4RDUA

Crystal structure of a distal-less homeobox protein 5 (dlx5) from homo sapiens at 1.85 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
RKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein DLX-5
publication title Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 22
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4rduA01
1BA5A 2Y2ZA 3BR2A 1XG1A 1MBKA 4FE7A 1D5YA 2D5VA 5GP9A 5J1UA 1WI3A 3PO3J 3MN2A 5K7FA 2K9NA 3ZQLA 4BBRJ 2R5ZA 5C4XJ 1HDPA 3S17J 3SJMA 3S16J 5BNGA 1LE8B 4L5EA 3HGYA 4M3GA 1MBEA 3BTLA 1RKTA 4C3JJ 2GM4A 4JX6A 5K7HA 2W48A 3D1NI 5FLVA 2GBYA 1K83J 5FLMJ 2COBA 2EZHA 1H8AC 3GTOJ 1SANA 1TWCJ 2KT0A 2DMTA 3QPLA 1APLC 2HI3A 2ME6A 3ZOBA 1JJ8C 1MSFC 1YRNB 2QF7A 5FKMA 1GT0C 1B72B 3E7LA 2DN0A 5GPAA 3IH4A 5EG0B 1VNDA 2JK3A 2E2HJ 2FX0A 3CDLA 3HEFA 2DTZA 1I50J 2MSYA 4V2FA 5IP6A 1EF4A 4A3LJ 3BR6A 1ETQA 2LD5A 1WH5A 1MBJA 4XRMA 1WH7A 3H3VK 1CQTA 3S2HJ 1RESA 1FJLA 2JA8J 3BG9A 3O8GA 2LVSA 5M5YJ 1RETA 4DZPA 4DYRA 5J3LA 2XPWA 2LP0A 4MO7A 3HDDA 4I6ZA 1TWAJ 2QCOA 1Y1VJ 1IGNA 3TW7A 2X6OA 4FISA 2AHQA 2L7FP 4QTRA 1U9OA 1FIPA 1NK3P 1H88C 3OOUA 2EQRA 3BG3A 2ID3A 3HM5A 5IPAA 4A3DJ 3O8HA 1S7EA 1VF9A 2HXOA 1OFCX 1TC3C 1Q1VA 1OCPA 2YUSA 2I10A 1IJWC 2OPTA 3HOVJ 1TWFJ 5C44J 1QVTA 2R92J 4B4CA 4M3EA 3PO2J 1I6HJ 3WHBA 3FK7A 4GFBA 1HDDC 1ENHA 2NOGA 3ZQGA 3ZQHA 5C4JJ 1VI0A 5F27A 3I4MJ 2Y0SN 1MNMC 3GTMJ 2XPUA 1JT0A 4IHYA 5F08A 1GDTA 2R7ZJ 4A3IJ 4M6VA 1VFCA 2TRTA 4QIWN 2DJNA 2LLKA 4JX5A 1O4XA 1T56A 2K9SA 4A69C 3JRFA 3PM1A 3NARA 4MFDA 5DS9A 4A3EJ 5FKNA 2LFBA 3MVPA 3BG5A 3TP3A 4J19A 2R0QC 2CJJA 3BT9A 1OCTC 1ETKA 1AU7A 3NAUA 5IYCJ 3FISA 4DYQA 3Q0UA 4CYCA 3A01A 1FTTA 5FKOA 4V2GA 5E3NA 3M3YJ 4A93J 3RZDJ 1ETVA 3GTQJ 2E2IJ 2HOTA 1JKPC 2JWTA 1POGA 1Z0XA 4MIMA 4A3JJ 3C2BA 3LNQA 2MGQA 3DCFA 2E1OA 1JTYA 2DA3A 4A3MJ 4BBSJ 3S2DJ 2LR8A 1F43A 4Y52J 1ZR4A 1BJZA 1PUFB 3QQAA 5GPCA 2R5YB 1MBGA 2DA6A 2MG4A 2DA2A 1UHSA 3WHCA 2KDZA 5EYRA 1I3QJ 2HQ5A 3K7AJ 2ZB9A 4X6AJ 1T33A 2L7MP 3FKIJ 5EGOA 1YRNA 2M9HA 2CQQA 1B72A 1P7IA 2DMQA 1JKRC 1IDZA 2WV1A 5EZHA 4UUTA 2LK2A 1WCMJ 1G2HA 4JX4A 2DA4A 3GBGA 2NVQJ 2RAEA 1W0UA 5IOYA 5E3OA 3HOUJ 3I4NJ 2LKXA 3S1RJ 2R5ZB 2ELKA 2EZIA 1BL0A 2PMZN 2IBDA 1AKHB 4LOCA 4AYBN 1ETWA 2EZLA 3G1MA 1ZTRA 3M4OJ 2VPRA 3S14J 4A3KJ 4DW6A 2VUMJ 1MBFA 3HOWJ 2VI6A 2JA7J 2CRGA 2EBIA 1P7JA 1B8IA 4XIDA 3HOZJ 1JTXA 2H8RA 4C3IJ 2G0EA 3G1LA 5IOZA 2O9LA 1OJLA 3ZQFA 3ZQIA 2JJ7A 3DEWA 4Y7NJ 3IV5A 3L1PA 3FIWA 1MH4A 5EZGA 2JA5J 5IYBJ 1TWGJ 4B1RA 3JRDA 1NTCA 2NS7A 1ETXA 1GVDA 3QPSA 1IRZA 2Y31A 3S1NJ 1IV6A 1IG7A 1LFBA 5FJ8J 2IEKA 2AO9A 4D7MA 2FJ1A 3RKQA 4D7NA 1K61A 3SFIA 2NVTJ 2NS8A 3LOCA 3SDGA 1ZQ3P 1IUFA 2L7ZA 2FD5A 1JKQC 2Y9YA 5F04A 3GTGJ 3GTLJ 5M5WJ 2X48A 5HODA 5DTDA 4XICA 2XGDA 4C2MJ 2ECBA 4NDLA 1QPIA 4A3CJ 5F0HA 2ME0A 2HYJA 2XPVA 3G1OA 3TEDA 2M34A 1GV2A 2XGCA 1R9TJ 3CCYA 4M3DA 5FKLA 1W0TA 3S1QJ 1BW5A 5F0FA 2NVYJ 3S1MJ 4A3GJ 2L0KA 3FK6A 1MSEC 2H1KA 4AUXA 3GTKJ 4XRSA 1WPKA 4UUSB 2HDDA 2M2EA 3HGGA 4BY1J 4FCYA 2O7OA 4S0HB 1RR7A 3LSGA 4FE4A 3BQZA 1ORKA 1HOMA 3BR5A 4BY7J 1PUFA 4IHWA 1U78A 2IAIA 1XC5A 2XGEA 3VPRA 1XS9A 5JLXA 2R5YA 2XSDC 5M3MJ 1LE8A 3K2AA 1WGXA 4CYCB 3A01B 1RPWA 2JA6J 5M5XJ 2VKEA 2NVXJ 1FIAA 2HOSA 2E2JJ 2OF7A 4MFEA 2K40A 1HCRA 4A3BJ 2EZKA 4JP0A 3IH2A 1TWHJ 5EG0A 2CU7A 1E3OC 1JGGA 3RQIA 1QRYA 3LSRA 3UKGA 4AC0A 1LFUP 4D5CA 2YU9J 1JT6A 4M3BA 3BR1A 1ZK8A 2DMUA 1AKHA 1MH3A 2M8GX 3IH3A 1SFOJ 5C3EJ 2MW8A 4ABZA 2X9DA 4W97A 1ZR2A 5J1RA 4MLOA 2EH3A 4QSHA 5EGOB 1GUUA 4IHVA 4G12A 4DZJA 1ZGWA 2Y30A 3F0CA 3Q3SA 4HNVA 1UG2A 5EDNA 3TP0A 3TW6A 5IP9J 2WAQN 1X2NA 3BR3A 1IC8A 1MBHA 4I76A 2ID6A 2HOAA 3A02A 1JJ6C 3HOYJ 2XB0X 2R93J 1JUPA 3JRAA 2CQXA 2K9QA 2O8KA 3A03A 2JN6A 2E19A 4A3FJ 2N8GA 1A6IA 2ECCA 3BTCA 2JMWA 3MKLA 1JKOC 2DA7A 5EF6A 1FEXA 4XK4A 3B6AA 1AHDP 1IDYA 4RDUA 1B8IB 3W6VA 5M3FJ 2L9RA 4W1UA 3CMYA 5IYDJ 2LY9A 3HOXJ 2DMPA 1ETYA 5F0CA 1GV5A 3LSPA 1F36A 2XRLA 4C3HJ 2WB1N 4IHXA 3S15J 2CUFA 4X1EA 2DA1A 2DA5A 4IEJA 1UMQA 5E3LA 2TCTA 3Q0VA 3JRBA 4BXXJ 1A5JA 5FKKA 2Y9ZA 3BR0A 1Y1WJ 2YS9A 1DU6A 1HLVA 1RKWA 1NK2P 2P81A 3JRHA 4D5FA 4UUSA 3JRCA 3HKZN 3JREA 2XB5A 4JYKA 5IP7J 1ITYA 3JRGA 2HXIA 1U9NA 3BQYA 3OSFA 1H89C 5E3MA 1BW6A 2CUEA 2VKVA 3HBLA 4XRSG 5F1JA 3RZOJ 3H0GJ 4EEFG 3GTJJ 4FTHA 3GTPJ 2LTPA 5EEAA 1FTZA 4BKXA 5JLWA 3ZQCA 2B63J 1Z77A 3OSGA 9ANTA 1QVUA 2FQ4A 3Q0WA 1ETOA 1DU0A 3BTJA 3CQZJ 1ZKGA 1X58A 5J1YA 3BTIA 3JR9A 3HB9A 4M3FA 1X2MA 3JRIA 1JUMA 3OIOA 2GLOA 1HF0A 4DYCA 2DMNA 3LSJA 4RBOA 1JUSA 2M0CA 5K7ZA 1U8BA 4B3AA 3B6CA
chains in the Genus database with same CATH superfamily
3KEYA 1CGPA 2WC2A 2F5EA 4G7OF 4FE7A 2STTA 2OC6A 2XKOA 2EK5A 2XUBA 3DFGA 4MQ9F 4Q48A 2Y48A 1O3TA 4XNFA 3QWLA 4XLPF 1HDPA 3RYRA 2PN6A 3F6VA 5GADJ 5L3BA 1S7OA 1Z6TA 3OIQA 1JHHA 2CS3A 4M3GA 3OMYA 4JX6A 4BE1A 4XLNF 5TISC 1GHCA 3DTKA 2LYCA 4EV0A 3BWGA 1H8AC 2EZHA 2KT0A 1C0WA 2KJBA 3FF5A 4BDZA 3Q9VA 2QF7A 5FD6A 3E7LA 3V8JA 4OAYA 2DN0A 5GPAA 1V5FA 3IH4A 1VNDA 2A6TA 2J5PA 1T2KA 4ETSA 5CYVA 3FXUA 3K1PA 2LG4A 3R61A 1D3YA 3WTXC 4PCQA 4A3LJ 1R4MB 1ETQA 4XRMA 1WH7A 2EINH 4PJMA 3A1YA 3H3VK 3R6SA 3VSLA 1F5TA 4F91B 3LWFA 1FJLA 2JA8J 3BG9A 1DDNA 5M5YJ 1FSEA 3MQ0A 2QZ8A 5J3LA 2MFZA 2AS5F 3OWTA 4MO7A 5AONA 4I6ZA 1J5YA 2ZMEC 2KIUA 4XM3A 4LB6B 3N97A 4HG2A 1FIPA 5CJ9A 1OQYA 2Q8KA 5HLTA 4F52A 2VONA 4ZJZA 1X1PA 2EQRA 2H6BA 2P4WA 1QZZA 4PSXA 4BQQA 3K4MA 4YFKF 4A3DJ 3JCUC 4FETA 1R5GA 2I10A 2OPTA 3F8NA 3HOVJ 3RJPA 3TDUC 1OPCA 1Z67A 1YX5A 3SEZA 4M3EA 4LFUA 2M4GA 5DD8A 2UZKA 1ENHA 1LPQA 3O6BB 2RV8A 5F27A 3VDXA 4UXNA 2BVMA 2Y0SN 1MNMC 2OTLI 1BI1A 1JT0A 4EQQA 1KU2A 2DFIA 4M6VA 2Z99A 1I39A 4S04A 3SZPA 2L4MA 3F23A 4A0XA 1G3WA 2LLKA 2X1DA 3ERED 2V1DA 1XGNA 1IUYA 1B9NA 4HF0A 5DM7F 3PNTA 2BY2A 1MD0A 3MVPA 3BG5A 5JR3A 5D5VB 4J19A 2K9LA 3J7YJ 1WJEA 1ETKA 3PNYA 2BE5F 2V6EA 1EJ9A 1IN8A 1KQ9A 3FISA 3Q0UA 4N4OB 5DD4A 2LNBA 4V2GA 5E3NA 2JRMA 4KUMA 3RZDJ 4DNCA 2KRHA 4PGHA 1BN5A 3KZIC 4E4HA 4JOMA 2EFNA 4CHUA 1YITI 3P7NA 1JKPC 1F4KA 2VJJA 4U7BA 2FNPA 3RIRA 1A31A 4MIMA 3IKVA 2QQ8A 5ILSA 3OYCA 2X1CA 5IT3A 5ICEA 3ML6A 2PFBA 3E0JB 3ULQB 1K78A 2HOEA 1VQ4I 1DP7P 2OV7A 1VQ7I 1I27A 5E18F 2LOOA 1TQIA 1OR7A 1BJZA 5J8FA 3V7SA 1G8XA 3LFKA 5GPCA 2CV0A 2R5YB 1X1BA 2ZJRF 2MG4A 3KE2A 1PP7U 4KMFA 3CC2I 2HQ5A 2W84A 3AG4H 1T33A 4UVBA 1YRNA 3RKXA 3L2UA 1B72A 3VYUB 2ZXIA 1IZ1A 5EZHA 3HTSB 5ICGA 2MLGA 1MIJA 5IY5H 3ABKH 5F64A 3ZGKA 2VE8A 1J2XA 1EH6A 2RAEA 4OINF 1S6LA 4N9IA 4J00A 2PJRA 5LD2C 1HSJA 1U0JA 3I4NJ 1ZRDA 5KHDA 3BROA 4A2UA 2ELKA 2F5DA 2XVCA 2EZIA 2PMZN 3TL4X 3BLYA 1LNWA 4LOCA 2BXZA 2WV0A 2FE3A 2XAHA 5DM6F 1OMIA 4ZTFA 1Y6IA 2F5FA 3LA7A 3NWTA 2RN7A 5ICCA 5LGUA 3ZPLA 2UV1A 1MBFA 2RQPA 4XSXF 2VI6A 2MD5A 5TRDA 1B8IA 2D45A 1XCVA 2DLLA 1UHMA 4XIDA 5DYMA 1IW7F 2G0EA 4Y15A 3WTYC 2BY3A 2O9LA 4OMYA 5B1AH 4TV7A 3AL0C 2HYGD 1SVLA 5HS8A 3LAJA 2K3PA 4WF2A 1MH4A 2VB6A 4NQWA 1TWGJ 1W7PD 5CQEA 3RKWA 2NS7A 5E1XA 1R1UA 1FY7A 1ETXA 2K9MA 2PMUA 3TBIA 4QWQA 4ON0A 3SFZA 3B02A 4XMYA 2R7WA 2R3SA 1R5HA 2L02A 1IRZA 2LKSA 2Y31A 3JAMK 1IV6A 1N78A 1J7KA 2FA5A 1R22A 1KYWA 4EMSA 2ZJPF 1MJAA 1TW3A 5D8KB 3C3WA 1MMSA 3FXQA 2R7VA 4QLCU 3H5AA 1IUFA 2JUGA 1STZA 2K7LA 2NS0A 4G94A 2Y9YA 3GTGJ 2X48A 1SMTA 4XICA 4MNUA 5DTDA 4C2MJ 5JVTA 1RRJA 2BV6A 4LMYA 1O3QA 4BYYA 4DIQA 1F9NA 4RB3C 5JVGF 4XORA 2R7FA 2L7KA 1R9TJ 3CCYA 4M3DA 1HW2A 2EFPA 2DW4A 3QP5A 4KIFA 4HSRA 3S1QJ 3O2PE 4BHPA 1A35A 4A3GJ 2HZDA 1VQKI 2CFOA 5TJJA 2KPMA 5E1ZB 3VWBA 3PJRA 3E5QA 3CMMA 3TKYA 2JPCA 5KNLA 5H6RA 1G3SA 1LDKB 1P2FA 4HDVA 3V7RA 1LKXA 4RGUA 2V4JC 1ZREA 2O7OA 3T8TA 3KP3A 3GFIA 1ZGJA 3HOSA 4ESBA 3BQZA 2V1NA 2V9VA 5LGTA 2RC4A 2K85A 3CDIA 1FYMA 3HXLA 4IHWA 1PDNC 2HGCA 2DI3A 3EYYA 3CCQI 1SVMA 3GXOA 1V3FA 1YJNI 1IN7A 1J59A 1IRFA 1UZCA 3SEQA 2EA2A 3BZCA 2JA6J 4H0EA 2GIZA 3W3CA 3J81Z 2H1LA 2OQRA 2A69F 3KP5A 2XAUA 3KEOA 4BNCA 2FXAA 3MZYA 2OF7A 4HX8A 3CCEI 2VXDA 4EJTA 2DODA 2ZO4A 1KU3A 1MKMA 2CU7A 2IVMA 4RGSA 1E3OC 1JGGA 1ZH5A 1TQMA 1K78B 4LK1F 2IA2A 4E7HA 2ZMEA 1BIBA 1JT6A 2GXGA 4M3BA 1LFPA 2O8XA 1Q1HA 1ZK8A 4XRFA 1ONVA 2V7FA 3WGIA 4M6XA 3OYMA 5GTIC 3EYIA 1P4WA 1SFOJ 5E20A 4HBLA 1P6RA 1T6SA 1D1CA 3L00A 4PJ0C 5C3EJ 2ZBKA 3DU6A 2Y69H 3GMEA 5FLXK 2DFEA 1LDJA 2DYRH 3KLNA 2XAQA 2VJ5A 2EH3A 1Y8QB 2VQLA 3OOPA 1W7PB 4MLOA 1USSA 3I5UA 3G6EI 2VC1A 2IXSA 1ZGWA 2Y30A 4HNVA 4BUPA 1T39A 1UG2A 2V26A 1D0XA 3IC7A 2FOKA 2IP2A 4I01A 3GX4X 2WAQN 1LVKA 3I9V2 2I8DA 2PJRB 3JSPA 1IC8A 4YG2F 3U21A 4P55A 2K4BA 2YX7A 2X6WA 3M07A 3GZ6A 2XF6A 1YW9A 3DXJF 3VYSB 1JUPA 1WFXA 1QA6A 4CGZA 3R4KA 4KA4A 5HDNA 2VBWA 2O8KA 2ZSHB 3M7GA 2E19A 2OTJI 5ERIA 1W36D 3FXJA 2JMWA 2IGNA 4AIDA 2HQNA 1DUXC 1FEXA 3ZMSA 4CCNA 1R23A 3BP8A 4HAMA 3B6AA 3ZQQA 4HLYA 2HZTA 2KJCA 