3P9CA

Crystal structure of perennial ryegrass lpomt1 bound to sah
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
352
structure length
352
Chain Sequence
AASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 118
structure length 352
sequence length 352
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9cA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9cA02
4GOMD 3LAJA 1B1BA 1REPC 3EGIA 2B9EA 2RV8A 3QP6A 1BJAA 3J81K 3RI4A 2F5CA 4XRFA 3FUUA 1GVJA 1YW7A 3JSPA 2Z6UA 3R0AA 3P9CA 3VC1A 2KJBA 2Y1XA 3KQWA 4HV6A 1XXLA 3EMDA 2D1HA 3GIWA 3KQPA 4BLWA 3V8LA 3QOPA 1PP7U 1YS7A 5DEQA 1MD0A 3QU6A 4DMGA 1RJFA 4G7HF 4P96A 4YMGA 1FSHA 3RKWA 4GYGA 4I98B 1HNNA 1V3FA 4RGUA 3E8SA 4X61A 3BZBA 1G3YA 4OBXA 3GFMA 1TNTA 3KKZA 2HEOA 2IW5A 2DK5A 2DPUA 1WS6A 3CJRA 3MZYA 4LGWA 3NMUF 2Q2EA 1BI3A 1ZG1A 2UZKA 3KETA 2IIPA 3KP4A 3GRUA 1L3IA 3HRUA 4ISCA 4M74A 4KNYA 4X1OA 3TM4A 3FXRA 3GFJA 5FD6A 3BWCA 4KMUX 4HV5A 5IKMA 4FSXA 1YFJA 3E6MA 3ER8A 3CUQA 3FPGA 3WTXC 3F72A 5LEJA 1K78A 1OKRA 4I0AA 3GU3A 1I1NA 1P2FA 1ONVA 1SD4A 2KKOA 1KIAA 2NRAC 3OZRA 4RWZA 2ZBKA 5ICFA 1WZNA 3KR1A 3A7EA 2G7UA 1RNLA 4OU0A 2ZBQA 4RTNA 4DM3A 2P40A 2YTZA 2O03A 2O57A 3EEOA 4AIKA 2P5LC 1B9NA 4H0NA 3O3KA 2EX4A 3TDZC 4C4AA 3R4KA 3GUDA 5K0LA 4LB6B 3SSOA 1BIBA 4PYMA 2WK1A 1D5VA 2RKHA 3TO7A 2L01A 4CYDA 2Z9OA 4QWQA 3LFKA 3TO6A 4XUDA 5LRRA 5LQRA 3P9NA 1O3QA 5CJ9A 3J80K 4EM2A 3AWIA 4WWCA 3R61A 5D8KB 2XAJA 2VDUE 1ON2A 5FULA 1EV7A 4HH4A 2VC0A 4D0PA 3TKAA 1FSEA 5LQUA 1A04A 1AQJA 1R6AA 3F8NA 1SUSA 2JHAA 3KPVA 3FYDA 5DT2A 2OD5A 1X3UA 3AJDA 1FBSA 3UJCA 4ENMA 5KS2A 1H9TA 4GOOD 2F8LA 3BWYA 5BQTA 1YF3A 1VE3A 4HX4A 2K7LA 2KW5A 2AOXA 2B2CA 4PDKA 3I54A 1VP9A 4Z2YA 3JWIA 3FRIA 3KFWX 3EGVA 1IN8A 4NB5A 5HZMA 1X1DA 1QO0D 3CDHA 3L2CA 4PINA 2QLZA 5FHRA 3HOSA 3HM2A 4HZFA 2ZCWA 1RJDA 4IRHA 3OFJA 2EV6A 5E8IA 2XIGA 2DLLA 1WY7A 2Y1WA 5LQKA 3BP8A 1O7LA 1XGNA 4G6DA 1SD7A 5GWXA 4RVHA 4G7OF 3J7AO 3E6CC 3BGVA 4XLNF 2RNJA 2RGVA 3GRRA 5D5VB 3JTGA 3SVZA 3TPZA 3K0LA 1KHHA 3R9XB 1BI1A 1G6NA 3L09A 2CO5A 2P3QA 1KPHA 2XVMA 2LNBA 3HNRA 4KUMA 2XUBA 3U9GA 3DXYA 2HOEA 3P9IA 4WXCA 2EFOA 1WG8A 3FUWA 3PTAA 2MLKA 2L4AA 2G8NA 3WE2A 1L1EA 3FXQA 3I0TA 2Z6QA 4C06A 2VXZA 1RI1A 3UWPA 3EYIA 5IT9K 1KQ9A 3T5XA 1TQMA 4CXFA 1NBHA 1YFLA 5D1NA 1GHCA 4M9XA 3W6JB 2OY0A 3SSNA 4YV2A 2FRHA 5LBQA 3CJNA 3KPUA 5ED4A 1I6XA 3RPQA 2XAHA 3G2MA 2A07F 2EFPA 2IBTA 3LL7A 1HSTA 1MJBA 3DTNA 2PN6A 3VEPA 3WU1B 1WXXA 2YPRA 4EVIA 4Y30A 5E1OA 2HDCA 6PAXA 3BKWA 4CZZA 1XVAA 2PX5A 2IH5A 2V74B 3EMBA 4U7TB 4OMZA 3BDDA 1U5TA 1R74A 1UFKA 5EHGA 3B3GA 2JPCA 5E8GA 1Z05A 2NNYA 2PGXA 2H11A 3TOAA 2ISYA 5TJJA 1YQAA 2BGCA 2IP2A 2STTA 2DBBA 1DL5A 1WWXA 5F6FA 4UOEA 5F2NA 5DRYA 4OIOF 1RI3A 3HCCA 5ICEA 1EIZA 5BW4A 5K01A 4LG0A 1NW6A 4ON0A 3KEQA 4LWOA 2QRVB 3PQKA 3JSOA 1PDNC 2ETHA 1TNSA 2DFIA 3NJRA 4L5JA 3H2BA 4B17A 4RTQA 3FPHA 2G71A 3GF2A 3V7SA 5IT9Z 4N9IA 2XYVA 5JI6A 2C7PA 2XGXA 2G7HA 4KIBA 4EJUA 4AVPA 5CUQA 3K9TA 3F8CA 4HQMA 4RAYA 4AUKA 4ER5A 2UXXA 2PX4A 5E18F 5DTRA 2XVCA 1YLFA 1AF7A 4RB0A 3PS9A 2OKCA 3ELKA 3F8MA 5IT3A 2XBMA 3FZVA 2IRFG 2YX7A 1X19A 5C0OE 1W7PD 1G38A 4EJTA 3HA7A 3KLOA 5EPEA 1UHWA 4UVBA 1D2CA 2GXBA 3I59B 1H1DA 5G02A 3A26A 3TLJA 1WI9A 1ZYRF 1NW3A 2MC3A 2XVAA 2EFJA 2DO7A 1YG2A 4GF5A 4QPPA 4U7BA 3E3VA 3HVKA 1FBNA 3G73A 5BXYA 4QPNA 1BC7C 5LSAA 3RIRA 2PWPA 3T7TA 4Q5SF 1DCTA 3RKYA 5AIQA 5EG5A 4JK1X 1P1CA 3WODF 2XASA 2C6YA 5DSXA 3FTEA 2H6CA 3AXTA 4L9JA 2YQZA 4GQBA 2UWMA 4IV8A 4MGRA 2C7QA 3HCFA 2MLGA 1PRYA 3DULA 4EQZA 2I62A 2JG3A 2PBIA 2VDVE 3LCVB 2L4MA 5BW5A 4RVFA 2AVNA 3ERED 1OMIA 3IHUA 5DD8A 1IRFA 4ZZDA 1KU9A 1C0WA 4UVCA 2ELHA 2BBYA 4YIIA 2GZWA 4HA8A 2MH9A 2G9WA 3I4PA 1G8AA 3R0JA 3IKTA 3L9FA 5CVVA 2FEZA 3GCZA 3NVKI 2GAFA 1AV6A 3H92A 5E20A 3O2PE 3TM5A 2A14A 1B42A 1RIOH 1HBXG 1R18A 2ESRA 3BGIA 5K5QA 1EAMA 3KQVA 5LGUA 5EZSA 2OZ6A 5ERGB 2GA2A 4DQ2A 5BS6A 1P39A 4OQEA 4XLPF 3P2KA 3KEOA 5GM1A 2IPQX 1O54A 4HDVA 4IHTA 1O57A 4LB5A 2YX4A 5DD4A 1FY7A 3LQRA 3KZZA 3M1EA 4OMYA 2A6HF 4AZTA 3E05A 2FBHA 5JFRA 2CWEA 1R5HA 4M7RA 4HBLA 3LA7A 5K0NA 4L5IA 3DXXA 4IJAA 2QY6A 2HZTA 1G4DA 4IRGA 5DYMA 2ADUA 3FRHA 5J8FA 3CUOA 5EKUA 4JXJA 3A7DA 2NAZA 5HIIA 3B89A 3WE3A 4NQWA 3P9KA 4ER7A 1S7OA 4C07A 4RSRA 5KQRA 4OIRF 1Z7UA 2ZFWA 2PXCA 3IEIA 3O4FA 3GGDA 4QVGA 5ILUA 2W84A 3NW9A 4FZVA 2X4HA 4BXUA 2E1NA 1N7JA 4MWZA 4ASNA 4XSZF 2JT1A 2M30A 2F5EA 2FPOA 4RTPA 2FOKA 3THRA 4RV9A 4MTEA 3LA2A 1QPMA 2V6CA 1HKTA 1NW5A 1R00A 2W25A 2P6TA 4LK0F 2JHCA 4Q48A 2HFHA 2M45A 2VP3A 5DTMA 3ROUA 3GYHX 5HFJA 3T8RA 3FPFA 3VB2A 1YW8A 3DH0A 3OFKA 1FOKA 4U0WA 1IN5A 2OBPA 1SQGA 3P8ZA 3FPEA 1RUNA 2PQ8A 4PGHA 1P4XA 5HDGA 3EVGA 5EOVA 5TRDA 2EJRA 4RTSA 3CJTA 3ULQB 3O31A 3DKWA 2PXXA 2XKPA 3ZMVA 3M33A 4R8RA 5CVJA 1TTYA 1VTNC 1OYWA 2P35A 3ZMUA 5HDNA 4PYNA 1TW3A 2F5FA 1TLHB 1R1UA 3M6XA 5EHIA 1JHFA 2RVCA 4ZYEA 4KDPA 2G70A 1IXRC 1UHMA 3F6VA 4KDRA 5EMMA 3TOSA 2CWWA 5DCMB 5EKXA 4G7ZF 2GAUA 3KQOA 2B0LA 2PMHA 4FGZA 3ZMSA 4E2XA 2GA1A 2O07A 3B02A 2VN2A 2VT2A 4RTOA 3V8JA 1KYWA 4PONA 2YXEA 3WTWC 3DUWA 4IKPA 1DPRA 4EM0B 5CD1A 2I6GA 