1MDMA

Inhibited fragment of ets-1 and paired domain of pax5 bound to dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
b'GVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAX5/ETS BINDING SITE ON THE MB-1 PROMOTER
publication title STRUCTURAL ANALYSIS OF THE AUTOINHIBITION OF ETS-1 AND ITS ROLE IN PROTEIN PARTNERSHIPS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA02
2OU2A 1K78A 1RUNA 3TDZC 4P96A 4M9ZA 3RI4A 4IRGA 1ZREA 3F3XA 2GA2A 4LLNA 4XLNF 1WI9A 4MNUA 2IW5A 4OMZA 1Z7UA 2Q2EA 1C0WA 3MAJA 3ECOA 1P6RA 4L9VA 3TKYA 4Q47A 3CTAA 2RQPA 3TOBA 1IN7A 4S04A 3KEQA 3M8EA 3TGNA 5E1ZB 3FF5A 3MWMA 1R5GA 1OYWA 2OA4A 2H27A 1J2XA 1TNSA 1GXPA 2NS0A 3KFWX 2LF8A 4CDGA 1XGOA 1HSTA 2F5DA 3LA3A 3GFLA 1W7PD 4BH9A 3G73A 4OIRF 4EMSA 5D8KB 1XSXA 1TNTA 4AD9A 3Q5FA 1FPQA 1R23A 4KNYA 2A68F 3MQ0A 3FMQA 4CZZA 3S2WA 4Q48A 5E20A 3SXYA 3D5LA 3TO7A 1G3TA 1GXQA 2J5OA 2JRTA 3GZ6A 1V4RA 2GZWA 1Z91A 3O2PE 3LAJA 2RGVA 4ESFA 2CGPA 2M87A 4UUVA 3ABTA 2X4HA 2K7LA 1WKMA 3HHGA 3RYPA 1RZ4A 1TW3A 1W7PA 3FHZA 2QUFA 4LGWA 5D6EA 2GAUA 6PAXA 3HSRA 2K02A 2Y48A 2D1VA 3WE3A 2ESNA 4RB1A 3RDIA 1O3RA 1R00A 3ABUA 2FBHA 3I64A 3IWFA 3KP4A 4UNOA 5DCMB 1HKSA 2HTJA 4ENNA 1CF7A 2ZNZA 2PG4A 5KVRA 4Y15A 4ZZLA 2P5VA 4P55A 4FX4A 3WU0A 1HXDA 4Y17A 4O5VA 4UV9A 2ZFWA 5LLQA 4EV0A 4RGXA 1LJ9A 5FGMA 1XGMA 3GFMA 2QBYA 5K5RA 1IUYA 2VE8A 2V1XA 1ZH5A 1P4WA 4ASNA 2UWMA 1T6SA 2H94A 1IXCA 4O3MA 4L5IA 1EH6A 4MTEA 4LK1F 3F8CA 1GVJA 2CW0F 1A04A 1ON1A 3WGGA 3F72A 3GF2A 1FYMA 2EA2A 1QGPA 4GCVA 1CGPA 1XGSA 3DPLC 4MQVA 1XCVA 4ZYEA 2XAJA 4O6JA 3K1MA 4L5JA 4GYIA 3I54A 1H0MA 1D8KA 2WTEA 2DQRA 1HKTA 3F22A 1WWXA 2VOOA 4HF2A 1U6GA 4BNCA 3GUDA 4KMUX 2FA5A 2P5LC 1SFUA 2FQ3A 5HS9A 4P5OA 4UV8A 4HF0A 3QU6A 3ML6A 1IXRC 5H20A 1SAXA 2GA1A 3K1NA 2FBIA 4KT5C 5FO5A 2VONA 2KRFA 3SZTA 4HLXA 3F6VA 2GWRA 3WTXC 2PFBA 2XRNA 4HW0A 1YTYA 3JSPA 2UXXA 2EB7A 3ISPA 4WXHA 5FFZA 3MFKA 2UZKA 2ACJA 1MD0A 2Y0MA 1G3SA 2O0YA 1LDDA 1ODDA 1JHFA 5CYVA 3WTSC 1U78A 2DAOA 1TQIA 2O3FA 1LVAA 5LBQA 3GXOA 2QVOA 3E5QA 4YIFA 3NRVA 1PDNC 1O3TA 2M1BA 2BBYA 5HS7A 3QP6A 3BPVA 2A6HF 3CO7C 1J0RA 1ULYA 3GZ5A 2K4JA 5LEKA 3LWFA 4G94A 1YW7A 3FM5A 3I58A 1SMTA 3M1EA 4R1HA 2ZNYA 1IW7F 2D1HA 1W5SA 2RNJA 1JHHA 2VBYA 3ZMSA 3WTZA 2V1DA 1TLHB 4CYDA 3R60A 4LMYA 3TO6A 1IN8A 1P4XA 2MC3A 1DPUA 3OV8A 3FZVA 2UXNA 3REOA 5L3BA 5EEHA 1TQPA 3E6MA 3P7NA 1J5YA 1KGSA 3BZ6A 1USTA 5E1XA 2EFQA 2OZ6A 1BI3A 1REPC 2E7WA 2EV0A 4AIHA 4A5MA 1ZRFA 1SMYF 3ERED 3GX4X 3F8MA 2IA2A 3H92A 2J5PA 1HW5A 3COAC 2CWEA 5LGUA 4ENMA 3QU3A 5HVQC 3WTUC 4PGGA 3SFZA 3HYIA 3RKXA 4BHCA 1TW2A 3GFJA 4BHPA 1JE8A 2HGCA 4EJTA 2QWWA 2JPCA 5D5XB 3GWZA 1EV7A 3O6BB 3KLNA 1KQ0A 2C6YA 1ZLKA 3HTUA 4A0XA 1R1VA 3E3VA 3PFIA 2WV0A 1Q1HA 1IAWA 3ZN0A 3F6OA 2Z5UA 1YW9A 3RKYA 2FNAA 1U5TB 3IRQA 2JT1A 1F1ZA 1FZPB 1HBXG 4GO1A 2KJBA 2VT2A 3SQNA 4OINF 1K7AA 3N97A 2A07F 5IT9Z 1F5TA 4UVCA 4NQWA 5CVVA 1RIOH 4G7HF 3CUQC 1FBUA 1SD7A 5A2QZ 4TV7A 2HFHA 3FXUA 4ENKA 2PMUA 4IVNA 4GXOA 1LEAA 3M8FA 4M9SA 2EK5A 4IF4A 2DQLA 2P6SA 1U2WA 3K1PA 4XBFA 3V7RA 1XDSA 1I6XA 4L9TA 1G3WA 1KU7A 4M71A 4ENJA 5HOOA 1J9IA 2CG4A 4OIOF 3CUQB 4KDPA 1GHCA 1XDUA 1XCBA 3JAMZ 1XMKA 4RGUA 2GQQA 3KE2A 2NYXA 3TOAA 3T8RA 1STZA 1QBJA 2L54A 4ESJA 3DFGA 4PDKA 5JI6A 3GEZA 2HR3A 1G6NA 2VC0A 1DP7P 3NEUA 5DDGA 5D4RA 3RPQA 1MDMA 2LF7A 3V8LA 3ZP5A 2ADUA 1Z1DA 2IPQX 2DK5A 3RJPA 1ZARA 4RAYA 3GO5A 5BS6A 3RPUA 4U7DA 1IF1A 1G4DA 2DPUA 4RB2C 2L4AA 3HTSB 4EGZA 2P5KA 1BBYA 1UHWA 2WWYA 1UFMA 2VBXA 4R79A 2Z3YA 2PMHA 2XAFA 3FM3A 4PCQA 5JVTA 5ICEA 3KZYA 5ERIA 2P7VB 4ZZDA 3MZHA 3RIRA 1T2KA 3EETA 2HQNA 4JK1X 2B0LA 2FMYA 3K9TA 1MJBA 3I59A 2LKPA 3E6DA 3ZQ7A 1ZYRF 4OIQF 4MQ9F 3EUHA 4WCGA 3BP8A 2E7XA 3QP5A 4KMFA 2ZMEB 2QZ8A 2L3DA 3IWZA 2MLKA 2NRAC 1OMIA 3DF8A 4D0PA 4LB5A 5LHIA 5AIPA 2V9VA 4EJVA 2EFOA 1RI7A 3ZMTA 1ONVA 5BPDA 3CDHA 3I0TA 1ZN2A 3LQQA 2W85A 1ZGAA 5J8FA 4HOBA 2FOKA 2G7HA 4M6XA 2VC1A 2OD5A 4IXAA 3P9CA 2A69F 4U0VA 3V8JA 1XSVA 3OOPA 1T0FA 2VN2A 3E97A 4L18B 1YQAA 4LLGF 5CVIA 5FD6A 4AIJA 2XAGA 4CO8A 2CQKA 3BWGA 3KP2A 2PI0A 3WU1B 4I09A 4AIKA 4HYEA 4OOIA 1K78B 2CSOA 5CVJA 1FOKA 4RB3C 4QLCU 2IT0A 3C1DA 1ZG5A 4XLPF 1FT9A 3ZMZA 2XAHA 4YFXF 5HLGA 3C18A 3U9GA 1VTNC 3C3WA 1OPCA 1ZRCA 1OKRA 2Q8KA 1IRFA 2CFXA 4HF1A 1HW1A 2P6TA 3W6JB 5E18F 3AAFA 2A5YB 2KIMA 3V7SA 1F9NA 3IKTA 3ZN1A 1O57A 3E6CC 2HZTA 2D2WA 1BIAA 1IN4A 1S7OA 3N4MA 1HSJA 1YYVA 3K2ZA 2HYFA 2FU4A 3G3ZA 5LHGA 4G8XA 3F8BA 2MH9A 1AOYA 2R7DA 4IRIA 3T1BA 5HLIA 5FLXZ 4G6DA 1S29A 1QO0D 1LQ1A 4PGHA 5EEGA 2DU9A 3L00A 1MJ9A 3HOSA 1QNTA 2EFWA 2DI3A 4I0BA 2R3SA 1MZBA 2YU3A 1YLFA 5HDKA 5ILUA 2IRFG 2XVCA 4M6YA 3R0AA 1FP1D 2ZO4A 2D45A 2MA3A 1D3YA 4OMYA 1MJAA 1T38A 2BE5F 3EDPA 1BIBA 4IHSA 4L0YB 3I4PA 4IJAA 3FWEA 5ICGA 3JW4A 4GGGA 3Q9VA 5H6RA 4FX0A 2NNNA 5D5WB 4I98B 5E8GA 3IRRA 4EJOA 2Q0OA 2QYOA 1R36A 1XD7A 2MD5A 2HOEA 3LA2A 1W7PB 1BJAA 3J80Z 4M73A 2MH2A 2XHKA 1WQ2A 2OQRA 4KIBA 4QWQA 2E1CA 4AWXB 2DLLA 5E8IA 2CYYA 1FSEA 5J8CA 1YS7A 1UB9A 5L3FA 1NHAA 1FBSA 5E1WA 2QLZA 4EVIA 4S05A 4YFNF 5IT9K 2QQBA 3CO6C 4ETSA 2KJCA 4EM2A 1CF7B 2VT3A 1AWCA 1T39A 3MCZA 2XASA 4Q5SF 4UHTA 3MZYA 5A2QK 1TQMA 5DV5A 4KFCA 2PN6A 4LG0A 3P9KA 1W5TA 3HUGA 2K27A 2MBFA 4MTDA 4EJWA 1QZZA 2MLGA 4U0YA 3MEXA 1TTYA 2ISZA 3KLOA 2Z9OA 2QBYB 1Z05A 5CLSA 2VODA 5BOXA 3KP6A 1S6LA 5D5UB 2K4BA 4BXUA 4I2OA 4LLLA 3FXQA 4AVPA 4HLYA 3WODF 4NHJA 1YO5C 3TO9A 2L01A 5L3CA 3JAMK 4N9HA 1B6AA 2RN7A 3E6BA 5DYMA 1D8JA 3I5UA 1J7KA 5F64A 2WC2A 4OIPF 2P8TA 1O3SA 3QAHA 4KUMA 5K5QA 3C7JA 3R61A 1IN6A 3ECHA 1FLIA 5LHHA 3BOQA 4I01A 4HQMA 3EYYA 3DPTA 1ZG3A 4EQQA 2L4MA 4G9YA 1WSUA 4E70A 2RDPA 1QZYA 1BC8C 4G7OF 4Z2YA 2HS5A 2K86A 2Z99A 1EH8A 1SD6A 5D6FA 1U5TC 5JR3A 2Z33A 4U0WA 2OZUA 1X3UA 2FEZA 4I02A 1J75A 5HDGA 3B02A 2OQGA 3P9IA 1B59A 4G6QA 1SFEA 3CUOA 2H6CA 2NNYA 2CO5A 4IRHA 1KYZA 2YX4A 1QQIA 4JQFA 2YR2A 1PUEE 1LB2A 5D4SA 4A2UA 1K6OA 1FSHA 5K5OA 3Q9SA 5BQTA 3LQRA 4MEYF 4A5NA 1Z6RA 2W24A 4L9JA 2EV5A 3M7GA 2JPBA 3I71A 3PQKA 1BC7C 4K2EA 4CICA 3ROUA 1UCRA 2O03A 2F5EA 2FMLA 2XROA 4ZYDA 4UVAA 5LRRA 1USSA 2ZJ2A 2JSCA 3FXRA 2FE3A 2TDXA 1HKQA 4BYYA 4M72A 2BEOA 2O6GE 3BROA 3LA7A 3VB2A 1XMAA 4N0BA 3GVAA 2W84A 3JTGA 4WXDA 5DD4A 3TQNA 5L3DA 2HYGD 3KP7A 4LFUA 4F7ZA 2L02A 5L3GA 5HS8A 4IPAA 3ZMDA 5ILSA 3KEOA 1R5HA 3RYRA 2M5WA 5DUKA 4CXFA 3T0YA 1KQ9A 3GYHX 2IA1A 3H3ZA 2AS5F 4A6DA 2STTA 2O61A 1Z9CA 4G7ZF 3WTYC 4HZFA 3F21A 2DTRA 2F5FA 1BI2A 1F4KA 2BV6A 4WWCA 3H3UA 5BMZA 4UVBA 5DEQA 4HX4A 5DD8A 3V4GA 3GFIA 5FFXA 2V6CA 4FT8A 1BI1A 3LFKA 2AXLA 5J6XA 4HAMA 2GXGA 3IKVA 2PJPA 3RKWA 5DCMA 2OAZA 4B09A 3J81Z 3E5UA 1LNWA 5L3EA 5IT3A 2E1NA 2V1UA 1YIOA 2ELHA 3DV8A 1FBQA 3VFZA 2DFIA 3RTRA 1U8RA 2GXBA 2LDUA 3ULQB 3HOTA 2VXZA 5FLXK 1LDKB 3K69A 4MHGA 1HQCA 2RVCA 1O3QA 2JZYA 3GLXA 4U88A 3VEPA 5ICFA 2P4WA 4RS8A 2ZCWA 1ON2A 2XKPA 1IN5A 1B9NA 1KYWA 3WTTC 2GIVA 3DEUA 3R4KA 2COMA 2BGCA 4I7HA 4HX7A 3KCCA 3M9AA 4L0ZB 1XGNA 2RKHA 1Z6TA 2RV8A 1IRGA 5FD5A 2F2EA 2IJLA 2KIUA 1KU9A 4WF2A 1V3FA 2QM3A 4EGYA 3W6KB 5ILVA 2QENA 3F8NA 4BAYA 4HQEA 5HLHA 3J80K 3WTVC 2G7UA 4ESBA 5D8LB 4RAZA 5CVRA 1SFXA 1IZ1A 3KP3A 1MDMB 2M45A 2O8XA 2A6EF 3BPXA 1BM9A 3WE2A 5E17F 5TRDA 3HIFA 2EWNA 2XKOA 4IHTA 1R22A 4PZJA 2PLYA 2DBBA 4KN7X 3ELKA 3DXJF 2XUBA 4ON0A 1G3YA 5LEJA 4ZYHA 3R6SA 4N9IA 3HRMA 4LJZF 4YIIA 3V7CA 5JHUA 1P92A 1YW8A 1FP2A 1Y0UA 2HDCA 1JGSA 2QQ9A 3FMSA 5AONA 3HSEA 4KICA 4LK0F 3WTWC 1ZAOA 2EFNA 3I59B 4XRFA 2HKXA 1ZLJA 5AIQA 1J59A 1R1UA 1L0OC 2R7FA 5KK1A 2RC4A 2KKOA 4WX9A 2ISYA 1K79A 1R58A 1RNLA 3J7AO 2FF4A 2M30A 1ZGJA 2ESHA 1YG2A 4KA4A 2ZXJA 3SHFA 4DNCA 3R0JA 4HV6A 2KIFA 1JXSA 3JSOA 4Q4ZF 2ZBKA 4YG2F 3B73A 4EM1A 3U2RA 1W4MA 2DW4A 4HX8A 3KZZA 3ZMUA 4Y13A 1IXSB 2F5CA 3CJNA 1R1TA 3BJAA 3EQLF 4MEXF 1FYLA 3WG9A 2H6BA 3F23A 4HV5A 3BJOA 3HHHA 4LD5A 4KIGA 1S3JA 4ZH4F 1LEBA 4P9UA 3T5XA 1E17A 2PEXA 4EM0B 1FWZA 1KQ8A 1FC3A 2ETHA 3BJ6A 4XSXF 1R7JA 1YS6A 4R8HA 2EJRA 4BQAA 3L7WA 1B1BA 4OU0A 1KU2A 4H0EA 2FXAA 1KU3A 2YSRA 3ZMVA 2STWA 1I1GA 3L2CA 3TDUC 1RUOA 4ZYGA 1U5TA 2LSOA 3QRFF 3EYIA 1BI0A 1H9GA 1FX7A 1WRJA 2PBIA 3VODA 4HBLA 3QPTA 3IL2A 1S8NA 3HRTA 1MKMA 4I0AA 1P4AA 2YPRA 4CHUA 2IA0A 1BOAA 2EA4A 1O7FA 1O7LA 1QPMA 3KETA 1P2FA 4LB6B 5LRSA 3DKWA 1DUXC 1PP8F 2VBZA 5K1YA 1B4AA 2DT5A 3D0SA 2W25A 4L9NA 3CUQA 1PP7U 3LSTA 2IP2A 2DO7A 2YX7A 3V8KA 4KIFA 3IHUA 2EFPA 4P9FA 5FB2A 3L09A 2BYVE 4KYWA 2FRHA 1E2XA 2IVMA 3F8FA 2W57A 4DQ2A 2XAQA 3L9FA 2ZKZA 4HDVA 4A0YA 5JFRA 5LGTA 4MGRA 1EH7A 3SZPA 2XGXA 2VBWA 3VOEA 5CJ9A 4HDUA 1ZRDA 3J81K 4BHBA 5F1RA 2DK8A 3ZPLA 1SD5A 2DPDA 2HWVA 5DUIA 3HRSA 4U7BA 4CGZA 4M9XA 1DPRA 3KP5A 3GW2A 5BPIA 2A3SA 1XN7A 2A61A 5F6FA 4YFKF 5ICCA 4EJUA 2FSWA 3T8TA 2G9WA 3E5XA 3NQOA 1XB4A 2Y75A 1SD4A 3JTHA 2LNBA 5DCFA 1YFHA 1FNNA 3HSFA 2QQAA 2EV6A 2FBKA 3FMRA 4NB5A 4RGSA 4UXNA 1U3EM 2XIGA 2JTVA 2OBPA 3CLOA 5D5VB 1ZHFA 4LG0B 3DP7A 3U1DA 3IC7A 4KN4X 3K0LA 2FNPA 4GYGA 2ZMEA 4B8XA 1B9MA 5LGNA 1OYIA 2PQ8A 4JBAA 3FX3A 3I53A 3WGHA 1FYKA 1OYYA 1D5VA 1XSDA 1UHMA 2P7CB 2H09A 5TJJA 2HTSA 4RGRA 4WK8F 1ZG1A 2M8EA 4WXCA 2HQRA 3PQJA 2VOPA 4A0ZA 1I5ZA 1MGTA 1OR7A 4A12A 4FHTA 2HKOA 2X0LA 5CVUA 3DQVC 4XSZF 5H6QA 1I1SA 2XV4S 3QOPA 4RB0A 1KA8A 1TBXA 1LDJA 1H9TA 5ED4A 3BY6A 1DDNA 1FY7A 4M74A 1S7AA 2NAZA 2HEOA 3QPHA 3HRUA 3BDDA 1L3LA 4A6EA 2VE9A 5HDNA 1T98A 1BN5A 1HW2A 3O3KA 3WGIA 1I27A 2V79A 4HA8A 3LAPA
chains in the Genus database with same CATH superfamily
2OU2A 3BCBA 1K78A 5K7HA 1WJDA 1VQPI 1RUNA 3RQIA 2OTJI 2CJJA 3TDZC 2W7NA 4JX4A 3CJQB 2A05A 4BJTA 1HC8A 4P96A 4M9ZA 1DQUA 4XIDA 3RI4A 4IRGA 5EEAA 1GUUA 3QPSA 1ZREA 3F3XA 2GA2A 2DXIA 4LLNA 4XLNF 1WJFA 1WI9A 4MNUA 2IW5A 4BE1A 3A1YA 2K85A 4XONA 4C3HJ 2L7FP 4OMZA 1S7EA 4D7NA 2XF7A 3GTPJ 4ZDPA 5KAIC 3EUAA 1Z7UA 2Q2EA 1C0WA 3MAJA 3LMMA 3ECOA 1Y1WJ 4BACA 1P6RA 4L9VA 3CDLA 4XOTA 3TKYA 1IRXA 4Q47A 2KDOA 2L7ZA 3OYMA 3CTAA 4L5EA 1HDDC 2ZSHB 1P9QC 3CP8A 2R7XA 2BZTA 3OSGA 2RQPA 3TOBA 4A3JJ 2GBYA 5B1AH 1IN7A 3MKLA 2HXOA 1IG7A 4NDLA 5EG0A 4RA2A 4S04A 3KEQA 3S2DJ 3M8EA 3TGNA 5E1ZB 3IAM2 4PFPA 3FF5A 4XRMA 3MWMA 2X9DA 3S2HJ 1R5GA 2VPLA 1OYWA 2OA4A 2H27A 1J2XA 1TNSA 1LPQA 1GXPA 2NS0A 3KFWX 3QOEA 4J00A 2LF8A 3JREA 4DBRA 1Y8RB 4CDGA 2FUG2 3H0GJ 3KEYA 2OJED 1XGOA 2QCOA 3FISA 2EIKH 1HSTA 4AC0A 2F5DA 2M2EA 3LA3A 3GFLA 2XSDC 1W7PD 4BH9A 3C2BA 3G73A 4OIRF 4EMSA 5D8KB 2X1EA 1XSXA 1TNTA 4CYCB 4AD9A 1YI2I 2B9SA 4JP0A 1X2NA 3Q5FA 1ETWA 1R23A 1FPQA 3FKIJ 4ABZA 4KNYA 2CFOA 3CC2I 2A68F 2DA5A 3MQ0A 3L2WA 4E7KA 3FMQA 2EQRA 4CZZA 3S2WA 2KT0A 4V2GA 4Q48A 5E20A 3SXYA 3D5LA 3PNTA 4D5FA 2XDVA 1VQNI 3TO7A 1G3TA 1GXQA 2J5OA 2JRTA 3GZ6A 2E35A 2VKVA 3FK6A 4QIWN 1V4RA 2GZWA 1Z91A 3ESWB 3O2PE 3LAJA 2RGVA 1YJNI 4ESFA 2CGPA 4XLHA 3MD2A 3CCYA 3BG6A 2M87A 4UUVA 3ABTA 4BDZA 2X4HA 3SZGA 1O4XA 4CA0A 1LE8A 1G59A 2K7LA 1WKMA 3W2AA 3HHGA 3RYPA 1RZ4A 1TW3A 1OCOH 1W7PA 3FHZA 2QUFA 4LGWA 4XMYA 5D6EA 5DS9A 1T56A 3CCJI 1W0TA 1JJ8C 2LY2A 2GAUA 1YOVB 3ZQHA 3I4MJ 1EKEA 3ZRGA 3A01A 6PAXA 3HSRA 4NC7A 3WHCA 3HM5A 1Z0XA 2GLOA 2Y48A 2K02A 1PJRA 2AXTC 2D1VA 3WE3A 2ESNA 4RB1A 3RDIA 4EEFG 1O3RA 1R00A 2JSPA 3ABUA 4A93J 1V5FA 3VSLA 3G1LA 5EGOB 2LVSA 3EUHC 2Y0SA 2FBHA 2CV2A 3I64A 3HOWJ 1NK3P 2LRDA 3DPUA 2EIJH 3HC7A 1R49A 4C3IJ 2CW7A 3IWFA 3KP4A 5EZHA 1RR8C 4UNOA 2ICWG 2NOJB 5DCMB 1HKSA 2HTJA 4ENNA 1MBKA 5F08A 2CQNA 3JRFA 2H1KA 3CCMI 2V26A 1CF7A 3GMEA 2KQRA 2ZNZA 2M4GA 2PG4A 4E7LA 1MSFC 5KVRA 4Y15A 1FTTA 4ZZLA 2P5VA 4P55A 1WCMJ 4FX4A 3HPGA 4OAZA 4XORA 3WU0A 1HXDA 4Y17A 3H35A 4O5VA 4UV9A 1X3WB 2ZFWA 5LLQA 3S3OA 4EV0A 1IDYA 4RGXA 1LJ9A 5FGMA 1XGMA 3GFMA 2LTPA 5E3LA 3DTIA 2QBYA 2R92J 5K5RA 1IUYA 2VE8A 3K70C 2V1XA 3JRGA 2DOAA 1ZH5A 2HI3A 1JT6A 2KRCA 1P4WA 4ASNA 2UWMA 3E7LA 4E4HA 