1MDMA

Inhibited fragment of ets-1 and paired domain of pax5 bound to dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
b'GVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAX5/ETS BINDING SITE ON THE MB-1 PROMOTER
publication title STRUCTURAL ANALYSIS OF THE AUTOINHIBITION OF ETS-1 AND ITS ROLE IN PROTEIN PARTNERSHIPS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA02
5BMZA 2VC1A 3WGGA 4YIFA 5FD5A 1TQIA 1YS7A 4ESBA 1T2KA 2QYOA 2IA2A 1XCBA 1K7AA 3KEQA 4WWCA 4LB6B 1O3QA 3ABTA 3KP7A 1IN6A 3NEUA 1KYWA 1FT9A 1QZYA 3MZHA 4KYWA 1HKQA 4M71A 3W6JB 1BC7C 1YFHA 2GQQA 2PBIA 2PMHA 2RKHA 2XAGA 1IXCA 2M8EA 1KU7A 3KP5A 4IRGA 4WCGA 2MBFA 1KU9A 1X3UA 4LK1F 4WXHA 5FFZA 1H0MA 1OMIA 3ZMTA 2GWRA 2OQRA 1ZLKA 2A69F 1YW8A 4KN7X 1DPRA 2EV6A 3CO6C 1XMAA 3MWMA 5HLIA 2CFXA 2VONA 2GXGA 5LGNA 1PDNC 1T0FA 2OQGA 3WU0A 5H6QA 2OA4A 2XIGA 1XN7A 3RJPA 1FBQA 4UUVA 4YG2F 2EFOA 5E8IA 2P5KA 5FO5A 4FT8A 3KP2A 3S2WA 2MLGA 3IWZA 1OPCA 2ZJ2A 3E6CC 3QP5A 4RGXA 3P9IA 3IRRA 1FSHA 2DK8A 5DYMA 1SD6A 1FX7A 3WTUC 3F8MA 2KJCA 3FM5A 1IF1A 3KE2A 1LNWA 3KEOA 3EYYA 2DPDA 4ENMA 3KP4A 1LDDA 3IWFA 4HX7A 3G73A 1FYKA 4HV6A 2BYVE 2WWYA 1WI9A 2O8XA 2VBZA 1TTYA 4HDUA 4LLNA 3CUQA 3JSOA 2PG4A 1AWCA 1IN5A 1QZZA 1SFUA 3N4MA 1OKRA 4R79A 2MA3A 2XAQA 3I53A 4UXNA 1ZGAA 1YS6A 2EV5A 3SZTA 1G6NA 5J8CA 1I6XA 2Q0OA 2EB7A 3E5UA 2IA1A 4LG0B 3GWZA 3BOQA 5ICFA 2G7UA 4PGGA 2KIFA 3F6OA 1U5TC 3F6VA 4KIGA 5LHHA 2ZCWA 4AIKA 2RVCA 3I59A 2QLZA 3GLXA 5HS8A 5KVRA 2A6HF 1W5TA 4M6XA 1HKTA 2VE9A 3LA2A 5CVUA 1R36A 2RV8A 5LEJA 3T8RA 4Q5SF 4FX0A 4LJZF 4M72A 4IRIA 1BJAA 1FYLA 5BPIA 2P6TA 5E8GA 1XDUA 2XV4S 2GAUA 3EETA 4XRFA 1PP7U 2HQRA 1S7OA 3BJ6A 4MQVA 4LB5A 2OZUA 5DDGA 5L3FA 3ZMDA 1B6AA 5D8LB 2HKXA 2IW5A 1RIOH 2E7XA 4KIFA 2YPRA 4LLGF 1XGMA 1LEAA 3RIRA 4ZH4F 1R1TA 5J6XA 1KQ0A 5J8FA 1U5TB 4A0YA 2X0LA 2DT5A 1MKMA 5BS6A 1W5SA 1YW7A 2FNPA 4G6QA 3JTHA 5ICEA 2PJPA 3OV8A 2PLYA 2K7LA 4LK0F 4O5VA 3KP6A 4ETSA 3TDUC 2FU4A 3DQVC 3RYRA 3HRTA 2UWMA 2ISZA 4RGSA 2YX4A 5ILUA 4CGZA 3KFWX 5JVTA 1IRGA 1W7PB 4B09A 2P8TA 2CW0F 1ZLJA 5LBQA 3HSRA 1ON1A 3FMSA 3FX3A 1O3TA 1I1GA 4YFKF 4RGUA 5L3EA 2H6CA 1TW2A 3I4PA 4HAMA 4CYDA 1IUYA 3IKTA 1U3EM 2M45A 2FSWA 2XAHA 2FF4A 1BIBA 4I0AA 2OBPA 1RUNA 2HR3A 4ZYGA 2HYGD 2A3SA 3MZYA 1LDKB 2LSOA 2ZXJA 2R7DA 4KN4X 3ULQB 2D1VA 2Q8KA 2WV0A 5ED4A 5K5RA 4GO1A 3HRMA 1F5TA 3KZYA 4XBFA 3WTSC 2P7CB 4IF4A 2J5PA 2RC4A 3HSFA 3QPHA 1XB4A 1KU2A 4KIBA 3WTZA 4HA8A 2VOPA 1A04A 4TV7A 2COMA 1KQ9A 1I1SA 4Q4ZF 3V8JA 4EMSA 3H3UA 5JR3A 4Y17A 2EA2A 4HBLA 5LGTA 4KNYA 3LFKA 5DCFA 4HF2A 2A61A 2VXZA 4RB0A 4G7OF 2QQAA 4L0YB 3DV8A 2QVOA 2CYYA 4A5MA 1F4KA 4HV5A 1LEBA 2GA2A 4OIQF 3P9CA 2YR2A 2KIUA 1ON2A 1TQPA 4GCVA 1R22A 3MQ0A 4AIJA 3WE2A 4DQ2A 2OD5A 4GGGA 3E5XA 2LKPA 4OOIA 1BBYA 3L2CA 3FZVA 1J7KA 3Q5FA 3DF8A 5AONA 2RDPA 4BHPA 2CG4A 3SFZA 3WTVC 2HOEA 3BDDA 3BY6A 3E6BA 3SXYA 2BE5F 3WGHA 3ZN1A 5DUIA 3N97A 5BPDA 2H6BA 1FPQA 3MEXA 4G7HF 3R0JA 2FQ3A 4P55A 2EFPA 2VBWA 4G94A 1BM9A 3H92A 3CUQC 4LLLA 1R00A 2P6SA 1USTA 2K02A 4ENKA 2RGVA 5D6FA 4EGZA 3WTTC 2H27A 1G4DA 3J7AO 4ENNA 3CJNA 4BXUA 1YG2A 4AIHA 4H0EA 4KA4A 4NHJA 2MD5A 2E1NA 5FFXA 3D0SA 2QBYB 1O57A 2QZ8A 2NRAC 2VT3A 1W7PD 3BROA 1PP8F 3VEPA 3GUDA 1ZRFA 1TNSA 1FWZA 2EK5A 3LWFA 4O3MA 3KP3A 1XCVA 3HSEA 1HXDA 2M1BA 4HYEA 2FXAA 3TGNA 4HLYA 2NNYA 4RB2C 1O3RA 3JSPA 1UB9A 2O61A 4Z2YA 1RUOA 3CUQB 3LQRA 2ZKZA 2JRTA 3WG9A 2NS0A 3GFIA 4P9UA 3IRQA 2ZO4A 3FMRA 3F23A 2R3SA 1ZRCA 2L4MA 2NAZA 5EEHA 1DP7P 4EV0A 2FOKA 3JW4A 3IHUA 1R5HA 4WXDA 1EH6A 5LRRA 3BZ6A 1HW1A 1J9IA 4BAYA 1B9NA 4M9SA 2OAZA 5LLQA 3JTGA 4UVAA 3TO9A 1ZARA 3E6DA 4WF2A 1BOAA 3DKWA 3ERED 4I0BA 4OIPF 4M9XA 3OOPA 5JHUA 4GYIA 4L9NA 1SD5A 1G3WA 1HBXG 3U2RA 1JXSA 2NNNA 5DCMA 1BI2A 4EM1A 1YQAA 1CGPA 1WSUA 1K78A 2W24A 2DQRA 4OMYA 3E3VA 3I54A 3CUOA 1CF7A 2NYXA 4L9VA 1XSXA 1ONVA 2VODA 1FYMA 2XGXA 3EDPA 4OMZA 1IRFA 4CZZA 5A2QK 4BQAA 2LF7A 5E1ZB 1PUEE 4U0VA 3B02A 4F7ZA 2Z9OA 3FXQA 2ISYA 3KLOA 4Y15A 2YSRA 4ESJA 4CO8A 2D1HA 3FM3A 4ZYEA 2PMUA 1J75A 2QUFA 5D4RA 5DD8A 1RNLA 3T5XA 2HZTA 1K79A 2EFWA 4QWQA 1GVJA 5HDNA 1IAWA 3O3KA 1ZH5A 3BPXA 5D5XB 1T6SA 2W85A 4BNCA 3IC7A 1JHHA 4JBAA 2TDXA 1MDMA 4UVCA 2IP2A 5D6EA 2AS5F 5KK1A 1IXRC 5D8KB 1O7FA 5HS7A 5DD4A 2QQBA 2O0YA 3HYIA 2KRFA 1JHFA 2HWVA 4Q47A 4HQEA 1XGSA 4ESFA 1S3JA 2ZNZA 2BBYA 1R1UA 3E6MA 4L9JA 2EWNA 3I5UA 2DO7A 2VBXA 3ZMZA 4YIIA 3H3ZA 1XDSA 1D5VA 2QENA 4UV9A 4HDVA 2ELHA 1JGSA 2JT1A 3WE3A 3WODF 4KMFA 1T98A 1E17A 1ZRDA 4I02A 4L5IA 1O7LA 2L02A 1DUXC 4LD5A 4EJVA 4WK8F 1P92A 2M5WA 4LFUA 1G3TA 4ON0A 4IRHA 1OR7A 3E5QA 4LMYA 5F64A 1YTYA 3C18A 2P7VB 5HS9A 4UNOA 2GZWA 5JI6A 2ZMEA 5D4SA 5DV5A 1ZG5A 5LHIA 2HYFA 3V7CA 3HOTA 1WKMA 4HZFA 5HDGA 2DW4A 3M1EA 2VOOA 1RI7A 2XROA 2DK5A 3K1NA 4HX8A 2HEOA 4AD9A 5CVRA 3RI4A 2XKPA 2Z33A 2RN7A 3MAJA 2K86A 2VC0A 3REOA 2P5LC 1TW3A 2DTRA 3P7NA 2HGCA 5BQTA 1LDJA 1J5YA 3JAMK 3DXJF 2DQLA 5DUKA 2BEOA 3ECOA 2PEXA 1FBUA 1P6RA 4IHSA 1BI0A 4HX4A 1LQ1A 1ZHFA 2GXBA 5L3GA 2L01A 5L3CA 3K1PA 1HSJA 1BI1A 3J80K 2A6EF 4EJWA 4QLCU 3D5LA 2IJLA 5D5UB 1LJ9A 2B0LA 2STWA 2AXLA 2MC3A 1I5ZA 5HOOA 4XLPF 4IVNA 3ZMUA 4P96A 4NQWA 1SD4A 3BJAA 5CLSA 5L3DA 4A5NA 3V7RA 2BGCA 3TDZC 4IJAA 4O6JA 3QPTA 1Z6RA 5F6FA 5K1YA 3EQLF 1Q1HA 4OINF 3DEUA 1K6OA 3TO7A 4RAZA 2DI3A 1WQ2A 1SFXA 4A0XA 2C6YA 4HLXA 1G3YA 2XVCA 3K1MA 2DPUA 5IT9Z 2W84A 2VBYA 3V4GA 4MQ9F 1V4RA 1IN7A 2A5YB 1EV7A 3GX4X 5K5QA 2STTA 2ADUA 3ZP5A 5A2QZ 2RNJA 2FEZA 3I0TA 3F8NA 3LAJA 4FX4A 3HOSA 3GEZA 1W4MA 5FLXK 1OYIA 2XRNA 3V8LA 4S04A 4A12A 1UCRA 1ZREA 2CQKA 3CTAA 1BN5A 1GXPA 1J0RA 4M9ZA 5CVJA 1F1ZA 2PFBA 4P5OA 1QO0D 4EVIA 2GA1A 1FY7A 2JPBA 4JK1X 4KMUX 1FBSA 2G9WA 5D5VB 1IW7F 2KKOA 1MJBA 3R60A 4MEYF 1K78B 2A07F 2FE3A 2DLLA 5E20A 2HTSA 1DDNA 3GZ5A 3M8FA 2W57A 2UZKA 5LGUA 1ZG1A 3QU6A 1CF7B 4MGRA 2ZNYA 4OIRF 4EJUA 1DPUA 3QAHA 3ELKA 1XSDA 3W6KB 3ZQ7A 1HSTA 5HLHA 2F5CA 1FOKA 3K0LA 3I71A 3TO6A 2XUBA 4G9YA 4IPAA 4OU0A 4A6DA 1P4WA 3QP6A 3O2PE 1FZPB 3CO7C 3LA3A 2XHKA 3R61A 1Z6TA 3F8BA 2Y48A 3IKVA 2IRFG 4MTEA 2PQ8A 3BP8A 3DP7A 2FMYA 1WRJA 4UHTA 1P4XA 4I09A 4EQQA 3E97A 1J2XA 1S6LA 3DFGA 1SD7A 1MDMB 2QM3A 4XSXF 4XLNF 2HTJA 1ZYRF 4HQMA 4CDGA 3WTXC 2VN2A 2K4JA 3GFJA 2XAJA 3I58A 3PQJA 1D8KA 1U8RA 2XKOA 1O3SA 5ICCA 2FNAA 4AWXB 5D5WB 5LHGA 1TLHB 3M9AA 3KCCA 1RZ4A 4U7BA 5CYVA 4OIOF 4UV8A 4R8HA 2F5FA 3CLOA 2JZYA 4G8XA 5LEKA 1MD0A 2G7HA 3PQKA 1NHAA 5FD6A 1YO5C 1XGNA 1KU3A 1Y0UA 1USSA 1MJAA 1UHWA 2O6GE 1UFMA 1FP2A 1KGSA 4ZZDA 1IN8A 4I2OA 3I59B 2FMLA 3JAMZ 4U0YA 1HKSA 4ASNA 3RTRA 4BHCA 1FSEA 3HHGA 4RB1A 3F8FA 4CXFA 1R7JA 3VODA 1C0WA 3GFLA 1P2FA 3FF5A 1YIOA 5IT9K 3FWEA 5BOXA 5LRSA 3B73A 4ZYHA 1H9TA 5CVVA 4WX9A 3GZ6A 3J80Z 4N9IA 1HW5A 2L4AA 5E18F 2Z5UA 3EYIA 3RDIA 4EM2A 3LAPA 2HDCA 4N9HA 3HTUA 2LNBA 1SFEA 2ZMEB 2A68F 2P5VA 4YFXF 4ENJA 3TQNA 2M87A 3M8EA 2CWEA 4I7HA 1T38A 2EA4A 3FXUA 2MLKA 3NQOA 3VOEA 5F1RA 3ZMSA 4XSZF 2QBYA 5ICGA 2CSOA 1IZ1A 3ZN0A 1QNTA 3GVAA 4CICA 2V1UA 2F2EA 4BYYA 3SZPA 4G6DA 4M74A 3I64A 1F9NA 3ABUA 5IT3A 1G3SA 4KUMA 3MFKA 5E1WA 2W25A 5ERIA 3F21A 1B9MA 3C1DA 1TQMA 3V8KA 3KLNA 2Z3YA 5H6RA 1ZN2A 2YX7A 6PAXA 2JPCA 4EJOA 1TBXA 2Z99A 4P9FA 3GW2A 2DFIA 2LDUA 2L54A 3L00A 1R1VA 2DU9A 4Y13A 3BPVA 3BJOA 3M7GA 5FLXZ 1FNNA 1OYWA 1ULYA 4YFNF 4M6YA 4M73A 3Q9VA 2F5DA 3F8CA 2CO5A 3DPLC 1KYZA 2OZ6A 3L7WA 1Z1DA 3FHZA 5AIQA 4HF1A 1FC3A 4JQFA 4KT5C 2VT2A 4WXCA 5JFRA 4U88A 1KQ8A 3RKXA 4PGHA 5ILSA 3QRFF 2H09A 3LSTA 2L3DA 3KETA 1GXQA 1MJ9A 2ESHA 2WC2A 5TRDA 1ODDA 2HKOA 3C7JA 3C3WA 3K9TA 4EGYA 5HLGA 1BI3A 1SAXA 3QU3A 3VFZA 3J81K 4BH9A 1J59A 1XD7A 3LQQA 1E2XA 1QBJA 3FMQA 2IPQX 4ZYDA 1S8NA 4DNCA 4PCQA 1REPC 2QQ9A 2XAFA 5L3BA 3F72A 1XSVA 3G3ZA 3RKWA 4A6EA 3QOPA 2V6CA 3K69A 2D2WA 4RAYA 1Z91A 1FP1D 3ML6A 1H9GA 2IVMA 3WGIA 3FXRA 4HF0A 3GF2A 1GHCA 4MHGA 2V1DA 4BHBA 1T39A 3GYHX 4IXAA 5TJJA 4G7ZF 1Z05A 1EH7A 5ILVA 1STZA 4I98B 2FBHA 3GXOA 3AAFA 4N0BA 1B59A 2IT0A 4KFCA 1YLFA 3WTYC 3ZPLA 2X4HA 4LG0A 2PI0A 1D8JA 2FA5A 1I27A 5E1XA 2ETHA 2FBIA 1IXSB 3V7SA 2ESNA 4I01A 3SHFA 4EM0B 5DEQA 1HQCA 2P4WA 2WTEA 2Y75A 2GIVA 3U1DA 3T0YA 2V9VA 1LVAA 1QGPA 1V3FA 3TOBA 4E70A 1BIAA 4U7DA 2YU3A 2HQNA 4L5JA 3TKYA 4L0ZB 4ZZLA 5H20A 1ZAOA 3L9FA 3BWGA 4A0ZA 5HVQC 2J5OA 2R7FA 2D45A 4RS8A 2V79A 3R4KA 1Z9CA 1ZG3A 2PN6A 3NRVA 3VB2A 2JTVA 1VTNC 4U0WA 2CGPA 1OYYA 3SQNA 4PDKA 4GXOA 1JE8A 3MCZA 2E7WA 3RPUA 1S29A 1AOYA 1TNTA 2V1XA 2EFNA 2MH2A 5EEGA 3ZMVA 1FLIA 3HHHA 2ZFWA 4LGWA 1U5TA 4PZJA 3O6BB 4UVBA 1UHMA 3ROUA 4RGRA 3WU1B 2UXXA 2BV6A 3GFMA 1S7AA 5HDKA 5FGMA 4B8XA 1HW2A 3HUGA 4S05A 3TOAA 3HIFA 2ACJA 1U78A 2RQPA 2HS5A 1L3LA 3R6SA 1R5GA 2HFHA 4HW0A 1W7PA 1QPMA 4IHTA 4L18B 2QWWA 3PFIA 2H94A 4AVPA 2XASA 2O03A 1Z7UA 3F3XA 3ISPA 4D0PA 1KA8A 2MH9A 1YW9A 5DCMB 3RPQA 4K2EA 4FHTA 5CJ9A 3COAC 1B4AA 4NB5A 3F22A 4MTDA 2LF8A 2KJBA 3LA7A 3L09A 1L0OC 2DAOA 2KIMA 4Q48A 1R23A 2DBBA 4L9TA 4RB3C 2EV0A 4R1HA 1MZBA 2Y0MA 5CVIA 1XMKA 2F5EA 2UXNA 3WTWC 2O3FA 3RKYA 3HRSA 1QQIA 1P4AA 3CDHA 3EUHA 3K2ZA 4MNUA 4MEXF 1U6GA 2VE8A 1EH8A 1U2WA 1ZGJA 1MGTA 3R0AA 2ZBKA 3IL2A 3Q9SA 3T8TA 1SMYF 4GYGA 5E17F 2M30A 2OU2A 1XGOA 4HOBA 2JSCA 1BC8C 1WWXA 2EFQA 3T1BA 2EJRA 4A2UA 3HTSB 3DPTA 4KDPA 2FRHA 4KICA 3RYPA 1R58A 2K27A 3GO5A 2E1CA 2K4BA 5AIPA 2Q2EA 3ECHA 3P9KA 4CHUA 2FBKA 1SMTA 4EJTA 2IA0A 3U9GA 1YYVA 3J81Z 5K5OA 1D3YA 1IN4A 1B1BA 3HRUA 1LB2A 5FB2A 3KZZA
chains in the Genus database with same CATH superfamily
5BMZA 2IGKA 2VC1A 3WGGA 4DOZA 4YIFA 5IPAA 2ZB9A 2MGQA 5FD5A 1X1PA 4B48A 1A6QA 1TQIA 1YS7A 3KIOA 4ESBA 3BTJA 4FTHA 1T2KA 2QYOA 2IA2A 4XLFA 1XCBA 3I9V2 1K7AA 3KEQA 4BDZA 1RPWA 1WH5A 3ASOH 4LB6B 4WWCA 1O3QA 3ABTA 3G1OA 1XX5A 2CW7A 3NARA 3MKYB 2HOTA 3KP7A 4XNFA 1Y0NA 2W1OA 1IN6A 2F4MB 3NEUA 1KYWA 1FT9A 1U9OA 3S32A 1QZYA 4XN0A 3DEEA 3MZHA 3V42A 4KYWA 2Y69H 3L2RA 2AQEA 1HKQA 4M71A 3W6JB 1BC7C 2JA2A 1YFHA 2GQQA 2PBIA 2PMHA 2RKHA 2XAGA 1IXCA 1V5GA 1TWFJ 2M8EA 3S3OA 1KU7A 3KP5A 4DIQA 4IRGA 3O8GA 2VJIA 4WCGA 1HDPA 1OCPA 4I6ZA 5F27A 2MBFA 1KU9A 1X3UA 2DCEA 4LK1F 4WXHA 5GADJ 5B3SH 3PO2J 1YRNA 5FFZA 5FB2A 4A93J 1H0MA 1OMIA 3ZMTA 3KPHA 2GWRA 2OQRA 1ZLKA 2A69F 1YW8A 1UZCA 4AVZA 4BQQA 1Y1WJ 4KN7X 1DPRA 1W5CC 2EV6A 3CO6C 2R7UA 1ERDA 1XMAA 3MWMA 5HLIA 2CFXA 1A35A 4E7ZA 2VONA 2GXGA 4CH7A 5LGNA 1YJ9I 3BR5A 1PDNC 1T0FA 2OQGA 2DT7B 3WU0A 5H6QA 2OA4A 4HG2A 2XIGA 1XN7A 3RJPA 1FBQA 4UUVA 2L9SA 4BEHB 2ECCA 4YG2F 2EFOA 2DYSH 3C2BA 5E8IA 2P5KA 1BOBA 5FO5A 3K4NA 4FT8A 2Y31A 4OAZA 3KP2A 3S2WA 2ZJQF 2MLGA 3IWZA 1VZ0A 4G12A 1OPCA 1ORKA 2ZJ2A 5CQEA 4CCOA 3E6CC 3QP5A 2K3FA 2CU7A 4RGXA 1R5ID 3P9IA 3OYGA 1JUMA 1WJAA 3IRRA 1FSHA 3CZ6A 3G6EI 2DK8A 2R7QA 5M5XJ 5DYMA 1SANA 1SD6A 3OL4A 2JA6J 1FX7A 2LOOA 1MBEA 3WTUC 5M5YJ 3F8MA 2KJCA 3BR1A 3FM5A 4IHWA 2HVQA 2RQQA 3FXKA 1IF1A 3KE2A 2VUMJ 1LNWA 3KEOA 1Y56A 1IUFA 4FASD 4XL9A 3EYYA 2DPDA 4ENMA 3KP4A 2DYRH 1B8IA 1LDDA 1RKTA 1F36A 1P7IA 3IWFA 4HX7A 3G73A 1FYKA 4HV6A 2BYVE 2WWYA 1WI9A 2O8XA 2VBZA 1YE9A 1TTYA 4J19A 4HDUA 4E7IA 3H0GJ 1X1DA 3AG1H 4LLNA 3CUQA 3JSOA 3SEQA 3B6CA 4XRSA 2IS6A 1MIJA 4ZDPA 1N78A 2PG4A 1AWCA 1I6HJ 1IN5A 1QZZA 3HKZA 1FMVA 3VYSB 1SFUA 3N4MA 1OKRA 4R79A 2MA3A 2XAQA 2NVYJ 3I53A 4UXNA 3FHNA 5FLVA 1ZGAA 5FKNA 4CCNA 1CQTA 1YS6A 1VQ4I 2CQ7A 3PNTA 5JLXA 2EV5A 2X51A 3SZTA 3K4JA 1G6NA 5J8CA 1I6XA 2Q0OA 1AHDP 2EB7A 3E5UA 3VSLA 2IA1A 2MABA 4LG0B 3GWZA 3BOQA 1JTXA 4XICA 2Z2SB 5ICFA 2L7MP 2IGMA 2G7UA 4PGGA 2OPTA 2KIFA 5F04A 3VPRA 1SVLA 3F6OA 1U5TC 3LNQA 3QWLA 2ICWG 1D0ZA 4RLQA 3F6VA 4XLEA 4KIGA 1ITYA 2E5NA 5LHHA 2ZCWA 2NVQJ 4AIKA 5GP9A 3S14J 1GV2A 4FETA 3ONQA 2RVCA 5IOYA 3I59A 2QLZA 2Y0SA 3GLXA 3IAS2 5HS8A 2JA7J 2WB1N 3BR3A 2Y9ZA 5KVRA 2A6HF 1W5TA 1JI8A 2LKXA 2VKVA 1VF9A 4M6XA 1HKTA 2VE9A 