1XDUA 2ZXJA 3F22A 2FK7A 3LGAA 3CBGA 1IW7F 5FTWA 2ZTHA 4CHUA 2LSOA 3LWFA 3C7JA 4P7GA 9MHTA 5DUIA 5H20A 5ERIA 1S29A 3JWHA 2A61A 2EWNA 1XCVA 4UV9A 4LG1A 4IHSA 2IH4A 1BI0A 5K8VA 5FA8A 2F5DA 3I71A 3WGIA 1G3SA 5E1WA 3ZMTA 3KP2A 3U1DA 2IPXA 1V4RA 3B73A 1R7JA 4UVAA 4U0YA 2QE6A 1E2XA 1B9MA 4G8XA 2PBFA 5FADA 1XTPA 3M8FA 3V8KA 1ORIA 2JH8A 4UNOA 4RVGA 1LEBA 1XJ5A 2CL5A 2OQRA 1LEAA 2ZBPA 3QV2A 5HIMA 4GC5A 4XUCA 2ZZNA 1Q0SA 3B3FA 1BKYA 1SQFA 4BP3A 3WTSC 3G7UA 1S6LA 1YUBA 5L3EA 1MGTA 2OXTA 4BNCA 1ZH5A 2ZZMA 3QU3A 1VIDA 3BT7A 2PX8A 4ZZLA 3WTVC 3ID6C 4MTLA 3OOPA 2VC1A 5LRSA 4LECA 3G89A 5EIFA 4EK9A 1BI2A 2R3SA 1ZRFA 1R36A 2Y75A 4I0BA 5DM4A 4DKJA 3TO9A 1I5ZA 3QAHA 5K0FA 2GLUA 3ZN1A 2DK8A 1WQ2A 1FT9A 8MHTA 5DUKA 2YR0A 2CKDA 5ILVA 1V39A 1D2HA 2VBWA 2D2WA 3E6BA 2JHPA 5T64A 3F23A 1ZGJA 2YX1A 3ZQ7A 2DQRA 2QM3A 3JWGA 2UYHA 4L18B 2V1UA 2ZLBA 3HVHA 2H09A 5L3DA 1TPYA 2A69F 5FB2A 1NV9A 3BJ6A 2Q0OA 3SQNA 2QBYB 3EVFA 4PGGA 1QZYA 1R1VA 5KYGA 5D4SA 2EFWA 1KU2A 4CXMA 1P4WA 2PFBA 4U0VA 5LLQA 1NBIA 2HV9A 3S68A 3WU0A 5E8JA 1O3SA 1R22A 1SUIA 1MKMA 4ENKA 2UXNA 1O3TA 1CGPA 2E7XA 4Y15A 3UJ9A 1USTA 4HF0A 2FCAA 4HSGA 4A12A 2P41A 1ORHA 1YYVA 2AS5F 2QRVA 4P9UA 1HKSA 1EH7A 2Y0MA 2ONZA 2NYUA 3UJBA 5DXJA 3BJAA 1JG4A 4YMHA 2VOPA 3LX6A 2ZW9A 1KA8A 5K0JA 2EA2A 2AS0A 1EJ6A 4P7KA 5K09A 3K2ZA 3FM5A 2QYOA 1LDJA 1FBQA 4JQFA 3NDJA 2PJDA 4BH9A 2V1DA 4R1HA 3J81Z 2ZWVA 5T67A 2FNPA 4XSXF 5CCBA 2D45A 4CGZA 3GO5A 3LHDA 3DXJF 4FS8A 3ME5A 1U2WA 2OAZA 5K0GA 3HVJA 3SM3A 2DQLA 1G55A 3OU2A 3M70A 1W4MA 3LKDA 1SFEA 3VFZA 2E1CA 4PYOA 4CKEA 4GXOA 1KR5A 5EGSA 4L0YB 2FHPA 3PB3A 4KICA 3I59A 1FBUA 1INLA 3GRZA 4WXHA 4EV0A 3M6UA 3GXOA 3IRRA 5DM2A 1JG3A 5DSTA 2B78A 2EK5A 3T1BA 2PMUA 2YR2A 3BZ6A 3GWZA 2IFTA 3NTVA 4GO1A 1HMYA 1K7AA 3U2RA 2OBFA 3G2OA 3ZP5A 4PYQA 2CMGA 1EJ0A 1SMTA 1B4AA 3FWEA 5BMZA 4F86A 2Z3YA 2OPBA 3KLNA 1QBJA 4BLUA 2HTJA 3C1DA 3GX4X 3M6VA 3R0QA 4HAMA 4EJWA 1OYYA 4M71A 1HW2A 1NW8A 2H6BA 3HEMA 5DLYA 3BPXA 4MHTA 3OU6A 3I9FA 4BHCA 1ZQ9A 4RTRA 2XAFA 4XBFA 1M6EX 1LQ1A 2AOVA 2EA4A 3DV8A 4A6EA 5LHHA 2PV0A 3TKYA 2OB1A 2QVOA 2O3FA 4UUVA 4I02A 2YXDA 2FXAA 5DDGA 3O7WA 4XUEA 4LMYA 2JRTA 2KIFA 3HSEA 2HS5A 2AOWA 4Y13A 2KJCA 3EYYA 2FK8A 2QWWA 2NS0A 4LLLA 2CYYA 4OBWA 2NP7A 2DULA 1J7KA 3VYWA 2NXJA 4OIQF 4FX4A 4CICA 1SFUA 4M9ZA 4ZYHA 1ULYA 4E2WA 1QGPA 1EH8A 1OPCA 4E2ZA 2AOUB 3J80Z 1ZLJA 4LK1F 4QQNA 5ICGA 4B8XA 3HRSA 4S04A 5D4RA 1U6GA 4EKIA 3FPJA 3RYRA 2PEXA 1QZZA 2EG5A 2ZZKA 4MTDA 3NWBA 4L9VA 1T6SA 3BOQA 3WTUC 5BOXA 1LB2A 1JG1A 2AR0A 1Z6RA 3T7SA 3SFZA 1K79A 3PX3A 3VODA 3LCCA 4R8SA 1RJGA 2M87A 4OA5A 3LBYA 1KQ0A 4YIFA 2HWKA 4R6WA 3TGNA 5IH3A 4XCXA 2HTSA 2MA3A 3I64A 3RYPA 2Z33A 5K0EA 4AZSA 2YU3A 4AIHA 3OZSA 2R6ZA 2GIVA 4HYEA 5EIWA 5BPIA 1KU7A 4QVKA 1N2XA 1XB4A 2CQKA 2P7CB 3FTDA 1D2GA 3E5XA 2VS1A 2GS9A 4GC9A 1QAMA 2DAOA 1QAQA 2PLWA 1VL5A 4KRGA 1XDZA 3KPJA 1DUSA 2FSWA 4PYIA 4WVLA 3O6BB 5D6EA 5E9WA 3OE4A 2P6SA 3GO4A 3MAJA 3BWMA 2P7VB 1IY9A 3EPPA 4U7PB 2K86A 4QTUB 3ML6A 5D5UB 2BR4A 3FUVA 2QUFA 4I2OA 5LGNA 3C3YA 3B5IA 2YUIA 2DI3A 2H00A 3G2PA 3NDIA 3OCJA 2HNKA 2K27A 4FT4A 5DX8A 1IN4A 4HTFB 4M36A 3L00A 1YW9A 1ZG5A 4YFXF 1P91A 2FRXA 4YUVA 1Z9CA 4F84A 1J9IA 4MHGA 3MEXA 4PZJA 5DCMA 3HTXA 2OU2A 2GB4A 2K4MA 3EUHA 4WF2A 1E17A 4I09A 5DPMA 10MHA 4YUYA 2GQQA 3PFGA 1T2KA 1L9KA 2VODA 2OB2A 4X41A 3TQSA 2BZGA 2KIMA 5BP7A 3BXOA 5HIJA 2FE3A 3B3JA 4GOLD 5D8LB 2UYQA 3V8VA 4GBED 1SD6A 3GZ5A 1AQIA 5EMJA 1FJXA 5D5XB 2EFQA 3RTRA 2JJQA 1WSUA 1ON1A 3REOA 3HVIA 3RJPA 1H9GA 2AN5A 3OPNA 3QOXA 2NXNA 4RTMA 2LD4A 3FX3A 3GFLA 3KP7A 1HQCA 3IYLW 3HCEA 1ZRDA 2VBXA 1P6RA 3SZPA 3OU7A 1JHHA 3KPWA 2PY6A 2ACJA 5FWDA 4DCMA 1AWCA 3FM3A 4F7ZA 4ZH4F 3KR2A 3MB5A 3U81A 2VONA 3AXSA 5K05A 3IKVA 2IDKA 4P7JA 3ERCA 2GH1A 3HYIA 3K69A 3EGEA 2YVLA 5DTQA 7MHTA 3GLXA 4HF2A 3HCDA 1DP7P 4HGYA 3SXJA 3ECOA 2OYRA 3IC7A 2V1XA 4QLCU 1KPIA 1R58A 4UV8A 4FT8A 2PT6A 3E5QA 3I5UA 5CYVA 1W5TA 4ER6A 5HDKA 3R60A 2P3OA 1U78A 4PYLA 1ZGAA 4LFUA 4HQEA 3LKZA 1ZLKA 2PVCA 5EQJB 1MZBA 1P92A 2OQGA 2XKOA 1JE8A 3CKKA 3WSTA 2V7EA 1W7PB 4M6YA 3M7GA 4KN4X 1WXWA 5K5OA 2IDJA 3IHTA 2GA9A 3ORHA 4YV1A 2VDWA 2F2EA 3DLCA 3GEZA 3PVCA 5LHGA 4O3MA 3QP5A 3HSFA 3T7RA 1KPGA 4U88A 4HOBA 1ZN2A 5HILA 3GNLA 2JSCA 2AXLA 2ZO4A 2OZVA 4RGXA 3FTFA 5CLSA 1FNNA 4ESFA 3KR9A 4QTTB 3EDPA 3FMSA 5DXAA 2BEOA 2VZ9A 2ZCJA 2QBYA 3MCZA 1HW5A 1RUOA 2V79A 2BYVE 4NHJA 3BGDA 1Q1HA 4LLNA 1SVUA 3ABTA 3WGHA 1OR8A 1L3BA 4OOIA 3SHFA 3MAGA 3ER9A 2ISZA 4BQAA 1IXSB 3FMQA 4FP9A 1JQDA 4PYKA 4DA4A 2UZ4A 1X1BA 2L3DA 3AY0A 1DPUA 2MH2A 4OINF 1RI4A 4E2YA 2WC2A 5D6FA 3TFWA 1QAOA 2GWRA 3K0BA 2FA5A 2HQRA 4WXDA 4CDGA 1YB2A 3UBTA 3R6TA 2EFNA 4E32A 3R6SA 4I7HA 4MQ4A 2XAQA 5KQSA 5KVRA 4HG2A 3DPLC 3UJ6A 2WA1A 1QANA 5K03A 1R8XA 3CGGA 3GDHA 4AZVA 2AVDA 1IXKA 3LPMA 1USSA 3C3WA 2IA0A 1FP2A 2DW4A 1PUEE 4EKGA 4HLXA 3BPVA 4YUZA 4YFNF 4K6MA 3GVAA 1TQIA 3HRTA 5GP1A 1KQ8A 5D5WB 1LDKB 1NHAA 3E5UA 1BC8C 1XSDA 2PSSA 2E7WA 4C04A 4GCVA 1IN6A 3EVDA 2HQNA 2GPYA 4A5NA 5GIPE 4HC4A 2LF8A 3F3XA 2P8TA 4M38A 2DPMA 3ELYA 1CF7B 1SKMA 3EETA 1O7FA 5K1YA 2ZSUA 3JAMK 