1MDMA

Inhibited fragment of ets-1 and paired domain of pax5 bound to dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
GVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAX5/ETS BINDING SITE ON THE MB-1 PROMOTER
publication title STRUCTURAL ANALYSIS OF THE AUTOINHIBITION OF ETS-1 AND ITS ROLE IN PROTEIN PARTNERSHIPS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA02
1WI9A 5FD5A 3G3ZA 4IRHA 4U0YA 5HDGA 1W7PD 2R7DA 3LA7A 3R60A 5H20A 4B09A 2IRFG 3FMSA 5ILUA 1I6XA 1Z91A 2VOOA 1R36A 1J75A 2UWMA 3MQ0A 1TW2A 4LFUA 4MNUA 3REOA 3KP5A 1D8JA 5DEQA 1FBSA 2G9WA 4MGRA 4HV5A 1RIOH 4RB1A 4UVBA 1GVJA 3RKWA 1UHWA 1AOYA 2Q2EA 4DQ2A 4YIFA 4HDVA 3FM3A 1B1BA 4L9TA 2HQNA 4RS8A 4I0BA 2OQRA 5DD4A 1EH8A 2JPCA 2O61A 3VEPA 1XDUA 1BI0A 1BI2A 2H27A 3SXYA 2NYXA 1JE8A 3V7RA 1BM9A 2ZNYA 1LB2A 5LRSA 3SZPA 3T5XA 1JHHA 5DUKA 5TRDA 3AAFA 2ESHA 3I0TA 5JVTA 4LJZF 1KYWA 1T0FA 4BQAA 3KCCA 1FT9A 3ZMDA 2QENA 4FT8A 3V4GA 1C0WA 2P4WA 1AWCA 4WCGA 1MJ9A 3R6SA 2EB7A 1A04A 4G6QA 1BIAA 1KU9A 2ZFWA 5K5RA 4UHTA 1SFEA 1VTNC 2VBXA 4HDUA 3CO7C 5CVUA 5LEJA 1I1SA 2JTVA 1H9TA 3IWZA 1U3EM 1YS6A 4BH9A 1XCBA 4ZYHA 5LHIA 3JAMZ 1KQ8A 4HF1A 5H6RA 2F2EA 2ELHA 3ZP5A 4AD9A 1USSA 1XGOA 4OIRF 3LA2A 1U8RA 1ZLJA 3FXRA 5HS8A 2VT2A 4BHPA 4LG0B 1EH6A 4P9FA 1SFUA 3HHHA 4YIIA 3ERED 2HZTA 3E6DA 4G94A 2K4BA 1S8NA 5FO5A 3QRFF 2VXZA 3IL2A 3HOTA 2CGPA 2PEXA 3PQKA 1RUOA 1Z6RA 2K27A 3U9GA 4LG0A 4XRFA 2L02A 3CDHA 4CZZA 3V8JA 4ZYGA 5D6FA 3HRMA 1XMKA 1WKMA 2TDXA 1B59A 2DQLA 4OOIA 4UNOA 1W5TA 2LSOA 2XROA 4KN4X 3DXJF 3H92A 3GZ6A 4M9ZA 4LLNA 3LWFA 4N9HA 2RDPA 5CLSA 3I64A 3KP6A 4ZZDA 1KYZA 2HDCA 5D5XB 1B9MA 3I58A 2V1XA 1QNTA 4CYDA 4YFKF 1R1TA 2CG4A 3K1NA 4RGUA 5E1XA 2IVMA 4IF4A 1T2KA 1LJ9A 2P5LC 2QQAA 2A61A 2ZKZA 3WGIA 1R1VA 4M71A 3DP7A 2M5WA 2VN2A 1SD5A 3GFLA 2EFWA 4A6EA 3EQLF 4M73A 4RAYA 1R1UA 5CJ9A 4A6DA 3RPUA 3RI4A 1OYIA 2Q0OA 1LDDA 4IRGA 4IJAA 4P96A 2V9VA 2O8XA 1IN5A 3FHZA 4HV6A 4HLYA 5D4RA 3TDUC 4EVIA 2Q8KA 4OU0A 2WTEA 3KP4A 1STZA 2IA0A 2IW5A 3F3XA 3F22A 2H6BA 3BDDA 4WF2A 1PP8F 3ZMSA 1FYLA 2GXGA 3V7SA 2XIGA 2DLLA 3P9KA 4O5VA 2HR3A 3TDZC 2NNNA 2E1NA 2GAUA 1G3SA 3DKWA 3M8EA 1YW7A 3IKVA 2OBPA 5FGMA 4CO8A 5A2QZ 1LVAA 3VODA 5F6FA 3J80K 1HW2A 2XV4S 4TV7A 4WK8F 4E70A 2IA2A 5ICCA 4I98B 5JFRA 1MKMA 1SAXA 2R7FA 3LSTA 3U1DA 3JSPA 2ZO4A 2ZMEA 3RTRA 3F8NA 3F8BA 4K2EA 3KETA 1KGSA 1U6GA 2BYVE 3E97A 2CQKA 5J6XA 1HKQA 2K02A 3EYIA 2W84A 1Q1HA 2P7VB 1FYMA 2GXBA 4BHBA 4Z2YA 3CTAA 4WWCA 3P7NA 4QLCU 4FHTA 5DDGA 2LDUA 3WE2A 2A6EF 2CO5A 2Z3YA 3F6VA 3SFZA 4LLGF 2DFIA 3GF2A 5FLXZ 3GUDA 4UVCA 1IN8A 3E3VA 5DV5A 3JW4A 1F4KA 2RV8A 2UZKA 4A5MA 1TQMA 4ENNA 3K1PA 2RN7A 4CXFA 1ZLKA 1QZYA 3BJAA 2BV6A 4KYWA 1H0MA 3ZPLA 3C7JA 1FC3A 1V3FA 1XDSA 4AWXB 1IZ1A 2A3SA 5K5QA 2P7CB 1ZG1A 2W85A 2L4AA 3TO7A 5BQTA 1FSEA 1TLHB 2KRFA 2XAFA 3ULQB 4AIKA 1IXCA 3QPTA 2IA1A 2MLKA 4Y17A 4XLPF 3HSEA 1J9IA 4ENJA 1EH7A 2J5OA 2F5FA 2P5KA 3RPQA 1YS7A 4RB3C 3KP3A 1SD4A 4YG2F 2A5YB 4KMFA 5HVQC 3R4KA 4OIPF 5ICGA 1ZRCA 3M8FA 5ICEA 3JSOA 4EGYA 5AONA 2JT1A 3H3UA 3BROA 3H3ZA 1ON2A 4I02A 4RGXA 2FMYA 1O7FA 5E8GA 3CUOA 5F64A 3J81K 5E1ZB 3WGHA 2O3FA 2C6YA 4I09A 1DP7P 1U5TB 1YQAA 2MA3A 3C3WA 1LEBA 4MEXF 2KIUA 4HW0A 4Q47A 3ABTA 3BJOA 2LKPA 4I01A 3V7CA 4OIQF 2Y75A 3SZTA 2KIFA 1U5TA 1P92A 4XSXF 1F1ZA 2VE8A 1RZ4A 3L9FA 4WXHA 2ZNZA 2EA2A 1FZPB 2FSWA 3BZ6A 4DNCA 2H09A 3FMQA 3ZQ7A 1P2FA 5AIQA 3BOQA 3ISPA 1MZBA 3V8LA 4LMYA 2ACJA 2M30A 2STWA 2NS0A 4EJTA 3ECHA 3NEUA 4EMSA 3RIRA 2EFPA 4EJUA 3T0YA 4ZYEA 4EJWA 3GEZA 4GXOA 3HHGA 1BI3A 1TW3A 1W7PA 1IXRC 3EUHA 4JQFA 3E5XA 1Z7UA 1FWZA 2QWWA 3FM5A 1XCVA 4BNCA 2PBIA 2IT0A 4RGSA 3TQNA 1R7JA 2Z99A 5HS9A 1D8KA 5LLQA 1FY7A 3MEXA 5K1YA 2MLGA 2UXXA 3HSFA 2YX4A 3KZYA 2G7UA 5HOOA 5LBQA 4L0ZB 5ILVA 3VB2A 4XLNF 1S6LA 2PI0A 4HQEA 3E6CC 1ZGJA 1G3YA 1OYYA 1GHCA 1ODDA 2HQRA 4UV9A 3KE2A 2CFXA 5CVVA 1DPRA 2EK5A 4UXNA 1K6OA 1IN7A 2MC3A 5BOXA 1NHAA 1XGNA 3O2PE 2FXAA 2F5EA 2CW0F 4KIBA 3C1DA 4MEYF 3B73A 2ESNA 1SMYF 3OOPA 4BYYA 3M7GA 3MFKA 4ENMA 3TGNA 1DDNA 5L3CA 5BPDA 2AXLA 1REPC 1OKRA 5KK1A 1KQ0A 2P8TA 3BJ6A 5DCFA 2ISYA 3GO5A 2MH2A 1B4AA 2Z5UA 2H6CA 3BP8A 3QAHA 2HGCA 1S7OA 3DEUA 3BWGA 3FMRA 2Z9OA 5IT3A 2NRAC 3R0JA 5LHHA 2UXNA 1RUNA 2Z33A 1BBYA 2DU9A 5LRRA 4KA4A 2WC2A 1FLIA 4LB5A 1SD7A 3RYPA 1XGSA 2O6GE 4ZYDA 4CGZA 4JK1X 1IN6A 3JTGA 3CUQC 3FXQA 5D8KB 2OA4A 3GWZA 3I4PA 1G6NA 4UV8A 1U78A 3GFJA 5KVRA 5IT9Z 3DF8A 2K7LA 2LNBA 3WTUC 3N4MA 4IHTA 1SMTA 2EFNA 5L3EA 3I53A 1O7LA 1ZREA 2DPDA 2QBYB 4U7BA 4ESFA 3GX4X 1ONVA 4KMUX 2EJRA 1RI7A 5HLIA 4EV0A 2FBHA 2M8EA 4O6JA 3JAMK 1HKSA 2K86A 1DUXC 1XSXA 3NRVA 3QPHA 2P6TA 2ZBKA 3GLXA 4A0ZA 2VE9A 1QBJA 2QBYA 1PUEE 1X3UA 2FE3A 6PAXA 1XN7A 1ZYRF 2HTJA 1MGTA 4L18B 2PFBA 1QGPA 4KT5C 1ZGAA 4IHSA 5E18F 2VBWA 2PJPA 2DAOA 5E20A 1UHMA 2PG4A 3KEOA 1YW9A 4L9VA 3FXUA 3W6JB 3HRSA 3QP5A 2VC1A 3RKYA 1Z1DA 3KLNA 3J80Z 1FNNA 2HS5A 3F23A 1ZRDA 2PMUA 3B02A 5ERIA 2QZ8A 5E17F 4MTEA 3CLOA 3TO6A 4HX4A 2XKPA 1LEAA 3K0LA 2ZJ2A 4ESJA 4I0AA 2Y48A 3TKYA 4MQ9F 5CYVA 4U0WA 5D5VB 1B6AA 5L3FA 4LK1F 1FBUA 3ROUA 3HTUA 1FP1D 2DI3A 5BS6A 3COAC 1HSJA 1FX7A 1BN5A 4ETSA 2IJLA 1IRFA 1YO5C 1R22A 4CDGA 4N9IA 3LAPA 3SHFA 1OR7A 3GXOA 1J0RA 3ZN0A 2CWEA 3I54A 2QQBA 2FBIA 1F9NA 1IN4A 2QQ9A 1QO0D 2AS5F 2VBYA 2ZXJA 2P5VA 2ISZA 2GWRA 3EYYA 4I7HA 4BXUA 2ZMEB 2ADUA 2YR2A 1O57A 3ZMUA 3HRUA 5HDKA 3NQOA 1E2XA 1GXPA 3WTWC 2KJBA 4HOBA 2EV6A 5F1RA 2M87A 1R00A 4NB5A 5LGUA 1ZN2A 3EDPA 1D3YA 2GIVA 4U88A 3O6BB 3T8TA 3Q5FA 2G7HA 3ZMTA 4PGGA 2QLZA 3WTYC 1PP7U 3G73A 1KA8A 5LGTA 4HF2A 3CJNA 4EM2A 1F5TA 2FBKA 3SQNA 1KQ9A 1I1GA 2D1HA 2PMHA 2XRNA 5FB2A 3V8KA 3I5UA 1ZG3A 4ASNA 4A0YA 2GA1A 2FU4A 1LNWA 5LEKA 3KP7A 1YIOA 2F5DA 5L3DA 2A07F 4GYIA 3KEQA 3WG9A 1TNTA 5D5WB 1Y0UA 3T8RA 5HLGA 2FMLA 2FRHA 2VC0A 1IAWA 1LDKB 3BPXA 4HBLA 3ZMVA 1TNSA 3PQJA 5CVRA 1YFHA 2KIMA 2XAQA 4GO1A 1XSDA 2L3DA 5LHGA 1MDMB 1K78A 4F7ZA 1WRJA 5FFZA 4ZZLA 3MZHA 4GCVA 2DK5A 2A68F 2O0YA 3L7WA 1BIBA 4PDKA 2WV0A 4HYEA 2A6HF 1R58A 3F72A 1TBXA 2OQGA 2Y0MA 1MDMA 1S29A 1Z9CA 1CF7A 5FLXK 1HBXG 2DQRA 1IUYA 1GXQA 2E1CA 3DPLC 4AVPA 4A5NA 3MCZA 2FA5A 3Q9VA 3PFIA 1H9GA 1K79A 2D1VA 3TOBA 4PGHA 2V1DA 2VOPA 2JRTA 3D0SA 2P6SA 1W5SA 4XSZF 1FSHA 1J5YA 1IF1A 3IHUA 4R79A 2MBFA 1R5GA 5FFXA 5L3BA 5BPIA 4M72A 4Q4ZF 1BJAA 1MJAA 1V4RA 2EFOA 1P4AA 2W57A 2HTSA 4IVNA 1J2XA 2XUBA 2XVCA 4Y15A 1G3TA 5D8LB 4S04A 2E7XA 1I5ZA 2VT3A 1XMAA 4P9UA 2NAZA 3MAJA 1LDJA 1MD0A 1WWXA 1JGSA 4ZH4F 2V1UA 3HSRA 1RNLA 1W7PB 4IPAA 4G7OF 4A0XA 3L00A 2L01A 5D6EA 2R3SA 2BBYA 4KIGA 4G7ZF 1U2WA 2NNYA 1HW5A 3FX3A 4UUVA 2M45A 5ICFA 1QQIA 3O3KA 4S05A 1UFMA 5DCMB 2VODA 5BMZA 1BC7C 1T38A 3L2CA 4HX8A 1L0OC 3WU1B 2RVCA 1HKTA 2F5CA 1T39A 1D5VA 5DCMA 1YTYA 4KICA 2YSRA 3OV8A 2MD5A 3F8CA 3KFWX 4OMZA 2XGXA 3M1EA 4L5JA 1LQ1A 1R5HA 5CVJA 3GFMA 2XASA 4YFXF 3T1BA 2K4JA 4N0BA 4LK0F 1FP2A 4KN7X 3RKXA 2OZUA 1UB9A 2FNPA 2QUFA 3GW2A 1YYVA 1ON1A 3KLOA 4ENKA 1IXSB 4RAZA 3WGGA 4ON0A 3RJPA 3RYRA 4WXCA 4P55A 2V79A 1TTYA 5J8CA 3TOAA 1HXDA 1QZZA 5LGNA 1T98A 4Q5SF 4YFNF 4MTDA 2FNAA 4OMYA 3JTHA 5JHUA 3M9AA 3P9IA 4EQQA 3GVAA 1ZG5A 2YU3A 3D5LA 3ZN1A 2O03A 3DPTA 3U2RA 1E17A 3I59B 1USTA 5HS7A 1Z6TA 3Q9SA 3K1MA 1ZRFA 3N97A 3ABUA 2OZ6A 1R23A 5AIPA 4JBAA 4U0VA 2RC4A 3I59A 3E6MA 2COMA 4HAMA 4O3MA 1BI1A 3K9TA 3DV8A 2XHKA 4CHUA 2RGVA 4KIFA 5J8FA 4EJOA 4WX9A 2QM3A 1JHFA 2D2WA 4LLLA 3L09A 3QU3A 4EM1A 2E7WA 3LAJA 2DW4A 2BEOA 2KJCA 2L4MA 4RB2C 3F6OA 4G7HF 5DUIA 1B9NA 1O3QA 5DYMA 1CGPA 1YLFA 3E6BA 1J59A 2MH9A 2DBBA 1OPCA 1FPQA 3F21A 4Q48A 4M9SA 4QWQA 3K2ZA 1BC8C 1SD6A 2VBZA 4MHGA 2OU2A 3W6KB 4GGGA 4R1HA 5H6QA 3R0AA 2L54A 3WTZA 3P9CA 5JI6A 3GYHX 2M1BA 1JXSA 2CSOA 2IP2A 2B0LA 2PN6A 3WTSC 3DFGA 2XAHA 3LFKA 2DO7A 2XAJA 2XAGA 1TQPA 4A2UA 4I2OA 5K5OA 4G8XA 4ESBA 1P4XA 1WSUA 4BAYA 3E5QA 5HDNA 2EV5A 2XKOA 4R8HA 2JSCA 5DD8A 4HA8A 4Y13A 4IRIA 1EV7A 4OINF 2FF4A 5IT9K 3ML6A 2J5PA 3WODF 1KU7A 4G6DA 4BHCA 1XGMA 2DTRA 5FD6A 4FX0A 4RGRA 1KU2A 1T6SA 4LB6B 3HUGA 3WTVC 5D5UB 2EFQA 4M6YA 2HYGD 1W4MA 3R61A 4L0YB 5CVIA 2W24A 2HKXA 4NQWA 5JR3A 4GYGA 4FX4A 1BOAA 1I27A 1HSTA 3LQQA 4L9JA 2PLYA 2DT5A 2YX7A 4MQVA 2OD5A 2LF7A 3CO6C 1P6RA 3HRTA 3FZVA 2JPBA 1MJBA 2BE5F 3WE3A 2HEOA 3LQRA 5L3GA 3I71A 3CUQB 3WTXC 4IXAA 3TO9A 2BGCA 2PQ8A 4OIOF 4HF0A 4M6XA 2HFHA 1K7AA 1U5TC 2QVOA 2IPQX 3FF5A 4AIJA 1UCRA 4D0PA 3KZZA 3CUQA 5E1WA 2RNJA 1FYKA 1S3JA 3FWEA 2D45A 3BPVA 4PZJA 2LF8A 1FBQA 3DQVC 5E8IA 3IRQA 4HZFA 4U7DA 5ED4A 3GFIA 2FOKA 1YW8A 2GZWA 5HLHA 1J7KA 5A2QK 1XD7A 4M74A 3MZYA 2YPRA 4M9XA 3IRRA 2EV0A 3HOSA 2HWVA 1P4WA 2HOEA 4H0EA 4B8XA 2FEZA 1HQCA 4NHJA 4EGZA 4KNYA 2WWYA 4L9NA 1FOKA 1ZH5A 3J7AO 1PDNC 3HTSB 3EETA 2FQ3A 2H94A 3J81Z 4XBFA 3HIFA 2ZCWA 3VOEA 2EWNA 1K78B 5D4SA 4HQMA 4KFCA 2DPUA 1KU3A 4L5IA 2HKOA 3K69A 2EA4A 1IW7F 4UVAA 2RKHA 1TQIA 4AIHA 1OMIA 1ZARA 2HYFA 5ILSA 3KP2A 2DK8A 3BY6A 1S7AA 1CF7B 3WU0A 2JZYA 3IKTA 3WTTC 2ETHA 1ZAOA 3IWFA 3HYIA 1WQ2A 4KUMA 2KKOA 2CYYA 1G3WA 3GZ5A 1XSVA 4EM0B 1O3RA 2A69F 4RB0A 1DPUA 4CICA 3S2WA 5EEHA 4HLXA 1ULYA 1IRGA 5TJJA 5EEGA 2OAZA 3VFZA 2STTA 1ZHFA 3F8MA 4G9YA 4KDPA 3MWMA 3QU6A 3QOPA 1QPMA 3IC7A 3C18A 1YG2A 3ECOA 1O3TA 4HX7A 2GQQA 2X0LA 3E5UA 4P5OA 4PCQA 3LA3A 2RQPA 4LGWA 3ZMZA 1Z05A 4A12A 1SFXA 2X4HA 2V6CA 2QYOA 4LD5A 1L3LA 3RDIA 2VONA 3F8FA 2W25A 2GA2A 3ELKA 1HW1A 1G4DA 1XB4A 3QP6A 4EJVA 1O3SA 4WXDA 1OYWA
chains in the Genus database with same CATH superfamily
1P7IA 1WI9A 5FD5A 3G3ZA 2YU9J 2V9KA 4IRHA 5JHFA 4U0YA 4A3MJ 1K4SA 3P5JA 1ZQ3P 5HDGA 2CV1A 3HOXJ 3AKZA 3B6AA 5J1UA 2O5RA 3OIOA 4U87A 1W7PD 2R7DA 3LA7A 3R60A 5E3MA 2VLAA 5H20A 4B09A 4KT6A 2WAEA 2M4KA 2IRFG 3FMSA 2NVUB 5ILUA 3ZQCA 1I6XA 1Z91A 3BR3A 4E7ZA 2VOOA 1R36A 4IKFA 1J75A 2UWMA 3MQ0A 1TW2A 4LFUA 4MNUA 3REOA 5F0CA 1WH5A 3LSGA 2BHZA 3K4CA 4BBSJ 2Q2EB 2WY8Q 3KP5A 4QPOA 5DEQA 1FBSA 2G9WA 1D8JA 2H8WA 2BXZA 4XN0A 5TGTA 4MGRA 4HV5A 4BJ6C 2MYSA 1Z3YA 1PVEA 1RKWA 2GOMA 1YJNI 1RIOH 1Y8QB 4RB1A 1VQOI 3RSNA 3K10A 4L5EA 4I76A 1AKHB 4UVBA 1GVJA 3RKWA 1UHWA 1AOYA 2Q2EA 2MABA 4DQ2A 4YIFA 2DDAA 4HDVA 2FUG2 1WI3A 3FM3A 1B1BA 3DTKA 2XAUA 4L9TA 5EG0B 1HDPA 2HQNA 4RS8A 4I0BA 2OQRA 3K4NA 5DD4A 1EH8A 1AKHA 3BR1A 2JPCA 2O61A 1V54H 3VEPA 1XDUA 1BI0A 1BI2A 2V4JC 2I8DA 2JA2A 3SXYA 2H27A 2NYXA 1JE8A 2NVQJ 1W5CC 3GTPJ 2AQFA 4IO9F 5EG0A 3MKLA 3V7RA 1ERDA 1BM9A 2ZNYA 4A3BJ 5DM6F 1BL0A 5J1RA 5DS9A 2JA8J 1LB2A 5LRSA 3SZPA 3CCSI 1ZGWA 3T5XA 2WAQN 4CZCA 2BVLA 5FKNA 1JHHA 1QRYA 2ZXIA 5DUKA 4UB6C 5TRDA 2KL4A 3AAFA 2ESHA 3I0TA 5F27A 5JVTA 3E7LA 3M8JA 4LJZF 3IUOA 4DZJA 3RZOJ 1KYWA 1T0FA 4BQAA 2XRLA 3QPLA 3KCCA 1FT9A 3ZMDA 3HGGA 2QENA 3HPGA 4FT8A 3V4GA 1ZR2A 2P4WA 1Y1VJ 1C0WA 4PK4A 1AWCA 4WCGA 1MJ9A 3R6SA 2EB7A 5B3SH 2XDVA 4XICA 3HKZA 2DTZA 3HDDA 1YOVB 1A04A 4G6QA 2MGQA 1BIAA 1KU9A 1MMNA 2Y9ZA 3CC2I 4FE7A 3OYLA 2ZFWA 5K5RA 4UHTA 1SFEA 1H8AC 1VTNC 2I10A 4QSHA 3GTGJ 2VBXA 1OR7C 4HDUA 3CO7C 5CVUA 5LEJA 1I1SA 2JTVA 1H9TA 3IWZA 1U3EM 2WAFA 4PJJA 1YS6A 4BH9A 1XCBA 1S7EA 1I3QJ 4DBRA 4ZYHA 1YJWI 3UKGA 5LHIA 3JAMZ 1POGA 1KQ8A 4HF1A 5H6RA 3FXKA 2VL8A 2ELHA 2F2EA 1BJZA 2QEXI 3ZP5A 2V26A 4AD9A 3VYRB 2L7MP 2VPLA 1FMWA 1USSA 3JREA 4OWRB 3BZCA 1XGOA 4OIRF 1IC8A 3LA2A 3DTIA 4M3BA 1U8RA 4BY7J 1ZLJA 2Z16A 3FXRA 5HS8A 3AL0C 2VT2A 5M5XJ 4C3HJ 4BHPA 2JRMA 4HEA2 1EH6A 4LG0B 4PJ0C 3L1PA 1QZEA 4P9FA 3FBIB 3K4KA 1SFUA 3MN2A 3HHHA 4YIIA 1VQ8I 3ERED 1P9QC 2HZTA 3E6DA 3FK7A 1VQLI 1LKXA 3NAUA 4G94A 4ZDLA 2LY2A 2K4BA 1S8NA 5FO5A 5LD2C 3QRFF 3BQYA 5JVGF 2VXZA 1V55H 2X85A 3E0JB 3IL2A 3HOTA 2CGPA 2PEXA 3PQKA 1RUOA 2XB0X 3GTKJ 1Z6RA 2K27A 3U9GA 4LG0A 4XRFA 3BCBA 2L02A 1NK2P 3ABKH 3CDHA 4CZZA 2DT7B 2F4MB 3V8JA 3DCFA 4ZYGA 2M7BA 5D6FA 3HRMA 2WV1A 4LG3A 1XMKA 2JA5J 1WKMA 2TDXA 