1MDMA

Inhibited fragment of ets-1 and paired domain of pax5 bound to dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
GVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL ANALYSIS OF THE AUTOINHIBITION OF ETS-1 AND ITS ROLE IN PROTEIN PARTNERSHIPS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords PAX5/ETS BINDING SITE ON THE MB-1 PROMOTER
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mdmA02
3BJAA 2LDUA 2VONA 5F6FA 4KICA 5HVQC 3GFMA 2L02A 4M6YA 5D4RA 3TO9A 3I54A 4KA4A 3LAPA 1S6LA 2XKOA 2JSCA 3N4MA 4KDPA 5J6XA 3EDPA 5HDGA 1R00A 1SFXA 3W6JB 2K7LA 3IL2A 1C0WA 3REOA 1AWCA 4O3MA 3T0YA 1W5SA 2O6GE 4IHSA 3GX4X 5F64A 4CO8A 3JAMZ 4MGRA 3DXJF 3WTSC 1CF7A 4QLCU 2PJPA 3J80Z 4XSZF 4BHPA 3JTGA 3WTTC 1HQCA 2HKOA 2FBHA 3GF2A 2X0LA 4U0WA 4PGGA 4HDVA 4RGSA 4F7ZA 1I27A 5KK1A 1TQIA 3JTHA 4BH9A 2CO5A 4IVNA 1PUEE 3HUGA 3GO5A 4ESJA 4UXNA 4KFCA 4EV0A 2JZYA 2Q2EA 3KP7A 5HS9A 4MNUA 1YO5C 2EFNA 3FM3A 1XSVA 2QLZA 1IN6A 3O6BB 2M1BA 2ZO4A 4UVAA 2OQRA 2XKPA 1BC8C 1RUNA 3KP6A 3Q5FA 4OINF 3SXYA 4M9XA 1P2FA 2K4BA 2G7UA 1D3YA 4U0YA 3KP3A 3SZPA 2QQBA 5KVRA 3DKWA 1FSHA 4OOIA 1STZA 3KLOA 1FP1D 2JPCA 4KYWA 4OU0A 2QBYA 3WG9A 1FYKA 2QYOA 5ICGA 4OIRF 4OIPF 3CDHA 3H3UA 4M71A 2O8XA 2JPBA 3V7CA 4OMZA 3LSTA 2EFOA 4Q47A 5IT3A 3V8JA 2HKXA 4G6DA 1PP8F 3IC7A 1F9NA 3F8CA 4RGRA 1QQIA 1XDSA 1D5VA 3FX3A 4G7HF 3RPQA 4FX0A 4AIHA 2OA4A 2XASA 1U8RA 1RZ4A 1QNTA 1F1ZA 3VOEA 1H0MA 2ADUA 3V8LA 2VE9A 3DPLC 1SFUA 4PCQA 4RB0A 4ZYEA 4S04A 5L3BA 4HBLA 2D2WA 3WU1B 5E20A 1Z9CA 2M30A 2ZBKA 3WGIA 2FMLA 3BPXA 2GA2A 1SD4A 3F6VA 1ZH5A 4G8XA 1R5HA 2HQNA 2DAOA 4B09A 4UNOA 4LG0A 3HHGA 1W5TA 1TBXA 2FSWA 1SMYF 1R1VA 1ULYA 4EM2A 1RUOA 3E6CC 3FXUA 5K1YA 1EH8A 2EA2A 2V1UA 1OKRA 4CHUA 3MFKA 1KU3A 1LDJA 2IVMA 3MZHA 3GEZA 4P5OA 1BI1A 3PQKA 2L4AA 1YLFA 1GVJA 1KU9A 1MKMA 3GUDA 2XV4S 2GQQA 5DCMB 4WXCA 1K7AA 3RYRA 2DO7A 1LJ9A 3JSOA 1YQAA 2XUBA 4BYYA 1HXDA 3BDDA 4GYIA 1ZG3A 3TDZC 2XAJA 2RN7A 4GCVA 3M7GA 2A6EF 1ZG1A 3F23A 4IRGA 2FEZA 3ROUA 2KIUA 1XMKA 1U6GA 2ZJ2A 5JI6A 3D0SA 1GHCA 2YX4A 5LHGA 1LVAA 3OV8A 3RIRA 2O3FA 3GFIA 2UXNA 3OOPA 1P6RA 2QZ8A 4G7ZF 1G4DA 4U7DA 2K86A 4YFXF 4YFNF 2BBYA 3KETA 2OD5A 3KEOA 3IRRA 1MD0A 2A6HF 3GLXA 3BY6A 5D5VB 1S7AA 2M8EA 1Z91A 4YG2F 3V4GA 2IPQX 1O7LA 4RAZA 3IRQA 2EV0A 1O3QA 2RNJA 4EJOA 5H6RA 3FMSA 3FZVA 4P96A 4A5NA 2IA0A 1IXSB 1IW7F 5AONA 1P4AA 1VTNC 2NRAC 1R36A 2XVCA 1G6NA 2MH2A 3LA3A 4IPAA 1I1GA 3K1NA 4LK0F 2DPDA 1ZLJA 1ONVA 4K2EA 4LK1F 2XRNA 4A0ZA 1OPCA 1DDNA 3KP4A 4ESBA 2EK5A 3J7AO 4I0AA 2BV6A 4KIGA 2P5LC 2CQKA 1FWZA 2Y75A 2E7WA 1ON2A 2DFIA 2IT0A 1G3WA 2HDCA 5J8FA 3GYHX 1LDKB 2KJBA 3P9IA 3KE2A 3DQVC 5E8GA 4HLXA 3MCZA 5LGTA 4CICA 2QENA 2G9WA 3Q9VA 2OZUA 1BN5A 1G3YA 3FF5A 3H3ZA 1ZRCA 4LLGF 3WU0A 2OQGA 4I7HA 3U2RA 2M5WA 1HBXG 2E1CA 4ZH4F 1IZ1A 1A04A 1O3RA 1ZYRF 4PDKA 1KQ0A 4LLNA 3BWGA 1J9IA 4BNCA 5D8KB 4R79A 1J2XA 5ICEA 1FP2A 1ZARA 3JW4A 2P7CB 1FBSA 1TNSA 5L3GA 1FYLA 3ZQ7A 2CSOA 3HTUA 2STWA 4OMYA 5LLQA 3S2WA 4HX4A 4JK1X 3V7SA 3F72A 3ZP5A 3QPHA 3TO7A 4MTDA 1QZZA 3ZN1A 4XLPF 4LB5A 2MD5A 3DV8A 3T1BA 3E5QA 3HSEA 3RKXA 2E7XA 5FO5A 1MDMB 4D0PA 5DDGA 3P9KA 2OBPA 3HSFA 2XROA 4MQ9F 4A12A 3EYIA 1BI2A 5HDNA 5D5WB 2TDXA 2MC3A 1G3SA 2V1XA 1J5YA 2VXZA 3ZMTA 2VBWA 2H27A 4HZFA 3ZMVA 1SD6A 3C18A 3DFGA 1F5TA 1YFHA 1BIBA 2D1VA 4PGHA 2EV5A 1AOYA 1Z6TA 2PLYA 1USTA 2IJLA 2QWWA 4LB6B 3CLOA 3T5XA 2FNAA 5CLSA 5A2QK 1R23A 4GYGA 1L0OC 4UUVA 2PQ8A 2R7FA 3QPTA 2M45A 4HV5A 4RB2C 4KN7X 4HLYA 2CYYA 2R7DA 2KIFA 1OYWA 4L9NA 5A2QZ 2PI0A 4E70A 4UHTA 5HOOA 3ZPLA 3QRFF 2GXBA 1U5TC 1E2XA 4AWXB 1D8KA 3F8FA 1D8JA 1CF7B 2ESNA 3F8NA 1OMIA 2EFQA 2J5PA 2NNYA 5HS7A 1REPC 4RGUA 1UHMA 2PN6A 3R6SA 3T8RA 3GXOA 1BJAA 2FQ3A 2DI3A 3L2CA 4IF4A 3KZYA 3WGHA 3TQNA 4M74A 3MZYA 4U0VA 4M6XA 2COMA 4HF2A 3K9TA 1ZN2A 3E5XA 3GFJA 4M73A 3FWEA 3HRTA 2RVCA 2EJRA 2ZMEA 4P9UA 1KU7A 4I09A 3K1MA 1SFEA 2CWEA 5LRRA 1E17A 5H6QA 3KZZA 5FD6A 4NHJA 2RC4A 1R5GA 3O3KA 2Z3YA 3M8FA 5E8IA 3R61A 4ESFA 5E1XA 1U2WA 4FX4A 2DBBA 4UVBA 1SD5A 2DT5A 4OIQF 2Q8KA 2B0LA 2IA2A 2KIMA 4G6QA 4KIFA 1F4KA 1O3TA 3I59B 1MJAA 4CYDA 1FNNA 3W6KB 4R8HA 5E18F 4BHCA 1BM9A 3GZ5A 4Q4ZF 2VODA 3F8MA 2K4JA 3WE2A 2YR2A 4ZYDA 3TKYA 3K0LA 4MEYF 3J80K 1DPRA 1K78A 1PDNC 1XSDA 3CJNA 1O3SA 2F5CA 5JHUA 5CVUA 2F5EA 4O6JA 3ZMDA 3FMRA 4XLNF 1TLHB 1IXRC 1IUYA 1T2KA 3MWMA 4EJVA 5LBQA 1Z6RA 5DD8A 2HS5A 2OZ6A 2XAFA 3GWZA 2EB7A 5IT9K 4KIBA 2GAUA 3I64A 4ENMA 1TTYA 3LQRA 2M87A 2GXGA 2FXAA 4ZZLA 2R3SA 2MBFA 4AIKA 1QBJA 1K79A 2ZNZA 2V9VA 2RV8A 4M9SA 2BEOA 3ABTA 4BQAA 2FMYA 1I5ZA 2JT1A 1X3UA 4EM0B 5LEJA 4EJWA 2BGCA 4EGYA 1Y0UA 4YFKF 2EFPA 2ZMEB 3E97A 2HTJA 4OIOF 3QP6A 1CGPA 4CGZA 1XGNA 1XSXA 4U7BA 5DD4A 4FHTA 1FOKA 4KMFA 2EA4A 5HS8A 4EM1A 2K02A 3K2ZA 5ICCA 4KNYA 2STTA 2ISZA 3IWZA 1LEAA 2P5KA 3RPUA 3ECOA 1FC3A 4IJAA 3NQOA 2FRHA 4XSXF 4MQVA 2W84A 5DYMA 1TQPA 1FSEA 3TOBA 3L7WA 2RGVA 3I59A 2DQRA 4G7OF 2VT3A 2MLGA 3HRSA 5CVRA 4N9HA 1B9NA 2L54A 3KLNA 4MHGA 2VOPA 3ELKA 3C7JA 1WKMA 3ZMSA 4RB3C 3RJPA 3HOTA 1KA8A 3MEXA 3WTXC 1K6OA 1YS6A 2NAZA 3P7NA 1J59A 4I0BA 3VB2A 3ZN0A 2GZWA 1HSJA 2LNBA 1J7KA 2ZXJA 3LAJA 2V79A 3R60A 2XHKA 3L09A 1JXSA 4RGXA 4BHBA 1HKTA 4O5VA 1FZPB 1S3JA 3K1PA 4EJUA 2HR3A 3N97A 2Z5UA 4L9JA 4ENKA 5ICFA 3ZMZA 5CVVA 5K5OA 1TNTA 2ISYA 4HW0A 2V1DA 2HOEA 4HX7A 4IHTA 4A6EA 4HAMA 1NHAA 3KP2A 5HLIA 1ZAOA 1FYMA 4CXFA 2YPRA 3HHHA 3F3XA 4DQ2A 3B73A 1SAXA 4KT5C 4ZZDA 2L4MA 3E6BA 5BPDA 2XAHA 2FA5A 2WV0A 4CZZA 2FE3A 1QGPA 2FOKA 4AD9A 3VFZA 2JTVA 5LRSA 3WTVC 4ZYHA 2CW0F 2O03A 4TV7A 4B8XA 4HYEA 5BPIA 1B1BA 1S29A 2VOOA 1XCBA 1WWXA 2IA1A 1O57A 2VBYA 2NNNA 2Z99A 4EGZA 2A69F 5D5UB 1IN8A 3QOPA 4FT8A 4LMYA 1IRFA 4GXOA 2DPUA 3KEQA 3DP7A 3I71A 1G3TA 1R1UA 1B59A 3BOQA 1ODDA 1YW9A 3CUOA 3GVAA 4G94A 3SFZA 3EETA 1O7FA 5BMZA 1ZLKA 5IT9Z 1T0FA 5H20A 2XAGA 5TRDA 5HLGA 3HRUA 2ELHA 1B4AA 2V6CA 4XRFA 2FBIA 3DPTA 2VBXA 4M72A 2OU2A 1P92A 3PFIA 2BE5F 1BOAA 1XGMA 3FXRA 2LSOA 5EEHA 3D5LA 4RS8A 2GA1A 4IXAA 2LF7A 1JHFA 5FLXZ 4HV6A 2QQ9A 4JBAA 1EV7A 1YG2A 2VC1A 2HYFA 1UHWA 2W85A 5DUKA 2FU4A 1SD7A 1PP7U 4GGGA 2F5FA 3VEPA 2AXLA 1IAWA 1R7JA 1BC7C 4L5IA 2DW4A 1ZG5A 1FY7A 2P6SA 2DK5A 3HYIA 3E6DA 1YYVA 4HQEA 3MAJA 1J0RA 4H0EA 1UB9A 5FB2A 3SZTA 5ERIA 1MJ9A 3K69A 5JVTA 3KFWX 1FPQA 3LWFA 3TOAA 5L3DA 2QM3A 3U1DA 2Z33A 1FBQA 3E6MA 3C1DA 4HOBA 2KRFA 2RKHA 1BI3A 4ENNA 1U3EM 3JAMK 4IRHA 1KYWA 3SQNA 3RI4A 4WXHA 2F5DA 3ABUA 3RKWA 4HF0A 3CTAA 5BOXA 3COAC 5K5RA 3M8EA 2HYGD 5D6EA 1WSUA 3G3ZA 2KKOA 4Y13A 1XGOA 4EJTA 2C6YA 2HZTA 1BBYA 5HDKA 3R0JA 3I53A 1EH6A 3ISPA 1EH7A 3FMQA 1WI9A 1FBUA 1LNWA 3I0TA 3CUQB 4JQFA 4L9VA 4LGWA 5DCFA 4WWCA 2QVOA 3DF8A 4MTEA 4WK8F 3WTYC 2UWMA 3I4PA 3HRMA 2H94A 5L3EA 3IKTA 4A2UA 1UFMA 5LGNA 2Z9OA 1MDMA 2FNPA 2VE8A 3BP8A 1Q1HA 3M9AA 4S05A 1ZHFA 4HF1A 3F8BA 2NS0A 1S8NA 2QUFA 2ZKZA 2ACJA 1L3LA 4UV8A 1HKQA 2P6TA 4Z2YA 5AIQA 5CVJA 2A68F 4ON0A 1USSA 1FLIA 4AIJA 1I1SA 4BXUA 1K78B 4EVIA 1HW1A 2Y48A 5DV5A 3BJ6A 2DQLA 2D1HA 1GXQA 1P4XA 2XGXA 5D6FA 1R58A 2HWVA 1GXPA 4EMSA 3MQ0A 2YX7A 1XD7A 1YIOA 1QZYA 4BAYA 5EEGA 2ESHA 3E3VA 4Q5SF 1RNLA 1IN5A 3LA2A 1ON1A 1V3FA 4XBFA 4IRIA 2H6CA 1XCVA 2VT2A 2XIGA 3WODF 3TDUC 3BZ6A 2K27A 2A3SA 1IN4A 1WRJA 2P4WA 2XAQA 3E5UA 2OAZA 2DTRA 1HKSA 3HIFA 4LD5A 4A0XA 3L00A 1KQ8A 2PG4A 1MGTA 1KGSA 3BROA 1TW2A 4LFUA 4ASNA 2LKPA 2WC2A 2ZNYA 5LHIA 1UCRA 4N9IA 5DEQA 4WF2A 1XMAA 5CVIA 1R1TA 2NYXA 4RB1A 3ERED 1KU2A 3RTRA 2ZCWA 4P9FA 2MH9A 3LFKA 1FT9A 4I01A 1DUXC 3IHUA 2HGCA 2QBYB 3ECHA 2W25A 4ZYGA 2RQPA 3ML6A 2P8TA 5K5QA 2O0YA 1ZREA 2FF4A 1DP7P 2HTSA 5D4SA 1KQ9A 4L0ZB 4Y15A 3AAFA 1XN7A 2PMUA 1BIAA 1HSTA 1IN7A 5TJJA 2CG4A 5ILUA 2FBKA 3CO7C 3GFLA 1QO0D 3CUQC 3QAHA 2MLKA 3U9GA 1H9GA 4NQWA 2UZKA 1Z05A 1R22A 1KYZA 1YW8A 3EQLF 1BI0A 1W4MA 1V4RA 5F1RA 2EWNA 3C3WA 2ZFWA 3V7RA 3WE3A 1T6SA 1XGSA 1LQ1A 1IRGA 5D8LB 3JSPA 5ILVA 1YS7A 1Z1DA 4KUMA 5ED4A 3BJOA 4HDUA 1MJBA 4G9YA 3NRVA 2VN2A 5DUIA 5FLXK 2A5YB 2DLLA 2H09A 2GWRA 1MZBA 4I02A 4LG0B 2G7HA 3Q9SA 2Y0MA 2AS5F 1FX7A 3IKVA 4AVPA 4KN4X 5CJ9A 1T38A 5BS6A 5J8CA 4LLLA 3F21A 3QU3A 5CYVA 3NEUA 3EUHA 3H92A 1ZRFA 3EYYA 4DNCA 3TO6A 4UVCA 3GW2A 3DEUA 3M1EA 4RAYA 4KMUX 2IW5A 2DK8A 2LF8A 1Z7UA 3CUQA 3KP5A 1JHHA 1T39A 5L3FA 1TQMA 5DCMA 1XDUA 2H6BA 3HSRA 3WGGA 4GO1A 5ILSA 3F22A 1IF1A 3LQQA 2A61A 4ENJA 2F2EA 5LHHA 1P4WA 4MEXF 5AIPA 1S7OA 2P7VB 1W7PA 1T98A 3GZ6A 2HFHA 4A0YA 4UV9A 2W57A 5E1WA 2VBZA 3WTUC 5FD5A 3RYPA 5E17F 1SMTA 2IP2A 3BPVA 4L5JA 1OYIA 2KJCA 4YIIA 1YW7A 4Q48A 4I2OA 3P9CA 3LA7A 5FGMA 3FXQA 1HW5A 5L3CA 2HEOA 1ZGAA 4PZJA 3R0AA 2J5OA 2WTEA 1U5TA 3RKYA 3O2PE 3J81Z 5D5XB 2GIVA 5FFZA 4N0BA 3QP5A 3WTZA 4L18B 3B02A 4YIFA 5FFXA 3L9FA 1JGSA 3HTSB 4P55A 2DU9A 2O61A 4HQMA 5BQTA 2UXXA 4EQQA 2L3DA 3RDIA 1U5TB 1RIOH 4A5MA 4WX9A 1B6AA 3IWFA 2HQRA 4M9ZA 4HX8A 4LJZF 4WCGA 4CDGA 2D45A 1IXCA 3I58A 2X4HA 4L0YB 4HA8A 2CGPA 3SHFA 5E1ZB 3FM5A 1J75A 2PEXA 2PMHA 3T8TA 3I5UA 4L9TA 1OYYA 3G73A 2L01A 1QPMA 3VODA 1W7PD 2PFBA 4U88A 2CFXA 4A6DA 2A07F 3QU6A 1LB2A 3J81K 1ZRDA 4ETSA 5LEKA 2EFWA 3FHZA 2ETHA 1I6XA 4QWQA 3F6OA 2E1NA 2EV6A 2RDPA 1U78A 2W24A 1DPUA 1ZGJA 1HW2A 1B9MA 3HOSA 1H9TA 1WQ2A 4NB5A 2QQAA 2YSRA 1JE8A 4WXDA 4R1HA 3PQJA 2VC0A 1W7PB 5JR3A 1XB4A 2P5VA 5LGUA 1RI7A 3CO6C 2JRTA 3WTWC 5HLHA 2Q0OA 3ZMUA 1LDDA 5JFRA 4Y17A 2WWYA 4I98B 2MA3A 2IRFG 1LEBA 2PBIA 2BYVE 2YU3A 3TGNA 3V8KA 1TW3A 6PAXA 3ULQB 1YTYA 3R4KA 3KCCA 1OR7A
chains in the Genus database with same CATH superfamily
3BJAA 2M7AA 2CU7A 1A6QA 2LDUA 1QVUA 3OWTA 3HG9A 2VONA 2ZB9A 5F6FA 4KICA 5HVQC 3GFMA 4D7NA 5GAGJ 2L02A 4M6YA 5D4RA 3TO9A 2RAEA 1Z3YA 3GBGA 1HC8A 3I54A 4KA4A 3LAPA 1EJ9A 2R7SA 1N78A 3GTLJ 5GTIC 1S6LA 2XKOA 2JSCA 3N4MA 1EF4A 4KDPA 1D0ZA 5J6XA 2W1OA 3EDPA 1R00A 1D1CA 1SFXA 5HDGA 3W6JB 1T8IA 1K6YA 2K7LA 1G2HA 3IL2A 1C0WA 3MD2A 2Z1DA 3REOA 2O8KA 1E0EA 2CUJA 1AWCA 1VFCA 3CJRB 4O3MA 1FIPA 3T0YA 1W5SA 2O6GE 4IHSA 4DBRA 3MZ8A 3GX4X 5F64A 1MNEA 2R4GA 1R5ID 1Z3XA 1KZHA 3NAUA 1LFUP 4CO8A 3JAMZ 1Z7LA 3NARA 4MGRA 3DXJF 3WTSC 1CF7A 2WA0A 4QLCU 2JQ7A 2PJPA 3J80Z 4XSZF 4BHPA 3JTGA 2QKLB 2XSJC 3WTTC 1HQCA 1V55H 2VIXA 2HKOA 2FBHA 3GF2A 2X0LA 4PJJA 4U0WA 3QWLA 5M5WJ 2L0KA 4ZYAA 1NH3A 4PGGA 2I5UA 4HDVA 4C3JJ 4RGSA 4F7ZA 1I27A 3CMYA 5KK1A 1TQIA 5F1JA 3JTHA 1YI2I 1SFKA 2CO5A 4IVNA 4BH9A 1PUEE 1ENHA 1A35A 1KONA 3HUGA 4IHYA 3GO5A 4PJNA 4ESJA 3L2WA 4UXNA 1Y1WJ 3F0CA 4KFCA 4EV0A 2JZYA 1NK2P 2Q2EA 2ECCA 3KP7A 2W7NA 5HS9A 4MNUA 1POGA 1YO5C 4EATA 2EFNA 3FM3A 3CCEI 1XSVA 3TBIA 2QLZA 1IN6A 2EZIA 4JP0A 2NS8A 1VI0A 5EG0A 1K83J 2DMTA 3O6BB 3JREA 3ZGKA 2M1BA 2ZO4A 4BDYA 4UVAA 1PYVA 2OQRA 2Y9YA 2XKPA 4BJ5C 1MSEC 1N75A 1BC8C 1RUNA 1Q1VA 4RLFA 3KP6A 4XICA 3Q5FA 4OINF 3J7ZI 1ETYA 1JT0A 3SXYA 4M9XA 1P2FA 2K4BA 2G7UA 1D3YA 1SFOJ 4U0YA 2PX9A 4X0GA 3KP3A 4HPQA 3SZPA 2EZKA 2QQBA 2QSGX 2JUCA 5KVRA 3WG7H 3DKWA 4M3FA 3G1LA 1FSHA 4OOIA 2ZJQF 1STZA 3KLOA 1HF0A 1FP1D 2XGDA 2JPCA 4KYWA 4BBSJ 3OYFA 4OU0A 2QBYA 2DOEA 1E3HA 1X1DA 4RAGA 3WG9A 2KMUA 1FYKA 1W36C 2QYOA 3H5RA 5ICGA 2ZXIA 4OIRF 4OIPF 3C2GA 3CDHA 4XK4A 3H3UA 4M71A 2O8XA 3M1CA 2V9KA 2JPBA 4BQOA 3V7CA 4Y33A 2I8DA 4AM3A 4OMZA 3LSTA 2VJ4A 2F4IA 2GLOA 1XC5A 2W4SA 2EFOA 4Q47A 4LOCA 2QEXI 1D1AA 1TWGJ 3V8JA 5IT3A 2LD5A 3JR9A 2HKXA 3O8HA 4G6DA 2O9LA 2HVRA 3BR3A 1PP8F 3IC7A 1F9NA 2DN0A 3S1NJ 2R5YA 3CC4I 3F8CA 1NG7A 3RPUD 3CQZJ 2CW8A 4XMYA 4RGRA 1QQIA 1A36A 1LVKA 3I3LA 1AHDP 3BQZA 4NUBA 2DA1A 1XDSA 2N8GA 2Y9ZA 5IP7J 1D5VA 3FX3A 4G7HF 3RPQA 4FX0A 1WPKA 2OA4A 5FKKA 4AIHA 4E6KG 2XASA 1RZ4A 1U8RA 1ACIA 1QNTA 4E7HA 1F1ZA 1SC7A 1B8IB 3VOEA 1H0MA 2ADUA 1CQTA 3V8LA 3JRDA 2VE9A 3DPLC 1SFUA 2X9DA 3OYIA 3W2VA 4PCQA 4RB0A 4ZYEA 4S04A 1SANA 4F92B 3SZGA 4RA2A 1TT5B 5L3BA 4HBLA 3G1OA 3SEQA 2BY0A 