4RDUA

Crystal structure of a distal-less homeobox protein 5 (dlx5) from homo sapiens at 1.85 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
RKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Homeobox protein DLX-5
publication title Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
rcsb
source organism Homo sapiens
total genus 22
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4rduA01
4M3GA 1GV2A 4FISA 4FTHA 2ZB9A 3QPLA 2LK2A 2Y31A 5E3OA 4XRSG 5FKOA 2M8GX 3OSGA 3TEDA 3GTKJ 5EGOB 1TWCJ 2DA6A 1Q1VA 3I4MJ 1IJWC 4A3GJ 1WH7A 1X2NA 3BG3A 1B8IA 1JJ8C 5IP9J 2NVYJ 5F0FA 2K40A 2ID6A 5M5XJ 1E3OC 4C3IJ 1R9TJ 5EYRA 2FJ1A 3OSFA 2JA5J 2DA1A 1W0UA 1X2MA 2AO9A 4UUSB 1H89C 5FKLA 3SFIA 1ZQ3P 5IP7J 4A93J 3NARA 2KT0A 1JKQC 4C3HJ 2NS8A 1NK3P 5JLXA 3CDLA 2O7OA 4MFDA 3FK6A 2H8RA 1WCMJ 3Q3SA 1BJZA 1VI0A 1ETQA 3ZQIA 1FIAA 1GVDA 3JRHA 2PMZN 2IAIA 1U78A 4B3AA 2P81A 3A03A 4Y52J 5EZGA 3E7LA 1HLVA 2H1KA 3H0GJ 5IYCJ 2FX0A 3FIWA 2L9RA 2LY9A 4A3FJ 2E2HJ 3QPSA 1BW5A 4A3CJ 1FTTA 4EEFG 1BW6A 3H3VK 3HOUJ 1YRNA 1IUFA 2MGQA 1IV6A 3A01B 1S7EA 2GBYA 1JGGA 1MNMC 1RETA 3OOUA 1RESA 1IC8A 3BT9A 2M34A 2HXOA 2JA6J 1GV5A 2XPVA 1D5YA 1JUSA 3LSJA 1QVTA 4M3EA 4G12A 4QTRA 2Y30A 3BR0A 2XGDA 4NDLA 3O8HA 4AC0A 1VF9A 2LR8A 2MSYA 1OCPA 1MSFC 1WPKA 3MVPA 1X58A 3CQZJ 3S2DJ 1LE8B 3JRAA 1ETKA 3Q0WA 4DYQA 1OFCX 1XC5A 5F04A 1IDZA 1T33A 3BR1A 1GUUA 4BBRJ 2NVQJ 3B6CA 3S14J 4C2MJ 3MKLA 1POGA 4JX4A 4GFBA 3JRGA 2HYJA 2VKEA 4L5EA 1P7IA 4A3IJ 1HDDC 3RZOJ 1RKTA 4D7NA 4UUTA 2OF7A 2HXIA 1JT6A 3DEWA 3LOCA 3BTCA 1GT0C 2K9SA 5J1YA 3O8GA 3K2AA 2NOGA 3LSGA 3S16J 1K83J 3GTPJ 2K9QA 2ID3A 2EZKA 1U8BA 2WV1A 5EG0B 2E2IJ 3A02A 1QVUA 1MH3A 4M6VA 3TP0A 5K7FA 2CUFA 2COBA 3HDDA 2G0EA 5GP9A 4DZJA 5J3LA 5EGOA 4IHWA 2E2JJ 1RKWA 2Y0SN 4BKXA 5FLVA 2DTZA 2CJJA 2DMPA 2NVXJ 2HOTA 1A6IA 2XB5A 3GTQJ 1JKPC 1EF4A 2LLKA 4A3KJ 4W1UA 3MN2A 3NAUA 1MBKA 2R5ZB 3JR9A 1ZGWA 3G1MA 1I50J 2R5YB 3F0CA 5DTDA 4B4CA 3WHBA 2YS9A 2JJ7A 4XICA 2ME0A 3LSPA 4MIMA 4IHVA 3BTIA 1VFCA 1JTXA 4V2FA 3I4NJ 3QQAA 2ELKA 3LSRA 3S15J 2K9NA 4DZPA 4MO7A 3HOVJ 2XB0X 3Q0VA 2R0QC 1B72A 5FKKA 2QCOA 1PUFA 2EBIA 3GTOJ 3LNQA 2JK3A 1HF0A 2X6OA 1MH4A 5FKNA 3RKQA 2JMWA 5HODA 5C3EJ 1Y1WJ 2M2EA 2D5VA 1GDTA 1CQTA 1FJLA 3A01A 4A3BJ 2FD5A 4FCYA 2W48A 3BQZA 1JKOC 4BY7J 2XGEA 2HOAA 2QF7A 2IBDA 4M3BA 2Y9YA 1MBHA 4XK4A 3CCYA 4Y7NJ 5JLWA 2NS7A 3JRIA 2CU7A 2L0KA 2RAEA 3PO2J 3S1MJ 3GTJJ 2ME6A 5IPAA 3D1NI 1JUPA 3GTMJ 1IG7A 5C44J 9ANTA 4W97A 1W0TA 1Z0XA 1ZKGA 3JRDA 1H88C 1LE8A 1YRNB 1P7JA 4M3FA 3W6VA 2X48A 1A5JA 5F0CA 1TWAJ 1ETYA 1XG1A 2XRLA 1HCRA 1OJLA 1JUMA 3ZQHA 1I6HJ 3OIOA 1ORKA 2EZIA 1AU7A 1MSEC 2WAQN 1IRZA 2L7MP 3S1RJ 2XGCA 1QPIA 1RPWA 3RZDJ 1SFOJ 1MBJA 1FEXA 3IH2A 1BL0A 3FISA 4M3DA 2JA7J 3HM5A 2L7FP 1UG2A 3HOYJ 2KDZA 5EG0A 3G1OA 1H8AC 3WHCA 1TC3C 1F36A 3HGGA 5EEAA 5EZHA 4J19A 2O9LA 2VPRA 4IEJA 2FQ4A 5J1UA 1LFBA 2DMNA 4FE4A 5FJ8J 2CUEA 4XRSA 1O4XA 1F43A 2GLOA 1AKHB 3BR2A 2MW8A 2X9DA 3BTJA 1XS9A 5F08A 3VPRA 5FKMA 2EZLA 5EDNA 3RQIA 4IHXA 1U9OA 3B6AA 4CYCB 1IGNA 4JP0A 5IP6A 5E3MA 2MG4A 2M0CA 2R5ZA 3SJMA 2DN0A 2EH3A 4A3LJ 4UUSA 5C4XJ 1HOMA 1BA5A 3IV5A 4ABZA 1APLC 1ZR2A 2DMQA 4A69C 4IHYA 1I3QJ 4S0HB 5IOYA 1ITYA 2O8KA 3ZOBA 3HOXJ 1Y1VJ 2XPWA 3JRBA 2VKVA 1NK2P 2YUSA 1IDYA 2VI6A 3S17J 5DS9A 1ETXA 2AHQA 1T56A 4BXXJ 2B63J 5M3MJ 5K7ZA 2ECCA 3FKIJ 2DA3A 1WI3A 2OPTA 1B8IB 4MLOA 5GPCA 2R7ZJ 3BR5A 1ENHA 5F0HA 1VNDA 1G2HA 2DA2A 3HKZN 2HOSA 1SANA 3HB9A 3TW6A 3PO3J 4QSHA 2E19A 1ZR4A 4A3JJ 3ZQLA 3L1PA 4XIDA 2NVTJ 3GBGA 2LP0A 4D7MA 4QIWN 5E3LA 3TW7A 5K7HA 3HGYA 2HDDA 2N8GA 3SDGA 3GTLJ 3JRCA 1MBGA 3BG9A 3HOWJ 1ZTRA 4C3JJ 4I76A 2JN6A 1LFUP 2CRGA 1AHDP 2EQRA 1ETVA 2ECBA 2Y9ZA 1B72B 5J1RA 1PUFB 3BQYA 3M4OJ 4XRMA 3HEFA 2XPUA 2HI3A 5IYDJ 3DCFA 1ZK8A 2LFBA 1UMQA 1OCTC 3CMYA 2JWTA 1U9NA 2M9HA 1JTYA 1Z77A 4A3DJ 1FIPA 2L7ZA 4JX5A 4V2GA 2DMTA 4DYRA 3UKGA 1TWGJ 5M5YJ 2IEKA 5GPAA 1MBFA 3ZQCA 3BG5A 4A3MJ 2CQXA 2LTPA 1JJ6C 2TCTA 4DYCA 5BNGA 4AUXA 2E1OA 1WGXA 3IH3A 3BR6A 2VUMJ 2DJNA 3K7AJ 4DW6A 3S1NJ 4BY1J 3M3YJ 1NTCA 1JKRC 3HBLA 5C4JJ 4LOCA 1WH5A 2GM4A 1FTZA 3HOZJ 3S2HJ 4B1RA 5FLMJ 2Y2ZA 4HNVA 2EZHA 1TWHJ 2LVSA 3ZQGA 3G1LA 3BTLA 1RR7A 2DMUA 4FE7A 5IYBJ 4D5CA 4X6AJ 2JA8J 4JX6A 2LD5A 1MBEA 1TWFJ 3C2BA 5M3FJ 1DU6A 1UHSA 5M5WJ 4MFEA 5F1JA 3FK7A 2LKXA 3Q0UA 3PM1A 4RDUA 3JREA 4I6ZA 4X1EA 1DU0A 4JYKA 3S1QJ 1K61A 2WB1N 3GTGJ 2I10A 1AKHA 2HQ5A 2YU9J 4D5FA 2TRTA 5IOZA 4AYBN 4CYCA 2DA7A 2XSDC 3BR3A 1JT0A 5F27A 5E3NA 4RBOA 4BBSJ 2DA5A 3TP3A 2R92J 1QRYA 1ETWA 3ZQFA 5EF6A 3JRFA 3IH4A 2R5YA 2R93J 1ETOA 2CQQA 2DA4A 1HDPA 4A3EJ
chains in the Genus database with same CATH superfamily
3B02A 3OL4A 2MLGA 4M3GA 3W6KB 4ZJZA 3DU5A 4XKWA 3QPLA 2Z5UA 3MEXA 2RQQA 3AG1H 2VQLA 3K0LA 2OCEA 4RS8A 2I5UA 2V9PA 2X1DA 1SVOA 2ESNA 3H5AA 5J47A 3OSGA 2Z1DA 3RIRA 5EGOB 1TWCJ 2DA6A 2ZNYA 2UXNA 1B9NA 3BZCA 3CZ6A 2O5RA 4HW0A 5M5XJ 4AIKA 2K40A 2XROA 1C0WA 4EM2A 3TGNA 4AVZA 4ETSA 3PJRA 5EYRA 3OSFA 1D8KA 3V42A 2AO9A 4UUSB 4DNCA 4A93J 2J5OA 1JKQC 1NK3P 3VFZA 2PN6A 2X51A 3RDIA 3KLOA 2H1LA 1S6LA 3Q3SA 2M3AA 3GFIA 1QPMA 1BJZA 1F9NA 5E79C 4KA4A 3WG7H 1N75A 1GVDA 3GEZA 3H9GA 4BYYA 1BOAA 1MMDA 4Y52J 1DGWY 4GYGA 3E7LA 3H5NA 5J4YA 1YW8A 3I64A 2BE5F 5D8LB 2L9RA 3S3NA 2E2HJ 3OYNA 4F55A 3A4CA 2KIMA 1ZAOA 4A3CJ 3H3VK 3HOUJ 3FM5A 4J00A 1IUFA 1B6AA 3J80K 2H6CA 1MJ9A 1IV6A 4PJNA 2GBYA 3OYGA 2UXXA 3LWFA 1H9GA 2LMDA 4GYIA 1T95A 1WKMA 2ZKZA 5B3SH 3T8RA 4CUGA 4G9YA 2WAQA 1IC8A 1GXQA 2HXOA 1GV5A 2VOOA 3ESWB 3ASOH 3BC8A 4OAYA 5DV5A 1FOYA 3DXJF 4QTRA 2CFXA 2MBFA 2OA4A 1XCVA 3IL2A 2XGDA 3MZHA 5FLXK 3FXKA 1FMWA 3WODF 1OCPA 4ESFA 4C2TA 1LDDA 3EUHA 3GFLA 2ZXIA 4G94A 1ZELA 1IN4A 2K4BA 3JRAA 4CCMA 1EH8A 1U5TA 2JQ7A 3SFZA 5B1AH 3PQKA 4DYQA 3Q9SA 1UB9A 2JA2A 3V8KA 1TW2A 4Q47A 4BBRJ 2YU3A 5AIQA 1MNEA 4C2MJ 1VZ0A 2KKOA 1W4MA 4L5EA 4A3IJ 1OMIA 3HSEA 4U0YA 3V7SA 4D7NA 4D1QA 3GZNB 2ZC2A 1TZLA 1JT6A 2QQ9A 3U9GA 4AIHA 2BHYA 2XAQA 4I09A 4BE2A 4F91B 2K9SA 2LG4A 5J1YA 3VSLA 1ZRDA 3AAFA 3S16J 3OS0A 1W5TA 3S32A 3JSOA 1CF7A 4XSXF 2X1CA 2EZKA 4UY8I 5D5XB 4BEHB 3L2RA 2DAOA 4M6VA 3W2AA 1S7OA 4HF2A 3S93A 1IF1A 5EGOA 5J3LA 2ICWG 5CVIA 4CH7A 2E2JJ 1RKWA 4AM3A 2KIUA 2DTZA 3J80Z 2M4GA 2XB5A 3I59B 1X3WB 3GTQJ 2LKPA 1JKPC 2LLKA 2YX7A 3GX4X 4A3KJ 1DP3A 3RJPA 1ZARA 5CQGA 5LD2C 1ZGWA 2I8DA 3G1MA 1BI2A 2R4GA 4IO9F 3F0CA 1MD0A 2DQLA 1IRFA 3QOEA 4XR6A 2YS9A 3IRRA 3K69A 4TV7A 5FLXZ 4MIMA 3K4JA 2W85A 4FETA 4U0VA 4IHVA 3K10A 4MTDA 3I4NJ 3C7JA 1VQLI 3DPLC 4ZYEA 3KCCA 4MO7A 3W3CA 3C2GA 1FY7A 2OQGA 1B72A 5FKKA 2QKMB 4QPOA 4YFXF 3WG9A 4OIPF 1SMTA 2OV7A 3C1DA 4PJLA 5E1ZB 1MMGA 3LA7A 3LNQA 1SFUA 2GIVA 2JK3A 4N4OB 4UVAA 1MH4A 5HODA 3V7RA 1TLHB 2M2EA 4YIRX 1G4DA 5BPDA 2UZKA 2W48A 2O6GE 1JHHA 1KU9A 2JZYA 1VQKI 1Z91A 3DP7A 1MDMB 4I7HA 3U1DA 2IBDA 2L02A 3CCYA 4Y7NJ 3KP3A 2BW3A 3JRIA 1S8NA 2E34A 2L0KA 2PEXA 3PO2J 1LVAA 2BOLA 2DBBA 3ECOA 5L3GA 4LG0B 5JFRA 2VE8A 3OY9A 1GVJA 4PUSA 1IG7A 3DLAA 2Y75A 4W97A 2ZFUA 5KCMA 2GWRA 3BCAA 3G2BA 3H1CA 3LSKA 4I2OA 2R7DA 3VEPA 1YRNB 1BN5A 2HS5A 4HRIA 4B47A 1TWAJ 2QKLB 5KVRA 1K7AA 4DOZA 5B5EC 4PCQA 3ZQHA 3BG7A 3PFIA 3PNVA 3IKTA 2LOOA 3ZCOA 1P4XA 3SEZA 5J8FA 3FXOA 4AYBA 1OCRH 1FSEA 4BDYA 2WAQN 1QO0D 1BI3A 3KYDB 4HSRA 5JVTA 3VYRB 1SFOJ 5LGTA 2V6EA 1VQ5I 3IHUA 3M8FA 4BGDA 1FEXA 3K4LA 3IH2A 5BS6A 2DFIA 3ABLH 5F1RA 1IXSB 4C2UA 4U7BA 4BEHA 3G6EI 1H8AC 4CHUA 2KP6A 4CZCA 3HGGA 5EEAA 4WWCA 2O9LA 2VPRA 3K2ZA 4KDPA 1LFBA 4FE4A 1PVEA 3SZTA 2DLLA 3ULQB 1ZG5A 2CSOA 3I59A 2GLOA 1AKHB 1IAWA 1SMYF 1H0MA 4IHTA 3VPRA 3KZIC 5EDNA 5HDGA 1U9OA 1IGNA 1Z67A 4XQFA 3DBLB 1E17A 3ZMTA 5E3MA 3ZMUA 4UB8C 2MG4A 2OD5A 2VIXA 3VOEA 3CMAI 4O5VA 5JR3A 3SJMA 1HW5A 2DN0A 2QWWA 3CDHA 3AL0C 2IVMA 2EIKH 1Z9CA 2K86A 1HOMA 2ZNZA 4IZZA 1S7AA 4ABZA 4ZYHA 1APLC 4A69C 4D9JA 3HOXJ 1IO2A 2GIZA 3KPHA 3H9JA 2FUG2 3RPUA 2XAGA 4NB5A 4JOMA 2NNYA 3GXOA 1FOKA 1EKEA 4R1HA 2ECCA 3HJEA 2QQBA 3C3WA 3FKIJ 2QQAA 4RB1A 2XIGA 1WI3A 3SHFA 2CMPA 3IWZA 3CDIA 5F0HA 1YHQI 1VQOI 4KFCA 3HB9A 1V55H 3L1PA 2W84A 5FRNA 2LP0A 1YLFA 2IS6A 2UV1A 1YITI 3ERMA 5AIPA 1WJFA 5K7HA 1MDMA 3CUQC 2EV0A 3HGYA 1WJ5A 3SDGA 3CC2I 1WJAA 3JRCA 2B9SA 1MNDA 4ITVA 1W1WE 1OYIA 4I76A 1D5VA 3KEOA 1BR2A 1Y0NA 3IKVA 2EPFA 4BQOA 4D0PA 3KIOA 2OC6A 5J1RA 5EEHA 3OWTA 1PUFB 1HSTA 3M8JA 2IP2A 5E17F 4XRMA 2PJRA 3DCFA 4LIUA 2ELHA 1UMQA 1FOWA 3CMYA 1MJBA 3KLNA 5HS7A 4M6XA 4V2GA 5BPIA 2XF5A 2GAUA 1MBFA 4XLNF 1KA8A 2VBYA 2TCTA 3LA2A 4DYCA 1XGMA 2CGPA 2IGOA 1UG0A 1P92A 2E1OA 2DQRA 3IH3A 2W24A 2DJNA 3ABKH 3S1NJ 2HDWA 1D0YA 4B8XA 1R1VA 1NTCA 3DPTA 2W25A 5C4JJ 2JSCA 3I71A 5HS8A 2QEXI 4IOCF 3CC7I 4KUMA 4B1RA 2Y2ZA 2FOWA 1X3ZB 2NRAC 2LVSA 3ZQGA 3QU3A 2EFQA 1FWZA 4WXCA 1RR7A 2DMUA 1X1PA 3E5QA 