1B59A 3SEQA 2DQLA 4OOIA 4UNOA 5CPRB 3OYKA 1VFCA 1W5TA 2LSOA 1W36C 3JCUC 2E2HJ 5E3NA 2XROA 4IHYA 5GAEJ 4KN4X 1HDDC 3DXJF 3K4JA 5CKTA 4BKXA 3H92A 2YS9A 3GZ6A 4JX6A 3WHBA 4M9ZA 4LLNA 2VASA 3LWFA 4XORA 4N9HA 1TWCJ 2CV2A 2K3FA 1VQ6I 2RDPA 3GCMA 4DOZA 5CLSA 3I64A 3KP6A 3TEDA 1WZ2A 4ZZDA 4B4CA 1KYZA 2KFDA 2VJIA 1FIPA 1T56A 2FX0A 2HDCA 4A93J 4MO7A 5D5XB 1B9MA 3H35A 3I58A 2V1XA 1U9NA 1QNTA 2R0QC 1T08B 4CYDA 2X1DA 4YFKF 2QSGX 1XTAA 3JRFA 2Y31A 1R1TA 2CG4A 3BG5A 2CUEA 3K1NA 4RGUA 5E1XA 1ZR4A 3GMEA 2IVMA 2KRHA 1S5LC 1OCRH 4LOCA 4IF4A 4FETA 1T2KA 1ETXA 1LJ9A 2P5LC 1JUSA 1K6YA 2QQAA 2A61A 2HPMA 2ZKZA 3WGIA 2K9SA 1R1VA 4M71A 3DP7A 2M5WA 3BR2A 2VN2A 1SD5A 3GFLA 2EFWA 2E1MB 4A6EA 3CC7I 4YRVA 2VI6A 3EQLF 4M73A 4RAYA 1R1UA 5CJ9A 4A6DA 2QA4I 3RPUA 2DA6A 3K4MA 3HUGB 3BCAA 1OYIA 3RI4A 2Q0OA 1KONA 2JN6A 1LDDA 4BQNA 3RKQA 1JTYA 4DZPA 4IRGA 5HLTA 4IJAA 4P96A 4MFEA 2V9VA 2O8XA 1IN5A 3FHZA 4HV6A 5C44J 1A6IA 3LL7A 1TWHJ 5D4RA 4HLYA 2QKMB 1OJLA 1WJDA 2H8RA 3TDUC 1VQ4I 4EVIA 3LOCA 3OOUA 3WG7H 2Q8KA 2Z1DA 5K7FA 3CCYA 2R7QA 2QQ8A 1SFOJ 3CCLI 4OU0A 3D5SC 2WTEA 3M4OJ 4FQGA 3KP4A 1STZA 2IA0A 2IW5A 1T33A 2ECBA 3F3XA 4DGWB 2COBA 3F22A 2QCOA 2H6BA 3OYIA 1QPIA 3CCUI 3BDDA 4BXXJ 4WF2A 1FJLA 1E3HA 1PP8F 2GM4A 3ZMSA 3FBNB 2TCTA 1FYLA 2GXGA 2DOAA 2EINH 2NVXJ 3V7SA 2XIGA 2DLLA 3P9KA 3H3VK 1MBEA 3PNTA 4O5VA 1R5ID 1IJWC 2HR3A 3TDZC 4CCMA 2R7RA 2NNNA 2E1NA 2GAUA 3CP8A 4HNTA 1WVRA 1G3SA 1X3WB 3DKWA 3DU6A 3M8EA 3BLYA 1YW7A 4A3LJ 4AC0A 5H2FC 3IKVA 2OBPA 3LSKA 3OMYA 2CH0A 5FGMA 4CO8A 5A2QZ 2LR8A 3J7AY 3CCMI 1LVAA 2ZC2A 5IP6A 3VODA 1MNDA 3NWTA 5F6FA 3J80K 3L2VA 3O8GA 1N25A 2R7OA 3H5AA 3IAS2 1HW2A 2XV4S 4TV7A 2R4GA 2ELJA 3PNYA 1EA3A 1MBKA 1SFKA 4WK8F 2CW8A 3PNVA 4A3GJ 4E70A 2IA2A 2L9SA 5DTDA 3PFYA 5ICCA 1HOMA 4I98B 2JJ7A 5JFRA 1MKMA 5GTIC 1UJ8A 3HKZN 1SAXA 2XPWA 4W97A 4RLFA 2R7FA 2F5VA 3LSTA 5GP9A 3U1DA 1DU6A 1APLC 3JSPA 2ZO4A 1BW5A 4IEJA 5F1JA 2ZMEA 3RTRA 2FD5A 2AO9A 3F8NA 3F8BA 4K2EA 3KETA 1VI0A 2W48A 1FMVA 1I50J 1KGSA 4C2UA 1U6GA 4AYBN 1ZELA 3OYFA 3JRCA 2BYVE 3E97A 2CQKA 5J6XA 1HKQA 3BR5A 5FLVA 2K02A 3EYIA 2W84A 4BE0A 3B6CA 2LD5A 1Q1HA 2P7VB 3SDGA 4YIRX 1ETOA 4A3EJ 1FYMA 1MBJA 3EPZA 2GXBA 2Y0SA 4BHBA 4Z2YA 4ZDOA 3CTAA 3FDYA 1XC5A 2MSYA 3G1OA 4WWCA 4C2MJ 2MG4A 3P7NA 4QLCU 4V2FA 2QSFX 4FHTA 3ZR8X 5DDGA 4CA0A 2LDUA 3WE2A 2A6EF 2CO5A 3HXLA 4M3DA 3TW7A 3ZGKA 3GTMJ 3RZDJ 2Z3YA 3F6VA 4RBOA 2LFBA 3PUFA 3SFZA 2OTJI 4MFDA 4LLGF 3HOUJ 3DEWA 2E19A 4W1UA 2DFIA 3GF2A 5FLXZ 3GUDA 3S1NJ 4UVCA 2ZJQF 1IN8A 3F9KA 3E3VA 3IH4A 4LITA 5DV5A 2Y2ZA 3JW4A 1F4KA 2RV8A 4BE1A 2OCCH 2KZVA 2UZKA 2NOJB 4BQQA 1FOWA 2HNHA 1TQMA 3A4CA 4A5MA 3CJRB 1YITI 2HYJA 4ENNA 2IGKA 3UR3C 1E3OC 3K1PA 4NBQA 2RN7A 4CXFA 4CCNA 1ZLKA 1NG6A 2E71A 1QZYA 3BJAA 4PSWA 3TBIA 2BV6A 4KYWA 1OCOH 2DA3A 1H0MA 3ZPLA 3C7JA 2EH3A 1FC3A 1V3FA 1XDSA 4AWXB 1IZ1A 2A3SA 5K5QA 3CF5F 3JRHA 2KISA 2A6TA 2P7CB 1ZG1A 2B63J 2JVHA 2W85A 2R93J 2FQ4A 2L4AA 4RM2A 1YX3A 3TO7A 4IOCF 5EGOA 1D0YA 1RKTA 4ZJZA 5BQTA 2K9LA 1FSEA 1N78A 1YIJI 1IUFA 1TLHB 2KRFA 2XAFA 3S2DJ 1X1DA 3ULQB 4AIKA 1IXCA 4RA2A 3QPTA 1HC8A 1IGNA 2IA1A 2MLKA 4X1EA 4Y17A 4HNVA 4XLPF 3HSEA 1B72A 1J9IA 4F55A 4ENJA 1XS9A 1EH7A 2XGCA 5IYCJ 2J5OA 2F5FA 2X6OA 3E1SA 2L0KA 2P5KA 4E7KA 3RPQA 1YS7A 3K4BA 4I6ZA 2WADA 2LMDA 4RB3C 3KP3A 2KDZA 3OS1A 5HODA 1BOBA 1SD4A 4YG2F 1GT0C 3PJRA 2A5YB 4KMFA 3HM5A 2BY3A 5HVQC 4E6KG 3R4KA 4OIPF 5ICGA 1ZRCA 1TL8A 3M8FA 4PJLA 5ICEA 3JSOA 4EGYA 2F4IA 5AONA 4BL0B 2JT1A 3H3UA 3BROA 3H3ZA 3OYCA 1ON2A 4I02A 5IOZA 2DODA 2XPVA 1TT0A 4RGXA 1ETKA 3PIOF 2FMYA 1O7FA 5E8GA 2VKEA 3K4LA 1BA5A 3Q0VA 4BJTA 1TT5B 4JX4A 3CUOA 4OAZA 4C3IJ 1H89C 3CC4I 5KCMA 4XKBA 5F64A 5J4YA 1U9OA 3J81K 2CU7A 5JLWA 2CQNA 5E1ZB 2VQCA 3WGHA 1SVMA 2O3FA 2C6YA 4I09A 1DP7P 3PIPF 4ABZA 1U5TB 3OYHA 5FRNA 1YQAA 4ZTJA 4AU7A 4B48A 2MA3A 3C3WA 4XN3A 1LEBA 4MEXF 2KIUA 4HW0A 4Q47A 3ABTA 1JUPA 3VWBA 4XLHA 1YJ9I 3BJOA 2LKPA 4I01A 4QTRA 2CUZA 3A2KA 3V7CA 2KPMA 4OIQF 2Y75A 1D0XA 3SZTA 2KIFA 1X2MA 2LBFB 1U5TA 1P92A 4XSXF 1F1ZA 2VE8A 4PFPA 1RZ4A 3L9FA 4WXHA 2ZNZA 2EA2A 3FXJA 1FZPB 2FSWA 4Y3OA 3BZ6A 4DNCA 2H09A 1Z0XA 5IPAA 4NC6A 3FMQA 3F0CA 3OR1C 5K7HA 3OL3A 2DA2A 3HOVJ 3I4MJ 1DGRM 1SEUA 2LBFA 3ZQ7A 1P2FA 5AIQA 4UUSA 4A3IJ 1Y1WJ 4IHXA 3BOQA 3ISPA 1MZBA 3V8LA 4LMYA 3TW6A 1K4TA 2ACJA 2M30A 2STWA 2LVSA 3CZ6A 2NS0A 4XM3A 5B1AH 2LLKA 4EJTA 3ECHA 1D1BA 3NEUA 4EMSA 4IHWA 5M5WJ 3RIRA 2N8GA 2EFPA 4EJUA 3T0YA 2QSHX 1QHHD 2CUFA 4ZYEA 5EEAA 2X6YA 4UY8I 4PUSA 4KJZA 4EJWA 1YI2I 2XF6A 3GEZA 5FKLA 1LFUP 4GXOA 3HHGA 4XLEA 1BI3A 1TW3A 1W7PA 1IXRC 1D1AA 3EUHA 4JQFA 3E5XA 1Z7UA 4DYRA 3MKZA 2M3AA 1FWZA 2HZDA 3QYBA 2QWWA 5FJ8J 3FM5A 2K9NA 3PSFA 3S15J 1IO2A 1XCVA 2VKDA 5C4JJ 4DIQA 4BNCA 2DN0A 2PBIA 2IT0A 4B3XA 2XPUA 1Z21A 3BTLA 2A05A 2X6XA 4RGSA 2HVQA 3TQNA 1R7JA 2Z99A 4IOAF 2RREA 1MMSA 5HS9A 2Y0SN 2O9LA 1D8KA 5LLQA 5LFAA 1FY7A 3MEXA 3Q0WA 5GADJ 3OYJA 2LRDA 5K1YA 3CMAI 1U8BA 4F52A 4D7MA 2MLGA 5BNGA 4A3CJ 1WJEA 2DT6A 2CQ7A 2HPIA 2UXXA 3HSFA 5FKKA 2YX4A 3KZYA 1E0EA 2G7UA 1GVDA 3BG6A 5HOOA 4XKWA 5LBQA 4L0ZB 2L9RA 1GLNA 5ILVA 4CCJA 1Y6IA 3VB2A 2L9NA 4XLNF 1S6LA 3LSIA 2OJED 5J40A 2PI0A 4HQEA 2EPFA 3E6CC 1ZGJA 1G3YA 1TC3C 1OYYA 1FOXA 1GHCA 1ODDA 1Y8RB 2HQRA 3FXLA 3KE2A 4UV9A 2CFXA 2HQAA 5CVVA 3FKIJ 4DJAA 1DPRA 2BXYA 2W82A 4FASD 3L2QA 2EK5A 4UXNA 4XLFA 4BS9A 2IS2A 1RR7A 1K6OA 3OYGA 1IN7A 2K85A 1G8XA 2MC3A 3DBLB 5BOXA 1NHAA 1XGNA 2BY1A 5EDNA 2PX9A 3O2PE 2FXAA 2F5EA 1MMAA 3GBGA 2CW0F 4KIBA 3C1DA 4MEYF 3B73A 2ESNA 2A5WA 1SMYF 3OOPA 4BYYA 3CCEI 3M7GA 3MFKA 2BHYA 4ENMA 3TGNA 1DDNA 5L3CA 1T95A 3IV5A 5BPDA 2AXLA 2X48A 5B5EC 1REPC 3A02A 1OKRA 3BZKA 3OYBA 1PYVA 5KK1A 4CCOA 1KQ0A 2P8TA 4E4HA 2CRGA 3BJ6A 3EUAA 1W1WE 1X1BA 5DCFA 2ISYA 3GO5A 2MH2A 2RQQA 1H88C 2HOSA 1B4AA 3VSLA 2GLOA 2Z5UA 3I3LA 2H6CA 1D5YA 3BP8A 3QAHA 2HGCA 4IX7A 1S7OA 2EIMH 4HSTA 5GAHJ 3DEUA 3BWGA 4AIDA 3FMRA 3QODA 2Z9OA 5IT3A 1U0JA 2NRAC 2ZXHA 3R0JA 2BW3B 5LHHA 1NH3A 2UXNA 3L2RA 2VB6A 3CDIA 1RUNA 1SC7A 2Z33A 1BBYA 1A5JA 2DU9A 5LRRA 4KA4A 2WC2A 1FLIA 4LB5A 1SD7A 3RYPA 1XGSA 4G12A 1WJAA 2P0WA 2O6GE 4ZYDA 2R7VA 4CGZA 1VQ5I 4P1WA 3CCVI 1X19A 4JK1X 1IN6A 3JTGA 2BW3A 3H9QA 3CUQC 3FXQA 5D8KB 2LOOA 2OA4A 1T8IA 3WU2C 1RR8C 1RPWA 3GWZA 1YRNB 4V19K 5KAIC 3I4PA 3HOYJ 1G6NA 4UV8A 1U78A 2EZLA 1JJ6C 3GFJA 5KVRA 5IT9Z 3DF8A 2K7LA 4X0GA 4GDFA 4FCYA 2LNBA 2W4SA 3WTUC 3N4MA 1SMTA 4IHTA 2EFNA 5L3EA 3BR6A 1QVTA 1EF4A 3I53A 3OS0A 1O7LA 1ZREA 2DPDA 2QBYB 4U7BA 1VQMI 2YUSA 4ESFA 3GX4X 1UG2A 3DEEA 1X1CA 1YRNA 1A35A 1ONVA 4KMUX 1BR2A 2EIKH 1QU3A 3I9V2 2EJRA 1RI7A 5HLIA 4EV0A 1TWGJ 2FBHA 2M8EA 4O6JA 3PM1A 2DYSH 3JAMK 4KISA 1HKSA 2K86A 1DUXC 1XSXA 1EJ9A 4RLQA 3NRVA 3QPHA 2JQ7A 2P6TA 2ZBKA 3GLXA 4A0ZA 2DOFA 2VE9A 1Y0NA 3AG2H 1QBJA 2VPRA 3JRIA 2QBYA 2ZJPF 4RAGA 2DOEA 1JT6A 1PUEE 1X3UA 3OWTA 1VZ0A 2FE3A 3PO3J 6PAXA 1XN7A 1ZYRF 2HTJA 2V6EA 1MGTA 4L18B 2PFBA 1QGPA 4KT5C 1ZGAA 4IHSA 3HG9A 4MLOA 4NC7A 4UUTA 5E18F 4HG2A 4KITB 4ITVA 3GLLA 2VBWA 3RPUD 2ZSIB 4B3AA 2PJPA 2DAOA 3S2HJ 5E20A 1UHMA 2PG4A 1QHGA 3KEOA 1YW9A 4L9VA 2FJ1A 1MNMC 3FXUA 3W6JB 3HRSA 3QP5A 2VC1A 3RKYA 3HGYA 1Z1DA 1RRJA 3KLNA 3J80Z 1FNNA 2XB5A 2LP0A 2HS5A 3CF2A 4EATA 3F23A 3S3MA 1S9HA 1ZRDA 3G71I 2PMUA 5EF6A 2L5QA 3B02A 5ERIA 2QZ8A 4XIDA 5E17F 2DMTA 4MTEA 3CLOA 4YELA 3TO6A 1A31A 4HX4A 2XKPA 1LEAA 3QYEA 3K0LA 3RQIA 2ZJ2A 4ESJA 4HSRA 4I0AA 2Y48A 3TKYA 3MKWB 2NS8A 5E3LA 4MQ9F 2R5YB 5CYVA 1R49A 2HDDA 4U0WA 1UHSA 5D5VB 2KIQA 1B6AA 2OPTA 1E3PA 1XG1A 4F3QA 5L3FA 1TZLA 4LK1F 1FBUA 3ROUA 1A36A 3HTUA 1FTTA 1FP1D 4ANJA 2DI3A 5BS6A 3COAC 1HSJA 1FX7A 2VQGA 3TP0A 2LKXA 2K9QA 1BN5A 4ETSA 2EBIA 2IJLA 1IRFA 1YO5C 5IYDJ 2E5ZA 1R22A 2M4GA 4CDGA 2NVYJ 4N9IA 3LAPA 3SHFA 2R5YA 1OR7A 5C3EJ 3GXOA 1J0RA 2X6WA 4C3JJ 3ZN0A 2CWEA 2R7UA 3I54A 1DP3A 2QQBA 1Z3XA 2FBIA 1F9NA 2UV1A 1MH4A 3AL0B 5GPCA 1DU0A 2LREA 4Y4RA 1IN4A 2QQ9A 1QO0D 1SVOA 2AS5F 4A3FJ 2VBYA 2XSJC 2ZXJA 2P5VA 2VUMJ 3CD6I 2ISZA 1JGGA 5J3LA 2GWRA 2KDOA 2M0MA 3EYYA 4I7HA 4XLCA 4BXUA 3W3CA 4D5FA 4E7LA 2ZMEB 2WB1A 2ADUA 2CS3A 3ABMH 3ZQQA 2YR2A 1O57A 2HI3A 3ZMUA 3HRUA 2JUCA 3BC8A 1KZHA 2LG4A 1RC9A 5HDKA 3NQOA 3JRDA 2HVRA 1E2XA 1SVLA 2ICWG 1DQUA 2M34A 1GXPA 1MW7A 5F0HA 2CMPA 4XNFA 3WTWC 3PUBA 2IS4A 2KJBA 1D0ZA 2X1EA 1OCTC 4HOBA 2EV6A 4J00A 3A03A 5F1RA 2PMZA 2M87A 3OYDA 1R00A 4NB5A 1X4PA 5LGUA 3M3YJ 4XKCA 5J1YA 1ZN2A 3EDPA 1D3YA 3FXMA 9ANTA 2GIVA 4U88A 3O6BB 5B1BH 5M3MJ 3VYTB 3T8TA 3Q5FA 2EQRA 2G7HA 3AFHA 1ZTRA 4PGGA 2QLZA 3ZMTA 2E36A 4ZYAA 2E35A 3WTYC 2GBYA 1X2NA 2LTPA 1PP7U 3G73A 2DFEA 2JVGA 1KA8A 5LGTA 3D1NI 4H4KC 5F0FA 4HF2A 3CJNA 1JJ8C 1X1PA 2LY1A 4EM2A 3OR2C 1F5TA 1W0UA 3DLAA 2FBKA 2OCEA 3SQNA 1VQNI 1KQ9A 1I1GA 3CESA 2D1HA 3OSFA 4IQ4A 3A0BC 2TRTA 2PMHA 2XRNA 5FB2A 3W2WA 3DU5A 5F08A 3ASNH 3A01B 3SFIA 3V8KA 3I5UA 2DMPA 2QGUA 1ZG3A 4ASNA 1IDZA 2DJIA 4A0YA 2GA1A 4AVZA 2FU4A 1LNWA 5LEKA 3K70C 3DKXA 3KP7A 2Z2SB 1YIOA 3OYEA 3LFUA 1UMQA 2ID3A 3A01A 2PJRB 5EGOB 1LFPA 1ZKGA 3GTOJ 2F5DA 5KHDA 2K3PA 5L3DA 3OL4A 4GYIA 1JKOC 2A07F 1MSFC 3KEQA 2O7OA 3WG9A 1W0TA 2NXNB 1TNTA 5D5WB 1B72B 3H36A 1Y0UA 2ID6A 3T8RA 2R7SA 5HLGA 1ETVA 2FMLA 3BG9A 2PJRA 2FRHA 3W6VA 2VC0A 4E7IA 2CFOA 2ECCA 1IAWA 1LDKB 3BPXA 4A3KJ 4HBLA 3ZMVA 1MSEC 1TNSA 3PQJA 4D9JA 3LNQA 5CVRA 3DPUA 2DFHA 1YFHA 2KIMA 2XAQA 2ZSHB 2K5CA 2KQRA 4GO1A 4F93B 1XSDA 2L3DA 5LHGA 5IP9J 1MDMB 1K78A 3ZQLA 3W2AA 4F7ZA 1WRJA 5FFZA 1WHUA 4ZZLA 3MZHA 1R4MB 4Y7NJ 1JKQC 4GCVA 2KP6A 1AU7A 3S1QJ 2DK5A 2I5UA 2A68F 2O0YA 3L7WA 1BIBA 4PDKA 1T0FC 2WV0A 4HYEA 1XPXA 2A6HF 1R58A 2IBDA 3F72A 1TBXA 2OQGA 5JLXA 4UB8C 1A6QA 2F48A 2Y0MA 4XKVA 3HJEA 4CCKA 1MDMA 1S29A 1Z9CA 1CF7A 5FLXK 3QWLA 1HBXG 2MW8A 2VJ5A 1X58A 2DQRA 3KYCB 3S93A 1VNDA 1IUYA 1GV2A 4A3DJ 1GXQA 3CCRI 1R6RA 2E1CA 3DPLC 3OY9A 1MBGA 1F43A 4AVPA 4A5NA 3MCZA 5E3OA 3HC7A 1MNEA 2FA5A 2L2OA 3Q9VA 2P81A 2VKHA 3PFIA 3C2BA 2HXOA 2IXSA 1H9GA 3H0GJ 1K79A 2D1VA 3IAM2 2KZGA 3S1MJ 1UG0A 3TOBA 5KAFC 4PGHA 4FISA 4D5CA 2V1DA 2VOPA 2NOGA 3PO2J 2JRTA 3D0SA 2P6SA 1W5SA 4XSZF 1FSHA 1J5YA 2ME0A 2VJ4A 3FIWA 1IF1A 3IHUA 4R79A 3ZCOA 3K2AA 2MBFA 1UZCA 3JRBA 3BG7A 1R5GA 5FFXA 5L3BA 5BPIA 4M72A 3V42A 3FXOA 1BJAA 1MJAA 4PJNA 4UUSB 4Q4ZF 2D5VA 1V4RA 2RNGA 1V5FA 2DMUA 2EFOA 3LSJA 2AXTC 5K7ZA 3CMYA 1P4AA 5EZHA 4E7SA 2W57A 5B66C 2HTSA 4OAYA 4DBQA 1Z67A 2CJJA 2K9MA 3OSGA 4IVNA 1QVUA 1J2XA 1HLVA 4S0HB 1TWFJ 2XUBA 2WBMA 2XVCA 4Y15A 3ABLH 3CCJI 1G3TA 2XC7A 1FOYA 5D8LB 4AM3A 4I99C 4S04A 3VYSB 5GAGJ 2E7XA 1I5ZA 2VT3A 1XMAA 4P9UA 4A69C 4CCLA 2E60A 2NAZA 1GUUA 3MAJA 1LDJA 1MD0A 1WWXA 2BY0A 1JGSA 1WCMJ 1MMDA 4ZH4F 2V1UA 4FE4A 3HSRA 4J01A 1RNLA 1W7PB 4IPAA 4M3GA 3SYTA 3K70D 1IRZA 3ZQIA 2AQEA 4G7OF 2WB1N 4BDZA 4A0XA 4YEJA 3L00A 2L01A 5D6EA 2R3SA 1ENHA 1OCCH 2BBYA 4KIGA 3J7ZI 4G7ZF 1U2WA 2NNYA 1HW5A 1OFCX 3FX3A 4BUPA 3HPHA 4UUVA 2M45A 3ESWB 5ICFA 1QQIA 2O8KA 3O3KA 2DMNA 4S05A 1UFMA 1IV6A 5FRMA 1LUJB 4Y52J 5DCMB 3H1CA 2PMZN 1OISA 2HU9A 2VODA 2DFFA 5BMZA 5IOYA 1BC7C 1LFBA 2R7TA 1T38A 2LH9A 3TL4X 3L2CA 4HX8A 2DDBA 1RESA 1L0OC 4GRIA 2BZTA 1P7JA 2AHQA 2OF7A 3AG4H 1VF9A 3PL8A 3WU1B 2RVCA 4J19A 4AUXA 1HKTA 2F5CA 3MZ8A 4ZDPA 3OYNA 2IAIA 3M07A 2R5ZB 1T39A 4B1RA 3L2WA 3CCQI 5DCMA 1D5VA 3LSMA 1YTYA 4NNJA 4KICA 2YSRA 2M9HA 4C9YA 3OV8A 1NG7A 2OTLI 1VQKI 2MD5A 3F8CA 4V2GA 2JA7J 3KFWX 4OMZA 4RDUA 2XGXA 2E1OA 3M1EA 4L5JA 5M3FJ 1M1EB 1LQ1A 2XGEA 1IV8A 4LIUA 2GOXB 1R5HA 1YE9A 2R5ZA 5CVJA 1VQPI 3GFMA 2XASA 1X1AA 4YFXF 3T1BA 4IQJA 2K4JA 2Q1ZB 3H5RA 2IGOA 3QQAA 3QYFA 4N0BA 4LK0F 1FP2A 4KN7X 2RAEA 3RKXA 1ETYA 2OZUA 3O8HA 1UB9A 2M2EA 2FNPA 2QUFA 3WHCA 3GW2A 1YYVA 1ON1A 3KLOA 4C2TA 3IH2A 4ENKA 3G1LA 1IXSB 3DBHB 4RAZA 3WGGA 3QPSA 2E1MC 4ON0A 3RJPA 4QPQA 3RYRA 1NK3P 1VQ9I 