2XC7A 3S1NJ 3I4MJ 3LA2A 4RA2A 5CVUA 5JLWA 1R36A 2RV8A 4XN3A 5LEJA 3T8RA 4Q5SF 4FX0A 4LJZF 4M72A 4IRIA 1BJAA 3BCBA 4X1EA 1IG7A 1GUUA 1FYLA 1Y1VJ 5BPIA 4ANJA 4E7HA 2P6TA 1E0EA 5BNGA 5E8GA 2V1NA 1XDUA 2XV4S 3ZQQA 2GAUA 3EETA 4XRFA 1PP7U 2HQRA 4XKBA 1I39A 1S7OA 1GT0C 3BJ6A 4XLCA 4MQVA 3HM5A 3HZJA 5DM6F 4LB5A 2K5CA 1ETQA 4PUSA 3DCFA 4C2TA 2IBDA 2OZUA 5DDGA 5L3FA 4B3XA 2MW8A 2COBA 3ZMDA 4A3DJ 2BHYA 1B6AA 5D8LB 4N4OB 2HKXA 4NNJA 2GLOA 3CCYA 2IW5A 3TW6A 2DA5A 5DS9A 2E7XA 3PUFA 5E3MA 3MMYB 2BY0A 2HU9A 1RIOH 3QYEA 4KIFA 2YPRA 4LLGF 1XGMA 1LEAA 3OWTA 3RIRA 3RQ4A 4ZH4F 1LE8A 2R5ZA 1R1TA 5J6XA 1KQ0A 3JR9A 2VKDA 5J8FA 5IOZA 1U5TB 2IGNA 1NTCA 4A0YA 2X0LA 4A3IJ 2DT5A 1MKMA 2EZKA 3TL4X 5BS6A 1W5SA 1YW7A 2FNPA 4D9JA 3EUHC 2NVTJ 2EBIA 4G6QA 3JTHA 3K10A 5ICEA 4II3A 2PJPA 3OV8A 3K70D 2PLYA 2K7LA 4LK0F 4O5VA 4Y52J 3KP6A 4ETSA 3TDUC 2FU4A 4DYRA 3TW7A 4IO9F 3DQVC 3RYRA 1E3HA 1WVRA 4HNVA 3HRTA 3HUGB 2CFOA 2UWMA 1LUJB 1LFPA 2ISZA 4RGSA 4B3AA 5FLMJ 2YX4A 4AU7A 1WZ2A 5ILUA 2LBFB 4CGZA 1GLNA 3KFWX 4AC0A 5JVTA 3DBRB 4XOPA 1W7PB 2QKMB 4B09A 2P8TA 1IRGA 1PJRA 2CW0F 1ACIA 1ZLJA 5LBQA 3HSRA 2W7NA 1ON1A 3FMSA 4EATA 3FX3A 4JX5A 1O3TA 1JUPA 4NC7A 1I1GA 4YFKF 4RGUA 5L3EA 1D5YA 3JRHA 1MMNA 2VIXA 3PSIA 2OC6A 1UG0A 1S9HA 2H6CA 5FROA 3BLYA 3O8HA 2CV2A 3OS0A 1TW2A 3I4PA 2R93J 5J1UA 2LY9A 4CYDA 1IUYA 3GTKJ 2FD5A 3IKTA 1U3EM 1X1BA 2M45A 3JRAA 2FSWA 2XB0X 1O4XA 2XAHA 3CDIA 2FF4A 2IEKA 1BIBA 1EA3A 5KCMA 4I0AA 2OBPA 1RUNA 2HR3A 4ZYGA 2HYGD 2A3SA 3MZYA 1LDKB 2WY8Q 3OSGA 1WGXA 3RZOJ 2LSOA 2ZXJA 2LFBA 3OYKA 4NDLA 2R7DA 4KN4X 3ULQB 2D1VA 2Q8KA 1PUFB 2WV0A 5ED4A 5K5RA 4GO1A 3HRMA 1F5TA 3KZYA 2HZDA 4XBFA 1SFKA 3WTSC 3CCVI 2P7CB 2I8DA 4MFDA 1DU0A 5IYCJ 2EZLA 4IF4A 2J5PA 5IP7J 3LSPA 2RC4A 3HSFA 1D1AA 3QPHA 1XB4A 1KU2A 4KIBA 3EUAA 2R7TA 3RKQA 3A01A 2R0QC 2R7XA 1X2NA 2XPWA 3CCLI 3Q0UA 3WTZA 4HA8A 2VOPA 1A04A 1NK3P 4TV7A 2COMA 1KQ9A 5B66C 1I1SA 4Q4ZF 2IGOA 2MG4A 2V26A 3V8JA 3FISA 3H0DA 2ZFUA 1OCTC 4EMSA 1X4PA 3H3UA 5JR3A 4Y17A 2EA2A 2KT0A 4HBLA 3CCSI 4E7SA 2CQNA 2Q2EB 5LGTA 4KNYA 3QODA 3LFKA 3CCUI 3VYTB 4A3MJ 5DCFA 4HF2A 3CJQB 1X3WB 3BT9A 2A61A 2K9MA 2VXZA 3CF5F 3FKJA 5E3LA 1X4OA 4RB0A 1MH4A 4G7OF 2QQAA 2YU9J 4ZDOA 3ZGKA 3DU5A 4L0YB 1T0FC 2CUFA 1SVMA 2HOSA 3DV8A 3IV5A 5M3MJ 5KNLA 2QVOA 2CYYA 4A5MA 1F4KA 3PNYA 4HV5A 1LEBA 2GA2A 2R5YA 4OIQF 1QVTA 2DA1A 3E7LA 3P9CA 2YR2A 5C4JJ 2KIUA 1ON2A 1D0YA 5J3LA 4CA0A 4N4NB 2DFHA 1TQPA 4UB6C 4GCVA 1R22A 2E2JJ 3MQ0A 4AIJA 3E0JB 3WE2A 4DQ2A 5EGOA 2OD5A 3KEYA 2MFZA 4GGGA 3E5XA 3H36A 4IKFA 2LKPA 1S7EA 3L1PA 1IDYA 4FQGA 4OOIA 3HC7A 1BBYA 2LYCA 3L2CA 3FZVA 1J7KA 4I99C 3Q5FA 4UUSA 1IGNA 5M5WJ 3DTEA 3DF8A 3OYBA 3B6AA 5AONA 2RDPA 4F3QA 4BHPA 2CG4A 3BG9A 3SFZA 4IQ4A 3JRIA 2QGUA 2BXYA 3WTVC 1VQ6I 2HOEA 3BDDA 3BY6A 3E6BA 1T8IA 3SXYA 3AG2H 4F92B 2BE5F 1V55H 2KL4A 2WAQA 3MKLA 3WGHA 1Q1VA 3TEDA 3ZN1A 5DUIA 4Z6YA 2VPRA 3N97A 5BPDA 2GXAA 3BQYA 1Z77A 2H6BA 1YRNB 1FPQA 3MEXA 3BR2A 3GTLJ 4DBQA 1RC9A 3TP3A 4G7HF 3R0JA 3NWSA 1WJEA 2ECBA 3L2UA 3RPUD 1MBJA 3HOVJ 2FQ3A 2KZGA 2EFPA 3KX2A 4P55A 1VQ9I 2CMPA 3GMEA 5C4XJ 2VBWA 4C2UA 2HQAA 4BJ5C 4G94A 1BM9A 3H92A 3A2KA 3K7AJ 1V54H 3CUQC 4LLLA 4DBRA 2L9RA 1R00A 2P6SA 1USTA 1TWAJ 5TISC 2K02A 2VLAA 4ENKA 2RGVA 5D6FA 1WCMJ 4EGZA 1E3PA 3WTTC 2H27A 1G4DA 1MNMC 2OCCH 3DLAA 3J7AO 4ENNA 3MN2A 1JKOC 3CJNA 1H89C 4BXUA 1YG2A 4AIHA 4H0EA 1WPKA 3OMYA 3DU6A 4KA4A 2XAUA 4E7LA 4NHJA 2MD5A 2E1NA 5FFXA 5LD2C 2KQRA 4JX4A 1H88C 2EIKH 3CMEI 3D0SA 4RLFA 5HODA 2QBYB 4JX6A 2JQ7A 2CUJA 1I50J 1O57A 2KDZA 4ZTJA 4Y33A 2QZ8A 1JJ6C 3U1KA 2NRAC 3CCMI 2VT3A 3K70C 1W7PD 2BY1A 4FE4A 4PJMA 1G8XA 3BROA 2DXIA 4B44A 1I3QJ 2HXOA 3ZXSA 1NG6A 1PP8F 3VEPA 4A3LJ 3OYAA 3GUDA 1ZRFA 5EEAA 2LY2A 3WG7H 4J01A 1TNSA 1FWZA 1DGRM 2EILH 2EK5A 3LWFA 3OR2C 1QZEA 4O3MA 1XC5A 1XCVA 3HSEA 3KP3A 1HXDA 3W2AA 2M1BA 4BY7J 4HYEA 2FXAA 3FXJA 1B8IB 4MO7A 1U8BA 3TGNA 4HLYA 2NNYA 4BUPA 4DW6A 4RB2C 2QSGX 1O3RA 3BZCA 3JSPA 3X2QH 1UB9A 2O61A 2BY3A 4FISA 1VQPI 1TWCJ 1VQ5I 2E1OA 3OYMA 4Z2YA 1RUOA 3L2WA 3CUQB 3BR6A 3LQRA 4A3FJ 2ZKZA 2EINH 4XIDA 5IP9J 2JRTA 2Q1ZB 3WG9A 2R7RA 2NS0A 3GFIA 3LFUA 4B43A 4P9UA 3IRQA 3H1CA 2L7FP 3DEWA 4AYBA 2ZO4A 3FMRA 1AU7A 3LL7A 1DQUA 3F23A 4L5EA 2R3SA 5CPRB 4IOCF 1ZRCA 1MMSA 1A36A 1SVOA 2L4MA 4YEJA 2NAZA 3BTLA 4DJAA 4D1QA 5EEHA 1DP7P 4EV0A 2FOKA 3JW4A 3IHUA 3ZR8X 1R5HA 4HNTA 4WXDA 2XSJC 3KZIC 1EH6A 5LRRA 3BZ6A 2ZSIB 2VL8A 3S1QJ 4MFEA 2KISA 2Z16A 1HW1A 2CV1A 1J9IA 4BAYA 2DOFA 1B9NA 4M9SA 2OAZA 1PVEA 1R71A 3SDGA 3J7ZI 3TBIA 5LLQA 2AQFA 3JTGA 3QYBA 4UVAA 3TO9A 1Z3YA 4E7KA 1ZARA 3E6DA 4WF2A 1BOAA 3DKWA 3ERED 4I0BA 4C2MJ 3DTIA 4OIPF 3QPSA 4M9XA 1ZGWA 3CC4I 2OJED 3OOPA 5JHUA 4GYIA 1QU3A 4L9NA 1SD5A 5FKKA 1LVKA 1NH3A 5FKLA 1G3WA 2IS1A 1HBXG 3IH3A 3U2RA 1JXSA 2NNNA 5DCMA 1BI2A 1MW7A 1ZKGA 4EM1A 1YQAA 1CGPA 1WSUA 1K78A 5IY5H 4BJ6C 4PFPA 1T08B 2W24A 2DQRA 4OMYA 3E3VA 3I54A 1XS9A 5J1YA 4HRIA 3CUOA 1YIJI 1CF7A 2V4JC 3RSNA 2NYXA 4C30A 4L9VA 3AG3H 1XSXA 2IS2A 1ONVA 2VODA 2MD0A 5J4VA 5KHDA 1FYMA 2W00A 2XGXA 3EDPA 4OMZA 1BJZA 2OV7A 2QF7A 1IRFA 4CZZA 5A2QK 4BQAA 1XG1A 2JSPA 2LF7A 5E1ZB 3ZQLA 2HQ5A 3D5SC 1PUEE 3BG6A 3CMAI 4XKCA 4U0VA 3B02A 1GDTA 4F7ZA 4QSHA 2Z9OA 3FXQA 2ISYA 4ABZA 3LMMA 1UAAA 3KLOA 1Z67A 4Y15A 2NXNB 3OL3A 2QQ8A 2YSRA 1FIAA 2KPMA 4ESJA 1ZR4A 1LE8B 4CO8A 2BY2A 2D1HA 3FM3A 4ZYEA 1X19A 5K7ZA 4X0GA 2FQ4A 3OYHA 2PMUA 1J75A 2QUFA 2WA0A 5D4RA 5DD8A 1RNLA 3T5XA 4V2GA 2HZTA 1K79A 1HDDC 2EFWA 4QWQA 3IH2A 4IHXA 1GVJA 1UJ8A 5HDNA 2K85A 3K4CA 1IAWA 3O3KA 1ZH5A 3BPXA 4HSRA 5D5XB 1T6SA 1R49A 4NC6A 2W85A 4BNCA 3IC7A 1TWGJ 1LFUP 1JHHA 1ETWA 4JBAA 2TDXA 4BE1A 2X6OA 1MDMA 1FJLA 4UVCA 2E34A 1N77A 2IP2A 1RR7A 1APLC 5GTIC 3CLQA 5D6EA 2AS5F 5KK1A 2G0EA 4V2FA 1IXRC 2BHZA 3ABKH 1ZELA 5D8KB 1MNEA 1O7FA 5HS7A 5DD4A 1YOVB 2QQBA 3IH4A 2EIJH 2O0YA 2LLKA 4U87A 2XPUA 1H8AC 3PIOF 2H8RA 3LSIA 3HYIA 2KRFA 2RREA 4AUXA 5IYDJ 4YRVA 4BBSJ 1JHFA 2HWVA 4Q47A 3HKZN 2XDVA 4HQEA 1XGSA 1OCCH 2BW3A 4ESFA 2ZSHB 3S8PA 1S3JA 2ZNZA 2X6YA 1BA5A 1UMQA 5J40A 2XPVA 3I3LA 2BBYA 1A5JA 1R1UA 3E6MA 2JUGA 2JVHA 2EWNA 4L9JA 1QHHD 3W3CA 2PX9A 4PK4A 3I5UA 2DO7A 2VBXA 3ZMZA 3Q0WA 3H3ZA 1XDSA 4YIIA 1D5VA 2QENA 5KAFC 3BC8A 4UV9A 4HDVA 1OFCX 3OYFA 1V5EA 2L7KA 2ELHA 1YJNI 1JGSA 4XMYA 2JT1A 3WE3A 1QRYA 3M8JA 2XF6A 3WODF 1V5FA 3OY9A 3M1CA 4KMFA 1JUSA 2A6TA 1T98A 1E17A 1ZRDA 3HPHA 3S2DJ 2F5VA 4I02A 3WHCA 1UELB 2MSYA 4L5IA 5CQGA 2WB1A 3PM1A 4D5CA 1PYVA 1O7LA 3LSHA 4IOAF 2L02A 2BXZA 2HDWA 3QPLA 1DUXC 2L2OA 1WJBA 3VSKA 4LD5A 4EJVA 4ZC3A 1P92A 2M5WA 4LFUA 4ON0A 1G3TA 4WK8F 4IRHA 3K6GA 1OR7A 3A01B 3E5QA 4LMYA 5F64A 3ERMA 3ZCOA 1YTYA 2EQRA 2M34A 2XGCA 3C18A 5E3NA 4A3GJ 4A69C 2P7VB 2X48A 5HS9A 3JRGA 4UNOA 3MVPA 5GAEJ 2GZWA 4MLOA 2KFDA 3DKYA 1OCOH 5JI6A 3SJMA 1Z3XA 2ZMEA 4Y3OA 3BG5A 1U0JA 5D4SA 3OYIA 5DV5A 1YJWI 4QPOA 1ZG5A 2MC4A 5LHIA 2HYFA 1MMAA 2LREA 3V7CA 3HOTA 3OOUA 1WKMA 2ID6A 4GRIA 4J00A 4HZFA 5HDGA 3OSFA 2DW4A 3M1EA 3TP0A 4XORA 2VOOA 1RI7A 3LSMA 2XROA 2R4GA 3PO3J 1RKWA 5C44J 2DA6A 3K4MA 2DK5A 2I5UA 3K1NA 4HX8A 2PJRA 3ZQIA 2HEOA 5B1BH 4AD9A 4P1WA 1KONA 2NS8A 5CVRA 3HG9A 2IS4A 2DMPA 2LVSA 3KYLA 3FBIB 2ELKA 3RI4A 3AL0C 2XKPA 2Z33A 2R5YB 2K9QA 2M0MA 1VQOI 2RN7A 3MAJA 4YIRX 3OYNA 2K86A 2VC0A 4BDYA 3REOA 4CUGA 5GPCA 2P5LC 2QEXI 2ID3A 2PMZA 1TW3A 2RNGA 3JRBA 3S1MJ 2R7OA 3CP8A 2DTRA 2VASA 3C2GA 3P7NA 2HGCA 5BQTA 5EGOB 1LDJA 1J5YA 3JAMK 3DXJF 3CMYA 4KT6A 2DQLA 1UHSA 5DUKA 4ZJZA 3UKGA 3LSRA 1B72A 2BEOA 4UUSB 4CCMA 5FRMA 3ECOA 2PEXA 3VYUB 2D5VA 1FBUA 1P6RA 2QSFX 4I76A 2V6EA 4IHSA 4C3JJ 1BI0A 4HX4A 4IQJA 2R7VA 2VQLA 1IC8A 1LQ1A 4W1UA 1ZHFA 3FK6A 2GXBA 4E4HA 5L3GA 3D1NI 3TMOA 2L01A 5L3CA 3KYDB 3H9JA 1HSJA 3K1PA 1VQ8I 3PJRA 1BI1A 3J80K 1RETA 1G59A 4ZTFA 4RAGA 2A6EF 1D0XA 4EJWA 1Z21A 4QLCU 3D5LA 2IJLA 3GTGJ 1GV5A 5D5UB 3HBLA 1X3ZB 3OYLA 1LJ9A 1AKHA 2B0LA 2STWA 2AXLA 1MH3A 2XGDA 1X1AA 2MC3A 1FTZA 1I5ZA 3SDBA 5EDNA 5HOOA 4XLPF 1X58A 2EZIA 4IVNA 3ZMUA 1NK2P 4P96A 2F6CA 4NQWA 2ZJRF 2O8KA 1SD4A 3BJAA 1ZK8A 1MBKA 4M3BA 3H35A 5CLSA 2BVMA 5L3DA 3EPZA 4A5NA 3V7RA 3AL0B 4G6TB 2BGCA 1POGA 4HSTA 1HC8A 3TDZC 4IJAA 4O6JA 2JWTA 3QPTA 1T56A 4CCLA 1Z6RA 5IYBJ 5F6FA 3CESA 1W1WE 2DMNA 5K1YA 1N75A 3EQLF 1Q1HA 2BOLA 4OINF 3M3YJ 2E5ZA 2XRLA 3DEUA 1K6OA 1JTYA 2KMUA 3TO7A 2TCTA 2TRTA 3H5NA 4RAZA 3S3MA 2DI3A 1WQ2A 1FIPA 3W2WA 3BZKA 3I55I 3JREA 1SFXA 4A0XA 2C6YA 2LK2A 5F08A 4XONA 3BG7A 2DA3A 2K9SA 2KIQA 1GVDA 4HLXA 1G3YA 1A6IA 3HOUJ 1MBGA 3D5RC 2M3AA 4DYCA 2XVCA 2MYSA 3G1LA 3K1MA 2DPUA 3S1RJ 1QHGA 1JKQC 4EEFG 5IT9Z 2CW8A 2W84A 2VBYA 3V4GA 4MQ9F 1V4RA 3LSJA 4NC8A 1IN7A 2A5YB 4A3JJ 1EV7A 3U21A 2WAFA 3ZQFA 2R7ZJ 3ZRGA 3GX4X 5K5QA 4XLHA 2STTA 2FJ1A 2L0KA 2ADUA 3ZP5A 2DFEA 3CP2A 2NVXJ 3ZOBA 4BGDA 5A2QZ 2F4OB 2RNJA 2JRMA 3GBGA 2FEZA 3I0TA 3F8NA 3LAJA 4FX4A 3HOSA 3GEZA 4HEA2 1W4MA 4CYCA 5FLXK 4XKWA 1OYIA 3F0CA 4PSXA 2XRNA 3V8LA 4S04A 4A3CJ 1XPXA 3ABMH 1WH7A 3DBLB 1T95A 4A12A 1UCRA 4QTRA 1ZREA 5GAGJ 2CQKA 3CTAA 4OWRB 1BN5A 1GXPA 1S5LC 1J0RA 4M9ZA 4FCYA 5CVJA 4C9YA 1FOYA 1F1ZA 2PFBA 4P5OA 1QO0D 3JCUC 4EVIA 1R9TJ 1A31A 3FXOA 2WBMA 1P9QC 2LBFA 4DYQA 4BE2A 2GA1A 1WHUA 2EIMH 1FY7A 3DTKA 2JPBA 2WAEA 4JK1X 2B9SA 4KMUX 1FBSA 2G9WA 5D5VB 1IW7F 1DP3A 2K40A 3RQIA 3LSGA 2N8GA 2KKOA 3HOYJ 1MJBA 3R60A 2VJJA 5DTDA 2OCEA 2Y30A 5LFAA 4MEYF 1K78B 2A07F 2FE3A 2DLLA 3QQAA 5E20A 2HTSA 1W0TA 4B47A 1BW6A 4A3KJ 1DDNA 3CJRB 3CD6I 2YUSA 3GZ5A 3M8FA 2VB6A 2W57A 2UZKA 4S0HB 5LGUA 4A3EJ 1ZG1A 2R7SA 3QU6A 1CF7B 1S72I 3ESWB 4MGRA 2ZNYA 4M3DA 4OIRF 4EJUA 4HPQA 1JGGA 3OS2A 4XOTA 1DPUA 3QAHA 2GBYA 4BQNA 2LY1A 3ELKA 1XSDA 3W6KB 3ZQ7A 1HSTA 1R4MB 5HLHA 2F5CA 4V19K 2CJJA 1FOKA 3K0LA 3K4BA 2M4KA 3I71A 4M3GA 3TO6A 1OISA 1QVUA 2AO9A 3G1MA 2XUBA 5EYRA 3CDLA 2B7EA 4G9YA 2LP0A 3SZGA 3IAM2 4IPAA 4OU0A 2YS9A 4A6DA 1P4WA 3BQZA 4KISA 4DZPA 4D5FA 3QP6A 3O2PE 1FZPB 3P5JA 2H1KA 3CO7C 3HL2A 3LA3A 2XHKA 3R61A 1Z6TA 2CS3A 3F8BA 1OQYA 2Y48A 2E35A 3CQZJ 3IKVA 2IRFG 2ZXWH 2OTLI 4MTEA 2PQ8A 3BP8A 3DP7A 3GTQJ 3CJTB 2FMYA 1WRJA 4H4KC 4UHTA 2E2HJ 2WY7Q 1P4XA 3OYDA 5EF6A 4I09A 4EQQA 2HI3A 3A03A 3E97A 2W4SA 1J2XA 1S6LA 2M9HA 1W0UA 1Z7LA 2X9DA 3OIOA 3DFGA 1SD7A 1MDMB 2QM3A 3F9KA 1BR1A 2KP6A 3LOCA 4XSXF 2VPLA 2I10A 3FK7A 4XLNF 2HTJA 3OS1A 1ZYRF 3A0BC 4HQMA 3H5AA 4KJZA 2IAIA 4CDGA 3WTXC 4FE7A 1OR7C 4NUBA 3UNGC 2NOGA 1JT6A 2VN2A 4D7MA 3OIPA 2K4JA 3GFJA 5J1RA 2XAJA 3GTMJ 3I58A 3PQJA 1D8KA 4RDUA 3VWBA 1U8RA 2XKOA 4BS9A 3I56I 3L2VA 1TWHJ 1O3SA 5ICCA 1TL8A 2FNAA 2BW3B 4AWXB 5D5WB 5LHGA 1TLHB 3M9AA 3KCCA 1RZ4A 3ZQGA 5HLTA 4U7BA 3LSKA 2ZMEC 5CYVA 3S17J 2ZXIA 4AYBN 4OIOF 4UV8A 4R8HA 1DU6A 2F5FA 4F91B 3OIQA 3CLOA 2DODA 1U9NA 2V7FA 4IHVA 4CCKA 2JZYA 2A5WA 2A05A 3DBHB 4G8XA 5LEKA 1MD0A 2JA8J 4BY1J 2G7HA 3PQKA 1TC3C 1NHAA 5FD6A 3RCOA 1YO5C 1XGNA 3GTPJ 1KU3A 1Y0UA 1USSA 4XR6A 1MJAA 1UHWA 5FKMA 4PJLA 2O6GE 1UFMA 2E1MC 2ME0A 1FP2A 5FRNA 1KGSA 2LR8A 4ZZDA 1MMGA 1IN8A 4I2OA 5EG0A 5HNHA 3I59B 4C3HJ 5GTHC 3EUKL 2FMLA 1LKXA 4D7NA 3BTCA 2LRDA 5EZGA 1ZR2A 2LD5A 3JAMZ 4U0YA 1HKSA 2X6XA 4ASNA 2M0CA 2AXTC 3RTRA 4BHCA 1FSEA 2HXIA 3HHGA 4RB1A 5B1AH 3F8FA 4CXFA 1R7JA 1MMDA 3VODA 1C0WA 3GFLA 1P2FA 4CCJA 4M3FA 3I4NJ 3FF5A 1YIOA 5J47A 4RM3A 5IT9K 2M8GX 3BG3A 3FWEA 3DLLF 3CC7I 5BOXA 5LRSA 5M3FJ 3B73A 4ZYHA 4BKXA 3PSFA 1H9TA 1MBHA 5CVVA 4WX9A 3GZ6A 3J80Z 4E6KG 2DMUA 2DA7A 2M7AA 4N9IA 1HW5A 1Y8RB 2L4AA 4Y4RA 3JRFA 3M4OJ 5E18F 2Z5UA 3EYIA 3RDIA 4EM2A 1MNDA 3LAPA 2HDCA 4N9HA 3HTUA 5E79C 2ZXHA 2LNBA 1Y39A 1SFEA 2ZMEB 1K61A 1N25A 4LOCA 2A68F 4F93B 4RMNA 3J7AY 3AFHA 2E71A 1LFBA 5FJ8J 3OYCA 2P5VA 1K6YA 2M2EA 5KAIC 1ETYA 4YFXF 2R5ZB 4ENJA 3TQNA 1VQMI 3CCEI 4UY8I 3AKZA 2M87A 3M8EA 1YHQI 3CC2I 2CWEA 3ABLH 4I7HA 1T38A 2PJRB 2EA4A 1EJ9A 