5F2OA 1F4KA 2VT3A 2IBSA 3DXZA 1UCRA 2O0YA 4X60A 2FBIA 2GXGA 4N9HA 1ZRCA 4ESJA 5CCXA 1R5GA 2QQ9A 3RIEA 2IA2A 2O8XA 3MFKA 1GXQA 3QPTA 5EVJA 2DTRA 5CM2Z 4GEKA 3G2QA 1XN7A 4BLVA 1FX7A 1P1BA 5EMLA 3CTAA 4E33A 2WV0A 3F4KA 4PYJA 4E31A 3HRMA 5L3CA 4I01A 4GOND 3HA5A 2CG4A 3PLAE 3MQ2A 3CLOA 1QYRA 2MD5A 2QENA 3CUQC 3H3UA 5DCFA 4S05A 3UA4A 3AAFA 3Q7EA 4JBAA 3OE5A 4DNCA 5EC8A 2JPBA 1LNWA 1SD5A 3ZN0A 4IF4A 2STWA 3CJQA 1XSXA 1VQ1A 3C0KA 2BE5F 3I53A 3E23A 2A6EF 5BPDA 3LSTA 1NKVA 2AOTB 1OYIA 1RI7A 3VC2A 3P2IA 2KIUA 4MQVA 3DPTA 5FD5A 4EJOA 1TBXA 1MJFA 2HR1A 1EQAA 5CIYA 4KYWA 4EGYA 2ZFUA 3SGLA 4Y2HA 1BOAA 1YS6A 2RC4A 5FO5A 2AOUA 4KA4A 4RS8A 4KDCA 3WTTC 1WRJA 3P71T 4RYLA 3G3ZA 1FLIA 2COMA 3LCUA 3BJOA 2LF7A 2NYXA 1U8RA 3FYCA 3TDUC 1XGSA 1UFMA 2CMHA 4YUXA 2C7RA 1M6YA 5E1ZB 5HS7A 2DT5A 3C6KA 3GW2A 2N47A 4CKCA 3C6MA 5E1MA 4ZYGA 3BKXA 4OQDA 4RAZA 3UJDA 2EJTA 3GRVA 2W57A 3D0SA 5FLXK 4ER3A 4F85A 1I27A 1RI2A 1WKMA 4AD9A 1OR7A 1G3TA 1VPTA 3G5LA 2HMYB 5FHQA 3FXUA 1JGSA 3IWZA 2ONYA 1XCLA 4L7VA 1IXCA 2NNNA 2ZNZA 2ESNA 4AWXB 4CO8A 4M6XA 5E2AA 5M5BA 1I1GA 5EEHA 2L02A 4EGZA 2RDPA 3M4XA 4P58A 3KQTA 1S3JA 1KYZA 2BH2A 2NXCA 2FMLA 3M8EA 3WG9A 5FQNA 3EEYA 4EMSA 1IAWA 3EVCA 4RB3C 1MJAA 3P7NA 4OA8A 1YZ3A 4WK8F 5CVDA 1YIOA 3KP3A 4P7FA 2IJLA 5DWQA 2VOOA 5EZQA 3V97A 5GINE 2Z5UA 2ADMA 5A2QK 3TMAA 5KK1A 1I4WA 4EJVA 3DOUA 4RTLA 5HLHA 4RB2C 4A5MA 5DM0A 2M5WA 3BROA 1D3YA 1R23A 4KN7X 1L3LA 5HVQC 3DMFA 4HDUA 1BOOA 2FNAA 3MZHA 4CKBA 3MWMA 3W6KB 3DFGA 3ELWA 3C18A 1SMYF 1Z1DA 3HCAA 3RW9A 1EH6A 2LDUA 4BAYA 4FHTA 3V7RA 1J0RA 3L7WA 4ENNA 1L0OC 3KU1A 4HTFA 2PI0A 3FHZA 2C7OA 3COAC 5EEGA 5FLXZ 4MEYF 4UHTA 5DRTA 3BWGA 2OA4A 4U7DA 4LWPA 1AOYA 2M1BA 3CVOA 2D1VA 1BN5A 3UJ8A 4RTKA 3MCTA 3OV8A 3E6DA 1O9HA 3ZMZA 3EVBA 1U5TC 2B25A 1DUXC 1JQEA 2P8JA 2FBKA 5L3FA 4A0ZA 3EVEA 4V0QA 2Q41A 4FSDA 2Z6AA 2IGTA 4LD5A 2PWYA 5LQJA 4HX7A 3HSRA 2ZMEB 1IZ1A 1FYKA 1P4AA 3DR5A 4N0BA 3ZMDA 3CC8A 1SG9A 3PT9A 5A2QZ 2X0LA 3UJAA 4G94A 2ERCA 4BHPA 5E17F 5B1SA 2VBZA 1SAXA 3VSEA 5FCDA 3TR6A 2QQAA 4E70A 3BY6A 3SSMA 3UJ7A 5F1RA 1STZA 5JR3A 4O29A 3UA3A 2HYFA 4RTJA 1HW1A 3CO7C 1Z91A 4OIPF 2ZJ2A 3KPYA 1RZ4A 3LDUA 3IL2A 1FYMA 4HF1A 4MIKA 5D1HA 1KP9A 1XGMA 4NECA 3KCCA 4R79A 1N7IA 5H02A 4HLYA 4KW7A 2WWYA 3F8FA 3FUTA 2H94A 5HOQA 5EMKA 1MDMB 3L8DA 4IV0A 3F21A 4V0RA 1XCJA 3BUSA 4HRAA 5J8CA 3KHKA 3UFBA 4KIFA 1ZREA 5FA5A 4YV0A 2J5PA 2JZYA 2R7DA 2H27A 2O0LA 1W7PA 4RGSA 4WCGA 2VBYA 1VBFA 1Z3CA 4R05A 3HCBA 1J2XA 5T6BA 1IM8A 4EM1A 1BC5A 2L54A 3DP7A 2ZULA 3HTSB 5CVEA 1IF1A 3LDGA 5GIOE 5CVUA 3FF5A 1T0FA 3MGGA 1VP3A 2RQPA 3ELDA 2IA1A 4O6JA 2I7CA 3Q9VA 3E97A 2WTEA 4AIJA 2FF4A 2ORED 2ZNYA 5LHIA 1ZKDA 3LAPA 3A25A 1T39A 5AIPA 4B09A 4GYIA 3KR0A 5HIKA 3RDIA 2QZ8A 1SFXA 5ICCA 4PCAA 2HR3A 3C3PA 5JVTA 2E5WA 2VE8A 1J59A 3QPHA 4DZRA 5HOOA 3PFHA 1S7AA 3NRVA 4BY9E 3QOWA 1QQIA 1ZAOA 5FUBA 4BP1A 1T43A 3IV6A 3X0DA 1M0EA 4GGGA 1U2ZA 4R8HA 3HOTA 3M6WA 3FUXA 3A27A 2G1PA 1I9GA 3E7PA 2XYRA 4C03A 1Q0TA 3ABUA 3SR4A 3D5LA 1YO5C 1MHTA 3F6OA 4TV7A 1DDNA 4QDKA 3MHTA 4A6DA 3ELUA 1JSXA 1TQPA 5HLIA 4HGZA 2ZWAA 4M9SA 1JQ3A 4MNUA 1NT2A 1ZG3A 2AN4A 1VLMA 1GXPA 1FYLA 3KQYA 1BHJA 5E1XA 2CGPA 1JG2A 4KWCA 4QDJA 5HLGA 1HKQA 1BM9A 3SX0A 2EB7A 5K0BA 4X63A 5JUWA 3UZUA 3GRYA 3JW4A 3A4TA 4MQ9F 4M73A 1T38A 5L3BA 3CUQB 1CF7A 2AZTA 3CO6C 3CCFA 2G72A 2HGCA 5FFZA 1K78B 5LR6A 3MTEA 3G88A 4CTKA 2FYTA 4Q4ZF 4KVZA 3Q9SA 3P2EA 4OX9Y 4WX9A 4A2UA 2EV5A 5FGMA 4P5OA 2XYQA 2ESHA 1R8YA 3G8BA 2A68F 4L9TA 4Q47A 2KRFA 2CW0F 3DEUA 4MEXF 1FZPB 4Y17A 4G56A 4IVNA 4RGRA 2XRNA 3HHHA 1Z6TA 4K2EA 1F38A 2ZIFA 5E1BA 4FR0A 4AZWA 2EJUA 1X1CA 3Q5FA 1QNTA 1F5TA 5E2BA 3PX2A 5H6RA 2W24A 2PXAA 1XSVA 1I1SA 5H6QA 2P4WA 3R24A 3K1NA 2WA2A 1F3LA 2BM9A 2PLYA 5DX1A 5K5RA 1XDSA 3I58A 1G6Q1 5JHUA 2P7IA 2PJPA 3D2LA 3DLIA 5GM2A 4BYYA 3H3ZA 1NW7A 5LQAA 3KP5A 3HUGA 1XMKA 1LJ9A 2O61A 2NP6A 2AOTA 5HS9A 3KZYA 3N4MA 2ZIEA 2IH2A 2R7FA 4UXNA 3SZTA 2FU4A 1F9NA 1HSJA 1RJEA 2Q8KA 5FQOA 3N97A 3MQ0A 2A3SA 5C1IA 5L3GA 1TW2A 1B59A 1S8NA 2XHKA 5KVAA 2BV6A 4L9NA 3MTIA 5MHTA 1B6AA 3S2WA 1RI5A 3SMQA 5ILSA 1O9GA 4DF3A 3K1MA 1O3RA 2ZKZA 1R1TA 4KFCA 3DMHA 3JWJA 2JTVA 2BM8A 1YFHA 3OZTA 4HX8A 3NQOA 4YFKF 5E1DA 1D8KA 3G8AA 3RKXA 2HWVA 5LQNA 1FP1D 3EQLF 2FQ3A 4P55A 4FT2A 3TQNA 1YTYA 2PX2A 1J5YA 1W5SA 2VE9A 2FMYA 3HA3A 3HP7A 4YUWA 4AX8A 3Q87B 4IWNA 1JXSA 5HEKA 1H0MA 1JSZA 4ENJA 5CVIA 4A0YA 2P7HA 5J6XA 4CTJA 5AONA 1T98A 5LGTA 2H1RA 4LJZF 4G9YA 3GJYA 1XMAA 2O06A 4CWAA 4IRIA 1YZHA 2PKWA 3QRFF 3IWFA 2UYOA 3KE2A 5F2KA 4A0XA 3TRKA 4KT5C 1JR4A 5HS8A 1K6OA 3HIFA 4PCLA 2DU9A 1BIAA 4H0EA 1KGSA 2NNWB 2B3TA 2O6GE 3DMGA 1U3EM 2V9VA 3SXYA 1ZARA 3JTHA 2BR3A 1FWZA 2P3LA 3DF8A 2BR5A 4C08A 1XCBA 1J75A 5K0CA 3ISPA 4RX1A 3PQJA 3WGGA 3B7PA 1KU3A 1G60A 2YXLA 5U4XA 4C05A 4BHBA 1U5TB 3M9AA 5E8RA 3THSA 1KXZA 1UIRA 1FC3A 1NE2A 2I9KA 2A5YB 4ZYDA 1EG2A 4M37A 4YG2F 4ETSA 5E9JA 4ZTBA 3R3HA 5GOZA 1JTFA 4G6QA 3GFIA 3WTZA 2AN3A 3ZPLA 2K4BA 2OO3A 1G8SA 4ATNA 3MERA 4P9FA 2IVMA 3FMRA 2DPDA 5DV5A 3RODA 4HW0A 2HYGD 4LLGF 3HTUA 3KQQA 4LG0B 3TOBA 2O05A 1HXDA 3WTYC 