1B8IB 5IYDJ 4PFPA 2LY9A 2ZFUA 2DMPA 2O3FA 1FBSA 3FMSA 3R0AA 1F36A 2WB1N 4NQWB 4IHXA 3FXKA 1I5ZA 4OIRF 3OYAA 2R7RA 1YQAA 4EM2A 2DPUA 3FXRA 1U6GA 3M1EA 2E1MB 1X3UA 2G9WA 1UELB 2D1VA 2YS9A 4H4KC 3PIOF 2VT3A 3K70C 1BI2A 1K6YA 2RGVA 3BC8A 2XB5A 2KHMA 2P7VB 4E70A 1IN4A 2KLOA 4I98B 1U9NA 3BQYA 4ZH4F 3R60A 5E3MA 3OSFA 3Q5FA 1BW6A 2LDUA 2BY0A 3GWZA 4RA2A 1FZPB 3JTGA 3GTJJ 1FTZA 5A2QK 4NNJA 3CCSI 4CXFA 3S3OA 1A6QA 1B6AA 3ZQCA 2VBXA 4BQOA 2L9NA 3Q0WA 2OZ6A 3BTJA 2VLAA 4GYIA 4R1HA 3TDZC 4KN4X 3I4PA 4RGRA 1UCRA 3H3ZA 3V42A 4CCLA 2ETHA 2GLOA 1LDDA 1IRGA 2Y0MA 2EPFA 2QA4I 2NYXA 3V7CA 5K7ZA 3GLXA 1U8BA 4B3AA 4PJNA 1GVJA 1W1WE 2ZFWA 4JBAA 4U7DA 2QEXI 1Y39A 1XG1A 1MBKA 2QKLB 4I0AA 3CUQC 2KKOA 1WJ5A 1QPMA 4WXHA 3MN2A 1MW7A 2FEZA 4IX7A 4BBRJ 1TTYA 4ZYAA 2AQEA 3SJMA 3S16J 3HG9A 3KPHA 5BNGA 5GAEJ 4AIKA 1XPXA 3DU5A 4E7IA 3J80Z 5DCFA 1YLFA 1SFEA 1YW7A 4GGGA 1SFKA 2MA3A 2KZVA 1YW8A 2GQQA 3BTLA 2PI0A 1RKTA 5K7HA 5BPDA 5FLVA 2R4GA 5KCMA 1S5LC 1UG0A 4M9SA 3ELKA 1TWCJ 1ZG3A 2JSPA 1RNLA 3QPLA 1VQ8I 2ZNYA 3ZOBA 1MSFC 1P92A 2HFHA 1MJ9A 5FKMA 1LEAA 1VQMI 3TOAA 3DKXA 1GXPA 3QU3A 4AM3A 1V5EA 2E2HJ 2O03A 2FX0A 3CDLA 1QZEA 4EM0B 3I58A 2R7DA 5HDGA 4V2FA 2EV5A 1EF4A 2X6XA 3E6BA 4NUBA 3BR6A 2GIVA 1TT5B 3E3VA 3M9AA 3CTAA 3IUOA 3NRVA 2F5CA 2ZXHA 3CDHA 1CQTA 2JVGA 2K4JA 2WBMA 4K2EA 1ZHFA 4BL0B 1HW5A 2JT1A 4DZPA 4OWRB 2LP0A 4Y33A 3L09A 2DAOA 2K5CA 3OYGA 3HDDA 1X4PA 1Y1VJ 4OOIA 3TW7A 1PUEE 3W2VA 1I1GA 4HQEA 2AHQA 1U9OA 3F72A 3GO5A 2DCEA 2W85A 3ZMVA 3KCCA 2A6EF 2WWYA 1OCPA 1WJDA 5BOXA 2NNYA 1IJWC 4XONA 3SZGA 3K4NA 3K4KA 1QVTA 2R92J 5HS9A 4HV5A 3PFIA 3PO2J 5B3SH 1HKSA 3WHBA 5E8GA 3I59A 3ZQHA 2LH9A 2DPDA 1VI0A 4LB5A 2H8WA 2ADUA 1O7FA 3IHUA 2VQHA 1WRJA 2AQFA 4EGZA 3WTUC 4KNYA 4JQFA 3FMQA 4II3A 4LG3A 5L3CA 1R7JA 2OU2A 3COAC 5FFZA 1FYKA 4A69C 3IWZA 3HSFA 4BAYA 4RB1A 5DS9A 1W5SA 1BOBA 2XIGA 5CLSA 2Q0OA 5D5XB 4BH9A 2XF5A 2XC7A 2CV1A 1FNNA 2BXYA 1IRXA 1U2WA 2CJJA 1J75A 2DXIA 1OCTC 4RM3A 4LG0A 4OIPF 3BJOA 3L2VA 4ESFA 1SVOA 3M3YJ 4A93J 3GYHX 3HL2A 2EJRA 2UUZA 2HWVA 4AWXB 5J4YA 1K7AA 2IS6A 3BG6A 2QGUA 3BZ6A 3D5RC 3WTTC 3S32A 1E3HA 4ASNA 5LBQA 5DCMA 3L2WA 4RGXA 2KRFA 4RM2A 2XSJC 4PK4A 3N05A 3DCFA 2EV6A 3IWFA 4G6DA 1VQPI 5IT9Z 1JTYA 2DA3A 2JA2A 4CH7A 3K4CA 4A3MJ 4GDFA 5E17F 2RREA 3HRTA 2RNJA 4HNUA 5JI6A 4I0BA 2D1HA 3QODA 4MEYF 2BYVE 2M3AA 3GCMA 2EB7A 4UHTA 3QQAA 4NC8A 1MMGA 3FBNB 2KQRA 3IAS2 3SDBA 1N75A 1Z05A 2KDZA 2DA2A 1PYVA 2GXBA 4E6KG 2GA2A 1I6XA 3ESWB 3K7AJ 4FQGA 1QHHD 3K6GA 3OL4A 4Y13A 2B7EA 2P8TA 1ZLKA 5EGOA 3ZN0A 2BOLA 2CQQA 2M9HA 2DK5A 5K1YA 1P7IA 1SD6A 2DMQA 5TGTA 1JKRC 3I3LA 4AIHA 2W24A 4KFCA 3GBGA 4Q47A 2NVQJ 4GYGA 3OS0A 2UWMA 5E3OA 4OIQF 2Z2SB 2DJIA 3VB2A 2FOWA 2EFWA 5ED4A 2DK8A 2PLYA 3S3NA 3HZJA 3S1RJ 3AL0B 5J47A 2EFQA 2NAZA 4R79A 2IBDA 2G7UA 1AKHB 1ETWA 1ZTRA 3GZNB 2A3SA 4MHGA 3PIPF 1R5ID 1Y0UA 3PSIA 1SMYF 1VQ5I 2M4KA 3FHZA 1XN7A 1FP1D 4CICA 3PSFA 1FLIA 1OISA 2HVSA 3HRUA 3DPLC 2LF7A 3UR3C 3HOZJ 2YPRA 1EH8A 2VL8A 4C3IJ 5B66C 2QBYA 1USTA 1OJLA 1ZGAA 5GAGJ 5KAIC 2KIMA 5E8IA 2JJ7A 3C2GA 4WXCA 2JA5J 4HF1A 3FIWA 4LJZF 2I5UA 5IYBJ 1YI2I 1NTCA 3C1DA 3ZR8X 2YU3A 3WTWC 4C30A 2BBYA 2A07F 4II2A 2V6CA 5LEKA 4XKWA 1ZLJA 3QPSA 3TOBA 1JI8A 2V1UA 5B5EC 4PFOA 1IG7A 2IEKA 4HYEA 1KU9A 2O6GE 4UUVA 4M73A 3LA2A 3CD6I 1WHUA 1N25A 1RI7A 3CF2A 4M72A 3W2WA 2QQAA 1T38A 4CDGA 2NVTJ 1TNTA 1KQ8A 2R7XA 2CGPA 2L7ZA 1JKQC 5F04A 3CCRI 5M5WJ 2RKHA 1DQUA 2XGDA 3MZ8A 5ILUA 4NDLA 4A3CJ 4RAFA 4UV9A 2COMA 2ME0A 2KMUA 3T0YA 5LRRA 1T8IA 1SD5A 3E6MA 2M34A 3BDDA 1GV2A 3I64A 3CUQA 2EFOA 1XTAA 1TBXA 2A5YB 3WG9A 1S29A 2Z1DA 1BW5A 5F0FA 1YO5C 4OMZA 1TQPA 2L0KA 3I59B 3P9KA 3FK6A 4NC7A 5BS6A 3T8RA 4PGGA 3PUBA 4UUSB 3HGGA 1GLNA 3HC7A 4GO1A 1NH3A 2BW3B 3U2RA 3K1MA 4S0HB 1E3PA 4WXDA 2ZJQF 4ANJA 1Z91A 2PQ8A 1FP2A 1ORKA 3WGHA 3KETA 3MMYB 1HOMA 2G7HA 4KITB 1PUFA 1U78A 2IAIA 1XC5A 2O5RA 2M5WA 5FRMA 2XSDC 3HYIA 4OAZA 5D4SA 1OCOH 1LE8A 3K2AA 1O7LA 1H9TA 3CUOA 3JSOA 2ISZA 2FMLA 2M87A 4I2OA 5D4RA 3MKYB 5M5XJ 3FX3A 4CZZA 2XGXA 2E2JJ 1XSVA 5BPIA 1XSDA 2VOPA 5DCMB 2HYFA 3RKYA 2ZJ2A 1BR1A 1K4TA 4JP0A 1HCRA 3CO6C 1TWHJ 4YFNF 4BGDA 2XHKA 3GUDA 1QRYA 3LSRA 2A68F 2NRAC 4IRHA 2CW7A 3HRSA 4AC0A 4D5CA 2PX9A 2KFDA 2VBYA 4DOZA 2L4AA 3BR1A 2M8GX 2MH2A 2IS1A 2QENA 4F7ZA 5B1BH 4IQJA 3VSKA 1P4XA 3LSIA 2P6SA 2X9DA 4HOBA 3F9KA 4O5VA 4HW0A 4EGYA 3H3UA 3ZP5A 1ZR2A 3BJAA 4B48A 2K3FA 1RUOA 2W1OA 4M9ZA 5EGOB 3D5LA 3RPQA 4Q4ZF 1LUJB 3F0CA 4N9HA 3Q3SA 2CMPA 2VC0A 3TP0A 3D5SC 1IN6A 3JW4A 1WJAA 5AIPA 4ZZLA 1Z9CA 2DT5A 2ZC2A 5H20A 1YJ9I 3IRQA 2ZNZA 3L9FA 2VE9A 4I99C 4I76A 2X85A 2ID6A 4XN0A 2GOXB 2KRCA 1JJ6C 3HOYJ 4AD9A 4BS9A 2ISYA 1VZ0A 2CQXA 1ON1A 4M71A 2JN6A 1A6IA 2Z5UA 2IRFG 3PQKA 5EJCA 1BR2A 1JKOC 3PNVA 2ACJA 2DA7A 1LVAA 1AHDP 4RDUA 2FSWA 2L5QA 3HPHA 3KP4A 3W6VA 3BY6A 2L9RA 3H9JA 4AVPA 1SD4A 2Q2EA 4F55A 2E60A 2GXAA 5F0CA 1R4NB 3ZMDA 1I1SA 2QM3A 4C3HJ 2FU4A 3PUFA 1L0OC 3BCBA 5DUIA 2CG4A 2DFFA 2DA1A 4IEJA 2MC4A 5GTHC 2CW0F 5E3LA 1BC8C 2KISA 2BVLA 2XV4S 3WTVC 1YIJI 1A5JA 3JRBA 3AG1H 1BJAA 2VKDA 4UB8C 5FKKA 4A6EA 5L3FA 5LRSA 3H92A 1PP8F 4B47A 2PG4A 3RQ4A 5KAFC 1QQIA 1NK2P 5H2FC 1H9GA 1ZG1A 3JRHA 4UV8A 3JREA 4DJAA 5IP7J 2BGCA 1TW2A 3JRGA 2PBIA 5FROA 4L18B 2QSHX 4G8XA 3H0DA 3CCVI 2Z3YA 2CV2A 3CCMI 1K79A 3H0GJ 1J9IA 3GTPJ 5EEAA 3ASNH 4HA8A 2F4OB 4L9TA 4XLFA 2VJIA 2F4IA 3FKJA 4RAGA 4BKXA 5JLWA 1VQ9I 2HR3A 2B63J 4KICA 2VQGA 1M1EB 4A5MA 3HOTA 3CQZJ 1U5TC 4HPQA 4U0YA 5D6EA 3CUQB 3E1SA 1YHQI 4I09A 2M7BA 2PMZA 4BJ5C 5ILVA 5J1YA 3I54A 4B8XA 3CJRB 3JR9A 3HB9A 3J7AO 3LSMA 1WWXA 1ZRCA 4NBQA 1TL8A 1XGOA 1X2MA 3QYFA 1ODDA 4LGWA 4IOAF 1JUMA 3OIOA 4LLNA 1HF0A 3I0TA 3WU1B 4DYCA 2JVHA 3LSJA 5HNHA 1REPC 4E7LA 3OYFA 5DV5A 2Y2ZA 1IXRC 2E1NA 1IXCA 3BR2A 1D5YA 3P5JA 2D5VA 3HPGA 5J1UA 3KEQA 5LEJA 3PO3J 4P5OA 3M8JA 4LLLA 4XN3A 2R5ZA 3A4CA 5C4XJ 2FNAA 2IA1A 4WX9A 1LE8B 4P9FA 3CMEI 4QPOA 3LQQA 2MABA 3FM3A 1MBEA 4C3JJ 2W48A 3BOQA 4IKFA 5L3DA 2MLKA 1E2XA 2GBYA 1K83J 3QPHA 2COBA 3GTOJ 1APLC 3KYDB 4LIUA 3OR2C 1YRNB 1B59A 1B72B 3RPUA 1JGSA 1WZ2A 1MDMA 2JK3A 3V8LA 2DTZA 5LFAA 5JHFA 2MSYA 1X1CA 5IP6A 4MEXF 4P1WA 4XKVA 2H09A 3KP7A 2LD5A 1WH5A 2R7SA 1T98A 3OYKA 2X6YA 3CJTB 3HJEA 1EKEA 1HQCA 2AXLA 4P9UA 1G4DA 2ELHA 3O8GA 5ICFA 4PDKA 1VQ6I 2YSRA 2O0YA 3M8EA 1UB9A 1TWAJ 3HUGA 1IGNA 3ABTA 3HSRA 4P96A 4QTRA 4A12A 4WCGA 1MZBA 1H88C 4BEHA 1SAXA 3OOUA 4IVNA 2XKPA 3BG3A 2ID3A 3HM5A 5IPAA 1VF9A 2HXOA 4XSZF 1OFCX 3ZMTA 1TC3C 3R0JA 2IW5A 2YUSA 1BBYA 2AXTC 2ZXWH 5CVVA 1TWFJ 5LHHA 3U9GA 1FT9A 3RSNA 1ON2A 4B4CA 3ZRGA 1XCBA 3FK7A 5DUKA 2XROA 4QPQA 1Z21A 2NOGA 2F48A 3ZQGA 1HW1A 1T0FC 1OYYA 1E0EA 2W57A 4RS8A 2XPUA 4L5IA 5F08A 1WJBA 3SQNA 1GDTA 2H94A 4A3IJ 3GLLA 1FYLA 5CVJA 2LY2A 2DJNA 4HSTA 1QHGA 5KK1A 2Q2EB 1O4XA 4MTEA 4L9NA 3F3XA 2DOAA 3JRFA 4IF4A 1D1BA 3NARA 1J09A 2LFBA 2P5KA 4XOPA 4BQNA 1FBQA 4IZZA 3EUKL 3BT9A 2M0MA 3AKZA 1AU7A 4L9JA 3NAUA 5IYCJ 4DYQA 1FTTA 4CYCA 3A01A 5KVRA 3GFMA 1DGRM 1DGWY 1ETVA 5DDGA 2JWTA 1B1BA 1FC3A 4ESJA 4YFXF 1XB4A 4A3JJ 3C2BA 4MQVA 3LNQA 2MGQA 3KYCB 3G4SI 2E1OA 2WTEA 3F8FA 1YS7A 4OIOF 5J6XA 1F1ZA 2WAQA 3FBIB 3CMAI 4XOTA 4C9YA 2RNGA 4C2TA 3HHGA 2EIJH 4Y52J 2DDAA 1DPUA 2E35A 4IO9F 4XKCA 3CC4I 1MBGA 4KT6A 3WGGA 3MKZA 1UHSA 1YS6A 3FM5A 4LIVA 4DGWB 4GXOA 3ROUA 1FOKA 3EUHC 1LEBA 1I3QJ 5D5WB 3K0LA 2ZB9A 3FKIJ 3OYBA 2WV1A 3QRFF 2QKMB 2LK2A 1WCMJ 1G2HA 2RVCA 1L3LA 2VJ4A 4HNTA 1MMNA 3BCAA 1W0UA 4V19K 1HKQA 2K27A 2WY8Q 2CUZA 3F21A 1AA7A 4CSWA 1Z3XA 2LKXA 1NHAA 2WB1A 2R5ZB 2ZMEB 3RDIA 1BL0A 5D6FA 2DBBA 3DF8A 1VQNI 3B73A 4AYBN 2EZLA 3G1MA 1RIOH 1BOAA 3M4OJ 1TP4A 5FGMA 4ZYDA 4DW6A 2L2OA 3FXMA 2VUMJ 2MH9A 2GA1A 3FHNA 2B9SA 2JA7J 3ISPA 1WSUA 2EBIA 2VODA 3FWEA 2BEOA 1MNDA 5CKTA 1YOVB 5LGNA 1XDUA 2WADA 1G3YA 3G1LA 1HSTA 5IOZA 4RB2C 4HF2A 4Z6YA 5BQTA 1MMDA 3LMMA 1YIOA 4L0YB 3A0BC 3L1PA 2GOMA 4NC6A 1QBJA 1YJWI 4B1RA 3VEPA 3JRDA 4KDPA 1MGTA 3H5RA 2A05A 3K2ZA 2VOOA 4J01A 2W00A 4U87A 1XMXA 3DBHB 2WAEA 3ZCOA 4CCKA 2IS2A 3S1NJ 3DEUA 2OCEA 1LFBA 3E97A 5FJ8J 2J5OA 1KONA 1U5TA 2AO9A 2E71A 2VXZA 3SYTA 4D7MA 4L0ZB 5E1WA 2FJ1A 4D7NA 1XD7A 4GCVA 2R7UA 1K61A 5D8LB 3HUGB 3SFIA 2R7QA 4LLGF 3FMRA 2R7OA 3SDGA 1OCRH 4HLXA 5FO5A 4G9YA 4CCOA 2Z16A 2YX4A 2X51A 1Z7LA 3ABUA 4EJUA 1B4AA 3LA3A 1ZRFA 1QPIA 2ZSIB 5HNFA 4CO8A 2CQNA 4KISA 2HYJA 2JZYA 2OQGA 5HS7A 3LQRA 1RC9A 4BJ6C 3BPXA 3MD2A 5HLIA 1HXDA 4BHCA 4EJWA 5L3EA 5FKLA 1W0TA 1K6OA 2IT0A 3K69A 3S1MJ 3RI4A 2LC2A 1MSEC 3GTKJ 3VYTB 3F8CA 1WPKA 3I53A 2M2EA 3NQOA 4BY1J 4FCYA 1LQ1A 1CF7A 2HS5A 1Y56A 1RR7A 1S72I 4B43A 3LL7A 4A6DA 4FX4A 1HKTA 2HPIA 4F93B 3OYNA 3BR5A 2F4MB 2XASA 4BY7J 3S8PA 1FMVA 4HZFA 2FBKA 2OJED 2ZKZA 2XGEA 3VPRA 1XS9A 3VODA 2QLZA 5JLXA 3EUAA 2Z33A 2R5YA 