2IBDA 2D2WA 3WU1B 1Y8QB 2ZSIB 5E20A 2IS2A 1Z9CA 4V19K 3BCBA 2DA5A 1S9HA 2M30A 2ZBKA 3WGIA 2FMLA 3BR6A 3Q0VA 3S15J 3OIOA 3BPXA 2GA2A 1SD4A 2YS9A 3F6VA 3GMEA 3VYUB 1ZH5A 2L7FP 3QYEA 1T08B 3DLLF 4G8XA 2LBFB 4P1WA 1R5HA 2HQNA 5HNFA 1LKXA 2DAOA 4B09A 5FLMJ 4LG0A 3HHGA 4UNOA 3HOZJ 3H35A 1W5TA 2WB1N 1TBXA 1LFPA 2FSWA 5M3MJ 1SMYF 1R1VA 2IS6A 1ULYA 4EM2A 1RUOA 3E6CC 3FXUA 1T33A 2CQQA 5K1YA 1EH8A 2EA2A 5EGOA 4PFPA 4AUXA 2LVSA 2V1UA 4JYKA 1OKRA 4IZZA 3RSNA 4CHUA 1K61A 3MFKA 1KU3A 1LDJA 2IVMA 3MZHA 3GEZA 4DW6A 4P5OA 1BI1A 3E0JB 4HNTA 5EF6A 3PQKA 3S32A 2L4AA 1OQYA 3AG3H 2EBIA 1YLFA 3IAM2 1GVJA 2X6XA 3GTMJ 1JGGA 1KU9A 4E7SA 1MKMA 2NOGA 3GUDA 3BQYA 1Y39A 2W82A 2XV4S 2QF7A 2AQFA 2GQQA 2JJ7A 2XAUA 3IH2A 5DCMB 4WXCA 1K7AA 4X6AJ 3RYRA 2F48A 2DO7A 3IH3A 1LJ9A 5IY5H 2VJJA 1VQKI 2KZGA 3JSOA 1I39A 1YQAA 2R7RA 4IO9F 3W2WA 2R7XA 2XUBA 3IV5A 3MKWB 3H1CA 2CV2A 4BYYA 1HXDA 3BDDA 4XONA 3KYLA 4GYIA 1ZG3A 3TDZC 5E3OA 2KIQA 2XAJA 2DCEA 2RN7A 4GCVA 3I55I 3M7GA 2XB0X 5FRNA 2P0WA 2A6EF 4ZTJA 3CMMA 3CJQB 2DYRH 3JRGA 1ZG1A 3F23A 1NK3P 3QPLA 4IRGA 2FEZA 3ROUA 2KIUA 1XMKA 4Z6YA 3HM5A 1U6GA 2ZJ2A 2KT0A 3G4SI 5JI6A 1UJ8A 2VKEA 3D0SA 1GHCA 1AA7A 2YX4A 5LHGA 1LVAA 3OV8A 3RIRA 2O3FA 2TRTA 1Y6IA 1BL0A 3OYKA 2EH3A 4BBRJ 1OFCX 1WVRA 2PMZA 2V4JC 3GFIA 1YX3A 2DTZA 2UXNA 2BVLA 3OOPA 4V2FA 1P6RA 2QZ8A 3M8JA 5J1YA 4G7ZF 3TEDA 1G4DA 1MMDA 3DKYA 4U7DA 2K86A 4YFXF 4YFNF 2BBYA 3RKQA 4XLAA 3KETA 1PUFB 3ZQFA 3HPGA 3M07A 2OD5A 3KEOA 3IRRA 2JN6A 1MD0A 2A6HF 2BHZA 1MH3A 3GLXA 3BY6A 5D5VB 3H9JA 4RM3A 1S7AA 2XPUA 1YRNB 2M8EA 2XF6A 3ZQCA 1Z91A 4YG2F 4PJLA 4ZDOA 4UUSA 3V4GA 5B66C 2IPQX 1O7LA 3OYGA 2L9NA 4RAZA 3IRQA 2FX0A 2EV0A 2VLAA 1O3QA 1WJCA 2RNJA 4EJOA 4QSHA 4E7JA 2R7VA 1FEXA 2K9LA 5H6RA 3CCMI 1D1BA 3FMSA 3H9GA 3FZVA 3MN2A 4P96A 4GRIA 4A5NA 2IA0A 1IXSB 1JKPC 1IW7F 1YJ9I 3HDDA 5AONA 4IQJA 1P4AA 1MMSA 1VTNC 2Z2SB 4PFOA 3OYMA 3GCMA 3DBHB 2NRAC 4U87A 3OS1A 1R36A 2XVCA 1FJLA 1G6NA 2MH2A 5F27A 3LA3A 4IPAA 1I1GA 2LBFA 3K1NA 1N77A 4LK0F 2DPDA 1IV8A 2XF7A 1ZLJA 1ONVA 2VL8A 4K2EA 4LK1F 3LSRA 3ZQQA 2XRNA 2Y30A 4A0ZA 3K4JA 1OPCA 1DDNA 3KYCB 1IO2A 5J1UA 3KP4A 2OCCH 2A05A 4ESBA 2EK5A 3HOVJ 3J7AO 3OYAA 4I0AA 2FUG2 4XLCA 5B1AH 2BV6A 3HL2A 1R49A 4KIGA 2P5LC 1LE8A 2JA7J 2CQKA 4ZTFA 2DA2A 1FWZA 2Y75A 1H88C 9ANTA 2E7WA 4A3KJ 1ON2A 2DFIA 5DTDA 4YEJA 2IT0A 1P9QC 4CCNA 4QPQA 1G3WA 2HDCA 3ZQIA 1K4SA 5IPAA 4FETA 5J8FA 3GYHX 1LDKB 2KJBA 5F0FA 3VSKA 2BY3A 2VXDA 3IAS2 3P9IA 3KE2A 1FMVA 3DQVC 5GPAA 5E8GA 3DU6A 4HLXA 1VQMI 4N4NB 3MCZA 1OCOH 1A31A 5LGTA 4MO7A 4CICA 4XIDA 2QENA 2AO9A 2G9WA 3Q9VA 2OZUA 1BN5A 5BNGA 1ZK8A 1GUUA 1YE9A 1G3YA 3FF5A 3H3ZA 1ZRCA 4LLGF 2H8RA 3WU0A 4C2MJ 1SEUA 2OQGA 4XLFA 4I7HA 2NXNB 5GTHC 4JX6A 3U2RA 1W36D 2M34A 2M5WA 3K4NA 2LLKA 3GTPJ 4DZPA 1HBXG 1HDPA 3JRHA 1S72I 2E1CA 4ZH4F 3ZQGA 1IZ1A 2WY8Q 1A04A 1O3RA 3JRIA 3OR1C 1ZYRF 1AKHB 4PDKA 4IKFA 2EIJH 1KQ0A 1N25A 4LLNA 2HXIA 3BWGA 1J9IA 3OYHA 5KNLA 4BNCA 5D8KB 4R79A 1J2XA 3AG2H 2X85A 5ICEA 1FP2A 1ZARA 3JW4A 2V26A 2P7CB 4J01A 2MABA 4GFBA 1FBSA 1TNSA 4AU7A 2MD0A 5GAEJ 2JSPA 1TWFJ 5L3GA 1FYLA 3ZQ7A 2R7TA 1RPWA 2CSOA 1ZKGA 3HTUA 1GVDA 2STWA 4OMYA 5LLQA 2R93J 1V54H 3HOUJ 3J7AY 3S2WA 4HX4A 4JK1X 2EZLA 4NBQA 4XNFA 3HOXJ 1YHQI 1IGNA 3V7SA 3PO2J 1X4OA 3F72A 2VQCA 1X3ZB 3A03A 3ZP5A 3QPHA 3TO7A 5M5YJ 2LMDA 4RDUA 4MTDA 3AKZA 3FKJA 3AG1H 1FMWA 4XRMA 1QZZA 1M1EB 3ZN1A 4XLPF 4LB5A 2MD5A 1R9TJ 3DV8A 4A3LJ 3T1BA 3E5QA 3HSEA 3PFYA 4ABZA 3RKXA 2E7XA 4MFDA 2CUZA 5FO5A 1MDMB 3CCQI 4D0PA 5DDGA 3P9KA 2OBPA 3HSFA 2XROA 3TP0A 4MQ9F 4A12A 3BR2A 2KP6A 3EYIA 3WU2C 3HKZN 5B1BH 1BI2A 2M8GX 5HDNA 2GIZA 5D5WB 3OYCA 3ONQA 2TDXA 2MC3A 2JMWA 2V1XA 2KISA 1J5YA 2VXZA 3ZQHA 3N05A 3HOWJ 1IUFA 1WFXA 5K7HA 3PIOF 2X6OA 3ZMTA 4CUGA 2VBWA 2H27A 3KEYA 3OYEA 2BOLA 2G0EA 1OJLA 4HZFA 3LSKA 2HI3A 1XMXA 3ZMVA 1SD6A 4D9JA 2M0CA 4RM2A 3C18A 3FXMA 1QU3A 3UKGA 3DFGA 3QQAA 4A69C 1F5TA 1RR7A 3QYFA 2KRCA 1IG7A 2BVMA 1YFHA 4A3GJ 1JUMA 1BIBA 2D1VA 4PGHA 2EV5A 1AOYA 4XM3A 2E5ZA 1Z6TA 2DMUA 2PLYA 2V9PA 1USTA 2IJLA 2DJIA 2BXZA 2QWWA 1WH5A 4LB6B 3CLOA 3T5XA 4XRSA 3S3MA 2FNAA 5CLSA 5A2QK 1R23A 4GYGA 4DOZA 2KDZA 1I6HJ 1L0OC 4UUVA 2IGMA 5IOZA 2PQ8A 2R7FA 3QPTA 2IAIA 3VPRA 2M45A 4HV5A 4JOMA 4DBQA 4RB2C 1G59A 1SVMA 1O4XA 1WJBA 2IGNA 4KN7X 4HLYA 2CYYA 2R7DA 2KIFA 4ANJA 1OYWA 3PSIA 4L9NA 4D5CA 5J4VA 3OL3A 3CCJI 5A2QZ 1B72B 2PI0A 4E70A 1MNDA 4UHTA 5HOOA 2AXTC 3ZPLA 3CF2A 3OYLA 3QRFF 2GXBA 1U5TC 1E2XA 4AWXB 2OF7A 2OPTA 2RNGA 1D8KA 3F8FA 1D8JA 3UR3C 2ZXWH 1CF7B 1QVTA 4HSTA 2NVYJ 2ESNA 2L9VA 4Y52J 2VI6A 3W6VA 3F8NA 3RQIA 1OMIA 2DT6A 2EFQA 2J5PA 2NNYA 2YUSA 5HS7A 3FBIB 1REPC 3PNTA 4RGUA 1UHMA 4B43A 2PN6A 2ECBA 3R6SA 3S2DJ 2XDVA 1Y1VJ 3T8RA 2KQRA 3A02A 1DU6A 3GXOA 2X48A 1BJAA 2Y69H 2FQ3A 2DI3A 3L2CA 1YJNI 3TMOA 1ZR4A 2IS4A 3CP8A 2ELJA 4HNUA 2JK3A 4IF4A 3KZYA 1XTAA 2Q2EB 3WGHA 3TQNA 4M74A 3MZYA 4U0VA 4M6XA 2COMA 2WBMA 5F0CA 4HF2A 3K9TA 1ZN2A 4B48A 1U9NA 3E5XA 3GFJA 3FWEA 4M73A 4PK4A 2ME6A 3OIPA 4E7KA 5E3LA 5EDNA 3F9KA 3HRTA 2RVCA 4CCOA 2EJRA 2ZMEA 4ZDPA 4P9UA 1B8IA 1KU7A 4I09A 1MMNA 3CESA 3K1MA 2CS3A 2QKMB 3CF5F 1SFEA 2WAFA 1TC3C 4RMNA 2CWEA 5LRRA 1E17A 5H6QA 3CCYA 3S3OA 3BG7A 1MMAA 1ORKA 5JLXA 3KZZA 3ABMH 3DLAA 5FD6A 2VB6A 2R5ZA 4NHJA 4Y7NJ 2RC4A 3CCLI 5M5XJ 1R5GA 3O3KA 3MKYB 2Z3YA 3M8FA 3LFUA 5E8IA 3R61A 4ESFA 3S1QJ 5E1XA 1U2WA 1VQPI 2ID3A 2DBBA 4UVBA 4FX4A 1SD5A 2DT5A 4UUTA 2KL4A 3QOEA 4OIQF 1FOYA 5KCMA 2Q8KA 2B0LA 2IA2A 2NVUB 4ZDLA 1VQOI 1ETOA 2M9HA 2B9SA 2KIMA 1IDYA 1EKEA 1PVEA 1IC8A 4G6QA 4KIFA 2K9NA 2HDWA 2L2OA 1F4KA 1O3TA 3I59B 1MJAA 4CYDA 3Q0UA 1FNNA 3W6KB 4R8HA 5E18F 2XPWA 4BHCA 1TWAJ 1BM9A 4XN3A 3GZ5A 3PUFA 4Q4ZF 4W1UA 2VODA 2K3FA 1JT6A 1YIJI 2X1DA 4XRSG 4OAZA 5FKMA 3HB9A 3F8MA 2K4JA 3WE2A 3V42A 2YR2A 4ZYDA 1OLTA 3KCCA 2H8WA 3TKYA 3G71I 2NVQJ 3S14J 3K0LA 1Z67A 1WCMJ 2E19A 5E79C 5K7ZA 1VQ9I 4PJMA 4MEYF 1RESA 3J80K 1DPRA 1K78A 3BR0A 1FTTA 2KFDA 2OJED 1PDNC 3JRFA 2DFHA 1XSDA 3M3YJ 2M3AA 3KX2A 3CJNA 4ITVA 1O3SA 2LP0A 3K4MA 2HOTA 1OR7C 2AQEA 5C44J 2HU9A 1JUSA 1Y8RB 2F5CA 1ZGWA 4QIWN 5JHUA 2XSDC 1T95A 5CVUA 3HGGA 4BL0B 3RZOJ 4W97A 2F5EA 1WJEA 4O6JA 3FIWA 3ZMDA 2CH0A 3FMRA 4XLNF 1R6RA 1TLHB 1IXRC 3ZOBA 1IUYA 1T2KA 3MWMA 4EJVA 5LBQA 1SVLA 1Z6RA 3MKZA 1MMGA 3X2QH 2LRDA 5DD8A 5H2FC 4II2A 1XPXA 2HS5A 4FE7A 2OZ6A 3H36A 2XAFA 3HXLA 3GWZA 2DA4A 2EB7A 5IT9K 3A1YA 3UNGC 4KIBA 1Y0NA 2GAUA 3I64A 4ENMA 1TTYA 5EG0B 2IGOA 4LG3A 1JTXA 3LQRA 2M87A 3C2BA 4BEHB 2GXGA 2FXAA 2RQQA 4ZZLA 2R3SA 2MBFA 4AIKA 2DFEA 1QBJA 2CJJA 4E7ZA 2E71A 4KITB 2ZNZA 1K79A 1JJ8C 5DM7F 2V9VA 4XQFA 2RV8A 4M9SA 3L2VA 2BEOA 3ABTA 1J09A 4BQAA 5LFAA 3MKLA 4UY8I 3ABKH 4HNVA 2FMYA 1UG2A 1I5ZA 2BY1A 2JT1A 3PM1A 2HOAA 4DYRA 2E1OA 1X3UA 5LD2C 4EM0B 5LEJA 4EJWA 2BGCA 4EGYA 4IHXA 4NC7A 3DTIA 4BXFA 1Y0UA 4YFKF 2EFPA 2ZMEB 3E97A 1F36A 2HTJA 4QPOA 4OIOF 2L7ZA 3HBLA 3QP6A 1CGPA 4CGZA 1ERDA 1XGNA 1XSXA 4U7BA 2CV1A 5DD4A 5FROA 4FHTA 1FOKA 4HEA2 3ERMA 4KMFA 3GTGJ 2EA4A 5TISC 5HS8A 4EM1A 4A3MJ 2K02A 3BG6A 1HDDC 2F4OB 3K2ZA 2VJ5A 5ICCA 4KNYA 2STTA 4DJAA 2ISZA 4PSXA 4IHWA 3IWZA 1LEAA 4XOPA 2P5KA 1RKTA 3RPUA 1W0TA 3ECOA 1FC3A 1VQNI 4IJAA 3NQOA 2FRHA 1AU7A 2VKVA 4B3XA 2CUFA 5GP9A 4XSXF 3ZXSA 5C4JJ 4MQVA 1JI8A 2ID6A 2W84A 2I10A 3PUBA 5DYMA 4DGWB 3G1MA 2KZVA 1TQPA 1FSEA 2L5QA 3HKZA 5IYCJ 4BJ6C 2V6EA 2OUMA 2EILH 3DEWA 3TOBA 1OISA 1UHSA 3L7WA 2RGVA 3I59A 2DQRA 4G7OF 2VT3A 3BLYA 1HCRA 5HNHA 2MG4A 3S8PA 2MLGA 3BTCA 1YJWI 3GTKJ 2W48A 4BUPA 4DYQA 3EUHC 3HRSA 5CVRA 4N9HA 1VNDA 1FIAA 3HC7A 4NQWB 2KHMA 1B9NA 2LREA 1MBJA 3S93A 2L54A 3KLNA 1IRXA 4MHGA 2VOPA 4MLOA 2LK2A 1X2MA 4L5EA 3ELKA 5JLWA 3C7JA 1K4TA 1WKMA 3ZMSA 4RB3C 1JKRC 3P5JA 3RJPA 3ASNH 3I56I 3HOTA 1KA8A 2X51A 3MEXA 3WTXC 3CLQA 3E7LA 3KYDB 1YS6A 1K6OA 2R7ZJ 1Y56A 3CMEI 2NAZA 4DYCA 5DS9A 3P7NA 1J59A 4I0BA 3VB2A 3LNQA 3ZN0A 2GZWA 1HSJA 1VZ0A 2O7OA 2QQ8A 2LNBA 2CMPA 1J7KA 2ZXJA 3LAJA 2V79A 3R60A 2BW3B 3FK7A 2XHKA 3L09A 1JXSA 3ESWB 4RGXA 2X1EA 2E34A 3FBNB 1RKWA 4BHBA 3CD6I 1HKTA 4O5VA 2LFBA 1FZPB 1ZTRA 1S3JA 3D1NI 2K85A 4IQ4A 3K1PA 4XKWA 4EJUA 2HR3A 3N97A 2Z5UA 2M7BA 4L9JA 4ENKA 1GDTA 5ICFA 2CFOA 2R7WA 3ZMZA 2HOSA 2GBYA 5CVVA 3WHBA 2ZMEC 5K5OA 2HDDA 1TNTA 2ISYA 1ZELA 4F91B 2XB5A 2W00A 2UUZA 3LSIA 2Y0SA 1ZQ3P 4HW0A 2V1DA 2HOEA 4I6ZA 2JWTA 3IUOA 4HX7A 4IHTA 4A6EA 3OSFA 4HAMA 4CH7A 1NHAA 4AIDA 3KP2A 3JRBA 5HLIA 1ZAOA 2GXAA 1FYMA 1YX5A 3BC8A 2KPMA 1BW6A 4CXFA 2YPRA 3HHHA 3F3XA 4DQ2A 3B73A 1P7JA 3H5AA 1SAXA 1QA6A 2CRGA 4KT5C 1IJWC 2Y31A 3FXKA 4ZZDA 2L4MA 4QTRA 2NVXJ 4A3BJ 3E6BA 5BPDA 4FTHA 1X4PA 4G6TB 2XAHA 2FA5A 3A0HC 2WV0A 1MBKA 1QHGA 2NS7A 4CZZA 2HZDA 3S2HJ 2FE3A 1QGPA 2FOKA 2JA8J 3DPUA 4AD9A 2VPLA 2MYSA 3E1SA 3VFZA 4AVZA 2JTVA 5LRSA 4LIUA 3WTVC 4ZYHA 2CW0F 2O03A 4JX5A 4TV7A 4B8XA 4C9YA 2L7MP 4HYEA 5BPIA 1B1BA 1S29A 2VOOA 1RR8C 1XCBA 5J1RA 1DU0A 1WWXA 2IA1A 1O57A 2JRMA 2EIKH 2VBYA 1WJDA 2NNNA 2Z99A 4EGZA 2A69F 4OWRB 5D5UB 2LY9A 1IN8A 2IEKA 3Q3SA 2QGUA 3QOPA 4FT8A 4LMYA 1IRFA 2QSHX 3PO3J 5M3FJ 1NG6A 4GXOA 2DPUA 2Q1ZB 3KEQA 2LKXA 3DP7A 4UB8C 3I71A 1G3TA 1BW5A 1R1UA 1B59A 3BOQA 2VPRA 1ODDA 2HPIA 4A3IJ 2JVHA 2DOAA 1OCTC 3M4OJ 3CDIA 1WH7A 2OV7A 1YW9A 5JHFA 1A5JA 3CUOA 3GVAA 5FKLA 4G94A 3SFZA 3EETA 1O7FA 5BMZA 3SDBA 1S5LC 1ZLKA 5IT9Z 1T0FA 5H20A 2IS1A 2EINH 2XAGA 3LMMA 3VYTB 5TRDA 2JA6J 5HLGA 3HRUA 2ELHA 3BTIA 1B4AA 3FKIJ 3W3CA 2V6CA 4XRFA 3DTEA 2FBIA 3DPTA 1BR4A 1TWHJ 2VBXA 2MSYA 1UMQA 2WY7Q 3CCVI 4M72A 2FQ4A 2OU2A 1P92A 4IOAF 4CA0A 3PFIA 3GTJJ 2BE5F 2FJ1A 1BOAA 1XGMA 2ME0A 3FXRA 2DMNA 2LSOA 5GPCA 2F5VA 1V5GA 1H89C 3OS2A 5EEHA 3D5LA 4RS8A 5B3SH 4S0HB 2GA1A 2R92J 3LSPA 4IXAA 2LF7A 2JUGA 1JHFA 5FLXZ 1IRZA 4HV6A 2QQ9A 4JBAA 1EV7A 1YG2A 1VQ5I 3AFHA 2VC1A 3TP3A 2HYFA 2VJIA 1UHWA 2W85A 5DUKA 2FU4A 1SD7A 1PP7U 1DGWY 3DKXA 4GGGA 2F5FA 3VEPA 1RRJA 2AXLA 3LOCA 2QCOA 1IAWA 4A3FJ 3OYDA 1R7JA 1BC7C 4L5IA 3BG3A 2DW4A 3A2KA 1ZG5A 1FY7A 4BACA 3OSGA 1X1AA 2IGKA 2P6SA 2DK5A 1ETVA 3HYIA 2WAQA 1MH4A 3E6DA 5IOYA 3FHNA 1EA3A 1YYVA 1HOMA 2XF5A 5JVGF 4HQEA 3MAJA 5FKOA 2DYSH 2Y2ZA 1J0RA 4JX4A 1UB9A 3PSFA 4H0EA 5FB2A 1U0JA 3BZKA 3MVPA 3SZTA 4M3BA 5ERIA 1MJ9A 4XR6A 4XLEA 2X6WA 3BR1A 3K69A 3WHCA 1JKQC 3CC2I 3H0DA 5JVTA 1DP3A 3KFWX 1FPQA 2WAQN 3LWFA 2LOOA 1QPIA 3TOAA 5L3DA 2QM3A 3U1DA 2Z33A 2HVSA 3EUAA 3MMYB 1FBQA 4BE0A 3E6MA 4BQQA 2PMZN 3C1DA 2KRFA 4HOBA 4BY1J 2RKHA 1BI3A 4ENNA 5F04A 1U3EM 3JAMK 4XKCA 1PUFA 2ZSHB 4IRHA 5DM6F 3EPZA 3ZR8X 4F93B 3OOUA 1TWCJ 1KYWA 3HZJA 3SQNA 3RI4A 3O8GA 4WXHA 2F5DA 3ABUA 4F3QA 5FKNA 3RKWA 4HF0A 3CTAA 2DDAA 5BOXA 2K9MA 3COAC 1R4MB 5K5RA 4E7IA 2K3PA 1TZLA 3GLLA 1UELB 3M8EA 1GV5A 2HYGD 5D6EA 1LUJB 1WSUA 3G3ZA 2KKOA 4Y13A 1XGOA 3PL8A 4EJTA 5HLTA 2C6YA 2HZTA 1BBYA 1V5EA 5HDKA 3VSLA 3R0JA 3I53A 4A3EJ 1LPQA 1EH6A 2V1NA 1ZR2A 2V7FA 2OC6A 3ISPA 1EH7A 2R5YB 3FMQA 2RREA 1WI9A 1X19A 1FBUA 1LNWA 3I0TA 4IX7A 3CUQB 2VQLA 4CCMA 4JQFA 1X1CA 4L9VA 1E3OC 2DMPA 2WADA 4LGWA 5DCFA 2F6CA 4XOTA 4WWCA 2QVOA 3DF8A 4MTEA 4WK8F 3WTYC 2UWMA 4M3GA 3I4PA 4B47A 3HRMA 2H94A 2HVQA 4C2UA 5L3EA 2DOFA 3IKTA 4A2UA 1GLNA 2PJRB 1UFMA 3DBLB 3LL7A 5LGNA 2Z9OA 2JVGA 1RETA 3PNYA 2VKHA 2D5VA 2DXIA 1OCRH 5TGTA 4KISA 2R7UA 2LYCA 2DMQA 3K4BA 3A01A 3L2RA 1MDMA 3GTOJ 1FTZA 2FNPA 3CC7I 3A0BC 2DJNA 2VE8A 3BP8A 1Q1HA 3M9AA 2E5NA 3NWSA 4S05A 1ZHFA 2M4GA 4HF1A 3F8BA 2BHYA 2KRHA 2NS0A 3BT9A 1S8NA 2QUFA 4F52A 2ZKZA 2E36A 2ACJA 1W5CC 4HSRA 1L3LA 4UV8A 1HKQA 2P6TA 3NWTA 3CCSI 2XGCA 4Z2YA 5AIQA 2DA6A 5CVJA 2A68F 1R71A 2CQ7A 4ON0A 2COBA 1OCPA 1USSA 1YITI 1FLIA 4XKVA 3H3VK 2JA2A 4AIJA 3FXOA 1I1SA 4BXUA 3TW6A 1K78B 4EVIA 1HW1A 2HPMA 2Y48A 5DV5A 3BJ6A 2DQLA 2D1HA 1GXQA 1P4XA 2XGXA 5IP6A 3I4MJ 2KLOA 3GZNB 5D6FA 1R58A 2GOXB 2HWVA 1GXPA 2X1CA 2XPVA 1I50J 