2J5OA 1X1AA 2UYCA 3KQMA 4EQQA 3FZGA 4L0ZB 3BWBA 3LECA 1IN7A 2XV4S 3F8BA 1LDDA 1F1ZA 3IRQA 2P5VA 1ZHFA 1L3CA 2XROA 3LQQA 3ECHA 4DCGA 3G5TA 3V7CA 2ZMEA 2TDXA 2W85A 3K1PA 3V4GA 5CVRA 4PCQA 5LQCA 5LEKA 2Y48A 3GZ6A 3HHGA 1JTEA 4POOA 2M8EA 3LA3A 5P8WA 3T0YA 1NV8A 2HTEA 2K4JA 2CFXA 2ZIGA 3K6RA 4RVDA 2K02A 1IRGA 2HKOA 2LKPA 2ZVJA 4E30A 2RN7A 2ZBRA 3KQSA 5FWAA 5DX0A 1XGOA 1IUYA 2CSOA 2XAGA 1UB9A 1MJ9A 1FPQA 4KIGA 3DQVC 1BBYA 2NXEA 1G3WA 3FTCA 2P5KA 1LVAA 3NWEA 1XD7A 5C9ZA 2EV0A 3P97A 4FX0A 3VOEA 5E9QA 3KP6A 5F64A 1MDMA 2MBFA 4KMFA 1Y0UA 4M72A 5DM1A 3NEUA 3T0IA 3EVAA 4IPAA 4QQKA 5FFXA 1UWVA 3RPUA 4PWYA 4DQ0A 4IXAA 1PP8F 3JAMZ 4PIMA 2OZUA 2IT0A 3PFIA 2QQBA 4ESBA 1PJZA 4RB1A 4O5VA 4ER0A 2Z99A 4PIPA 2PG4A 1ODDA 1D8JA 2PT9A 3NVMB 2HKXA 3ANXA 4PNEA 4R6XA 3LDFA 1Y8CA 2YSRA 4GUAA 3LBFA 2P1DA 2JH9A 3EVZA 3T8TA
chains in the Genus database with same CATH superfamily
1E3MA 2BI4A 2R2GA 4N5DA 2GM9A 4WK2B 4CODB 1ZJ6A 4WSOA 2CRGA 3E15A 1ENHA 4DDUA 4QXPA 4YT8A 3TS1A 3DMPA 4F1WA 4PXSA 3VUEA 5FUXA 2VBFA 4C7BA 1JWAB 3VDMA 2Y0BA 4LG3A 3KKZA 5DNDA 4HDSB 3LP8A 3COVA 2G6BA 3DW1X 1GM5A 2IPLA 4X1IB 2TRTA 1L3IA 3FXRA 2R5WA 1PUFB 4EJSB 4PC1A 1EUZA 2HLPA 3K4KA 5JXJA 2RSLA 1GU0A 3F72A 5LEJA 3PEFA 4POAA 4I7EA 2YIJA 5DLPA 2AX3A 2OHHA 3RVMA 3GOQA 4QOFA 1E8NA 2YTZA 3LO8A 4QUEA 5KINB 4H0NA 1GA6A 1UZAA 4UEQA 4LHXA 4BO7A 2PQ0A 2EDAA 3E7FA 4K6FA 2NO7A 3WKAA 4DJJA 3HB9A 2HJRA 3CQZJ 3EE6A 4C0HA 2W11A 2YQ4A 2B4QA 2FFJA 1F6BA 4BLOA 5F08A 1KF0A 4FBGA 1EGAA 1G3MA 2G76A 3AJDA 2AR7A 3BE8A 4ENMA 1XDWA 1MENA 3I2HA 1QVTA 1F36A 2C1XA 2W93A 3JWIA 2ZYGA 5JD5A 5HZMA 4CQMA 1PJBA 5BOVA 2QLZA 1GYRA 1PHRA 1AUVA 1LC3A 4EBFA 3OE7A 1HSZA 4MRAA 3KEFA 4B9EA 1AA9A 1SK9A 2VR1A 1VMEA 2QI9C 2BGWA 1ESNA 1WPKA 5JE8A 1GL3A 1X14A 1T4GA 5IAKA 3DMTA 3TRFA 1MX1A 2I4IA 3KLBA 3PC3A 4WXCA 1HZZA 2OFOA 2M32A 1BGXT 5BSVA 2XBLA 1L5SA 3DOEA 2OTCA 4C6HA 1QBGA 1RWVA 4M0LA 4D0SA 5AW0A 5DNVA 3SF8A 5D1NA 2Y1FA 1BR2A 1U80A 4Z1MA 3ZR8X 2QTNA 4X95A 13PKA 4XEHA 1MJBA 2JAXA 3DTNA 4B0OA 3NBKA 2PRKA 1TZJA 3FBTA 4CZZA 2PX5A 3X2FA 2V74B 3SEAA 4M88A 4W5OA 5ER6A 2H1VA 4UTXA 2X1DA 1E5TA 2IHZA 1JEYB 1JHQA 4UZFA 2J0EA 3ZCOA 1LUJB 4RPIA 5CCDA 2H11A 3TOAA 4OHFA 5IAEA 4QATA 3PNLA 1M1YA 3GTPJ 4GFDA 4LTDA 3G17A 3WOVA 2H1HA 1PZMA 3AVXA 1K6XA 2VBGA 4GWLA 2XYVA 1USIA 2YHIA 4E11A 2G7HA 1NKTA 1XD9A 4N8SA 4LOLA 2Q4RA 2CH0A 4RAYA 4B4DA 1WEHA 2OE2A 4QQFA 2C5FA 2ZBDA 3AEUA 5EZ6B 2XVCA 2HFKA 1HC8A 4KFTA 5C0OE 1QBKC 5AXDA 2G1JA 4NS4A 1HDYA 1S5LC 1Z63A 2EFJA 3LUHA 4PZPA 2BAGA 1D6MA 1KMQA 4HAYA 3RIRA 3TLBA 2XMDA 3DE1X 4JK1X 1KIFA 2B4TO 2AC4A 1YC5A 5C31A 4BDYA 2VFAA 2FJPA 3PNKA 1WU7A 2ZWMA 3U9SA 4UTZA 2XUPA 4DGWB 3IXQA 4YIRX 3HYLA 4ZFNA 2YMMA 1VG1A 2DHDA 2MH9A 2PUDA 3A06A 2DGDA 3BK7A 1TA9A 4Y52J 3R6DA 2H08A 3NCHA 5LGUA 1Z26A 5ES3A 4W7SA 5ERGB 4V1CI 1QK3A 3NT5A 2DQZA 5KX5A 5BVGA 2DOEA 2V54A 3AEKB 5JCJA 2PT7A 3E05A 4Q3CA 2CWEA 3LA7A 4MWOA 3F9RA 1JHAA 5TR9A 2ZXWH 2VJNA 4DA7A 2YINC 4FINA 3H0EA 2MT9A 2D7CA 1Q77A 2F8SA 2QAIA 2VRWA 3DCIA 1K5DA 2FFQA 4Q01A 1VOTA 3HUEA 1XXHA 2BMFA 4FZVA 2XWSA 4E51A 1YE5A 3IP1A 3UPTA 2I7TA 4KDEA 1N75A 3AFOA 1U28A 2XIJA 1KO5A 2V6CA 2RH9B 1P9NA 2P6TA 4X90A 2JHCA 5ALPA 3GYHX 1Q19A 3L4SO 1RP1A 2HV8A 2XCLA 3KWMA 2R66A 3ELBA 1Z6AA 1I10A 4A91A 4EGQA 2IEKA 2XDQA 2WF5A 1WCMJ 1TLHB 1RC8A 2D54A 3LT0A 2FQ1A 1A4XA 3F9KA 5F7OA 2PVSA 2CWWA 4DA0A 3A9UA 4CLOA 3NHFA 3G6WA 4QZVA 5IABA 4I99A 4TLAA 1XZ8A 1A9RA 2BISA 4ZCPA 1ABFA 9MHTA 3JWHA 1AKHB 2P4SA 5L4LA 4LGVA 1SU6A 4CCJA 3U1DA 2V9CA 2CVPA 1LVKA 1JR2A 4O4IB 2Q45A 3U3RA 3SIPA 5ERXA 2AYXA 4CLHA 1J56A 2VCHA 3ICOA 1Z2OX 4MITA 3VU0A 3WTSC 4Q7EA 4IX9A 2O3RA 5CAEA 5AUQA 3G89A 5TMBA 5AJVB 5JYDA 1ZRFA 1F1JA 1W88B 3W5UA 5DM4A 1KKMA 4D82A 2CEAA 2FR1A 5BXQC 1D0VA 2HU2A 4LNUB 5I4IA 3HC7A 4ENQA 3A6EA 2D2FA 3U21A 1MSFC 2QM3A 2PWZA 3VSLA 3AR2A 4NE2A 4HAOA 3HVHA 3I2KA 1B6RA 3D4BA 3QELA 3Q0EA 2AD1A 4OOEA 4HATA 5D4SA 1SY7A 2WIAA 4XTRA 1KU2A 1YR1A 5J23A 3S68A 3MCUA 1MX9A 4AUNA 5IXSA 3CZAA 2LY1A 1RZRD 1GRRA 4Y15A 1OU0A 2QU7A 2C2MA 3OR2C 2QRVA 5LLDA 3TNYA 3OIPA 2ZXUA 3ECAA 1P0IA 2HMTA 1GPH1 2K9LA 4YMVA 3FFWA 3U80A 4N49A 3DWLE 2X23A 1OE0A 5F33A 1LQ2A 2ZGVA 4YBRA 5JLWA 4IQ4A 1RBMA 4NMWA 2VBIA 4W1UA 4FDLA 5EJFA 1AA6A 1QFZA 1H6AA 5K3AA 2RAVA 2HPVA 4IHVA 3ZV7A 1TC1A 2WUGA 1E9DA 2IHNA 3UQYS 2YC2C 3BZ6A 4DCUA 3ZZ0A 3DG9A 2RGAA 3IESA 4IX7A 4J4BA 1NG1A 3C70A 3FWEA 3QVWA 4J2HA 3GX4X 3R0QA 1A8IA 3OFND 2A59A 1OYYA 1HW2A 1W0KD 2H6BA 3HEMA 5DLYA 3UICA 3DE6X 4RSHA 1ZK4A 1HGXA 1M6EX 1ZOLA 3ZWPA 1XZBA 1T3ZA 4JEHA 3QHAA 1PL0A 2CJXA 4EHHA 4Q1DA 1P4HA 2LGJA 5FNZA 2FK8A 4LLLA 2VYND 1POXA 4EY5A 4OIQF 4TRMA 4WE3A 4E2WA 4ARSA 5G40A 3AONB 4OPMA 4CQJA 4LK1F 2OUMA 4B8XA 1XU9A 3CX4A 2C84A 3QVKA 1YRNB 1LFAA 3U7HB 3I2GA 2QM8A 1XCMA 4JT2A 2ZZKA 3SYMA 5BOXA 3FPLA 1Z6RA 1KI4A 1RWWA 1Y7HA 2I5UA 1I36A 1TT5B 3VODA 2ZSHA 4OA5A 1KQ0A 1YA8A 2FZEA 1R4NB 2HHAA 3O73A 4FFBB 2GD0A 2EJWA 4AIHA 3JAKA 2V6FA 5HG0A 2PL1A 2W70A 1N2XA 2PO5A 4QTZA 2X0IA 3CKYA 1U8CB 2XLCA 1RPWA 4D74A 2X9QA 2BH9A 4A8JA 5AI8A 1ID1A 3WAKA 1E64A 2P9YA 4LBZA 2MSCB 1DUSA 