1ETOA 3FXUA 2KHMA 2MLKA 2E1MB 2VQCA 3NQOA 3VOEA 3CCRI 5F1RA 3ZMSA 3MKZA 4XSZF 4BXFA 3H5RA 2W82A 2QBYA 3OYJA 2P81A 2BVLA 5ICGA 2CSOA 1IZ1A 5EZHA 3K4LA 3ZN0A 1QNTA 3GVAA 4CICA 1K4TA 1EF4A 2V1UA 2F2EA 4BYYA 3PFYA 3SZPA 2WV1A 2W48A 4C3IJ 4MIMA 2RAEA 4G6DA 4M74A 3W2VA 1LPQA 3I64A 1HLVA 4JP0A 1F9NA 3ABUA 5IT3A 2DA2A 2KZVA 1G3SA 4XKVA 4KUMA 3MFKA 2HNHA 1BW5A 4KITB 5E1WA 1B72B 2W25A 5EJCA 5ERIA 3F21A 3S16J 2DA4A 1B9MA 3C1DA 1TQMA 4BXXJ 2VXDA 2L9NA 3V8KA 3KLNA 2Z3YA 5H6RA 1ZN2A 2E19A 2YX7A 6PAXA 2CRGA 3G4SI 2JPCA 3G2BA 3PNVA 1SEUA 1YI2I 4M6VA 5GPAA 4EJOA 1TBXA 2Z99A 4P9FA 3W6VA 3GW2A 3MKWB 2X1DA 1ZTRA 2AHQA 2DFIA 2LDUA 2L54A 2LTPA 2KLOA 3L00A 1R1VA 2EH3A 1AKHB 2DU9A 1R6RA 3VDXA 1YX5A 2VJ5A 4Y13A 4LIUA 3BPVA 3BJOA 3M7GA 5FLXZ 4BQOA 3S3NA 1VFCA 1FNNA 1OYWA 1ULYA 2DMTA 4NQWB 2CUEA 2HOAA 2VQGA 4YFNF 4A3BJ 4M6YA 2DDBA 2R7WA 4NBQA 4M73A 2OF7A 5F0FA 3Q9VA 2KDOA 5GAHJ 4B4CA 2F5DA 3F8CA 3QOEA 1WJCA 2Y0SN 2CO5A 3DPLC 5K7FA 1KYZA 2OZ6A 3L7WA 1Z1DA 1BR4A 3FHZA 5AIQA 3JRDA 4IZZA 4HF1A 3RZDJ 2LH9A 4BE0A 1W36D 1MBFA 1FC3A 3FXLA 4JQFA 4KT5C 2VT2A 4JYKA 4WXCA 2EZHA 5JFRA 1X2MA 1IRXA 2XF5A 4U88A 3DPUA 1KQ8A 3RKXA 2FOWA 4PGHA 5ILSA 3QRFF 2H09A 1FMWA 3AG4H 3LSTA 3ASNH 2L3DA 3KETA 1GXQA 1MJ9A 4F52A 3FIWA 2ESHA 2WC2A 5TRDA 1ODDA 2HKOA 3C7JA 5J4YA 2CH0A 2K3PA 3C3WA 3K9TA 4EGYA 1F43A 2QSHX 2UV1A 5CKTA 5HLGA 1QA6A 1FTTA 2LG4A 1BI3A 4HNUA 3E1SA 3S93A 1SAXA 1I3AA 3QU3A 4BEHA 3VFZA 3J81K 2LMDA 4BH9A 2QKLB 1J59A 1HF0A 2IXSA 1XD7A 2O5RA 4PFOA 2JUCA 3DKXA 3LQQA 1DGWY 2JVGA 3CF2A 3A1YA 1E2XA 2HPMA 4B1RA 1K4SA 1QBJA 2E2IJ 1TP4A 2IPQX 3FMQA 4ZYDA 4CYCB 1D1BA 1S8NA 4DNCA 4PCQA 3UR3C 4X6AJ 1REPC 5E3OA 2JJ7A 1VI0A 4QPQA 1SAUA 3S15J 1EKEA 1ZQ3P 1VQKI 3N05A 1XMXA 2P0WA 2KRCA 4XLAA 2GOMA 1WJ5A 5JHFA 2CUZA 2QQ9A 2PMZN 3VYRB 2XAFA 4DZJA 2O7OA 3F72A 5L3BA 9ANTA 1XSVA 2DT6A 1IV6A 2HPIA 3G3ZA 3RKWA 4A6EA 3HPGA 3QOPA 2V6CA 2LKSA 3K69A 2D2WA 2Y9YA 2OTJI 2VKHA 4ITVA 4RAYA 1JJ8C 3ZQCA 1Z91A 1FP1D 3FDYA 4RAFA 3SYTA 3ML6A 2QCOA 1H9GA 2DDAA 2NOJB 4PSWA 3H9QA 1Y6IA 5F1JA 2X85A 2IVMA 4ZYAA 3FXRA 3WGIA 2HYJA 2DJIA 2V9PA 4HF0A 3L2QA 3GF2A 1IO2A 1GHCA 3HEFA 4MHGA 2V1DA 1RESA 2HDDA 4BHBA 4PJ0C 1T39A 4XM3A 3GYHX 4IXAA 2DN0A 5TJJA 1Z05A 4G7ZF 1MSEC 2HVSA 1EH7A 3FBNB 5ILVA 1STZA 4I98B 4XK4A 2FBHA 1VQLI 4CSWA 3BCAA 1IRZA 3GXOA 3GZNB 3AAFA 4N0BA 3HGYA 1B59A 2IT0A 4KFCA 3BR0A 1YLFA 4JOMA 3WTYC 3ZPLA 2DTZA 2X4HA 4LITA 4LG0A 3S2HJ 3K2AA 3FKIJ 2PI0A 2NS7A 2Y2ZA 1WJDA 1D8JA 2FA5A 1I27A 5E1XA 4CZCA 2ETHA 2FBIA 1G2HA 4XQFA 1IXSB 1WJFA 3V7SA 4AIDA 2ESNA 4GFBA 4I01A 3SHFA 2KRHA 4EM0B 5DEQA 1HQCA 2P4WA 2WTEA 2LC2A 2Y75A 2GIVA 3U1DA 3T0YA 4IHYA 4LG3A 3G71I 5F0CA 5H2FC 5IP6A 2V9VA 1ETVA 1LVAA 1IV8A 3CMMA 4IX7A 1QGPA 4ZDLA 2Z1DA 1V3FA 4M3EA 1JKPC 1J09A 3TOBA 1MSFC 4E70A 1BIAA 2VJ4A 4U7DA 3NWTA 3A0HC 3SFIA 2EPFA 2YU3A 5JVGF 3MZ8A 2HQNA 4L5JA 4AM3A 3TKYA 4L0ZB 4ZZLA 5H20A 1ZAOA 1M1EB 3SEZA 3L9FA 2ZC2A 3BWGA 3QYFA 5K7HA 3Q3SA 4A0ZA 4XRSG 5HVQC 2J5OA 2R7FA 2R92J 2D45A 2H1LA 3K4KA 4RS8A 2V79A 3R4KA 1Z9CA 1ZG3A 2DFFA 2PN6A 2X6WA 3NRVA 4YELA 3VB2A 2V9KA 2FX0A 5HNFA 2JTVA 1VTNC 4U0WA 2CGPA 1OYYA 3SQNA 4PDKA 3GTJJ 4GXOA 2NVUB 1JE8A 2X1EA 3BTIA 2O9LA 4BJTA 4II2A 3A4CA 3MCZA 2E7WA 1TT5B 5TGTA 3NAUA 2K9LA 2UUZA 1RRJA 3RPUA 5B5EC 2GM4A 3C2HA 1S29A 2M4GA 1AOYA 1JKRC 1AA7A 2VI6A 3H9GA 1TNTA 4IEJA 3HOZJ 4E7JA 1SFOJ 1BR2A 2M7BA 2DOAA 4F55A 2V1XA 1K83J 1R4NB 3GTOJ 2EFNA 2XGEA 1UG2A 3HOWJ 2CQXA 2MH2A 5EEGA 2QA4I 3ZMVA 4W97A 1FLIA 5DM7F 3HHHA 2ZFWA 4LGWA 1U5TA 4PZJA 3O6BB 3GCMA 4UVBA 2HVRA 1UHMA 2WADA 3A02A 3ROUA 4RGRA 2GOXB 3WU1B 2UXXA 1FEXA 2B63J 2BV6A 3GFMA 4PJJA 3HJEA 1S7AA 5HDKA 3IP4B 5FGMA 4B8XA 1ETXA 4Y7NJ 1HW2A 1HCRA 4UUTA 3HUGA 3M07A 2CV0A 3CCJI 1HOMA 4S05A 3TOAA 3MD2A 3HIFA 2DJNA 2ACJA 4IL6C 1U78A 2RQPA 1OJLA 1P7JA 2HS5A 1L3LA 2L9VA 3R6SA 2E36A 1RR8C 1R5GA 3CCQI 2XSDC 5EG0B 3DWLE 5C3EJ 1QPIA 1TT0A 2HFHA 1W7PA 3PUBA 4HW0A 1QPMA 4IHTA 1YX3A 2OUMA 4XRMA 1VQ7I 4L18B 2QWWA 3PFIA 2H94A 2WAQN 2XASA 4PJNA 4AVPA 2O03A 1Z7UA 3F3XA 3ISPA 4D0PA 1KA8A 1W36C 2MH9A 3PL8A 1YW9A 5DCMB 3RPQA 3J7YJ 3WHBA 1OCRH 4K2EA 4FHTA 5CJ9A 3COAC 1B4AA 5F0HA 4DGWB 1HA8A 3Q0VA 4NB5A 2K9NA 2XB5A 5FKOA 3F22A 4BBRJ 4MTDA 2H8WA 2LF8A 2KJBA 3LA7A 3L09A 1L0OC 2ELJA 2DAOA 1IJWC 2BZTA 2KIMA 4Q48A 1R23A 2DBBA 4L9TA 4RB3C 2EV0A 1OLTA 3GLLA 4R1HA 2ZJPF 4OAYA 1MZBA 2Y0MA 5CVIA 1XMKA 2VKEA 2F5EA 2UXNA 3WU2C 3WTWC 1IDZA 1Z0XA 2F48A 2O3FA 3RKYA 3HRSA 1QQIA 1P4AA 2DMQA 2F4IA 2ME6A 1BL0A 2CQQA 3CDHA 3EUHA 3K2ZA 4MNUA 2JK3A 3FXMA 4MEXF 2XF7A 1U6GA 3KYCB 3HOXJ 2VE8A 1EH8A 3OYEA 1U2WA 1ZGJA 3IUOA 2JA5J 1MGTA 3R0AA 1ETKA 4RM2A 2ZBKA 1WI3A 1PUFA 1Y8QB 3IL2A 3ZQHA 3Q9SA 3T8TA 1TZLA 4GDFA 3JRCA 1SMYF 4GYGA 5E17F 2M30A 1WFXA 2OU2A 1XTAA 1XGOA 1NG7A 3PIPF 4HOBA 2JSCA 4LIVA 1BC8C 1WWXA 2EFQA 4UB8C 1YITI 1VQNI 4BACA 3T1BA 4BL0B 2JN6A 2EJRA 4A2UA 3HXLA 1OCZH 3HTSB 2VQHA 2L5QA 2L7ZA 3HGGA 3DPTA 1T33A 2JMWA 4KDPA 2FUG2 4BU2A 1KZHA 1D1CA 2FRHA 3OR1C 4KICA 3RYPA 1R58A 2K27A 3GO5A 2E1CA 4RBOA 1JT0A 2K4BA 1FOWA 5AIPA 2Q2EA 2X1CA 3HB9A 1SC7A 2E60A 3ECHA 3P9KA 4CHUA 2FBKA 2DOEA 2GIZA 3H3VK 1X1CA 1SMTA 4EJTA 2IA0A 3U9GA 1YYVA 1FOXA 3J81Z 4QIWN 1ENHA 5K5OA 1D3YA 1VNDA 1IN4A 3HDDA 1B1BA 1E3OC 3HRUA 1LB2A 4HAMA 3KZZA
chains in the Genus database with same CATH topology
5BMZA 2VC1A 3WGGA 4YIFA 5FD5A 1TQIA 1YS7A 4ESBA 1T2KA 2QYOA 2IA2A 1XCBA 1K7AA 3KEQA 4WWCA 4LB6B 1O3QA 3ABTA 3KP7A 1IN6A 3NEUA 1KYWA 1FT9A 1QZYA 3MZHA 4KYWA 1HKQA 4M71A 3W6JB 1BC7C 1YFHA 2GQQA 2PBIA 2PMHA 2RKHA 2XAGA 1IXCA 2M8EA 1KU7A 3KP5A 4IRGA 4WCGA 2MBFA 1KU9A 1X3UA 4LK1F 4WXHA 5FFZA 1H0MA 1OMIA 3ZMTA 2GWRA 2OQRA 1ZLKA 2A69F 1YW8A 4KN7X 1DPRA 2EV6A 3CO6C 1XMAA 3MWMA 5HLIA 2CFXA 2VONA 2GXGA 5LGNA 1PDNC 1T0FA 2OQGA 3WU0A 5H6QA 2OA4A 2XIGA 1XN7A 3RJPA 1FBQA 4UUVA 4YG2F 2EFOA 5E8IA 2P5KA 5FO5A 4FT8A 3KP2A 3S2WA 2MLGA 3IWZA 1OPCA 2ZJ2A 3E6CC 3QP5A 4RGXA 3P9IA 3IRRA 1FSHA 2DK8A 5DYMA 1SD6A 1FX7A 3WTUC 3F8MA 2KJCA 3FM5A 1IF1A 3KE2A 1LNWA 3KEOA 3EYYA 2DPDA 4ENMA 3KP4A 1LDDA 3IWFA 4HX7A 3G73A 1FYKA 4HV6A 2BYVE 2WWYA 1WI9A 2O8XA 2VBZA 1TTYA 4HDUA 4LLNA 3CUQA 3JSOA 2PG4A 1AWCA 1IN5A 1QZZA 1SFUA 3N4MA 1OKRA 4R79A 2MA3A 2XAQA 3I53A 4UXNA 1ZGAA 1YS6A 2EV5A 3SZTA 1G6NA 5J8CA 1I6XA 2Q0OA 2EB7A 3E5UA 2IA1A 4LG0B 3GWZA 3BOQA 5ICFA 2G7UA 4PGGA 2KIFA 3F6OA 1U5TC 3F6VA 4KIGA 5LHHA 2ZCWA 4AIKA 2RVCA 3I59A 2QLZA 3GLXA 5HS8A 5KVRA 2A6HF 1W5TA 4M6XA 1HKTA 2VE9A 3LA2A 5CVUA 1R36A 2RV8A 5LEJA 3T8RA 4Q5SF 4FX0A 4LJZF 4M72A 4IRIA 1BJAA 1FYLA 5BPIA 2P6TA 5E8GA 1XDUA 2XV4S 2GAUA 3EETA 4XRFA 1PP7U 2HQRA 1S7OA 3BJ6A 4MQVA 4LB5A 2OZUA 5DDGA 5L3FA 3ZMDA 1B6AA 5D8LB 2HKXA 2IW5A 1RIOH 2E7XA 4KIFA 2YPRA 4LLGF 1XGMA 1LEAA 3RIRA 4ZH4F 1R1TA 5J6XA 1KQ0A 5J8FA 1U5TB 4A0YA 2X0LA 2DT5A 1MKMA 5BS6A 1W5SA 1YW7A 2FNPA 4G6QA 3JTHA 5ICEA 2PJPA 3OV8A 2PLYA 2K7LA 4LK0F 4O5VA 3KP6A 4ETSA 3TDUC 2FU4A 3DQVC 3RYRA 3HRTA 2UWMA 2ISZA 4RGSA 2YX4A 5ILUA 4CGZA 3KFWX 5JVTA 1IRGA 1W7PB 4B09A 2P8TA 2CW0F 1ZLJA 5LBQA 3HSRA 1ON1A 3FMSA 3FX3A 1O3TA 1I1GA 4YFKF 4RGUA 5L3EA 2H6CA 1TW2A 3I4PA 4HAMA 4CYDA 1IUYA 3IKTA 1U3EM 2M45A 2FSWA 2XAHA 2FF4A 1BIBA 4I0AA 2OBPA 1RUNA 2HR3A 4ZYGA 2HYGD 2A3SA 3MZYA 1LDKB 2LSOA 2ZXJA 2R7DA 4KN4X 3ULQB 2D1VA 2Q8KA 2WV0A 5ED4A 5K5RA 4GO1A 3HRMA 1F5TA 3KZYA 4XBFA 3WTSC 2P7CB 4IF4A 2J5PA 2RC4A 3HSFA 3QPHA 1XB4A 1KU2A 4KIBA 3WTZA 4HA8A 2VOPA 1A04A 4TV7A 2COMA 1KQ9A 1I1SA 4Q4ZF 3V8JA 4EMSA 3H3UA 5JR3A 4Y17A 2EA2A 4HBLA 5LGTA 4KNYA 3LFKA 5DCFA 4HF2A 2A61A 2VXZA 4RB0A 4G7OF 2QQAA 4L0YB 3DV8A 2QVOA 2CYYA 4A5MA 1F4KA 4HV5A 1LEBA 2GA2A 4OIQF 3P9CA 2YR2A 2KIUA 1ON2A 1TQPA 4GCVA 1R22A 3MQ0A 4AIJA 3WE2A 4DQ2A 2OD5A 4GGGA 3E5XA 2LKPA 4OOIA 1BBYA 3L2CA 3FZVA 1J7KA 3Q5FA 3DF8A 5AONA 2RDPA 4BHPA 2CG4A 3SFZA 3WTVC 2HOEA 3BDDA 3BY6A 3E6BA 3SXYA 2BE5F 3WGHA 3ZN1A 5DUIA 3N97A 5BPDA 2H6BA 1FPQA 3MEXA 4G7HF 3R0JA 2FQ3A 4P55A 2EFPA 2VBWA 4G94A 1BM9A 3H92A 3CUQC 4LLLA 1R00A 2P6SA 1USTA 2K02A 4ENKA 2RGVA 5D6FA 4EGZA 3WTTC 2H27A 1G4DA 3J7AO 4ENNA 3CJNA 4BXUA 1YG2A 4AIHA 4H0EA 4KA4A 4NHJA 2MD5A 2E1NA 5FFXA 3D0SA 2QBYB 1O57A 2QZ8A 2NRAC 2VT3A 1W7PD 3BROA 1PP8F 3VEPA 3GUDA 1ZRFA 1TNSA 1FWZA 2EK5A 3LWFA 4O3MA 3KP3A 1XCVA 3HSEA 1HXDA 2M1BA 4HYEA 2FXAA 3TGNA 4HLYA 2NNYA 4RB2C 1O3RA 3JSPA 1UB9A 2O61A 4Z2YA 1RUOA 3CUQB 3LQRA 2ZKZA 2JRTA 3WG9A 2NS0A 3GFIA 4P9UA 3IRQA 2ZO4A 3FMRA 3F23A 2R3SA 1ZRCA 2L4MA 2NAZA 5EEHA 1DP7P 4EV0A 2FOKA 3JW4A 3IHUA 1R5HA 4WXDA 1EH6A 5LRRA 3BZ6A 1HW1A 1J9IA 4BAYA 1B9NA 4M9SA 2OAZA 5LLQA 3JTGA 4UVAA 3TO9A 1ZARA 3E6DA 4WF2A 1BOAA 3DKWA 3ERED 4I0BA 4OIPF 4M9XA 3OOPA 5JHUA 4GYIA 4L9NA 1SD5A 1G3WA 1HBXG 3U2RA 1JXSA 2NNNA 5DCMA 1BI2A 4EM1A 1YQAA 1CGPA 1WSUA 1K78A 2W24A 2DQRA 4OMYA 3E3VA 3I54A 3CUOA 1CF7A 2NYXA 4L9VA 1XSXA 1ONVA 2VODA 1FYMA 2XGXA 3EDPA 4OMZA 1IRFA 4CZZA 5A2QK 4BQAA 2LF7A 5E1ZB 1PUEE 4U0VA 3B02A 4F7ZA 2Z9OA 3FXQA 2ISYA 3KLOA 4Y15A 2YSRA 4ESJA 4CO8A 2D1HA 3FM3A 4ZYEA 2PMUA 1J75A 2QUFA 5D4RA 5DD8A 1RNLA 3T5XA 2HZTA 1K79A 2EFWA 4QWQA 1GVJA 5HDNA 1IAWA 3O3KA 1ZH5A 3BPXA 5D5XB 1T6SA 2W85A 4BNCA 3IC7A 1JHHA 4JBAA 2TDXA 1MDMA 4UVCA 2IP2A 5D6EA 2AS5F 5KK1A 1IXRC 5D8KB 1O7FA 5HS7A 5DD4A 2QQBA 2O0YA 3HYIA 2KRFA 1JHFA 2HWVA 4Q47A 4HQEA 1XGSA 4ESFA 1S3JA 2ZNZA 2BBYA 1R1UA 3E6MA 4L9JA 2EWNA 3I5UA 2DO7A 2VBXA 3ZMZA 4YIIA 3H3ZA 1XDSA 1D5VA 2QENA 4UV9A 4HDVA 2ELHA 1JGSA 2JT1A 3WE3A 3WODF 4KMFA 1T98A 1E17A 1ZRDA 4I02A 4L5IA 1O7LA 2L02A 1DUXC 4LD5A 4EJVA 4WK8F 1P92A 2M5WA 4LFUA 1G3TA 4ON0A 4IRHA 1OR7A 3E5QA 4LMYA 5F64A 1YTYA 3C18A 2P7VB 5HS9A 4UNOA 2GZWA 5JI6A 2ZMEA 5D4SA 5DV5A 1ZG5A 5LHIA 2HYFA 3V7CA 3HOTA 1WKMA 4HZFA 5HDGA 2DW4A 3M1EA 2VOOA 1RI7A 2XROA 2DK5A 3K1NA 4HX8A 2HEOA 4AD9A 5CVRA 3RI4A 2XKPA 2Z33A 2RN7A 3MAJA 2K86A 2VC0A 3REOA 2P5LC 1TW3A 2DTRA 3P7NA 2HGCA 5BQTA 1LDJA 1J5YA 3JAMK 3DXJF 2DQLA 5DUKA 2BEOA 3ECOA 2PEXA 1FBUA 1P6RA 4IHSA 1BI0A 4HX4A 1LQ1A 1ZHFA 2GXBA 5L3GA 2L01A 5L3CA 3K1PA 1HSJA 1BI1A 3J80K 2A6EF 4EJWA 4QLCU 3D5LA 2IJLA 5D5UB 1LJ9A 2B0LA 2STWA 2AXLA 2MC3A 1I5ZA 5HOOA 4XLPF 4IVNA 3ZMUA 4P96A 4NQWA 1SD4A 3BJAA 5CLSA 5L3DA 4A5NA 3V7RA 2BGCA 3TDZC 4IJAA 4O6JA 3QPTA 1Z6RA 5F6FA 5K1YA 3EQLF 1Q1HA 4OINF 3DEUA 1K6OA 3TO7A 4RAZA 2DI3A 1WQ2A 1SFXA 4A0XA 2C6YA 4HLXA 1G3YA 2XVCA 3K1MA 2DPUA 5IT9Z 2W84A 2VBYA 3V4GA 4MQ9F 1V4RA 1IN7A 2A5YB 1EV7A 3GX4X 5K5QA 2STTA 2ADUA 3ZP5A 5A2QZ 2RNJA 2FEZA 3I0TA 3F8NA 3LAJA 4FX4A 3HOSA 3GEZA 1W4MA 5FLXK 1OYIA 2XRNA 3V8LA 4S04A 4A12A 1UCRA 1ZREA 2CQKA 3CTAA 1BN5A 1GXPA 1J0RA 4M9ZA 5CVJA 1F1ZA 2PFBA 4P5OA 1QO0D 4EVIA 2GA1A 1FY7A 2JPBA 4JK1X 4KMUX 1FBSA 2G9WA 5D5VB 1IW7F 2KKOA 1MJBA 3R60A 4MEYF 1K78B 2A07F 2FE3A 2DLLA 5E20A 2HTSA 1DDNA 3GZ5A 3M8FA 2W57A 2UZKA 5LGUA 1ZG1A 3QU6A 1CF7B 4MGRA 2ZNYA 4OIRF 4EJUA 1DPUA 3QAHA 3ELKA 1XSDA 3W6KB 3ZQ7A 1HSTA 5HLHA 2F5CA 1FOKA 3K0LA 3I71A 3TO6A 2XUBA 4G9YA 4IPAA 4OU0A 4A6DA 1P4WA 3QP6A 3O2PE 1FZPB 3CO7C 3LA3A 2XHKA 3R61A 1Z6TA 3F8BA 2Y48A 3IKVA 2IRFG 4MTEA 2PQ8A 3BP8A 3DP7A 2FMYA 1WRJA 4UHTA 1P4XA 4I09A 4EQQA 3E97A 1J2XA 1S6LA 3DFGA 1SD7A 1MDMB 2QM3A 4XSXF 4XLNF 2HTJA 1ZYRF 4HQMA 4CDGA 3WTXC 2VN2A 2K4JA 3GFJA 2XAJA 3I58A 3PQJA 1D8KA 1U8RA 2XKOA 1O3SA 5ICCA 2FNAA 4AWXB 5D5WB 5LHGA 1TLHB 3M9AA 3KCCA 1RZ4A 4U7BA 5CYVA 4OIOF 4UV8A 4R8HA 2F5FA 3CLOA 2JZYA 4G8XA 5LEKA 1MD0A 2G7HA 3PQKA 1NHAA 5FD6A 1YO5C 1XGNA 1KU3A 1Y0UA 1USSA 1MJAA 1UHWA 2O6GE 1UFMA 1FP2A 1KGSA 4ZZDA 1IN8A 4I2OA 3I59B 2FMLA 3JAMZ 4U0YA 1HKSA 4ASNA 3RTRA 4BHCA 1FSEA 3HHGA 4RB1A 3F8FA 4CXFA 1R7JA 3VODA 1C0WA 3GFLA 1P2FA 3FF5A 1YIOA 5IT9K 3FWEA 5BOXA 5LRSA 3B73A 4ZYHA 1H9TA 5CVVA 4WX9A 3GZ6A 3J80Z 4N9IA 1HW5A 2L4AA 5E18F 2Z5UA 3EYIA 3RDIA 4EM2A 3LAPA 2HDCA 4N9HA 3HTUA 2LNBA 1SFEA 