1D1CA 5GAGJ 4BE2A 1T6SA 4ANJA 2H94A 5B66C 3BT9A 4CSWA 2O8KA 1IXCA 2IEKA 2NS8A 4O3MA 1ETOA 2CUZA 3ABLH 4JX6A 2MG4A 4L5IA 1EH6A 2JQ7A 4QTRA 4MTEA 2ID6A 4LK1F 4BU2A 3F8CA 3DBRB 1GVJA 2CW0F 1A04A 1ON1A 3WGGA 3F72A 4CCMA 1JT0A 3NWTA 3GF2A 1I3QJ 1FYMA 2KL4A 2EA2A 1QGPA 4GCVA 1CGPA 4AYBN 1XGSA 2M8GX 3DPLC 5GTIC 4IKFA 5FLMJ 4MQVA 1XCVA 5F0HA 1FIAA 2QGUA 4ZYEA 2XAJA 4O6JA 4KT6A 3K1MA 2CUEA 3K4JA 4L5JA 4GYIA 3I54A 1ETVA 5CKTA 3O8HA 1H0MA 1D8KA 2WTEA 2DQRA 2WY7Q 1HKTA 3HOZJ 3F22A 1WWXA 2VOOA 4HF2A 2FQ4A 3BR0A 3VYRB 1U6GA 2BVMA 2Y69H 2DYRH 2TRTA 2L7MP 4BNCA 3GUDA 4KMUX 2FA5A 2P5LC 1SFUA 2FQ3A 5J1UA 5HS9A 1XS9A 4P5OA 4UV8A 4HF0A 3QU6A 4RBOA 5K7ZA 3ML6A 3AL0C 1A5JA 1ERDA 1E3HA 1IXRC 2LP0A 5H20A 1SAXA 3JR9A 2GA1A 2VQHA 3OYNA 1LFPA 3HKZA 2FBIA 3K1NA 3GTQJ 4KT5C 5FO5A 2VONA 3LNQA 2KRFA 3SZTA 1R5ID 4HLXA 2CQQA 4IHXA 1NTCA 1H8AC 3DTKA 3F6VA 2CMPA 1DP3A 2GWRA 3WTXC 2PFBA 3K6GA 3PO2J 2MW8A 2XRNA 4HW0A 1YTYA 1QZEA 3JSPA 2W00A 4IHWA 2UXXA 4AUXA 3SEZA 2CQ7A 5DTDA 2M0MA 2VJJA 2EB7A 2CV0A 2KZGA 3KZIC 3OOUA 3ISPA 2JVGA 4WXHA 2E71A 5FFZA 3C2GA 3MFKA 2UZKA 4XLFA 2X51A 1W1WE 2ACJA 1MD0A 4IHVA 4JX5A 2BOLA 2Y0MA 1G3SA 2O0YA 1LDDA 3AL0B 1ODDA 1JHFA 5CYVA 3WTSC 1U78A 4CH7A 2ZJPF 3OS0A 2DAOA 1TQIA 2L7KA 2O3FA 3JCUC 1LVAA 3DU6A 5LBQA 3GXOA 2QVOA 3E5QA 4YIFA 2E34A 2K5CA 3NRVA 2ECCA 1SANA 1X1PA 1PDNC 5B3SH 1O3TA 2OCCH 2HOTA 2XC7A 3OYIA 1VQKI 1D0XA 1R9TJ 2M1BA 2BBYA 4F92B 5HS7A 3QP6A 5J47A 2LYCA 3D5RC 3BPVA 3HOUJ 1X1CA 3CCRI 2A6HF 3CO7C 1J0RA 1ULYA 1XG1A 3GZ5A 3KX2A 1XMXA 5EYRA 1XX5A 2K4JA 2IS6A 5LEKA 3LWFA 4G94A 1YW7A 3FM5A 5IP6A 2JN6A 1SMTA 3I58A 4BEHB 3M1EA 4R1HA 4D1QA 2GIZA 2ZNYA 3WHBA 3S15J 1IW7F 4RLQA 5CQGA 1AKHA 2D1HA 1OCRH 1W5SA 2VB6A 4X1EA 3G6EI 2RNJA 2JA2A 1WJ5A 2GXAA 1JHHA 4D9JA 2F6CA 2VBYA 3ZMSA 2X6XA 2CRGA 3HGGA 2HQ5A 5LFAA 1A31A 1LUJB 3WTZA 3S17J 4Y7NJ 2V1DA 1TLHB 4DZJA 3X2QH 4CYDA 2M4KA 3R60A 3J7AY 4LMYA 3UKGA 3TO6A 1IN8A 1P4XA 2MC3A 1DPUA 3KYCB 3OV8A 3LSGA 3H5RA 3FZVA 2M7AA 2UXNA 1YX3A 3REOA 5L3BA 5EEHA 4E7IA 1VQOI 1TQPA 2E5ZA 3E6MA 1D0YA 3F0CA 2H1LA 3P7NA 2QQ8A 2XSJC 5GADJ 1J5YA 2ZB9A 1KGSA 2NVYJ 2OTLI 1KZHA 2Z1DA 3BZ6A 1USTA 5E1XA 3L1PA 1S72I 2LY1A 2EFQA 2OZ6A 4IOCF 3E0JB 1BI3A 1REPC 1OFCX 2E7WA 2EV0A 4AIHA 1WHUA 4A69C 4A5MA 1X2MA 1GT0C 3WU2C 5FKLA 1ZRFA 3UNGC 1SMYF 3ERED 3GX4X 1P7IA 3A03A 4IL6C 3F8MA 4PFOA 4FQGA 2IA2A 3H92A 2J5PA 1YRNA 1HW5A 3COAC 2CWEA 3IV5A 5LGUA 4ENMA 3QU3A 2FJ1A 2FOWA 5IY5H 5HVQC 3WTUC 4PGGA 3LSPA 2BY2A 2WAQA 3SFZA 3HYIA 3RKXA 3S1RJ 5GPCA 4BHCA 3CQZJ 1TW2A 3GFJA 2PX9A 4BHPA 1JE8A 2HGCA 4EJTA 2QWWA 1ZQ3P 2JPCA 2K9MA 5D5XB 2KPMA 3GWZA 2W48A 2PJRB 2M0CA 4XRSG 1EV7A 1S5LC 2KHMA 3O6BB 3M07A 2JA7J 3KLNA 1KQ0A 1W36C 2C6YA 3ZCOA 3ZXSA 1ZLKA 4LITA 3HTUA 4F91B 5B1BH 2VI6A 2NS7A 5GAHJ 4A0XA 1R1VA 3E3VA 2NXNB 3PFIA 2WV0A 1Q1HA 5M5WJ 1XPXA 1IAWA 4P1WA 3ZN0A 3F6OA 4FE7A 2Z5UA 3OYBA 3D5SC 2RREA 1YW9A 3RKYA 2FNAA 1TZLA 3PFYA 1U5TB 3FBNB 3IRQA 2JT1A 1F1ZA 1NG6A 3HEFA 3OYGA 1FZPB 1HBXG 4GO1A 2KJBA 3ZQGA 2Z2SB 2V7FA 2VT2A 3SQNA 3VPRA 4OINF 4EATA 1K7AA 3N97A 2A07F 2R7WA 1ORKA 5IT9Z 1F5TA 3PNVA 3JRBA 2DODA 4UVCA 5FJ8J 4NQWA 5CVVA 3VYUB 4ZDOA 2LMDA 3DEWA 4PJLA 1X4OA 2DA6A 1RIOH 4G7HF 3CUQC 1FBUA 1SD7A 3OR1C 5A2QZ 4TV7A 2P0WA 5FLVA 3OS2A 1YIJI 2HFHA 3FXUA 4ENKA 2JA8J 2PMUA 2VKHA 4BE0A 3HBLA 4MIMA 5FRMA 2L5QA 3BQZA 4IVNA 4GXOA 1LEAA 3M8FA 4M9SA 2EK5A 4IF4A 2DQLA 2P6SA 1I6HJ 1Y56A 2NVXJ 2ELKA 4QPOA 1U2WA 4RM3A 2DA4A 3K1PA 4XBFA 3V7RA 1XDSA 1MBJA 1I6XA 4L9TA 2XB5A 1G3WA 3OIOA 1KU7A 4M71A 1F36A 4PSWA 4ENJA 1VNDA 3BTJA 5HOOA 1J9IA 2CG4A 4OIOF 2M34A 3H0DA 2ECBA 3BR2A 2DJNA 2VXDA 3CUQB 4KDPA 1GHCA 1XDUA 1XCBA 3JAMZ 3JRAA 1XMKA 2R7ZJ 2LREA 4RGUA 2GQQA 3KE2A 3HG9A 4UUSB 2K9SA 5C3EJ 2KZVA 1SFOJ 2NYXA 3TOAA 3T8RA 1BR2A 1TWFJ 1STZA 2AO9A 4FASD 1QBJA 4GRIA 2L54A 3DFGA 5HLTA 2R0QC 4PDKA 5JI6A 4ESJA 3GEZA 2HR3A 2IS1A 1G6NA 1NG7A 2LOOA 2BXYA 2DA3A 4IHYA 2VC0A 1DP7P 1SEUA 2G0EA 3TW7A 2HYJA 3SDGA 3NEUA 1PUFB 1WJCA 4XR6A 5DDGA 2CH0A 2ZJRF 3TEDA 5D4RA 4RAGA 3RPQA 1ACIA 4DYRA 4ITVA 1Z67A 5E3NA 1MDMA 1NH3A 2LF7A 4UB6C 3V8LA 3ZP5A 3BCAA 3A4CA 2ADUA 4D5CA 4F93B 4H4KC 1Z1DA 1GV5A 2IPQX 3ZR8X 2DK5A 1EJ9A 4LIUA 3FK7A 3RJPA 1ZARA 4RAYA 3AKZA 3GO5A 2IGKA 2Q1ZB 1OCTC 4BJ5C 1SVLA 3DBHB 3OYKA 5BS6A 1UG2A 3RPUA 2IS2A 3M4OJ 2HOAA 4U7DA 1IF1A 1G4DA 1QA6A 2DPUA 1J09A 1G2HA 4RB2C 2M9HA 2L4AA 3HTSB 1DU6A 1UZCA 1MMAA 1T8IA 4EGZA 2P5KA 1BBYA 5M3MJ 3G71I 1UHWA 2WWYA 1UFMA 2JUGA 2VBXA 2DA1A 1N78A 1E3PA 4BUPA 3I3LA 3H9JA 4R79A 1IRZA 5M3FJ 5F27A 4RLFA 2CW8A 2Z3YA 5H2FC 2A6TA 2ZMEC 2PMHA 2XAFA 3CD6I 3FM3A 4PCQA 5JVTA 5ICEA 3KZYA 5ERIA 2P7VB 2W4SA 4BXFA 4ZZDA 1MBGA 3MZHA 1FOXA 2V9PA 2PMZA 3RIRA 1IV8A 1T2KA 1IUFA 1EA3A 3MN2A 3EETA 2HQNA 4II2A 4JK1X 2B0LA 2FMYA 3K9TA 4W1UA 1MJBA 1W0UA 2P81A 3HOVJ 4XNFA 3I59A 4B3AA 1EF4A 2LKPA 3CF2A 3CP2A 3E6DA 3ZQ7A 2VJ4A 5JLWA 1TT0A 1ZYRF 4OIQF 3K70D 4MQ9F 3EUHA 3DBLB 1VQLI 2K3PA 3SEQA 3ASOH 4WCGA 1FTZA 3BP8A 2E7XA 3SYTA 1OR7C 2HPIA 1B8IA 3QP5A 1JTXA 2ELJA 3Q3SA 5IP7J 2ZMEB 2QZ8A 4KMFA 2L3DA 5F04A 3IWZA 1D5YA 2MLKA 2NRAC 1OMIA 3DF8A 4PUSA 4D0PA 3GTOJ 4LG3A 4LB5A 3N05A 5LHIA 5AIPA 2V9VA 4EJVA 4II3A 2DMPA 2EFOA 2LBFA 1RI7A 3CESA 3ZMTA 1ONVA 2L2OA 4C3JJ 5BPDA 1BW6A 2RNGA 5J1RA 3CDHA 1ZELA 3IAS2 2BW3B 1QVTA 3I0TA 1ZN2A 3LQQA 2W85A 1ZGAA 5J8FA 3K4LA 1R4NB 3I55I 2AHQA 4HOBA 2FOKA 2W82A 1AU7A 1MNMC 4B44A 2G7HA 5CPRB 3PIOF 2D5VA 2K3FA 4M6XA 2VC1A 2OD5A 3BZCA 4IXAA 3P9CA 2A69F 5FKKA 4U0VA 4ZTJA 1MSEC 1Y6IA 3V8JA 2YUSA 3ZQQA 1XSVA 4UUTA 3OOPA 1T0FA 2R7UA 4BL0B 1MNDA 3PIPF 1Y1VJ 4XKCA 2VN2A 3E97A 4L18B 1K4SA 2M3AA 1YQAA 4LLGF 5CVIA 5FD6A 2HU9A 3I56I 2X48A 4AIJA 5DM7F 1LFUP 2E2IJ 2XAGA 5E3OA 1HOMA 2UUZA 3OIPA 4A3LJ 2GOXB 2A5WA 2BY1A 4CO8A 2CQKA 3BWGA 3KP2A 4YELA 2PI0A 3WU1B 2ID3A 2VPRA 1MMGA 2XB0X 3OMYA 4I09A 4AIKA 1JI8A 4HYEA 4OOIA 1K78B 3CLQA 2CSOA 5CVJA 3UR3C 1FOKA 4RB3C 4S0HB 4BS9A 3G1OA 4QLCU 2IT0A 2HOSA 3C1DA 1ZG5A 4XN0A 2Y30A 1FT9A 3ZMZA 4XLPF 2XAHA 4OWRB 4YFXF 5F0CA 2DT7B 5HLGA 2HVRA 5KCMA 3C18A 2F5VA 3O8GA 1YITI 2CU7A 3AG1H 4NNJA 3U9GA 2NOGA 1VTNC 4FCYA 3C3WA 1OPCA 1ZRCA 1OKRA 3A02A 2Q8KA 4ZC3A 1IRFA 2CFXA 4HF1A 2ZXIA 1HW1A 2P6TA 3W6JB 5E18F 3MKYB 1G8XA 3AAFA 2A5YB 2KIMA 3V7SA 1F9NA 9ANTA 3IKTA 2LG4A 3ZN1A 2Q2EB 1O57A 3E6CC 2NVQJ 2HZTA 3F9KA 2VUMJ 2D2WA 3ZQLA 4QSHA 1BIAA 1IN4A 1S7OA 3VSKA 3V42A 2H8RA 2XF5A 3N4MA 1HSJA 3GBGA 2KFDA 1YYVA 2L9NA 1UJ8A 4JYKA 1T33A 3HZJA 3K2ZA 2HYFA 2FU4A 4GDFA 3G3ZA 5LHGA 2OF7A 4G8XA 1M1EB 2XPWA 3F8BA 2MH9A 4HSTA 1AOYA 5EG0B 3JRCA 4HNUA 3RZDJ 1APLC 1X3ZB 2DFEA 4NC6A 2R7DA 4IRIA 1MBEA 3H9GA 4IZZA 3MMYB 3L2RA 3T1BA 1RETA 5HLIA 5FLXZ 5GTHC 2E1MC 4A3DJ 4QPQA 4G6DA 5J4VA 1ZKGA 1S29A 1QO0D 1LQ1A 4PGHA 5EEGA 2DU9A 3L00A 1MJ9A 1Z3YA 3HOYJ 2XAUA 3HOSA 1RKWA 1QNTA 1TWAJ 2EFWA 2HDWA 2X1CA 2DI3A 5DM6F 4I0BA 1IC8A 2R3SA 4G6TB 1MZBA 3EPZA 2YU3A 1YLFA 5HDKA 5ILUA 4UB8C 2IRFG 3VYTB 2XVCA 1SFKA 3R0AA 4M6YA 1FP1D 3BR1A 2JA6J 2ZO4A 1SVMA 2D45A 2MA3A 2HDDA 1D3YA 3BLYA 3QYFA 1MJAA 4OMYA 3GLLA 1T38A 1YE9A 1RKTA 2BE5F 3EDPA 2E1MB 1BIBA 4HSRA 4IHSA 1BA5A 4L0YB 3I4PA 4IJAA 3FWEA 1POGA 5ICGA 3TBIA 3JW4A 3A2KA 3WG7H 2X6YA 3S93A 5M5XJ 4GGGA 2TCTA 2DA2A 2VQLA 3Q9VA 5H6RA 4FX0A 2F4OB 2NNNA 3OR2C 4NC8A 5D5WB 1B72A 4IX7A 3KIOA 4I98B 5E8GA 3IRRA 1MH3A 4EJOA 1QU3A 2DTZA 2Q0OA 1QHHD 4U87A 1UMQA 2QYOA 1R36A 1LE8B 3CCUI 3FXMA 4PJMA 2ME6A 4BBRJ 1XD7A 1GV2A 2AQEA 1IO2A 2MD5A 2HOEA 3LA2A 1W7PB 3PJRA 5M5YJ 1BJAA 3DTEA 1Y39A 3HOXJ 3J80Z 3KYLA 4M73A 2MH2A 2XHKA 1WQ2A 3A01B 4PSXA 2OQRA 4KIBA 2Y9ZA 1W36D 4QWQA 2E1CA 3E1SA 2DLLA 4AWXB 5E8IA 2QSGX 2Y0SN 2X6OA 3S1NJ 2CYYA 1DGRM 2QKLB 1MW7A 2ZXWH 1FSEA 5J8CA 1YS7A 1ZR4A 1UB9A 5L3FA 5EF6A 1K83J 1NHAA 4IQ4A 1FBSA 5E1WA 2QLZA 4EVIA 4S05A 4YFNF 5IT9K 1VZ0A 2QQBA 3PUBA 3CO6C 2R5ZA 4ETSA 4YIRX 2BVLA 2LFBA 2KJCA 4EM2A 1CF7B 2VT3A 1AWCA 1YJWI 3G4SI 1T39A 3MCZA 1X4PA 2XASA 4Q5SF 3S1MJ 4UHTA 1VQ9I 3MZYA 1I50J 5A2QK 4Y33A 1TQMA 2X6WA 5DV5A 4KFCA 1GLNA 1JUPA 2PN6A 3Q0VA 1Y8QB 4LG0A 3P9KA 1W5TA 3HUGA 2K27A 2MBFA 4MTDA 4EJWA 2ZJQF 2VJ5A 1QZZA 1OISA 2MLGA 4U0YA 3FIWA 1TTYA 2DA7A 3MEXA 4PJNA 1H88C 2ISZA 3KLOA 3OYHA 2Z9OA 2QBYB 1Z05A 5CLSA 2VODA 5BOXA 2KP6A 3KP6A 1S6LA 5D5UB 3S32A 2K4BA 4BXUA 2R93J 4I2OA 4E7ZA 3PUFA 3LOCA 2F4IA 4C2TA 4F52A 2EINH 2K40A 4LLLA 1H89C 2X1DA 3FXQA 4DZPA 3PNYA 4AVPA 4HLYA 3CJTB 2E19A 3WODF 4E6KG 4NHJA 1YO5C 3TO9A 2L01A 5L3CA 3JAMK 2DT6A 3U1KA 4N9HA 2KIQA 1B6AA 2RN7A 1MBFA 4F3QA 1JUMA 2JMWA 2IXSA 3E6BA 5DYMA 5GP9A 1D8JA 1PVEA 1RR7A 1P7JA 2EZKA 3I5UA 1J7KA 5F64A 2LR8A 4YEJA 2MD0A 4FISA 3H3VK 2E5NA 2WC2A 1OLTA 4OIPF 2P8TA 1WVRA 1O3SA 5E79C 3QAHA 4KUMA 5K5QA 3C7JA 1A36A 3R61A 1IN6A 3ECHA 3GTMJ 4A3BJ 3JRHA 1FLIA 4N4NB 5LHHA 3BOQA 4I01A 5TGTA 4ZDLA 5C4JJ 2R5YA 1MH4A 2ZXHA 4XK4A 4HQMA 3EYYA 3DPTA 1ZG3A 4EQQA 3S14J 2L4MA 4G9YA 4A3KJ 1WSUA 4E70A 2COBA 4XICA 1CQTA 2RDPA 1QZYA 1V54H 3B6CA 1BC8C 3CC7I 2KLOA 4G7OF 2KISA 3GTLJ 4Z2YA 2HS5A 2K86A 2Z99A 2IGMA 2MGQA 4M3GA 2IAIA 1EH8A 1SD6A 5D6FA 1U5TC 3BG3A 2HQAA 3HKZN 3HL2A 3PM1A 5JR3A 3A0HC 4F55A 2Z33A 4U0WA 2OZUA 2F48A 1WH7A 4XLAA 1U0JA 4AVZA 1X3UA 2FEZA 4I02A 1ITYA 1J75A 5HDGA 1V5EA 3B02A 2DDAA 4DOZA 2OQGA 3P9IA 1B59A 3OWTA 3EUKL 1BR4A 3L2UA 4J19A 4G6QA 1SFEA 1VQMI 3CUOA 2H6CA 3OYCA 5J1YA 2NNYA 4V2FA 5J4YA 1VQ8I 2CO5A 4IRHA 3DKXA 1KYZA 2YX4A 1QQIA 3KYDB 4A3MJ 2XGDA 2ZFUA 1YHQI 4JQFA 2YR2A 3MKZA 1PUEE 5C4XJ 2RQQA 1UHSA 1LB2A 2E1OA 5D4SA 3OYDA 4A2UA 2WA0A 3H1CA 3Q0UA 2R7OA 1K6OA 1D1BA 2BY0A 1FSHA 5K5OA 3Q9SA 4RDUA 3AG3H 3LQRA 5BQTA 4MEYF 3L2VA 4A5NA 1Z6RA 2W24A 2FX0A 4L9JA 2EV5A 2LK2A 3M7GA 2JPBA 3I71A 3PQKA 2E60A 1IDZA 3OYLA 1RESA 3BG9A 2L9VA 4FE4A 4B47A 1BC7C 4K2EA 3TW6A 3ROUA 4CICA 1UCRA 2O03A 2F5EA 4Y3OA 2FMLA 2XROA 4ZYDA 2DFFA 4UVAA 4ZTFA 5LRRA 1USSA 3QPLA 3W2VA 1K61A 2ZJ2A 2JSCA 3ABKH 1AKHB 2VLAA 1N25A 3G2BA 3LSHA 1VI0A 3FXRA 4BGDA 2FE3A 2N8GA 2TDXA 1HKQA 3SFIA 3K2AA 1AA7A 4BYYA 4BKXA 4M72A 1KONA 2BEOA 2O6GE 2X85A 4HRIA 3BROA 3LA7A 3MVPA 1FMVA 3VB2A 1QPIA 1XMAA 4N0BA 3GVAA 5IYBJ 2W84A 5E3MA 2DOFA 3GCMA 3JTGA 2VQGA 3K4NA 5FKNA 1X1DA 4CYCA 2O9LA 4WXDA 4D7MA 5DD4A 3TQNA 5L3DA 4DIQA 3M8JA 3MKWB 2HYGD 3DLAA 3CCVI 1V5GA 1WJEA 3OYEA 4RM2A 1ZR2A 3KP7A 4LFUA 1MMSA 4F7ZA 2KMUA 2L02A 5L3GA 2WAEA 4IPAA 3ZMDA 5HS8A 5HNHA 5ILSA 3KEOA 1R5HA 3RYRA 2M5WA 1WH5A 5DUKA 2MYSA 2XGCA 2XRLA 4A3GJ 4Y52J 4CXFA 3T0YA 3GTKJ 4KISA 3ZQCA 1KQ9A 2LKSA 2WADA 3GYHX 2IA1A 3H3ZA 2AS5F 4A6DA 3ZOBA 2STTA 2GOMA 3D1NI 1Z9CA 2O61A 4G7ZF 2VJIA 4ZJZA 5B5EC 1YRNB 3WTYC 4HZFA 1I3AA 3F21A 4N4OB 2WAQN 2DTRA 2BXZA 2F5FA 1BI2A 2OUMA 1F4KA 1UELB 2BV6A 4HNTA 4WWCA 3H3UA 5BMZA 4UVBA 3H5NA 1HF0A 1D0ZA 4BQNA 2Z16A 5DEQA 3H5AA 4HX4A 5DD8A 3V4GA 4AIDA 3GFIA 4YRVA 3ASNH 3S3MA 2CV1A 5FFXA 3LSKA 2V6CA 2NVUB 1TWGJ 4FT8A 2CUJA 1BI1A 3GTJJ 3LFKA 2AXLA 4HEA2 4DYQA 5J6XA 5EGOA 1WFXA 4HAMA 5C44J 3OYFA 1DGWY 4MLOA 1QVUA 2GXGA 3LSJA 3RQ4A 5F0FA 3IKVA 2PJPA 3RKWA 2WB1N 5DCMA 2OAZA 4B09A 3J81Z 2LD5A 3E5UA 5FKMA 3BG5A 4M3FA 4LIVA 2IS4A 1LNWA 5L3EA 3DKYA 5IT3A 2E1NA 2WAFA 4DJAA 2V1UA 1T08B 1YIOA 3HB9A 3S8PA 1MMDA 2ELHA 3DV8A 1FEXA 2WY8Q 1FBQA 3VFZA 2DFIA 3RTRA 3ONQA 1U8RA 2GXBA 2LDUA 3ULQB 3BR3A 3I4NJ 3HOTA 2JRMA 1RRJA 2VXZA 5FLXK 3CF5F 1LDKB 3K69A 3OYJA 3CMAI 2XPUA 2K9LA 1BW5A 3J7YJ 1JKQC 4MHGA 4IEJA 4BY1J 4BDYA 1HQCA 2OPTA 4NQWB 2RVCA 4W97A 3TP3A 1O3QA 2VKEA 2JZYA 3GLXA 4U88A 1OCCH 1W5CC 3VEPA 4I99C 5ICFA 2JVHA 3BQYA 2P4WA 3G1MA 3I9V2 4RS8A 4ZYAA 1UAAA 4BQOA 2ZCWA 1ON2A 2XKPA 1IN5A 1B9NA 1KYWA 3BZKA 3WTTC 1A6QA 2GIVA 2QEXI 1ETQA 2OC6A 3S1QJ 3ZGKA 2XF6A 4XL9A 3DEUA 3R4KA 5IYDJ 3P5JA 3SJMA 2COMA 2BGCA 4I7HA 3FBIB 4HX7A 1ZTRA 3KCCA 3M9AA 2MABA 3S3NA 1SAUA 3TMOA 4L0ZB 1XGNA 4AYBA 4DYCA 4LOCA 