1WKMA 3WTZA 5M3MJ 1A04A 2V9PA 4HDUA 1WGXA 4CYCB 3A01B 2P5LC 5FLXZ 1FOWA 2HTJA 4ITVA 3T1BA 4CUGA 3OYHA 2L54A 1QU3A 1W5CC 2LRDA 3W6JB 2VKEA 2NVXJ 1FIAA 4KMUX 2ESHA 4MFEA 1QZYA 2A6HF 4ZYHA 4A3BJ 1IO2A 3CZ6A 3WE3A 3P9CA 5EG0A 1JHFA 3RQIA 4FASD 2C6YA 3UKGA 3QP6A 3HHHA 1WJCA 3CO7C 1XX5A 4BHBA 2DMUA 1YYVA 2QUFA 3IH3A 2HQAA 2EWNA 4ABZA 4M6YA 3M1CA 1X4OA 3J81K 3V8KA 1MMAA 1S7AA 1W5TA 5HOOA 5J1RA 4XLAA 4G7ZF 1MNEA 2P0WA 3KZYA 4QSHA 3G2BA 1GUUA 4IHVA 4G12A 1Y0NA 3HKZA 4D0PA 1T0FA 5K5RA 3TW6A 5IP9J 4G6TB 1XGSA 2RQQA 3VOEA 4FT8A 3AG3H 3BR3A 2F2EA 2QVOA 4UVAA 3A0HC 1SC7A 1R36A 1W4MA 3OS1A 4ZTJA 2HOAA 3A02A 2XB0X 2R93J 1XMKA 4NHJA 1ULYA 2KL4A 3A03A 3M8FA 3G71I 1IAWA 4XR6A 3S3MA 2ECCA 2VIXA 3BTCA 4XL9A 3LFUA 1W36C 2CWEA 2EIKH 3DPUA 5JHUA 2XAJA 1IDYA 3NEUA 1OYWA 1YFHA 5M3FJ 3KFWX 4W1UA 2H6CA 3GZ5A 3SXYA 3HOXJ 3MCZA 5A2QZ 3LSPA 1AWCA 1VQLI 3GFLA 2LBFA 4Y17A 3S15J 2CUFA 4X1EA 3VYRB 2DA5A 1FSHA 2CQ7A 2TCTA 3OV8A 3Q0VA 2EV0A 4RAYA 5CVRA 4AIJA 4BXXJ 3K70D 2Y9ZA 3BR0A 1P4AA 3PFYA 2K02A 2W4SA 5CVUA 2DTRA 1BC7C 3F6OA 1HLVA 1U5TB 1EH7A 3CLQA 4D5FA 4IOCF 3JRCA 1D8JA 1SFXA 1X1AA 3ABMH 1ZG5A 2IGKA 1ITYA 1XMAA 2YR2A 2E36A 4I7HA 5HLHA 2DO7A 3EUHA 3QOPA 4ZYGA 1FX7A 1U3EM 1R49A 1H89C 1Z1DA 2GWRA 2VKVA 3HBLA 4XRSG 1O3SA 2P7CB 3RZOJ 3CP2A 2KIQA 2LTPA 2EA4A 3J7ZI 1ACIA 1UJ8A 3OIPA 3CJQB 1ZN2A 2NNNA 4RLQA 3HTUA 3OSGA 1QVUA 4KJZA 2HEOA 1ETOA 1WJFA 1XSXA 1ZKGA 1X1DA 1X58A 4LG0B 2M7AA 5FB2A 4M3FA 2W7NA 3OYIA 4HEA2 1N77A 2V9KA 2LMDA 2JTVA 3QYEA 1BIAA 2KDOA 3BPVA 3QAHA 1UAAA 2K86A 3K4LA 3DV8A 4RBOA 2MC3A 1JUSA 3TO9A 3ZMUA 4KT5C 1CF7B 3B6CA 4FHTA 1RZ4A 1BA5A 4HV6A 3CJNA 1X3WB 5GP9A 1WI3A 5K7FA 2K9NA 1R58A 3L7WA 3ZQLA 1QNTA 2JQ7A 3S17J 4L9VA 4NB5A 4B44A 1NG7A 3VFZA 2L3DA 2F5VA 3IKTA 4L5EA 2EILH 5FFXA 3ZXSA 3HGYA 3GF2A 3MFKA 2GM4A 1SD7A 1W7PA 3D1NI 2V1XA 2L01A 2OUMA 2OA4A 5FLMJ 1SANA 3TO6A 2DMTA 4HQMA 2HI3A 2ME6A 1RR8C 1JJ8C 3K10A 1GT0C 2Y0SA 3TGNA 3ECOA 4Y3OA 4RMNA 4ZDOA 5EG0B 3S93A 2H27A 1KA8A 2ELJA 1NG6A 2L9VA 2PJPA 3KYLA 3HEFA 3HIFA 4C2UA 1I50J 2CSOA 2FUG2 1YTYA 2BHYA 5GAHJ 3PQJA 1P9QC 5LHGA 1WI9A 3I71A 4IXAA 3J80K 3H9QA 2M8EA 4RB0A 1S9HA 2QYOA 4MGRA 1MBJA 2BHZA 2UXNA 1V55H 1WQ2A 2IPQX 4ENNA 3S2HJ 1GXQA 1RESA 2WY7Q 2XAGA 2XF7A 4LD5A 2OBPA 4IRGA 2LVSA 1RETA 2XAFA 4DYRA 2XPWA 1IN5A 4WK8F 2JUCA 1UFMA 3RTRA 1SFUA 1BM9A 3DKWA 2VT2A 2IA0A 2QCOA 3C18A 2X6OA 4YELA 4FISA 2VKHA 2IS4A 4KN7X 2B0LA 3X2QH 2O61A 2L7FP 3MWMA 1NK3P 1KQ0A 2HKOA 4PJJA 2QBYB 2GAUA 3DTIA 1FOXA 1D1AA 2RDPA 4AVZA 5CVIA 3O8HA 1S7EA 3OS2A 1OYIA 3H1CA 5EEGA 2M1BA 1Q1VA 4YIFA 3C2HA 3N4MA 2FBHA 5C44J 4IHTA 1UHWA 4D1QA 1ERDA 3AG2H 1I6HJ 2DOEA 4BXUA 1HC8A 4GFBA 1KZHA 1HDDC 2VBZA 5H6QA 5C4JJ 3I4MJ 2VQCA 4EATA 2QSGX 3OYDA 3GTMJ 1PVEA 1OLTA 4IHYA 2R7ZJ 2TDXA 1G3TA 4JK1X 3MAJA 1VFCA 3H36A 1G59A 2TRTA 4QIWN 2OZUA 4JX5A 1HA8A 3A2KA 1T56A 2EIMH 2K9SA 2PEXA 1OCZH 5DEQA 3PM1A 1A36A 4MFDA 2LBFB 4YEJA 4A3EJ 5FKNA 4Z2YA 4EJVA 4PZJA 3TP3A 2STWA 3IL2A 3E6DA 4BE0A 2R0QC 2VN2A 1G6NA 3D0SA 1V4RA 3U1DA 4MTDA 2PMHA 3TMOA 1JXSA 3TQNA 5LLQA 5FKOA 1VQOI 4RAZA 2CW8A 2MYSA 2CH0A 2M30A 3WODF 5J4VA 4O6JA 3GEZA 3L2QA 3GTQJ 3DEEA 2E2IJ 2HOTA 3PL8A 3MEXA 4ZYEA 3ONQA 1POGA 3HRMA 4BE2A 2E7WA 1Z0XA 5HVQC 4UY8I 2BY1A 2DOFA 3LSTA 3GFJA 4Y4RA 3RYPA 2CUJA 2DYSH 4BBSJ 3FDYA 3UNGC 1E17A 3KP2A 3DTEA 4I02A 2LR8A 2QSFX 3DWLE 3S2DJ 1F43A 1ZR4A 3NWSA 2E1CA 2DFHA 1PUFB 1J0RA 2VPLA 3OYEA 2LF8A 3F8BA 3JTHA 3I56I 2FBIA 4E7ZA 4Q5SF 2DA6A 3F22A 4DBRA 3IP4B 3WHCA 4ENMA 2A61A 4L5JA 2CYYA 1R1TA 5EYRA 2Q1ZB 4X6AJ 2VASA 4IJAA 2L7MP 3ZQ7A 3K1NA 5HDKA 3OYJA 4B3XA 4AU7A 4CZCA 4PJLA 3LAPA 1IDZA 4UUTA 2CO5A 4GRIA 3CCJI 3MZHA 4JX4A 3BZKA 2DA4A 1R00A 3Q9SA 4FX0A 3E6CC 4E7SA 5IT9K 3K4JA 3OR1C 5IOYA 4CA0A 3HOUJ 2IGMA 3QOEA 2NXNB 3H9GA 1XGMA 2IJLA 3DBRB 3SHFA 4KIBA 4ZZDA 3E5XA 3CLOA 1OCCH 2VPRA 5JFRA 3ERMA 3S14J 3CF5F 4CYDA 1D5VA 3REOA 5EEHA 1SEUA 2LKPA 4A3KJ 2NVUB 4ZC3A 2HPMA 3HOWJ 1QO0D 4E7KA 2CRGA 1P7JA 1T08B 3K4BA 4XLCA 4RLFA 4IRIA 3K9TA 5J8CA 1JTXA 2H8RA 3IAM2 3FZVA 2FMYA 3L2RA 3ZQFA 1SAUA 3ZQIA 3DEWA 4Y7NJ 3IV5A 4EVIA 4EJOA 5EZGA 5J40A 3EDPA 4UB6C 1FBUA 4YIIA 3BJ6A 2JPBA 4D9JA 4HX7A 1FPQA 4XBFA 4EM1A 1S3JA 1R71A 1GVDA 2HQRA 3ZMZA 2FRHA 3DBLB 3FXLA 2DT6A 2ZXJA 3IRRA 3OYLA 3RPUD 5CPRB 2OD5A 3KP6A 4IPAA 3J7AY 2BZTA 2HTSA 3RKQA 4A5NA 1D0ZA 2CQKA 4M74A 5D5UB 2NS8A 3KZZA 3LOCA 1ZQ3P 2FD5A 2WA0A 4BDYA 1TT0A 3U1KA 3ZN1A 3GTLJ 2P6TA 3H5NA 1R6RA 5HODA 2ECBA 3WG7H 2HU9A 2W25A 5F0HA 2HDCA 4U88A 3MKWB 5FD5A 1EV7A 2QWWA 2WAFA 3WTSC 2XPVA 3G1OA 1YG2A 3P9IA 3TEDA 1HBXG 1ZAOA 2XGCA 1I3AA 1YX3A 4F92B 2JSCA 3DKYA 3QYBA 4YRVA 4ENJA 2NVYJ 2ZCWA 3OY9A 2HKXA 2H1KA 4AUXA 4XRSA 3EPZA 4BQAA 2OAZA 1IV8A 4DQ2A 1S8NA 1Z6RA 3WE2A 3ABLH 2HDDA 3TO7A 3FXOA 4ZDPA 4U0VA 3CC7I 5HLGA 3LSGA 1K4SA 2DQRA 4IHSA 3O3KA 4FE4A 3T5XA 5L3GA 3DLAA 4PUSA 3F8MA 1Z3YA 4R8HA 4X0GA 4BACA 5K5QA 1OKRA 3BG7A 3HSEA 1U8RA 3KLOA 4ENKA 1RPWA 5E79C 3ASOH 3W6KB 2P5VA 3CCUI 2HDWA 2DDBA 3H35A 2X0LA 3OL3A 2L9SA 4OU0A 3WU0A 6PAXA 1R1VA 2HOSA 1IF1A 1EA3A 4BJTA 1ZYRF 2K40A 3G3ZA 2EZKA 3V4GA 3IH2A 2KZGA 1TLHB 4IQ4A 4XLHA 1MJBA 1ZARA 1LFUP 5CQGA 1V54H 2DQLA 2YU9J 5K5OA 3W2AA 1FOYA 2E34A 1LJ9A 1AKHA 1MH3A 2Z9OA 3EETA 2MW8A 4XQFA 2E5ZA 2M45A 2LSOA 4A0ZA 4W97A 4A0YA 4BU2A 4PSWA 3JAMZ 1IXSB 5AIQA 3WU2C 3CESA 3DP7A 4F3QA 4DZJA 1D0YA 2MBFA 1XDSA 5F6FA 5EDNA 4DBQA 1OR7C 1PJRA 2UXXA 1X2NA 2ESNA 1MDMB 2OCCH 1FWZA 1MBHA 2QQBA 4KYWA 2KIFA 2F6CA 4N4NB 1ZELA 1BI0A 1WVRA 3I55I 3EQLF 3CP8A 1BR4A 4LITA 1DP3A 2LREA 3JRAA 2K9QA 2XDVA 3QU6A 4HX4A 4CCMA 1D8KA 4A3FJ 2N8GA 2XRNA 5FRNA 3MKLA 2D2WA 1TZLA 1KYZA 3AFHA 5EF6A 2LY1A 4BXFA 3CCLI 3DPTA 1LB2A 4XK4A 3DLLF 4LK0F 2HVQA 3CMYA 2CFXA 1ETYA 1YE9A 1RUNA 3GW2A 2X1EA 1GV5A 2XRLA 2A5WA 1H0MA 1Z7UA 4BEHB 3LSKA 2V79A 5LHIA 1O57A 1UMQA 2R7TA 2MD0A 4O3MA 1X3ZB 4N0BA 3L2CA 3DQVC 3GVAA 2E7XA 1KU7A 2E5NA 5BMZA 1Y1WJ 2X4HA 1TNSA 1DU6A 4E7JA 1VTNC 1RKWA 4XLEA 1AOYA 2P81A 4KIGA 2FQ3A 4UUSA 1X19A 1Y8RB 3HKZN 2KP6A 4JYKA 2Y75A 3LSHA 3ECHA 2BW3A 2GZWA 2HXIA 4UVCA 2DT7B 3C7JA 4G6QA 4S05A 2CUEA 5F1JA 3SZTA 4EEFG 5F1RA 4FTHA 3E5UA 2HNHA 3KIOA 4XKBA 3S2WA 4M9XA 4CCJA 1KGSA 1Z77A 2E1MC 2FF4A 3AAFA 2ICWG 4IL6C 2FQ4A 9ANTA 2HVRA 4U0WA 1DU0A 3KX2A 3G73A 1FMWA 2QQ9A 3RCOA 3BTIA 1B9MA 1O3RA 4AYBA 1DPRA 1T95A 1BI3A 4WWCA 4G7HF 3JRIA 4B09A 2DU9A 4UNOA 2DMNA 1V5GA 2JRTA 3QPTA 4YIRX 2W82A 2IGOA 4ZDLA 2M0CA 1JE8A 1QGPA 2NOJB 4HRIA
chains in the Genus database with same CATH topology
1BA5A 2Y2ZA 3BR2A 1XG1A 1MBKA 4FE7A 1D5YA 2D5VA 5GP9A 5J1UA 1WI3A 3PO3J 3MN2A 5K7FA 2K9NA 3ZQLA 4BBRJ 2R5ZA 5C4XJ 1HDPA 3S17J 3SJMA 3S16J 5BNGA 1LE8B 4L5EA 3HGYA 4M3GA 1MBEA 3BTLA 1RKTA 4C3JJ 2GM4A 4JX6A 5K7HA 2W48A 3D1NI 5FLVA 2GBYA 1K83J 5FLMJ 2COBA 2EZHA 1H8AC 3GTOJ 1SANA 1TWCJ 2KT0A 2DMTA 3QPLA 1APLC 2HI3A 2ME6A 3ZOBA 1JJ8C 1MSFC 1YRNB 2QF7A 5FKMA 1GT0C 1B72B 3E7LA 2DN0A 5GPAA 3IH4A 5EG0B 1VNDA 2JK3A 2E2HJ 2FX0A 3CDLA 3HEFA 2DTZA 1I50J 2MSYA 4V2FA 5IP6A 1EF4A 4A3LJ 3BR6A 1ETQA 2LD5A 1WH5A 1MBJA 4XRMA 1WH7A 3H3VK 1CQTA 3S2HJ 1RESA 1FJLA 2JA8J 3BG9A 3O8GA 2LVSA 5M5YJ 1RETA 4DZPA 4DYRA 5J3LA 2XPWA 2LP0A 4MO7A 3HDDA 4I6ZA 1TWAJ 2QCOA 1Y1VJ 1IGNA 3TW7A 2X6OA 4FISA 2AHQA 2L7FP 4QTRA 1U9OA 1FIPA 1NK3P 1H88C 3OOUA 2EQRA 3BG3A 2ID3A 3HM5A 5IPAA 4A3DJ 3O8HA 1S7EA 1VF9A 2HXOA 1OFCX 1TC3C 1Q1VA 1OCPA 2YUSA 2I10A 1IJWC 2OPTA 3HOVJ 1TWFJ 5C44J 1QVTA 2R92J 4B4CA 4M3EA 3PO2J 1I6HJ 3WHBA 3FK7A 4GFBA 1HDDC 1ENHA 2NOGA 3ZQGA 3ZQHA 5C4JJ 1VI0A 5F27A 3I4MJ 2Y0SN 1MNMC 3GTMJ 2XPUA 1JT0A 4IHYA 5F08A 1GDTA 2R7ZJ 4A3IJ 4M6VA 1VFCA 2TRTA 4QIWN 2DJNA 2LLKA 4JX5A 1O4XA 1T56A 2K9SA 4A69C 3JRFA 3PM1A 3NARA 4MFDA 5DS9A 4A3EJ 5FKNA 2LFBA 3MVPA 3BG5A 3TP3A 4J19A 2R0QC 2CJJA 3BT9A 1OCTC 1ETKA 1AU7A 3NAUA 5IYCJ 3FISA 4DYQA 3Q0UA 4CYCA 3A01A 1FTTA 5FKOA 4V2GA 5E3NA 3M3YJ 4A93J 3RZDJ 1ETVA 3GTQJ 2E2IJ 2HOTA 1JKPC 2JWTA 1POGA 1Z0XA 4MIMA 4A3JJ 3C2BA 3LNQA 2MGQA 3DCFA 2E1OA 1JTYA 2DA3A 4A3MJ 4BBSJ 3S2DJ 2LR8A 1F43A 4Y52J 1ZR4A 1BJZA 1PUFB 3QQAA 5GPCA 2R5YB 1MBGA 2DA6A 2MG4A 2DA2A 1UHSA 3WHCA 2KDZA 5EYRA 1I3QJ 2HQ5A 3K7AJ 2ZB9A 4X6AJ 1T33A 2L7MP 3FKIJ 5EGOA 1YRNA 2M9HA 2CQQA 1B72A 1P7IA 2DMQA 1JKRC 1IDZA 2WV1A 5EZHA 4UUTA 2LK2A 1WCMJ 1G2HA 4JX4A 2DA4A 3GBGA 2NVQJ 2RAEA 1W0UA 5IOYA 5E3OA 3HOUJ 3I4NJ 2LKXA 3S1RJ 2R5ZB 2ELKA 2EZIA 1BL0A 2PMZN 2IBDA 1AKHB 4LOCA 4AYBN 1ETWA 2EZLA 3G1MA 1ZTRA 3M4OJ 2VPRA 3S14J 4A3KJ 4DW6A 2VUMJ 1MBFA 3HOWJ 2VI6A 2JA7J 2CRGA 2EBIA 1P7JA 1B8IA 4XIDA 3HOZJ 1JTXA 2H8RA 4C3IJ 2G0EA 3G1LA 5IOZA 2O9LA 1OJLA 3ZQFA 3ZQIA 2JJ7A 3DEWA 4Y7NJ 3IV5A 3L1PA 3FIWA 1MH4A 5EZGA 2JA5J 5IYBJ 1TWGJ 4B1RA 3JRDA 1NTCA 2NS7A 1ETXA 1GVDA 3QPSA 1IRZA 2Y31A 3S1NJ 1IV6A 1IG7A 1LFBA 5FJ8J 2IEKA 