4MVJM 3L6UA 4LV8B 5A2QA 3NPMA 3ESQA 4JJFA 3U26A 3JARA 4DV5B 3ZWOA 3T3DA 4GRDA 5BN5A 2K85A 1UZMA 4BFUA 1XPXA 4J3NA 2Y66A 2H00A 3ETHA 2IEAA 5ARCA 2VATA 1BOBA 5M7EA 4H4KC 2OV8A 3ZI4A 4F7DA 3LYAA 3JASB 1WH5A 4AK9A 4A6XA 4DSZA 7ABPA 1AH2A 1ZISA 1E58A 4HXEB 4RH0A 3H9CA 5D85A 2HT1A 5EAIA 1M5UA 1FJXA 5D5XB 1F60A 1MF7A 2WMDA 2HN9A 3RJPA 1QJCA 4WOBA 4BBRJ 2XB5A 2E1PA 2WB4A 2ACJA 1M2OB 1B15A 4DAEA 1KK0A 1W4LA 1GPDG 4YUAA 4P98A 2OBXA 3OYAA 3ERCA 4E4TA 4DV2B 1P7IA 5KVCA 4UXJA 3GRCA 1W36D 1Y8QB 3OQPA 4RJJA 4BKQA 3KYDB 2WTBA 4KYUA 2XE8A 5KWIA 2M8GX 2G9VA 2NUAA 1PTKA 5AJTA 4PPQA 5DTJA 2V7EA 2BFFB 2GA9A 1EXVA 2VDWA 1BE6A 4RPHA 2QD5A 1SKBA 2QG6A 3A4LA 3A1NA 2ZM6B 2DMPA 1Y81A 5FUWA 1H1LA 1MTZA 5H3CA 2M7AA 2VAVA 1XRRA 1XI2A 3STTA 4K1LA 3E6AA 1GUDA 2IXBA 3ABTA 5L4SA 1A9PA 5A1JA 2XNDA 5G2OA 3ER9A 4I4CA 2OLJA 2F5VA 1J0EA 2JGDB 2UZ4A 3W34A 3FOFC 3LJKA 2GJSA 3AIKA 3H83A 3I4CA 1DUIA 4MMYB 3HU2A 5IW8A 3RJ9A 3KP1A 4OJYA 3T5MA 3FX2A 5CA0B 5CGQB 5KVRA 5AVJA 5FOXA 1R66A 4HG2A 5IVHA 4YUZA 3FR7A 4DXHA 3U16A 1WE2A 4CM4B 3RYCB 3WDKA 4YJ3A 5BNGA 4B8ZA 3D6UA 1NHWA 4P08A 2J0SA 2PRJA 3O7MA 5FTKA 1H66A 4EYKA 5LA6B 4GZ3A 3ELYA 1N4AA 5IDQA 1LI5A 1OPRA 4F6CA 4CKWB 1DG1G 1ZD8A 2VDMB 1ETYA 4ZZ3A 5ECWA 5DYTA 3WGJA 2EHDA 3HB5X 3Q3IA 4FEAA 3DO8A 2CB9A 2KYRA 2DUUA 3KOOA 4ZXPA 3WHPA 3WLFA 2JGLA 1NTCA 1AO3A 1EGMB 3HZJA 4BTVA 1HTTA 3PLAE 3NWJA 1IZYA 3NHLA 3CUQC 4CBVA 3OE5A 1NUQA 2X5NA 2OUIA 2Q46A 1Z2DA 3SU8A 2H5EA 4QHSA 1QQ5A 4RPCA 1TBXA 4LJLA 4UCQA 1XK6A 1EUDA 3ITEA 2ZFUA 4CNQA 4YP9A 3NAGA 4UB6C 1WRJA 4QOSA 3P71T 3OECA 2C98A 2HSWA 1DELA 5KPJA 4LMRA 1RDFA 1YB7A 2YJGA 1BDHA 3BSWA 2R5YB 4W63A 3VPFA 3GFRA 1LPAB 1QDEA 4AC9A 4NXMB 4AD9A 1JWLA 1V6SA 1YS9A 1JWBB 3WGLA 2KFDA 3BIXA 1IXCA 2EKQA 1ZCBA 1C7FA 2NYVA 1Z4LA 1KYZA 2JCSA 3ZGNA 1KZ1A 3JSXA 2HEIA 2F4IA 5CPFA 3Q7IA 5K99A 2OHOA 4OA8A 4DT1A 3ES9A 4JX9A 2XUOA 4NBQA 3WZMA 4F93B 5CEFA 4BB0A 4PGFA 2FN8A 4YPVA 5JDCC 4L75A 1YI1A 3BROA 2XTNA 3PQ3A 2C7BA 2VHUA 4IG4A 4AJEA 5C1PA 3GFFA 1T33A 3W1WA 4BAYA 4BNTA 1J0RA 4WXMA 2VCYA 3KU1A 4QE3A 4MEYF 1VQMI 4QUKA 2LV8A 1F7VA 5HS6A 3R40A 3OV8A 5JMWA 3X1KA 3W9BA 1G5HA 2BHYA 2WINI 3PENA 2Q7XA 5KNBA 1XGKA 1H8HD 1EHCA 1C30A 4MOWA 1UWCA 1NVWQ 1IBCA 4LD5A 2ZI3A 1SQ0A 3O5AA 3QVLA 2B30A 1V1MB 1FYKA 3DR5A 4N0BA 5CRIA 2NZ2A 2ACEA 3CC8A 5DTEA 5HKKD 2X0LA 2GPJA 1E6KA 3E3LA 5B1SA 4UD2A 2G67A 3HZHA 3TR6A 1NU6A 4KU4A 3LQ4A 1V11B 1QZEA 2TCTA 3T15A 2FR0A 3GGOA 3TNFA 1HW1A 3USES 1RZ4A 2OXCA 2BEUA 2CK3D 1G291 4IO0A 3W8FA 1BE0A 2Q5FA 1BAPA 4IKOA 2H4YA 5L3QB 4BJ5C 1ZVMA 5EE0A 1JDSA 2PS0A 3M6LA 4HRAA 5EIBC 4DNPA 1W6UA 4TROA 2HD4A 2O0LA 1O0CA 1GTRA 2OPTA 4WCGA 3R7DA 3RVKA 1BC5A 3P45A 5ULLA 5ESRA 4ZKDA 4PYRA 1Y1QA 2WAOA 1EB9A 3KBOA 5GIOE 5H5JA 4BS9A 4E5PA 1HOMA 4MPPA 3FYUC 4RZUA 4NZOA 1US8A 3MWJA 4O2BA 4YEJA 4D44A 4BE2A 2VI5A 1J8FA 2E5WA 3J81A 5T57A 1N6RA 4DE5A 1GN9A 5AM3A 1EFRD 1SU7A 1KY3A 1IH8A 3QBDA 2ZB7A 1VKZA 2PSEA 1I1OA 1Q0TA 2B36A 4IGIA 3CNOA 4EB3A 1T5TA 5A4MS 4AX4A 1ZKGA 1RQLA 1WFXA 3CJRB 4A8PA 5J58A 1V71A 1JT0A 3HL2A 4NU5A 4BJ6C 1GXPA 1XDDA 3G2IA 3ITNA 2K3PA 2JA6J 2I2CA 4HLUA 4DSAA 5HS4A 1L5HB 1ZUIA 2PLRA 3A6LA 3UZUA 3PX7A 4JT8A 3RS4A 2QOEA 3CW8X 1I50J 3T9AA 3Q9SA 1H2AS 4PE5B 2ESHA 4QBIA 3GCWA 4WWHA 1IHOA 2OZLA 2WDPA 1QG2A 3F7NA 3B3AA 3Q5FA 3DBRB 5I48A 5JO9A 4YALA 2C82A 3MTBA 1F3LA 5K5RA 1Z6ZA 1G6Q1 5JHUA 4XQ0A 1N6HA 2ZJPF 2NP6A 1IEXA 1ZO8A 2A1UA 3F0TA 3V33A 2GLOA 3KZYA 1M2VA 4YWHA 2F1IA 3MQ0A 1J49A 1NFQA 5C1IA 4OHCA 3L1PA 1YQEA 4ZO9A 4X8HA 1N2CA 1Z34A 3SYTA 4LHWA 1R1TA 4UM8B 1CR6A 1KONA 1A95A 3RSZA 3R6GA 5K4HA 3FXJA 1RCUA 4DIBA 4KQWA 3TMKA 1B4DA 1R4MA 3SVLA 1DX9A 1A7AA 4XYBA 4HFMA 4IIHA 5JOQA 4TVKA 3NOXA 5GV7A 4CTJA 4LFBB 4G9YA 2CLCX 1L5NA 2Q8QA 3LUBA 2O06A 1X15A 3L7CA 1T5HX 4LZLA 1N8TA 1FNSA 4M89A 1TO1E 5F2KA 3OYFA 4ZVRA 4EHDA 2DU9A 1MBFA 1L5GB 3TG2A 2JEYA 3U1TA 1DC6A 1SO8A 1TEZA 5KTTA 2BR5A 5TMPA 1R0ZA 2EEPA 2Z57A 1R5OA 2EARA 4OJKA 1Y7PA 4IIUA 4LQLA 1IBSA 2IY8A 2XWJI 2YZNA 3AM5A 2VZLA 4TXMA 1J2JA 2J9XB 4EYQA 4J6FA 5HKAA 3A4MA 1ZJ4A 3JRXA 2V5UA 1B8VA 1EWYA 3CRW1 2DA5A 2J5OA 1SC7A 1LZKA 2Z3WA 4B6EA 3SE7A 2YOGA 3JYQA 1DQSA 4ILEA 1A88A 4RGVA 1L3CA 1D6JA 2GHIA 2HMSA 1YRAA 5KJ6A 5FD8A 4P3PA 3LYUA 4LRQA 4HMQA 4M9UA 3B6IA 3UBMA 1OISA 2BFAA 2ZI5A 3K6RA 2G9NA 4G1UC 2JC3A 1IRGA 4KIUA 1QHXA 3BWDD 4C1NA 2ZAMA 5K7ZA 5CH8A 2RK3A 3EZ2A 4DEXA 1B00A 1YFKA 1FPQA 1APLC 5BV1A 1UXIA 2P5KA 2J0VA 1XCOA 5E9QA 3NEUA 4IPAA 1OWMA 4PWYA 2B8JA 1PP8F 4TTQA 3ZCTA 2R00A 4O5VA 3LY7A 2K5UA 3HV2A 4EY4A 5LYYA 3ANXA 1WUYA 2D5CA 5I01A 1Y8CA 1JNYA 2WSSD 1E3LA 2A58A 2ECKA 2GARA 1T5BA 2IXEA 4EQ6B 1VE7A 2BUCA 2F5CA 3RYFB 3UHOA 4ZDOA 1DSSG 4YRCA 1G9XA 4C4PA 3KQPA 1XZFA 1P4RA 1PP7U 5C8XA 3B7GA 1RJFA 1OIXA 2ID3A 4EFNA 3HG7A 2PMZN 1QPGA 4PO8A 2QY9A 2WKQA 5ITWA 3MBIA 4CMAA 1WDLA 1NE7A 1OKKD 1U7WA 2HXOA 2F4NA 5TF0A 1C7RA 4KNYA 2YXBA 1FMWA 2KZGA 3UMSA 4NKRA 3EA0A 2P0YA 1PK7A 3O3NB 1B26A 4JMLA 1P2FA 5FWNA 1SCKA 1E63A 4L16A 4NJEA 4GVPA 3OQ1A 4UHDA 3KR1A 3NHBA 3AR8A 3EXHA 5BMOA 2P5LC 1XCGB 4CPDA 1YJ9I 1FDTA 2Q6VA 4ZANA 2X1CA 4AI6A 3LSJA 4OAOA 