2ZMEB 2A68F 2P5VA 4YFXF 4ENJA 3TQNA 2M87A 3M8EA 2CWEA 4I7HA 1T38A 2EA4A 3FXUA 2MLKA 3NQOA 3VOEA 5F1RA 3ZMSA 4XSZF 2QBYA 5ICGA 2CSOA 1IZ1A 3ZN0A 1QNTA 3GVAA 4CICA 2V1UA 2F2EA 4BYYA 3SZPA 4G6DA 4M74A 3I64A 1F9NA 3ABUA 5IT3A 1G3SA 4KUMA 3MFKA 5E1WA 2W25A 5ERIA 3F21A 1B9MA 3C1DA 1TQMA 3V8KA 3KLNA 2Z3YA 5H6RA 1ZN2A 2YX7A 6PAXA 2JPCA 4EJOA 1TBXA 2Z99A 4P9FA 3GW2A 2DFIA 2LDUA 2L54A 3L00A 1R1VA 2DU9A 4Y13A 3BPVA 3BJOA 3M7GA 5FLXZ 1FNNA 1OYWA 1ULYA 4YFNF 4M6YA 4M73A 3Q9VA 2F5DA 3F8CA 2CO5A 3DPLC 1KYZA 2OZ6A 3L7WA 1Z1DA 3FHZA 5AIQA 4HF1A 1FC3A 4JQFA 4KT5C 2VT2A 4WXCA 5JFRA 4U88A 1KQ8A 3RKXA 4PGHA 5ILSA 3QRFF 2H09A 3LSTA 2L3DA 3KETA 1GXQA 1MJ9A 2ESHA 2WC2A 5TRDA 1ODDA 2HKOA 3C7JA 3C3WA 3K9TA 4EGYA 5HLGA 1BI3A 1SAXA 3QU3A 3VFZA 3J81K 4BH9A 1J59A 1XD7A 3LQQA 1E2XA 1QBJA 3FMQA 2IPQX 4ZYDA 1S8NA 4DNCA 4PCQA 1REPC 2QQ9A 2XAFA 5L3BA 3F72A 1XSVA 3G3ZA 3RKWA 4A6EA 3QOPA 2V6CA 3K69A 2D2WA 4RAYA 1Z91A 1FP1D 3ML6A 1H9GA 2IVMA 3WGIA 3FXRA 4HF0A 3GF2A 1GHCA 4MHGA 2V1DA 4BHBA 1T39A 3GYHX 4IXAA 5TJJA 4G7ZF 1Z05A 1EH7A 5ILVA 1STZA 4I98B 2FBHA 3GXOA 3AAFA 4N0BA 1B59A 2IT0A 4KFCA 1YLFA 3WTYC 3ZPLA 2X4HA 4LG0A 2PI0A 1D8JA 2FA5A 1I27A 5E1XA 2ETHA 2FBIA 1IXSB 3V7SA 2ESNA 4I01A 3SHFA 4EM0B 5DEQA 1HQCA 2P4WA 2WTEA 2Y75A 2GIVA 3U1DA 3T0YA 2V9VA 1LVAA 1QGPA 1V3FA 3TOBA 4E70A 1BIAA 4U7DA 2YU3A 2HQNA 4L5JA 3TKYA 4L0ZB 4ZZLA 5H20A 1ZAOA 3L9FA 3BWGA 4A0ZA 5HVQC 2J5OA 2R7FA 2D45A 4RS8A 2V79A 3R4KA 1Z9CA 1ZG3A 2PN6A 3NRVA 3VB2A 2JTVA 1VTNC 4U0WA 2CGPA 1OYYA 3SQNA 4PDKA 4GXOA 1JE8A 3MCZA 2E7WA 3RPUA 1S29A 1AOYA 1TNTA 2V1XA 2EFNA 2MH2A 5EEGA 3ZMVA 1FLIA 3HHHA 2ZFWA 4LGWA 1U5TA 4PZJA 3O6BB 4UVBA 1UHMA 3ROUA 4RGRA 3WU1B 2UXXA 2BV6A 3GFMA 1S7AA 5HDKA 5FGMA 4B8XA 1HW2A 3HUGA 4S05A 3TOAA 3HIFA 2ACJA 1U78A 2RQPA 2HS5A 1L3LA 3R6SA 1R5GA 2HFHA 4HW0A 1W7PA 1QPMA 4IHTA 4L18B 2QWWA 3PFIA 2H94A 4AVPA 2XASA 2O03A 1Z7UA 3F3XA 3ISPA 4D0PA 1KA8A 2MH9A 1YW9A 5DCMB 3RPQA 4K2EA 4FHTA 5CJ9A 3COAC 1B4AA 4NB5A 3F22A 4MTDA 2LF8A 2KJBA 3LA7A 3L09A 1L0OC 2DAOA 2KIMA 4Q48A 1R23A 2DBBA 4L9TA 4RB3C 2EV0A 4R1HA 1MZBA 2Y0MA 5CVIA 1XMKA 2F5EA 2UXNA 3WTWC 2O3FA 3RKYA 3HRSA 1QQIA 1P4AA 3CDHA 3EUHA 3K2ZA 4MNUA 4MEXF 1U6GA 2VE8A 1EH8A 1U2WA 1ZGJA 1MGTA 3R0AA 2ZBKA 3IL2A 3Q9SA 3T8TA 1SMYF 4GYGA 5E17F 2M30A 2OU2A 1XGOA 4HOBA 2JSCA 1BC8C 1WWXA 2EFQA 3T1BA 2EJRA 4A2UA 3HTSB 3DPTA 4KDPA 2FRHA 4KICA 3RYPA 1R58A 2K27A 3GO5A 2E1CA 2K4BA 5AIPA 2Q2EA 3ECHA 3P9KA 4CHUA 2FBKA 1SMTA 4EJTA 2IA0A 3U9GA 1YYVA 3J81Z 5K5OA 1D3YA 1IN4A 1B1BA 3HRUA 1LB2A 5FB2A 3KZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMZ A;  2VC1 A;  3WGG A;  4YIF A;  5FD5 A;  1TQI A;  1YS7 A;  4ESB A;  1T2K A;  2QYO A;  2IA2 A;  1XCB A;  1K7A A;  3KEQ A;  4WWC A;  4LB6 B;  1O3Q A;  3ABT A;  3KP7 A;  1IN6 A;  3NEU A;  1KYW A;  1FT9 A;  1QZY A;  3MZH A;  4KYW A;  1HKQ A;  4M71 A;  3W6J B;  1BC7 C;  1YFH A;  2GQQ A;  2PBI A;  2PMH A;  2RKH A;  2XAG A;  1IXC A;  2M8E A;  1KU7 A;  3KP5 A;  4IRG A;  4WCG A;  2MBF A;  1KU9 A;  1X3U A;  4LK1 F;  4WXH A;  5FFZ A;  1H0M A;  1OMI A;  3ZMT A;  2GWR A;  2OQR A;  1ZLK A;  2A69 F;  1YW8 A;  4KN7 X;  1DPR A;  2EV6 A;  3CO6 C;  1XMA A;  3MWM A;  5HLI A;  2CFX A;  2VON A;  2GXG A;  5LGN A;  1PDN C;  1T0F A;  2OQG A;  3WU0 A;  5H6Q A;  2OA4 A;  2XIG A;  1XN7 A;  3RJP A;  1FBQ A;  4UUV A;  4YG2 F;  2EFO A;  5E8I A;  2P5K A;  5FO5 A;  4FT8 A;  3KP2 A;  3S2W A;  2MLG A;  3IWZ A;  1OPC A;  2ZJ2 A;  3E6C C;  3QP5 A;  4RGX A;  3P9I A;  3IRR A;  1FSH A;  2DK8 A;  5DYM A;  1SD6 A;  1FX7 A;  3WTU C;  3F8M A;  2KJC A;  3FM5 A;  1IF1 A;  3KE2 A;  1LNW A;  3KEO A;  3EYY A;  2DPD A;  4ENM A;  3KP4 A;  1LDD A;  3IWF A;  4HX7 A;  3G73 A;  1FYK A;  4HV6 A;  2BYV E;  2WWY A;  1WI9 A;  2O8X A;  2VBZ A;  1TTY A;  4HDU A;  4LLN A;  3CUQ A;  3JSO A;  2PG4 A;  1AWC A;  1IN5 A;  1QZZ A;  1SFU A;  3N4M A;  1OKR A;  4R79 A;  2MA3 A;  2XAQ A;  3I53 A;  4UXN A;  1ZGA A;  1YS6 A;  2EV5 A;  3SZT A;  1G6N A;  5J8C A;  1I6X A;  2Q0O A;  2EB7 A;  3E5U A;  2IA1 A;  4LG0 B;  3GWZ A;  3BOQ A;  5ICF A;  2G7U A;  4PGG A;  2KIF A;  3F6O A;  1U5T C;  3F6V A;  4KIG A;  5LHH A;  2ZCW A;  4AIK A;  2RVC A;  3I59 A;  2QLZ A;  3GLX A;  5HS8 A;  5KVR A;  2A6H F;  1W5T A;  4M6X A;  1HKT A;  2VE9 A;  3LA2 A;  5CVU A;  1R36 A;  2RV8 A;  5LEJ A;  3T8R A;  4Q5S F;  4FX0 A;  4LJZ F;  4M72 A;  4IRI A;  1BJA A;  1FYL A;  5BPI A;  2P6T A;  5E8G A;  1XDU A;  2XV4 S;  2GAU A;  3EET A;  4XRF A;  1PP7 U;  2HQR A;  1S7O A;  3BJ6 A;  4MQV A;  4LB5 A;  2OZU A;  5DDG A;  5L3F A;  3ZMD A;  1B6A A;  5D8L B;  2HKX A;  2IW5 A;  1RIO H;  2E7X A;  4KIF A;  2YPR A;  4LLG F;  1XGM A;  1LEA A;  3RIR A;  4ZH4 F;  1R1T A;  5J6X A;  1KQ0 A;  5J8F A;  1U5T B;  4A0Y A;  2X0L A;  2DT5 A;  1MKM A;  5BS6 A;  1W5S A;  1YW7 A;  2FNP A;  4G6Q A;  3JTH A;  5ICE A;  2PJP A;  3OV8 A;  2PLY A;  2K7L A;  4LK0 F;  4O5V A;  3KP6 A;  4ETS A;  3TDU C;  2FU4 A;  3DQV C;  3RYR A;  3HRT A;  2UWM A;  2ISZ A;  4RGS A;  2YX4 A;  5ILU A;  4CGZ A;  3KFW X;  5JVT A;  1IRG A;  1W7P B;  4B09 A;  2P8T A;  2CW0 F;  1ZLJ A;  5LBQ A;  3HSR A;  1ON1 A;  3FMS A;  3FX3 A;  1O3T A;  1I1G A;  4YFK F;  4RGU A;  5L3E A;  2H6C A;  1TW2 A;  3I4P A;  4HAM A;  4CYD A;  1IUY A;  3IKT A;  1U3E M;  2M45 A;  2FSW A;  2XAH A;  2FF4 A;  1BIB A;  4I0A A;  2OBP A;  1RUN A;  2HR3 A;  4ZYG A;  2HYG D;  2A3S A;  3MZY A;  1LDK B;  2LSO A;  2ZXJ A;  2R7D A;  4KN4 X;  3ULQ B;  2D1V A;  2Q8K A;  2WV0 A;  5ED4 A;  5K5R A;  4GO1 A;  3HRM A;  1F5T A;  3KZY A;  4XBF A;  3WTS C;  2P7C B;  4IF4 A;  2J5P A;  2RC4 A;  3HSF A;  3QPH A;  1XB4 A;  1KU2 A;  4KIB A;  3WTZ A;  4HA8 A;  2VOP A;  1A04 A;  4TV7 A;  2COM A;  1KQ9 A;  1I1S A;  4Q4Z F;  3V8J A;  4EMS A;  3H3U A;  5JR3 A;  4Y17 A;  2EA2 A;  4HBL A;  5LGT A;  4KNY A;  3LFK A;  5DCF A;  4HF2 A;  2A61 A;  2VXZ A;  4RB0 A;  4G7O F;  2QQA A;  4L0Y B;  3DV8 A;  2QVO A;  2CYY A;  4A5M A;  1F4K A;  4HV5 A;  1LEB A;  2GA2 A;  4OIQ F;  3P9C A;  2YR2 A;  2KIU A;  1ON2 A;  1TQP A;  4GCV A;  1R22 A;  3MQ0 A;  4AIJ A;  3WE2 A;  4DQ2 A;  2OD5 A;  4GGG A;  3E5X A;  2LKP A;  4OOI A;  1BBY A;  3L2C A;  3FZV A;  1J7K A;  3Q5F A;  3DF8 A;  5AON A;  2RDP A;  4BHP A;  2CG4 A;  3SFZ A;  3WTV C;  2HOE A;  3BDD A;  3BY6 A;  3E6B A;  3SXY A;  2BE5 F;  3WGH A;  3ZN1 A;  5DUI A;  3N97 A;  5BPD A;  2H6B A;  1FPQ A;  3MEX A;  4G7H F;  3R0J A;  2FQ3 A;  4P55 A;  2EFP A;  2VBW A;  4G94 A;  1BM9 A;  3H92 A;  3CUQ C;  4LLL A;  1R00 A;  2P6S A;  1UST A;  2K02 A;  4ENK A;  2RGV A;  5D6F A;  4EGZ A;  3WTT C;  2H27 A;  1G4D A;  3J7A O;  4ENN A;  3CJN A;  4BXU A;  1YG2 A;  4AIH A;  4H0E A;  4KA4 A;  4NHJ A;  2MD5 A;  2E1N A;  5FFX A;  3D0S A;  2QBY B;  1O57 A;  2QZ8 A;  2NRA C;  2VT3 A;  1W7P D;  3BRO A;  1PP8 F;  3VEP A;  3GUD A;  1ZRF A;  1TNS A;  1FWZ A;  2EK5 A;  3LWF A;  4O3M A;  3KP3 A;  1XCV A;  3HSE A;  1HXD A;  2M1B A;  4HYE A;  2FXA A;  3TGN A;  4HLY A;  2NNY A;  4RB2 C;  1O3R A;  3JSP A;  1UB9 A;  2O61 A;  4Z2Y A;  1RUO A;  3CUQ B;  3LQR A;  2ZKZ A;  2JRT A;  3WG9 A;  2NS0 A;  3GFI A;  4P9U A;  3IRQ A;  2ZO4 A;  3FMR A;  3F23 A;  2R3S A;  1ZRC A;  2L4M A;  2NAZ A;  5EEH A;  1DP7 P;  4EV0 A;  2FOK A;  3JW4 A;  3IHU A;  1R5H A;  4WXD A;  1EH6 A;  5LRR A;  3BZ6 A;  1HW1 A;  1J9I A;  4BAY A;  1B9N A;  4M9S A;  2OAZ A;  5LLQ A;  3JTG A;  4UVA A;  3TO9 A;  1ZAR A;  3E6D A;  4WF2 A;  1BOA A;  3DKW A;  3ERE D;  4I0B A;  4OIP F;  4M9X A;  3OOP A;  5JHU A;  4GYI A;  4L9N A;  1SD5 A;  1G3W A;  1HBX G;  3U2R A;  1JXS A;  2NNN A;  5DCM A;  1BI2 A;  4EM1 A;  1YQA A;  1CGP A;  1WSU A;  1K78 A;  2W24 A;  2DQR A;  4OMY A;  3E3V A;  3I54 A;  3CUO A;  1CF7 A;  2NYX A;  4L9V A;  1XSX A;  1ONV A;  2VOD A;  1FYM A;  2XGX A;  3EDP A;  4OMZ A;  1IRF A;  4CZZ A;  5A2Q K;  4BQA A;  2LF7 A;  5E1Z B;  1PUE E;  4U0V A;  3B02 A;  4F7Z A;  2Z9O A;  3FXQ A;  2ISY A;  3KLO A;  4Y15 A;  2YSR A;  4ESJ A;  4CO8 A;  2D1H A;  3FM3 A;  4ZYE A;  2PMU A;  1J75 A;  2QUF A;  5D4R A;  5DD8 A;  1RNL A;  3T5X A;  2HZT A;  1K79 A;  2EFW A;  4QWQ A;  1GVJ A;  5HDN A;  1IAW A;  3O3K A;  1ZH5 A;  3BPX A;  5D5X B;  1T6S A;  2W85 A;  4BNC A;  3IC7 A;  1JHH A;  4JBA A;  2TDX A;  1MDM A;  4UVC A;  2IP2 A;  5D6E A;  2AS5 F;  5KK1 A;  1IXR C;  5D8K B;  1O7F A;  5HS7 A;  5DD4 A;  2QQB A;  2O0Y A;  3HYI A;  2KRF A;  1JHF A;  2HWV A;  4Q47 A;  4HQE A;  1XGS A;  4ESF A;  1S3J A;  2ZNZ A;  2BBY A;  1R1U A;  3E6M A;  4L9J A;  2EWN A;  3I5U A;  2DO7 A;  2VBX A;  3ZMZ A;  4YII A;  3H3Z A;  1XDS A;  1D5V A;  2QEN A;  4UV9 A;  4HDV A;  2ELH A;  1JGS A;  2JT1 A;  3WE3 A;  3WOD F;  4KMF A;  1T98 A;  1E17 A;  1ZRD A;  4I02 A;  4L5I A;  1O7L A;  2L02 A;  1DUX C;  4LD5 A;  4EJV A;  4WK8 F;  1P92 A;  2M5W A;  4LFU A;  1G3T A;  4ON0 A;  4IRH A;  1OR7 A;  3E5Q A;  4LMY A;  5F64 A;  1YTY A;  3C18 A;  2P7V B;  5HS9 A;  4UNO A;  2GZW A;  5JI6 A;  2ZME A;  5D4S A;  5DV5 A;  1ZG5 A;  5LHI A;  2HYF A;  3V7C A;  3HOT A;  1WKM A;  4HZF A;  5HDG A;  2DW4 A;  3M1E A;  2VOO A;  1RI7 A;  2XRO A;  2DK5 A;  3K1N A;  4HX8 A;  2HEO A;  4AD9 A;  5CVR A;  3RI4 A;  2XKP A;  2Z33 A;  2RN7 A;  3MAJ A;  2K86 A;  2VC0 A;  3REO A;  2P5L C;  1TW3 A;  2DTR A;  3P7N A;  2HGC A;  5BQT A;  1LDJ A;  1J5Y A;  3JAM K;  3DXJ F;  2DQL A;  5DUK A;  2BEO A;  3ECO A;  2PEX A;  1FBU A;  1P6R A;  4IHS A;  1BI0 A;  4HX4 A;  1LQ1 A;  1ZHF A;  2GXB A;  5L3G A;  2L01 A;  5L3C A;  3K1P A;  1HSJ A;  1BI1 A;  3J80 K;  2A6E F;  4EJW A;  4QLC U;  3D5L A;  2IJL A;  5D5U B;  1LJ9 A;  2B0L A;  2STW A;  2AXL A;  2MC3 A;  1I5Z A;  5HOO A;  4XLP F;  4IVN A;  3ZMU A;  4P96 A;  4NQW A;  1SD4 A;  3BJA A;  5CLS A;  5L3D A;  4A5N A;  3V7R A;  2BGC A;  3TDZ C;  4IJA A;  4O6J A;  3QPT A;  1Z6R A;  5F6F A;  5K1Y A;  3EQL F;  1Q1H A;  4OIN F;  3DEU A;  1K6O A;  3TO7 A;  4RAZ A;  2DI3 A;  1WQ2 A;  1SFX A;  4A0X A;  2C6Y A;  4HLX A;  1G3Y A;  2XVC A;  3K1M A;  2DPU A;  5IT9 Z;  2W84 A;  2VBY A;  3V4G A;  4MQ9 F;  1V4R A;  1IN7 A;  2A5Y B;  1EV7 A;  3GX4 X;  5K5Q A;  2STT A;  2ADU A;  3ZP5 A;  5A2Q Z;  2RNJ A;  2FEZ A;  3I0T A;  3F8N A;  3LAJ A;  4FX4 A;  3HOS A;  3GEZ A;  1W4M A;  5FLX K;  1OYI A;  2XRN A;  3V8L A;  4S04 A;  4A12 A;  1UCR A;  1ZRE A;  2CQK A;  3CTA A;  1BN5 A;  1GXP A;  1J0R A;  4M9Z A;  5CVJ A;  1F1Z A;  2PFB A;  4P5O A;  1QO0 D;  4EVI A;  2GA1 A;  1FY7 A;  2JPB A;  4JK1 X;  4KMU X;  1FBS A;  2G9W A;  5D5V B;  1IW7 F;  2KKO A;  1MJB A;  3R60 A;  4MEY F;  1K78 B;  2A07 F;  2FE3 A;  2DLL A;  5E20 A;  2HTS A;  1DDN A;  3GZ5 A;  3M8F A;  2W57 A;  2UZK A;  5LGU A;  1ZG1 A;  3QU6 A;  1CF7 B;  4MGR A;  2ZNY A;  4OIR F;  4EJU A;  1DPU A;  3QAH A;  3ELK A;  1XSD A;  3W6K B;  3ZQ7 A;  1HST A;  5HLH A;  2F5C A;  1FOK A;  3K0L A;  3I71 A;  3TO6 A;  2XUB A;  4G9Y A;  4IPA A;  4OU0 A;  4A6D A;  1P4W A;  3QP6 A;  3O2P E;  1FZP B;  3CO7 C;  3LA3 A;  2XHK A;  3R61 A;  1Z6T A;  3F8B A;  2Y48 A;  3IKV A;  2IRF G;  4MTE A;  2PQ8 A;  3BP8 A;  3DP7 A;  2FMY A;  1WRJ A;  4UHT A;  1P4X A;  4I09 A;  4EQQ A;  3E97 A;  1J2X A;  1S6L A;  3DFG A;  1SD7 A;  1MDM B;  2QM3 A;  4XSX F;  4XLN F;  2HTJ A;  1ZYR F;  4HQM A;  4CDG A;  3WTX C;  2VN2 A;  2K4J A;  3GFJ A;  2XAJ A;  3I58 A;  3PQJ A;  1D8K A;  1U8R A;  2XKO A;  1O3S A;  5ICC A;  2FNA A;  4AWX B;  5D5W B;  5LHG A;  1TLH B;  3M9A A;  3KCC A;  1RZ4 A;  4U7B A;  5CYV A;  4OIO F;  4UV8 A;  4R8H A;  2F5F A;  3CLO A;  2JZY A;  4G8X A;  5LEK A;  1MD0 A;  2G7H A;  3PQK A;  1NHA A;  5FD6 A;  1YO5 C;  1XGN A;  1KU3 A;  1Y0U A;  1USS A;  1MJA A;  1UHW A;  2O6G E;  