA 2H52A 3JD0A 4H3HB 4E5KA 1H9GA 3TMKA 3TJRA 3VPXA 2ZATA 4OYRA 4YVFA 2IYXA 2RGNC 1HG0A 1XTRA 2R25B 2BUBA 3C5WP 3OFJA 3SSAA 4YLYA 4Z1MD 4AJPA 1RHQA 4CM7A 3ENZA 5J8CA 1KPGA 1QVWA 5GJCA 3J81K 1VSQA 5TDHA 1E18A 4KLCA 3W05A 3TRKA 3OPYB 1ZC4A 2HL6A 2CUEA 4U39A 4RGSA 3JZFA 2W42A 2Z9OA 1CUGA 1TPZA 5LOVF 1KKLA 3OCVA 2YXEA 3LT2A 3MTEA 4S3MA 1YRAA 1KMNA 9MHTA 4BGIA 5EHZA 1B6RA 4MVJF 4OB8A 4ZPJA 5I4BA 4Q66C 1NQTA 4M1ZA 1DC6A 1V96A 2X9VA 1Z8DA 4Z0HO 4ZU6X 1G9XA 2DOFA 3BFJA 3Q8XB 4UAUA 5JADA 3CCYA 2Y93A 1ZS9A 4J0CA 5GIPE 3DL4A 1GL7A 4JI3B 5CJ2A 1P9RA 3IAUA 3UV6A 3V7YA 5IWAB 1MVOA 5ERGB 2PSDA 5JD4A 1T1RA 5G0TA 1X1BA 1MRNA 3RC2A 1YZLA 4XYLA 2QZ9A 1GV2A 3UIEA 2ANBA 1TP4A 2GXGA 3HBLA 1FFEA 3QTLA 2ATCA 3ICOA 3OAAA 2P8JA 5ALJA 1G6NA 1YK0A 3PFWO 5CIWA 5H3LA 5TF4A 1RC8A 1F6WA 2N9UA 2BRUA 1KIMA 1J5YA 3QP6A 1U99A 4FETA 3AF4A 4QQFA 5FBHA 3LU1A 2IHUA 1QGDA 1Z2PX 4O2AF 4UTVA 3RVSA 2ZNYA 4D82A 2FZKA 1T6BY 4R1SA 1CQIB 1DTWA 3K70C 1Y5MA 3EVTA 4AX4A 4IQ8A 2QUHA 5JFRA 1QNFA 1SD2A 2QRVB 1FCJA 2NZYA 3OX1A 1F0NA 5FUWA 3LSKA 4MS1A 1VBNA 4WN9B 4DV5B 3T3NA 4L1KA 4X1OA 2A05A 1YAJA 1GRRA 1R4MB 1QUEA 2JI6A 3NHWA 4BX3A 4OMZA 4YG2F 4DCVA 5KZMB 2XVCA 1WD7A 1RWNA 2DH5A 1Q0LA 2AR9A 2FRDA 4D3ZA 3AY0A 1Y8AA 3M6AA 1K83J 3UC9A 1ZNXA 2UUZA 2VNJA 2C54A 1AY0A 3KX2A 3AJ8A 4HQFA