4CCJA 3SZPA 4X6AJ 1V5EA 2JA8J 2LD5A 1N77A 1DU6A 2R3SA 3OYCA 4CCKA 3T8TA 1KYZA 1J75A 3FK7A 4WCGA 4M72A 1BC7C 2P5VA 2CWEA 4RDUA 1S29A 2E1MC 4I6ZA 1FSHA 3KEQA 3R6SA 1DU0A 2VN2A 4P5OA 2FRHA 2WB1N 1AKHA 4KIFA 3DBRB 4ZDLA 4D5FA 5KK1A 4PFOA 1YG2A 2FNPA 1LB2A 4AYBN 1R22A 2L7KA 5FO5A 4PJMA 3ZQQA 3OYFA 1JT0A 3QODA 5E3NA 2HGCA 4RBOA 2ZBKA 1E3HA 2DA5A 2BY0A 1K79A 4Z2YA 1XMAA 4IVNA 1EA3A 1IXRC 1NG7A 1RNLA 2CQQA 1HDPA 3A2KA 2ZCWA 1VQ7I 2ZB9A 2K27A 2LK2A 2Y31A 2V1XA 4B3XA 3F8CA 4UNOA 4XRSG 3W2WA 4ZZLA 5FKOA 2VJ5A 5D6FA 1U2WA 3TEDA 3GTKJ 5ICEA 3HSRA 5DD4A 1WH7A 3BG3A 3LQQA 3QU6A 2HQNA 4HPQA 3IWFA 4PSXA 5F0FA 1P9QC 3G4SI 3ABTA 4NQWB 4CICA 1TQMA 2JA5J 2G7UA 1V5GA 4NBQA 1X2MA 1H89C 3SFIA 3NARA 1PJRA 2KT0A 1LEBA 3CDLA 2O7OA 2M4KA 2P4WA 3EUAA 1ZN2A 3R60A 4II3A 2H8RA 1WCMJ 2KQRA 2QGUA 2JVGA 5D5WB 4KNYA 3ZQIA 1J59A 2KRCA 4HG2A 3QWLA 4P96A 1U78A 2LF8A 3QYFA 2IT0A 4Q5SF 3HRMA 4ZDPA 2R7RA 3A03A 4UV9A 4I0BA 4XMYA 4A12A 5FROA 4HAMA 2GXBA 4HX4A 4AIDA 5ILSA 3FIWA 4MEXF 2KRFA 4A3FJ 3VYTB 2O0YA 2DOAA 4UB6C 4EVIA 1QBJA 2XKPA 3BZ6A 4AIJA 1BW6A 3TO9A 2DFEA 3DQVC 3QYBA 4YIIA 2CW0F 3A01B 1S7EA 3DKXA 2XAUA 3F8MA 2RNJA 1MKMA 2GOXB 2DODA 3I4PA 4KMFA 2QZ8A 1UELB 2EV6A 2WWYA 4XONA 2M34A 2V7FA 5CVRA 2JA6J 1T38A 1L0OC 4LMYA 1JUSA 1IZ1A 4M3EA 1XSXA 3UR3C 2H27A 3CD6I 2ZJ2A 4P9FA 1ZRFA 3CUOA 3WGGA 1ON2A 1D0XA 3LMMA 2K7LA 1FPQA 2CV1A 3VSKA 3R4KA 3K4BA 3MZYA 1G3SA 3MQ0A 4PJ0C 3PIOF 4IX7A 1R00A 2KZGA 3F6OA 3U2RA 1X58A 1UZCA 5HDKA 3FHZA 3VWBA 1H9TA 1P2FA 4CZZA 4RB0A 1ETKA 1A31A 4B43A 3HRSA 3OS2A 2IXSA 2DT7B 2MABA 3FXUA 5F04A 3CUQA 5IY5H 1T33A 3HUGA 2DTRA 2BVMA 2RC4A 2NVQJ 1UJ8A 1XTAA 2VXDA 5DCMA 2CQNA 4JX4A 3E5UA 1A04A 4GFBA 3JRGA 3KX2A 4S05A 3R0AA 1RIOH 1GHCA 5ICFA 3LQRA 3FXJA 1SFXA 3JCUC 2OF7A 1I1GA 1E2XA 3ECHA 1YO5C 4UVBA 2WAEA 1SAUA 3DEWA 4FT8A 2K4JA 5DEQA 3L09A 4RAYA 3P5JA 2D1HA 1WQ2A 4WXHA 4WF2A 2X0LA 2K9QA 2ID3A 2HVRA 3DTEA 3D5LA 1R1TA 4FX0A 3QOPA 1QVUA 2A69F 2NAZA 1GLNA 2G7HA 4BHPA 3TP0A 5K7FA 2JUGA 3HDDA 2G0EA 5GAEJ 5GP9A 4DZJA 2A6EF 4NUBA 5L3EA 5FLVA 2CJJA 2NVXJ 2VONA 3HHGA 4BL0B 2X1EA 4I98B 1EF4A 4L5IA 2AQFA 3TBIA 1KU7A 4JBAA 3GUDA 1E0EA 2XVCA 1SVMA 3LSIA 2HTSA 3M1CA 1WSUA 2R5ZB 1ZYRF 3IAM2 1IN7A 4OU0A 2FF4A 4XLCA 1USTA 2R5YB 5E20A 5DTDA 5TGTA 2E36A 4B4CA 1HSJA 3WHBA 2Q1ZB 4OAZA 4QLCU 1X4OA 4FX4A 2JUCA 2K5CA 2X4HA 2IGKA 3LSPA 1OLTA 2FA5A 3TL4X 1WRJA 4U88A 2CW8A 1VFCA 4V2FA 4A2UA 1FNNA 1SD6A 2R7FA 3SDBA 2OAZA 5KHDA 2HPIA 2KPMA 4O6JA 3WE3A 3LSRA 4BQAA 1V5FA 1VQPI 1UHMA 3KP4A 1O7FA 5JVGF 1WJBA 4PGHA 4R79A 2IA1A 2EB7A 3GFJA 1D3YA 2ZJQF 3H3UA 4LB5A 2JVHA 4KISA 3GTOJ 1W36D 4EGZA 4C30A 2EWNA 2PMUA 1FBQA 4E7ZA 1Y8QB 2R7SA 3FBIB 5FKNA 2QSFX 4E7SA 1Y1WJ 2D5VA 3SEQA 4PK4A 1GDTA 4RAGA 4PJJA 3A01A 3RPQA 1HKSA 1R23A 1OISA 2FD5A 2D2WA 1PUEE 2VKHA 4ZTJA 4L5JA 3LA3A 4L9NA 2HOAA 1MBHA 4UUVA 4QWQA 3LFKA 1Z21A 4CGZA 2NS7A 1R5GA 2CH0A 3W6JB 5H2FC 1TT5B 2MC4A 2RAEA 5DD8A 1K4SA 3H0DA 4ZC3A 3I5UA 3IC7A 2MFZA 3O2PE 4LG3A 5C44J 2GA1A 1L3LA 3HL2A 4G6DA 5CLSA 4I01A 1A36A 3ZPLA 1Z3XA 2Z3YA 3NRVA 2E5ZA 4MQ9F 1ZKGA 3K1MA 3JRDA 1K78B 1FC3A 4P9UA 3W6VA 2X48A 3E0JB 3NQOA 1ETYA 1XG1A 2LY1A 3LAPA 3BWGA 4ZYGA 1HCRA 3DFGA 1JUMA 4F7ZA 1YJWI 1I6HJ 2LKSA 3TOBA 4BDZA 1D1BA 2AQEA 4A0YA 3M9AA 1IRZA 2VKDA 3S1RJ 2DK5A 1RPWA 3DBHB 4LLNA 1KONA 3CCJI 5E8IA 4FHTA 2BGCA 5LGUA 1BL0A 3QRFF 2KRHA 4NNJA 2L7FP 2CUZA 2FOKA 1T39A 2P0WA 4HLYA 1I3AA 4HDUA 4GXOA 4XM3A 3C18A 1RUNA 3G1OA 2RNGA 1JE8A 3E6DA 3WHCA 1TC3C 4E6KG 1MMAA 5EZHA 2DJIA 4IEJA 3KP7A 2STWA 5J1UA 3TO7A 4RM3A 3CMEI 1F1ZA 4M9SA 2DOFA 5EJCA 1XSDA 2UWMA 2R7UA 3O3KA 4XRSA 5FD5A 3I55I 5FB2A 1F43A 2BXYA 4LIVA 1MMNA 1R58A 1SC7A 2X9DA 2WADA 2LF7A 4CCOA 4IPAA 1J0RA 4Y13A 3B6AA 5IP6A 2OJED 2VC1A 4BACA 1UFMA 3CCEI 2LBFB 5GAHJ 2R5ZA 2D45A 1G59A 3JSPA 3RSNA 2EH3A 1F4KA 4A3LJ 1J9IA 4UUSA 5C4XJ 2DT5A 3SYTA 2G9WA 4CA0A 3IV5A 2P8TA 3BLYA 1IW7F 3HPHA 4S0HB 2NS0A 3PSIA 1O7LA 2W82A 2XPWA 3DLLF 5IT9K 2MA3A 1TNTA 1XGOA 2L2OA 4DQ2A 1U8RA 5LRRA 2ACJA 1J7KA 5FFXA 1TNSA 4N9IA 5LLQA 3GZ6A 2B63J 1RZ4A 1KQ0A 1XMKA 1MMSA 2O03A 3ASNH 2LNBA 3NWSA 5GPCA 5H6QA 3BR5A 3ZRGA 5CVJA 2E1NA 2YPRA 2IS2A 3ZXSA 3L2VA 2HOSA 1D0ZA 3TW6A 5HVQC 3PO3J 4AWXB 1U3EM 1W5CC 1ZR4A 2XASA 5CJ9A 3CJQB 2KIQA 3GWZA 3QP5A 2KHMA 3GZ5A 1LFPA 2XHKA 5E3LA 4E7LA 3TW7A 2VB6A 2Q0OA 2L4MA 4U0WA 3ZMDA 4AVPA 1NHAA 4EJUA 2BYVE 4L0ZB 1ZGJA 2Z33A 1U0JA 5CKTA 1ZREA 1LDKB 2GXGA 3M8EA 2P7VB 3H36A 4C3JJ 2RN7A 2RQPA 1PP7U 4EGYA 2CRGA 1ETVA 3D0SA 2Y9ZA 3IUOA 2VASA 3BQYA 2Y69H 3DF8A 2HI3A 4EJOA 1ZK8A 2ZO4A 2QSGX 1X3UA 1U9NA 2M9HA 2LH9A 4A5MA 1YS6A 1HC8A 3CO6C 4XN0A 5HNFA 2E7XA 3WTYC 4JX5A 4YRVA 4DYRA 5M5YJ 3F8FA 2IEKA 3ELKA 2VODA 2IGMA 4WX9A 3EQLF 3K70D 3ONQA 4LFUA 2HVQA 5F6FA 3H92A 4AUXA 1WGXA 2KJCA 3I0TA 1PDNC 3K7AJ 4KT6A 2ZXJA 1IN5A 4RLFA 4BY1J 1HW1A 3M3YJ 1JKRC 2DCEA 1Y56A 5IT9Z 2L9SA 4HNUA 4ZTFA 1FTZA 3S2HJ 2IA2A 4XL9A 3GFMA 3R61A 1TWHJ 1STZA 2QSHX 3G1LA 3BTLA 4EJWA 1N25A 5IYBJ 4FE7A 3WU0A 3ZQ7A 4JX6A 5KAIC 1I5ZA 1SVLA 1TWFJ 3C2BA 5J6XA 4MQVA 4J01A 2VJ4A 2A5YB 3CCLI 2XC7A 3JREA 4RAFA 1Z7LA 4JYKA 2DU9A 3I9V2 1QHGA 3CLOA 4HSTA 2CS3A 5IOZA 3J7YJ 3OYDA 1W7PB 1PP8F 2XSDC 3BR3A 2LBFA 3GLLA 4IRGA 5CVVA 1S5LC 4IOAF 1DGRM 5ICGA 2D1VA 1R49A 5LBQA 4BBSJ 5L3BA 1QHHD 4XOTA 5ICCA 1IXCA 2BZTA 3NWTA 2V6CA 5EF6A 3JRFA 3IH4A 3C2HA 3LSMA 3MZ8A 4YG2F 3EDPA 1TT0A 4RA2A 2QA4I 4CO8A 3HYIA 3GMEA 5CVUA 5DDGA 2DDAA 2F5CA 4A3EJ 2RVCA 4IQ4A 5FGMA 4ENKA 4FTHA 1KU3A 2QYOA 4HF0A 3BOQA 4M71A 4EV0A 4BXFA 2STTA 2E71A 2XAFA 1OCCH 2EJRA 4L9VA 4DGWB 1X1BA 5BMZA 1IJWC 4PZJA 1BI1A 3A0BC 5FD6A 4HQMA 2QQ8A 1X2NA 1JJ8C 2NVYJ 1E3OC 1Z6RA 1TW3A 2XAJA 4C3IJ 1V54H 3P9CA 3HTSB 4MEYF 4G7HF 1ONVA 2FJ1A 4BAYA 2DA1A 2A6HF 5DYMA 5HLIA 2CO5A 3V8JA 1OR7A 1XX5A 5FKLA 2HWVA 2ZSHB 5IP7J 2EINH 1SFEA 1R5ID 4HEA2 1FP2A 4M9ZA 1G3TA 5JLXA 4PFPA 4E4HA 3DKYA 2M7BA 3OIQA 3QAHA 1ETQA 5JI6A 3JRHA 4NC8A 2IAIA 4HOBA 2DPDA 4B3AA 2MD5A 2P81A 1QZZA 2K3FA 2ESHA 2JRMA 1WFXA 2XF7A 3OOPA 4M6YA 5EZGA 4LG0A 4ZDOA 2FU4A 2V1NA 5EEGA 2W7NA 2LY9A 2JTVA 2Z99A 1YIJI 1XGNA 1T0FC 4H4KC 1WVRA 4B44A 2FMLA 4BQQA 2H8WA 3JAMK 2K9MA 4ZZDA 4WXDA 3DTKA 1YRNA 4N9HA 4IRIA 1W7PD 4HX7A 5DCFA 3MMYB 2JPBA 4FASD 3Q5FA 1JGGA 2PMHA 3HIFA 4OOIA 4BQNA 2DFHA 1K6OA 1X19A 2ZXHA 3T1BA 1D8JA 1B1BA 2X6YA 1RESA 1DUXC 1V4RA 3QPTA 1BI0A 2XPVA 3TQNA 3LSJA 5L3DA 1QVTA 2PI0A 3PQJA 2IJLA 3BR0A 3CP8A 3FM3A 4KT5C 5HLGA 4XLPF 3RQ4A 2DYRH 1RRJA 2V79A 1FYLA 2LR8A 2MSYA 3FBNB 2P6TA 1I39A 2DPUA 3MVPA 2RREA 2PJPA 3CQZJ 2KMUA 3RYRA 3F22A 2F5FA 2GXAA 1LE8B 1ERDA 4NHJA 4QPQA 2A3SA 4IRHA 1VTNC 4ESBA 2OBPA 3E97A 5KAFC 3Q0WA 2BY2A 1IDZA 2NXNB 2XKOA 1GUUA 3M7GA 2CQKA 2Y0MA 4A0XA 3KETA 3S14J 1W7PA 2UUZA 2VKEA 3RI4A 1P7IA 1KQ8A 1HDDC 4UV8A 4ENNA 4OIQF 4OMZA 2FMYA 4F52A 4UUTA 1ZGAA 1AA7A 2HXIA 3VDXA 1I27A 4NC7A 1VQ9I 2H09A 2M8EA 2OU2A 4U7DA 3O8GA 3OYLA 3OYHA 4HNTA 2P7CB 1UHWA 1G8XA 1QZEA 3TDZC 3GTPJ 3PUBA 3HRTA 2CG4A 4HA8A 4OINF 5EG0B 1NH3A 3AKZA 1MH3A 2VQCA 1JXSA 2CUFA 2COBA 4JK1X 4IHWA 3JAMZ 4IKFA 4E7KA 2BEOA 1ODDA 2W4SA 2DMPA 2HOTA 1OCOH 3CCUI 3BJ6A 3K4KA 1WJEA 2J5PA 5FRMA 2HVSA 5AONA 3K4CA 1BOBA 3L2CA 1ZLKA 4LK0F 5K1YA 3JR9A 1I50J 2F6CA 2IS4A 3KZZA 2E5NA 1TQPA 3RKWA 2JJ7A 3N05A 4ASNA 1SEUA 2A05A 1YI2I 5HOOA 2E7WA 1OYYA 2IA0A 5B1BH 3KYLA 2O61A 4E7JA 3BTIA 1JTXA 2WV0A 1LJ9A 3S15J 4S04A 2IS1A 3WGHA 2F2EA 4DZPA 2HPMA 1G3YA 1IN6A 3HOVJ 3HG9A 1Q1HA 2DO7A 1YQAA 2VJJA 5CYVA 2DYSH 2R0QC 1MJAA 2ETHA 1OQYA 2QCOA 3TO6A 1PUFA 2EBIA 4BE1A 2K3PA 1X1AA 3PIPF 5E1WA 3WTTC 4DBQA 1HF0A 2X6OA 3ROUA 5ED4A 1UAAA 2M0MA 1XMXA 1BIBA 1KZHA 1S3JA 2JMWA 5J8CA 1REPC 2DDBA 4L9TA 4A3BJ 2M1BA 3N97A 2OTJI 4OMYA 3WTXC 2P6SA 2HYGD 2XRNA 2EA4A 4ZYAA 5JHFA 4LB6B 2TDXA 2XGEA 4M3BA 2QF7A 4XK4A 2XGXA 2LC2A 2GZWA 2NVUB 2CU7A 2HQAA 3GTJJ 5ILUA 5IPAA 5D4SA 1LUJB 2P5KA 3PNTA 3AG4H 2VBWA 3GVAA 2MYSA 9ANTA 1FYMA 3MD2A 3WTZA 4Q4ZF 3V7CA 3OYBA 2Z16A 2M87A 2MH9A 3D5RC 4UHTA 1IV8A 2M5WA 3CP2A 2VPLA 3X2QH 3CCQI 1LQ1A 1LE8A 2FEZA 4M3FA 3ABMH 4BNCA 1A5JA 2WAFA 4XRFA 3GYHX 5GADJ 2IGNA 3COAC 4R8HA 2CW7A 4RLQA 3BPXA 1OJLA 3AG3H 1BM9A 5LHIA 1O3QA 3PL8A 3RKXA 2EZIA 3AFHA 4LD5A 3OYKA 1X4PA 2R7VA 1FP1D 4RB2C 1MSEC 3OMYA 4K2EA 4JQFA 1BIAA 2XGCA 1W5SA 3TMOA 1QPIA 3MKWB 1QA6A 1USSA 5FFZA 1YOVB 1K4TA 1R4NB 3OL3A 1T0FA 4M3DA 5A2QK 2JA7J 3HM5A 5F64A 2NYXA 4UXNA 2B7EA 3KZYA 2V9VA 1Z1DA 1A6QA 4YELA 3RCOA 5EG0A 1U5TB 4BHCA 3CCSI 3CCVI 2ELJA 3H3ZA 4J19A 4KJZA 3T0YA 1ZG1A 2DMNA 3TKYA 4P55A 5FJ8J 1TQIA 2CUEA 3CLQA 3ZP5A 3BCBA 2MW8A 4F3QA 2VLAA 3N4MA 4WK8F 1XSVA 2EZLA 3RQIA 3OS1A 4CYCB 3OIPA 4NQWA 2RV8A 3MKYB 1MIJA 2GOMA 3OR1C 5D5VB 2FNAA 2BY3A 5GTIC 4IHYA 1I3QJ 5ILVA 1FMVA 2JRTA 3ZOBA 4F92B 5K5RA 2O8KA 1G6NA 2M45A 3JRBA 3FZVA 1E3PA 3DKWA 