2H8WA 2RKHA 4Z6YA 1Z6TA 4C2UA 2RV8A 4XLCA 3HPHA 1IRGA 5FD5A 2F2EA 2IJLA 5JHFA 4BJ6C 3PO3J 2KIUA 4CCJA 2DN0A 1YJ9I 1KU9A 2B7EA 4WF2A 2EPFA 1V3FA 2QM3A 4EGYA 2F4MB 3W6KB 5IPAA 5ILVA 3PSIA 3ABMH 2QENA 3F8NA 4BAYA 4B1RA 2RAEA 3MZ8A 5HLHA 2K9QA 4BQQA 5KHDA 3J80K 3WTVC 4HQEA 2G7UA 1ETXA 4ESBA 3OY9A 3M3YJ 3QQAA 2VQCA 1U9NA 4B43A 5D8LB 2VL8A 4RAZA 5CVRA 1XTAA 1SFXA 3B6AA 1TL8A 1IZ1A 1V55H 3KP3A 1MDMB 2M45A 2O8XA 2A6EF 3BPXA 1BM9A 2WBMA 3OSFA 3WE2A 3JRIA 5E17F 5TRDA 4RAFA 3HIFA 4G12A 2EWNA 3FXJA 2XKOA 4IHTA 1WGXA 1R22A 1SVOA 4PZJA 4XLEA 4C30A 4M3DA 2PLYA 4KJZA 3QODA 2DBBA 4KN7X 5J40A 1TWHJ 3ELKA 3U21A 3DXJF 4B4CA 1IJWC 1Z21A 2XUBA 4ON0A 1G3YA 1OCPA 3BR5A 5LEJA 4ZYHA 3R6SA 4N9IA 3HRMA 2V4JC 3VDXA 4LJZF 4YIIA 1UG0A 4DW6A 3IP4B 3V7CA 5JHUA 2Y31A 1P92A 5LD2C 1YW8A 1FP2A 1Y0UA 3CMEI 4AM3A 2WV1A 3H9QA 3BTLA 2HDCA 2KRHA 1JGSA 5GAEJ 2VIXA 1ETYA 4BY7J 2QQ9A 3GZNB 1ZGWA 3FMSA 1NK2P 2PMZN 5AONA 3HSEA 3SDBA 4HNVA 1Q1VA 1MNEA 4KICA 3M1CA 4PK4A 1Z77A 4LK0F 3WTWC 1ZAOA 2DMTA 4FETA 2EFNA 3I59B 4XRFA 2HKXA 1ZLJA 4HG2A 5IP9J 5FKOA 5AIQA 1R4MB 4BEHA 1J59A 1R1UA 1MMNA 1L0OC 1Y0NA 2R7FA 5KK1A 2RC4A 3IH2A 1A35A 2KKOA 1B8IB 4WX9A 1VQ5I 3DWLE 2ISYA 1A6IA 1K79A 5EZGA 2DCEA 1R58A 1RNLA 2JJ7A 3J7AO 2FF4A 2M30A 4XRSA 2KDZA 1U8BA 2Y2ZA 3FKJA 2LBFB 1N75A 1JUSA 1T0FC 1ZGJA 2ESHA 1JKOC 1AHDP 1OJLA 3NAUA 3AG2H 4AU7A 1RC9A 1YG2A 4KA4A 2ZXJA 3SHFA 4E7HA 4DNCA 3K4KA 3FXOA 4XN3A 2ME0A 2CUFA 3R0JA 1TC3C 2GM4A 2AQFA 2W1OA 1OQYA 2KIFA 3HXLA 3OIQA 2IBDA 4HV6A 1JXSA 3JSOA 1VQ7I 4Q4ZF 2ZBKA 4YG2F 4MFDA 1ENHA 1IV6A 3B73A 4M6VA 4EM1A 3ZQIA 2LC2A 1W4MA 3U2RA 5EJCA 2DW4A 3RSNA 4HX8A 3RKQA 4E7SA 3KZZA 2YU9J 3ZMUA 2HVQA 4Y13A 2E2JJ 1IXSB 2F5CA 3CJNA 1R1TA 4E7JA 3FXLA 4DBQA 5FRNA 2R7TA 1WPKA 2JA5J 3BJAA 2IGOA 2EIMH 3EQLF 4MEXF 3GTGJ 1HLVA 1FYLA 3WG9A 2H6BA 2JUCA 1K4TA 4XM3A 4V19K 3F23A 2QSFX 2M7BA 4HV5A 2VKDA 2DJIA 3BJOA 3HHHA 4LD5A 2VASA 2HZDA 3FXKA 4NBQA 4KIGA 1S3JA 2O5RA 2ZSIB 4ZH4F 3S16J 1LEBA 4P9UA 5HNFA 3CDIA 3T5XA 2L9RA 1E17A 4CCKA 5FROA 2PEXA 4EM0B 1LVKA 1FWZA 2CQXA 2QSHX 2MC4A 1KQ8A 1FC3A 1YX5A 2OCEA 2ETHA 2PJRA 1OCZH 1R6RA 3BJ6A 4XSXF 4A3FJ 1R7JA 4Y4RA 1YS6A 2BHZA 2XPVA 1X19A 4R8HA 3ZQFA 2HXIA 2EZIA 2EJRA 4BQAA 5IYCJ 3A0BC 3L7WA 1B1BA 5BNGA 1E0EA 4OU0A 4MO7A 1KU2A 4H0EA 1HCRA 2FXAA 2R7QA 1KU3A 4I6ZA 1JGGA 2YSRA 3ZMVA 2STWA 1F43A 1HDPA 4XKVA 1VQ4I 3K4MA 1I1GA 3NWSA 3BG7A 1BJZA 3L2CA 1ZK8A 3TDUC 4CCOA 1RUOA 3ERMA 4B48A 4ZYGA 1U5TA 2LSOA 2LKXA 3QRFF 1LFBA 2R7SA 4BXXJ 2V9KA 3EYIA 2LH9A 2BHYA 4FTHA 1FIPA 1PYVA 1XC5A 1BI0A 2HNHA 1H9GA 1FX7A 1WRJA 2PBIA 1JTYA 1IGNA 5CQEA 3VODA 4HBLA 3RCOA 3QPTA 4GFBA 3IL2A 3LSIA 3FDYA 2DFHA 3FHNA 1MBHA 2MSYA 1S8NA 2L9SA 3HRTA 2I8DA 2V6EA 1VQ6I 1MKMA 3OL3A 4I76A 4XKBA 4I0AA 1P4AA 1FOWA 2QF7A 2YPRA 4CHUA 2IA0A 2I5UA 1BOAA 2JK3A 4M3EA 2EA4A 1Z3XA 2CS3A 1S9HA 3JRDA 1LKXA 1O7FA 1O7LA 4RMNA 3CCSI 1QPMA 3KETA 3VWBA 3CMMA 1P2FA 3BTCA 4LB6B 4IOAF 2DDBA 5LRSA 3DKWA 1DUXC 1GVDA 2Y9YA 1PP8F 1BL0A 2VBZA 5EDNA 3CCEI 5K1YA 2DMUA 1B4AA 2OV7A 2DT5A 3D0SA 3K4CA 2W25A 4L9NA 3C2HA 2LY9A 3CUQA 4DGWB 3CCQI 2EBIA 3KPHA 2FD5A 3LSTA 1PP7U 2E2HJ 4PJ0C 3Q0WA 5KAFC 3DEEA 4IQJA 2IP2A 2DO7A 2YX7A 3V8KA 4KIFA 4BBSJ 4UUSA 4A3IJ 3IHUA 5F1JA 1JKPC 1RPWA 2EFPA 1VFCA 3CMYA 3H36A 4UY8I 3PL8A 4P9FA 5FB2A 3L09A 2BYVE 4KYWA 3TP0A 1JJ6C 3K7AJ 2QA4I 1TP4A 1E2XA 2FRHA 2IVMA 2W57A 3F8FA 4DQ2A 1PUFA 2XAQA 1U9OA 3L9FA 2ZKZA 4HDVA 4A0YA 5JFRA 2IGNA 5LGTA 1B72B 1FOYA 2K9NA 3QWLA 4MGRA 1EH7A 3SZPA 2XGXA 2VBWA 3VOEA 3CJRB 4M3BA 4A3EJ 1Z7LA 5JLXA 1HA8A 2EH3A 3AFHA 4NUBA 5CJ9A 4HDUA 1ZRDA 2I10A 5IOYA 4BHBA 3J81K 3AG4H 4X0GA 5F1RA 2DK8A 1X1BA 3ZPLA 1SD5A 3BTIA 1E3OC 2DPDA 2HWVA 5DUIA 3HRSA 4U7BA 4CGZA 1N77A 4M9XA 2NVTJ 4XQFA 4X6AJ 1DPRA 3KP5A 3GW2A 2UV1A 5BPIA 2DYSH 2O7OA 2A3SA 2ZC2A 1TWCJ 3BR6A 3RZOJ 3W6VA 1XN7A 1DU0A 1D1AA 2A61A 5F6FA 4YFKF 2QKMB 3DU5A 5ICCA 4EJUA 2WB1A 4HPQA 5HODA 2FSWA 1FJLA 1ETKA 2DOEA 5J3LA 3CCLI 3T8TA 4CZCA 3CZ6A 2EZHA 2G9WA 3E5XA 2MFZA 2EILH 3NQOA 2R5ZB 3NARA 1XB4A 2Y75A 2HVSA 1SD4A 3JTHA 3K10A 2LLKA 2LNBA 2BY3A 3QYEA 5DCFA 1YFHA 1FNNA 2DMQA 3HSFA 4C2MJ 3IUOA 2QQAA 2EV6A 5JVGF 2FBKA 3FMRA 4NB5A 2L0KA 4RGSA 4UXNA 1U3EM 3VYSB 2XIGA 2JTVA 2OBPA 3CLOA 5K7FA 5D5VB 1FMWA 1ZHFA 4LG0B 3HUGB 3DP7A 3U1DA 3IC7A 4KN4X 3QYBA 3K0LA 2FNPA 1QHGA 4GYGA 1BR1A 2ZMEA 3LL7A 3BC8A 3LSMA 3L2QA 3HGYA 4B8XA 1B9MA 3TL4X 5LGNA 4C9YA 1OYIA 1WJAA 5IOZA 2PQ8A 4JBAA 3FX3A 3I53A 1VF9A 4CUGA 3WGHA 4MFEA 1FYKA 5TISC 1OYYA 1D5VA 1K6YA 1WZ2A 1QRYA 1XSDA 2E36A 3OL4A 1UHMA 1R71A 2P7CB 2H09A 4OAYA 5TJJA 2HTSA 4RGRA 1I39A 3CC4I 4WK8F 2BW3A 1X58A 5GPAA 1ZG1A 3PSFA 2M8EA 4WXCA 4CCNA 3IH3A 2R4GA 3DCFA 2HQRA 2B63J 3PQJA 2VOPA 3OS1A 4A0ZA 1I5ZA 1MGTA 1OR7A 4FHTA 2HKOA 4A12A 2X0LA 5CVUA 3W3CA 1BOBA 3DQVC 1X1AA 4XSZF 3W2WA 1WJBA 4KITB 3K4BA 5H6QA 3LSRA 2R7RA 1I1SA 3RPUD 2XV4S 4CCLA 3QOPA 4RB0A 1KA8A 1TBXA 1LDJA 1T95A 3LFUA 1WI3A 3J7ZI 1H9TA 5ED4A 2DMNA 3BY6A 2R5YB 2R7VA 4J01A 2V1NA 4XOPA 1DDNA 1SC7A 1FY7A 2EZLA 1S7AA 4M74A 2HPMA 3HDDA 2NAZA 4PJJA 2HEOA 4XKWA 3QPHA 3HRUA 3BDDA 3OYAA 1JKRC 1L3LA 4A6EA 1MIJA 1TT5B 5KNLA 2VE9A 5HDNA 4IO9F 1T98A 2JWTA 1BN5A 4JOMA 1GDTA 1HW2A 4A3CJ 4B3XA 3O3KA 3WGIA 3IH4A 3DLLF 1I27A 2XGEA 2YS9A 2V79A 3HJEA 4HA8A 3LAPA
chains in the Genus database with same CATH topology
2OU2A 1K78A 1RUNA 3TDZC 4P96A 4M9ZA 3RI4A 4IRGA 1ZREA 3F3XA 2GA2A 4LLNA 4XLNF 1WI9A 4MNUA 2IW5A 4OMZA 1Z7UA 2Q2EA 1C0WA 3MAJA 3ECOA 1P6RA 4L9VA 3TKYA 4Q47A 3CTAA 2RQPA 3TOBA 1IN7A 4S04A 3KEQA 3M8EA 3TGNA 5E1ZB 3FF5A 3MWMA 1R5GA 1OYWA 2OA4A 2H27A 1J2XA 1TNSA 1GXPA 2NS0A 3KFWX 2LF8A 4CDGA 1XGOA 1HSTA 2F5DA 3LA3A 3GFLA 1W7PD 4BH9A 3G73A 4OIRF 4EMSA 5D8KB 1XSXA 1TNTA 4AD9A 3Q5FA 1FPQA 1R23A 4KNYA 2A68F 3MQ0A 3FMQA 4CZZA 3S2WA 4Q48A 5E20A 3SXYA 3D5LA 3TO7A 1G3TA 1GXQA 2J5OA 2JRTA 3GZ6A 1V4RA 2GZWA 1Z91A 3O2PE 3LAJA 2RGVA 4ESFA 2CGPA 2M87A 4UUVA 3ABTA 2X4HA 2K7LA 1WKMA 3HHGA 3RYPA 1RZ4A 1TW3A 1W7PA 3FHZA 2QUFA 4LGWA 5D6EA 2GAUA 6PAXA 3HSRA 2K02A 2Y48A 2D1VA 3WE3A 2ESNA 4RB1A 3RDIA 1O3RA 1R00A 3ABUA 2FBHA 3I64A 3IWFA 3KP4A 4UNOA 5DCMB 1HKSA 2HTJA 4ENNA 1CF7A 2ZNZA 2PG4A 5KVRA 4Y15A 4ZZLA 2P5VA 4P55A 4FX4A 3WU0A 1HXDA 4Y17A 4O5VA 4UV9A 2ZFWA 5LLQA 4EV0A 4RGXA 1LJ9A 5FGMA 1XGMA 3GFMA 2QBYA 5K5RA 1IUYA 2VE8A 2V1XA 1ZH5A 1P4WA 4ASNA 2UWMA 1T6SA 2H94A 1IXCA 4O3MA 4L5IA 1EH6A 4MTEA 4LK1F 3F8CA 1GVJA 2CW0F 1A04A 1ON1A 3WGGA 3F72A 3GF2A 1FYMA 2EA2A 1QGPA 4GCVA 1CGPA 1XGSA 3DPLC 4MQVA 1XCVA 4ZYEA 2XAJA 4O6JA 3K1MA 4L5JA 4GYIA 3I54A 1H0MA 1D8KA 2WTEA 2DQRA 1HKTA 3F22A 1WWXA 2VOOA 4HF2A 1U6GA 4BNCA 3GUDA 4KMUX 2FA5A 2P5LC 1SFUA 2FQ3A 5HS9A 4P5OA 4UV8A 4HF0A 3QU6A 3ML6A 1IXRC 5H20A 1SAXA 2GA1A 3K1NA 2FBIA 4KT5C 5FO5A 2VONA 2KRFA 3SZTA 4HLXA 3F6VA 2GWRA 3WTXC 2PFBA 2XRNA 4HW0A 1YTYA 3JSPA 2UXXA 2EB7A 3ISPA 4WXHA 5FFZA 3MFKA 2UZKA 2ACJA 1MD0A 2Y0MA 1G3SA 2O0YA 1LDDA 1ODDA 1JHFA 5CYVA 3WTSC 1U78A 2DAOA 1TQIA 2O3FA 1LVAA 5LBQA 3GXOA 2QVOA 3E5QA 4YIFA 3NRVA 1PDNC 1O3TA 2M1BA 2BBYA 5HS7A 3QP6A 3BPVA 2A6HF 3CO7C 1J0RA 1ULYA 3GZ5A 2K4JA 5LEKA 3LWFA 4G94A 1YW7A 3FM5A 3I58A 1SMTA 3M1EA 4R1HA 2ZNYA 1IW7F 2D1HA 1W5SA 2RNJA 1JHHA 2VBYA 3ZMSA 3WTZA 2V1DA 1TLHB 4CYDA 3R60A 4LMYA 3TO6A 1IN8A 1P4XA 2MC3A 1DPUA 3OV8A 3FZVA 2UXNA 3REOA 5L3BA 5EEHA 1TQPA 3E6MA 3P7NA 1J5YA 1KGSA 3BZ6A 1USTA 5E1XA 2EFQA 2OZ6A 1BI3A 1REPC 2E7WA 2EV0A 4AIHA 4A5MA 1ZRFA 1SMYF 3ERED 3GX4X 3F8MA 2IA2A 3H92A 2J5PA 1HW5A 3COAC 2CWEA 5LGUA 4ENMA 3QU3A 5HVQC 3WTUC 4PGGA 3SFZA 3HYIA 3RKXA 4BHCA 1TW2A 3GFJA 4BHPA 1JE8A 2HGCA 4EJTA 2QWWA 2JPCA 5D5XB 3GWZA 1EV7A 3O6BB 3KLNA 1KQ0A 2C6YA 1ZLKA 3HTUA 4A0XA 1R1VA 3E3VA 3PFIA 2WV0A 1Q1HA 1IAWA 3ZN0A 3F6OA 2Z5UA 1YW9A 3RKYA 2FNAA 1U5TB 3IRQA 2JT1A 1F1ZA 1FZPB 1HBXG 4GO1A 2KJBA 2VT2A 3SQNA 4OINF 1K7AA 3N97A 2A07F 5IT9Z 1F5TA 4UVCA 4NQWA 5CVVA 1RIOH 4G7HF 3CUQC 1FBUA 1SD7A 5A2QZ 4TV7A 2HFHA 3FXUA 4ENKA 2PMUA 4IVNA 4GXOA 1LEAA 3M8FA 4M9SA 2EK5A 4IF4A 2DQLA 2P6SA 1U2WA 3K1PA 4XBFA 3V7RA 1XDSA 1I6XA 4L9TA 1G3WA 1KU7A 4M71A 4ENJA 5HOOA 1J9IA 2CG4A 4OIOF 3CUQB 4KDPA 1GHCA 1XDUA 1XCBA 3JAMZ 1XMKA 4RGUA 2GQQA 3KE2A 2NYXA 3TOAA 3T8RA 1STZA 1QBJA 2L54A 4ESJA 3DFGA 4PDKA 5JI6A 3GEZA 2HR3A 1G6NA 2VC0A 1DP7P 3NEUA 5DDGA 5D4RA 3RPQA 1MDMA 2LF7A 3V8LA 3ZP5A 2ADUA 1Z1DA 2IPQX 2DK5A 3RJPA 1ZARA 4RAYA 3GO5A 5BS6A 3RPUA 4U7DA 1IF1A 1G4DA 2DPUA 4RB2C 2L4AA 3HTSB 4EGZA 2P5KA 1BBYA 1UHWA 2WWYA 1UFMA 2VBXA 4R79A 2Z3YA 2PMHA 2XAFA 3FM3A 4PCQA 5JVTA 5ICEA 3KZYA 5ERIA 2P7VB 4ZZDA 3MZHA 3RIRA 1T2KA 3EETA 2HQNA 4JK1X 2B0LA 2FMYA 3K9TA 1MJBA 3I59A 2LKPA 3E6DA 3ZQ7A 1ZYRF 4OIQF 4MQ9F 3EUHA 4WCGA 3BP8A 2E7XA 3QP5A 4KMFA 2ZMEB 2QZ8A 2L3DA 3IWZA 2MLKA 2NRAC 1OMIA 3DF8A 4D0PA 4LB5A 5LHIA 5AIPA 2V9VA 4EJVA 2EFOA 1RI7A 3ZMTA 1ONVA 5BPDA 3CDHA 3I0TA 1ZN2A 3LQQA 2W85A 1ZGAA 5J8FA 4HOBA 2FOKA 2G7HA 4M6XA 2VC1A 2OD5A 4IXAA 3P9CA 2A69F 4U0VA 3V8JA 1XSVA 3OOPA 1T0FA 2VN2A 3E97A 4L18B 1YQAA 4LLGF 5CVIA 5FD6A 4AIJA 2XAGA 4CO8A 2CQKA 3BWGA 3KP2A 2PI0A 3WU1B 4I09A 4AIKA 4HYEA 4OOIA 1K78B 2CSOA 5CVJA 1FOKA 4RB3C 4QLCU 2IT0A 3C1DA 1ZG5A 4XLPF 1FT9A 3ZMZA 2XAHA 4YFXF 5HLGA 3C18A 3U9GA 1VTNC 3C3WA 1OPCA 1ZRCA 1OKRA 2Q8KA 1IRFA 2CFXA 4HF1A 1HW1A 2P6TA 3W6JB 5E18F 3AAFA 2A5YB 2KIMA 3V7SA 1F9NA 3IKTA 3ZN1A 1O57A 3E6CC 2HZTA 2D2WA 1BIAA 1IN4A 1S7OA 3N4MA 1HSJA 1YYVA 3K2ZA 2HYFA 2FU4A 3G3ZA 5LHGA 4G8XA 3F8BA 2MH9A 1AOYA 2R7DA 4IRIA 3T1BA 5HLIA 5FLXZ 4G6DA 1S29A 1QO0D 1LQ1A 4PGHA 5EEGA 2DU9A 3L00A 1MJ9A 3HOSA 1QNTA 2EFWA 2DI3A 4I0BA 2R3SA 1MZBA 2YU3A 1YLFA 5HDKA 5ILUA 2IRFG 2XVCA 4M6YA 3R0AA 1FP1D 2ZO4A 2D45A 2MA3A 1D3YA 4OMYA 1MJAA 1T38A 2BE5F 3EDPA 1BIBA 4IHSA 4L0YB 3I4PA 4IJAA 3FWEA 5ICGA 3JW4A 4GGGA 3Q9VA 5H6RA 4FX0A 2NNNA 5D5WB 4I98B 5E8GA 3IRRA 4EJOA 2Q0OA 2QYOA 1R36A 1XD7A 2MD5A 2HOEA 3LA2A 1W7PB 1BJAA 3J80Z 4M73A 2MH2A 2XHKA 1WQ2A 2OQRA 4KIBA 4QWQA 2E1CA 4AWXB 2DLLA 5E8IA 2CYYA 1FSEA 5J8CA 1YS7A 1UB9A 5L3FA 1NHAA 1FBSA 5E1WA 2QLZA 4EVIA 4S05A 4YFNF 5IT9K 2QQBA 3CO6C 4ETSA 2KJCA 4EM2A 1CF7B 2VT3A 1AWCA 1T39A 3MCZA 2XASA 4Q5SF 4UHTA 3MZYA 5A2QK 1TQMA 5DV5A 4KFCA 2PN6A 4LG0A 3P9KA 1W5TA 3HUGA 2K27A 2MBFA 4MTDA 4EJWA 1QZZA 2MLGA 4U0YA 3MEXA 1TTYA 2ISZA 3KLOA 2Z9OA 2QBYB 1Z05A 5CLSA 2VODA 5BOXA 3KP6A 1S6LA 5D5UB 2K4BA 4BXUA 4I2OA 4LLLA 3FXQA 4AVPA 4HLYA 3WODF 4NHJA 1YO5C 3TO9A 2L01A 5L3CA 3JAMK 4N9HA 1B6AA 2RN7A 3E6BA 5DYMA 1D8JA 3I5UA 1J7KA 5F64A 2WC2A 4OIPF 2P8TA 1O3SA 3QAHA 4KUMA 5K5QA 3C7JA 3R61A 1IN6A 3ECHA 1FLIA 5LHHA 3BOQA 4I01A 4HQMA 3EYYA 3DPTA 1ZG3A 4EQQA 2L4MA 4G9YA 1WSUA 4E70A 2RDPA 1QZYA 1BC8C 4G7OF 4Z2YA 2HS5A 2K86A 2Z99A 1EH8A 1SD6A 5D6FA 1U5TC 5JR3A 2Z33A 4U0WA 2OZUA 1X3UA 2FEZA 4I02A 1J75A 5HDGA 3B02A 2OQGA 3P9IA 1B59A 4G6QA 1SFEA 3CUOA 2H6CA 2NNYA 2CO5A 4IRHA 1KYZA 2YX4A 1QQIA 4JQFA 2YR2A 1PUEE 1LB2A 5D4SA 4A2UA 1K6OA 1FSHA 5K5OA 3Q9SA 5BQTA 3LQRA 4MEYF 4A5NA 1Z6RA 2W24A 4L9JA 2EV5A 3M7GA 2JPBA 3I71A 3PQKA 1BC7C 4K2EA 4CICA 3ROUA 1UCRA 2O03A 2F5EA 2FMLA 2XROA 4ZYDA 4UVAA 5LRRA 1USSA 2ZJ2A 2JSCA 3FXRA 2FE3A 2TDXA 1HKQA 4BYYA 4M72A 2BEOA 2O6GE 3BROA 3LA7A 3VB2A 1XMAA 4N0BA 3GVAA 2W84A 3JTGA 4WXDA 5DD4A 3TQNA 5L3DA 2HYGD 3KP7A 4LFUA 4F7ZA 2L02A 5L3GA 5HS8A 4IPAA 3ZMDA 5ILSA 3KEOA 1R5HA 3RYRA 2M5WA 5DUKA 4CXFA 3T0YA 1KQ9A 3GYHX 2IA1A 3H3ZA 2AS5F 4A6DA 2STTA 2O61A 1Z9CA 4G7ZF 3WTYC 4HZFA 3F21A 2DTRA 2F5FA 1BI2A 1F4KA 2BV6A 4WWCA 3H3UA 5BMZA 4UVBA 5DEQA 4HX4A 5DD8A 3V4GA 3GFIA 5FFXA 2V6CA 4FT8A 1BI1A 3LFKA 2AXLA 5J6XA 4HAMA 2GXGA 3IKVA 2PJPA 3RKWA 5DCMA 2OAZA 4B09A 3J81Z 3E5UA 1LNWA 5L3EA 5IT3A 2E1NA 2V1UA 1YIOA 2ELHA 3DV8A 1FBQA 3VFZA 2DFIA 3RTRA 1U8RA 2GXBA 2LDUA 3ULQB 3HOTA 2VXZA 5FLXK 1LDKB 3K69A 4MHGA 1HQCA 2RVCA 1O3QA 2JZYA 