3TL4X 4EMSA 1OCZH 3MQ0A 2YX7A 3OY9A 4C3HJ 1XD7A 3SDGA 1VF9A 1YIOA 3RQ4A 1QZYA 4BAYA 5EEGA 2ESHA 3E3VA 4Q5SF 1RNLA 3B6AA 2B63J 1IN5A 3LA2A 1ON1A 1PJRA 1V3FA 1JJ6C 4XBFA 2DA3A 4X1EA 1YOVB 3OYJA 1FOWA 2H6CA 2L7KA 4IRIA 1XCVA 2VT2A 2XIGA 1AKHA 1ITYA 4LIVA 3WODF 3TDUC 1VQ4I 3BZ6A 2M2EA 2K27A 5IP9J 3CP2A 3BR5A 2A3SA 1IN4A 1WRJA 2P4WA 2XAQA 3E5UA 2OAZA 3I9V2 2DTRA 1HKSA 2NOJB 2ICWG 3HIFA 4AC0A 1D0XA 4LD5A 3L00A 4I99C 5J40A 4A0XA 1KQ8A 2K40A 1GV2A 2PG4A 3BTLA 1MGTA 3D5SC 1BOBA 1KGSA 2WAEA 2IXSA 3BROA 3KIOA 2ZJPF 3H9QA 3W2AA 4RAFA 2F4MB 2R0QC 1TW2A 4LFUA 4ASNA 3JRAA 3CCRI 2LKPA 2WC2A 2ZNYA 5IYDJ 5LHIA 1UCRA 4N9IA 5DEQA 2VASA 4D7MA 3K6GA 4WF2A 3JRCA 1XMAA 3EUKL 5CVIA 1R1TA 2NYXA 3K4KA 4PJ0C 4RB1A 3LSGA 4NC8A 2LR8A 3ERED 2OCEA 5B5EC 1ETKA 3S1RJ 3L2UA 4J19A 2M4KA 1VQ7I 1KU2A 3RTRA 4CYCB 2UV1A 2CUEA 4NDLA 5KAIC 2ZCWA 4B4CA 4P9FA 2HYJA 3OMYA 2MH9A 2DFFA 3LFKA 4BS9A 1MSFC 3S1MJ 1T0FC 3SJMA 1FT9A 4I01A 1DUXC 2E1MB 3IHUA 2HGCA 4F55A 1MNMC 2QBYB 3ECHA 3ZQLA 2M0MA 3HGYA 2W25A 4ZYGA 2RQPA 2ZC2A 1HLVA 3ML6A 2P8TA 5K5QA 1X2NA 1BR1A 3S16J 3DTKA 2O0YA 1ZREA 2FF4A 4RBOA 1MBEA 4Y3OA 1DGRM 3FISA 1DP7P 2HTSA 2E2HJ 5D4SA 1KQ9A 4L0ZB 4Y15A 3AAFA 1P7IA 4UB6C 2K5CA 1XN7A 4UUSB 1E3PA 2CQNA 2PMUA 2FOWA 1BIAA 1HSTA 1V5FA 1IN7A 1Z0XA 5TJJA 3K10A 2CG4A 4GDFA 5ILUA 2FBKA 3CO7C 3GFLA 1QO0D 4CCKA 3L2QA 1TP4A 3CUQC 2E35A 2Y0SN 4BGDA 3KPHA 3QAHA 2MLKA 3U9GA 1H9GA 1A6IA 4NQWA 1VQLI 4J00A 2CV0A 1H8AC 1BR2A 2UZKA 3K70D 1Z05A 1R22A 1KYZA 1YW8A 3OYNA 3EQLF 3HJEA 3FXJA 3HOYJ 4XL9A 3K2AA 1BI0A 2OTLI 1W4MA 5C4XJ 1V4RA 2Z16A 5F1RA 3TW7A 2VUMJ 4BJTA 2TCTA 2EWNA 4IEJA 4Y4RA 3C3WA 2ZFWA 3V7RA 3WE3A 1T6SA 1XGSA 2BY2A 2H1LA 2LH9A 4YELA 1LQ1A 1IRGA 3J7YJ 5D8LB 3JSPA 5F08A 1GT0C 3BZCA 5ILVA 1YS7A 3U21A 5FLVA 4IOCF 2XGEA 3AL0C 1Z1DA 4KUMA 3FXLA 5ED4A 3BJOA 4I76A 4HDUA 3CJTB 1MJBA 4G9YA 1I3AA 3IH4A 1ETQA 3NRVA 2VN2A 4BXXJ 2L9RA 3HPHA 2EPFA 4NNJA 2A5YB 2DLLA 2H09A 5CQEA 4CCJA 5DUIA 3C2HA 5FLXK 5J4YA 2GWRA 1QHHD 4N4OB 1MZBA 4I02A 4LG0B 3SYTA 2G7HA 2QSFX 2WV1A 3Q9SA 2DT7B 2Y0MA 2QA4I 3BCAA 2AS5F 3CMAI 1UG0A 1FX7A 3IKVA 4AVPA 1MBHA 4E7LA 4KN4X 5CJ9A 5BS6A 5J8CA 1T38A 1ETXA 4LLLA 3F21A 3QU3A 4C3IJ 2LG4A 4HG2A 5CYVA 3NEUA 3EUHA 3VYSB 5K7FA 3H92A 1ZRFA 3LSMA 3EYYA 4BQNA 4DNCA 3TO6A 4UVCA 2DODA 2R7OA 3GW2A 3JCUC 3DEUA 2P81A 1BA5A 3M1EA 4RAYA 4KMUX 5EYRA 2IW5A 1WGXA 3BG9A 5KHDA 2DK8A 4BKXA 5FJ8J 4CCLA 2LF8A 1Z7UA 3CUQA 2YU9J 3KP5A 4KJZA 1JHHA 4BDZA 3ZRGA 2ZFUA 1T39A 5L3FA 1TQMA 1YRNA 4BE1A 5E3NA 3K4CA 5DCMA 4ZJZA 4EEFG 1XDUA 2H6BA 1Z77A 2R7QA 3HSRA 3WGGA 4CZCA 4GO1A 5ILSA 3F22A 1IF1A 3LQQA 2EZHA 2A61A 2LTPA 4ENJA 2FD5A 2F2EA 5LHHA 1P4WA 4DIQA 2MGQA 4MEXF 5AIPA 1S7OA 5EZHA 2P7VB 2NVTJ 2A5WA 3ABLH 4CSWA 4C30A 4IL6C 3G2BA 1TL8A 1FOXA 1W7PA 1T98A 4M6VA 2CW7A 3GZ6A 2HFHA 3CCUI 4A0YA 4UV9A 2W57A 5E1WA 2VBZA 5FD5A 3WTUC 4V2GA 2MW8A 4G12A 3RYPA 4BY7J 5E17F 5J3LA 4OAYA 1SMTA 2IP2A 5HODA 2K9SA 3BPVA 4MFEA 3PJRA 3Q0WA 4L5JA 5EJCA 1OYIA 1DQUA 2KJCA 3PNVA 3RZDJ 3QYBA 1MW7A 4YIIA 3K70C 4PSWA 3H0GJ 1LFBA 2E2JJ 2E1MC 1QRYA 1OCCH 4XLHA 1YW7A 3D5RC 2EIMH 1XX5A 4Q48A 2B7EA 4E4HA 4D1QA 3HEFA 1W1WE 4I2OA 3P9CA 3LA7A 1BJZA 1TT0A 5FGMA 2X6YA 3FXQA 1VQ6I 1HW5A 1WJ5A 1T56A 5L3CA 1ZGAA 2HEOA 4PZJA 1S7EA 5EEAA 3LSJA 3DEEA 3R0AA 4II3A 3PIPF 2J5OA 1ETWA 3OL4A 1QZEA 2WTEA 1U5TA 1U8BA 3RKYA 3ASOH 1JKOC 2LKSA 5FRMA 3O2PE 2VQGA 1JUPA 5EZGA 3J81Z 3L1PA 1U9OA 2R5ZB 3U1KA 5D5XB 2LY1A 3OS0A 2GIVA 3OR2C 3VDXA 1IV6A 1WZ2A 4RLQA 5FFZA 4D5FA 5GAHJ 4N0BA 3A01B 3QP5A 5J47A 5F0HA 3WTZA 4L18B 4IHVA 2K9QA 3B02A 2XC7A 4YIFA 3S17J 2HNHA 5FFXA 2VQHA 1G8XA 1IDZA 2L9SA 3L9FA 1JGSA 3HTSB 4P55A 2DU9A 2O61A 4HQMA 5BQTA 2UXXA 4EQQA 2L3DA 3RDIA 5EGOB 3IP4B 2BZTA 2DDBA 2AHQA 1U5TB 2BXYA 5CQGA 1RIOH 4A5MA 4WX9A 1B6AA 3IWFA 2OTJI 2HQRA 4M9ZA 4DZJA 1UAAA 4HX8A 5CKTA 3K4LA 2LC2A 3B6CA 2XRLA 5GADJ 1XS9A 4LJZF 4FQGA 3BTJA 4B1RA 2O5RA 3H5NA 4FISA 2HQAA 1LE8B 3KZIC 2GOMA 4WCGA 4C2TA 1RC9A 2A6TA 2HXOA 1D0YA 4CDGA 2D45A 1IXCA 3I58A 2X4HA 1B72A 4BEHA 4L0YB 4CYCA 2E2IJ 3AL0B 2VKDA 2MFZA 1WJFA 4HA8A 2CGPA 3HUGB 3SHFA 1MIJA 1SVOA 5E1ZB 4FCYA 2LY2A 3FM5A 4MIMA 3CZ6A 1J75A 2PEXA 2PMHA 3T8TA 3I5UA 4XORA 4L9TA 1OYYA 3G73A 1X1BA 2HQ5A 3G6EI 2L01A 1QPMA 3VODA 1W7PD 2BW3A 2PFBA 4U88A 2CFXA 4KT6A 4A6DA 1APLC 2A07F 5CPRB 3QU6A 1HA8A 1LB2A 3J81K 2JA5J 1ZRDA 2ZJRF 4ETSA 3AG4H 2CQXA 1X1PA 5LEKA 1UZCA 4A93J 4XN0A 1I3QJ 3RCOA 2EFWA 5C3EJ 3FHZA 1WI3A 1I6XA 2DA7A 2ETHA 4QWQA 3F6OA 2E1NA 3K7AJ 3OIQA 3SFIA 1W0UA 1WJAA 4A3CJ 2E60A 2EV6A 5KAFC 4B3AA 5IYBJ 1XG1A 2GM4A 3OYBA 2H1KA 2ELKA 3VWBA 1F43A 3SEZA 4AYBN 1NTCA 2RDPA 5E3MA 1MBGA 2MC4A 1U78A 2W24A 3I4NJ 2KDOA 1DPUA 4HRIA 1ZGJA 2EQRA 1HW2A 1B9MA 3HOSA 1H9TA 1WQ2A 4NB5A 2QQAA 2YSRA 3CDLA 3LSHA 1JE8A 4FE4A 4WXDA 4R1HA 4A3DJ 1D5YA 3PQJA 2VC0A 4BU2A 3A4CA 1W7PB 5JR3A 1XB4A 2P5VA 3DCFA 1X58A 3FDYA 1RI7A 5LGUA 3CO6C 1SAUA 4H4KC 4M3EA 2JRTA 1JTYA 1R4NB 4PUSA 3WTWC 3ZCOA 3GTQJ 5HLHA 3QPSA 3S3NA 2Q0OA 1WHUA 3ZMUA 1VQ8I 4BE2A 1LDDA 3DU5A 5JFRA 4Y17A 1X3WB 2WWYA 2ZXHA 4I98B 2MA3A 2PJRA 3BG5A 1MBFA 4M3DA 3DWLE 2IRFG 4ZC3A 1LEBA 3VYRB 3FK6A 2PBIA 3DBRB 3QODA 4YIRX 2BYVE 4LITA 2YU3A 3TGNA 4NC6A 4FASD 3V8KA 1TW3A 4YRVA 1Z21A 6PAXA 4XKBA 4B44A 3ULQB 1YTYA 3R4KA 4AYBA 1G3SA 4A3JJ 2WB1A 1OR7A
chains in the Genus database with same CATH topology
3BJAA 2LDUA 2VONA 5F6FA 4KICA 5HVQC 3GFMA 2L02A 4M6YA 5D4RA 3TO9A 3I54A 4KA4A 3LAPA 1S6LA 2XKOA 2JSCA 3N4MA 4KDPA 5J6XA 3EDPA 5HDGA 1R00A 1SFXA 3W6JB 2K7LA 3IL2A 1C0WA 3REOA 1AWCA 4O3MA 3T0YA 1W5SA 2O6GE 4IHSA 3GX4X 5F64A 4CO8A 3JAMZ 4MGRA 3DXJF 3WTSC 1CF7A 4QLCU 2PJPA 3J80Z 4XSZF 4BHPA 3JTGA 3WTTC 1HQCA 2HKOA 2FBHA 3GF2A 2X0LA 4U0WA 4PGGA 4HDVA 4RGSA 4F7ZA 1I27A 5KK1A 1TQIA 3JTHA 4BH9A 2CO5A 4IVNA 1PUEE 3HUGA 3GO5A 4ESJA 4UXNA 4KFCA 4EV0A 2JZYA 2Q2EA 3KP7A 5HS9A 4MNUA 1YO5C 2EFNA 3FM3A 1XSVA 2QLZA 1IN6A 3O6BB 2M1BA 2ZO4A 4UVAA 2OQRA 2XKPA 1BC8C 1RUNA 3KP6A 3Q5FA 4OINF 3SXYA 4M9XA 1P2FA 2K4BA 2G7UA 1D3YA 4U0YA 3KP3A 3SZPA 2QQBA 5KVRA 3DKWA 1FSHA 4OOIA 1STZA 3KLOA 1FP1D 2JPCA 4KYWA 4OU0A 2QBYA 3WG9A 1FYKA 2QYOA 5ICGA 4OIRF 4OIPF 3CDHA 3H3UA 4M71A 2O8XA 2JPBA 3V7CA 4OMZA 3LSTA 2EFOA 4Q47A 5IT3A 3V8JA 2HKXA 4G6DA 1PP8F 3IC7A 1F9NA 3F8CA 4RGRA 1QQIA 1XDSA 1D5VA 3FX3A 4G7HF 3RPQA 4FX0A 4AIHA 2OA4A 2XASA 1U8RA 1RZ4A 1QNTA 1F1ZA 3VOEA 1H0MA 2ADUA 3V8LA 2VE9A 3DPLC 1SFUA 4PCQA 4RB0A 4ZYEA 4S04A 5L3BA 4HBLA 2D2WA 3WU1B 5E20A 1Z9CA 2M30A 2ZBKA 3WGIA 2FMLA 3BPXA 2GA2A 1SD4A 3F6VA 1ZH5A 4G8XA 1R5HA 2HQNA 2DAOA 4B09A 4UNOA 4LG0A 3HHGA 1W5TA 1TBXA 2FSWA 1SMYF 1R1VA 1ULYA 4EM2A 1RUOA 3E6CC 3FXUA 5K1YA 1EH8A 2EA2A 2V1UA 1OKRA 4CHUA 3MFKA 1KU3A 1LDJA 2IVMA 3MZHA 3GEZA 4P5OA 1BI1A 3PQKA 2L4AA 1YLFA 1GVJA 1KU9A 1MKMA 3GUDA 2XV4S 2GQQA 5DCMB 4WXCA 1K7AA 3RYRA 2DO7A 1LJ9A 3JSOA 1YQAA 2XUBA 4BYYA 1HXDA 3BDDA 4GYIA 1ZG3A 3TDZC 2XAJA 2RN7A 4GCVA 3M7GA 2A6EF 1ZG1A 3F23A 4IRGA 2FEZA 3ROUA 2KIUA 1XMKA 1U6GA 2ZJ2A 5JI6A 3D0SA 1GHCA 2YX4A 5LHGA 1LVAA 3OV8A 3RIRA 2O3FA 3GFIA 2UXNA 3OOPA 1P6RA 2QZ8A 4G7ZF 1G4DA 4U7DA 2K86A 4YFXF 4YFNF 2BBYA 3KETA 2OD5A 3KEOA 3IRRA 1MD0A 2A6HF 3GLXA 3BY6A 5D5VB 1S7AA 2M8EA 1Z91A 4YG2F 3V4GA 2IPQX 1O7LA 4RAZA 3IRQA 2EV0A 1O3QA 2RNJA 4EJOA 5H6RA 3FMSA 3FZVA 4P96A 4A5NA 2IA0A 1IXSB 1IW7F 5AONA 1P4AA 1VTNC 2NRAC 1R36A 2XVCA 1G6NA 2MH2A 3LA3A 4IPAA 1I1GA 3K1NA 4LK0F 2DPDA 1ZLJA 1ONVA 4K2EA 4LK1F 2XRNA 4A0ZA 1OPCA 1DDNA 3KP4A 4ESBA 2EK5A 3J7AO 4I0AA 2BV6A 4KIGA 2P5LC 2CQKA 1FWZA 2Y75A 2E7WA 1ON2A 2DFIA 2IT0A 1G3WA 2HDCA 5J8FA 3GYHX 1LDKB 2KJBA 3P9IA 3KE2A 3DQVC 5E8GA 4HLXA 3MCZA 5LGTA 4CICA 2QENA 2G9WA 3Q9VA 2OZUA 1BN5A 1G3YA 3FF5A 3H3ZA 1ZRCA 4LLGF 3WU0A 2OQGA 4I7HA 3U2RA 2M5WA 1HBXG 2E1CA 4ZH4F 1IZ1A 1A04A 1O3RA 1ZYRF 4PDKA 1KQ0A 4LLNA 3BWGA 1J9IA 4BNCA 5D8KB 4R79A 1J2XA 5ICEA 1FP2A 1ZARA 3JW4A 2P7CB 1FBSA 1TNSA 5L3GA 1FYLA 3ZQ7A 2CSOA 3HTUA 2STWA 4OMYA 5LLQA 3S2WA 4HX4A 4JK1X 3V7SA 3F72A 3ZP5A 3QPHA 3TO7A 4MTDA 1QZZA 3ZN1A 4XLPF 4LB5A 2MD5A 3DV8A 3T1BA 3E5QA 3HSEA 3RKXA 2E7XA 5FO5A 1MDMB 4D0PA 5DDGA 3P9KA 2OBPA 3HSFA 2XROA 4MQ9F 4A12A 3EYIA 1BI2A 5HDNA 5D5WB 2TDXA 2MC3A 1G3SA 2V1XA 1J5YA 2VXZA 3ZMTA 2VBWA 2H27A 4HZFA 3ZMVA 1SD6A 3C18A 3DFGA 1F5TA 1YFHA 1BIBA 2D1VA 4PGHA 2EV5A 1AOYA 1Z6TA 2PLYA 1USTA 2IJLA 2QWWA 4LB6B 3CLOA 3T5XA 2FNAA 5CLSA 5A2QK 1R23A 4GYGA 1L0OC 4UUVA 2PQ8A 2R7FA 3QPTA 2M45A 4HV5A 4RB2C 4KN7X 4HLYA 2CYYA 2R7DA 2KIFA 1OYWA 4L9NA 5A2QZ 2PI0A 4E70A 4UHTA 5HOOA 3ZPLA 3QRFF 2GXBA 1U5TC 1E2XA 4AWXB 1D8KA 3F8FA 1D8JA 1CF7B 2ESNA 3F8NA 1OMIA 2EFQA 2J5PA 2NNYA 5HS7A 1REPC 4RGUA 1UHMA 2PN6A 3R6SA 3T8RA 3GXOA 1BJAA 2FQ3A 2DI3A 3L2CA 4IF4A 3KZYA 3WGHA 3TQNA 4M74A 3MZYA 4U0VA 4M6XA 2COMA 4HF2A 3K9TA 1ZN2A 3E5XA 3GFJA 4M73A 3FWEA 3HRTA 2RVCA 2EJRA 2ZMEA 4P9UA 1KU7A 4I09A 3K1MA 1SFEA 2CWEA 5LRRA 1E17A 5H6QA 3KZZA 5FD6A 4NHJA 2RC4A 1R5GA 3O3KA 2Z3YA 3M8FA 5E8IA 3R61A 4ESFA 5E1XA 1U2WA 4FX4A 2DBBA 4UVBA 1SD5A 2DT5A 4OIQF 2Q8KA 2B0LA 2IA2A 2KIMA 4G6QA 4KIFA 1F4KA 1O3TA 3I59B 1MJAA 4CYDA 1FNNA 3W6KB 4R8HA 5E18F 4BHCA 1BM9A 3GZ5A 4Q4ZF 2VODA 3F8MA 2K4JA 3WE2A 2YR2A 4ZYDA 3TKYA 3K0LA 4MEYF 3J80K 1DPRA 1K78A 1PDNC 1XSDA 3CJNA 1O3SA 2F5CA 5JHUA 5CVUA 2F5EA 4O6JA 3ZMDA 3FMRA 4XLNF 1TLHB 1IXRC 1IUYA 1T2KA 3MWMA 4EJVA 5LBQA 1Z6RA 5DD8A 2HS5A 2OZ6A 2XAFA 3GWZA 2EB7A 5IT9K 4KIBA 2GAUA 3I64A 4ENMA 1TTYA 3LQRA 2M87A 2GXGA 2FXAA 4ZZLA 2R3SA 2MBFA 4AIKA 1QBJA 1K79A 2ZNZA 2V9VA 2RV8A 4M9SA 2BEOA 3ABTA 4BQAA 2FMYA 1I5ZA 2JT1A 1X3UA 4EM0B 5LEJA 4EJWA 2BGCA 4EGYA 1Y0UA 4YFKF 2EFPA 2ZMEB 3E97A 2HTJA 4OIOF 3QP6A 1CGPA 4CGZA 1XGNA 1XSXA 4U7BA 5DD4A 4FHTA 1FOKA 4KMFA 2EA4A 5HS8A 4EM1A 2K02A 3K2ZA 5ICCA 4KNYA 2STTA 2ISZA 3IWZA 1LEAA 2P5KA 3RPUA 3ECOA 1FC3A 4IJAA 3NQOA 2FRHA 4XSXF 4MQVA 2W84A 5DYMA 1TQPA 1FSEA 3TOBA 3L7WA 2RGVA 3I59A 2DQRA 4G7OF 2VT3A 2MLGA 3HRSA 5CVRA 4N9HA 1B9NA 2L54A 3KLNA 4MHGA 2VOPA 3ELKA 3C7JA 1WKMA 3ZMSA 4RB3C 3RJPA 3HOTA 1KA8A 3MEXA 3WTXC 1K6OA 1YS6A 2NAZA 3P7NA 1J59A 4I0BA 3VB2A 3ZN0A 2GZWA 1HSJA 2LNBA 1J7KA 2ZXJA 3LAJA 2V79A 3R60A 2XHKA 3L09A 1JXSA 4RGXA 4BHBA 1HKTA 4O5VA 1FZPB 1S3JA 3K1PA 4EJUA 2HR3A 3N97A 2Z5UA 4L9JA 4ENKA 5ICFA 3ZMZA 5CVVA 5K5OA 1TNTA 2ISYA 4HW0A 2V1DA 2HOEA 4HX7A 4IHTA 4A6EA 4HAMA 1NHAA 3KP2A 5HLIA 1ZAOA 1FYMA 4CXFA 2YPRA 3HHHA 3F3XA 4DQ2A 3B73A 1SAXA 4KT5C 4ZZDA 2L4MA 3E6BA 5BPDA 2XAHA 2FA5A 2WV0A 4CZZA 2FE3A 1QGPA 2FOKA 4AD9A 3VFZA 2JTVA 5LRSA 3WTVC 4ZYHA 2CW0F 2O03A 4TV7A 4B8XA 4HYEA 5BPIA 1B1BA 1S29A 2VOOA 1XCBA 1WWXA 2IA1A 1O57A 2VBYA 2NNNA 2Z99A 4EGZA 2A69F 5D5UB 1IN8A 3QOPA 4FT8A 4LMYA 1IRFA 4GXOA 2DPUA 3KEQA 3DP7A 3I71A 1G3TA 1R1UA 1B59A 3BOQA 1ODDA 1YW9A 3CUOA 3GVAA 4G94A 3SFZA 3EETA 1O7FA 5BMZA 1ZLKA 5IT9Z 1T0FA 5H20A 2XAGA 5TRDA 5HLGA 3HRUA 2ELHA 1B4AA 2V6CA 4XRFA 2FBIA 3DPTA 2VBXA 4M72A 2OU2A 1P92A 3PFIA 2BE5F 1BOAA 1XGMA 3FXRA 2LSOA 5EEHA 3D5LA 4RS8A 2GA1A 4IXAA 2LF7A 1JHFA 5FLXZ 4HV6A 2QQ9A 4JBAA 1EV7A 1YG2A 2VC1A 2HYFA 1UHWA 2W85A 5DUKA 2FU4A 1SD7A 1PP7U 4GGGA 2F5FA 3VEPA 2AXLA 1IAWA 1R7JA 1BC7C 4L5IA 2DW4A 1ZG5A 1FY7A 2P6SA 2DK5A 3HYIA 3E6DA 1YYVA 4HQEA 3MAJA 1J0RA 4H0EA 1UB9A 5FB2A 3SZTA 5ERIA 1MJ9A 3K69A 5JVTA 3KFWX 1FPQA 3LWFA 3TOAA 5L3DA 2QM3A 3U1DA 2Z33A 1FBQA 3E6MA 3C1DA 4HOBA 2KRFA 2RKHA 1BI3A 4ENNA 1U3EM 3JAMK 4IRHA 1KYWA 3SQNA 3RI4A 4WXHA 2F5DA 3ABUA 3RKWA 4HF0A 3CTAA 5BOXA 3COAC 5K5RA 3M8EA 2HYGD 5D6EA 1WSUA 3G3ZA 2KKOA 4Y13A 1XGOA 4EJTA 2C6YA 2HZTA 1BBYA 5HDKA 3R0JA 3I53A 1EH6A 3ISPA 1EH7A 3FMQA 1WI9A 1FBUA 1LNWA 3I0TA 3CUQB 4JQFA 4L9VA 4LGWA 5DCFA 4WWCA 2QVOA 3DF8A 4MTEA 4WK8F 3WTYC 2UWMA 3I4PA 3HRMA 2H94A 5L3EA 3IKTA 4A2UA 1UFMA 5LGNA 2Z9OA 1MDMA 2FNPA 2VE8A 3BP8A 1Q1HA 3M9AA 4S05A 1ZHFA 4HF1A 3F8BA 