4HDVA 4M9XA 3HTUA 2VKVA 2HQRA 2M7AA 2YUSA 2F4MB 2PMZA 3RKYA 1SD4A 4F93B 1IDYA 4X0GA 2CYYA 1B9MA 4PDKA 4UVCA 2AHQA 3E5XA 2YSRA 2DK8A 4LJZF 1U6GA 5D6EA 1FT9A 2JSPA 3FDYA 1AOYA 5M3MJ 2CUJA 4OIOF 2WY8Q 1B8IB 1Y8RB 2XSJC 2R7ZJ 1ENHA 1LPQA 2DA2A 1SANA 1LNWA 1OKRA 4IL6C 3QP6A 3S8PA 1B4AA 1DPRA 2MH2A 1BC8C 1SD7A 1R4MB 2E19A 3KP6A 4A3JJ 3KP5A 3JTGA 3ZQLA 1IN8A 3S3MA 2NVTJ 3GBGA 3WU2C 1J2XA 2R7XA 3VYSB 3ZMVA 4QIWN 1QNTA 4CCLA 4HV5A 3L00A 3L2QA 2YR2A 3GTLJ 1P4WA 2CQ7A 2HFHA 1MBGA 3I54A 2R7QA 3FMSA 5A2QZ 3OYEA 3LSTA 3HSFA 3BG9A 2KZVA 1R6RA 2H6BA 1YX5A 1ZTRA 3QYEA 2JN6A 2A6TA 4C9YA 4LGWA 1MGTA 2X85A 1B72B 2WA0A 4I02A 2HNHA 3K70C 2KLOA 3FXQA 2FSWA 3HEFA 5IYDJ 2K02A 2W1OA 3F72A 3ML6A 4G8XA 1OCTC 1O57A 2JWTA 1D1CA 4B09A 4A3DJ 3HPGA 4LLLA 1R5HA 2RDPA 1TWGJ 1IRXA 2ZMEB 3UKGA 3WTWC 3A1YA 2X6XA 5GPAA 1Z6TA 1HXDA 2COMA 2KIFA 4BJ5C 4H0EA 3ZQCA 2IRFG 3MAJA 2CQXA 3LL7A 2LTPA 1JJ6C 2Z9OA 1WJDA 3I3LA 5BNGA 2DT6A 5HDNA 2V1DA 1G3WA 3BP8A 2P5LC 1O3SA 4Y15A 4KYWA 3HRUA 4GCVA 3K4MA 3ZGKA 2ZJRF 1LKXA 1KYWA 3P7NA 1SFKA 2BW3B 4G7OF 1Y0UA 4G6TB 2MLKA 2GM4A 3LSHA 2LSOA 1N78A 4ENMA 2ADUA 5FLMJ 4BXUA 4XN3A 4HNVA 4ENJA 2EZHA 3J81K 1KGSA 1OR7C 3ZMZA 4XBFA 5BOXA 2V4JC 3OYJA 5E1XA 4D5CA 1HW2A 4RGUA 5M3FJ 1XDSA 2LYCA 1UHSA 3CJRB 3I56I 1FX7A 5M5WJ 3GO5A 4FQGA 2PQ8A 4BUPA 2Y0SA 4GGGA 2HZDA 4RM2A 4X1EA 5HNHA 2E1CA 3S1QJ 4Q48A 4KN7X 3LAJA 1YE9A 4PSWA 4EM0B 2VBXA 1YYVA 2GA2A 1V3FA 3FXMA 4RAZA 4CYCA 1R36A 4XNFA 3E6MA 2AS5F 5F27A 3GCMA 1FBUA 1QRYA 2R5YA 2R93J 3E6BA 2VE9A 4ON0A 1ETOA 2DA4A 3J7AO 4PGGA 1GV2A 4FISA 2HOEA 4YIFA 3MCZA 5TJJA 5E3OA 3DPUA 3DV8A 1HA8A 3BG6A 1EH7A 1VQ6I 1JGSA 2MD0A 4XORA 2KL4A 2M8GX 3JW4A 3M07A 3I4MJ 1Q1VA 1R71A 4A3GJ 4Y33A 5D8KB 4HYEA 1YJNI 1B8IA 5IP9J 2ID6A 3IAS2 3F21A 1I1SA 2K85A 4CSWA 3FKJA 2PX9A 1R9TJ 2ZXWH 4BJTA 3TOAA 2E60A 1W0UA 3NEUA 4RMNA 1CGPA 1YW7A 1VQ4I 1ZQ3P 4KMUX 5D5UB 5E18F 3IRQA 2K9LA 4C3HJ 1P4AA 2NS8A 1YJ9I 4RGXA 3CF2A 4MFDA 3FK6A 2WBMA 3EUKL 4KITB 5K5OA 2OCCH 2KISA 2A68F 2Q2EB 1VI0A 2LY2A 3L2WA 1FIAA 3J81Z 2OZ6A 4XSZF 2A5WA 1EV7A 2PMZN 2X6WA 1T98A 3HHHA 4HQEA 1ZRCA 5L3FA 2CFOA 2VC0A 1BBYA 4IQJA 2HR3A 1HLVA 2H1KA 2VJIA 3H0GJ 2EFPA 5IYCJ 2FX0A 5B66C 3U21A 2C6YA 1F5TA 2M30A 3PSFA 3QPSA 1BW5A 2ZMEA 1FTTA 4EEFG 4ANJA 2V26A 1K78A 2MGQA 5LHGA 1JHFA 1BR1A 5J4VA 1XD7A 1TBXA 1MNMC 2EILH 1I6XA 1WWXA 1IRGA 1DPUA 1WI9A 1RETA 3J7ZI 3OOUA 3DWLE 5DM7F 3BT9A 3K9TA 2QLZA 3EETA 4M73A 1VQMI 1D5YA 1RI7A 5GAGJ 2L5QA 2HKXA 4G12A 3G71I 2Y30A 3I53A 2PJRB 3K1PA 3EYIA 4NDLA 4N0BA 3O8HA 4AC0A 4MHGA 1BR4A 1VF9A 1XGSA 2VL8A 4EMSA 1J5YA 3OYAA 4YEJA 1MSFC 1BJAA 2L9VA 1WPKA 1VQ8I 1M1EB 3S2DJ 2O3FA 4RGRA 3CC4I 3B73A 1Y6IA 2WB1A 3BROA 1EJ9A 4DIQA 2ISZA 1OFCX 1XC5A 2W57A 3L7WA 1HQCA 2EK5A 3BR1A 3MWMA 4KIGA 2NOJB 4CCNA 2ZJPF 3FHNA 3B6CA 3H5RA 4A6DA 3TDUC 1EH6A 3MKLA 1POGA 1XPXA 2F5VA 2HYJA 4P1WA 4A0ZA 3E1SA 1IUYA 3DU6A 3GLXA 3RZOJ 1RKTA 3RPUD 1TL8A 4MTEA 2A61A 3WGIA 5HLTA 1YFHA 4XKBA 3I58A 1AWCA 3LOCA 1ZG3A 3BTCA 1GT0C 1FZPB 4EJTA 3H9QA 4MGRA 2HU9A 3K2AA 2NOGA 3LSGA 3K1NA 1K83J 4OWRB 1U8BA 2WV1A 4Y17A 2E2IJ 4KIBA 3REOA 3A02A 1RR8C 2WY7Q 2Z2SB 1Y39A 5LEKA 3ZMSA 2Y0SN 4BKXA 2R7OA 3CO7C 3M1EA 4RB3C 2EFWA 1ZHFA 2JT1A 2OQRA 1A6IA 2EA2A 1MW7A 1MZBA 3WU1B 3HKZA 5HLHA 2Q8KA 4AU7A 3H35A 1TTYA 4W1UA 2F48A 2NNNA 3CMMA 3MN2A 4XOPA 3NAUA 5LGNA 1MBKA 1T6SA 4LK1F 1FYKA 2EFOA 2KDOA 4KICA 2W00A 4GRIA 2GQQA 3ISPA 3Q9VA 2BVLA 3KEYA 4E70A 3PFYA 4G7ZF 4XICA 2ME0A 2HKOA 4HV6A 4HX8A 5H20A 1Z05A 3HOSA 2Q2EA 1LEAA 4IJAA 3QQAA 2ELKA 4CDGA 2H94A 3ZR8X 2K9NA 4L18B 3JTHA 3EYYA 2VQHA 3SZGA 1FBSA 3F3XA 2XB0X 3Q0VA 3S2WA 4MNUA 1Z3YA 2LREA 2FQ3A 3G3ZA 4E7IA 1KU2A 3A0HC 2AXLA 4IHSA 3BPVA 1VQNI 2QUFA 3RKQA 5C3EJ 4L0YB 1HBXG 1CQTA 1FJLA 4DBRA 3F23A 2FXAA 4CXFA 4FCYA 4L9JA 2Y48A 3BQZA 2VQGA 1JKOC 3W2VA 1PYVA 4BY7J 2L01A 2QBYB 2Y9YA 5LRSA 3HXLA 5ERIA 4I0AA 5JLWA 1T8IA 4RGSA 4YFNF 1B59A 3T5XA 5J40A 4BHBA 4LLGF 5HS9A 2V1UA 3ERED 3HZJA 3S1MJ 2ME6A 3FX3A 4XKVA 3GF2A 3D1NI 1JUPA 3GTMJ 4XLHA 2QM3A 1LVKA 1OPCA 1W0TA 1Z0XA 1NG6A 2DOEA 2ISYA 3AL0B 4B48A 1H88C 4BU2A 1P7JA 5F0CA 3BY6A 3K4NA 2XRLA 4EQQA 1QGPA 4N4NB 5DM6F 1D1AA 4KN4X 2JPCA 3VODA 3OIOA 1ORKA 2DI3A 1SAXA 3K6GA 1AU7A 2L3DA 6PAXA 3FF5A 3L9FA 3L2UA 1YW9A 1KQ9A 2L4AA 4A5NA 2L7MP 4ZYDA 3RZDJ 1FLIA 1MBJA 2VXZA 4EJVA 1TP4A 2BXZA 1YIOA 2EIJH 3CCMI 1RUOA 3CJNA 4Z6YA 3FXLA 3FISA 2XUBA 3UNGC 4HBLA 5TISC 1WZ2A 3KE2A 1UG2A 3HOYJ 2FE3A 1T08B 3WE2A 2KDZA 2PBIA 3V4GA 3FWEA 5BQTA 2EFNA 2L9NA 2BBYA 3E3VA 1F36A 3R0JA 4I99C 5DUIA 2XF6A 1HKTA 1HKQA 2FQ4A 3CUQB 3GW2A 3HUGB 3CTAA 1R1UA 2HYFA 1UCRA 2CV2A 2HZTA 1OYWA 1O4XA 5DCMB 4E7HA 2IPQX 2YX4A 3BR2A 3BTJA 1XS9A 3FMQA 5F08A 1FOXA 5FKMA 1ZH5A 4LITA 1WHUA 4IHXA 4U87A 3DEUA 1YTYA 4CYDA 1RC9A 3DEEA 4JP0A 2M0CA 3CF5F 3ZN0A 3ZN1A 4GDFA 1BA5A 4V19K 1R7JA 3DTIA 1ZR2A 2DMQA 1OCZH 3P9IA 3OYIA 4XKCA 1ITYA 2XDVA 1QZYA 5IOYA 2HEOA 1J09A 1Y1VJ 2EV5A 4M74A 4NC6A 2VBZA 2XV4S 1S9HA 1NK2P 3WTVC 4Y3OA 2DFFA 3OV8A 5JHUA 2VI6A 4ESJA 1A35A 3S17J 5DS9A 1W36C 1ETXA 2E35A 1DQUA 3BZKA 2V9KA 2RKHA 4BJ6C 1YS7A 4O3MA 4XLFA 1T56A 3CJTB 1ULYA 3PUFA 5K7ZA 2OUMA 2VT3A 1Z7UA 2EIMH 3IP4B 3F8BA 2VOPA 2DW4A 2OTLI 4XLAA 2DA3A 2RGVA 2OPTA 4MLOA 1SD5A 2FBHA 1VNDA 1G2HA 4OIRF 3HKZN 3VB2A 3WTUC 3MKZA 4DJAA 2LDUA 4QSHA 4Y4RA 1ON1A 1O3TA 4YFKF 2HDCA 3EUHC 4EATA 1QU3A 4XIDA 3FXRA 2KJBA 3F9KA 1U5TC 2XAHA 3U1KA 4D7MA 5CQEA 1XN7A 2QBYA 2HDDA 4G6QA 1DDNA 1O3RA 2HTJA 2N8GA 5GTHC 5TRDA 2FBIA 2E1MB 2O8XA 2QVOA 3D5SC 3HOWJ 2F4OB 3ABUA 1GXPA 1LFUP 2BV6A 3BJAA 1AHDP 2EQRA 2ECBA 3WTSC 3HOTA 4BH9A 1DP7P 1X1DA 1K6YA 2PG4A 3M4OJ 2XPUA 2LFBA 3BJOA 3OR2C 5IT3A 3E6CC 1JTYA 1Z77A 1FIPA 1X1CA 2L7ZA 4HF1A 2DMTA 3BDDA 5H6RA 4BXXJ 2OZUA 3KP2A 3OYMA 2R7TA 3BG5A 3F8NA 4IXAA 4A3MJ 1S72I 1XDUA 3KYCB 1QQIA 1XB4A 3BR6A 3KFWX 2A07F 2PLYA 2VUMJ 2F4IA 5E8GA 3RTRA 2IW5A 3SQNA 3AG2H 4DW6A 3FMRA 4ZH4F 3J7AY 3S3OA 5K5QA 2R7WA 3HBLA 4LOCA 4HZFA 2F5DA 1WH5A 1JI8A 2BHZA 2L54A 2WTEA 2PFBA 2ZSIB 3EPZA 3VYUB 3HOZJ 5LHHA 3HC7A 2B0LA 5LFAA 3RYPA 2F5EA 5L3CA 3SXYA 2CV0A 2QENA 5KNLA 1MBEA 1YX3A 4AD9A 4MFEA 2BY1A 2LRDA 5F1JA 3O6BB 5D4RA 2LKXA 3Q0UA 3PM1A 1P6RA 3MFKA 4IF4A 2VT2A 1K61A 3P9KA 3GTGJ 1XCBA 2I10A 2ZFWA 3F6VA 4GO1A 1LDJA 2HQ5A 5CPRB 2YU9J 5DUKA 3LFUA 2TRTA 2KFDA 2AXTC 2DA7A 4II2A 4A6EA 1ACIA 4EM1A 1ZLJA 4XLEA 1WJCA 2MC3A 4BS9A 3PNYA 2DXIA 3TP3A 3V8LA 2R92J 1T2KA 2FBKA 2ZMEC 3CESA 3QPHA 5LEJA 1ETWA 2WC2A 3ZQFA 4BE0A 3G73A 3CCRI 1CF7B 4HLXA
chains in the Genus database with same CATH topology
4M3GA 1GV2A 4FISA 4FTHA 2ZB9A 3QPLA 2LK2A 2Y31A 5E3OA 4XRSG 5FKOA 2M8GX 3OSGA 3TEDA 3GTKJ 5EGOB 1TWCJ 2DA6A 1Q1VA 3I4MJ 1IJWC 4A3GJ 1WH7A 1X2NA 3BG3A 1B8IA 1JJ8C 5IP9J 2NVYJ 5F0FA 2K40A 2ID6A 5M5XJ 1E3OC 4C3IJ 1R9TJ 5EYRA 2FJ1A 3OSFA 2JA5J 2DA1A 1W0UA 1X2MA 2AO9A 4UUSB 1H89C 5FKLA 3SFIA 1ZQ3P 5IP7J 4A93J 3NARA 2KT0A 1JKQC 4C3HJ 2NS8A 1NK3P 5JLXA 3CDLA 2O7OA 4MFDA 3FK6A 2H8RA 1WCMJ 3Q3SA 1BJZA 1VI0A 1ETQA 3ZQIA 1FIAA 1GVDA 3JRHA 2PMZN 2IAIA 1U78A 4B3AA 2P81A 3A03A 4Y52J 5EZGA 3E7LA 1HLVA 2H1KA 3H0GJ 5IYCJ 2FX0A 3FIWA 2L9RA 2LY9A 4A3FJ 2E2HJ 3QPSA 1BW5A 4A3CJ 1FTTA 4EEFG 1BW6A 3H3VK 3HOUJ 1YRNA 1IUFA 2MGQA 1IV6A 3A01B 1S7EA 2GBYA 1JGGA 1MNMC 1RETA 3OOUA 1RESA 1IC8A 3BT9A 2M34A 2HXOA 2JA6J 1GV5A 2XPVA 1D5YA 1JUSA 3LSJA 1QVTA 4M3EA 4G12A 4QTRA 2Y30A 3BR0A 2XGDA 4NDLA 3O8HA 4AC0A 1VF9A 2LR8A 2MSYA 1OCPA 1MSFC 1WPKA 3MVPA 1X58A 3CQZJ 3S2DJ 1LE8B 3JRAA 1ETKA 3Q0WA 4DYQA 1OFCX 1XC5A 5F04A 1IDZA 1T33A 3BR1A 1GUUA 4BBRJ 2NVQJ 3B6CA 3S14J 4C2MJ 3MKLA 1POGA 4JX4A 4GFBA 3JRGA 2HYJA 2VKEA 4L5EA 1P7IA 4A3IJ 1HDDC 3RZOJ 1RKTA 4D7NA 4UUTA 2OF7A 2HXIA 1JT6A 3DEWA 3LOCA 3BTCA 1GT0C 2K9SA 5J1YA 3O8GA 3K2AA 2NOGA 3LSGA 3S16J 1K83J 3GTPJ 2K9QA 2ID3A 2EZKA 1U8BA 2WV1A 5EG0B 2E2IJ 3A02A 1QVUA 1MH3A 4M6VA 3TP0A 5K7FA 2CUFA 2COBA 3HDDA 2G0EA 5GP9A 4DZJA 5J3LA 5EGOA 4IHWA 2E2JJ 1RKWA 2Y0SN 4BKXA 5FLVA 2DTZA 2CJJA 2DMPA 2NVXJ 2HOTA 1A6IA 2XB5A 3GTQJ 1JKPC 1EF4A 2LLKA 4A3KJ 4W1UA 3MN2A 3NAUA 1MBKA 2R5ZB 3JR9A 1ZGWA 3G1MA 1I50J 2R5YB 3F0CA 5DTDA 4B4CA 3WHBA 2YS9A 2JJ7A 4XICA 2ME0A 3LSPA 4MIMA 4IHVA 3BTIA 1VFCA 1JTXA 4V2FA 3I4NJ 3QQAA 2ELKA 3LSRA 3S15J 2K9NA 4DZPA 4MO7A 3HOVJ 2XB0X 3Q0VA 2R0QC 1B72A 5FKKA 2QCOA 1PUFA 2EBIA 3GTOJ 3LNQA 2JK3A 1HF0A 2X6OA 1MH4A 5FKNA 3RKQA 2JMWA 5HODA 5C3EJ 1Y1WJ 2M2EA 2D5VA 1GDTA 1CQTA 1FJLA 3A01A 4A3BJ 2FD5A 4FCYA 2W48A 3BQZA 1JKOC 4BY7J 2XGEA 2HOAA 2QF7A 2IBDA 4M3BA 2Y9YA 1MBHA 4XK4A 3CCYA 4Y7NJ 5JLWA 2NS7A 3JRIA 2CU7A 2L0KA 2RAEA 3PO2J 3S1MJ 3GTJJ 2ME6A 5IPAA 3D1NI 1JUPA 3GTMJ 1IG7A 5C44J 9ANTA 4W97A 1W0TA 1Z0XA 1ZKGA 3JRDA 1H88C 1LE8A 1YRNB 1P7JA 4M3FA 3W6VA 2X48A 1A5JA 5F0CA 1TWAJ 1ETYA 1XG1A 2XRLA 1HCRA 1OJLA 1JUMA 