3GLXA 4U88A 3VEPA 5ICFA 2P4WA 4RS8A 2ZCWA 1ON2A 2XKPA 1IN5A 1B9NA 1KYWA 3WTTC 2GIVA 3DEUA 3R4KA 2COMA 2BGCA 4I7HA 4HX7A 3KCCA 3M9AA 4L0ZB 1XGNA 2RKHA 1Z6TA 2RV8A 1IRGA 5FD5A 2F2EA 2IJLA 2KIUA 1KU9A 4WF2A 1V3FA 2QM3A 4EGYA 3W6KB 5ILVA 2QENA 3F8NA 4BAYA 4HQEA 5HLHA 3J80K 3WTVC 2G7UA 4ESBA 5D8LB 4RAZA 5CVRA 1SFXA 1IZ1A 3KP3A 1MDMB 2M45A 2O8XA 2A6EF 3BPXA 1BM9A 3WE2A 5E17F 5TRDA 3HIFA 2EWNA 2XKOA 4IHTA 1R22A 4PZJA 2PLYA 2DBBA 4KN7X 3ELKA 3DXJF 2XUBA 4ON0A 1G3YA 5LEJA 4ZYHA 3R6SA 4N9IA 3HRMA 4LJZF 4YIIA 3V7CA 5JHUA 1P92A 1YW8A 1FP2A 1Y0UA 2HDCA 1JGSA 2QQ9A 3FMSA 5AONA 3HSEA 4KICA 4LK0F 3WTWC 1ZAOA 2EFNA 3I59B 4XRFA 2HKXA 1ZLJA 5AIQA 1J59A 1R1UA 1L0OC 2R7FA 5KK1A 2RC4A 2KKOA 4WX9A 2ISYA 1K79A 1R58A 1RNLA 3J7AO 2FF4A 2M30A 1ZGJA 2ESHA 1YG2A 4KA4A 2ZXJA 3SHFA 4DNCA 3R0JA 4HV6A 2KIFA 1JXSA 3JSOA 4Q4ZF 2ZBKA 4YG2F 3B73A 4EM1A 3U2RA 1W4MA 2DW4A 4HX8A 3KZZA 3ZMUA 4Y13A 1IXSB 2F5CA 3CJNA 1R1TA 3BJAA 3EQLF 4MEXF 1FYLA 3WG9A 2H6BA 3F23A 4HV5A 3BJOA 3HHHA 4LD5A 4KIGA 1S3JA 4ZH4F 1LEBA 4P9UA 3T5XA 1E17A 2PEXA 4EM0B 1FWZA 1KQ8A 1FC3A 2ETHA 3BJ6A 4XSXF 1R7JA 1YS6A 4R8HA 2EJRA 4BQAA 3L7WA 1B1BA 4OU0A 1KU2A 4H0EA 2FXAA 1KU3A 2YSRA 3ZMVA 2STWA 1I1GA 3L2CA 3TDUC 1RUOA 4ZYGA 1U5TA 2LSOA 3QRFF 3EYIA 1BI0A 1H9GA 1FX7A 1WRJA 2PBIA 3VODA 4HBLA 3QPTA 3IL2A 1S8NA 3HRTA 1MKMA 4I0AA 1P4AA 2YPRA 4CHUA 2IA0A 1BOAA 2EA4A 1O7FA 1O7LA 1QPMA 3KETA 1P2FA 4LB6B 5LRSA 3DKWA 1DUXC 1PP8F 2VBZA 5K1YA 1B4AA 2DT5A 3D0SA 2W25A 4L9NA 3CUQA 1PP7U 3LSTA 2IP2A 2DO7A 2YX7A 3V8KA 4KIFA 3IHUA 2EFPA 4P9FA 5FB2A 3L09A 2BYVE 4KYWA 2FRHA 1E2XA 2IVMA 3F8FA 2W57A 4DQ2A 2XAQA 3L9FA 2ZKZA 4HDVA 4A0YA 5JFRA 5LGTA 4MGRA 1EH7A 3SZPA 2XGXA 2VBWA 3VOEA 5CJ9A 4HDUA 1ZRDA 3J81K 4BHBA 5F1RA 2DK8A 3ZPLA 1SD5A 2DPDA 2HWVA 5DUIA 3HRSA 4U7BA 4CGZA 4M9XA 1DPRA 3KP5A 3GW2A 5BPIA 2A3SA 1XN7A 2A61A 5F6FA 4YFKF 5ICCA 4EJUA 2FSWA 3T8TA 2G9WA 3E5XA 3NQOA 1XB4A 2Y75A 1SD4A 3JTHA 2LNBA 5DCFA 1YFHA 1FNNA 3HSFA 2QQAA 2EV6A 2FBKA 3FMRA 4NB5A 4RGSA 4UXNA 1U3EM 2XIGA 2JTVA 2OBPA 3CLOA 5D5VB 1ZHFA 4LG0B 3DP7A 3U1DA 3IC7A 4KN4X 3K0LA 2FNPA 4GYGA 2ZMEA 4B8XA 1B9MA 5LGNA 1OYIA 2PQ8A 4JBAA 3FX3A 3I53A 3WGHA 1FYKA 1OYYA 1D5VA 1XSDA 1UHMA 2P7CB 2H09A 5TJJA 2HTSA 4RGRA 4WK8F 1ZG1A 2M8EA 4WXCA 2HQRA 3PQJA 2VOPA 4A0ZA 1I5ZA 1MGTA 1OR7A 4A12A 4FHTA 2HKOA 2X0LA 5CVUA 3DQVC 4XSZF 5H6QA 1I1SA 2XV4S 3QOPA 4RB0A 1KA8A 1TBXA 1LDJA 1H9TA 5ED4A 3BY6A 1DDNA 1FY7A 4M74A 1S7AA 2NAZA 2HEOA 3QPHA 3HRUA 3BDDA 1L3LA 4A6EA 2VE9A 5HDNA 1T98A 1BN5A 1HW2A 3O3KA 3WGIA 1I27A 2V79A 4HA8A 3LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU2 A;  1K78 A;  1RUN A;  3TDZ C;  4P96 A;  4M9Z A;  3RI4 A;  4IRG A;  1ZRE A;  3F3X A;  2GA2 A;  4LLN A;  4XLN F;  1WI9 A;  4MNU A;  2IW5 A;  4OMZ A;  1Z7U A;  2Q2E A;  1C0W A;  3MAJ A;  3ECO A;  1P6R A;  4L9V A;  3TKY A;  4Q47 A;  3CTA A;  2RQP A;  3TOB A;  1IN7 A;  4S04 A;  3KEQ A;  3M8E A;  3TGN A;  5E1Z B;  3FF5 A;  3MWM A;  1R5G A;  1OYW A;  2OA4 A;  2H27 A;  1J2X A;  1TNS A;  1GXP A;  2NS0 A;  3KFW X;  2LF8 A;  4CDG A;  1XGO A;  1HST A;  2F5D A;  3LA3 A;  3GFL A;  1W7P D;  4BH9 A;  3G73 A;  4OIR F;  4EMS A;  5D8K B;  1XSX A;  1TNT A;  4AD9 A;  3Q5F A;  1FPQ A;  1R23 A;  4KNY A;  2A68 F;  3MQ0 A;  3FMQ A;  4CZZ A;  3S2W A;  4Q48 A;  5E20 A;  3SXY A;  3D5L A;  3TO7 A;  1G3T A;  1GXQ A;  2J5O A;  2JRT A;  3GZ6 A;  1V4R A;  2GZW A;  1Z91 A;  3O2P E;  3LAJ A;  2RGV A;  4ESF A;  2CGP A;  2M87 A;  4UUV A;  3ABT A;  2X4H A;  2K7L A;  1WKM A;  3HHG A;  3RYP A;  1RZ4 A;  1TW3 A;  1W7P A;  3FHZ A;  2QUF A;  4LGW A;  5D6E A;  2GAU A;  6PAX A;  3HSR A;  2K02 A;  2Y48 A;  2D1V A;  3WE3 A;  2ESN A;  4RB1 A;  3RDI A;  1O3R A;  1R00 A;  3ABU A;  2FBH A;  3I64 A;  3IWF A;  3KP4 A;  4UNO A;  5DCM B;  1HKS A;  2HTJ A;  4ENN A;  1CF7 A;  2ZNZ A;  2PG4 A;  5KVR A;  4Y15 A;  4ZZL A;  2P5V A;  4P55 A;  4FX4 A;  3WU0 A;  1HXD A;  4Y17 A;  4O5V A;  4UV9 A;  2ZFW A;  5LLQ A;  4EV0 A;  4RGX A;  1LJ9 A;  5FGM A;  1XGM A;  3GFM A;  2QBY A;  5K5R A;  1IUY A;  2VE8 A;  2V1X A;  1ZH5 A;  1P4W A;  4ASN A;  2UWM A;  1T6S A;  2H94 A;  1IXC A;  4O3M A;  4L5I A;  1EH6 A;  4MTE A;  4LK1 F;  3F8C A;  1GVJ A;  2CW0 F;  1A04 A;  1ON1 A;  3WGG A;  3F72 A;  3GF2 A;  1FYM A;  2EA2 A;  1QGP A;  4GCV A;  1CGP A;  1XGS A;  3DPL C;  4MQV A;  1XCV A;  4ZYE A;  2XAJ A;  4O6J A;  3K1M A;  4L5J A;  4GYI A;  3I54 A;  1H0M A;  1D8K A;  2WTE A;  2DQR A;  1HKT A;  3F22 A;  1WWX A;  2VOO A;  4HF2 A;  1U6G A;  4BNC A;  3GUD A;  4KMU X;  2FA5 A;  2P5L C;  1SFU A;  2FQ3 A;  5HS9 A;  4P5O A;  4UV8 A;  4HF0 A;  3QU6 A;  3ML6 A;  1IXR C;  5H20 A;  1SAX A;  2GA1 A;  3K1N A;  2FBI A;  4KT5 C;  5FO5 A;  2VON A;  2KRF A;  3SZT A;  4HLX A;  3F6V A;  2GWR A;  3WTX C;  2PFB A;  2XRN A;  4HW0 A;  1YTY A;  3JSP A;  2UXX A;  2EB7 A;  3ISP A;  4WXH A;  5FFZ A;  3MFK A;  2UZK A;  2ACJ A;  1MD0 A;  2Y0M A;  1G3S A;  2O0Y A;  1LDD A;  1ODD A;  1JHF A;  5CYV A;  3WTS C;  1U78 A;  2DAO A;  1TQI A;  2O3F A;  1LVA A;  5LBQ A;  3GXO A;  2QVO A;  3E5Q A;  4YIF A;  3NRV A;  1PDN C;  1O3T A;  2M1B A;  2BBY A;  5HS7 A;  3QP6 A;  3BPV A;  2A6H F;  3CO7 C;  1J0R A;  1ULY A;  3GZ5 A;  2K4J A;  5LEK A;  3LWF A;  4G94 A;  1YW7 A;  3FM5 A;  3I58 A;  1SMT A;  3M1E A;  4R1H A;  2ZNY A;  1IW7 F;  2D1H A;  1W5S A;  2RNJ A;  1JHH A;  2VBY A;  3ZMS A;  3WTZ A;  2V1D A;  1TLH B;  4CYD A;  3R60 A;  4LMY A;  3TO6 A;  1IN8 A;  1P4X A;  2MC3 A;  1DPU A;  3OV8 A;  3FZV A;  2UXN A;  3REO A;  5L3B A;  5EEH A;  1TQP A;  3E6M A;  3P7N A;  1J5Y A;  1KGS A;  3BZ6 A;  1UST A;  5E1X A;  2EFQ A;  2OZ6 A;  1BI3 A;  1REP C;  2E7W A;  2EV0 A;  4AIH A;  4A5M A;  1ZRF A;  1SMY F;  3ERE D;  3GX4 X;  3F8M A;  2IA2 A;  3H92 A;  2J5P A;  1HW5 A;  3COA C;  2CWE A;  5LGU A;  4ENM A;  3QU3 A;  5HVQ C;  3WTU C;  4PGG A;  3SFZ A;  3HYI A;  3RKX A;  4BHC A;  1TW2 A;  3GFJ A;  4BHP A;  1JE8 A;  2HGC A;  4EJT A;  2QWW A;  2JPC A;  5D5X B;  3GWZ A;  1EV7 A;  3O6B B;  3KLN A;  1KQ0 A;  2C6Y A;  1ZLK A;  3HTU A;  4A0X A;  1R1V A;  3E3V A;  3PFI A;  2WV0 A;  1Q1H A;  1IAW A;  3ZN0 A;  3F6O A;  2Z5U A;  1YW9 A;  3RKY A;  2FNA A;  1U5T B;  3IRQ A;  2JT1 A;  1F1Z A;  1FZP B;  1HBX G;  4GO1 A;  2KJB A;  2VT2 A;  3SQN A;  4OIN F;  1K7A A;  3N97 A;  2A07 F;  5IT9 Z;  1F5T A;  4UVC A;  4NQW A;  5CVV A;  1RIO H;  4G7H F;  3CUQ C;  1FBU A;  1SD7 A;  5A2Q Z;  4TV7 A;  2HFH A;  3FXU A;  4ENK A;  2PMU A;  4IVN A;  4GXO A;  1LEA A;  3M8F A;  4M9S A;  2EK5 A;  4IF4 A;  2DQL A;  2P6S A;  1U2W A;  3K1P A;  4XBF A;  3V7R A;  1XDS A;  1I6X A;  4L9T A;  1G3W A;  1KU7 A;  4M71 A;  4ENJ A;  5HOO A;  1J9I A;  2CG4 A;  4OIO F;  3CUQ B;  4KDP A;  1GHC A;  1XDU A;  1XCB A;  3JAM Z;  1XMK A;  4RGU A;  2GQQ A;  3KE2 A;  2NYX A;  3TOA A;  3T8R A;  1STZ A;  1QBJ A;  2L54 A;  4ESJ A;  3DFG A;  4PDK A;  5JI6 A;  3GEZ A;  2HR3 A;  1G6N A;  2VC0 A;  1DP7 P;  3NEU A;  5DDG A;  5D4R A;  3RPQ A;  1MDM A;  2LF7 A;  3V8L A;  3ZP5 A;  2ADU A;  1Z1D A;  2IPQ X;  2DK5 A;  3RJP A;  1ZAR A;  4RAY A;  3GO5 A;  5BS6 A;  3RPU A;  4U7D A;  1IF1 A;  1G4D A;  2DPU A;  4RB2 C;  2L4A A;  3HTS B;  4EGZ A;  2P5K A;  1BBY A;  1UHW A;  2WWY A;  1UFM A;  2VBX A;  4R79 A;  2Z3Y A;  2PMH A;  2XAF A;  3FM3 A;  4PCQ A;  5JVT A;  5ICE A;  3KZY A;  5ERI A;  2P7V B;  4ZZD A;  3MZH A;  3RIR A;  1T2K A;  3EET A;  2HQN A;  4JK1 X;  2B0L A;  2FMY A;  3K9T A;  1MJB A;  3I59 A;  2LKP A;  3E6D A;  3ZQ7 A;  1ZYR F;  4OIQ F;  4MQ9 F;  3EUH A;  4WCG A;  3BP8 A;  2E7X A;  3QP5 A;  4KMF A;  2ZME B;  2QZ8 A;  2L3D A;  3IWZ A;  2MLK A;  2NRA C;  1OMI A;  3DF8 A;  4D0P A;  4LB5 A;  5LHI A;  5AIP A;  2V9V A;  4EJV A;  2EFO A;  1RI7 A;  3ZMT A;  1ONV A;  5BPD A;  3CDH A;  3I0T A;  1ZN2 A;  3LQQ A;  2W85 A;  1ZGA A;  5J8F A;  4HOB A;  2FOK A;  2G7H A;  4M6X A;  2VC1 A;  2OD5 A;  4IXA A;  3P9C A;  2A69 F;  4U0V A;  3V8J A;  1XSV A;  3OOP A;  1T0F A;  2VN2 A;  3E97 A;  4L18 B;  1YQA A;  4LLG F;  5CVI A;  5FD6 A;  4AIJ A;  2XAG A;  4CO8 A;  2CQK A;  3BWG A;  3KP2 A;  2PI0 A;  3WU1 B;  4I09 A;  4AIK A;  4HYE A;  4OOI A;  1K78 B;  2CSO A;  5CVJ A;  1FOK A;  4RB3 C;  4QLC U;  2IT0 A;  3C1D A;  1ZG5 A;  4XLP F;  1FT9 A;  3ZMZ A;  2XAH A;  4YFX F;  5HLG A;  3C18 A;  3U9G A;  1VTN C;  3C3W A;  1OPC A;  1ZRC A;  1OKR A;  2Q8K A;  1IRF A;  2CFX A;  4HF1 A;  1HW1 A;  2P6T A;  3W6J B;  5E18 F;  3AAF A;  2A5Y B;  2KIM A;  3V7S A;  1F9N A;  3IKT A;  3ZN1 A;  1O57 A;  3E6C C;  2HZT A;  2D2W A;  1BIA A;  1IN4 A;  1S7O A;  3N4M A;  1HSJ A;  1YYV A;  3K2Z A;  2HYF A;  2FU4 A;  3G3Z A;  5LHG A;  4G8X A;  3F8B A;  2MH9 A;  1AOY A;  2R7D A;  4IRI A;  3T1B A;  5HLI A;  5FLX Z;  4G6D A;  1S29 A;  1QO0 D;  1LQ1 A;  4PGH A;  5EEG A;  2DU9 A;  3L00 A;  1MJ9 A;  3HOS A;  1QNT A;  2EFW A;  2DI3 A;  4I0B A;  2R3S A;  1MZB A;  2YU3 A;  1YLF A;  5HDK A;  5ILU A;  2IRF G;  2XVC A;  4M6Y A;  3R0A A;  1FP1 D;  2ZO4 A;  2D45 A;  2MA3 A;  1D3Y A;  4OMY A;  1MJA A;  1T38 A;  2BE5 F;  3EDP A;  1BIB A;  4IHS A;  4L0Y B;  3I4P A;  4IJA A;  3FWE A;  5ICG A;  3JW4 A;  4GGG A;  3Q9V A;  5H6R A;  4FX0 A;  2NNN A;  5D5W B;  4I98 B;  5E8G A;  3IRR A;  4EJO A;  2Q0O A;  2QYO A;  1R36 A;  1XD7 A;  2MD5 A;  2HOE A;  3LA2 A;  1W7P B;  1BJA A;  3J80 Z;  4M73 A;  2MH2 A;  2XHK A;  1WQ2 A;  2OQR A;  4KIB A;  4QWQ A;  2E1C A;  4AWX B;  2DLL A;  5E8I A;  2CYY A;  1FSE A;  5J8C A;  1YS7 A;  1UB9 A;  5L3F A;  1NHA A;  1FBS A;  5E1W A;  2QLZ A;  4EVI A;  4S05 A;  4YFN F;  5IT9 K;  2QQB A;  3CO6 C;  4ETS A;  2KJC A;  4EM2 A;  1CF7 B;  2VT3 A;  1AWC A;  1T39 A;  3MCZ A;  2XAS A;  4Q5S F;  4UHT A;  3MZY A;  5A2Q K;  1TQM A;  5DV5 A;  4KFC A;  2PN6 A;  4LG0 A;  3P9K A;  1W5T A;  3HUG A;  2K27 A;  2MBF A;  4MTD A;  4EJW A;  1QZZ A;  2MLG A;  4U0Y A;  3MEX A;  1TTY A;  2ISZ A;  3KLO A;  2Z9O A;  2QBY B;  1Z05 A;  5CLS A;  2VOD A;  5BOX A;  3KP6 A;  1S6L A;  5D5U B;  2K4B A;  4BXU A;  4I2O A;  4LLL A;  3FXQ A;  4AVP A;  4HLY A;  3WOD F;  4NHJ A;  1YO5 C;  3TO9 A;  2L01 A;  5L3C A;  3JAM K;  4N9H A;  1B6A A;  2RN7 A;  3E6B A;  5DYM A;  1D8J A;  3I5U A;  1J7K A;  5F64 A;  2WC2 A;  4OIP F;  2P8T A;  1O3S A;  3QAH A;  4KUM A;  5K5Q A;  3C7J A;  3R61 A;  1IN6 A;  3ECH A;  1FLI A;  5LHH A;  3BOQ A;  4I01 A;  4HQM A;  3EYY A;  3DPT A;  1ZG3 A;  4EQQ A;  2L4M A;  4G9Y A;  1WSU A;  4E70 A;  2RDP A;  1QZY A;  1BC8 C;  4G7O F;  4Z2Y A;  2HS5 A;  2K86 A;  2Z99 A;  1EH8 A;  1SD6 A;  5D6F A;  1U5T C;  5JR3 A;  2Z33 A;  4U0W A;  2OZU A;  1X3U A;  2FEZ A;  4I02 A;  1J75 A;  5HDG A;  3B02 A;  2OQG A;  3P9I A;  1B59 A;  4G6Q A;  1SFE A;  3CUO A;  2H6C A;  2NNY A;  2CO5 A;  4IRH A;  1KYZ A;  2YX4 A;  1QQI A;  4JQF A;  2YR2 A;  1PUE E;  1LB2 A;  5D4S A;  4A2U A;  1K6O A;  1FSH A;  5K5O A;  3Q9S A;  5BQT A;  3LQR A;  4MEY F;  4A5N A;  1Z6R A;  2W24 A;  4L9J A;  2EV5 A;  3M7G A;  2JPB A;  3I71 A;  3PQK A;  1BC7 C;  4K2E A;  4CIC A;  3ROU A;  1UCR A;  2O03 A;  2F5E A;  2FML A;  2XRO A;  4ZYD A;  4UVA A;  5LRR A;  1USS A;  2ZJ2 A;  2JSC A;  3FXR A;  2FE3 A;  2TDX A;  1HKQ A;  4BYY A;  4M72 A;  2BEO A;  2O6G E;  3BRO A;  3LA7 A;  3VB2 A;  1XMA A;  4N0B A;  3GVA A;  2W84 A;  3JTG A;  4WXD A;  5DD4 A;  3TQN A;  5L3D A;  2HYG D;  3KP7 A;  4LFU A;  4F7Z A;  2L02 A;  5L3G A;  5HS8 A;  4IPA A;  3ZMD A;  5ILS A;  3KEO A;  1R5H A;  3RYR A;  2M5W A;  5DUK A;  4CXF A;  3T0Y A;  1KQ9 A;  3GYH X;  2IA1 A;  3H3Z A;  2AS5 F;  4A6D A;  2STT A;  2O61 A;  1Z9C A;  4G7Z F;  3WTY C;  4HZF A;  3F21 A;  2DTR A;  2F5F A;  1BI2 A;  1F4K A;  2BV6 A;  4WWC A;  