2W2PA 3P9NA 2OZPA 1NJ6A 5J59A 2SNIE 2ELJA 3R61A 4AG6A 3NC4A 4ZVKA 5CJ2A 4S1PA 4L2IB 3TKAA 1FSEA 5IM5A 1UKYA 3F4BA 1RXUA 3AI3A 1P2VA 1UPXA 2B6NA 4GOOD 5DP2A 2OQIA 4GGMX 2B2CA 3LM8A 4AS1A 1AQ6A 5KX5F 2Q2VA 1BXRA 2OV3A 5CNJA 3IULA 2QVGA 5B66C 5BN3B 3O9ZA 3GP3A 3N2ZB 3A11A 1XGNA 3AP2A 3I28A 1Y1KE 3SJAA 1RYZA 1QCZA 4TXHA 3A70A 1TFUA 1WUIS 5A6VA 2LNBA 5B4VA 3HNRA 2C1EA 4UDOA 4WJZA 4UARA 3SJMA 1QTQA 3KV1A 3OHSX 2L4AA 1L1EA 2FSUA 1WB6A 4M8IA 3EYIA 5IT9K 5D7BA 1NJSA 2W4MA 4FGKA 1SKYE 4AYBN 3W6JB 3R3YA 4I5IA 4KQJA 3SICE 5AXCA 5AI0A 1TCBA 2J5BA 2R62A 1C9DB 1YX3A 2I0FA 3CPHA 1U5BA 3G2MA 3NH9A 3LL7A 1GPYA 3V48A 2A92A 1S3FA 3O1IC 4BXOB 3V6MA 2J45A 5IF3A 5HF9A 5E1OA 3HKCB 1WJ5A 1UMCB 3GEMA 1RFLA 4BNHA 1R15A 1NHGA 3B3GA 1BN6A 4YH1A 2NV2B 1NPDA 2ZAGA 1LVUA 1JJBA 4O25A 3LQ2A 1DL5A 5CK5A 3FXOA 2RJOA 1EFPA 4PNZA 3KOUA 2J67A 1PDNC 5CB6A 4BNLA 4V3BA 4ZMSA 4KZKA 4HQ0A 4PW0A 4YJFB 4ENWA 3RANA 5B1IA 3K9TA 1SKAA 1H5QA 2BVLA 4YPFA 4JLAA 1OA1A 5FWXA 2XT0A 1GUUA 1GWNA 1L7XA 3PZBA 1P0QA 2H2WA 1USGA 1MIHA 2H65A 3QYEA 1ZI8A 1UHWA 1H1DA 1MMGA 3I59B 2HZ7A 5GPBA 3E3VA 2QORA 1R8JA 3L8YA 5DHUA 3BJEA 3IA7A 2JHGA 5DSXA 3FTEA 3DVRX 1XKTA 3KKNA 4QVIA 4D9GA 1ZRMA 5DD8A 1IRFA 4FWBA 3GRPA 4Y4RA 3PFNA 1QRTA 4EG5A 5I7OA 1AV6A 4DZPA 5E20A 4UZEA 1RIOH 2UDPA 4K0KB 2OZ6A 1VHWA 2GA2A 4KH1A 3OYHA 1P9LA 3U3JA 1K61A 2P1ZA 3WLEA 2BBWA 4EY8A 4QAQA 3ENQA 2I80A 4CCOA 3OT1A 3TNDA 2BJHA 4AKSA 1KOJA 1LFBA 3PGVA 2VJIA 4NMLA 3RRNA 1PDOA 1JJIA 1G2PA 1YJAA 2OV6A 5LP6C 5K0NA 3DXXA 2HZTA 4O33A 1CVLA 2XUDA 1P6UA 3NIWA 4REQB 2NAZA 3ZU4A 1PFQA 1WDWB 1MMAA 3MD9A 5JXHA 2PCLA 4GI5A 2WUFA 3GA5A 2K7FA 1IOLA 1VCIA 4DZZA 5DIZA 1SFOJ 4NE7A 4HDOB 1I3OA 3HLYA 4Z0NA 2DHQA 3IXMA 1XLVA 4J90A 3OEWA 2M30A 1EUQA 2ZPAA 1IBMB 1P31A 4FCCA 4K2AA 2G4CA 1NJ1A 3THRA 5A3JA 1X7GA 2O1WA 3A9SA 4DNFA 1ZAYA 3GBVA 3EIEA 2AHRA 3ROUA 1VPEA 2VRCD 3VB2A 5LZ8A 1YOVB 4UAVA 4TRRA 2E34A 1IHXA 1IN5A 2PQ8A 1X77A 4LXHA 1FP6A 5CNIA 2EJRA 1CP2A 3K0AA 1CJUC 5EPUA 5HDNA 2PSFA 4PYNA 4DIMA 4I2NA 1P18A 5H83A 3HDDA 1TVMA 2WFMA 5CCEA 5DHAA 1D4OA 3P9PA 3NFYA 1KS2A 1BD3A 1IRZA 4DV0B 4D9FA 4G1MB 4Q3KA 1XDUA 4LITA 1CR4A 3M2TA 5DXFA 1UPBA 4J1TA 5D3MB 1XV5A 2YS6A 2HU5A 1BHSA 1U2GC 3RSOA 4Q66C 3KDPA 1P1RA 1ORVA 2QE6A 4RANA 1ZMXA 2BY3A 2BMJA 1DTSA 2WU3A 4U7GA 5KNCA 3WHBA 4LZWA 2HXSA 2WKWA 1MGTA 3FD8A 3IQWA 4GP6A 1VG0B 4EK9A 1BI2A 3M1LA 4GPZA 3OQHA 3F1KA 4MQFB 4E08A 2GK3A 3WBBA 2ZRJA 3CWQA 1MW7A 3ZQ7A 3I6MA 3PD7A 4HPJB 3UYKA 3K16A 5IEBA 2A69F 4N5HX 4LYGA 5KYGA 2AXEA 1Q12A 1U1CA 5TPZD 3NT4A 2JVKA 1T2VA 1R22A 4MTCA 1JFRA 4N9WA 3I0ZA 4X44A 1Z47A 5G4LA 1D2EA 2NYUA 2QMQA 3ZCVA 1UK9A 3PIOF 3S29A 1TRHA 3S28A 2AO9A 3UK2A 2MC4A 2LW7A 3EVNA 3RK0A 1RKWA 3OZXA 2FSFA 5IP5A 4D5FA 2JGRA 4EPTA 2X5KO 1SUBA 4PEVA 2R8PA 2F6CA 4QDZA 4ND1A 4OMFG 3AKDA 4CKEA 2VOJA 4ODIA 3OCWA 3RAJA 4EB6B 4QRHA 3EXFB 1T36A 1P5JA 2JLZA 2BE9A 3NNDA 3JAMA 2QQGA 1MNDA 2P3SA 4PSXA 1RRPA 1RCTE 4R5MA 2UU9B 2ZT6A 2FEXA 5JWOA 3KYJB 1Q3HA 1ADCA 2ZANA 2ZQYA 1S7EA 3G8CA 3VKUA 4MHTA 5CH3A 2REQA 1DO2A 5J4HA 2NSHA 3OJ0A 1YVUA 3PGLA 2CNWD 5I45A 2Z04A 2RB4A 1OXTA 4EUFA 3E35A 2XAAA 3S2EA 1TU3A 3VYWA 2NXJA 5DMHA 4F4CA 1S1CA 2ZJFA 4OI2A 1P9WA 2XF2A 2O8KA 3RRZA 1UOEA 1T10A 2A7XA 4EKIA 1JHUA 3Q0UA 1WVIA 4LA4A 1N1MA 4MDHA 1QGYA 1K79A 4WESA 1DQZA 2V7FA 1Y8RB 3LL4A 4ZOLB 3GLFA 4ALLA 4XCXA 1UAAA 1K7FB 5F1OA 3DLAA 4NHEA 3KJNA 1EX7A 2Q3BA 4L5YA 1XJ0A 1VG8A 3D3NA 3MF4A 4YJ3F 1X8LA 5IKEA 2J3MA 4UPDA 4N0DA 3TGLA 1Z33A 3OUTA 4PY2A 2E71A 2DAOA 5FKNA 1CEXA 1M54A 1UUFA 3M34A 3KPJA 3TZEA 3IAM2 4NUBA 3S15J 2DMUA 2E18A 1DWQA 4C88A 1SB8A 3WK5A 3JQ9A 4U7PB 1VL0A 4W4TA 4WRRA 1H42A 3ML6A 2G9ZA 2WD7B 3KOYA 2WWGA 1H2BA 5BPHA 4BV8A 2O7RA 1T9KA 2Y4NA 2DYKA 3CWCA 1L7QA 4QPCA 1YW9A 1GUAA 2JLUA 1LS1A 1MC8A 2GN6A 3G49A 3RSGA 2J33A 3H6KA 1MABA 4C7KA 2OU2A 3EUFA 1YWGO 2B99A 1JAXA 1GNPA 1HDIA 1WQ4A 2KIMA 3LNQA 1K4YA 2DFFA 1U3TA 3OD1A 5JISA 3CPEA 2IGNA 5C4JJ 1FTGA 1PNTA 2GUWA 3DEHA 3GLVA 1U5AA 4LJ8A 3AR3A 2LD4A 3FX3A 4FQ7A 5BURA 2XPVA 3EGDA 3OSGA 4ZAYA 5CB4B 1P6RA 4OGWA 2VJMA 4RNCA 2NV6A 4QPQA 4F7ZA 3HI4A 3AV0B 2OP0A 3UCXA 3KR2A 2OO5A 1VGVA 1XUOA 1YDHA 1GO2A 1ESMA 2E6KA 1NP7A 3DHVA 2NPFA 2I3ZA 4ENSA 3F8TA 2L2QA 4IJVA 5F7JA 4ZAFA 4IZ6A 1KJQA 4DUPA 3TLZA 5H8WA 16PKA 4D3ZA 1PZNA 1E89A 1FA9A 2CZQA 3ZHOA 2RGNA 4Y6LA 2O2YA 3CE9A 2CLKB 4KN5A 2IDJA 4RA6B 5FBQB 1T6NA 5A3QA 2EOAA 3ZLBA 4PLFA 3OKAA 3N0XA 1I6LA 2DDAA 5HILA 2HLHA 3IB3A 5JNLA 2C92A 5CLSA 5CB0A 3F46A 2ZDGA 3DNPA 4YJ2A 2IQ5A 2ZRFA 4OFZA 4NNJA 3WGHA 1L3BA 3CTMA 1XAHA 4BQAA 1IXSB 4IIYA 3H4IA 2FZ5A 4OSPA 3B2QA 2GPSA 5HRAA 2MH2A 1W0CA 4O63O 3PNTA 3AVPA 4CDGA 4EPYA 1HUQA 1Z83A 1JLSA 4OH1A 1MW9X 2J9FB 3K1AB 3NOOA 3HG9A 3VHLB 1KP2A 2MWMA 5GVSA 2JFGA 2F7SA 2Y0DA 1YA4A 1C81A 2RK4A 3RFVA 1XSDA 2YBEA 1EFHA 4Y2XA 1EE9A 5JEDA 4HC4A 2Q6OA 3M9LA 4Y6PA 5HNFA 2CHVA 4NDLA 4ZJPA 3EETA 3FUCA 4PV7A 4X94A 5KAIC 1OPXA 3ZCXA 4A1OA 2FBIA 2R6JA 4TV8A 3V9AA 3AM3A 2YJ3A 1YDFA 4FISA 1DQPA 2QRJA 3MVEA 3GLGB 4G9BA 3G68A 3FISA 3AUSA 4EUKA 4W5JA 1WABA 1VXOA 5LB4A 3OHMA 4BFCA 4IOMA 5ARBA 3CLOA 1O0SA 