2AO9A 4D7MA 2FJ1A 3RKQA 4D7NA 1K61A 3SFIA 2NVTJ 2NS8A 3LOCA 3SDGA 1ZQ3P 1IUFA 2L7ZA 2FD5A 1JKQC 2Y9YA 5F04A 3GTGJ 3GTLJ 5M5WJ 2X48A 5HODA 5DTDA 4XICA 2XGDA 4C2MJ 2ECBA 4NDLA 1QPIA 4A3CJ 5F0HA 2ME0A 2HYJA 2XPVA 3G1OA 3TEDA 2M34A 1GV2A 2XGCA 1R9TJ 3CCYA 4M3DA 5FKLA 1W0TA 3S1QJ 1BW5A 5F0FA 2NVYJ 3S1MJ 4A3GJ 2L0KA 3FK6A 1MSEC 2H1KA 4AUXA 3GTKJ 4XRSA 1WPKA 4UUSB 2HDDA 2M2EA 3HGGA 4BY1J 4FCYA 2O7OA 4S0HB 1RR7A 3LSGA 4FE4A 3BQZA 1ORKA 1HOMA 3BR5A 4BY7J 1PUFA 4IHWA 1U78A 2IAIA 1XC5A 2XGEA 3VPRA 1XS9A 5JLXA 2R5YA 2XSDC 5M3MJ 1LE8A 3K2AA 1WGXA 4CYCB 3A01B 1RPWA 2JA6J 5M5XJ 2VKEA 2NVXJ 1FIAA 2HOSA 2E2JJ 2OF7A 4MFEA 2K40A 1HCRA 4A3BJ 2EZKA 4JP0A 3IH2A 1TWHJ 5EG0A 2CU7A 1E3OC 1JGGA 3RQIA 1QRYA 3LSRA 3UKGA 4AC0A 1LFUP 4D5CA 2YU9J 1JT6A 4M3BA 3BR1A 1ZK8A 2DMUA 1AKHA 1MH3A 2M8GX 3IH3A 1SFOJ 5C3EJ 2MW8A 4ABZA 2X9DA 4W97A 1ZR2A 5J1RA 4MLOA 2EH3A 4QSHA 5EGOB 1GUUA 4IHVA 4G12A 4DZJA 1ZGWA 2Y30A 3F0CA 3Q3SA 4HNVA 1UG2A 5EDNA 3TP0A 3TW6A 5IP9J 2WAQN 1X2NA 3BR3A 1IC8A 1MBHA 4I76A 2ID6A 2HOAA 3A02A 1JJ6C 3HOYJ 2XB0X 2R93J 1JUPA 3JRAA 2CQXA 2K9QA 2O8KA 3A03A 2JN6A 2E19A 4A3FJ 2N8GA 1A6IA 2ECCA 3BTCA 2JMWA 3MKLA 1JKOC 2DA7A 5EF6A 1FEXA 4XK4A 3B6AA 1AHDP 1IDYA 4RDUA 1B8IB 3W6VA 5M3FJ 2L9RA 4W1UA 3CMYA 5IYDJ 2LY9A 3HOXJ 2DMPA 1ETYA 5F0CA 1GV5A 3LSPA 1F36A 2XRLA 4C3HJ 2WB1N 4IHXA 3S15J 2CUFA 4X1EA 2DA1A 2DA5A 4IEJA 1UMQA 5E3LA 2TCTA 3Q0VA 3JRBA 4BXXJ 1A5JA 5FKKA 2Y9ZA 3BR0A 1Y1WJ 2YS9A 1DU6A 1HLVA 1RKWA 1NK2P 2P81A 3JRHA 4D5FA 4UUSA 3JRCA 3HKZN 3JREA 2XB5A 4JYKA 5IP7J 1ITYA 3JRGA 2HXIA 1U9NA 3BQYA 3OSFA 1H89C 5E3MA 1BW6A 2CUEA 2VKVA 3HBLA 4XRSG 5F1JA 3RZOJ 3H0GJ 4EEFG 3GTJJ 4FTHA 3GTPJ 2LTPA 5EEAA 1FTZA 4BKXA 5JLWA 3ZQCA 2B63J 1Z77A 3OSGA 9ANTA 1QVUA 2FQ4A 3Q0WA 1ETOA 1DU0A 3BTJA 3CQZJ 1ZKGA 1X58A 5J1YA 3BTIA 3JR9A 3HB9A 4M3FA 1X2MA 3JRIA 1JUMA 3OIOA 2GLOA 1HF0A 4DYCA 2DMNA 3LSJA 4RBOA 1JUSA 2M0CA 5K7ZA 1U8BA 4B3AA 3B6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BA5 A;  2Y2Z A;  3BR2 A;  1XG1 A;  1MBK A;  4FE7 A;  1D5Y A;  2D5V A;  5GP9 A;  5J1U A;  1WI3 A;  3PO3 J;  3MN2 A;  5K7F A;  2K9N A;  3ZQL A;  4BBR J;  2R5Z A;  5C4X J;  1HDP A;  3S17 J;  3SJM A;  3S16 J;  5BNG A;  1LE8 B;  4L5E A;  3HGY A;  4M3G A;  1MBE A;  3BTL A;  1RKT A;  4C3J J;  2GM4 A;  4JX6 A;  5K7H A;  2W48 A;  3D1N I;  5FLV A;  2GBY A;  1K83 J;  5FLM J;  2COB A;  2EZH A;  1H8A C;  3GTO J;  1SAN A;  1TWC J;  2KT0 A;  2DMT A;  3QPL A;  1APL C;  2HI3 A;  2ME6 A;  3ZOB A;  1JJ8 C;  1MSF C;  1YRN B;  2QF7 A;  5FKM A;  1GT0 C;  1B72 B;  3E7L A;  2DN0 A;  5GPA A;  3IH4 A;  5EG0 B;  1VND A;  2JK3 A;  2E2H J;  2FX0 A;  3CDL A;  3HEF A;  2DTZ A;  1I50 J;  2MSY A;  4V2F A;  5IP6 A;  1EF4 A;  4A3L J;  3BR6 A;  1ETQ A;  2LD5 A;  1WH5 A;  1MBJ A;  4XRM A;  1WH7 A;  3H3V K;  1CQT A;  3S2H J;  1RES A;  1FJL A;  2JA8 J;  3BG9 A;  3O8G A;  2LVS A;  5M5Y J;  1RET A;  4DZP A;  4DYR A;  5J3L A;  2XPW A;  2LP0 A;  4MO7 A;  3HDD A;  4I6Z A;  1TWA J;  2QCO A;  1Y1V J;  1IGN A;  3TW7 A;  2X6O A;  4FIS A;  2AHQ A;  2L7F P;  4QTR A;  1U9O A;  1FIP A;  1NK3 P;  1H88 C;  3OOU A;  2EQR A;  3BG3 A;  2ID3 A;  3HM5 A;  5IPA A;  4A3D J;  3O8H A;  1S7E A;  1VF9 A;  2HXO A;  1OFC X;  1TC3 C;  1Q1V A;  1OCP A;  2YUS A;  2I10 A;  1IJW C;  2OPT A;  3HOV J;  1TWF J;  5C44 J;  1QVT A;  2R92 J;  4B4C A;  4M3E A;  3PO2 J;  1I6H J;  3WHB A;  3FK7 A;  4GFB A;  1HDD C;  1ENH A;  2NOG A;  3ZQG A;  3ZQH A;  5C4J J;  1VI0 A;  5F27 A;  3I4M J;  2Y0S N;  1MNM C;  3GTM J;  2XPU A;  1JT0 A;  4IHY A;  5F08 A;  1GDT A;  2R7Z J;  4A3I J;  4M6V A;  1VFC A;  2TRT A;  4QIW N;  2DJN A;  2LLK A;  4JX5 A;  1O4X A;  1T56 A;  2K9S A;  4A69 C;  3JRF A;  3PM1 A;  3NAR A;  4MFD A;  5DS9 A;  4A3E J;  5FKN A;  2LFB A;  3MVP A;  3BG5 A;  3TP3 A;  4J19 A;  2R0Q C;  2CJJ A;  3BT9 A;  1OCT C;  1ETK A;  1AU7 A;  3NAU A;  5IYC J;  3FIS A;  4DYQ A;  3Q0U A;  4CYC A;  3A01 A;  1FTT A;  5FKO A;  4V2G A;  5E3N A;  3M3Y J;  4A93 J;  3RZD J;  1ETV A;  3GTQ J;  2E2I J;  2HOT A;  1JKP C;  2JWT A;  1POG A;  1Z0X A;  4MIM A;  4A3J J;  3C2B A;  3LNQ A;  2MGQ A;  3DCF A;  2E1O A;  1JTY A;  2DA3 A;  4A3M J;  4BBS J;  3S2D J;  2LR8 A;  1F43 A;  4Y52 J;  1ZR4 A;  1BJZ A;  1PUF B;  3QQA A;  5GPC A;  2R5Y B;  1MBG A;  2DA6 A;  2MG4 A;  2DA2 A;  1UHS A;  3WHC A;  2KDZ A;  5EYR A;  1I3Q J;  2HQ5 A;  3K7A J;  2ZB9 A;  4X6A J;  1T33 A;  2L7M P;  3FKI J;  5EGO A;  1YRN A;  2M9H A;  2CQQ A;  1B72 A;  1P7I A;  2DMQ A;  1JKR C;  1IDZ A;  2WV1 A;  5EZH A;  4UUT A;  2LK2 A;  1WCM J;  1G2H A;  4JX4 A;  2DA4 A;  3GBG A;  2NVQ J;  2RAE A;  1W0U A;  5IOY A;  5E3O A;  3HOU J;  3I4N J;  2LKX A;  3S1R J;  2R5Z B;  2ELK A;  2EZI A;  1BL0 A;  2PMZ N;  2IBD A;  1AKH B;  4LOC A;  4AYB N;  1ETW A;  2EZL A;  3G1M A;  1ZTR A;  3M4O J;  2VPR A;  3S14 J;  4A3K J;  4DW6 A;  2VUM J;  1MBF A;  3HOW J;  2VI6 A;  2JA7 J;  2CRG A;  2EBI A;  1P7J A;  1B8I A;  4XID A;  3HOZ J;  1JTX A;  2H8R A;  4C3I J;  2G0E A;  3G1L A;  5IOZ A;  2O9L A;  1OJL A;  3ZQF A;  3ZQI A;  2JJ7 A;  3DEW A;  4Y7N J;  3IV5 A;  3L1P A;  3FIW A;  1MH4 A;  5EZG A;  2JA5 J;  5IYB J;  1TWG J;  4B1R A;  3JRD A;  1NTC A;  2NS7 A;  1ETX A;  1GVD A;  3QPS A;  1IRZ A;  2Y31 A;  3S1N J;  1IV6 A;  1IG7 A;  1LFB A;  5FJ8 J;  2IEK A;  2AO9 A;  4D7M A;  2FJ1 A;  3RKQ A;  4D7N A;  1K61 A;  3SFI A;  2NVT J;  2NS8 A;  3LOC A;  3SDG A;  1ZQ3 P;  1IUF A;  2L7Z A;  2FD5 A;  1JKQ C;  2Y9Y A;  5F04 A;  3GTG J;  3GTL J;  5M5W J;  2X48 A;  5HOD A;  5DTD A;  4XIC A;  2XGD A;  4C2M J;  2ECB A;  4NDL A;  1QPI A;  4A3C J;  5F0H A;  2ME0 A;  2HYJ A;  2XPV A;  3G1O A;  3TED A;  2M34 A;  1GV2 A;  2XGC A;  1R9T J;  3CCY A;  4M3D A;  5FKL A;  1W0T A;  3S1Q J;  1BW5 A;  5F0F A;  2NVY J;  3S1M J;  4A3G J;  2L0K A;  3FK6 A;  1MSE C;  2H1K A;  4AUX A;  3GTK J;  4XRS A;  1WPK A;  4UUS B;  2HDD A;  2M2E A;  3HGG A;  4BY1 J;  4FCY A;  2O7O A;  4S0H B;  1RR7 A;  3LSG A;  4FE4 A;  3BQZ A;  1ORK A;  1HOM A;  3BR5 A;  4BY7 J;  1PUF A;  4IHW A;  1U78 A;  2IAI A;  1XC5 A;  2XGE A;  3VPR A;  1XS9 A;  5JLX A;  2R5Y A;  2XSD C;  5M3M J;  1LE8 A;  3K2A A;  1WGX A;  4CYC B;  3A01 B;  1RPW A;  2JA6 J;  5M5X J;  2VKE A;  2NVX J;  1FIA A;  2HOS A;  2E2J J;  2OF7 A;  4MFE A;  2K40 A;  1HCR A;  4A3B J;  2EZK A;  4JP0 A;  3IH2 A;  1TWH J;  5EG0 A;  2CU7 A;  1E3O C;  1JGG A;  3RQI A;  1QRY A;  3LSR A;  3UKG A;  4AC0 A;  1LFU P;  4D5C A;  2YU9 J;  1JT6 A;  4M3B A;  3BR1 A;  1ZK8 A;  2DMU A;  1AKH A;  1MH3 A;  2M8G X;  3IH3 A;  1SFO J;  5C3E J;  2MW8 A;  4ABZ A;  2X9D A;  4W97 A;  1ZR2 A;  5J1R A;  4MLO A;  2EH3 A;  4QSH A;  5EGO B;  1GUU A;  4IHV A;  4G12 A;  4DZJ A;  1ZGW A;  2Y30 A;  3F0C A;  3Q3S A;  4HNV A;  1UG2 A;  5EDN A;  3TP0 A;  3TW6 A;  5IP9 J;  2WAQ N;  1X2N A;  3BR3 A;  1IC8 A;  1MBH A;  4I76 A;  2ID6 A;  2HOA A;  3A02 A;  1JJ6 C;  3HOY J;  2XB0 X;  2R93 J;  1JUP A;  3JRA A;  2CQX A;  2K9Q A;  2O8K A;  3A03 A;  2JN6 A;  2E19 A;  4A3F J;  2N8G A;  1A6I A;  2ECC A;  3BTC A;  2JMW A;  3MKL A;  1JKO C;  2DA7 A;  5EF6 A;  1FEX A;  4XK4 A;  3B6A A;  1AHD P;  1IDY A;  4RDU A;  1B8I B;  3W6V A;  5M3F J;  2L9R A;  4W1U A;  3CMY A;  5IYD J;  2LY9 A;  3HOX J;  2DMP A;  1ETY A;  5F0C A;  1GV5 A;  3LSP A;  1F36 A;  2XRL A;  4C3H J;  2WB1 N;  4IHX A;  3S15 J;  2CUF A;  4X1E A;  2DA1 A;  2DA5 A;  4IEJ A;  1UMQ A;  5E3L A;  2TCT A;  3Q0V A;  3JRB A;  4BXX J;  1A5J A;  5FKK A;  2Y9Z A;  3BR0 A;  1Y1W J;  2YS9 A;  1DU6 A;  1HLV A;  1RKW A;  1NK2 P;  2P81 A;  3JRH A;  4D5F A;  4UUS A;  3JRC A;  3HKZ N;  3JRE A;  2XB5 A;  4JYK A;  5IP7 J;  1ITY A;  3JRG A;  2HXI A;  1U9N A;  3BQY A;  3OSF A;  1H89 C;  5E3M A;  1BW6 A;  2CUE A;  2VKV A;  3HBL A;  4XRS G;  5F1J A;  3RZO J;  3H0G J;  4EEF G;  3GTJ J;  4FTH A;  3GTP J;  2LTP A;  5EEA A;  1FTZ A;  4BKX A;  5JLW A;  3ZQC A;  2B63 J;  1Z77 A;  3OSG A;  9ANT A;  1QVU A;  2FQ4 A;  3Q0W A;  1ETO A;  1DU0 A;  3BTJ A;  3CQZ J;  1ZKG A;  1X58 A;  5J1Y A;  3BTI A;  3JR9 A;  3HB9 A;  4M3F A;  1X2M A;  3JRI A;  1JUM A;  3OIO A;  2GLO A;  1HF0 A;  4DYC A;  2DMN A;  3LSJ A;  4RBO A;  1JUS A;  2M0C A;  5K7Z A;  1U8B A;  4B3A A;  3B6C A; 
#chains in the Genus database with same CATH topology