3H3U A;  5BMZ A;  4UVB A;  5DEQ A;  4HX4 A;  5DD8 A;  3V4G A;  3GFI A;  5FFX A;  2V6C A;  4FT8 A;  1BI1 A;  3LFK A;  2AXL A;  5J6X A;  4HAM A;  2GXG A;  3IKV A;  2PJP A;  3RKW A;  5DCM A;  2OAZ A;  4B09 A;  3J81 Z;  3E5U A;  1LNW A;  5L3E A;  5IT3 A;  2E1N A;  2V1U A;  1YIO A;  2ELH A;  3DV8 A;  1FBQ A;  3VFZ A;  2DFI A;  3RTR A;  1U8R A;  2GXB A;  2LDU A;  3ULQ B;  3HOT A;  2VXZ A;  5FLX K;  1LDK B;  3K69 A;  4MHG A;  1HQC A;  2RVC A;  1O3Q A;  2JZY A;  3GLX A;  4U88 A;  3VEP A;  5ICF A;  2P4W A;  4RS8 A;  2ZCW A;  1ON2 A;  2XKP A;  1IN5 A;  1B9N A;  1KYW A;  3WTT C;  2GIV A;  3DEU A;  3R4K A;  2COM A;  2BGC A;  4I7H A;  4HX7 A;  3KCC A;  3M9A A;  4L0Z B;  1XGN A;  2RKH A;  1Z6T A;  2RV8 A;  1IRG A;  5FD5 A;  2F2E A;  2IJL A;  2KIU A;  1KU9 A;  4WF2 A;  1V3F A;  2QM3 A;  4EGY A;  3W6K B;  5ILV A;  2QEN A;  3F8N A;  4BAY A;  4HQE A;  5HLH A;  3J80 K;  3WTV C;  2G7U A;  4ESB A;  5D8L B;  4RAZ A;  5CVR A;  1SFX A;  1IZ1 A;  3KP3 A;  1MDM B;  2M45 A;  2O8X A;  2A6E F;  3BPX A;  1BM9 A;  3WE2 A;  5E17 F;  5TRD A;  3HIF A;  2EWN A;  2XKO A;  4IHT A;  1R22 A;  4PZJ A;  2PLY A;  2DBB A;  4KN7 X;  3ELK A;  3DXJ F;  2XUB A;  4ON0 A;  1G3Y A;  5LEJ A;  4ZYH A;  3R6S A;  4N9I A;  3HRM A;  4LJZ F;  4YII A;  3V7C A;  5JHU A;  1P92 A;  1YW8 A;  1FP2 A;  1Y0U A;  2HDC A;  1JGS A;  2QQ9 A;  3FMS A;  5AON A;  3HSE A;  4KIC A;  4LK0 F;  3WTW C;  1ZAO A;  2EFN A;  3I59 B;  4XRF A;  2HKX A;  1ZLJ A;  5AIQ A;  1J59 A;  1R1U A;  1L0O C;  2R7F A;  5KK1 A;  2RC4 A;  2KKO A;  4WX9 A;  2ISY A;  1K79 A;  1R58 A;  1RNL A;  3J7A O;  2FF4 A;  2M30 A;  1ZGJ A;  2ESH A;  1YG2 A;  4KA4 A;  2ZXJ A;  3SHF A;  4DNC A;  3R0J A;  4HV6 A;  2KIF A;  1JXS A;  3JSO A;  4Q4Z F;  2ZBK A;  4YG2 F;  3B73 A;  4EM1 A;  3U2R A;  1W4M A;  2DW4 A;  4HX8 A;  3KZZ A;  3ZMU A;  4Y13 A;  1IXS B;  2F5C A;  3CJN A;  1R1T A;  3BJA A;  3EQL F;  4MEX F;  1FYL A;  3WG9 A;  2H6B A;  3F23 A;  4HV5 A;  3BJO A;  3HHH A;  4LD5 A;  4KIG A;  1S3J A;  4ZH4 F;  1LEB A;  4P9U A;  3T5X A;  1E17 A;  2PEX A;  4EM0 B;  1FWZ A;  1KQ8 A;  1FC3 A;  2ETH A;  3BJ6 A;  4XSX F;  1R7J A;  1YS6 A;  4R8H A;  2EJR A;  4BQA A;  3L7W A;  1B1B A;  4OU0 A;  1KU2 A;  4H0E A;  2FXA A;  1KU3 A;  2YSR A;  3ZMV A;  2STW A;  1I1G A;  3L2C A;  3TDU C;  1RUO A;  4ZYG A;  1U5T A;  2LSO A;  3QRF F;  3EYI A;  1BI0 A;  1H9G A;  1FX7 A;  1WRJ A;  2PBI A;  3VOD A;  4HBL A;  3QPT A;  3IL2 A;  1S8N A;  3HRT A;  1MKM A;  4I0A A;  1P4A A;  2YPR A;  4CHU A;  2IA0 A;  1BOA A;  2EA4 A;  1O7F A;  1O7L A;  1QPM A;  3KET A;  1P2F A;  4LB6 B;  5LRS A;  3DKW A;  1DUX C;  1PP8 F;  2VBZ A;  5K1Y A;  1B4A A;  2DT5 A;  3D0S A;  2W25 A;  4L9N A;  3CUQ A;  1PP7 U;  3LST A;  2IP2 A;  2DO7 A;  2YX7 A;  3V8K A;  4KIF A;  3IHU A;  2EFP A;  4P9F A;  5FB2 A;  3L09 A;  2BYV E;  4KYW A;  2FRH A;  1E2X A;  2IVM A;  3F8F A;  2W57 A;  4DQ2 A;  2XAQ A;  3L9F A;  2ZKZ A;  4HDV A;  4A0Y A;  5JFR A;  5LGT A;  4MGR A;  1EH7 A;  3SZP A;  2XGX A;  2VBW A;  3VOE A;  5CJ9 A;  4HDU A;  1ZRD A;  3J81 K;  4BHB A;  5F1R A;  2DK8 A;  3ZPL A;  1SD5 A;  2DPD A;  2HWV A;  5DUI A;  3HRS A;  4U7B A;  4CGZ A;  4M9X A;  1DPR A;  3KP5 A;  3GW2 A;  5BPI A;  2A3S A;  1XN7 A;  2A61 A;  5F6F A;  4YFK F;  5ICC A;  4EJU A;  2FSW A;  3T8T A;  2G9W A;  3E5X A;  3NQO A;  1XB4 A;  2Y75 A;  1SD4 A;  3JTH A;  2LNB A;  5DCF A;  1YFH A;  1FNN A;  3HSF A;  2QQA A;  2EV6 A;  2FBK A;  3FMR A;  4NB5 A;  4RGS A;  4UXN A;  1U3E M;  2XIG A;  2JTV A;  2OBP A;  3CLO A;  5D5V B;  1ZHF A;  4LG0 B;  3DP7 A;  3U1D A;  3IC7 A;  4KN4 X;  3K0L A;  2FNP A;  4GYG A;  2ZME A;  4B8X A;  1B9M A;  5LGN A;  1OYI A;  2PQ8 A;  4JBA A;  3FX3 A;  3I53 A;  3WGH A;  1FYK A;  1OYY A;  1D5V A;  1XSD A;  1UHM A;  2P7C B;  2H09 A;  5TJJ A;  2HTS A;  4RGR A;  4WK8 F;  1ZG1 A;  2M8E A;  4WXC A;  2HQR A;  3PQJ A;  2VOP A;  4A0Z A;  1I5Z A;  1MGT A;  1OR7 A;  4A12 A;  4FHT A;  2HKO A;  2X0L A;  5CVU A;  3DQV C;  4XSZ F;  5H6Q A;  1I1S A;  2XV4 S;  3QOP A;  4RB0 A;  1KA8 A;  1TBX A;  1LDJ A;  1H9T A;  5ED4 A;  3BY6 A;  1DDN A;  1FY7 A;  4M74 A;  1S7A A;  2NAZ A;  2HEO A;  3QPH A;  3HRU A;  3BDD A;  1L3L A;  4A6E A;  2VE9 A;  5HDN A;  1T98 A;  1BN5 A;  1HW2 A;  3O3K A;  3WGI A;  1I27 A;  2V79 A;  4HA8 A;  3LAP A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  3BCB A;  1K78 A;  5K7H A;  1WJD A;  1VQP I;  1RUN A;  3RQI A;  2OTJ I;  2CJJ A;  3TDZ C;  2W7N A;  4JX4 A;  3CJQ B;  2A05 A;  4BJT A;  1HC8 A;  4P96 A;  4M9Z A;  1DQU A;  4XID A;  3RI4 A;  4IRG A;  5EEA A;  1GUU A;  3QPS A;  1ZRE A;  3F3X A;  2GA2 A;  2DXI A;  4LLN A;  4XLN F;  1WJF A;  1WI9 A;  4MNU A;  2IW5 A;  4BE1 A;  3A1Y A;  2K85 A;  4XON A;  4C3H J;  2L7F P;  4OMZ A;  1S7E A;  4D7N A;  2XF7 A;  3GTP J;  4ZDP A;  5KAI C;  3EUA A;  1Z7U A;  2Q2E A;  1C0W A;  3MAJ A;  3LMM A;  3ECO A;  1Y1W J;  4BAC A;  1P6R A;  4L9V A;  3CDL A;  4XOT A;  3TKY A;  1IRX A;  4Q47 A;  2KDO A;  2L7Z A;  3OYM A;  3CTA A;  4L5E A;  1HDD C;  2ZSH B;  1P9Q C;  3CP8 A;  2R7X A;  2BZT A;  3OSG A;  2RQP A;  3TOB A;  4A3J J;  2GBY A;  5B1A H;  1IN7 A;  3MKL A;  2HXO A;  1IG7 A;  4NDL A;  5EG0 A;  4RA2 A;  4S04 A;  3KEQ A;  3S2D J;  3M8E A;  3TGN A;  5E1Z B;  3IAM 2;  4PFP A;  3FF5 A;  4XRM A;  3MWM A;  2X9D A;  3S2H J;  1R5G A;  2VPL A;  1OYW A;  2OA4 A;  2H27 A;  1J2X A;  1TNS A;  1LPQ A;  1GXP A;  2NS0 A;  3KFW X;  3QOE A;  4J00 A;  2LF8 A;  3JRE A;  4DBR A;  1Y8R B;  4CDG A;  2FUG 2;  3H0G J;  3KEY A;  2OJE D;  1XGO A;  2QCO A;  3FIS A;  2EIK H;  1HST A;  4AC0 A;  2F5D A;  2M2E A;  3LA3 A;  3GFL A;  2XSD C;  1W7P D;  4BH9 A;  3C2B A;  3G73 A;  4OIR F;  4EMS A;  5D8K B;  2X1E A;  1XSX A;  1TNT A;  4CYC B;  4AD9 A;  1YI2 I;  2B9S A;  4JP0 A;  1X2N A;  3Q5F A;  1ETW A;  1R23 A;  1FPQ A;  3FKI J;  4ABZ A;  4KNY A;  2CFO A;  3CC2 I;  2A68 F;  2DA5 A;  3MQ0 A;  3L2W A;  4E7K A;  3FMQ A;  2EQR A;  4CZZ A;  3S2W A;  2KT0 A;  4V2G A;  4Q48 A;  5E20 A;  3SXY A;  3D5L A;  3PNT A;  4D5F A;  2XDV A;  1VQN I;  3TO7 A;  1G3T A;  1GXQ A;  2J5O A;  2JRT A;  3GZ6 A;  2E35 A;  2VKV A;  3FK6 A;  4QIW N;  1V4R A;  2GZW A;  1Z91 A;  3ESW B;  3O2P E;  3LAJ A;  2RGV A;  1YJN I;  4ESF A;  2CGP A;  4XLH A;  3MD2 A;  3CCY A;  3BG6 A;  2M87 A;  4UUV A;  3ABT A;  4BDZ A;  2X4H A;  3SZG A;  1O4X A;  4CA0 A;  1LE8 A;  1G59 A;  2K7L A;  1WKM A;  3W2A A;  3HHG A;  3RYP A;  1RZ4 A;  1TW3 A;  1OCO H;  1W7P A;  3FHZ A;  2QUF A;  4LGW A;  4XMY A;  5D6E A;  5DS9 A;  1T56 A;  3CCJ I;  1W0T A;  1JJ8 C;  2LY2 A;  2GAU A;  1YOV B;  3ZQH A;  3I4M J;  1EKE A;  3ZRG A;  3A01 A;  6PAX A;  3HSR A;  4NC7 A;  3WHC A;  3HM5 A;  1Z0X A;  2GLO A;  2Y48 A;  2K02 A;  1PJR A;  2AXT C;  2D1V A;  3WE3 A;  2ESN A;  4RB1 A;  3RDI A;  4EEF G;  1O3R A;  1R00 A;  2JSP A;  3ABU A;  4A93 J;  1V5F A;  3VSL A;  3G1L A;  5EGO B;  2LVS A;  3EUH C;  2Y0S A;  2FBH A;  2CV2 A;  3I64 A;  3HOW J;  1NK3 P;  2LRD A;  3DPU A;  2EIJ H;  3HC7 A;  1R49 A;  4C3I J;  2CW7 A;  3IWF A;  3KP4 A;  5EZH A;  1RR8 C;  4UNO A;  2ICW G;  2NOJ B;  5DCM B;  1HKS A;  2HTJ A;  4ENN A;  1MBK A;  5F08 A;  2CQN A;  3JRF A;  2H1K A;  3CCM I;  2V26 A;  1CF7 A;  3GME A;  2KQR A;  2ZNZ A;  2M4G A;  2PG4 A;  4E7L A;  1MSF C;  5KVR A;  4Y15 A;  1FTT A;  4ZZL A;  2P5V A;  4P55 A;  1WCM J;  4FX4 A;  3HPG A;  4OAZ A;  4XOR A;  3WU0 A;  1HXD A;  4Y17 A;  3H35 A;  4O5V A;  4UV9 A;  1X3W B;  2ZFW A;  5LLQ A;  3S3O A;  4EV0 A;  1IDY A;  4RGX A;  1LJ9 A;  5FGM A;  1XGM A;  3GFM A;  2LTP A;  5E3L A;  3DTI A;  2QBY A;  2R92 J;  5K5R A;  1IUY A;  2VE8 A;  3K70 C;  2V1X A;  3JRG A;  2DOA A;  1ZH5 A;  2HI3 A;  1JT6 A;  2KRC A;  1P4W A;  4ASN A;  2UWM A;  3E7L A;  4E4H A;  1D1C A;  5GAG J;  4BE2 A;  1T6S A;  4ANJ A;  2H94 A;  5B66 C;  3BT9 A;  4CSW A;  2O8K A;  1IXC A;  2IEK A;  2NS8 A;  4O3M A;  1ETO A;  2CUZ A;  3ABL H;  4JX6 A;  2MG4 A;  4L5I A;  1EH6 A;  2JQ7 A;  4QTR A;  4MTE A;  2ID6 A;  4LK1 F;  4BU2 A;  3F8C A;  3DBR B;  1GVJ A;  2CW0 F;  1A04 A;  1ON1 A;  3WGG A;  3F72 A;  4CCM A;  1JT0 A;  3NWT A;  3GF2 A;  1I3Q J;  1FYM A;  2KL4 A;  2EA2 A;  1QGP A;  4GCV A;  1CGP A;  4AYB N;  1XGS A;  2M8G X;  3DPL C;  5GTI C;  4IKF A;  5FLM J;  4MQV A;  1XCV A;  5F0H A;  1FIA A;  2QGU A;  4ZYE A;  2XAJ A;  4O6J A;  4KT6 A;  3K1M A;  2CUE A;  3K4J A;  4L5J A;  4GYI A;  3I54 A;  1ETV A;  5CKT A;  3O8H A;  1H0M A;  1D8K A;  2WTE A;  2DQR A;  2WY7 Q;  1HKT A;  3HOZ J;  3F22 A;  1WWX A;  2VOO A;  4HF2 A;  2FQ4 A;  3BR0 A;  3VYR B;  1U6G A;  2BVM A;  2Y69 H;  2DYR H;  2TRT A;  2L7M P;  4BNC A;  3GUD A;  4KMU X;  2FA5 A;  2P5L C;  1SFU A;  2FQ3 A;  5J1U A;  5HS9 A;  1XS9 A;  4P5O A;  4UV8 A;  4HF0 A;  3QU6 A;  4RBO A;  5K7Z A;  3ML6 A;  3AL0 C;  1A5J A;  1ERD A;  1E3H A;  1IXR C;  2LP0 A;  5H20 A;  1SAX A;  3JR9 A;  2GA1 A;  2VQH A;  3OYN A;  1LFP A;  3HKZ A;  2FBI A;  3K1N A;  3GTQ J;  4KT5 C;  5FO5 A;  2VON A;  3LNQ A;  2KRF A;  3SZT A;  1R5I D;  4HLX A;  2CQQ A;  4IHX A;  1NTC A;  1H8A C;  3DTK A;  3F6V A;  2CMP A;  1DP3 A;  2GWR A;  3WTX C;  2PFB A;  3K6G A;  3PO2 J;  2MW8 A;  2XRN A;  4HW0 A;  1YTY A;  1QZE A;  3JSP A;  2W00 A;  4IHW A;  2UXX A;  4AUX A;  3SEZ A;  2CQ7 A;  5DTD A;  2M0M A;  2VJJ A;  2EB7 A;  2CV0 A;  2KZG A;  3KZI C;  3OOU A;  3ISP A;  2JVG A;  4WXH A;  2E71 A;  5FFZ A;  3C2G A;  3MFK A;  2UZK A;  4XLF A;  2X51 A;  1W1W E;  2ACJ A;  1MD0 A;  4IHV A;  4JX5 A;  2BOL A;  2Y0M A;  1G3S A;  2O0Y A;  1LDD A;  3AL0 B;  1ODD A;  1JHF A;  5CYV A;  3WTS C;  1U78 A;  4CH7 A;  2ZJP F;  3OS0 A;  2DAO A;  1TQI A;  2L7K A;  2O3F A;  3JCU C;  1LVA A;  3DU6 A;  5LBQ A;  3GXO A;  2QVO A;  3E5Q A;  4YIF A;  2E34 A;  2K5C A;  3NRV A;  2ECC A;  1SAN A;  1X1P A;  1PDN C;  5B3S H;  1O3T A;  2OCC H;  2HOT A;  2XC7 A;  3OYI A;  1VQK I;  1D0X A;  1R9T J;  2M1B A;  2BBY A;  4F92 B;  5HS7 A;  3QP6 A;  5J47 A;  2LYC A;  3D5R C;  3BPV A;  3HOU J;  1X1C A;  3CCR I;  2A6H F;  3CO7 C;  1J0R A;  1ULY A;  1XG1 A;  3GZ5 A;  3KX2 A;  1XMX A;  5EYR A;  1XX5 A;  2K4J A;  2IS6 A;  5LEK A;  3LWF A;  4G94 A;  1YW7 A;  3FM5 A;  5IP6 A;  2JN6 A;  1SMT A;  3I58 A;  4BEH B;  3M1E A;  4R1H A;  4D1Q A;  2GIZ A;  2ZNY A;  3WHB A;  3S15 J;  1IW7 F;  4RLQ A;  5CQG A;  1AKH A;  2D1H A;  1OCR H;  1W5S A;  2VB6 A;  4X1E A;  3G6E I;  2RNJ A;  2JA2 A;  1WJ5 A;  2GXA A;  1JHH A;  4D9J A;  2F6C A;  2VBY A;  3ZMS A;  2X6X A;  2CRG A;  3HGG A;  2HQ5 A;  5LFA A;  1A31 A;  1LUJ B;  3WTZ A;  3S17 J;  4Y7N J;  2V1D A;  1TLH B;  4DZJ A;  3X2Q H;  4CYD A;  2M4K A;  3R60 A;  3J7A Y;  4LMY A;  3UKG A;  3TO6 A;  1IN8 A;  1P4X A;  2MC3 A;  1DPU A;  3KYC B;  3OV8 A;  3LSG A;  3H5R A;  3FZV A;  2M7A A;  2UXN A;  1YX3 A;  3REO A;  5L3B A;  5EEH A;  4E7I A;  1VQO I;  1TQP A;  2E5Z A;  3E6M A;  1D0Y A;  3F0C A;  2H1L A;  3P7N A;  2QQ8 A;  2XSJ C;  5GAD J;  1J5Y A;  2ZB9 A;  1KGS A;  2NVY J;  2OTL I;  1KZH A;  2Z1D A;  3BZ6 A;  1UST A;  5E1X A;  3L1P A;  1S72 I;  2LY1 A;  2EFQ A;  2OZ6 A;  4IOC F;  3E0J B;  1BI3 A;  1REP C;  1OFC X;  2E7W A;  2EV0 A;  4AIH A;  1WHU A;  4A69 C;  4A5M A;  1X2M A;  1GT0 C;  3WU2 C;  5FKL A;  1ZRF A;  3UNG C;  1SMY F;  3ERE D;  3GX4 X;  1P7I A;  3A03 A;  4IL6 C;  3F8M A;  4PFO A;  4FQG A;  2IA2 A;  3H92 A;  2J5P A;  1YRN A;  1HW5 A;  3COA C;  2CWE A;  3IV5 A;  5LGU A;  4ENM A;  3QU3 A;  2FJ1 A;  2FOW A;  5IY5 H;  5HVQ C;  3WTU C;  4PGG A;  3LSP A;  2BY2 A;  2WAQ A;  3SFZ A;  3HYI A;  3RKX A;  3S1R J;  5GPC A;  4BHC A;  3CQZ J;  1TW2 A;  3GFJ A;  2PX9 A;  4BHP A;  1JE8 A;  2HGC