2FSPA 5EUBA 2IU3A 3Q7EA 2YNMA 3HY4A 3ASYA 1WMFA 2FRVA 3L05A 4QARA 3ZDFA 3E23A 4DDKA 2BEWA 4PZLA 4ZVLA 1UBCA 4IHYA 4DV3B 2Y6UA 4MQVA 5SZKB 3A31A 2BLLA 4XGQA 4KYWA 4O2BF 1R0YA 4N47A 1C50A 3T0FA 1XLTA 4BJ3A 4G5XA 3HUDA 2AOUA 4RS8A 3U5TA 1GCOA 3FDFA 4RYLA 3G3ZA 4M7WA 3BJOA 5KO2A 4B3SB 3QVJA 1Q1AA 3LHFA 3W8RA 1A35A 3GARA 1QK4A 1ZD2P 3BRWD 4CUKA 4RAZA 3VR5D 4TZTA 1DIAA 3DC7A 5BOSB 4DQXA 3PEYA 4KAFA 4KHPB 1Z5NA 2ZRCA 1OFUA 1TCCA 2VEDA 3BX1A 2BFEA 4INZA 1UKAA 1JFSA 3M4JA 1XD8A 1LBSA 1DBIA 1I0IA 5AJYA 3ABRB 1WSWA 3EVCA 4W6ZA 3QVXA 4NYIQ 4MNTA 4WK8F 5CPBA 1YIOA 1G18A 4JYAB 3M3HA 1DJLA 1I4WA 1RHQA 5AOVA 1L3LA 4FKZA 2IPAB 3ELWA 3D6JA 3HVRA 2GERA 3QFSA 2IYQA 2J87A 4LRWA 4P33A 1JVBA 1HLVA 2NZWA 3TZBA 2AYYA 2PLAA 5FLXZ 3HJTA 3H0KA 4MSUA 1C1XB 5IANA 4DM4A 2P5SA 3K15A 4BNWA 1EFKA 2X1HA 4JLWA 4C2UA 1FUEA 4V0QA 1IHPA 2BGJA 4FU0A 2PWYA 3A0RB 2XMGA 2FFRA 3V2IA 3C1UA 2M1XA 4NS1A 3BAZA 1CJVC 5AJZA 2QXYA 1E1RD 3BIOA 3RSQA 1SIWA 2YFYA 5JR3A 4O29A 3R3WA 3UT5A 1AUPA 3VR6A 3NHRA 1FYMA 1VSBA 1TJPB 3J7TA 3MFQA 3FHJA 3BE6A 3KUCA 5HNKA 2PV7A 5AVYA 5KBYA 1WU8A 2JFHA 2BIFA 3AMVA 3I5YA 3DDUA 5F1PA 1NMYA 1QOZA 1W9HA 2HLDD 4NMXB 2ISSD 5FTNA 1OSNA 4PJNA 4MA0A 2HMWA 3PI6A 4GMFA 4MPDA 1JIQA 4E7IA 2W7TA 2X4IA 3NG1A 3RTAA 4L78A 3RDIA 3VNUA 2UZ0A 3W7BA 3TBFA 1J59A 3F5FA 4M8LA 2VSXA 4QTYA 1W1IA 3RUEA 3HOVJ 4LHEA 5JADA 1SC4A 2KLHA 4WK0B 4ZI3A 1SQ5A 3RTBA 4DV4B 1WUHS 1K9SA 2ZWAA 1IJFA 4OJQA 2WJJA 2KL4A 2IX9A 1HKQA 1BM9A 5L9AA 5M34A 3O8DA 4M73A 4B33A 5FFZA 9GPBA 1BA5A 3ZWNA 2D0IA 1H0SA 4M9CA 4OVKA 4OHMA 4MRSA 1FLVA 3IVMA 3CLVA 2HSEA 2O2DA 4P7BA 4LOKA 4MEXF 4N39A 2PCJA 4N01A 2VJ5A 4GMXA 4DWOA 3B20A 2ZUUA 4EJSC 3P27A 3K9WA 4Y6SA 4RDXA 4D25A 4JGIA 3N75A 3LF2A 3IAM1 3FZNA 3NOVA 3I6QA 4QECA 2P2DA 1W47A 1F9NA 3N97A 3IBSA 3TMYA 4PC6A 1B59A 1Z2NX 1S9HA 1WIWA 2BV6A 1V1RA 2LPMA 2OAP1 5JRJA 3DBVO 2WJAA 2LIVA 2ZVPX 3L2UA 5IRCD 1VCNA 4KN9S 4KFCA 2OXFA 2PVPA 1QFMA 2FMHA 1KMCA 2VHJA 3FPAA 2PKQO 3EOZA 1BGVA 5LQNA 2C3PA 1I3LA 3DFKA 4YV7A 4ZYAA 2EP7A 4YGYA 2F3TA 1O08A 4EI2A 3CC4I 3ASOH 1LS6A 4UQOA 2C2KA 5CVIA 4MAMA 3OYIA 2NQTA 4AICA 1EVIA 1DB3A 4U39A 2YZGA 4KK4A 1HV8A 1E4EA 1L8OA 5FOTA 5AI4A 2HEGA 1HDGO 4NCJA 1RS0A 1UQUA 4MUEA 3L0BA 1TMGE 5EF6A 2P6RA 2P3LA 1FXSA 1J75A 2TMYA 3VPCA 4YELA 2A5LA 2NTVA 3N8GA 5GJWC 2YRWA 2F3UA 4AYTA 2FUNB 2VQ3A 1KYVA 1YHNA 3N2YA 3E9NA 4HLNA 4QULA 1DBWA 4G6QA 1JLMA 1GTVA 2B9VA 3C2HA 4IDAA 2TS1A 1UXKA 5FKLA 3RUHA 1PYGA 5DV5A 1YHYA 2HYGD 2FDCA 1ZX1A 2BTEA 1ISFA 3ESBA 1K8RA 3GTGJ 1URPA 2N0SA 5CLLA 4L0ZB 3A2LA 3E70C 3V8EA 3CLUC 2XWBF 4DR2B 4HPWA 1LFPA 1WCIA 2YJ6A 3I62A 3UOWA 2ODTX 3EZFA 1UZNA 2Q5IA 1WKVA 3MRTA 2E4VA 4Q0MA 5BUZA 4LJAA 1GXSA 5IU6A 3FCCA 2Z2SB 2YJ5A 1QDLB 5CFMA 1HM5A 1ZK8A 3WFZA 2O2GA 4JBLA 1E3OC 2MYUA 3QLUC 4XM2A 4XE5A 2QKLB 2ZBRA 3D3JA 2G5PA 3LG2A 3PE6A 1OLXB 1G64A 2WC1A 2PUTA 1SCIA 2ILTA 3MTDA 3AOEC 2YMQA 2DHCA 3HYRA 2HSZA 3S2GA 3OX2A 4MH0R 4MEAA 3RI3A 3RUIA 3PFIA 2QQBA 1ZFNA 5EIOA 4MHOA 4RB1A 2AFIA 1RYEA 1ODDA 2WNHA 3PBKA 3F3KA 1BIFA 3HMKA 3LDFA 1Y7LA 2Y77A 4L6IA 3UMYA 3QE3A 4U2GA 2L42A 4FGWA 4KOAA 2O8BA 5BV7A 1REPC 1WJBA 2QHXA 1ZHHA 3QP6A 3UM9A 3COYA 1YW7A 3JSPA 4LY3A 2Z5VA 2C00A 1HLFA 2HUPA 2PIDA 3KQWA 3AK4A 1TU4A 1HBJA 4KRFA 1X0VA 3HB7A 4KWIA 3INGA 3TMOA 3DMDA 5ITZA 3RYIB 1HNNA 3OL3A 5BUSA 2QE7A 4K6HA 4I5GA 1NVUQ 4NQWB 2HO4A 2FMUA 3NMUF 2VYVD 2GYWA 1N7HA 4OK6A 4K87A 4EGSA 2I1VB 3QEAZ 3PXDA 4ND5A 3OS2A 2NT4A 1KS9A 3KP4A 1P5ZB 1KYTA 1ICEA 2P91A 1FU7A 2XWPA 3E6MA 2A6PA 4CCAA 5I8ZA 4NAUA 3GRKA 3KYBA 2BT4A 2DM6A 3K9CA 1FVHA 5EMNA 3BCBA 4TN5A 2I29A 2VLBA 4D4IA 1JHPA 4OGLA 5KJEA 3ONQA 3PU6A 3VI3B 4GOXA 2ZJYA 1NH3A 2WWRA 5K1ZA 2WWVD 4CYDA 3PF9A 2OYCA 1JEEA 3QXJA 4WLVA 1JU3A 3SQMA 2J3KA 4CEJB 4DBLE 4HNSA 1JFTA 4R1QA 4Q3NA 1RM0A 3G0HA 1S2IA 5GAGJ 3LSYA 1ZIXA 3UJCA 3BSFA 2H5IA 5IUJC 5CB8A 4PDKA 3LTNC 1H8ED 5CT6A 4D6PA 4PNPA 1X7WB 1X1DA 1M8FA 3K92A 4NCHA 2RI1A 4DOZA 2NU8A 4HZFA 3GGCA 1VZ3A 3PYLA 4RV5A 3OJWA 1FYVA 1AKNA 3DDSA 4HN4B 4PGMA 4FI3F 2RNJA 4B3CA 3ZKWA 3JTGA 1VFPA 4OB7A 4N41A 1S4QA 3IUJA 2NYRA 3QTLA 1B8OA 3Q8MA 4C76A 1KK1A 4WCDA 2CLSA 2VXZA 2ZJ3A 4JB8A 4PZCA 2EQ5A 3JQBC 5F9FA 2FRHA 4D46A 2QT9A 5K6TA 3WGVA 5JSZB 5E6UA 3VEPA 5COQA 5JYBA 2IXTA 3W4KA 4AF7A 4V2IA 4MS3B 3W9YA 3PQ4A 2Y1CA 1N1DA 2XJ4A 2P5UA 2Q1UA 5JI2E 3KFXA 3HN2A 4Z4FA 1LSSA 3AHFA 5K3DA 3FM9A 4F5DA 2GQ0A 4F4DA 3OH8A 1EIZA 1Q2UA 4XOPA 3TD2A 4LWOA 3BK1A 3P1JA 4TWIA 4D8VA 3V7SA 1BWSA 2VZ8A 3TIFA 1D1PA 4DNOA 2XZLA 4ZI5A 2F9FA 2JIQA 4ER5A 4XVHA 4DXAA 3LSIA 4ETIA 2IS4A 3MGCA 3GA7A 5E18F 5HX7A 4LXYA 2A8YA 4MI1A 3V8PA 1FNMA 1MG5A 1USVA 5DNCA 3K6SA 2XVAA 4DLRA 4GF5A 3KQUA 1I24A 5HQ3B 1NPYA 3RWBA 4O4HB 1NOJA 1YDGA 2K87A 5JJIA 3FTQA 1P1CA 2XASA 1VJ1A 2H1CA 1P61B 2G0NA 3QVMA 3C16C 2C7QA 5AKLA 2JG3A 1KI2A 2X3UA 2L4MA 4XIGS 1Z9BA 1HA8A 1CEQA 1ZICA 3OX1A 4PFSA 4EO4A 1HE4A 3ACDA 4QBHA 4MR9A 1YTLA 3QOFA 4HA8A 3U6BA 3W06A 4UVIA 2IAIA 2VPTA 1ZW6A 3W5IA 1HBXG 4XD7A 1L7BA 2PLNA 1DKOA 1KO4A 4UM7A 5K8UA 1RAHA 4QXMA 3GVXA 3KZZA 2VASA 1EJ9A 2HFJA 3V34A 1K7EB 4FC6A 3AF1A 2C2YA 4AZTA 2J85A 1X8XA 