4M6VA 2DCEA 4WXCA 4P55A 2F4OB 2V79A 4BGDA 1TTYA 5J8CA 2G0EA 3TOAA 3MVPA 1S72I 2LY9A 2JK3A 1LVKA 1TWAJ 3BTCA 1HXDA 1QZZA 3ZXSA 4JYKA 5LGNA 2B9SA 3KIOA 1T98A 2DA7A 4F91B 4Q5SF 4MIMA 4YFNF 2L7KA 4MTDA 5KNLA 2FNAA 4OMYA 3JTHA 3SDBA 3ERMA 5JHUA 3M9AA 3P9IA 4EQQA 3GVAA 1ZG5A 2WA0A 3JRGA 5DM7F 2YU3A 3D5LA 2Y30A 3ZN1A 2CQXA 3S17J 2O03A 4M3EA 3DPTA 3U2RA 4LIVA 2BVMA 3H9GA 1E17A 5EZGA 2GIZA 3I59B 4AYBA 1USTA 3L2UA 2V1NA 3ONQA 5HS7A 1Z6TA 2ZXWH 2ME6A 3Q9SA 3K1MA 1ZRFA 3N97A 3ABUA 2OZ6A 1SANA 1O4XA 2Y69H 4XRMA 1Z77A 1R23A 5AIPA 2OC6A 2QKLB 2IGNA 3K6GA 2DJNA 4JBAA 2LC2A 2VQHA 4U0VA 1MIJA 2RC4A 4HNUA 3I59A 3E6MA 2COMA 4HAMA 4O3MA 1BI1A 3QOEA 3K9TA 2MD0A 3DV8A 1GV5A 2XHKA 4CHUA 2RGVA 4KIFA 5J8FA 2V9PA 4XRSG 3VDXA 4EJOA 3TMOA 3NWSA 3BTJA 2QM3A 4WX9A 1WJCA 4GFBA 2NVTJ 3I4NJ 1JHFA 2D2WA 4LLLA 5FROA 3L09A 3J7YJ 2CV0A 1X3ZB 3QU3A 4EM1A 1I6HJ 2IS1A 2E7WA 3LAJA 2XGDA 2ZMEC 4BE2A 1G2HA 2DW4A 3ZQGA 1WJBA 4IZZA 2E2JJ 2BEOA 2IGMA 2KJCA 2L4MA 4RB2C 3ZRGA 3F6OA 4G7HF 2E5NA 3IH3A 5DUIA 1PUFB 1HA8A 2ZFUA 2DA4A 2W00A 1B9NA 1O3QA 5DYMA 4BBRJ 1CGPA 1YLFA 3E6BA 4BQOA 3SZGA 1J59A 2MH9A 2CUJA 2DBBA 2QF7A 1OPCA 5CQEA 4N4NB 1FPQA 4Y33A 1OLTA 3F21A 1I39A 4Q48A 4M9SA 4QWQA 3K2ZA 3CP2A 1BC8C 1UAAA 1PUFA 1MH3A 1SD6A 2VBZA 3HEFA 4MHGA 2E2IJ 5J4VA 2OU2A 2L7FP 2XF5A 3W6KB 1HF0A 2X9DA 4IHVA 4GGGA 4R1HA 4E7HA 5H6QA 3R0AA 2L54A 1WH7A 3WTZA 3P9CA 3G2BA 1LE8B 2Y9YA 4IL6C 2EILH 5JI6A 3GYHX 2M1BA 1JXSA 2JMWA 5FLMJ 2R7WA 2CSOA 2IP2A 2B0LA 4XRSA 1VQ7I 3BT9A 2PN6A 2L9VA 3WTSC 3DFGA 1NTCA 2XAHA 3LFKA 2IEKA 2DO7A 4QIWN 3S3OA 2XAJA 2XAGA 3RCOA 1TQPA 3VPRA 4A2UA 1X4OA 4I2OA 1UELB 3DWLE 1F36A 5E79C 2LK2A 5EJCA 1LE8A 3NARA 3FHNA 4XOPA 3U1KA 4BDYA 4F92B 5K5OA 1V5GA 3KEYA 1AA7A 4G8XA 4ESBA 2VKVA 3LSHA 2HVSA 1DGWY 4XK4A 4Z6YA 1P4XA 1WSUA 1OCZH 4BAYA 1GDTA 1CQTA 3DLLF 3E5QA 5HDNA 2EV5A 2XKOA 4R8HA 1MBFA 2JSCA 3AG3H 5DD8A 4HA8A 4Y13A 3A1YA 4PSXA 4IRIA 1D1CA 1EV7A 3Q0UA 4OINF 2FF4A 1R4NB 1G59A 4RMNA 2HXIA 5IT9K 1I3AA 2J5PA 3ML6A 3OS2A 4NUBA 1FEXA 1WGXA 3WODF 1KU7A 3CLQA 4G6DA 4G6TB 4BHCA 2GXAA 3U21A 4BACA 1XGMA 1EKEA 3K7AJ 3FISA 3GTJJ 2DTRA 5FD6A 2OV7A 1OCPA 3BG3A 3ZQHA 2KMUA 2F6CA 4FX0A 3DTEA 2ZJRF 4NQWB 1K83J 3ZOBA 2M7AA 4RGRA 3JR9A 1KU2A 1T6SA 4LB6B 3HUGA 3HL2A 3WTVC 5FKOA 4PJMA 5EYRA 5D5UB 2EFQA 4M6YA 3SJMA 1ETQA 2BY2A 2JUGA 2HYGD 1W4MA 1TP4A 3R61A 4L0YB 5IP7J 2LKSA 5CVIA 2W24A 1JI8A 5TISC 2HKXA 4NQWA 3S8PA 3H9JA 4HRIA 5JR3A 4B47A 3I56I 4GYGA 3BR0A 2VXDA 3LSPA 4FX4A 1BOAA 5GPAA 1HSTA 1I27A 2ELKA 3LQQA 4L9JA 2PLYA 1JKPC 1N77A 2DT5A 2YX7A 2JSPA 4MQVA 2OD5A 2H1LA 5C4XJ 2VQLA 2MC4A 2LF7A 1BR4A 3CO6C 1HCRA 2DA5A 1P6RA 3HRTA 3CMMA 3FZVA 4NC8A 2EZHA 3GZNB 4DYCA 4DYQA 1BR1A 2V7FA 1R71A 3OYAA 4BY1J 2JPBA 4ZC3A 1MJBA 2BE5F 3WE3A 2HEOA 4A3JJ 3RQ4A 3LQRA 3G1MA 2VJJA 3KPHA 5L3GA 2R7ZJ 2EZIA 3I71A 2ZB9A 3CUQB 1ORKA 1JUMA 3OYMA 1J09A 3WTXC 4IXAA 3TO9A 2BGCA 4N4OB 2PQ8A 3DKYA 4DW6A 3LSRA 4OIOF 4X6AJ 4HF0A 4M6XA 2E34A 2HFHA 1K7AA 1U5TC 1YHQI 2QVOA 2NS7A 2IPQX 3FF5A 4AIJA 5HNHA 1UCRA 4XOTA 4D0PA 4B44A 3KZZA 3CUQA 1W36D 2X1CA 3KX2A 5E1WA 3Q3SA 4XONA 3KZIC 2RNJA 2JWTA 1FYKA 4D7NA 4E7JA 3HOZJ 1S3JA 1SAUA 2HDWA 2UUZA 1RETA 3M1CA 4CSWA 2KHMA 3FWEA 2D45A 3W2VA 3ZQFA 3BPVA 4B43A 3CDLA 3CJTB 4PZJA 2LF8A 3CQZJ 3IP4B 1FBQA 3DQVC 4XR6A 1FIAA 3DBRB 5E8IA 1WFXA 5FKMA 3IRQA 3C2HA 3HB9A 4HZFA 4U7DA 5ED4A 3GFIA 2FOKA 1YW8A 2GZWA 3EUKL 5HLHA 1K61A 2R7XA 1J7KA 1R9TJ 2W1OA 5A2QK 1XD7A 4M74A 3MZYA 2YPRA 4M9XA 3IRRA 2EV0A 3HOSA 3BQZA 3H0DA 3OIQA 2HWVA 2WAQA 1P4WA 1V5EA 4CYCB 3JRAA 2HOEA 2M8GX 4XQFA 3VYUB 4H0EA 4B8XA 4RAFA 3EUHC 1LPQA 1Q1VA 1HQCA 2FEZA 3S32A 4NHJA 4XMYA 1IG7A 4EGZA 4KNYA 4BJ5C 4D1QA 5IYBJ 2WY7Q 2WWYA 4L9NA 1FOKA 2DMQA 4EEFG 1ZH5A 3J7AO 3A0HC 1IDYA 1PDNC 3HTSB 3EETA 2FQ3A 4HPQA 2H94A 3AG1H 1XX5A 3TP3A 4CYCA 3UNGC 3J81Z 4XBFA 1Y56A 3HIFA 2ZCWA 1Z7LA 3X2QH 4CUGA 3VOEA 2EWNA 3N05A 1WJFA 1K78B 5D4SA 4HQMA 4KFCA 4ZTFA 2DPUA 1KU3A 4L5IA 2FOWA 2HKOA 3K69A 2EA4A 1IW7F 4UVAA 2RKHA 1TQIA 4AIHA 2JA6J 2VIXA 1OMIA 3FK6A 2HQ5A 1Y39A 1ZARA 4CH7A 2HYFA 2XSDC 5CQGA 3H5NA 3VSKA 5ILSA 3KP2A 2DK8A 3BY6A 1ETWA 1S7AA 3HZJA 3S3NA 1CF7B 3WU0A 4XLAA 1WJ5A 1BW6A 1ZK8A 2JZYA 3IKTA 3WTTC 1ITYA 2EZKA 2ETHA 3HOWJ 1ZAOA 2DYRH 3IWFA 3HYIA 1WQ2A 4KUMA 3C2GA 2KKOA 4BXFA 2CYYA 3D5RC 3MKYB 1JKRC 2MFZA 2KRCA 3KYLA 5HNFA 1IRXA 1G3WA 1MBHA 3GZ5A 1XSVA 3MD2A 4EM0B 1O3RA 1B8IB 2A69F 4RB0A 1DPUA 4C30A 3LMMA 4CICA 2W7NA 1JTXA 3S2WA 2HOTA 5EEHA 1QA6A 3S1RJ 2H1KA 3HBLA 3FKJA 3CMEI 3G4SI 1N75A 4BEHB 4HLXA 1ULYA 1IRGA 1AHDP 1OQYA 1ACIA 3OIPA 5TJJA 5EEGA 4JX5A 2IS6A 2OAZA 3SEZA 5IY5H 1B8IA 3CJQB 3VFZA 4NDLA 2STTA 4PFOA 1ZHFA 1YX5A 2KT0A 3F8MA 3GTQJ 4G9YA 4JOMA 4KDPA 4M3FA 2HOAA 3KYDB 4BU2A 3MWMA 3PSIA 3QU6A 3GTLJ 3QOPA 1QPMA 2M0CA 4BEHA 2X51A 3IC7A 3C18A 4RM3A 1YG2A 3ECOA 2DXIA 2XF7A 1O3TA 3G6EI 4HX7A 2GQQA 1PJRA 2X0LA 3E5UA 1JT0A 4II3A 4P5OA 4PCQA 3LA3A 2CQQA 2RQPA 4LGWA 4FTHA 2R92J 2EIJH 3ZMZA 1Z05A 2KLOA 3I55I 1FTZA 3ASOH 4A12A 1SFXA 2OUMA 2X4HA 2V6CA 3MMYB 3BTIA 4JP0A 2L7ZA 1WPKA 2K40A 2QYOA 4LD5A 1L3LA 2CW7A 2B7EA 3RDIA 5J47A 2VONA 1XMXA 5M5YJ 3S16J 3F8FA 2W25A 2GA2A 4II2A 2BOLA 5F04A 5GTHC 2LYCA 4XL9A 3ELKA 1HW1A 1G4DA 1XB4A 3QP6A 4EJVA 3S14J 2DA1A 1O3SA 1MMGA 4WXDA 1OYWA
chains in the Genus database with same CATH topology
1WI9A 5FD5A 3G3ZA 4IRHA 4U0YA 5HDGA 1W7PD 2R7DA 3LA7A 3R60A 5H20A 4B09A 2IRFG 3FMSA 5ILUA 1I6XA 1Z91A 2VOOA 1R36A 1J75A 2UWMA 3MQ0A 1TW2A 4LFUA 4MNUA 3REOA 3KP5A 1D8JA 5DEQA 1FBSA 2G9WA 4MGRA 4HV5A 1RIOH 4RB1A 4UVBA 1GVJA 3RKWA 1UHWA 1AOYA 2Q2EA 4DQ2A 4YIFA 4HDVA 3FM3A 1B1BA 4L9TA 2HQNA 4RS8A 4I0BA 2OQRA 5DD4A 1EH8A 2JPCA 2O61A 3VEPA 1XDUA 1BI0A 1BI2A 2H27A 3SXYA 2NYXA 1JE8A 3V7RA 1BM9A 2ZNYA 1LB2A 5LRSA 3SZPA 3T5XA 1JHHA 5DUKA 5TRDA 3AAFA 2ESHA 3I0TA 5JVTA 4LJZF 1KYWA 1T0FA 4BQAA 3KCCA 1FT9A 3ZMDA 2QENA 4FT8A 3V4GA 1C0WA 2P4WA 1AWCA 4WCGA 1MJ9A 3R6SA 2EB7A 1A04A 4G6QA 1BIAA 1KU9A 2ZFWA 5K5RA 4UHTA 1SFEA 1VTNC 2VBXA 4HDUA 3CO7C 5CVUA 5LEJA 1I1SA 2JTVA 1H9TA 3IWZA 1U3EM 1YS6A 4BH9A 1XCBA 4ZYHA 5LHIA 3JAMZ 1KQ8A 4HF1A 5H6RA 2F2EA 2ELHA 3ZP5A 4AD9A 1USSA 1XGOA 4OIRF 3LA2A 1U8RA 1ZLJA 3FXRA 5HS8A 2VT2A 4BHPA 4LG0B 1EH6A 4P9FA 1SFUA 3HHHA 4YIIA 3ERED 2HZTA 3E6DA 4G94A 2K4BA 1S8NA 5FO5A 3QRFF 2VXZA 3IL2A 3HOTA 2CGPA 2PEXA 3PQKA 1RUOA 1Z6RA 2K27A 3U9GA 4LG0A 4XRFA 2L02A 3CDHA 4CZZA 3V8JA 4ZYGA 5D6FA 3HRMA 1XMKA 1WKMA 2TDXA 1B59A 2DQLA 4OOIA 4UNOA 1W5TA 2LSOA 2XROA 4KN4X 3DXJF 3H92A 3GZ6A 4M9ZA 4LLNA 3LWFA 4N9HA 2RDPA 5CLSA 3I64A 3KP6A 4ZZDA 1KYZA 2HDCA 5D5XB 1B9MA 3I58A 2V1XA 1QNTA 4CYDA 4YFKF 1R1TA 2CG4A 3K1NA 4RGUA 5E1XA 2IVMA 4IF4A 1T2KA 1LJ9A 2P5LC 2QQAA 2A61A 2ZKZA 3WGIA 1R1VA 4M71A 3DP7A 2M5WA 2VN2A 1SD5A 3GFLA 2EFWA 4A6EA 3EQLF 4M73A 4RAYA 1R1UA 5CJ9A 4A6DA 3RPUA 3RI4A 1OYIA 2Q0OA 1LDDA 4IRGA 4IJAA 4P96A 2V9VA 2O8XA 1IN5A 3FHZA 4HV6A 4HLYA 5D4RA 3TDUC 4EVIA 2Q8KA 4OU0A 2WTEA 3KP4A 1STZA 2IA0A 2IW5A 3F3XA 3F22A 2H6BA 3BDDA 4WF2A 1PP8F 3ZMSA 1FYLA 2GXGA 3V7SA 2XIGA 2DLLA 3P9KA 4O5VA 2HR3A 3TDZC 2NNNA 2E1NA 2GAUA 1G3SA 3DKWA 3M8EA 1YW7A 3IKVA 2OBPA 5FGMA 4CO8A 5A2QZ 1LVAA 3VODA 5F6FA 3J80K 1HW2A 2XV4S 4TV7A 4WK8F 4E70A 2IA2A 5ICCA 4I98B 5JFRA 1MKMA 1SAXA 2R7FA 3LSTA 3U1DA 3JSPA 2ZO4A 2ZMEA 3RTRA 3F8NA 3F8BA 4K2EA 3KETA 1KGSA 1U6GA 2BYVE 3E97A 2CQKA 5J6XA 1HKQA 2K02A 3EYIA 2W84A 1Q1HA 2P7VB 1FYMA 2GXBA 4BHBA 4Z2YA 3CTAA 4WWCA 3P7NA 4QLCU 4FHTA 5DDGA 2LDUA 3WE2A 2A6EF 2CO5A 2Z3YA 3F6VA 3SFZA 4LLGF 2DFIA 3GF2A 5FLXZ 3GUDA 4UVCA 1IN8A 3E3VA 5DV5A 3JW4A 1F4KA 2RV8A 2UZKA 4A5MA 1TQMA 4ENNA 3K1PA 2RN7A 4CXFA 1ZLKA 1QZYA 3BJAA 2BV6A 4KYWA 1H0MA 3ZPLA 3C7JA 1FC3A 1V3FA 1XDSA 4AWXB 1IZ1A 2A3SA 5K5QA 2P7CB 1ZG1A 2W85A 2L4AA 3TO7A 5BQTA 1FSEA 1TLHB 2KRFA 2XAFA 3ULQB 4AIKA 1IXCA 3QPTA 2IA1A 2MLKA 4Y17A 4XLPF 3HSEA 1J9IA 4ENJA 1EH7A 2J5OA 2F5FA 2P5KA 3RPQA 1YS7A 4RB3C 3KP3A 1SD4A 4YG2F 2A5YB 4KMFA 5HVQC 3R4KA 4OIPF 5ICGA 1ZRCA 3M8FA 5ICEA 3JSOA 4EGYA 5AONA 2JT1A 3H3UA 3BROA 3H3ZA 1ON2A 4I02A 4RGXA 2FMYA 1O7FA 5E8GA 3CUOA 5F64A 3J81K 5E1ZB 3WGHA 2O3FA 2C6YA 4I09A 1DP7P 1U5TB 1YQAA 2MA3A 3C3WA 1LEBA 4MEXF 2KIUA 4HW0A 4Q47A 3ABTA 3BJOA 2LKPA 4I01A 3V7CA 4OIQF 2Y75A 3SZTA 2KIFA 1U5TA 1P92A 4XSXF 1F1ZA 2VE8A 1RZ4A 3L9FA 4WXHA 2ZNZA 2EA2A 1FZPB 2FSWA 3BZ6A 4DNCA 2H09A 3FMQA 3ZQ7A 1P2FA 5AIQA 3BOQA 3ISPA 1MZBA 3V8LA 4LMYA 2ACJA 2M30A 2STWA 2NS0A 4EJTA 3ECHA 3NEUA 4EMSA 3RIRA 2EFPA 4EJUA 3T0YA 4ZYEA 4EJWA 3GEZA 4GXOA 3HHGA 1BI3A 1TW3A 1W7PA 1IXRC 3EUHA 4JQFA 3E5XA 1Z7UA 1FWZA 2QWWA 3FM5A 1XCVA 4BNCA 2PBIA 2IT0A 4RGSA 3TQNA 1R7JA 2Z99A 5HS9A 1D8KA 5LLQA 1FY7A 3MEXA 5K1YA 2MLGA 2UXXA 3HSFA 2YX4A 3KZYA 2G7UA 5HOOA 5LBQA 4L0ZB 5ILVA 3VB2A 4XLNF 1S6LA 2PI0A 4HQEA 3E6CC 1ZGJA 1G3YA 1OYYA 1GHCA 1ODDA 2HQRA 4UV9A 3KE2A 2CFXA 5CVVA 1DPRA 2EK5A 4UXNA 1K6OA 1IN7A 2MC3A 5BOXA 1NHAA 1XGNA 3O2PE 2FXAA 2F5EA 2CW0F 4KIBA 3C1DA 4MEYF 3B73A 2ESNA 1SMYF 3OOPA 4BYYA 3M7GA 3MFKA 4ENMA 3TGNA 1DDNA 5L3CA 5BPDA 2AXLA 1REPC 1OKRA 5KK1A 1KQ0A 2P8TA 3BJ6A 5DCFA 2ISYA 3GO5A 2MH2A 1B4AA 2Z5UA 2H6CA 3BP8A 3QAHA 2HGCA 1S7OA 3DEUA 3BWGA 3FMRA 2Z9OA 5IT3A 2NRAC 3R0JA 5LHHA 2UXNA 1RUNA 2Z33A 1BBYA 2DU9A 5LRRA 4KA4A 2WC2A 1FLIA 4LB5A 1SD7A 3RYPA 1XGSA 2O6GE 4ZYDA 4CGZA 4JK1X 1IN6A 3JTGA 3CUQC 3FXQA 5D8KB 2OA4A 3GWZA 3I4PA 1G6NA 4UV8A 1U78A 3GFJA 5KVRA 5IT9Z 3DF8A 2K7LA 2LNBA 3WTUC 3N4MA 4IHTA 1SMTA 2EFNA 5L3EA 3I53A 1O7LA 1ZREA 2DPDA 2QBYB 4U7BA 4ESFA 3GX4X 1ONVA 4KMUX 2EJRA 1RI7A 5HLIA 4EV0A 2FBHA 2M8EA 4O6JA 3JAMK 1HKSA 2K86A 1DUXC 1XSXA 3NRVA 3QPHA 2P6TA 2ZBKA 3GLXA 4A0ZA 2VE9A 1QBJA 2QBYA 1PUEE 1X3UA 2FE3A 6PAXA 1XN7A 1ZYRF 2HTJA 1MGTA 4L18B 2PFBA 1QGPA 4KT5C 1ZGAA 4IHSA 5E18F 2VBWA 2PJPA 2DAOA 5E20A 1UHMA 2PG4A 3KEOA 1YW9A 4L9VA 3FXUA 3W6JB 3HRSA 3QP5A 2VC1A 3RKYA 1Z1DA 3KLNA 3J80Z 1FNNA 2HS5A 3F23A 1ZRDA 2PMUA 3B02A 5ERIA 2QZ8A 5E17F 4MTEA 3CLOA 3TO6A 4HX4A 2XKPA 1LEAA 3K0LA 2ZJ2A 4ESJA 4I0AA 2Y48A 3TKYA 4MQ9F 5CYVA 4U0WA 5D5VB 1B6AA 5L3FA 4LK1F 1FBUA 3ROUA 3HTUA 1FP1D 2DI3A 5BS6A 3COAC 1HSJA 1FX7A 1BN5A 4ETSA 2IJLA 1IRFA 1YO5C 1R22A 4CDGA 4N9IA 3LAPA 3SHFA 1OR7A 3GXOA 1J0RA 3ZN0A 2CWEA 3I54A 2QQBA 2FBIA 1F9NA 1IN4A 2QQ9A 1QO0D 2AS5F 2VBYA 2ZXJA 2P5VA 2ISZA 2GWRA 3EYYA 4I7HA 4BXUA 2ZMEB 2ADUA 2YR2A 1O57A 3ZMUA 3HRUA 5HDKA 3NQOA 1E2XA 1GXPA 3WTWC 2KJBA 4HOBA 2EV6A 5F1RA 2M87A 1R00A 4NB5A 5LGUA 1ZN2A 3EDPA 1D3YA 2GIVA 4U88A 3O6BB 3T8TA 3Q5FA 2G7HA 3ZMTA 4PGGA 2QLZA 3WTYC 1PP7U 3G73A 1KA8A 5LGTA 4HF2A 3CJNA 4EM2A 1F5TA 2FBKA 3SQNA 1KQ9A 1I1GA 2D1HA 2PMHA 2XRNA 5FB2A 3V8KA 3I5UA 1ZG3A 4ASNA 4A0YA 2GA1A 2FU4A 1LNWA 5LEKA 3KP7A 1YIOA 2F5DA 5L3DA 2A07F 4GYIA 3KEQA 3WG9A 1TNTA 5D5WB 1Y0UA 3T8RA 5HLGA 2FMLA 2FRHA 2VC0A 1IAWA 1LDKB 3BPXA 4HBLA 3ZMVA 1TNSA 3PQJA 5CVRA 1YFHA 2KIMA 2XAQA 4GO1A 1XSDA 2L3DA 5LHGA 1MDMB 1K78A 4F7ZA 1WRJA 5FFZA 4ZZLA 3MZHA 4GCVA 2DK5A 2A68F 2O0YA 3L7WA 1BIBA 4PDKA 2WV0A 4HYEA 2A6HF 1R58A 3F72A 1TBXA 2OQGA 2Y0MA 1MDMA 1S29A 1Z9CA 1CF7A 5FLXK 1HBXG 2DQRA 1IUYA 1GXQA 2E1CA 3DPLC 4AVPA 4A5NA 3MCZA 2FA5A 3Q9VA 3PFIA 1H9GA 1K79A 2D1VA 3TOBA 4PGHA 2V1DA 2VOPA 2JRTA 3D0SA 2P6SA 1W5SA 4XSZF 1FSHA 1J5YA 1IF1A 3IHUA 4R79A 2MBFA 1R5GA 5FFXA 5L3BA 5BPIA 4M72A 4Q4ZF 1BJAA 1MJAA 1V4RA 2EFOA 1P4AA 2W57A 2HTSA 4IVNA 1J2XA 2XUBA 2XVCA 4Y15A 1G3TA 5D8LB 4S04A 2E7XA 1I5ZA 2VT3A 1XMAA 4P9UA 2NAZA 3MAJA 1LDJA 1MD0A 1WWXA 1JGSA 4ZH4F 2V1UA 3HSRA 1RNLA 1W7PB 4IPAA 4G7OF 4A0XA 3L00A 2L01A 5D6EA 2R3SA 2BBYA 4KIGA 4G7ZF 1U2WA 2NNYA 1HW5A 3FX3A 4UUVA 2M45A 5ICFA 1QQIA 3O3KA 4S05A 1UFMA 5DCMB 2VODA 5BMZA 1BC7C 1T38A 3L2CA 4HX8A 1L0OC 3WU1B 2RVCA 1HKTA 2F5CA 1T39A 1D5VA 5DCMA 1YTYA 4KICA 2YSRA 3OV8A 2MD5A 3F8CA 3KFWX 4OMZA 2XGXA 3M1EA 4L5JA 