A;  4EJT A;  2QWW A;  1ZQ3 P;  2JPC A;  2K9M A;  5D5X B;  2KPM A;  3GWZ A;  2W48 A;  2PJR B;  2M0C A;  4XRS G;  1EV7 A;  1S5L C;  2KHM A;  3O6B B;  3M07 A;  2JA7 J;  3KLN A;  1KQ0 A;  1W36 C;  2C6Y A;  3ZCO A;  3ZXS A;  1ZLK A;  4LIT A;  3HTU A;  4F91 B;  5B1B H;  2VI6 A;  2NS7 A;  5GAH J;  4A0X A;  1R1V A;  3E3V A;  2NXN B;  3PFI A;  2WV0 A;  1Q1H A;  5M5W J;  1XPX A;  1IAW A;  4P1W A;  3ZN0 A;  3F6O A;  4FE7 A;  2Z5U A;  3OYB A;  3D5S C;  2RRE A;  1YW9 A;  3RKY A;  2FNA A;  1TZL A;  3PFY A;  1U5T B;  3FBN B;  3IRQ A;  2JT1 A;  1F1Z A;  1NG6 A;  3HEF A;  3OYG A;  1FZP B;  1HBX G;  4GO1 A;  2KJB A;  3ZQG A;  2Z2S B;  2V7F A;  2VT2 A;  3SQN A;  3VPR A;  4OIN F;  4EAT A;  1K7A A;  3N97 A;  2A07 F;  2R7W A;  1ORK A;  5IT9 Z;  1F5T A;  3PNV A;  3JRB A;  2DOD A;  4UVC A;  5FJ8 J;  4NQW A;  5CVV A;  3VYU B;  4ZDO A;  2LMD A;  3DEW A;  4PJL A;  1X4O A;  2DA6 A;  1RIO H;  4G7H F;  3CUQ C;  1FBU A;  1SD7 A;  3OR1 C;  5A2Q Z;  4TV7 A;  2P0W A;  5FLV A;  3OS2 A;  1YIJ I;  2HFH A;  3FXU A;  4ENK A;  2JA8 J;  2PMU A;  2VKH A;  4BE0 A;  3HBL A;  4MIM A;  5FRM A;  2L5Q A;  3BQZ A;  4IVN A;  4GXO A;  1LEA A;  3M8F A;  4M9S A;  2EK5 A;  4IF4 A;  2DQL A;  2P6S A;  1I6H J;  1Y56 A;  2NVX J;  2ELK A;  4QPO A;  1U2W A;  4RM3 A;  2DA4 A;  3K1P A;  4XBF A;  3V7R A;  1XDS A;  1MBJ A;  1I6X A;  4L9T A;  2XB5 A;  1G3W A;  3OIO A;  1KU7 A;  4M71 A;  1F36 A;  4PSW A;  4ENJ A;  1VND A;  3BTJ A;  5HOO A;  1J9I A;  2CG4 A;  4OIO F;  2M34 A;  3H0D A;  2ECB A;  3BR2 A;  2DJN A;  2VXD A;  3CUQ B;  4KDP A;  1GHC A;  1XDU A;  1XCB A;  3JAM Z;  3JRA A;  1XMK A;  2R7Z J;  2LRE A;  4RGU A;  2GQQ A;  3KE2 A;  3HG9 A;  4UUS B;  2K9S A;  5C3E J;  2KZV A;  1SFO J;  2NYX A;  3TOA A;  3T8R A;  1BR2 A;  1TWF J;  1STZ A;  2AO9 A;  4FAS D;  1QBJ A;  4GRI A;  2L54 A;  3DFG A;  5HLT A;  2R0Q C;  4PDK A;  5JI6 A;  4ESJ A;  3GEZ A;  2HR3 A;  2IS1 A;  1G6N A;  1NG7 A;  2LOO A;  2BXY A;  2DA3 A;  4IHY A;  2VC0 A;  1DP7 P;  1SEU A;  2G0E A;  3TW7 A;  2HYJ A;  3SDG A;  3NEU A;  1PUF B;  1WJC A;  4XR6 A;  5DDG A;  2CH0 A;  2ZJR F;  3TED A;  5D4R A;  4RAG A;  3RPQ A;  1ACI A;  4DYR A;  4ITV A;  1Z67 A;  5E3N A;  1MDM A;  1NH3 A;  2LF7 A;  4UB6 C;  3V8L A;  3ZP5 A;  3BCA A;  3A4C A;  2ADU A;  4D5C A;  4F93 B;  4H4K C;  1Z1D A;  1GV5 A;  2IPQ X;  3ZR8 X;  2DK5 A;  1EJ9 A;  4LIU A;  3FK7 A;  3RJP A;  1ZAR A;  4RAY A;  3AKZ A;  3GO5 A;  2IGK A;  2Q1Z B;  1OCT C;  4BJ5 C;  1SVL A;  3DBH B;  3OYK A;  5BS6 A;  1UG2 A;  3RPU A;  2IS2 A;  3M4O J;  2HOA A;  4U7D A;  1IF1 A;  1G4D A;  1QA6 A;  2DPU A;  1J09 A;  1G2H A;  4RB2 C;  2M9H A;  2L4A A;  3HTS B;  1DU6 A;  1UZC A;  1MMA A;  1T8I A;  4EGZ A;  2P5K A;  1BBY A;  5M3M J;  3G71 I;  1UHW A;  2WWY A;  1UFM A;  2JUG A;  2VBX A;  2DA1 A;  1N78 A;  1E3P A;  4BUP A;  3I3L A;  3H9J A;  4R79 A;  1IRZ A;  5M3F J;  5F27 A;  4RLF A;  2CW8 A;  2Z3Y A;  5H2F C;  2A6T A;  2ZME C;  2PMH A;  2XAF A;  3CD6 I;  3FM3 A;  4PCQ A;  5JVT A;  5ICE A;  3KZY A;  5ERI A;  2P7V B;  2W4S A;  4BXF A;  4ZZD A;  1MBG A;  3MZH A;  1FOX A;  2V9P A;  2PMZ A;  3RIR A;  1IV8 A;  1T2K A;  1IUF A;  1EA3 A;  3MN2 A;  3EET A;  2HQN A;  4II2 A;  4JK1 X;  2B0L A;  2FMY A;  3K9T A;  4W1U A;  1MJB A;  1W0U A;  2P81 A;  3HOV J;  4XNF A;  3I59 A;  4B3A A;  1EF4 A;  2LKP A;  3CF2 A;  3CP2 A;  3E6D A;  3ZQ7 A;  2VJ4 A;  5JLW A;  1TT0 A;  1ZYR F;  4OIQ F;  3K70 D;  4MQ9 F;  3EUH A;  3DBL B;  1VQL I;  2K3P A;  3SEQ A;  3ASO H;  4WCG A;  1FTZ A;  3BP8 A;  2E7X A;  3SYT A;  1OR7 C;  2HPI A;  1B8I A;  3QP5 A;  1JTX A;  2ELJ A;  3Q3S A;  5IP7 J;  2ZME B;  2QZ8 A;  4KMF A;  2L3D A;  5F04 A;  3IWZ A;  1D5Y A;  2MLK A;  2NRA C;  1OMI A;  3DF8 A;  4PUS A;  4D0P A;  3GTO J;  4LG3 A;  4LB5 A;  3N05 A;  5LHI A;  5AIP A;  2V9V A;  4EJV A;  4II3 A;  2DMP A;  2EFO A;  2LBF A;  1RI7 A;  3CES A;  3ZMT A;  1ONV A;  2L2O A;  4C3J J;  5BPD A;  1BW6 A;  2RNG A;  5J1R A;  3CDH A;  1ZEL A;  3IAS 2;  2BW3 B;  1QVT A;  3I0T A;  1ZN2 A;  3LQQ A;  2W85 A;  1ZGA A;  5J8F A;  3K4L A;  1R4N B;  3I55 I;  2AHQ A;  4HOB A;  2FOK A;  2W82 A;  1AU7 A;  1MNM C;  4B44 A;  2G7H A;  5CPR B;  3PIO F;  2D5V A;  2K3F A;  4M6X A;  2VC1 A;  2OD5 A;  3BZC A;  4IXA A;  3P9C A;  2A69 F;  5FKK A;  4U0V A;  4ZTJ A;  1MSE C;  1Y6I A;  3V8J A;  2YUS A;  3ZQQ A;  1XSV A;  4UUT A;  3OOP A;  1T0F A;  2R7U A;  4BL0 B;  1MND A;  3PIP F;  1Y1V J;  4XKC A;  2VN2 A;  3E97 A;  4L18 B;  1K4S A;  2M3A A;  1YQA A;  4LLG F;  5CVI A;  5FD6 A;  2HU9 A;  3I56 I;  2X48 A;  4AIJ A;  5DM7 F;  1LFU P;  2E2I J;  2XAG A;  5E3O A;  1HOM A;  2UUZ A;  3OIP A;  4A3L J;  2GOX B;  2A5W A;  2BY1 A;  4CO8 A;  2CQK A;  3BWG A;  3KP2 A;  4YEL A;  2PI0 A;  3WU1 B;  2ID3 A;  2VPR A;  1MMG A;  2XB0 X;  3OMY A;  4I09 A;  4AIK A;  1JI8 A;  4HYE A;  4OOI A;  1K78 B;  3CLQ A;  2CSO A;  5CVJ A;  3UR3 C;  1FOK A;  4RB3 C;  4S0H B;  4BS9 A;  3G1O A;  4QLC U;  2IT0 A;  2HOS A;  3C1D A;  1ZG5 A;  4XN0 A;  2Y30 A;  1FT9 A;  3ZMZ A;  4XLP F;  2XAH A;  4OWR B;  4YFX F;  5F0C A;  2DT7 B;  5HLG A;  2HVR A;  5KCM A;  3C18 A;  2F5V A;  3O8G A;  1YIT I;  2CU7 A;  3AG1 H;  4NNJ A;  3U9G A;  2NOG A;  1VTN C;  4FCY A;  3C3W A;  1OPC A;  1ZRC A;  1OKR A;  3A02 A;  2Q8K A;  4ZC3 A;  1IRF A;  2CFX A;  4HF1 A;  2ZXI A;  1HW1 A;  2P6T A;  3W6J B;  5E18 F;  3MKY B;  1G8X A;  3AAF A;  2A5Y B;  2KIM A;  3V7S A;  1F9N A;  9ANT A;  3IKT A;  2LG4 A;  3ZN1 A;  2Q2E B;  1O57 A;  3E6C C;  2NVQ J;  2HZT A;  3F9K A;  2VUM J;  2D2W A;  3ZQL A;  4QSH A;  1BIA A;  1IN4 A;  1S7O A;  3VSK A;  3V42 A;  2H8R A;  2XF5 A;  3N4M A;  1HSJ A;  3GBG A;  2KFD A;  1YYV A;  2L9N A;  1UJ8 A;  4JYK A;  1T33 A;  3HZJ A;  3K2Z A;  2HYF A;  2FU4 A;  4GDF A;  3G3Z A;  5LHG A;  2OF7 A;  4G8X A;  1M1E B;  2XPW A;  3F8B A;  2MH9 A;  4HST A;  1AOY A;  5EG0 B;  3JRC A;  4HNU A;  3RZD J;  1APL C;  1X3Z B;  2DFE A;  4NC6 A;  2R7D A;  4IRI A;  1MBE A;  3H9G A;  4IZZ A;  3MMY B;  3L2R A;  3T1B A;  1RET A;  5HLI A;  5FLX Z;  5GTH C;  2E1M C;  4A3D J;  4QPQ A;  4G6D A;  5J4V A;  1ZKG A;  1S29 A;  1QO0 D;  1LQ1 A;  4PGH A;  5EEG A;  2DU9 A;  3L00 A;  1MJ9 A;  1Z3Y A;  3HOY J;  2XAU A;  3HOS A;  1RKW A;  1QNT A;  1TWA J;  2EFW A;  2HDW A;  2X1C A;  2DI3 A;  5DM6 F;  4I0B A;  1IC8 A;  2R3S A;  4G6T B;  1MZB A;  3EPZ A;  2YU3 A;  1YLF A;  5HDK A;  5ILU A;  4UB8 C;  2IRF G;  3VYT B;  2XVC A;  1SFK A;  3R0A A;  4M6Y A;  1FP1 D;  3BR1 A;  2JA6 J;  2ZO4 A;  1SVM A;  2D45 A;  2MA3 A;  2HDD A;  1D3Y A;  3BLY A;  3QYF A;  1MJA A;  4OMY A;  3GLL A;  1T38 A;  1YE9 A;  1RKT A;  2BE5 F;  3EDP A;  2E1M B;  1BIB A;  4HSR A;  4IHS A;  1BA5 A;  4L0Y B;  3I4P A;  4IJA A;  3FWE A;  1POG A;  5ICG A;  3TBI A;  3JW4 A;  3A2K A;  3WG7 H;  2X6Y A;  3S93 A;  5M5X J;  4GGG A;  2TCT A;  2DA2 A;  2VQL A;  3Q9V A;  5H6R A;  4FX0 A;  2F4O B;  2NNN A;  3OR2 C;  4NC8 A;  5D5W B;  1B72 A;  4IX7 A;  3KIO A;  4I98 B;  5E8G A;  3IRR A;  1MH3 A;  4EJO A;  1QU3 A;  2DTZ A;  2Q0O A;  1QHH D;  4U87 A;  1UMQ A;  2QYO A;  1R36 A;  1LE8 B;  3CCU I;  3FXM A;  4PJM A;  2ME6 A;  4BBR J;  1XD7 A;  1GV2 A;  2AQE A;  1IO2 A;  2MD5 A;  2HOE A;  3LA2 A;  1W7P B;  3PJR A;  5M5Y J;  1BJA A;  3DTE A;  1Y39 A;  3HOX J;  3J80 Z;  3KYL A;  4M73 A;  2MH2 A;  2XHK A;  1WQ2 A;  3A01 B;  4PSX A;  2OQR A;  4KIB A;  2Y9Z A;  1W36 D;  4QWQ A;  2E1C A;  3E1S A;  2DLL A;  4AWX B;  5E8I A;  2QSG X;  2Y0S N;  2X6O A;  3S1N J;  2CYY A;  1DGR M;  2QKL B;  1MW7 A;  2ZXW H;  1FSE A;  5J8C A;  1YS7 A;  1ZR4 A;  1UB9 A;  5L3F A;  5EF6 A;  1K83 J;  1NHA A;  4IQ4 A;  1FBS A;  5E1W A;  2QLZ A;  4EVI A;  4S05 A;  4YFN F;  5IT9 K;  1VZ0 A;  2QQB A;  3PUB A;  3CO6 C;  2R5Z A;  4ETS A;  4YIR X;  2BVL A;  2LFB A;  2KJC A;  4EM2 A;  1CF7 B;  2VT3 A;  1AWC A;  1YJW I;  3G4S I;  1T39 A;  3MCZ A;  1X4P A;  2XAS A;  4Q5S F;  3S1M J;  4UHT A;  1VQ9 I;  3MZY A;  1I50 J;  5A2Q K;  4Y33 A;  1TQM A;  2X6W A;  5DV5 A;  4KFC A;  1GLN A;  1JUP A;  2PN6 A;  3Q0V A;  1Y8Q B;  4LG0 A;  3P9K A;  1W5T A;  3HUG A;  2K27 A;  2MBF A;  4MTD A;  4EJW A;  2ZJQ F;  2VJ5 A;  1QZZ A;  1OIS A;  2MLG A;  4U0Y A;  3FIW A;  1TTY A;  2DA7 A;  3MEX A;  4PJN A;  1H88 C;  2ISZ A;  3KLO A;  3OYH A;  2Z9O A;  2QBY B;  1Z05 A;  5CLS A;  2VOD A;  5BOX A;  2KP6 A;  3KP6 A;  1S6L A;  5D5U B;  3S32 A;  2K4B A;  4BXU A;  2R93 J;  4I2O A;  4E7Z A;  3PUF A;  3LOC A;  2F4I A;  4C2T A;  4F52 A;  2EIN H;  2K40 A;  4LLL A;  1H89 C;  2X1D A;  3FXQ A;  4DZP A;  3PNY A;  4AVP A;  4HLY A;  3CJT B;  2E19 A;  3WOD F;  4E6K G;  4NHJ A;  1YO5 C;  3TO9 A;  2L01 A;  5L3C A;  3JAM K;  2DT6 A;  3U1K A;  4N9H A;  2KIQ A;  1B6A A;  2RN7 A;  1MBF A;  4F3Q A;  1JUM A;  2JMW A;  2IXS A;  3E6B A;  5DYM A;  5GP9 A;  1D8J A;  1PVE A;  1RR7 A;  1P7J A;  2EZK A;  3I5U A;  1J7K A;  5F64 A;  2LR8 A;  4YEJ A;  2MD0 A;  4FIS A;  3H3V K;  2E5N A;  2WC2 A;  1OLT A;  4OIP F;  2P8T A;  1WVR A;  1O3S A;  5E79 C;  3QAH A;  4KUM A;  5K5Q A;  3C7J A;  1A36 A;  3R61 A;  1IN6 A;  3ECH A;  3GTM J;  4A3B J;  3JRH A;  1FLI A;  4N4N B;  5LHH A;  3BOQ A;  4I01 A;  5TGT A;  4ZDL A;  5C4J J;  2R5Y A;  1MH4 A;  2ZXH A;  4XK4 A;  4HQM A;  3EYY A;  3DPT A;  1ZG3 A;  4EQQ A;  3S14 J;  2L4M A;  4G9Y A;  4A3K J;  1WSU A;  4E70 A;  2COB A;  4XIC A;  1CQT A;  2RDP A;  1QZY A;  1V54 H;  3B6C A;  1BC8 C;  3CC7 I;  2KLO A;  4G7O F;  2KIS A;  3GTL J;  4Z2Y A;  2HS5 A;  2K86 A;  2Z99 A;  2IGM A;  2MGQ A;  4M3G A;  2IAI A;  1EH8 A;  1SD6 A;  5D6F A;  1U5T C;  3BG3 A;  2HQA A;  3HKZ N;  3HL2 A;  3PM1 A;  5JR3 A;  3A0H C;  4F55 A;  2Z33 A;  4U0W A;  2OZU A;  2F48 A;  1WH7 A;  4XLA A;  1U0J A;  4AVZ A;  1X3U A;  2FEZ A;  4I02 A;  1ITY A;  1J75 A;  5HDG A;  1V5E A;  3B02 A;  2DDA A;  4DOZ A;  2OQG A;  3P9I A;  1B59 A;  3OWT A;  3EUK L;  1BR4 A;  3L2U A;  4J19 A;  4G6Q A;  1SFE A;  1VQM I;  3CUO A;  2H6C A;  3OYC A;  5J1Y A;  2NNY A;  4V2F A;  5J4Y A;  1VQ8 I;  2CO5 A;  4IRH A;  3DKX A;  1KYZ A;  2YX4 A;  1QQI A;  3KYD B;  4A3M J;  2XGD A;  2ZFU A;  1YHQ I;  4JQF A;  2YR2 A;  3MKZ A;  1PUE E;  5C4X J;  2RQQ A;  1UHS A;  1LB2 A;  2E1O A;  5D4S A;  3OYD A;  4A2U A;  2WA0 A;  3H1C A;  3Q0U A;  2R7O A;  1K6O A;  1D1B A;  2BY0 A;  1FSH A;  5K5O A;  3Q9S A;  4RDU A;  3AG3 H;  3LQR A;  5BQT A;  4MEY F;  3L2V A;  4A5N A;  1Z6R A;  2W24 A;  2FX0 A;  4L9J A;  2EV5 A;  2LK2 A;  3M7G A;  2JPB A;  3I71 A;  3PQK A;  2E60 A;  1IDZ A;  3OYL A;  1RES A;  3BG9 A;  2L9V A;  4FE4 A;  4B47 A;  1BC7 C;  4K2E A;  3TW6 A;  3ROU A;  4CIC A;  1UCR A;  2O03 A;  2F5E A;  4Y3O A;  2FML A;  2XRO A;  4ZYD A;  2DFF A;  4UVA A;  4ZTF A;  5LRR A;  1USS A;  3QPL A;  3W2V A;  1K61 A;  2ZJ2 A;  2JSC A;  3ABK H;  1AKH B;  2VLA A;  1N25 A;  3G2B A;  3LSH A;  1VI0 A;  3FXR A;  4BGD A;  2FE3 A;  2N8G A;  2TDX A;  1HKQ A;  3SFI A;  3K2A A;  1AA7 A;  4BYY A;  4BKX A;  4M72 A;  1KON A;  2BEO A;  2O6G E;  2X85 A;  4HRI A;  3BRO A;  3LA7 A;  3MVP A;  1FMV A;  3VB2 A;  1QPI A;  1XMA A;  4N0B A;  3GVA A;  5IYB J;  2W84 A;  5E3M A;  2DOF A;  3GCM A;  3JTG A;  2VQG A;  3K4N A;  5FKN A;  1X1D A;  4CYC A;  2O9L A;  4WXD A;  4D7M A;  5DD4 A;  3TQN A;  5L3D A;  4DIQ A;  3M8J A;  3MKW B;  2HYG D;  3DLA A;  3CCV I;  1V5G A;  1WJE A;  3OYE A;  4RM2 A;  1ZR2 A;  3KP7 A;  4LFU A;  1MMS A;  4F7Z A;  2KMU A;  2L02 A;  5L3G A;  2WAE A;  4IPA A;  3ZMD A;  5HS8 A;  5HNH A;  5ILS A;  3KEO A;  1R5H A;  3RYR A;  2M5W A;  1WH5 A;  5DUK A;  2MYS A;  2XGC A;  2XRL A;  4A3G J;  4Y52 J;  4CXF A;  3T0Y A;  3GTK J;  4KIS A;  3ZQC A;  1KQ9 A;  