2XX3A 1R5HA 2IYTA 5J2TB 1PV1A 4BOYA 4WZZA 4G6ZA 4HB4A 1TL7C 2I6TA 4QBFA 2DUNA 2OECA 1UC4B 2Q2OA 3CC2I 1EFLA 4G97A 3O4FA 4B7UA 4E5VA 1WTCA 1N7JA 2JJ8A 4BQRA 4ZXFA 1BE1A 4KO2S 5FA6A 2FOKA 5ADWA 5BSRA 1YRWA 3MBKA 3GTOJ 4KDFA 4DANA 3ZVLA 1CIPA 2WI8A 2Q3LA 4FE3A 5DCUA 2QVLA 2ZI9A 5NLLA 1NZDA 2RHJA 1CY4A 1PJ8A 2O3JA 1M8GA 4P38A 1P4XA 3D8TA 3QPBA 4JHLA 3CJTA 5L4NA 1NRXA 3DLPX 1OYWA 2ZT8A 2IUEA 2K7ZA 5EG0A 1UHMA 4PHGA 5G1OA 2JBAB 1YR6A 1XEWY 2CLLB 4BVGA 3L79A 5ALLA 2GAUA 2Y99A 1P2SA 3ZBQA 1Z3YA 1CQJB 4HVLA 5DNYB 1Y8AA 1V2GA 3V8JA 1KYWA 4YRQA 2YXEA 2MJLA 5L3SB 2XLBA 1H6DA 4IIEA 2Z9CA 3A0BC 1F0PA 3ZHTA 2DQKA 2FPGB 1IHDA 1BVRA 1DKQA 3ZHZA 4MR8B 5P21A 1YD7A 1I3QJ 4ARCA 3WGIA 3KU4A 4PSKA 5FUQA 1E2XA 4WY2A 4E6PA 4G8XA 4ND7A 5FADA 1FTTA 1SWWA 2NS8A 2CCGA 1LTHR 1MP0A 4BUZA 1RJWA 1Q0SA 1Z75A 3MWGA 2GCOB 5CA1B 3J7AC 4F2WA 4OATA 1ZH5A 4CUZA 2PX8A 1RXYA 4M8SA 3OOPA 3D0KA 1EGHA 4B43A 4BJHB 5F9HA 1V95A 4YY3B 1I39A 4DRXB 3OTWA 3CEJA 5DN6A 2ZRGA 5LOVA 2D2WA 4BTLA 3ZWKA 4NY1A 2A94A 1SULA 5L3DA 3L9WA 1NV9A 1I13A 4TRJA 4BEHB 3G85A 4ZAGA 4LXTA 1QE5A 5CX1A 4NFSA 2PLFA 5AK3A 2B63J 3VR3D 1LDGA 3EG9B 1TQ6A 1MKMA 2UXNA 4MO2A 1RXCA 5LNK6 3EAQA 3RGGA 5GAHJ 1R50A 1JAZA 3BJAA 3ICQB 2Y9MB 3HBJA 3RKSA 1U4SA 1LDJA 3IPYA 3BXZA 2PJUA 3NDJA 4JJ4A 2NO5A 4GZLA 3JRFA 1VA4A 2OMKA 4DG8A 5DW3A 3WL5A 4CM8B 2QZ4A 2VF8A 3AKEA 3OYJA 3AUKA 3T0GA 1I6KA 2HGZA 5C4IA 2DQLA 4N3GA 5EHNA 4BY1J 2YUSA 4DLAA 4YEDA 1M2EA 2B35A 4NIMA 1O95C 3GXOA 2P2GA 2DA1A 1E2GA 2IFTA 3JQ8B 1V8FA 2VAXA 4AIRA 2YCBA 5C3MA 3TSYA 2DG2A 3ZP5A 4PYQA 1E3WB 4ALIA 3NJ4A 2Z2JA 3IDAA 4J7UA 3D8SA 5BYJA 1SCAA 1V5GA 3C1DA 1RE0A 1J42A 1OHHA 1LQ1A 1TKRA 1KY2A 3FSJX 3THXB 4JP1A 4YFYA 3AJEA 3AEQA 3FDZB 2DEUA 2DWPA 3GH1A 3PEWA 1G4UR 4YJ2F 4LCEA 4PR3A 5K3FB 2ZSIB 4LF6B 1LFDB 1EH8A 1VZ0A 3EAFA 3IVRA 3DDOA 4UJ5A 5CX4A 1LBQA 2YOHA 4G67A 4L0MA 4QUGA 2D5LA 4QU5A 3S7TA 3LUDA 4XWTA 1RJGA 1KBZA 1VQOI 1BWPA 3EBPA 3E8MA 1HURA 2HTSA 3I8XA 2JK0A 2PL5A 5IAJA 2KB0A 3L8EA 3H2YA 1RPAA 3UMRA 4D96A 2QMEA 1DTWB 4JXZA 3RUCA 5D5HA 4IXDA 4LDPA 4QHYA 3FTDA 1T4MA 1RQRA 2GNPA 2P1RA 1NRJB 1R6BX 4B6PA 1NOKA 2X8JB 4IO1A 3AHEA 2PA3A 1A2KC 3GJZA 2QA4I 3C15C 4NJMA 3TLXA 4TV8F 4LKRA 1OQYA 2VUHB 5B2FA 2BTQB 4MVJA 3N2LA 2X5JO 1LDYA 3AG1H 2RB5A 4DMKA 5D5UB 4JASB 1NI5A 1LSOA 2ZJ5A 3KT0A 4CYCA 2QTBA 2HIMA 1NN1A 4FW8A 4I1UA 3OYBA 4HDQB 3PRYA 1NLYA 1J0DA 4OF4A 3KKQA 2K27A 4I66A 1P1IA 1RHKA 2BEKA 1N2JA 4A16A 5JZSA 2GI4A 4JP3A 3HTXA 4LJ9A 2K4MA 2NT3A 4CR7A 2QP9X 3EPJA 4KYVA 1D5CA 4UUNA 4DR7B 5CTJA 1E92A 3O95A 4JBIA 3CMYA 1U9JA 1AQIA 3OLVA 2J7PA 1GPNA 2GETA 2EFQA 1WSUA 1M33A 2GCGA 1GP2A 5D5PA 5KTRA 5J63A 1B0UA 2ZRBA 1G5QA 1XEXA 3IYLW 2EZHA 2QL9A 221PA 1W5FA 5FWDA 4DUZB 3FM3A 1AKVA 4ZH4F 1XVIA 2HIHA 3ADPA 1OREA 3LW7A 2R7AA 5HJ7A 1EXDA 1EYZA 5K51A 4XMYA 2EYUA 3HCDA 1DP7P 2XADA 1QRAA 3QQAA 3HO8A 3HNOA 4IHQA 2JAWA 4NVRA 2DDBA 5MFZA 3F6CA 3RYTC 4H0CA 4D81A 2D3WA 4NZPA 3M7GA 5L45A 4NV3A 1KPGA 5CT9A 1GQYA 3BJZA 2VHEA 4RE5A 1RW4A 3VYTB 1IMOA 4HRVA 4URZR 2ACVA 5CBKA 4XN0A 2QBYA 1N3BA 3RS0A 5TPWB 1OR8A 1JUPA 1KVQA 4XR4A 3AL3A 1BFKA 4GEGA 1Y4DE 2VNKA 4IXMA 5LIPA 2WC2A 5HNHA 5D6FA 4XRRA 4IHWA 2K40A 2Q4OA 4AP6A 2GLTA 1YR3A 1RC9A 5AW5A 1JTXA 3EYAA 1ICIA 4IFEA 3UATA 1WBDA 4IAOA 3T7IA 1N9KA 1Q57A 4UBIA 1USSA 1RACA 1S72I 2WJIA 3CX7A 1GTJ1 4Q3DA 3Q8WA 4AZ3A 2GPYA 5THXA 2WP0A 3C6QA 4OM8A 1AHNA 5HQJA 1CF7B 3LYLA 4MP3A 5A4AA 1VL1A 3TVTA 1NTRA 4IEIA 2Q5HA 3RIEA 3C74A 3QPTA 4IWXA 5I3ZA 1Q1EA 3HMQA 5A0VA 1UC9A 1WXFA 3W5VA 3ROFA 4B8WA 2QENA 4KSBA 3ZH9B 1M6HA 3CMEI 4F12A 3U4QA 5TS2A 3VTZA 5F21A 2WJWA 3HKZA 5GAJA 2F3PA 4TMZA 4AG5A 1IBKB 1DWUA 4MV5A 1TQ2A 2BHLA 1SVOA 1JAIA 3LBHA 3O93A 5G1NA 1MDBA 1E62A 2WG1A 4AT1A 1H2EA 2GEDA 5J5AA 2W7NA 3K9BA 3OPYA 4DJFC 4EMTA 3M3PA 3CBQA 1FLIA 5JFOA 5GQSA 4FR5A 2COMA 2AFRA 3B78A 3UTCA 2R84A 2QV7A 2DT5A 4HAIA 3GRVA 5F1KA 1ENYA 2MOKA 5AK4A 3ZV3A 2ONYA 3GROA 1FQOA 3P9XA 2EJVA 3E9QA 1ND5A 1HSOA 1NVEA 3ZQHA 3NHPA 3HI6A 3N87A 5FQNA 4RELA 4ZCQA 3VU9A 2GZSA 4EMSA 1PG5A 2FDRA 2GHTA 4HCJA 4C4SA 2VOOA 3V97A 4MLOA 1Q22A 2WKSA 4EJVA 1CZHA 1NBMD 5HLHA 5JBIA 1UXOA 1BQ3A 4L74A 4EEXA 4D56A 3GXBA 1NX6A 2ZXIA 3DKPA 1BOOA 1PEAA 4B3AA 2C96A 4E7KA 3TCKA 1ZWLA 3OYLA 4V38A 2DFDA 3COAC 1V4VA 2C7OA 3H97A 4DCSA 4BX0A 2QSFX 1PR5A 1KJNA 2AK3A 2P81A 4UMEA 1NXXA 4FYJA 4J0EA 3CEHA 4A0ZA 5C5CA 4EP1A 4TMXA 1K66A 3FVQA 3T1TA 1CQTA 5KOJB 3TPFA 4OKNA 2K3FA 2P9FA 2YV4A 4F5EA 5GTHC 4LOHA 3WP0A 5H3HA 1V7PC 2G06A 1UDWA 3L1IA 4CQNA 3UJ7A 4DLPA 4FB5A 3JVUA 1ILWA 2QRQA 4EEKA 3F8SA 3RAGA 4IUCS 4DLXA 4ND8B 4IIXA 3MMSA 4DJTA 2F1HA 3EC2A 4R69A 1U3UA 2PHZA 4DWWA 2WWYA 2UZAA 3S27A 4JKIA 2Z08A 2WADA 1WF3A 3TW7A 2Z4SA 3PE3A 5FA5A 4B76A 1XZHA 5C35A 5JVDA 5T6BA 1FFEA 2QRHA 3B70A 4EM1A 1FX0A 1MKYA 2OXRA 4M53A 4ZD6A 5JDIC 3N7TA 1M34E 4ZRMA 2Q1YA 3FI9A 5LHIA 1Q2XA 4XWGA 3FB4A 3KR0A 2FMIA 3Q6IA 4ZZ2A 5JVTA 4DZRA 3PFHA 1GKLA 3X0DA 3SJ7A 5KVSA 1LV7A 3TG8A 1U94A 1M73E 3ZDQA 1YO5C 3Q3VA 4MYCA 5L95A 4MO7A 1UBGA 2VJKA 3ZJVA 2HVRA 2VPWA 3Q0WA 3ZEAA 4ZEWA 1IZ8A 3K09C 2HA3A 4MVYA 5T4HA 2HL6A 3A6DA 1JNXX