1LQ1A 1R5HA 5CVJA 3GFMA 2XASA 4YFXF 3T1BA 2K4JA 4N0BA 4LK0F 1FP2A 4KN7X 3RKXA 2OZUA 1UB9A 2FNPA 2QUFA 3GW2A 1YYVA 1ON1A 3KLOA 4ENKA 1IXSB 4RAZA 3WGGA 4ON0A 3RJPA 3RYRA 4WXCA 4P55A 2V79A 1TTYA 5J8CA 3TOAA 1HXDA 1QZZA 5LGNA 1T98A 4Q5SF 4YFNF 4MTDA 2FNAA 4OMYA 3JTHA 5JHUA 3M9AA 3P9IA 4EQQA 3GVAA 1ZG5A 2YU3A 3D5LA 3ZN1A 2O03A 3DPTA 3U2RA 1E17A 3I59B 1USTA 5HS7A 1Z6TA 3Q9SA 3K1MA 1ZRFA 3N97A 3ABUA 2OZ6A 1R23A 5AIPA 4JBAA 4U0VA 2RC4A 3I59A 3E6MA 2COMA 4HAMA 4O3MA 1BI1A 3K9TA 3DV8A 2XHKA 4CHUA 2RGVA 4KIFA 5J8FA 4EJOA 4WX9A 2QM3A 1JHFA 2D2WA 4LLLA 3L09A 3QU3A 4EM1A 2E7WA 3LAJA 2DW4A 2BEOA 2KJCA 2L4MA 4RB2C 3F6OA 4G7HF 5DUIA 1B9NA 1O3QA 5DYMA 1CGPA 1YLFA 3E6BA 1J59A 2MH9A 2DBBA 1OPCA 1FPQA 3F21A 4Q48A 4M9SA 4QWQA 3K2ZA 1BC8C 1SD6A 2VBZA 4MHGA 2OU2A 3W6KB 4GGGA 4R1HA 5H6QA 3R0AA 2L54A 3WTZA 3P9CA 5JI6A 3GYHX 2M1BA 1JXSA 2CSOA 2IP2A 2B0LA 2PN6A 3WTSC 3DFGA 2XAHA 3LFKA 2DO7A 2XAJA 2XAGA 1TQPA 4A2UA 4I2OA 5K5OA 4G8XA 4ESBA 1P4XA 1WSUA 4BAYA 3E5QA 5HDNA 2EV5A 2XKOA 4R8HA 2JSCA 5DD8A 4HA8A 4Y13A 4IRIA 1EV7A 4OINF 2FF4A 5IT9K 3ML6A 2J5PA 3WODF 1KU7A 4G6DA 4BHCA 1XGMA 2DTRA 5FD6A 4FX0A 4RGRA 1KU2A 1T6SA 4LB6B 3HUGA 3WTVC 5D5UB 2EFQA 4M6YA 2HYGD 1W4MA 3R61A 4L0YB 5CVIA 2W24A 2HKXA 4NQWA 5JR3A 4GYGA 4FX4A 1BOAA 1I27A 1HSTA 3LQQA 4L9JA 2PLYA 2DT5A 2YX7A 4MQVA 2OD5A 2LF7A 3CO6C 1P6RA 3HRTA 3FZVA 2JPBA 1MJBA 2BE5F 3WE3A 2HEOA 3LQRA 5L3GA 3I71A 3CUQB 3WTXC 4IXAA 3TO9A 2BGCA 2PQ8A 4OIOF 4HF0A 4M6XA 2HFHA 1K7AA 1U5TC 2QVOA 2IPQX 3FF5A 4AIJA 1UCRA 4D0PA 3KZZA 3CUQA 5E1WA 2RNJA 1FYKA 1S3JA 3FWEA 2D45A 3BPVA 4PZJA 2LF8A 1FBQA 3DQVC 5E8IA 3IRQA 4HZFA 4U7DA 5ED4A 3GFIA 2FOKA 1YW8A 2GZWA 5HLHA 1J7KA 5A2QK 1XD7A 4M74A 3MZYA 2YPRA 4M9XA 3IRRA 2EV0A 3HOSA 2HWVA 1P4WA 2HOEA 4H0EA 4B8XA 2FEZA 1HQCA 4NHJA 4EGZA 4KNYA 2WWYA 4L9NA 1FOKA 1ZH5A 3J7AO 1PDNC 3HTSB 3EETA 2FQ3A 2H94A 3J81Z 4XBFA 3HIFA 2ZCWA 3VOEA 2EWNA 1K78B 5D4SA 4HQMA 4KFCA 2DPUA 1KU3A 4L5IA 2HKOA 3K69A 2EA4A 1IW7F 4UVAA 2RKHA 1TQIA 4AIHA 1OMIA 1ZARA 2HYFA 5ILSA 3KP2A 2DK8A 3BY6A 1S7AA 1CF7B 3WU0A 2JZYA 3IKTA 3WTTC 2ETHA 1ZAOA 3IWFA 3HYIA 1WQ2A 4KUMA 2KKOA 2CYYA 1G3WA 3GZ5A 1XSVA 4EM0B 1O3RA 2A69F 4RB0A 1DPUA 4CICA 3S2WA 5EEHA 4HLXA 1ULYA 1IRGA 5TJJA 5EEGA 2OAZA 3VFZA 2STTA 1ZHFA 3F8MA 4G9YA 4KDPA 3MWMA 3QU6A 3QOPA 1QPMA 3IC7A 3C18A 1YG2A 3ECOA 1O3TA 4HX7A 2GQQA 2X0LA 3E5UA 4P5OA 4PCQA 3LA3A 2RQPA 4LGWA 3ZMZA 1Z05A 4A12A 1SFXA 2X4HA 2V6CA 2QYOA 4LD5A 1L3LA 3RDIA 2VONA 3F8FA 2W25A 2GA2A 3ELKA 1HW1A 1G4DA 1XB4A 3QP6A 4EJVA 1O3SA 4WXDA 1OYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI9 A;  5FD5 A;  3G3Z A;  4IRH A;  4U0Y A;  5HDG A;  1W7P D;  2R7D A;  3LA7 A;  3R60 A;  5H20 A;  4B09 A;  2IRF G;  3FMS A;  5ILU A;  1I6X A;  1Z91 A;  2VOO A;  1R36 A;  1J75 A;  2UWM A;  3MQ0 A;  1TW2 A;  4LFU A;  4MNU A;  3REO A;  3KP5 A;  1D8J A;  5DEQ A;  1FBS A;  2G9W A;  4MGR A;  4HV5 A;  1RIO H;  4RB1 A;  4UVB A;  1GVJ A;  3RKW A;  1UHW A;  1AOY A;  2Q2E A;  4DQ2 A;  4YIF A;  4HDV A;  3FM3 A;  1B1B A;  4L9T A;  2HQN A;  4RS8 A;  4I0B A;  2OQR A;  5DD4 A;  1EH8 A;  2JPC A;  2O61 A;  3VEP A;  1XDU A;  1BI0 A;  1BI2 A;  2H27 A;  3SXY A;  2NYX A;  1JE8 A;  3V7R A;  1BM9 A;  2ZNY A;  1LB2 A;  5LRS A;  3SZP A;  3T5X A;  1JHH A;  5DUK A;  5TRD A;  3AAF A;  2ESH A;  3I0T A;  5JVT A;  4LJZ F;  1KYW A;  1T0F A;  4BQA A;  3KCC A;  1FT9 A;  3ZMD A;  2QEN A;  4FT8 A;  3V4G A;  1C0W A;  2P4W A;  1AWC A;  4WCG A;  1MJ9 A;  3R6S A;  2EB7 A;  1A04 A;  4G6Q A;  1BIA A;  1KU9 A;  2ZFW A;  5K5R A;  4UHT A;  1SFE A;  1VTN C;  2VBX A;  4HDU A;  3CO7 C;  5CVU A;  5LEJ A;  1I1S A;  2JTV A;  1H9T A;  3IWZ A;  1U3E M;  1YS6 A;  4BH9 A;  1XCB A;  4ZYH A;  5LHI A;  3JAM Z;  1KQ8 A;  4HF1 A;  5H6R A;  2F2E A;  2ELH A;  3ZP5 A;  4AD9 A;  1USS A;  1XGO A;  4OIR F;  3LA2 A;  1U8R A;  1ZLJ A;  3FXR A;  5HS8 A;  2VT2 A;  4BHP A;  4LG0 B;  1EH6 A;  4P9F A;  1SFU A;  3HHH A;  4YII A;  3ERE D;  2HZT A;  3E6D A;  4G94 A;  2K4B A;  1S8N A;  5FO5 A;  3QRF F;  2VXZ A;  3IL2 A;  3HOT A;  2CGP A;  2PEX A;  3PQK A;  1RUO A;  1Z6R A;  2K27 A;  3U9G A;  4LG0 A;  4XRF A;  2L02 A;  3CDH A;  4CZZ A;  3V8J A;  4ZYG A;  5D6F A;  3HRM A;  1XMK A;  1WKM A;  2TDX A;  1B59 A;  2DQL A;  4OOI A;  4UNO A;  1W5T A;  2LSO A;  2XRO A;  4KN4 X;  3DXJ F;  3H92 A;  3GZ6 A;  4M9Z A;  4LLN A;  3LWF A;  4N9H A;  2RDP A;  5CLS A;  3I64 A;  3KP6 A;  4ZZD A;  1KYZ A;  2HDC A;  5D5X B;  1B9M A;  3I58 A;  2V1X A;  1QNT A;  4CYD A;  4YFK F;  1R1T A;  2CG4 A;  3K1N A;  4RGU A;  5E1X A;  2IVM A;  4IF4 A;  1T2K A;  1LJ9 A;  2P5L C;  2QQA A;  2A61 A;  2ZKZ A;  3WGI A;  1R1V A;  4M71 A;  3DP7 A;  2M5W A;  2VN2 A;  1SD5 A;  3GFL A;  2EFW A;  4A6E A;  3EQL F;  4M73 A;  4RAY A;  1R1U A;  5CJ9 A;  4A6D A;  3RPU A;  3RI4 A;  1OYI A;  2Q0O A;  1LDD A;  4IRG A;  4IJA A;  4P96 A;  2V9V A;  2O8X A;  1IN5 A;  3FHZ A;  4HV6 A;  4HLY A;  5D4R A;  3TDU C;  4EVI A;  2Q8K A;  4OU0 A;  2WTE A;  3KP4 A;  1STZ A;  2IA0 A;  2IW5 A;  3F3X A;  3F22 A;  2H6B A;  3BDD A;  4WF2 A;  1PP8 F;  3ZMS A;  1FYL A;  2GXG A;  3V7S A;  2XIG A;  2DLL A;  3P9K A;  4O5V A;  2HR3 A;  3TDZ C;  2NNN A;  2E1N A;  2GAU A;  1G3S A;  3DKW A;  3M8E A;  1YW7 A;  3IKV A;  2OBP A;  5FGM A;  4CO8 A;  5A2Q Z;  1LVA A;  3VOD A;  5F6F A;  3J80 K;  1HW2 A;  2XV4 S;  4TV7 A;  4WK8 F;  4E70 A;  2IA2 A;  5ICC A;  4I98 B;  5JFR A;  1MKM A;  1SAX A;  2R7F A;  3LST A;  3U1D A;  3JSP A;  2ZO4 A;  2ZME A;  3RTR A;  3F8N A;  3F8B A;  4K2E A;  3KET A;  1KGS A;  1U6G A;  2BYV E;  3E97 A;  2CQK A;  5J6X A;  1HKQ A;  2K02 A;  3EYI A;  2W84 A;  1Q1H A;  2P7V B;  1FYM A;  2GXB A;  4BHB A;  4Z2Y A;  3CTA A;  4WWC A;  3P7N A;  4QLC U;  4FHT A;  5DDG A;  2LDU A;  3WE2 A;  2A6E F;  2CO5 A;  2Z3Y A;  3F6V A;  3SFZ A;  4LLG F;  2DFI A;  3GF2 A;  5FLX Z;  3GUD A;  4UVC A;  1IN8 A;  3E3V A;  5DV5 A;  3JW4 A;  1F4K A;  2RV8 A;  2UZK A;  4A5M A;  1TQM A;  4ENN A;  3K1P A;  2RN7 A;  4CXF A;  1ZLK A;  1QZY A;  3BJA A;  2BV6 A;  4KYW A;  1H0M A;  3ZPL A;  3C7J A;  1FC3 A;  1V3F A;  1XDS A;  4AWX B;  1IZ1 A;  2A3S A;  5K5Q A;  2P7C B;  1ZG1 A;  2W85 A;  2L4A A;  3TO7 A;  5BQT A;  1FSE A;  1TLH B;  2KRF A;  2XAF A;  3ULQ B;  4AIK A;  1IXC A;  3QPT A;  2IA1 A;  2MLK A;  4Y17 A;  4XLP F;  3HSE A;  1J9I A;  4ENJ A;  1EH7 A;  2J5O A;  2F5F A;  2P5K A;  3RPQ A;  1YS7 A;  4RB3 C;  3KP3 A;  1SD4 A;  4YG2 F;  2A5Y B;  4KMF A;  5HVQ C;  3R4K A;  4OIP F;  5ICG A;  1ZRC A;  3M8F A;  5ICE A;  3JSO A;  4EGY A;  5AON A;  2JT1 A;  3H3U A;  3BRO A;  3H3Z A;  1ON2 A;  4I02 A;  4RGX A;  2FMY A;  1O7F A;  5E8G A;  3CUO A;  5F64 A;  3J81 K;  5E1Z B;  3WGH A;  2O3F A;  2C6Y A;  4I09 A;  1DP7 P;  1U5T B;  1YQA A;  2MA3 A;  3C3W A;  1LEB A;  4MEX F;  2KIU A;  4HW0 A;  4Q47 A;  3ABT A;  3BJO A;  2LKP A;  4I01 A;  3V7C A;  4OIQ F;  2Y75 A;  3SZT A;  2KIF A;  1U5T A;  1P92 A;  4XSX F;  1F1Z A;  2VE8 A;  1RZ4 A;  3L9F A;  4WXH A;  2ZNZ A;  2EA2 A;  1FZP B;  2FSW A;  3BZ6 A;  4DNC A;  2H09 A;  3FMQ A;  3ZQ7 A;  1P2F A;  5AIQ A;  3BOQ A;  3ISP A;  1MZB A;  3V8L A;  4LMY A;  2ACJ A;  2M30 A;  2STW A;  2NS0 A;  4EJT A;  3ECH A;  3NEU A;  4EMS A;  3RIR A;  2EFP A;  4EJU A;  3T0Y A;  4ZYE A;  4EJW A;  3GEZ A;  4GXO A;  3HHG A;  1BI3 A;  1TW3 A;  1W7P A;  1IXR C;  3EUH A;  4JQF A;  3E5X A;  1Z7U A;  1FWZ A;  2QWW A;  3FM5 A;  1XCV A;  4BNC A;  2PBI A;  2IT0 A;  4RGS A;  3TQN A;  1R7J A;  2Z99 A;  5HS9 A;  1D8K A;  5LLQ A;  1FY7 A;  3MEX A;  5K1Y A;  2MLG A;  2UXX A;  3HSF A;  2YX4 A;  3KZY A;  2G7U A;  5HOO A;  5LBQ A;  4L0Z B;  5ILV A;  3VB2 A;  4XLN F;  1S6L A;  2PI0 A;  4HQE A;  3E6C C;  1ZGJ A;  1G3Y A;  1OYY A;  1GHC A;  1ODD A;  2HQR A;  4UV9 A;  3KE2 A;  2CFX A;  5CVV A;  1DPR A;  2EK5 A;  4UXN A;  1K6O A;  1IN7 A;  2MC3 A;  5BOX A;  1NHA A;  1XGN A;  3O2P E;  2FXA A;  2F5E A;  2CW0 F;  4KIB A;  3C1D A;  4MEY F;  3B73 A;  2ESN A;  1SMY F;  3OOP A;  4BYY A;  3M7G A;  3MFK A;  4ENM A;  3TGN A;  1DDN A;  5L3C A;  5BPD A;  2AXL A;  1REP C;  1OKR A;  5KK1 A;  1KQ0 A;  2P8T A;  3BJ6 A;  5DCF A;  2ISY A;  3GO5 A;  2MH2 A;  1B4A A;  2Z5U A;  2H6C A;  3BP8 A;  3QAH A;  2HGC A;  1S7O A;  3DEU A;  3BWG A;  3FMR A;  2Z9O A;  5IT3 A;  2NRA C;  3R0J A;  5LHH A;  2UXN A;  1RUN A;  2Z33 A;  1BBY A;  2DU9 A;  5LRR A;  4KA4 A;  2WC2 A;  1FLI A;  4LB5 A;  1SD7 A;  3RYP A;  1XGS A;  2O6G E;  4ZYD A;  4CGZ A;  4JK1 X;  1IN6 A;  3JTG A;  3CUQ C;  3FXQ A;  5D8K B;  2OA4 A;  3GWZ A;  3I4P A;  1G6N A;  4UV8 A;  1U78 A;  3GFJ A;  5KVR A;  5IT9 Z;  3DF8 A;  2K7L A;  2LNB A;  3WTU C;  3N4M A;  4IHT A;  1SMT A;  2EFN A;  5L3E A;  3I53 A;  1O7L A;  1ZRE A;  2DPD A;  2QBY B;  4U7B A;  4ESF A;  3GX4 X;  1ONV A;  4KMU X;  2EJR A;  1RI7 A;  5HLI A;  4EV0 A;  2FBH A;  2M8E A;  4O6J A;  3JAM K;  1HKS A;  2K86 A;  1DUX C;  1XSX A;  3NRV A;  3QPH A;  2P6T A;  2ZBK A;  3GLX A;  4A0Z A;  2VE9 A;  1QBJ A;  2QBY A;  1PUE E;  1X3U A;  2FE3 A;  6PAX A;  1XN7 A;  1ZYR F;  2HTJ A;  1MGT A;  4L18 B;  2PFB A;  1QGP A;  4KT5 C;  1ZGA A;  4IHS A;  5E18 F;  2VBW A;  2PJP A;  2DAO A;  5E20 A;  1UHM A;  2PG4 A;  3KEO A;  1YW9 A;  4L9V A;  3FXU A;  3W6J B;  3HRS A;  3QP5 A;  2VC1 A;  3RKY A;  1Z1D A;  3KLN A;  3J80 Z;  1FNN A;  2HS5 A;  3F23 A;  1ZRD A;  2PMU A;  3B02 A;  5ERI A;  2QZ8 A;  5E17 F;  4MTE A;  3CLO A;  3TO6 A;  4HX4 A;  2XKP A;  1LEA A;  3K0L A;  2ZJ2 A;  4ESJ A;  4I0A A;  2Y48 A;  3TKY A;  4MQ9 F;  5CYV A;  4U0W A;  5D5V B;  1B6A A;  5L3F A;  4LK1 F;  1FBU A;  3ROU A;  3HTU A;  1FP1 D;  2DI3 A;  5BS6 A;  3COA C;  1HSJ A;  1FX7 A;  1BN5 A;  4ETS A;  2IJL A;  1IRF A;  1YO5 C;  1R22 A;  4CDG A;  4N9I A;  3LAP A;  3SHF A;  1OR7 A;  3GXO A;  1J0R A;  3ZN0 A;  2CWE A;  3I54 A;  2QQB A;  2FBI A;  1F9N A;  1IN4 A;  2QQ9 A;  1QO0 D;  2AS5 F;  2VBY A;  2ZXJ A;  2P5V A;  2ISZ A;  2GWR A;  3EYY A;  4I7H A;  4BXU A;  2ZME B;  2ADU A;  2YR2 A;  1O57 A;  3ZMU A;  3HRU A;  5HDK A;  3NQO A;  1E2X A;  1GXP A;  3WTW C;  2KJB A;  4HOB A;  2EV6 A;  5F1R A;  2M87 A;  1R00 A;  4NB5 A;  5LGU A;  1ZN2 A;  3EDP A;  1D3Y A;  2GIV A;  4U88 A;  3O6B B;  3T8T A;  3Q5F A;  2G7H A;  3ZMT A;  4PGG A;  2QLZ A;  3WTY C;  1PP7 U;  3G73 A;  1KA8 A;  5LGT A;  4HF2 A;  3CJN A;  4EM2 A;  1F5T A;  2FBK A;  3SQN A;  1KQ9 A;  1I1G A;  2D1H A;  2PMH A;  2XRN A;  5FB2 A;  3V8K A;  3I5U A;  1ZG3 A;  4ASN A;  4A0Y A;  2GA1 A;  2FU4 A;  1LNW A;  5LEK A;  3KP7 A;  1YIO A;  2F5D A;  5L3D A;  2A07 F;  4GYI A;  3KEQ A;  3WG9 A;  1TNT A;  5D5W B;  1Y0U A;  3T8R A;  5HLG A;  2FML A;  2FRH A;  2VC0 A;  1IAW A;  1LDK B;  3BPX A;  4HBL A;  3ZMV A;  1TNS A;  3PQJ A;  5CVR A;  1YFH A;  2KIM A;  2XAQ A;  4GO1 A;  1XSD A;  2L3D A;  5LHG A;  1MDM B;  1K78 A;  4F7Z A;  1WRJ A;  5FFZ A;  4ZZL A;  3MZH A;  4GCV A;  2DK5 A;  2A68 F;  2O0Y A;  3L7W A;  1BIB A;  4PDK A;  2WV0 A;  4HYE A;  2A6H F;  1R58 A;  3F72 A;  1TBX A;  2OQG A;  2Y0M A;  1MDM A;  1S29 A;  1Z9C A;  1CF7 A;  5FLX K;  1HBX G;  2DQR A;  1IUY A;  1GXQ A;  2E1C A;  3DPL C;  4AVP A;  4A5N A;  3MCZ A;  2FA5 A;  3Q9V A;  3PFI A;  1H9G A;  1K79 A;  2D1V A;  3TOB A;  4PGH A;  2V1D A;  2VOP A;  2JRT A;  3D0S A;  2P6S A;  1W5S A;  4XSZ F;  1FSH A;  1J5Y A;  1IF1 A;  3IHU A;  4R79 A;  2MBF A;  1R5G A;  5FFX A;  5L3B A;  5BPI A;  4M72 A;  4Q4Z F;  1BJA A;  1MJA A;  1V4R A;  2EFO A;  1P4A A;  2W57 A;  2HTS A;  4IVN A;  1J2X A;  2XUB A;  2XVC A;  4Y15 A;  1G3T A;  5D8L B;  4S04 A;  2E7X A;  1I5Z A;  2VT3 A;  1XMA A;  4P9U A;  2NAZ A;  3MAJ A;  1LDJ A;  1MD0 A;  1WWX A;  1JGS A;  4ZH4 