1UFM A;  1FP2 A;  1KGS A;  4ZZD A;  1IN8 A;  4I2O A;  3I59 B;  2FML A;  3JAM Z;  4U0Y A;  1HKS A;  4ASN A;  3RTR A;  4BHC A;  1FSE A;  3HHG A;  4RB1 A;  3F8F A;  4CXF A;  1R7J A;  3VOD A;  1C0W A;  3GFL A;  1P2F A;  3FF5 A;  1YIO A;  5IT9 K;  3FWE A;  5BOX A;  5LRS A;  3B73 A;  4ZYH A;  1H9T A;  5CVV A;  4WX9 A;  3GZ6 A;  3J80 Z;  4N9I A;  1HW5 A;  2L4A A;  5E18 F;  2Z5U A;  3EYI A;  3RDI A;  4EM2 A;  3LAP A;  2HDC A;  4N9H A;  3HTU A;  2LNB A;  1SFE A;  2ZME B;  2A68 F;  2P5V A;  4YFX F;  4ENJ A;  3TQN A;  2M87 A;  3M8E A;  2CWE A;  4I7H A;  1T38 A;  2EA4 A;  3FXU A;  2MLK A;  3NQO A;  3VOE A;  5F1R A;  3ZMS A;  4XSZ F;  2QBY A;  5ICG A;  2CSO A;  1IZ1 A;  3ZN0 A;  1QNT A;  3GVA A;  4CIC A;  2V1U A;  2F2E A;  4BYY A;  3SZP A;  4G6D A;  4M74 A;  3I64 A;  1F9N A;  3ABU A;  5IT3 A;  1G3S A;  4KUM A;  3MFK A;  5E1W A;  2W25 A;  5ERI A;  3F21 A;  1B9M A;  3C1D A;  1TQM A;  3V8K A;  3KLN A;  2Z3Y A;  5H6R A;  1ZN2 A;  2YX7 A;  6PAX A;  2JPC A;  4EJO A;  1TBX A;  2Z99 A;  4P9F A;  3GW2 A;  2DFI A;  2LDU A;  2L54 A;  3L00 A;  1R1V A;  2DU9 A;  4Y13 A;  3BPV A;  3BJO A;  3M7G A;  5FLX Z;  1FNN A;  1OYW A;  1ULY A;  4YFN F;  4M6Y A;  4M73 A;  3Q9V A;  2F5D A;  3F8C A;  2CO5 A;  3DPL C;  1KYZ A;  2OZ6 A;  3L7W A;  1Z1D A;  3FHZ A;  5AIQ A;  4HF1 A;  1FC3 A;  4JQF A;  4KT5 C;  2VT2 A;  4WXC A;  5JFR A;  4U88 A;  1KQ8 A;  3RKX A;  4PGH A;  5ILS A;  3QRF F;  2H09 A;  3LST A;  2L3D A;  3KET A;  1GXQ A;  1MJ9 A;  2ESH A;  2WC2 A;  5TRD A;  1ODD A;  2HKO A;  3C7J A;  3C3W A;  3K9T A;  4EGY A;  5HLG A;  1BI3 A;  1SAX A;  3QU3 A;  3VFZ A;  3J81 K;  4BH9 A;  1J59 A;  1XD7 A;  3LQQ A;  1E2X A;  1QBJ A;  3FMQ A;  2IPQ X;  4ZYD A;  1S8N A;  4DNC A;  4PCQ A;  1REP C;  2QQ9 A;  2XAF A;  5L3B A;  3F72 A;  1XSV A;  3G3Z A;  3RKW A;  4A6E A;  3QOP A;  2V6C A;  3K69 A;  2D2W A;  4RAY A;  1Z91 A;  1FP1 D;  3ML6 A;  1H9G A;  2IVM A;  3WGI A;  3FXR A;  4HF0 A;  3GF2 A;  1GHC A;  4MHG A;  2V1D A;  4BHB A;  1T39 A;  3GYH X;  4IXA A;  5TJJ A;  4G7Z F;  1Z05 A;  1EH7 A;  5ILV A;  1STZ A;  4I98 B;  2FBH A;  3GXO A;  3AAF A;  4N0B A;  1B59 A;  2IT0 A;  4KFC A;  1YLF A;  3WTY C;  3ZPL A;  2X4H A;  4LG0 A;  2PI0 A;  1D8J A;  2FA5 A;  1I27 A;  5E1X A;  2ETH A;  2FBI A;  1IXS B;  3V7S A;  2ESN A;  4I01 A;  3SHF A;  4EM0 B;  5DEQ A;  1HQC A;  2P4W A;  2WTE A;  2Y75 A;  2GIV A;  3U1D A;  3T0Y A;  2V9V A;  1LVA A;  1QGP A;  1V3F A;  3TOB A;  4E70 A;  1BIA A;  4U7D A;  2YU3 A;  2HQN A;  4L5J A;  3TKY A;  4L0Z B;  4ZZL A;  5H20 A;  1ZAO A;  3L9F A;  3BWG A;  4A0Z A;  5HVQ C;  2J5O A;  2R7F A;  2D45 A;  4RS8 A;  2V79 A;  3R4K A;  1Z9C A;  1ZG3 A;  2PN6 A;  3NRV A;  3VB2 A;  2JTV A;  1VTN C;  4U0W A;  2CGP A;  1OYY A;  3SQN A;  4PDK A;  4GXO A;  1JE8 A;  3MCZ A;  2E7W A;  3RPU A;  1S29 A;  1AOY A;  1TNT A;  2V1X A;  2EFN A;  2MH2 A;  5EEG A;  3ZMV A;  1FLI A;  3HHH A;  2ZFW A;  4LGW A;  1U5T A;  4PZJ A;  3O6B B;  4UVB A;  1UHM A;  3ROU A;  4RGR A;  3WU1 B;  2UXX A;  2BV6 A;  3GFM A;  1S7A A;  5HDK A;  5FGM A;  4B8X A;  1HW2 A;  3HUG A;  4S05 A;  3TOA A;  3HIF A;  2ACJ A;  1U78 A;  2RQP A;  2HS5 A;  1L3L A;  3R6S A;  1R5G A;  2HFH A;  4HW0 A;  1W7P A;  1QPM A;  4IHT A;  4L18 B;  2QWW A;  3PFI A;  2H94 A;  4AVP A;  2XAS A;  2O03 A;  1Z7U A;  3F3X A;  3ISP A;  4D0P A;  1KA8 A;  2MH9 A;  1YW9 A;  5DCM B;  3RPQ A;  4K2E A;  4FHT A;  5CJ9 A;  3COA C;  1B4A A;  4NB5 A;  3F22 A;  4MTD A;  2LF8 A;  2KJB A;  3LA7 A;  3L09 A;  1L0O C;  2DAO A;  2KIM A;  4Q48 A;  1R23 A;  2DBB A;  4L9T A;  4RB3 C;  2EV0 A;  4R1H A;  1MZB A;  2Y0M A;  5CVI A;  1XMK A;  2F5E A;  2UXN A;  3WTW C;  2O3F A;  3RKY A;  3HRS A;  1QQI A;  1P4A A;  3CDH A;  3EUH A;  3K2Z A;  4MNU A;  4MEX F;  1U6G A;  2VE8 A;  1EH8 A;  1U2W A;  1ZGJ A;  1MGT A;  3R0A A;  2ZBK A;  3IL2 A;  3Q9S A;  3T8T A;  1SMY F;  4GYG A;  5E17 F;  2M30 A;  2OU2 A;  1XGO A;  4HOB A;  2JSC A;  1BC8 C;  1WWX A;  2EFQ A;  3T1B A;  2EJR A;  4A2U A;  3HTS B;  3DPT A;  4KDP A;  2FRH A;  4KIC A;  3RYP A;  1R58 A;  2K27 A;  3GO5 A;  2E1C A;  2K4B A;  5AIP A;  2Q2E A;  3ECH A;  3P9K A;  4CHU A;  2FBK A;  1SMT A;  4EJT A;  2IA0 A;  3U9G A;  1YYV A;  3J81 Z;  5K5O A;  1D3Y A;  1IN4 A;  1B1B A;  3HRU A;  1LB2 A;  5FB2 A;  3KZZ A; 
#chains in the Genus database with same CATH topology
 5BMZ A;  2IGK A;  2VC1 A;  3WGG A;  4DOZ A;  4YIF A;  5IPA A;  2ZB9 A;  2MGQ A;  5FD5 A;  1X1P A;  4B48 A;  1A6Q A;  1TQI A;  1YS7 A;  3KIO A;  4ESB A;  3BTJ A;  4FTH A;  1T2K A;  2QYO A;  2IA2 A;  4XLF A;  1XCB A;  3I9V 2;  1K7A A;  3KEQ A;  4BDZ A;  1RPW A;  1WH5 A;  3ASO H;  4LB6 B;  4WWC A;  1O3Q A;  3ABT A;  3G1O A;  1XX5 A;  2CW7 A;  3NAR A;  3MKY B;  2HOT A;  3KP7 A;  4XNF A;  1Y0N A;  2W1O A;  1IN6 A;  2F4M B;  3NEU A;  1KYW A;  1FT9 A;  1U9O A;  3S32 A;  1QZY A;  4XN0 A;  3DEE A;  3MZH A;  3V42 A;  4KYW A;  2Y69 H;  3L2R A;  2AQE A;  1HKQ A;  4M71 A;  3W6J B;  1BC7 C;  2JA2 A;  1YFH A;  2GQQ A;  2PBI A;  2PMH A;  2RKH A;  2XAG A;  1IXC A;  1V5G A;  1TWF J;  2M8E A;  3S3O A;  1KU7 A;  3KP5 A;  4DIQ A;  4IRG A;  3O8G A;  2VJI A;  4WCG A;  1HDP A;  1OCP A;  4I6Z A;  5F27 A;  2MBF A;  1KU9 A;  1X3U A;  2DCE A;  4LK1 F;  4WXH A;  5GAD J;  5B3S H;  3PO2 J;  1YRN A;  5FFZ A;  5FB2 A;  4A93 J;  1H0M A;  1OMI A;  3ZMT A;  3KPH A;  2GWR A;  2OQR A;  1ZLK A;  2A69 F;  1YW8 A;  1UZC A;  4AVZ A;  4BQQ A;  1Y1W J;  4KN7 X;  1DPR A;  1W5C C;  2EV6 A;  3CO6 C;  2R7U A;  1ERD A;  1XMA A;  3MWM A;  5HLI A;  2CFX A;  1A35 A;  4E7Z A;  2VON A;  2GXG A;  4CH7 A;  5LGN A;  1YJ9 I;  3BR5 A;  1PDN C;  1T0F A;  2OQG A;  2DT7 B;  3WU0 A;  5H6Q A;  2OA4 A;  4HG2 A;  2XIG A;  1XN7 A;  3RJP A;  1FBQ A;  4UUV A;  2L9S A;  4BEH B;  2ECC A;  4YG2 F;  2EFO A;  2DYS H;  3C2B A;  5E8I A;  2P5K A;  1BOB A;  5FO5 A;  3K4N A;  4FT8 A;  2Y31 A;  4OAZ A;  3KP2 A;  3S2W A;  2ZJQ F;  2MLG A;  3IWZ A;  1VZ0 A;  4G12 A;  1OPC A;  1ORK A;  2ZJ2 A;  5CQE A;  4CCO A;  3E6C C;  3QP5 A;  2K3F A;  2CU7 A;  4RGX A;  1R5I D;  3P9I A;  3OYG A;  1JUM A;  1WJA A;  3IRR A;  1FSH A;  3CZ6 A;  3G6E I;  2DK8 A;  2R7Q A;  5M5X J;  5DYM A;  1SAN A;  1SD6 A;  3OL4 A;  2JA6 J;  1FX7 A;  2LOO A;  1MBE A;  3WTU C;  5M5Y J;  3F8M A;  2KJC A;  3BR1 A;  3FM5 A;  4IHW A;  2HVQ A;  2RQQ A;  3FXK A;  1IF1 A;  3KE2 A;  2VUM J;  1LNW A;  3KEO A;  1Y56 A;  1IUF A;  4FAS D;  4XL9 A;  3EYY A;  2DPD A;  4ENM A;  3KP4 A;  2DYR H;  1B8I A;  1LDD A;  1RKT A;  1F36 A;  1P7I A;  3IWF A;  4HX7 A;  3G73 A;  1FYK A;  4HV6 A;  2BYV E;  2WWY A;  1WI9 A;  2O8X A;  2VBZ A;  1YE9 A;  1TTY A;  4J19 A;  4HDU A;  4E7I A;  3H0G J;  1X1D A;  3AG1 H;  4LLN A;  3CUQ A;  3JSO A;  3SEQ A;  3B6C A;  4XRS A;  2IS6 A;  1MIJ A;  4ZDP A;  1N78 A;  2PG4 A;  1AWC A;  1I6H J;  1IN5 A;  1QZZ A;  3HKZ A;  1FMV A;  3VYS B;  1SFU A;  3N4M A;  1OKR A;  4R79 A;  2MA3 A;  2XAQ A;  2NVY J;  3I53 A;  4UXN A;  3FHN A;  5FLV A;  1ZGA A;  5FKN A;  4CCN A;  1CQT A;  1YS6 A;  1VQ4 I;  2CQ7 A;  3PNT A;  5JLX A;  2EV5 A;  2X51 A;  3SZT A;  3K4J A;  1G6N A;  5J8C A;  1I6X A;  2Q0O A;  1AHD P;  2EB7 A;  3E5U A;  3VSL A;  2IA1 A;  2MAB A;  4LG0 B;  3GWZ A;  3BOQ A;  1JTX A;  4XIC A;  2Z2S B;  5ICF A;  2L7M P;  2IGM A;  2G7U A;  4PGG A;  2OPT A;  2KIF A;  5F04 A;  3VPR A;  1SVL A;  3F6O A;  1U5T C;  3LNQ A;  3QWL A;  2ICW G;  1D0Z A;  4RLQ A;  3F6V A;  4XLE A;  4KIG A;  1ITY A;  2E5N A;  5LHH A;  2ZCW A;  2NVQ J;  4AIK A;  5GP9 A;  3S14 J;  1GV2 A;  4FET A;  3ONQ A;  2RVC A;  5IOY A;  3I59 A;  2QLZ A;  2Y0S A;  3GLX A;  3IAS 2;  5HS8 A;  2JA7 J;  2WB1 N;  3BR3 A;  2Y9Z A;  5KVR A;  2A6H F;  1W5T A;  1JI8 A;  2LKX A;  2VKV A;  1VF9 A;  4M6X A;  1HKT A;  2VE9 A;  2XC7 A;  3S1N J;  3I4M J;  3LA2 A;  4RA2 A;  5CVU A;  5JLW A;  1R36 A;  2RV8 A;  4XN3 A;  5LEJ A;  3T8R A;  4Q5S F;  4FX0 A;  4LJZ F;  4M72 A;  4IRI A;  1BJA A;  3BCB A;  4X1E A;  1IG7 A;  1GUU A;  1FYL A;  1Y1V J;  5BPI A;  4ANJ A;  4E7H A;  2P6T A;  1E0E A;  5BNG A;  5E8G A;  2V1N A;  1XDU A;  2XV4 S;  3ZQQ A;  2GAU A;  3EET A;  4XRF A;  1PP7 U;  2HQR A;  4XKB A;  1I39 A;  1S7O A;  1GT0 C;  3BJ6 A;  4XLC A;  4MQV A;  3HM5 A;  3HZJ A;  5DM6 F;  4LB5 A;  2K5C A;  1ETQ A;  4PUS A;  3DCF A;  4C2T A;  2IBD A;  2OZU A;  5DDG A;  5L3F A;  4B3X A;  2MW8 A;  2COB A;  3ZMD A;  4A3D J;  2BHY A;  1B6A A;  5D8L B;  4N4O B;  2HKX A;  4NNJ A;  2GLO A;  3CCY A;  2IW5 A;  3TW6 A;  2DA5 A;  5DS9 A;  2E7X A;  3PUF A;  5E3M A;  3MMY B;  2BY0 A;  2HU9 A;  1RIO H;  3QYE A;  4KIF A;  2YPR A;  4LLG F;  1XGM A;  1LEA A;  3OWT A;  3RIR A;  3RQ4 A;  4ZH4 F;  1LE8 A;  2R5Z A;  1R1T A;  5J6X A;  1KQ0 A;  3JR9 A;  2VKD A;  5J8F A;  5IOZ A;  1U5T B;  2IGN A;  1NTC A;  4A0Y A;  2X0L A;  4A3I J;  2DT5 A;  1MKM A;  2EZK A;  3TL4 X;  5BS6 A;  1W5S A;  1YW7 A;  2FNP A;  4D9J A;  3EUH C;  2NVT J;  2EBI A;  4G6Q A;  3JTH A;  3K10 A;  5ICE A;  4II3 A;  2PJP A;  3OV8 A;  3K70 D;  2PLY A;  2K7L A;  4LK0 F;  4O5V A;  4Y52 J;  3KP6 A;  4ETS A;  3TDU C;  2FU4 A;  4DYR A;  3TW7 A;  4IO9 F;  3DQV C;  3RYR A;  1E3H A;  1WVR A;  4HNV A;  3HRT A;  3HUG B;  2CFO A;  2UWM A;  1LUJ B;  1LFP A;  2ISZ A;  4RGS A;  4B3A A;  5FLM J;  2YX4 A;  4AU7 A;  1WZ2 A;  5ILU A;  2LBF B;  4CGZ A;  1GLN A;  3KFW X;  4AC0 A;  5JVT A;  3DBR B;  4XOP A;  1W7P B;  2QKM B;  4B09 A;  2P8T A;  1IRG A;  1PJR A;  2CW0 F;  1ACI A;  1ZLJ A;  5LBQ A;  3HSR A;  2W7N A;  1ON1 A;  3FMS A;  4EAT A;  3FX3 A;  4JX5 A;  1O3T A;  1JUP A;  4NC7 A;  1I1G A;  4YFK F;  4RGU A;  5L3E A;  1D5Y A;  3JRH A;  1MMN A;  2VIX A;  3PSI A;  2OC6 A;  1UG0 A;  1S9H A;  2H6C A;  5FRO A;  3BLY A;  3O8H A;  2CV2 A;  3OS0 A;  1TW2 A;  3I4P A;  2R93 J;  5J1U A;  2LY9 A;  4CYD A;  1IUY A;  3GTK J;  2FD5 A;  3IKT A;  1U3E M;  1X1B A;  2M45 A;  3JRA A;  2FSW A;  2XB0 X;  1O4X A;  2XAH A;  3CDI A;  2FF4 A;  2IEK A;  1BIB A;  1EA3 A;  5KCM A;  4I0A A;  2OBP A;  1RUN A;  2HR3 A;  4ZYG A;  2HYG D;  2A3S A;  3MZY A;  1LDK B;  2WY8 Q;  3OSG A;  1WGX A;  3RZO J;  2LSO A;  2ZXJ A;  2LFB A;  3OYK A;  4NDL A;  2R7D A;  4KN4 X;  3ULQ B;  2D1V A;  2Q8K A;  1PUF B;  2WV0 A;  5ED4 A;  5K5R A;  4GO1 A;  3HRM A;  1F5T A;  3KZY A;  2HZD A;  4XBF A;  1SFK A;  3WTS C;  3CCV I;  2P7C B;  2I8D A;  4MFD A;  1DU0 A;  5IYC J;  2EZL A;  4IF4 A;  2J5P A;  5IP7 J;  3LSP A;  2RC4 A;  3HSF A;  1D1A A;  3QPH A;  1XB4 A;  1KU2 A;  4KIB A;  3EUA A;  2R7T A;  3RKQ A;  3A01 A;  2R0Q C;  2R7X A;  1X2N A;  2XPW A;  3CCL I;  3Q0U A;  3WTZ A;  4HA8 A;  2VOP A;  1A04 A;  1NK3 P;  4TV7 A;  2COM A;  1KQ9 A;  5B66 C;  1I1S A;  4Q4Z F;  2IGO A;  2MG4 A;  2V26 A;  3V8J A;  3FIS A;  3H0D A;  2ZFU A;  1OCT C;  4EMS A;  1X4P A;  3H3U A;  5JR3 A;  4Y17 A;  2EA2 A;  2KT0 A;  4HBL A;  3CCS I;  4E7S A;  2CQN A;  2Q2E B;  5LGT A;  4KNY A;  3QOD A;  3LFK A;  3CCU I;  3VYT B;  4A3M J;  5DCF A;  4HF2 A;  3CJQ B;  1X3W B;  3BT9 A;  2A61 A;  2K9M A;  2VXZ A;  3CF5 F;  3FKJ A;  5E3L A;  1X4O A;  4RB0 A;  1MH4 A;  4G7O F;  2QQA A;  2YU9 J;  4ZDO A;  3ZGK A;  3DU5 A;  4L0Y B;  1T0F C;  2CUF A;  1SVM A;  2HOS A;  3DV8 A;  3IV5 A;  5M3M J;  5KNL A;  2QVO A;  2CYY A;  4A5M A;  1F4K A;  3PNY A;  4HV5 A;  1LEB A;  2GA2 A;  2R5Y A;  4OIQ F;  1QVT A;  2DA1 A;  3E7L A;  3P9C A;  2YR2 A;  5C4J J;  2KIU A;  1ON2 A;  1D0Y A;  5J3L A;  4CA0 A;  4N4N B;  2DFH A;  1TQP A;  4UB6 C;  4GCV A;  1R22 A;  2E2J J;  3MQ0 A;  4AIJ A;  3E0J B;  3WE2 A;  4DQ2 A;  5EGO A;  2OD5 A;  3KEY A;  2MFZ A;  4GGG A;  3E5X A;  3H36 A;  4IKF A;  2LKP A;  1S7E A;  3L1P A;  