2NS0A 1S8NA 2QUFA 2ZKZA 2ACJA 1L3LA 4UV8A 1HKQA 2P6TA 4Z2YA 5AIQA 5CVJA 2A68F 4ON0A 1USSA 1FLIA 4AIJA 1I1SA 4BXUA 1K78B 4EVIA 1HW1A 2Y48A 5DV5A 3BJ6A 2DQLA 2D1HA 1GXQA 1P4XA 2XGXA 5D6FA 1R58A 2HWVA 1GXPA 4EMSA 3MQ0A 2YX7A 1XD7A 1YIOA 1QZYA 4BAYA 5EEGA 2ESHA 3E3VA 4Q5SF 1RNLA 1IN5A 3LA2A 1ON1A 1V3FA 4XBFA 4IRIA 2H6CA 1XCVA 2VT2A 2XIGA 3WODF 3TDUC 3BZ6A 2K27A 2A3SA 1IN4A 1WRJA 2P4WA 2XAQA 3E5UA 2OAZA 2DTRA 1HKSA 3HIFA 4LD5A 4A0XA 3L00A 1KQ8A 2PG4A 1MGTA 1KGSA 3BROA 1TW2A 4LFUA 4ASNA 2LKPA 2WC2A 2ZNYA 5LHIA 1UCRA 4N9IA 5DEQA 4WF2A 1XMAA 5CVIA 1R1TA 2NYXA 4RB1A 3ERED 1KU2A 3RTRA 2ZCWA 4P9FA 2MH9A 3LFKA 1FT9A 4I01A 1DUXC 3IHUA 2HGCA 2QBYB 3ECHA 2W25A 4ZYGA 2RQPA 3ML6A 2P8TA 5K5QA 2O0YA 1ZREA 2FF4A 1DP7P 2HTSA 5D4SA 1KQ9A 4L0ZB 4Y15A 3AAFA 1XN7A 2PMUA 1BIAA 1HSTA 1IN7A 5TJJA 2CG4A 5ILUA 2FBKA 3CO7C 3GFLA 1QO0D 3CUQC 3QAHA 2MLKA 3U9GA 1H9GA 4NQWA 2UZKA 1Z05A 1R22A 1KYZA 1YW8A 3EQLF 1BI0A 1W4MA 1V4RA 5F1RA 2EWNA 3C3WA 2ZFWA 3V7RA 3WE3A 1T6SA 1XGSA 1LQ1A 1IRGA 5D8LB 3JSPA 5ILVA 1YS7A 1Z1DA 4KUMA 5ED4A 3BJOA 4HDUA 1MJBA 4G9YA 3NRVA 2VN2A 5DUIA 5FLXK 2A5YB 2DLLA 2H09A 2GWRA 1MZBA 4I02A 4LG0B 2G7HA 3Q9SA 2Y0MA 2AS5F 1FX7A 3IKVA 4AVPA 4KN4X 5CJ9A 1T38A 5BS6A 5J8CA 4LLLA 3F21A 3QU3A 5CYVA 3NEUA 3EUHA 3H92A 1ZRFA 3EYYA 4DNCA 3TO6A 4UVCA 3GW2A 3DEUA 3M1EA 4RAYA 4KMUX 2IW5A 2DK8A 2LF8A 1Z7UA 3CUQA 3KP5A 1JHHA 1T39A 5L3FA 1TQMA 5DCMA 1XDUA 2H6BA 3HSRA 3WGGA 4GO1A 5ILSA 3F22A 1IF1A 3LQQA 2A61A 4ENJA 2F2EA 5LHHA 1P4WA 4MEXF 5AIPA 1S7OA 2P7VB 1W7PA 1T98A 3GZ6A 2HFHA 4A0YA 4UV9A 2W57A 5E1WA 2VBZA 3WTUC 5FD5A 3RYPA 5E17F 1SMTA 2IP2A 3BPVA 4L5JA 1OYIA 2KJCA 4YIIA 1YW7A 4Q48A 4I2OA 3P9CA 3LA7A 5FGMA 3FXQA 1HW5A 5L3CA 2HEOA 1ZGAA 4PZJA 3R0AA 2J5OA 2WTEA 1U5TA 3RKYA 3O2PE 3J81Z 5D5XB 2GIVA 5FFZA 4N0BA 3QP5A 3WTZA 4L18B 3B02A 4YIFA 5FFXA 3L9FA 1JGSA 3HTSB 4P55A 2DU9A 2O61A 4HQMA 5BQTA 2UXXA 4EQQA 2L3DA 3RDIA 1U5TB 1RIOH 4A5MA 4WX9A 1B6AA 3IWFA 2HQRA 4M9ZA 4HX8A 4LJZF 4WCGA 4CDGA 2D45A 1IXCA 3I58A 2X4HA 4L0YB 4HA8A 2CGPA 3SHFA 5E1ZB 3FM5A 1J75A 2PEXA 2PMHA 3T8TA 3I5UA 4L9TA 1OYYA 3G73A 2L01A 1QPMA 3VODA 1W7PD 2PFBA 4U88A 2CFXA 4A6DA 2A07F 3QU6A 1LB2A 3J81K 1ZRDA 4ETSA 5LEKA 2EFWA 3FHZA 2ETHA 1I6XA 4QWQA 3F6OA 2E1NA 2EV6A 2RDPA 1U78A 2W24A 1DPUA 1ZGJA 1HW2A 1B9MA 3HOSA 1H9TA 1WQ2A 4NB5A 2QQAA 2YSRA 1JE8A 4WXDA 4R1HA 3PQJA 2VC0A 1W7PB 5JR3A 1XB4A 2P5VA 5LGUA 1RI7A 3CO6C 2JRTA 3WTWC 5HLHA 2Q0OA 3ZMUA 1LDDA 5JFRA 4Y17A 2WWYA 4I98B 2MA3A 2IRFG 1LEBA 2PBIA 2BYVE 2YU3A 3TGNA 3V8KA 1TW3A 6PAXA 3ULQB 1YTYA 3R4KA 3KCCA 1OR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJA A;  2LDU A;  2VON A;  5F6F A;  4KIC A;  5HVQ C;  3GFM A;  2L02 A;  4M6Y A;  5D4R A;  3TO9 A;  3I54 A;  4KA4 A;  3LAP A;  1S6L A;  2XKO A;  2JSC A;  3N4M A;  4KDP A;  5J6X A;  3EDP A;  5HDG A;  1R00 A;  1SFX A;  3W6J B;  2K7L A;  3IL2 A;  1C0W A;  3REO A;  1AWC A;  4O3M A;  3T0Y A;  1W5S A;  2O6G E;  4IHS A;  3GX4 X;  5F64 A;  4CO8 A;  3JAM Z;  4MGR A;  3DXJ F;  3WTS C;  1CF7 A;  4QLC U;  2PJP A;  3J80 Z;  4XSZ F;  4BHP A;  3JTG A;  3WTT C;  1HQC A;  2HKO A;  2FBH A;  3GF2 A;  2X0L A;  4U0W A;  4PGG A;  4HDV A;  4RGS A;  4F7Z A;  1I27 A;  5KK1 A;  1TQI A;  3JTH A;  4BH9 A;  2CO5 A;  4IVN A;  1PUE E;  3HUG A;  3GO5 A;  4ESJ A;  4UXN A;  4KFC A;  4EV0 A;  2JZY A;  2Q2E A;  3KP7 A;  5HS9 A;  4MNU A;  1YO5 C;  2EFN A;  3FM3 A;  1XSV A;  2QLZ A;  1IN6 A;  3O6B B;  2M1B A;  2ZO4 A;  4UVA A;  2OQR A;  2XKP A;  1BC8 C;  1RUN A;  3KP6 A;  3Q5F A;  4OIN F;  3SXY A;  4M9X A;  1P2F A;  2K4B A;  2G7U A;  1D3Y A;  4U0Y A;  3KP3 A;  3SZP A;  2QQB A;  5KVR A;  3DKW A;  1FSH A;  4OOI A;  1STZ A;  3KLO A;  1FP1 D;  2JPC A;  4KYW A;  4OU0 A;  2QBY A;  3WG9 A;  1FYK A;  2QYO A;  5ICG A;  4OIR F;  4OIP F;  3CDH A;  3H3U A;  4M71 A;  2O8X A;  2JPB A;  3V7C A;  4OMZ A;  3LST A;  2EFO A;  4Q47 A;  5IT3 A;  3V8J A;  2HKX A;  4G6D A;  1PP8 F;  3IC7 A;  1F9N A;  3F8C A;  4RGR A;  1QQI A;  1XDS A;  1D5V A;  3FX3 A;  4G7H F;  3RPQ A;  4FX0 A;  4AIH A;  2OA4 A;  2XAS A;  1U8R A;  1RZ4 A;  1QNT A;  1F1Z A;  3VOE A;  1H0M A;  2ADU A;  3V8L A;  2VE9 A;  3DPL C;  1SFU A;  4PCQ A;  4RB0 A;  4ZYE A;  4S04 A;  5L3B A;  4HBL A;  2D2W A;  3WU1 B;  5E20 A;  1Z9C A;  2M30 A;  2ZBK A;  3WGI A;  2FML A;  3BPX A;  2GA2 A;  1SD4 A;  3F6V A;  1ZH5 A;  4G8X A;  1R5H A;  2HQN A;  2DAO A;  4B09 A;  4UNO A;  4LG0 A;  3HHG A;  1W5T A;  1TBX A;  2FSW A;  1SMY F;  1R1V A;  1ULY A;  4EM2 A;  1RUO A;  3E6C C;  3FXU A;  5K1Y A;  1EH8 A;  2EA2 A;  2V1U A;  1OKR A;  4CHU A;  3MFK A;  1KU3 A;  1LDJ A;  2IVM A;  3MZH A;  3GEZ A;  4P5O A;  1BI1 A;  3PQK A;  2L4A A;  1YLF A;  1GVJ A;  1KU9 A;  1MKM A;  3GUD A;  2XV4 S;  2GQQ A;  5DCM B;  4WXC A;  1K7A A;  3RYR A;  2DO7 A;  1LJ9 A;  3JSO A;  1YQA A;  2XUB A;  4BYY A;  1HXD A;  3BDD A;  4GYI A;  1ZG3 A;  3TDZ C;  2XAJ A;  2RN7 A;  4GCV A;  3M7G A;  2A6E F;  1ZG1 A;  3F23 A;  4IRG A;  2FEZ A;  3ROU A;  2KIU A;  1XMK A;  1U6G A;  2ZJ2 A;  5JI6 A;  3D0S A;  1GHC A;  2YX4 A;  5LHG A;  1LVA A;  3OV8 A;  3RIR A;  2O3F A;  3GFI A;  2UXN A;  3OOP A;  1P6R A;  2QZ8 A;  4G7Z F;  1G4D A;  4U7D A;  2K86 A;  4YFX F;  4YFN F;  2BBY A;  3KET A;  2OD5 A;  3KEO A;  3IRR A;  1MD0 A;  2A6H F;  3GLX A;  3BY6 A;  5D5V B;  1S7A A;  2M8E A;  1Z91 A;  4YG2 F;  3V4G A;  2IPQ X;  1O7L A;  4RAZ A;  3IRQ A;  2EV0 A;  1O3Q A;  2RNJ A;  4EJO A;  5H6R A;  3FMS A;  3FZV A;  4P96 A;  4A5N A;  2IA0 A;  1IXS B;  1IW7 F;  5AON A;  1P4A A;  1VTN C;  2NRA C;  1R36 A;  2XVC A;  1G6N A;  2MH2 A;  3LA3 A;  4IPA A;  1I1G A;  3K1N A;  4LK0 F;  2DPD A;  1ZLJ A;  1ONV A;  4K2E A;  4LK1 F;  2XRN A;  4A0Z A;  1OPC A;  1DDN A;  3KP4 A;  4ESB A;  2EK5 A;  3J7A O;  4I0A A;  2BV6 A;  4KIG A;  2P5L C;  2CQK A;  1FWZ A;  2Y75 A;  2E7W A;  1ON2 A;  2DFI A;  2IT0 A;  1G3W A;  2HDC A;  5J8F A;  3GYH X;  1LDK B;  2KJB A;  3P9I A;  3KE2 A;  3DQV C;  5E8G A;  4HLX A;  3MCZ A;  5LGT A;  4CIC A;  2QEN A;  2G9W A;  3Q9V A;  2OZU A;  1BN5 A;  1G3Y A;  3FF5 A;  3H3Z A;  1ZRC A;  4LLG F;  3WU0 A;  2OQG A;  4I7H A;  3U2R A;  2M5W A;  1HBX G;  2E1C A;  4ZH4 F;  1IZ1 A;  1A04 A;  1O3R A;  1ZYR F;  4PDK A;  1KQ0 A;  4LLN A;  3BWG A;  1J9I A;  4BNC A;  5D8K B;  4R79 A;  1J2X A;  5ICE A;  1FP2 A;  1ZAR A;  3JW4 A;  2P7C B;  1FBS A;  1TNS A;  5L3G A;  1FYL A;  3ZQ7 A;  2CSO A;  3HTU A;  2STW A;  4OMY A;  5LLQ A;  3S2W A;  4HX4 A;  4JK1 X;  3V7S A;  3F72 A;  3ZP5 A;  3QPH A;  3TO7 A;  4MTD A;  1QZZ A;  3ZN1 A;  4XLP F;  4LB5 A;  2MD5 A;  3DV8 A;  3T1B A;  3E5Q A;  3HSE A;  3RKX A;  2E7X A;  5FO5 A;  1MDM B;  4D0P A;  5DDG A;  3P9K A;  2OBP A;  3HSF A;  2XRO A;  4MQ9 F;  4A12 A;  3EYI A;  1BI2 A;  5HDN A;  5D5W B;  2TDX A;  2MC3 A;  1G3S A;  2V1X A;  1J5Y A;  2VXZ A;  3ZMT A;  2VBW A;  2H27 A;  4HZF A;  3ZMV A;  1SD6 A;  3C18 A;  3DFG A;  1F5T A;  1YFH A;  1BIB A;  2D1V A;  4PGH A;  2EV5 A;  1AOY A;  1Z6T A;  2PLY A;  1UST A;  2IJL A;  2QWW A;  4LB6 B;  3CLO A;  3T5X A;  2FNA A;  5CLS A;  5A2Q K;  1R23 A;  4GYG A;  1L0O C;  4UUV A;  2PQ8 A;  2R7F A;  3QPT A;  2M45 A;  4HV5 A;  4RB2 C;  4KN7 X;  4HLY A;  2CYY A;  2R7D A;  2KIF A;  1OYW A;  4L9N A;  5A2Q Z;  2PI0 A;  4E70 A;  4UHT A;  5HOO A;  3ZPL A;  3QRF F;  2GXB A;  1U5T C;  1E2X A;  4AWX B;  1D8K A;  3F8F A;  1D8J A;  1CF7 B;  2ESN A;  3F8N A;  1OMI A;  2EFQ A;  2J5P A;  2NNY A;  5HS7 A;  1REP C;  4RGU A;  1UHM A;  2PN6 A;  3R6S A;  3T8R A;  3GXO A;  1BJA A;  2FQ3 A;  2DI3 A;  3L2C A;  4IF4 A;  3KZY A;  3WGH A;  3TQN A;  4M74 A;  3MZY A;  4U0V A;  4M6X A;  2COM A;  4HF2 A;  3K9T A;  1ZN2 A;  3E5X A;  3GFJ A;  4M73 A;  3FWE A;  3HRT A;  2RVC A;  2EJR A;  2ZME A;  4P9U A;  1KU7 A;  4I09 A;  3K1M A;  1SFE A;  2CWE A;  5LRR A;  1E17 A;  5H6Q A;  3KZZ A;  5FD6 A;  4NHJ A;  2RC4 A;  1R5G A;  3O3K A;  2Z3Y A;  3M8F A;  5E8I A;  3R61 A;  4ESF A;  5E1X A;  1U2W A;  4FX4 A;  2DBB A;  4UVB A;  1SD5 A;  2DT5 A;  4OIQ F;  2Q8K A;  2B0L A;  2IA2 A;  2KIM A;  4G6Q A;  4KIF A;  1F4K A;  1O3T A;  3I59 B;  1MJA A;  4CYD A;  1FNN A;  3W6K B;  4R8H A;  5E18 F;  4BHC A;  1BM9 A;  3GZ5 A;  4Q4Z F;  2VOD A;  3F8M A;  2K4J A;  3WE2 A;  2YR2 A;  4ZYD A;  3TKY A;  3K0L A;  4MEY F;  3J80 K;  1DPR A;  1K78 A;  1PDN C;  1XSD A;  3CJN A;  1O3S A;  2F5C A;  5JHU A;  5CVU A;  2F5E A;  4O6J A;  3ZMD A;  3FMR A;  4XLN F;  1TLH B;  1IXR C;  1IUY A;  1T2K A;  3MWM A;  4EJV A;  5LBQ A;  1Z6R A;  5DD8 A;  2HS5 A;  2OZ6 A;  2XAF A;  3GWZ A;  2EB7 A;  5IT9 K;  4KIB A;  2GAU A;  3I64 A;  4ENM A;  1TTY A;  3LQR A;  2M87 A;  2GXG A;  2FXA A;  4ZZL A;  2R3S A;  2MBF A;  4AIK A;  1QBJ A;  1K79 A;  2ZNZ A;  2V9V A;  2RV8 A;  4M9S A;  2BEO A;  3ABT A;  4BQA A;  2FMY A;  1I5Z A;  2JT1 A;  1X3U A;  4EM0 B;  5LEJ A;  4EJW A;  2BGC A;  4EGY A;  1Y0U A;  4YFK F;  2EFP A;  2ZME B;  3E97 A;  2HTJ A;  4OIO F;  3QP6 A;  1CGP A;  4CGZ A;  1XGN A;  1XSX A;  4U7B A;  5DD4 A;  4FHT A;  1FOK A;  4KMF A;  2EA4 A;  5HS8 A;  4EM1 A;  2K02 A;  3K2Z A;  5ICC A;  4KNY A;  2STT A;  2ISZ A;  3IWZ A;  1LEA A;  2P5K A;  3RPU A;  3ECO A;  1FC3 A;  4IJA A;  3NQO A;  2FRH A;  4XSX F;  4MQV A;  2W84 A;  5DYM A;  1TQP A;  1FSE A;  3TOB A;  3L7W A;  2RGV A;  3I59 A;  2DQR A;  4G7O F;  2VT3 A;  2MLG A;  3HRS A;  5CVR A;  4N9H A;  1B9N A;  2L54 A;  3KLN A;  4MHG A;  2VOP A;  3ELK A;  3C7J A;  1WKM A;  3ZMS A;  4RB3 C;  3RJP A;  3HOT A;  1KA8 A;  3MEX A;  3WTX C;  1K6O A;  1YS6 A;  2NAZ A;  3P7N A;  1J59 A;  4I0B A;  3VB2 A;  3ZN0 A;  2GZW A;  1HSJ A;  2LNB A;  1J7K A;  2ZXJ A;  3LAJ A;  2V79 A;  3R60 A;  2XHK A;  3L09 A;  1JXS A;  4RGX A;  4BHB A;  1HKT A;  4O5V A;  1FZP B;  1S3J A;  3K1P A;  4EJU A;  2HR3 A;  3N97 A;  2Z5U A;  4L9J A;  4ENK A;  5ICF A;  3ZMZ A;  5CVV A;  5K5O A;  1TNT A;  2ISY A;  4HW0 A;  2V1D A;  2HOE A;  4HX7 A;  4IHT A;  4A6E A;  4HAM A;  1NHA A;  3KP2 A;  5HLI A;  1ZAO A;  1FYM A;  4CXF A;  2YPR A;  3HHH A;  3F3X A;  4DQ2 A;  3B73 A;  1SAX A;  4KT5 C;  4ZZD A;  2L4M A;  3E6B A;  5BPD A;  2XAH A;  2FA5 A;  2WV0 A;  4CZZ A;  2FE3 A;  1QGP A;  2FOK A;  4AD9 A;  3VFZ A;  2JTV A;  5LRS A;  3WTV C;  4ZYH A;  2CW0 F;  2O03 A;  4TV7 A;  4B8X A;  4HYE A;  5BPI A;  1B1B A;  1S29 A;  2VOO A;  1XCB A;  1WWX A;  2IA1 A;  1O57 A;  2VBY A;  2NNN A;  2Z99 A;  4EGZ A;  2A69 F;  5D5U B;  1IN8 A;  3QOP A;  4FT8 A;  4LMY A;  1IRF A;  4GXO A;  2DPU A;  3KEQ A;  3DP7 A;  3I71 A;  1G3T A;  1R1U A;  1B59 A;  3BOQ A;  1ODD A;  1YW9 A;  3CUO A;  3GVA A;  4G94 A;  3SFZ A;  3EET A;  1O7F A;  5BMZ A;  1ZLK A;  5IT9 Z;  1T0F A;  5H20 A;  2XAG A;  5TRD A;  5HLG A;  3HRU A;  2ELH A;  1B4A A;  2V6C A;  4XRF A;  2FBI A;  3DPT A;  2VBX A;  4M72 A;  2OU2 A;  1P92 A;  3PFI A;  2BE5 F;  1BOA A;  1XGM A;  3FXR A;  2LSO A;  5EEH A;  3D5L A;  4RS8 A;  2GA1 A;  4IXA A;  2LF7 A;  1JHF A;  5FLX Z;  4HV6 A;  2QQ9 A;  4JBA A;  1EV7 A;  1YG2 A;  2VC1 A;  2HYF A;  1UHW A;  2W85 A;  5DUK A;  2FU4 A;  1SD7 A;  1PP7 U;  4GGG A;  2F5F A;  3VEP A;  2AXL A;  1IAW A;  1R7J A;  1BC7 C;  4L5I A;  2DW4 A;  1ZG5 A;  1FY7 A;  2P6S A;  2DK5 A;  3HYI A;  3E6D A;  1YYV A;  4HQE A;  3MAJ A;  1J0R A;  4H0E A;  1UB9 A;  5FB2 A;  3SZT A;  5ERI A;  1MJ9 A;  3K69 A;  5JVT A;  3KFW X;  1FPQ A;  3LWF A;  3TOA A;  5L3D A;  2QM3 A;  3U1D A;  2Z33 A;  1FBQ A;  3E6M A;  3C1D A;  4HOB A;  2KRF A;  2RKH A;  1BI3 A;  4ENN A;  1U3E M;  3JAM K;  4IRH A;  1KYW A;  3SQN A;  3RI4 A;  4WXH A;  2F5D A;  3ABU A;  3RKW A;  4HF0 A;  3CTA A;  5BOX A;  3COA C;  5K5R A;  3M8E A;  2HYG D;  5D6E A;  1WSU A;  3G3Z