F;  2V1U A;  3HSR A;  1RNL A;  1W7P B;  4IPA A;  4G7O F;  4A0X A;  3L00 A;  2L01 A;  5D6E A;  2R3S A;  2BBY A;  4KIG A;  4G7Z F;  1U2W A;  2NNY A;  1HW5 A;  3FX3 A;  4UUV A;  2M45 A;  5ICF A;  1QQI A;  3O3K A;  4S05 A;  1UFM A;  5DCM B;  2VOD A;  5BMZ A;  1BC7 C;  1T38 A;  3L2C A;  4HX8 A;  1L0O C;  3WU1 B;  2RVC A;  1HKT A;  2F5C A;  1T39 A;  1D5V A;  5DCM A;  1YTY A;  4KIC A;  2YSR A;  3OV8 A;  2MD5 A;  3F8C A;  3KFW X;  4OMZ A;  2XGX A;  3M1E A;  4L5J A;  1LQ1 A;  1R5H A;  5CVJ A;  3GFM A;  2XAS A;  4YFX F;  3T1B A;  2K4J A;  4N0B A;  4LK0 F;  1FP2 A;  4KN7 X;  3RKX A;  2OZU A;  1UB9 A;  2FNP A;  2QUF A;  3GW2 A;  1YYV A;  1ON1 A;  3KLO A;  4ENK A;  1IXS B;  4RAZ A;  3WGG A;  4ON0 A;  3RJP A;  3RYR A;  4WXC A;  4P55 A;  2V79 A;  1TTY A;  5J8C A;  3TOA A;  1HXD A;  1QZZ A;  5LGN A;  1T98 A;  4Q5S F;  4YFN F;  4MTD A;  2FNA A;  4OMY A;  3JTH A;  5JHU A;  3M9A A;  3P9I A;  4EQQ A;  3GVA A;  1ZG5 A;  2YU3 A;  3D5L A;  3ZN1 A;  2O03 A;  3DPT A;  3U2R A;  1E17 A;  3I59 B;  1UST A;  5HS7 A;  1Z6T A;  3Q9S A;  3K1M A;  1ZRF A;  3N97 A;  3ABU A;  2OZ6 A;  1R23 A;  5AIP A;  4JBA A;  4U0V A;  2RC4 A;  3I59 A;  3E6M A;  2COM A;  4HAM A;  4O3M A;  1BI1 A;  3K9T A;  3DV8 A;  2XHK A;  4CHU A;  2RGV A;  4KIF A;  5J8F A;  4EJO A;  4WX9 A;  2QM3 A;  1JHF A;  2D2W A;  4LLL A;  3L09 A;  3QU3 A;  4EM1 A;  2E7W A;  3LAJ A;  2DW4 A;  2BEO A;  2KJC A;  2L4M A;  4RB2 C;  3F6O A;  4G7H F;  5DUI A;  1B9N A;  1O3Q A;  5DYM A;  1CGP A;  1YLF A;  3E6B A;  1J59 A;  2MH9 A;  2DBB A;  1OPC A;  1FPQ A;  3F21 A;  4Q48 A;  4M9S A;  4QWQ A;  3K2Z A;  1BC8 C;  1SD6 A;  2VBZ A;  4MHG A;  2OU2 A;  3W6K B;  4GGG A;  4R1H A;  5H6Q A;  3R0A A;  2L54 A;  3WTZ A;  3P9C A;  5JI6 A;  3GYH X;  2M1B A;  1JXS A;  2CSO A;  2IP2 A;  2B0L A;  2PN6 A;  3WTS C;  3DFG A;  2XAH A;  3LFK A;  2DO7 A;  2XAJ A;  2XAG A;  1TQP A;  4A2U A;  4I2O A;  5K5O A;  4G8X A;  4ESB A;  1P4X A;  1WSU A;  4BAY A;  3E5Q A;  5HDN A;  2EV5 A;  2XKO A;  4R8H A;  2JSC A;  5DD8 A;  4HA8 A;  4Y13 A;  4IRI A;  1EV7 A;  4OIN F;  2FF4 A;  5IT9 K;  3ML6 A;  2J5P A;  3WOD F;  1KU7 A;  4G6D A;  4BHC A;  1XGM A;  2DTR A;  5FD6 A;  4FX0 A;  4RGR A;  1KU2 A;  1T6S A;  4LB6 B;  3HUG A;  3WTV C;  5D5U B;  2EFQ A;  4M6Y A;  2HYG D;  1W4M A;  3R61 A;  4L0Y B;  5CVI A;  2W24 A;  2HKX A;  4NQW A;  5JR3 A;  4GYG A;  4FX4 A;  1BOA A;  1I27 A;  1HST A;  3LQQ A;  4L9J A;  2PLY A;  2DT5 A;  2YX7 A;  4MQV A;  2OD5 A;  2LF7 A;  3CO6 C;  1P6R A;  3HRT A;  3FZV A;  2JPB A;  1MJB A;  2BE5 F;  3WE3 A;  2HEO A;  3LQR A;  5L3G A;  3I71 A;  3CUQ B;  3WTX C;  4IXA A;  3TO9 A;  2BGC A;  2PQ8 A;  4OIO F;  4HF0 A;  4M6X A;  2HFH A;  1K7A A;  1U5T C;  2QVO A;  2IPQ X;  3FF5 A;  4AIJ A;  1UCR A;  4D0P A;  3KZZ A;  3CUQ A;  5E1W A;  2RNJ A;  1FYK A;  1S3J A;  3FWE A;  2D45 A;  3BPV A;  4PZJ A;  2LF8 A;  1FBQ A;  3DQV C;  5E8I A;  3IRQ A;  4HZF A;  4U7D A;  5ED4 A;  3GFI A;  2FOK A;  1YW8 A;  2GZW A;  5HLH A;  1J7K A;  5A2Q K;  1XD7 A;  4M74 A;  3MZY A;  2YPR A;  4M9X A;  3IRR A;  2EV0 A;  3HOS A;  2HWV A;  1P4W A;  2HOE A;  4H0E A;  4B8X A;  2FEZ A;  1HQC A;  4NHJ A;  4EGZ A;  4KNY A;  2WWY A;  4L9N A;  1FOK A;  1ZH5 A;  3J7A O;  1PDN C;  3HTS B;  3EET A;  2FQ3 A;  2H94 A;  3J81 Z;  4XBF A;  3HIF A;  2ZCW A;  3VOE A;  2EWN A;  1K78 B;  5D4S A;  4HQM A;  4KFC A;  2DPU A;  1KU3 A;  4L5I A;  2HKO A;  3K69 A;  2EA4 A;  1IW7 F;  4UVA A;  2RKH A;  1TQI A;  4AIH A;  1OMI A;  1ZAR A;  2HYF A;  5ILS A;  3KP2 A;  2DK8 A;  3BY6 A;  1S7A A;  1CF7 B;  3WU0 A;  2JZY A;  3IKT A;  3WTT C;  2ETH A;  1ZAO A;  3IWF A;  3HYI A;  1WQ2 A;  4KUM A;  2KKO A;  2CYY A;  1G3W A;  3GZ5 A;  1XSV A;  4EM0 B;  1O3R A;  2A69 F;  4RB0 A;  1DPU A;  4CIC A;  3S2W A;  5EEH A;  4HLX A;  1ULY A;  1IRG A;  5TJJ A;  5EEG A;  2OAZ A;  3VFZ A;  2STT A;  1ZHF A;  3F8M A;  4G9Y A;  4KDP A;  3MWM A;  3QU6 A;  3QOP A;  1QPM A;  3IC7 A;  3C18 A;  1YG2 A;  3ECO A;  1O3T A;  4HX7 A;  2GQQ A;  2X0L A;  3E5U A;  4P5O A;  4PCQ A;  3LA3 A;  2RQP A;  4LGW A;  3ZMZ A;  1Z05 A;  4A12 A;  1SFX A;  2X4H A;  2V6C A;  2QYO A;  4LD5 A;  1L3L A;  3RDI A;  2VON A;  3F8F A;  2W25 A;  2GA2 A;  3ELK A;  1HW1 A;  1G4D A;  1XB4 A;  3QP6 A;  4EJV A;  1O3S A;  4WXD A;  1OYW A; 
#chains in the Genus database with same CATH topology
 1P7I A;  1WI9 A;  5FD5 A;  3G3Z A;  2YU9 J;  2V9K A;  4IRH A;  5JHF A;  4U0Y A;  4A3M J;  1K4S A;  3P5J A;  1ZQ3 P;  5HDG A;  2CV1 A;  3HOX J;  3AKZ A;  3B6A A;  5J1U A;  2O5R A;  3OIO A;  4U87 A;  1W7P D;  2R7D A;  3LA7 A;  3R60 A;  5E3M A;  2VLA A;  5H20 A;  4B09 A;  4KT6 A;  2WAE A;  2M4K A;  2IRF G;  3FMS A;  2NVU B;  5ILU A;  3ZQC A;  1I6X A;  1Z91 A;  3BR3 A;  4E7Z A;  2VOO A;  1R36 A;  4IKF A;  1J75 A;  2UWM A;  3MQ0 A;  1TW2 A;  4LFU A;  4MNU A;  3REO A;  5F0C A;  1WH5 A;  3LSG A;  2BHZ A;  3K4C A;  4BBS J;  2Q2E B;  2WY8 Q;  3KP5 A;  4QPO A;  5DEQ A;  1FBS A;  2G9W A;  1D8J A;  2H8W A;  2BXZ A;  4XN0 A;  5TGT A;  4MGR A;  4HV5 A;  4BJ6 C;  2MYS A;  1Z3Y A;  1PVE A;  1RKW A;  2GOM A;  1YJN I;  1RIO H;  1Y8Q B;  4RB1 A;  1VQO I;  3RSN A;  3K10 A;  4L5E A;  4I76 A;  1AKH B;  4UVB A;  1GVJ A;  3RKW A;  1UHW A;  1AOY A;  2Q2E A;  2MAB A;  4DQ2 A;  4YIF A;  2DDA A;  4HDV A;  2FUG 2;  1WI3 A;  3FM3 A;  1B1B A;  3DTK A;  2XAU A;  4L9T A;  5EG0 B;  1HDP A;  2HQN A;  4RS8 A;  4I0B A;  2OQR A;  3K4N A;  5DD4 A;  1EH8 A;  1AKH A;  3BR1 A;  2JPC A;  2O61 A;  1V54 H;  3VEP A;  1XDU A;  1BI0 A;  1BI2 A;  2V4J C;  2I8D A;  2JA2 A;  3SXY A;  2H27 A;  2NYX A;  1JE8 A;  2NVQ J;  1W5C C;  3GTP J;  2AQF A;  4IO9 F;  5EG0 A;  3MKL A;  3V7R A;  1ERD A;  1BM9 A;  2ZNY A;  4A3B J;  5DM6 F;  1BL0 A;  5J1R A;  5DS9 A;  2JA8 J;  1LB2 A;  5LRS A;  3SZP A;  3CCS I;  1ZGW A;  3T5X A;  2WAQ N;  4CZC A;  2BVL A;  5FKN A;  1JHH A;  1QRY A;  2ZXI A;  5DUK A;  4UB6 C;  5TRD A;  2KL4 A;  3AAF A;  2ESH A;  3I0T A;  5F27 A;  5JVT A;  3E7L A;  3M8J A;  4LJZ F;  3IUO A;  4DZJ A;  3RZO J;  1KYW A;  1T0F A;  4BQA A;  2XRL A;  3QPL A;  3KCC A;  1FT9 A;  3ZMD A;  3HGG A;  2QEN A;  3HPG A;  4FT8 A;  3V4G A;  1ZR2 A;  2P4W A;  1Y1V J;  1C0W A;  4PK4 A;  1AWC A;  4WCG A;  1MJ9 A;  3R6S A;  2EB7 A;  5B3S H;  2XDV A;  4XIC A;  3HKZ A;  2DTZ A;  3HDD A;  1YOV B;  1A04 A;  4G6Q A;  2MGQ A;  1BIA A;  1KU9 A;  1MMN A;  2Y9Z A;  3CC2 I;  4FE7 A;  3OYL A;  2ZFW A;  5K5R A;  4UHT A;  1SFE A;  1H8A C;  1VTN C;  2I10 A;  4QSH A;  3GTG J;  2VBX A;  1OR7 C;  4HDU A;  3CO7 C;  5CVU A;  5LEJ A;  1I1S A;  2JTV A;  1H9T A;  3IWZ A;  1U3E M;  2WAF A;  4PJJ A;  1YS6 A;  4BH9 A;  1XCB A;  1S7E A;  1I3Q J;  4DBR A;  4ZYH A;  1YJW I;  3UKG A;  5LHI A;  3JAM Z;  1POG A;  1KQ8 A;  4HF1 A;  5H6R A;  3FXK A;  2VL8 A;  2ELH A;  2F2E A;  1BJZ A;  2QEX I;  3ZP5 A;  2V26 A;  4AD9 A;  3VYR B;  2L7M P;  2VPL A;  1FMW A;  1USS A;  3JRE A;  4OWR B;  3BZC A;  1XGO A;  4OIR F;  1IC8 A;  3LA2 A;  3DTI A;  4M3B A;  1U8R A;  4BY7 J;  1ZLJ A;  2Z16 A;  3FXR A;  5HS8 A;  3AL0 C;  2VT2 A;  5M5X J;  4C3H J;  4BHP A;  2JRM A;  4HEA 2;  1EH6 A;  4LG0 B;  4PJ0 C;  3L1P A;  1QZE A;  4P9F A;  3FBI B;  3K4K A;  1SFU A;  3MN2 A;  3HHH A;  4YII A;  1VQ8 I;  3ERE D;  1P9Q C;  2HZT A;  3E6D A;  3FK7 A;  1VQL I;  1LKX A;  3NAU A;  4G94 A;  4ZDL A;  2LY2 A;  2K4B A;  1S8N A;  5FO5 A;  5LD2 C;  3QRF F;  3BQY A;  5JVG F;  2VXZ A;  1V55 H;  2X85 A;  3E0J B;  3IL2 A;  3HOT A;  2CGP A;  2PEX A;  3PQK A;  1RUO A;  2XB0 X;  3GTK J;  1Z6R A;  2K27 A;  3U9G A;  4LG0 A;  4XRF A;  3BCB A;  2L02 A;  1NK2 P;  3ABK H;  3CDH A;  4CZZ A;  2DT7 B;  2F4M B;  3V8J A;  3DCF A;  4ZYG A;  2M7B A;  5D6F A;  3HRM A;  2WV1 A;  4LG3 A;  1XMK A;  2JA5 J;  1WKM A;  2TDX A;  1B59 A;  3SEQ A;  2DQL A;  4OOI A;  4UNO A;  5CPR B;  3OYK A;  1VFC A;  1W5T A;  2LSO A;  1W36 C;  3JCU C;  2E2H J;  5E3N A;  2XRO A;  4IHY A;  5GAE J;  4KN4 X;  1HDD C;  3DXJ F;  3K4J A;  5CKT A;  4BKX A;  3H92 A;  2YS9 A;  3GZ6 A;  4JX6 A;  3WHB A;  4M9Z A;  4LLN A;  2VAS A;  3LWF A;  4XOR A;  4N9H A;  1TWC J;  2CV2 A;  2K3F A;  1VQ6 I;  2RDP A;  3GCM A;  4DOZ A;  5CLS A;  3I64 A;  3KP6 A;  3TED A;  1WZ2 A;  4ZZD A;  4B4C A;  1KYZ A;  2KFD A;  2VJI A;  1FIP A;  1T56 A;  2FX0 A;  2HDC A;  4A93 J;  4MO7 A;  5D5X B;  1B9M A;  3H35 A;  3I58 A;  2V1X A;  1U9N A;  1QNT A;  2R0Q C;  1T08 B;  4CYD A;  2X1D A;  4YFK F;  2QSG X;  1XTA A;  3JRF A;  2Y31 A;  1R1T A;  2CG4 A;  3BG5 A;  2CUE A;  3K1N A;  4RGU A;  5E1X A;  1ZR4 A;  3GME A;  2IVM A;  2KRH A;  1S5L C;  1OCR H;  4LOC A;  4IF4 A;  4FET A;  1T2K A;  1ETX A;  1LJ9 A;  2P5L C;  1JUS A;  1K6Y A;  2QQA A;  2A61 A;  2HPM A;  2ZKZ A;  3WGI A;  2K9S A;  1R1V A;  4M71 A;  3DP7 A;  2M5W A;  3BR2 A;  2VN2 A;  1SD5 A;  3GFL A;  2EFW A;  2E1M B;  4A6E A;  3CC7 I;  4YRV A;  2VI6 A;  3EQL F;  4M73 A;  4RAY A;  1R1U A;  5CJ9 A;  4A6D A;  2QA4 I;  3RPU A;  2DA6 A;  3K4M A;  3HUG B;  3BCA A;  1OYI A;  3RI4 A;  2Q0O A;  1KON A;  2JN6 A;  1LDD A;  4BQN A;  3RKQ A;  1JTY A;  4DZP A;  4IRG A;  5HLT A;  4IJA A;  4P96 A;  4MFE A;  2V9V A;  2O8X A;  1IN5 A;  3FHZ A;  4HV6 A;  5C44 J;  1A6I A;  3LL7 A;  1TWH J;  5D4R A;  4HLY A;  2QKM B;  1OJL A;  1WJD A;  2H8R A;  3TDU C;  1VQ4 I;  4EVI A;  3LOC A;  3OOU A;  3WG7 H;  2Q8K A;  2Z1D A;  5K7F A;  3CCY A;  2R7Q A;  2QQ8 A;  1SFO J;  3CCL I;  4OU0 A;  3D5S C;  2WTE A;  3M4O J;  4FQG A;  3KP4 A;  1STZ A;  2IA0 A;  2IW5 A;  1T33 A;  2ECB A;  3F3X A;  4DGW B;  2COB A;  3F22 A;  2QCO A;  2H6B A;  3OYI A;  1QPI A;  3CCU I;  3BDD A;  4BXX J;  4WF2 A;  1FJL A;  1E3H A;  1PP8 F;  2GM4 A;  3ZMS A;  3FBN B;  2TCT A;  1FYL A;  2GXG A;  2DOA A;  2EIN H;  2NVX J;  3V7S A;  2XIG A;  2DLL A;  3P9K A;  3H3V K;  1MBE A;  3PNT A;  4O5V A;  1R5I D;  1IJW C;  2HR3 A;  3TDZ C;  4CCM A;  2R7R A;  2NNN A;  2E1N A;  2GAU A;  3CP8 A;  4HNT A;  1WVR A;  1G3S A;  1X3W B;  3DKW A;  3DU6 A;  3M8E A;  3BLY A;  1YW7 A;  4A3L J;  4AC0 A;  5H2F C;  3IKV A;  2OBP A;  3LSK A;  3OMY A;  2CH0 A;  5FGM A;  4CO8 A;  5A2Q Z;  2LR8 A;  3J7A Y;  3CCM I;  1LVA A;  2ZC2 A;  5IP6 A;  3VOD A;  1MND A;  3NWT A;  5F6F A;  3J80 K;  3L2V A;  3O8G A;  1N25 A;  2R7O A;  3H5A A;  3IAS 2;  1HW2 A;  2XV4 S;  4TV7 A;  2R4G A;  2ELJ A;  3PNY A;  1EA3 A;  1MBK A;  1SFK A;  4WK8 F;  2CW8 A;  3PNV A;  4A3G J;  4E70 A;  2IA2 A;  2L9S A;  5DTD A;  3PFY A;  5ICC A;  1HOM A;  4I98 B;  2JJ7 A;  5JFR A;  1MKM A;  5GTI C;  1UJ8 A;  3HKZ N;  1SAX A;  2XPW A;  4W97 A;  4RLF A;  2R7F A;  2F5V A;  3LST A;  5GP9 A;  3U1D A;  1DU6 A;  1APL C;  3JSP A;  2ZO4 A;  1BW5 A;  4IEJ A;  5F1J A;  2ZME A;  3RTR A;  2FD5 A;  2AO9 A;  3F8N A;  3F8B A;  4K2E A;  3KET A;  1VI0 A;  2W48 A;  1FMV A;  1I50 J;  1KGS A;  4C2U A;  1U6G A;  4AYB N;  1ZEL A;  3OYF A;  3JRC A;  2BYV E;  3E97 A;  2CQK A;  5J6X A;  1HKQ A;  3BR5 A;  5FLV A;  2K02 A;  3EYI A;  2W84 A;  4BE0 A;  3B6C A;  2LD5 A;  1Q1H A;  2P7V B;  3SDG A;  4YIR X;  1ETO A;  4A3E J;  1FYM A;  1MBJ A;  3EPZ A;  2GXB A;  2Y0S A;  4BHB A;  4Z2Y A;  4ZDO A;  3CTA A;  3FDY A;  1XC5 A;  2MSY A;  3G1O A;  4WWC A;  4C2M J;  2MG4 A;  3P7N A;  4QLC U;  4V2F A;  2QSF X;  4FHT A;  3ZR8 X;  5DDG A;  4CA0 A;  2LDU A;  3WE2 A;  2A6E F;  2CO5 A;  3HXL A;  4M3D A;  3TW7 A;  3ZGK A;  3GTM J;  3RZD J;  2Z3Y A;  3F6V A;  4RBO A;  2LFB A;  3PUF A;  3SFZ A;  2OTJ I;  4MFD A;  4LLG F;  3HOU J;  3DEW A;  2E19 A;  4W1U A;  2DFI A;  3GF2 A;  5FLX Z;  3GUD A;  3S1N J;  4UVC A;  2ZJQ F;  1IN8 A;  3F9K A;  3E3V A;  3IH4 A;  4LIT A;  5DV5 A;  2Y2Z A;  3JW4 A;  