 3KEY A;  1CGP A;  2WC2 A;  2F5E A;  4G7O F;  4FE7 A;  2STT A;  2OC6 A;  2XKO A;  2EK5 A;  2XUB A;  3DFG A;  4MQ9 F;  4Q48 A;  2Y48 A;  1O3T A;  4XNF A;  3QWL A;  4XLP F;  1HDP A;  3RYR A;  2PN6 A;  3F6V A;  5GAD J;  5L3B A;  1S7O A;  1Z6T A;  3OIQ A;  1JHH A;  2CS3 A;  4M3G A;  3OMY A;  4JX6 A;  4BE1 A;  4XLN F;  5TIS C;  1GHC A;  3DTK A;  2LYC A;  4EV0 A;  3BWG A;  1H8A C;  2EZH A;  2KT0 A;  1C0W A;  2KJB A;  3FF5 A;  4BDZ A;  3Q9V A;  2QF7 A;  5FD6 A;  3E7L A;  3V8J A;  4OAY A;  2DN0 A;  5GPA A;  1V5F A;  3IH4 A;  1VND A;  2A6T A;  2J5P A;  1T2K A;  4ETS A;  5CYV A;  3FXU A;  3K1P A;  2LG4 A;  3R61 A;  1D3Y A;  3WTX C;  4PCQ A;  4A3L J;  1R4M B;  1ETQ A;  4XRM A;  1WH7 A;  2EIN H;  4PJM A;  3A1Y A;  3H3V K;  3R6S A;  3VSL A;  1F5T A;  4F91 B;  3LWF A;  1FJL A;  2JA8 J;  3BG9 A;  1DDN A;  5M5Y J;  1FSE A;  3MQ0 A;  2QZ8 A;  5J3L A;  2MFZ A;  2AS5 F;  3OWT A;  4MO7 A;  5AON A;  4I6Z A;  1J5Y A;  2ZME C;  2KIU A;  4XM3 A;  4LB6 B;  3N97 A;  4HG2 A;  1FIP A;  5CJ9 A;  1OQY A;  2Q8K A;  5HLT A;  4F52 A;  2VON A;  4ZJZ A;  1X1P A;  2EQR A;  2H6B A;  2P4W A;  1QZZ A;  4PSX A;  4BQQ A;  3K4M A;  4YFK F;  4A3D J;  3JCU C;  4FET A;  1R5G A;  2I10 A;  2OPT A;  3F8N A;  3HOV J;  3RJP A;  3TDU C;  1OPC A;  1Z67 A;  1YX5 A;  3SEZ A;  4M3E A;  4LFU A;  2M4G A;  5DD8 A;  2UZK A;  1ENH A;  1LPQ A;  3O6B B;  2RV8 A;  5F27 A;  3VDX A;  4UXN A;  2BVM A;  2Y0S N;  1MNM C;  2OTL I;  1BI1 A;  1JT0 A;  4EQQ A;  1KU2 A;  2DFI A;  4M6V A;  2Z99 A;  1I39 A;  4S04 A;  3SZP A;  2L4M A;  3F23 A;  4A0X A;  1G3W A;  2LLK A;  2X1D A;  3ERE D;  2V1D A;  1XGN A;  1IUY A;  1B9N A;  4HF0 A;  5DM7 F;  3PNT A;  2BY2 A;  1MD0 A;  3MVP A;  3BG5 A;  5JR3 A;  5D5V B;  4J19 A;  2K9L A;  3J7Y J;  1WJE A;  1ETK A;  3PNY A;  2BE5 F;  2V6E A;  1EJ9 A;  1IN8 A;  1KQ9 A;  3FIS A;  3Q0U A;  4N4O B;  5DD4 A;  2LNB A;  4V2G A;  5E3N A;  2JRM A;  4KUM A;  3RZD J;  4DNC A;  2KRH A;  4PGH A;  1BN5 A;  3KZI C;  4E4H A;  4JOM A;  2EFN A;  4CHU A;  1YIT I;  3P7N A;  1JKP C;  1F4K A;  2VJJ A;  4U7B A;  2FNP A;  3RIR A;  1A31 A;  4MIM A;  3IKV A;  2QQ8 A;  5ILS A;  3OYC A;  2X1C A;  5IT3 A;  5ICE A;  3ML6 A;  2PFB A;  3E0J B;  3ULQ B;  1K78 A;  2HOE A;  1VQ4 I;  1DP7 P;  2OV7 A;  1VQ7 I;  1I27 A;  5E18 F;  2LOO A;  1TQI A;  1OR7 A;  1BJZ A;  5J8F A;  3V7S A;  1G8X A;  3LFK A;  5GPC A;  2CV0 A;  2R5Y B;  1X1B A;  2ZJR F;  2MG4 A;  3KE2 A;  1PP7 U;  4KMF A;  3CC2 I;  2HQ5 A;  2W84 A;  3AG4 H;  1T33 A;  4UVB A;  1YRN A;  3RKX A;  3L2U A;  1B72 A;  3VYU B;  2ZXI A;  1IZ1 A;  5EZH A;  3HTS B;  5ICG A;  2MLG A;  1MIJ A;  5IY5 H;  3ABK H;  5F64 A;  3ZGK A;  2VE8 A;  1J2X A;  1EH6 A;  2RAE A;  4OIN F;  1S6L A;  4N9I A;  4J00 A;  2PJR A;  5LD2 C;  1HSJ A;  1U0J A;  3I4N J;  1ZRD A;  5KHD A;  3BRO A;  4A2U A;  2ELK A;  2F5D A;  2XVC A;  2EZI A;  2PMZ N;  3TL4 X;  3BLY A;  1LNW A;  4LOC A;  2BXZ A;  2WV0 A;  2FE3 A;  2XAH A;  5DM6 F;  1OMI A;  4ZTF A;  1Y6I A;  2F5F A;  3LA7 A;  3NWT A;  2RN7 A;  5ICC A;  5LGU A;  3ZPL A;  2UV1 A;  1MBF A;  2RQP A;  4XSX F;  2VI6 A;  2MD5 A;  5TRD A;  1B8I A;  2D45 A;  1XCV A;  2DLL A;  1UHM A;  4XID A;  5DYM A;  1IW7 F;  2G0E A;  4Y15 A;  3WTY C;  2BY3 A;  2O9L A;  4OMY A;  5B1A H;  4TV7 A;  3AL0 C;  2HYG D;  1SVL A;  5HS8 A;  3LAJ A;  2K3P A;  4WF2 A;  1MH4 A;  2VB6 A;  4NQW A;  1TWG J;  1W7P D;  5CQE A;  3RKW A;  2NS7 A;  5E1X A;  1R1U A;  1FY7 A;  1ETX A;  2K9M A;  2PMU A;  3TBI A;  4QWQ A;  4ON0 A;  3SFZ A;  3B02 A;  4XMY A;  2R7W A;  2R3S A;  1R5H A;  2L02 A;  1IRZ A;  2LKS A;  2Y31 A;  3JAM K;  1IV6 A;  1N78 A;  1J7K A;  2FA5 A;  1R22 A;  1KYW A;  4EMS A;  2ZJP F;  1MJA A;  1TW3 A;  5D8K B;  3C3W A;  1MMS A;  3FXQ A;  2R7V A;  4QLC U;  3H5A A;  1IUF A;  2JUG A;  1STZ A;  2K7L A;  2NS0 A;  4G94 A;  2Y9Y A;  3GTG J;  2X48 A;  1SMT A;  4XIC A;  4MNU A;  5DTD A;  4C2M J;  5JVT A;  1RRJ A;  2BV6 A;  4LMY A;  1O3Q A;  4BYY A;  4DIQ A;  1F9N A;  4RB3 C;  5JVG F;  4XOR A;  2R7F A;  2L7K A;  1R9T J;  3CCY A;  4M3D A;  1HW2 A;  2EFP A;  2DW4 A;  3QP5 A;  4KIF A;  4HSR A;  3S1Q J;  3O2P E;  4BHP A;  1A35 A;  4A3G J;  2HZD A;  1VQK I;  2CFO A;  5TJJ A;  2KPM A;  5E1Z B;  3VWB A;  3PJR A;  3E5Q A;  3CMM A;  3TKY A;  2JPC A;  5KNL A;  5H6R A;  1G3S A;  1LDK B;  1P2F A;  4HDV A;  3V7R A;  1LKX A;  4RGU A;  2V4J C;  1ZRE A;  2O7O A;  3T8T A;  3KP3 A;  3GFI A;  1ZGJ A;  3HOS A;  4ESB A;  3BQZ A;  2V1N A;  2V9V A;  5LGT A;  2RC4 A;  2K85 A;  3CDI A;  1FYM A;  3HXL A;  4IHW A;  1PDN C;  2HGC A;  2DI3 A;  3EYY A;  3CCQ I;  1SVM A;  3GXO A;  1V3F A;  1YJN I;  1IN7 A;  1J59 A;  1IRF A;  1UZC A;  3SEQ A;  2EA2 A;  3BZC A;  2JA6 J;  4H0E A;  2GIZ A;  3W3C A;  3J81 Z;  2H1L A;  2OQR A;  2A69 F;  3KP5 A;  2XAU A;  3KEO A;  4BNC A;  2FXA A;  3MZY A;  2OF7 A;  4HX8 A;  3CCE I;  2VXD A;  4EJT A;  2DOD A;  2ZO4 A;  1KU3 A;  1MKM A;  2CU7 A;  2IVM A;  4RGS A;  1E3O C;  1JGG A;  1ZH5 A;  1TQM A;  1K78 B;  4LK1 F;  2IA2 A;  4E7H A;  2ZME A;  1BIB A;  1JT6 A;  2GXG A;  4M3B A;  1LFP A;  2O8X A;  1Q1H A;  1ZK8 A;  4XRF A;  1ONV A;  2V7F A;  3WGI A;  4M6X A;  3OYM A;  5GTI C;  3EYI A;  1P4W A;  1SFO J;  5E20 A;  4HBL A;  1P6R A;  1T6S A;  1D1C A;  3L00 A;  4PJ0 C;  5C3E J;  2ZBK A;  3DU6 A;  2Y69 H;  3GME A;  5FLX K;  2DFE A;  1LDJ A;  2DYR H;  3KLN A;  2XAQ A;  2VJ5 A;  2EH3 A;  1Y8Q B;  2VQL A;  3OOP A;  1W7P B;  4MLO A;  1USS A;  3I5U A;  3G6E I;  2VC1 A;  2IXS A;  1ZGW A;  2Y30 A;  4HNV A;  4BUP A;  1T39 A;  1UG2 A;  2V26 A;  1D0X A;  3IC7 A;  2FOK A;  2IP2 A;  4I01 A;  3GX4 X;  2WAQ N;  1LVK A;  3I9V 2;  2I8D A;  2PJR B;  3JSP A;  1IC8 A;  4YG2 F;  3U21 A;  4P55 A;  2K4B A;  2YX7 A;  2X6W A;  3M07 A;  3GZ6 A;  2XF6 A;  1YW9 A;  3DXJ F;  3VYS B;  1JUP A;  1WFX A;  1QA6 A;  4CGZ A;  3R4K A;  4KA4 A;  5HDN A;  2VBW A;  2O8K A;  2ZSH B;  3M7G A;  2E19 A;  2OTJ I;  5ERI A;  1W36 D;  3FXJ A;  2JMW A;  2IGN A;  4AID A;  2HQN A;  1DUX C;  1FEX A;  3ZMS A;  4CCN A;  1R23 A;  3BP8 A;  4HAM A;  3B6A A;  3ZQQ A;  4HLY A;  2HZT A;  2KJC A;  1B8I B;  5IYD J;  4PFP A;  2LY9 A;  2ZFU A;  2DMP A;  2O3F A;  1FBS A;  3FMS A;  3R0A A;  1F36 A;  2WB1 N;  4NQW B;  4IHX A;  3FXK A;  1I5Z A;  4OIR F;  3OYA A;  2R7R A;  1YQA A;  4EM2 A;  2DPU A;  3FXR A;  1U6G A;  3M1E A;  2E1M B;  1X3U A;  2G9W A;  1UEL B;  2D1V A;  2YS9 A;  4H4K C;  3PIO F;  2VT3 A;  3K70 C;  1BI2 A;  1K6Y A;  2RGV A;  3BC8 A;  2XB5 A;  2KHM A;  2P7V B;  4E70 A;  1IN4 A;  2KLO A;  4I98 B;  1U9N A;  3BQY A;  4ZH4 F;  3R60 A;  5E3M A;  3OSF A;  3Q5F A;  1BW6 A;  2LDU A;  2BY0 A;  3GWZ A;  4RA2 A;  1FZP B;  3JTG A;  3GTJ J;  1FTZ A;  5A2Q K;  4NNJ A;  3CCS I;  4CXF A;  3S3O A;  1A6Q A;  1B6A A;  3ZQC A;  2VBX A;  4BQO A;  2L9N A;  3Q0W A;  2OZ6 A;  3BTJ A;  2VLA A;  4GYI A;  4R1H A;  3TDZ C;  4KN4 X;  3I4P A;  4RGR A;  1UCR A;  3H3Z A;  3V42 A;  4CCL A;  2ETH A;  2GLO A;  1LDD A;  1IRG A;  2Y0M A;  2EPF A;  2QA4 I;  2NYX A;  3V7C A;  5K7Z A;  3GLX A;  1U8B A;  4B3A A;  4PJN A;  1GVJ A;  1W1W E;  2ZFW A;  4JBA A;  4U7D A;  2QEX I;  1Y39 A;  1XG1 A;  1MBK A;  2QKL B;  4I0A A;  3CUQ C;  2KKO A;  1WJ5 A;  1QPM A;  4WXH A;  3MN2 A;  1MW7 A;  2FEZ A;  4IX7 A;  4BBR J;  1TTY A;  4ZYA A;  2AQE A;  3SJM A;  3S16 J;  3HG9 A;  3KPH A;  5BNG A;  5GAE J;  4AIK A;  1XPX A;  3DU5 A;  4E7I A;  3J80 Z;  5DCF A;  1YLF A;  1SFE A;  1YW7 A;  4GGG A;  1SFK A;  2MA3 A;  2KZV A;  1YW8 A;  2GQQ A;  3BTL A;  2PI0 A;  1RKT A;  5K7H A;  5BPD A;  5FLV A;  2R4G A;  5KCM A;  1S5L C;  1UG0 A;  4M9S A;  3ELK A;  1TWC J;  1ZG3 A;  2JSP A;  1RNL A;  3QPL A;  1VQ8 I;  2ZNY A;  3ZOB A;  1MSF C;  1P92 A;  2HFH A;  1MJ9 A;  5FKM A;  1LEA A;  1VQM I;  3TOA A;  3DKX A;  1GXP A;  3QU3 A;  4AM3 A;  1V5E A;  2E2H J;  2O03 A;  2FX0 A;  3CDL A;  1QZE A;  4EM0 B;  3I58 A;  2R7D A;  5HDG A;  4V2F A;  2EV5 A;  1EF4 A;  2X6X A;  3E6B A;  4NUB A;  3BR6 A;  2GIV A;  1TT5 B;  3E3V A;  3M9A A;  3CTA A;  3IUO A;  3NRV A;  2F5C A;  2ZXH A;  3CDH A;  1CQT A;  2JVG A;  2K4J A;  2WBM A;  4K2E A;  1ZHF A;  4BL0 B;  1HW5 A;  2JT1 A;  4DZP A;  4OWR B;  2LP0 A;  4Y33 A;  3L09 A;  2DAO A;  2K5C A;  3OYG A;  3HDD A;  1X4P A;  1Y1V J;  4OOI A;  3TW7 A;  1PUE E;  3W2V A;  1I1G A;  4HQE A;  2AHQ A;  1U9O A;  3F72 A;  3GO5 A;  2DCE A;  2W85 A;  3ZMV A;  3KCC A;  2A6E F;  2WWY A;  1OCP A;  1WJD A;  5BOX A;  2NNY A;  1IJW C;  4XON A;  3SZG A;  3K4N A;  3K4K A;  1QVT A;  2R92 J;  5HS9 A;  4HV5 A;  3PFI A;  3PO2 J;  5B3S H;  1HKS A;  3WHB A;  5E8G A;  3I59 A;  3ZQH A;  2LH9 A;  2DPD A;  1VI0 A;  4LB5 A;  2H8W A;  2ADU A;  1O7F A;  3IHU A;  2VQH A;  1WRJ A;  2AQF A;  4EGZ A;  3WTU C;  4KNY A;  4JQF A;  3FMQ A;  4II3 A;  4LG3 A;  5L3C A;  1R7J A;  2OU2 A;  3COA C;  5FFZ A;  1FYK A;  4A69 C;  3IWZ A;  3HSF A;  4BAY A;  4RB1 A;  5DS9 A;  1W5S A;  1BOB A;  2XIG A;  5CLS A;  2Q0O A;  5D5X B;  4BH9 A;  2XF5 A;  2XC7 A;  2CV1 A;  1FNN A;  2BXY A;  1IRX A;  1U2W A;  2CJJ A;  