1IDY A;  4FQG A;  4OOI A;  3HC7 A;  1BBY A;  2LYC A;  3L2C A;  3FZV A;  1J7K A;  4I99 C;  3Q5F A;  4UUS A;  1IGN A;  5M5W J;  3DTE A;  3DF8 A;  3OYB A;  3B6A A;  5AON A;  2RDP A;  4F3Q A;  4BHP A;  2CG4 A;  3BG9 A;  3SFZ A;  4IQ4 A;  3JRI A;  2QGU A;  2BXY A;  3WTV C;  1VQ6 I;  2HOE A;  3BDD A;  3BY6 A;  3E6B A;  1T8I A;  3SXY A;  3AG2 H;  4F92 B;  2BE5 F;  1V55 H;  2KL4 A;  2WAQ A;  3MKL A;  3WGH A;  1Q1V A;  3TED A;  3ZN1 A;  5DUI A;  4Z6Y A;  2VPR A;  3N97 A;  5BPD A;  2GXA A;  3BQY A;  1Z77 A;  2H6B A;  1YRN B;  1FPQ A;  3MEX A;  3BR2 A;  3GTL J;  4DBQ A;  1RC9 A;  3TP3 A;  4G7H F;  3R0J A;  3NWS A;  1WJE A;  2ECB A;  3L2U A;  3RPU D;  1MBJ A;  3HOV J;  2FQ3 A;  2KZG A;  2EFP A;  3KX2 A;  4P55 A;  1VQ9 I;  2CMP A;  3GME A;  5C4X J;  2VBW A;  4C2U A;  2HQA A;  4BJ5 C;  4G94 A;  1BM9 A;  3H92 A;  3A2K A;  3K7A J;  1V54 H;  3CUQ C;  4LLL A;  4DBR A;  2L9R A;  1R00 A;  2P6S A;  1UST A;  1TWA J;  5TIS C;  2K02 A;  2VLA A;  4ENK A;  2RGV A;  5D6F A;  1WCM J;  4EGZ A;  1E3P A;  3WTT C;  2H27 A;  1G4D A;  1MNM C;  2OCC H;  3DLA A;  3J7A O;  4ENN A;  3MN2 A;  1JKO C;  3CJN A;  1H89 C;  4BXU A;  1YG2 A;  4AIH A;  4H0E A;  1WPK A;  3OMY A;  3DU6 A;  4KA4 A;  2XAU A;  4E7L A;  4NHJ A;  2MD5 A;  2E1N A;  5FFX A;  5LD2 C;  2KQR A;  4JX4 A;  1H88 C;  2EIK H;  3CME I;  3D0S A;  4RLF A;  5HOD A;  2QBY B;  4JX6 A;  2JQ7 A;  2CUJ A;  1I50 J;  1O57 A;  2KDZ A;  4ZTJ A;  4Y33 A;  2QZ8 A;  1JJ6 C;  3U1K A;  2NRA C;  3CCM I;  2VT3 A;  3K70 C;  1W7P D;  2BY1 A;  4FE4 A;  4PJM A;  1G8X A;  3BRO A;  2DXI A;  4B44 A;  1I3Q J;  2HXO A;  3ZXS A;  1NG6 A;  1PP8 F;  3VEP A;  4A3L J;  3OYA A;  3GUD A;  1ZRF A;  5EEA A;  2LY2 A;  3WG7 H;  4J01 A;  1TNS A;  1FWZ A;  1DGR M;  2EIL H;  2EK5 A;  3LWF A;  3OR2 C;  1QZE A;  4O3M A;  1XC5 A;  1XCV A;  3HSE A;  3KP3 A;  1HXD A;  3W2A A;  2M1B A;  4BY7 J;  4HYE A;  2FXA A;  3FXJ A;  1B8I B;  4MO7 A;  1U8B A;  3TGN A;  4HLY A;  2NNY A;  4BUP A;  4DW6 A;  4RB2 C;  2QSG X;  1O3R A;  3BZC A;  3JSP A;  3X2Q H;  1UB9 A;  2O61 A;  2BY3 A;  4FIS A;  1VQP I;  1TWC J;  1VQ5 I;  2E1O A;  3OYM A;  4Z2Y A;  1RUO A;  3L2W A;  3CUQ B;  3BR6 A;  3LQR A;  4A3F J;  2ZKZ A;  2EIN H;  4XID A;  5IP9 J;  2JRT A;  2Q1Z B;  3WG9 A;  2R7R A;  2NS0 A;  3GFI A;  3LFU A;  4B43 A;  4P9U A;  3IRQ A;  3H1C A;  2L7F P;  3DEW A;  4AYB A;  2ZO4 A;  3FMR A;  1AU7 A;  3LL7 A;  1DQU A;  3F23 A;  4L5E A;  2R3S A;  5CPR B;  4IOC F;  1ZRC A;  1MMS A;  1A36 A;  1SVO A;  2L4M A;  4YEJ A;  2NAZ A;  3BTL A;  4DJA A;  4D1Q A;  5EEH A;  1DP7 P;  4EV0 A;  2FOK A;  3JW4 A;  3IHU A;  3ZR8 X;  1R5H A;  4HNT A;  4WXD A;  2XSJ C;  3KZI C;  1EH6 A;  5LRR A;  3BZ6 A;  2ZSI B;  2VL8 A;  3S1Q J;  4MFE A;  2KIS A;  2Z16 A;  1HW1 A;  2CV1 A;  1J9I A;  4BAY A;  2DOF A;  1B9N A;  4M9S A;  2OAZ A;  1PVE A;  1R71 A;  3SDG A;  3J7Z I;  3TBI A;  5LLQ A;  2AQF A;  3JTG A;  3QYB A;  4UVA A;  3TO9 A;  1Z3Y A;  4E7K A;  1ZAR A;  3E6D A;  4WF2 A;  1BOA A;  3DKW A;  3ERE D;  4I0B A;  4C2M J;  3DTI A;  4OIP F;  3QPS A;  4M9X A;  1ZGW A;  3CC4 I;  2OJE D;  3OOP A;  5JHU A;  4GYI A;  1QU3 A;  4L9N A;  1SD5 A;  5FKK A;  1LVK A;  1NH3 A;  5FKL A;  1G3W A;  2IS1 A;  1HBX G;  3IH3 A;  3U2R A;  1JXS A;  2NNN A;  5DCM A;  1BI2 A;  1MW7 A;  1ZKG A;  4EM1 A;  1YQA A;  1CGP A;  1WSU A;  1K78 A;  5IY5 H;  4BJ6 C;  4PFP A;  1T08 B;  2W24 A;  2DQR A;  4OMY A;  3E3V A;  3I54 A;  1XS9 A;  5J1Y A;  4HRI A;  3CUO A;  1YIJ I;  1CF7 A;  2V4J C;  3RSN A;  2NYX A;  4C30 A;  4L9V A;  3AG3 H;  1XSX A;  2IS2 A;  1ONV A;  2VOD A;  2MD0 A;  5J4V A;  5KHD A;  1FYM A;  2W00 A;  2XGX A;  3EDP A;  4OMZ A;  1BJZ A;  2OV7 A;  2QF7 A;  1IRF A;  4CZZ A;  5A2Q K;  4BQA A;  1XG1 A;  2JSP A;  2LF7 A;  5E1Z B;  3ZQL A;  2HQ5 A;  3D5S C;  1PUE E;  3BG6 A;  3CMA I;  4XKC A;  4U0V A;  3B02 A;  1GDT A;  4F7Z A;  4QSH A;  2Z9O A;  3FXQ A;  2ISY A;  4ABZ A;  3LMM A;  1UAA A;  3KLO A;  1Z67 A;  4Y15 A;  2NXN B;  3OL3 A;  2QQ8 A;  2YSR A;  1FIA A;  2KPM A;  4ESJ A;  1ZR4 A;  1LE8 B;  4CO8 A;  2BY2 A;  2D1H A;  3FM3 A;  4ZYE A;  1X19 A;  5K7Z A;  4X0G A;  2FQ4 A;  3OYH A;  2PMU A;  1J75 A;  2QUF A;  2WA0 A;  5D4R A;  5DD8 A;  1RNL A;  3T5X A;  4V2G A;  2HZT A;  1K79 A;  1HDD C;  2EFW A;  4QWQ A;  3IH2 A;  4IHX A;  1GVJ A;  1UJ8 A;  5HDN A;  2K85 A;  3K4C A;  1IAW A;  3O3K A;  1ZH5 A;  3BPX A;  4HSR A;  5D5X B;  1T6S A;  1R49 A;  4NC6 A;  2W85 A;  4BNC A;  3IC7 A;  1TWG J;  1LFU P;  1JHH A;  1ETW A;  4JBA A;  2TDX A;  4BE1 A;  2X6O A;  1MDM A;  1FJL A;  4UVC A;  2E34 A;  1N77 A;  2IP2 A;  1RR7 A;  1APL C;  5GTI C;  3CLQ A;  5D6E A;  2AS5 F;  5KK1 A;  2G0E A;  4V2F A;  1IXR C;  2BHZ A;  3ABK H;  1ZEL A;  5D8K B;  1MNE A;  1O7F A;  5HS7 A;  5DD4 A;  1YOV B;  2QQB A;  3IH4 A;  2EIJ H;  2O0Y A;  2LLK A;  4U87 A;  2XPU A;  1H8A C;  3PIO F;  2H8R A;  3LSI A;  3HYI A;  2KRF A;  2RRE A;  4AUX A;  5IYD J;  4YRV A;  4BBS J;  1JHF A;  2HWV A;  4Q47 A;  3HKZ N;  2XDV A;  4HQE A;  1XGS A;  1OCC H;  2BW3 A;  4ESF A;  2ZSH B;  3S8P A;  1S3J A;  2ZNZ A;  2X6Y A;  1BA5 A;  1UMQ A;  5J40 A;  2XPV A;  3I3L A;  2BBY A;  1A5J A;  1R1U A;  3E6M A;  2JUG A;  2JVH A;  2EWN A;  4L9J A;  1QHH D;  3W3C A;  2PX9 A;  4PK4 A;  3I5U A;  2DO7 A;  2VBX A;  3ZMZ A;  3Q0W A;  3H3Z A;  1XDS A;  4YII A;  1D5V A;  2QEN A;  5KAF C;  3BC8 A;  4UV9 A;  4HDV A;  1OFC X;  3OYF A;  1V5E A;  2L7K A;  2ELH A;  1YJN I;  1JGS A;  4XMY A;  2JT1 A;  3WE3 A;  1QRY A;  3M8J A;  2XF6 A;  3WOD F;  1V5F A;  3OY9 A;  3M1C A;  4KMF A;  1JUS A;  2A6T A;  1T98 A;  1E17 A;  1ZRD A;  3HPH A;  3S2D J;  2F5V A;  4I02 A;  3WHC A;  1UEL B;  2MSY A;  4L5I A;  5CQG A;  2WB1 A;  3PM1 A;  4D5C A;  1PYV A;  1O7L A;  3LSH A;  4IOA F;  2L02 A;  2BXZ A;  2HDW A;  3QPL A;  1DUX C;  2L2O A;  1WJB A;  3VSK A;  4LD5 A;  4EJV A;  4ZC3 A;  1P92 A;  2M5W A;  4LFU A;  4ON0 A;  1G3T A;  4WK8 F;  4IRH A;  3K6G A;  1OR7 A;  3A01 B;  3E5Q A;  4LMY A;  5F64 A;  3ERM A;  3ZCO A;  1YTY A;  2EQR A;  2M34 A;  2XGC A;  3C18 A;  5E3N A;  4A3G J;  4A69 C;  2P7V B;  2X48 A;  5HS9 A;  3JRG A;  4UNO A;  3MVP A;  5GAE J;  2GZW A;  4MLO A;  2KFD A;  3DKY A;  1OCO H;  5JI6 A;  3SJM A;  1Z3X A;  2ZME A;  4Y3O A;  3BG5 A;  1U0J A;  5D4S A;  3OYI A;  5DV5 A;  1YJW I;  4QPO A;  1ZG5 A;  2MC4 A;  5LHI A;  2HYF A;  1MMA A;  2LRE A;  3V7C A;  3HOT A;  3OOU A;  1WKM A;  2ID6 A;  4GRI A;  4J00 A;  4HZF A;  5HDG A;  3OSF A;  2DW4 A;  3M1E A;  3TP0 A;  4XOR A;  2VOO A;  1RI7 A;  3LSM A;  2XRO A;  2R4G A;  3PO3 J;  1RKW A;  5C44 J;  2DA6 A;  3K4M A;  2DK5 A;  2I5U A;  3K1N A;  4HX8 A;  2PJR A;  3ZQI A;  2HEO A;  5B1B H;  4AD9 A;  4P1W A;  1KON A;  2NS8 A;  5CVR A;  3HG9 A;  2IS4 A;  2DMP A;  2LVS A;  3KYL A;  3FBI B;  2ELK A;  3RI4 A;  3AL0 C;  2XKP A;  2Z33 A;  2R5Y B;  2K9Q A;  2M0M A;  1VQO I;  2RN7 A;  3MAJ A;  4YIR X;  3OYN A;  2K86 A;  2VC0 A;  4BDY A;  3REO A;  4CUG A;  5GPC A;  2P5L C;  2QEX I;  2ID3 A;  2PMZ A;  1TW3 A;  2RNG A;  3JRB A;  3S1M J;  2R7O A;  3CP8 A;  2DTR A;  2VAS A;  3C2G A;  3P7N A;  2HGC A;  5BQT A;  5EGO B;  1LDJ A;  1J5Y A;  3JAM K;  3DXJ F;  3CMY A;  4KT6 A;  2DQL A;  1UHS A;  5DUK A;  4ZJZ A;  3UKG A;  3LSR A;  1B72 A;  2BEO A;  4UUS B;  4CCM A;  5FRM A;  3ECO A;  2PEX A;  3VYU B;  2D5V A;  1FBU A;  1P6R A;  2QSF X;  4I76 A;  2V6E A;  4IHS A;  4C3J J;  1BI0 A;  4HX4 A;  4IQJ A;  2R7V A;  2VQL A;  1IC8 A;  1LQ1 A;  4W1U A;  1ZHF A;  3FK6 A;  2GXB A;  4E4H A;  5L3G A;  3D1N I;  3TMO A;  2L01 A;  5L3C A;  3KYD B;  3H9J A;  1HSJ A;  3K1P A;  1VQ8 I;  3PJR A;  1BI1 A;  3J80 K;  1RET A;  1G59 A;  4ZTF A;  4RAG A;  2A6E F;  1D0X A;  4EJW A;  1Z21 A;  4QLC U;  3D5L A;  2IJL A;  3GTG J;  1GV5 A;  5D5U B;  3HBL A;  1X3Z B;  3OYL A;  1LJ9 A;  1AKH A;  2B0L A;  2STW A;  2AXL A;  1MH3 A;  2XGD A;  1X1A A;  2MC3 A;  1FTZ A;  1I5Z A;  3SDB A;  5EDN A;  5HOO A;  4XLP F;  1X58 A;  2EZI A;  4IVN A;  3ZMU A;  1NK2 P;  4P96 A;  2F6C A;  4NQW A;  2ZJR F;  2O8K A;  1SD4 A;  3BJA A;  1ZK8 A;  1MBK A;  4M3B A;  3H35 A;  5CLS A;  2BVM A;  5L3D A;  3EPZ A;  4A5N A;  3V7R A;  3AL0 B;  4G6T B;  2BGC A;  1POG A;  4HST A;  1HC8 A;  3TDZ C;  4IJA A;  4O6J A;  2JWT A;  3QPT A;  1T56 A;  4CCL A;  1Z6R A;  5IYB J;  5F6F A;  3CES A;  1W1W E;  2DMN A;  5K1Y A;  1N75 A;  3EQL F;  1Q1H A;  2BOL A;  4OIN F;  3M3Y J;  2E5Z A;  2XRL A;  3DEU A;  1K6O A;  1JTY A;  2KMU A;  3TO7 A;  2TCT A;  2TRT A;  3H5N A;  4RAZ A;  3S3M A;  2DI3 A;  1WQ2 A;  1FIP A;  3W2W A;  3BZK A;  3I55 I;  3JRE A;  1SFX A;  4A0X A;  2C6Y A;  2LK2 A;  5F08 A;  4XON A;  3BG7 A;  2DA3 A;  2K9S A;  2KIQ A;  1GVD A;  4HLX A;  1G3Y A;  1A6I A;  3HOU J;  1MBG A;  3D5R C;  2M3A A;  4DYC A;  2XVC A;  2MYS A;  3G1L A;  3K1M A;  2DPU A;  3S1R J;  1QHG A;  1JKQ C;  4EEF G;  5IT9 Z;  2CW8 A;  2W84 A;  2VBY A;  3V4G A;  4MQ9 F;  1V4R A;  3LSJ A;  4NC8 A;  1IN7 A;  2A5Y B;  4A3J J;  1EV7 A;  3U21 A;  2WAF A;  3ZQF A;  2R7Z J;  3ZRG A;  3GX4 X;  5K5Q A;  4XLH A;  2STT A;  2FJ1 A;  2L0K A;  2ADU A;  3ZP5 A;  2DFE A;  3CP2 A;  2NVX J;  3ZOB A;  4BGD A;  5A2Q Z;  2F4O B;  2RNJ A;  2JRM A;  3GBG A;  2FEZ A;  3I0T A;  3F8N A;  3LAJ A;  4FX4 A;  3HOS A;  3GEZ A;  4HEA 2;  1W4M A;  4CYC A;  5FLX K;  4XKW A;  1OYI A;  3F0C A;  4PSX A;  2XRN A;  3V8L A;  4S04 A;  4A3C J;  1XPX A;  3ABM H;  1WH7 A;  3DBL B;  1T95 A;  4A12 A;  1UCR A;  4QTR A;  1ZRE A;  5GAG J;  2CQK A;  3CTA A;  4OWR B;  1BN5 A;  1GXP A;  1S5L C;  1J0R A;  4M9Z A;  4FCY A;  5CVJ A;  4C9Y A;  1FOY A;  1F1Z A;  2PFB A;  4P5O A;  1QO0 D;  3JCU C;  4EVI A;  1R9T J;  1A31 A;  3FXO A;  2WBM A;  1P9Q C;  2LBF A;  4DYQ A;  4BE2 A;  2GA1 A;  1WHU A;  2EIM H;  1FY7 A;  3DTK A;  2JPB A;  2WAE A;  4JK1 X;  2B9S A;  4KMU X;  1FBS A;  2G9W A;  5D5V B;  1IW7 F;  1DP3 A;  2K40 A;  3RQI A;  3LSG A;  2N8G A;  2KKO A;  3HOY J;  1MJB A;  3R60 A;  2VJJ A;  5DTD A;  2OCE A;  2Y30 A;  5LFA A;  4MEY F;  1K78 B;  2A07 F;  2FE3 A;  2DLL A;  3QQA A;  5E20 A;  2HTS A;  1W0T A;  4B47 A;  1BW6 A;  4A3K J;  1DDN A;  3CJR B;  3CD6 I;  2YUS A;  3GZ5 A;  3M8F A;  2VB6 A;  2W57 A;  2UZK A;  4S0H B;  5LGU A;  4A3E J;  1ZG1 A;  2R7S A;  3QU6 A;  1CF7 B;  1S72 I;  3ESW B;  4MGR A;  2ZNY A;  4M3D A;  4OIR F;  4EJU A;  4HPQ A;  1JGG A;  3OS2 A;  4XOT A;  1DPU A;  3QAH A;  2GBY A;  4BQN A;  2LY1 A;  3ELK A;  1XSD A;  3W6K B;  3ZQ7 A;  1HST A;  1R4M B;  5HLH A;  2F5C A;  4V19 K;  2CJJ A;  1FOK A;  3K0L A;  3K4B A;  2M4K A;  3I71 A;  4M3G A;  3TO6 A;  1OIS A;  1QVU A;  2AO9 A;  3G1M A;  2XUB A;  5EYR A;  3CDL A;  2B7E A;  4G9Y A;  2LP0 A;  3SZG A;  3IAM 2;  4IPA A;  4OU0 A;  2YS9 A;  4A6D A;  1P4W A;  3BQZ A;  4KIS A;  4DZP A;  4D5F A;  3QP6 A;  3O2P E;  1FZP B;  3P5J A;  2H1K A;  3CO7 C;  3HL2 A;  3LA3 A;  2XHK A;  3R61 A;  1Z6T A;  2CS3 A;  3F8B A;  1OQY A;  2Y48 A;  2E35 A;  3CQZ J;  3IKV A;  2IRF G;  2ZXW H;  2OTL I;  4MTE A;  2PQ8 A;  3BP8 A;  3DP7 A;  3GTQ J;  3CJT B;  2FMY A;  1WRJ A;  4H4K C;  4UHT A;  2E2H J;  2WY7 Q;  1P4X A;  3OYD A;  5EF6 A;  4I09 A;  4EQQ A;  2HI3 A;  3A03 A;  3E97 A;  2W4S A;  1J2X A;  1S6L A;  2M9H A;  1W0U A;  1Z7L A;  2X9D A;  3OIO A;  3DFG A;  1SD7 A;  1MDM B;  2QM3 A;  3F9K A;  1BR1 A;  2KP6 A;  3LOC A;  4XSX F;  2VPL A;  2I10 A;  3FK7 A;  4XLN F;  2HTJ A;  3OS1 A;  1ZYR F;  3A0B C;  4HQM A;  3H5A A;  4KJZ A;  2IAI A;  4CDG A;  3WTX C;  4FE7 A;  1OR7 C;  4NUB A;  3UNG C;  2NOG A;  1JT6 A;  2VN2 A;  4D7M A;  3OIP A;  2K4J A;  3GFJ A;  5J1R A;  2XAJ A;  3GTM J;  3I58 A;  3PQJ A;  1D8K