1F4K A;  2RV8 A;  4BE1 A;  2OCC H;  2KZV A;  2UZK A;  2NOJ B;  4BQQ A;  1FOW A;  2HNH A;  1TQM A;  3A4C A;  4A5M A;  3CJR B;  1YIT I;  2HYJ A;  4ENN A;  2IGK A;  3UR3 C;  1E3O C;  3K1P A;  4NBQ A;  2RN7 A;  4CXF A;  4CCN A;  1ZLK A;  1NG6 A;  2E71 A;  1QZY A;  3BJA A;  4PSW A;  3TBI A;  2BV6 A;  4KYW A;  1OCO H;  2DA3 A;  1H0M A;  3ZPL A;  3C7J A;  2EH3 A;  1FC3 A;  1V3F A;  1XDS A;  4AWX B;  1IZ1 A;  2A3S A;  5K5Q A;  3CF5 F;  3JRH A;  2KIS A;  2A6T A;  2P7C B;  1ZG1 A;  2B63 J;  2JVH A;  2W85 A;  2R93 J;  2FQ4 A;  2L4A A;  4RM2 A;  1YX3 A;  3TO7 A;  4IOC F;  5EGO A;  1D0Y A;  1RKT A;  4ZJZ A;  5BQT A;  2K9L A;  1FSE A;  1N78 A;  1YIJ I;  1IUF A;  1TLH B;  2KRF A;  2XAF A;  3S2D J;  1X1D A;  3ULQ B;  4AIK A;  1IXC A;  4RA2 A;  3QPT A;  1HC8 A;  1IGN A;  2IA1 A;  2MLK A;  4X1E A;  4Y17 A;  4HNV A;  4XLP F;  3HSE A;  1B72 A;  1J9I A;  4F55 A;  4ENJ A;  1XS9 A;  1EH7 A;  2XGC A;  5IYC J;  2J5O A;  2F5F A;  2X6O A;  3E1S A;  2L0K A;  2P5K A;  4E7K A;  3RPQ A;  1YS7 A;  3K4B A;  4I6Z A;  2WAD A;  2LMD A;  4RB3 C;  3KP3 A;  2KDZ A;  3OS1 A;  5HOD A;  1BOB A;  1SD4 A;  4YG2 F;  1GT0 C;  3PJR A;  2A5Y B;  4KMF A;  3HM5 A;  2BY3 A;  5HVQ C;  4E6K G;  3R4K A;  4OIP F;  5ICG A;  1ZRC A;  1TL8 A;  3M8F A;  4PJL A;  5ICE A;  3JSO A;  4EGY A;  2F4I A;  5AON A;  4BL0 B;  2JT1 A;  3H3U A;  3BRO A;  3H3Z A;  3OYC A;  1ON2 A;  4I02 A;  5IOZ A;  2DOD A;  2XPV A;  1TT0 A;  4RGX A;  1ETK A;  3PIO F;  2FMY A;  1O7F A;  5E8G A;  2VKE A;  3K4L A;  1BA5 A;  3Q0V A;  4BJT A;  1TT5 B;  4JX4 A;  3CUO A;  4OAZ A;  4C3I J;  1H89 C;  3CC4 I;  5KCM A;  4XKB A;  5F64 A;  5J4Y A;  1U9O A;  3J81 K;  2CU7 A;  5JLW A;  2CQN A;  5E1Z B;  2VQC A;  3WGH A;  1SVM A;  2O3F A;  2C6Y A;  4I09 A;  1DP7 P;  3PIP F;  4ABZ A;  1U5T B;  3OYH A;  5FRN A;  1YQA A;  4ZTJ A;  4AU7 A;  4B48 A;  2MA3 A;  3C3W A;  4XN3 A;  1LEB A;  4MEX F;  2KIU A;  4HW0 A;  4Q47 A;  3ABT A;  1JUP A;  3VWB A;  4XLH A;  1YJ9 I;  3BJO A;  2LKP A;  4I01 A;  4QTR A;  2CUZ A;  3A2K A;  3V7C A;  2KPM A;  4OIQ F;  2Y75 A;  1D0X A;  3SZT A;  2KIF A;  1X2M A;  2LBF B;  1U5T A;  1P92 A;  4XSX F;  1F1Z A;  2VE8 A;  4PFP A;  1RZ4 A;  3L9F A;  4WXH A;  2ZNZ A;  2EA2 A;  3FXJ A;  1FZP B;  2FSW A;  4Y3O A;  3BZ6 A;  4DNC A;  2H09 A;  1Z0X A;  5IPA A;  4NC6 A;  3FMQ A;  3F0C A;  3OR1 C;  5K7H A;  3OL3 A;  2DA2 A;  3HOV J;  3I4M J;  1DGR M;  1SEU A;  2LBF A;  3ZQ7 A;  1P2F A;  5AIQ A;  4UUS A;  4A3I J;  1Y1W J;  4IHX A;  3BOQ A;  3ISP A;  1MZB A;  3V8L A;  4LMY A;  3TW6 A;  1K4T A;  2ACJ A;  2M30 A;  2STW A;  2LVS A;  3CZ6 A;  2NS0 A;  4XM3 A;  5B1A H;  2LLK A;  4EJT A;  3ECH A;  1D1B A;  3NEU A;  4EMS A;  4IHW A;  5M5W J;  3RIR A;  2N8G A;  2EFP A;  4EJU A;  3T0Y A;  2QSH X;  1QHH D;  2CUF A;  4ZYE A;  5EEA A;  2X6Y A;  4UY8 I;  4PUS A;  4KJZ A;  4EJW A;  1YI2 I;  2XF6 A;  3GEZ A;  5FKL A;  1LFU P;  4GXO A;  3HHG A;  4XLE A;  1BI3 A;  1TW3 A;  1W7P A;  1IXR C;  1D1A A;  3EUH A;  4JQF A;  3E5X A;  1Z7U A;  4DYR A;  3MKZ A;  2M3A A;  1FWZ A;  2HZD A;  3QYB A;  2QWW A;  5FJ8 J;  3FM5 A;  2K9N A;  3PSF A;  3S15 J;  1IO2 A;  1XCV A;  2VKD A;  5C4J J;  4DIQ A;  4BNC A;  2DN0 A;  2PBI A;  2IT0 A;  4B3X A;  2XPU A;  1Z21 A;  3BTL A;  2A05 A;  2X6X A;  4RGS A;  2HVQ A;  3TQN A;  1R7J A;  2Z99 A;  4IOA F;  2RRE A;  1MMS A;  5HS9 A;  2Y0S N;  2O9L A;  1D8K A;  5LLQ A;  5LFA A;  1FY7 A;  3MEX A;  3Q0W A;  5GAD J;  3OYJ A;  2LRD A;  5K1Y A;  3CMA I;  1U8B A;  4F52 A;  4D7M A;  2MLG A;  5BNG A;  4A3C J;  1WJE A;  2DT6 A;  2CQ7 A;  2HPI A;  2UXX A;  3HSF A;  5FKK A;  2YX4 A;  3KZY A;  1E0E A;  2G7U A;  1GVD A;  3BG6 A;  5HOO A;  4XKW A;  5LBQ A;  4L0Z B;  2L9R A;  1GLN A;  5ILV A;  4CCJ A;  1Y6I A;  3VB2 A;  2L9N A;  4XLN F;  1S6L A;  3LSI A;  2OJE D;  5J40 A;  2PI0 A;  4HQE A;  2EPF A;  3E6C C;  1ZGJ A;  1G3Y A;  1TC3 C;  1OYY A;  1FOX A;  1GHC A;  1ODD A;  1Y8R B;  2HQR A;  3FXL A;  3KE2 A;  4UV9 A;  2CFX A;  2HQA A;  5CVV A;  3FKI J;  4DJA A;  1DPR A;  2BXY A;  2W82 A;  4FAS D;  3L2Q A;  2EK5 A;  4UXN A;  4XLF A;  4BS9 A;  2IS2 A;  1RR7 A;  1K6O A;  3OYG A;  1IN7 A;  2K85 A;  1G8X A;  2MC3 A;  3DBL B;  5BOX A;  1NHA A;  1XGN A;  2BY1 A;  5EDN A;  2PX9 A;  3O2P E;  2FXA A;  2F5E A;  1MMA A;  3GBG A;  2CW0 F;  4KIB A;  3C1D A;  4MEY F;  3B73 A;  2ESN A;  2A5W A;  1SMY F;  3OOP A;  4BYY A;  3CCE I;  3M7G A;  3MFK A;  2BHY A;  4ENM A;  3TGN A;  1DDN A;  5L3C A;  1T95 A;  3IV5 A;  5BPD A;  2AXL A;  2X48 A;  5B5E C;  1REP C;  3A02 A;  1OKR A;  3BZK A;  3OYB A;  1PYV A;  5KK1 A;  4CCO A;  1KQ0 A;  2P8T A;  4E4H A;  2CRG A;  3BJ6 A;  3EUA A;  1W1W E;  1X1B A;  5DCF A;  2ISY A;  3GO5 A;  2MH2 A;  2RQQ A;  1H88 C;  2HOS A;  1B4A A;  3VSL A;  2GLO A;  2Z5U A;  3I3L A;  2H6C A;  1D5Y A;  3BP8 A;  3QAH A;  2HGC A;  4IX7 A;  1S7O A;  2EIM H;  4HST A;  5GAH J;  3DEU A;  3BWG A;  4AID A;  3FMR A;  3QOD A;  2Z9O A;  5IT3 A;  1U0J A;  2NRA C;  2ZXH A;  3R0J A;  2BW3 B;  5LHH A;  1NH3 A;  2UXN A;  3L2R A;  2VB6 A;  3CDI A;  1RUN A;  1SC7 A;  2Z33 A;  1BBY A;  1A5J A;  2DU9 A;  5LRR A;  4KA4 A;  2WC2 A;  1FLI A;  4LB5 A;  1SD7 A;  3RYP A;  1XGS A;  4G12 A;  1WJA A;  2P0W A;  2O6G E;  4ZYD A;  2R7V A;  4CGZ A;  1VQ5 I;  4P1W A;  3CCV I;  1X19 A;  4JK1 X;  1IN6 A;  3JTG A;  2BW3 A;  3H9Q A;  3CUQ C;  3FXQ A;  5D8K B;  2LOO A;  2OA4 A;  1T8I A;  3WU2 C;  1RR8 C;  1RPW A;  3GWZ A;  1YRN B;  4V19 K;  5KAI C;  3I4P A;  3HOY J;  1G6N A;  4UV8 A;  1U78 A;  2EZL A;  1JJ6 C;  3GFJ A;  5KVR A;  5IT9 Z;  3DF8 A;  2K7L A;  4X0G A;  4GDF A;  4FCY A;  2LNB A;  2W4S A;  3WTU C;  3N4M A;  1SMT A;  4IHT A;  2EFN A;  5L3E A;  3BR6 A;  1QVT A;  1EF4 A;  3I53 A;  3OS0 A;  1O7L A;  1ZRE A;  2DPD A;  2QBY B;  4U7B A;  1VQM I;  2YUS A;  4ESF A;  3GX4 X;  1UG2 A;  3DEE A;  1X1C A;  1YRN A;  1A35 A;  1ONV A;  4KMU X;  1BR2 A;  2EIK H;  1QU3 A;  3I9V 2;  2EJR A;  1RI7 A;  5HLI A;  4EV0 A;  1TWG J;  2FBH A;  2M8E A;  4O6J A;  3PM1 A;  2DYS H;  3JAM K;  4KIS A;  1HKS A;  2K86 A;  1DUX C;  1XSX A;  1EJ9 A;  4RLQ A;  3NRV A;  3QPH A;  2JQ7 A;  2P6T A;  2ZBK A;  3GLX A;  4A0Z A;  2DOF A;  2VE9 A;  1Y0N A;  3AG2 H;  1QBJ A;  2VPR A;  3JRI A;  2QBY A;  2ZJP F;  4RAG A;  2DOE A;  1JT6 A;  1PUE E;  1X3U A;  3OWT A;  1VZ0 A;  2FE3 A;  3PO3 J;  6PAX A;  1XN7 A;  1ZYR F;  2HTJ A;  2V6E A;  1MGT A;  4L18 B;  2PFB A;  1QGP A;  4KT5 C;  1ZGA A;  4IHS A;  3HG9 A;  4MLO A;  4NC7 A;  4UUT A;  5E18 F;  4HG2 A;  4KIT B;  4ITV A;  3GLL A;  2VBW A;  3RPU D;  2ZSI B;  4B3A A;  2PJP A;  2DAO A;  3S2H J;  5E20 A;  1UHM A;  2PG4 A;  1QHG A;  3KEO A;  1YW9 A;  4L9V A;  2FJ1 A;  1MNM C;  3FXU A;  3W6J B;  3HRS A;  3QP5 A;  2VC1 A;  3RKY A;  3HGY A;  1Z1D A;  1RRJ A;  3KLN A;  3J80 Z;  1FNN A;  2XB5 A;  2LP0 A;  2HS5 A;  3CF2 A;  4EAT A;  3F23 A;  3S3M A;  1S9H A;  1ZRD A;  3G71 I;  2PMU A;  5EF6 A;  2L5Q A;  3B02 A;  5ERI A;  2QZ8 A;  4XID A;  5E17 F;  2DMT A;  4MTE A;  3CLO A;  4YEL A;  3TO6 A;  1A31 A;  4HX4 A;  2XKP A;  1LEA A;  3QYE A;  3K0L A;  3RQI A;  2ZJ2 A;  4ESJ A;  4HSR A;  4I0A A;  2Y48 A;  3TKY A;  3MKW B;  2NS8 A;  5E3L A;  4MQ9 F;  2R5Y B;  5CYV A;  1R49 A;  2HDD A;  4U0W A;  1UHS A;  5D5V B;  2KIQ A;  1B6A A;  2OPT A;  1E3P A;  1XG1 A;  4F3Q A;  5L3F A;  1TZL A;  4LK1 F;  1FBU A;  3ROU A;  1A36 A;  3HTU A;  1FTT A;  1FP1 D;  4ANJ A;  2DI3 A;  5BS6 A;  3COA C;  1HSJ A;  1FX7 A;  2VQG A;  3TP0 A;  2LKX A;  2K9Q A;  1BN5 A;  4ETS A;  2EBI A;  2IJL A;  1IRF A;  1YO5 C;  5IYD J;  2E5Z A;  1R22 A;  2M4G A;  4CDG A;  2NVY J;  4N9I A;  3LAP A;  3SHF A;  2R5Y A;  1OR7 A;  5C3E J;  3GXO A;  1J0R A;  2X6W A;  4C3J J;  3ZN0 A;  2CWE A;  2R7U A;  3I54 A;  1DP3 A;  2QQB A;  1Z3X A;  2FBI A;  1F9N A;  2UV1 A;  1MH4 A;  3AL0 B;  5GPC A;  1DU0 A;  2LRE A;  4Y4R A;  1IN4 A;  2QQ9 A;  1QO0 D;  1SVO A;  2AS5 F;  4A3F J;  2VBY A;  2XSJ C;  2ZXJ A;  2P5V A;  2VUM J;  3CD6 I;  2ISZ A;  1JGG A;  5J3L A;  2GWR A;  2KDO A;  2M0M A;  3EYY A;  4I7H A;  4XLC A;  4BXU A;  3W3C A;  4D5F A;  4E7L A;  2ZME B;  2WB1 A;  2ADU A;  2CS3 A;  3ABM H;  3ZQQ A;  2YR2 A;  1O57 A;  2HI3 A;  3ZMU A;  3HRU A;  2JUC A;  3BC8 A;  1KZH A;  2LG4 A;  1RC9 A;  5HDK A;  3NQO A;  3JRD A;  2HVR A;  1E2X A;  1SVL A;  2ICW G;  1DQU A;  2M34 A;  1GXP A;  1MW7 A;  5F0H A;  2CMP A;  4XNF A;  3WTW C;  3PUB A;  2IS4 A;  2KJB A;  1D0Z A;  2X1E A;  1OCT C;  4HOB A;  2EV6 A;  4J00 A;  3A03 A;  5F1R A;  2PMZ A;  2M87 A;  3OYD A;  1R00 A;  4NB5 A;  1X4P A;  5LGU A;  3M3Y J;  4XKC A;  5J1Y A;  1ZN2 A;  3EDP A;  1D3Y A;  3FXM A;  9ANT A;  2GIV A;  4U88 A;  3O6B B;  5B1B H;  5M3M J;  3VYT B;  3T8T A;  3Q5F A;  2EQR A;  2G7H A;  3AFH A;  1ZTR A;  4PGG A;  2QLZ A;  3ZMT A;  2E36 A;  4ZYA A;  2E35 A;  3WTY C;  2GBY A;  1X2N A;  2LTP A;  1PP7 U;  3G73 A;  2DFE A;  2JVG A;  1KA8 A;  5LGT A;  3D1N I;  4H4K C;  5F0F A;  4HF2 A;  3CJN A;  1JJ8 C;  1X1P A;  2LY1 A;  4EM2 A;  3OR2 C;  1F5T A;  1W0U A;  3DLA A;  2FBK A;  2OCE A;  3SQN A;  1VQN I;  1KQ9 A;  1I1G A;  3CES A;  2D1H A;  3OSF A;  4IQ4 A;  3A0B C;  2TRT A;  2PMH A;  2XRN A;  5FB2 A;  3W2W A;  3DU5 A;  5F08 A;  3ASN H;  3A01 B;  3SFI A;  3V8K A;  3I5U A;  2DMP A;  2QGU A;  1ZG3 A;  4ASN A;  1IDZ A;  2DJI A;  4A0Y A;  2GA1 A;  4AVZ A;  2FU4 A;  1LNW A;  5LEK A;  3K70 C;  3DKX A;  3KP7 A;  2Z2S B;  1YIO A;  3OYE A;  3LFU A;  1UMQ A;  2ID3 A;  3A01 A;  2PJR B;  5EGO B;  1LFP A;  1ZKG A;  3GTO J;  2F5D A;  5KHD A;  2K3P A;  5L3D A;  3OL4 A;  4GYI A;  1JKO C;  2A07 F;  1MSF C;  3KEQ A;  2O7O A;  3WG9 A;  1W0T A;  2NXN B;  1TNT A;  5D5W B;  1B72 B;  3H36 A;  1Y0U A;  2ID6 A;  3T8R A;  2R7S A;  5HLG A;  1ETV A;  2FML A;  3BG9 A;  2PJR A;  2FRH A;  3W6V A;  2VC0 A;  4E7I A;  2CFO A;  2ECC A;  1IAW A;  1LDK B;  3BPX A;  4A3K J;  4HBL A;  3ZMV A;  1MSE C;  1TNS A;  3PQJ A;  4D9J A;  3LNQ A;  5CVR A;  3DPU A;  2DFH A;  1YFH A;  2KIM A;  2XAQ A;  2ZSH B;  2K5C A;  2KQR A;  4GO1 A;  4F93 B;  1XSD A;  2L3D A;  5LHG A;  5IP9 J;  1MDM B;  1K78 A;  3ZQL A;  3W2A A;  4F7Z A;  1WRJ A;  5FFZ A;  1WHU A;  4ZZL A;  3MZH A;  1R4M B;  4Y7N J;  1JKQ C;  4GCV A;  2KP6 A;  1AU7 A;  3S1Q J;  2DK5 A;  2I5U A;  2A68 F;  2O0Y A;  3L7W A;  1BIB A;  4PDK A;  1T0F C;  2WV0 A;  4HYE A;  1XPX A;  2A6H F;  1R58 A;  2IBD A;  3F72 A;  1TBX A;  2OQG A;  5JLX A;  4UB8 C;  1A6Q A;  2F48 A;  2Y0M A;  4XKV A;  3HJE A;  4CCK A;  1MDM A;  1S29 A;  1Z9C A;  1CF7 A;  5FLX K;  3QWL A;  1HBX G;  2MW8 A;  2VJ5 A;  1X58 A;  2DQR A;  3KYC B;  3S93 A;  1VND A;  1IUY A;  1GV2 A;  4A3D J;  1GXQ A;  3CCR I;  1R6R A;  2E1C A;  3DPL C;  3OY9 A;  1MBG A;  1F43 A;  4AVP A;  4A5N A;  3MCZ A;  5E3O A;  3HC7 A;  1MNE A;  2FA5 A;  2L2O A;  3Q9V A;  2P81 A;  2VKH A;  3PFI A;  3C2B A;  2HXO A;  2IXS A;  1H9G A;  3H0G J;  1K79 A;  2D1V A;  3IAM 2;  2KZG A;  3S1M J;  1UG0 A;  3TOB A;  5KAF C;  4PGH A;  4FIS A;  4D5C A;  2V1D A;  2VOP A;  2NOG A;  3PO2 J;  2JRT A;  3D0S A;  2P6S A;  1W5S A;  4XSZ F;  1FSH A;  1J5Y A;  2ME0 A;  2VJ4 A;  3FIW A;  1IF1 A;  3IHU A;  4R79 A;  3ZCO A;  3K2A A;  2MBF A;  1UZC A;  3JRB A;  3BG7 A;  1R5G A;  5FFX A;  5L3B A;  5BPI A;  4M72 A;  3V42 A;  3FXO A;  1BJA A;  1MJA A;  4PJN A;  4UUS B;  4Q4Z F;  2D5V A;  1V4R A;  2RNG A;  1V5F A;  2DMU A;  2EFO A;  3LSJ A;  2AXT C;  5K7Z A;  3CMY A;  1P4A A;  5EZH A;  4E7S A;  2W57 A;  5B66 C;  2HTS A;  4OAY A;  4DBQ A;  1Z67 A;  2CJJ A;  2K9M A;  3OSG A;  4IVN A;  1QVU A;  1J2X A;  1HLV A;  4S0H B;  1TWF J;  2XUB A;  2WBM A;  2XVC A;  4Y15 