1J75 A;  2DXI A;  1OCT C;  4RM3 A;  4LG0 A;  4OIP F;  3BJO A;  3L2V A;  4ESF A;  1SVO A;  3M3Y J;  4A93 J;  3GYH X;  3HL2 A;  2EJR A;  2UUZ A;  2HWV A;  4AWX B;  5J4Y A;  1K7A A;  2IS6 A;  3BG6 A;  2QGU A;  3BZ6 A;  3D5R C;  3WTT C;  3S32 A;  1E3H A;  4ASN A;  5LBQ A;  5DCM A;  3L2W A;  4RGX A;  2KRF A;  4RM2 A;  2XSJ C;  4PK4 A;  3N05 A;  3DCF A;  2EV6 A;  3IWF A;  4G6D A;  1VQP I;  5IT9 Z;  1JTY A;  2DA3 A;  2JA2 A;  4CH7 A;  3K4C A;  4A3M J;  4GDF A;  5E17 F;  2RRE A;  3HRT A;  2RNJ A;  4HNU A;  5JI6 A;  4I0B A;  2D1H A;  3QOD A;  4MEY F;  2BYV E;  2M3A A;  3GCM A;  2EB7 A;  4UHT A;  3QQA A;  4NC8 A;  1MMG A;  3FBN B;  2KQR A;  3IAS 2;  3SDB A;  1N75 A;  1Z05 A;  2KDZ A;  2DA2 A;  1PYV A;  2GXB A;  4E6K G;  2GA2 A;  1I6X A;  3ESW B;  3K7A J;  4FQG A;  1QHH D;  3K6G A;  3OL4 A;  4Y13 A;  2B7E A;  2P8T A;  1ZLK A;  5EGO A;  3ZN0 A;  2BOL A;  2CQQ A;  2M9H A;  2DK5 A;  5K1Y A;  1P7I A;  1SD6 A;  2DMQ A;  5TGT A;  1JKR C;  3I3L A;  4AIH A;  2W24 A;  4KFC A;  3GBG A;  4Q47 A;  2NVQ J;  4GYG A;  3OS0 A;  2UWM A;  5E3O A;  4OIQ F;  2Z2S B;  2DJI A;  3VB2 A;  2FOW A;  2EFW A;  5ED4 A;  2DK8 A;  2PLY A;  3S3N A;  3HZJ A;  3S1R J;  3AL0 B;  5J47 A;  2EFQ A;  2NAZ A;  4R79 A;  2IBD A;  2G7U A;  1AKH B;  1ETW A;  1ZTR A;  3GZN B;  2A3S A;  4MHG A;  3PIP F;  1R5I D;  1Y0U A;  3PSI A;  1SMY F;  1VQ5 I;  2M4K A;  3FHZ A;  1XN7 A;  1FP1 D;  4CIC A;  3PSF A;  1FLI A;  1OIS A;  2HVS A;  3HRU A;  3DPL C;  2LF7 A;  3UR3 C;  3HOZ J;  2YPR A;  1EH8 A;  2VL8 A;  4C3I J;  5B66 C;  2QBY A;  1UST A;  1OJL A;  1ZGA A;  5GAG J;  5KAI C;  2KIM A;  5E8I A;  2JJ7 A;  3C2G A;  4WXC A;  2JA5 J;  4HF1 A;  3FIW A;  4LJZ F;  2I5U A;  5IYB J;  1YI2 I;  1NTC A;  3C1D A;  3ZR8 X;  2YU3 A;  3WTW C;  4C30 A;  2BBY A;  2A07 F;  4II2 A;  2V6C A;  5LEK A;  4XKW A;  1ZLJ A;  3QPS A;  3TOB A;  1JI8 A;  2V1U A;  5B5E C;  4PFO A;  1IG7 A;  2IEK A;  4HYE A;  1KU9 A;  2O6G E;  4UUV A;  4M73 A;  3LA2 A;  3CD6 I;  1WHU A;  1N25 A;  1RI7 A;  3CF2 A;  4M72 A;  3W2W A;  2QQA A;  1T38 A;  4CDG A;  2NVT J;  1TNT A;  1KQ8 A;  2R7X A;  2CGP A;  2L7Z A;  1JKQ C;  5F04 A;  3CCR I;  5M5W J;  2RKH A;  1DQU A;  2XGD A;  3MZ8 A;  5ILU A;  4NDL A;  4A3C J;  4RAF A;  4UV9 A;  2COM A;  2ME0 A;  2KMU A;  3T0Y A;  5LRR A;  1T8I A;  1SD5 A;  3E6M A;  2M34 A;  3BDD A;  1GV2 A;  3I64 A;  3CUQ A;  2EFO A;  1XTA A;  1TBX A;  2A5Y B;  3WG9 A;  1S29 A;  2Z1D A;  1BW5 A;  5F0F A;  1YO5 C;  4OMZ A;  1TQP A;  2L0K A;  3I59 B;  3P9K A;  3FK6 A;  4NC7 A;  5BS6 A;  3T8R A;  4PGG A;  3PUB A;  4UUS B;  3HGG A;  1GLN A;  3HC7 A;  4GO1 A;  1NH3 A;  2BW3 B;  3U2R A;  3K1M A;  4S0H B;  1E3P A;  4WXD A;  2ZJQ F;  4ANJ A;  1Z91 A;  2PQ8 A;  1FP2 A;  1ORK A;  3WGH A;  3KET A;  3MMY B;  1HOM A;  2G7H A;  4KIT B;  1PUF A;  1U78 A;  2IAI A;  1XC5 A;  2O5R A;  2M5W A;  5FRM A;  2XSD C;  3HYI A;  4OAZ A;  5D4S A;  1OCO H;  1LE8 A;  3K2A A;  1O7L A;  1H9T A;  3CUO A;  3JSO A;  2ISZ A;  2FML A;  2M87 A;  4I2O A;  5D4R A;  3MKY B;  5M5X J;  3FX3 A;  4CZZ A;  2XGX A;  2E2J J;  1XSV A;  5BPI A;  1XSD A;  2VOP A;  5DCM B;  2HYF A;  3RKY A;  2ZJ2 A;  1BR1 A;  1K4T A;  4JP0 A;  1HCR A;  3CO6 C;  1TWH J;  4YFN F;  4BGD A;  2XHK A;  3GUD A;  1QRY A;  3LSR A;  2A68 F;  2NRA C;  4IRH A;  2CW7 A;  3HRS A;  4AC0 A;  4D5C A;  2PX9 A;  2KFD A;  2VBY A;  4DOZ A;  2L4A A;  3BR1 A;  2M8G X;  2MH2 A;  2IS1 A;  2QEN A;  4F7Z A;  5B1B H;  4IQJ A;  3VSK A;  1P4X A;  3LSI A;  2P6S A;  2X9D A;  4HOB A;  3F9K A;  4O5V A;  4HW0 A;  4EGY A;  3H3U A;  3ZP5 A;  1ZR2 A;  3BJA A;  4B48 A;  2K3F A;  1RUO A;  2W1O A;  4M9Z A;  5EGO B;  3D5L A;  3RPQ A;  4Q4Z F;  1LUJ B;  3F0C A;  4N9H A;  3Q3S A;  2CMP A;  2VC0 A;  3TP0 A;  3D5S C;  1IN6 A;  3JW4 A;  1WJA A;  5AIP A;  4ZZL A;  1Z9C A;  2DT5 A;  2ZC2 A;  5H20 A;  1YJ9 I;  3IRQ A;  2ZNZ A;  3L9F A;  2VE9 A;  4I99 C;  4I76 A;  2X85 A;  2ID6 A;  4XN0 A;  2GOX B;  2KRC A;  1JJ6 C;  3HOY J;  4AD9 A;  4BS9 A;  2ISY A;  1VZ0 A;  2CQX A;  1ON1 A;  4M71 A;  2JN6 A;  1A6I A;  2Z5U A;  2IRF G;  3PQK A;  5EJC A;  1BR2 A;  1JKO C;  3PNV A;  2ACJ A;  2DA7 A;  1LVA A;  1AHD P;  4RDU A;  2FSW A;  2L5Q A;  3HPH A;  3KP4 A;  3W6V A;  3BY6 A;  2L9R A;  3H9J A;  4AVP A;  1SD4 A;  2Q2E A;  4F55 A;  2E60 A;  2GXA A;  5F0C A;  1R4N B;  3ZMD A;  1I1S A;  2QM3 A;  4C3H J;  2FU4 A;  3PUF A;  1L0O C;  3BCB A;  5DUI A;  2CG4 A;  2DFF A;  2DA1 A;  4IEJ A;  2MC4 A;  5GTH C;  2CW0 F;  5E3L A;  1BC8 C;  2KIS A;  2BVL A;  2XV4 S;  3WTV C;  1YIJ I;  1A5J A;  3JRB A;  3AG1 H;  1BJA A;  2VKD A;  4UB8 C;  5FKK A;  4A6E A;  5L3F A;  5LRS A;  3H92 A;  1PP8 F;  4B47 A;  2PG4 A;  3RQ4 A;  5KAF C;  1QQI A;  1NK2 P;  5H2F C;  1H9G A;  1ZG1 A;  3JRH A;  4UV8 A;  3JRE A;  4DJA A;  5IP7 J;  2BGC A;  1TW2 A;  3JRG A;  2PBI A;  5FRO A;  4L18 B;  2QSH X;  4G8X A;  3H0D A;  3CCV I;  2Z3Y A;  2CV2 A;  3CCM I;  1K79 A;  3H0G J;  1J9I A;  3GTP J;  5EEA A;  3ASN H;  4HA8 A;  2F4O B;  4L9T A;  4XLF A;  2VJI A;  2F4I A;  3FKJ A;  4RAG A;  4BKX A;  5JLW A;  1VQ9 I;  2HR3 A;  2B63 J;  4KIC A;  2VQG A;  1M1E B;  4A5M A;  3HOT A;  3CQZ J;  1U5T C;  4HPQ A;  4U0Y A;  5D6E A;  3CUQ B;  3E1S A;  1YHQ I;  4I09 A;  2M7B A;  2PMZ A;  4BJ5 C;  5ILV A;  5J1Y A;  3I54 A;  4B8X A;  3CJR B;  3JR9 A;  3HB9 A;  3J7A O;  3LSM A;  1WWX A;  1ZRC A;  4NBQ A;  1TL8 A;  1XGO A;  1X2M A;  3QYF A;  1ODD A;  4LGW A;  4IOA F;  1JUM A;  3OIO A;  4LLN A;  1HF0 A;  3I0T A;  3WU1 B;  4DYC A;  2JVH A;  3LSJ A;  5HNH A;  1REP C;  4E7L A;  3OYF A;  5DV5 A;  2Y2Z A;  1IXR C;  2E1N A;  1IXC A;  3BR2 A;  1D5Y A;  3P5J A;  2D5V A;  3HPG A;  5J1U A;  3KEQ A;  5LEJ A;  3PO3 J;  4P5O A;  3M8J A;  4LLL A;  4XN3 A;  2R5Z A;  3A4C A;  5C4X J;  2FNA A;  2IA1 A;  4WX9 A;  1LE8 B;  4P9F A;  3CME I;  4QPO A;  3LQQ A;  2MAB A;  3FM3 A;  1MBE A;  4C3J J;  2W48 A;  3BOQ A;  4IKF A;  5L3D A;  2MLK A;  1E2X A;  2GBY A;  1K83 J;  3QPH A;  2COB A;  3GTO J;  1APL C;  3KYD B;  4LIU A;  3OR2 C;  1YRN B;  1B59 A;  1B72 B;  3RPU A;  1JGS A;  1WZ2 A;  1MDM A;  2JK3 A;  3V8L A;  2DTZ A;  5LFA A;  5JHF A;  2MSY A;  1X1C A;  5IP6 A;  4MEX F;  4P1W A;  4XKV A;  2H09 A;  3KP7 A;  2LD5 A;  1WH5 A;  2R7S A;  1T98 A;  3OYK A;  2X6Y A;  3CJT B;  3HJE A;  1EKE A;  1HQC A;  2AXL A;  4P9U A;  1G4D A;  2ELH A;  3O8G A;  5ICF A;  4PDK A;  1VQ6 I;  2YSR A;  2O0Y A;  3M8E A;  1UB9 A;  1TWA J;  3HUG A;  1IGN A;  3ABT A;  3HSR A;  4P96 A;  4QTR A;  4A12 A;  4WCG A;  1MZB A;  1H88 C;  4BEH A;  1SAX A;  3OOU A;  4IVN A;  2XKP A;  3BG3 A;  2ID3 A;  3HM5 A;  5IPA A;  1VF9 A;  2HXO A;  4XSZ F;  1OFC X;  3ZMT A;  1TC3 C;  3R0J A;  2IW5 A;  2YUS A;  1BBY A;  2AXT C;  2ZXW H;  5CVV A;  1TWF J;  5LHH A;  3U9G A;  1FT9 A;  3RSN A;  1ON2 A;  4B4C A;  3ZRG A;  1XCB A;  3FK7 A;  5DUK A;  2XRO A;  4QPQ A;  1Z21 A;  2NOG A;  2F48 A;  3ZQG A;  1HW1 A;  1T0F C;  1OYY A;  1E0E A;  2W57 A;  4RS8 A;  2XPU A;  4L5I A;  5F08 A;  1WJB A;  3SQN A;  1GDT A;  2H94 A;  4A3I J;  3GLL A;  1FYL A;  5CVJ A;  2LY2 A;  2DJN A;  4HST A;  1QHG A;  5KK1 A;  2Q2E B;  1O4X A;  4MTE A;  4L9N A;  3F3X A;  2DOA A;  3JRF A;  4IF4 A;  1D1B A;  3NAR A;  1J09 A;  2LFB A;  2P5K A;  4XOP A;  4BQN A;  1FBQ A;  4IZZ A;  3EUK L;  3BT9 A;  2M0M A;  3AKZ A;  1AU7 A;  4L9J A;  3NAU A;  5IYC J;  4DYQ A;  1FTT A;  4CYC A;  3A01 A;  5KVR A;  3GFM A;  1DGR M;  1DGW Y;  1ETV A;  5DDG A;  2JWT A;  1B1B A;  1FC3 A;  4ESJ A;  4YFX F;  1XB4 A;  4A3J J;  3C2B A;  4MQV A;  3LNQ A;  2MGQ A;  3KYC B;  3G4S I;  2E1O A;  2WTE A;  3F8F A;  1YS7 A;  4OIO F;  5J6X A;  1F1Z A;  2WAQ A;  3FBI B;  3CMA I;  4XOT A;  4C9Y A;  2RNG A;  4C2T A;  3HHG A;  2EIJ H;  4Y52 J;  2DDA A;  1DPU A;  2E35 A;  4IO9 F;  4XKC A;  3CC4 I;  1MBG A;  4KT6 A;  3WGG A;  3MKZ A;  1UHS A;  1YS6 A;  3FM5 A;  4LIV A;  4DGW B;  4GXO A;  3ROU A;  1FOK A;  3EUH C;  1LEB A;  1I3Q J;  5D5W B;  3K0L A;  2ZB9 A;  3FKI J;  3OYB A;  2WV1 A;  3QRF F;  2QKM B;  2LK2 A;  1WCM J;  1G2H A;  2RVC A;  1L3L A;  2VJ4 A;  4HNT A;  1MMN A;  3BCA A;  1W0U A;  4V19 K;  1HKQ A;  2K27 A;  2WY8 Q;  2CUZ A;  3F21 A;  1AA7 A;  4CSW A;  1Z3X A;  2LKX A;  1NHA A;  2WB1 A;  2R5Z B;  2ZME B;  3RDI A;  1BL0 A;  5D6F A;  2DBB A;  3DF8 A;  1VQN I;  3B73 A;  4AYB N;  2EZL A;  3G1M A;  1RIO H;  1BOA A;  3M4O J;  1TP4 A;  5FGM A;  4ZYD A;  4DW6 A;  2L2O A;  3FXM A;  2VUM J;  2MH9 A;  2GA1 A;  3FHN A;  2B9S A;  2JA7 J;  3ISP A;  1WSU A;  2EBI A;  2VOD A;  3FWE A;  2BEO A;  1MND A;  5CKT A;  1YOV B;  5LGN A;  1XDU A;  2WAD A;  1G3Y A;  3G1L A;  1HST A;  5IOZ A;  