A;  4RDU A;  3VWB A;  1U8R A;  2XKO A;  4BS9 A;  3I56 I;  3L2V A;  1TWH J;  1O3S A;  5ICC A;  1TL8 A;  2FNA A;  2BW3 B;  4AWX B;  5D5W B;  5LHG A;  1TLH B;  3M9A A;  3KCC A;  1RZ4 A;  3ZQG A;  5HLT A;  4U7B A;  3LSK A;  2ZME C;  5CYV A;  3S17 J;  2ZXI A;  4AYB N;  4OIO F;  4UV8 A;  4R8H A;  1DU6 A;  2F5F A;  4F91 B;  3OIQ A;  3CLO A;  2DOD A;  1U9N A;  2V7F A;  4IHV A;  4CCK A;  2JZY A;  2A5W A;  2A05 A;  3DBH B;  4G8X A;  5LEK A;  1MD0 A;  2JA8 J;  4BY1 J;  2G7H A;  3PQK A;  1TC3 C;  1NHA A;  5FD6 A;  3RCO A;  1YO5 C;  1XGN A;  3GTP J;  1KU3 A;  1Y0U A;  1USS A;  4XR6 A;  1MJA A;  1UHW A;  5FKM A;  4PJL A;  2O6G E;  1UFM A;  2E1M C;  2ME0 A;  1FP2 A;  5FRN A;  1KGS A;  2LR8 A;  4ZZD A;  1MMG A;  1IN8 A;  4I2O A;  5EG0 A;  5HNH A;  3I59 B;  4C3H J;  5GTH C;  3EUK L;  2FML A;  1LKX A;  4D7N A;  3BTC A;  2LRD A;  5EZG A;  1ZR2 A;  2LD5 A;  3JAM Z;  4U0Y A;  1HKS A;  2X6X A;  4ASN A;  2M0C A;  2AXT C;  3RTR A;  4BHC A;  1FSE A;  2HXI A;  3HHG A;  4RB1 A;  5B1A H;  3F8F A;  4CXF A;  1R7J A;  1MMD A;  3VOD A;  1C0W A;  3GFL A;  1P2F A;  4CCJ A;  4M3F A;  3I4N J;  3FF5 A;  1YIO A;  5J47 A;  4RM3 A;  5IT9 K;  2M8G X;  3BG3 A;  3FWE A;  3DLL F;  3CC7 I;  5BOX A;  5LRS A;  5M3F J;  3B73 A;  4ZYH A;  4BKX A;  3PSF A;  1H9T A;  1MBH A;  5CVV A;  4WX9 A;  3GZ6 A;  3J80 Z;  4E6K G;  2DMU A;  2DA7 A;  2M7A A;  4N9I A;  1HW5 A;  1Y8R B;  2L4A A;  4Y4R A;  3JRF A;  3M4O J;  5E18 F;  2Z5U A;  3EYI A;  3RDI A;  4EM2 A;  1MND A;  3LAP A;  2HDC A;  4N9H A;  3HTU A;  5E79 C;  2ZXH A;  2LNB A;  1Y39 A;  1SFE A;  2ZME B;  1K61 A;  1N25 A;  4LOC A;  2A68 F;  4F93 B;  4RMN A;  3J7A Y;  3AFH A;  2E71 A;  1LFB A;  5FJ8 J;  3OYC A;  2P5V A;  1K6Y A;  2M2E A;  5KAI C;  1ETY A;  4YFX F;  2R5Z B;  4ENJ A;  3TQN A;  1VQM I;  3CCE I;  4UY8 I;  3AKZ A;  2M87 A;  3M8E A;  1YHQ I;  3CC2 I;  2CWE A;  3ABL H;  4I7H A;  1T38 A;  2PJR B;  2EA4 A;  1EJ9 A;  1ETO A;  3FXU A;  2KHM A;  2MLK A;  2E1M B;  2VQC A;  3NQO A;  3VOE A;  3CCR I;  5F1R A;  3ZMS A;  3MKZ A;  4XSZ F;  4BXF A;  3H5R A;  2W82 A;  2QBY A;  3OYJ A;  2P81 A;  2BVL A;  5ICG A;  2CSO A;  1IZ1 A;  5EZH A;  3K4L A;  3ZN0 A;  1QNT A;  3GVA A;  4CIC A;  1K4T A;  1EF4 A;  2V1U A;  2F2E A;  4BYY A;  3PFY A;  3SZP A;  2WV1 A;  2W48 A;  4C3I J;  4MIM A;  2RAE A;  4G6D A;  4M74 A;  3W2V A;  1LPQ A;  3I64 A;  1HLV A;  4JP0 A;  1F9N A;  3ABU A;  5IT3 A;  2DA2 A;  2KZV A;  1G3S A;  4XKV A;  4KUM A;  3MFK A;  2HNH A;  1BW5 A;  4KIT B;  5E1W A;  1B72 B;  2W25 A;  5EJC A;  5ERI A;  3F21 A;  3S16 J;  2DA4 A;  1B9M A;  3C1D A;  1TQM A;  4BXX J;  2VXD A;  2L9N A;  3V8K A;  3KLN A;  2Z3Y A;  5H6R A;  1ZN2 A;  2E19 A;  2YX7 A;  6PAX A;  2CRG A;  3G4S I;  2JPC A;  3G2B A;  3PNV A;  1SEU A;  1YI2 I;  4M6V A;  5GPA A;  4EJO A;  1TBX A;  2Z99 A;  4P9F A;  3W6V A;  3GW2 A;  3MKW B;  2X1D A;  1ZTR A;  2AHQ A;  2DFI A;  2LDU A;  2L54 A;  2LTP A;  2KLO A;  3L00 A;  1R1V A;  2EH3 A;  1AKH B;  2DU9 A;  1R6R A;  3VDX A;  1YX5 A;  2VJ5 A;  4Y13 A;  4LIU A;  3BPV A;  3BJO A;  3M7G A;  5FLX Z;  4BQO A;  3S3N A;  1VFC A;  1FNN A;  1OYW A;  1ULY A;  2DMT A;  4NQW B;  2CUE A;  2HOA A;  2VQG A;  4YFN F;  4A3B J;  4M6Y A;  2DDB A;  2R7W A;  4NBQ A;  4M73 A;  2OF7 A;  5F0F A;  3Q9V A;  2KDO A;  5GAH J;  4B4C A;  2F5D A;  3F8C A;  3QOE A;  1WJC A;  2Y0S N;  2CO5 A;  3DPL C;  5K7F A;  1KYZ A;  2OZ6 A;  3L7W A;  1Z1D A;  1BR4 A;  3FHZ A;  5AIQ A;  3JRD A;  4IZZ A;  4HF1 A;  3RZD J;  2LH9 A;  4BE0 A;  1W36 D;  1MBF A;  1FC3 A;  3FXL A;  4JQF A;  4KT5 C;  2VT2 A;  4JYK A;  4WXC A;  2EZH A;  5JFR A;  1X2M A;  1IRX A;  2XF5 A;  4U88 A;  3DPU A;  1KQ8 A;  3RKX A;  2FOW A;  4PGH A;  5ILS A;  3QRF F;  2H09 A;  1FMW A;  3AG4 H;  3LST A;  3ASN H;  2L3D A;  3KET A;  1GXQ A;  1MJ9 A;  4F52 A;  3FIW A;  2ESH A;  2WC2 A;  5TRD A;  1ODD A;  2HKO A;  3C7J A;  5J4Y A;  2CH0 A;  2K3P A;  3C3W A;  3K9T A;  4EGY A;  1F43 A;  2QSH X;  2UV1 A;  5CKT A;  5HLG A;  1QA6 A;  1FTT A;  2LG4 A;  1BI3 A;  4HNU A;  3E1S A;  3S93 A;  1SAX A;  1I3A A;  3QU3 A;  4BEH A;  3VFZ A;  3J81 K;  2LMD A;  4BH9 A;  2QKL B;  1J59 A;  1HF0 A;  2IXS A;  1XD7 A;  2O5R A;  4PFO A;  2JUC A;  3DKX A;  3LQQ A;  1DGW Y;  2JVG A;  3CF2 A;  3A1Y A;  1E2X A;  2HPM A;  4B1R A;  1K4S A;  1QBJ A;  2E2I J;  1TP4 A;  2IPQ X;  3FMQ A;  4ZYD A;  4CYC B;  1D1B A;  1S8N A;  4DNC A;  4PCQ A;  3UR3 C;  4X6A J;  1REP C;  5E3O A;  2JJ7 A;  1VI0 A;  4QPQ A;  1SAU A;  3S15 J;  1EKE A;  1ZQ3 P;  1VQK I;  3N05 A;  1XMX A;  2P0W A;  2KRC A;  4XLA A;  2GOM A;  1WJ5 A;  5JHF A;  2CUZ A;  2QQ9 A;  2PMZ N;  3VYR B;  2XAF A;  4DZJ A;  2O7O A;  3F72 A;  5L3B A;  9ANT A;  1XSV A;  2DT6 A;  1IV6 A;  2HPI A;  3G3Z A;  3RKW A;  4A6E A;  3HPG A;  3QOP A;  2V6C A;  2LKS A;  3K69 A;  2D2W A;  2Y9Y A;  2OTJ I;  2VKH A;  4ITV A;  4RAY A;  1JJ8 C;  3ZQC A;  1Z91 A;  1FP1 D;  3FDY A;  4RAF A;  3SYT A;  3ML6 A;  2QCO A;  1H9G A;  2DDA A;  2NOJ B;  4PSW A;  3H9Q A;  1Y6I A;  5F1J A;  2X85 A;  2IVM A;  4ZYA A;  3FXR A;  3WGI A;  2HYJ A;  2DJI A;  2V9P A;  4HF0 A;  3L2Q A;  3GF2 A;  1IO2 A;  1GHC A;  3HEF A;  4MHG A;  2V1D A;  1RES A;  2HDD A;  4BHB A;  4PJ0 C;  1T39 A;  4XM3 A;  3GYH X;  4IXA A;  2DN0 A;  5TJJ A;  1Z05 A;  4G7Z F;  1MSE C;  2HVS A;  1EH7 A;  3FBN B;  5ILV A;  1STZ A;  4I98 B;  4XK4 A;  2FBH A;  1VQL I;  4CSW A;  3BCA A;  1IRZ A;  3GXO A;  3GZN B;  3AAF A;  4N0B A;  3HGY A;  1B59 A;  2IT0 A;  4KFC A;  3BR0 A;  1YLF A;  4JOM A;  3WTY C;  3ZPL A;  2DTZ A;  2X4H A;  4LIT A;  4LG0 A;  3S2H J;  3K2A A;  3FKI J;  2PI0 A;  2NS7 A;  2Y2Z A;  1WJD A;  1D8J A;  2FA5 A;  1I27 A;  5E1X A;  4CZC A;  2ETH A;  2FBI A;  1G2H A;  4XQF A;  1IXS B;  1WJF A;  3V7S A;  4AID A;  2ESN A;  4GFB A;  4I01 A;  3SHF A;  2KRH A;  4EM0 B;  5DEQ A;  1HQC A;  2P4W A;  2WTE A;  2LC2 A;  2Y75 A;  2GIV A;  3U1D A;  3T0Y A;  4IHY A;  4LG3 A;  3G71 I;  5F0C A;  5H2F C;  5IP6 A;  2V9V A;  1ETV A;  1LVA A;  1IV8 A;  3CMM A;  4IX7 A;  1QGP A;  4ZDL A;  2Z1D A;  1V3F A;  4M3E A;  1JKP C;  1J09 A;  3TOB A;  1MSF C;  4E70 A;  1BIA A;  2VJ4 A;  4U7D A;  3NWT A;  3A0H C;  3SFI A;  2EPF A;  2YU3 A;  5JVG F;  3MZ8 A;  2HQN A;  4L5J A;  4AM3 A;  3TKY A;  4L0Z B;  4ZZL A;  5H20 A;  1ZAO A;  1M1E B;  3SEZ A;  3L9F A;  2ZC2 A;  3BWG A;  3QYF A;  5K7H A;  3Q3S A;  4A0Z A;  4XRS G;  5HVQ C;  2J5O A;  2R7F A;  2R92 J;  2D45 A;  2H1L A;  3K4K A;  4RS8 A;  2V79 A;  3R4K A;  1Z9C A;  1ZG3 A;  2DFF A;  2PN6 A;  2X6W A;  3NRV A;  4YEL A;  3VB2 A;  2V9K A;  2FX0 A;  5HNF A;  2JTV A;  1VTN C;  4U0W A;  2CGP A;  1OYY A;  3SQN A;  4PDK A;  3GTJ J;  4GXO A;  2NVU B;  1JE8 A;  2X1E A;  3BTI A;  2O9L A;  4BJT A;  4II2 A;  3A4C A;  3MCZ A;  2E7W A;  1TT5 B;  5TGT A;  3NAU A;  2K9L A;  2UUZ A;  1RRJ A;  3RPU A;  5B5E C;  2GM4 A;  3C2H A;  1S29 A;  2M4G A;  1AOY A;  1JKR C;  1AA7 A;  2VI6 A;  3H9G A;  1TNT A;  4IEJ A;  3HOZ J;  4E7J A;  1SFO J;  1BR2 A;  2M7B A;  2DOA A;  4F55 A;  2V1X A;  1K83 J;  1R4N B;  3GTO J;  2EFN A;  2XGE A;  1UG2 A;  3HOW J;  2CQX A;  2MH2 A;  5EEG A;  2QA4 I;  3ZMV A;  4W97 A;  1FLI A;  5DM7 F;  3HHH A;  2ZFW A;  4LGW A;  1U5T A;  4PZJ A;  3O6B B;  3GCM A;  4UVB A;  2HVR A;  1UHM A;  2WAD A;  3A02 A;  3ROU A;  4RGR A;  2GOX B;  3WU1 B;  2UXX A;  1FEX A;  2B63 J;  2BV6 A;  3GFM A;  4PJJ A;  3HJE A;  1S7A A;  5HDK A;  3IP4 B;  5FGM A;  4B8X A;  1ETX A;  4Y7N J;  1HW2 A;  1HCR A;  4UUT A;  3HUG A;  3M07 A;  2CV0 A;  3CCJ I;  1HOM A;  4S05 A;  3TOA A;  3MD2 A;  3HIF A;  2DJN A;  2ACJ A;  4IL6 C;  1U78 A;  2RQP A;  1OJL A;  1P7J A;  2HS5 A;  1L3L A;  2L9V A;  3R6S A;  2E36 A;  1RR8 C;  1R5G A;  3CCQ I;  2XSD C;  5EG0 B;  3DWL E;  5C3E J;  1QPI A;  1TT0 A;  2HFH A;  1W7P A;  3PUB A;  4HW0 A;  1QPM A;  4IHT A;  1YX3 A;  2OUM A;  4XRM A;  1VQ7 I;  4L18 B;  2QWW A;  3PFI A;  2H94 A;  2WAQ N;  2XAS A;  4PJN A;  4AVP A;  2O03 A;  1Z7U A;  3F3X A;  3ISP A;  4D0P A;  1KA8 A;  1W36 C;  2MH9 A;  3PL8 A;  1YW9 A;  5DCM B;  3RPQ A;  3J7Y J;  3WHB A;  1OCR H;  4K2E A;  4FHT A;  5CJ9 A;  3COA C;  1B4A A;  5F0H A;  4DGW B;  1HA8 A;  3Q0V A;  4NB5 A;  2K9N A;  2XB5 A;  5FKO A;  3F22 A;  4BBR J;  4MTD A;  2H8W A;  2LF8 A;  2KJB A;  3LA7 A;  3L09 A;  1L0O C;  2ELJ A;  2DAO A;  1IJW C;  2BZT A;  2KIM A;  4Q48 A;  1R23 A;  2DBB A;  4L9T A;  4RB3 C;  2EV0 A;  1OLT A;  3GLL A;  4R1H A;  2ZJP F;  4OAY A;  1MZB A;  2Y0M A;  5CVI A;  1XMK A;  2VKE A;  2F5E A;  2UXN A;  3WU2 C;  3WTW C;  1IDZ A;  1Z0X A;  2F48 A;  2O3F A;  3RKY A;  3HRS A;  1QQI A;  1P4A A;  2DMQ A;  2F4I A;  2ME6 A;  1BL0 A;  2CQQ A;  3CDH A;  3EUH A;  3K2Z A;  4MNU A;  2JK3 A;  3FXM A;  4MEX F;  2XF7 A;  1U6G A;  3KYC B;  3HOX J;  2VE8 A;  1EH8 A;  3OYE A;  1U2W A;  1ZGJ A;  3IUO A;  2JA5 J;  1MGT A;  3R0A A;  1ETK A;  4RM2 A;  2ZBK A;  1WI3 A;  1PUF A;  1Y8Q B;  3IL2 A;  3ZQH A;  3Q9S A;  3T8T A;  1TZL A;  4GDF A;  3JRC A;  1SMY F;  4GYG A;  5E17 F;  2M30 A;  1WFX A;  2OU2 A;  1XTA A;  1XGO A;  1NG7 A;  3PIP F;  4HOB A;  2JSC A;  4LIV A;  1BC8 C;  1WWX A;  2EFQ A;  4UB8 C;  1YIT I;  1VQN I;  4BAC A;  3T1B A;  4BL0 B;  2JN6 A;  2EJR A;  4A2U A;  3HXL A;  1OCZ H;  3HTS B;  2VQH A;  2L5Q A;  2L7Z A;  3HGG A;  3DPT A;  1T33 A;  2JMW A;  4KDP A;  2FUG 2;  4BU2 A;  1KZH A;  1D1C A;  2FRH A;  3OR1 C;  4KIC A;  3RYP A;  1R58 A;  2K27 A;  3GO5 A;  2E1C A;  4RBO A;  1JT0 A;  2K4B A;  1FOW A;  5AIP A;  2Q2E A;  2X1C A;  3HB9 A;  1SC7 A;  2E60 A;  3ECH A;  3P9K A;  4CHU A;  2FBK A;  2DOE A;  2GIZ A;  3H3V K;  1X1C A;  1SMT A;  4EJT A;  2IA0 A;  3U9G A;  1YYV A;  1FOX A;  3J81 Z;  4QIW N;  1ENH A;  5K5O A;  1D3Y A;  1VND A;  1IN4 A;  3HDD A;  1B1B A;  1E3O C;  3HRU A;  1LB2 A;  4HAM A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 5BMZ A;  2VC1 A;  3WGG A;  4YIF A;  5FD5 A;  1TQI A;  1YS7 A;  4ESB A;  1T2K A;  2QYO A;  2IA2 A;  1XCB A;  1K7A A;  3KEQ A;  4WWC A;  4LB6 B;  1O3Q A;  3ABT A;  3KP7 A;  1IN6 A;  3NEU A;  1KYW A;  1FT9 A;  1QZY A;  3MZH A;  4KYW A;  1HKQ A;  4M71 A;  3W6J B;  1BC7 C;  1YFH A;  2GQQ A;  2PBI A;  2PMH A;  2RKH A;  2XAG A;  1IXC A;  2M8E A;  1KU7 A;  3KP5 A;  4IRG A;  4WCG A;  2MBF A;  1KU9 A;  1X3U A;  4LK1 F;  4WXH A;  5FFZ A;  1H0M A;  1OMI A;  3ZMT A;  2GWR A;  2OQR A;  1ZLK A;  2A69 F;  1YW8 A;  4KN7 X;  1DPR A;  2EV6 A;  3CO6 C;  1XMA A;  3MWM A;  5HLI A;  2CFX A;  2VON A;  2GXG A;  5LGN A;  1PDN C;  1T0F A;  2OQG A;  3WU0 A;  5H6Q A;  2OA4 A;  2XIG A;  1XN7 A;  3RJP A;  1FBQ A;  4UUV A;  4YG2 F;  2EFO A;  5E8I A;  2P5K A;  5FO5 A;  4FT8 A;  3KP2 A;  3S2W A;  2MLG A;  3IWZ A;  1OPC A;  2ZJ2 A;  3E6C C;  3QP5 A;  4RGX A;  3P9I A;  3IRR A;  1FSH A;  2DK8 A;  5DYM A;  1SD6 A;  1FX7 A;  3WTU C;  3F8M A;  2KJC A;  3FM5 A;  1IF1 A;  3KE2 A;  1LNW A;  3KEO A;  3EYY A;  2DPD A;  4ENM A;  3KP4 A;  1LDD A;  3IWF A;  4HX7 A;  3G73 A;  1FYK A;  4HV6 A;  2BYV E;  2WWY A;  1WI9 A;  2O8X A;  2VBZ A;  1TTY A;  4HDU A;  4LLN A;  3CUQ A;  3JSO A;  2PG4 A;  1AWC A;  1IN5 A;  1QZZ A;  1SFU A;  3N4M A;  1OKR A;  4R79 A;  2MA3 A;  2XAQ A;  3I53 A;  4UXN A;  1ZGA A;  1YS6 A;  2EV5 A;  3SZT A;  1G6N A;  5J8C A;  1I6X A;  2Q0O A;  2EB7 A;  3E5U A;  2IA1 A;  4LG0 B;  3GWZ A;  3BOQ A;  5ICF A;  2G7U A;  4PGG A;  2KIF A;  3F6O A;  1U5T C;  3F6V A;  4KIG A;  5LHH A;  2ZCW A;  4AIK A;  2RVC A;  3I59 A;  2QLZ A;  3GLX A;  5HS8 A;  5KVR A;  2A6H F;  1W5T A;  4M6X A;  1HKT A;  2VE9 A;  3LA2 A;  5CVU A;  1R36 A;  2RV8 A;  5LEJ A;  3T8R A;  4Q5S F;  4FX0 A;  4LJZ F;  