A;  3ABL H;  3CCJ I;  1G3T A;  2XC7 A;  1FOY A;  5D8L B;  4AM3 A;  4I99 C;  4S04 A;  3VYS B;  5GAG J;  2E7X A;  1I5Z A;  2VT3 A;  1XMA A;  4P9U A;  4A69 C;  4CCL A;  2E60 A;  2NAZ A;  1GUU A;  3MAJ A;  1LDJ A;  1MD0 A;  1WWX A;  2BY0 A;  1JGS A;  1WCM J;  1MMD A;  4ZH4 F;  2V1U A;  4FE4 A;  3HSR A;  4J01 A;  1RNL A;  1W7P B;  4IPA A;  4M3G A;  3SYT A;  3K70 D;  1IRZ A;  3ZQI A;  2AQE A;  4G7O F;  2WB1 N;  4BDZ A;  4A0X A;  4YEJ A;  3L00 A;  2L01 A;  5D6E A;  2R3S A;  1ENH A;  1OCC H;  2BBY A;  4KIG A;  3J7Z I;  4G7Z F;  1U2W A;  2NNY A;  1HW5 A;  1OFC X;  3FX3 A;  4BUP A;  3HPH A;  4UUV A;  2M45 A;  3ESW B;  5ICF A;  1QQI A;  2O8K A;  3O3K A;  2DMN A;  4S05 A;  1UFM A;  1IV6 A;  5FRM A;  1LUJ B;  4Y52 J;  5DCM B;  3H1C A;  2PMZ N;  1OIS A;  2HU9 A;  2VOD A;  2DFF A;  5BMZ A;  5IOY A;  1BC7 C;  1LFB A;  2R7T A;  1T38 A;  2LH9 A;  3TL4 X;  3L2C A;  4HX8 A;  2DDB A;  1RES A;  1L0O C;  4GRI A;  2BZT A;  1P7J A;  2AHQ A;  2OF7 A;  3AG4 H;  1VF9 A;  3PL8 A;  3WU1 B;  2RVC A;  4J19 A;  4AUX A;  1HKT A;  2F5C A;  3MZ8 A;  4ZDP A;  3OYN A;  2IAI A;  3M07 A;  2R5Z B;  1T39 A;  4B1R A;  3L2W A;  3CCQ I;  5DCM A;  1D5V A;  3LSM A;  1YTY A;  4NNJ A;  4KIC A;  2YSR A;  2M9H A;  4C9Y A;  3OV8 A;  1NG7 A;  2OTL I;  1VQK I;  2MD5 A;  3F8C A;  4V2G A;  2JA7 J;  3KFW X;  4OMZ A;  4RDU A;  2XGX A;  2E1O A;  3M1E A;  4L5J A;  5M3F J;  1M1E B;  1LQ1 A;  2XGE A;  1IV8 A;  4LIU A;  2GOX B;  1R5H A;  1YE9 A;  2R5Z A;  5CVJ A;  1VQP I;  3GFM A;  2XAS A;  1X1A A;  4YFX F;  3T1B A;  4IQJ A;  2K4J A;  2Q1Z B;  3H5R A;  2IGO A;  3QQA A;  3QYF A;  4N0B A;  4LK0 F;  1FP2 A;  4KN7 X;  2RAE A;  3RKX A;  1ETY A;  2OZU A;  3O8H A;  1UB9 A;  2M2E A;  2FNP A;  2QUF A;  3WHC A;  3GW2 A;  1YYV A;  1ON1 A;  3KLO A;  4C2T A;  3IH2 A;  4ENK A;  3G1L A;  1IXS B;  3DBH B;  4RAZ A;  3WGG A;  3QPS A;  2E1M C;  4ON0 A;  3RJP A;  4QPQ A;  3RYR A;  1NK3 P;  1VQ9 I;  4M6V A;  2DCE A;  4WXC A;  4P55 A;  2F4O B;  2V79 A;  4BGD A;  1TTY A;  5J8C A;  2G0E A;  3TOA A;  3MVP A;  1S72 I;  2LY9 A;  2JK3 A;  1LVK A;  1TWA J;  3BTC A;  1HXD A;  1QZZ A;  3ZXS A;  4JYK A;  5LGN A;  2B9S A;  3KIO A;  1T98 A;  2DA7 A;  4F91 B;  4Q5S F;  4MIM A;  4YFN F;  2L7K A;  4MTD A;  5KNL A;  2FNA A;  4OMY A;  3JTH A;  3SDB A;  3ERM A;  5JHU A;  3M9A A;  3P9I A;  4EQQ A;  3GVA A;  1ZG5 A;  2WA0 A;  3JRG A;  5DM7 F;  2YU3 A;  3D5L A;  2Y30 A;  3ZN1 A;  2CQX A;  3S17 J;  2O03 A;  4M3E A;  3DPT A;  3U2R A;  4LIV A;  2BVM A;  3H9G A;  1E17 A;  5EZG A;  2GIZ A;  3I59 B;  4AYB A;  1UST A;  3L2U A;  2V1N A;  3ONQ A;  5HS7 A;  1Z6T A;  2ZXW H;  2ME6 A;  3Q9S A;  3K1M A;  1ZRF A;  3N97 A;  3ABU A;  2OZ6 A;  1SAN A;  1O4X A;  2Y69 H;  4XRM A;  1Z77 A;  1R23 A;  5AIP A;  2OC6 A;  2QKL B;  2IGN A;  3K6G A;  2DJN A;  4JBA A;  2LC2 A;  2VQH A;  4U0V A;  1MIJ A;  2RC4 A;  4HNU A;  3I59 A;  3E6M A;  2COM A;  4HAM A;  4O3M A;  1BI1 A;  3QOE A;  3K9T A;  2MD0 A;  3DV8 A;  1GV5 A;  2XHK A;  4CHU A;  2RGV A;  4KIF A;  5J8F A;  2V9P A;  4XRS G;  3VDX A;  4EJO A;  3TMO A;  3NWS A;  3BTJ A;  2QM3 A;  4WX9 A;  1WJC A;  4GFB A;  2NVT J;  3I4N J;  1JHF A;  2D2W A;  4LLL A;  5FRO A;  3L09 A;  3J7Y J;  2CV0 A;  1X3Z B;  3QU3 A;  4EM1 A;  1I6H J;  2IS1 A;  2E7W A;  3LAJ A;  2XGD A;  2ZME C;  4BE2 A;  1G2H A;  2DW4 A;  3ZQG A;  1WJB A;  4IZZ A;  2E2J J;  2BEO A;  2IGM A;  2KJC A;  2L4M A;  4RB2 C;  3ZRG A;  3F6O A;  4G7H F;  2E5N A;  3IH3 A;  5DUI A;  1PUF B;  1HA8 A;  2ZFU A;  2DA4 A;  2W00 A;  1B9N A;  1O3Q A;  5DYM A;  4BBR J;  1CGP A;  1YLF A;  3E6B A;  4BQO A;  3SZG A;  1J59 A;  2MH9 A;  2CUJ A;  2DBB A;  2QF7 A;  1OPC A;  5CQE A;  4N4N B;  1FPQ A;  4Y33 A;  1OLT A;  3F21 A;  1I39 A;  4Q48 A;  4M9S A;  4QWQ A;  3K2Z A;  3CP2 A;  1BC8 C;  1UAA A;  1PUF A;  1MH3 A;  1SD6 A;  2VBZ A;  3HEF A;  4MHG A;  2E2I J;  5J4V A;  2OU2 A;  2L7F P;  2XF5 A;  3W6K B;  1HF0 A;  2X9D A;  4IHV A;  4GGG A;  4R1H A;  4E7H A;  5H6Q A;  3R0A A;  2L54 A;  1WH7 A;  3WTZ A;  3P9C A;  3G2B A;  1LE8 B;  2Y9Y A;  4IL6 C;  2EIL H;  5JI6 A;  3GYH X;  2M1B A;  1JXS A;  2JMW A;  5FLM J;  2R7W A;  2CSO A;  2IP2 A;  2B0L A;  4XRS A;  1VQ7 I;  3BT9 A;  2PN6 A;  2L9V A;  3WTS C;  3DFG A;  1NTC A;  2XAH A;  3LFK A;  2IEK A;  2DO7 A;  4QIW N;  3S3O A;  2XAJ A;  2XAG A;  3RCO A;  1TQP A;  3VPR A;  4A2U A;  1X4O A;  4I2O A;  1UEL B;  3DWL E;  1F36 A;  5E79 C;  2LK2 A;  5EJC A;  1LE8 A;  3NAR A;  3FHN A;  4XOP A;  3U1K A;  4BDY A;  4F92 B;  5K5O A;  1V5G A;  3KEY A;  1AA7 A;  4G8X A;  4ESB A;  2VKV A;  3LSH A;  2HVS A;  1DGW Y;  4XK4 A;  4Z6Y A;  1P4X A;  1WSU A;  1OCZ H;  4BAY A;  1GDT A;  1CQT A;  3DLL F;  3E5Q A;  5HDN A;  2EV5 A;  2XKO A;  4R8H A;  1MBF A;  2JSC A;  3AG3 H;  5DD8 A;  4HA8 A;  4Y13 A;  3A1Y A;  4PSX A;  4IRI A;  1D1C A;  1EV7 A;  3Q0U A;  4OIN F;  2FF4 A;  1R4N B;  1G59 A;  4RMN A;  2HXI A;  5IT9 K;  1I3A A;  2J5P A;  3ML6 A;  3OS2 A;  4NUB A;  1FEX A;  1WGX A;  3WOD F;  1KU7 A;  3CLQ A;  4G6D A;  4G6T B;  4BHC A;  2GXA A;  3U21 A;  4BAC A;  1XGM A;  1EKE A;  3K7A J;  3FIS A;  3GTJ J;  2DTR A;  5FD6 A;  2OV7 A;  1OCP A;  3BG3 A;  3ZQH A;  2KMU A;  2F6C A;  4FX0 A;  3DTE A;  2ZJR F;  4NQW B;  1K83 J;  3ZOB A;  2M7A A;  4RGR A;  3JR9 A;  1KU2 A;  1T6S A;  4LB6 B;  3HUG A;  3HL2 A;  3WTV C;  5FKO A;  4PJM A;  5EYR A;  5D5U B;  2EFQ A;  4M6Y A;  3SJM A;  1ETQ A;  2BY2 A;  2JUG A;  2HYG D;  1W4M A;  1TP4 A;  3R61 A;  4L0Y B;  5IP7 J;  2LKS A;  5CVI A;  2W24 A;  1JI8 A;  5TIS C;  2HKX A;  4NQW A;  3S8P A;  3H9J A;  4HRI A;  5JR3 A;  4B47 A;  3I56 I;  4GYG A;  3BR0 A;  2VXD A;  3LSP A;  4FX4 A;  1BOA A;  5GPA A;  1HST A;  1I27 A;  2ELK A;  3LQQ A;  4L9J A;  2PLY A;  1JKP C;  1N77 A;  2DT5 A;  2YX7 A;  2JSP A;  4MQV A;  2OD5 A;  2H1L A;  5C4X J;  2VQL A;  2MC4 A;  2LF7 A;  1BR4 A;  3CO6 C;  1HCR A;  2DA5 A;  1P6R A;  3HRT A;  3CMM A;  3FZV A;  4NC8 A;  2EZH A;  3GZN B;  4DYC A;  4DYQ A;  1BR1 A;  2V7F A;  1R71 A;  3OYA A;  4BY1 J;  2JPB A;  4ZC3 A;  1MJB A;  2BE5 F;  3WE3 A;  2HEO A;  4A3J J;  3RQ4 A;  3LQR A;  3G1M A;  2VJJ A;  3KPH A;  5L3G A;  2R7Z J;  2EZI A;  3I71 A;  2ZB9 A;  3CUQ B;  1ORK A;  1JUM A;  3OYM A;  1J09 A;  3WTX C;  4IXA A;  3TO9 A;  2BGC A;  4N4O B;  2PQ8 A;  3DKY A;  4DW6 A;  3LSR A;  4OIO F;  4X6A J;  4HF0 A;  4M6X A;  2E34 A;  2HFH A;  1K7A A;  1U5T C;  1YHQ I;  2QVO A;  2NS7 A;  2IPQ X;  3FF5 A;  4AIJ A;  5HNH A;  1UCR A;  4XOT A;  4D0P A;  4B44 A;  3KZZ A;  3CUQ A;  1W36 D;  2X1C A;  3KX2 A;  5E1W A;  3Q3S A;  4XON A;  3KZI C;  2RNJ A;  2JWT A;  1FYK A;  4D7N A;  4E7J A;  3HOZ J;  1S3J A;  1SAU A;  2HDW A;  2UUZ A;  1RET A;  3M1C A;  4CSW A;  2KHM A;  3FWE A;  2D45 A;  3W2V A;  3ZQF A;  3BPV A;  4B43 A;  3CDL A;  3CJT B;  4PZJ A;  2LF8 A;  3CQZ J;  3IP4 B;  1FBQ A;  3DQV C;  4XR6 A;  1FIA A;  3DBR B;  5E8I A;  1WFX A;  5FKM A;  3IRQ A;  3C2H A;  3HB9 A;  4HZF A;  4U7D A;  5ED4 A;  3GFI A;  2FOK A;  1YW8 A;  2GZW A;  3EUK L;  5HLH A;  1K61 A;  2R7X A;  1J7K A;  1R9T J;  2W1O A;  5A2Q K;  1XD7 A;  4M74 A;  3MZY A;  2YPR A;  4M9X A;  3IRR A;  2EV0 A;  3HOS A;  3BQZ A;  3H0D A;  3OIQ A;  2HWV A;  2WAQ A;  1P4W A;  1V5E A;  4CYC B;  3JRA A;  2HOE A;  2M8G X;  4XQF A;  3VYU B;  4H0E A;  4B8X A;  4RAF A;  3EUH C;  1LPQ A;  1Q1V A;  1HQC A;  2FEZ A;  3S32 A;  4NHJ A;  4XMY A;  1IG7 A;  4EGZ A;  4KNY A;  4BJ5 C;  4D1Q A;  5IYB J;  2WY7 Q;  2WWY A;  4L9N A;  1FOK A;  2DMQ A;  4EEF G;  1ZH5 A;  3J7A O;  3A0H C;  1IDY A;  1PDN C;  3HTS B;  3EET A;  2FQ3 A;  4HPQ A;  2H94 A;  3AG1 H;  1XX5 A;  3TP3 A;  4CYC A;  3UNG C;  3J81 Z;  4XBF A;  1Y56 A;  3HIF A;  2ZCW A;  1Z7L A;  3X2Q H;  4CUG A;  3VOE A;  2EWN A;  3N05 A;  1WJF A;  1K78 B;  5D4S A;  4HQM A;  4KFC A;  4ZTF A;  2DPU A;  1KU3 A;  4L5I A;  2FOW A;  2HKO A;  3K69 A;  2EA4 A;  1IW7 F;  4UVA A;  2RKH A;  1TQI A;  4AIH A;  2JA6 J;  2VIX A;  1OMI A;  3FK6 A;  2HQ5 A;  1Y39 A;  1ZAR A;  4CH7 A;  2HYF A;  2XSD C;  5CQG A;  3H5N A;  3VSK A;  5ILS A;  3KP2 A;  2DK8 A;  3BY6 A;  1ETW A;  1S7A A;  3HZJ A;  3S3N A;  1CF7 B;  3WU0 A;  4XLA A;  1WJ5 A;  1BW6 A;  1ZK8 A;  2JZY A;  3IKT A;  3WTT C;  1ITY A;  2EZK A;  2ETH A;  3HOW J;  1ZAO A;  2DYR H;  3IWF A;  3HYI A;  1WQ2 A;  4KUM A;  3C2G A;  2KKO A;  4BXF A;  2CYY A;  3D5R C;  3MKY B;  1JKR C;  2MFZ A;  2KRC A;  3KYL A;  5HNF A;  1IRX A;  1G3W A;  1MBH A;  3GZ5 A;  1XSV A;  3MD2 A;  4EM0 B;  1O3R A;  1B8I B;  2A69 F;  4RB0 A;  1DPU A;  4C30 A;  3LMM A;  4CIC A;  2W7N A;  1JTX A;  3S2W A;  2HOT A;  5EEH A;  1QA6 A;  3S1R J;  2H1K A;  3HBL A;  3FKJ A;  3CME I;  3G4S I;  1N75 A;  4BEH B;  4HLX A;  1ULY A;  1IRG A;  1AHD P;  1OQY A;  1ACI A;  3OIP A;  5TJJ A;  5EEG A;  4JX5 A;  2IS6 A;  2OAZ A;  3SEZ A;  5IY5 H;  1B8I A;  3CJQ B;  3VFZ A;  4NDL A;  2STT A;  4PFO A;  1ZHF A;  1YX5 A;  2KT0 A;  3F8M A;  3GTQ J;  4G9Y A;  4JOM A;  4KDP A;  4M3F A;  2HOA A;  3KYD B;  4BU2 A;  3MWM A;  3PSI A;  3QU6 A;  3GTL J;  3QOP A;  1QPM A;  2M0C A;  4BEH A;  2X51 A;  3IC7 A;  3C18 A;  4RM3 A;  1YG2 A;  3ECO A;  2DXI A;  2XF7 A;  1O3T A;  3G6E I;  4HX7 A;  2GQQ A;  1PJR A;  2X0L A;  3E5U A;  1JT0 A;  4II3 A;  4P5O A;  4PCQ A;  3LA3 A;  2CQQ A;  2RQP A;  4LGW A;  4FTH A;  2R92 J;  2EIJ H;  3ZMZ A;  1Z05 A;  2KLO A;  3I55 I;  1FTZ A;  3ASO H;  4A12 A;  1SFX A;  2OUM A;  2X4H A;  2V6C A;  3MMY B;  3BTI A;  4JP0 A;  2L7Z A;  1WPK A;  2K40 A;  2QYO A;  4LD5 A;  1L3L A;  2CW7 A;  2B7E A;  3RDI A;  5J47 A;  2VON A;  1XMX A;  5M5Y J;  3S16 J;  3F8F A;  2W25 A;  2GA2 A;  4II2 A;  2BOL A;  5F04 A;  5GTH C;  2LYC A;  4XL9 A;  3ELK A;  1HW1 A;  1G4D A;  1XB4 A;  3QP6 A;  4EJV A;  3S14 J;  2DA1 A;  1O3S A;  1MMG A;  4WXD A;  1OYW A; 
#chains in the Genus database with same CATH homology
 1WI9 A;  5FD5 A;  3G3Z A;  4IRH A;  4U0Y A;  5HDG A;  1W7P D;  2R7D A;  3LA7 A;  3R60 A;  5H20 A;  4B09 A;  2IRF G;  3FMS A;  5ILU A;  1I6X A;  1Z91 A;  2VOO A;  1R36 A;  1J75 A;  2UWM A;  3MQ0 A;  1TW2 A;  4LFU A;  4MNU A;  3REO A;  3KP5 A;  1D8J A;  5DEQ A;  1FBS A;  2G9W A;  4MGR A;  4HV5 A;  1RIO H;  4RB1 A;  4UVB A;  1GVJ A;  3RKW A;  1UHW A;  1AOY A;  2Q2E A;  4DQ2 A;  4YIF A;  4HDV A;  3FM3 A;  1B1B A;  4L9T A;  2HQN A;  4RS8 A;  4I0B A;  2OQR A;  5DD4 A;  1EH8 A;  2JPC A;  2O61 A;  3VEP A;  1XDU A;  1BI0 A;  1BI2 A;  2H27 A;  3SXY A;  2NYX A;  1JE8 A;  3V7R A;  1BM9 A;  2ZNY A;  1LB2 A;  5LRS A;  3SZP A;  3T5X A;  1JHH A;  5DUK A;  5TRD A;  3AAF A;  2ESH A;  3I0T A;  5JVT A;  4LJZ F;  1KYW A;  1T0F A;  4BQA A;  3KCC A;  1FT9 A;  3ZMD A;  2QEN A;  4FT8 A;  3V4G A;  1C0W A;  2P4W A;  1AWC A;  4WCG A;  1MJ9 A;  3R6S A;  2EB7 A;  1A04 A;  4G6Q A;  1BIA A;  1KU9 A;  2ZFW A;  5K5R A;  4UHT A;  1SFE A;  1VTN C;  2VBX A;  4HDU A;  3CO7 C;  5CVU A;  5LEJ A;  1I1S A;  2JTV A;  1H9T A;  3IWZ A;  1U3E M;  1YS6 A;  4BH9 A;  1XCB A;  4ZYH A;  5LHI A;  3JAM Z;  1KQ8 A;  4HF1 A;  5H6R A;  2F2E A;  2ELH A;  3ZP5 A;  4AD9 A;  1USS A;  1XGO A;  4OIR F;  3LA2 A;  1U8R A;  1ZLJ A;  3FXR A;  5HS8 A;  2VT2 A;  4BHP A;  4LG0 B;  1EH6 A;  4P9F A;  1SFU A;  3HHH A;  4YII A;  3ERE D;  2HZT A;  3E6D A;  4G94 A;  2K4B A;  1S8N A;  5FO5 A;  3QRF F;  2VXZ A;  3IL2 A;  3HOT A;  2CGP A;  2PEX A;  3PQK A;  1RUO A;  1Z6R A;  2K27 A;  3U9G A;  4LG0 A;  4XRF A;  2L02 A;  3CDH A;  4CZZ A;  3V8J A;  4ZYG A;  5D6F A;  3HRM A;  1XMK A;  1WKM A;  2TDX A;  1B59 A;  2DQL A;  4OOI A;  4UNO A;  1W5T A;  2LSO A;  2XRO A;  4KN4 X;  3DXJ F;  3H92 A;  3GZ6 A;  4M9Z A;  4LLN A;  