3ZQHA 1I6HJ 3OIOA 1ORKA 2EZIA 1AU7A 1MSEC 2WAQN 1IRZA 2L7MP 3S1RJ 2XGCA 1QPIA 1RPWA 3RZDJ 1SFOJ 1MBJA 1FEXA 3IH2A 1BL0A 3FISA 4M3DA 2JA7J 3HM5A 2L7FP 1UG2A 3HOYJ 2KDZA 5EG0A 3G1OA 1H8AC 3WHCA 1TC3C 1F36A 3HGGA 5EEAA 5EZHA 4J19A 2O9LA 2VPRA 4IEJA 2FQ4A 5J1UA 1LFBA 2DMNA 4FE4A 5FJ8J 2CUEA 4XRSA 1O4XA 1F43A 2GLOA 1AKHB 3BR2A 2MW8A 2X9DA 3BTJA 1XS9A 5F08A 3VPRA 5FKMA 2EZLA 5EDNA 3RQIA 4IHXA 1U9OA 3B6AA 4CYCB 1IGNA 4JP0A 5IP6A 5E3MA 2MG4A 2M0CA 2R5ZA 3SJMA 2DN0A 2EH3A 4A3LJ 4UUSA 5C4XJ 1HOMA 1BA5A 3IV5A 4ABZA 1APLC 1ZR2A 2DMQA 4A69C 4IHYA 1I3QJ 4S0HB 5IOYA 1ITYA 2O8KA 3ZOBA 3HOXJ 1Y1VJ 2XPWA 3JRBA 2VKVA 1NK2P 2YUSA 1IDYA 2VI6A 3S17J 5DS9A 1ETXA 2AHQA 1T56A 4BXXJ 2B63J 5M3MJ 5K7ZA 2ECCA 3FKIJ 2DA3A 1WI3A 2OPTA 1B8IB 4MLOA 5GPCA 2R7ZJ 3BR5A 1ENHA 5F0HA 1VNDA 1G2HA 2DA2A 3HKZN 2HOSA 1SANA 3HB9A 3TW6A 3PO3J 4QSHA 2E19A 1ZR4A 4A3JJ 3ZQLA 3L1PA 4XIDA 2NVTJ 3GBGA 2LP0A 4D7MA 4QIWN 5E3LA 3TW7A 5K7HA 3HGYA 2HDDA 2N8GA 3SDGA 3GTLJ 3JRCA 1MBGA 3BG9A 3HOWJ 1ZTRA 4C3JJ 4I76A 2JN6A 1LFUP 2CRGA 1AHDP 2EQRA 1ETVA 2ECBA 2Y9ZA 1B72B 5J1RA 1PUFB 3BQYA 3M4OJ 4XRMA 3HEFA 2XPUA 2HI3A 5IYDJ 3DCFA 1ZK8A 2LFBA 1UMQA 1OCTC 3CMYA 2JWTA 1U9NA 2M9HA 1JTYA 1Z77A 4A3DJ 1FIPA 2L7ZA 4JX5A 4V2GA 2DMTA 4DYRA 3UKGA 1TWGJ 5M5YJ 2IEKA 5GPAA 1MBFA 3ZQCA 3BG5A 4A3MJ 2CQXA 2LTPA 1JJ6C 2TCTA 4DYCA 5BNGA 4AUXA 2E1OA 1WGXA 3IH3A 3BR6A 2VUMJ 2DJNA 3K7AJ 4DW6A 3S1NJ 4BY1J 3M3YJ 1NTCA 1JKRC 3HBLA 5C4JJ 4LOCA 1WH5A 2GM4A 1FTZA 3HOZJ 3S2HJ 4B1RA 5FLMJ 2Y2ZA 4HNVA 2EZHA 1TWHJ 2LVSA 3ZQGA 3G1LA 3BTLA 1RR7A 2DMUA 4FE7A 5IYBJ 4D5CA 4X6AJ 2JA8J 4JX6A 2LD5A 1MBEA 1TWFJ 3C2BA 5M3FJ 1DU6A 1UHSA 5M5WJ 4MFEA 5F1JA 3FK7A 2LKXA 3Q0UA 3PM1A 4RDUA 3JREA 4I6ZA 4X1EA 1DU0A 4JYKA 3S1QJ 1K61A 2WB1N 3GTGJ 2I10A 1AKHA 2HQ5A 2YU9J 4D5FA 2TRTA 5IOZA 4AYBN 4CYCA 2DA7A 2XSDC 3BR3A 1JT0A 5F27A 5E3NA 4RBOA 4BBSJ 2DA5A 3TP3A 2R92J 1QRYA 1ETWA 3ZQFA 5EF6A 3JRFA 3IH4A 2R5YA 2R93J 1ETOA 2CQQA 2DA4A 1HDPA 4A3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3G A;  1GV2 A;  4FIS A;  4FTH A;  2ZB9 A;  3QPL A;  2LK2 A;  2Y31 A;  5E3O A;  4XRS G;  5FKO A;  2M8G X;  3OSG A;  3TED A;  3GTK J;  5EGO B;  1TWC J;  2DA6 A;  1Q1V A;  3I4M J;  1IJW C;  4A3G J;  1WH7 A;  1X2N A;  3BG3 A;  1B8I A;  1JJ8 C;  5IP9 J;  2NVY J;  5F0F A;  2K40 A;  2ID6 A;  5M5X J;  1E3O C;  4C3I J;  1R9T J;  5EYR A;  2FJ1 A;  3OSF A;  2JA5 J;  2DA1 A;  1W0U A;  1X2M A;  2AO9 A;  4UUS B;  1H89 C;  5FKL A;  3SFI A;  1ZQ3 P;  5IP7 J;  4A93 J;  3NAR A;  2KT0 A;  1JKQ C;  4C3H J;  2NS8 A;  1NK3 P;  5JLX A;  3CDL A;  2O7O A;  4MFD A;  3FK6 A;  2H8R A;  1WCM J;  3Q3S A;  1BJZ A;  1VI0 A;  1ETQ A;  3ZQI A;  1FIA A;  1GVD A;  3JRH A;  2PMZ N;  2IAI A;  1U78 A;  4B3A A;  2P81 A;  3A03 A;  4Y52 J;  5EZG A;  3E7L A;  1HLV A;  2H1K A;  3H0G J;  5IYC J;  2FX0 A;  3FIW A;  2L9R A;  2LY9 A;  4A3F J;  2E2H J;  3QPS A;  1BW5 A;  4A3C J;  1FTT A;  4EEF G;  1BW6 A;  3H3V K;  3HOU J;  1YRN A;  1IUF A;  2MGQ A;  1IV6 A;  3A01 B;  1S7E A;  2GBY A;  1JGG A;  1MNM C;  1RET A;  3OOU A;  1RES A;  1IC8 A;  3BT9 A;  2M34 A;  2HXO A;  2JA6 J;  1GV5 A;  2XPV A;  1D5Y A;  1JUS A;  3LSJ A;  1QVT A;  4M3E A;  4G12 A;  4QTR A;  2Y30 A;  3BR0 A;  2XGD A;  4NDL A;  3O8H A;  4AC0 A;  1VF9 A;  2LR8 A;  2MSY A;  1OCP A;  1MSF C;  1WPK A;  3MVP A;  1X58 A;  3CQZ J;  3S2D J;  1LE8 B;  3JRA A;  1ETK A;  3Q0W A;  4DYQ A;  1OFC X;  1XC5 A;  5F04 A;  1IDZ A;  1T33 A;  3BR1 A;  1GUU A;  4BBR J;  2NVQ J;  3B6C A;  3S14 J;  4C2M J;  3MKL A;  1POG A;  4JX4 A;  4GFB A;  3JRG A;  2HYJ A;  2VKE A;  4L5E A;  1P7I A;  4A3I J;  1HDD C;  3RZO J;  1RKT A;  4D7N A;  4UUT A;  2OF7 A;  2HXI A;  1JT6 A;  3DEW A;  3LOC A;  3BTC A;  1GT0 C;  2K9S A;  5J1Y A;  3O8G A;  3K2A A;  2NOG A;  3LSG A;  3S16 J;  1K83 J;  3GTP J;  2K9Q A;  2ID3 A;  2EZK A;  1U8B A;  2WV1 A;  5EG0 B;  2E2I J;  3A02 A;  1QVU A;  1MH3 A;  4M6V A;  3TP0 A;  5K7F A;  2CUF A;  2COB A;  3HDD A;  2G0E A;  5GP9 A;  4DZJ A;  5J3L A;  5EGO A;  4IHW A;  2E2J J;  1RKW A;  2Y0S N;  4BKX A;  5FLV A;  2DTZ A;  2CJJ A;  2DMP A;  2NVX J;  2HOT A;  1A6I A;  2XB5 A;  3GTQ J;  1JKP C;  1EF4 A;  2LLK A;  4A3K J;  4W1U A;  3MN2 A;  3NAU A;  1MBK A;  2R5Z B;  3JR9 A;  1ZGW A;  3G1M A;  1I50 J;  2R5Y B;  3F0C A;  5DTD A;  4B4C A;  3WHB A;  2YS9 A;  2JJ7 A;  4XIC A;  2ME0 A;  3LSP A;  4MIM A;  4IHV A;  3BTI A;  1VFC A;  1JTX A;  4V2F A;  3I4N J;  3QQA A;  2ELK A;  3LSR A;  3S15 J;  2K9N A;  4DZP A;  4MO7 A;  3HOV J;  2XB0 X;  3Q0V A;  2R0Q C;  1B72 A;  5FKK A;  2QCO A;  1PUF A;  2EBI A;  3GTO J;  3LNQ A;  2JK3 A;  1HF0 A;  2X6O A;  1MH4 A;  5FKN A;  3RKQ A;  2JMW A;  5HOD A;  5C3E J;  1Y1W J;  2M2E A;  2D5V A;  1GDT A;  1CQT A;  1FJL A;  3A01 A;  4A3B J;  2FD5 A;  4FCY A;  2W48 A;  3BQZ A;  1JKO C;  4BY7 J;  2XGE A;  2HOA A;  2QF7 A;  2IBD A;  4M3B A;  2Y9Y A;  1MBH A;  4XK4 A;  3CCY A;  4Y7N J;  5JLW A;  2NS7 A;  3JRI A;  2CU7 A;  2L0K A;  2RAE A;  3PO2 J;  3S1M J;  3GTJ J;  2ME6 A;  5IPA A;  3D1N I;  1JUP A;  3GTM J;  1IG7 A;  5C44 J;  9ANT A;  4W97 A;  1W0T A;  1Z0X A;  1ZKG A;  3JRD A;  1H88 C;  1LE8 A;  1YRN B;  1P7J A;  4M3F A;  3W6V A;  2X48 A;  1A5J A;  5F0C A;  1TWA J;  1ETY A;  1XG1 A;  2XRL A;  1HCR A;  1OJL A;  1JUM A;  3ZQH A;  1I6H J;  3OIO A;  1ORK A;  2EZI A;  1AU7 A;  1MSE C;  2WAQ N;  1IRZ A;  2L7M P;  3S1R J;  2XGC A;  1QPI A;  1RPW A;  3RZD J;  1SFO J;  1MBJ A;  1FEX A;  3IH2 A;  1BL0 A;  3FIS A;  4M3D A;  2JA7 J;  3HM5 A;  2L7F P;  1UG2 A;  3HOY J;  2KDZ A;  5EG0 A;  3G1O A;  1H8A C;  3WHC A;  1TC3 C;  1F36 A;  3HGG A;  5EEA A;  5EZH A;  4J19 A;  2O9L A;  2VPR A;  4IEJ A;  2FQ4 A;  5J1U A;  1LFB A;  2DMN A;  4FE4 A;  5FJ8 J;  2CUE A;  4XRS A;  1O4X A;  1F43 A;  2GLO A;  1AKH B;  3BR2 A;  2MW8 A;  2X9D A;  3BTJ A;  1XS9 A;  5F08 A;  3VPR A;  5FKM A;  2EZL A;  5EDN A;  3RQI A;  4IHX A;  1U9O A;  3B6A A;  4CYC B;  1IGN A;  4JP0 A;  5IP6 A;  5E3M A;  2MG4 A;  2M0C A;  2R5Z A;  3SJM A;  2DN0 A;  2EH3 A;  4A3L J;  4UUS A;  5C4X J;  1HOM A;  1BA5 A;  3IV5 A;  4ABZ A;  1APL C;  1ZR2 A;  2DMQ A;  4A69 C;  4IHY A;  1I3Q J;  4S0H B;  5IOY A;  1ITY A;  2O8K A;  3ZOB A;  3HOX J;  1Y1V J;  2XPW A;  3JRB A;  2VKV A;  1NK2 P;  2YUS A;  1IDY A;  2VI6 A;  3S17 J;  5DS9 A;  1ETX A;  2AHQ A;  1T56 A;  4BXX J;  2B63 J;  5M3M J;  5K7Z A;  2ECC A;  3FKI J;  2DA3 A;  1WI3 A;  2OPT A;  1B8I B;  4MLO A;  5GPC A;  2R7Z J;  3BR5 A;  1ENH A;  5F0H A;  1VND A;  1G2H A;  2DA2 A;  3HKZ N;  2HOS A;  1SAN A;  3HB9 A;  3TW6 A;  3PO3 J;  4QSH A;  2E19 A;  1ZR4 A;  4A3J J;  3ZQL A;  3L1P A;  4XID A;  2NVT J;  3GBG A;  2LP0 A;  4D7M A;  4QIW N;  5E3L A;  3TW7 A;  5K7H A;  3HGY A;  2HDD A;  2N8G A;  3SDG A;  3GTL J;  3JRC A;  1MBG A;  3BG9 A;  3HOW J;  1ZTR A;  4C3J J;  4I76 A;  2JN6 A;  1LFU P;  2CRG A;  1AHD P;  2EQR A;  1ETV A;  2ECB A;  2Y9Z A;  1B72 B;  5J1R A;  1PUF B;  3BQY A;  3M4O J;  4XRM A;  3HEF A;  2XPU A;  2HI3 A;  5IYD J;  3DCF A;  1ZK8 A;  2LFB A;  1UMQ A;  1OCT C;  3CMY A;  2JWT A;  1U9N A;  2M9H A;  1JTY A;  1Z77 A;  4A3D J;  1FIP A;  2L7Z A;  4JX5 A;  4V2G A;  2DMT A;  4DYR A;  3UKG A;  1TWG J;  5M5Y J;  2IEK A;  5GPA A;  1MBF A;  3ZQC A;  3BG5 A;  4A3M J;  2CQX A;  2LTP A;  1JJ6 C;  2TCT A;  4DYC A;  5BNG A;  4AUX A;  2E1O A;  1WGX A;  3IH3 A;  3BR6 A;  2VUM J;  2DJN A;  3K7A J;  4DW6 A;  3S1N J;  4BY1 J;  3M3Y J;  1NTC A;  1JKR C;  3HBL A;  5C4J J;  4LOC A;  1WH5 A;  2GM4 A;  1FTZ A;  3HOZ J;  3S2H J;  4B1R A;  5FLM J;  2Y2Z A;  4HNV A;  2EZH A;  1TWH J;  2LVS A;  3ZQG A;  3G1L A;  3BTL A;  1RR7 A;  2DMU A;  4FE7 A;  5IYB J;  4D5C A;  4X6A J;  2JA8 J;  4JX6 A;  2LD5 A;  1MBE A;  1TWF J;  3C2B A;  5M3F J;  1DU6 A;  1UHS A;  5M5W J;  4MFE A;  5F1J A;  3FK7 A;  2LKX A;  3Q0U A;  3PM1 A;  4RDU A;  3JRE A;  4I6Z A;  4X1E A;  1DU0 A;  4JYK A;  3S1Q J;  1K61 A;  2WB1 N;  3GTG J;  2I10 A;  1AKH A;  2HQ5 A;  2YU9 J;  4D5F A;  2TRT A;  5IOZ A;  4AYB N;  4CYC A;  2DA7 A;  2XSD C;  3BR3 A;  1JT0 A;  5F27 A;  5E3N A;  4RBO A;  4BBS J;  2DA5 A;  3TP3 A;  2R92 J;  1QRY A;  1ETW A;  3ZQF A;  5EF6 A;  3JRF A;  3IH4 A;  2R5Y A;  2R93 J;  1ETO A;  2CQQ A;  2DA4 A;  1HDP A;  4A3E J; 
#chains in the Genus database with same CATH topology