A;  2KKO A;  4Y13 A;  1XGO A;  4EJT A;  2C6Y A;  2HZT A;  1BBY A;  5HDK A;  3R0J A;  3I53 A;  1EH6 A;  3ISP A;  1EH7 A;  3FMQ A;  1WI9 A;  1FBU A;  1LNW A;  3I0T A;  3CUQ B;  4JQF A;  4L9V A;  4LGW A;  5DCF A;  4WWC A;  2QVO A;  3DF8 A;  4MTE A;  4WK8 F;  3WTY C;  2UWM A;  3I4P A;  3HRM A;  2H94 A;  5L3E A;  3IKT A;  4A2U A;  1UFM A;  5LGN A;  2Z9O A;  1MDM A;  2FNP A;  2VE8 A;  3BP8 A;  1Q1H A;  3M9A A;  4S05 A;  1ZHF A;  4HF1 A;  3F8B A;  2NS0 A;  1S8N A;  2QUF A;  2ZKZ A;  2ACJ A;  1L3L A;  4UV8 A;  1HKQ A;  2P6T A;  4Z2Y A;  5AIQ A;  5CVJ A;  2A68 F;  4ON0 A;  1USS A;  1FLI A;  4AIJ A;  1I1S A;  4BXU A;  1K78 B;  4EVI A;  1HW1 A;  2Y48 A;  5DV5 A;  3BJ6 A;  2DQL A;  2D1H A;  1GXQ A;  1P4X A;  2XGX A;  5D6F A;  1R58 A;  2HWV A;  1GXP A;  4EMS A;  3MQ0 A;  2YX7 A;  1XD7 A;  1YIO A;  1QZY A;  4BAY A;  5EEG A;  2ESH A;  3E3V A;  4Q5S F;  1RNL A;  1IN5 A;  3LA2 A;  1ON1 A;  1V3F A;  4XBF A;  4IRI A;  2H6C A;  1XCV A;  2VT2 A;  2XIG A;  3WOD F;  3TDU C;  3BZ6 A;  2K27 A;  2A3S A;  1IN4 A;  1WRJ A;  2P4W A;  2XAQ A;  3E5U A;  2OAZ A;  2DTR A;  1HKS A;  3HIF A;  4LD5 A;  4A0X A;  3L00 A;  1KQ8 A;  2PG4 A;  1MGT A;  1KGS A;  3BRO A;  1TW2 A;  4LFU A;  4ASN A;  2LKP A;  2WC2 A;  2ZNY A;  5LHI A;  1UCR A;  4N9I A;  5DEQ A;  4WF2 A;  1XMA A;  5CVI A;  1R1T A;  2NYX A;  4RB1 A;  3ERE D;  1KU2 A;  3RTR A;  2ZCW A;  4P9F A;  2MH9 A;  3LFK A;  1FT9 A;  4I01 A;  1DUX C;  3IHU A;  2HGC A;  2QBY B;  3ECH A;  2W25 A;  4ZYG A;  2RQP A;  3ML6 A;  2P8T A;  5K5Q A;  2O0Y A;  1ZRE A;  2FF4 A;  1DP7 P;  2HTS A;  5D4S A;  1KQ9 A;  4L0Z B;  4Y15 A;  3AAF A;  1XN7 A;  2PMU A;  1BIA A;  1HST A;  1IN7 A;  5TJJ A;  2CG4 A;  5ILU A;  2FBK A;  3CO7 C;  3GFL A;  1QO0 D;  3CUQ C;  3QAH A;  2MLK A;  3U9G A;  1H9G A;  4NQW A;  2UZK A;  1Z05 A;  1R22 A;  1KYZ A;  1YW8 A;  3EQL F;  1BI0 A;  1W4M A;  1V4R A;  5F1R A;  2EWN A;  3C3W A;  2ZFW A;  3V7R A;  3WE3 A;  1T6S A;  1XGS A;  1LQ1 A;  1IRG A;  5D8L B;  3JSP A;  5ILV A;  1YS7 A;  1Z1D A;  4KUM A;  5ED4 A;  3BJO A;  4HDU A;  1MJB A;  4G9Y A;  3NRV A;  2VN2 A;  5DUI A;  5FLX K;  2A5Y B;  2DLL A;  2H09 A;  2GWR A;  1MZB A;  4I02 A;  4LG0 B;  2G7H A;  3Q9S A;  2Y0M A;  2AS5 F;  1FX7 A;  3IKV A;  4AVP A;  4KN4 X;  5CJ9 A;  1T38 A;  5BS6 A;  5J8C A;  4LLL A;  3F21 A;  3QU3 A;  5CYV A;  3NEU A;  3EUH A;  3H92 A;  1ZRF A;  3EYY A;  4DNC A;  3TO6 A;  4UVC A;  3GW2 A;  3DEU A;  3M1E A;  4RAY A;  4KMU X;  2IW5 A;  2DK8 A;  2LF8 A;  1Z7U A;  3CUQ A;  3KP5 A;  1JHH A;  1T39 A;  5L3F A;  1TQM A;  5DCM A;  1XDU A;  2H6B A;  3HSR A;  3WGG A;  4GO1 A;  5ILS A;  3F22 A;  1IF1 A;  3LQQ A;  2A61 A;  4ENJ A;  2F2E A;  5LHH A;  1P4W A;  4MEX F;  5AIP A;  1S7O A;  2P7V B;  1W7P A;  1T98 A;  3GZ6 A;  2HFH A;  4A0Y A;  4UV9 A;  2W57 A;  5E1W A;  2VBZ A;  3WTU C;  5FD5 A;  3RYP A;  5E17 F;  1SMT A;  2IP2 A;  3BPV A;  4L5J A;  1OYI A;  2KJC A;  4YII A;  1YW7 A;  4Q48 A;  4I2O A;  3P9C A;  3LA7 A;  5FGM A;  3FXQ A;  1HW5 A;  5L3C A;  2HEO A;  1ZGA A;  4PZJ A;  3R0A A;  2J5O A;  2WTE A;  1U5T A;  3RKY A;  3O2P E;  3J81 Z;  5D5X B;  2GIV A;  5FFZ A;  4N0B A;  3QP5 A;  3WTZ A;  4L18 B;  3B02 A;  4YIF A;  5FFX A;  3L9F A;  1JGS A;  3HTS B;  4P55 A;  2DU9 A;  2O61 A;  4HQM A;  5BQT A;  2UXX A;  4EQQ A;  2L3D A;  3RDI A;  1U5T B;  1RIO H;  4A5M A;  4WX9 A;  1B6A A;  3IWF A;  2HQR A;  4M9Z A;  4HX8 A;  4LJZ F;  4WCG A;  4CDG A;  2D45 A;  1IXC A;  3I58 A;  2X4H A;  4L0Y B;  4HA8 A;  2CGP A;  3SHF A;  5E1Z B;  3FM5 A;  1J75 A;  2PEX A;  2PMH A;  3T8T A;  3I5U A;  4L9T A;  1OYY A;  3G73 A;  2L01 A;  1QPM A;  3VOD A;  1W7P D;  2PFB A;  4U88 A;  2CFX A;  4A6D A;  2A07 F;  3QU6 A;  1LB2 A;  3J81 K;  1ZRD A;  4ETS A;  5LEK A;  2EFW A;  3FHZ A;  2ETH A;  1I6X A;  4QWQ A;  3F6O A;  2E1N A;  2EV6 A;  2RDP A;  1U78 A;  2W24 A;  1DPU A;  1ZGJ A;  1HW2 A;  1B9M A;  3HOS A;  1H9T A;  1WQ2 A;  4NB5 A;  2QQA A;  2YSR A;  1JE8 A;  4WXD A;  4R1H A;  3PQJ A;  2VC0 A;  1W7P B;  5JR3 A;  1XB4 A;  2P5V A;  5LGU A;  1RI7 A;  3CO6 C;  2JRT A;  3WTW C;  5HLH A;  2Q0O A;  3ZMU A;  1LDD A;  5JFR A;  4Y17 A;  2WWY A;  4I98 B;  2MA3 A;  2IRF G;  1LEB A;  2PBI A;  2BYV E;  2YU3 A;  3TGN A;  3V8K A;  1TW3 A;  6PAX A;  3ULQ B;  1YTY A;  3R4K A;  3KCC A;  1OR7 A; 
#chains in the Genus database with same CATH topology
 3BJA A;  2M7A A;  2CU7 A;  1A6Q A;  2LDU A;  1QVU A;  3OWT A;  3HG9 A;  2VON A;  2ZB9 A;  5F6F A;  4KIC A;  5HVQ C;  3GFM A;  4D7N A;  5GAG J;  2L02 A;  4M6Y A;  5D4R A;  3TO9 A;  2RAE A;  1Z3Y A;  3GBG A;  1HC8 A;  3I54 A;  4KA4 A;  3LAP A;  1EJ9 A;  2R7S A;  1N78 A;  3GTL J;  5GTI C;  1S6L A;  2XKO A;  2JSC A;  3N4M A;  1EF4 A;  4KDP A;  1D0Z A;  5J6X A;  2W1O A;  3EDP A;  1R00 A;  1D1C A;  1SFX A;  5HDG A;  3W6J B;  1T8I A;  1K6Y A;  2K7L A;  1G2H A;  3IL2 A;  1C0W A;  3MD2 A;  2Z1D A;  3REO A;  2O8K A;  1E0E A;  2CUJ A;  1AWC A;  1VFC A;  3CJR B;  4O3M A;  1FIP A;  3T0Y A;  1W5S A;  2O6G E;  4IHS A;  4DBR A;  3MZ8 A;  3GX4 X;  5F64 A;  1MNE A;  2R4G A;  1R5I D;  1Z3X A;  1KZH A;  3NAU A;  1LFU P;  4CO8 A;  3JAM Z;  1Z7L A;  3NAR A;  4MGR A;  3DXJ F;  3WTS C;  1CF7 A;  2WA0 A;  4QLC U;  2JQ7 A;  2PJP A;  3J80 Z;  4XSZ F;  4BHP A;  3JTG A;  2QKL B;  2XSJ C;  3WTT C;  1HQC A;  1V55 H;  2VIX A;  2HKO A;  2FBH A;  3GF2 A;  2X0L A;  4PJJ A;  4U0W A;  3QWL A;  5M5W J;  2L0K A;  4ZYA A;  1NH3 A;  4PGG A;  2I5U A;  4HDV A;  4C3J J;  4RGS A;  4F7Z A;  1I27 A;  3CMY A;  5KK1 A;  1TQI A;  5F1J A;  3JTH A;  1YI2 I;  1SFK A;  2CO5 A;  4IVN A;  4BH9 A;  1PUE E;  1ENH A;  1A35 A;  1KON A;  3HUG A;  4IHY A;  3GO5 A;  4PJN A;  4ESJ A;  3L2W A;  4UXN A;  1Y1W J;  3F0C A;  4KFC A;  4EV0 A;  2JZY A;  1NK2 P;  2Q2E A;  2ECC A;  3KP7 A;  2W7N A;  5HS9 A;  4MNU A;  1POG A;  1YO5 C;  4EAT A;  2EFN A;  3FM3 A;  3CCE I;  1XSV A;  3TBI A;  2QLZ A;  1IN6 A;  2EZI A;  4JP0 A;  2NS8 A;  1VI0 A;  5EG0 A;  1K83 J;  2DMT A;  3O6B B;  3JRE A;  3ZGK A;  2M1B A;  2ZO4 A;  4BDY A;  4UVA A;  1PYV A;  2OQR A;  2Y9Y A;  2XKP A;  4BJ5 C;  1MSE C;  1N75 A;  1BC8 C;  1RUN A;  1Q1V A;  4RLF A;  3KP6 A;  4XIC A;  3Q5F A;  4OIN F;  3J7Z I;  1ETY A;  1JT0 A;  3SXY A;  4M9X A;  1P2F A;  2K4B A;  2G7U A;  1D3Y A;  1SFO J;  4U0Y A;  2PX9 A;  4X0G A;  3KP3 A;  4HPQ A;  3SZP A;  2EZK A;  2QQB A;  2QSG X;  2JUC A;  5KVR A;  3WG7 H;  3DKW A;  4M3F A;  3G1L A;  1FSH A;  4OOI A;  2ZJQ F;  1STZ A;  3KLO A;  1HF0 A;  1FP1 D;  2XGD A;  2JPC A;  4KYW A;  4BBS J;  3OYF A;  4OU0 A;  2QBY A;  2DOE A;  1E3H A;  1X1D A;  4RAG A;  3WG9 A;  2KMU A;  1FYK A;  1W36 C;  2QYO A;  3H5R A;  5ICG A;  2ZXI A;  4OIR F;  4OIP F;  3C2G A;  3CDH A;  4XK4 A;  3H3U A;  4M71 A;  2O8X A;  3M1C A;  2V9K A;  2JPB A;  4BQO A;  3V7C A;  4Y33 A;  2I8D A;  4AM3 A;  4OMZ A;  3LST A;  2VJ4 A;  2F4I A;  2GLO A;  1XC5 A;  2W4S A;  2EFO A;  4Q47 A;  4LOC A;  2QEX I;  1D1A A;  1TWG J;  3V8J A;  5IT3 A;  2LD5 A;  3JR9 A;  2HKX A;  3O8H A;  4G6D A;  2O9L A;  2HVR A;  3BR3 A;  1PP8 F;  3IC7 A;  1F9N A;  2DN0 A;  3S1N J;  2R5Y A;  3CC4 I;  3F8C A;  1NG7 A;  3RPU D;  3CQZ J;  2CW8 A;  4XMY A;  4RGR A;  1QQI A;  1A36 A;  1LVK A;  3I3L A;  1AHD P;  3BQZ A;  4NUB A;  2DA1 A;  1XDS A;  2N8G A;  2Y9Z A;  5IP7 J;  1D5V A;  3FX3 A;  4G7H F;  3RPQ A;  4FX0 A;  1WPK A;  2OA4 A;  5FKK A;  4AIH A;  4E6K G;  2XAS A;  1RZ4 A;  1U8R A;  1ACI A;  1QNT A;  4E7H A;  1F1Z A;  1SC7 A;  1B8I B;  3VOE A;  1H0M A;  2ADU A;  1CQT A;  3V8L A;  3JRD A;  2VE9 A;  3DPL C;  1SFU A;  2X9D A;  3OYI A;  3W2V A;  4PCQ A;  4RB0 A;  4ZYE A;  4S04 A;  1SAN A;  4F92 B;  3SZG A;  4RA2 A;  1TT5 B;  5L3B A;  4HBL A;  3G1O A;  3SEQ A;  2BY0 A;  2IBD A;  2D2W A;  3WU1 B;  1Y8Q B;  2ZSI B;  5E20 A;  2IS2 A;  1Z9C A;  4V19 K;  3BCB A;  2DA5 A;  1S9H A;  2M30 A;  2ZBK A;  3WGI A;  2FML A;  3BR6 A;  3Q0V A;  3S15 J;  3OIO A;  3BPX A;  2GA2 A;  1SD4 A;  2YS9 A;  3F6V A;  3GME A;  3VYU B;  1ZH5 A;  2L7F P;  3QYE A;  1T08 B;  3DLL F;  4G8X A;  2LBF B;  4P1W A;  1R5H A;  2HQN A;  5HNF A;  1LKX A;  2DAO A;  4B09 A;  5FLM J;  4LG0 A;  3HHG A;  4UNO A;  3HOZ J;  3H35 A;  1W5T A;  2WB1 N;  1TBX A;  1LFP A;  2FSW A;  5M3M J;  1SMY F;  1R1V A;  2IS6 A;  1ULY A;  4EM2 A;  1RUO A;  3E6C C;  3FXU A;  1T33 A;  2CQQ A;  5K1Y A;  1EH8 A;  2EA2 A;  5EGO A;  4PFP A;  4AUX A;  2LVS A;  2V1U A;  4JYK A;  1OKR A;  4IZZ A;  3RSN A;  4CHU A;  1K61 A;  3MFK A;  1KU3 A;  1LDJ A;  2IVM A;  3MZH A;  3GEZ A;  4DW6 A;  4P5O A;  1BI1 A;  3E0J B;  4HNT A;  5EF6 A;  3PQK A;  3S32 A;  2L4A A;  1OQY A;  3AG3 H;  2EBI A;  1YLF A;  3IAM 2;  1GVJ A;  2X6X A;  3GTM J;  1JGG A;  1KU9 A;  4E7S A;  1MKM A;  2NOG A;  3GUD A;  3BQY A;  1Y39 A;  2W82 A;  2XV4 S;  2QF7 A;  2AQF A;  2GQQ A;  2JJ7 A;  2XAU A;  3IH2 A;  5DCM B;  4WXC A;  1K7A A;  4X6A J;  3RYR A;  2F48 A;  2DO7 A;  3IH3 A;  1LJ9 A;  5IY5 H;  2VJJ A;  1VQK I;  2KZG A;  3JSO A;  1I39 A;  1YQA A;  2R7R A;  4IO9 F;  3W2W A;  2R7X A;  2XUB A;  3IV5 A;  3MKW B;  3H1C A;  2CV2 A;  4BYY A;  1HXD A;  3BDD A;  4XON A;  3KYL A;  4GYI A;  1ZG3 A;  3TDZ C;  5E3O A;  2KIQ A;  2XAJ A;  2DCE A;  2RN7 A;  4GCV A;  3I55 I;  3M7G A;  2XB0 X;  5FRN A;  2P0W A;  2A6E F;  4ZTJ A;  3CMM A;  3CJQ B;  2DYR H;  3JRG A;  1ZG1 A;  3F23 A;  1NK3 P;  3QPL A;  4IRG A;  2FEZ A;  3ROU A;  2KIU A;  1XMK A;  4Z6Y A;  3HM5 A;  1U6G A;  2ZJ2 A;  2KT0 A;  3G4S I;  5JI6 A;  1UJ8 A;  2VKE A;  3D0S A;  1GHC A;  1AA7 A;  2YX4 A;  5LHG A;  1LVA A;  3OV8 A;  3RIR A;  2O3F A;  2TRT A;  1Y6I A;  1BL0 A;  3OYK A;  2EH3 A;  4BBR J;  1OFC X;  1WVR A;  2PMZ A;  2V4J C;  3GFI A;  1YX3 A;  2DTZ A;  2UXN A;  2BVL A;  3OOP A;  4V2F A;  1P6R A;  2QZ8 A;  3M8J A;  5J1Y A;  4G7Z F;  3TED A;  1G4D A;  1MMD A;  3DKY A;  4U7D A;  2K86 A;  4YFX F;  4YFN F;  2BBY A;  3RKQ A;  4XLA A;  3KET A;  1PUF B;  3ZQF A;  3HPG A;  3M07 A;  2OD5 A;  3KEO A;  3IRR A;  2JN6 A;  1MD0 A;  2A6H F;  2BHZ A;  1MH3 A;  3GLX A;  3BY6 A;  5D5V B;  3H9J A;  4RM3 A;  1S7A A;  2XPU A;  1YRN B;  2M8E A;  2XF6 A;  3ZQC A;  1Z91 A;  4YG2 F;  4PJL A;  4ZDO A;  4UUS A;  3V4G A;  5B66 C;  2IPQ X;  1O7L A;  3OYG A;  2L9N A;  4RAZ A;  3IRQ A;  2FX0 A;  2EV0 A;  2VLA A;  1O3Q A;  1WJC A;  2RNJ A;  4EJO A;  4QSH A;  4E7J A;  2R7V A;  1FEX A;  2K9L A;  5H6R A;  3CCM I;  1D1B A;  3FMS A;  3H9G A;  3FZV A;  3MN2 A;  4P96 A;  4GRI A;  4A5N A;  2IA0 A;  1IXS B;  1JKP C;  1IW7 F;  1YJ9 I;  3HDD A;  5AON A;  4IQJ A;  1P4A A;  1MMS A;  1VTN C;  2Z2S B;  4PFO A;  3OYM A;  3GCM A;  3DBH B;  2NRA C;  4U87 A;  3OS1 A;  1R36 A;  2XVC A;  1FJL A;  1G6N A;  2MH2 A;  5F27 A;  3LA3 A;  4IPA A;  1I1G A;  2LBF A;  3K1N A;  1N77 A;  4LK0 F;  2DPD A;  1IV8 A;  2XF7 A;  1ZLJ A;  1ONV A;  2VL8 A;  4K2E A;  4LK1 F;  3LSR A;  3ZQQ A;  2XRN A;  2Y30 A;  4A0Z A;  3K4J A;  1OPC A;  1DDN A;  3KYC B;  1IO2 A;  5J1U A;  3KP4 A;  2OCC H;  2A05 A;  4ESB A;  2EK5 A;  3HOV J;  3J7A O;  3OYA A;  4I0A A;  2FUG 2;  4XLC A;  5B1A H;  2BV6 A;  3HL2 A;  1R49 A;  4KIG A;  2P5L C;  1LE8 A;  2JA7 J;  2CQK A;  4ZTF A;  2DA2 A;  1FWZ A;  2Y75 A;  1H88 C;  9ANT A;  2E7W A;  4A3K J;  1ON2 A;  2DFI A;  5DTD A;  4YEJ A;  2IT0 A;  1P9Q C;  4CCN A;  4QPQ A;  1G3W A;  2HDC A;  3ZQI A;  1K4S A;  5IPA A;  4FET A;  5J8F A;  3GYH X;  1LDK B;  2KJB A;  5F0F A;  3VSK A;  2BY3 A;  2VXD A;  3IAS 2;  3P9I A;  3KE2 A;  1FMV A;  3DQV C;  5GPA A;  5E8G A;  3DU6 A;  4HLX A;  1VQM I;  4N4N B;  3MCZ A;  1OCO H;  1A31 A;  5LGT A;  4MO7 A;  4CIC A;  4XID A;  2QEN A;  2AO9 A;  2G9W A;  3Q9V