2LKS A;  2WAD A;  3GYH X;  2IA1 A;  3H3Z A;  2AS5 F;  4A6D A;  3ZOB A;  2STT A;  2GOM A;  3D1N I;  1Z9C A;  2O61 A;  4G7Z F;  2VJI A;  4ZJZ A;  5B5E C;  1YRN B;  3WTY C;  4HZF A;  1I3A A;  3F21 A;  4N4O B;  2WAQ N;  2DTR A;  2BXZ A;  2F5F A;  1BI2 A;  2OUM A;  1F4K A;  1UEL B;  2BV6 A;  4HNT A;  4WWC A;  3H3U A;  5BMZ A;  4UVB A;  3H5N A;  1HF0 A;  1D0Z A;  4BQN A;  2Z16 A;  5DEQ A;  3H5A A;  4HX4 A;  5DD8 A;  3V4G A;  4AID A;  3GFI A;  4YRV A;  3ASN H;  3S3M A;  2CV1 A;  5FFX A;  3LSK A;  2V6C A;  2NVU B;  1TWG J;  4FT8 A;  2CUJ A;  1BI1 A;  3GTJ J;  3LFK A;  2AXL A;  4HEA 2;  4DYQ A;  5J6X A;  5EGO A;  1WFX A;  4HAM A;  5C44 J;  3OYF A;  1DGW Y;  4MLO A;  1QVU A;  2GXG A;  3LSJ A;  3RQ4 A;  5F0F A;  3IKV A;  2PJP A;  3RKW A;  2WB1 N;  5DCM A;  2OAZ A;  4B09 A;  3J81 Z;  2LD5 A;  3E5U A;  5FKM A;  3BG5 A;  4M3F A;  4LIV A;  2IS4 A;  1LNW A;  5L3E A;  3DKY A;  5IT3 A;  2E1N A;  2WAF A;  4DJA A;  2V1U A;  1T08 B;  1YIO A;  3HB9 A;  3S8P A;  1MMD A;  2ELH A;  3DV8 A;  1FEX A;  2WY8 Q;  1FBQ A;  3VFZ A;  2DFI A;  3RTR A;  3ONQ A;  1U8R A;  2GXB A;  2LDU A;  3ULQ B;  3BR3 A;  3I4N J;  3HOT A;  2JRM A;  1RRJ A;  2VXZ A;  5FLX K;  3CF5 F;  1LDK B;  3K69 A;  3OYJ A;  3CMA I;  2XPU A;  2K9L A;  1BW5 A;  3J7Y J;  1JKQ C;  4MHG A;  4IEJ A;  4BY1 J;  4BDY A;  1HQC A;  2OPT A;  4NQW B;  2RVC A;  4W97 A;  3TP3 A;  1O3Q A;  2VKE A;  2JZY A;  3GLX A;  4U88 A;  1OCC H;  1W5C C;  3VEP A;  4I99 C;  5ICF A;  2JVH A;  3BQY A;  2P4W A;  3G1M A;  3I9V 2;  4RS8 A;  4ZYA A;  1UAA A;  4BQO A;  2ZCW A;  1ON2 A;  2XKP A;  1IN5 A;  1B9N A;  1KYW A;  3BZK A;  3WTT C;  1A6Q A;  2GIV A;  2QEX I;  1ETQ A;  2OC6 A;  3S1Q J;  3ZGK A;  2XF6 A;  4XL9 A;  3DEU A;  3R4K A;  5IYD J;  3P5J A;  3SJM A;  2COM A;  2BGC A;  4I7H A;  3FBI B;  4HX7 A;  1ZTR A;  3KCC A;  3M9A A;  2MAB A;  3S3N A;  1SAU A;  3TMO A;  4L0Z B;  1XGN A;  4AYB A;  4DYC A;  4LOC A;  2H8W A;  2RKH A;  4Z6Y A;  1Z6T A;  4C2U A;  2RV8 A;  4XLC A;  3HPH A;  1IRG A;  5FD5 A;  2F2E A;  2IJL A;  5JHF A;  4BJ6 C;  3PO3 J;  2KIU A;  4CCJ A;  2DN0 A;  1YJ9 I;  1KU9 A;  2B7E A;  4WF2 A;  2EPF A;  1V3F A;  2QM3 A;  4EGY A;  2F4M B;  3W6K B;  5IPA A;  5ILV A;  3PSI A;  3ABM H;  2QEN A;  3F8N A;  4BAY A;  4B1R A;  2RAE A;  3MZ8 A;  5HLH A;  2K9Q A;  4BQQ A;  5KHD A;  3J80 K;  3WTV C;  4HQE A;  2G7U A;  1ETX A;  4ESB A;  3OY9 A;  3M3Y J;  3QQA A;  2VQC A;  1U9N A;  4B43 A;  5D8L B;  2VL8 A;  4RAZ A;  5CVR A;  1XTA A;  1SFX A;  3B6A A;  1TL8 A;  1IZ1 A;  1V55 H;  3KP3 A;  1MDM B;  2M45 A;  2O8X A;  2A6E F;  3BPX A;  1BM9 A;  2WBM A;  3OSF A;  3WE2 A;  3JRI A;  5E17 F;  5TRD A;  4RAF A;  3HIF A;  4G12 A;  2EWN A;  3FXJ A;  2XKO A;  4IHT A;  1WGX A;  1R22 A;  1SVO A;  4PZJ A;  4XLE A;  4C30 A;  4M3D A;  2PLY A;  4KJZ A;  3QOD A;  2DBB A;  4KN7 X;  5J40 A;  1TWH J;  3ELK A;  3U21 A;  3DXJ F;  4B4C A;  1IJW C;  1Z21 A;  2XUB A;  4ON0 A;  1G3Y A;  1OCP A;  3BR5 A;  5LEJ A;  4ZYH A;  3R6S A;  4N9I A;  3HRM A;  2V4J C;  3VDX A;  4LJZ F;  4YII A;  1UG0 A;  4DW6 A;  3IP4 B;  3V7C A;  5JHU A;  2Y31 A;  1P92 A;  5LD2 C;  1YW8 A;  1FP2 A;  1Y0U A;  3CME I;  4AM3 A;  2WV1 A;  3H9Q A;  3BTL A;  2HDC A;  2KRH A;  1JGS A;  5GAE J;  2VIX A;  1ETY A;  4BY7 J;  2QQ9 A;  3GZN B;  1ZGW A;  3FMS A;  1NK2 P;  2PMZ N;  5AON A;  3HSE A;  3SDB A;  4HNV A;  1Q1V A;  1MNE A;  4KIC A;  3M1C A;  4PK4 A;  1Z77 A;  4LK0 F;  3WTW C;  1ZAO A;  2DMT A;  4FET A;  2EFN A;  3I59 B;  4XRF A;  2HKX A;  1ZLJ A;  4HG2 A;  5IP9 J;  5FKO A;  5AIQ A;  1R4M B;  4BEH A;  1J59 A;  1R1U A;  1MMN A;  1L0O C;  1Y0N A;  2R7F A;  5KK1 A;  2RC4 A;  3IH2 A;  1A35 A;  2KKO A;  1B8I B;  4WX9 A;  1VQ5 I;  3DWL E;  2ISY A;  1A6I A;  1K79 A;  5EZG A;  2DCE A;  1R58 A;  1RNL A;  2JJ7 A;  3J7A O;  2FF4 A;  2M30 A;  4XRS A;  2KDZ A;  1U8B A;  2Y2Z A;  3FKJ A;  2LBF B;  1N75 A;  1JUS A;  1T0F C;  1ZGJ A;  2ESH A;  1JKO C;  1AHD P;  1OJL A;  3NAU A;  3AG2 H;  4AU7 A;  1RC9 A;  1YG2 A;  4KA4 A;  2ZXJ A;  3SHF A;  4E7H A;  4DNC A;  3K4K A;  3FXO A;  4XN3 A;  2ME0 A;  2CUF A;  3R0J A;  1TC3 C;  2GM4 A;  2AQF A;  2W1O A;  1OQY A;  2KIF A;  3HXL A;  3OIQ A;  2IBD A;  4HV6 A;  1JXS A;  3JSO A;  1VQ7 I;  4Q4Z F;  2ZBK A;  4YG2 F;  4MFD A;  1ENH A;  1IV6 A;  3B73 A;  4M6V A;  4EM1 A;  3ZQI A;  2LC2 A;  1W4M A;  3U2R A;  5EJC A;  2DW4 A;  3RSN A;  4HX8 A;  3RKQ A;  4E7S A;  3KZZ A;  2YU9 J;  3ZMU A;  2HVQ A;  4Y13 A;  2E2J J;  1IXS B;  2F5C A;  3CJN A;  1R1T A;  4E7J A;  3FXL A;  4DBQ A;  5FRN A;  2R7T A;  1WPK A;  2JA5 J;  3BJA A;  2IGO A;  2EIM H;  3EQL F;  4MEX F;  3GTG J;  1HLV A;  1FYL A;  3WG9 A;  2H6B A;  2JUC A;  1K4T A;  4XM3 A;  4V19 K;  3F23 A;  2QSF X;  2M7B A;  4HV5 A;  2VKD A;  2DJI A;  3BJO A;  3HHH A;  4LD5 A;  2VAS A;  2HZD A;  3FXK A;  4NBQ A;  4KIG A;  1S3J A;  2O5R A;  2ZSI B;  4ZH4 F;  3S16 J;  1LEB A;  4P9U A;  5HNF A;  3CDI A;  3T5X A;  2L9R A;  1E17 A;  4CCK A;  5FRO A;  2PEX A;  4EM0 B;  1LVK A;  1FWZ A;  2CQX A;  2QSH X;  2MC4 A;  1KQ8 A;  1FC3 A;  1YX5 A;  2OCE A;  2ETH A;  2PJR A;  1OCZ H;  1R6R A;  3BJ6 A;  4XSX F;  4A3F J;  1R7J A;  4Y4R A;  1YS6 A;  2BHZ A;  2XPV A;  1X19 A;  4R8H A;  3ZQF A;  2HXI A;  2EZI A;  2EJR A;  4BQA A;  5IYC J;  3A0B C;  3L7W A;  1B1B A;  5BNG A;  1E0E A;  4OU0 A;  4MO7 A;  1KU2 A;  4H0E A;  1HCR A;  2FXA A;  2R7Q A;  1KU3 A;  4I6Z A;  1JGG A;  2YSR A;  3ZMV A;  2STW A;  1F43 A;  1HDP A;  4XKV A;  1VQ4 I;  3K4M A;  1I1G A;  3NWS A;  3BG7 A;  1BJZ A;  3L2C A;  1ZK8 A;  3TDU C;  4CCO A;  1RUO A;  3ERM A;  4B48 A;  4ZYG A;  1U5T A;  2LSO A;  2LKX A;  3QRF F;  1LFB A;  2R7S A;  4BXX J;  2V9K A;  3EYI A;  2LH9 A;  2BHY A;  4FTH A;  1FIP A;  1PYV A;  1XC5 A;  1BI0 A;  2HNH A;  1H9G A;  1FX7 A;  1WRJ A;  2PBI A;  1JTY A;  1IGN A;  5CQE A;  3VOD A;  4HBL A;  3RCO A;  3QPT A;  4GFB A;  3IL2 A;  3LSI A;  3FDY A;  2DFH A;  3FHN A;  1MBH A;  2MSY A;  1S8N A;  2L9S A;  3HRT A;  2I8D A;  2V6E A;  1VQ6 I;  1MKM A;  3OL3 A;  4I76 A;  4XKB A;  4I0A A;  1P4A A;  1FOW A;  2QF7 A;  2YPR A;  4CHU A;  2IA0 A;  2I5U A;  1BOA A;  2JK3 A;  4M3E A;  2EA4 A;  1Z3X A;  2CS3 A;  1S9H A;  3JRD A;  1LKX A;  1O7F A;  1O7L A;  4RMN A;  3CCS I;  1QPM A;  3KET A;  3VWB A;  3CMM A;  1P2F A;  3BTC A;  4LB6 B;  4IOA F;  2DDB A;  5LRS A;  3DKW A;  1DUX C;  1GVD A;  2Y9Y A;  1PP8 F;  1BL0 A;  2VBZ A;  5EDN A;  3CCE I;  5K1Y A;  2DMU A;  1B4A A;  2OV7 A;  2DT5 A;  3D0S A;  3K4C A;  2W25 A;  4L9N A;  3C2H A;  2LY9 A;  3CUQ A;  4DGW B;  3CCQ I;  2EBI A;  3KPH A;  2FD5 A;  3LST A;  1PP7 U;  2E2H J;  4PJ0 C;  3Q0W A;  5KAF C;  3DEE A;  4IQJ A;  2IP2 A;  2DO7 A;  2YX7 A;  3V8K A;  4KIF A;  4BBS J;  4UUS A;  4A3I J;  3IHU A;  5F1J A;  1JKP C;  1RPW A;  2EFP A;  1VFC A;  3CMY A;  3H36 A;  4UY8 I;  3PL8 A;  4P9F A;  5FB2 A;  3L09 A;  2BYV E;  4KYW A;  3TP0 A;  1JJ6 C;  3K7A J;  2QA4 I;  1TP4 A;  1E2X A;  2FRH A;  2IVM A;  2W57 A;  3F8F A;  4DQ2 A;  1PUF A;  2XAQ A;  1U9O A;  3L9F A;  2ZKZ A;  4HDV A;  4A0Y A;  5JFR A;  2IGN A;  5LGT A;  1B72 B;  1FOY A;  2K9N A;  3QWL A;  4MGR A;  1EH7 A;  3SZP A;  2XGX A;  2VBW A;  3VOE A;  3CJR B;  4M3B A;  4A3E J;  1Z7L A;  5JLX A;  1HA8 A;  2EH3 A;  3AFH A;  4NUB A;  5CJ9 A;  4HDU A;  1ZRD A;  2I10 A;  5IOY A;  4BHB A;  3J81 K;  3AG4 H;  4X0G A;  5F1R A;  2DK8 A;  1X1B A;  3ZPL A;  1SD5 A;  3BTI A;  1E3O C;  2DPD A;  2HWV A;  5DUI A;  3HRS A;  4U7B A;  4CGZ A;  1N77 A;  4M9X A;  2NVT J;  4XQF A;  4X6A J;  1DPR A;  3KP5 A;  3GW2 A;  2UV1 A;  5BPI A;  2DYS H;  2O7O A;  2A3S A;  2ZC2 A;  1TWC J;  3BR6 A;  3RZO J;  3W6V A;  1XN7 A;  1DU0 A;  1D1A A;  2A61 A;  5F6F A;  4YFK F;  2QKM B;  3DU5 A;  5ICC A;  4EJU A;  2WB1 A;  4HPQ A;  5HOD A;  2FSW A;  1FJL A;  1ETK A;  2DOE A;  5J3L A;  3CCL I;  3T8T A;  4CZC A;  3CZ6 A;  2EZH A;  2G9W A;  3E5X A;  2MFZ A;  2EIL H;  3NQO A;  2R5Z B;  3NAR A;  1XB4 A;  2Y75 A;  2HVS A;  1SD4 A;  3JTH A;  3K10 A;  2LLK A;  2LNB A;  2BY3 A;  3QYE A;  5DCF A;  1YFH A;  1FNN A;  2DMQ A;  3HSF A;  4C2M J;  3IUO A;  2QQA A;  2EV6 A;  5JVG F;  2FBK A;  3FMR A;  4NB5 A;  2L0K A;  4RGS A;  4UXN A;  1U3E M;  3VYS B;  2XIG A;  2JTV A;  2OBP A;  3CLO A;  5K7F A;  5D5V B;  1FMW A;  1ZHF A;  4LG0 B;  3HUG B;  3DP7 A;  3U1D A;  3IC7 A;  4KN4 X;  3QYB A;  3K0L A;  2FNP A;  1QHG A;  4GYG A;  1BR1 A;  2ZME A;  3LL7 A;  3BC8 A;  3LSM A;  3L2Q A;  3HGY A;  4B8X A;  1B9M A;  3TL4 X;  5LGN A;  4C9Y A;  1OYI A;  1WJA A;  5IOZ A;  2PQ8 A;  4JBA A;  3FX3 A;  3I53 A;  1VF9 A;  4CUG A;  3WGH A;  4MFE A;  1FYK A;  5TIS C;  1OYY A;  1D5V A;  1K6Y A;  1WZ2 A;  1QRY A;  1XSD A;  2E36 A;  3OL4 A;  1UHM A;  1R71 A;  2P7C B;  2H09 A;  4OAY A;  5TJJ A;  2HTS A;  4RGR A;  1I39 A;  3CC4 I;  4WK8 F;  2BW3 A;  1X58 A;  5GPA A;  1ZG1 A;  3PSF A;  2M8E A;  4WXC A;  4CCN A;  3IH3 A;  2R4G A;  3DCF A;  2HQR A;  2B63 J;  3PQJ A;  2VOP A;  3OS1 A;  4A0Z A;  1I5Z A;  1MGT A;  1OR7 A;  4FHT A;  2HKO A;  4A12 A;  2X0L A;  5CVU A;  3W3C A;  1BOB A;  3DQV C;  1X1A A;  4XSZ F;  3W2W A;  1WJB A;  4KIT B;  3K4B A;  5H6Q A;  3LSR A;  2R7R A;  1I1S A;  3RPU D;  2XV4 S;  4CCL A;  3QOP A;  4RB0 A;  1KA8 A;  1TBX A;  1LDJ A;  1T95 A;  3LFU A;  1WI3 A;  3J7Z I;  1H9T A;  5ED4 A;  2DMN A;  3BY6 A;  2R5Y B;  2R7V A;  4J01 A;  2V1N A;  4XOP A;  1DDN A;  1SC7 A;  1FY7 A;  2EZL A;  1S7A A;  4M74 A;  2HPM A;  3HDD A;  2NAZ A;  4PJJ A;  2HEO A;  4XKW A;  3QPH A;  3HRU A;  3BDD A;  3OYA A;  1JKR C;  1L3L A;  4A6E A;  1MIJ A;  1TT5 B;  5KNL A;  2VE9 A;  5HDN A;  4IO9 F;  1T98 A;  2JWT A;  1BN5 A;  4JOM A;  1GDT A;  1HW2 A;  4A3C J;  4B3X A;  3O3K A;  3WGI A;  3IH4 A;  3DLL F;  1I27 A;  2XGE A;  2YS9 A;  2V79 A;  3HJE A;  4HA8 A;  3LAP A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  1K78 A;  1RUN A;  3TDZ C;  4P96 A;  4M9Z A;  3RI4 A;  4IRG A;  1ZRE A;  3F3X A;  2GA2 A;  4LLN A;  4XLN F;  1WI9 A;  4MNU A;  2IW5 A;  4OMZ A;  1Z7U A;  2Q2E A;  1C0W A;  3MAJ A;  3ECO A;  1P6R A;  4L9V A;  3TKY A;  4Q47 A;  3CTA A;  2RQP A;  3TOB A;  1IN7 A;  4S04 A;  3KEQ A;  3M8E A;  3TGN A;  5E1Z B;  3FF5 A;  3MWM A;  1R5G A;  1OYW A;  2OA4 A;  2H27 A;  1J2X A;  1TNS A;  1GXP A;  2NS0 A;  3KFW X;  2LF8 A;  4CDG A;  1XGO A;  1HST A;  2F5D A;  3LA3 A;  3GFL A;  1W7P D;  4BH9 A;  3G73 A;  4OIR F;  4EMS A;  5D8K B;  1XSX A;  1TNT A;  4AD9 A;  3Q5F A;  1FPQ A;  1R23 A;  4KNY A;  2A68 F;  3MQ0 A;  3FMQ A;  4CZZ A;  3S2W A;  4Q48 A;  5E20 A;  3SXY A;  3D5L A;  3TO7 A;  1G3T A;  1GXQ A;  2J5O A;  2JRT A;  3GZ6 A;  1V4R A;  2GZW A;  1Z91 A;  3O2P E;  3LAJ A;  2RGV A;  4ESF A;  2CGP A;  2M87 A;  4UUV A;  3ABT A;  2X4H A;  2K7L A;  1WKM A;  3HHG A;  3RYP A;  1RZ4 A;  1TW3 A;  1W7P A;  3FHZ A;  2QUF A;  4LGW A;  5D6E A;  2GAU A;  6PAX A;  3HSR A;  2K02 A;  2Y48 A;  2D1V A;  3WE3 A;  2ESN A;  4RB1 A;  3RDI A;  1O3R A;  1R00 A;  3ABU A;  2FBH A;  3I64 A;  3IWF A;  3KP4 A;  4UNO A;  5DCM B;  1HKS A;  2HTJ A;  4ENN A;  1CF7 A;  2ZNZ A;  2PG4 A;  5KVR A;  4Y15 A;  4ZZL A;  2P5V A;  4P55 A;  4FX4 A;  3WU0 A;  1HXD A;  4Y17 A;  4O5V A;  4UV9 A;  2ZFW A;  5LLQ A;  4EV0 A;  4RGX A;  1LJ9 A;  5FGM A;  1XGM A;  3GFM A;  2QBY A;  5K5R A;  1IUY A;  2VE8 A;  2V1X A;  1ZH5 A;  1P4W A;  4ASN A;  2UWM A;  1T6S A;  2H94 A;  1IXC A;  4O3M A;  4L5I A;  1EH6 A;  4MTE A;  4LK1 F;  3F8C A;  1GVJ A;  2CW0 F;  1A04 A;  1ON1 A;  3WGG A;  3F72 A;  3GF2 A;  1FYM A;  2EA2 A;  1QGP A;  4GCV A;  1CGP A;  1XGS A;  3DPL C;  4MQV A;  1XCV A;  4ZYE A;  2XAJ A;  4O6J A;  