 3B02 A;  3OL4 A;  2MLG A;  4M3G A;  3W6K B;  4ZJZ A;  3DU5 A;  4XKW A;  3QPL A;  2Z5U A;  3MEX A;  2RQQ A;  3AG1 H;  2VQL A;  3K0L A;  2OCE A;  4RS8 A;  2I5U A;  2V9P A;  2X1D A;  1SVO A;  2ESN A;  3H5A A;  5J47 A;  3OSG A;  2Z1D A;  3RIR A;  5EGO B;  1TWC J;  2DA6 A;  2ZNY A;  2UXN A;  1B9N A;  3BZC A;  3CZ6 A;  2O5R A;  4HW0 A;  5M5X J;  4AIK A;  2K40 A;  2XRO A;  1C0W A;  4EM2 A;  3TGN A;  4AVZ A;  4ETS A;  3PJR A;  5EYR A;  3OSF A;  1D8K A;  3V42 A;  2AO9 A;  4UUS B;  4DNC A;  4A93 J;  2J5O A;  1JKQ C;  1NK3 P;  3VFZ A;  2PN6 A;  2X51 A;  3RDI A;  3KLO A;  2H1L A;  1S6L A;  3Q3S A;  2M3A A;  3GFI A;  1QPM A;  1BJZ A;  1F9N A;  5E79 C;  4KA4 A;  3WG7 H;  1N75 A;  1GVD A;  3GEZ A;  3H9G A;  4BYY A;  1BOA A;  1MMD A;  4Y52 J;  1DGW Y;  4GYG A;  3E7L A;  3H5N A;  5J4Y A;  1YW8 A;  3I64 A;  2BE5 F;  5D8L B;  2L9R A;  3S3N A;  2E2H J;  3OYN A;  4F55 A;  3A4C A;  2KIM A;  1ZAO A;  4A3C J;  3H3V K;  3HOU J;  3FM5 A;  4J00 A;  1IUF A;  1B6A A;  3J80 K;  2H6C A;  1MJ9 A;  1IV6 A;  4PJN A;  2GBY A;  3OYG A;  2UXX A;  3LWF A;  1H9G A;  2LMD A;  4GYI A;  1T95 A;  1WKM A;  2ZKZ A;  5B3S H;  3T8R A;  4CUG A;  4G9Y A;  2WAQ A;  1IC8 A;  1GXQ A;  2HXO A;  1GV5 A;  2VOO A;  3ESW B;  3ASO H;  3BC8 A;  4OAY A;  5DV5 A;  1FOY A;  3DXJ F;  4QTR A;  2CFX A;  2MBF A;  2OA4 A;  1XCV A;  3IL2 A;  2XGD A;  3MZH A;  5FLX K;  3FXK A;  1FMW A;  3WOD F;  1OCP A;  4ESF A;  4C2T A;  1LDD A;  3EUH A;  3GFL A;  2ZXI A;  4G94 A;  1ZEL A;  1IN4 A;  2K4B A;  3JRA A;  4CCM A;  1EH8 A;  1U5T A;  2JQ7 A;  3SFZ A;  5B1A H;  3PQK A;  4DYQ A;  3Q9S A;  1UB9 A;  2JA2 A;  3V8K A;  1TW2 A;  4Q47 A;  4BBR J;  2YU3 A;  5AIQ A;  1MNE A;  4C2M J;  1VZ0 A;  2KKO A;  1W4M A;  4L5E A;  4A3I J;  1OMI A;  3HSE A;  4U0Y A;  3V7S A;  4D7N A;  4D1Q A;  3GZN B;  2ZC2 A;  1TZL A;  1JT6 A;  2QQ9 A;  3U9G A;  4AIH A;  2BHY A;  2XAQ A;  4I09 A;  4BE2 A;  4F91 B;  2K9S A;  2LG4 A;  5J1Y A;  3VSL A;  1ZRD A;  3AAF A;  3S16 J;  3OS0 A;  1W5T A;  3S32 A;  3JSO A;  1CF7 A;  4XSX F;  2X1C A;  2EZK A;  4UY8 I;  5D5X B;  4BEH B;  3L2R A;  2DAO A;  4M6V A;  3W2A A;  1S7O A;  4HF2 A;  3S93 A;  1IF1 A;  5EGO A;  5J3L A;  2ICW G;  5CVI A;  4CH7 A;  2E2J J;  1RKW A;  4AM3 A;  2KIU A;  2DTZ A;  3J80 Z;  2M4G A;  2XB5 A;  3I59 B;  1X3W B;  3GTQ J;  2LKP A;  1JKP C;  2LLK A;  2YX7 A;  3GX4 X;  4A3K J;  1DP3 A;  3RJP A;  1ZAR A;  5CQG A;  5LD2 C;  1ZGW A;  2I8D A;  3G1M A;  1BI2 A;  2R4G A;  4IO9 F;  3F0C A;  1MD0 A;  2DQL A;  1IRF A;  3QOE A;  4XR6 A;  2YS9 A;  3IRR A;  3K69 A;  4TV7 A;  5FLX Z;  4MIM A;  3K4J A;  2W85 A;  4FET A;  4U0V A;  4IHV A;  3K10 A;  4MTD A;  3I4N J;  3C7J A;  1VQL I;  3DPL C;  4ZYE A;  3KCC A;  4MO7 A;  3W3C A;  3C2G A;  1FY7 A;  2OQG A;  1B72 A;  5FKK A;  2QKM B;  4QPO A;  4YFX F;  3WG9 A;  4OIP F;  1SMT A;  2OV7 A;  3C1D A;  4PJL A;  5E1Z B;  1MMG A;  3LA7 A;  3LNQ A;  1SFU A;  2GIV A;  2JK3 A;  4N4O B;  4UVA A;  1MH4 A;  5HOD A;  3V7R A;  1TLH B;  2M2E A;  4YIR X;  1G4D A;  5BPD A;  2UZK A;  2W48 A;  2O6G E;  1JHH A;  1KU9 A;  2JZY A;  1VQK I;  1Z91 A;  3DP7 A;  1MDM B;  4I7H A;  3U1D A;  2IBD A;  2L02 A;  3CCY A;  4Y7N J;  3KP3 A;  2BW3 A;  3JRI A;  1S8N A;  2E34 A;  2L0K A;  2PEX A;  3PO2 J;  1LVA A;  2BOL A;  2DBB A;  3ECO A;  5L3G A;  4LG0 B;  5JFR A;  2VE8 A;  3OY9 A;  1GVJ A;  4PUS A;  1IG7 A;  3DLA A;  2Y75 A;  4W97 A;  2ZFU A;  5KCM A;  2GWR A;  3BCA A;  3G2B A;  3H1C A;  3LSK A;  4I2O A;  2R7D A;  3VEP A;  1YRN B;  1BN5 A;  2HS5 A;  4HRI A;  4B47 A;  1TWA J;  2QKL B;  5KVR A;  1K7A A;  4DOZ A;  5B5E C;  4PCQ A;  3ZQH A;  3BG7 A;  3PFI A;  3PNV A;  3IKT A;  2LOO A;  3ZCO A;  1P4X A;  3SEZ A;  5J8F A;  3FXO A;  4AYB A;  1OCR H;  1FSE A;  4BDY A;  2WAQ N;  1QO0 D;  1BI3 A;  3KYD B;  4HSR A;  5JVT A;  3VYR B;  1SFO J;  5LGT A;  2V6E A;  1VQ5 I;  3IHU A;  3M8F A;  4BGD A;  1FEX A;  3K4L A;  3IH2 A;  5BS6 A;  2DFI A;  3ABL H;  5F1R A;  1IXS B;  4C2U A;  4U7B A;  4BEH A;  3G6E I;  1H8A C;  4CHU A;  2KP6 A;  4CZC A;  3HGG A;  5EEA A;  4WWC A;  2O9L A;  2VPR A;  3K2Z A;  4KDP A;  1LFB A;  4FE4 A;  1PVE A;  3SZT A;  2DLL A;  3ULQ B;  1ZG5 A;  2CSO A;  3I59 A;  2GLO A;  1AKH B;  1IAW A;  1SMY F;  1H0M A;  4IHT A;  3VPR A;  3KZI C;  5EDN A;  5HDG A;  1U9O A;  1IGN A;  1Z67 A;  4XQF A;  3DBL B;  1E17 A;  3ZMT A;  5E3M A;  3ZMU A;  4UB8 C;  2MG4 A;  2OD5 A;  2VIX A;  3VOE A;  3CMA I;  4O5V A;  5JR3 A;  3SJM A;  1HW5 A;  2DN0 A;  2QWW A;  3CDH A;  3AL0 C;  2IVM A;  2EIK H;  1Z9C A;  2K86 A;  1HOM A;  2ZNZ A;  4IZZ A;  1S7A A;  4ABZ A;  4ZYH A;  1APL C;  4A69 C;  4D9J A;  3HOX J;  1IO2 A;  2GIZ A;  3KPH A;  3H9J A;  2FUG 2;  3RPU A;  2XAG A;  4NB5 A;  4JOM A;  2NNY A;  3GXO A;  1FOK A;  1EKE A;  4R1H A;  2ECC A;  3HJE A;  2QQB A;  3C3W A;  3FKI J;  2QQA A;  4RB1 A;  2XIG A;  1WI3 A;  3SHF A;  2CMP A;  3IWZ A;  3CDI A;  5F0H A;  1YHQ I;  1VQO I;  4KFC A;  3HB9 A;  1V55 H;  3L1P A;  2W84 A;  5FRN A;  2LP0 A;  1YLF A;  2IS6 A;  2UV1 A;  1YIT I;  3ERM A;  5AIP A;  1WJF A;  5K7H A;  1MDM A;  3CUQ C;  2EV0 A;  3HGY A;  1WJ5 A;  3SDG A;  3CC2 I;  1WJA A;  3JRC A;  2B9S A;  1MND A;  4ITV A;  1W1W E;  1OYI A;  4I76 A;  1D5V A;  3KEO A;  1BR2 A;  1Y0N A;  3IKV A;  2EPF A;  4BQO A;  4D0P A;  3KIO A;  2OC6 A;  5J1R A;  5EEH A;  3OWT A;  1PUF B;  1HST A;  3M8J A;  2IP2 A;  5E17 F;  4XRM A;  2PJR A;  3DCF A;  4LIU A;  2ELH A;  1UMQ A;  1FOW A;  3CMY A;  1MJB A;  3KLN A;  5HS7 A;  4M6X A;  4V2G A;  5BPI A;  2XF5 A;  2GAU A;  1MBF A;  4XLN F;  1KA8 A;  2VBY A;  2TCT A;  3LA2 A;  4DYC A;  1XGM A;  2CGP A;  2IGO A;  1UG0 A;  1P92 A;  2E1O A;  2DQR A;  3IH3 A;  2W24 A;  2DJN A;  3ABK H;  3S1N J;  2HDW A;  1D0Y A;  4B8X A;  1R1V A;  1NTC A;  3DPT A;  2W25 A;  5C4J J;  2JSC A;  3I71 A;  5HS8 A;  2QEX I;  4IOC F;  3CC7 I;  4KUM A;  4B1R A;  2Y2Z A;  2FOW A;  1X3Z B;  2NRA C;  2LVS A;  3ZQG A;  3QU3 A;  2EFQ A;  1FWZ A;  4WXC A;  1RR7 A;  2DMU A;  1X1P A;  3E5Q A;  4CCJ A;  3SZP A;  4X6A J;  1V5E A;  2JA8 J;  2LD5 A;  1N77 A;  1DU6 A;  2R3S A;  3OYC A;  4CCK A;  3T8T A;  1KYZ A;  1J75 A;  3FK7 A;  4WCG A;  4M72 A;  1BC7 C;  2P5V A;  2CWE A;  4RDU A;  1S29 A;  2E1M C;  4I6Z A;  1FSH A;  3KEQ A;  3R6S A;  1DU0 A;  2VN2 A;  4P5O A;  2FRH A;  2WB1 N;  1AKH A;  4KIF A;  3DBR B;  4ZDL A;  4D5F A;  5KK1 A;  4PFO A;  1YG2 A;  2FNP A;  1LB2 A;  4AYB N;  1R22 A;  2L7K A;  5FO5 A;  4PJM A;  3ZQQ A;  3OYF A;  1JT0 A;  3QOD A;  5E3N A;  2HGC A;  4RBO A;  2ZBK A;  1E3H A;  2DA5 A;  2BY0 A;  1K79 A;  4Z2Y A;  1XMA A;  4IVN A;  1EA3 A;  1IXR C;  1NG7 A;  1RNL A;  2CQQ A;  1HDP A;  3A2K A;  2ZCW A;  1VQ7 I;  2ZB9 A;  2K27 A;  2LK2 A;  2Y31 A;  2V1X A;  4B3X A;  3F8C A;  4UNO A;  4XRS G;  3W2W A;  4ZZL A;  5FKO A;  2VJ5 A;  5D6F A;  1U2W A;  3TED A;  3GTK J;  5ICE A;  3HSR A;  5DD4 A;  1WH7 A;  3BG3 A;  3LQQ A;  3QU6 A;  2HQN A;  4HPQ A;  3IWF A;  4PSX A;  5F0F A;  1P9Q C;  3G4S I;  3ABT A;  4NQW B;  4CIC A;  1TQM A;  2JA5 J;  2G7U A;  1V5G A;  4NBQ A;  1X2M A;  1H89 C;  3SFI A;  3NAR A;  1PJR A;  2KT0 A;  1LEB A;  3CDL A;  2O7O A;  2M4K A;  2P4W A;  3EUA A;  1ZN2 A;  3R60 A;  4II3 A;  2H8R A;  1WCM J;  2KQR A;  2QGU A;  2JVG A;  5D5W B;  4KNY A;  3ZQI A;  1J59 A;  2KRC A;  4HG2 A;  3QWL A;  4P96 A;  1U78 A;  2LF8 A;  3QYF A;  2IT0 A;  4Q5S F;  3HRM A;  4ZDP A;  2R7R A;  3A03 A;  4UV9 A;  4I0B A;  4XMY A;  4A12 A;  5FRO A;  4HAM A;  2GXB A;  4HX4 A;  4AID A;  5ILS A;  3FIW A;  4MEX F;  2KRF A;  4A3F J;  3VYT B;  2O0Y A;  2DOA A;  4UB6 C;  4EVI A;  1QBJ A;  2XKP A;  3BZ6 A;  4AIJ A;  1BW6 A;  3TO9 A;  2DFE A;  3DQV C;  3QYB A;  4YII A;  2CW0 F;  3A01 B;  1S7E A;  3DKX A;  2XAU A;  3F8M A;  2RNJ A;  1MKM A;  2GOX B;  2DOD A;  3I4P A;  4KMF A;  2QZ8 A;  1UEL B;  2EV6 A;  2WWY A;  4XON A;  2M34 A;  2V7F A;  5CVR A;  2JA6 J;  1T38 A;  1L0O C;  4LMY A;  1JUS A;  1IZ1 A;  4M3E A;  1XSX A;  3UR3 C;  2H27 A;  3CD6 I;  2ZJ2 A;  4P9F A;  1ZRF A;  3CUO A;  3WGG A;  1ON2 A;  1D0X A;  3LMM A;  2K7L A;  1FPQ A;  2CV1 A;  3VSK A;  3R4K A;  3K4B A;  3MZY A;  1G3S A;  3MQ0 A;  4PJ0 C;  3PIO F;  4IX7 A;  1R00 A;  2KZG A;  3F6O A;  3U2R A;  1X58 A;  1UZC A;  5HDK A;  3FHZ A;  3VWB A;  1H9T A;  1P2F A;  4CZZ A;  4RB0 A;  1ETK A;  1A31 A;  4B43 A;  3HRS A;  3OS2 A;  2IXS A;  2DT7 B;  2MAB A;  3FXU A;  5F04 A;  3CUQ A;  5IY5 H;  1T33 A;  3HUG A;  2DTR A;  2BVM A;  2RC4 A;  2NVQ J;  1UJ8 A;  1XTA A;  2VXD A;  5DCM A;  2CQN A;  4JX4 A;  3E5U A;  1A04 A;  4GFB A;  3JRG A;  3KX2 A;  4S05 A;  3R0A A;  1RIO H;  1GHC A;  5ICF A;  3LQR A;  3FXJ A;  1SFX A;  3JCU C;  2OF7 A;  1I1G A;  1E2X A;  3ECH A;  1YO5 C;  4UVB A;  2WAE A;  1SAU A;  3DEW A;  4FT8 A;  2K4J A;  5DEQ A;  3L09 A;  4RAY A;  3P5J A;  2D1H A;  1WQ2 A;  4WXH A;  4WF2 A;  2X0L A;  2K9Q A;  2ID3 A;  2HVR A;  3DTE A;  3D5L A;  1R1T A;  4FX0 A;  3QOP A;  1QVU A;  2A69 F;  2NAZ A;  1GLN A;  2G7H A;  4BHP A;  3TP0 A;  5K7F