A;  2OZU A;  1BN5 A;  5BNG A;  1ZK8 A;  1GUU A;  1YE9 A;  1G3Y A;  3FF5 A;  3H3Z A;  1ZRC A;  4LLG F;  2H8R A;  3WU0 A;  4C2M J;  1SEU A;  2OQG A;  4XLF A;  4I7H A;  2NXN B;  5GTH C;  4JX6 A;  3U2R A;  1W36 D;  2M34 A;  2M5W A;  3K4N A;  2LLK A;  3GTP J;  4DZP A;  1HBX G;  1HDP A;  3JRH A;  1S72 I;  2E1C A;  4ZH4 F;  3ZQG A;  1IZ1 A;  2WY8 Q;  1A04 A;  1O3R A;  3JRI A;  3OR1 C;  1ZYR F;  1AKH B;  4PDK A;  4IKF A;  2EIJ H;  1KQ0 A;  1N25 A;  4LLN A;  2HXI A;  3BWG A;  1J9I A;  3OYH A;  5KNL A;  4BNC A;  5D8K B;  4R79 A;  1J2X A;  3AG2 H;  2X85 A;  5ICE A;  1FP2 A;  1ZAR A;  3JW4 A;  2V26 A;  2P7C B;  4J01 A;  2MAB A;  4GFB A;  1FBS A;  1TNS A;  4AU7 A;  2MD0 A;  5GAE J;  2JSP A;  1TWF J;  5L3G A;  1FYL A;  3ZQ7 A;  2R7T A;  1RPW A;  2CSO A;  1ZKG A;  3HTU A;  1GVD A;  2STW A;  4OMY A;  5LLQ A;  2R93 J;  1V54 H;  3HOU J;  3J7A Y;  3S2W A;  4HX4 A;  4JK1 X;  2EZL A;  4NBQ A;  4XNF A;  3HOX J;  1YHQ I;  1IGN A;  3V7S A;  3PO2 J;  1X4O A;  3F72 A;  2VQC A;  1X3Z B;  3A03 A;  3ZP5 A;  3QPH A;  3TO7 A;  5M5Y J;  2LMD A;  4RDU A;  4MTD A;  3AKZ A;  3FKJ A;  3AG1 H;  1FMW A;  4XRM A;  1QZZ A;  1M1E B;  3ZN1 A;  4XLP F;  4LB5 A;  2MD5 A;  1R9T J;  3DV8 A;  4A3L J;  3T1B A;  3E5Q A;  3HSE A;  3PFY A;  4ABZ A;  3RKX A;  2E7X A;  4MFD A;  2CUZ A;  5FO5 A;  1MDM B;  3CCQ I;  4D0P A;  5DDG A;  3P9K A;  2OBP A;  3HSF A;  2XRO A;  3TP0 A;  4MQ9 F;  4A12 A;  3BR2 A;  2KP6 A;  3EYI A;  3WU2 C;  3HKZ N;  5B1B H;  1BI2 A;  2M8G X;  5HDN A;  2GIZ A;  5D5W B;  3OYC A;  3ONQ A;  2TDX A;  2MC3 A;  2JMW A;  2V1X A;  2KIS A;  1J5Y A;  2VXZ A;  3ZQH A;  3N05 A;  3HOW J;  1IUF A;  1WFX A;  5K7H A;  3PIO F;  2X6O A;  3ZMT A;  4CUG A;  2VBW A;  2H27 A;  3KEY A;  3OYE A;  2BOL A;  2G0E A;  1OJL A;  4HZF A;  3LSK A;  2HI3 A;  1XMX A;  3ZMV A;  1SD6 A;  4D9J A;  2M0C A;  4RM2 A;  3C18 A;  3FXM A;  1QU3 A;  3UKG A;  3DFG A;  3QQA A;  4A69 C;  1F5T A;  1RR7 A;  3QYF A;  2KRC A;  1IG7 A;  2BVM A;  1YFH A;  4A3G J;  1JUM A;  1BIB A;  2D1V A;  4PGH A;  2EV5 A;  1AOY A;  4XM3 A;  2E5Z A;  1Z6T A;  2DMU A;  2PLY A;  2V9P A;  1UST A;  2IJL A;  2DJI A;  2BXZ A;  2QWW A;  1WH5 A;  4LB6 B;  3CLO A;  3T5X A;  4XRS A;  3S3M A;  2FNA A;  5CLS A;  5A2Q K;  1R23 A;  4GYG A;  4DOZ A;  2KDZ A;  1I6H J;  1L0O C;  4UUV A;  2IGM A;  5IOZ A;  2PQ8 A;  2R7F A;  3QPT A;  2IAI A;  3VPR A;  2M45 A;  4HV5 A;  4JOM A;  4DBQ A;  4RB2 C;  1G59 A;  1SVM A;  1O4X A;  1WJB A;  2IGN A;  4KN7 X;  4HLY A;  2CYY A;  2R7D A;  2KIF A;  4ANJ A;  1OYW A;  3PSI A;  4L9N A;  4D5C A;  5J4V A;  3OL3 A;  3CCJ I;  5A2Q Z;  1B72 B;  2PI0 A;  4E70 A;  1MND A;  4UHT A;  5HOO A;  2AXT C;  3ZPL A;  3CF2 A;  3OYL A;  3QRF F;  2GXB A;  1U5T C;  1E2X A;  4AWX B;  2OF7 A;  2OPT A;  2RNG A;  1D8K A;  3F8F A;  1D8J A;  3UR3 C;  2ZXW H;  1CF7 B;  1QVT A;  4HST A;  2NVY J;  2ESN A;  2L9V A;  4Y52 J;  2VI6 A;  3W6V A;  3F8N A;  3RQI A;  1OMI A;  2DT6 A;  2EFQ A;  2J5P A;  2NNY A;  2YUS A;  5HS7 A;  3FBI B;  1REP C;  3PNT A;  4RGU A;  1UHM A;  4B43 A;  2PN6 A;  2ECB A;  3R6S A;  3S2D J;  2XDV A;  1Y1V J;  3T8R A;  2KQR A;  3A02 A;  1DU6 A;  3GXO A;  2X48 A;  1BJA A;  2Y69 H;  2FQ3 A;  2DI3 A;  3L2C A;  1YJN I;  3TMO A;  1ZR4 A;  2IS4 A;  3CP8 A;  2ELJ A;  4HNU A;  2JK3 A;  4IF4 A;  3KZY A;  1XTA A;  2Q2E B;  3WGH A;  3TQN A;  4M74 A;  3MZY A;  4U0V A;  4M6X A;  2COM A;  2WBM A;  5F0C A;  4HF2 A;  3K9T A;  1ZN2 A;  4B48 A;  1U9N A;  3E5X A;  3GFJ A;  3FWE A;  4M73 A;  4PK4 A;  2ME6 A;  3OIP A;  4E7K A;  5E3L A;  5EDN A;  3F9K A;  3HRT A;  2RVC A;  4CCO A;  2EJR A;  2ZME A;  4ZDP A;  4P9U A;  1B8I A;  1KU7 A;  4I09 A;  1MMN A;  3CES A;  3K1M A;  2CS3 A;  2QKM B;  3CF5 F;  1SFE A;  2WAF A;  1TC3 C;  4RMN A;  2CWE A;  5LRR A;  1E17 A;  5H6Q A;  3CCY A;  3S3O A;  3BG7 A;  1MMA A;  1ORK A;  5JLX A;  3KZZ A;  3ABM H;  3DLA A;  5FD6 A;  2VB6 A;  2R5Z A;  4NHJ A;  4Y7N J;  2RC4 A;  3CCL I;  5M5X J;  1R5G A;  3O3K A;  3MKY B;  2Z3Y A;  3M8F A;  3LFU A;  5E8I A;  3R61 A;  4ESF A;  3S1Q J;  5E1X A;  1U2W A;  1VQP I;  2ID3 A;  2DBB A;  4UVB A;  4FX4 A;  1SD5 A;  2DT5 A;  4UUT A;  2KL4 A;  3QOE A;  4OIQ F;  1FOY A;  5KCM A;  2Q8K A;  2B0L A;  2IA2 A;  2NVU B;  4ZDL A;  1VQO I;  1ETO A;  2M9H A;  2B9S A;  2KIM A;  1IDY A;  1EKE A;  1PVE A;  1IC8 A;  4G6Q A;  4KIF A;  2K9N A;  2HDW A;  2L2O A;  1F4K A;  1O3T A;  3I59 B;  1MJA A;  4CYD A;  3Q0U A;  1FNN A;  3W6K B;  4R8H A;  5E18 F;  2XPW A;  4BHC A;  1TWA J;  1BM9 A;  4XN3 A;  3GZ5 A;  3PUF A;  4Q4Z F;  4W1U A;  2VOD A;  2K3F A;  1JT6 A;  1YIJ I;  2X1D A;  4XRS G;  4OAZ A;  5FKM A;  3HB9 A;  3F8M A;  2K4J A;  3WE2 A;  3V42 A;  2YR2 A;  4ZYD A;  1OLT A;  3KCC A;  2H8W A;  3TKY A;  3G71 I;  2NVQ J;  3S14 J;  3K0L A;  1Z67 A;  1WCM J;  2E19 A;  5E79 C;  5K7Z A;  1VQ9 I;  4PJM A;  4MEY F;  1RES A;  3J80 K;  1DPR A;  1K78 A;  3BR0 A;  1FTT A;  2KFD A;  2OJE D;  1PDN C;  3JRF A;  2DFH A;  1XSD A;  3M3Y J;  2M3A A;  3KX2 A;  3CJN A;  4ITV A;  1O3S A;  2LP0 A;  3K4M A;  2HOT A;  1OR7 C;  2AQE A;  5C44 J;  2HU9 A;  1JUS A;  1Y8R B;  2F5C A;  1ZGW A;  4QIW N;  5JHU A;  2XSD C;  1T95 A;  5CVU A;  3HGG A;  4BL0 B;  3RZO J;  4W97 A;  2F5E A;  1WJE A;  4O6J A;  3FIW A;  3ZMD A;  2CH0 A;  3FMR A;  4XLN F;  1R6R A;  1TLH B;  1IXR C;  3ZOB A;  1IUY A;  1T2K A;  3MWM A;  4EJV A;  5LBQ A;  1SVL A;  1Z6R A;  3MKZ A;  1MMG A;  3X2Q H;  2LRD A;  5DD8 A;  5H2F C;  4II2 A;  1XPX A;  2HS5 A;  4FE7 A;  2OZ6 A;  3H36 A;  2XAF A;  3HXL A;  3GWZ A;  2DA4 A;  2EB7 A;  5IT9 K;  3A1Y A;  3UNG C;  4KIB A;  1Y0N A;  2GAU A;  3I64 A;  4ENM A;  1TTY A;  5EG0 B;  2IGO A;  4LG3 A;  1JTX A;  3LQR A;  2M87 A;  3C2B A;  4BEH B;  2GXG A;  2FXA A;  2RQQ A;  4ZZL A;  2R3S A;  2MBF A;  4AIK A;  2DFE A;  1QBJ A;  2CJJ A;  4E7Z A;  2E71 A;  4KIT B;  2ZNZ A;  1K79 A;  1JJ8 C;  5DM7 F;  2V9V A;  4XQF A;  2RV8 A;  4M9S A;  3L2V A;  2BEO A;  3ABT A;  1J09 A;  4BQA A;  5LFA A;  3MKL A;  4UY8 I;  3ABK H;  4HNV A;  2FMY A;  1UG2 A;  1I5Z A;  2BY1 A;  2JT1 A;  3PM1 A;  2HOA A;  4DYR A;  2E1O A;  1X3U A;  5LD2 C;  4EM0 B;  5LEJ A;  4EJW A;  2BGC A;  4EGY A;  4IHX A;  4NC7 A;  3DTI A;  4BXF A;  1Y0U A;  4YFK F;  2EFP A;  2ZME B;  3E97 A;  1F36 A;  2HTJ A;  4QPO A;  4OIO F;  2L7Z A;  3HBL A;  3QP6 A;  1CGP A;  4CGZ A;  1ERD A;  1XGN A;  1XSX A;  4U7B A;  2CV1 A;  5DD4 A;  5FRO A;  4FHT A;  1FOK A;  4HEA 2;  3ERM A;  4KMF A;  3GTG J;  2EA4 A;  5TIS C;  5HS8 A;  4EM1 A;  4A3M J;  2K02 A;  3BG6 A;  1HDD C;  2F4O B;  3K2Z A;  2VJ5 A;  5ICC A;  4KNY A;  2STT A;  4DJA A;  2ISZ A;  4PSX A;  4IHW A;  3IWZ A;  1LEA A;  4XOP A;  2P5K A;  1RKT A;  3RPU A;  1W0T A;  3ECO A;  1FC3 A;  1VQN I;  4IJA A;  3NQO A;  2FRH A;  1AU7 A;  2VKV A;  4B3X A;  2CUF A;  5GP9 A;  4XSX F;  3ZXS A;  5C4J J;  4MQV A;  1JI8 A;  2ID6 A;  2W84 A;  2I10 A;  3PUB A;  5DYM A;  4DGW B;  3G1M A;  2KZV A;  1TQP A;  1FSE A;  2L5Q A;  3HKZ A;  5IYC J;  4BJ6 C;  2V6E A;  2OUM A;  2EIL H;  3DEW A;  3TOB A;  1OIS A;  1UHS A;  3L7W A;  2RGV A;  3I59 A;  2DQR A;  4G7O F;  2VT3 A;  3BLY A;  1HCR A;  5HNH A;  2MG4 A;  3S8P A;  2MLG A;  3BTC A;  1YJW I;  3GTK J;  2W48 A;  4BUP A;  4DYQ A;  3EUH C;  3HRS A;  5CVR A;  4N9H A;  1VND A;  1FIA A;  3HC7 A;  4NQW B;  2KHM A;  1B9N A;  2LRE A;  1MBJ A;  3S93 A;  2L54 A;  3KLN A;  1IRX A;  4MHG A;  2VOP A;  4MLO A;  2LK2 A;  1X2M A;  4L5E A;  3ELK A;  5JLW A;  3C7J A;  1K4T A;  1WKM A;  3ZMS A;  4RB3 C;  1JKR C;  3P5J A;  3RJP A;  3ASN H;  3I56 I;  3HOT A;  1KA8 A;  2X51 A;  3MEX A;  3WTX C;  3CLQ A;  3E7L A;  3KYD B;  1YS6 A;  1K6O A;  2R7Z J;  1Y56 A;  3CME I;  2NAZ A;  4DYC A;  5DS9 A;  3P7N A;  1J59 A;  4I0B A;  3VB2 A;  3LNQ A;  3ZN0 A;  2GZW A;  1HSJ A;  1VZ0 A;  2O7O A;  2QQ8 A;  2LNB A;  2CMP A;  1J7K A;  2ZXJ A;  3LAJ A;  2V79 A;  3R60 A;  2BW3 B;  3FK7 A;  2XHK A;  3L09 A;  1JXS A;  3ESW B;  4RGX A;  2X1E A;  2E34 A;  3FBN B;  1RKW A;  4BHB A;  3CD6 I;  1HKT A;  4O5V A;  2LFB A;  1FZP B;  1ZTR A;  1S3J A;  3D1N I;  2K85 A;  4IQ4 A;  3K1P A;  4XKW A;  4EJU A;  2HR3 A;  3N97 A;  2Z5U A;  2M7B A;  4L9J A;  4ENK A;  1GDT A;  5ICF A;  2CFO A;  2R7W A;  3ZMZ A;  2HOS A;  2GBY A;  5CVV A;  3WHB A;  2ZME C;  5K5O A;  2HDD A;  1TNT A;  2ISY A;  1ZEL A;  4F91 B;  2XB5 A;  2W00 A;  2UUZ A;  3LSI A;  2Y0S A;  1ZQ3 P;  4HW0 A;  2V1D A;  2HOE A;  4I6Z A;  2JWT A;  3IUO A;  4HX7 A;  4IHT A;  4A6E A;  3OSF A;  4HAM A;  4CH7 A;  1NHA A;  4AID A;  3KP2 A;  3JRB A;  5HLI A;  1ZAO A;  2GXA A;  1FYM A;  1YX5 A;  3BC8 A;  2KPM A;  1BW6 A;  4CXF A;  2YPR A;  3HHH A;  3F3X A;  4DQ2 A;  3B73 A;  1P7J A;  3H5A A;  1SAX A;  1QA6 A;  2CRG A;  4KT5 C;  1IJW C;  2Y31 A;  3FXK A;  4ZZD A;  2L4M A;  4QTR A;  2NVX J;  4A3B J;  3E6B A;  5BPD A;  4FTH A;  1X4P A;  4G6T B;  2XAH A;  2FA5 A;  3A0H C;  2WV0 A;  1MBK A;  1QHG A;  2NS7 A;  4CZZ A;  2HZD A;  3S2H J;  2FE3 A;  1QGP A;  2FOK A;  2JA8 J;  3DPU A;  4AD9 A;  2VPL A;  2MYS A;  3E1S A;  3VFZ A;  4AVZ A;  2JTV A;  5LRS A;  4LIU A;  3WTV C;  4ZYH A;  2CW0 F;  2O03 A;  4JX5 A;  4TV7 A;  4B8X A;  4C9Y A;  2L7M P;  4HYE A;  5BPI A;  1B1B A;  1S29 A;  2VOO A;  1RR8 C;  1XCB A;  5J1R A;  1DU0 A;  1WWX A;  2IA1 A;  1O57 A;  2JRM A;  2EIK H;  2VBY A;  1WJD A;  2NNN A;  2Z99 A;  4EGZ A;  2A69 F;  4OWR B;  5D5U B;  2LY9 A;  1IN8 A;  2IEK A;  3Q3S A;  2QGU A;  3QOP A;  4FT8 A;  4LMY A;  1IRF A;  2QSH X;  3PO3 J;  5M3F J;  1NG6 A;  4GXO A;  2DPU A;  2Q1Z B;  3KEQ A;  2LKX A;  3DP7 A;  4UB8 C;  3I71 A;  1G3T A;  1BW5 A;  1R1U A;  1B59 A;  3BOQ A;  2VPR A;  1ODD A;  2HPI A;  4A3I J;  2JVH A;  2DOA A;  1OCT C;  3M4O J;  3CDI A;  1WH7 A;  2OV7 A;  1YW9 A;  5JHF A;  1A5J A;  3CUO A;  3GVA A;  5FKL A;  4G94 A;  3SFZ A;  3EET A;  1O7F A;  5BMZ A;  3SDB A;  1S5L C;  1ZLK A;  5IT9 Z;  1T0F A;  5H20 A;  2IS1 A;  2EIN H;  2XAG A;  3LMM A;  3VYT B;  5TRD A;  2JA6 J;  5HLG A;  3HRU A;  2ELH A;  3BTI A;  1B4A A;  3FKI J;  3W3C A;  2V6C A;  4XRF A;  3DTE A;  2FBI A;  3DPT A;  1BR4 A;  1TWH J;  2VBX A;  2MSY A;  1UMQ A;  2WY7 Q;  3CCV I;  4M72 A;  2FQ4 A;  2OU2 A;  1P92 A;  4IOA F;  4CA0 A;  3PFI A;  3GTJ J;  2BE5 F;  2FJ1 A;  1BOA A;  1XGM A;  2ME0 A;  3FXR A;  2DMN A;  2LSO A;  5GPC A;  2F5V A;  1V5G A;  1H89 C;  3OS2 A;  5EEH A;  3D5L A;  4RS8 A;  5B3S H;  4S0H B;  2GA1 A;  2R92 J;  3LSP A;  4IXA A;  2LF7 A;  2JUG A;  1JHF A;  5FLX Z;  1IRZ A;  4HV6 A;  2QQ9 A;  4JBA A;  1EV7 A;  1YG2 A;  1VQ5 I;  3AFH A;  2VC1 A;  3TP3 A;  2HYF A;  2VJI A;  1UHW A;  2W85 A;  5DUK A;  2FU4 A;  1SD7 A;  1PP7 U;  1DGW Y;  3DKX A;  4GGG A;  2F5F A;  3VEP A;  1RRJ A;  2AXL A;  3LOC A;  2QCO A;  1IAW A;  4A3F J;  3OYD A;  1R7J A;  1BC7 C;  4L5I A;  3BG3 A;  2DW4 A;  3A2K A;  1ZG5 A;  1FY7 A;  4BAC A;  3OSG A;  1X1A A;  2IGK A;  2P6S A;  2DK5 A;  1ETV A;  3HYI A;  2WAQ A;  1MH4 A;  3E6D A;  5IOY A;  3FHN A;  1EA3 A;  1YYV A;  1HOM A;  2XF5 A;  5JVG F;  4HQE A;  3MAJ A;  5FKO A;  2DYS H;  2Y2Z A;  1J0R A;  4JX4 A;  1UB9 A;  3PSF A;  4H0E A;  5FB2 A;  1U0J A;  3BZK A;  3MVP A;  3SZT A;  4M3B A;  5ERI A;  1MJ9 A;  4XR6 A;  4XLE A;  2X6W A;  3BR1 A;  3K69 A;  3WHC A;  1JKQ C;  3CC2 I;  3H0D A;  5JVT A;  1DP3 A;  3KFW X;  1FPQ A;  2WAQ N;  3LWF A;  2LOO A;  1QPI A;  3TOA A;  5L3D A;  2QM3 A;  3U1D A;  2Z33 A;  2HVS A;  3EUA A;  3MMY B;  1FBQ A;  4BE0 A;  3E6M A;  4BQQ A;  2PMZ N;  3C1D A;  2KRF A;  4HOB A;  4BY1 J;  2RKH A;  1BI3 A;  4ENN A;  5F04 A;  1U3E M;  3JAM K;  4XKC A;  1PUF A;  2ZSH B;  4IRH A;  5DM6 F;  3EPZ A;  3ZR8 X;  4F93 B;  3OOU A;  1TWC J;  1KYW A;  3HZJ A;  3SQN A;  3RI4 A;  3O8G A;  4WXH A;  2F5D A;  3ABU A;  4F3Q A;  5FKN A;  3RKW A;  4HF0 A;  3CTA A;  2DDA A;  5BOX A;  2K9M A;  3COA C;  1R4M B;  5K5R A;  4E7I A;  2K3P A;  1TZL A;  3GLL A;  1UEL B;  3M8E A;  1GV5 A;  2HYG D;  5D6E A;  1LUJ B;  1WSU A;  3G3Z A;  2KKO A;  4Y13 A;  1XGO A;  3PL8 A;  4EJT A;  5HLT A;  2C6Y A;  2HZT A;  1BBY A;  1V5E A;  5HDK A;  3VSL A;  3R0J A;  3I53 A;  4A3E J;  1LPQ A;  1EH6 A;  2V1N A;  1ZR2 A;  2V7F A;  2OC6 A;  3ISP A;  1EH7 A;  2R5Y B;  3FMQ A;  2RRE A;  1WI9 A;  1X19 A;  1FBU A;  1LNW A;  3I0T A;  4IX7 A;  3CUQ B;  2VQL A;  4CCM A;  4JQF A;  1X1C A;  4L9V A;  1E3O C;  2DMP A;  2WAD A;  4LGW A;  5DCF A;  2F6C A;  4XOT A;  4WWC A;  2QVO A;  3DF8 A;  4MTE A;  4WK8 F;  3WTY C;  2UWM A;  4M3G A;  3I4P A;  4B47 A;  3HRM A;  2H94 A;  2HVQ A;  4C2U A;  5L3E A;  2DOF A;  3IKT A;  4A2U A;  1GLN A;  2PJR B;  1UFM A;  3DBL B;  3LL7 A;  5LGN A;  2Z9O A;  2JVG A;  1RET A;  3PNY A;  2VKH A;  2D5V A;  2DXI A;  1OCR H;  5TGT A;  4KIS A;  2R7U A;  2LYC A;  2DMQ A;  3K4B A;  3A01 A;  3L2R A;  1MDM A;  3GTO J;  1FTZ A;  2FNP A;  3CC7 I;  3A0B C;  2DJN A;  2VE8 A;  3BP8 A;  1Q1H A;  3M9A A;  2E5N A;  3NWS A;  4S05 A;  1ZHF A;  2M4G A;  4HF1 A;  3F8B A;  2BHY A;  2KRH A;  2NS0 A;  3BT9 A;  1S8N A;  2QUF A;  4F52 A;  2ZKZ A;  2E36 A;  2ACJ A;  1W5C C;  4HSR A;  1L3L A;  4UV8 A;  1HKQ A;  2P6T A;  3NWT A;  3CCS I;  2XGC A;  4Z2Y A;  5AIQ A;  2DA6 A;  5CVJ A;  2A68 F;  1R71 A;  2CQ7 A;  4ON0 A;  2COB A;  1OCP A;  1USS A;  1YIT I;  1FLI A;  4XKV A;  3H3V K;  2JA2 A;  4AIJ A;  3FXO A;  1I1S A;  4BXU A;  3TW6 A;  1K78 B;  4EVI A;  1HW1 A;  2HPM A;  2Y48 A;  5DV5 A;  3BJ6 A;  2DQL A;  2D1H A;  1GXQ A;  1P4X A;  2XGX A;  5IP6 A;  3I4M J;  2KLO A;  3GZN B;  5D6F A;  1R58 A;  2GOX B;  2HWV A;  1GXP A;  2X1C A;  2XPV A;  1I50 J;  3TL4 X;  4EMS A;  1OCZ H;  3MQ0 A;  2YX7 A;  3OY9 A;  4C3H J;  1XD7 A;  3SDG A;  1VF9 A;  1YIO A;  3RQ4 A;  1QZY A;  4BAY A;  5EEG A;  2ESH A;  3E3V A;  4Q5S F;  1RNL A;  3B6A A;  2B63 J;  1IN5 A;  3LA2 A;  1ON1 A;  1PJR A;  1V3F A;  1JJ6 C;  4XBF A;  2DA3 A;  4X1E A;  1YOV B;  3OYJ A;  1FOW A;  2H6C A;  2L7K A;  4IRI A;  1XCV A;  2VT2 A;  2XIG A;  1AKH A;  1ITY A;  4LIV A;  3WOD F;  3TDU C;  1VQ4 I;  3BZ6 A;  2M2E A;  2K27 A;  5IP9 J;  3CP2 A;  3BR5 A;  2A3S A;  1IN4 A;  1WRJ A;  2P4W A;  2XAQ A;  3E5U A;  2OAZ A;  3I9V 2;  2DTR A;  1HKS A;  2NOJ B;  2ICW G;  3HIF A;  4AC0 A;  1D0X A;  4LD5 A;  3L00 A;  4I99 C;  5J40 A;  4A0X A;  1KQ8 A;  2K40 A;  1GV2 A;  2PG4 A;  3BTL A;  1MGT A;  3D5S C;  1BOB A;  1KGS A;  2WAE A;  2IXS A;  3BRO A;  3KIO A;  2ZJP F;  3H9Q A;  3W2A A;  4RAF A;  2F4M B;  2R0Q C;  1TW2 A;  4LFU A;  4ASN A;  3JRA A;  3CCR I;  2LKP A;  2WC2 A;  2ZNY A;  5IYD J;  5LHI A;  1UCR A;  4N9I A;  5DEQ A;  2VAS A;  4D7M A;  3K6G A;  4WF2 A;  3JRC A;  1XMA A;  3EUK L;  5CVI A;  1R1T A;  2NYX A;  3K4K A;  4PJ0 C;  4RB1 A;  3LSG A;  4NC8 A;  2LR8 A;  3ERE D;  2OCE A;  5B5E C;  1ETK A;  3S1R J;  3L2U A;  4J19 A;  2M4K A;  1VQ7 I;  1KU2 A;  3RTR A;  4CYC B;  2UV1 A;  2CUE A;  4NDL A;  5KAI C;  2ZCW A;  4B4C A;  4P9F A;  2HYJ A;  3OMY A;  2MH9 A;  2DFF A;  3LFK A;  4BS9 A;  1MSF C;  3S1M J;  1T0F C;  3SJM A;  1FT9 A;  4I01 A;  1DUX C;  2E1M B;  3IHU A;  2HGC A;  4F55 A;  1MNM C;  2QBY B;  3ECH A;  3ZQL A;  2M0M A;  3HGY A;  2W25 A;  4ZYG A;  2RQP A;  2ZC2 A;  1HLV A;  3ML6 A;  2P8T A;  5K5Q A;  1X2N A;  1BR1 A;  3S16 J;  3DTK A;  2O0Y A;  1ZRE A;  2FF4 A;  4RBO A;  1MBE A;  4Y3O A;  1DGR M;  3FIS A;  1DP7 P;  2HTS A;  2E2H J;  5D4S A;  1KQ9 A;  4L0Z B;  4Y15 A;  3AAF A;  1P7I A;  4UB6 C;  2K5C A;  1XN7 A;  4UUS B;  1E3P A;  2CQN A;  2PMU A;  2FOW A;  1BIA A;  1HST A;  1V5F A;  1IN7 A;  1Z0X A;  5TJJ A;  3K10 A;  2CG4 A;  4GDF A;  5ILU A;  2FBK A;  3CO7 C;  3GFL A;  1QO0 D;  4CCK A;  3L2Q A;  1TP4 A;  3CUQ C;  2E35 A;  2Y0S N;  4BGD A;  3KPH A;  3QAH A;  2MLK A;  3U9G A;  1H9G A;  1A6I A;  4NQW A;  1VQL I;  4J00 A;  2CV0 A;  1H8A C;  1BR2 A;  2UZK A;  3K70 D;  1Z05 A;  1R22 A;  1KYZ A;  1YW8 A;  3OYN A;  3EQL F;  3HJE A;  3FXJ A;  3HOY J;  4XL9 A;  3K2A A;  1BI0 A;  2OTL I;  1W4M A;  5C4X J;  1V4R A;  2Z16 A;  5F1R A;  3TW7 A;  2VUM J;  4BJT A;  2TCT A;  2EWN A;  4IEJ A;  4Y4R A;  3C3W A;  2ZFW A;  3V7R A;  3WE3 A;  1T6S A;  1XGS A;  2BY2 A;  2H1L A;  2LH9 A;  4YEL A;  1LQ1 A;  1IRG A;  3J7Y J;  5D8L B;  3JSP A;  5F08 A;  1GT0 C;  3BZC A;  5ILV A;  1YS7 A;  3U21 A;  5FLV A;  4IOC F;  2XGE A;  3AL0 C;  1Z1D A;  4KUM A;  3FXL A;  5ED4 A;  3BJO A;  4I76 A;  4HDU A;  3CJT B;  1MJB A;  4G9Y A;  1I3A A;  3IH4 A;  1ETQ A;  3NRV A;  2VN2 A;  4BXX J;  2L9R A;  3HPH A;  2EPF A;  4NNJ A;  2A5Y B;  2DLL A;  2H09 A;  5CQE A;  4CCJ A;  5DUI A;  3C2H A;  5FLX K;  5J4Y A;  2GWR A;  1QHH D;  4N4O B;  1MZB A;  4I02 A;  4LG0 B;  3SYT A;  2G7H A;  2QSF X;  2WV1 A;  3Q9S A;  2DT7 B;  2Y0M A;  2QA4 I;  3BCA A;  2AS5 F;  3CMA I;  1UG0 A;  1FX7 A;  3IKV A;  4AVP A;  1MBH A;  4E7L A;  4KN4 X;  5CJ9 A;  5BS6 A;  5J8C A;  1T38 A;  1ETX A;  4LLL A;  3F21 A;  3QU3 A;  4C3I J;  2LG4 A;  4HG2 A;  5CYV A;  3NEU A;  3EUH A;  3VYS B;  5K7F A;  3H92 A;  1ZRF A;  3LSM A;  3EYY A;  4BQN A;  4DNC A;  3TO6 A;  4UVC A;  2DOD A;  2R7O A;  3GW2 A;  3JCU C;  3DEU A;  2P81 A;  1BA5 A;  3M1E A;  4RAY A;  4KMU X;  5EYR A;  2IW5 A;  1WGX A;  3BG9 A;  5KHD A;  2DK8 A;  4BKX A;  5FJ8 J;  4CCL A;  2LF8 A;  1Z7U A;  3CUQ A;  2YU9 J;  3KP5 A;  4KJZ A;  1JHH A;  4BDZ A;  3ZRG A;  2ZFU A;  1T39 A;  5L3F A;  1TQM A;  1YRN A;  4BE1 A;  5E3N A;  3K4C A;  5DCM A;  4ZJZ A;  4EEF G;  1XDU A;  2H6B A;  1Z77 A;  2R7Q A;  3HSR A;  3WGG A;  4CZC A;  4GO1 A;  5ILS A;  3F22 A;  1IF1 A;  3LQQ A;  2EZH A;  2A61 A;  2LTP A;  4ENJ A;  2FD5 A;  2F2E A;  5LHH A;  1P4W A;  4DIQ A;  2MGQ A;  4MEX F;  5AIP A;  1S7O A;  5EZH A;  2P7V B;  2NVT J;  2A5W A;  3ABL H;  4CSW A;  4C30 A;  4IL6 C;  3G2B A;  1TL8 A;  1FOX A;  1W7P A;  1T98 A;  4M6V A;  2CW7 A;  3GZ6 A;  2HFH A;  3CCU I;  4A0Y A;  4UV9 A;  2W57 A;  5E1W A;  2VBZ A;  5FD5 A;  3WTU C;  4V2G A;  2MW8 A;  4G12 A;  3RYP A;  4BY7 J;  5E17 F;  5J3L A;  4OAY A;  1SMT A;  2IP2 A;  5HOD A;  2K9S A;  3BPV A;  4MFE A;  3PJR A;  3Q0W A;  4L5J A;  5EJC A;  1OYI A;  1DQU A;  2KJC A;  3PNV A;  3RZD J;  3QYB A;  1MW7 A;  4YII A;  3K70 C;  4PSW A;  3H0G J;  1LFB A;  2E2J J;  2E1M C;  1QRY A;  1OCC H;  4XLH A;  1YW7 A;  3D5R C;  2EIM H;  1XX5 A;  4Q48 A;  2B7E A;  4E4H A;  4D1Q A;  3HEF A;  1W1W E;  4I2O A;  3P9C A;  3LA7 A;  1BJZ A;  1TT0 A;  5FGM A;  2X6Y A;  3FXQ A;  1VQ6 I;  1HW5 A;  1WJ5 A;  1T56 A;  5L3C A;  1ZGA A;  2HEO A;  4PZJ A;  1S7E A;  5EEA A;  3LSJ A;  3DEE A;  3R0A A;  4II3 A;  3PIP F;  2J5O A;  1ETW A;  3OL4 A;  1QZE A;  2WTE A;  1U5T A;  1U8B A;  3RKY A;  3ASO H;  1JKO C;  2LKS A;  5FRM A;  3O2P E;  2VQG A;  1JUP A;  5EZG A;  3J81 Z;  3L1P A;  1U9O A;  2R5Z B;  3U1K A;  5D5X B;  2LY1 A;  3OS0 A;  2GIV A;  3OR2 C;  3VDX A;  1IV6 A;  1WZ2 A;  4RLQ A;  5FFZ A;  4D5F A;  5GAH J;  4N0B A;  3A01 B;  3QP5 A;  5J47 A;  5F0H A;  3WTZ A;  4L18 B;  4IHV A;  2K9Q A;  3B02 A;  2XC7 A;  4YIF A;  3S17 J;  2HNH A;  5FFX A;  2VQH A;  1G8X A;  1IDZ A;  2L9S A;  3L9F A;  1JGS A;  3HTS B;  4P55 A;  2DU9 A;  2O61 A;  4HQM A;  5BQT A;  2UXX A;  4EQQ A;  2L3D A;  3RDI A;  5EGO B;  3IP4 B;  2BZT A;  2DDB A;  2AHQ A;  1U5T B;  2BXY A;  5CQG A;  1RIO H;  4A5M A;  4WX9 A;  1B6A A;  3IWF A;  2OTJ I;  2HQR A;  4M9Z A;  4DZJ A;  1UAA A;  4HX8 A;  5CKT A;  3K4L A;  2LC2 A;  3B6C A;  2XRL A;  5GAD J;  1XS9 A;  4LJZ F;  4FQG A;  3BTJ A;  4B1R A;  2O5R A;  3H5N A;  4FIS A;  2HQA A;  1LE8 B;  3KZI C;  2GOM A;  4WCG A;  4C2T A;  1RC9 A;  2A6T A;  2HXO A;  1D0Y A;  4CDG A;  2D45 A;  1IXC A;  3I58 A;  2X4H A;  1B72 A;  4BEH A;  4L0Y B;  4CYC A;  2E2I J;  3AL0 B;  2VKD A;  2MFZ A;  1WJF A;  4HA8 A;  2CGP A;  3HUG B;  3SHF A;  1MIJ A;  1SVO A;  5E1Z B;  4FCY A;  2LY2 A;  3FM5 A;  4MIM A;  3CZ6 A;  1J75 A;  2PEX A;  2PMH A;  3T8T A;  3I5U A;  4XOR A;  4L9T A;  1OYY A;  3G73 A;  1X1B A;  2HQ5 A;  3G6E I;  2L01 A;  1QPM A;  3VOD A;  1W7P D;  2BW3 A;  2PFB A;  4U88 A;  2CFX A;  4KT6 A;  4A6D A;  1APL C;  2A07 F;  5CPR B;  3QU6 A;  1HA8 A;  1LB2 A;  3J81 K;  2JA5 J;  1ZRD A;  2ZJR F;  4ETS A;  3AG4 H;  2CQX A;  1X1P A;  5LEK A;  1UZC A;  4A93 J;  4XN0 A;  1I3Q J;  3RCO A;  2EFW A;  5C3E J;  3FHZ A;  1WI3 A;  1I6X A;  2DA7 A;  2ETH A;  4QWQ A;  3F6O A;  2E1N A;  3K7A J;  3OIQ A;  3SFI A;  1W0U A;  1WJA A;  4A3C J;  2E60 A;  2EV6 A;  5KAF C;  4B3A A;  5IYB J;  1XG1 A;  2GM4 A;  3OYB A;  2H1K A;  2ELK A;  3VWB A;  1F43 A;  3SEZ A;  4AYB N;  1NTC A;  2RDP A;  5E3M A;  1MBG A;  2MC4 A;  1U78 A;  2W24 A;  3I4N J;  2KDO A;  1DPU A;  4HRI A;  1ZGJ A;  2EQR A;  1HW2 A;  1B9M A;  3HOS A;  1H9T A;  1WQ2 A;  4NB5 A;  2QQA A;  2YSR A;  3CDL A;  3LSH A;  1JE8 A;  4FE4 A;  4WXD A;  4R1H A;  4A3D J;  1D5Y A;  3PQJ A;  2VC0 A;  4BU2 A;  3A4C A;  1W7P B;  5JR3 A;  1XB4 A;  2P5V A;  3DCF A;  1X58 A;  3FDY A;  1RI7 A;  5LGU A;  3CO6 C;  1SAU A;  4H4K C;  4M3E A;  2JRT A;  1JTY A;  1R4N B;  4PUS A;  3WTW C;  3ZCO A;  3GTQ J;  5HLH A;  3QPS A;  3S3N A;  2Q0O A;  1WHU A;  3ZMU A;  1VQ8 I;  4BE2 A;  1LDD A;  3DU5 A;  5JFR A;  4Y17 A;  1X3W B;  2WWY A;  2ZXH A;  4I98 B;  2MA3 A;  2PJR A;  3BG5 A;  1MBF A;  4M3D A;  3DWL E;  2IRF G;  4ZC3 A;  1LEB A;  3VYR B;  3FK6 A;  2PBI A;  3DBR B;  3QOD A;  4YIR X;  2BYV E;  4LIT A;  2YU3 A;  3TGN A;  4NC6 A;  4FAS D;  3V8K A;  1TW3 A;  4YRV A;  1Z21 A;  6PAX A;  4XKB A;  4B44 A;  3ULQ B;  1YTY A;  3R4K A;  4AYB A;  1G3S A;  4A3J J;  2WB1 A;  1OR7 A; 
#chains in the Genus database with same CATH homology
 3BJA A;  2LDU A;  2VON A;  5F6F A;  4KIC A;  5HVQ C;  3GFM A;  2L02 A;  4M6Y A;  5D4R A;  3TO9 A;  3I54 A;  4KA4 A;  3LAP A;  1S6L A;  2XKO A;  2JSC A;  3N4M A;  4KDP A;  5J6X A;  3EDP A;  5HDG A;  1R00 A;  1SFX A;  3W6J B;  2K7L A;  3IL2 A;  1C0W A;  3REO A;  1AWC A;  4O3M A;  3T0Y A;  1W5S A;  2O6G E;  4IHS A;  3GX4 X;  5F64 A;  4CO8 A;  3JAM Z;  4MGR A;  3DXJ F;  3WTS C;  1CF7 A;  4QLC U;  2PJP A;  3J80 Z;  4XSZ F;  4BHP A;  3JTG A;  3WTT C;  1HQC A;  2HKO A;  2FBH A;  3GF2 A;  2X0L A;  4U0W A;  4PGG A;  4HDV A;  4RGS A;  4F7Z A;  1I27 A;  5KK1 A;  1TQI A;  3JTH A;  4BH9 A;  2CO5 A;  4IVN A;  1PUE E;  3HUG A;  3GO5 A;  4ESJ A;  4UXN A;  4KFC A;  4EV0 A;  2JZY A;  2Q2E A;  3KP7 A;  5HS9 A;  4MNU A;  1YO5 C;  2EFN A;  3FM3 A;  1XSV A;  2QLZ A;  1IN6 A;  3O6B B;  2M1B A;  2ZO4 A;  4UVA A;  2OQR A;  2XKP A;  1BC8 C;  1RUN A;  3KP6 A;  3Q5F A;  4OIN F;  3SXY A;  4M9X A;  1P2F A;  2K4B A;  2G7U A;  1D3Y A;  4U0Y A;  3KP3 A;  3SZP A;  2QQB A;  5KVR A;  3DKW A;  1FSH A;  4OOI A;  1STZ A;  3KLO A;  1FP1 D;  2JPC A;  4KYW A;  4OU0 A;  2QBY A;  3WG9 A;  1FYK A;  2QYO A;  5ICG A;  4OIR F;  4OIP F;  3CDH A;  3H3U A;  4M71 A;  2O8X A;  2JPB A;  3V7C A;  4OMZ A;  3LST A;  2EFO A;  4Q47 A;  5IT3 A;  3V8J A;  2HKX A;  4G6D A;  1PP8 F;  3IC7 A;  1F9N A;  3F8C A;  4RGR A;  1QQI A;  1XDS A;  1D5V A;  3FX3 A;  4G7H F;  3RPQ A;  4FX0 A;  4AIH A;  2OA4 A;  2XAS A;  1U8R A;  1RZ4 A;  1QNT A;  1F1Z A;  3VOE A;  1H0M A;  2ADU A;  3V8L A;  2VE9 A;  3DPL C;  1SFU A;  4PCQ A;  4RB0 A;  4ZYE A;  4S04 A;  5L3B A;  4HBL A;  2D2W A;  3WU1 B;  5E20 A;  1Z9C A;  2M30 A;  2ZBK A;  3WGI A;  2FML A;  3BPX A;  2GA2 A;  1SD4 A;  3F6V A;  1ZH5 A;  4G8X A;  1R5H A;  2HQN