4RB2 C;  4HF2 A;  4Z6Y A;  5BQT A;  1MMD A;  3LMM A;  1YIO A;  4L0Y B;  3A0B C;  3L1P A;  2GOM A;  4NC6 A;  1QBJ A;  1YJW I;  4B1R A;  3VEP A;  3JRD A;  4KDP A;  1MGT A;  3H5R A;  2A05 A;  3K2Z A;  2VOO A;  4J01 A;  2W00 A;  4U87 A;  1XMX A;  3DBH B;  2WAE A;  3ZCO A;  4CCK A;  2IS2 A;  3S1N J;  3DEU A;  2OCE A;  1LFB A;  3E97 A;  5FJ8 J;  2J5O A;  1KON A;  1U5T A;  2AO9 A;  2E71 A;  2VXZ A;  3SYT A;  4D7M A;  4L0Z B;  5E1W A;  2FJ1 A;  4D7N A;  1XD7 A;  4GCV A;  2R7U A;  1K61 A;  5D8L B;  3HUG B;  3SFI A;  2R7Q A;  4LLG F;  3FMR A;  2R7O A;  3SDG A;  1OCR H;  4HLX A;  5FO5 A;  4G9Y A;  4CCO A;  2Z16 A;  2YX4 A;  2X51 A;  1Z7L A;  3ABU A;  4EJU A;  1B4A A;  3LA3 A;  1ZRF A;  1QPI A;  2ZSI B;  5HNF A;  4CO8 A;  2CQN A;  4KIS A;  2HYJ A;  2JZY A;  2OQG A;  5HS7 A;  3LQR A;  1RC9 A;  4BJ6 C;  3BPX A;  3MD2 A;  5HLI A;  1HXD A;  4BHC A;  4EJW A;  5L3E A;  5FKL A;  1W0T A;  1K6O A;  2IT0 A;  3K69 A;  3S1M J;  3RI4 A;  2LC2 A;  1MSE C;  3GTK J;  3VYT B;  3F8C A;  1WPK A;  3I53 A;  2M2E A;  3NQO A;  4BY1 J;  4FCY A;  1LQ1 A;  1CF7 A;  2HS5 A;  1Y56 A;  1RR7 A;  1S72 I;  4B43 A;  3LL7 A;  4A6D A;  4FX4 A;  1HKT A;  2HPI A;  4F93 B;  3OYN A;  3BR5 A;  2F4M B;  2XAS A;  4BY7 J;  3S8P A;  1FMV A;  4HZF A;  2FBK A;  2OJE D;  2ZKZ A;  2XGE A;  3VPR A;  1XS9 A;  3VOD A;  2QLZ A;  5JLX A;  3EUA A;  2Z33 A;  2R5Y A;  1WKM A;  3WTZ A;  5M3M J;  1A04 A;  2V9P A;  4HDU A;  1WGX A;  4CYC B;  3A01 B;  2P5L C;  5FLX Z;  1FOW A;  2HTJ A;  4ITV A;  3T1B A;  4CUG A;  3OYH A;  2L54 A;  1QU3 A;  1W5C C;  2LRD A;  3W6J B;  2VKE A;  2NVX J;  1FIA A;  4KMU X;  2ESH A;  4MFE A;  1QZY A;  2A6H F;  4ZYH A;  4A3B J;  1IO2 A;  3CZ6 A;  3WE3 A;  3P9C A;  5EG0 A;  1JHF A;  3RQI A;  4FAS D;  2C6Y A;  3UKG A;  3QP6 A;  3HHH A;  1WJC A;  3CO7 C;  1XX5 A;  4BHB A;  2DMU A;  1YYV A;  2QUF A;  3IH3 A;  2HQA A;  2EWN A;  4ABZ A;  4M6Y A;  3M1C A;  1X4O A;  3J81 K;  3V8K A;  1MMA A;  1S7A A;  1W5T A;  5HOO A;  5J1R A;  4XLA A;  4G7Z F;  1MNE A;  2P0W A;  3KZY A;  4QSH A;  3G2B A;  1GUU A;  4IHV A;  4G12 A;  1Y0N A;  3HKZ A;  4D0P A;  1T0F A;  5K5R A;  3TW6 A;  5IP9 J;  4G6T B;  1XGS A;  2RQQ A;  3VOE A;  4FT8 A;  3AG3 H;  3BR3 A;  2F2E A;  2QVO A;  4UVA A;  3A0H C;  1SC7 A;  1R36 A;  1W4M A;  3OS1 A;  4ZTJ A;  2HOA A;  3A02 A;  2XB0 X;  2R93 J;  1XMK A;  4NHJ A;  1ULY A;  2KL4 A;  3A03 A;  3M8F A;  3G71 I;  1IAW A;  4XR6 A;  3S3M A;  2ECC A;  2VIX A;  3BTC A;  4XL9 A;  3LFU A;  1W36 C;  2CWE A;  2EIK H;  3DPU A;  5JHU A;  2XAJ A;  1IDY A;  3NEU A;  1OYW A;  1YFH A;  5M3F J;  3KFW X;  4W1U A;  2H6C A;  3GZ5 A;  3SXY A;  3HOX J;  3MCZ A;  5A2Q Z;  3LSP A;  1AWC A;  1VQL I;  3GFL A;  2LBF A;  4Y17 A;  3S15 J;  2CUF A;  4X1E A;  3VYR B;  2DA5 A;  1FSH A;  2CQ7 A;  2TCT A;  3OV8 A;  3Q0V A;  2EV0 A;  4RAY A;  5CVR A;  4AIJ A;  4BXX J;  3K70 D;  2Y9Z A;  3BR0 A;  1P4A A;  3PFY A;  2K02 A;  2W4S A;  5CVU A;  2DTR A;  1BC7 C;  3F6O A;  1HLV A;  1U5T B;  1EH7 A;  3CLQ A;  4D5F A;  4IOC F;  3JRC A;  1D8J A;  1SFX A;  1X1A A;  3ABM H;  1ZG5 A;  2IGK A;  1ITY A;  1XMA A;  2YR2 A;  2E36 A;  4I7H A;  5HLH A;  2DO7 A;  3EUH A;  3QOP A;  4ZYG A;  1FX7 A;  1U3E M;  1R49 A;  1H89 C;  1Z1D A;  2GWR A;  2VKV A;  3HBL A;  4XRS G;  1O3S A;  2P7C B;  3RZO J;  3CP2 A;  2KIQ A;  2LTP A;  2EA4 A;  3J7Z I;  1ACI A;  1UJ8 A;  3OIP A;  3CJQ B;  1ZN2 A;  2NNN A;  4RLQ A;  3HTU A;  3OSG A;  1QVU A;  4KJZ A;  2HEO A;  1ETO A;  1WJF A;  1XSX A;  1ZKG A;  1X1D A;  1X58 A;  4LG0 B;  2M7A A;  5FB2 A;  4M3F A;  2W7N A;  3OYI A;  4HEA 2;  1N77 A;  2V9K A;  2LMD A;  2JTV A;  3QYE A;  1BIA A;  2KDO A;  3BPV A;  3QAH A;  1UAA A;  2K86 A;  3K4L A;  3DV8 A;  4RBO A;  2MC3 A;  1JUS A;  3TO9 A;  3ZMU A;  4KT5 C;  1CF7 B;  3B6C A;  4FHT A;  1RZ4 A;  1BA5 A;  4HV6 A;  3CJN A;  1X3W B;  5GP9 A;  1WI3 A;  5K7F A;  2K9N A;  1R58 A;  3L7W A;  3ZQL A;  1QNT A;  2JQ7 A;  3S17 J;  4L9V A;  4NB5 A;  4B44 A;  1NG7 A;  3VFZ A;  2L3D A;  2F5V A;  3IKT A;  4L5E A;  2EIL H;  5FFX A;  3ZXS A;  3HGY A;  3GF2 A;  3MFK A;  2GM4 A;  1SD7 A;  1W7P A;  3D1N I;  2V1X A;  2L01 A;  2OUM A;  2OA4 A;  5FLM J;  1SAN A;  3TO6 A;  2DMT A;  4HQM A;  2HI3 A;  2ME6 A;  1RR8 C;  1JJ8 C;  3K10 A;  1GT0 C;  2Y0S A;  3TGN A;  3ECO A;  4Y3O A;  4RMN A;  4ZDO A;  5EG0 B;  3S93 A;  2H27 A;  1KA8 A;  2ELJ A;  1NG6 A;  2L9V A;  2PJP A;  3KYL A;  3HEF A;  3HIF A;  4C2U A;  1I50 J;  2CSO A;  2FUG 2;  1YTY A;  2BHY A;  5GAH J;  3PQJ A;  1P9Q C;  5LHG A;  1WI9 A;  3I71 A;  4IXA A;  3J80 K;  3H9Q A;  2M8E A;  4RB0 A;  1S9H A;  2QYO A;  4MGR A;  1MBJ A;  2BHZ A;  2UXN A;  1V55 H;  1WQ2 A;  2IPQ X;  4ENN A;  3S2H J;  1GXQ A;  1RES A;  2WY7 Q;  2XAG A;  2XF7 A;  4LD5 A;  2OBP A;  4IRG A;  2LVS A;  1RET A;  2XAF A;  4DYR A;  2XPW A;  1IN5 A;  4WK8 F;  2JUC A;  1UFM A;  3RTR A;  1SFU A;  1BM9 A;  3DKW A;  2VT2 A;  2IA0 A;  2QCO A;  3C18 A;  2X6O A;  4YEL A;  4FIS A;  2VKH A;  2IS4 A;  4KN7 X;  2B0L A;  3X2Q H;  2O61 A;  2L7F P;  3MWM A;  1NK3 P;  1KQ0 A;  2HKO A;  4PJJ A;  2QBY B;  2GAU A;  3DTI A;  1FOX A;  1D1A A;  2RDP A;  4AVZ A;  5CVI A;  3O8H A;  1S7E A;  3OS2 A;  1OYI A;  3H1C A;  5EEG A;  2M1B A;  1Q1V A;  4YIF A;  3C2H A;  3N4M A;  2FBH A;  5C44 J;  4IHT A;  1UHW A;  4D1Q A;  1ERD A;  3AG2 H;  1I6H J;  2DOE A;  4BXU A;  1HC8 A;  4GFB A;  1KZH A;  1HDD C;  2VBZ A;  5H6Q A;  5C4J J;  3I4M J;  2VQC A;  4EAT A;  2QSG X;  3OYD A;  3GTM J;  1PVE A;  1OLT A;  4IHY A;  2R7Z J;  2TDX A;  1G3T A;  4JK1 X;  3MAJ A;  1VFC A;  3H36 A;  1G59 A;  2TRT A;  4QIW N;  2OZU A;  4JX5 A;  1HA8 A;  3A2K A;  1T56 A;  2EIM H;  2K9S A;  2PEX A;  1OCZ H;  5DEQ A;  3PM1 A;  1A36 A;  4MFD A;  2LBF B;  4YEJ A;  4A3E J;  5FKN A;  4Z2Y A;  4EJV A;  4PZJ A;  3TP3 A;  2STW A;  3IL2 A;  3E6D A;  4BE0 A;  2R0Q C;  2VN2 A;  1G6N A;  3D0S A;  1V4R A;  3U1D A;  4MTD A;  2PMH A;  3TMO A;  1JXS A;  3TQN A;  5LLQ A;  5FKO A;  1VQO I;  4RAZ A;  2CW8 A;  2MYS A;  2CH0 A;  2M30 A;  3WOD F;  5J4V A;  4O6J A;  3GEZ A;  3L2Q A;  3GTQ J;  3DEE A;  2E2I J;  2HOT A;  3PL8 A;  3MEX A;  4ZYE A;  3ONQ A;  1POG A;  3HRM A;  4BE2 A;  2E7W A;  1Z0X A;  5HVQ C;  4UY8 I;  2BY1 A;  2DOF A;  3LST A;  3GFJ A;  4Y4R A;  3RYP A;  2CUJ A;  2DYS H;  4BBS J;  3FDY A;  3UNG C;  1E17 A;  3KP2 A;  3DTE A;  4I02 A;  2LR8 A;  2QSF X;  3DWL E;  3S2D J;  1F43 A;  1ZR4 A;  3NWS A;  2E1C A;  2DFH A;  1PUF B;  1J0R A;  2VPL A;  3OYE A;  2LF8 A;  3F8B A;  3JTH A;  3I56 I;  2FBI A;  4E7Z A;  4Q5S F;  2DA6 A;  3F22 A;  4DBR A;  3IP4 B;  3WHC A;  4ENM A;  2A61 A;  4L5J A;  2CYY A;  1R1T A;  5EYR A;  2Q1Z B;  4X6A J;  2VAS A;  4IJA A;  2L7M P;  3ZQ7 A;  3K1N A;  5HDK A;  3OYJ A;  4B3X A;  4AU7 A;  4CZC A;  4PJL A;  3LAP A;  1IDZ A;  4UUT A;  2CO5 A;  4GRI A;  3CCJ I;  3MZH A;  4JX4 A;  3BZK A;  2DA4 A;  1R00 A;  3Q9S A;  4FX0 A;  3E6C C;  4E7S A;  5IT9 K;  3K4J A;  3OR1 C;  5IOY A;  4CA0 A;  3HOU J;  2IGM A;  3QOE A;  2NXN B;  3H9G A;  1XGM A;  2IJL A;  3DBR B;  3SHF A;  4KIB A;  4ZZD A;  3E5X A;  3CLO A;  1OCC H;  2VPR A;  5JFR A;  3ERM A;  3S14 J;  3CF5 F;  4CYD A;  1D5V A;  3REO A;  5EEH A;  1SEU A;  2LKP A;  4A3K J;  2NVU B;  4ZC3 A;  2HPM A;  3HOW J;  1QO0 D;  4E7K A;  2CRG A;  1P7J A;  1T08 B;  3K4B A;  4XLC A;  4RLF A;  4IRI A;  3K9T A;  5J8C A;  1JTX A;  2H8R A;  3IAM 2;  3FZV A;  2FMY A;  3L2R A;  3ZQF A;  1SAU A;  3ZQI A;  3DEW A;  4Y7N J;  3IV5 A;  4EVI A;  4EJO A;  5EZG A;  5J40 A;  3EDP A;  4UB6 C;  1FBU A;  4YII A;  3BJ6 A;  2JPB A;  4D9J A;  4HX7 A;  1FPQ A;  4XBF A;  4EM1 A;  1S3J A;  1R71 A;  1GVD A;  2HQR A;  3ZMZ A;  2FRH A;  3DBL B;  3FXL A;  2DT6 A;  2ZXJ A;  3IRR A;  3OYL A;  3RPU D;  5CPR B;  2OD5 A;  3KP6 A;  4IPA A;  3J7A Y;  2BZT A;  2HTS A;  3RKQ A;  4A5N A;  1D0Z A;  2CQK A;  4M74 A;  5D5U B;  2NS8 A;  3KZZ A;  3LOC A;  1ZQ3 P;  2FD5 A;  2WA0 A;  4BDY A;  1TT0 A;  3U1K A;  3ZN1 A;  3GTL J;  2P6T A;  3H5N A;  1R6R A;  5HOD A;  2ECB A;  3WG7 H;  2HU9 A;  2W25 A;  5F0H A;  2HDC A;  4U88 A;  3MKW B;  5FD5 A;  1EV7 A;  2QWW A;  2WAF A;  3WTS C;  2XPV A;  3G1O A;  1YG2 A;  3P9I A;  3TED A;  1HBX G;  1ZAO A;  2XGC A;  1I3A A;  1YX3 A;  4F92 B;  2JSC A;  3DKY A;  3QYB A;  4YRV A;  4ENJ A;  2NVY J;  2ZCW A;  3OY9 A;  2HKX A;  2H1K A;  4AUX A;  4XRS A;  3EPZ A;  4BQA A;  2OAZ A;  1IV8 A;  4DQ2 A;  1S8N A;  1Z6R A;  3WE2 A;  3ABL H;  2HDD A;  3TO7 A;  3FXO A;  4ZDP A;  4U0V A;  3CC7 I;  5HLG A;  3LSG A;  1K4S A;  2DQR A;  4IHS A;  3O3K A;  4FE4 A;  3T5X A;  5L3G A;  3DLA A;  4PUS A;  3F8M A;  1Z3Y A;  4R8H A;  4X0G A;  4BAC A;  5K5Q A;  1OKR A;  3BG7 A;  3HSE A;  1U8R A;  3KLO A;  4ENK A;  1RPW A;  5E79 C;  3ASO H;  3W6K B;  2P5V A;  3CCU I;  2HDW A;  2DDB A;  3H35 A;  2X0L A;  3OL3 A;  2L9S A;  4OU0 A;  3WU0 A;  6PAX A;  1R1V A;  2HOS A;  1IF1 A;  1EA3 A;  4BJT A;  1ZYR F;  2K40 A;  3G3Z A;  2EZK A;  3V4G A;  3IH2 A;  2KZG A;  1TLH B;  4IQ4 A;  4XLH A;  1MJB A;  1ZAR A;  1LFU P;  5CQG A;  1V54 H;  2DQL A;  2YU9 J;  5K5O A;  3W2A A;  1FOY A;  2E34 A;  1LJ9 A;  1AKH A;  1MH3 A;  2Z9O A;  3EET A;  2MW8 A;  4XQF A;  2E5Z A;  2M45 A;  2LSO A;  4A0Z A;  4W97 A;  4A0Y A;  4BU2 A;  4PSW A;  3JAM Z;  1IXS B;  5AIQ A;  3WU2 C;  3CES A;  3DP7 A;  4F3Q A;  4DZJ A;  1D0Y A;  2MBF A;  1XDS A;  5F6F A;  5EDN A;  4DBQ A;  1OR7 C;  1PJR A;  2UXX A;  1X2N A;  2ESN A;  1MDM B;  2OCC H;  1FWZ A;  1MBH A;  2QQB A;  4KYW A;  2KIF A;  2F6C A;  4N4N B;  1ZEL A;  1BI0 A;  1WVR A;  3I55 I;  3EQL F;  3CP8 A;  1BR4 A;  4LIT A;  1DP3 A;  2LRE A;  3JRA A;  2K9Q A;  2XDV A;  3QU6 A;  4HX4 A;  4CCM A;  1D8K A;  4A3F J;  2N8G A;  2XRN A;  5FRN A;  3MKL A;  2D2W A;  1TZL A;  1KYZ A;  3AFH A;  5EF6 A;  2LY1 A;  4BXF A;  3CCL I;  3DPT A;  1LB2 A;  4XK4 A;  3DLL F;  4LK0 F;  2HVQ A;  3CMY A;  2CFX A;  1ETY A;  1YE9 A;  1RUN A;  3GW2 A;  2X1E A;  1GV5 A;  2XRL A;  2A5W A;  1H0M A;  1Z7U A;  4BEH B;  3LSK A;  2V79 A;  5LHI A;  1O57 A;  1UMQ A;  2R7T A;  2MD0 A;  4O3M A;  1X3Z B;  4N0B A;  3L2C A;  3DQV C;  3GVA A;  2E7X A;  1KU7 A;  2E5N A;  5BMZ A;  1Y1W J;  2X4H A;  1TNS A;  1DU6 A;  4E7J A;  1VTN C;  1RKW A;  4XLE A;  1AOY A;  2P81 A;  4KIG A;  2FQ3 A;  4UUS A;  1X19 A;  1Y8R B;  3HKZ N;  2KP6 A;  4JYK A;  2Y75 A;  3LSH A;  3ECH A;  2BW3 A;  2GZW A;  2HXI A;  4UVC A;  2DT7 B;  3C7J A;  4G6Q A;  4S05 A;  2CUE A;  5F1J A;  3SZT A;  4EEF G;  5F1R A;  4FTH A;  3E5U A;  2HNH A;  3KIO A;  4XKB A;  3S2W A;  4M9X A;  4CCJ A;  1KGS A;  1Z77 A;  2E1M C;  2FF4 A;  3AAF A;  2ICW G;  4IL6 C;  2FQ4 A;  9ANT A;  2HVR A;  4U0W A;  1DU0 A;  3KX2 A;  3G73 A;  1FMW A;  2QQ9 A;  3RCO A;  3BTI A;  1B9M A;  1O3R A;  4AYB A;  1DPR A;  1T95 A;  1BI3 A;  4WWC A;  4G7H F;  3JRI A;  4B09 A;  2DU9 A;  4UNO A;  2DMN A;  1V5G A;  2JRT A;  3QPT A;  4YIR X;  2W82 A;  2IGO A;  4ZDL A;  2M0C A;  1JE8 A;  1QGP A;  2NOJ B;  4HRI A; 
#chains in the Genus database with same CATH homology
 1BA5 A;  2Y2Z A;  3BR2 A;  1XG1 A;  1MBK A;  4FE7 A;  1D5Y A;  2D5V A;  5GP9 A;  5J1U A;  1WI3 A;  3PO3 J;  3MN2 A;  5K7F A;  2K9N A;  3ZQL A;  4BBR J;  2R5Z A;  5C4X J;  1HDP A;  3S17 J;  3SJM A;  3S16 J;  5BNG A;  1LE8 B;  4L5E A;  3HGY A;  4M3G A;  1MBE A;  3BTL A;  1RKT A;  4C3J J;  2GM4 A;  4JX6 A;  5K7H A;  2W48 A;  3D1N I;  5FLV A;  2GBY A;  1K83 J;  5FLM J;  2COB A;  2EZH A;  1H8A C;  3GTO J;  1SAN A;  1TWC J;  2KT0 A;  2DMT A;  3QPL A;  1APL C;  2HI3 A;  2ME6 A;  3ZOB A;  1JJ8 C;  1MSF C;  1YRN B;  2QF7 A;  5FKM A;  1GT0 C;  1B72 B;  3E7L A;  2DN0 A;  5GPA A;  3IH4 A;  5EG0 B;  1VND A;  2JK3 A;  2E2H J;  2FX0 A;  3CDL A;  3HEF A;  2DTZ A;  1I50 J;  2MSY A;  4V2F A;  5IP6 A;  1EF4 A;  4A3L J;  3BR6 A;  1ETQ A;  2LD5 A;  1WH5 A;  1MBJ A;  4XRM A;  1WH7 A;  3H3V K;  1CQT A;  3S2H J;  1RES A;  1FJL A;  2JA8 J;  3BG9 A;  3O8G A;  2LVS A;  5M5Y J;  1RET A;  4DZP A;  4DYR A;  5J3L A;  2XPW A;  2LP0 A;  4MO7 A;  3HDD A;  4I6Z A;  1TWA J;  2QCO A;  1Y1V J;  1IGN A;  3TW7 A;  2X6O A;  4FIS A;  2AHQ A;  2L7F P;  4QTR A;  1U9O A;  1FIP A;  1NK3 P;  1H88 C;  3OOU A;  2EQR A;  3BG3 A;  2ID3 A;  3HM5 A;  5IPA A;  4A3D J;  3O8H A;  1S7E A;  1VF9 A;  2HXO A;  1OFC X;  1TC3 C;  1Q1V A;  1OCP A;  2YUS A;  2I10 A;  1IJW C;  2OPT A;  3HOV J;  1TWF J;  5C44 J;  1QVT A;  2R92 J;  4B4C A;  4M3E A;  3PO2 J;  1I6H J;  3WHB A;  3FK7 A;  4GFB A;  1HDD C;  1ENH A;  2NOG A;  3ZQG A;  3ZQH A;  5C4J J;  1VI0 A;  5F27 A;  3I4M J;  2Y0S N;  1MNM C;  3GTM J;  2XPU A;  1JT0 A;  4IHY A;  5F08 A;  1GDT A;  2R7Z J;  4A3I J;  4M6V A;  1VFC A;  2TRT A;  4QIW N;  2DJN A;  2LLK A;  4JX5 A;  1O4X A;  1T56 A;  2K9S A;  4A69 C;  3JRF A;  3PM1 A;  3NAR A;  4MFD A;  5DS9 A;  4A3E J;  5FKN A;  2LFB A;  3MVP A;  3BG5 A;  3TP3 A;  4J19 A;  2R0Q C;  2CJJ A;  3BT9 A;  1OCT C;  1ETK A;  1AU7 A;  3NAU A;  5IYC J;  3FIS A;  4DYQ A;  3Q0U A;  4CYC A;  3A01 A;  1FTT A;  5FKO A;  4V2G A;  5E3N A;  3M3Y J;  4A93 J;  3RZD J;  1ETV A;  3GTQ J;  2E2I J;  2HOT A;  1JKP C;  2JWT A;  1POG A;  1Z0X A;  4MIM A;  4A3J J;  3C2B A;  3LNQ A;  2MGQ A;  3DCF A;  2E1O A;  1JTY A;  2DA3 A;  4A3M J;  4BBS J;  3S2D J;  2LR8 A;  1F43 A;  4Y52 J;  1ZR4 A;  1BJZ A;  1PUF B;  3QQA A;  5GPC A;  2R5Y B;  1MBG A;  2DA6 A;  2MG4 A;  2DA2 A;  1UHS A;  3WHC A;  2KDZ A;  5EYR A;  1I3Q J;  2HQ5 A;  3K7A J;  2ZB9 A;  4X6A J;  1T33 A;  2L7M P;  3FKI J;  5EGO A;  1YRN A;  2M9H A;  2CQQ A;  1B72 A;  1P7I A;  2DMQ A;  1JKR C;  1IDZ A;  2WV1 A;  5EZH A;  4UUT A;  2LK2 A;  1WCM J;  1G2H A;  4JX4 A;  2DA4 A;  3GBG A;  2NVQ J;  2RAE A;  1W0U A;  5IOY A;  5E3O A;  3HOU J;  3I4N J;  2LKX A;  3S1R J;  2R5Z B;  2ELK A;  2EZI A;  1BL0 A;  2PMZ N;  2IBD A;  1AKH B;  4LOC A;  4AYB N;  1ETW A;  2EZL A;  3G1M A;  1ZTR A;  3M4O J;  2VPR A;  3S14 J;  4A3K J;  4DW6 A;  2VUM J;  1MBF A;  3HOW J;  2VI6 A;  2JA7 J;  2CRG A;  2EBI A;  1P7J A;  1B8I A;  4XID A;  3HOZ J;  1JTX A;  2H8R A;  4C3I J;  2G0E A;  3G1L A;  5IOZ A;  2O9L A;  1OJL A;  3ZQF A;  3ZQI A;  2JJ7 A;  3DEW A;  4Y7N J;  3IV5 A;  3L1P A;  3FIW A;  1MH4 A;  5EZG A;  2JA5 J;  5IYB J;  1TWG J;  4B1R A;  3JRD A;  1NTC A;  2NS7 A;  1ETX A;  1GVD A;  3QPS A;  1IRZ A;  2Y31 A;  3S1N J;  1IV6 A;  1IG7 A;  1LFB A;  5FJ8 J;  2IEK A;  2AO9 A;  4D7M A;  2FJ1 A;  3RKQ A;  4D7N A;  1K61 A;  3SFI A;  2NVT J;  2NS8 A;  3LOC A;  3SDG A;  1ZQ3 P;  1IUF A;  2L7Z A;  2FD5 A;  1JKQ C;  2Y9Y A;  5F04 A;  3GTG J;  3GTL J;  5M5W J;  2X48 A;  5HOD A;  5DTD A;  4XIC A;  2XGD A;  4C2M J;  2ECB A;  4NDL A;  1QPI A;  4A3C J;  5F0H A;  2ME0 A;  2HYJ A;  2XPV A;  3G1O A;  3TED A;  2M34 A;  1GV2 A;  2XGC A;  1R9T J;  3CCY A;  4M3D A;  5FKL A;  1W0T A;  3S1Q J;  1BW5 A;  5F0F A;  2NVY J;  3S1M J;  4A3G J;  2L0K A;  3FK6 A;  1MSE C;  2H1K A;  4AUX A;  3GTK J;  4XRS A;  1WPK A;  4UUS B;  2HDD A;  2M2E A;  3HGG A;  4BY1 J;  4FCY A;  2O7O A;  4S0H B;  1RR7 A;  3LSG A;  4FE4 A;  3BQZ A;  1ORK A;  1HOM A;  3BR5 A;  4BY7 J;  1PUF A;  4IHW A;  1U78 A;  2IAI A;  1XC5 A;  2XGE A;  3VPR A;  1XS9 A;  5JLX A;  2R5Y A;  2XSD C;  5M3M J;  1LE8 A;  3K2A A;  1WGX A;  4CYC B;  3A01 B;  1RPW A;  2JA6 J;  5M5X J;  2VKE A;  2NVX J;  1FIA A;  2HOS A;  2E2J J;  2OF7 A;  4MFE A;  2K40 A;  1HCR A;  4A3B J;  2EZK A;  4JP0 A;  3IH2 A;  1TWH J;  5EG0 A;  2CU7 A;  1E3O C;  1JGG A;  3RQI A;  1QRY A;  3LSR A;  3UKG A;  4AC0 A;  1LFU P;  4D5C A;  2YU9 J;  1JT6 A;  4M3B A;  3BR1 A;  1ZK8 A;  2DMU A;  1AKH A;  1MH3 A;  2M8G X;  3IH3 A;  1SFO J;  5C3E J;  2MW8 A;  4ABZ A;  2X9D A;  4W97 A;  1ZR2 A;  5J1R A;  4MLO A;  2EH3 A;  4QSH A;  5EGO B;  1GUU A;  4IHV A;  4G12 A;  4DZJ A;  1ZGW A;  2Y30 A;  3F0C A;  3Q3S A;  4HNV A;  1UG2 A;  5EDN A;  3TP0 A;  3TW6 A;  5IP9 J;  2WAQ N;  1X2N A;  3BR3 A;  1IC8 A;  1MBH A;  4I76 A;  2ID6 A;  2HOA A;  3A02 A;  1JJ6 C;  3HOY J;  2XB0 X;  2R93 J;  1JUP A;  3JRA A;  2CQX A;  2K9Q A;  2O8K A;  3A03 A;  2JN6 A;  2E19 A;  4A3F J;  2N8G A;  1A6I A;  2ECC A;  3BTC A;  2JMW A;  3MKL A;  1JKO C;  2DA7 A;  5EF6 A;  1FEX A;  4XK4 A;  3B6A A;  1AHD P;  1IDY A;  4RDU A;  1B8I B;  3W6V A;  5M3F J;  2L9R A;  4W1U A;  3CMY A;  5IYD J;  2LY9 A;  3HOX J;  2DMP A;  1ETY A;  5F0C A;  1GV5 A;  3LSP A;  1F36 A;  2XRL A;  4C3H J;  2WB1 N;  4IHX A;  3S15 J;  2CUF A;  4X1E A;  2DA1 A;  2DA5 A;  4IEJ A;  1UMQ A;  5E3L A;  2TCT A;  3Q0V A;  3JRB A;  4BXX J;  1A5J A;  5FKK A;  2Y9Z A;  3BR0 A;  1Y1W J;  2YS9 A;  1DU6 A;  1HLV A;  1RKW A;  1NK2 P;  2P81 A;  3JRH A;  4D5F A;  4UUS A;  3JRC A;  3HKZ N;  3JRE A;  2XB5 A;  4JYK A;  5IP7 J;  1ITY A;  3JRG A;  2HXI A;  1U9N A;  3BQY A;  3OSF A;  1H89 C;  5E3M A;  1BW6 A;  2CUE A;  2VKV A;  3HBL A;  4XRS G;  5F1J A;  3RZO J;  3H0G J;  4EEF G;  3GTJ J;  4FTH A;  3GTP J;  2LTP A;  5EEA A;  1FTZ A;  4BKX A;  5JLW A;  3ZQC A;  2B63 J;  1Z77 A;  3OSG A;  9ANT A;  1QVU A;  2FQ4 A;  3Q0W A;  1ETO A;  1DU0 A;  3BTJ A;  3CQZ J;  1ZKG A;  1X58 A;  5J1Y A;  3BTI A;  3JR9 A;  3HB9 A;  4M3F A;  1X2M A;  3JRI A;  1JUM A;  3OIO A;  2GLO A;  1HF0 A;  4DYC A;  2DMN A;  3LSJ A;  4RBO A;  1JUS A;  2M0C A;  5K7Z A;  1U8B A;  4B3A A;  3B6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...