A;  2JUG A;  3HDD A;  2G0E A;  5GAE J;  5GP9 A;  4DZJ A;  2A6E F;  4NUB A;  5L3E A;  5FLV A;  2CJJ A;  2NVX J;  2VON A;  3HHG A;  4BL0 B;  2X1E A;  4I98 B;  1EF4 A;  4L5I A;  2AQF A;  3TBI A;  1KU7 A;  4JBA A;  3GUD A;  1E0E A;  2XVC A;  1SVM A;  3LSI A;  2HTS A;  3M1C A;  1WSU A;  2R5Z B;  1ZYR F;  3IAM 2;  1IN7 A;  4OU0 A;  2FF4 A;  4XLC A;  1UST A;  2R5Y B;  5E20 A;  5DTD A;  5TGT A;  2E36 A;  4B4C A;  1HSJ A;  3WHB A;  2Q1Z B;  4OAZ A;  4QLC U;  1X4O A;  4FX4 A;  2JUC A;  2K5C A;  2X4H A;  2IGK A;  3LSP A;  1OLT A;  2FA5 A;  3TL4 X;  1WRJ A;  4U88 A;  2CW8 A;  1VFC A;  4V2F A;  4A2U A;  1FNN A;  1SD6 A;  2R7F A;  3SDB A;  2OAZ A;  5KHD A;  2HPI A;  2KPM A;  4O6J A;  3WE3 A;  3LSR A;  4BQA A;  1V5F A;  1VQP I;  1UHM A;  3KP4 A;  1O7F A;  5JVG F;  1WJB A;  4PGH A;  4R79 A;  2IA1 A;  2EB7 A;  3GFJ A;  1D3Y A;  2ZJQ F;  3H3U A;  4LB5 A;  2JVH A;  4KIS A;  3GTO J;  1W36 D;  4EGZ A;  4C30 A;  2EWN A;  2PMU A;  1FBQ A;  4E7Z A;  1Y8Q B;  2R7S A;  3FBI B;  5FKN A;  2QSF X;  4E7S A;  1Y1W J;  2D5V A;  3SEQ A;  4PK4 A;  1GDT A;  4RAG A;  4PJJ A;  3A01 A;  3RPQ A;  1HKS A;  1R23 A;  1OIS A;  2FD5 A;  2D2W A;  1PUE E;  2VKH A;  4ZTJ A;  4L5J A;  3LA3 A;  4L9N A;  2HOA A;  1MBH A;  4UUV A;  4QWQ A;  3LFK A;  1Z21 A;  4CGZ A;  2NS7 A;  1R5G A;  2CH0 A;  3W6J B;  5H2F C;  1TT5 B;  2MC4 A;  2RAE A;  5DD8 A;  1K4S A;  3H0D A;  4ZC3 A;  3I5U A;  3IC7 A;  2MFZ A;  3O2P E;  4LG3 A;  5C44 J;  2GA1 A;  1L3L A;  3HL2 A;  4G6D A;  5CLS A;  4I01 A;  1A36 A;  3ZPL A;  1Z3X A;  2Z3Y A;  3NRV A;  2E5Z A;  4MQ9 F;  1ZKG A;  3K1M A;  3JRD A;  1K78 B;  1FC3 A;  4P9U A;  3W6V A;  2X48 A;  3E0J B;  3NQO A;  1ETY A;  1XG1 A;  2LY1 A;  3LAP A;  3BWG A;  4ZYG A;  1HCR A;  3DFG A;  1JUM A;  4F7Z A;  1YJW I;  1I6H J;  2LKS A;  3TOB A;  4BDZ A;  1D1B A;  2AQE A;  4A0Y A;  3M9A A;  1IRZ A;  2VKD A;  3S1R J;  2DK5 A;  1RPW A;  3DBH B;  4LLN A;  1KON A;  3CCJ I;  5E8I A;  4FHT A;  2BGC A;  5LGU A;  1BL0 A;  3QRF F;  2KRH A;  4NNJ A;  2L7F P;  2CUZ A;  2FOK A;  1T39 A;  2P0W A;  4HLY A;  1I3A A;  4HDU A;  4GXO A;  4XM3 A;  3C18 A;  1RUN A;  3G1O A;  2RNG A;  1JE8 A;  3E6D A;  3WHC A;  1TC3 C;  4E6K G;  1MMA A;  5EZH A;  2DJI A;  4IEJ A;  3KP7 A;  2STW A;  5J1U A;  3TO7 A;  4RM3 A;  3CME I;  1F1Z A;  4M9S A;  2DOF A;  5EJC A;  1XSD A;  2UWM A;  2R7U A;  3O3K A;  4XRS A;  5FD5 A;  3I55 I;  5FB2 A;  1F43 A;  2BXY A;  4LIV A;  1MMN A;  1R58 A;  1SC7 A;  2X9D A;  2WAD A;  2LF7 A;  4CCO A;  4IPA A;  1J0R A;  4Y13 A;  3B6A A;  5IP6 A;  2OJE D;  2VC1 A;  4BAC A;  1UFM A;  3CCE I;  2LBF B;  5GAH J;  2R5Z A;  2D45 A;  1G59 A;  3JSP A;  3RSN A;  2EH3 A;  1F4K A;  4A3L J;  1J9I A;  4UUS A;  5C4X J;  2DT5 A;  3SYT A;  2G9W A;  4CA0 A;  3IV5 A;  2P8T A;  3BLY A;  1IW7 F;  3HPH A;  4S0H B;  2NS0 A;  3PSI A;  1O7L A;  2W82 A;  2XPW A;  3DLL F;  5IT9 K;  2MA3 A;  1TNT A;  1XGO A;  2L2O A;  4DQ2 A;  1U8R A;  5LRR A;  2ACJ A;  1J7K A;  5FFX A;  1TNS A;  4N9I A;  5LLQ A;  3GZ6 A;  2B63 J;  1RZ4 A;  1KQ0 A;  1XMK A;  1MMS A;  2O03 A;  3ASN H;  2LNB A;  3NWS A;  5GPC A;  5H6Q A;  3BR5 A;  3ZRG A;  5CVJ A;  2E1N A;  2YPR A;  2IS2 A;  3ZXS A;  3L2V A;  2HOS A;  1D0Z A;  3TW6 A;  5HVQ C;  3PO3 J;  4AWX B;  1U3E M;  1W5C C;  1ZR4 A;  2XAS A;  5CJ9 A;  3CJQ B;  2KIQ A;  3GWZ A;  3QP5 A;  2KHM A;  3GZ5 A;  1LFP A;  2XHK A;  5E3L A;  4E7L A;  3TW7 A;  2VB6 A;  2Q0O A;  2L4M A;  4U0W A;  3ZMD A;  4AVP A;  1NHA A;  4EJU A;  2BYV E;  4L0Z B;  1ZGJ A;  2Z33 A;  1U0J A;  5CKT A;  1ZRE A;  1LDK B;  2GXG A;  3M8E A;  2P7V B;  3H36 A;  4C3J J;  2RN7 A;  2RQP A;  1PP7 U;  4EGY A;  2CRG A;  1ETV A;  3D0S A;  2Y9Z A;  3IUO A;  2VAS A;  3BQY A;  2Y69 H;  3DF8 A;  2HI3 A;  4EJO A;  1ZK8 A;  2ZO4 A;  2QSG X;  1X3U A;  1U9N A;  2M9H A;  2LH9 A;  4A5M A;  1YS6 A;  1HC8 A;  3CO6 C;  4XN0 A;  5HNF A;  2E7X A;  3WTY C;  4JX5 A;  4YRV A;  4DYR A;  5M5Y J;  3F8F A;  2IEK A;  3ELK A;  2VOD A;  2IGM A;  4WX9 A;  3EQL F;  3K70 D;  3ONQ A;  4LFU A;  2HVQ A;  5F6F A;  3H92 A;  4AUX A;  1WGX A;  2KJC A;  3I0T A;  1PDN C;  3K7A J;  4KT6 A;  2ZXJ A;  1IN5 A;  4RLF A;  4BY1 J;  1HW1 A;  3M3Y J;  1JKR C;  2DCE A;  1Y56 A;  5IT9 Z;  2L9S A;  4HNU A;  4ZTF A;  1FTZ A;  3S2H J;  2IA2 A;  4XL9 A;  3GFM A;  3R61 A;  1TWH J;  1STZ A;  2QSH X;  3G1L A;  3BTL A;  4EJW A;  1N25 A;  5IYB J;  4FE7 A;  3WU0 A;  3ZQ7 A;  4JX6 A;  5KAI C;  1I5Z A;  1SVL A;  1TWF J;  3C2B A;  5J6X A;  4MQV A;  4J01 A;  2VJ4 A;  2A5Y B;  3CCL I;  2XC7 A;  3JRE A;  4RAF A;  1Z7L A;  4JYK A;  2DU9 A;  3I9V 2;  1QHG A;  3CLO A;  4HST A;  2CS3 A;  5IOZ A;  3J7Y J;  3OYD A;  1W7P B;  1PP8 F;  2XSD C;  3BR3 A;  2LBF A;  3GLL A;  4IRG A;  5CVV A;  1S5L C;  4IOA F;  1DGR M;  5ICG A;  2D1V A;  1R49 A;  5LBQ A;  4BBS J;  5L3B A;  1QHH D;  4XOT A;  5ICC A;  1IXC A;  2BZT A;  3NWT A;  2V6C A;  5EF6 A;  3JRF A;  3IH4 A;  3C2H A;  3LSM A;  3MZ8 A;  4YG2 F;  3EDP A;  1TT0 A;  4RA2 A;  2QA4 I;  4CO8 A;  3HYI A;  3GME A;  5CVU A;  5DDG A;  2DDA A;  2F5C A;  4A3E J;  2RVC A;  4IQ4 A;  5FGM A;  4ENK A;  4FTH A;  1KU3 A;  2QYO A;  4HF0 A;  3BOQ A;  4M71 A;  4EV0 A;  4BXF A;  2STT A;  2E71 A;  2XAF A;  1OCC H;  2EJR A;  4L9V A;  4DGW B;  1X1B A;  5BMZ A;  1IJW C;  4PZJ A;  1BI1 A;  3A0B C;  5FD6 A;  4HQM A;  2QQ8 A;  1X2N A;  1JJ8 C;  2NVY J;  1E3O C;  1Z6R A;  1TW3 A;  2XAJ A;  4C3I J;  1V54 H;  3P9C A;  3HTS B;  4MEY F;  4G7H F;  1ONV A;  2FJ1 A;  4BAY A;  2DA1 A;  2A6H F;  5DYM A;  5HLI A;  2CO5 A;  3V8J A;  1OR7 A;  1XX5 A;  5FKL A;  2HWV A;  2ZSH B;  5IP7 J;  2EIN H;  1SFE A;  1R5I D;  4HEA 2;  1FP2 A;  4M9Z A;  1G3T A;  5JLX A;  4PFP A;  4E4H A;  3DKY A;  2M7B A;  3OIQ A;  3QAH A;  1ETQ A;  5JI6 A;  3JRH A;  4NC8 A;  2IAI A;  4HOB A;  2DPD A;  4B3A A;  2MD5 A;  2P81 A;  1QZZ A;  2K3F A;  2ESH A;  2JRM A;  1WFX A;  2XF7 A;  3OOP A;  4M6Y A;  5EZG A;  4LG0 A;  4ZDO A;  2FU4 A;  2V1N A;  5EEG A;  2W7N A;  2LY9 A;  2JTV A;  2Z99 A;  1YIJ I;  1XGN A;  1T0F C;  4H4K C;  1WVR A;  4B44 A;  2FML A;  4BQQ A;  2H8W A;  3JAM K;  2K9M A;  4ZZD A;  4WXD A;  3DTK A;  1YRN A;  4N9H A;  4IRI A;  1W7P D;  4HX7 A;  5DCF A;  3MMY B;  2JPB A;  4FAS D;  3Q5F A;  1JGG A;  2PMH A;  3HIF A;  4OOI A;  4BQN A;  2DFH A;  1K6O A;  1X19 A;  2ZXH A;  3T1B A;  1D8J A;  1B1B A;  2X6Y A;  1RES A;  1DUX C;  1V4R A;  3QPT A;  1BI0 A;  2XPV A;  3TQN A;  3LSJ A;  5L3D A;  1QVT A;  2PI0 A;  3PQJ A;  2IJL A;  3BR0 A;  3CP8 A;  3FM3 A;  4KT5 C;  5HLG A;  4XLP F;  3RQ4 A;  2DYR H;  1RRJ A;  2V79 A;  1FYL A;  2LR8 A;  2MSY A;  3FBN B;  2P6T A;  1I39 A;  2DPU A;  3MVP A;  2RRE A;  2PJP A;  3CQZ J;  2KMU A;  3RYR A;  3F22 A;  2F5F A;  2GXA A;  1LE8 B;  1ERD A;  4NHJ A;  4QPQ A;  2A3S A;  4IRH A;  1VTN C;  4ESB A;  2OBP A;  3E97 A;  5KAF C;  3Q0W A;  2BY2 A;  1IDZ A;  2NXN B;  2XKO A;  1GUU A;  3M7G A;  2CQK A;  2Y0M A;  4A0X A;  3KET A;  3S14 J;  1W7P A;  2UUZ A;  2VKE A;  3RI4 A;  1P7I A;  1KQ8 A;  1HDD C;  4UV8 A;  4ENN A;  4OIQ F;  4OMZ A;  2FMY A;  4F52 A;  4UUT A;  1ZGA A;  1AA7 A;  2HXI A;  3VDX A;  1I27 A;  4NC7 A;  1VQ9 I;  2H09 A;  2M8E A;  2OU2 A;  4U7D A;  3O8G A;  3OYL A;  3OYH A;  4HNT A;  2P7C B;  1UHW A;  1G8X A;  1QZE A;  3TDZ C;  3GTP J;  3PUB A;  3HRT A;  2CG4 A;  4HA8 A;  4OIN F;  5EG0 B;  1NH3 A;  3AKZ A;  1MH3 A;  2VQC A;  1JXS A;  2CUF A;  2COB A;  4JK1 X;  4IHW A;  3JAM Z;  4IKF A;  4E7K A;  2BEO A;  1ODD A;  2W4S A;  2DMP A;  2HOT A;  1OCO H;  3CCU I;  3BJ6 A;  3K4K A;  1WJE A;  2J5P A;  5FRM A;  2HVS A;  5AON A;  3K4C A;  1BOB A;  3L2C A;  1ZLK A;  4LK0 F;  5K1Y A;  3JR9 A;  1I50 J;  2F6C A;  2IS4 A;  3KZZ A;  2E5N A;  1TQP A;  3RKW A;  2JJ7 A;  3N05 A;  4ASN A;  1SEU A;  2A05 A;  1YI2 I;  5HOO A;  2E7W A;  1OYY A;  2IA0 A;  5B1B H;  3KYL A;  2O61 A;  4E7J A;  3BTI A;  1JTX A;  2WV0 A;  1LJ9 A;  3S15 J;  4S04 A;  2IS1 A;  3WGH A;  2F2E A;  4DZP A;  2HPM A;  1G3Y A;  1IN6 A;  3HOV J;  3HG9 A;  1Q1H A;  2DO7 A;  1YQA A;  2VJJ A;  5CYV A;  2DYS H;  2R0Q C;  1MJA A;  2ETH A;  1OQY A;  2QCO A;  3TO6 A;  1PUF A;  2EBI A;  4BE1 A;  2K3P A;  1X1A A;  3PIP F;  5E1W A;  3WTT C;  4DBQ A;  1HF0 A;  2X6O A;  3ROU A;  5ED4 A;  1UAA A;  2M0M A;  1XMX A;  1BIB A;  1KZH A;  1S3J A;  2JMW A;  5J8C A;  1REP C;  2DDB A;  4L9T A;  4A3B J;  2M1B A;  3N97 A;  2OTJ I;  4OMY A;  3WTX C;  2P6S A;  2HYG D;  2XRN A;  2EA4 A;  4ZYA A;  5JHF A;  4LB6 B;  2TDX A;  2XGE A;  4M3B A;  2QF7 A;  4XK4 A;  2XGX A;  2LC2 A;  2GZW A;  2NVU B;  2CU7 A;  2HQA A;  3GTJ J;  5ILU A;  5IPA A;  5D4S A;  1LUJ B;  2P5K A;  3PNT A;  3AG4 