3K1M A;  4L5J A;  4GYI A;  3I54 A;  1H0M A;  1D8K A;  2WTE A;  2DQR A;  1HKT A;  3F22 A;  1WWX A;  2VOO A;  4HF2 A;  1U6G A;  4BNC A;  3GUD A;  4KMU X;  2FA5 A;  2P5L C;  1SFU A;  2FQ3 A;  5HS9 A;  4P5O A;  4UV8 A;  4HF0 A;  3QU6 A;  3ML6 A;  1IXR C;  5H20 A;  1SAX A;  2GA1 A;  3K1N A;  2FBI A;  4KT5 C;  5FO5 A;  2VON A;  2KRF A;  3SZT A;  4HLX A;  3F6V A;  2GWR A;  3WTX C;  2PFB A;  2XRN A;  4HW0 A;  1YTY A;  3JSP A;  2UXX A;  2EB7 A;  3ISP A;  4WXH A;  5FFZ A;  3MFK A;  2UZK A;  2ACJ A;  1MD0 A;  2Y0M A;  1G3S A;  2O0Y A;  1LDD A;  1ODD A;  1JHF A;  5CYV A;  3WTS C;  1U78 A;  2DAO A;  1TQI A;  2O3F A;  1LVA A;  5LBQ A;  3GXO A;  2QVO A;  3E5Q A;  4YIF A;  3NRV A;  1PDN C;  1O3T A;  2M1B A;  2BBY A;  5HS7 A;  3QP6 A;  3BPV A;  2A6H F;  3CO7 C;  1J0R A;  1ULY A;  3GZ5 A;  2K4J A;  5LEK A;  3LWF A;  4G94 A;  1YW7 A;  3FM5 A;  3I58 A;  1SMT A;  3M1E A;  4R1H A;  2ZNY A;  1IW7 F;  2D1H A;  1W5S A;  2RNJ A;  1JHH A;  2VBY A;  3ZMS A;  3WTZ A;  2V1D A;  1TLH B;  4CYD A;  3R60 A;  4LMY A;  3TO6 A;  1IN8 A;  1P4X A;  2MC3 A;  1DPU A;  3OV8 A;  3FZV A;  2UXN A;  3REO A;  5L3B A;  5EEH A;  1TQP A;  3E6M A;  3P7N A;  1J5Y A;  1KGS A;  3BZ6 A;  1UST A;  5E1X A;  2EFQ A;  2OZ6 A;  1BI3 A;  1REP C;  2E7W A;  2EV0 A;  4AIH A;  4A5M A;  1ZRF A;  1SMY F;  3ERE D;  3GX4 X;  3F8M A;  2IA2 A;  3H92 A;  2J5P A;  1HW5 A;  3COA C;  2CWE A;  5LGU A;  4ENM A;  3QU3 A;  5HVQ C;  3WTU C;  4PGG A;  3SFZ A;  3HYI A;  3RKX A;  4BHC A;  1TW2 A;  3GFJ A;  4BHP A;  1JE8 A;  2HGC A;  4EJT A;  2QWW A;  2JPC A;  5D5X B;  3GWZ A;  1EV7 A;  3O6B B;  3KLN A;  1KQ0 A;  2C6Y A;  1ZLK A;  3HTU A;  4A0X A;  1R1V A;  3E3V A;  3PFI A;  2WV0 A;  1Q1H A;  1IAW A;  3ZN0 A;  3F6O A;  2Z5U A;  1YW9 A;  3RKY A;  2FNA A;  1U5T B;  3IRQ A;  2JT1 A;  1F1Z A;  1FZP B;  1HBX G;  4GO1 A;  2KJB A;  2VT2 A;  3SQN A;  4OIN F;  1K7A A;  3N97 A;  2A07 F;  5IT9 Z;  1F5T A;  4UVC A;  4NQW A;  5CVV A;  1RIO H;  4G7H F;  3CUQ C;  1FBU A;  1SD7 A;  5A2Q Z;  4TV7 A;  2HFH A;  3FXU A;  4ENK A;  2PMU A;  4IVN A;  4GXO A;  1LEA A;  3M8F A;  4M9S A;  2EK5 A;  4IF4 A;  2DQL A;  2P6S A;  1U2W A;  3K1P A;  4XBF A;  3V7R A;  1XDS A;  1I6X A;  4L9T A;  1G3W A;  1KU7 A;  4M71 A;  4ENJ A;  5HOO A;  1J9I A;  2CG4 A;  4OIO F;  3CUQ B;  4KDP A;  1GHC A;  1XDU A;  1XCB A;  3JAM Z;  1XMK A;  4RGU A;  2GQQ A;  3KE2 A;  2NYX A;  3TOA A;  3T8R A;  1STZ A;  1QBJ A;  2L54 A;  4ESJ A;  3DFG A;  4PDK A;  5JI6 A;  3GEZ A;  2HR3 A;  1G6N A;  2VC0 A;  1DP7 P;  3NEU A;  5DDG A;  5D4R A;  3RPQ A;  1MDM A;  2LF7 A;  3V8L A;  3ZP5 A;  2ADU A;  1Z1D A;  2IPQ X;  2DK5 A;  3RJP A;  1ZAR A;  4RAY A;  3GO5 A;  5BS6 A;  3RPU A;  4U7D A;  1IF1 A;  1G4D A;  2DPU A;  4RB2 C;  2L4A A;  3HTS B;  4EGZ A;  2P5K A;  1BBY A;  1UHW A;  2WWY A;  1UFM A;  2VBX A;  4R79 A;  2Z3Y A;  2PMH A;  2XAF A;  3FM3 A;  4PCQ A;  5JVT A;  5ICE A;  3KZY A;  5ERI A;  2P7V B;  4ZZD A;  3MZH A;  3RIR A;  1T2K A;  3EET A;  2HQN A;  4JK1 X;  2B0L A;  2FMY A;  3K9T A;  1MJB A;  3I59 A;  2LKP A;  3E6D A;  3ZQ7 A;  1ZYR F;  4OIQ F;  4MQ9 F;  3EUH A;  4WCG A;  3BP8 A;  2E7X A;  3QP5 A;  4KMF A;  2ZME B;  2QZ8 A;  2L3D A;  3IWZ A;  2MLK A;  2NRA C;  1OMI A;  3DF8 A;  4D0P A;  4LB5 A;  5LHI A;  5AIP A;  2V9V A;  4EJV A;  2EFO A;  1RI7 A;  3ZMT A;  1ONV A;  5BPD A;  3CDH A;  3I0T A;  1ZN2 A;  3LQQ A;  2W85 A;  1ZGA A;  5J8F A;  4HOB A;  2FOK A;  2G7H A;  4M6X A;  2VC1 A;  2OD5 A;  4IXA A;  3P9C A;  2A69 F;  4U0V A;  3V8J A;  1XSV A;  3OOP A;  1T0F A;  2VN2 A;  3E97 A;  4L18 B;  1YQA A;  4LLG F;  5CVI A;  5FD6 A;  4AIJ A;  2XAG A;  4CO8 A;  2CQK A;  3BWG A;  3KP2 A;  2PI0 A;  3WU1 B;  4I09 A;  4AIK A;  4HYE A;  4OOI A;  1K78 B;  2CSO A;  5CVJ A;  1FOK A;  4RB3 C;  4QLC U;  2IT0 A;  3C1D A;  1ZG5 A;  4XLP F;  1FT9 A;  3ZMZ A;  2XAH A;  4YFX F;  5HLG A;  3C18 A;  3U9G A;  1VTN C;  3C3W A;  1OPC A;  1ZRC A;  1OKR A;  2Q8K A;  1IRF A;  2CFX A;  4HF1 A;  1HW1 A;  2P6T A;  3W6J B;  5E18 F;  3AAF A;  2A5Y B;  2KIM A;  3V7S A;  1F9N A;  3IKT A;  3ZN1 A;  1O57 A;  3E6C C;  2HZT A;  2D2W A;  1BIA A;  1IN4 A;  1S7O A;  3N4M A;  1HSJ A;  1YYV A;  3K2Z A;  2HYF A;  2FU4 A;  3G3Z A;  5LHG A;  4G8X A;  3F8B A;  2MH9 A;  1AOY A;  2R7D A;  4IRI A;  3T1B A;  5HLI A;  5FLX Z;  4G6D A;  1S29 A;  1QO0 D;  1LQ1 A;  4PGH A;  5EEG A;  2DU9 A;  3L00 A;  1MJ9 A;  3HOS A;  1QNT A;  2EFW A;  2DI3 A;  4I0B A;  2R3S A;  1MZB A;  2YU3 A;  1YLF A;  5HDK A;  5ILU A;  2IRF G;  2XVC A;  4M6Y A;  3R0A A;  1FP1 D;  2ZO4 A;  2D45 A;  2MA3 A;  1D3Y A;  4OMY A;  1MJA A;  1T38 A;  2BE5 F;  3EDP A;  1BIB A;  4IHS A;  4L0Y B;  3I4P A;  4IJA A;  3FWE A;  5ICG A;  3JW4 A;  4GGG A;  3Q9V A;  5H6R A;  4FX0 A;  2NNN A;  5D5W B;  4I98 B;  5E8G A;  3IRR A;  4EJO A;  2Q0O A;  2QYO A;  1R36 A;  1XD7 A;  2MD5 A;  2HOE A;  3LA2 A;  1W7P B;  1BJA A;  3J80 Z;  4M73 A;  2MH2 A;  2XHK A;  1WQ2 A;  2OQR A;  4KIB A;  4QWQ A;  2E1C A;  4AWX B;  2DLL A;  5E8I A;  2CYY A;  1FSE A;  5J8C A;  1YS7 A;  1UB9 A;  5L3F A;  1NHA A;  1FBS A;  5E1W A;  2QLZ A;  4EVI A;  4S05 A;  4YFN F;  5IT9 K;  2QQB A;  3CO6 C;  4ETS A;  2KJC A;  4EM2 A;  1CF7 B;  2VT3 A;  1AWC A;  1T39 A;  3MCZ A;  2XAS A;  4Q5S F;  4UHT A;  3MZY A;  5A2Q K;  1TQM A;  5DV5 A;  4KFC A;  2PN6 A;  4LG0 A;  3P9K A;  1W5T A;  3HUG A;  2K27 A;  2MBF A;  4MTD A;  4EJW A;  1QZZ A;  2MLG A;  4U0Y A;  3MEX A;  1TTY A;  2ISZ A;  3KLO A;  2Z9O A;  2QBY B;  1Z05 A;  5CLS A;  2VOD A;  5BOX A;  3KP6 A;  1S6L A;  5D5U B;  2K4B A;  4BXU A;  4I2O A;  4LLL A;  3FXQ A;  4AVP A;  4HLY A;  3WOD F;  4NHJ A;  1YO5 C;  3TO9 A;  2L01 A;  5L3C A;  3JAM K;  4N9H A;  1B6A A;  2RN7 A;  3E6B A;  5DYM A;  1D8J A;  3I5U A;  1J7K A;  5F64 A;  2WC2 A;  4OIP F;  2P8T A;  1O3S A;  3QAH A;  4KUM A;  5K5Q A;  3C7J A;  3R61 A;  1IN6 A;  3ECH A;  1FLI A;  5LHH A;  3BOQ A;  4I01 A;  4HQM A;  3EYY A;  3DPT A;  1ZG3 A;  4EQQ A;  2L4M A;  4G9Y A;  1WSU A;  4E70 A;  2RDP A;  1QZY A;  1BC8 C;  4G7O F;  4Z2Y A;  2HS5 A;  2K86 A;  2Z99 A;  1EH8 A;  1SD6 A;  5D6F A;  1U5T C;  5JR3 A;  2Z33 A;  4U0W A;  2OZU A;  1X3U A;  2FEZ A;  4I02 A;  1J75 A;  5HDG A;  3B02 A;  2OQG A;  3P9I A;  1B59 A;  4G6Q A;  1SFE A;  3CUO A;  2H6C A;  2NNY A;  2CO5 A;  4IRH A;  1KYZ A;  2YX4 A;  1QQI A;  4JQF A;  2YR2 A;  1PUE E;  1LB2 A;  5D4S A;  4A2U A;  1K6O A;  1FSH A;  5K5O A;  3Q9S A;  5BQT A;  3LQR A;  4MEY F;  4A5N A;  1Z6R A;  2W24 A;  4L9J A;  2EV5 A;  3M7G A;  2JPB A;  3I71 A;  3PQK A;  1BC7 C;  4K2E A;  4CIC A;  3ROU A;  1UCR A;  2O03 A;  2F5E A;  2FML A;  2XRO A;  4ZYD A;  4UVA A;  5LRR A;  1USS A;  2ZJ2 A;  2JSC A;  3FXR A;  2FE3 A;  2TDX A;  1HKQ A;  4BYY A;  4M72 A;  2BEO A;  2O6G E;  3BRO A;  3LA7 A;  3VB2 A;  1XMA A;  4N0B A;  3GVA A;  2W84 A;  3JTG A;  4WXD A;  5DD4 A;  3TQN A;  5L3D A;  2HYG D;  3KP7 A;  4LFU A;  4F7Z A;  2L02 A;  5L3G A;  5HS8 A;  4IPA A;  3ZMD A;  5ILS A;  3KEO A;  1R5H A;  3RYR A;  2M5W A;  5DUK A;  4CXF A;  3T0Y A;  1KQ9 A;  3GYH X;  2IA1 A;  3H3Z A;  2AS5 F;  4A6D A;  2STT A;  2O61 A;  1Z9C A;  4G7Z F;  3WTY C;  4HZF A;  3F21 A;  2DTR A;  2F5F A;  1BI2 A;  1F4K A;  2BV6 A;  4WWC A;  3H3U A;  5BMZ A;  4UVB A;  5DEQ A;  4HX4 A;  5DD8 A;  3V4G A;  3GFI A;  5FFX A;  2V6C A;  4FT8 A;  1BI1 A;  3LFK A;  2AXL A;  5J6X A;  4HAM A;  2GXG A;  3IKV A;  2PJP A;  3RKW A;  5DCM A;  2OAZ A;  4B09 A;  3J81 Z;  3E5U A;  1LNW A;  5L3E A;  5IT3 A;  2E1N A;  2V1U A;  1YIO A;  2ELH A;  3DV8 A;  1FBQ A;  3VFZ A;  2DFI A;  3RTR A;  1U8R A;  2GXB A;  2LDU A;  3ULQ B;  3HOT A;  2VXZ A;  5FLX K;  1LDK B;  3K69 A;  4MHG A;  1HQC A;  2RVC A;  1O3Q A;  2JZY A;  3GLX A;  4U88 A;  3VEP A;  5ICF A;  2P4W A;  4RS8 A;  2ZCW A;  1ON2 A;  2XKP A;  1IN5 A;  1B9N A;  1KYW A;  3WTT C;  2GIV A;  3DEU A;  3R4K A;  2COM A;  2BGC A;  4I7H A;  4HX7 A;  3KCC A;  3M9A A;  4L0Z B;  1XGN A;  2RKH A;  1Z6T A;  2RV8 A;  1IRG A;  5FD5 A;  2F2E A;  2IJL A;  2KIU A;  1KU9 A;  4WF2 A;  1V3F A;  2QM3 A;  4EGY A;  3W6K B;  5ILV A;  2QEN A;  3F8N A;  4BAY A;  4HQE A;  5HLH A;  3J80 K;  3WTV C;  2G7U A;  4ESB A;  5D8L B;  4RAZ A;  5CVR A;  1SFX A;  1IZ1 A;  3KP3 A;  1MDM B;  2M45 A;  2O8X A;  2A6E F;  3BPX A;  1BM9 A;  3WE2 A;  5E17 F;  5TRD A;  3HIF A;  2EWN A;  2XKO A;  4IHT A;  1R22 A;  4PZJ A;  2PLY A;  2DBB A;  4KN7 X;  3ELK A;  3DXJ F;  2XUB A;  4ON0 A;  1G3Y A;  5LEJ A;  4ZYH A;  3R6S A;  4N9I A;  3HRM A;  4LJZ F;  4YII A;  3V7C A;  5JHU A;  1P92 A;  1YW8 A;  1FP2 A;  1Y0U A;  2HDC A;  1JGS A;  2QQ9 A;  3FMS A;  5AON A;  3HSE A;  4KIC A;  4LK0 F;  3WTW C;  1ZAO A;  2EFN A;  3I59 B;  4XRF A;  2HKX A;  1ZLJ A;  5AIQ A;  1J59 A;  1R1U A;  1L0O C;  2R7F A;  5KK1 A;  2RC4 A;  2KKO A;  4WX9 A;  2ISY A;  1K79 A;  1R58 A;  1RNL A;  3J7A O;  2FF4 A;  2M30 A;  1ZGJ A;  2ESH A;  1YG2 A;  4KA4 A;  2ZXJ A;  3SHF A;  4DNC A;  3R0J A;  4HV6 A;  2KIF A;  1JXS A;  3JSO A;  4Q4Z F;  2ZBK A;  4YG2 F;  3B73 A;  4EM1 A;  3U2R A;  1W4M A;  2DW4 A;  4HX8 A;  3KZZ A;  3ZMU A;  4Y13 A;  1IXS B;  2F5C A;  3CJN A;  1R1T A;  3BJA A;  3EQL F;  4MEX F;  1FYL A;  3WG9 A;  2H6B A;  3F23 A;  4HV5 A;  3BJO A;  3HHH A;  4LD5 A;  4KIG A;  1S3J A;  4ZH4 F;  1LEB A;  4P9U A;  3T5X A;  1E17 A;  2PEX A;  4EM0 B;  1FWZ A;  1KQ8 A;  1FC3 A;  2ETH A;  3BJ6 A;  4XSX F;  1R7J A;  1YS6 A;  4R8H A;  2EJR A;  4BQA A;  3L7W A;  1B1B A;  4OU0 A;  1KU2 A;  4H0E A;  2FXA A;  1KU3 A;  2YSR A;  3ZMV A;  2STW A;  1I1G A;  3L2C A;  3TDU C;  1RUO A;  4ZYG A;  1U5T A;  2LSO A;  3QRF F;  3EYI A;  1BI0 A;  1H9G A;  1FX7 A;  1WRJ A;  2PBI A;  3VOD A;  4HBL A;  3QPT A;  3IL2 A;  1S8N A;  3HRT A;  1MKM A;  4I0A A;  1P4A A;  2YPR A;  4CHU A;  2IA0 A;  1BOA A;  2EA4 A;  1O7F A;  1O7L A;  1QPM A;  3KET A;  1P2F A;  4LB6 B;  5LRS A;  3DKW A;  1DUX C;  1PP8 F;  2VBZ A;  5K1Y A;  1B4A A;  2DT5 A;  3D0S A;  2W25 A;  4L9N A;  3CUQ A;  1PP7 U;  3LST A;  2IP2 A;  2DO7 A;  2YX7 A;  3V8K A;  4KIF A;  3IHU A;  2EFP A;  4P9F A;  5FB2 A;  3L09 A;  2BYV E;  4KYW A;  2FRH A;  1E2X A;  2IVM A;  3F8F A;  2W57 A;  4DQ2 A;  2XAQ A;  3L9F A;  2ZKZ A;  4HDV A;  4A0Y A;  5JFR A;  5LGT A;  4MGR A;  1EH7 A;  3SZP A;  2XGX A;  2VBW A;  3VOE A;  5CJ9 A;  4HDU A;  1ZRD A;  3J81 K;  4BHB A;  5F1R A;  2DK8 A;  3ZPL A;  1SD5 A;  2DPD A;  2HWV A;  5DUI A;  3HRS A;  4U7B A;  4CGZ A;  4M9X A;  1DPR A;  3KP5 A;  3GW2 A;  5BPI A;  2A3S A;  1XN7 A;  2A61 A;  5F6F A;  4YFK F;  5ICC A;  4EJU A;  2FSW A;  3T8T A;  2G9W A;  3E5X A;  3NQO A;  1XB4 A;  2Y75 A;  1SD4 A;  3JTH A;  2LNB A;  5DCF A;  1YFH A;  1FNN A;  3HSF A;  2QQA A;  2EV6 A;  2FBK A;  3FMR A;  4NB5 A;  4RGS A;  4UXN A;  1U3E M;  2XIG A;  2JTV A;  2OBP A;  3CLO A;  5D5V B;  1ZHF A;  4LG0 B;  3DP7 A;  3U1D A;  3IC7 A;  4KN4 X;  3K0L A;  2FNP A;  4GYG A;  2ZME A;  4B8X A;  1B9M A;  5LGN A;  1OYI A;  2PQ8 A;  4JBA A;  3FX3 A;  3I53 A;  3WGH A;  1FYK A;  1OYY A;  1D5V A;  1XSD A;  1UHM A;  2P7C B;  2H09 A;  5TJJ A;  2HTS A;  4RGR A;  4WK8 F;  1ZG1 A;  2M8E A;  4WXC A;  2HQR A;  3PQJ A;  2VOP A;  4A0Z A;  1I5Z A;  1MGT A;  1OR7 A;  4A12 A;  4FHT A;  2HKO A;  2X0L A;  5CVU A;  3DQV C;  4XSZ F;  5H6Q A;  1I1S A;  2XV4 S;  3QOP A;  4RB0 A;  1KA8 A;  1TBX A;  1LDJ A;  1H9T A;  5ED4 A;  3BY6 A;  1DDN A;  1FY7 A;  4M74 A;  1S7A A;  2NAZ A;  2HEO A;  3QPH A;  3HRU A;  3BDD A;  1L3L A;  4A6E A;  2VE9 A;  5HDN A;  1T98 A;  1BN5 A;  1HW2 A;  3O3K A;  3WGI A;  1I27 A;  2V79 A;  4HA8 A;  3LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...