4M72 A;  4IRI A;  1BJA A;  1FYL A;  5BPI A;  2P6T A;  5E8G A;  1XDU A;  2XV4 S;  2GAU A;  3EET A;  4XRF A;  1PP7 U;  2HQR A;  1S7O A;  3BJ6 A;  4MQV A;  4LB5 A;  2OZU A;  5DDG A;  5L3F A;  3ZMD A;  1B6A A;  5D8L B;  2HKX A;  2IW5 A;  1RIO H;  2E7X A;  4KIF A;  2YPR A;  4LLG F;  1XGM A;  1LEA A;  3RIR A;  4ZH4 F;  1R1T A;  5J6X A;  1KQ0 A;  5J8F A;  1U5T B;  4A0Y A;  2X0L A;  2DT5 A;  1MKM A;  5BS6 A;  1W5S A;  1YW7 A;  2FNP A;  4G6Q A;  3JTH A;  5ICE A;  2PJP A;  3OV8 A;  2PLY A;  2K7L A;  4LK0 F;  4O5V A;  3KP6 A;  4ETS A;  3TDU C;  2FU4 A;  3DQV C;  3RYR A;  3HRT A;  2UWM A;  2ISZ A;  4RGS A;  2YX4 A;  5ILU A;  4CGZ A;  3KFW X;  5JVT A;  1IRG A;  1W7P B;  4B09 A;  2P8T A;  2CW0 F;  1ZLJ A;  5LBQ A;  3HSR A;  1ON1 A;  3FMS A;  3FX3 A;  1O3T A;  1I1G A;  4YFK F;  4RGU A;  5L3E A;  2H6C A;  1TW2 A;  3I4P A;  4HAM A;  4CYD A;  1IUY A;  3IKT A;  1U3E M;  2M45 A;  2FSW A;  2XAH A;  2FF4 A;  1BIB A;  4I0A A;  2OBP A;  1RUN A;  2HR3 A;  4ZYG A;  2HYG D;  2A3S A;  3MZY A;  1LDK B;  2LSO A;  2ZXJ A;  2R7D A;  4KN4 X;  3ULQ B;  2D1V A;  2Q8K A;  2WV0 A;  5ED4 A;  5K5R A;  4GO1 A;  3HRM A;  1F5T A;  3KZY A;  4XBF A;  3WTS C;  2P7C B;  4IF4 A;  2J5P A;  2RC4 A;  3HSF A;  3QPH A;  1XB4 A;  1KU2 A;  4KIB A;  3WTZ A;  4HA8 A;  2VOP A;  1A04 A;  4TV7 A;  2COM A;  1KQ9 A;  1I1S A;  4Q4Z F;  3V8J A;  4EMS A;  3H3U A;  5JR3 A;  4Y17 A;  2EA2 A;  4HBL A;  5LGT A;  4KNY A;  3LFK A;  5DCF A;  4HF2 A;  2A61 A;  2VXZ A;  4RB0 A;  4G7O F;  2QQA A;  4L0Y B;  3DV8 A;  2QVO A;  2CYY A;  4A5M A;  1F4K A;  4HV5 A;  1LEB A;  2GA2 A;  4OIQ F;  3P9C A;  2YR2 A;  2KIU A;  1ON2 A;  1TQP A;  4GCV A;  1R22 A;  3MQ0 A;  4AIJ A;  3WE2 A;  4DQ2 A;  2OD5 A;  4GGG A;  3E5X A;  2LKP A;  4OOI A;  1BBY A;  3L2C A;  3FZV A;  1J7K A;  3Q5F A;  3DF8 A;  5AON A;  2RDP A;  4BHP A;  2CG4 A;  3SFZ A;  3WTV C;  2HOE A;  3BDD A;  3BY6 A;  3E6B A;  3SXY A;  2BE5 F;  3WGH A;  3ZN1 A;  5DUI A;  3N97 A;  5BPD A;  2H6B A;  1FPQ A;  3MEX A;  4G7H F;  3R0J A;  2FQ3 A;  4P55 A;  2EFP A;  2VBW A;  4G94 A;  1BM9 A;  3H92 A;  3CUQ C;  4LLL A;  1R00 A;  2P6S A;  1UST A;  2K02 A;  4ENK A;  2RGV A;  5D6F A;  4EGZ A;  3WTT C;  2H27 A;  1G4D A;  3J7A O;  4ENN A;  3CJN A;  4BXU A;  1YG2 A;  4AIH A;  4H0E A;  4KA4 A;  4NHJ A;  2MD5 A;  2E1N A;  5FFX A;  3D0S A;  2QBY B;  1O57 A;  2QZ8 A;  2NRA C;  2VT3 A;  1W7P D;  3BRO A;  1PP8 F;  3VEP A;  3GUD A;  1ZRF A;  1TNS A;  1FWZ A;  2EK5 A;  3LWF A;  4O3M A;  3KP3 A;  1XCV A;  3HSE A;  1HXD A;  2M1B A;  4HYE A;  2FXA A;  3TGN A;  4HLY A;  2NNY A;  4RB2 C;  1O3R A;  3JSP A;  1UB9 A;  2O61 A;  4Z2Y A;  1RUO A;  3CUQ B;  3LQR A;  2ZKZ A;  2JRT A;  3WG9 A;  2NS0 A;  3GFI A;  4P9U A;  3IRQ A;  2ZO4 A;  3FMR A;  3F23 A;  2R3S A;  1ZRC A;  2L4M A;  2NAZ A;  5EEH A;  1DP7 P;  4EV0 A;  2FOK A;  3JW4 A;  3IHU A;  1R5H A;  4WXD A;  1EH6 A;  5LRR A;  3BZ6 A;  1HW1 A;  1J9I A;  4BAY A;  1B9N A;  4M9S A;  2OAZ A;  5LLQ A;  3JTG A;  4UVA A;  3TO9 A;  1ZAR A;  3E6D A;  4WF2 A;  1BOA A;  3DKW A;  3ERE D;  4I0B A;  4OIP F;  4M9X A;  3OOP A;  5JHU A;  4GYI A;  4L9N A;  1SD5 A;  1G3W A;  1HBX G;  3U2R A;  1JXS A;  2NNN A;  5DCM A;  1BI2 A;  4EM1 A;  1YQA A;  1CGP A;  1WSU A;  1K78 A;  2W24 A;  2DQR A;  4OMY A;  3E3V A;  3I54 A;  3CUO A;  1CF7 A;  2NYX A;  4L9V A;  1XSX A;  1ONV A;  2VOD A;  1FYM A;  2XGX A;  3EDP A;  4OMZ A;  1IRF A;  4CZZ A;  5A2Q K;  4BQA A;  2LF7 A;  5E1Z B;  1PUE E;  4U0V A;  3B02 A;  4F7Z A;  2Z9O A;  3FXQ A;  2ISY A;  3KLO A;  4Y15 A;  2YSR A;  4ESJ A;  4CO8 A;  2D1H A;  3FM3 A;  4ZYE A;  2PMU A;  1J75 A;  2QUF A;  5D4R A;  5DD8 A;  1RNL A;  3T5X A;  2HZT A;  1K79 A;  2EFW A;  4QWQ A;  1GVJ A;  5HDN A;  1IAW A;  3O3K A;  1ZH5 A;  3BPX A;  5D5X B;  1T6S A;  2W85 A;  4BNC A;  3IC7 A;  1JHH A;  4JBA A;  2TDX A;  1MDM A;  4UVC A;  2IP2 A;  5D6E A;  2AS5 F;  5KK1 A;  1IXR C;  5D8K B;  1O7F A;  5HS7 A;  5DD4 A;  2QQB A;  2O0Y A;  3HYI A;  2KRF A;  1JHF A;  2HWV A;  4Q47 A;  4HQE A;  1XGS A;  4ESF A;  1S3J A;  2ZNZ A;  2BBY A;  1R1U A;  3E6M A;  4L9J A;  2EWN A;  3I5U A;  2DO7 A;  2VBX A;  3ZMZ A;  4YII A;  3H3Z A;  1XDS A;  1D5V A;  2QEN A;  4UV9 A;  4HDV A;  2ELH A;  1JGS A;  2JT1 A;  3WE3 A;  3WOD F;  4KMF A;  1T98 A;  1E17 A;  1ZRD A;  4I02 A;  4L5I A;  1O7L A;  2L02 A;  1DUX C;  4LD5 A;  4EJV A;  4WK8 F;  1P92 A;  2M5W A;  4LFU A;  1G3T A;  4ON0 A;  4IRH A;  1OR7 A;  3E5Q A;  4LMY A;  5F64 A;  1YTY A;  3C18 A;  2P7V B;  5HS9 A;  4UNO A;  2GZW A;  5JI6 A;  2ZME A;  5D4S A;  5DV5 A;  1ZG5 A;  5LHI A;  2HYF A;  3V7C A;  3HOT A;  1WKM A;  4HZF A;  5HDG A;  2DW4 A;  3M1E A;  2VOO A;  1RI7 A;  2XRO A;  2DK5 A;  3K1N A;  4HX8 A;  2HEO A;  4AD9 A;  5CVR A;  3RI4 A;  2XKP A;  2Z33 A;  2RN7 A;  3MAJ A;  2K86 A;  2VC0 A;  3REO A;  2P5L C;  1TW3 A;  2DTR A;  3P7N A;  2HGC A;  5BQT A;  1LDJ A;  1J5Y A;  3JAM K;  3DXJ F;  2DQL A;  5DUK A;  2BEO A;  3ECO A;  2PEX A;  1FBU A;  1P6R A;  4IHS A;  1BI0 A;  4HX4 A;  1LQ1 A;  1ZHF A;  2GXB A;  5L3G A;  2L01 A;  5L3C A;  3K1P A;  1HSJ A;  1BI1 A;  3J80 K;  2A6E F;  4EJW A;  4QLC U;  3D5L A;  2IJL A;  5D5U B;  1LJ9 A;  2B0L A;  2STW A;  2AXL A;  2MC3 A;  1I5Z A;  5HOO A;  4XLP F;  4IVN A;  3ZMU A;  4P96 A;  4NQW A;  1SD4 A;  3BJA A;  5CLS A;  5L3D A;  4A5N A;  3V7R A;  2BGC A;  3TDZ C;  4IJA A;  4O6J A;  3QPT A;  1Z6R A;  5F6F A;  5K1Y A;  3EQL F;  1Q1H A;  4OIN F;  3DEU A;  1K6O A;  3TO7 A;  4RAZ A;  2DI3 A;  1WQ2 A;  1SFX A;  4A0X A;  2C6Y A;  4HLX A;  1G3Y A;  2XVC A;  3K1M A;  2DPU A;  5IT9 Z;  2W84 A;  2VBY A;  3V4G A;  4MQ9 F;  1V4R A;  1IN7 A;  2A5Y B;  1EV7 A;  3GX4 X;  5K5Q A;  2STT A;  2ADU A;  3ZP5 A;  5A2Q Z;  2RNJ A;  2FEZ A;  3I0T A;  3F8N A;  3LAJ A;  4FX4 A;  3HOS A;  3GEZ A;  1W4M A;  5FLX K;  1OYI A;  2XRN A;  3V8L A;  4S04 A;  4A12 A;  1UCR A;  1ZRE A;  2CQK A;  3CTA A;  1BN5 A;  1GXP A;  1J0R A;  4M9Z A;  5CVJ A;  1F1Z A;  2PFB A;  4P5O A;  1QO0 D;  4EVI A;  2GA1 A;  1FY7 A;  2JPB A;  4JK1 X;  4KMU X;  1FBS A;  2G9W A;  5D5V B;  1IW7 F;  2KKO A;  1MJB A;  3R60 A;  4MEY F;  1K78 B;  2A07 F;  2FE3 A;  2DLL A;  5E20 A;  2HTS A;  1DDN A;  3GZ5 A;  3M8F A;  2W57 A;  2UZK A;  5LGU A;  1ZG1 A;  3QU6 A;  1CF7 B;  4MGR A;  2ZNY A;  4OIR F;  4EJU A;  1DPU A;  3QAH A;  3ELK A;  1XSD A;  3W6K B;  3ZQ7 A;  1HST A;  5HLH A;  2F5C A;  1FOK A;  3K0L A;  3I71 A;  3TO6 A;  2XUB A;  4G9Y A;  4IPA A;  4OU0 A;  4A6D A;  1P4W A;  3QP6 A;  3O2P E;  1FZP B;  3CO7 C;  3LA3 A;  2XHK A;  3R61 A;  1Z6T A;  3F8B A;  2Y48 A;  3IKV A;  2IRF G;  4MTE A;  2PQ8 A;  3BP8 A;  3DP7 A;  2FMY A;  1WRJ A;  4UHT A;  1P4X A;  4I09 A;  4EQQ A;  3E97 A;  1J2X A;  1S6L A;  3DFG A;  1SD7 A;  1MDM B;  2QM3 A;  4XSX F;  4XLN F;  2HTJ A;  1ZYR F;  4HQM A;  4CDG A;  3WTX C;  2VN2 A;  2K4J A;  3GFJ A;  2XAJ A;  3I58 A;  3PQJ A;  1D8K A;  1U8R A;  2XKO A;  1O3S A;  5ICC A;  2FNA A;  4AWX B;  5D5W B;  5LHG A;  1TLH B;  3M9A A;  3KCC A;  1RZ4 A;  4U7B A;  5CYV A;  4OIO F;  4UV8 A;  4R8H A;  2F5F A;  3CLO A;  2JZY A;  4G8X A;  5LEK A;  1MD0 A;  2G7H A;  3PQK A;  1NHA A;  5FD6 A;  1YO5 C;  1XGN A;  1KU3 A;  1Y0U A;  1USS A;  1MJA A;  1UHW A;  2O6G E;  1UFM A;  1FP2 A;  1KGS A;  4ZZD A;  1IN8 A;  4I2O A;  3I59 B;  2FML A;  3JAM Z;  4U0Y A;  1HKS A;  4ASN A;  3RTR A;  4BHC A;  1FSE A;  3HHG A;  4RB1 A;  3F8F A;  4CXF A;  1R7J A;  3VOD A;  1C0W A;  3GFL A;  1P2F A;  3FF5 A;  1YIO A;  5IT9 K;  3FWE A;  5BOX A;  5LRS A;  3B73 A;  4ZYH A;  1H9T A;  5CVV A;  4WX9 A;  3GZ6 A;  3J80 Z;  4N9I A;  1HW5 A;  2L4A A;  5E18 F;  2Z5U A;  3EYI A;  3RDI A;  4EM2 A;  3LAP A;  2HDC A;  4N9H A;  3HTU A;  2LNB A;  1SFE A;  2ZME B;  2A68 F;  2P5V A;  4YFX F;  4ENJ A;  3TQN A;  2M87 A;  3M8E A;  2CWE A;  4I7H A;  1T38 A;  2EA4 A;  3FXU A;  2MLK A;  3NQO A;  3VOE A;  5F1R A;  3ZMS A;  4XSZ F;  2QBY A;  5ICG A;  2CSO A;  1IZ1 A;  3ZN0 A;  1QNT A;  3GVA A;  4CIC A;  2V1U A;  2F2E A;  4BYY A;  3SZP A;  4G6D A;  4M74 A;  3I64 A;  1F9N A;  3ABU A;  5IT3 A;  1G3S A;  4KUM A;  3MFK A;  5E1W A;  2W25 A;  5ERI A;  3F21 A;  1B9M A;  3C1D A;  1TQM A;  3V8K A;  3KLN A;  2Z3Y A;  5H6R A;  1ZN2 A;  2YX7 A;  6PAX A;  2JPC A;  4EJO A;  1TBX A;  2Z99 A;  4P9F A;  3GW2 A;  2DFI A;  2LDU A;  2L54 A;  3L00 A;  1R1V A;  2DU9 A;  4Y13 A;  3BPV A;  3BJO A;  3M7G A;  5FLX Z;  1FNN A;  1OYW A;  1ULY A;  4YFN F;  4M6Y A;  4M73 A;  3Q9V A;  2F5D A;  3F8C A;  2CO5 A;  3DPL C;  1KYZ A;  2OZ6 A;  3L7W A;  1Z1D A;  3FHZ A;  5AIQ A;  4HF1 A;  1FC3 A;  4JQF A;  4KT5 C;  2VT2 A;  4WXC A;  5JFR A;  4U88 A;  1KQ8 A;  3RKX A;  4PGH A;  5ILS A;  3QRF F;  2H09 A;  3LST A;  2L3D A;  3KET A;  1GXQ A;  1MJ9 A;  2ESH A;  2WC2 A;  5TRD A;  1ODD A;  2HKO A;  3C7J A;  3C3W A;  3K9T A;  4EGY A;  5HLG A;  1BI3 A;  1SAX A;  3QU3 A;  3VFZ A;  3J81 K;  4BH9 A;  1J59 A;  1XD7 A;  3LQQ A;  1E2X A;  1QBJ A;  3FMQ A;  2IPQ X;  4ZYD A;  1S8N A;  4DNC A;  4PCQ A;  1REP C;  2QQ9 A;  2XAF A;  5L3B A;  3F72 A;  1XSV A;  3G3Z A;  3RKW A;  4A6E A;  3QOP A;  2V6C A;  3K69 A;  2D2W A;  4RAY A;  1Z91 A;  1FP1 D;  3ML6 A;  1H9G A;  2IVM A;  3WGI A;  3FXR A;  4HF0 A;  3GF2 A;  1GHC A;  4MHG A;  2V1D A;  4BHB A;  1T39 A;  3GYH X;  4IXA A;  5TJJ A;  4G7Z F;  1Z05 A;  1EH7 A;  5ILV A;  1STZ A;  4I98 B;  2FBH A;  3GXO A;  3AAF A;  4N0B A;  1B59 A;  2IT0 A;  4KFC A;  1YLF A;  3WTY C;  3ZPL A;  2X4H A;  4LG0 A;  2PI0 A;  1D8J A;  2FA5 A;  1I27 A;  5E1X A;  2ETH A;  2FBI A;  1IXS B;  3V7S A;  2ESN A;  4I01 A;  3SHF A;  4EM0 B;  5DEQ A;  1HQC A;  2P4W A;  2WTE A;  2Y75 A;  2GIV A;  3U1D A;  3T0Y A;  2V9V A;  1LVA A;  1QGP A;  1V3F A;  3TOB A;  4E70 A;  1BIA A;  4U7D A;  2YU3 A;  2HQN A;  4L5J A;  3TKY A;  4L0Z B;  4ZZL A;  5H20 A;  1ZAO A;  3L9F A;  3BWG A;  4A0Z A;  5HVQ C;  2J5O A;  2R7F A;  2D45 A;  4RS8 A;  2V79 A;  3R4K A;  1Z9C A;  1ZG3 A;  2PN6 A;  3NRV A;  3VB2 A;  2JTV A;  1VTN C;  4U0W A;  2CGP A;  1OYY A;  3SQN A;  4PDK A;  4GXO A;  1JE8 A;  3MCZ A;  2E7W A;  3RPU A;  1S29 A;  1AOY A;  1TNT A;  2V1X A;  2EFN A;  2MH2 A;  5EEG A;  3ZMV A;  1FLI A;  3HHH A;  2ZFW A;  4LGW A;  1U5T A;  4PZJ A;  3O6B B;  4UVB A;  1UHM A;  3ROU A;  4RGR A;  3WU1 B;  2UXX A;  2BV6 A;  3GFM A;  1S7A A;  5HDK A;  5FGM A;  4B8X A;  1HW2 A;  3HUG A;  4S05 A;  3TOA A;  3HIF A;  2ACJ A;  1U78 A;  2RQP A;  2HS5 A;  1L3L A;  3R6S A;  1R5G A;  2HFH A;  4HW0 A;  1W7P A;  1QPM A;  4IHT A;  4L18 B;  2QWW A;  3PFI A;  2H94 A;  4AVP A;  2XAS A;  2O03 A;  1Z7U A;  3F3X A;  3ISP A;  4D0P A;  1KA8 A;  2MH9 A;  1YW9 A;  5DCM B;  3RPQ A;  4K2E A;  4FHT A;  5CJ9 A;  3COA C;  1B4A A;  4NB5 A;  3F22 A;  4MTD A;  2LF8 A;  2KJB A;  3LA7 A;  3L09 A;  1L0O C;  2DAO A;  2KIM A;  4Q48 A;  1R23 A;  2DBB A;  4L9T A;  4RB3 C;  2EV0 A;  4R1H A;  1MZB A;  2Y0M A;  5CVI A;  1XMK A;  2F5E A;  2UXN A;  3WTW C;  2O3F A;  3RKY A;  3HRS A;  1QQI A;  1P4A A;  3CDH A;  3EUH A;  3K2Z A;  4MNU A;  4MEX F;  1U6G A;  2VE8 A;  1EH8 A;  1U2W A;  1ZGJ A;  1MGT A;  3R0A A;  2ZBK A;  3IL2 A;  3Q9S A;  3T8T A;  1SMY F;  4GYG A;  5E17 F;  2M30 A;  2OU2 A;  1XGO A;  4HOB A;  2JSC A;  1BC8 C;  1WWX A;  2EFQ A;  3T1B A;  2EJR A;  4A2U A;  3HTS B;  3DPT A;  4KDP A;  2FRH A;  4KIC A;  3RYP A;  1R58 A;  2K27 A;  3GO5 A;  2E1C A;  2K4B A;  5AIP A;  2Q2E A;  3ECH A;  3P9K A;  4CHU A;  2FBK A;  1SMT A;  4EJT A;  2IA0 A;  3U9G A;  1YYV A;  3J81 Z;  5K5O A;  1D3Y A;  1IN4 A;  1B1B A;  3HRU A;  1LB2 A;  5FB2 A;  3KZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...