H;  2VBW A;  3GVA A;  2MYS A;  9ANT A;  1FYM A;  3MD2 A;  3WTZ A;  4Q4Z F;  3V7C A;  3OYB A;  2Z16 A;  2M87 A;  2MH9 A;  3D5R C;  4UHT A;  1IV8 A;  2M5W A;  3CP2 A;  2VPL A;  3X2Q H;  3CCQ I;  1LQ1 A;  1LE8 A;  2FEZ A;  4M3F A;  3ABM H;  4BNC A;  1A5J A;  2WAF A;  4XRF A;  3GYH X;  5GAD J;  2IGN A;  3COA C;  4R8H A;  2CW7 A;  4RLQ A;  3BPX A;  1OJL A;  3AG3 H;  1BM9 A;  5LHI A;  1O3Q A;  3PL8 A;  3RKX A;  2EZI A;  3AFH A;  4LD5 A;  3OYK A;  1X4P A;  2R7V A;  1FP1 D;  4RB2 C;  1MSE C;  3OMY A;  4K2E A;  4JQF A;  1BIA A;  2XGC A;  1W5S A;  3TMO A;  1QPI A;  3MKW B;  1QA6 A;  1USS A;  5FFZ A;  1YOV B;  1K4T A;  1R4N B;  3OL3 A;  1T0F A;  4M3D A;  5A2Q K;  2JA7 J;  3HM5 A;  5F64 A;  2NYX A;  4UXN A;  2B7E A;  3KZY A;  2V9V A;  1Z1D A;  1A6Q A;  4YEL A;  3RCO A;  5EG0 A;  1U5T B;  4BHC A;  3CCS I;  3CCV I;  2ELJ A;  3H3Z A;  4J19 A;  4KJZ A;  3T0Y A;  1ZG1 A;  2DMN A;  3TKY A;  4P55 A;  5FJ8 J;  1TQI A;  2CUE A;  3CLQ A;  3ZP5 A;  3BCB A;  2MW8 A;  4F3Q A;  2VLA A;  3N4M A;  4WK8 F;  1XSV A;  2EZL A;  3RQI A;  3OS1 A;  4CYC B;  3OIP A;  4NQW A;  2RV8 A;  3MKY B;  1MIJ A;  2GOM A;  3OR1 C;  5D5V B;  2FNA A;  2BY3 A;  5GTI C;  4IHY A;  1I3Q J;  5ILV A;  1FMV A;  2JRT A;  3ZOB A;  4F92 B;  5K5R A;  2O8K A;  1G6N A;  2M45 A;  3JRB A;  3FZV A;  1E3P A;  3DKW A;  4HDV A;  4M9X A;  3HTU A;  2VKV A;  2HQR A;  2M7A A;  2YUS A;  2F4M B;  2PMZ A;  3RKY A;  1SD4 A;  4F93 B;  1IDY A;  4X0G A;  2CYY A;  1B9M A;  4PDK A;  4UVC A;  2AHQ A;  3E5X A;  2YSR A;  2DK8 A;  4LJZ F;  1U6G A;  5D6E A;  1FT9 A;  2JSP A;  3FDY A;  1AOY A;  5M3M J;  2CUJ A;  4OIO F;  2WY8 Q;  1B8I B;  1Y8R B;  2XSJ C;  2R7Z J;  1ENH A;  1LPQ A;  2DA2 A;  1SAN A;  1LNW A;  1OKR A;  4IL6 C;  3QP6 A;  3S8P A;  1B4A A;  1DPR A;  2MH2 A;  1BC8 C;  1SD7 A;  1R4M B;  2E19 A;  3KP6 A;  4A3J J;  3KP5 A;  3JTG A;  3ZQL A;  1IN8 A;  3S3M A;  2NVT J;  3GBG A;  3WU2 C;  1J2X A;  2R7X A;  3VYS B;  3ZMV A;  4QIW N;  1QNT A;  4CCL A;  4HV5 A;  3L00 A;  3L2Q A;  2YR2 A;  3GTL J;  1P4W A;  2CQ7 A;  2HFH A;  1MBG A;  3I54 A;  2R7Q A;  3FMS A;  5A2Q Z;  3OYE A;  3LST A;  3HSF A;  3BG9 A;  2KZV A;  1R6R A;  2H6B A;  1YX5 A;  1ZTR A;  3QYE A;  2JN6 A;  2A6T A;  4C9Y A;  4LGW A;  1MGT A;  2X85 A;  1B72 B;  2WA0 A;  4I02 A;  2HNH A;  3K70 C;  2KLO A;  3FXQ A;  2FSW A;  3HEF A;  5IYD J;  2K02 A;  2W1O A;  3F72 A;  3ML6 A;  4G8X A;  1OCT C;  1O57 A;  2JWT A;  1D1C A;  4B09 A;  4A3D J;  3HPG A;  4LLL A;  1R5H A;  2RDP A;  1TWG J;  1IRX A;  2ZME B;  3UKG A;  3WTW C;  3A1Y A;  2X6X A;  5GPA A;  1Z6T A;  1HXD A;  2COM A;  2KIF A;  4BJ5 C;  4H0E A;  3ZQC A;  2IRF G;  3MAJ A;  2CQX A;  3LL7 A;  2LTP A;  1JJ6 C;  2Z9O A;  1WJD A;  3I3L A;  5BNG A;  2DT6 A;  5HDN A;  2V1D A;  1G3W A;  3BP8 A;  2P5L C;  1O3S A;  4Y15 A;  4KYW A;  3HRU A;  4GCV A;  3K4M A;  3ZGK A;  2ZJR F;  1LKX A;  1KYW A;  3P7N A;  1SFK A;  2BW3 B;  4G7O F;  1Y0U A;  4G6T B;  2MLK A;  2GM4 A;  3LSH A;  2LSO A;  1N78 A;  4ENM A;  2ADU A;  5FLM J;  4BXU A;  4XN3 A;  4HNV A;  4ENJ A;  2EZH A;  3J81 K;  1KGS A;  1OR7 C;  3ZMZ A;  4XBF A;  5BOX A;  2V4J C;  3OYJ A;  5E1X A;  4D5C A;  1HW2 A;  4RGU A;  5M3F J;  1XDS A;  2LYC A;  1UHS A;  3CJR B;  3I56 I;  1FX7 A;  5M5W J;  3GO5 A;  4FQG A;  2PQ8 A;  4BUP A;  2Y0S A;  4GGG A;  2HZD A;  4RM2 A;  4X1E A;  5HNH A;  2E1C A;  3S1Q J;  4Q48 A;  4KN7 X;  3LAJ A;  1YE9 A;  4PSW A;  4EM0 B;  2VBX A;  1YYV A;  2GA2 A;  1V3F A;  3FXM A;  4RAZ A;  4CYC A;  1R36 A;  4XNF A;  3E6M A;  2AS5 F;  5F27 A;  3GCM A;  1FBU A;  1QRY A;  2R5Y A;  2R93 J;  3E6B A;  2VE9 A;  4ON0 A;  1ETO A;  2DA4 A;  3J7A O;  4PGG A;  1GV2 A;  4FIS A;  2HOE A;  4YIF A;  3MCZ A;  5TJJ A;  5E3O A;  3DPU A;  3DV8 A;  1HA8 A;  3BG6 A;  1EH7 A;  1VQ6 I;  1JGS A;  2MD0 A;  4XOR A;  2KL4 A;  2M8G X;  3JW4 A;  3M07 A;  3I4M J;  1Q1V A;  1R71 A;  4A3G J;  4Y33 A;  5D8K B;  4HYE A;  1YJN I;  1B8I A;  5IP9 J;  2ID6 A;  3IAS 2;  3F21 A;  1I1S A;  2K85 A;  4CSW A;  3FKJ A;  2PX9 A;  1R9T J;  2ZXW H;  4BJT A;  3TOA A;  2E60 A;  1W0U A;  3NEU A;  4RMN A;  1CGP A;  1YW7 A;  1VQ4 I;  1ZQ3 P;  4KMU X;  5D5U B;  5E18 F;  3IRQ A;  2K9L A;  4C3H J;  1P4A A;  2NS8 A;  1YJ9 I;  4RGX A;  3CF2 A;  4MFD A;  3FK6 A;  2WBM A;  3EUK L;  4KIT B;  5K5O A;  2OCC H;  2KIS A;  2A68 F;  2Q2E B;  1VI0 A;  2LY2 A;  3L2W A;  1FIA A;  3J81 Z;  2OZ6 A;  4XSZ F;  2A5W A;  1EV7 A;  2PMZ N;  2X6W A;  1T98 A;  3HHH A;  4HQE A;  1ZRC A;  5L3F A;  2CFO A;  2VC0 A;  1BBY A;  4IQJ A;  2HR3 A;  1HLV A;  2H1K A;  2VJI A;  3H0G J;  2EFP A;  5IYC J;  2FX0 A;  5B66 C;  3U21 A;  2C6Y A;  1F5T A;  2M30 A;  3PSF A;  3QPS A;  1BW5 A;  2ZME A;  1FTT A;  4EEF G;  4ANJ A;  2V26 A;  1K78 A;  2MGQ A;  5LHG A;  1JHF A;  1BR1 A;  5J4V A;  1XD7 A;  1TBX A;  1MNM C;  2EIL H;  1I6X A;  1WWX A;  1IRG A;  1DPU A;  1WI9 A;  1RET A;  3J7Z I;  3OOU A;  3DWL E;  5DM7 F;  3BT9 A;  3K9T A;  2QLZ A;  3EET A;  4M73 A;  1VQM I;  1D5Y A;  1RI7 A;  5GAG J;  2L5Q A;  2HKX A;  4G12 A;  3G71 I;  2Y30 A;  3I53 A;  2PJR B;  3K1P A;  3EYI A;  4NDL A;  4N0B A;  3O8H A;  4AC0 A;  4MHG A;  1BR4 A;  1VF9 A;  1XGS A;  2VL8 A;  4EMS A;  1J5Y A;  3OYA A;  4YEJ A;  1MSF C;  1BJA A;  2L9V A;  1WPK A;  1VQ8 I;  1M1E B;  3S2D J;  2O3F A;  4RGR A;  3CC4 I;  3B73 A;  1Y6I A;  2WB1 A;  3BRO A;  1EJ9 A;  4DIQ A;  2ISZ A;  1OFC X;  1XC5 A;  2W57 A;  3L7W A;  1HQC A;  2EK5 A;  3BR1 A;  3MWM A;  4KIG A;  2NOJ B;  4CCN A;  2ZJP F;  3FHN A;  3B6C A;  3H5R A;  4A6D A;  3TDU C;  1EH6 A;  3MKL A;  1POG A;  1XPX A;  2F5V A;  2HYJ A;  4P1W A;  4A0Z A;  3E1S A;  1IUY A;  3DU6 A;  3GLX A;  3RZO J;  1RKT A;  3RPU D;  1TL8 A;  4MTE A;  2A61 A;  3WGI A;  5HLT A;  1YFH A;  4XKB A;  3I58 A;  1AWC A;  3LOC A;  1ZG3 A;  3BTC A;  1GT0 C;  1FZP B;  4EJT A;  3H9Q A;  4MGR A;  2HU9 A;  3K2A A;  2NOG A;  3LSG A;  3K1N A;  1K83 J;  4OWR B;  1U8B A;  2WV1 A;  4Y17 A;  2E2I J;  4KIB A;  3REO A;  3A02 A;  1RR8 C;  2WY7 Q;  2Z2S B;  1Y39 A;  5LEK A;  3ZMS A;  2Y0S N;  4BKX A;  2R7O A;  3CO7 C;  3M1E A;  4RB3 C;  2EFW A;  1ZHF A;  2JT1 A;  2OQR A;  1A6I A;  2EA2 A;  1MW7 A;  1MZB A;  3WU1 B;  3HKZ A;  5HLH A;  2Q8K A;  4AU7 A;  3H35 A;  1TTY A;  4W1U A;  2F48 A;  2NNN A;  3CMM A;  3MN2 A;  4XOP A;  3NAU A;  5LGN A;  1MBK A;  1T6S A;  4LK1 F;  1FYK A;  2EFO A;  2KDO A;  4KIC A;  2W00 A;  4GRI A;  2GQQ A;  3ISP A;  3Q9V A;  2BVL A;  3KEY A;  4E70 A;  3PFY A;  4G7Z F;  4XIC A;  2ME0 A;  2HKO A;  4HV6 A;  4HX8 A;  5H20 A;  1Z05 A;  3HOS A;  2Q2E A;  1LEA A;  4IJA A;  3QQA A;  2ELK A;  4CDG A;  2H94 A;  3ZR8 X;  2K9N A;  4L18 B;  3JTH A;  3EYY A;  2VQH A;  3SZG A;  1FBS A;  3F3X A;  2XB0 X;  3Q0V A;  3S2W A;  4MNU A;  1Z3Y A;  2LRE A;  2FQ3 A;  3G3Z A;  4E7I A;  1KU2 A;  3A0H C;  2AXL A;  4IHS A;  3BPV A;  1VQN I;  2QUF A;  3RKQ A;  5C3E J;  4L0Y B;  1HBX G;  1CQT A;  1FJL A;  4DBR A;  3F23 A;  2FXA A;  4CXF A;  4FCY A;  4L9J A;  2Y48 A;  3BQZ A;  2VQG A;  1JKO C;  3W2V A;  1PYV A;  4BY7 J;  2L01 A;  2QBY B;  2Y9Y A;  5LRS A;  3HXL A;  5ERI A;  4I0A A;  5JLW A;  1T8I A;  4RGS A;  4YFN F;  1B59 A;  3T5X A;  5J40 A;  4BHB A;  4LLG F;  5HS9 A;  2V1U A;  3ERE D;  3HZJ A;  3S1M J;  2ME6 A;  3FX3 A;  4XKV A;  3GF2 A;  3D1N I;  1JUP A;  3GTM J;  4XLH A;  2QM3 A;  1LVK A;  1OPC A;  1W0T A;  1Z0X A;  1NG6 A;  2DOE A;  2ISY A;  3AL0 B;  4B48 A;  1H88 C;  4BU2 A;  1P7J A;  5F0C A;  3BY6 A;  3K4N A;  2XRL A;  4EQQ A;  1QGP A;  4N4N B;  5DM6 F;  1D1A A;  4KN4 X;  2JPC A;  3VOD A;  3OIO A;  1ORK A;  2DI3 A;  1SAX A;  3K6G A;  1AU7 A;  2L3D A;  6PAX A;  3FF5 A;  3L9F A;  3L2U A;  1YW9 A;  1KQ9 A;  2L4A A;  4A5N A;  2L7M P;  4ZYD A;  3RZD J;  1FLI A;  1MBJ A;  2VXZ A;  4EJV A;  1TP4 A;  2BXZ A;  1YIO A;  2EIJ H;  3CCM I;  1RUO A;  3CJN A;  4Z6Y A;  3FXL A;  3FIS A;  2XUB A;  3UNG C;  4HBL A;  5TIS C;  1WZ2 A;  3KE2 A;  1UG2 A;  3HOY J;  2FE3 A;  1T08 B;  3WE2 A;  2KDZ A;  2PBI A;  3V4G A;  3FWE A;  5BQT A;  2EFN A;  2L9N A;  2BBY A;  3E3V A;  1F36 A;  3R0J A;  4I99 C;  5DUI A;  2XF6 A;  1HKT A;  1HKQ A;  2FQ4 A;  3CUQ B;  3GW2 A;  3HUG B;  3CTA A;  1R1U A;  2HYF A;  1UCR A;  2CV2 A;  2HZT A;  1OYW A;  1O4X A;  5DCM B;  4E7H A;  2IPQ X;  2YX4 A;  3BR2 A;  3BTJ A;  1XS9 A;  3FMQ A;  5F08 A;  1FOX A;  5FKM A;  1ZH5 A;  4LIT A;  1WHU A;  4IHX A;  4U87 A;  3DEU A;  1YTY A;  4CYD A;  1RC9 A;  3DEE A;  4JP0 A;  2M0C A;  3CF5 F;  3ZN0 A;  3ZN1 A;  4GDF A;  1BA5 A;  4V19 K;  1R7J A;  3DTI A;  1ZR2 A;  2DMQ A;  1OCZ H;  3P9I A;  3OYI A;  4XKC A;  1ITY A;  2XDV A;  1QZY A;  5IOY A;  2HEO A;  1J09 