A;  2DAO A;  4B09 A;  4UNO A;  4LG0 A;  3HHG A;  1W5T A;  1TBX A;  2FSW A;  1SMY F;  1R1V A;  1ULY A;  4EM2 A;  1RUO A;  3E6C C;  3FXU A;  5K1Y A;  1EH8 A;  2EA2 A;  2V1U A;  1OKR A;  4CHU A;  3MFK A;  1KU3 A;  1LDJ A;  2IVM A;  3MZH A;  3GEZ A;  4P5O A;  1BI1 A;  3PQK A;  2L4A A;  1YLF A;  1GVJ A;  1KU9 A;  1MKM A;  3GUD A;  2XV4 S;  2GQQ A;  5DCM B;  4WXC A;  1K7A A;  3RYR A;  2DO7 A;  1LJ9 A;  3JSO A;  1YQA A;  2XUB A;  4BYY A;  1HXD A;  3BDD A;  4GYI A;  1ZG3 A;  3TDZ C;  2XAJ A;  2RN7 A;  4GCV A;  3M7G A;  2A6E F;  1ZG1 A;  3F23 A;  4IRG A;  2FEZ A;  3ROU A;  2KIU A;  1XMK A;  1U6G A;  2ZJ2 A;  5JI6 A;  3D0S A;  1GHC A;  2YX4 A;  5LHG A;  1LVA A;  3OV8 A;  3RIR A;  2O3F A;  3GFI A;  2UXN A;  3OOP A;  1P6R A;  2QZ8 A;  4G7Z F;  1G4D A;  4U7D A;  2K86 A;  4YFX F;  4YFN F;  2BBY A;  3KET A;  2OD5 A;  3KEO A;  3IRR A;  1MD0 A;  2A6H F;  3GLX A;  3BY6 A;  5D5V B;  1S7A A;  2M8E A;  1Z91 A;  4YG2 F;  3V4G A;  2IPQ X;  1O7L A;  4RAZ A;  3IRQ A;  2EV0 A;  1O3Q A;  2RNJ A;  4EJO A;  5H6R A;  3FMS A;  3FZV A;  4P96 A;  4A5N A;  2IA0 A;  1IXS B;  1IW7 F;  5AON A;  1P4A A;  1VTN C;  2NRA C;  1R36 A;  2XVC A;  1G6N A;  2MH2 A;  3LA3 A;  4IPA A;  1I1G A;  3K1N A;  4LK0 F;  2DPD A;  1ZLJ A;  1ONV A;  4K2E A;  4LK1 F;  2XRN A;  4A0Z A;  1OPC A;  1DDN A;  3KP4 A;  4ESB A;  2EK5 A;  3J7A O;  4I0A A;  2BV6 A;  4KIG A;  2P5L C;  2CQK A;  1FWZ A;  2Y75 A;  2E7W A;  1ON2 A;  2DFI A;  2IT0 A;  1G3W A;  2HDC A;  5J8F A;  3GYH X;  1LDK B;  2KJB A;  3P9I A;  3KE2 A;  3DQV C;  5E8G A;  4HLX A;  3MCZ A;  5LGT A;  4CIC A;  2QEN A;  2G9W A;  3Q9V A;  2OZU A;  1BN5 A;  1G3Y A;  3FF5 A;  3H3Z A;  1ZRC A;  4LLG F;  3WU0 A;  2OQG A;  4I7H A;  3U2R A;  2M5W A;  1HBX G;  2E1C A;  4ZH4 F;  1IZ1 A;  1A04 A;  1O3R A;  1ZYR F;  4PDK A;  1KQ0 A;  4LLN A;  3BWG A;  1J9I A;  4BNC A;  5D8K B;  4R79 A;  1J2X A;  5ICE A;  1FP2 A;  1ZAR A;  3JW4 A;  2P7C B;  1FBS A;  1TNS A;  5L3G A;  1FYL A;  3ZQ7 A;  2CSO A;  3HTU A;  2STW A;  4OMY A;  5LLQ A;  3S2W A;  4HX4 A;  4JK1 X;  3V7S A;  3F72 A;  3ZP5 A;  3QPH A;  3TO7 A;  4MTD A;  1QZZ A;  3ZN1 A;  4XLP F;  4LB5 A;  2MD5 A;  3DV8 A;  3T1B A;  3E5Q A;  3HSE A;  3RKX A;  2E7X A;  5FO5 A;  1MDM B;  4D0P A;  5DDG A;  3P9K A;  2OBP A;  3HSF A;  2XRO A;  4MQ9 F;  4A12 A;  3EYI A;  1BI2 A;  5HDN A;  5D5W B;  2TDX A;  2MC3 A;  1G3S A;  2V1X A;  1J5Y A;  2VXZ A;  3ZMT A;  2VBW A;  2H27 A;  4HZF A;  3ZMV A;  1SD6 A;  3C18 A;  3DFG A;  1F5T A;  1YFH A;  1BIB A;  2D1V A;  4PGH A;  2EV5 A;  1AOY A;  1Z6T A;  2PLY A;  1UST A;  2IJL A;  2QWW A;  4LB6 B;  3CLO A;  3T5X A;  2FNA A;  5CLS A;  5A2Q K;  1R23 A;  4GYG A;  1L0O C;  4UUV A;  2PQ8 A;  2R7F A;  3QPT A;  2M45 A;  4HV5 A;  4RB2 C;  4KN7 X;  4HLY A;  2CYY A;  2R7D A;  2KIF A;  1OYW A;  4L9N A;  5A2Q Z;  2PI0 A;  4E70 A;  4UHT A;  5HOO A;  3ZPL A;  3QRF F;  2GXB A;  1U5T C;  1E2X A;  4AWX B;  1D8K A;  3F8F A;  1D8J A;  1CF7 B;  2ESN A;  3F8N A;  1OMI A;  2EFQ A;  2J5P A;  2NNY A;  5HS7 A;  1REP C;  4RGU A;  1UHM A;  2PN6 A;  3R6S A;  3T8R A;  3GXO A;  1BJA A;  2FQ3 A;  2DI3 A;  3L2C A;  4IF4 A;  3KZY A;  3WGH A;  3TQN A;  4M74 A;  3MZY A;  4U0V A;  4M6X A;  2COM A;  4HF2 A;  3K9T A;  1ZN2 A;  3E5X A;  3GFJ A;  4M73 A;  3FWE A;  3HRT A;  2RVC A;  2EJR A;  2ZME A;  4P9U A;  1KU7 A;  4I09 A;  3K1M A;  1SFE A;  2CWE A;  5LRR A;  1E17 A;  5H6Q A;  3KZZ A;  5FD6 A;  4NHJ A;  2RC4 A;  1R5G A;  3O3K A;  2Z3Y A;  3M8F A;  5E8I A;  3R61 A;  4ESF A;  5E1X A;  1U2W A;  4FX4 A;  2DBB A;  4UVB A;  1SD5 A;  2DT5 A;  4OIQ F;  2Q8K A;  2B0L A;  2IA2 A;  2KIM A;  4G6Q A;  4KIF A;  1F4K A;  1O3T A;  3I59 B;  1MJA A;  4CYD A;  1FNN A;  3W6K B;  4R8H A;  5E18 F;  4BHC A;  1BM9 A;  3GZ5 A;  4Q4Z F;  2VOD A;  3F8M A;  2K4J A;  3WE2 A;  2YR2 A;  4ZYD A;  3TKY A;  3K0L A;  4MEY F;  3J80 K;  1DPR A;  1K78 A;  1PDN C;  1XSD A;  3CJN A;  1O3S A;  2F5C A;  5JHU A;  5CVU A;  2F5E A;  4O6J A;  3ZMD A;  3FMR A;  4XLN F;  1TLH B;  1IXR C;  1IUY A;  1T2K A;  3MWM A;  4EJV A;  5LBQ A;  1Z6R A;  5DD8 A;  2HS5 A;  2OZ6 A;  2XAF A;  3GWZ A;  2EB7 A;  5IT9 K;  4KIB A;  2GAU A;  3I64 A;  4ENM A;  1TTY A;  3LQR A;  2M87 A;  2GXG A;  2FXA A;  4ZZL A;  2R3S A;  2MBF A;  4AIK A;  1QBJ A;  1K79 A;  2ZNZ A;  2V9V A;  2RV8 A;  4M9S A;  2BEO A;  3ABT A;  4BQA A;  2FMY A;  1I5Z A;  2JT1 A;  1X3U A;  4EM0 B;  5LEJ A;  4EJW A;  2BGC A;  4EGY A;  1Y0U A;  4YFK F;  2EFP A;  2ZME B;  3E97 A;  2HTJ A;  4OIO F;  3QP6 A;  1CGP A;  4CGZ A;  1XGN A;  1XSX A;  4U7B A;  5DD4 A;  4FHT A;  1FOK A;  4KMF A;  2EA4 A;  5HS8 A;  4EM1 A;  2K02 A;  3K2Z A;  5ICC A;  4KNY A;  2STT A;  2ISZ A;  3IWZ A;  1LEA A;  2P5K A;  3RPU A;  3ECO A;  1FC3 A;  4IJA A;  3NQO A;  2FRH A;  4XSX F;  4MQV A;  2W84 A;  5DYM A;  1TQP A;  1FSE A;  3TOB A;  3L7W A;  2RGV A;  3I59 A;  2DQR A;  4G7O F;  2VT3 A;  2MLG A;  3HRS A;  5CVR A;  4N9H A;  1B9N A;  2L54 A;  3KLN A;  4MHG A;  2VOP A;  3ELK A;  3C7J A;  1WKM A;  3ZMS A;  4RB3 C;  3RJP A;  3HOT A;  1KA8 A;  3MEX A;  3WTX C;  1K6O A;  1YS6 A;  2NAZ A;  3P7N A;  1J59 A;  4I0B A;  3VB2 A;  3ZN0 A;  2GZW A;  1HSJ A;  2LNB A;  1J7K A;  2ZXJ A;  3LAJ A;  2V79 A;  3R60 A;  2XHK A;  3L09 A;  1JXS A;  4RGX A;  4BHB A;  1HKT A;  4O5V A;  1FZP B;  1S3J A;  3K1P A;  4EJU A;  2HR3 A;  3N97 A;  2Z5U A;  4L9J A;  4ENK A;  5ICF A;  3ZMZ A;  5CVV A;  5K5O A;  1TNT A;  2ISY A;  4HW0 A;  2V1D A;  2HOE A;  4HX7 A;  4IHT A;  4A6E A;  4HAM A;  1NHA A;  3KP2 A;  5HLI A;  1ZAO A;  1FYM A;  4CXF A;  2YPR A;  3HHH A;  3F3X A;  4DQ2 A;  3B73 A;  1SAX A;  4KT5 C;  4ZZD A;  2L4M A;  3E6B A;  5BPD A;  2XAH A;  2FA5 A;  2WV0 A;  4CZZ A;  2FE3 A;  1QGP A;  2FOK A;  4AD9 A;  3VFZ A;  2JTV A;  5LRS A;  3WTV C;  4ZYH A;  2CW0 F;  2O03 A;  4TV7 A;  4B8X A;  4HYE A;  5BPI A;  1B1B A;  1S29 A;  2VOO A;  1XCB A;  1WWX A;  2IA1 A;  1O57 A;  2VBY A;  2NNN A;  2Z99 A;  4EGZ A;  2A69 F;  5D5U B;  1IN8 A;  3QOP A;  4FT8 A;  4LMY A;  1IRF A;  4GXO A;  2DPU A;  3KEQ A;  3DP7 A;  3I71 A;  1G3T A;  1R1U A;  1B59 A;  3BOQ A;  1ODD A;  1YW9 A;  3CUO A;  3GVA A;  4G94 A;  3SFZ A;  3EET A;  1O7F A;  5BMZ A;  1ZLK A;  5IT9 Z;  1T0F A;  5H20 A;  2XAG A;  5TRD A;  5HLG A;  3HRU A;  2ELH A;  1B4A A;  2V6C A;  4XRF A;  2FBI A;  3DPT A;  2VBX A;  4M72 A;  2OU2 A;  1P92 A;  3PFI A;  2BE5 F;  1BOA A;  1XGM A;  3FXR A;  2LSO A;  5EEH A;  3D5L A;  4RS8 A;  2GA1 A;  4IXA A;  2LF7 A;  1JHF A;  5FLX Z;  4HV6 A;  2QQ9 A;  4JBA A;  1EV7 A;  1YG2 A;  2VC1 A;  2HYF A;  1UHW A;  2W85 A;  5DUK A;  2FU4 A;  1SD7 A;  1PP7 U;  4GGG A;  2F5F A;  3VEP A;  2AXL A;  1IAW A;  1R7J A;  1BC7 C;  4L5I A;  2DW4 A;  1ZG5 A;  1FY7 A;  2P6S A;  2DK5 A;  3HYI A;  3E6D A;  1YYV A;  4HQE A;  3MAJ A;  1J0R A;  4H0E A;  1UB9 A;  5FB2 A;  3SZT A;  5ERI A;  1MJ9 A;  3K69 A;  5JVT A;  3KFW X;  1FPQ A;  3LWF A;  3TOA A;  5L3D A;  2QM3 A;  3U1D A;  2Z33 A;  1FBQ A;  3E6M A;  3C1D A;  4HOB A;  2KRF A;  2RKH A;  1BI3 A;  4ENN A;  1U3E M;  3JAM K;  4IRH A;  1KYW A;  3SQN A;  3RI4 A;  4WXH A;  2F5D A;  3ABU A;  3RKW A;  4HF0 A;  3CTA A;  5BOX A;  3COA C;  5K5R A;  3M8E A;  2HYG D;  5D6E A;  1WSU A;  3G3Z A;  2KKO A;  4Y13 A;  1XGO A;  4EJT A;  2C6Y A;  2HZT A;  1BBY A;  5HDK A;  3R0J A;  3I53 A;  1EH6 A;  3ISP A;  1EH7 A;  3FMQ A;  1WI9 A;  1FBU A;  1LNW A;  3I0T A;  3CUQ B;  4JQF A;  4L9V A;  4LGW A;  5DCF A;  4WWC A;  2QVO A;  3DF8 A;  4MTE A;  4WK8 F;  3WTY C;  2UWM A;  3I4P A;  3HRM A;  2H94 A;  5L3E A;  3IKT A;  4A2U A;  1UFM A;  5LGN A;  2Z9O A;  1MDM A;  2FNP A;  2VE8 A;  3BP8 A;  1Q1H A;  3M9A A;  4S05 A;  1ZHF A;  4HF1 A;  3F8B A;  2NS0 A;  1S8N A;  2QUF A;  2ZKZ A;  2ACJ A;  1L3L A;  4UV8 A;  1HKQ A;  2P6T A;  4Z2Y A;  5AIQ A;  5CVJ A;  2A68 F;  4ON0 A;  1USS A;  1FLI A;  4AIJ A;  1I1S A;  4BXU A;  1K78 B;  4EVI A;  1HW1 A;  2Y48 A;  5DV5 A;  3BJ6 A;  2DQL A;  2D1H A;  1GXQ A;  1P4X A;  2XGX A;  5D6F A;  1R58 A;  2HWV A;  1GXP A;  4EMS A;  3MQ0 A;  2YX7 A;  1XD7 A;  1YIO A;  1QZY A;  4BAY A;  5EEG A;  2ESH A;  3E3V A;  4Q5S F;  1RNL A;  1IN5 A;  3LA2 A;  1ON1 A;  1V3F A;  4XBF A;  4IRI A;  2H6C A;  1XCV A;  2VT2 A;  2XIG A;  3WOD F;  3TDU C;  3BZ6 A;  2K27 A;  2A3S A;  1IN4 A;  1WRJ A;  2P4W A;  2XAQ A;  3E5U A;  2OAZ A;  2DTR A;  1HKS A;  3HIF A;  4LD5 A;  4A0X A;  3L00 A;  1KQ8 A;  2PG4 A;  1MGT A;  1KGS A;  3BRO A;  1TW2 A;  4LFU A;  4ASN A;  2LKP A;  2WC2 A;  2ZNY A;  5LHI A;  1UCR A;  4N9I A;  5DEQ A;  4WF2 A;  1XMA A;  5CVI A;  1R1T A;  2NYX A;  4RB1 A;  3ERE D;  1KU2 A;  3RTR A;  2ZCW A;  4P9F A;  2MH9 A;  3LFK A;  1FT9 A;  4I01 A;  1DUX C;  3IHU A;  2HGC A;  2QBY B;  3ECH A;  2W25 A;  4ZYG A;  2RQP A;  3ML6 A;  2P8T A;  5K5Q A;  2O0Y A;  1ZRE A;  2FF4 A;  1DP7 P;  2HTS A;  5D4S A;  1KQ9 A;  4L0Z B;  4Y15 A;  3AAF A;  1XN7 A;  2PMU A;  1BIA A;  1HST A;  1IN7 A;  5TJJ A;  2CG4 A;  5ILU A;  2FBK A;  3CO7 C;  3GFL A;  1QO0 D;  3CUQ C;  3QAH A;  2MLK A;  3U9G A;  1H9G A;  4NQW A;  2UZK A;  1Z05 A;  1R22 A;  1KYZ A;  1YW8 A;  3EQL F;  1BI0 A;  1W4M A;  1V4R A;  5F1R A;  2EWN A;  3C3W A;  2ZFW A;  3V7R A;  3WE3 A;  1T6S A;  1XGS A;  1LQ1 A;  1IRG A;  5D8L B;  3JSP A;  5ILV A;  1YS7 A;  1Z1D A;  4KUM A;  5ED4 A;  3BJO A;  4HDU A;  1MJB A;  4G9Y A;  3NRV A;  2VN2 A;  5DUI A;  5FLX K;  2A5Y B;  2DLL A;  2H09 A;  2GWR A;  1MZB A;  4I02 A;  4LG0 B;  2G7H A;  3Q9S A;  2Y0M A;  2AS5 F;  1FX7 A;  3IKV A;  4AVP A;  4KN4 X;  5CJ9 A;  1T38 A;  5BS6 A;  5J8C A;  4LLL A;  3F21 A;  3QU3 A;  5CYV A;  3NEU A;  3EUH A;  3H92 A;  1ZRF A;  3EYY A;  4DNC A;  3TO6 A;  4UVC A;  3GW2 A;  3DEU A;  3M1E A;  4RAY A;  4KMU X;  2IW5 A;  2DK8 A;  2LF8 A;  1Z7U A;  3CUQ A;  3KP5 A;  1JHH A;  1T39 A;  5L3F A;  1TQM A;  5DCM A;  1XDU A;  2H6B A;  3HSR A;  3WGG A;  4GO1 A;  5ILS A;  3F22 A;  1IF1 A;  3LQQ A;  2A61 A;  4ENJ A;  2F2E A;  5LHH A;  1P4W A;  4MEX F;  5AIP A;  1S7O A;  2P7V B;  1W7P A;  1T98 A;  3GZ6 A;  2HFH A;  4A0Y A;  4UV9 A;  2W57 A;  5E1W A;  2VBZ A;  3WTU C;  5FD5 A;  3RYP A;  5E17 F;  1SMT A;  2IP2 A;  3BPV A;  4L5J A;  1OYI A;  2KJC A;  4YII A;  1YW7 A;  4Q48 A;  4I2O A;  3P9C A;  3LA7 A;  5FGM A;  3FXQ A;  1HW5 A;  5L3C A;  2HEO A;  1ZGA A;  4PZJ A;  3R0A A;  2J5O A;  2WTE A;  1U5T A;  3RKY A;  3O2P E;  3J81 Z;  5D5X B;  2GIV A;  5FFZ A;  4N0B A;  3QP5 A;  3WTZ A;  4L18 B;  3B02 A;  4YIF A;  5FFX A;  3L9F A;  1JGS A;  3HTS B;  4P55 A;  2DU9 A;  2O61 A;  4HQM A;  5BQT A;  2UXX A;  4EQQ A;  2L3D A;  3RDI A;  1U5T B;  1RIO H;  4A5M A;  4WX9 A;  1B6A A;  3IWF A;  2HQR A;  4M9Z A;  4HX8 A;  4LJZ F;  4WCG A;  4CDG A;  2D45 A;  1IXC A;  3I58 A;  2X4H A;  4L0Y B;  4HA8 A;  2CGP A;  3SHF A;  5E1Z B;  3FM5 A;  1J75 A;  2PEX A;  2PMH A;  3T8T A;  3I5U A;  4L9T A;  1OYY A;  3G73 A;  2L01 A;  1QPM A;  3VOD A;  1W7P D;  2PFB A;  4U88 A;  2CFX A;  4A6D A;  2A07 F;  3QU6 A;  1LB2 A;  3J81 K;  1ZRD A;  4ETS A;  5LEK A;  2EFW A;  3FHZ A;  2ETH A;  1I6X A;  4QWQ A;  3F6O A;  2E1N A;  2EV6 A;  2RDP A;  1U78 A;  2W24 A;  1DPU A;  1ZGJ A;  1HW2 A;  1B9M A;  3HOS A;  1H9T A;  1WQ2 A;  4NB5 A;  2QQA A;  2YSR A;  1JE8 A;  4WXD A;  4R1H A;  3PQJ A;  2VC0 A;  1W7P B;  5JR3 A;  1XB4 A;  2P5V A;  5LGU A;  1RI7 A;  3CO6 C;  2JRT A;  3WTW C;  5HLH A;  2Q0O A;  3ZMU A;  1LDD A;  5JFR A;  4Y17 A;  2WWY A;  4I98 B;  2MA3 A;  2IRF G;  1LEB A;  2PBI A;  2BYV E;  2YU3 A;  3TGN A;  3V8K A;  1TW3 A;  6PAX A;  3ULQ B;  1YTY A;  3R4K A;  3KCC A;  1OR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...