3LWF A;  4N9H A;  2RDP A;  5CLS A;  3I64 A;  3KP6 A;  4ZZD A;  1KYZ A;  2HDC A;  5D5X B;  1B9M A;  3I58 A;  2V1X A;  1QNT A;  4CYD A;  4YFK F;  1R1T A;  2CG4 A;  3K1N A;  4RGU A;  5E1X A;  2IVM A;  4IF4 A;  1T2K A;  1LJ9 A;  2P5L C;  2QQA A;  2A61 A;  2ZKZ A;  3WGI A;  1R1V A;  4M71 A;  3DP7 A;  2M5W A;  2VN2 A;  1SD5 A;  3GFL A;  2EFW A;  4A6E A;  3EQL F;  4M73 A;  4RAY A;  1R1U A;  5CJ9 A;  4A6D A;  3RPU A;  3RI4 A;  1OYI A;  2Q0O A;  1LDD A;  4IRG A;  4IJA A;  4P96 A;  2V9V A;  2O8X A;  1IN5 A;  3FHZ A;  4HV6 A;  4HLY A;  5D4R A;  3TDU C;  4EVI A;  2Q8K A;  4OU0 A;  2WTE A;  3KP4 A;  1STZ A;  2IA0 A;  2IW5 A;  3F3X A;  3F22 A;  2H6B A;  3BDD A;  4WF2 A;  1PP8 F;  3ZMS A;  1FYL A;  2GXG A;  3V7S A;  2XIG A;  2DLL A;  3P9K A;  4O5V A;  2HR3 A;  3TDZ C;  2NNN A;  2E1N A;  2GAU A;  1G3S A;  3DKW A;  3M8E A;  1YW7 A;  3IKV A;  2OBP A;  5FGM A;  4CO8 A;  5A2Q Z;  1LVA A;  3VOD A;  5F6F A;  3J80 K;  1HW2 A;  2XV4 S;  4TV7 A;  4WK8 F;  4E70 A;  2IA2 A;  5ICC A;  4I98 B;  5JFR A;  1MKM A;  1SAX A;  2R7F A;  3LST A;  3U1D A;  3JSP A;  2ZO4 A;  2ZME A;  3RTR A;  3F8N A;  3F8B A;  4K2E A;  3KET A;  1KGS A;  1U6G A;  2BYV E;  3E97 A;  2CQK A;  5J6X A;  1HKQ A;  2K02 A;  3EYI A;  2W84 A;  1Q1H A;  2P7V B;  1FYM A;  2GXB A;  4BHB A;  4Z2Y A;  3CTA A;  4WWC A;  3P7N A;  4QLC U;  4FHT A;  5DDG A;  2LDU A;  3WE2 A;  2A6E F;  2CO5 A;  2Z3Y A;  3F6V A;  3SFZ A;  4LLG F;  2DFI A;  3GF2 A;  5FLX Z;  3GUD A;  4UVC A;  1IN8 A;  3E3V A;  5DV5 A;  3JW4 A;  1F4K A;  2RV8 A;  2UZK A;  4A5M A;  1TQM A;  4ENN A;  3K1P A;  2RN7 A;  4CXF A;  1ZLK A;  1QZY A;  3BJA A;  2BV6 A;  4KYW A;  1H0M A;  3ZPL A;  3C7J A;  1FC3 A;  1V3F A;  1XDS A;  4AWX B;  1IZ1 A;  2A3S A;  5K5Q A;  2P7C B;  1ZG1 A;  2W85 A;  2L4A A;  3TO7 A;  5BQT A;  1FSE A;  1TLH B;  2KRF A;  2XAF A;  3ULQ B;  4AIK A;  1IXC A;  3QPT A;  2IA1 A;  2MLK A;  4Y17 A;  4XLP F;  3HSE A;  1J9I A;  4ENJ A;  1EH7 A;  2J5O A;  2F5F A;  2P5K A;  3RPQ A;  1YS7 A;  4RB3 C;  3KP3 A;  1SD4 A;  4YG2 F;  2A5Y B;  4KMF A;  5HVQ C;  3R4K A;  4OIP F;  5ICG A;  1ZRC A;  3M8F A;  5ICE A;  3JSO A;  4EGY A;  5AON A;  2JT1 A;  3H3U A;  3BRO A;  3H3Z A;  1ON2 A;  4I02 A;  4RGX A;  2FMY A;  1O7F A;  5E8G A;  3CUO A;  5F64 A;  3J81 K;  5E1Z B;  3WGH A;  2O3F A;  2C6Y A;  4I09 A;  1DP7 P;  1U5T B;  1YQA A;  2MA3 A;  3C3W A;  1LEB A;  4MEX F;  2KIU A;  4HW0 A;  4Q47 A;  3ABT A;  3BJO A;  2LKP A;  4I01 A;  3V7C A;  4OIQ F;  2Y75 A;  3SZT A;  2KIF A;  1U5T A;  1P92 A;  4XSX F;  1F1Z A;  2VE8 A;  1RZ4 A;  3L9F A;  4WXH A;  2ZNZ A;  2EA2 A;  1FZP B;  2FSW A;  3BZ6 A;  4DNC A;  2H09 A;  3FMQ A;  3ZQ7 A;  1P2F A;  5AIQ A;  3BOQ A;  3ISP A;  1MZB A;  3V8L A;  4LMY A;  2ACJ A;  2M30 A;  2STW A;  2NS0 A;  4EJT A;  3ECH A;  3NEU A;  4EMS A;  3RIR A;  2EFP A;  4EJU A;  3T0Y A;  4ZYE A;  4EJW A;  3GEZ A;  4GXO A;  3HHG A;  1BI3 A;  1TW3 A;  1W7P A;  1IXR C;  3EUH A;  4JQF A;  3E5X A;  1Z7U A;  1FWZ A;  2QWW A;  3FM5 A;  1XCV A;  4BNC A;  2PBI A;  2IT0 A;  4RGS A;  3TQN A;  1R7J A;  2Z99 A;  5HS9 A;  1D8K A;  5LLQ A;  1FY7 A;  3MEX A;  5K1Y A;  2MLG A;  2UXX A;  3HSF A;  2YX4 A;  3KZY A;  2G7U A;  5HOO A;  5LBQ A;  4L0Z B;  5ILV A;  3VB2 A;  4XLN F;  1S6L A;  2PI0 A;  4HQE A;  3E6C C;  1ZGJ A;  1G3Y A;  1OYY A;  1GHC A;  1ODD A;  2HQR A;  4UV9 A;  3KE2 A;  2CFX A;  5CVV A;  1DPR A;  2EK5 A;  4UXN A;  1K6O A;  1IN7 A;  2MC3 A;  5BOX A;  1NHA A;  1XGN A;  3O2P E;  2FXA A;  2F5E A;  2CW0 F;  4KIB A;  3C1D A;  4MEY F;  3B73 A;  2ESN A;  1SMY F;  3OOP A;  4BYY A;  3M7G A;  3MFK A;  4ENM A;  3TGN A;  1DDN A;  5L3C A;  5BPD A;  2AXL A;  1REP C;  1OKR A;  5KK1 A;  1KQ0 A;  2P8T A;  3BJ6 A;  5DCF A;  2ISY A;  3GO5 A;  2MH2 A;  1B4A A;  2Z5U A;  2H6C A;  3BP8 A;  3QAH A;  2HGC A;  1S7O A;  3DEU A;  3BWG A;  3FMR A;  2Z9O A;  5IT3 A;  2NRA C;  3R0J A;  5LHH A;  2UXN A;  1RUN A;  2Z33 A;  1BBY A;  2DU9 A;  5LRR A;  4KA4 A;  2WC2 A;  1FLI A;  4LB5 A;  1SD7 A;  3RYP A;  1XGS A;  2O6G E;  4ZYD A;  4CGZ A;  4JK1 X;  1IN6 A;  3JTG A;  3CUQ C;  3FXQ A;  5D8K B;  2OA4 A;  3GWZ A;  3I4P A;  1G6N A;  4UV8 A;  1U78 A;  3GFJ A;  5KVR A;  5IT9 Z;  3DF8 A;  2K7L A;  2LNB A;  3WTU C;  3N4M A;  4IHT A;  1SMT A;  2EFN A;  5L3E A;  3I53 A;  1O7L A;  1ZRE A;  2DPD A;  2QBY B;  4U7B A;  4ESF A;  3GX4 X;  1ONV A;  4KMU X;  2EJR A;  1RI7 A;  5HLI A;  4EV0 A;  2FBH A;  2M8E A;  4O6J A;  3JAM K;  1HKS A;  2K86 A;  1DUX C;  1XSX A;  3NRV A;  3QPH A;  2P6T A;  2ZBK A;  3GLX A;  4A0Z A;  2VE9 A;  1QBJ A;  2QBY A;  1PUE E;  1X3U A;  2FE3 A;  6PAX A;  1XN7 A;  1ZYR F;  2HTJ A;  1MGT A;  4L18 B;  2PFB A;  1QGP A;  4KT5 C;  1ZGA A;  4IHS A;  5E18 F;  2VBW A;  2PJP A;  2DAO A;  5E20 A;  1UHM A;  2PG4 A;  3KEO A;  1YW9 A;  4L9V A;  3FXU A;  3W6J B;  3HRS A;  3QP5 A;  2VC1 A;  3RKY A;  1Z1D A;  3KLN A;  3J80 Z;  1FNN A;  2HS5 A;  3F23 A;  1ZRD A;  2PMU A;  3B02 A;  5ERI A;  2QZ8 A;  5E17 F;  4MTE A;  3CLO A;  3TO6 A;  4HX4 A;  2XKP A;  1LEA A;  3K0L A;  2ZJ2 A;  4ESJ A;  4I0A A;  2Y48 A;  3TKY A;  4MQ9 F;  5CYV A;  4U0W A;  5D5V B;  1B6A A;  5L3F A;  4LK1 F;  1FBU A;  3ROU A;  3HTU A;  1FP1 D;  2DI3 A;  5BS6 A;  3COA C;  1HSJ A;  1FX7 A;  1BN5 A;  4ETS A;  2IJL A;  1IRF A;  1YO5 C;  1R22 A;  4CDG A;  4N9I A;  3LAP A;  3SHF A;  1OR7 A;  3GXO A;  1J0R A;  3ZN0 A;  2CWE A;  3I54 A;  2QQB A;  2FBI A;  1F9N A;  1IN4 A;  2QQ9 A;  1QO0 D;  2AS5 F;  2VBY A;  2ZXJ A;  2P5V A;  2ISZ A;  2GWR A;  3EYY A;  4I7H A;  4BXU A;  2ZME B;  2ADU A;  2YR2 A;  1O57 A;  3ZMU A;  3HRU A;  5HDK A;  3NQO A;  1E2X A;  1GXP A;  3WTW C;  2KJB A;  4HOB A;  2EV6 A;  5F1R A;  2M87 A;  1R00 A;  4NB5 A;  5LGU A;  1ZN2 A;  3EDP A;  1D3Y A;  2GIV A;  4U88 A;  3O6B B;  3T8T A;  3Q5F A;  2G7H A;  3ZMT A;  4PGG A;  2QLZ A;  3WTY C;  1PP7 U;  3G73 A;  1KA8 A;  5LGT A;  4HF2 A;  3CJN A;  4EM2 A;  1F5T A;  2FBK A;  3SQN A;  1KQ9 A;  1I1G A;  2D1H A;  2PMH A;  2XRN A;  5FB2 A;  3V8K A;  3I5U A;  1ZG3 A;  4ASN A;  4A0Y A;  2GA1 A;  2FU4 A;  1LNW A;  5LEK A;  3KP7 A;  1YIO A;  2F5D A;  5L3D A;  2A07 F;  4GYI A;  3KEQ A;  3WG9 A;  1TNT A;  5D5W B;  1Y0U A;  3T8R A;  5HLG A;  2FML A;  2FRH A;  2VC0 A;  1IAW A;  1LDK B;  3BPX A;  4HBL A;  3ZMV A;  1TNS A;  3PQJ A;  5CVR A;  1YFH A;  2KIM A;  2XAQ A;  4GO1 A;  1XSD A;  2L3D A;  5LHG A;  1MDM B;  1K78 A;  4F7Z A;  1WRJ A;  5FFZ A;  4ZZL A;  3MZH A;  4GCV A;  2DK5 A;  2A68 F;  2O0Y A;  3L7W A;  1BIB A;  4PDK A;  2WV0 A;  4HYE A;  2A6H F;  1R58 A;  3F72 A;  1TBX A;  2OQG A;  2Y0M A;  1MDM A;  1S29 A;  1Z9C A;  1CF7 A;  5FLX K;  1HBX G;  2DQR A;  1IUY A;  1GXQ A;  2E1C A;  3DPL C;  4AVP A;  4A5N A;  3MCZ A;  2FA5 A;  3Q9V A;  3PFI A;  1H9G A;  1K79 A;  2D1V A;  3TOB A;  4PGH A;  2V1D A;  2VOP A;  2JRT A;  3D0S A;  2P6S A;  1W5S A;  4XSZ F;  1FSH A;  1J5Y A;  1IF1 A;  3IHU A;  4R79 A;  2MBF A;  1R5G A;  5FFX A;  5L3B A;  5BPI A;  4M72 A;  4Q4Z F;  1BJA A;  1MJA A;  1V4R A;  2EFO A;  1P4A A;  2W57 A;  2HTS A;  4IVN A;  1J2X A;  2XUB A;  2XVC A;  4Y15 A;  1G3T A;  5D8L B;  4S04 A;  2E7X A;  1I5Z A;  2VT3 A;  1XMA A;  4P9U A;  2NAZ A;  3MAJ A;  1LDJ A;  1MD0 A;  1WWX A;  1JGS A;  4ZH4 F;  2V1U A;  3HSR A;  1RNL A;  1W7P B;  4IPA A;  4G7O F;  4A0X A;  3L00 A;  2L01 A;  5D6E A;  2R3S A;  2BBY A;  4KIG A;  4G7Z F;  1U2W A;  2NNY A;  1HW5 A;  3FX3 A;  4UUV A;  2M45 A;  5ICF A;  1QQI A;  3O3K A;  4S05 A;  1UFM A;  5DCM B;  2VOD A;  5BMZ A;  1BC7 C;  1T38 A;  3L2C A;  4HX8 A;  1L0O C;  3WU1 B;  2RVC A;  1HKT A;  2F5C A;  1T39 A;  1D5V A;  5DCM A;  1YTY A;  4KIC A;  2YSR A;  3OV8 A;  2MD5 A;  3F8C A;  3KFW X;  4OMZ A;  2XGX A;  3M1E A;  4L5J A;  1LQ1 A;  1R5H A;  5CVJ A;  3GFM A;  2XAS A;  4YFX F;  3T1B A;  2K4J A;  4N0B A;  4LK0 F;  1FP2 A;  4KN7 X;  3RKX A;  2OZU A;  1UB9 A;  2FNP A;  2QUF A;  3GW2 A;  1YYV A;  1ON1 A;  3KLO A;  4ENK A;  1IXS B;  4RAZ A;  3WGG A;  4ON0 A;  3RJP A;  3RYR A;  4WXC A;  4P55 A;  2V79 A;  1TTY A;  5J8C A;  3TOA A;  1HXD A;  1QZZ A;  5LGN A;  1T98 A;  4Q5S F;  4YFN F;  4MTD A;  2FNA A;  4OMY A;  3JTH A;  5JHU A;  3M9A A;  3P9I A;  4EQQ A;  3GVA A;  1ZG5 A;  2YU3 A;  3D5L A;  3ZN1 A;  2O03 A;  3DPT A;  3U2R A;  1E17 A;  3I59 B;  1UST A;  5HS7 A;  1Z6T A;  3Q9S A;  3K1M A;  1ZRF A;  3N97 A;  3ABU A;  2OZ6 A;  1R23 A;  5AIP A;  4JBA A;  4U0V A;  2RC4 A;  3I59 A;  3E6M A;  2COM A;  4HAM A;  4O3M A;  1BI1 A;  3K9T A;  3DV8 A;  2XHK A;  4CHU A;  2RGV A;  4KIF A;  5J8F A;  4EJO A;  4WX9 A;  2QM3 A;  1JHF A;  2D2W A;  4LLL A;  3L09 A;  3QU3 A;  4EM1 A;  2E7W A;  3LAJ A;  2DW4 A;  2BEO A;  2KJC A;  2L4M A;  4RB2 C;  3F6O A;  4G7H F;  5DUI A;  1B9N A;  1O3Q A;  5DYM A;  1CGP A;  1YLF A;  3E6B A;  1J59 A;  2MH9 A;  2DBB A;  1OPC A;  1FPQ A;  3F21 A;  4Q48 A;  4M9S A;  4QWQ A;  3K2Z A;  1BC8 C;  1SD6 A;  2VBZ A;  4MHG A;  2OU2 A;  3W6K B;  4GGG A;  4R1H A;  5H6Q A;  3R0A A;  2L54 A;  3WTZ A;  3P9C A;  5JI6 A;  3GYH X;  2M1B A;  1JXS A;  2CSO A;  2IP2 A;  2B0L A;  2PN6 A;  3WTS C;  3DFG A;  2XAH A;  3LFK A;  2DO7 A;  2XAJ A;  2XAG A;  1TQP A;  4A2U A;  4I2O A;  5K5O A;  4G8X A;  4ESB A;  1P4X A;  1WSU A;  4BAY A;  3E5Q A;  5HDN A;  2EV5 A;  2XKO A;  4R8H A;  2JSC A;  5DD8 A;  4HA8 A;  4Y13 A;  4IRI A;  1EV7 A;  4OIN F;  2FF4 A;  5IT9 K;  3ML6 A;  2J5P A;  3WOD F;  1KU7 A;  4G6D A;  4BHC A;  1XGM A;  2DTR A;  5FD6 A;  4FX0 A;  4RGR A;  1KU2 A;  1T6S A;  4LB6 B;  3HUG A;  3WTV C;  5D5U B;  2EFQ A;  4M6Y A;  2HYG D;  1W4M A;  3R61 A;  4L0Y B;  5CVI A;  2W24 A;  2HKX A;  4NQW A;  5JR3 A;  4GYG A;  4FX4 A;  1BOA A;  1I27 A;  1HST A;  3LQQ A;  4L9J A;  2PLY A;  2DT5 A;  2YX7 A;  4MQV A;  2OD5 A;  2LF7 A;  3CO6 C;  1P6R A;  3HRT A;  3FZV A;  2JPB A;  1MJB A;  2BE5 F;  3WE3 A;  2HEO A;  3LQR A;  5L3G A;  3I71 A;  3CUQ B;  3WTX C;  4IXA A;  3TO9 A;  2BGC A;  2PQ8 A;  4OIO F;  4HF0 A;  4M6X A;  2HFH A;  1K7A A;  1U5T C;  2QVO A;  2IPQ X;  3FF5 A;  4AIJ A;  1UCR A;  4D0P A;  3KZZ A;  3CUQ A;  5E1W A;  2RNJ A;  1FYK A;  1S3J A;  3FWE A;  2D45 A;  3BPV A;  4PZJ A;  2LF8 A;  1FBQ A;  3DQV C;  5E8I A;  3IRQ A;  4HZF A;  4U7D A;  5ED4 A;  3GFI A;  2FOK A;  1YW8 A;  2GZW A;  5HLH A;  1J7K A;  5A2Q K;  1XD7 A;  4M74 A;  3MZY A;  2YPR A;  4M9X A;  3IRR A;  2EV0 A;  3HOS A;  2HWV A;  1P4W A;  2HOE A;  4H0E A;  4B8X A;  2FEZ A;  1HQC A;  4NHJ A;  4EGZ A;  4KNY A;  2WWY A;  4L9N A;  1FOK A;  1ZH5 A;  3J7A O;  1PDN C;  3HTS B;  3EET A;  2FQ3 A;  2H94 A;  3J81 Z;  4XBF A;  3HIF A;  2ZCW A;  3VOE A;  2EWN A;  1K78 B;  5D4S A;  4HQM A;  4KFC A;  2DPU A;  1KU3 A;  4L5I A;  2HKO A;  3K69 A;  2EA4 A;  1IW7 F;  4UVA A;  2RKH A;  1TQI A;  4AIH A;  1OMI A;  1ZAR A;  2HYF A;  5ILS A;  3KP2 A;  2DK8 A;  3BY6 A;  1S7A A;  1CF7 B;  3WU0 A;  2JZY A;  3IKT A;  3WTT C;  2ETH A;  1ZAO A;  3IWF A;  3HYI A;  1WQ2 A;  4KUM A;  2KKO A;  2CYY A;  1G3W A;  3GZ5 A;  1XSV A;  4EM0 B;  1O3R A;  2A69 F;  4RB0 A;  1DPU A;  4CIC A;  3S2W A;  5EEH A;  4HLX A;  1ULY A;  1IRG A;  5TJJ A;  5EEG A;  2OAZ A;  3VFZ A;  2STT A;  1ZHF A;  3F8M A;  4G9Y A;  4KDP A;  3MWM A;  3QU6 A;  3QOP A;  1QPM A;  3IC7 A;  3C18 A;  1YG2 A;  3ECO A;  1O3T A;  4HX7 A;  2GQQ A;  2X0L A;  3E5U A;  4P5O A;  4PCQ A;  3LA3 A;  2RQP A;  4LGW A;  3ZMZ A;  1Z05 A;  4A12 A;  1SFX A;  2X4H A;  2V6C A;  2QYO A;  4LD5 A;  1L3L A;  3RDI A;  2VON A;  3F8F A;  2W25 A;  2GA2 A;  3ELK A;  1HW1 A;  1G4D A;  1XB4 A;  3QP6 A;  4EJV A;  1O3S A;  4WXD A;  1OYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...