A;  1Y1V J;  2EV5 A;  4M74 A;  4NC6 A;  2VBZ A;  2XV4 S;  1S9H A;  1NK2 P;  3WTV C;  4Y3O A;  2DFF A;  3OV8 A;  5JHU A;  2VI6 A;  4ESJ A;  1A35 A;  3S17 J;  5DS9 A;  1W36 C;  1ETX A;  2E35 A;  1DQU A;  3BZK A;  2V9K A;  2RKH A;  4BJ6 C;  1YS7 A;  4O3M A;  4XLF A;  1T56 A;  3CJT B;  1ULY A;  3PUF A;  5K7Z A;  2OUM A;  2VT3 A;  1Z7U A;  2EIM H;  3IP4 B;  3F8B A;  2VOP A;  2DW4 A;  2OTL I;  4XLA A;  2DA3 A;  2RGV A;  2OPT A;  4MLO A;  1SD5 A;  2FBH A;  1VND A;  1G2H A;  4OIR F;  3HKZ N;  3VB2 A;  3WTU C;  3MKZ A;  4DJA A;  2LDU A;  4QSH A;  4Y4R A;  1ON1 A;  1O3T A;  4YFK F;  2HDC A;  3EUH C;  4EAT A;  1QU3 A;  4XID A;  3FXR A;  2KJB A;  3F9K A;  1U5T C;  2XAH A;  3U1K A;  4D7M A;  5CQE A;  1XN7 A;  2QBY A;  2HDD A;  4G6Q A;  1DDN A;  1O3R A;  2HTJ A;  2N8G A;  5GTH C;  5TRD A;  2FBI A;  2E1M B;  2O8X A;  2QVO A;  3D5S C;  3HOW J;  2F4O B;  3ABU A;  1GXP A;  1LFU P;  2BV6 A;  3BJA A;  1AHD P;  2EQR A;  2ECB A;  3WTS C;  3HOT A;  4BH9 A;  1DP7 P;  1X1D A;  1K6Y A;  2PG4 A;  3M4O J;  2XPU A;  2LFB A;  3BJO A;  3OR2 C;  5IT3 A;  3E6C C;  1JTY A;  1Z77 A;  1FIP A;  1X1C A;  2L7Z A;  4HF1 A;  2DMT A;  3BDD A;  5H6R A;  4BXX J;  2OZU A;  3KP2 A;  3OYM A;  2R7T A;  3BG5 A;  3F8N A;  4IXA A;  4A3M J;  1S72 I;  1XDU A;  3KYC B;  1QQI A;  1XB4 A;  3BR6 A;  3KFW X;  2A07 F;  2PLY A;  2VUM J;  2F4I A;  5E8G A;  3RTR A;  2IW5 A;  3SQN A;  3AG2 H;  4DW6 A;  3FMR A;  4ZH4 F;  3J7A Y;  3S3O A;  5K5Q A;  2R7W A;  3HBL A;  4LOC A;  4HZF A;  2F5D A;  1WH5 A;  1JI8 A;  2BHZ A;  2L54 A;  2WTE A;  2PFB A;  2ZSI B;  3EPZ A;  3VYU B;  3HOZ J;  5LHH A;  3HC7 A;  2B0L A;  5LFA A;  3RYP A;  2F5E A;  5L3C A;  3SXY A;  2CV0 A;  2QEN A;  5KNL A;  1MBE A;  1YX3 A;  4AD9 A;  4MFE A;  2BY1 A;  2LRD A;  5F1J A;  3O6B B;  5D4R A;  2LKX A;  3Q0U A;  3PM1 A;  1P6R A;  3MFK A;  4IF4 A;  2VT2 A;  1K61 A;  3P9K A;  3GTG J;  1XCB A;  2I10 A;  2ZFW A;  3F6V A;  4GO1 A;  1LDJ A;  2HQ5 A;  5CPR B;  2YU9 J;  5DUK A;  3LFU A;  2TRT A;  2KFD A;  2AXT C;  2DA7 A;  4II2 A;  4A6E A;  1ACI A;  4EM1 A;  1ZLJ A;  4XLE A;  1WJC A;  2MC3 A;  4BS9 A;  3PNY A;  2DXI A;  3TP3 A;  3V8L A;  2R92 J;  1T2K A;  2FBK A;  2ZME C;  3CES A;  3QPH A;  5LEJ A;  1ETW A;  2WC2 A;  3ZQF A;  4BE0 A;  3G73 A;  3CCR I;  1CF7 B;  4HLX A; 
#chains in the Genus database with same CATH homology
 4M3G A;  1GV2 A;  4FIS A;  4FTH A;  2ZB9 A;  3QPL A;  2LK2 A;  2Y31 A;  5E3O A;  4XRS G;  5FKO A;  2M8G X;  3OSG A;  3TED A;  3GTK J;  5EGO B;  1TWC J;  2DA6 A;  1Q1V A;  3I4M J;  1IJW C;  4A3G J;  1WH7 A;  1X2N A;  3BG3 A;  1B8I A;  1JJ8 C;  5IP9 J;  2NVY J;  5F0F A;  2K40 A;  2ID6 A;  5M5X J;  1E3O C;  4C3I J;  1R9T J;  5EYR A;  2FJ1 A;  3OSF A;  2JA5 J;  2DA1 A;  1W0U A;  1X2M A;  2AO9 A;  4UUS B;  1H89 C;  5FKL A;  3SFI A;  1ZQ3 P;  5IP7 J;  4A93 J;  3NAR A;  2KT0 A;  1JKQ C;  4C3H J;  2NS8 A;  1NK3 P;  5JLX A;  3CDL A;  2O7O A;  4MFD A;  3FK6 A;  2H8R A;  1WCM J;  3Q3S A;  1BJZ A;  1VI0 A;  1ETQ A;  3ZQI A;  1FIA A;  1GVD A;  3JRH A;  2PMZ N;  2IAI A;  1U78 A;  4B3A A;  2P81 A;  3A03 A;  4Y52 J;  5EZG A;  3E7L A;  1HLV A;  2H1K A;  3H0G J;  5IYC J;  2FX0 A;  3FIW A;  2L9R A;  2LY9 A;  4A3F J;  2E2H J;  3QPS A;  1BW5 A;  4A3C J;  1FTT A;  4EEF G;  1BW6 A;  3H3V K;  3HOU J;  1YRN A;  1IUF A;  2MGQ A;  1IV6 A;  3A01 B;  1S7E A;  2GBY A;  1JGG A;  1MNM C;  1RET A;  3OOU A;  1RES A;  1IC8 A;  3BT9 A;  2M34 A;  2HXO A;  2JA6 J;  1GV5 A;  2XPV A;  1D5Y A;  1JUS A;  3LSJ A;  1QVT A;  4M3E A;  4G12 A;  4QTR A;  2Y30 A;  3BR0 A;  2XGD A;  4NDL A;  3O8H A;  4AC0 A;  1VF9 A;  2LR8 A;  2MSY A;  1OCP A;  1MSF C;  1WPK A;  3MVP A;  1X58 A;  3CQZ J;  3S2D J;  1LE8 B;  3JRA A;  1ETK A;  3Q0W A;  4DYQ A;  1OFC X;  1XC5 A;  5F04 A;  1IDZ A;  1T33 A;  3BR1 A;  1GUU A;  4BBR J;  2NVQ J;  3B6C A;  3S14 J;  4C2M J;  3MKL A;  1POG A;  4JX4 A;  4GFB A;  3JRG A;  2HYJ A;  2VKE A;  4L5E A;  1P7I A;  4A3I J;  1HDD C;  3RZO J;  1RKT A;  4D7N A;  4UUT A;  2OF7 A;  2HXI A;  1JT6 A;  3DEW A;  3LOC A;  3BTC A;  1GT0 C;  2K9S A;  5J1Y A;  3O8G A;  3K2A A;  2NOG A;  3LSG A;  3S16 J;  1K83 J;  3GTP J;  2K9Q A;  2ID3 A;  2EZK A;  1U8B A;  2WV1 A;  5EG0 B;  2E2I J;  3A02 A;  1QVU A;  1MH3 A;  4M6V A;  3TP0 A;  5K7F A;  2CUF A;  2COB A;  3HDD A;  2G0E A;  5GP9 A;  4DZJ A;  5J3L A;  5EGO A;  4IHW A;  2E2J J;  1RKW A;  2Y0S N;  4BKX A;  5FLV A;  2DTZ A;  2CJJ A;  2DMP A;  2NVX J;  2HOT A;  1A6I A;  2XB5 A;  3GTQ J;  1JKP C;  1EF4 A;  2LLK A;  4A3K J;  4W1U A;  3MN2 A;  3NAU A;  1MBK A;  2R5Z B;  3JR9 A;  1ZGW A;  3G1M A;  1I50 J;  2R5Y B;  3F0C A;  5DTD A;  4B4C A;  3WHB A;  2YS9 A;  2JJ7 A;  4XIC A;  2ME0 A;  3LSP A;  4MIM A;  4IHV A;  3BTI A;  1VFC A;  1JTX A;  4V2F A;  3I4N J;  3QQA A;  2ELK A;  3LSR A;  3S15 J;  2K9N A;  4DZP A;  4MO7 A;  3HOV J;  2XB0 X;  3Q0V A;  2R0Q C;  1B72 A;  5FKK A;  2QCO A;  1PUF A;  2EBI A;  3GTO J;  3LNQ A;  2JK3 A;  1HF0 A;  2X6O A;  1MH4 A;  5FKN A;  3RKQ A;  2JMW A;  5HOD A;  5C3E J;  1Y1W J;  2M2E A;  2D5V A;  1GDT A;  1CQT A;  1FJL A;  3A01 A;  4A3B J;  2FD5 A;  4FCY A;  2W48 A;  3BQZ A;  1JKO C;  4BY7 J;  2XGE A;  2HOA A;  2QF7 A;  2IBD A;  4M3B A;  2Y9Y A;  1MBH A;  4XK4 A;  3CCY A;  4Y7N J;  5JLW A;  2NS7 A;  3JRI A;  2CU7 A;  2L0K A;  2RAE A;  3PO2 J;  3S1M J;  3GTJ J;  2ME6 A;  5IPA A;  3D1N I;  1JUP A;  3GTM J;  1IG7 A;  5C44 J;  9ANT A;  4W97 A;  1W0T A;  1Z0X A;  1ZKG A;  3JRD A;  1H88 C;  1LE8 A;  1YRN B;  1P7J A;  4M3F A;  3W6V A;  2X48 A;  1A5J A;  5F0C A;  1TWA J;  1ETY A;  1XG1 A;  2XRL A;  1HCR A;  1OJL A;  1JUM A;  3ZQH A;  1I6H J;  3OIO A;  1ORK A;  2EZI A;  1AU7 A;  1MSE C;  2WAQ N;  1IRZ A;  2L7M P;  3S1R J;  2XGC A;  1QPI A;  1RPW A;  3RZD J;  1SFO J;  1MBJ A;  1FEX A;  3IH2 A;  1BL0 A;  3FIS A;  4M3D A;  2JA7 J;  3HM5 A;  2L7F P;  1UG2 A;  3HOY J;  2KDZ A;  5EG0 A;  3G1O A;  1H8A C;  3WHC A;  1TC3 C;  1F36 A;  3HGG A;  5EEA A;  5EZH A;  4J19 A;  2O9L A;  2VPR A;  4IEJ A;  2FQ4 A;  5J1U A;  1LFB A;  2DMN A;  4FE4 A;  5FJ8 J;  2CUE A;  4XRS A;  1O4X A;  1F43 A;  2GLO A;  1AKH B;  3BR2 A;  2MW8 A;  2X9D A;  3BTJ A;  1XS9 A;  5F08 A;  3VPR A;  5FKM A;  2EZL A;  5EDN A;  3RQI A;  4IHX A;  1U9O A;  3B6A A;  4CYC B;  1IGN A;  4JP0 A;  5IP6 A;  5E3M A;  2MG4 A;  2M0C A;  2R5Z A;  3SJM A;  2DN0 A;  2EH3 A;  4A3L J;  4UUS A;  5C4X J;  1HOM A;  1BA5 A;  3IV5 A;  4ABZ A;  1APL C;  1ZR2 A;  2DMQ A;  4A69 C;  4IHY A;  1I3Q J;  4S0H B;  5IOY A;  1ITY A;  2O8K A;  3ZOB A;  3HOX J;  1Y1V J;  2XPW A;  3JRB A;  2VKV A;  1NK2 P;  2YUS A;  1IDY A;  2VI6 A;  3S17 J;  5DS9 A;  1ETX A;  2AHQ A;  1T56 A;  4BXX J;  2B63 J;  5M3M J;  5K7Z A;  2ECC A;  3FKI J;  2DA3 A;  1WI3 A;  2OPT A;  1B8I B;  4MLO A;  5GPC A;  2R7Z J;  3BR5 A;  1ENH A;  5F0H A;  1VND A;  1G2H A;  2DA2 A;  3HKZ N;  2HOS A;  1SAN A;  3HB9 A;  3TW6 A;  3PO3 J;  4QSH A;  2E19 A;  1ZR4 A;  4A3J J;  3ZQL A;  3L1P A;  4XID A;  2NVT J;  3GBG A;  2LP0 A;  4D7M A;  4QIW N;  5E3L A;  3TW7 A;  5K7H A;  3HGY A;  2HDD A;  2N8G A;  3SDG A;  3GTL J;  3JRC A;  1MBG A;  3BG9 A;  3HOW J;  1ZTR A;  4C3J J;  4I76 A;  2JN6 A;  1LFU P;  2CRG A;  1AHD P;  2EQR A;  1ETV A;  2ECB A;  2Y9Z A;  1B72 B;  5J1R A;  1PUF B;  3BQY A;  3M4O J;  4XRM A;  3HEF A;  2XPU A;  2HI3 A;  5IYD J;  3DCF A;  1ZK8 A;  2LFB A;  1UMQ A;  1OCT C;  3CMY A;  2JWT A;  1U9N A;  2M9H A;  1JTY A;  1Z77 A;  4A3D J;  1FIP A;  2L7Z A;  4JX5 A;  4V2G A;  2DMT A;  4DYR A;  3UKG A;  1TWG J;  5M5Y J;  2IEK A;  5GPA A;  1MBF A;  3ZQC A;  3BG5 A;  4A3M J;  2CQX A;  2LTP A;  1JJ6 C;  2TCT A;  4DYC A;  5BNG A;  4AUX A;  2E1O A;  1WGX A;  3IH3 A;  3BR6 A;  2VUM J;  2DJN A;  3K7A J;  4DW6 A;  3S1N J;  4BY1 J;  3M3Y J;  1NTC A;  1JKR C;  3HBL A;  5C4J J;  4LOC A;  1WH5 A;  2GM4 A;  1FTZ A;  3HOZ J;  3S2H J;  4B1R A;  5FLM J;  2Y2Z A;  4HNV A;  2EZH A;  1TWH J;  2LVS A;  3ZQG A;  3G1L A;  3BTL A;  1RR7 A;  2DMU A;  4FE7 A;  5IYB J;  4D5C A;  4X6A J;  2JA8 J;  4JX6 A;  2LD5 A;  1MBE A;  1TWF J;  3C2B A;  5M3F J;  1DU6 A;  1UHS A;  5M5W J;  4MFE A;  5F1J A;  3FK7 A;  2LKX A;  3Q0U A;  3PM1 A;  4RDU A;  3JRE A;  4I6Z A;  4X1E A;  1DU0 A;  4JYK A;  3S1Q J;  1K61 A;  2WB1 N;  3GTG J;  2I10 A;  1AKH A;  2HQ5 A;  2YU9 J;  4D5F A;  2TRT A;  5IOZ A;  4AYB N;  4CYC A;  2DA7 A;  2XSD C;  3BR3 A;  1JT0 A;  5F27 A;  5E3N A;  4RBO A;  4BBS J;  2DA5 A;  3TP3 A;  2R92 J;  1QRY A;  1ETW A;  3ZQF A;  5EF6 A;  3JRF A;  3IH4 A;  2R5Y A;  2R93 J;  1ETO A;  2CQQ A;  2DA4 A;  1HDP A;  4A3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...